1JW9D

Structure of the native moeb-moad protein complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
publication title Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2001-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jw9D00
1NI3A 2WS3B 3FC4A 1JWBD 2BT6A 4HROA 3ETRA 1B9RA 1KF6B 1UWMA 1L6UA 3AEEB 1E7PB 2WU5B 4C80A 3AN1A 1YJJA 1NYRA 2W55A 3LB8C 1FRRA 1RM6C 3SFEB 3VR9B 1ROEA 1J7BA 2MJDA 3VR8B 2WLBA 4YTPB 4C7ZA 1E6EB 5C3JB 4N58A 3P4RB 1NEKB 1DOXA 1CZPA 1CJEA 2Y5CA 5C2TB 4YSYB 1N5XA 1NENB 1DOIA 2AX5A 2CJNA 3KWLA 3W5UB 1AYFA 3AV8A 3NRZA 4N6EB 1L5PA 1QOFA 1T3QA 1VLBA 3B2FA 2LEKA 1ZUD2 1L0VB 5EE9A 1JRPA 3SR6A 1NVID 1VJKA 1FFUA 1JW9D 4ZHOA 1J7CA 1XLNA 2W3RA 3AE8B 4ZOHC 4YTNB 1E0ZA 1XLQA 1N62A 1FO4A 3SFDB 2WP9B 3HRDD 3B9JA 2WDRB 2K9XA 3L4PA 3AB5A 2OHFA 3AE6B 3AE3B 3NVWA 4YTMB 3VRAB 2QIEB 1QF6A 1QT9A 4US8A 1XLOA 4N59A 1JWAD 2DBYA 4WQMA 3W5VB 1JROA 2K22A 1FMAD 1KRHA 3AECB 3EUB2 1YQ3B 3AEAB 3AMZA 4A9AA 1PFDA 3ZYYX 3CWIA 1SF0A 1QOGA 1PUTA 1RYJA 1IUEA 1FXAA 1WGKA 4YSXB 3P63A 2H89B 5H8YE 2M19A 1XO3A 4WWMA 2FBWB 3WCQA 3HUIA 1DGJA 1I7HA 2MJEA 3FAHA 2WU2B 1ZOYB 5AUKA 1A70A 2W3SA 3AEBB 1F0ZA 2W54A 1OQQA 3P1MA 1RFKA 2K5PA 3AH7A 3NVYA 2E3TA 4IDIA 1ZP0B 2BS3B 2JX5A 3ABVB 2MJ3A 1SB3C 3AE7B 1WXQA 5H92C 2G1EA 3NVZA 4P6VF 1WWTA 3P4QB 4JWUC 1V8CA 3NVVA 3AEDB 3DWMA 3AEGB 1FRDA 1DOYA 1JQ4A 3P4SB 1RWSA 1VDVA 2PKOA 2Q5WD 4C7YA 2WDQB 3AE4B 2QJLA 1TKGA 1R7SA 1FIQA 1TKYA 1SIJA 1WYGA 3DWGC 3PO0A 5AUIA 4HRSA 3AE5B 1XLPA 5EE1A 5EE0A 1E10A 3B2GA 1J7AA 1QOAA 2KMMA 1QOBA 1FFVA 4USAA 2HTME 1OQRA 1EWYC 3AE9B 1N63A 4YSZB 1JALA 3AE1B 2L83A 1TJEA 1FM0D 2MH7A 3AM9A 4US9A 3P4PB 1N60A 4YXDB 2PVGC 1N5WA 3CIRB 3RPFC 2PVOD 2EKIA 3BIID 1AWDA 1KFYB 3AEFB 2BS4B 2KAJA 2DWQA 5G5GA 3VRBB 5G5HA 3W9CB 2N0SB 1ZXIA 3NS1A 1YQ4B 2L52A 4JX1C 1GPXA 4YT0B 1QLBB 2H88B 4KX6B 1PDXA 1E9MA 2B76B 1YJIA 2WDVB 2WQYB 4LTUA 1V97A 3HVZA 1WRIA 5GXGB 1OFFA 2PIAA 1L6VA 1N61A 1GAQB 4FXCA 2CJOA 1FXIA 4ZHPA 3LXFA 4JWSC 2ACZB 5EE3A 2M56B 1NYQA 1TKEA 2JQRB 2BS2B 4ITKA 2CU3A 1TYGB 3AE2B 5MPOA
chains in the Genus database with same CATH superfamily
3TUOA 1U4AA 3FC4A 3AI5A 4C00A 1B9RA 1E7PB 2WU5B 1WZ0A 3SHQA 2L3ZA 2ONQA 2DENB 4X57B 4LCDE 2IY1B 3DPDA 3VH3B 1FNUA 2I1KA 4RCOA 1PGXA 2KYWA 1AYFA 4W9JA 4LNOA 1F52A 4BAXA 3A9JA 3PPAA 5FK9C 1GB1A 2WYQA 1FO4A 1J19A 2R2OA 1KJTA 2J0KA 2D10A 2K9XA 4WJPA 5CHWA 3R2IA 2JT4B 1WH3A 4MSMB 2HTHA 2BKRB 2OJWA 4EE2A 2N4FA 1WGKA 4HJGE 2H89B 3UINB 1HTOA 2BF8B 2DX5B 2XK5B 3ZJTA 2FIFA 2GBMA 1DGJA 4EZLA 3NG0A 1JWUD 4LNIA 2HJ1A 4CYEA 4IDIA 2D11A 1VCBA 3WANA 2QEJC 2KKCA 2IGHA 3AEDB 1D5ZC 2ZW0A 4C7YA 2PKOA 2Q5WD 1EU3A 4OW0A 1R7SA 2KHWB 4XWWA 2K8HA 1E10A 2K1FA 1I4QA 4BKGA 2NMQA 3KW5B 1EO6A 1IGDA 3HVDA 5D3DA 3HIZA 4RGOS 2PVGC 3CIRB 3IAM1 2L0FA 4EFOA 3JW0X 4NQLB 2O6VA 4HLEA 1JQ4A 1K52A 2C7NB 1ZXIA 4KDLB 1V5TA 2MQJA 1YQBA 3BVZA 2WDVB 5E6OA 1F2RC 4KKJA 2JU6X 1UELA 3E9SA 2A4ZA 3PHWB 3UQAA 1TKEA 3PGEA 4XE0A 5MPOA 2N1VA 3ZW3A 2ZW1A 4GDLA 1YJJA 2UYZB 2V0GA 4DQOC 3VR8B 2LWPA 3OJ3A 1NEKB 3Q14C 2MBEA 3MFGA 1LGRA 3L10B 1TS5A 3QA8A 3QCAA 4G11A 2J4XA 2UU7A 1QQRA 1YOVB 3SEBA 3BVGA 3HRDD 1WGHA 3IHPC 3AE6B 4TMAB 2R61A 1XLOA 4HPMB 1P7EA 1GJZA 3EC8A 3MP9A 2KVZA 4NAWA 2WXPA 4RGNA 2LHEA 2WDTB 3CWIA 1FXAA 3DBHB 4AP4C 2M19A 2KLCA 1SXTA 1X1MA 4RF0A 2DAJA 2WXOA 4EEWA 4ZYSA 1GG3A 5CTRC 1PGAA 4S17A 2JZZA 3NVZA 3RCZA 3ZIMA 4IKGA 3URYA 3UI3A 2JY6A 4I6LB 1SE2A 3R66C 3X23A 4GDKA 4PYZA 4UDUC 1EWYC 2EMTA 2QDFA 2KFJA 2BYEA 3P4PB 5TSSA 4XC2A 2K25A 2XBBC 4FJVB 4WJNA 1RAXA 2NBVB 2N0SB 4PYUA 2IYDB 2NVUI 1N6ZA 4KSLC 2BWES 3PZ7A 4DXFA 4LTUA 1DYQA 2D07B 3VHTC 4KVGB 1GOZA 3NOBA 2M56B 2K6QA 1HZ6A 2J0MA 2Z0EB 2WS3B 4LJOB 1JRUA 2BT6A 2LFIA 3DVNU 4HROA 4EOYA 5DPSA 1KLVA 3VR9B 4MELA 1V1PA 4XGAB 1CJEA 2M0XA 1Y56A 3W5UB 5LNK1 1T3QA 3Q8CA 3MJ5A 1XLNA 4NAMA 2I1JA 3L16A 2N9EB 4G3XB 4YTMB 5L83A 1EUVB 5G55A 3EUB2 4IOIE 3RNFC 2GBJA 2GI9A 1YQ3B 3UQBA 3TSSA 2C7HA 4YSXB 1T6BX 5H8YE 1XO3A 3H9DA 2LGIA 3T3OA 4RGMA 4BKSA 2DYBA 2W3SA 3P1MA 3JSVA 3NVYA 2KTRB 2MJ3A 1WXQA 1WWTA 5D6JB 3WA0A 4CO7A 3AEGB 2QHOA 1L4DB 3QIJA 1TKGA 1SIJA 3TEWA 3D32A 1J0GA 3EECA 4IG7B 1HZ5A 1OQYA 4USAA 1XD3B 4MGYE 5E6JA 2D5GA 1GPXA 1QILA 1QLBB 2H88B 1WY8A 2YEPB 3LXFA 4J3OD 1L0XB 2MBHA 3Q8FA 3PSEB 4MSQB 1I4RA 3GS2A 3A1QB 4FA6A 1G6JA 1L6UA 2V3NA 4TSSA 2JYEA 4NY0A 4C80A 3EHVA 1WM3A 3ZUNA 1C3TA 3BINA 4MEMA 4DHJD 2ON8A 3N1ZC 2KMAA 3O65B 1FD6A 4RM9A 4RGTA 2C7MB 5DCNA 1WXAA 1J8CA 1L0VB 1QZEA 2KQ4X 1JRPA 3SR6A 3GE3C 4F8CB 5JH5C 2AQ1B 4YTNB 1E0ZA 1N62A 3QJZA 1TBEA 4KIKA 4PK1A 1HA5A 4ZDVA 3VRAB 5HHDG 3DCGA 4KGTA 4DDID 3V05A 1WRDB 3H7PA 1STEA 1LO5D 3Q3OC 4TUUA 4WURA 1R4MB 4C4VA 2WU2B 1K53A 2LZ6A 2BYTA 1SB3C 4R3DA 2C5LC 1V8CA 4ICVA 1D3ZA 5JHAA 3V62A 3DWMA 3P4SB 2WDQB 2BYFA 4MM3B 1GNUA 1XLPA 5EE0A 4A8XC 4BKTA 2JRIB 2GRIA 1E7UA 4CHKA 1WJ4A 3KYCD 3RNAC 1SE9A 2PW9A 2O6VB 3V6CB 4YXDB 1LXDA 1KM7A 3LYYA 3H1UA 4YT0B 3A9KA 2WXGA 1R4NI 4XDCA 3HVZA 1CMXB 3GOEA 2JF5A 2RMMA 5I4DA 4GDLB 1C4AA 2MHJA 3WAOA 1UWMA 3OJ4B 1WIAA 1NYRA 2IGGA 2JZ3B 1IBXA 3IT6B 4HCPB 1ET6A 2DZIA 1WE6A 2MWSB 3PLUA 3APCA 3ZDTA 1UGJA 1KTKA 3FILA 3ZKJC 1D5XC 1MHHE 2IBIB 1C9FA 4II2B 4BFRA 2D2QA 4M0WA 2MBQA 3AEAB 5FR6A 4REZA 2O6VD 4P1CC 2KANA 5J2RA 2WHIA 4I6NB 4WJQA 2WXKA 4JQWC 1FRDA 3QQ8B 5BO4B 4KDIC 2FUG1 2HE7A 4GDKB 1WE7A 4IWQA 2BB5A 3WAMA 2BQQA 2I2YA 1J7AA 3PTFC 1FFVA 1OQRA 4ASWC 3AE1B 3AM9A 5J18A 4US9A 1N60A 3DBLI 3SU8X 3DHIC 4PS8A 2DWQA 5G5GA 3NS1A 2A5UA 2ZJDA 3CF6E 4AOFA 4K3CA 3VTWA 1MHXA 2C9WB 3TEZA 2AL6A 1B1ZA 5HI1A 2WWZA 1AARA 2MBBB 2KOXA 2NS5A 1XXGA 4OVUA 1GB4A 1WX8A 