1JW9D

Structure of the native moeb-moad protein complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2001-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jw9D00
1F0ZA 1ZXIA 4JWSC 4USAA 3P1MA 4A9AA 5G5HA 3AH7A 1NVID 5GXGB 1QOFA 1JWBD 1PFDA 1R7SA 3NS1A 2W3SA 5C3JB 1GAQB 1VJKA 3AE6B 3NVYA 2DBYA 2Y5CA 2M19A 3B2FA 5H8YE 2JQRB 3VR9B 4YSXB 1J7BA 4KX6B 5AUIA 2H88B 2DWQA 3L4PA 1NEKB 1NYRA 3FAHA 1GPXA 1WRIA 1FMAD 3AE5B 4ITKA 2E3TA 2QJLA 3AV8A 3P4QB 3CIRB 3AEEB 2MJ3A 2K9XA 5AUKA 5EE9A 2Q5WD 1JQ4A 1YQ3B 1ZOYB 1RFKA 3P4RB 4LTUA 5C2TB 1JW9D 3AEGB 3P63A 1ZUD2 2BS4B 2MH7A 5G5GA 4JX1C 2CJNA 3AE8B 3NVVA 2CJOA 2WLBA 3AN1A 1FFVA 3B2GA 3P4SB 1E7PB 5EE0A 1KF6B 1SIJA 1NYQA 1N62A 2OHFA 2WDVB 1JWAD 4JWUC 1TKGA 3AEBB 2FBWB 2AX5A 2W54A 4IDIA 2LEKA 4YXDB 1E10A 2WU5B 2K5PA 2CU3A 3W9CB 1SF0A 2MJDA 3EUB2 3VRAB 2W55A 2WDQB 2WS3B 3VRBB 1V97A 1L0VB 1AWDA 1N60A 1QOBA 2HTME 1XO3A 3AECB 3DWGC 3LXFA 4HROA 1RM6C 1I7HA 2MJEA 2WU2B 3BIID 5EE1A 4US9A 4FXCA 1A70A 3AE3B 1VDVA 3AE7B 1E9MA 3ETRA 4ZHPA 1XLNA 3DWMA 1QT9A 1RWSA 1NI3A 2KAJA 2PKOA 1PDXA 2WQYB 3AB5A 1YQ4B 2WDRB 2KMMA 3PO0A 3SR6A 2H89B 3VR8B 2L52A 1QF6A 1TKEA 3SFEB 3AM9A 3HVZA 3AEAB 2M56B 1QLBB 3NVWA 1CZPA 1FM0D 2WP9B 3W5UB 1B9RA 1E6EB 1YJIA 2BT6A 4YTMB 1ROEA 4N59A 3WCQA 4C7ZA 1XLQA 2W3RA 4YSYB 3HRDD 4WWMA 1XLPA 4YT0B 1KFYB 1J7AA 1UWMA 1CJEA 4US8A 1TKYA 1FFUA 2ACZB 2JX5A 1FO4A 1DGJA 3ZYYX 1T3QA 1N63A 1L6VA 1FXIA 1FRDA 4YTNB 4N6EB 5MPOA 1FRRA 2BS3B 1EWYC 1FXAA 3CWIA 3KWLA 4YSZB 3B9JA 4N58A 3NRZA 1WYGA 1PUTA 1WGKA 3HUIA 4C80A 3SFDB 1KRHA 1N61A 2B76B 4WQMA 3W5VB 1J7CA 3FC4A 3AMZA 1L6UA 1E0ZA 2PVGC 1VLBA 3AE4B 3LB8C 3AEDB 1L5PA 2K22A 1WXQA 1ZP0B 3AE1B 2G1EA 1NENB 3AE2B 1N5WA 1V8CA 3AEFB 3ABVB 1N5XA 1TYGB 1JRPA 1SB3C 2BS2B 1JALA 1OQRA 1DOXA 1OQQA 1WWTA 1AYFA 1DOIA 2QIEB 2EKIA 4C7YA 4ZHOA 2N0SB 5H92C 3NVZA 3RPFC 3P4PB 4ZOHC 4YTPB 2PIAA 2L83A 1TJEA 1FIQA 1XLOA 5EE3A 1QOAA 1OFFA 3AE9B 4P6VF 1YJJA 4HRSA 2PVOD 1QOGA 1DOYA 1JROA 1IUEA 1RYJA
chains in the Genus database with same CATH superfamily
2BYTA 1E7VA 3APCA 3IFWB 4UDUC 3VH3B 3ZIMA 2JYTA 1I4PA 3KW5B 3L54A 2C7HA 4YSXB 2IGHA 3URYA 3U30A 2LHEA 3L4PA 3ZJVA 3VDZA 2KLCA 2KMAA 3AV8A 3CIRB 3MFGA 2WNMA 4N9F4 2AQ1B 2WLBA 3O65B 3P4SB 2OHFA 4HDOA 2CU3A 3MHZA 1WJ4A 4OVVA 2CS4A 2LWPA 3UI3A 1L0VB 3DWGC 2YEPB 2QCZA 2N9PC 4PYUA 3ETRA 2ZJDA 2Z0EB 3A4RA 3SR6A 3AB5A 4ARIA 2KNBA 1KLUD 3C8YA 2K3UA 4YTMB 2IO2B 4GXBA 4WWMA 5E6NA 2J52A 4Q2JA 3L13A 2KZRA 1FO4A 1TBEA 1T3QA 1N63A 4O1NA 2NTTA 1RAXA 3SEBA 2KDEB 3N20C 1J19A 4ZRKA 4AUQC 4DDGD 1SE4A 3ZQ4A 3MJ5A 4ACFA 2LRUA 2BYVE 3ZKJC 4W9FA 5LXIB 1C4AA 1OEYA 3I3TB 4RGTA 3L17A 3PLUA 1GB4A 1L4DB 1HTQA 1GOZA 5H92C 2JYEA 3HK0A 3ZXRA 2N9LA 3AE9B 1YJJA 4XX5A 2KX3A 3V62A 1VCBA 2FCSA 2JY6A 2O6VA 4MGKE 1E5WA 3B2FA 3GZNB 4LLGM 2V4IB 3OJ3A 2Z0DB 3AU5A 4C56C 3P4QB 3ML9A 3V60A 3Q69A 2XK5A 3JYUA 1NYQA 2UYZB 3M62B 4II2B 4NY0A 3AEBB 2FBWB 2ZPNA 3TSSA 3BK2A 4MSMB 2AWTA 2RD0A 3D32A 4URKA 3DPDA 4IKGA 1E9MA 3BY4B 4EZJA 1ZGUB 2GOWA 1NI3A 1PDXA 3Q3FA 4EZKA 4NAMA 1JWMD 3RNGC 1CZPA 3KH0A 4GU2A 1WXVA 2FIFA 5IKCM 1JCKB 5BMIA 1DGJA 2PLPA 1E8WA 2JRIB 5D3DA 2JVCA 3HUIA 4MH0E 4OHJA 1J7CA 1C76A 2KANA 4RFBA 2Z8LA 1C4PA 2AL6A 1E8XA 1N5WA 4L1BA 1TYGB 4M0WB 4HPMB 2K8BA 2M1MA 3K9PB 3V3XA 2MEKA 4IWQA 1WIAA 1FNWA 1NI2A 1FCCC 4GDKB 1OFFA 1TZOA 3HIZA 1IYFA 1EWCA 2NPTA 2L8JA 4BOSC 1MFWA 3ZNGC 3GE3C 2LGYA 1PYWD 2KWVB 3KQ4A 4PS7A 4KKJA 4IWPA 2LZ6A 2L0FA 3VR9B 3APFA 3RT3B 5AZGA 4A8XC 2JZPA 1XCQL 4P1CC 3A33B 4ZRJA 4B6WA 5AEKB 3FILA 4WJOA 5L83A 3VUWA 1ZOYB 1XQQA 1L0YB 1UNSA 4B9KA 1UZXB 3C19A 1RLFA 4C4VA 4G3XB 2PW9A 3CF6E 1YQBA 3U52E 3TL5A 2WXHA 4K1RB 3H7PB 3IT6B 1EU4A 3GOEA 2MJDA 3VRAB 4M8MA 3L10B 2JSVX 2BW2A 2IO3B 1K50A 1R4NB 1RM6C 2DHZA 2AQ2B 4ZYSA 1EUVB 4HJGE 2X38A 2WQYB 1K51A 3L0WB 2JZZA 1TKEA 1NDDA 2O2VA 4GB9A 3UIOB 4WAFA 1XLPA 1VD2A 3BK1A 4CYEA 2ACZB 2V3PA 4OVUA 5TSSA 1WR1A 3RNBC 2JT4B 5D6JB 1UGJA 1WYGA 2D10A 3QHTA 4RH6A 2B76B 3RNFC 4F1SA 3EHVA 4ICVA 5D94A 1F2RC 2N7DA 4K3CA 4NQKE 1JALA 2DYMA 4FJYA 4YWGG 1N6ZA 3ECIA 3L08A 4GIVA 2LGIA 5DCNA 3NVZA 3RZFA 1FIQA 2NCNA 4PK1A 1QOAA 3DVGX 4BKTA 4NNJB 4AQ7A 1AARA 4NAWA 1QOGA 1C1YB 2W9NA 5G5HA 5GXGB 1LO5D 1Z2MA 3WAPA 4KX6B 2H88B 2GBMA 3N1YC 3RZWC 3ZRFA 4XC2A 2DX5B 2KOXA 5C2TB 4ARCA 3PZ7A 1YMHE 4MJSA 4A3OA 2JXTA 1SIJA 3QAQA 2WDVB 3RYTA 4ZDVA 2INNE 4GLSC 4YXDB 2KDBA 2REXA 3W9CB 2CHZA 1WJUA 2W55A 3ZJUA 3VRBB 1WM3A 3ZTDA 3LXFA 4FXCA 2Z59B 3A1QA 4A90A 1V5OA 3GS2A 4N59A 5T8IA 4NJCA 2W3RA 4I6LB 3HM6X 3PRPB 4DK5A 1EU3A 4NJ6A 2JX5A 1FXTB 4RM9A 1TGZB 2FUG1 4BVUC 3B9JA 5J17A 5IN7A 1WGKA 1GC7A 5AZFA 2FNJB 3B08A 4C80A 3SFDB 3Q3JA 5HI1A 2INPE 2EKEC 4MSQB 1C3TA 2ZW0A 3V6CB 3DOWA 2BS2B 3I9V1 1DOXA 1DOIA 3DDCB 2LXCA 2WDTB 3NHEB 4GGQA 4HRSA 1KLVA 2NMQA 4JWSC 4K3BA 4W9KA 4ASWC 1QOFA 2KN4A 2KN5A 2L05A 1SE2A 4B95A 1L7YA 5DPWA 2DBYA 1SE3A 3SHQA 1FMAD 2D2QA 3AEEB 4LCDE 1DYQA 2BB5A 2GBJA 4HKQA 2FCNA 4HXDA 2KJHB 5GMVA 3N1ZC 4ZRIA 2ZCCA 3TMPB 2NTSA 5EE0A 1KF6B 2ZZPB 1I4HA 4K7SA 1V6EA 2WXRA 4J6IA 1TIFA 1P7EA 2XEWA 1ESFA 2J0KA 4NQLB 3DWMA 3X23A 1RWSA 3QQ8B 3DBHI 2PKOA 3R2IA 3RULA 3H8HA 2LGDA 3MC9A 3VR8B 1MG4A 1V80A 4LJPB 1SEBD 2BF8B 4C7ZA 3AXCA 1UWMA 2L76A 3ZNID 3RFZB 3NRZA 1KH0A 2D5GA 2KJ6A 4HDQA 2BVCA 4JIOU 1N61A 3W5VB 3DHIC 3FC4A 3KYDD 1L6UA 5FK9C 1GC6A 2RDGA 2MBEA 3DVGY 2LMCA 4IWOA 4W9LA 3AEFB 3ABVB 1TS2A 2IPKD 1ZXHA 4RMAA 1SGHA 3JSVA 3DVNV 1GJZA 4MGIE 2PIAA 4BFRA 1TJEA 2KHWB 2RSUA 2DENB 2LRWA 1ZPSA 4LNKA 5C3JB 2GLSA 2LXAA 3AE6B 3RD2A 1L4ZB 3ZDMC 1J0GA 5IAAC 2K6QA 1J7BA 3LJ3A 4ZRPA 3N30A 1WRIA 2YVCA 3VTVA 