2IGGA

Determination of the solution structures of domains ii and iii of protein g from streptococcus by 1h nmr
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
64
structure length
64
Chain Sequence
LTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin-binding protein
molecule keywords PROTEIN G
publication title Determination of the solution structures of domains II and III of protein G from Streptococcus by 1H nuclear magnetic resonance.
pubmed doi rcsb
source organism Streptococcus sp. gx7805
total genus 12
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 1992-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2iggA00
2JXTA 2N9KA 2GB1A 1MVKA 1F2RC 3FILA 5HHDG 4IOIE 2JZPA 3MP9A 1QKZA 3V3XA 1PGXA 2RMMA 5BMHA 2LHDA 1YNTE 1ZXHA 2JU6X 2KWDA 1FCLA 2QMTA 5BMIA 2OEDA 1HEZE 5HI1A 2LGIA 2J53A 5HG2A 1XF5L 4KGRA 4D2KA 1IGCA 1JMLA 2KN4A 2QSDA 1FCCC 1K52A 2IGGA 2ZW0A 1K53A 2EELA 1HZ6A 4IKGA 5HFYA 1UWXA 3GB1A 1XCTL 1P7FA 2N9LA 2IGHA 1IBXB 1MHHE 2PTLA 4KGSA 1IBXA 1K50A 1K51A 1D4BA 4HKZE 2KDMA 4OZAA 4HJGE 2JSVX 5BMGA 1PGAA 1Q10A 2KACA 4GLSC 1C9FA 2J52A 1F2RI 4KGTA 2ZW1A 2KQ4X 2N7JA 1IGDA 2PW9A 2LHEA 2I2YA 2K0PA 2LUMA 4OZCA 1P7EA 2ONQA 1XCQL 1GB4A 2JWUA 2RPVA 1MPEA 2NMQA 2ON8A 1PGBA 2I38A 2PLPA 1MHXA 5JXVA 1YMHE 2IGDA 1KH0A 1EM7A 4MACA 1MI0A 3UI3A 4WH4A 1FD6A 1HZ5A 2GI9A 3FILB 1GB1A 4OZBA
chains in the Genus database with same CATH superfamily
1ZDXA 3JW0X 3PPAA 2WDRB 4HPMB 3ZGZA 1WYWB 5C2TB 3KYDD 2L0TA 2PVOD 2KWVB 3DVGX 3V3XA 2BBCA 3H7PB 2BS3B 2KOXA 4L23A 4C4VB 4BZAA 3AI5A 3P63A 5HG2A 1L6UA 1EF1A 4D2KA 2JF5A 4AJWA 1S1QB 3W1SC 2DWQA 3A4RA 3DVNV 3AEFB 1I35A 1J7AA 1TY0A 2BPSA 2N9EB 3ZIMA 2ZW0A 3PRZA 1K53A 4EEWA 2RDBC 3R66C 3T9LA 3IT4B 3ZQ4A 2K39A 3DQVA 1N62A 2JX5A 2VH1A 1IBXB 2L1AA 2JUOA 2WU5B 3OAWA 2XN9C 3ECIA 3PZDA 4WWMA 1QOAA 2DX5B 1WJ6A 1RLFA 2KKCA 3NJTA 1E90A 1YIWA 5LNK1 3T3NA 4MJSB 5BMGA 4WIPA 4I6NB 3DBHB 5G55A 2KO3A 1R4MB 4GMVA 4US9A 4IWQA 3P4QB 2N7EA 2M17A 4OZCA 4WAFA 2GRIA 3VH4B 2D2QA 2BGFA 3A1QA 4EKUA 2MSED 1TS3A 1TIFA 4FHJA 4LDTB 1MHXA 1KTKA 4FULA 2Q5WD 1AW7A 1WXAA 3KH0A 4HDQA 2IGDA 3VAWA 4WWPA 3PV1A 4A9AA 1HXYD 3VQIA 2JYEA 4MACA 3ZNHB 1FFUA 4GU2A 4FLHA 2W3RA 2LXCA 1WXMA 4HK2A 4BVUC 1F2RC 2BYEA 2CJOA 1ZDVA 2UU7A 1KLGD 4PT5A 2DAFA 4N9F4 2IY0B 3UQAA 4W9JA 3B2FA 4EZKA 1DYQA 1FXIA 2JRHA 4MELA 1FCLA 5C23A 3UQBA 3W9CB 4DHZE 1JQ4A 3MC8A 4HCNB 3FKYA 2G45B 2N1VA 3AU5A 3AEGB 4B0EA 4FHKA 1HZ6A 1WM3A 4TQ1A 2NVUI 3RI7C 2WGSA 2LEKA 1YOVB 3A33B 3W5VB 1EWYC 3IHPC 4J3OD 2SEBD 1N5WA 3N1ZC 1RRBA 3KYCD 2V0GA 4ARCA 3NZ3A 1Z5SB 2L32A 2KXJA 3OG5A 2H89B 4FJZA 1P98A 3I63C 2MLBA 2BW2A 4G0NB 3BVMA 1LO5D 1E6EB 4FJVB 3AXCA 5JZEB 1CK1A 1E8YA 2BVCA 2LHEA 3Q3MC 1GNUA 2G9HD 2L7RA 3R7RA 1MPEA 2AL3A 4JPSA 2LGDA 4HVBA 2NMQA 5AZFA 4EOYA 4BKSA 1WSPA 2ON8A 2CU1A 4II2B 4CQNA 5D3IB 2MP2B 4MEMA 3RNCC 4A90A 4BKGA 2WXNA 3NG0A 1V1PA 1GB1A 3PRPB 3VR8B 2JY6A 5HHDG 3PZ7A 2KVRA 1TS5A 3NZSA 1WX7A 5CTRC 3EGRA 2LRWA 2VRRB 4P6VF 2VH2A 3QK0A 1ESFA 3L17A 3GE8C 3TIXA 4K7SA 1FRRA 1HEZE 4ZRQA 3N1YC 4IWOA 1TJEA 2Z0EB 1E10A 1EWCA 1WXSA 1GUAB 3RNAC 3KUCB 2IBIB 3A9JA 2XK5A 2O2VB 1WRIA 1YD8U 2QDFA 1JWBD 5GXGB 2DYBA 2W55A 1RAXA 2H88B 2GBKA 2RGFA 4JQWC 1EU4A 2DNFA 2IGHA 4JE3B 2D3CA 2FUG1 4DHJB 3DHIC 4CHKA 5FK9C 3ZNZB 1E8WA 2NPTB 3Q8BA 2MH7A 2WP9B 3SEBA 3PGEA 2J4XA 1PQSA 4TMAB 2JSVX 1WMHA 1P1AA 3H8HA 2ZPNA 2WXLA 4RNAA 2ZCBA 4A20A 3HM6X 1QOBA 3L08A 4YWGG 2BF8B 5DPSA 1WGHA 4MSMB 4RCOA 4ZOHC 3PLVA 2PIAA 2FBWB 3QJZA 2K8HA 1VD2A 1EO6A 2K25A 1X1MA 2JQRB 4N58A 2WHIA 4YL8A 1J7CA 5GMVA 2MHJA 2Y5CA 2GI9A 3SR6A 3IAS1 2LGXA 3L54A 2A5UA 3GZNI 2N7DA 1R4NB 2MBHA 2VZKD 1AARA 1FXAA 3J9CA 1SB3C 3R8BA 1NVID 3E56A 1WFYA 5BMHA 4R3DA 1Y56A 1KOTA 1P0RA 1KFYB 1DGJA 4HKQA 4KGRA 3EFCA 4REZA 1FRDA 1LM8B 3UINB 1UH6A 4S17A 3WAMA 5LXIB 2R2QA 2KHWB 1SIJA 3RZWC 2JYTA 1D5ZC 1OQRA 1UF0A 2AQ1B 3ZYYX 1WJUA 1TKGA 3KWVA 2DZKA 1LGRA 2NBUA 3GP7A 2PE9A 3AN1A 4NZLB 3T8MA 4C7ZA 1OQYA 2AWTA 2IJ0A 4EZJA 3WALA 4W9EA 3GS2A 2G1EA 3LYYA 1VJKA 3TEXA 3MHSD 1TGZB 4IW0A 1STEA 1SGHA 2I2YA 1WE7A 2LUMA 1EF5A 3DBSA 3DBHI 1R4MI 3GE3C 3PSEB 4ZRKA 1LQBA 2PEAA 2N4FA 3APFA 2N0SB 3Q3OC 3PTFC 1ISNA 2C7HA 2N9PC 3NOBA 4ANXA 2IO3B 5E6PA 4FA6A 2AQ3B 2AEHA 4EE2A 4MGZE 2M4NA 4XYCA 5AUKA 2GBMA 1GAQB 4DDID 4HWIB 1SXTA 5C1ZA 2JZPA 4CO7A 2WXRA 2BYFA 1OEYJ 1HTOA 4GDLB 2WDTB 4W9CA 2RMMA 3IFWB 1ET6A 1QOGA 2CHXA 3C0RB 2DLBA 3H7PA 4C4VA 3R2IA 1UD7A 2EKEC 3QA8A 1K52A 3RNGC 3NVYA 2IGGA 1XQQA 4DXAB 2FIDA 3DCGA 5CHFA 1I4GA 3C8YA 3H7SA 4H2AA 1WI0A 4KX6B 1Q5WB 4LNOA 2LGSA 1YN5A 5G5GA 2KWUB 2PTLA 1V1OA 4BFRA 4NAMA 4KGSA 4DXGA 4WJOA 3ZKJC 1IBXA 3ZXRA 4ZRJA 5IA7A 1D4BA 4G3XB 1VZ8A 4HPLB 3BK2A 2DZMA 3B08A 4MGIE 1WXVA 1PGAA 3L0WB 4UDUC 2GOWA 4XDCA 4KGTA 4MJSA 5AUIA 1E5WA 4RGOS 1JRPA 4E71A 2LI5A 1P7EA 3HVDA 1QT9A 4AS1A 1CQVA 1JWSD 2WXHA 4HRSA 3ZJTA 1MI0A 1CZPA 4YTPB 1S3SG 2QJLA 1C76A 5BO4B 2ZZPB 1V97A 2KMCA 3DVNU 2K9XA 2KDFB 3MP9A 3U4EG 4W9GA 1PGXA 1B9RA 3GZNB 4ICVA 2IY1B 2KX0A 2RD0A 3O13A 4RMAA 2Z8LA 3AE1B 3EECA 5LXHA 1UZXB 2V4LA 1D5MC 3B2GA 3SU8X 4A3OA 3N3KB 1NBFC 3OWEB 1RFKA 2AYOB 4K7UA 4G11A 4RH6A 3U2SC 2BS4B 1H4RA 3APDA 1YQ3B 4IKGA 5D3DA 4B0MA 2PJHA 3RMKC 2K8CA 4WJPA 3W1YA 5BYSA 4YSXB 2KLGA 4I6PA 5D2MB 1SSNA 3K9PB 2L83A 1ET9A 2WXQA 2RDHA 2MBEA 4LJPB 