1JW9D

Structure of the native moeb-moad protein complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
publication title Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2001-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jw9D00
1WXQA 1JWBD 2W3RA 3ETRA 1E7PB 1JWAD 5AUIA 1QF6A 1XLOA 2FBWB 4US9A 3EUB2 1PFDA 4YTNB 1AWDA 3AM9A 5H92C 1L5PA 4A9AA 1JRPA 3NRZA 2L83A 3B9JA 1YJIA 1DGJA 1PDXA 2AX5A 1N5WA 3AN1A 1DOYA 2Y5CA 3DWGC 4YSZB 4LTUA 1FO4A 3AE5B 1L6UA 4C80A 4JWUC 1GPXA 1GAQB 4YSXB 2WDVB 3WCQA 3AEDB 1UWMA 3P63A 2BS3B 3AV8A 3FC4A 1VJKA 3AEEB 3VR9B 1XLPA 1QOFA 2M56B 3BIID 5G5GA 1FXAA 1FFUA 1DOIA 1OFFA 2H89B 3NVYA 4N59A 2QIEB 3AH7A 3P4PB 1NI3A 1T3QA 1XLQA 1PUTA 1CJEA 3PO0A 1ROEA 1FRDA 1TKEA 1FM0D 3P4SB 4YTMB 5EE1A 2CU3A 3AE6B 1NEKB 1J7CA 1OQQA 1E6EB 2BT6A 2HTME 2JX5A 2MJ3A 2DWQA 2N0SB 2W55A 2PVOD 3AE3B 4WQMA 1ZXIA 4ZOHC 3W5UB 1FRRA 4C7YA 3HVZA 2Q5WD 1V8CA 1JALA 3CWIA 3HRDD 3FAHA 1N5XA 3P4QB 1E0ZA 2G1EA 2DBYA 1QOGA 4JX1C 1F0ZA 2WQYB 2WS3B 1YQ3B 3AECB 1QOBA 2WDQB 1NYQA 1YQ4B 2KAJA 5EE9A 3L4PA 2LEKA 1N63A 5C3JB 5EE0A 3CIRB 4YSYB 1N60A 1RYJA 3NS1A 1VDVA 2OHFA 2M19A 1YJJA 1B9RA 3AEAB 5H8YE 1NYRA 1XO3A 2WLBA 1FIQA 1WYGA 2E3TA 4USAA 3VRBB 1OQRA 4IDIA 1J7AA 3B2FA 5AUKA 4KX6B 4US8A 1EWYC 1NVID 3NVWA 1E9MA 1I7HA 2WU2B 1RWSA 2K22A 2K9XA 3P4RB 5MPOA 1DOXA 1SB3C 3AE1B 2W54A 4YT0B 3W9CB 2WU5B 5EE3A 3AE4B 2MJDA 1TKYA 3AE8B 4FXCA 1R7SA 2PIAA 1AYFA 3AEFB 1JROA 2WDRB 2B76B 4P6VF 1QT9A 1JW9D 1KRHA 3DWMA 4C7ZA 3AE7B 3AMZA 3NVVA 4ZHPA 1VLBA 3KWLA 1E10A 1WRIA 3VR8B 1N61A 1TYGB 3LB8C 3B2GA 1A70A 3AE2B 3AE9B 3W5VB 1RM6C 1JQ4A 2WP9B 1RFKA 2BS4B 2PKOA 5GXGB 2MH7A 3NVZA 2W3SA 3LXFA 1V97A 4HRSA 5C2TB 1L0VB 1SIJA 1ZUD2 1FXIA 1SF0A 3AEGB 3ABVB 5G5HA 3RPFC 4N58A 2QJLA 2MJEA 1CZPA 1TJEA 1ZOYB 3SR6A 1QLBB 3AEBB 4YTPB 1NENB 2PVGC 3VRAB 1FMAD 3HUIA 3ZYYX 2EKIA 2CJNA 1N62A 2JQRB 2L52A 3P1MA 1L6VA 1XLNA 4N6EB 4YXDB 1KF6B 1TKGA 1FFVA 2BS2B 1QOAA 2H88B 1IUEA 1KFYB 2CJOA 4ITKA 4WWMA 1WWTA 2KMMA 1ZP0B 4ZHOA 2K5PA 1WGKA 4JWSC 3AB5A 4HROA 3SFDB 1J7BA 2ACZB 3SFEB
chains in the Genus database with same CATH superfamily
4TSSA 2M17A 3RD2A 4AWJA 4A9AA 4KVGB 3M3JA 2WYQA 3Q2AC 3O65B 4NY0A 4LNFA 4CO7A 3M95A 2IGGA 2V1YA 3AEDB 3DPDA 4KGTA 1FFUA 1T3QA 2MBBB 2XN9C 4AP4C 2RSUA 3P4SB 2CU3A 2X8XX 3AE6B 2ZPNA 3MTNB 5IA7A 4ZOHC 2PVOD 2G1EA 3Q3JA 4KZ0A 4LNKA 3LDZE 3RMKC 5C3JB 4N9F4 3PZ7A 3UQAA 1YJJA 2KJRA 1D5MC 3BVGA 2MSED 2DLBA 4LNNA 1I7HA 1Y8RC 4RFBA 3P4RB 3V61A 3SHQA 5BMIA 4HPMB 4X57B 3T8MA 3ZGZA 3Q8AA 4FXCA 2KACA 1V6EA 3U7ZA 4BKGA 2KLGA 2CHZA 3QA8A 3VH3B 4W9DA 3MJ5A 2KDMA 3R66C 1I4QA 5AZHA 4GGQA 4FJVB 2KFKB 1FCCC 2WP9B 2MH7A 1CQVA 2DX5B 3GZNI 2PVGC 2LVPA 1J0GA 2K8HA 1UUPA 4JL9A 2G4DB 2WXHA 1KFYB 2QDFA 3QARA 2KD0A 1ZP0B 3IFWB 2KMAA 3SFDB 4H2AA 4HROA 2CR5A 4GDLA 1IBXB 1TBEA 1WI0A 3QHTA 1T0RC 1AWDA 1L7YA 1V1PB 4HKQA 3AE5B 5KHOA 4MH8A 2KDBA 3W2DA 1D5ZC 4TMAB 3BZDB 4HPPA 1YD8U 3PTFC 5EE1A 1OQQA 3JYUA 5FR3A 1FNUA 3CWIA 3A33B 3FAHA 3P4QB 4JIOU 1R4MI 4XWTA 4JX1C 2KOXA 1SJED 3Q8FA 2PJHA 4C56C 4DHJB 3NS1A 1VDVA 3VVWB 2E6XA 4IM3A 4F8CB 1B9RA 4CHKA 1Z2MA 5TSSA 4J6IA 1MG8A 3Q69A 1EWYC 4KV2A 3C8YA 2DZJA 5HI1A 5TR5A 3M62B 1V9JA 3ZTCA 1D3ZA 1WGGA 3TEZA 4I6LB 4AQ7A 1V2YA 4II2B 5AEKB 5HG2A 2K3UA 4B0MA 2AQ3B 1JCKB 1KLUD 4LK0M 3DBRB 4KSLC 2QCZA 3LXFA 3PREA 1H8CA 1SIJA 3K9PB 2N9KA 1ZKHA 2SEBD 2UYZB 3ZDTA 3RNCC 1UGJA 2LVQA 1TKGA 2L05A 1F77A 3VTVA 4TUUA 1JMLA 2N7DA 3Q3OC 3TBLD 3I63C 4O1NA 1EUVB 2IPKD 4KSKC 3A9JB 1TS2A 1XT9B 3AM9A 1V5TA 3VHTC 2LUMA 3B9JA 3UIOB 1C77A 2RPQA 4LTUA 4A90A 1ISNA 2BPSA 3PPAA 4YSXB 1WGDA 2WDVB 2GBKA 1FEHA 2FE8A 3N30A 2KQ7A 3BIID 2RD0A 3ZNID 1C9FA 1Y56A 2VZKB 4GXBA 5J18A 3Q3NC 4OZCA 2JX5A 2R2QA 1FXTB 1JALA 2PW9A 1J19A 4M01A 4HJKA 3ZO5B 1T0SC 3APCA 4WAAA 3L16A 3BK2A 1N63A 3IG3A 2KX0A 3SDLC 5BYQA 1FPYA 3V6CB 4NJCA 1WSPA 2LASA 2JU6X 5AZGA 3ZJVA 1IBXA 1NVID 4GN1A 1I4HA 2NBWB 1SB3C 4HWIB 2G4SA 2J42A 4MJSB 4M02A 2WDRB 2YEPF 4DXFA 3DQVA 2X38A 4A3PA 3V62A 3RULA 3TMPB 1JQ4A 1RFKA 2IBIB 2WXGA 3UIPB 4RGMA 3WANA 3ABVB 3KW5B 3QJZA 4ZRQA 3TSSA 2HJ8A 4OZBA 2I2YA 4B6WA 2JXXA 1SSNA 5D3DA 1T0QC 4E71A 3Q14C 3BVMA 5FKAC 2BVCA 2JUOA 1J7BA 4LDTD 3UF8A 3BK1A 3KUDB 4LLGM 3RCZA 1JRPA 2EMSA 3IT4B 4W9EA 4ZYNA 1DOYA 5CX3A 1V80A 4MSQB 2G9HD 4AUQC 2LD9A 3ALBA 5DPSA 2BQQA 3WCQA 2XK5B 3DVGX 2H89B 5J2RA 4ZRIA 2KZRA 3IVFA 4XYCA 4F1SA 1OEYJ 3AU4A 4NNJB 4HKZE 3DBLB 2GBNA 3URYA 4W9FA 2MLBA 3OJ3A 4FHKA 2IYDB 3A9KB 1BUIC 1WGRA 2N1VA 2KQSA 1WX8A 1VZ6A 3AECB 1Q1OA 4IKGA 3TEWA 2N9XA 2KDFB 4IWOA 1SIFA 2HDEA 2WLBA 3W1SA 4RMAA 2WXLA 1ENFA 1P98A 3NVWA 4DXAB 3IHPC 3TL5A 3H7PB 1DOXA 3SEBA 4WH4A 5CTRC 5FR6A 3Q8EA 1KM7A 4DWFA 1C4PA 4EFOA 4OW0A 4HDQA 3APDA 4WJQA 3AE7B 4ZHPA 3FILB 3KWLA 3MHZA 3LB8C 3B2GA 1A70A 5JXVA 1RM6C 3ML8A 4JQWC 2V9HA 2KMCA 1C78A 1EU3A 2D11A 3H8HA 1TZ1A 2LHEA 2JRHA 1XXGA 2JRIB 2JYTA 2FUG1 2DNFA 2JQRB 4ANXA 3S2AA 2W82A 1XLNA 2BYVE 1ZDXA 2H88B 3JSVB 2BBCA 1WWTA 3ONSA 4A20A 3R7RA 1E7UA 2ACZB 3AI5A 2KN4A 5E6NA 1TZOA 1QF6A 2FBWB 4US9A 3V60A 1PFDA 3RUIB 3MP9A 2N1WA 2M1MA 4JGHB 4MJSA 1Q5WB 3I5JC 2KTFA 1GC7A 2QC8A 1YNTE 1LM8B 1FXAA 1OFFA 3DHIC 2JZPA 3NVYA 3ZNHB 1CJEA 4MM3B 4TQ1A 4YTMB 1RAXA 2HD5B 2N0SB 2N7JA 4C7YA 2NVUI 3L08A 4WQOB 2Q5WD 3R2IA 2PMVA 3PVLA 4XWWA 2WQYB 2WS3B 3M63B 3UQBA 3EHVA 1TT5B 1JRUA 3IAM1 1HZ5A 3T9LA 1ZE3D 2WXMA 5BMGA 1OGWA 1IGCA 1ZXHA 2OHFA 4MGIE 1FIQA 4OVUA 4HLEA 2ZNVB 4BFRA 3PRZA 1TTNA 1RWSA 1WIAA 2FCNA 2KANA 5EE3A 4DK5A 2VH1A 3TEXA 2KWVB 1JROA 3PRMB 3TJPA 1M4VA 5HFYA 3Q6BA 4M8NA 2XK5A 3DCGA 3H1UA 3NHEB 1VLBA 3KQ4A 3PHWB 5IAAC 3MC9A 2KTRB 2BS4B 