1E0ZA

[2fe-2s]-ferredoxin from halobacterium salinarum
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
128
structure length
127
Chain Sequence
PTVEYLNYETLDDQGWDMDDDDLFEKAADAGLDGEDYGTMEVAEGEYILEAAEAQGYDWPFSCRAGACANCASIVKEGEIDMDMQQILSDEEVEEKDVRLTCIGSPAADEVKIVYNAHLDYLQNRVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title A Two-Alpha-Helix Extra Domain Mediates the Halophilic Character of a Plant-Type Ferredoxin from Halophilic Archaea.
pubmed doi rcsb
molecule tags Electron transport
total genus 20
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2000-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1e0zA00
1SB3C 1V97A 2WP9B 1OQQA 1YJJA 2K22A 2MJDA 2PKOA 1NI3A 3P63A 5EE1A 5EE9A 5AUIA 5H92C 2W54A 1I7HA 1RYJA 1PUTA 2PVOD 1FXAA 1N61A 4ITKA 1L6VA 1WRIA 3ABVB 3NS1A 1IUEA 1CJEA 2M56B 2MJEA 3CIRB 3FAHA 1JWAD 3AE7B 3B2GA 5G5HA 3AEFB 3LXFA 1V8CA 4YT0B 5AUKA 1L0VB 2KAJA 1TKEA 2MH7A 3AV8A 4KX6B 4YSYB 3BIID 1YJIA 1FFUA 3AE9B 1E0ZA 2OHFA 1JROA 1FFVA 1J7AA 1NENB 1KRHA 4C7ZA 3KWLA 1YQ4B 1CZPA 3W5UB 1EWYC 3W9CB 3AE6B 1ZOYB 1WGKA 1L6UA 1JWBD 1QLBB 4YTPB 1ROEA 1FMAD 1SIJA 2Y5CA 1PFDA 1DOIA 3NRZA 4YXDB 3AE2B 1NYQA 1R7SA 2JQRB 3AE3B 2K5PA 5C2TB 3AEBB 3P4SB 5GXGB 2LEKA 1ZUD2 3VR8B 1FXIA 3AEEB 4YSZB 4YTMB 3HVZA 1N62A 3SFDB 4JWUC 1A70A 1T3QA 4WQMA 2H89B 1OQRA 1TKGA 1ZP0B 1RFKA 1OFFA 2W3SA 1RM6C 2W55A 2FBWB 3CWIA 4A9AA 1AYFA 1N63A 1DOXA 2ACZB 2WDQB 2JX5A 3P4PB 1N60A 3AN1A 2PIAA 3NVWA 3EUB2 2EKIA 3B9JA 4JX1C 1FO4A 5G5GA 1XLQA 1WYGA 3VRAB 4N58A 2Q5WD 4LTUA 4C80A 3VRBB 1QOBA 1QOAA 2WU5B 2W3RA 4ZHPA 1J7CA 2QJLA 3ETRA 3HUIA 1JQ4A 1KFYB 4FXCA 1WWTA 3AECB 2M19A 3B2FA 1N5WA 2N0SB 1N5XA 2WU2B 1YQ3B 3NVVA 3FC4A 3P4QB 4C7YA 1UWMA 3P4RB 1JW9D 1E9MA 3AE8B 3W5VB 1DGJA 2WDRB 1VJKA 3PO0A 1F0ZA 2G1EA 1FIQA 2WLBA 1KF6B 1VLBA 2CJOA 3AEAB 5C3JB 2B76B 2K9XA 2WDVB 1J7BA 2H88B 2BS2B 3P1MA 4N6EB 1TYGB 4HROA 2HTME 2DBYA 5MPOA 1E7PB 1L5PA 1PDXA 3DWGC 1NEKB 2L52A 3DWMA 1B9RA 4IDIA 3L4PA 1FRDA 1RWSA 4ZHOA 2PVGC 1QF6A 1QOFA 4YTNB 4JWSC 1E6EB 1NYRA 1XLPA 1VDVA 5EE3A 1XO3A 3VR9B 2BT6A 2CU3A 3SR6A 1GAQB 3HRDD 3AE5B 3RPFC 4N59A 1QT9A 1JALA 3NVYA 1ZXIA 2CJNA 1QOGA 3AE4B 3AMZA 1GPXA 1FM0D 3ZYYX 2L83A 1DOYA 2QIEB 4USAA 1WXQA 2WS3B 5H8YE 3LB8C 4HRSA 2MJ3A 3SFEB 1FRRA 3WCQA 4US8A 1NVID 2BS4B 4WWMA 2WQYB 2KMMA 1TJEA 3AE1B 1XLOA 4P6VF 1JRPA 2DWQA 3AEDB 2E3TA 1SF0A 4US9A 1E10A 1TKYA 2BS3B 3AB5A 3AEGB 3AM9A 4ZOHC 5EE0A 3NVZA 3AH7A 4YSXB 2AX5A 1AWDA 1XLNA
chains in the Genus database with same CATH superfamily
5AZGA 3PZ7A 1C9FA 2MJDA 5EE1A 4FJZA 4WH4A 5AZFA 2L1AA 3TSSA 1A5RA 2N1WA 2KFKB 2IO1B 3NJTA 2J0KA 5DPWA 3NS1A 2KX3A 4DHZE 4CYEA 3PS6A 1HZ5A 2IO3B 3TEWA 4NAWB 2JWUA 3L08A 1MHXA 4AJYB 1YOVB 2ZEQA 2KWCA 2KTRB 1DOIA 3MC9A 1SXTA 2AQ1B 4ZYNA 1FXIA 4GU2A 3H7SA 2WGSA 3HVZA 4JWUC 1YQBA 2K39A 3DBHB 1ZP0B 1N63A 2IJ0A 4A3PA 3VTWA 2INNE 5DCNA 2Q5WD 4C80A 3ONSA 1ENFA 1WXVA 1WWTA 1KTKA 4XC2A 4K7UA 2DNFA 1WX8A 2WXFA 3KYCD 2D07B 3FC4A 1QQRA 3P4RB 1YX5B 2YLMA 1EWCA 2L05A 2UU7A 2BYTA 3FKYA 1E90A 4D2KA 4I6PA 2K9XA 4KIKB 1EUVB 2QILA 2C5LC 3L4PA 3RNAC 1L4DB 5CX3A 3W1SC 1D6EC 1E6EB 2WWZA 2BVCA 4RM8A 2RSUA 2L76A 1ZPSA 2PTLA 2ICIA 3PLVA 4MJSA 2QIEB 2LXCA 1DOYA 3QCAA 4XZ4A 1QKZA 2BGFA 4EOYA 2EELA 4IC7B 1HZ6A 3PGEA 1XCTL 4W9LA 1V1OA 5J17A 1WJ4A 3CSTA 3ALBA 1WRIA 2HD5B 3DBLI 2HJ8A 2RGFA 5JXVA 1D4BA 3Q3NC 4C7ZA 2EMTA 2NBVB 2J53A 4XDCA 3N30A 5BMGA 4HVBA 3N3KB 2LASA 2QEJC 2OEDA 2RR9A 1Z2MA 3A1QB 2W3SA 3WAOA 1LGRA 4NAWA 2KOXA 3R2TA 5IA7A 1VZ7A 3AN1A 3GS2A 2JPHA 3PHXB 1F1HA 1MG4A 1JCKB 1I4XA 3M95A 2BWFA 3Q6BA 1ZDXA 4K81A 3OJ4B 3WAPA 4ANVA 3KUZA 3U52E 1GOZA 2IY0B 1TYGB 2LJ5A 3SHQA 3Q3OC 4G11A 1UD7A 2NCNA 1QF6A 1WMHA 1WYWB 1VR9A 2K25A 2KANA 1I4HA 2FIFA 3RNBC 2PEAA 1I42A 2DZMA 1XD3B 1JWMD 2BB6A 1WXQA 1FRRA 5FR3A 4US8A 4WJQA 3OLMD 2KQ7A 3LDZE 1F2RC 2IZVB 1GC6A 1HEZE 1GJZA 3DPDA 3IHPC 4W9FA 1SJED 4EZLA 2FAZA 1SB3C 4OVZA 2RDBC 3KVFB 4KGTA 4MH0E 1OQYA 2KC2A 2KNBA 4MSQB 4L1BA 1TZ1A 5IP4D 4LDTD 3RMKC 4HCPB 3NS8A 4HK2A 2M56B 2OOBB 3LXFA 3KUCB 2KAJA 1TKEA 1M4VA 5IN7A 2D11A 2DAFA 1E0ZA 2BKRB 1YD8U 3PLUA 3AE6B 4LCDE 2R2OA 1ZDVA 3PT2B 2VZKD 4ZYSA 2Y5CA 2XK5B 3NG0A 4P1BC 3V6EB 4RMAA 1MJDA 1SE3A 2WXRA 2D3BA 2MBEA 3TEXA 2WXQA 1XLQA 1SSNA 1IBXA 2WU5B 2NPTA 3PV1A 2AQ3B 4FXCA 2N0SB 1SE4A 2LI5A 2J0JA 3DVNU 3PO0A 4MSMB 5C23A 1KM7A 2C7MB 3EHVA 3ZO5B 5I4DA 1B9RA 3V62A 5J18A 3B1LX 2KACA 2KMAA 4F7ZA 3OJ3A 3GZNI 1QT9A 5HI1A 2M8SA 3WCQA 2WQYB 3RT3B 3TIXA 2BB5A 1PYWD 1V86A 1XT9B 4AOFA 4US9A 1H8CA 