1YJJA

Rdc-refined solution nmr structure of oxidized putidaredoxin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putidaredoxin
publication title Redox-dependent structural differences in putidaredoxin derived from homologous structure refinement via residual dipolar couplings.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Electron transport
total genus 16
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yjjA00
1JALA 1QLBB 2CJOA 2EKIA 2W55A 4FXCA 2OHFA 5C3JB 3AE7B 1DGJA 1WGKA 2PVGC 3LB8C 5G5HA 3AE2B 4A9AA 1FIQA 1KF6B 1AYFA 2WU5B 4N6EB 3VR8B 1YQ4B 3NVVA 3AEDB 1NYQA 1E6EB 2WDQB 2BS3B 3CWIA 3NVYA 1E7PB 1T3QA 1N5WA 2W3SA 3P4RB 4WQMA 2WQYB 3AE5B 2H89B 1FO4A 3DWMA 3SFEB 1OFFA 1WRIA 1N60A 1I7HA 4JX1C 3SFDB 1FM0D 1R7SA 3NS1A 2G1EA 5AUKA 1JROA 3AM9A 4N59A 3AE1B 1RYJA 4JWUC 5G5GA 1NEKB 1NVID 1N62A 1J7AA 3W5UB 2L52A 2Y5CA 2K22A 2L83A 1GAQB 1FXIA 4YSXB 3P63A 1VDVA 1PUTA 3AEBB 1EWYC 1NI3A 1GPXA 1TKEA 1L5PA 1TJEA 1XLOA 2WP9B 1WWTA 3ABVB 2W54A 5GXGB 3ETRA 4YXDB 1NYRA 3VRAB 2DBYA 4US8A 1JWAD 3NVZA 2H88B 1V8CA 1ZP0B 3DWGC 2QJLA 4LTUA 3RPFC 4ZOHC 1AWDA 1N61A 1WYGA 2WLBA 3P1MA 1DOIA 1QOGA 1TKYA 2PIAA 2Q5WD 3AH7A 2ACZB 3AEFB 3AE3B 1KFYB 2JX5A 3BIID 5MPOA 1L6UA 1ZXIA 2JQRB 1L0VB 1OQRA 1QOBA 2WS3B 3B2GA 1J7BA 1JW9D 1RWSA 3AB5A 2WU2B 1N63A 3LXFA 2PVOD 4ZHPA 3HRDD 1F0ZA 1L6VA 1CZPA 4ITKA 3AECB 1N5XA 1PDXA 3HVZA 3AE6B 4C7ZA 1YJIA 1JWBD 2N0SB 1FRDA 3AE8B 5H8YE 3CIRB 1RM6C 1XLQA 3AEEB 1RFKA 1B9RA 1V97A 3HUIA 2M56B 5EE3A 3SR6A 1NENB 2PKOA 1SF0A 2BS2B 1E0ZA 1XO3A 4N58A 3VRBB 5EE9A 3AV8A 1J7CA 3AE4B 3KWLA 2AX5A 2K9XA 2KMMA 1A70A 3L4PA 4IDIA 1QT9A 1IUEA 2W3RA 1VLBA 2MJ3A 1ZUD2 3FAHA 1FFVA 1SIJA 1XLNA 4US9A 4YSYB 1DOXA 3B9JA 1KRHA 2CU3A 4USAA 2MJEA 3P4SB 4KX6B 1JQ4A 3P4PB 3AN1A 3W9CB 1QOFA 1FRRA 4YSZB 1FMAD 2HTME 2MH7A 4HRSA 1XLPA 2MJDA 3P4QB 4YTMB 5EE1A 1FXAA 1WXQA 1JRPA 1ROEA 3AMZA 2B76B 2LEKA 3ZYYX 1PFDA 3PO0A 4C7YA 4YTPB 1SB3C 2WDVB 1FFUA 4HROA 2K5PA 2KAJA 1DOYA 3WCQA 2CJNA 5C2TB 4C80A 1E9MA 5H92C 3AE9B 4YT0B 2M19A 1TKGA 5AUIA 2DWQA 3VR9B 4JWSC 3W5VB 5EE0A 3B2FA 1UWMA 4ZHOA 4WWMA 1YJJA 3FC4A 3EUB2 1ZOYB 4YTNB 1E10A 1QOAA 1TYGB 2FBWB 3NVWA 1VJKA 2WDRB 1CJEA 1OQQA 3AEAB 1YQ3B 1QF6A 3NRZA 4P6VF 2BT6A 3AEGB 2QIEB 2E3TA 2BS4B
chains in the Genus database with same CATH superfamily
3BINA 1K8RB 2K8HA 3AE7B 3HIZA 3NVYA 2L32A 4I6PA 1V6EA 3PTFC 2RPQA 4MGIE 4M8NA 3BK1A 3QX1A 2LASA 4BAXA 1SGHA 4GSWA 4LJPB 3AE1B 1GAQB 2KOXA 2BYEA 4A6QA 4WJQA 2KVZA 2MBQA 1D5ZC 5JHBA 3SD5A 2H88B 1EU3A 1XQQA 2EELA 2C7NB 1ZE3D 2KFKA 1G6JA 1ESFA 4IWOA 2OOBB 5HHDG 1K50A 3X0WA 2WU2B 4TUUA 2IGGA 3AECB 3PSEB 3V62A 2N9LA 1P3QU 3IHPC 4BVUC 3U2SC 3CIRB 1XLQA 1P7EA 2INCC 2PE6B 3VRBB 2ZPNA 3BVZA 1J7CA 3AE4B 3L13A 3WAPA 1IUEA 3APDA 1WJ4A 3PHWB 5CHWA 1Q10A 4NAWB 1V86A 4KGRA 2GLSA 2N1VA 3T3NA 2RDBC 1FMAD 2WXNA 2JWZA 2DYBA 2JPHA 1V5TA 1FXAA 3N1YC 1JRPA 2J52A 4PK1A 4OVUA 1MG4A 1XF5L 2NTTA 4HEA1 5C2TB 2N9KA 4DQOC 2SAKA 4L2YA 4K7WA 2KNBA 5KHOA 1UWMA 1RFAA 1WE6A 1Q0WB 3D32A 2JSVX 4P6VF 1WJ6A 3PPAA 2FAZA 4EEWA 4PYZA 2MQJA 2H89B 3VUYA 4G3XB 5GMVA 2IGHA 1SE4A 1FM0D 3SFDB 4ASWC 2JZZA 1HTQA 2UU7A 4ZYNA 4ZRIA 3TIXA 3NZSA 4WJOA 4JE3B 2O6VA 4WWNA 4XYCA 1FXIA 1K52A 3QCAA 2KJRA 4HDQA 1MG8A 1HEZE 2KDBA 4JLCA 4W9CA 1KLVA 1XLOA 2KX0A 4IG7B 2KMAA 4FBJB 5LLIA 4NPNA 1AWDA 2Q5WD 4FJYA 1TIFA 1C3TA 3KQ4A 4II2B 2PTLA 1LO5D 2MBHA 1UUPA 3HVDA 4RH6A 1HTOA 3NHEB 3P42A 2QSDA 1V1PA 2KTRB 3VTVA 4O1NA 2N7EA 2NS5A 3AE8B 3DPDA 4OW0A 3N1XC 5IKCM 2KN4A 1SF0A 1E0ZA 4DXGA 3AV8A 3WA0A 1S1QB 3QHTA 4HXDA 2MCNB 3ZLZA 2NTSA 3ZNHB 2JU6X 1XCQL 2KWDA 4IC7B 2JRHA 2JXTA 1MJDA 5D6JB 5L83A 1EU4A 5E6JA 4ZDVA 3PVLA 3MP9A 3C8YA 4NJCA 1PFDA 2UYZB 3DQVA 2WDVB 2WNMA 4HROA 1WE7A 1LQBA 4YT0B 2YVCA 1TKGA 2PMVA 4IKGA 4GDLA 4PS8A 2OJRA 2PPHA 1WF9A 1GG3A 1KJTA 1CJEA 1QF6A 4LNOA 3NRZA 4MACA 4F7ZA 2INNE 3ZO5B 5C3JB 2D3CA 2LI5A 3ML9A 1C78A 4ANUA 3WALA 4BKTA 1I7HA 2W9NA 2C60A 3WAMA 2L0TA 4GDKA 1YJ1A 1ZPSA 1L5PA 4HCNB 2DBYA 4RM8A 4LTUA 2ZPYA 5IP4D 1FNUA 3PZ8A 2LZ6A 2OJWA 3BVMA 4EOYA 3PRMB 1ZXIA 2KXJA 3BZDB 3PRPB 1N63A 1L0XB 1R4NB 2IO1B 1R4NI 4RGNA 3H1UA 2YEPF 3Q8BA 4F8CB 1UZXB 1V49A 2AQ3B 3IBEA 4GMVA 3KW5B 1YN5A 1P9DU 1I4RA 4A20A 4RGTA 3FILB 2ONQA 1MVKA 1C4AA 2Z8LA 1P98A 5CHFA 4S0RA 4HK2A 5C23A 5BO4B 5DCNA 2LD9A 3T3OA 1S3SG 4GXBA 3UQBA 1QKZA 3GE3C 3Q8CA 4YTPB 3AU4A 2G4DB 2J42A 2LUEA 3A9KA 3KWVA 4LNKA 2BF8B 5AUIA 2R2OA 2AEHA 3N20C 2JYEA 4YTNB 1E10A 2GBKA 5JH5C 3A9JA 4XWWA 2CR5A 2EKIA 3IFWB 1UF0A 4A9AA 1TGZB 4M0WA 3VR8B 1PYWD 2L0FA 4A3OA 4XZ4A 1F0ZA 2GBJA 2WQYB 2HJ1A 4H2AA 2N9XA 4JWUC 4B6WA 1NVID 3W5UB 1TZOA 1E90A 3DDCB 2WXGA 1KLGD 4EZLA 1ENFA 1C1YB 4W9GA 2V9HA 1WWTA 3ETRA 3TEXA 2LHDA 2XNAC 1V9JA 1T0SC 1IBXB 3V3XA 3QC8B 3AE3B 4MM3B 3AXCA 3BIID 1L0VB 2WS3B 3B2GA 2NPTA 2M0AA 2BTEA 4J6IA 3HRDD 1L4DB 1OEYJ 3VUXA 2V3PA 2L1AA 4C7ZA 2VRRB 3ZKJC 4HPLB 4W9KA 1T5XD 2BS2B 4N58A 2YLMA 1WR1A 2C7HA 2QMTA 2KWCA 4P7IA 2NBWB 1GJZA 4RFBA 1I35A 4MJSA 2CKHB 2RR9A 4KKIA 1LFDA 2MH7A 1C76A 4EE2A 4P1BC 2JRIB 1YN4A 4KZCA 4EZJA 4W9FA 5AZHA 1F1HA 1WZ3A 3LDZE 4WWOA 2G4SA 2JWUA 4NZLB 4KDLB 4KDIC 4X57B 5IOIA 4HVBA 3EUB2 2MBBB 1QOAA 3Q3JA 3EC8A 2D3BA 1FCCC 4W9LA 2WXFA 4D2KA 1F2RC 2J0JA 2KACA 3DCGA 3AE5B 3HK0A 3SEBA 2M8SA 2WXLA 5AEKB 1R7SA 4HWIB 3DVGX 3Q8AA 3OG5A 4WAFA 2LJIA 3E9SA 1UELA 2ZVNA 2MX2A 1NYRA 4YL8A 3VRAB 4MH0E 1CK1A 1WX8A 2MP2B 2QJLA 1L0YB 1Q1OA 4DHZE 4REZA 2BB6A 1J0GA 3H7PA 4M00A 3V60A 1JW9D 2QILA 1ZW7A 4MEMA 3RNFC 2K8BA 3KUDB 3PLUA 4PS3A 5JZEB 3SR6A 4IUMB 1N6ZA 4JGHB 4MGYE 1H4RA 1VLBA 4LJOB 2MJ3A 3Q69A 2IO2B 5G2NA 5D7GA 3VQIA 3I9V1 5EE1A 4M8MA 4KV2A 