2PKOA 3E9SA 3RNGC 1L0VB 5G5HA 2EMTA 1QLBB 1C79A 4BKSD 3VRAB 2L52A 2V0GA 5DPWA 1F2RC 5HKHA 4IM0A 3N1YC 4FJYA 1K51A 4ITKA 3VQIA 1TS5A 1WM3A 4GMVA 1FO4A 1K50A 3QWZB 3V6EB 1EO6A 1NI2A 1E7PB 5AUIA 1XLOA 2BYEA 2PLPA 3H7PA 4LCDE 2PTLA 1LO5D 1N6ZA 4ICVA 1I35A 1GB1A 3EECA 2KX3A 1P7EA 1OQYA 2BTEA 2KWCA 2BS3B 4II3B 1D5XC 3QQ8B 3CSFA 2LRWA 3FILA 1HTQA 2QIEB 1VR9A 3JVZX 4P1CC 1UF0A 3UGBB 2PE6B 3ML9A 4HCNB 1HTOA 2BT6A 3PLUA 2BB6A 2BW2A 2INCC 1WH3A 2JF5A 2J7QB 4ASWC 4WJOA 1YQ4B 2RDBC 3JSVA 4A55A 3OWEB 5L95C 5CHFA 1G6JA 2BF8B 2JY6A 1XD3B 3ZUNA 1V49A 4KX6B 3GB1A 2WU2B 2NCNA 1STEA 3IBEA 3KYDD 4IOIE 1E8WA 4EE2A 1OEYA 4NAWB 4RF0A 2BYTA 2GRIA 2ZNVC 3ZQ4A 4GDKA 3ZDMC 4C7ZA 2BWFA 3O13A 1YIWA 3H9DA 3R7QA 4MM3A 1GNUA 5IN7A 1SF0A 3AEGB 1SGHA 2LZ6A 3DBHB 1K52A 4GU2A 2ZVNA 4REZA 4QAYA 3WAMA 3ZVVA 1FMAD 2KK8A 4D2KA 2QMTA 4L1BA 2L1AA 1KF6B 1IUEA 1UNSA 1KLVA 4DDID 3V3XA 4RGOS 4PK1A 3NZUA 2WXIA 2ZCCA 3PSEB 3ETRA 2AQ2B 1EWCA 2IDYA 2KN5A 4XE0A 4HDOA 4PT5A 1SEBD 1V81A 4JWUC 1UWXA 2L7RA 1WJNA 1TIFA 1WXVA 3ZRCA 2LRUA 4M8MA 2JVCA 3CMMB 1F2RI 1PUTA 2KTRA 3P2BA 3V05A 1JWSD 1FRDA 2OJRA 3U30A 3HIZA 2DWQA 2QILA 4ZYSA 4HJGE 2GBRA 2D3AA 4IG7B 1E0ZA 2DBYA 4G50A 1YQ3B 4A3OA 1MG4A 3P42A 1TS3A 1WGYA 3U8ZA 5DPRA 2KXJA 2IO2B 2WXJA 3EGRA 4USAA 4IDIA 1LQBA 2J0KA 1P0RA 2PEAA 4LJPB 1P9DU 3EA6A 1V1OA 1ZW7A 2NBUA 3AE4B 3U52E 1IPGA 4M00A 1AYFA 2FCMA 2MX2A 3B1LX 5BYRA 1ZGUB 2JPHA 1YQBA 3L13A 4MEMA 4BOZB 4K3CA 3AE2B 2A5UA 3KVFB 1A5RA 4HRSA 2D3GA 2WXNA 3RPFC 3I57A 3R2TA 2QJLA 2OOBB 4BBNF 4EEWA 2GOWA 3AEBB 2WX0A 4EKUA 3HUIA 3MJWA 3N32A 4HXDA 3GE3C 4BBNC 3D32A 1WJUA 2GBMA 2DZIA 3GP7A 3B0AA 1UBIA 2K39A 2YVCA 1GOZA 5EDSA 1L5PA 3RNAC 1YJIA 1WXAA 2J52A 2EELA 2MEKA 2K6DB 2Y5CA 2CKHB 2KT7A 4KKIA 4C80A 1MI0A 4NAWA 4OVVA 2C7HA 3AH7A 1GG3A 1WY8A 4K1RB 2JYEA 4BOSC 4P16A 2INNE 1V86A 3QCAA 2JWZA 3WAOA 2JXTA 2YLMA 1WZ3A 1UGMA 1F0ZA 1QOBA 1WGHA 3NZ3A 3U4EG 2KYWA 1I4PA 1TS4A 1K8RB 4P1BC 1TGZB 3KWVA 2C7MB 1MFWA 4B0EA 1BMLC 2FCSA 1XQQA 4MT5A 3PGEA 3W9CB 2C60A 4ACFA 2VH2A 5C1ZA 2NPTA 1LXDA 3AMZA 1P1AA 3NVVA 1L4ZB 1WMHA 3WIMA 1QKZA 4HEA1 2N9EB 4RCOA 3L10B 4LDTB 4LNIA 3NVZA 3KLSX 4PYZA 4FA6A 1TY2A 2WWZA 2CHXA 2L76A 1NENB 1L0XB 3OAWA 2N9LA 3ENEA 2D2QA 1P7FA 3QX1A 2LGIA 1RFAA 4ZHOA 4G11A 3L54A 1WGKA 2LJIA 4RH6A 4MGYE 1LFDA 2W3RA 2IO3B 3TCAA 3VUXA 4XX5A 2UU7A 2AX5A 1IP9A 1N5WA 4K3BA 4KGSA 1QOFA 5G5GA 1DOIA 1GB4A 2IO0B 4FN2A 4GIVA 4KGRA 3NG0A 4AJWA 3U7DA 2NMQA 4K81A 2VZKD 1J7CA 4R3DA 2ZVOA 3NJTA 3HVZA 1V8CA 1ET9A 1X1MA 1I4XA 2DHZA 1HQRD 2RDGA 3ZIMA 3GE8C 3L4PA 3W1SC 3ZNGC 2CU1A 4FBJB 1RYJA 2IY0B 2M19A 2HTHA 2E3TA 4WJNA 5JHBA 4G3XB 4IWQA 4XZ4A 2WX1A 1CMXB 1SBBB 3IXSA 2MJDA 4DDGD 3ECIA 2K8BA 4TKNA 1AW7A 3VH4B 3ZRFA 4IM2A 4KDIC 1XF5L 1UH6A 3BYTB 1E10A 1WRIA 2BWES 2Y3AA 1UBQA 3VR8B 1VD2A 3W5VB 2FUHB 3LJ3A 2AWTA 2WXQA 3SD5A 5FK9C 1T6BX 1I4RA 3GOEA 2BKRB 4S17A 4WWPA 1NDDA 1UELA 3AULA 1KJTA 1PYWD 3PT2B 2KMMA 2K6QA 2IZVB 4Q2JA 4RGTA 3ZJUA 1YN4A 2WXKA 3BY4B 1NBFC 2DZMA 2FNJB 1R4NB 2L0FA 2LVOA 2C5LC 3J9CA 4S0RA 3GZNB 4NZLB 2LGSA 3X23A 1SE9A 1JWMD 4ZDVA 2ICIA 4EZLA 4GLSC 2WHIA 3A4RA 1YJ1A 2LXAA 2TSSA 3AV8A 3AEEB 4PS8A 3PLVA 3WAPA 1PGBA 2C7NB 1GC6A 1XLQA 4M0WA 5E6JA 1YN5A 2EKEC 2HTME 1E6EB 3AE3B 4YWGG 4EUTA 4KIKA 4I6PA 3RNEC 3I3TB 4URKA 4PS3A 3X0WA 2KC2A 3R3MA 5LXIB 2LEKA 4GDKB 2XNAC 1N60A 2R61A 4PYUA 2D3BA 3DBRI 1XO3A 2I1KA 1YN3A 1J7AA 3B2FA 5BYSA 4US8A 1RRBA 3WALA 2C9WB 1FNWA 2W54A 4YT0B 2ON8A 3AE8B 5BO4B 4AJYB 3DHHC 3AEFB 4A6QA 1HXYD 2UWQA 4LJOB 4W9KA 5LXHA 5T8IA 3Q8BA 2KVZA 2V3SA 4MH0E 4C4VA 4DHZE 2W3SA 2IGDA 1V97A 2O6VD 4CQNA 2WXOA 2WGSA 2V4LA 2L3ZA 4YTPB 2V3PA 4NQLB 2EKIA 4RF1A 1V5OA 2A4ZA 2LUEA 4W9IA 1E8YA 2K0PA 5IKCM 4WWMA 1I42A 2J53A 1FCLA 2L32A 2OJWA 4JWSC 1Z5SB 2HE7A 2AYOB 2XEWA 5CHVC 4JPSA 3PV1A 3KYCD 2HJ1A 2Y5BB 3Q3FA 3SU8X 4W9GA 5H92C 3N1ZC 1GPXA 5JHAA 3RNFC 1VZ7A 2DENB 5JH5C 3P4PB 3AU5A 2AL3A 2MP2A 1IGDA 2BYFA 1L0YB 2K1FA 2RPVA 4WQMA 2ZPYA 1ZXIA 4WAFA 5D2MB 3HRDD 4BZAA 3EC8A 2WXFA 3TEYA 3ZKJC 5EE0A 3MFGA 2J0MA 2M0AA 1C4AA 1UD7A 1WF9A 1OTRB 1AN8A 5L83A 1OQRA 2WNMA 3BYYB 4NJ6A 1Q0WB 3KH0A 2ASQA 4P6VF 5D94A 1CK1A 1WE6A 3DWMA 1C1YB 4XDCA 4WWNA 1XCQL 1YMHE 2Z59B 4P7IA 4HVBA 2O6VA 3APFA 1XCTL 1GUAB 4N58A 2D5GA 2MWSB 2KKCA 3BWUD 1JWUD 4CYEA 1RLFA 4MSMB 3HM6X 1L4DB 3DVNV 3A1QB 2L8JA 3RT3B 1BXTA 3N3KB 3DBLI 4BKSA 1WRDB 1S3SG 2WXPA 2Z0DB 5G55A 1L6UA 4DQOC 3OG5A 2NTTA 2KO3A 3FKYA 1UWMA 2KWDA 2INDC 2B3AA 4K7UA 5GMVA 4FULA 3RZWC 1EF5A 4OZAA 3PO0A 2NBVB 1FM0D 2MA9B 3ZJTA 2W55A 4MACA 1YOVB 1AARA 5HHDG 5BMHA 2INPE 2ZCBA 4MGZE 2WDQB 2NPTB 2L00B 4W9HA 2KDIA 1WM2A 1WMHB 3MC8A 3IT6B 1L2NA 1SJHD 1R4NI 2L0TA 2LXCA 1MJDA 1YX5B 1MHXA 4WURA 2GMIC 2K22A 5MPOA 2GI9A 1C4CA 3RYTA 2KNBA 2WU5B 1F1HA 3DVGY 3Q8CA 1R7SA 1JW9D 2CS4A 1E8XA 2V4IB 2JWUA 1ACCA 2CHWA 4HK2A 1ZDVA 2KWUB 2RR9A 3VFKA 4WJPA 2D10A 1IYFA 4E74A 1QQRA 3P1MA 4N6EB 3TIXA 1F52A 4KDLB 3N1XC 1EU4A 2O2VB 1PQSA 2K5PA 2JT4B 2MBQA 2DYOA 2J4XA 3DBSA 5E6PA 2RDHA 2G3QB 3C0RB 2ZZPB 3MC0B 1M94A 4JLCA 1DGJA 1YX6B 1ESFA 3DWGC 2MBOA 4YSZB 2ONQA 2RMMA 4ZRJA 3CSTA 1FNVA 2MCNB 2QHOA 1E7VA 4RNAA 1EM7A 2QEJC 4EOYA 1S1QB 4ZRKA 4ANVA 1HA5A 2FIFA 2Z8LA 1WJ6A 1NEKB 4NPNA 5LLIA 3EFCA 5IOIA 2N4FA 3W5UB 4BKTA 4MDKE 4C00A 1FRRA 2MBHA 3VXWA 5D3IB 1WJ4A 2YEPB 4I6NB 1DYQA 2D3CA 3VUWA 3ZLZA 3HVDA 5EE9A 2LJ5A 2IO1B 2ZW1A 4L2YA 1WX9A 2KJ6A 3I9V1 3AEAB 1WYGA 3A1QA 5KHQA 4MGKE 4ARIA 5C23A 4B9KA 2MRPA 4KKJA 4GOCA 2B76B 5E6OA 1SXTA 4DHJD 2AEHA 1TYGB 4W9JA 2GBJA 5J17A 1VZ8A 2LWPA 1XEEA 5D7GA 4RGNA 3HM3A 2G45B 3H7SA 3ZXRA 2KDEB 1VRAB 2CJNA 1N62A 3KUZA 4HPLB 4RM8A 4YXDB 