4GU2A

Crystal structure of ubiquitin from entamoeba histolytica to 1.35 angstrom
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
72
structure length
68
Chain Sequence
MQIFVKKTITLEVEPNDSIDAIKAKIQEKEGIPPDQQRLIFAGKQLEEGKTLSDYNIQKESTLHLVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ubiquitin
publication title Structural Determinants of Ubiquitin Conjugation in Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 21
structure length 68
sequence length 72
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gu2A00
5D2MB 1GC7A 1WXSA 3PHXB 3RT3B 3N3KB 4A3PA 3R7RA 2KC2A 2KDFB 4ZRJA 4DHJB 2C5LC 4EZJA 1Y8RC 4HCPB 3LDZE 4DDID 3U7DA 1J19A 2O6VA 3A9JB 1WRDB 5CHVC 4ANUA 2VRRB 2JRHA 2ZNVB 4BKTA 2MRPA 2HTHA 5AZGA 2IY1B 4CO7A 2OOBB 4IM2A 1P3QU 1Q0WB 2KJ6A 2FIDA 3RZFA 4IWPA 1V9JA 1TTNA 3KYCD 3RUIB 4MDKE 3V61A 3PRZA 2LZ6A 4B9KA 4MM3A 2PEAA 2C9WB 4GSWA 4X57B 1OEYJ 2O6VB 4MGKE 2MBOA 3DOWA 5CHWA 2KKCA 5KHOA 4FJZA 4ZRKA 3W1YA 3ZUNA 5JHBA 2ZPYA 2K8CA 2MW5A 3DQVA 4TUUA 3M63B 2MA9B 1UD7A 1WR1A 3QQ8B 4FLHA 3L54A 4W9LA 4DDGD 3HK0A 1H4RA 1WF9A 3WALA 5JHAA 1WIAA 4CYEA 4IM0A 4M8MA 4DHJD 4GDLA 4NJ6A 1IP9A 1EO6A 2CKHB 2LRWA 2FCNA 3QX1A 1V81A 2HD5B 1KJTA 4W9KA 4WJNA 2JY6A 2LVQA 2ZCCA 3HHMA 3L17A 4KZ0A 1K8RB 2LVOA 2NCNA 3APFA 2NPTA 3ALBA 1WX7A 3L16A 4BFRA 3KVFB 1VD2A 3H9DA 2UYZB 1RLFA 4GDLB 4KSKC 2ZEQA 1EF1A 2K39A 2K6QA 4DHZE 2O6VD 1C3TA 4FADA 5DPWA 4BVUC 4MSMB 5JZEB 2ZZPB 2R2OA 2JPHA 1WZ0A 2ZVOA 4W9DA 4TV3A 2DX5B 1WXVA 3UQBA 2PPHA 1VCBA 3A4RA 4IG7B 1MG8A 5E6OA 3ZIMA 2Z59B 2NPTB 1WJNA 1YIWA 4M8NA 1I35A 3PLUA 2ASQA 2I1JA 3VAWA 2K25A 1OGWA 4E71A 1GUAB 3VXWA 3WIMA 4W9CA 4LDTD 4F8CB 4MGIE 2KFKA 2J0MA 4WWNA 3SD5A 2DZJA 5L83A 2LWPA 1EF5A 1WGRA 3ZNGC 3X23A 3MJWA 3ZDMC 2MQJA 2JT4B 2KDEB 3EHVA 1YX5B 1WX9A 3VTUA 1LFDA 3ZRCA 1WFYA 2BYEA 1RRBA 1NBFC 1V86A 3CSTA 3KUDB 3U30A 1Z2MA 1WY8A 3V6EB 2V4LA 4FULA 2RR9A 3QCAA 3OLMD 2WWZA 2FCMA 4MGYE 2KFKB 1UGMA 3IG3A 5J18A 2CHWA 2WX0A 2ZJDA 3VTVA 5J17A 3VH3B 1E7VA 2G4SA 2LGDA 3DBHI 2M17A 4FN2A 4WWOA 1E7UA 1IPGA 4IWQA 4WAAA 4EUTA 2FAZA 1R4MI 4EFOA 3R7QA 2ZNVC 3N32A 5CTRC 2LUEA 1GNUA 1WX8A 2JUOA 2G4DB 4HXDA 1LQBA 3RCZA 3RULA 3DBRI 2DAFA 3JSVA 3NZSA 3PRMB 3QA8A 3IBEA 3PZDA 4HJKA 4I6LB 1LM8B 4DK5A 4ANWA 1P0RA 1WI0A 1RFAA 2N9XA 2REXA 4YL8A 3QJZA 1SGHA 2DYMA 4NPNA 3ZDTA 3VUXA 4BKGA 2ZVNA 2N4FA 4BBNC 1WE6A 3GZNI 3L13A 3ZNID 5J2RA 1V6EA 4N9F4 3L0WB 3JSVB 2J7QB 2MWSB 2KNBA 1CMXB 4GGQA 4NAWA 2LXCA 2C7MB 2M1MA 4HDOA 4LJPB 4NNJB 4PYZA 1L2NA 2IO3B 4K7WA 4FA6A 4BBNF 1E8ZA 2MBHA 1WGGA 2MX2A 2KXJA 1WJ4A 4W9JA 2M0XA 4IWOA 4AP4C 1F9JA 2KX0A 3OJ4B 1WR6E 4NQKE 4K7UA 4AJYB 2KZRA 3JVZX 4WQOB 3QAQA 4NAWB 1GJZA 1V2YA 2LD9A 4A20A 2N9PC 4CHKA 3V62A 2B3AA 1KM7A 2WDTB 4AWJA 2Y5BB 4ZRIA 4FJYA 5LXIB 2MP2A 4NY0A 1YJ1A 2LJ5A 5G2NA 3ENEA 3QIJA 3NZUA 5AEKB 3HIZA 3OAWA 3PHWB 4G50A 4P7IA 2PE9A 1P1AA 4K81A 2NVUI 4G3XB 4MGZE 2GBKA 2W9NA 3V60A 4EKUA 3A1QA 5E6NA 3I3TB 1V80A 4HDQA 4II2B 5AZFA 2GBJA 4J6IA 4MEMA 3KH0A 1UBQA 4ANXA 2MP2B 1J0GA 3R3MA 3ECIA 1KOTA 2AL3A 4GN1A 3BINA 3BY4B 5CX3A 1WGHA 4I6NB 1LXDA 4ZYNA 1R4NI 3L10B 3PRPB 3KW5B 2CHXA 4JQWC 2IO1B 2EKEC 1GC6A 3A1QB 2KD0A 1WJ6A 3JW0X 4II3B 4IUMB 3SHQA 5KHQA 1WJUA 2WYQA 4HLEA 2WX1A 2BKFA 2KOXA 4GU2A 5AZHA 3TBLD 1WM2A 1P98A 3PT2B 2L00B 1SE9A 3PLVA 2J0JA 3X0WA 5IA7A 4WJPA 2M8SA 3H7SA 3B0AA 2HE7A 4ICUA 2XEWA 3DVGY 1YQBA 3P2BA 1WM3A 4DHZB 2FCSA 3PV1A 3C0RB 3VHTC 3ZNHB 2UWQA 1H8CA 2JRIB 1T0YA 3M3JA 3O65B 3DBLI 1PQSA 4W9IA 2IY0B 2ZCBA 4JLCA 5EDSA 1E5WA 2MBEA 1NI2A 1C1YB 2NBUA 4JGHB 5D94A 4B95A 1HE8A 1FXTB 2DYOA 2MCNB 1A5RA 2K8BA 4JL9A 2AEHA 5HKHA 4HPMB 2KO3A 1I42A 1X1MA 2RSUA 2L0FA 1UH6A 2KHWB 4IM3A 3L08A 5D6JB 2V3SA 3IFWB 2C60A 4WJOA 2D3GA 2KWUB 2LGXA 2KFJA 4AJWA 3R66C 4TQ1A 2DZKA 2FIFA 1L7YA 3W1SC 4ZDVA 2L0TA 4MELA 4PYUA 3NOBA 2DHZA 1P9DU 1E90A 2DZIA 3ZRFA 4HVBA 1XQQA 4W9GA 3PPAA 5IAAC 3TCAA 2CU1A 3M95A 2O2VA 1XD3B 4K1RB 4KV2A 5DCNA 4AOFA 1V49A 2LGYA 1V5TA 2IYDB 1G6JA 2DENB 3DDCB 3OJ3A 1WMHA 2FUHB 3EC8A 3ZKJC 1OEYA 2L76A 5D7GA 5DPRA 2K1FA 2D11A 4DXAB 2BWES 1WXMA 2LXAA 1ISNA 4DBGA 1NDDA 2GBMA 2HJ8A 2O2VB 1RAXA 2N9EB 3W1SA 3B08A 2KMCA 3RYTA 2DZMA 2YLMA 3AU4A 4PS3A 2XK5A 5G55A 1UELA 2KJHB 1Z5SB 3UINB 1WZ3A 4FBJB 1OTRB 5LLIA 1YX6B 4FJVB 4M0WB 4XZ4A 3NHEB 4BOSC 1WMHB 1ZW7A 3IVFA 3H7PA 3IHPC 2OJRA 3ML8A 3QK0A 4OVVA 4AUQC 2LASA 4DWFA 2N7EA 2KWVB 3JYUA 2D07B 4OVUA 4GB9A 3EFUA 2NBWB 5TR5A 3VDZA 1J8CA 2V1YA 4B6WA 1YD8U 2K6DB 2DYBA 3UIOB 2L3ZA 3AULA 2XK5B 5CHFA 4ASWC 3D32A 2IO2B 4GDKA 4BKSA 4FHJA 2C7HA 1ZGUB 3APCA 3ZVVA 3QWZB 3MTNB 4W9EA 2RD0A 2NS5A 2YVCA 3Q3JA 1WGYA 4KDIC 3H7PB 4XX5A 4EZKA 3A33B 2CHZA 3MHSD 2DAJA 3PSEB 4GMVA 3QHTA 4NQLB 4KSLC 3DVNV 1JRUA 2KWCA 4KDLB 4NJ7A 1BT0A 3RD2A 4GDKB 3EECA 3VH4B 2L7RA 1S3SG 3TJPA 2GMIC 2MBBB 5FR6A 3RZWC 2G45B 2C7NB 3VFKA 3CMMB 3VVWB 3DCGA 4PS8A 4I6PA 3PVLA 2KANA 1TBEA 1QZEA 4KVGB 2BKRB 3B1LX 4F7ZA 3CSFA 4WJQA 4W9HA 4RM9A 2MBQA 2NBVB 1Q5WB 1UBIA 2RGFA 3ZTCA 2KLCA 2FCQA 3M62B 5L95C 3AU5A 3APDA 2J0KA 3KUCB 4GIVA 2KLGA 3ZLZA 4A3OA 2K8HA 1WXAA 2KDBA 1S1QB 4GXBA 3A4SC 3KYDD 4LDTB 1AARA 1SIFA 2D10A 3DVGX 4BKSD 2I1KA 4MH0E 3NS8A 1Q1OA 3PREA 5JH5C 4HK2A 2MLBA 3ML9A 2IBIB 3TMPB 3ZNZB 3ZTDA 3GOEA 3KUZA 4E74A 1OQYA 2BWFA 2KJRA 4LCDE 1ZKHA 1EUVB 3UIPB 4G11A 2JWZA 3T9LA 2EMTA 2IZVB 2Z0EB 4K7SA 2KQSA 4GOCA 3A9KA 1GG3A 4IW0A 2JZ3B 1IYFA 2BPSA 2QHOA 3VUWA 2GOWA 2N7DA 5C1ZA 4ANVA 2NR2A 2G3QB 1KLVA 2LVPA 3DPDA 4JIOU 2L05A 2MSED 5E6PA 2GBNA 3N30A 3DBSA 4LJOB 2BYFA 2CS4A 1E8WA 1TZ1A 3AI5A 3CF6E 3SDLC 5GMVA 2N1WA 1E8YA 2Z0DB 5LXHA 3UQAA 2AWTA 3A9KB 2A5UA 3SU8X 4F1SA 2RPQA 4KIKA 3ZW3A 2KTRA 3NY5A 3WAMA 2FNJB 3K9PB 3DVNU 3TIXA 2AYOB 2IO0B 3UF8A 4XC2A 3WAOA 3Q3FA 2N1VA 4MSQB 2A4ZA 4W9FA 4BOZB 5C23A 2KVRA 1M94A 3AXCA 2AL6A 4URKA 2LI5A 2BGFA 4RMAA 4EOYA 2GBRA 3PS6A 3QARA 4TKNA 2KN5A 3PTFC 4G0NB 4KIKB 4RM8A 2KTRB 4ICVA 3V6CB 2PE6B 2XBBC 1D3ZA 2PJHA 4HWIB 2R2QA 2M4NA 4WWPA 3UGBB 1WYWB 2KX3A 5BO4B 3WAPA 1WGDA 2L8JA 2LRUA 3PGEA 3T8MA 4MJSA 2KDIA 3S2AA 1TGZB 2EMSA 2JZZA 3HM3A 2ZPNA 4EEWA 2KQ7A 3K9OB 3ONSA 2KK8A 1U4AA 2JF5A 3LJ3A 5DPTA 3U8ZA 2CR5A 2JVCA 1UZXB 2BF8B 2JXXA 3VTWA 3WANA 2BYVE 4HPLB 3QC8B 3HM6X 4MJSB 3H1UA 2D2QA 3ZO5B 4PS7A 2KTFA 4FHKA 1WH3A 1XT9B 3VUYA 4TQ0A 3WA0A 2KMAA 4IC7B 4E3CA 1V5OA 3A9JA 4KZCA 1E8XA 3H6NA 5DPSA 3VQIA 2KC1A 3TL5A 1WE7A 4EZLA 4HCNB
chains in the Genus database with same CATH superfamily
