1YJJA

Rdc-refined solution nmr structure of oxidized putidaredoxin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
106
structure length
106
Chain Sequence
b'SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putidaredoxin
publication title Redox-dependent structural differences in putidaredoxin derived from homologous structure refinement via residual dipolar couplings.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Electron transport
total genus 16
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yjjA00
1SB3C 1TKGA 4FXCA 3AE3B 1N61A 2WS3B 1TYGB 1QT9A 2W3SA 1PUTA 2PKOA 2QJLA 1E7PB 3ABVB 3EUB2 1VJKA 4JWSC 3HRDD 2H88B 4ITKA 1JALA 1J7AA 4YT0B 1N5WA 1TKYA 5AUKA 3AN1A 1FO4A 1FM0D 1QLBB 2ACZB 3PO0A 4YTMB 1N62A 1JQ4A 2AX5A 1J7CA 1NEKB 5EE3A 5EE0A 5H92C 1QOFA 2DWQA 2G1EA 2BT6A 3ETRA 5G5GA 1F0ZA 1J7BA 1OFFA 2JX5A 4IDIA 1FFUA 1OQQA 1ZUD2 4KX6B 1N60A 3RPFC 1PFDA 1E9MA 1SF0A 1NENB 2MJDA 1L5PA 2WDQB 1OQRA 1UWMA 3AEGB 4ZHPA 3AEBB 3NVVA 1V97A 4US9A 1RWSA 2WDVB 2DBYA 3B2FA 1B9RA 1KRHA 1YQ3B 3NS1A 1FRRA 2WP9B 3AE1B 4N59A 3CWIA 2FBWB 3W5VB 3NVYA 1XLNA 1DGJA 2L52A 2Q5WD 2KAJA 2CU3A 2QIEB 2K5PA 3WCQA 1QOGA 2MH7A 1QOAA 3P4RB 4C80A 4N58A 1FFVA 1QF6A 3CIRB 4YTNB 2CJOA 2HTME 1AWDA 4YSZB 3AE7B 2E3TA 3L4PA 3KWLA 2B76B 1JROA 5C2TB 3BIID 1XLPA 4YSYB 3AE2B 1XO3A 3FAHA 3LXFA 1JRPA 3AV8A 5G5HA 2BS2B 3W5UB 1ZXIA 4C7YA 4US8A 1GPXA 1NYQA 3AEAB 1EWYC 1JW9D 2W3RA 3SR6A 3AECB 1R7SA 4YTPB 1WRIA 3AMZA 4ZOHC 3P4PB 1FMAD 1L6UA 4P6VF 4C7ZA 1L0VB 3AE9B 3AEFB 3DWGC 3NRZA 1XLQA 3AEEB 4HRSA 1SIJA 5EE1A 1I7HA 1RYJA 1NI3A 1YJIA 5AUIA 4A9AA 3VRAB 3W9CB 1E6EB 4N6EB 1RM6C 2M19A 1DOYA 3LB8C 2BS3B 1KFYB 2PIAA 4LTUA 3SFEB 3AB5A 5EE9A 3ZYYX 1WXQA 2W54A 2WLBA 3AEDB 1DOXA 1ROEA 1TJEA 3HVZA 1JWBD 2M56B 1TKEA 2WDRB 1YQ4B 2K9XA 2WU5B 3HUIA 2PVGC 3SFDB 2EKIA 4USAA 1CJEA 3AE8B 2Y5CA 4HROA 5H8YE 4YXDB 2KMMA 1NVID 1PDXA 4YSXB 1V8CA 1WWTA 1VLBA 2N0SB 1YJJA 3FC4A 4WWMA 2JQRB 3AE5B 2WU2B 1NYRA 2CJNA 1QOBA 3B9JA 1WGKA 3NVWA 2L83A 5GXGB 5C3JB 3P4QB 3VRBB 1FXAA 2PVOD 1RFKA 1L6VA 1FRDA 2K22A 2W55A 3P4SB 1FXIA 2WQYB 1KF6B 3AE4B 3AE6B 3AH7A 1ZP0B 3DWMA 4JWUC 4ZHOA 2H89B 2MJ3A 1XLOA 1VDVA 4WQMA 2LEKA 1N63A 2MJEA 3P1MA 1CZPA 3VR8B 3VR9B 3P63A 1IUEA 5MPOA 1T3QA 1GAQB 2OHFA 1JWAD 3B2GA 1N5XA 1FIQA 1AYFA 4JX1C 1WYGA 3AM9A 1E0ZA 1DOIA 1E10A 1ZOYB 1A70A 3NVZA 2BS4B
chains in the Genus database with same CATH superfamily
1JWMD 2WS3B 1TYGB 4BFRA 3PT2B 1QZEA 4LNNA 3SHQA 3MHSD 1KLGD 4TUUA 1TS2A 2KFKB 1QLBB 1V1PA 3P2BA 4KVGB 1NEKB 1MG4A 3ETRA 4XGAB 4EFOA 1P1AA 3QJZA 2JXTA 3I57A 2Y5PA 2Z0DB 3I9V1 3MFGA 4FHKA 5KHQA 2D10A 2W82A 1XQQA 3AEBB 4YL8A 2LXAA 2BWES 2MCNB 2Y5BB 3H8HA 2WP9B 2RDHA 2O6VB 4WQOB 1WSPA 3VQIA 1UWXA 2JRHA 1FFVA 4ZYSA 1V49A 1E90A 4JPSA 3VDZA 3NY5A 4C7YA 1C1YB 3VVWB 4D2KA 1K50A 2XBBC 1EO6A 3AE9B 4K7WA 3UQBA 1DYQA 4II2B 3W9CB 2L00B 2M19A 3HHMA 2WLBA 2BB6A 2KACA 5BMIA 1ROEA 2K8CA 2ZW1A 1WFYA 2IO2B 2K9XA 2N7DA 3DBLB 1Q1OA 3ZO5B 3DCGA 2WU2B 2BYVE 1FXAA 4DBGA 4YSXB 4B9KA 4DQOC 1YD8U 4EEWA 3PRPB 4KSKC 3Q8FA 2GMIC 1VR9A 1SXTA 1V6EA 4M8MA 3RZWC 1XT9B 4NJ7A 1TS3A 1UGJA 3TEZA 2KFJA 3NVZA 4HK2A 4FXCA 2GOWA 1T0SC 2UYZB 1TBEA 4LK0M 2J4XA 3MJ5A 3AN1A 5AZHA 3ZIMA 1FM0D 2DZIA 5EE3A 2C9WB 2C7MB 2N1VA 1OFFA 2KTFA 2LJ5A 4AQ7A 2L7RA 3RZFA 3R3MA 2I1KA 3JYUA 1MHXA 3ZXVA 1RWSA 1V80A 2HD5B 5BYQA 1I4HA 3VTUA 2Q5WD 3VXWA 1C76A 1WE7A 3E9SA 4LNFA 3IBEA 4ZRPA 1AWDA 4YSZB 2DLBA 1RAXA 5C2TB 1C77A 1ZDXA 2FE8A 4MM3A 3QX1A 3SR6A 2PTLA 4WWPA 2LJIA 1WXSA 4DHJB 4I6PA 3ONSA 4HDOA 1C4PA 4M00A 1UH6A 4AOFA 2IGDA 1OQYA 1WE6A 2IDYA 1X1MA 1MVKA 1TJEA 2IO1B 1FEHA 4BKGA 4LDTB 3T3OA 3SFDB 5H8YE 1C79A 3V05A 3WA0A 4IM0A 3OJ3A 3FC4A 1PGBA 3AE5B 4HEA1 3NVWA 3SD5A 1L6VA 2WQYB 3GE8C 2MSED 3V3XA 3T9LA 1WJ4A 4G3XB 3VR9B 1VZ6A 4G0NB 4W9FA 2KXJA 2L8JA 1FIQA 3ZTDA 2QSDA 3H6NA 3N1XC 2MP2A 3W2DA 3QAQA 3EC8A 3ABVB 2RDBC 1F2RI 1P98A 2JYTA 4RGTA 1TKYA 3UGBB 4YTMB 4X57B 2VRRB 3HK0A 3DHGC 2JWUA 2W9NA 2G9HD 4NNJB 2I1JA 4ANWA 4HCNB 5CTRC 4II3B 2WXMA 3PSEB 3PV1A 2PEAA 4Q2JA 2NCNA 3SDLC 5DCNA 2O2VB 3SU8X 4GLSC 3L10B 1WR6E 2L52A 4NAWA 4P1BC 2DENB 1IBXB 2XK5B 1ZE3D 2L0FA 2AL3A 5DPTA 3T3NA 2WGSA 2UWQA 1AARA 3AXCA 1I4XA 5HKHA 1VCBA 4DHZE 4S17A 1XO3A 4ZRQA 5IOIA 3PTFC 1E8WA 1SGHA 4GMVA 2V9HA 4IM3A 1HQRD 2N9XA 1HZ6A 4HPLB 1ZW7A 3APDA 4A8XC 2BQQA 2KX3A 4L2YA 1WXVA 1WIAA 2PIAA 3NS8A 1WXQA 3AEDB 2BYFA 1JWBD 2G4DB 3HVZA 4OVUA 2KFKA 4E3CA 2K39A 2Y5CA 3H1UA 4MGKE 3L13A 3HIZA 3U7ZA 2GB1A 3W1SC 1GB4A 2PJHA 5IN7A 2MBEA 4G11A 4C4VB 3AE6B 2MRPA 2GBJA 2WXNA 1N63A 2O6VA 4F1SA 2YVCA 1SJED 2IZVB 2WX1A 4JE3B 4FBJB 4R3DA 3APCA 1ZOYB 3WANA 2OOBB 2GBMA 2W3SA 1E7UA 2Z59B 2QJLA 4L1BA 5KHOA 3U7DA 3R66C 1VJKA 1ZKHA 3TMPB 2CHXA 3PZ7A 1P7EA 2FCNA 2KWVB 2MX2A 2AX5A 4QAYA 5HG2A 1NBFC 2JVCA 2Z8LA 2D3BA 3N9YC 1UBIA 2KMAA 4WWOA 3CSFA 1OQRA 5D7GA 4HDQA 3ZNHB 1U4AA 3AE1B 3ZRCA 2QIEB 2KMCA 4M8NA 5D6JB 3L16A 2LGYA 3I63C 1D3ZA 1ZGUB 2AQ3B 3MP9A 3QWZB 4NJCA 4FJVB 4ZYNA 1EWYC 2W3RA 2L3ZA 2J0JA 2JZ3B 3DWGC 3UINB 4DDGD 4A90A 1YJIA 2ZEQA 3N32A 3SFEB 4RGMA 3APFA 4WH4A 3UIOB 2WU5B 1CJEA 2REXA 3KLSX 3VUWA 3ZJUA 4GB9A 3KYDD 2J53A 2LD9A 3L0WB 2DNFA 3VRBB 1D5XC 3DWMA 1ZP0B 2KJRA 3ZQ4A 4WJOA 1GAQB 5E6OA 3DBHB 2YEPB 2KQSA 4BOSC 2WYQA 1J0GA 4WWNA 1VZ8A 2JRIB 2ZPYA 4JWSC 1KLUD 2DX5B 2UU7A 3NZ3A 1Z2MA 2LZ6A 2ACZB 4KKJA 2BT6A 2ZW0A 1C3TA 4P1CC 2JX5A 4MELA 2KC2A 1EM7A 3DPDA 4RH6A 1L0YB 2JY6A 1WX7A 1PYWD 3TCAA 1TS4A 3CF6E 2JT4B 2LI5A 4EZJA 2D5GA 2CU3A 3BVMA 3WCQA 3P4RB 1ZXHA 3CIRB 2HTME 1OTRB 2SAKA 4YSYB 2C7HA 3LXFA 3W5UB 1G6JA 3KW5B 3H7SA 1K51A 4C7ZA 5FK9C 5G2NA 3B0AA 2YLMA 3JVZX 2LMCA 2ICIA 