1JW9D

Structure of the native moeb-moad protein complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
publication title Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2001-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jw9D00
2MJ3A 1XLQA 3P1MA 3AEFB 4ZOHC 2BS2B 2W54A 3W5VB 1UWMA 3NVYA 5C2TB 3BIID 5GXGB 3P4PB 1ZXIA 1TKYA 3AH7A 1KRHA 4YTNB 1EWYC 2WDQB 1WWTA 2CU3A 2DBYA 4C7ZA 1V8CA 2OHFA 1JWBD 2K22A 4US8A 5C3JB 2LEKA 1FRDA 1XLNA 1VJKA 3AM9A 1KFYB 3HUIA 1GAQB 1YQ3B 1XLPA 5EE3A 3HVZA 1DOXA 2QIEB 3AE8B 2L83A 3FAHA 1WRIA 3P4RB 4C80A 3AE1B 3DWGC 5EE0A 2WP9B 1NYRA 1PUTA 2W55A 1E9MA 3PO0A 5G5HA 1FO4A 1NVID 2MJDA 1T3QA 3VRAB 1CZPA 1AYFA 1QLBB 1ZOYB 3AEDB 4N59A 4ZHPA 1FFUA 1OQQA 1YJJA 1JALA 3VR8B 1ZUD2 3AE9B 1L0VB 2M19A 1E10A 1QOGA 1QOBA 1L5PA 2Q5WD 2K9XA 1QT9A 2ACZB 4US9A 2W3SA 3AN1A 2JX5A 5MPOA 1NYQA 1RWSA 1R7SA 3AEGB 1E7PB 1FIQA 2WU2B 1IUEA 3CIRB 3LXFA 2BS3B 3SFDB 1F0ZA 3AE2B 3AEAB 3HRDD 1FFVA 1N60A 2KAJA 4JWUC 2M56B 4YSYB 2BS4B 3CWIA 1TKEA 2B76B 1WGKA 1N62A 1ZP0B 3AE7B 1J7BA 4KX6B 2WLBA 5EE1A 3RPFC 1QF6A 1DOYA 1J7CA 5H92C 1FMAD 1FXAA 5AUIA 2JQRB 1FM0D 1RFKA 2G1EA 3B9JA 2Y5CA 1JQ4A 2CJNA 2H88B 2PVOD 1L6VA 1XLOA 1FRRA 2N0SB 3AE4B 1E0ZA 2PIAA 3P4QB 1GPXA 4JX1C 4YT0B 3DWMA 3NRZA 1QOFA 2MH7A 2PKOA 1DOIA 2E3TA 1B9RA 1SIJA 1WXQA 3NVVA 3P63A 1N5XA 1TJEA 1N5WA 1RYJA 1KF6B 1PDXA 1TKGA 2DWQA 3EUB2 3NVWA 4A9AA 1N61A 2W3RA 1L6UA 4YTPB 2MJEA 4LTUA 1OFFA 1E6EB 2EKIA 3KWLA 3NS1A 1QOAA 2K5PA 3ABVB 3ETRA 1RM6C 3AMZA 4IDIA 5H8YE 1I7HA 4YTMB 1FXIA 1A70A 1YQ4B 3B2GA 1PFDA 3ZYYX 5AUKA 1J7AA 1XO3A 3W9CB 1TYGB 3AE3B 4WWMA 3WCQA 1SF0A 1ROEA 2AX5A 1N63A 1NEKB 2H89B 4ZHOA 1JWAD 4USAA 4N58A 1NI3A 4HROA 3P4SB 1V97A 2WU5B 3AE5B 4YSZB 1CJEA 1JROA 2PVGC 2WDVB 2KMMA 3AB5A 3AE6B 1VDVA 1YJIA 2CJOA 3L4PA 3VRBB 3FC4A 3W5UB 2QJLA 2L52A 2WQYB 2WDRB 2WS3B 3AECB 4N6EB 1JRPA 3AEBB 1VLBA 4FXCA 3NVZA 4YSXB 3AV8A 4YXDB 2BT6A 5EE9A 1SB3C 3SFEB 3VR9B 4JWSC 4WQMA 3AEEB 4HRSA 3LB8C 5G5GA 3SR6A 1OQRA 4C7YA 1WYGA 2FBWB 3B2FA 1DGJA 1JW9D 1AWDA 4P6VF 2HTME 1NENB 4ITKA
chains in the Genus database with same CATH superfamily
3VDZA 1V1PB 2BKRB 2N1VA 1WWTA 2K6DB 5C3JB 1TT5B 1FRDA 1ET9A 3U4EG 2N7DA 4BVUC 4ICUA 1GAQB 1I4PA 3P4RB 4MGZE 1GUAB 2CHZA 3GP7A 2G4SA 1CZPA 1AYFA 4W9DA 1ISNA 2IZVB 4ASWC 1YJJA 1GC7A 1L0XB 2KFKB 2W3SA 3RUIB 4RF0A 3LXFA 2N9XA 2KWVB 4EE2A 2YVCA 2V0GA 4EEWA 2JRHA 4E74A 4C56C 3IHPC 3N1YC 4QAYA 1WH3A 2CJNA 2N0SB 2HTHA 4CHKA 4YT0B 3B08A 1YD8U 2PKOA 3APDA 4JQWC 2J52A 3BWUD 2L32A 4FADA 1WR1A 1TKGA 1V80A 2DWQA 3A4SC 1P7FA 3Q2AC 3E9SA 2W3RA 2MBEA 2KDBA 2IGGA 4O1NA 2J0JA 5H8YE 4DK5A 3B2GA 3R8BA 2QEJC 4DHZE 1J7AA 2KLCA 1FEHA 1TY2A 2J53A 2V4IB 1QILA 4ZHOA 3DDCB 2XNAC 2X38A 4RFBA 3K9PB 1YJIA 4N6EB 5BO4B 4BAXA 1SB3C 3NZ3A 1TS5A 2RDBC 1MHHE 5G5GA 1OQRA 1WYGA 3LYYA 4FHJA 2IO3B 4P6VF 1EM7A 2WXMA 3QIJA 1YNTE 3NVYA 2K0PA 2L0TA 3KLSX 2WDQB 3KQ4A 4KDIC 1V8CA 1SJHD 4GDLA 2KACA 3I57A 4XWWA 1XLPA 3IT4B 3ZQ4A 4KSLC 1SBBB 1WMHA 2WP9B 4GSWA 3BZDB 4FJVB 4GN1A 1L7YA 3Q14C 4W9KA 2MRPA 5JHBA 3AE9B 3ZIMA 4PS3A 3WAPA 4W9JA 2FCSA 2ACZB 2BYEA 4MGIE 4MM3A 3SFDB 1E7PB 3WALA 2C7NB 1WF9A 3CWIA 4G50A 2B3AA 3BYYB 2E6XA 4NJ6A 2A4ZA 2C7MB 3NZUA 3ZJUA 3KWVA 2O2VB 4KGSA 4JIOU 4RH6A 2GLSA 3ZDTA 4ARCA 1E7UA 3TEYA 4RGNA 2BF8B 2QHOA 1JWUD 3GS2A 2DLBA 1YIWA 1SE2A 1A70A 1C1YB 2WYQA 3WCQA 1IPGA 1GG3A 3ZNHB 5HFYA 2TSSA 2WDVB 4HKZE 3W5UB 2KQSA 2BBCA 2WDRB 4XWTA 2INNE 2Z59B 1V9JA 4ZDVA 2PEAA 1WR6E 3SR6A 4KZCA 2A5UA 1V5TA 1WZ3A 2DNFA 1XLQA 2JWUA 2CHXA 3KH0A 3ZXVA 4TSSA 4JPSA 1I4HA 4M01A 2JWZA 3L13A 4PT5A 2JZ3B 4AJYB 4DDGD 1WXAA 2PPHA 2QIEB 3AE8B 4IM0A 4MGKE 1LQBA 3C19A 3SEBA 2IO0B 3DBRI 3A9KB 1NVID 1VZ7A 3P2BA 3SHQA 1SGHA 5IAAC 4ZHPA 5C1ZA 2M17A 4IM2A 3PVLA 1ZXHA 3BY4B 2K9XA 2L7RA 3V60A 3HK0A 1TS2A 2KAJA 1XT9B 3RPFC 2ZNVC 2KFKA 3IBEA 1I4GA 1TGZB 2FIFA 3RI7C 5JZEB 3ONSA 1EF5A 4ANUA 1DYQA 3LDZE 3CSFA 3ZJVA 1GC6A 3UIPB 2MJEA 2INCC 2OJWA 3KWLA 4MH8A 4RM9A 4IDIA 3VH4B 4BZAA 4FJZA 2HJ1A 3VQIA 1Q1OA 3ZNID 3N30A 2PE9A 3S2AA 4ZYNA 3ZYYX 1XD3B 1SIFA 3L10B 4D2KA 1N63A 1GB1A 2LGIA 4B9KA 4IWOA 2PVGC 2LVQA 2HD5B 2V3SA 1WY8A 1BXTA 2L76A 2IDYA 2RR9A 3AV8A 2KNBA 1P7EA 1V81A 3SD5A 1U4AA 1EUVB 4LNKA 4JL9A 2MEKA 1X1MA 2D07B 2MJ3A 4ACFA 4OHJA 4F8CB 2YEPF 3PV1A 4HPPA 4P1CC 1C4AA 1ZXIA 4WURA 1C4CA 2GBMA 2VZKB 4REZA 2KWCA 3V61A 3EFUA 4HXDA 2LWPA 4HPMB 2M4NA 1F2RC 2IO1B 4LK0M 3EC8A 3RNAC 4MJSB 1L0VB 1QOBA 2GBJA 2MBOA 3MJWA 2BYTA 2KTFA 3GB1A 1VRAB 2KKCA 4JWUC 1H4RA 5FKAC 4II3B 3JSVB 1V6EA 3AE7B 1WGKA 1XF5L 4EOYA 1FMAD 2JU6X 4HWIB 1STEA 3PZDA 2JVCA 2H88B 2PVOD 3ZXRA 1FRRA 2MX2A 2D10A 3NRZA 2ICIA 3CSTA 2E3TA 4WWPA 2Z0DB 1N5WA 1RYJA 2KT7A 3MHZA 4LTUA 5AZGA 1FXIA 1WXSA 4WJPA 3AULA 1M4VA 4WWMA 3H7PB 2OJRA 1K52A 2PLPA 2M8SA 5TSSA 4N58A 1NI3A 4HROA 4HCPB 2WXPA 3R3MA 3TJPA 4LNFA 3OG5A 4BOZB 5D7GA 3UI3A 3RNGC 3IAS1 3VR9B 1SEBD 3DHGC 3AEEB 1WJ4A 2AQ2B 3TL5A 3A9JA 3QQ8B 3Q8EA 3M95A 2Y3AA 3R7RA 1R4NB 1K8RB 2FCQA 4R3DA 4DBGA 3UQAA 2IO2B 2DBYA 2ZCBA 3VVWB 2K22A 2KX0A 3TEWA 4FJYA 1EO6A 1WM2A 1UBIA 2W55A 1C3TA 1IGCA 1MHXA 3ML8A 5DPWA 3VRAB 1V1OA 1OQQA 4KV2A 1WFYA 3DBLB 4B6WA 1HEZE 2BB6A 2DZMA 4B0MA 4FLHA 3A9KA 4EZLA 1NYQA 4CQNA 4AWJA 1OGWA 3HRDD 1N60A 4YSYB 1UF0A 4M0WA 4EZKA 2B76B 2LJIA 2BYVE 4DXAB 3OJ3A 4FULA 3WANA 3EFCA 2RDGA 2G3QB 2V3NA 5HKHA 2PIAA 1UWXA 2MP2B 4JX1C 1JWMD 3U30A 1E8XA 4NAMA 3MC8A 1VZ8A 1D3ZA 1TJEA 4NJ7A 3N20C 3RNBC 1CMXB 3RN9C 3L16A 4OZBA 1OFFA 1YN4A 3L08A 4HDOA 3ENEA 4BOSC 1LGRA 5FR3A 1PFDA 1FCCC 4HLEA 4LJOB 1EWCA 3DHIC 1XCTL 1R4MB 4USAA 1J8CA 4RGMA 3RZFA 4OVVA 2LRUA 2WQYB 4WAAA 2LFIA 