3AECB 5D2MB 4C80A 1B1ZA 4P16A 2JRHA 2MRPA 4FXCA 4BZAA 1XLNA 2KJ6A 2FIDA 3N1ZC 3KYCD 2KT7A 1D5ZC 4MM3A 5C3JB 3I57A 2MBOA 3W1YA 4ZRKA 5JHBA 2ZPYA 4TUUA 2D3BA 1UD7A 3QQ8B 4DDGD 3HK0A 2WXLA 1H4RA 1WF9A 1STEA 4KX6B 4IM0A 4J3OD 4NJ6A 4MM3B 5G5HA 1IP9A 1KRHA 2CKHB 3HVDA 3P63A 1V81A 2IPKD 3RN9C 2BTEA 4WJNA 1A70A 1T3QA 2NPTA 1AWDA 4BFRA 1VD2A 3H9DA 2UYZB 1YN5A 2K6QA 5FK9C 1DOIA 1C3TA 5DPWA 4MSMB 2ZZPB 1WZ0A 3EGRA 2DX5B 1VCBA 1MG8A 2Z59B 2NPTB 1WJNA 1I35A 4M8NA 2L32A 2I1JA 3VAWA 1GUAB 2W54A 2B76B 4LDTD 3Q3NC 2KFKA 4WWNA 2LWPA 3ZNGC 3ZDMC 2KDEB 2SEBD 1YX5B 1WX9A 3N1XC 1RRBA 5EE0A 3U30A 1Z2MA 2QMTA 3V6EB 4BAXA 2RMMA 2FCMA 3IAS1 2KFKB 1UGMA 1T6BX 3VH3B 4FN2A 4WAAA 4YTMB 1FXIA 5EE3A 1R4MB 4NAMA 1WX8A 3PO0A 2BT6A 1F2RI 4GLSC 4K3BA 1LQBA 4RF0A 3RCZA 2DAFA 3JSVA 4WH4A 2BW2A 2AX5A 1LM8B 1WI0A 2LUMA 3QJZA 2DYMA 1HEZE 2WXJA 4NPNA 3W5UB 3ZDTA 3W2DA 2ZVNA 4BBNC 1XO3A 3JSVB 2N9LA 5IKCM 3RI7C 3U4EG 4LJPB 4ZYSA 1C4CA 3Q8EA 2EELA 1AYFA 3CWIA 1YNTE 2KXJA 4OZCA 4LNNA 4KGSA 2OEDA 3BYYB 1YMHE 1UWXA 4AJYB 2KZRA 2Q5WD 3QAQA 1V2YA 4A20A 1I4GA 1QQRA 4CHKA 2WDTB 1KM7A 4FJYA 1HZ6A 5LXIB 2WXQA 3ENEA 3W9CB 3PHWB 2PE9A 1MHXA 3VR9B 3TSSA 2QSDA 1MFWA 1P7FA 2GBKA 2CJNA 1DYQA 4TSSA 5AZFA 2GBJA 1UBQA 1J0GA 3ECIA 1BMLC 1KOTA 5CX3A 4O1NA 3GS2A 3DHIC 2CHXA 3CIRB 1R4NB 3SHQA 2KDMA 2BKFA 4GU2A 2KN4A 1SE9A 2D5GA 1FNVA 2WXNA 2L1AA 1F2RC 3FILA 3H7SA 1YQBA 3P2BA 4DHZB 3PV1A 3B2GA 1H8CA 5G5GA 2EKIA 1TKGA 3NS1A 1N61A 2ON8A 3Q8AA 1C1YB 2MCNB 1FMAD 2HJ1A 4HPMB 3FILB 2L0FA 2WU5B 2KHWB 4ARCA 4JPSA 3IFWB 2C60A 2KAJA 1NYRA 2BS2B 3R66C 2FBWB 2FIFA 2L0TA 5HFYA 3T3NA 3AE9B 4PYUA 2JQRB 2XNAC 2DHZA 1PGBA 4W9GA 4OZBA 3M95A 3KQ4A 1V49A 2LGYA 2DENB 3OJ3A 4XWWA 2FUHB 1I4HA 5D7GA 4DXAB 1SEBD 2BWES 1JALA 1ISNA 4DBGA 2GBMA 3RYTA 4LNKA 1JQ4A 1T0QC 1UELA 2KJHB 5BYSA 2PW9A 3TEYA 1YX6B 1WXQA 2QIEB 3IHPC 2OJRA 1QLBB 4OVVA 2LASA 4DWFA 2N7EA 2SAKA 1J8CA 2D07B 5TR5A 4B6WA 4REZA 3AULA 4WIPA 4M00A 2IO2B 1QF6A 4W9EA 1KH0A 2NS5A 4XX5A 1JROA 4P1BC 1MPEA 3MJ5A 3N20C 1NVID 2HTME 1PUTA 1N62A 1BT0A 3J9CA 4OZAA 1HTOA 1KF6B 2C7NB 3CMMB 3H8HA 1TS2A 3VVWB 2IDYA 4I6PA 1VZ6A 3RFZB 3B1LX 3E9SA 3DWGC 4F7ZA 4RM9A 2NBVB 4MACA 1UBIA 2KLCA 5L95C 2J0KA 3FKYA 2LMCA 3A4SC 1SIFA 3HVZA 1TZOA 1TT5B 4HK2A 1JWAD 3TMPB 3ZNZB 3AEFB 3GOEA 2MJ3A 4E74A 1OQYA 2PVGC 3AE5B 2IZVB 4GOCA 1GG3A 1RWSA 3R8BA 2BPSA 1SE3A 2N7DA 2WS3B 1TZ1A 3SDLC 5GMVA 1E8YA 4KIKA 3Q3MC 5FKAC 3NG0A 3K9PB 4KKIA 1UUPA 2AYOB 2IO0B 4MSQB 2A4ZA 1M94A 2WXHA 2ZW1A 3RNBC 2BGFA 3PS6A 3QARA 4KIKB 2PE6B 4HWIB 1SXTA 1SB3C 1N5WA 4AS1A 5BO4B 3WAPA 4IDIA 2L8JA 3PGEA 4WWMA 2KDIA 4ITKA 4LK0M 1TGZB 3S2AA 3HM3A 2KYWA 2KQ7A 2LFIA 1U4AA 2JF5A 3NVYA 2JXXA 4EE2A 4XWTA 3HM6X 3UI3A 4FHKA 1XT9B 2PIAA 2KMAA 4IC7B 4E3CA 2Y5PA 4LNFA 1E8XA 3KLSX 3PZ7A 4MT5A 3H6NA 4A55A 1L4DB 1TY2A 3RT3B 2BB5A 3N3KB 1SE4A 2X8XX 3NRZA 2KDFB 4HCPB 1J19A 2O6VA 1WRDB 5CHVC 2VRRB 2HTHA 1MI0A 3EFCA 5AZGA 2IY1B 2OOBB 3RZFA 3Q69A 1V9JA 1TTNA 5EE9A 1Q10A 3RUIB 3P4SB 3HUIA 1FNUA 2PEAA 3MC9A 1OEYJ 1R7SA 2O6VB 4MGKE 5CHWA 5KHOA 4B0EA 4FJZA 2MW5A 1D5XC 1V8CA 3DQVA 2MA9B 4FLHA 3RNAC 3L54A 1J7BA 1FD6A 3WALA 4RNAA 1JWUD 4GDLA 1EO6A 3QX1A 2FUG1 2HD5B 1IUEA 1KJTA 3ETRA 1F1HA 2JY6A 4KZ0A 2LVOA 1V1OA 3APFA 4LLGM 3L16A 1EWYC 2OHFA 3KVFB 1TYGB 4GDLB 4KSKC 1FIQA 2K39A 2LHDA 2O6VD 4BVUC 2WHIA 2R2OA 2ZVOA 4TV3A 3RNGC 3A4RA 4IG7B 2IJ0A 5BMGA 3PLUA 2K25A 1OGWA 5HHDG 4MGIE 5L83A 2J0MA 2DZJA 1EF5A 1ZOYB 2INCC 1DOYA 2ZW0A 2W55A 1LFDA 1D5MC 4FULA 2RR9A 3QCAA 3C19A 4MGYE 2ZJDA 1KTKA 4DXGA 2LGDA 4WWOA 1E0ZA 4EUTA 4EFOA 3DBHB 2ZNVC 2LUEA 5I4DA 2JUOA 4WQMA 3DBRI 1FPYA 3NZSA 2QDFA 3PRMB 1JWBD 2V3NA 4HJKA 1E9MA 2N9XA 4IKGA 1C76A 4ARIA 1WRIA 3AE7B 3V05A 4BKGA 5BYQA 1WE6A 3L13A 5J2RA 1WYGA 1HTQA 1V6EA 4N9F4 3L0WB 2W3RA 2MWSB 1N63A 2KNBA 1K52A 2LXCA 2C7MB 1YJJA 1HXYD 2IO3B 4K7WA 3BZDB 1E8ZA 2M0XA 4IWOA 2J52A 4XDDA 4K7UA 3HRDD 1VDVA 4K3CA 1GJZA 1PYWD 4ZRIA 3BIID 1F77A 2LEKA 2K9XA 2WNMA 3FC4A 1YJ1A 3P1MA 4KGTA 3OAWA 4JWUC 4P7IA 4YSYB 4ZRQA 2PLPA 1CZPA 1E7PB 3V60A 1V80A 2K5PA 4C56C 4US9A 4MEMA 4GN1A 1RFKA 1SBBB 4US8A 1XCQL 2WDRB 4JQWC 1GC6A 4II3B 1YQ4B 4M02A 4HJGE 2KOXA 4ZHOA 1I7HA 1WM2A 3WCQA 1OFFA 2JSVX 2WDQB 2LGIA 4WJPA 3B0AA 4ICUA 3DVGY 3ZNHB 2JRIB 1T0YA 5EDSA 1GAQB 2IY0B 2RDHA 3DBLB 1A5RA 2K8BA 2AEHA 2BS3B 1I42A 2RSUA 1UH6A 3AE3B 3W5VB 5D6JB 1FFUA 2KFJA 1EWCA 3LB8C 4R3DA 3BVMA 1SIJA 2DZIA 3Q8FA 1XQQA 3TCAA 2CU1A 5DCNA 4KV2A 2PTLA 3GE3C 2IYDB 1NEKB 2BQQA 1TS3A 2ACZB 3DDCB 1MHHE 3EC8A 1QILA 2L76A 5DPRA 2MHJA 1FRDA 1NDDA 2HJ8A 2N9EB 1ZDVA 2MJDA 2KMCA 3AU4A 2G9HD 1CQVA 5G55A 3SEBA 1CK1A 4FJVB 1FCCC 3IVFA 1I4QA 4AUQC 1I4RA 1YD8U 3LYYA 4BKSA 3NVWA 4UDUC 1UF0A 3APCA 3QWZB 3MTNB 2YVCA 4EZKA 2MJEA 3Q6BA 3A33B 2VZKB 3QHTA 3V3XA 4NJ7A 1NI3A 5BMHA 2HDEA 2QCZA 3EECA 2L7RA 1S3SG 2GMIC 3RZWC 2QJLA 1TJEA 1N5XA 3VFKA 3DCGA 4ZOHC 2KANA 1TBEA 3AEDB 3CSFA 2RGFA 3SR6A 3ZTCA 3M62B 2FCQA 3AU5A 3APDA 1JRPA 1MG4A 3ZLZA 4C00A 2VZKD 2K8HA 1YN4A 4D2KA 2KDBA 4RGOS 2N7JA 3KYDD 1AARA 4BKSD 1WWTA 1Q1OA 2D3AA 5JH5C 2IBIB 1M4VA 4L1BA 2JWZA 2KWDA 3AE6B 2Z0EB 2KQSA 3A9KA 4IW0A 2V0GA 2JZ3B 3VUWA 2CU3A 5C1ZA 2NR2A 2WU2B 1KLVA 1PDXA 1QOBA 2BYFA 4LJOB 3AI5A 1T0SC 3Q14C 1EM7A 2N1WA 2Z0DB 2AWTA 3A9KB 4WURA 2A5UA 2JXTA 2MEKA 3EUB2 3ZW3A 3NY5A 5EE1A 3UF8A 3Q3FA 2N1VA 4RFBA 2GLSA 1MVKA 4P6VF 3IXSA 4ZHPA 4URKA 4YXDB 2LI5A 2WLBA 4EOYA 1Y56A 4TKNA 1K50A 1D3ZA 2PJHA 2R2QA 2QC8A 2M4NA 1WYWB 2KX3A 2VH2A 4MJSA 2EMSA 1WSPA 3IT4B 4EEWA 3K9OB 3ZYYX 5HG2A 1AW7A 2CR5A 2JVCA 4A9AA 2M0AA 2BF8B 3VTWA 3WANA 2BYTA 4MJSB 1UNSA 4TQ0A 3WA0A 4KGRA 2OJWA 1SJHD 5IOIA 3VQIA 1WE7A 2JU6X 1GC7A 3AE2B 3R7RA 2KC2A 4DHJB 1VLBA 1Y8RC 3LDZE 4KKJA 4DDID 1GPXA 4ANUA 4BKTA 5LNK1 3O13A 1E6EB 4HROA 1P3QU 1Q0WB 4IWPA 1IGCA 4MDKE 3PRZA 2LZ6A 4B9KA 3NVVA 2BVCA 4GSWA 3DOWA 2KKCA 2IGHA 2K8CA 3M63B 5H8YE 3AB5A 1HQRD 1ZDXA 5JHAA 1FRRA 4M8MA 4DHJD 2LRWA 2FCNA 1RM6C 4W9KA 3P4RB 4RGTA 2LVQA 2ZCCA 3ABVB 1V97A 3HHMA 3L17A 2NCNA 3PZ8A 1WX7A 1TKEA 2J53A 2ZEQA 1EF1A 1YOVB 1L5PA 3Q8BA 4FADA 3TEXA 5JZEB 1NYQA 1C78A 3UQBA 1WXVA 3ZIMA 5E6OA 1YIWA 2I2YA 3VXWA 3WIMA 2VH1A 3T3OA 1WGRA 3ZJTA 4N59A 3X23A 2MQJA 2JT4B 1C4PA 1C4AA 3ZRCA 3AE8B 1WFYA 2BYEA 2KQ4X 1NBFC 1V86A 3CSTA 5AUKA 2JYTA 1ROEA 1WY8A 5AUIA 3GB1A 4JE3B 3OLMD 2WWZA 2CHWA 1KLUD 3VTVA 2BS4B 4ZRPA 1E7VA 2G4SA 4HPPA 1E7UA 4IWQA 4C7YA 3B9JA 2FAZA 1R4MI 1TIFA 3R7QA 3MHZA 3TUOA 3AEBB 5CTRC 2WXGA 1GNUA 2E6XA 3RNFC 2G4DB 1ESFA 3QA8A 3PZDA 4DK5A 4ANWA 1P0RA 2REXA 2WP9B 4YL8A 2BBCA 2N4FA 3GZNI 4AQ7A 4XYCA 5MPOA 2J7QB 2W82A 4RCOA 1CMXB 4GGQA 2M1MA 1L6VA 3SFDB 2MX2A 1WJ4A 4W9JA 2KX0A 3AE1B 1ZXHA 4NQKE 1PFDA 4NJCA 4DQOC 3AEAB 3JVZX 4WQOB 1F52A 1C77A 4Q2JA 3V62A 4AWJA 2Y5BB 1BUIC 1FM0D 2MP2A 3OG5A 4NY0A 2LJ5A 5G2NA 3QIJA 3HIZA 4G50A 2WXMA 4K81A 2NVUI 4EKUA 5E6NA 4HDQA 1QOGA 4II2B 3KH0A 1PGXA 4ANXA 2MP2B 2J4XA 2AL3A 3BINA 3BY4B 1WGHA 4JX1C 4ZYNA 1R4NI 3KW5B 2EKEC 2KD0A 3JW0X 2AQ2B 2WYQA 4HLEA 3SFEB 1P98A 1UWMA 1ENFA 4HKQA 2J0JA 3X0WA 1XF5L 5FR3A 3RPFC 2XEWA 1WM3A 4H2AA 2FCSA 3VHTC 1OQRA 4OVZA 3M3JA 4W9IA 4JLCA 3ZXVA 2MBEA 4B95A 1NI2A 1HE8A 1FXTB 2DYOA 5BYRA 1ET6A 1T0RC 2V3SA 2WQYB 2L52A 3NJTA 1YN3A 4ZDVA 1IGDA 1L7YA 4MELA 4ACFA 4YSZB 3Q3OC 3ZRFA 4HVBA 1C79A 2X38A 2O2VA 4K1RB 4A6QA 4AOFA 4USAA 2INDC 1G6JA 2V3PA 4A8XC 1WMHA 3BK2A 2D11A 3AEGB 2NTTA 1FFVA 2O2VB 3W1SA 3B08A 2XK5A 2UU7A 2E3TA 5LLIA 4FBJB 4XZ4A 4OHJA 1QT9A 1WMHB 1ZW7A 2LHEA 5IO9A 3H7PA 3ML8A 1XXGA 4MH8A 4GB9A 3EFUA 2NBWB 2V1YA 2K6DB 3UIOB 2L3ZA 2XK5B 4GDKA 5IN7A 4FHJA 2C7HA 4HKZE 1ZGUB 4DXFA 3ZVVA 3FAHA 2KMMA 1ZXIA 4KDIC 3H7PB 2FE8A 3MHSD 2DAJA 1YQ3B 2G1EA 3GE8C 3PSEB 4GMVA 1VZ7A 1GB4A 2KWCA 3AH7A 1QOFA 3RD2A 1TS5A 4GDKB 3AEEB 1TS4A 3AMZA 2MBBB 3C8YA 5FR6A 2WXRA 1L0XB 1C9FA 4PS8A 3PVLA 1JWSD 1AN8A 4KVGB 2BKRB 3RNCC 4WJQA 1Q5WB 4CQNA 4TMAB 4GIVA 2KLGA 1ZPSA 5T8IA 4A3OA 1ZP0B 3KWLA 1S1QB 4YSXB 4LDTB 3DVGX 3PREA 3BYTB 2MLBA 3ML9A 2WXKA 4YTNB 3ZTDA 4YWGG 2KJRA 1FNWA 1ZKHA 1EUVB 3UIPB 1DGJA 2EMTA 4K7SA 1JCKB 2QHOA 1YJIA 3NZ3A 2RDBC 2AQ3B 3IT6B 4JIOU 2MSED 5E6PA 4NZLB 2GBNA 5HI1A 2QILA 3P4PB 1VR9A 2CS4A 3CF6E 5BMIA 2M56B 2V4IB 2DNFA 3DWMA 3MFGA 3EA6A 2INNE 1HZ5A 2KTRA 2R61A 4HEA1 1GOZA 3P42A 3DVNU 2K3UA 4XE0A 4XC2A 3WAOA 4W9FA 4BOZB 1K51A 2KVRA 2AL6A 3AM9A 3DHHC 4G0NB 2DLBA 3PTFC 2KTRB 4ICVA 3V6CB 1ACCA 2XBBC 2Z8LA 2IGGA 1D4BA 4WWPA 1WGDA 3T8MA 2NTSA 2ZPNA 1L0VB 1FEHA 4L2YA 2PMVA 3ONSA 2KK8A 3U8ZA 3LJ3A 2WXPA 1UZXB 3VR8B 4HPLB 3QC8B 3H1UA 3ZO5B 4PS7A 1WH3A 3GP7A 3VUYA 2I38A 3A9JA 1NENB 4XDCA 2H89B 3GZNB 3TL5A 4EZLA 2WXIA 1BXTA 3VRAB 1J7CA 1WXSA 3PHXB 4C4VA 4A3PA 1L6UA 4ZRJA 2C5LC 4EZJA 4L23A 3U7DA 4RH6A 3A9JB 1T5XD 2ONQA 2ZNVB 2TSSA 1VJKA 3BWUD 4CO7A 4IM2A 4C4VB 3BVZA 2N9KA 3V61A 2C9WB 4X57B 3ZUNA 1WR1A 2WXFA 4W9LA 1VZ8A 2PKOA 1WIAA 4CYEA 2W3SA 2KVZA 3I5JC 1VRAB 1K8RB 2Y5CA 1TKYA 5D3DA 3ALBA 1V1PA 1SE2A 3RNEC 1RLFA 4DHZE 4PT5A 3MC8A 1KFYB 2JPHA 4W9DA 2PPHA 2D3CA 2INPE 2MH7A 1V1PB 2ASQA 2IGDA 4E71A 4W9CA 4F8CB 3SD5A 2H88B 5TSSA 3MJWA 3EHVA 3VTUA 1B9RA 2JX5A 3KUDB 3ZGZA 2V4LA 2GRIA 2M19A 2LGSA 3IG3A 5J18A 2GI9A 2WX0A 4LTUA 5J17A 2DWQA 1EU4A 3DBHI 2M17A 1IPGA 2L83A 1TY0A 3N32A 4B0MA 5GXGB 4HXDA 3RULA 3I9V1 2Y3AA 3IBEA 4I6LB 3DBRB 1RFAA 1N6ZA 1SGHA 3VUXA 1K53A 3ZNID 1L0YB 1PGAA 4XGAB 4NAWA 4HDOA 4NNJB 4PYZA 1L2NA 4FA6A 4BBNF 2MBHA 5D3IB 1WGGA 3N9YC 4AP4C 3MC0B 1F9JA 3OJ4B 1WR6E 4YTPB 3N1YC 4NAWB 2LD9A 2N9PC 2B3AA 4RGNA 1UGJA 3AE4B 3ZJUA 2BB6A 3NZUA 5AEKB 1XEEA 1P1AA 1LGRA 4G3XB 4MGZE 2W9NA 3A1QA 3URYA 3I3TB 1D6EC 1ZUD2 1ZE3D 3TEZA 4J6IA 3R3MA 4RF1A 2GB1A 4I6NB 1LXDA 3L10B 3PRPB 3Q2AC 1J7AA 1DOXA 2CJOA 2IO1B 3A1QB 4IUMB 1WJ6A 5KHQA 4N6EB 1WJUA 4OW0A 3U2SC 2WX1A 2WGSA 5AZHA 1FXAA 3TBLD 5H92C 2J42A 3PT2B 2L00B 4S0RA 2YEPF 1IBXA 3PLVA 3B2FA 5IA7A 2M8SA 1HA5A 1F0ZA 1EU3A 2HE7A 1WGKA 3C0RB 2UWQA 3O65B 3DBLI 1PQSA 2ZCBA 1E10A 1E5WA 4JGHB 1IBXB 2NBUA 5D94A 1SF0A 4C7ZA 4P1CC 2QEJC 4JL9A 5HKHA 2KO3A 1X1MA 1QKZA 4IM3A 3L08A 3MP9A 3RMKC 3ZQ4A 4WJOA 2D3GA 2KWUB 2LGXA 4A90A 2YEPB 4AJWA 4TQ1A 2AQ1B 2DZKA 3W1SC 4WAFA 1FCLA 3DHGC 1GB1A 3NOBA 1E90A 1P9DU 3PPAA 5IAAC 1XD3B 5C2TB 1V5TA 1I4XA 5IP4D 4IOIE 4M0WA 2JYEA 2JZPA 3ZKJC 1OEYA 2K1FA 2JWUA 1WXMA 1CJEA 2LXAA 1MJDA 4N58A 1RAXA 2DZMA 2YLMA 4PS3A 2RPVA 3AN1A 3UINB 1Z5SB 2ICIA 2WXOA 1JW9D 1WZ3A 1OTRB 4M0WB 3LXFA 3NHEB 4BOSC 1FO4A 3QK0A 1XLOA 2KWVB 3JYUA 4OVUA 2V9HA 3VDZA 2DYBA 3U7ZA 5CHFA 4ASWC 3D32A 2RD0A 3Q3JA 1WGYA 3OWEB 2CHZA 2PVOD 4HRSA 4NQLB 4KSLC 3DVNV 1JRUA 4QAYA 1RYJA 4KDLB 5E6JA 2WDVB 2NMQA 3L4PA 3Q8CA 3I63C 3P4QB 4RGMA 3VH4B 3TJPA 2G45B 1QZEA 1LO5D 4W9HA 2MBQA 1L4ZB 3KUCB 1OQQA 1XCTL 1WXAA 4GXBA 4S17A 2D10A 2I1KA 4MH0E 3NS8A 1N60A 2K22A 1SJED 3KUZA 3KWVA 2BWFA 4LCDE 4G11A 3T9LA 3BK1A 1IYFA 3U52E 2GOWA 4ANVA 2G3QB 4M01A 2LVPA 3DPDA 2L05A 2XN9C 3NUHB 3N30A 3DBSA 3R2IA 1E8WA 1KLGD 1P7EA 5LXHA 3UQAA 3VRBB 3SU8X 4F1SA 2RPQA 3E56A 3ZJVA 3WAMA 2FNJB 1ET9A 3TIXA 4PK1A 2K0PA 1XLQA 5C23A 3R2TA 3AXCA 4RMAA 5JXVA 2GBRA 1I4PA 4LNOA 2KN5A 4RM8A 2N0SB 3IAM1 3UGBB 2RDGA 2LRUA 2JZZA 2DBYA 3NVZA 1XLPA 5DPTA 3AV8A 3BVGA 2BYVE 4JWSC 4YT0B 1JMLA 2D2QA 2KACA 2KTFA 1SSNA 1JWMD 1V5OA 1QOAA 4KZCA 4LNIA 5DPSA 2LJIA 3TEWA 2KC1A 3ZXRA 4HCNB
chains in the Genus database with same CATH topology
5D2MB 1GC7A 1WXSA 3PHXB 3RT3B 3N3KB 4A3PA 3R7RA 2KC2A 2KDFB 4ZRJA 4DHJB 2C5LC 4EZJA 1Y8RC 4HCPB 3LDZE 4DDID 3U7DA 1J19A 2O6VA 3A9JB 1WRDB 5CHVC 4ANUA 2VRRB 2JRHA 2ZNVB 4BKTA 2MRPA 2HTHA 5AZGA 2IY1B 4CO7A 2OOBB 4IM2A 1P3QU 1Q0WB 2KJ6A 2FIDA 3RZFA 4IWPA 1V9JA 1TTNA 3KYCD 3RUIB 4MDKE 3V61A 3PRZA 2LZ6A 4B9KA 4MM3A 2PEAA 2C9WB 4GSWA 4X57B 1OEYJ 2O6VB 4MGKE 2MBOA 3DOWA 5CHWA 2KKCA 5KHOA 4FJZA 4ZRKA 3W1YA 3ZUNA 5JHBA 2ZPYA 2K8CA 2MW5A 3DQVA 4TUUA 3M63B 2MA9B 1UD7A 1WR1A 3QQ8B 4FLHA 3L54A 4W9LA 4DDGD 3HK0A 1H4RA 1WF9A 3WALA 5JHAA 1WIAA 4CYEA 4IM0A 4M8MA 4DHJD 4GDLA 4NJ6A 1IP9A 1EO6A 2CKHB 2LRWA 2FCNA 3QX1A 1V81A 2HD5B 1KJTA 4W9KA 4WJNA 2JY6A 2LVQA 2ZCCA 3HHMA 3L17A 4KZ0A 1K8RB 2LVOA 2NCNA 3APFA 2NPTA 3ALBA 1WX7A 3L16A 4BFRA 3KVFB 1VD2A 3H9DA 2UYZB 1RLFA 4GDLB 4KSKC 2ZEQA 1EF1A 2K39A 2K6QA 4DHZE 2O6VD 1C3TA 4FADA 5DPWA 4BVUC 4MSMB 5JZEB 2ZZPB 2R2OA 2JPHA 1WZ0A 2ZVOA 4W9DA 4TV3A 2DX5B 1WXVA 3UQBA 2PPHA 1VCBA 3A4RA 4IG7B 1MG8A 5E6OA 3ZIMA 2Z59B 2NPTB 1WJNA 1YIWA 4M8NA 1I35A 3PLUA 2ASQA 2I1JA 3VAWA 2K25A 1OGWA 4E71A 1GUAB 3VXWA 3WIMA 4W9CA 4LDTD 4F8CB 4MGIE 2KFKA 2J0MA 4WWNA 3SD5A 2DZJA 5L83A 2LWPA 1EF5A 1WGRA 3ZNGC 3X23A 3MJWA 3ZDMC 2MQJA 2JT4B 2KDEB 3EHVA 1YX5B 1WX9A 3VTUA 1LFDA 3ZRCA 1WFYA 2BYEA 1RRBA 1NBFC 1V86A 3CSTA 3KUDB 3U30A 1Z2MA 1WY8A 3V6EB 2V4LA 4FULA 2RR9A 3QCAA 3OLMD 2WWZA 2FCMA 4MGYE 2KFKB 1UGMA 3IG3A 5J18A 2CHWA 2WX0A 2ZJDA 3VTVA 5J17A 3VH3B 1E7VA 2G4SA 2LGDA 3DBHI 2M17A 4FN2A 4WWOA 1E7UA 1IPGA 4IWQA 4WAAA 4EUTA 2FAZA 1R4MI 4EFOA 3R7QA 2ZNVC 3N32A 5CTRC 2LUEA 1GNUA 1WX8A 2JUOA 2G4DB 4HXDA 1LQBA 3RCZA 3RULA 3DBRI 2DAFA 3JSVA 3NZSA 3PRMB 3QA8A 3IBEA 3PZDA 4HJKA 4I6LB 1LM8B 4DK5A 4ANWA 1P0RA 1WI0A 1RFAA 2N9XA 2REXA 4YL8A 3QJZA 1SGHA 2DYMA 4NPNA 3ZDTA 3VUXA 4BKGA 2ZVNA 2N4FA 4BBNC 1WE6A 3GZNI 3L13A 3ZNID 5J2RA 1V6EA 4N9F4 3L0WB 3JSVB 2J7QB 2MWSB 2KNBA 1CMXB 4GGQA 4NAWA 2LXCA 2C7MB 2M1MA 4HDOA 4LJPB 4NNJB 4PYZA 1L2NA 2IO3B 4K7WA 4FA6A 4BBNF 1E8ZA 2MBHA 1WGGA 2MX2A 2KXJA 1WJ4A 4W9JA 2M0XA 4IWOA 4AP4C 1F9JA 2KX0A 3OJ4B 1WR6E 4NQKE 4K7UA 4AJYB 2KZRA 3JVZX 4WQOB 3QAQA 4NAWB 1GJZA 1V2YA 2LD9A 4A20A 2N9PC 4CHKA 3V62A 2B3AA 1KM7A 2WDTB 4AWJA 2Y5BB 4ZRIA 4FJYA 5LXIB 2MP2A 4NY0A 1YJ1A 2LJ5A 5G2NA 3ENEA 3QIJA 3NZUA 5AEKB 3HIZA 3OAWA 3PHWB 4G50A 4P7IA 2PE9A 1P1AA 4K81A 2NVUI 4G3XB 4MGZE 2GBKA 2W9NA 3V60A 4EKUA 3A1QA 5E6NA 3I3TB 1V80A 4HDQA 4II2B 5AZFA 2GBJA 4J6IA 4MEMA 3KH0A 1UBQA 4ANXA 2MP2B 1J0GA 3R3MA 3ECIA 1KOTA 2AL3A 4GN1A 3BINA 3BY4B 5CX3A 1WGHA 4I6NB 1LXDA 4ZYNA 1R4NI 3L10B 3PRPB 3KW5B 2CHXA 4JQWC 2IO1B 2EKEC 1GC6A 3A1QB 2KD0A 1WJ6A 3JW0X 4II3B 4IUMB 3SHQA 5KHQA 1WJUA 2WYQA 4HLEA 2WX1A 2BKFA 2KOXA 4GU2A 5AZHA 3TBLD 1WM2A 1P98A 3PT2B 2L00B 1SE9A 3PLVA 2J0JA 3X0WA 5IA7A 4WJPA 2M8SA 3H7SA 3B0AA 2HE7A 4ICUA 2XEWA 3DVGY 1YQBA 3P2BA 1WM3A 4DHZB 2FCSA 3PV1A 3C0RB 3VHTC 3ZNHB 2UWQA 1H8CA 2JRIB 1T0YA 3M3JA 3O65B 3DBLI 1PQSA 4W9IA 2IY0B 2ZCBA 4JLCA 5EDSA 1E5WA 2MBEA 1NI2A 1C1YB 2NBUA 4JGHB 5D94A 4B95A 1HE8A 1FXTB 2DYOA 2MCNB 1A5RA 2K8BA 4JL9A 2AEHA 5HKHA 4HPMB 2KO3A 1I42A 1X1MA 2RSUA 2L0FA 1UH6A 2KHWB 4IM3A 3L08A 5D6JB 2V3SA 3IFWB 2C60A 4WJOA 2D3GA 2KWUB 2LGXA 2KFJA 4AJWA 3R66C 4TQ1A 2DZKA 2FIFA 1L7YA 3W1SC 4ZDVA 2L0TA 4MELA 4PYUA 3NOBA 2DHZA 1P9DU 1E90A 2DZIA 3ZRFA 4HVBA 1XQQA 4W9GA 3PPAA 5IAAC 3TCAA 2CU1A 3M95A 2O2VA 1XD3B 4K1RB 4KV2A 5DCNA 4AOFA 1V49A 2LGYA 1V5TA 2IYDB 1G6JA 2DENB 3DDCB 3OJ3A 1WMHA 2FUHB 3EC8A 3ZKJC 1OEYA 2L76A 5D7GA 5DPRA 2K1FA 2D11A 4DXAB 2BWES 1WXMA 2LXAA 1ISNA 4DBGA 1NDDA 2GBMA 2HJ8A 2O2VB 1RAXA 2N9EB 3W1SA 3B08A 2KMCA 3RYTA 2DZMA 2YLMA 3AU4A 4PS3A 2XK5A 5G55A 1UELA 2KJHB 1Z5SB 3UINB 1WZ3A 4FBJB 1OTRB 5LLIA 1YX6B 4FJVB 4M0WB 4XZ4A 3NHEB 4BOSC 1WMHB 1ZW7A 3IVFA 3H7PA 3IHPC 2OJRA 3ML8A 3QK0A 4OVVA 4AUQC 2LASA 4DWFA 2N7EA 2KWVB 3JYUA 2D07B 4OVUA 4GB9A 3EFUA 2NBWB 5TR5A 3VDZA 1J8CA 2V1YA 4B6WA 1YD8U 2K6DB 2DYBA 3UIOB 2L3ZA 3AULA 2XK5B 5CHFA 4ASWC 3D32A 2IO2B 4GDKA 4BKSA 4FHJA 2C7HA 1ZGUB 3APCA 3ZVVA 3QWZB 3MTNB 4W9EA 2RD0A 