3A4RA 3LB8C 2KDEB 4HPMB 2XNAC 1TKEA 2V4LA 2LGSA 2KMMA 2C60A 4ICUA 2JSVX 4AJYB 3V60A 4AJWA 1V86A 2KO3A 4W9CA 4BKSD 2L83A 3Q3JA 4KIKB 4KDIC 5J17A 2WHIA 2O2VA 2VH1A 2MJ3A 3ENEA 3DBRI 2K0PA 1IUEA 4NQLB 1IBXA 2XK5A 3ZJVA 1SSNA 4URKA 1XXGA 4W9GA 3IG3A 4YT0B 1SB3C 2J7QB 1FPYA 2NTSA 2R61A 1NI2A 2M0XA 4NJ6A 3S2AA 1HEZE 3VH4B 3PREA 5D2MB 2NBVB 2KDIA 1QILA 4RF0A 3VHTC 1H4RA 2NPTB 4ARCA 4ASWC 1XF5L 1T6BX 3DHIC 4RNAA 3ZNZB 4LNIA 2CHZA 2M0AA 3B2FA 1WZ0A 1GC7A 3W5VB 1LXDA 1XLNA 2X38A 3VTWA 4L23A 4K3CA 5FR6A 3BVGA 2RPVA 3AULA 1E8YA 1P3QU 2CKHB 4NY0A 4C4VA 1XLPA 3EFCA 3BZDB 1L4ZB 3AEAB 3ALBA 1FCLA 2FAZA 1XCQL 4HWIB 1WRIA 1L6UA 3PPAA 3V62A 3LDZE 4BVUC 4A9AA 2KHWB 1K53A 3ZVVA 4TKNA 2ZJDA 1R4NI 4K7UA 4S0RA 2LUMA 2LASA 3A4SC 3ZUNA 3HUIA 3TL5A 4LJPB 3H9DA 1GJZA 3RNAC 2IPKD 1YX6B 1NYRA 2EMTA 2KVRA 2RGFA 4P7IA 3KH0A 1QF6A 3AU5A 3RULA 1KF6B 1IGDA 3PRZA 1C4AA 2H89B 3U52E 4UDUC 2BB5A 1I4PA 2FCMA 1CZPA 1H8CA 2N9EB 2IGGA 4AWJA 1C9FA 4EZLA 5EDSA 2PKOA 2LWPA 3DBHI 3K9OB 1D5MC 2HJ8A 3A1QA 5H92C 5J18A 2K3UA 3GS2A 2IY0B 4F7ZA 4B0EA 2INPE 2WDQB 4MSQB 3NVVA 4US9A 4PS3A 2DAJA 1F52A 4MJSA 1QOAA 2I2YA 2CJOA 4IWPA 3GE3C 3DVNV 1T5XD 3UQAA 3D32A 1A5RA 2BYEA 3AE2B 4OVVA 2WXHA 1JRPA 1OEYJ 1YMHE 4M02A 3AECB 1LO5D 3BINA 3K9PB 2FIDA 1WGDA 4GXBA 1EU4A 1VZ7A 1KTKA 4N6EB 3C8YA 2BS3B 4G50A 2D3AA 1ISNA 3PHXB 1EUVB 2KN5A 2W54A 2LGDA 2M8SA 2WDRB 2ZCBA 1YQ4B 3OG5A 1PDXA 1Y8RC 2KDBA 2ZVOA 3MC8A 4JL9A 4RGOS 4K1RB 2C7NB 3AI5A 2J52A 4WWMA 5BMGA 1HTQA 4JGHB 3SEBA 1D4BA 2W55A 2D3GA 5IAAC 2KQ7A 3Q8CA 1YN4A 2LFIA 3VR8B 2RMMA 1T3QA 3VFKA 3Q8BA 2INCC 1JWAD 3B2GA 5FR3A 5BMHA 2BS4B 5CHFA 2JU6X 5I4DA 3AE3B 4C56C 1N61A 1CMXB 1QT9A 3R8BA 1V1OA 3W1YA 3O65B 3HRDD 2RPQA 3I3TB 1J7AA 3Q3MC 5BYRA 1FO4A 5BO4B 3RFZB 3FILB 4REZA 1F0ZA 2MBOA 1J7BA 1IP9A 1PFDA 1WGRA 1J8CA 3Q8EA 2N7EA 1YN3A 2QILA 3PGEA 4IM2A 2IY1B 1AN8A 4GDKB 1L7YA 3W1SA 4N58A 3TEWA 1SBBB 4OW0A 4KIKA 2MBHA 1S1QB 2B76B 4XDDA 2WWZA 4LNKA 2RDGA 1KM7A 2GBNA 1YOVB 2KQ4X 2M1MA 2KTRB 3AMZA 3P4PB 4P6VF 1JWSD 1XLQA 1XCTL 2LGXA 1L4DB 5AUIA 2N4FA 1D5ZC 2JYEA 3QHTA 4W9LA 2RR9A 3TUOA 2MBBB 3ZDMC 3ML8A 2M17A 1P7FA 3R2IA 1WGHA 4DXFA 2NPTA 5HFYA 4JQWC 3MTNB 1FD6A 2NVUI 2OEDA 1Y56A 1ESFA 2NTTA 4ANUA 3JW0X 2K6QA 1MJDA 4ICVA 3EFUA 2K6DB 1GB1A 4IW0A 2WXRA 2OHFA 3QQ8B 5LNK1 4CQNA 3IVFA 1GUAB 3DOWA 2J0MA 3AM9A 4KKIA 1WY8A 1PUTA 3A9KB 2IGHA 5D3DA 3KWVA 3CSTA 3IT6B 4HVBA 2QHOA 2BBCA 5HI1A 3DBLI 2LVQA 5G55A 1J19A 2MLBA 5EE0A 2MEKA 3HM6X 2CR5A 3Q3NC 1CQVA 1FFUA 1OQQA 1B1ZA 3EGRA 3Q8AA 1XD3B 1GOZA 4B6WA 3NZSA 1E5WA 3DHHC 4PYUA 2BF8B 3TIXA 3ZXRA 2DAFA 5DPWA 4FJYA 4IWOA 1TGZB 1MHHE 4HXDA 4WJQA 1UNSA 3AV8A 1EF1A 1ET9A 1RLFA 3L54A 3KVFB 2WXPA 3WALA 5IO9A 1YIWA 2CHWA 2NBUA 4H2AA 4TQ0A 4EOYA 1SE9A 3QIJA 4FN2A 2D07B 5J2RA 1RM6C 1SEBD 2N1WA 2N9LA 1LFDA 3PZDA 4XZ4A 4DXAB 2MBQA 3KYCD 4W9EA 1BMLC 3WAPA 4HLEA 3PHWB 1FNVA 3FKYA 2N9PC 1QKZA 5BYSA 2HDEA 3BK1A 3J9CA 1WWTA 4LLGM 4PK1A 1BT0A 2PLPA 4MDKE 1QOBA 1CK1A 1RFKA 2PW9A 3URYA 1MG8A 4A55A 1I42A 3P63A 3VUYA 1STEA 3N3KB 1FNWA 2KZRA 4W9KA 3NJTA 1E7PB 1MI0A 4GIVA 2AYOB 3Q14C 2HJ1A 3IAS1 4TQ1A 2C5LC 1N5WA 3OLMD 4J3OD 2INNE 1T0YA 2YEPF 4PT5A 2AEHA 1V97A 3ML9A 2DBYA 3B08A 2DYBA 1KRHA 2DYMA 3N20C 2FBWB 3DVGY 3E56A 4EZKA 3DVGX 2J42A 2KDFB 2GBRA 4KZ0A 1E8XA 4BZAA 1F77A 3AE7B 1HE8A 2AQ2B 3ZNID 2DZKA 3WAOA 2V0GA 3C0RB 5G5HA 3EA6A 3PLUA 3RCZA 2Y3AA 4GOCA 4GDLB 4EKUA 3H7PB 1ENFA 3NRZA 3M63B 1YJ1A 1K52A 3UIPB 1FNUA 4E74A 4RGNA 1DOYA 2AQ1B 3ZYYX 2KYWA 2GRIA 4KZCA 1HZ5A 1WXMA 1ACCA 2ONQA 3M3JA 2KANA 4JLCA 1WJNA 3UF8A 4HROA 3FILA 3IHPC 2LRWA 2CU1A 2JWZA 2KC1A 2CJNA 4LJOB 2ZZPB 3RYTA 1FRDA 2BGFA 4HRSA 1LQBA 1GC6A 4KV2A 2KLCA 4GDKA 3CMMB 2ZCCA 4GN1A 3WIMA 5LXIB 2GLSA 3BY4B 4A20A 3VUXA 1ZPSA 1YQBA 4NZLB 2G45B 2ASQA 4WAAA 5LLIA 4DXGA 2D3CA 3EUB2 1PGXA 3VAWA 1TZ1A 2BPSA 5JH5C 4FHJA 4ITKA 5AUKA 2HE7A 2QMTA 2KTRA 2MA9B 1QOFA 4OZCA 3NG0A 2J0KA 4KX6B 2ON8A 4F8CB 4ZRJA 1SF0A 2KDMA 2MJDA 4O1NA 4W9IA 1MFWA 1WX8A 3BYTB 3C19A 1YQ3B 2BVCA 3BWUD 1P9DU 2FUG1 2K5PA 3ZJTA 4C80A 3DDCB 2AWTA 4A3OA 4BKTA 4MSMB 1TZOA 1JROA 3V61A 3GZNB 5IKCM 2BS2B 2MWSB 4IWQA 2L32A 3BYYB 4NAWB 4ZRIA 2KWCA 3O13A 3Q2AC 3ZLZA 1VRAB 1R7SA 3Q3FA 1UF0A 1L0VB 2DZMA 1RYJA 1NI3A 3DQVA 1E6EB 3RNBC 3A9KA 2KOXA 5T8IA 1KFYB 2BKFA 1AW7A 1GNUA 4YWGG 2PVGC 3NOBA 1R4MB 4OHJA 3RN9C 5DPSA 2JQRB 4XC2A 4ANXA 2G3QB 4ACFA 3B1LX 1JWUD 3TSSA 4MACA 1WZ3A 3P4SB 2HTHA 3AH7A 3PVLA 2WDTB 5C1ZA 1K8RB 2LEKA 3P1MA 4BBNC 2WXLA 4DHZB 4GU2A 3A9JB 2L76A 4OZBA 1N5XA 4CO7A 3WAMA 1E10A 4XWTA 1UBQA 4RM9A 1SE2A 4M01A 4MH8A 1WGYA 1WM3A 4HKZE 1N62A 1J7CA 2RSUA 4MEMA 1IYFA 1IPGA 4HKQA 4IDIA 1ZUD2 3IT4B 1N60A 3RPFC 2E6XA 4TSSA 1L5PA 3AEGB 3NS1A 1ET6A 2ZNVB 4N59A 3L08A 4HJGE 5JHBA 3M95A 2DZJA 1KJTA 2BYTA 2K1FA 4B0MA 3X0WA 3QA8A 5D94A 2NBWB 4ZRKA 3T8MA 4JIOU 2IYDB 3FAHA 5AZGA 2FCQA 1NYQA 2IJ0A 3U30A 1F1HA 2OJRA 2FCSA 4K81A 1UZXB 5L83A 1V5OA 2QC8A 3N30A 1EWCA 1WMHB 3AB5A 5EE9A 4IOIE 4PYZA 5AZFA 4BAXA 2M56B 4HCPB 2JUOA 3ECIA 4CYEA 4J6IA 2EKIA 3AE8B 4YXDB 2ZVNA 4FADA 2PE6B 1JRUA 2EELA 2L1AA 3NHEB 2V3PA 4PS8A 4FJZA 5C3JB 3P4QB 2PVOD 4LTUA 3AE4B 2MHJA 2LHEA 3R2TA 3VTVA 3PLVA 2FIFA 2KJHB 2L05A 3NVYA 2X8XX 1M94A 3OAWA 1I4RA 1WR1A 3NZUA 2SEBD 2JPHA 3AU4A 4GDLA 4KGTA 4A6QA 2IO3B 3H7PA 4E71A 2KWUB 2FNJB 1E8ZA 1TY2A 5TR5A 3Q3OC 2QEJC 4OZAA 4WAFA 5IP4D 4ZHPA 2ZPNA 2KWDA 3PRMB 4WJNA 1C78A 3PZ8A 2IO0B 4A3PA 4DWFA 4GSWA 1QOGA 3OJ4B 4P16A 1BUIC 2KK8A 3BK2A 4IG7B 4YTNB 1WH3A 3KWLA 4BOZB 2WXIA 1F9JA 2WX0A 4US8A 3RI7C 2VZKD 5C23A 4DK5A 4YTPB 4RCOA 1Q0WB 3GZNI 3QCAA 3AEEB 2K25A 3V6EB 1EU3A 1S3SG 3VRAB 5IA7A 3IXSA 3RNFC 2BW2A 1PQSA 2JF5A 2RD0A 