3V05A 2C5LC 5FK9C 3KUZA 4TQ1A 3A33B 2KDIA 2FUHB 2J4XA 5C2TB 2N4FA 4WAFA 3AH7A 2JZPA 2I38A 2ZPYA 1ENFA 1GOZA 5D3DA 3ZVVA 5L95C 2K39A 3W1SC 2REXA 3AE1B 2ZJDA 2NPTB 2UWQA 4K1RB 4N59A 4ZRPA 3RMKC 5E6JA 4MDKE 2I2YA 3VR8B 5KHQA 1ZUD2 2KMAA 2WX0A 1E8YA 3HIZA 4GDKB 2JY6A 2XBBC 4W9GA 3AN1A 4F7ZA 1R7SA 1FIQA 5G2NA 3H7SA 4A3OA 2I1KA 5CX3A 3OLMD 1UBQA 2VZKD 4KX6B 1EU4A 5C23A 4L1BA 4K7UA 2WX1A 4K7SA 1WX8A 1MVKA 4AOFA 1Y8RC 2KQ7A 3JSVA 2RGFA 4GGQA 1WXQA 4M00A 2ON8A 3ZLZA 1YN3A 1IP9A 3Q3OC 3RNEC 2W9NA 1Z5SB 4ZRJA 2O6VB 3B0AA 3KW5B 3ZKJC 3WIMA 1YQ4B 3UF8A 3A1QB 2RD0A 4E3CA 1I4RA 2WXJA 2CKHB 4HEA1 2MSED 3QARA 3V3XA 2WU5B 3AE5B 3SU8X 4AQ7A 1F9JA 3H7PA 3AEBB 5HHDG 4WJNA 1C77A 3QHTA 4DHJD 1GNUA 2ONQA 3BVMA 2NVUI 3AXCA 3B2FA 4MEMA 1JW9D 3ZJTA 1NENB 1ACCA 2RMMA 3P1MA 2W54A 4RGTA 3C0RB 4WH4A 3RCZA 2LI5A 3QA8A 2ZVNA 2SAKA 1GJZA 1JRUA 1AW7A 2Z8LA 1P0RA 1KFYB 3GZNB 3HVZA 2KTRB 5EE0A 1PQSA 1WJUA 2BWFA 3AI5A 1V49A 1XEEA 4NPNA 3ZRFA 2LRWA 3CMMB 4BFRA 3KVFB 4S17A 4XDDA 3BVGA 2LVPA 4GB9A 2M19A 3O13A 1I4QA 5JH5C 4B95A 2AL3A 1IUEA 1Z2MA 5J2RA 2BS4B 1TY0A 1F0ZA 1QF6A 5EE1A 4NAWA 3PRZA 2MQJA 1FM0D 3QJZA 1T0QC 2ZW1A 2MW5A 4AP4C 4J3OD 2KOXA 3V6CB 3V62A 3DHHC 1KTKA 1OTRB 3D32A 4PS8A 3TEZA 2LVOA 2HDEA 1N5XA 4C4VB 3TBLD 2OEDA 1L6UA 4YTPB 2NCNA 1GB4A 1OQYA 2MP2A 2EKIA 5BYRA 4WWOA 2DYMA 1RM6C 2NMQA 2PW9A 1S1QB 2MBHA 1FNUA 2YEPB 1Q10A 2EMTA 1SF0A 4DQOC 5L83A 4ANXA 3PHWB 1CJEA 1K51A 4OZAA 3BK1A 2UYZB 2CHWA 1P1AA 2L52A 1RAXA 2WS3B 3AECB 4YXDB 4II2B 4HRSA 3KUCB 2WDTB 5D2MB 1K53A 3ETRA 4ITKA 3HM6X 1E90A 1P9DU 5HG2A 2J0MA 1D4BA 4W9IA 2WGSA 2D3BA 3E56A 3Q3JA 2X8XX 1DOXA 3TUOA 1HTOA 1PGXA 4TQ0A 3ZRCA 2XK5B 4LJPB 2K8HA 4E71A 1QLBB 1FCLA 4ZRKA 3Q3FA 1EU3A 1E10A 2W82A 2L1AA 2C7HA 2IYDB 4RF1A 3U7ZA 1R4NI 3SDLC 5IO9A 1V1PA 2BS3B 3AEAB 1RLFA 4A3PA 4KGTA 3MC0B 5LXIB 1D5MC 4GDKA 1RFAA 1MJDA 1SSNA 2L00B 3U7DA 3ZGZA 1E8ZA 1XLOA 2JZZA 2JRIB 2ZVOA 4XYCA 1T0SC 3ML9A 2PTLA 2LZ6A 2MCNB 1SIJA 2CR5A 1T0RC 2GI9A 3VTWA 1KLVA 2KDMA 5T8IA 4IOIE 2KFJA 1I7HA 1L2NA 1LO5D 5AEKB 3PREA 3JYUA 4K3BA 1TYGB 3L0WB 2DYOA 2SEBD 2KWDA 3PRMB 2BVCA 3T3OA 2RPVA 2O6VA 3P42A 4EFOA 3A1QA 1QKZA 2KD0A 3PPAA 3NOBA 1UNSA 4C7YA 2KJ6A 2CU1A 4GIVA 4MGYE 3RT3B 2AQ1B 1UWMA 1WI0A 3BIID 5FR6A 2D5GA 3W2DA 2V9HA 2O6VD 2LXCA 2BB5A 3R66C 3ZNGC 4US8A 2LGYA 1ZE3D 3MFGA 1R4MI 4WJOA 3GE8C 1YQ3B 2L3ZA 4LDTB 1HZ5A 2KLGA 1T3QA 3AEDB 1I35A 2KXJA 2KTRA 2INPE 2R61A 1E8WA 5LXHA 3X23A 4G3XB 3GE3C 3R2IA 4MELA 1XQQA 4PK1A 2M0AA 3WA0A 3IXSA 1N6ZA 1J7BA 2WLBA 2KJHB 4C00A 2JQRB 3VAWA 4FN2A 1NBFC 4P7IA 4NQKE 3Q6BA 2ZPNA 2WXQA 1TIFA 1M94A 4KKJA 2VH2A 3MHSD 4HCNB 2K5PA 2LD9A 1LXDA 4GXBA 4C4VA 2JYTA 2AL6A 2R2QA 1ROEA 2QCZA 2H89B 4G0NB 3KYCD 3DBSA 3P4SB 1JROA 1TS3A 2GBKA 2L8JA 1HXYD 5BYSA 3N3KB 1MFWA 3APFA 1YX5B 5LNK1 3Q3MC 2O2VA 2NBWB 2NTSA 5BMGA 4ZYSA 1C78A 2JPHA 4MACA 1WGHA 2JT4B 1JWBD 1VJKA 4NJCA 2N9PC 2JXTA 1WRIA 2KQ4X 2GB1A 1CQVA 2HE7A 4KDLB 1ZGUB 2MJDA 3H8HA 3PTFC 2FIDA 1HA5A 2VH1A 4Q2JA 4MSMB 2PJHA 2K8CA 2LXAA 2XK5A 2KYWA 3NJTA 3CF6E 1WIAA 2WXFA 1JCKB 1RWSA 3A4RA 3GOEA 4AJWA 2LHEA 3FILB 2D3GA 3BINA 1N62A 3Q8AA 4IC7B 2BTEA 1PGBA 3GZNI 1WX9A 4LNOA 2LJ5A 2WXOA 3TMPB 4AS1A 2RPQA 2LUEA 4NZLB 2RSUA 3P63A 1ZDVA 1PDXA 2ZNVB 3DBRB 1MG8A 2GBNA 1QQRA 4YTMB 1NI2A 2BGFA 4MH0E 3EGRA 3UINB 5CTRC 4IKGA 2NTTA 5AUIA 2AYOB 1VR9A 2L05A 3H6NA 1VLBA 3NVZA 3TSSA 1WYWB 4CO7A 1DGJA 3I9V1 4OZCA 4LLGM 3NY5A 4MM3B 4UDUC 3P4PB 2ZCCA 1EWYC 1TS4A 2LMCA 3T3NA 1XCQL 1I42A 1SXTA 4DDID 1WGGA 3U8ZA 2L83A 3NG0A 4C80A 3EECA 2DZJA 3BK2A 2DX5B 2D2QA 4HJKA 3DBHB 1KOTA 4TKNA 1VD2A 3PT2B 1QT9A 3TEXA 5I4DA 4NQLB 4YWGG 2MBQA 1HTQA 1TZOA 2NR2A 1LFDA 1D6EC 2WXRA 3PS6A 1FNVA 1IGDA 4AUQC 1FXAA 2JF5A 2Y5CA 4A20A 4KZ0A 5D6JB 1JMLA 1E0ZA 1SE4A 2LHDA 1GPXA 4LDTD 2IY0B 1F77A 1B9RA 2DAJA 5E6NA 4DHZB 1KF6B 3VHTC 4A9AA 3DVNU 4GMVA 4MJSA 1QOAA 3ABVB 3O65B 4YL8A 3AMZA 1FPYA 3ZTCA 1E7VA 5CHWA 4MT5A 1XO3A 5DPSA 1WSPA 3OAWA 4RM8A 3PHXB 3ZDMC 5D3IB 2KMMA 3R2TA 3AB5A 3U2SC 4W9LA 2QJLA 2LUMA 4RGOS 5HI1A 4FBJB 3N1ZC 3IAM1 2QILA 3M63B 3L17A 1V2YA 4I6PA 5D94A 4DXGA 2IJ0A 2KVZA 3AEFB 1LM8B 3W5VB 1KH0A 4KKIA 1KRHA 4FHKA 3VFKA 4C7ZA 1RRBA 4WQOB 3M3JA 5E6PA 4G11A 4HVBA 3Q8CA 5J17A 3EHVA 4J6IA 2KC2A 4XZ4A 4BBNC 1C79A 2K8BA 3R7QA 4A6QA 4ANWA 2K1FA 1WJ6A 2BW2A 1PUTA 2N9LA 5JHAA 2KX3A 3MTNB 1ZOYB 2V4LA 1WRDB 4KIKB 5J18A 4M8MA 2KN4A 2MWSB 2MLBA 5KHOA 2MA9B 5MPOA 1UUPA 5IP4D 2WNMA 5CHFA 4JE3B 1FXTB 3U52E 1YMHE 2I1JA 4M8NA 2BPSA 3ZTDA 1TBEA 1TTNA 3FILA 1MI0A 1ZKHA 4XE0A 2DYBA 2NBUA 1C9FA 4L2YA 1KJTA 1FNWA 3NVWA 3L54A 1N61A 2OOBB 1KLGD 5G55A 2KDFB 1ZW7A 4M02A 4HK2A 1E5WA 3NS8A 3RFZB 5AUKA 1WGYA 4LCDE 3AE3B 3NZSA 4RMAA 3AU5A 4IUMB 3UQBA 1C4PA 4YSZB 3VRBB 5IN7A 4ICVA 5BMHA 3RYTA 3HVDA 3ZNZB 2EELA 1L4DB 4JWSC 3TIXA 2KDEB 3LB8C 1BMLC 5LLIA 2D3CA 2BKFA 5AZFA 2V3PA 3KUDB 4K7WA 1Y56A 4EKUA 1IBXB 4HDQA 3AU4A 5DCNA 4HJGE 2FUG1 1MPEA 4EZJA 3DPDA 2R2OA 4I6NB 2AQ3B 4MSQB 4RCOA 4PYUA 2QMTA 3WAOA 1ESFA 2MBBB 2OHFA 3V6EB 4DXFA 2WXLA 3H9DA 4GU2A 4TMAB 2NBVB 4WWNA 3HUIA 2KMCA 2G9HD 1HQRD 3NUHB 3PO0A 1J0GA 2K25A 1L0YB 2AEHA 3VUXA 4BKTA 4ZRIA 3WAMA 3ZW3A 2Q5WD 3UGBB 2BYFA 4N9F4 3CIRB 1YN5A 3N9YC 1F52A 3AE2B 1FFVA 3OJ4B 3BYTB 5JXVA 2GOWA 2N9EB 2KZRA 2FNJB 5H92C 4XC2A 1JQ4A 3P4QB 3A9JB 3DWMA 2BWES 3T8MA 2HJ8A 2NPTA 2J7QB 4W9EA 2UU7A 1A5RA 4K81A 2XEWA 4F1SA 2PMVA 3QAQA 1UGJA 2ASQA 4WIPA 1VDVA 2CJOA 1KM7A 3I3TB 1T0YA 1WX7A 4YSXB 2WXHA 2NS5A 2BT6A 3Q69A 2MHJA 3SFEB 4WQMA 1VCBA 3DBLI 3N32A 2VRRB 2FBWB 1HZ6A 1T5XD 3DCGA 4OVZA 2FCMA 1WXVA 3APCA 4ZOHC 5GXGB 1TKYA 4M0WB 4YTNB 4W9FA 1FD6A 1WGDA 3N1XC 3I63C 