4IWOA 1GUAB 5EE0A 4DBGA 1XLNA 2WP9B 4KSKC 3P63A 4OHJA 3A4SC 3QX1A 2VH1A 2V3NA 1L6VA 3ABVB 2QMTA 1V8CA 3ZLZA 2WXOA 3R2IA 2BTEA 1IYFA 1CMXB 3DBRB 2O6VB 2JVCA 5AZHA 1FMAD 1YX6B 2GBKA 2DYBA 4M8NA 1YMHE 4M01A 1UZXB 1FNVA 5GXGB 2B3AA 2FNJB 4GOCA 3AEEB 3IAM1 2WXMA 4J3OD 2H89B 2WNMA 2D10A 1RM6C 2MRPA 1I4GA 3V05A 3BVMA 1QOBA 2M19A 5DPSA 2BWES 3ENEA 1R4NI 3P4QB 3L10B 3I63C 1XXGA 2CJOA 2MP2B 3HVDA 3U30A 1J7BA 2N1VA 3TMPB 4I6NB 3VUYA 1QOFA 4FJVB 2Z59B 1VDVA 3A33B 2L0TA 1VD2A 3Q69A 5DPRA 5BYRA 4I6LB 4BBNF 2BYFA 4MGKE 2Z0DB 3ZYYX 3T3OA 4EZJA 5KHQA 2LGYA 2A5UA 4C00A 2DWQA 1P1AA 2CHXA 1SIFA 2JZPA 2BS3B 3DBRI 2YEPF 5T8IA 3KLSX 2BYVE 1NI3A 2LHEA 4GSWA 3H8HA 3ZNID 3TBLD 3KWVA 2J42A 1YN5A 4NZLB 1PGAA 4A90A 3VVWB 2MBBB 3AE9B 1UBIA 5BMHA 4BKGA 3KWLA 1MFWA 2YVCA 3VAWA 1UH6A 5E6JA 3X23A 3VXWA 3VR8B 2L3ZA 4S0RA 3EA6A 4NQLB 1S1QB 5J2RA 5G2NA 2ZPYA 1C4CA 4L23A 5D3DA 1NBFC 2ZNVB 4BOZB 1V1PB 2PPHA 3BYYB 2MCNB 3P4PB 3NVWA 2ONQA 2JZZA 2IYDB 1C76A 1WE7A 2D3CA 2GOWA 1Q0WB 2N7DA 4IKGA 2XNAC 3PZ8A 1C79A 2W9NA 2IGGA 1FIQA 2WLBA 2GMIC 3H6NA 3OAWA 1NI2A 1V5OA 2H88B 2NTTA 3W1SA 3ZVVA 2QC8A 2HTME 2KD0A 2D5GA 3WANA 1L5PA 4DHJB 3QAQA 4E74A 1FRDA 4PYUA 1K51A 4AWJA 4MACA 4RF1A 2YEPB 2CU3A 2WHIA 3AE5B 2I2YA 3NVYA 3PPAA 1FM0D 5FK9C 3CMMB 3LB8C 4MJSB 2KMMA 1WGHA 1TY2A 3L0WB 1SF0A 2MX2A 3RULA 1TKYA 2ZW1A 2K8CA 4C7YA 2XN9C 4HWIB 2NBUA 2K8BA 3Q3JA 2FCQA 2D2QA 5BO4B 3ZNZB 5L83A 2GBJA 2PVOD 1V80A 2WXGA 4YL8A 4ZRIA 1GG3A 5G5HA 4GDLB 4ASWC 1WGGA 4HJKA 2N9LA 5KHOA 2SEBD 1AN8A 2NR2A 4W9HA 2L8JA 4EKUA 4S17A 1NYQA 1P0RA 2K5PA 3APFA 3IBEA 1PGBA 4HPLB 1ZUD2 3HIZA 1C77A 1HTOA 3ML8A 3JW0X 4HPMB 4HJGE 1F2RI 4WQMA 4KSLC 1HQRD 2LRUA 2VRRB 3LJ3A 1EO6A 2FCMA 2JX5A 2ZVOA 3X0WA 1WH3A 1WYGA 4AP4C 3AULA 4K3BA 2G4DB 2Y5BB 2O6VD 3RI7C 5HFYA 1UWMA 3W5VB 3RCZA 2FCSA 3VTVA 3Q14C 3DBLB 4HROA 5MPOA 1V1PA 2M0XA 2MA9B 1PDXA 1WXSA 3V60A 1WGDA 2C7HA 1WMHB 4OVVA 4OVUA 3H7PB 2BBCA 4N59A 1JALA 3GP7A 1ZXIA 3AMZA 3GOEA 2FE8A 1Q10A 2MEKA 4RNAA 2K8HA 2QDFA 1KLGD 2BKFA 2FCNA 1L0YB 1J19A 2PMVA 4DWFA 4ZOHC 4NJ6A 4H2AA 3PVLA 5EE9A 5H92C 4HDOA 3KUDB 4WAAA 2C9WB 4FN2A 4IWQA 1FXAA 2LD9A 4B95A 2N7JA 3FAHA 3AEFB 1XCQL 3MJWA 3AV8A 2IGHA 5D3IB 2FIDA 4LNNA 3QIJA 3HHMA 4F8CB 2PE6B 4JGHB 1UBQA 2Y5PA 2LHDA 4IM2A 5BMIA 3P2BA 2LMCA 4IM0A 2KN4A 3AE3B 5C2TB 1D5XC 3P4SB 1SE2A 1KLUD 3L13A 4GDLA 1Z5SB 2WXJA 5C1ZA 1HE8A 1YIWA 3IT4B 2JRIB 1DOXA 4WWOA 4LNKA 5E6NA 2KX0A 4GDKA 4ICVA 1WSPA 1MG8A 1IBXB 2NPTB 4HCNB 5JHBA 4AS1A 1VJKA 3ML9A 2B76B 4WQOB 5L95C 1V9JA 5FKAC 3RYTA 4XDDA 4XX5A 5LXIB 5LXHA 2SAKA 2AWTA 4DQOC 1XO3A 3SR6A 2Z0EB 3UGBB 5AEKB 3E56A 3PREA 1CK1A 3H1UA 2CJNA 3VFKA 4AUQC 2X38A 5CTRC 5D94A 5JH5C 3WA0A 4JQWC 3DHGC 4GXBA 3RNEC 2WXNA 3C19A 2JT4B 3AI5A 2KLGA 3AB5A 3BVGA 2IO0B 3VHTC 3QK0A 4RCOA 4W9DA 2V3PA 2WXLA 3GE3C 5D2MB 3H7PA 3QJZA 2JSVX 4TV3A 3TUOA 1D3ZA 2LVOA 4A6QA 3C8YA 4ARCA 3ZRCA 3T3NA 3WIMA 4G50A 4FHKA 2MH7A 4YWGG 2HDEA 2L32A 3VH4B 1J7AA 4ANXA 4YXDB 1TTNA 3R3MA 3GZNB 1K50A 5BYQA 2AYOB 1WGRA 3R7QA 2BQQA 2I1JA 2MW5A 4YSZB 1DYQA 2KMCA 2VH2A 1KH0A 2R2QA 4E71A 4A9AA 2FBWB 4RM9A 1AYFA 2ASQA 2IO2B 1P7FA 2KXJA 2IGDA 2WX0A 1TS4A 2KYWA 3NOBA 4RH6A 2W3RA 1R4MB 1KFYB 4PS3A 3ZDTA 3HK0A 1N5XA 3DQVA 3EGRA 1EF1A 1ET6A 1E9MA 1E7VA 2G1EA 2INPE 2TSSA 1GC7A 4MM3A 3S2AA 1WZ3A 2NMQA 4MELA 3DWGC 2NVUI 4AJWA 1XQQA 4BKTA 2KWDA 2PVGC 3TCAA 4IUMB 1P98A 2KWUB 3J9CA 1F9JA 5EE3A 3VR9B 2BT6A 2CS4A 2JF5A 3PSEB 2JXXA 1T6BX 5CHVC 4ZRJA 4USAA 3AU4A 2BS4B 3A9JA 1XLOA 2LGDA 3T9LA 3B0AA 4KDIC 5DPTA 4RGNA 4ICUA 2LFIA 5E6OA 2JU6X 4Q2JA 4BZAA 3B08A 4YSXB 3ZQ4A 2A4ZA 2CR5A 3VQIA 3PRPB 1R4NB 2GBNA 3NHEB 4WIPA 1WM2A 1ZGUB 3UQBA 1T5XD 1OTRB 1ZW7A 2KKCA 3KYDD 2MJEA 1VZ8A 4YT0B 4XWTA 1L0VB 4KX6B 3R7RA 2NS5A 3PRMB 5LNK1 4TKNA 1KRHA 2RMMA 3V3XA 3D32A 1RFAA 2RD0A 1ROEA 1UELA 4NY0A 1R4MI 4KDLB 2DAJA 4W9JA 4YTMB 3Q3MC 1GB1A 4FBJB 3EC8A 4G3XB 1I4QA 3ZNGC 5IOIA 3NUHB 1TS3A 1JQ4A 2LXAA 4A20A 2JY6A 1G6JA 1IP9A 2XBBC 4KGSA 1JRUA 1JW9D 2DHZA 2KVZA 3DCGA 4TQ1A 2LWPA 2MLBA 4K7WA 2DBYA 2BYEA 4JLCA 1NEKB 1V6EA 3Q8FA 4KVGB 4ZHOA 2M4NA 2KDFB 2V9HA 3UIOB 5CHFA 1WRDB 3N32A 2JZ3B 1QOGA 3AE4B 4HLEA 4QAYA 4B6WA 1ESFA 3TEYA 4OZCA 4ANWA 1JRPA 4P16A 4LJPB 4FULA 4K3CA 3ZJUA 3DHIC 2JWZA 1MHHE 4ZRQA 1LXDA 1I7HA 4ANUA 2J7QB 3A9KA 3DOWA 4E3CA 5JHAA 4J6IA 2K6QA 4PS7A 3MHSD 1UUPA 4PT5A 1IUEA 2CHWA 3R8BA 3UIPB 3BIID 3ZDMC 1YJIA 3BK2A 1E8WA 3MC0B 1PQSA 2GLSA 3JSVB 2CKHB 3EECA 4WURA 3O13A 1LO5D 4KGRA 4PK1A 2CU1A 1WGKA 1KLVA 1QLBB 2J52A 4TQ0A 2W82A 4GIVA 1C78A 3K9OB 4FA6A 