1JW9D

Structure of the native moeb-moad protein complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
b'MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
publication title Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2001-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jw9D00
2DBYA 2MJ3A 1RYJA 2WU5B 1N60A 1JWBD 1DOIA 1FFUA 3W5UB 2AX5A 2H88B 4IDIA 1PDXA 3AH7A 4ITKA 1E0ZA 1ZXIA 4YSYB 3AE9B 1R7SA 1L6VA 1WXQA 1WYGA 2KAJA 1NYQA 5AUIA 1GAQB 4YSZB 1J7CA 1JWAD 2L52A 3AE8B 4A9AA 3P4RB 1JQ4A 1PFDA 1CJEA 2ACZB 2CJOA 1VDVA 2Q5WD 3NVVA 2K9XA 5G5GA 1ROEA 5GXGB 3AEDB 2H89B 5AUKA 1QOFA 4C7YA 3NVZA 4US9A 2M56B 3P63A 2M19A 3SFDB 1JALA 1OQQA 5EE0A 1VJKA 1ZUD2 4YTPB 4YTNB 1IUEA 1L0VB 1N5WA 1TJEA 1V97A 3AEGB 1E10A 1SB3C 1XLPA 1KF6B 2PIAA 3ETRA 1FRRA 2QIEB 1VLBA 3EUB2 1EWYC 3FC4A 4KX6B 1FRDA 5MPOA 2BS4B 2W3RA 3ZYYX 1OQRA 1T3QA 3ABVB 3DWMA 3VRAB 3AE3B 1A70A 1JROA 1NVID 2WDRB 4N6EB 4FXCA 2WQYB 2HTME 3RPFC 3LXFA 1PUTA 1WRIA 2MJDA 1KFYB 3AN1A 1YQ4B 2WU2B 5C2TB 4YXDB 4ZOHC 3VR8B 4HRSA 2MH7A 3PO0A 3DWGC 2LEKA 1QOAA 1RFKA 1XLQA 1ZOYB 5EE1A 5H92C 1DOYA 3AV8A 1YJJA 3P4QB 1WGKA 1QT9A 2K22A 1QLBB 1DGJA 2WP9B 3SFEB 5G5HA 1FMAD 1N62A 4N58A 2MJEA 1NI3A 4YTMB 4US8A 3BIID 2QJLA 5EE3A 1TKYA 3NVWA 4WWMA 1E9MA 4JWUC 5C3JB 1XO3A 3W5VB 1OFFA 3AE2B 5EE9A 1SF0A 2BS3B 1FXAA 3P4PB 1TKGA 3L4PA 4N59A 1NENB 2WLBA 1N61A 1E7PB 3AE5B 2L83A 4WQMA 1F0ZA 1N63A 1GPXA 2JX5A 2PVGC 4JWSC 2G1EA 3B9JA 1TKEA 2BS2B 3CIRB 1JRPA 1JW9D 1RM6C 2WDQB 3NRZA 3SR6A 2PKOA 1J7AA 4P6VF 4C80A 1L5PA 3HVZA 4C7ZA 1NEKB 2K5PA 1XLNA 1QF6A 1V8CA 3KWLA 1QOGA 3AB5A 1QOBA 2KMMA 3AE6B 1TYGB 3WCQA 2E3TA 3AM9A 2JQRB 4ZHOA 1FXIA 2W55A 4YT0B 1E6EB 3B2FA 1RWSA 4YSXB 3HRDD 4LTUA 1AYFA 2FBWB 3NVYA 4HROA 1B9RA 3FAHA 1KRHA 1YJIA 3HUIA 2EKIA 3B2GA 2PVOD 2Y5CA 1FM0D 1YQ3B 4ZHPA 3AEEB 2WDVB 2N0SB 3AEFB 3NS1A 1J7BA 2OHFA 3AE7B 1XLOA 1NYRA 1FO4A 2BT6A 1ZP0B 3CWIA 5H8YE 1FIQA 3AECB 1I7HA 3AE4B 2W54A 1N5XA 3VR9B 3AEBB 1UWMA 1L6UA 2W3SA 1AWDA 1WWTA 3AE1B 1DOXA 1FFVA 3P1MA 2WS3B 1SIJA 2CU3A 3AMZA 3LB8C 4JX1C 2CJNA 3VRBB 3W9CB 2DWQA 3AEAB 3P4SB 2B76B 1CZPA 4USAA
chains in the Genus database with same CATH superfamily
2DBYA 3W5UB 5FR6A 3MC8A 1FNWA 4ITKA 2LFIA 2KWDA 1WXQA 1E8WA 1NYQA 4TV3A 1RLFA 1ROEA 3N32A 4A3OA 4C7YA 3NVZA 1JCKB 4N9F4 1C1YB 3AU5A 2CU1A 4YTNB 1PGBA 2QSDA 1V5OA 1KF6B 2DAJA 3EGRA 4J6IA 1LQBA 2HTME 1L7YA 1YQ4B 1KJTA 1SE4A 4JQWC 2AWTA 3ZDMC 2NS5A 2GBRA 2KOXA 2ZZPB 3P4QB 4HK2A 1WX9A 2V9HA 4ZRJA 3IVFA 2M4NA 1TKYA 1WSPA 3V05A 3A9KB 4WURA 3PZ8A 1WJ4A 4FJVB 4FHJA 1GOZA 3AULA 1CQVA 2N9XA 5G2NA 2KKCA 4RFBA 4BBNC 3UQBA 2RR9A 2KZRA 4RCOA 4NQKE 3TUOA 3VQIA 2WXRA 4HJGE 1Q10A 2KMMA 2XK5A 4PYZA 2WXHA 2V3NA 3ZJTA 2QDFA 2RDHA 3R7RA 4NAMA 1V6EA 4DHJD 2WDVB 2N0SB 1ACCA 3EECA 5H8YE 3AE4B 3OLMD 3K9OB 1Z2MA 3DOWA 3IG3A 4AWJA 4GDLA 1WXVA 3RNEC 2WS3B 4JX1C 2IDYA 4K7WA 3QJZA 3PVLA 4K81A 4GMVA 1Q1OA 2L76A 2EMTA 3V61A 2PTLA 2K25A 4MEMA 3VH4B 1FXTB 2IGGA 4YTPB 5CHFA 5LLIA 4NJCA 1N5WA 2IJ0A 1STEA 4MACA 1RRBA 4MGIE 3DBRB 4XDCA 1WX8A 3VRAB 4GN1A 1NVID 2WDRB 4N6EB 2ZEQA 1WRIA 3TEWA 1DOYA 4W9JA 2L3ZA 2UU7A 1E8XA 1WR6E 4DDID 3DVNV 4FADA 1NI3A 3ZW3A 4C4VB 3BYYB 1XEEA 1TT5B 4A3PA 3W5VB 3OAWA 1E7PB 2L83A 2JX5A 1VD2A 1TKEA 3B9JA 3SR6A 2ZNVB 1ISNA 2KC1A 5C1ZA 2JZ3B 2MBBB 3CF6E 2N9EB 2D3CA 1TY2A 3DPDA 4J3OD 2NMQA 2KHWB 1KRHA 5DPWA 1SE3A 2WYQA 2LXAA 4KVGB 1MHXA 3KW5B 4F1SA 3VVWB 4KGTA 2BB6A 3AE1B 1DOXA 3NZSA 2M0AA 4IWOA 1WRDB 3NOBA 3RNBC 1Z5SB 2NVUI 3C8YA 1V1PA 1ET6A 2CS4A 5TR5A 1SSNA 1K51A 2E6XA 1AARA 2DLBA 1JALA 4EFOA 2KYWA 1ZUD2 4IOIE 4MJSA 1V97A 1I4RA 2O2VB 3TL5A 5IA7A 4KX6B 2PE6B 3IBEA 3TIXA 1FPYA 5JHAA 2LMCA 3Q8CA 4HKZE 2K8BA 2MCNB 4TQ1A 2BW2A 2LGYA 4M0WA 2JT4B 5JZEB 4NQLB 1ZOYB 3MP9A 5H92C 1T0RC 3BYTB 1WZ0A 4II3B 2O6VB 4E74A 4A20A 2WP9B 4TUUA 5KHOA 2FCQA 3LYYA 1ZXHA 2BS3B 2KC2A 2KWVB 4BFRA 4KIKB 1E7VA 1F0ZA 3OJ3A 2KDFB 4XDDA 2FUHB 4P16A 3EHVA 2KQ4X 2BS2B 4MH8A 1VR9A 3RNFC 2PKOA 3PLUA 5IOIA 4DXAB 1L5PA 2GBMA 3EFUA 2IO2B 1QOGA 2NTSA 2KFJA 1E8YA 3RI7C 4IUMB 4W9HA 3HM3A 4OHJA 1D5XC 4RGOS 2FIDA 2DENB 3APCA 4DWFA 3L16A 2Z59B 3TEXA 3R66C 3DHIC 3VTUA 5LXHA 2JXTA 1FFVA 3A9KA 4F8CB 2WXMA 4GIVA 1T0QC 4PS3A 2DWQA 4EOYA 1CZPA 4USAA 4FLHA 3R7QA 2REXA 1L6VA 3PRZA 5AUIA 1J7CA 3ZTDA 4G3XB 2KN5A 1K53A 3ALBA 2MEKA 2DZIA 1YN4A 1V2YA 3SEBA 2AEHA 3L10B 1SB3C 3ETRA 5MPOA 1FRDA 2AL3A 3QIJA 3DWMA 1CMXB 5LXIB 1UZXB 1WFYA 2INNE 2KMCA 3RPFC 3NS8A 1XF5L 4WJPA 3V6EB 1R4NB 2CHWA 3ZGZA 1HTQA 3ZNGC 1V49A 3BY4B 1SJHD 4H2AA 3SFEB 3Q3NC 2RD0A 2N4FA 1OGWA 4US8A 2WX0A 3AE2B 5BMIA 3DBRI 2I38A 2KTRB 4MM3B 4K7UA 3EFCA 1KLVA 1MVKA 1K8RB 3FKYA 3W1SC 1GPXA 1F52A 3GZNB 3Q6BA 2Z8LA 4KSLC 1K50A 2K5PA 3RFZB 4B0MA 2E3TA 4LLGM 4WJOA 1E6EB 4YSXB 1YJ1A 1U4AA 2K0PA 3DBLB 1FD6A 3PRMB 3C19A 3QARA 4KGSA 4M8NA 1VZ8A 1D4BA 2N9KA 2Z0EB 2FCNA 5IO9A 2YVCA 2G4DB 3BWUD 3E9SA 3H7SA 4C4VA 1WI0A 2JYEA 1TGZB 2GBJA 5E6PA 2B76B 2K8HA 1EWCA 2WU5B 2LRWA 4JE3B 1WX7A 3AE9B 3GB1A 1AW7A 1GB4A 4RGTA 1YN3A 4JGHB 1VDVA 4JL9A 4ASWC 1YN5A 1BMLC 2KVRA 2KWCA 4ICUA 1EM7A 4BZAA 1T0SC 1UBQA 4M00A 1IUEA 3JW0X 1XLPA 2PIAA 4I6NB 2DZKA 1IP9A 2IGDA 4HPMB 5D7GA 1H8CA 2KJ6A 5D94A 3O65B 1WM3A 2C9WB 3NG0A 2RDGA 2M1MA 3Q2AC 4RGNA 1KOTA 5EE1A 4DK5A 3H8HA 1WGKA 2JUOA 1DGJA 4X57B 3H1UA 3PZ7A 1MG8A 4NPNA 4W9IA 2WDTB 2J52A 1WGGA 1FXAA 4ARCA 3MC9A 4K3CA 2B3AA 2CHZA 1IYFA 1RM6C 4W9GA 2X38A 2Y5BB 3HVZA 2JXXA 2O2VA 4MGZE 3V6CB 2NTTA 2W55A 3KH0A 3B2FA 4FBJB 2KDMA 1ZGUB 2MRPA 3ML8A 3PTFC 4BVUC 1YJIA 4ZYNA 2QC8A 2XEWA 3DVGX 4FJYA 1WJNA 1FM0D 3DBHB 3AEFB 5AZHA 3N1ZC 1P3QU 2O6VA 4MSMB 4DHJB 1UWMA 