2LEKA 2M1MA 3Q8FA 2LASA 1UELA 5EE3A 2N1WA 4DWFA 3ALBA 3DWGC 1E9MA 2ZZPB 2EKEC 2JSVX 1S3SG 2GRIA 2DZIA 4H2AA 4HKQA 3J9CA 2WU2B 3IG3A 3M62B 4CYEA 1KLUD 4KIKA 1SE9A 3QWZB 1I4XA 2DHZA 2QC8A 1UD7A 2GMIC 4IW0A 3DQVA 2BQQA 5EDSA 1ET6A 1P3QU 3B9JA 2DZKA 3VTVA 1L6VA 2V1YA 1WGRA 4A90A 2IGDA 1TZ1A 4PYZA 4W9HA 3ECIA 1DOIA 5BYQA 4P1BC 3UIOB 2N7JA 3EUB2 1G6JA 2QDFA 2J42A 3DBHI 3EA6A 1E6EB 2KANA 3RZWC 3C8YA 3QX1A 2PE6B 3K9OB 1F2RI 1H8CA 2AX5A 4ANVA 4XX5A 1JWAD 2IY1B 1WE6A 3QK0A 1JRPA 1IYFA 4FXCA 4K3CA 4LNNA 3PLVA 2KN5A 3QC8B 4IM3A 5DPRA 2DENB 1WM3A 4OVUA 2DAFA 4TV3A 1OEYJ 2EMSA 4ZRQA 4IWPA 2FE8A 4ARIA 4A55A 2ZW0A 3VUYA 5CHVC 2CU3A 1HE8A 3BVZA 1D5ZC 2N7EA 5IKCM 1IBXA 2KHWB 3W1YA 1D5XC 1YX6B 2M0XA 4IWQA 1VZ6A 1SE3A 3MP9A 5IOIA 1NYRA 2C60A 5TR5A 5G5HA 1FO4A 4FA6A 4PS7A 1FFUA 1AN8A 1JALA 4S0RA 2AWTA 2WWZA 3Q3NC 4DHJB 3RD2A 1BUIC 2QSDA 1QOGA 2KJRA 4US9A 2JX5A 2K6QA 1SJED 2JYEA 1UGMA 1L4ZB 3KYDD 3W1SA 1DOYA 4W9CA 2G1EA 1OEYA 2YLMA 2G45B 1QOFA 1P98A 4GOCA 1ZPSA 4GLSC 3NVVA 1YQBA 4NY0A 2Y5PA 4BBNF 3PLUA 5AZHA 1XXGA 3X0WA 1Q0WB 4IG7B 2IPKD 3VTUA 3JW0X 4EUTA 2FCNA 1ZDXA 5GMVA 3RULA 4OW0A 3RNCC 4BKSA 2D3AA 3PZ8A 4XGAB 4A8XC 3PGEA 3W9CB 2KVRA 1AARA 5DPTA 1NEKB 2G4DB 1PYWD 4KSKC 2J0KA 2L0FA 3L4PA 3FC4A 3MC9A 2KK8A 1WJNA 1UZXB 4X57B 1MG4A 1NDDA 2Y5BB 3URYA 4URKA 2WHIA 2Z0EB 4RNAA 2LGXA 4BKSD 3VXWA 3TCAA 1J19A 4B0EA 2HTME 2M56B 3JVZX 4GDLB 2BS2B 1UH6A 2JUOA 1WMHB 4HPLB 4NAWB 3NHEB 1Q5WB 3AM9A 1B1ZA 1XLNA 1WXMA 3LJ3A 1QZEA 1WE7A 1WZ0A 4LNIA 1F1HA 2WXGA 3RNFC 2D11A 1YJ1A 1YOVB 2GBRA 3FAHA 2KWUB 2RDHA 2JXXA 2KC1A 3IFWB 3DOWA 1V5OA 1T6BX 3PSEB 5IA7A 2C9WB 1BT0A 3T9LA 2XN9C 1L5PA 2K3UA 3IVFA 1EF1A 3AEGB 4NNJB 4JLCA 2N9KA 1TKEA 3Q8BA 1ZP0B 1V86A 2WXNA 1J7CA 3DVNV 3ZUNA 3ZO5B 2WXIA 3HM3A 1K50A 1RFKA 3HHMA 3PRPB 3FKYA 3AE4B 3B1LX 4BKGA 4P16A 2CS4A 2MH7A 4KVGB 1PGAA 2IGHA 3I5JC 3QCAA 2KO3A 3NS1A 3MJ5A 2WXKA 3IT6B 4XDCA 3DVGY 4L23A 3VH3B 2INDC 4I6LB 4JGHB 3PZ7A 4KGRA 1CK1A 3H1UA 3DVGX 1V97A 3VUWA 1JWSD 3AE6B 2ZEQA 4TUUA 5BMIA 2IBIB 1C76A 4WJQA 5EE9A 2LGSA 2FAZA 2LGDA 1AWDA 3OWEB 5E6OA
chains in the Genus database with same CATH topology
2V3PA 1Y56A 2Y3AA 1IBXB 2AQ1B 1UWMA 1V1PB 3BIID 4HJGE 2D5GA 2FUG1 1MPEA 3W2DA 4R3DA 1WWTA 2AQ3B 2BB5A 4RCOA 2QMTA 2DBYA 1ESFA 2OHFA 2K22A 4DXFA 4US8A 2WXLA 5C3JB 1ZE3D 1FRDA 4TMAB 3TEWA 1ET9A 3MFGA 3U4EG 3HUIA 1GAQB 1I4PA 1YQ3B 3P4RB 2G9HD 1HQRD 3NUHB 2W55A 3PO0A 1IGCA 1HZ5A 1MHXA 3GP7A 1T3QA 3VRAB 1CZPA 1AYFA 1L0YB 3AEDB 1V1OA 1OQQA 1YJJA 2INPE 1L0XB 2R61A 1HEZE 2BB6A 2Q5WD 3R2IA 2W3SA 4B0MA 1NYQA 4CQNA 3CIRB 1YN5A 2M0AA 3N9YC 4RF0A 3LXFA 3AE2B 3HRDD 1FFVA 1N60A 3BYTB 5JXVA 4EE2A 4YSYB 4M0WA 3IXSA 2B76B 2LJIA 1J7BA 2WLBA 5H92C 2V0GA 2JQRB 4C56C 1JQ4A 2CJNA 2RDGA 2N0SB 2V3NA 2PIAA 3P4QB 1UWXA 4JX1C 4YT0B 1JWMD 3DWMA 2PKOA 4NAMA 2J52A 1VZ8A 2WXQA 3BWUD 1TJEA 2L32A 1TKGA 4KKJA 2DWQA 1P7FA 3E9SA 2W3RA 4OZBA 2IGGA 1OFFA 1YN4A 4O1NA 2K5PA 5H8YE 5FR3A 3B2GA 3R8BA 1PFDA 2QEJC 1FCCC 1J7AA 2JYTA 2PMVA 1FEHA 1TY2A 2J53A 1EWCA 2V4IB 1ROEA 1QILA 2H89B 1XCTL 4ZHOA 4USAA 1UGJA 2XNAC 2X38A 3P4SB 4RGMA 4RFBA 4WIPA 1JROA 1TS3A 1VDVA 1YJIA 2CJOA 1HXYD 2WQYB 5BYSA 2LFIA 3V05A 4N6EB 4YSXB 2WXHA 2BT6A 3Q69A 1SB3C 3NZ3A 5FK9C 1TS5A 4WQMA 3SFEB 5LNK1 1MHHE 4TQ1A 5G5GA 1OQRA 1WYGA 2FBWB 3LYYA 1HZ6A 2J4XA 1T5XD 1EM7A 4OVZA 4P6VF 2WXMA 2NTSA 4ZOHC 1YNTE 3NVYA 5BMGA 5GXGB 2K0PA 5C2TB 4ZYSA 1C78A 4WAFA 1TKYA 3AH7A 3KLSX 4YTNB 2WDQB 1FD6A 3KQ4A 2JZPA 4MACA 2I38A 1V8CA 1ENFA 1JWBD 1GOZA 1SJHD 2LEKA 2KACA 1VJKA 3I57A 3Q8FA 5D3DA 4XWWA 1XLPA 3IT4B 4NJCA 5EE3A 3ZQ4A 2JXTA 1SBBB 1WRIA 2KQ4X 2GB1A 1CQVA 3AE1B 2WP9B 3DWGC 1E9MA 2JSVX 2MJDA 3BZDB 3H8HA 1HA5A 4N59A 4ZRPA 5E6JA 2I2YA 4Q2JA 3VR8B 1ZUD2 3AE9B 2GRIA 4GDKB 2ACZB 2WXFA 3AN1A 4H2AA 1JCKB 4HKQA 1RWSA 3J9CA 1R7SA 3SFDB 1E7PB 1FIQA 2WU2B 2LHEA 1KLUD 3FILB 3CWIA 1N62A 1I4XA 2VZKD 1EU4A 3Q8AA 4KX6B 3BYYB 2BTEA 4L1BA 1ET6A 2E6XA 1PGBA 3B9JA 1L6VA 2WXOA 1MVKA 4A90A 2IGDA 3ZJUA 4AS1A 3KWVA 4NZLB 1DOIA 1WXQA 3P63A 5BYQA 1ZDVA 4KGSA 4ARCA 4RH6A 1PDXA 2ON8A 2N7JA 3EUB2 3TEYA 4RGNA 2J42A 1YN3A 1QQRA 3GS2A 1JWUD 3EA6A 1E6EB 2DLBA 1SE2A 4YTMB 3C8YA 1A70A 1YQ4B 1F2RI 1I4RA 2WXJA 3WCQA 3EGRA 2AX5A 1JWAD 5HFYA 4HEA1 4IKGA 2TSSA 3V3XA 2WU5B 2NTTA 3AE5B 2WDVB 5AUIA 4AQ7A 4HKZE 3W5UB 2BBCA 2WDRB 1VR9A 1JRPA 3AEBB 4XWTA 1VLBA 5HHDG 4FXCA 3NVZA 2INNE 3TSSA 1C77A 2ONQA 3BVMA 3SR6A 3B2FA 1DGJA 3I9V1 1JW9D 4LLGM 4OZCA 3ZJTA 1NENB 1ACCA 1XLQA 2JWUA 2RMMA 3P1MA 2W54A 4MM3B 4RGTA 4WH4A 4ZRQA 4UDUC 2FE8A 3P4PB 4ARIA 4A55A 2ZW0A 1EWYC 1TS4A 4TSSA 2CU3A 2LMCA 4JPSA 1I4HA 3T3NA 2SAKA 1XCQL 3BVZA 1AW7A 1D5ZC 4PT5A 2Z8LA 1IBXA 1SXTA 1D5XC 1KFYB 3HVZA 2QIEB 3AE8B 2L83A 1VZ6A 4C80A 1SE3A 3MP9A 5EE0A 1NYRA 3SEBA 5G5HA 1XEEA 1FO4A 3BK2A 1NVID 1VZ7A 4ZHPA 1FFUA 1AN8A 1JALA 4XDDA 3BVGA 1BUIC 2M19A 2QSDA 1QOGA 1ZXHA 3O13A 1I4QA 2K9XA 1QT9A 4US9A 3TEXA 5I4DA 2JX5A 4YWGG 1TZOA 1TS2A 1IUEA 1SJED 2JYEA 2KAJA 2BS4B 1L4ZB 1D6EC 1TY0A 2WXRA 1F0ZA 3RPFC 1QF6A 1FNVA 3W1SA 5EE1A 1DOYA 1IGDA 1FXAA 1I4GA 1FM0D 2G1EA 2Y5CA 2ZW1A 1JMLA 4J3OD 1SE4A 1E0ZA 2LHDA 1GPXA 1KTKA 1DYQA 1QOFA 3TEZA 1ZPSA 1F77A 1B9RA 2HDEA 4GLSC 3NVVA 3ZJVA 1N5XA 2Y5PA 1KF6B 4A9AA 2OEDA 1XXGA 1L6UA 4YTPB 2MJEA 2IPKD 1GB4A 2EKIA 3KWLA 5BYRA 1QOAA 1ZDXA 3ABVB 2DYMA 4MH8A 1RM6C 3AMZA 2NMQA 4IDIA 2PW9A 4OW0A 3VQIA 3PZ8A 4A8XC 3ZYYX 1FNUA 2YEPB 4MT5A 1XO3A 3W9CB 1Q10A 1WSPA 1SF0A 4D2KA 4DQOC 1N63A 1NEKB 1GB1A 2LGIA 5D3IB 1PYWD 1CJEA 2PVGC 2KMMA 1K51A 3AB5A 3BK1A 3L4PA 3R2TA 4OZAA 3U2SC 3FC4A 2QJLA 2L52A 1BXTA 2LUMA 2WS3B 3AECB 4RGOS 3URYA 2IDYA 5HI1A 