4B95A 1WJ6A 3KUDB 3JSVB 2GBKA 1GG3A 3HVDA 2V3NA 2KLGA 1TT5B 1JCKB 1NVID 3DVNU 5E6NA 4TV3A 1VLBA 2N0SB 2Z0EB 1R4MI 3B9JA 3V6CB 3PS6A 4BBNF 5TSSA 2QCZA 2KVZA 2MW5A 2NR2A 2LHDA 1E0ZA 3NUHB 1A70A 1TKGA 2KN4A 1I35A 2L0TA 2KD0A 4KDLB 1HXYD 1SE4A 3TBLD 1HA5A 1SJHD 2DWQA 2KX0A 2LRUA 3X23A 1V2YA 3RMKC 3U4EG 1T0RC 3ZDTA 1D6EC 2WDVB 4XYCA 2NMQA 3P42A 3ZGZA 1FRRA 4RM8A 5JHAA 1PGAA 1VD2A 2KJ6A 2KAJA 2NS5A 2MH7A 3M62B 4FA6A 2KNBA 4M0WB 2PE9A 3BIID 1EF5A 3RUIB 4MGYE 4K3BA 1GPXA 1IGCA 1V5TA 1WM2A 2K8HA 5FKAC 4ZOHC 1V1PB 4RFBA 3A9JA 3AEFB 3DBRB 1BXTA 1V81A 2LVOA 1I7HA 4AS1A 4MT5A 3U8ZA 2BWFA 3ZRFA 1DOXA 4IKGA 1YX5B 2TSSA 4K7SA 2JZPA 1KLVA 2N7JA 1FXTB 3KUCB 2WXFA 4ZDVA 3DBSA 1V8CA 2O6VD 5GMVA 1YJJA 4HJKA 3OWEB 4IC7B 1WGKA 2AL6A 2MQJA 2K22A 5D3IB 1WI0A 4HPPA 3GB1A 2LVPA 3RNEC 1V9JA 1RRBA 2BKRB 4WQMA 1LM8B 2WXJA 2BTEA 1MPEA 2PMVA 1F2RC 2G4SA 1HTOA 5DPRA 4N9F4 2VH2A 1NDDA 1I4GA 2OJWA 1WYWB 4AUQC 1UD7A 2H88B 1ZDVA 1JMLA 3PO0A 4W9HA 4I6LB 2D2QA 4MGZE 5AEKB 2WXOA 2EKEC 1E9MA 1WMHA 4WIPA 1YNTE 3N1YC 1FCCC 1B9RA 3TEYA 3A1QB 2V3SA 4MGIE 3EHVA 1R4NB 3CWIA 1DGJA 3ZTCA 4W9DA 4EUTA 1WF9A 5CHWA 3KUZA 4XWWA 2XN9C 1WX9A 3ZKJC 1L2NA 1YN5A 2M4NA 3MJWA 2E3TA 1XEEA 3L4PA 3IFWB 4AP4C 3EECA 1ZXIA 4KGRA 4LCDE 3RT3B 4MJSB 5CX3A 2JZZA 4XDCA 2I38A 1JW9D 3ZNGC 1FMAD 3LYYA 2B3AA 4GGQA 1SIJA 4W9JA 2WXQA 5EE1A 2ZNVC 5L95C 2R2OA 2GI9A 2KT7A 3R7RA 2INDC 1N6ZA 3UI3A 1OEYA 3RNGC 3RD2A 1UUPA 3GOEA 1P0RA 2LUEA 3R7QA 2K8BA 1WXAA 4USAA 4WJPA 2N9KA 3N1ZC 4KSLC 2WXGA 3ZW3A 3Q69A 4NQKE 4ARIA 3BVZA 1TS5A 1RFAA 2QDFA 4C00A 4ZHOA 3U2SC 5JZEB 1XLOA 1VDVA 2JXXA 4CHKA 4MM3B 2MJEA 2LGIA 3MHZA 4DHJD 2R2QA 3QARA 1QQRA 1WGGA 2LXCA 2WXKA 3IAM1 1OGWA 2IBIB 3QK0A 2EMSA 2VZKB 4IUMB 1JALA 5JXVA 4LDTD 3MC0B 1JQ4A 2WNMA 2G1EA 3LJ3A 5G5GA 5E6PA 1WJUA 2DHZA 2A5UA 1LGRA 3TJPA 1NENB 1UWMA 4BKSA 3JSVA 3MC9A 4XE0A 1UELA 4NAMA 1KH0A 5LXHA 2FUHB 3QC8B 1SE3A 1UGMA 2MP2B 2V1YA 2V4IB 3HM3A 4FLHA 1T0QC 5E6JA 1Q5WB 1SIFA 5HHDG 2DYOA 5CHVC 4EE2A 4PS7A 1M4VA 1Q10A 3RNCC 3GP7A 4ANVA 4OVZA 1WRDB 4RMAA 3VH3B 4KGSA 1TY0A 2KKCA 2D11A 1TTNA 4FULA 1E7VA 2A4ZA 3Q6BA 1I4QA 2XEWA 1L0XB 4TMAB 2PPHA 4DDID 4WURA 4RF1A 1TIFA 4LNOA 4I6NB 5GXGB 2CS4A 1FXIA 4JWUC 3L17A 4NPNA 1C4CA 3I5JC 3KQ4A 5MPOA 4MH0E 1KOTA 3TEXA 1AYFA 4JX1C 1Z5SB 1WYGA 3A33B 1DOIA 4XX5A 4M0WA
chains in the Genus database with same CATH topology
1JWMD 1I4RA 2WS3B 1TYGB 1PUTA 2IGHA 5D3DA 1VZ8A 3KWVA 4JWSC 1KLUD 2SEBD 1KLGD 3IT6B 3NZ3A 2BBCA 5HI1A 4KGTA 1TS2A 4A6QA 1QLBB 1V1PA 2ACZB 4KKJA 1NEKB 5EE0A 2MEKA 2BT6A 3ETRA 2ZW0A 2JXTA 3I57A 2JX5A 1CQVA 1TY2A 1FFUA 1OQQA 2Y5PA 1B1ZA 3I9V1 3MFGA 3EGRA 3Q8AA 2QEJC 1EM7A 4OZAA 4WAFA 1GOZA 2W82A 4ZHPA 4RH6A 3AEBB 2KWDA 1L0YB 1PYWD 1TS4A 3H8HA 2WP9B 1C78A 3PZ8A 2RDHA 2D5GA 2CU3A 1WSPA 3BVMA 3VQIA 3WCQA 1QOGA 1UWXA 4P16A 1BUIC 3P4RB 1FFVA 3BK2A 1ZXHA 4ZYSA 3CIRB 4YTNB 2HTME 4JPSA 2SAKA 1MHHE 3KWLA 1UNSA 2WXIA 4YSYB 4C7YA 3LXFA 3W5UB 3AV8A 4US8A 2VZKD 1ET9A 4D2KA 4YTPB 1K51A 1K50A 4RCOA 2WXPA 4C7ZA 5FK9C 3AE9B 3AEEB 4H2AA 4TQ0A 1DYQA 1EU3A 3VRAB 3IXSA 2LMCA 3W9CB 2ICIA 1RM6C 2M19A 1SEBD 3LB8C 2BW2A 2WLBA 2BB6A 2KACA 2N9LA 1ROEA 5BMIA 2ZW1A 2XNAC 1TKEA 1BMLC 2K9XA 3HVDA 1FNVA 2KMMA 5BYSA 1QKZA 2V3NA 2HDEA 3BK1A 1JCKB 1NVID 3J9CA 1WWTA 4LLGM 1VLBA 2JSVX 2N0SB 2PLPA 2WU2B 1QOBA 3B9JA 2L83A 1CK1A 1FXAA 1RFKA 2PW9A 4YSXB 3URYA 5TSSA 4A55A 2MJ3A 4DQOC 2K0PA 3P63A 1IUEA 3Q8FA 1IBXA 1STEA 1VR9A 3ZJVA 1SXTA 1SSNA 2LHDA 1FNWA 1XXGA 1E0ZA 1TS3A 3NUHB 1UGJA 1A70A 4YT0B 3TEZA 3NVZA 1SB3C 1TKGA 2KN4A 4FXCA 2NTSA 2R61A 1E7PB 1MI0A 4LK0M 1HEZE 3IAS1 4TQ1A 2J4XA 1N5WA 1HXYD 3MJ5A 1SE4A 3AN1A 4J3OD 1FM0D 1HA5A 1QILA 4RF0A 1SJHD 5EE3A 2DWQA 2INNE 4ARCA 1XF5L 1T6BX 1OFFA 2YEPF 4PT5A 4AQ7A 4RNAA 3U4EG 1MHXA 1V97A 1D6EC 1RWSA 2DBYA 2M0AA 2NMQA 2WDVB 3B2FA 3P42A 1KRHA 2DYMA 3ZGZA 1FRRA 1PGAA 2FBWB 5BYQA 3W5VB 1XLNA 3E56A 2X38A 1I4HA 2Q5WD 4L23A 2KAJA 1C76A 2MH7A 2J42A 3E9SA 4ZRPA 3BVGA 1F77A 1AWDA 2RPVA 4YSZB 2DLBA 3AE7B 2AQ2B 5C2TB 1C77A 3BIID 2V0GA 1XLPA 5G5HA 3EA6A 1ZDXA 3BZDB 2FE8A 1GPXA 1IGCA 1L4ZB 3AEAB 2Y3AA 1FCLA 3SR6A 1XCQL 2PTLA 4GDLB 1WRIA 2LJIA 1V1PB 4RFBA 4ZOHC 5FKAC 1L6UA 1ENFA 3NRZA 3AEFB 1C4PA 1BXTA 1I7HA 1K52A 4A9AA 2IGDA 4AS1A 4MT5A 1FNUA 1K53A 4RGNA 2IDYA 1DOYA 2AQ1B 3ZYYX 1DOXA 2GRIA 2LUMA 4IKGA 1MVKA 1HZ5A 1TJEA 1ACCA 2ONQA 2TSSA 1FEHA 2JZPA 3T3OA 2N7JA 3HUIA 3SFDB 5H8YE 2WXFA 1C79A 4HROA 3FILA 3V05A 1V8CA 1YJJA 3FC4A 2IPKD 1PGBA 3AE5B 3OWEB 1NYRA 2CJNA 1WGKA 4HEA1 3NVWA 1QF6A 2K22A 1L6VA 1FRDA 4HRSA 2WQYB 1KF6B 5D3IB 3GB1A 1IGDA 1C4AA 2H89B 4WQMA 3U52E 3V3XA 4UDUC 2BB5A 1I4PA 3VR9B 1CZPA 1VZ6A 2WXJA 2BTEA 1MPEA 1ZPSA 2PMVA 1FIQA 4NZLB 2QSDA 2IGGA 1F2RC 1C9FA 4DXGA 3W2DA 2PKOA 1PGXA 3ABVB 3EUB2 1F2RI 1I4GA 2JYTA 2H88B 1ZDVA 4ITKA 4RGTA 1TKYA 5AUKA 1JMLA 2QMTA 1D5MC 3PO0A 4YTMB 5H92C 1QOFA 4OZCA 2K3UA 3GS2A 4KX6B 2JWUA 2G9HD 2ON8A 2WXOA 4B0EA 1E9MA 1SF0A 2KDMA 2MJDA 4WIPA 4O1NA 2INPE 1YNTE 2WDQB 2WXMA 3NVVA 4US9A 1FCCC 3BYTB 1B9RA 3TEYA 4Q2JA 1YQ3B 3CWIA 4GLSC 1DGJA 2L52A 3BWUD 2FUG1 2K5PA 3ZJTA 1IBXB 1ZE3D 1QOAA 2XN9C 4C80A 4XWWA 2I2YA 1YN5A 2CJOA 3T3NA 1TZOA 2E3TA 1XEEA 1T5XD 1I4XA 3L4PA 1JROA 3AE2B 4ZRQA 1XO3A 2WXHA 1JRPA 2BS2B 1ZXIA 4KGRA 1YMHE 2L32A 3BYYB 4NAWB 4XDCA 2I38A 1JW9D 1HQRD 3O13A 1HZ6A 1VRAB 1R7SA 3AECB 1FMAD 1LO5D 3LYYA 1L0VB 1SIJA 5EE1A 2WXQA 4A8XC 1RYJA 1NI3A 4L2YA 1EU4A 2GI9A 1VZ7A 1E6EB 1KTKA 4N6EB 3UI3A 3C8YA 5T8IA 2BS3B 1KFYB 2PIAA 1WXQA 2W54A 3AEDB 1UUPA 1AW7A 1JWBD 3HVZA 2WDRB 1YQ4B 4YWGG 2PVGC 4USAA 2Y5CA 1PDXA 3U7ZA 4OHJA 4RGOS 2GB1A 2N9KA 1GB4A 2J52A 4WWMA 5BMGA 2JQRB 2WXGA 3Q69A 4ARIA 1JWUD 