5IP4D 3U7DA 2RPVA 3X23A 4BKGA 1A5RA 2GBKA 4OZCA 1TS4A 3N30A 3PS6A 4KIKA 4A6QA 4PYUA 4XE0A 4LNOA 1GC7A 2L8JA 2MJ3A 5D3IB 4A55A 2BPSA 4YL8A 2R2OA 1L2NA 5D6JB 3WIMA 4ZRPA 2L52A 3PRPB 4KDIC 3VTVA 2ON8A 1PFDA 3NHEB 5CHVC 3BVMA 3W2DA 1TBEA 2XBBC 1MHHE 1TJEA 1EWYC 1T0YA 2ZPNA 4P1CC 2W3RA 2ZW1A 3A1QB 4MH0E 2BGFA 1IPGA 1A70A 4OVUA 1FNUA 2JRHA 1KFYB 2NR2A 4WJQA 2MH7A 1RFKA 2ICIA 1V80A 3HVDA 1QLBB 4FA6A 1EO6A 1WXAA 1P0RA 5EE9A 2DX5B 1I4PA 2LHDA 1NENB 3AE5B 1JWUD 4W9LA 2KLGA 3L54A 1JRPA 1JW9D 1LM8B 1OQYA 3MHSD 2IO0B 4OVZA 4C7ZA 3Q3MC 1V8CA 2WXPA 3AB5A 1Q0WB 2KX0A 3NVYA 2KX3A 3CSFA 2WXLA 2SAKA 1NBFC 1IGDA 1YQ3B 4HDQA 1FO4A 3N20C 4RF1A 1ENFA 3AI5A 3DQVA 5E6OA 1L6UA 3L0WB 1AWDA 3W1SA 2KTRA 4MM3A 2V4IB 3ZTCA 3DBLI 3OWEB 3B0AA 1RYJA 2K6DB 1E0ZA 3Q3JA 4LK0M 4RF0A 4FULA 3R3MA 2K8CA 2MSED 3C0RB 1CJEA 5CX3A 3DDCB 3ZDTA 2D3BA 3P2BA 1UBIA 4JLCA 4ZRIA 4RMAA 4IWPA 1WE6A 4HWIB 4S0RA 2FAZA 1WIAA 2J42A 2L32A 1EF1A 1FCCC 2V3PA 1ZPSA 2LXCA 4HKQA 3WAMA 2IYDB 2N7DA 4IW0A 2WXJA 4TMAB 3ZO5B 2AQ1B 2MWSB 2WX1A 1RFAA 2I1KA 4I6LB 4DXGA 1FMAD 4WWOA 4KSKC 3ENEA 3L08A 1ZE3D 2W9NA 4BOSC 3APDA 3MFGA 2INPE 1SF0A 1UUPA 4QAYA 4N59A 3U7ZA 2MHJA 1VCBA 3DVGY 4EUTA 2PEAA 2DYBA 1C3TA 2C7MB 2GBNA 2JU6X 4L23A 3Q8AA 4KGRA 1D5MC 1FCLA 4OW0A 3ZVVA 3WA0A 3BVGA 2BYTA 3RZFA 1FXIA 4AUQC 3ZJUA 3HRDD 4LTUA 4EKUA 2FBWB 5E6JA 3V60A 4FN2A 4JIOU 4KKIA 3SU8X 1ZDVA 2Z0DB 5J2RA 2FUG1 3QAQA 3EC8A 1UH6A 2L7RA 1WR1A 4DQOC 3AEBB 1LO5D 1P7EA 2W3SA 1KM7A 2D11A 2VRRB 3MHZA 1WGHA 2KT7A 3P4SB 2I1JA 2D5GA 3ZUNA 4S17A 2MP2B 1S3SG 2KDBA 2H88B 3AH7A 4LNKA 3KUCB 1LFDA 2OJWA 4E71A 1J0GA 4YWGG 3P4RB 2Q5WD 5GXGB 3VUYA 3AEDB 4EZJA 5GMVA 1BXTA 3TEZA 2L05A 4ZDVA 2N9PC 3EUB2 2BTEA 2XN9C 2M8SA 4F7ZA 3VR8B 2NBWB 2DYOA 1XT9B 3RULA 4IM3A 3PV1A 3PLVA 3I5JC 1MG4A 1HQRD 4OZAA 3VUXA 4JWUC 1XO3A 1EUVB 2NPTB 2ZPYA 1SE2A 2GRIA 4WJNA 3U4EG 1MJDA 3SD5A 3P4PB 4GU2A 4HPLB 3ML9A 1EU3A 4BOZB 4REZA 4W9FA 2JYTA 2JSVX 1WXSA 2WXQA 1SEBD 1M94A 3A1QA 2IO1B 1TYGB 3UQAA 4URKA 3NZUA 4MGYE 2BYEA 2QHOA 5CTRC 4CYEA 4ZYSA 2PVOD 4BKSD 3AEEB 2K6QA 2G4SA 1JWSD 2MBHA 5BYSA 1R4MB 1P9DU 2W54A 1SXTA 2YEPB 3W1YA 1H4RA 4BKTA 2J0MA 1YOVB 2ZJDA 3AMZA 4DXFA 3QX1A 5FK9C 4AOFA 2K39A 4HCPB 3RYTA 1TIFA 4P7IA 4GLSC 1DYQA 1GB1A 1BUIC 1HA5A 2J53A 1I4QA 2V1YA 3AE8B 4DBGA 2WHIA 4FJZA 3UIOB 3BVZA 2PW9A 2BYVE 2IO3B 3EA6A 3QK0A 4BBNF 5JXVA 1TS2A 2D2QA 1E90A 2VZKD 4IKGA 4XGAB 4CQNA 1I35A 2WXFA 2Y5PA 4FXCA 4ANXA 1WZ3A 5CHWA 4ZOHC 4RH6A 3MTNB 4AJWA 1C4AA 4L1BA 3APFA 2J7QB 4RNAA 1V9JA 1X1MA 4WAAA 2JRIB 4CO7A 2M17A 1D5ZC 3QQ8B 5DCNA 3CIRB 5G55A 1Y8RC 4P6VF 4MGKE 3WAOA 2JWUA 1V1OA 1YIWA 1RAXA 2LGDA 5J18A 3HUIA 1XQQA 2CHXA 2IGHA 1FNVA 1SE9A 2JVCA 1L4DB 3DVNU 4LCDE 1WM2A 3SDLC 1D3ZA 1HEZE 2KO3A 1QILA 2QCZA 4G11A 2GOWA 4K1RB 3KVFB 1IBXB 2MBOA 1EU4A 3B08A 3RNGC 1D6EC 3TCAA 4MDKE 1WJUA 3NY5A 4KDLB 2LI5A 3JYUA 4HLEA 2PLPA 2A5UA 4E3CA 2INCC 1CK1A 4PS8A 1GAQB 4LDTD 2CJOA 4UDUC 3RNAC 5IKCM 1WMHB 2KDIA 3O13A 3QA8A 2IY1B 1C9FA 3VXWA 3GE8C 4CHKA 4KV2A 3VTWA 1OQQA 5EE0A 4HCNB 1J8CA 1E10A 4G0NB 3S2AA 1FRRA 4TKNA 3FC4A 2KFKB 2KLCA 1TY0A 5L95C 2HJ1A 3VHTC 3ZLZA 2WQYB 3PHWB 4ANUA 3L13A 3X0WA 2LEKA 1JWMD 1QOAA 4PT5A 3HK0A 3V3XA 3T9LA 3IAM1 4GDKB 2MP2A 5BMHA 3BIID 2W82A 2OEDA 5DPRA 1GG3A 3BK1A 2LGSA 1TKGA 3L4PA 1VZ7A 2N7JA 2QMTA 5T8IA 1JMLA 1VZ6A 1YNTE 1N63A 1UELA 2MBQA 2FCMA 1F2RI 1Y56A 2QILA 1QF6A 3KWLA 2C60A 4NJ6A 1P98A 2JF5A 1UGJA 4Q2JA 1AYFA 3NUHB 1WH3A 4RM9A 2Y5CA 2DZMA 4B95A 4TQ0A 3NS1A 2OHFA 3AE7B 3RZWC 2BT6A 3RCZA 1MI0A 1Q5WB 5C23A 1IGCA 2NBUA 3TSSA 3P1MA 2NPTA 2HD5B 1TZOA 2UWQA 2D3GA 3Q69A 4LNNA 2KDEB 3ZKJC 3I57A 3ONSA 2WXNA 1FFUA 3A33B 1XCQL 1TS5A 1T5XD 2C7NB 3RD2A 2GB1A 2KAJA 1PYWD 4YSZB 3H6NA 1E8ZA 1C4CA 4C00A 3R2TA 4US9A 2Y3AA 4PS7A 3KUDB 3SFDB 4KKJA 2X8XX 3TEYA 1VJKA 3IT4B 4M02A 2LASA 2G3QB 3QCAA 4EE2A 3ZYYX 2MQJA 4W9EA 3U8ZA 3PSEB 5C2TB 1C79A 1V5TA 1YX6B 1C4PA 3AV8A 2JPHA 4M8MA 1BT0A 1GNUA 3JSVB 2J0JA 4BAXA 1TS3A 4KZCA 3MC0B 2DHZA 5LNK1 3IXSA 1OFFA 3ZRFA 4K3BA 2PPHA 5IAAC 2XNAC 2J4XA 1C77A 4IM2A 4WQMA 2R61A 3Q8EA 3H9DA 1I42A 3HIZA 4IG7B 1TTNA 3VH3B 3WCQA 3AM9A 2JQRB 2KJHB 3GP7A 5DPTA 1ET9A 2V4LA 4AS1A 3K9PB 4LNFA 1WF9A 2CKHB 5BYQA 2LVQA 2ONQA 5L83A 2WGSA 1PGXA 1I7HA 1OEYJ 3VR9B 3N1XC 4D2KA 1R4NI 3PPAA 4NAWB 1ZKHA 3PZDA 5FR3A 1YX5B 4RGMA 5BYRA 2ZVOA 1N60A 1JWBD 2AX5A 4B6WA 2LRUA 4YSYB 3KYDD 1XXGA 2PE9A 4GSWA 4ZRKA 4A9AA 1JQ4A 3Q14C 3GZNI 3U30A 2H89B 2MLBA 3DCGA 2M56B 3UIPB 1L0VB 3AEGB 1F77A 3OJ4B 2KTFA 2BB5A 3ABVB 4XC2A 1L4ZB 3ZIMA 1M4VA 1PUTA 1UD7A 2AYOB 2SEBD 2AL6A 1IBXA 2WXOA 2V3SA 1YJJA 5DPSA 2L00B 2NBVB 3U2SC 4WIPA 1N62A 4N58A 1VRAB 5EE3A 4XX5A 2K1FA 2BBCA 3TBLD 4B0EA 2LUMA 3H7PB 3PT2B 4A8XC 3KYCD 1WMHA 3IT6B 2J0KA 3WAPA 2WDQB 3E56A 5AEKB 1J7AA 3GOEA 1NEKB 4LNIA 2KFKA 2EKEC 2C5LC 2L0FA 2LWPA 3NJTA 1B9RA 3ZNHB 3DHGC 3VAWA 5KHQA 2PMVA 2V0GA 1NDDA 2FE8A 3ZNZB 3J9CA 3PGEA 3AECB 4GDKA 1N5XA 3RN9C 2IBIB 3M62B 5FKAC 2LVPA 4II2B 5TSSA 4A90A 2KWUB 3M63B 2A4ZA 4WH4A 3VRBB 3ZQ4A 1UNSA 4WAFA 4MELA 4DHZE 3T3NA 2LD9A 3I9V1 4ARIA 4GOCA 3DHHC 4HXDA 3BK2A 1WYGA 1ZW7A 2K9XA 4OVVA 1PQSA 4L2YA 2ZNVC 4ANVA 2YLMA 3ZNID 2BS4B 5HHDG 1T3QA 2AQ2B 1WXMA 4GXBA 3AE3B 1JROA 3UINB 2GI9A 3DBHI 2KANA 3AN1A 2VZKB 1FEHA 2N1VA 3A9JB 1QZEA 2KN4A 2K22A 3P42A 3B1LX 2OOBB 2EELA 1E9MA 4WWMA 1SGHA 5HI1A 3MJ5A 2TSSA 3NZ3A 4I6PA 2BKFA 2WLBA 1WE7A 1HXYD 4HJKA 3IFWB 1J19A 2KMAA 3NRZA 4C80A 4W9DA 4HDOA 4JPSA 1YQBA 2MA9B 1WGDA 1OEYA 1LXDA 3IHPC 1F2RC 4ANWA 3FILB 1C76A 1RWSA 2WXKA 2MBEA 2WXGA 1E7UA 2BQQA 4AQ7A 3TJPA 1KLUD 2NCNA 1J7BA 4MT5A 3JSVA 2KXJA 2G45B 1NI2A 3N3KB 3BZDB 3ZRCA 