2KT7A 2ZVOA 3CSFA 4W9DA 2KC1A 1WFYA 1XXGA 2YLMA 3B2GA 2INCC 5E6PA 4F8CB 2B3AA 4BAXA 2C7MB 5L95C 2KKCA 2WXOA 1SF0A 3AU4A 4DHZB 2IO1B 2BWES 4BKSD 2R61A 4P16A 4L23A 5EE1A 2NBWB 1XLNA 1QT9A 3PHXB 3QARA 2LI5A 2KMMA 1QF6A 3AM9A 3E56A 1V1PB 3C0RB 3WAMA 3EC8A 4AJYB 3WCQA 1XLQA 4M02A 3BYYB 3RMKC 1L6VA 2QILA 1ZDVA 3CWIA 2FAZA 4FA6A 3AI5A 1JWSD 1WX9A 4WQMA 4CQNA 2E6XA 1VLBA 3LB8C 1ET6A 5HG2A 3FKYA 1WXAA 1VRAB 3PZDA 1UELA 3QJZA 4WQOB 2V3NA 1YJ1A 1WGHA 3H7PA 3UQAA 2N7EA 1AW7A 2EMTA 1WE6A 4XWTA 2O6VD 1F0ZA 1ET9A 2IY1B 5LLIA 1D5MC 3NVYA 3QA8A 1STEA 2Y5CA 4EOYA 1WX8A 2DWQA 2QC8A 2M17A 2ZNVB 1Q5WB 4KKIA 2N9EB 4IG7B 4NZLB 5BO4B 5CHWA 1I4RA 2GRIA 3H6NA 4KGSA 1JW9D 4IOIE 2KVZA 2LUMA 2LUEA 2MBBB 5G5GA 5HFYA 1D5XC 3ZRCA 2DZKA 3P42A 2CJOA 4S0RA 5LNK1 4H2AA 3VVWB 2RPQA 1YIWA 3Q3MC 5C23A 3WANA 2VZKD 2LVPA 1P3QU 4C00A 3R7RA 4KGTA 3EECA 4KSKC 3DVNU 3HVDA 2DYBA 2KWDA 2L32A 1CMXB 5JXVA 4LK0M 3BWUD 1VDVA 3Q8CA 3PLVA 2MBHA 2KQSA 1S1QB 2WX0A 1K52A 2RGFA 2DNFA 2WX1A 1QLBB 1WZ0A 4FBJB 1YJIA 3VQIA 3RCZA 1FNVA 1V9JA 3MP9A 1FRDA 1D6EC 2JWUA 4GN1A 1EWYC 4A6QA 3QCAA 2CKHB 4MELA 4X57B 4EEWA 3RUIB 1WSPA 1SBBB 1HA5A 4NAWB 1MHXA 2V9HA 3ZO5B 3VTUA 2JZ3B 2OOBB 2BKRB 1V8CA 3RN9C 2GBNA 3R3MA 4ANUA 4HWIB 3CSTA 2HE7A 3RPFC 4YTPB 2KO3A 1E8YA 3OG5A 2N9XA 2JF5A 2DAFA 2ON8A 1JROA 1QKZA 4W9HA 3P1MA 1NVID 4REZA 1JWBD 2RDBC 2KYWA 4K7UA 3KUDB 3QIJA 2ZNVC 4DXAB 1K8RB 1WX7A 2V0GA 4BOZB 2JQRB 2ONQA 2AL3A 2WXKA 1NEKB 4HVBA 4AS1A 1GPXA 1TTNA 4MGZE 4P1BC 3N32A 3ZUNA 2G9HD 1YQ3B 3W1YA 2NBUA 5E6JA 3PHWB 3UINB 1TS5A 1G6JA 4PS3A 3ALBA 4DHJB 2LEKA 3WAOA 3VXWA 2DZJA 1C79A 3EUB2 2KVRA 4IM0A 5D3IB 3NY5A 1QOBA 4HEA1 3Q8FA 2MJEA 4ZYNA 3E9SA 3AE3B 3T3OA 3AE7B 1TZ1A 3APDA 1V1OA 3VAWA 2K6DB 4W9GA 4GDLB 1V49A 2XNAC 4JL9A 3JVZX 1ROEA 1FEHA 4G0NB 3KWVA 1CJEA 2KXJA 2JUOA 3A9JB 4MT5A 2D11A 1KTKA 2JXXA 3DBSA 2ZPYA 4FJZA 3PZ8A 2L00B 1Q1OA 2PE6B 1EM7A 1T0SC 4JGHB 2QSDA 1MI0A 2NVUI 1U4AA 3PTFC 2PVGC 3EFUA 3TBLD 1ZP0B 1D3ZA 1T6BX 1AN8A 1Q0WB 1WWTA 1LFDA 3Q14C 1WJNA 4ZHOA 3VTWA 4MEMA 4DXGA 2WXJA 3RI7C 3PSEB 4GDLA 3U2SC 3BINA 1MJDA 4MGYE 4B0EA 1F1HA 1ZW7A 3SD5A 1R7SA 4A55A 2O6VB 4WURA 2V3SA 1V86A 5H8YE 2TSSA 4TQ1A 4KGRA 1OQYA 2FCMA 2QJLA 1L0XB 3IHPC 1XF5L 1J8CA 4FJVB 1I4GA 5LXHA 5BMGA 1HEZE 4HCNB 4JX1C 3AE8B 4HLEA 4IW0A 3BVZA 2N4FA 2KFJA 3BVGA 3U7DA 4FN2A 4MDKE 1HZ6A 2G4SA 2G3QB 1TT5B 2KWCA 1HTOA 1GG3A 2KACA 1N60A 4HK2A 2QEJC 1I7HA 3OLMD 4ZHPA 3RNCC 2NBVB 1D4BA 1V5TA 2L7RA 3R2TA 3NVWA 4BBNC 1OGWA 2HDEA 4KIKB 1J7AA 4YT0B 4JPSA 2GI9A 1C9FA 4TV3A 1FXAA 1LGRA 4CHKA 3IAS1 1PUTA 3I57A 2KWUB 2MQJA 3BYTB 2NPTB 1P1AA 2K22A 3Q8AA 4M01A 2X8XX 3W1SA 5D7GA 1NENB 3NZSA 4BZAA 4J3OD 4IUMB 4KV2A 3P4PB 1TS4A 4ZOHC 5EE3A 2G45B 3K9OB 4S17A 2A5UA 2K0PA 1R4MB 4USAA 3H9DA 4M00A 5EDSA 2J0JA 3MJWA 1YNTE 2KDIA 4FHJA 4XGAB 1IBXB 4WWNA 3PPAA 3Q3NC 5I4DA 3QWZB 1NYRA 2I1KA 2BTEA 2MJ3A 2MCNB 2MP2A 1IGDA 1JQ4A 3VFKA 4IC7B 3AEGB 3PRMB 5KHQA 2MW5A 3T3NA 1WGDA 1WI0A 4JWUC 2LGXA 2QMTA 1OEYJ 1SSNA 1PGBA 4IM3A 1PGAA 1XO3A 1EF1A 4W9CA 2QHOA 5CX3A 4OZBA 2KMCA 2KFKB 4RM8A 4ANXA 2J4XA 3N9YC 2D3GA 2KQ4X 2V1YA 2CR5A 2WP9B 1E6EB 1WE7A 3ZVVA 1SJHD 1I4QA 5BYQA 1ISNA 5MPOA 1UUPA 2IBIB 1C4CA 3JSVB 2I2YA 3WALA 4G50A 3PREA 3SU8X 3U7ZA 4B0MA 3PGEA 4DDID 2LHDA 2G1EA 3IG3A 3WIMA 2WXPA 1R4NI 1SJED 3Q6BA 3UIPB 3UF8A 3EFCA 4M8NA 3PT2B 3UQBA 2D3AA 4KDIC 1IUEA 3T8MA 5HKHA 3NS1A 2ZEQA 1WM2A 3DBLI 2R2QA 2NS5A 4MACA 1FNUA 2EMSA 2M4NA 1WXMA 2J42A 1XD3B 1Z5SB 2WHIA 2FE8A 2N9KA 4GDKA 4EUTA 1E90A 2YEPF 4W9EA 2RPVA 5EE9A 3DBRB 3TUOA 1RFKA 2J7QB 1V2YA 2D07B 4EE2A 2CJNA 3NVVA 4XWWA 3T9LA 4F7ZA 1GUAB 4JQWC 1EO6A 2BYEA 4RNAA 1RRBA 1E7UA 3VHTC 5G55A 3OJ4B 3ML8A 2WS3B 4AWJA 2HTME 4C7YA 4HROA 4RGNA 3PV1A 4KZCA 3EA6A 4JLCA 3A1QB 3PO0A 3R8BA 2L52A 4G11A 2MBQA 1WYWB 2ZCBA 1YOVB 3L16A 1UH6A 2D3CA 2BYFA 1ENFA 4YSYB 2GMIC 3NZUA 2KDFB 4PT5A 4CO7A 4YTNB 5KHOA 3R66C 3S2AA 2A4ZA 2L3ZA 2WGSA 2VZKB 2DYOA 1E0ZA 1XCTL 2FIDA 4ZRQA 5J2RA 1H8CA 1LQBA 1Y56A 2IGDA 2WXIA 4BKGA 2DAJA 2MWSB 1AYFA 1C77A 2M0AA 4WJQA 3M95A 3P2BA 1XLOA 5E6OA 4GMVA 3KLSX 1DOYA 1JRUA 4RF0A 3DBHB 2SAKA 2BWFA 4A9AA 2OEDA 2LFIA 2MLBA 1CQVA 3DHHC 3W1SC 3FAHA 3A9KB 2J53A 3AE5B 1P9DU 4TMAB 1ZDXA 4ICUA 5DPTA 4E3CA 4R3DA 1YX6B 3SDLC 2HJ8A 3P4RB 4ANVA 2VH2A 2ASQA 4PS8A 4I6NB 2KK8A 4K7WA 2LASA 3H7SA 5D2MB 4LNOA 2WYQA 4IDIA 2IY0B 5AZHA 2V4LA 3TEYA 1AWDA 3I63C 1VZ8A 3GB1A 3DBLB 2PPHA 5J18A 4DBGA 3AULA 1T0YA 2KAJA 5JZEB 5BYSA 1HE8A 1H4RA 1SIFA 2BT6A 4LNIA 3ONSA 1D5ZC 1QZEA 3OWEB 3GE8C 2L0TA 3V05A 1OTRB 4TSSA 5FR6A 1FXIA 4RCOA 4N6EB 2BPSA 3IT4B 3VH4B 4DHZE 3IBEA 3A9JA 4N58A 4C4VB 3QX1A 1PQSA 3U8ZA 3AMZA 1KOTA 2Y3AA 2DZMA 4DXFA 4FLHA 1L5PA 1L2NA 1WF9A 2L1AA 3Q2AC 4EZLA 1JWUD 2LJ5A 3IXSA 2PVOD 4KVGB 2AQ3B 3JW0X 3NS8A 1RYJA 2RDHA 2UWQA 3M3JA 4OVZA 4YL8A 1KM7A 3W2DA 4LNFA 2M19A 2MA9B 2CU1A 3EGRA 3MC0B 3RNEC 1SXTA 2E3TA 5HHDG 1UBQA 2LD9A 3TCAA 2KD0A 5AUKA 1WZ3A 3MHSD 2C60A 1MHHE 4LTUA 3P63A 4DQOC 1ZUD2 2MH7A 3TJPA 4TKNA 2GB1A 1FFVA 2BGFA 1F77A 1E7PB 4AP4C 2LJIA 1N62A 4W9JA 2C9WB 1C78A 2BBCA 2N1VA 5IA7A 2HTHA 2LVOA 1TY0A 2LGSA 2VRRB 2KQ7A 3AECB 3NJTA 3ENEA 1UBIA 1TS3A 1WGYA 1BUIC 1YQ4B 2H89B 4WIPA 2ZVNA 3HVZA 1WY8A 4TUUA 2M56B 2IO0B 1UGMA 4P7IA 4FADA 5C1ZA 2C7NB 4RGMA 1HQRD 4NPNA 2W82A 1IGCA 4US8A 1FFUA 2LVQA 1ZKHA 4A20A 1XEEA 3IAM1 5CHFA 2KLGA 3KWLA 4MM3B 4FULA 2Y5BB 1V81A 5DPRA 3V61A 3A4SC 3NZ3A 4WWPA 3ZNHB 1K53A 4BBNF 4EFOA 3ZDTA 2PEAA 3AEDB 3Q3OC 2WXLA 1IBXA 1WXSA 3ZTCA 3GP7A 1OQRA 3NUHB 4OZCA 2GBRA 3IVFA 4WAAA 3CMMB 2GBKA 2AYOB 1T5XD 1B1ZA 3H1UA 4P6VF 3TIXA 1XT9B 3AH7A 3RNAC 3ZXVA 3ZJTA 1HZ5A 