4GU2A

Crystal structure of ubiquitin from entamoeba histolytica to 1.35 angstrom
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
72
structure length
68
Chain Sequence
MQIFVKKTITLEVEPNDSIDAIKAKIQEKEGIPPDQQRLIFAGKQLEEGKTLSDYNIQKESTLHLVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants of Ubiquitin Conjugation in Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Protein binding
molecule keywords Ubiquitin
total genus 21
structure length 68
sequence length 72
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gu2A00
4EUTA 2M1MA 3M62B 3DQVA 4TQ0A 4WJOA 3ML9A 2NVUI 2CHWA 2DZKA 4K7SA 1KLVA 5BO4B 2C9WB 3A4RA 2C7MB 2FCNA 2LVQA 1WM2A 5J17A 1Z5SB 3R7RA 1RRBA 3SU8X 1V80A 1LM8B 3HM3A 3GZNI 1SIFA 3ZDTA 1V81A 2LXAA 2YVCA 3VTWA 2MW5A 3ZNHB 3PPAA 1EUVB 2FIFA 4W9FA 2GOWA 1LXDA 3ZDMC 4DK5A 3MJWA 3N30A 2ZEQA 1WXVA 1OGWA 2G4SA 4ZRIA 4DBGA 2HE7A 1E5WA 2NS5A 2OJRA 2KOXA 2ZZPB 4GDLA 5E6OA 1JRUA 3CMMB 1UGMA 4IM3A 3BY4B 4ICVA 2JZ3B 1MG8A 2XBBC 3QK0A 4AOFA 2JWZA 4HDOA 2K6DB 3DDCB 5E6NA 3H7PA 2IYDB 3DBHI 3ZVVA 4XZ4A 2J0MA 4DDID 4AUQC 2FCMA 3A9KB 3KUDB 2DZIA 4GU2A 4HCNB 3PGEA 1WJUA 5LXIB 1YIWA 3T8MA 4MJSA 1WX7A 1OQYA 4OVVA 4HXDA 4EEWA 2DZJA 2KHWB 1IPGA 3D32A 3DBSA 4DHZE 4PS8A 3UGBB 2M8SA 1TZ1A 2LASA 4DHJD 2LWPA 4G0NB 4ZRKA 2REXA 4GB9A 2I1KA 3UQAA 1UH6A 3UIPB 3M63B 2D3GA 1J0GA 2R2QA 3Q3JA 4MGZE 1V5TA 2LGDA 3IVFA 4ZYNA 3QIJA 4BVUC 1TTNA 3R7QA 3VAWA 1WFYA 1P1AA 2IO3B 2PE6B 3UQBA 2K25A 3WIMA 1WX8A 2KJ6A 2MRPA 3ZRFA 1P3QU 1P9DU 1S1QB 2K39A 2KFKB 4GOCA 4HK2A 4HVBA 4M8MA 3PRMB 1BT0A 2I1JA 1TBEA 1FXTB 1J19A 5GMVA 1UELA 1H8CA 2Y5BB 4FLHA 3KYCD 3V6EB 4AJYB 3WAOA 4OVUA 3ZO5B 2L8JA 3BINA 5CHVC 5DCNA 3ENEA 3L17A 3T9LA 2NPTB 5LLIA 4LJOB 2IO2B 1R4MI 4RM8A 2D11A 3DVGY 1GNUA 1C3TA 2K6QA 1ZW7A 4WWNA 4URKA 2FCQA 2BKFA 1E90A 1U4AA 1EO6A 1GJZA 4K7WA 4EZKA 4NJ7A 3PSEB 2IZVB 5C23A 2N9XA 1P0RA 3PLVA 2D2QA 1EF5A 2PEAA 4W9GA 3CF6E 4WJNA 4ZDVA 2KFJA 2MBBB 4NY0A 3ZNID 2NBUA 5DPRA 2N4FA 2BWFA 3SHQA 2KQ7A 2KWVB 4HCPB 1L7YA 1WXMA 2RSUA 4KDIC 3N32A 2V1YA 3NOBA 3TCAA 1G6JA 1WJ6A 2JRHA 4DDGD 2NBWB 3PREA 4MGKE 5DPWA 2XEWA 2CR5A 1WXAA 4HDQA 3S2AA 1L2NA 3TJPA 3X0WA 2DYOA 5IA7A 3L0WB 2LVPA 1E8YA 3R3MA 3K9PB 2RD0A 1NDDA 2KTFA 4NNJB 5AEKB 1I42A 2BWES 3L10B 2JXXA 5G55A 2N9PC 2KC2A 3DVNU 2R2OA 1J8CA 5JH5C 4WQOB 3PHWB 2DZMA 1RFAA 2N1VA 2ZJDA 4LDTB 2WDTB 2HTHA 3QAQA 4FADA 2MBEA 1KOTA 2RGFA 4ICUA 1YD8U 2LRUA 2KX3A 2RR9A 1WF9A 3KW5B 4JGHB 4W9EA 4II2B 2KDIA 4KSLC 3I3TB 3TIXA 3H7SA 4TUUA 2KDFB 3VUWA 3DPDA 4ANWA 3VUXA 4LCDE 4IWPA 5D2MB 2WWZA 2WX0A 2GBKA 3ZIMA 3EHVA 4KVGB 2CHXA 3RZFA 1UBQA 3MTNB 3LDZE 3QQ8B 2IO1B 1M94A 3LJ3A 3ZRCA 1WXSA 3U30A 4DXAB 2ZNVB 3NHEB 2L05A 2CU1A 2KO3A 3DCGA 2DYMA 3ZTCA 3PS6A 2CS4A 2FAZA 3L13A 3VFKA 3DOWA 5DPTA 3ZNZB 4GXBA 3QWZB 4K81A 4LDTD 4FHJA 1WE7A 3VTUA 2IY1B 4B9KA 3TL5A 3A1QB 3H9DA 3NZSA 4HLEA 2D10A 4GSWA 2GBMA 2KTRB 2L0TA 4FN2A 2MCNB 4FHKA 1V6EA 2J0KA 2N1WA 4GMVA 2N7DA 3OJ3A 3RYTA 2Z59B 4I6PA 2ZNVC 5G2NA 4KDLB 3AI5A 1GC7A 2MA9B 2V4LA 2KDEB 4NQKE 5D7GA 3C0RB 4WJPA 4NPNA 3ZNGC 2KWCA 3B0AA 1WR6E 1NBFC 4HWIB 2O2VA 2KMCA 1WZ3A 2MSED 2DAJA 3UINB 5C1ZA 4WJQA 2LGYA 1ISNA 2MP2B 3QJZA 2WYQA 2UYZB 4MH0E 4BBNF 1WGRA 2LD9A 3EECA 2K8BA 5JHAA 3WA0A 2J7QB 4K7UA 3CSFA 4BKSD 1WMHB 4P7IA 3VVWB 4TV3A 3K9OB 1IP9A 4FBJB 2JT4B 3W1SA 4M8NA 3IFWB 4MDKE 2KD0A 3GOEA 4KIKA 2LZ6A 2MBOA 5AZFA 2XK5B 4EZJA 1YX6B 3SD5A 3ZUNA 3A33B 1D3ZA 3VXWA 1WGDA 3HK0A 3WAMA 4MM3A 4WWPA 1XT9B 1SGHA 2C7NB 1WH3A 4N9F4 1V9JA 1XQQA 5KHQA 1UBIA 3TBLD 1Q1OA 3B08A 3N3KB 2EMSA 1E7UA 3KUCB 3W1YA 3ALBA 3QA8A 4FJZA 4G11A 2ZPYA 3VQIA 2BYFA 5TR5A 4A3PA 4A3OA 4M0WB 3B1LX 2FIDA 4BKGA 4ANUA 4BOSC 3ONSA 4XC2A 1H4RA 3IHPC 3RULA 2M4NA 2FCSA 5KHOA 2L00B 5L83A 3KH0A 4IC7B 3PRZA 2Z0DB 4IM0A 2KTRA 3QX1A 3SDLC 4BBNC 4EOYA 4BFRA 1IYFA 2G3QB 5CTRC 4F8CB 4GDKA 2KDBA 1XD3B 2UWQA 1ZGUB 4A20A 2JVCA 5EDSA 2O2VB 4IWQA 3ZLZA 2GMIC 4F1SA 1V86A 4DHJB 4WAAA 3EC8A 2JY6A 1HE8A 2PJHA 4J6IA 4KSKC 4TKNA 2BPSA 2AL3A 2BYVE 5AZHA 2M17A 2JPHA 2JZZA 3A1QA 3PV1A 2C60A 4NAWB 4K1RB 1Z2MA 2VRRB 1AARA 1WYWB 2GBRA 2OOBB 3RT3B 2BKRB 3OLMD 2KMAA 4FA6A 1Q5WB 4TQ1A 2LVOA 1WGGA 2LI5A 4II3B 3X23A 3IG3A 2KK8A 3QARA 1E8ZA 1TGZB 4YL8A 4B6WA 1WM3A 2XK5A 3VHTC 1EF1A 1GG3A 2CKHB 4MGYE 3WALA 2KXJA 2A5UA 1WX9A 3KUZA 3ZKJC 2D07B 2K1FA 2GBJA 2K8CA 1RAXA 4GN1A 4G50A 2L76A 3L16A 3MHSD 1OEYJ 4B95A 1WRDB 5CHFA 2KKCA 3CSTA 3A9JB 3P2BA 4PYUA 1LFDA 5DPSA 3KVFB 3PLUA 3VTVA 2DX5B 3RUIB 1V49A 2MBHA 1GC6A 4NJ6A 2LGXA 3NS8A 2KC1A 2NR2A 4E3CA 3PHXB 2BYEA 4AP4C 1YQBA 3JVZX 4I6NB 2QHOA 3DBLI 3PZDA 4FULA 3H1UA 1S3SG 3HIZA 4JL9A 2EKEC 1KM7A 2L3ZA 2M0XA 1V2YA 1I35A 1F9JA 1PQSA 2MX2A 4X57B 2KVRA 2AYOB 2JRIB 1WIAA 3UIOB 4ANXA 3M95A 4KZ0A 3RD2A 4GDKB 3JYUA 1Y8RC 1RLFA 3M3JA 2KZRA 3H6NA 2KX0A 2N9EB 3QHTA 4IUMB 3V61A 3Q3FA 4MELA 4CYEA 1UZXB 1WI0A 4GGQA 4W9HA 4JIOU 2NBVB 3UF8A 3ML8A 3HM6X 2DHZA 2IO0B 2J0JA 4AJWA 2CHZA 5CX3A 3KYDD 4F7ZA 2B3AA 1K8RB 4NAWA 4EZLA 2LUEA 1WR1A 2JF5A 2A4ZA 2C7HA 4PS3A 3VUYA 1NI2A 1OTRB 1GUAB 1WE6A 2KANA 4RMAA 4EFOA 1E8WA 2MWSB 3L08A 3JSVA 2C5LC 4BKTA 2RPQA 1WJ4A 2KLGA 4EKUA 2DYBA 2WX1A 2FNJB 4FJVB 3DVNV 1T0YA 4W9DA 4W9CA 2ZCCA 5J18A 4DHZB 1VCBA 2KN5A 3AXCA 4BOZB 1YJ1A 3NY5A 4W9JA 1SE9A 2BGFA 3L54A 3U7DA 1UD7A 1CMXB 1WGHA 4E74A 4MSQB 3TMPB 4NQLB 4WWOA 4G3XB 3APDA 4HPLB 2O6VA 4KZCA 2PPHA 4FJYA 1QZEA 2BF8B 3A9JA 3EFUA 2L0FA 2Z0EB 4MSMB 2G45B 4JLCA 2DAFA 3U8ZA 3V6CB 2JUOA 4PYZA 2IY0B 4I6LB 1Q0WB 2YLMA 3QCAA 4HPMB 4HJKA 1VD2A 5JZEB 4BKSA 2AWTA 3OAWA 4LJPB 3W1SC 5J2RA 4IW0A 5AZGA 5IAAC 3JW0X 1E8XA 1YX5B 2ZVOA 3AU5A 2G4DB 3V60A 3DBRI 1KJTA 3VH3B 4W9KA 3WANA 1P98A 2ZPNA 1E7VA 1R4NI 2KWUB 2AL6A 2IBIB 2KJRA 2V3SA 4DWFA 3APFA 2HJ8A 5D94A 3ZTDA 2O6VD 3A9KA 3PT2B 4RM9A 3QC8B 2MP2A 2MBQA 2LJ5A 4W9IA 3NZUA 1V5OA 4IWOA 3IBEA 3HHMA 2EMTA 3ZW3A 5JHBA 1WMHA 2ZVNA 2KNBA 2ASQA 3OJ4B 4XX5A 3JSVB 4CHKA 2N7EA 3A4SC 4GDLB 2AEHA 1LQBA 5D6JB 2FUHB 2HD5B 1WY8A 3PRPB 1WJNA 1WZ0A 3RZWC 2W9NA 4KIKB 3RCZA 2KFKA 3H7PB 5FR6A 3VH4B 4ZRJA 4E71A 3O65B 5CHWA 3V62A 2MLBA 3APCA 4IM2A 3PVLA 1C1YB 2GBNA 2ZCBA 5E6PA 2KQSA 1OEYA 2PE9A 4MJSB 4MGIE 1WGYA 4ANVA 2O6VB 2DENB 4PS7A 3DVGX 4AWJA 2NPTA 2NCNA 3R66C 1X1MA 3VDZA 4KV2A 3PTFC 5HKHA 2L7RA 3ECIA 1A5RA 3AU4A 4W9LA 2LRWA 4GIVA 4CO7A 5L95C 5LXHA 4JQWC 2KLCA 2MQJA 4MEMA 2LXCA 4ASWC 1ZKHA 4IG7B 2K8HA 3WAPA 3AULA 2KJHB
chains in the Genus database with same CATH superfamily