3AV8A 4YXDB 4RNAA 1P7EA 3IAM1 2QILA 4HRSA 1K53A 4B0EA 2HTME 2M56B 3ETRA 2MEKA 4ITKA 4DXGA 2MJ3A 4GDLB 2IJ0A 3AEFB 2BS2B 4OHJA 3W5VB 5HG2A 2YEPF 1C4AA 1KH0A 4KKIA 1ZXIA 1KRHA 4WURA 1D4BA 1C4CA 4NAWB 4C7ZA 2VZKB 4REZA 3AM9A 1B1ZA 1XLNA 3Q8CA 3E56A 2WXGA 1C79A 4A6QA 1DOXA 3TUOA 3FAHA 1PGXA 4TQ0A 2BW2A 1PUTA 2RDHA 2N9LA 1F2RC 4LK0M 1QLBB 1ZOYB 1T6BX 1FCLA 1L0VB 1EU3A 1E10A 2XN9C 1QOBA 2W82A 1L5PA 2L1AA 2KN4A 2K3UA 4RF1A 3U7ZA 5MPOA 1UUPA 2BYTA 2WNMA 3AEGB 3GB1A 4JE3B 1VRAB 1V1PA 2BS3B 3AEAB 4JWUC 4KGTA 3U52E 5FKAC 3MC0B 1YMHE 2N9KA 1TKEA 3AE7B 1WGKA 1ZP0B 1D5MC 3Q8BA 1XF5L 2WXNA 1J7CA 1FMAD 2JU6X 2WXIA 1SSNA 1K50A 1RFKA 1STEA 3ZGZA 2H88B 2PVOD 1XLOA 1FRRA 3AE4B 3FILA 4P16A 1MI0A 2PTLA 4XE0A 3NRZA 2ICIA 2MH7A 1C9FA 2E3TA 1PGAA 1SIJA 4L2YA 1N5WA 1RYJA 1FNWA 2IGHA 3NVWA 2GI9A 1N61A 1KLGD 3MHZA 2KDMA 4LTUA 5T8IA 4IOIE 3NS1A 3MJ5A 1I7HA 1LO5D 1FXIA 2WXKA 3IT6B 4XDCA 3RFZB 4L23A 5AUKA 1M4VA 3PZ7A 1TYGB 4KGRA 3AE3B 4WWMA 2DYOA 1CK1A 1K52A 2PLPA 2SEBD 2KWDA 5TSSA 4N58A 1NI3A 4HROA 3T3OA 1C4PA 1V97A 2RPVA 4YSZB 1JWSD 3AE6B 2WXPA 3P42A 3VRBB 5BMHA 5D7GA 1QKZA 3HVDA 3UI3A 2EELA 1L4DB 5BMIA 1C76A 1UNSA 5EE9A 3IAS1 3VR9B 4JWSC 1SEBD 3AEEB 2AQ2B 3LB8C 4C7YA 1BMLC 3Q8EA 1AWDA 3OWEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJ3 A;  1XLQ A;  3P1M A;  3AEF B;  4ZOH C;  2BS2 B;  2W54 A;  3W5V B;  1UWM A;  3NVY A;  5C2T B;  3BII D;  5GXG B;  3P4P B;  1ZXI A;  1TKY A;  3AH7 A;  1KRH A;  4YTN B;  1EWY C;  2WDQ B;  1WWT A;  2CU3 A;  2DBY A;  4C7Z A;  1V8C A;  2OHF A;  1JWB D;  2K22 A;  4US8 A;  5C3J B;  2LEK A;  1FRD A;  1XLN A;  1VJK A;  3AM9 A;  1KFY B;  3HUI A;  1GAQ B;  1YQ3 B;  1XLP A;  5EE3 A;  3HVZ A;  1DOX A;  2QIE B;  3AE8 B;  2L83 A;  3FAH A;  1WRI A;  3P4R B;  4C80 A;  3AE1 B;  3DWG C;  5EE0 A;  2WP9 B;  1NYR A;  1PUT A;  2W55 A;  1E9M A;  3PO0 A;  5G5H A;  1FO4 A;  1NVI D;  2MJD A;  1T3Q A;  3VRA B;  1CZP A;  1AYF A;  1QLB B;  1ZOY B;  3AED B;  4N59 A;  4ZHP A;  1FFU A;  1OQQ A;  1YJJ A;  1JAL A;  3VR8 B;  1ZUD 2;  3AE9 B;  1L0V B;  2M19 A;  1E10 A;  1QOG A;  1QOB A;  1L5P A;  2Q5W D;  2K9X A;  1QT9 A;  2ACZ B;  4US9 A;  2W3S A;  3AN1 A;  2JX5 A;  5MPO A;  1NYQ A;  1RWS A;  1R7S A;  3AEG B;  1E7P B;  1FIQ A;  2WU2 B;  1IUE A;  3CIR B;  3LXF A;  2BS3 B;  3SFD B;  1F0Z A;  3AE2 B;  3AEA B;  3HRD D;  1FFV A;  1N60 A;  2KAJ A;  4JWU C;  2M56 B;  4YSY B;  2BS4 B;  3CWI A;  1TKE A;  2B76 B;  1WGK A;  1N62 A;  1ZP0 B;  3AE7 B;  1J7B A;  4KX6 B;  2WLB A;  5EE1 A;  3RPF C;  1QF6 A;  1DOY A;  1J7C A;  5H92 C;  1FMA D;  1FXA A;  5AUI A;  2JQR B;  1FM0 D;  1RFK A;  2G1E A;  3B9J A;  2Y5C A;  1JQ4 A;  2CJN A;  2H88 B;  2PVO D;  1L6V A;  1XLO A;  1FRR A;  2N0S B;  3AE4 B;  1E0Z A;  2PIA A;  3P4Q B;  1GPX A;  4JX1 C;  4YT0 B;  3DWM A;  3NRZ A;  1QOF A;  2MH7 A;  2PKO A;  1DOI A;  2E3T A;  1B9R A;  1SIJ A;  1WXQ A;  3NVV A;  3P63 A;  1N5X A;  1TJE A;  1N5W A;  1RYJ A;  1KF6 B;  1PDX A;  1TKG A;  2DWQ A;  3EUB 2;  3NVW A;  4A9A A;  1N61 A;  2W3R A;  1L6U A;  4YTP B;  2MJE A;  4LTU A;  1OFF A;  1E6E B;  2EKI A;  3KWL A;  3NS1 A;  1QOA A;  2K5P A;  3ABV B;  3ETR A;  1RM6 C;  3AMZ A;  4IDI A;  5H8Y E;  1I7H A;  4YTM B;  1FXI A;  1A70 A;  1YQ4 B;  3B2G A;  1PFD A;  3ZYY X;  5AUK A;  1J7A A;  1XO3 A;  3W9C B;  1TYG B;  3AE3 B;  4WWM A;  3WCQ A;  1SF0 A;  1ROE A;  2AX5 A;  1N63 A;  1NEK B;  2H89 B;  4ZHO A;  1JWA D;  4USA A;  4N58 A;  1NI3 A;  4HRO A;  3P4S B;  1V97 A;  2WU5 B;  3AE5 B;  4YSZ B;  1CJE A;  1JRO A;  2PVG C;  2WDV B;  2KMM A;  3AB5 A;  3AE6 B;  1VDV A;  1YJI A;  2CJO A;  3L4P A;  3VRB B;  3FC4 A;  3W5U B;  2QJL A;  2L52 A;  2WQY B;  2WDR B;  2WS3 B;  3AEC B;  4N6E B;  1JRP A;  3AEB B;  1VLB A;  4FXC A;  3NVZ A;  4YSX B;  3AV8 A;  4YXD B;  2BT6 A;  5EE9 A;  1SB3 C;  3SFE B;  3VR9 B;  4JWS C;  4WQM A;  3AEE B;  4HRS A;  3LB8 C;  5G5G A;  3SR6 A;  1OQR A;  4C7Y A;  1WYG A;  2FBW B;  3B2F A;  1DGJ A;  1JW9 D;  1AWD A;  4P6V F;  2HTM E;  1NEN B;  4ITK A; 
#chains in the Genus database with same CATH topology
 3VDZ A;  1V1P B;  2BKR B;  2N1V A;  1WWT A;  2K6D B;  5C3J B;  1TT5 B;  1FRD A;  1ET9 A;  3U4E G;  2N7D A;  4BVU C;  4ICU A;  1GAQ B;  1I4P A;  3P4R B;  4MGZ E;  1GUA B;  2CHZ A;  3GP7 A;  2G4S A;  1CZP A;  1AYF A;  4W9D A;  1ISN A;  2IZV B;  4ASW C;  1YJJ A;  1GC7 A;  1L0X B;  2KFK B;  2W3S A;  3RUI B;  4RF0 A;  3LXF A;  2N9X A;  2KWV B;  4EE2 A;  2YVC A;  2V0G A;  4EEW A;  2JRH A;  4E74 A;  4C56 C;  3IHP C;  3N1Y C;  4QAY A;  1WH3 A;  2CJN A;  2N0S B;  2HTH A;  4CHK A;  4YT0 B;  3B08 A;  1YD8 U;  2PKO A;  3APD A;  4JQW C;  2J52 A;  3BWU D;  2L32 A;  4FAD A;  1WR1 A;  1TKG A;  1V80 A;  2DWQ A;  3A4S C;  1P7F A;  3Q2A C;  3E9S A;  2W3R A;  2MBE A;  2KDB A;  2IGG A;  4O1N A;  2J0J A;  5H8Y E;  4DK5 A;  3B2G A;  3R8B A;  2QEJ C;  4DHZ E;  1J7A A;  2KLC A;  1FEH A;  1TY2 A;  2J53 A;  2V4I B;  1QIL A;  4ZHO A;  3DDC B;  2XNA C;  2X38 A;  4RFB A;  3K9P B;  1YJI A;  4N6E B;  5BO4 B;  4BAX A;  1SB3 C;  3NZ3 A;  1TS5 A;  2RDB C;  1MHH E;  5G5G A;  1OQR A;  1WYG A;  3LYY A;  4FHJ A;  2IO3 B;  4P6V F;  1EM7 A;  2WXM A;  3QIJ A;  1YNT E;  3NVY A;  2K0P A;  2L0T A;  3KLS X;  2WDQ B;  3KQ4 A;  4KDI C;  1V8C A;  1SJH D;  4GDL A;  2KAC A;  3I57 A;  4XWW A;  1XLP A;  3IT4 B;  3ZQ4 A;  4KSL C;  1SBB B;  1WMH A;  2WP9 B;  4GSW A;  3BZD B;  4FJV B;  4GN1 A;  1L7Y A;  3Q14 C;  4W9K A;  2MRP A;  5JHB A;  3AE9 B;  3ZIM A;  4PS3 A;  3WAP A;  4W9J A;  2FCS A;  2ACZ B;  2BYE A;  4MGI E;  4MM3 A;  3SFD B;  1E7P B;  3WAL