3BVZA 3TSSA 1TS5A 3SEBA 1D4BA 4MACA 2W55A 3P4SB 4ZHOA 3AE6B 3AH7A 3U2SC 3Q8CA 1XLOA 1VDVA 1YN4A 2WXNA 4MM3B 2LFIA 2LEKA 1N63A 2MJEA 3P1MA 3VR8B 2LGIA 2RMMA 1T3QA 3MHZA 2WXLA 1SJED 3Q8BA 1JWAD 3B2GA 1N5XA 4OZBA 4JE3B 4R3DA 1QQRA 1E10A 5FR3A 1ZOYB 5BMHA 2BS4B 2JU6X 2WXKA 3IAM1 5I4DA 3AE3B 4C56C 1N61A 4XWTA 1QT9A 1SE2A 3R8BA 1V1OA 2W3SA 2QJLA 4L1BA 2VZKB 1VJKA 4MH8A 3HRDD 1JALA 1J7AA 5BYRA 5JXVA 3PZ7A 1FO4A 1P7EA 4HKZE 3MC0B 1N62A 1JQ4A 2AX5A 1J7CA 2WNMA 3RFZB 2G1EA 3FILB 5HG2A 5G5GA 4REZA 4HKQA 1F0ZA 2Z8LA 1J7BA 4IDIA 1ZUD2 3IT4B 1N60A 3RPFC 2E6XA 3N9YC 4TSSA 1PFDA 1NENB 3Q8EA 1L5PA 1OQRA 1UWMA 3AEGB 5D7GA 1YN3A 2QILA 4XE0A 3NS1A 1AN8A 1ET6A 3AE1B 4N59A 4GDKB 4HJGE 4NAMA 3W1SA 1KH0A 2QIEB 2BYTA 1SE3A 4N58A 4B0MA 3TEWA 1SBBB 4OW0A 2V4IB 2B76B 4XDDA 2AQ3B 3MP9A 4NJCA 3FAHA 5E6JA 2RDGA 1NYQA 5HHDG 1EWYC 2IJ0A 2DYOA 2W3RA 4EE2A 2KQ4X 3AMZA 1M4VA 3P4PB 1JWSD 4P6VF 1Q10A 3DWGC 1XLQA 1XCTL 3GP7A 1L4DB 4OVZA 4A90A 1YJIA 5AUIA 1D5ZC 2JYEA 1EWCA 4KGSA 3SFEB 3AB5A 1TY0A 5EE9A 4RGMA 4IOIE 3TUOA 2M56B 4WH4A 1P7FA 2WU5B 3R2IA 2EKIA 1CJEA 3AE8B 4YXDB 4DXFA 5HFYA 2EELA 1I4QA 2L1AA 3KLSX 1L0XB 3ZJUA 4TMAB 1FD6A 2V3PA 4WURA 2OEDA 1Y56A 4RF1A 2J53A 1ESFA 2NTTA 5GXGB 5C3JB 3P4QB 3VRBB 2PVOD 1D5XC 4LTUA 1FXIA 3AE4B 3DWMA 4JWUC 1ZP0B 2LHEA 3ZQ4A 1C4CA 3R2TA 3KQ4A 1GB1A 5MPOA 1GAQB 2WXRA 2OHFA 5LNK1 4CQNA 3TEXA 1AYFA 4JX1C 1WYGA 2YEPB 3AM9A 1DOIA 4KKIA 3NVYA 4M0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SB3 C;  1TKG A;  4FXC A;  3AE3 B;  1N61 A;  2WS3 B;  1TYG B;  1QT9 A;  2W3S A;  1PUT A;  2PKO A;  2QJL A;  1E7P B;  3ABV B;  3EUB 2;  1VJK A;  4JWS C;  3HRD D;  2H88 B;  4ITK A;  1JAL A;  1J7A A;  4YT0 B;  1N5W A;  1TKY A;  5AUK A;  3AN1 A;  1FO4 A;  1FM0 D;  1QLB B;  2ACZ B;  3PO0 A;  4YTM B;  1N62 A;  1JQ4 A;  2AX5 A;  1J7C A;  1NEK B;  5EE3 A;  5EE0 A;  5H92 C;  1QOF A;  2DWQ A;  2G1E A;  2BT6 A;  3ETR A;  5G5G A;  1F0Z A;  1J7B A;  1OFF A;  2JX5 A;  4IDI A;  1FFU A;  1OQQ A;  1ZUD 2;  4KX6 B;  1N60 A;  3RPF C;  1PFD A;  1E9M A;  1SF0 A;  1NEN B;  2MJD A;  1L5P A;  2WDQ B;  1OQR A;  1UWM A;  3AEG B;  4ZHP A;  3AEB B;  3NVV A;  1V97 A;  4US9 A;  1RWS A;  2WDV B;  2DBY A;  3B2F A;  1B9R A;  1KRH A;  1YQ3 B;  3NS1 A;  1FRR A;  2WP9 B;  3AE1 B;  4N59 A;  3CWI A;  2FBW B;  3W5V B;  3NVY A;  1XLN A;  1DGJ A;  2L52 A;  2Q5W D;  2KAJ A;  2CU3 A;  2QIE B;  2K5P A;  3WCQ A;  1QOG A;  2MH7 A;  1QOA A;  3P4R B;  4C80 A;  4N58 A;  1FFV A;  1QF6 A;  3CIR B;  4YTN B;  2CJO A;  2HTM E;  1AWD A;  4YSZ B;  3AE7 B;  2E3T A;  3L4P A;  3KWL A;  2B76 B;  1JRO A;  5C2T B;  3BII D;  1XLP A;  4YSY B;  3AE2 B;  1XO3 A;  3FAH A;  3LXF A;  1JRP A;  3AV8 A;  5G5H A;  2BS2 B;  3W5U B;  1ZXI A;  4C7Y A;  4US8 A;  1GPX A;  1NYQ A;  3AEA B;  1EWY C;  1JW9 D;  2W3R A;  3SR6 A;  3AEC B;  1R7S A;  4YTP B;  1WRI A;  3AMZ A;  4ZOH C;  3P4P B;  1FMA D;  1L6U A;  4P6V F;  4C7Z A;  1L0V B;  3AE9 B;  3AEF B;  3DWG C;  3NRZ A;  1XLQ A;  3AEE B;  4HRS A;  1SIJ A;  5EE1 A;  1I7H A;  1RYJ A;  1NI3 A;  1YJI A;  5AUI A;  4A9A A;  3VRA B;  3W9C B;  1E6E B;  4N6E B;  1RM6 C;  2M19 A;  1DOY A;  3LB8 C;  2BS3 B;  1KFY B;  2PIA A;  4LTU A;  3SFE B;  3AB5 A;  5EE9 A;  3ZYY X;  1WXQ A;  2W54 A;  2WLB A;  3AED B;  1DOX A;  1ROE A;  1TJE A;  3HVZ A;  1JWB D;  2M56 B;  1TKE A;  2WDR B;  1YQ4 B;  2K9X A;  2WU5 B;  3HUI A;  2PVG C;  3SFD B;  2EKI A;  4USA A;  1CJE A;  3AE8 B;  2Y5C A;  4HRO A;  5H8Y E;  4YXD B;  2KMM A;  1NVI D;  1PDX A;  4YSX B;  1V8C A;  1WWT A;  1VLB A;  2N0S B;  1YJJ A;  3FC4 A;  4WWM A;  2JQR B;  3AE5 B;  2WU2 B;  1NYR A;  2CJN A;  1QOB A;  3B9J A;  1WGK A;  3NVW A;  2L83 A;  5GXG B;  5C3J B;  3P4Q B;  3VRB B;  1FXA A;  2PVO D;  1RFK A;  1L6V A;  1FRD A;  2K22 A;  2W55 A;  3P4S B;  1FXI A;  2WQY B;  1KF6 B;  3AE4 B;  3AE6 B;  3AH7 A;  1ZP0 B;  3DWM A;  4JWU C;  4ZHO A;  2H89 B;  2MJ3 A;  1XLO A;  1VDV A;  4WQM A;  2LEK A;  1N63 A;  2MJE A;  3P1M A;  1CZP A;  3VR8 B;  3VR9 B;  3P63 A;  1IUE A;  5MPO A;  1T3Q A;  1GAQ B;  2OHF A;  1JWA D;  3B2G A;  1N5X A;  1FIQ A;  1AYF A;  4JX1 C;  1WYG A;  3AM9 A;  1E0Z A;  1DOI A;  1E10 A;  1ZOY B;  1A70 A;  3NVZ A;  2BS4 B; 
#chains in the Genus database with same CATH topology
 1JWM D;  2WS3 B;  1TYG B;  4BFR A;  3PT2 B;  1QZE A;  4LNN A;  3SHQ A;  3MHS D;  1KLG D;  4TUU A;  1TS2 A;  2KFK B;  1QLB B;  1V1P A;  3P2B A;  4KVG B;  1NEK B;  1MG4 A;  3ETR A;  4XGA B;  4EFO A;  1P1A A;  3QJZ A;  2JXT A;  3I57 A;  2Y5P A;  2Z0D B;  3I9V 1;  3MFG A;  4FHK A;  5KHQ A;  2D10 A;  2W82 A;  1XQQ A;  3AEB B;  4YL8 A;  2LXA A;  2BWE S;  2MCN B;  2Y5B B;  3H8H A;  2WP9 B;  2RDH A;  2O6V B;  4WQO B;  1WSP A;  3VQI A;  1UWX A;  2JRH A;  1FFV A;  4ZYS A;  1V49 A;  1E90 A;  4JPS A;  3VDZ A;  3NY5 A;  4C7Y A;  1C1Y B;  3VVW B;  4D2K A;  1K50 A;  2XBB C;  1EO6 A;  3AE9 B;  4K7W A;  3UQB A;  1DYQ A;  4II2 B;  3W9C B;  2L00 B;  2M19 A;  3HHM A;  2WLB A;  2BB6 A;  2KAC A;  5BMI A;  1ROE A;  2K8C A;  2ZW1 A;  1WFY A;  2IO2 B;  2K9X A;  2N7D A;  3DBL B;  1Q1O A;  3ZO5 B;  3DCG A;  2WU2 B;  2BYV E;  1FXA A;  4DBG A;  4YSX B;  4B9K A;  4DQO C;  1YD8 U;  4EEW A;  3PRP B;  4KSK C;  3Q8F A;  2GMI C;  1VR9 A;  1SXT A;  1V6E A;  4M8M A;  3RZW C;  1XT9 B;  4NJ7 A;  1TS3 A;  1UGJ A;  3TEZ A;  2KFJ A;  3NVZ A;  4HK2 A;  4FXC A;  2GOW A;  1T0S C;  2UYZ B;  1TBE A;  4LK0 M;  2J4X A;  3MJ5 A;  3AN1 A;  5AZH A;  3ZIM A;  1FM0 D;  2DZI A;  5EE3 A;  2C9W B;  2C7M B;  2N1V A;  1OFF A;  2KTF A;  2LJ5 A;  4AQ7 A;  2L7R A;  3RZF A;  3R3M A;  2I1K A;  3JYU A;  1MHX A;  3ZXV