3ZYYX 3FILB 2DZKA 4K7SA 2QCZA 2LVQA 3DBLB 1Z5SB 1RRBA 4HROA 4C4VA 3BVMA 5H8YE 3N20C 3PPAA 3MJWA 1QOBA 1TKYA 2G4SA 3DWGC 1E5WA 2OJRA 3CMMB 1UGMA 4ICVA 2K0PA 3Q69A 1HZ6A 1J7BA 2JX5A 3QK0A 2K6DB 3DDCB 3H7PA 4ZHOA 3FC4A 4MH8A 4DDID 2FCMA 4C7ZA 4HCNB 3SFDB 2LHEA 1YIWA 1LGRA 4MJSA 3I63C 3W2DA 1L4ZB 2M8SA 1BUIC 1E6EB 2D3GA 3P4RB 3IVFA 3QIJA 4BVUC 1WX8A 1TS4A 1GOZA 1S1QB 4BAXA 4HK2A 2WXPA 1SJED 3PRMB 1BT0A 2I1JA 1J19A 3V6EB 4FLHA 1JALA 2JZPA 3L17A 3T9LA 5LLIA 2IO2B 1C3TA 4RM8A 3GB1A 2BKFA 4H2AA 3PZ7A 5C23A 2N9XA 1P0RA 3TUOA 1L5PA 4C56C 3CF6E 4WJNA 4NY0A 5H92C 3ZNID 2N4FA 2BWFA 3ZXRA 4HKQA 1B1ZA 1L7YA 1PYWD 2HDEA 4KDIC 2M0AA 2HTME 4DDGD 3TJPA 4LTUA 1ET6A 1T5XD 2D5GA 3K9PB 1WWTA 4EE2A 3SFEB 5AEKB 2R2OA 3VRBB 4WQOB 4ICUA 1JMLA 2LRUA 1WF9A 4JGHB 4KSLC 4NZLB 3DPDA 4ANWA 4LCDE 4IWPA 2WWZA 3U7ZA 3ZIMA 1ZOYB 1UBQA 3QQ8B 4YTPB 3U4EG 3GS2A 2L32A 2IGHA 2FAZA 3DOWA 4RNAA 1SB3C 4OW0A 4B9KA 3TL5A 2BYTA 1P7FA 3A1QB 3H9DA 3NZSA 2KTRB 4FN2A 2K9XA 3N1ZC 1V6EA 2N1WA 1YQ4B 1JCKB 1GC7A 2KDEB 4WJPA 1EWCA 3ZNGC 3WCQA 2O2VA 2KMCA 1WZ3A 1UGJA 4WJQA 2V3NA 4A8XC 3BIID 4BBNF 2K8BA 1UWXA 4GLSC 3K9OB 3BWUD 3Q8EA 2V4IB 4LNFA 4MDKE 4KIKA 2LZ6A 2MBOA 1ESFA 4EZJA 3ZUNA 3H8HA 3R2TA 3WAMA 4WWPA 1J7AA 2PVOD 4N9F4 1F0ZA 1UBIA 1Q1OA 3N3KB 2EMSA 3ALBA 3QA8A 4FJZA 4G11A 1V97A 4A3OA 2BB5A 4HRSA 2KAJA 5BYQA 4XC2A 1I4PA 3AE6B 3RULA 3CIRB 2M4NA 2L00B 1QLBB 4IC7B 4QAYA 4IM0A 4BBNC 3TEXA 2INNE 2KDBA 4RGTA 1D6EC 1XD3B 2WDRB 4A20A 2JVCA 2BS4B 2GMIC 2IGDA 1E10A 1V86A 1FD6A 4DXGA 1PGBA 2JY6A 2IJ0A 2NTSA 1NYRA 4J6IA 2BPSA 1SIJA 2AL3A 2BYVE 2JPHA 4NAWB 1Z2MA 2VRRB 4O1NA 1K52A 3RT3B 2WXIA 2LI5A 4II3B 2WGSA 2KK8A 2GB1A 4B6WA 1XLOA 1Y56A 3Q3MC 1EF1A 3BK2A 1PFDA 2CKHB 5D3IB 2KWDA 3FKYA 1WRDB 2PLPA 3A9JB 5DPSA 3CWIA 1LFDA 3RMKC 1GAQB 3RUIB 4NJ6A 2KC1A 2NR2A 1JROA 3HUIA 4AQ7A 4NAMA 1YQBA 1TS2A 2LGSA 4JL9A 2L3ZA 3Q8BA 2LJIA 2MX2A 1D5MC 1MVKA 3UIOB 1N61A 3M3JA 1FFUA 1T0QC 3AMZA 2WXKA 3NUHB 1E0ZA 1JWMD 4W9HA 3UF8A 2J42A 2J0JA 4HPPA 2LEKA 4AJWA 3RNEC 2B3AA 1K8RB 4PK1A 4PS3A 4YTMB 1Q10A 2RPQA 3KWLA 1WJ4A 2KLGA 2WX1A 4W9DA 3P42A 3L4PA 5J18A 4BOZB 1J7CA 3NY5A 2WXOA 1SE9A 1UD7A 1N63A 2V9HA 4YXDB 1FNVA 1I4QA 4G3XB 3APDA 4MSMB 2DAFA 3U8ZA 1RYJA 1SE2A 3QCAA 1ET9A 3FILA 4BKSA 3OAWA 4LJPB 4IW0A 5AZGA 1E8XA 1YX5B 2RPVA 2ZVOA 3VR8B 3V60A 1PGAA 3DBRI 2V0GA 4W9KA 2ZPNA 2YEPB 2V3SA 2KMMA 2MP2A 1KLGD 3C19A 4W9IA 1SBBB 1V5OA 3HHMA 1QF6A 1WMHA 2ZVNA 3AEAB 2RDGA 4MACA 1FO4A 2G1EA 4GDLB 1WJNA 4ZHPA 4KIKB 2KFKA 5FR6A 3PVLA 1C1YB 1JWUD 2O6VB 4AWJA 3DVGX 3B2GA 4KV2A 4M0WA 3W5VB 3MC0B 3AU4A 1TT5B 4YWGG 2KLCA 2LXCA 4ASWC 1ZKHA 3BVZA 4IG7B 2BB6A 3AULA 4EUTA 2M1MA 3M62B 4LNNA 4WJOA 3ML9A 2QEJC 1KLVA 1T6BX 2C9WB 2FCNA 1L4DB 1WM2A 3SU8X 1V80A 1LM8B 1V81A 2LXAA 2Q5WD 4A55A 2FIFA 4W9FA 2E6XA 1WXVA 1OGWA 2W3SA 4DBGA 2NS5A 2ZZPB 2JZ3B 1VZ8A 3I5JC 3BYYB 2Y5CA 4AOFA 3N1XC 1STEA 1AN8A 2IYDB 1GB1A 3ZVVA 3KUDB 3RNBC 4GU2A 5LXIB 3T8MA 4OVVA 4RF0A 1C76A 2ACZB 1IPGA 5G5GA 3GE8C 1TZ1A 3IT4B 4DHJD 2LWPA 4ZRKA 1YMHE 2REXA 4GB9A 2I1KA 3M63B 2D3AA 3Q3JA 4USAA 1TYGB 1V5TA 2SEBD 4ZYNA 1OQQA 1WFYA 1P1AA 4YT0B 4GOCA 1DYQA 4HVBA 4Q2JA 1ZXIA 2QDFA 1UELA 2Y5BB 3WAOA 3Q6BA 5DCNA 1XO3A 5IOIA 1GNUA 1ZW7A 2W54A 2FCQA 1E90A 1U4AA 1UF0A 4K7WA 4EZKA 2IZVB 4XDCA 5HFYA 1HTQA 2JXTA 1BXTA 2D2QA 1EF5A 4ZDVA 2KFJA 2L52A 1YOVB 2KWVB 4HCPB 3TCAA 2V1YA 3NOBA 3Q8CA 1WJ6A 2JRHA 5DPWA 4HDQA 2DYOA 2Y5PA 3NRZA 3HVDA 4KKJA 2PKOA 4NNJB 2BWES 3L10B 2JXXA 2QSDA 2N9PC 2KC2A 2V3PA 3EGRA 2KDMA 1RFAA 4JX1C 4LDTB 1HQRD 1KOTA 1YD8U 2H89B 1FM0D 3KW5B 3I3TB 3H7SA 1NENB 2EKIA 3ZGZA 5D2MB 2B76B 2GBKA 1ZP0B 3MTNB 3LDZE 1SE3A 2K5PA 2IO1B 4WIPA 3ZRCA 2BS3B 3U30A 2L05A 3P1MA 2MEKA 1YN5A 5DPTA 4C00A 4XE0A 3QWZB 3V05A 4FHJA 1WE7A 3VTUA 3NVYA 2IDYA 2D10A 2N0SB 4P1CC 2L0TA 4GMVA 4ZRPA 3OJ3A 3MHZA 3AI5A 2V4LA 4NQKE 3C0RB 4KKIA 2FE8A 3B0AA 1NBFC 4HWIB 4MT5A 2J53A 3UINB 1ZDVA 2LGYA 2MP2B 3QJZA 2UYZB 4NJCA 1WGRA 3EECA 1IUEA 3TSSA 3WA0A 2J7QB 4K7UA 5HI1A 4BKSD 1WMHB 1IP9A 1CJEA 2JT4B 3O13A 4M8NA 3IFWB 5FR3A 2LFIA 3V3XA 3MP9A 2KD0A 3A33B 1XLNA 3VXWA 2C7NB 1WH3A 1QKZA 3KUCB 1SJHD 2QMTA 4YSZB 1NVID 2LGIA 1SXTA 5FKAC 2FIDA 1IGCA 4OVZA 4ANUA 2WHIA 2ZW0A 1L0VB 2IGGA 3N1YC 2VZKD 3PRZA 2KTRA 3SDLC 1WXQA 4EOYA 1D5XC 4BFRA 1RM6C 4YSYB 5CTRC 4F8CB 2H88B 3R2IA 3RI7C 3GE3C 3U52E 2UWQA 3P4PB 4WAAA 1F2RC 1XF5L 2PJHA 2KT7A 1N6ZA 5G5HA 4KSKC 4TKNA 2EELA 3RNAC 3OWEB 3A1QA 4AS1A 1QOAA 4K1RB 1AARA 2GBRA 2KMAA 4FA6A 1Q5WB 2LVOA 4XDDA 1KF6B 3X23A 4YL8A 5TSSA 1WM3A 2XK5A 3VHTC 4JPSA 1GG3A 1XCQL 2A5UA 3ZKJC 3EFCA 5D3DA 2K8CA 4ZOHC 1RAXA 2ONQA 4G50A 1QT9A 3P63A 2L76A 4B95A 3CSTA 3P2BA 1N62A 3AE3B 3KVFB 3PLUA 2DX5B 1C4AA 2LGXA 3NS8A 4E3CA 2BBCA 2BYEA 1VLBA 4RGNA 5BYRA 4FULA 3HIZA 1S3SG 1TKEA 1VZ7A 2BW2A 1KM7A 1L0YB 3FAHA 2M0XA 1V2YA 1F9JA 1KH0A 4X57B 2KVRA 2AYOB 3AEDB 2JRIB 1GPXA 3RD2A 3VR9B 1A70A 1Y8RC 4KX6B 1LO5D 3QHTA 4IUMB 3V61A 4MELA 5LNK1 1WI0A 4JIOU 3HM6X 4RCOA 2IO0B 4F7ZA 4EZLA 4NAWA 3RNGC 2C7HA 4JWSC 4P6VF 1GUAB 1FXIA 4RMAA 1E8WA 3JSVA 2C5LC 2WXGA 3DHGC 2J4XA 1D5ZC 4FJVB 3AB5A 4IDIA 4W9CA 3RN9C 1FNUA 2PVGC 1VCBA 1YJ1A 2BGFA 3L54A 3U7DA 4D2KA 4N59A 1WGHA 1T0RC 2INPE 2WXFA 4WWOA 2ZW1A 4FJYA 1TZOA 2BF8B 3EFUA 2L0FA 2Z0EB 2WXJA 4JLCA 3MC8A 2JUOA 1WRIA 2D3CA 3AECB 1C9FA 1TKGA 1YJIA 2CJOA 4OZAA 2UU7A 3W1SC 5IAAC 2JQRB 3AU5A 1P98A 4DWFA 2KJRA 3APFA 2O6VD 1F2RI 4RM9A 3QC8B 3BVGA 4CQNA 1JWAD 5EE1A 1K51A 3LYYA 3ZXVA 1EM7A 2WDQB 2KNBA 3E9SA 1C78A 4XX5A 3JSVB 2FUHB 3PRPB 4JE3B 2W9NA 3H7PB 4E71A 2QIEB 3O65B 3V62A 2MLBA 1JRPA 1I4XA 2KQSA 1OEYA 4MJSB 2NPTA 3R66C 2Z8LA 4TSSA 3PTFC 3ZQ4A 2L7RA 3ECIA 1A5RA 3IXSA 4CO7A 5LXHA 4JQWC 4MEMA 2MQJA 3ZJUA 5C2TB 2KJHB 1MPEA 3DQVA 1V1OA 4TQ0A 2NVUI 5BO4B 2N9LA 2C7MB 3A4RA 2NTTA 3R7RA 5IKCM 3BZDB 1FFVA 3HM3A 5C3JB 1C77A 3ZDTA 3VTWA 4US9A 2MW5A 3ZNHB 4L23A 1EUVB 2GOWA 1LXDA 4A6QA 1CZPA 3PZ8A 3N30A 2LHDA 4ZRIA 2HE7A 2KOXA 4GDLA 5IP4D 3BY4B 5AUIA 4LNKA 3EA6A 2XBBC 1T0SC 2JWZA 4HDOA 5E6NA 2KQ4X 4XZ4A 2J0MA 4AUQC 1JWSD 2DZIA 4YSXB 3PGEA 5MPOA 2WXQA 1WX7A 1OQYA 4LLGM 2KHWB 3D32A 4PS8A 2LASA 3AE4B 3GP7A 3UQAA 1FCCC 5I4DA 2Y3AA 1J0GA 1TTNA 2PE6B 2K25A 1RFKA 2KJ6A 2MRPA 1P3QU 2QC8A 4M8MA 5AUKA 1MJDA 2AQ1B 4XWWA 1FXTB 5GMVA 3KYCD 4AJYB 4OVUA 4KGRA 2NPTB 1R4MI 3W5UB 2D11A 4WWNA 4URKA 4REZA 1IBXB 1I4HA 4NJ7A 1B9RA 1L6VA 1RWSA 3Q8FA 3PLVA 1R4MB 1HXYD 4W9GA 3DBHB 2MBBB 3AEGB 2BTEA 2NBUA 1MHHE 3E56A 1EU3A 2RSUA 3N32A 2WXMA 2NBWB 3PREA 4MGKE 2CR5A 1WXAA 3NJTA 2L83A 1L2NA 3L0WB 3R3MA 2RD0A 3RFZB 2KTFA 1I42A 3Q3OC 3LXFA 1QOFA 4A9AA 1J8CA 4DXFA 2DZMA 3KLSX 2WDTB 2HTHA 3QAQA 3DHHC 2RGFA 2KX3A 1IGDA 2R61A 4W9EA 2KDIA 2KDFB 3IAS1 3VUWA 2N9KA 5E6JA 2WX0A 3HRDD 4PT5A 4KVGB 2CHXA 1I4GA 1M94A 3LJ3A 1FXAA 3NHEB 2CU1A 2KO3A 4ARCA 2DYMA 2K22A 2J52A 2QILA 2IY1B 4WURA 1DGJA 1KTKA 4HLEA 2W55A 1JWBD 2MJ3A 3AE7B 1YNTE 4FHKA 3RYTA 4I6PA 5G2NA 2INDC 3RPFC 2RMMA 4ZYSA 4NPNA 2KWCA 3SEBA 1WR6E 1MHXA 1F52A 1XLPA 3U2SC 2MHJA 2MSED 1OFFA 2DAJA 2WYQA 2BT6A 1VJKA 1KRHA 2LD9A 5JHAA 1V1PA 3CSFA 4FBJB 1WYGA 3KWVA 5EE0A 1DOIA 5IO9A 1FMAD 3GOEA 2XK5B 1YX6B 2AQ2B 1WGDA 2W3RA 1SGHA 1XQQA 5KHQA 2JWUA 2ICIA 2OJWA 3B08A 1E7UA 3W1YA 4HJGE 2MH7A 3VRAB 2BVCA 3VQIA 2BYFA 2WDVB 5TR5A 4M02A 4BKGA 1H4RA 2OEDA 3NS1A 1XLQA 2Z0DB 1R4NB 4ITKA 4TMAB 3AE5B 3AEBB 2WU5B 5BYSA 1ZXHA 4GDKA 1FRRA 1ZGUB 2O2VB 2TSSA 2GRIA 2NMQA 3EC8A 1HE8A 4HEA1 5AZHA 2M17A 3PV1A 2C60A 4B0MA 2OOBB 2BKRB 3OLMD 3BK1A 4TQ1A 2I38A 1WGGA 2YEPF 1BMLC 3NZ3A 3QARA 2KN4A 4M01A 4MGYE 4OZCA 1NYQA 1CK1A 2KXJA 3WALA 3ABVB 3KUZA 1AYFA 2DLBA 3AEFB 4GN1A 3MHSD 3DBRB 5CHFA 3R8BA 2GLSA 4RGMA 1V49A 1JQ4A 1GC6A 5BMIA 3B9JA 4M00A 1VDVA 3PZDA 3H1UA 2EKEC 2N7JA 5EE3A 1I35A 4WAFA 1PQSA 1UNSA 4ANXA 3M95A 1RLFA 3AH7A 2KX0A 1UZXB 4GGQA 5JXVA 2NBVB 1E7PB 1N5WA 3ML8A 2DHZA 2CHZA 2JF5A 2A4ZA 1OTRB 1WE6A 2KANA 3L08A 4BKTA 4HKZE 2X8XX 5FK9C 3DVNV 2DNFA 2ZCCA 3BYTB 4DHZB 2M56B 3AXCA 3Q3NC 4RGOS 2JSVX 4E74A 3TMPB 2RDHA 2O6VA 4KZCA 2PPHA 2PMVA 2G45B 3NVWA 4PYZA 2IY0B 3T3NA 2VH2A 4HJKA 1VD2A 5JZEB 2AWTA 2WU2B 