3WA0A 2BS2B 1E5WA 5DCNA 2KC1A 2M8SA 4ZRPA 1HEZE 1KLGD 3NUHB 2IGHA 3LYYA 2KFKA 4M0WB 1WXQA 2ZJDA 1JWAD 2PE9A 3K9OB 4FADA 4KIKB 3QIJA 4GB9A 2M0XA 2LGXA 4GSWA 4ANUA 2JZ3B 3OJ4B 1TY0A 1WYWB 4OHJA 2M56B 3TUOA 3H6NA 4EZKA 5LNK1 1NI3A 4IWPA 3DOWA 4FLHA 2KVRA 3EFUA 5G2NA 1V1PA 1WXMA 2LMCA 1WE7A 1MPEA 2GB1A 4K7SA 2LGYA 4BAXA 3BVZA 2KAJA 2LI5A 4TQ0A 2IY1B 1QZEA 4YSYB 2NR2A 2O2VA 5IP4D 3QC8B 1WR1A 4JE3B 4ICUA 4C4VB 2I38A 1H4RA 2AL6A 3VRBB 1KH0A 3NOBA 3VAWA 4IUMB 3DBHI 3HK0A 5D6JB 3RNBC 1TKYA 4NAMA 5AZFA 1QT9A 2KFJA 2XBBC 4BVUC 5DPTA 1B1ZA 4WIPA 4ARCA 3PZ8A 5GXGB 1U4AA 3SR6A 1EF1A 2KQ4X 1CZPA 4L23A 2BGFA 3ZYYX 2DYMA 1L6VA 4XC2A 5CHWA 3KUCB 1WR6E 1FFVA 2Z0EB 3C19A 2CJOA 2M4NA 2W9NA 3AB5A 2MP2B 2DAFA 3ZTDA 3R8BA 2VRRB 4UDUC 3EUB2 4YTNB 3UI3A 3NRZA 3T3NA 1PDXA 3AN1A 2V3NA 1PGXA 1T0YA 1HZ6A 1PGAA 1ZPSA 3VUYA 3OLMD 4MELA 3P63A 3VR9B 2D07B 2I1JA 4DHZB 1UZXB 4PS7A 3AXCA 3Q3MC 2DYBA 1ROEA 1GJZA 2BKFA 1Q10A 3A9JA 3T3OA 4KZCA 3JW0X 3QAQA 2J0JA 3ZW3A 1N5XA 3PHXB 4F7ZA 4AS1A 4FHJA 2N7EA 2ZEQA 3CIRB 2Y5PA 2FAZA 3GS2A 1NYRA 2SAKA 4K7WA 2WXRA 2O6VB 4B95A 1C76A 4OVZA 2K9XA 1K53A 4DXGA 3AE1B 3L17A 1P3QU 4RM9A 3L0WB 2MW5A 3PZDA 4AOFA 2KHWB 2JZZA 1C3TA 4EZJA 3VTWA 5JZEB 1N61A 3CF6E 3A4SC 2DAJA 1VCBA 2NTSA 2K25A 3PRPB 1J8CA 3B08A 5C2TB 2MJEA 3NZSA 3VTUA 1FD6A 1SE3A 1WZ0A 2MQJA 1ET6A 1R4MB 2WDTB 1WXSA 1QOAA 2N9PC 2ZW0A 2KJHB 3U2SC 4FJZA 3DHGC 4W9CA 2LGDA 4IW0A 2KLCA 5I4DA 3SFEB 1WFYA 1JWBD 1BT0A 2LHDA 3UINB 2IJ0A 3N20C 2L83A 4IC7B 3PS6A 1GAQB 1KOTA 3ZNZB 2R2OA 3DDCB 4XDDA 3FC4A 1VJKA 1XLPA 4E3CA 3VDZA 4N59A 4A8XC 4WWOA 1TKEA 1WX7A 2MJ3A 1HE8A 2AQ1B 4ANWA 4DBGA 1SE2A 3RN9C 1T5XD 4W9LA 3HHMA 3MHSD 1QOGA 2LFIA 1D6EC 1NYQA 2NS5A 2QSDA 3BINA 3N9YC 2PPHA 2RGFA 1MHHE 5H8YE 4TV3A 4GDLB 3NY5A 5AUKA 4J3OD 2MHJA 3E56A 1E9MA 4YL8A 3RZFA 1KTKA 2FCQA 3A9KA 3NS8A 1MVKA 2OEDA 1I4GA 2PIAA 4NJ7A 4LNOA 4HCPB 1KRHA 1E90A 1F9JA 3DVNU 3W1YA 2DZKA 2GLSA 3IAS1 4G0NB 3AE9B 1E8ZA 1ZUD2 1FXIA 2BB5A 4NQKE 1TJEA 1QILA 1ZOYB 1SE4A 3RI7C 2JSVX 4XGAB 3ZXVA 2REXA 3RFZB 1D4BA 2FIDA 3QK0A 2K8CA 1LGRA 2MBEA 5IO9A
chains in the Genus database with same CATH topology
2KN4A 2W3RA 1TZOA 4TSSA 1QF6A 2FBWB 4US9A 2RDHA 1PFDA 4A9AA 3MC0B 3MP9A 1DGJA 2AX5A 1N5WA 1ESFA 3DWGC 4YSZB 2ONQA 2RMMA 1FNVA 2IGGA 3AEDB 4KGSA 1YNTE 4KGTA 1QOFA 5G5GA 1FXAA 1FFUA 1DOIA 1OFFA 2JZPA 1GB4A 3NVYA 4RNAA 1EM7A 2QEJC 1T3QA 2XN9C 1CJEA 4KGRA 2NMQA 1HA5A 3P4SB 4MM3B 2Z8LA 2VZKD 4TQ1A 2CU3A 4YTMB 3AE6B 1NEKB 1J7CA 3W5UB 2N0SB 2N7JA 4ZOHC 2PVOD 4C7YA 1FRRA 4R3DA 5D3IB 3HVZA 2Q5WD 1V8CA 1ET9A 2YEPB 2PMVA 1I4XA 1DYQA 3R2IA 1HQRD 2G1EA 2RDGA 4XWWA 2WQYB 2WS3B 3HVDA 5EE9A 3L4PA 5C3JB 3IAM1 1HZ5A 1ZE3D 1RYJA 2WXMA 3PZ7A 5BMGA 1IGCA 1ZXHA 2M19A 2OHFA 2ZW1A 4L2YA 1YJJA 3I9V1 3AEAB 1D5MC 1FIQA 1WYGA 2E3TA 3BVGA 2DLBA 1I7HA 4ARIA 1RWSA 3P4RB 4RFBA 5BMIA 1SBBB 3ZGZA 5EE3A 3IXSA 3Q8AA 4FXCA 2MJDA 2KACA 4KKJA 3TEXA 3U7ZA 1JROA 1M4VA 2B76B 5HFYA 1AW7A 1SXTA 1VLBA 3KQ4A 3MJ5A 1XF5L 2KDMA 1I4QA 3BYTB 1E10A 1WRIA 2Y3AA 3VR8B 1TYGB 3W5VB 1FCCC 2WP9B 1VZ8A 2BS4B 2PKOA 2MH7A 1XEEA 3E9SA 5D7GA 1L0VB 5G5HA 1CQVA 4RGNA 2WXQA 1QLBB 2PVGC 1C79A 1T6BX 1I4RA 5FK9C 3VRAB 1VRAB 2CJNA 1N62A 2L52A 2V0GA 4YXDB 1F2RC 1UUPA 2BS2B 1K51A 1PYWD 1KFYB 2WXHA 4ITKA 4ZRPA 1HEZE 1KLGD 2KMMA 3NUHB 2IGHA 3LYYA 1TS5A 3VQIA 1ZP0B 4Q2JA 4RGTA 3ZJUA 1YN4A 2WXKA 3SFDB 4H2AA 4HROA 1FO4A 1K50A 1WXQA 1IBXB 1E7PB 1JWAD 5AUIA 1XLOA 3J9CA 2PLPA 1AWDA 2PTLA 1LO5D 4NZLB 1V1PB 1JWMD 4HKQA 1GB1A 2ICIA 3AE5B 4MH8A 4GLSC 1P7EA 2BTEA 1TY0A 2BS3B 2TSSA 3AV8A 3AEEB 1D5XC 4OHJA 2M56B 1PGBA 3TUOA 3FILA 5LNK1 2QIEB 1VR9A 1NI3A 3W2DA 1XLQA 4M0WA 1D5ZC 4TMAB 5E6JA 3BZDB 1YN5A 5EE1A 1OQQA 2HTME 1E6EB 2BT6A 3AE3B 4YWGG 5FR3A 1V1PA 2BB6A 1FNUA 2BW2A 2LMCA 3CWIA 1MPEA 3FAHA 3P4QB 4XWTA 4JX1C 2GB1A 3BVZA 1SJED 1YQ4B 2KAJA 3Q8FA 4TQ0A 4C56C 2LEKA 4GDKB 4YSYB 2XNAC 4A55A 1N60A 3NS1A 3OWEB 1VDVA 2R61A 2E6XA 4JE3B 1B9RA 1XO3A 2I38A 1YN3A 5TSSA 3VRBB 1J7AA 3B2FA 1KH0A 3Q69A 4KX6B 1EWYC 4US8A 5BYSA 3GB1A 2WU2B 3C8YA 5HI1A 1FNWA 1STEA 2W54A 4YT0B 2ACZB 2ON8A 4IOIE 3AE8B 1TKYA 4NAMA 4EE2A 4NAWB 3AEFB 4A6QA 4RF0A 2BYTA 1HXYD 2GRIA 1QT9A 3ZQ4A 5T8IA 3Q8BA 3TEZA 4C7ZA 4AQ7A 3O13A 5HG2A 2K3UA 4B0MA 2AQ3B 1JCKB 1KLUD 4LK0M 1B1ZA 4WIPA 4ARCA 3PZ8A 5GXGB 2W3SA 2IGDA 1V97A 3LXFA 1SIJA 3SR6A 1SF0A 3AEGB 4CQNA 2KQ4X 2N9KA 1CZPA 2WXOA 1K52A 4L23A 4YTPB 2SEBD 4REZA 1FMAD 2V3PA 3ZYYX 2EKIA 4RF1A 4D2KA 2QMTA 1UGJA 4L1BA 2DYMA 1L6VA 2L1AA 1KF6B 1TKGA 1FFVA 2K0PA 1IUEA 1F77A 2CJOA 1UNSA 4WWMA 2J53A 1FCLA 1JMLA 2L32A 4JWSC 3V3XA 3AB5A 4O1NA 4RGOS 4JPSA 2IPKD 2WXIA 3R8BA 3ETRA 4UDUC 2AQ2B 1TS2A 3EUB2 1EWCA 4YTNB 3UI3A 2IDYA 5H92C 3AM9A 4XE0A 3NRZA 2LUMA 3T3NA 3B9JA 1C77A 1PDXA 3AN1A 4PT5A 4LTUA 2V3NA 1PGXA 1SEBD 4A90A 1HZ6A 4JWUC 1GPXA 1PGAA 1ZPSA 4YSXB 1UWXA 2WDVB 1FEHA 2FE8A 3P63A 1VZ7A 3VR9B 3BIID 3P4PB 1C9FA 1Y56A 1F2RI 1PUTA 3V05A 1ROEA 1JWSD 1FRDA 1Q10A 1IGDA 2VZKB 3T3OA 1L0YB 4OZCA 2JX5A 2DWQA 2RPVA 4WQMA 1ZXIA 2QILA 4WAFA 4ZYSA 4HJGE 1JALA 3HRDD 2PW9A 1N5XA 1E0ZA 2DBYA 2WXFA 4AS1A 1YQ3B 3TEYA 3BK2A 1N63A 3P42A 5EE0A 1TS3A 3CIRB 2Y5PA 3MFGA 2M0AA 1C4AA 2WXJA 3EGRA 5BYQA 3GS2A 1AN8A 1NYRA 2SAKA 4NJCA 1WSPA 2WXRA 4USAA 1OQRA 4IDIA 2JU6X 2WNMA 3ZJVA 1IBXA 1C76A 1NVID 3BYYB 4OVZA 1I4HA 2K9XA 3EA6A 1K53A 1SB3C 4DXGA 3AE1B 1V1OA 2J42A 3AE4B 3U52E 1AYFA 2WDRB 2YEPF 4P6VF 4DXFA 1CK1A 2X38A 3DWMA 5BYRA 4XDCA 1XCQL 1YMHE 1N61A 3AE2B 1JQ4A 1RFKA 2WXGA 2NTSA 4HRSA 1XCTL 5C2TB 4RGMA 2WXNA 3RPFC 3ABVB 3I57A 3R2TA 4N58A 2QJLA 2D5GA 2MJEA 3AEBB 3BWUD 4ZRQA 3TSSA 1JWUD 1FD6A 3HUIA 1SE3A 