1YJJA

Rdc-refined solution nmr structure of oxidized putidaredoxin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-dependent structural differences in putidaredoxin derived from homologous structure refinement via residual dipolar couplings.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Electron transport
molecule keywords Putidaredoxin
total genus 16
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yjjA00
3AH7A 2K5PA 4WQMA 3AEDB 3AB5A 1FRDA 2PIAA 4P6VF 3AN1A 1ZP0B 2AX5A 1L5PA 2ACZB 3P1MA 1N5WA 1JQ4A 1F0ZA 1FRRA 2H88B 1YJIA 4N59A 1FXIA 5H8YE 2QIEB 3AEGB 4N58A 1TYGB 2HTME 1N60A 1XO3A 1JW9D 1NYQA 3PO0A 3NVYA 3NVVA 1TKYA 1JWAD 3VR9B 2WDRB 1E10A 1ROEA 1SF0A 2BS2B 4ITKA 1VDVA 1RYJA 1UWMA 3AE5B 5G5GA 3VRBB 1XLNA 1E0ZA 4A9AA 3SFDB 4JWSC 1SIJA 3P63A 3AEEB 1N63A 2N0SB 1R7SA 3NVWA 1JROA 2WU2B 1B9RA 2PVGC 1WWTA 3AECB 5H92C 3ZYYX 3B9JA 1QF6A 1KF6B 2MJ3A 3NS1A 3RPFC 1KRHA 2MJEA 3EUB2 2PKOA 4YTMB 4FXCA 4C7YA 3KWLA 3AE7B 1FO4A 1E6EB 2M56B 2BS4B 1DOXA 5EE9A 1QOAA 3AV8A 2W54A 1EWYC 2OHFA 1TKEA 1RFKA 1VLBA 1PFDA 1ZOYB 2W3RA 4YSYB 2W3SA 1SB3C 4YSZB 3AMZA 1FM0D 1PDXA 1N5XA 3SR6A 1JRPA 1L6VA 4N6EB 4YSXB 4US9A 1J7BA 3AEAB 1CZPA 2FBWB 1YQ4B 3BIID 3B2GA 2KAJA 1KFYB 2W55A 3HVZA 1CJEA 3DWMA 5AUIA 3W5VB 3W5UB 1V8CA 3CIRB 3L4PA 3AE6B 1GPXA 1WXQA 2K22A 1FFVA 4YTNB 1OQQA 2L52A 1T3QA 2G1EA 2KMMA 2WP9B 3FC4A 2Y5CA 4KX6B 4ZHPA 1DGJA 3NVZA 2B76B 1WRIA 1XLQA 1N61A 1XLOA 2PVOD 3HUIA 1FFUA 4ZOHC 5C3JB 1N62A 4YTPB 2WS3B 2JQRB 2WU5B 1FIQA 3B2FA 3SFEB 1AWDA 2EKIA 1QLBB 1DOIA 3AE8B 3ETRA 4HRSA 3VR8B 2WLBA 4YXDB 1V97A 1NYRA 4WWMA 1I7HA 3AE4B 3W9CB 4C80A 1JALA 1VJKA 3VRAB 1RWSA 1FMAD 1QT9A 4HROA 1RM6C 1WGKA 2QJLA 2LEKA 1XLPA 2L83A 1DOYA 4LTUA 3LB8C 1J7AA 1ZUD2 3AE2B 5EE3A 5EE0A 4YT0B 1QOBA 4C7ZA 2CJOA 2BT6A 1NENB 3AM9A 3P4QB 1J7CA 1NI3A 2H89B 3DWGC 2WDQB 3FAHA 5AUKA 1YJJA 3CWIA 2E3TA 1TJEA 2CJNA 3ABVB 3AE3B 3LXFA 3P4PB 1QOFA 1YQ3B 1GAQB 3NRZA 4JX1C 1E7PB 1E9MA 1AYFA 1TKGA 1WYGA 2MJDA 4USAA 3AEBB 2WQYB 3P4RB 1ZXIA 2CU3A 3AE9B 5GXGB 1L6UA 1FXAA 2Q5WD 4JWUC 1IUEA 2DWQA 1JWBD 2K9XA 1PUTA 5G5HA 2MH7A 1NVID 1OQRA 2JX5A 1A70A 3WCQA 5C2TB 2BS3B 2DBYA 2WDVB 2M19A 1OFFA 3AEFB 3HRDD 5EE1A 1NEKB 3AE1B 4ZHOA 4US8A 1L0VB 3P4SB 5MPOA 1QOGA 4IDIA
chains in the Genus database with same CATH superfamily
3BK2A 1N6ZA 2K5PA 4HK2A 4RGMA 2MHJA 3AN1A 2CHZA 1ZKHA 1U4AA 2H88B 2AQ3B 2WDTB 3LJ3A 2O2VB 3M3JA 2YEPB 1WMHB 3PZDA 2FAZA 3Q8EA 4GN1A 1MG4A 1P9DU 2KVZA 4XDDA 1V6EA 2KWVB 5D3DA 3EUB2 2KFJA 5CHFA 3EA6A 4C7YA 2I2YA 2GBNA 1FO4A 4RFBA 3HIZA 1TKEA 1ZOYB 1OGWA 1BXTA 4YSXB 4P16A 1UD7A 3BIID 1NI2A 2KAJA 1KFYB 3TMPB 4B6WA 3AE6B 2KX3A 1LGRA 5TSSA 1V49A 4MH0E 2B76B 3M63B 3WANA 3T9LA 2JU6X 2I38A 2WU5B 2RPQA 3RZFA 4K7SA 3DBRB 1WJ6A 4DK5A 1RLFA 3VRAB 1K52A 2ZNVB 1WGYA 1XQQA 1WE7A 4MEMA 2L83A 3FILA 1ET6A 5IAAC 2DLBA 3A9JA 3PS6A 2BQQA 2K6QA 3R7RA 3PSEB 1KTKA 1WMHA 1YQ3B 3OWEB 2WQYB 3AE9B 2K9XA 2DAFA 4A55A 4WWNA 5C2TB 1R4NB 1Q1OA 1YX6B 4ARCA 1BUIC 3PREA 1FD6A 2K8CA 5T8IA 1JQ4A 2YVCA 4TSSA 4NPNA 1D3ZA 2G9HD 3PT2B 2MBOA 1NYQA 3A9KB 3DBLB 3QIJA 2WXOA 1XLNA 4A9AA 4PS7A 2KDEB 1WX9A 3ZYYX 1SEBD 2JYTA 1GOZA 4II3B 2MBBB 1R4MI 1Q5WB 1OEYA 3ZDMC 3P2BA 2REXA 3LDZE 1B1ZA 4LNOA 2EKEC 4BKGA 4FA6A 1D5ZC 2JRHA 3HM6X 5D7GA 3B1LX 2KT7A 2FE8A 4NNJB 4WQOB 2WNMA 5BMIA 2HJ1A 3VTUA 4CHKA 2KN4A 3ECIA 3CIRB 3L4PA 1GPXA 4YTNB 4BKSA 3KW5B 1IP9A 4YTPB 2KTRB 2ZW0A 2OEDA 2DENB 4ZRJA 3ETRA 4RF1A 2G4SA 3UF8A 2IGHA 4I6PA 1KJTA 3N1YC 3EECA 1P1AA 4ANVA 3FAHA 2H89B 4NJCA 4W9JA 3JSVA 3AE3B 3IFWB 1QOFA 1TS4A 2Y3AA 2GB1A 4G50A 3VUWA 5AEKB 2KDFB 4NAMA 4JWUC 2KWCA 1XF5L 4KSKC 3DVGX 2LZ6A 1P7EA 3P4SB 2J7QB 2IO2B 5L83A 2KWUB 4FADA 5IA7A 1L5PA 2ACZB 3P1MA 4KZCA 3ZJTA 3WIMA 4XWTA 3Q3NC 2NR2A 1C3TA 4C56C 1UUPA 1JW9D 3ZNGC 3NVVA 2BKRB 1RFAA 2BVCA 2V3PA 3H6NA 5J2RA 4OVZA 1WX7A 1XCTL 2WXKA 4I6NB 4FJYA 3D32A 3KUDB 2KOXA 1LFDA 2O6VA 4GDKA 3APFA 3DBSA 2IDYA 3NS1A 4DHJD 2JZZA 2PKOA 4AUQC 4RM9A 3T3OA 3HVDA 2INPE 3AV8A 2IGDA 5IO9A 2N9LA 2WXFA 1YIWA 1C79A 4WH4A 2Z8LA 3EGRA 3E56A 2IJ0A 1WY8A 1K51A 3O65B 1MHXA 4WJOA 3DBHI 2L52A 1XD3B 2G1EA 2NTTA 3A9JB 1FNVA 1N61A 2EMTA 2VZKD 2WS3B 2XNAC 1TGZB 2GMIC 1AWDA 3RI7C 2DNFA 3AE4B 1AW7A 2N7JA 3IAM1 3WAPA 2JUOA 1L4ZB 3PLVA 1L2NA 2D10A 4W9LA 5EE3A 2OJRA 4K7WA 5J18A 3JVZX 3TCAA 1GB1A 2E3TA 4EZLA 4JX1C 1WYGA 1MFWA 1R4MB 4KDLB 2KDBA 1JWUD 3QAQA 3BYYB 1A70A 2BYFA 5EDSA 5AZFA 3HRDD 3U2SC 2Z0DB 4MSMB 5DPTA 3AH7A 2MA9B 2LJIA 3C19A 3KVFB 2LHDA 2QEJC 3L0WB 3DHIC 2GI9A 3PTFC 2QIEB 4KDIC 2ZCBA 3VR9B 3NVYA 2N7EA 3AULA 3UIPB 1ROEA 1YN3A 2QCZA 3DOWA 4ZYNA 1OTRB 4B95A 5D94A 4EZKA 5H92C 3BVZA 4IOIE 2L3ZA 2RD0A 1OEYJ 3ZNHB 3KWLA 3GE8C 2FCNA 1EWYC 3N9YC 2FCQA 2GRIA 4ZRIA 2IO0B 2J4XA 2WXJA 4HDOA 3AEAB 1YQ4B 1TZOA 2LWPA 1TTNA 3MJWA 2GBMA 1Q10A 4PS3A 2ZZPB 1WXQA 1WFYA 3QARA 2K8HA 2V3NA 3GZNB 2FCMA 2QSDA 3RUIB 3ZXVA 3IT6B 2VRRB 4LNFA 4ANXA 3K9PB 2IY1B 5DPWA 3EFCA 2BYVE 3N3KB 1DOIA 2KJHB 3RNBC 2KX0A 4ANUA 1I4QA 3KYDD 4MACA 1RWSA 3HHMA 4OVUA 1SJHD 2LFIA 3AE2B 1ZUD2 4H2AA 2MWSB 3ZQ4A 3P4QB 3PPAA 5AUKA 4HLEA 2AL3A 1I4GA 2QDFA 3Q3OC 1V81A 3R3MA 4CQNA 4A3OA 4USAA 2WX0A 5G2NA 4MH8A 2WXNA 1ET9A 3IAS1 1V1PB 4W9KA 2LD9A 2A4ZA 4WQMA 3TL5A 4WJQA 1F0ZA 1WM3A 3I9V1 5LLIA 1FXIA 3R2IA 2MX2A 2HTME 3P42A 2E6XA 2OOBB 3V05A 1E10A 1TKYA 5CTRC 4ITKA 3FILB 3UINB 3AE5B 2KD0A 1SIFA 4IWOA 1E8WA 2N0SB 1A5RA 2CR5A 2NBWB 4LCDE 2LVPA 1UF0A 3U7ZA 2KJ6A 3L10B 3RNGC 2J0MA 4EZJA 4W9HA 3N1XC 4PYZA 1K53A 2MEKA 2BB5A 2QILA 4YWGG 4YSZB 4RGNA 4A8XC 1PGAA 3U30A 2MP2A 1M94A 2D3GA 4US9A 1UWXA 4RM8A 2KYWA 1VD2A 4HKZE 2K22A 1JMLA 4E71A 4GLSC 3LYYA 