2CHXA 4LNNA 4MM3A 4QAYA 1HXYD 4WWOA 2OJRA 3O13A 2FUHB 2IYDB 1FPYA 4E71A 2PTLA 2BQQA 1WMHB 1I42A 3DBRI 2DZIA 1WR6E 1I4XA 4RF1A 4E74A 1F2RI 4KIKA 2WXQA 3AN1A 3PRZA 1SE9A 1R4MI 1WJ6A 2KTFA 4W9IA 1FCLA 2WXNA 1EF5A 2W54A 1E10A 1IP9A 4II3B 5CHVC 2JWZA 2KJRA 2PE9A 2WDQB 1Q10A 3B0AA 2MRPA 3KUCB 3BIID 1KLGD 4US9A 3ZNZB 1KJTA 3M63B 4FHKA 4D2KA 2WDRB 2CHWA 3N3KB 2WXMA 3AEAB 1RFAA 2SEBD 1B9RA 2MP2B 3J9CA 1CK1A 4JE3B 3U4EG 2QDFA 1TKYA 4HCPB 1M4VA 2IDYA 4M0WA 1FRRA 1MG8A 2UU7A 2K8HA 1GB1A 4WH4A 3AE4B 1M94A 1MVKA 2O2VB 2WXFA 2AEHA 4HJKA 3OAWA 1SB3C 4LDTB 2KFKA 1S3SG 4IM2A 1X1MA 3PVLA 4HPLB 1IPGA 1BT0A 3ZLZA 2ICIA 1ZXIA 3VUYA 1P7FA 4GOCA 1GAQB 1VJKA 2D3BA 3N1XC 1WGRA 4AOFA 5CTRC 4KDLB 5IOIA 1E8ZA 3A9KA 4ITKA 1QILA 2HD5B 3WA0A 2Q5WD 2KDMA 2PJHA 2JU6X 2BS4B 2I38A 2KTRA 2IGGA 2XK5B 4DHJD 3R7QA 2KTRB 5TR5A 1MPEA 4XYCA 3PS6A 1WGGA 3KYCD 1TKGA 1TY2A 2WU5B 3LYYA 2K1FA 3DCGA 3ZW3A 4OZAA 1V97A 4A3PA 3BVMA 3MTNB 1ZE3D 3HHMA 4NJ7A 4MH8A 3HM3A 1ACCA 4TQ0A 4KSLC 2RR9A 1UWXA 3SFEB 4WJNA 4PYZA 2DLBA 3W5UB 2KC2A 4XZ4A 4MJSB 1KFYB 4OW0A 2HJ1A 1T0RC 1JMLA 4BKSA 2EELA 4XDCA 4YSZB 1YX5B 2Y5PA 2MBOA 1BXTA 1BMLC 1WH3A 4EKUA 1V1PA 3GZNI 4WJPA 1UD7A 3NG0A 2M0XA 5FR3A 2MX2A 3AE2B 3LDZE 3UGBB 1JRPA 2G4DB 4K81A 1OQQA 4XE0A 2QIEB 3TEZA 2INDC 2OJWA 3NOBA 5JH5C 3I5JC 2K8CA 3ZGZA 1Y8RC 1WRDB 3TEWA 2IZVB 1PFDA 2W3SA 2FCQA 2BKFA 1FD6A 2WXGA 1YN3A 5JHBA 5AUIA 2NR2A 2M8SA 3QK0A 4GSWA 2XN9C 2K9XA 1LXDA 1VR9A 3QC8B 3Q8BA 1I35A 5DPSA 2C5LC 3X0WA 3KUZA 1JWAD 4AJWA 4LJOB 2IJ0A 2AX5A 2K5PA 2ZW1A 2WWZA 1WMHA 3DHGC 2K39A 2WU2B 3DQVA 1YD8U 1A70A 1P98A 2JPHA 1F9JA 1YN4A 2BB6A 4DWFA 3VUXA 5G2NA 1NBFC 4XDDA 1FM0D 2PMVA 5BMHA 1VZ6A 2MSED 3HRDD 1VZ7A 1QQRA 5JHAA 1T0QC 4ANWA 2MHJA 4KZ0A 3V6EB 3B1LX 3ZYYX 5IP4D 2BS3B 2KX0A 3BZDB 2RMMA 1P0RA 4RGOS 2XBBC 1KRHA 2J0MA 3MC8A 4HPPA 1YN5A 3TEXA 1UF0A 1WXQA 3AE1B 3FILB 2I1JA 4HKZE 2JRHA 2K25A 1N5XA 2VH1A 1F52A 2N7JA 3KVFB 1PGXA 5BYRA 2EKIA 2N1WA 3Q8EA 2N0SB 4LDTD 1GNUA 4I6PA 2L83A 5FKAC 2R2OA 1LM8B 5IO9A 4L2YA 1A5RA
chains in the Genus database with same CATH topology
2BYTA 4JWSC 4B0EA 2RDHA 4UDUC 1QOFA 1R7SA 4OVZA 2KN4A 4A55A 1SE2A 2JYTA 4WURA 1I4PA 3W2DA 2DBYA 1SE3A 2M19A 3EGRA 3MC0B 5H8YE 4YSXB 2IGHA 3URYA 2TSSA 4TQ1A 2LHEA 3L4PA 4KGRA 1SXTA 1FMAD 2E3TA 3ZJVA 5HHDG 2QJLA 3AV8A 1L0XB 3CIRB 3AEEB 3MFGA 1DYQA 1XF5L 5AUKA 1I4GA 2BB5A 4HKQA 1MHHE 4LTUA 2WNMA 5BMGA 3P63A 4DQOC 1ZUD2 1HEZE 2MH7A 2AQ1B 4JX1C 3AE8B 2GB1A 2WLBA 1FFVA 3P4SB 1F77A 1E7PB 2NTSA 1KF6B 2LJIA 3BVZA 5EE0A 1N62A 2OHFA 3BVGA 1HZ6A 1I4HA 2CU3A 3MHZA 1C78A 2BBCA 2KACA 3UI3A 1TY0A 1L0VB 2WXRA 1N60A 3AECB 2QEJC 3DWGC 2YEPB 1I7HA 1P7EA 1TS3A 1ESFA 3ETRA 4ZHPA 3DWMA 1RWSA 1BUIC 1D4BA 2PKOA 3SR6A 3AB5A 3R2IA 1YQ4B 3H8HA 3VR8B 2H89B 4WIPA 4ARIA 1KLUD 3C8YA 3R2TA 2K3UA 3HVZA 2M56B 3NVWA 4YTMB 1SEBD 4RGMA 4C7ZA 1HQRD 4WWMA 2HDEA 2J52A 1J7AA 2W82A 4Q2JA 4YT0B 1UWMA 1IGCA 4US8A 1FFUA 1FO4A 4JPSA 1T3QA 1N63A 4O1NA 2GI9A 2NTTA 1XEEA 3IAM1 1C9FA 1FXAA 3KWLA 3SEBA 4MM3B 3RFZB 3NRZA 3IAS1 1KH0A 1PUTA 2D5GA 3I57A 1SE4A 3BYTB 3NZ3A 3ZQ4A 1N61A 3MJ5A 3W5VB 1K53A 3FC4A 1L6UA 5FK9C 3AEDB 2K22A 2RDGA 3Q8AA 2WXLA 1IBXA 3W1SA 5D7GA 1NENB 2LMCA 3AEFB 3ABVB 4J3OD 1C4AA 1TS2A 2IPKD 1ZXHA 3GP7A 4RGTA 1OQRA 3NUHB 4OZCA 1GB4A 1L4DB 1GOZA 5H92C 2JYEA 1TS4A 3P4PB 4ZOHC 2PIAA 5EE3A 1TJEA 1T5XD 1B1ZA 2K0PA 2N9LA 3AE9B 1YJJA 4P6VF 1ZPSA 4USAA 3AH7A 1YNTE 3ZJTA 5C3JB 1HZ5A 1IBXB 3AE6B 1HXYD 3B2FA 1L4ZB 5I4DA 1J7BA 3O13A 4ZRPA 4LLGM 2V4IB 1NYRA 1WRIA 2PTLA 2BTEA 4C56C 3P4QB 2MJ3A 1IGDA 1I4XA 1JQ4A 4RF1A 1XXGA 1F2RI 3AEGB 3Q69A 2WXQA 3AN1A 3T3NA 3B2GA 1NYQA 4JWUC 1FCLA 2WXNA 3AEBB 2FBWB 2QMTA 3TSSA 2W54A 1E10A 2WXOA 3BK2A 1SSNA 1SF0A 1PGBA 2WDQB 1Q10A 1PGAA 2R61A 1XO3A 4P16A 4L23A 3BIID 1KLGD 5EE1A 4US9A 4IKGA 1E9MA 4OZBA 1XLNA 1QT9A 4D2KA 1NI3A 1PDXA 2WDRB 2KMMA 1QF6A 4NAMA 2J4XA 1JWMD 3N9YC 2WXMA 3AM9A 3AEAB 2KQ4X 1CZPA 2WP9B 3E56A 2SEBD 1B9RA 1E6EB 1V1PB 1SJHD 3J9CA 3WCQA 1CK1A 1XLQA 4JE3B 1JCKB 1I4QA 5BYQA 3BYYB 5BMIA 3U4EG 1TKYA 1DGJA 2PLPA 1L6VA 1M4VA 2IDYA 4M0WA 2QILA 1ZDVA 5D3DA 1FRRA 5MPOA 1UUPA 3CWIA 1JWSD 1C4CA 3HUIA 2I2YA 4OHJA 1GB1A 4WQMA 4CQNA 1J7CA 2E6XA 1C76A 4WH4A 4RFBA 3U7ZA 4B0MA 1VLBA 3AE4B 3LB8C 1MVKA 1C4PA 2Z8LA 1ET6A 5HG2A 2LHDA 2WXFA 2G1EA 1N5WA 1VRAB 4L1BA 1TYGB 2WXPA 1SB3C 1SJED 3V3XA 2MEKA 2V3NA 1FNWA 1FCCC 4GDKB 1AW7A 1OFFA 1TZOA 1EWCA 4XWTA 2ICIA 1IUEA 1F0ZA 1ET9A 1ZXIA 1PYWD 3NS1A 3KQ4A 1P7FA 1GAQB 1D5MC 1VJKA 4KKJA 3NVYA 4MACA 1FNUA 1STEA 2Y5CA 3VR9B 2J42A 2DWQA 4A8XC 2JZPA 4ITKA 1XCQL 4KKIA 2FE8A 2N9KA 1QILA 2YEPF 4NZLB 2RPVA 3FILA 5EE9A 2Q5WD 1I4RA 2GRIA 2KDMA 1ZOYB 4KGSA 1RFKA 3TUOA 2JU6X 1JW9D 4EE2A 4IOIE 2BS4B 2I38A 1L0YB 2LUMA 1UNSA 2IGGA 5G5GA 5HFYA 1D5XC 2CJNA 3NVVA 3P42A 2CJOA 5LNK1 4XWWA 1MPEA 4H2AA 2PW9A 3U52E 2VZKD 2WXHA 1TKGA 4KGTA 3IT6B 4RNAA 1TY2A 2WU5B 1EU4A 3LYYA 2MJDA 3VRAB 3HVDA 2JSVX 4OZAA 2WS3B 1V97A 2KWDA 2BW2A 2L32A 1K50A 2HTME 3BVMA 4C7YA 4HROA 4RGNA 1RM6C 5JXVA 1ZE3D 4MH8A 4LK0M 2AQ2B 3BWUD 4ZYSA 1VDVA 1ACCA 3Q8CA 4TQ0A 3EA6A 4HJGE 1K52A 2X38A 2WQYB 3PO0A 1K51A 3R8BA 1UWXA 2L52A 1TKEA 3SFEB 2DLBA 1QLBB 3W5UB 1YJIA 3VQIA 4YSYB 1ENFA 4WAFA 1XLPA 1KFYB 4OW0A 1FNVA 3BK1A 2ACZB 2V3PA 5TSSA 3MP9A 1JMLA 4PT5A 1FRDA 2EELA 4YTNB 1D6EC 2JWUA 1EWYC 4XDCA 1UGJA 4A6QA 4YSZB 1WYGA 2Y5PA 2VZKB 2DYOA 1WSPA 4RH6A 1BXTA 2B76B 1BMLC 1SBBB 1E0ZA 1HA5A 1V1PA 1XCTL 4NAWB 1MHXA 1F2RC 4ZRQA 1Y56A 5FR3A 3AE2B 1V8CA 2IGDA 2WXIA 1JRPA 1JALA 2DYMA 1OQQA 4XE0A 2QIEB 1AYFA 4YWGG 2LGIA 3TEZA 3NVZA 1C77A 2M0AA 3RPFC 4YTPB 1FIQA 1XLOA 1QOAA 