2LEKA 1LM8B 1WR6E 2V0GA 3BVZA 4RGOS 3K9PB 1I35A 2MHJA 1E8ZA 3TEZA 4GN1A 4ZDVA 1T0SC 1FO4A 2KDIA 1C4AA 3PZDA 3VRAB 2L00B 5E6PA 4LTUA 2K3UA 4URKA 3ETRA 2WDTB 1P7EA 4JE3B 4RF0A 4M0WA 2DYMA 1XEEA 5D6JB 4EZKA 3EFUA 5C3JB 4MGZE 1VLBA 3IG3A 1E7UA 1BMLC 5IAAC 2DX5B 4NAMA 3RNGC 1XLPA 3UI3A 2DZKA 2Y3AA 1L2NA 1BUIC 2KDMA 1U4AA 3M3JA 2L83A 3SEBA 4REZA 2MJ3A 4W9KA 1NVID 2REXA 3AE1B 3BWUD 3AEDB 1YJ1A 1IPGA 1YJJA 2K22A 5AUIA 1WI0A 2W54A 3L54A 2K0PA 4LNOA 4XWWA 5AUKA 4GLSC 3IT6B 4BFRA 3KQ4A 3SD5A 2GRIA 2I38A 3W5UB 2X8XX 3W9CB 1JWBD 4KZCA 3ECIA 2KLCA 2KJ6A 4P1CC 5GMVA 1V49A 3OG5A 4FHJA 2LUEA 3ZGZA 2DLBA 3N9YC 2ACZB 2LZ6A 3JSVA 2IBIB 2C60A 4LDTB 1WIAA 3HUIA 4WWPA 4GDKB 1SJHD 3B2FA 2GBMA 3JYUA 1KOTA 4ZRKA 2WU2B 3IVFA 2RPQA 3I57A 1XF5L 5IO9A 2CHZA 2PW9A 4DXFA 2WDVB 2KDBA 1T0YA 4MDKE 3MP9A 2ZW0A 3I3TB 2VZKB 1RWSA 1VCBA 2KQ4X 3VH3B 4YTNB 3M63B 3ZTCA 3IAS1 2MWSB 3PRZA 2WXIA 1WXMA 2LUMA 1WF9A 1SBBB 1X1MA 4RGMA 2RPVA 1FPYA 2LJIA 5IKCM 2KO3A 4W9EA 1VRAB 1WX7A 4P6VF 2E3TA 1WE6A 1AW7A 1T0QC 2AQ2B 3PHWB 1C3TA 1WZ0A 3MTNB 4OZBA 4KZ0A 4B0MA 2ZCCA 1C1YB 3GE8C 1UNSA 2HTHA 2KZRA 1EF5A 2UWQA 3AE7B 4LK0M 3W2DA 2UYZB 4BKSD 3M62B 2KT7A 2IDYA 3QC8B 4M8MA 1CZPA 2BPSA 1UGJA 1L6UA 2MSED 4YTPB 4DHZB 1UGMA 4XYCA 3VTUA 4HXDA 3FILA 4LNIA 3AE2B 3WALA 1Y56A 4MGIE 1V2YA 2ZCBA 4HEA1 1TS2A 1HXYD 2LGSA 3SFDB 1ISNA 4HDQA 1EU4A 1E8XA 4KKIA 1KJTA 3V6CB 4XGAB 3NZSA 5G5GA 2MBHA 2N7EA 4XE0A 3VRBB 3AECB 1N5WA 3DDCB 1YQ3B 2KJRA 3AE8B 1F0ZA 3BYTB 3N1YC 1WFYA 4EE2A 2N9KA 4MM3B 3R66C 2LVQA 2PE9A 4B9KA 2AL6A 1PGXA 1NYRA 3LYYA 4BVUC 1ET9A 3UQAA 3Q8AA 1YN3A 4ZRPA 3N1ZC 5HHDG 3ZW3A 4ARIA 3ZRFA 2KJHB 5H8YE 1MI0A 4HRSA 2O2VB 2WXKA 4P7IA 3DBHI 3A9JB 4WAFA 3BZDB 3RNCC 4LNFA 4DDGD 2MBOA 1K52A 1ZXHA 3L17A 4BAXA 1FCCC 1Q5WB 2KFKA 2QHOA 5EDSA 4IOIE 5JZEB 4JIOU 2RDHA 3RZFA 3ZUNA 2Z8LA 4O1NA 1FFUA 4JL9A 1FFVA 4A8XC 1HTQA 1TBEA 1QILA 2K6DB 2KDEB 2L0FA 2KTRA 4FJYA 4C4VB 4DHJD 1SIJA 2LVPA 4M00A 3QA8A 1J8CA 1WM3A 1JWSD 1N62A 4HKZE 1A70A 4RGTA 1OQRA 4MEMA 2W55A 1OFFA 2KWVB 3MFGA 1VZ6A 3Q8CA 4N58A 1ZKHA 1I4RA 2ZNVC 4ZHPA 1GB4A 3NVVA 1C4PA 3Q8EA 2WDRB 3EFCA 3ZXVA 4KIKA 3AEAB 3IXSA 2KTFA 1MPEA 2LGIA 3MJ5A 1EU3A 4L2YA 2KC1A 4BBNC 3DWMA 2L52A 3U8ZA 1WJ6A 2JUOA 3DVGX 3U7DA 1TT5B 2V4IB 3QARA 2KHWB 3RPFC 3HRDD 3N20C 3O65B 3Q8BA 3BY4B 2E6XA 4WWNA 2ZPNA 2D3AA 1FEHA 3NZ3A 3I5JC 4WWMA 3DBSA 1K53A 4NPNA 2IY1B 2C7NB 3AEGB 3UINB 2INCC 2DYOA 1V97A 3URYA 2MQJA 2HJ1A 4OZAA 3CSFA 4NQKE 2ON8A 1TGZB 3HM6X 3SU8X 4F1SA 2MBQA 3A9KB 2DENB 2JYTA 2BF8B 1V81A 4AQ7A 1H4RA 1JWAD 2O2VA 4CHKA 4IWPA 4HKQA 1D5MC 2QSDA 4B0EA 1F52A 2OHFA 1JROA 3L16A 2I1KA 2XEWA 4R3DA 1EWYC 3CF6E 1PFDA 4K1RB 4EUTA 4UDUC 3TL5A 2FUG1 2PLPA 4MT5A 2HE7A 4PS8A 3A1QA 2DZJA 3AXCA 4WJNA 1P9DU 1T3QA 3ZKJC 1RFKA 1WGYA 3NY5A 2JXTA 5D7GA 1N60A 3B9JA 3UF8A 3RNFC 2V3SA 2WXPA 4C4VA 2QJLA 1JWUD 3IFWB 1NDDA 3DHHC 4M0WB 1FNWA 3ZNHB 2KN5A 1MVKA 4W9GA 4MH8A 1E5WA 1GNUA 4IDIA 4TUUA 3AU5A 3GB1A 4II2B 4ACFA 2N4FA 2NTSA 1N6ZA 1WJNA 4G0NB 1UF0A 3W1YA 1GAQB 3JVZX 1Y8RC 3ZJTA 4EEWA 4A55A 1GPXA 2ZJDA 4CQNA 2WS3B 1M94A 3H9DA 2KQSA 4JPSA 1TJEA 1TS5A 4DDID 1E10A 2N9PC 3ZJVA 3PTFC 3NVZA 2INDC 1AWDA 1RLFA 2KFJA 1OEYJ 1L0XB 3I9V1 1STEA 2AEHA 3DVGY 1RYJA 4HPPA 1PUTA 2G45B 4M02A 1N61A 5FR6A 1J0GA 3DVNV 3ZTDA 1OGWA 1FD6A 2KK8A 1CJEA 2N9EB 1Q1OA 1IGDA 3B2GA 3P42A 5HG2A 1LFDA 1QZEA 1TZOA 1NENB 4MGYE 1RAXA 3V61A 1YQ4B 3T8MA 1FNUA 4N9F4 2R61A 1ZOYB 2GI9A 3NZUA 1SEBD 3NRZA 2XK5A 4K7SA 2JQRB 1P3QU 2IPKD 3N1XC 4W9IA 3AEBB 2K1FA 1K8RB 3RFZB 1S3SG 1BT0A 2L7RA 1WJUA 2NBWB 3C0RB 3QQ8B 2G3QB 2WDQB 2EMSA 4JX1C 2EKIA 3BK1A 1E8YA 2GB1A 1QOAA 1J7CA 5LLIA 5BYSA 1WR1A 4WJOA 2OJWA 1B1ZA 1SGHA 3TJPA 1DGJA 1BXTA 4GB9A 4LJOB 1KF6B 1V5TA 3P1MA 3VUXA 3QWZB 3HM3A 1E7PB 1L7YA 2J0MA 1SE9A 4IM3A 2BW2A 2D3GA 4TSSA 2OJRA 3OWEB 4NJCA 4IG7B 5CHWA 2RDGA 2KVRA 1YNTE 3SFEB 4LLGM 1IGCA 2ZVNA 2G4SA 4FLHA 2ZZPB 2LGXA 3ZIMA 3A4RA 3AH7A 1I4PA 3ZXRA 1OQQA 4DXAB 2PKOA 2JRHA 3RZWC 2WX1A 3RUIB 4KV2A 2DZIA 3RN9C 1ZE3D 2PJHA 4ITKA 1RRBA 5TR5A 4BOSC 1D5ZC 1UWXA 3BINA 4EFOA 1TY0A 2JYEA 4OW0A 3CIRB 3MC8A 4GMVA 2WYQA 4II3B 4RFBA 4FADA 4YSYB 1FCLA 2AL3A 2O6VA 3APDA 2V4LA 3WAMA 2EKEC 1LQBA 2LRWA 3U4EG 3U2SC 1R7SA 3FILB 1WXAA 3VDZA 4NNJB 2M1MA 1TKGA 3CWIA 4C56C 3MHZA 5G55A 2PIAA 3EUB2 1YN4A 4WJPA 1JMLA 1T0RC 3RD2A 4KKJA 4IW0A 4PYZA 4DXGA 1WY8A 4BKSA 2V1YA 3SDLC 1HA5A 3KH0A 2GBRA 2MP2A 3VUWA 2G9HD 4N6EB 2BS2B 1CQVA 4GGQA 2WXHA 4W9CA 4TMAB 4X57B 4NJ7A 3QHTA 5TSSA 4JWSC 4CO7A 3E9SA 3Q2AC 1AARA 1ACCA 4A3OA 3KW5B 2N9XA 1EM7A 1FXTB 1OEYA 2FUHB 2QCZA 1F77A 2J4XA 1L4ZB 2M0AA 3APCA 5HKHA 1TIFA 3Q3FA 1WX9A 4DK5A 3U7ZA 3AM9A 2M17A 2AX5A
