1YJJA

Rdc-refined solution nmr structure of oxidized putidaredoxin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Putidaredoxin
publication title Redox-dependent structural differences in putidaredoxin derived from homologous structure refinement via residual dipolar couplings.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 16
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yjjA00
3B9JA 1SF0A 3AV8A 4JWUC 2MH7A 3B2FA 3HRDD 3P4PB 3KWLA 2LEKA 3B2GA 3LXFA 5G5HA 3AEFB 1FO4A 3NVWA 5EE1A 1VLBA 3AE3B 2WLBA 4YSXB 1JWBD 3ZYYX 1PFDA 1RWSA 2QIEB 1JRPA 1L5PA 2K5PA 1R7SA 1N60A 1OFFA 1VJKA 2WQYB 1NYRA 1YJIA 1J7AA 1QOGA 3FAHA 1WRIA 1FM0D 2BT6A 2M56B 2WU5B 3VR9B 4YSZB 4YTNB 1WWTA 3AE1B 3AE9B 4US9A 4YT0B 4N6EB 1DOIA 2CU3A 2N0SB 1E9MA 1T3QA 2W3SA 1YQ3B 3CWIA 3P4RB 4YTMB 5C2TB 2AX5A 1JW9D 1VDVA 3W5VB 3AE6B 1QLBB 2W3RA 1RYJA 2PIAA 1AYFA 1NYQA 3AH7A 4LTUA 4WWMA 3AE2B 3NVVA 2WDVB 1EWYC 1YQ4B 2WP9B 1UWMA 3W5UB 3NVZA 1XLOA 1JQ4A 1JROA 1SB3C 1QT9A 4HROA 2H89B 3AE8B 1N5WA 3AM9A 1XLPA 2FBWB 3SFEB 1NENB 2HTME 2L52A 4YXDB 1PUTA 2BS2B 1E0ZA 2W55A 3P4SB 2L83A 4ZOHC 1YJJA 3NRZA 5EE0A 1F0ZA 4US8A 2PKOA 1XLNA 1N63A 1CJEA 3AB5A 3ETRA 5MPOA 2DWQA 2EKIA 2Y5CA 1AWDA 1TYGB 2B76B 5H92C 4ITKA 1QF6A 2WS3B 1ROEA 4A9AA 1XO3A 5G5GA 2QJLA 4IDIA 4JWSC 1V8CA 1GAQB 4C7ZA 1DGJA 5EE3A 1XLQA 1L6VA 2G1EA 3CIRB 1FIQA 2CJOA 3AE5B 3AE4B 1FXIA 1QOBA 3HUIA 3RPFC 3AECB 5AUIA 1JALA 1KRHA 1KF6B 3AEAB 2MJ3A 3P1MA 1ZUD2 4N58A 3VR8B 2PVGC 1DOYA 1E10A 1E7PB 1GPXA 1J7CA 2KMMA 1SIJA 3DWMA 1TKYA 3EUB2 1QOFA 3AEGB 4YSYB 2WDQB 1IUEA 3WCQA 1CZPA 4C80A 1TKEA 1JWAD 1WYGA 1ZP0B 1FFVA 1PDXA 1OQQA 2M19A 1DOXA 1E6EB 3HVZA 1V97A 2E3TA 3P4QB 5H8YE 2JQRB 1RM6C 3AEBB 3P63A 1N61A 2OHFA 1FRDA 2WDRB 3AEDB 3AN1A 4KX6B 4N59A 1RFKA 1OQRA 1NEKB 2WU2B 1ZOYB 3LB8C 3NVYA 4USAA 1N5XA 3VRAB 3W9CB 1FRRA 2CJNA 2H88B 2PVOD 1NI3A 4C7YA 2BS3B 1FMAD 1TKGA 2W54A 5C3JB 3L4PA 4YTPB 3ABVB 2BS4B 3BIID 5AUKA 3VRBB 4P6VF 4ZHPA 4ZHOA 1WGKA 3DWGC 4HRSA 1N62A 1B9RA 1TJEA 1A70A 4JX1C 3AEEB 2KAJA 1QOAA 2MJEA 1NVID 1WXQA 2K9XA 2MJDA 3NS1A 3PO0A 1KFYB 4FXCA 3SR6A 2K22A 1ZXIA 2Q5WD 1L6UA 2JX5A 2DBYA 1J7BA 4WQMA 3AMZA 2ACZB 3AE7B 1FFUA 1FXAA 3FC4A 5GXGB 5EE9A 1I7HA 1L0VB 3SFDB
chains in the Genus database with same CATH superfamily
4B0EA 4JPSA 2QILA 2AEHA 3Q2AC 3TCAA 2UYZB 3L08A 2KO3A 3Q14C 1PFDA 4BAXA 1R7SA 4MT5A 1LM8B 1RFAA 2W3RA 2C9WB 1YQBA 1TIFA 4XWTA 3O65B 4IKGA 4GXBA 5FKAC 4GB9A 3TBLD 4ANVA 1WR6E 2KOXA 2QEJC 1PYWD 4D2KA 5TR5A 2O2VB 3ZW3A 4HWIB 3UQAA 1ZXHA 4II2B 4JWSC 2WNMA 2PE9A 5EE3A 1R4MB 2IY0B 1SSNA 4E71A 3EA6A 2LHEA 3BVMA 1Q1OA 2C7MB 4GDKA 1SIJA 3WCQA 3ZO5B 3ZVVA 1ZP0B 3C0RB 2DAJA 3WA0A 3RULA 1VZ6A 2INPE 2ONQA 4WH4A 2UU7A 2OHFA 4HVBA 4YT0B 5J2RA 1D5XC 4M0WA 3ZTCA 1KJTA 2H88B 5FK9C 2W9NA 5E6JA 1E7VA 2DX5B 2JZZA 4ANUA 4BOZB 4HRSA 3PTFC 3Q8EA 1LQBA 3I3TB 3PZ7A 4JLCA 4WQMA 4BOSC 1AW7A 3SFDB 3A9JA 2GLSA 2MH7A 1J8CA 3IVFA 4WURA 2LEKA 3DVNV 1TS5A 4ZRKA 2KMCA 3M62B 1CK1A 3T3NA 3VR9B 2JPHA 2L05A 3MHZA 4TQ1A 3WALA 3ZJVA 2AYOB 2J0KA 2NTSA 1DOIA 1C4PA 4EZJA 4W9FA 4YTMB 3CWIA 4RMAA 4JQWC 1RYJA 4LTUA 4W9CA 1FNUA 1JQ4A 5JH5C 4AJWA 4WWPA 2NS5A 2K8HA 1SE9A 2CKHB 4GDKB 4RM9A 1WXMA 1WH3A 4LDTB 3SDLC 1JMLA 1SJED 3TEZA 1EWCA 3PHWB 4ZYSA 3Q8AA 4IDIA 3CIRB 1EF5A 4DHJB 3JYUA 4URKA 4ASWC 3A9KA 4M0WB 4NPNA 1ZUD2 3VR8B 1V5OA 2KT7A 3S2AA 3EFUA 2KN4A 1CMXB 3C8YA 1KM7A 1YD8U 3AEGB 3RCZA 2VRRB 4HPLB 2D07B 3ZTDA 3Q3FA 1VZ7A 1GJZA 3AEDB 2IO1B 3DDCB 1XCQL 4HEA1 2QSDA 3I9V1 2GBJA 4NZLB 2CHZA 1LO5D 2W54A 3RNGC 4OZBA 2MHJA 3LYYA 1EU3A 1TJEA 3OG5A 3D32A 2K9XA 3PO0A 3SU8X 2K22A 4K3BA 5HG2A 3ZJTA 1XT9B 5CX3A 4F7ZA 2O6VD 2Y5BB 3QC8B 2KLCA 3Q3OC 2G4DB 3B2GA 3CSTA 4MEMA 2DYOA 1BT0A 1UBIA 1WM3A 1YOVB 1Q10A 2N9EB 5KHQA 2J0MA 1YJIA 4XYCA 4B0MA 4OHJA 3IAM1 4MSMB 1WI0A 1SE3A 4BBNC 1YQ4B 2ZW1A 3DBSA 2MW5A 1XLOA 5BMGA 1QT9A 3AE8B 4GOCA 3AM9A 3B08A 3V6CB 2DLBA 1PUTA 3PHXB 4RFBA 4IWPA 1TBEA 2C60A 1EUVB 1ISNA 1XF5L 2LASA 3TSSA 1FXTB 1I4XA 1EM7A 2WS3B 2KTFA 4MGIE 1ROEA 1F2RC 4IC7B 4EE2A 3WAPA 4AWJA 4A8XC 4A90A 3ZRFA 2J52A 2N1WA 1KF6B 2KVRA 2L76A 2MJ3A 3CSFA 4N58A 3RZFA 1HXYD 4N9F4 4A6QA 3DBLB 3CF6E 2WXIA 3PREA 1V86A 3PVLA 1T0YA 1F77A 2WXNA 1AN8A 1RFKA 2K8CA 2V3SA 1N5XA 4FJVB 3VRAB 1FMAD 1UWXA 3QK0A 3A4RA 2JT4B 4G0NB 5AEKB 3A33B 3MP9A 2N9PC 1STEA 1FCCC 4JX1C 3ZDTA 3AEEB 5IA7A 3DBHB 2KAJA 3PGEA 5IKCM 1ZXIA 2QHOA 3PLVA 4ZRIA 3VUWA 2FCMA 4KGTA 5GXGB 2WXPA 3UIOB 4E74A 3KUZA 1IP9A 1BUIC 5AZFA 5HI1A 3I57A 2LRUA 5BYQA 1RWSA 4WWNA 2K5PA 1WYWB 2X8XX 4FA6A 2M0AA 4NJ6A 3Q3MC 4GIVA 1E90A 2WYQA 4ICVA 1C76A 3DBLI 3QIJA 3AE2B 3BZDB 1EWYC 1RAXA 4YL8A 3QQ8B 3B0AA 4YXDB 2W55A 1TY2A 2AL6A 3APCA 2PKOA 2ZPYA 5E6OA 2N9KA 2PTLA 3RMKC 2FCNA 2MA9B 2NR2A 2HDEA 4CYEA 1GUAB 1WM2A 4ZRJA 2REXA 2INNE 3IBEA 4DXGA 3ZKJC 1P3QU 3QX1A 3KW5B 3TL5A 1PQSA 3PPAA 3PRZA 2MX2A 4RH6A 1Q0WB 3N20C 1WX9A 1PDXA 1KLVA 3AU4A 4L23A 1VRAB 1UUPA 2DZMA 4LJOB 4ICUA 3PSEB 4KX6B 3UIPB 4H2AA 3U2SC 5LXIB 4UDUC 3BIID 4K81A 3GOEA 4HPPA 5G55A 5AZGA 1GC7A 3PS6A 2N9XA 4FHJA 2M17A 2LXAA 2M8SA 2JXTA 2LMCA 3NOBA 4K7UA 1I7HA 1SF0A 2NBUA 5JHBA 1YN4A 5D3DA 1D5MC 2EELA 4FULA 4BKTA 2KJHB 1QZEA 4DDGD 3QAQA 1WRIA 1WWTA 1VDVA 3IT4B 1FEHA 2JRIB 3HIZA 1XLPA 2L52A 4WJPA 3BVGA 1T6BX 2L83A 1F9JA 1V1OA 3AB5A 1T0QC 2NVUI 1FD6A 4S0RA 2EKIA 5G2NA 2Y5CA 3B1LX 5H92C 3UI3A 1LFDA 2I2YA 4MH8A 4KDLB 3OLMD 4RNAA 3RPFC 3T8MA 1UBQA 5LXHA 1XCTL 4I6PA 3DPDA 1H8CA 2KMMA 5HFYA 4YSYB 5CHFA 2IDYA 3V6EB 1ZW7A 1V9JA 3RNCC 1NBFC 1E6EB 2QMTA 1C9FA 2KK8A 1NDDA 2E3TA 2J53A 4B95A 3TEWA 2N9LA 4J6IA 4MDKE 4DQOC 2WDRB 4C56C 1OQRA 3LB8C 1JWMD 2V4IB 