3KLSX 4AQ7A 3ZGZA 1DOYA 1QOGA 2ON8A 1JROA 4RF0A 3TEWA 1QKZA 2SAKA 3P1MA 4A9AA 5G5HA 5GXGB 1NVID 4REZA 1JWBD 1PFDA 2OEDA 2W3SA 1FD6A 2LFIA 1LO5D 2WXGA 1YN3A 2V0GA 2JQRB 1CQVA 2ONQA 4KX6B 5AUIA 2H88B 2WXKA 1NEKB 1GPXA 3FAHA 4AS1A 2J53A 3AE5B 4TMAB 1ZDXA 2XN9C 2K9XA 1VR9A 2G9HD 4R3DA 1YQ3B 3P4RB 3Q8BA 5C2TB 3PZ7A 4ARCA 1YMHE 5E6JA 1TS5A 2JXTA 1SIJA 2WDVB 1JWAD 2IJ0A 2INNE 2AX5A 4GLSC 4IDIA 2LEKA 4YXDB 2K5PA 2ZW1A 1C79A 3W9CB 3EUB2 3TEYA 2W55A 3ZJUA 3VRBB 1AWDA 5D3IB 1QOBA 4HEA1 3LXFA 3Q8FA 2MJEA 1VZ8A 2WU2B 3GB1A 4FXCA 1A70A 3E9SA 3AE3B 3T3OA 3AE7B 1YN4A 2KAJA 1V1OA 2BB6A 5BYSA 4A90A 4GDLB 2XNAC 4XDDA 1FM0D 3GS2A 2BT6A 1ROEA 4N59A 1FEHA 2PMVA 1D5ZC 5T8IA 4NJCA 2W3RA 5BMHA 1VZ6A 3HRDD 1VZ7A 1QQRA 3OWEB 3KWVA 1CJEA 1EU3A 3V05A 2JX5A 3ZYYX 4MT5A 4TSSA 1FXIA 4RCOA 4N6EB 2BS3B 1KTKA 2FUG1 3IT4B 3BZDB 3PZ8A 3B9JA 4N58A 2RMMA 1WGKA 4RGOS 4C80A 1EM7A 3SFDB 1KRHA 2QSDA 5HI1A 1MI0A 3AMZA 2Y3AA 1YN5A 2PVGC 3TEXA 4DXFA 1L5PA 1WXQA 2INPE 1ZP0B 2L1AA 3AE1B 3FILB 4HKZE 2ZW0A 1N5XA 1T6BX 1JWUD 2BS2B 2N7JA 1AN8A 3I9V1 1PGXA 1DOXA 1WWTA 1DOIA 5BYRA 2EKIA 3Q8EA 4ZHOA 2N0SB 4DXGA 5FKAC 2L83A 3IXSA 2WXJA 4L2YA 4HRSA 2PVOD 2AQ3B 3U2SC 2NMQA 1RYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F0Z A;  1ZXI A;  4JWS C;  4USA A;  3P1M A;  4A9A A;  5G5H A;  3AH7 A;  1NVI D;  5GXG B;  1QOF A;  1JWB D;  1PFD A;  1R7S A;  3NS1 A;  2W3S A;  5C3J B;  1GAQ B;  1VJK A;  3AE6 B;  3NVY A;  2DBY A;  2Y5C A;  2M19 A;  3B2F A;  5H8Y E;  2JQR B;  3VR9 B;  4YSX B;  1J7B A;  4KX6 B;  5AUI A;  2H88 B;  2DWQ A;  3L4P A;  1NEK B;  1NYR A;  3FAH A;  1GPX A;  1WRI A;  1FMA D;  3AE5 B;  4ITK A;  2E3T A;  2QJL A;  3AV8 A;  3P4Q B;  3CIR B;  3AEE B;  2MJ3 A;  2K9X A;  5AUK A;  5EE9 A;  2Q5W D;  1JQ4 A;  1YQ3 B;  1ZOY B;  1RFK A;  3P4R B;  4LTU A;  5C2T B;  1JW9 D;  3AEG B;  3P63 A;  1ZUD 2;  2BS4 B;  2MH7 A;  5G5G A;  4JX1 C;  2CJN A;  3AE8 B;  3NVV A;  2CJO A;  2WLB A;  3AN1 A;  1FFV A;  3B2G A;  3P4S B;  1E7P B;  5EE0 A;  1KF6 B;  1SIJ A;  1NYQ A;  1N62 A;  2OHF A;  2WDV B;  1JWA D;  4JWU C;  1TKG A;  3AEB B;  2FBW B;  2AX5 A;  2W54 A;  4IDI A;  2LEK A;  4YXD B;  1E10 A;  2WU5 B;  2K5P A;  2CU3 A;  3W9C B;  1SF0 A;  2MJD A;  3EUB 2;  3VRA B;  2W55 A;  2WDQ B;  2WS3 B;  3VRB B;  1V97 A;  1L0V B;  1AWD A;  1N60 A;  1QOB A;  2HTM E;  1XO3 A;  3AEC B;  3DWG C;  3LXF A;  4HRO A;  1RM6 C;  1I7H A;  2MJE A;  2WU2 B;  3BII D;  5EE1 A;  4US9 A;  4FXC A;  1A70 A;  3AE3 B;  1VDV A;  3AE7 B;  1E9M A;  3ETR A;  4ZHP A;  1XLN A;  3DWM A;  1QT9 A;  1RWS A;  1NI3 A;  2KAJ A;  2PKO A;  1PDX A;  2WQY B;  3AB5 A;  1YQ4 B;  2WDR B;  2KMM A;  3PO0 A;  3SR6 A;  2H89 B;  3VR8 B;  2L52 A;  1QF6 A;  1TKE A;  3SFE B;  3AM9 A;  3HVZ A;  3AEA B;  2M56 B;  1QLB B;  3NVW A;  1CZP A;  1FM0 D;  2WP9 B;  3W5U B;  1B9R A;  1E6E B;  1YJI A;  2BT6 A;  4YTM B;  1ROE A;  4N59 A;  3WCQ A;  4C7Z A;  1XLQ A;  2W3R A;  4YSY B;  3HRD D;  4WWM A;  1XLP A;  4YT0 B;  1KFY B;  1J7A A;  1UWM A;  1CJE A;  4US8 A;  1TKY A;  1FFU A;  2ACZ B;  2JX5 A;  1FO4 A;  1DGJ A;  3ZYY X;  1T3Q A;  1N63 A;  1L6V A;  1FXI A;  1FRD A;  4YTN B;  4N6E B;  5MPO A;  1FRR A;  2BS3 B;  1EWY C;  1FXA A;  3CWI A;  3KWL A;  4YSZ B;  3B9J A;  4N58 A;  3NRZ A;  1WYG A;  1PUT A;  1WGK A;  3HUI A;  4C80 A;  3SFD B;  1KRH A;  1N61 A;  2B76 B;  4WQM A;  3W5V B;  1J7C A;  3FC4 A;  3AMZ A;  1L6U A;  1E0Z A;  2PVG C;  1VLB A;  3AE4 B;  3LB8 C;  3AED B;  1L5P A;  2K22 A;  1WXQ A;  1ZP0 B;  3AE1 B;  2G1E A;  1NEN B;  3AE2 B;  1N5W A;  1V8C A;  3AEF B;  3ABV B;  1N5X A;  1TYG B;  1JRP A;  1SB3 C;  2BS2 B;  1JAL A;  1OQR A;  1DOX A;  1OQQ A;  1WWT A;  1AYF A;  1DOI A;  2QIE B;  2EKI A;  4C7Y A;  4ZHO A;  2N0S B;  5H92 C;  3NVZ A;  3RPF C;  3P4P B;  4ZOH C;  4YTP B;  2PIA A;  2L83 A;  1TJE A;  1FIQ A;  1XLO A;  5EE3 A;  1QOA A;  1OFF A;  3AE9 B;  4P6V F;  1YJJ A;  4HRS A;  2PVO D;  1QOG A;  1DOY A;  1JRO A;  1IUE A;  1RYJ A; 
#chains in the Genus database with same CATH topology
 2BYT A;  1E7V A;  3APC A;  3IFW B;  4UDU C;  3VH3 B;  3ZIM A;  2JYT A;  1I4P A;  3KW5 B;  3L54 A;  2C7H A;  4YSX B;  2IGH A;  3URY A;  3U30 A;  2LHE A;  3L4P A;  3ZJV A;  3VDZ A;  2KLC A;  2KMA A;  3AV8 A;  3CIR B;  3MFG A;  2WNM A;  4N9F 4;  2AQ1 B;  2WLB A;  3O65 B;  3P4S B;  2OHF A;  4HDO A;  2CU3 A;  3MHZ A;  1WJ4 A;  4OVV A;  2CS4 A;  2LWP A;  3UI3 A;  1L0V B;  3DWG C;  2YEP B;  2QCZ A;  2N9P C;  4PYU A;  3ETR A;  2ZJD A;  2Z0E B;  3A4R A;  3SR6 A;  3AB5 A;  4ARI A;  2KNB A;  1KLU D;  3C8Y A;  2K3U A;  4YTM B;  2IO2 B;  4GXB A;  4WWM A;  5E6N A;  2J52 A;  4Q2J A;  3L13 A;  2KZR A;  1FO4 A;  1TBE A;  1T3Q A;  1N63 A;  4O1N A;  2NTT A;  1RAX A;  3SEB A;  2KDE B;  3N20 C;  1J19 A;  4ZRK A;  4AUQ C;  4DDG D;  1SE4 A;  3ZQ4 A;  3MJ5 A;  4ACF A;  2LRU A;  2BYV E;  3ZKJ C;  4W9F A;  5LXI B;  1C4A A;  1OEY A;  3I3T B;  4RGT A;  3L17 A;  3PLU A;  1GB4 A;  1L4D B;  1HTQ A;  1GOZ A;  5H92 C;  2JYE A;  3HK0 A;  3ZXR A;  2N9L A;  3AE9 B;  1YJJ A;  4XX5 A;  2KX3 A;  3V62 A;  1VCB A;  2FCS A;  2JY6 A;  2O6V A;  4MGK E;  1E5W A;  3B2F A;  3GZN B;  4LLG M;  2V4I B;  3OJ3 A;  2Z0D B;  3AU5 A;  4C56 C;  3P4Q B;  3ML9 A;  3V60 A;  3Q69 A;  2XK5 A;  3JYU A;  1NYQ A;  2UYZ B;  3M62 B;  4II2 B;  4NY0 A;  3AEB B;  2FBW B;  2ZPN A;  3TSS A;  3BK2 A;  4MSM B;  2AWT A;  2RD0 A;  3D32 A;  4URK A;  3DPD A;  4IKG A;  1E9M A;  3BY4 B;  4EZJ A;  1ZGU B;  2GOW A;  1NI3 A;  1PDX A;  3Q3F A;  4EZK A;  4NAM A;  1JWM D;  3RNG C;  1CZP A;  3KH0 A;  4GU2 A;  1WXV