3T3OA 1WGRA 3JVZX 3KLSX 2MW5A 3R8BA 2D10A 5D3DA 2QEJC 1SIJA 1MPEA 3LB8C 4P1BC 2RPQA 4W9CA 3AEAB 3HM6X 2ASQA 1V86A 1I4XA 5JHBA 2JZPA 1PDXA 2R2QA 3AXCA 3U52E 1P1AA 1JWAD 1GUAB 2RGFA 3NVVA 1F1HA 2BKRB 3PHXB 2INDC 4LDTB 1KH0A 2LGXA 3VDZA 4XWWA 3VUWA 3WALA 2JWZA 3N1YC 5E6NA 2QIEB 1I4HA 4NY0A 1HZ6A 2MX2A 2K3UA 4XWTA 1B1ZA 2JY6A 4YXDB 4HRSA 4NAWA 3SHQA 2BVCA 1XLQA 4GGQA 1EF5A 4IWQA 3ZXVA 4B9KA 3ZXRA 1SBBB 5G5HA 2WWZA 4AP4C 3NVWA 5C3JB 5JH5C 2KK8A 2D3AA 2RSUA 2RMMA 1YD8U 2PVGC 4XYCA 2L1AA 1HE8A 3HHMA 2BYFA 3QWZB 1SJED 2LGIA 1V81A 2DNFA 1AN8A 3TMPB 4YT0B 1KTKA 2ZW0A 5HG2A 1F9JA 3D32A 2M0XA 4NZLB 4ZHPA 4WQOB 1NYRA 3UF8A 3QHTA 5D2MB 4K7SA 4IM0A 3IAS1 4FHKA 4AJYB 4EEWA 3A4SC 3H7PA 2PJHA 3LJ3A 4KZ0A 3T8MA 3KUZA 2N1WA 4HVBA 1DOIA 3URYA 4GB9A 2HTHA 3LDZE 1R7SA 1KLGD 1K52A 1GC6A 1WY8A 3Q8FA 2ZCBA 2ACZB 2UYZB 5G5GA 3R2IA 1T6BX 2AQ3B 2LZ6A 1QOFA 3ZJVA 2JZZA 4RM8A 4C56C 2C7HA 3BINA 1VLBA 2I2YA 1XCTL 1JRUA 1UWXA 2XK5B 1WJ6A 3UGBB 4BKSA 3LXFA 2RDBC 2MJDA 2O6VD 4WWNA 2FCSA 4ACFA 2LJIA 1UF0A 4NJ7A 1QT9A 3VFKA 3DBSA 4TSSA 4GDLB 1S1QB 2IPKD 2KQ7A 5J17A 1UGMA 1N61A 1SIFA 3L17A 2IZVB 1QKZA 2LUEA 2KVZA 4JWSC 3CMMB 2ZCCA 3AU4A 2G1EA 2CR5A 1L0YB 1XLNA 3AE6B 4R3DA 2HE7A 3Q8BA 2IY0B 2GMIC 1LGRA 3FAHA 4OZBA 2EKIA 3RNCC 2WNMA 2ZVNA 3CSTA 3A9JA 2FIFA 2HDEA 5BO4B 5HKHA 1XD3B 3OG5A 1MFWA 3V62A 3KWVA 5AZGA 3RT3B 2DZJA 4ZRQA 2CU3A 3MJWA 2CJNA 2FNJB 4LJPB 3A4RA 3KQ4A 3GS2A 4ICVA 3QC8B 4IDIA 3I3TB 1ZXIA 3N9YC 2D07B 1G6JA 2WXIA 3M3JA 3FILA 5AUKA 1HZ5A 1YMHE 2HJ8A 2BWFA 3P63A 2M19A 4M01A 2DAFA 2KQSA 3UI3A 3Q3OC 1E5WA 1OQRA 1P7FA 2KACA 4PK1A 2EMSA 3GE3C 2KD0A 5AZFA 2DYMA 2WU2B 1R4MI 3PO0A 3DWGC 2BWES 3RMKC 4W9KA 5I4DA 5IN7A 2BF8B 2OJRA 1OTRB 3Q3FA 1ZDXA 3ECIA 4EZKA 2LHEA 3WANA 1ESFA 2MJEA 5BMGA 2GLSA 4YTMB 2QJLA 2LVOA 1WGYA 2VH2A 2N7EA 1L0XB 2LJ5A 2YEPF 2N9LA 2VH1A 1C78A 2L0TA 4WWPA 4DDGD 4MSQB 3PREA 4LJOB 2KNBA 4EZLA 1V1PB 1GJZA 4G50A 1PGAA 1QOBA 5HFYA 4ZHOA 4HEA1 4HROA 1WYWB 3B2GA 1TZ1A 4MJSB 1XLOA 1QQRA 1N6ZA 1ZP0B 3CWIA 4O1NA 1FIQA 4DHZB 2G9HD 3RUIB 3I63C 1WWTA 4HPPA 4M0WB 4XZ4A 1HTOA 3M95A 1I4GA 5EDSA 4NNJB 3W9CB 4IC7B 2KJRA
chains in the Genus database with same CATH topology
2DBYA 1GB1A 1BUIC 2WU5B 3W5UB 3T3NA 1FNWA 4JE3B 1HA5A 3I9V1 4ITKA 2LFIA 4ARIA 2J53A 2KWDA 3AE9B 3GB1A 1I4QA 3BK2A 1WXQA 1WYGA 1AW7A 1NYQA 4RGTA 1GB4A 1YN3A 3AE8B 1VDVA 2K9XA 1ROEA 1YN5A 1BMLC 4L2YA 4C7YA 3NVZA 1EM7A 1JCKB 3BVZA 2PW9A 3EA6A 4YTNB 1PGBA 1IUEA 2QSDA 5JXVA 1TS2A 1XLPA 1KF6B 2PIAA 2VZKD 2BS4B 2IGDA 4IKGA 5HHDG 3EGRA 1T3QA 4CQNA 2AQ2B 5D7GA 2WXFA 3AE3B 1JROA 2Y5PA 4FXCA 2HTME 2GI9A 3AN1A 1YQ4B 2VZKB 4ZOHC 1SE4A 4RH6A 2RDGA 1C4AA 4RGNA 1FEHA 5EE1A 4L1BA 3H8HA 3P4QB 1WGKA 2KN4A 2K22A 1DGJA 3P42A 4RNAA 3PZ7A 1TKYA 2EELA 1E9MA 4WWMA 5HI1A 1WSPA 3V05A 3MJ5A 2J52A 4WURA 3PZ8A 1FXAA 2TSSA 3NZ3A 4ARCA 2WLBA 1D5ZC 1HXYD 1GOZA 1CQVA 3CIRB 1RM6C 3NRZA 4C80A 4P6VF 4JPSA 4RFBA 2X38A 3HVZA 4RCOA 2JWUA 3TUOA 3VQIA 1V1OA 2WXRA 4HJGE 1Q10A 2KMMA 1F2RC 2NTTA 2W55A 3FILB 3B2FA 2WXHA 1C76A 1RWSA 2V3NA 2KDMA 2WXKA 3ZJTA 1YJIA 3HUIA 2WXGA 2RDHA 4NAMA 2IGHA 1FNVA 4AQ7A 1FM0D 2WDVB 2N0SB 3AEFB 1KLUD 1J7BA 4MT5A 1ACCA 1L4DB 5H8YE 3AE4B 3BZDB 1HEZE 3T3OA 1UWMA 1QILA 3KLSX 3R8BA 5D3DA 2RPVA 2QEJC 1SIJA 1MPEA 2WS3B 3LB8C 4JX1C 2IDYA 1IBXB 4OZCA 1TS4A 3AEAB 1EU4A 4A6QA 1D6EC 4XE0A 2MJ3A 1I4XA 5D3IB 4A55A 2JZPA 1PDXA 2PLPA 3U52E 1CK1A 1GAQB 4ZRPA 1JWAD 2L52A 2ON8A 1PFDA 2CJOA 3NVVA 4UDUC 2PTLA 3O13A 1C9FA 3BVMA 2IGGA 3W2DA 1OQQA 5EE0A 4YTPB 1KH0A 4XWWA 1MHHE 1N5WA 1TJEA 4NJCA 2IJ0A 1STEA 4MACA 1E10A 1FRRA 2QIEB 1EWYC 3FC4A 1I4HA 2W3RA 1TY0A 2ZW1A 4XDCA 1HZ6A 3VRAB 2K3UA 1A70A 1NVID 2WDRB 4N6EB 4XWTA 2WQYB 1FNUA 1WRIA 1B1ZA 1KFYB 4YXDB 4HRSA 2MH7A 2LEKA 1JWMD 1QOAA 1RFKA 1XLQA 2ICIA 4PT5A 3TEWA 1DOYA 3HVDA 3V3XA 1QLBB 1SBBB 3IAM1 4GDKB 5G5HA 1NI3A 5BMHA 3BIID 2W82A 2OEDA 3NVWA 3BYYB 1XEEA 5C3JB 3W5VB 5EE9A 1I4PA 2LHDA 3BK1A 1TKGA 3L4PA 1VZ7A 1NENB 2N7JA 1E7PB 2QMTA 5T8IA 1JMLA 3AE5B 1JWUD 1VZ6A 2L83A 2RMMA 1YNTE 1N63A 2JX5A 2PVGC 3B9JA 1TKEA 2L1AA 1JRPA 1JW9D 3SR6A 1EWCA 4OVZA 1F2RI 1Y56A 4C7ZA 2QILA 1QF6A 1V8CA 3KWLA 1SJED 2WXPA 2LGIA 3AB5A 1TY2A 4J3OD 1AN8A 1UGJA 4Q2JA 4YT0B 1KTKA 1AYFA 3NVYA 2NMQA 2ZW0A 1KRHA 5HG2A 3NUHB 2WXLA 2SAKA 1SE3A 2Y5CA 4NZLB 1YQ3B 1IGDA 4ZHPA 4TQ0A 3NS1A 2OHFA 1MHXA 3AE7B 1NYRA 1FO4A 2BT6A 1MI0A 4RF1A 1ENFA 1L6UA 1IGCA 1AWDA 4KGTA 2BB6A 3AE1B 1DOXA 3IAS1 3TSSA 3P1MA 3W1SA 1TZOA 2M0AA 3Q69A 2V4IB 3OWEB 3I57A 1RYJA 2WXNA 1DOIA 1FFUA 1XCQL 1E0ZA 3URYA 1TS5A 3C8YA 4LK0M 1R7SA 1V1PA 4RF0A 1T5XD 2GB1A 1ET6A 1KLGD 1K52A 2KAJA 1PYWD 4YSZB 3Q8FA 1C4CA 1CJEA 2ACZB 5G5GA 1SSNA 3R2IA 1K51A 1T6BX 3R2TA 2AQ3B 2E6XA 1QOFA 3ZJVA 4US9A 2Y3AA 2DLBA 3SFDB 4KKJA 1JALA 4C56C 3TEYA 1VJKA 1ZUD2 4IOIE 3IT4B 1V97A 1I4RA 1VLBA 2J42A 2I2YA 4KX6B 1XCTL 2L32A 1UWXA 4EE2A 3ZYYX 1FCCC 2LMCA 3Q8CA 2V3PA 4HKZE 1ZPSA 4TQ1A 4HKQA 3LXFA 2MJDA 2BW2A 4M0WA 5C2TB 1C79A 4TMAB 2WXJA 1C4PA 1ZOYB 2AQ1B 3MP9A 5H92C 3AV8A 2LJIA 3BYTB 1QT9A 2WP9B 4DXGA 1TS3A 1FMAD 3MC0B 5LNK1 4TSSA 4GDLB 1ZE3D 3IXSA 3LYYA 1OFFA 2IPKD 1ZXHA 3MFGA 2INPE 1SF0A 2BS3B 1UUPA 4N59A 3U7ZA 1N61A 2XNAC 2J4XA 1C77A 1QKZA 4WQMA 1F0ZA 2R61A 3Q8EA 4XDDA 4JWSC 4P16A 2G1EA 2KQ4X 2BS2B 4MH8A 1VR9A 2JU6X 4L23A 2PKOA 3Q8AA 4KGRA 1L5PA 1L0YB 1D5MC 1XLNA 1QOGA 2NTSA 1FCLA 4OW0A 3AE6B 3BVGA 3WCQA 2BYTA 4R3DA 3AM9A 2JQRB 3GP7A 1FXIA 3Q8BA 3ZJUA 3HRDD 4LTUA 4OHJA 2FBWB 1D5XC 3FAHA 4RGOS 5E6JA 4KKIA 4OZBA 1ET9A 2EKIA 4AS1A 1ZDVA 2WNMA 2FUG1 5BYQA 2HDEA 2ONQA 1PGXA 1I7HA 3TEXA 4DQOC 3VR9B 3AEBB 1LO5D 1P7EA 3KWVA 4D2KA 2JXTA 2W3SA 