4GU2A

Crystal structure of ubiquitin from entamoeba histolytica to 1.35 angstrom
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
72
structure length
68
Chain Sequence
b'MQIFVKKTITLEVEPNDSIDAIKAKIQEKEGIPPDQQRLIFAGKQLEEGKTLSDYNIQKESTLHLVLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Structural Determinants of Ubiquitin Conjugation in Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Protein binding
total genus 21
structure length 68
sequence length 72
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gu2A00
2V3SA 5D94A 2MRPA 4ZRJA 4NY0A 2GBRA 2CU1A 1VD2A 3T8MA 2BF8B 1GC6A 4J6IA 5AZGA 3VUWA 3DVNV 1WXMA 4IW0A 1E7VA 2GOWA 4K7UA 2MBEA 3V60A 1YX5B 3VTUA 3QJZA 1RFAA 3GOEA 3VXWA 3PGEA 4KVGB 3EFUA 2PE9A 3S2AA 3TL5A 3JVZX 2BYFA 2K8HA 2LASA 3VTWA 3VUXA 4DHZE 1E8YA 4BVUC 4JLCA 4FJYA 1ZGUB 2OJRA 4EEWA 4IG7B 1I35A 4MEMA 3ZVVA 4K7SA 2KQSA 1FXTB 2MP2B 2MQJA 4NPNA 5G55A 2K39A 4GDLA 3TBLD 3HK0A 2L7RA 3ZRFA 2KXJA 2IO2B 5D2MB 1WE6A 4HLEA 1GUAB 4DHJB 3N32A 1OTRB 4TUUA 1GJZA 4GOCA 1X1MA 3PLVA 2KVRA 2M4NA 2MW5A 2K1FA 3GZNI 4RMAA 4GN1A 3ZIMA 1WE7A 2Z0EB 2KTRA 2KANA 4LDTB 4ANWA 3KH0A 3VFKA 3PS6A 3MJWA 5J18A 3K9PB 4NJ6A 2LVQA 2IO0B 2UWQA 3A1QA 3HM6X 3PRZA 4RM9A 3JSVB 3M63B 4FBJB 5HKHA 3I3TB 5L95C 4K1RB 3A9KA 4AJYB 2BKRB 2G4SA 3ZNHB 3X0WA 2LVPA 2HTHA 2M8SA 3H7PA 3PSEB 1IYFA 4AUQC 4DXAB 2FCNA 1YJ1A 4GDKB 4A3PA 4LCDE 2FNJB 3H6NA 2ZVOA 4G11A 5J17A 5KHQA 2J0JA 3A4SC 5CHWA 4ASWC 1V80A 3L0WB 3DBSA 5DCNA 1LFDA 1SIFA 4KDIC 4B95A 2BWFA 1UH6A 2R2OA 1LXDA 2BGFA 2JRHA 3CMMB 3RCZA 3K9OB 4IM0A 4WJQA 4W9GA 3DVNU 1WJUA 2ZPYA 2ZVNA 3A9JA 4ZYNA 4ANXA 1L2NA 2O6VA 2N7EA 4W9KA 1K8RB 3BINA 4KSLC 2ZCCA 2I1JA 1V86A 4HJKA 2AEHA 4KDLB 4WJNA 1WGDA 3W1YA 3IHPC 2FIFA 4EFOA 4PYZA 2C7MB 2GBMA 3CSTA 3ZKJC 4ZRKA 4G50A 3PZDA 3UGBB 3PV1A 1NDDA 5AZFA 1WM2A 3NHEB 4IUMB 2LI5A 4II3B 4KZ0A 2W9NA 1WF9A 3RYTA 2D11A 4BOZB 2D10A 1WH3A 1WGGA 3BY4B 4HK2A 4ICVA 5JHAA 2CR5A 1XD3B 4GDLB 4BBNF 2L8JA 5E6NA 2L05A 3ML8A 3UIPB 2KLGA 4M8MA 3RZFA 1SGHA 3LJ3A 4HPMB 3QWZB 5LLIA 4W9HA 1LQBA 2KDBA 4K81A 1YIWA 4NQKE 1WYWB 3ENEA 2REXA 1UELA 4X57B 3QAQA 2KTRB 1EF5A 2C7NB 1BT0A 3QCAA 4A20A 4GGQA 3LDZE 5L83A 3OJ4B 3CSFA 3PTFC 2KLCA 3M62B 4BOSC 1WMHA 2C5LC 4TV3A 4KSKC 3KUCB 2K25A 3AULA 3WAPA 2KNBA 1P9DU 3WALA 1C1YB 3ZNID 2GBJA 4HCNB 2EKEC 4II2B 5AEKB 2ZJDA 2KC1A 1EUVB 2JY6A 4HWIB 2YLMA 2K8BA 3EC8A 4AOFA 1UZXB 2CHZA 2DZKA 1RRBA 3C0RB 3H7PB 4XX5A 2K8CA 4BFRA 1WX9A 2AL6A 3DCGA 4CO7A 2GBNA 1P3QU 1WXAA 2MBHA 3A4RA 3ZNZB 1IPGA 1F9JA 1ZKHA 3APCA 2FAZA 2MBOA 1TZ1A 1OQYA 4JIOU 1WRDB 3KVFB 5DPSA 1WGRA 2IYDB 4MGYE 2NCNA 1GNUA 2AYOB 4NQLB 2GMIC 2N9XA 2I1KA 2RPQA 3EECA 4MJSA 3AU4A 4IC7B 3RD2A 4PS3A 4B9KA 3CF6E 3VTVA 1WZ3A 4KIKA 3MTNB 2CKHB 3DBHI 4WWPA 1I42A 3A9JB 2D07B 4HDOA 4I6NB 2JWZA 4MGKE 3UQBA 1EF1A 3T9LA 2C9WB 1J0GA 3Q3JA 4BKSD 1CMXB 3L17A 4GB9A 4F8CB 3RULA 4IWQA 1JRUA 4MGIE 1WZ0A 3HHMA 4M0WB 2KHWB 5D6JB 3VDZA 4RM8A 3VAWA 3UQAA 3IG3A 2KDFB 2LD9A 3UINB 2WWZA 2MCNB 1IP9A 1VCBA 5G2NA 2XK5B 2JXXA 3VHTC 1S3SG 2XEWA 4EZJA 2KFKB 2MX2A 4YL8A 1KM7A 1Q5WB 2V4LA 3SU8X 2HD5B 4E71A 1C3TA 1H8CA 1UGMA 3DVGX 4DDID 1V81A 3D32A 3KUDB 3UIOB 2KWCA 2C7HA 4M8NA 2L00B 4GSWA 1WM3A 4FADA 2WX1A 1OEYJ 4WJPA 4NAWA 4TQ0A 3B0AA 4JGHB 4HXDA 2JZZA 2JRIB 2LRUA 2FIDA 2DYOA 1ZW7A 2JUOA 1R4MI 2KMCA 3A33B 3QA8A 5E6OA 3V62A 2N9PC 2R2QA 2N9EB 4EZKA 4GXBA 1WXSA 2PPHA 2KJHB 5DPWA 1GG3A 3H1UA 1AARA 2M1MA 5LXHA 2NPTA 4DHJD 2LXAA 4FJVB 1H4RA 3WAOA 1TBEA 1V5TA 1QZEA 4BKGA 3NZUA 4E74A 3OAWA 3W1SC 3IBEA 2K6QA 4LDTD 3NY5A 2L76A 2FUHB 4ANVA 1XQQA 4FN2A 5DPRA 2ZNVC 1G6JA 1V5OA 4BKTA 1UBQA 2FCMA 3DOWA 5DPTA 2KJRA 2LXCA 4P7IA 2KN5A 3V6EB 4MJSB 3DDCB 3AU5A 2DYBA 3VUYA 2KX3A 1YD8U 4W9EA 3WAMA 1Z2MA 2BWES 2KC2A 3V61A 3R3MA 1P98A 3KYDD 1KOTA 4BBNC 4OVUA 4MH0E 3ZDTA 2KQ7A 4GMVA 4I6PA 3H7SA 1XT9B 2YVCA 4EZLA 2KX0A 3KUZA 1J19A 3PT2B 2PJHA 3R7QA 1WFYA 1Z5SB 2Z0DB 1TGZB 4FHJA 2LRWA 3ZNGC 2PEAA 1WGYA 2KDEB 3QIJA 2CHWA 2L3ZA 3U7DA 2BYEA 3ONSA 4MDKE 4MELA 4NJ7A 3A1QB 2J0KA 2DZMA 3IFWB 2WYQA 2N4FA 3JSVA 4WAAA 5D7GA 5JH5C 2LGYA 1R4NI 3R7RA 4WJOA 4CYEA 3W1SA 3R66C 1HE8A 4AJWA 2RR9A 3A9KB 2DAFA 3VH4B 2RGFA 2KD0A 2G45B 2KDIA 4TKNA 2DYMA 3UF8A 2NVUI 4NAWB 2L0FA 3SHQA 2WX0A 2GBKA 3RT3B 2JF5A 1P1AA 1V6EA 2MBQA 4GDKA 2BKFA 2IZVB 3KW5B 5GMVA 3TCAA 3L16A 4PS8A 5EDSA 4N9F4 2KZRA 1V2YA 2KJ6A 2NPTB 1YX6B 5KHOA 2PE6B 1T0YA 2KK8A 2KO3A 4TQ1A 2A4ZA 2KKCA 3PLUA 3HIZA 2LGDA 4W9DA 5CHFA 1NBFC 2EMTA 4W9JA 2IY0B 3ZDMC 3HM3A 2DAJA 2O6VB 4FJZA 3V6CB 4EUTA 4DWFA 3SD5A 1PQSA 3WANA 3U8ZA 3VQIA 1OEYA 2LUEA 1LM8B 1V49A 3NZSA 2ZCBA 3DPDA 4W9LA 1E8WA 2Y5BB 5IAAC 2IY1B 2N7DA 4DBGA 4IWOA 4GU2A 1WY8A 2NBUA 1YQBA 4FULA 2FCQA 1WX8A 3P2BA 4WQOB 4DDGD 5LXIB 3SDLC 2OOBB 2KWUB 3RUIB 1WIAA 2LGXA 2DX5B 5E6PA 2KWVB 3X23A 3ZLZA 3TMPB 3B1LX 3ALBA 4JQWC 3IVFA 3AXCA 1V9JA 3PHWB 3PPAA 4MSQB 1WGHA 1P0RA 2D2QA 3M3JA 2DHZA 3JYUA 4XC2A 4WWOA 2LJ5A 1KLVA 1KJTA 1U4AA 2G3QB 3L13A 4PS7A 4NNJB 3APFA 3L54A 2IO3B 2ZEQA 3L10B 3DVGY 5JHBA 2K6DB 4MSMB 1WMHB 2XBBC 2MBBB 4DHZB 4BKSA 3QHTA 4ZRIA 2O6VD 4HPLB 3DQVA 4W9FA 3ZTDA 1WR6E 1Q0WB 2BYVE 3PRMB 4KZCA 3TJPA 1S1QB 1Y8RC 4MGZE 3H9DA 3PVLA 4HDQA 3ZO5B 2JPHA 1E7UA 4ICUA 5C23A 3O65B 2ZNVB 2O2VA 2IO1B 3PREA 5J2RA 2JT4B 3AI5A 4IM2A 2MLBA 3TIXA 1SE9A 3L08A 4HVBA 2KOXA 2EMSA 4G0NB 2NS5A 3ZUNA 1ISNA 4WWNA 1J8CA 1UBIA 3KYCD 4GIVA 2HE7A 4W9IA 2AWTA 1WI0A 2WDTB 1NI2A 1WX7A 1WXVA 4LJOB 4K7WA 2RD0A 4FHKA 3N3KB 2KMAA 5BO4B 1MG8A 5C1ZA 2J7QB 1OGWA 3MHSD 3QC8B 2VRRB 4KIKB 5CHVC 1E5WA 4LJPB 3WA0A 3VVWB 2MP2A 2M17A 3B08A 2BPSA 3PHXB 3OLMD 2ZPNA 2RSUA 1UD7A 4XZ4A 5FR6A 5IA7A 2UYZB 4FLHA 4ZDVA 1D3ZA 2LZ6A 4A3OA 5CTRC 3NS8A 4DK5A 3APDA 2IBIB 4OVVA 3QX1A 2DZIA 1RLFA 2NBVB 3M95A 2MWSB 3JW0X 2J0MA 1EO6A 2KFJA 2LVOA 3NOBA 1TTNA 4IM3A 1A5RA 4I6LB 5TR5A 4FA6A 3ZW3A 1E90A 2G4DB 2B3AA 1GC7A 2JVCA 2V1YA 2CHXA 2JZ3B 3RZWC 1Q1OA 3QQ8B 2XK5A 4PYUA 4EOYA 2M0XA 1E8ZA 2KFKA 3PRPB 1RAXA 1E8XA 3Q3FA 3QK0A 4F7ZA 2FCSA 3ZRCA 4URKA 5CX3A 3U30A 4KV2A 2ASQA 2N1VA 2N1WA 2Z59B 3DBLI 3ZTCA 4E3CA 1L7YA 4B6WA 1WJ6A 2HJ8A 4CHKA 1WR1A 4EKUA 4HCPB 5JZEB 2MSED 2ZZPB 4AP4C 2NR2A 2LWPA 2MA9B 3ECIA 2QHOA 3OJ3A 3EHVA 1WJNA 4G3XB 3ML9A 4AWJA 5AZHA 2DENB 2D3GA 3VH3B 4ANUA 4F1SA 3QARA 3WIMA 2DZJA 2CS4A 3DBRI 1WJ4A 2A5UA 1M94A 4IWPA 2KTFA 4W9CA 2C60A 3N30A 4MM3A 2AL3A 4JL9A 2L0TA 2O2VB 2NBWB
chains in the Genus database with same CATH superfamily