A;  2FIF A;  5IKC M;  1JCK B;  5BMI A;  1DGJ A;  2PLP A;  1E8W A;  2JRI B;  5D3D A;  2JVC A;  3HUI A;  4MH0 E;  4OHJ A;  1J7C A;  1C76 A;  2KAN A;  4RFB A;  2Z8L A;  1C4P A;  2AL6 A;  1E8X A;  1N5W A;  4L1B A;  1TYG B;  4M0W B;  4HPM B;  2K8B A;  2M1M A;  3K9P B;  3V3X A;  2MEK A;  4IWQ A;  1WIA A;  1FNW A;  1NI2 A;  1FCC C;  4GDK B;  1OFF A;  1TZO A;  3HIZ A;  1IYF A;  1EWC A;  2NPT A;  2L8J A;  4BOS C;  1MFW A;  3ZNG C;  3GE3 C;  2LGY A;  1PYW D;  2KWV B;  3KQ4 A;  4PS7 A;  4KKJ A;  4IWP A;  2LZ6 A;  2L0F A;  3VR9 B;  3APF A;  3RT3 B;  5AZG A;  4A8X C;  2JZP A;  1XCQ L;  4P1C C;  3A33 B;  4ZRJ A;  4B6W A;  5AEK B;  3FIL A;  4WJO A;  5L83 A;  3VUW A;  1ZOY B;  1XQQ A;  1L0Y B;  1UNS A;  4B9K A;  1UZX B;  3C19 A;  1RLF A;  4C4V A;  4G3X B;  2PW9 A;  3CF6 E;  1YQB A;  3U52 E;  3TL5 A;  2WXH A;  4K1R B;  3H7P B;  3IT6 B;  1EU4 A;  3GOE A;  2MJD A;  3VRA B;  4M8M A;  3L10 B;  2JSV X;  2BW2 A;  2IO3 B;  1K50 A;  1R4N B;  1RM6 C;  2DHZ A;  2AQ2 B;  4ZYS A;  1EUV B;  4HJG E;  2X38 A;  2WQY B;  1K51 A;  3L0W B;  2JZZ A;  1TKE A;  1NDD A;  2O2V A;  4GB9 A;  3UIO B;  4WAF A;  1XLP A;  1VD2 A;  3BK1 A;  4CYE A;  2ACZ B;  2V3P A;  4OVU A;  5TSS A;  1WR1 A;  3RNB C;  2JT4 B;  5D6J B;  1UGJ A;  1WYG A;  2D10 A;  3QHT A;  4RH6 A;  2B76 B;  3RNF C;  4F1S A;  3EHV A;  4ICV A;  5D94 A;  1F2R C;  2N7D A;  4K3C A;  4NQK E;  1JAL A;  2DYM A;  4FJY A;  4YWG G;  1N6Z A;  3ECI A;  3L08 A;  4GIV A;  2LGI A;  5DCN A;  3NVZ A;  3RZF A;  1FIQ A;  2NCN A;  4PK1 A;  1QOA A;  3DVG X;  4BKT A;  4NNJ B;  4AQ7 A;  1AAR A;  4NAW A;  1QOG A;  1C1Y B;  2W9N A;  5G5H A;  5GXG B;  1LO5 D;  1Z2M A;  3WAP A;  4KX6 B;  2H88 B;  2GBM A;  3N1Y C;  3RZW C;  3ZRF A;  4XC2 A;  2DX5 B;  2KOX A;  5C2T B;  4ARC A;  3PZ7 A;  1YMH E;  4MJS A;  4A3O A;  2JXT A;  1SIJ A;  3QAQ A;  2WDV B;  3RYT A;  4ZDV A;  2INN E;  4GLS C;  4YXD B;  2KDB A;  2REX A;  3W9C B;  2CHZ A;  1WJU A;  2W55 A;  3ZJU A;  3VRB B;  1WM3 A;  3ZTD A;  3LXF A;  4FXC A;  2Z59 B;  3A1Q A;  4A90 A;  1V5O A;  3GS2 A;  4N59 A;  5T8I A;  4NJC A;  2W3R A;  4I6L B;  3HM6 X;  3PRP B;  4DK5 A;  1EU3 A;  4NJ6 A;  2JX5 A;  1FXT B;  4RM9 A;  1TGZ B;  2FUG 1;  4BVU C;  3B9J A;  5J17 A;  5IN7 A;  1WGK A;  1GC7 A;  5AZF A;  2FNJ B;  3B08 A;  4C80 A;  3SFD B;  3Q3J A;  5HI1 A;  2INP E;  2EKE C;  4MSQ B;  1C3T A;  2ZW0 A;  3V6C B;  3DOW A;  2BS2 B;  3I9V 1;  1DOX A;  1DOI A;  3DDC B;  2LXC A;  2WDT B;  3NHE B;  4GGQ A;  4HRS A;  1KLV A;  2NMQ A;  4JWS C;  4K3B A;  4W9K A;  4ASW C;  1QOF A;  2KN4 A;  2KN5 A;  2L05 A;  1SE2 A;  4B95 A;  1L7Y A;  5DPW A;  2DBY A;  1SE3 A;  3SHQ A;  1FMA D;  2D2Q A;  3AEE B;  4LCD E;  1DYQ A;  2BB5 A;  2GBJ A;  4HKQ A;  2FCN A;  4HXD A;  2KJH B;  5GMV A;  3N1Z C;  4ZRI A;  2ZCC A;  3TMP B;  2NTS A;  5EE0 A;  1KF6 B;  2ZZP B;  1I4H A;  4K7S A;  1V6E A;  2WXR A;  4J6I A;  1TIF A;  1P7E A;  2XEW A;  1ESF A;  2J0K A;  4NQL B;  3DWM A;  3X23 A;  1RWS A;  3QQ8 B;  3DBH I;  2PKO A;  3R2I A;  3RUL A;  3H8H A;  2LGD A;  3MC9 A;  3VR8 B;  1MG4 A;  1V80 A;  4LJP B;  1SEB D;  2BF8 B;  4C7Z A;  3AXC A;  1UWM A;  2L76 A;  3ZNI D;  3RFZ B;  3NRZ A;  1KH0 A;  2D5G A;  2KJ6 A;  4HDQ A;  2BVC A;  4JIO U;  1N61 A;  3W5V B;  3DHI C;  3FC4 A;  3KYD D;  1L6U A;  5FK9 C;  1GC6 A;  2RDG A;  2MBE A;  3DVG Y;  2LMC A;  4IWO A;  4W9L A;  3AEF B;  3ABV B;  1TS2 A;  2IPK D;  1ZXH A;  4RMA A;  1SGH A;  3JSV A;  3DVN V;  1GJZ A;  4MGI E;  2PIA A;  4BFR A;  1TJE A;  2KHW B;  2RSU A;  2DEN B;  2LRW A;  1ZPS A;  4LNK A;  5C3J B;  2GLS A;  2LXA A;  3AE6 B;  3RD2 A;  1L4Z B;  3ZDM C;  1J0G A;  5IAA C;  2K6Q A;  1J7B A;  3LJ3 A;  4ZRP A;  3N30 A;  1WRI A;  2YVC A;  3VTV A;  2KT7 A;  2ZVO A;  3CSF A;  4W9D A;  2KC1 A;  1WFY A;  1XXG A;  2YLM A;  3B2G A;  2INC C;  5E6P A;  4F8C B;  2B3A A;  4BAX A;  2C7M B;  5L95 C;  2KKC A;  2WXO A;  1SF0 A;  3AU4 A;  4DHZ B;  2IO1 B;  2BWE S;  4BKS D;  2R61 A;  4P16 A;  4L23 A;  5EE1 A;  2NBW B;  1XLN A;  1QT9 A;  3PHX B;  3QAR A;  2LI5 A;  2KMM A;  1QF6 A;  3AM9 A;  3E56 A;  1V1P B;  3C0R B;  3WAM A;  3EC8 A;  4AJY B;  3WCQ A;  1XLQ A;  4M02 A;  3BYY B;  3RMK C;  1L6V A;  2QIL A;  1ZDV A;  3CWI A;  2FAZ A;  4FA6 A;  3AI5 A;  1JWS D;  1WX9 A;  4WQM A;  4CQN A;  2E6X A;  1VLB A;  3LB8 C;  1ET6 A;  5HG2 A;  3FKY A;  1WXA A;  1VRA B;  3PZD A;  1UEL A;  3QJZ A;  4WQO B;  2V3N A;  1YJ1 A;  1WGH A;  3H7P A;  3UQA A;  2N7E A;  1AW7 A;  2EMT A;  1WE6 A;  4XWT A;  2O6V D;  1F0Z A;  1ET9 A;  2IY1 B;  5LLI A;  1D5M C;  3NVY A;  3QA8 A;  1STE A;  2Y5C A;  4EOY A;  1WX8 A;  2DWQ A;  2QC8 A;  2M17 A;  2ZNV B;  1Q5W B;  4KKI A;  2N9E B;  4IG7 B;  4NZL B;  5BO4 B;  5CHW A;  1I4R A;  2GRI A;  3H6N A;  4KGS A;  1JW9 D;  4IOI E;  2KVZ A;  2LUM A;  2LUE A;  2MBB B;  5G5G A;  5HFY A;  1D5X C;  3ZRC A;  2DZK A;  3P42 A;  2CJO A;  4S0R A;  5LNK 1;  4H2A A;  3VVW B;  2RPQ A;  1YIW A;  3Q3M C;  5C23 A;  3WAN A;  2VZK D;  2LVP A;  1P3Q U;  4C00 A;  3R7R A;  4KGT A;  3EEC A;  4KSK C;  3DVN U;  3HVD A;  2DYB A;  2KWD A;  2L32 A;  1CMX B;  5JXV A;  4LK0 M;  3BWU D;  1VDV A;  3Q8C A;  3PLV A;  2MBH A;  2KQS A;  1S1Q B;  2WX0 A;  1K52 A;  2RGF A;  2DNF A;  2WX1 A;  1QLB B;  1WZ0 A;  4FBJ B;  1YJI A;  3VQI A;  3RCZ A;  1FNV A;  1V9J A;  3MP9 A;  1FRD A;  1D6E C;  2JWU A;  4GN1 A;  1EWY C;  4A6Q A;  3QCA A;  2CKH B;  4MEL A;  4X57 B;  4EEW A;  3RUI B;  1WSP A;  1SBB B;  1HA5 A;  4NAW B;  1MHX A;  2V9H A;  3ZO5 B;  3VTU A;  2JZ3 B;  2OOB B;  2BKR B;  1V8C A;  3RN9 C;  2GBN A;  