4ZRQA 1FFVA 4NAWB 3MHZA 2CU3A 2CJNA 2WXMA 5FR3A 2DWQA 3KQ4A 3P4SB 4RGMA 5BYRA 3GS2A 1CZPA 2D5GA 4USAA 1N60A 1JWBD 2AX5A 2H88B 4IDIA 3AH7A 1ZXIA 4YSYB 3N9YC 1L6VA 1XXGA 5AUIA 1J7CA 2WXIA 4YWGG 4A9AA 3P4RB 1JQ4A 2Q5WD 1K53A 5GXGB 3FILA 3AEDB 2H89B 5AUKA 1HZ5A 1YMHE 1BXTA 2MEKA 3TEZA 2M56B 3P63A 1YN4A 2M19A 3SEBA 1L0VB 3AEGB 1F77A 3UI3A 1SB3C 3EUB2 3ETRA 5MPOA 1FRDA 2BTEA 2BB5A 2XN9C 1OQRA 1P7FA 3ABVB 3DWMA 2KACA 1L4ZB 2INNE 3RPFC 1M4VA 1PUTA 2DYMA 1XF5L 2WU2B 2SEBD 3VR8B 3PO0A 3DWGC 1IBXA 2WXOA 5I4DA 2DYOA 1YJJA 3ZGZA 1ZDXA 4H2AA 1SJHD 2LHEA 3SFEB 3U2SC 4WIPA 1N62A 1ESFA 2MJEA 1HQRD 4N58A 5BMGA 4YTMB 4OZAA 4US8A 1VRAB 2QJLA 5EE3A 4JWUC 1XO3A 2BBCA 4B0EA 3AE2B 5BMIA 1SE2A 2GRIA 2I38A 3U4EG 2LUMA 4MM3B 3P4PB 1L0XB 4A8XC 2YEPF 1EU3A 2N9LA 1C78A 4REZA 1MVKA 3IT6B 1GPXA 2JYTA 2JSVX 2WXQA 1SEBD 2WDQB 3E56A 1J7AA 2Z8LA 1V1PB 1K50A 1NEKB 2K5PA 3RFZB 4B0MA 1PGAA 1QOBA 1TYGB 5HFYA 2E3TA 4LLGM 4ZHOA 1E6EB 4YSXB 2K0PA 4HEA1 4HROA 1B9RA 2PMVA 3B2GA 4ZYSA 2PVOD 2V0GA 1FD6A 2FE8A 3AEEB 4KGSA 3J9CA 1VZ8A 1JWSD 1D4BA 1XLOA 1QQRA 2N9KA 5BYSA 1ZP0B 3CWIA 4O1NA 1FIQA 3AECB 2W54A 1N5XA 2G9HD 1SXTA 3BWUD 3E9SA 5FKAC 2YEPB 1WWTA 4A90A 5TSSA 4WH4A 2JYEA 1I4GA 3AMZA 3VRBB 4DXFA 3W9CB 5FK9C 3ZQ4A 1UNSA 4WAFA 2B76B 4GLSC 1DYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DBY A;  2MJ3 A;  1RYJ A;  2WU5 B;  1N60 A;  1JWB D;  1DOI A;  1FFU A;  3W5U B;  2AX5 A;  2H88 B;  4IDI A;  1PDX A;  3AH7 A;  4ITK A;  1E0Z A;  1ZXI A;  4YSY B;  3AE9 B;  1R7S A;  1L6V A;  1WXQ A;  1WYG A;  2KAJ A;  1NYQ A;  5AUI A;  1GAQ B;  4YSZ B;  1J7C A;  1JWA D;  2L52 A;  3AE8 B;  4A9A A;  3P4R B;  1JQ4 A;  1PFD A;  1CJE A;  2ACZ B;  2CJO A;  1VDV A;  2Q5W D;  3NVV A;  2K9X A;  5G5G A;  1ROE A;  5GXG B;  3AED B;  2H89 B;  5AUK A;  1QOF A;  4C7Y A;  3NVZ A;  4US9 A;  2M56 B;  3P63 A;  2M19 A;  3SFD B;  1JAL A;  1OQQ A;  5EE0 A;  1VJK A;  1ZUD 2;  4YTP B;  4YTN B;  1IUE A;  1L0V B;  1N5W A;  1TJE A;  1V97 A;  3AEG B;  1E10 A;  1SB3 C;  1XLP A;  1KF6 B;  2PIA A;  3ETR A;  1FRR A;  2QIE B;  1VLB A;  3EUB 2;  1EWY C;  3FC4 A;  4KX6 B;  1FRD A;  5MPO A;  2BS4 B;  2W3R A;  3ZYY X;  1OQR A;  1T3Q A;  3ABV B;  3DWM A;  3VRA B;  3AE3 B;  1A70 A;  1JRO A;  1NVI D;  2WDR B;  4N6E B;  4FXC A;  2WQY B;  2HTM E;  3RPF C;  3LXF A;  1PUT A;  1WRI A;  2MJD A;  1KFY B;  3AN1 A;  1YQ4 B;  2WU2 B;  5C2T B;  4YXD B;  4ZOH C;  3VR8 B;  4HRS A;  2MH7 A;  3PO0 A;  3DWG C;  2LEK A;  1QOA A;  1RFK A;  1XLQ A;  1ZOY B;  5EE1 A;  5H92 C;  1DOY A;  3AV8 A;  1YJJ A;  3P4Q B;  1WGK A;  1QT9 A;  2K22 A;  1QLB B;  1DGJ A;  2WP9 B;  3SFE B;  5G5H A;  1FMA D;  1N62 A;  4N58 A;  2MJE A;  1NI3 A;  4YTM B;  4US8 A;  3BII D;  2QJL A;  5EE3 A;  1TKY A;  3NVW A;  4WWM A;  1E9M A;  4JWU C;  5C3J B;  1XO3 A;  3W5V B;  1OFF A;  3AE2 B;  5EE9 A;  1SF0 A;  2BS3 B;  1FXA A;  3P4P B;  1TKG A;  3L4P A;  4N59 A;  1NEN B;  2WLB A;  1N61 A;  1E7P B;  3AE5 B;  2L83 A;  4WQM A;  1F0Z A;  1N63 A;  1GPX A;  2JX5 A;  2PVG C;  4JWS C;  2G1E A;  3B9J A;  1TKE A;  2BS2 B;  3CIR B;  1JRP A;  1JW9 D;  1RM6 C;  2WDQ B;  3NRZ A;  3SR6 A;  2PKO A;  1J7A A;  4P6V F;  4C80 A;  1L5P A;  3HVZ A;  4C7Z A;  1NEK B;  2K5P A;  1XLN A;  1QF6 A;  1V8C A;  3KWL A;  1QOG A;  3AB5 A;  1QOB A;  2KMM A;  3AE6 B;  1TYG B;  3WCQ A;  2E3T A;  3AM9 A;  2JQR B;  4ZHO A;  1FXI A;  2W55 A;  4YT0 B;  1E6E B;  3B2F A;  1RWS A;  4YSX B;  3HRD D;  4LTU A;  1AYF A;  2FBW B;  3NVY A;  4HRO A;  1B9R A;  3FAH A;  1KRH A;  1YJI A;  3HUI A;  2EKI A;  3B2G A;  2PVO D;  2Y5C A;  1FM0 D;  1YQ3 B;  4ZHP A;  3AEE B;  2WDV B;  2N0S B;  3AEF B;  3NS1 A;  1J7B A;  2OHF A;  3AE7 B;  1XLO A;  1NYR A;  1FO4 A;  2BT6 A;  1ZP0 B;  3CWI A;  5H8Y E;  1FIQ A;  3AEC B;  1I7H A;  3AE4 B;  2W54 A;  1N5X A;  3VR9 B;  3AEB B;  1UWM A;  1L6U A;  2W3S A;  1AWD A;  1WWT A;  3AE1 B;  1DOX A;  1FFV A;  3P1M A;  2WS3 B;  1SIJ A;  2CU3 A;  3AMZ A;  3LB8 C;  4JX1 C;  2CJN A;  3VRB B;  3W9C B;  2DWQ A;  3AEA B;  3P4S B;  2B76 B;  1CZP A;  4USA A; 
#chains in the Genus database with same CATH topology
 2DBY A;  3W5U B;  5FR6 A;  3MC8 A;  1FNW A;  4ITK A;  2LFI A;  2KWD A;  1WXQ A;  1E8W A;  1NYQ A;  4TV3 A;  1RLF A;  1ROE A;  3N32 A;  4A3O A;  4C7Y A;  3NVZ A;  1JCK B;  4N9F 4;  1C1Y B;  3AU5 A;  2CU1 A;  4YTN B;  1PGB A;  2QSD A;  1V5O A;  1KF6 B;  2DAJ A;  3EGR A;  4J6I A;  1LQB A;  2HTM E;  1L7Y A;  1YQ4 B;  1KJT A;  1SE4 A;  4JQW C;  2AWT A;  3ZDM C;  2NS5 A;  2GBR A;  2KOX A;  2ZZP B;  3P4Q B;  4HK2 A;  1WX9 A;  2V9H A;  4ZRJ A;  3IVF A;  2M4N A;  1TKY A;  1WSP A;  3V05 A;  3A9K B;  4WUR A;  3PZ8 A;  1WJ4 A;  4FJV B;  4FHJ A;  1GOZ A;  3AUL A;  1CQV A;  2N9X A;  5G2N A;  2KKC A;  4RFB A;  4BBN C;  3UQB A;  2RR9 A;  2KZR A;  4RCO A;  4NQK E;  3TUO A;  3VQI A;  2WXR A;  4HJG E;  1Q10 A;  2KMM A;  2XK5 A;  4PYZ A;  2WXH A;  2V3N A;  3ZJT A;  2QDF A;  2RDH A;  3R7R A;  4NAM A;  1V6E A;  4DHJ D;  2WDV B;  2N0S B;  1ACC A;  3EEC A;  5H8Y E;  3AE4 B;  3OLM D;  3K9O B;  1Z2M A;  3DOW A;  3IG3 A;  4AWJ A;  4GDL A;  1WXV A;  3RNE C;  2WS3 B;  4JX1 C;  2IDY A;  4K7W A;  3QJZ A;  3PVL A;  4K81 A;  4GMV A;  1Q1O A;  2L76 A;  2EMT A;  3V61 A;  2PTL A;  2K25 A;  4MEM A;  3VH4 B;  1FXT B;  2IGG A;  4YTP B;  5CHF A;  5LLI A;  4NJC A;  1N5W A;  2IJ0 A;  1STE A;  4MAC A;  1RRB A;  4MGI E;  3DBR B;  4XDC A;  1WX8 A;  3VRA B;  4GN1 A;  1NVI D;  2WDR B;  4N6E B;  2ZEQ A;  1WRI A;  3TEW A;  1DOY A;  4W9J A;  2L3Z A;  2UU7 A;  1E8X A;  1WR6 E;  4DDI D;  3DVN V;  4FAD A;  1NI3 A;  3ZW3 