4MM3B 1UBIA 2QHOA 2V3NA 1GC6A 1VRAB 3VTUA 3H6NA 1ROEA 2DBYA 1CJEA 2KYWA 3RULA 2KMMA 4ZYNA 3IVFA 2AL6A 2RDGA 4URKA 1XCQL 1RWSA 4W9HA 5FR6A 4N59A 1V86A 4BBNC 1PGBA 2C60A 2I38A 2C5LC 3M3JA 5DPRA 3NVWA 1YQBA 1I7HA 3HVZA 2BQQA 2LVPA 3Q69A 2MP2A 5EE1A 3TMPB 1FD6A 3AEDB 3WIMA 2K1FA 4M0WB 1YJ1A 3TJPA 2JXTA 2GB1A 3Q8AA 3C19A 1GC7A 2CS4A 4DQOC 3JVZX 1V8CA 4NJ6A 4YSZB 3LB8C 4ARIA 1MG4A 4MGKE 3B0AA 1FNVA 1Y8RC 1QKZA 3WAPA 2VZKB 4IWPA 3CWIA 1ZXHA 3I3TB 3TUOA 2INPE 3U8ZA 1R4NI 2LXAA 5J17A 3VRBB 5BMIA 1WGYA 1TBEA 2PVGC 3B9JA 4B6WA 4XWTA 1NDDA 2MWSB 4NAWB 1TS2A 1L4DB 4FADA 1DOXA 4KIKB 1TZOA 1ZPSA 1WXQA 4W9DA 2Y3AA 2O2VA 3K9OB 4RGTA 2CHZA 4XDDA 2C7NB 2WXPA 4BAXA 5D7GA 1FEHA 3AECB 4MH0E 2JPHA 2X8XX 1V81A 4RFBA 1H8CA 3QAQA 2NBWB 2WXGA 4USAA 1T0RC 4K3BA 2NPTA 4J6IA 4DHZB 2WXFA 1C4AA 1SE2A 3W2DA 4ANUA 2HJ1A 1YN3A 4ZRPA 1IGDA 4C00A 2V1YA 1PDXA 4DK5A 2YVCA 2UWQA 4LNKA 1PYWD 2RPQA 2WNMA 4P1CC 4HPPA 3ZDMC 3ZJVA 3MHZA 2J0KA 4M8NA 5EE9A 2BKFA 4IUMB 1P9DU 1WYGA 3UF8A 1T0SC 2O6VD 3EA6A 1L6VA 5J18A 1YN4A 2CU3A 2FNJB 3RZFA 1YQ4B 1VDVA 2M0AA 2OEDA 2G3QB 2K3UA 1C1YB 2LRUA 1XEEA 5IO9A 5I4DA 1TT5B 3TBLD 1KJTA 1T6BX 2M1MA 3ZLZA 1WZ3A 2MCNB 3Q8EA 2LJIA 5D94A 3L13A 3ALBA 3MC9A 4IM3A 4PS8A 3N32A 4KDIC 1E0ZA 4KZCA 5DPTA 3WCQA 2JT4B 3AE5B 3IBEA 3IAM1 3GB1A 1E7VA 4E74A 2LJ5A 3NZUA 5EE3A 3DVGY 5DCNA 1YJIA 1IUEA 2JRIB 3MC0B 3ZNID 1K50A 3I9V1 4BKTA 3TSSA 1A5RA 4OZAA 4CYEA 2LD9A 4OVVA 5AZHA 2KACA 2YLMA 4PYZA 1L4ZB 1F2RI 5IP4D 2PW9A 2CJNA 2FE8A 4FBJB 3DDCB 1YX5B 1QZEA 1N6ZA 4JX1C 2INNE 3LDZE 2V3SA 4W9FA 3AEEB 2MX2A 4DBGA 2L0FA 2D10A 2M8SA 2Y5BB 5J2RA 3HIZA 3DWMA 3ZO5B 3DWGC 2LUEA 2BS2B 2ACZB 2YEPB 2CKHB 2K6DB 2WXIA 1GJZA 1KLVA 3VR9B 4L2YA 3DHHC 5L95C 2L05A 1V9JA 1WWTA 3VH3B 4GDLA 2W82A 2W54A 1FFVA 3AE4B 2DZIA 3L16A 4LLGM 4A8XC 2NBVB 4K81A 1FO4A 2J53A 3AH7A 3T3OA 1MG8A 4W9IA 3I57A 3KW5B 3A9KB 4Q2JA 1C77A 1L2NA 4RGNA 1WE6A 3HK0A 3VVWB 4LNFA 3JSVB 3P4PB 4AWJA 2JWZA 5LLIA 2KVZA 4I6LB 1XT9B 2MA9B 4WQMA 2KQ7A 1UWXA 3HUIA 3V05A 3RNFC 1NENB 4OVZA 5T8IA 2D11A 4NQKE 2K22A 2FIFA 3VUXA 4ANWA 4K3CA 3ENEA 3ZVVA 1V49A 4LDTD 3NVVA 1SBBB 1D3ZA 2MBQA 2INDC 4HLEA 3VHTC 3WANA 1L0YB 4OVUA 2C7MB 2LASA 1WRDB 5MPOA 4JLCA 2J52A 4HEA1 1N5XA 3A4SC 2N7JA 2I1JA 1C78A 4EFOA 4PK1A 2YEPF 1R7SA 1WF9A 5JXVA 1MJDA 3MFGA 2ZEQA 3AB5A 2D5GA 3AM9A 4LTUA 4DXFA 2ZNVB 4NJ7A 4ACFA 1K8RB 1JW9D 2ZCCA 4GXBA 2REXA 2NCNA 1VZ6A 4S0RA 4WJNA 1UWMA 2WDVB 4WWNA 2OJRA 2OHFA 5TR5A 1TY2A 3ZW3A 3Q8CA 4F8CB 2LHDA 2KDIA 3AEBB 2KQSA 3KLSX 3CIRB 2BB6A 2HE7A 1UGMA 4JL9A 2KD0A 3NY5A 3QQ8B 2KJHB 3ML8A 2D3BA 1JALA 2BYVE 3ZXVA 4MT5A 1PFDA 3UGBB 1T5XD 1CMXB 3O65B 2WYQA 1IP9A 2D07B 5CHVC 1EU3A 3V6CB 1T0YA 2PKOA 2JZ3B 2DHZA 1SEBD 4HXDA 4ITKA 2RSUA 3VRAB 3BWUD 3VUWA 4DWFA 1F0ZA 2W9NA 1E8ZA 2BWFA 1XO3A 1JWUD 2TSSA 2MRPA 4M02A 1QF6A 1ZW7A 3U7DA 3DBRI 2IZVB 3ZRFA 1ZXIA 4KVGB 1SE9A 4HJKA 1FNWA 4MM3A 2I1KA 4ICUA 4W9LA 1RFAA 1F52A 4TUUA 4ZDVA 5BYRA 2BYTA 2ZVOA 3CF6E 3N20C 3UIPB 3VDZA 3NVZA 2IPKD 2JWUA 2KTFA 4GB9A 5IKCM 4GIVA 2C9WB 1OFFA 3BZDB 5IOIA 2IDYA 3MTNB 1C79A 3PREA 4X57B 2MJEA 2ICIA 2WXJA 1HZ5A 2EMSA 3BINA 4B95A 1VZ7A 3FILB 4KKIA 3RFZB 2QCZA 3CMMB 4M0WA 3N1XC 1M94A 1KLUD 4IOIE 3OJ3A 3QIJA 4HCPB 2O6VB 1TTNA 3AE3B 1N60A 3GOEA 3EHVA 2CR5A 3EFUA 4P16A 4DHJD 1SIFA 4TQ0A 3NRZA 3Q6BA 4GDKB 3DOWA 1XLOA 5CX3A 1WIAA 2LGIA 2G4SA 4HROA 4MDKE 2J42A 5CHWA 5IN7A 3VTVA 1RYJA 2JZZA 1E8XA 3ABVB 3PHWB 1Q1OA 1UBQA 3MJWA 2V4IB 3IT6B 1C4PA 4NAWA 3X0WA 1EUVB 5KHQA 3Q3JA 4KIKA 2MJDA 1NYQA 2X38A 1HTQA 2EKIA 2KDBA 5BYQA 4WQOB 4AUQC 4II3B 3Q2AC 3APCA 2ZVNA 2MW5A 1K51A 1TZ1A 2J7QB 2SAKA 2INCC 2KTRB 4KZ0A 2HTME 1ENFA 5DPWA 2MBBB 5TSSA 2XBBC 3IG3A 4KDLB 3D32A 2ZW1A 4BKSD 4IC7B 2WXOA 1WGDA 4BOSC 1KM7A 3Q8FA 4LNIA 1ZOYB 4DDGD 4XE0A 2OJWA 1QQRA 3AEAB 1L0XB 3BVZA 5E6OA 3RCZA 1FIQA 2ZNVC 2BT6A 2DYMA 3DBLI 1TKEA 2EMTA 3FAHA 2MEKA 2QIEB 2J0JA 4WH4A 4AQ7A 2L3ZA 4ZRIA 2KJ6A 1MVKA 4W9KA 2JXXA 5EE0A 4NNJB 3RUIB 3KUDB 1XXGA 3BYYB 2KFKB 3M95A 3AE2B 3P1MA 2QC8A 1N61A 3P42A 1F77A 1AYFA 2FCMA 2QMTA 1V2YA 1UNSA 3ZTDA 4ANVA 1T0QC 3QC8B 2WDQB 3V61A 4AJYB 1ZP0B 5FR3A 3AE9B 3U30A 4M8MA 2KX3A 3I5JC 1WJ4A 2N9LA 4EZLA 1MHHE 2XEWA 3ETRA 3Q14C 1OQQA 3TL5A 3M62B 2L00B 3PVLA 2FUHB 1YJJA 1A70A 1SJHD 1WR6E 2KDMA 3BYTB 2CHWA 1JROA 4GSWA 4E3CA 2KMAA 2MQJA 2WWZA 2KN5A 1I4PA 3VUYA 3L10B 2D3GA 5JHAA 1JWMD 3DBRB 1DOYA 3H9DA 1ZE3D 2B76B 2K0PA 1I4QA 4BOZB 4EUTA 1E9MA 2KNBA 3DPDA 3WAOA 1YMHE 4P7IA 4ZHPA 2HDEA 4M00A 4PS7A 4OZBA 4K1RB 4RGMA 2DZJA 3AE7B 2M0XA 4C7YA 3WA0A 3PRMB 3BY4B 1HA5A 4AOFA 3L4PA 2KWCA 2Z59B 3KVFB 3SFDB 1C3TA 3SDLC 2MJ3A 4NY0A 1XLPA 1WGKA 1L5PA 1NYRA 2KC2A 4LCDE 3ZTCA 1YNTE 2JU6X 3RT3B 2LVQA 1Z2MA 1J19A 3BIID 4ZYSA 2LVOA 1KRHA 1MFWA 4A55A 4WAAA 1ZKHA 1E7PB 2K5PA 1C4CA 1NI2A 1J0GA 3Q3NC 2J0MA 5IAAC 3A9KA 3SFEB 1JRUA 2E3TA 4K7WA 3RPFC 3JSVA 1VLBA 1D6EC 1XLQA 2PPHA 4LNNA 2N1WA 1DOIA 4FJYA 4NJCA 1P7FA 2WX1A 2GLSA 3H1UA 2K6QA 3VFKA 1IYFA 3TCAA 1L0VB 4IDIA 1M4VA 3B1LX 5AZGA 1KF6B 1WX8A 1F9JA 4HKZE 3HM3A 3ONSA 4HDOA 3UIOB 2KZRA 1E7UA 5HKHA 1IPGA 3PZ8A 2KANA 1I4HA 3P4RB 3RNBC 4GLSC 1T3QA 4FXCA 2KQ4X 1WJNA 2AX5A 1I42A 4LJOB 3RYTA 3A1QB 3ZDTA 3ZUNA 3BK1A 2W3SA 2L52A 2QEJC 2LFIA 4JIOU 2PLPA 2GBNA 5JH5C 3PS6A 5FKAC 2WXKA 4XWWA 3PO0A 4PYUA 4YXDB 1EM7A 3TEZA 1SJED 4GGQA 4B9KA 2KC1A 