chains in the Genus database with same CATH topology
5T8IA 1ZXHA 2YEPF 2MJDA 3KLSX 3PZ7A 1C9FA 1NI3A 5EE1A 2LHEA 4WH4A 3VQIA 1FCCC 2L1AA 3H8HA 3TSSA 4WIPA 4IOIE 3NS1A 1T5XD 3KWVA 2J42A 1YN5A 2MJEA 1VZ8A 2RDHA 3TEWA 1HZ5A 4NZLB 4YT0B 2Z8LA 4XWTA 1L0VB 4NAWB 4KX6B 1PGAA 4A90A 2JWUA 4O1NA 1FFUA 3AE9B 5LNK1 5BMHA 1FFVA 1KRHA 4A8XC 2RMMA 1MHXA 3KWLA 1QILA 3V3XA 1ROEA 1SIJA 1DOIA 5E6JA 1SXTA 2AQ1B 3VR8B 1FXIA 3EA6A 4YTMB 1JWSD 3HVZA 1N62A 4JWUC 1C4CA 1A70A 4HKZE 4RGTA 1GB1A 1OQRA 4L23A 1ZP0B 2W55A 1OFFA 5D3DA 1N63A 3MFGA 1V1PB 3BYYB 3P4PB 1I4QA 3NVWA 1VZ6A 2IJ0A 3Q8CA 2ONQA 2INNE 4N58A 2Q5WD 1I4RA 3NUHB 4C80A 1TS3A 1C76A 4ZHPA 1JQ4A 1ENFA 1WWTA 1KTKA 4KGSA 4IKGA 2XNAC 1C4PA 2WXFA 1C79A 3NVVA 3PZ8A 3Q8EA 3FC4A 1GB4A 1QQRA 3P4RB 1JW9D 2IGGA 2WDRB 1EWCA 2BYTA 1FIQA 2WLBA 3AEAB 4TQ1A 3IXSA 4D2KA 2K9XA 2H88B 2NTTA 3W1SA 1MPEA 2LGIA 3MJ5A 1EU3A 4L2YA 2HTME 2DBYA 2D5GA 1L5PA 3DWMA 1NEKB 2L52A 2QILA 3L4PA 1FRDA 1L4DB 3Q8FA 4ZHOA 1D6EC 1K51A 4MACA 1E6EB 4RF1A 2YEPB 2V4IB 2CU3A 3RPFC 3HRDD 3AE5B 3Q8BA 2I2YA 1ZPSA 3NVYA 2PTLA 2E6XA 1QOGA 3AE4B 1FM0D 2ICIA 5FK9C 2QIEB 1DOYA 3LB8C 1ESFA 1FEHA 3NZ3A 4WWMA 3TEYA 2KMMA 1K53A 1QKZA 4OZCA 1JRPA 1TY2A 1SF0A 2EELA 1HZ6A 1TKYA 2ZW1A 4P16A 3ZJUA 3AEGB 1XCTL 4C7YA 2XN9C 2DYOA 1V97A 3URYA 1MHHE 1V1OA 4OZAA 2ON8A 4ZRQA 1I7HA 2PVOD 1WRIA 2WXGA 2JYTA 1UUPA 4PT5A 1IUEA 5G5HA 4AQ7A 1JWAD 4GDLB 4HKQA 3R8BA 1D5MC 2QSDA 5JXVA 1D4BA 3BIID 1YJIA 3BK2A 4B0EA 3MC0B 2OHFA 1JROA 2N9LA 4WURA 3O13A 2SEBD 1LO5D 4C7ZA 1AN8A 4KGRA 4R3DA 1EWYC 2J53A 1WGKA 1QLBB 4XDCA 1PFDA 2J52A 4TQ0A 2W82A 1NYQA 4UDUC 1C78A 5BMGA 2K5PA 1PGBA 2LEKA 1ZUD2 2FUG1 2PLPA 1C77A 4MT5A 2V0GA 3BVZA 4HJGE 1F2RI 4RGOS 2QEJC 2OEDA 1T3QA 4WQMA 2W3SA 3TEZA 1RFKA 1HQRD 3R2TA 2JXTA 5D7GA 1VZ7A 2JX5A 1N60A 3AN1A 1FO4A 3GS2A 3B9JA 1C4AA 1WYGA 3VRAB 2WXPA 1JCKB 4LTUA 2K3UA 2QJLA 3ETRA 1I4XA 1P7EA 1JWUD 4JE3B 1ZDXA 4RF0A 4M0WA 5HFYA 1UWMA 2DYMA 1XEEA 3W5VB 1FNWA 5C3JB 1VLBA 3U52E 1GOZA 1MVKA 4MH8A 1TYGB 4HROA 5MPOA 1V1PA 1PDXA 4IDIA 3GB1A 2NTSA 1BMLC 1QF6A 1VR9A 4NAMA 1XLPA 3UI3A 1I4HA 2BBCA 1GAQB 2Y3AA 4N59A 1BUIC 2KDMA 1JALA 3GP7A 1ZXIA 3ZJTA 1JWMD 2BB6A 3AMZA 4A55A 1GPXA 2FE8A 1Q10A 2L83A 4CQNA 3SEBA 1WXQA 2MEKA 2WS3B 4REZA 2MJ3A 4RNAA 1FRRA 5FR3A 4US8A 1NVID 1KLGD 4JPSA 1TJEA 3AE1B 3BWUD 3AEDB 1F2RC 1TS5A 1L0YB 2PMVA 1HEZE 1E10A 1SJED 3ZJVA 4ZOHC 3NVZA 1AWDA 1SB3C 4H2AA 1YJJA 2K22A 4OVZA 1L0XB 5EE9A 4KGTA 5AUIA 3I9V1 1STEA 5H92C 2W54A 4L1BA 1RYJA 1PUTA 1FXAA 1N61A 2K0PA 1FD6A 2N7JA 1CJEA 2M56B 3FAHA 1IGDA 3B2GA 3P42A 5HG2A 3AEFB 3LXFA 4XWWA 5AUKA 1XCQL 2KAJA 1TKEA 1M4VA 3AV8A 2IGHA 4GLSC 3IT6B 5D3IB 1TZOA 1E0ZA 3KQ4A 1NENB 2GRIA 1YQ4B 1FNUA 2I38A 3W5UB 2R61A 2Y5PA 2LHDA 3AE6B 1ZOYB 2GI9A 3W9CB 1JWBD 1ZDVA 2VZKD 4ZYSA 1SEBD 2Y5CA 3NRZA 2LMCA 5BMIA 2KN4A 2JQRB 3AE3B 2IPKD 5C2TB 1D5XC 3AEBB 3P4SB 3RFZB 1SE2A 1KLUD 1SE3A 2WXJA 2WXRA 3ZGZA 2DLBA 3N9YC 2ACZB 2WDQB 3IT4B 4JX1C 1DOXA 3TEXA 2EKIA 2WXQA 1XLQA 3BK1A 2GB1A 1SSNA 1IBXA 2WU5B 1QOAA 1J7CA 1WSPA 3HUIA 1IBXB 4GDKB 2AQ3B 4FXCA 5BYSA 1SJHD 3B2FA 2N0SB 2WU2B 1B1ZA 1SE4A 3I57A 1XF5L 4AS1A 1DGJA 1BXTA 1VJKA 3PO0A 1KF6B 2PW9A 4DXFA 2B76B 2WDVB 3P1MA 3MP9A 5FKAC 2ZW0A 1E7PB 4XDDA 2VZKB 5I4DA 1B9RA 2SAKA 1RWSA 3ZQ4A 2KQ4X 4YTNB 2BW2A 2KACA 4TSSA 3IAS1 4DQOC 2WXIA 1XO3A 3SR6A 2LUMA 1SBBB 3E56A 1CK1A 1QT9A 5HI1A 3OWEB 4NJCA 4RGMA 2CJNA 2RPVA 2X38A 2RDGA 2LJIA 1YNTE 3SFEB 4LLGM 3WCQA 1IGCA 2WQYB 2BB5A 1PYWD 1VRAB 4P6VF 2E3TA 2WXNA 1AW7A 4US9A 2AQ2B 3AB5A 3BVGA 5EE0A 4RCOA 4OZBA 3AH7A 2V3PA 1XLNA 2WXLA 2WP9B 1I4PA 1OQQA 3P63A 2PKOA 4OHJA 2JSVX 4B0MA 3TUOA 4A6QA 1ZE3D 3C8YA 2V3NA 4ITKA 1L6VA 1UNSA 3ABVB 1D5ZC 1UWXA 1TY0A 2JYEA 4OW0A 4ARCA 2QMTA 3CIRB 3AE7B 4LK0M 3T3NA 1V8CA 4RFBA 3W2DA 4YSYB 2MH7A 2WXOA 4YWGG 2HDEA 3R2IA 1FCLA 2IDYA 2BTEA 2L32A 1J7AA 1CZPA 1UGJA 1L6UA 4YTPB 4YXDB 1FMAD 3U4EG 3FILA 3U2SC 3AE2B 1R7SA 3FILB 1Y56A 1YMHE 1FNVA 4HEA1 1TS2A 5GXGB 1K50A 5BYQA 1HXYD 3AEEB 4YSZB 3IAM1 1DYQA 3SFDB 2WXMA 1KH0A 4J3OD 1EU4A 2H89B 1TKGA 2WNMA 4KKIA 3CWIA 4A9AA 1RM6C 4C56C 2FBWB 3MHZA 1AYFA 1I4GA 2PIAA 1P7FA 3EUB2 5G5GA 2IGDA 3V05A 1TS4A 1YN4A 3BVMA 4RH6A 1QOBA 4XE0A 3VRBB 2W3RA 1JMLA 1KFYB 3AECB 2M19A 4KKJA 1N5WA 4DXGA 1N5XA 1YQ3B 3EGRA 1ET6A 3P4QB 1E9MA 3AE8B 1HA5A 1F0ZA 3BYTB 2G1EA 1XXGA 2G9HD 2CJOA 3HVDA 4N6EB 2INPE 1J7BA 2TSSA 2BS2B 4EE2A 1CQVA 2N9KA 4MM3B 2WXHA 2NMQA 