3NZ3A 4ZRJA 4NY0A 2GBRA 4DQOC 3T8MA 1QOGA 4K3CA 1GC6A 4J6IA 1K53A 3DVNV 2IGHA 3LB8C 3QJZA 1FPYA 3VUXA 2K8HA 1E8YA 2OJRA 3AM9A 4EEWA 4MEMA 1XCTL 5G55A 4GDLA 5GXGB 5BYQA 2IJ0A 3FC4A 2KXJA 4DHJB 3N32A 1C4AA 1X1MA 3PLVA 2KVRA 1EM7A 2M4NA 3GZNI 2LEKA 1WE7A 2KTRA 2BYTA 3CIRB 4OZCA 1ET6A 2V4IB 4ZHPA 3KQ4A 3MJWA 2LVQA 2IO0B 2INNE 3L4PA 1I7HA 2L32A 4K1RB 1NYRA 1V97A 2BQQA 1JWAD 1MG4A 3NVZA 3RFZB 2M8SA 4DXAB 4A8XC 4LCDE 3H6NA 1L0VB 4G11A 5CHWA 2JU6X 3Q8AA 1V80A 2MEKA 5DCNA 4XDDA 1JWMD 1CQVA 2L83A 2QEJC 1UH6A 2JRHA 3K9OB 1EWCA 2ZVNA 2N7EA 3BINA 2I1JA 1V86A 4KDLB 2AEHA 1WGDA 4RGOS 4OVZA 3IHPC 4M0WA 4ZRKA 3PZDA 4ZYSA 3PV1A 4IUMB 2LI5A 4II3B 1WF9A 1WH3A 4HK2A 4C80A 4GDLB 2L8JA 2R61A 2KLGA 3RZFA 3ZJUA 3LJ3A 5LLIA 2FUG1 4W9HA 3ENEA 2REXA 1XEEA 3NUHB 2LHEA 2KTRB 1WGKA 1EF5A 4GGQA 1SE4A 2WU5B 3OJ4B 3CSFA 1PDXA 2V3PA 2JQRB 3GS2A 3URYA 1WYGA 3WALA 3AULA 3WAPA 2KNBA 1P9DU 1C1YB 3ZNID 5AEKB 1EUVB 2YLMA 4US8A 1ZE3D 1JW9D 1RRBA 3MC8A 2K8CA 1PGBA 3ZNZB 1JQ4A 1WXQA 1E0ZA 4HKQA 1Y56A 4JIOU 3KVFB 1MI0A 2AYOB 2GMIC 2RPQA 3ZXRA 3BK1A 1C9FA 4B9KA 3CF6E 4KIKA 1FEHA 3DBHI 4LNIA 2D07B 4HDOA 5EE3A 2C9WB 3NS1A 1CMXB 1IUEA 4C7YA 3KLSX 4IWQA 3RULA 1QF6A 4MGIE 2VH2A 4M0WB 2KHWB 2JYEA 2KDFB 3UINB 1FD6A 1IGCA 2E6XA 2HTME 1S3SG 4IKGA 1KM7A 1C3TA 4DDID 3KUDB 4GSWA 2WX1A 3U7ZA 3B0AA 4RF1A 2WP9B 4EZKA 2N9EB 1NEKB 2JYTA 4A6QA 1GG3A 1MHXA 5H8YE 4FJVB 1H4RA 3R8BA 4YTMB 3AEAB 3NZUA 1MVKA 3NY5A 3HVZA 1XQQA 5DPRA 1V5OA 4BKTA 3Q8EA 4YSZB 5DPTA 3N20C 4P7IA 2KN5A 4Q2JA 1RWSA 1TKYA 1ZP0B 2XN9C 3BZDB 1JRPA 3WAMA 2BWES 4MT5A 2NMQA 1P98A 2KQ7A 4I6PA 2TSSA 5BMGA 3PT2B 2GLSA 3AEGB 1WFYA 1Z5SB 1R4MB 3QIJA 1MFWA 2ON8A 2CJOA 3ONSA 4MELA 4NJ7A 1C4PA 3JSVA 3MHZA 1PUTA 4KGTA 4NAMA 3DHIC 2G45B 3UF8A 1TJEA 1TZOA 3KW5B 5GMVA 5JXVA 1ZDVA 1I4QA 2L1AA 1I4XA 2PE6B 5IP4D 1YQ4B 2A4ZA 3PLUA 2LGDA 1L0YB 4W9JA 3W2DA 4D2KA 3HM3A 2O6VB 2V3NA 4EUTA 3Q3OC 3NZSA 4LTUA 2IY1B 3W5VB 1E7PB 4GU2A 2NBUA 1FRRA 1GB4A 1VDVA 4MH8A 4A55A 5HG2A 3DBLB 2LGXA 3CWIA 2DX5B 1XXGA 5E6PA 2KWVB 4J3OD 3X23A 3ZLZA 3ALBA 4JQWC 2LMCA 3PHWB 3PPAA 1DOXA 2D2QA 5C2TB 2WDRB 2WGSA 3Q6BA 3TEYA 2ZEQA 3BK2A 4BKSA 1C78A 3KWLA 2O6VD 4HPLB 1FCCC 4DXGA 1ZOYB 3ZO5B 1E7UA 3O65B 3RNGC 2JT4B 4IM2A 1VJKA 4RGNA 2SEBD 2X38A 3ETRA 3I9V1 1J8CA 1I4PA 2AWTA 2EKIA 1WXVA 4LJOB 5BO4B 2QJLA 1MG8A 3WCQA 3U52E 4GLSC 4WWMA 2BPSA 3OLMD 5IA7A 2RSUA 5IOIA 3GZNB 4ZDVA 5CTRC 2I38A 3NS8A 5G5HA 3SEBA 2IBIB 2DBYA 3M95A 3NOBA 3ZXVA 4FA6A 3AMZA 2CHXA 4XWWA 1Q1OA 3Q2AC 2KFKA 3PRPB 1E8XA 2FCSA 3ZRCA 5FK9C 2BB6A 3U30A 4KV2A 2Z59B 2INDC 3ZTCA 1L7YA 5BMIA 4N59A 1HQRD 5HHDG 4UDUC 1C4CA 5JZEB 4AP4C 4M00A 2M0AA 3EHVA 1D4BA 3B9JA 2CS4A 2B76B 4W9CA 3TSSA 2KTFA 3N30A 2AL3A 2L0TA 4XYCA 2NBWB 1YN5A 2CU1A 1E6EB 3VUWA 1E7VA 1RFKA 2MBEA 2WXRA 3VTUA 1FCLA 1BXTA 3TL5A 3NVYA 2BYFA 4IG7B 3TEWA 3ZVVA 1VLBA 3HK0A 3ZJTA 3RNCC 1WSPA 1WE6A 2MW5A 3ZIMA 3N9YC 4GN1A 3RI7C 1K50A 4LDTB 3SFEB 3KH0A 1FO4A 3PS6A 2MJDA 3RNAC 3HM6X 3A1QA 3PRZA 4RGTA 4FBJB 5HKHA 2V0GA 2D3BA 3I3TB 3A9KA 4AJYB 3ZNHB 3SFDB 3H7PA 3PSEB 2WS3B 4B0MA 2VZKD 2FNJB 1FXIA 2J0JA 2ICIA 1LFDA 1HZ5A 5IO9A 3FILA 4C4VA 3H8HA 4L23A 2R2OA 2BGFA 1ACCA 3CMMB 4W9GA 1WJUA 2ZPYA 1KLUD 5D3DA 3SR6A 2WXFA 4W9KA 4S17A 2WXOA 2GBMA 4LNFA 4G50A 4YTPB 1NDDA 1WM2A 4KZ0A 4TSSA 2D11A 2D10A 2W82A 2E3TA 2CR5A 1XD3B 4BBNF 5E6NA 2INPE 2FBWB 3QWZB 1QOFA 4K81A 2KDBA 1YIWA 4TMAB 1ZXHA 2N0SB 4A20A 1VRAB 2KLCA 1STEA 3M62B 2C5LC 2OEDA 4KSKC 3I57A 2KDMA 4HWIB 4RFBA 1XLNA 1UZXB 2CHZA 3C0RB 3H7PB 1WX9A 4CO7A 2MBHA 1WXAA 2RDBC 1UWMA 5C3JB 2FAZA 1BMLC 1ROEA 2BB5A 1J7AA 1WRDB 1L4DB 1N60A 1WGRA 2IYDB 4XDCA 4MGYE 1GNUA 4NQLB 3RD2A 4IC7B 4PS3A 3FILB 4C4VB 1ZPSA 3VTVA 1XLPA 4NJCA 3HUIA 5H92C 1TYGB 5HFYA 4WWPA 1I42A 3AH7A 4I6NB 3UQBA 1EF1A 3T9LA 3BIID 1ESFA 3Q3JA 1PYWD 4F8CB 3BYTB 3UQAA 5D6JB 3VDZA 3IG3A 3AE1B 2XK5B 3VHTC 2XEWA 2LJIA 4EZJA 2MX2A 2HD5B 1H8CA 4CQNA 1JALA 3D32A 2K22A 3ZJVA 4ZOHC 2MHJA 1SBBB 4LNOA 1MJDA 4FADA 1OEYJ 4WJPA 4NAWA 2VH1A 4HXDA 2YEPB 2JZZA 2LRUA 3A33B 2FIDA 5E6OA 2KMCA 3V62A 4GXBA 1WXSA 2PPHA 2D3CA 2KJHB 5DPWA 4US9A 3H1UA 1AARA 1RYJA 2NPTA 4DHJD 4JE3B 1BUIC 1DOYA 4OHJA 4BKGA 1QZEA 4E74A 3W1SC 2KAJA 2FUHB 4KKIA 2GRIA 2ZNVC 1NENB 2KJRA 4XE0A 3DDCB 4WQMA 3NVWA 3VUYA 2YEPF 1SF0A 4W9EA 3V61A 3KYDD 2PMVA 2BW2A 4M02A 1YN3A 1FNWA 2JZPA 1F2RI 2WDVB 4HPPA 1ZXIA 2PJHA 1ET9A 2Y3AA 4FHJA 4YTNB 2PEAA 1WGYA 1TS4A 2BS4B 2BBCA 1N63A 2BYEA 4MDKE 3BVZA 4YSYB 1KH0A 2DZMA 4S0RA 2WYQA 2N4FA 4WAAA 5JH5C 1SE3A 1R4NI 2LGYA 1I4HA 4CYEA 3W1SA 1K51A 2QMTA 1T5XD 2DYMA 4WURA 3MC9A 4NAWB 5G5GA 3GE3C 1VR9A 2MBQA 4GDKA 2IZVB 1B9RA 4PS8A 2M56B 1FM0D 5EE0A 2KJ6A 2NPTB 1YX6B 3Q8FA 1T0YA 2WXHA 3DHHC 3HIZA 1NBFC 2EMTA 4OZBA 1PQSA 4XWTA 3U8ZA 1RM6C 3MJ5A 1OEYA 2KVZA 2LUEA 4JWSC 2ZCBA 3DPDA 2N7DA 5IKCM 1YQBA 4FULA 2FCQA 1TT5B 1A70A 2BTEA 2OOBB 2KWUB 3RUIB 1WIAA 3TMPB 1V1OA 3B1LX 2WXNA 3C8YA 4KKJA 3AXCA 1V9JA 1GPXA 2RDGA 2N9LA 2DHZA 4XC2A 3BVMA 4WWOA 2LJ5A 1L5PA 2JX5A 3L13A 3AE2B 2IO3B 1ZDXA 3L10B 5JHBA 2K6DB 4JX1C 3MP9A 3ZTDA 4WH4A 1YOVB 2KWDA 1Q0WB 2K0PA 1S1QB 4HDQA 2ZNVB 3AEEB 3L08A 3EUB2 4GIVA 5BYRA 1WI0A 4K7WA 4LK0M 3QC8B 3NJTA 2VRRB 3NRZA 4KIKB 5CHVC 4P1BC 2HJ1A 4LJPB 5AUKA 3B08A 1LO5D 1D3ZA 4A3OA 2WXKA 3APDA 3RNFC 2DZIA 2WXIA 2NBVB 2MWSB 1B1ZA 1JROA 5TR5A 1E90A 4P6VF 2JVCA 2I2YA 1M4VA 2Y5CA 4PYUA 1SJHD 1AW7A 3Q3FA 2WXJA 5CX3A 3IXSA 1UUPA 2N1WA 4E3CA 1P7FA 2X8XX 3P4QB 4HEA1 4B6WA 4WAFA 1WJ6A 1KTKA 1FFVA 3IAM1 4EKUA 3T3OA 1SXTA 2ZZPB 2LWPA 4ZRPA 2QHOA 3OJ3A 1D6EC 1AYFA 2W3SA 4G3XB 5AZHA 4ARCA 4ZRQA 2D3GA 3VH3B 1HXYD 1WJ4A 4OW0A 1M94A 2C60A 4MM3A 4JL9A 2V3SA 5D94A 1T6BX 1PGXA 1WRIA 2AQ3B 2BF8B 1WXMA 2GOWA 4K7UA 3AECB 3BWUD 3V60A 1YX5B 3GOEA 3AEDB 4KVGB 3EFUA 1SJED 2PE9A 2RPVA 3JVZX 2RDHA 1L4ZB 4JLCA 2Y5PA 4K7SA 2KQSA 1FXTB 2K39A 3TBLD 2L7RA 1F2RC 3VR8B 3DHGC 2KMMA 2LGSA 5D2MB 4HLEA 1GJZA 4TUUA 4GOCA 2W3RA 2K1FA 1YJJA 3NG0A 4EE2A 3E56A 3K9PB 4NJ6A 3AE5B 4RM9A 3JSVB 3M63B 3GE8C 1MHHE 3X0WA 2H89B 1IYFA 1N61A 4AQ7A 4A3PA 2PW9A 1J7CA 2J42A 1WWTA 1UWXA 5MPOA 4HROA 1KFYB 3DBSA 3P42A 2PTLA 4KDIC 4B95A 2BWFA 4MM3B 1LXDA 2QC8A 4IM0A 2QSDA 4WJQA 3DVNU 2XNAC 4ZYNA 3A9JA 2KQ4X 3U4EG 2W54A 1K8RB 4KSLC 4PK1A 4H2AA 1TS5A 3W5UB 3ZKJC 3RNBC 5AZFA 3NHEB 3ZGZA 2MJ3A 2W9NA 3RYTA 2QDFA 5JHAA 3BYYB 1JWUD 3MC0B 1UELA 3QAQA 1BT0A 2GB1A 3PTFC 4DXFA 1J7BA 1QLBB 4BOSC 1WMHA 5BMHA 2K25A 4II2B 2KC1A 2JY6A 1SSNA 3EC8A 1T0QC 4AOFA 2DZKA 1C79A 1JCKB 4BFRA 1FNVA 2AL6A 3DCGA 5EE9A 3A4RA 3R2IA 2NTTA 1D5ZC 2MBOA 1TS3A 1UF0A 1TZ1A 3RN9C 1OQYA 3C19A 3VR9B 4RH6A 4A90A 2N9XA 2I1KA 4LLGM 3AU4A 2D5GA 1WZ3A 4A9AA 3MTNB 2CKHB 1HTOA 3A9JB 2NTSA 3W9CB 2JWZA 1J0GA 4BKSD 1YN4A 4BAXA 1WZ0A 5AUIA 4RM8A 2LD9A 2WWZA 3J9CA 1VCBA 2KFKB 2BS2B 4YL8A 1Q5WB 2V4LA 4E71A 3DVGX 2WU2B 2KWCA 4NZLB 2L00B 3I63C 1E9MA 2MJEA 4TQ0A 1QKZA 4JGHB 2JRIB 3IT6B 2JUOA 4N58A 1R4MI 1T0SC 2KT7A 2LUMA 2WLBA 3DBHB 1K52A 2JWUA 2MH7A 2LXAA 1JMLA 3U2SC 1TBEA 1V5TA 3OAWA 5BYSA 3IBEA 3GB1A 4LDTD 2L76A 2N9KA 1OQQA 4ANVA 1UBQA 2FCMA 1N5WA 4REZA 3V6EB 1XO3A 3AE3B 2DYBA 2KX3A 2OHFA 1KOTA 1FXAA 1GOZA 1Q10A 4RCOA 2CU3A 4OVUA 4MH0E 1TS2A 4GMVA 3H7SA 1XT9B 2YVCA 2KX0A 3KUZA 1J19A 3R7QA 1TGZB 3ZNGC 3N1ZC 2CHWA 1D5MC 5I4DA 3A1QB 2J0KA 4K3BA 2ONQA 4HRSA 4B0EA 4AJWA 3A9KB 2DAFA 1C76A 2KD0A 3GP7A 1ZUD2 2Z8LA 2NVUI 2L0FA 3SHQA 3RT3B 2AQ2B 2ACZB 2BKFA 2K5PA 3L16A 3Q3MC 3Q69A 5EDSA 3V05A 2KZRA 1V2YA 2INCC 3PO0A 5KHOA 2KK8A 2KO3A 4TQ1A 4W9DA 2KKCA 1FMAD 2QCZA 2IY0B 3ZDMC 4FJZA 3V6CB 4ZHOA 4WIPA 3RMKC 1LM8B 1V49A 4W9LA 2LGIA 1E8WA 3ZYYX 1YQ3B 1TIFA 4IWOA 1WY8A 1L0XB 3P2BA 4WQOB 5LXIB 3P4RB 3N1XC 1CZPA 3FKYA 2H88B 1KLVA 1KJTA 1U4AA 1DGJA 3APFA 3L54A 3DVGY 3OG5A 3E9SA 4MSMB 4DHZB 2XBBC 2MBBB 4ZRIA 3AEBB 1N62A 3RNEC 3DQVA 1WR6E 2AQ1B 2JSVX 2L52A 1Y8RC 3AE8B 4MGZE 3PVLA 4XGAB 2JPHA 3OWEB 2O2VA 2IO1B 3PREA 5J2RA 2MLBA 3EA6A 3TIXA 2PLPA 1UGJA 4HVBA 2EMSA 4G0NB 3ZUNA 1ISNA 4W9IA 2WDTB 4FHKA 3N3KB 2J7QB 1AN8A 1JWSD 2J53A 2PVGC 1KLGD 3WA0A 3VVWB 2MP2A 1EU3A 5FR6A 3PHXB 1UD7A 2UYZB 2LZ6A 1TKGA 5E6JA 