4A90A 1EWYC 3VH3B 3WANA 1R4NI 1WGKA 2KWUB 3EUB2 2IBIB 2HJ8A 3ZTDA 1UWMA 3A9KA 1K50A 2BS2B 2MBQA 3ZJVA 2LJ5A 2BQQA 3NZUA 2HJ1A 4K3CA 3IBEA 1XXGA 1GB4A 2N7EA 3A4SC 5GXGB 2XNAC 2AEHA 1LQBA 1NEKB 3ETRA 1K53A 3RCZA 5CHWA 4IKGA 2X38A 4OZBA 3OG5A 2GBNA 3P4QB 3UI3A 2DENB 2NCNA 1X1MA 3TEZA 2D3BA 2LRWA 4GIVA 1PGXA 3WAPA 3AM9A 4KGSA 4LK0M 2CHWA 2I2YA 3TEYA 2OHFA 5J17A 2JYEA 2L1AA 2FBWB 3NVVA 1KLUD 3GZNI 1SIFA 4FXCA 2YVCA 4DQOC 3ZDMC 4DK5A 1DOYA 2CU3A 2ZEQA 1FRDA 1QILA 4P1BC 5E6OA 1JRUA 2JYTA 4K3BA 4IM3A 4N58A 4BZAA 1OQRA 1MG8A 3MJ5A 2VZKB 2W82A 1D4BA 4YTNB 2KVZA 1L0XB 1PDXA 3DBHI 3A9KB 1XCTL 1WJUA 2DBYA 1TY0A 1ROEA 4EEWA 4HXDA 2DZJA 2ON8A 3DBSA 4DHZE 4KGTA 3UGBB 4G0NB 2DWQA 3AE8B 1MG4A 1UH6A 3UIPB 2R2QA 3MFGA 4MGZE 2LGDA 4J3OD 2WXNA 1YN3A 3R7QA 3VAWA 2IO3B 3UQBA 3WIMA 3ZRFA 1QQRA 1P9DU 2K39A 2KFKB 1TBEA 1H8CA 4C4VB 3NVZA 1P7EA 3ZO5B 2L8JA 3BINA 5CHVC 3W9CB 3ENEA 4LJOB 3DVGY 2K6QA 3URYA 1GJZA 1EO6A 3I9V1 3PSEB 1MI0A 2PEAA 5HG2A 5DPRA 3SHQA 5HHDG 2KQ7A 1WSPA 1G6JA 1WXMA 1R7SA 2GI9A 4L1BA 2XEWA 3IT6B 1T3QA 4ACFA 3S2AA 3X0WA 5IA7A 2LVPA 1E8YA 2WS3B 1NDDA 5G55A 2PTLA 3AEEB 3DVNU 2MJEA 1SSNA 5JH5C 3PHWB 1I7HA 3I57A 2N1VA 2ZJDA 3DHIC 4FADA 2G9HD 1FCLA 2MBEA 2RR9A 4L2YA 3TEWA 4II2B 4US8A 3TIXA 2IPKD 4TUUA 1HZ5A 3VUXA 1QOGA 1ZE3D 3SR6A 3EHVA 3RZFA 1AWDA 1WXSA 4DXAB 2ZNVB 3DCGA 3ZTCA 2WXHA 3PS6A 2CS4A 3L13A 3VFKA 3ZNZB 4GXBA 4K81A 4LDTD 1DOXA 1L6UA 2RDBC 4GSWA 4LNOA 2GBMA 2MCNB 2J0KA 2N7DA 2Z59B 4LNIA 2ZNVC 3GZNB 1ZUD2 4KDLB 2MA9B 5D7GA 4XGAB 2INCC 4ARIA 1YJJA 2VH1A 5C1ZA 3Q8AA 1ISNA 1F1HA 2PW9A 2LMCA 4MH0E 2WXRA 1YN4A 2LUMA 4P7IA 3VVWB 4TV3A 3T3OA 4RF1A 3W1SA 1TY2A 3N9YC 1MFWA 5AZFA 1F77A 4R3DA 3SD5A 1D3ZA 3HK0A 4MM3A 1XT9B 5BMGA 1V9JA 2CJNA 3AE2B 3TBLD 3DWMA 4S17A 4C7YA 2MJDA 2ZPYA 4A3PA 3Q14C 4WQMA 4M0WB 3B1LX 4BOSC 3ONSA 3IHPC 2FCSA 1TJEA 5KHOA 5L83A 1N5XA 3KH0A 4UDUC 3QX1A 2KYWA 1C4CA 1IYFA 2G3QB 1SF0A 1ZPSA 3RNCC 5EDSA 3B2FA 4IWQA 4WWMA 3ZLZA 4F1SA 4DHJB 4OHJA 2AQ3B 2FUG1 2JZZA 3NG0A 1NI3A 3C8YA 1V1PB 2WP9B 1WYWB 1FNWA 1I4RA 2XN9C 3IG3A 1E8ZA 1TGZB 2WLBA 2AX5A 3KQ4A 4WH4A 1WX9A 2D07B 2K1FA 2GBJA 3L16A 1OEYJ 1ENFA 1HTOA 3J9CA 2KKCA 4PYUA 1V8CA 1C4PA 3VTVA 2MBHA 1AW7A 1FEHA 3PHXB 3RNFC 4B0EA 4AP4C 3JVZX 4I6NB 2QHOA 4S0RA 3DBLI 4RFBA 4MM3B 1JW9D 3IAM1 1WIAA 4KZ0A 1SEBD 4GDKB 3JYUA 2JU6X 3MC9A 2KZRA 3H6NA 2N9EB 1XEEA 1EU4A 3Q3FA 1VZ6A 4CYEA 4P16A 2K3UA 5CX3A 3KYDD 2LUEA 1WR1A 3VUYA 1NI2A 4EFOA 2MWSB 1N60A 4IOIE 1YQ3B 3P4SB 4EKUA 2DYBA 1PUTA 2FNJB 1T0YA 1VRAB 3AE9B 3ZJTA 2KN5A 4W9JA 3Q2AC 1CMXB 1M4VA 4MSQB 5IN7A 1C79A 4NQLB 3AE1B 4HPLB 1QZEA 3A9JA 4JWUC 3V6CB 4I6LB 1Q0WB 2YLMA 4HPMB 2QJLA 5EE9A 1SE4A 5J2RA 3JW0X 2WQYB 3AV8A 1ACCA 2G4DB 1UUPA 1KJTA 4N6EB 1E7VA 2AL6A 2WXLA 5D94A 3PT2B 1CQVA 5BMHA 3LB8C 2M19A 5T8IA 2KACA 1ZDXA 4IWOA 2EMTA 4ZRQA 3ZW3A 5JHBA 1TS3A 2WNMA 2ASQA 3OJ4B 1HA5A 3HVZA 4CHKA 2E3TA 5D6JB 1KFYB 4XWTA 4XYCA 2HD5B 1WY8A 3RZWC 1WZ0A 3PO0A 2PIAA 3VH4B 4ZRJA 3APCA 4IM2A 1FPYA 2ZCBA 3AN1A 5E6PA 2SAKA 2PE9A 4MGIE 1WGYA 4ANVA 4RH6A 4PS7A 1VR9A 3VDZA 5HKHA 1TIFA 4W9LA 1HEZE 5L95C 1IBXA 4C80A 1E9MA 1TS5A 2K8HA 1FIQA
chains in the Genus database with same CATH topology
4EUTA 2M1MA 3M62B 3DQVA 4TQ0A 4WJOA 3ML9A 2NVUI 2CHWA 2DZKA 4K7SA 1KLVA 5BO4B 2C9WB 3A4RA 2C7MB 2FCNA 2LVQA 1WM2A 5J17A 1Z5SB 3R7RA 1RRBA 3SU8X 1V80A 1LM8B 3HM3A 3GZNI 1SIFA 3ZDTA 1V81A 2LXAA 2YVCA 3VTWA 2MW5A 3ZNHB 3PPAA 1EUVB 2FIFA 4W9FA 2GOWA 1LXDA 3ZDMC 4DK5A 3MJWA 3N30A 2ZEQA 1WXVA 1OGWA 2G4SA 4ZRIA 4DBGA 2HE7A 1E5WA 2NS5A 2OJRA 2KOXA 2ZZPB 4GDLA 5E6OA 1JRUA 3CMMB 1UGMA 4IM3A 3BY4B 4ICVA 2JZ3B 1MG8A 2XBBC 3QK0A 4AOFA 2JWZA 4HDOA 2K6DB 3DDCB 5E6NA 3H7PA 2IYDB 3DBHI 3ZVVA 4XZ4A 2J0MA 4DDID 4AUQC 2FCMA 3A9KB 3KUDB 2DZIA 4GU2A 4HCNB 3PGEA 1WJUA 5LXIB 1YIWA 3T8MA 4MJSA 1WX7A 1OQYA 4OVVA 4HXDA 4EEWA 2DZJA 2KHWB 1IPGA 3D32A 3DBSA 4DHZE 4PS8A 3UGBB 2M8SA 1TZ1A 2LASA 4DHJD 2LWPA 4G0NB 4ZRKA 2REXA 4GB9A 2I1KA 3UQAA 1UH6A 3UIPB 3M63B 2D3GA 1J0GA 2R2QA 3Q3JA 4MGZE 1V5TA 2LGDA 3IVFA 4ZYNA 3QIJA 4BVUC 1TTNA 3R7QA 3VAWA 1WFYA 1P1AA 2IO3B 2PE6B 3UQBA 2K25A 3WIMA 1WX8A 2KJ6A 2MRPA 3ZRFA 1P3QU 1P9DU 1S1QB 2K39A 2KFKB 4GOCA 4HK2A 4HVBA 4M8MA 3PRMB 1BT0A 2I1JA 1TBEA 1FXTB 1J19A 5GMVA 1UELA 1H8CA 2Y5BB 4FLHA 3KYCD 3V6EB 4AJYB 3WAOA 4OVUA 3ZO5B 2L8JA 3BINA 5CHVC 5DCNA 3ENEA 3L17A 3T9LA 2NPTB 5LLIA 4LJOB 2IO2B 1R4MI 4RM8A 2D11A 3DVGY 1GNUA 1C3TA 2K6QA 1ZW7A 4WWNA 4URKA 2FCQA 2BKFA 1E90A 1U4AA 1EO6A 1GJZA 4K7WA 4EZKA 4NJ7A 3PSEB 2IZVB 5C23A 2N9XA 1P0RA 3PLVA 2D2QA 1EF5A 2PEAA 4W9GA 3CF6E 4WJNA 4ZDVA 2KFJA 2MBBB 4NY0A 3ZNID 2NBUA 5DPRA 2N4FA 2BWFA 3SHQA 2KQ7A 2KWVB 4HCPB 1L7YA 1WXMA 2RSUA 4KDIC 3N32A 2V1YA 3NOBA 3TCAA 1G6JA 1WJ6A 2JRHA 4DDGD 2NBWB 3PREA 4MGKE 5DPWA 2XEWA 2CR5A 1WXAA 4HDQA 3S2AA 1L2NA 3TJPA 3X0WA 2DYOA 5IA7A 3L0WB 2LVPA 1E8YA 3R3MA 3K9PB 2RD0A 1NDDA 2KTFA 4NNJB 5AEKB 1I42A 2BWES 3L10B 2JXXA 5G55A 2N9PC 2KC2A 3DVNU 2R2OA 1J8CA 5JH5C 4WQOB 3PHWB 2DZMA 1RFAA 2N1VA 2ZJDA 4LDTB 2WDTB 2HTHA 3QAQA 4FADA 2MBEA 1KOTA 2RGFA 4ICUA 1YD8U 2LRUA 2KX3A 2RR9A 1WF9A 3KW5B 4JGHB 4W9EA 4II2B 2KDIA 4KSLC 3I3TB 3TIXA 3H7SA 4TUUA 2KDFB 3VUWA 3DPDA 4ANWA 3VUXA 4LCDE 4IWPA 5D2MB 2WWZA 2WX0A 2GBKA 3ZIMA 3EHVA 4KVGB 2CHXA 3RZFA 1UBQA 3MTNB 3LDZE 3QQ8B 2IO1B 1M94A 3LJ3A 3ZRCA 1WXSA 3U30A 4DXAB 2ZNVB 3NHEB 2L05A 2CU1A 2KO3A 3DCGA 2DYMA 3ZTCA 3PS6A 2CS4A 2FAZA 3L13A 3VFKA 3DOWA 5DPTA 3ZNZB 4GXBA 3QWZB 4K81A 4LDTD 4FHJA 1WE7A 3VTUA 2IY1B 4B9KA 3TL5A 3A1QB 3H9DA 3NZSA 4HLEA 2D10A 4GSWA 2GBMA 2KTRB 2L0TA 4FN2A 2MCNB 4FHKA 1V6EA 2J0KA 2N1WA 4GMVA 2N7DA 3OJ3A 3RYTA 2Z59B 4I6PA 2ZNVC 5G2NA 4KDLB 3AI5A 1GC7A 2MA9B 2V4LA 2KDEB 4NQKE 5D7GA 3C0RB 4WJPA 4NPNA 3ZNGC 2KWCA 3B0AA 1WR6E 1NBFC 4HWIB 2O2VA 2KMCA 1WZ3A 2MSED 2DAJA 3UINB 5C1ZA 4WJQA 2LGYA 1ISNA 2MP2B 3QJZA 2WYQA 2UYZB 4MH0E 4BBNF 1WGRA 2LD9A 3EECA 2K8BA 5JHAA 3WA0A 2J7QB 4K7UA 3CSFA 4BKSD 1WMHB 4P7IA 3VVWB 4TV3A 3K9OB 1IP9A 4FBJB 2JT4B 3W1SA 4M8NA 3IFWB 4MDKE 2KD0A 3GOEA 4KIKA 2LZ6A 2MBOA 5AZFA 2XK5B 4EZJA 1YX6B 3SD5A 3ZUNA 3A33B 1D3ZA 3VXWA 1WGDA 3HK0A 3WAMA 4MM3A 4WWPA 1XT9B 1SGHA 2C7NB 1WH3A 4N9F4 1V9JA 1XQQA 5KHQA 1UBIA 3TBLD 1Q1OA 3B08A 3N3KB 2EMSA 1E7UA 3KUCB 3W1YA 3ALBA 3QA8A 4FJZA 4G11A 2ZPYA 3VQIA 2BYFA 5TR5A 4A3PA 4A3OA 4M0WB 3B1LX 2FIDA 4BKGA 4ANUA 4BOSC 3ONSA 4XC2A 1H4RA 3IHPC 3RULA 2M4NA 2FCSA 5KHOA 2L00B 5L83A 3KH0A 4IC7B 3PRZA 2Z0DB 4IM0A 2KTRA 3QX1A 3SDLC 4BBNC 4EOYA 4BFRA 1IYFA 2G3QB 5CTRC 4F8CB 4GDKA 2KDBA 1XD3B 2UWQA 1ZGUB 4A20A 2JVCA 5EDSA 2O2VB 4IWQA 3ZLZA 2GMIC 4F1SA 1V86A 4DHJB 4WAAA 3EC8A 2JY6A 1HE8A 2PJHA 4J6IA 4KSKC 4TKNA 2BPSA 2AL3A 2BYVE 5AZHA 2M17A 2JPHA 2JZZA 3A1QA 3PV1A 2C60A 4NAWB 4K1RB 1Z2MA 2VRRB 1AARA 1WYWB 2GBRA 2OOBB 3RT3B 2BKRB 3OLMD 2KMAA 4FA6A 1Q5WB 4TQ1A 2LVOA 1WGGA 2LI5A 4II3B 3X23A 3IG3A 2KK8A 3QARA 1E8ZA 1TGZB 4YL8A 4B6WA 1WM3A 2XK5A 3VHTC 1EF1A 1GG3A 2CKHB 4MGYE 3WALA 2KXJA 2A5UA 1WX9A 3KUZA 3ZKJC 2D07B 2K1FA 2GBJA 2K8CA 1RAXA 4GN1A 4G50A 2L76A 3L16A 3MHSD 1OEYJ 4B95A 1WRDB 5CHFA 2KKCA 3CSTA 3A9JB 3P2BA 4PYUA 1LFDA 5DPSA 3KVFB 3PLUA 3VTVA 2DX5B 3RUIB 1V49A 2MBHA 1GC6A 4NJ6A 2LGXA 3NS8A 2KC1A 2NR2A 4E3CA 3PHXB 2BYEA 4AP4C 1YQBA 3JVZX 4I6NB 2QHOA 3DBLI 3PZDA 4FULA 3H1UA 