4GU2A

Crystal structure of ubiquitin from entamoeba histolytica to 1.35 angstrom
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
72
structure length
68
Chain Sequence
MQIFVKKTITLEVEPNDSIDAIKAKIQEKEGIPPDQQRLIFAGKQLEEGKTLSDYNIQKESTLHLVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants of Ubiquitin Conjugation in Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Protein binding
molecule keywords Ubiquitin
total genus 21
structure length 68
sequence length 72
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gu2A00
2M17A 4ZYNA 4XZ4A 2LRUA 1GC6A 3WALA 3ZDMC 1GJZA 5DPSA 4HJKA 5L83A 3JSVB 2DYOA 4W9FA 4EZLA 1H4RA 3CSFA 3H6NA 5D6JB 4ICVA 5DCNA 2KJRA 2VRRB 3EECA 4FJVB 4HWIB 3W1SA 2K8HA 2D2QA 1WXAA 2PJHA 4KDLB 3MJWA 4ZDVA 5E6OA 2N9EB 1V5OA 1WZ0A 4I6LB 4M8NA 2BPSA 1ZW7A 3R3MA 2AEHA 2C60A 4RM8A 1WE7A 3L10B 4XC2A 2DZJA 4BOSC 5JHBA 1ZKHA 2BKFA 2WDTB 2KLGA 4ICUA 2LASA 2IO3B 4JL9A 3V61A 3ENEA 2KD0A 2WYQA 1V2YA 2CHXA 2K6DB 4LCDE 2XK5B 2XBBC 4A3OA 3H7PB 3DVGY 3IHPC 3WA0A 4DHZB 2J0MA 3SD5A 3PRZA 2YVCA 3KUDB 1WGRA 2J7QB 2JVCA 3DBSA 3T9LA 3L17A 3VTVA 4FN2A 1V6EA 2NPTB 2JUOA 2RGFA 3CMMB 1V5TA 2Y5BB 3RUIB 2FIDA 3BINA 3MTNB 4IUMB 2REXA 3ML8A 2KFJA 2KVRA 3A1QA 4MGYE 4KIKA 3W1YA 4DK5A 3QJZA 3R66C 1MG8A 1V81A 3WIMA 4FJYA 2J0KA 2YLMA 4FHKA 5DPWA 1C3TA 1J8CA 4G11A 5CX3A 3U7DA 2KX3A 2GBMA 4ANXA 4EUTA 2L3ZA 1XD3B 2KDIA 3VUYA 4GB9A 1Z5SB 3D32A 2CHWA 4A3PA 2MBOA 4W9DA 4NNJB 2C7HA 2V4LA 3RYTA 3EHVA 3ZLZA 3VH4B 4WWPA 1E5WA 2V1YA 3WAPA 4BOZB 2NS5A 4TQ1A 2LWPA 4IWOA 2D10A 4W9JA 2IO0B 3RT3B 2G45B 4MJSA 3AU5A 4WJPA 3JW0X 1YJ1A 4GDLB 1TBEA 2C9WB 5DPTA 3PRMB 4E74A 4JGHB 3V6EB 3DVNV 1WX7A 2CKHB 3VH3B 3VTUA 2KOXA 5G2NA 2KX0A 1Z2MA 3NHEB 3PVLA 2L8JA 3DCGA 3RD2A 2CS4A 2Z0DB 3SDLC 3NS8A 2G4SA 3HM3A 2IY0B 2N1VA 2MLBA 2WX1A 2XEWA 3L54A 4CYEA 2MBBB 3QARA 3X23A 2IY1B 2JRIB 2K25A 1IPGA 4URKA 2K1FA 3TCAA 2LVQA 2KXJA 1GUAB 2KQ7A 1UZXB 3APFA 4PYUA 3PGEA 2NBVB 4GIVA 2A4ZA 4GN1A 4FBJB 1IP9A 3OAWA 3A9JB 2BYVE 1WR6E 3VVWB 3WAMA 1GC7A 3Q3FA 5IA7A 3U30A 1KJTA 1TZ1A 2KKCA 4NPNA 2A5UA 3IFWB 3PSEB 4GOCA 3B0AA 1WRDB 3WANA 2HTHA 3TMPB 2HD5B 2LVOA 3KUZA 1IYFA 3QX1A 1WIAA 4WJNA 1WM2A 2KN5A 3VUWA 3PREA 4IWPA 1C1YB 1E8ZA 1S1QB 3L16A 2KANA 4FULA 1V9JA 2BF8B 3APCA 3GOEA 4IM3A 4NQKE 3VFKA 3CSTA 1E8YA 4B6WA 2ZJDA 1KM7A 2LJ5A 1P3QU 3IVFA 3PS6A 4JIOU 4TQ0A 1L2NA 1YX6B 3DBHI 2DZMA 2B3AA 3EC8A 3JVZX 1T0YA 3PHXB 4GDKA 4I6NB 4MGIE 4AOFA 4W9CA 4B9KA 4BKSA 4BKTA 2I1KA 3UF8A 2WWZA 2KK8A 3ZTDA 1BT0A 4EZKA 4W9KA 2L05A 2Z0EB 4HXDA 3WAOA 2J0JA 3A4SC 2BYFA 3PHWB 4KIKB 4F8CB 3GZNI 3KW5B 3VTWA 2NBWB 2MSED 2KLCA 3H9DA 2KJ6A 2IYDB 4MEMA 1V86A 1WI0A 4X57B 2AWTA 4GU2A 5D94A 2JY6A 2N7DA 2KC2A 3DBLI 1V49A 2LGDA 4MSQB 4ANWA 2Z59B 5BO4B 4WJQA 3UQAA 3AXCA 1M94A 4AJWA 2ZNVB 1SIFA 4PS7A 2GMIC 2CU1A 2RSUA 1OQYA 3AU4A 2AYOB 2NPTA 3DOWA 4HPMB 3R7RA 3RULA 1LXDA 5J2RA 1UH6A 4MGZE 4LDTB 4MM3A 1WXVA 5D2MB 2L76A 4I6PA 2KJHB 1P9DU 3RZWC 3MHSD 4BKSD 1G6JA 3VAWA 3M63B 3X0WA 4ANVA 1WGGA 2K8BA 2L0FA 3ZTCA 3ZO5B 1XQQA 4G0NB 1JRUA 3APDA 4K7UA 5J18A 3ZNZB 2ZCCA 4BKGA 5LXHA 1YX5B 4DDID 1RAXA 4F1SA 3ZNHB 2CHZA 1P0RA 2JXXA 4FADA 1CMXB 1RFAA 3PLUA 2MP2A 3AI5A 1ZGUB 3QCAA 2JPHA 1UELA 3DVNU 4II3B 2ZEQA 4W9GA 5AEKB 2KNBA 3A4RA 3N32A 2ZPYA 1WGDA 4AP4C 2NR2A 1FXTB 2BWFA 1AARA 2ZCBA 2GBJA 5LLIA 1I42A 1LM8B 4JLCA 4A20A 1K8RB 3ZKJC 3ZNID 4EOYA 1LQBA 4BBNF 1R4NI 3A9KB 2DZIA 1WYWB 2HE7A 3VXWA 1WJ4A 1VD2A 3UINB 1P98A 3HK0A 2FAZA 3QQ8B 2MA9B 4NAWB 2DAJA 3TBLD 2V3SA 2LXCA 3HIZA 4NJ6A 1WH3A 1WR1A 2KWCA 4MELA 2D07B 3DPDA 3UIPB 2KDEB 4PS3A 4WJOA 2IZVB 4NY0A 1SGHA 4YL8A 2QHOA 2MRPA 4KSKC 3NZSA 4P7IA 1H8CA 3H1UA 3DDCB 5GMVA 2C5LC 3NY5A 1D3ZA 4K7SA 2MCNB 2UWQA 3T8MA 4E71A 3ZVVA 1ISNA 4FHJA 3H7SA 2D3GA 1X1MA 3A9KA 4M0WB 4IC7B 1YQBA 5AZFA 2N9PC 1LFDA 2FUHB 3V62A 4NAWA 4W9LA 4BVUC 5KHQA 3K9OB 1UBIA 1XT9B 4HDOA 3V60A 4TUUA 3TIXA 2LD9A 2IO2B 1WZ3A 3JYUA 2LGYA 1TTNA 4II2B 3ML9A 1P1AA 1WMHA 2DAFA 3SU8X 1GG3A 2N9XA 2O6VB 3M62B 4GMVA 5KHOA 4HPLB 3QIJA 2GBRA 2ZVNA 4NQLB 1WJ6A 4TV3A 2K39A 2FCMA 2JZZA 2LRWA 2FCSA 2O6VD 4DHZE 1Q5WB 2K6QA 4FJZA 4HLEA 2L0TA 4W9IA 5DPRA 4HDQA 1I35A 1OTRB 4DDGD 3ZRCA 1KOTA 1EF1A 3LDZE 4IW0A 2L7RA 3KH0A 1V80A 3R7QA 1GNUA 3NZUA 3TL5A 5CTRC 2O2VA 2KO3A 1WXMA 5D7GA 4GDKB 4OVUA 1A5RA 1OGWA 5L95C 1OEYA 2KTRA 4DBGA 5CHWA 2FNJB 2ZPNA 4GXBA 2KC1A 3KUCB 3W1SC 4GGQA 4E3CA 2BYEA 1U4AA 2RR9A 4KZ0A 1NBFC 3RZFA 1F9JA 3N3KB 2GBNA 2OJRA 4KDIC 4HCPB 3ZDTA 1WJNA 2KDBA 4RMAA 4RM9A 4K7WA 4M8MA 2CR5A 3UIOB 4IM0A 3PRPB 3ZUNA 2W9NA 1WX9A 3UQBA 2LZ6A 1Q1OA 4WAAA 5CHFA 1WJUA 2IO1B 2K8CA 4BBNC 3ZNGC 1VCBA 4OVVA 4ZRKA 1WGHA 2DYBA 2EKEC 3ECIA 4CHKA 2PPHA 2LGXA 2DX5B 2RPQA 4KZCA 3JSVA 5C23A 4DHJD 5JZEB 2UYZB 1Y8RC 4KV2A 3B1LX 4MJSB 4JQWC 1UD7A 1YD8U 1WXSA 2M4NA 4EZJA 2LI5A 2KDFB 3N30A 3Q3JA 3VDZA 1L7YA 1EF5A 4XX5A 4IG7B 2HJ8A 3P2BA 2C7MB 2FIFA 3BY4B 1WX8A 3KVFB 3ONSA 5G55A 1EO6A 3PPAA 1NI2A 2JRHA 4ANUA 1Q0WB 4N9F4 5LXIB 3PLVA 4ASWC 4EEWA 4HCNB 4MDKE 3VHTC 3QHTA 1S3SG 4DHJB 2ZZPB 1WF9A 2BWES 2EMTA 2I1JA 2MP2B 2AL6A 2NCNA 3KYDD 4G50A 3OJ3A 4W9EA 1TGZB 4W9HA 5AZGA 3NOBA 4GDLA 2KTRB 2JT4B 3QWZB 3A1QB 1RLFA 3HM6X 3ZIMA 2BGFA 5CHVC 3PZDA 4PS8A 2FCNA 4NJ7A 2KHWB 3O65B 3U8ZA 4K1RB 4BFRA 1NDDA 2DYMA 3QK0A 4KSLC 3AULA 3M95A 4EFOA 1HE8A 4MSMB 2ZNVC 1KLVA 3A9JA 1E7VA 1E8WA 4B95A 5EDSA 4LJOB 2L00B 2M1MA 2KMCA 2R2QA 3H7PA 4LJPB 5FR6A 3VUXA 2MW5A 2R2OA 3I3TB 4TKNA 4GSWA 2C7NB 3EFUA 3S2AA 2WX0A 3PV1A 2GBKA 3DVGX 2KZRA 2ZVOA 3C0RB 4MGKE 3QA8A 4IM2A 4HK2A 2NBUA 2FCQA 4ZRIA 4AJYB 2DENB 3L0WB 3PT2B 2BKRB 2LVPA 3IBEA 2JWZA 1J19A 2KWVB 4DXAB 3QC8B 3ZW3A 3DQVA 2IBIB 3K9PB 4K81A 2G3QB 5TR5A 4F7ZA 2D11A 4FA6A 2MWSB 3CF6E 4FLHA 3QAQA 2MBHA 4J6IA 2ASQA 5HKHA 2MBQA 1QZEA 3ZRFA 1SE9A 2NVUI 1E7UA 1WE6A 1WMHB 2KFKB 5IAAC 5JHAA 4PYZA 1EUVB 3DBRI 4WQOB 2PEAA 4CO7A 2PE6B 3PTFC 2G4DB 2MBEA 2M8SA 3V6CB 4ZRJA 4WWOA 4DWFA 4WWNA 2XK5A 2DZKA 2LUEA 3L13A 3TJPA 2GOWA 4G3XB 1WGYA 2N4FA 3L08A 1UGMA 3SHQA 2OOBB 3UGBB 4AWJA 3IG3A 3B08A 5AZHA 4EKUA 2JZ3B 1J0GA 2O2VB 3HHMA 1WFYA 1R4MI 4KVGB 2EMSA 3OJ4B 1WY8A 4MH0E 1YIWA 3KYCD 2KTFA 1E8XA 3RCZA 5JH5C 2KFKA 2LXAA 5J17A 4LDTD 2PE9A 2JF5A 2KQSA 3A33B 2M0XA 3ALBA 3LJ3A 1RRBA 2DHZA 5C1ZA 3VQIA 1E90A 2RD0A 2MQJA 2N7EA 1OEYJ 3M3JA 2KMAA 2KWUB 1PQSA 2AL3A 2O6VA 5E6PA 2MX2A 2N1WA 4IWQA 1WM3A 5E6NA 4AUQC 1UBQA 4HVBA 3OLMD
chains in the Genus database with same CATH superfamily