4ZHPA 1DGJA 4IWQA 4KVGB 2W82A 1F2RC 2V3SA 4HRSA 4M8NA 3VTVA 1NYRA 1JALA 4HEA1 3PRMB 1KOTA 2MSED 2L7RA 4DHZB 1YJJA 2KTRA 1P3QU 3Q8AA 4HDQA 3R7QA 1SE2A 3KYCD 1ZXIA 2VH2A 4JIOU 1NVID 2D3BA 2BS3B 5EE1A 3KLSX 1F52A 2ZW1A 4BKTA 2BYEA 2FIDA 2MLBA 1WRDB 4DDGD 3VHTC 2O6VB 1E90A 4GDKB 2VH1A 5BYRA 1L4DB 1JWAD 4KGSA 1T0QC 1ISNA 4ZYSA 2W9NA 1UGJA 5C23A 3SFDB 1EM7A 3ZTDA 3KQ4A 1WWTA 3Q14C 4I6LB 3PRPB 3QC8B 5G55A 1F2RI 1YQBA 2R2QA 1F77A 3ONSA 2Z59B 2KC1A 2ASQA 3RMKC 1NBFC 2NTSA 4FHJA 3Q3MC 2IYDB 1SGHA 4DQOC 4G0NB 2UWQA 3R66C 2LGIA 2D5GA 4A6QA 5KHQA 2D11A 2FBWB 3B2GA 2L32A 5GMVA 3J9CA 3VFKA 4ZDVA 2M0AA 2PPHA 1I4RA 4N9F4 3IXSA 4OVVA 3NVZA 1XLQA 1L0XB 2BWES 3SFEB 2ZPNA 2EKIA 1QLBB 3AU5A 4IG7B 1GJZA 3PGEA 2XK5A 4C80A 4M8MA 2UYZB 5CX3A 4HROA 1E8ZA 1OQYA 4JPSA 2G4DB 4NY0A 3MC8A 1WH3A 3QHTA 3URYA 2M1MA 4W9GA 1YNTE 2MQJA 3WAOA 4M02A 1DYQA 3ZNZB 4HVBA 1WE6A 4IM2A 1QKZA 3L17A 2LJ5A 3M62B 4S0RA 2UU7A 3NHEB 2IO1B 5E6OA 2RSUA 2M0XA 1UZXB 4NQLB 4IC7B 4REZA 3O13A 5H8YE 1MVKA 1TYGB 4X57B 1ZDXA 3TBLD 2BS2B 4LLGM 2HD5B 3MJ5A 4HPLB 4KSLC 4MJSA 4LK0M 3BYTB 1JROA 2WU2B 3H8HA 1B9RA 1WXAA 3UI3A 3RZWC 2LVOA 4ZRKA 5IOIA 1S3SG 4J3OD 1C9FA 2K0PA 3EFUA 2K8BA 2PLPA 2NMQA 4W9DA 4HJKA 1QOAA 1VCBA 1RFKA 3H7PA 4RGOS 3GP7A 1XEEA 1K8RB 1SB3C 3T8MA 3ZXRA 1D4BA 3MTNB 4OHJA 2IY0B 2W55A 4XYCA 5DPRA 2N7DA 4MGIE 2CHWA 2KMMA 2O6VD 4Q2JA 2I1KA 3PHXB 4HWIB 3JYUA 1J8CA 3SHQA 2ICIA 1V86A 2ZPYA 2WLBA 2DZJA 2J42A 1I4HA 3ZJVA 1D6EC 1GG3A 3TJPA 2M17A 1LO5D 1YN4A 1DOYA 3W1SC 4GMVA 4YT0B 4C7ZA 1FEHA 3ABVB 1YX5B 2X38A 1TKGA 3TEYA 5GXGB 1E5WA 2Q5WD 2BPSA 2DWQA 3ALBA 2MH7A 1L0YB 3ML8A 1NEKB 1QZEA 2BB6A 3A1QB 2JXXA 2G3QB 2PIAA 1PQSA 3DQVA 4O1NA 3QWZB 4WJNA 2WHIA 1T0RC 4WJPA 2L8JA 3DCGA 2PTLA 1XO3A 1UBIA 2JPHA 1C4AA 3DBRI 2V1YA 5BYSA 1WXMA 3JSVB 4PT5A 3NVWA 2A5UA 4M0WB 2PVGC 2WXLA 3I5JC 2WX1A 1C76A 1Z2MA 1LQBA 4YTMB 2IPKD 1FNUA 4KGRA 4W9CA 3Q3JA 4JE3B 3DVGY 1V5OA 4K1RB 1MPEA 2IO3B 2BKFA 4N6EB 4NQKE 3MHSD 1WGGA 2JT4B 3N1ZC 5FR3A 4RGTA 5AUIA 1ZDVA 2AQ2B 2LVQA 2MRPA 4XE0A 1T3QA 2OJWA 4XWWA 4GDLA 4IUMB 3V60A 1YD8U 4HXDA 4ARIA 3X23A 3L08A 1LM8B 5J17A 4OW0A 1YN5A 4RH6A 4TQ1A 2WYQA 3OJ4B 4WWMA 4WURA 1ESFA 1YJ1A 2INDC 4NAWA 3A9KA 4BBNC 3CMMB 5EE0A 2BW2A 3AM9A 4FJZA 5KHOA 4K81A 1WXVA 4G3XB 2KTFA 4XC2A 1AYFA 1E7PB 1HXYD 2XEWA 3P4RB 2M8SA 1HTOA 4RMAA 1Y56A 2NVUI 4ZHOA 3V6EB 1WZ0A 1T5XD 4HJGE 4IWPA 4FLHA 2C9WB 1QILA 4IM0A 4K7UA 4URKA 1ZP0B 4A20A 3QCAA 3MC9A 1D5MC 3RN9C 2J53A 3ZW3A 4N59A 3AXCA 3U52E 5LNK1 4LJPB 4ANWA 2AQ1B 3ZUNA 5CHVC 4C4VA 4DHZE 2N1WA 2WXGA 2KACA 3DHGC 1EF5A 4XDCA 2FIFA 2LGYA 1SE3A 4OZAA 3ZGZA 4LNKA 4L2YA 1QF6A 1KF6B 2MJ3A 2KXJA 2D3CA 2IGGA 1KRHA 1FCCC 2KVRA 2W54A 2ZVOA 4J6IA 3UIOB 3BVGA 2RDBC 2KMAA 3MC0B 2L0FA 2JSVX 1JRPA 2JF5A 3IHPC 2IZVB 2KDIA 3L54A 2WXIA 4FULA 2ZJDA 1XLOA 1FFUA 1PYWD 2NBUA 3QA8A 4CO7A 1FIQA 1Q0WB 2HE7A 1C77A 2BYTA 2IBIB 2ZNVC 2WXPA 3QJZA 1QQRA 3KWVA 3V3XA 1QOBA 2BT6A 2QC8A 3ZLZA 3Q6BA 1TJEA 5BMHA 2LUEA 1WZ3A 3PLUA 3UQBA 1E7VA 3QX1A 1JWBD 4KIKA 3APDA 4UDUC 3VUYA 3WCQA 2CS4A 3AE1B 3RCZA 1K50A 5C1ZA 3AB5A 3BINA 2LRWA 1XXGA 2BGFA 2EELA 2QHOA 4KIKB 4TUUA 3AEGB 1TBEA 3VH4B 1HEZE 3PO0A 2DZMA 2Y5BB 1WSPA 3X0WA 3VTWA 2TSSA 3V61A 2YEPF 4JWSC 2KO3A 2RPVA 1EO6A 3B9JA 2ZCCA 4B0MA 2ON8A 4NJ6A 3QK0A 1MI0A 3UGBB 3ZIMA 1V5TA 4HKQA 3PRZA 4DHJB 3VAWA 4C4VB 1VLBA 5IP4D 5HFYA 2W3SA 3DVNU 2KLCA 1RAXA 2KFKB 1MHHE 4AJWA 1FNWA 3NUHB 2C60A 3Q8FA 1WJNA 4K3BA 1EUVB 4II2B 2R2OA 4PYUA 1HQRD 1AN8A 4HCNB 4WWOA 3DBHB 4ZOHC 3L16A 5D2MB 4PS8A 2KNBA 3TEXA 5JHAA 2YLMA 4DXAB 2L0TA 3EHVA 4YXDB 1V97A 2LASA 4IKGA 3W9CB 3APCA 3Q3FA 1QT9A 2KQ7A 1XLPA 1S1QB 2JRIB 4LTUA 1J7AA 1KLVA 3W2DA 2GOWA 1XCQL 2KQSA 2O2VA 1UELA 4MM3B 3TEZA 4LDTB 3ZNID 1NDDA 1GAQB 2WXQA 4QAYA 1FXAA 3WA0A 1VR9A 1HE8A 4DWFA 4ACFA 1I4PA 2M19A 1KM7A 4US8A 1QOGA 1MG8A 5AZGA 3K9OB 1J19A 1R4NI 3R8BA 4P6VF 1C4PA 3TIXA 3VUXA 4AS1A 1I35A 2LMCA 3UQAA 3MP9A 2B3AA 3RNAC 1TS2A 2LUMA 4BOSC 1JRUA 2NBVB 4RCOA 4BOZB 4GB9A 4F7ZA 1ZE3D 2N9PC 2WXMA 3W1SA 4GSWA 3GE3C 5IN7A 1BT0A 1TIFA 1GNUA 2MJEA 2Y5PA 1E6EB 2M56B 2PJHA 1EU4A 5FK9C 4IW0A 4P7IA 4M01A 2I1JA 2KZRA 4R3DA 1RRBA 4WIPA 1IGCA 4GXBA 3DHHC 2DHZA 4P1BC 3H7SA 3NOBA 1CZPA 1GUAB 3RNFC 3E9SA 4EKUA 2WP9B 4S17A 1YOVB 3RD2A 5JZEB 1V2YA 5E6PA 4MM3A 3DPDA 3EC8A 4BBNF 2JWUA 2KWDA 3PV1A 3VR8B 3GOEA 2K3UA 3N30A 1TS3A 3RULA 2C7MB 2D3AA 4KV2A 4F8CB 3VXWA 4W9FA 1SJED 2JVCA 3IG3A 1MJDA 3IBEA 2XN9C 2MCNB 2BWFA 2WXRA 4F1SA 4KKJA 3NY5A 3IVFA 3BZDB 4LDTD 2RR9A 1OFFA 2PW9A 5JHBA 2CKHB 4A90A 4KGTA 1WR6E 2MBQA 2V4IB 3U8ZA 1I4XA 1N60A 2AYOB 2GLSA 4W9EA 1SSNA 1UBQA 5G5GA 2PE6B 1SXTA 2MW5A 4EEWA 4MSQB 2KDMA 2RDHA 3ZDTA 3I63C 4DDID 2MBHA 4MELA 1EF1A 3RPFC 1LXDA 4DXFA 3TEWA 2R61A 1UH6A 1H4RA 3ZJUA 1TS5A 4EUTA 4YSYB 1TY0A 4RNAA 4LJOB 3AMZA 1PDXA 3SR6A 2AWTA 4E74A 1HZ5A 1SE9A 2K25A 1IBXB 1PGXA 2Y5CA 1E8XA 1WR1A 3GB1A 3HK0A 4BFRA 1VZ8A 2SAKA 2KANA 3B2FA 3VVWB 2INNE 3AE8B 1VZ7A 4TV3A 3NZSA 2HJ8A 1T0SC 2GBKA 1VJKA 1P98A 1RM6C 2QJLA 2CJOA 1BMLC 1NI3A 3LXFA 1V80A 2KN5A 4AWJA 4L23A 1L6UA 2JWZA 2KKCA 2DZKA 4OZBA 3OLMD 5JH5C 2WDVB 2DBYA 4EOYA 4AOFA 5FKAC 4MGKE 3TUOA 2L76A 2HDEA 5DCNA 4AP4C 1JWSD 1IYFA 1ZXHA 3AEDB 2DZIA 3CSFA 3I3TB 3OAWA 3N32A 3A4SC 1Y8RC 1T6BX 1N5WA 2M4NA 3FKYA 1HZ6A 4MGYE 4N58A 3Q69A 2WDRB 2NCNA 1VDVA 3RFZB 3NG0A 3PZ8A 4MJSB 3AEEB 1N63A 2KQ4X 3AECB 2L1AA 2BBCA 1KLUD 2XK5B 3AU4A 3ZKJC 4FXCA 4CYEA 1TY2A 3AE7B 1UGMA 3NZ3A 5E6JA 3R2TA 5E6NA 3W1YA 4TKNA 2L05A 2RMMA 3KUCB 2ONQA 1FM0D 2Z0EB 2DX5B 4MT5A 5BYQA 4ASWC 3A1QA 4KZ0A 1FFVA 3SD5A 3JW0X 1SE4A 2V9HA 5TR5A 1N62A 5C3JB 3V62A 3CSTA 2ZVNA 4G11A 2NPTA 4GGQA 4M00A 