4OZBA 2I2YA 1ET6A 1SSNA 5D3DA 1QOAA 2ZW0A 1L4DB 3U2SC 3BVMA 5FKAC 3GP7A 1J7BA 5I4DA 3SFEB 1BXTA 1JWBD 2LHDA 1GOZA 2IJ0A 3BK1A 1L5PA 4LLGM 1JRPA 2L83A 3IT4B 1YJIA 2WXPA 1DOYA 2J52A 2EELA 2MEKA 2Y5CA 1L6UA 2G9HD 4KKIA 4C80A 4DQOC 1MI0A 1GAQB 2NTTA 3WCQA 1UWMA 2KWDA 4XDDA 3FC4A 1VJKA 1XLPA 2H89B 4N59A 3AH7A 4A8XC 4OZAA 3PO0A 2JYEA 4P16A 1TKEA 1FM0D 2INNE 3ZJTA 2MJ3A 2W55A 2JXTA 4MACA 4HKZE 2AQ1B 5HHDG 3URYA 1SE2A 1T5XD 5BMHA 1BUIC 1QOGA 1F0ZA 2INPE 2LFIA 1D6EC 1VZ6A 3AECB 1QOBA 2WDQB 1NYQA 2QSDA 4IKGA 3NZ3A 3U4EG 3TEWA 3N9YC 1I4PA 3IT6B 1TS4A 1SJHD 1MHHE 2HDEA 5H8YE 2WLBA 4GDLB 3W1SA 2WXLA 5AUKA 4J3OD 3E56A 1MHXA 1ENFA 3KWVA 3NVWA 1E9MA 4WURA 4B0EA 2K22A 1BMLC 5MPOA 1KTKA 4WH4A 3SEBA 2GI9A 4MT5A 1DOXA 1C4CA 3Q8EA 3W9CB 2WU5B 1MVKA 1C4PA 2OEDA 3Q8CA 1I4GA 1R7SA 2PIAA 4OW0A 1JW9D 1KRHA 3AE7B 3AMZA 3NVVA 1L4ZB 4ZHPA 1QKZA 3FILB 3KWLA 4HEA1 2V4IB 4RCOA 2JWUA 1ACCA 3IAS1 3MHZA 3LB8C 3B2GA 1A70A 3AE9B 5JXVA 1RM6C 1ZDVA 3NVZA 1C78A 3KLSX 1EU3A 1ZUD2 3H8HA 1FXIA 1TY2A 2BB5A 1TJEA 1QILA 1ZOYB 1SE4A 2LHEA 1NENB 1XXGA 1L0XB 2JYTA 2N9LA 1QQRA 2FUG1 2JQRB 2JSVX 3P1MA 2W82A 1XLNA 4N6EB 3RFZB 1P7FA 2H88B 1ZDXA 2BBCA 1D4BA 2LGIA 1EU4A 1WWTA 4ZHOA 2K5PA 1WGKA 2LJIA 4RH6A 2DYOA 2J4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXQ A;  1JWB D;  2W3R A;  3ETR A;  1E7P B;  1JWA D;  5AUI A;  1QF6 A;  1XLO A;  2FBW B;  4US9 A;  3EUB 2;  1PFD A;  4YTN B;  1AWD A;  3AM9 A;  5H92 C;  1L5P A;  4A9A A;  1JRP A;  3NRZ A;  2L83 A;  3B9J A;  1YJI A;  1DGJ A;  1PDX A;  2AX5 A;  1N5W A;  3AN1 A;  1DOY A;  2Y5C A;  3DWG C;  4YSZ B;  4LTU A;  1FO4 A;  3AE5 B;  1L6U A;  4C80 A;  4JWU C;  1GPX A;  1GAQ B;  4YSX B;  2WDV B;  3WCQ A;  3AED B;  1UWM A;  3P63 A;  2BS3 B;  3AV8 A;  3FC4 A;  1VJK A;  3AEE B;  3VR9 B;  1XLP A;  1QOF A;  2M56 B;  3BII D;  5G5G A;  1FXA A;  1FFU A;  1DOI A;  1OFF A;  2H89 B;  3NVY A;  4N59 A;  2QIE B;  3AH7 A;  3P4P B;  1NI3 A;  1T3Q A;  1XLQ A;  1PUT A;  1CJE A;  3PO0 A;  1ROE A;  1FRD A;  1TKE A;  1FM0 D;  3P4S B;  4YTM B;  5EE1 A;  2CU3 A;  3AE6 B;  1NEK B;  1J7C A;  1OQQ A;  1E6E B;  2BT6 A;  2HTM E;  2JX5 A;  2MJ3 A;  2DWQ A;  2N0S B;  2W55 A;  2PVO D;  3AE3 B;  4WQM A;  1ZXI A;  4ZOH C;  3W5U B;  1FRR A;  4C7Y A;  3HVZ A;  2Q5W D;  1V8C A;  1JAL A;  3CWI A;  3HRD D;  3FAH A;  1N5X A;  3P4Q B;  1E0Z A;  2G1E A;  2DBY A;  1QOG A;  4JX1 C;  1F0Z A;  2WQY B;  2WS3 B;  1YQ3 B;  3AEC B;  1QOB A;  2WDQ B;  1NYQ A;  1YQ4 B;  2KAJ A;  5EE9 A;  3L4P A;  2LEK A;  1N63 A;  5C3J B;  5EE0 A;  3CIR B;  4YSY B;  1N60 A;  1RYJ A;  3NS1 A;  1VDV A;  2OHF A;  2M19 A;  1YJJ A;  1B9R A;  3AEA B;  5H8Y E;  1NYR A;  1XO3 A;  2WLB A;  1FIQ A;  1WYG A;  2E3T A;  4USA A;  3VRB B;  1OQR A;  4IDI A;  1J7A A;  3B2F A;  5AUK A;  4KX6 B;  4US8 A;  1EWY C;  1NVI D;  3NVW A;  1E9M A;  1I7H A;  2WU2 B;  1RWS A;  2K22 A;  2K9X A;  3P4R B;  5MPO A;  1DOX A;  1SB3 C;  3AE1 B;  2W54 A;  4YT0 B;  3W9C B;  2WU5 B;  5EE3 A;  3AE4 B;  2MJD A;  1TKY A;  3AE8 B;  4FXC A;  1R7S A;  2PIA A;  1AYF A;  3AEF B;  1JRO A;  2WDR B;  2B76 B;  4P6V F;  1QT9 A;  1JW9 D;  1KRH A;  3DWM A;  4C7Z A;  3AE7 B;  3AMZ A;  3NVV A;  4ZHP A;  1VLB A;  3KWL A;  1E10 A;  1WRI A;  3VR8 B;  1N61 A;  1TYG B;  3LB8 C;  3B2G A;  1A70 A;  3AE2 B;  3AE9 B;  3W5V B;  1RM6 C;  1JQ4 A;  2WP9 B;  1RFK A;  2BS4 B;  2PKO A;  5GXG B;  2MH7 A;  3NVZ A;  2W3S A;  3LXF A;  1V97 A;  4HRS A;  5C2T B;  1L0V B;  1SIJ A;  1ZUD 2;  1FXI A;  1SF0 A;  3AEG B;  3ABV B;  5G5H A;  3RPF C;  4N58 A;  2QJL A;  2MJE A;  1CZP A;  1TJE A;  1ZOY B;  3SR6 A;  1QLB B;  3AEB B;  4YTP B;  1NEN B;  2PVG C;  3VRA B;  1FMA D;  3HUI A;  3ZYY X;  2EKI A;  2CJN A;  1N62 A;  2JQR B;  2L52 A;  3P1M A;  1L6V A;  1XLN A;  4N6E B;  4YXD B;  1KF6 B;  1TKG A;  1FFV A;  2BS2 B;  1QOA A;  2H88 B;  1IUE A;  1KFY B;  2CJO A;  4ITK A;  4WWM A;  1WWT A;  2KMM A;  1ZP0 B;  4ZHO A;  2K5P A;  1WGK A;  4JWS C;  3AB5 A;  4HRO A;  3SFD B;  1J7B A;  2ACZ B;  3SFE B; 
#chains in the Genus database with same CATH topology
 4TSS A;  2M17 A;  3RD2 A;  4AWJ A;  4A9A A;  4KVG B;  3M3J A;  2WYQ A;  3Q2A C;  3O65 B;  4NY0 A;  4LNF A;  4CO7 A;  3M95 A;  2IGG A;  2V1Y A;  3AED B;  3DPD A;  4KGT A;  1FFU A;  1T3Q A;  2MBB B;  2XN9 C;  4AP4 C;  2RSU A;  3P4S B;  2CU3 A;  2X8X X;  3AE6 B;  2ZPN A;  3MTN B;  5IA7 A;  4ZOH C;  2PVO D;  2G1E A;  3Q3J A;  4KZ0 A;  4LNK A;  3LDZ E;  3RMK C;  5C3J B;  4N9F 4;  3PZ7 A;  3UQA A;  1YJJ A;  2KJR A;  1D5M C;  3BVG A;  2MSE D;  2DLB A;  4LNN A;  1I7H A;  1Y8R C;  4RFB A;  3P4R B;  3V61 A;  3SHQ A;  5BMI A;  4HPM B;  4X57 B;  3T8M A;  3ZGZ A;  3Q8A A;  4FXC A;  2KAC A;  1V6E A;  3U7Z A;  4BKG A;  2KLG A;  2CHZ A;  3QA8 A;  3VH3 B;  4W9D A;  3MJ5 A;  2KDM A;  3R66 C;  1I4Q A;  5AZH A;  4GGQ A;  4FJV B;  2KFK B;  1FCC C;  2WP9 B;  2MH7 A;  1CQV A;  2DX5 B;  3GZN I;  2PVG C;  2LVP A;  1J0G A;  2K8H A;  1UUP A;  4JL9 A;  2G4D B;  2WXH A;  1KFY B;  2QDF A;  3QAR A;  2KD0 A;  1ZP0 B;  3IFW B;  2KMA A;  3SFD B;  4H2A A;  4HRO A;  2CR5 A;  4GDL A;  1IBX B;  1TBE A;  1WI0 A;  3QHT A;  1T0R C;  1AWD A;  1L7Y A;  1V1P B;  4HKQ A;  3AE5 B;  5KHO A;  4MH8 A;  2KDB A;  3W2D A;  1D5Z C;  4TMA B;  3BZD B;  4HPP A;  1YD8 U;  3PTF C;  5EE1 A;  1OQQ A;  3JYU A;  5FR3 A;  1FNU A;  3CWI A;  3A33 B;  3FAH A;  3P4Q B;  4JIO U;  1R4M I;  4XWT A;  4JX1 C;  2KOX A;  1SJE D;  3Q8F A;  2PJH A;  4C56 C;  4DHJ B;  3NS1 A;  1VDV A;  3VVW B;  2E6X A;  4IM3 A;  4F8C B;  1B9R A;  4CHK A;  1Z2M A;  5TSS A;  4J6I A;  1MG8 