3DWGC 4TMAB 2KWDA 2PVGC 5TSSA 1QOFA 4JWSC 3J9CA 1PGXA 1NYRA 1VDVA 3E9SA 1ET9A 3LYYA 5EE3A 3VR9B 2BT6A 1ACCA 3Q8AA 1YN3A 4ZRPA 5HHDG 1EM7A 3Q69A 5BYRA 4ARIA 1T6BX 3ZYYX 3T3OA 4USAA 5H8YE 1MI0A 4HRSA 2BS4B 2WXKA 1XLOA 1F77A 2DWQA 2J4XA 4WAFA 1L4ZB 2M0AA 3BZDB 4RGNA 2JZPA 2LFIA 2BS3B 2JU6X 3U7ZA 3AM9A 4Q2JA 4YSXB 2AX5A 1K52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SB3 C;  1V97 A;  2WP9 B;  1OQQ A;  1YJJ A;  2K22 A;  2MJD A;  2PKO A;  1NI3 A;  3P63 A;  5EE1 A;  5EE9 A;  5AUI A;  5H92 C;  2W54 A;  1I7H A;  1RYJ A;  1PUT A;  2PVO D;  1FXA A;  1N61 A;  4ITK A;  1L6V A;  1WRI A;  3ABV B;  3NS1 A;  1IUE A;  1CJE A;  2M56 B;  2MJE A;  3CIR B;  3FAH A;  1JWA D;  3AE7 B;  3B2G A;  5G5H A;  3AEF B;  3LXF A;  1V8C A;  4YT0 B;  5AUK A;  1L0V B;  2KAJ A;  1TKE A;  2MH7 A;  3AV8 A;  4KX6 B;  4YSY B;  3BII D;  1YJI A;  1FFU A;  3AE9 B;  1E0Z A;  2OHF A;  1JRO A;  1FFV A;  1J7A A;  1NEN B;  1KRH A;  4C7Z A;  3KWL A;  1YQ4 B;  1CZP A;  3W5U B;  1EWY C;  3W9C B;  3AE6 B;  1ZOY B;  1WGK A;  1L6U A;  1JWB D;  1QLB B;  4YTP B;  1ROE A;  1FMA D;  1SIJ A;  2Y5C A;  1PFD A;  1DOI A;  3NRZ A;  4YXD B;  3AE2 B;  1NYQ A;  1R7S A;  2JQR B;  3AE3 B;  2K5P A;  5C2T B;  3AEB B;  3P4S B;  5GXG B;  2LEK A;  1ZUD 2;  3VR8 B;  1FXI A;  3AEE B;  4YSZ B;  4YTM B;  3HVZ A;  1N62 A;  3SFD B;  4JWU C;  1A70 A;  1T3Q A;  4WQM A;  2H89 B;  1OQR A;  1TKG A;  1ZP0 B;  1RFK A;  1OFF A;  2W3S A;  1RM6 C;  2W55 A;  2FBW B;  3CWI A;  4A9A A;  1AYF A;  1N63 A;  1DOX A;  2ACZ B;  2WDQ B;  2JX5 A;  3P4P B;  1N60 A;  3AN1 A;  2PIA A;  3NVW A;  3EUB 2;  2EKI A;  3B9J A;  4JX1 C;  1FO4 A;  5G5G A;  1XLQ A;  1WYG A;  3VRA B;  4N58 A;  2Q5W D;  4LTU A;  4C80 A;  3VRB B;  1QOB A;  1QOA A;  2WU5 B;  2W3R A;  4ZHP A;  1J7C A;  2QJL A;  3ETR A;  3HUI A;  1JQ4 A;  1KFY B;  4FXC A;  1WWT A;  3AEC B;  2M19 A;  3B2F A;  1N5W A;  2N0S B;  1N5X A;  2WU2 B;  1YQ3 B;  3NVV A;  3FC4 A;  3P4Q B;  4C7Y A;  1UWM A;  3P4R B;  1JW9 D;  1E9M A;  3AE8 B;  3W5V B;  1DGJ A;  2WDR B;  1VJK A;  3PO0 A;  1F0Z A;  2G1E A;  1FIQ A;  2WLB A;  1KF6 B;  1VLB A;  2CJO A;  3AEA B;  5C3J B;  2B76 B;  2K9X A;  2WDV B;  1J7B A;  2H88 B;  2BS2 B;  3P1M A;  4N6E B;  1TYG B;  4HRO A;  2HTM E;  2DBY A;  5MPO A;  1E7P B;  1L5P A;  1PDX A;  3DWG C;  1NEK B;  2L52 A;  3DWM A;  1B9R A;  4IDI A;  3L4P A;  1FRD A;  1RWS A;  4ZHO A;  2PVG C;  1QF6 A;  1QOF A;  4YTN B;  4JWS C;  1E6E B;  1NYR A;  1XLP A;  1VDV A;  5EE3 A;  1XO3 A;  3VR9 B;  2BT6 A;  2CU3 A;  3SR6 A;  1GAQ B;  3HRD D;  3AE5 B;  3RPF C;  4N59 A;  1QT9 A;  1JAL A;  3NVY A;  1ZXI A;  2CJN A;  1QOG A;  3AE4 B;  3AMZ A;  1GPX A;  1FM0 D;  3ZYY X;  2L83 A;  1DOY A;  2QIE B;  4USA A;  1WXQ A;  2WS3 B;  5H8Y E;  3LB8 C;  4HRS A;  2MJ3 A;  3SFE B;  1FRR A;  3WCQ A;  4US8 A;  1NVI D;  2BS4 B;  4WWM A;  2WQY B;  2KMM A;  1TJE A;  3AE1 B;  1XLO A;  4P6V F;  1JRP A;  2DWQ A;  3AED B;  2E3T A;  1SF0 A;  4US9 A;  1E10 A;  1TKY A;  2BS3 B;  3AB5 A;  3AEG B;  3AM9 A;  4ZOH C;  5EE0 A;  3NVZ A;  3AH7 A;  4YSX B;  2AX5 A;  1AWD A;  1XLN A; 
#chains in the Genus database with same CATH topology
 5AZG A;  3PZ7 A;  1C9F A;  2MJD A;  5EE1 A;  4FJZ A;  4WH4 A;  5AZF A;  2L1A A;  3TSS A;  1A5R A;  2N1W A;  2KFK B;  2IO1 B;  3NJT A;  2J0K A;  5DPW A;  3NS1 A;  2KX3 A;  4DHZ E;  4CYE A;  3PS6 A;  1HZ5 A;  2IO3 B;  3TEW A;  4NAW B;  2JWU A;  3L08 A;  1MHX A;  4AJY B;  1YOV B;  2ZEQ A;  2KWC A;  2KTR B;  1DOI A;  3MC9 A;  1SXT A;  2AQ1 B;  4ZYN A;  1FXI A;  4GU2 A;  3H7S A;  2WGS A;  3HVZ A;  4JWU C;  1YQB A;  2K39 A;  3DBH B;  1ZP0 B;  1N63 A;  2IJ0 A;  4A3P A;  3VTW A;  2INN E;  5DCN A;  2Q5W D;  4C80 A;  3ONS A;  1ENF A;  1WXV A;  1WWT A;  1KTK A;  4XC2 A;  4K7U A;  2DNF A;  1WX8 A;  2WXF A;  3KYC D;  2D07 B;  3FC4 A;  1QQR A;  3P4R B;  1YX5 B;  2YLM A;  1EWC A;  2L05 A;  2UU7 A;  2BYT A;  3FKY A;  1E90 A;  4D2K A;  4I6P A;  2K9X A;  4KIK B;  1EUV B;  2QIL A;  2C5L C;  3L4P A;  3RNA C;  1L4D B;  5CX3 A;  3W1S C;  1D6E C;  1E6E B;  2WWZ A;  2BVC A;  4RM8 A;  2RSU A;  2L76 A;  1ZPS A;  2PTL A;  2ICI A;  3PLV A;  4MJS A;  2QIE B;  2LXC A;  1DOY A;  3QCA A;  4XZ4 A;  1QKZ A;  2BGF A;  4EOY A;  2EEL A;  4IC7 B;  1HZ6 A;  3PGE A;  1XCT L;  4W9L A;  1V1O A;  5J17 A;  1WJ4 A;  3CST A;  3ALB A;  1WRI A;  2HD5 B;  3DBL I;  2HJ8 A;  2RGF A;  5JXV A;  1D4B A;  3Q3N C;  4C7Z A;  2EMT A;  2NBV B;  2J53 A;  4XDC A;  3N30 A;  5BMG A;  4HVB A;  3N3K B;  2LAS