A;  4C4V B;  3BYY B;  1XEE A;  1TT5 B;  4A3P A;  3W5V B;  3OAW A;  1E7P B;  2L83 A;  2JX5 A;  1VD2 A;  1TKE A;  3B9J A;  3SR6 A;  2ZNV B;  1ISN A;  2KC1 A;  5C1Z A;  2JZ3 B;  2MBB B;  3CF6 E;  2N9E B;  2D3C A;  1TY2 A;  3DPD A;  4J3O D;  2NMQ A;  2KHW B;  1KRH A;  5DPW A;  1SE3 A;  2WYQ A;  2LXA A;  4KVG B;  1MHX A;  3KW5 B;  4F1S A;  3VVW B;  4KGT A;  2BB6 A;  3AE1 B;  1DOX A;  3NZS A;  2M0A A;  4IWO A;  1WRD B;  3NOB A;  3RNB C;  1Z5S B;  2NVU I;  3C8Y A;  1V1P A;  1ET6 A;  2CS4 A;  5TR5 A;  1SSN A;  1K51 A;  2E6X A;  1AAR A;  2DLB A;  1JAL A;  4EFO A;  2KYW A;  1ZUD 2;  4IOI E;  4MJS A;  1V97 A;  1I4R A;  2O2V B;  3TL5 A;  5IA7 A;  4KX6 B;  2PE6 B;  3IBE A;  3TIX A;  1FPY A;  5JHA A;  2LMC A;  3Q8C A;  4HKZ E;  2K8B A;  2MCN B;  4TQ1 A;  2BW2 A;  2LGY A;  4M0W A;  2JT4 B;  5JZE B;  4NQL B;  1ZOY B;  3MP9 A;  5H92 C;  1T0R C;  3BYT B;  1WZ0 A;  4II3 B;  2O6V B;  4E74 A;  4A20 A;  2WP9 B;  4TUU A;  5KHO A;  2FCQ A;  3LYY A;  1ZXH A;  2BS3 B;  2KC2 A;  2KWV B;  4BFR A;  4KIK B;  1E7V A;  1F0Z A;  3OJ3 A;  2KDF B;  4XDD A;  2FUH B;  4P16 A;  3EHV A;  2KQ4 X;  2BS2 B;  4MH8 A;  1VR9 A;  3RNF C;  2PKO A;  3PLU A;  5IOI A;  4DXA B;  1L5P A;  2GBM A;  3EFU A;  2IO2 B;  1QOG A;  2NTS A;  2KFJ A;  1E8Y A;  3RI7 C;  4IUM B;  4W9H A;  3HM3 A;  4OHJ A;  1D5X C;  4RGO S;  2FID A;  2DEN B;  3APC A;  4DWF A;  3L16 A;  2Z59 B;  3TEX A;  3R66 C;  3DHI C;  3VTU A;  5LXH A;  2JXT A;  1FFV A;  3A9K A;  4F8C B;  2WXM A;  4GIV A;  1T0Q C;  4PS3 A;  2DWQ A;  4EOY A;  1CZP A;  4USA A;  4FLH A;  3R7Q A;  2REX A;  1L6V A;  3PRZ A;  5AUI A;  1J7C A;  3ZTD A;  4G3X B;  2KN5 A;  1K53 A;  3ALB A;  2MEK A;  2DZI A;  1YN4 A;  1V2Y A;  3SEB A;  2AEH A;  3L10 B;  1SB3 C;  3ETR A;  5MPO A;  1FRD A;  2AL3 A;  3QIJ A;  3DWM A;  1CMX B;  5LXI B;  1UZX B;  1WFY A;  2INN E;  2KMC A;  3RPF C;  3NS8 A;  1XF5 L;  4WJP A;  3V6E B;  1R4N B;  2CHW A;  3ZGZ A;  1HTQ A;  3ZNG C;  1V49 A;  3BY4 B;  1SJH D;  4H2A A;  3SFE B;  3Q3N C;  2RD0 A;  2N4F A;  1OGW A;  4US8 A;  2WX0 A;  3AE2 B;  5BMI A;  3DBR I;  2I38 A;  2KTR B;  4MM3 B;  4K7U A;  3EFC A;  1KLV A;  1MVK A;  1K8R B;  3FKY A;  3W1S C;  1GPX A;  1F52 A;  3GZN B;  3Q6B A;  2Z8L A;  4KSL C;  1K50 A;  2K5P A;  3RFZ B;  4B0M A;  2E3T A;  4LLG M;  4WJO A;  1E6E B;  4YSX B;  1YJ1 A;  1U4A A;  2K0P A;  3DBL B;  1FD6 A;  3PRM B;  3C19 A;  3QAR A;  4KGS A;  4M8N A;  1VZ8 A;  1D4B A;  2N9K A;  2Z0E B;  2FCN A;  5IO9 A;  2YVC A;  2G4D B;  3BWU D;  3E9S A;  3H7S A;  4C4V A;  1WI0 A;  2JYE A;  1TGZ B;  2GBJ A;  5E6P A;  2B76 B;  2K8H A;  1EWC A;  2WU5 B;  2LRW A;  4JE3 B;  1WX7 A;  3AE9 B;  3GB1 A;  1AW7 A;  1GB4 A;  4RGT A;  1YN3 A;  4JGH B;  1VDV A;  4JL9 A;  4ASW C;  1YN5 A;  1BML C;  2KVR A;  2KWC A;  4ICU A;  1EM7 A;  4BZA A;  1T0S C;  1UBQ A;  4M00 A;  1IUE A;  3JW0 X;  1XLP A;  2PIA A;  4I6N B;  2DZK A;  1IP9 A;  2IGD A;  4HPM B;  5D7G A;  1H8C A;  2KJ6 A;  5D94 A;  3O65 B;  1WM3 A;  2C9W B;  3NG0 A;  2RDG A;  2M1M A;  3Q2A C;  4RGN A;  1KOT A;  5EE1 A;  4DK5 A;  3H8H A;  1WGK A;  2JUO A;  1DGJ A;  4X57 B;  3H1U A;  3PZ7 A;  1MG8 A;  4NPN A;  4W9I A;  2WDT B;  2J52 A;  1WGG A;  1FXA A;  4ARC A;  3MC9 A;  4K3C A;  2B3A A;  2CHZ A;  1IYF A;  1RM6 C;  4W9G A;  2X38 A;  2Y5B B;  3HVZ A;  2JXX A;  2O2V A;  4MGZ E;  3V6C B;  2NTT A;  2W55 A;  3KH0 A;  3B2F A;  4FBJ B;  2KDM A;  1ZGU B;  2MRP A;  3ML8 A;  3PTF C;  4BVU C;  1YJI A;  4ZYN A;  2QC8 A;  2XEW A;  3DVG X;  4FJY A;  1WJN A;  1FM0 D;  3DBH B;  3AEF B;  5AZH A;  3N1Z C;  1P3Q U;  2O6V A;  4MSM B;  4DHJ B;  1UWM A;  5IP4 D;  3U7D A;  2RPV A;  3X23 A;  4BKG A;  1A5R A;  2GBK A;  4OZC A;  1TS4 A;  3N30 A;  3PS6 A;  4KIK A;  4A6Q A;  4PYU A;  4XE0 A;  4LNO A;  1GC7 A;  2L8J A;  2MJ3 A;  5D3I B;  4A55 A;  2BPS A;  4YL8 A;  2R2O A;  1L2N A;  5D6J B;  3WIM A;  4ZRP A;  2L52 A;  3PRP B;  4KDI C;  3VTV A;  2ON8 A;  1PFD A;  3NHE B;  5CHV C;  3BVM A;  3W2D A;  1TBE A;  2XBB C;  1MHH E;  1TJE A;  1EWY C;  1T0Y A;  2ZPN A;  4P1C C;  2W3R A;  2ZW1 A;  3A1Q B;  4MH0 E;  2BGF A;  1IPG A;  1A70 A;  4OVU A;  1FNU A;  2JRH A;  1KFY B;  2NR2 A;  4WJQ A;  2MH7 A;  1RFK A;  2ICI A;  1V80 A;  3HVD A;  1QLB B;  4FA6 A;  1EO6 A;  1WXA A;  1P0R A;  5EE9 A;  2DX5 B;  1I4P A;  2LHD A;  1NEN B;  3AE5 B;  1JWU D;  4W9L A;  2KLG A;  3L54 A;  1JRP A;  1JW9 D;  1LM8 B;  1OQY A;  3MHS D;  2IO0 B;  4OVZ A;  4C7Z A;  3Q3M C;  1V8C A;  2WXP A;  3AB5 A;  1Q0W B;  2KX0 A;  3NVY A;  2KX3 A;  3CSF A;  2WXL A;  2SAK A;  1NBF C;  1IGD A;  1YQ3 B;  4HDQ A;  1FO4 A;  3N20 C;  4RF1 A;  1ENF A;  3AI5 A;  3DQV A;  5E6O A;  1L6U A;  3L0W B;  1AWD A;  3W1S A;  2KTR A;  4MM3 A;  2V4I B;  3ZTC A;  3DBL I;  3OWE B;  3B0A A;  1RYJ A;  2K6D B;  1E0Z A;  3Q3J A;  4LK0 M;  4RF0 A;  4FUL A;  3R3M A;  2K8C A;  2MSE D;  3C0R B;  1CJE A;  5CX3 A;  3DDC B;  3ZDT A;  2D3B A;  3P2B A;  1UBI A;  4JLC A;  4ZRI A;  4RMA A;  4IWP A;  1WE6 A;  4HWI B;  4S0R A;  2FAZ A;  1WIA A;  2J42 A;  2L32 A;  1EF1 A;  1FCC C;  2V3P A;  1ZPS A;  2LXC A;  4HKQ A;  3WAM A;  2IYD B;  2N7D A;  4IW0 A;  2WXJ A;  4TMA B;  3ZO5 B;  2AQ1 B;  2MWS B;  2WX1 A;  1RFA A;  2I1K A;  4I6L B;  4DXG A;  1FMA D;  4WWO A;  4KSK C;  3ENE A;  3L08 A;  1ZE3 D;  2W9N A;  4BOS C;  3APD A;  3MFG A;  2INP E;  1SF0 A;  1UUP A;  4QAY A;  4N59 A;  3U7Z A;  2MHJ A;  1VCB A;  3DVG Y;  4EUT A;  2PEA A;  2DYB A;  1C3T A;  2C7M B;  2GBN A;  2JU6 X;  4L23 A;  3Q8A A;  4KGR A;  1D5M C;  1FCL A;  4OW0 A;  3ZVV A;  3WA0 A;  3BVG A;  2BYT A;  3RZF