2LEKA 2O2VB 2IBIB 3VAWA 2JZ3B 3RI7C 1MI0A 2W82A 3VXWA 3U8ZA 5G55A 2BKFA 1Y8RC 3IG3A 3EECA 2GRIA 3A33B 4A8XC 1BXTA 5FK9C 4N9F4 4IM3A 5IAAC 1AYFA 1STEA 1RLFA 5D2MB 2NR2A 1OQYA 4WQMA 3VFKA 5TR5A 1WRIA 1ZXHA 4KGSA 3NY5A 2GMIC 4W9DA 1ZDXA 2V0GA 2JXXA 1C9FA 4I6NB 2M17A 4J3OD 3H6NA 3ZTDA 2ZCCA 2N4FA 3MJ5A 2DAJA 4XDCA 4ZOHC 2KKCA 1QOGA 1TKYA 2V3NA 3N30A 2JQRB 2KFKB 2WDTB 3NUHB 4C4VB 3MHSD 4UDUC 4ZHPA 4OVVA 3AE6B 3U7ZA 3T8MA 4RMAA 2ASQA 3C0RB 4B95A 4KZ0A 1FXTB 3ZDTA 4M01A 4GGQA 1C4PA 1HQRD 2AX5A 4NQKE 2KT7A 4L1BA 2FE8A 2XK5B 3NOBA 2LMCA 4JL9A 1PQSA 3MC9A 4YSZB 1E8YA 4WQOB 3P4QB 3IT6B 1E8XA 3KH0A 3R2TA 5D3IB 1YN3A 2CJNA 1XXGA 1VZ8A 1VCBA 1WGDA 5LXIB 1X1MA 1TS2A 1YJJA 1ZOYB 2WXQA 4IOIE 1OQQA 2ZCBA 4ZRPA 3ONSA 3RNCC 1UD7A 1XT9B 4KGTA 4ZRKA 2D11A 3UIOB 3UF8A 2DLBA 1OFFA 1AN8A 1E8ZA 5E6PA 1FNWA 2DENB 3RT3B 1V80A 3DBLB 2KQ7A 4GU2A 3DBLI 5G5GA 1N62A 2L83A 2KANA 4IWQA 4NQLB 3EA6A 3W1SA 1NI3A 3B08A 4BZAA 1GPXA 3HHMA 1WGYA 3AU5A 3TEZA 4AQ7A 1YX6B 2JUOA 4CQNA 4IM2A 1K51A 4NAWA 1FCLA 2QDFA 1EF1A 1L6UA 5DPTA 3Q6BA 4FHJA 4MGKE 1WRDB 3ZGZA 1NI2A 3BYYB 3HVZA 2C5LC 4W9JA 5FR6A 1IYFA 3EHVA 1B9RA 3JYUA 4GN1A 3TSSA 1WMHA 1WY8A 3E56A 2QC8A 5EE9A 2YEPB 3QK0A 3KWLA 1LXDA 5DPRA 1T0QC 2ZW1A 1QT9A 2W3RA 4P16A 3L10B 2Z0DB 3CSFA 1A5RA 3IVFA 1T0YA 2KYWA 2MJDA 4MGZE 2HDEA 3IT4B 4B0EA 3N9YC 5C1ZA 1IP9A 5J18A 1TT5B 1XEEA 1JMLA 5CHVC 4ZRJA 3Q3MC 2X8XX 2L7RA 1YQ3B 2GI9A 2ZVOA 2DZKA 2MBEA 1YNTE 2W55A 1C4CA 2HJ8A 1E7UA 3IAM1 1V5OA 2JZPA 4ANWA 3NVVA 1N5WA 4RNAA 4LNNA 1IPGA 3QJZA 5IN7A 1V2YA 3PZ7A 3TL5A 3GP7A 3T9LA 2D2QA 3KUCB 5BMIA 4G0NB 4CO7A 2JF5A 3RNGC 1V81A 1WFYA 4II3B 5GXGB 2BKRB 2N7JA 2WXPA 4US8A 3OAWA 1KH0A 2J4XA 4PYUA 4A55A 2PIAA 2PEAA 1KFYB 2ON8A 1QOBA 2PLPA 4G50A 1LM8B 2IJ0A 2A4ZA 3OJ3A 3N32A 2BYTA 2M56B 2KLGA 3J9CA 1XO3A 1TS3A 1CMXB 3LYYA 3PRZA 3AI5A 1EF5A 4US9A 1HZ6A 1FRRA 2DNFA 3KYDD 1I42A 4YTMB 4ANXA 2LGSA 1ROEA 1TY2A 1GNUA 3NG0A 4LNFA 3PREA 1FFUA 2OEDA 2K5PA 4KIKB 5HKHA 2M19A 2V1YA 3C19A 2WX1A 3VR9B 4W9EA 5EE0A 2REXA 3OLMD 2D5GA 1TYGB 2BWES 2WYQA 3W1YA 2AYOB 3AEGB 2DHZA 3Q14C 1JALA 3ZRFA 1JCKB 1DGJA 1EWCA 1WGKA 3SDLC 4JIOU 3ZIMA 4DK5A 5DPSA 4DXAB 1E6EB 3A4SC 2G9HD 1M4VA 1T3QA 3WAOA 3PZDA 2XEWA 3DWMA 4B9KA 3NS1A 5LNK1 4RGOS 1T6BX 4FHKA 2M4NA 4ANVA 1MHHE 4TV3A 5JHAA 1WGHA 1VZ7A 2D10A 4DBGA 4W9IA 1EM7A 2W54A 3VHTC 2BB5A 1WYWB 2KDEB 4AJYB 3RPFC 3URYA 5BMGA 3IAS1 2C7MB 3JVZX 3FILA 3QARA 3WIMA 2JYTA 3BK2A 4JQWC 5CTRC 4E74A 1QZEA 3L0WB 1F77A 1F2RI 3NJTA 1SXTA 2N9PC 3UGBB 1VD2A 2Y3AA 2MSED 1KTKA 1I4PA 1VR9A 1DYQA 4GB9A 5EE3A 3OWEB 3FKYA 2N9EB 1ZKHA 3Q8EA 5HG2A 2BVCA 5D3DA 4PT5A 3L4PA 4IM0A 4EKUA 1AW7A 1I4GA 3H9DA 2DAFA 1QOFA 3BWUD 2SEBD 2FCMA 2ZEQA 1L4ZB 4K7UA 3VH4B 1SB3C 1BT0A 4LDTB 5E6OA 3AE9B 2GBMA 2RGFA 2KN5A 3TEWA 2AQ1B 3B2FA 1WGRA 1XCTL 1D4BA 2HE7A 3H7SA 5BYSA 2BT6A 1SEBD 2QIEB 2BS4B 1SE3A 1QLBB 2CJOA 1RAXA 2RPVA 3JSVB 2DX5B 4N6EB 2XN9C 1IBXA 4E71A 4MM3A 2AL3A 4K7SA 2FCQA 3SFEB 3R7QA 3R8BA 2G1EA 1SBBB 2LGIA 4OHJA 3RNBC 4BKSD 1JROA 3AM9A 3PHXB 2N7DA 1WM2A 1TJEA 3AULA 4HPPA 3BY4B 5J17A 5AZFA 1N61A 2VH1A 1DOIA 4ZRQA 1UNSA 5MPOA 3MTNB 3GZNB 3RYTA 3H7PB 2MW5A 3CSTA 1GB4A 1KOTA 1R4MB 1L6VA 4ITKA 4S17A 1N5XA 1R4MI 1JWBD 1FRDA 5LXHA 2IPKD 1PGAA 2A5UA 1VZ6A 3N1ZC 3QWZB 5EDSA 4G11A 2C9WB 2K1FA 1OEYA 3O13A 3GOEA 3VTWA 3ZJTA 3DBSA 2ZW0A 5BYQA 4IDIA 2DZJA 1YQBA 3MJWA 3FAHA 3ZW3A 3SU8X 2CU3A 1OTRB 1NBFC 1QILA 3AN1A 3M95A 3KYCD 4FJVB 4TKNA 2NVUI 3V05A 4KSLC 2WXKA 1JRUA 2M0XA 2FUHB 2VZKB 1IGDA 1KM7A 3V6CB 3A1QB 4WJNA 4WWMA 4CHKA 2BW2A 2WDRB 2UWQA 2IDYA 1U4AA 4W9HA 4DDGD 3N3KB 2MP2A 5I4DA 3AE2B 4C00A 3DVGY 4XX5A 3L54A 1D6EC 2K8CA 1NYQA 4AS1A 4LK0M 3R3MA 1N60A 3Q3NC 1XD3B 4JX1C 1E8WA 3L17A 3GB1A 1ET9A 2KQSA 1D3ZA 2BPSA 1J7AA 2L52A 1P0RA 1TTNA 4GOCA 4NJ7A 1PUTA 2FNJB 3M62B 4ICUA 2R61A 4LNIA 2J0MA 2K6DB 1ZP0B 2CS4A 3RZFA 1T0RC 2QCZA 3ML8A 4FLHA 3APFA 2IO3B 4BOZB 3I3TB 1RWSA 5E6NA 4BBNC 3KLSX 1MHXA 2INDC 2O2VA 3OJ4B 1KLUD 1WXAA 1TZ1A 2HTHA 2RMMA 1WH3A 1PGBA 3Q3FA 1QQRA 3ZVVA 2I2YA 5BMHA 1FFVA 2JVCA 3R7RA 2DYMA 3W2DA 2IGDA 3HM3A 3RCZA 1WXQA 2BYVE 4BBNF 1C77A 2NBUA 3Q3OC 4KKJA 3ZDMC 4CYEA 3R2IA 2LVOA 2MA9B 4EFOA 3HM6X 2D07B 4ZHOA 3NVWA 4KVGB 1FPYA 2MWSB 4M02A 4K1RB 3NZUA 2V4IB 3EFUA 2KZRA 2PVGC 3LB8C 1KF6B 3ZNGC 2ZNVB 2Y5PA 1E7PB 2GBRA 3U52E 4LDTD 4PS7A 4TQ1A 3VDZA 4C4VA 1Q5WB 3RN9C 5L95C 4FN2A 3MHZA 3DBHB 1FEHA 3GE8C 4TMAB 3DBHI 1VDVA 4DHJB 4DXFA 1I4QA 2WP9B 2DYOA 2ICIA 3DWGC 1V8CA 4HLEA 2IYDB 2QHOA 2XK5A 3DHGC 2JX5A 2L76A 2WHIA 4BKGA 4L23A 4AUQC 1WI0A 2JY6A 3RMKC 2JT4B 3GS2A 1TBEA 3P2BA 1YIWA 1GB1A 1PDXA 3QAQA 3VH3B 2O6VB 2KDFB 2GB1A 1NENB 1GUAB 3LJ3A 4DWFA 2N1WA 4HJGE 2J7QB 2KDIA 1WMHB 4C56C 1JWSD 4XDDA 4WIPA 4K3BA 1XLNA 3RNEC 2RDGA 1DOXA 1WJUA 3VUWA 4KX6B 1Z2MA 2K39A 1MFWA 4RM9A 3TCAA 3TMPB 1XLPA 1WSPA 4ARIA 1WGGA 1RRBA 1V1PB 2BQQA 3JW0X 1WX9A 1UGMA 3O65B 4MSMB 3VVWB 3X23A 1E9MA 2I1KA 3PT2B 1HA5A 1YD8U 2WGSA 2ZNVC 3W5VB 1UH6A 4HJKA 1J19A 2BBCA 5TSSA 1VRAB 2D3AA 2B3AA 1E7VA 1OGWA 4FXCA 4ARCA 2KDMA 2J0KA 2CHWA 2WU5B 2KVRA 3B0AA 2GOWA 3CWIA 2VZKD 1I4HA 3DBRB 3DBRI 1WJNA 3W1SC 4QAYA 5AUKA 3ECIA 1RYJA 1WXSA 2WXJA 3TEYA 2Y5CA 4GDLB 3UI3A 1SSNA 2LRUA 4YSXB 4NY0A 1EWYC 2Y5BB 4BOSC 3S2AA 4NNJB 2Z0EB 3TJPA 3ABVB 2L8JA 3A4RA 3DVNU 3ZNZB 4WWPA 3WANA 3ZXVA 1ACCA 2L3ZA 4EUTA 2ACZB 3AEFB 2MHJA 5AZGA 2FCNA 2KLCA 4YWGG 2KTRA 3AB5A 2V3SA 4JPSA 4AJWA 3ZRCA 3B1LX 4GDKB 5H8YE 3IXSA 3HUIA 1SJED 3I5JC 5JXVA 4BKSA 3RZWC 2LUMA 4OZBA 4XWTA 1F52A 4AWJA 2KC2A 3RFZB 2KMMA 3PGEA 1SIJA 2PE9A 2WXIA 4HCPB 4XGAB 1KRHA 1EUVB 2MJEA 3P4SB 2Z59B 4EZKA 1H8CA 1HXYD 2EMSA 3W9CB 4HRSA 2G3QB 