A;  2QEJ C;  2OED A;  2RR9 A;  1Z2M A;  3A1Q B;  2W3S A;  3WAO A;  1LGR A;  4NAW A;  2KOX A;  3R2T A;  5IA7 A;  1VZ7 A;  3AN1 A;  3GS2 A;  2JPH A;  3PHX B;  1F1H A;  1MG4 A;  1JCK B;  1I4X A;  3M95 A;  2BWF A;  3Q6B A;  1ZDX A;  4K81 A;  3OJ4 B;  3WAP A;  4ANV A;  3KUZ A;  3U52 E;  1GOZ A;  2IY0 B;  1TYG B;  2LJ5 A;  3SHQ A;  3Q3O C;  4G11 A;  1UD7 A;  2NCN A;  1QF6 A;  1WMH A;  1WYW B;  1VR9 A;  2K25 A;  2KAN A;  1I4H A;  2FIF A;  3RNB C;  2PEA A;  1I42 A;  2DZM A;  1XD3 B;  1JWM D;  2BB6 A;  1WXQ A;  1FRR A;  5FR3 A;  4US8 A;  4WJQ A;  3OLM D;  2KQ7 A;  3LDZ E;  1F2R C;  2IZV B;  1GC6 A;  1HEZ E;  1GJZ A;  3DPD A;  3IHP C;  4W9F A;  1SJE D;  4EZL A;  2FAZ A;  1SB3 C;  4OVZ A;  2RDB C;  3KVF B;  4KGT A;  4MH0 E;  1OQY A;  2KC2 A;  2KNB A;  4MSQ B;  4L1B A;  1TZ1 A;  5IP4 D;  4LDT D;  3RMK C;  4HCP B;  3NS8 A;  4HK2 A;  2M56 B;  2OOB B;  3LXF A;  3KUC B;  2KAJ A;  1TKE A;  1M4V A;  5IN7 A;  2D11 A;  2DAF A;  1E0Z A;  2BKR B;  1YD8 U;  3PLU A;  3AE6 B;  4LCD E;  2R2O A;  1ZDV A;  3PT2 B;  2VZK D;  4ZYS A;  2Y5C A;  2XK5 B;  3NG0 A;  4P1B C;  3V6E B;  4RMA A;  1MJD A;  1SE3 A;  2WXR A;  2D3B A;  2MBE A;  3TEX A;  2WXQ A;  1XLQ A;  1SSN A;  1IBX A;  2WU5 B;  2NPT A;  3PV1 A;  2AQ3 B;  4FXC A;  2N0S B;  1SE4 A;  2LI5 A;  2J0J A;  3DVN U;  3PO0 A;  4MSM B;  5C23 A;  1KM7 A;  2C7M B;  3EHV A;  3ZO5 B;  5I4D A;  1B9R A;  3V62 A;  5J18 A;  3B1L X;  2KAC A;  2KMA A;  4F7Z A;  3OJ3 A;  3GZN I;  1QT9 A;  5HI1 A;  2M8S A;  3WCQ A;  2WQY B;  3RT3 B;  3TIX A;  2BB5 A;  1PYW D;  1V86 A;  1XT9 B;  4AOF A;  4US9 A;  1H8C A;  4IWO A;  1GUA B;  5EE0 A;  4DBG A;  1XLN A;  2WP9 B;  4KSK C;  3P63 A;  4OHJ A;  3A4S C;  3QX1 A;  2VH1 A;  2V3N A;  1L6V A;  3ABV B;  2QMT A;  1V8C A;  3ZLZ A;  2WXO A;  3R2I A;  2BTE A;  1IYF A;  1CMX B;  3DBR B;  2O6V B;  2JVC A;  5AZH A;  1FMA D;  1YX6 B;  2GBK A;  2DYB A;  4M8N A;  1YMH E;  4M01 A;  1UZX B;  1FNV A;  5GXG B;  2B3A A;  2FNJ B;  4GOC A;  3AEE B;  3IAM 1;  2WXM A;  4J3O D;  2H89 B;  2WNM A;  2D10 A;  1RM6 C;  2MRP A;  1I4G A;  3V05 A;  3BVM A;  1QOB A;  2M19 A;  5DPS A;  2BWE S;  3ENE A;  1R4N I;  3P4Q B;  3L10 B;  3I63 C;  1XXG A;  2CJO A;  2MP2 B;  3HVD A;  3U30 A;  1J7B A;  2N1V A;  3TMP B;  4I6N B;  3VUY A;  1QOF A;  4FJV B;  2Z59 B;  1VDV A;  3A33 B;  2L0T A;  1VD2 A;  3Q69 A;  5DPR A;  5BYR A;  4I6L B;  4BBN F;  2BYF A;  4MGK E;  2Z0D B;  3ZYY X;  3T3O A;  4EZJ A;  5KHQ A;  2LGY A;  2A5U A;  4C00 A;  2DWQ A;  1P1A A;  2CHX A;  1SIF A;  2JZP A;  2BS3 B;  3DBR I;  2YEP F;  5T8I A;  3KLS X;  2BYV E;  1NI3 A;  2LHE A;  4GSW A;  3H8H A;  3ZNI D;  3TBL D;  3KWV A;  2J42 A;  1YN5 A;  4NZL B;  1PGA A;  4A90 A;  3VVW B;  2MBB B;  3AE9 B;  1UBI A;  5BMH A;  4BKG A;  3KWL A;  1MFW A;  2YVC A;  3VAW A;  1UH6 A;  5E6J A;  3X23 A;  3VXW A;  3VR8 B;  2L3Z A;  4S0R A;  3EA6 A;  4NQL B;  1S1Q B;  5J2R A;  5G2N A;  2ZPY A;  1C4C A;  4L23 A;  5D3D A;  1NBF C;  2ZNV B;  4BOZ B;  1V1P B;  2PPH A;  3BYY B;  2MCN B;  3P4P B;  3NVW A;  2ONQ A;  2JZZ A;  2IYD B;  1C76 A;  1WE7 A;  2D3C A;  2GOW A;  1Q0W B;  2N7D A;  4IKG A;  2XNA C;  3PZ8 A;  1C79 A;  2W9N A;  2IGG A;  1FIQ A;  2WLB A;  2GMI C;  3H6N A;  3OAW A;  1NI2 A;  1V5O A;  2H88 B;  2NTT A;  3W1S A;  3ZVV A;  2QC8 A;  2HTM E;  2KD0 A;  2D5G A;  3WAN A;  1L5P A;  4DHJ B;  3QAQ A;  4E74 A;  1FRD A;  4PYU A;  1K51 A;  4AWJ A;  4MAC A;  4RF1 A;  2YEP B;  2CU3 A;  2WHI A;  3AE5 B;  2I2Y A;  3NVY A;  3PPA A;  1FM0 D;  5FK9 C;  3CMM B;  3LB8 C;  4MJS B;  2KMM A;  1WGH A;  1TY2 A;  3L0W B;  1SF0 A;  2MX2 A;  3RUL A;  1TKY A;  2ZW1 A;  2K8C A;  4C7Y A;  2XN9 C;  4HWI B;  2NBU A;  2K8B A;  3Q3J A;  2FCQ A;  2D2Q A;  5BO4 B;  3ZNZ B;  5L83 A;  2GBJ A;  2PVO D;  1V80 A;  2WXG A;  4YL8 A;  4ZRI A;  1GG3 A;  5G5H A;  4GDL B;  4ASW C;  1WGG A;  4HJK A;  2N9L A;  5KHO A;  2SEB D;  1AN8 A;  2NR2 A;  4W9H A;  2L8J A;  4EKU A;  4S17 A;  1NYQ A;  1P0R A;  2K5P A;  3APF A;  3IBE A;  1PGB A;  4HPL B;  1ZUD 2;  3HIZ A;  1C77 A;  1HTO A;  3ML8 A;  3JW0 X;  4HPM B;  4HJG E;  1F2R I;  4WQM A;  4KSL C;  1HQR D;  2LRU A;  2VRR B;  3LJ3 A;  1EO6 A;  2FCM A;  2JX5 A;  2ZVO A;  3X0W A;  1WH3 A;  1WYG A;  4AP4 C;  3AUL A;  4K3B A;  2G4D B;  2Y5B B;  2O6V D;  3RI7 C;  5HFY A;  1UWM A;  3W5V B;  3RCZ A;  2FCS A;  3VTV A;  3Q14 C;  3DBL B;  4HRO A;  5MPO A;  1V1P A;  2M0X A;  2MA9 B;  1PDX A;  1WXS A;  3V60 A;  1WGD A;  2C7H A;  1WMH B;  4OVV A;  4OVU A;  3H7P B;  