1SXTA 2LRUA 2FUG1 3WALA 1HTQA 3ZDMC 3ABVB 5L83A 3JSVB 4EZLA 1H4RA 5D6JB 1R7SA 3W1SA 4KDLB 3EUB2 1SB3C 2BT6A 1WZ0A 2N9EB 4I6LB 2BPSA 4YTNB 3T3OA 1WE7A 3L10B 1FFVA 5JHBA 3P4RB 3V61A 4JL9A 2IO3B 2GRIA 3H7PB 3Q14C 2N7JA 2J0MA 3SD5A 1K52A 2J7QB 2JUOA 2Y5BB 2JYEA 2KVRA 4KIKA 2H88B 3R66C 1VZ8A 4KGTA 2EKIA 2YLMA 2V4IB 4G11A 2KYWA 3BZDB 2KX3A 2GBMA 4ANXA 3VUYA 2INNE 4GB9A 4RF1A 2DNFA 4OZBA 1VZ7A 1SE3A 4NNJB 2V4LA 3RYTA 1YQ3B 3VH4B 4WWPA 1E5WA 2R61A 2W3SA 4IWOA 4W9JA 2NTTA 1QLBB 1T5XD 1GAQB 3VR8B 1E10A 3AU5A 1YJ1A 4GDLB 1VR9A 2WXJA 1ROEA 5DPTA 3GE8C 3VH3B 2KOXA 5G2NA 3RD2A 3DCGA 3ETRA 3L54A 2XEWA 1PDXA 1QOFA 3J9CA 2K1FA 3BIID 2LVQA 4KKJA 2KQ7A 1ZXHA 1UZXB 4PYUA 3OG5A 5HFYA 3PGEA 3I9V1 2VH1A 1P7EA 2WNMA 3A9JB 2BYVE 3WAMA 1GC7A 5IA7A 3U30A 3WANA 4B0EA 2LVOA 3QX1A 1WIAA 4WJNA 1B9RA 4IOIE 3VUWA 3WCQA 1C1YB 1S1QB 5BMGA 3L16A 3APCA 1XLQA 4D2KA 3MFGA 4B6WA 4US8A 2ZJDA 4R3DA 3IVFA 4JIOU 3DBHI 2DZMA 2B3AA 4HKZE 3EC8A 1T0YA 4MGIE 4BKTA 1SE2A 3Q3OC 2IPKD 1EU3A 4M01A 4W9KA 4H2AA 3WAOA 2J0JA 1ZP0B 3VTWA 2NBWB 2Y5PA 2MSED 1TY0A 2KLCA 3NRZA 1T0SC 1V86A 1I4PA 2Z59B 5BO4B 4WJQA 5BYQA 2ZW1A 3DBHB 1F77A 2ZNVB 4PS7A 3HUIA 1OQYA 3TEYA 4HPMB 3I5JC 1JALA 3NUHB 4MGZE 4PK1A 3EA6A 3P4PB 3IT4B 4BKSD 5IO9A 3M63B 3VRAB 1WGGA 3SEBA 1XQQA 3KLSX 1JRUA 4K7UA 2PW9A 2AQ3B 5LXHA 1TT5B 1WWTA 3N1ZC 5LNK1 2CHZA 1P0RA 4C00A 5BYRA 3PLUA 1HEZE 1UELA 4II3B 5AEKB 2DLBA 3A4RA 1WGDA 4AP4C 3MC0B 1K8RB 1FPYA 3U7ZA 4RNAA 4BBNF 1D6EC 2BBCA 3DBLB 1TKGA 3HK0A 2MA9B 4IDIA 1TS4A 4NJ6A 2KWCA 3BK2A 2QHOA 1OQQA 4P7IA 1H8CA 5GMVA 4DQOC 3RFZB 3Q8BA 4FXCA 2Z8LA 4AS1A 1YNTE 4E71A 1ISNA 5EE9A 1JROA 1V1PA 5AZFA 4OW0A 3V62A 1B1ZA 2INCC 1J7BA 1XT9B 3H8HA 3TIXA 2LD9A 2LGYA 2Y5CA 4II2B 1L6UA 1WMHA 5KHOA 4HPLB 2ZVNA 1WJ6A 1STEA 2JZZA 2WP9B 4DHZE 5JXVA 4HRSA 1OTRB 2ON8A 1KOTA 1EF1A 1ZPSA 3KH0A 3TL5A 5CTRC 2O2VA 2ZW0A 1FO4A 5D7GA 4GDKB 4OVUA 4MACA 1OGWA 1ACCA 2AQ2B 5GXGB 2KWDA 1FD6A 2KC1A 1JRPA 2RR9A 1F9JA 1I4RA 2D3BA 2M56B 3R2IA 4J3OD 2KDBA 4RM9A 2CR5A 3UIOB 1E7PB 2JX5A 3OWEB 4BBNC 4OVVA 2DYBA 1M4VA 4A9AA 4C7YA 3DWMA 5IP4D 3JSVA 5C23A 4DHJD 2KVZA 3B1LX 3EGRA 1WXSA 3Q3MC 3NVWA 2G9HD 3P1MA 3KVFB 2WDQB 1D4BA 1EO6A 2BVCA 2JRHA 3AM9A 4ANUA 5LXIB 3PLVA 4YT0B 4ZOHC 2N9LA 2W54A 1ZDVA 2BWES 2I1JA 1VZ6A 3W5UB 1TYGB 4WH4A 4W9EA 3QWZB 3A1QB 3HM6X 1UF0A 2BGFA 5CHVC 4XGAB 2FCNA 4NJ7A 3O65B 4MSMB 1E7VA 3FILB 2ONQA 5EDSA 4LJOB 2LHEA 2L00B 4LJPB 2KMCA 2MW5A 2R2OA 3I3TB 4TKNA 2V9HA 1L5PA 2JXTA 2WHIA 1MPEA 4RH6A 4HK2A 3CWIA 2DENB 3L0WB 2LVPA 1L0XB 1J19A 2KWVB 3QC8B 3DQVA 3RNBC 2D11A 3QAQA 2MBQA 3ZRFA 4OHJA 4P16A 2NVUI 1EUVB 2PEAA 1ET9A 3P4QB 3PTFC 5EE1A 5TSSA 4DWFA 3KWVA 4G3XB 1XLOA 4A55A 3UGBB 4AWJA 2K9XA 2JZ3B 1EM7A 4KVGB 1MHXA 1TS5A 3ZJTA 3KYCD 1XCQL 3L4PA 2LXAA 2PE9A 2JF5A 1RWSA 3BWUD 2MQJA 2XNAC 3M3JA 2QMTA 1HTOA 1FNVA 2KWUB 1PQSA 2O6VA 5E6PA 1CK1A 4AUQC 4HVBA 3RNCC 4ZYNA 2TSSA 5DPSA 4HJKA 1KRHA 3GS2A 2DYOA 4ICVA 4ARIA 1KLUD 4YXDB 4FJVB 2D2QA 2KACA 3MJWA 3RN9C 5E6OA 1V5OA 3NG0A 1KTKA 1N60A 4M8NA 1F0ZA 1ZW7A 2AEHA 4YSYB 4BOSC 2BKFA 4ICUA 2LASA 2QCZA 2WYQA 1V2YA 2CHXA 2PKOA 4LCDE 3ZXVA 4S17A 3DVGY 2M0AA 4DHZB 5H92C 5MPOA 3DBSA 2NPTB 1L0YB 2RGFA 4ZHOA 3BINA 3MHZA 2REXA 3TSSA 2KFJA 4DK5A 3QJZA 4FJYA 2IGHA 2WXKA 1J8CA 3U7DA 3AEFB 3MP9A 2CHWA 1FNUA 4W9DA 3WAPA 3AEEB 2D10A 4EE2A 2LGIA 2IO0B 3NVYA 1WRIA 4WJPA 3P63A 3AE9B 3JW0X 1TBEA 4M02A 1V1OA 2MEKA 4PT5A 3PRMB 1T3QA 3V6EB 3RNFC 1WX7A 2CKHB 3VTUA 3RPFC 1PGXA 2CS4A 2Z0DB 2N1VA 4CYEA 1E0ZA 4URKA 3TCAA 3RNEC 2XN9C 2NBVB 2JQRB 4FBJB 2FE8A 1IP9A 4LNKA 3AMZA 2KKCA 4NPNA 2A5UA 1WYGA 2OJWA 1WRDB 2HTHA 2HD5B 4RGNA 1IYFA 4KKIA 5C3JB 1P7FA 3UI3A 4RGMA 2KANA 4FULA 1V9JA 3GOEA 3URYA 4NQKE 2JSVX 5AUIA 3AEDB 3BK1A 1YX6B 3BYTB 3N1XC 3JVZX 3PHXB 4GDKA 1FCLA 4L23A 4BKSA 2I1KA 1BT0A 2EELA 4US9A 4HXDA 3VRBB 2BYFA 3PHWB 4F8CB 2QSDA 4MEMA 4N58A 4GU2A 1ENFA 5H8YE 1EWYC 1GOZA 3AXCA 4AJWA 2CU1A 2RSUA 2AYOB 1LXDA 4XWTA 4MM3A 1WXVA 1V1PB 5D2MB 2WXIA 1P9DU 1JWSD 3RZWC 1K51A 3VAWA 1VJKA 3X0WA 2ACZB 2ICIA 4G0NB 3APDA 2BW2A 2JWUA 3ZNZB 4DDID 1SSNA 4RFBA 1SIJA 2JXXA 2WXRA 3CIRB 1QKZA 1N5XA 2KNBA 2N9KA 1FXTB 1AARA 1I42A 1LM8B 4JLCA 4A20A 2JYTA 2CJOA 4EOYA 1LQBA 3N20C 1KH0A 1TS2A 3A9KB 2DZIA 1WYWB 1CQVA 1VD2A 1FFUA 3IAM1 3TBLD 2V3SA 1JMLA 1WH3A 1SF0A 4MELA 2IGGA 3TEZA 1D5ZC 3AE3B 3C19A 3NZSA 3H1UA 3DDCB 5BMHA 2UWQA 1ZE3D 1X1MA 4IC7B 1YQBA 2N0SB 1UWXA 3MC9A 1SE4A 1DOIA 3BYYB 3K9OB 1UBIA 3NVZA 3V60A 4TUUA 1XF5L 2VH2A 2J42A 1XXGA 2N9XA 2RDBC 1QQRA 5FKAC 4NQLB 3U4EG 1OQRA 2FCMA 2LRWA 4XWWA 1AYFA 2K6QA 2J53A 2L0TA 3GE3C 4W9IA 4A90A 1F2RI 1I4GA 3R7QA 1GNUA 1SBBB 3NZUA 2G1EA 4ZHPA 2KO3A 1OEYA 2KTRA 4YSXB 2FNJB 2IJ0A 1YJIA 3KUCB 4GGQA 2BYEA 4KZ0A 4TSSA 4K3BA 2OJRA 1HA5A 1ZDXA 1TKYA 3ZDTA 4HJGE 1LGRA 5AUKA 3ZUNA 2W9NA 4K3CA 2LZ6A 1Q1OA 4WAAA 1RYJA 2K8CA 4ZRKA 1WGHA 3I63C 2Q5WD 4MJSB 2UYZB 1YD8U 2LI5A 4WIPA 3T3NA 3Q3JA 1L7YA 1EF5A 4XX5A 5IOIA 2KAJA 3U2SC 2C7MB 1WX8A 5G55A 3ONSA 3PPAA 4N9F4 4EEWA 4HCNB 1QOBA 3GZNB 1S3SG 4DHJB 4G50A 1D5XC 3OJ3A 1TGZB 4W9HA 5AZGA 3NOBA 4GDLA 2FBWB 2JT4B 1EWCA 3Q8AA 3PZDA 4PS8A 2KHWB 2WXOA 4K1RB 3U8ZA 4BFRA 2DYMA 4EFOA 1L4ZB 5HHDG 1XEEA 4B95A 3RNGC 5I4DA 3H7PA 2QJLA 3S2AA 4GSWA 2WX0A 1N63A 2LGSA 2INDC 2GBKA 3N1YC 2KZRA 4MGKE 3QA8A 4ZRIA 4ZYSA 2JWZA 2MHJA 4NJCA 4DXAB 3ZW3A 3E9SA 1YQ4B 2D5GA 1C4CA 4MT5A 1NVID 2MWSB 1Q10A 1E7UA 1WE6A 1WMHB 5JHAA 3LYYA 2IDYA 1JWUD 4NZLB 2MBEA 4ZRJA 2DZKA 3L13A 1XO3A 2LFIA 2N4FA 2VZKD 2BB6A 3IXSA 3IG3A 2WXLA 4N6EB 3B08A 4EKUA 1NEKB 1J0GA 3HHMA 1ZUD2 1R4MI 3OJ4B 1WY8A 4MH0E 1FIQA 1YIWA 2KTFA 3RCZA 1CZPA 2KFKA 4WAFA 5J17A 4LDTD 3A33B 3LJ3A 2WS3B 3SFDB 1RRBA 4S0RA 1YOVB 1WGKA 2BYTA 2KMAA 2MX2A 1WM3A 5E6NA 1C77A 3OLMD 1WXQA 2JZPA 4C4VA 1GJZA 3AE8B 3CSFA 3H6NA 5D3IB 5DCNA 2VRRB 4HWIB 2K8HA 2PJHA 1WXAA 1IBXB 4WURA 1GB1A 4ITKA 2C60A 4RM8A 1HXYD 1ZKHA 1OFFA 1PGAA 1N62A 1UUPA 2KD0A 2XK5B 4OZAA 2XBBC 5HG2A 3WA0A 2YVCA 2D3AA 3VTVA 4FN2A 1V6EA 3TUOA 3CMMB 1V5TA 2QILA 3MTNB 2NMQA 4IUMB 3ML8A 1IBXA 3A1QA 4MGYE 2LEKA 1MG8A 1V81A 4OZCA 2J0KA 5DPWA 4FHKA 3TEWA 3FILA 1C3TA 2AQ1B 2LMCA 5E6JA 2L3ZA 1XD3B 1PGBA 1SJHD 3EHVA 1NENB 2NS5A 1V97A 1JW9D 1T6BX 3PZ7A 2K22A 3Q2AC 3ZYYX 4JWUC 4E74A 4JGHB 1PYWD 3DVNV 3KWLA 3RMKC 1N61A 2MJEA 1YN3A 2KX0A 3NZ3A 3NHEB 3PVLA 2L8JA 4LK0M 3SDLC 3NS8A 2Y3AA 2MLBA 2WX1A 2K25A 2K0PA 5G5GA 5FK9C 3APFA 1CJEA 2A4ZA 4GN1A 2W82A 3OAWA 4LLGM 1WR6E 3VVWB 3Q3FA 1TZ1A 3IFWB 3Q8FA 2WXMA 3PSEB 5IN7A 3KUZA 1JWMD 1WM2A 1TKEA 3DWGC 1BUIC 2KN5A 1E9MA 3PREA 4IWPA 1SEBD 1E8ZA 2RMMA 1QF6A 4MH8A 1DGJA 2BF8B 4IM3A 3ZQ4A 2IGDA 1P3QU 3PS6A 4TQ0A 1MG4A 1L2NA 1L4DB 1FEHA 4I6NB 1N6ZA 1JQ4A 1JCKB 4B9KA 1K50A 2WWZA 2KK8A 3ZTDA 4GLSC 1VDVA 2L05A 2Z0EB 3Q8EA 3A4SC 4KIKB 3KW5B 2KMMA 3H9DA 1QILA 4X57B 2AWTA 2L52A 2JY6A 3DBLI 2H89B 4MSQB 4ZRPA 1TZOA 1M94A 3AE4B 1YMHE 1SIFA 1YN4A 3DOWA 3AU4A 2NPTA 3FAHA 5J2RA 4MM3B 2BS2B 4LDTB 2WQYB 3MC8A 2L76A 3P4SB 1HZ6A 3MHSD 2K8BA 3ZTCA 4YSZB 2ZCCA 4BKGA 1YX5B 2W55A 3ZJVA 1RAXA 4F1SA 2OEDA 1CMXB 1RFAA 4CQNA 3AI5A 1ZGUB 2AX5A 4W9GA 3R2TA 3B2FA 3AE7B 2ZCBA 1C76A 2GBJA 3EFCA 5LLIA 4ACFA 3ZNID 2OHFA 1FMAD 3VXWA 2I2YA 2FAZA 2RDGA 1XCTL 2LXCA 3HIZA 1WR1A 3UIPB 1EU4A 4PS3A 2IZVB 4NY0A 2MRPA 3AEAB 4HKQA 2C5LC 2L32A 3NVVA 2MCNB 1VRAB 4C7ZA 4L2YA 2D3GA 3ZJUA 4M0WB 4LTUA 1LFDA 4W9LA 4BVUC 2WXHA 1TS3A 1T0QC 2GB1A 1DOYA 2IO2B 4XE0A 1TTNA 1FXIA 1P1AA 3VR9B 2DAFA 2O6VB 3M62B 1MFWA 3QIJA 4TV3A 2FCSA 1Q5WB 4HLEA 2WXNA 3PO0A 4HDQA 3V3XA 4M0WA 3DHIC 4DDGD 4HEA1 4IW0A 2W3RA 3O13A 2WLBA 1V80A 4BAXA 5BYSA 5L95C 2PLPA 1C78A 4DBGA 4GXBA 4E3CA 3ZXRA 1NBFC 2DWQA 3RZFA 4LNOA 4KDIC 4HCPB 5BMIA 1IGDA 1WJNA 4HPPA 4WQMA 4K7WA 4UDUC 2KT7A 3PRPB 1WX9A 3C8YA 5CHFA 1WJUA 2IO1B 3U52E 3ZNGC 4C80A 4TMAB 4CHKA 1GPXA 1L0VB 2DX5B 4C4VB 4RGTA 2WXPA 4KZCA 4HROA 5G5HA 5JZEB 1Y8RC 4KV2A 1NYQA 4JQWC 1UD7A 1RM6C 2KDFB 1R4MB 3N30A 3VDZA 2JU6X 4IG7B 2HJ8A 1JWAD 4JWSC 3P2BA 3W5VB 3BY4B 1LO5D 2BS4B 1NI2A 5T8IA 1Q0WB 1F2RC 4MDKE 3VHTC 3QHTA 4YWGG 2ZZPB 2EMTA 2MP2B 2NCNA 3KYDD 1V8CA 3Q3NC 2KTRB 