A;  1FXI A;  4AUQ C;  3ZJU A;  3HRD D;  4LTU A;  4EKU A;  2FBW B;  5E6J A;  3V60 A;  4FN2 A;  4JIO U;  4KKI A;  3SU8 X;  1ZDV A;  2Z0D B;  5J2R A;  2FUG 1;  3QAQ A;  3EC8 A;  1UH6 A;  2L7R A;  1WR1 A;  4DQO C;  3AEB B;  1LO5 D;  1P7E A;  2W3S A;  1KM7 A;  2D11 A;  2VRR B;  3MHZ A;  1WGH A;  2KT7 A;  3P4S B;  2I1J A;  2D5G A;  3ZUN A;  4S17 A;  2MP2 B;  1S3S G;  2KDB A;  2H88 B;  3AH7 A;  4LNK A;  3KUC B;  1LFD A;  2OJW A;  4E71 A;  1J0G A;  4YWG G;  3P4R B;  2Q5W D;  5GXG B;  3VUY A;  3AED B;  4EZJ A;  5GMV A;  1BXT A;  3TEZ A;  2L05 A;  4ZDV A;  2N9P C;  3EUB 2;  2BTE A;  2XN9 C;  2M8S A;  4F7Z A;  3VR8 B;  2NBW B;  2DYO A;  1XT9 B;  3RUL A;  4IM3 A;  3PV1 A;  3PLV A;  3I5J C;  1MG4 A;  1HQR D;  4OZA A;  3VUX A;  4JWU C;  1XO3 A;  1EUV B;  2NPT B;  2ZPY A;  1SE2 A;  2GRI A;  4WJN A;  3U4E G;  1MJD A;  3SD5 A;  3P4P B;  4GU2 A;  4HPL B;  3ML9 A;  1EU3 A;  4BOZ B;  4REZ A;  4W9F A;  2JYT A;  2JSV X;  1WXS A;  2WXQ A;  1SEB D;  1M94 A;  3A1Q A;  2IO1 B;  1TYG B;  3UQA A;  4URK A;  3NZU A;  4MGY E;  2BYE A;  2QHO A;  5CTR C;  4CYE A;  4ZYS A;  2PVO D;  4BKS D;  3AEE B;  2K6Q A;  2G4S A;  1JWS D;  2MBH A;  5BYS A;  1R4M B;  1P9D U;  2W54 A;  1SXT A;  2YEP B;  3W1Y A;  1H4R A;  4BKT A;  2J0M A;  1YOV B;  2ZJD A;  3AMZ A;  4DXF A;  3QX1 A;  5FK9 C;  4AOF A;  2K39 A;  4HCP B;  3RYT A;  1TIF A;  4P7I A;  4GLS C;  1DYQ A;  1GB1 A;  1BUI C;  1HA5 A;  2J53 A;  1I4Q A;  2V1Y A;  3AE8 B;  4DBG A;  2WHI A;  4FJZ A;  3UIO B;  3BVZ A;  2PW9 A;  2BYV E;  2IO3 B;  3EA6 A;  3QK0 A;  4BBN F;  5JXV A;  1TS2 A;  2D2Q A;  1E90 A;  2VZK D;  4IKG A;  4XGA B;  4CQN A;  1I35 A;  2WXF A;  2Y5P A;  4FXC A;  4ANX A;  1WZ3 A;  5CHW A;  4ZOH C;  4RH6 A;  3MTN B;  4AJW A;  1C4A A;  4L1B A;  3APF A;  2J7Q B;  4RNA A;  1V9J A;  1X1M A;  4WAA A;  2JRI B;  4CO7 A;  2M17 A;  1D5Z C;  3QQ8 B;  5DCN A;  3CIR B;  5G55 A;  1Y8R C;  4P6V F;  4MGK E;  3WAO A;  2JWU A;  1V1O A;  1YIW A;  1RAX A;  2LGD A;  5J18 A;  3HUI A;  1XQQ A;  2CHX A;  2IGH A;  1FNV A;  1SE9 A;  2JVC A;  1L4D B;  3DVN U;  4LCD E;  1WM2 A;  3SDL C;  1D3Z A;  1HEZ E;  2KO3 A;  1QIL A;  2QCZ A;  4G11 A;  2GOW A;  4K1R B;  3KVF B;  1IBX B;  2MBO A;  1EU4 A;  3B08 A;  3RNG C;  1D6E C;  3TCA A;  4MDK E;  1WJU A;  3NY5 A;  4KDL B;  2LI5 A;  3JYU A;  4HLE A;  2PLP A;  2A5U A;  4E3C A;  2INC C;  1CK1 A;  4PS8 A;  1GAQ B;  4LDT D;  2CJO A;  4UDU C;  3RNA C;  5IKC M;  1WMH B;  2KDI A;  3O13 A;  3QA8 A;  2IY1 B;  1C9F A;  3VXW A;  3GE8 C;  4CHK A;  4KV2 A;  3VTW A;  1OQQ A;  5EE0 A;  4HCN B;  1J8C A;  1E10 A;  4G0N B;  3S2A A;  1FRR A;  4TKN A;  3FC4 A;  2KFK B;  2KLC A;  1TY0 A;  5L95 C;  2HJ1 A;  3VHT C;  3ZLZ A;  2WQY B;  3PHW B;  4ANU A;  3L13 A;  3X0W A;  2LEK A;  1JWM D;  1QOA A;  4PT5 A;  3HK0 A;  3V3X A;  3T9L A;  3IAM 1;  4GDK B;  2MP2 A;  5BMH A;  3BII D;  2W82 A;  2OED A;  5DPR A;  1GG3 A;  3BK1 A;  2LGS A;  1TKG A;  3L4P A;  1VZ7 A;  2N7J A;  2QMT A;  5T8I A;  1JML A;  1VZ6 A;  1YNT E;  1N63 A;  1UEL A;  2MBQ A;  2FCM A;  1F2R I;  1Y56 A;  2QIL A;  1QF6 A;  3KWL A;  2C60 A;  4NJ6 A;  1P98 A;  2JF5 A;  1UGJ A;  4Q2J A;  1AYF A;  3NUH B;  1WH3 A;  4RM9 A;  2Y5C A;  2DZM A;  4B95 A;  4TQ0 A;  3NS1 A;  2OHF A;  3AE7 B;  3RZW C;  2BT6 A;  3RCZ A;  1MI0 A;  1Q5W B;  5C23 A;  1IGC A;  2NBU A;  3TSS A;  3P1M A;  2NPT A;  2HD5 B;  1TZO A;  2UWQ A;  2D3G A;  3Q69 A;  4LNN A;  2KDE B;  3ZKJ C;  3I57 A;  3ONS A;  2WXN A;  1FFU A;  3A33 B;  1XCQ L;  1TS5 A;  1T5X D;  2C7N B;  3RD2 A;  2GB1 A;  2KAJ A;  1PYW D;  4YSZ B;  3H6N A;  1E8Z A;  1C4C A;  4C00 A;  3R2T A;  4US9 A;  2Y3A A;  4PS7 A;  3KUD B;  3SFD B;  4KKJ A;  2X8X X;  3TEY A;  1VJK A;  3IT4 B;  4M02 A;  2LAS A;  2G3Q B;  3QCA A;  4EE2 A;  3ZYY X;  2MQJ A;  4W9E A;  3U8Z A;  3PSE B;  5C2T B;  1C79 A;  1V5T A;  1YX6 B;  1C4P A;  3AV8 A;  2JPH A;  4M8M A;  1BT0 A;  1GNU A;  3JSV B;  2J0J A;  4BAX A;  1TS3 A;  4KZC A;  3MC0 B;  2DHZ A;  5LNK 1;  3IXS A;  1OFF A;  3ZRF A;  4K3B A;  2PPH A;  5IAA C;  2XNA C;  2J4X A;  1C77 A;  4IM2 A;  4WQM A;  2R61 A;  3Q8E A;  3H9D A;  1I42 A;  3HIZ A;  4IG7 B;  1TTN A;  3VH3 B;  3WCQ A;  3AM9 A;  2JQR B;  2KJH B;  3GP7 A;  5DPT A;  1ET9 A;  2V4L A;  4AS1 A;  3K9P B;  4LNF A;  1WF9 A;  2CKH B;  5BYQ A;  2LVQ A;  2ONQ A;  5L83 A;  2WGS A;  1PGX A;  1I7H A;  1OEY J;  3VR9 B;  3N1X C;  4D2K A;  1R4N I;  3PPA A;  4NAW B;  1ZKH A;  3PZD A;  5FR3 A;  1YX5 B;  4RGM A;  5BYR A;  2ZVO A;  1N60 A;  1JWB D;  2AX5 A;  4B6W A;  2LRU A;  4YSY B;  3KYD D;  1XXG A;  2PE9 A;  4GSW A;  4ZRK A;  4A9A A;  1JQ4 A;  3Q14 C;  3GZN I;  3U30 A;  2H89 B;  2MLB A;  3DCG A;  2M56 B;  3UIP B;  1L0V B;  3AEG B;  1F77 A;  3OJ4 B;  2KTF A;  2BB5 A;  3ABV B;  4XC2 A;  1L4Z B;  3ZIM A;  1M4V A;  1PUT A;  1UD7 A;  2AYO B;  2SEB D;  2AL6 A;  1IBX A;  2WXO A;  2V3S A;  1YJJ A;  5DPS A;  2L00 B;  2NBV B;  3U2S C;  4WIP A;  1N62 A;  4N58 A;  1VRA B;  5EE3 A;  4XX5 A;  2K1F A;  2BBC A;  3TBL D;  4B0E A;  2LUM A;  3H7P B;  3PT2 B;  4A8X C;  3KYC D;  1WMH A;  3IT6 B;  2J0K A;  3WAP A;  2WDQ B;  3E56 A;  5AEK B;  1J7A A;  3GOE A;  1NEK B;  4LNI A;  2KFK A;  2EKE C;  2C5L C;  2L0F A;  2LWP A;  3NJT A;  1B9R A;  3ZNH B;  3DHG C;  3VAW A;  5KHQ A;  2PMV A;  2V0G A;  1NDD A;  2FE8 A;  3ZNZ B;  3J9C A;  3PGE A;  3AEC B;  4GDK A;  1N5X A;  3RN9 C;  2IBI B;  3M62 B;  5FKA C;  2LVP A;  4II2 B;  5TSS A;  4A90 A;  2KWU B;  3M63 B;  2A4Z A;  4WH4 A;  3VRB B;  3ZQ4 A;  1UNS A;  4WAF A;  4MEL A;  4DHZ E;  3T3N A;  2LD9 A;  3I9V 1;  4ARI A;  