3NZ3A 1V1PB 2BTEA 1FRRA 1RM6C 2LXCA 2UWQA 3L17A 1JWSD 4YTPB 2JWUA 1T0YA 1CZPA 3KUDB 2K8CA 1DOIA 2IO1B 2YVCA 4A90A 3KWLA 4HK2A 3AV8A 3NRZA 1VLBA 3Q8EA 2PEAA 1E5WA 1MG4A 1TY0A 4MJSA 3Q8BA 4A20A 3H8HA 3TJPA 5C23A 3B9JA 2NTSA 1FEHA 2WNMA 2RSUA 4US8A 3WAPA 4LK0M 1BXTA 2RPQA 2Y5PA 1QOGA 4FULA 3ZLZA 3LDZE 2SAKA 2Z0DB 4EZJA 2WXNA 1ZOYB 1D4BA 4ZRIA 1WGDA 1D5MC 1RFKA 3DBRB 1ZP0B 3DDCB 4NJ7A 3T9LA 3NS8A 2N1WA 2WXMA 4J6IA 1YIWA 1DOYA 3FKYA 1R4NB 2KQ7A 3AE4B 4GLSC 1RFAA 2VZKB 4WJOA 3ONSA 4FHKA 3W1SA 3AE5B 4HEA1 2ZZPB 1BT0A 3HHMA 4FHJA 1YNTE 3MJWA 2KMMA 4A55A 1XQQA 3AE9B 3N3KB 3VXWA 3TL5A 2IGDA 2EKIA 4AJWA 1KLGD 4E71A 1ET9A 4DHZB 2KDMA 3BWUD 3U52E 4DHZE 2GB1A 3PZDA 3MHSD 5DPTA 2RPVA 2V9HA 3KH0A 3WIMA 3R7RA 2ACZB 3N1XC 2WXHA 3ZJUA 1EU4A 4EUTA 1ZGUB 4EKUA 2AWTA 2AYOB 4Q2JA 2M1MA 4KGSA 2KACA 4YSYB 2VH2A 3GP7A 5BMGA 2LXAA 2G45B 3DVNV 1TZ1A 5D7GA 1YMHE 4KIKB 2W3RA 4WAAA 3U4EG 2FCQA 2WP9B 1WXSA 3RULA 2JSVX 2LVOA 1ZW7A 2KC1A 1QF6A 2VZKD 4W9FA 3W5VB 3VFKA 2KC2A 2KZRA 4A9AA 1SF0A 1PUTA 4WAFA 4C4VB 4HDOA 2TSSA 4QAYA 3T3NA 2WXFA 1XCTL 1E7VA 3WCQA 1KOTA 3AEBB 2PLPA 2W54A 2ZVOA 2BS3B 3ABVB 1C79A 2G1EA 4XWTA 2LGDA 4L1BA 1RWSA 2M8SA 3ZNGC 3Q3NC 3Q2AC 1ESFA 5DPWA 2LUEA 3ZXRA 4ACFA 3K9PB 5D94A 2LVPA 4K7SA 4AUQC 2G3QB 4IM0A 2IO2B 1WXVA 3APFA 2BS4B 1MI0A 1ZDVA 2AQ2B 2BBCA 1I4GA 5D2MB 3T8MA 3C19A 4RMAA 4KGRA 3VTUA 4WWOA 1V97A 4M00A 1P7FA 2DAFA 1L6VA 3GE8C 3R7QA 1LQBA 3OLMD 3TMPB 1WR6E 2DYMA 4FBJB 1NYQA 2JQRB 3CSTA 4MGZE 1JWBD 2KDFB 3ZO5B 2JRHA 4HKZE 2X8XX 4IM2A 1FCCC 1ROEA 4BBNC 4HVBA 3MHZA 3NZUA 2KFKB 1WXMA 2DNFA 1VD2A 2CJNA 3P2BA 1WGYA 1UD7A 1SEBD 1SE3A 3IAS1 4ANXA 1V81A 3PLVA 2N7JA 3Q69A 4ANUA 2MP2A 3B08A 2QIEB 1WFYA 2D3CA 2QSDA 3ZDMC 1TY2A 2IDYA 2YEPF 1RYJA 2M17A 2L76A 2L1AA 3VVWB 2LJ5A 5AUKA 1M94A 2R2QA 5BMIA 2K5PA 1YD8U 2KWCA 2VRRB 4GOCA 4K7WA 1C78A 1KH0A 1Y8RC 3R2TA 1E8WA 1VDVA 3RT3B 1VZ7A 4DK5A 4BZAA 2V4LA 1GUAB 1MJDA 3ZRCA 2QC8A 3I3TB 1V86A 2CKHB 4FJYA 4B95A 3ZTDA 4F1SA 1TTNA 4TKNA 1S3SG 2N7EA 4HPPA 2JWZA 4JGHB 5E6PA 2JVCA 2PIAA 4H2AA 1AW7A 4K3BA 3Q3FA 2L05A 4BVUC 2BS2B 4O1NA 2V1YA 2JXTA 3AEEB 3N20C 2W55A 1J7BA 1T0SC 4HWIB 3ZXVA 4IWPA 2I38A 1I4HA 4K1RB 4IWOA 1QOFA 2K0PA 3RMKC 1SIFA 3APDA 1WGRA 2AL3A 2LJIA 2XK5A 4ZOHC 4LNNA 2NPTA 2FCSA 4ZRKA 1K50A 2IJ0A 4MT5A 2GOWA 4ZRPA 3AE3B 1HXYD 4EZKA 2BW2A 1PGBA 3RI7C 4WQMA 3TBLD 3CMMB 5JZEB 1SE4A 1VZ8A 1UBQA 1C76A 3P63A 1C4CA 2CHZA 3A9JB 2LRWA 2NTTA 1XT9B 1MFWA 1WJ6A 2E3TA 2KN4A 5H92C 4KSKC 2YLMA 4M8MA 1UF0A 4XDDA 4D2KA 4ZRJA 3PT2B 4XZ4A 4B0MA 2WXQA 1OEYJ 2MX2A 4GB9A 1QOAA 2BPSA 3VUWA 4M01A 1EF1A 1WR1A 4ZYNA 2PMVA 1TT5B 2EKEC 1WYWB 2MEKA 3X0WA 3KWVA 2V3SA 3WALA 4W9CA 4W9IA 4JX1C 2FE8A 2B76B 2D3GA 3EGRA 1T5XD 1WRIA 5GXGB 3BK2A 3I57A 5IN7A 4ZHPA 4GSWA 4RF1A 3NY5A 1H4RA 1WJUA 4IUMB 1NI3A 5LLIA 3QAQA 4B9KA 2IY0B 2KDEB 5GMVA 4OHJA 1MVKA 3SFEB 3TIXA 1L2NA 2D3BA 2O2VA 3DBSA 5D3IB 1L5PA 3KQ4A 3AXCA 4A3OA 4GU2A 1SJED 1SJHD 2N9KA 4K81A 2K6DB 2WDRB 3V6EB 5G2NA 4JIOU 3J9CA 1FMAD 1KRHA 2KXJA 4AS1A 2REXA 2LVQA 4N9F4 1I7HA 3ZNZB 3L0WB 3SD5A 3L13A 5J17A 1HQRD 4KKIA 1C1YB 5FKAC 3ZGZA 2AEHA 2IO0B 4NAWB 4DXAB 3RNEC 2EELA 3N9YC 5CX3A 1ZKHA 3AULA 2QJLA 1TKYA 3QWZB 2J42A 2IZVB 4B0EA 2OEDA 2HJ8A 3U7ZA 1FNWA 3U2SC 4DXGA 2KVRA 3N32A 1YX5B 2KX0A 4WWNA 2N9XA 3DOWA 2JZPA 5EDSA 4M8NA 2RDBC 3EFUA 4NPNA 2N9LA 1WJNA 2L52A 4HKQA 1IP9A 1YJIA 2LRUA 2V3PA 2J0JA 4LDTB 4MH8A 3KUZA 4M02A 2JPHA 3MC8A 3I9V1 1ACCA 3B1LX 5JHBA 2J53A 2RDGA 2D3AA 3U8ZA 2Y3AA 2KDBA 2WX0A 4GN1A 2CHXA 3RN9C 2LGXA 2KWDA 3O13A 1WZ3A 4MDKE 1EWCA 3B2FA 3QK0A 1VJKA 1F1HA 3M62B 1XCQL 2XNAC 3V3XA 1K51A 2KTRA 4URKA 1AN8A 2MCNB 3W1YA 2DBYA 4PS3A 3Q3MC 4PT5A 5LXHA 2GBKA 2LGSA 1UZXB 2JYTA 2FNJB 1Q10A 3DBHI 3C8YA 2BYVE 4ARCA 3HUIA 2Y5BB 1A70A 2M4NA 2LD9A 2JX5A 2KN5A 1S1QB 4TQ0A 2CS4A 3NHEB 1WF9A 1C4PA 3ZNHB 4LDTD 1I42A 1WX9A 2KLGA 2WX1A 3BZDB 4NNJB 1UH6A 4HCNB 1TGZB 4IW0A 5AUIA 5IOIA 5HFYA 4A6QA 5IKCM 2AQ3B 3JSVB 4RH6A 4MGKE 3KLSX 4DWFA 1SGHA 1N5WA 3DHGC 2PVOD 2GLSA 3QHTA 3H7SA 3A1QA 4TV3A 1JCKB 1ZPSA 3ECIA 2PE9A 3ZRFA 1HTQA 1YX6B 5FR3A 3L54A 5HG2A 3QX1A 1FNVA 3Q8AA 4JWSC 2ZPNA 4E3CA 2Z59B 4AQ7A 3AE2B 2DHZA 3ENEA 3IXSA 2KNBA 2GBRA 2MJDA 2RDHA 2WXLA 2ZCBA 3TEXA 2MW5A 4W9DA 3A4RA 1E8YA 3VUXA 1T0RC 4L23A 2LUMA 2MBOA 2NPTB 3JVZX 2BGFA 2E6XA 2NCNA 3AE8B 3IG3A 1V5OA 3VQIA 5AZFA 3N30A 1TS2A 3AB5A 2OHFA 4F7ZA 1MG8A 1QT9A 2J7QB 5LXIB 1RLFA 1A5RA 4P16A 4BKSD 1F2RI 1E8XA 2DLBA 4MM3A 4DDGD 1V2YA 1OGWA 4G0NB 3ZVVA 1VR9A 1Q1OA 3AU4A 1H8CA 1OQQA 4OZBA 1XF5L 4AJYB 4JLCA 3GZNI 3NVVA 3RD2A 3H7PB 4P1BC 4KZCA 2BVCA 2ZNVB 2HD5B 2ZPYA 5AEKB 1WYGA 1FPYA 3A4SC 1WM2A 3DQVA 2RR9A 3PRZA 2G4DB 5IAAC 1N63A 4YSZB 1JALA 5BYRA 3VTVA 4IM3A 1NDDA 2KD0A 3U7DA 3ZQ4A 1QKZA 3DBLB 4GMVA 4WH4A 3AEFB 1BUIC 3IBEA 5G5HA 3W9CB 1WX7A 2DZMA 3BY4B 3I63C 3GB1A 4GGQA 2QMTA 1YN3A 2DZKA 4YL8A 1JWMD 4NQKE 5EE3A 1P9DU 3VH4B 3ML9A 4BOSC 5IA7A 3AN1A 3A9KB 3LB8C 1IYFA 2O2VB 1C77A 5C2TB 3OG5A 4E74A 2K3UA 1ZXHA 1I4PA 1V9JA 2INNE 4LJPB 4NJ6A 4ZHOA 4GXBA 4MH0E 1NBFC 2G9HD 1TZOA 1XLQA 3PV1A 1P98A 2LI5A 3L4PA 1IBXB 1D6EC 2GMIC 1P1AA 5CHVC 2INPE 2G4SA 3RZWC 1FXTB 2KJ6A 1PFDA 3PRMB 3W1SC 1IUEA 4OZCA 4FJZA 2KWUB 4WWMA 4C56C 1R4MI 4W9EA 3FILB 2BB6A 5DPRA 5E6NA 3U30A 3DVGX 4P6VF 4JWUC 2PJHA 3PREA 4M0WB 2MLBA 1F9JA 4BOZB 1CK1A 2FCNA 4ZRQA 2LGYA 2MA9B 1WI0A 2INCC 3DHHC 1L7YA 2N7DA 2SEBD 3I5JC 2KWVB 2W9NA 1AWDA 1KFYB 3MC9A 2XN9C 3E56A 3RYTA 2KAJA 1IGCA 1F77A 1Z5SB 4YWGG 1PDXA 4ANWA 3HK0A 1LM8B 4XYCA 3HM3A 1LFDA 1TYGB 4LNKA 1UGMA 5C1ZA 1OTRB 1HE8A 4KZ0A 2ICIA 3ETRA 1WMHA 4BBNF 2M0AA 2PPHA 1Z2MA 3IT4B 5C3JB 4N58A 