A;  3Q69 A;  1EWY C;  4KV2 A;  3C8Y A;  2DZJ A;  5HI1 A;  5TR5 A;  3M62 B;  1V9J A;  3ZTC A;  1D3Z A;  1WGG A;  3TEZ A;  4I6L B;  4AQ7 A;  1V2Y A;  4II2 B;  5AEK B;  5HG2 A;  2K3U A;  4B0M A;  2AQ3 B;  1JCK B;  1KLU D;  4LK0 M;  3DBR B;  4KSL C;  2QCZ A;  3LXF A;  3PRE A;  1H8C A;  1SIJ A;  3K9P B;  2N9K A;  1ZKH A;  2SEB D;  2UYZ B;  3ZDT A;  3RNC C;  1UGJ A;  2LVQ A;  1TKG A;  2L05 A;  1F77 A;  3VTV A;  4TUU A;  1JML A;  2N7D A;  3Q3O C;  3TBL D;  3I63 C;  4O1N A;  1EUV B;  2IPK D;  4KSK C;  3A9J B;  1TS2 A;  1XT9 B;  3AM9 A;  1V5T A;  3VHT C;  2LUM A;  3B9J A;  3UIO B;  1C77 A;  2RPQ A;  4LTU A;  4A90 A;  1ISN A;  2BPS A;  3PPA A;  4YSX B;  1WGD A;  2WDV B;  2GBK A;  1FEH A;  2FE8 A;  3N30 A;  2KQ7 A;  3BII D;  2RD0 A;  3ZNI D;  1C9F A;  1Y56 A;  2VZK B;  4GXB A;  5J18 A;  3Q3N C;  4OZC A;  2JX5 A;  2R2Q A;  1FXT B;  1JAL A;  2PW9 A;  1J19 A;  4M01 A;  4HJK A;  3ZO5 B;  1T0S C;  3APC A;  4WAA A;  3L16 A;  3BK2 A;  1N63 A;  3IG3 A;  2KX0 A;  3SDL C;  5BYQ A;  1FPY A;  3V6C B;  4NJC A;  1WSP A;  2LAS A;  2JU6 X;  5AZG A;  3ZJV A;  1IBX A;  1NVI D;  4GN1 A;  1I4H A;  2NBW B;  1SB3 C;  4HWI B;  2G4S A;  2J42 A;  4MJS B;  4M02 A;  2WDR B;  2YEP F;  4DXF A;  3DQV A;  2X38 A;  4A3P A;  3V62 A;  3RUL A;  3TMP B;  1JQ4 A;  1RFK A;  2IBI B;  2WXG A;  3UIP B;  4RGM A;  3WAN A;  3ABV B;  3KW5 B;  3QJZ A;  4ZRQ A;  3TSS A;  2HJ8 A;  4OZB A;  2I2Y A;  4B6W A;  2JXX A;  1SSN A;  5D3D A;  1T0Q C;  4E71 A;  3Q14 C;  3BVM A;  5FKA C;  2BVC A;  2JUO A;  1J7B A;  4LDT D;  3UF8 A;  3BK1 A;  3KUD B;  4LLG M;  3RCZ A;  1JRP A;  2EMS A;  3IT4 B;  4W9E A;  4ZYN A;  1DOY A;  5CX3 A;  1V80 A;  4MSQ B;  2G9H D;  4AUQ C;  2LD9 A;  3ALB A;  5DPS A;  2BQQ A;  3WCQ A;  2XK5 B;  3DVG X;  2H89 B;  5J2R A;  4ZRI A;  2KZR A;  3IVF A;  4XYC A;  4F1S A;  1OEY J;  3AU4 A;  4NNJ B;  4HKZ E;  3DBL B;  2GBN A;  3URY A;  4W9F A;  2MLB A;  3OJ3 A;  4FHK A;  2IYD B;  3A9K B;  1BUI C;  1WGR A;  2N1V A;  2KQS A;  1WX8 A;  1VZ6 A;  3AEC B;  1Q1O A;  4IKG A;  3TEW A;  2N9X A;  2KDF B;  4IWO A;  1SIF A;  2HDE A;  2WLB A;  3W1S A;  4RMA A;  2WXL A;  1ENF A;  1P98 A;  3NVW A;  4DXA B;  3IHP C;  3TL5 A;  3H7P B;  1DOX A;  3SEB A;  4WH4 A;  5CTR C;  5FR6 A;  3Q8E A;  1KM7 A;  4DWF A;  1C4P A;  4EFO A;  4OW0 A;  4HDQ A;  3APD A;  4WJQ A;  3AE7 B;  4ZHP A;  3FIL B;  3KWL A;  3MHZ A;  3LB8 C;  3B2G A;  1A70 A;  5JXV A;  1RM6 C;  3ML8 A;  4JQW C;  2V9H A;  2KMC A;  1C78 A;  1EU3 A;  2D11 A;  3H8H A;  1TZ1 A;  2LHE A;  2JRH A;  1XXG A;  2JRI B;  2JYT A;  2FUG 1;  2DNF A;  2JQR B;  4ANX A;  3S2A A;  2W82 A;  1XLN A;  2BYV E;  1ZDX A;  2H88 B;  3JSV B;  2BBC A;  1WWT A;  3ONS A;  4A20 A;  3R7R A;  1E7U A;  2ACZ B;  3AI5 A;  2KN4 A;  5E6N A;  1TZO A;  1QF6 A;  2FBW B;  4US9 A;  3V60 A;  1PFD A;  3RUI B;  3MP9 A;  2N1W A;  2M1M A;  4JGH B;  4MJS A;  1Q5W B;  3I5J C;  2KTF A;  1GC7 A;  2QC8 A;  1YNT E;  1LM8 B;  1FXA A;  1OFF A;  3DHI C;  2JZP A;  3NVY A;  3ZNH B;  1CJE A;  4MM3 B;  4TQ1 A;  4YTM B;  1RAX A;  2HD5 B;  2N0S B;  2N7J A;  4C7Y A;  2NVU I;  3L08 A;  4WQO B;  2Q5W D;  3R2I A;  2PMV A;  3PVL A;  4XWW A;  2WQY B;  2WS3 B;  3M63 B;  3UQB A;  3EHV A;  1TT5 B;  1JRU A;  3IAM 1;  1HZ5 A;  3T9L A;  1ZE3 D;  2WXM A;  5BMG A;  1OGW A;  1IGC A;  1ZXH A;  2OHF A;  4MGI E;  1FIQ A;  4OVU A;  4HLE A;  2ZNV B;  4BFR A;  3PRZ A;  1TTN A;  1RWS A;  1WIA A;  2FCN A;  2KAN A;  5EE3 A;  4DK5 A;  2VH1 A;  3TEX A;  2KWV B;  1JRO A;  3PRM B;  3TJP A;  1M4V A;  5HFY A;  3Q6B A;  4M8N A;  2XK5 A;  3DCG A;  3H1U A;  3NHE B;  1VLB A;  3KQ4 A;  3PHW B;  5IAA C;  3MC9 A;  2KTR B;  2BS4 B;  2PKO A;  3E9S A;  3RNG C;  1L0V B;  5G5H A;  2EMT A;  1QLB B;  1C79 A;  4BKS D;  3VRA B;  2L52 A;  2V0G A;  5DPW A;  1F2R C;  5HKH A;  4IM0 A;  3N1Y C;  4FJY A;  1K51 A;  4ITK A;  3VQI A;  1TS5 A;  1WM3 A;  4GMV A;  1FO4 A;  1K50 A;  3QWZ B;  3V6E B;  1EO6 A;  1NI2 A;  1E7P B;  5AUI A;  1XLO A;  2BYE A;  2PLP A;  3H7P A;  4LCD E;  2PTL A;  1LO5 D;  1N6Z A;  4ICV A;  1I35 A;  1GB1 A;  3EEC A;  2KX3 A;  1P7E A;  1OQY A;  2BTE A;  2KWC A;  2BS3 B;  4II3 B;  1D5X C;  3QQ8 B;  3CSF A;  2LRW A;  3FIL A;  1HTQ A;  2QIE B;  1VR9 A;  3JVZ X;  4P1C C;  1UF0 A;  3UGB B;  2PE6 B;  3ML9 A;  4HCN B;  1HTO A;  2BT6 A;  3PLU A;  2BB6 A;  2BW2 A;  2INC C;  1WH3 A;  2JF5 A;  2J7Q B;  4ASW C;  4WJO A;  1YQ4 B;  2RDB C;  3JSV A;  4A55 A;  3OWE B;  5L95 C;  5CHF A;  1G6J A;  2BF8 B;  2JY6 A;  1XD3 B;  3ZUN A;  1V49 A;  4KX6 B;  3GB1 A;  2WU2 B;  2NCN A;  1STE A;  3IBE A;  3KYD D;  4IOI E;  1E8W A;  4EE2 A;  1OEY A;  4NAW B;  4RF0 A;  2BYT A;  2GRI A;  2ZNV C;  3ZQ4 A;  4GDK A;  3ZDM C;  4C7Z A;  2BWF A;  3O13 A;  1YIW A;  3H9D A;  3R7Q A;  4MM3 A;  1GNU A;  5IN7 A;  1SF0 A;  3AEG B;  1SGH A;  2LZ6 A;  3DBH B;  1K52 A;  4GU2 A;  2ZVN A;  4REZ A;  4QAY A;  3WAM A;  3ZVV A;  1FMA D;  2KK8 A;  4D2K A;  2QMT A;  4L1B A;  2L1A A;  1KF6 B;  1IUE A;  1UNS A;  1KLV A;  4DDI D;  3V3X A;  4RGO S;  4PK1 A;  3NZU A;  2WXI A;  2ZCC A;  3PSE B;  3ETR A;  2AQ2 B;  1EWC A;  2IDY A;  2KN5 A;  4XE0 A;  4HDO A;  4PT5 A;  1SEB D;  1V81 A;  4JWU C;  1UWX A;  2L7R A;  1WJN A;  1TIF A;  1WXV A;  3ZRC A;  2LRU A;  4M8M A;  2JVC A;  3CMM B;  1F2R I;  1PUT A;  2KTR A;  3P2B A;  3V05 A;  1JWS D;  1FRD A;  2OJR A;  3U30 A;  3HIZ A;  2DWQ A;  2QIL A;  4ZYS A;  4HJG E;  2GBR A;  2D3A A;  4IG7 B;  1E0Z A;  2DBY A;  4G50 A;  1YQ3 B;  4A3O A;  1MG4 A;  3P42 A;  1TS3 A;  1WGY A;  3U8Z A;  5DPR A;  2KXJ A;  2IO2 B;  2WXJ A;  