1S3SG 3HIZA 4JL9A 2EKEC 1KM7A 2L3ZA 2M0XA 1V2YA 1I35A 1F9JA 1PQSA 2MX2A 4X57B 2KVRA 2AYOB 2JRIB 1WIAA 3UIOB 4ANXA 3M95A 4KZ0A 3RD2A 4GDKB 3JYUA 1Y8RC 1RLFA 3M3JA 2KZRA 3H6NA 2KX0A 2N9EB 3QHTA 4IUMB 3V61A 3Q3FA 4MELA 4CYEA 1UZXB 1WI0A 4GGQA 4W9HA 4JIOU 2NBVB 3UF8A 3ML8A 3HM6X 2DHZA 2IO0B 2J0JA 4AJWA 2CHZA 5CX3A 3KYDD 4F7ZA 2B3AA 1K8RB 4NAWA 4EZLA 2LUEA 1WR1A 2JF5A 2A4ZA 2C7HA 4PS3A 3VUYA 1NI2A 1OTRB 1GUAB 1WE6A 2KANA 4RMAA 4EFOA 1E8WA 2MWSB 3L08A 3JSVA 2C5LC 4BKTA 2RPQA 1WJ4A 2KLGA 4EKUA 2DYBA 2WX1A 2FNJB 4FJVB 3DVNV 1T0YA 4W9DA 4W9CA 2ZCCA 5J18A 4DHZB 1VCBA 2KN5A 3AXCA 4BOZB 1YJ1A 3NY5A 4W9JA 1SE9A 2BGFA 3L54A 3U7DA 1UD7A 1CMXB 1WGHA 4E74A 4MSQB 3TMPB 4NQLB 4WWOA 4G3XB 3APDA 4HPLB 2O6VA 4KZCA 2PPHA 4FJYA 1QZEA 2BF8B 3A9JA 3EFUA 2L0FA 2Z0EB 4MSMB 2G45B 4JLCA 2DAFA 3U8ZA 3V6CB 2JUOA 4PYZA 2IY0B 4I6LB 1Q0WB 2YLMA 3QCAA 4HPMB 4HJKA 1VD2A 5JZEB 4BKSA 2AWTA 3OAWA 4LJPB 3W1SC 5J2RA 4IW0A 5AZGA 5IAAC 3JW0X 1E8XA 1YX5B 2ZVOA 3AU5A 2G4DB 3V60A 3DBRI 1KJTA 3VH3B 4W9KA 3WANA 1P98A 2ZPNA 1E7VA 1R4NI 2KWUB 2AL6A 2IBIB 2KJRA 2V3SA 4DWFA 3APFA 2HJ8A 5D94A 3ZTDA 2O6VD 3A9KA 3PT2B 4RM9A 3QC8B 2MP2A 2MBQA 2LJ5A 4W9IA 3NZUA 1V5OA 4IWOA 3IBEA 3HHMA 2EMTA 3ZW3A 5JHBA 1WMHA 2ZVNA 2KNBA 2ASQA 3OJ4B 4XX5A 3JSVB 4CHKA 2N7EA 3A4SC 4GDLB 2AEHA 1LQBA 5D6JB 2FUHB 2HD5B 1WY8A 3PRPB 1WJNA 1WZ0A 3RZWC 2W9NA 4KIKB 3RCZA 2KFKA 3H7PB 5FR6A 3VH4B 4ZRJA 4E71A 3O65B 5CHWA 3V62A 2MLBA 3APCA 4IM2A 3PVLA 1C1YB 2GBNA 2ZCBA 5E6PA 2KQSA 1OEYA 2PE9A 4MJSB 4MGIE 1WGYA 4ANVA 2O6VB 2DENB 4PS7A 3DVGX 4AWJA 2NPTA 2NCNA 3R66C 1X1MA 3VDZA 4KV2A 3PTFC 5HKHA 2L7RA 3ECIA 1A5RA 3AU4A 4W9LA 2LRWA 4GIVA 4CO7A 5L95C 5LXHA 4JQWC 2KLCA 2MQJA 4MEMA 2LXCA 4ASWC 1ZKHA 4IG7B 2K8HA 3WAPA 3AULA 2KJHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EUT A;  2M1M A;  3M62 B;  3DQV A;  4TQ0 A;  4WJO A;  3ML9 A;  2NVU I;  2CHW A;  2DZK A;  4K7S A;  1KLV A;  5BO4 B;  2C9W B;  3A4R A;  2C7M B;  2FCN A;  2LVQ A;  1WM2 A;  5J17 A;  1Z5S B;  3R7R A;  1RRB A;  3SU8 X;  1V80 A;  1LM8 B;  3HM3 A;  3GZN I;  1SIF A;  3ZDT A;  1V81 A;  2LXA A;  2YVC A;  3VTW A;  2MW5 A;  3ZNH B;  3PPA A;  1EUV B;  2FIF A;  4W9F A;  2GOW A;  1LXD A;  3ZDM C;  4DK5 A;  3MJW A;  3N30 A;  2ZEQ A;  1WXV A;  1OGW A;  2G4S A;  4ZRI A;  4DBG A;  2HE7 A;  1E5W A;  2NS5 A;  2OJR A;  2KOX A;  2ZZP B;  4GDL A;  5E6O A;  1JRU A;  3CMM B;  1UGM A;  4IM3 A;  3BY4 B;  4ICV A;  2JZ3 B;  1MG8 A;  2XBB C;  3QK0 A;  4AOF A;  2JWZ A;  4HDO A;  2K6D B;  3DDC B;  5E6N A;  3H7P A;  2IYD B;  3DBH I;  3ZVV A;  4XZ4 A;  2J0M A;  4DDI D;  4AUQ C;  2FCM A;  3A9K B;  3KUD B;  2DZI A;  4GU2 A;  4HCN B;  3PGE A;  1WJU A;  5LXI B;  1YIW A;  3T8M A;  4MJS A;  1WX7 A;  1OQY A;  4OVV A;  4HXD A;  4EEW A;  2DZJ A;  2KHW B;  1IPG A;  3D32 A;  3DBS A;  4DHZ E;  4PS8 A;  3UGB B;  2M8S A;  1TZ1 A;  2LAS A;  4DHJ D;  2LWP A;  4G0N B;  4ZRK A;  2REX A;  4GB9 A;  2I1K A;  3UQA A;  1UH6 A;  3UIP B;  3M63 B;  2D3G A;  1J0G A;  2R2Q A;  3Q3J A;  4MGZ E;  1V5T A;  2LGD A;  3IVF A;  4ZYN A;  3QIJ A;  4BVU C;  1TTN A;  3R7Q A;  3VAW A;  1WFY A;  1P1A A;  2IO3 B;  2PE6 B;  3UQB A;  2K25 A;  3WIM A;  1WX8 A;  2KJ6 A;  2MRP A;  3ZRF A;  1P3Q U;  1P9D U;  1S1Q B;  2K39 A;  2KFK B;  4GOC A;  4HK2 A;  4HVB A;  4M8M A;  3PRM B;  1BT0 A;  2I1J A;  1TBE A;  1FXT B;  1J19 A;  5GMV A;  1UEL A;  1H8C A;  2Y5B B;  4FLH A;  3KYC D;  3V6E B;  4AJY B;  3WAO A;  4OVU A;  3ZO5 B;  2L8J A;  3BIN A;  5CHV C;  5DCN A;  3ENE A;  3L17 A;  3T9L A;  2NPT B;  5LLI A;  4LJO B;  2IO2 B;  1R4M I;  4RM8 A;  2D11 A;  3DVG Y;  1GNU A;  1C3T A;  2K6Q A;  1ZW7 A;  4WWN A;  4URK A;  2FCQ A;  2BKF A;  1E90 A;  1U4A A;  1EO6 A;  1GJZ A;  4K7W A;  4EZK A;  4NJ7 A;  3PSE B;  2IZV B;  5C23 A;  2N9X A;  1P0R A;  3PLV A;  2D2Q A;  1EF5 A;  2PEA A;  4W9G A;  3CF6 E;  4WJN A;  4ZDV A;  2KFJ A;  2MBB B;  4NY0 A;  3ZNI D;  2NBU A;  5DPR A;  2N4F A;  2BWF A;  3SHQ A;  2KQ7 A;  2KWV B;  4HCP B;  1L7Y A;  1WXM A;  2RSU A;  4KDI C;  3N32 A;  2V1Y A;  3NOB A;  3TCA A;  1G6J A;  1WJ6 A;  2JRH A;  4DDG D;  2NBW B;  3PRE A;  4MGK E;  5DPW A;  2XEW A;  2CR5 A;  1WXA A;  4HDQ A;  3S2A A;  1L2N A;  3TJP A;  3X0W A;  2DYO A;  5IA7 A;  3L0W B;  2LVP A;  1E8Y A;  3R3M A;  3K9P B;  2RD0 A;  1NDD A;  2KTF A;  4NNJ B;  5AEK B;  1I42 A;  2BWE S;  3L10 B;  2JXX A;  5G55 A;  2N9P C;  2KC2 A;  3DVN U;  2R2O A;  1J8C A;  5JH5 C;  4WQO B;  3PHW B;  2DZM A;  1RFA A;  2N1V A;  2ZJD A;  4LDT B;  2WDT B;  2HTH A;  3QAQ A;  4FAD A;  2MBE A;  1KOT A;  2RGF A;  4ICU A;  1YD8 U;  2LRU A;  2KX3 A;  2RR9 A;  1WF9 A;  3KW5 B;  4JGH B;  4W9E A;  4II2 B;  2KDI A;  4KSL C;  3I3T B;  3TIX A;  3H7S A;  4TUU A;  2KDF B;  3VUW A;  3DPD A;  4ANW A;  3VUX A;  4LCD E;  4IWP A;  5D2M B;  2WWZ A;  2WX0 A;  2GBK A;  3ZIM A;  3EHV A;  4KVG B;  2CHX A;  3RZF A;  1UBQ A;  3MTN B;  3LDZ E;  3QQ8 B;  2IO1 B;  1M94 A;  3LJ3 A;  3ZRC A;  1WXS A;  3U30 A;  4DXA B;  2ZNV B;  3NHE B;  2L05 A;  2CU1 A;  2KO3 A;  3DCG A;  2DYM A;  3ZTC A;  3PS6 A;  2CS4 A;  2FAZ A;  3L13 A;  3VFK A;  3DOW A;  5DPT A;  3ZNZ B;  4GXB A;  3QWZ B;  4K81 A;  4LDT D;  4FHJ A;  1WE7 A;  3VTU A;  2IY1 B;  4B9K A;  3TL5 A;  3A1Q B;  3H9D A;  3NZS A;  4HLE A;  2D10 A;  4GSW A;  2GBM A;  2KTR B;  2L0T A;  4FN2 A;  2MCN B;  4FHK A;  1V6E A;  2J0K A;  2N1W A;  4GMV A;  2N7D A;  3OJ3 A;  3RYT A;  2Z59 B;  4I6P A;  2ZNV C;  5G2N A;  4KDL B;  3AI5 A;  1GC7 A;  2MA9 B;  2V4L A;  2KDE B;  4NQK E;  5D7G A;  3C0R B;  4WJP A;  4NPN A;  3ZNG C;  2KWC A;  3B0A A;  1WR6 E;  1NBF C;  4HWI B;  2O2V A;  2KMC A;  1WZ3 A;  2MSE D;  2DAJ A;  3UIN B;  5C1Z A;  4WJQ A;  2LGY A;  1ISN A;  2MP2 B;  3QJZ A;  2WYQ A;  2UYZ B;  4MH0 E;  4BBN F;  1WGR A;  2LD9 A;  3EEC A;  2K8B A;  5JHA A;  3WA0 A;  2J7Q B;  4K7U A;  3CSF A;  4BKS D;  1WMH B;  4P7I A;  3VVW B;  4TV3 A;  3K9O B;  1IP9 A;  4FBJ B;  2JT4 B;  3W1S A;  4M8N A;  3IFW B;  4MDK E;  2KD0 A;  3GOE A;  4KIK A;  2LZ6 A;  2MBO A;  5AZF A;  2XK5 B;  4EZJ A;  1YX6 B;  3SD5 A;  3ZUN A;  3A33 B;  1D3Z A;  3VXW A;  1WGD A;  3HK0 A;  3WAM A;  4MM3 A;  4WWP A;  1XT9 B;  1SGH A;  2C7N B;  1WH3 A;  4N9F 4;  1V9J A;  1XQQ A;  5KHQ A;  1UBI A;  3TBL D;  1Q1O A;  3B08 A;  3N3K B;  2EMS A;  1E7U A;  3KUC B;  3W1Y A;  3ALB A;  3QA8 A;  4FJZ A;  4G11 A;  2ZPY A;  3VQI A;  2BYF A;  5TR5 A;  4A3P A;  4A3O A;  4M0W B;  3B1L X;  2FID A;  4BKG A;  4ANU A;  4BOS C;  3ONS A;  4XC2 A;  1H4R A;  3IHP C;  3RUL A;  2M4N A;  2FCS A;  5KHO A;  2L00 B;  5L83 A;  3KH0 A;  4IC7 B;  3PRZ A;  2Z0D B;  4IM0 A;  2KTR A;  3QX1 A;  3SDL C;  4BBN C;  4EOY A;  4BFR A;  1IYF A;  2G3Q B;  5CTR C;  4F8C B;  4GDK A;  2KDB A;  1XD3 B;  2UWQ A;  1ZGU B;  4A20 A;  2JVC A;  5EDS A;  2O2V B;  4IWQ A;  3ZLZ A;  2GMI C;  4F1S A;  1V86 A;  4DHJ B;  4WAA A;  3EC8 A;  2JY6 A;  1HE8 A;  2PJH A;  4J6I A;  4KSK C;  4TKN A;  2BPS A;  2AL3 A;  2BYV E;  5AZH A;  2M17 A;  2JPH A;  2JZZ A;  3A1Q A;  3PV1 A;  2C60 A;  4NAW B;  4K1R B;  1Z2M A;  2VRR B;  1AAR A;  1WYW B;  2GBR A;  2OOB B;  3RT3 B;  2BKR B;  3OLM D;  2KMA A;  4FA6 A;  1Q5W B;  4TQ1 A;  2LVO A;  1WGG A;  2LI5 A;  4II3 B;  