4GU2A

Crystal structure of ubiquitin from entamoeba histolytica to 1.35 angstrom
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
72
structure length
68
Chain Sequence
MQIFVKKTITLEVEPNDSIDAIKAKIQEKEGIPPDQQRLIFAGKQLEEGKTLSDYNIQKESTLHLVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Structural Determinants of Ubiquitin Conjugation in Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Protein binding
total genus 21
structure length 68
sequence length 72
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gu2A00
2KO3A 3O65B 1V86A 3LJ3A 3QX1A 3DPDA 4URKA 4GOCA 1G6JA 4FBJB 4P7IA 4JLCA 2LXCA 2AL3A 3ZRCA 3D32A 3H6NA 2MX2A 2LGDA 3I3TB 1P98A 4HJKA 4I6NB 3OJ3A 3SHQA 1Q0WB 4WWOA 2LASA 2FAZA 2Y5BB 2YLMA 4AP4C 1L7YA 5BO4B 3NHEB 2DAFA 1YD8U 2IZVB 2LRWA 3JSVB 2LUEA 4B9KA 2NPTA 3V61A 1A5RA 5HKHA 4ZYNA 4LCDE 3H9DA 4RM8A 1C1YB 1UBQA 3TJPA 5G55A 4GU2A 3WANA 2JZ3B 2B3AA 3RYTA 1RFAA 3ZTDA 3IBEA 3ECIA 3PLUA 5C23A 4HVBA 2I1JA 3B0AA 1V81A 4HLEA 4FHJA 3N30A 5AEKB 3H7PB 2LVQA 3L17A 4GXBA 3ONSA 2MLBA 5JH5C 1GJZA 4BBNC 1EO6A 1VD2A 4I6LB 5KHQA 1WXVA 3M3JA 1ISNA 1WY8A 2NBUA 3WAOA 1E7VA 4BOZB 2QHOA 2LD9A 1YIWA 1MG8A 1SIFA 4MEMA 3SDLC 4M8MA 1D3ZA 3QQ8B 3OLMD 4EZKA 1V49A 4M0WB 4MM3A 4DWFA 2PE9A 4MJSA 1WGYA 4GDKA 3UIPB 1VCBA 3W1SA 3OAWA 3VTUA 5L83A 5C1ZA 3TCAA 3KUDB 2NPTB 5GMVA 2GBNA 4FHKA 4EOYA 4KSLC 2DYMA 2FCMA 2IYDB 5EDSA 2V4LA 4II2B 4HWIB 2D2QA 3ZRFA 3PTFC 4W9HA 4E3CA 2LI5A 2J0MA 1YQBA 5J17A 2FCQA 1C3TA 1EF5A 2KWUB 3AU5A 4PS8A 1YJ1A 2LVPA 2W9NA 2N9PC 3AXCA 3ZUNA 4NAWB 3JYUA 4WJOA 1F9JA 4I6PA 2BWES 1WJUA 2M8SA 2CR5A 3ZNGC 4AJWA 2A4ZA 3EFUA 2J7QB 1OTRB 1V6EA 4ANWA 2N7DA 3EC8A 4GDKB 4MJSB 2L00B 2MQJA 2BYFA 3A1QB 2ASQA 4NPNA 3MTNB 4FULA 4GN1A 3M63B 2XBBC 2J0JA 4NQLB 2L3ZA 4HCNB 1J0GA 1GG3A 1V5OA 1H8CA 4MGZE 3VXWA 4ANUA 2CHZA 1S3SG 3RUIB 4BVUC 2KTRA 2DENB 4ZRJA 5AZGA 2K8BA 2L76A 5DPWA 4ICUA 2LRUA 3PLVA 3DVGY 4LJOB 2O6VB 2L7RA 3QK0A 1P3QU 1SE9A 5DCNA 4FJVB 3DVNU 3VAWA 4HCPB 5IA7A 1GC7A 4TQ0A 2ZNVB 2MBQA 2BGFA 2MBOA 4KV2A 1OEYA 2BF8B 2L0FA 3ML8A 3JSVA 5JHAA 2WX0A 1LFDA 1XT9B 4B6WA 4EFOA 2G4DB 4G50A 1I42A 3MHSD 2BKRB 1UZXB 4W9JA 4WAAA 4IUMB 3VHTC 4MGKE 4IC7B 5LXHA 2KC1A 3VH3B 3ZNZB 4IM2A 3PREA 4LJPB 3PGEA 3DDCB 3ZW3A 4KZCA 5LLIA 3CSFA 3U7DA 2MBEA 3A4SC 2N1VA 2KTRB 3UF8A 3Q3FA 3VDZA 2J0KA 1ZGUB 1IYFA 4A20A 1KJTA 3IG3A 4G11A 4MGYE 3RZWC 2NVUI 3C0RB 4GDLB 4LDTD 4EKUA 5LXIB 3VH4B 2D3GA 1T0YA 2KTFA 3M95A 4E74A 4K1RB 2BYEA 3PT2B 1WI0A 3PV1A 4IWOA 4FADA 1WZ0A 3T9LA 2L05A 2MWSB 3TL5A 5DPRA 2IO2B 4HDQA 4XX5A 1SGHA 1LXDA 4GMVA 4IM0A 2G3QB 2N7EA 4E71A 3ML9A 2Z59B 3UGBB 3V60A 3L13A 2WWZA 1WGGA 4KIKB 4RMAA 1K8RB 2PJHA 3ZLZA 3DQVA 2M17A 2KQSA 1WJ6A 2LGXA 3KW5B 2DZKA 2GBKA 4M8NA 5D6JB 3L08A 3MJWA 3VUYA 3V62A 5JHBA 1QZEA 1M94A 2A5UA 2L8JA 4PYUA 2DX5B 2G45B 4N9F4 2RD0A 3A9JB 3N32A 4TQ1A 3V6CB 4DHZE 2GOWA 2MBHA 4BKSA 2MRPA 4MSQB 2V3SA 4G0NB 2ZVNA 3R66C 3VUWA 2KZRA 1JRUA 3N3KB 3GOEA 2JY6A 4NAWA 2IO3B 2KN5A 2YVCA 4J6IA 4NNJB 2RGFA 2FNJB 2UYZB 1XD3B 2ZPNA 1V2YA 2KLCA 5CHFA 4GB9A 1R4MI 4MSMB 1Q5WB 4W9DA 1E8WA 5CTRC 5AZFA 2KKCA 1V9JA 1Z5SB 3A1QA 3ZNHB 2CHXA 2VRRB 1RAXA 1J8CA 2OOBB 4MGIE 3W1SC 5E6NA 1P0RA 4NJ6A 1WX7A 2HE7A 3PZDA 1I35A 3QARA 1UELA 2D07B 1EUVB 4DHJD 3DVNV 1WXSA 1Q1OA 2WDTB 3L10B 2GBJA 3RCZA 2KDBA 1TGZB 1E8YA 2K8HA 3JW0X 3HM6X 2D11A 3L54A 1WRDB 1HE8A 4DBGA 3B1LX 3VFKA 3K9PB 2DZIA 3AU4A 3KUCB 4KDLB 3RD2A 4IWPA 2O6VA 3UINB 1X1MA 4XZ4A 4IW0A 4CO7A 3R7QA 1H4RA 2RR9A 2FCSA 4NQKE 4PS7A 2MSED 2EKEC 4EZJA 2BKFA 3DBRI 2IO0B 4W9IA 3QHTA 5TR5A 3BINA 2BYVE 2KJHB 2PEAA 4A3PA 4EZLA 1U4AA 4FJYA 4IWQA 2ZNVC 4ANVA 1OEYJ 1LQBA 2C60A 1NDDA 3PRMB 5CHWA 2KXJA 2FIDA 4RM9A 3ZIMA 2C9WB 4DDGD 4DHZB 2K6QA 3K9OB 3DBLI 3QIJA 2N1WA 2FIFA 3PRPB 5E6PA 2MP2B 2KFKB 3VUXA 2KX3A 4OVUA 3ZO5B 5J18A 1WM3A 2KQ7A 2RPQA 2NS5A 3NZUA 4W9LA 5E6OA 3KYDD 3QAQA 3ZDMC 2JRHA 3ZTCA 2N9XA 3JVZX 3PSEB 4ICVA 2JT4B 4GDLA 2R2QA 4WJNA 4AJYB 2C7HA 2JF5A 4DK5A 2LZ6A 1S1QB 3S2AA 3NZSA 3SU8X 4ZRIA 2K25A 4WWPA 4FN2A 2KVRA 3VQIA 2AEHA 4JGHB 3WIMA 3HHMA 4W9FA 4A3OA 3OJ4B 2AYOB 1TBEA 1WE6A 1WGHA 3HIZA 3T8MA 4F7ZA 2L0TA 2MA9B 3KYCD 3APCA 2JRIB 3DCGA 2K1FA 1GC6A 3DVGX 2KLGA 3IFWB 2WX1A 4IM3A 4KIKA 2D10A 4G3XB 2KOXA 2K6DB 2V1YA 1XQQA 2JPHA 3NOBA 2HD5B 3IHPC 4IG7B 3H7SA 2O2VB 3A9JA 4JQWC 4HK2A 5DPTA 4DDID 4FA6A 1BT0A 2KD0A 3A33B 1WXAA 2ZZPB 1WH3A 3APFA 2ZVOA 3PHXB 4F8CB 2I1KA 2KK8A 1NI2A 3UQAA 4K7SA 2M1MA 1V5TA 2GBMA 3CSTA 3L0WB 4TUUA 4BBNF 3AULA 1YX6B 4GGQA 2ZCBA 3H1UA 2HTHA 1OQYA 1IPGA 2EMSA 5JZEB 5DPSA 2CS4A 4HPMB 1OGWA 4MDKE 2KWVB 3TBLD 1L2NA 4FJZA 2KWCA 1WJ4A 2PPHA 4PYZA 2KDFB 4KDIC 4WJPA 2LXAA 2LJ5A 4JIOU 4GSWA 3QC8B 4EEWA 1UGMA 4II3B 2MBBB 2RSUA 3LDZE 2N9EB 3ZNID 3SD5A 4X57B 3BY4B 3PRZA 3WAMA 2KANA 3TIXA 3EECA 4W9KA 3ZDTA 2IBIB 1UH6A 2C7MB 1WMHB 1E7UA 1KM7A 2DYOA 1E90A 3ZKJC 3A9KB 5AZHA 5D94A 2ZJDA 5KHOA 2KFJA 1P9DU 2DZMA 2O6VD 2Z0DB 1WIAA 3QWZB 3V6EB 2PE6B 2DZJA 3HK0A 2OJRA 3IVFA 4HDOA 2M4NA 3ALBA 4BFRA 2KX0A 2C7NB 2BPSA 4DXAB 4F1SA 2KMAA 1KOTA 4MH0E 3WA0A 2MP2A 2KFKA 2LGYA 3P2BA 2DHZA 1ZKHA 3UQBA 1V80A 4WWNA 3X23A 3CF6E 4GIVA 3RT3B 2MCNB 2DAJA 2GMIC 3VVWB 4EUTA 5G2NA 4W9GA 1RRBA 2JWZA 2GBRA 3DBSA 4AWJA 3EHVA 4NJ7A 1PQSA 1LM8B 1WFYA 1E5WA 1WX8A 2IO1B 4WQOB 4AOFA 3GZNI 3U30A 3B08A 2N4FA 5CX3A 2UWQA 3R3MA 1NBFC 1WJNA 2JVCA 3RZFA 2IY0B 2KC2A 3KH0A 3KVFB 1WGDA 4MELA 4ZDVA 4OVVA 3M62B 2K8CA 2REXA 4LDTB 3VTVA 1WX9A 2CKHB 4JL9A 4BOSC 2R2OA 1P1AA 2KJ6A 1CMXB 3APDA 4HPLB 2NCNA 1WR1A 4ASWC 3WALA 2Z0EB 3KUZA 1EF1A 4B95A 4PS3A 2DYBA 4TKNA 1GNUA 4W9CA 3TMPB 5L95C 3PHWB 4AUQC 1YX5B 2CHWA 1R4NI 2NBWB 2ZEQA 3PS6A 3PVLA 4W9EA 2O2VA 1WM2A 3L16A 4KVGB 1KLVA 4NY0A 3RULA 3U8ZA 3A4RA 4XC2A 4KZ0A 4BKGA 2KJRA 1WR6E 3PPAA 2KDEB 1WZ3A 2XK5A 3ENEA 2ZCCA 5IAAC 1UBIA 3R7RA 1UD7A 1WF9A 5CHVC 4YL8A 2WYQA 2MW5A 1E8ZA 1WE7A 4WJQA 2LVOA 5D7GA 3H7PA 2NR2A 4K7WA 1TTNA 3QCAA 2EMTA 2HJ8A 3WAPA 2K39A 3DBHI 3W1YA 3UIOB 2FCNA 4ZRKA 3VTWA 2JUOA 2JZZA 2BWFA 3DOWA 3HM3A 2NBVB 2XEWA 1E8XA 1FXTB 2JXXA 3NS8A 1ZW7A 4FLHA 4CYEA 3NY5A 1AARA 5D2MB 3QA8A 3CMMB 1RLFA 5J2RA 1WGRA 1WMHA 4KSKC 2KNBA 4ANXA 4K7UA 4DHJB 2AL6A 3A9KA 2IY1B 4BKTA 2ZPYA 4HXDA 2CU1A 1IP9A 3X0WA 4TV3A 4BKSD 1TZ1A 2KDIA 2AWTA 1Y8RC 1GUAB 2LWPA 2XK5B 3AI5A 4K81A 4CHKA 2KMCA 3QJZA 2M0XA 2FUHB 1J19A 3Q3JA 1WYWB 1WXMA 5FR6A 2G4SA 1Z2MA 3ZVVA 2C5LC 2KHWB
chains in the Genus database with same CATH superfamily