5IOIA 4A3OA 4B6WA 3N3KB 1NI3A 1Y8RC 2DZKA 4P7IA 2KANA 4M8NA 3BYTB 3Q3JA 1B9RA 1K51A 2O2VA 4KSLC 5CTRC 3VH3B 1WXQA 3I5JC 3A1QA 4RGNA 5TSSA 2BTEA 4IWOA 2MCNB 3LJ3A 2G9HD 4E3CA 1C79A 3WAOA 2V9HA 3P4PB 4G50A 2DZJA 4PS3A 1C77A 3ML8A 1GG3A 3JVZX 3KWVA 5J17A 2R2QA 1C4AA 4KSKC 1ZE3D 2XN9C 2XK5A 2OJRA 4US9A 4N6EB 1D4BA 4NQKE 2IPKD 2AX5A 1BMLC 5DPTA 4XGAB 1Q5WB 5BYRA 2FBWB 4LJPB 2BKRB 2K1FA 4ZOHC 2GBNA 3I63C 1WIAA 1I4QA 1MI0A 3T3OA 3TMPB 1HA5A 1MVKA 1V81A 1WJ6A 1V6EA 4LCDE 1QF6A 2IYDB 2KWCA 4ZDVA 5HKHA 2YLMA 3QJZA 4B9KA 2DZIA 1V80A 2LUMA 3H9DA 5LLIA 1T0RC 1WRDB 2M1MA 3L16A 2WXJA 1C3TA 4A3PA 4WAFA 1DOYA 3RNFC 3EUB2 1FCLA 4KGSA 4FBJB 3URYA 1TKEA 2G4SA 3H8HA 4NJ7A 2WXRA 3AI5A 2RR9A 1DOXA 2X38A 4EKUA 3A1QB 5H8YE 2JQRB 2V3NA 1N61A 3RI7C 4A55A 5JXVA 2NTTA 3NZUA 1I4RA 1EF1A 1WGDA 3W9CB 3VDZA 1EU4A 2AQ1B 1C4CA 1N6ZA 2MQJA 4AUQC 1L4ZB 1OEYJ 1S1QB 4FLHA 2RDHA 2KWUB 1TZ1A 3BK1A 1MPEA 2R61A 2XK5B 3NS8A 4KGRA 4OZAA 2YVCA 3OJ3A 1UELA 2MEKA 3HRDD 3R2IA 3MC8A 5G5HA 2JSVX 1UF0A 1GB4A 4HK2A 3ZYYX 4C4VA 3QWZB 1J7AA 2LHDA 2L8JA 4YTNB 3AE9B 4WJNA 4PK1A 2CU3A 2L1AA 1I4PA 3VUXA 1JW9D 1CQVA 2ZZPB 3AH7A 1QQRA 3VTUA 2AQ2B 3DHHC 2GOWA 3UINB 4KZCA 2WHIA 4X57B 2L32A 3UGBB 1R4MI 4ARIA 2ASQA 1CJEA 2NMQA 3GP7A 2MWSB 4W9DA 3PRMB 2J7QB 1VR9A 4M02A 2QJLA 2R2OA 1GAQB 3WAMA 2LJ5A 3AE5B 1HZ6A 4DWFA 1OTRB 2OOBB 1JALA 3Q8FA 3AEAB 3KVFB 1J7CA 1MG8A 1WZ0A 1QOFA 2KD0A 3BK2A 3PT2B 3R8BA 2I1KA 4IOIE 2AWTA 4WAAA 4K1RB 1F2RI 1SIFA 4G11A 1FRDA 3AN1A 1TGZB 1SE2A 2K39A 4M00A 2LVPA 1WJ4A 2NBWB 4XDDA 3L4PA 4KZ0A 3ABVB 1GC6A 4ZHPA 2PJHA 3LDZE 4RM8A 2N1VA 2KHWB 5EDSA 2HJ1A 4ZYNA 3NS1A 3SR6A 2LVQA 4C4VB 4ZRQA 3X23A 1L6UA 4W9IA 2WXLA 3X0WA 2RDGA 5EE9A 1WY8A 1WR1A 1V1PA 4JWUC 3B2FA 4CO7A 2UWQA 2IJ0A 1IYFA 3LXFA 4LNKA 1FO4A 1ZDXA 2E6XA 3AE3B 3QHTA 2WLBA 2LGYA 4DXAB 1NYRA 1QOGA 3NHEB 3GE8C 3P42A 4ZRPA 2C7NB 1IGDA 2B3AA 1PGXA 1AYFA 4F1SA 3A4SC 1ACCA 2JZ3B 2KX0A 3SHQA 2BQQA 2GB1A 2KWDA 4W9LA 2MP2B 1VCBA 1F52A 2BGFA 1I4GA 3V3XA 2FNJB 4ITKA 2V1YA 1XEEA 5G5GA 4BKSD 4BVUC 1FIQA 1QOBA 3HUIA 2SAKA 2HD5B 2LZ6A 2KFKA 3APDA 3P1MA 1IUEA 3NZ3A 3Q8CA 5AZHA 2GI9A 2JWZA 1PGAA 2BWFA 3V05A 4BZAA 3DVGY 3RFZB 4BKGA 2DYMA 1ZOYB 4USAA 3VTWA 3ZXRA 2PVOD 3HK0A 3ZJUA 1BXTA 3APFA 1V1PB 3BYYB 5J18A 2RGFA 3FILB 4KKJA 1P98A 2WXGA 4WWOA 2RD0A 3VHTC 2ZEQA 3AMZA 4M8MA 3AE7B 2PLPA 3VQIA 5T8IA 2QCZA 1IGCA 2WXOA 1D5ZC 3DOWA 3ZXVA 1C1YB 4KVGB 4W9EA 3AEFB 3MC9A 4DK5A 5DPRA 1TS4A 1JRPA 2DYBA 3U4EG 1HZ5A 2KMAA 2K0PA 5IO9A 3AE1B 5D6JB 2N0SB 4QAYA 2KDBA 2FAZA 3C19A 1K50A 2GBMA 1WE6A 1ESFA 4EFOA 1UWMA 3EECA 2NPTA 2V3PA 3EGRA 3ZNID 2HTME 3Q8BA 2KFKB 3IXSA 1T0SC 3KYDD 1XLNA 5IP4D 1KOTA 3N32A 1RLFA 2INCC 2MSED 4JL9A 4MJSA 4AP4C 4TMAB 3L0WB 2JWUA 2LI5A 4XX5A 3SD5A 2KWVB 2QDFA 2C7HA 4MGKE 1P7FA 4LDTD 3AECB 5AUIA 2K6QA 4JIOU 1L4DB 2PVGC 3T9LA 1K52A 2K6DB 3DWMA 4XWWA 3ZQ4A 4AJYB 1TZOA 1FFVA 1WMHA 3PZDA 4ANXA 4W9GA 3AEBB 2Z0EB 3DBHI 1KH0A 1TS3A 2A4ZA 2FCSA 4CHKA 4RGMA 1X1MA 1I35A 4YTPB 2MBBB 1N62A 2RMMA 2IY1B 3TEYA 1Y56A 1A5RA 4AQ7A 5D94A 2ACZB 2N7DA 2EMTA 1VD2A 3B9JA 3ZNHB 2KX3A 2LVOA 1JCKB 2GBKA 2NPTB 4AOFA 3TUOA 2AL3A 3FAHA 3QA8A 2HE7A 2K3UA 2W3SA 3ZIMA 1SXTA 4MJSB 2ICIA 2V0GA 5DCNA 2LGIA 4W9KA 3CMMB 3VVWB 2PE6B 2ZVOA 2YEPF 3RNAC 3NRZA 5LNK1 1N63A 1QKZA 4HCPB 2KJRA 3HM3A 1NI2A 2G3QB 1K53A 4FHKA 2XEWA 3EFCA 3ZUNA 2CU1A 4I6LB 4A9AA 1XO3A 1WMHB 2IO0B 3ML9A 2JYTA 1UGMA 1WFYA 1I4HA 1PGBA 3KUDB 4GGQA 3DVGX 3Q69A 2J4XA 1E7PB 1SBBB 3IT6B 1L0YB 3KH0A 3BY4B 3RYTA 1UZXB 4LNIA 1S3SG 2L0FA 4BBNF 3EHVA 1UGJA 2WXKA 4N59A 4KV2A 3NVYA 4KIKA 1MFWA 1D6EC 2CHXA 2BB5A 4ZHOA 2Y5PA 3KYCD 2I38A 4FXCA 1ZPSA 2JY6A 4JGHB 2WDTB 3NZSA 2KN5A 3ZRCA 4WQOB 5D7GA 5E6NA 2MBHA 2XNAC 4HXDA 2O6VA 3RT3B 3DHIC 1P1AA 2WWZA 3ZNGC 1HE8A 1HEZE 3GB1A 1SGHA 3E56A 2BT6A 1P9DU 3DCGA 1R4NB 1E9MA 2VH1A 3SEBA 3P4RB 5C2TB 3AE6B 2WXFA 2ZJDA 3NVVA 2HJ8A 1SB3C 2BW2A 1OEYA 4NQLB 2ZVNA 1MG4A 1NENB 3ONSA 3N30A 3O13A 4US8A 4GDLB 5I4DA 1WXSA 3DQVA 2DWQA 4P1CC 5E6PA 4ANWA 1H4RA 4NAMA 1M94A 2W82A 1J19A 4CQNA 2ON8A 2BYEA 1DGJA 4HPMB 2KDIA 2VZKD 2HTHA 1VZ8A 4KIKB 4REZA 5BMIA 1YIWA 5BO4B 2OEDA 3N1ZC 3N9YC 3HVZA 1V97A 3N1YC 2L7RA 3Q3NC 1EO6A 5IAAC 1R4NI 4W9HA 3KUCB 2YEPB 1J0GA 3EC8A 3KQ4A 1WGKA 2O6VB 4OVVA 2L0TA 3UQBA 1KFYB 4GMVA 3MJWA 3H7PA 2IZVB 2JXXA 1FXAA 2WGSA 5DPSA 4ARCA 4NY0A 2CHWA 4K7WA 3VUYA 3BVZA 1GNUA 1TY0A 3TEXA 2N7JA 2K8BA 1V2YA 1N60A 1OFFA 1FM0D 3PV1A 3N1XC 5JZEB 4W9JA 1G6JA 2K25A 4HKQA 4GU2A 2D3GA 2PIAA 3K9OB 4XZ4A 2WP9B 3Q6BA 4FJZA 1JROA 1FNWA 4IW0A 4J3OD 4OW0A 4HJGE 2LJIA 3P4SB 1SJHD 4BFRA 3W2DA 2KVZA 2FIDA 4NAWA 2D3BA 3IAS1 4HJKA 3ZDMC 1MHXA 1V49A 3DHGC 3R66C 5JHAA 2GBRA 4DXFA 4NJCA 1XLQA 4WJOA 3AE4B 1E5WA 2KTRA 2FUG1 3GS2A 2D10A 1E10A 2MBOA 2D2QA 1XXGA 1TT5B 4C80A 1YMHE 3DBRB 1JWAD 5D2MB 1OQYA 4AS1A 3HHMA 2KC2A 1Z2MA 4LNOA 2KLGA 2LGSA 3VAWA 4C7ZA 1P0RA 2ZNVC 3H7PB 1D3ZA 2WU2B 2MBEA 3WANA 2C5LC 3GZNB 1UNSA 3W1SC 2M4NA 1WXAA 3NJTA 5AUKA 4GSWA 1YNTE 2MP2A 1YN5A 3P2BA 3DWGC 3U30A 4IM0A 1WGHA 2MJDA 1NVID 1V5TA 2LGDA 2I1JA 2JUOA 2KC1A 4HDQA 1FFUA 2BYVE 3NY5A 3V61A 5L83A 2LGXA 4OZCA 1HTOA 3KWLA 4JE3B 3RD2A 2AQ3B 4DDID 4YSXB 1P7EA 4RCOA 3U7DA 4IWQA 5HHDG 2FCQA 2QIEB 2D5GA 4XE0A 3IG3A 2KQ7A 2WQYB 4A20A 3MC0B 5KHOA 4TV3A 2A5UA 5CHVC 3OAWA 3U8ZA 4NAWB 3DBRI 1KLGD 4II3B 4L2YA 4HROA 2H89B 4RGOS 3V60A 3FILA 1JRUA 2WXHA 2CS4A 3RN9C 3RZWC 1E0ZA 1E8WA 2BS2B 1LGRA 2KTRB 2J42A 3GZNI 2JF5A 1C78A 2BYFA 1L0XB 4DBGA 2MRPA 1SE4A 1TYGB 3R7RA 2Z8LA 4YWGG 2KYWA 2KDMA 2KQSA 1U4AA 4MACA 1V8CA 2VH2A 2RDBC 4GLSC 1FXIA 2DHZA 4Q2JA 1ET9A 3A9JB 4NNJB 1E8YA 2WDQB 3U7ZA 4I6NB 2KDFB 5D3IB 4PYZA 