5IO9A 4W9HA 1DOXA 3EA6A 1I35A 4OVVA 3V60A 4DHJB 2AX5A 2K39A 1ISNA 1YN4A 4L2YA 2IO3B 2JXXA 3R8BA 1ZUD2 5EE9A 1FFUA 3M63B 4WQOB 3R3MA 2QCZA 4JPSA 4RNAA 3GZNB 3HM6X 3NVWA 1GC6A 2KMCA 3KUCB 4LLGM 1RRBA 5AZHA 3RUIB 2NBUA 3MTNB 1JROA 4PS7A 4I6PA 1MPEA 3ZYYX 4W9LA 2MSED 4GIVA 4MJSB 3UIPB 2L0TA 3KYDD 3UIOB 3VUYA 1F0ZA 1CQVA 3K9OB 3V61A 4XX5A 1EF5A 2KQSA 2KT7A 1KLUD 3L08A 2PE6B 2W82A 3N1YC 3ZJVA 2PTLA 1Q5WB 1EM7A 1YJ1A 1WGGA 2KTFA 2WXIA 3BVMA 1ENFA 3M3JA 4ANVA 4IC7B 1I4XA 1PYWD 1UBIA 2HTME 2N9PC 2C60A 2MH7A 1TJEA 2CU1A 4ICUA 1V49A 3PZ8A 3VDZA 1JMLA 1ZE3D 2NBWB 1M4VA 2RD0A 3RNCC 3TCAA 2B3AA 2HDEA 1BMLC 1TIFA 4ARIA 4LNFA 2CJOA 2OJRA 1FXIA 1L0YB 1YN5A 4MACA 4ITKA 3A33B 2KX3A 5HKHA 2CU3A 1FCLA 4OZAA 1KF6B 3ZNID 2WXJA 4S0RA 3RNGC 4MGIE 1NI2A 1P0RA 1E6EB 3AU5A 3NZSA 5JXVA 1IPGA 4CQNA 3P4RB 1T0QC 2Y5CA 1NENB 2KO3A 1V80A 3KVFB 3RZFA 4N6EB 5KHQA 3W2DA 4JE3B 4A3PA 3Q6BA 5TR5A 2L32A 1J7CA 2KDIA 2WXRA 4WWPA 4HJKA 3PS6A 2FUHB 3SFDB 2L8JA 4HDQA 1HEZE 1WSPA 2KJRA 1JWAD 2L7RA 3AECB 1TS4A 1GC7A 3VAWA 4II3B 1V6EA 5IP4D 5KHOA 2OOBB 2MJEA 5BMHA 2L00B 2LHDA 3QARA 3P42A 3DBRI 4KV2A 1K8RB 3P4QB 3IFWB 3EFCA 2MRPA 1VRAB 2FAZA 3OAWA 4W9KA 1FIQA 3PO0A 3DWGC 5T8IA 1TS3A 4JL9A 3ZTCA 1ZDXA 2K8BA 2NR2A 2L83A 1Q0WB 2CHWA 3PHXB 3TEYA 4HPLB 3BIID 3JYUA 5CHFA 4G50A 3VRBB 3MC0B 4TQ1A 4KX6B 4W9GA 2BKFA 2WQYB 2KFKA 1V1OA 4OVZA 1OFFA 4RFBA 1N61A 3IVFA 3C0RB 1GAQB 5L95C 2INDC 5AZGA 1XEEA 2RGFA 4HXDA 2KK8A 3H6NA 2WGSA 2DZJA 2LMCA 2IPKD 4FN2A 1SBBB 2GBNA 2Z8LA 2ZEQA 2XEWA 4FLHA 2WLBA 4C7ZA 3CSFA 1N5XA 1UUPA 2LEKA 3LJ3A 5BYQA 2X38A 1NVID 3S2AA 1JW9D 4B6WA 1UWXA 1OEYA 3ALBA 3DVGY 2V4IB 2JUOA 4N59A 2VH1A 2K22A 3QC8B 3AMZA 4FADA 2LASA 1SSNA 3NUHB 2ZNVC 3B0AA 2FIDA 1VZ6A 3Q3JA 2FBWB 3FAHA 4NJCA 1PQSA 1UNSA 3AH7A 5BYSA 2MP2B 3UGBB 3AE7B 2FCMA 3BYYB 2ASQA 3OWEB 4RM8A 3RNBC 2BWFA 4DBGA 3RFZB 1E8ZA 4HRSA 5EE1A 3B2GA 2QILA 2DYOA 3SDLC 2ZVNA 3BYTB 1QOBA 4P7IA 4NZLB 1E90A 1L4ZB 3UF8A 3ML8A 1FM0D 3BK1A 2KJHB 3RPFC 4K7UA 2EMSA 1YQ4B 3PRPB 4AWJA 1E9MA 3NJTA 3M95A 1P3QU 4FXCA 2J52A 4WIPA 2ZCCA 1WMHB 3PVLA 2CR5A
chains in the Genus database with same CATH topology
3TUOA 1C4AA 4O1NA 3FC4A 1B9RA 2JXTA 1UWMA 3AEEB 1E7PB 2WU5B 3AN1A 1NYRA 2W55A 3LB8C 2IGGA 2ONQA 1J7BA 1IBXA 1FNUA 3IT6B 2I38A 1ET6A 1I4HA 1C77A 1PGXA 4RCOA 5C2TB 1AYFA 1ZXHA 2K3UA 1QOFA 2K0PA 1I4PA 2INNE 4ZHOA 1UGJA 2LJIA 1KTKA 4ZOHC 5FK9C 3FILA 2G9HD 1TZOA 1XLQA 1GB1A 1K50A 2IJ0A 4MT5A 1FO4A 4ZRPA 2K9XA 3L4PA 3AE3B 1IBXB 1HXYD 1D5XC 1MHHE 3R2IA 1D6EC 2BW2A 1C9FA 1PGBA 2INPE 4WQMA 4EE2A 1SE4A 4M0WA 3AEAB 1VZ8A 1PFDA 1C76A 1IUEA 1WGKA 3P63A 4HJGE 4OZCA 1C4CA 2H89B 4REZA 2NTTA 4WWMA 3ZJTA 4C56C 1DGJA 3FILB 1JWUD 2BB6A 2E3TA 2KN4A 4IDIA 2QEJC 5H92C 2WXKA 4P6VF 2IGHA 4JWUC 3AEDB 4XDDA 1D5ZC 1FRDA 4D2KA 2ZW0A 4C7YA 2PKOA 2FUG1 1CK1A 2Q5WD 4B0MA 2WXQA 4GDKB 1EU3A 4OW0A 4ZRQA 1R7SA 2BB5A 4XWWA 1E10A 1I4QA 2I2YA 2NMQA 1J7AA 1QOAA 1FFVA 2PMVA 1IGDA 1OQRA 3HVDA 5D3DA 3AE1B 2SEBD 3AM9A 4US9A 2MEKA 4RGOS 1N60A 2PVGC 3CIRB 3IAM1 3KWVA 1AWDA 1KFYB 2XN9C 3E56A 2KAJA 2DWQA 5G5GA 1IGCA 1K52A 1F77A 1JQ4A 1ZXIA 3NS1A 4JX1C 2FE8A 4YWGG 1PDXA 3BVZA 2B76B 2WDVB 3EGRA 1T5XD 1WRIA 5GXGB 1F2RC 3BK2A 4KKJA 3I57A 1MHXA 2JU6X 3E9SA 3TEZA 4ZHPA 1B1ZA 5HI1A 4RF1A 1TKEA 1TYGB 4XE0A 5MPOA 1NI3A 1XXGA 1GB4A 2ICIA 3ETRA 2ZW1A 3NZ3A 2M0AA 1V1PB 1YJJA 2BTEA 4OHJA 3IT4B 1FRRA 1MVKA 1RM6C 3SFEB 2V0GA 4DQOC 3VR8B 1JWSD 4YTPB 5C3JB 2JWUA 4N58A 1NEKB 1DOXA 1CZPA 3EA6A 4A90A 1DOIA 2AX5A 3KWLA 3MFGA 5D3IB 3AV8A 3NRZA 1YN4A 1L5PA 3KQ4A 4L2YA 1VLBA 1TS5A 3R8BA 1ZUD2 3Q8EA 5EE9A 1SJED 1FFUA 1TY0A 1SJHD 2N9KA 3Q8BA 2J4XA 3H8HA 1QQRA 3SEBA 3BVGA 4JPSA 4RNAA 3HRDD 3B9JA 2WDRB 3NVWA 2NTSA 3AE6B 4TMAB 1FEHA 2WNMA 4LLGM 2R61A 4US8A 1XLOA 1P7EA 3MP9A 1JROA 3J9CA 1FMAD 1KRHA 2WXPA 4LK0M 4RGNA 1BXTA 4AS1A 2Y5PA 1MPEA 2LHEA 3ZYYX 3CWIA 1QOGA 1FXAA 2SAKA 2M19A 1SXTA 1I7HA 4RF0A 2WXNA 2WXOA 1ZOYB 1F0ZA 1HQRD 4KKIA 1D4BA 1CQVA 1D5MC 1RFKA 4ZYSA 1ZP0B 1PGAA 3NVZA 5FKAC 3ZGZA 2WXMA 4IKGA 4NAWB 2EELA 3N9YC 3URYA 1DOYA 1KLUD 3UI3A 2W82A 3AE4B 4GLSC 1SE2A 2QJLA 3ZJVA 2VZKB 2PTLA 1TKYA 2J42A 1EM7A 3AE5B 3W1SA 4HEA1 4B0EA 2WXIA 2OEDA 3BVMA 1ENFA 1YNTE 4UDUC 3U7ZA 1FNWA 2KMMA 1I4XA 1PYWD 4A55A 2HTME 3AE9B 1EWYC 3U2SC 2MH7A 1TJEA 4DXGA 3P4PB 5TSSA 2JZPA 3PZ8A 2IGDA 2EKIA 1JMLA 1KLGD 1ZE3D 1ET9A 2N9LA 1M4VA 2N0SB 2KDMA 2L52A 3BWUD 2HDEA 3U52E 4HKQA 1BMLC 2GB1A 3PZ7A 1YJIA 4DXFA 2V3PA 4LTUA 1DYQA 4MH8A 2RPVA 4ARIA 2CJOA 1FXIA 1L0YB 1YN5A 2ACZB 1GOZA 4MACA 2M56B 4ITKA 2CU3A 2WXHA 1HZ6A 1FCLA 2WS3B 3ZJUA 3I9V1 2BT6A 2LFIA 4HROA 4OZAA 1ACCA 1KF6B 1EU4A 2WXJA 2J53A 2RDGA 3VR9B 2Y3AA 4Q2JA 4KGSA 1V1PA 1E6EB 5JXVA 4CQNA 2KACA 3P4RB 2KWDA 1CJEA 2Y5CA 4YSYB 3GP7A 1NENB 5BMGA 3O13A 1Y56A 3W5UB 5LNK1 4N6EB 1EWCA 1T3QA 3B2FA 3W2DA 4JE3B 3Q8CA 5D7GA 1VJKA 1YMHE 3MJ5A 2L32A 1J7CA 1XLNA 2W3RA 2WXRA 3U4EG 4NAMA 1XCQL 2XNAC 3V3XA 3SFDB 2WP9B 4YTMB 1K51A 1HEZE 1WSPA 2JSVX 1AN8A 1QF6A 2VZKD 1JWAD 2DBYA 3W5VB 3EUB2 4PT5A 3AECB 4IOIE 2GI9A 1YQ3B 2JYTA 1TS4A 4A9AA 1SF0A 1Q10A 1PUTA 3TSSA 4WAFA 4YSXB 1T6BX 3C8YA 2TSSA 5H8YE 3T3NA 2WXFA 1XCTL 1XO3A 2LGIA 3T3OA 4ARCA 3WCQA 3HUIA 4RGMA 2MJEA 1A70A 2W3SA 3AEBB 2PLPA 2LHDA 5BMHA 2W54A 3P1MA 3NVYA 3P42A 2BS3B 2JX5A 3ABVB 1C79A 2MJ3A 1WXQA 2G1EA 1WWTA 3P4QB 4TQ0A 4XWTA 3AEGB 4L1BA 1C4PA 1RWSA 1VRAB 1L4DB 3BZDB 1TKGA 1FIQA 1SIJA 3DWGC 1ESFA 3PO0A 5AUIA 1TS3A 5T8IA 3TEWA 5HFYA 1ZDXA 1HZ5A 4A6QA 2AQ3B 4USAA 4RH6A 2L83A 3KLSX 5E6JA 1N5WA 3TEYA 2PVOD 2D5GA 3BIID 2BS4B 1MI0A 3VRBB 1JCKB 1ZDVA 2AQ2B 1ZPSA 2BBCA 1GPXA 1I4GA 3MC0B 1QILA 1QLBB 