3Q3NC 4OVVA 2WXPA 3QX1A 1RLFA 3EFCA 2J0MA 1EO6A 2KFJA 2LVOA 1TTNA 4IM3A 1A5RA 4I6LB 2G4DB 2B3AA 3MFGA 1GC7A 2KACA 1E8ZA 3TUOA 1RAXA 3QK0A 1TY2A 2ASQA 2N1VA 3AN1A 1T0RC 3BVGA 3T3NA 2IGGA 2HJ8A 1WR1A 1T3QA 4JPSA 1WJNA 3ML9A 4AWJA 5FKAC 4ANUA 3WIMA 2DZJA 2J4XA 3DBRI 3IT4B 2D3AA 1ZKHA 2QIEB 2O2VB 4YT0B 2MRPA 4YXDB 1DYQA 2Q5WD 1VD2A 5AZGA 4R3DA 4IW0A 1RFAA 3VXWA 3PGEA 3HRDD 3S2AA 1VZ8A 4LNNA 2LASA 3VTWA 4DHZE 4BVUC 4FJYA 1TY0A 1CJEA 1ZGUB 2PIAA 1I35A 4NPNA 2MP2B 2MQJA 1XF5L 5FR3A 2WXLA 3ZRFA 2G9HD 2IO2B 2KYWA 1GUAB 1OTRB 1EWYC 4RGMA 3Q14C 3AE4B 3PZ8A 4RMAA 2Z0EB 2AX5A 2KANA 4ANWA 1C77A 3VFKA 5J18A 1JWBD 2WXGA 2UWQA 1L6UA 2G1EA 5EE1A 5L95C 2BKRB 2G4SA 1IGDA 1QQRA 2LVPA 2HTHA 4AUQC 2FCNA 1YJ1A 4GDKB 4L1BA 1KRHA 2RMMA 2ZVOA 5J17A 2WXMA 1D5XC 5KHQA 2OJWA 3A4SC 3I5JC 4ASWC 3L0WB 4P16A 4USAA 1SIFA 1YJIA 3RCZA 1HEZE 1XCQL 4ANXA 1YNTE 1L2NA 2O6VA 2JXTA 2WDQB 3UI3A 1IBXA 2BS3B 2ZCCA 4HJKA 4WJNA 3W1YA 2FIFA 4EFOA 4PYZA 2C7MB 1SEBD 3CSTA 1R7SA 3UGBB 3Q8BA 2GI9A 1EU4A 2WHIA 4BOZB 4ICVA 1WGGA 3BY4B 1OFFA 2ZW1A 3DWMA 2L05A 3ML8A 3UIPB 4M8MA 1SGHA 4HPMB 1LQBA 3AEFB 4NQKE 1WYWB 2BT6A 4YWGG 4X57B 2C7NB 3QCAA 3LDZE 5L83A 2KN4A 4KGRA 4TV3A 1MPEA 2IPKD 4JWUC 3KUCB 2ZW0A 2GBJA 4HCNB 2EKEC 4BZAA 2ZJDA 1F1HA 2K8BA 4ARIA 1I4GA 4XX5A 2PKOA 2GBNA 1P3QU 3V3XA 1IPGA 1F9JA 3APCA 4RF0A 4C7ZA 4YSXB 4ITKA 5DPSA 4HJGE 2NCNA 1ENFA 4MJSA 3EECA 1SE2A 3DWGC 1XLOA 1NVID 4MGKE 3AB5A 3ABVB 1IBXB 1F77A 1N6ZA 3L17A 4GB9A 1JRUA 3HHMA 1V1PA 4FXCA 3VAWA 1VZ6A 3N1YC 3TEXA 2MCNB 1IP9A 1HZ6A 1HTQA 5G2NA 4RNAA 2JXXA 3FAHA 3SU8X 1UGMA 1V81A 2SAKA 2K9XA 3UIOB 1AWDA 2WXQA 2C7HA 4M8NA 4C56C 3LYYA 2PVOD 1WM3A 3AE6B 2DYOA 1ZW7A 3QA8A 2N9PC 2R2QA 4M01A 3IAS1 2M1MA 5LXHA 4C00A 3WAOA 1E10A 1N5XA 5IN7A 2K6QA 3AV8A 1FIQA 4FN2A 1YMHE 1G6JA 3DOWA 4MACA 3ZQ4A 2LXCA 4MJSB 1QT9A 3AU5A 1YD8U 2V9HA 1LGRA 1QILA 2WNMA 1Z2MA 2KC2A 4IOIE 3R3MA 4BBNC 2CJNA 3ZDTA 3HVDA 1F52A 4EZLA 3RPFC 1PGAA 4L2YA 2Z0DB 1P7EA 2LRWA 2FE8A 1V1PB 2KDEB 2L3ZA 4HKZE 3U7DA 2DNFA 2WQYB 3IFWB 3P63A 5D7GA 3R7RA 4WJOA 2IGDA 3R66C 1HE8A 2RR9A 3VH4B 2RGFA 2KDIA 4TKNA 5T8IA 5TSSA 2WX0A 2GBKA 2JF5A 1P1AA 1V6EA 2J52A 5LNK1 3TCAA 2N7JA 1PFDA 4PT5A 4N9F4 1TKEA 4IDIA 1FFUA 2BVCA 5CHFA 1DOIA 2LFIA 2DAJA 1NYQA 3LXFA 4DWFA 3SD5A 3WANA 1SIJA 3VQIA 3R2TA 4OZAA 2Y5BB 5D3IB 5IAAC 5HI1A 4DBGA 3VRBB 1V8CA 1QOBA 4ACFA 1WX8A 1R4NB 2VZKB 4DDGD 3SDLC 1VZ7A 3Q8CA 2LHDA 4O1NA 3IVFA 3AE7B 4MSQB 3P1MA 1WGHA 2UU7A 1P0RA 3M3JA 3JYUA 4KGSA 1GB1A 2IDYA 4PS7A 2G3QB 1I4RA 4NNJB 3DBRB 1WMHB 3NVVA 3B2FA 3QHTA 3AE9B 4W9FA 1NI3A 3VRAB 2BYVE 3PRMB 4KZCA 3TJPA 1FNUA 3H9DA 4ICUA 5C23A 2DLBA 3TEZA 3AI5A 1SE9A 2KOXA 2NS5A 4KX6B 4WWNA 1UBIA 3KYCD 1KF6B 2HE7A 2DWQA 1NI2A 1WX7A 2RD0A 3EGRA 2KMAA 5C1ZA 1OGWA 3MHSD 2W55A 4LNKA 1E5WA 1HA5A 2M17A 3KWVA 4XZ4A 2ZPNA 3PZ7A 4FLHA 4N6EB 4DK5A 2M19A 3JW0X 1CK1A 2HDEA 3ZW3A 1UNSA 2K3UA 3RZWC 4AS1A 2V1YA 2JZ3B 4EOYA 3QQ8B 2XK5A 2M0XA 4QAYA 1GAQB 3P4PB 4F7ZA 4URKA 2EELA 3DBLI 1L6VA 1F0ZA 1SB3C 4CHKA 3P4SB 4HCPB 2MSED 2NR2A 2MA9B 3ECIA 3O13A 4P1CC 2DENB 1FRDA 1QOAA 3B2GA 4F1SA 3QARA 1OQRA 2A5UA 2QILA 4IWPA 1XLQA
chains in the Genus database with same CATH topology
2V3SA 5D94A 2MRPA 4ZRJA 4NY0A 2GBRA 2CU1A 1VD2A 3T8MA 2BF8B 1GC6A 4J6IA 5AZGA 3VUWA 3DVNV 1WXMA 4IW0A 1E7VA 2GOWA 4K7UA 2MBEA 3V60A 1YX5B 3VTUA 3QJZA 1RFAA 3GOEA 3VXWA 3PGEA 4KVGB 3EFUA 2PE9A 3S2AA 3TL5A 3JVZX 2BYFA 2K8HA 2LASA 3VTWA 3VUXA 4DHZE 1E8YA 4BVUC 4JLCA 4FJYA 1ZGUB 2OJRA 4EEWA 4IG7B 1I35A 4MEMA 3ZVVA 4K7SA 2KQSA 1FXTB 2MP2B 2MQJA 4NPNA 5G55A 2K39A 4GDLA 3TBLD 3HK0A 2L7RA 3ZRFA 2KXJA 2IO2B 5D2MB 1WE6A 4HLEA 1GUAB 4DHJB 3N32A 1OTRB 4TUUA 1GJZA 4GOCA 1X1MA 3PLVA 2KVRA 2M4NA 2MW5A 2K1FA 3GZNI 4RMAA 4GN1A 3ZIMA 1WE7A 2Z0EB 2KTRA 2KANA 4LDTB 4ANWA 3KH0A 3VFKA 3PS6A 3MJWA 5J18A 3K9PB 4NJ6A 2LVQA 2IO0B 2UWQA 3A1QA 3HM6X 3PRZA 4RM9A 3JSVB 3M63B 4FBJB 5HKHA 3I3TB 5L95C 4K1RB 3A9KA 4AJYB 2BKRB 2G4SA 3ZNHB 3X0WA 2LVPA 2HTHA 2M8SA 3H7PA 3PSEB 1IYFA 4AUQC 4DXAB 2FCNA 1YJ1A 4GDKB 4A3PA 4LCDE 2FNJB 3H6NA 2ZVOA 4G11A 5J17A 5KHQA 2J0JA 3A4SC 5CHWA 4ASWC 1V80A 3L0WB 3DBSA 5DCNA 1LFDA 1SIFA 4KDIC 4B95A 2BWFA 1UH6A 2R2OA 1LXDA 2BGFA 2JRHA 3CMMB 3RCZA 3K9OB 4IM0A 4WJQA 4W9GA 3DVNU 1WJUA 2ZPYA 2ZVNA 3A9JA 4ZYNA 4ANXA 1L2NA 2O6VA 2N7EA 4W9KA 1K8RB 3BINA 4KSLC 2ZCCA 2I1JA 1V86A 4HJKA 2AEHA 4KDLB 4WJNA 1WGDA 3W1YA 3IHPC 2FIFA 4EFOA 4PYZA 2C7MB 2GBMA 3CSTA 3ZKJC 4ZRKA 4G50A 3PZDA 3UGBB 3PV1A 1NDDA 5AZFA 1WM2A 3NHEB 4IUMB 2LI5A 4II3B 4KZ0A 2W9NA 1WF9A 3RYTA 2D11A 4BOZB 2D10A 1WH3A 1WGGA 3BY4B 4HK2A 4ICVA 5JHAA 2CR5A 1XD3B 4GDLB 4BBNF 2L8JA 5E6NA 2L05A 3ML8A 3UIPB 2KLGA 4M8MA 3RZFA 1SGHA 3LJ3A 4HPMB 3QWZB 5LLIA 4W9HA 1LQBA 2KDBA 4K81A 1YIWA 4NQKE 1WYWB 3ENEA 2REXA 1UELA 4X57B 3QAQA 2KTRB 1EF5A 2C7NB 1BT0A 3QCAA 4A20A 4GGQA 3LDZE 5L83A 3OJ4B 3CSFA 3PTFC 2KLCA 3M62B 4BOSC 1WMHA 2C5LC 4TV3A 4KSKC 3KUCB 2K25A 3AULA 3WAPA 2KNBA 1P9DU 3WALA 1C1YB 3ZNID 2GBJA 4HCNB 2EKEC 4II2B 5AEKB 2ZJDA 2KC1A 1EUVB 2JY6A 4HWIB 2YLMA 2K8BA 3EC8A 4AOFA 1UZXB 2CHZA 2DZKA 1RRBA 3C0RB 3H7PB 4XX5A 2K8CA 4BFRA 1WX9A 2AL6A 3DCGA 4CO7A 2GBNA 1P3QU 1WXAA 2MBHA 3A4RA 3ZNZB 1IPGA 1F9JA 1ZKHA 3APCA 2FAZA 2MBOA 1TZ1A 1OQYA 4JIOU 1WRDB 3KVFB 5DPSA 1WGRA 2IYDB 4MGYE 2NCNA 1GNUA 2AYOB 4NQLB 2GMIC 2N9XA 2I1KA 2RPQA 3EECA 4MJSA 3AU4A 4IC7B 3RD2A 4PS3A 4B9KA 3CF6E 3VTVA 1WZ3A 4KIKA 3MTNB 2CKHB 3DBHI 4WWPA 1I42A 3A9JB 2D07B 4HDOA 4I6NB 2JWZA 4MGKE 3UQBA 1EF1A 3T9LA 2C9WB 1J0GA 3Q3JA 4BKSD 1CMXB 3L17A 4GB9A 4F8CB 3RULA 4IWQA 1JRUA 4MGIE 1WZ0A 3HHMA 4M0WB 2KHWB 5D6JB 3VDZA 4RM8A 3VAWA 3UQAA 3IG3A 2KDFB 2LD9A 3UINB 2WWZA 2MCNB 1IP9A 1VCBA 5G2NA 2XK5B 2JXXA 3VHTC 1S3SG 2XEWA 4EZJA 2KFKB 2MX2A 4YL8A 1KM7A 1Q5WB 2V4LA 3SU8X 2HD5B 4E71A 1C3TA 1H8CA 1UGMA 3DVGX 4DDID 1V81A 3D32A 3KUDB 3UIOB 2KWCA 2C7HA 4M8NA 2L00B 4GSWA 1WM3A 4FADA 2WX1A 1OEYJ 4WJPA 4NAWA 4TQ0A 3B0AA 4JGHB 4HXDA 2JZZA 2JRIB 2LRUA 2FIDA 2DYOA 1ZW7A 2JUOA 1R4MI 2KMCA 3A33B 3QA8A 5E6OA 3V62A 2N9PC 2R2QA 2N9EB 4EZKA 4GXBA 1WXSA 2PPHA 2KJHB 5DPWA 1GG3A 3H1UA 1AARA 2M1MA 5LXHA 2NPTA 4DHJD 2LXAA 4FJVB 1H4RA 3WAOA 1TBEA 1V5TA 1QZEA 4BKGA 3NZUA 4E74A 3OAWA 3W1SC 3IBEA 2K6QA 4LDTD 3NY5A 2L76A 2FUHB 4ANVA 1XQQA 4FN2A 5DPRA 2ZNVC 1G6JA 1V5OA 4BKTA 1UBQA 2FCMA 3DOWA 5DPTA 2KJRA 2LXCA 4P7IA 2KN5A 3V6EB 4MJSB 3DDCB 3AU5A 2DYBA 3VUYA 2KX3A 1YD8U 4W9EA 3WAMA 1Z2MA 2BWES 2KC2A 3V61A 3R3MA 1P98A 3KYDD 1KOTA 4BBNC 4OVUA 4MH0E 3ZDTA 2KQ7A 4GMVA 4I6PA 3H7SA 1XT9B 2YVCA 4EZLA 2KX0A 3KUZA 1J19A 3PT2B 2PJHA 3R7QA 1WFYA 1Z5SB 2Z0DB 1TGZB 4FHJA 2LRWA 3ZNGC 2PEAA 1WGYA 2KDEB 3QIJA 2CHWA 2L3ZA 3U7DA 2BYEA 3ONSA 4MDKE 4MELA 4NJ7A 3A1QB 2J0KA 2DZMA 3IFWB 2WYQA 2N4FA 3JSVA 4WAAA 5D7GA 5JH5C 2LGYA 1R4NI 3R7RA 4WJOA 4CYEA 3W1SA 3R66C 1HE8A 4AJWA 2RR9A 3A9KB 2DAFA 3VH4B 2RGFA 2KD0A 2G45B 2KDIA 4TKNA 2DYMA 3UF8A 2NVUI 4NAWB 2L0FA 3SHQA 2WX0A 2GBKA 3RT3B 2JF5A 1P1AA 1V6EA 2MBQA 4GDKA 2BKFA 2IZVB 3KW5B 5GMVA 3TCAA 3L16A 4PS8A 5EDSA 4N9F4 2KZRA 1V2YA 2KJ6A 2NPTB 1YX6B 5KHOA 2PE6B 1T0YA 2KK8A 2KO3A 4TQ1A 2A4ZA 2KKCA 3PLUA 3HIZA 2LGDA 4W9DA 5CHFA 1NBFC 2EMTA 4W9JA 2IY0B 3ZDMC 3HM3A 2DAJA 2O6VB 4FJZA 3V6CB 4EUTA 4DWFA 3SD5A 1PQSA 3WANA 3U8ZA 3VQIA 1OEYA 2LUEA 1LM8B 1V49A 