4RF1A 2FUHB 4L1BA 2IGGA 2D11A 3IFWB 1NEKB 1GB1A 3H7SA 3KLSX 3L54A 4LLGM 1WGYA 3JSVA 4FN2A 4P6VF 3AXCA 2JRHA 2MBQA 2RPVA 3V62A 3ENEA 4G3XB 1YN3A 2JX5A 1B1ZA 4FADA 3JW0X 1FPYA 4M01A 1DYQA 2GRIA 2L00B 4HKZE 3M3JA 3A9KB 1JWBD 2XBBC 3MJ5A 1VJKA 2WU5B 1WE7A 3M63B 5C23A 4TUUA 2IO2B 2GMIC 4C00A 1YQ3B 2G45B 3W5VB 2LWPA 1IBXA 3U52E 1QLBB 2BF8B 3R7QA 1NYQA 3W1YA 2WDVB 2Y3AA 3MFGA 3NVZA 4K3CA 2FE8A 2Z0DB 2JYEA 3PLUA 1F0ZA 4EEWA 2DNFA 2LXCA 4HLEA 2FIFA 2INDC 4FJYA 3GE3C 2LFIA 1WJNA 3VH4B 3HM6X 1E7UA 2CJOA 4GN1A 1ZGUB 3OWEB 1KRHA 3RUIB 1K8RB 2DENB 1GPXA 4DHZB 3JSVB 1XD3B 2KKCA 3OJ4B 2KNBA 1OQQA 3HVDA 4EUTA 3H1UA 3P4QB 4P1BC 4F8CB 2CJNA 1M4VA 2RSUA 4MELA 1TKGA 5C3JB 4MH0E 1OGWA 4PT5A 1KTKA 2D3AA 2ZW0A 2NBVB 1WF9A 1QOAA 2MJEA 4TKNA 4DHJD 4LK0M 4TQ0A 4O1NA 2LRWA 5L95C 3FC4A 4MGZE 1QILA 2EMSA 4EZLA 3VTVA 3AV8A 1HTQA 1ENFA 1IBXB 1FNVA 2BKFA 4IM3A 3PRPB 4P16A 2EKEC 1KLUD 3K9PB 5EE1A 1VLBA 2JU6X 2RPQA 2LD9A 1L5PA 2M56B 4YSZB 3NUHB 2D3CA 3TJPA 2QC8A 2VZKB 5BYSA 1T3QA 2ZPNA 3E9SA 3M95A 1WXVA 2PPHA 4WIPA 2JVCA 4MGYE 4EOYA 3PZ8A 2KACA 1YJJA 4LNFA 5GMVA 4RF0A 1HQRD 4HCNB 1IPGA 1AWDA 2B76B 1WJUA 3ZNZB 1L2NA 3L17A 1ZKHA 3NG0A 4MM3A 1JWSD 3DVNU 3ZGZA 2WXQA 1L6VA 3QARA 4R3DA 5CHWA 2JZPA 2SEBD 1UD7A 3BINA 3WIMA 2BB6A 1ZDVA 3W1SA 3MHSD 4HDOA 2KDEB 3ECIA 3R2TA 1YX5B 3P63A 1T5XD 3VFKA 1WSPA 3QCAA 1FRRA 2BS3B 2IGDA 3FKYA 2TSSA 4OVUA 2BS4B 4GDLA 1WX8A 2PW9A 3ZLZA 1WZ3A 4IUMB 2LUEA 1WGGA 1YJ1A 2BYTA 4IM2A 1TTNA 3IHPC 4RGTA 1ET6A 2BBCA 1AARA 4K7SA 2V4LA 2KZRA 4MSQB 1J7BA 1MHHE 1L0VB 3TIXA 4LNNA 3RNBC 2OJWA 3R3MA 3NVWA 2IO3B 2KFJA 2L3ZA 4PS7A 2Z59B 2ZCCA 1SEBD 1YX6B 5IN7A 2NCNA 3L13A 3RNEC 1WX7A 1GOZA 2PEAA 4WWMA 2DAFA 4KKIA 2KQ4X 3L10B 3W5UB 4MM3B 5BMHA 1N5WA 2BWES 3SFEB 4DHZE 4OVZA 4WJQA 1L7YA 2IBIB 5EE0A 3ETRA 5MPOA 2WX0A 2ZNVB 3J9CA 4PS8A 4S17A 2WX1A 3VXWA 2M0XA 4KDIC 1TS2A 2G1EA 1E8XA 3ALBA 1XQQA 5C1ZA 2KXJA 1E8ZA 5DPWA 1F1HA 1I42A 4TSSA 4BKSA 2CR5A 1TKYA 1CZPA 2KJ6A 1WYGA 3AULA 5FR6A 2M19A 4XDCA 3H6NA 3AU5A 4EZKA 5FR3A 1RM6C 2PMVA 4XC2A 1Z5SB 4IG7B 4C7YA 2J0JA 2MLBA 4PYUA 3VRBB 1JWUD 1MJDA 2IGHA 2BPSA 4ACFA 2WXMA 1A70A 3BWUD 1RRBA 2Q5WD 1WGRA 2DBYA 2N4FA 2N7EA 1UH6A 2BVCA 1LXDA 3UF8A 2ZCBA 3MTNB
chains in the Genus database with same CATH topology
1SF0A 4OZCA 4B0EA 4JPSA 2QILA 1YN4A 3KWLA 4JE3B 5D3DA 2AQ3B 1D5MC 3AEFB 2EELA 4YSXB 1P7EA 4RCOA 1PFDA 5HHDG 1TS4A 2QIEB 1JRPA 2D5GA 4XE0A 1R7SA 3U4EG 2WQYB 3MC0B 1WRIA 1HZ5A 2K0PA 1WWTA 3AE1B 4MT5A 2N0SB 4NAWB 1VDVA 1K50A 2W3RA 3IT4B 1KLGD 1FEHA 1ESFA 1UWMA 2V3PA 3EGRA 4L2YA 4XWTA 4HROA 2H89B 4RGOS 3FILA 4IKGA 1XLPA 2WXHA 2HTME 2L52A 5FKAC 3BVGA 2BS2B 3Q8BA 1E0ZA 1T6BX 2L83A 3IXSA 1V1OA 2J42A 2QEJC 1PYWD 1XLNA 3AB5A 4D2KA 1C78A 1FD6A 1L0XB 2EKIA 2Y5CA 1SE4A 1TYGB 2Z8LA 4YWGG 5H92C 1ZXHA 2KDMA 3UI3A 4TMAB 2I2YA 4MACA 4JWSC 2WNMA 2JWUA 1V8CA 4MH8A 5EE3A 1SSNA 4GLSC 1FXIA 3EA6A 2LHEA 4RNAA 1P7FA 3BVMA 3AECB 3RPFC 4Q2JA 1ET9A 5AUIA 1XCTL 1L4DB 2PVGC 2KMMA 5HFYA 1K52A 1SIJA 3DWMA 4YSYB 2IDYA 2WDQB 3U7ZA 4XWWA 3WCQA 3ZQ4A 5D3IB 4RF1A 1ZP0B 1TZOA 1FFVA 4L1BA 1E6EB 2QMTA 1C9FA 2IGGA 2E3TA 2J53A 3TEWA 1VZ6A 2N9LA 3AEBB 2INPE 2ONQA 4WH4A 2OHFA 4DQOC 2WDRB 4YT0B 4C56C 1OQRA 1NEKB 1D5XC 1JWMD 3LB8C 4M0WA 1GB1A 1KH0A 2V4IB 3KLSX 2H88B 1TS3A 1NI3A 5FK9C 4LLGM 4RGMA 5E6JA 4YTPB 3BYTB 4P6VF 4HRSA 1N62A 2RMMA 2RPVA 1B9RA 1K51A 1WXQA 3TEYA 1Y56A 3Q8EA 4RGNA 5TSSA 2BTEA 1YN3A 3PZ7A 2JX5A 4AQ7A 1B1ZA 4WQMA 2ACZB 2G9HD 1AW7A 3SFDB 1C79A 3B9JA 2MH7A 3P4PB 1DYQA 1C77A 4WURA 2LEKA 1JCKB 1TS5A 2GRIA 4HKZE 3KWVA 1C4AA 1JWBD 3TUOA 1CK1A 1ZE3D 3MJ5A 1VJKA 2XN9C 3FAHA 3T3NA 2WU5B 3VR9B 3MHZA 4TQ1A 3ZJVA 4US9A 2K3UA 1DOIA 1C4PA 2NTSA 2W3SA 4N6EB 1D4BA 1YQ3B 1SXTA 2IPKD 3CWIA 4YTMB 3W5VB 2AX5A 2ICIA 1IBXA 3U52E 1QLBB 2V0GA 1RYJA 4LTUA 1BMLC 1NYQA 2WDVB 2Y3AA 3MFGA 3NVZA 1FNUA 1JQ4A 2LGIA 2FE8A 5BYRA 2FBWB 2JYEA 2YEPF 4ZOHC 3NRZA 1F0ZA 5LNK1 1N63A 1QKZA 1I4QA 1MI0A 3T3OA 4GDKB 1K53A 1HA5A 1MVKA 1JMLA 1SJED 3TEZA 1EWCA 1QF6A 4ZYSA 2LFIA 4A9AA 1XO3A 3Q8AA 4IDIA 2JYTA 2LUMA 3CIRB 2CJOA 1I4HA 1PGBA 3OWEB 2WXJA 1KRHA 4WAFA 1ZUD2 3VR8B 3Q69A 1DOYA 2J4XA 1E7PB 1GPXA 1SBBB 2KN4A 3C8YA 3IT6B 3EUB2 1L0YB 3AEGB 1FCLA 4KGSA 3URYA 1TKEA 3H8HA 2WXRA 1OQQA 1DOXA 3HVDA 2X38A 3P4QB 5H8YE 2JQRB 2V3NA 1UGJA 1VZ7A 2WXKA 1N61A 4N59A 3AEDB 4A55A 5JXVA 2NTTA 3NVYA 1XCQL 1I4RA 4HEA1 2QSDA 3I9V1 3W9CB 1EU4A 2CJNA 4NZLB 2AQ1B 1M4VA 1TKGA 1LO5D 2W54A 1D6EC 5C3JB 1C4CA 4OZBA 2BB5A 4PT5A 1KTKA 1L4ZB 4ZHOA 3LYYA 1EU3A 2Y5PA 1TJEA 2ZW0A 1QOAA 2MJEA 2K9XA 3PO0A 2I38A 4FXCA 4LK0M 2K22A 2RDHA 1ZPSA 4TQ0A 4O1NA 3BK1A 1MPEA 5HG2A 2R61A 3ZJTA 4KGRA 4OZAA 3FC4A 1QILA 3AV8A 2MEKA 3HRDD 1ENFA 1IBXB 5D7GA 1FNVA 3R2IA 4P16A 3B2GA 5G5HA 2XNAC 2JSVX 1KLUD 5EE1A 1GB4A 1VLBA 2DYOA 2JU6X 3ZYYX 1HEZE 3GB1A 1Q10A 1L5PA 3E56A 1YJIA 1J7AA 2LHDA 4OHJA 2M56B 4B0MA 2BT6A 4YSZB 3IAM1 3NUHB 4YTNB 3AE9B 2VZKB 2CU3A 2L1AA 1E9MA 1T3QA 5BYSA 1I4PA 3SEBA 3E9SA 3P4RB 5C2TB 1JW9D 3AE6B 1CQVA 1SE3A 3AH7A 2WXFA 4WIPA 1QQRA 3NVVA 1YQ4B 2ZW1A 2AQ2B 1XLOA 5BMGA 1SB3C 1QT9A 2BW2A 3AE8B 3PZ8A 3AM9A 2KACA 1NENB 2DLBA 1PUTA 2L32A 4RFBA 4ARIA 1YJJA 3O13A 4US8A 4GDLB 5I4DA 1CJEA 2NMQA 1XF5L 3GP7A 4RF0A 3TSSA 2DWQA 1HQRD 1I4XA 1AWDA 2B76B 4NAMA 1EM7A 2WS3B 1ROEA 1VR9A 2W82A 1F2RC 1JWSD 2QJLA 4CQNA 2ON8A 1GAQB 4EE2A 1DGJA 3ZGZA 2WXQA 1L6VA 3AE5B 4A8XC 4A90A 1HZ6A 2VZKD 1JALA 2J52A 1KF6B 1VZ8A 3AEAB 2MJ3A 3Q8FA 4N58A 4R3DA 2JZPA 1J7CA 4REZA 5BMIA 2SEBD 1HXYD 1QOFA 3BK2A 3R8BA 4A6QA 2BB6A 2OEDA 1ZDVA 3W1SA 2WXIA 4IOIE 3N9YC 3HVZA 1V97A 3R2TA 1F77A 2WXNA 1AN8A 1F2RI 3P63A 1FRDA 1T5XD 3AN1A 1RFKA 