1WI0A 2DAJA 3WAMA 4WAAA 1JWMD 1YMHE 4ICVA 2AEHA 2ZEQA 4TMAB 2JY6A 2XBBC 3Q8CA 4FBJB 2LXCA 3P4PB 3ZRCA 2C7NB 3SEBA 1WX8A 3NRZA 3H9DA 3RNEC 1WXSA 3AEBB 2N9XA 4LNIA 1WJ4A 2DYMA 5G5HA 3DVNV 2WGSA 1CMXB 4JL9A 4DXGA 5D6JB 5L95C 2JZPA 1WGDA 5CHWA 1FRDA 3PVLA 3A33B 4M0WA 1GC7A 3C8YA 4RF0A 5FR6A 2N9KA 1YJIA 1E8YA 3RT3B 1V1PA 2J52A 2RGFA 3M95A 1SF0A 2LGSA 1RYJA 1EU3A 1AARA 1SIJA 3S2AA 4BAXA 3ZVVA 4L1BA 2L00B 1C1YB 3HM3A 2BS4B 5EE9A 5I4DA 3VH3B 3H7PB 3Q2AC 2W3RA 1N5XA 1WGHA 4BVUC 4AJYB 1H8CA 1CJEA 3MFGA 4EE2A 2PMVA 3W5UB 2QMTA 3FC4A 4AQ7A 4MGZE 3ZO5B 3HUIA 2LHEA 3GZNI 1CK1A 3N20C 1L7YA 4IM3A 1X1MA 1I7HA 2DYBA 1FMAD 4HPPA 2JZ3B 1UNSA 1GC6A 3VQIA 5LXHA 3LB8C 1WJUA 3RYTA 1EWCA 2AL6A 3CWIA 1TZ1A 3NJTA 4OZCA 3I57A 2JYEA 5BO4B 2CU3A 1C4CA 1IUEA 3GS2A 1PUTA 1OQRA 2JX5A 4HCPB 1ENFA 3AEFB 4ZRPA 1L0VB 5MPOA 3C0RB 4C00A 2D07B 4IDIA 4B9KA 2J0JA 2LI5A 5HG2A 2FUHB 2AX5A 1G6JA 1T0YA 1VZ6A 4GU2A 1WM2A 4FHKA 1J0GA 3NZUA 1VRAB 3B0AA 5HHDG 2BTEA 3MHZA 1UWMA 2N4FA 1KLGD 1E0ZA 5AZHA 1XT9B 3DBLI 1P7FA 2LGDA 1R7SA 3Q8BA 3L13A 2INCC 4FN2A 4D2KA 4KKIA 4EFOA 1Z5SB 5JXVA 1V9JA 3A4RA 1WGRA 4BZAA 4B0EA 2OHFA 3TSSA 1WIAA 4GDLB 4LNNA 2NPTB 2PEAA 3PZ7A 4GIVA 3U4EG 2CHXA 4DBGA 2DYOA 3RNCC 1STEA 2KHWB 3HVZA 3DWMA 1P0RA 4A3PA 3ENEA 4E3CA 2EMSA 2PE9A 2VZKB 2KJRA 4KX6B 3BK1A 1WRIA 1ZW7A 2PVOD 2D2QA 3CF6E 2JQRB 1ACCA 4MDKE 1F1HA 4PK1A 1KH0A 4P1CC 3H1UA 2N1VA 2BF8B 3KH0A 1PGBA 2LEKA 3PHWB 1IGDA 3OG5A 4JQWC 1IBXA 1V1OA 4W9IA 1WF9A 2RDGA 3DWGC 2MBEA 2WDQB 3OJ3A 4K3CA 2CJNA 3BWUD 1E9MA 2K39A 1SBBB 2CU1A 3T3NA 2LRUA 2GBJA 3DDCB 3V6CB 1M4VA 2N9EB 5IKCM 2FCSA 5HI1A 2MP2B 2HTHA 4XZ4A 4ICUA 1C78A 1FRRA 1ZGUB 3VDZA 4NAWB 2KC2A 3KUZA 3BY4B 4HPMB 3VRBB 4FJVB 4YL8A 2KK8A 3ZRFA 4TQ0A 3P63A 2K1FA 2SEBD 5LXIB 1JCKB 4JLCA 1GB4A 5DPSA 3SU8X 2C5LC 2K6DB 2WXHA 1DOXA 1FXTB 3SDLC 2KMCA 1PFDA 2V4LA 1WYWB 4XGAB 1E7UA 1CQVA 1L6VA 2KLGA 1J7BA 3W5VB 4NJ7A 1V8CA 2WWZA 1IPGA 1OQQA 4XX5A 5BMGA 2LXAA 2LGXA 4JGHB 1FPYA 2JXTA 2C7HA 2GBRA 1TT5B 4BKSD 4ZRQA 2FNJB 4WAFA 2J0KA 3NS8A 1WGKA 2NS5A 1FCLA 1I42A 1NENB 1J7CA 3QQ8B 1HTQA 4NZLB 1HA5A 1D5XC 2MJDA 3AI5A 3ML9A 2G45B 3B08A 3BVMA 2KFKA 5HKHA 2X8XX 5D3IB 3WALA 2V0GA 4WWPA 4GOCA 2FUG1 3U7DA 3ZTCA 3IT4B 1ZPSA 1F9JA
chains in the Genus database with same CATH topology
4HJGE 3BK2A 2K5PA 1ZXHA 3AEDB 4WQMA 1QILA 4RGMA 3AN1A 1ZP0B 1T6BX 1N5WA 1D5MC 1F0ZA 2H88B 2J53A 3I9V1 4N59A 1FXIA 1HZ6A 3R2IA 4N58A 3U52E 2AQ3B 2HTME 5LNK1 3P42A 3Q69A 2E6XA 3V05A 1E10A 1TKYA 2AQ1B 2WDRB 4ITKA 2WXGA 3FILB 1VDVA 2KACA 3AE5B 4XDCA 3RFZB 2YEPB 1SE3A 3PZ8A 3Q8EA 4OZAA 3AEEB 1N63A 2N0SB 4XDDA 3ZGZA 2KQ4X 3AECB 4L2YA 1QF6A 1KF6B 2MJ3A 2L1AA 2BBCA 2IGGA 5D3DA 1KLUD 3U7ZA 1KRHA 3EUB2 3EA6A 1FCCC 4FXCA 4C7YA 2I2YA 1FO4A 1TY2A 3AE7B 4RFBA 3NZ3A 5E6JA 3R2TA 2W54A 3BVGA 1TKEA 1ZOYB 1K53A 2RMMA 2MEKA 2BB5A 2QILA 4YWGG 3MC0B 4YSZB 4RGNA 4A8XC 2ONQA 1PGAA 1FM0D 1BXTA 2JSVX 1JRPA 4YSXB 4MT5A 4P16A 4US9A 1UWXA 3BIID 5BYQA 2KAJA 1KFYB 4HKZE 2WXIA 3AE6B 2K22A 1JMLA 1FFVA 4GLSC 5TSSA 3LYYA 4ZHPA 1DGJA 1SE4A 2B76B 1XLOA 1FFUA 5C3JB 1N62A 1PYWD 2JU6X 2I38A 1FIQA 2WU5B 2W82A 1F2RC 4HRSA 1C77A 2BYTA 1NYRA 1JWMD 1YMHE 2WXPA 1JALA 3VRAB 1K52A 1QQRA 4HEA1 2L83A 3FILA 4TMAB 3KWVA 3V3XA 1ET6A 3Q8CA 2DLBA 1QOBA 2BT6A 1YJJA 1TJEA 3P4PB 3Q8AA 5BMHA 3SEBA 1KTKA 1YQ3B 3OWEB 3NRZA 1SE2A 2WQYB 3AEBB 1ZXIA 3AE9B 2K9XA 1JWBD 2DYMA 5G5HA 4UDUC 1NVID 4A55A 3WCQA 5C2TB 2BS3B 4DXGA 5EE1A 3AE1B 1K50A 3KLSX 2JZPA 4ARCA 1BUIC 2ZW1A 3AB5A 1FRDA 4M0WA 1XXGA 1FD6A 2EELA 3C8YA 4RF0A 5T8IA 1JQ4A 4TSSA 2N9KA 1YJIA 3AEGB 1V1PA 4GDKB 1HEZE 5BYRA 1L4DB 2G9HD 2J52A 1NYQA 3PO0A 1JWAD 1SF0A 1WSPA 4KGSA 1RYJA 2TSSA 1EU3A 2YEPF 2WXOA 1XLNA 4A9AA 4ZYSA 3SFDB 1UGJA 4JWSC 1SIJA 2RPVA 1EM7A 3KQ4A 1WWTA 3ZYYX 1SEBD 3B9JA 2JYTA 1GOZA 4B0MA 4L1BA 1F2RI 2ON8A 1F77A 1MI0A 4HKQA 1B1ZA 2BS4B 2NTSA 5EE9A 5I4DA 1D5ZC 1VLBA 2W3RA 5D7GA 4DQOC 5HFYA 2W3SA 2LGIA 2FE8A 1N5XA 2D5GA 4A6QA 1MHHE 2WNMA 2FBWB 3B2GA 1FNWA 2L32A 1CJEA 3NUHB 5BMIA 3MFGA 3J9CA 2PMVA 3W5UB 2KN4A 4EE2A 3CIRB 3L4PA 2M0AA 1GPXA 4YTNB 2QMTA 3FC4A 3Q8FA 1I4RA 4AQ7A 3IXSA 3NVZA 1HQRD 1AN8A 1XLQA 3HUIA 4ZOHC 2LHEA 4YTPB 1L0XB 3TEXA 2ZW0A 2OEDA 1CK1A 3SFEB 2EKIA 1QLBB 3ETRA 4RF1A 4YXDB 1V97A 4IKGA 1I7HA 2IGHA 3W9CB 4C80A 1FMAD 1QT9A 4HROA 1UNSA 1XLPA 4JPSA 3VQIA 4LTUA 3LB8C 1J7AA 3W2DA 1XCQL 3FAHA 2H89B 4NJCA 1EWCA 3CWIA 3AE3B 4MM3B 3TEZA 4OZCA 1QOFA 1TS4A 2Y3AA 1GAQB 3URYA 2GB1A 3I57A 2JYEA 2WXQA 1YNTE 2CU3A 1FXAA 4JWUC 1C4CA 4NAMA 1IUEA 1VR9A 3GS2A 1PUTA 1DYQA 1OQRA 2JX5A 1I4PA 1XF5L 1ENFA 2M19A 3AEFB 4ZRPA 4US8A 1L0VB 1P7EA 3P4SB 1QKZA 5MPOA 1QOGA 4IDIA 3R8BA 4P6VF 5HG2A 1C4PA 2AX5A 1L5PA 2ACZB 3P1MA 1VZ6A 3ZJTA 4XWTA 4AS1A 4REZA 3O13A 2LMCA 5H8YE 1MVKA 1TYGB 1VRAB 3MP9A 4C56C 1UUPA 1ZDXA 1JW9D 3NVVA 5HHDG 2BS2B 1TS2A 4LLGM 2V3PA 3MHZA 2LUMA 2BTEA 1UWMA 3MJ5A 1KLGD 1E0ZA 4OVZA 4LK0M 1XCTL 2WXKA 4RCOA 1P7FA 3BYTB 1R7SA 3Q8BA 1JROA 2WU2B 3H8HA 1B9RA 1ZE3D 3W1SA 2WXMA 2IDYA 3NS1A 3UI3A 4D2KA 4KKIA 2MJEA 2PKOA 4J3OD 1C9FA 5JXVA 2K0PA 2Y5PA 1E6EB 2M56B 2PLPA 2NMQA 1EU4A 5FK9C 4B0EA 3T3OA 3HVDA 1QOAA 2INPE 3AV8A 2OHFA 3TSSA 4GDLB 4R3DA 1RFKA 1IGCA 2IGDA 4WIPA 2N9LA 3PZ7A 4RGOS 3GP7A 1XEEA 1SB3C 2WXFA 1D4BA 1C79A 4WH4A 3U4EG 2DYOA 4OHJA 1CZPA 2Z8LA 1STEA 3EGRA 3E56A 2IJ0A 2W55A 3HVZA 3DWMA 1K51A 1MHXA 3E9SA 2L52A 2NTTA 2G1EA 2KMMA 2VZKB 2WP9B 4Q2JA 4KX6B 3BK1A 1WRIA 1FNVA 1N61A 2PVOD 2VZKD 2WS3B 2JQRB 2XNAC 1ACCA 2ICIA 1AWDA 2JWUA 2KWDA 3VR8B 2WLBA 2K3UA 1KH0A 2J42A 1I4HA 3ZJVA 1TS3A 1D6EC 3AE4B 1AW7A 2N7JA 3IAM1 1L4ZB 1PGBA 2LEKA 1IGDA 1IBXA 1LO5D 1YN4A 1DOYA 1V1OA 5EE3A 