3NZSA 2ZCBA 3DPDA 4W9LA 1E8WA 2Y5BB 5IAAC 2IY1B 2N7DA 4DBGA 4IWOA 4GU2A 1WY8A 2NBUA 1YQBA 4FULA 2FCQA 1WX8A 3P2BA 4WQOB 4DDGD 5LXIB 3SDLC 2OOBB 2KWUB 3RUIB 1WIAA 2LGXA 2DX5B 5E6PA 2KWVB 3X23A 3ZLZA 3TMPB 3B1LX 3ALBA 4JQWC 3IVFA 3AXCA 1V9JA 3PHWB 3PPAA 4MSQB 1WGHA 1P0RA 2D2QA 3M3JA 2DHZA 3JYUA 4XC2A 4WWOA 2LJ5A 1KLVA 1KJTA 1U4AA 2G3QB 3L13A 4PS7A 4NNJB 3APFA 3L54A 2IO3B 2ZEQA 3L10B 3DVGY 5JHBA 2K6DB 4MSMB 1WMHB 2XBBC 2MBBB 4DHZB 4BKSA 3QHTA 4ZRIA 2O6VD 4HPLB 3DQVA 4W9FA 3ZTDA 1WR6E 1Q0WB 2BYVE 3PRMB 4KZCA 3TJPA 1S1QB 1Y8RC 4MGZE 3H9DA 3PVLA 4HDQA 3ZO5B 2JPHA 1E7UA 4ICUA 5C23A 3O65B 2ZNVB 2O2VA 2IO1B 3PREA 5J2RA 2JT4B 3AI5A 4IM2A 2MLBA 3TIXA 1SE9A 3L08A 4HVBA 2KOXA 2EMSA 4G0NB 2NS5A 3ZUNA 1ISNA 4WWNA 1J8CA 1UBIA 3KYCD 4GIVA 2HE7A 4W9IA 2AWTA 1WI0A 2WDTB 1NI2A 1WX7A 1WXVA 4LJOB 4K7WA 2RD0A 4FHKA 3N3KB 2KMAA 5BO4B 1MG8A 5C1ZA 2J7QB 1OGWA 3MHSD 3QC8B 2VRRB 4KIKB 5CHVC 1E5WA 4LJPB 3WA0A 3VVWB 2MP2A 2M17A 3B08A 2BPSA 3PHXB 3OLMD 2ZPNA 2RSUA 1UD7A 4XZ4A 5FR6A 5IA7A 2UYZB 4FLHA 4ZDVA 1D3ZA 2LZ6A 4A3OA 5CTRC 3NS8A 4DK5A 3APDA 2IBIB 4OVVA 3QX1A 2DZIA 1RLFA 2NBVB 3M95A 2MWSB 3JW0X 2J0MA 1EO6A 2KFJA 2LVOA 3NOBA 1TTNA 4IM3A 1A5RA 4I6LB 5TR5A 4FA6A 3ZW3A 1E90A 2G4DB 2B3AA 1GC7A 2JVCA 2V1YA 2CHXA 2JZ3B 3RZWC 1Q1OA 3QQ8B 2XK5A 4PYUA 4EOYA 2M0XA 1E8ZA 2KFKA 3PRPB 1RAXA 1E8XA 3Q3FA 3QK0A 4F7ZA 2FCSA 3ZRCA 4URKA 5CX3A 3U30A 4KV2A 2ASQA 2N1VA 2N1WA 2Z59B 3DBLI 3ZTCA 4E3CA 1L7YA 4B6WA 1WJ6A 2HJ8A 4CHKA 1WR1A 4EKUA 4HCPB 5JZEB 2MSED 2ZZPB 4AP4C 2NR2A 2LWPA 2MA9B 3ECIA 2QHOA 3OJ3A 3EHVA 1WJNA 4G3XB 3ML9A 4AWJA 5AZHA 2DENB 2D3GA 3VH3B 4ANUA 4F1SA 3QARA 3WIMA 2DZJA 2CS4A 3DBRI 1WJ4A 2A5UA 1M94A 4IWPA 2KTFA 4W9CA 2C60A 3N30A 4MM3A 2AL3A 4JL9A 2L0TA 2O2VB 2NBWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V3S A;  5D94 A;  2MRP A;  4ZRJ A;  4NY0 A;  2GBR A;  2CU1 A;  1VD2 A;  3T8M A;  2BF8 B;  1GC6 A;  4J6I A;  5AZG A;  3VUW A;  3DVN V;  1WXM A;  4IW0 A;  1E7V A;  2GOW A;  4K7U A;  2MBE A;  3V60 A;  1YX5 B;  3VTU A;  3QJZ A;  1RFA A;  3GOE A;  3VXW A;  3PGE A;  4KVG B;  3EFU A;  2PE9 A;  3S2A A;  3TL5 A;  3JVZ X;  2BYF A;  2K8H A;  2LAS A;  3VTW A;  3VUX A;  4DHZ E;  1E8Y A;  4BVU C;  4JLC A;  4FJY A;  1ZGU B;  2OJR A;  4EEW A;  4IG7 B;  1I35 A;  4MEM A;  3ZVV A;  4K7S A;  2KQS A;  1FXT B;  2MP2 B;  2MQJ A;  4NPN A;  5G55 A;  2K39 A;  4GDL A;  3TBL D;  3HK0 A;  2L7R A;  3ZRF A;  2KXJ A;  2IO2 B;  5D2M B;  1WE6 A;  4HLE A;  1GUA B;  4DHJ B;  3N32 A;  1OTR B;  4TUU A;  1GJZ A;  4GOC A;  1X1M A;  3PLV A;  2KVR A;  2M4N A;  2MW5 A;  2K1F A;  3GZN I;  4RMA A;  4GN1 A;  3ZIM A;  1WE7 A;  2Z0E B;  2KTR A;  2KAN A;  4LDT B;  4ANW A;  3KH0 A;  3VFK A;  3PS6 A;  3MJW A;  5J18 A;  3K9P B;  4NJ6 A;  2LVQ A;  2IO0 B;  2UWQ A;  3A1Q A;  3HM6 X;  3PRZ A;  4RM9 A;  3JSV B;  3M63 B;  4FBJ B;  5HKH A;  3I3T B;  5L95 C;  4K1R B;  3A9K A;  4AJY B;  2BKR B;  2G4S A;  3ZNH B;  3X0W A;  2LVP A;  2HTH A;  2M8S A;  3H7P A;  3PSE B;  1IYF A;  4AUQ C;  4DXA B;  2FCN A;  1YJ1 A;  4GDK B;  4A3P A;  4LCD E;  2FNJ B;  3H6N A;  2ZVO A;  4G11 A;  5J17 A;  5KHQ A;  2J0J A;  3A4S C;  5CHW A;  4ASW C;  1V80 A;  3L0W B;  3DBS A;  5DCN A;  1LFD A;  1SIF A;  4KDI C;  4B95 A;  2BWF A;  1UH6 A;  2R2O A;  1LXD A;  2BGF A;  2JRH A;  3CMM B;  3RCZ A;  3K9O B;  4IM0 A;  4WJQ A;  4W9G A;  3DVN U;  1WJU A;  2ZPY A;  2ZVN A;  3A9J A;  4ZYN A;  4ANX A;  1L2N A;  2O6V A;  2N7E A;  4W9K A;  1K8R B;  3BIN A;  4KSL C;  2ZCC A;  2I1J A;  1V86 A;  4HJK A;  2AEH A;  4KDL B;  4WJN A;  1WGD A;  3W1Y A;  3IHP C;  2FIF A;  4EFO A;  4PYZ A;  2C7M B;  2GBM A;  3CST A;  3ZKJ C;  4ZRK A;  4G50 A;  3PZD A;  3UGB B;  3PV1 A;  1NDD A;  5AZF A;  1WM2 A;  3NHE B;  4IUM B;  2LI5 A;  4II3 B;  4KZ0 A;  2W9N A;  1WF9 A;  3RYT A;  2D11 A;  4BOZ B;  2D10 A;  1WH3 A;  1WGG A;  3BY4 B;  4HK2 A;  4ICV A;  5JHA A;  2CR5 A;  1XD3 B;  4GDL B;  4BBN F;  2L8J A;  5E6N A;  2L05 A;  3ML8 A;  3UIP B;  2KLG A;  4M8M A;  3RZF A;  1SGH A;  3LJ3 A;  4HPM B;  3QWZ B;  5LLI A;  4W9H A;  1LQB A;  2KDB A;  4K81 A;  1YIW A;  4NQK E;  1WYW B;  3ENE A;  2REX A;  1UEL A;  4X57 B;  3QAQ A;  2KTR B;  1EF5 A;  2C7N B;  1BT0 A;  3QCA A;  4A20 A;  4GGQ A;  3LDZ E;  5L83 A;  3OJ4 B;  3CSF A;  3PTF C;  2KLC A;  3M62 B;  4BOS C;  1WMH A;  2C5L C;  4TV3 A;  4KSK C;  3KUC B;  2K25 A;  3AUL A;  3WAP A;  2KNB A;  1P9D U;  3WAL A;  1C1Y B;  3ZNI D;  2GBJ A;  4HCN B;  2EKE C;  4II2 B;  5AEK B;  2ZJD A;  2KC1 A;  1EUV B;  2JY6 A;  4HWI B;  2YLM A;  2K8B A;  3EC8 A;  4AOF A;  1UZX B;  2CHZ A;  2DZK A;  1RRB A;  3C0R B;  3H7P B;  4XX5 A;  2K8C A;  4BFR A;  1WX9 A;  2AL6 A;  3DCG A;  4CO7 A;  2GBN A;  1P3Q U;  1WXA A;  2MBH A;  3A4R A;  3ZNZ B;  1IPG A;  1F9J A;  1ZKH A;  3APC A;  2FAZ A;  2MBO A;  1TZ1 A;  1OQY A;  4JIO U;  1WRD B;  3KVF B;  5DPS A;  1WGR A;  2IYD B;  4MGY E;  2NCN A;  1GNU A;  2AYO B;  4NQL B;  2GMI C;  2N9X A;  2I1K A;  2RPQ A;  3EEC A;  4MJS A;  3AU4 A;  4IC7 B;  3RD2 A;  4PS3 A;  4B9K A;  3CF6 E;  3VTV A;  1WZ3 A;  4KIK A;  3MTN B;  2CKH B;  3DBH I;  4WWP A;  1I42 A;  3A9J B;  2D07 B;  4HDO A;  4I6N B;  2JWZ A;  4MGK E;  3UQB A;  1EF1 A;  3T9L A;  2C9W B;  1J0G A;  3Q3J A;  4BKS D;  1CMX B;  3L17 A;  4GB9 A;  4F8C B;  3RUL A;  4IWQ A;  1JRU A;  4MGI E;  1WZ0 A;  3HHM A;  4M0W B;  2KHW B;  5D6J B;  3VDZ A;  4RM8 A;  3VAW A;  3UQA A;  3IG3 A;  2KDF B;  2LD9 A;  3UIN B;  2WWZ A;  2MCN B;  1IP9 A;  1VCB A;  5G2N A;  2XK5 B;  2JXX A;  3VHT C;  1S3S G;  2XEW A;  4EZJ A;  2KFK B;  2MX2 A;  4YL8 A;  1KM7 A;  1Q5W B;  2V4L A;  3SU8 X;  2HD5 B;  4E71 A;  1C3T A;  1H8C A;  1UGM A;  3DVG X;  4DDI D;  1V81 A;  3D32 A;  3KUD B;  3UIO B;  2KWC A;  2C7H A;  4M8N A;  2L00 B;  4GSW A;  1WM3 A;  4FAD A;  2WX1 A;  1OEY J;  4WJP A;  4NAW A;  4TQ0 A;  3B0A A;  4JGH B;  4HXD A;  2JZZ A;  2JRI B;  2LRU A;  2FID A;  2DYO A;  1ZW7 A;  2JUO A;  1R4M I;  2KMC A;  3A33 B;  3QA8 A;  5E6O A;  3V62 A;  2N9P C;  2R2Q A;  2N9E B;  4EZK A;  4GXB A;  1WXS A;  2PPH A;  2KJH B;  5DPW A;  1GG3 A;  3H1U A;  1AAR A;  2M1M A;  5LXH A;  2NPT A;  4DHJ D;  2LXA A;  4FJV B;  1H4R A;  3WAO A;  1TBE A;  1V5T A;  1QZE A;  4BKG A;  3NZU A;  4E74 A;  3OAW A;  3W1S C;  3IBE A;  2K6Q A;  4LDT D;  3NY5 A;  2L76 A;  2FUH B;  4ANV A;  1XQQ A;  4FN2 A;  5DPR A;  2ZNV C;  1G6J A;  1V5O A;  4BKT A;  1UBQ A;  2FCM A;  3DOW A;  5DPT A;  2KJR A;  2LXC A;  4P7I A;  2KN5 A;  3V6E B;  4MJS B;  3DDC B;  3AU5 A;  2DYB A;  3VUY A;  2KX3 A;  1YD8 U;  4W9E A;  3WAM A;  1Z2M A;  2BWE S;  2KC2 A;  3V61 A;  3R3M A;  1P98 A;  3KYD D;  1KOT A;  4BBN C;  4OVU A;  4MH0 E;  3ZDT A;  2KQ7 A;  4GMV A;  4I6P A;  3H7S A;  1XT9 B;  2YVC A;  4EZL A;  2KX0 A;  3KUZ A;  1J19 A;  3PT2 B;  2PJH A;  3R7Q A;  1WFY A;  1Z5S B;  2Z0D B;  1TGZ B;  4FHJ A;  2LRW A;  3ZNG C;  2PEA A;  1WGY A;  2KDE B;  3QIJ A;  2CHW A;  2L3Z A;  3U7D A;  2BYE A;  3ONS A;  4MDK E;  4MEL A;  4NJ7 A;  3A1Q B;  2J0K A;  2DZM A;  3IFW B;  2WYQ A;  2N4F A;  3JSV A;  4WAA A;  5D7G A;  5JH5 C;  2LGY A;  1R4N I;  3R7R A;  4WJO A;  4CYE A;  3W1S A;  3R66 C;  1HE8 A;  4AJW A;  2RR9 A;  3A9K B;  2DAF A;  3VH4 B;  2RGF