3R3M A;  4ANU A;  4HWI B;  3CST A;  2HE7 A;  3RPF C;  4YTP B;  2KO3 A;  1E8Y A;  3OG5 A;  2N9X A;  2JF5 A;  2DAF A;  2ON8 A;  1JRO A;  1QKZ A;  4W9H A;  3P1M A;  1NVI D;  4REZ A;  1JWB D;  2RDB C;  2KYW A;  4K7U A;  3KUD B;  3QIJ A;  2ZNV C;  4DXA B;  1K8R B;  1WX7 A;  2V0G A;  4BOZ B;  2JQR B;  2ONQ A;  2AL3 A;  2WXK A;  1NEK B;  4HVB A;  4AS1 A;  1GPX A;  1TTN A;  4MGZ E;  4P1B C;  3N32 A;  3ZUN A;  2G9H D;  1YQ3 B;  3W1Y A;  2NBU A;  5E6J A;  3PHW B;  3UIN B;  1TS5 A;  1G6J A;  4PS3 A;  3ALB A;  4DHJ B;  2LEK A;  3WAO A;  3VXW A;  2DZJ A;  1C79 A;  3EUB 2;  2KVR A;  4IM0 A;  5D3I B;  3NY5 A;  1QOB A;  4HEA 1;  3Q8F A;  2MJE A;  4ZYN A;  3E9S A;  3AE3 B;  3T3O A;  3AE7 B;  1TZ1 A;  3APD A;  1V1O A;  3VAW A;  2K6D B;  4W9G A;  4GDL B;  1V49 A;  2XNA C;  4JL9 A;  3JVZ X;  1ROE A;  1FEH A;  4G0N B;  3KWV A;  1CJE A;  2KXJ A;  2JUO A;  3A9J B;  4MT5 A;  2D11 A;  1KTK A;  2JXX A;  3DBS A;  2ZPY A;  4FJZ A;  3PZ8 A;  2L00 B;  1Q1O A;  2PE6 B;  1EM7 A;  1T0S C;  4JGH B;  2QSD A;  1MI0 A;  2NVU I;  1U4A A;  3PTF C;  2PVG C;  3EFU A;  3TBL D;  1ZP0 B;  1D3Z A;  1T6B X;  1AN8 A;  1Q0W B;  1WWT A;  1LFD A;  3Q14 C;  1WJN A;  4ZHO A;  3VTW A;  4MEM A;  4DXG A;  2WXJ A;  3RI7 C;  3PSE B;  4GDL A;  3U2S C;  3BIN A;  1MJD A;  4MGY E;  4B0E A;  1F1H A;  1ZW7 A;  3SD5 A;  1R7S A;  4A55 A;  2O6V B;  4WUR A;  2V3S A;  1V86 A;  5H8Y E;  2TSS A;  4TQ1 A;  4KGR A;  1OQY A;  2FCM A;  2QJL A;  1L0X B;  3IHP C;  1XF5 L;  1J8C A;  4FJV B;  1I4G A;  5LXH A;  5BMG A;  1HEZ E;  4HCN B;  4JX1 C;  3AE8 B;  4HLE A;  4IW0 A;  3BVZ A;  2N4F A;  2KFJ A;  3BVG A;  3U7D A;  4FN2 A;  4MDK E;  1HZ6 A;  2G4S A;  2G3Q B;  1TT5 B;  2KWC A;  1HTO A;  1GG3 A;  2KAC A;  1N60 A;  4HK2 A;  2QEJ C;  1I7H A;  3OLM D;  4ZHP A;  3RNC C;  2NBV B;  1D4B A;  1V5T A;  2L7R A;  3R2T A;  3NVW A;  4BBN C;  1OGW A;  2HDE A;  4KIK B;  1J7A A;  4YT0 B;  4JPS A;  2GI9 A;  1C9F A;  4TV3 A;  1FXA A;  1LGR A;  4CHK A;  3IAS 1;  1PUT A;  3I57 A;  2KWU B;  2MQJ A;  3BYT B;  2NPT B;  1P1A A;  2K22 A;  3Q8A A;  4M01 A;  2X8X X;  3W1S A;  5D7G A;  1NEN B;  3NZS A;  4BZA A;  4J3O D;  4IUM B;  4KV2 A;  3P4P B;  1TS4 A;  4ZOH C;  5EE3 A;  2G45 B;  3K9O B;  4S17 A;  2A5U A;  2K0P A;  1R4M B;  4USA A;  3H9D A;  4M00 A;  5EDS A;  2J0J A;  3MJW A;  1YNT E;  2KDI A;  4FHJ A;  4XGA B;  1IBX B;  4WWN A;  3PPA A;  3Q3N C;  5I4D A;  3QWZ B;  1NYR A;  2I1K A;  2BTE A;  2MJ3 A;  2MCN B;  2MP2 A;  1IGD A;  1JQ4 A;  3VFK A;  4IC7 B;  3AEG B;  3PRM B;  5KHQ A;  2MW5 A;  3T3N A;  1WGD A;  1WI0 A;  4JWU C;  2LGX A;  2QMT A;  1OEY J;  1SSN A;  1PGB A;  4IM3 A;  1PGA A;  1XO3 A;  1EF1 A;  4W9C A;  2QHO A;  5CX3 A;  4OZB A;  2KMC A;  2KFK B;  4RM8 A;  4ANX A;  2J4X A;  3N9Y C;  2D3G A;  2KQ4 X;  2V1Y A;  2CR5 A;  2WP9 B;  1E6E B;  1WE7 A;  3ZVV A;  1SJH D;  1I4Q A;  5BYQ A;  1ISN A;  5MPO A;  1UUP A;  2IBI B;  1C4C A;  3JSV B;  2I2Y A;  3WAL A;  4G50 A;  3PRE A;  3SU8 X;  3U7Z A;  4B0M A;  3PGE A;  4DDI D;  2LHD A;  2G1E A;  3IG3 A;  3WIM A;  2WXP A;  1R4N I;  1SJE D;  3Q6B A;  3UIP B;  3UF8 A;  3EFC A;  4M8N A;  3PT2 B;  3UQB A;  2D3A A;  4KDI C;  1IUE A;  3T8M A;  5HKH A;  3NS1 A;  2ZEQ A;  1WM2 A;  3DBL I;  2R2Q A;  2NS5 A;  4MAC A;  1FNU A;  2EMS A;  2M4N A;  1WXM A;  2J42 A;  1XD3 B;  1Z5S B;  2WHI A;  2FE8 A;  2N9K A;  4GDK A;  4EUT A;  1E90 A;  2YEP F;  4W9E A;  2RPV A;  5EE9 A;  3DBR B;  3TUO A;  1RFK A;  2J7Q B;  1V2Y A;  2D07 B;  4EE2 A;  2CJN A;  3NVV A;  4XWW A;  3T9L A;  4F7Z A;  1GUA B;  4JQW C;  1EO6 A;  2BYE A;  4RNA A;  1RRB A;  1E7U A;  3VHT C;  5G55 A;  3OJ4 B;  3ML8 A;  2WS3 B;  4AWJ A;  2HTM E;  4C7Y A;  4HRO A;  4RGN A;  3PV1 A;  4KZC A;  3EA6 A;  4JLC A;  3A1Q B;  3PO0 A;  3R8B A;  2L52 A;  4G11 A;  2MBQ A;  1WYW B;  2ZCB A;  1YOV B;  3L16 A;  1UH6 A;  2D3C A;  2BYF A;  1ENF A;  4YSY B;  2GMI C;  3NZU A;  2KDF B;  4PT5 A;  4CO7 A;  4YTN B;  5KHO A;  3R66 C;  3S2A A;  2A4Z A;  2L3Z A;  2WGS A;  2VZK B;  2DYO A;  1E0Z A;  1XCT L;  2FID A;  4ZRQ A;  5J2R A;  1H8C A;  1LQB A;  1Y56 A;  2IGD A;  2WXI A;  4BKG A;  2DAJ A;  2MWS B;  1AYF A;  1C77 A;  2M0A A;  4WJQ A;  3M95 A;  3P2B A;  1XLO A;  5E6O A;  4GMV A;  3KLS X;  1DOY A;  1JRU A;  4RF0 A;  3DBH B;  2SAK A;  2BWF A;  4A9A A;  2OED A;  2LFI A;  2MLB A;  1CQV A;  3DHH C;  3W1S C;  3FAH A;  3A9K B;  2J53 A;  3AE5 B;  1P9D U;  4TMA B;  1ZDX A;  4ICU A;  5DPT A;  4E3C A;  4R3D A;  1YX6 B;  3SDL C;  2HJ8 A;  3P4R B;  4ANV A;  2VH2 A;  2ASQ A;  4PS8 A;  4I6N B;  2KK8 A;  4K7W A;  2LAS A;  3H7S A;  5D2M B;  4LNO A;  2WYQ A;  4IDI A;  2IY0 B;  5AZH A;  2V4L A;  3TEY A;  1AWD A;  3I63 C;  1VZ8 A;  3GB1 A;  3DBL B;  2PPH A;  5J18 A;  4DBG A;  3AUL A;  1T0Y A;  2KAJ A;  5JZE B;  5BYS A;  1HE8 A;  1H4R A;  1SIF A;  2BT6 A;  4LNI A;  3ONS A;  1D5Z C;  1QZE A;  3OWE B;  3GE8 C;  2L0T A;  3V05 A;  1OTR B;  4TSS A;  5FR6 A;  1FXI A;  4RCO A;  4N6E B;  2BPS A;  3IT4 B;  3VH4 B;  4DHZ E;  3IBE A;  3A9J A;  4N58 A;  4C4V B;  3QX1 A;  1PQS A;  3U8Z A;  3AMZ A;  1KOT A;  2Y3A A;  2DZM A;  4DXF A;  4FLH A;  1L5P A;  1L2N A;  1WF9 A;  2L1A A;  3Q2A C;  4EZL A;  1JWU D;  2LJ5 A;  3IXS A;  2PVO D;  4KVG B;  2AQ3 B;  3JW0 X;  3NS8 A;  1RYJ A;  2RDH A;  2UWQ A;  3M3J A;  4OVZ A;  4YL8 A;  1KM7 A;  3W2D A;  4LNF A;  2M19 A;  2MA9 B;  2CU1 A;  3EGR A;  3MC0 B;  3RNE C;  1SXT A;  2E3T A;  5HHD G;  1UBQ A;  2LD9 A;  3TCA A;  2KD0 A;  5AUK A;  1WZ3 A;  3MHS D;  2C60 A;  1MHH E;  4LTU A;  3P63 A;  4DQO C;  1ZUD 2;  2MH7 