1WSPA 1SE2A 1N5XA 3VRAB 1FRRA 2BS3B 1FMAD 4XDDA 1UWXA 2IGDA 3L4PA 2TSSA 3ABVB 2BS4B 2YEPB 4ZHPA 2PW9A 3MP9A 3KQ4A 1WGKA 1STEA 1FCCC 4JX1C 2BYTA 3AEEB 2KAJA 4RGTA 1ET6A 2BBCA 3NS1A 3SR6A 1KFYB 1ZXIA 4ZRQA 1L6UA 1J7BA 2WXLA 4KGTA 1FXAA 2RDGA 5GXGB 5EE9A 1MHHE 2WXPA 4ARCA 1L0VB 1V1PA 4JWUC 3B2FA 2IJ0A 1BUIC 5HI1A 3LXFA 3BVZA 1FO4A 3NVWA 3I57A 1TY0A 1ZDXA 2E6XA 3AE3B 2WLBA 3TEXA 2N7JA 5BYQA 1RWSA 2K5PA 1N60A 1OFFA 1NYRA 1QOGA 2M0AA 1FM0D 3P42A 1SEBD 1C76A 4ZRPA 1IGDA 4HKQA 1GOZA 1PGXA 2PIAA 1AYFA 4WWMA 4KKIA 3AE2B 3BZDB 1EWYC 2KQ4X 2WP9B 3W5UB 1JROA 4MM3B 1FNWA 5BMHA 1N5WA 3SFEB 4J3OD 4OW0A 4YXDB 4HJGE 2LJIA 1ACCA 4OVZA 2W55A 3P4SB 1TY2A 1SJHD 5EE0A 2GB1A 2KWDA 2PKOA 3W2DA 3ETRA 2N9KA 5MPOA 2PTLA 3J9CA 2HDEA 3IAS1 1I4GA 3V3XA 4ITKA 1MHXA 1XEEA 5G5GA 2INNE 4DXFA 4NJCA 4DXGA 1TS2A 1XLQA 2G1EA 1FIQA 3AE4B 1QOBA 3HUIA 2SAKA 2FUG1 3GS2A 3P1MA 4TSSA 1E10A 4RH6A 1TKYA 1XXGA 1IUEA 3NZ3A 3Q8CA 1CZPA 4C80A 1YMHE 2GI9A 1JWAD 1WYGA 1PGAA 1PDXA 4AS1A 2M19A 4XDCA 4L23A 1VRAB 1UUPA 3V05A 5FR3A 1RM6C 2PMVA 3RFZB 4C7ZA 2DYMA 4KX6B 2WU2B 1ZOYB 4USAA 4H2AA 2PVOD 1UNSA 4C7YA 3ZJUA 3U2SC 1BXTA 1V1PB 4UDUC 5AUKA 3BIID 1JWUD 2IGHA 3BYYB 1YNTE 3VRBB 3FILB 4KKJA 1YN5A 3DWGC 2WXMA 1A70A 2WXGA 3BWUD 2MJDA 1NVID 2Q5WD 2DBYA 3AMZA 3AE7B 1FFUA 2PLPA 3VQIA 5T8IA 2JXTA 1IGCA 2LMCA 1D5ZC 2WXOA 1I7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B9J A;  1SF0 A;  3AV8 A;  4JWU C;  2MH7 A;  3B2F A;  3HRD D;  3P4P B;  3KWL A;  2LEK A;  3B2G A;  3LXF A;  5G5H A;  3AEF B;  1FO4 A;  3NVW A;  5EE1 A;  1VLB A;  3AE3 B;  2WLB A;  4YSX B;  1JWB D;  3ZYY X;  1PFD A;  1RWS A;  2QIE B;  1JRP A;  1L5P A;  2K5P A;  1R7S A;  1N60 A;  1OFF A;  1VJK A;  2WQY B;  1NYR A;  1YJI A;  1J7A A;  1QOG A;  3FAH A;  1WRI A;  1FM0 D;  2BT6 A;  2M56 B;  2WU5 B;  3VR9 B;  4YSZ B;  4YTN B;  1WWT A;  3AE1 B;  3AE9 B;  4US9 A;  4YT0 B;  4N6E B;  1DOI A;  2CU3 A;  2N0S B;  1E9M A;  1T3Q A;  2W3S A;  1YQ3 B;  3CWI A;  3P4R B;  4YTM B;  5C2T B;  2AX5 A;  1JW9 D;  1VDV A;  3W5V B;  3AE6 B;  1QLB B;  2W3R A;  1RYJ A;  2PIA A;  1AYF A;  1NYQ A;  3AH7 A;  4LTU A;  4WWM A;  3AE2 B;  3NVV A;  2WDV B;  1EWY C;  1YQ4 B;  2WP9 B;  1UWM A;  3W5U B;  3NVZ A;  1XLO A;  1JQ4 A;  1JRO A;  1SB3 C;  1QT9 A;  4HRO A;  2H89 B;  3AE8 B;  1N5W A;  3AM9 A;  1XLP A;  2FBW B;  3SFE B;  1NEN B;  2HTM E;  2L52 A;  4YXD B;  1PUT A;  2BS2 B;  1E0Z A;  2W55 A;  3P4S B;  2L83 A;  4ZOH C;  1YJJ A;  3NRZ A;  5EE0 A;  1F0Z A;  4US8 A;  2PKO A;  1XLN A;  1N63 A;  1CJE A;  3AB5 A;  3ETR A;  5MPO A;  2DWQ A;  2EKI A;  2Y5C A;  1AWD A;  1TYG B;  2B76 B;  5H92 C;  4ITK A;  1QF6 A;  2WS3 B;  1ROE A;  4A9A A;  1XO3 A;  5G5G A;  2QJL A;  4IDI A;  4JWS C;  1V8C A;  1GAQ B;  4C7Z A;  1DGJ A;  5EE3 A;  1XLQ A;  1L6V A;  2G1E A;  3CIR B;  1FIQ A;  2CJO A;  3AE5 B;  3AE4 B;  1FXI A;  1QOB A;  3HUI A;  3RPF C;  3AEC B;  5AUI A;  1JAL A;  1KRH A;  1KF6 B;  3AEA B;  2MJ3 A;  3P1M A;  1ZUD 2;  4N58 A;  3VR8 B;  2PVG C;  1DOY A;  1E10 A;  1E7P B;  1GPX A;  1J7C A;  2KMM A;  1SIJ A;  3DWM A;  1TKY A;  3EUB 2;  1QOF A;  3AEG B;  4YSY B;  2WDQ B;  1IUE A;  3WCQ A;  1CZP A;  4C80 A;  1TKE A;  1JWA D;  1WYG A;  1ZP0 B;  1FFV A;  1PDX A;  1OQQ A;  2M19 A;  1DOX A;  1E6E B;  3HVZ A;  1V97 A;  2E3T A;  3P4Q B;  5H8Y E;  2JQR B;  1RM6 C;  3AEB B;  3P63 A;  1N61 A;  2OHF A;  1FRD A;  2WDR B;  3AED B;  3AN1 A;  4KX6 B;  4N59 A;  1RFK A;  1OQR A;  1NEK B;  2WU2 B;  1ZOY B;  3LB8 C;  3NVY A;  4USA A;  1N5X A;  3VRA B;  3W9C B;  1FRR A;  2CJN A;  2H88 B;  2PVO D;  1NI3 A;  4C7Y A;  2BS3 B;  1FMA D;  1TKG A;  2W54 A;  5C3J B;  3L4P A;  4YTP B;  3ABV B;  2BS4 B;  3BII D;  5AUK A;  3VRB B;  4P6V F;  4ZHP A;  4ZHO A;  1WGK A;  3DWG C;  4HRS A;  1N62 A;  1B9R A;  1TJE A;  1A70 A;  4JX1 C;  3AEE B;  2KAJ A;  1QOA A;  2MJE A;  1NVI D;  1WXQ A;  2K9X A;  2MJD A;  3NS1 A;  3PO0 A;  1KFY B;  4FXC A;  3SR6 A;  2K22 A;  1ZXI A;  2Q5W D;  1L6U A;  2JX5 A;  2DBY A;  1J7B A;  4WQM A;  3AMZ A;  2ACZ B;  3AE7 B;  1FFU A;  1FXA A;  3FC4 A;  5GXG B;  5EE9 A;  1I7H A;  1L0V B;  3SFD B; 
#chains in the Genus database with same CATH topology
 4B0E A;  4JPS A;  2QIL A;  2AEH A;  3Q2A C;  3TCA A;  2UYZ B;  3L08 A;  2KO3 A;  3Q14 C;  1PFD A;  4BAX A;  1R7S A;  4MT5 A;  1LM8 B;  1RFA A;  2W3R A;  2C9W B;  1YQB A;  1TIF A;  4XWT A;  3O65 B;  4IKG A;  4GXB A;  5FKA C;  4GB9 A;  3TBL D;  4ANV A;  1WR6 E;  2KOX A;  2QEJ C;  1PYW D;  4D2K A;  5TR5 A;  2O2V B;  3ZW3 A;  4HWI B;  3UQA A;  1ZXH A;  4II2 B;  4JWS C;  2WNM A;  2PE9 A;  5EE3 A;  1R4M B;  2IY0 B;  1SSN A;  4E71 A;  3EA6 A;  2LHE A;  3BVM A;  1Q1O A;  2C7M B;  4GDK A;  1SIJ A;  3WCQ A;  3ZO5 B;  3ZVV A;  1ZP0 B;  3C0R B;  2DAJ A;  3WA0 A;  3RUL A;  1VZ6 A;  2INP E;  2ONQ A;  4WH4 A;  2UU7 A;  2OHF A;  4HVB A;  4YT0 B;  5J2R A;  1D5X C;  4M0W A;  3ZTC A;  1KJT A;  2H88 B;  5FK9 C;  2W9N A;  5E6J A;  1E7V A;  2DX5 B;  2JZZ A;  4ANU A;  4BOZ B;  4HRS A;  3PTF C;  3Q8E A;  1LQB A;  3I3T B;  3PZ7 A;  4JLC A;  4WQM A;  4BOS C;  1AW7 A;  3SFD B;  3A9J A;  2GLS A;  2MH7 A;  1J8C A;  3IVF A;  4WUR A;  2LEK A;  3DVN V;  1TS5 A;  4ZRK A;  2KMC A;  3M62 B;  1CK1 A;  3T3N A;  3VR9 B;  2JPH A;  2L05 A;  3MHZ A;  4TQ1 A;  3WAL A;  3ZJV A;  2AYO B;  2J0K A;  2NTS A;  1DOI A;  1C4P A;  4EZJ A;  4W9F A;  4YTM B;  3CWI A;  4RMA A;  4JQW C;  1RYJ A;  4LTU A;  4W9C A;  1FNU A;  1JQ4 A;  5JH5 C;  4AJW A;  4WWP A;  2NS5 A;  2K8H A;  1SE9 A;  2CKH B;  4GDK B;  4RM9 A;  1WXM A;  1WH3 A;  4LDT B;  3SDL C;  1JML A;  1SJE D;  3TEZ A;  1EWC A;  3PHW B;  4ZYS A;  3Q8A A;  4IDI A;  3CIR B;  1EF5 A;  4DHJ B;  3JYU A;  4URK A;  4ASW C;  3A9K A;  4M0W B;  4NPN A;  1ZUD 2;  3VR8 B;  1V5O A;  2KT7 A;  3S2A A;  3EFU A;  2KN4 A;  1CMX B;  3C8Y A;  1KM7 A;  1YD8 U;  3AEG B;  3RCZ A;  2VRR B;  4HPL B;  2D07 B;  3ZTD A;  3Q3F A;  1VZ7 A;  1GJZ A;  3AED B;  2IO1 B;  3DDC B;  1XCQ L;  4HEA 1;  2QSD A;  3I9V 1;  2GBJ A;  4NZL B;  2CHZ A;  1LO5 D;  2W54 A;  3RNG C;  4OZB A;  2MHJ A;  3LYY A;  1EU3 A;  1TJE A;  3OG5 A;  3D32 A;  2K9X A;  3PO0 A;  3SU8 X;  2K22 A;  4K3B A;  5HG2 A;  3ZJT A;  1XT9 B;  5CX3 A;  4F7Z A;  2O6V D;  2Y5B B;  3QC8 B;  2KLC A;  3Q3O C;  2G4D B;  3B2G A;  3CST A;  4MEM A;  2DYO A;  1BT0 A;  1UBI A;  1WM3 A;  1YOV B;  1Q10 A;  2N9E B;  5KHQ A;  2J0M A;  1YJI A;  4XYC A;  4B0M A;  4OHJ A;  3IAM 1;  4MSM B;  1WI0 A;  1SE3 A;  4BBN C;  1YQ4 B;  2ZW1 A;  3DBS A;  2MW5 A;  1XLO A;  5BMG A;  1QT9 A;  3AE8 B;  4GOC A;  3AM9 A;  3B08 A;  3V6C B;  2DLB A;  1PUT A;  3PHX B;  4RFB A;  4IWP A;  1TBE A;  2C60 A;  1EUV B;  1ISN A;  1XF5 L;  2LAS A;  3TSS A;  1FXT B;  1I4X A;  1EM7 A;  2WS3 B;  2KTF A;  4MGI E;  1ROE A;  1F2R C;  4IC7 B;  4EE2 A;  3WAP A;  4AWJ A;  4A8X C;  4A90 A;  3ZRF A;  2J52 A;  2N1W A;  1KF6 B;  2KVR A;  2L76 A;  2MJ3 A;  3CSF A;  4N58 A;  3RZF A;  1HXY D;  4N9F 4;  4A6Q A;  3DBL B;  3CF6 E;  2WXI A;  3PRE A;  1V86 A;  3PVL A;  1T0Y A;  1F77 A;  2WXN A;  1AN8 A;  1RFK A;  2K8C A;  2V3S A;  1N5X A;  4FJV B;  3VRA B;  1FMA D;  1UWX A;  3QK0 A;  3A4R A;  2JT4 B;  4G0N B;  5AEK B;  3A33 B;  3MP9 A;  2N9P C;  1STE A;  1FCC C;  4JX1 C;  3ZDT A;  3AEE B;  5IA7 A;  3DBH B;  2KAJ A;  3PGE A;  5IKC M;  1ZXI A;  2QHO A;  3PLV A;  4ZRI A;  3VUW A;  2FCM A;  4KGT A;  5GXG B;  2WXP A;  3UIO B;  4E74 A;  3KUZ A;  1IP9 A;  1BUI C;  5AZF A;  5HI1 A;  3I57 A;  2LRU A;  5BYQ A;  1RWS A;  4WWN A;  2K5P A;  1WYW B;  2X8X X;  4FA6 A;  2M0A A;  4NJ6 A;  3Q3M C;  4GIV A;  1E90 A;  2WYQ A;  4ICV A;  1C76 A;  3DBL I;  3QIJ A;  3AE2 B;  3BZD B;  1EWY C;  1RAX A;  4YL8 A;  3QQ8 B;  3B0A A;  4YXD B;  2W55 A;  1TY2 A;  2AL6 A;  3APC A;  2PKO A;  2ZPY A;  5E6O A;  2N9K A;  2PTL A;  3RMK C;  2FCN A;  2MA9 B;  2NR2 A;  2HDE A;  4CYE A;  1GUA B;  1WM2 A;  4ZRJ A;  2REX A;  2INN E;  3IBE A;  4DXG A;  3ZKJ C;  1P3Q U;  3QX1 A;  3KW5 B;  3TL5 A;  1PQS A;  3PPA A;  3PRZ A;  2MX2 A;  4RH6 A;  1Q0W B;  3N20 C;  1WX9 A;  1PDX A;  1KLV A;  3AU4 A;  4L23 A;  1VRA B;  1UUP A;  2DZM A;  4LJO B;  4ICU A;  3PSE B;  4KX6 B;  3UIP B;  4H2A A;  3U2S C;  5LXI B;  4UDU C;  3BII D;  4K81 A;  3GOE A;  4HPP A;  5G55 A;  5AZG A;  1GC7 A;  3PS6 A;  2N9X A;  4FHJ A;  2M17 A;  2LXA A;  2M8S A;  2JXT A;  2LMC A;  3NOB A;  4K7U A;  1I7H A;  1SF0 A;  2NBU A;  5JHB A;  1YN4 A;  5D3D A;  1D5M C;  2EEL A;  4FUL A;  4BKT A;  2KJH B;  1QZE A;  4DDG D;  3QAQ A;  1WRI A;  1WWT A;  1VDV A;  3IT4 B;  1FEH A;  2JRI B;  3HIZ A;  1XLP A;  2L52 A;  4WJP A;  3BVG A;  1T6B X;  2L83 A;  1F9J A;  1V1O A;  3AB5 A;  1T0Q C;  2NVU I;  1FD6 A;  4S0R A;  2EKI A;  5G2N A;  2Y5C A;  3B1L X;  5H92 C;  3UI3 A;  1LFD A;  2I2Y A;  4MH8 A;  4KDL B;  3OLM D;  4RNA A;  3RPF C;  3T8M A;  1UBQ A;  5LXH A;  1XCT L;  4I6P A;  3DPD A;  1H8C A;  2KMM A;  5HFY A;  4YSY B;  5CHF A;  2IDY A;  3V6E B;  1ZW7 A;  1V9J A;  3RNC C;  1NBF C;  1E6E B;  2QMT A;  1C9F A;  2KK8 A;  1NDD A;  2E3T A;  2J53 A;  4B95 A;  3TEW A;  2N9L A;  4J6I A;  4MDK E;  4DQO C;  2WDR B;  4C56 C;  1OQR A;  3LB8 C;  1JWM D;  2V4I B;  5IOI A;  4A3O A;  4B6W A;  3N3K B;  1NI3 A;  1Y8R C;  2DZK A;  4P7I A;  2KAN A;  4M8N A;  3BYT B;  3Q3J A;  1B9R A;  1K51 A;  2O2V A;  4KSL C;  5CTR C;  3VH3 B;  1WXQ A;  3I5J C;  3A1Q A;  4RGN A;  5TSS A;  2BTE A;  4IWO A;  2MCN B;  3LJ3 A;  2G9H D;  4E3C A;  1C79 A;  3WAO A;  2V9H A;  3P4P B;  4G50 A;  2DZJ A;  4PS3 A;  1C77 A;  3ML8 A;  1GG3 A;  3JVZ X;  3KWV A;  5J17 A;  2R2Q A;  1C4A A;  4KSK C;  1ZE3 D;  2XN9 C;  2XK5 A;  2OJR A;  4US9 A;  4N6E B;  1D4B A;  4NQK E;  2IPK D;  2AX5 A;  1BML C;  5DPT A;  4XGA B;  1Q5W B;  5BYR A;  2FBW B;  4LJP B;  2BKR B;  2K1F A;  4ZOH C;  2GBN A;  3I63 C;  1WIA A;  1I4Q A;  1MI0 A;  3T3O A;  3TMP B;  1HA5 A;  1MVK A;  1V81 A;  1WJ6 A;  1V6E A;  4LCD E;  1QF6 A;  2IYD B;  2KWC A;  4ZDV A;  5HKH A;  2YLM A;  3QJZ A;  4B9K A;  2DZI A;  1V80 A;  2LUM A;  3H9D A;  5LLI A;  1T0R C;  1WRD B;  2M1M A;  3L16 A;  2WXJ A;  1C3T A;  4A3P A;  4WAF A;  1DOY A;  3RNF C;  3EUB 2;  1FCL A;  4KGS A;  4FBJ B;  3URY A;  1TKE A;  2G4S A;  3H8H A;  4NJ7 A;  2WXR A;  3AI5 A;  2RR9 A;  1DOX A;  2X38 A;  4EKU A;  3A1Q B;  5H8Y E;  2JQR B;  2V3N A;  1N61 A;  3RI7 C;  4A55 A;  5JXV A;  2NTT A;  3NZU A;  1I4R A;  1EF1 A;  1WGD A;  3W9C B;  3VDZ A;  1EU4 A;  2AQ1 B;  1C4C A;  1N6Z A;  2MQJ A;  4AUQ C;  1L4Z B;  1OEY J;  1S1Q B;  4FLH A;  2RDH A;  2KWU B;  1TZ1 A;  3BK1 A;  1MPE A;  2R61 A;  2XK5 B;  3NS8 A;  4KGR A;  4OZA A;  2YVC A;  3OJ3 A;  1UEL A;  2MEK A;  3HRD D;  3R2I A;  3MC8 A;  5G5H A;  2JSV X;  1UF0 A;  1GB4 A;  4HK2 A;  3ZYY X;  4C4V A;  3QWZ B;  1J7A A;  2LHD A;  2L8J A;  4YTN B;  3AE9 B;  4WJN A;  4PK1 A;  2CU3 A;  2L1A A;  1I4P A;  3VUX A;  1JW9 D;  1CQV A;  2ZZP B;  3AH7 A;  1QQR A;  3VTU A;  2AQ2 B;  3DHH C;  2GOW A;  3UIN B;  4KZC A;  2WHI A;  4X57 B;  2L32 A;  3UGB B;  1R4M I;  4ARI A;  2ASQ A;  1CJE A;  2NMQ A;  3GP7 A;  2MWS B;  4W9D A;  3PRM B;  2J7Q B;  1VR9 A;  4M02 A;  2QJL A;  2R2O A;  1GAQ B;  3WAM A;  2LJ5 A;  3AE5 B;  1HZ6 A;  4DWF A;  1OTR B;  2OOB B;  1JAL A;  3Q8F A;  3AEA