A;  2KD0 A;  2G45 B;  2KDI A;  4TKN A;  2DYM A;  3UF8 A;  2NVU I;  4NAW B;  2L0F A;  3SHQ A;  2WX0 A;  2GBK A;  3RT3 B;  2JF5 A;  1P1A A;  1V6E A;  2MBQ A;  4GDK A;  2BKF A;  2IZV B;  3KW5 B;  5GMV A;  3TCA A;  3L16 A;  4PS8 A;  5EDS A;  4N9F 4;  2KZR A;  1V2Y A;  2KJ6 A;  2NPT B;  1YX6 B;  5KHO A;  2PE6 B;  1T0Y A;  2KK8 A;  2KO3 A;  4TQ1 A;  2A4Z A;  2KKC A;  3PLU A;  3HIZ A;  2LGD A;  4W9D A;  5CHF A;  1NBF C;  2EMT A;  4W9J A;  2IY0 B;  3ZDM C;  3HM3 A;  2DAJ A;  2O6V B;  4FJZ A;  3V6C B;  4EUT A;  4DWF A;  3SD5 A;  1PQS A;  3WAN A;  3U8Z A;  3VQI A;  1OEY A;  2LUE A;  1LM8 B;  1V49 A;  3NZS A;  2ZCB A;  3DPD A;  4W9L A;  1E8W A;  2Y5B B;  5IAA C;  2IY1 B;  2N7D A;  4DBG A;  4IWO A;  4GU2 A;  1WY8 A;  2NBU A;  1YQB A;  4FUL A;  2FCQ A;  1WX8 A;  3P2B A;  4WQO B;  4DDG D;  5LXI B;  3SDL C;  2OOB B;  2KWU B;  3RUI B;  1WIA A;  2LGX A;  2DX5 B;  5E6P A;  2KWV B;  3X23 A;  3ZLZ A;  3TMP B;  3B1L X;  3ALB A;  4JQW C;  3IVF A;  3AXC A;  1V9J A;  3PHW B;  3PPA A;  4MSQ B;  1WGH A;  1P0R A;  2D2Q A;  3M3J A;  2DHZ A;  3JYU A;  4XC2 A;  4WWO A;  2LJ5 A;  1KLV A;  1KJT A;  1U4A A;  2G3Q B;  3L13 A;  4PS7 A;  4NNJ B;  3APF A;  3L54 A;  2IO3 B;  2ZEQ A;  3L10 B;  3DVG Y;  5JHB A;  2K6D B;  4MSM B;  1WMH B;  2XBB C;  2MBB B;  4DHZ B;  4BKS A;  3QHT A;  4ZRI A;  2O6V D;  4HPL B;  3DQV A;  4W9F A;  3ZTD A;  1WR6 E;  1Q0W B;  2BYV E;  3PRM B;  4KZC A;  3TJP A;  1S1Q B;  1Y8R C;  4MGZ E;  3H9D A;  3PVL A;  4HDQ A;  3ZO5 B;  2JPH A;  1E7U A;  4ICU A;  5C23 A;  3O65 B;  2ZNV B;  2O2V A;  2IO1 B;  3PRE A;  5J2R A;  2JT4 B;  3AI5 A;  4IM2 A;  2MLB A;  3TIX A;  1SE9 A;  3L08 A;  4HVB A;  2KOX A;  2EMS A;  4G0N B;  2NS5 A;  3ZUN A;  1ISN A;  4WWN A;  1J8C A;  1UBI A;  3KYC D;  4GIV A;  2HE7 A;  4W9I A;  2AWT A;  1WI0 A;  2WDT B;  1NI2 A;  1WX7 A;  1WXV A;  4LJO B;  4K7W A;  2RD0 A;  4FHK A;  3N3K B;  2KMA A;  5BO4 B;  1MG8 A;  5C1Z A;  2J7Q B;  1OGW A;  3MHS D;  3QC8 B;  2VRR B;  4KIK B;  5CHV C;  1E5W A;  4LJP B;  3WA0 A;  3VVW B;  2MP2 A;  2M17 A;  3B08 A;  2BPS A;  3PHX B;  3OLM D;  2ZPN A;  2RSU A;  1UD7 A;  4XZ4 A;  5FR6 A;  5IA7 A;  2UYZ B;  4FLH A;  4ZDV A;  1D3Z A;  2LZ6 A;  4A3O A;  5CTR C;  3NS8 A;  4DK5 A;  3APD A;  2IBI B;  4OVV A;  3QX1 A;  2DZI A;  1RLF A;  2NBV B;  3M95 A;  2MWS B;  3JW0 X;  2J0M A;  1EO6 A;  2KFJ A;  2LVO A;  3NOB A;  1TTN A;  4IM3 A;  1A5R A;  4I6L B;  5TR5 A;  4FA6 A;  3ZW3 A;  1E90 A;  2G4D B;  2B3A A;  1GC7 A;  2JVC A;  2V1Y A;  2CHX A;  2JZ3 B;  3RZW C;  1Q1O A;  3QQ8 B;  2XK5 A;  4PYU A;  4EOY A;  2M0X A;  1E8Z A;  2KFK A;  3PRP B;  1RAX A;  1E8X A;  3Q3F A;  3QK0 A;  4F7Z A;  2FCS A;  3ZRC A;  4URK A;  5CX3 A;  3U30 A;  4KV2 A;  2ASQ A;  2N1V A;  2N1W A;  2Z59 B;  3DBL I;  3ZTC A;  4E3C A;  1L7Y A;  4B6W A;  1WJ6 A;  2HJ8 A;  4CHK A;  1WR1 A;  4EKU A;  4HCP B;  5JZE B;  2MSE D;  2ZZP B;  4AP4 C;  2NR2 A;  2LWP A;  2MA9 B;  3ECI A;  2QHO A;  3OJ3 A;  3EHV A;  1WJN A;  4G3X B;  3ML9 A;  4AWJ A;  5AZH A;  2DEN B;  2D3G A;  3VH3 B;  4ANU A;  4F1S A;  3QAR A;  3WIM A;  2DZJ A;  2CS4 A;  3DBR I;  1WJ4 A;  2A5U A;  1M94 A;  4IWP A;  2KTF A;  4W9C A;  2C60 A;  3N30 A;  4MM3 A;  2AL3 A;  4JL9 A;  2L0T A;  2O2V B;  2NBW B; 
#chains in the Genus database with same CATH topology
 3NZ3 A;  4ZRJ A;  4NY0 A;  2GBR A;  4DQO C;  3T8M A;  1QOG A;  4K3C A;  1GC6 A;  4J6I A;  1K53 A;  3DVN V;  2IGH A;  3LB8 C;  3QJZ A;  1FPY A;  3VUX A;  2K8H A;  1E8Y A;  2OJR A;  3AM9 A;  4EEW A;  4MEM A;  1XCT L;  5G55 A;  4GDL A;  5GXG B;  5BYQ A;  2IJ0 A;  3FC4 A;  2KXJ A;  4DHJ B;  3N32 A;  1C4A A;  1X1M A;  3PLV A;  2KVR A;  1EM7 A;  2M4N A;  3GZN I;  2LEK A;  1WE7 A;  2KTR A;  2BYT A;  3CIR B;  4OZC A;  1ET6 A;  2V4I B;  4ZHP A;  3KQ4 A;  3MJW A;  2LVQ A;  2IO0 B;  2INN E;  3L4P A;  1I7H A;  2L32 A;  4K1R B;  1NYR A;  1V97 A;  2BQQ A;  1JWA D;  1MG4 A;  3NVZ A;  3RFZ B;  2M8S A;  4DXA B;  4A8X C;  4LCD E;  3H6N A;  1L0V B;  4G11 A;  5CHW A;  2JU6 X;  3Q8A A;  1V80 A;  2MEK A;  5DCN A;  4XDD A;  1JWM D;  1CQV A;  2L83 A;  2QEJ C;  1UH6 A;  2JRH A;  3K9O B;  1EWC A;  2ZVN A;  2N7E A;  3BIN A;  2I1J A;  1V86 A;  4KDL B;  2AEH A;  1WGD A;  4RGO S;  4OVZ A;  3IHP C;  4M0W A;  4ZRK A;  3PZD A;  4ZYS A;  3PV1 A;  4IUM B;  2LI5 A;  4II3 B;  1WF9 A;  1WH3 A;  4HK2 A;  4C80 A;  4GDL B;  2L8J A;  2R61 A;  2KLG A;  3RZF A;  3ZJU A;  3LJ3 A;  5LLI A;  2FUG 1;  4W9H A;  3ENE A;  2REX A;  1XEE A;  3NUH B;  2LHE A;  2KTR B;  1WGK A;  1EF5 A;  4GGQ A;  1SE4 A;  2WU5 B;  3OJ4 B;  3CSF A;  1PDX A;  2V3P A;  2JQR B;  3GS2 A;  3URY A;  1WYG A;  3WAL A;  3AUL A;  3WAP A;  2KNB A;  1P9D U;  1C1Y B;  3ZNI D;  5AEK B;  1EUV B;  2YLM A;  4US8 A;  1ZE3 D;  1JW9 D;  1RRB A;  3MC8 A;  2K8C A;  1PGB A;  3ZNZ B;  1JQ4 A;  1WXQ A;  1E0Z A;  4HKQ A;  1Y56 A;  4JIO U;  3KVF B;  1MI0 A;  2AYO B;  2GMI C;  2RPQ A;  3ZXR A;  3BK1 A;  1C9F A;  4B9K A;  3CF6 E;  4KIK A;  1FEH A;  3DBH I;  4LNI A;  2D07 B;  4HDO A;  5EE3 A;  2C9W B;  3NS1 A;  1CMX B;  1IUE A;  4C7Y A;  3KLS X;  4IWQ A;  3RUL A;  1QF6 A;  4MGI E;  2VH2 A;  4M0W B;  2KHW B;  2JYE A;  2KDF B;  3UIN B;  1FD6 A;  1IGC A;  2E6X A;  2HTM E;  1S3S G;  4IKG A;  1KM7 A;  1C3T A;  4DDI D;  3KUD B;  4GSW A;  2WX1 A;  3U7Z A;  3B0A A;  4RF1 A;  2WP9 B;  4EZK A;  2N9E B;  1NEK B;  2JYT A;  4A6Q A;  1GG3 A;  1MHX A;  5H8Y E;  4FJV B;  1H4R A;  3R8B A;  4YTM B;  3AEA B;  3NZU A;  1MVK A;  3NY5 A;  3HVZ A;  1XQQ A;  5DPR A;  1V5O A;  4BKT A;  3Q8E A;  4YSZ B;  5DPT A;  3N20 C;  4P7I A;  2KN5 A;  4Q2J A;  1RWS A;  1TKY A;  1ZP0 B;  2XN9 C;  3BZD B;  1JRP A;  3WAM A;  2BWE S;  4MT5 A;  2NMQ A;  1P98 A;  2KQ7 A;  4I6P A;  2TSS A;  5BMG A;  3PT2 B;  2GLS A;  3AEG B;  1WFY A;  1Z5S B;  1R4M B;  3QIJ A;  1MFW A;  2ON8 A;  2CJO A;  3ONS A;  4MEL A;  4NJ7 A;  1C4P A;  3JSV A;  3MHZ A;  1PUT A;  4KGT A;  4NAM A;  3DHI C;  2G45 B;  3UF8 A;  1TJE A;  1TZO A;  3KW5 B;  5GMV A;  5JXV A;  1ZDV A;  1I4Q A;  2L1A A;  1I4X A;  2PE6 B;  5IP4 D;  1YQ4 B;  2A4Z A;  3PLU A;  2LGD A;  1L0Y B;  4W9J A;  3W2D A;  4D2K A;  3HM3 A;  2O6V B;  2V3N A;  4EUT A;  3Q3O C;  3NZS A;  4LTU A;  2IY1 B;  3W5V B;  1E7P B;  4GU2 A;  2NBU A;  1FRR A;  1GB4 A;  1VDV A;  4MH8 A;  4A55 A;  5HG2 A;  3DBL B;  2LGX A;  3CWI A;  2DX5 B;  1XXG A;  5E6P A;  2KWV B;  4J3O D;  3X23 A;  3ZLZ A;  3ALB A;  4JQW C;  2LMC A;  3PHW B;  3PPA A;  1DOX A;  2D2Q A;  5C2T B;  2WDR B;  2WGS A;  3Q6B A;  3TEY A;  2ZEQ A;  3BK2 A;  4BKS A;  1C78 A;  3KWL A;  2O6V D;  4HPL B;  1FCC C;  4DXG A;  1ZOY B;  3ZO5 B;  1E7U A;  3O65 B;  3RNG C;  2JT4 B;  4IM2 A;  1VJK A;  4RGN A;  2SEB D;  2X38 A;  3ETR A;  3I9V 1;  1J8C A;  1I4P A;  2AWT A;  2EKI A;  1WXV A;  4LJO B;  5BO4 B;  2QJL A;  1MG8 A;  3WCQ A;  3U52 E;  4GLS C;  4WWM A;  2BPS A;  3OLM D;  5IA7 A;  2RSU A;  5IOI A;  3GZN B;  4ZDV A;  5CTR C;  2I38 A;  3NS8 A;  5G5H A;  3SEB A;  2IBI B;  2DBY A;  3M95 A;  3NOB A;  3ZXV A;  4FA6 A;  3AMZ A;  2CHX A;  4XWW A;  1Q1O A;  3Q2A C;  2KFK A;  3PRP B;  1E8X A;  2FCS A;  3ZRC A;  5FK9 C;  2BB6 A;  3U30 A;  4KV2 A;  2Z59 B;  2IND C;  3ZTC A;  1L7Y