1RLFA 3ZIMA 4DXFA 2PIAA 3P42A 4XDDA 1NDDA 3QK0A 2X8XX 2GLSA 4KSLC 3AULA 3RNAC 3M95A 2ZNVC 2UU7A 3A9JA 2BB5A 3Q6BA 1N5WA 2M1MA 1FCCC 1F1HA 2WGSA 3EFUA 3PV1A 1I7HA 3DVGX 2ZVOA 1ZXIA 2FCQA 4AJYB 2WXGA 3LXFA 3AEGB 2BKRB 3IBEA 1UNSA 3W2DA 4F7ZA 4FA6A 3CF6E 4FLHA 3NS1A 4J6IA 2I38A 4A6QA 1C4PA 2QC8A 3DHHC 1Y56A 2PE6B 2G4DB 2M8SA 1DOXA 4ZRQA 4JE3B 1KF6B 4KX6B 4WWNA 2XK5A 2LUEA 3TJPA 2GOWA 1WGYA 1UGMA 3SHQA 2OOBB 3W9CB 4P6VF 5AZHA 1PFDA 2SEBD 1NI3A 1WSPA 1K53A 2EMSA 1KLGD 1MI0A 4M00A 2HDEA 2LUMA 1IUEA 3PZ8A 2KQSA 1AN8A 2PVOD 4KGRA 3VQIA 1E90A 1FRDA 2RD0A 4YTPB 2N7EA 2K5PA 2AL3A 2LJIA 2N1WA 4IWQA 4DXGA 2M17A 4XZ4A 1GC6A 3IT6B 4W9FA 3FC4A 1KFYB 2KJRA 3EECA 4ZDVA 3Q69A 3R3MA 4XC2A 2DZJA 2WDTB 2KLGA 3ENEA 2PTLA 2K6DB 3BVZA 2WU2B 4A3OA 3IHPC 4JPSA 3SFEB 2YEPB 4Q2JA 3PRZA 3KUDB 1WGRA 2RDHA 2JVCA 3T9LA 3L17A 3RUIB 2FIDA 3W1YA 2QDFA 1FRRA 3WIMA 2YEPF 4BZAA 2V0GA 1QOAA 5CX3A 4EUTA 2KDIA 4LNIA 1Z5SB 3D32A 4A3PA 2MBOA 2CU3A 2C7HA 3MJ5A 3ZLZA 4BOZB 2V1YA 3AE2B 3AV8A 4TQ1A 2LWPA 2MJDA 3RT3B 2G45B 1XLPA 4MJSA 1TJEA 2C9WB 1XLNA 2MJ3A 1Z2MA 3AECB 2X38A 1BMLC 2GI9A 1L6VA 2G4SA 2IY0B 3HM3A 3R8BA 2MBBB 3QARA 3X23A 2IY1B 2JRIB 1IPGA 2BTEA 2KXJA 1GUAB 3HRDD 2WDVB 1ESFA 2J4XA 4P1CC 2PVGC 4AQ7A 4GIVA 2CJNA 3V05A 3RI7C 2INPE 1KJTA 5D3DA 4GOCA 3B0AA 3TMPB 1IGCA 3VFKA 3CSTA 1E8YA 3AB5A 1I4QA 1KM7A 2LJ5A 1UGJA 2E3TA 4A8XC 2WXQA 4AOFA 4IKGA 4W9CA 1HQRD 3UF8A 4WWMA 4EZKA 3GZNI 2KJ6A 2IYDB 2DBYA 1WI0A 5D94A 2N7DA 2KC2A 3E56A 3IAS1 1V49A 1TIFA 1FXAA 2LGDA 4LNFA 4ANWA 2B76B 3SR6A 3UQAA 1C4AA 3GB1A 1C9FA 2GMIC 1JWBD 3RULA 3R7RA 3BVMA 1UH6A 4QAYA 4I6PA 2KJHB 1I4HA 1G6JA 4ANVA 3ZO5B 2L0FA 3LB8C 5J18A 2D3CA 3ZNHB 4FADA 2MP2A 3QCAA 2JPHA 3DVNU 3GP7A 2ZEQA 1UWMA 2PMVA 3N32A 2ZPYA 3AE5B 2NR2A 2BWFA 2KQ4X 4RGOS 3ZKJC 1C79A 2KDMA 1R4NI 3DHGC 4XYCA 2HE7A 1WJ4A 3UINB 1P98A 3QQ8B 4NAWB 3BVGA 2DAJA 4ARCA 1HZ5A 2M19A 2D07B 3DPDA 2KDEB 4WJOA 1A70A 1SGHA 4YL8A 4KSKC 3NY5A 1BXTA 3AE1B 4K7SA 1D3ZA 3T8MA 3ZVVA 4FHJA 3H7SA 1R4NB 3A9KA 2N9PC 5IKCM 2FUHB 3AE6B 4NAWA 5KHQA 4JX1C 2RPVA 4HDOA 1FNWA 1WZ3A 3JYUA 4REZA 3ML9A 1MJDA 1GG3A 3SU8X 4GMVA 3KQ4A 3ZGZA 2GBRA 2K39A 1QOGA 2O6VD 4FJZA 5DPRA 2L83A 1I35A 3ZRCA 3LDZE 2L7RA 2BQQA 1WXMA 1SJED 1A5RA 5CHWA 4LNNA 2ZPNA 4RCOA 3W1SC 1U4AA 2SAKA 1MVKA 3N3KB 2GBNA 3TEXA 2WU5B 1RFKA 3N9YC 3I57A 3AH7A 4RMAA 1VLBA 3HVDA 4M8MA 3NJTA 4IM0A 1F52A 4USAA 1J7CA 3UQBA 5EE0A 1YJJA 1VCBA 4KGSA 2J52A 3ECIA 2EKEC 2PPHA 5EE3A 2LGXA 4C56C 2RPQA 1MHHE 2LHDA 2V3PA 3Q8CA 2NTSA 2M4NA 4EZJA 1T0RC 4L1BA 1AW7A 2FIFA 4OVZA 1D5MC 4ASWC 1QT9A 1YN5A 2HJ1A 1WF9A 2KN4A 2E6XA 2AL6A 1E6EB 1NYRA 2K3UA 1HE8A 1KLVA 1E8WA 3VUXA 2R2QA 1J7AA 4P1BC 5FR6A 1FM0D 3AN1A 2C7NB 2V3NA 3C0RB 1ZOYB 4B0MA 2QIEB 4IM2A 2NBUA 4N59A 3PT2B 1DYQA 4XDCA 2IBIB 3K9PB 3FKYA 2G3QB 3DBRB 4K81A 5TR5A 2MBHA 2WXFA 2ASQA 5HKHA 1QZEA 1SE9A 2WDRB 2KFKB 5IAAC 4PYZA 3DBRI 4WQOB 4CO7A 5C2TB 3V6CB 4O1NA 4WWOA 3B2GA 3B9JA 1TY2A 3L08A 1GB4A 4YTMB 2L1AA 3AEBB 2O2VB 5HI1A 5FR3A 1WFYA 2QEJC 4RF0A 1PUTA 2VZKB 5JH5C 1E8XA 1AWDA 5C1ZA 2M0XA 3ALBA 2DHZA 3HVZA 1ET6A 1OEYJ 1I4XA 2HTME 2MH7A 2BS3B 1UBQA 4NAMA
chains in the Genus database with same CATH topology
2M17A 4ZYNA 4XZ4A 2LRUA 1GC6A 3WALA 3ZDMC 1GJZA 5DPSA 4HJKA 5L83A 3JSVB 2DYOA 4W9FA 4EZLA 1H4RA 3CSFA 3H6NA 5D6JB 4ICVA 5DCNA 2KJRA 2VRRB 3EECA 4FJVB 4HWIB 3W1SA 2K8HA 2D2QA 1WXAA 2PJHA 4KDLB 3MJWA 4ZDVA 5E6OA 2N9EB 1V5OA 1WZ0A 4I6LB 4M8NA 2BPSA 1ZW7A 3R3MA 2AEHA 2C60A 4RM8A 1WE7A 3L10B 4XC2A 2DZJA 4BOSC 5JHBA 1ZKHA 2BKFA 2WDTB 2KLGA 4ICUA 2LASA 2IO3B 4JL9A 3V61A 3ENEA 2KD0A 2WYQA 1V2YA 2CHXA 2K6DB 4LCDE 2XK5B 2XBBC 4A3OA 3H7PB 3DVGY 3IHPC 3WA0A 4DHZB 2J0MA 3SD5A 3PRZA 2YVCA 3KUDB 1WGRA 2J7QB 2JVCA 3DBSA 3T9LA 3L17A 3VTVA 4FN2A 1V6EA 2NPTB 2JUOA 2RGFA 3CMMB 1V5TA 2Y5BB 3RUIB 2FIDA 3BINA 3MTNB 4IUMB 2REXA 3ML8A 2KFJA 2KVRA 3A1QA 4MGYE 4KIKA 3W1YA 4DK5A 3QJZA 3R66C 1MG8A 1V81A 3WIMA 4FJYA 2J0KA 2YLMA 4FHKA 5DPWA 1C3TA 1J8CA 4G11A 5CX3A 3U7DA 2KX3A 2GBMA 4ANXA 4EUTA 2L3ZA 1XD3B 2KDIA 3VUYA 4GB9A 1Z5SB 3D32A 2CHWA 4A3PA 2MBOA 4W9DA 4NNJB 2C7HA 2V4LA 3RYTA 3EHVA 3ZLZA 3VH4B 4WWPA 1E5WA 2V1YA 3WAPA 4BOZB 2NS5A 4TQ1A 2LWPA 4IWOA 2D10A 4W9JA 2IO0B 3RT3B 2G45B 4MJSA 3AU5A 4WJPA 3JW0X 1YJ1A 4GDLB 1TBEA 2C9WB 5DPTA 3PRMB 4E74A 4JGHB 3V6EB 3DVNV 1WX7A 2CKHB 3VH3B 3VTUA 2KOXA 5G2NA 2KX0A 1Z2MA 3NHEB 3PVLA 2L8JA 3DCGA 3RD2A 2CS4A 2Z0DB 3SDLC 3NS8A 2G4SA 3HM3A 2IY0B 2N1VA 2MLBA 2WX1A 2XEWA 3L54A 4CYEA 2MBBB 3QARA 3X23A 2IY1B 2JRIB 2K25A 1IPGA 4URKA 2K1FA 3TCAA 2LVQA 2KXJA 1GUAB 2KQ7A 1UZXB 3APFA 4PYUA 3PGEA 2NBVB 4GIVA 2A4ZA 4GN1A 4FBJB 1IP9A 3OAWA 3A9JB 2BYVE 1WR6E 3VVWB 3WAMA 1GC7A 3Q3FA 5IA7A 3U30A 1KJTA 1TZ1A 2KKCA 4NPNA 2A5UA 3IFWB 3PSEB 4GOCA 3B0AA 1WRDB 3WANA 2HTHA 3TMPB 2HD5B 2LVOA 3KUZA 1IYFA 3QX1A 1WIAA 4WJNA 1WM2A 2KN5A 3VUWA 3PREA 4IWPA 1C1YB 1E8ZA 1S1QB 3L16A 2KANA 4FULA 1V9JA 2BF8B 3APCA 3GOEA 4IM3A 4NQKE 3VFKA 3CSTA 1E8YA 4B6WA 2ZJDA 1KM7A 2LJ5A 1P3QU 3IVFA 3PS6A 4JIOU 4TQ0A 1L2NA 1YX6B 3DBHI 2DZMA 2B3AA 3EC8A 3JVZX 1T0YA 3PHXB 4GDKA 4I6NB 4MGIE 4AOFA 4W9CA 4B9KA 4BKSA 4BKTA 2I1KA 3UF8A 2WWZA 2KK8A 3ZTDA 1BT0A 4EZKA 4W9KA 2L05A 2Z0EB 4HXDA 3WAOA 2J0JA 3A4SC 2BYFA 3PHWB 4KIKB 4F8CB 3GZNI 3KW5B 3VTWA 2NBWB 2MSED 2KLCA 3H9DA 2KJ6A 2IYDB 4MEMA 1V86A 1WI0A 4X57B 2AWTA 4GU2A 5D94A 2JY6A 2N7DA 2KC2A 3DBLI 1V49A 2LGDA 4MSQB 4ANWA 2Z59B 5BO4B 4WJQA 3UQAA 3AXCA 1M94A 4AJWA 2ZNVB 1SIFA 4PS7A 2GMIC 2CU1A 2RSUA 1OQYA 3AU4A 2AYOB 2NPTA 3DOWA 4HPMB 3R7RA 3RULA 1LXDA 5J2RA 1UH6A 4MGZE 4LDTB 4MM3A 1WXVA 5D2MB 2L76A 4I6PA 2KJHB 1P9DU 3RZWC 3MHSD 4BKSD 1G6JA 3VAWA 3M63B 3X0WA 4ANVA 1WGGA 2K8BA 2L0FA 3ZTCA 3ZO5B 1XQQA 4G0NB 1JRUA 3APDA 4K7UA 5J18A 3ZNZB 2ZCCA 4BKGA 5LXHA 1YX5B 4DDID 1RAXA 4F1SA 3ZNHB 2CHZA 1P0RA 2JXXA 4FADA 1CMXB 1RFAA 3PLUA 2MP2A 3AI5A 1ZGUB 3QCAA 2JPHA 1UELA 3DVNU 4II3B 2ZEQA 4W9GA 5AEKB 2KNBA 3A4RA 3N32A 2ZPYA 1WGDA 4AP4C 2NR2A 1FXTB 2BWFA 1AARA 2ZCBA 2GBJA 5LLIA 1I42A 1LM8B 4JLCA 4A20A 1K8RB 3ZKJC 3ZNID 4EOYA 1LQBA 4BBNF 1R4NI 3A9KB 2DZIA 1WYWB 2HE7A 3VXWA 1WJ4A 1VD2A 3UINB 1P98A 3HK0A 2FAZA 3QQ8B 2MA9B 4NAWB 2DAJA 3TBLD 2V3SA 2LXCA 3HIZA 4NJ6A 1WH3A 1WR1A 2KWCA 4MELA 2D07B 3DPDA 3UIPB 2KDEB 4PS3A 4WJOA 2IZVB 4NY0A 1SGHA 4YL8A 2QHOA 2MRPA 4KSKC 3NZSA 4P7IA 1H8CA 3H1UA 3DDCB 5GMVA 2C5LC 3NY5A 1D3ZA 4K7SA 2MCNB 2UWQA 3T8MA 4E71A 3ZVVA 1ISNA 4FHJA 3H7SA 2D3GA 1X1MA 3A9KA 4M0WB 4IC7B 1YQBA 5AZFA 2N9PC 1LFDA 2FUHB 3V62A 4NAWA 4W9LA 4BVUC 5KHQA 3K9OB 1UBIA 1XT9B 4HDOA 3V60A 4TUUA 3TIXA 2LD9A 2IO2B 1WZ3A 3JYUA 2LGYA 1TTNA 4II2B 3ML9A 1P1AA 1WMHA 2DAFA 3SU8X 1GG3A 2N9XA 2O6VB 3M62B 4GMVA 5KHOA 4HPLB 3QIJA 2GBRA 2ZVNA 4NQLB 1WJ6A 4TV3A 2K39A 2FCMA 2JZZA 2LRWA 2FCSA 2O6VD 4DHZE 1Q5WB 2K6QA 4FJZA 4HLEA 2L0TA 4W9IA 5DPRA 4HDQA 1I35A 1OTRB 4DDGD 3ZRCA 1KOTA 1EF1A 3LDZE 4IW0A 2L7RA 3KH0A 1V80A 3R7QA 1GNUA 3NZUA 3TL5A 5CTRC 2O2VA 2KO3A 1WXMA 5D7GA 4GDKB 4OVUA 1A5RA 1OGWA 5L95C 1OEYA 2KTRA 4DBGA 5CHWA 2FNJB 2ZPNA 4GXBA 2KC1A 3KUCB 3W1SC 4GGQA 4E3CA 2BYEA 1U4AA 2RR9A 4KZ0A 1NBFC 3RZFA 1F9JA 3N3KB 2GBNA 2OJRA 4KDIC 4HCPB 3ZDTA 1WJNA 2KDBA 4RMAA 4RM9A 4K7WA 4M8MA 2CR5A 3UIOB 4IM0A 3PRPB 3ZUNA 2W9NA 1WX9A 3UQBA 2LZ6A 1Q1OA 4WAAA 5CHFA 1WJUA 2IO1B 