2NS5A 2YVCA 3Q3JA 1WGYA 4KDIC 3H7PB 4XX5A 4EZKA 3A33B 2CHZA 3MHSD 2DAJA 3PSEB 4GMVA 3QHTA 4NQLB 4KSLC 3DVNV 1JRUA 2KWCA 4KDLB 4NJ7A 1BT0A 3RD2A 4GDKB 3EECA 3VH4B 2L7RA 1S3SG 3TJPA 2GMIC 2MBBB 5FR6A 3RZWC 2G45B 2C7NB 3VFKA 3CMMB 3VVWB 3DCGA 4PS8A 4I6PA 3PVLA 2KANA 1TBEA 1QZEA 4KVGB 2BKRB 3B1LX 4F7ZA 3CSFA 4WJQA 4W9HA 4RM9A 2MBQA 2NBVB 1Q5WB 1UBIA 2RGFA 3ZTCA 2KLCA 2FCQA 3M62B 5L95C 3AU5A 3APDA 2J0KA 3KUCB 4GIVA 2KLGA 3ZLZA 4A3OA 2K8HA 1WXAA 2KDBA 1S1QB 4GXBA 3A4SC 3KYDD 4LDTB 1AARA 1SIFA 2D10A 3DVGX 4BKSD 2I1KA 4MH0E 3NS8A 1Q1OA 3PREA 5JH5C 4HK2A 2MLBA 3ML9A 2IBIB 3TMPB 3ZNZB 3ZTDA 3GOEA 3KUZA 4E74A 1OQYA 2BWFA 2KJRA 4LCDE 1ZKHA 1EUVB 3UIPB 4G11A 2JWZA 3T9LA 2EMTA 2IZVB 2Z0EB 4K7SA 2KQSA 4GOCA 3A9KA 1GG3A 4IW0A 2JZ3B 1IYFA 2BPSA 2QHOA 3VUWA 2GOWA 2N7DA 5C1ZA 4ANVA 2NR2A 2G3QB 1KLVA 2LVPA 3DPDA 4JIOU 2L05A 2MSED 5E6PA 2GBNA 3N30A 3DBSA 4LJOB 2BYFA 2CS4A 1E8WA 1TZ1A 3AI5A 3CF6E 3SDLC 5GMVA 2N1WA 1E8YA 2Z0DB 5LXHA 3UQAA 2AWTA 3A9KB 2A5UA 3SU8X 4F1SA 2RPQA 4KIKA 3ZW3A 2KTRA 3NY5A 3WAMA 2FNJB 3K9PB 3DVNU 3TIXA 2AYOB 2IO0B 3UF8A 4XC2A 3WAOA 3Q3FA 2N1VA 4MSQB 2A4ZA 4W9FA 4BOZB 5C23A 2KVRA 1M94A 3AXCA 2AL6A 4URKA 2LI5A 2BGFA 4RMAA 4EOYA 2GBRA 3PS6A 3QARA 4TKNA 2KN5A 3PTFC 4G0NB 4KIKB 4RM8A 2KTRB 4ICVA 3V6CB 2PE6B 2XBBC 1D3ZA 2PJHA 4HWIB 2R2QA 2M4NA 4WWPA 3UGBB 1WYWB 2KX3A 5BO4B 3WAPA 1WGDA 2L8JA 2LRUA 3PGEA 3T8MA 4MJSA 2KDIA 3S2AA 1TGZB 2EMSA 2JZZA 3HM3A 2ZPNA 4EEWA 2KQ7A 3K9OB 3ONSA 2KK8A 1U4AA 2JF5A 3LJ3A 5DPTA 3U8ZA 2CR5A 2JVCA 1UZXB 2BF8B 2JXXA 3VTWA 3WANA 2BYVE 4HPLB 3QC8B 3HM6X 4MJSB 3H1UA 2D2QA 3ZO5B 4PS7A 2KTFA 4FHKA 1WH3A 1XT9B 3VUYA 4TQ0A 3WA0A 2KMAA 4IC7B 4E3CA 1V5OA 3A9JA 4KZCA 1E8XA 3H6NA 5DPSA 3VQIA 2KC1A 3TL5A 1WE7A 4EZLA 4HCNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D2M B;  1GC7 A;  1WXS A;  3PHX B;  3RT3 B;  3N3K B;  4A3P A;  3R7R A;  2KC2 A;  2KDF B;  4ZRJ A;  4DHJ B;  2C5L C;  4EZJ A;  1Y8R C;  4HCP B;  3LDZ E;  4DDI D;  3U7D A;  1J19 A;  2O6V A;  3A9J B;  1WRD B;  5CHV C;  4ANU A;  2VRR B;  2JRH A;  2ZNV B;  4BKT A;  2MRP A;  2HTH A;  5AZG A;  2IY1 B;  4CO7 A;  2OOB B;  4IM2 A;  1P3Q U;  1Q0W B;  2KJ6 A;  2FID A;  3RZF A;  4IWP A;  1V9J A;  1TTN A;  3KYC D;  3RUI B;  4MDK E;  3V61 A;  3PRZ A;  2LZ6 A;  4B9K A;  4MM3 A;  2PEA A;  2C9W B;  4GSW A;  4X57 B;  1OEY J;  2O6V B;  4MGK E;  2MBO A;  3DOW A;  5CHW A;  2KKC A;  5KHO A;  4FJZ A;  4ZRK A;  3W1Y A;  3ZUN A;  5JHB A;  2ZPY A;  2K8C A;  2MW5 A;  3DQV A;  4TUU A;  3M63 B;  2MA9 B;  1UD7 A;  1WR1 A;  3QQ8 B;  4FLH A;  3L54 A;  4W9L A;  4DDG D;  3HK0 A;  1H4R A;  1WF9 A;  3WAL A;  5JHA A;  1WIA A;  4CYE A;  4IM0 A;  4M8M A;  4DHJ D;  4GDL A;  4NJ6 A;  1IP9 A;  1EO6 A;  2CKH B;  2LRW A;  2FCN A;  3QX1 A;  1V81 A;  2HD5 B;  1KJT A;  4W9K A;  4WJN A;  2JY6 A;  2LVQ A;  2ZCC A;  3HHM A;  3L17 A;  4KZ0 A;  1K8R B;  2LVO A;  2NCN A;  3APF A;  2NPT A;  3ALB A;  1WX7 A;  3L16 A;  4BFR A;  3KVF B;  1VD2 A;  3H9D A;  2UYZ B;  1RLF A;  4GDL B;  4KSK C;  2ZEQ A;  1EF1 A;  2K39 A;  2K6Q A;  4DHZ E;  2O6V D;  1C3T A;  4FAD A;  5DPW A;  4BVU C;  4MSM B;  5JZE B;  2ZZP B;  2R2O A;  2JPH A;  1WZ0 A;  2ZVO A;  4W9D A;  4TV3 A;  2DX5 B;  1WXV A;  3UQB A;  2PPH A;  1VCB A;  3A4R A;  4IG7 B;  1MG8 A;  5E6O A;  3ZIM A;  2Z59 B;  2NPT B;  1WJN A;  1YIW A;  4M8N A;  1I35 A;  3PLU A;  2ASQ A;  2I1J A;  3VAW A;  2K25 A;  1OGW A;  4E71 A;  1GUA B;  3VXW A;  3WIM A;  4W9C A;  4LDT D;  4F8C B;  4MGI E;  2KFK A;  2J0M A;  4WWN A;  3SD5 A;  2DZJ A;  5L83 A;  2LWP A;  1EF5 A;  1WGR A;  3ZNG C;  3X23 A;  3MJW A;  3ZDM C;  2MQJ A;  2JT4 B;  2KDE B;  3EHV A;  1YX5 B;  1WX9 A;  3VTU A;  1LFD A;  3ZRC A;  1WFY A;  2BYE A;  1RRB A;  1NBF C;  1V86 A;  3CST A;  3KUD B;  3U30 A;  1Z2M A;  1WY8 A;  3V6E B;  2V4L A;  4FUL A;  2RR9 A;  3QCA A;  3OLM D;  2WWZ A;  2FCM A;  4MGY E;  2KFK B;  1UGM A;  3IG3 A;  5J18 A;  2CHW A;  2WX0 A;  2ZJD A;  3VTV A;  5J17 A;  3VH3 B;  1E7V A;  2G4S A;  2LGD A;  3DBH I;  2M17 A;  4FN2 A;  4WWO A;  1E7U A;  1IPG A;  4IWQ A;  4WAA A;  4EUT A;  2FAZ A;  1R4M I;  4EFO A;  3R7Q A;  2ZNV C;  3N32 A;  5CTR C;  2LUE A;  1GNU A;  1WX8 A;  2JUO A;  2G4D B;  4HXD A;  1LQB A;  3RCZ A;  3RUL A;  3DBR I;  2DAF A;  3JSV A;  3NZS A;  3PRM B;  3QA8 A;  3IBE A;  3PZD A;  4HJK A;  4I6L B;  1LM8 B;  4DK5 A;  4ANW A;  1P0R A;  1WI0 A;  1RFA A;  2N9X A;  2REX A;  4YL8 A;  3QJZ A;  1SGH A;  2DYM A;  4NPN A;  3ZDT A;  3VUX A;  4BKG A;  2ZVN A;  2N4F A;  4BBN C;  1WE6 A;  3GZN I;  3L13 A;  3ZNI D;  5J2R A;  1V6E A;  4N9F 4;  3L0W B;  3JSV B;  2J7Q B;  2MWS B;  2KNB A;  1CMX B;  4GGQ A;  4NAW A;  2LXC A;  2C7M B;  2M1M A;  4HDO A;  4LJP B;  4NNJ B;  4PYZ A;  1L2N A;  2IO3 B;  4K7W A;  4FA6 A;  4BBN F;  1E8Z A;  2MBH A;  1WGG A;  2MX2 A;  2KXJ A;  1WJ4 A;  4W9J A;  2M0X A;  4IWO A;  4AP4 C;  1F9J A;  2KX0 A;  3OJ4 B;  1WR6 E;  4NQK E;  4K7U A;  4AJY B;  2KZR A;  3JVZ X;  4WQO B;  3QAQ A;  4NAW B;  1GJZ A;  1V2Y A;  2LD9 A;  4A20 A;  2N9P C;  4CHK A;  3V62 A;  2B3A A;  1KM7 A;  2WDT B;  4AWJ A;  2Y5B B;  4ZRI A;  4FJY A;  5LXI B;  2MP2 A;  4NY0 A;  1YJ1 A;  2LJ5 A;  5G2N A;  3ENE A;  3QIJ A;  3NZU A;  5AEK B;  3HIZ A;  3OAW A;  3PHW B;  4G50 A;  4P7I A;  2PE9 A;  1P1A A;  4K81 A;  2NVU I;  4G3X B;  4MGZ E;  2GBK A;  2W9N A;  3V60 A;  4EKU A;  3A1Q A;  5E6N A;  3I3T B;  1V80 A;  4HDQ A;  4II2 B;  5AZF A;  2GBJ A;  4J6I A;  4MEM A;  3KH0 A;  1UBQ A;  4ANX A;  2MP2 B;  1J0G A;  3R3M A;  3ECI A;  1KOT A;  2AL3 A;  4GN1 A;  3BIN A;  3BY4 B;  5CX3 A;  1WGH A;  4I6N B;  1LXD A;  4ZYN A;  1R4N I;  3L10 B;  3PRP B;  3KW5 B;  2CHX A;  4JQW C;  2IO1 B;  2EKE C;  1GC6 A;  3A1Q B;  2KD0 A;  1WJ6 A;  3JW0 X;  4II3 B;  4IUM B;  3SHQ A;  5KHQ A;  1WJU A;  2WYQ A;  4HLE A;  2WX1 A;  2BKF A;  2KOX A;  4GU2 A;  5AZH A;  3TBL D;  1WM2 A;  1P98 A;  3PT2 B;  2L00 B;  1SE9 A;  3PLV A;  2J0J A;  3X0W A;  5IA7 A;  4WJP A;  2M8S A;  3H7S A;  3B0A A;  2HE7 A;  4ICU A;  2XEW A;  3DVG Y;  1YQB A;  3P2B A;  1WM3 A;  4DHZ B;  2FCS A;  3PV1 A;  3C0R B;  3VHT C;  3ZNH B;  2UWQ A;  1H8C A;  2JRI B;  1T0Y A;  3M3J A;  3O65 B;  3DBL I;  1PQS A;  4W9I A;  2IY0 B;  2ZCB A;  4JLC A;  5EDS A;  1E5W A;  2MBE A;  1NI2 A;  1C1Y B;  2NBU A;  4JGH B;  5D94 A;  4B95 A;  1HE8 A;  1FXT B;  2DYO A;  2MCN B;  1A5R A;  2K8B A;  4JL9 A;  2AEH A;  5HKH A;  4HPM B;  2KO3 A;  1I42 A;  1X1M A;  2RSU A;  2L0F A;  1UH6 A;  2KHW B;  4IM3 A;  3L08 A;  5D6J B;  2V3S A;  3IFW B;  2C60 A;  4WJO A;  2D3G A;  2KWU B;  2LGX A;  2KFJ A;  4AJW A;  3R66 C;  4TQ1 A;  2DZK A;  2FIF A;  1L7Y A;  3W1S C;  4ZDV A;  2L0T A;  4MEL A;  4PYU A;  3NOB A;  2DHZ A;  1P9D U;  1E90 A;  2DZI A;  3ZRF A;  4HVB A;  1XQQ A;  4W9G A;  3PPA A;  5IAA C;  3TCA A;  2CU1 A;  3M95 A;  2O2V A;  1XD3 B;  4K1R B;  4KV2 A;  5DCN A;  4AOF A;  1V49 A;  2LGY A;  1V5T A;  2IYD B;  1G6J A;  2DEN B;  3DDC B;  3OJ3 A;  1WMH A;  2FUH B;  3EC8 A;  3ZKJ C;  1OEY A;  2L76 A;  5D7G A;  5DPR A;  2K1F A;  2D11 A;  4DXA B;  2BWE S;  1WXM A;  2LXA A;  1ISN A;  4DBG A;  1NDD A;  2GBM A;  2HJ8 A;  2O2V B;  1RAX A;  2N9E B;  3W1S A;  3B08 A;  2KMC A;  3RYT A;  2DZM