3X23 A;  3IG3 A;  2KK8 A;  3QAR A;  1E8Z A;  1TGZ B;  4YL8 A;  4B6W A;  1WM3 A;  2XK5 A;  3VHT C;  1EF1 A;  1GG3 A;  2CKH B;  4MGY E;  3WAL A;  2KXJ A;  2A5U A;  1WX9 A;  3KUZ A;  3ZKJ C;  2D07 B;  2K1F A;  2GBJ A;  2K8C A;  1RAX A;  4GN1 A;  4G50 A;  2L76 A;  3L16 A;  3MHS D;  1OEY J;  4B95 A;  1WRD B;  5CHF A;  2KKC A;  3CST A;  3A9J B;  3P2B A;  4PYU A;  1LFD A;  5DPS A;  3KVF B;  3PLU A;  3VTV A;  2DX5 B;  3RUI B;  1V49 A;  2MBH A;  1GC6 A;  4NJ6 A;  2LGX A;  3NS8 A;  2KC1 A;  2NR2 A;  4E3C A;  3PHX B;  2BYE A;  4AP4 C;  1YQB A;  3JVZ X;  4I6N B;  2QHO A;  3DBL I;  3PZD A;  4FUL A;  3H1U A;  1S3S G;  3HIZ A;  4JL9 A;  2EKE C;  1KM7 A;  2L3Z A;  2M0X A;  1V2Y A;  1I35 A;  1F9J A;  1PQS A;  2MX2 A;  4X57 B;  2KVR A;  2AYO B;  2JRI B;  1WIA A;  3UIO B;  4ANX A;  3M95 A;  4KZ0 A;  3RD2 A;  4GDK B;  3JYU A;  1Y8R C;  1RLF A;  3M3J A;  2KZR A;  3H6N A;  2KX0 A;  2N9E B;  3QHT A;  4IUM B;  3V61 A;  3Q3F A;  4MEL A;  4CYE A;  1UZX B;  1WI0 A;  4GGQ A;  4W9H A;  4JIO U;  2NBV B;  3UF8 A;  3ML8 A;  3HM6 X;  2DHZ A;  2IO0 B;  2J0J A;  4AJW A;  2CHZ A;  5CX3 A;  3KYD D;  4F7Z A;  2B3A A;  1K8R B;  4NAW A;  4EZL A;  2LUE A;  1WR1 A;  2JF5 A;  2A4Z A;  2C7H A;  4PS3 A;  3VUY A;  1NI2 A;  1OTR B;  1GUA B;  1WE6 A;  2KAN A;  4RMA A;  4EFO A;  1E8W A;  2MWS B;  3L08 A;  3JSV A;  2C5L C;  4BKT A;  2RPQ A;  1WJ4 A;  2KLG A;  4EKU A;  2DYB A;  2WX1 A;  2FNJ B;  4FJV B;  3DVN V;  1T0Y A;  4W9D A;  4W9C A;  2ZCC A;  5J18 A;  4DHZ B;  1VCB A;  2KN5 A;  3AXC A;  4BOZ B;  1YJ1 A;  3NY5 A;  4W9J A;  1SE9 A;  2BGF A;  3L54 A;  3U7D A;  1UD7 A;  1CMX B;  1WGH A;  4E74 A;  4MSQ B;  3TMP B;  4NQL B;  4WWO A;  4G3X B;  3APD A;  4HPL B;  2O6V A;  4KZC A;  2PPH A;  4FJY A;  1QZE A;  2BF8 B;  3A9J A;  3EFU A;  2L0F A;  2Z0E B;  4MSM B;  2G45 B;  4JLC A;  2DAF A;  3U8Z A;  3V6C B;  2JUO A;  4PYZ A;  2IY0 B;  4I6L B;  1Q0W B;  2YLM A;  3QCA A;  4HPM B;  4HJK A;  1VD2 A;  5JZE B;  4BKS A;  2AWT A;  3OAW A;  4LJP B;  3W1S C;  5J2R A;  4IW0 A;  5AZG A;  5IAA C;  3JW0 X;  1E8X A;  1YX5 B;  2ZVO A;  3AU5 A;  2G4D B;  3V60 A;  3DBR I;  1KJT A;  3VH3 B;  4W9K A;  3WAN A;  1P98 A;  2ZPN A;  1E7V A;  1R4N I;  2KWU B;  2AL6 A;  2IBI B;  2KJR A;  2V3S A;  4DWF A;  3APF A;  2HJ8 A;  5D94 A;  3ZTD A;  2O6V D;  3A9K A;  3PT2 B;  4RM9 A;  3QC8 B;  2MP2 A;  2MBQ A;  2LJ5 A;  4W9I A;  3NZU A;  1V5O A;  4IWO A;  3IBE A;  3HHM A;  2EMT A;  3ZW3 A;  5JHB A;  1WMH A;  2ZVN A;  2KNB A;  2ASQ A;  3OJ4 B;  4XX5 A;  3JSV B;  4CHK A;  2N7E A;  3A4S C;  4GDL B;  2AEH A;  1LQB A;  5D6J B;  2FUH B;  2HD5 B;  1WY8 A;  3PRP B;  1WJN A;  1WZ0 A;  3RZW C;  2W9N A;  4KIK B;  3RCZ A;  2KFK A;  3H7P B;  5FR6 A;  3VH4 B;  4ZRJ A;  4E71 A;  3O65 B;  5CHW A;  3V62 A;  2MLB A;  3APC A;  4IM2 A;  3PVL A;  1C1Y B;  2GBN A;  2ZCB A;  5E6P A;  2KQS A;  1OEY A;  2PE9 A;  4MJS B;  4MGI E;  1WGY A;  4ANV A;  2O6V B;  2DEN B;  4PS7 A;  3DVG X;  4AWJ A;  2NPT A;  2NCN A;  3R66 C;  1X1M A;  3VDZ A;  4KV2 A;  3PTF C;  5HKH A;  2L7R A;  3ECI A;  1A5R A;  3AU4 A;  4W9L A;  2LRW A;  4GIV A;  4CO7 A;  5L95 C;  5LXH A;  4JQW C;  2KLC A;  2MQJ A;  4MEM A;  2LXC A;  4ASW C;  1ZKH A;  4IG7 B;  2K8H A;  3WAP A;  3AUL A;  2KJH B; 
#chains in the Genus database with same CATH topology
 3ZYY X;  3FIL B;  2DZK A;  4K7S A;  2QCZ A;  2LVQ A;  3DBL B;  1Z5S B;  1RRB A;  4HRO A;  4C4V A;  3BVM A;  5H8Y E;  3N20 C;  3PPA A;  3MJW A;  1QOB A;  1TKY A;  2G4S A;  3DWG C;  1E5W A;  2OJR A;  3CMM B;  1UGM A;  4ICV A;  2K0P A;  3Q69 A;  1HZ6 A;  1J7B A;  2JX5 A;  3QK0 A;  2K6D B;  3DDC B;  3H7P A;  4ZHO A;  3FC4 A;  4MH8 A;  4DDI D;  2FCM A;  4C7Z A;  4HCN B;  3SFD B;  2LHE A;  1YIW A;  1LGR A;  4MJS A;  3I63 C;  3W2D A;  1L4Z B;  2M8S A;  1BUI C;  1E6E B;  2D3G A;  3P4R B;  3IVF A;  3QIJ A;  4BVU C;  1WX8 A;  1TS4 A;  1GOZ A;  1S1Q B;  4BAX A;  4HK2 A;  2WXP A;  1SJE D;  3PRM B;  1BT0 A;  2I1J A;  1J19 A;  3V6E B;  4FLH A;  1JAL A;  2JZP A;  3L17 A;  3T9L A;  5LLI A;  2IO2 B;  1C3T A;  4RM8 A;  3GB1 A;  2BKF A;  4H2A A;  3PZ7 A;  5C23 A;  2N9X A;  1P0R A;  3TUO A;  1L5P A;  4C56 C;  3CF6 E;  4WJN A;  4NY0 A;  5H92 C;  3ZNI D;  2N4F A;  2BWF A;  3ZXR A;  4HKQ A;  1B1Z A;  1L7Y A;  1PYW D;  2HDE A;  4KDI C;  2M0A A;  2HTM E;  4DDG D;  3TJP A;  4LTU A;  1ET6 A;  1T5X D;  2D5G A;  3K9P B;  1WWT A;  4EE2 A;  3SFE B;  5AEK B;  2R2O A;  3VRB B;  4WQO B;  4ICU A;  1JML A;  2LRU A;  1WF9 A;  4JGH B;  4KSL C;  4NZL B;  3DPD A;  4ANW A;  4LCD E;  4IWP A;  2WWZ A;  3U7Z A;  3ZIM A;  1ZOY B;  1UBQ A;  3QQ8 B;  4YTP B;  3U4E G;  3GS2 A;  2L32 A;  2IGH A;  2FAZ A;  3DOW A;  4RNA A;  1SB3 C;  4OW0 A;  4B9K A;  3TL5 A;  2BYT A;  1P7F A;  3A1Q B;  3H9D A;  3NZS A;  2KTR B;  4FN2 A;  2K9X A;  3N1Z C;  1V6E A;  2N1W A;  1YQ4 B;  1JCK B;  1GC7 A;  2KDE B;  4WJP A;  1EWC A;  3ZNG C;  3WCQ A;  2O2V A;  2KMC A;  1WZ3 A;  1UGJ A;  4WJQ A;  2V3N A;  4A8X C;  3BII D;  4BBN F;  2K8B A;  1UWX A;  4GLS C;  3K9O B;  3BWU D;  3Q8E A;  2V4I B;  4LNF A;  4MDK E;  4KIK A;  2LZ6 A;  2MBO A;  1ESF A;  4EZJ A;  3ZUN A;  3H8H A;  3R2T A;  3WAM A;  4WWP A;  1J7A A;  2PVO D;  4N9F 4;  1F0Z A;  1UBI A;  1Q1O A;  3N3K B;  2EMS A;  3ALB A;  3QA8 A;  4FJZ A;  4G11 A;  1V97 A;  4A3O A;  2BB5 A;  4HRS A;  2KAJ A;  5BYQ A;  4XC2 A;  1I4P A;  3AE6 B;  3RUL A;  3CIR B;  2M4N A;  2L00 B;  1QLB B;  4IC7 B;  4QAY A;  4IM0 A;  4BBN C;  3TEX A;  2INN E;  2KDB A;  4RGT A;  1D6E C;  1XD3 B;  2WDR B;  4A20 A;  2JVC A;  2BS4 B;  2GMI C;  2IGD A;  1E10 A;  1V86 A;  1FD6 A;  4DXG A;  1PGB A;  2JY6 A;  2IJ0 A;  2NTS A;  1NYR A;  4J6I A;  2BPS A;  1SIJ A;  2AL3 A;  2BYV E;  2JPH A;  4NAW B;  1Z2M A;  2VRR B;  4O1N A;  1K52 A;  3RT3 B;  2WXI A;  2LI5 A;  4II3 B;  2WGS A;  2KK8 A;  2GB1 A;  4B6W A;  1XLO A;  1Y56 A;  3Q3M C;  1EF1 A;  3BK2 A;  1PFD A;  2CKH B;  5D3I B;  2KWD A;  3FKY A;  1WRD B;  2PLP A;  3A9J B;  5DPS A;  3CWI A;  1LFD A;  3RMK C;  1GAQ B;  3RUI B;  4NJ6 A;  2KC1 A;  2NR2 A;  1JRO A;  3HUI A;  4AQ7 A;  4NAM A;  1YQB A;  1TS2 A;  2LGS A;  4JL9 A;  2L3Z A;  3Q8B A;  2LJI A;  2MX2 A;  1D5M C;  1MVK A;  3UIO B;  1N61 A;  3M3J A;  1FFU A;  1T0Q C;  3AMZ A;  2WXK A;  3NUH B;  1E0Z A;  1JWM D;  4W9H A;  3UF8 A;  2J42 A;  2J0J A;  4HPP A;  2LEK A;  4AJW A;  3RNE C;  2B3A A;  1K8R B;  4PK1 A;  4PS3 A;  4YTM B;  1Q10 A;  2RPQ A;  3KWL A;  1WJ4 A;  2KLG A;  2WX1 A;  4W9D A;  3P42 A;  3L4P A;  5J18 A;  4BOZ B;  1J7C A;  3NY5 A;  2WXO A;  1SE9 A;  1UD7 A;  1N63 A;  2V9H A;  4YXD B;  1FNV A;  1I4Q A;  4G3X B;  3APD A;  4MSM B;  2DAF A;  3U8Z A;  1RYJ A;  1SE2 A;  3QCA A;  1ET9 A;  3FIL A;  4BKS A;  3OAW A;  4LJP B;  4IW0 A;  5AZG A;  1E8X A;  1YX5 B;  2RPV A;  2ZVO A;  3VR8 B;  3V60 A;  1PGA A;  3DBR I;  2V0G A;  4W9K A;  2ZPN A;  2YEP B;  2V3S A;  2KMM A;  2MP2 A;  1KLG D;  3C19 A;  4W9I A;  1SBB B;  1V5O A;  3HHM A;  1QF6 A;  1WMH A;  2ZVN A;  3AEA B;  2RDG A;  4MAC A;  1FO4 A;  2G1E A;  4GDL B;  1WJN A;  4ZHP A;  4KIK B;  2KFK A;  5FR6 A;  3PVL A;  1C1Y B;  1JWU D;  2O6V B;  4AWJ A;  3DVG X;  3B2G A;  4KV2 A;  4M0W A;  3W5V B;  3MC0 B;  3AU4 