2K8CA 4BBNC 3ZNGC 1VCBA 4OVVA 4ZRKA 1WGHA 2DYBA 2EKEC 3ECIA 4CHKA 2PPHA 2LGXA 2DX5B 2RPQA 4KZCA 3JSVA 5C23A 4DHJD 5JZEB 2UYZB 1Y8RC 4KV2A 3B1LX 4MJSB 4JQWC 1UD7A 1YD8U 1WXSA 2M4NA 4EZJA 2LI5A 2KDFB 3N30A 3Q3JA 3VDZA 1L7YA 1EF5A 4XX5A 4IG7B 2HJ8A 3P2BA 2C7MB 2FIFA 3BY4B 1WX8A 3KVFB 3ONSA 5G55A 1EO6A 3PPAA 1NI2A 2JRHA 4ANUA 1Q0WB 4N9F4 5LXIB 3PLVA 4ASWC 4EEWA 4HCNB 4MDKE 3VHTC 3QHTA 1S3SG 4DHJB 2ZZPB 1WF9A 2BWES 2EMTA 2I1JA 2MP2B 2AL6A 2NCNA 3KYDD 4G50A 3OJ3A 4W9EA 1TGZB 4W9HA 5AZGA 3NOBA 4GDLA 2KTRB 2JT4B 3QWZB 3A1QB 1RLFA 3HM6X 3ZIMA 2BGFA 5CHVC 3PZDA 4PS8A 2FCNA 4NJ7A 2KHWB 3O65B 3U8ZA 4K1RB 4BFRA 1NDDA 2DYMA 3QK0A 4KSLC 3AULA 3M95A 4EFOA 1HE8A 4MSMB 2ZNVC 1KLVA 3A9JA 1E7VA 1E8WA 4B95A 5EDSA 4LJOB 2L00B 2M1MA 2KMCA 2R2QA 3H7PA 4LJPB 5FR6A 3VUXA 2MW5A 2R2OA 3I3TB 4TKNA 4GSWA 2C7NB 3EFUA 3S2AA 2WX0A 3PV1A 2GBKA 3DVGX 2KZRA 2ZVOA 3C0RB 4MGKE 3QA8A 4IM2A 4HK2A 2NBUA 2FCQA 4ZRIA 4AJYB 2DENB 3L0WB 3PT2B 2BKRB 2LVPA 3IBEA 2JWZA 1J19A 2KWVB 4DXAB 3QC8B 3ZW3A 3DQVA 2IBIB 3K9PB 4K81A 2G3QB 5TR5A 4F7ZA 2D11A 4FA6A 2MWSB 3CF6E 4FLHA 3QAQA 2MBHA 4J6IA 2ASQA 5HKHA 2MBQA 1QZEA 3ZRFA 1SE9A 2NVUI 1E7UA 1WE6A 1WMHB 2KFKB 5IAAC 5JHAA 4PYZA 1EUVB 3DBRI 4WQOB 2PEAA 4CO7A 2PE6B 3PTFC 2G4DB 2MBEA 2M8SA 3V6CB 4ZRJA 4WWOA 4DWFA 4WWNA 2XK5A 2DZKA 2LUEA 3L13A 3TJPA 2GOWA 4G3XB 1WGYA 2N4FA 3L08A 1UGMA 3SHQA 2OOBB 3UGBB 4AWJA 3IG3A 3B08A 5AZHA 4EKUA 2JZ3B 1J0GA 2O2VB 3HHMA 1WFYA 1R4MI 4KVGB 2EMSA 3OJ4B 1WY8A 4MH0E 1YIWA 3KYCD 2KTFA 1E8XA 3RCZA 5JH5C 2KFKA 2LXAA 5J17A 4LDTD 2PE9A 2JF5A 2KQSA 3A33B 2M0XA 3ALBA 3LJ3A 1RRBA 2DHZA 5C1ZA 3VQIA 1E90A 2RD0A 2MQJA 2N7EA 1OEYJ 3M3JA 2KMAA 2KWUB 1PQSA 2AL3A 2O6VA 5E6PA 2MX2A 2N1WA 4IWQA 1WM3A 5E6NA 4AUQC 1UBQA 4HVBA 3OLMD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M17 A;  4ZYN A;  4XZ4 A;  2LRU A;  1GC6 A;  3WAL A;  3ZDM C;  1GJZ A;  5DPS A;  4HJK A;  5L83 A;  3JSV B;  2DYO A;  4W9F A;  4EZL A;  1H4R A;  3CSF A;  3H6N A;  5D6J B;  4ICV A;  5DCN A;  2KJR A;  2VRR B;  3EEC A;  4FJV B;  4HWI B;  3W1S A;  2K8H A;  2D2Q A;  1WXA A;  2PJH A;  4KDL B;  3MJW A;  4ZDV A;  5E6O A;  2N9E B;  1V5O A;  1WZ0 A;  4I6L B;  4M8N A;  2BPS A;  1ZW7 A;  3R3M A;  2AEH A;  2C60 A;  4RM8 A;  1WE7 A;  3L10 B;  4XC2 A;  2DZJ A;  4BOS C;  5JHB A;  1ZKH A;  2BKF A;  2WDT B;  2KLG A;  4ICU A;  2LAS A;  2IO3 B;  4JL9 A;  3V61 A;  3ENE A;  2KD0 A;  2WYQ A;  1V2Y A;  2CHX A;  2K6D B;  4LCD E;  2XK5 B;  2XBB C;  4A3O A;  3H7P B;  3DVG Y;  3IHP C;  3WA0 A;  4DHZ B;  2J0M A;  3SD5 A;  3PRZ A;  2YVC A;  3KUD B;  1WGR A;  2J7Q B;  2JVC A;  3DBS A;  3T9L A;  3L17 A;  3VTV A;  4FN2 A;  1V6E A;  2NPT B;  2JUO A;  2RGF A;  3CMM B;  1V5T A;  2Y5B B;  3RUI B;  2FID A;  3BIN A;  3MTN B;  4IUM B;  2REX A;  3ML8 A;  2KFJ A;  2KVR A;  3A1Q A;  4MGY E;  4KIK A;  3W1Y A;  4DK5 A;  3QJZ A;  3R66 C;  1MG8 A;  1V81 A;  3WIM A;  4FJY A;  2J0K A;  2YLM A;  4FHK A;  5DPW A;  1C3T A;  1J8C A;  4G11 A;  5CX3 A;  3U7D A;  2KX3 A;  2GBM A;  4ANX A;  4EUT A;  2L3Z A;  1XD3 B;  2KDI A;  3VUY A;  4GB9 A;  1Z5S B;  3D32 A;  2CHW A;  4A3P A;  2MBO A;  4W9D A;  4NNJ B;  2C7H A;  2V4L A;  3RYT A;  3EHV A;  3ZLZ A;  3VH4 B;  4WWP A;  1E5W A;  2V1Y A;  3WAP A;  4BOZ B;  2NS5 A;  4TQ1 A;  2LWP A;  4IWO A;  2D10 A;  4W9J A;  2IO0 B;  3RT3 B;  2G45 B;  4MJS A;  3AU5 A;  4WJP A;  3JW0 X;  1YJ1 A;  4GDL B;  1TBE A;  2C9W B;  5DPT A;  3PRM B;  4E74 A;  4JGH B;  3V6E B;  3DVN V;  1WX7 A;  2CKH B;  3VH3 B;  3VTU A;  2KOX A;  5G2N A;  2KX0 A;  1Z2M A;  3NHE B;  3PVL A;  2L8J A;  3DCG A;  3RD2 A;  2CS4 A;  2Z0D B;  3SDL C;  3NS8 A;  2G4S A;  3HM3 A;  2IY0 B;  2N1V A;  2MLB A;  2WX1 A;  2XEW A;  3L54 A;  4CYE A;  2MBB B;  3QAR A;  3X23 A;  2IY1 B;  2JRI B;  2K25 A;  1IPG A;  4URK A;  2K1F A;  3TCA A;  2LVQ A;  2KXJ A;  1GUA B;  2KQ7 A;  1UZX B;  3APF A;  4PYU A;  3PGE A;  2NBV B;  4GIV A;  2A4Z A;  4GN1 A;  4FBJ B;  1IP9 A;  3OAW A;  3A9J B;  2BYV E;  1WR6 E;  3VVW B;  3WAM A;  1GC7 A;  3Q3F A;  5IA7 A;  3U30 A;  1KJT A;  1TZ1 A;  2KKC A;  4NPN A;  2A5U A;  3IFW B;  3PSE B;  4GOC A;  3B0A A;  1WRD B;  3WAN A;  2HTH A;  3TMP B;  2HD5 B;  2LVO A;  3KUZ A;  1IYF A;  3QX1 A;  1WIA A;  4WJN A;  1WM2 A;  2KN5 A;  3VUW A;  3PRE A;  4IWP A;  1C1Y B;  1E8Z A;  1S1Q B;  3L16 A;  2KAN A;  4FUL A;  1V9J A;  2BF8 B;  3APC A;  3GOE A;  4IM3 A;  4NQK E;  3VFK A;  3CST A;  1E8Y A;  4B6W A;  2ZJD A;  1KM7 A;  2LJ5 A;  1P3Q U;  3IVF A;  3PS6 A;  4JIO U;  4TQ0 A;  1L2N A;  1YX6 B;  3DBH I;  2DZM A;  2B3A A;  3EC8 A;  3JVZ X;  1T0Y A;  3PHX B;  4GDK A;  4I6N B;  4MGI E;  4AOF A;  4W9C A;  4B9K A;  4BKS A;  4BKT A;  2I1K A;  3UF8 A;  2WWZ A;  2KK8 A;  3ZTD A;  1BT0 A;  4EZK A;  4W9K A;  2L05 A;  2Z0E B;  4HXD A;  3WAO A;  2J0J A;  3A4S C;  2BYF A;  3PHW B;  4KIK B;  4F8C B;  3GZN I;  3KW5 B;  3VTW A;  2NBW B;  2MSE D;  2KLC A;  3H9D A;  2KJ6 A;  2IYD B;  4MEM A;  1V86 A;  1WI0 A;  4X57 B;  2AWT A;  4GU2 A;  5D94 A;  2JY6 A;  2N7D A;  2KC2 A;  3DBL I;  1V49 A;  2LGD A;  4MSQ B;  4ANW A;  2Z59 B;  5BO4 B;  4WJQ A;  3UQA A;  3AXC A;  1M94 A;  4AJW A;  2ZNV B;  1SIF A;  4PS7 A;  2GMI C;  2CU1 A;  2RSU A;  1OQY A;  3AU4 A;  2AYO B;  2NPT A;  3DOW A;  4HPM B;  3R7R A;  3RUL A;  1LXD A;  5J2R A;  1UH6 A;  4MGZ E;  4LDT B;  4MM3 A;  1WXV A;  5D2M B;  2L76 A;  4I6P A;  2KJH B;  1P9D U;  3RZW C;  3MHS D;  4BKS D;  1G6J A;  3VAW A;  3M63 B;  3X0W A;  4ANV A;  1WGG A;  2K8B A;  2L0F A;  3ZTC A;  3ZO5 B;  1XQQ A;  4G0N B;  1JRU A;  3APD A;  4K7U A;  5J18 A;  3ZNZ B;  2ZCC A;  4BKG A;  5LXH A;  1YX5 B;  4DDI D;  1RAX A;  4F1S A;  3ZNH B;  2CHZ A;  1P0R A;  2JXX A;  4FAD A;  1CMX B;  1RFA A;  3PLU A;  2MP2 A;  3AI5 A;  1ZGU B;  3QCA A;  2JPH A;  1UEL A;  3DVN U;  4II3 B;  2ZEQ A;  4W9G A;  5AEK B;  2KNB A;  3A4R A;  3N32 A;  2ZPY A;  1WGD A;  4AP4 C;  2NR2 A;  1FXT B;  2BWF A;  1AAR A;  2ZCB A;  2GBJ A;  5LLI A;  1I42 A;  1LM8 B;  4JLC A;  4A20 A;  1K8R B;  3ZKJ C;  3ZNI D;  4EOY A;  1LQB A;  4BBN F;  1R4N I;  3A9K B;  2DZI A;  1WYW B;  2HE7 A;  3VXW A;  1WJ4 A;  1VD2 A;  3UIN B;  1P98 A;  3HK0 A;  2FAZ A;  3QQ8 B;  2MA9 B;  4NAW B;  2DAJ A;  3TBL D;  2V3S A;  2LXC A;  3HIZ A;  4NJ6 A;  1WH3 A;  1WR1 A;  2KWC A;  4MEL A;  2D07 B;  3DPD A;  3UIP B;  2KDE B;  4PS3 A;  4WJO A;  2IZV B;  4NY0 A;  1SGH A;  4YL8 A;  2QHO A;  2MRP A;  4KSK C;  3NZS A;  4P7I A;  1H8C A;  3H1U A;  3DDC B;  5GMV A;  2C5L C;  3NY5 A;  1D3Z A;  4K7S A;  2MCN B;  2UWQ A;  3T8M A;  4E71 A;  3ZVV A;  1ISN A;  4FHJ A;  3H7S A;  2D3G A;  1X1M A;  3A9K A;  4M0W B;  4IC7 B;  1YQB A;  5AZF A;  2N9P C;  1LFD A;  2FUH B;  3V62 A;  4NAW A;  4W9L A;  4BVU C;  5KHQ A;  3K9O B;  1UBI A;  1XT9 B;  4HDO A;  3V60 A;  4TUU A;  3TIX A;  2LD9 A;  2IO2 B;  1WZ3 A;  3JYU A;  2LGY A;  1TTN A;  4II2 B;  3ML9 A;  1P1A A;  1WMH A;  2DAF A;  3SU8 X;  1GG3 A;  2N9X A;  2O6V B;  3M62 B;  4GMV A;  5KHO A;  4HPL B;  3QIJ A;  2GBR A;  2ZVN A;  4NQL B;  1WJ6 A;  4TV3 A;  2K39 A;  2FCM A;  2JZZ A;  2LRW A;  2FCS A;  2O6V D;  4DHZ E;  1Q5W B;  2K6Q A;  4FJZ A;  4HLE A;  2L0T A;  4W9I A;  5DPR A;  4HDQ A;  1I35 A;  1OTR B;  4DDG D;  