A;  2YLM A;  3AU4 A;  4PS3 A;  2XK5 A;  5G55 A;  1UEL A;  2KJH B;  1Z5S B;  3UIN B;  1WZ3 A;  4FBJ B;  1OTR B;  5LLI A;  1YX6 B;  4FJV B;  4M0W B;  4XZ4 A;  3NHE B;  4BOS C;  1WMH B;  1ZW7 A;  3IVF A;  3H7P A;  3IHP C;  2OJR A;  3ML8 A;  3QK0 A;  4OVV A;  4AUQ C;  2LAS A;  4DWF A;  2N7E A;  2KWV B;  3JYU A;  2D07 B;  4OVU A;  4GB9 A;  3EFU A;  2NBW B;  5TR5 A;  3VDZ A;  1J8C A;  2V1Y A;  4B6W A;  1YD8 U;  2K6D B;  2DYB A;  3UIO B;  2L3Z A;  3AUL A;  2XK5 B;  5CHF A;  4ASW C;  3D32 A;  2IO2 B;  4GDK A;  4BKS A;  4FHJ A;  2C7H A;  1ZGU B;  3APC A;  3ZVV A;  3QWZ B;  3MTN B;  4W9E A;  2RD0 A;  2NS5 A;  2YVC A;  3Q3J A;  1WGY A;  4KDI C;  3H7P B;  4XX5 A;  4EZK A;  3A33 B;  2CHZ A;  3MHS D;  2DAJ A;  3PSE B;  4GMV A;  3QHT A;  4NQL B;  4KSL C;  3DVN V;  1JRU A;  2KWC A;  4KDL B;  4NJ7 A;  1BT0 A;  3RD2 A;  4GDK B;  3EEC A;  3VH4 B;  2L7R A;  1S3S G;  3TJP A;  2GMI C;  2MBB B;  5FR6 A;  3RZW C;  2G45 B;  2C7N B;  3VFK A;  3CMM B;  3VVW B;  3DCG A;  4PS8 A;  4I6P A;  3PVL A;  2KAN A;  1TBE A;  1QZE A;  4KVG B;  2BKR B;  3B1L X;  4F7Z A;  3CSF A;  4WJQ A;  4W9H A;  4RM9 A;  2MBQ A;  2NBV B;  1Q5W B;  1UBI A;  2RGF A;  3ZTC A;  2KLC A;  2FCQ A;  3M62 B;  5L95 C;  3AU5 A;  3APD A;  2J0K A;  3KUC B;  4GIV A;  2KLG A;  3ZLZ A;  4A3O A;  2K8H A;  1WXA A;  2KDB A;  1S1Q B;  4GXB A;  3A4S C;  3KYD D;  4LDT B;  1AAR A;  1SIF A;  2D10 A;  3DVG X;  4BKS D;  2I1K A;  4MH0 E;  3NS8 A;  1Q1O A;  3PRE A;  5JH5 C;  4HK2 A;  2MLB A;  3ML9 A;  2IBI B;  3TMP B;  3ZNZ B;  3ZTD A;  3GOE A;  3KUZ A;  4E74 A;  1OQY A;  2BWF A;  2KJR A;  4LCD E;  1ZKH A;  1EUV B;  3UIP B;  4G11 A;  2JWZ A;  3T9L A;  2EMT A;  2IZV B;  2Z0E B;  4K7S A;  2KQS A;  4GOC A;  3A9K A;  1GG3 A;  4IW0 A;  2JZ3 B;  1IYF A;  2BPS A;  2QHO A;  3VUW A;  2GOW A;  2N7D A;  5C1Z A;  4ANV A;  2NR2 A;  2G3Q B;  1KLV A;  2LVP A;  3DPD A;  4JIO U;  2L05 A;  2MSE D;  5E6P A;  2GBN A;  3N30 A;  3DBS A;  4LJO B;  2BYF A;  2CS4 A;  1E8W A;  1TZ1 A;  3AI5 A;  3CF6 E;  3SDL C;  5GMV A;  2N1W A;  1E8Y A;  2Z0D B;  5LXH A;  3UQA A;  2AWT A;  3A9K B;  2A5U A;  3SU8 X;  4F1S A;  2RPQ A;  4KIK A;  3ZW3 A;  2KTR A;  3NY5 A;  3WAM A;  2FNJ B;  3K9P B;  3DVN U;  3TIX A;  2AYO B;  2IO0 B;  3UF8 A;  4XC2 A;  3WAO A;  3Q3F A;  2N1V A;  4MSQ B;  2A4Z A;  4W9F A;  4BOZ B;  5C23 A;  2KVR A;  1M94 A;  3AXC A;  2AL6 A;  4URK A;  2LI5 A;  2BGF A;  4RMA A;  4EOY A;  2GBR A;  3PS6 A;  3QAR A;  4TKN A;  2KN5 A;  3PTF C;  4G0N B;  4KIK B;  4RM8 A;  2KTR B;  4ICV A;  3V6C B;  2PE6 B;  2XBB C;  1D3Z A;  2PJH A;  4HWI B;  2R2Q A;  2M4N A;  4WWP A;  3UGB B;  1WYW B;  2KX3 A;  5BO4 B;  3WAP A;  1WGD A;  2L8J A;  2LRU A;  3PGE A;  3T8M A;  4MJS A;  2KDI A;  3S2A A;  1TGZ B;  2EMS A;  2JZZ A;  3HM3 A;  2ZPN A;  4EEW A;  2KQ7 A;  3K9O B;  3ONS A;  2KK8 A;  1U4A A;  2JF5 A;  3LJ3 A;  5DPT A;  3U8Z A;  2CR5 A;  2JVC A;  1UZX B;  2BF8 B;  2JXX A;  3VTW A;  3WAN A;  2BYV E;  4HPL B;  3QC8 B;  3HM6 X;  4MJS B;  3H1U A;  2D2Q A;  3ZO5 B;  4PS7 A;  2KTF A;  4FHK A;  1WH3 A;  1XT9 B;  3VUY A;  4TQ0 A;  3WA0 A;  2KMA A;  4IC7 B;  4E3C A;  1V5O A;  3A9J A;  4KZC A;  1E8X A;  3H6N A;  5DPS A;  3VQI A;  2KC1 A;  3TL5 A;  1WE7 A;  4EZL A;  4HCN B; 
#chains in the Genus database with same CATH topology
 3AEC B;  5D2M B;  4C80 A;  1B1Z A;  4P16 A;  2JRH A;  2MRP A;  4FXC A;  4BZA A;  1XLN A;  2KJ6 A;  2FID A;  3N1Z C;  3KYC D;  2KT7 A;  1D5Z C;  4MM3 A;  5C3J B;  3I57 A;  2MBO A;  3W1Y A;  4ZRK A;  5JHB A;  2ZPY A;  4TUU A;  2D3B A;  1UD7 A;  3QQ8 B;  4DDG D;  3HK0 A;  2WXL A;  1H4R A;  1WF9 A;  1STE A;  4KX6 B;  4IM0 A;  4J3O D;  4NJ6 A;  4MM3 B;  5G5H A;  1IP9 A;  1KRH A;  2CKH B;  3HVD A;  3P63 A;  1V81 A;  2IPK D;  3RN9 C;  2BTE A;  4WJN A;  1A70 A;  1T3Q A;  2NPT A;  1AWD A;  4BFR A;  1VD2 A;  3H9D A;  2UYZ B;  1YN5 A;  2K6Q A;  5FK9 C;  1DOI A;  1C3T A;  5DPW A;  4MSM B;  2ZZP B;  1WZ0 A;  3EGR A;  2DX5 B;  1VCB A;  1MG8 A;  2Z59 B;  2NPT B;  1WJN A;  1I35 A;  4M8N A;  2L32 A;  2I1J A;  3VAW A;  1GUA B;  2W54 A;  2B76 B;  4LDT D;  3Q3N C;  2KFK A;  4WWN A;  2LWP A;  3ZNG C;  3ZDM C;  2KDE B;  2SEB D;  1YX5 B;  1WX9 A;  3N1X C;  1RRB A;  5EE0 A;  3U30 A;  1Z2M A;  2QMT A;  3V6E B;  4BAX A;  2RMM A;  2FCM A;  3IAS 1;  2KFK B;  1UGM A;  1T6B X;  3VH3 B;  4FN2 A;  4WAA A;  4YTM B;  1FXI A;  5EE3 A;  1R4M B;  4NAM A;  1WX8 A;  3PO0 A;  2BT6 A;  1F2R I;  4GLS C;  4K3B A;  1LQB A;  4RF0 A;  3RCZ A;  2DAF A;  3JSV A;  4WH4 A;  2BW2 A;  2AX5 A;  1LM8 B;  1WI0 A;  2LUM A;  3QJZ A;  2DYM A;  1HEZ E;  2WXJ A;  4NPN A;  3W5U B;  3ZDT A;  3W2D A;  2ZVN A;  4BBN C;  1XO3 A;  3JSV B;  2N9L A;  5IKC M;  3RI7 C;  3U4E G;  4LJP B;  4ZYS A;  1C4C A;  3Q8E A;  2EEL A;  1AYF A;  3CWI A;  1YNT E;  2KXJ A;  4OZC A;  4LNN A;  4KGS A;  2OED A;  3BYY B;  1YMH E;  1UWX A;  4AJY B;  2KZR A;  2Q5W D;  3QAQ A;  1V2Y A;  4A20 A;  1I4G A;  1QQR A;  4CHK A;  2WDT B;  1KM7 A;  4FJY A;  1HZ6 A;  5LXI B;  2WXQ A;  3ENE A;  3W9C B;  3PHW B;  2PE9 A;  1MHX A;  3VR9 B;  3TSS A;  2QSD A;  1MFW A;  1P7F A;  2GBK A;  2CJN A;  1DYQ A;  4TSS A;  5AZF A;  2GBJ A;  1UBQ A;  1J0G A;  3ECI A;  1BML C;  1KOT A;  5CX3 A;  4O1N A;  3GS2 A;  3DHI C;  2CHX A;  3CIR B;  1R4N B;  3SHQ A;  2KDM A;  2BKF A;  4GU2 A;  2KN4 A;  1SE9 A;  2D5G A;  1FNV A;  2WXN A;  2L1A A;  1F2R C;  3FIL A;  3H7S A;  1YQB A;  3P2B A;  4DHZ B;  3PV1 A;  3B2G A;  1H8C A;  5G5G A;  2EKI A;  1TKG A;  3NS1 A;  1N61 A;  2ON8 A;  3Q8A A;  1C1Y B;  2MCN B;  1FMA D;  2HJ1 A;  4HPM B;  3FIL B;  2L0F A;  2WU5 B;  2KHW B;  4ARC A;  4JPS A;  3IFW B;  2C60 A;  2KAJ A;  1NYR A;  2BS2 B;  3R66 C;  2FBW B;  2FIF A;  2L0T A;  5HFY A;  3T3N A;  3AE9 B;  4PYU A;  2JQR B;  2XNA C;  2DHZ A;  1PGB A;  4W9G A;  4OZB A;  3M95 A;  3KQ4 A;  1V49 A;  2LGY A;  2DEN B;  3OJ3 A;  4XWW A;  2FUH B;  1I4H A;  5D7G A;  4DXA B;  1SEB D;  2BWE S;  1JAL A;  1ISN A;  4DBG A;  2GBM A;  3RYT A;  4LNK A;  1JQ4 A;  1T0Q C;  1UEL A;  2KJH B;  5BYS A;  2PW9 A;  3TEY A;  1YX6 B;  1WXQ A;  2QIE B;  3IHP C;  2OJR A;  1QLB B;  4OVV A;  2LAS A;  4DWF A;  2N7E A;  2SAK A;  1J8C A;  2D07 B;  5TR5 A;  4B6W A;  4REZ A;  3AUL A;  4WIP A;  4M00 A;  2IO2 B;  1QF6 A;  4W9E A;  1KH0 A;  2NS5 A;  4XX5 A;  1JRO A;  4P1B C;  1MPE A;  3MJ5 A;  3N20 C;  1NVI D;  2HTM E;  1PUT A;  1N62 A;  1BT0 A;  3J9C A;  4OZA A;  1HTO A;  1KF6 B;  2C7N B;  3CMM B;  3H8H A;  1TS2 A;  3VVW B;  2IDY A;  4I6P A;  1VZ6 A;  3RFZ B;  3B1L X;  3E9S A;  3DWG C;  4F7Z A;  4RM9 A;  2NBV B;  4MAC A;  1UBI A;  2KLC A;  5L95 C;  2J0K A;  3FKY A;  2LMC A;  3A4S C;  1SIF A;  3HVZ A;  1TZO A;  1TT5 B;  4HK2 A;  1JWA D;  3TMP B;  3ZNZ B;  3AEF B;  3GOE A;  2MJ3 A;  4E74 A;  1OQY A;  2PVG C;  3AE5 B;  2IZV B;  4GOC A;  1GG3 A;  1RWS A;  3R8B A;  2BPS A;  1SE3 A;  2N7D A;  2WS3 B;  1TZ1 A;  3SDL C;  5GMV A;  1E8Y A;  4KIK A;  3Q3M C;  5FKA C;  3NG0 A;  3K9P B;  4KKI A;  1UUP A;  2AYO B;  2IO0 B;  4MSQ B;  2A4Z A;  1M94 A;  2WXH A;  2ZW1 A;  3RNB C;  2BGF A;  3PS6 A;  3QAR A;  4KIK B;  2PE6 B;  4HWI B;  1SXT A;  1SB3 C;  1N5W A;  4AS1 A;  5BO4 B;  3WAP A;  4IDI