B;  3KVF B;  1J7C A;  1MG8 A;  1WZ0 A;  1QOF A;  2KD0 A;  3BK2 A;  3PT2 B;  3R8B A;  2I1K A;  4IOI E;  2AWT A;  4WAA A;  4K1R B;  1F2R I;  1SIF A;  4G11 A;  1FRD A;  3AN1 A;  1TGZ B;  1SE2 A;  2K39 A;  4M00 A;  2LVP A;  1WJ4 A;  2NBW B;  4XDD A;  3L4P A;  4KZ0 A;  3ABV B;  1GC6 A;  4ZHP A;  2PJH A;  3LDZ E;  4RM8 A;  2N1V A;  2KHW B;  5EDS A;  2HJ1 A;  4ZYN A;  3NS1 A;  3SR6 A;  2LVQ A;  4C4V B;  4ZRQ A;  3X23 A;  1L6U A;  4W9I A;  2WXL A;  3X0W A;  2RDG A;  5EE9 A;  1WY8 A;  1WR1 A;  1V1P A;  4JWU C;  3B2F A;  4CO7 A;  2UWQ A;  2IJ0 A;  1IYF A;  3LXF A;  4LNK A;  1FO4 A;  1ZDX A;  2E6X A;  3AE3 B;  3QHT A;  2WLB A;  2LGY A;  4DXA B;  1NYR A;  1QOG A;  3NHE B;  3GE8 C;  3P42 A;  4ZRP A;  2C7N B;  1IGD A;  2B3A A;  1PGX A;  1AYF A;  4F1S A;  3A4S C;  1ACC A;  2JZ3 B;  2KX0 A;  3SHQ A;  2BQQ A;  2GB1 A;  2KWD A;  4W9L A;  2MP2 B;  1VCB A;  1F52 A;  2BGF A;  1I4G A;  3V3X A;  2FNJ B;  4ITK A;  2V1Y A;  1XEE A;  5G5G A;  4BKS D;  4BVU C;  1FIQ A;  1QOB A;  3HUI A;  2SAK A;  2HD5 B;  2LZ6 A;  2KFK A;  3APD A;  3P1M A;  1IUE A;  3NZ3 A;  3Q8C A;  5AZH A;  2GI9 A;  2JWZ A;  1PGA A;  2BWF A;  3V05 A;  4BZA A;  3DVG Y;  3RFZ B;  4BKG A;  2DYM A;  1ZOY B;  4USA A;  3VTW A;  3ZXR A;  2PVO D;  3HK0 A;  3ZJU A;  1BXT A;  3APF A;  1V1P B;  3BYY B;  5J18 A;  2RGF A;  3FIL B;  4KKJ A;  1P98 A;  2WXG A;  4WWO A;  2RD0 A;  3VHT C;  2ZEQ A;  3AMZ A;  4M8M A;  3AE7 B;  2PLP A;  3VQI A;  5T8I A;  2QCZ A;  1IGC A;  2WXO A;  1D5Z C;  3DOW A;  3ZXV A;  1C1Y B;  4KVG B;  4W9E A;  3AEF B;  3MC9 A;  4DK5 A;  5DPR A;  1TS4 A;  1JRP A;  2DYB A;  3U4E G;  1HZ5 A;  2KMA A;  2K0P A;  5IO9 A;  3AE1 B;  5D6J B;  2N0S B;  4QAY A;  2KDB A;  2FAZ A;  3C19 A;  1K50 A;  2GBM A;  1WE6 A;  1ESF A;  4EFO A;  1UWM A;  3EEC A;  2NPT A;  2V3P A;  3EGR A;  3ZNI D;  2HTM E;  3Q8B A;  2KFK B;  3IXS A;  1T0S C;  3KYD D;  1XLN A;  5IP4 D;  1KOT A;  3N32 A;  1RLF A;  2INC C;  2MSE D;  4JL9 A;  4MJS A;  4AP4 C;  4TMA B;  3L0W B;  2JWU A;  2LI5 A;  4XX5 A;  3SD5 A;  2KWV B;  2QDF A;  2C7H A;  4MGK E;  1P7F A;  4LDT D;  3AEC B;  5AUI A;  2K6Q A;  4JIO U;  1L4D B;  2PVG C;  3T9L A;  1K52 A;  2K6D B;  3DWM A;  4XWW A;  3ZQ4 A;  4AJY B;  1TZO A;  1FFV A;  1WMH A;  3PZD A;  4ANX A;  4W9G A;  3AEB B;  2Z0E B;  3DBH I;  1KH0 A;  1TS3 A;  2A4Z A;  2FCS A;  4CHK A;  4RGM A;  1X1M A;  1I35 A;  4YTP B;  2MBB B;  1N62 A;  2RMM A;  2IY1 B;  3TEY A;  1Y56 A;  1A5R A;  4AQ7 A;  5D94 A;  2ACZ B;  2N7D A;  2EMT A;  1VD2 A;  3B9J A;  3ZNH B;  2KX3 A;  2LVO A;  1JCK B;  2GBK A;  2NPT B;  4AOF A;  3TUO A;  2AL3 A;  3FAH A;  3QA8 A;  2HE7 A;  2K3U A;  2W3S A;  3ZIM A;  1SXT A;  4MJS B;  2ICI A;  2V0G A;  5DCN A;  2LGI A;  4W9K A;  3CMM B;  3VVW B;  2PE6 B;  2ZVO A;  2YEP F;  3RNA C;  3NRZ A;  5LNK 1;  1N63 A;  1QKZ A;  4HCP B;  2KJR A;  3HM3 A;  1NI2 A;  2G3Q B;  1K53 A;  4FHK A;  2XEW A;  3EFC A;  3ZUN A;  2CU1 A;  4I6L B;  4A9A A;  1XO3 A;  1WMH B;  2IO0 B;  3ML9 A;  2JYT A;  1UGM A;  1WFY A;  1I4H A;  1PGB A;  3KUD B;  4GGQ A;  3DVG X;  3Q69 A;  2J4X A;  1E7P B;  1SBB B;  3IT6 B;  1L0Y B;  3KH0 A;  3BY4 B;  3RYT A;  1UZX B;  4LNI A;  1S3S G;  2L0F A;  4BBN F;  3EHV A;  1UGJ A;  2WXK A;  4N59 A;  4KV2 A;  3NVY A;  4KIK A;  1MFW A;  1D6E C;  2CHX A;  2BB5 A;  4ZHO A;  2Y5P A;  3KYC D;  2I38 A;  4FXC A;  1ZPS A;  2JY6 A;  4JGH B;  2WDT B;  3NZS A;  2KN5 A;  3ZRC A;  4WQO B;  5D7G A;  5E6N A;  2MBH A;  2XNA C;  4HXD A;  2O6V A;  3RT3 B;  3DHI C;  1P1A A;  2WWZ A;  3ZNG C;  1HE8 A;  1HEZ E;  3GB1 A;  1SGH A;  3E56 A;  2BT6 A;  1P9D U;  3DCG A;  1R4N B;  1E9M A;  2VH1 A;  3SEB A;  3P4R B;  5C2T B;  3AE6 B;  2WXF A;  2ZJD A;  3NVV A;  2HJ8 A;  1SB3 C;  2BW2 A;  1OEY A;  4NQL B;  2ZVN A;  1MG4 A;  1NEN B;  3ONS A;  3N30 A;  3O13 A;  4US8 A;  4GDL B;  5I4D A;  1WXS A;  3DQV A;  2DWQ A;  4P1C C;  5E6P A;  4ANW A;  1H4R A;  4NAM A;  1M94 A;  2W82 A;  1J19 A;  4CQN A;  2ON8 A;  2BYE A;  1DGJ A;  4HPM B;  2KDI A;  2VZK D;  2HTH A;  1VZ8 A;  4KIK B;  4REZ A;  5BMI A;  1YIW A;  5BO4 B;  2OED A;  3N1Z C;  3N9Y C;  3HVZ A;  1V97 A;  3N1Y C;  2L7R A;  3Q3N C;  1EO6 A;  5IAA C;  1R4N I;  4W9H A;  3KUC B;  2YEP B;  1J0G A;  3EC8 A;  3KQ4 A;  1WGK A;  2O6V B;  4OVV A;  2L0T A;  3UQB A;  1KFY B;  4GMV A;  3MJW A;  3H7P A;  2IZV B;  2JXX A;  1FXA A;  2WGS A;  5DPS A;  4ARC A;  4NY0 A;  2CHW A;  4K7W A;  3VUY A;  3BVZ A;  1GNU A;  1TY0 A;  3TEX A;  2N7J A;  2K8B A;  1V2Y A;  1N60 A;  1OFF A;  1FM0 D;  3PV1 A;  3N1X C;  5JZE B;  4W9J A;  1G6J A;  2K25 A;  4HKQ A;  4GU2 A;  2D3G A;  2PIA A;  3K9O B;  4XZ4 A;  2WP9 B;  3Q6B A;  4FJZ A;  1JRO A;  1FNW A;  4IW0 A;  4J3O D;  4OW0 A;  4HJG E;  2LJI A;  3P4S B;  1SJH D;  4BFR A;  3W2D A;  2KVZ A;  2FID A;  4NAW A;  2D3B A;  3IAS 1;  4HJK A;  3ZDM C;  1MHX A;  1V49 A;  3DHG C;  3R66 C;  5JHA A;  2GBR A;  4DXF A;  4NJC A;  1XLQ A;  4WJO A;  3AE4 B;  1E5W A;  2KTR A;  2FUG 1;  3GS2 A;  2D10 A;  1E10 A;  2MBO A;  2D2Q A;  1XXG A;  1TT5 B;  4C80 A;  1YMH E;  3DBR B;  1JWA D;  5D2M B;  1OQY A;  4AS1 A;  3HHM A;  2KC2 A;  1Z2M A;  4LNO A;  2KLG A;  2LGS A;  3VAW A;  4C7Z A;  1P0R A;  2ZNV C;  3H7P B;  1D3Z A;  2WU2 B;  2MBE A;  3WAN A;  2C5L C;  3GZN B;  1UNS A;  3W1S C;  2M4N A;  1WXA A;  3NJT A;  5AUK A;  4GSW A;  1YNT E;  2MP2 A;  1YN5 A;  3P2B A;  3DWG C;  3U30 A;  4IM0 A;  1WGH A;  2MJD A;  1NVI D;  1V5T A;  2LGD A;  2I1J A;  2JUO A;  2KC1 A;  4HDQ A;  1FFU A;  2BYV E;  3NY5 A;  3V61 A;  5L83 A;  2LGX A;  4OZC A;  1HTO A;  3KWL A;  4JE3 B;  3RD2 A;  