3ZRC A;  1KOT A;  1EF1 A;  3LDZ E;  4IW0 A;  2L7R A;  3KH0 A;  1V80 A;  3R7Q A;  1GNU A;  3NZU A;  3TL5 A;  5CTR C;  2O2V A;  2KO3 A;  1WXM A;  5D7G A;  4GDK B;  4OVU A;  1A5R A;  1OGW A;  5L95 C;  1OEY A;  2KTR A;  4DBG A;  5CHW A;  2FNJ B;  2ZPN A;  4GXB A;  2KC1 A;  3KUC B;  3W1S C;  4GGQ A;  4E3C A;  2BYE A;  1U4A A;  2RR9 A;  4KZ0 A;  1NBF C;  3RZF A;  1F9J A;  3N3K B;  2GBN A;  2OJR A;  4KDI C;  4HCP B;  3ZDT A;  1WJN A;  2KDB A;  4RMA A;  4RM9 A;  4K7W A;  4M8M A;  2CR5 A;  3UIO B;  4IM0 A;  3PRP B;  3ZUN A;  2W9N A;  1WX9 A;  3UQB A;  2LZ6 A;  1Q1O A;  4WAA A;  5CHF A;  1WJU A;  2IO1 B;  2K8C A;  4BBN C;  3ZNG C;  1VCB A;  4OVV A;  4ZRK A;  1WGH A;  2DYB A;  2EKE C;  3ECI A;  4CHK A;  2PPH A;  2LGX A;  2DX5 B;  2RPQ A;  4KZC A;  3JSV A;  5C23 A;  4DHJ D;  5JZE B;  2UYZ B;  1Y8R C;  4KV2 A;  3B1L X;  4MJS B;  4JQW C;  1UD7 A;  1YD8 U;  1WXS A;  2M4N A;  4EZJ A;  2LI5 A;  2KDF B;  3N30 A;  3Q3J A;  3VDZ A;  1L7Y A;  1EF5 A;  4XX5 A;  4IG7 B;  2HJ8 A;  3P2B A;  2C7M B;  2FIF A;  3BY4 B;  1WX8 A;  3KVF B;  3ONS A;  5G55 A;  1EO6 A;  3PPA A;  1NI2 A;  2JRH A;  4ANU A;  1Q0W B;  4N9F 4;  5LXI B;  3PLV A;  4ASW C;  4EEW A;  4HCN B;  4MDK E;  3VHT C;  3QHT A;  1S3S G;  4DHJ B;  2ZZP B;  1WF9 A;  2BWE S;  2EMT A;  2I1J A;  2MP2 B;  2AL6 A;  2NCN A;  3KYD D;  4G50 A;  3OJ3 A;  4W9E A;  1TGZ B;  4W9H A;  5AZG A;  3NOB A;  4GDL A;  2KTR B;  2JT4 B;  3QWZ B;  3A1Q B;  1RLF A;  3HM6 X;  3ZIM A;  2BGF A;  5CHV C;  3PZD A;  4PS8 A;  2FCN A;  4NJ7 A;  2KHW B;  3O65 B;  3U8Z A;  4K1R B;  4BFR A;  1NDD A;  2DYM A;  3QK0 A;  4KSL C;  3AUL A;  3M95 A;  4EFO A;  1HE8 A;  4MSM B;  2ZNV C;  1KLV A;  3A9J A;  1E7V A;  1E8W A;  4B95 A;  5EDS A;  4LJO B;  2L00 B;  2M1M A;  2KMC A;  2R2Q A;  3H7P A;  4LJP B;  5FR6 A;  3VUX A;  2MW5 A;  2R2O A;  3I3T B;  4TKN A;  4GSW A;  2C7N B;  3EFU A;  3S2A A;  2WX0 A;  3PV1 A;  2GBK A;  3DVG X;  2KZR A;  2ZVO A;  3C0R B;  4MGK E;  3QA8 A;  4IM2 A;  4HK2 A;  2NBU A;  2FCQ A;  4ZRI A;  4AJY B;  2DEN B;  3L0W B;  3PT2 B;  2BKR B;  2LVP A;  3IBE A;  2JWZ A;  1J19 A;  2KWV B;  4DXA B;  3QC8 B;  3ZW3 A;  3DQV A;  2IBI B;  3K9P B;  4K81 A;  2G3Q B;  5TR5 A;  4F7Z A;  2D11 A;  4FA6 A;  2MWS B;  3CF6 E;  4FLH A;  3QAQ A;  2MBH A;  4J6I A;  2ASQ A;  5HKH A;  2MBQ A;  1QZE A;  3ZRF A;  1SE9 A;  2NVU I;  1E7U A;  1WE6 A;  1WMH B;  2KFK B;  5IAA C;  5JHA A;  4PYZ A;  1EUV B;  3DBR I;  4WQO B;  2PEA A;  4CO7 A;  2PE6 B;  3PTF C;  2G4D B;  2MBE A;  2M8S A;  3V6C B;  4ZRJ A;  4WWO A;  4DWF A;  4WWN A;  2XK5 A;  2DZK A;  2LUE A;  3L13 A;  3TJP A;  2GOW A;  4G3X B;  1WGY A;  2N4F A;  3L08 A;  1UGM A;  3SHQ A;  2OOB B;  3UGB B;  4AWJ A;  3IG3 A;  3B08 A;  5AZH A;  4EKU A;  2JZ3 B;  1J0G A;  2O2V B;  3HHM A;  1WFY A;  1R4M I;  4KVG B;  2EMS A;  3OJ4 B;  1WY8 A;  4MH0 E;  1YIW A;  3KYC D;  2KTF A;  1E8X A;  3RCZ A;  5JH5 C;  2KFK A;  2LXA A;  5J17 A;  4LDT D;  2PE9 A;  2JF5 A;  2KQS A;  3A33 B;  2M0X A;  3ALB A;  3LJ3 A;  1RRB A;  2DHZ A;  5C1Z A;  3VQI A;  1E90 A;  2RD0 A;  2MQJ A;  2N7E A;  1OEY J;  3M3J A;  2KMA A;  2KWU B;  1PQS A;  2AL3 A;  2O6V A;  5E6P A;  2MX2 A;  2N1W A;  4IWQ A;  1WM3 A;  5E6N A;  4AUQ C;  1UBQ A;  4HVB A;  3OLM D; 
#chains in the Genus database with same CATH topology
 1SXT A;  2LRU A;  2FUG 1;  3WAL A;  1HTQ A;  3ZDM C;  3ABV B;  5L83 A;  3JSV B;  4EZL A;  1H4R A;  5D6J B;  1R7S A;  3W1S A;  4KDL B;  3EUB 2;  1SB3 C;  2BT6 A;  1WZ0 A;  2N9E B;  4I6L B;  2BPS A;  4YTN B;  3T3O A;  1WE7 A;  3L10 B;  1FFV A;  5JHB A;  3P4R B;  3V61 A;  4JL9 A;  2IO3 B;  2GRI A;  3H7P B;  3Q14 C;  2N7J A;  2J0M A;  3SD5 A;  1K52 A;  2J7Q B;  2JUO A;  2Y5B B;  2JYE A;  2KVR A;  4KIK A;  2H88 B;  3R66 C;  1VZ8 A;  4KGT A;  2EKI A;  2YLM A;  2V4I B;  4G11 A;  2KYW A;  3BZD B;  2KX3 A;  2GBM A;  4ANX A;  3VUY A;  2INN E;  4GB9 A;  4RF1 A;  2DNF A;  4OZB A;  1VZ7 A;  1SE3 A;  4NNJ B;  2V4L A;  3RYT A;  1YQ3 B;  3VH4 B;  4WWP A;  1E5W A;  2R61 A;  2W3S A;  4IWO A;  4W9J A;  2NTT A;  1QLB B;  1T5X D;  1GAQ B;  3VR8 B;  1E10 A;  3AU5 A;  1YJ1 A;  4GDL B;  1VR9 A;  2WXJ A;  1ROE A;  5DPT A;  3GE8 C;  3VH3 B;  2KOX A;  5G2N A;  3RD2 A;  3DCG A;  3ETR A;  3L54 A;  2XEW A;  1PDX A;  1QOF A;  3J9C A;  2K1F A;  3BII D;  2LVQ A;  4KKJ A;  2KQ7 A;  1ZXH A;  1UZX B;  4PYU A;  3OG5 A;  5HFY A;  3PGE A;  3I9V 1;  2VH1 A;  1P7E A;  2WNM A;  3A9J B;  2BYV E;  3WAM A;  1GC7 A;  5IA7 A;  3U30 A;  3WAN A;  4B0E A;  2LVO A;  3QX1 A;  1WIA A;  4WJN A;  1B9R A;  4IOI E;  3VUW A;  3WCQ A;  1C1Y B;  1S1Q B;  5BMG A;  3L16 A;  3APC A;  1XLQ A;  4D2K A;  3MFG A;  4B6W A;  4US8 A;  2ZJD A;  4R3D A;  3IVF A;  4JIO U;  3DBH I;  2DZM A;  2B3A A;  4HKZ E;  3EC8 A;  1T0Y A;  4MGI E;  4BKT A;  1SE2 A;  3Q3O C;  2IPK D;  1EU3 A;  4M01 A;  4W9K A;  4H2A A;  3WAO A;  2J0J A;  1ZP0 B;  3VTW A;  2NBW B;  2Y5P A;  2MSE D;  1TY0 A;  2KLC A;  3NRZ A;  1T0S C;  1V86 A;  1I4P A;  2Z59 B;  5BO4 B;  4WJQ A;  5BYQ A;  2ZW1 A;  3DBH B;  1F77 A;  2ZNV B;  4PS7 A;  3HUI A;  1OQY A;  3TEY A;  4HPM B;  3I5J C;  1JAL A;  3NUH B;  4MGZ E;  4PK1 A;  3EA6 A;  3P4P B;  3IT4 B;  4BKS D;  5IO9 A;  3M63 B;  3VRA B;  1WGG A;  3SEB A;  1XQQ A;  3KLS X;  1JRU A;  4K7U A;  2PW9 A;  2AQ3 B;  5LXH A;  1TT5 B;  1WWT A;  3N1Z C;  5LNK 1;  2CHZ A;  1P0R A;  4C00 A;  5BYR A;  3PLU A;  1HEZ E;  1UEL A;  4II3 B;  5AEK B;  2DLB A;  3A4R A;  1WGD A;  4AP4 C;  3MC0 B;  1K8R B;  1FPY A;  3U7Z A;  4RNA A;  4BBN F;  1D6E C;  2BBC A;  3DBL B;  1TKG A;  3HK0 A;  2MA9 B;  4IDI A;  1TS4 A;  4NJ6 A;  2KWC A;  3BK2 A;  2QHO A;  1OQQ A;  4P7I A;  1H8C A;  5GMV A;  4DQO C;  3RFZ B;  3Q8B A;  4FXC A;  2Z8L A;  4AS1 A;  1YNT E;  4E71 A;  1ISN A;  5EE9 A;  1JRO A;  1V1P A;  5AZF A;  4OW0 A;  3V62 A;  1B1Z A;  2INC C;  1J7B A;  1XT9 B;  3H8H A;  3TIX A;  2LD9 A;  2LGY A;  2Y5C A;  4II2 B;  1L6U A;  1WMH A;  5KHO A;  4HPL B;  2ZVN A;  1WJ6 A;  1STE A;  2JZZ A;  2WP9 B;  4DHZ E;  5JXV A;  4HRS A;  1OTR B;  2ON8 A;  1KOT A;  1EF1 A;  1ZPS A;  3KH0 A;  3TL5 A;  5CTR C;  2O2V A;  2ZW0 A;  1FO4 A;  5D7G A;  4GDK B;  4OVU A;  4MAC A;  1OGW A;  1ACC A;  2AQ2 B;  5GXG B;  2KWD A;  1FD6 A;  2KC1 A;  1JRP A;  2RR9 A;  1F9J A;  1I4R A;  2D3B A;  2M56 B;  3R2I A;  4J3O D;  2KDB A;  4RM9 A;  2CR5 A;  3UIO B;  1E7P B;  2JX5 A;  3OWE B;  4BBN C;  4OVV A;  2DYB A;  1M4V A;  4A9A A;  4C7Y A;  3DWM A;  5IP4 D;  3JSV A;  5C23 A;  4DHJ D;  2KVZ A;  3B1L X;  3EGR A;  1WXS A;  3Q3M C;  3NVW A;  2G9H D;  3P1M A;  3KVF B;  2WDQ B;  1D4B A;  1EO6 A;  2BVC A;  2JRH A;  3AM9 A;  4ANU A;  5LXI B;  3PLV A;  4YT0 B;  4ZOH C;  2N9L A;  2W54 A;  1ZDV A;  2BWE S;  2I1J A;  1VZ6 A;  3W5U B;  1TYG B;  4WH4 A;  4W9E A;  3QWZ B;  3A1Q B;  3HM6 X;  1UF0 A;  2BGF A;  5CHV C;  4XGA B;  2FCN A;  4NJ7 A;  3O65 B;  4MSM B;  1E7V A;  3FIL B;  2ONQ A;  5EDS A;  4LJO B;  2LHE A;  2L00 B;  4LJP B;  2KMC A;  2MW5 A;  2R2O A;  3I3T B;  4TKN A;  2V9H A;  1L5P A;  2JXT A;  2WHI A;  1MPE A;  4RH6 A;  4HK2 A;  3CWI A;  2DEN B;  3L0W B;  2LVP A;  1L0X B;  1J19 A;  2KWV B;  3QC8 B;  3DQV A;  3RNB C;  2D11 A;  3QAQ A;  2MBQ A;  3ZRF A;  4OHJ A;  4P16 A;  2NVU I;  1EUV B;  2PEA A;  1ET9 A;  3P4Q B;  3PTF C;  5EE1 A;  5TSS A;  4DWF A;  3KWV A;  4G3X B;  1XLO A;  4A55 A;  3UGB B;  4AWJ A;  2K9X A;  2JZ3 B;  1EM7 A;  4KVG B;  1MHX A;  1TS5 A;  3ZJT A;  3KYC D;  1XCQ L;  3L4P A;  2LXA A;  2PE9 A;  2JF5 A;  1RWS A;  3BWU D;  2MQJ A;  2XNA C;  3M3J A;  2QMT A;  1HTO A;  1FNV A;  2KWU B;  1PQS A;  2O6V A;  5E6P A;  1CK1 A;  4AUQ C;  4HVB A;  3RNC C;  4ZYN A;  2TSS A;  5DPS A;  4HJK A;  1KRH A;  3GS2 A;  2DYO A;  4ICV A;  4ARI A;  1KLU D;  4YXD B;  4FJV B;  2D2Q A;  2KAC A;  3MJW A;  3RN9 C;  5E6O A;  1V5O A;  3NG0 A;  1KTK A;  1N60 A;  4M8N A;  1F0Z A;  1ZW7 A;  2AEH A;  4YSY B;  4BOS C;  2BKF A;  4ICU A;  2LAS A;  2QCZ A;  2WYQ A;  1V2Y A;  2CHX A;  2PKO A;  4LCD E;  3ZXV A;  4S17 A;  3DVG Y;  2M0A A;  4DHZ B;  5H92 C;  5MPO A;  3DBS A;  2NPT B;  1L0Y B;  2RGF A;  4ZHO A;  3BIN A;  3MHZ A;  2REX A;  3TSS A;  2KFJ A;  4DK5 A;  3QJZ A;  4FJY A;  2IGH A;  2WXK A;  1J8C A;  3U7D A;  3AEF B;  3MP9 A;  2CHW A;  1FNU A;  4W9D A;  3WAP A;  3AEE B;  2D10 A;  4EE2 A;  2LGI A;  2IO0 B;  3NVY A;  1WRI A;  4WJP A;  3P63 A;  3AE9 B;  3JW0 X;  1TBE A;  4M02 A;  1V1O A;  2MEK A;  4PT5 A;  3PRM B;  1T3Q A;  3V6E B;  3RNF C;  1WX7 A;  2CKH B;  3VTU A;  3RPF C;  1PGX A;  2CS4 A;  2Z0D B;  2N1V A;  4CYE A;  1E0Z A;  4URK A;  3TCA A;  3RNE C;  2XN9 C;  2NBV B;  2JQR B;  4FBJ B;  2FE8 A;  1IP9 A;  4LNK A;  3AMZ A;  2KKC A;  4NPN A;  2A5U A;  1WYG A;  2OJW A;  1WRD B;  2HTH A;  2HD5 B;  4RGN A;  1IYF A;  4KKI A;  5C3J B;  1P7F A;  3UI3 A;  4RGM A;  2KAN A;  4FUL A;  1V9J A;  3GOE A;  3URY A;  4NQK E;  2JSV X;  5AUI A;  3AED B;  3BK1 A;  1YX6 B;  3BYT B;  3N1X C;  3JVZ X;  3PHX B;  4GDK A;  1FCL A;  4L23 A;  4BKS A;  2I1K A;  1BT0 A;  2EEL A;  4US9 A;  4HXD A;  3VRB B;  2BYF A;  3PHW B;  4F8C B;  2QSD A;  4MEM A;  4N58 A;  4GU2 A;  1ENF A;  5H8Y E;  1EWY C;  1GOZ A;  3AXC A;  4AJW A;  2CU1 A;  2RSU A;  2AYO B;  1LXD A;  4XWT A;  4MM3 A;  1WXV A;  1V1P B;  5D2M B;  2WXI A;  1P9D U;  1JWS D;  3RZW C;  1K51 A;  3VAW A;  1VJK A;  3X0W A;  2ACZ B;  2ICI A;  4G0N B;  3APD A;  2BW2 A;  2JWU A;  3ZNZ B;  4DDI D;  1SSN A;  4RFB A;  1SIJ A;  2JXX A;  2WXR A;  3CIR B;  1QKZ A;  1N5X A;  2KNB A;  2N9K A;  1FXT B;  1AAR A;  1I42 A;  1LM8 B;  4JLC A;  4A20 A;  2JYT A;  2CJO A;  4EOY A;  1LQB A;  3N20 C;  1KH0 A;  1TS2 A;  3A9K B;  2DZI A;  1WYW B;  1CQV A;  1VD2 A;  1FFU A;  3IAM 1;  3TBL D;  2V3S A;  1JML A;  1WH3 A;  1SF0 A;  4MEL A;  2IGG A;  3TEZ A;  1D5Z C;  3AE3 B;  3C19 A;  3NZS A;  3H1U A;  3DDC B;  5BMH A;  2UWQ A;  1ZE3 D;  1X1M A;  4IC7 B;  1YQB A;  2N0S B;  1UWX A;  3MC9 A;  1SE4 A;  1DOI A;  3BYY B;  3K9O B;  1UBI A;  3NVZ A;  3V60 A;  4TUU A;  1XF5 L;  2VH2 A;  2J42 A;  1XXG A;  2N9X A;  2RDB C;  1QQR A;  5FKA C;  4NQL B;  3U4E G;  1OQR A;  2FCM A;  2LRW A;  4XWW A;  1AYF A;  2K6Q A;  2J53 A;  2L0T A;  3GE3 C;  4W9I A;  4A90 A;  1F2R I;  1I4G A;  3R7Q A;  1GNU A;  1SBB B;  3NZU A;  2G1E A;  4ZHP A;  2KO3 A;  1OEY A;  2KTR A;  4YSX B;  2FNJ B;  2IJ0 A;  1YJI A;  3KUC B;  4GGQ A;  2BYE A;  4KZ0 A;  4TSS A;  4K3B A;  2OJR A;  1HA5 A;  1ZDX A;  1TKY A;  3ZDT A;  4HJG E;  1LGR A;  5AUK A;  3ZUN A;  2W9N A;  4K3C A;  2LZ6 A;  1Q1O A;  4WAA A;  1RYJ A;  2K8C A;  4ZRK A;  1WGH A;  3I63 C;  2Q5W D;  4MJS B;  2UYZ B;  1YD8 U;  2LI5 A;  4WIP A;  3T3N A;  3Q3J A;  1L7Y A;  1EF5 A;  4XX5 A;  5IOI A;  2KAJ A;  3U2S C;  2C7M B;  1WX8 A;  5G55 A;  3ONS A;  3PPA A;  4N9F 4;  4EEW A;  4HCN B;  1QOB A;  3GZN B;  1S3S G;  4DHJ B;  4G50 A;  1D5X C;  3OJ3 A;  1TGZ B;  4W9H A;  5AZG A;  3NOB A;  4GDL A;  2FBW B;  2JT4 B;  1EWC A;  3Q8A A;  3PZD A;  4PS8 A;  2KHW B;  2WXO A;  4K1R B;  3U8Z A;  4BFR A;  2DYM A;  4EFO A;  1L4Z B;  5HHD G;  1XEE A;  4B95 A;  3RNG C;  5I4D A;  3H7P A;  2QJL A;  3S2A A;  4GSW A;  2WX0 A;  1N63 A;  2LGS A;  2IND C;  2GBK A;  3N1Y C;  2KZR A;  4MGK E;  3QA8 A;  4ZRI A;  4ZYS A;  2JWZ A;  2MHJ A;  4NJC A;  4DXA B;  3ZW3 A;  3E9S A;  1YQ4 B;  2D5G A;  1C4C A;  4MT5 A;  1NVI D;  2MWS B;  1Q10 A;  1E7U A;  1WE6 A;  1WMH B;  5JHA A;  3LYY A;  2IDY A;  1JWU D;  4NZL B;  2MBE A;  4ZRJ A;  2DZK A;  3L13 A;  1XO3 A;  2LFI A;  2N4F A;  2VZK D;  2BB6 A;  3IXS A;  3IG3 A;  2WXL A;  4N6E B;  3B08 A;  4EKU A;  1NEK B;  1J0G A;  3HHM A;  1ZUD 2;  1R4M I;  3OJ4 B;  1WY8 A;  4MH0 E;  1FIQ A;  1YIW A;  2KTF A;  3RCZ A;  1CZP A;  2KFK A;  4WAF A;  5J17 A;  4LDT D;  3A33 B;  3LJ3 A;  2WS3 B;  3SFD B;  1RRB A;  4S0R A;  1YOV B;  1WGK A;  2BYT A;  2KMA A;  2MX2 A;  1WM3 A;  5E6N A;  1C77 A;  3OLM D;  1WXQ A;  2JZP A;  4C4V A;  1GJZ A;  3AE8 B;  3CSF A;  3H6N A;  5D3I B;  5DCN A;  2VRR B;  4HWI B;  2K8H A;  2PJH A;  1WXA A;  1IBX B;  4WUR A;  1GB1 A;  4ITK A;  2C60 A;  4RM8 A;  1HXY D;  1ZKH A;  1OFF A;  1PGA A;  1N62 A;  1UUP A;  2KD0 A;  2XK5 B;  4OZA A;  2XBB C;  5HG2 A;  3WA0 A;  2YVC A;  2D3A A;  3VTV A;  4FN2 A;  1V6E A;  3TUO A;  3CMM B;  1V5T A;  2QIL A;  3MTN B;  2NMQ A;  4IUM B;  3ML8 A;  1IBX A;  3A1Q A;  4MGY E;  2LEK A;  1MG8 A;  1V81 A;  4OZC A;  2J0K A;  5DPW A;  4FHK A;  3TEW A;  3FIL A;  1C3T A;  2AQ1 B;  2LMC A;  5E6J A;  2L3Z A;  1XD3 B;  1PGB A;  1SJH D;  3EHV A;  1NEN B;  2NS5 A;  1V97 A;  1JW9 D;  1T6B X;  3PZ7 A;  2K22 A;  3Q2A C;  3ZYY X;  4JWU C;  4E74 A;  4JGH B;  1PYW D;  3DVN V;  3KWL A;  3RMK C;  1N61 A;  2MJE A;  1YN3 A;  2KX0 A;  3NZ3 A;  3NHE B;  3PVL A;  2L8J A;  4LK0 M;  3SDL C;  3NS8 A;  2Y3A A;  2MLB A;  2WX1 A;  2K25 A;  2K0P A;  5G5G A;  5FK9 C;  3APF A;  1CJE A;  2A4Z A;  4GN1 A;  2W82 A;  3OAW A;  4LLG M;  1WR6 E;  3VVW B;  3Q3F A;  1TZ1 A;  3IFW B;  3Q8F A;  2WXM A;  3PSE B;  5IN7 A;  3KUZ A;  1JWM D;  1WM2 A;  1TKE A;  3DWG C;  1BUI C;  2KN5 A;  1E9M A;  3PRE A;  4IWP A;  1SEB D;  1E8Z A;  2RMM A;  1QF6 A;  4MH8 A;  1DGJ A;  2BF8 B;  4IM3 A;  3ZQ4 A;  2IGD A;  1P3Q U;  3PS6 A;  4TQ0 A;  1MG4 A;  1L2N A;  1L4D B;  1FEH A;  4I6N B;  1N6Z A;  1JQ4 A;  1JCK B;  4B9K A;  1K50 A;  2WWZ A;  2KK8 A;  3ZTD A;  4GLS C;  1VDV A;  2L05 A;  2Z0E B;  3Q8E A;  3A4S C;  4KIK B;  3KW5 B;  2KMM A;  3H9D A;  1QIL A;  4X57 B;  2AWT A;  2L52 A;  2JY6 A;  3DBL I;  2H89 B;  4MSQ B;  4ZRP A;  1TZO A;  1M94 A;  3AE4 B;  1YMH E;  1SIF A;  1YN4 A;  3DOW A;  3AU4 A;  2NPT A;  3FAH A;  5J2R A;  4MM3 B;  2BS2 B;  4LDT B;  2WQY B;  3MC8 A;  2L76 A;  3P4S B;  1HZ6 A;  3MHS D;  2K8B A;  3ZTC A;  4YSZ B;  2ZCC A;  4BKG A;  1YX5 B;  2W55 A;  3ZJV A;  1RAX A;  4F1S A;  2OED A;  1CMX B;  1RFA A;  4CQN A;  3AI5 A;  1ZGU B;  2AX5 A;  4W9G A;  3R2T A;  3B2F A;  3AE7 B;  2ZCB A;  1C76 A;  2GBJ A;  3EFC A;  5LLI A;  4ACF A;  3ZNI D;  2OHF A;  1FMA D;  3VXW A;  2I2Y A;  2FAZ A;  2RDG A;  1XCT L;  2LXC A;  3HIZ A;  1WR1 A;  3UIP B;  1EU4 A;  4PS3 A;  2IZV B;  4NY0 A;  2MRP A;  3AEA B;  4HKQ A;  2C5L C;  2L32 A;  3NVV A;  2MCN B;  1VRA B;  4C7Z A;  4L2Y A;  2D3G A;  3ZJU A;  4M0W B;  4LTU A;  1LFD A;  4W9L A;  4BVU C;  2WXH A;  1TS3 A;  1T0Q C;  2GB1 A;  1DOY A;  2IO2 B;  4XE0 A;  1TTN A;  1FXI A;  1P1A A;  3VR9 B;  2DAF A;  2O6V B;  3M62 B;  1MFW A;  