1SJED 4YT0B 4C7ZA 1FEHA 2RDGA 3DWGC 2WDQB 1GB1A 2XN9C 2E3TA 2CJNA 3ABVB 2WXRA 3BWUD 4JX1C 2X38A 1E9MA 1TKGA 1WYGA 3TEYA 4KKJA 1SBBB 5GXGB 2Q5WD 2DWQA 3BZDB 1JWUD 3T3NA 2MH7A 3BYYB 1A70A 1L0YB 1OFFA 2PW9A 3HRDD 3U2SC 1NEKB 2BB6A 1M4VA 4A90A 4KGTA 3AH7A 2LJIA 2PIAA 4O1NA 2LHDA 5HI1A 2QEJC 2GI9A 1C78A 1FRRA 2V4IB 2PTLA 2QIEB 1I4XA 1N60A 1XO3A 1C4AA 3VR9B 3NVYA 4NAWB 5BYSA 1ROEA 1SSNA 1YN3A 5G5GA 3VRBB 1SXTA 4TQ0A 3P63A 4PT5A 2SEBD 2KDMA 3NVWA 2RDHA 1JCKB 2PVGC 5H92C 1GB4A 2WXLA 3BVZA 3RPFC 4IOIE 1C76A 4DXFA 4YTMB 2IPKD 1FNUA 3KWLA 4KGRA 3TEWA 2R61A 2WXHA 3ZJUA 1DOXA 1TS5A 1EWYC 3N9YC 4JE3B 1PFDA 4YSYB 2GRIA 1TY0A 4RNAA 3AMZA 1MPEA 1CQVA 1PDXA 3SR6A 1L6VA 2J4XA 4N6EB 2WXJA 1J7BA 3AEAB 1YQ4B 1TZOA 5FR3A 4RGTA 5AUIA 3W5VB 1ZDVA 1HZ5A 1V8CA 1Q10A 2AQ2B 1WXQA 4XE0A 2V3NA 1OQQA 1IBXB 1T3QA 1PGXA 4XWWA 2Y5CA 3GB1A 5BMGA 2QSDA 4ARIA 3IT6B 1VZ8A 2JXTA 2SAKA 4OW0A 1YN5A 3B2FA 4RH6A 2INNE 4TQ1A 3AE8B 1DOIA 1VZ7A 4ZRQA 4WAFA 4WWMA 1I4QA 4WURA 4MACA 1VJKA 1ESFA 1RWSA 1RM6C 1WGKA 2QJLA 1FCLA 1SJHD 2LFIA 3AE2B 1ZUD2 4H2AA 5EE0A 2BW2A 3ZQ4A 2CJOA 3AM9A 1NENB 3P4QB 1BMLC 1J7CA 1NI3A 5AUKA 4NZLB 1I4GA 3LXFA 4CQNA 1AYFA 1E7PB 1HA5A 1D5XC 2MJDA 4USAA 1HXYD 3P4RB 4L23A 4MH8A 1L6UA 2WXNA 3BVMA 1Y56A 5D3IB 1ET9A 2V0GA 4OZBA 3IAS1 1V1PB 2WDVB 2DBYA 2FUG1 5FKAC 4ZHOA 3TUOA 3IT4B 2HDEA 1T5XD 1ZPSA 1JWSD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AH7 A;  2K5P A;  4WQM A;  3AED B;  3AB5 A;  1FRD A;  2PIA A;  4P6V F;  3AN1 A;  1ZP0 B;  2AX5 A;  1L5P A;  2ACZ B;  3P1M A;  1N5W A;  1JQ4 A;  1F0Z A;  1FRR A;  2H88 B;  1YJI A;  4N59 A;  1FXI A;  5H8Y E;  2QIE B;  3AEG B;  4N58 A;  1TYG B;  2HTM E;  1N60 A;  1XO3 A;  1JW9 D;  1NYQ A;  3PO0 A;  3NVY A;  3NVV A;  1TKY A;  1JWA D;  3VR9 B;  2WDR B;  1E10 A;  1ROE A;  1SF0 A;  2BS2 B;  4ITK A;  1VDV A;  1RYJ A;  1UWM A;  3AE5 B;  5G5G A;  3VRB B;  1XLN A;  1E0Z A;  4A9A A;  3SFD B;  4JWS C;  1SIJ A;  3P63 A;  3AEE B;  1N63 A;  2N0S B;  1R7S A;  3NVW A;  1JRO A;  2WU2 B;  1B9R A;  2PVG C;  1WWT A;  3AEC B;  5H92 C;  3ZYY X;  3B9J A;  1QF6 A;  1KF6 B;  2MJ3 A;  3NS1 A;  3RPF C;  1KRH A;  2MJE A;  3EUB 2;  2PKO A;  4YTM B;  4FXC A;  4C7Y A;  3KWL A;  3AE7 B;  1FO4 A;  1E6E B;  2M56 B;  2BS4 B;  1DOX A;  5EE9 A;  1QOA A;  3AV8 A;  2W54 A;  1EWY C;  2OHF A;  1TKE A;  1RFK A;  1VLB A;  1PFD A;  1ZOY B;  2W3R A;  4YSY B;  2W3S A;  1SB3 C;  4YSZ B;  3AMZ A;  1FM0 D;  1PDX A;  1N5X A;  3SR6 A;  1JRP A;  1L6V A;  4N6E B;  4YSX B;  4US9 A;  1J7B A;  3AEA B;  1CZP A;  2FBW B;  1YQ4 B;  3BII D;  3B2G A;  2KAJ A;  1KFY B;  2W55 A;  3HVZ A;  1CJE A;  3DWM A;  5AUI A;  3W5V B;  3W5U B;  1V8C A;  3CIR B;  3L4P A;  3AE6 B;  1GPX A;  1WXQ A;  2K22 A;  1FFV A;  4YTN B;  1OQQ A;  2L52 A;  1T3Q A;  2G1E A;  2KMM A;  2WP9 B;  3FC4 A;  2Y5C A;  4KX6 B;  4ZHP A;  1DGJ A;  3NVZ A;  2B76 B;  1WRI A;  1XLQ A;  1N61 A;  1XLO A;  2PVO D;  3HUI A;  1FFU A;  4ZOH C;  5C3J B;  1N62 A;  4YTP B;  2WS3 B;  2JQR B;  2WU5 B;  1FIQ A;  3B2F A;  3SFE B;  1AWD A;  2EKI A;  1QLB B;  1DOI A;  3AE8 B;  3ETR A;  4HRS A;  3VR8 B;  2WLB A;  4YXD B;  1V97 A;  1NYR A;  4WWM A;  1I7H A;  3AE4 B;  3W9C B;  4C80 A;  1JAL A;  1VJK A;  3VRA B;  1RWS A;  1FMA D;  1QT9 A;  4HRO A;  1RM6 C;  1WGK A;  2QJL A;  2LEK A;  1XLP A;  2L83 A;  1DOY A;  4LTU A;  3LB8 C;  1J7A A;  1ZUD 2;  3AE2 B;  5EE3 A;  5EE0 A;  4YT0 B;  1QOB A;  4C7Z A;  2CJO A;  2BT6 A;  1NEN B;  3AM9 A;  3P4Q B;  1J7C A;  1NI3 A;  2H89 B;  3DWG C;  2WDQ B;  3FAH A;  5AUK A;  1YJJ A;  3CWI A;  2E3T A;  1TJE A;  2CJN A;  3ABV B;  3AE3 B;  3LXF A;  3P4P B;  1QOF A;  1YQ3 B;  1GAQ B;  3NRZ A;  4JX1 C;  1E7P B;  1E9M A;  1AYF A;  1TKG A;  1WYG A;  2MJD A;  4USA A;  3AEB B;  2WQY B;  3P4R B;  1ZXI A;  2CU3 A;  3AE9 B;  5GXG B;  1L6U A;  1FXA A;  2Q5W D;  4JWU C;  1IUE A;  2DWQ A;  1JWB D;  2K9X A;  1PUT A;  5G5H A;  2MH7 A;  1NVI D;  1OQR A;  2JX5 A;  1A70 A;  3WCQ A;  5C2T B;  2BS3 B;  2DBY A;  2WDV B;  2M19 A;  1OFF A;  3AEF B;  3HRD D;  5EE1 A;  1NEK B;  3AE1 B;  4ZHO A;  4US8 A;  1L0V B;  3P4S B;  5MPO A;  1QOG A;  4IDI A; 
#chains in the Genus database with same CATH topology
 3BK2 A;  1N6Z A;  2K5P A;  4HK2 A;  4RGM A;  2MHJ A;  3AN1 A;  2CHZ A;  1ZKH A;  1U4A A;  2H88 B;  2AQ3 B;  2WDT B;  3LJ3 A;  2O2V B;  3M3J A;  2YEP B;  1WMH B;  3PZD A;  2FAZ A;  3Q8E A;  4GN1 A;  1MG4 A;  1P9D U;  2KVZ A;  4XDD A;  1V6E A;  2KWV B;  5D3D A;  3EUB 2;  2KFJ A;  5CHF A;  3EA6 A;  4C7Y A;  2I2Y A;  2GBN A;  1FO4 A;  4RFB A;  3HIZ A;  1TKE A;  1ZOY B;  1OGW A;  1BXT A;  4YSX B;  4P16 A;  1UD7 A;  3BII D;  1NI2 A;  2KAJ A;  1KFY B;  3TMP B;  4B6W A;  3AE6 B;  2KX3 A;  1LGR A;  5TSS A;  1V49 A;  4MH0 E;  2B76 B;  3M63 B;  3WAN A;  3T9L A;  2JU6 X;  2I38 A;  2WU5 B;  2RPQ A;  3RZF A;  4K7S A;  3DBR B;  1WJ6 A;  4DK5 A;  1RLF A;  3VRA B;  1K52 A;  2ZNV B;  1WGY A;  1XQQ A;  1WE7 A;  4MEM A;  2L83 A;  3FIL A;  1ET6 A;  5IAA C;  2DLB A;  3A9J A;  3PS6 A;  2BQQ A;  2K6Q A;  3R7R A;  3PSE B;  1KTK A;  1WMH A;  1YQ3 B;  3OWE B;  2WQY B;  3AE9 B;  2K9X A;  2DAF A;  4A55 A;  4WWN A;  5C2T B;  1R4N B;  1Q1O A;  1YX6 B;  4ARC A;  1BUI C;  3PRE A;  1FD6 A;  2K8C A;  5T8I A;  1JQ4 A;  2YVC A;  4TSS A;  4NPN A;  1D3Z A;  2G9H D;  3PT2 B;  2MBO A;  1NYQ A;  3A9K B;  3DBL B;  3QIJ A;  2WXO A;  1XLN A;  4A9A A;  4PS7 A;  2KDE B;  1WX9 A;  3ZYY X;  1SEB D;  2JYT A;  1GOZ A;  4II3 B;  2MBB B;  1R4M I;  1Q5W B;  1OEY A;  3ZDM C;  3P2B A;  2REX A;  3LDZ E;  1B1Z A;  4LNO A;  2EKE C;  4BKG A;  4FA6 A;  1D5Z C;  2JRH A;  3HM6 X;  5D7G A;  3B1L X;  2KT7 A;  2FE8 A;  4NNJ B;  4WQO B;  2WNM A;  5BMI A;  2HJ1 A;  3VTU A;  4CHK A;  2KN4 A;  3ECI A;  3CIR B;  3L4P A;  1GPX A;  4YTN B;  4BKS A;  3KW5 B;  1IP9 A;  4YTP B;  2KTR B;  2ZW0 A;  2OED A;  2DEN B;  4ZRJ A;  3ETR A;  4RF1 A;  2G4S A;  3UF8 A;  2IGH A;  4I6P A;  1KJT A;  3N1Y C;  3EEC A;  1P1A A;  4ANV A;  3FAH A;  2H89 B;  4NJC A;  4W9J A;  3JSV A;  3AE3 B;  3IFW B;  1QOF A;  1TS4 A;  2Y3A A;  2GB1 A;  4G50 A;  3VUW A;  5AEK B;  2KDF B;  4NAM A;  4JWU C;  2KWC A;  1XF5 L;  4KSK C;  3DVG X;  2LZ6 A;  1P7E A;  3P4S B;  2J7Q B;  2IO2 B;  5L83 A;  2KWU B;  4FAD A;  5IA7 A;  1L5P A;  2ACZ B;  3P1M A;  4KZC A;  3ZJT A;  3WIM A;  4XWT A;  3Q3N C;  2NR2 A;  1C3T A;  4C56 C;  1UUP A;  1JW9 D;  3ZNG C;  3NVV A;  2BKR B;  1RFA A;  2BVC A;  2V3P A;  3H6N A;  5J2R A;  4OVZ A;  1WX7 A;  1XCT L;  2WXK A;  4I6N B;  4FJY A;  3D32 A;  3KUD B;  2KOX A;  1LFD A;  2O6V A;  4GDK A;  3APF A;  3DBS A;  2IDY A;  3NS1 A;  4DHJ D;  2JZZ A;  2PKO A;  4AUQ C;  4RM9 A;  3T3O A;  3HVD A;  2INP E;  3AV8 A;  2IGD A;  5IO9 A;  2N9L A;  2WXF A;  1YIW A;  1C79 A;  4WH4 A;  2Z8L A;  3EGR A;  3E56 A;  2IJ0 A;  1WY8 A;  1K51 A;  3O65 B;  1MHX A;  4WJO A;  3DBH I;  2L52 A;  1XD3 B;  2G1E A;  2NTT A;  3A9J B;  1FNV A;  1N61 A;  2EMT A;  2VZK D;  2WS3 B;  2XNA C;  1TGZ B;  2GMI C;  1AWD A;  3RI7 C;  2DNF A;  3AE4 B;  1AW7 A;  2N7J A;  3IAM 1;  3WAP A;  2JUO A;  1L4Z B;  3PLV A;  1L2N A;  2D10 A;  4W9L A;  5EE3 A;  2OJR A;  4K7W A;  5J18 A;  3JVZ X;  3TCA A;  1GB1 A;  2E3T A;  4EZL A;  4JX1 C;  1WYG A;  1MFW A;  1R4M B;  4KDL B;  2KDB A;  1JWU D;  3QAQ A;  3BYY B;  1A70 A;  2BYF A;  5EDS A;  5AZF A;  3HRD D;  3U2S C;  2Z0D B;  4MSM B;  5DPT A;  3AH7 A;  2MA9 B;  2LJI A;  3C19 A;  3KVF B;  2LHD A;  2QEJ C;  3L0W B;  3DHI C;  2GI9 A;  3PTF C;  2QIE B;  4KDI C;  2ZCB A;  3VR9 B;  3NVY A;  2N7E A;  3AUL A;  3UIP B;  1ROE A;  1YN3 A;  2QCZ A;  3DOW A;  4ZYN A;  1OTR B;  4B95 A;  5D94 A;  4EZK A;  5H92 C;  3BVZ A;  4IOI E;  2L3Z A;  2RD0 A;  1OEY J;  3ZNH B;  3KWL A;  3GE8 C;  2FCN A;  1EWY C;  3N9Y C;  2FCQ A;  2GRI A;  4ZRI A;  2IO0 B;  2J4X A;  2WXJ A;  4HDO A;  3AEA B;  1YQ4 B;  1TZO A;  2LWP A;  1TTN A;  3MJW A;  2GBM A;  1Q10 A;  4PS3 A;  2ZZP B;  1WXQ A;  1WFY A;  3QAR A;  2K8H A;  2V3N A;  3GZN B;  2FCM A;  2QSD A;  3RUI B;  3ZXV A;  3IT6 B;  2VRR B;  4LNF A;  4ANX A;  3K9P B;  2IY1 B;  5DPW A;  3EFC A;  2BYV E;  3N3K B;  1DOI A;  2KJH B;  3RNB C;  2KX0 A;  4ANU A;  1I4Q A;  3KYD D;  4MAC A;  1RWS A;  3HHM A;  4OVU A;  1SJH D;  2LFI A;  3AE2 B;  1ZUD 2;  4H2A A;  2MWS B;  3ZQ4 A;  3P4Q B;  3PPA A;  5AUK A;  4HLE A;  2AL3 A;  1I4G A;  2QDF A;  3Q3O C;  1V81 A;  3R3M A;  4CQN A;  4A3O A;  4USA A;  2WX0 A;  5G2N A;  4MH8 A;  2WXN A;  1ET9 A;  3IAS 1;  1V1P B;  4W9K A;  2LD9 A;  2A4Z A;  4WQM A;  3TL5 A;  4WJQ A;  1F0Z A;  1WM3 A;  3I9V 1;  5LLI A;  1FXI A;  3R2I A;  2MX2 A;  2HTM E;  3P42 A;  2E6X A;  2OOB B;  3V05 A;  1E10 A;  1TKY A;  5CTR C;  4ITK A;  3FIL B;  3UIN B;  3AE5 B;  2KD0 A;  1SIF A;  4IWO A;  1E8W A;  2N0S B;  1A5R A;  2CR5 A;  2NBW B;  4LCD E;  2LVP A;  1UF0 A;  3U7Z A;  2KJ6 A;  3L10 B;  3RNG C;  2J0M A;  4EZJ A;  4W9H A;  3N1X C;  4PYZ A;  1K53 A;  2MEK A;  2BB5 A;  2QIL A;  4YWG G;  4YSZ B;  4RGN A;  4A8X C;  1PGA A;  3U30 A;  2MP2 A;  1M94 A;  2D3G A;  4US9 A;  1UWX A;  4RM8 A;  2KYW A;  1VD2 A;  4HKZ E;  2K22 A;  1JML A;  4E71 A;  4GLS C;  3LYY A;  4ZHP A;  1DGJ A;  4IWQ A;  4KVG B;  2W82 A;  1F2R C;  2V3S A;  4HRS A;  4M8N A;  3VTV A;  1NYR A;  1JAL A;  4HEA 1;  3PRM B;  1KOT A;  2MSE D;  2L7R A;  4DHZ B;  1YJJ A;  2KTR A;  1P3Q U;  3Q8A A;  4HDQ A;  3R7Q A;  1SE2 A;  3KYC D;  1ZXI A;  2VH2 A;  4JIO U;  1NVI D;  2D3B A;  2BS3 B;  5EE1 A;  3KLS X;  1F52 A;  2ZW1 A;  4BKT A;  2BYE A;  2FID A;  2MLB A;  1WRD B;  4DDG D;  3VHT C;  2O6V B;  1E90 A;  4GDK B;  2VH1 A;  5BYR A;  1L4D B;  1JWA D;  4KGS A;  1T0Q C;  1ISN A;  4ZYS A;  2W9N A;  1UGJ A;  5C23 A;  3SFD B;  1EM7 A;  3ZTD A;  3KQ4 A;  1WWT A;  3Q14 C;  4I6L B;  3PRP B;  3QC8 B;  5G55 A;  1F2R I;  1YQB A;  2R2Q A;  1F77 A;  3ONS A;  2Z59 B;  2KC1 A;  2ASQ A;  3RMK C;  1NBF C;  2NTS A;  4FHJ A;  3Q3M C;  2IYD B;  1SGH A;  4DQO C;  4G0N B;  2UWQ A;  3R66 C;  2LGI A;  2D5G A;  4A6Q A;  5KHQ A;  2D11 A;  2FBW B;  3B2G A;  2L32 A;  5GMV A;  3J9C A;  3VFK A;  4ZDV A;  2M0A A;  2PPH A;  1I4R A;  4N9F 4;  3IXS A;  4OVV A;  3NVZ A;  1XLQ A;  1L0X B;  2BWE S;  3SFE B;  2ZPN A;  2EKI A;  1QLB B;  3AU5 A;  4IG7 B;  1GJZ A;  3PGE A;  2XK5 A;  4C80 A;  4M8M A;  2UYZ B;  5CX3 A;  4HRO A;  1E8Z A;  1OQY A;  4JPS A;  2G4D B;  4NY0 A;  3MC8 A;  1WH3 A;  3QHT A;  3URY A;  2M1M A;  4W9G A;  1YNT E;  2MQJ A;  3WAO A;  4M02 A;  1DYQ A;  3ZNZ B;  4HVB A;  1WE6 A;  4IM2 A;  1QKZ A;  3L17 A;  2LJ5 A;  3M62 B;  4S0R A;  2UU7 A;  3NHE B;  2IO1 B;  5E6O A;  2RSU A;  2M0X A;  1UZX B;  4NQL B;  4IC7 B;  4REZ A;  3O13 A;  5H8Y E;  1MVK A;  1TYG B;  4X57 B;  1ZDX A;  3TBL D;  2BS2 B;  4LLG M;  2HD5 B;  3MJ5 A;  4HPL B;  4KSL C;  4MJS A;  4LK0 M;  3BYT B;  1JRO A;  2WU2 B;  3H8H A;  1B9R A;  1WXA A;  3UI3 A;  3RZW C;  2LVO A;  4ZRK A;  5IOI A;  1S3S G;  4J3O D;  1C9F A;  2K0P A;  3EFU A;  2K8B A;  2PLP A;  2NMQ A;  4W9D A;  4HJK A;  1QOA A;  1VCB A;  1RFK A;  3H7P A;  4RGO S;  3GP7 A;  1XEE A;  1K8R B;  1SB3 C;  3T8M A;  3ZXR A;  1D4B A;  3MTN B;  4OHJ A;  2IY0 B;  2W55 A;  4XYC A;  5DPR A;  2N7D A;  4MGI E;  2CHW A;  2KMM A;  2O6V D;  4Q2J A;  2I1K A;  3PHX B;  4HWI B;  3JYU A;  1J8C A;  3SHQ A;  2ICI A;  1V86 A;  2ZPY A;  2WLB A;  2DZJ A;  2J42 A;  1I4H A;  3ZJV A;  1D6E C;  1GG3 A;  3TJP A;  2M17 A;  1LO5 D;  1YN4 A;  1DOY A;  3W1S C;  4GMV A;  4YT0 B;  4C7Z A;  1FEH A;  3ABV B;  1YX5 B;  2X38 A;  1TKG A;  3TEY A;  5GXG B;  1E5W A;  2Q5W D;  2BPS A;  2DWQ A;  3ALB A;  2MH7 A;  1L0Y B;  3ML8 A;  1NEK B;  1QZE A;  2BB6 A;  3A1Q B;  2JXX A;  2G3Q B;  2PIA A;  1PQS A;  3DQV A;  4O1N A;  3QWZ B;  4WJN A;  2WHI A;  1T0R C;  4WJP A;  2L8J A;  3DCG A;  2PTL A;  1XO3 A;  1UBI A;  2JPH A;  1C4A A;  3DBR I;  2V1Y A;  5BYS A;  1WXM A;  3JSV B;  4PT5 A;  3NVW A;  2A5U A;  4M0W B;  2PVG C;  2WXL A;  3I5J C;  2WX1 A;  1C76 A;  1Z2M A;  1LQB A;  4YTM B;  2IPK D;  1FNU A;  4KGR A;  4W9C A;  3Q3J A;  4JE3 B;  3DVG Y;  1V5O A;  4K1R B;  1MPE A;  2IO3 B;  2BKF A;  4N6E B;  4NQK E;  3MHS D;  1WGG A;  2JT4 B;  3N1Z C;  5FR3 A;  4RGT A;  5AUI A;  1ZDV A;  2AQ2 B;  2LVQ A;  2MRP A;  4XE0 A;  1T3Q A;  2OJW A;  4XWW A;  4GDL A;  4IUM B;  3V60 A;  1YD8 U;  4HXD A;  4ARI A;  3X23 A;  3L08 A;  1LM8 B;  5J17 A;  4OW0 A;  1YN5 A;  4RH6 A;  4TQ1 A;  2WYQ A;  3OJ4 B;  4WWM A;  4WUR A;  1ESF A;  1YJ1 A;  2IND C;  4NAW A;  3A9K A;  4BBN C;  3CMM B;  5EE0 A;  2BW2 A;  3AM9 A;  4FJZ A;  5KHO A;  4K81 A;  1WXV A;  4G3X B;  2KTF A;  4XC2 A;  1AYF A;  1E7P B;  1HXY D;  2XEW A;  3P4R B;  2M8S A;  1HTO A;  4RMA A;  1Y56 A;  2NVU I;  4ZHO A;  3V6E B;  1WZ0 A;  1T5X D;  4HJG E;  4IWP A;  4FLH A;  2C9W B;  1QIL A;  4IM0 A;  4K7U A;  4URK A;  1ZP0 B;  4A20 A;  3QCA A;  3MC9 A;  1D5M C;  3RN9 C;  2J53 A;  3ZW3 A;  4N59 A;  3AXC A;  3U52 E;  5LNK 1;  4LJP B;  4ANW A;  2AQ1 B;  3ZUN A;  5CHV C;  4C4V A;  4DHZ E;  2N1W A;  2WXG A;  2KAC A;  3DHG C;  1EF5 A;  4XDC A;  2FIF A;  2LGY A;  1SE3 A;  4OZA A;  3ZGZ A;  4LNK A;  4L2Y A;  1QF6 A;  1KF6 B;  2MJ3 A;  2KXJ A;  2D3C A;  2IGG A;  1KRH A;  1FCC C;  2KVR A;  2W54 A;  2ZVO A;  4J6I A;  3UIO B;  3BVG A;  2RDB C;  2KMA A;  3MC0 B;  2L0F A;  2JSV X;  1JRP A;  2JF5 A;  3IHP C;  2IZV B;  2KDI A;  3L54 A;  2WXI A;  4FUL A;  2ZJD A;  1XLO A;  1FFU A;  1PYW D;  2NBU A;  3QA8 A;  4CO7 A;  1FIQ A;  1Q0W B;  2HE7 A;  1C77 A;  2BYT A;  2IBI B;  2ZNV C;  2WXP A;  3QJZ A;  1QQR A;  3KWV A;  3V3X A;  1QOB A;  2BT6 A;  2QC8 A;  3ZLZ A;  3Q6B A;  1TJE A;  5BMH A;  2LUE A;  1WZ3 A;  3PLU A;  3UQB A;  1E7V A;  3QX1 A;  1JWB D;  4KIK A;  3APD A;  4UDU C;  3VUY A;  3WCQ A;  2CS4 A;  3AE1 B;  3RCZ A;  1K50 A;  5C1Z A;  3AB5 A;  3BIN A;  2LRW A;  1XXG A;  2BGF A;  2EEL A;  2QHO A;  4KIK B;  4TUU A;  3AEG B;  1TBE A;  3VH4 B;  1HEZ E;  3PO0 A;  2DZM A;  2Y5B B;  1WSP A;  3X0W A;  3VTW A;  2TSS A;  3V61 A;  2YEP F;  4JWS C;  2KO3 A;  2RPV A;  1EO6 A;  3B9J A;  2ZCC A;  4B0M A;  2ON8 A;  4NJ6 A;  3QK0 A;  1MI0 A;  3UGB B;  3ZIM A;  1V5T A;  4HKQ A;  3PRZ A;  4DHJ B;  3VAW A;  4C4V B;  1VLB A;  5IP4 D;  5HFY A;  2W3S A;  3DVN U;  2KLC A;  1RAX A;  2KFK B;  1MHH E;  4AJW A;  1FNW A;  3NUH B;  2C60 A;  3Q8F A;  1WJN A;  4K3B A;  1EUV B;  4II2 B;  2R2O A;  4PYU A;  1HQR D;  1AN8 A;  4HCN B;  4WWO A;  3DBH B;  4ZOH C;  3L16 A;  5D2M B;  4PS8 A;  2KNB A;  3TEX A;  5JHA A;  2YLM A;  4DXA B;  2L0T A;  3EHV A;  4YXD B;  1V97 A;  2LAS A;  4IKG A;  3W9C B;  3APC A;  3Q3F A;  1QT9 A;  2KQ7 A;  1XLP A;  1S1Q B;  2JRI B;  4LTU A;  1J7A A;  1KLV A;  3W2D A;  2GOW A;  1XCQ L;  2KQS A;  2O2V A;  1UEL A;  4MM3 B;  3TEZ A;  4LDT B;  3ZNI D;  1NDD A;  1GAQ B;  2WXQ A;  4QAY A;  1FXA A;  3WA0 A;  1VR9 A;  1HE8 A;  4DWF A;  4ACF A;  1I4P A;  2M19 A;  1KM7 A;  4US8 A;  1QOG A;  1MG8 A;  5AZG A;  3K9O B;  1J19 A;  1R4N I;  3R8B A;  4P6V F;  1C4P A;  3TIX A;  3VUX A;  4AS1 A;  1I35 A;  2LMC A;  3UQA A;  3MP9 A;  2B3A A;  3RNA C;  1TS2 A;  2LUM A;  4BOS C;  1JRU A;  2NBV B;  4RCO A;  4BOZ B;  4GB9 A;  4F7Z A;  1ZE3 D;  2N9P C;  2WXM A;  3W1S A;  4GSW A;  3GE3 C;  5IN7 A;  1BT0 A;  1TIF A;  1GNU A;  2MJE A;  2Y5P A;  1E6E B;  2M56 B;  2PJH A;  1EU4 A;  5FK9 C;  4IW0 A;  4P7I A;  4M01 A;  2I1J A;  2KZR A;  4R3D A;  1RRB A;  4WIP A;  1IGC A;  4GXB A;  3DHH C;  2DHZ A;  4P1B C;  3H7S A;  3NOB A;  1CZP A;  1GUA B;  3RNF C;  3E9S A;  4EKU A;  2WP9 B;  4S17 A;  1YOV B;  3RD2 A;  5JZE B;  1V2Y A;  5E6P A;  4MM3 A;  3DPD A;  3EC8 A;  4BBN F;  2JWU A;  2KWD A;  3PV1 A;  3VR8 B;  3GOE A;  2K3U A;  3N30 A;  1TS3 A;  3RUL A;  2C7M B;  2D3A A;  4KV2 A;  4F8C B;  3VXW A;  4W9F A;  1SJE D;  2JVC A;  3IG3 A;  1MJD A;  3IBE A;  2XN9 C;  2MCN B;  2BWF A;  2WXR A;  4F1S A;  4KKJ A;  3NY5 A;  3IVF A;  3BZD B;  4LDT D;  2RR9 A;  1OFF A;  2PW9 A;  5JHB A;  2CKH B;  4A90 A;  4KGT A;  1WR6 E;  2MBQ A;  2V4I B;  3U8Z A;  1I4X A;  1N60 A;  2AYO B;  2GLS A;  4W9E A;  1SSN A;  1UBQ A;  5G5G A;  2PE6 B;  1SXT A;  2MW5 A;  4EEW A;  4MSQ B;  2KDM A;  2RDH A;  3ZDT A;  3I63 C;  4DDI D;  2MBH A;  4MEL A;  1EF1 A;  3RPF C;  1LXD A;  4DXF A;  3TEW A;  2R61 A;  1UH6 A;  1H4R A;  3ZJU A;  1TS5 A;  4EUT A;  4YSY B;  1TY0 A;  4RNA A;  4LJO B;  3AMZ A;  1PDX A;  3SR6 A;  2AWT A;  4E74 A;  1HZ5 A;  1SE9 A;  2K25 A;  1IBX B;  1PGX A;  2Y5C A;  1E8X A;  1WR1 A;  3GB1 A;  3HK0 A;  4BFR A;  1VZ8 A;  2SAK A;  2KAN A;  3B2F A;  3VVW B;  2INN E;  3AE8 B;  1VZ7 A;  4TV3 A;  3NZS A;  2HJ8 A;  1T0S C;  2GBK A;  1VJK A;  1P98 A;  1RM6 C;  2QJL A;  2CJO A;  1BML C;  1NI3 A;  3LXF A;  1V80 A;  2KN5 A;  4AWJ A;  4L23 A;  1L6U A;  2JWZ A;  2KKC A;  2DZK A;  4OZB A;  3OLM D;  5JH5 C;  2WDV B;  2DBY A;  4EOY A;  4AOF A;  5FKA C;  4MGK E;  3TUO A;  2L76 A;  2HDE A;  5DCN