A;  1RWS A;  1V80 A;  2HD5 B;  5BYQ A;  1I4H A;  3VTU A;  2Q5W D;  3VXW A;  1C76 A;  1WE7 A;  3E9S A;  4LNF A;  3IBE A;  4ZRP A;  1AWD A;  4YSZ B;  2DLB A;  1RAX A;  5C2T B;  1C77 A;  1ZDX A;  2FE8 A;  4MM3 A;  3QX1 A;  3SR6 A;  2PTL A;  4WWP A;  2LJI A;  1WXS A;  4DHJ B;  4I6P A;  3ONS A;  4HDO A;  1C4P A;  4M00 A;  1UH6 A;  4AOF A;  2IGD A;  1OQY A;  1WE6 A;  2IDY A;  1X1M A;  1MVK A;  1TJE A;  2IO1 B;  1FEH A;  4BKG A;  4LDT B;  3T3O A;  3SFD B;  5H8Y E;  1C79 A;  3V05 A;  3WA0 A;  4IM0 A;  3OJ3 A;  3FC4 A;  1PGB A;  3AE5 B;  4HEA 1;  3NVW A;  3SD5 A;  1L6V A;  2WQY B;  3GE8 C;  2MSE D;  3V3X A;  3T9L A;  1WJ4 A;  4G3X B;  3VR9 B;  1VZ6 A;  4G0N B;  4W9F A;  2KXJ A;  2L8J A;  1FIQ A;  3ZTD A;  2QSD A;  3H6N A;  3N1X C;  2MP2 A;  3W2D A;  3QAQ A;  3EC8 A;  3ABV B;  2RDB C;  1F2R I;  1P98 A;  2JYT A;  4RGT A;  1TKY A;  3UGB B;  4YTM B;  4X57 B;  2VRR B;  3HK0 A;  3DHG C;  2JWU A;  2W9N A;  2G9H D;  4NNJ B;  2I1J A;  4ANW A;  4HCN B;  5CTR C;  4II3 B;  2WXM A;  3PSE B;  3PV1 A;  2PEA A;  4Q2J A;  2NCN A;  3SDL C;  5DCN A;  2O2V B;  3SU8 X;  4GLS C;  3L10 B;  1WR6 E;  2L52 A;  4NAW A;  4P1B C;  2DEN B;  1IBX B;  2XK5 B;  1ZE3 D;  2L0F A;  2AL3 A;  5DPT A;  3T3N A;  2WGS A;  2UWQ A;  1AAR A;  3AXC A;  1I4X A;  5HKH A;  1VCB A;  4DHZ E;  4S17 A;  1XO3 A;  4ZRQ A;  5IOI A;  3PTF C;  1E8W A;  1SGH A;  4GMV A;  2V9H A;  4IM3 A;  1HQR D;  2N9X A;  1HZ6 A;  4HPL B;  1ZW7 A;  3APD A;  4A8X C;  2BQQ A;  2KX3 A;  4L2Y A;  1WXV A;  1WIA A;  2PIA A;  3NS8 A;  1WXQ A;  3AED B;  2BYF A;  1JWB D;  2G4D B;  3HVZ A;  4OVU A;  2KFK A;  4E3C A;  2K39 A;  2Y5C A;  3H1U A;  4MGK E;  3L13 A;  3HIZ A;  3U7Z A;  2GB1 A;  3W1S C;  1GB4 A;  2PJH A;  5IN7 A;  2MBE A;  4G11 A;  4C4V B;  3AE6 B;  2MRP A;  2GBJ A;  2WXN A;  1N63 A;  2O6V A;  4F1S A;  2YVC A;  1SJE D;  2IZV B;  2WX1 A;  4JE3 B;  4FBJ B;  4R3D A;  3APC A;  1ZOY B;  3WAN A;  2OOB B;  2GBM A;  2W3S A;  1E7U A;  2Z59 B;  2QJL A;  4L1B A;  5KHO A;  3U7D A;  3R66 C;  1VJK A;  1ZKH A;  3TMP B;  2CHX A;  3PZ7 A;  1P7E A;  2FCN A;  2KWV B;  2MX2 A;  2AX5 A;  4QAY A;  5HG2 A;  1NBF C;  2JVC A;  2Z8L A;  2D3B A;  3N9Y C;  1UBI A;  2KMA A;  4WWO A;  3CSF A;  1OQR A;  5D7G A;  4HDQ A;  3ZNH B;  1U4A A;  3AE1 B;  3ZRC A;  2QIE B;  2KMC A;  4M8N A;  5D6J B;  3L16 A;  2LGY A;  3I63 C;  1D3Z A;  1ZGU B;  2AQ3 B;  3MP9 A;  3QWZ B;  4NJC A;  4FJV B;  4ZYN A;  1EWY C;  2W3R A;  2L3Z A;  2J0J A;  2JZ3 B;  3DWG C;  3UIN B;  4DDG D;  4A90 A;  1YJI A;  2ZEQ A;  3N32 A;  3SFE B;  4RGM A;  3APF A;  4WH4 A;  3UIO B;  2WU5 B;  1CJE A;  2REX A;  3KLS X;  3VUW A;  3ZJU A;  4GB9 A;  3KYD D;  2J53 A;  2LD9 A;  3L0W B;  2DNF A;  3VRB B;  1D5X C;  3DWM A;  1ZP0 B;  2KJR A;  3ZQ4 A;  4WJO A;  1GAQ B;  5E6O A;  3DBH B;  2YEP B;  2KQS A;  4BOS C;  2WYQ A;  1J0G A;  4WWN A;  1VZ8 A;  2JRI B;  2ZPY A;  4JWS C;  1KLU D;  2DX5 B;  2UU7 A;  3NZ3 A;  1Z2M A;  2LZ6 A;  2ACZ B;  4KKJ A;  2BT6 A;  2ZW0 A;  1C3T A;  4P1C C;  2JX5 A;  4MEL A;  2KC2 A;  1EM7 A;  3DPD A;  4RH6 A;  1L0Y B;  2JY6 A;  1WX7 A;  1PYW D;  3TCA A;  1TS4 A;  3CF6 E;  2JT4 B;  2LI5 A;  4EZJ A;  2D5G A;  2CU3 A;  3BVM A;  3WCQ A;  3P4R B;  1ZXH A;  3CIR B;  2HTM E;  1OTR B;  2SAK A;  4YSY B;  2C7H A;  3LXF A;  3W5U B;  1G6J A;  3KW5 B;  3H7S A;  1K51 A;  4C7Z A;  5FK9 C;  5G2N A;  3B0A A;  2YLM A;  3JVZ X;  2LMC A;  2ICI A;  3A4R A;  3LB8 C;  2KDE B;  4HPM B;  2XNA C;  1TKE A;  2V4L A;  2LGS A;  2KMM A;  2C60 A;  4ICU A;  2JSV X;  4AJY B;  3V60 A;  4AJW A;  1V86 A;  2KO3 A;  4W9C A;  4BKS D;  2L83 A;  3Q3J A;  4KIK B;  4KDI C;  5J17 A;  2WHI A;  2O2V A;  2VH1 A;  2MJ3 A;  3ENE A;  3DBR I;  2K0P A;  1IUE A;  4NQL B;  1IBX A;  2XK5 A;  3ZJV A;  1SSN A;  4URK A;  1XXG A;  4W9G A;  3IG3 A;  4YT0 B;  1SB3 C;  2J7Q B;  1FPY A;  2NTS A;  2R61 A;  1NI2 A;  2M0X A;  4NJ6 A;  3S2A A;  1HEZ E;  3VH4 B;  3PRE A;  5D2M B;  2NBV B;  2KDI A;  1QIL A;  4RF0 A;  3VHT C;  1H4R A;  2NPT B;  4ARC A;  4ASW C;  1XF5 L;  1T6B X;  3DHI C;  4RNA A;  3ZNZ B;  4LNI A;  2CHZ A;  2M0A A;  3B2F A;  1WZ0 A;  1GC7 A;  3W5V B;  1LXD A;  1XLN A;  2X38 A;  3VTW A;  4L23 A;  4K3C A;  5FR6 A;  3BVG A;  2RPV A;  3AUL A;  1E8Y A;  1P3Q U;  2CKH B;  4NY0 A;  4C4V A;  1XLP A;  3EFC A;  3BZD B;  1L4Z B;  3AEA B;  3ALB A;  1FCL A;  2FAZ A;  1XCQ L;  4HWI B;  1WRI A;  1L6U A;  3PPA A;  3V62 A;  3LDZ E;  4BVU C;  4A9A A;  2KHW B;  1K53 A;  3ZVV A;  4TKN A;  2ZJD A;  1R4N I;  4K7U A;  4S0R A;  2LUM A;  2LAS A;  3A4S C;  3ZUN A;  3HUI A;  3TL5 A;  4LJP B;  3H9D A;  1GJZ A;  3RNA C;  2IPK D;  1YX6 B;  1NYR A;  2EMT A;  2KVR A;  2RGF A;  4P7I A;  3KH0 A;  1QF6 A;  3AU5 A;  3RUL A;  1KF6 B;  1IGD A;  3PRZ A;  1C4A A;  2H89 B;  3U52 E;  4UDU C;  2BB5 A;  1I4P A;  2FCM A;  1CZP A;  1H8C A;  2N9E B;  2IGG A;  4AWJ A;  1C9F A;  4EZL A;  5EDS A;  2PKO A;  2LWP A;  3DBH I;  3K9O B;  1D5M C;  2HJ8 A;  3A1Q A;  5H92 C;  5J18 A;  2K3U A;  3GS2 A;  2IY0 B;  4F7Z A;  4B0E A;  2INP E;  2WDQ B;  4MSQ B;  3NVV A;  4US9 A;  4PS3 A;  2DAJ A;  1F52 A;  4MJS A;  1QOA A;  2I2Y A;  2CJO A;  4IWP A;  3GE3 C;  3DVN V;  1T5X D;  3UQA A;  3D32 A;  1A5R A;  2BYE A;  3AE2 B;  4OVV A;  2WXH A;  1JRP A;  1OEY J;  1YMH E;  4M02 A;  3AEC B;  1LO5 D;  3BIN A;  3K9P B;  2FID A;  1WGD A;  4GXB A;  1EU4 A;  1VZ7 A;  1KTK A;  4N6E B;  3C8Y A;  2BS3 B;  4G50 A;  2D3A A;  1ISN A;  3PHX B;  1EUV B;  2KN5 A;  2W54 A;  2LGD A;  2M8S A;  2WDR B;  2ZCB A;  1YQ4 B;  3OG5 A;  1PDX A;  1Y8R C;  2KDB A;  2ZVO A;  3MC8 A;  4JL9 A;  4RGO S;  4K1R B;  