4KGRA 2H88B 4TQ1A 4KX6B 5FR3A 5HG2A 2WQYB 1V97A 1P7FA 1V1OA 4OVZA 1OFFA 1L6VA 4RFBA 1N61A 2YEPB 1GAQB 1FNVA 3Q8AA 3LXFA 4JWSC 1XEEA 4J3OD 1L0XB 2DYMA 1NYQA 2JQRB 4AQ7A 3AE2B 3Q8FA 1JWBD 1I4RA 3GS2A 4HKZE 1L6UA 2V3NA 3IXSA 2JYEA 4TSSA 4C80A 2LMCA 2IPKD 1FCCC 1ROEA 1SBBB 2MJDA 2Z8LA 2RDHA 2WXLA 2WLBA 3TEXA 4C7ZA 3MHZA 2ON8A 1N5XA 2CJNA 4L23A 1FD6A 2LUMA 1UUPA 1SEBD 1SE3A 2LEKA 4RGTA 3IAS1 5BYQA 1L0VB 2KQ4X 1JRPA 2X38A 1NVID 3SR6A 1JW9D 2E6XA 3AE8B 2AQ1B 4YTNB 2N7JA 3VQIA 1E0ZA 3Q69A 1N62A 1TS2A 1UWXA 3AB5A 2OHFA 1HA5A 3VRAB 5HHDG 2QIEB 1QT9A 2QSDA 4N59A 2V4IB 4KGTA 1TY2A 3V05A 2IDYA 2K22A 1STEA 4P16A 1LO5D 3AMZA 1F2RI 2YEPF 4WURA 3NUHB 1SSNA 1RYJA 1VZ6A 2DLBA 2FBWB 2L1AA 3FAHA 4NJCA 1VR9A 2WU2B 5AUKA 1UNSA 5BMIA 1OQQA 2K5PA 1K53A 3AH7A 4OZBA 5BYSA 1XF5L 2BYTA 3AE7B 1SB3C 4R3DA 3BYYB 1C78A 1KH0A 1V8CA 3NVVA 3DWMA 3OWEB 3R2TA 3P4SB 1VDVA 1VZ7A 3RFZB 2WDQB 1WYGA 4HRSA 4MM3B 1XLPA 5EE1A 5EE0A 3B2GA 2QILA 2DYOA 4A8XC 3BYTB 1QOBA 2GRIA 4NZLB 1L4ZB 1N63A 4YSZB 1JALA 5BYRA 1FM0D 3BK1A 2PW9A 3ZQ4A 4YXDB 1QKZA 3RPFC 3LYYA 4WH4A 3AEFB 1BUIC 5G5HA 3W9CB 1YQ4B 4YT0B 2WXGA 1E9MA 3GB1A 4XDCA 3HVZA 2QMTA 1YN3A 2PIAA 4H2AA 1AW7A 1JWMD 4FXCA 2J52A 2RMMA 4WIPA 5EE3A 2BS2B 5I4DA 4GDLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI3 A;  2WS3 B;  3FC4 A;  1JWB D;  2BT6 A;  4HRO A;  3ETR A;  1B9R A;  1KF6 B;  1UWM A;  1L6U A;  3AEE B;  1E7P B;  2WU5 B;  4C80 A;  3AN1 A;  1YJJ A;  1NYR A;  2W55 A;  3LB8 C;  1FRR A;  1RM6 C;  3SFE B;  3VR9 B;  1ROE A;  1J7B A;  2MJD A;  3VR8 B;  2WLB A;  4YTP B;  4C7Z A;  1E6E B;  5C3J B;  4N58 A;  3P4R B;  1NEK B;  1DOX A;  1CZP A;  1CJE A;  2Y5C A;  5C2T B;  4YSY B;  1N5X A;  1NEN B;  1DOI A;  2AX5 A;  2CJN A;  3KWL A;  3W5U B;  1AYF A;  3AV8 A;  3NRZ A;  4N6E B;  1L5P A;  1QOF A;  1T3Q A;  1VLB A;  3B2F A;  2LEK A;  1ZUD 2;  1L0V B;  5EE9 A;  1JRP A;  3SR6 A;  1NVI D;  1VJK A;  1FFU A;  1JW9 D;  4ZHO A;  1J7C A;  1XLN A;  2W3R A;  3AE8 B;  4ZOH C;  4YTN B;  1E0Z A;  1XLQ A;  1N62 A;  1FO4 A;  3SFD B;  2WP9 B;  3HRD D;  3B9J A;  2WDR B;  2K9X A;  3L4P A;  3AB5 A;  2OHF A;  3AE6 B;  3AE3 B;  3NVW A;  4YTM B;  3VRA B;  2QIE B;  1QF6 A;  1QT9 A;  4US8 A;  1XLO A;  4N59 A;  1JWA D;  2DBY A;  4WQM A;  3W5V B;  1JRO A;  2K22 A;  1FMA D;  1KRH A;  3AEC B;  3EUB 2;  1YQ3 B;  3AEA B;  3AMZ A;  4A9A A;  1PFD A;  3ZYY X;  3CWI A;  1SF0 A;  1QOG A;  1PUT A;  1RYJ A;  1IUE A;  1FXA A;  1WGK A;  4YSX B;  3P63 A;  2H89 B;  5H8Y E;  2M19 A;  1XO3 A;  4WWM A;  2FBW B;  3WCQ A;  3HUI A;  1DGJ A;  1I7H A;  2MJE A;  3FAH A;  2WU2 B;  1ZOY B;  5AUK A;  1A70 A;  2W3S A;  3AEB B;  1F0Z A;  2W54 A;  1OQQ A;  3P1M A;  1RFK A;  2K5P A;  3AH7 A;  3NVY A;  2E3T A;  4IDI A;  1ZP0 B;  2BS3 B;  2JX5 A;  3ABV B;  2MJ3 A;  1SB3 C;  3AE7 B;  1WXQ A;  5H92 C;  2G1E A;  3NVZ A;  4P6V F;  1WWT A;  3P4Q B;  4JWU C;  1V8C A;  3NVV A;  3AED B;  3DWM A;  3AEG B;  1FRD A;  1DOY A;  1JQ4 A;  3P4S B;  1RWS A;  1VDV A;  2PKO A;  2Q5W D;  4C7Y A;  2WDQ B;  3AE4 B;  2QJL A;  1TKG A;  1R7S A;  1FIQ A;  1TKY A;  1SIJ A;  1WYG A;  3DWG C;  3PO0 A;  5AUI A;  4HRS A;  3AE5 B;  1XLP A;  5EE1 A;  5EE0 A;  1E10 A;  3B2G A;  1J7A A;  1QOA A;  2KMM A;  1QOB A;  1FFV A;  4USA A;  2HTM E;  1OQR A;  1EWY C;  3AE9 B;  1N63 A;  4YSZ B;  1JAL A;  3AE1 B;  2L83 A;  1TJE A;  1FM0 D;  2MH7 A;  3AM9 A;  4US9 A;  3P4P B;  1N60 A;  4YXD B;  2PVG C;  1N5W A;  3CIR B;  3RPF C;  2PVO D;  2EKI A;  3BII D;  1AWD A;  1KFY B;  3AEF B;  2BS4 B;  2KAJ A;  2DWQ A;  5G5G A;  3VRB B;  5G5H A;  3W9C B;  2N0S B;  1ZXI A;  3NS1 A;  1YQ4 B;  2L52 A;  4JX1 C;  1GPX A;  4YT0 B;  1QLB B;  2H88 B;  4KX6 B;  1PDX A;  1E9M A;  2B76 B;  1YJI A;  2WDV B;  2WQY B;  4LTU A;  1V97 A;  3HVZ A;  1WRI A;  5GXG B;  1OFF A;  2PIA A;  1L6V A;  1N61 A;  1GAQ B;  4FXC A;  2CJO A;  1FXI A;  4ZHP A;  3LXF A;  4JWS C;  2ACZ B;  5EE3 A;  2M56 B;  1NYQ A;  1TKE A;  2JQR B;  2BS2 B;  4ITK A;  2CU3 A;  1TYG B;  3AE2 B;  5MPO A; 
#chains in the Genus database with same CATH topology
 3TUO A;  1U4A A;  3FC4 A;  3AI5 A;  4C00 A;  1B9R A;  1E7P B;  2WU5 B;  1WZ0 A;  3SHQ A;  2L3Z A;  2ONQ A;  2DEN B;  4X57 B;  4LCD E;  2IY1 B;  3DPD A;  3VH3 B;  1FNU A;  2I1K A;  4RCO A;  1PGX A;  2KYW A;  1AYF A;  4W9J A;  4LNO A;  1F52 A;  4BAX A;  3A9J A;  3PPA A;  5FK9 C;  1GB1 A;  2WYQ A;  1FO4 A;  1J19 A;  2R2O A;  1KJT A;  2J0K A;  2D10 A;  2K9X A;  4WJP A;  5CHW A;  3R2I A;  2JT4 B;  1WH3 A;  4MSM B;  2HTH A;  2BKR B;  2OJW A;  4EE2 A;  2N4F A;  1WGK A;  4HJG E;  2H89 B;  3UIN B;  1HTO A;  2BF8 B;  2DX5 B;  2XK5 B;  3ZJT A;  2FIF A;  2GBM A;  1DGJ A;  4EZL A;  3NG0 A;  1JWU D;  4LNI A;  2HJ1 A;  4CYE A;  4IDI A;  2D11 A;  1VCB A;  3WAN A;  2QEJ C;  2KKC A;  2IGH A;  3AED B;  1D5Z C;  2ZW0 A;  4C7Y A;  2PKO A;  2Q5W D;  1EU3 A;  4OW0 A;  1R7S A;  2KHW B;  4XWW A;  2K8H A;  1E10 A;  2K1F A;  1I4Q A;  4BKG A;  2NMQ A;  3KW5 B;  1EO6 A;  1IGD A;  3HVD A;  5D3D A;  3HIZ A;  4RGO S;  2PVG C;  3CIR B;  3IAM 1;  2L0F A;  4EFO A;  3JW0 X;  4NQL B;  2O6V A;  4HLE A;  1JQ4 A;  1K52 A;  2C7N B;  1ZXI A;  4KDL B;  1V5T A;  2MQJ A;  1YQB A;  3BVZ A;  2WDV B;  5E6O A;  1F2R C;  4KKJ A;  2JU6 X;  1UEL A;  3E9S A;  2A4Z A;  3PHW B;  3UQA A;  1TKE A;  3PGE A;  4XE0 A;  5MPO A;  2N1V A;  3ZW3 A;  2ZW1 A;  4GDL A;  1YJJ A;  2UYZ B;  2V0G A;  4DQO C;  3VR8 B;  2LWP A;  3OJ3 A;  1NEK B;  3Q14 C;  2MBE A;  3MFG A;  1LGR A;  3L10 B;  1TS5 A;  3QA8 A;  3QCA A;  4G11 A;  2J4X A;  2UU7 A;  1QQR A;  1YOV B;  3SEB