2BBC A;  4N59 A;  1JAL A;  3GP7 A;  1ZXI A;  3AMZ A;  3GOE A;  2FE8 A;  1Q10 A;  2MEK A;  4RNA A;  2K8H A;  2QDF A;  1KLG D;  2BKF A;  2FCN A;  1L0Y B;  1J19 A;  2PMV A;  4DWF A;  4ZOH C;  4NJ6 A;  4H2A A;  3PVL A;  5EE9 A;  5H92 C;  4HDO A;  3KUD B;  4WAA A;  2C9W B;  4FN2 A;  4IWQ A;  1FXA A;  2LD9 A;  4B95 A;  2N7J A;  3FAH A;  3AEF B;  1XCQ L;  3MJW A;  3AV8 A;  2IGH A;  5D3I B;  2FID A;  4LNN A;  3QIJ A;  3HHM A;  4F8C B;  2PE6 B;  4JGH B;  1UBQ A;  2Y5P A;  2LHD A;  4IM2 A;  5BMI A;  3P2B A;  2LMC A;  4IM0 A;  2KN4 A;  3AE3 B;  5C2T B;  1D5X C;  3P4S B;  1SE2 A;  1KLU D;  3L13 A;  4GDL A;  1Z5S B;  2WXJ A;  5C1Z A;  1HE8 A;  1YIW A;  3IT4 B;  2JRI B;  1DOX A;  4WWO A;  4LNK A;  5E6N A;  2KX0 A;  4GDK A;  4ICV A;  1WSP A;  1MG8 A;  1IBX B;  2NPT B;  4HCN B;  5JHB A;  4AS1 A;  1VJK A;  3ML9 A;  2B76 B;  4WQO B;  5L95 C;  1V9J A;  5FKA C;  3RYT A;  4XDD A;  4XX5 A;  5LXI B;  5LXH A;  2SAK A;  2AWT A;  4DQO C;  1XO3 A;  3SR6 A;  2Z0E B;  3UGB B;  5AEK B;  3E56 A;  3PRE A;  1CK1 A;  3H1U A;  2CJN A;  3VFK A;  4AUQ C;  2X38 A;  5CTR C;  5D94 A;  5JH5 C;  3WA0 A;  4JQW C;  3DHG C;  4GXB A;  3RNE C;  2WXN A;  3C19 A;  2JT4 B;  3AI5 A;  2KLG A;  3AB5 A;  3BVG A;  2IO0 B;  3VHT C;  3QK0 A;  4RCO A;  4W9D A;  2V3P A;  2WXL A;  3GE3 C;  5D2M B;  3H7P A;  3QJZ A;  2JSV X;  4TV3 A;  3TUO A;  1D3Z A;  2LVO A;  4A6Q A;  3C8Y A;  4ARC A;  3ZRC A;  3T3N A;  3WIM A;  4G50 A;  4FHK A;  2MH7 A;  4YWG G;  2HDE A;  2L32 A;  3VH4 B;  1J7A A;  4ANX A;  4YXD B;  1TTN A;  3R3M A;  3GZN B;  1K50 A;  5BYQ A;  2AYO B;  1WGR A;  3R7Q A;  2BQQ A;  2I1J A;  2MW5 A;  4YSZ B;  1DYQ A;  2KMC A;  2VH2 A;  1KH0 A;  2R2Q A;  4E71 A;  4A9A A;  2FBW B;  4RM9 A;  1AYF A;  2ASQ A;  2IO2 B;  1P7F A;  2KXJ A;  2IGD A;  2WX0 A;  1TS4 A;  2KYW A;  3NOB A;  4RH6 A;  2W3R A;  1R4M B;  1KFY B;  4PS3 A;  3ZDT A;  3HK0 A;  1N5X A;  3DQV A;  3EGR A;  1EF1 A;  1ET6 A;  1E9M A;  1E7V A;  2G1E A;  2INP E;  2TSS A;  1GC7 A;  4MM3 A;  3S2A A;  1WZ3 A;  2NMQ A;  4MEL A;  3DWG C;  2NVU I;  4AJW A;  1XQQ A;  4BKT A;  2KWD A;  2PVG C;  3TCA A;  4IUM B;  1P98 A;  2KWU B;  3J9C A;  1F9J A;  5EE3 A;  3VR9 B;  2BT6 A;  2CS4 A;  2JF5 A;  3PSE B;  2JXX A;  1T6B X;  5CHV C;  4ZRJ A;  4USA A;  3AU4 A;  2BS4 B;  3A9J A;  1XLO A;  2LGD A;  3T9L A;  3B0A A;  4KDI C;  5DPT A;  4RGN A;  4ICU A;  2LFI A;  5E6O A;  2JU6 X;  4Q2J A;  4BZA A;  3B08 A;  4YSX B;  3ZQ4 A;  2A4Z A;  2CR5 A;  3VQI A;  3PRP B;  1R4N B;  2GBN A;  3NHE B;  4WIP A;  1WM2 A;  1ZGU B;  3UQB A;  1T5X D;  1OTR B;  1ZW7 A;  2KKC A;  3KYD D;  2MJE A;  1VZ8 A;  4YT0 B;  4XWT A;  1L0V B;  4KX6 B;  3R7R A;  2NS5 A;  3PRM B;  5LNK 1;  4TKN A;  1KRH A;  2RMM A;  3V3X A;  3D32 A;  1RFA A;  2RD0 A;  1ROE A;  1UEL A;  4NY0 A;  1R4M I;  4KDL B;  2DAJ A;  4W9J A;  4YTM B;  3Q3M C;  1GB1 A;  4FBJ B;  3EC8 A;  4G3X B;  1I4Q A;  3ZNG C;  5IOI A;  3NUH B;  1TS3 A;  1JQ4 A;  2LXA A;  4A20 A;  2JY6 A;  1G6J A;  1IP9 A;  2XBB C;  4KGS A;  1JRU A;  1JW9 D;  2DHZ A;  2KVZ A;  3DCG A;  4TQ1 A;  2LWP A;  2MLB A;  4K7W A;  2DBY A;  2BYE A;  4JLC A;  1NEK B;  1V6E A;  3Q8F A;  4KVG B;  4ZHO A;  2M4N A;  2KDF B;  2V9H A;  3UIO B;  5CHF A;  1WRD B;  3N32 A;  2JZ3 B;  1QOG A;  3AE4 B;  4HLE A;  4QAY A;  4B6W A;  1ESF A;  3TEY A;  4OZC A;  4ANW A;  1JRP A;  4P16 A;  4LJP B;  4FUL A;  4K3C A;  3ZJU A;  3DHI C;  2JWZ A;  1MHH E;  4ZRQ A;  1LXD A;  1I7H A;  4ANU A;  2J7Q B;  3A9K A;  3DOW A;  4E3C A;  5JHA A;  4J6I A;  2K6Q A;  4PS7 A;  3MHS D;  1UUP A;  4PT5 A;  1IUE A;  2CHW A;  3R8B A;  3UIP B;  3BII D;  3ZDM C;  1YJI A;  3BK2 A;  1E8W A;  3MC0 B;  1PQS A;  2GLS A;  3JSV B;  2CKH B;  3EEC A;  4WUR A;  3O13 A;  1LO5 D;  4KGR A;  4PK1 A;  2CU1 A;  1WGK A;  1KLV A;  1QLB B;  2J52 A;  4TQ0 A;  2W82 A;  4GIV A;  1C78 A;  3K9O B;  4FA6 A;  2LEK A;  1LM8 B;  1WR6 E;  2V0G A;  3BVZ A;  4RGO S;  3K9P B;  1I35 A;  2MHJ A;  1E8Z A;  3TEZ A;  4GN1 A;  4ZDV A;  1T0S C;  1FO4 A;  2KDI A;  1C4A A;  3PZD A;  3VRA B;  2L00 B;  5E6P A;  4LTU A;  2K3U A;  4URK A;  3ETR A;  2WDT B;  1P7E A;  4JE3 B;  4RF0 A;  4M0W A;  2DYM A;  1XEE A;  5D6J B;  4EZK A;  3EFU A;  5C3J B;  4MGZ E;  1VLB A;  3IG3 A;  1E7U A;  1BML C;  5IAA C;  2DX5 B;  4NAM A;  3RNG C;  1XLP A;  3UI3 A;  2DZK A;  2Y3A A;  1L2N A;  1BUI C;  2KDM A;  1U4A A;  3M3J A;  2L83 A;  3SEB A;  4REZ A;  2MJ3 A;  4W9K A;  1NVI D;  2REX A;  3AE1 B;  3BWU D;  3AED B;  1YJ1 A;  1IPG A;  1YJJ A;  