A;  5BMI A;  4N59 A;  1HQR D;  5HHD G;  4UDU C;  1C4C A;  5JZE B;  4AP4 C;  4M00 A;  2M0A A;  3EHV A;  1D4B A;  3B9J A;  2CS4 A;  2B76 B;  4W9C A;  3TSS A;  2KTF A;  3N30 A;  2AL3 A;  2L0T A;  4XYC A;  2NBW B;  1YN5 A;  2CU1 A;  1E6E B;  3VUW A;  1E7V A;  1RFK A;  2MBE A;  2WXR A;  3VTU A;  1FCL A;  1BXT A;  3TL5 A;  3NVY A;  2BYF A;  4IG7 B;  3TEW A;  3ZVV A;  1VLB A;  3HK0 A;  3ZJT A;  3RNC C;  1WSP A;  1WE6 A;  2MW5 A;  3ZIM A;  3N9Y C;  4GN1 A;  3RI7 C;  1K50 A;  4LDT B;  3SFE B;  3KH0 A;  1FO4 A;  3PS6 A;  2MJD A;  3RNA C;  3HM6 X;  3A1Q A;  3PRZ A;  4RGT A;  4FBJ B;  5HKH A;  2V0G A;  2D3B A;  3I3T B;  3A9K A;  4AJY B;  3ZNH B;  3SFD B;  3H7P A;  3PSE B;  2WS3 B;  4B0M A;  2VZK D;  2FNJ B;  1FXI A;  2J0J A;  2ICI A;  1LFD A;  1HZ5 A;  5IO9 A;  3FIL A;  4C4V A;  3H8H A;  4L23 A;  2R2O A;  2BGF A;  1ACC A;  3CMM B;  4W9G A;  1WJU A;  2ZPY A;  1KLU D;  5D3D A;  3SR6 A;  2WXF A;  4W9K A;  4S17 A;  2WXO A;  2GBM A;  4LNF A;  4G50 A;  4YTP B;  1NDD A;  1WM2 A;  4KZ0 A;  4TSS A;  2D11 A;  2D10 A;  2W82 A;  2E3T A;  2CR5 A;  1XD3 B;  4BBN F;  5E6N A;  2INP E;  2FBW B;  3QWZ B;  1QOF A;  4K81 A;  2KDB A;  1YIW A;  4TMA B;  1ZXH A;  2N0S B;  4A20 A;  1VRA B;  2KLC A;  1STE A;  3M62 B;  2C5L C;  2OED A;  4KSK C;  3I57 A;  2KDM A;  4HWI B;  4RFB A;  1XLN A;  1UZX B;  2CHZ A;  3C0R B;  3H7P B;  1WX9 A;  4CO7 A;  2MBH A;  1WXA A;  2RDB C;  1UWM A;  5C3J B;  2FAZ A;  1BML C;  1ROE A;  2BB5 A;  1J7A A;  1WRD B;  1L4D B;  1N60 A;  1WGR A;  2IYD B;  4XDC A;  4MGY E;  1GNU A;  4NQL B;  3RD2 A;  4IC7 B;  4PS3 A;  3FIL B;  4C4V B;  1ZPS A;  3VTV A;  1XLP A;  4NJC A;  3HUI A;  5H92 C;  1TYG B;  5HFY A;  4WWP A;  1I42 A;  3AH7 A;  4I6N B;  3UQB A;  1EF1 A;  3T9L A;  3BII D;  1ESF A;  3Q3J A;  1PYW D;  4F8C B;  3BYT B;  3UQA A;  5D6J B;  3VDZ A;  3IG3 A;  3AE1 B;  2XK5 B;  3VHT C;  2XEW A;  2LJI A;  4EZJ A;  2MX2 A;  2HD5 B;  1H8C A;  4CQN A;  1JAL A;  3D32 A;  2K22 A;  3ZJV A;  4ZOH C;  2MHJ A;  1SBB B;  4LNO A;  1MJD A;  4FAD A;  1OEY J;  4WJP A;  4NAW A;  2VH1 A;  4HXD A;  2YEP B;  2JZZ A;  2LRU A;  3A33 B;  2FID A;  5E6O A;  2KMC A;  3V62 A;  4GXB A;  1WXS A;  2PPH A;  2D3C A;  2KJH B;  5DPW A;  4US9 A;  3H1U A;  1AAR A;  1RYJ A;  2NPT A;  4DHJ D;  4JE3 B;  1BUI C;  1DOY A;  4OHJ A;  4BKG A;  1QZE A;  4E74 A;  3W1S C;  2KAJ A;  2FUH B;  4KKI A;  2GRI A;  2ZNV C;  1NEN B;  2KJR A;  4XE0 A;  3DDC B;  4WQM A;  3NVW A;  3VUY A;  2YEP F;  1SF0 A;  4W9E A;  3V61 A;  3KYD D;  2PMV A;  2BW2 A;  4M02 A;  1YN3 A;  1FNW A;  2JZP A;  1F2R I;  2WDV B;  4HPP A;  1ZXI A;  2PJH A;  1ET9 A;  2Y3A A;  4FHJ A;  4YTN B;  2PEA A;  1WGY A;  1TS4 A;  2BS4 B;  2BBC A;  1N63 A;  2BYE A;  4MDK E;  3BVZ A;  4YSY B;  1KH0 A;  2DZM A;  4S0R A;  2WYQ A;  2N4F A;  4WAA A;  5JH5 C;  1SE3 A;  1R4N I;  2LGY A;  1I4H A;  4CYE A;  3W1S A;  1K51 A;  2QMT A;  1T5X D;  2DYM A;  4WUR A;  3MC9 A;  4NAW B;  5G5G A;  3GE3 C;  1VR9 A;  2MBQ A;  4GDK A;  2IZV B;  1B9R A;  4PS8 A;  2M56 B;  1FM0 D;  5EE0 A;  2KJ6 A;  2NPT B;  1YX6 B;  3Q8F A;  1T0Y A;  2WXH A;  3DHH C;  3HIZ A;  1NBF C;  2EMT A;  4OZB A;  1PQS A;  4XWT A;  3U8Z A;  1RM6 C;  3MJ5 A;  1OEY A;  2KVZ A;  2LUE A;  4JWS C;  2ZCB A;  3DPD A;  2N7D A;  5IKC M;  1YQB A;  4FUL A;  2FCQ A;  1TT5 B;  1A70 A;  2BTE A;  2OOB B;  2KWU B;  3RUI B;  1WIA A;  3TMP B;  1V1O A;  3B1L X;  2WXN A;  3C8Y A;  4KKJ A;  3AXC A;  1V9J A;  1GPX A;  2RDG A;  2N9L A;  2DHZ A;  4XC2 A;  3BVM A;  4WWO A;  2LJ5 A;  1L5P A;  2JX5 A;  3L13 A;  3AE2 B;  2IO3 B;  1ZDX A;  3L10 B;  5JHB A;  2K6D B;  4JX1 C;  3MP9 A;  3ZTD A;  4WH4 A;  1YOV B;  2KWD A;  1Q0W B;  2K0P A;  1S1Q B;  4HDQ A;  2ZNV B;  3AEE B;  3L08 A;  3EUB 2;  4GIV A;  5BYR A;  1WI0 A;  4K7W A;  4LK0 M;  3QC8 B;  3NJT A;  2VRR B;  3NRZ A;  4KIK B;  5CHV C;  4P1B C;  2HJ1 A;  4LJP B;  5AUK A;  3B08 A;  1LO5 D;  1D3Z A;  4A3O A;  2WXK A;  3APD A;  3RNF C;  2DZI A;  2WXI A;  2NBV B;  2MWS B;  1B1Z A;  1JRO A;  5TR5 A;  1E90 A;  4P6V F;  2JVC A;  2I2Y A;  1M4V A;  2Y5C A;  4PYU A;  1SJH D;  1AW7 A;  3Q3F A;  2WXJ A;  5CX3 A;  3IXS A;  1UUP A;  2N1W A;  4E3C A;  1P7F A;  2X8X X;  3P4Q B;  4HEA 1;  4B6W A;  4WAF A;  1WJ6 A;  1KTK A;  1FFV A;  3IAM 1;  4EKU A;  3T3O A;  1SXT A;  2ZZP B;  2LWP A;  4ZRP A;  2QHO A;  3OJ3 A;  1D6E C;  1AYF A;  2W3S A;  4G3X B;  5AZH A;  4ARC A;  4ZRQ A;  2D3G A;  3VH3 B;  1HXY D;  1WJ4 A;  4OW0 A;  1M94 A;  2C60 A;  4MM3 A;  4JL9 A;  2V3S A;  5D94 A;  1T6B X;  1PGX A;  1WRI A;  2AQ3 B;  2BF8 B;  1WXM A;  2GOW A;  4K7U A;  3AEC B;  3BWU D;  3V60 A;  1YX5 B;  3GOE A;  3AED B;  4KVG B;  3EFU A;  1SJE D;  2PE9 A;  2RPV A;  3JVZ X;  2RDH A;  1L4Z B;  4JLC A;  2Y5P A;  4K7S A;  2KQS A;  1FXT B;  2K39 A;  3TBL D;  2L7R A;  1F2R C;  3VR8 B;  3DHG C;  2KMM A;  2LGS A;  5D2M B;  4HLE A;  1GJZ A;  4TUU A;  4GOC A;  2W3R A;  2K1F A;  1YJJ A;  3NG0 A;  4EE2 A;  3E56 A;  3K9P B;  4NJ6 A;  3AE5 B;  4RM9 A;  3JSV B;  3M63 B;  3GE8 C;  1MHH E;  3X0W A;  2H89 B;  1IYF A;  1N61 A;  4AQ7 A;  4A3P A;  2PW9 A;  1J7C A;  2J42 A;  1WWT A;  1UWX A;  5MPO A;  4HRO A;  1KFY B;  3DBS A;  3P42 A;  2PTL A;  4KDI C;  4B95 A;  2BWF A;  4MM3 B;  1LXD A;  2QC8 A;  4IM0 A;  2QSD A;  4WJQ A;  3DVN U;  2XNA C;  4ZYN A;  3A9J A;  2KQ4 X;  3U4E G;  2W54 A;  1K8R B;  4KSL C;  4PK1 A;  4H2A A;  1TS5 A;  3W5U B;  3ZKJ C;  3RNB C;  5AZF A;  3NHE B;  3ZGZ A;  2MJ3 A;  2W9N A;  3RYT A;  2QDF A;  5JHA A;  3BYY B;  1JWU D;  3MC0 B;  1UEL A;  3QAQ A;  1BT0 A;  2GB1 A;  3PTF C;  4DXF A;  1J7B A;  1QLB B;  4BOS C;  1WMH A;  5BMH A;  2K25 A;  4II2 B;  2KC1 A;  2JY6 A;  1SSN A;  3EC8 A;  1T0Q C;  4AOF A;  2DZK A;  1C79 A;  1JCK B;  4BFR A;  1FNV A;  2AL6 A;  3DCG A;  5EE9 A;  3A4R A;  3R2I A;  2NTT A;  1D5Z C;  2MBO A;  1TS3 A;  1UF0 A;  1TZ1 A;  3RN9 C;  1OQY A;  3C19 A;  3VR9 B;  4RH6 A;  4A90 A;  2N9X A;  2I1K A;  4LLG M;  3AU4 A;  2D5G A;  1WZ3 A;  4A9A A;  3MTN B;  2CKH B;  1HTO A;  3A9J B;  2NTS A;  3W9C B;  2JWZ A;  1J0G A;  4BKS D;  1YN4 A;  4BAX A;  1WZ0 A;  5AUI A;  4RM8 A;  2LD9 A;  2WWZ A;  3J9C A;  1VCB A;  2KFK B;  2BS2 B;  4YL8 A;  1Q5W B;  2V4L A;  4E71 A;  3DVG X;  2WU2 B;  2KWC A;  4NZL B;  2L00 B;  3I63 C;  1E9M A;  2MJE A;  4TQ0 A;  1QKZ A;  4JGH B;  2JRI B;  3IT6 B;  2JUO A;  4N58 A;  1R4M I;  1T0S C;  2KT7 A;  2LUM A;  2WLB A;  3DBH B;  1K52 A;  2JWU A;  2MH7 A;  2LXA A;  1JML A;  3U2S C;  1TBE A;  1V5T A;  3OAW A;  5BYS A;  3IBE A;  3GB1 A;  4LDT D;  2L76 A;  2N9K A;  1OQQ A;  4ANV A;  1UBQ A;  2FCM A;  1N5W A;  4REZ A;  3V6E B;  1XO3 A;  3AE3 B;  2DYB A;  2KX3 A;  2OHF A;  1KOT A;  1FXA A;  1GOZ A;  1Q10 A;  4RCO A;  2CU3 A;  4OVU A;  4MH0 E;  1TS2 A;  4GMV A;  3H7S A;  1XT9 B;  2YVC A;  2KX0 A;  3KUZ A;  1J19 A;  3R7Q A;  1TGZ B;  3ZNG C;  3N1Z C;  2CHW A;  1D5M C;  5I4D A;  3A1Q B;  2J0K A;  4K3B A;  2ONQ A;  4HRS A;  4B0E A;  4AJW A;  3A9K B;  2DAF A;  1C76 A;  2KD0 A;  3GP7 A;  1ZUD 2;  2Z8L A;  2NVU I;  2L0F A;  3SHQ A;  3RT3 B;  2AQ2 B;  2ACZ B;  2BKF A;  2K5P A;  3L16 A;  3Q3M C;  3Q69 A;  5EDS A;  3V05 A;  2KZR A;  1V2Y A;  2INC C;  3PO0 A;  