A;  3BVG A;  3HRD D;  1WGH A;  3IHP C;  3AE6 B;  4TMA B;  2R61 A;  1XLO A;  4HPM B;  1P7E A;  1GJZ A;  3EC8 A;  3MP9 A;  2KVZ A;  4NAW A;  2WXP A;  4RGN A;  2LHE A;  2WDT B;  3CWI A;  1FXA A;  3DBH B;  4AP4 C;  2M19 A;  2KLC A;  1SXT A;  1X1M A;  4RF0 A;  2DAJ A;  2WXO A;  4EEW A;  4ZYS A;  1GG3 A;  5CTR C;  1PGA A;  4S17 A;  2JZZ A;  3NVZ A;  3RCZ A;  3ZIM A;  4IKG A;  3URY A;  3UI3 A;  2JY6 A;  4I6L B;  1SE2 A;  3R66 C;  3X23 A;  4GDK A;  4PYZ A;  4UDU C;  1EWY C;  2EMT A;  2QDF A;  2KFJ A;  2BYE A;  3P4P B;  5TSS A;  4XC2 A;  2K25 A;  2XBB C;  4FJV B;  4WJN A;  1RAX A;  2NBV B;  2N0S B;  4PYU A;  2IYD B;  2NVU I;  1N6Z A;  4KSL C;  2BWE S;  3PZ7 A;  4DXF A;  4LTU A;  1DYQ A;  2D07 B;  3VHT C;  4KVG B;  1GOZ A;  3NOB A;  2M56 B;  2K6Q A;  1HZ6 A;  2J0M A;  2Z0E B;  2WS3 B;  4LJO B;  1JRU A;  2BT6 A;  2LFI A;  3DVN U;  4HRO A;  4EOY A;  5DPS A;  1KLV A;  3VR9 B;  4MEL A;  1V1P A;  4XGA B;  1CJE A;  2M0X A;  1Y56 A;  3W5U B;  5LNK 1;  1T3Q A;  3Q8C A;  3MJ5 A;  1XLN A;  4NAM A;  2I1J A;  3L16 A;  2N9E B;  4G3X B;  4YTM B;  5L83 A;  1EUV B;  5G55 A;  3EUB 2;  4IOI E;  3RNF C;  2GBJ A;  2GI9 A;  1YQ3 B;  3UQB A;  3TSS A;  2C7H A;  4YSX B;  1T6B X;  5H8Y E;  1XO3 A;  3H9D A;  2LGI A;  3T3O A;  4RGM A;  4BKS A;  2DYB A;  2W3S A;  3P1M A;  3JSV A;  3NVY A;  2KTR B;  2MJ3 A;  1WXQ A;  1WWT A;  5D6J B;  3WA0 A;  4CO7 A;  3AEG B;  2QHO A;  1L4D B;  3QIJ A;  1TKG A;  1SIJ A;  3TEW A;  3D32 A;  1J0G A;  3EEC A;  4IG7 B;  1HZ5 A;  1OQY A;  4USA A;  1XD3 B;  4MGY E;  5E6J A;  2D5G A;  1GPX A;  1QIL A;  1QLB B;  2H88 B;  1WY8 A;  2YEP B;  3LXF A;  4J3O D;  1L0X B;  2MBH A;  3Q8F A;  3PSE B;  4MSQ B;  1I4R A;  3GS2 A;  3A1Q B;  4FA6 A;  1G6J A;  1L6U A;  2V3N A;  4TSS A;  2JYE A;  4NY0 A;  4C80 A;  3EHV A;  1WM3 A;  3ZUN A;  1C3T A;  3BIN A;  4MEM A;  4DHJ D;  2ON8 A;  3N1Z C;  2KMA A;  3O65 B;  1FD6 A;  4RM9 A;  4RGT A;  2C7M B;  5DCN A;  1WXA A;  1J8C A;  1L0V B;  1QZE A;  2KQ4 X;  1JRP A;  3SR6 A;  3GE3 C;  4F8C B;  5JH5 C;  2AQ1 B;  4YTN B;  1E0Z A;  1N62 A;  3QJZ A;  1TBE A;  4KIK A;  4PK1 A;  1HA5 A;  4ZDV A;  3VRA B;  5HHD G;  3DCG A;  4KGT A;  4DDI D;  3V05 A;  1WRD B;  3H7P A;  1STE A;  1LO5 D;  3Q3O C;  4TUU A;  4WUR A;  1R4M B;  4C4V A;  2WU2 B;  1K53 A;  2LZ6 A;  2BYT A;  1SB3 C;  4R3D A;  2C5L C;  1V8C A;  4ICV A;  1D3Z A;  5JHA A;  3V62 A;  3DWM A;  3P4S B;  2WDQ B;  2BYF A;  4MM3 B;  1GNU A;  1XLP A;  5EE0 A;  4A8X C;  4BKT A;  2JRI B;  2GRI A;  1E7U A;  4CHK A;  1WJ4 A;  3KYC D;  3RNA C;  1SE9 A;  2PW9 A;  2O6V B;  3V6C B;  4YXD B;  1LXD A;  1KM7 A;  3LYY A;  3H1U A;  4YT0 B;  3A9K A;  2WXG A;  1R4N I;  4XDC A;  3HVZ A;  1CMX B;  3GOE A;  2JF5 A;  2RMM A;  5I4D A;  4GDL B;  1C4A A;  2MHJ A;  3WAO A;  1UWM A;  3OJ4 B;  1WIA A;  1NYR A;  2IGG A;  2JZ3 B;  1IBX A;  3IT6 B;  4HCP B;  1ET6 A;  2DZI A;  1WE6 A;  2MWS B;  3PLU A;  3APC A;  3ZDT A;  1UGJ A;  1KTK A;  3FIL A;  3ZKJ C;  1D5X C;  1MHH E;  2IBI B;  1C9F A;  4II2 B;  4BFR A;  2D2Q A;  4M0W A;  2MBQ A;  3AEA B;  5FR6 A;  4REZ A;  2O6V D;  4P1C C;  2KAN A;  5J2R A;  2WHI A;  4I6N B;  4WJQ A;  2WXK A;  4JQW C;  1FRD A;  3QQ8 B;  5BO4 B;  4KDI C;  2FUG 1;  2HE7 A;  4GDK B;  1WE7 A;  4IWQ A;  2BB5 A;  3WAM A;  2BQQ A;  2I2Y A;  1J7A A;  3PTF C;  1FFV A;  1OQR A;  4ASW C;  3AE1 B;  3AM9 A;  5J18 A;  4US9 A;  1N60 A;  3DBL I;  3SU8 X;  3DHI C;  4PS8 A;  2DWQ A;  5G5G A;  3NS1 A;  2A5U A;  2ZJD A;  3CF6 E;  4AOF A;  4K3C A;  3VTW A;  1MHX A;  2C9W B;  3TEZ A;  2AL6 A;  1B1Z A;  5HI1 A;  2WWZ A;  1AAR A;  2MBB B;  2KOX A;  2NS5 A;  1XXG A;  4OVU A;  1GB4 A;  1WX8 A;  3NZ3 A;  1V1P B;  2BTE A;  1FRR A;  1RM6 C;  2LXC A;  2UWQ A;  3L17 A;  1JWS D;  4YTP B;  2JWU A;  1T0Y A;  1CZP A;  3KUD B;  2K8C A;  1DOI A;  2IO1 B;  2YVC A;  4A90 A;  3KWL A;  4HK2 A;  3AV8 A;  3NRZ A;  1VLB A;  3Q8E A;  2PEA A;  1E5W A;  1MG4 A;  1TY0 A;  4MJS A;  3Q8B A;  4A20 A;  3H8H A;  3TJP A;  5C23 A;  3B9J A;  2NTS A;  1FEH A;  2WNM A;  2RSU A;  4US8 A;  3WAP A;  4LK0 M;  1BXT A;  2RPQ A;  2Y5P A;  1QOG A;  4FUL A;  3ZLZ A;  3LDZ E;  2SAK A;  2Z0D B;  4EZJ A;  2WXN A;  1ZOY B;  1D4B A;  4ZRI A;  1WGD A;  1D5M C;  1RFK A;  3DBR B;  1ZP0 B;  3DDC B;  4NJ7 A;  3T9L A;  3NS8 A;  2N1W A;  2WXM A;  4J6I A;  1YIW A;  1DOY A;  3FKY A;  1R4N B;  2KQ7 A;  3AE4 B;  4GLS C;  1RFA A;  2VZK B;  4WJO A;  3ONS A;  4FHK A;  3W1S A;  3AE5 B;  4HEA 1;  2ZZP B;  1BT0 A;  3HHM A;  4FHJ A;  1YNT E;  3MJW A;  2KMM A;  4A55 A;  1XQQ A;  3AE9 B;  3N3K B;  3VXW A;  3TL5 A;  2IGD A;  2EKI A;  4AJW A;  1KLG D;  4E71 A;  1ET9 A;  4DHZ B;  2KDM A;  3BWU D;  3U52 E;  4DHZ E;  2GB1 A;  3PZD A;  3MHS D;  5DPT A;  2RPV A;  2V9H A;  3KH0 A;  3WIM A;  3R7R A;  2ACZ B;  3N1X C;  2WXH A;  3ZJU A;  1EU4 A;  4EUT A;  1ZGU B;  4EKU A;  2AWT A;  2AYO B;  4Q2J A;  2M1M A;  4KGS A;  2KAC A;  4YSY B;  2VH2 A;  3GP7 A;  5BMG A;  2LXA A;  2G45 B;  3DVN V;  1TZ1 A;  5D7G A;  1YMH E;  4KIK B;  2W3R A;  4WAA A;  3U4E G;  2FCQ A;  2WP9 B;  1WXS A;  3RUL A;  2JSV X;  2LVO A;  1ZW7 A;  2KC1 A;  1QF6 A;  2VZK D;  4W9F A;  3W5V B;  3VFK A;  2KC2 A;  2KZR A;  4A9A A;  1SF0 A;  1PUT A;  4WAF A;  4C4V B;  4HDO A;  2TSS A;  4QAY A;  3T3N A;  2WXF A;  1XCT L;  1E7V A;  3WCQ A;  1KOT A;  3AEB B;  2PLP A;  2W54 A;  2ZVO A;  2BS3 B;  3ABV B;  1C79 A;  2G1E A;  4XWT A;  2LGD A;  4L1B A;  1RWS A;  2M8S A;  3ZNG C;  3Q3N C;  3Q2A C;  1ESF A;  5DPW A;  2LUE A;  3ZXR A;  4ACF A;  3K9P B;  5D94 A;  2LVP A;  4K7S A;  4AUQ C;  2G3Q B;  4IM0 A;  2IO2 B;  1WXV A;  3APF A;  2BS4 B;  1MI0 A;  1ZDV A;  2AQ2 B;  2BBC A;  1I4G A;  5D2M B;  3T8M A;  3C19 A;  4RMA A;  4KGR A;  3VTU A;  4WWO A;  1V97 A;  4M00 A;  1P7F A;  2DAF A;  1L6V A;  3GE8 C;  3R7Q A;  1LQB A;  3OLM D;  3TMP B;  1WR6 E;  2DYM A;  4FBJ B;  1NYQ A;  2JQR B;  3CST A;  4MGZ E;  1JWB D;  2KDF B;  3ZO5 B;  2JRH A;  4HKZ E;  2X8X X;  4IM2 A;  1FCC C;  1ROE A;  4BBN C;  4HVB A;  3MHZ A;  3NZU A;  2KFK B;  1WXM A;  2DNF A;  1VD2 A;  2CJN A;  3P2B A;  1WGY A;  1UD7 A;  1SEB D;  1SE3 A;  3IAS 1;  4ANX A;  1V81 A;  3PLV A;  2N7J A;  3Q69 A;  4ANU A;  2MP2 A;  3B08 A;  2QIE B;  1WFY A;  2D3C A;  2QSD A;  3ZDM C;  1TY2 A;  2IDY A;  2YEP F;  1RYJ A;  2M17 A;  2L76 A;  2L1A A;  3VVW B;  2LJ5 A;  5AUK A;  1M94 A;  2R2Q A;  5BMI A;  2K5P A;  1YD8 U;  2KWC A;  2VRR B;  4GOC A;  4K7W A;  1C78 A;  1KH0 A;  1Y8R C;  3R2T A;  1E8W A;  1VDV A;  3RT3 B;  1VZ7 A;  4DK5 A;  4BZA A;  2V4L A;  1GUA B;  1MJD A;  3ZRC A;  2QC8 A;  3I3T B;  1V86 A;  2CKH B;  4FJY A;  4B95 A;  3ZTD A;  4F1S A;  1TTN A;  4TKN A;  1S3S G;  2N7E A;  4HPP A;  2JWZ A;  4JGH B;  5E6P A;  2JVC A;  2PIA A;  4H2A A;  1AW7 A;  4K3B A;  3Q3F A;  2L05 A;  4BVU C;  2BS2 B;  4O1N A;  2V1Y A;  2JXT A;  3AEE B;  3N20 C;  2W55 A;  1J7B A;  1T0S C;  4HWI B;  3ZXV A;  4IWP A;  2I38 A;  1I4H A;  4K1R B;  4IWO A;  1QOF A;  2K0P A;  3RMK C;  1SIF A;  3APD A;  1WGR A;  2AL3 A;  2LJI A;  2XK5 A;  4ZOH C;  4LNN A;  2NPT A;  2FCS A;  4ZRK A;  1K50 A;  2IJ0 A;  4MT5 A;  2GOW A;  4ZRP A;  3AE3 B;  1HXY D;  4EZK A;  2BW2 A;  1PGB A;  3RI7 C;  4WQM A;  3TBL D;  3CMM B;  5JZE B;  1SE4 A;  1VZ8 A;  1UBQ A;  1C76 A;  3P63 A;  1C4C A;  2CHZ A;  3A9J B;  2LRW A;  2NTT A;  1XT9 B;  1MFW A;  1WJ6 A;  2E3T A;  2KN4 A;  5H92 C;  4KSK C;  2YLM A;  4M8M A;  1UF0 A;  4XDD A;  4D2K A;  4ZRJ A;  3PT2 B;  4XZ4 A;  4B0M A;  2WXQ A;  1OEY J;  2MX2 A;  4GB9 A;  1QOA A;  2BPS A;  3VUW A;  4M01 A;  1EF1 A;  1WR1 A;  4ZYN A;  2PMV A;  1TT5 B;  2EKE C;  1WYW B;  2MEK A;  3X0W A;  3KWV A;  2V3S A;  3WAL A;  4W9C A;  4W9I A;  4JX1 C;  2FE8 A;  2B76 B;  2D3G A;  3EGR A;  1T5X D;  1WRI A;  5GXG B;  3BK2 A;  3I57 A;  5IN7 A;  4ZHP A;  4GSW A;  4RF1 A;  3NY5 A;  1H4R A;  1WJU A;  4IUM B;  1NI3 A;  5LLI A;  3QAQ A;  4B9K A;  2IY0 B;  2KDE B;  5GMV A;  4OHJ A;  1MVK A;  3SFE B;  3TIX A;  1L2N A;  2D3B A;  2O2V A;  3DBS A;  5D3I B;  1L5P A;  3KQ4 A;  3AXC A;  4A3O A;  4GU2 A;  1SJE D;  1SJH D;  2N9K A;  4K81 A;  2K6D B;  2WDR B;  3V6E B;  5G2N A;  4JIO U;  3J9C A;  1FMA D;  1KRH A;  2KXJ A;  4AS1 A;  2REX A;  2LVQ A;  4N9F 4;  1I7H A;  3ZNZ B;  3L0W B;  3SD5 A;  3L13 A;  5J17 A;  1HQR D;  4KKI A;  1C1Y B;  5FKA C;  3ZGZ A;  2AEH A;  2IO0 B;  4NAW B;  4DXA B;  3RNE C;  2EEL A;  3N9Y C;  5CX3 A;  1ZKH A;  3AUL A;  2QJL A;  1TKY A;  3QWZ B;  2J42 A;  2IZV B;  4B0E A;  2OED A;  2HJ8 A;  3U7Z A;  1FNW A;  3U2S C;  4DXG A;  2KVR A;  3N32 A;  1YX5 B;  2KX0 A;  4WWN A;  2N9X A;  3DOW A;  2JZP A;  5EDS A;  4M8N A;  2RDB C;  3EFU A;  4NPN A;  2N9L A;  1WJN A;  2L52 A;  4HKQ A;  1IP9 A;  1YJI A;  2LRU A;  2V3P A;  2J0J A;  4LDT B;  4MH8 A;  3KUZ A;  4M02 A;  2JPH A;  3MC8 A;  3I9V 1;  1ACC A;  3B1L X;  5JHB A;  2J53 A;  2RDG A;  2D3A A;  3U8Z A;  2Y3A A;  2KDB A;  2WX0 A;  4GN1 A;  2CHX A;  3RN9 C;  2LGX A;  2KWD A;  3O13 A;  1WZ3 A;  4MDK E;  1EWC A;  3B2F A;  3QK0 A;  1VJK A;  1F1H A;  3M62 B;  1XCQ L;  2XNA C;  3V3X A;  1K51 A;  2KTR A;  4URK A;  1AN8 A;  2MCN B;  3W1Y A;  2DBY A;  4PS3 A;  3Q3M C;  4PT5 A;  5LXH A;  2GBK A;  2LGS A;  1UZX B;  2JYT A;  2FNJ B;  1Q10 A;  3DBH I;  3C8Y A;  2BYV E;  4ARC A;  3HUI A;  2Y5B B;  1A70 A;  2M4N A;  2LD9 A;  2JX5 A;  2KN5 A;  1S1Q B;  4TQ0 A;  2CS4 A;  3NHE B;  1WF9 A;  1C4P A;  3ZNH B;  4LDT D;  1I42 A;  1WX9 A;  2KLG A;  2WX1 A;  3BZD B;  4NNJ B;  1UH6 A;  4HCN B;  1TGZ B;  4IW0 A;  5AUI A;  5IOI A;  5HFY A;  4A6Q A;  5IKC M;  2AQ3 B;  3JSV B;  4RH6 A;  4MGK E;  3KLS X;  4DWF A;  1SGH A;  1N5W A;  3DHG C;  2PVO D;  2GLS A;  3QHT A;  3H7S A;  3A1Q A;  4TV3 A;  1JCK B;  1ZPS A;  3ECI A;  2PE9 A;  3ZRF A;  1HTQ A;  1YX6 B;  5FR3 A;  3L54 A;  5HG2 A;  3QX1 A;  1FNV A;  3Q8A A;  4JWS C;  2ZPN A;  4E3C A;  2Z59 B;  4AQ7 A;  3AE2 B;  2DHZ A;  3ENE A;  3IXS A;  2KNB A;  2GBR A;  2MJD A;  2RDH A;  2WXL A;  2ZCB A;  3TEX A;  2MW5 A;  4W9D A;  3A4R A;  1E8Y A;  3VUX A;  1T0R C;  4L23 A;  2LUM A;  2MBO A;  2NPT B;  3JVZ X;  2BGF A;  2E6X A;  2NCN A;  3AE8 B;  3IG3 A;  1V5O A;  3VQI A;  5AZF A;  3N30 A;  1TS2 A;  3AB5 A;  2OHF A;  4F7Z A;  1MG8 A;  1QT9 A;  2J7Q B;  5LXI B;  1RLF A;  1A5R A;  4P16 A;  4BKS D;  1F2R I;  1E8X A;  2DLB A;  4MM3 A;  4DDG D;  1V2Y A;  1OGW A;  4G0N B;  3ZVV A;  1VR9 A;  1Q1O A;  3AU4 A;  1H8C A;  1OQQ A;  4OZB A;  1XF5 L;  4AJY B;  4JLC A;  3GZN I;  3NVV A;  3RD2 A;  3H7P B;  4P1B C;  4KZC A;  2BVC A;  2ZNV B;  2HD5 B;  2ZPY A;  5AEK B;  1WYG A;  1FPY A;  3A4S C;  1WM2 A;  3DQV A;  2RR9 A;  3PRZ A;  2G4D B;  5IAA C;  1N63 A;  4YSZ B;  1JAL A;  5BYR A;  3VTV A;  4IM3 A;  1NDD A;  2KD0 A;  3U7D A;  3ZQ4 A;  1QKZ A;  3DBL B;  4GMV A;  4WH4 A;  3AEF B;  1BUI C;  3IBE A;  5G5H A;  3W9C B;  1WX7 A;  2DZM A;  3BY4 B;  3I63 C;  3GB1 A;  4GGQ A;  2QMT A;  1YN3 A;  2DZK A;  4YL8 A;  1JWM D;  4NQK E;  5EE3 A;  1P9D U;  3VH4 B;  3ML9 A;  4BOS C;  5IA7 A;  3AN1 A;  3A9K B;  3LB8 C;  1IYF A;  2O2V B;  1C77 A;  5C2T B;  3OG5 A;  4E74 A;  2K3U A;  1ZXH A;  1I4P A;  1V9J A;  2INN E;  4LJP B;  4NJ6 A;  4ZHO A;  4GXB