1YOVB 3DVNV 1GOZA 2EKEC 3CMMB 2LXAA 2KK8A 4MSQB 5DPWA 1P7FA 3BVGA 3APCA 4K81A 2KAJA 3RULA 2KMCA 2BYFA 3BYTB 3QA8A 1L7YA 1P1AA 1BUIC 4JWSC 2FUG1 1B1ZA 2LJ5A 1TS5A 3MC0B 1VJKA 2KJHB 1TY0A 3PLVA 2E3TA 1EO6A 2QEJC 4ICVA 5KHQA 4GLSC 5G5HA 1FIQA 4I6LB 4AP4C 1ET6A 1YQ4B 2K0PA 1SIFA 3I57A 2IY0B 2FIDA 2E6XA 4HDOA 4WURA 3ENEA 1V1OA 2MRPA 1J8CA 1JWMD 2AWTA 3A9KB 2LXCA 4DDID 2L00B 1ZGUB 3MFGA 4AOFA 4MT5A 3EFCA 3ZXRA 3A9JB 2KHWB 5FKAC 3U4EG 1C79A 4M0WB 1GC6A 1WYGA 3P1MA 2HD5B 2LGDA 2CU1A 3Q8FA 1E5WA 4NAMA 2ZJDA 2CHXA 1J7BA 3LXFA 2PVOD 1UWXA 2N0SB 4DHJD 3QQ8B 4IW0A 3U7DA 3EGRA 4K3CA 4KIKA 3KUZA 4MDKE 4ZYSA 1K53A 2RSUA 1SE9A 3ALBA 3RD2A 1A70A 2WXOA 1UBQA 2KX3A 3R66C 1WXVA 2AQ2B 4USAA 2BWFA 4RGMA 2KWUB 3ZUNA 2NPTB 3K9PB 2R2QA 3L16A 1HZ5A 3VTUA 3TUOA 2O6VD 5FR3A 2B76B 4WH4A 2NMQA 5T8IA 3ZYYX 4C7YA 3V6EB 3ZJVA 3ZJUA 3WCQA 4C80A 4KSKC 2DWQA 1PGXA 3FC4A 2KJ6A 1M94A 2LFIA 3DHIC 4RCOA 1D5MC 3AEAB 3K9OB 4FADA 4MJSB 1BMLC 2K6QA 2PJHA 1L2NA 2OHFA 3ZQ4A 2IY1B 2GBNA 2DZIA 5IO9A 2X38A 4URKA 3P4RB 2BS3B 1FO4A 4HKZE 2WXMA 1WM3A 2ZZPB 2NBVB 1UBIA 2WX0A 3PV1A 1SE2A 1LGRA 2IO0B 3DHHC 3AEBB 2MBOA 2PW9A 2LVPA 2IZVB 1TKEA 3NZ3A 1MPEA 2BGFA 3NVZA 2AL6A 5D94A 2WLBA 4FJZA 2I38A 3RUIB 1FD6A 3UIPB 2VH2A 4XE0A 1ZDVA 4NJ6A 2XBBC 2G45B 2J53A 3M3JA 4RF0A 1CZPA 4OZCA 3AEEB 1RFKA 1V97A 4A3PA 4TQ0A 1YMHE 4WAAA 3I63C 4FULA 1WXMA 4HPMB 5J2RA 2WWZA 1ZUD2 1HE8A 3Q2AC 3P4PB 2LWPA 2EMTA 4F1SA 3GZNI 3JSVA 1WZ0A 1IGCA 2LHEA 1F9JA 4E3CA 2KFJA 3L08A 1DOYA 2D3GA 2DZMA 4OVZA 4TSSA 3KVFB 4ACFA 4FA6A 1JWUD 5BYRA 2LGYA 1Z5SB 2LRWA 1FNVA 3UINB 3AEDB 1NDDA 2WDQB 4HKQA 2W3SA 4Q2JA 2K3UA 1WR6E 3MC8A 1UGJA 1TS4A 5IA7A 1I4XA 4N59A 5HFYA 2K25A 2LVQA 2KO3A 1NEKB 3ZTCA 4XC2A 2K22A 2FIFA 2RDHA 2WXHA 2RD0A 1GC7A 3P63A 4R3DA 4BFRA 4YXDB 3U30A 2KTFA 1D5XC 3TBLD 3NS8A 1JWAD 4MH8A 4DHZB 3H8HA 2I1JA 1WX7A 3AH7A 3M63B 2M1MA 2MEKA 1OQRA 3V61A 3PS6A 2LGXA 2NCNA 4IWPA 4GIVA 4OZAA 1CQVA 1YJIA 1ISNA 1RM6C 1YX5B 2CHZA 2V4LA 3SHQA 4RF1A 2KD0A 2PKOA 2KC1A 4A90A 3CF6E 3A1QA 3DOWA 4WJPA 2K9XA 5CX3A 1WIAA 2L05A 4YSYB 4P1CC 3B9JA 4MELA 1JQ4A 3QIJA 2HTME 3ZNID 3RNAC 4B0MA 2INPE 4LCDE 4LLGM 3AMZA 2WXRA 5HI1A 2FCSA 2MLBA 1SJHD 3UQAA 3PO0A 2KWVB 2TSSA 1AARA 5H92C 2KQ4X 2FBWB 1Y56A
chains in the Genus database with same CATH topology
1JALA 1FCCC 2WXFA 4FXCA 4D2KA 4ARCA 3AE7B 2KDMA 1JCKB 1DGJA 1EWCA 1WGKA 1F2RC 2WU5B 2KACA 1E6EB 2VZKD 3CWIA 3NVYA 2G9HD 1M4VA 1T3QA 2L32A 1I4HA 3AE5B 3BK1A 3DWMA 3SEBA 2WXLA 1R7SA 3NS1A 5LNK1 4RGOS 5AUKA 1T6BX 3Q8AA 3AE1B 1RYJA 2WXJA 3TEYA 4WAFA 2Y5CA 4GDLB 2LJIA 3UI3A 1GAQB 1SSNA 1MHHE 4YSXB 1EWYC 4A6QA 1VZ7A 3E9SA 1EM7A 3ABVB 2W54A 1D5ZC 2BB5A 1NYRA 3VRAB 1CK1A 2H88B 1EU3A 3RPFC 5BMGA 2QJLA 3URYA 1L0YB 3IAS1 1ACCA 2EELA 1ZE3D 3FILA 1ESFA 2ACZB 3AEFB 4REZA 2JYTA 2BB6A 3BK2A 4YWGG 5HHDG 1K50A 1JW9D 3AB5A 1F77A 2WU2B 1F2RI 2IGGA 4JPSA 1SXTA 3AECB 2Y3AA 2QILA 4GDKB 2N9LA 1KTKA 1I4PA 1VR9A 5H8YE 1DYQA 3IXSA 3U2SC 3CIRB 1XLQA 3HUIA 5EE3A 1SJED 3SR6A 3OWEB 1P7EA 5JXVA 3VRBB 3Q8EA 2LUMA 3BVZA 4OZBA 4XWTA 1J7CA 5HG2A 3AE4B 5D3DA 4PT5A 3RFZB 2KMMA 3L4PA 1IUEA 1VLBA 1Q10A 2MJ3A 4NAWB 1SIJA 1AW7A 2WXIA 1I4GA 3Q69A 4KGRA 1KRHA 2MJEA 3P4SB 5D7GA 1HXYD 1QOFA 3W9CB 3T3NA 1FMAD 3BWUD 4HRSA 2SEBD 3VQIA 2WXNA 3I9V1 5EE1A 1FXAA 1GOZA 1JRPA 2J52A 1L4ZB 1XF5L 2LEKA 1P7FA 1SB3C 2NTTA 3BVGA 4HEA1 1MI0A 2KAJA 5C2TB 2N9KA 3BYTB 2SAKA 2W82A 4DQOC 4L2YA 3AE9B 1BUIC 3TEWA 4JWSC 2AQ1B 2FUG1 1B1ZA 1UWMA 3B2FA 1XCTL 1D4BA 1TS5A 2GRIA 3MC0B 1VJKA 5BYSA 2JSVX 4P6VF 2BT6A 1SEBD 4A8XC 1TY0A 2E3TA 2BS4B 2QIEB 1BXTA 1SE3A 1QLBB 2CJOA 5FK9C 2QEJC 4GLSC 2RPVA 5G5HA 1FIQA 1AYFA 4N6EB 2XN9C 1STEA 1ET6A 1IBXA 1YQ4B 2K0PA 4WQMA 3I57A 2H89B 2E6XA 3SFEB 1WRIA 1ZXHA 1SE4A 1FM0D 2IGHA 4KGSA 4WURA 3R8BA 3SFDB 2G1EA 1V1OA 1SBBB 2LGIA 4OHJA 1JROA 3AM9A 1JWMD 4JE3B 1ZDXA 1FXIA 1K52A 3MFGA 2V0GA 1HEZE 1C9FA 4MT5A 4J3OD 1XLOA 1TJEA 3MJ5A 5FKAC 3U4EG 1C79A 4XDCA 4ZOHC 1AWDA 1N61A 1WYGA 3P1MA 1DOIA 1QOGA 1TKYA 2Q5WD 2V3NA 4ZRQA 1UNSA 3Q8FA 5MPOA 3KQ4A 4NAMA 2JQRB 2PTLA 1LO5D 1J7BA 1UUPA 3HVDA 4RH6A 3NUHB 3P42A 3LXFA 2PVOD 1V1PA 2QSDA 4UDUC 4ZHPA 1GB4A 1L6VA 4ITKA 1UWXA 4O1NA 1N5XA 3AE6B 3U7ZA 1JWBD 2N0SB 1FRDA 3AE8B 4OW0A 2IPKD 1PGAA 1VZ6A 3EGRA 2KN4A 1SF0A 1E0ZA 1C4PA 1HQRD 3O13A 4DXGA 3AV8A 3ZJTA 4ZYSA 1K53A 2AX5A 2ZW0A 5BYQA 1A70A 2WXOA 4IDIA 2NTSA 2JU6X 3FAHA 1XCQL 2KWDA 2AQ2B 4L1BA 2CU3A 2FE8A 4USAA 2LMCA 1QILA 2JXTA 3AN1A 4RGMA 4YSZB 1EU4A 5E6JA 3V05A 3P4QB 1HZ5A 2WXKA 3IT6B 3MP9A 3TUOA 3C8YA 4NJCA 5FR3A 2VZKB 2B76B 4WH4A 2NMQA 1PFDA 3R2TA 5D3IB 5T8IA 3ZYYX 1YN3A 4C7YA 2WDVB 1IGDA 2WNMA 4HROA 3ZJVA 3ZJUA 3WCQA 2CJNA 4C80A 1XXGA 1VZ8A 4YT0B 1TKGA 2PMVA 2DWQA 4IKGA 1PGXA 4WWMA 1TS2A 1YJJA 3FC4A 1ZOYB 2LFIA 4RCOA 2BW2A 2WXQA 4IOIE 2WDRB 1CJEA 1D5MC 1OQQA 3AEAB 1QF6A 3NRZA 2IDYA 4MACA 2INNE 1BMLC 4ZRPA 5C3JB 2OHFA 3ZQ4A 5I4DA 3AE2B 1C78A 2X38A 1D6EC 1NYQA 3P4RB 2BS3B 4KGTA 4AS1A 1FO4A 4LK0M 4HKZE 2WXMA 2DLBA 1OFFA 1AN8A 1N60A 1I7HA 4JX1C 1FNWA 3GB1A 1ET9A 5G5GA 1N62A 1J7AA 2L52A 2L83A 1SE2A 1PUTA 3AEBB 3EA6A 2PW9A 3W1SA 1NI3A 1GPXA 1TKEA 1ZPSA 1L5PA 3NZ3A 2R61A 1MPEA 3TEZA 2DBYA 4AQ7A 4CQNA 3NVZA 1ZP0B 4LTUA 1FNUA 3PZ8A 1K51A 2WLBA 1FCLA 2I38A 3BVMA 1FD6A 4XE0A 1L6UA 1ZDVA 1ZXIA 3BZDB 2J53A 3ZGZA 1RWSA 4RF0A 1N63A 1L0XB 1CZPA 3BYYB 3HVZA 3KLSX 1MHXA 4OZCA 1KLUD 4RGNA 2YEPF 3AEEB 1RFKA 3Q8BA 2AQ3B 1B9RA 1V97A 2RMMA 4TQ0A 1YMHE 3TSSA 3E56A 5EE9A 2YEPB 3KWLA 1PGBA 1YN5A 1I4RA 1QQRA 2ZW1A 1QT9A 2W3RA 2I2YA 4RGTA 4P16A 5BMHA 1ZUD2 1FFVA 3FILB 2ONQA 1MVKA 1C4AA 2Z8LA 3P4PB 2DYMA 3W2DA 2IGDA 2MJDA 2HDEA 3IT4B 1IGCA 1WXQA 2LHEA 