4RFBA 3C19A 3GZNB 3LJ3A 3QX1A 4OZCA 4FBJB 1MFWA 2J42A 3D32A 5FKAC 3ZRCA 2MX2A 4I6NB 1P98A 4HJKA 3SHQA 5LNK1 2QDFA 2JX5A 2LRWA 4B9KA 4ZYNA 2FUG1 4B0MA 1VDVA 3PZ8A 4GU2A 3RMKC 2N7JA 3LB8C 5JH5C 3ECIA 4HVBA 5C23A 1V81A 3MJ5A 3RPFC 3L17A 4P1BC 2LGSA 2WXQA 2WXNA 2J53A 2LD9A 2ZW1A 4JE3B 4MEMA 3P4QB 4MM3A 2PE9A 4MJSA 1WGYA 4GDKA 1D5ZC 4LNNA 2NPTB 2GBNA 5EE1A 2IYDB 1SE2A 1T0RC 1V8CA 3PTFC 3GB1A 1YJJA 5AUKA 1OFFA 1K53A 2L52A 1C3TA 3AU5A 2K0PA 2LVPA 1MG4A 2B76B 1FXIA 3JYUA 1F9JA 3I57A 3RNEC 3EFUA 1TS4A 2N7DA 3GS2A 3IXSA 3FC4A 4FULA 1XO3A 1J0GA 4A6QA 1TS3A 1H8CA 3FAHA 4AQ7A 5DPWA 4ZRJA 5AZGA 2K8BA 3L4PA 2HJ1A 3E9SA 2O6VB 1P3QU 1SE9A 4FJVB 3DVNU 3NUHB 3VAWA 2JWUA 4OW0A 5BYQA 3U52E 2ZNVB 4C80A 2BF8B 2L0FA 5JHAA 2WDQB 2G4DB 2JQRB 4WAAA 4IUMB 5LXHA 1C9FA 3VH3B 3ZNZB 3PGEA 3U2SC 4KZCA 3DHGC 3U7DA 3A4SC 2JYEA 1ZGUB 4G11A 4LDTD 3VH4B 2KTFA 2BYEA 5D3IB 3PV1A 3VRAB 2L32A 4M0WA 3TL5A 4HDQA 4XX5A 4USAA 2Z59B 4KIKB 1WJ6A 2DZKA 1M94A 2A5UA 2J4XA 2L8JA 2DX5B 2RD0A 3N32A 3AEEB 2GOWA 1D5XC 3VUWA 1JRUA 4NAWA 1TS5A 3GP7A 1L6UA 4NNJB 4RGNA 2RGFA 2KLCA 3AECB 1FCLA 2CHXA 2VRRB 2OOBB 2HE7A 4XE0A 3LYYA 1EUVB 1WXSA 2WDTB 3L10B 1TGZB 2K8HA 3HM6X 1XCTL 1HE8A 4WURA 4IWPA 4CO7A 1H4RA 4NQKE 4PS7A 1NENB 3DBRI 4W9IA 4HRSA 1BMLC 2BYVE 2KJHB 2PEAA 4A3PA 1U4AA 3FILB 4IWQA 1E6EB 2C60A 2QMTA 2IJ0A 3OG5A 2C9WB 4DDGD 3ETRA 1EWYC 2BB5A 5J18A 4ARIA 1F1HA 1OQRA 3ZTCA 2PW9A 2JF5A 1S1QB 2BB6A 1ZDXA 3NZSA 4WWPA 2KVRA 3VQIA 3H8HA 3WIMA 3HHMA 2AYOB 3HIZA 1JWUD 3DVGX 2MH7A 4G3XB 1T3QA 2K6DB 3P42A 1R4MB 1T0QC 2HD5B 4WIPA 4ARCA 3N1YC 4C56C 2ZZPB 1WH3A 4JWSC 2N0SB 4YSXB 3CSTA 4BBNF 1YX6B 3R2TA 1D6EC 2ZCBA 4XDDA 2WXGA 3TBLD 2PPHA 4WJPA 1EU4A 1ESFA 4EEWA 2PTLA 2RSUA 3SD5A 3V05A 3PRZA 2DNFA 4W9KA 3ZDTA 1WMHB 3MP9A 4O1NA 5AZHA 2ZJDA 5G5HA 4S0RA 1B9RA 2Z0DB 2KAJA 4RGMA 2PE6B 3AE8B 4DXAB 1KOTA 2KQ4X 1TIFA 3P2BA 2LGYA 1L4ZB 2DHZA 3X23A 3PZ7A 3CF6E 4GIVA 3RT3B 3AE2B 5AUIA 3ZJUA 1V1PA 1AW7A 1L0YB 3EHVA 1WX8A 4WQOB 1BUIC 5H92C 4S17A 1WJNA 2JVCA 4OZBA 1EWCA 2RMMA 3KVFB 4MELA 3Q8AA 1QOFA 5T8IA 4LDTB 4BOSC 2R2OA 3APDA 1C79A 2Z0EB 5IN7A 4TKNA 1GNUA 4HROA 4AUQC 1YX5B 4XGAB 2O2VA 1QLBB 1GPXA 1XLQA 2R61A 4BKGA 1JALA 2Q5WD 4LTUA 2KJRA 1DYQA 1QOAA 2Z8LA 1VZ8A 3ENEA 2XK5A 1PGXA 2ZCCA 1UBIA 3V3XA 5CHVC 4YL8A 1E8ZA 1WE7A 4WJQA 1UWMA 2HJ8A 3WAPA 2K39A 1TKEA 3VTWA 2JUOA 2NBVB 1FXAA 1E8XA 4FLHA 5D2MB 3QA8A 3CMMB 1K51A 1WGRA 3A9KA 4WAFA 4HXDA 2D5GA 1TZ1A 2KDIA 5BMGA 1GUAB 4CHKA 1YOVB 2Y5PA 2M0XA 4YXDB 4JX1C 1R7SA 2SEBD 5FR6A 1WYWB 1WXMA 2G4SA 2C5LC 2KHWB 2IPKD 4REZA 1V86A 4GOCA 4P7IA 4JLCA 1CQVA 2LASA 2FAZA 2YLMA 4AP4C 1FIQA 3CWIA 2DAFA 1V97A 1YD8U 1CJEA 2IZVB 2LUEA 2NPTA 3V61A 4HKZE 4LCDE 4RM8A 1KFYB 3RYTA 3ZTDA 3PLUA 4HLEA 4BAXA 3B0AA 4PK1A 1N61A 4GXBA 2MLBA 5KHQA 3M3JA 2RDGA 1ISNA 1WY8A 1E7VA 4BOZB 2KDMA 1YIWA 4LK0M 1MG8A 1SIFA 3SDLC 3Q8CA 2WDVB 4M8MA 3OLMD 3I63C 3UIPB 2MJDA 1VCBA 3W1SA 5L83A 4P6VF 1QF6A 3DBHB 2BT6A 2ON8A 2V4LA 1SJED 2DBYA 2D2QA 2JZPA 3N20C 4DXFA 1QT9A 3NZ3A 3BVZA 2FCQA 4KKJA 4OHJA 4DXGA 3AXCA 3ZUNA 1WJUA 2M8SA 2CR5A 4AJWA 4MT5A 2A4ZA 1ZUD2 1V6EA 5HHDG 1MPEA 2ASQA 4GN1A 2HDEA 2ZW0A 2XBBC 3W9CB 4C00A 2OJWA 2I38A 2Y5CA 3AV8A 1GG3A 1GOZA 3VXWA 4ANUA 5C2TB 1S3SG 2XNAC 4BVUC 2L76A 2LRUA 4LJOB 5DCNA 1HA5A 1VZ6A 1XXGA 1PUTA 1L0VB 1GC7A 2BYTA 2MBOA 1JW9D 3ML8A 3JSVA 2WX0A 1LFDA 1XT9B 5BYSA 4B6WA 1FCCC 1NEKB 1I42A 2AQ1B 1UZXB 3VHTC 2KC1A 2EELA 4IM2A 4C4VA 3DDCB 3ZW3A 5LLIA 4IOIE 1UF0A 3KQ4A 2N1VA 2KTRB 4RCOA 1SE3A 1HEZE 5BMHA 2J0KA 3HUIA 1IYFA 4A20A 2GB1A 4MH8A 1KJTA 1N62A 5HG2A 1UWXA 3NVVA 3R8BA 4GDLB 1I4HA 3RZWC 4EKUA 5LXIB 3RNGC 4GLSC 4IWOA 3SEBA 2L05A 2IGDA 5DPRA 2QJLA 1FFVA 1SGHA 1LXDA 2BQQA 4GMVA 4L1BA 1F52A 2WWZA 1K8RB 2QC8A 2LGXA 3KW5B 4JPSA 3MJWA 4US9A 5JHBA 3BYYB 2G45B 1L6VA 3MC0B 2MBHA 4BKSA 2MRPA 4MSQB 3RI7C 2ZVNA 3GOEA 5FR3A 2YVCA 3P4SB 4MSMB 3MFGA 5CTRC 3DWMA 3A1QA 3AH7A 1RAXA 1J8CA 3W1SC 5E6NA 1P0RA 4KGRA 5H8YE 2BVCA 5IO9A 1HTOA 1Q1OA 2GBJA 3RCZA 2KDBA 4DBGA 4A9AA 1T5XD 1TS2A 4WWMA 3R7QA 1ZPSA 3AEFB 5TR5A 2YEPB 3AMZA 4FJYA 1YN3A 4ANVA 2CJNA 2ZNVC 1JQ4A 1AWDA 4DHZB 4ITKA 3BVMA 3K9OB 1BXTA 3DBLI 3PRPB 3Q69A 2MP2B 2KFKB 3ZO5B 2INCC 2KQ7A 2NS5A 3NZUA 4W9LA 1SEBD 2K9XA 3NVWA 2JRHA 3QAQA 1LGRA 2JT4B 4WJNA 2N9LA 2ONQA 3AB5A 2C7HA 2LZ6A 2K25A 2GRIA 4FN2A 3BIID 1AN8A 3TEXA 4W9FA 1TBEA 1WE6A 1WGHA 4F7ZA 2E6XA 3APCA 1GC6A 2KLGA 1RWSA 1YQ3B 2W54A 2JPHA 1F2RC 4RF1A 3IHPC 4IG7B 3AEAB 4JQWC 3A9JA 3OWEB 5DPTA 2KD0A 1NI2A 2K3UA 3UQAA 4K7SA 2M1MA 1V5TA 2GBMA 3L0WB 2YEPF 1SBBB 3PO0A 1WYGA 4P16A 1OQYA 1IPGA 2EMSA 4L23A 5JZEB 2CS4A 1Q10A 1OGWA 4MDKE 2KWVB 2H88B 4FJZA 1TKYA 1PYWD 1Y56A 4D2KA 2JU6X 1UGMA 1L4DB 2N9EB 4X57B 3EECA 2Y3AA 2DYOA 1DOIA 1FM0D 2IDYA 1T6BX 1ET9A 2WXJA 2DZMA 1WIAA 2DZJA 3HK0A 3IVFA 3R2IA 2PIAA 2BPSA 2H89B 2M56B 2E3TA 1STEA 5IKCM 4MH0E 1ZKHA 1V80A 1PGAA 3IAM1 1YN5A 5G2NA 4W9GA 2GBRA 3DBSA 4NJ7A 1PQSA 1LM8B 3GZNI 3B08A 2V3PA 1P7EA 4N59A 2KC2A 1WGDA 4ZDVA 1UNSA 4OVVA 5EE9A 2K8CA 2REXA 3VTVA 1WX9A 2CKHB 3HRDD 1CMXB 4HPLB 2NCNA 2EKIA 1WRIA 1EF1A 4B95A 4PS3A 2DYBA 2FBWB 2BS4B 1C78A 2OEDA 5IP4D 1YNTE 4W9EA 3L16A 4MM3B 4NY0A 3U8ZA 1QOBA 2D3CA 1WR6E 1C4AA 2KYWA 2KDEB 1UD7A 2CU3A 2MW5A 3EGRA 2LVOA 2NR2A 4K7WA 1I4PA 2FE8A 5IOIA 3SFDB 2WXIA 2JZZA 4NZLB 4US8A 2XEWA 2QILA 3NS8A 3Q8BA 1RLFA 1ACCA 4KSKC 1FEHA 3RFZB 1FRDA 4K7UA 2AL6A 1HXYD 4K3CA 5HFYA 4ZRPA 4K81A 3C8YA 3TUOA 2FUHB 1Z2MA 1PDXA 2KO3A 4LNIA 1G6JA 4XWWA 2LXCA 2LGDA 3I3TB 1Q0WB 4WWOA 2Y5BB 1UGJA 1L7YA 2LMCA 3NHEB 5G5GA 3RNFC 5HKHA 1ET6A 2PLPA 3H9DA 1UBQA 2INPE 5G55A 1PFDA 3WANA 4AS1A 2JZ3B 1R4NB 2B3AA 1RFAA 3IBEA 1XEEA 3Q3NC 4FHJA 2LVQA 1GJZA 2BS2B 1EO6A 1VD2A 4I6LB 1WXVA 2NBUA 4WQMA 3WAOA 2QHOA 2N9KA 2LHEA 1D3ZA 3ABVB 3QQ8B 4EZKA 4M0WB 4K3BA 5C1ZA 5GMVA 4EOYA 2DYMA 3Q2AC 1FNVA 3EA6A 3P63A 3U7ZA 3ZJVA 4HWIB 3MC8A 4E3CA 2LI5A 5TSSA 1FNWA 1B1ZA 1KF6B 1YQBA 3AEBB 1KRHA 1YJ1A 2OHFA 3BZDB 2DWQA 4NAWB 3HVDA 4I6PA 1F2RI 2JXTA 1RFKA 3ZNGC 4ANWA 1OTRB 1IBXA 2L00B 2BYFA 2INDC 2WXOA 4C7YA 3M63B 3AE4B 4NQLB 1SF0A 1FD6A 2MHJA 1V5OA 3VR8B 2CHZA 3RUIB 2KTRA 1SXTA 2DENB 3TEZA 1WSPA 1C76A 3P4PB 3PLVA 3DVGY 3QK0A 1KTKA 3B2FA 1SJHD 5IA7A 4TQ0A 2WP9B 1N63A 2WDRB 4EFOA 3T3NA 1ZXIA 1JMLA 3ZXVA 1DOYA 4MGKE 1SSNA 1I4GA 2LUMA 4BZAA 3PREA 1A70A 3EFCA 3CSFA 4M01A 2MBEA 3UF8A 1QKZA 1CK1A 3IG3A 3C0RB 1PGBA 4E74A 4K1RB 2WGSA 3RN9C 1WI0A 3T9LA 1ENFA 2MWSB 1UUPA 3N1ZC 3E56A 4E71A 3V60A 1FMAD 1WGGA 4YTMB 2PJHA 2M17A 2KQSA 2GBKA 4M8NA 3W5UB 3VUYA 2PKOA 2VH1A 1J7AA 3V62A 4N9F4 1EM7A 4NAMA 4TQ1A 3V6CB 2KACA 4A90A 4G0NB 1F77A 3N9YC 2KZRA 1MJDA 2JY6A 2IO3B 3NVYA 4RF0A 4J6IA 1XD3B 2ZPNA 4HPPA 1V2YA 4GB9A 1R4MI 2L1AA 4W9DA 1E8WA 5AZFA 1V9JA 1Z5SB 4NJCA 4NJ6A 1WX7A 1NI3A 1XLPA 3QARA 1UELA 3DVNV 1NYQA 4WH4A 2LGIA 2X38A 2D11A 3ZJTA 4JWUC 3B1LX 2DZIA 3AU4A 4KDLB 3RD2A 2O6VA 1X1MA 4IW0A 2RDHA 3VRBB 2FCSA 1IGDA 1E7PB 2MSED 1V1OA 1YMHE 1JROA 4EZJA 3QHTA 2JSVX 1JCKB 4EZLA 3NG0A 1OEYJ 1TY0A 1LQBA 3PRMB 3ZIMA 2FIDA 4RM9A 2K6QA 3QIJA 2FIFA 3U4EG 2KX3A 1JRPA 1VR9A 1WM3A 4FXCA 2RPQA 2BW2A 4IDIA 3J9CA 5E6OA 4YSZB 3NJTA 3AE7B 3ZDMC 1V1PB 2BTEA 2N9XA 3CIRB 3JVZX 3GE8C 2R2QA 4DK5A 3S2AA 4ZRIA 2INNE 2SAKA 4JGHB 4RGOS 4A3OA 3OJ4B 3T8MA 4HEA1 4ZYSA 1TT5B 2L0TA 3KYCD 3DCGA 1TJEA 2M0AA 2KT7A 3IFWB 2WX1A 3KLSX 1TYGB 4IM3A 3RNAC 4KIKA 2D3BA 2WXFA 2KOXA 4DQOC 3NOBA 2O2VB 2WS3B 4YSYB 2KVZA 4DDID 4FA6A 1BT0A 1WXAA 3APFA 2ICIA 2ZVOA 3PHXB 3AE1B 2I1KA 2KK8A 3NRZA 4TUUA 4GGQA 2HTHA 1HZ5A 3AN1A 2IGGA 5DPSA 4HPMB 1E9MA 1L2NA 4LNKA 2KWCA 1JWAD 4JIOU 2KWDA 2JYTA 4GSWA 3DBRB 2MBBB 1FPYA 3BY4B 2AQ2B 3Q6BA 4YTPB 5JXVA 2KANA 3TIXA 2IBIB 1UH6A 1RM6C 1E10A 1E7UA 3W2DA 1E90A 3ZKJC 5D3DA 3A9KB 2LEKA 5D94A 1C4CA 5KHOA 1MI0A 1IUEA 1FFUA 3QWZB 3V6EB 2AX5A 2OJRA 3FILA 4HDOA 1T0SC 2M4NA 4BFRA 2KX0A 1F0ZA 4F1SA 2KMAA 3P4RB 4OZAA 1HTQA 3WA0A 3BWUD 3UQBA 3W5VB 1DOXA 2DAJA 5HI1A 4KKIA 2WU5B 2J52A 1ZOYB 1N5XA 3U30A 2N4FA 4A8XC 4OVZA 2UWQA 3R3MA 4XWTA 3B2GA 1FO4A 3M62B 2DLBA 4JL9A 2WXMA 4PT5A 2W3SA 1AYFA 4P1CC 4ASWC 4CQNA 4W9CA 3PHWB 