A;  2L8J A;  3PGE A;  4WWM A;  2KDI A;  4ITK A;  4LK0 M;  1TGZ B;  3S2A A;  3HM3 A;  2KYW A;  2KQ7 A;  2LFI A;  1U4A A;  2JF5 A;  3NVY A;  2JXX A;  4EE2 A;  4XWT A;  3HM6 X;  3UI3 A;  4FHK A;  1XT9 B;  2PIA A;  2KMA A;  4IC7 B;  4E3C A;  2Y5P A;  4LNF A;  1E8X A;  3KLS X;  3PZ7 A;  4MT5 A;  3H6N A;  4A55 A;  1L4D B;  1TY2 A;  3RT3 B;  2BB5 A;  3N3K B;  1SE4 A;  2X8X X;  3NRZ A;  2KDF B;  4HCP B;  1J19 A;  2O6V A;  1WRD B;  5CHV C;  2VRR B;  2HTH A;  1MI0 A;  3EFC A;  5AZG A;  2IY1 B;  2OOB B;  3RZF A;  3Q69 A;  1V9J A;  1TTN A;  5EE9 A;  1Q10 A;  3RUI B;  3P4S B;  3HUI A;  1FNU A;  2PEA A;  3MC9 A;  1OEY J;  1R7S A;  2O6V B;  4MGK E;  5CHW A;  5KHO A;  4B0E A;  4FJZ A;  2MW5 A;  1D5X C;  1V8C A;  3DQV A;  2MA9 B;  4FLH A;  3RNA C;  3L54 A;  1J7B A;  1FD6 A;  3WAL A;  4RNA A;  1JWU D;  4GDL A;  1EO6 A;  3QX1 A;  2FUG 1;  2HD5 B;  1IUE A;  1KJT A;  3ETR A;  1F1H A;  2JY6 A;  4KZ0 A;  2LVO A;  1V1O A;  3APF A;  4LLG M;  3L16 A;  1EWY C;  2OHF A;  3KVF B;  1TYG B;  4GDL B;  4KSK C;  1FIQ A;  2K39 A;  2LHD A;  2O6V D;  4BVU C;  2WHI A;  2R2O A;  2ZVO A;  4TV3 A;  3RNG C;  3A4R A;  4IG7 B;  2IJ0 A;  5BMG A;  3PLU A;  2K25 A;  1OGW A;  5HHD G;  4MGI E;  5L83 A;  2J0M A;  2DZJ A;  1EF5 A;  1ZOY B;  2INC C;  1DOY A;  2ZW0 A;  2W55 A;  1LFD A;  1D5M C;  4FUL A;  2RR9 A;  3QCA A;  3C19 A;  4MGY E;  2ZJD A;  1KTK A;  4DXG A;  2LGD A;  4WWO A;  1E0Z A;  4EUT A;  4EFO A;  3DBH B;  2ZNV C;  2LUE A;  5I4D A;  2JUO A;  4WQM A;  3DBR I;  1FPY A;  3NZS A;  2QDF A;  3PRM B;  1JWB D;  2V3N A;  4HJK A;  1E9M A;  2N9X A;  4IKG A;  1C76 A;  4ARI A;  1WRI A;  3AE7 B;  3V05 A;  4BKG A;  5BYQ A;  1WE6 A;  3L13 A;  5J2R A;  1WYG A;  1HTQ A;  1V6E A;  4N9F 4;  3L0W B;  2W3R A;  2MWS B;  1N63 A;  2KNB A;  1K52 A;  2LXC A;  2C7M B;  1YJJ A;  1HXY D;  2IO3 B;  4K7W A;  3BZD B;  1E8Z A;  2M0X A;  4IWO A;  2J52 A;  4XDD A;  4K7U A;  3HRD D;  1VDV A;  4K3C A;  1GJZ A;  1PYW D;  4ZRI A;  3BII D;  1F77 A;  2LEK A;  2K9X A;  2WNM A;  3FC4 A;  1YJ1 A;  3P1M A;  4KGT A;  3OAW A;  4JWU C;  4P7I A;  4YSY B;  4ZRQ A;  2PLP A;  1CZP A;  1E7P B;  3V60 A;  1V80 A;  2K5P A;  4C56 C;  4US9 A;  4MEM A;  4GN1 A;  1RFK A;  1SBB B;  4US8 A;  1XCQ L;  2WDR B;  4JQW C;  1GC6 A;  4II3 B;  1YQ4 B;  4M02 A;  4HJG E;  2KOX A;  4ZHO A;  1I7H A;  1WM2 A;  3WCQ A;  1OFF A;  2JSV X;  2WDQ B;  2LGI A;  4WJP A;  3B0A A;  4ICU A;  3DVG Y;  3ZNH B;  2JRI B;  1T0Y A;  5EDS A;  1GAQ B;  2IY0 B;  2RDH A;  3DBL B;  1A5R A;  2K8B A;  2AEH A;  2BS3 B;  1I42 A;  2RSU A;  1UH6 A;  3AE3 B;  3W5V B;  5D6J B;  1FFU A;  2KFJ A;  1EWC A;  3LB8 C;  4R3D A;  3BVM A;  1SIJ A;  2DZI A;  3Q8F A;  1XQQ A;  3TCA A;  2CU1 A;  5DCN A;  4KV2 A;  2PTL A;  3GE3 C;  2IYD B;  1NEK B;  2BQQ A;  1TS3 A;  2ACZ B;  3DDC B;  1MHH E;  3EC8 A;  1QIL A;  2L76 A;  5DPR A;  2MHJ A;  1FRD A;  1NDD A;  2HJ8 A;  2N9E B;  1ZDV A;  2MJD A;  2KMC A;  3AU4 A;  2G9H D;  1CQV A;  5G55 A;  3SEB A;  1CK1 A;  4FJV B;  1FCC C;  3IVF A;  1I4Q A;  4AUQ C;  1I4R A;  1YD8 U;  3LYY A;  4BKS A;  3NVW A;  4UDU C;  1UF0 A;  3APC A;  3QWZ B;  3MTN B;  2YVC A;  4EZK A;  2MJE A;  3Q6B A;  3A33 B;  2VZK B;  3QHT A;  3V3X A;  4NJ7 A;  1NI3 A;  5BMH A;  2HDE A;  2QCZ A;  3EEC A;  2L7R A;  1S3S G;  2GMI C;  3RZW C;  2QJL A;  1TJE A;  1N5X A;  3VFK A;  3DCG A;  4ZOH C;  2KAN A;  1TBE A;  3AED B;  3CSF A;  2RGF A;  3SR6 A;  3ZTC A;  3M62 B;  2FCQ A;  3AU5 A;  3APD A;  1JRP A;  1MG4 A;  3ZLZ A;  4C00 A;  2VZK D;  2K8H A;  1YN4 A;  4D2K A;  2KDB A;  4RGO S;  2N7J A;  3KYD D;  1AAR A;  4BKS D;  1WWT A;  1Q1O A;  2D3A A;  5JH5 C;  2IBI B;  1M4V A;  4L1B A;  2JWZ A;  2KWD A;  3AE6 B;  2Z0E B;  2KQS A;  3A9K A;  4IW0 A;  2V0G A;  2JZ3 B;  3VUW A;  2CU3 A;  5C1Z A;  2NR2 A;  2WU2 B;  1KLV A;  1PDX A;  1QOB A;  2BYF A;  4LJO B;  3AI5 A;  1T0S C;  3Q14 C;  1EM7 A;  2N1W A;  2Z0D B;  2AWT A;  3A9K B;  4WUR A;  2A5U A;  2JXT A;  2MEK A;  3EUB 2;  3ZW3 A;  3NY5 A;  5EE1 A;  3UF8 A;  3Q3F A;  2N1V A;  4RFB A;  2GLS A;  1MVK A;  4P6V F;  3IXS A;  4ZHP A;  4URK A;  4YXD B;  2LI5 A;  2WLB A;  4EOY A;  1Y56 A;  4TKN A;  1K50 A;  1D3Z A;  2PJH A;  2R2Q A;  2QC8 A;  2M4N A;  1WYW B;  2KX3 A;  2VH2 A;  4MJS A;  2EMS A;  1WSP A;  3IT4 B;  4EEW A;  3K9O B;  3ZYY X;  5HG2 A;  1AW7 A;  2CR5 A;  2JVC A;  4A9A A;  2M0A A;  2BF8 B;  3VTW A;  3WAN A;  2BYT A;  4MJS B;  1UNS A;  4TQ0 A;  3WA0 A;  4KGR A;  2OJW A;  1SJH D;  5IOI A;  3VQI A;  1WE7 A;  2JU6 X;  1GC7 A;  3AE2 B;  3R7R A;  2KC2 A;  4DHJ B;  1VLB A;  1Y8R C;  3LDZ E;  4KKJ A;  4DDI D;  1GPX A;  4ANU A;  4BKT A;  5LNK 1;  3O13 A;  1E6E B;  4HRO A;  1P3Q U;  1Q0W B;  4IWP A;  1IGC A;  4MDK E;  3PRZ A;  2LZ6 A;  4B9K A;  3NVV A;  2BVC A;  4GSW A;  3DOW A;  2KKC A;  2IGH A;  2K8C A;  3M63 B;  5H8Y E;  3AB5 A;  1HQR D;  1ZDX A;  5JHA A;  1FRR A;  4M8M A;  4DHJ D;  2LRW A;  2FCN A;  1RM6 C;  4W9K A;  3P4R B;  4RGT A;  2LVQ A;  2ZCC A;  3ABV B;  1V97 A;  3HHM A;  3L17 A;  2NCN A;  3PZ8 A;  1WX7 A;  1TKE A;  2J53 A;  2ZEQ A;  1EF1 A;  1YOV B;  1L5P A;  3Q8B A;  4FAD A;  3TEX A;  5JZE B;  1NYQ A;  1C78 A;  3UQB A;  1WXV A;  3ZIM A;  5E6O A;  1YIW A;  2I2Y A;  3VXW A;  3WIM A;  2VH1 A;  3T3O A;  1WGR A;  3ZJT A;  4N59 A;  3X23 A;  2MQJ A;  2JT4 B;  1C4P A;  1C4A A;  3ZRC A;  3AE8 B;  1WFY A;  2BYE A;  2KQ4 X;  1NBF C;  1V86 A;  3CST A;  5AUK A;  2JYT A;  1ROE A;  1WY8 A;  5AUI A;  3GB1 A;  4JE3 B;  3OLM D;  2WWZ A;  2CHW A;  1KLU D;  3VTV A;  2BS4 B;  4ZRP A;  1E7V A;  2G4S A;  4HPP A;  1E7U A;  4IWQ A;  4C7Y A;  3B9J A;  2FAZ A;  1R4M I;  1TIF A;  3R7Q A;  3MHZ A;  3TUO A;  3AEB B;  5CTR C;  2WXG A;  1GNU A;  2E6X A;  3RNF C;  2G4D B;  1ESF A;  3QA8 A;  3PZD A;  4DK5 A;  4ANW A;  1P0R A;  2REX A;  2WP9 B;  4YL8 A;  2BBC A;  2N4F A;  3GZN I;  4AQ7 A;  4XYC A;  5MPO A;  2J7Q B;  2W82 A;  4RCO A;  1CMX B;  4GGQ A;  2M1M A;  1L6V A;  3SFD B;  2MX2 A;  1WJ4 A;  4W9J A;  2KX0 A;  3AE1 B;  1ZXH A;  4NQK E;  1PFD A;  4NJC A;  4DQO C;  3AEA B;  3JVZ X;  4WQO B;  1F52 A;  1C77 A;  4Q2J A;  3V62 A;  4AWJ A;  2Y5B B;  1BUI C;  1FM0 D;  2MP2 A;  3OG5 A;  4NY0 A;  2LJ5 A;  5G2N A;  3QIJ A;  3HIZ A;  4G50 A;  2WXM A;  4K81 A;  2NVU I;  4EKU A;  5E6N A;  4HDQ A;  1QOG A;  4II2 B;  3KH0 A;  1PGX A;  4ANX A;  2MP2 B;  2J4X A;  2AL3 A;  3BIN A;  3BY4 B;  1WGH A;  4JX1 C;  4ZYN A;  1R4N I;  3KW5 B;  2EKE C;  2KD0 A;  3JW0 X;  2AQ2 B;  2WYQ A;  4HLE A;  3SFE B;  1P98 A;  1UWM A;  1ENF A;  4HKQ A;  2J0J A;  3X0W A;  1XF5 L;  5FR3 A;  3RPF C;  2XEW A;  1WM3 A;  4H2A A;  2FCS A;  3VHT C;  1OQR A;  4OVZ A;  3M3J A;  4W9I A;  4JLC A;  3ZXV A;  2MBE A;  4B95 A;  1NI2 A;  1HE8 A;  1FXT B;  2DYO A;  5BYR A;  1ET6 A;  1T0R C;  2V3S A;  2WQY B;  2L52 A;  3NJT A;  1YN3 A;  4ZDV A;  1IGD A;  1L7Y A;  4MEL A;  4ACF A;  4YSZ B;  3Q3O C;  3ZRF A;  4HVB A;  1C79 A;  2X38 A;  2O2V A;  4K1R B;  4A6Q A;  4AOF A;  4USA A;  2IND C;  1G6J A;  2V3P A;  4A8X C;  1WMH A;  3BK2 A;  2D11 A;  3AEG B;  2NTT A;  1FFV A;  2O2V B;  3W1S A;  3B08 A;  2XK5 A;  2UU7 A;  2E3T A;  5LLI A;  4FBJ B;  4XZ4 A;  4OHJ A;  1QT9 A;  1WMH B;  1ZW7 A;  