2Z0DB 3DBLB 2WS3B 2PMVA 2KDEB 4XGAB 4LK0M 3AV8A 1TS4A 2BWES 1WGGA 2KJRA 3W1SA 2LMCA 2JVCA 4NQLB 5HI1A 3N30A 1IGCA 2GMIC 1SE3A 4OHJA 1ZUD2 4AP4C 1UELA 2G4DB 1FCCC 2WLBA 4WWOA 1U4AA 2EELA 5HFYA 2HJ8A 3VXWA 3PLUA 2LGYA 3ZNGC 1QOFA 1XCTL 2KAJA 2FCNA 1OTRB 1WZ0A 3U52E 1WX9A 4C56C 5G5HA 1GG3A 3QARA 2HD5B 3QX1A 4TSSA 4PS3A 4HJGE 3QCAA 3R3MA 1F1HA 2E6XA 3AE6B 3ML9A 1Q10A 3RN9C 1C9FA 2LZ6A 5H8YE 3QHTA 4KV2A 1UGJA 4MGYE 2V3PA 2V9HA 1VCBA 2D3AA 2R2OA 3EUB2 4KSKC 4YSYB 3TEWA 5L83A 3QWZB 1I4RA 2MBOA 3DHGC 1ZGUB 1KH0A 4JGHB 1V1PB 1BXTA 4IM2A 2OOBB 4JWSC 4WURA 1PUTA 1B1ZA 2N9KA 1WGRA 2NTSA 2M19A 4KSLC 3LXFA 3FILA 1OGWA 1RM6C 1WR1A 2FCQA 2IYDB 1HE8A 4F7ZA 3JYUA 3NS1A 4MH8A 1V6EA 3VTWA 1WM2A 2O6VA 4RM8A 2WX0A 2KT7A 2KWDA 1QILA 4ZHOA 1XF5L 1BUIC 4GDKA 1JWAD 2ZJDA 2NTTA 3A9JB 2XK5B 4NPNA 4US8A 2DENB 1AWDA 3KQ4A 4C80A 1WY8A 2DYOA 4XZ4A 2WXMA 1V5OA 1GOZA 1UUPA 3N9YC 3OLMD 3NUHB 4N6EB 5C3JB 2IO1B 3ZJUA 2BTEA 2HTHA 4YT0B 2DAJA 3PT2B 2FAZA 1LXDA 1J7BA 1XLNA 3RD2A 2KK8A 3FC4A 3CSTA 1WMHB 3EC8A 4P1BC 1SF0A 1GPXA 1SE4A 2NR2A 3NHEB 5JHBA 3X23A 2KTRA 3AU4A 2L8JA 4MSQB 2K8BA 2N9XA 4XC2A 4KKJA 5D6JB 3KUZA 5AEKB 2RPVA 1V80A 4A6QA 2PE6B 4F1SA 1J8CA 3V6EB 1WH3A 5E6JA 4ASWC 2XNAC 3UI3A 1TKYA 3KWLA 3W5UB 3RNEC 1FPYA 4QAYA 4L1BA 4TV3A 3S2AA 1JCKB 1N63A 2KLCA 3IXSA 4YTMB 3R7QA 1FMAD 1NI3A 4WJQA 3V62A 2B3AA 1FM0D 3AMZA 4RF1A 3URYA 2GBJA 2KFKA 3P4SB 3Q3FA 2IO0B 3TEYA 3BVGA 1YX6B 3PHXB 1LFDA 4IM0A 1FNUA 2NS5A 1Q0WB 1L7YA 1AN8A 1JMLA 2KN4A 3SD5A 4GOCA 2FCSA 2QSDA 4RF0A 2M56B 2RR9A 2IO2B 3U7ZA 4FN2A 2WU2B 3AULA 1ACCA 3CSFA 3M63B 4RM9A 3LJ3A 1QLBB 4OW0A 5H92C 3SHQA 4BBNF 4G50A 5KHOA 2WQYB 4O1NA 1XD3B 2ASQA 2AQ2B 1P3QU 3ZRCA 4GN1A 1TYGB 2BKRB 1HQRD 2Y5PA 4M01A 4A3PA 3MJ5A 3V60A 1BT0A 3HRDD 2BB5A 2KFJA 2A4ZA 5G2NA 5EDSA 1FXTB 2QILA 3P2BA 5E6NA 2ONQA 3OJ4B 1GB4A 3NS8A 1D5XC 4IG7B 4XX5A 2LWPA 1OEYA 1NEKB 2GBRA 2UYZB 4YTNB 1I4XA 2ZPYA 2R61A 3E9SA 3HHMA 1V5TA 4TKNA 3AE8B 4JWUC 2L76A 1VR9A 1BMLC 3R2TA 1G6JA
chains in the Genus database with same CATH topology
3AE7B 2WXIA 1ZDXA 4C7YA 5AUKA 1GAQB 3VR9B 4L2YA 1HA5A 1SXTA 3L4PA 2JZPA 3SFDB 2WDRB 2WXRA 3ZGZA 5C2TB 4GDLB 2MJ3A 2PVOD 1XLPA 1WGKA 1L5PA 1NYRA 1WWTA 3V3XA 2RMMA 2BBCA 1ET6A 1QOGA 1YNTE 2JU6X 2W82A 2W54A 1FFVA 2BS3B 4L23A 3AE4B 4A8XC 4LLGM 2DLBA 3BIID 4ZYSA 1FO4A 2J53A 3P63A 3AH7A 1L6UA 5HG2A 1KRHA 4D2KA 3R2IA 3T3OA 3I57A 2DWQA 4A55A 4Q2JA 1E7PB 1C77A 2K5PA 4RGNA 1C4CA 1K52A 3AEFB 3NVYA 1J7AA 2IGGA 1TY0A 4RGMA 3SFEB 3P4PB 2ZW0A 2E3TA 1I4GA 3C8YA 4WQMA 1K53A 3RPFC 1VLBA 4H2AA 1D6EC 1UWXA 3HUIA 3IT4B 4KX6B 3V05A 3ZQ4A 1NENB 1XLQA 4OVZA 5T8IA 1YN5A 1DOIA 1N62A 2JX5A 4NJCA 2K22A 1P7FA 5G5GA 1IBXB 2L1AA 2PTLA 2WU5B 1V1OA 2XN9C 1L0VB 4IDIA 4KGSA 4NAMA 1M4VA 4DXGA 1IBXA 3NVVA 1KF6B 4WWMA 1QOAA 1SBBB 1D4BA 1VZ8A 4HKZE 1L0YB 5LNK1 3PZ8A 3BK2A 3T3NA 1I4HA 3P4RB 5BMGA 5MPOA 1PGAA 4GLSC 4UDUC 4WIPA 1T3QA 2J52A 4HEA1 4FXCA 1N5XA 4XDCA 4KGTA 2KQ4X 4US9A 2N7JA 2AX5A 5AUIA 3P4QB 4RGOS 1JRPA 4OZCA 4WAFA 1P7EA 2GRIA 1C78A 3BK1A 2W3SA 3HVDA 2L52A 2QEJC 1QT9A 2LFIA 2YEPF 1R7SA 1TS3A 4AS1A 2PLPA 1MHXA 1CQVA 1KTKA 5JXVA 1JWSD 2Q5WD 1AW7A 3MFGA 2IGDA 2WXHA 2WXKA 5FKAC 4XWWA 3AB5A 3PO0A 4HRSA 4YXDB 4A9AA 1HXYD 3ZJTA 3VQIA 2D5GA 1EM7A 2JYEA 3AM9A 4LTUA 4MACA 1MI0A 1CZPA 4DXFA 1FFUA 3TEZA 4YTPB 1SJED 2QJLA 1C76A 2W3RA 1JW9D 1V97A 1VZ6A 1F2RC 1UWMA 2WDVB 2CJOA 1ZDVA 1KLGD 2K9XA 2OHFA 2PMVA 2WS3B 4PT5A 3MP9A 3U4EG 1TY2A 3B2FA 4LK0M 3AV8A 3Q8CA 1PGXA 1TS4A 1B9RA 2LHDA 3AEBB 3O13A 1DYQA 1FXIA 3KLSX 2Z8LA 2LMCA 2BB6A 3AE1B 3CIRB 3W1SA 1FCLA 1D5MC 5HI1A 3W9CB 3B2GA 1IGCA 3OWEB 1RFKA 1JQ4A 1SE3A 4OHJA 1JALA 1ZUD2 4MT5A 1PFDA 3AEGB 1T5XD 1FCCC 2WLBA 4RH6A 3U2SC 4B0EA 2BS4B 1YQ3B 2EELA 1EU3A 1HZ6A 4IKGA 4TQ1A 5HFYA 2PKOA 5D3DA 4B0MA 1QOFA 1XCTL 1SEBD 2KAJA 4ITKA 2LEKA 5BYSA 3U52E 3VRAB 3BWUD 4YSXB 1F0ZA 3W5VB 1EWYC 4J3OD 4C56C 1XO3A 1JWUD 5G5HA 2TSSA 2SEBD 1N5WA 1SSNA 2L83A 1QF6A 1ET9A 2WXQA 2RDHA 2V0GA 4ARCA 4MM3B 3NZ3A 2V3NA 4TSSA 4HJGE 1ZXIA 1VRAB 2E6XA 2L32A 1FNWA 3AE6B 1Q10A 1C9FA 2H89B 5H8YE 1ROEA 2DBYA 1CJEA 2BW2A 2KMMA 1LO5D 3BVMA 1E6EB 5BYRA 1CK1A 2BYTA 2LHEA 2G9HD 2RDGA 1UGJA 1XCQL 3NVZA 2IPKD 2V3PA 1RWSA 2JWUA 4N59A 1MPEA 4JPSA 3EUB2 2NMQA 1WSPA 2ON8A 1OFFA 1PGBA 2I38A 3BZDB 4YSYB 3TEWA 4CQNA 5D3IB 1I4RA 2IDYA 3NVWA 4A90A 1I7HA 1KH0A 3HVZA 1V1PB 3Q69A 2WXNA 1C79A 1BXTA 5EE1A 1FD6A 4JWSC 2MJEA 4WURA 2ICIA 2WXJA 3AEDB 1HZ5A 1V1PA 1VZ7A 3FILB 1PUTA 4KKIA 3RFZB 1GB1A 1B1ZA 2JXTA 2N9KA 2GB1A 3Q8AA 2NTSA 4DQOC 3VR8B 1V8CA 2M19A 4YSZB 3LXFA 3FILA 5HHDG 4M0WA 3LB8C 4ARIA 1KLUD 4IOIE 1RM6C 3PZ7A 1FNVA 1TS5A 1QKZA 3AE3B 3EGRA 3NS1A 1N60A 4MH8A 2VZKB 4P6VF 3CWIA 1ZXHA 4P16A 3TUOA 1ESFA 2INPE 2KWDA 1QILA 4TQ0A 3NRZA 3VRBB 5BMIA 4GDKB 4ZHOA 1FRRA 1HEZE 1XLOA 4ZRQA 2PVGC 1TJEA 3B9JA 2LGIA 4HROA 1XF5L 4XWTA 1BUIC 2J42A 1JWAD 1RYJA 1E10A 2NTTA 1EWCA 3ABVB 4US8A 4NAWB 1TS2A 1AWDA 1L4DB 1DOXA 3KQ4A 1TZOA 4C80A 2V4IB 3IT6B 1C4PA 1WRIA 2DYOA 2WXMA 1JWBD 1GOZA 1UUPA 5GXGB 2W55A 1ZPSA 1WXQA 2MJDA 2Y3AA 3N9YC 1NYQA 2H88B 2X38A 4RGTA 4XDDA 3NUHB 1EU4A 4N6EB 2EKIA 5C3JB 2WXPA 5D7GA 1FEHA 2IGHA 4JE3B 3ZJUA 3AECB 2FUG1 5BYQA 2BTEA 4YT0B 5FK9C 1J7BA 2MH7A 3Q8BA 1XLNA 4RFBA 1K51A 2WP9B 3SEBA 2WXGA 3FC4A 4USAA 2SAKA 1SF0A 2J4XA 2HTME 4TMAB 1GPXA 1ENFA 2WXFA 