4B0EA 3T3OA 1QKZA 3N9YC 3Q8CA 1C77A 4YTPB 1DOYA 4KKJA 2J42A 3R2IA 1XEEA 1JMLA 3KWVA 5AUIA 4OVZA 4TSSA 4ZHOA 2JYEA 4YTNB 1E10A 3NVWA 1YQ3B 2GI9A 1JWUD 5BYRA 4XWWA 1YNTE 2EKIA 2V4IB 2W55A 1C4CA 2PVGC 3IAM1 3LB8C 1FNVA 4A9AA 4M0WA 1KF6B 2Y5PA 3VR8B 2JZPA 1PYWD 3NVVA 3AEDB 2WDQB 4HKQA 1F0ZA 1E7PB 2W3SA 1N5WA 4Q2JA 4RNAA 2K3UA 2WQYB 3U52E 1UGJA 1TS4A 4TQ1A 4H2AA 1I4XA 3PZ7A 3GP7A 4N59A 5HFYA 3MHZA 4JWUC 1NEKB 1NVID 3W5UB 1TZOA 2K22A 2WXHA 2RDHA 1FEHA 4TMAB 2WXGA 3P63A 1VDVA 1KLGD 4DXFA 1ENFA 5BMIA 4R3DA 4YXDB 1I4QA 2WP9B 1WWTA 5GXGB 2N7JA 3ETRA 2DYOA 1D5XC 2ICIA 2WXPA 3TEXA 4US8A 1JWAD 4MH8A 2LHDA 1V8CA 3DWGC 2XNAC 3H8HA 1KH0A 2J4XA 4A55A 1IBXB 2PIAA 3V3XA 3AH7A 3AE3B 4MM3B 1KFYB 2MEKA 2ON8A 2JX5A 3BIID 4L23A 1L0VB 1OQRA 1QOBA 2PLPA 2WS3B 3B2GA 2M0AA 2BTEA 3GS2A 4OZAA 3HRDD 1L4DB 1GB1A 2IJ0A 1PDXA 2V3PA 2L1AA 4C7ZA 1CQVA 1YJIA 1RM6C 2BYTA 2M56B 2GB1A 4RF1A 1NENB 1T5XD 2BS2B 2PKOA 3J9CA 1XO3A 4N58A 4A90A 1TS3A 4HJGE 3LYYA 2QMTA 4C56C 2K9XA 1JWSD 4XDDA 4WIPA 1XLNA 4US9A 2RDGA 4YSYB 1DOXA 3B9JA 1HZ6A 4RFBA 4KX6B 1JQ4A 4KKIA 1FRRA 2HTME 2MH7A 1C76A 4B0MA 4EE2A 2INPE 1XLPA 1WSPA 4LLGM 4YTMB 4ARIA 1ROEA 1TY2A 1V1PB 1YN4A 3AMZA 2WXRA 5HI1A 1SJHD 3PO0A 2TSSA 1FFUA 2OEDA 2JWUA 2K5PA 4NZLB 1E9MA 5H92C 2M19A 1HA5A 3VR9B 2KQ4X 3W5VB 5EE0A 3EUB2 2D5GA 1QOAA 1TYGB 2FBWB 2BBCA 5TSSA 1VRAB 3AEGB 1Y56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JAL A;  1QLB B;  2CJO A;  2EKI A;  2W55 A;  4FXC A;  2OHF A;  5C3J B;  3AE7 B;  1DGJ A;  1WGK A;  2PVG C;  3LB8 C;  5G5H A;  3AE2 B;  4A9A A;  1FIQ A;  1KF6 B;  1AYF A;  2WU5 B;  4N6E B;  3VR8 B;  1YQ4 B;  3NVV A;  3AED B;  1NYQ A;  1E6E B;  2WDQ B;  2BS3 B;  3CWI A;  3NVY A;  1E7P B;  1T3Q A;  1N5W A;  2W3S A;  3P4R B;  4WQM A;  2WQY B;  3AE5 B;  2H89 B;  1FO4 A;  3DWM A;  3SFE B;  1OFF A;  1WRI A;  1N60 A;  1I7H A;  4JX1 C;  3SFD B;  1FM0 D;  1R7S A;  3NS1 A;  2G1E A;  5AUK A;  1JRO A;  3AM9 A;  4N59 A;  3AE1 B;  1RYJ A;  4JWU C;  5G5G A;  1NEK B;  1NVI D;  1N62 A;  1J7A A;  3W5U B;  2L52 A;  2Y5C A;  2K22 A;  2L83 A;  1GAQ B;  1FXI A;  4YSX B;  3P63 A;  1VDV A;  1PUT A;  3AEB B;  1EWY C;  1NI3 A;  1GPX A;  1TKE A;  1L5P A;  1TJE A;  1XLO A;  2WP9 B;  1WWT A;  3ABV B;  2W54 A;  5GXG B;  3ETR A;  4YXD B;  1NYR A;  3VRA B;  2DBY A;  4US8 A;  1JWA D;  3NVZ A;  2H88 B;  1V8C A;  1ZP0 B;  3DWG C;  2QJL A;  4LTU A;  3RPF C;  4ZOH C;  1AWD A;  1N61 A;  1WYG A;  2WLB A;  3P1M A;  1DOI A;  1QOG A;  1TKY A;  2PIA A;  2Q5W D;  3AH7 A;  2ACZ B;  3AEF B;  3AE3 B;  1KFY B;  2JX5 A;  3BII D;  5MPO A;  1L6U A;  1ZXI A;  2JQR B;  1L0V B;  1OQR A;  1QOB A;  2WS3 B;  3B2G A;  1J7B A;  1JW9 D;  1RWS A;  3AB5 A;  2WU2 B;  1N63 A;  3LXF A;  2PVO D;  4ZHP A;  3HRD D;  1F0Z A;  1L6V A;  1CZP A;  4ITK A;  3AEC B;  1N5X A;  1PDX A;  3HVZ A;  3AE6 B;  4C7Z A;  1YJI A;  1JWB D;  2N0S B;  1FRD A;  3AE8 B;  5H8Y E;  3CIR B;  1RM6 C;  1XLQ A;  3AEE B;  1RFK A;  1B9R A;  1V97 A;  3HUI A;  2M56 B;  5EE3 A;  3SR6 A;  1NEN B;  2PKO A;  1SF0 A;  2BS2 B;  1E0Z A;  1XO3 A;  4N58 A;  3VRB B;  5EE9 A;  3AV8 A;  1J7C A;  3AE4 B;  3KWL A;  2AX5 A;  2K9X A;  2KMM A;  1A70 A;  3L4P A;  4IDI A;  1QT9 A;  1IUE A;  2W3R A;  1VLB A;  2MJ3 A;  1ZUD 2;  3FAH A;  1FFV A;  1SIJ A;  1XLN A;  4US9 A;  4YSY B;  1DOX A;  3B9J A;  1KRH A;  2CU3 A;  4USA A;  2MJE A;  3P4S B;  4KX6 B;  1JQ4 A;  3P4P B;  3AN1 A;  3W9C B;  1QOF A;  1FRR A;  4YSZ B;  1FMA D;  2HTM E;  2MH7 A;  4HRS A;  1XLP A;  2MJD A;  3P4Q B;  4YTM B;  5EE1 A;  1FXA A;  1WXQ A;  1JRP A;  1ROE A;  3AMZ A;  2B76 B;  2LEK A;  3ZYY X;  1PFD A;  3PO0 A;  4C7Y A;  4YTP B;  1SB3 C;  2WDV B;  1FFU A;  4HRO A;  2K5P A;  2KAJ A;  1DOY A;  3WCQ A;  2CJN A;  5C2T B;  4C80 A;  1E9M A;  5H92 C;  3AE9 B;  4YT0 B;  2M19 A;  1TKG A;  5AUI A;  2DWQ A;  3VR9 B;  4JWS C;  3W5V B;  5EE0 A;  3B2F A;  1UWM A;  4ZHO A;  4WWM A;  1YJJ A;  3FC4 A;  3EUB 2;  1ZOY B;  4YTN B;  1E10 A;  1QOA A;  1TYG B;  2FBW B;  3NVW A;  1VJK A;  2WDR B;  1CJE A;  1OQQ A;  3AEA B;  1YQ3 B;  1QF6 A;  3NRZ A;  4P6V F;  2BT6 A;  3AEG B;  2QIE B;  2E3T A;  2BS4 B; 
#chains in the Genus database with same CATH topology
 3BIN A;  1K8R B;  2K8H A;  3AE7 B;  3HIZ A;  3NVY A;  2L32 A;  4I6P A;  1V6E A;  3PTF C;  2RPQ A;  4MGI E;  4M8N A;  3BK1 A;  3QX1 A;  2LAS A;  4BAX A;  1SGH A;  4GSW A;  4LJP B;  3AE1 B;  1GAQ B;  2KOX A;  2BYE A;  4A6Q A;  4WJQ A;  2KVZ A;  2MBQ A;  1D5Z C;  5JHB A;  3SD5 A;  2H88 B;  1EU3 A;  1XQQ A;  2EEL A;  2C7N B;  1ZE3 D;  2KFK A;  1G6J A;  1ESF A;  4IWO A;  2OOB B;  5HHD G;  1K50 A;  3X0W A;  2WU2 B;  4TUU A;  2IGG A;  3AEC B;  3PSE B;  3V62 A;  2N9L A;  1P3Q U;  3IHP C;  4BVU C;  3U2S C;  3CIR B;  1XLQ A;  1P7E A;  2INC C;  2PE6 B;  3VRB B;  2ZPN A;  3BVZ A;  1J7C A;  3AE4 B;  3L13 A;  3WAP A;  1IUE A;  3APD A;  1WJ4 A;  3PHW B;  5CHW A;  1Q10 A;  4NAW B;  1V86 A;  4KGR A;  2GLS A;  2N1V A;  3T3N A;  2RDB C;  1FMA D;  2WXN A;  2JWZ A;  2DYB A;  2JPH A;  1V5T A;  1FXA A;  3N1Y C;  1JRP A;  2J52 A;  4PK1 A;  4OVU A;  1MG4 A;  1XF5 L;  2NTT A;  4HEA 1;  5C2T B;  2N9K A;  4DQO C;  2SAK A;  4L2Y A;  4K7W A;  2KNB A;  5KHO A;  1UWM A;  1RFA A;  1WE6 A;  1Q0W B;  3D32 A;  2JSV X;  4P6V F;  1WJ6 A;  3PPA A;  2FAZ A;  4EEW A;  4PYZ A;  2MQJ A;  2H89 B;  3VUY A;  4G3X B;  5GMV A;  2IGH A;  1SE4 A;  1FM0 D;  3SFD B;  4ASW C;  2JZZ A;  1HTQ A;  2UU7 A;  4ZYN A;  4ZRI A;  3TIX A;  3NZS A;  4WJO A;  4JE3 B;  2O6V A;  4WWN A;  4XYC A;  1FXI A;  1K52 A;  3QCA A;  2KJR A;  4HDQ A;  1MG8 A;  1HEZ E;  2KDB A;  