2NBWB 4R3DA 4KVGB 3AEDB 1KLVA 2I2YA 4XC2A 3NS1A 2WXRA 2RDBC 3PPAA 4H2AA 1C4PA 3B9JA 1WF9A 3AE3B 2WYQA 2W3RA 5D7GA 1TTNA 1JWSD 3QCAA 1E0ZA 5EE0A 3DBHI 3W1YA 3UIOB 2FCNA 4ZRKA 4YWGG 3HM3A 4HKQA 2JXXA 5MPOA 1ZW7A 5E6JA 4CYEA 3NY5A 2HTME 5J2RA 1WMHA 2KNBA 2PVOD 4ANXA 1SIJA 2IY1B 4BKTA 2ZPYA 4ACFA 1ZXHA 1N60A 2CU1A 1XLNA 3X0WA 1IP9A 2AWTA 2KMCA 1QQRA 1N5WA 1ZP0B 1J19A 1I7HA 3Q3JA 3TEYA 3H7PB 3ZVVA 1CZPA 2TSSA 1M4VA 3O65B 3DPDA 4URKA 2AL3A 3H6NA 4ZHPA 3OJ3A 5BO4B 1NYRA 4J3OD 1K52A 2WXKA 3JSVB 3FKYA 2IGHA 4XYCA 1A5RA 1C1YB 1HZ6A 3TJPA 1OQQA 4C4VB 5AEKB 2I1JA 3N30A 3ONSA 4BBNC 1XF5L 4C7ZA 3RNBC 3VR9B 2NTTA 5EE3A 1V49A 4YT0B 4DWFA 4RH6A 3OAWA 3VTUA 4ZHOA 3TCAA 3KUDB 4FHKA 4KSLC 2FCMA 5EDSA 3ZYYX 4II2B 2VZKB 3ZRFA 4W9HA 2L83A 2KMMA 2J0MA 5J17A 1EF5A 2KWUB 4TMAB 4PS8A 2W9NA 2N9PC 2G1EA 4WJOA 4MACA 3BK1A 2BWES 3T3OA 2J7QB 3MC9A 2M19A 2V3NA 3ZQ4A 3EC8A 4GDKB 1XLOA 2MQJA 4MJSB 3DWGC 3N1XC 3A1QB 1MHHE 4NPNA 3MTNB 5BMIA 2J0JA 4EE2A 2L3ZA 4HCNB 3BYTB 4MGZE 2V9HA 3UI3A 2L7RA 4XDCA 4HCPB 3SFEB 1JWBD 2WNMA 2WXHA 4KGSA 2MBQA 2BGFA 4N6EB 5C3JB 4KV2A 1OEYA 3SR6A 4M00A 2G9HD 4ZRQA 4G50A 1LO5D 3MHSD 2BKRB 4W9JA 4IC7B 1P7FA 4LJPB 4LLGM 1FRRA 3AM9A 1SE4A 4KGTA 3Q3FA 3VDZA 1XCQL 4RGTA 2BBCA 4MGYE 2NVUI 2D3GA 1T0YA 3M95A 3PT2B 2KN4A 1TZOA 4FADA 1WZ0A 2WXPA 4QAYA 1VZ7A 2IO2B 2QEJC 4IM0A 2G3QB 2N7EA 2W82A 3Q14C 3ML9A 3UGBB 3L13A 2V0GA 3KWVA 4RMAA 3ZLZA 3DQVA 5D6JB 3L08A 1D5MC 1QZEA 4PYUA 4A55A 3A9JB 2QCZA 4DHZE 2QSDA 2WXLA 2V3SA 3DHHC 3R66C 3N3KB 2WQYB 2KN5A 2FNJB 2UYZB 1J7BA 2WU2B 3BVGA 5CHFA 3IT6B 1Q5WB 1I4XA 2KKCA 3GE3C 3ZNHB 4MGIE 1ROEA 3PZDA 3AE6B 1I35A 2D07B 3O13A 4DHJD 3ZXRA 1E8YA 3JW0X 1L5PA 2GI9A 3L54A 1WRDB 3EUB2 3VFKA 3K9PB 3KUCB 3LXFA 3UINB 3BK2A 4XZ4A 2RR9A 1WWTA 2LJIA 1K50A 2EKEC 1TY2A 2LHDA 2BKFA 2IO0B 4Q2JA 3BINA 1YQ4B 3I9V1 1KLGD 1NDDA 5CHWA 2KXJA 1D4BA 3NVZA 1KH0A 2ACZB 2N1WA 5E6PA 3VUXA 4OVUA 1YJIA 1MHXA 2XN9C 2AQ3B 3KYDD 2WLBA 3PSEB 4ICVA 4GDLA 4AJYB 4UDUC 2X8XX 3SU8X 1JWMD 2MJEA 3IAS1 5BYRA 1VRAB 2AEHA 1I4QA 1N6ZA 2MA9B 2JRIB 2K1FA 2NMQA 4HJGE 1SB3C 1FNUA 1GB4A 2D10A 2V1YA 4ZOHC 1XQQA 3H7SA 4HK2A 3A33B 3RNCC 2MEKA 4F8CB 3AULA 3H1UA 2LFIA 3Q8EA 4B0EA 1WGKA 4M02A 1WJ4A 4PYZA 2KDFB 4KDIC 1EU3A 2LXAA 2LJ5A 1GAQB 3QC8B 4KX6B 4II3B 3LDZE 5I4DA 3ZNID 2PMVA 3Q8FA 1L0XB 4LNFA 3WAMA 2K22A 5GXGB 2C7MB 3ZGZA 1TKGA 1KM7A 3I5JC 3WCQA 3DBLB 2RPVA 3KWLA 1IGCA 2KFJA 2D3AA 1P9DU 2O6VD 2V4IB 4N58A 1HQRD 2VH2A 1J7CA 3ALBA 1I4RA 2C7NB 4IKGA 2WHIA 3TEWA 2MP2A 2KFKA 1C77A 3IT4B 4WWNA 3AE9B 2K5PA 2MCNB 2GMIC 3VVWB 3P1MA 3AE5B 4EUTA 1RRBA 2JWZA 4AWJA 1WFYA 1E5WA 2IO1B 3AEGB 4AOFA 4LNOA 5CX3A 3RZFA 1NBFC 2PVGC 2IY0B 3KH0A 4TSSA 1P1AA 2KJ6A 1WR1A 3WALA 1WXQA 3KUZA 1QOGA 5L95C 2UU7A 1ZDVA 3TMPB 2CHWA 1R4NI 2ZEQA 3PS6A 3PVLA 1WM2A 3RULA 3A4RA 3Q3MC 4KZ0A 1RYJA 4YTNB 1YN4A 1VJKA 5FK9C 1WZ3A 2GLSA 5IAAC 3R7RA 4L2YA 2QIEB 3H7PA 4RNAA 1VLBA 1DGJA 2EMTA 2MJ3A 3TSSA 3HVZA 2BWFA 3DOWA 3URYA 3MHZA 1ZE3D 1FXTB 1QILA 1GB1A 2VZKD 1IBXB 1AARA 2NTSA 2BS3B 3DHIC 1MVKA 2W55A 4DHJB 3Q3OC 4BKSD 4TV3A 3AI5A 2XK5B 1Y8RC 2LWPA 3QJZA 2CJOA 1KLUD 1NVID 4ICUA
chains in the Genus database with same CATH topology
2KO3A 3O65B 1V86A 3LJ3A 3QX1A 3DPDA 4URKA 4GOCA 1G6JA 4FBJB 4P7IA 4JLCA 2LXCA 2AL3A 3ZRCA 3D32A 3H6NA 2MX2A 2LGDA 3I3TB 1P98A 4HJKA 4I6NB 3OJ3A 3SHQA 1Q0WB 4WWOA 2LASA 2FAZA 2Y5BB 2YLMA 4AP4C 1L7YA 5BO4B 3NHEB 2DAFA 1YD8U 2IZVB 2LRWA 3JSVB 2LUEA 4B9KA 2NPTA 3V61A 1A5RA 5HKHA 4ZYNA 4LCDE 3H9DA 4RM8A 1C1YB 1UBQA 3TJPA 5G55A 4GU2A 3WANA 2JZ3B 2B3AA 3RYTA 1RFAA 3ZTDA 3IBEA 3ECIA 3PLUA 5C23A 4HVBA 2I1JA 3B0AA 1V81A 4HLEA 4FHJA 3N30A 5AEKB 3H7PB 2LVQA 3L17A 4GXBA 3ONSA 2MLBA 5JH5C 1GJZA 4BBNC 1EO6A 1VD2A 4I6LB 5KHQA 1WXVA 3M3JA 1ISNA 1WY8A 2NBUA 3WAOA 1E7VA 4BOZB 2QHOA 2LD9A 1YIWA 1MG8A 1SIFA 4MEMA 3SDLC 4M8MA 1D3ZA 3QQ8B 3OLMD 4EZKA 1V49A 4M0WB 4MM3A 4DWFA 2PE9A 4MJSA 1WGYA 4GDKA 3UIPB 1VCBA 3W1SA 3OAWA 3VTUA 5L83A 5C1ZA 3TCAA 3KUDB 2NPTB 5GMVA 2GBNA 4FHKA 4EOYA 4KSLC 2DYMA 2FCMA 2IYDB 5EDSA 2V4LA 4II2B 4HWIB 2D2QA 3ZRFA 3PTFC 4W9HA 4E3CA 2LI5A 2J0MA 1YQBA 5J17A 2FCQA 1C3TA 1EF5A 2KWUB 3AU5A 4PS8A 1YJ1A 2LVPA 2W9NA 2N9PC 3AXCA 3ZUNA 4NAWB 3JYUA 4WJOA 1F9JA 4I6PA 2BWES 1WJUA 2M8SA 2CR5A 3ZNGC 4AJWA 2A4ZA 3EFUA 2J7QB 1OTRB 1V6EA 4ANWA 2N7DA 3EC8A 4GDKB 4MJSB 2L00B 2MQJA 2BYFA 3A1QB 2ASQA 4NPNA 3MTNB 4FULA 4GN1A 3M63B 2XBBC 2J0JA 4NQLB 2L3ZA 4HCNB 1J0GA 1GG3A 1V5OA 1H8CA 4MGZE 3VXWA 4ANUA 2CHZA 1S3SG 3RUIB 4BVUC 2KTRA 2DENB 4ZRJA 5AZGA 2K8BA 2L76A 5DPWA 4ICUA 2LRUA 3PLVA 3DVGY 4LJOB 2O6VB 2L7RA 3QK0A 1P3QU 1SE9A 5DCNA 4FJVB 3DVNU 3VAWA 4HCPB 5IA7A 1GC7A 4TQ0A 2ZNVB 2MBQA 2BGFA 2MBOA 4KV2A 1OEYA 2BF8B 2L0FA 3ML8A 3JSVA 5JHAA 2WX0A 1LFDA 1XT9B 4B6WA 4EFOA 2G4DB 4G50A 1I42A 3MHSD 2BKRB 1UZXB 4W9JA 4WAAA 4IUMB 3VHTC 4MGKE 4IC7B 5LXHA 2KC1A 3VH3B 3ZNZB 4IM2A 3PREA 4LJPB 3PGEA 3DDCB 3ZW3A 4KZCA 5LLIA 3CSFA 3U7DA 2MBEA 3A4SC 2N1VA 2KTRB 3UF8A 3Q3FA 3VDZA 2J0KA 1ZGUB 1IYFA 4A20A 1KJTA 3IG3A 4G11A 4MGYE 3RZWC 2NVUI 3C0RB 4GDLB 4LDTD 4EKUA 5LXIB 3VH4B 2D3GA 1T0YA 2KTFA 3M95A 4E74A 4K1RB 2BYEA 3PT2B 1WI0A 3PV1A 4IWOA 4FADA 1WZ0A 3T9LA 2L05A 2MWSB 3TL5A 5DPRA 2IO2B 4HDQA 4XX5A 1SGHA 1LXDA 4GMVA 4IM0A 2G3QB 2N7EA 4E71A 3ML9A 2Z59B 3UGBB 3V60A 3L13A 2WWZA 1WGGA 4KIKB 4RMAA 1K8RB 2PJHA 3ZLZA 3DQVA 2M17A 2KQSA 1WJ6A 2LGXA 3KW5B 2DZKA 2GBKA 4M8NA 5D6JB 3L08A 3MJWA 3VUYA 3V62A 5JHBA 1QZEA 1M94A 2A5UA 2L8JA 4PYUA 2DX5B 2G45B 4N9F4 2RD0A 3A9JB 3N32A 4TQ1A 3V6CB 4DHZE 2GOWA 2MBHA 4BKSA 2MRPA 4MSQB 2V3SA 4G0NB 2ZVNA 3R66C 3VUWA 2KZRA 1JRUA 3N3KB 3GOEA 2JY6A 4NAWA 2IO3B 2KN5A 2YVCA 4J6IA 4NNJB 2RGFA 2FNJB 2UYZB 1XD3B 2ZPNA 1V2YA 2KLCA 5CHFA 4GB9A 1R4MI 4MSMB 1Q5WB 4W9DA 1E8WA 5CTRC 5AZFA 2KKCA 1V9JA 1Z5SB 3A1QA 3ZNHB 2CHXA 2VRRB 1RAXA 1J8CA 2OOBB 4MGIE 3W1SC 5E6NA 1P0RA 4NJ6A 1WX7A 2HE7A 3PZDA 1I35A 3QARA 1UELA 2D07B 1EUVB 4DHJD 3DVNV 1WXSA 1Q1OA 2WDTB 3L10B 2GBJA 3RCZA 2KDBA 1TGZB 1E8YA 2K8HA 3JW0X 3HM6X 2D11A 3L54A 1WRDB 1HE8A 4DBGA 3B1LX 3VFKA 3K9PB 2DZIA 3AU4A 3KUCB 4KDLB 3RD2A 4IWPA 2O6VA 3UINB 1X1MA 4XZ4A 4IW0A 4CO7A 3R7QA 1H4RA 2RR9A 2FCSA 4NQKE 4PS7A 2MSED 2EKEC 4EZJA 2BKFA 3DBRI 2IO0B 4W9IA 3QHTA 5TR5A 3BINA 2BYVE 2KJHB 2PEAA 4A3PA 4EZLA 1U4AA 4FJYA 4IWQA 2ZNVC 4ANVA 1OEYJ 1LQBA 2C60A 1NDDA 3PRMB 5CHWA 2KXJA 2FIDA 4RM9A 3ZIMA 2C9WB 4DDGD 4DHZB 2K6QA 3K9OB 3DBLI 3QIJA 2N1WA 2FIFA 3PRPB 5E6PA 2MP2B 2KFKB 3VUXA 2KX3A 4OVUA 3ZO5B 5J18A 1WM3A 2KQ7A 2RPQA 2NS5A 3NZUA 4W9LA 5E6OA 3KYDD 3QAQA 3ZDMC 2JRHA 3ZTCA 2N9XA 3JVZX 3PSEB 4ICVA 2JT4B 4GDLA 2R2QA 4WJNA 4AJYB 2C7HA 2JF5A 4DK5A 2LZ6A 1S1QB 3S2AA 3NZSA 3SU8X 4ZRIA 2K25A 4WWPA 4FN2A 2KVRA 3VQIA 2AEHA 4JGHB 3WIMA 3HHMA 4W9FA 4A3OA 3OJ4B 2AYOB 1TBEA 1WE6A 1WGHA 3HIZA 3T8MA 4F7ZA 2L0TA 2MA9B 3KYCD 3APCA 2JRIB 3DCGA 2K1FA 1GC6A 3DVGX 2KLGA 3IFWB 2WX1A 4IM3A 4KIKA 2D10A 4G3XB 2KOXA 2K6DB 2V1YA 1XQQA 2JPHA 3NOBA 2HD5B 3IHPC 4IG7B 3H7SA 2O2VB 3A9JA 4JQWC 4HK2A 5DPTA 4DDID 4FA6A 1BT0A 2KD0A 3A33B 1WXAA 2ZZPB 1WH3A 3APFA 2ZVOA 3PHXB 4F8CB 2I1KA 2KK8A 1NI2A 3UQAA 4K7SA 2M1MA 1V5TA 2GBMA 3CSTA 3L0WB 4TUUA 4BBNF 3AULA 1YX6B 4GGQA 2ZCBA 3H1UA 2HTHA 1OQYA 1IPGA 2EMSA 5JZEB 5DPSA 2CS4A 4HPMB 1OGWA 4MDKE 2KWVB 3TBLD 1L2NA 4FJZA 