4GOC A;  3DHH C;  4HXD A;  3BK2 A;  1WYG A;  1ZW7 A;  2K9X A;  4OVV A;  1PQS A;  4L2Y A;  2ZNV C;  4ANV A;  2YLM A;  3ZNI D;  2BS4 B;  5HHD G;  1T3Q A;  2AQ2 B;  1WXM A;  4GXB A;  3AE3 B;  1JRO A;  3UIN B;  2GI9 A;  3DBH I;  2KAN A;  3AN1 A;  2VZK B;  1FEH A;  2N1V A;  3A9J B;  1QZE A;  2KN4 A;  2K22 A;  3P42 A;  3B1L X;  2OOB B;  2EEL A;  1E9M A;  4WWM A;  1SGH A;  5HI1 A;  3MJ5 A;  2TSS A;  3NZ3 A;  4I6P A;  2BKF A;  2WLB A;  1WE7 A;  1HXY D;  4HJK A;  3IFW B;  1J19 A;  2KMA A;  3NRZ A;  4C80 A;  4W9D A;  4HDO A;  4JPS A;  1YQB A;  2MA9 B;  1WGD A;  1OEY A;  1LXD A;  3IHP C;  1F2R C;  4ANW A;  3FIL B;  1C76 A;  1RWS A;  2WXK A;  2MBE A;  2WXG A;  1E7U A;  2BQQ A;  4AQ7 A;  3TJP A;  1KLU D;  2NCN A;  1J7B A;  4MT5 A;  3JSV A;  2KXJ A;  2G45 B;  1NI2 A;  3N3K B;  3BZD B;  3ZRC A;  3T3O A;  1WGR A;  3JVZ X;  3KLS X;  2MW5 A;  3R8B A;  2D10 A;  5D3D A;  2QEJ C;  1SIJ A;  1MPE A;  3LB8 C;  4P1B C;  2RPQ A;  4W9C A;  3AEA B;  3HM6 X;  2ASQ A;  1V86 A;  1I4X A;  5JHB A;  2JZP A;  1PDX A;  2R2Q A;  3AXC A;  3U52 E;  1P1A A;  1JWA D;  1GUA B;  2RGF A;  3NVV A;  1F1H A;  2BKR B;  3PHX B;  2IND C;  4LDT B;  1KH0 A;  2LGX A;  3VDZ A;  4XWW A;  3VUW A;  3WAL A;  2JWZ A;  3N1Y C;  5E6N A;  2QIE B;  1I4H A;  4NY0 A;  1HZ6 A;  2MX2 A;  2K3U A;  4XWT A;  1B1Z A;  2JY6 A;  4YXD B;  4HRS A;  4NAW A;  3SHQ A;  2BVC A;  1XLQ A;  4GGQ A;  1EF5 A;  4IWQ A;  3ZXV A;  4B9K A;  3ZXR A;  1SBB B;  5G5H A;  2WWZ A;  4AP4 C;  3NVW A;  5C3J B;  5JH5 C;  2KK8 A;  2D3A A;  2RSU A;  2RMM A;  1YD8 U;  2PVG C;  4XYC A;  2L1A A;  1HE8 A;  3HHM A;  2BYF A;  3QWZ B;  1SJE D;  2LGI A;  1V81 A;  2DNF A;  1AN8 A;  3TMP B;  4YT0 B;  1KTK A;  2ZW0 A;  5HG2 A;  1F9J A;  3D32 A;  2M0X A;  4NZL B;  4ZHP A;  4WQO B;  1NYR A;  3UF8 A;  3QHT A;  5D2M B;  4K7S A;  4IM0 A;  3IAS 1;  4FHK A;  4AJY B;  4EEW A;  3A4S C;  3H7P A;  2PJH A;  3LJ3 A;  4KZ0 A;  3T8M A;  3KUZ A;  2N1W A;  4HVB A;  1DOI A;  3URY A;  4GB9 A;  2HTH A;  3LDZ E;  1R7S A;  1KLG D;  1K52 A;  1GC6 A;  1WY8 A;  3Q8F A;  2ZCB A;  2ACZ B;  2UYZ B;  5G5G A;  3R2I A;  1T6B X;  2AQ3 B;  2LZ6 A;  1QOF A;  3ZJV A;  2JZZ A;  4RM8 A;  4C56 C;  2C7H A;  3BIN A;  1VLB A;  2I2Y A;  1XCT L;  1JRU A;  1UWX A;  2XK5 B;  1WJ6 A;  3UGB B;  4BKS A;  3LXF A;  2RDB C;  2MJD A;  2O6V D;  4WWN A;  2FCS A;  4ACF A;  2LJI A;  1UF0 A;  4NJ7 A;  1QT9 A;  3VFK A;  3DBS A;  4TSS A;  4GDL B;  1S1Q B;  2IPK D;  2KQ7 A;  5J17 A;  1UGM A;  1N61 A;  1SIF A;  3L17 A;  2IZV B;  1QKZ A;  2LUE A;  2KVZ A;  4JWS C;  3CMM B;  2ZCC A;  3AU4 A;  2G1E A;  2CR5 A;  1L0Y B;  1XLN A;  3AE6 B;  4R3D A;  2HE7 A;  3Q8B A;  2IY0 B;  2GMI C;  1LGR A;  3FAH A;  4OZB A;  2EKI A;  3RNC C;  2WNM A;  2ZVN A;  3CST A;  3A9J A;  2FIF A;  2HDE A;  5BO4 B;  5HKH A;  1XD3 B;  3OG5 A;  1MFW A;  3V62 A;  3KWV A;  5AZG A;  3RT3 B;  2DZJ A;  4ZRQ A;  2CU3 A;  3MJW A;  2CJN A;  2FNJ B;  4LJP B;  3A4R A;  3KQ4 A;  3GS2 A;  4ICV A;  3QC8 B;  4IDI A;  3I3T B;  1ZXI A;  3N9Y C;  2D07 B;  1G6J A;  2WXI A;  3M3J A;  3FIL A;  5AUK A;  1HZ5 A;  1YMH E;  2HJ8 A;  2BWF A;  3P63 A;  2M19 A;  4M01 A;  2DAF A;  2KQS A;  3UI3 A;  3Q3O C;  1E5W A;  1OQR A;  1P7F A;  2KAC A;  4PK1 A;  2EMS A;  3GE3 C;  2KD0 A;  5AZF A;  2DYM A;  2WU2 B;  1R4M I;  3PO0 A;  3DWG C;  2BWE S;  3RMK C;  4W9K A;  5I4D A;  5IN7 A;  2BF8 B;  2OJR A;  1OTR B;  3Q3F A;  1ZDX A;  3ECI A;  4EZK A;  2LHE A;  3WAN A;  1ESF A;  2MJE A;  5BMG A;  2GLS A;  4YTM B;  2QJL A;  2LVO A;  1WGY A;  2VH2 A;  2N7E A;  1L0X B;  2LJ5 A;  2YEP F;  2N9L A;  2VH1 A;  1C78 A;  2L0T A;  4WWP A;  4DDG D;  4MSQ B;  3PRE A;  4LJO B;  2KNB A;  4EZL A;  1V1P B;  1GJZ A;  4G50 A;  1PGA A;  1QOB A;  5HFY A;  4ZHO A;  4HEA 1;  4HRO A;  1WYW B;  3B2G A;  1TZ1 A;  4MJS B;  1XLO A;  1QQR A;  1N6Z A;  1ZP0 B;  3CWI A;  4O1N A;  1FIQ A;  4DHZ B;  2G9H D;  3RUI B;  3I63 C;  1WWT A;  4HPP A;  4M0W B;  4XZ4 A;  1HTO A;  3M95 A;  1I4G A;  5EDS A;  4NNJ B;  3W9C B;  4IC7 B;  2KJR A; 
#chains in the Genus database with same CATH homology
 2DBY A;  1GB1 A;  1BUI C;  2WU5 B;  3W5U B;  3T3N A;  1FNW A;  4JE3 B;  1HA5 A;  3I9V 1;  4ITK A;  2LFI A;  4ARI A;  2J53 A;  2KWD A;  3AE9 B;  3GB1 A;  1I4Q A;  3BK2 A;  1WXQ A;  1WYG A;  1AW7 A;  1NYQ A;  4RGT A;  1GB4 A;  1YN3 A;  3AE8 B;  1VDV A;  2K9X A;  1ROE A;  1YN5 A;  1BML C;  4L2Y A;  4C7Y A;  3NVZ A;  1EM7 A;  1JCK B;  3BVZ A;  2PW9 A;  3EA6 A;  4YTN B;  1PGB A;  1IUE A;  2QSD A;  5JXV A;  1TS2 A;  1XLP A;  1KF6 B;  2PIA A;  2VZK D;  2BS4 B;  2IGD A;  4IKG A;  5HHD G;  3EGR A;  1T3Q A;  4CQN A;  2AQ2 B;  5D7G A;  2WXF A;  3AE3 B;  1JRO A;  2Y5P A;  4FXC A;  2HTM E;  2GI9 A;  3AN1 A;  1YQ4 B;  2VZK B;  4ZOH C;  1SE4 A;  4RH6 A;  2RDG A;  1C4A A;  4RGN A;  1FEH A;  5EE1 A;  4L1B A;  3H8H A;  3P4Q B;  1WGK A;  2KN4 A;  2K22 A;  1DGJ A;  3P42 A;  4RNA A;  3PZ7 A;  1TKY A;  2EEL A;  1E9M A;  4WWM A;  5HI1 A;  1WSP A;  3V05 A;  3MJ5 A;  2J52 A;  4WUR A;  3PZ8 A;  1FXA A;  2TSS A;  3NZ3 A;  4ARC A;  2WLB A;  1D5Z C;  1HXY D;  1GOZ A;  1CQV A;  3CIR B;  1RM6 C;  3NRZ A;  4C80 A;  4P6V F;  4JPS A;  4RFB A;  2X38 A;  3HVZ A;  4RCO A;  2JWU A;  3TUO A;  3VQI A;  1V1O A;  2WXR A;  4HJG E;  1Q10 A;  2KMM A;  1F2R C;  2NTT A;  2W55 A;  3FIL B;  3B2F A;  2WXH A;  1C76 A;  1RWS A;  2V3N A;  2KDM A;  2WXK A;  3ZJT A;  1YJI A;  3HUI A;  2WXG A;  2RDH A;  4NAM A;  2IGH A;  1FNV A;  4AQ7 A;  1FM0 D;  2WDV B;  2N0S B;  3AEF B;  1KLU D;  1J7B A;  4MT5 A;  1ACC A;  1L4D B;  5H8Y E;  3AE4 B;  