4JLC A;  4W9C A;  1KLV A;  1XLO A;  2KX0 A;  4IG7 B;  2KMA A;  4FBJ B;  5LLI A;  4NPN A;  1AWD A;  2Q5W D;  4FJY A;  1TIF A;  1C3T A;  3KQ4 A;  4II2 B;  2PTL A;  1LO5 D;  2MBH A;  1UUP A;  3HVD A;  4RH6 A;  1HTO A;  3NHE B;  3P42 A;  2QSD A;  1V1P A;  2KTR B;  3VTV A;  4O1N A;  2N7E A;  2NS5 A;  3AE8 B;  3DPD A;  4OW0 A;  3N1X C;  5IKC M;  2KN4 A;  1SF0 A;  1E0Z A;  4DXG A;  3AV8 A;  3WA0 A;  1S1Q B;  3QHT A;  4HXD A;  2MCN B;  3ZLZ A;  2NTS A;  3ZNH B;  2JU6 X;  1XCQ L;  2KWD A;  4IC7 B;  2JRH A;  2JXT A;  1MJD A;  5D6J B;  5L83 A;  1EU4 A;  5E6J A;  4ZDV A;  3PVL A;  3MP9 A;  3C8Y A;  4NJC A;  1PFD A;  2UYZ B;  3DQV A;  2WDV B;  2WNM A;  4HRO A;  1WE7 A;  1LQB A;  4YT0 B;  2YVC A;  1TKG A;  2PMV A;  4IKG A;  4GDL A;  4PS8 A;  2OJR A;  2PPH A;  1WF9 A;  1GG3 A;  1KJT A;  1CJE A;  1QF6 A;  4LNO A;  3NRZ A;  4MAC A;  4F7Z A;  2INN E;  3ZO5 B;  5C3J B;  2D3C A;  2LI5 A;  3ML9 A;  1C78 A;  4ANU A;  3WAL A;  4BKT A;  1I7H A;  2W9N A;  2C60 A;  3WAM A;  2L0T A;  4GDK A;  1YJ1 A;  1ZPS A;  1L5P A;  4HCN B;  2DBY A;  4RM8 A;  4LTU A;  2ZPY A;  5IP4 D;  1FNU A;  3PZ8 A;  2LZ6 A;  2OJW A;  3BVM A;  4EOY A;  3PRM B;  1ZXI A;  2KXJ A;  3BZD B;  3PRP B;  1N63 A;  1L0X B;  1R4N B;  2IO1 B;  1R4N I;  4RGN A;  3H1U A;  2YEP F;  3Q8B A;  4F8C B;  1UZX B;  1V49 A;  2AQ3 B;  3IBE A;  4GMV A;  3KW5 B;  1YN5 A;  1P9D U;  1I4R A;  4A20 A;  4RGT A;  3FIL B;  2ONQ A;  1MVK A;  1C4A A;  2Z8L A;  1P98 A;  5CHF A;  4S0R A;  4HK2 A;  5C23 A;  5BO4 B;  5DCN A;  2LD9 A;  3T3O A;  1S3S G;  4GXB A;  3UQB A;  1QKZ A;  3GE3 C;  3Q8C A;  4YTP B;  3AU4 A;  2G4D B;  2J42 A;  2LUE A;  3A9K A;  3KWV A;  4LNK A;  2BF8 B;  5AUI A;  2R2O A;  2AEH A;  3N20 C;  2JYE A;  4YTN B;  1E10 A;  2GBK A;  5JH5 C;  3A9J A;  4XWW A;  2CR5 A;  2EKI A;  3IFW B;  1UF0 A;  4A9A A;  1TGZ B;  4M0W A;  3VR8 B;  1PYW D;  2L0F A;  4A3O A;  4XZ4 A;  1F0Z A;  2GBJ A;  2WQY B;  2HJ1 A;  4H2A A;  2N9X A;  4JWU C;  4B6W A;  1NVI D;  3W5U B;  1TZO A;  1E90 A;  3DDC B;  2WXG A;  1KLG D;  4EZL A;  1ENF A;  1C1Y B;  4W9G A;  2V9H A;  1WWT A;  3ETR A;  3TEX A;  2LHD A;  2XNA C;  1V9J A;  1T0S C;  1IBX B;  3V3X A;  3QC8 B;  3AE3 B;  4MM3 B;  3AXC A;  3BII D;  1L0V B;  2WS3 B;  3B2G A;  2NPT A;  2M0A A;  2BTE A;  4J6I A;  3HRD D;  1L4D B;  1OEY J;  3VUX A;  2V3P A;  2L1A A;  4C7Z A;  2VRR B;  3ZKJ C;  4HPL B;  4W9K A;  1T5X D;  2BS2 B;  4N58 A;  2YLM A;  1WR1 A;  2C7H A;  2QMT A;  2KWC A;  4P7I A;  2NBW B;  1GJZ A;  4RFB A;  1I35 A;  4MJS A;  2CKH B;  2RR9 A;  4KKI A;  1LFD A;  2MH7 A;  1C76 A;  4EE2 A;  4P1B C;  2JRI B;  1YN4 A;  4KZC A;  4EZJ A;  4W9F A;  5AZH A;  1F1H A;  1WZ3 A;  3LDZ E;  4WWO A;  2G4S A;  2JWU A;  4NZL B;  4KDL B;  4KDI C;  4X57 B;  5IOI A;  4HVB A;  3EUB 2;  2MBB B;  1QOA A;  3Q3J A;  3EC8 A;  2D3B A;  1FCC C;  4W9L A;  2WXF A;  4D2K A;  1F2R C;  2J0J A;  2KAC A;  3DCG A;  3AE5 B;  3HK0 A;  3SEB A;  2M8S A;  2WXL A;  5AEK B;  1R7S A;  4HWI B;  3DVG X;  3Q8A A;  3OG5 A;  4WAF A;  2LJI A;  3E9S A;  1UEL A;  2ZVN A;  2MX2 A;  1NYR A;  4YL8 A;  3VRA B;  4MH0 E;  1CK1 A;  1WX8 A;  2MP2 B;  2QJL A;  1L0Y B;  1Q1O A;  4DHZ E;  4REZ A;  2BB6 A;  1J0G A;  3H7P A;  4M00 A;  3V60 A;  1JW9 D;  2QIL A;  1ZW7 A;  4MEM A;  3RNF C;  2K8B A;  3KUD B;  3PLU A;  4PS3 A;  5JZE B;  3SR6 A;  4IUM B;  1N6Z A;  4JGH B;  4MGY E;  1H4R A;  1VLB A;  4LJO B;  2MJ3 A;  3Q69 A;  2IO2 B;  5G2N A;  5D7G A;  3VQI A;  3I9V 1;  5EE1 A;  4M8M A;  4KV2 A;  2LEK A;  2O2V B;  2IBI B;  3VAW A;  2JZ3 B;  3RI7 C;  1MI0 A;  2W82 A;  3VXW A;  3U8Z A;  5G55 A;  2BKF A;  1Y8R C;  3IG3 A;  3EEC A;  2GRI A;  3A33 B;  4A8X C;  1BXT A;  5FK9 C;  4N9F 4;  4IM3 A;  5IAA C;  1AYF A;  1STE A;  1RLF A;  5D2M B;  2NR2 A;  1OQY A;  4WQM A;  3VFK A;  5TR5 A;  1WRI A;  1ZXH A;  4KGS A;  3NY5 A;  2GMI C;  4W9D A;  1ZDX A;  2V0G A;  2JXX A;  1C9F A;  4I6N B;  2M17 A;  4J3O D;  3H6N A;  3ZTD A;  2ZCC A;  2N4F A;  3MJ5 A;  2DAJ A;  4XDC A;  4ZOH C;  2KKC A;  1QOG A;  1TKY A;  2V3N A;  3N30 A;  2JQR B;  2KFK B;  2WDT B;  3NUH B;  4C4V B;  3MHS D;  4UDU C;  4ZHP A;  4OVV A;  3AE6 B;  3U7Z A;  3T8M A;  4RMA A;  2ASQ A;  3C0R B;  4B95 A;  4KZ0 A;  1FXT B;  3ZDT A;  4M01 A;  4GGQ A;  1C4P A;  1HQR D;  2AX5 A;  4NQK E;  2KT7 A;  4L1B A;  2FE8 A;  2XK5 B;  3NOB A;  2LMC A;  4JL9 A;  1PQS A;  3MC9 A;  4YSZ B;  1E8Y A;  4WQO B;  3P4Q B;  3IT6 B;  1E8X A;  3KH0 A;  3R2T A;  5D3I B;  1YN3 A;  2CJN A;  1XXG A;  1VZ8 A;  1VCB A;  1WGD A;  5LXI B;  1X1M A;  1TS2 A;  1YJJ A;  1ZOY B;  2WXQ A;  4IOI E;  1OQQ A;  2ZCB A;  4ZRP A;  3ONS A;  3RNC C;  1UD7 A;  1XT9 B;  4KGT A;  4ZRK A;  2D11 A;  3UIO B;  3UF8 A;  2DLB A;  1OFF A;  1AN8 A;  1E8Z A;  5E6P A;  1FNW A;  2DEN B;  3RT3 B;  1V80 A;  3DBL B;  2KQ7 A;  4GU2 A;  3DBL I;  5G5G A;  1N62 A;  2L83 A;  2KAN A;  4IWQ A;  4NQL B;  3EA6 A;  3W1S A;  1NI3 A;  3B08 A;  4BZA A;  1GPX A;  3HHM A;  1WGY A;  3AU5 A;  3TEZ A;  4AQ7 A;  1YX6 B;  2JUO A;  4CQN A;  4IM2 A;  1K51 A;  4NAW A;  1FCL A;  2QDF A;  1EF1 A;  1L6U A;  5DPT A;  3Q6B A;  4FHJ A;  4MGK E;  1WRD B;  3ZGZ A;  1NI2 A;  3BYY B;  3HVZ A;  2C5L C;  4W9J A;  5FR6 A;  1IYF A;  3EHV A;  1B9R A;  3JYU A;  4GN1 A;  3TSS A;  1WMH A;  1WY8 A;  3E56 A;  2QC8 A;  5EE9 A;  2YEP B;  3QK0 A;  3KWL A;  1LXD A;  5DPR A;  1T0Q C;  2ZW1 A;  1QT9 A;  2W3R A;  4P16 A;  3L10 B;  2Z0D B;  3CSF A;  1A5R A;  3IVF A;  1T0Y A;  2KYW A;  2MJD A;  4MGZ E;  2HDE A;  3IT4 B;  4B0E A;  3N9Y C;  5C1Z A;  1IP9 A;  5J18 A;  1TT5 B;  1XEE A;  1JML A;  5CHV C;  