A;  4AP4 C;  1JWS D;  1IYF A;  1ZXH A;  3AED B;  2DZI A;  3CSF A;  3I3T B;  3OAW A;  3N32 A;  3A4S C;  1Y8R C;  1T6B X;  1N5W A;  2M4N A;  3FKY A;  1HZ6 A;  4MGY E;  4N58 A;  3Q69 A;  2WDR B;  2NCN A;  1VDV A;  3RFZ B;  3NG0 A;  3PZ8 A;  4MJS B;  3AEE B;  1N63 A;  2KQ4 X;  3AEC B;  2L1A A;  2BBC A;  1KLU D;  2XK5 B;  3AU4 A;  3ZKJ C;  4FXC A;  4CYE A;  1TY2 A;  3AE7 B;  1UGM A;  3NZ3 A;  5E6J A;  3R2T A;  5E6N A;  3W1Y A;  4TKN A;  2L05 A;  2RMM A;  3KUC B;  2ONQ A;  1FM0 D;  2Z0E B;  2DX5 B;  4MT5 A;  5BYQ A;  4ASW C;  3A1Q A;  4KZ0 A;  1FFV A;  3SD5 A;  3JW0 X;  1SE4 A;  2V9H A;  5TR5 A;  1N62 A;  5C3J B;  3V62 A;  3CST A;  2ZVN A;  4G11 A;  2NPT A;  4GGQ A;  4M00 A;  1WI0 A;  2DAJ A;  3WAM A;  4WAA A;  1JWM D;  1YMH E;  4ICV A;  2AEH A;  2ZEQ A;  4TMA B;  2JY6 A;  2XBB C;  3Q8C A;  4FBJ B;  2LXC A;  3P4P B;  3ZRC A;  2C7N B;  3SEB A;  1WX8 A;  3NRZ A;  3H9D A;  3RNE C;  1WXS A;  3AEB B;  2N9X A;  4LNI A;  1WJ4 A;  2DYM A;  5G5H A;  3DVN V;  2WGS A;  1CMX B;  4JL9 A;  4DXG A;  5D6J B;  5L95 C;  2JZP A;  1WGD A;  5CHW A;  1FRD A;  3PVL A;  3A33 B;  4M0W A;  1GC7 A;  3C8Y A;  4RF0 A;  5FR6 A;  2N9K A;  1YJI A;  1E8Y A;  3RT3 B;  1V1P A;  2J52 A;  2RGF A;  3M95 A;  1SF0 A;  2LGS A;  1RYJ A;  1EU3 A;  1AAR A;  1SIJ A;  3S2A A;  4BAX A;  3ZVV A;  4L1B A;  2L00 B;  1C1Y B;  3HM3 A;  2BS4 B;  5EE9 A;  5I4D A;  3VH3 B;  3H7P B;  3Q2A C;  2W3R A;  1N5X A;  1WGH A;  4BVU C;  4AJY B;  1H8C A;  1CJE A;  3MFG A;  4EE2 A;  2PMV A;  3W5U B;  2QMT A;  3FC4 A;  4AQ7 A;  4MGZ E;  3ZO5 B;  3HUI A;  2LHE A;  3GZN I;  1CK1 A;  3N20 C;  1L7Y A;  4IM3 A;  1X1M A;  1I7H A;  2DYB A;  1FMA D;  4HPP A;  2JZ3 B;  1UNS A;  1GC6 A;  3VQI A;  5LXH A;  3LB8 C;  1WJU A;  3RYT A;  1EWC A;  2AL6 A;  3CWI A;  1TZ1 A;  3NJT A;  4OZC A;  3I57 A;  2JYE A;  5BO4 B;  2CU3 A;  1C4C A;  1IUE A;  3GS2 A;  1PUT A;  1OQR A;  2JX5 A;  4HCP B;  1ENF A;  3AEF B;  4ZRP A;  1L0V B;  5MPO A;  3C0R B;  4C00 A;  2D07 B;  4IDI A;  4B9K A;  2J0J A;  2LI5 A;  5HG2 A;  2FUH B;  2AX5 A;  1G6J A;  1T0Y A;  1VZ6 A;  4GU2 A;  1WM2 A;  4FHK A;  1J0G A;  3NZU A;  1VRA B;  3B0A A;  5HHD G;  2BTE A;  3MHZ A;  1UWM A;  2N4F A;  1KLG D;  1E0Z A;  5AZH A;  1XT9 B;  3DBL I;  1P7F A;  2LGD A;  1R7S A;  3Q8B A;  3L13 A;  2INC C;  4FN2 A;  4D2K A;  4KKI A;  4EFO A;  1Z5S B;  5JXV A;  1V9J A;  3A4R A;  1WGR A;  4BZA A;  4B0E A;  2OHF A;  3TSS A;  1WIA A;  4GDL B;  4LNN A;  2NPT B;  2PEA A;  3PZ7 A;  4GIV A;  3U4E G;  2CHX A;  4DBG A;  2DYO A;  3RNC C;  1STE A;  2KHW B;  3HVZ A;  3DWM A;  1P0R A;  4A3P A;  3ENE A;  4E3C A;  2EMS A;  2PE9 A;  2VZK B;  2KJR A;  4KX6 B;  3BK1 A;  1WRI A;  1ZW7 A;  2PVO D;  2D2Q A;  3CF6 E;  2JQR B;  1ACC A;  4MDK E;  1F1H A;  4PK1 A;  1KH0 A;  4P1C C;  3H1U A;  2N1V A;  2BF8 B;  3KH0 A;  1PGB A;  2LEK A;  3PHW B;  1IGD A;  3OG5 A;  4JQW C;  1IBX A;  1V1O A;  4W9I A;  1WF9 A;  2RDG A;  3DWG C;  2MBE A;  2WDQ B;  3OJ3 A;  4K3C A;  2CJN A;  3BWU D;  1E9M A;  2K39 A;  1SBB B;  2CU1 A;  3T3N A;  2LRU A;  2GBJ A;  3DDC B;  3V6C B;  1M4V A;  2N9E B;  5IKC M;  2FCS A;  5HI1 A;  2MP2 B;  2HTH A;  4XZ4 A;  4ICU A;  1C78 A;  1FRR A;  1ZGU B;  3VDZ A;  4NAW B;  2KC2 A;  3KUZ A;  3BY4 B;  4HPM B;  3VRB B;  4FJV B;  4YL8 A;  2KK8 A;  3ZRF A;  4TQ0 A;  3P63 A;  2K1F A;  2SEB D;  5LXI B;  1JCK B;  4JLC A;  1GB4 A;  5DPS A;  3SU8 X;  2C5L C;  2K6D B;  2WXH A;  1DOX A;  1FXT B;  3SDL C;  2KMC A;  1PFD A;  2V4L A;  1WYW B;  4XGA B;  1E7U A;  1CQV A;  1L6V A;  2KLG A;  1J7B A;  3W5V B;  4NJ7 A;  1V8C A;  2WWZ A;  1IPG A;  1OQQ A;  4XX5 A;  5BMG A;  2LXA A;  2LGX A;  4JGH B;  1FPY A;  2JXT A;  2C7H A;  2GBR A;  1TT5 B;  4BKS D;  4ZRQ A;  2FNJ B;  4WAF A;  2J0K A;  3NS8 A;  1WGK A;  2NS5 A;  1FCL A;  1I42 A;  1NEN B;  1J7C A;  3QQ8 B;  1HTQ A;  4NZL B;  1HA5 A;  1D5X C;  2MJD A;  3AI5 A;  3ML9 A;  2G45 B;  3B08 A;  3BVM A;  2KFK A;  5HKH A;  2X8X X;  5D3I B;  3WAL A;  2V0G A;  4WWP A;  4GOC A;  2FUG 1;  3U7D A;  3ZTC A;  3IT4 B;  1ZPS A;  1F9J A; 
#chains in the Genus database with same CATH homology
 4HJG E;  3BK2 A;  2K5P A;  1ZXH A;  3AED B;  4WQM A;  1QIL A;  4RGM A;  3AN1 A;  1ZP0 B;  1T6B X;  1N5W A;  1D5M C;  1F0Z A;  2H88 B;  2J53 A;  3I9V 1;  4N59 A;  1FXI A;  1HZ6 A;  3R2I A;  4N58 A;  3U52 E;  2AQ3 B;  2HTM E;  5LNK 1;  3P42 A;  3Q69 A;  2E6X A;  3V05 A;  1E10 A;  1TKY A;  2AQ1 B;  2WDR B;  4ITK A;  2WXG A;  3FIL B;  1VDV A;  2KAC A;  3AE5 B;  4XDC A;  3RFZ B;  2YEP B;  1SE3 A;  3PZ8 A;  3Q8E A;  4OZA A;  3AEE B;  1N63 A;  2N0S B;  4XDD A;  3ZGZ A;  2KQ4 X;  3AEC B;  4L2Y A;  1QF6 A;  1KF6 B;  2MJ3 A;  2L1A A;  2BBC A;  2IGG A;  5D3D A;  1KLU D;  3U7Z A;  1KRH A;  3EUB 2;  3EA6 A;  1FCC C;  4FXC A;  4C7Y A;  2I2Y A;  1FO4 A;  1TY2 A;  3AE7 B;  4RFB A;  3NZ3 A;  5E6J A;  3R2T A;  2W54 A;  3BVG A;  1TKE A;  1ZOY B;  1K53 A;  2RMM A;  2MEK A;  2BB5 A;  2QIL A;  4YWG G;  3MC0 B;  4YSZ B;  4RGN A;  4A8X C;  2ONQ A;  1PGA A;  1FM0 D;  1BXT A;  2JSV X;  1JRP A;  4YSX B;  4MT5 A;  4P16 A;  4US9 A;  1UWX A;  3BII D;  5BYQ A;  2KAJ A;  1KFY B;  4HKZ E;  2WXI A;  3AE6 B;  2K22 A;  1JML A;  1FFV A;  4GLS C;  5TSS A;  3LYY A;  4ZHP A;  1DGJ A;  1SE4 A;  2B76 B;  1XLO A;  1FFU A;  5C3J B;  1N62 A;  1PYW D;  2JU6 X;  2I38 A;  1FIQ A;  2WU5 B;  2W82 A;  1F2R C;  4HRS A;  1C77 A;  2BYT A;  1NYR A;  1JWM D;  1YMH E;  2WXP A;  1JAL A;  3VRA B;  1K52 A;  1QQR A;  4HEA 1;  2L83 A;  3FIL A;  4TMA B;  3KWV A;  3V3X A;  1ET6 A;  3Q8C A;  2DLB A;  1QOB A;  2BT6 A;  1YJJ A;  1TJE