2C7N B;  3AI5 A;  2J52 A;  4WWM A;  5BMG A;  1HTQ A;  4JGH B;  3SEB A;  1D4B A;  2W55 A;  2D3G A;  5IAA C;  2KQ7 A;  3Q8C A;  1YN4 A;  2LFI A;  3VR8 B;  2RMM A;  1T3Q A;  3VFK A;  3Q8B A;  2INC C;  1JWA D;  3B2G A;  5FR3 A;  5BMH A;  2BS4 B;  5CHF A;  2JU6 X;  5I4D A;  3AE3 B;  4C56 C;  1N61 A;  1CMX B;  1QT9 A;  3R8B A;  1V1O A;  3W1Y A;  3O65 B;  3HRD D;  2RPQ A;  3I3T B;  1J7A A;  3Q3M C;  5BYR A;  1FO4 A;  5BO4 B;  3RFZ B;  3FIL B;  4REZ A;  1F0Z A;  2MBO A;  1J7B A;  1IP9 A;  1PFD A;  1WGR A;  1J8C A;  3Q8E A;  2N7E A;  1YN3 A;  2QIL A;  3PGE A;  4IM2 A;  2IY1 B;  1AN8 A;  4GDK B;  1L7Y A;  3W1S A;  4N58 A;  3TEW A;  1SBB B;  4OW0 A;  4KIK A;  2MBH A;  1S1Q B;  2B76 B;  4XDD A;  2WWZ A;  4LNK A;  2RDG A;  1KM7 A;  2GBN A;  1YOV B;  2KQ4 X;  2M1M A;  2KTR B;  3AMZ A;  3P4P B;  4P6V F;  1JWS D;  1XLQ A;  1XCT L;  2LGX A;  1L4D B;  5AUI A;  2N4F A;  1D5Z C;  2JYE A;  3QHT A;  4W9L A;  2RR9 A;  3TUO A;  2MBB B;  3ZDM C;  3ML8 A;  2M17 A;  1P7F A;  3R2I A;  1WGH A;  4DXF A;  2NPT A;  5HFY A;  4JQW C;  3MTN B;  1FD6 A;  2NVU I;  2OED A;  1Y56 A;  1ESF A;  2NTT A;  4ANU A;  3JW0 X;  2K6Q A;  1MJD A;  4ICV A;  3EFU A;  2K6D B;  1GB1 A;  4IW0 A;  2WXR A;  2OHF A;  3QQ8 B;  5LNK 1;  4CQN A;  3IVF A;  1GUA B;  3DOW A;  2J0M A;  3AM9 A;  4KKI A;  1WY8 A;  1PUT A;  3A9K B;  2IGH A;  5D3D A;  3KWV A;  3CST A;  3IT6 B;  4HVB A;  2QHO A;  2BBC A;  5HI1 A;  3DBL I;  2LVQ A;  5G55 A;  1J19 A;  2MLB A;  5EE0 A;  2MEK A;  3HM6 X;  2CR5 A;  3Q3N C;  1CQV A;  1FFU A;  1OQQ A;  1B1Z A;  3EGR A;  3Q8A A;  1XD3 B;  1GOZ A;  4B6W A;  3NZS A;  1E5W A;  3DHH C;  4PYU A;  2BF8 B;  3TIX A;  3ZXR A;  2DAF A;  5DPW A;  4FJY A;  4IWO A;  1TGZ B;  1MHH E;  4HXD A;  4WJQ A;  1UNS A;  3AV8 A;  1EF1 A;  1ET9 A;  1RLF A;  3L54 A;  3KVF B;  2WXP A;  3WAL A;  5IO9 A;  1YIW A;  2CHW A;  2NBU A;  4H2A A;  4TQ0 A;  4EOY A;  1SE9 A;  3QIJ A;  4FN2 A;  2D07 B;  5J2R A;  1RM6 C;  1SEB D;  2N1W A;  2N9L A;  1LFD A;  3PZD A;  4XZ4 A;  4DXA B;  2MBQ A;  3KYC D;  4W9E A;  1BML C;  3WAP A;  4HLE A;  3PHW B;  1FNV A;  3FKY A;  2N9P C;  1QKZ A;  5BYS A;  2HDE A;  3BK1 A;  3J9C A;  1WWT A;  4LLG M;  4PK1 A;  1BT0 A;  2PLP A;  4MDK E;  1QOB A;  1CK1 A;  1RFK A;  2PW9 A;  3URY A;  1MG8 A;  4A55 A;  1I42 A;  3P63 A;  3VUY A;  1STE A;  3N3K B;  1FNW A;  2KZR A;  4W9K A;  3NJT A;  1E7P B;  1MI0 A;  4GIV A;  2AYO B;  3Q14 C;  2HJ1 A;  3IAS 1;  4TQ1 A;  2C5L C;  1N5W A;  3OLM D;  4J3O D;  2INN E;  1T0Y A;  2YEP F;  4PT5 A;  2AEH A;  1V97 A;  3ML9 A;  2DBY A;  3B08 A;  2DYB A;  1KRH A;  2DYM A;  3N20 C;  2FBW B;  3DVG Y;  3E56 A;  4EZK A;  3DVG X;  2J42 A;  2KDF B;  2GBR A;  4KZ0 A;  1E8X A;  4BZA A;  1F77 A;  3AE7 B;  1HE8 A;  2AQ2 B;  3ZNI D;  2DZK A;  3WAO A;  2V0G A;  3C0R B;  5G5H A;  3EA6 A;  3PLU A;  3RCZ A;  2Y3A A;  4GOC A;  4GDL B;  4EKU A;  3H7P B;  1ENF A;  3NRZ A;  3M63 B;  1YJ1 A;  1K52 A;  3UIP B;  1FNU A;  4E74 A;  4RGN A;  1DOY A;  2AQ1 B;  3ZYY X;  2KYW A;  2GRI A;  4KZC A;  1HZ5 A;  1WXM A;  1ACC A;  2ONQ A;  3M3J A;  2KAN A;  4JLC A;  1WJN A;  3UF8 A;  4HRO A;  3FIL A;  3IHP C;  2LRW A;  2CU1 A;  2JWZ A;  2KC1 A;  2CJN A;  4LJO B;  2ZZP B;  3RYT A;  1FRD A;  2BGF A;  4HRS A;  1LQB A;  1GC6 A;  4KV2 A;  2KLC A;  4GDK A;  3CMM B;  2ZCC A;  4GN1 A;  3WIM A;  5LXI B;  2GLS A;  3BY4 B;  4A20 A;  3VUX A;  1ZPS A;  1YQB A;  4NZL B;  2G45 B;  2ASQ A;  4WAA A;  5LLI A;  4DXG A;  2D3C A;  3EUB 2;  1PGX A;  3VAW A;  1TZ1 A;  2BPS A;  5JH5 C;  4FHJ A;  4ITK A;  5AUK A;  2HE7 A;  2QMT A;  2KTR A;  2MA9 B;  1QOF A;  4OZC A;  3NG0 A;  2J0K A;  4KX6 B;  2ON8 A;  4F8C B;  4ZRJ A;  1SF0 A;  2KDM A;  2MJD A;  4O1N A;  4W9I A;  1MFW A;  1WX8 A;  3BYT B;  3C19 A;  1YQ3 B;  2BVC A;  3BWU D;  1P9D U;  2FUG 1;  2K5P A;  3ZJT A;  4C80 A;  3DDC B;  2AWT A;  4A3O A;  4BKT A;  4MSM B;  1TZO A;  1JRO A;  3V61 A;  3GZN B;  5IKC M;  2BS2 B;  2MWS B;  4IWQ A;  2L32 A;  3BYY B;  4NAW B;  4ZRI A;  2KWC A;  3O13 A;  3Q2A C;  3ZLZ A;  1VRA B;  1R7S A;  3Q3F A;  1UF0 A;  1L0V B;  2DZM A;  1RYJ A;  1NI3 A;  3DQV A;  1E6E B;  3RNB C;  3A9K A;  2KOX A;  5T8I A;  1KFY B;  2BKF A;  1AW7 A;  1GNU A;  4YWG G;  2PVG C;  3NOB A;  1R4M B;  4OHJ A;  3RN9 C;  5DPS A;  2JQR B;  4XC2 A;  4ANX A;  2G3Q B;  4ACF A;  3B1L X;  1JWU D;  3TSS A;  4MAC A;  1WZ3 A;  3P4S B;  2HTH A;  3AH7 A;  3PVL A;  2WDT B;  5C1Z A;  1K8R B;  2LEK A;  3P1M A;  4BBN C;  2WXL A;  4DHZ B;  4GU2 A;  3A9J B;  2L76 A;  4OZB A;  1N5X A;  4CO7 A;  3WAM A;  1E10 A;  4XWT A;  1UBQ A;  4RM9 A;  1SE2 A;  4M01 A;  4MH8 A;  1WGY A;  1WM3 A;  4HKZ E;  1N62 A;  1J7C A;  2RSU A;  4MEM A;  1IYF A;  1IPG A;  4HKQ A;  4IDI A;  1ZUD 2;  3IT4 B;  1N60 A;  3RPF C;  2E6X A;  4TSS A;  1L5P A;  3AEG B;  3NS1 A;  1ET6 A;  2ZNV B;  4N59 A;  3L08 A;  4HJG E;  5JHB A;  3M95 A;  2DZJ A;  1KJT A;  2BYT A;  2K1F A;  4B0M A;  3X0W A;  3QA8 A;  5D94 A;  2NBW B;  4ZRK A;  3T8M A;  4JIO U;  2IYD B;  3FAH A;  5AZG A;  2FCQ A;  1NYQ A;  2IJ0 A;  3U30 A;  1F1H A;  2OJR A;  2FCS A;  4K81 A;  1UZX B;  5L83 A;  1V5O A;  2QC8 A;  3N30 A;  1EWC A;  1WMH B;  3AB5 A;  5EE9 A;  4IOI E;  4PYZ A;  5AZF A;  4BAX A;  2M56 B;  4HCP B;  2JUO A;  3ECI A;  4CYE A;  4J6I A;  2EKI A;  3AE8 B;  4YXD B;  2ZVN A;  4FAD A;  2PE6 B;  1JRU A;  2EEL A;  2L1A A;  3NHE B;  2V3P A;  4PS8 A;  4FJZ A;  5C3J B;  3P4Q B;  2PVO D;  4LTU A;  3AE4 B;  2MHJ A;  2LHE A;  3R2T A;  3VTV A;  3PLV A;  2FIF A;  2KJH B;  2L05 A;  3NVY A;  2X8X X;  1M94 A;  3OAW A;  1I4R A;  1WR1 A;  3NZU A;  2SEB D;  2JPH