A;  3TJP A;  4TKN A;  2GB1 A;  1FFV A;  2BGF A;  1F77 A;  1E7P B;  4AP4 C;  2LJI A;  1N62 A;  4W9J A;  2C9W B;  1C78 A;  2BBC A;  2N1V A;  5IA7 A;  2HTH A;  2LVO A;  1TY0 A;  2LGS A;  2VRR B;  2KQ7 A;  3AEC B;  3NJT A;  3ENE A;  1UBI A;  1TS3 A;  1WGY A;  1BUI C;  1YQ4 B;  2H89 B;  4WIP A;  2ZVN A;  3HVZ A;  1WY8 A;  4TUU A;  2M56 B;  2IO0 B;  1UGM A;  4P7I A;  4FAD A;  5C1Z A;  2C7N B;  4RGM A;  1HQR D;  4NPN A;  2W82 A;  1IGC A;  4US8 A;  1FFU A;  2LVQ A;  1ZKH A;  4A20 A;  1XEE A;  3IAM 1;  5CHF A;  2KLG A;  3KWL A;  4MM3 B;  4FUL A;  2Y5B B;  1V81 A;  5DPR A;  3V61 A;  3A4S C;  3NZ3 A;  4WWP A;  3ZNH B;  1K53 A;  4BBN F;  4EFO A;  3ZDT A;  2PEA A;  3AED B;  3Q3O C;  2WXL A;  1IBX A;  1WXS A;  3ZTC A;  3GP7 A;  1OQR A;  3NUH B;  4OZC A;  2GBR A;  3IVF A;  4WAA A;  3CMM B;  2GBK A;  2AYO B;  1T5X D;  1B1Z A;  3H1U A;  4P6V F;  3TIX A;  1XT9 B;  3AH7 A;  3RNA C;  3ZXV A;  3ZJT A;  1HZ5 A;  2CHX A;  4LNN A;  4MM3 A;  4QAY A;  1HXY D;  4WWO A;  2OJR A;  3O13 A;  2FUH B;  2IYD B;  1FPY A;  4E71 A;  2PTL A;  2BQQ A;  1WMH B;  1I42 A;  3DBR I;  2DZI A;  1WR6 E;  1I4X A;  4RF1 A;  4E74 A;  1F2R I;  4KIK A;  2WXQ A;  3AN1 A;  3PRZ A;  1SE9 A;  1R4M I;  1WJ6 A;  2KTF A;  4W9I A;  1FCL A;  2WXN A;  1EF5 A;  2W54 A;  1E10 A;  1IP9 A;  4II3 B;  5CHV C;  2JWZ A;  2KJR A;  2PE9 A;  2WDQ B;  1Q10 A;  3B0A A;  2MRP A;  3KUC B;  3BII D;  1KLG D;  4US9 A;  3ZNZ B;  1KJT A;  3M63 B;  4FHK A;  4D2K A;  2WDR B;  2CHW A;  3N3K B;  2WXM A;  3AEA B;  1RFA A;  2SEB D;  1B9R A;  2MP2 B;  3J9C A;  1CK1 A;  4JE3 B;  3U4E G;  2QDF A;  1TKY A;  4HCP B;  1M4V A;  2IDY A;  4M0W A;  1FRR A;  1MG8 A;  2UU7 A;  2K8H A;  1GB1 A;  4WH4 A;  3AE4 B;  1M94 A;  1MVK A;  2O2V B;  2WXF A;  2AEH A;  4HJK A;  3OAW A;  1SB3 C;  4LDT B;  2KFK A;  1S3S G;  4IM2 A;  1X1M A;  3PVL A;  4HPL B;  1IPG A;  1BT0 A;  3ZLZ A;  2ICI A;  1ZXI A;  3VUY A;  1P7F A;  4GOC A;  1GAQ B;  1VJK A;  2D3B A;  3N1X C;  1WGR A;  4AOF A;  5CTR C;  4KDL B;  5IOI A;  1E8Z A;  3A9K A;  4ITK A;  1QIL A;  2HD5 B;  3WA0 A;  2Q5W D;  2KDM A;  2PJH A;  2JU6 X;  2BS4 B;  2I38 A;  2KTR A;  2IGG A;  2XK5 B;  4DHJ D;  3R7Q A;  2KTR B;  5TR5 A;  1MPE A;  4XYC A;  3PS6 A;  1WGG A;  3KYC D;  1TKG A;  1TY2 A;  2WU5 B;  3LYY A;  2K1F A;  3DCG A;  3ZW3 A;  4OZA A;  1V97 A;  4A3P A;  3BVM A;  3MTN B;  1ZE3 D;  3HHM A;  4NJ7 A;  4MH8 A;  3HM3 A;  1ACC A;  4TQ0 A;  4KSL C;  2RR9 A;  1UWX A;  3SFE B;  4WJN A;  4PYZ A;  2DLB A;  3W5U B;  2KC2 A;  4XZ4 A;  4MJS B;  1KFY B;  4OW0 A;  2HJ1 A;  1T0R C;  1JML A;  4BKS A;  2EEL A;  4XDC A;  4YSZ B;  1YX5 B;  2Y5P A;  2MBO A;  1BXT A;  1BML C;  1WH3 A;  4EKU A;  1V1P A;  3GZN I;  4WJP A;  1UD7 A;  3NG0 A;  2M0X A;  5FR3 A;  2MX2 A;  3AE2 B;  3LDZ E;  3UGB B;  1JRP A;  2G4D B;  4K81 A;  1OQQ A;  4XE0 A;  2QIE B;  3TEZ A;  2IND C;  2OJW A;  3NOB A;  5JH5 C;  3I5J C;  2K8C A;  3ZGZ A;  1Y8R C;  1WRD B;  3TEW A;  2IZV B;  1PFD A;  2W3S A;  2FCQ A;  2BKF A;  1FD6 A;  2WXG A;  1YN3 A;  5JHB A;  5AUI A;  2NR2 A;  2M8S A;  3QK0 A;  4GSW A;  2XN9 C;  2K9X A;  1LXD A;  1VR9 A;  3QC8 B;  3Q8B A;  1I35 A;  5DPS A;  2C5L C;  3X0W A;  3KUZ A;  1JWA D;  4AJW A;  4LJO B;  2IJ0 A;  2AX5 A;  2K5P A;  2ZW1 A;  2WWZ A;  1WMH A;  3DHG C;  2K39 A;  2WU2 B;  3DQV A;  1YD8 U;  1A70 A;  1P98 A;  2JPH A;  1F9J A;  1YN4 A;  2BB6 A;  4DWF A;  3VUX A;  5G2N A;  1NBF C;  4XDD A;  1FM0 D;  2PMV A;  5BMH A;  1VZ6 A;  2MSE D;  3HRD D;  1VZ7 A;  1QQR A;  5JHA A;  1T0Q C;  4ANW A;  2MHJ A;  4KZ0 A;  3V6E B;  3B1L X;  3ZYY X;  5IP4 D;  2BS3 B;  2KX0 A;  3BZD B;  2RMM A;  1P0R A;  4RGO S;  2XBB C;  1KRH A;  2J0M A;  3MC8 A;  4HPP A;  1YN5 A;  3TEX A;  1UF0 A;  1WXQ A;  3AE1 B;  3FIL B;  2I1J A;  4HKZ E;  2JRH A;  2K25 A;  1N5X A;  2VH1 A;  1F52 A;  2N7J A;  3KVF B;  1PGX A;  5BYR A;  2EKI A;  2N1W A;  3Q8E A;  2N0S B;  4LDT D;  1GNU A;  4I6P A;  2L83 A;  5FKA C;  2R2O A;  1LM8 B;  5IO9 A;  4L2Y A;  1A5R A; 
#chains in the Genus database with same CATH homology
 2BYT A;  4JWS C;  4B0E A;  2RDH A;  4UDU C;  1QOF A;  1R7S A;  4OVZ A;  2KN4 A;  4A55 A;  1SE2 A;  2JYT A;  4WUR A;  1I4P A;  3W2D A;  2DBY A;  1SE3 A;  2M19 A;  3EGR A;  3MC0 B;  5H8Y E;  4YSX B;  2IGH A;  3URY A;  2TSS A;  4TQ1 A;  2LHE A;  3L4P A;  4KGR A;  1SXT A;  1FMA D;  2E3T A;  3ZJV A;  5HHD G;  2QJL A;  3AV8 A;  1L0X B;  3CIR B;  3AEE B;  3MFG A;  1DYQ A;  1XF5 L;  5AUK A;  1I4G A;  2BB5 A;  4HKQ A;  1MHH E;  4LTU A;  2WNM A;  5BMG A;  3P63 A;  4DQO C;  1ZUD 2;  1HEZ E;  2MH7 A;  2AQ1 B;  4JX1 C;  3AE8 B;  2GB1 A;  2WLB A;  1FFV A;  3P4S B;  1F77 A;  1E7P B;  2NTS A;  1KF6 B;  2LJI A;  3BVZ A;  5EE0 A;  1N62 A;  2OHF A;  3BVG A;  1HZ6 A;  1I4H A;  2CU3 A;  3MHZ A;  1C78 A;  2BBC A;  2KAC A;  3UI3 A;  1TY0 A;  1L0V B;  2WXR A;  1N60 A;  3AEC B;  2QEJ C;  3DWG C;  2YEP B;  1I7H A;  1P7E A;  1TS3 A;  1ESF A;  3ETR A;  4ZHP A;  3DWM A;  1RWS A;  1BUI C;  1D4B A;  2PKO A;  3SR6 A;  3AB5 A;  3R2I A;  1YQ4 B;  3H8H A;  3VR8 B;  2H89 B;  4WIP A;  4ARI A;  1KLU D;  3C8Y A;  3R2T A;  2K3U A;  3HVZ A;  2M56 B;  3NVW A;  4YTM B;  1SEB D;  4RGM A;  4C7Z A;  1HQR D;  4WWM A;  2HDE A;  2J52 A;  1J7A A;  2W82 A;  4Q2J A;  4YT0 B;  1UWM A;  1IGC A;  4US8 A;  1FFU A;  1FO4 A;  4JPS A;  1T3Q A;  1N63 A;  4O1N A;  2GI9 A;  2NTT A;  1XEE A;  3IAM 1;  1C9F A;  1FXA A;  3KWL A;  3SEB A;  4MM3 B;  3RFZ B;  3NRZ A;  3IAS 1;  1KH0 A;  1PUT A;  2D5G A;  3I57 A;  1SE4 A;  3BYT B;  3NZ3 A;  3ZQ4 A;  1N61 A;  3MJ5 A;  