2KWCA 1WJ4A 2PPHA 4PYZA 2KDFB 4KDIC 4WJPA 2LXAA 2LJ5A 4JIOU 4GSWA 3QC8B 4EEWA 1UGMA 4II3B 2MBBB 2RSUA 3LDZE 2N9EB 3ZNID 3SD5A 4X57B 3BY4B 3PRZA 3WAMA 2KANA 3TIXA 3EECA 4W9KA 3ZDTA 2IBIB 1UH6A 2C7MB 1WMHB 1E7UA 1KM7A 2DYOA 1E90A 3ZKJC 3A9KB 5AZHA 5D94A 2ZJDA 5KHOA 2KFJA 1P9DU 2DZMA 2O6VD 2Z0DB 1WIAA 3QWZB 3V6EB 2PE6B 2DZJA 3HK0A 2OJRA 3IVFA 4HDOA 2M4NA 3ALBA 4BFRA 2KX0A 2C7NB 2BPSA 4DXAB 4F1SA 2KMAA 1KOTA 4MH0E 3WA0A 2MP2A 2KFKA 2LGYA 3P2BA 2DHZA 1ZKHA 3UQBA 1V80A 4WWNA 3X23A 3CF6E 4GIVA 3RT3B 2MCNB 2DAJA 2GMIC 3VVWB 4EUTA 5G2NA 4W9GA 1RRBA 2JWZA 2GBRA 3DBSA 4AWJA 3EHVA 4NJ7A 1PQSA 1LM8B 1WFYA 1E5WA 1WX8A 2IO1B 4WQOB 4AOFA 3GZNI 3U30A 3B08A 2N4FA 5CX3A 2UWQA 3R3MA 1NBFC 1WJNA 2JVCA 3RZFA 2IY0B 2KC2A 3KH0A 3KVFB 1WGDA 4MELA 4ZDVA 4OVVA 3M62B 2K8CA 2REXA 4LDTB 3VTVA 1WX9A 2CKHB 4JL9A 4BOSC 2R2OA 1P1AA 2KJ6A 1CMXB 3APDA 4HPLB 2NCNA 1WR1A 4ASWC 3WALA 2Z0EB 3KUZA 1EF1A 4B95A 4PS3A 2DYBA 4TKNA 1GNUA 4W9CA 3TMPB 5L95C 3PHWB 4AUQC 1YX5B 2CHWA 1R4NI 2NBWB 2ZEQA 3PS6A 3PVLA 4W9EA 2O2VA 1WM2A 3L16A 4KVGB 1KLVA 4NY0A 3RULA 3U8ZA 3A4RA 4XC2A 4KZ0A 4BKGA 2KJRA 1WR6E 3PPAA 2KDEB 1WZ3A 2XK5A 3ENEA 2ZCCA 5IAAC 1UBIA 3R7RA 1UD7A 1WF9A 5CHVC 4YL8A 2WYQA 2MW5A 1E8ZA 1WE7A 4WJQA 2LVOA 5D7GA 3H7PA 2NR2A 4K7WA 1TTNA 3QCAA 2EMTA 2HJ8A 3WAPA 2K39A 3DBHI 3W1YA 3UIOB 2FCNA 4ZRKA 3VTWA 2JUOA 2JZZA 2BWFA 3DOWA 3HM3A 2NBVB 2XEWA 1E8XA 1FXTB 2JXXA 3NS8A 1ZW7A 4FLHA 4CYEA 3NY5A 1AARA 5D2MB 3QA8A 3CMMB 1RLFA 5J2RA 1WGRA 1WMHA 4KSKC 2KNBA 4ANXA 4K7UA 4DHJB 2AL6A 3A9KA 2IY1B 4BKTA 2ZPYA 4HXDA 2CU1A 1IP9A 3X0WA 4TV3A 4BKSD 1TZ1A 2KDIA 2AWTA 1Y8RC 1GUAB 2LWPA 2XK5B 3AI5A 4K81A 4CHKA 2KMCA 3QJZA 2M0XA 2FUHB 1J19A 3Q3JA 1WYWB 1WXMA 5FR6A 2G4SA 1Z2MA 3ZVVA 2C5LC 2KHWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KO3 A;  3O65 B;  1V86 A;  3LJ3 A;  3QX1 A;  3DPD A;  4URK A;  4GOC A;  1G6J A;  4FBJ B;  4P7I A;  4JLC A;  2LXC A;  2AL3 A;  3ZRC A;  3D32 A;  3H6N A;  2MX2 A;  2LGD A;  3I3T B;  1P98 A;  4HJK A;  4I6N B;  3OJ3 A;  3SHQ A;  1Q0W B;  4WWO A;  2LAS A;  2FAZ A;  2Y5B B;  2YLM A;  4AP4 C;  1L7Y A;  5BO4 B;  3NHE B;  2DAF A;  1YD8 U;  2IZV B;  2LRW A;  3JSV B;  2LUE A;  4B9K A;  2NPT A;  3V61 A;  1A5R A;  5HKH A;  4ZYN A;  4LCD E;  3H9D A;  4RM8 A;  1C1Y B;  1UBQ A;  3TJP A;  5G55 A;  4GU2 A;  3WAN A;  2JZ3 B;  2B3A A;  3RYT A;  1RFA A;  3ZTD A;  3IBE A;  3ECI A;  3PLU A;  5C23 A;  4HVB A;  2I1J A;  3B0A A;  1V81 A;  4HLE A;  4FHJ A;  3N30 A;  5AEK B;  3H7P B;  2LVQ A;  3L17 A;  4GXB A;  3ONS A;  2MLB A;  5JH5 C;  1GJZ A;  4BBN C;  1EO6 A;  1VD2 A;  4I6L B;  5KHQ A;  1WXV A;  3M3J A;  1ISN A;  1WY8 A;  2NBU A;  3WAO A;  1E7V A;  4BOZ B;  2QHO A;  2LD9 A;  1YIW A;  1MG8 A;  1SIF A;  4MEM A;  3SDL C;  4M8M A;  1D3Z A;  3QQ8 B;  3OLM D;  4EZK A;  1V49 A;  4M0W B;  4MM3 A;  4DWF A;  2PE9 A;  4MJS A;  1WGY A;  4GDK A;  3UIP B;  1VCB A;  3W1S A;  3OAW A;  3VTU A;  5L83 A;  5C1Z A;  3TCA A;  3KUD B;  2NPT B;  5GMV A;  2GBN A;  4FHK A;  4EOY A;  4KSL C;  2DYM A;  2FCM A;  2IYD B;  5EDS A;  2V4L A;  4II2 B;  4HWI B;  2D2Q A;  3ZRF A;  3PTF C;  4W9H A;  4E3C A;  2LI5 A;  2J0M A;  1YQB A;  5J17 A;  2FCQ A;  1C3T A;  1EF5 A;  2KWU B;  3AU5 A;  4PS8 A;  1YJ1 A;  2LVP A;  2W9N A;  2N9P C;  3AXC A;  3ZUN A;  4NAW B;  3JYU A;  4WJO A;  1F9J A;  4I6P A;  2BWE S;  1WJU A;  2M8S A;  2CR5 A;  3ZNG C;  4AJW A;  2A4Z A;  3EFU A;  2J7Q B;  1OTR B;  1V6E A;  4ANW A;  2N7D A;  3EC8 A;  4GDK B;  4MJS B;  2L00 B;  2MQJ A;  2BYF A;  3A1Q B;  2ASQ A;  4NPN A;  3MTN B;  4FUL A;  4GN1 A;  3M63 B;  2XBB C;  2J0J A;  4NQL B;  2L3Z A;  4HCN B;  1J0G A;  1GG3 A;  1V5O A;  1H8C A;  4MGZ E;  3VXW A;  4ANU A;  2CHZ A;  1S3S G;  3RUI B;  4BVU C;  2KTR A;  2DEN B;  4ZRJ A;  5AZG A;  2K8B A;  2L76 A;  5DPW A;  4ICU A;  2LRU A;  3PLV A;  3DVG Y;  4LJO B;  2O6V B;  2L7R A;  3QK0 A;  1P3Q U;  1SE9 A;  5DCN A;  4FJV B;  3DVN U;  3VAW A;  4HCP B;  5IA7 A;  1GC7 A;  4TQ0 A;  2ZNV B;  2MBQ A;  2BGF A;  2MBO A;  4KV2 A;  1OEY A;  2BF8 B;  2L0F A;  3ML8 A;  3JSV A;  5JHA A;  2WX0 A;  1LFD A;  1XT9 B;  4B6W A;  4EFO A;  2G4D B;  4G50 A;  1I42 A;  3MHS D;  2BKR B;  1UZX B;  4W9J A;  4WAA A;  4IUM B;  3VHT C;  4MGK E;  4IC7 B;  5LXH A;  2KC1 A;  3VH3 B;  3ZNZ B;  4IM2 A;  3PRE A;  4LJP B;  3PGE A;  3DDC B;  3ZW3 A;  4KZC A;  5LLI A;  3CSF A;  3U7D A;  2MBE A;  3A4S C;  2N1V A;  2KTR B;  3UF8 A;  3Q3F A;  3VDZ A;  2J0K A;  1ZGU B;  1IYF A;  4A20 A;  1KJT A;  3IG3 A;  4G11 A;  4MGY E;  3RZW C;  2NVU I;  3C0R B;  4GDL B;  4LDT D;  4EKU A;  5LXI B;  3VH4 B;  2D3G A;  1T0Y A;  2KTF A;  3M95 A;  4E74 A;  4K1R B;  2BYE A;  3PT2 B;  1WI0 A;  3PV1 A;  4IWO A;  4FAD A;  1WZ0 A;  3T9L A;  2L05 A;  2MWS B;  3TL5 A;  5DPR A;  2IO2 B;  4HDQ A;  4XX5 A;  1SGH A;  1LXD A;  4GMV A;  4IM0 A;  2G3Q B;  2N7E A;  4E71 A;  3ML9 A;  2Z59 B;  3UGB B;  3V60 A;  3L13 A;  2WWZ A;  1WGG A;  4KIK B;  4RMA A;  1K8R B;  2PJH A;  3ZLZ A;  3DQV A;  2M17 A;  2KQS A;  1WJ6 A;  2LGX A;  3KW5 B;  2DZK A;  2GBK A;  4M8N A;  5D6J B;  3L08 A;  3MJW A;  3VUY A;  3V62 A;  5JHB A;  1QZE A;  1M94 A;  2A5U A;  2L8J A;  4PYU A;  2DX5 B;  2G45 B;  4N9F 4;  2RD0 A;  3A9J B;  3N32 A;  4TQ1 A;  3V6C B;  4DHZ E;  2GOW A;  2MBH A;  4BKS A;  2MRP A;  4MSQ B;  2V3S A;  4G0N B;  2ZVN A;  3R66 C;  3VUW A;  2KZR A;  1JRU A;  3N3K B;  3GOE A;  2JY6 A;  4NAW A;  2IO3 B;  2KN5 A;  2YVC A;  4J6I A;  4NNJ B;  2RGF A;  2FNJ B;  2UYZ B;  1XD3 B;  2ZPN A;  1V2Y A;  2KLC A;  5CHF A;  4GB9 A;  1R4M I;  4MSM B;  1Q5W B;  4W9D A;  1E8W A;  5CTR C;  5AZF A;  2KKC A;  1V9J A;  1Z5S B;  3A1Q A;  3ZNH B;  2CHX A;  2VRR B;  1RAX A;  1J8C A;  2OOB B;  4MGI E;  3W1S C;  5E6N A;  1P0R A;  4NJ6 A;  1WX7 A;  2HE7 A;  3PZD A;  1I35 A;  3QAR A;  1UEL A;  2D07 B;  1EUV B;  4DHJ D;  3DVN V;  1WXS A;  1Q1O A;  2WDT B;  3L10 B;  2GBJ A;  3RCZ A;  2KDB A;  1TGZ B;  1E8Y A;  2K8H A;  3JW0 X;  3HM6 X;  2D11 A;  3L54 A;  1WRD B;  1HE8 A;  4DBG A;  3B1L X;  3VFK A;  3K9P B;  2DZI A;  3AU4 A;  3KUC B;  4KDL B;  3RD2 A;  4IWP A;  2O6V A;  3UIN B;  1X1M A;  4XZ4 A;  4IW0 A;  4CO7 A;  3R7Q A;  1H4R A;  2RR9 A;  2FCS A;  4NQK E;  4PS7 A;  2MSE D;  2EKE C;  4EZJ A;  2BKF A;  3DBR I;  2IO0 B;  4W9I A;  3QHT A;  5TR5 A;  3BIN A;  2BYV E;  2KJH B;  2PEA A;  4A3P A;  4EZL A;  1U4A A;  4FJY A;  4IWQ A;  2ZNV C;  4ANV A;  1OEY J;  1LQB A;  2C60 A;  1NDD A;  3PRM B;  5CHW A;  2KXJ A;  2FID A;  4RM9 A;  3ZIM A;  2C9W B;  4DDG D;  4DHZ B;  2K6Q A;  3K9O B;  3DBL I;  3QIJ A;  2N1W A;  2FIF A;  3PRP B;  5E6P A;  2MP2 B;  2KFK B;  3VUX A;  2KX3 A;  4OVU A;  3ZO5 B;  5J18 A;  1WM3 A;  2KQ7 A;  2RPQ A;  2NS5 A;  3NZU A;  4W9L A;  5E6O A;  3KYD D;  3QAQ A;  3ZDM C;  2JRH A;  3ZTC A;  2N9X A;  3JVZ X;  3PSE B;  4ICV A;  2JT4 B;  4GDL A;  2R2Q A;  4WJN A;  4AJY B;  2C7H A;  2JF5 A;  4DK5 A;  2LZ6 A;  1S1Q B;  3S2A A;  3NZS A;  3SU8 X;  4ZRI A;  2K25 A;  4WWP A;  4FN2 A;  2KVR A;  3VQI A;  2AEH A;  4JGH B;  3WIM A;  3HHM A;  4W9F A;  4A3O A;  3OJ4 B;  2AYO B;  1TBE A;  1WE6 A;  1WGH A;  3HIZ A;  3T8M A;  4F7Z A;  2L0T A;  2MA9 B;  3KYC D;  3APC A;  2JRI B;  3DCG A;  2K1F