3EGR A;  4USA A;  4IDI A;  1LQB A;  2J0K A;  1P0R A;  2PEA A;  4LJP B;  1P9D U;  3EA6 A;  1V1O A;  1ZW7 A;  2NBU A;  3AE4 B;  3U52 E;  1IPG A;  4M00 A;  1AYF A;  2FCM A;  2MX2 A;  3B1L X;  5BYR A;  1ZGU B;  2JPH A;  1YQB A;  3L13 A;  4MEM A;  4BOZ B;  4K3C A;  3AE2 B;  2A5U A;  3KVF B;  1A5R A;  4HRS A;  2D3G A;  2WXN A;  3RPF C;  3I57 A;  3R2T A;  2QJL A;  2OOB B;  4BBN F;  4EEW A;  2GOW A;  3AEB B;  2WX0 A;  4EKU A;  3HUI A;  3MJW A;  3N32 A;  4HXD A;  3GE3 C;  4BBN C;  3D32 A;  1WJU A;  2GBM A;  2DZI A;  3GP7 A;  3B0A A;  1UBI A;  2K39 A;  2YVC A;  1GOZ A;  5EDS A;  1L5P A;  3RNA C;  1YJI A;  1WXA A;  2J52 A;  2EEL A;  2MEK A;  2K6D B;  2Y5C A;  2CKH B;  2KT7 A;  4KKI A;  4C80 A;  1MI0 A;  4NAW A;  4OVV A;  2C7H A;  3AH7 A;  1GG3 A;  1WY8 A;  4K1R B;  2JYE A;  4BOS C;  4P16 A;  2INN E;  1V86 A;  3QCA A;  2JWZ A;  3WAO A;  2JXT A;  2YLM A;  1WZ3 A;  1UGM A;  1F0Z A;  1QOB A;  1WGH A;  3NZ3 A;  3U4E G;  2KYW A;  1I4P A;  1TS4 A;  1K8R B;  4P1B C;  1TGZ B;  3KWV A;  2C7M B;  1MFW A;  4B0E A;  1BML C;  2FCS A;  1XQQ A;  4MT5 A;  3PGE A;  3W9C B;  2C60 A;  4ACF A;  2VH2 A;  5C1Z A;  2NPT A;  1LXD A;  3AMZ A;  1P1A A;  3NVV A;  1L4Z B;  1WMH A;  3WIM A;  1QKZ A;  4HEA 1;  2N9E B;  4RCO A;  3L10 B;  4LDT B;  4LNI A;  3NVZ A;  3KLS X;  4PYZ A;  4FA6 A;  1TY2 A;  2WWZ A;  2CHX A;  2L76 A;  1NEN B;  1L0X B;  3OAW A;  2N9L A;  3ENE A;  2D2Q A;  1P7F A;  3QX1 A;  2LGI A;  1RFA A;  4ZHO A;  4G11 A;  3L54 A;  1WGK A;  2LJI A;  4RH6 A;  4MGY E;  1LFD A;  2W3R A;  2IO3 B;  3TCA A;  3VUX A;  4XX5 A;  2UU7 A;  2AX5 A;  1IP9 A;  1N5W A;  4K3B A;  4KGS A;  1QOF A;  5G5G A;  1DOI A;  1GB4 A;  2IO0 B;  4FN2 A;  4GIV A;  4KGR A;  3NG0 A;  4AJW A;  3U7D A;  2NMQ A;  4K81 A;  2VZK D;  1J7C A;  4R3D A;  2ZVO A;  3NJT A;  3HVZ A;  1V8C A;  1ET9 A;  1X1M A;  1I4X A;  2DHZ A;  1HQR D;  2RDG A;  3ZIM A;  3GE8 C;  3L4P A;  3W1S C;  3ZNG C;  2CU1 A;  4FBJ B;  1RYJ A;  2IY0 B;  2M19 A;  2HTH A;  2E3T A;  4WJN A;  5JHB A;  4G3X B;  4IWQ A;  4XZ4 A;  2WX1 A;  1CMX B;  1SBB B;  3IXS A;  2MJD A;  4DDG D;  3ECI A;  2K8B A;  4TKN A;  1AW7 A;  3VH4 B;  3ZRF A;  4IM2 A;  4KDI C;  1XF5 L;  1UH6 A;  3BYT B;  1E10 A;  1WRI A;  2BWE S;  2Y3A A;  1UBQ A;  3VR8 B;  1VD2 A;  3W5V B;  2FUH B;  3LJ3 A;  2AWT A;  2WXQ A;  3SD5 A;  5FK9 C;  1T6B X;  1I4R A;  3GOE A;  2BKR B;  4S17 A;  4WWP A;  1NDD A;  1UEL A;  3AUL A;  1KJT A;  1PYW D;  3PT2 B;  2KMM A;  2K6Q A;  2IZV B;  4Q2J A;  4RGT A;  3ZJU A;  1YN4 A;  2WXK A;  3BY4 B;  1NBF C;  2DZM A;  2FNJ B;  1R4N B;  2L0F A;  2LVO A;  2C5L C;  3J9C A;  4S0R A;  3GZN B;  4NZL B;  2LGS A;  3X23 A;  1SE9 A;  1JWM D;  4ZDV A;  2ICI A;  4EZL A;  4GLS C;  2WHI A;  3A4R A;  1YJ1 A;  2LXA A;  2TSS A;  3AV8 A;  3AEE B;  4PS8 A;  3PLV A;  3WAP A;  1PGB A;  2C7N B;  1GC6 A;  1XLQ A;  4M0W A;  5E6J A;  1YN5 A;  2EKE C;  2HTM E;  1E6E B;  3AE3 B;  4YWG G;  4EUT A;  4KIK A;  4I6P A;  3RNE C;  3I3T B;  4URK A;  4PS3 A;  3X0W A;  2KC2 A;  3R3M A;  5LXI B;  2LEK A;  4GDK B;  2XNA C;  1N60 A;  2R61 A;  4PYU A;  2D3B A;  3DBR I;  1XO3 A;  2I1K A;  1YN3 A;  1J7A A;  3B2F A;  5BYS A;  4US8 A;  1RRB A;  3WAL A;  2C9W B;  1FNW A;  2W54 A;  4YT0 B;  2ON8 A;  3AE8 B;  5BO4 B;  4AJY B;  3DHH C;  3AEF B;  4A6Q A;  1HXY D;  2UWQ A;  4LJO B;  4W9K A;  5LXH A;  5T8I A;  3Q8B A;  2KVZ A;  2V3S A;  4MH0 E;  4C4V A;  4DHZ E;  2W3S A;  2IGD A;  1V97 A;  2O6V D;  4CQN A;  2WXO A;  2WGS A;  2V4L A;  2L3Z A;  4YTP B;  2V3P A;  4NQL B;  2EKI A;  4RF1 A;  1V5O A;  2A4Z A;  2LUE A;  4W9I A;  1E8Y A;  2K0P A;  5IKC M;  4WWM A;  1I42 A;  2J53 A;  1FCL A;  2L32 A;  2OJW A;  4JWS C;  1Z5S B;  2HE7 A;  2AYO B;  2XEW A;  5CHV C;  4JPS A;  3PV1 A;  3KYC D;  2HJ1 A;  2Y5B B;  3Q3F A;  3SU8 X;  4W9G A;  5H92 C;  3N1Z C;  1GPX A;  5JHA A;  3RNF C;  1VZ7 A;  2DEN B;  5JH5 C;  3P4P B;  3AU5 A;  2AL3 A;  2MP2 A;  1IGD A;  2BYF A;  1L0Y B;  2K1F A;  2RPV A;  4WQM A;  2ZPY A;  1ZXI A;  4WAF A;  5D2M B;  3HRD D;  4BZA A;  3EC8 A;  2WXF A;  3TEY A;  3ZKJ C;  5EE0 A;  3MFG A;  2J0M A;  2M0A A;  1C4A A;  1UD7 A;  1WF9 A;  1OTR B;  1AN8 A;  5L83 A;  1OQR A;  2WNM A;  3BYY B;  4NJ6 A;  1Q0W B;  3KH0 A;  2ASQ A;  4P6V F;  5D94 A;  1CK1 A;  1WE6 A;  3DWM A;  1C1Y B;  4XDC A;  4WWN A;  1XCQ L;  1YMH E;  2Z59 B;  4P7I A;  4HVB A;  2O6V A;  3APF A;  1XCT L;  1GUA B;  4N58 A;  2D5G A;  2MWS B;  2KKC A;  3BWU D;  1JWU D;  4CYE A;  1RLF A;  4MSM B;  3HM6 X;  1L4D B;  3DVN V;  3A1Q B;  2L8J A;  3RT3 B;  1BXT A;  3N3K B;  3DBL I;  4BKS A;  1WRD B;  1S3S G;  2WXP A;  2Z0D B;  5G55 A;  1L6U A;  4DQO C;  3OG5 A;  2NTT A;  2KO3 A;  3FKY A;  1UWM A;  2KWD A;  2IND C;  2B3A A;  4K7U A;  5GMV A;  4FUL A;  3RZW C;  1EF5 A;  4OZA A;  3PO0 A;  2NBV B;  1FM0 D;  2MA9 B;  3ZJT A;  2W55 A;  4MAC A;  1YOV B;  1AAR A;  5HHD G;  5BMH A;  2INP E;  2ZCB A;  4MGZ E;  2WDQ B;  2NPT B;  2L00 B;  4W9H A;  2KDI A;  1WM2 A;  1WMH B;  3MC8 A;  3IT6 B;  1L2N A;  1SJH D;  1R4N I;  2L0T A;  2LXC A;  1MJD A;  1YX5 B;  1MHX A;  4WUR A;  2GMI C;  2K22 A;  5MPO A;  2GI9 A;  1C4C A;  3RYT A;  2KNB A;  2WU5 B;  1F1H A;  3DVG Y;  3Q8C A;  1R7S A;  1JW9 D;  2CS4 A;  1E8X A;  2V4I B;  2JWU A;  1ACC A;  2CHW A;  4HK2 A;  1ZDV A;  2KWU B;  2RR9 A;  3VFK A;  4WJP A;  2D10 A;  1IYF A;  4E74 A;  1QQR A;  3P1M A;  4N6E B;  3TIX A;  1F52 A;  4KDL B;  3N1X C;  1EU4 A;  2O2V B;  1PQS A;  2K5P A;  2JT4 B;  2MBQ A;  2DYO A;  2J4X A;  3DBS A;  5E6P A;  2RDH A;  2G3Q B;  3C0R B;  2ZZP B;  3MC0 B;  1M94 