5KHO A;  2KK8 A;  2KO3 A;  4TQ1 A;  4W9D A;  2KKC A;  1FMA D;  2QCZ A;  2IY0 B;  3ZDM C;  4FJZ A;  3V6C B;  4ZHO A;  4WIP A;  3RMK C;  1LM8 B;  1V49 A;  4W9L A;  2LGI A;  1E8W A;  3ZYY X;  1YQ3 B;  1TIF A;  4IWO A;  1WY8 A;  1L0X B;  3P2B A;  4WQO B;  5LXI B;  3P4R B;  3N1X C;  1CZP A;  3FKY A;  2H88 B;  1KLV A;  1KJT A;  1U4A A;  1DGJ A;  3APF A;  3L54 A;  3DVG Y;  3OG5 A;  3E9S A;  4MSM B;  4DHZ B;  2XBB C;  2MBB B;  4ZRI A;  3AEB B;  1N62 A;  3RNE C;  3DQV A;  1WR6 E;  2AQ1 B;  2JSV X;  2L52 A;  1Y8R C;  3AE8 B;  4MGZ E;  3PVL A;  4XGA B;  2JPH A;  3OWE B;  2O2V A;  2IO1 B;  3PRE A;  5J2R A;  2MLB A;  3EA6 A;  3TIX A;  2PLP A;  1UGJ A;  4HVB A;  2EMS A;  4G0N B;  3ZUN A;  1ISN A;  4W9I A;  2WDT B;  4FHK A;  3N3K B;  2J7Q B;  1AN8 A;  1JWS D;  2J53 A;  2PVG C;  1KLG D;  3WA0 A;  3VVW B;  2MP2 A;  1EU3 A;  5FR6 A;  3PHX B;  1UD7 A;  2UYZ B;  2LZ6 A;  1TKG A;  5E6J A;  3Q3N C;  4OVV A;  2WXP A;  3QX1 A;  1RLF A;  3EFC A;  2J0M A;  1EO6 A;  2KFJ A;  2LVO A;  1TTN A;  4IM3 A;  1A5R A;  4I6L B;  2G4D B;  2B3A A;  3MFG A;  1GC7 A;  2KAC A;  1E8Z A;  3TUO A;  1RAX A;  3QK0 A;  1TY2 A;  2ASQ A;  2N1V A;  3AN1 A;  1T0R C;  3BVG A;  3T3N A;  2IGG A;  2HJ8 A;  1WR1 A;  1T3Q A;  4JPS A;  1WJN A;  3ML9 A;  4AWJ A;  5FKA C;  4ANU A;  3WIM A;  2DZJ A;  2J4X A;  3DBR I;  3IT4 B;  2D3A A;  1ZKH A;  2QIE B;  2O2V B;  4YT0 B;  2MRP A;  4YXD B;  1DYQ A;  2Q5W D;  1VD2 A;  5AZG A;  4R3D A;  4IW0 A;  1RFA A;  3VXW A;  3PGE A;  3HRD D;  3S2A A;  1VZ8 A;  4LNN A;  2LAS A;  3VTW A;  4DHZ E;  4BVU C;  4FJY A;  1TY0 A;  1CJE A;  1ZGU B;  2PIA A;  1I35 A;  4NPN A;  2MP2 B;  2MQJ A;  1XF5 L;  5FR3 A;  2WXL A;  3ZRF A;  2G9H D;  2IO2 B;  2KYW A;  1GUA B;  1OTR B;  1EWY C;  4RGM A;  3Q14 C;  3AE4 B;  3PZ8 A;  4RMA A;  2Z0E B;  2AX5 A;  2KAN A;  4ANW A;  1C77 A;  3VFK A;  5J18 A;  1JWB D;  2WXG A;  2UWQ A;  1L6U A;  2G1E A;  5EE1 A;  5L95 C;  2BKR B;  2G4S A;  1IGD A;  1QQR A;  2LVP A;  2HTH A;  4AUQ C;  2FCN A;  1YJ1 A;  4GDK B;  4L1B A;  1KRH A;  2RMM A;  2ZVO A;  5J17 A;  2WXM A;  1D5X C;  5KHQ A;  2OJW A;  3A4S C;  3I5J C;  4ASW C;  3L0W B;  4P16 A;  4USA A;  1SIF A;  1YJI A;  3RCZ A;  1HEZ E;  1XCQ L;  4ANX A;  1YNT E;  1L2N A;  2O6V A;  2JXT A;  2WDQ B;  3UI3 A;  1IBX A;  2BS3 B;  2ZCC A;  4HJK A;  4WJN A;  3W1Y A;  2FIF A;  4EFO A;  4PYZ A;  2C7M B;  1SEB D;  3CST A;  1R7S A;  3UGB B;  3Q8B A;  2GI9 A;  1EU4 A;  2WHI A;  4BOZ B;  4ICV A;  1WGG A;  3BY4 B;  1OFF A;  2ZW1 A;  3DWM A;  2L05 A;  3ML8 A;  3UIP B;  4M8M A;  1SGH A;  4HPM B;  1LQB A;  3AEF B;  4NQK E;  1WYW B;  2BT6 A;  4YWG G;  4X57 B;  2C7N B;  3QCA A;  3LDZ E;  5L83 A;  2KN4 A;  4KGR A;  4TV3 A;  1MPE A;  2IPK D;  4JWU C;  3KUC B;  2ZW0 A;  2GBJ A;  4HCN B;  2EKE C;  4BZA A;  2ZJD A;  1F1H A;  2K8B A;  4ARI A;  1I4G A;  4XX5 A;  2PKO A;  2GBN A;  1P3Q U;  3V3X A;  1IPG A;  1F9J A;  3APC A;  4RF0 A;  4C7Z A;  4YSX B;  4ITK A;  5DPS A;  4HJG E;  2NCN A;  1ENF A;  4MJS A;  3EEC A;  1SE2 A;  3DWG C;  1XLO A;  1NVI D;  4MGK E;  3AB5 A;  3ABV B;  1IBX B;  1F77 A;  1N6Z A;  3L17 A;  4GB9 A;  1JRU A;  3HHM A;  1V1P A;  4FXC A;  3VAW A;  1VZ6 A;  3N1Y C;  3TEX A;  2MCN B;  1IP9 A;  1HZ6 A;  1HTQ A;  5G2N A;  4RNA A;  2JXX A;  3FAH A;  3SU8 X;  1UGM A;  1V81 A;  2SAK A;  2K9X A;  3UIO B;  1AWD A;  2WXQ A;  2C7H A;  4M8N A;  4C56 C;  3LYY A;  2PVO D;  1WM3 A;  3AE6 B;  2DYO A;  1ZW7 A;  3QA8 A;  2N9P C;  2R2Q A;  4M01 A;  3IAS 1;  2M1M A;  5LXH A;  4C00 A;  3WAO A;  1E10 A;  1N5X A;  5IN7 A;  2K6Q A;  3AV8 A;  1FIQ A;  4FN2 A;  1YMH E;  1G6J A;  3DOW A;  4MAC A;  3ZQ4 A;  2LXC A;  4MJS B;  1QT9 A;  3AU5 A;  1YD8 U;  2V9H A;  1LGR A;  1QIL A;  2WNM A;  1Z2M A;  2KC2 A;  4IOI E;  3R3M A;  4BBN C;  2CJN A;  3ZDT A;  3HVD A;  1F52 A;  4EZL A;  3RPF C;  1PGA A;  4L2Y A;  2Z0D B;  1P7E A;  2LRW A;  2FE8 A;  1V1P B;  2KDE B;  2L3Z A;  4HKZ E;  3U7D A;  2DNF A;  2WQY B;  3IFW B;  3P63 A;  5D7G A;  3R7R A;  4WJO A;  2IGD A;  3R66 C;  1HE8 A;  2RR9 A;  3VH4 B;  2RGF A;  2KDI A;  4TKN A;  5T8I A;  5TSS A;  2WX0 A;  2GBK A;  2JF5 A;  1P1A A;  1V6E A;  2J52 A;  5LNK 1;  3TCA A;  2N7J A;  1PFD A;  4PT5 A;  4N9F 4;  1TKE A;  4IDI A;  1FFU A;  2BVC A;  5CHF A;  1DOI A;  2LFI A;  2DAJ A;  1NYQ A;  3LXF A;  4DWF A;  3SD5 A;  3WAN A;  1SIJ A;  3VQI A;  3R2T A;  4OZA A;  2Y5B B;  5D3I B;  5IAA C;  5HI1 A;  4DBG A;  3VRB B;  1V8C A;  1QOB A;  4ACF A;  1WX8 A;  1R4N B;  2VZK B;  4DDG D;  3SDL C;  1VZ7 A;  3Q8C A;  2LHD A;  4O1N A;  3IVF A;  3AE7 B;  4MSQ B;  3P1M A;  1WGH A;  2UU7 A;  1P0R A;  3M3J A;  3JYU A;  4KGS A;  1GB1 A;  2IDY A;  4PS7 A;  2G3Q B;  1I4R A;  4NNJ B;  3DBR B;  1WMH B;  3NVV A;  3B2F A;  3QHT A;  3AE9 B;  4W9F A;  1NI3 A;  3VRA B;  2BYV E;  3PRM B;  4KZC A;  3TJP A;  1FNU A;  3H9D A;  4ICU A;  5C23 A;  2DLB A;  3TEZ A;  3AI5 A;  1SE9 A;  2KOX A;  2NS5 A;  4KX6 B;  4WWN A;  1UBI A;  3KYC D;  1KF6 B;  2HE7 A;  2DWQ A;  1NI2 A;  1WX7 A;  2RD0 A;  3EGR A;  2KMA A;  5C1Z A;  1OGW A;  3MHS D;  2W55 A;  4LNK A;  1E5W A;  1HA5 A;  2M17 A;  3KWV A;  4XZ4 A;  2ZPN A;  3PZ7 A;  4FLH A;  4N6E B;  4DK5 A;  2M19 A;  3JW0 X;  1CK1 A;  2HDE A;  3ZW3 A;  1UNS A;  2K3U A;  3RZW C;  4AS1 A;  2V1Y A;  2JZ3 B;  4EOY A;  3QQ8 B;  2XK5 A;  2M0X A;  4QAY A;  1GAQ B;  3P4P B;  4F7Z A;  4URK A;  2EEL A;  3DBL I;  1L6V A;  1F0Z A;  1SB3 C;  4CHK A;  3P4S B;  4HCP B;  2MSE D;  2NR2 A;  2MA9 B;  3ECI A;  3O13 A;  4P1C C;  2DEN B;  1FRD A;  1QOA A;  3B2G A;  4F1S A;  3QAR A;  1OQR A;  2A5U A;  2QIL A;  4IWP A;  1XLQ A; 
#chains in the Genus database with same CATH homology
 2V3S A;  5D94 A;  2MRP A;  4ZRJ A;  4NY0 A;  2GBR A;  2CU1 A;  1VD2 A;  3T8M A;  2BF8 B;  1GC6 A;  4J6I A;  5AZG A;  3VUW A;  3DVN V;  1WXM A;  4IW0 A;  1E7V A;  2GOW A;  4K7U A;  2MBE A;  3V60 A;  1YX5 B;  3VTU A;  3QJZ A;  1RFA A;  3GOE A;  3VXW A;  3PGE A;  4KVG B;  3EFU A;  2PE9 A;  3S2A A;  3TL5 A;  3JVZ X;  2BYF A;  2K8H A;  2LAS A;  3VTW A;  3VUX A;  4DHZ E;  1E8Y A;  4BVU C;  4JLC A;  4FJY A;  1ZGU B;  2OJR A;  4EEW A;  4IG7 B;  1I35 A;  4MEM A;  3ZVV A;  4K7S A;  2KQS A;  1FXT B;  2MP2 B;  2MQJ A;  4NPN A;  5G55 A;  2K39 A;  4GDL A;  3TBL D;  3HK0 A;  2L7R A;  3ZRF A;  2KXJ A;  2IO2 B;  5D2M B;  1WE6 A;  4HLE A;  1GUA B;  4DHJ B;  3N32 A;  1OTR B;  4TUU A;  1GJZ A;  4GOC A;  1X1M A;  3PLV A;  2KVR A;  2M4N A;  2MW5 A;  2K1F A;  3GZN I;  4RMA A;  4GN1 A;  3ZIM A;  1WE7 A;  2Z0E B;  2KTR A;  2KAN A;  4LDT B;  4ANW A;  3KH0 A;  3VFK A;  3PS6 A;  3MJW A;  5J18 A;  3K9P B;  4NJ6 A;  2LVQ A;  2IO0 B;  2UWQ A;  3A1Q A;  3HM6 X;  3PRZ A;  4RM9 A;  3JSV B;  3M63 B;  4FBJ B;  5HKH A;  3I3T B;  5L95 C;  4K1R B;  3A9K A;  4AJY B;  2BKR B;  2G4S A;  3ZNH B;  3X0W A;  2LVP A;  2HTH A;  2M8S A;  3H7P A;  3PSE B;  1IYF A;  4AUQ C;  4DXA B;  2FCN A;  1YJ1 A;  4GDK B;  4A3P A;  4LCD E;  2FNJ B;  3H6N A;  2ZVO A;  4G11 A;  5J17 A;  5KHQ A;  2J0J A;  3A4S C;  5CHW A;  4ASW C;  1V80 A;  3L0W B;  3DBS A;  5DCN A;  1LFD A;  1SIF A;  4KDI C;  4B95 A;  2BWF A;  1UH6 A;  2R2O A;  1LXD A;  2BGF A;  2JRH A;  3CMM B;  3RCZ A;  