1C4AA 1SE4A 2JSVX 1SE2A 5TSSA 3W2DA 3H8HA 4RNAA 2WXLA 1YN3A 1QOBA 2ZW1A 4YWGG 4ZRPA 1IGDA 2WXOA 1PDXA 4KKJA 3Q8FA 1ZOYB 4RCOA 4ZOHC 1PYWD 2RPVA 2PIAA 4XE0A 1QQRA 2FBWB 3AEAB 4A6QA 2WNMA 3ZJVA 1L0XB 3BVZA 3MHZA 1FIQA 5EE9A 2BT6A 2DYMA 2JQRB 4N58A 1TKEA 3FAHA 2MEKA 5E6JA 1J7CA 2XNAC 2QIEB 3UI3A 4WH4A 4AQ7A 1TKYA 1WYGA 2Y5CA 3KWLA 3W5UB 2GI9A 3SR6A 3IAS1 4L1BA 1JCKB 1MVKA 1N63A 3EA6A 3IXSA 4YTMB 1FMAD 5EE0A 1NI3A 2VZKD 1XXGA 1L6VA 1FXAA 3BYYB 3J9CA 1SB3C 3R8BA 1FM0D 1NVID 3AE2B 3AMZA 3E56A 3P1MA 1YN4A 1N61A 2CU3A 5BMHA 3P42A 4RF1A 4R3DA 1F77A 3URYA 1Y56A 1AYFA 3P4SB 1YQ4B 1KFYB 1VDVA 2M0AA 2QMTA 1DGJA 3TEYA 2OEDA 4HKQA 2K3UA 3BVGA 1XEEA 1UNSA 5I4DA 4KGRA 1FNUA 4REZA 1T6BX 1AN8A 1JMLA 1FRDA 2KN4A 2QSDA 4RF0A 2WDQB 3Q8EA 2LJIA 2M56B 1SIJA 3U7ZA 2JYTA 1ZP0B 1D5ZC 1OQRA 2AQ1B 2WU2B 3ZYYX 1E0ZA 3WCQA 3AE9B 5FR3A 1TKGA 1ACCA 3AE5B 3IAM1 3KWVA 3GB1A 2N9LA 1MHHE 3ETRA 5EE3A 1OQQA 1YJIA 1IUEA 1QLBB 4OW0A 5H92C 3GP7A 3AN1A 1YJJA 1A70A 1SJHD 2WQYB 3MC0B 1K50A 4NZLB 4O1NA 3I9V1 3TSSA 4C7ZA 2IJ0A 2AQ2B 2KDMA 4OZAA 3BYTB 1JROA 1TYGB 1HQRD 2Y5PA 1I4PA 3GS2A 3MJ5A 2KACA 2G1EA 3HRDD 2BB5A 3LYYA 1VJKA 1L4ZB 3TEXA 1F2RI 1DOYA 1JWMD 2QILA 2PW9A 2CJNA 1ZE3D 2B76B 1STEA 2FE8A 2I2YA 2K0PA 2LUMA 2ONQA 1GB4A 1D5XC 4JX1C 2INNE 1I4QA 3AEEB 1E9MA 1NEKB 1YMHE 4YTNB 4ZHPA 2N0SB 1I4XA 3DWMA 2R61A 3E9SA 3DWGC 2HDEA 2AQ3B 2BS2B 3AE8B 4JWUC 1VR9A 1BMLC 3R2TA 2ACZB 4OZBA 2YEPB 4EE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXT A;  2N9K A;  2GB1 A;  1MVK A;  1F2R C;  3FIL A;  5HHD G;  4IOI E;  2JZP A;  3MP9 A;  1QKZ A;  3V3X A;  1PGX A;  2RMM A;  5BMH A;  2LHD A;  1YNT E;  1ZXH A;  2JU6 X;  2KWD A;  1FCL A;  2QMT A;  5BMI A;  2OED A;  1HEZ E;  5HI1 A;  2LGI A;  2J53 A;  5HG2 A;  1XF5 L;  4KGR A;  4D2K A;  1IGC A;  1JML A;  2KN4 A;  2QSD A;  1FCC C;  1K52 A;  2IGG A;  2ZW0 A;  1K53 A;  2EEL A;  1HZ6 A;  4IKG A;  5HFY A;  1UWX A;  3GB1 A;  1XCT L;  1P7F A;  2N9L A;  2IGH A;  1IBX B;  1MHH E;  2PTL A;  4KGS A;  1IBX A;  1K50 A;  1K51 A;  1D4B A;  4HKZ E;  2KDM A;  4OZA A;  4HJG E;  2JSV X;  5BMG A;  1PGA A;  1Q10 A;  2KAC A;  4GLS C;  1C9F A;  2J52 A;  1F2R I;  4KGT A;  2ZW1 A;  2KQ4 X;  2N7J A;  1IGD A;  2PW9 A;  2LHE A;  2I2Y A;  2K0P A;  2LUM A;  4OZC A;  1P7E A;  2ONQ A;  1XCQ L;  1GB4 A;  2JWU A;  2RPV A;  1MPE A;  2NMQ A;  2ON8 A;  1PGB A;  2I38 A;  2PLP A;  1MHX A;  5JXV A;  1YMH E;  2IGD A;  1KH0 A;  1EM7 A;  4MAC A;  1MI0 A;  3UI3 A;  4WH4 A;  1FD6 A;  1HZ5 A;  2GI9 A;  3FIL B;  1GB1 A;  4OZB A; 
#chains in the Genus database with same CATH topology
 1ZDX A;  3JW0 X;  3PPA A;  2WDR B;  4HPM B;  3ZGZ A;  1WYW B;  5C2T B;  3KYD D;  2L0T A;  2PVO D;  2KWV B;  3DVG X;  3V3X A;  2BBC A;  3H7P B;  2BS3 B;  2KOX A;  4L23 A;  4C4V B;  4BZA A;  3AI5 A;  3P63 A;  5HG2 A;  1L6U A;  1EF1 A;  4D2K A;  2JF5 A;  4AJW A;  1S1Q B;  3W1S C;  2DWQ A;  3A4R A;  3DVN V;  3AEF B;  1I35 A;  1J7A A;  1TY0 A;  2BPS A;  2N9E B;  3ZIM A;  2ZW0 A;  3PRZ A;  1K53 A;  4EEW A;  2RDB C;  3R66 C;  3T9L A;  3IT4 B;  3ZQ4 A;  2K39 A;  3DQV A;  1N62 A;  2JX5 A;  2VH1 A;  1IBX B;  2L1A A;  2JUO A;  2WU5 B;  3OAW A;  2XN9 C;  3ECI A;  3PZD A;  4WWM A;  1QOA A;  2DX5 B;  1WJ6 A;  1RLF A;  2KKC A;  3NJT A;  1E90 A;  1YIW A;  5LNK 1;  3T3N A;  4MJS B;  5BMG A;  4WIP A;  4I6N B;  3DBH B;  5G55 A;  2KO3 A;  1R4M B;  4GMV A;  4US9 A;  4IWQ A;  3P4Q B;  2N7E A;  2M17 A;  4OZC A;  4WAF A;  2GRI A;  3VH4 B;  2D2Q A;  2BGF A;  3A1Q A;  4EKU A;  2MSE D;  1TS3 A;  1TIF A;  4FHJ A;  4LDT B;  1MHX A;  1KTK A;  4FUL A;  2Q5W D;  1AW7 A;  1WXA A;  3KH0 A;  4HDQ A;  2IGD A;  3VAW A;  4WWP A;  3PV1 A;  4A9A A;  1HXY D;  3VQI A;  2JYE A;  4MAC A;  3ZNH B;  1FFU A;  4GU2 A;  4FLH A;  2W3R A;  2LXC A;  1WXM A;  4HK2 A;  4BVU C;  1F2R C;  2BYE A;  2CJO A;  1ZDV A;  2UU7 A;  1KLG D;  4PT5 A;  2DAF A;  4N9F 4;  2IY0 B;  3UQA A;  4W9J A;  3B2F A;  4EZK A;  1DYQ A;  1FXI A;  2JRH A;  4MEL A;  1FCL A;  5C23 A;  3UQB A;  3W9C B;  4DHZ E;  1JQ4 A;  3MC8 A;  4HCN B;  3FKY A;  2G45 B;  2N1V A;  3AU5 A;  3AEG B;  4B0E A;  4FHK A;  1HZ6 A;  1WM3 A;  4TQ1 A;  2NVU I;  3RI7 C;  2WGS A;  2LEK A;  1YOV B;  3A33 B;  3W5V B;  1EWY C;  3IHP C;  4J3O D;  2SEB D;  1N5W A;  3N1Z C;  1RRB A;  3KYC D;  2V0G A;  4ARC A;  3NZ3 A;  1Z5S B;  2L32 A;  2KXJ A;  3OG5 A;  2H89 B;  4FJZ A;  1P98 A;  3I63 C;  2MLB A;  2BW2 A;  4G0N B;  3BVM A;  1LO5 D;  1E6E B;  4FJV B;  3AXC A;  5JZE B;  1CK1 A;  1E8Y A;  2BVC A;  2LHE A;  3Q3M C;  1GNU A;  2G9H D;  2L7R A;  3R7R A;  1MPE A;  2AL3 A;  4JPS A;  2LGD A;  4HVB A;  2NMQ A;  5AZF A;  4EOY A;  4BKS A;  1WSP A;  2ON8 A;  2CU1 A;  4II2 B;  4CQN A;  5D3I B;  2MP2 B;  4MEM A;  3RNC C;  4A90 A;  4BKG A;  2WXN A;  3NG0 A;  1V1P A;  1GB1 A;  3PRP B;  3VR8 B;  2JY6 A;  5HHD G;  3PZ7 A;  2KVR A;  1TS5 A;  3NZS A;  1WX7 A;  5CTR C;  3EGR A;  2LRW A;  2VRR B;  4P6V F;  2VH2 A;  3QK0 A;  1ESF A;  3L17 A;  3GE8 C;  3TIX A;  4K7S A;  1FRR A;  1HEZ E;  4ZRQ A;  3N1Y C;  4IWO A;  1TJE A;  2Z0E B;  1E10 A;  1EWC A;  1WXS A;  1GUA B;  3RNA C;  3KUC B;  2IBI B;  3A9J A;  2XK5 A;  2O2V B;  1WRI A;  1YD8 U;  2QDF A;  1JWB D;  5GXG B;  2DYB A;  2W55 A;  1RAX A;  2H88 B;  2GBK A;  2RGF A;  4JQW C;  