2LHE A;  5IO9 A;  3H7P A;  3ML8 A;  1XXG A;  4MH8 A;  4GB9 A;  3EFU A;  2NBW B;  2V1Y A;  2K6D B;  3UIO B;  2L3Z A;  2XK5 B;  4GDK A;  5IN7 A;  4FHJ A;  2C7H A;  4HKZ E;  1ZGU B;  4DXF A;  3ZVV A;  3FAH A;  2KMM A;  1ZXI A;  4KDI C;  3H7P B;  2FE8 A;  3MHS D;  2DAJ A;  1YQ3 B;  2G1E A;  3GE8 C;  3PSE B;  4GMV A;  1VZ7 A;  1GB4 A;  2KWC A;  3AH7 A;  1QOF A;  3RD2 A;  1TS5 A;  4GDK B;  3AEE B;  1TS4 A;  3AMZ A;  2MBB B;  3C8Y A;  5FR6 A;  2WXR A;  1L0X B;  1C9F A;  4PS8 A;  3PVL A;  1JWS D;  1AN8 A;  4KVG B;  2BKR B;  3RNC C;  4WJQ A;  1Q5W B;  4CQN A;  4TMA B;  4GIV A;  2KLG A;  1ZPS A;  5T8I A;  4A3O A;  1ZP0 B;  3KWL A;  1S1Q B;  4YSX B;  4LDT B;  3DVG X;  3PRE A;  3BYT B;  2MLB A;  3ML9 A;  2WXK A;  4YTN B;  3ZTD A;  4YWG G;  2KJR A;  1FNW A;  1ZKH A;  1EUV B;  3UIP B;  1DGJ A;  2EMT A;  4K7S A;  1JCK B;  2QHO A;  1YJI A;  3NZ3 A;  2RDB C;  2AQ3 B;  3IT6 B;  4JIO U;  2MSE D;  5E6P A;  4NZL B;  2GBN A;  5HI1 A;  2QIL A;  3P4P B;  1VR9 A;  2CS4 A;  3CF6 E;  5BMI A;  2M56 B;  2V4I B;  2DNF A;  3DWM A;  3MFG A;  3EA6 A;  2INN E;  1HZ5 A;  2KTR A;  2R61 A;  4HEA 1;  1GOZ A;  3P42 A;  3DVN U;  2K3U A;  4XE0 A;  4XC2 A;  3WAO A;  4W9F A;  4BOZ B;  1K51 A;  2KVR A;  2AL6 A;  3AM9 A;  3DHH C;  4G0N B;  2DLB A;  3PTF C;  2KTR B;  4ICV A;  3V6C B;  1ACC A;  2XBB C;  2Z8L A;  2IGG A;  1D4B A;  4WWP A;  1WGD A;  3T8M A;  2NTS A;  2ZPN A;  1L0V B;  1FEH A;  4L2Y A;  2PMV A;  3ONS A;  2KK8 A;  3U8Z A;  3LJ3 A;  2WXP A;  1UZX B;  3VR8 B;  4HPL B;  3QC8 B;  3H1U A;  3ZO5 B;  4PS7 A;  1WH3 A;  3GP7 A;  3VUY A;  2I38 A;  3A9J A;  1NEN B;  4XDC A;  2H89 B;  3GZN B;  3TL5 A;  4EZL A;  2WXI A;  1BXT A;  3VRA B;  1J7C A;  1WXS A;  3PHX B;  4C4V A;  4A3P A;  1L6U A;  4ZRJ A;  2C5L C;  4EZJ A;  4L23 A;  3U7D A;  4RH6 A;  3A9J B;  1T5X D;  2ONQ A;  2ZNV B;  2TSS A;  1VJK A;  3BWU D;  4CO7 A;  4IM2 A;  4C4V B;  3BVZ A;  2N9K A;  3V61 A;  2C9W B;  4X57 B;  3ZUN A;  1WR1 A;  2WXF A;  4W9L A;  1VZ8 A;  2PKO A;  1WIA A;  4CYE A;  2W3S A;  2KVZ A;  3I5J C;  1VRA B;  1K8R B;  2Y5C A;  1TKY A;  5D3D A;  3ALB A;  1V1P A;  1SE2 A;  3RNE C;  1RLF A;  4DHZ E;  4PT5 A;  3MC8 A;  1KFY B;  2JPH A;  4W9D A;  2PPH A;  2D3C A;  2INP E;  2MH7 A;  1V1P B;  2ASQ A;  2IGD A;  4E71 A;  4W9C A;  4F8C B;  3SD5 A;  2H88 B;  5TSS A;  3MJW A;  3EHV A;  3VTU A;  1B9R A;  2JX5 A;  3KUD B;  3ZGZ A;  2V4L A;  2GRI A;  2M19 A;  2LGS A;  3IG3 A;  5J18 A;  2GI9 A;  2WX0 A;  4LTU A;  5J17 A;  2DWQ A;  1EU4 A;  3DBH I;  2M17 A;  1IPG A;  2L83 A;  1TY0 A;  3N32 A;  4B0M A;  5GXG B;  4HXD A;  3RUL A;  3I9V 1;  2Y3A A;  3IBE A;  4I6L B;  3DBR B;  1RFA A;  1N6Z A;  1SGH A;  3VUX A;  1K53 A;  3ZNI D;  1L0Y B;  1PGA A;  4XGA B;  4NAW A;  4HDO A;  4NNJ B;  4PYZ A;  1L2N A;  4FA6 A;  4BBN F;  2MBH A;  5D3I B;  1WGG A;  3N9Y C;  4AP4 C;  3MC0 B;  1F9J A;  3OJ4 B;  1WR6 E;  4YTP B;  3N1Y C;  4NAW B;  2LD9 A;  2N9P C;  2B3A A;  4RGN A;  1UGJ A;  3AE4 B;  3ZJU A;  2BB6 A;  3NZU A;  5AEK B;  1XEE A;  1P1A A;  1LGR A;  4G3X B;  4MGZ E;  2W9N A;  3A1Q A;  3URY A;  3I3T B;  1D6E C;  1ZUD 2;  1ZE3 D;  3TEZ A;  4J6I A;  3R3M A;  4RF1 A;  2GB1 A;  4I6N B;  1LXD A;  3L10 B;  3PRP B;  3Q2A C;  1J7A A;  1DOX A;  2CJO A;  2IO1 B;  3A1Q B;  4IUM B;  1WJ6 A;  5KHQ A;  4N6E B;  1WJU A;  4OW0 A;  3U2S C;  2WX1 A;  2WGS A;  5AZH A;  1FXA A;  3TBL D;  5H92 C;  2J42 A;  3PT2 B;  2L00 B;  4S0R A;  2YEP F;  1IBX A;  3PLV A;  3B2F A;  5IA7 A;  2M8S A;  1HA5 A;  1F0Z A;  1EU3 A;  2HE7 A;  1WGK A;  3C0R B;  2UWQ A;  3O65 B;  3DBL I;  1PQS A;  2ZCB A;  1E10 A;  1E5W A;  4JGH B;  1IBX B;  2NBU A;  5D94 A;  1SF0 A;  4C7Z A;  4P1C C;  2QEJ C;  4JL9 A;  5HKH A;  2KO3 A;  1X1M A;  1QKZ A;  4IM3 A;  3L08 A;  3MP9 A;  3RMK C;  3ZQ4 A;  4WJO A;  2D3G A;  2KWU B;  2LGX A;  4A90 A;  2YEP B;  4AJW A;  4TQ1 A;  2AQ1 B;  2DZK A;  3W1S C;  4WAF A;  1FCL A;  3DHG C;  1GB1 A;  3NOB A;  1E90 A;  1P9D U;  3PPA A;  5IAA C;  1XD3 B;  5C2T B;  1V5T A;  1I4X A;  5IP4 D;  4IOI E;  4M0W A;  2JYE A;  2JZP A;  3ZKJ C;  1OEY A;  2K1F A;  2JWU A;  1WXM A;  1CJE A;  2LXA A;  1MJD A;  4N58 A;  1RAX A;  2DZM A;  2YLM A;  4PS3 A;  2RPV A;  3AN1 A;  3UIN B;  1Z5S B;  2ICI A;  2WXO A;  1JW9 D;  1WZ3 A;  1OTR B;  4M0W B;  3LXF A;  3NHE B;  4BOS C;  1FO4 A;  3QK0 A;  1XLO A;  2KWV B;  3JYU A;  4OVU A;  2V9H A;  3VDZ A;  2DYB A;  3U7Z A;  5CHF A;  4ASW C;  3D32 A;  2RD0 A;  3Q3J A;  1WGY A;  3OWE B;  2CHZ A;  2PVO D;  4HRS A;  4NQL B;  4KSL C;  3DVN V;  1JRU A;  4QAY A;  1RYJ A;  4KDL B;  5E6J A;  2WDV B;  2NMQ A;  3L4P A;  3Q8C A;  3I63 C;  3P4Q B;  4RGM A;  3VH4 B;  3TJP A;  2G45 B;  1QZE A;  1LO5 D;  4W9H A;  2MBQ A;  1L4Z B;  3KUC B;  1OQQ A;  1XCT L;  1WXA A;  4GXB A;  4S17 A;  2D10 A;  2I1K A;  4MH0 E;  3NS8 A;  1N60 A;  2K22 A;  1SJE D;  3KUZ A;  3KWV A;  2BWF A;  4LCD E;  4G11 A;  3T9L A;  3BK1 A;  1IYF A;  3U52 E;  2GOW A;  4ANV A;  2G3Q B;  4M01 A;  2LVP A;  3DPD A;  2L05 A;  2XN9 C;  3NUH B;  3N30 A;  3DBS A;  3R2I A;  1E8W A;  1KLG D;  1P7E A;  5LXH A;  3UQA A;  3VRB B;  3SU8 X;  4F1S A;  2RPQ A;  3E56 A;  3ZJV A;  3WAM A;  2FNJ B;  1ET9 A;  3TIX A;  4PK1 A;  2K0P A;  1XLQ A;  5C23 A;  3R2T A;  3AXC A;  4RMA A;  5JXV A;  2GBR A;  1I4P A;  4LNO A;  2KN5 A;  4RM8 A;  2N0S B;  3IAM 1;  3UGB B;  2RDG A;  2LRU A;  2JZZ A;  2DBY A;  3NVZ A;  1XLP A;  5DPT A;  3AV8 A;  3BVG A;  2BYV E;  4JWS C;  4YT0 B;  1JML A;  2D2Q A;  2KAC A;  2KTF A;  1SSN A;  1JWM D;  1V5O A;  1QOA A;  4KZC A;  4LNI A;  5DPS A;  2LJI A;  3TEW A;  2KC1 A;  3ZXR A;  4HCN B; 
#chains in the Genus database with same CATH homology
 5D2M B;  1GC7 A;  1WXS A;  3PHX B;  3RT3 B;  3N3K B;  4A3P A;  3R7R A;  2KC2 A;  2KDF B;  4ZRJ A;  4DHJ B;  2C5L C;  4EZJ A;  1Y8R C;  4HCP B;  3LDZ E;  4DDI D;  3U7D A;  1J19 A;  2O6V A;  3A9J B;  1WRD B;  5CHV C;  4ANU A;  2VRR B;  2JRH A;  2ZNV B;  4BKT A;  2MRP A;  2HTH A;  5AZG A;  2IY1 B;  4CO7 A;  2OOB B;  4IM2 A;  1P3Q U;  1Q0W B;  2KJ6 A;  2FID A;  3RZF A;  4IWP A;  1V9J A;  1TTN A;  3KYC D;  3RUI B;  4MDK E;  3V61 A;  3PRZ A;  2LZ6 A;  4B9K A;  4MM3 A;  2PEA A;  2C9W B;  4GSW A;  4X57 B;  1OEY J;  2O6V B;  4MGK E;  2MBO A;  3DOW A;  5CHW A;  2KKC A;  5KHO A;  4FJZ A;  4ZRK A;  3W1Y A;  3ZUN A;  5JHB A;  2ZPY A;  2K8C A;  2MW5 A;  3DQV A;  4TUU A;  3M63 B;  2MA9 B;  1UD7 A;  1WR1 A;  3QQ8 B;  4FLH A;  3L54 A;  4W9L A;  4DDG D;  3HK0 A;  1H4R A;  1WF9 A;  3WAL A;  5JHA A;  1WIA A;  4CYE A;  4IM0 A;  4M8M A;  4DHJ D;  4GDL A;  4NJ6 A;  1IP9 A;  1EO6 A;  2CKH B;  2LRW A;  2FCN A;  3QX1 A;  1V81 A;  2HD5 B;  1KJT A;  4W9K A;  4WJN A;  2JY6 A;  2LVQ A;  2ZCC A;  3HHM A;  3L17 A;  4KZ0 A;  1K8R B;  2LVO A;  2NCN A;  3APF A;  2NPT A;  3ALB A;  1WX7 A;  3L16 A;  4BFR A;  3KVF B;  1VD2 A;  3H9D A;  2UYZ B;  1RLF A;  4GDL B;  4KSK C;  2ZEQ A;  1EF1 A;  2K39 A;  2K6Q A;  4DHZ E;  2O6V D;  1C3T A;  4FAD A;  5DPW A;  4BVU C;  4MSM B;  5JZE B;  2ZZP B;  2R2O A;  2JPH A;  1WZ0 A;  2ZVO A;  4W9D A;  4TV3 A;  2DX5 B;  1WXV A;  3UQB A;  2PPH A;  1VCB A;  3A4R A;  4IG7 B;  1MG8 A;  5E6O A;  3ZIM A;  2Z59 B;  2NPT B;  1WJN