3BZD B;  1HEZ E;  3T3O A;  1UWM A;  1QIL A;  3KLS X;  3R8B A;  5D3D A;  2RPV A;  2QEJ C;  1SIJ A;  1MPE A;  2WS3 B;  3LB8 C;  4JX1 C;  2IDY A;  1IBX B;  4OZC A;  1TS4 A;  3AEA B;  1EU4 A;  4A6Q A;  1D6E C;  4XE0 A;  2MJ3 A;  1I4X A;  5D3I B;  4A55 A;  2JZP A;  1PDX A;  2PLP A;  3U52 E;  1CK1 A;  1GAQ B;  4ZRP A;  1JWA D;  2L52 A;  2ON8 A;  1PFD A;  2CJO A;  3NVV A;  4UDU C;  2PTL A;  3O13 A;  1C9F A;  3BVM A;  2IGG A;  3W2D A;  1OQQ A;  5EE0 A;  4YTP B;  1KH0 A;  4XWW A;  1MHH E;  1N5W A;  1TJE A;  4NJC A;  2IJ0 A;  1STE A;  4MAC A;  1E10 A;  1FRR A;  2QIE B;  1EWY C;  3FC4 A;  1I4H A;  2W3R A;  1TY0 A;  2ZW1 A;  4XDC A;  1HZ6 A;  3VRA B;  2K3U A;  1A70 A;  1NVI D;  2WDR B;  4N6E B;  4XWT A;  2WQY B;  1FNU A;  1WRI A;  1B1Z A;  1KFY B;  4YXD B;  4HRS A;  2MH7 A;  2LEK A;  1JWM D;  1QOA A;  1RFK A;  1XLQ A;  2ICI A;  4PT5 A;  3TEW A;  1DOY A;  3HVD A;  3V3X A;  1QLB B;  1SBB B;  3IAM 1;  4GDK B;  5G5H A;  1NI3 A;  5BMH A;  3BII D;  2W82 A;  2OED A;  3NVW A;  3BYY B;  1XEE A;  5C3J B;  3W5V B;  5EE9 A;  1I4P A;  2LHD A;  3BK1 A;  1TKG A;  3L4P A;  1VZ7 A;  1NEN B;  2N7J A;  1E7P B;  2QMT A;  5T8I A;  1JML A;  3AE5 B;  1JWU D;  1VZ6 A;  2L83 A;  2RMM A;  1YNT E;  1N63 A;  2JX5 A;  2PVG C;  3B9J A;  1TKE A;  2L1A A;  1JRP A;  1JW9 D;  3SR6 A;  1EWC A;  4OVZ A;  1F2R I;  1Y56 A;  4C7Z A;  2QIL A;  1QF6 A;  1V8C A;  3KWL A;  1SJE D;  2WXP A;  2LGI A;  3AB5 A;  1TY2 A;  4J3O D;  1AN8 A;  1UGJ A;  4Q2J A;  4YT0 B;  1KTK A;  1AYF A;  3NVY A;  2NMQ A;  2ZW0 A;  1KRH A;  5HG2 A;  3NUH B;  2WXL A;  2SAK A;  1SE3 A;  2Y5C A;  4NZL B;  1YQ3 B;  1IGD A;  4ZHP A;  4TQ0 A;  3NS1 A;  2OHF A;  1MHX A;  3AE7 B;  1NYR A;  1FO4 A;  2BT6 A;  1MI0 A;  4RF1 A;  1ENF A;  1L6U A;  1IGC A;  1AWD A;  4KGT A;  2BB6 A;  3AE1 B;  1DOX A;  3IAS 1;  3TSS A;  3P1M A;  3W1S A;  1TZO A;  2M0A A;  3Q69 A;  2V4I B;  3OWE B;  3I57 A;  1RYJ A;  2WXN A;  1DOI A;  1FFU A;  1XCQ L;  1E0Z A;  3URY A;  1TS5 A;  3C8Y A;  4LK0 M;  1R7S A;  1V1P A;  4RF0 A;  1T5X D;  2GB1 A;  1ET6 A;  1KLG D;  1K52 A;  2KAJ A;  1PYW D;  4YSZ B;  3Q8F A;  1C4C A;  1CJE A;  2ACZ B;  5G5G A;  1SSN A;  3R2I A;  1K51 A;  1T6B X;  3R2T A;  2AQ3 B;  2E6X A;  1QOF A;  3ZJV A;  4US9 A;  2Y3A A;  2DLB A;  3SFD B;  4KKJ A;  1JAL A;  4C56 C;  3TEY A;  1VJK A;  1ZUD 2;  4IOI E;  3IT4 B;  1V97 A;  1I4R A;  1VLB A;  2J42 A;  2I2Y A;  4KX6 B;  1XCT L;  2L32 A;  1UWX A;  4EE2 A;  3ZYY X;  1FCC C;  2LMC A;  3Q8C A;  2V3P A;  4HKZ E;  1ZPS A;  4TQ1 A;  4HKQ A;  3LXF A;  2MJD A;  2BW2 A;  4M0W A;  5C2T B;  1C79 A;  4TMA B;  2WXJ A;  1C4P A;  1ZOY B;  2AQ1 B;  3MP9 A;  5H92 C;  3AV8 A;  2LJI A;  3BYT B;  1QT9 A;  2WP9 B;  4DXG A;  1TS3 A;  1FMA D;  3MC0 B;  5LNK 1;  4TSS A;  4GDL B;  1ZE3 D;  3IXS A;  3LYY A;  1OFF A;  2IPK D;  1ZXH A;  3MFG A;  2INP E;  1SF0 A;  2BS3 B;  1UUP A;  4N59 A;  3U7Z A;  1N61 A;  2XNA C;  2J4X A;  1C77 A;  1QKZ A;  4WQM A;  1F0Z A;  2R61 A;  3Q8E A;  4XDD A;  4JWS C;  4P16 A;  2G1E A;  2KQ4 X;  2BS2 B;  4MH8 A;  1VR9 A;  2JU6 X;  4L23 A;  2PKO A;  3Q8A A;  4KGR A;  1L5P A;  1L0Y B;  1D5M C;  1XLN A;  1QOG A;  2NTS A;  1FCL A;  4OW0 A;  3AE6 B;  3BVG A;  3WCQ A;  2BYT A;  4R3D A;  3AM9 A;  2JQR B;  3GP7 A;  1FXI A;  3Q8B A;  3ZJU A;  3HRD D;  4LTU A;  4OHJ A;  2FBW B;  1D5X C;  3FAH A;  4RGO S;  5E6J A;  4KKI A;  4OZB A;  1ET9 A;  2EKI A;  4AS1 A;  1ZDV A;  2WNM A;  2FUG 1;  5BYQ A;  2HDE A;  2ONQ A;  1PGX A;  1I7H A;  3TEX A;  4DQO C;  3VR9 B;  3AEB B;  1LO5 D;  1P7E A;  3KWV A;  4D2K A;  2JXT A;  2W3S A;  4ZRQ A;  1FFV A;  4NAW B;  3MHZ A;  2CU3 A;  2CJN A;  2WXM A;  5FR3 A;  2DWQ A;  3KQ4 A;  3P4S B;  4RGM A;  5BYR A;  3GS2 A;  1CZP A;  2D5G A;  4USA A;  1N60 A;  1JWB D;  2AX5 A;  2H88 B;  4IDI A;  3AH7 A;  1ZXI A;  4YSY B;  3N9Y C;  1L6V A;  1XXG A;  5AUI A;  1J7C A;  2WXI A;  4YWG G;  4A9A A;  3P4R B;  1JQ4 A;  2Q5W D;  1K53 A;  5GXG B;  3FIL A;  3AED B;  2H89 B;  5AUK A;  1HZ5 A;  1YMH E;  1BXT A;  2MEK A;  3TEZ A;  2M56 B;  3P63 A;  1YN4 A;  2M19 A;  3SEB A;  1L0V B;  3AEG B;  1F77 A;  3UI3 A;  1SB3 C;  3EUB 2;  3ETR A;  5MPO A;  1FRD A;  2BTE A;  2BB5 A;  2XN9 C;  1OQR A;  1P7F A;  3ABV B;  3DWM A;  2KAC A;  1L4Z B;  2INN E;  3RPF C;  1M4V A;  1PUT A;  2DYM A;  1XF5 L;  2WU2 B;  2SEB D;  3VR8 B;  3PO0 A;  3DWG C;  1IBX A;  2WXO A;  5I4D A;  2DYO A;  1YJJ A;  3ZGZ A;  1ZDX A;  4H2A A;  1SJH D;  2LHE A;  3SFE B;  3U2S C;  4WIP A;  1N62 A;  1ESF A;  2MJE A;  1HQR D;  4N58 A;  5BMG A;  4YTM B;  4OZA A;  4US8 A;  1VRA B;  2QJL A;  5EE3 A;  4JWU C;  1XO3 A;  2BBC A;  4B0E A;  3AE2 B;  5BMI A;  1SE2 A;  2GRI A;  2I38 A;  3U4E G;  2LUM A;  4MM3 B;  3P4P B;  1L0X B;  4A8X C;  2YEP F;  1EU3 A;  2N9L A;  1C78 A;  4REZ A;  1MVK A;  3IT6 B;  1GPX A;  2JYT A;  2JSV X;  2WXQ A;  1SEB D;  2WDQ B;  3E56 A;  1J7A A;  2Z8L A;  1V1P B;  1K50 A;  1NEK B;  2K5P A;  3RFZ B;  4B0M A;  1PGA A;  1QOB A;  1TYG B;  5HFY A;  2E3T A;  4LLG M;  4ZHO A;  1E6E B;  4YSX B;  2K0P A;  4HEA 1;  4HRO A;  1B9R A;  2PMV A;  3B2G A;  4ZYS A;  2PVO D;  2V0G A;  1FD6 A;  2FE8 A;  3AEE B;  4KGS A;  3J9C A;  1VZ8 A;  1JWS D;  1D4B A;  1XLO A;  1QQR A;  2N9K A;  5BYS A;  1ZP0 B;  3CWI A;  4O1N A;  1FIQ A;  3AEC B;  2W54 A;  1N5X A;  2G9H D;  1SXT A;  3BWU D;  3E9S A;  5FKA C;  2YEP B;  1WWT A;  4A90 A;  5TSS A;  4WH4 A;  2JYE A;  1I4G A;  3AMZ A;  3VRB B;  4DXF A;  3W9C B;  5FK9 C;  3ZQ4 A;  1UNS A;  4WAF A;  2B76 B;  4GLS C;  1DYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...