1EU4 A;  2DNF A;  2IGH A;  4JE3 B;  2D3C A;  2FUG 1;  4DHJ B;  3DHI C;  4CHK A;  5FK9 C;  3ZNZ B;  1E8W A;  2NPT B;  3Q8B A;  2MH7 A;  2WP9 B;  3SEB A;  3PGE A;  2J4X A;  1PQS A;  4TMA B;  2JSV X;  1WMH A;  1P1A A;  3H8H A;  2ZPN A;  2WXL A;  4RNA A;  2ZCB A;  4A20 A;  3HM6 X;  1QOB A;  3L08 A;  4YWG G;  2BF8 B;  5DPS A;  1WGH A;  4MSM B;  4RCO A;  4ZOH C;  3PLV A;  2PIA A;  2FBW B;  3QJZ A;  2K8H A;  1VD2 A;  1EO6 A;  2K25 A;  1X1M A;  2JQR B;  4N58 A;  2WHI A;  4YL8 A;  1J7C A;  5GMV A;  2MHJ A;  2Y5C A;  2GI9 A;  3SR6 A;  3IAS 1;  2LGX A;  3L54 A;  2A5U A;  3GZN I;  2N7D A;  1R4N B;  2MBH A;  2VZK D;  1AAR A;  1FXA A;  3J9C A;  1SB3 C;  3R8B A;  1NVI D;  3E56 A;  1WFY A;  5BMH A;  4R3D A;  1Y56 A;  1KOT A;  1P0R A;  1KFY B;  1DGJ A;  4HKQ A;  4KGR A;  3EFC A;  4REZ A;  1FRD A;  1LM8 B;  3UIN B;  1UH6 A;  4S17 A;  3WAM A;  5LXI B;  2R2Q A;  2KHW B;  1SIJ A;  3RZW C;  2JYT A;  1D5Z C;  1OQR A;  1UF0 A;  2AQ1 B;  3ZYY X;  1WJU A;  1TKG A;  3KWV A;  2DZK A;  1LGR A;  2NBU A;  3GP7 A;  2PE9 A;  3AN1 A;  4NZL B;  3T8M A;  4C7Z A;  1OQY A;  2AWT A;  2IJ0 A;  4EZJ A;  3WAL A;  4W9E A;  3GS2 A;  2G1E A;  3LYY A;  1VJK A;  3TEX A;  3MHS D;  1TGZ B;  4IW0 A;  1STE A;  1SGH A;  2I2Y A;  1WE7 A;  2LUM A;  1EF5 A;  3DBS A;  3DBH I;  1R4M I;  3GE3 C;  3PSE B;  4ZRK A;  1LQB A;  2PEA A;  2N4F A;  3APF A;  2N0S B;  3Q3O C;  3PTF C;  1ISN A;  2C7H A;  2N9P C;  3NOB A;  4ANX A;  2IO3 B;  5E6P A;  4FA6 A;  2AQ3 B;  2AEH A;  4EE2 A;  4MGZ E;  2M4N A;  4XYC A;  5AUK A;  2GBM A;  1GAQ B;  4DDI D;  4HWI B;  1SXT A;  5C1Z A;  2JZP A;  4CO7 A;  2WXR A;  2BYF A;  1OEY J;  1HTO A;  4GDL B;  2WDT B;  4W9C A;  2RMM A;  3IFW B;  1ET6 A;  1QOG A;  2CHX A;  3C0R B;  2DLB A;  3H7P A;  4C4V A;  3R2I A;  1UD7 A;  2EKE C;  3QA8 A;  1K52 A;  3RNG C;  3NVY A;  2IGG A;  1XQQ A;  4DXA B;  2FID A;  3DCG A;  5CHF A;  1I4G A;  3C8Y A;  3H7S A;  4H2A A;  1WI0 A;  4KX6 B;  1Q5W B;  4LNO A;  2LGS A;  1YN5 A;  5G5G A;  2KWU B;  2PTL A;  1V1O A;  4BFR A;  4NAM A;  4KGS A;  4DXG A;  4WJO A;  3ZKJ C;  1IBX A;  3ZXR A;  4ZRJ A;  5IA7 A;  1D4B A;  4G3X B;  1VZ8 A;  4HPL B;  3BK2 A;  2DZM A;  3B08 A;  4MGI E;  1WXV A;  1PGA A;  3L0W B;  4UDU C;  2GOW A;  4XDC A;  4KGT A;  4MJS A;  5AUI A;  1E5W A;  4RGO S;  1JRP A;  4E71 A;  2LI5 A;  1P7E A;  3HVD A;  1QT9 A;  4AS1 A;  1CQV A;  1JWS D;  2WXH A;  4HRS A;  3ZJT A;  1MI0 A;  1CZP A;  4YTP B;  1S3S G;  2QJL A;  1C76 A;  5BO4 B;  2ZZP B;  1V97 A;  2KMC A;  3DVN U;  2K9X A;  2KDF B;  3MP9 A;  3U4E G;  4W9G A;  1PGX A;  1B9R A;  3GZN B;  4ICV A;  2IY1 B;  2KX0 A;  2RD0 A;  3O13 A;  4RMA A;  2Z8L A;  3AE1 B;  3EEC A;  5LXH A;  1UZX B;  2V4L A;  1D5M C;  3B2G A;  3SU8 X;  4A3O A;  3N3K B;  1NBF C;  3OWE B;  1RFK A;  2AYO B;  4K7U A;  4G11 A;  4RH6 A;  3U2S C;  2BS4 B;  1H4R A;  3APD A;  1YQ3 B;  4IKG A;  5D3D A;  4B0M A;  2PJH A;  3RMK C;  2K8C A;  4WJP A;  3W1Y A;  5BYS A;  4YSX B;  2KLG A;  4I6P A;  5D2M B;  1SSN A;  3K9P B;  2L83 A;  1ET9 A;  2WXQ A;  2RDH A;  2MBE A;  4LJP B;  4MM3 B;  1UBI A;  2QHO A;  2V3N A;  1GC6 A;  1VRA B;  3VTU A;  3H6N A;  1ROE A;  2DBY A;  1CJE A;  2KYW A;  3RUL A;  2KMM A;  4ZYN A;  3IVF A;  2AL6 A;  2RDG A;  4URK A;  1XCQ L;  1RWS A;  4W9H A;  5FR6 A;  4N59 A;  1V86 A;  4BBN C;  1PGB A;  2C60 A;  2I38 A;  2C5L C;  3M3J A;  5DPR A;  3NVW A;  1YQB A;  1I7H A;  3HVZ A;  2BQQ A;  2LVP A;  3Q69 A;  2MP2 A;  5EE1 A;  3TMP B;  1FD6 A;  3AED B;  3WIM A;  2K1F A;  4M0W B;  1YJ1 A;  3TJP A;  2JXT A;  2GB1 A;  3Q8A A;  3C19 A;  1GC7 A;  2CS4 A;  4DQO C;  3JVZ X;  1V8C A;  4NJ6 A;  4YSZ B;  3LB8 C;  4ARI A;  1MG4 A;  4MGK E;  3B0A A;  1FNV A;  1Y8R C;  1QKZ A;  3WAP A;  2VZK B;  4IWP A;  3CWI A;  1ZXH A;  3I3T B;  3TUO A;  2INP E;  3U8Z A;  1R4N I;  2LXA A;  5J17 A;  3VRB B;  5BMI A;  1WGY A;  1TBE A;  2PVG C;  3B9J A;  4B6W A;  4XWT A;  1NDD A;  2MWS B;  4NAW B;  1TS2 A;  1L4D B;  4FAD A;  1DOX A;  4KIK B;  1TZO A;  1ZPS A;  1WXQ A;  4W9D A;  2Y3A A;  2O2V A;  3K9O B;  4RGT A;  2CHZ A;  4XDD A;  2C7N B;  2WXP A;  4BAX A;  5D7G A;  1FEH A;  3AEC B;  4MH0 E;  2JPH A;  2X8X X;  1V81 A;  4RFB A;  1H8C A;  3QAQ A;  2NBW B;  2WXG A;  4USA A;  1T0R C;  4K3B A;  2NPT A;  4J6I A;  4DHZ B;  2WXF A;  1C4A A;  1SE2 A;  3W2D A;  4ANU A;  2HJ1 A;  1YN3 A;  4ZRP A;  1IGD A;  4C00 A;  2V1Y A;  1PDX A;  4DK5 A;  2YVC A;  2UWQ A;  4LNK A;  1PYW D;  2RPQ A;  2WNM A;  4P1C C;  4HPP A;  3ZDM C;  3ZJV A;  3MHZ A;  2J0K A;  4M8N A;  5EE9 A;  2BKF A;  4IUM B;  1P9D U;  1WYG A;  3UF8 A;  1T0S C;  2O6V D;  3EA6 A;  1L6V A;  5J18 A;  1YN4 A;  2CU3 A;  2FNJ B;  3RZF A;  1YQ4 B;  1VDV A;  2M0A A;  2OED A;  2G3Q B;  2K3U A;  1C1Y B;  2LRU A;  1XEE A;  5IO9 A;  5I4D A;  1TT5 B;  3TBL D;  1KJT A;  1T6B X;  2M1M A;  3ZLZ A;  1WZ3 A;  2MCN B;  3Q8E A;  2LJI A;  5D94 A;  3L13 A;  3ALB A;  3MC9 A;  4IM3 A;  4PS8 A;  3N32 A;  4KDI C;  1E0Z A;  4KZC A;  5DPT A;  3WCQ A;  2JT4 B;  3AE5 B;  3IBE A;  3IAM 1;  3GB1 A;  1E7V A;  4E74 A;  2LJ5 A;  3NZU A;  5EE3 A;  3DVG Y;  5DCN A;  1YJI A;  1IUE A;  2JRI B;  3MC0 B;  3ZNI D;  1K50 A;  3I9V 1;  4BKT A;  3TSS A;  1A5R A;  4OZA A;  4CYE A;  2LD9 A;  4OVV A;  5AZH A;  2KAC A;  2YLM A;  4PYZ A;  1L4Z B;  1F2R I;  5IP4 D;  2PW9 A;  2CJN A;  2FE8 A;  4FBJ B;  3DDC B;  1YX5 B;  1QZE A;  1N6Z A;  4JX1 C;  2INN E;  3LDZ E;  2V3S A;  4W9F A;  3AEE B;  2MX2 A;  4DBG A;  2L0F A;  2D10 A;  2M8S A;  2Y5B B;  5J2R A;  3HIZ A;  3DWM A;  3ZO5 B;  3DWG C;  2LUE A;  2BS2 B;  2ACZ B;  2YEP B;  2CKH B;  2K6D B;  2WXI A;  1GJZ A;  1KLV A;  3VR9 B;  4L2Y A;  3DHH C;  5L95 C;  2L05 A;  1V9J A;  1WWT A;  3VH3 B;  4GDL A;  2W82 A;  2W54 A;  1FFV A;  3AE4 B;  2DZI A;  3L16 A;  4LLG M;  4A8X C;  2NBV B;  4K81 A;  1FO4 A;  2J53 A;  3AH7 A;  3T3O A;  1MG8 A;  4W9I A;  3I57 A;  3KW5 B;  3A9K B;  4Q2J A;  1C77 A;  1L2N A;  4RGN A;  1WE6 A;  3HK0 A;  3VVW B;  4LNF A;  3JSV B;  3P4P B;  4AWJ A;  2JWZ A;  5LLI A;  2KVZ A;  4I6L B;  1XT9 B;  2MA9 B;  4WQM A;  2KQ7 A;  1UWX A;  3HUI A;  3V05 A;  3RNF C;  1NEN B;  4OVZ A;  5T8I A;  2D11 A;  4NQK E;  2K22 A;  2FIF A;  3VUX A;  4ANW A;  4K3C A;  3ENE A;  3ZVV A;  1V49 A;  4LDT D;  3NVV A;  1SBB B;  1D3Z A;  2MBQ A;  2IND C;  4HLE A;  3VHT C;  3WAN A;  1L0Y B;  4OVU A;  2C7M B;  2LAS A;  1WRD B;  5MPO A;  4JLC A;  2J52 A;  4HEA 1;  1N5X A;  3A4S C;  2N7J A;  2I1J A;  1C78 A;  4EFO A;  4PK1 A;  2YEP F;  1R7S A;  1WF9 A;  5JXV A;  1MJD A;  3MFG A;  2ZEQ A;  3AB5 A;  2D5G A;  3AM9 A;  4LTU A;  4DXF A;  2ZNV B;  4NJ7 A;  4ACF A;  1K8R B;  1JW9 D;  2ZCC A;  4GXB A;  2REX A;  2NCN A;  1VZ6 A;  4S0R A;  4WJN A;  1UWM A;  2WDV B;  4WWN A;  2OJR A;  2OHF A;  5TR5 A;  1TY2 A;  3ZW3 A;  3Q8C A;  4F8C B;  2LHD A;  2KDI A;  3AEB B;  2KQS A;  3KLS X;  3CIR B;  2BB6 A;  2HE7 A;  1UGM A;  4JL9 A;  2KD0 A;  3NY5 A;  3QQ8 B;  2KJH B;  3ML8 A;  2D3B A;  1JAL A;  2BYV E;  3ZXV A;  4MT5 A;  1PFD A;  3UGB B;  1T5X D;  1CMX B;  3O65 B;  2WYQ A;  1IP9 A;  2D07 B;  5CHV C;  1EU3 A;  3V6C B;  1T0Y A;  2PKO A;  2JZ3 B;  2DHZ A;  1SEB D;  4HXD A;  4ITK A;  2RSU A;  3VRA B;  3BWU D;  3VUW A;  4DWF A;  1F0Z A;  2W9N A;  1E8Z A;  2BWF A;  1XO3 A;  1JWU D;  2TSS A;  2MRP A;  4M02 A;  1QF6 A;  1ZW7 A;  3U7D A;  3DBR I;  2IZV B;  3ZRF A;  1ZXI A;  4KVG B;  1SE9 A;  4HJK A;  1FNW A;  4MM3 A;  2I1K A;  4ICU A;  4W9L A;  1RFA A;  1F52 A;  4TUU A;  4ZDV A;  5BYR A;  2BYT A;  2ZVO A;  3CF6 E;  3N20 C;  3UIP B;  3VDZ A;  3NVZ A;  2IPK D;  2JWU A;  2KTF A;  4GB9 A;  5IKC M;  4GIV A;  2C9W B;  1OFF A;  3BZD B;  5IOI A;  2IDY A;  3MTN B;  1C79 A;  3PRE A;  4X57 B;  2MJE A;  2ICI A;  2WXJ A;  1HZ5 A;  2EMS A;  3BIN A;  4B95 A;  1VZ7 A;  3FIL B;  4KKI A;  3RFZ B;  2QCZ A;  3CMM B;  4M0W A;  3N1X C;  1M94 A;  1KLU D;  4IOI E;  3OJ3 A;  3QIJ A;  4HCP B;  2O6V B;  1TTN A;  3AE3 B;  1N60 A;  3GOE A;  3EHV A;  2CR5 A;  3EFU A;  4P16 A;  4DHJ D;  1SIF A;  4TQ0 A;  3NRZ A;  3Q6B A;  4GDK B;  3DOW A;  1XLO A;  5CX3 A;  1WIA A;  2LGI A;  2G4S A;  4HRO A;  4MDK E;  2J42 A;  5CHW A;  5IN7 A;  3VTV A;  1RYJ A;  2JZZ A;  1E8X A;  3ABV B;  3PHW B;  1Q1O A;  1UBQ A;  3MJW A;  2V4I B;  3IT6 B;  1C4P A;  4NAW A;  3X0W A;  1EUV B;  5KHQ A;  3Q3J A;  4KIK A;  2MJD A;  1NYQ A;  2X38 A;  1HTQ A;  2EKI A;  2KDB A;  5BYQ A;  4WQO B;  4AUQ C;  4II3 B;  3Q2A C;  3APC A;  2ZVN A;  2MW5 A;  1K51 A;  1TZ1 A;  2J7Q B;  2SAK A;  2INC C;  2KTR B;  4KZ0 A;  2HTM E;  1ENF A;  5DPW A;  2MBB B;  5TSS A;  2XBB C;  3IG3 A;  4KDL B;  3D32 A;  2ZW1 A;  4BKS D;  4IC7 B;  2WXO A;  1WGD A;  4BOS C;  1KM7 A;  3Q8F A;  4LNI A;  1ZOY B;  4DDG D;  4XE0 A;  2OJW A;  1QQR A;  3AEA B;  1L0X B;  3BVZ A;  5E6O A;  3RCZ A;  1FIQ A;  2ZNV C;  2BT6 A;  2DYM A;  3DBL I;  1TKE A;  2EMT A;  3FAH A;  2MEK A;  2QIE B;  2J0J A;  4WH4 A;  4AQ7 A;  2L3Z A;  4ZRI A;  2KJ6 A;  1MVK A;  4W9K A;  2JXX A;  5EE0 A;  4NNJ B;  3RUI B;  3KUD B;  1XXG A;  3BYY B;  2KFK B;  3M95 A;  3AE2 B;  3P1M A;  2QC8 A;  1N61 A;  3P42 A;  1F77 A;  1AYF A;  2FCM A;  2QMT A;  1V2Y A;  1UNS A;  3ZTD A;  4ANV A;  1T0Q C;  3QC8 B;  2WDQ B;  3V61 A;  4AJY B;  1ZP0 B;  5FR3 A;  3AE9 B;  3U30 A;  4M8M A;  2KX3 A;  3I5J C;  1WJ4 A;  2N9L A;  4EZL A;  1MHH E;  2XEW A;  3ETR A;  3Q14 C;  1OQQ A;  3TL5 A;  3M62 B;  2L00 B;  3PVL A;  2FUH B;  1YJJ A;  1A70 A;  1SJH D;  1WR6 E;  2KDM A;  3BYT B;  2CHW A;  1JRO A;  4GSW A;  4E3C A;  2KMA A;  2MQJ A;  2WWZ A;  2KN5 A;  1I4P A;  3VUY A;  3L10 B;  2D3G A;  5JHA A;  1JWM D;  3DBR B;  1DOY A;  3H9D A;  1ZE3 D;  2B76 B;  2K0P A;  1I4Q A;  4BOZ B;  4EUT A;  1E9M A;  2KNB A;  3DPD A;  3WAO A;  1YMH E;  4P7I A;  4ZHP A;  2HDE A;  4M00 A;  4PS7 A;  4OZB A;  4K1R B;  4RGM A;  2DZJ A;  3AE7 B;  2M0X A;  4C7Y A;  3WA0 A;  3PRM B;  3BY4 B;  1HA5 A;  4AOF A;  3L4P A;  2KWC A;  2Z59 B;  3KVF B;  3SFD B;  1C3T A;  3SDL C;  2MJ3 A;  4NY0 A;  1XLP A;  1WGK A;  1L5P A;  1NYR A;  2KC2 A;  4LCD E;  3ZTC A;  1YNT E;  2JU6 X;  3RT3 B;  2LVQ A;  1Z2M A;  1J19 A;  3BII D;  4ZYS A;  2LVO A;  1KRH A;  1MFW A;  4A55 A;  4WAA A;  1ZKH A;  1E7P B;  2K5P A;  1C4C A;  1NI2 A;  1J0G A;  3Q3N C;  2J0M A;  5IAA C;  3A9K A;  3SFE B;  1JRU A;  2E3T A;  4K7W A;  3RPF C;  3JSV A;  1VLB A;  1D6E C;  1XLQ A;  2PPH A;  4LNN A;  2N1W A;  1DOI A;  4FJY A;  4NJC A;  1P7F A;  2WX1 A;  2GLS A;  3H1U A;  2K6Q A;  3VFK A;  1IYF A;  3TCA A;  1L0V B;  4IDI A;  1M4V A;  3B1L X;  5AZG A;  1KF6 B;  1WX8 A;  1F9J A;  4HKZ E;  3HM3 