3W5V B;  1K53 A;  3FC4 A;  1L6U A;  5FK9 C;  3AED B;  2K22 A;  2RDG A;  3Q8A A;  2WXL A;  1IBX A;  3W1S A;  5D7G A;  1NEN B;  2LMC A;  3AEF B;  3ABV B;  4J3O D;  1C4A A;  1TS2 A;  2IPK D;  1ZXH A;  3GP7 A;  4RGT A;  1OQR A;  3NUH B;  4OZC A;  1GB4 A;  1L4D B;  1GOZ A;  5H92 C;  2JYE A;  1TS4 A;  3P4P B;  4ZOH C;  2PIA A;  5EE3 A;  1TJE A;  1T5X D;  1B1Z A;  2K0P A;  2N9L A;  3AE9 B;  1YJJ A;  4P6V F;  1ZPS A;  4USA A;  3AH7 A;  1YNT E;  3ZJT A;  5C3J B;  1HZ5 A;  1IBX B;  3AE6 B;  1HXY D;  3B2F A;  1L4Z B;  5I4D A;  1J7B A;  3O13 A;  4ZRP A;  4LLG M;  2V4I B;  1NYR A;  1WRI A;  2PTL A;  2BTE A;  4C56 C;  3P4Q B;  2MJ3 A;  1IGD A;  1I4X A;  1JQ4 A;  4RF1 A;  1XXG A;  1F2R I;  3AEG B;  3Q69 A;  2WXQ A;  3AN1 A;  3T3N A;  3B2G A;  1NYQ A;  4JWU C;  1FCL A;  2WXN A;  3AEB B;  2FBW B;  2QMT A;  3TSS A;  2W54 A;  1E10 A;  2WXO A;  3BK2 A;  1SSN A;  1SF0 A;  1PGB A;  2WDQ B;  1Q10 A;  1PGA A;  2R61 A;  1XO3 A;  4P16 A;  4L23 A;  3BII D;  1KLG D;  5EE1 A;  4US9 A;  4IKG A;  1E9M A;  4OZB A;  1XLN A;  1QT9 A;  4D2K A;  1NI3 A;  1PDX A;  2WDR B;  2KMM A;  1QF6 A;  4NAM A;  2J4X A;  1JWM D;  3N9Y C;  2WXM A;  3AM9 A;  3AEA B;  2KQ4 X;  1CZP A;  2WP9 B;  3E56 A;  2SEB D;  1B9R A;  1E6E B;  1V1P B;  1SJH D;  3J9C A;  3WCQ A;  1CK1 A;  1XLQ A;  4JE3 B;  1JCK B;  1I4Q A;  5BYQ A;  3BYY B;  5BMI A;  3U4E G;  1TKY A;  1DGJ A;  2PLP A;  1L6V A;  1M4V A;  2IDY A;  4M0W A;  2QIL A;  1ZDV A;  5D3D A;  1FRR A;  5MPO A;  1UUP A;  3CWI A;  1JWS D;  1C4C A;  3HUI A;  2I2Y A;  4OHJ A;  1GB1 A;  4WQM A;  4CQN A;  1J7C A;  2E6X A;  1C76 A;  4WH4 A;  4RFB A;  3U7Z A;  4B0M A;  1VLB A;  3AE4 B;  3LB8 C;  1MVK A;  1C4P A;  2Z8L A;  1ET6 A;  5HG2 A;  2LHD A;  2WXF A;  2G1E A;  1N5W A;  1VRA B;  4L1B A;  1TYG B;  2WXP A;  1SB3 C;  1SJE D;  3V3X A;  2MEK A;  2V3N A;  1FNW A;  1FCC C;  4GDK B;  1AW7 A;  1OFF A;  1TZO A;  1EWC A;  4XWT A;  2ICI A;  1IUE A;  1F0Z A;  1ET9 A;  1ZXI A;  1PYW D;  3NS1 A;  3KQ4 A;  1P7F A;  1GAQ B;  1D5M C;  1VJK A;  4KKJ A;  3NVY A;  4MAC A;  1FNU A;  1STE A;  2Y5C A;  3VR9 B;  2J42 A;  2DWQ A;  4A8X C;  2JZP A;  4ITK A;  1XCQ L;  4KKI A;  2FE8 A;  2N9K A;  1QIL A;  2YEP F;  4NZL B;  2RPV A;  3FIL A;  5EE9 A;  2Q5W D;  1I4R A;  2GRI A;  2KDM A;  1ZOY B;  4KGS A;  1RFK A;  3TUO A;  2JU6 X;  1JW9 D;  4EE2 A;  4IOI E;  2BS4 B;  2I38 A;  1L0Y B;  2LUM A;  1UNS A;  2IGG A;  5G5G A;  5HFY A;  1D5X C;  2CJN A;  3NVV A;  3P42 A;  2CJO A;  5LNK 1;  4XWW A;  1MPE A;  4H2A A;  2PW9 A;  3U52 E;  2VZK D;  2WXH A;  1TKG A;  4KGT A;  3IT6 B;  4RNA A;  1TY2 A;  2WU5 B;  1EU4 A;  3LYY A;  2MJD A;  3VRA B;  3HVD A;  2JSV X;  4OZA A;  2WS3 B;  1V97 A;  2KWD A;  2BW2 A;  2L32 A;  1K50 A;  2HTM E;  3BVM A;  4C7Y A;  4HRO A;  4RGN A;  1RM6 C;  5JXV A;  1ZE3 D;  4MH8 A;  4LK0 M;  2AQ2 B;  3BWU D;  4ZYS A;  1VDV A;  1ACC A;  3Q8C A;  4TQ0 A;  3EA6 A;  4HJG E;  1K52 A;  2X38 A;  2WQY B;  3PO0 A;  1K51 A;  3R8B A;  1UWX A;  2L52 A;  1TKE A;  3SFE B;  2DLB A;  1QLB B;  3W5U B;  1YJI A;  3VQI A;  4YSY B;  1ENF A;  4WAF A;  1XLP A;  1KFY B;  4OW0 A;  1FNV A;  3BK1 A;  2ACZ B;  2V3P A;  5TSS A;  3MP9 A;  1JML A;  4PT5 A;  1FRD A;  2EEL A;  4YTN B;  1D6E C;  2JWU A;  1EWY C;  4XDC A;  1UGJ A;  4A6Q A;  4YSZ B;  1WYG A;  2Y5P A;  2VZK B;  2DYO A;  1WSP A;  4RH6 A;  1BXT A;  2B76 B;  1BML C;  1SBB B;  1E0Z A;  1HA5 A;  1V1P A;  1XCT L;  4NAW B;  1MHX A;  1F2R C;  4ZRQ A;  1Y56 A;  5FR3 A;  3AE2 B;  1V8C A;  2IGD A;  2WXI A;  1JRP A;  1JAL A;  2DYM A;  1OQQ A;  4XE0 A;  2QIE B;  1AYF A;  4YWG G;  2LGI A;  3TEZ A;  3NVZ A;  1C77 A;  2M0A A;  3RPF C;  4YTP B;  1FIQ A;  1XLO A;  1QOA A;  3KLS X;  4AQ7 A;  3ZGZ A;  1DOY A;  1QOG A;  2ON8 A;  1JRO A;  4RF0 A;  3TEW A;  1QKZ A;  2SAK A;  3P1M A;  4A9A A;  5G5H A;  5GXG B;  1NVI D;  4REZ A;  1JWB D;  1PFD A;  2OED A;  2W3S A;  1FD6 A;  2LFI A;  1LO5 D;  2WXG A;  1YN3 A;  2V0G A;  2JQR B;  1CQV A;  2ONQ A;  4KX6 B;  5AUI A;  2H88 B;  2WXK A;  1NEK B;  1GPX A;  3FAH A;  4AS1 A;  2J53 A;  3AE5 B;  4TMA B;  1ZDX A;  2XN9 C;  2K9X A;  1VR9 A;  2G9H D;  4R3D A;  1YQ3 B;  3P4R B;  3Q8B A;  5C2T B;  3PZ7 A;  4ARC A;  1YMH E;  5E6J A;  1TS5 A;  2JXT A;  1SIJ A;  2WDV B;  1JWA D;  2IJ0 A;  2INN E;  2AX5 A;  4GLS C;  4IDI A;  2LEK A;  4YXD B;  2K5P A;  2ZW1 A;  1C79 A;  3W9C B;  3EUB 2;  3TEY A;  2W55 A;  3ZJU A;  3VRB B;  1AWD A;  5D3I B;  1QOB A;  4HEA 1;  3LXF A;  3Q8F A;  2MJE A;  1VZ8 A;  2WU2 B;  3GB1 A;  4FXC A;  1A70 A;  3E9S A;  3AE3 B;  3T3O A;  3AE7 B;  1YN4 A;  2KAJ A;  1V1O A;  2BB6 A;  5BYS A;  4A90 A;  4GDL B;  2XNA C;  4XDD A;  1FM0 D;  3GS2 A;  2BT6 A;  1ROE A;  4N59 A;  1FEH A;  2PMV A;  1D5Z C;  5T8I A;  4NJC A;  2W3R A;  5BMH A;  1VZ6 A;  3HRD D;  1VZ7 A;  1QQR A;  3OWE B;  3KWV A;  1CJE A;  1EU3 A;  3V05 A;  2JX5 A;  3ZYY X;  4MT5 A;  4TSS A;  1FXI A;  4RCO A;  4N6E B;  2BS3 B;  1KTK A;  2FUG 1;  3IT4 B;  3BZD B;  3PZ8 A;  3B9J A;  4N58 A;  2RMM A;  1WGK A;  4RGO S;  4C80 A;  1EM7 A;  3SFD B;  1KRH A;  2QSD A;  5HI1 A;  1MI0 A;  3AMZ A;  2Y3A A;  1YN5 A;  2PVG C;  3TEX A;  4DXF A;  1L5P A;  1WXQ A;  2INP E;  1ZP0 B;  2L1A A;  3AE1 B;  3FIL B;  4HKZ E;  2ZW0 A;  1N5X A;  1T6B X;  1JWU D;  2BS2 B;  2N7J A;  1AN8 A;  3I9V 1;  1PGX A;  1DOX A;  1WWT A;  1DOI A;  5BYR A;  2EKI A;  3Q8E A;  4ZHO A;  2N0S B;  4DXG A;  5FKA C;  2L83 A;  3IXS A;  2WXJ A;  4L2Y A;  4HRS A;  2PVO D;  2AQ3 B;  3U2S C;  2NMQ A;  1RYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...