A;  2C7N B;  1WF9 A;  3CWI A;  4G50 A;  2B3A A;  3BYY B;  2E6X A;  4NJ6 A;  2A4Z A;  2C7M B;  3NZU A;  3ZJU A;  3KWV A;  2O2V B;  4KGS A;  4JIO U;  4RH6 A;  2GLS A;  3ZDT A;  4ARC A;  1E7U A;  3TEY A;  4RGN A;  2BF8 B;  2QHO A;  1JWU D;  3GS2 A;  2DLB A;  1YIW A;  1SE2 A;  1A70 A;  1C1Y B;  2WYQ A;  3WCQ A;  1IPG A;  1GG3 A;  3ZNH B;  5HFY A;  2TSS A;  2WDV B;  4HKZ E;  3W5U B;  2KQS A;  2BBC A;  2WDR B;  4XWT A;  2INN E;  2Z59 B;  1V9J A;  4ZDV A;  2PEA A;  1WR6 E;  3SR6 A;  4KZC A;  2A5U A;  1V5T A;  1WZ3 A;  2DNF A;  1XLQ A;  2JWU A;  2CHX A;  3KH0 A;  3ZXV A;  4TSS A;  4JPS A;  1I4H A;  4M01 A;  2JWZ A;  3L13 A;  4PT5 A;  2JZ3 B;  4AJY B;  4DDG D;  1WXA A;  2PPH A;  2QIE B;  3AE8 B;  4IM0 A;  4MGK E;  1LQB A;  3C19 A;  3SEB A;  2IO0 B;  3DBR I;  3A9K B;  1NVI D;  1VZ7 A;  3P2B A;  3SHQ A;  1SGH A;  5IAA C;  4ZHP A;  5C1Z A;  2M17 A;  4IM2 A;  3PVL A;  1ZXH A;  3BY4 B;  2K9X A;  2L7R A;  3V60 A;  3HK0 A;  1TS2 A;  2KAJ A;  1XT9 B;  3RPF C;  2ZNV C;  2KFK A;  3IBE A;  1I4G A;  1TGZ B;  2FIF A;  3RI7 C;  5JZE B;  3ONS A;  1EF5 A;  4ANU A;  1DYQ A;  3LDZ E;  3CSF A;  3ZJV A;  1GC6 A;  3UIP B;  2MJE A;  2INC C;  2OJW A;  3KWL A;  4MH8 A;  4RM9 A;  4IDI A;  3VH4 B;  4BZA A;  4FJZ A;  2HJ1 A;  3VQI A;  1Q1O A;  3ZNI D;  3N30 A;  2PE9 A;  3S2A A;  4ZYN A;  3ZYY X;  1XD3 B;  1SIF A;  3L10 B;  4D2K A;  1N63 A;  1GB1 A;  2LGI A;  4B9K A;  4IWO A;  2PVG C;  2LVQ A;  2HD5 B;  2V3S A;  1WY8 A;  1BXT A;  2L76 A;  2IDY A;  2RR9 A;  3AV8 A;  2KNB A;  1P7E A;  1V81 A;  3SD5 A;  1U4A A;  1EUV B;  4LNK A;  4JL9 A;  2MEK A;  1X1M A;  2D07 B;  2MJ3 A;  4ACF A;  4OHJ A;  4F8C B;  2YEP F;  3PV1 A;  4HPP A;  4P1C C;  1C4A A;  1ZXI A;  4WUR A;  1C4C A;  2GBM A;  2VZK B;  4REZ A;  2KWC A;  3V61 A;  3EFU A;  4HXD A;  2LWP A;  4HPM B;  2M4N A;  1F2R C;  2IO1 B;  4LK0 M;  3EC8 A;  3RNA C;  4MJS B;  1L0V B;  1QOB A;  2GBJ A;  2MBO A;  3MJW A;  2BYT A;  2KTF A;  3GB1 A;  1VRA B;  2KKC A;  4JWU C;  1H4R A;  5FKA C;  4II3 B;  3JSV B;  1V6E A;  3AE7 B;  1WGK A;  1XF5 L;  4EOY A;  1FMA D;  2JU6 X;  4HWI B;  1STE A;  3PZD A;  2JVC A;  2H88 B;  2PVO D;  3ZXR A;  1FRR A;  2MX2 A;  2D10 A;  3NRZ A;  2ICI A;  3CST A;  2E3T A;  4WWP A;  2Z0D B;  1N5W A;  1RYJ A;  2KT7 A;  3MHZ A;  4LTU A;  5AZG A;  1FXI A;  1WXS A;  4WJP A;  3AUL A;  1M4V A;  4WWM A;  3H7P B;  2OJR A;  1K52 A;  2PLP A;  2M8S A;  5TSS A;  4N58 A;  1NI3 A;  4HRO A;  4HCP B;  2WXP A;  3R3M A;  3TJP A;  4LNF A;  3OG5 A;  4BOZ B;  5D7G A;  3UI3 A;  3RNG C;  3IAS 1;  3VR9 B;  1SEB D;  3DHG C;  3AEE B;  1WJ4 A;  2AQ2 B;  3TL5 A;  3A9J A;  3QQ8 B;  3Q8E A;  3M95 A;  2Y3A A;  3R7R A;  1R4N B;  1K8R B;  2FCQ A;  4R3D A;  4DBG A;  3UQA A;  2IO2 B;  2DBY A;  2ZCB A;  3VVW B;  2K22 A;  2KX0 A;  3TEW A;  4FJY A;  1EO6 A;  1WM2 A;  1UBI A;  2W55 A;  1C3T A;  1IGC A;  1MHX A;  3ML8 A;  5DPW A;  3VRA B;  1V1O A;  1OQQ A;  4KV2 A;  1WFY A;  3DBL B;  4B6W A;  1HEZ E;  2BB6 A;  2DZM A;  4B0M A;  4FLH A;  3A9K A;  4EZL A;  1NYQ A;  4CQN A;  4AWJ A;  1OGW A;  3HRD D;  1N60 A;  4YSY B;  1UF0 A;  4M0W A;  4EZK A;  2B76 B;  2LJI A;  2BYV E;  4DXA B;  3OJ3 A;  4FUL A;  3WAN A;  3EFC A;  2RDG A;  2G3Q B;  2V3N A;  5HKH A;  2PIA A;  1UWX A;  2MP2 B;  4JX1 C;  1JWM D;  3U30 A;  1E8X A;  4NAM A;  3MC8 A;  1VZ8 A;  1D3Z A;  1TJE A;  4NJ7 A;  3N20 C;  3RNB C;  1CMX B;  3RN9 C;  3L16 A;  4OZB A;  1OFF A;  1YN4 A;  3L08 A;  4HDO A;  3ENE A;  4BOS C;  1LGR A;  5FR3 A;  1PFD A;  1FCC C;  4HLE A;  4LJO B;  1EWC A;  3DHI C;  1XCT L;  1R4M B;  4USA A;  1J8C A;  4RGM A;  3RZF A;  4OVV A;  2LRU A;  2WQY B;  4WAA A;  2LFI A;  3V05 A;  2C5L C;  5FK9 C;  3KUZ A;  4TQ1 A;  3A33 B;  2KDI A;  2FUH B;  2J4X A;  5C2T B;  2N4F A;  4WAF A;  3AH7 A;  2JZP A;  2I38 A;  2ZPY A;  1ENF A;  1GOZ A;  5D3D A;  3ZVV A;  5L95 C;  2K39 A;  3W1S C;  2REX A;  3AE1 B;  2ZJD A;  2NPT B;  2UWQ A;  4K1R B;  4N59 A;  4ZRP A;  3RMK C;  5E6J A;  4MDK E;  2I2Y A;  3VR8 B;  5KHQ A;  1ZUD 2;  2KMA A;  2WX0 A;  1E8Y A;  3HIZ A;  4GDK B;  2JY6 A;  2XBB C;  4W9G A;  3AN1 A;  4F7Z A;  1R7S A;  1FIQ A;  5G2N A;  3H7S A;  4A3O A;  2I1K A;  5CX3 A;  3OLM D;  1UBQ A;  2VZK D;  4KX6 B;  1EU4 A;  5C23 A;  4L1B A;  4K7U A;  2WX1 A;  4K7S A;  1WX8 A;  1MVK A;  4AOF A;  1Y8R C;  2KQ7 A;  3JSV A;  2RGF A;  4GGQ A;  1WXQ A;  4M00 A;  2ON8 A;  3ZLZ A;  1YN3 A;  1IP9 A;  3Q3O C;  3RNE C;  2W9N A;  1Z5S B;  4ZRJ A;  2O6V B;  3B0A A;  3KW5 B;  3ZKJ C;  3WIM A;  1YQ4 B;  3UF8 A;  3A1Q B;  2RD0 A;  4E3C A;  1I4R A;  2WXJ A;  2CKH B;  4HEA 1;  2MSE D;  3QAR A;  3V3X A;  2WU5 B;  3AE5 B;  3SU8 X;  4AQ7 A;  1F9J A;  3H7P A;  3AEB B;  5HHD G;  4WJN A;  1C77 A;  3QHT A;  4DHJ D;  1GNU A;  2ONQ A;  3BVM A;  2NVU I;  3AXC A;  3B2F A;  4MEM A;  1JW9 D;  3ZJT A;  1NEN B;  1ACC A;  2RMM A;  3P1M A;  2W54 A;  4RGT A;  3C0R B;  4WH4 A;  3RCZ A;  2LI5 A;  3QA8 A;  2ZVN A;  2SAK A;  1GJZ A;  1JRU A;  1AW7 A;  2Z8L A;  1P0R A;  1KFY B;  3GZN B;  3HVZ A;  2KTR B;  5EE0 A;  1PQS A;  1WJU A;  2BWF A;  3AI5 A;  1V49 A;  1XEE A;  4NPN A;  3ZRF A;  2LRW A;  3CMM B;  4BFR A;  3KVF B;  4S17 A;  4XDD A;  3BVG A;  2LVP A;  4GB9 A;  2M19 A;  3O13 A;  1I4Q A;  5JH5 C;  4B95 A;  2AL3 A;  1IUE A;  1Z2M A;  5J2R A;  2BS4 B;  1TY0 A;  1F0Z A;  1QF6 A;  5EE1 A;  4NAW A;  3PRZ A;  2MQJ A;  1FM0 D;  3QJZ A;  1T0Q C;  2ZW1 A;  2MW5 A;  4AP4 C;  4J3O D;  2KOX A;  3V6C B;  3V62 A;  3DHH C;  1KTK A;  1OTR B;  3D32 A;  4PS8 A;  3TEZ A;  2LVO A;  2HDE A;  1N5X A;  4C4V B;  3TBL D;  