A;  1YIW A;  4M8N A;  1I35 A;  3PLU A;  2ASQ A;  2I1J A;  3VAW A;  2K25 A;  1OGW A;  4E71 A;  1GUA B;  3VXW A;  3WIM A;  4W9C A;  4LDT D;  4F8C B;  4MGI E;  2KFK A;  2J0M A;  4WWN A;  3SD5 A;  2DZJ A;  5L83 A;  2LWP A;  1EF5 A;  1WGR A;  3ZNG C;  3X23 A;  3MJW A;  3ZDM C;  2MQJ A;  2JT4 B;  2KDE B;  3EHV A;  1YX5 B;  1WX9 A;  3VTU A;  1LFD A;  3ZRC A;  1WFY A;  2BYE A;  1RRB A;  1NBF C;  1V86 A;  3CST A;  3KUD B;  3U30 A;  1Z2M A;  1WY8 A;  3V6E B;  2V4L A;  4FUL A;  2RR9 A;  3QCA A;  3OLM D;  2WWZ A;  2FCM A;  4MGY E;  2KFK B;  1UGM A;  3IG3 A;  5J18 A;  2CHW A;  2WX0 A;  2ZJD A;  3VTV A;  5J17 A;  3VH3 B;  1E7V A;  2G4S A;  2LGD A;  3DBH I;  2M17 A;  4FN2 A;  4WWO A;  1E7U A;  1IPG A;  4IWQ A;  4WAA A;  4EUT A;  2FAZ A;  1R4M I;  4EFO A;  3R7Q A;  2ZNV C;  3N32 A;  5CTR C;  2LUE A;  1GNU A;  1WX8 A;  2JUO A;  2G4D B;  4HXD A;  1LQB A;  3RCZ A;  3RUL A;  3DBR I;  2DAF A;  3JSV A;  3NZS A;  3PRM B;  3QA8 A;  3IBE A;  3PZD A;  4HJK A;  4I6L B;  1LM8 B;  4DK5 A;  4ANW A;  1P0R A;  1WI0 A;  1RFA A;  2N9X A;  2REX A;  4YL8 A;  3QJZ A;  1SGH A;  2DYM A;  4NPN A;  3ZDT A;  3VUX A;  4BKG A;  2ZVN A;  2N4F A;  4BBN C;  1WE6 A;  3GZN I;  3L13 A;  3ZNI D;  5J2R A;  1V6E A;  4N9F 4;  3L0W B;  3JSV B;  2J7Q B;  2MWS B;  2KNB A;  1CMX B;  4GGQ A;  4NAW A;  2LXC A;  2C7M B;  2M1M A;  4HDO A;  4LJP B;  4NNJ B;  4PYZ A;  1L2N A;  2IO3 B;  4K7W A;  4FA6 A;  4BBN F;  1E8Z A;  2MBH A;  1WGG A;  2MX2 A;  2KXJ A;  1WJ4 A;  4W9J A;  2M0X A;  4IWO A;  4AP4 C;  1F9J A;  2KX0 A;  3OJ4 B;  1WR6 E;  4NQK E;  4K7U A;  4AJY B;  2KZR A;  3JVZ X;  4WQO B;  3QAQ A;  4NAW B;  1GJZ A;  1V2Y A;  2LD9 A;  4A20 A;  2N9P C;  4CHK A;  3V62 A;  2B3A A;  1KM7 A;  2WDT B;  4AWJ A;  2Y5B B;  4ZRI A;  4FJY A;  5LXI B;  2MP2 A;  4NY0 A;  1YJ1 A;  2LJ5 A;  5G2N A;  3ENE A;  3QIJ A;  3NZU A;  5AEK B;  3HIZ A;  3OAW A;  3PHW B;  4G50 A;  4P7I A;  2PE9 A;  1P1A A;  4K81 A;  2NVU I;  4G3X B;  4MGZ E;  2GBK A;  2W9N A;  3V60 A;  4EKU A;  3A1Q A;  5E6N A;  3I3T B;  1V80 A;  4HDQ A;  4II2 B;  5AZF A;  2GBJ A;  4J6I A;  4MEM A;  3KH0 A;  1UBQ A;  4ANX A;  2MP2 B;  1J0G A;  3R3M A;  3ECI A;  1KOT A;  2AL3 A;  4GN1 A;  3BIN A;  3BY4 B;  5CX3 A;  1WGH A;  4I6N B;  1LXD A;  4ZYN A;  1R4N I;  3L10 B;  3PRP B;  3KW5 B;  2CHX A;  4JQW C;  2IO1 B;  2EKE C;  1GC6 A;  3A1Q B;  2KD0 A;  1WJ6 A;  3JW0 X;  4II3 B;  4IUM B;  3SHQ A;  5KHQ A;  1WJU A;  2WYQ A;  4HLE A;  2WX1 A;  2BKF A;  2KOX A;  4GU2 A;  5AZH A;  3TBL D;  1WM2 A;  1P98 A;  3PT2 B;  2L00 B;  1SE9 A;  3PLV A;  2J0J A;  3X0W A;  5IA7 A;  4WJP A;  2M8S A;  3H7S A;  3B0A A;  2HE7 A;  4ICU A;  2XEW A;  3DVG Y;  1YQB A;  3P2B A;  1WM3 A;  4DHZ B;  2FCS A;  3PV1 A;  3C0R B;  3VHT C;  3ZNH B;  2UWQ A;  1H8C A;  2JRI B;  1T0Y A;  3M3J A;  3O65 B;  3DBL I;  1PQS A;  4W9I A;  2IY0 B;  2ZCB A;  4JLC A;  5EDS A;  1E5W A;  2MBE A;  1NI2 A;  1C1Y B;  2NBU A;  4JGH B;  5D94 A;  4B95 A;  1HE8 A;  1FXT B;  2DYO A;  2MCN B;  1A5R A;  2K8B A;  4JL9 A;  2AEH A;  5HKH A;  4HPM B;  2KO3 A;  1I42 A;  1X1M A;  2RSU A;  2L0F A;  1UH6 A;  2KHW B;  4IM3 A;  3L08 A;  5D6J B;  2V3S A;  3IFW B;  2C60 A;  4WJO A;  2D3G A;  2KWU B;  2LGX A;  2KFJ A;  4AJW A;  3R66 C;  4TQ1 A;  2DZK A;  2FIF A;  1L7Y A;  3W1S C;  4ZDV A;  2L0T A;  4MEL A;  4PYU A;  3NOB A;  2DHZ A;  1P9D U;  1E90 A;  2DZI A;  3ZRF A;  4HVB A;  1XQQ A;  4W9G A;  3PPA A;  5IAA C;  3TCA A;  2CU1 A;  3M95 A;  2O2V A;  1XD3 B;  4K1R B;  4KV2 A;  5DCN A;  4AOF A;  1V49 A;  2LGY A;  1V5T A;  2IYD B;  1G6J A;  2DEN B;  3DDC B;  3OJ3 A;  1WMH A;  2FUH B;  3EC8 A;  3ZKJ C;  1OEY A;  2L76 A;  5D7G A;  5DPR A;  2K1F A;  2D11 A;  4DXA B;  2BWE S;  1WXM A;  2LXA A;  1ISN A;  4DBG A;  1NDD A;  2GBM A;  2HJ8 A;  2O2V B;  1RAX A;  2N9E B;  3W1S A;  3B08 A;  2KMC A;  3RYT A;  2DZM A;  2YLM A;  3AU4 A;  4PS3 A;  2XK5 A;  5G55 A;  1UEL A;  2KJH B;  1Z5S B;  3UIN B;  1WZ3 A;  4FBJ B;  1OTR B;  5LLI A;  1YX6 B;  4FJV B;  4M0W B;  4XZ4 A;  3NHE B;  4BOS C;  1WMH B;  1ZW7 A;  3IVF A;  3H7P A;  3IHP C;  2OJR A;  3ML8 A;  3QK0 A;  4OVV A;  4AUQ C;  2LAS A;  4DWF A;  2N7E A;  2KWV B;  3JYU A;  2D07 B;  4OVU A;  4GB9 A;  3EFU A;  2NBW B;  5TR5 A;  3VDZ A;  1J8C A;  2V1Y A;  4B6W A;  1YD8 U;  2K6D B;  2DYB A;  3UIO B;  2L3Z A;  3AUL A;  2XK5 B;  5CHF A;  4ASW C;  3D32 A;  2IO2 B;  4GDK A;  4BKS A;  4FHJ A;  2C7H A;  1ZGU B;  3APC A;  3ZVV A;  3QWZ B;  3MTN B;  4W9E A;  2RD0 A;  2NS5 A;  2YVC A;  3Q3J A;  1WGY A;  4KDI C;  3H7P B;  4XX5 A;  4EZK A;  3A33 B;  2CHZ A;  3MHS D;  2DAJ A;  3PSE B;  4GMV A;  3QHT A;  4NQL B;  4KSL C;  3DVN V;  1JRU A;  2KWC A;  4KDL B;  4NJ7 A;  1BT0 A;  3RD2 A;  4GDK B;  3EEC A;  3VH4 B;  2L7R A;  1S3S G;  3TJP A;  2GMI C;  2MBB B;  5FR6 A;  3RZW C;  2G45 B;  2C7N B;  3VFK A;  3CMM B;  3VVW B;  3DCG A;  4PS8 A;  4I6P A;  3PVL A;  2KAN A;  1TBE A;  1QZE A;  4KVG B;  2BKR B;  3B1L X;  4F7Z A;  3CSF A;  4WJQ A;  4W9H A;  4RM9 A;  2MBQ A;  2NBV B;  1Q5W B;  1UBI A;  2RGF A;  3ZTC A;  2KLC A;  2FCQ A;  3M62 B;  5L95 C;  3AU5 A;  3APD A;  2J0K A;  3KUC B;  4GIV A;  2KLG A;  3ZLZ A;  4A3O A;  2K8H A;  1WXA A;  2KDB A;  1S1Q B;  4GXB A;  3A4S C;  3KYD D;  4LDT B;  1AAR A;  1SIF A;  2D10 A;  3DVG X;  4BKS D;  2I1K A;  4MH0 E;  3NS8 A;  1Q1O A;  3PRE A;  5JH5 C;  4HK2 A;  2MLB A;  3ML9 A;  2IBI B;  3TMP B;  3ZNZ B;  3ZTD A;  3GOE A;  3KUZ A;  4E74 A;  1OQY A;  2BWF A;  2KJR A;  4LCD E;  1ZKH A;  1EUV B;  3UIP B;  4G11 A;  2JWZ A;  3T9L A;  2EMT A;  2IZV B;  2Z0E B;  4K7S A;  2KQS A;  4GOC A;  3A9K A;  1GG3 A;  4IW0 A;  2JZ3 B;  1IYF A;  2BPS A;  2QHO A;  3VUW A;  2GOW A;  2N7D A;  5C1Z A;  4ANV A;  2NR2 A;  2G3Q B;  1KLV A;  2LVP A;  3DPD A;  4JIO U;  2L05 A;  2MSE D;  5E6P A;  2GBN A;  3N30 A;  3DBS A;  4LJO B;  2BYF A;  2CS4 A;  1E8W A;  1TZ1 A;  3AI5 A;  3CF6 E;  3SDL C;  5GMV A;  2N1W A;  1E8Y A;  2Z0D B;  5LXH A;  3UQA A;  2AWT A;  3A9K B;  2A5U A;  3SU8 X;  4F1S A;  2RPQ A;  4KIK A;  3ZW3 A;  2KTR A;  3NY5 A;  3WAM A;  2FNJ B;  3K9P B;  3DVN U;  3TIX A;  2AYO B;  2IO0 B;  3UF8 A;  4XC2 A;  3WAO A;  3Q3F A;  2N1V A;  4MSQ B;  2A4Z A;  4W9F A;  4BOZ B;  5C23 A;  2KVR A;  1M94 A;  3AXC A;  2AL6 A;  4URK A;  2LI5 A;  2BGF A;  4RMA A;  4EOY A;  2GBR A;  3PS6 A;  3QAR A;  4TKN A;  2KN5 A;  3PTF C;  4G0N B;  4KIK B;  4RM8 A;  2KTR B;  4ICV A;  3V6C B;  2PE6 B;  2XBB C;  1D3Z A;  2PJH A;  4HWI B;  2R2Q A;  2M4N A;  4WWP A;  3UGB B;  1WYW B;  2KX3 A;  5BO4 B;  3WAP A;  1WGD A;  2L8J A;  2LRU A;  3PGE A;  3T8M A;  4MJS A;  2KDI A;  3S2A A;  1TGZ B;  2EMS A;  2JZZ A;  3HM3 A;  2ZPN A;  4EEW A;  2KQ7 A;  3K9O B;  3ONS A;  2KK8 A;  1U4A A;  2JF5 A;  3LJ3 A;  5DPT A;  3U8Z A;  2CR5 A;  2JVC A;  1UZX B;  2BF8 B;  2JXX A;  3VTW A;  3WAN A;  2BYV E;  4HPL B;  3QC8 B;  3HM6 X;  4MJS B;  3H1U A;  2D2Q A;  3ZO5 B;  4PS7 A;  2KTF A;  4FHK A;  1WH3 A;  1XT9 B;  3VUY A;  4TQ0 A;  3WA0 A;  2KMA A;  4IC7 B;  4E3C A;  1V5O A;  3A9J A;  4KZC A;  1E8X A;  3H6N A;  5DPS A;  3VQI A;  2KC1 A;  3TL5 A;  1WE7 A;  4EZL A;  4HCN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...