2AQ3 B;  4DDI D;  4YSX B;  1P7E A;  4RCO A;  3U7D A;  4IWQ A;  5HHD G;  2FCQ A;  2QIE B;  2D5G A;  4XE0 A;  3IG3 A;  2KQ7 A;  2WQY B;  4A20 A;  3MC0 B;  5KHO A;  4TV3 A;  2A5U A;  5CHV C;  3OAW A;  3U8Z A;  4NAW B;  3DBR I;  1KLG D;  4II3 B;  4L2Y A;  4HRO A;  2H89 B;  4RGO S;  3V60 A;  3FIL A;  1JRU A;  2WXH A;  2CS4 A;  3RN9 C;  3RZW C;  1E0Z A;  1E8W A;  2BS2 B;  1LGR A;  2KTR B;  2J42 A;  3GZN I;  2JF5 A;  1C78 A;  2BYF A;  1L0X B;  4DBG A;  2MRP A;  1SE4 A;  1TYG B;  3R7R A;  2Z8L A;  4YWG G;  2KYW A;  2KDM A;  2KQS A;  1U4A A;  4MAC A;  1V8C A;  2VH2 A;  2RDB C;  4GLS C;  1FXI A;  2DHZ A;  4Q2J A;  1ET9 A;  3A9J B;  4NNJ B;  1E8Y A;  2WDQ B;  3U7Z A;  4I6N B;  2KDF B;  5D3I B;  4PYZ A;  4RF1 A;  2FUH B;  4L1B A;  2IGG A;  2D11 A;  3IFW B;  1NEK B;  1GB1 A;  3H7S A;  3KLS X;  3L54 A;  4LLG M;  1WGY A;  3JSV A;  4FN2 A;  4P6V F;  3AXC A;  2JRH A;  2MBQ A;  2RPV A;  3V62 A;  3ENE A;  4G3X B;  1YN3 A;  2JX5 A;  1B1Z A;  4FAD A;  3JW0 X;  1FPY A;  4M01 A;  1DYQ A;  2GRI A;  2L00 B;  4HKZ E;  3M3J A;  3A9K B;  1JWB D;  2XBB C;  3MJ5 A;  1VJK A;  2WU5 B;  1WE7 A;  3M63 B;  5C23 A;  4TUU A;  2IO2 B;  2GMI C;  4C00 A;  1YQ3 B;  2G45 B;  3W5V B;  2LWP A;  1IBX A;  3U52 E;  1QLB B;  2BF8 B;  3R7Q A;  1NYQ A;  3W1Y A;  2WDV B;  2Y3A A;  3MFG A;  3NVZ A;  4K3C A;  2FE8 A;  2Z0D B;  2JYE A;  3PLU A;  1F0Z A;  4EEW A;  2DNF A;  2LXC A;  4HLE A;  2FIF A;  2IND C;  4FJY A;  3GE3 C;  2LFI A;  1WJN A;  3VH4 B;  3HM6 X;  1E7U A;  2CJO A;  4GN1 A;  1ZGU B;  3OWE B;  1KRH A;  3RUI B;  1K8R B;  2DEN B;  1GPX A;  4DHZ B;  3JSV B;  1XD3 B;  2KKC A;  3OJ4 B;  2KNB A;  1OQQ A;  3HVD A;  4EUT A;  3H1U A;  3P4Q B;  4P1B C;  4F8C B;  2CJN A;  1M4V A;  2RSU A;  4MEL A;  1TKG A;  5C3J B;  4MH0 E;  1OGW A;  4PT5 A;  1KTK A;  2D3A A;  2ZW0 A;  2NBV B;  1WF9 A;  1QOA A;  2MJE A;  4TKN A;  4DHJ D;  4LK0 M;  4TQ0 A;  4O1N A;  2LRW A;  5L95 C;  3FC4 A;  4MGZ E;  1QIL A;  2EMS A;  4EZL A;  3VTV A;  3AV8 A;  1HTQ A;  1ENF A;  1IBX B;  1FNV A;  2BKF A;  4IM3 A;  3PRP B;  4P16 A;  2EKE C;  1KLU D;  3K9P B;  5EE1 A;  1VLB A;  2JU6 X;  2RPQ A;  2LD9 A;  1L5P A;  2M56 B;  4YSZ B;  3NUH B;  2D3C A;  3TJP A;  2QC8 A;  2VZK B;  5BYS A;  1T3Q A;  2ZPN A;  3E9S A;  3M95 A;  1WXV A;  2PPH A;  4WIP A;  2JVC A;  4MGY E;  4EOY A;  3PZ8 A;  2KAC A;  1YJJ A;  4LNF A;  5GMV A;  4RF0 A;  1HQR D;  4HCN B;  1IPG A;  1AWD A;  2B76 B;  1WJU A;  3ZNZ B;  1L2N A;  3L17 A;  1ZKH A;  3NG0 A;  4MM3 A;  1JWS D;  3DVN U;  3ZGZ A;  2WXQ A;  1L6V A;  3QAR A;  4R3D A;  5CHW A;  2JZP A;  2SEB D;  1UD7 A;  3BIN A;  3WIM A;  2BB6 A;  1ZDV A;  3W1S A;  3MHS D;  4HDO A;  2KDE B;  3ECI A;  3R2T A;  1YX5 B;  3P63 A;  1T5X D;  3VFK A;  1WSP A;  3QCA A;  1FRR A;  2BS3 B;  2IGD A;  3FKY A;  2TSS A;  4OVU A;  2BS4 B;  4GDL A;  1WX8 A;  2PW9 A;  3ZLZ A;  1WZ3 A;  4IUM B;  2LUE A;  1WGG A;  1YJ1 A;  2BYT A;  4IM2 A;  1TTN A;  3IHP C;  4RGT A;  1ET6 A;  2BBC A;  1AAR A;  4K7S A;  2V4L A;  2KZR A;  4MSQ B;  1J7B A;  1MHH E;  1L0V B;  3TIX A;  4LNN A;  3RNB C;  2OJW A;  3R3M A;  3NVW A;  2IO3 B;  2KFJ A;  2L3Z A;  4PS7 A;  2Z59 B;  2ZCC A;  1SEB D;  1YX6 B;  5IN7 A;  2NCN A;  3L13 A;  3RNE C;  1WX7 A;  1GOZ A;  2PEA A;  4WWM A;  2DAF A;  4KKI A;  2KQ4 X;  3L10 B;  3W5U B;  4MM3 B;  5BMH A;  1N5W A;  2BWE S;  3SFE B;  4DHZ E;  4OVZ A;  4WJQ A;  1L7Y A;  2IBI B;  5EE0 A;  3ETR A;  5MPO A;  2WX0 A;  2ZNV B;  3J9C A;  4PS8 A;  4S17 A;  2WX1 A;  3VXW A;  2M0X A;  4KDI C;  1TS2 A;  2G1E A;  1E8X A;  3ALB A;  1XQQ A;  5C1Z A;  2KXJ A;  1E8Z A;  5DPW A;  1F1H A;  1I42 A;  4TSS A;  4BKS A;  2CR5 A;  1TKY A;  1CZP A;  2KJ6 A;  1WYG A;  3AUL A;  5FR6 A;  2M19 A;  4XDC A;  3H6N A;  3AU5 A;  4EZK A;  5FR3 A;  1RM6 C;  2PMV A;  4XC2 A;  1Z5S B;  4IG7 B;  4C7Y A;  2J0J A;  2MLB A;  4PYU A;  3VRB B;  1JWU D;  1MJD A;  2IGH A;  2BPS A;  4ACF A;  2WXM A;  1A70 A;  3BWU D;  1RRB A;  2Q5W D;  1WGR A;  2DBY A;  2N4F A;  2N7E A;  1UH6 A;  2BVC A;  1LXD A;  3UF8 A;  2ZCB A;  3MTN B; 
#chains in the Genus database with same CATH homology
 1SF0 A;  4OZC A;  4B0E A;  4JPS A;  2QIL A;  1YN4 A;  3KWL A;  4JE3 B;  5D3D A;  2AQ3 B;  1D5M C;  3AEF B;  2EEL A;  4YSX B;  1P7E A;  4RCO A;  1PFD A;  5HHD G;  1TS4 A;  2QIE B;  1JRP A;  2D5G A;  4XE0 A;  1R7S A;  3U4E G;  2WQY B;  3MC0 B;  1WRI A;  1HZ5 A;  2K0P A;  1WWT A;  3AE1 B;  4MT5 A;  2N0S B;  4NAW B;  1VDV A;  1K50 A;  2W3R A;  3IT4 B;  1KLG D;  1FEH A;  1ESF A;  1UWM A;  2V3P A;  3EGR A;  4L2Y A;  4XWT A;  4HRO A;  2H89 B;  4RGO S;  3FIL A;  4IKG A;  1XLP A;  2WXH A;  2HTM E;  2L52 A;  5FKA C;  3BVG A;  2BS2 B;  3Q8B A;  1E0Z A;  1T6B X;  2L83 A;  3IXS A;  1V1O A;  2J42 A;  2QEJ C;  1PYW D;  1XLN A;  3AB5 A;  4D2K A;  1C78 A;  1FD6 A;  1L0X B;  2EKI A;  2Y5C A;  1SE4 A;  1TYG B;  2Z8L A;  4YWG G;  5H92 C;  1ZXH A;  2KDM A;  3UI3 A;  4TMA B;  2I2Y A;  4MAC A;  4JWS C;  2WNM A;  2JWU A;  1V8C A;  4MH8 A;  5EE3 A;  1SSN A;  4GLS C;  1FXI A;  3EA6 A;  2LHE A;  4RNA A;  1P7F A;  3BVM A;  3AEC B;  3RPF C;  4Q2J A;  1ET9 A;  5AUI A;  1XCT L;  1L4D B;  2PVG C;  2KMM A;  5HFY A;  1K52 A;  1SIJ A;  3DWM A;  4YSY B;  2IDY A;  2WDQ B;  3U7Z A;  4XWW A;  3WCQ A;  3ZQ4 A;  5D3I B;  4RF1 A;  1ZP0 B;  1TZO A;  1FFV A;  4L1B A;  1E6E B;  2QMT A;  1C9F A;  2IGG A;  2E3T A;  2J53 A;  3TEW A;  1VZ6 A;  2N9L A;  3AEB B;  2INP E;  2ONQ A;  4WH4 A;  2OHF A;  4DQO C;  2WDR B;  4YT0 B;  4C56 C;  1OQR A;  1NEK B;  1D5X C;  1JWM D;  3LB8 C;  4M0W A;  1GB1 A;  1KH0 A;  2V4I B;  3KLS X;  