2OED A;  1L6U A;  4YTP B;  2NCN A;  1GB4 A;  1OQY A;  2MP2 A;  2EKI A;  5BYR A;  4WWO A;  2DYM A;  1RM6 C;  2NMQ A;  2PW9 A;  1S1Q B;  2MBH A;  1FNU A;  2YEP B;  1Q10 A;  2EMT A;  1SF0 A;  4DQO C;  5L83 A;  4ANX A;  3PHW B;  1CJE A;  1K51 A;  4OZA A;  3BK1 A;  2UYZ B;  2CHW A;  1P1A A;  2L52 A;  1RAX A;  2WS3 B;  3AEC B;  4YXD B;  4II2 B;  4HRS A;  3KUC B;  2WDT B;  5D2M B;  1K53 A;  3ETR A;  4ITK A;  3HM6 X;  1E90 A;  1P9D U;  5HG2 A;  2J0M A;  1D4B A;  4W9I A;  2WGS A;  2D3B A;  3E56 A;  3Q3J A;  2X8X X;  1DOX A;  3TUO A;  1HTO A;  1PGX A;  4TQ0 A;  3ZRC A;  2XK5 B;  4LJP B;  2K8H A;  4E71 A;  1QLB B;  1FCL A;  4ZRK A;  3Q3F A;  1EU3 A;  1E10 A;  2W82 A;  2L1A A;  2C7H A;  2IYD B;  4RF1 A;  3U7Z A;  1R4N I;  3SDL C;  5IO9 A;  1V1P A;  2BS3 B;  3AEA B;  1RLF A;  4A3P A;  4KGT A;  3MC0 B;  5LXI B;  1D5M C;  4GDK A;  1RFA A;  1MJD A;  1SSN A;  2L00 B;  3U7D A;  3ZGZ A;  1E8Z A;  1XLO A;  2JZZ A;  2JRI B;  2ZVO A;  4XYC A;  1T0S C;  3ML9 A;  2PTL A;  2LZ6 A;  2MCN B;  1SIJ A;  2CR5 A;  1T0R C;  2GI9 A;  3VTW A;  1KLV A;  2KDM A;  5T8I A;  4IOI E;  2KFJ A;  1I7H A;  1L2N A;  1LO5 D;  5AEK B;  3PRE A;  3JYU A;  4K3B A;  1TYG B;  3L0W B;  2DYO A;  2SEB D;  2KWD A;  3PRM B;  2BVC A;  3T3O A;  2RPV A;  2O6V A;  3P42 A;  4EFO A;  3A1Q A;  1QKZ A;  2KD0 A;  3PPA A;  3NOB A;  1UNS A;  4C7Y A;  2KJ6 A;  2CU1 A;  4GIV A;  4MGY E;  3RT3 B;  2AQ1 B;  1UWM A;  1WI0 A;  3BII D;  5FR6 A;  2D5G A;  3W2D A;  2V9H A;  2O6V D;  2LXC A;  2BB5 A;  3R66 C;  3ZNG C;  4US8 A;  2LGY A;  1ZE3 D;  3MFG A;  1R4M I;  4WJO A;  3GE8 C;  1YQ3 B;  2L3Z A;  4LDT B;  1HZ5 A;  2KLG A;  1T3Q A;  3AED B;  1I35 A;  2KXJ A;  2KTR A;  2INP E;  2R61 A;  1E8W A;  5LXH A;  3X23 A;  4G3X B;  3GE3 C;  3R2I A;  4MEL A;  1XQQ A;  4PK1 A;  2M0A A;  3WA0 A;  3IXS A;  1N6Z A;  1J7B A;  2WLB A;  2KJH B;  4C00 A;  2JQR B;  3VAW A;  4FN2 A;  1NBF C;  4P7I A;  4NQK E;  3Q6B A;  2ZPN A;  2WXQ A;  1TIF A;  1M94 A;  4KKJ A;  2VH2 A;  3MHS D;  4HCN B;  2K5P A;  2LD9 A;  1LXD A;  4GXB A;  4C4V A;  2JYT A;  2AL6 A;  2R2Q A;  1ROE A;  2QCZ A;  2H89 B;  4G0N B;  3KYC D;  3DBS A;  3P4S B;  1JRO A;  1TS3 A;  2GBK A;  2L8J A;  1HXY D;  5BYS A;  3N3K B;  1MFW A;  3APF A;  1YX5 B;  5LNK 1;  3Q3M C;  2O2V A;  2NBW B;  2NTS A;  5BMG A;  4ZYS A;  1C78 A;  2JPH A;  4MAC A;  1WGH A;  2JT4 B;  1JWB D;  1VJK A;  4NJC A;  2N9P C;  2JXT A;  1WRI A;  2KQ4 X;  2GB1 A;  1CQV A;  2HE7 A;  4KDL B;  1ZGU B;  2MJD A;  3H8H A;  3PTF C;  2FID A;  1HA5 A;  2VH1 A;  4Q2J A;  4MSM B;  2PJH A;  2K8C A;  2LXA A;  2XK5 A;  2KYW A;  3NJT A;  3CF6 E;  1WIA A;  2WXF A;  1JCK B;  1RWS A;  3A4R A;  3GOE A;  4AJW A;  2LHE A;  3FIL B;  2D3G A;  3BIN A;  1N62 A;  3Q8A A;  4IC7 B;  2BTE A;  1PGB A;  3GZN I;  1WX9 A;  4LNO A;  2LJ5 A;  2WXO A;  3TMP B;  4AS1 A;  2RPQ A;  2LUE A;  4NZL B;  2RSU A;  3P63 A;  1ZDV A;  1PDX A;  2ZNV B;  3DBR B;  1MG8 A;  2GBN A;  1QQR A;  4YTM B;  1NI2 A;  2BGF A;  4MH0 E;  3EGR A;  3UIN B;  5CTR C;  4IKG A;  2NTT A;  5AUI A;  2AYO B;  1VR9 A;  2L05 A;  3H6N A;  1VLB A;  3NVZ A;  3TSS A;  1WYW B;  4CO7 A;  1DGJ A;  3I9V 1;  4OZC A;  4LLG M;  3NY5 A;  4MM3 B;  4UDU C;  3P4P B;  2ZCC A;  1EWY C;  1TS4 A;  2LMC A;  3T3N A;  1XCQ L;  1I42 A;  1SXT A;  4DDI D;  1WGG A;  3U8Z A;  2L83 A;  3NG0 A;  4C80 A;  3EEC A;  2DZJ A;  3BK2 A;  2DX5 B;  2D2Q A;  4HJK A;  3DBH B;  1KOT A;  4TKN A;  1VD2 A;  3PT2 B;  1QT9 A;  3TEX A;  5I4D A;  4NQL B;  4YWG G;  2MBQ A;  1HTQ A;  1TZO A;  2NR2 A;  1LFD A;  1D6E C;  2WXR A;  3PS6 A;  1FNV A;  1IGD A;  4AUQ C;  1FXA A;  2JF5 A;  2Y5C A;  4A20 A;  4KZ0 A;  5D6J B;  1JML A;  1E0Z A;  1SE4 A;  2LHD A;  1GPX A;  4LDT D;  2IY0 B;  1F77 A;  1B9R A;  2DAJ A;  5E6N A;  4DHZ B;  1KF6 B;  3VHT C;  4A9A A;  3DVN U;  4GMV A;  4MJS A;  1QOA A;  3ABV B;  3O65 B;  4YL8 A;  3AMZ A;  1FPY A;  3ZTC A;  1E7V A;  5CHW A;  4MT5 A;  1XO3 A;  5DPS A;  1WSP A;  3OAW A;  4RM8 A;  3PHX B;  3ZDM C;  5D3I B;  2KMM A;  3R2T A;  3AB5 A;  3U2S C;  4W9L A;  2QJL A;  2LUM A;  4RGO S;  5HI1 A;  4FBJ B;  3N1Z C;  3IAM 1;  2QIL A;  3M63 B;  3L17 A;  1V2Y A;  4I6P A;  5D94 A;  4DXG A;  2IJ0 A;  2KVZ A;  3AEF B;  1LM8 B;  3W5V B;  1KH0 A;  4KKI A;  1KRH A;  4FHK A;  3VFK A;  4C7Z A;  1RRB A;  4WQO B;  3M3J A;  5E6P A;  4G11 A;  4HVB A;  3Q8C A;  5J17 A;  3EHV A;  4J6I A;  2KC2 A;  4XZ4 A;  4BBN C;  1C79 A;  2K8B A;  3R7Q A;  4A6Q A;  4ANW A;  2K1F A;  1WJ6 A;  2BW2 A;  1PUT A;  2N9L A;  5JHA A;  2KX3 A;  3MTN B;  1ZOY B;  2V4L A;  1WRD B;  4KIK B;  5J18 A;  4M8M A;  2KN4 A;  2MWS B;  2MLB A;  5KHO A;  2MA9 B;  5MPO A;  1UUP A;  5IP4 D;  2WNM A;  5CHF A;  4JE3 B;  1FXT B;  3U52 E;  1YMH E;  2I1J A;  4M8N A;  2BPS A;  3ZTD A;  1TBE A;  1TTN A;  3FIL A;  1MI0 A;  1ZKH A;  4XE0 A;  2DYB A;  2NBU A;  1C9F A;  4L2Y A;  1KJT A;  1FNW A;  3NVW A;  3L54 A;  1N61 A;  2OOB B;  1KLG D;  5G55 A;  2KDF B;  1ZW7 A;  4M02 A;  4HK2 A;  1E5W A;  3NS8 A;  3RFZ B;  5AUK A;  1WGY A;  4LCD E;  3AE3 B;  3NZS A;  4RMA A;  3AU5 A;  4IUM B;  3UQB A;  1C4P A;  4YSZ B;  3VRB B;  5IN7 A;  4ICV A;  5BMH A;  3RYT A;  3HVD A;  3ZNZ B;  2EEL A;  1L4D B;  4JWS C;  3TIX A;  2KDE B;  3LB8 C;  1BML C;  5LLI A;  2D3C A;  2BKF A;  5AZF A;  2V3P A;  3KUD B;  4K7W A;  1Y56 A;  4EKU A;  1IBX B;  4HDQ A;  3AU4 A;  5DCN A;  4HJG E;  2FUG 1;  1MPE A;  4EZJ A;  3DPD A;  2R2O A;  4I6N B;  2AQ3 B;  4MSQ B;  4RCO A;  4PYU A;  2QMT A;  3WAO A;  1ESF A;  2MBB B;  2OHF A;  3V6E B;  4DXF A;  2WXL A;  3H9D A;  4GU2 