A;  1GC6 A;  3DVG X;  2KLG A;  3IFW B;  2WX1 A;  4IM3 A;  4KIK A;  2D10 A;  4G3X B;  2KOX A;  2K6D B;  2V1Y A;  1XQQ A;  2JPH A;  3NOB A;  2HD5 B;  3IHP C;  4IG7 B;  3H7S A;  2O2V B;  3A9J A;  4JQW C;  4HK2 A;  5DPT A;  4DDI D;  4FA6 A;  1BT0 A;  2KD0 A;  3A33 B;  1WXA A;  2ZZP B;  1WH3 A;  3APF A;  2ZVO A;  3PHX B;  4F8C B;  2I1K A;  2KK8 A;  1NI2 A;  3UQA A;  4K7S A;  2M1M A;  1V5T A;  2GBM A;  3CST A;  3L0W B;  4TUU A;  4BBN F;  3AUL A;  1YX6 B;  4GGQ A;  2ZCB A;  3H1U A;  2HTH A;  1OQY A;  1IPG A;  2EMS A;  5JZE B;  5DPS A;  2CS4 A;  4HPM B;  1OGW A;  4MDK E;  2KWV B;  3TBL D;  1L2N A;  4FJZ A;  2KWC A;  1WJ4 A;  2PPH A;  4PYZ A;  2KDF B;  4KDI C;  4WJP A;  2LXA A;  2LJ5 A;  4JIO U;  4GSW A;  3QC8 B;  4EEW A;  1UGM A;  4II3 B;  2MBB B;  2RSU A;  3LDZ E;  2N9E B;  3ZNI D;  3SD5 A;  4X57 B;  3BY4 B;  3PRZ A;  3WAM A;  2KAN A;  3TIX A;  3EEC A;  4W9K A;  3ZDT A;  2IBI B;  1UH6 A;  2C7M B;  1WMH B;  1E7U A;  1KM7 A;  2DYO A;  1E90 A;  3ZKJ C;  3A9K B;  5AZH A;  5D94 A;  2ZJD A;  5KHO A;  2KFJ A;  1P9D U;  2DZM A;  2O6V D;  2Z0D B;  1WIA A;  3QWZ B;  3V6E B;  2PE6 B;  2DZJ A;  3HK0 A;  2OJR A;  3IVF A;  4HDO A;  2M4N A;  3ALB A;  4BFR A;  2KX0 A;  2C7N B;  2BPS A;  4DXA B;  4F1S A;  2KMA A;  1KOT A;  4MH0 E;  3WA0 A;  2MP2 A;  2KFK A;  2LGY A;  3P2B A;  2DHZ A;  1ZKH A;  3UQB A;  1V80 A;  4WWN A;  3X23 A;  3CF6 E;  4GIV A;  3RT3 B;  2MCN B;  2DAJ A;  2GMI C;  3VVW B;  4EUT A;  5G2N A;  4W9G A;  1RRB A;  2JWZ A;  2GBR A;  3DBS A;  4AWJ A;  3EHV A;  4NJ7 A;  1PQS A;  1LM8 B;  1WFY A;  1E5W A;  1WX8 A;  2IO1 B;  4WQO B;  4AOF A;  3GZN I;  3U30 A;  3B08 A;  2N4F A;  5CX3 A;  2UWQ A;  3R3M A;  1NBF C;  1WJN A;  2JVC A;  3RZF A;  2IY0 B;  2KC2 A;  3KH0 A;  3KVF B;  1WGD A;  4MEL A;  4ZDV A;  4OVV A;  3M62 B;  2K8C A;  2REX A;  4LDT B;  3VTV A;  1WX9 A;  2CKH B;  4JL9 A;  4BOS C;  2R2O A;  1P1A A;  2KJ6 A;  1CMX B;  3APD A;  4HPL B;  2NCN A;  1WR1 A;  4ASW C;  3WAL A;  2Z0E B;  3KUZ A;  1EF1 A;  4B95 A;  4PS3 A;  2DYB A;  4TKN A;  1GNU A;  4W9C A;  3TMP B;  5L95 C;  3PHW B;  4AUQ C;  1YX5 B;  2CHW A;  1R4N I;  2NBW B;  2ZEQ A;  3PS6 A;  3PVL A;  4W9E A;  2O2V A;  1WM2 A;  3L16 A;  4KVG B;  1KLV A;  4NY0 A;  3RUL A;  3U8Z A;  3A4R A;  4XC2 A;  4KZ0 A;  4BKG A;  2KJR A;  1WR6 E;  3PPA A;  2KDE B;  1WZ3 A;  2XK5 A;  3ENE A;  2ZCC A;  5IAA C;  1UBI A;  3R7R A;  1UD7 A;  1WF9 A;  5CHV C;  4YL8 A;  2WYQ A;  2MW5 A;  1E8Z A;  1WE7 A;  4WJQ A;  2LVO A;  5D7G A;  3H7P A;  2NR2 A;  4K7W A;  1TTN A;  3QCA A;  2EMT A;  2HJ8 A;  3WAP A;  2K39 A;  3DBH I;  3W1Y A;  3UIO B;  2FCN A;  4ZRK A;  3VTW A;  2JUO A;  2JZZ A;  2BWF A;  3DOW A;  3HM3 A;  2NBV B;  2XEW A;  1E8X A;  1FXT B;  2JXX A;  3NS8 A;  1ZW7 A;  4FLH A;  4CYE A;  3NY5 A;  1AAR A;  5D2M B;  3QA8 A;  3CMM B;  1RLF A;  5J2R A;  1WGR A;  1WMH A;  4KSK C;  2KNB A;  4ANX A;  4K7U A;  4DHJ B;  2AL6 A;  3A9K A;  2IY1 B;  4BKT A;  2ZPY A;  4HXD A;  2CU1 A;  1IP9 A;  3X0W A;  4TV3 A;  4BKS D;  1TZ1 A;  2KDI A;  2AWT A;  1Y8R C;  1GUA B;  2LWP A;  2XK5 B;  3AI5 A;  4K81 A;  4CHK A;  2KMC A;  3QJZ A;  2M0X A;  2FUH B;  1J19 A;  3Q3J A;  1WYW B;  1WXM A;  5FR6 A;  2G4S A;  1Z2M A;  3ZVV A;  2C5L C;  2KHW B; 
#chains in the Genus database with same CATH topology
 4RFB A;  3C19 A;  3GZN B;  3LJ3 A;  3QX1 A;  4OZC A;  4FBJ B;  1MFW A;  2J42 A;  3D32 A;  5FKA C;  3ZRC A;  2MX2 A;  4I6N B;  1P98 A;  4HJK A;  3SHQ A;  5LNK 1;  2QDF A;  2JX5 A;  2LRW A;  4B9K A;  4ZYN A;  2FUG 1;  4B0M A;  1VDV A;  3PZ8 A;  4GU2 A;  3RMK C;  2N7J A;  3LB8 C;  5JH5 C;  3ECI A;  4HVB A;  5C23 A;  1V81 A;  3MJ5 A;  3RPF C;  3L17 A;  4P1B C;  2LGS A;  2WXQ A;  2WXN A;  2J53 A;  2LD9 A;  2ZW1 A;  4JE3 B;  4MEM A;  3P4Q B;  4MM3 A;  2PE9 A;  4MJS A;  1WGY A;  4GDK A;  1D5Z C;  4LNN A;  2NPT B;  2GBN A;  5EE1 A;  2IYD B;  1SE2 A;  1T0R C;  1V8C A;  3PTF C;  3GB1 A;  1YJJ A;  5AUK A;  1OFF A;  1K53 A;  2L52 A;  1C3T A;  3AU5 A;  2K0P A;  2LVP A;  1MG4 A;  2B76 B;  1FXI A;  3JYU A;  1F9J A;  3I57 A;  3RNE C;  3EFU A;  1TS4 A;  2N7D A;  3GS2 A;  3IXS A;  3FC4 A;  4FUL A;  1XO3 A;  1J0G A;  4A6Q A;  1TS3 A;  1H8C A;  3FAH A;  4AQ7 A;  5DPW A;  4ZRJ A;  5AZG A;  2K8B A;  3L4P A;  2HJ1 A;  3E9S A;  2O6V B;  1P3Q U;  1SE9 A;  4FJV B;  3DVN U;  3NUH B;  3VAW A;  2JWU A;  4OW0 A;  5BYQ A;  3U52 E;  2ZNV B;  4C80 A;  2BF8 B;  2L0F A;  5JHA A;  2WDQ B;  2G4D B;  2JQR B;  4WAA A;  4IUM B;  5LXH A;  1C9F A;  3VH3 B;  3ZNZ B;  3PGE A;  3U2S C;  4KZC A;  3DHG C;  3U7D A;  3A4S C;  2JYE A;  1ZGU B;  4G11 A;  4LDT D;  3VH4 B;  2KTF A;  2BYE A;  5D3I B;  3PV1 A;  3VRA B;  2L32 A;  4M0W A;  3TL5 A;  4HDQ A;  4XX5 A;  4USA A;  2Z59 B;  4KIK B;  1WJ6 A;  2DZK A;  1M94 A;  2A5U A;  2J4X A;  2L8J A;  2DX5 B;  2RD0 A;  3N32 A;  3AEE B;  2GOW A;  1D5X C;  3VUW A;  1JRU A;  4NAW A;  1TS5 A;  3GP7 A;  1L6U A;  4NNJ B;  4RGN A;  2RGF A;  2KLC A;  3AEC B;  1FCL A;  2CHX A;  2VRR B;  2OOB B;  2HE7 A;  4XE0 A;  3LYY A;  1EUV B;  1WXS A;  2WDT B;  3L10 B;  1TGZ B;  2K8H A;  3HM6 X;  1XCT L;  1HE8 A;  4WUR A;  4IWP A;  4CO7 A;  1H4R A;  4NQK E;  4PS7 A;  1NEN B;  3DBR I;  4W9I A;  4HRS A;  1BML C;  2BYV E;  2KJH B;  2PEA A;  4A3P A;  1U4A A;  3FIL B;  4IWQ A;  1E6E B;  2C60 A;  2QMT A;  2IJ0 A;  3OG5 A;  2C9W B;  4DDG D;  3ETR A;  1EWY C;  2BB5 A;  5J18 A;  4ARI A;  1F1H A;  1OQR A;  3ZTC A;  2PW9 A;  2JF5 A;  1S1Q B;  2BB6 A;  1ZDX A;  3NZS A;  4WWP A;  2KVR A;  3VQI A;  3H8H A;  3WIM A;  3HHM A;  2AYO B;  3HIZ A;  1JWU D;  3DVG X;  2MH7 A;  4G3X B;  1T3Q A;  2K6D B;  3P42 A;  1R4M B;  1T0Q C;  2HD5 B;  4WIP A;  4ARC A;  3N1Y C;  4C56 C;  2ZZP B;  1WH3 A;  4JWS C;  2N0S B;  4YSX B;  3CST A;  4BBN F;  1YX6 B;  3R2T A;  1D6E C;  2ZCB A;  4XDD A;  2WXG A;  3TBL D;  2PPH A;  4WJP A;  1EU4 A;  1ESF A;  4EEW A;  2PTL A;  2RSU A;  3SD5 A;  3V05 A;  3PRZ A;  2DNF A;  4W9K A;  3ZDT A;  1WMH B;  3MP9 A;  4O1N A;  5AZH A;  2ZJD A;  5G5H A;  4S0R A;  1B9R A;  2Z0D B;  2KAJ A;  4RGM A;  2PE6 B;  3AE8 B;  4DXA B;  1KOT A;  2KQ4 X;  1TIF A;  3P2B A;  2LGY A;  1L4Z B;  2DHZ A;  3X23 A;  3PZ7 A;  3CF6 E;  4GIV A;  3RT3 B;  3AE2 B;  5AUI A;  3ZJU A;  1V1P A;  1AW7 A;  1L0Y B;  3EHV A;  1WX8 A;  4WQO B;  1BUI C;  5H92 C;  4S17 A;  1WJN A;  2JVC A;  4OZB A;  1EWC A;  2RMM A;  3KVF B;  4MEL A;  3Q8A A;  1QOF A;  5T8I A;  4LDT B;  4BOS C;  2R2O A;  3APD A;  1C79 A;  2Z0E B;  5IN7 A;  4TKN A;  1GNU A;  4HRO A;  4AUQ C;  1YX5 B;  4XGA B;  2O2V A;  1QLB B;  1GPX A;  1XLQ A;  2R61 A;  4BKG A;  1JAL A;  2Q5W D;  4LTU A;  2KJR A;  1DYQ A;  1QOA A;  2Z8L A;  1VZ8 A;  3ENE A;  2XK5 A;  1PGX A;  2ZCC A;  1UBI A;  3V3X A;  5CHV C;  4YL8 A;  1E8Z A;  1WE7 A;  4WJQ A;  1UWM A;  2HJ8 A;  3WAP A;  2K39 A;  1TKE A;  3VTW A;  2JUO A;  2NBV B;  1FXA A;  1E8X A;  4FLH A;  5D2M B;  3QA8 A;  3CMM B;  1K51 A;  1WGR A;  3A9K A;  4WAF A;  4HXD A;  2D5G A;  1TZ1 A;  2KDI A;  5BMG A;  1GUA B;  4CHK A;  1YOV B;  2Y5P A;  2M0X A;  4YXD B;  4JX1 C;  1R7S A;  2SEB D;  5FR6 A;  1WYW B;  1WXM A;  2G4S A;  2C5L C;  2KHW B;  2IPK D;  4REZ A;  1V86 A;  4GOC A;  4P7I