A;  4MH0 E;  1NBF C;  2G9H D;  1TZO A;  1XLQ A;  3PV1 A;  1P98 A;  2LI5 A;  3L4P A;  1IBX B;  1D6E C;  2GMI C;  1P1A A;  5CHV C;  2INP E;  2G4S A;  3RZW C;  1FXT B;  2KJ6 A;  1PFD A;  3PRM B;  3W1S C;  1IUE A;  4OZC A;  4FJZ A;  2KWU B;  4WWM A;  4C56 C;  1R4M I;  4W9E A;  3FIL B;  2BB6 A;  5DPR A;  5E6N A;  3U30 A;  3DVG X;  4P6V F;  4JWU C;  2PJH A;  3PRE A;  4M0W B;  2MLB A;  1F9J A;  4BOZ B;  1CK1 A;  2FCN A;  4ZRQ A;  2LGY A;  2MA9 B;  1WI0 A;  2INC C;  3DHH C;  1L7Y A;  2N7D A;  2SEB D;  3I5J C;  2KWV B;  2W9N A;  1AWD A;  1KFY B;  3MC9 A;  2XN9 C;  3E56 A;  3RYT A;  2KAJ A;  1IGC A;  1F77 A;  1Z5S B;  4YWG G;  1PDX A;  4ANW A;  3HK0 A;  1LM8 B;  4XYC A;  3HM3 A;  1LFD A;  1TYG B;  4LNK A;  1UGM A;  5C1Z A;  1OTR B;  1HE8 A;  4KZ0 A;  2ICI A;  3ETR A;  1WMH A;  4BBN F;  2M0A A;  2PPH A;  1Z2M A;  3IT4 B;  5C3J B;  4N58 A;  5IO9 A;  4W9H A;  1DOX A;  3EA6 A;  1I35 A;  4OVV A;  3V60 A;  4DHJ B;  2AX5 A;  2K39 A;  1ISN A;  1YN4 A;  4L2Y A;  2IO3 B;  2JXX A;  3R8B A;  1ZUD 2;  5EE9 A;  1FFU A;  3M63 B;  4WQO B;  3R3M A;  2QCZ A;  4JPS A;  4RNA A;  3GZN B;  3HM6 X;  3NVW A;  1GC6 A;  2KMC A;  3KUC B;  4LLG M;  1RRB A;  5AZH A;  3RUI B;  2NBU A;  3MTN B;  1JRO A;  4PS7 A;  4I6P A;  1MPE A;  3ZYY X;  4W9L A;  2MSE D;  4GIV A;  4MJS B;  3UIP B;  2L0T A;  3KYD D;  3UIO B;  3VUY A;  1F0Z A;  1CQV A;  3K9O B;  3V61 A;  4XX5 A;  1EF5 A;  2KQS A;  2KT7 A;  1KLU D;  3L08 A;  2PE6 B;  2W82 A;  3N1Y C;  3ZJV A;  2PTL A;  1Q5W B;  1EM7 A;  1YJ1 A;  1WGG A;  2KTF A;  2WXI A;  3BVM A;  1ENF A;  3M3J A;  4ANV A;  4IC7 B;  1I4X A;  1PYW D;  1UBI A;  2HTM E;  2N9P C;  2C60 A;  2MH7 A;  1TJE A;  2CU1 A;  4ICU A;  1V49 A;  3PZ8 A;  3VDZ A;  1JML A;  1ZE3 D;  2NBW B;  1M4V A;  2RD0 A;  3RNC C;  3TCA A;  2B3A A;  2HDE A;  1BML C;  1TIF A;  4ARI A;  4LNF A;  2CJO A;  2OJR A;  1FXI A;  1L0Y B;  1YN5 A;  4MAC A;  4ITK A;  3A33 B;  2KX3 A;  5HKH A;  2CU3 A;  1FCL A;  4OZA A;  1KF6 B;  3ZNI D;  2WXJ A;  4S0R A;  3RNG C;  4MGI E;  1NI2 A;  1P0R A;  1E6E B;  3AU5 A;  3NZS A;  5JXV A;  1IPG A;  4CQN A;  3P4R B;  1T0Q C;  2Y5C A;  1NEN B;  2KO3 A;  1V80 A;  3KVF B;  3RZF A;  4N6E B;  5KHQ A;  3W2D A;  4JE3 B;  4A3P A;  3Q6B A;  5TR5 A;  2L32 A;  1J7C A;  2KDI A;  2WXR A;  4WWP A;  4HJK A;  3PS6 A;  2FUH B;  3SFD B;  2L8J A;  4HDQ A;  1HEZ E;  1WSP A;  2KJR A;  1JWA D;  2L7R A;  3AEC B;  1TS4 A;  1GC7 A;  3VAW A;  4II3 B;  1V6E A;  5IP4 D;  5KHO A;  2OOB B;  2MJE A;  5BMH A;  2L00 B;  2LHD A;  3QAR A;  3P42 A;  3DBR I;  4KV2 A;  1K8R B;  3P4Q B;  3IFW B;  3EFC A;  2MRP A;  1VRA B;  2FAZ A;  3OAW A;  4W9K A;  1FIQ A;  3PO0 A;  3DWG C;  5T8I A;  1TS3 A;  4JL9 A;  3ZTC A;  1ZDX A;  2K8B A;  2NR2 A;  2L83 A;  1Q0W B;  2CHW A;  3PHX B;  3TEY A;  4HPL B;  3BII D;  3JYU A;  5CHF A;  4G50 A;  3VRB B;  3MC0 B;  4TQ1 A;  4KX6 B;  4W9G A;  2BKF A;  2WQY B;  2KFK A;  1V1O A;  4OVZ A;  1OFF A;  4RFB A;  1N61 A;  3IVF A;  3C0R B;  1GAQ B;  5L95 C;  2IND C;  5AZG A;  1XEE A;  2RGF A;  4HXD A;  2KK8 A;  3H6N A;  2WGS A;  2DZJ A;  2LMC A;  2IPK D;  4FN2 A;  1SBB B;  2GBN A;  2Z8L A;  2ZEQ A;  2XEW A;  4FLH A;  2WLB A;  4C7Z A;  3CSF A;  1N5X A;  1UUP A;  2LEK A;  3LJ3 A;  5BYQ A;  2X38 A;  1NVI D;  3S2A A;  1JW9 D;  4B6W A;  1UWX A;  1OEY A;  3ALB A;  3DVG Y;  2V4I B;  2JUO A;  4N59 A;  2VH1 A;  2K22 A;  3QC8 B;  3AMZ A;  4FAD A;  2LAS A;  1SSN A;  3NUH B;  2ZNV C;  3B0A A;  2FID A;  1VZ6 A;  3Q3J A;  2FBW B;  3FAH A;  4NJC A;  1PQS A;  1UNS A;  3AH7 A;  5BYS A;  2MP2 B;  3UGB B;  3AE7 B;  2FCM A;  3BYY B;  2ASQ A;  3OWE B;  4RM8 A;  3RNB C;  2BWF A;  4DBG A;  3RFZ B;  1E8Z A;  4HRS A;  5EE1 A;  3B2G A;  2QIL A;  2DYO A;  3SDL C;  2ZVN A;  3BYT B;  1QOB A;  4P7I A;  4NZL B;  1E90 A;  1L4Z B;  3UF8 A;  3ML8 A;  1FM0 D;  3BK1 A;  2KJH B;  3RPF C;  4K7U A;  2EMS A;  1YQ4 B;  3PRP B;  4AWJ A;  1E9M A;  3NJT A;  3M95 A;  1P3Q U;  4FXC A;  2J52 A;  4WIP A;  2ZCC A;  1WMH B;  3PVL A;  2CR5 A; 
#chains in the Genus database with same CATH homology
 3TUO A;  1C4A A;  4O1N A;  3FC4 A;  1B9R A;  2JXT A;  1UWM A;  3AEE B;  1E7P B;  2WU5 B;  3AN1 A;  1NYR A;  2W55 A;  3LB8 C;  2IGG A;  2ONQ A;  1J7B A;  1IBX A;  1FNU A;  3IT6 B;  2I38 A;  1ET6 A;  1I4H A;  1C77 A;  1PGX A;  4RCO A;  5C2T B;  1AYF A;  1ZXH A;  2K3U A;  1QOF A;  2K0P A;  1I4P A;  2INN E;  4ZHO A;  1UGJ A;  2LJI A;  1KTK A;  4ZOH C;  5FK9 C;  3FIL A;  2G9H D;  1TZO A;  1XLQ A;  1GB1 A;  1K50 A;  2IJ0 A;  4MT5 A;  1FO4 A;  4ZRP A;  2K9X A;  3L4P A;  3AE3 B;  1IBX B;  1HXY D;  1D5X C;  1MHH E;  3R2I A;  1D6E C;  2BW2 A;  1C9F A;  1PGB A;  2INP E;  4WQM A;  4EE2 A;  1SE4 A;  4M0W A;  3AEA B;  1VZ8 A;  1PFD A;  1C76 A;  1IUE A;  1WGK A;  3P63 A;  4HJG E;  4OZC A;  1C4C A;  2H89 B;  4REZ A;  2NTT A;  4WWM A;  3ZJT A;  4C56 C;  1DGJ A;  3FIL B;  1JWU D;  2BB6 A;  2E3T A;  2KN4 A;  4IDI A;  2QEJ C;  5H92 C;  2WXK A;  4P6V F;  2IGH A;  4JWU C;  3AED B;  4XDD A;  1D5Z C;  1FRD A;  4D2K A;  2ZW0 A;  4C7Y A;  2PKO A;  2FUG 1;  1CK1 A;  2Q5W D;  4B0M A;  2WXQ A;  4GDK B;  1EU3 A;  4OW0 A;  4ZRQ A;  1R7S A;  2BB5 A;  4XWW A;  1E10 A;  1I4Q A;  2I2Y A;  2NMQ A;  1J7A A;  1QOA A;  1FFV A;  2PMV A;  1IGD A;  1OQR A;  3HVD A;  5D3D A;  3AE1 B;  2SEB D;  3AM9 A;  4US9 A;  2MEK A;  4RGO S;  1N60 A;  2PVG C;  3CIR B;  3IAM 1;  3KWV A;  1AWD A;  1KFY B;  2XN9 C;  3E56 A;  2KAJ A;  2DWQ A;  5G5G A;  1IGC A;  1K52 A;  1F77 A;  1JQ4 A;  1ZXI A;  3NS1 A;  4JX1 C;  2FE8 A;  4YWG G;  1PDX A;  3BVZ A;  