A;  4TMA B;  2NBV B;  4WWN A;  3HUI A;  2KMC A;  2G9H D;  1HQR D;  3NUH B;  3PO0 A;  1J0G A;  2K25 A;  1L0Y B;  2AEH A;  3VUX A;  4BKT A;  4ZRI A;  3WAM A;  3ZW3 A;  2Q5W D;  3UGB B;  2BYF A;  4N9F 4;  3CIR B;  1YN5 A;  3N9Y C;  1F52 A;  3AE2 B;  1FFV A;  3OJ4 B;  3BYT B;  5JXV A;  2GOW A;  2N9E B;  2KZR A;  2FNJ B;  5H92 C;  4XC2 A;  1JQ4 A;  3P4Q B;  3A9J B;  3DWM A;  2BWE S;  3T8M A;  2HJ8 A;  2NPT A;  2J7Q B;  4W9E A;  2UU7 A;  1A5R A;  4K81 A;  2XEW A;  4F1S A;  2PMV A;  3QAQ A;  1UGJ A;  2ASQ A;  4WIP A;  1VDV A;  2CJO A;  1KM7 A;  3I3T B;  1T0Y A;  1WX7 A;  4YSX B;  2WXH A;  2NS5 A;  2BT6 A;  3Q69 A;  2MHJ A;  3SFE B;  4WQM A;  1VCB A;  3DBL I;  3N32 A;  2VRR B;  2FBW B;  1HZ6 A;  1T5X D;  3DCG A;  4OVZ A;  2FCM A;  1WXV A;  3APC A;  4ZOH C;  5GXG B;  1TKY A;  4M0W B;  4YTN B;  4W9F A;  1FD6 A;  1WGD A;  3N1X C;  3I63 C;  2LEK A;  2M1M A;  3Q8F A;  2LAS A;  1UEL A;  5EE3 A;  2N1W A;  4DWF A;  3ALB A;  3DWG C;  1E9M A;  2ZZP B;  2EKE C;  2JSV X;  1S3S G;  2GRI A;  2DZI A;  4H2A A;  4HKQ A;  3J9C A;  2WU2 B;  3IG3 A;  3M62 B;  4CYE A;  1KLU D;  4KIK A;  1SE9 A;  3QWZ B;  1I4X A;  2DHZ A;  2QC8 A;  1UD7 A;  2GMI C;  4IW0 A;  3DQV A;  2BQQ A;  5EDS A;  1ET6 A;  1P3Q U;  3B9J A;  2DZK A;  3VTV A;  1L6V A;  2V1Y A;  1WGR A;  4A90 A;  2IGD A;  1TZ1 A;  4PYZ A;  4W9H A;  3ECI A;  1DOI A;  5BYQ A;  4P1B C;  3UIO B;  2N7J A;  3EUB 2;  1G6J A;  2QDF A;  2J42 A;  3DBH I;  3EA6 A;  1E6E B;  2KAN A;  3RZW C;  3C8Y A;  3QX1 A;  2PE6 B;  3K9O B;  1F2R I;  1H8C A;  2AX5 A;  4ANV A;  4XX5 A;  1JWA D;  2IY1 B;  1WE6 A;  3QK0 A;  1JRP A;  1IYF A;  4FXC A;  4K3C A;  4LNN A;  3PLV A;  2KN5 A;  3QC8 B;  4IM3 A;  5DPR A;  2DEN B;  1WM3 A;  4OVU A;  2DAF A;  4TV3 A;  1OEY J;  2EMS A;  4ZRQ A;  4IWP A;  2FE8 A;  4ARI A;  4A55 A;  2ZW0 A;  3VUY A;  5CHV C;  2CU3 A;  1HE8 A;  3BVZ A;  1D5Z C;  2N7E A;  5IKC M;  1IBX A;  2KHW B;  3W1Y A;  1D5X C;  1YX6 B;  2M0X A;  4IWQ A;  1VZ6 A;  1SE3 A;  3MP9 A;  5IOI A;  1NYR A;  2C60 A;  5TR5 A;  5G5H A;  1FO4 A;  4FA6 A;  4PS7 A;  1FFU A;  1AN8 A;  1JAL A;  4S0R A;  2AWT A;  2WWZ A;  3Q3N C;  4DHJ B;  3RD2 A;  1BUI C;  2QSD A;  1QOG A;  2KJR A;  4US9 A;  2JX5 A;  2K6Q A;  1SJE D;  2JYE A;  1UGM A;  1L4Z B;  3KYD D;  3W1S A;  1DOY A;  4W9C A;  2G1E A;  1OEY A;  2YLM A;  2G45 B;  1QOF A;  1P98 A;  4GOC A;  1ZPS A;  4GLS C;  3NVV A;  1YQB A;  4NY0 A;  2Y5P A;  4BBN F;  3PLU A;  5AZH A;  1XXG A;  3X0W A;  1Q0W B;  4IG7 B;  2IPK D;  3VTU A;  3JW0 X;  4EUT A;  2FCN A;  1ZDX A;  5GMV A;  3RUL A;  4OW0 A;  3RNC C;  4BKS A;  2D3A A;  3PZ8 A;  4XGA B;  4A8X C;  3PGE A;  3W9C B;  2KVR A;  1AAR A;  5DPT A;  1NEK B;  2G4D B;  1PYW D;  4KSK C;  2J0K A;  2L0F A;  3L4P A;  3FC4 A;  3MC9 A;  2KK8 A;  1WJN A;  1UZX B;  4X57 B;  1MG4 A;  1NDD A;  2Y5B B;  3URY A;  4URK A;  2WHI A;  2Z0E B;  4RNA A;  2LGX A;  4BKS D;  3VXW A;  3TCA A;  1J19 A;  4B0E A;  2HTM E;  2M56 B;  3JVZ X;  4GDL B;  2BS2 B;  1UH6 A;  2JUO A;  1WMH B;  4HPL B;  4NAW B;  3NHE B;  1Q5W B;  3AM9 A;  1B1Z A;  1XLN A;  1WXM A;  3LJ3 A;  1QZE A;  1WE7 A;  1WZ0 A;  4LNI A;  1F1H A;  2WXG A;  3RNF C;  2D11 A;  1YJ1 A;  1YOV B;  2GBR A;  3FAH A;  2KWU B;  2RDH A;  2JXX A;  2KC1 A;  3IFW B;  3DOW A;  1V5O A;  1T6B X;  3PSE B;  5IA7 A;  2C9W B;  1BT0 A;  3T9L A;  2XN9 C;  1L5P A;  2K3U A;  3IVF A;  1EF1 A;  3AEG B;  4NNJ B;  4JLC A;  2N9K A;  1TKE A;  3Q8B A;  1ZP0 B;  1V86 A;  2WXN A;  1J7C A;  3DVN V;  3ZUN A;  3ZO5 B;  2WXI A;  3HM3 A;  1K50 A;  1RFK A;  3HHM A;  3PRP B;  3FKY A;  3AE4 B;  3B1L X;  4BKG A;  4P16 A;  2CS4 A;  2MH7 A;  4KVG B;  1PGA A;  2IGH A;  3I5J C;  3QCA A;  2KO3 A;  3NS1 A;  3MJ5 A;  2WXK A;  3IT6 B;  4XDC A;  3DVG Y;  4L23 A;  3VH3 B;  2IND C;  4I6L B;  4JGH B;  3PZ7 A;  4KGR A;  1CK1 A;  3H1U A;  3DVG X;  1V97 A;  3VUW A;  1JWS D;  3AE6 B;  2ZEQ A;  4TUU A;  5BMI A;  2IBI B;  1C76 A;  4WJQ A;  5EE9 A;  2LGS A;  2FAZ A;  2LGD A;  1AWD A;  3OWE B;  5E6O A; 
#chains in the Genus database with same CATH homology
 2V3P A;  1Y56 A;  2Y3A A;  1IBX B;  2AQ1 B;  1UWM A;  1V1P B;  3BII D;  4HJG E;  2D5G A;  2FUG 1;  1MPE A;  3W2D A;  4R3D A;  1WWT A;  2AQ3 B;  2BB5 A;  4RCO A;  2QMT A;  2DBY A;  1ESF A;  2OHF A;  2K22 A;  4DXF A;  4US8 A;  2WXL A;  5C3J B;  1ZE3 D;  1FRD A;  4TMA B;  3TEW A;  1ET9 A;  3MFG A;  3U4E G;  3HUI A;  1GAQ B;  1I4P A;  1YQ3 B;  3P4R B;  2G9H D;  1HQR D;  3NUH B;  2W55 A;  3PO0 A;  1IGC A;  1HZ5 A;  1MHX A;  3GP7 A;  1T3Q A;  3VRA B;  1CZP A;  1AYF A;  1L0Y B;  3AED B;  1V1O A;  1OQQ A;  1YJJ A;  2INP E;  1L0X B;  2R61 A;  1HEZ E;  2BB6 A;  2Q5W D;  3R2I A;  2W3S A;  4B0M A;  1NYQ A;  4CQN A;  3CIR B;  1YN5 A;  2M0A A;  3N9Y C;  4RF0 A;  3LXF A;  3AE2 B;  3HRD D;  1FFV A;  1N60 A;  3BYT B;  5JXV A;  4EE2 A;  4YSY B;  4M0W A;  3IXS A;  2B76 B;  2LJI A;  1J7B A;  2WLB A;  5H92 C;  2V0G A;  2JQR B;  4C56 C;  1JQ4 A;  2CJN A;  2RDG A;  2N0S B;  2V3N A;  2PIA A;  3P4Q B;  1UWX A;  4JX1 C;  4YT0 B;  1JWM D;  3DWM A;  2PKO A;  4NAM A;  2J52 A;  1VZ8 A;  2WXQ A;  3BWU D;  1TJE A;  2L32 A;  1TKG A;  4KKJ A;  2DWQ A;  1P7F A;  3E9S A;  2W3R A;  4OZB A;  2IGG A;  1OFF A;  1YN4 A;  4O1N A;  2K5P A;  5H8Y E;  5FR3 A;  3B2G A;  3R8B A;  1PFD A;  2QEJ C;  1FCC C;  1J7A A;  2JYT A;  2PMV A;  1FEH A;  1TY2 A;  2J53 A;  1EWC A;  2V4I B;  1ROE A;  1QIL A;  2H89 B;  1XCT L;  4ZHO A;  4USA A;  1UGJ A;  2XNA C;  2X38 A;  3P4S B;  4RGM A;  4RFB A;  4WIP A;  1JRO A;  1TS3 A;  1VDV A;  1YJI A;  2CJO A;  