A;  3ONS A;  4HDO A;  3UIO B;  2KZR A;  1E7U A;  5HKH A;  1IPG A;  3PZ8 A;  2KAN A;  1I4H A;  3P4R B;  3RNB C;  4GLS C;  1T3Q A;  4FXC A;  2KQ4 X;  1WJN A;  2AX5 A;  1I42 A;  4LJO B;  3RYT A;  3A1Q B;  3ZDT A;  3ZUN A;  3BK1 A;  2W3S A;  2L52 A;  2QEJ C;  2LFI A;  4JIO U;  2PLP A;  2GBN A;  5JH5 C;  3PS6 A;  5FKA C;  2WXK A;  4XWW A;  3PO0 A;  4PYU A;  4YXD B;  1EM7 A;  3TEZ A;  1SJE D;  4GGQ A;  4B9K A;  2KC1 A;  2Z0D B;  3DBL B;  2WS3 B;  2PMV A;  2KDE B;  4XGA B;  4LK0 M;  3AV8 A;  1TS4 A;  2BWE S;  1WGG A;  2KJR A;  3W1S A;  2LMC A;  2JVC A;  4NQL B;  5HI1 A;  3N30 A;  1IGC A;  2GMI C;  1SE3 A;  4OHJ A;  1ZUD 2;  4AP4 C;  1UEL A;  2G4D B;  1FCC C;  2WLB A;  4WWO A;  1U4A A;  2EEL A;  5HFY A;  2HJ8 A;  3VXW A;  3PLU A;  2LGY A;  3ZNG C;  1QOF A;  1XCT L;  2KAJ A;  2FCN A;  1OTR B;  1WZ0 A;  3U52 E;  1WX9 A;  4C56 C;  5G5H A;  1GG3 A;  3QAR A;  2HD5 B;  3QX1 A;  4TSS A;  4PS3 A;  4HJG E;  3QCA A;  3R3M A;  1F1H A;  2E6X A;  3AE6 B;  3ML9 A;  1Q10 A;  3RN9 C;  1C9F A;  2LZ6 A;  5H8Y E;  3QHT A;  4KV2 A;  1UGJ A;  4MGY E;  2V3P A;  2V9H A;  1VCB A;  2D3A A;  2R2O A;  3EUB 2;  4KSK C;  4YSY B;  3TEW A;  5L83 A;  3QWZ B;  1I4R A;  2MBO A;  3DHG C;  1ZGU B;  1KH0 A;  4JGH B;  1V1P B;  1BXT A;  4IM2 A;  2OOB B;  4JWS C;  4WUR A;  1PUT A;  1B1Z A;  2N9K A;  1WGR A;  2NTS A;  2M19 A;  4KSL C;  3LXF A;  3FIL A;  1OGW A;  1RM6 C;  1WR1 A;  2FCQ A;  2IYD B;  1HE8 A;  4F7Z A;  3JYU A;  3NS1 A;  4MH8 A;  1V6E A;  3VTW A;  1WM2 A;  2O6V A;  4RM8 A;  2WX0 A;  2KT7 A;  2KWD A;  1QIL A;  4ZHO A;  1XF5 L;  1BUI C;  4GDK A;  1JWA D;  2ZJD A;  2NTT A;  3A9J B;  2XK5 B;  4NPN A;  4US8 A;  2DEN B;  1AWD A;  3KQ4 A;  4C80 A;  1WY8 A;  2DYO A;  4XZ4 A;  2WXM A;  1V5O A;  1GOZ A;  1UUP A;  3N9Y C;  3OLM D;  3NUH B;  4N6E B;  5C3J B;  2IO1 B;  3ZJU A;  2BTE A;  2HTH A;  4YT0 B;  2DAJ A;  3PT2 B;  2FAZ A;  1LXD A;  1J7B A;  1XLN A;  3RD2 A;  2KK8 A;  3FC4 A;  3CST A;  1WMH B;  3EC8 A;  4P1B C;  1SF0 A;  1GPX A;  1SE4 A;  2NR2 A;  3NHE B;  5JHB A;  3X23 A;  2KTR A;  3AU4 A;  2L8J A;  4MSQ B;  2K8B A;  2N9X A;  4XC2 A;  4KKJ A;  5D6J B;  3KUZ A;  5AEK B;  2RPV A;  1V80 A;  4A6Q A;  2PE6 B;  4F1S A;  1J8C A;  3V6E B;  1WH3 A;  5E6J A;  4ASW C;  2XNA C;  3UI3 A;  1TKY A;  3KWL A;  3W5U B;  3RNE C;  1FPY A;  4QAY A;  4L1B A;  4TV3 A;  3S2A A;  1JCK B;  1N63 A;  2KLC A;  3IXS A;  4YTM B;  3R7Q A;  1FMA D;  1NI3 A;  4WJQ A;  3V62 A;  2B3A A;  1FM0 D;  3AMZ A;  4RF1 A;  3URY A;  2GBJ A;  2KFK A;  3P4S B;  3Q3F A;  2IO0 B;  3TEY A;  3BVG A;  1YX6 B;  3PHX B;  1LFD A;  4IM0 A;  1FNU A;  2NS5 A;  1Q0W B;  1L7Y A;  1AN8 A;  1JML A;  2KN4 A;  3SD5 A;  4GOC A;  2FCS A;  2QSD A;  4RF0 A;  2M56 B;  2RR9 A;  2IO2 B;  3U7Z A;  4FN2 A;  2WU2 B;  3AUL A;  1ACC A;  3CSF A;  3M63 B;  4RM9 A;  3LJ3 A;  1QLB B;  4OW0 A;  5H92 C;  3SHQ A;  4BBN F;  4G50 A;  5KHO A;  2WQY B;  4O1N A;  1XD3 B;  2ASQ A;  2AQ2 B;  1P3Q U;  3ZRC A;  4GN1 A;  1TYG B;  2BKR B;  1HQR D;  2Y5P A;  4M01 A;  4A3P A;  3MJ5 A;  3V60 A;  1BT0 A;  3HRD D;  2BB5 A;  2KFJ A;  2A4Z A;  5G2N A;  5EDS A;  1FXT B;  2QIL A;  3P2B A;  5E6N A;  2ONQ A;  3OJ4 B;  1GB4 A;  3NS8 A;  1D5X C;  4IG7 B;  4XX5 A;  2LWP A;  1OEY A;  1NEK B;  2GBR A;  2UYZ B;  4YTN B;  1I4X A;  2ZPY A;  2R61 A;  3E9S A;  3HHM A;  1V5T A;  4TKN A;  3AE8 B;  4JWU C;  2L76 A;  1VR9 A;  1BML C;  3R2T A;  1G6J A; 
#chains in the Genus database with same CATH homology
 3AE7 B;  2WXI A;  1ZDX A;  4C7Y A;  5AUK A;  1GAQ B;  3VR9 B;  4L2Y A;  1HA5 A;  1SXT A;  3L4P A;  2JZP A;  3SFD B;  2WDR B;  2WXR A;  3ZGZ A;  5C2T B;  4GDL B;  2MJ3 A;  2PVO D;  1XLP A;  1WGK A;  1L5P A;  1NYR A;  1WWT A;  3V3X A;  2RMM A;  2BBC A;  1ET6 A;  1QOG A;  1YNT E;  2JU6 X;  2W82 A;  2W54 A;  1FFV A;  2BS3 B;  4L23 A;  3AE4 B;  4A8X C;  4LLG M;  2DLB A;  3BII D;  4ZYS A;  1FO4 A;  2J53 A;  3P63 A;  3AH7 A;  1L6U A;  5HG2 A;  1KRH A;  4D2K A;  3R2I A;  3T3O A;  3I57 A;  2DWQ A;  4A55 A;  4Q2J A;  1E7P B;  1C77 A;  2K5P A;  4RGN A;  1C4C A;  1K52 A;  3AEF B;  3NVY A;  1J7A A;  2IGG A;  1TY0 A;  4RGM A;  3SFE B;  3P4P B;  2ZW0 A;  2E3T A;  1I4G A;  3C8Y A;  4WQM A;  1K53 A;  3RPF C;  1VLB A;  4H2A A;  1D6E C;  1UWX A;  3HUI A;  3IT4 B;  4KX6 B;  3V05 A;  3ZQ4 A;  1NEN B;  1XLQ A;  4OVZ A;  5T8I A;  1YN5 A;  1DOI A;  1N62 A;  2JX5 A;  4NJC A;  2K22 A;  1P7F A;  5G5G A;  1IBX B;  2L1A A;  2PTL A;  2WU5 B;  1V1O A;  2XN9 C;  1L0V B;  4IDI A;  4KGS A;  4NAM A;  1M4V A;  4DXG A;  1IBX A;  3NVV A;  1KF6 B;  4WWM A;  1QOA A;  1SBB B;  1D4B A;  1VZ8 A;  4HKZ E;  1L0Y B;  5LNK 1;  3PZ8 A;  3BK2 A;  3T3N A;  1I4H A;  3P4R B;  5BMG A;  5MPO A;  1PGA A;  4GLS C;  4UDU C;  4WIP A;  1T3Q A;  2J52 A;  4HEA 1;  4FXC A;  1N5X A;  4XDC A;  4KGT A;  2KQ4 X;  4US9 A;  2N7J A;  2AX5 A;  5AUI A;  3P4Q B;  4RGO S;  1JRP A;  4OZC A;  4WAF A;  1P7E A;  2GRI A;  1C78 A;  3BK1 A;  2W3S A;  3HVD A;  2L52 A;  2QEJ C;  1QT9 A;  2LFI A;  2YEP F;  1R7S A;  1TS3 A;  4AS1 A;  2PLP A;  1MHX A;  1CQV A;  1KTK A;  5JXV A;  1JWS D;  2Q5W D;  1AW7 A;  3MFG A;  2IGD A;  2WXH A;  2WXK A;  5FKA C;  4XWW A;  3AB5 A;  3PO0 A;  4HRS A;  4YXD B;  4A9A A;  1HXY D;  3ZJT A;  3VQI A;  2D5G A;  1EM7 A;  