A;  3P4P B;  3Q8A A;  5BMH A;  3SEB A;  1KTK A;  1YQ3 B;  3OWE B;  3NRZ A;  1SE2 A;  2WQY B;  3AEB B;  1ZXI A;  3AE9 B;  2K9X A;  1JWB D;  2DYM A;  5G5H A;  4UDU C;  1NVI D;  4A55 A;  3WCQ A;  5C2T B;  2BS3 B;  4DXG A;  5EE1 A;  3AE1 B;  1K50 A;  3KLS X;  2JZP A;  4ARC A;  1BUI C;  2ZW1 A;  3AB5 A;  1FRD A;  4M0W A;  1XXG A;  1FD6 A;  2EEL A;  3C8Y A;  4RF0 A;  5T8I A;  1JQ4 A;  4TSS A;  2N9K A;  1YJI A;  3AEG B;  1V1P A;  4GDK B;  1HEZ E;  5BYR A;  1L4D B;  2G9H D;  2J52 A;  1NYQ A;  3PO0 A;  1JWA D;  1SF0 A;  1WSP A;  4KGS A;  1RYJ A;  2TSS A;  1EU3 A;  2YEP F;  2WXO A;  1XLN A;  4A9A A;  4ZYS A;  3SFD B;  1UGJ A;  4JWS C;  1SIJ A;  2RPV A;  1EM7 A;  3KQ4 A;  1WWT A;  3ZYY X;  1SEB D;  3B9J A;  2JYT A;  1GOZ A;  4B0M A;  4L1B A;  1F2R I;  2ON8 A;  1F77 A;  1MI0 A;  4HKQ A;  1B1Z A;  2BS4 B;  2NTS A;  5EE9 A;  5I4D A;  1D5Z C;  1VLB A;  2W3R A;  5D7G A;  4DQO C;  5HFY A;  2W3S A;  2LGI A;  2FE8 A;  1N5X A;  2D5G A;  4A6Q A;  1MHH E;  2WNM A;  2FBW B;  3B2G A;  1FNW A;  2L32 A;  1CJE A;  3NUH B;  5BMI A;  3MFG A;  3J9C A;  2PMV A;  3W5U B;  2KN4 A;  4EE2 A;  3CIR B;  3L4P A;  2M0A A;  1GPX A;  4YTN B;  2QMT A;  3FC4 A;  3Q8F A;  1I4R A;  4AQ7 A;  3IXS A;  3NVZ A;  1HQR D;  1AN8 A;  1XLQ A;  3HUI A;  4ZOH C;  2LHE A;  4YTP B;  1L0X B;  3TEX A;  2ZW0 A;  2OED A;  1CK1 A;  3SFE B;  2EKI A;  1QLB B;  3ETR A;  4RF1 A;  4YXD B;  1V97 A;  4IKG A;  1I7H A;  2IGH A;  3W9C B;  4C80 A;  1FMA D;  1QT9 A;  4HRO A;  1UNS A;  1XLP A;  4JPS A;  3VQI A;  4LTU A;  3LB8 C;  1J7A A;  3W2D A;  1XCQ L;  3FAH A;  2H89 B;  4NJC A;  1EWC A;  3CWI A;  3AE3 B;  4MM3 B;  3TEZ A;  4OZC A;  1QOF A;  1TS4 A;  2Y3A A;  1GAQ B;  3URY A;  2GB1 A;  3I57 A;  2JYE A;  2WXQ A;  1YNT E;  2CU3 A;  1FXA A;  4JWU C;  1C4C A;  4NAM A;  1IUE A;  1VR9 A;  3GS2 A;  1PUT A;  1DYQ A;  1OQR A;  2JX5 A;  1I4P A;  1XF5 L;  1ENF A;  2M19 A;  3AEF B;  4ZRP A;  4US8 A;  1L0V B;  1P7E A;  3P4S B;  1QKZ A;  5MPO A;  1QOG A;  4IDI A;  3R8B A;  4P6V F;  5HG2 A;  1C4P A;  2AX5 A;  1L5P A;  2ACZ B;  3P1M A;  1VZ6 A;  3ZJT A;  4XWT A;  4AS1 A;  4REZ A;  3O13 A;  2LMC A;  5H8Y E;  1MVK A;  1TYG B;  1VRA B;  3MP9 A;  4C56 C;  1UUP A;  1ZDX A;  1JW9 D;  3NVV A;  5HHD G;  2BS2 B;  1TS2 A;  4LLG M;  2V3P A;  3MHZ A;  2LUM A;  2BTE A;  1UWM A;  3MJ5 A;  1KLG D;  1E0Z A;  4OVZ A;  4LK0 M;  1XCT L;  2WXK A;  4RCO A;  1P7F A;  3BYT B;  1R7S A;  3Q8B A;  1JRO A;  2WU2 B;  3H8H A;  1B9R A;  1ZE3 D;  3W1S A;  2WXM A;  2IDY A;  3NS1 A;  3UI3 A;  4D2K A;  4KKI A;  2MJE A;  2PKO A;  4J3O D;  1C9F A;  5JXV A;  2K0P A;  2Y5P A;  1E6E B;  2M56 B;  2PLP A;  2NMQ A;  1EU4 A;  5FK9 C;  4B0E A;  3T3O A;  3HVD A;  1QOA A;  2INP E;  3AV8 A;  2OHF A;  3TSS A;  4GDL B;  4R3D A;  1RFK A;  1IGC A;  2IGD A;  4WIP A;  2N9L A;  3PZ7 A;  4RGO S;  3GP7 A;  1XEE A;  1SB3 C;  2WXF A;  1D4B A;  1C79 A;  4WH4 A;  3U4E G;  2DYO A;  4OHJ A;  1CZP A;  2Z8L A;  1STE A;  3EGR A;  3E56 A;  2IJ0 A;  2W55 A;  3HVZ A;  3DWM A;  1K51 A;  1MHX A;  3E9S A;  2L52 A;  2NTT A;  2G1E A;  2KMM A;  2VZK B;  2WP9 B;  4Q2J A;  4KX6 B;  3BK1 A;  1WRI A;  1FNV A;  1N61 A;  2PVO D;  2VZK D;  2WS3 B;  2JQR B;  2XNA C;  1ACC A;  2ICI A;  1AWD A;  2JWU A;  2KWD A;  3VR8 B;  2WLB A;  2K3U A;  1KH0 A;  2J42 A;  1I4H A;  3ZJV A;  1TS3 A;  1D6E C;  3AE4 B;  1AW7 A;  2N7J A;  3IAM 1;  1L4Z B;  1PGB A;  2LEK A;  1IGD A;  1IBX A;  1LO5 D;  1YN4 A;  1DOY A;  1V1O A;  5EE3 A;  1SJE D;  4YT0 B;  4C7Z A;  1FEH A;  2RDG A;  3DWG C;  2WDQ B;  1GB1 A;  2XN9 C;  2E3T A;  2CJN A;  3ABV B;  2WXR A;  3BWU D;  4JX1 C;  2X38 A;  1E9M A;  1TKG A;  1WYG A;  3TEY A;  4KKJ A;  1SBB B;  5GXG B;  2Q5W D;  2DWQ A;  3BZD B;  1JWU D;  3T3N A;  2MH7 A;  3BYY B;  1A70 A;  1L0Y B;  1OFF A;  2PW9 A;  3HRD D;  3U2S C;  1NEK B;  2BB6 A;  1M4V A;  4A90 A;  4KGT A;  3AH7 A;  2LJI A;  2PIA A;  4O1N A;  2LHD A;  5HI1 A;  2QEJ C;  2GI9 A;  1C78 A;  1FRR A;  2V4I B;  2PTL A;  2QIE B;  1I4X A;  1N60 A;  1XO3 A;  1C4A A;  3VR9 B;  3NVY A;  4NAW B;  5BYS A;  1ROE A;  1SSN A;  1YN3 A;  5G5G A;  3VRB B;  1SXT A;  4TQ0 A;  3P63 A;  4PT5 A;  2SEB D;  2KDM A;  3NVW A;  2RDH A;  1JCK B;  2PVG C;  5H92 C;  1GB4 A;  2WXL A;  3BVZ A;  3RPF C;  4IOI E;  1C76 A;  4DXF A;  4YTM B;  2IPK D;  1FNU A;  3KWL A;  4KGR A;  3TEW A;  2R61 A;  2WXH A;  3ZJU A;  1DOX A;  1TS5 A;  1EWY C;  3N9Y C;  4JE3 B;  1PFD A;  4YSY B;  2GRI A;  1TY0 A;  4RNA A;  3AMZ A;  1MPE A;  1CQV A;  1PDX A;  3SR6 A;  1L6V A;  2J4X A;  4N6E B;  2WXJ A;  1J7B A;  3AEA B;  1YQ4 B;  1TZO A;  5FR3 A;  4RGT A;  5AUI A;  3W5V B;  1ZDV A;  1HZ5 A;  1V8C A;  1Q10 A;  2AQ2 B;  1WXQ A;  4XE0 A;  2V3N A;  1OQQ A;  1IBX B;  1T3Q A;  1PGX A;  4XWW A;  2Y5C A;  3GB1 A;  5BMG A;  2QSD A;  4ARI A;  3IT6 B;  1VZ8 A;  2JXT A;  2SAK A;  4OW0 A;  1YN5 A;  3B2F A;  4RH6 A;  2INN E;  4TQ1 A;  3AE8 B;  1DOI A;  1VZ7 A;  4ZRQ A;  4WAF A;  4WWM A;  1I4Q A;  4WUR A;  4MAC A;  1VJK A;  1ESF A;  1RWS A;  1RM6 C;  1WGK A;  2QJL A;  1FCL A;  1SJH D;  2LFI A;  3AE2 B;  1ZUD 2;  4H2A A;  5EE0 A;  2BW2 A;  3ZQ4 A;  2CJO A;  3AM9 A;  1NEN B;  3P4Q B;  1BML C;  1J7C A;  1NI3 A;  5AUK A;  4NZL B;  1I4G A;  3LXF A;  4CQN A;  1AYF A;  1E7P B;  1HA5 A;  1D5X C;  2MJD A;  4USA A;  1HXY D;  3P4R B;  4L23 A;  4MH8 A;  1L6U A;  2WXN A;  3BVM A;  1Y56 A;  5D3I B;  1ET9 A;  2V0G A;  4OZB A;  3IAS 1;  1V1P B;  2WDV B;  2DBY A;  2FUG 1;  5FKA C;  4ZHO A;  3TUO A;  3IT4 B;  2HDE A;  1T5X D;  1ZPS A;  1JWS D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...