3QIJ A;  4TV3 A;  2FCS A;  1Q5W B;  4HLE A;  2WXN A;  3PO0 A;  4HDQ A;  3V3X A;  4M0W A;  3DHI C;  4DDG D;  4HEA 1;  4IW0 A;  2W3R A;  3O13 A;  2WLB A;  1V80 A;  4BAX A;  5BYS A;  5L95 C;  2PLP A;  1C78 A;  4DBG A;  4GXB A;  4E3C A;  3ZXR A;  1NBF C;  2DWQ A;  3RZF A;  4LNO A;  4KDI C;  4HCP B;  5BMI A;  1IGD A;  1WJN A;  4HPP A;  4WQM A;  4K7W A;  4UDU C;  2KT7 A;  3PRP B;  1WX9 A;  3C8Y A;  5CHF A;  1WJU A;  2IO1 B;  3U52 E;  3ZNG C;  4C80 A;  4TMA B;  4CHK A;  1GPX A;  1L0V B;  2DX5 B;  4C4V B;  4RGT A;  2WXP A;  4KZC A;  4HRO A;  5G5H A;  5JZE B;  1Y8R C;  4KV2 A;  1NYQ A;  4JQW C;  1UD7 A;  1RM6 C;  2KDF B;  1R4M B;  3N30 A;  3VDZ A;  2JU6 X;  4IG7 B;  2HJ8 A;  1JWA D;  4JWS C;  3P2B A;  3W5V B;  3BY4 B;  1LO5 D;  2BS4 B;  1NI2 A;  5T8I A;  1Q0W B;  1F2R C;  4MDK E;  3VHT C;  3QHT A;  4YWG G;  2ZZP B;  2EMT A;  2MP2 B;  2NCN A;  3KYD D;  1V8C A;  3Q3N C;  2KTR B;  1RLF A;  3ZIM A;  4DXF A;  2PIA A;  3P42 A;  4XDD A;  1NDD A;  3QK0 A;  2X8X X;  2GLS A;  4KSL C;  3AUL A;  3RNA C;  3M95 A;  2ZNV C;  2UU7 A;  3A9J A;  2BB5 A;  3Q6B A;  1N5W A;  2M1M A;  1FCC C;  1F1H A;  2WGS A;  3EFU A;  3PV1 A;  1I7H A;  3DVG X;  2ZVO A;  1ZXI A;  2FCQ A;  4AJY B;  2WXG A;  3LXF A;  3AEG B;  2BKR B;  3IBE A;  1UNS A;  3W2D A;  4F7Z A;  4FA6 A;  3CF6 E;  4FLH A;  3NS1 A;  4J6I A;  2I38 A;  4A6Q A;  1C4P A;  2QC8 A;  3DHH C;  1Y56 A;  2PE6 B;  2G4D B;  2M8S A;  1DOX A;  4ZRQ A;  4JE3 B;  1KF6 B;  4KX6 B;  4WWN A;  2XK5 A;  2LUE A;  3TJP A;  2GOW A;  1WGY A;  1UGM A;  3SHQ A;  2OOB B;  3W9C B;  4P6V F;  5AZH A;  1PFD A;  2SEB D;  1NI3 A;  1WSP A;  1K53 A;  2EMS A;  1KLG D;  1MI0 A;  4M00 A;  2HDE A;  2LUM A;  1IUE A;  3PZ8 A;  2KQS A;  1AN8 A;  2PVO D;  4KGR A;  3VQI A;  1E90 A;  1FRD A;  2RD0 A;  4YTP B;  2N7E A;  2K5P A;  2AL3 A;  2LJI A;  2N1W A;  4IWQ A;  4DXG A;  2M17 A;  4XZ4 A;  1GC6 A;  3IT6 B;  4W9F A;  3FC4 A;  1KFY B;  2KJR A;  3EEC A;  4ZDV A;  3Q69 A;  3R3M A;  4XC2 A;  2DZJ A;  2WDT B;  2KLG A;  3ENE A;  2PTL A;  2K6D B;  3BVZ A;  2WU2 B;  4A3O A;  3IHP C;  4JPS A;  3SFE B;  2YEP B;  4Q2J A;  3PRZ A;  3KUD B;  1WGR A;  2RDH A;  2JVC A;  3T9L A;  3L17 A;  3RUI B;  2FID A;  3W1Y A;  2QDF A;  1FRR A;  3WIM A;  2YEP F;  4BZA A;  2V0G A;  1QOA A;  5CX3 A;  4EUT A;  2KDI A;  4LNI A;  1Z5S B;  3D32 A;  4A3P A;  2MBO A;  2CU3 A;  2C7H A;  3MJ5 A;  3ZLZ A;  4BOZ B;  2V1Y A;  3AE2 B;  3AV8 A;  4TQ1 A;  2LWP A;  2MJD A;  3RT3 B;  2G45 B;  1XLP A;  4MJS A;  1TJE A;  2C9W B;  1XLN A;  2MJ3 A;  1Z2M A;  3AEC B;  2X38 A;  1BML C;  2GI9 A;  1L6V A;  2G4S A;  2IY0 B;  3HM3 A;  3R8B A;  2MBB B;  3QAR A;  3X23 A;  2IY1 B;  2JRI B;  1IPG A;  2BTE A;  2KXJ A;  1GUA B;  3HRD D;  2WDV B;  1ESF A;  2J4X A;  4P1C C;  2PVG C;  4AQ7 A;  4GIV A;  2CJN A;  3V05 A;  3RI7 C;  2INP E;  1KJT A;  5D3D A;  4GOC A;  3B0A A;  3TMP B;  1IGC A;  3VFK A;  3CST A;  1E8Y A;  3AB5 A;  1I4Q A;  1KM7 A;  2LJ5 A;  1UGJ A;  2E3T A;  4A8X C;  2WXQ A;  4AOF A;  4IKG A;  4W9C A;  1HQR D;  3UF8 A;  4WWM A;  4EZK A;  3GZN I;  2KJ6 A;  2IYD B;  2DBY A;  1WI0 A;  5D94 A;  2N7D A;  2KC2 A;  3E56 A;  3IAS 1;  1V49 A;  1TIF A;  1FXA A;  2LGD A;  4LNF A;  4ANW A;  2B76 B;  3SR6 A;  3UQA A;  1C4A A;  3GB1 A;  1C9F A;  2GMI C;  1JWB D;  3RUL A;  3R7R A;  3BVM A;  1UH6 A;  4QAY A;  4I6P A;  2KJH B;  1I4H A;  1G6J A;  4ANV A;  3ZO5 B;  2L0F A;  3LB8 C;  5J18 A;  2D3C A;  3ZNH B;  4FAD A;  2MP2 A;  3QCA A;  2JPH A;  3DVN U;  3GP7 A;  2ZEQ A;  1UWM A;  2PMV A;  3N32 A;  2ZPY A;  3AE5 B;  2NR2 A;  2BWF A;  2KQ4 X;  4RGO S;  3ZKJ C;  1C79 A;  2KDM A;  1R4N I;  3DHG C;  4XYC A;  2HE7 A;  1WJ4 A;  3UIN B;  1P98 A;  3QQ8 B;  4NAW B;  3BVG A;  2DAJ A;  4ARC A;  1HZ5 A;  2M19 A;  2D07 B;  3DPD A;  2KDE B;  4WJO A;  1A70 A;  1SGH A;  4YL8 A;  4KSK C;  3NY5 A;  1BXT A;  3AE1 B;  4K7S A;  1D3Z A;  3T8M A;  3ZVV A;  4FHJ A;  3H7S A;  1R4N B;  3A9K A;  2N9P C;  5IKC M;  2FUH B;  3AE6 B;  4NAW A;  5KHQ A;  4JX1 C;  2RPV A;  4HDO A;  1FNW A;  1WZ3 A;  3JYU A;  4REZ A;  3ML9 A;  1MJD A;  1GG3 A;  3SU8 X;  4GMV A;  3KQ4 A;  3ZGZ A;  2GBR A;  2K39 A;  1QOG A;  2O6V D;  4FJZ A;  5DPR A;  2L83 A;  1I35 A;  3ZRC A;  3LDZ E;  2L7R A;  2BQQ A;  1WXM A;  1SJE D;  1A5R A;  5CHW A;  4LNN A;  2ZPN A;  4RCO A;  3W1S C;  1U4A A;  2SAK A;  1MVK A;  3N3K B;  2GBN A;  3TEX A;  2WU5 B;  1RFK A;  3N9Y C;  3I57 A;  3AH7 A;  4RMA A;  1VLB A;  3HVD A;  4M8M A;  3NJT A;  4IM0 A;  1F52 A;  4USA A;  1J7C A;  3UQB A;  5EE0 A;  1YJJ A;  1VCB A;  4KGS A;  2J52 A;  3ECI A;  2EKE C;  2PPH A;  5EE3 A;  2LGX A;  4C56 C;  2RPQ A;  1MHH E;  2LHD A;  2V3P A;  3Q8C A;  2NTS A;  2M4N A;  4EZJ A;  1T0R C;  4L1B A;  1AW7 A;  2FIF A;  4OVZ A;  1D5M C;  4ASW C;  1QT9 A;  1YN5 A;  2HJ1 A;  1WF9 A;  2KN4 A;  2E6X A;  2AL6 A;  1E6E B;  1NYR A;  2K3U A;  1HE8 A;  1KLV A;  1E8W A;  3VUX A;  2R2Q A;  1J7A A;  4P1B C;  5FR6 A;  1FM0 D;  3AN1 A;  2C7N B;  2V3N A;  3C0R B;  1ZOY B;  4B0M A;  2QIE B;  4IM2 A;  2NBU A;  4N59 A;  3PT2 B;  1DYQ A;  4XDC A;  2IBI B;  3K9P B;  3FKY A;  2G3Q B;  3DBR B;  4K81 A;  5TR5 A;  2MBH A;  2WXF A;  2ASQ A;  5HKH A;  1QZE A;  1SE9 A;  2WDR B;  2KFK B;  5IAA C;  4PYZ A;  3DBR I;  4WQO B;  4CO7 A;  5C2T B;  3V6C B;  4O1N A;  4WWO A;  3B2G A;  3B9J A;  1TY2 A;  3L08 A;  1GB4 A;  4YTM B;  2L1A A;  3AEB B;  2O2V B;  5HI1 A;  5FR3 A;  1WFY A;  2QEJ C;  4RF0 A;  1PUT A;  2VZK B;  5JH5 C;  1E8X A;  1AWD A;  5C1Z A;  2M0X A;  3ALB A;  2DHZ A;  3HVZ A;  1ET6 A;  1OEY J;  1I4X A;  2HTM E;  2MH7 A;  2BS3 B;  1UBQ A;  4NAM A; 
#chains in the Genus database with same CATH homology
 2M17 A;  4ZYN A;  4XZ4 A;  2LRU A;  1GC6 A;  3WAL A;  3ZDM C;  1GJZ A;  5DPS A;  4HJK A;  5L83 A;  3JSV B;  2DYO A;  4W9F A;  4EZL A;  1H4R A;  3CSF A;  3H6N A;  5D6J B;  4ICV A;  5DCN A;  2KJR A;  2VRR B;  3EEC A;  4FJV B;  4HWI B;  3W1S A;  2K8H A;  2D2Q A;  1WXA A;  2PJH A;  4KDL B;  3MJW A;  4ZDV A;  5E6O A;  2N9E B;  1V5O A;  1WZ0 A;  4I6L B;  4M8N A;  2BPS A;  1ZW7 A;  3R3M A;  2AEH A;  2C60 A;  4RM8 A;  1WE7 A;  3L10 B;  4XC2 A;  2DZJ A;  4BOS C;  5JHB A;  1ZKH A;  2BKF A;  2WDT B;  2KLG A;  4ICU A;  2LAS A;  2IO3 B;  4JL9 A;  3V61 A;  3ENE A;  2KD0 A;  2WYQ A;  1V2Y A;  2CHX A;  2K6D B;  4LCD E;  2XK5 B;  2XBB C;  4A3O A;  3H7P B;  3DVG Y;  3IHP C;  3WA0 A;  4DHZ B;  2J0M A;  3SD5 A;  3PRZ A;  2YVC A;  3KUD B;  1WGR A;  2J7Q B;  2JVC A;  3DBS A;  3T9L A;  3L17 A;  3VTV A;  4FN2 A;  1V6E A;  2NPT B;  2JUO A;  2RGF A;  3CMM B;  1V5T A;  2Y5B B;  3RUI B;  2FID A;  3BIN A;  3MTN B;  4IUM B;  2REX A;  3ML8 A;  2KFJ A;  2KVR A;  3A1Q A;  4MGY E;  4KIK A;  3W1Y A;  4DK5 A;  3QJZ A;  3R66 C;  1MG8 A;  1V81 A;  3WIM A;  4FJY A;  2J0K A;  2YLM A;  4FHK A;  5DPW A;  1C3T A;  1J8C A;  4G11 A;  5CX3 A;  3U7D A;  2KX3 A;  2GBM A;  4ANX A;  4EUT A;  2L3Z A;  1XD3 B;  2KDI A;  3VUY A;  4GB9 A;  1Z5S B;  3D32 A;  2CHW A;  4A3P A;  2MBO A;  4W9D A;  4NNJ B;  2C7H A;  2V4L A;  3RYT A;  3EHV A;  3ZLZ A;  3VH4 B;  4WWP A;  1E5W A;  2V1Y A;  3WAP A;  4BOZ B;  2NS5 A;  4TQ1 A;  2LWP A;  4IWO A;  2D10 A;  4W9J A;  2IO0 B;  3RT3 