3K9O B;  4IM0 A;  4WJQ A;  4W9G A;  3DVN U;  1WJU A;  2ZPY A;  2ZVN A;  3A9J A;  4ZYN A;  4ANX A;  1L2N A;  2O6V A;  2N7E A;  4W9K A;  1K8R B;  3BIN A;  4KSL C;  2ZCC A;  2I1J A;  1V86 A;  4HJK A;  2AEH A;  4KDL B;  4WJN A;  1WGD A;  3W1Y A;  3IHP C;  2FIF A;  4EFO A;  4PYZ A;  2C7M B;  2GBM A;  3CST A;  3ZKJ C;  4ZRK A;  4G50 A;  3PZD A;  3UGB B;  3PV1 A;  1NDD A;  5AZF A;  1WM2 A;  3NHE B;  4IUM B;  2LI5 A;  4II3 B;  4KZ0 A;  2W9N A;  1WF9 A;  3RYT A;  2D11 A;  4BOZ B;  2D10 A;  1WH3 A;  1WGG A;  3BY4 B;  4HK2 A;  4ICV A;  5JHA A;  2CR5 A;  1XD3 B;  4GDL B;  4BBN F;  2L8J A;  5E6N A;  2L05 A;  3ML8 A;  3UIP B;  2KLG A;  4M8M A;  3RZF A;  1SGH A;  3LJ3 A;  4HPM B;  3QWZ B;  5LLI A;  4W9H A;  1LQB A;  2KDB A;  4K81 A;  1YIW A;  4NQK E;  1WYW B;  3ENE A;  2REX A;  1UEL A;  4X57 B;  3QAQ A;  2KTR B;  1EF5 A;  2C7N B;  1BT0 A;  3QCA A;  4A20 A;  4GGQ A;  3LDZ E;  5L83 A;  3OJ4 B;  3CSF A;  3PTF C;  2KLC A;  3M62 B;  4BOS C;  1WMH A;  2C5L C;  4TV3 A;  4KSK C;  3KUC B;  2K25 A;  3AUL A;  3WAP A;  2KNB A;  1P9D U;  3WAL A;  1C1Y B;  3ZNI D;  2GBJ A;  4HCN B;  2EKE C;  4II2 B;  5AEK B;  2ZJD A;  2KC1 A;  1EUV B;  2JY6 A;  4HWI B;  2YLM A;  2K8B A;  3EC8 A;  4AOF A;  1UZX B;  2CHZ A;  2DZK A;  1RRB A;  3C0R B;  3H7P B;  4XX5 A;  2K8C A;  4BFR A;  1WX9 A;  2AL6 A;  3DCG A;  4CO7 A;  2GBN A;  1P3Q U;  1WXA A;  2MBH A;  3A4R A;  3ZNZ B;  1IPG A;  1F9J A;  1ZKH A;  3APC A;  2FAZ A;  2MBO A;  1TZ1 A;  1OQY A;  4JIO U;  1WRD B;  3KVF B;  5DPS A;  1WGR A;  2IYD B;  4MGY E;  2NCN A;  1GNU A;  2AYO B;  4NQL B;  2GMI C;  2N9X A;  2I1K A;  2RPQ A;  3EEC A;  4MJS A;  3AU4 A;  4IC7 B;  3RD2 A;  4PS3 A;  4B9K A;  3CF6 E;  3VTV A;  1WZ3 A;  4KIK A;  3MTN B;  2CKH B;  3DBH I;  4WWP A;  1I42 A;  3A9J B;  2D07 B;  4HDO A;  4I6N B;  2JWZ A;  4MGK E;  3UQB A;  1EF1 A;  3T9L A;  2C9W B;  1J0G A;  3Q3J A;  4BKS D;  1CMX B;  3L17 A;  4GB9 A;  4F8C B;  3RUL A;  4IWQ A;  1JRU A;  4MGI E;  1WZ0 A;  3HHM A;  4M0W B;  2KHW B;  5D6J B;  3VDZ A;  4RM8 A;  3VAW A;  3UQA A;  3IG3 A;  2KDF B;  2LD9 A;  3UIN B;  2WWZ A;  2MCN B;  1IP9 A;  1VCB A;  5G2N A;  2XK5 B;  2JXX A;  3VHT C;  1S3S G;  2XEW A;  4EZJ A;  2KFK B;  2MX2 A;  4YL8 A;  1KM7 A;  1Q5W B;  2V4L A;  3SU8 X;  2HD5 B;  4E71 A;  1C3T A;  1H8C A;  1UGM A;  3DVG X;  4DDI D;  1V81 A;  3D32 A;  3KUD B;  3UIO B;  2KWC A;  2C7H A;  4M8N A;  2L00 B;  4GSW A;  1WM3 A;  4FAD A;  2WX1 A;  1OEY J;  4WJP A;  4NAW A;  4TQ0 A;  3B0A A;  4JGH B;  4HXD A;  2JZZ A;  2JRI B;  2LRU A;  2FID A;  2DYO A;  1ZW7 A;  2JUO A;  1R4M I;  2KMC A;  3A33 B;  3QA8 A;  5E6O A;  3V62 A;  2N9P C;  2R2Q A;  2N9E B;  4EZK A;  4GXB A;  1WXS A;  2PPH A;  2KJH B;  5DPW A;  1GG3 A;  3H1U A;  1AAR A;  2M1M A;  5LXH A;  2NPT A;  4DHJ D;  2LXA A;  4FJV B;  1H4R A;  3WAO A;  1TBE A;  1V5T A;  1QZE A;  4BKG A;  3NZU A;  4E74 A;  3OAW A;  3W1S C;  3IBE A;  2K6Q A;  4LDT D;  3NY5 A;  2L76 A;  2FUH B;  4ANV A;  1XQQ A;  4FN2 A;  5DPR A;  2ZNV C;  1G6J A;  1V5O A;  4BKT A;  1UBQ A;  2FCM A;  3DOW A;  5DPT A;  2KJR A;  2LXC A;  4P7I A;  2KN5 A;  3V6E B;  4MJS B;  3DDC B;  3AU5 A;  2DYB A;  3VUY A;  2KX3 A;  1YD8 U;  4W9E A;  3WAM A;  1Z2M A;  2BWE S;  2KC2 A;  3V61 A;  3R3M A;  1P98 A;  3KYD D;  1KOT A;  4BBN C;  4OVU A;  4MH0 E;  3ZDT A;  2KQ7 A;  4GMV A;  4I6P A;  3H7S A;  1XT9 B;  2YVC A;  4EZL A;  2KX0 A;  3KUZ A;  1J19 A;  3PT2 B;  2PJH A;  3R7Q A;  1WFY A;  1Z5S B;  2Z0D B;  1TGZ B;  4FHJ A;  2LRW A;  3ZNG C;  2PEA A;  1WGY A;  2KDE B;  3QIJ A;  2CHW A;  2L3Z A;  3U7D A;  2BYE A;  3ONS A;  4MDK E;  4MEL A;  4NJ7 A;  3A1Q B;  2J0K A;  2DZM A;  3IFW B;  2WYQ A;  2N4F A;  3JSV A;  4WAA A;  5D7G A;  5JH5 C;  2LGY A;  1R4N I;  3R7R A;  4WJO A;  4CYE A;  3W1S A;  3R66 C;  1HE8 A;  4AJW A;  2RR9 A;  3A9K B;  2DAF A;  3VH4 B;  2RGF A;  2KD0 A;  2G45 B;  2KDI A;  4TKN A;  2DYM A;  3UF8 A;  2NVU I;  4NAW B;  2L0F A;  3SHQ A;  2WX0 A;  2GBK A;  3RT3 B;  2JF5 A;  1P1A A;  1V6E A;  2MBQ A;  4GDK A;  2BKF A;  2IZV B;  3KW5 B;  5GMV A;  3TCA A;  3L16 A;  4PS8 A;  5EDS A;  4N9F 4;  2KZR A;  1V2Y A;  2KJ6 A;  2NPT B;  1YX6 B;  5KHO A;  2PE6 B;  1T0Y A;  2KK8 A;  2KO3 A;  4TQ1 A;  2A4Z A;  2KKC A;  3PLU A;  3HIZ A;  2LGD A;  4W9D A;  5CHF A;  1NBF C;  2EMT A;  4W9J A;  2IY0 B;  3ZDM C;  3HM3 A;  2DAJ A;  2O6V B;  4FJZ A;  3V6C B;  4EUT A;  4DWF A;  3SD5 A;  1PQS A;  3WAN A;  3U8Z A;  3VQI A;  1OEY A;  2LUE A;  1LM8 B;  1V49 A;  3NZS A;  2ZCB A;  3DPD A;  4W9L A;  1E8W A;  2Y5B B;  5IAA C;  2IY1 B;  2N7D A;  4DBG A;  4IWO A;  4GU2 A;  1WY8 A;  2NBU A;  1YQB A;  4FUL A;  2FCQ A;  1WX8 A;  3P2B A;  4WQO B;  4DDG D;  5LXI B;  3SDL C;  2OOB B;  2KWU B;  3RUI B;  1WIA A;  2LGX A;  2DX5 B;  5E6P A;  2KWV B;  3X23 A;  3ZLZ A;  3TMP B;  3B1L X;  3ALB A;  4JQW C;  3IVF A;  3AXC A;  1V9J A;  3PHW B;  3PPA A;  4MSQ B;  1WGH A;  1P0R A;  2D2Q A;  3M3J A;  2DHZ A;  3JYU A;  4XC2 A;  4WWO A;  2LJ5 A;  1KLV A;  1KJT A;  1U4A A;  2G3Q B;  3L13 A;  4PS7 A;  4NNJ B;  3APF A;  3L54 A;  2IO3 B;  2ZEQ A;  3L10 B;  3DVG Y;  5JHB A;  2K6D B;  4MSM B;  1WMH B;  2XBB C;  2MBB B;  4DHZ B;  4BKS A;  3QHT A;  4ZRI A;  2O6V D;  4HPL B;  3DQV A;  4W9F A;  3ZTD A;  1WR6 E;  1Q0W B;  2BYV E;  3PRM B;  4KZC A;  3TJP A;  1S1Q B;  1Y8R C;  4MGZ E;  3H9D A;  3PVL A;  4HDQ A;  3ZO5 B;  2JPH A;  1E7U A;  4ICU A;  5C23 A;  3O65 B;  2ZNV B;  2O2V A;  2IO1 B;  3PRE A;  5J2R A;  2JT4 B;  3AI5 A;  4IM2 A;  2MLB A;  3TIX A;  1SE9 A;  3L08 A;  4HVB A;  2KOX A;  2EMS A;  4G0N B;  2NS5 A;  3ZUN A;  1ISN A;  4WWN A;  1J8C A;  1UBI A;  3KYC D;  4GIV A;  2HE7 A;  4W9I A;  2AWT A;  1WI0 A;  2WDT B;  1NI2 A;  1WX7 A;  1WXV A;  4LJO B;  4K7W A;  2RD0 A;  4FHK A;  3N3K B;  2KMA A;  5BO4 B;  1MG8 A;  5C1Z A;  2J7Q B;  1OGW A;  3MHS D;  3QC8 B;  2VRR B;  4KIK B;  5CHV C;  1E5W A;  4LJP B;  3WA0 A;  3VVW B;  2MP2 A;  2M17 A;  3B08 A;  2BPS A;  3PHX B;  3OLM D;  2ZPN A;  2RSU A;  1UD7 A;  4XZ4 A;  5FR6 A;  5IA7 A;  2UYZ B;  4FLH A;  4ZDV A;  1D3Z A;  2LZ6 A;  4A3O A;  5CTR C;  3NS8 A;  4DK5 A;  3APD A;  2IBI B;  4OVV A;  3QX1 A;  2DZI A;  1RLF A;  2NBV B;  3M95 A;  2MWS B;  3JW0 X;  2J0M A;  1EO6 A;  2KFJ A;  2LVO A;  3NOB A;  1TTN A;  4IM3 A;  1A5R A;  4I6L B;  5TR5 A;  4FA6 A;  3ZW3 A;  1E90 A;  2G4D B;  2B3A A;  1GC7 A;  2JVC A;  2V1Y A;  2CHX A;  2JZ3 B;  3RZW C;  1Q1O A;  3QQ8 B;  2XK5 A;  4PYU A;  4EOY A;  2M0X A;  1E8Z A;  2KFK A;  3PRP B;  1RAX A;  1E8X A;  3Q3F A;  3QK0 A;  4F7Z A;  2FCS A;  3ZRC A;  4URK A;  5CX3 A;  3U30 A;  4KV2 A;  2ASQ A;  2N1V A;  2N1W A;  2Z59 B;  3DBL I;  3ZTC A;  4E3C A;  1L7Y A;  4B6W A;  1WJ6 A;  2HJ8 A;  4CHK A;  1WR1 A;  4EKU A;  4HCP B;  5JZE B;  2MSE D;  2ZZP B;  4AP4 C;  2NR2 A;  2LWP A;  2MA9 B;  3ECI A;  2QHO A;  3OJ3 A;  3EHV A;  1WJN A;  4G3X B;  3ML9 A;  4AWJ A;  5AZH A;  2DEN B;  2D3G A;  3VH3 B;  4ANU A;  4F1S A;  3QAR A;  3WIM A;  2DZJ A;  2CS4 A;  3DBR I;  1WJ4 A;  2A5U A;  1M94 A;  4IWP A;  2KTF A;  4W9C A;  2C60 A;  3N30 A;  4MM3 A;  2AL3 A;  4JL9 A;  2L0T A;  2O2V B;  2NBW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...