A;  4JLC A;  1CQV A;  2LAS A;  2FAZ A;  2YLM A;  4AP4 C;  1FIQ A;  3CWI A;  2DAF A;  1V97 A;  1YD8 U;  1CJE A;  2IZV B;  2LUE A;  2NPT A;  3V61 A;  4HKZ E;  4LCD E;  4RM8 A;  1KFY B;  3RYT A;  3ZTD A;  3PLU A;  4HLE A;  4BAX A;  3B0A A;  4PK1 A;  1N61 A;  4GXB A;  2MLB A;  5KHQ A;  3M3J A;  2RDG A;  1ISN A;  1WY8 A;  1E7V A;  4BOZ B;  2KDM A;  1YIW A;  4LK0 M;  1MG8 A;  1SIF A;  3SDL C;  3Q8C A;  2WDV B;  4M8M A;  3OLM D;  3I63 C;  3UIP B;  2MJD A;  1VCB A;  3W1S A;  5L83 A;  4P6V F;  1QF6 A;  3DBH B;  2BT6 A;  2ON8 A;  2V4L A;  1SJE D;  2DBY A;  2D2Q A;  2JZP A;  3N20 C;  4DXF A;  1QT9 A;  3NZ3 A;  3BVZ A;  2FCQ A;  4KKJ A;  4OHJ A;  4DXG A;  3AXC A;  3ZUN A;  1WJU A;  2M8S A;  2CR5 A;  4AJW A;  4MT5 A;  2A4Z A;  1ZUD 2;  1V6E A;  5HHD G;  1MPE A;  2ASQ A;  4GN1 A;  2HDE A;  2ZW0 A;  2XBB C;  3W9C B;  4C00 A;  2OJW A;  2I38 A;  2Y5C A;  3AV8 A;  1GG3 A;  1GOZ A;  3VXW A;  4ANU A;  5C2T B;  1S3S G;  2XNA C;  4BVU C;  2L76 A;  2LRU A;  4LJO B;  5DCN A;  1HA5 A;  1VZ6 A;  1XXG A;  1PUT A;  1L0V B;  1GC7 A;  2BYT A;  2MBO A;  1JW9 D;  3ML8 A;  3JSV A;  2WX0 A;  1LFD A;  1XT9 B;  5BYS A;  4B6W A;  1FCC C;  1NEK B;  1I42 A;  2AQ1 B;  1UZX B;  3VHT C;  2KC1 A;  2EEL A;  4IM2 A;  4C4V A;  3DDC B;  3ZW3 A;  5LLI A;  4IOI E;  1UF0 A;  3KQ4 A;  2N1V A;  2KTR B;  4RCO A;  1SE3 A;  1HEZ E;  5BMH A;  2J0K A;  3HUI A;  1IYF A;  4A20 A;  2GB1 A;  4MH8 A;  1KJT A;  1N62 A;  5HG2 A;  1UWX A;  3NVV A;  3R8B A;  4GDL B;  1I4H A;  3RZW C;  4EKU A;  5LXI B;  3RNG C;  4GLS C;  4IWO A;  3SEB A;  2L05 A;  2IGD A;  5DPR A;  2QJL A;  1FFV A;  1SGH A;  1LXD A;  2BQQ A;  4GMV A;  4L1B A;  1F52 A;  2WWZ A;  1K8R B;  2QC8 A;  2LGX A;  3KW5 B;  4JPS A;  3MJW A;  4US9 A;  5JHB A;  3BYY B;  2G45 B;  1L6V A;  3MC0 B;  2MBH A;  4BKS A;  2MRP A;  4MSQ B;  3RI7 C;  2ZVN A;  3GOE A;  5FR3 A;  2YVC A;  3P4S B;  4MSM B;  3MFG A;  5CTR C;  3DWM A;  3A1Q A;  3AH7 A;  1RAX A;  1J8C A;  3W1S C;  5E6N A;  1P0R A;  4KGR A;  5H8Y E;  2BVC A;  5IO9 A;  1HTO A;  1Q1O A;  2GBJ A;  3RCZ A;  2KDB A;  4DBG A;  4A9A A;  1T5X D;  1TS2 A;  4WWM A;  3R7Q A;  1ZPS A;  3AEF B;  5TR5 A;  2YEP B;  3AMZ A;  4FJY A;  1YN3 A;  4ANV A;  2CJN A;  2ZNV C;  1JQ4 A;  1AWD A;  4DHZ B;  4ITK A;  3BVM A;  3K9O B;  1BXT A;  3DBL I;  3PRP B;  3Q69 A;  2MP2 B;  2KFK B;  3ZO5 B;  2INC C;  2KQ7 A;  2NS5 A;  3NZU A;  4W9L A;  1SEB D;  2K9X A;  3NVW A;  2JRH A;  3QAQ A;  1LGR A;  2JT4 B;  4WJN A;  2N9L A;  2ONQ A;  3AB5 A;  2C7H A;  2LZ6 A;  2K25 A;  2GRI A;  4FN2 A;  3BII D;  1AN8 A;  3TEX A;  4W9F A;  1TBE A;  1WE6 A;  1WGH A;  4F7Z A;  2E6X A;  3APC A;  1GC6 A;  2KLG A;  1RWS A;  1YQ3 B;  2W54 A;  2JPH A;  1F2R C;  4RF1 A;  3IHP C;  4IG7 B;  3AEA B;  4JQW C;  3A9J A;  3OWE B;  5DPT A;  2KD0 A;  1NI2 A;  2K3U A;  3UQA A;  4K7S A;  2M1M A;  1V5T A;  2GBM A;  3L0W B;  2YEP F;  1SBB B;  3PO0 A;  1WYG A;  4P16 A;  1OQY A;  1IPG A;  2EMS A;  4L23 A;  5JZE B;  2CS4 A;  1Q10 A;  1OGW A;  4MDK E;  2KWV B;  2H88 B;  4FJZ A;  1TKY A;  1PYW D;  1Y56 A;  4D2K A;  2JU6 X;  1UGM A;  1L4D B;  2N9E B;  4X57 B;  3EEC A;  2Y3A A;  2DYO A;  1DOI A;  1FM0 D;  2IDY A;  1T6B X;  1ET9 A;  2WXJ A;  2DZM A;  1WIA A;  2DZJ A;  3HK0 A;  3IVF A;  3R2I A;  2PIA A;  2BPS A;  2H89 B;  2M56 B;  2E3T A;  1STE A;  5IKC M;  4MH0 E;  1ZKH A;  1V80 A;  1PGA A;  3IAM 1;  1YN5 A;  5G2N A;  4W9G A;  2GBR A;  3DBS A;  4NJ7 A;  1PQS A;  1LM8 B;  3GZN I;  3B08 A;  2V3P A;  1P7E A;  4N59 A;  2KC2 A;  1WGD A;  4ZDV A;  1UNS A;  4OVV A;  5EE9 A;  2K8C A;  2REX A;  3VTV A;  1WX9 A;  2CKH B;  3HRD D;  1CMX B;  4HPL B;  2NCN A;  2EKI A;  1WRI A;  1EF1 A;  4B95 A;  4PS3 A;  2DYB A;  2FBW B;  2BS4 B;  1C78 A;  2OED A;  5IP4 D;  1YNT E;  4W9E A;  3L16 A;  4MM3 B;  4NY0 A;  3U8Z A;  1QOB A;  2D3C A;  1WR6 E;  1C4A A;  2KYW A;  2KDE B;  1UD7 A;  2CU3 A;  2MW5 A;  3EGR A;  2LVO A;  2NR2 A;  4K7W A;  1I4P A;  2FE8 A;  5IOI A;  3SFD B;  2WXI A;  2JZZ A;  4NZL B;  4US8 A;  2XEW A;  2QIL A;  3NS8 A;  3Q8B A;  1RLF A;  1ACC A;  4KSK C;  1FEH A;  3RFZ B;  1FRD A;  4K7U A;  2AL6 A;  1HXY D;  4K3C A;  5HFY A;  4ZRP A;  4K81 A;  3C8Y A;  3TUO A;  2FUH B;  1Z2M A;  1PDX A;  2KO3 A;  4LNI A;  1G6J A;  4XWW A;  2LXC A;  2LGD A;  3I3T B;  1Q0W B;  4WWO A;  2Y5B B;  1UGJ A;  1L7Y A;  2LMC A;  3NHE B;  5G5G A;  3RNF C;  5HKH A;  1ET6 A;  2PLP A;  3H9D A;  1UBQ A;  2INP E;  5G55 A;  1PFD A;  3WAN A;  4AS1 A;  2JZ3 B;  1R4N B;  2B3A A;  1RFA A;  3IBE A;  1XEE A;  3Q3N C;  4FHJ A;  2LVQ A;  1GJZ A;  2BS2 B;  1EO6 A;  1VD2 A;  4I6L B;  1WXV A;  2NBU A;  4WQM A;  3WAO A;  2QHO A;  2N9K A;  2LHE A;  1D3Z A;  3ABV B;  3QQ8 B;  4EZK A;  4M0W B;  4K3B A;  5C1Z A;  5GMV A;  4EOY A;  2DYM A;  3Q2A C;  1FNV A;  3EA6 A;  3P63 A;  3U7Z A;  3ZJV A;  4HWI B;  3MC8 A;  4E3C A;  2LI5 A;  5TSS A;  1FNW A;  1B1Z A;  1KF6 B;  1YQB A;  3AEB B;  1KRH A;  1YJ1 A;  2OHF A;  3BZD B;  2DWQ A;  4NAW B;  3HVD A;  4I6P A;  1F2R I;  2JXT A;  1RFK A;  3ZNG C;  4ANW A;  1OTR B;  1IBX A;  2L00 B;  2BYF A;  2IND C;  2WXO A;  4C7Y A;  3M63 B;  3AE4 B;  4NQL B;  1SF0 A;  1FD6 A;  2MHJ A;  1V5O A;  3VR8 B;  2CHZ A;  3RUI B;  2KTR A;  1SXT A;  2DEN B;  3TEZ A;  1WSP A;  1C76 A;  3P4P B;  3PLV A;  3DVG Y;  3QK0 A;  1KTK A;  3B2F A;  1SJH D;  5IA7 A;  4TQ0 A;  2WP9 B;  1N63 A;  2WDR B;  4EFO A;  3T3N A;  1ZXI A;  1JML A;  3ZXV A;  1DOY A;  4MGK E;  1SSN A;  1I4G A;  2LUM A;  4BZA A;  3PRE A;  1A70 A;  3EFC A;  3CSF A;  4M01 A;  2MBE A;  3UF8 A;  1QKZ A;  1CK1 A;  3IG3 A;  3C0R B;  1PGB A;  4E74 A;  4K1R B;  2WGS A;  3RN9 C;  1WI0 A;  3T9L A;  1ENF A;  2MWS B;  1UUP A;  3N1Z C;  3E56 A;  4E71 A;  3V60 A;  1FMA D;  1WGG A;  4YTM B;  2PJH A;  2M17 A;  2KQS A;  2GBK A;  4M8N A;  3W5U B;  3VUY A;  2PKO A;  2VH1 A;  1J7A A;  3V62 A;  4N9F 4;  1EM7 A;  4NAM A;  4TQ1 A;  3V6C B;  2KAC A;  4A90 A;  4G0N B;  1F77 A;  3N9Y C;  2KZR A;  1MJD A;  2JY6 A;  2IO3 B;  3NVY A;  4RF0 A;  4J6I A;  1XD3 B;  2ZPN A;  4HPP A;  1V2Y A;  4GB9 A;  1R4M I;  2L1A A;  4W9D A;  1E8W A;  5AZF A;  1V9J A;  1Z5S B;  4NJC A;  4NJ6 A;  1WX7 A;  1NI3 A;  1XLP A;  3QAR A;  1UEL A;  3DVN V;  1NYQ A;  4WH4 A;  2LGI A;  2X38 A;  2D11 A;  3ZJT A;  4JWU C;  3B1L X;  2DZI A;  3AU4 A;  4KDL B;  3RD2 A;  2O6V A;  1X1M A;  4IW0 A;  2RDH A;  3VRB B;  2FCS A;  1IGD A;  1E7P B;  2MSE D;  1V1O A;  1YMH E;  1JRO A;  4EZJ A;  3QHT A;  2JSV X;  1JCK B;  4EZL A;  3NG0 A;  1OEY J;  1TY0 A;  1LQB A;  3PRM B;  3ZIM A;  2FID A;  4RM9 A;  2K6Q A;  3QIJ A;  2FIF A;  3U4E G;  2KX3 A;  1JRP A;  1VR9 A;  1WM3 A;  4FXC A;  2RPQ A;  2BW2 A;  4IDI A;  3J9C A;  5E6O A;  4YSZ B;  3NJT A;  3AE7 B;  3ZDM C;  1V1P B;  2BTE A;  2N9X A;  3CIR B;  3JVZ X;  3GE8 C;  2R2Q A;  4DK5 A;  3S2A A;  4ZRI A;  2INN E;  2SAK A;  4JGH B;  4RGO S;  4A3O A;  3OJ4 B;  3T8M A;  4HEA 1;  4ZYS A;  1TT5 B;  2L0T A;  3KYC D;  3DCG A;  1TJE A;  2M0A A;  2KT7 A;  3IFW B;  2WX1 A;  3KLS X;  1TYG B;  4IM3 A;  3RNA C;  4KIK A;  2D3B A;  2WXF A;  2KOX A;  4DQO C;  3NOB A;  2O2V B;  2WS3 B;  4YSY B;  2KVZ A;  4DDI D;  4FA6 A;  1BT0 A;  1WXA A;  3APF A;  2ICI A;  