B;  2G45 B;  4MJS A;  3AU5 A;  4WJP A;  3JW0 X;  1YJ1 A;  4GDL B;  1TBE A;  2C9W B;  5DPT A;  3PRM B;  4E74 A;  4JGH B;  3V6E B;  3DVN V;  1WX7 A;  2CKH B;  3VH3 B;  3VTU A;  2KOX A;  5G2N A;  2KX0 A;  1Z2M A;  3NHE B;  3PVL A;  2L8J A;  3DCG A;  3RD2 A;  2CS4 A;  2Z0D B;  3SDL C;  3NS8 A;  2G4S A;  3HM3 A;  2IY0 B;  2N1V A;  2MLB A;  2WX1 A;  2XEW A;  3L54 A;  4CYE A;  2MBB B;  3QAR A;  3X23 A;  2IY1 B;  2JRI B;  2K25 A;  1IPG A;  4URK A;  2K1F A;  3TCA A;  2LVQ A;  2KXJ A;  1GUA B;  2KQ7 A;  1UZX B;  3APF A;  4PYU A;  3PGE A;  2NBV B;  4GIV A;  2A4Z A;  4GN1 A;  4FBJ B;  1IP9 A;  3OAW A;  3A9J B;  2BYV E;  1WR6 E;  3VVW B;  3WAM A;  1GC7 A;  3Q3F A;  5IA7 A;  3U30 A;  1KJT A;  1TZ1 A;  2KKC A;  4NPN A;  2A5U A;  3IFW B;  3PSE B;  4GOC A;  3B0A A;  1WRD B;  3WAN A;  2HTH A;  3TMP B;  2HD5 B;  2LVO A;  3KUZ A;  1IYF A;  3QX1 A;  1WIA A;  4WJN A;  1WM2 A;  2KN5 A;  3VUW A;  3PRE A;  4IWP A;  1C1Y B;  1E8Z A;  1S1Q B;  3L16 A;  2KAN A;  4FUL A;  1V9J A;  2BF8 B;  3APC A;  3GOE A;  4IM3 A;  4NQK E;  3VFK A;  3CST A;  1E8Y A;  4B6W A;  2ZJD A;  1KM7 A;  2LJ5 A;  1P3Q U;  3IVF A;  3PS6 A;  4JIO U;  4TQ0 A;  1L2N A;  1YX6 B;  3DBH I;  2DZM A;  2B3A A;  3EC8 A;  3JVZ X;  1T0Y A;  3PHX B;  4GDK A;  4I6N B;  4MGI E;  4AOF A;  4W9C A;  4B9K A;  4BKS A;  4BKT A;  2I1K A;  3UF8 A;  2WWZ A;  2KK8 A;  3ZTD A;  1BT0 A;  4EZK A;  4W9K A;  2L05 A;  2Z0E B;  4HXD A;  3WAO A;  2J0J A;  3A4S C;  2BYF A;  3PHW B;  4KIK B;  4F8C B;  3GZN I;  3KW5 B;  3VTW A;  2NBW B;  2MSE D;  2KLC A;  3H9D A;  2KJ6 A;  2IYD B;  4MEM A;  1V86 A;  1WI0 A;  4X57 B;  2AWT A;  4GU2 A;  5D94 A;  2JY6 A;  2N7D A;  2KC2 A;  3DBL I;  1V49 A;  2LGD A;  4MSQ B;  4ANW A;  2Z59 B;  5BO4 B;  4WJQ A;  3UQA A;  3AXC A;  1M94 A;  4AJW A;  2ZNV B;  1SIF A;  4PS7 A;  2GMI C;  2CU1 A;  2RSU A;  1OQY A;  3AU4 A;  2AYO B;  2NPT A;  3DOW A;  4HPM B;  3R7R A;  3RUL A;  1LXD A;  5J2R A;  1UH6 A;  4MGZ E;  4LDT B;  4MM3 A;  1WXV A;  5D2M B;  2L76 A;  4I6P A;  2KJH B;  1P9D U;  3RZW C;  3MHS D;  4BKS D;  1G6J A;  3VAW A;  3M63 B;  3X0W A;  4ANV A;  1WGG A;  2K8B A;  2L0F A;  3ZTC A;  3ZO5 B;  1XQQ A;  4G0N B;  1JRU A;  3APD A;  4K7U A;  5J18 A;  3ZNZ B;  2ZCC A;  4BKG A;  5LXH A;  1YX5 B;  4DDI D;  1RAX A;  4F1S A;  3ZNH B;  2CHZ A;  1P0R A;  2JXX A;  4FAD A;  1CMX B;  1RFA A;  3PLU A;  2MP2 A;  3AI5 A;  1ZGU B;  3QCA A;  2JPH A;  1UEL A;  3DVN U;  4II3 B;  2ZEQ A;  4W9G A;  5AEK B;  2KNB A;  3A4R A;  3N32 A;  2ZPY A;  1WGD A;  4AP4 C;  2NR2 A;  1FXT B;  2BWF A;  1AAR A;  2ZCB A;  2GBJ A;  5LLI A;  1I42 A;  1LM8 B;  4JLC A;  4A20 A;  1K8R B;  3ZKJ C;  3ZNI D;  4EOY A;  1LQB A;  4BBN F;  1R4N I;  3A9K B;  2DZI A;  1WYW B;  2HE7 A;  3VXW A;  1WJ4 A;  1VD2 A;  3UIN B;  1P98 A;  3HK0 A;  2FAZ A;  3QQ8 B;  2MA9 B;  4NAW B;  2DAJ A;  3TBL D;  2V3S A;  2LXC A;  3HIZ A;  4NJ6 A;  1WH3 A;  1WR1 A;  2KWC A;  4MEL A;  2D07 B;  3DPD A;  3UIP B;  2KDE B;  4PS3 A;  4WJO A;  2IZV B;  4NY0 A;  1SGH A;  4YL8 A;  2QHO A;  2MRP A;  4KSK C;  3NZS A;  4P7I A;  1H8C A;  3H1U A;  3DDC B;  5GMV A;  2C5L C;  3NY5 A;  1D3Z A;  4K7S A;  2MCN B;  2UWQ A;  3T8M A;  4E71 A;  3ZVV A;  1ISN A;  4FHJ A;  3H7S A;  2D3G A;  1X1M A;  3A9K A;  4M0W B;  4IC7 B;  1YQB A;  5AZF A;  2N9P C;  1LFD A;  2FUH B;  3V62 A;  4NAW A;  4W9L A;  4BVU C;  5KHQ A;  3K9O B;  1UBI A;  1XT9 B;  4HDO A;  3V60 A;  4TUU A;  3TIX A;  2LD9 A;  2IO2 B;  1WZ3 A;  3JYU A;  2LGY A;  1TTN A;  4II2 B;  3ML9 A;  1P1A A;  1WMH A;  2DAF A;  3SU8 X;  1GG3 A;  2N9X A;  2O6V B;  3M62 B;  4GMV A;  5KHO A;  4HPL B;  3QIJ A;  2GBR A;  2ZVN A;  4NQL B;  1WJ6 A;  4TV3 A;  2K39 A;  2FCM A;  2JZZ A;  2LRW A;  2FCS A;  2O6V D;  4DHZ E;  1Q5W B;  2K6Q A;  4FJZ A;  4HLE A;  2L0T A;  4W9I A;  5DPR A;  4HDQ A;  1I35 A;  1OTR B;  4DDG D;  3ZRC A;  1KOT A;  1EF1 A;  3LDZ E;  4IW0 A;  2L7R A;  3KH0 A;  1V80 A;  3R7Q A;  1GNU A;  3NZU A;  3TL5 A;  5CTR C;  2O2V A;  2KO3 A;  1WXM A;  5D7G A;  4GDK B;  4OVU A;  1A5R A;  1OGW A;  5L95 C;  1OEY A;  2KTR A;  4DBG A;  5CHW A;  2FNJ B;  2ZPN A;  4GXB A;  2KC1 A;  3KUC B;  3W1S C;  4GGQ A;  4E3C A;  2BYE A;  1U4A A;  2RR9 A;  4KZ0 A;  1NBF C;  3RZF A;  1F9J A;  3N3K B;  2GBN A;  2OJR A;  4KDI C;  4HCP B;  3ZDT A;  1WJN A;  2KDB A;  4RMA A;  4RM9 A;  4K7W A;  4M8M A;  2CR5 A;  3UIO B;  4IM0 A;  3PRP B;  3ZUN A;  2W9N A;  1WX9 A;  3UQB A;  2LZ6 A;  1Q1O A;  4WAA A;  5CHF A;  1WJU A;  2IO1 B;  2K8C A;  4BBN C;  3ZNG C;  1VCB A;  4OVV A;  4ZRK A;  1WGH A;  2DYB A;  2EKE C;  3ECI A;  4CHK A;  2PPH A;  2LGX A;  2DX5 B;  2RPQ A;  4KZC A;  3JSV A;  5C23 A;  4DHJ D;  5JZE B;  2UYZ B;  1Y8R C;  4KV2 A;  3B1L X;  4MJS B;  4JQW C;  1UD7 A;  1YD8 U;  1WXS A;  2M4N A;  4EZJ A;  2LI5 A;  2KDF B;  3N30 A;  3Q3J A;  3VDZ A;  1L7Y A;  1EF5 A;  4XX5 A;  4IG7 B;  2HJ8 A;  3P2B A;  2C7M B;  2FIF A;  3BY4 B;  1WX8 A;  3KVF B;  3ONS A;  5G55 A;  1EO6 A;  3PPA A;  1NI2 A;  2JRH A;  4ANU A;  1Q0W B;  4N9F 4;  5LXI B;  3PLV A;  4ASW C;  4EEW A;  4HCN B;  4MDK E;  3VHT C;  3QHT A;  1S3S G;  4DHJ B;  2ZZP B;  1WF9 A;  2BWE S;  2EMT A;  2I1J A;  2MP2 B;  2AL6 A;  2NCN A;  3KYD D;  4G50 A;  3OJ3 A;  4W9E A;  1TGZ B;  4W9H A;  5AZG A;  3NOB A;  4GDL A;  2KTR B;  2JT4 B;  3QWZ B;  3A1Q B;  1RLF A;  3HM6 X;  3ZIM A;  2BGF A;  5CHV C;  3PZD A;  4PS8 A;  2FCN A;  4NJ7 A;  2KHW B;  3O65 B;  3U8Z A;  4K1R B;  4BFR A;  1NDD A;  2DYM A;  3QK0 A;  4KSL C;  3AUL A;  3M95 A;  4EFO A;  1HE8 A;  4MSM B;  2ZNV C;  1KLV A;  3A9J A;  1E7V A;  1E8W A;  4B95 A;  5EDS A;  4LJO B;  2L00 B;  2M1M A;  2KMC A;  2R2Q A;  3H7P A;  4LJP B;  5FR6 A;  3VUX A;  2MW5 A;  2R2O A;  3I3T B;  4TKN A;  4GSW A;  2C7N B;  3EFU A;  3S2A A;  2WX0 A;  3PV1 A;  2GBK A;  3DVG X;  2KZR A;  2ZVO A;  3C0R B;  4MGK E;  3QA8 A;  4IM2 A;  4HK2 A;  2NBU A;  2FCQ A;  4ZRI A;  4AJY B;  2DEN B;  3L0W B;  3PT2 B;  2BKR B;  2LVP A;  3IBE A;  2JWZ A;  1J19 A;  2KWV B;  4DXA B;  3QC8 B;  3ZW3 A;  3DQV A;  2IBI B;  3K9P B;  4K81 A;  2G3Q B;  5TR5 A;  4F7Z A;  2D11 A;  4FA6 A;  2MWS B;  3CF6 E;  4FLH A;  3QAQ A;  2MBH A;  4J6I A;  2ASQ A;  5HKH A;  2MBQ A;  1QZE A;  3ZRF A;  1SE9 A;  2NVU I;  1E7U A;  1WE6 A;  1WMH B;  2KFK B;  5IAA C;  5JHA A;  4PYZ A;  1EUV B;  3DBR I;  4WQO B;  2PEA A;  4CO7 A;  2PE6 B;  3PTF C;  2G4D B;  2MBE A;  2M8S A;  3V6C B;  4ZRJ A;  4WWO A;  4DWF A;  4WWN A;  2XK5 A;  2DZK A;  2LUE A;  3L13 A;  3TJP A;  2GOW A;  4G3X B;  1WGY A;  2N4F A;  3L08 A;  1UGM A;  3SHQ A;  2OOB B;  3UGB B;  4AWJ A;  3IG3 A;  3B08 A;  5AZH A;  4EKU A;  2JZ3 B;  1J0G A;  2O2V B;  3HHM A;  1WFY A;  1R4M I;  4KVG B;  2EMS A;  3OJ4 B;  1WY8 A;  4MH0 E;  1YIW A;  3KYC D;  2KTF A;  1E8X A;  3RCZ A;  5JH5 C;  2KFK A;  2LXA A;  5J17 A;  4LDT D;  2PE9 A;  2JF5 A;  2KQS A;  3A33 B;  2M0X A;  3ALB A;  3LJ3 A;  1RRB A;  2DHZ A;  5C1Z A;  3VQI A;  1E90 A;  2RD0 A;  2MQJ A;  2N7E A;  1OEY J;  3M3J A;  2KMA A;  2KWU B;  1PQS A;  2AL3 A;  2O6V A;  5E6P A;  2MX2 A;  2N1W A;  4IWQ A;  1WM3 A;  5E6N A;  4AUQ C;  1UBQ A;  4HVB A;  3OLM D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...