A;  1TT5 B;  4YWG G;  2KLC A;  2LXC A;  4ASW C;  1ZKH A;  3BVZ A;  4IG7 B;  2BB6 A;  3AUL A;  4EUT A;  2M1M A;  3M62 B;  4LNN A;  4WJO A;  3ML9 A;  2QEJ C;  1KLV A;  1T6B X;  2C9W B;  2FCN A;  1L4D B;  1WM2 A;  3SU8 X;  1V80 A;  1LM8 B;  1V81 A;  2LXA A;  2Q5W D;  4A55 A;  2FIF A;  4W9F A;  2E6X A;  1WXV A;  1OGW A;  2W3S A;  4DBG A;  2NS5 A;  2ZZP B;  2JZ3 B;  1VZ8 A;  3I5J C;  3BYY B;  2Y5C A;  4AOF A;  3N1X C;  1STE A;  1AN8 A;  2IYD B;  1GB1 A;  3ZVV A;  3KUD B;  3RNB C;  4GU2 A;  5LXI B;  3T8M A;  4OVV A;  4RF0 A;  1C76 A;  2ACZ B;  1IPG A;  5G5G A;  3GE8 C;  1TZ1 A;  3IT4 B;  4DHJ D;  2LWP A;  4ZRK A;  1YMH E;  2REX A;  4GB9 A;  2I1K A;  3M63 B;  2D3A A;  3Q3J A;  4USA A;  1TYG B;  1V5T A;  2SEB D;  4ZYN A;  1OQQ A;  1WFY A;  1P1A A;  4YT0 B;  4GOC A;  1DYQ A;  4HVB A;  4Q2J A;  1ZXI A;  2QDF A;  1UEL A;  2Y5B B;  3WAO A;  3Q6B A;  5DCN A;  1XO3 A;  5IOI A;  1GNU A;  1ZW7 A;  2W54 A;  2FCQ A;  1E90 A;  1U4A A;  1UF0 A;  4K7W A;  4EZK A;  2IZV B;  4XDC A;  5HFY A;  1HTQ A;  2JXT A;  1BXT A;  2D2Q A;  1EF5 A;  4ZDV A;  2KFJ A;  2L52 A;  1YOV B;  2KWV B;  4HCP B;  3TCA A;  2V1Y A;  3NOB A;  3Q8C A;  1WJ6 A;  2JRH A;  5DPW A;  4HDQ A;  2DYO A;  2Y5P A;  3NRZ A;  3HVD A;  4KKJ A;  2PKO A;  4NNJ B;  2BWE S;  3L10 B;  2JXX A;  2QSD A;  2N9P C;  2KC2 A;  2V3P A;  3EGR A;  2KDM A;  1RFA A;  4JX1 C;  4LDT B;  1HQR D;  1KOT A;  1YD8 U;  2H89 B;  1FM0 D;  3KW5 B;  3I3T B;  3H7S A;  1NEN B;  2EKI A;  3ZGZ A;  5D2M B;  2B76 B;  2GBK A;  1ZP0 B;  3MTN B;  3LDZ E;  1SE3 A;  2K5P A;  2IO1 B;  4WIP A;  3ZRC A;  2BS3 B;  3U30 A;  2L05 A;  3P1M A;  2MEK A;  1YN5 A;  5DPT A;  4C00 A;  4XE0 A;  3QWZ B;  3V05 A;  4FHJ A;  1WE7 A;  3VTU A;  3NVY A;  2IDY A;  2D10 A;  2N0S B;  4P1C C;  2L0T A;  4GMV A;  4ZRP A;  3OJ3 A;  3MHZ A;  3AI5 A;  2V4L A;  4NQK E;  3C0R B;  4KKI A;  2FE8 A;  3B0A A;  1NBF C;  4HWI B;  4MT5 A;  2J53 A;  3UIN B;  1ZDV A;  2LGY A;  2MP2 B;  3QJZ A;  2UYZ B;  4NJC A;  1WGR A;  3EEC A;  1IUE A;  3TSS A;  3WA0 A;  2J7Q B;  4K7U A;  5HI1 A;  4BKS D;  1WMH B;  1IP9 A;  1CJE A;  2JT4 B;  3O13 A;  4M8N A;  3IFW B;  5FR3 A;  2LFI A;  3V3X A;  3MP9 A;  2KD0 A;  3A33 B;  1XLN A;  3VXW A;  2C7N B;  1WH3 A;  1QKZ A;  3KUC B;  1SJH D;  2QMT A;  4YSZ B;  1NVI D;  2LGI A;  1SXT A;  5FKA C;  2FID A;  1IGC A;  4OVZ A;  4ANU A;  2WHI A;  2ZW0 A;  1L0V B;  2IGG A;  3N1Y C;  2VZK D;  3PRZ A;  2KTR A;  3SDL C;  1WXQ A;  4EOY A;  1D5X C;  4BFR A;  1RM6 C;  4YSY B;  5CTR C;  4F8C B;  2H88 B;  3R2I A;  3RI7 C;  3GE3 C;  3U52 E;  2UWQ A;  3P4P B;  4WAA A;  1F2R C;  1XF5 L;  2PJH A;  2KT7 A;  1N6Z A;  5G5H A;  4KSK C;  4TKN A;  2EEL A;  3RNA C;  3OWE B;  3A1Q A;  4AS1 A;  1QOA A;  4K1R B;  1AAR A;  2GBR A;  2KMA A;  4FA6 A;  1Q5W B;  2LVO A;  4XDD A;  1KF6 B;  3X23 A;  4YL8 A;  5TSS A;  1WM3 A;  2XK5 A;  3VHT C;  4JPS A;  1GG3 A;  1XCQ L;  2A5U A;  3ZKJ C;  3EFC A;  5D3D A;  2K8C A;  4ZOH C;  1RAX A;  2ONQ A;  4G50 A;  1QT9 A;  3P63 A;  2L76 A;  4B95 A;  3CST A;  3P2B A;  1N62 A;  3AE3 B;  3KVF B;  3PLU A;  2DX5 B;  1C4A A;  2LGX A;  3NS8 A;  4E3C A;  2BBC A;  2BYE A;  1VLB A;  4RGN A;  5BYR A;  4FUL A;  3HIZ A;  1S3S G;  1TKE A;  1VZ7 A;  2BW2 A;  1KM7 A;  1L0Y B;  3FAH A;  2M0X A;  1V2Y A;  1F9J A;  1KH0 A;  4X57 B;  2KVR A;  2AYO B;  3AED B;  2JRI B;  1GPX A;  3RD2 A;  3VR9 B;  1A70 A;  1Y8R C;  4KX6 B;  1LO5 D;  3QHT A;  4IUM B;  3V61 A;  4MEL A;  5LNK 1;  1WI0 A;  4JIO U;  3HM6 X;  4RCO A;  2IO0 B;  4F7Z A;  4EZL A;  4NAW A;  3RNG C;  2C7H A;  4JWS C;  4P6V F;  1GUA B;  1FXI A;  4RMA A;  1E8W A;  3JSV A;  2C5L C;  2WXG A;  3DHG C;  2J4X A;  1D5Z C;  4FJV B;  3AB5 A;  4IDI A;  4W9C A;  3RN9 C;  1FNU A;  2PVG C;  1VCB A;  1YJ1 A;  2BGF A;  3L54 A;  3U7D A;  4D2K A;  4N59 A;  1WGH A;  1T0R C;  2INP E;  2WXF A;  4WWO A;  2ZW1 A;  4FJY A;  1TZO A;  2BF8 B;  3EFU A;  2L0F A;  2Z0E B;  2WXJ A;  4JLC A;  3MC8 A;  2JUO A;  1WRI A;  2D3C A;  3AEC B;  1C9F A;  1TKG A;  1YJI A;  2CJO A;  4OZA A;  2UU7 A;  3W1S C;  5IAA C;  2JQR B;  3AU5 A;  1P98 A;  4DWF A;  2KJR A;  3APF A;  2O6V D;  1F2R I;  4RM9 A;  3QC8 B;  3BVG A;  4CQN A;  1JWA D;  5EE1 A;  1K51 A;  3LYY A;  3ZXV A;  1EM7 A;  2WDQ B;  2KNB A;  3E9S A;  1C78 A;  4XX5 A;  3JSV B;  2FUH B;  3PRP B;  4JE3 B;  2W9N A;  3H7P B;  4E71 A;  2QIE B;  3O65 B;  3V62 A;  2MLB A;  1JRP A;  1I4X A;  2KQS A;  1OEY A;  4MJS B;  2NPT A;  3R66 C;  2Z8L A;  4TSS A;  3PTF C;  3ZQ4 A;  2L7R A;  3ECI A;  1A5R A;  3IXS A;  4CO7 A;  5LXH A;  4JQW C;  4MEM A;  2MQJ A;  3ZJU A;  5C2T B;  2KJH B;  1MPE A;  3DQV A;  1V1O A;  4TQ0 A;  2NVU I;  5BO4 B;  2N9L A;  2C7M B;  3A4R A;  2NTT A;  3R7R A;  5IKC M;  3BZD B;  1FFV A;  3HM3 A;  5C3J B;  1C77 A;  3ZDT A;  3VTW A;  4US9 A;  2MW5 A;  3ZNH B;  4L23 A;  1EUV B;  2GOW A;  1LXD A;  4A6Q A;  1CZP A;  3PZ8 A;  3N30 A;  2LHD A;  4ZRI A;  2HE7 A;  2KOX A;  4GDL A;  5IP4 D;  3BY4 B;  5AUI A;  4LNK A;  3EA6 A;  2XBB C;  1T0S C;  2JWZ A;  4HDO A;  5E6N A;  2KQ4 X;  4XZ4 A;  2J0M A;  4AUQ C;  1JWS D;  2DZI A;  4YSX B;  3PGE A;  5MPO A;  2WXQ A;  1WX7 A;  1OQY A;  4LLG M;  2KHW B;  3D32 A;  4PS8 A;  2LAS A;  3AE4 B;  3GP7 A;  3UQA A;  1FCC C;  5I4D A;  2Y3A A;  1J0G A;  1TTN A;  2PE6 B;  2K25 A;  1RFK A;  2KJ6 A;  2MRP A;  1P3Q U;  2QC8 A;  4M8M A;  5AUK A;  1MJD A;  2AQ1 B;  4XWW A;  1FXT B;  5GMV A;  3KYC D;  4AJY B;  4OVU A;  4KGR A;  2NPT B;  1R4M I;  3W5U B;  2D11 A;  4WWN A;  4URK A;  4REZ A;  1IBX B;  1I4H A;  4NJ7 A;  1B9R A;  1L6V A;  1RWS A;  3Q8F A;  3PLV A;  1R4M B;  1HXY D;  4W9G A;  3DBH B;  2MBB B;  3AEG B;  2BTE A;  2NBU A;  1MHH E;  3E56 A;  1EU3 A;  2RSU A;  3N32 A;  2WXM A;  2NBW B;  3PRE A;  4MGK E;  2CR5 A;  1WXA A;  3NJT A;  2L83 A;  1L2N A;  3L0W B;  3R3M A;  2RD0 A;  3RFZ B;  2KTF A;  1I42 A;  3Q3O C;  3LXF A;  1QOF A;  4A9A A;  1J8C A;  4DXF A;  2DZM A;  3KLS X;  2WDT B;  2HTH A;  3QAQ A;  3DHH C;  2RGF A;  2KX3 A;  1IGD A;  2R61 A;  4W9E A;  2KDI A;  2KDF B;  3IAS 1;  3VUW A;  2N9K A;  5E6J A;  2WX0 A;  3HRD D;  4PT5 A;  4KVG B;  2CHX A;  1I4G A;  1M94 A;  3LJ3 A;  1FXA A;  3NHE B;  2CU1 A;  2KO3 A;  4ARC A;  2DYM A;  2K22 A;  2J52 A;  2QIL A;  2IY1 B;  4WUR A;  1DGJ A;  1KTK A;  4HLE A;  2W55 A;  1JWB D;  2MJ3 A;  3AE7 B;  1YNT E;  4FHK A;  3RYT A;  4I6P A;  5G2N A;  2IND C;  3RPF C;  2RMM A;  4ZYS A;  4NPN A;  2KWC A;  3SEB A;  1WR6 E;  1MHX A;  1F52 A;  1XLP A;  3U2S C;  2MHJ A;  2MSE D;  1OFF A;  2DAJ A;  2WYQ A;  2BT6 A;  1VJK A;  1KRH A;  2LD9 A;  5JHA A;  1V1P A;  3CSF A;  4FBJ B;  1WYG A;  3KWV A;  5EE0 A;  1DOI A;  5IO9 A;  1FMA D;  3GOE A;  2XK5 B;  1YX6 B;  2AQ2 B;  1WGD A;  2W3R A;  1SGH A;  1XQQ A;  5KHQ A;  2JWU A;  2ICI A;  2OJW A;  3B08 A;  1E7U A;  3W1Y A;  4HJG E;  2MH7 A;  3VRA B;  2BVC A;  3VQI A;  2BYF A;  2WDV B;  5TR5 A;  4M02 A;  4BKG A;  1H4R A;  2OED A;  3NS1 A;  1XLQ A;  2Z0D B;  1R4N B;  4ITK A;  4TMA B;  3AE5 B;  3AEB B;  2WU5 B;  5BYS A;  1ZXH A;  4GDK A;  1FRR A;  1ZGU B;  2O2V B;  2TSS A;  2GRI A;  2NMQ A;  3EC8 A;  1HE8 A;  4HEA 1;  5AZH A;  2M17 A;  3PV1 A;  2C60 A;  4B0M A;  2OOB B;  