4ZRJ A;  3Q3M C;  2X8X X;  2L7R A;  1YQ3 B;  2GI9 A;  2ZVO A;  2DZK A;  2MBE A;  1YNT E;  2W55 A;  1C4C A;  2HJ8 A;  1E7U A;  3IAM 1;  1V5O A;  2JZP A;  4ANW A;  3NVV A;  1N5W A;  4RNA A;  4LNN A;  1IPG A;  3QJZ A;  5IN7 A;  1V2Y A;  3PZ7 A;  3TL5 A;  3GP7 A;  3T9L A;  2D2Q A;  3KUC B;  5BMI A;  4G0N B;  4CO7 A;  2JF5 A;  3RNG C;  1V81 A;  1WFY A;  4II3 B;  5GXG B;  2BKR B;  2N7J A;  2WXP A;  4US8 A;  3OAW A;  1KH0 A;  2J4X A;  4PYU A;  4A55 A;  2PIA A;  2PEA A;  1KFY B;  2ON8 A;  1QOB A;  2PLP A;  4G50 A;  1LM8 B;  2IJ0 A;  2A4Z A;  3OJ3 A;  3N32 A;  2BYT A;  2M56 B;  2KLG A;  3J9C A;  1XO3 A;  1TS3 A;  1CMX B;  3LYY A;  3PRZ A;  3AI5 A;  1EF5 A;  4US9 A;  1HZ6 A;  1FRR A;  2DNF A;  3KYD D;  1I42 A;  4YTM B;  4ANX A;  2LGS A;  1ROE A;  1TY2 A;  1GNU A;  3NG0 A;  4LNF A;  3PRE A;  1FFU A;  2OED A;  2K5P A;  4KIK B;  5HKH A;  2M19 A;  2V1Y A;  3C19 A;  2WX1 A;  3VR9 B;  4W9E A;  5EE0 A;  2REX A;  3OLM D;  2D5G A;  1TYG B;  2BWE S;  2WYQ A;  3W1Y A;  2AYO B;  3AEG B;  2DHZ A;  3Q14 C;  1JAL A;  3ZRF A;  1JCK B;  1DGJ A;  1EWC A;  1WGK A;  3SDL C;  4JIO U;  3ZIM A;  4DK5 A;  5DPS A;  4DXA B;  1E6E B;  3A4S C;  2G9H D;  1M4V A;  1T3Q A;  3WAO A;  3PZD A;  2XEW A;  3DWM A;  4B9K A;  3NS1 A;  5LNK 1;  4RGO S;  1T6B X;  4FHK A;  2M4N A;  4ANV A;  1MHH E;  4TV3 A;  5JHA A;  1WGH A;  1VZ7 A;  2D10 A;  4DBG A;  4W9I A;  1EM7 A;  2W54 A;  3VHT C;  2BB5 A;  1WYW B;  2KDE B;  4AJY B;  3RPF C;  3URY A;  5BMG A;  3IAS 1;  2C7M B;  3JVZ X;  3FIL A;  3QAR A;  3WIM A;  2JYT A;  3BK2 A;  4JQW C;  5CTR C;  4E74 A;  1QZE A;  3L0W B;  1F77 A;  1F2R I;  3NJT A;  1SXT A;  2N9P C;  3UGB B;  1VD2 A;  2Y3A A;  2MSE D;  1KTK A;  1I4P A;  1VR9 A;  1DYQ A;  4GB9 A;  5EE3 A;  3OWE B;  3FKY A;  2N9E B;  1ZKH A;  3Q8E A;  5HG2 A;  2BVC A;  5D3D A;  4PT5 A;  3L4P A;  4IM0 A;  4EKU A;  1AW7 A;  1I4G A;  3H9D A;  2DAF A;  1QOF A;  3BWU D;  2SEB D;  2FCM A;  2ZEQ A;  1L4Z B;  4K7U A;  3VH4 B;  1SB3 C;  1BT0 A;  4LDT B;  5E6O A;  3AE9 B;  2GBM A;  2RGF A;  2KN5 A;  3TEW A;  2AQ1 B;  3B2F A;  1WGR A;  1XCT L;  1D4B A;  2HE7 A;  3H7S A;  5BYS A;  2BT6 A;  1SEB D;  2QIE B;  2BS4 B;  1SE3 A;  1QLB B;  2CJO A;  1RAX A;  2RPV A;  3JSV B;  2DX5 B;  4N6E B;  2XN9 C;  1IBX A;  4E71 A;  4MM3 A;  2AL3 A;  4K7S A;  2FCQ A;  3SFE B;  3R7Q A;  3R8B A;  2G1E A;  1SBB B;  2LGI A;  4OHJ A;  3RNB C;  4BKS D;  1JRO A;  3AM9 A;  3PHX B;  2N7D A;  1WM2 A;  1TJE A;  3AUL A;  4HPP A;  3BY4 B;  5J17 A;  5AZF A;  1N61 A;  2VH1 A;  1DOI A;  4ZRQ A;  1UNS A;  5MPO A;  3MTN B;  3GZN B;  3RYT A;  3H7P B;  2MW5 A;  3CST A;  1GB4 A;  1KOT A;  1R4M B;  1L6V A;  4ITK A;  4S17 A;  1N5X A;  1R4M I;  1JWB D;  1FRD A;  5LXH A;  2IPK D;  1PGA A;  2A5U A;  1VZ6 A;  3N1Z C;  3QWZ B;  5EDS A;  4G11 A;  2C9W B;  2K1F A;  1OEY A;  3O13 A;  3GOE A;  3VTW A;  3ZJT A;  3DBS A;  2ZW0 A;  5BYQ A;  4IDI A;  2DZJ A;  1YQB A;  3MJW A;  3FAH A;  3ZW3 A;  3SU8 X;  2CU3 A;  1OTR B;  1NBF C;  1QIL A;  3AN1 A;  3M95 A;  3KYC D;  4FJV B;  4TKN A;  2NVU I;  3V05 A;  4KSL C;  2WXK A;  1JRU A;  2M0X A;  2FUH B;  2VZK B;  1IGD A;  1KM7 A;  3V6C B;  3A1Q B;  4WJN A;  4WWM A;  4CHK A;  2BW2 A;  2WDR B;  2UWQ A;  2IDY A;  1U4A A;  4W9H A;  4DDG D;  3N3K B;  2MP2 A;  5I4D A;  3AE2 B;  4C00 A;  3DVG Y;  4XX5 A;  3L54 A;  1D6E C;  2K8C A;  1NYQ A;  4AS1 A;  4LK0 M;  3R3M A;  1N60 A;  3Q3N C;  1XD3 B;  4JX1 C;  1E8W A;  3L17 A;  3GB1 A;  1ET9 A;  2KQS A;  1D3Z A;  2BPS A;  1J7A A;  2L52 A;  1P0R A;  1TTN A;  4GOC A;  4NJ7 A;  1PUT A;  2FNJ B;  3M62 B;  4ICU A;  2R61 A;  4LNI A;  2J0M A;  2K6D B;  1ZP0 B;  2CS4 A;  3RZF A;  1T0R C;  2QCZ A;  3ML8 A;  4FLH A;  3APF A;  2IO3 B;  4BOZ B;  3I3T B;  1RWS A;  5E6N A;  4BBN C;  3KLS X;  1MHX A;  2IND C;  2O2V A;  3OJ4 B;  1KLU D;  1WXA A;  1TZ1 A;  2HTH A;  2RMM A;  1WH3 A;  1PGB A;  3Q3F A;  1QQR A;  3ZVV A;  2I2Y A;  5BMH A;  1FFV A;  2JVC A;  3R7R A;  2DYM A;  3W2D A;  2IGD A;  3HM3 A;  3RCZ A;  1WXQ A;  2BYV E;  4BBN F;  1C77 A;  2NBU A;  3Q3O C;  4KKJ A;  3ZDM C;  4CYE A;  3R2I A;  2LVO A;  2MA9 B;  4EFO A;  3HM6 X;  2D07 B;  4ZHO A;  3NVW A;  4KVG B;  1FPY A;  2MWS B;  4M02 A;  4K1R B;  3NZU A;  2V4I B;  3EFU A;  2KZR A;  2PVG C;  3LB8 C;  1KF6 B;  3ZNG C;  2ZNV B;  2Y5P A;  1E7P B;  2GBR A;  3U52 E;  4LDT D;  4PS7 A;  4TQ1 A;  3VDZ A;  4C4V A;  1Q5W B;  3RN9 C;  5L95 C;  4FN2 A;  3MHZ A;  3DBH B;  1FEH A;  3GE8 C;  4TMA B;  3DBH I;  1VDV A;  4DHJ B;  4DXF A;  1I4Q A;  2WP9 B;  2DYO A;  2ICI A;  3DWG C;  1V8C A;  4HLE A;  2IYD B;  2QHO A;  2XK5 A;  3DHG C;  2JX5 A;  2L76 A;  2WHI A;  4BKG A;  4L23 A;  4AUQ C;  1WI0 A;  2JY6 A;  3RMK C;  2JT4 B;  3GS2 A;  1TBE A;  3P2B A;  1YIW A;  1GB1 A;  1PDX A;  3QAQ A;  3VH3 B;  2O6V B;  2KDF B;  2GB1 A;  1NEN B;  1GUA B;  3LJ3 A;  4DWF A;  2N1W A;  4HJG E;  2J7Q B;  2KDI A;  1WMH B;  4C56 C;  1JWS D;  4XDD A;  4WIP A;  4K3B A;  1XLN A;  3RNE C;  2RDG A;  1DOX A;  1WJU A;  3VUW A;  4KX6 B;  1Z2M A;  2K39 A;  1MFW A;  4RM9 A;  3TCA A;  3TMP B;  1XLP A;  1WSP A;  4ARI A;  1WGG A;  1RRB A;  1V1P B;  2BQQ A;  3JW0 X;  1WX9 A;  1UGM A;  3O65 B;  4MSM B;  3VVW B;  3X23 A;  1E9M A;  2I1K A;  3PT2 B;  1HA5 A;  1YD8 U;  2WGS A;  2ZNV C;  3W5V B;  1UH6 A;  4HJK A;  1J19 A;  2BBC A;  5TSS A;  1VRA B;  2D3A A;  2B3A A;  1E7V A;  1OGW A;  4FXC A;  4ARC A;  2KDM A;  2J0K A;  2CHW A;  2WU5 B;  2KVR A;  3B0A A;  2GOW A;  3CWI A;  2VZK D;  1I4H A;  3DBR B;  3DBR I;  1WJN A;  3W1S C;  4QAY A;  5AUK A;  3ECI A;  1RYJ A;  1WXS A;  2WXJ A;  3TEY