1HXY D;  2WQY B;  5BYS A;  2LFI A;  3V05 A;  4N6E B;  4YSX B;  2WXH A;  2BT6 A;  3Q69 A;  1SB3 C;  3NZ3 A;  5FK9 C;  1TS5 A;  4WQM A;  3SFE B;  5LNK 1;  1MHH E;  4TQ1 A;  5G5G A;  1OQR A;  1WYG A;  2FBW B;  3LYY A;  1HZ6 A;  2J4X A;  1T5X D;  1EM7 A;  4OVZ A;  4P6V F;  2WXM A;  2NTS A;  4ZOH C;  1YNT E;  3NVY A;  5BMG A;  5GXG B;  2K0P A;  5C2T B;  4ZYS A;  1C78 A;  4WAF A;  1TKY A;  3AH7 A;  3KLS X;  4YTN B;  2WDQ B;  1FD6 A;  3KQ4 A;  2JZP A;  4MAC A;  2I38 A;  1V8C A;  1ENF A;  1JWB D;  1GOZ A;  1SJH D;  2LEK A;  2KAC A;  1VJK A;  3I57 A;  3Q8F A;  5D3D A;  4XWW A;  1XLP A;  3IT4 B;  4NJC A;  5EE3 A;  3ZQ4 A;  2JXT A;  1SBB B;  1WRI A;  2KQ4 X;  2GB1 A;  1CQV A;  3AE1 B;  2WP9 B;  3DWG C;  1E9M A;  2JSV X;  2MJD A;  3BZD B;  3H8H A;  1HA5 A;  4N59 A;  4ZRP A;  5E6J A;  2I2Y A;  4Q2J A;  3VR8 B;  1ZUD 2;  3AE9 B;  2GRI A;  4GDK B;  2ACZ B;  2WXF A;  3AN1 A;  4H2A A;  1JCK B;  4HKQ A;  1RWS A;  3J9C A;  1R7S A;  3SFD B;  1E7P B;  1FIQ A;  2WU2 B;  2LHE A;  1KLU D;  3FIL B;  3CWI A;  1N62 A;  1I4X A;  2VZK D;  1EU4 A;  3Q8A A;  4KX6 B;  3BYY B;  2BTE A;  4L1B A;  1ET6 A;  2E6X A;  1PGB A;  3B9J A;  1L6V A;  2WXO A;  1MVK A;  4A90 A;  2IGD A;  3ZJU A;  4AS1 A;  3KWV A;  4NZL B;  1DOI A;  1WXQ A;  3P63 A;  5BYQ A;  1ZDV A;  4KGS A;  4ARC A;  4RH6 A;  1PDX A;  2ON8 A;  2N7J A;  3EUB 2;  3TEY A;  4RGN A;  2J42 A;  1YN3 A;  1QQR A;  3GS2 A;  1JWU D;  3EA6 A;  1E6E B;  2DLB A;  1SE2 A;  4YTM B;  3C8Y A;  1A70 A;  1YQ4 B;  1F2R I;  1I4R A;  2WXJ A;  3WCQ A;  3EGR A;  2AX5 A;  1JWA D;  5HFY A;  4HEA 1;  4IKG A;  2TSS A;  3V3X A;  2WU5 B;  2NTT A;  3AE5 B;  2WDV B;  5AUI A;  4AQ7 A;  4HKZ E;  3W5U B;  2BBC A;  2WDR B;  1VR9 A;  1JRP A;  3AEB B;  4XWT A;  1VLB A;  5HHD G;  4FXC A;  3NVZ A;  2INN E;  3TSS A;  1C77 A;  2ONQ A;  3BVM A;  3SR6 A;  3B2F A;  1DGJ A;  3I9V 1;  1JW9 D;  4LLG M;  4OZC A;  3ZJT A;  1NEN B;  1ACC A;  1XLQ A;  2JWU A;  2RMM A;  3P1M A;  2W54 A;  4MM3 B;  4RGT A;  4WH4 A;  4ZRQ A;  4UDU C;  2FE8 A;  3P4P B;  4ARI A;  4A55 A;  2ZW0 A;  1EWY C;  1TS4 A;  4TSS A;  2CU3 A;  2LMC A;  4JPS A;  1I4H A;  3T3N A;  2SAK A;  1XCQ L;  3BVZ A;  1AW7 A;  1D5Z C;  4PT5 A;  2Z8L A;  1IBX A;  1SXT A;  1D5X C;  1KFY B;  3HVZ A;  2QIE B;  3AE8 B;  2L83 A;  1VZ6 A;  4C80 A;  1SE3 A;  3MP9 A;  5EE0 A;  1NYR A;  3SEB A;  5G5H A;  1XEE A;  1FO4 A;  3BK2 A;  1NVI D;  1VZ7 A;  4ZHP A;  1FFU A;  1AN8 A;  1JAL A;  4XDD A;  3BVG A;  1BUI C;  2M19 A;  2QSD A;  1QOG A;  1ZXH A;  3O13 A;  1I4Q A;  2K9X A;  1QT9 A;  4US9 A;  3TEX A;  5I4D A;  2JX5 A;  4YWG G;  1TZO A;  1TS2 A;  1IUE A;  1SJE D;  2JYE A;  2KAJ A;  2BS4 B;  1L4Z B;  1D6E C;  1TY0 A;  2WXR A;  1F0Z A;  3RPF C;  1QF6 A;  1FNV A;  3W1S A;  5EE1 A;  1DOY A;  1IGD A;  1FXA A;  1I4G A;  1FM0 D;  2G1E A;  2Y5C A;  2ZW1 A;  1JML A;  4J3O D;  1SE4 A;  1E0Z A;  2LHD A;  1GPX A;  1KTK A;  1DYQ A;  1QOF A;  3TEZ A;  1ZPS A;  1F77 A;  1B9R A;  2HDE A;  4GLS C;  3NVV A;  3ZJV A;  1N5X A;  2Y5P A;  1KF6 B;  4A9A A;  2OED A;  1XXG A;  1L6U A;  4YTP B;  2MJE A;  2IPK D;  1GB4 A;  2EKI A;  3KWL A;  5BYR A;  1QOA A;  1ZDX A;  3ABV B;  2DYM A;  4MH8 A;  1RM6 C;  3AMZ A;  2NMQ A;  4IDI A;  2PW9 A;  4OW0 A;  3VQI A;  3PZ8 A;  4A8X C;  3ZYY X;  1FNU A;  2YEP B;  4MT5 A;  1XO3 A;  3W9C B;  1Q10 A;  1WSP A;  1SF0 A;  4D2K A;  4DQO C;  1N63 A;  1NEK B;  1GB1 A;  2LGI A;  5D3I B;  1PYW D;  1CJE A;  2PVG C;  2KMM A;  1K51 A;  3AB5 A;  3BK1 A;  3L4P A;  3R2T A;  4OZA A;  3U2S C;  3FC4 A;  2QJL A;  2L52 A;  1BXT A;  2LUM A;  2WS3 B;  3AEC B;  4RGO S;  3URY A;  2IDY A;  5HI1 A;  3AV8 A;  4YXD B;  4RNA A;  1P7E A;  3IAM 1;  2QIL A;  4HRS A;  1K53 A;  4B0E A;  2HTM E;  2M56 B;  3ETR A;  2MEK A;  4ITK A;  4DXG A;  2MJ3 A;  4GDL B;  2IJ0 A;  3AEF B;  2BS2 B;  4OHJ A;  3W5V B;  5HG2 A;  2YEP F;  1C4A A;  1KH0 A;  4KKI A;  1ZXI A;  1KRH A;  4WUR A;  1D4B A;  1C4C A;  4NAW B;  4C7Z A;  2VZK B;  4REZ A;  3AM9 A;  1B1Z A;  1XLN A;  3Q8C A;  3E56 A;  2WXG A;  1C79 A;  4A6Q A;  1DOX A;  3TUO A;  3FAH A;  1PGX A;  4TQ0 A;  2BW2 A;  1PUT A;  2RDH A;  2N9L A;  1F2R C;  4LK0 M;  1QLB B;  1ZOY B;  1T6B X;  1FCL A;  1L0V B;  1EU3 A;  1E10 A;  2XN9 C;  1QOB A;  2W82 A;  1L5P A;  2L1A A;  2KN4 A;  2K3U A;  4RF1 A;  3U7Z A;  5MPO A;  1UUP A;  2BYT A;  2WNM A;  3AEG B;  3GB1 A;  4JE3 B;  1VRA B;  1V1P A;  2BS3 B;  3AEA B;  4JWU C;  4KGT A;  3U52 E;  5FKA C;  3MC0 B;  1YMH E;  2N9K A;  1TKE A;  3AE7 B;  1WGK A;  1ZP0 B;  1D5M C;  3Q8B A;  1XF5 L;  2WXN A;  1J7C A;  1FMA D;  2JU6 X;  2WXI A;  1SSN A;  1K50 A;  1RFK A;  1STE A;  3ZGZ A;  2H88 B;  2PVO D;  1XLO A;  1FRR A;  3AE4 B;  3FIL A;  4P16 A;  1MI0 A;  2PTL A;  4XE0 A;  3NRZ A;  2ICI A;  2MH7 A;  1C9F A;  2E3T A;  1PGA A;  1SIJ A;  4L2Y A;  1N5W A;  1RYJ A;  1FNW A;  2IGH A;  3NVW A;  2GI9 A;  1N61 A;  1KLG D;  3MHZ A;  2KDM A;  4LTU A;  5T8I A;  4IOI E;  3NS1 A;  3MJ5 A;  1I7H A;  1LO5 D;  1FXI A;  2WXK A;  3IT6 B;  4XDC A;  3RFZ B;  4L23 A;  5AUK A;  1M4V A;  3PZ7 A;  1TYG B;  4KGR A;  3AE3 B;  4WWM A;  2DYO A;  1CK1 A;  1K52 A;  2PLP A;  2SEB D;  2KWD A;  5TSS A;  4N58 A;  1NI3 A;  4HRO A;  3T3O A;  1C4P A;  1V97 A;  2RPV A;  4YSZ B;  1JWS D;  3AE6 B;  2WXP A;  3P42 A;  3VRB B;  5BMH A;  5D7G A;  1QKZ A;  3HVD A;  3UI3 A;  2EEL A;  1L4D B;  5BMI A;  1C76 A;  1UNS A;  5EE9 A;  3IAS 1;  3VR9 B;  4JWS C;  1SEB D;  3AEE B;  2AQ2 B;  3LB8 C;  4C7Y A;  1BML C;  3Q8E A;  1AWD A;  3OWE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...