A;  4JLC A;  1DGJ A;  1YX6 B;  1ESF A;  3DWG C;  2MBO A;  4YSZ B;  2ONQ A;  2RMM A;  4ZRJ A;  3CST A;  1FNV A;  2MCN B;  2QHO A;  1E7V A;  4RNA A;  1EM7 A;  2QEJ C;  4EOY A;  1S1Q B;  4ZRK A;  4ANV A;  1HA5 A;  2FIF A;  2Z8L A;  1WJ6 A;  1NEK B;  4NPN A;  5LLI A;  3EFC A;  5IOI A;  2N4F A;  3W5U B;  4BKT A;  4MDK E;  4C00 A;  1FRR A;  2MBH A;  3VXW A;  5D3I B;  1WJ4 A;  2YEP B;  4I6N B;  1DYQ A;  2D3C A;  3VUW A;  3ZLZ A;  3HVD A;  5EE9 A;  2LJ5 A;  2IO1 B;  2ZW1 A;  4L2Y A;  1WX9 A;  2KJ6 A;  3I9V 1;  3AEA B;  1WYG A;  3A1Q A;  5KHQ A;  4MGK E;  4ARI A;  5C23 A;  4B9K A;  2MRP A;  4KKJ A;  4GOC A;  2B76 B;  5E6O A;  1SXT A;  4DHJ D;  2AEH A;  1TYG B;  4W9J A;  2GBJ A;  5J17 A;  1VZ8 A;  2LWP A;  1XEE A;  5D7G A;  4RGN A;  3HM3 A;  2G45 B;  3H7S A;  3ZXR A;  2KDE B;  1VRA B;  2CJN A;  1N62 A;  3KUZ A;  4HPL B;  4RM8 A;  4YXD B;  3WA0 A;  2BS2 B;  1E5W A;  5DCN A;  2KC1 A;  2M8S A;  4ZRP A;  1HEZ E;  1KLG D;  3NUH B;  2IGH A;  3LYY A;  2KFK A;  4M0W B;  1WXQ A;  2ZJD A;  1JWA D;  2PE9 A;  3K9O B;  4FAD A;  4KIK B;  3QIJ A;  4GB9 A;  2M0X A;  2LGX A;  4GSW A;  4ANU A;  2JZ3 B;  3OJ4 B;  1TY0 A;  1WYW B;  4OHJ A;  2M56 B;  3TUO A;  3H6N A;  4EZK A;  5LNK 1;  1NI3 A;  4IWP A;  3DOW A;  4FLH A;  2KVR A;  3EFU A;  5G2N A;  1V1P A;  1WXM A;  2LMC A;  1WE7 A;  1MPE A;  2GB1 A;  4K7S A;  2LGY A;  4BAX A;  3BVZ A;  2KAJ A;  2LI5 A;  4TQ0 A;  2IY1 B;  1QZE A;  4YSY B;  2NR2 A;  2O2V A;  5IP4 D;  3QC8 B;  1WR1 A;  4JE3 B;  4ICU A;  4C4V B;  2I38 A;  1H4R A;  2AL6 A;  3VRB B;  1KH0 A;  3NOB A;  3VAW A;  4IUM B;  3DBH I;  3HK0 A;  5D6J B;  3RNB C;  1TKY A;  4NAM A;  5AZF A;  1QT9 A;  2KFJ A;  2XBB C;  4BVU C;  5DPT A;  1B1Z A;  4WIP A;  4ARC A;  3PZ8 A;  5GXG B;  1U4A A;  3SR6 A;  1EF1 A;  2KQ4 X;  1CZP A;  4L23 A;  2BGF A;  3ZYY X;  2DYM A;  1L6V A;  4XC2 A;  5CHW A;  3KUC B;  1WR6 E;  1FFV A;  2Z0E B;  3C19 A;  2CJO A;  2M4N A;  2W9N A;  3AB5 A;  2MP2 B;  2DAF A;  3ZTD A;  3R8B A;  2VRR B;  4UDU C;  3EUB 2;  4YTN B;  3UI3 A;  3NRZ A;  3T3N A;  1PDX A;  3AN1 A;  2V3N A;  1PGX A;  1T0Y A;  1HZ6 A;  1PGA A;  1ZPS A;  3VUY A;  3OLM D;  4MEL A;  3P63 A;  3VR9 B;  2D07 B;  2I1J A;  4DHZ B;  1UZX B;  4PS7 A;  3AXC A;  3Q3M C;  2DYB A;  1ROE A;  1GJZ A;  2BKF A;  1Q10 A;  3A9J A;  3T3O A;  4KZC A;  3JW0 X;  3QAQ A;  2J0J A;  3ZW3 A;  1N5X A;  3PHX B;  4F7Z A;  4AS1 A;  4FHJ A;  2N7E A;  2ZEQ A;  3CIR B;  2Y5P A;  2FAZ A;  3GS2 A;  1NYR A;  2SAK A;  4K7W A;  2WXR A;  2O6V B;  4B95 A;  1C76 A;  4OVZ A;  2K9X A;  1K53 A;  4DXG A;  3AE1 B;  3L17 A;  1P3Q U;  4RM9 A;  3L0W B;  2MW5 A;  3PZD A;  4AOF A;  2KHW B;  2JZZ A;  1C3T A;  4EZJ A;  3VTW A;  5JZE B;  1N61 A;  3CF6 E;  3A4S C;  2DAJ A;  1VCB A;  2NTS A;  2K25 A;  3PRP B;  1J8C A;  3B08 A;  5C2T B;  2MJE A;  3NZS A;  3VTU A;  1FD6 A;  1SE3 A;  1WZ0 A;  2MQJ A;  1ET6 A;  1R4M B;  2WDT B;  1WXS A;  1QOA A;  2N9P C;  2ZW0 A;  2KJH B;  3U2S C;  4FJZ A;  3DHG C;  4W9C A;  2LGD A;  4IW0 A;  2KLC A;  5I4D A;  3SFE B;  1WFY A;  1JWB D;  1BT0 A;  2LHD A;  3UIN B;  2IJ0 A;  3N20 C;  2L83 A;  4IC7 B;  3PS6 A;  1GAQ B;  1KOT A;  3ZNZ B;  2R2O A;  3DDC B;  4XDD A;  3FC4 A;  1VJK A;  1XLP A;  4E3C A;  3VDZ A;  4N59 A;  4A8X C;  4WWO A;  1TKE A;  1WX7 A;  2MJ3 A;  1HE8 A;  2AQ1 B;  4ANW A;  4DBG A;  1SE2 A;  3RN9 C;  1T5X D;  4W9L A;  3HHM A;  3MHS D;  1QOG A;  2LFI A;  1D6E C;  1NYQ A;  2NS5 A;  2QSD A;  3BIN A;  3N9Y C;  2PPH A;  2RGF A;  1MHH E;  5H8Y E;  4TV3 A;  4GDL B;  3NY5 A;  5AUK A;  4J3O D;  2MHJ A;  3E56 A;  1E9M A;  4YL8 A;  3RZF A;  1KTK A;  2FCQ A;  3A9K A;  3NS8 A;  1MVK A;  2OED A;  1I4G A;  2PIA A;  4NJ7 A;  4LNO A;  4HCP B;  1KRH A;  1E90 A;  1F9J A;  3DVN U;  3W1Y A;  2DZK A;  2GLS A;  3IAS 1;  4G0N B;  3AE9 B;  1E8Z A;  1ZUD 2;  1FXI A;  2BB5 A;  4NQK E;  1TJE A;  1QIL A;  1ZOY B;  1SE4 A;  3RI7 C;  2JSV X;  4XGA B;  3ZXV A;  2REX A;  3RFZ B;  1D4B A;  2FID A;  3QK0 A;  2K8C A;  1LGR A;  2MBE A;  5IO9 A; 
#chains in the Genus database with same CATH homology
 2KN4 A;  2W3R A;  1TZO A;  4TSS A;  1QF6 A;  2FBW B;  4US9 A;  2RDH A;  1PFD A;  4A9A A;  3MC0 B;  3MP9 A;  1DGJ A;  2AX5 A;  1N5W A;  1ESF A;  3DWG C;  4YSZ B;  2ONQ A;  2RMM A;  1FNV A;  2IGG A;  3AED B;  4KGS A;  1YNT E;  4KGT A;  1QOF A;  5G5G A;  1FXA A;  1FFU A;  1DOI A;  1OFF A;  2JZP A;  1GB4 A;  3NVY A;  4RNA A;  1EM7 A;  2QEJ C;  1T3Q A;  2XN9 C;  1CJE A;  4KGR A;  2NMQ A;  1HA5 A;  3P4S B;  4MM3 B;  2Z8L A;  2VZK D;  4TQ1 A;  2CU3 A;  4YTM B;  3AE6 B;  1NEK B;  1J7C A;  3W5U B;  2N0S B;  2N7J A;  4ZOH C;  2PVO D;  4C7Y A;  1FRR A;  4R3D A;  5D3I B;  3HVZ A;  2Q5W D;  1V8C A;  1ET9 A;  2YEP B;  2PMV A;  1I4X A;  1DYQ A;  3R2I A;  1HQR D;  2G1E A;  2RDG A;  4XWW A;  2WQY B;  2WS3 B;  3HVD A;  5EE9 A;  3L4P A;  5C3J B;  3IAM 1;  1HZ5 A;  1ZE3 D;  1RYJ A;  2WXM A;  3PZ7 A;  5BMG A;  1IGC A;  1ZXH A;  2M19 A;  2OHF A;  2ZW1 A;  4L2Y A;  1YJJ A;  3I9V 1;  3AEA B;  1D5M C;  1FIQ A;  1WYG A;  2E3T A;  3BVG A;  2DLB A;  1I7H A;  4ARI A;  1RWS A;  3P4R B;  4RFB A;  5BMI A;  1SBB B;  3ZGZ A;  5EE3 A;  3IXS A;  3Q8A A;  4FXC A;  2MJD A;  2KAC A;  4KKJ A;  3TEX A;  3U7Z A;  1JRO A;  1M4V A;  2B76 B;  5HFY A;  1AW7 A;  1SXT A;  1VLB A;  3KQ4 A;  3MJ5 A;  1XF5 L;  2KDM A;  1I4Q A;  3BYT B;  1E10 A;  1WRI A;  2Y3A A;  3VR8 B;  1TYG B;  3W5V B;  1FCC C;  2WP9 B;  1VZ8 A;  2BS4 B;  2PKO A;  2MH7 A;  1XEE A;  3E9S A;  5D7G A;  1L0V B;  5G5H A;  1CQV A;  4RGN A;  2WXQ A;  1QLB B;  2PVG C;  1C79 A;  