A;  3AU4 A;  4GDL A;  4KGT A;  4A6Q A;  2IO3 B;  3H7P A;  4E71 A;  2KWU B;  2FNJ B;  1E8Z A;  1TY2 A;  5TR5 A;  3Q3O C;  2QEJ C;  4OZA A;  4WAF A;  5IP4 D;  4ZHP A;  2ZPN A;  2KWD A;  3PRM B;  4WJN A;  1C78 A;  3PZ8 A;  2IO0 B;  4A3P A;  4DWF A;  4GSW A;  1QOG A;  3OJ4 B;  4P16 A;  1BUI C;  2KK8 A;  3BK2 A;  4IG7 B;  4YTN B;  1WH3 A;  3KWL A;  4BOZ B;  2WXI A;  1F9J A;  2WX0 A;  4US8 A;  3RI7 C;  2VZK D;  5C23 A;  4DK5 A;  4YTP B;  4RCO A;  1Q0W B;  3GZN I;  3QCA A;  3AEE B;  2K25 A;  3V6E B;  1EU3 A;  1S3S G;  3VRA B;  5IA7 A;  3IXS A;  3RNF C;  2BW2 A;  1PQS A;  2JF5 A;  2RD0 A;  4B95 A;  1WJ6 A;  3KUD B;  3JSV B;  2GBK A;  1GG3 A;  3HVD A;  2V3N A;  2KLG A;  1TT5 B;  1JCK B;  1NVI D;  3DVN U;  5E6N A;  4TV3 A;  1VLB A;  2N0S B;  2Z0E B;  1R4M I;  3B9J A;  3V6C B;  3PS6 A;  4BBN F;  5TSS A;  2QCZ A;  2KVZ A;  2MW5 A;  2NR2 A;  2LHD A;  1E0Z A;  3NUH B;  1A70 A;  1TKG A;  2KN4 A;  1I35 A;  2L0T A;  2KD0 A;  4KDL B;  1HXY D;  1SE4 A;  3TBL D;  1HA5 A;  1SJH D;  2DWQ A;  2KX0 A;  2LRU A;  3X23 A;  1V2Y A;  3RMK C;  3U4E G;  1T0R C;  3ZDT A;  1D6E C;  2WDV B;  4XYC A;  2NMQ A;  3P42 A;  3ZGZ A;  1FRR A;  4RM8 A;  5JHA A;  1PGA A;  1VD2 A;  2KJ6 A;  2KAJ A;  2NS5 A;  2MH7 A;  3M62 B;  4FA6 A;  2KNB A;  4M0W B;  2PE9 A;  3BII D;  1EF5 A;  3RUI B;  4MGY E;  4K3B A;  1GPX A;  1IGC A;  1V5T A;  1WM2 A;  2K8H A;  5FKA C;  4ZOH C;  1V1P B;  4RFB A;  3A9J A;  3AEF B;  3DBR B;  1BXT A;  1V81 A;  2LVO A;  1I7H A;  4AS1 A;  4MT5 A;  3U8Z A;  2BWF A;  3ZRF A;  1DOX A;  4IKG A;  1YX5 B;  2TSS A;  4K7S A;  2JZP A;  1KLV A;  2N7J A;  1FXT B;  3KUC B;  2WXF A;  4ZDV A;  3DBS A;  1V8C A;  2O6V D;  5GMV A;  1YJJ A;  4HJK A;  3OWE B;  4IC7 B;  1WGK A;  2AL6 A;  2MQJ A;  2K22 A;  5D3I B;  1WI0 A;  4HPP A;  3GB1 A;  2LVP A;  3RNE C;  1V9J A;  1RRB A;  2BKR B;  4WQM A;  1LM8 B;  2WXJ A;  2BTE A;  1MPE A;  2PMV A;  1F2R C;  2G4S A;  1HTO A;  5DPR A;  4N9F 4;  2VH2 A;  1NDD A;  1I4G A;  2OJW A;  1WYW B;  4AUQ C;  1UD7 A;  2H88 B;  1ZDV A;  1JML A;  3PO0 A;  4W9H A;  4I6L B;  2D2Q A;  4MGZ E;  5AEK B;  2WXO A;  2EKE C;  1E9M A;  1WMH A;  4WIP A;  1YNT E;  3N1Y C;  1FCC C;  1B9R A;  3TEY A;  3A1Q B;  2V3S A;  4MGI E;  3EHV A;  1R4N B;  3CWI A;  1DGJ A;  3ZTC A;  4W9D A;  4EUT A;  1WF9 A;  5CHW A;  3KUZ A;  4XWW A;  2XN9 C;  1WX9 A;  3ZKJ C;  1L2N A;  1YN5 A;  2M4N A;  3MJW A;  2E3T A;  1XEE A;  3L4P A;  3IFW B;  4AP4 C;  3EEC A;  1ZXI A;  4KGR A;  4LCD E;  3RT3 B;  4MJS B;  5CX3 A;  2JZZ A;  4XDC A;  2I38 A;  1JW9 D;  3ZNG C;  1FMA D;  3LYY A;  2B3A A;  4GGQ A;  1SIJ A;  4W9J A;  2WXQ A;  5EE1 A;  2ZNV C;  5L95 C;  2R2O A;  2GI9 A;  2KT7 A;  3R7R A;  2IND C;  1N6Z A;  3UI3 A;  1OEY A;  3RNG C;  3RD2 A;  1UUP A;  3GOE A;  1P0R A;  2LUE A;  3R7Q A;  2K8B A;  1WXA A;  4USA A;  4WJP A;  2N9K A;  3N1Z C;  4KSL C;  2WXG A;  3ZW3 A;  3Q69 A;  4NQK E;  4ARI A;  3BVZ A;  1TS5 A;  1RFA A;  2QDF A;  4C00 A;  4ZHO A;  3U2S C;  5JZE B;  1XLO A;  1VDV A;  2JXX A;  4CHK A;  4MM3 B;  2MJE A;  2LGI A;  3MHZ A;  4DHJ D;  2R2Q A;  3QAR A;  1QQR A;  1WGG A;  2LXC A;  2WXK A;  3IAM 1;  1OGW A;  2IBI B;  3QK0 A;  2EMS A;  2VZK B;  4IUM B;  1JAL A;  5JXV A;  4LDT D;  3MC0 B;  1JQ4 A;  2WNM A;  2G1E A;  3LJ3 A;  5G5G A;  5E6P A;  1WJU A;  2DHZ A;  2A5U A;  1LGR A;  3TJP A;  1NEN B;  1UWM A;  4BKS A;  3JSV A;  3MC9 A;  4XE0 A;  1UEL A;  4NAM A;  1KH0 A;  5LXH A;  2FUH B;  3QC8 B;  1SE3 A;  1UGM A;  2MP2 B;  2V1Y A;  2V4I B;  3HM3 A;  4FLH A;  1T0Q C;  5E6J A;  1Q5W B;  1SIF A;  5HHD G;  2DYO A;  5CHV C;  4EE2 A;  4PS7 A;  1M4V A;  1Q10 A;  3RNC C;  3GP7 A;  4ANV A;  4OVZ A;  1WRD B;  4RMA A;  3VH3 B;  4KGS A;  1TY0 A;  2KKC A;  2D11 A;  1TTN A;  4FUL A;  1E7V A;  2A4Z A;  3Q6B A;  1I4Q A;  2XEW A;  1L0X B;  4TMA B;  2PPH A;  4DDI D;  4WUR A;  4RF1 A;  1TIF A;  4LNO A;  4I6N B;  5GXG B;  2CS4 A;  1FXI A;  4JWU C;  3L17 A;  4NPN A;  1C4C A;  3I5J C;  3KQ4 A;  5MPO A;  4MH0 E;  1KOT A;  3TEX A;  1AYF A;  4JX1 C;  1Z5S B;  1WYG A;  3A33 B;  1DOI A;  4XX5 A;  4M0W A; 
#chains in the Genus database with same CATH homology
 1JWM D;  1I4R A;  2WS3 B;  1TYG B;  1PUT A;  2IGH A;  5D3D A;  1VZ8 A;  3KWV A;  4JWS C;  1KLU D;  2SEB D;  1KLG D;  3IT6 B;  3NZ3 A;  2BBC A;  5HI1 A;  4KGT A;  1TS2 A;  4A6Q A;  1QLB B;  1V1P A;  2ACZ B;  4KKJ A;  1NEK B;  5EE0 A;  2MEK A;  2BT6 A;  3ETR A;  2ZW0 A;  2JXT A;  3I57 A;  2JX5 A;  1CQV A;  1TY2 A;  1FFU A;  1OQQ A;  2Y5P A;  1B1Z A;  3I9V 1;  3MFG A;  3EGR A;  3Q8A A;  2QEJ C;  1EM7 A;  4OZA A;  4WAF A;  1GOZ A;  2W82 A;  4ZHP A;  4RH6 A;  3AEB B;  2KWD A;  1L0Y B;  1PYW D;  1TS4 A;  3H8H A;  2WP9 B;  1C78 A;  3PZ8 A;  2RDH A;  2D5G A;  2CU3 A;  1WSP A;  3BVM A;  3VQI A;  3WCQ A;  1QOG A;  1UWX A;  4P16 A;  1BUI C;  3P4R B;  1FFV A;  3BK2 A;  1ZXH A;  4ZYS A;  3CIR B;  4YTN B;  2HTM E;  4JPS A;  2SAK A;  1MHH E;  3KWL A;  1UNS A;  2WXI A;  4YSY B;  4C7Y A;  3LXF A;  3W5U B;  3AV8 A;  4US8 A;  2VZK D;  1ET9 A;  4D2K A;  4YTP B;  1K51 A;  1K50 A;  4RCO A;  2WXP A;  4C7Z A;  5FK9 C;  3AE9 B;  3AEE B;  4H2A A;  4TQ0 A;  1DYQ A;  1EU3 A;  3VRA B;  3IXS A;  2LMC A;  3W9C B;  2ICI A;  1RM6 C;  2M19 A;  1SEB D;  3LB8 C;  2BW2 A;  2WLB A;  2BB6 A;  2KAC A;  2N9L A;  1ROE A;  5BMI A;  2ZW1 A;  2XNA C;  1TKE A;  1BML C;  2K9X A;  3HVD A;  1FNV A;  2KMM A;  5BYS A;  1QKZ A;  2V3N A;  2HDE A;  3BK1 A;  1JCK B;  1NVI D;  3J9C A;  1WWT A;  4LLG M;  1VLB A;  2JSV X;  2N0S B;  2PLP A;  2WU2 B;  1QOB A;  3B9J A;  2L83 A;  1CK1 A;  1FXA A;  1RFK A;  2PW9 A;  