2BKR B;  3OLM D;  3BK1 A;  4TQ1 A;  2I38 A;  1WGG A;  2YEP F;  1BML C;  3NZ3 A;  3QAR A;  2KN4 A;  4M01 A;  4MGY E;  4OZC A;  1NYQ A;  1CK1 A;  2KXJ A;  3WAL A;  3ABV B;  3KUZ A;  1AYF A;  2DLB A;  3AEF B;  4GN1 A;  3MHS D;  3DBR B;  5CHF A;  3R8B A;  2GLS A;  4RGM A;  1V49 A;  1JQ4 A;  1GC6 A;  5BMI A;  3B9J A;  4M00 A;  1VDV A;  3PZD A;  3H1U A;  2EKE C;  2N7J A;  5EE3 A;  1I35 A;  4WAF A;  1PQS A;  1UNS A;  4ANX A;  3M95 A;  1RLF A;  3AH7 A;  2KX0 A;  1UZX B;  4GGQ A;  5JXV A;  2NBV B;  1E7P B;  1N5W A;  3ML8 A;  2DHZ A;  2CHZ A;  2JF5 A;  2A4Z A;  1OTR B;  1WE6 A;  2KAN A;  3L08 A;  4BKT A;  4HKZ E;  2X8X X;  5FK9 C;  3DVN V;  2DNF A;  2ZCC A;  3BYT B;  4DHZ B;  2M56 B;  3AXC A;  3Q3N C;  4RGO S;  2JSV X;  4E74 A;  3TMP B;  2RDH A;  2O6V A;  4KZC A;  2PPH A;  2PMV A;  2G45 B;  3NVW A;  4PYZ A;  2IY0 B;  3T3N A;  2VH2 A;  4HJK A;  1VD2 A;  5JZE B;  2AWT A;  2WU2 B;  4A90 A;  1EWY C;  3VH3 B;  3WAN A;  1R4N I;  1WGK A;  2KWU B;  3EUB 2;  2IBI B;  2HJ8 A;  3ZTD A;  1UWM A;  3A9K A;  1K50 A;  2BS2 B;  2MBQ A;  3ZJV A;  2LJ5 A;  2BQQ A;  3NZU A;  2HJ1 A;  4K3C A;  3IBE A;  1XXG A;  1GB4 A;  2N7E A;  3A4S C;  5GXG B;  2XNA C;  2AEH A;  1LQB A;  1NEK B;  3ETR A;  1K53 A;  3RCZ A;  5CHW A;  4IKG A;  2X38 A;  4OZB A;  3OG5 A;  2GBN A;  3P4Q B;  3UI3 A;  2DEN B;  2NCN A;  1X1M A;  3TEZ A;  2D3B A;  2LRW A;  4GIV A;  1PGX A;  3WAP A;  3AM9 A;  4KGS A;  4LK0 M;  2CHW A;  2I2Y A;  3TEY A;  2OHF A;  5J17 A;  2JYE A;  2L1A A;  2FBW B;  3NVV A;  1KLU D;  3GZN I;  1SIF A;  4FXC A;  2YVC A;  4DQO C;  3ZDM C;  4DK5 A;  1DOY A;  2CU3 A;  2ZEQ A;  1FRD A;  1QIL A;  4P1B C;  5E6O A;  1JRU A;  2JYT A;  4K3B A;  4IM3 A;  4N58 A;  4BZA A;  1OQR A;  1MG8 A;  3MJ5 A;  2VZK B;  2W82 A;  1D4B A;  4YTN B;  2KVZ A;  1L0X B;  1PDX A;  3DBH I;  3A9K B;  1XCT L;  1WJU A;  2DBY A;  1TY0 A;  1ROE A;  4EEW A;  4HXD A;  2DZJ A;  2ON8 A;  3DBS A;  4DHZ E;  4KGT A;  3UGB B;  4G0N B;  2DWQ A;  3AE8 B;  1MG4 A;  1UH6 A;  3UIP B;  2R2Q A;  3MFG A;  4MGZ E;  2LGD A;  4J3O D;  2WXN A;  1YN3 A;  3R7Q A;  3VAW A;  2IO3 B;  3UQB A;  3WIM A;  3ZRF A;  1QQR A;  1P9D U;  2K39 A;  2KFK B;  1TBE A;  1H8C A;  4C4V B;  3NVZ A;  1P7E A;  3ZO5 B;  2L8J A;  3BIN A;  5CHV C;  3W9C B;  3ENE A;  4LJO B;  3DVG Y;  2K6Q A;  3URY A;  1GJZ A;  1EO6 A;  3I9V 1;  3PSE B;  1MI0 A;  2PEA A;  5HG2 A;  5DPR A;  3SHQ A;  5HHD G;  2KQ7 A;  1WSP A;  1G6J A;  1WXM A;  1R7S A;  2GI9 A;  4L1B A;  2XEW A;  3IT6 B;  1T3Q A;  4ACF A;  3S2A A;  3X0W A;  5IA7 A;  2LVP A;  1E8Y A;  2WS3 B;  1NDD A;  5G55 A;  2PTL A;  3AEE B;  3DVN U;  2MJE A;  1SSN A;  5JH5 C;  3PHW B;  1I7H A;  3I57 A;  2N1V A;  2ZJD A;  3DHI C;  4FAD A;  2G9H D;  1FCL A;  2MBE A;  2RR9 A;  4L2Y A;  3TEW A;  4II2 B;  4US8 A;  3TIX A;  2IPK D;  4TUU A;  1HZ5 A;  3VUX A;  1QOG A;  1ZE3 D;  3SR6 A;  3EHV A;  3RZF A;  1AWD A;  1WXS A;  4DXA B;  2ZNV B;  3DCG A;  3ZTC A;  2WXH A;  3PS6 A;  2CS4 A;  3L13 A;  3VFK A;  3ZNZ B;  4GXB A;  4K81 A;  4LDT D;  1DOX A;  1L6U A;  2RDB C;  4GSW A;  4LNO A;  2GBM A;  2MCN B;  2J0K A;  2N7D A;  2Z59 B;  4LNI A;  2ZNV C;  3GZN B;  1ZUD 2;  4KDL B;  2MA9 B;  5D7G A;  4XGA B;  2INC C;  4ARI A;  1YJJ A;  2VH1 A;  5C1Z A;  3Q8A A;  1ISN A;  1F1H A;  2PW9 A;  2LMC A;  4MH0 E;  2WXR A;  1YN4 A;  2LUM A;  4P7I A;  3VVW B;  4TV3 A;  3T3O A;  4RF1 A;  3W1S A;  1TY2 A;  3N9Y C;  1MFW A;  5AZF A;  1F77 A;  4R3D A;  3SD5 A;  1D3Z A;  3HK0 A;  4MM3 A;  1XT9 B;  5BMG A;  1V9J A;  2CJN A;  3AE2 B;  3TBL D;  3DWM A;  4S17 A;  4C7Y A;  2MJD A;  2ZPY A;  4A3P A;  3Q14 C;  4WQM A;  4M0W B;  3B1L X;  4BOS C;  3ONS A;  3IHP C;  2FCS A;  1TJE A;  5KHO A;  5L83 A;  1N5X A;  3KH0 A;  4UDU C;  3QX1 A;  2KYW A;  1C4C A;  1IYF A;  2G3Q B;  1SF0 A;  1ZPS A;  3RNC C;  5EDS A;  3B2F A;  4IWQ A;  4WWM A;  3ZLZ A;  4F1S A;  4DHJ B;  4OHJ A;  2AQ3 B;  2FUG 1;  2JZZ A;  3NG0 A;  1NI3 A;  3C8Y A;  1V1P B;  2WP9 B;  1WYW B;  1FNW A;  1I4R A;  2XN9 C;  3IG3 A;  1E8Z A;  1TGZ B;  2WLB A;  2AX5 A;  3KQ4 A;  4WH4 A;  1WX9 A;  2D07 B;  2K1F A;  2GBJ A;  3L16 A;  1OEY J;  1ENF A;  1HTO A;  3J9C A;  2KKC A;  4PYU A;  1V8C A;  1C4P A;  3VTV A;  2MBH A;  1AW7 A;  1FEH A;  3PHX B;  3RNF C;  4B0E A;  4AP4 C;  3JVZ X;  4I6N B;  2QHO A;  4S0R A;  3DBL I;  4RFB A;  4MM3 B;  1JW9 D;  3IAM 1;  1WIA A;  4KZ0 A;  1SEB D;  4GDK B;  3JYU A;  2JU6 X;  3MC9 A;  2KZR A;  3H6N A;  2N9E B;  1XEE A;  1EU4 A;  3Q3F A;  1VZ6 A;  4CYE A;  4P16 A;  2K3U A;  5CX3 A;  3KYD D;  2LUE A;  1WR1 A;  3VUY A;  1NI2 A;  4EFO A;  2MWS B;  1N60 A;  4IOI E;  1YQ3 B;  3P4S B;  4EKU A;  2DYB A;  1PUT A;  2FNJ B;  1T0Y A;  1VRA B;  3AE9 B;  3ZJT A;  2KN5 A;  4W9J A;  3Q2A C;  1CMX B;  1M4V A;  4MSQ B;  5IN7 A;  1C79 A;  4NQL B;  3AE1 B;  4HPL B;  1QZE A;  3A9J A;  4JWU C;  3V6C B;  4I6L B;  1Q0W B;  2YLM A;  4HPM B;  2QJL A;  5EE9 A;  1SE4 A;  5J2R A;  3JW0 X;  2WQY B;  3AV8 A;  1ACC A;  2G4D B;  1UUP A;  1KJT A;  4N6E B;  1E7V A;  2AL6 A;  2WXL A;  5D94 A;  3PT2 B;  1CQV A;  5BMH A;  3LB8 C;  2M19 A;  5T8I A;  2KAC A;  1ZDX A;  4IWO A;  2EMT A;  4ZRQ A;  3ZW3 A;  5JHB A;  1TS3 A;  2WNM A;  2ASQ A;  3OJ4 B;  1HA5 A;  3HVZ A;  4CHK A;  2E3T A;  5D6J B;  1KFY B;  4XWT A;  4XYC A;  2HD5 B;  1WY8 A;  3RZW C;  1WZ0 A;  3PO0 A;  2PIA A;  3VH4 B;  4ZRJ A;  3APC A;  4IM2 A;  1FPY A;  2ZCB A;  3AN1 A;  5E6P A;  2SAK A;  2PE9 A;  4MGI E;  1WGY A;  4ANV A;  4RH6 A;  4PS7 A;  1VR9 A;  3VDZ A;  5HKH A;  1TIF A;  4W9L A;  1HEZ E;  5L95 C;  1IBX A;  4C80 A;  1E9M A;  1TS5 A;  2K8H A;  1FIQ A; 
#chains in the Genus database with same CATH homology
 4EUT A;  2M1M A;  3M62 B;  3DQV A;  4TQ0 A;  4WJO A;  3ML9 A;  2NVU I;  2CHW A;  2DZK A;  4K7S A;  1KLV A;  5BO4 B;  2C9W B;  3A4R A;  2C7M B;  2FCN A;  2LVQ A;  1WM2 A;  5J17 A;  1Z5S B;  3R7R A;  1RRB A;  3SU8 X;  1V80 A;  1LM8 B;  3HM3 A;  3GZN I;  1SIF A;  3ZDT A;  1V81 A;  2LXA A;  2YVC A;  3VTW A;  2MW5 A;  3ZNH B;  3PPA A;  1EUV B;  2FIF A;  4W9F A;  2GOW A;  1LXD A;  3ZDM C;  4DK5 A;  3MJW A;  3N30 A;  2ZEQ A;  1WXV A;  1OGW A;  2G4S A;  4ZRI A;  4DBG A;  2HE7 A;  1E5W A;  2NS5 A;  2OJR A;  2KOX A;  2ZZP B;  4GDL A;  5E6O A;  1JRU A;  3CMM B;  1UGM A;  4IM3 A;  3BY4 B;  4ICV A;  2JZ3 B;  1MG8 A;  2XBB C;  3QK0 A;  4AOF A;  2JWZ A;  4HDO A;  2K6D B;  3DDC B;  5E6N A;  3H7P A;  2IYD B;  3DBH I;  3ZVV A;  4XZ4 A;  2J0M A;  4DDI D;  4AUQ C;  2FCM A;  3A9K B;  3KUD B;  2DZI A;  4GU2 A;  4HCN B;  3PGE A;  1WJU A;  5LXI B;  1YIW A;  3T8M A;  4MJS A;  1WX7 A;  1OQY A;  4OVV A;  4HXD A;  4EEW A;  2DZJ A;  2KHW B;  1IPG A;  3D32 A;  3DBS A;  4DHZ E;  4PS8 A;  3UGB B;  2M8S A;  1TZ1 A;  2LAS A;  4DHJ D;  2LWP A;  4G0N B;  4ZRK A;  2REX A;  4GB9 A;  2I1K A;  3UQA A;  1UH6 A;  3UIP B;  3M63 B;  2D3G A;  1J0G A;  2R2Q A;  3Q3J A;  4MGZ E;  1V5T A;  2LGD A;  3IVF A;  4ZYN A;  3QIJ A;  4BVU C;  1TTN A;  3R7Q A;  3VAW A;  1WFY A;  1P1A A;  2IO3 B;  2PE6 B;  3UQB A;  2K25 A;  3WIM A;  1WX8 A;  2KJ6 A;  2MRP A;  3ZRF A;  1P3Q U;  1P9D U;  1S1Q B;  2K39 A;  2KFK B;  4GOC A;  4HK2 A;  4HVB A;  4M8M A;  3PRM B;  1BT0 A;  