1T6B X;  1I4R A;  5FK9 C;  3VRA B;  1VRA B;  2CJN A;  1N62 A;  2L52 A;  2V0G A;  4YXD B;  1F2R C;  1UUP A;  2BS2 B;  1K51 A;  1PYW D;  1KFY B;  2WXH A;  4ITK A;  4ZRP A;  1HEZ E;  1KLG D;  2KMM A;  3NUH B;  2IGH A;  3LYY A;  1TS5 A;  3VQI A;  1ZP0 B;  4Q2J A;  4RGT A;  3ZJU A;  1YN4 A;  2WXK A;  3SFD B;  4H2A A;  4HRO A;  1FO4 A;  1K50 A;  1WXQ A;  1IBX B;  1E7P B;  1JWA D;  5AUI A;  1XLO A;  3J9C A;  2PLP A;  1AWD A;  2PTL A;  1LO5 D;  4NZL B;  1V1P B;  1JWM D;  4HKQ A;  1GB1 A;  2ICI A;  3AE5 B;  4MH8 A;  4GLS C;  1P7E A;  2BTE A;  1TY0 A;  2BS3 B;  2TSS A;  3AV8 A;  3AEE B;  1D5X C;  4OHJ A;  2M56 B;  1PGB A;  3TUO A;  3FIL A;  5LNK 1;  2QIE B;  1VR9 A;  1NI3 A;  3W2D A;  1XLQ A;  4M0W A;  1D5Z C;  4TMA B;  5E6J A;  3BZD B;  1YN5 A;  5EE1 A;  1OQQ A;  2HTM E;  1E6E B;  2BT6 A;  3AE3 B;  4YWG G;  5FR3 A;  1V1P A;  2BB6 A;  1FNU A;  2BW2 A;  2LMC A;  3CWI A;  1MPE A;  3FAH A;  3P4Q B;  4XWT A;  4JX1 C;  2GB1 A;  3BVZ A;  1SJE D;  1YQ4 B;  2KAJ A;  3Q8F A;  4TQ0 A;  4C56 C;  2LEK A;  4GDK B;  4YSY B;  2XNA C;  4A55 A;  1N60 A;  3NS1 A;  3OWE B;  1VDV A;  2R61 A;  2E6X A;  4JE3 B;  1B9R A;  1XO3 A;  2I38 A;  1YN3 A;  5TSS A;  3VRB B;  1J7A A;  3B2F A;  1KH0 A;  3Q69 A;  4KX6 B;  1EWY C;  4US8 A;  5BYS A;  3GB1 A;  2WU2 B;  3C8Y A;  5HI1 A;  1FNW A;  1STE A;  2W54 A;  4YT0 B;  2ACZ B;  2ON8 A;  4IOI E;  3AE8 B;  1TKY A;  4NAM A;  4EE2 A;  4NAW B;  3AEF B;  4A6Q A;  4RF0 A;  2BYT A;  1HXY D;  2GRI A;  1QT9 A;  3ZQ4 A;  5T8I A;  3Q8B A;  3TEZ A;  4C7Z A;  4AQ7 A;  3O13 A;  5HG2 A;  2K3U A;  4B0M A;  2AQ3 B;  1JCK B;  1KLU D;  4LK0 M;  1B1Z A;  4WIP A;  4ARC A;  3PZ8 A;  5GXG B;  2W3S A;  2IGD A;  1V97 A;  3LXF A;  1SIJ A;  3SR6 A;  1SF0 A;  3AEG B;  4CQN A;  2KQ4 X;  2N9K A;  1CZP A;  2WXO A;  1K52 A;  4L23 A;  4YTP B;  2SEB D;  4REZ A;  1FMA D;  2V3P A;  3ZYY X;  2EKI A;  4RF1 A;  4D2K A;  2QMT A;  1UGJ A;  4L1B A;  2DYM A;  1L6V A;  2L1A A;  1KF6 B;  1TKG A;  1FFV A;  2K0P A;  1IUE A;  1F77 A;  2CJO A;  1UNS A;  4WWM A;  2J53 A;  1FCL A;  1JML A;  2L32 A;  4JWS C;  3V3X A;  3AB5 A;  4O1N A;  4RGO S;  4JPS A;  2IPK D;  2WXI A;  3R8B A;  3ETR A;  4UDU C;  2AQ2 B;  1TS2 A;  3EUB 2;  1EWC A;  4YTN B;  3UI3 A;  2IDY A;  5H92 C;  3AM9 A;  4XE0 A;  3NRZ A;  2LUM A;  3T3N A;  3B9J A;  1C77 A;  1PDX A;  3AN1 A;  4PT5 A;  4LTU A;  2V3N A;  1PGX A;  1SEB D;  4A90 A;  1HZ6 A;  4JWU C;  1GPX A;  1PGA A;  1ZPS A;  4YSX B;  1UWX A;  2WDV B;  1FEH A;  2FE8 A;  3P63 A;  1VZ7 A;  3VR9 B;  3BII D;  3P4P B;  1C9F A;  1Y56 A;  1F2R I;  1PUT A;  3V05 A;  1ROE A;  1JWS D;  1FRD A;  1Q10 A;  1IGD A;  2VZK B;  3T3O A;  1L0Y B;  4OZC A;  2JX5 A;  2DWQ A;  2RPV A;  4WQM A;  1ZXI A;  2QIL A;  4WAF A;  4ZYS A;  4HJG E;  1JAL A;  3HRD D;  2PW9 A;  1N5X A;  1E0Z A;  2DBY A;  2WXF A;  4AS1 A;  1YQ3 B;  3TEY A;  3BK2 A;  1N63 A;  3P42 A;  5EE0 A;  1TS3 A;  3CIR B;  2Y5P A;  3MFG A;  2M0A A;  1C4A A;  2WXJ A;  3EGR A;  5BYQ A;  3GS2 A;  1AN8 A;  1NYR A;  2SAK A;  4NJC A;  1WSP A;  2WXR A;  4USA A;  1OQR A;  4IDI A;  2JU6 X;  2WNM A;  3ZJV A;  1IBX A;  1C76 A;  1NVI D;  3BYY B;  4OVZ A;  1I4H A;  2K9X A;  3EA6 A;  1K53 A;  1SB3 C;  4DXG A;  3AE1 B;  1V1O A;  2J42 A;  3AE4 B;  3U52 E;  1AYF A;  2WDR B;  2YEP F;  4P6V F;  4DXF A;  1CK1 A;  2X38 A;  3DWM A;  5BYR A;  4XDC A;  1XCQ L;  1YMH E;  1N61 A;  3AE2 B;  1JQ4 A;  1RFK A;  2WXG A;  2NTS A;  4HRS A;  1XCT L;  5C2T B;  4RGM A;  2WXN A;  3RPF C;  3ABV B;  3I57 A;  3R2T A;  4N58 A;  2QJL A;  2D5G A;  2MJE A;  3AEB B;  3BWU D;  4ZRQ A;  3TSS A;  1JWU D;  1FD6 A;  3HUI A;  1SE3 A;  4OZB A;  2I2Y A;  1ET6 A;  1SSN A;  5D3D A;  1QOA A;  2ZW0 A;  1L4D B;  3U2S C;  3BVM A;  5FKA C;  3GP7 A;  1J7B A;  5I4D A;  3SFE B;  1BXT A;  1JWB D;  2LHD A;  1GOZ A;  2IJ0 A;  3BK1 A;  1L5P A;  4LLG M;  1JRP A;  2L83 A;  3IT4 B;  1YJI A;  2WXP A;  1DOY A;  2J52 A;  2EEL A;  2MEK A;  2Y5C A;  1L6U A;  2G9H D;  4KKI A;  4C80 A;  4DQO C;  1MI0 A;  1GAQ B;  2NTT A;  3WCQ A;  1UWM A;  2KWD A;  4XDD A;  3FC4 A;  1VJK A;  1XLP A;  2H89 B;  4N59 A;  3AH7 A;  4A8X C;  4OZA A;  3PO0 A;  2JYE A;  4P16 A;  1TKE A;  1FM0 D;  2INN E;  3ZJT A;  2MJ3 A;  2W55 A;  2JXT A;  4MAC A;  4HKZ E;  2AQ1 B;  5HHD G;  3URY A;  1SE2 A;  1T5X D;  5BMH A;  1BUI C;  1QOG A;  1F0Z A;  2INP E;  2LFI A;  1D6E C;  1VZ6 A;  3AEC B;  1QOB A;  2WDQ B;  1NYQ A;  2QSD A;  4IKG A;  3NZ3 A;  3U4E G;  3TEW A;  3N9Y C;  1I4P A;  3IT6 B;  1TS4 A;  1SJH D;  1MHH E;  2HDE A;  5H8Y E;  2WLB A;  4GDL B;  3W1S A;  2WXL A;  5AUK A;  4J3O D;  3E56 A;  1MHX A;  1ENF A;  3KWV A;  3NVW A;  1E9M A;  4WUR A;  4B0E A;  2K22 A;  1BML C;  5MPO A;  1KTK A;  4WH4 A;  3SEB A;  2GI9 A;  4MT5 A;  1DOX A;  1C4C A;  3Q8E A;  3W9C B;  2WU5 B;  1MVK A;  1C4P A;  2OED A;  3Q8C A;  1I4G A;  1R7S A;  2PIA A;  4OW0 A;  1JW9 D;  1KRH A;  3AE7 B;  3AMZ A;  3NVV A;  1L4Z B;  4ZHP A;  1QKZ A;  3FIL B;  3KWL A;  4HEA 1;  2V4I B;  4RCO A;  2JWU A;  1ACC A;  3IAS 1;  3MHZ A;  3LB8 C;  3B2G A;  1A70 A;  3AE9 B;  5JXV A;  1RM6 C;  1ZDV A;  3NVZ A;  1C78 A;  3KLS X;  1EU3 A;  1ZUD 2;  3H8H A;  1FXI A;  1TY2 A;  2BB5 A;  1TJE A;  1QIL A;  1ZOY B;  1SE4 A;  2LHE A;  1NEN B;  1XXG A;  1L0X B;  2JYT A;  2N9L A;  1QQR A;  2FUG 1;  2JQR B;  2JSV X;  3P1M A;  2W82 A;  1XLN A;  4N6E B;  3RFZ B;  1P7F A;  2H88 B;  1ZDX A;  2BBC A;  1D4B A;  2LGI A;  1EU4 A;  1WWT A;  4ZHO A;  2K5P A;  1WGK A;  2LJI A;  4RH6 A;  2DYO A;  2J4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...