2B76 B;  2WDV B;  3EGR A;  1T5X D;  1WRI A;  5GXG B;  1F2R C;  3BK2 A;  4KKJ A;  3I57 A;  1MHX A;  2JU6 X;  3E9S A;  3TEZ A;  4ZHP A;  1B1Z A;  5HI1 A;  4RF1 A;  1TKE A;  1TYG B;  4XE0 A;  5MPO A;  1NI3 A;  1XXG A;  1GB4 A;  2ICI A;  3ETR A;  2ZW1 A;  3NZ3 A;  2M0A A;  1V1P B;  1YJJ A;  2BTE A;  4OHJ A;  3IT4 B;  1FRR A;  1MVK A;  1RM6 C;  3SFE B;  2V0G A;  4DQO C;  3VR8 B;  1JWS D;  4YTP B;  5C3J B;  2JWU A;  4N58 A;  1NEK B;  1DOX A;  1CZP A;  3EA6 A;  4A90 A;  1DOI A;  2AX5 A;  3KWL A;  3MFG A;  5D3I B;  3AV8 A;  3NRZ A;  1YN4 A;  1L5P A;  3KQ4 A;  4L2Y A;  1VLB A;  1TS5 A;  3R8B A;  1ZUD 2;  3Q8E A;  5EE9 A;  1SJE D;  1FFU A;  1TY0 A;  1SJH D;  2N9K A;  3Q8B A;  2J4X A;  3H8H A;  1QQR A;  3SEB A;  3BVG A;  4JPS A;  4RNA A;  3HRD D;  3B9J A;  2WDR B;  3NVW A;  2NTS A;  3AE6 B;  4TMA B;  1FEH A;  2WNM A;  4LLG M;  2R61 A;  4US8 A;  1XLO A;  1P7E A;  3MP9 A;  1JRO A;  3J9C A;  1FMA D;  1KRH A;  2WXP A;  4LK0 M;  4RGN A;  1BXT A;  4AS1 A;  2Y5P A;  1MPE A;  2LHE A;  3ZYY X;  3CWI A;  1QOG A;  1FXA A;  2SAK A;  2M19 A;  1SXT A;  1I7H A;  4RF0 A;  2WXN A;  2WXO A;  1ZOY B;  1F0Z A;  1HQR D;  4KKI A;  1D4B A;  1CQV A;  1D5M C;  1RFK A;  4ZYS A;  1ZP0 B;  1PGA A;  3NVZ A;  5FKA C;  3ZGZ A;  2WXM A;  4IKG A;  4NAW B;  2EEL A;  3N9Y C;  3URY A;  1DOY A;  1KLU D;  3UI3 A;  2W82 A;  3AE4 B;  4GLS C;  1SE2 A;  2QJL A;  3ZJV A;  2VZK B;  2PTL A;  1TKY A;  2J42 A;  1EM7 A;  3AE5 B;  3W1S A;  4HEA 1;  4B0E A;  2WXI A;  2OED A;  3BVM A;  1ENF A;  1YNT E;  4UDU C;  3U7Z A;  1FNW A;  2KMM A;  1I4X A;  1PYW D;  4A55 A;  2HTM E;  3AE9 B;  1EWY C;  3U2S C;  2MH7 A;  1TJE A;  4DXG A;  3P4P B;  5TSS A;  2JZP A;  3PZ8 A;  2IGD A;  2EKI A;  1JML A;  1KLG D;  1ZE3 D;  1ET9 A;  2N9L A;  1M4V A;  2N0S B;  2KDM A;  2L52 A;  3BWU D;  2HDE A;  3U52 E;  4HKQ A;  1BML C;  2GB1 A;  3PZ7 A;  1YJI A;  4DXF A;  2V3P A;  4LTU A;  1DYQ A;  4MH8 A;  2RPV A;  4ARI A;  2CJO A;  1FXI A;  1L0Y B;  1YN5 A;  2ACZ B;  1GOZ A;  4MAC A;  2M56 B;  4ITK A;  2CU3 A;  2WXH A;  1HZ6 A;  1FCL A;  2WS3 B;  3ZJU A;  3I9V 1;  2BT6 A;  2LFI A;  4HRO A;  4OZA A;  1ACC A;  1KF6 B;  1EU4 A;  2WXJ A;  2J53 A;  2RDG A;  3VR9 B;  2Y3A A;  4Q2J A;  4KGS A;  1V1P A;  1E6E B;  5JXV A;  4CQN A;  2KAC A;  3P4R B;  2KWD A;  1CJE A;  2Y5C A;  4YSY B;  3GP7 A;  1NEN B;  5BMG A;  3O13 A;  1Y56 A;  3W5U B;  5LNK 1;  4N6E B;  1EWC A;  1T3Q A;  3B2F A;  3W2D A;  4JE3 B;  3Q8C A;  5D7G A;  1VJK A;  1YMH E;  3MJ5 A;  2L32 A;  1J7C A;  1XLN A;  2W3R A;  2WXR A;  3U4E G;  4NAM A;  1XCQ L;  2XNA C;  3V3X A;  3SFD B;  2WP9 B;  4YTM B;  1K51 A;  1HEZ E;  1WSP A;  2JSV X;  1AN8 A;  1QF6 A;  2VZK D;  1JWA D;  2DBY A;  3W5V B;  3EUB 2;  4PT5 A;  3AEC B;  4IOI E;  2GI9 A;  1YQ3 B;  2JYT A;  1TS4 A;  4A9A A;  1SF0 A;  1Q10 A;  1PUT A;  3TSS A;  4WAF A;  4YSX B;  1T6B X;  3C8Y A;  2TSS A;  5H8Y E;  3T3N A;  2WXF A;  1XCT L;  1XO3 A;  2LGI A;  3T3O A;  4ARC A;  3WCQ A;  3HUI A;  4RGM A;  2MJE A;  1A70 A;  2W3S A;  3AEB B;  2PLP A;  2LHD A;  5BMH A;  2W54 A;  3P1M A;  3NVY A;  3P42 A;  2BS3 B;  2JX5 A;  3ABV B;  1C79 A;  2MJ3 A;  1WXQ A;  2G1E A;  1WWT A;  3P4Q B;  4TQ0 A;  4XWT A;  3AEG B;  4L1B A;  1C4P A;  1RWS A;  1VRA B;  1L4D B;  3BZD B;  1TKG A;  1FIQ A;  1SIJ A;  3DWG C;  1ESF A;  3PO0 A;  5AUI A;  1TS3 A;  5T8I A;  3TEW A;  5HFY A;  1ZDX A;  1HZ5 A;  4A6Q A;  2AQ3 B;  4USA A;  4RH6 A;  2L83 A;  3KLS X;  5E6J A;  1N5W A;  3TEY A;  2PVO D;  2D5G A;  3BII D;  2BS4 B;  1MI0 A;  3VRB B;  1JCK B;  1ZDV A;  2AQ2 B;  1ZPS A;  2BBC A;  1GPX A;  1I4G A;  3MC0 B;  1QIL A;  1QLB B;  4KGR A;  2H88 B;  4TQ1 A;  4KX6 B;  5FR3 A;  5HG2 A;  2WQY B;  1V97 A;  1P7F A;  1V1O A;  4OVZ A;  1OFF A;  1L6V A;  4RFB A;  1N61 A;  2YEP B;  1GAQ B;  1FNV A;  3Q8A A;  3LXF A;  4JWS C;  1XEE A;  4J3O D;  1L0X B;  2DYM A;  1NYQ A;  2JQR B;  4AQ7 A;  3AE2 B;  3Q8F A;  1JWB D;  1I4R A;  3GS2 A;  4HKZ E;  1L6U A;  2V3N A;  3IXS A;  2JYE A;  4TSS A;  4C80 A;  2LMC A;  2IPK D;  1FCC C;  1ROE A;  1SBB B;  2MJD A;  2Z8L A;  2RDH A;  2WXL A;  2WLB A;  3TEX A;  4C7Z A;  3MHZ A;  2ON8 A;  1N5X A;  2CJN A;  4L23 A;  1FD6 A;  2LUM A;  1UUP A;  1SEB D;  1SE3 A;  2LEK A;  4RGT A;  3IAS 1;  5BYQ A;  1L0V B;  2KQ4 X;  1JRP A;  2X38 A;  1NVI D;  3SR6 A;  1JW9 D;  2E6X A;  3AE8 B;  2AQ1 B;  4YTN B;  2N7J A;  3VQI A;  1E0Z A;  3Q69 A;  1N62 A;  1TS2 A;  1UWX A;  3AB5 A;  2OHF A;  1HA5 A;  3VRA B;  5HHD G;  2QIE B;  1QT9 A;  2QSD A;  4N59 A;  2V4I B;  4KGT A;  1TY2 A;  3V05 A;  2IDY A;  2K22 A;  1STE A;  4P16 A;  1LO5 D;  3AMZ A;  1F2R I;  2YEP F;  4WUR A;  3NUH B;  1SSN A;  1RYJ A;  1VZ6 A;  2DLB A;  2FBW B;  2L1A A;  3FAH A;  4NJC A;  1VR9 A;  2WU2 B;  5AUK A;  1UNS A;  5BMI A;  1OQQ A;  2K5P A;  1K53 A;  3AH7 A;  4OZB A;  5BYS A;  1XF5 L;  2BYT A;  3AE7 B;  1SB3 C;  4R3D A;  3BYY B;  1C78 A;  1KH0 A;  1V8C A;  3NVV A;  3DWM A;  3OWE B;  3R2T A;  3P4S B;  1VDV A;  1VZ7 A;  3RFZ B;  2WDQ B;  1WYG A;  4HRS A;  4MM3 B;  1XLP A;  5EE1 A;  5EE0 A;  3B2G A;  2QIL A;  2DYO A;  4A8X C;  3BYT B;  1QOB A;  2GRI A;  4NZL B;  1L4Z B;  1N63 A;  4YSZ B;  1JAL A;  5BYR A;  1FM0 D;  3BK1 A;  2PW9 A;  3ZQ4 A;  4YXD B;  1QKZ A;  3RPF C;  3LYY A;  4WH4 A;  3AEF B;  1BUI C;  5G5H A;  3W9C B;  1YQ4 B;  4YT0 B;  2WXG A;  1E9M A;  3GB1 A;  4XDC A;  3HVZ A;  2QMT A;  1YN3 A;  2PIA A;  4H2A A;  1AW7 A;  1JWM D;  4FXC A;  2J52 A;  2RMM A;  4WIP A;  5EE3 A;  2BS2 B;  5I4D A;  4GDL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...