2JYE A;  3AM9 A;  4LTU A;  4MAC A;  1MI0 A;  1CZP A;  4DXF A;  1FFU A;  3TEZ A;  4YTP B;  1SJE D;  2QJL A;  1C76 A;  2W3R A;  1JW9 D;  1V97 A;  1VZ6 A;  1F2R C;  1UWM A;  2WDV B;  2CJO A;  1ZDV A;  1KLG D;  2K9X A;  2OHF A;  2PMV A;  2WS3 B;  4PT5 A;  3MP9 A;  3U4E G;  1TY2 A;  3B2F A;  4LK0 M;  3AV8 A;  3Q8C A;  1PGX A;  1TS4 A;  1B9R A;  2LHD A;  3AEB B;  3O13 A;  1DYQ A;  1FXI A;  3KLS X;  2Z8L A;  2LMC A;  2BB6 A;  3AE1 B;  3CIR B;  3W1S A;  1FCL A;  1D5M C;  5HI1 A;  3W9C B;  3B2G A;  1IGC A;  3OWE B;  1RFK A;  1JQ4 A;  1SE3 A;  4OHJ A;  1JAL A;  1ZUD 2;  4MT5 A;  1PFD A;  3AEG B;  1T5X D;  1FCC C;  2WLB A;  4RH6 A;  3U2S C;  4B0E A;  2BS4 B;  1YQ3 B;  2EEL A;  1EU3 A;  1HZ6 A;  4IKG A;  4TQ1 A;  5HFY A;  2PKO A;  5D3D A;  4B0M A;  1QOF A;  1XCT L;  1SEB D;  2KAJ A;  4ITK A;  2LEK A;  5BYS A;  3U52 E;  3VRA B;  3BWU D;  4YSX B;  1F0Z A;  3W5V B;  1EWY C;  4J3O D;  4C56 C;  1XO3 A;  1JWU D;  5G5H A;  2TSS A;  2SEB D;  1N5W A;  1SSN A;  2L83 A;  1QF6 A;  1ET9 A;  2WXQ A;  2RDH A;  2V0G A;  4ARC A;  4MM3 B;  3NZ3 A;  2V3N A;  4TSS A;  4HJG E;  1ZXI A;  1VRA B;  2E6X A;  2L32 A;  1FNW A;  3AE6 B;  1Q10 A;  1C9F A;  2H89 B;  5H8Y E;  1ROE A;  2DBY A;  1CJE A;  2BW2 A;  2KMM A;  1LO5 D;  3BVM A;  1E6E B;  5BYR A;  1CK1 A;  2BYT A;  2LHE A;  2G9H D;  2RDG A;  1UGJ A;  1XCQ L;  3NVZ A;  2IPK D;  2V3P A;  1RWS A;  2JWU A;  4N59 A;  1MPE A;  4JPS A;  3EUB 2;  2NMQ A;  1WSP A;  2ON8 A;  1OFF A;  1PGB A;  2I38 A;  3BZD B;  4YSY B;  3TEW A;  4CQN A;  5D3I B;  1I4R A;  2IDY A;  3NVW A;  4A90 A;  1I7H A;  1KH0 A;  3HVZ A;  1V1P B;  3Q69 A;  2WXN A;  1C79 A;  1BXT A;  5EE1 A;  1FD6 A;  4JWS C;  2MJE A;  4WUR A;  2ICI A;  2WXJ A;  3AED B;  1HZ5 A;  1V1P A;  1VZ7 A;  3FIL B;  1PUT A;  4KKI A;  3RFZ B;  1GB1 A;  1B1Z A;  2JXT A;  2N9K A;  2GB1 A;  3Q8A A;  2NTS A;  4DQO C;  3VR8 B;  1V8C A;  2M19 A;  4YSZ B;  3LXF A;  3FIL A;  5HHD G;  4M0W A;  3LB8 C;  4ARI A;  1KLU D;  4IOI E;  1RM6 C;  3PZ7 A;  1FNV A;  1TS5 A;  1QKZ A;  3AE3 B;  3EGR A;  3NS1 A;  1N60 A;  4MH8 A;  2VZK B;  4P6V F;  3CWI A;  1ZXH A;  4P16 A;  3TUO A;  1ESF A;  2INP E;  2KWD A;  1QIL A;  4TQ0 A;  3NRZ A;  3VRB B;  5BMI A;  4GDK B;  4ZHO A;  1FRR A;  1HEZ E;  1XLO A;  4ZRQ A;  2PVG C;  1TJE A;  3B9J A;  2LGI A;  4HRO A;  1XF5 L;  4XWT A;  1BUI C;  2J42 A;  1JWA D;  1RYJ A;  1E10 A;  2NTT A;  1EWC A;  3ABV B;  4US8 A;  4NAW B;  1TS2 A;  1AWD A;  1L4D B;  1DOX A;  3KQ4 A;  1TZO A;  4C80 A;  2V4I B;  3IT6 B;  1C4P A;  1WRI A;  2DYO A;  2WXM A;  1JWB D;  1GOZ A;  1UUP A;  5GXG B;  2W55 A;  1ZPS A;  1WXQ A;  2MJD A;  2Y3A A;  3N9Y C;  1NYQ A;  2H88 B;  2X38 A;  4RGT A;  4XDD A;  3NUH B;  1EU4 A;  4N6E B;  2EKI A;  5C3J B;  2WXP A;  5D7G A;  1FEH A;  2IGH A;  4JE3 B;  3ZJU A;  3AEC B;  2FUG 1;  5BYQ A;  2BTE A;  4YT0 B;  5FK9 C;  1J7B A;  2MH7 A;  3Q8B A;  1XLN A;  4RFB A;  1K51 A;  2WP9 B;  3SEB A;  2WXG A;  3FC4 A;  4USA A;  2SAK A;  1SF0 A;  2J4X A;  2HTM E;  4TMA B;  1GPX A;  1ENF A;  2WXF A;  1C4A A;  1SE4 A;  2JSV X;  1SE2 A;  5TSS A;  3W2D A;  3H8H A;  4RNA A;  2WXL A;  1YN3 A;  1QOB A;  2ZW1 A;  4YWG G;  4ZRP A;  1IGD A;  2WXO A;  1PDX A;  4KKJ A;  3Q8F A;  1ZOY B;  4RCO A;  4ZOH C;  1PYW D;  2RPV A;  2PIA A;  4XE0 A;  1QQR A;  2FBW B;  3AEA B;  4A6Q A;  2WNM A;  3ZJV A;  1L0X B;  3BVZ A;  3MHZ A;  1FIQ A;  5EE9 A;  2BT6 A;  2DYM A;  2JQR B;  4N58 A;  1TKE A;  3FAH A;  2MEK A;  5E6J A;  1J7C A;  2XNA C;  2QIE B;  3UI3 A;  4WH4 A;  4AQ7 A;  1TKY A;  1WYG A;  2Y5C A;  3KWL A;  3W5U B;  2GI9 A;  3SR6 A;  3IAS 1;  4L1B A;  1JCK B;  1MVK A;  1N63 A;  3EA6 A;  3IXS A;  4YTM B;  1FMA D;  5EE0 A;  1NI3 A;  2VZK D;  1XXG A;  1L6V A;  1FXA A;  3BYY B;  3J9C A;  1SB3 C;  3R8B A;  1FM0 D;  1NVI D;  3AE2 B;  3AMZ A;  3E56 A;  3P1M A;  1YN4 A;  1N61 A;  2CU3 A;  5BMH A;  3P42 A;  4RF1 A;  4R3D A;  1F77 A;  3URY A;  1Y56 A;  1AYF A;  3P4S B;  1YQ4 B;  1KFY B;  1VDV A;  2M0A A;  2QMT A;  1DGJ A;  3TEY A;  2OED A;  4HKQ A;  2K3U A;  3BVG A;  1XEE A;  1UNS A;  5I4D A;  4KGR A;  1FNU A;  4REZ A;  1T6B X;  1AN8 A;  1JML A;  1FRD A;  2KN4 A;  2QSD A;  4RF0 A;  2WDQ B;  3Q8E A;  2LJI A;  2M56 B;  1SIJ A;  3U7Z A;  2JYT A;  1ZP0 B;  1D5Z C;  1OQR A;  2AQ1 B;  2WU2 B;  3ZYY X;  1E0Z A;  3WCQ A;  3AE9 B;  5FR3 A;  1TKG A;  1ACC A;  3AE5 B;  3IAM 1;  3KWV A;  3GB1 A;  2N9L A;  1MHH E;  3ETR A;  5EE3 A;  1OQQ A;  1YJI A;  1IUE A;  1QLB B;  4OW0 A;  5H92 C;  3GP7 A;  3AN1 A;  1YJJ A;  1A70 A;  1SJH D;  2WQY B;  3MC0 B;  1K50 A;  4NZL B;  4O1N A;  3I9V 1;  3TSS A;  4C7Z A;  2IJ0 A;  2AQ2 B;  2KDM A;  4OZA A;  3BYT B;  1JRO A;  1TYG B;  1HQR D;  2Y5P A;  1I4P A;  3GS2 A;  3MJ5 A;  2KAC A;  2G1E A;  3HRD D;  2BB5 A;  3LYY A;  1VJK A;  1L4Z B;  3TEX A;  1F2R I;  1DOY A;  1JWM D;  2QIL A;  2PW9 A;  2CJN A;  1ZE3 D;  2B76 B;  1STE A;  2FE8 A;  2I2Y A;  2K0P A;  2LUM A;  2ONQ A;  1GB4 A;  1D5X C;  4JX1 C;  2INN E;  1I4Q A;  3AEE B;  1E9M A;  1NEK B;  1YMH E;  4YTN B;  4ZHP A;  2N0S B;  1I4X A;  3DWM A;  2R61 A;  3E9S A;  3DWG C;  2HDE A;  2AQ3 B;  2BS2 B;  3AE8 B;  4JWU C;  1VR9 A;  1BML C;  3R2T A;  2ACZ B;  4OZB A;  2YEP B;  4EE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...