2ZVO A;  3PHX B;  3AE1 B;  2I1K A;  2KK8 A;  3NRZ A;  4TUU A;  4GGQ A;  2HTH A;  1HZ5 A;  3AN1 A;  2IGG A;  5DPS A;  4HPM B;  1E9M A;  1L2N A;  4LNK A;  2KWC A;  1JWA D;  4JIO U;  2KWD A;  2JYT A;  4GSW A;  3DBR B;  2MBB B;  1FPY A;  3BY4 B;  2AQ2 B;  3Q6B A;  4YTP B;  5JXV A;  2KAN A;  3TIX A;  2IBI B;  1UH6 A;  1RM6 C;  1E10 A;  1E7U A;  3W2D A;  1E90 A;  3ZKJ C;  5D3D A;  3A9K B;  2LEK A;  5D94 A;  1C4C A;  5KHO A;  1MI0 A;  1IUE A;  1FFU A;  3QWZ B;  3V6E B;  2AX5 A;  2OJR A;  3FIL A;  4HDO A;  1T0S C;  2M4N A;  4BFR A;  2KX0 A;  1F0Z A;  4F1S A;  2KMA A;  3P4R B;  4OZA A;  1HTQ A;  3WA0 A;  3BWU D;  3UQB A;  3W5V B;  1DOX A;  2DAJ A;  5HI1 A;  4KKI A;  2WU5 B;  2J52 A;  1ZOY B;  1N5X A;  3U30 A;  2N4F A;  4A8X C;  4OVZ A;  2UWQ A;  3R3M A;  4XWT A;  3B2G A;  1FO4 A;  3M62 B;  2DLB A;  4JL9 A;  2WXM A;  4PT5 A;  2W3S A;  1AYF A;  4P1C C;  4ASW C;  4CQN A;  4W9C A;  3PHW B;  2NBW B;  4R3D A;  4KVG B;  3AED B;  1KLV A;  2I2Y A;  4XC2 A;  3NS1 A;  2WXR A;  2RDB C;  3PPA A;  4H2A A;  1C4P A;  3B9J A;  1WF9 A;  3AE3 B;  2WYQ A;  2W3R A;  5D7G A;  1TTN A;  1JWS D;  3QCA A;  1E0Z A;  5EE0 A;  3DBH I;  3W1Y A;  3UIO B;  2FCN A;  4ZRK A;  4YWG G;  3HM3 A;  4HKQ A;  2JXX A;  5MPO A;  1ZW7 A;  5E6J A;  4CYE A;  3NY5 A;  2HTM E;  5J2R A;  1WMH A;  2KNB A;  2PVO D;  4ANX A;  1SIJ A;  2IY1 B;  4BKT A;  2ZPY A;  4ACF A;  1ZXH A;  1N60 A;  2CU1 A;  1XLN A;  3X0W A;  1IP9 A;  2AWT A;  2KMC A;  1QQR A;  1N5W A;  1ZP0 B;  1J19 A;  1I7H A;  3Q3J A;  3TEY A;  3H7P B;  3ZVV A;  1CZP A;  2TSS A;  1M4V A;  3O65 B;  3DPD A;  4URK A;  2AL3 A;  3H6N A;  4ZHP A;  3OJ3 A;  5BO4 B;  1NYR A;  4J3O D;  1K52 A;  2WXK A;  3JSV B;  3FKY A;  2IGH A;  4XYC A;  1A5R A;  1C1Y B;  1HZ6 A;  3TJP A;  1OQQ A;  4C4V B;  5AEK B;  2I1J A;  3N30 A;  3ONS A;  4BBN C;  1XF5 L;  4C7Z A;  3RNB C;  3VR9 B;  2NTT A;  5EE3 A;  1V49 A;  4YT0 B;  4DWF A;  4RH6 A;  3OAW A;  3VTU A;  4ZHO A;  3TCA A;  3KUD B;  4FHK A;  4KSL C;  2FCM A;  5EDS A;  3ZYY X;  4II2 B;  2VZK B;  3ZRF A;  4W9H A;  2L83 A;  2KMM A;  2J0M A;  5J17 A;  1EF5 A;  2KWU B;  4TMA B;  4PS8 A;  2W9N A;  2N9P C;  2G1E A;  4WJO A;  4MAC A;  3BK1 A;  2BWE S;  3T3O A;  2J7Q B;  3MC9 A;  2M19 A;  2V3N A;  3ZQ4 A;  3EC8 A;  4GDK B;  1XLO A;  2MQJ A;  4MJS B;  3DWG C;  3N1X C;  3A1Q B;  1MHH E;  4NPN A;  3MTN B;  5BMI A;  2J0J A;  4EE2 A;  2L3Z A;  4HCN B;  3BYT B;  4MGZ E;  2V9H A;  3UI3 A;  2L7R A;  4XDC A;  4HCP B;  3SFE B;  1JWB D;  2WNM A;  2WXH A;  4KGS A;  2MBQ A;  2BGF A;  4N6E B;  5C3J B;  4KV2 A;  1OEY A;  3SR6 A;  4M00 A;  2G9H D;  4ZRQ A;  4G50 A;  1LO5 D;  3MHS D;  2BKR B;  4W9J A;  4IC7 B;  1P7F A;  4LJP B;  4LLG M;  1FRR A;  3AM9 A;  1SE4 A;  4KGT A;  3Q3F A;  3VDZ A;  1XCQ L;  4RGT A;  2BBC A;  4MGY E;  2NVU I;  2D3G A;  1T0Y A;  3M95 A;  3PT2 B;  2KN4 A;  1TZO A;  4FAD A;  1WZ0 A;  2WXP A;  4QAY A;  1VZ7 A;  2IO2 B;  2QEJ C;  4IM0 A;  2G3Q B;  2N7E A;  2W82 A;  3Q14 C;  3ML9 A;  3UGB B;  3L13 A;  2V0G A;  3KWV A;  4RMA A;  3ZLZ A;  3DQV A;  5D6J B;  3L08 A;  1D5M C;  1QZE A;  4PYU A;  4A55 A;  3A9J B;  2QCZ A;  4DHZ E;  2QSD A;  2WXL A;  2V3S A;  3DHH C;  3R66 C;  3N3K B;  2WQY B;  2KN5 A;  2FNJ B;  2UYZ B;  1J7B A;  2WU2 B;  3BVG A;  5CHF A;  3IT6 B;  1Q5W B;  1I4X A;  2KKC A;  3GE3 C;  3ZNH B;  4MGI E;  1ROE A;  3PZD A;  3AE6 B;  1I35 A;  2D07 B;  3O13 A;  4DHJ D;  3ZXR A;  1E8Y A;  3JW0 X;  1L5P A;  2GI9 A;  3L54 A;  1WRD B;  3EUB 2;  3VFK A;  3K9P B;  3KUC B;  3LXF A;  3UIN B;  3BK2 A;  4XZ4 A;  2RR9 A;  1WWT A;  2LJI A;  1K50 A;  2EKE C;  1TY2 A;  2LHD A;  2BKF A;  2IO0 B;  4Q2J A;  3BIN A;  1YQ4 B;  3I9V 1;  1KLG D;  1NDD A;  5CHW A;  2KXJ A;  1D4B A;  3NVZ A;  1KH0 A;  2ACZ B;  2N1W A;  5E6P A;  3VUX A;  4OVU A;  1YJI A;  1MHX A;  2XN9 C;  2AQ3 B;  3KYD D;  2WLB A;  3PSE B;  4ICV A;  4GDL A;  4AJY B;  4UDU C;  2X8X X;  3SU8 X;  1JWM D;  2MJE A;  3IAS 1;  5BYR A;  1VRA B;  2AEH A;  1I4Q A;  1N6Z A;  2MA9 B;  2JRI B;  2K1F A;  2NMQ A;  4HJG E;  1SB3 C;  1FNU A;  1GB4 A;  2D10 A;  2V1Y A;  4ZOH C;  1XQQ A;  3H7S A;  4HK2 A;  3A33 B;  3RNC C;  2MEK A;  4F8C B;  3AUL A;  3H1U A;  2LFI A;  3Q8E A;  4B0E A;  1WGK A;  4M02 A;  1WJ4 A;  4PYZ A;  2KDF B;  4KDI C;  1EU3 A;  2LXA A;  2LJ5 A;  1GAQ B;  3QC8 B;  4KX6 B;  4II3 B;  3LDZ E;  5I4D A;  3ZNI D;  2PMV A;  3Q8F A;  1L0X B;  4LNF A;  3WAM A;  2K22 A;  5GXG B;  2C7M B;  3ZGZ A;  1TKG A;  1KM7 A;  3I5J C;  3WCQ A;  3DBL B;  2RPV A;  3KWL A;  1IGC A;  2KFJ A;  2D3A A;  1P9D U;  2O6V D;  2V4I B;  4N58 A;  1HQR D;  2VH2 A;  1J7C A;  3ALB A;  1I4R A;  2C7N B;  4IKG A;  2WHI A;  3TEW A;  2MP2 A;  2KFK A;  1C77 A;  3IT4 B;  4WWN A;  3AE9 B;  2K5P A;  2MCN B;  2GMI C;  3VVW B;  3P1M A;  3AE5 B;  4EUT A;  1RRB A;  2JWZ A;  4AWJ A;  1WFY A;  1E5W A;  2IO1 B;  3AEG B;  4AOF A;  4LNO A;  5CX3 A;  3RZF A;  1NBF C;  2PVG C;  2IY0 B;  3KH0 A;  4TSS A;  1P1A A;  2KJ6 A;  1WR1 A;  3WAL A;  1WXQ A;  3KUZ A;  1QOG A;  5L95 C;  2UU7 A;  1ZDV A;  3TMP B;  2CHW A;  1R4N I;  2ZEQ A;  3PS6 A;  3PVL A;  1WM2 A;  3RUL A;  3A4R A;  3Q3M C;  4KZ0 A;  1RYJ A;  4YTN B;  1YN4 A;  1VJK A;  5FK9 C;  1WZ3 A;  2GLS A;  5IAA C;  3R7R A;  4L2Y A;  2QIE B;  3H7P A;  4RNA A;  1VLB A;  1DGJ A;  2EMT A;  2MJ3 A;  3TSS A;  3HVZ A;  2BWF A;  3DOW A;  3URY A;  3MHZ A;  1ZE3 D;  1FXT B;  1QIL A;  1GB1 A;  2VZK D;  1IBX B;  1AAR A;  2NTS A;  2BS3 B;  3DHI C;  1MVK A;  2W55 A;  4DHJ B;  3Q3O C;  4BKS D;  4TV3 A;  3AI5 A;  2XK5 B;  1Y8R C;  2LWP A;  3QJZ A;  2CJO A;  1KLU D;  1NVI D;  4ICU A; 
#chains in the Genus database with same CATH homology
 2KO3 A;  3O65 B;  1V86 A;  3LJ3 A;  3QX1 A;  3DPD A;  4URK A;  4GOC A;  1G6J A;  4FBJ B;  4P7I A;  4JLC A;  2LXC A;  2AL3 A;  3ZRC A;  3D32 A;  3H6N A;  2MX2 A;  2LGD A;  3I3T B;  1P98 A;  4HJK A;  4I6N B;  3OJ3 A;  3SHQ A;  1Q0W B;  4WWO A;  2LAS A;  2FAZ A;  2Y5B B;  2YLM A;  4AP4 C;  1L7Y A;  5BO4 B;  3NHE B;  2DAF A;  1YD8 U;  2IZV B;  2LRW A;  3JSV B;  2LUE A;  4B9K A;  2NPT A;  3V61 A;  1A5R A;  5HKH A;  4ZYN A;  4LCD E;  3H9D A;  4RM8 A;  1C1Y B;  1UBQ A;  3TJP A;  5G55 A;  4GU2 A;  3WAN A;  2JZ3 B;  2B3A A;  3RYT A;  1RFA A;  3ZTD A;  3IBE A;  3ECI A;  3PLU A;  5C23 A;  4HVB A;  2I1J A;  3B0A A;  1V81 A;  4HLE A;  4FHJ A;  3N30 A;  5AEK B;  3H7P B;  2LVQ A;  3L17 A;  4GXB A;  3ONS A;  2MLB A;  5JH5 C;  1GJZ A;  4BBN C;  1EO6 A;  1VD2 A;  4I6L B;  5KHQ A;  1WXV A;  3M3J A;  1ISN A;  1WY8 A;  2NBU A;  3WAO A;  1E7V A;  4BOZ B;  2QHO A;  2LD9 A;  1YIW A;  1MG8 A;  1SIF A;  4MEM A;  3SDL C;  4M8M A;  1D3Z A;  3QQ8 B;  3OLM D;  4EZK A;  1V49 A;  4M0W B;  4MM3 A;  4DWF A;  2PE9 A;  4MJS A;  1WGY A;  4GDK A;  3UIP B;  1VCB A;  3W1S A;  3OAW A;  3VTU A;  5L83 A;  5C1Z A;  3TCA A;  3KUD B;  2NPT B;  5GMV A;  2GBN A;  4FHK A;  4EOY A;  4KSL C;  2DYM A;  2FCM A;  2IYD B;  5EDS A;  2V4L A;  4II2 B;  4HWI B;  2D2Q A;  3ZRF A;  3PTF C;  4W9H A;  4E3C A;  2LI5 A;  2J0M A;  1YQB A;  5J17 A;  2FCQ A;  1C3T A;  1EF5 A;  2KWU B;  3AU5 A;  4PS8 A;  1YJ1 A;  2LVP A;  2W9N A;  2N9P C;  3AXC A;  3ZUN A;  4NAW B;  3JYU A;  4WJO