2I1J A;  1TBE A;  1FXT B;  1J19 A;  5GMV A;  1UEL A;  1H8C A;  2Y5B B;  4FLH A;  3KYC D;  3V6E B;  4AJY B;  3WAO A;  4OVU A;  3ZO5 B;  2L8J A;  3BIN A;  5CHV C;  5DCN A;  3ENE A;  3L17 A;  3T9L A;  2NPT B;  5LLI A;  4LJO B;  2IO2 B;  1R4M I;  4RM8 A;  2D11 A;  3DVG Y;  1GNU A;  1C3T A;  2K6Q A;  1ZW7 A;  4WWN A;  4URK A;  2FCQ A;  2BKF A;  1E90 A;  1U4A A;  1EO6 A;  1GJZ A;  4K7W A;  4EZK A;  4NJ7 A;  3PSE B;  2IZV B;  5C23 A;  2N9X A;  1P0R A;  3PLV A;  2D2Q A;  1EF5 A;  2PEA A;  4W9G A;  3CF6 E;  4WJN A;  4ZDV A;  2KFJ A;  2MBB B;  4NY0 A;  3ZNI D;  2NBU A;  5DPR A;  2N4F A;  2BWF A;  3SHQ A;  2KQ7 A;  2KWV B;  4HCP B;  1L7Y A;  1WXM A;  2RSU A;  4KDI C;  3N32 A;  2V1Y A;  3NOB A;  3TCA A;  1G6J A;  1WJ6 A;  2JRH A;  4DDG D;  2NBW B;  3PRE A;  4MGK E;  5DPW A;  2XEW A;  2CR5 A;  1WXA A;  4HDQ A;  3S2A A;  1L2N A;  3TJP A;  3X0W A;  2DYO A;  5IA7 A;  3L0W B;  2LVP A;  1E8Y A;  3R3M A;  3K9P B;  2RD0 A;  1NDD A;  2KTF A;  4NNJ B;  5AEK B;  1I42 A;  2BWE S;  3L10 B;  2JXX A;  5G55 A;  2N9P C;  2KC2 A;  3DVN U;  2R2O A;  1J8C A;  5JH5 C;  4WQO B;  3PHW B;  2DZM A;  1RFA A;  2N1V A;  2ZJD A;  4LDT B;  2WDT B;  2HTH A;  3QAQ A;  4FAD A;  2MBE A;  1KOT A;  2RGF A;  4ICU A;  1YD8 U;  2LRU A;  2KX3 A;  2RR9 A;  1WF9 A;  3KW5 B;  4JGH B;  4W9E A;  4II2 B;  2KDI A;  4KSL C;  3I3T B;  3TIX A;  3H7S A;  4TUU A;  2KDF B;  3VUW A;  3DPD A;  4ANW A;  3VUX A;  4LCD E;  4IWP A;  5D2M B;  2WWZ A;  2WX0 A;  2GBK A;  3ZIM A;  3EHV A;  4KVG B;  2CHX A;  3RZF A;  1UBQ A;  3MTN B;  3LDZ E;  3QQ8 B;  2IO1 B;  1M94 A;  3LJ3 A;  3ZRC A;  1WXS A;  3U30 A;  4DXA B;  2ZNV B;  3NHE B;  2L05 A;  2CU1 A;  2KO3 A;  3DCG A;  2DYM A;  3ZTC A;  3PS6 A;  2CS4 A;  2FAZ A;  3L13 A;  3VFK A;  3DOW A;  5DPT A;  3ZNZ B;  4GXB A;  3QWZ B;  4K81 A;  4LDT D;  4FHJ A;  1WE7 A;  3VTU A;  2IY1 B;  4B9K A;  3TL5 A;  3A1Q B;  3H9D A;  3NZS A;  4HLE A;  2D10 A;  4GSW A;  2GBM A;  2KTR B;  2L0T A;  4FN2 A;  2MCN B;  4FHK A;  1V6E A;  2J0K A;  2N1W A;  4GMV A;  2N7D A;  3OJ3 A;  3RYT A;  2Z59 B;  4I6P A;  2ZNV C;  5G2N A;  4KDL B;  3AI5 A;  1GC7 A;  2MA9 B;  2V4L A;  2KDE B;  4NQK E;  5D7G A;  3C0R B;  4WJP A;  4NPN A;  3ZNG C;  2KWC A;  3B0A A;  1WR6 E;  1NBF C;  4HWI B;  2O2V A;  2KMC A;  1WZ3 A;  2MSE D;  2DAJ A;  3UIN B;  5C1Z A;  4WJQ A;  2LGY A;  1ISN A;  2MP2 B;  3QJZ A;  2WYQ A;  2UYZ B;  4MH0 E;  4BBN F;  1WGR A;  2LD9 A;  3EEC A;  2K8B A;  5JHA A;  3WA0 A;  2J7Q B;  4K7U A;  3CSF A;  4BKS D;  1WMH B;  4P7I A;  3VVW B;  4TV3 A;  3K9O B;  1IP9 A;  4FBJ B;  2JT4 B;  3W1S A;  4M8N A;  3IFW B;  4MDK E;  2KD0 A;  3GOE A;  4KIK A;  2LZ6 A;  2MBO A;  5AZF A;  2XK5 B;  4EZJ A;  1YX6 B;  3SD5 A;  3ZUN A;  3A33 B;  1D3Z A;  3VXW A;  1WGD A;  3HK0 A;  3WAM A;  4MM3 A;  4WWP A;  1XT9 B;  1SGH A;  2C7N B;  1WH3 A;  4N9F 4;  1V9J A;  1XQQ A;  5KHQ A;  1UBI A;  3TBL D;  1Q1O A;  3B08 A;  3N3K B;  2EMS A;  1E7U A;  3KUC B;  3W1Y A;  3ALB A;  3QA8 A;  4FJZ A;  4G11 A;  2ZPY A;  3VQI A;  2BYF A;  5TR5 A;  4A3P A;  4A3O A;  4M0W B;  3B1L X;  2FID A;  4BKG A;  4ANU A;  4BOS C;  3ONS A;  4XC2 A;  1H4R A;  3IHP C;  3RUL A;  2M4N A;  2FCS A;  5KHO A;  2L00 B;  5L83 A;  3KH0 A;  4IC7 B;  3PRZ A;  2Z0D B;  4IM0 A;  2KTR A;  3QX1 A;  3SDL C;  4BBN C;  4EOY A;  4BFR A;  1IYF A;  2G3Q B;  5CTR C;  4F8C B;  4GDK A;  2KDB A;  1XD3 B;  2UWQ A;  1ZGU B;  4A20 A;  2JVC A;  5EDS A;  2O2V B;  4IWQ A;  3ZLZ A;  2GMI C;  4F1S A;  1V86 A;  4DHJ B;  4WAA A;  3EC8 A;  2JY6 A;  1HE8 A;  2PJH A;  4J6I A;  4KSK C;  4TKN A;  2BPS A;  2AL3 A;  2BYV E;  5AZH A;  2M17 A;  2JPH A;  2JZZ A;  3A1Q A;  3PV1 A;  2C60 A;  4NAW B;  4K1R B;  1Z2M A;  2VRR B;  1AAR A;  1WYW B;  2GBR A;  2OOB B;  3RT3 B;  2BKR B;  3OLM D;  2KMA A;  4FA6 A;  1Q5W B;  4TQ1 A;  2LVO A;  1WGG A;  2LI5 A;  4II3 B;  3X23 A;  3IG3 A;  2KK8 A;  3QAR A;  1E8Z A;  1TGZ B;  4YL8 A;  4B6W A;  1WM3 A;  2XK5 A;  3VHT C;  1EF1 A;  1GG3 A;  2CKH B;  4MGY E;  3WAL A;  2KXJ A;  2A5U A;  1WX9 A;  3KUZ A;  3ZKJ C;  2D07 B;  2K1F A;  2GBJ A;  2K8C A;  1RAX A;  4GN1 A;  4G50 A;  2L76 A;  3L16 A;  3MHS D;  1OEY J;  4B95 A;  1WRD B;  5CHF A;  2KKC A;  3CST A;  3A9J B;  3P2B A;  4PYU A;  1LFD A;  5DPS A;  3KVF B;  3PLU A;  3VTV A;  2DX5 B;  3RUI B;  1V49 A;  2MBH A;  1GC6 A;  4NJ6 A;  2LGX A;  3NS8 A;  2KC1 A;  2NR2 A;  4E3C A;  3PHX B;  2BYE A;  4AP4 C;  1YQB A;  3JVZ X;  4I6N B;  2QHO A;  3DBL I;  3PZD A;  4FUL A;  3H1U A;  1S3S G;  3HIZ A;  4JL9 A;  2EKE C;  1KM7 A;  2L3Z A;  2M0X A;  1V2Y A;  1I35 A;  1F9J A;  1PQS A;  2MX2 A;  4X57 B;  2KVR A;  2AYO B;  2JRI B;  1WIA A;  3UIO B;  4ANX A;  3M95 A;  4KZ0 A;  3RD2 A;  4GDK B;  3JYU A;  1Y8R C;  1RLF A;  3M3J A;  2KZR A;  3H6N A;  2KX0 A;  2N9E B;  3QHT A;  4IUM B;  3V61 A;  3Q3F A;  4MEL A;  4CYE A;  1UZX B;  1WI0 A;  4GGQ A;  4W9H A;  4JIO U;  2NBV B;  3UF8 A;  3ML8 A;  3HM6 X;  2DHZ A;  2IO0 B;  2J0J A;  4AJW A;  2CHZ A;  5CX3 A;  3KYD D;  4F7Z A;  2B3A A;  1K8R B;  4NAW A;  4EZL A;  2LUE A;  1WR1 A;  2JF5 A;  2A4Z A;  2C7H A;  4PS3 A;  3VUY A;  1NI2 A;  1OTR B;  1GUA B;  1WE6 A;  2KAN A;  4RMA A;  4EFO A;  1E8W A;  2MWS B;  3L08 A;  3JSV A;  2C5L C;  4BKT A;  2RPQ A;  1WJ4 A;  2KLG A;  4EKU A;  2DYB A;  2WX1 A;  2FNJ B;  4FJV B;  3DVN V;  1T0Y A;  4W9D A;  4W9C A;  2ZCC A;  5J18 A;  4DHZ B;  1VCB A;  2KN5 A;  3AXC A;  4BOZ B;  1YJ1 A;  3NY5 A;  4W9J A;  1SE9 A;  2BGF A;  3L54 A;  3U7D A;  1UD7 A;  1CMX B;  1WGH A;  4E74 A;  4MSQ B;  3TMP B;  4NQL B;  4WWO A;  4G3X B;  3APD A;  4HPL B;  2O6V A;  4KZC A;  2PPH A;  4FJY A;  1QZE A;  2BF8 B;  3A9J A;  3EFU A;  2L0F A;  2Z0E B;  4MSM B;  2G45 B;  4JLC A;  2DAF A;  3U8Z A;  3V6C B;  2JUO A;  4PYZ A;  2IY0 B;  4I6L B;  1Q0W B;  2YLM A;  3QCA A;  4HPM B;  4HJK A;  1VD2 A;  5JZE B;  4BKS A;  2AWT A;  3OAW A;  4LJP B;  3W1S C;  5J2R A;  4IW0 A;  5AZG A;  5IAA C;  3JW0 X;  1E8X A;  1YX5 B;  2ZVO A;  3AU5 A;  2G4D B;  3V60 A;  3DBR I;  1KJT A;  3VH3 B;  4W9K A;  3WAN A;  1P98 A;  2ZPN A;  1E7V A;  1R4N I;  2KWU B;  2AL6 A;  2IBI B;  2KJR A;  2V3S A;  4DWF A;  3APF A;  2HJ8 A;  5D94 A;  3ZTD A;  2O6V D;  3A9K A;  3PT2 B;  4RM9 A;  3QC8 B;  2MP2 A;  2MBQ A;  2LJ5 A;  4W9I A;  3NZU A;  1V5O A;  4IWO A;  3IBE A;  3HHM A;  2EMT A;  3ZW3 A;  5JHB A;  1WMH A;  2ZVN A;  2KNB A;  2ASQ A;  3OJ4 B;  4XX5 A;  3JSV B;  4CHK A;  2N7E A;  3A4S C;  4GDL B;  2AEH A;  1LQB A;  5D6J B;  2FUH B;  2HD5 B;  1WY8 A;  3PRP B;  1WJN A;  1WZ0 A;  3RZW C;  2W9N A;  4KIK B;  3RCZ A;  2KFK A;  3H7P B;  5FR6 A;  3VH4 B;  4ZRJ A;  4E71 A;  3O65 B;  5CHW A;  3V62 A;  2MLB A;  3APC A;  4IM2 A;  3PVL A;  1C1Y B;  2GBN A;  2ZCB A;  5E6P A;  2KQS A;  1OEY A;  2PE9 A;  4MJS B;  4MGI E;  1WGY A;  4ANV A;  2O6V B;  2DEN B;  4PS7 A;  3DVG X;  4AWJ A;  2NPT A;  2NCN A;  3R66 C;  1X1M A;  3VDZ A;  4KV2 A;  3PTF C;  5HKH A;  2L7R A;  3ECI A;  1A5R A;  3AU4 A;  4W9L A;  2LRW A;  4GIV A;  4CO7 A;  5L95 C;  5LXH A;  4JQW C;  2KLC A;  2MQJ A;  4MEM A;  2LXC A;  4ASW C;  1ZKH A;  4IG7 B;  2K8H A;  3WAP A;  3AUL A;  2KJH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...