A;  2Y5C A;  4GDL B;  3UI3 A;  1SSN A;  2LRU A;  4YSX B;  4NY0 A;  1EWY C;  2Y5B B;  4BOS C;  3S2A A;  4NNJ B;  2Z0E B;  3TJP A;  3ABV B;  2L8J A;  3A4R A;  3DVN U;  3ZNZ B;  4WWP A;  3WAN A;  3ZXV A;  1ACC A;  2L3Z A;  4EUT A;  2ACZ B;  3AEF B;  2MHJ A;  5AZG A;  2FCN A;  2KLC A;  4YWG G;  2KTR A;  3AB5 A;  2V3S A;  4JPS A;  4AJW A;  3ZRC A;  3B1L X;  4GDK B;  5H8Y E;  3IXS A;  3HUI A;  1SJE D;  3I5J C;  5JXV A;  4BKS A;  3RZW C;  2LUM A;  4OZB A;  4XWT A;  1F52 A;  4AWJ A;  2KC2 A;  3RFZ B;  2KMM A;  3PGE A;  1SIJ A;  2PE9 A;  2WXI A;  4HCP B;  4XGA B;  1KRH A;  1EUV B;  2MJE A;  3P4S B;  2Z59 B;  4EZK A;  1H8C A;  1HXY D;  2EMS A;  3W9C B;  4HRS A;  2G3Q B;  1YOV B;  3DVN V;  1GOZ A;  2EKE C;  3CMM B;  2LXA A;  2KK8 A;  4MSQ B;  5DPW A;  1P7F A;  3BVG A;  3APC A;  4K81 A;  2KAJ A;  3RUL A;  2KMC A;  2BYF A;  3BYT B;  3QA8 A;  1L7Y A;  1P1A A;  1BUI C;  4JWS C;  2FUG 1;  1B1Z A;  2LJ5 A;  1TS5 A;  3MC0 B;  1VJK A;  2KJH B;  1TY0 A;  3PLV A;  2E3T A;  1EO6 A;  2QEJ C;  4ICV A;  5KHQ A;  4GLS C;  5G5H A;  1FIQ A;  4I6L B;  4AP4 C;  1ET6 A;  1YQ4 B;  2K0P A;  1SIF A;  3I57 A;  2IY0 B;  2FID A;  2E6X A;  4HDO A;  4WUR A;  3ENE A;  1V1O A;  2MRP A;  1J8C A;  1JWM D;  2AWT A;  3A9K B;  2LXC A;  4DDI D;  2L00 B;  1ZGU B;  3MFG A;  4AOF A;  4MT5 A;  3EFC A;  3ZXR A;  3A9J B;  2KHW B;  5FKA C;  3U4E G;  1C79 A;  4M0W B;  1GC6 A;  1WYG A;  3P1M A;  2HD5 B;  2LGD A;  2CU1 A;  3Q8F A;  1E5W A;  4NAM A;  2ZJD A;  2CHX A;  1J7B A;  3LXF A;  2PVO D;  1UWX A;  2N0S B;  4DHJ D;  3QQ8 B;  4IW0 A;  3U7D A;  3EGR A;  4K3C A;  4KIK A;  3KUZ A;  4MDK E;  4ZYS A;  1K53 A;  2RSU A;  1SE9 A;  3ALB A;  3RD2 A;  1A70 A;  2WXO A;  1UBQ A;  2KX3 A;  3R66 C;  1WXV A;  2AQ2 B;  4USA A;  2BWF A;  4RGM A;  2KWU B;  3ZUN A;  2NPT B;  3K9P B;  2R2Q A;  3L16 A;  1HZ5 A;  3VTU A;  3TUO A;  2O6V D;  5FR3 A;  2B76 B;  4WH4 A;  2NMQ A;  5T8I A;  3ZYY X;  4C7Y A;  3V6E B;  3ZJV A;  3ZJU A;  3WCQ A;  4C80 A;  4KSK C;  2DWQ A;  1PGX A;  3FC4 A;  2KJ6 A;  1M94 A;  2LFI A;  3DHI C;  4RCO A;  1D5M C;  3AEA B;  3K9O B;  4FAD A;  4MJS B;  1BML C;  2K6Q A;  2PJH A;  1L2N A;  2OHF A;  3ZQ4 A;  2IY1 B;  2GBN A;  2DZI A;  5IO9 A;  2X38 A;  4URK A;  3P4R B;  2BS3 B;  1FO4 A;  4HKZ E;  2WXM A;  1WM3 A;  2ZZP B;  2NBV B;  1UBI A;  2WX0 A;  3PV1 A;  1SE2 A;  1LGR A;  2IO0 B;  3DHH C;  3AEB B;  2MBO A;  2PW9 A;  2LVP A;  2IZV B;  1TKE A;  3NZ3 A;  1MPE A;  2BGF A;  3NVZ A;  2AL6 A;  5D94 A;  2WLB A;  4FJZ A;  2I38 A;  3RUI B;  1FD6 A;  3UIP B;  2VH2 A;  4XE0 A;  1ZDV A;  4NJ6 A;  2XBB C;  2G45 B;  2J53 A;  3M3J A;  4RF0 A;  1CZP A;  4OZC A;  3AEE B;  1RFK A;  1V97 A;  4A3P A;  4TQ0 A;  1YMH E;  4WAA A;  3I63 C;  4FUL A;  1WXM A;  4HPM B;  5J2R A;  2WWZ A;  1ZUD 2;  1HE8 A;  3Q2A C;  3P4P B;  2LWP A;  2EMT A;  4F1S A;  3GZN I;  3JSV A;  1WZ0 A;  1IGC A;  2LHE A;  1F9J A;  4E3C A;  2KFJ A;  3L08 A;  1DOY A;  2D3G A;  2DZM A;  4OVZ A;  4TSS A;  3KVF B;  4ACF A;  4FA6 A;  1JWU D;  5BYR A;  2LGY A;  1Z5S B;  2LRW A;  1FNV A;  3UIN B;  3AED B;  1NDD A;  2WDQ B;  4HKQ A;  2W3S A;  4Q2J A;  2K3U A;  1WR6 E;  3MC8 A;  1UGJ A;  1TS4 A;  5IA7 A;  1I4X A;  4N59 A;  5HFY A;  2K25 A;  2LVQ A;  2KO3 A;  1NEK B;  3ZTC A;  4XC2 A;  2K22 A;  2FIF A;  2RDH A;  2WXH A;  2RD0 A;  1GC7 A;  3P63 A;  4R3D A;  4BFR A;  4YXD B;  3U30 A;  2KTF A;  1D5X C;  3TBL D;  3NS8 A;  1JWA D;  4MH8 A;  4DHZ B;  3H8H A;  2I1J A;  1WX7 A;  3AH7 A;  3M63 B;  2M1M A;  2MEK A;  1OQR A;  3V61 A;  3PS6 A;  2LGX A;  2NCN A;  4IWP A;  4GIV A;  4OZA A;  1CQV A;  1YJI A;  1ISN A;  1RM6 C;  1YX5 B;  2CHZ A;  2V4L A;  3SHQ A;  4RF1 A;  2KD0 A;  2PKO A;  2KC1 A;  4A90 A;  3CF6 E;  3A1Q A;  3DOW A;  4WJP A;  2K9X A;  5CX3 A;  1WIA A;  2L05 A;  4YSY B;  4P1C C;  3B9J A;  4MEL A;  1JQ4 A;  3QIJ A;  2HTM E;  3ZNI D;  3RNA C;  4B0M A;  2INP E;  4LCD E;  4LLG M;  3AMZ A;  2WXR A;  5HI1 A;  2FCS A;  2MLB A;  1SJH D;  3UQA A;  3PO0 A;  2KWV B;  2TSS A;  1AAR A;  5H92 C;  2KQ4 X;  2FBW B;  1Y56 A; 
#chains in the Genus database with same CATH homology
 1JAL A;  1FCC C;  2WXF A;  4FXC A;  4D2K A;  4ARC A;  3AE7 B;  2KDM A;  1JCK B;  1DGJ A;  1EWC A;  1WGK A;  1F2R C;  2WU5 B;  2KAC A;  1E6E B;  2VZK D;  3CWI A;  3NVY A;  2G9H D;  1M4V A;  1T3Q A;  2L32 A;  1I4H A;  3AE5 B;  3BK1 A;  3DWM A;  3SEB A;  2WXL A;  1R7S A;  3NS1 A;  5LNK 1;  4RGO S;  5AUK A;  1T6B X;  3Q8A A;  3AE1 B;  1RYJ A;  2WXJ A;  3TEY A;  4WAF A;  2Y5C A;  4GDL B;  2LJI A;  3UI3 A;  1GAQ B;  1SSN A;  1MHH E;  4YSX B;  1EWY C;  4A6Q A;  1VZ7 A;  3E9S A;  1EM7 A;  3ABV B;  2W54 A;  1D5Z C;  2BB5 A;  1NYR A;  3VRA B;  1CK1 A;  2H88 B;  1EU3 A;  3RPF C;  5BMG A;  2QJL A;  3URY A;  1L0Y B;  3IAS 1;  1ACC A;  2EEL A;  1ZE3 D;  3FIL A;  1ESF A;  2ACZ B;  3AEF B;  4REZ A;  2JYT A;  2BB6 A;  3BK2 A;  4YWG G;  5HHD G;  1K50 A;  1JW9 D;  3AB5 A;  1F77 A;  2WU2 B;  1F2R I;  2IGG A;  4JPS A;  1SXT A;  3AEC B;  2Y3A A;  2QIL A;  4GDK B;  2N9L A;  1KTK A;  1I4P A;  1VR9 A;  5H8Y E;  1DYQ A;  3IXS A;  3U2S C;  3CIR B;  1XLQ A;  3HUI A;  5EE3 A;  1SJE D;  3SR6 A;  3OWE B;  1P7E A;  5JXV A;  3VRB B;  3Q8E A;  2LUM A;  3BVZ A;  4OZB A;  4XWT A;  1J7C A;  5HG2 A;  3AE4 B;  5D3D A;  4PT5 A;  3RFZ B;  2KMM A;  3L4P A;  1IUE A;  1VLB A;  1Q10 A;  2MJ3 A;  4NAW B;  1SIJ A;  1AW7 A;  2WXI A;  1I4G A;  3Q69 A;  4KGR A;  1KRH A;  2MJE A;  3P4S B;  5D7G A;  1HXY D;  1QOF A;  3W9C B;  3T3N A;  1FMA D;  3BWU D;  4HRS A;  2SEB D;  3VQI A;  2WXN A;  3I9V 1;  5EE1 A;  1FXA A;  1GOZ A;  1JRP A;  2J52 A;  1L4Z B;  1XF5 L;  2LEK A;  1P7F A;  1SB3 C;  2NTT A;  3BVG A;  4HEA 1;  1MI0 A;  2KAJ A;  5C2T B;  2N9K A;  3BYT B;  2SAK A;  2W82 A;  4DQO C;  4L2Y A;  3AE9 B;  1BUI C;  3TEW A;  4JWS C;  2AQ1 B;  2FUG 1;  1B1Z A;  1UWM A;  3B2F A;  1XCT L;  1D4B A;  1TS5 A;  2GRI A;  3MC0 B;  1VJK A;  5BYS A;  2JSV X;  4P6V F;  2BT6 A;  1SEB D;  4A8X C;  1TY0 A;  2E3T A;  2BS4 B;  2QIE B;  1BXT A;  1SE3 A;  1QLB B;  2CJO A;  5FK9 C;  2QEJ C;  4GLS C;  2RPV A;  5G5H A;  1FIQ A;  1AYF A;  4N6E B;  2XN9 C;  1STE A;  1ET6 A;  1IBX A;  1YQ4 B;  2K0P A;  4WQM A;  3I57 A;  2H89 B;  2E6X A;  3SFE B;  1WRI A;  1ZXH A;  1SE4 A;  1FM0 D;  2IGH A;  4KGS A;  4WUR A;  3R8B A;  3SFD B;  2G1E A;  1V1O A;  1SBB B;  2LGI A;  4OHJ A;  1JRO A;  3AM9 A;  1JWM D;  4JE3 B;  1ZDX A;  1FXI A;  1K52 A;  3MFG A;  2V0G A;  1HEZ E;  1C9F A;  4MT5 A;  4J3O D;  1XLO A;  1TJE A;  3MJ5 A;  5FKA C;  3U4E G;  1C79 A;  4XDC A;  4ZOH C;  1AWD A;  1N61 A;  1WYG A;  3P1M A;  1DOI A;  1QOG A;  1TKY A;  2Q5W D;  2V3N A;  4ZRQ A;  1UNS A;  3Q8F A;  5MPO A;  3KQ4 A;  4NAM A;  2JQR B;  2PTL A;  1LO5 D;  1J7B A;  1UUP A;  3HVD A;  4RH6 A;  3NUH B;  3P42 A;  3LXF A;  2PVO D;  1V1P A;  2QSD A;  4UDU C;  4ZHP A;  1GB4 A;  1L6V A;  4ITK A;  1UWX A;  4O1N A;  1N5X A;  3AE6 B;  3U7Z A;  1JWB D;  2N0S B;  1FRD A;  3AE8 B;  4OW0 A;  2IPK D;  1PGA A;  1VZ6 A;  3EGR A;  2KN4 A;  1SF0 A;  1E0Z A;  1C4P A;  1HQR D;  3O13 A;  4DXG A;  3AV8 A;  3ZJT A;  4ZYS A;  1K53 A;  2AX5 A;  2ZW0 A;  5BYQ A;  1A70 A;  2WXO A;  4IDI A;  2NTS A;  2JU6 X;  3FAH A;  1XCQ L;  2KWD A;  2AQ2 B;  4L1B A;  2CU3 A;  2FE8 A;  4USA A;  2LMC A;  1QIL A;  2JXT A;  3AN1 A;  4RGM A;  4YSZ B;  1EU4 A;  5E6J A;  3V05 A;  3P4Q B;  1HZ5 A;  2WXK A;  3IT6 B;  3MP9 A;  3TUO A;  3C8Y A;  4NJC A;  5FR3 A;  2VZK B;  2B76 B;  4WH4 A;  2NMQ A;  1PFD A;  3R2T A;  5D3I B;  5T8I A;  3ZYY X;  1YN3 A;  4C7Y A;  2WDV B;  1IGD A;  2WNM A;  4HRO A;  3ZJV A;  3ZJU A;  3WCQ A;  2CJN A;  4C80 A;  1XXG A;  1VZ8 A;  4YT0 B;  1TKG A;  2PMV A;  2DWQ A;  4IKG A;  1PGX A;  4WWM A;  1TS2 A;  1YJJ A;  3FC4 A;  1ZOY B;  2LFI A;  4RCO A;  2BW2 A;  2WXQ A;  4IOI E;  2WDR B;  1CJE A;  1D5M C;  1OQQ A;  3AEA B;  1QF6 A;  3NRZ A;  2IDY A;  4MAC A;  2INN E;  1BML C;  4ZRP A;  5C3J B;  2OHF A;  3ZQ4 A;  5I4D A;  3AE2 B;  1C78 A;  2X38 A;  1D6E C;  1NYQ A;  3P4R B;  2BS3 B;  4KGT A;  4AS1 A;  1FO4 A;  4LK0 M;  4HKZ E;  2WXM A;  2DLB A;  1OFF A;  1AN8 A;  1N60 A;  1I7H A;  4JX1 C;  1FNW A;  3GB1 A;  1ET9 A;  5G5G A;  1N62 A;  1J7A A;  2L52 A;  2L83 A;  1SE2 A;  1PUT A;  3AEB B;  3EA6 A;  2PW9 A;  3W1S A;  1NI3 A;  1GPX A;  1TKE A;  1ZPS A;  1L5P A;  3NZ3 A;  2R61 A;  1MPE A;  3TEZ A;  2DBY A;  4AQ7 A;  4CQN A;  3NVZ A;  1ZP0 B;  4LTU A;  1FNU A;  3PZ8 A;  1K51 A;  2WLB A;  1FCL A;  2I38 A;  3BVM A;  1FD6 A;  4XE0 A;  1L6U A;  1ZDV A;  1ZXI A;  3BZD B;  2J53 A;  3ZGZ A;  1RWS A;  4RF0 A;  1N63 A;  1L0X B;  1CZP A;  3BYY B;  3HVZ A;  3KLS X;  1MHX A;  4OZC A;  1KLU D;  4RGN A;  2YEP F;  3AEE B;  1RFK A;  3Q8B A;  2AQ3 B;  1B9R A;  1V97 A;  2RMM A;  4TQ0 A;  1YMH E;  3TSS A;  3E56 A;  5EE9 A;  2YEP B;  3KWL A;  1PGB A;  1YN5 A;  1I4R A;  1QQR A;  2ZW1 A;  1QT9 A;  2W3R A;  2I2Y A;  4RGT A;  4P16 A;  5BMH A;  1ZUD 2;  1FFV A;  3FIL B;  2ONQ A;  1MVK A;  1C4A A;  2Z8L A;  3P4P B;  2DYM A;  3W2D A;  2IGD A;  2MJD A;  2HDE A;  3IT4 B;  1IGC A;  1WXQ A;  2LHE A;  4B0E A;  3T3O A;  1QKZ A;  3N9Y C;  3Q8C A;  1C77 A;  4YTP B;  1DOY A;  4KKJ A;  2J42 A;  3R2I A;  1XEE A;  1JML A;  3KWV A;  5AUI A;  4OVZ A;  4TSS A;  4ZHO A;  2JYE A;  4YTN B;  1E10 A;  3NVW A;  1YQ3 B;  2GI9 A;  1JWU D;  5BYR A;  4XWW A;  1YNT E;  2EKI A;  2V4I B;  2W55 A;  1C4C A;  2PVG C;  3IAM 1;  3LB8 C;  1FNV A;  4A9A A;  4M0W A;  1KF6 B;  2Y5P A;  3VR8 B;  2JZP A;  1PYW D;  3NVV A;  3AED B;  2WDQ B;  4HKQ A;  1F0Z A;  1E7P B;  2W3S A;  1N5W A;  4Q2J A;  4RNA A;  2K3U A;  2WQY B;  3U52 E;  1UGJ A;  1TS4 A;  4TQ1 A;  4H2A A;  1I4X A;  3PZ7 A;  3GP7 A;  4N59 A;  5HFY A;  3MHZ A;  4JWU C;  1NEK B;  1NVI D;  3W5U B;  1TZO A;  2K22 A;  2WXH A;  2RDH A;  1FEH A;  4TMA B;  2WXG A;  3P63 A;  1VDV A;  1KLG D;  4DXF A;  1ENF A;  5BMI A;  4R3D A;  4YXD B;  1I4Q A;  2WP9 B;  1WWT A;  5GXG B;  2N7J A;  3ETR A;  2DYO A;  1D5X C;  2ICI A;  2WXP A;  3TEX A;  4US8 A;  1JWA D;  4MH8 A;  2LHD A;  1V8C A;  3DWG C;  2XNA C;  3H8H A;  1KH0 A;  2J4X A;  4A55 A;  1IBX B;  2PIA A;  3V3X A;  3AH7 A;  3AE3 B;  4MM3 B;  1KFY B;  2MEK A;  2ON8 A;  2JX5 A;  3BII D;  4L23 A;  1L0V B;  1OQR A;  1QOB A;  2PLP A;  2WS3 B;  3B2G A;  2M0A A;  2BTE A;  3GS2 A;  4OZA A;  3HRD D;  1L4D B;  1GB1 A;  2IJ0 A;  1PDX A;  2V3P A;  2L1A A;  4C7Z A;  1CQV A;  1YJI A;  1RM6 C;  2BYT A;  2M56 B;  2GB1 A;  4RF1 A;  1NEN B;  1T5X D;  2BS2 B;  2PKO A;  3J9C A;  1XO3 A;  4N58 A;  4A90 A;  1TS3 A;  4HJG E;  3LYY A;  2QMT A;  4C56 C;  2K9X A;  1JWS D;  4XDD A;  4WIP A;  1XLN A;  4US9 A;  2RDG A;  4YSY B;  1DOX A;  3B9J A;  1HZ6 A;  4RFB A;  4KX6 B;  1JQ4 A;  4KKI A;  1FRR A;  2HTM E;  2MH7 A;  1C76 A;  4B0M A;  4EE2 A;  2INP E;  1XLP A;  1WSP A;  4LLG M;  4YTM B;  4ARI A;  1ROE A;  1TY2 A;  1V1P B;  1YN4 A;  3AMZ A;  2WXR A;  5HI1 A;  1SJH D;  3PO0 A;  2TSS A;  1FFU A;  2OED A;  2JWU A;  2K5P A;  4NZL B;  1E9M A;  5H92 C;  2M19 A;  1HA5 A;  3VR9 B;  2KQ4 X;  3W5V B;  5EE0 A;  3EUB 2;  2D5G A;  1QOA A;  1TYG B;  2FBW B;  2BBC A;  5TSS A;  1VRA B;  3AEG B;  1Y56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...