2H88 B;  1TS3 A;  1NI3 A;  5FK9 C;  4LLG M;  4RGM A;  5E6J A;  4YTP B;  3BYT B;  4P6V F;  4HRS A;  1N62 A;  2RMM A;  2RPV A;  1B9R A;  1K51 A;  1WXQ A;  3TEY A;  1Y56 A;  3Q8E A;  4RGN A;  5TSS A;  2BTE A;  1YN3 A;  3PZ7 A;  2JX5 A;  4AQ7 A;  1B1Z A;  4WQM A;  2ACZ B;  2G9H D;  1AW7 A;  3SFD B;  1C79 A;  3B9J A;  2MH7 A;  3P4P B;  1DYQ A;  1C77 A;  4WUR A;  2LEK A;  1JCK B;  1TS5 A;  2GRI A;  4HKZ E;  3KWV A;  1C4A A;  1JWB D;  3TUO A;  1CK1 A;  1ZE3 D;  3MJ5 A;  1VJK A;  2XN9 C;  3FAH A;  3T3N A;  2WU5 B;  3VR9 B;  3MHZ A;  4TQ1 A;  3ZJV A;  4US9 A;  2K3U A;  1DOI A;  1C4P A;  2NTS A;  2W3S A;  4N6E B;  1D4B A;  1YQ3 B;  1SXT A;  2IPK D;  3CWI A;  4YTM B;  3W5V B;  2AX5 A;  2ICI A;  1IBX A;  3U52 E;  1QLB B;  2V0G A;  1RYJ A;  4LTU A;  1BML C;  1NYQ A;  2WDV B;  2Y3A A;  3MFG A;  3NVZ A;  1FNU A;  1JQ4 A;  2LGI A;  2FE8 A;  5BYR A;  2FBW B;  2JYE A;  2YEP F;  4ZOH C;  3NRZ A;  1F0Z A;  5LNK 1;  1N63 A;  1QKZ A;  1I4Q A;  1MI0 A;  3T3O A;  4GDK B;  1K53 A;  1HA5 A;  1MVK A;  1JML A;  1SJE D;  3TEZ A;  1EWC A;  1QF6 A;  4ZYS A;  2LFI A;  4A9A A;  1XO3 A;  3Q8A A;  4IDI A;  2JYT A;  2LUM A;  3CIR B;  2CJO A;  1I4H A;  1PGB A;  3OWE B;  2WXJ A;  1KRH A;  4WAF A;  1ZUD 2;  3VR8 B;  3Q69 A;  1DOY A;  2J4X A;  1E7P B;  1GPX A;  1SBB B;  2KN4 A;  3C8Y A;  3IT6 B;  3EUB 2;  1L0Y B;  3AEG B;  1FCL A;  4KGS A;  3URY A;  1TKE A;  3H8H A;  2WXR A;  1OQQ A;  1DOX A;  3HVD A;  2X38 A;  3P4Q B;  5H8Y E;  2JQR B;  2V3N A;  1UGJ A;  1VZ7 A;  2WXK A;  1N61 A;  4N59 A;  3AED B;  4A55 A;  5JXV A;  2NTT A;  3NVY A;  1XCQ L;  1I4R A;  4HEA 1;  2QSD A;  3I9V 1;  3W9C B;  1EU4 A;  2CJN A;  4NZL B;  2AQ1 B;  1M4V A;  1TKG A;  1LO5 D;  2W54 A;  1D6E C;  5C3J B;  1C4C A;  4OZB A;  2BB5 A;  4PT5 A;  1KTK A;  1L4Z B;  4ZHO A;  3LYY A;  1EU3 A;  2Y5P A;  1TJE A;  2ZW0 A;  1QOA A;  2MJE A;  2K9X A;  3PO0 A;  2I38 A;  4FXC A;  4LK0 M;  2K22 A;  2RDH A;  1ZPS A;  4TQ0 A;  4O1N A;  3BK1 A;  1MPE A;  5HG2 A;  2R61 A;  3ZJT A;  4KGR A;  4OZA A;  3FC4 A;  1QIL A;  3AV8 A;  2MEK A;  3HRD D;  1ENF A;  1IBX B;  5D7G A;  1FNV A;  3R2I A;  4P16 A;  3B2G A;  5G5H A;  2XNA C;  2JSV X;  1KLU D;  5EE1 A;  1GB4 A;  1VLB A;  2DYO A;  2JU6 X;  3ZYY X;  1HEZ E;  3GB1 A;  1Q10 A;  1L5P A;  3E56 A;  1YJI A;  1J7A A;  2LHD A;  4OHJ A;  2M56 B;  4B0M A;  2BT6 A;  4YSZ B;  3IAM 1;  3NUH B;  4YTN B;  3AE9 B;  2VZK B;  2CU3 A;  2L1A A;  1E9M A;  1T3Q A;  5BYS A;  1I4P A;  3SEB A;  3E9S A;  3P4R B;  5C2T B;  1JW9 D;  3AE6 B;  1CQV A;  1SE3 A;  3AH7 A;  2WXF A;  4WIP A;  1QQR A;  3NVV A;  1YQ4 B;  2ZW1 A;  2AQ2 B;  1XLO A;  5BMG A;  1SB3 C;  1QT9 A;  2BW2 A;  3AE8 B;  3PZ8 A;  3AM9 A;  2KAC A;  1NEN B;  2DLB A;  1PUT A;  2L32 A;  4RFB A;  4ARI A;  1YJJ A;  3O13 A;  4US8 A;  4GDL B;  5I4D A;  1CJE A;  2NMQ A;  1XF5 L;  3GP7 A;  4RF0 A;  3TSS A;  2DWQ A;  1HQR D;  1I4X A;  1AWD A;  2B76 B;  4NAM A;  1EM7 A;  2WS3 B;  1ROE A;  1VR9 A;  2W82 A;  1F2R C;  1JWS D;  2QJL A;  4CQN A;  2ON8 A;  1GAQ B;  4EE2 A;  1DGJ A;  3ZGZ A;  2WXQ A;  1L6V A;  3AE5 B;  4A8X C;  4A90 A;  1HZ6 A;  2VZK D;  1JAL A;  2J52 A;  1KF6 B;  1VZ8 A;  3AEA B;  2MJ3 A;  3Q8F A;  4N58 A;  4R3D A;  2JZP A;  1J7C A;  4REZ A;  5BMI A;  2SEB D;  1HXY D;  1QOF A;  3BK2 A;  3R8B A;  4A6Q A;  2BB6 A;  2OED A;  1ZDV A;  3W1S A;  2WXI A;  4IOI E;  3N9Y C;  3HVZ A;  1V97 A;  3R2T A;  1F77 A;  2WXN A;  1AN8 A;  1F2R I;  3P63 A;  1FRD A;  1T5X D;  3AN1 A;  1RFK A;  1WSP A;  1SE2 A;  1N5X A;  3VRA B;  1FRR A;  2BS3 B;  1FMA D;  4XDD A;  1UWX A;  2IGD A;  3L4P A;  2TSS A;  3ABV B;  2BS4 B;  2YEP B;  4ZHP A;  2PW9 A;  3MP9 A;  3KQ4 A;  1WGK A;  1STE A;  1FCC C;  4JX1 C;  2BYT A;  3AEE B;  2KAJ A;  4RGT A;  1ET6 A;  2BBC A;  3NS1 A;  3SR6 A;  1KFY B;  1ZXI A;  4ZRQ A;  1L6U A;  1J7B A;  2WXL A;  4KGT A;  1FXA A;  2RDG A;  5GXG B;  5EE9 A;  1MHH E;  2WXP A;  4ARC A;  1L0V B;  1V1P A;  4JWU C;  3B2F A;  2IJ0 A;  1BUI C;  5HI1 A;  3LXF A;  3BVZ A;  1FO4 A;  3NVW A;  3I57 A;  1TY0 A;  1ZDX A;  2E6X A;  3AE3 B;  2WLB A;  3TEX A;  2N7J A;  5BYQ A;  1RWS A;  2K5P A;  1N60 A;  1OFF A;  1NYR A;  1QOG A;  2M0A A;  1FM0 D;  3P42 A;  1SEB D;  1C76 A;  4ZRP A;  1IGD A;  4HKQ A;  1GOZ A;  1PGX A;  2PIA A;  1AYF A;  4WWM A;  4KKI A;  3AE2 B;  3BZD B;  1EWY C;  2KQ4 X;  2WP9 B;  3W5U B;  1JRO A;  4MM3 B;  1FNW A;  5BMH A;  1N5W A;  3SFE B;  4J3O D;  4OW0 A;  4YXD B;  4HJG E;  2LJI A;  1ACC A;  4OVZ A;  2W55 A;  3P4S B;  1TY2 A;  1SJH D;  5EE0 A;  2GB1 A;  2KWD A;  2PKO A;  3W2D A;  3ETR A;  2N9K A;  5MPO A;  2PTL A;  3J9C A;  2HDE A;  3IAS 1;  1I4G A;  3V3X A;  4ITK A;  1MHX A;  1XEE A;  5G5G A;  2INN E;  4DXF A;  4NJC A;  4DXG A;  1TS2 A;  1XLQ A;  2G1E A;  1FIQ A;  3AE4 B;  1QOB A;  3HUI A;  2SAK A;  2FUG 1;  3GS2 A;  3P1M A;  4TSS A;  1E10 A;  4RH6 A;  1TKY A;  1XXG A;  1IUE A;  3NZ3 A;  3Q8C A;  1CZP A;  4C80 A;  1YMH E;  2GI9 A;  1JWA D;  1WYG A;  1PGA A;  1PDX A;  4AS1 A;  2M19 A;  4XDC A;  4L23 A;  1VRA B;  1UUP A;  3V05 A;  5FR3 A;  1RM6 C;  2PMV A;  3RFZ B;  4C7Z A;  2DYM A;  4KX6 B;  2WU2 B;  1ZOY B;  4USA A;  4H2A A;  2PVO D;  1UNS A;  4C7Y A;  3ZJU A;  3U2S C;  1BXT A;  1V1P B;  4UDU C;  5AUK A;  3BII D;  1JWU D;  2IGH A;  3BYY B;  1YNT E;  3VRB B;  3FIL B;  4KKJ A;  1YN5 A;  3DWG C;  2WXM A;  1A70 A;  2WXG A;  3BWU D;  2MJD A;  1NVI D;  2Q5W D;  2DBY A;  3AMZ A;  3AE7 B;  1FFU A;  2PLP A;  3VQI A;  5T8I A;  2JXT A;  1IGC A;  2LMC A;  1D5Z C;  2WXO A;  1I7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...