4YSX B;  3URY A;  5TSS A;  4A55 A;  2MJ3 A;  4DQO C;  2K0P A;  3P63 A;  1IUE A;  3Q8F A;  1IBX A;  1STE A;  1VR9 A;  3ZJV A;  1SXT A;  1SSN A;  2LHD A;  1FNW A;  1XXG A;  1E0Z A;  1TS3 A;  3NUH B;  1UGJ A;  1A70 A;  4YT0 B;  3TEZ A;  3NVZ A;  1SB3 C;  1TKG A;  2KN4 A;  4FXC A;  2NTS A;  2R61 A;  1E7P B;  1MI0 A;  4LK0 M;  1HEZ E;  3IAS 1;  4TQ1 A;  2J4X A;  1N5W A;  1HXY D;  3MJ5 A;  1SE4 A;  3AN1 A;  4J3O D;  1FM0 D;  1HA5 A;  1QIL A;  4RF0 A;  1SJH D;  5EE3 A;  2DWQ A;  2INN E;  4ARC A;  1XF5 L;  1T6B X;  1OFF A;  2YEP F;  4PT5 A;  4AQ7 A;  4RNA A;  3U4E G;  1MHX A;  1V97 A;  1D6E C;  1RWS A;  2DBY A;  2M0A A;  2NMQ A;  2WDV B;  3B2F A;  3P42 A;  1KRH A;  2DYM A;  3ZGZ A;  1FRR A;  1PGA A;  2FBW B;  5BYQ A;  3W5V B;  1XLN A;  3E56 A;  2X38 A;  1I4H A;  2Q5W D;  4L23 A;  2KAJ A;  1C76 A;  2MH7 A;  2J42 A;  3E9S A;  4ZRP A;  3BVG A;  1F77 A;  1AWD A;  2RPV A;  4YSZ B;  2DLB A;  3AE7 B;  2AQ2 B;  5C2T B;  1C77 A;  3BII D;  2V0G A;  1XLP A;  5G5H A;  3EA6 A;  1ZDX A;  3BZD B;  2FE8 A;  1GPX A;  1IGC A;  1L4Z B;  3AEA B;  2Y3A A;  1FCL A;  3SR6 A;  1XCQ L;  2PTL A;  4GDL B;  1WRI A;  2LJI A;  1V1P B;  4RFB A;  4ZOH C;  5FKA C;  1L6U A;  1ENF A;  3NRZ A;  3AEF B;  1C4P A;  1BXT A;  1I7H A;  1K52 A;  4A9A A;  2IGD A;  4AS1 A;  4MT5 A;  1FNU A;  1K53 A;  4RGN A;  2IDY A;  1DOY A;  2AQ1 B;  3ZYY X;  1DOX A;  2GRI A;  2LUM A;  4IKG A;  1MVK A;  1HZ5 A;  1TJE A;  1ACC A;  2ONQ A;  2TSS A;  1FEH A;  2JZP A;  3T3O A;  2N7J A;  3HUI A;  3SFD B;  5H8Y E;  2WXF A;  1C79 A;  4HRO A;  3FIL A;  3V05 A;  1V8C A;  1YJJ A;  3FC4 A;  2IPK D;  1PGB A;  3AE5 B;  3OWE B;  1NYR A;  2CJN A;  1WGK A;  4HEA 1;  3NVW A;  1QF6 A;  2K22 A;  1L6V A;  1FRD A;  4HRS A;  2WQY B;  1KF6 B;  5D3I B;  3GB1 A;  1IGD A;  1C4A A;  2H89 B;  4WQM A;  3U52 E;  3V3X A;  4UDU C;  2BB5 A;  1I4P A;  3VR9 B;  1CZP A;  1VZ6 A;  2WXJ A;  2BTE A;  1MPE A;  1ZPS A;  2PMV A;  1FIQ A;  4NZL B;  2QSD A;  2IGG A;  1F2R C;  1C9F A;  4DXG A;  3W2D A;  2PKO A;  1PGX A;  3ABV B;  3EUB 2;  1F2R I;  1I4G A;  2JYT A;  2H88 B;  1ZDV A;  4ITK A;  4RGT A;  1TKY A;  5AUK A;  1JML A;  2QMT A;  1D5M C;  3PO0 A;  4YTM B;  5H92 C;  1QOF A;  4OZC A;  2K3U A;  3GS2 A;  4KX6 B;  2JWU A;  2G9H D;  2ON8 A;  2WXO A;  4B0E A;  1E9M A;  1SF0 A;  2KDM A;  2MJD A;  4WIP A;  4O1N A;  2INP E;  1YNT E;  2WDQ B;  2WXM A;  3NVV A;  4US9 A;  1FCC C;  3BYT B;  1B9R A;  3TEY A;  4Q2J A;  1YQ3 B;  3CWI A;  4GLS C;  1DGJ A;  2L52 A;  3BWU D;  2FUG 1;  2K5P A;  3ZJT A;  1IBX B;  1ZE3 D;  1QOA A;  2XN9 C;  4C80 A;  4XWW A;  2I2Y A;  1YN5 A;  2CJO A;  3T3N A;  1TZO A;  2E3T A;  1XEE A;  1T5X D;  1I4X A;  3L4P A;  1JRO A;  3AE2 B;  4ZRQ A;  1XO3 A;  2WXH A;  1JRP A;  2BS2 B;  1ZXI A;  4KGR A;  1YMH E;  2L32 A;  3BYY B;  4NAW B;  4XDC A;  2I38 A;  1JW9 D;  1HQR D;  3O13 A;  1HZ6 A;  1VRA B;  1R7S A;  3AEC B;  1FMA D;  1LO5 D;  3LYY A;  1L0V B;  1SIJ A;  5EE1 A;  2WXQ A;  4A8X C;  1RYJ A;  1NI3 A;  4L2Y A;  1EU4 A;  2GI9 A;  1VZ7 A;  1E6E B;  1KTK A;  4N6E B;  3UI3 A;  3C8Y A;  5T8I A;  2BS3 B;  1KFY B;  2PIA A;  1WXQ A;  2W54 A;  3AED B;  1UUP A;  1AW7 A;  1JWB D;  3HVZ A;  2WDR B;  1YQ4 B;  4YWG G;  2PVG C;  4USA A;  2Y5C A;  1PDX A;  3U7Z A;  4OHJ A;  4RGO S;  2GB1 A;  2N9K A;  1GB4 A;  2J52 A;  4WWM A;  5BMG A;  2JQR B;  2WXG A;  3Q69 A;  4ARI A;  1JWU D;  3BVZ A;  3TSS A;  1TS5 A;  3SEB A;  1D4B A;  4MAC A;  2W55 A;  3P4S B;  4ZHO A;  3AE6 B;  3AH7 A;  3U2S C;  3Q8C A;  1XLO A;  1VDV A;  1YN4 A;  2WXN A;  4MM3 B;  2LFI A;  2LEK A;  1N63 A;  2MJE A;  3P1M A;  3VR8 B;  2LGI A;  2RMM A;  1T3Q A;  3MHZ A;  2WXL A;  1SJE D;  3Q8B A;  1JWA D;  3B2G A;  1N5X A;  4OZB A;  4JE3 B;  4R3D A;  1QQR A;  1E10 A;  5FR3 A;  1ZOY B;  5BMH A;  2BS4 B;  2JU6 X;  2WXK A;  3IAM 1;  5I4D A;  3AE3 B;  4C56 C;  1N61 A;  4XWT A;  1QT9 A;  1SE2 A;  3R8B A;  1V1O A;  2W3S A;  2QJL A;  4L1B A;  2VZK B;  1VJK A;  4MH8 A;  3HRD D;  1JAL A;  1J7A A;  5BYR A;  5JXV A;  3PZ7 A;  1FO4 A;  1P7E A;  4HKZ E;  3MC0 B;  1N62 A;  1JQ4 A;  2AX5 A;  1J7C A;  2WNM A;  3RFZ B;  2G1E A;  3FIL B;  5HG2 A;  5G5G A;  4REZ A;  4HKQ A;  1F0Z A;  2Z8L A;  1J7B A;  4IDI A;  1ZUD 2;  3IT4 B;  1N60 A;  3RPF C;  2E6X A;  3N9Y C;  4TSS A;  1PFD A;  1NEN B;  3Q8E A;  1L5P A;  1OQR A;  1UWM A;  3AEG B;  5D7G A;  1YN3 A;  2QIL A;  4XE0 A;  3NS1 A;  1AN8 A;  1ET6 A;  3AE1 B;  4N59 A;  4GDK B;  4HJG E;  4NAM A;  3W1S A;  1KH0 A;  2QIE B;  2BYT A;  1SE3 A;  4N58 A;  4B0M A;  3TEW A;  1SBB B;  4OW0 A;  2V4I B;  2B76 B;  4XDD A;  2AQ3 B;  3MP9 A;  4NJC A;  3FAH A;  5E6J A;  2RDG A;  1NYQ A;  5HHD G;  1EWY C;  2IJ0 A;  2DYO A;  2W3R A;  4EE2 A;  2KQ4 X;  3AMZ A;  1M4V A;  3P4P B;  1JWS D;  4P6V F;  1Q10 A;  3DWG C;  1XLQ A;  1XCT L;  3GP7 A;  1L4D B;  4OVZ A;  4A90 A;  1YJI A;  5AUI A;  1D5Z C;  2JYE A;  1EWC A;  4KGS A;  3SFE B;  3AB5 A;  1TY0 A;  5EE9 A;  4RGM A;  4IOI E;  3TUO A;  2M56 B;  4WH4 A;  1P7F A;  2WU5 B;  3R2I A;  2EKI A;  1CJE A;  3AE8 B;  4YXD B;  4DXF A;  5HFY A;  2EEL A;  1I4Q A;  2L1A A;  3KLS X;  1L0X B;  3ZJU A;  4TMA B;  1FD6 A;  2V3P A;  4WUR A;  2OED A;  1Y56 A;  4RF1 A;  2J53 A;  1ESF A;  2NTT A;  5GXG B;  5C3J B;  3P4Q B;  3VRB B;  2PVO D;  1D5X C;  4LTU A;  1FXI A;  3AE4 B;  3DWM A;  4JWU C;  1ZP0 B;  2LHE A;  3ZQ4 A;  1C4C A;  3R2T A;  3KQ4 A;  1GB1 A;  5MPO A;  1GAQ B;  2WXR A;  2OHF A;  5LNK 1;  4CQN A;  3TEX A;  1AYF A;  4JX1 C;  1WYG A;  2YEP B;  3AM9 A;  1DOI A;  4KKI A;  3NVY A;  4M0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...