A;  1F9J A;  4I6P A;  2BWE S;  1WJU A;  2M8S A;  2CR5 A;  3ZNG C;  4AJW A;  2A4Z A;  3EFU A;  2J7Q B;  1OTR B;  1V6E A;  4ANW A;  2N7D A;  3EC8 A;  4GDK B;  4MJS B;  2L00 B;  2MQJ A;  2BYF A;  3A1Q B;  2ASQ A;  4NPN A;  3MTN B;  4FUL A;  4GN1 A;  3M63 B;  2XBB C;  2J0J A;  4NQL B;  2L3Z A;  4HCN B;  1J0G A;  1GG3 A;  1V5O A;  1H8C A;  4MGZ E;  3VXW A;  4ANU A;  2CHZ A;  1S3S G;  3RUI B;  4BVU C;  2KTR A;  2DEN B;  4ZRJ A;  5AZG A;  2K8B A;  2L76 A;  5DPW A;  4ICU A;  2LRU A;  3PLV A;  3DVG Y;  4LJO B;  2O6V B;  2L7R A;  3QK0 A;  1P3Q U;  1SE9 A;  5DCN A;  4FJV B;  3DVN U;  3VAW A;  4HCP B;  5IA7 A;  1GC7 A;  4TQ0 A;  2ZNV B;  2MBQ A;  2BGF A;  2MBO A;  4KV2 A;  1OEY A;  2BF8 B;  2L0F A;  3ML8 A;  3JSV A;  5JHA A;  2WX0 A;  1LFD A;  1XT9 B;  4B6W A;  4EFO A;  2G4D B;  4G50 A;  1I42 A;  3MHS D;  2BKR B;  1UZX B;  4W9J A;  4WAA A;  4IUM B;  3VHT C;  4MGK E;  4IC7 B;  5LXH A;  2KC1 A;  3VH3 B;  3ZNZ B;  4IM2 A;  3PRE A;  4LJP B;  3PGE A;  3DDC B;  3ZW3 A;  4KZC A;  5LLI A;  3CSF A;  3U7D A;  2MBE A;  3A4S C;  2N1V A;  2KTR B;  3UF8 A;  3Q3F A;  3VDZ A;  2J0K A;  1ZGU B;  1IYF A;  4A20 A;  1KJT A;  3IG3 A;  4G11 A;  4MGY E;  3RZW C;  2NVU I;  3C0R B;  4GDL B;  4LDT D;  4EKU A;  5LXI B;  3VH4 B;  2D3G A;  1T0Y A;  2KTF A;  3M95 A;  4E74 A;  4K1R B;  2BYE A;  3PT2 B;  1WI0 A;  3PV1 A;  4IWO A;  4FAD A;  1WZ0 A;  3T9L A;  2L05 A;  2MWS B;  3TL5 A;  5DPR A;  2IO2 B;  4HDQ A;  4XX5 A;  1SGH A;  1LXD A;  4GMV A;  4IM0 A;  2G3Q B;  2N7E A;  4E71 A;  3ML9 A;  2Z59 B;  3UGB B;  3V60 A;  3L13 A;  2WWZ A;  1WGG A;  4KIK B;  4RMA A;  1K8R B;  2PJH A;  3ZLZ A;  3DQV A;  2M17 A;  2KQS A;  1WJ6 A;  2LGX A;  3KW5 B;  2DZK A;  2GBK A;  4M8N A;  5D6J B;  3L08 A;  3MJW A;  3VUY A;  3V62 A;  5JHB A;  1QZE A;  1M94 A;  2A5U A;  2L8J A;  4PYU A;  2DX5 B;  2G45 B;  4N9F 4;  2RD0 A;  3A9J B;  3N32 A;  4TQ1 A;  3V6C B;  4DHZ E;  2GOW A;  2MBH A;  4BKS A;  2MRP A;  4MSQ B;  2V3S A;  4G0N B;  2ZVN A;  3R66 C;  3VUW A;  2KZR A;  1JRU A;  3N3K B;  3GOE A;  2JY6 A;  4NAW A;  2IO3 B;  2KN5 A;  2YVC A;  4J6I A;  4NNJ B;  2RGF A;  2FNJ B;  2UYZ B;  1XD3 B;  2ZPN A;  1V2Y A;  2KLC A;  5CHF A;  4GB9 A;  1R4M I;  4MSM B;  1Q5W B;  4W9D A;  1E8W A;  5CTR C;  5AZF A;  2KKC A;  1V9J A;  1Z5S B;  3A1Q A;  3ZNH B;  2CHX A;  2VRR B;  1RAX A;  1J8C A;  2OOB B;  4MGI E;  3W1S C;  5E6N A;  1P0R A;  4NJ6 A;  1WX7 A;  2HE7 A;  3PZD A;  1I35 A;  3QAR A;  1UEL A;  2D07 B;  1EUV B;  4DHJ D;  3DVN V;  1WXS A;  1Q1O A;  2WDT B;  3L10 B;  2GBJ A;  3RCZ A;  2KDB A;  1TGZ B;  1E8Y A;  2K8H A;  3JW0 X;  3HM6 X;  2D11 A;  3L54 A;  1WRD B;  1HE8 A;  4DBG A;  3B1L X;  3VFK A;  3K9P B;  2DZI A;  3AU4 A;  3KUC B;  4KDL B;  3RD2 A;  4IWP A;  2O6V A;  3UIN B;  1X1M A;  4XZ4 A;  4IW0 A;  4CO7 A;  3R7Q A;  1H4R A;  2RR9 A;  2FCS A;  4NQK E;  4PS7 A;  2MSE D;  2EKE C;  4EZJ A;  2BKF A;  3DBR I;  2IO0 B;  4W9I A;  3QHT A;  5TR5 A;  3BIN A;  2BYV E;  2KJH B;  2PEA A;  4A3P A;  4EZL A;  1U4A A;  4FJY A;  4IWQ A;  2ZNV C;  4ANV A;  1OEY J;  1LQB A;  2C60 A;  1NDD A;  3PRM B;  5CHW A;  2KXJ A;  2FID A;  4RM9 A;  3ZIM A;  2C9W B;  4DDG D;  4DHZ B;  2K6Q A;  3K9O B;  3DBL I;  3QIJ A;  2N1W A;  2FIF A;  3PRP B;  5E6P A;  2MP2 B;  2KFK B;  3VUX A;  2KX3 A;  4OVU A;  3ZO5 B;  5J18 A;  1WM3 A;  2KQ7 A;  2RPQ A;  2NS5 A;  3NZU A;  4W9L A;  5E6O A;  3KYD D;  3QAQ A;  3ZDM C;  2JRH A;  3ZTC A;  2N9X A;  3JVZ X;  3PSE B;  4ICV A;  2JT4 B;  4GDL A;  2R2Q A;  4WJN A;  4AJY B;  2C7H A;  2JF5 A;  4DK5 A;  2LZ6 A;  1S1Q B;  3S2A A;  3NZS A;  3SU8 X;  4ZRI A;  2K25 A;  4WWP A;  4FN2 A;  2KVR A;  3VQI A;  2AEH A;  4JGH B;  3WIM A;  3HHM A;  4W9F A;  4A3O A;  3OJ4 B;  2AYO B;  1TBE A;  1WE6 A;  1WGH A;  3HIZ A;  3T8M A;  4F7Z A;  2L0T A;  2MA9 B;  3KYC D;  3APC A;  2JRI B;  3DCG A;  2K1F A;  1GC6 A;  3DVG X;  2KLG A;  3IFW B;  2WX1 A;  4IM3 A;  4KIK A;  2D10 A;  4G3X B;  2KOX A;  2K6D B;  2V1Y A;  1XQQ A;  2JPH A;  3NOB A;  2HD5 B;  3IHP C;  4IG7 B;  3H7S A;  2O2V B;  3A9J A;  4JQW C;  4HK2 A;  5DPT A;  4DDI D;  4FA6 A;  1BT0 A;  2KD0 A;  3A33 B;  1WXA A;  2ZZP B;  1WH3 A;  3APF A;  2ZVO A;  3PHX B;  4F8C B;  2I1K A;  2KK8 A;  1NI2 A;  3UQA A;  4K7S A;  2M1M A;  1V5T A;  2GBM A;  3CST A;  3L0W B;  4TUU A;  4BBN F;  3AUL A;  1YX6 B;  4GGQ A;  2ZCB A;  3H1U A;  2HTH A;  1OQY A;  1IPG A;  2EMS A;  5JZE B;  5DPS A;  2CS4 A;  4HPM B;  1OGW A;  4MDK E;  2KWV B;  3TBL D;  1L2N A;  4FJZ A;  2KWC A;  1WJ4 A;  2PPH A;  4PYZ A;  2KDF B;  4KDI C;  4WJP A;  2LXA A;  2LJ5 A;  4JIO U;  4GSW A;  3QC8 B;  4EEW A;  1UGM A;  4II3 B;  2MBB B;  2RSU A;  3LDZ E;  2N9E B;  3ZNI D;  3SD5 A;  4X57 B;  3BY4 B;  3PRZ A;  3WAM A;  2KAN A;  3TIX A;  3EEC A;  4W9K A;  3ZDT A;  2IBI B;  1UH6 A;  2C7M B;  1WMH B;  1E7U A;  1KM7 A;  2DYO A;  1E90 A;  3ZKJ C;  3A9K B;  5AZH A;  5D94 A;  2ZJD A;  5KHO A;  2KFJ A;  1P9D U;  2DZM A;  2O6V D;  2Z0D B;  1WIA A;  3QWZ B;  3V6E B;  2PE6 B;  2DZJ A;  3HK0 A;  2OJR A;  3IVF A;  4HDO A;  2M4N A;  3ALB A;  4BFR A;  2KX0 A;  2C7N B;  2BPS A;  4DXA B;  4F1S A;  2KMA A;  1KOT A;  4MH0 E;  3WA0 A;  2MP2 A;  2KFK A;  2LGY A;  3P2B A;  2DHZ A;  1ZKH A;  3UQB A;  1V80 A;  4WWN A;  3X23 A;  3CF6 E;  4GIV A;  3RT3 B;  2MCN B;  2DAJ A;  2GMI C;  3VVW B;  4EUT A;  5G2N A;  4W9G A;  1RRB A;  2JWZ A;  2GBR A;  3DBS A;  4AWJ A;  3EHV A;  4NJ7 A;  1PQS A;  1LM8 B;  1WFY A;  1E5W A;  1WX8 A;  2IO1 B;  4WQO B;  4AOF A;  3GZN I;  3U30 A;  3B08 A;  2N4F A;  5CX3 A;  2UWQ A;  3R3M A;  1NBF C;  1WJN A;  2JVC A;  3RZF A;  2IY0 B;  2KC2 A;  3KH0 A;  3KVF B;  1WGD A;  4MEL A;  4ZDV A;  4OVV A;  3M62 B;  2K8C A;  2REX A;  4LDT B;  3VTV A;  1WX9 A;  2CKH B;  4JL9 A;  4BOS C;  2R2O A;  1P1A A;  2KJ6 A;  1CMX B;  3APD A;  4HPL B;  2NCN A;  1WR1 A;  4ASW C;  3WAL A;  2Z0E B;  3KUZ A;  1EF1 A;  4B95 A;  4PS3 A;  2DYB A;  4TKN A;  1GNU A;  4W9C A;  3TMP B;  5L95 C;  3PHW B;  4AUQ C;  1YX5 B;  2CHW A;  1R4N I;  2NBW B;  2ZEQ A;  3PS6 A;  3PVL A;  4W9E A;  2O2V A;  1WM2 A;  3L16 A;  4KVG B;  1KLV A;  4NY0 A;  3RUL A;  3U8Z A;  3A4R A;  4XC2 A;  4KZ0 A;  4BKG A;  2KJR A;  1WR6 E;  3PPA A;  2KDE B;  1WZ3 A;  2XK5 A;  3ENE A;  2ZCC A;  5IAA C;  1UBI A;  3R7R A;  1UD7 A;  1WF9 A;  5CHV C;  4YL8 A;  2WYQ A;  2MW5 A;  1E8Z A;  1WE7 A;  4WJQ A;  2LVO A;  5D7G A;  3H7P A;  2NR2 A;  4K7W A;  1TTN A;  3QCA A;  2EMT A;  2HJ8 A;  3WAP A;  2K39 A;  3DBH I;  3W1Y A;  3UIO B;  2FCN A;  4ZRK A;  3VTW A;  2JUO A;  2JZZ A;  2BWF A;  3DOW A;  3HM3 A;  2NBV B;  2XEW A;  1E8X A;  1FXT B;  2JXX A;  3NS8 A;  1ZW7 A;  4FLH A;  4CYE A;  3NY5 A;  1AAR A;  5D2M B;  3QA8 A;  3CMM B;  1RLF A;  5J2R A;  1WGR A;  1WMH A;  4KSK C;  2KNB A;  4ANX A;  4K7U A;  4DHJ B;  2AL6 A;  3A9K A;  2IY1 B;  4BKT A;  2ZPY A;  4HXD A;  2CU1 A;  1IP9 A;  3X0W A;  4TV3 A;  4BKS D;  1TZ1 A;  2KDI A;  2AWT A;  1Y8R C;  1GUA B;  2LWP A;  2XK5 B;  3AI5 A;  4K81 A;  4CHK A;  2KMC A;  3QJZ A;  2M0X A;  2FUH B;  1J19 A;  3Q3J A;  1WYW B;  1WXM A;  5FR6 A;  2G4S A;  1Z2M A;  3ZVV A;  2C5L C;  2KHW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...