2K22 A;  5AUI A;  1WI0 A;  2W54 A;  3L54 A;  2K0P A;  4LNO A;  4XWW A;  5AUK A;  4GLS C;  3IT6 B;  4BFR A;  3KQ4 A;  3SD5 A;  2GRI A;  2I38 A;  3W5U B;  2X8X X;  3W9C B;  1JWB D;  4KZC A;  3ECI A;  2KLC A;  2KJ6 A;  4P1C C;  5GMV A;  1V49 A;  3OG5 A;  4FHJ A;  2LUE A;  3ZGZ A;  2DLB A;  3N9Y C;  2ACZ B;  2LZ6 A;  3JSV A;  2IBI B;  2C60 A;  4LDT B;  1WIA A;  3HUI A;  4WWP A;  4GDK B;  1SJH D;  3B2F A;  2GBM A;  3JYU A;  1KOT A;  4ZRK A;  2WU2 B;  3IVF A;  2RPQ A;  3I57 A;  1XF5 L;  5IO9 A;  2CHZ A;  2PW9 A;  4DXF A;  2WDV B;  2KDB A;  1T0Y A;  4MDK E;  3MP9 A;  2ZW0 A;  3I3T B;  2VZK B;  1RWS A;  1VCB A;  2KQ4 X;  3VH3 B;  4YTN B;  3M63 B;  3ZTC A;  3IAS 1;  2MWS B;  3PRZ A;  2WXI A;  1WXM A;  2LUM A;  1WF9 A;  1SBB B;  1X1M A;  4RGM A;  2RPV A;  1FPY A;  2LJI A;  5IKC M;  2KO3 A;  4W9E A;  1VRA B;  1WX7 A;  4P6V F;  2E3T A;  1WE6 A;  1AW7 A;  1T0Q C;  2AQ2 B;  3PHW B;  1C3T A;  1WZ0 A;  3MTN B;  4OZB A;  4KZ0 A;  4B0M A;  2ZCC A;  1C1Y B;  3GE8 C;  1UNS A;  2HTH A;  2KZR A;  1EF5 A;  2UWQ A;  3AE7 B;  4LK0 M;  3W2D A;  2UYZ B;  4BKS D;  3M62 B;  2KT7 A;  2IDY A;  3QC8 B;  4M8M A;  1CZP A;  2BPS A;  1UGJ A;  1L6U A;  2MSE D;  4YTP B;  4DHZ B;  1UGM A;  4XYC A;  3VTU A;  4HXD A;  3FIL A;  4LNI A;  3AE2 B;  3WAL A;  1Y56 A;  4MGI E;  1V2Y A;  2ZCB A;  4HEA 1;  1TS2 A;  1HXY D;  2LGS A;  3SFD B;  1ISN A;  4HDQ A;  1EU4 A;  1E8X A;  4KKI A;  1KJT A;  3V6C B;  4XGA B;  3NZS A;  5G5G A;  2MBH A;  2N7E A;  4XE0 A;  3VRB B;  3AEC B;  1N5W A;  3DDC B;  1YQ3 B;  2KJR A;  3AE8 B;  1F0Z A;  3BYT B;  3N1Y C;  1WFY A;  4EE2 A;  2N9K A;  4MM3 B;  3R66 C;  2LVQ A;  2PE9 A;  4B9K A;  2AL6 A;  1PGX A;  1NYR A;  3LYY A;  4BVU C;  1ET9 A;  3UQA A;  3Q8A A;  1YN3 A;  4ZRP A;  3N1Z C;  5HHD G;  3ZW3 A;  4ARI A;  3ZRF A;  2KJH B;  5H8Y E;  1MI0 A;  4HRS A;  2O2V B;  2WXK A;  4P7I A;  3DBH I;  3A9J B;  4WAF A;  3BZD B;  3RNC C;  4LNF A;  4DDG D;  2MBO A;  1K52 A;  1ZXH A;  3L17 A;  4BAX A;  1FCC C;  1Q5W B;  2KFK A;  2QHO A;  5EDS A;  4IOI E;  5JZE B;  4JIO U;  2RDH A;  3RZF A;  3ZUN A;  2Z8L A;  4O1N A;  1FFU A;  4JL9 A;  1FFV A;  4A8X C;  1HTQ A;  1TBE A;  1QIL A;  2K6D B;  2KDE B;  2L0F A;  2KTR A;  4FJY A;  4C4V B;  4DHJ D;  1SIJ A;  2LVP A;  4M00 A;  3QA8 A;  1J8C A;  1WM3 A;  1JWS D;  1N62 A;  4HKZ E;  1A70 A;  4RGT A;  1OQR A;  4MEM A;  2W55 A;  1OFF A;  2KWV B;  3MFG A;  1VZ6 A;  3Q8C A;  4N58 A;  1ZKH A;  1I4R A;  2ZNV C;  4ZHP A;  1GB4 A;  3NVV A;  1C4P A;  3Q8E A;  2WDR B;  3EFC A;  3ZXV A;  4KIK A;  3AEA B;  3IXS A;  2KTF A;  1MPE A;  2LGI A;  3MJ5 A;  1EU3 A;  4L2Y A;  2KC1 A;  4BBN C;  3DWM A;  2L52 A;  3U8Z A;  1WJ6 A;  2JUO A;  3DVG X;  3U7D A;  1TT5 B;  2V4I B;  3QAR A;  2KHW B;  3RPF C;  3HRD D;  3N20 C;  3O65 B;  3Q8B A;  3BY4 B;  2E6X A;  4WWN A;  2ZPN A;  2D3A A;  1FEH A;  3NZ3 A;  3I5J C;  4WWM A;  3DBS A;  1K53 A;  4NPN A;  2IY1 B;  2C7N B;  3AEG B;  3UIN B;  2INC C;  2DYO A;  1V97 A;  3URY A;  2MQJ A;  2HJ1 A;  4OZA A;  3CSF A;  4NQK E;  2ON8 A;  1TGZ B;  3HM6 X;  3SU8 X;  4F1S A;  2MBQ A;  3A9K B;  2DEN B;  2JYT A;  2BF8 B;  1V81 A;  4AQ7 A;  1H4R A;  1JWA D;  2O2V A;  4CHK A;  4IWP A;  4HKQ A;  1D5M C;  2QSD A;  4B0E A;  1F52 A;  2OHF A;  1JRO A;  3L16 A;  2I1K A;  2XEW A;  4R3D A;  1EWY C;  3CF6 E;  1PFD A;  4K1R B;  4EUT A;  4UDU C;  3TL5 A;  2FUG 1;  2PLP A;  4MT5 A;  2HE7 A;  4PS8 A;  3A1Q A;  2DZJ A;  3AXC A;  4WJN A;  1P9D U;  1T3Q A;  3ZKJ C;  1RFK A;  1WGY A;  3NY5 A;  2JXT A;  5D7G A;  1N60 A;  3B9J A;  3UF8 A;  3RNF C;  2V3S A;  2WXP A;  4C4V A;  2QJL A;  1JWU D;  3IFW B;  1NDD A;  3DHH C;  4M0W B;  1FNW A;  3ZNH B;  2KN5 A;  1MVK A;  4W9G A;  4MH8 A;  1E5W A;  1GNU A;  4IDI A;  4TUU A;  3AU5 A;  3GB1 A;  4II2 B;  4ACF A;  2N4F A;  2NTS A;  1N6Z A;  1WJN A;  4G0N B;  1UF0 A;  3W1Y A;  1GAQ B;  3JVZ X;  1Y8R C;  3ZJT A;  4EEW A;  4A55 A;  1GPX A;  2ZJD A;  4CQN A;  2WS3 B;  1M94 A;  3H9D A;  2KQS A;  4JPS A;  1TJE A;  1TS5 A;  4DDI D;  1E10 A;  2N9P C;  3ZJV A;  3PTF C;  3NVZ A;  2IND C;  1AWD A;  1RLF A;  2KFJ A;  1OEY J;  1L0X B;  3I9V 1;  1STE A;  2AEH A;  3DVG Y;  1RYJ A;  4HPP A;  1PUT A;  2G45 B;  4M02 A;  1N61 A;  5FR6 A;  1J0G A;  3DVN V;  3ZTD A;  1OGW A;  1FD6 A;  2KK8 A;  1CJE A;  2N9E B;  1Q1O A;  1IGD A;  3B2G A;  3P42 A;  5HG2 A;  1LFD A;  1QZE A;  1TZO A;  1NEN B;  4MGY E;  1RAX A;  3V61 A;  1YQ4 B;  3T8M A;  1FNU A;  4N9F 4;  2R61 A;  1ZOY B;  2GI9 A;  3NZU A;  1SEB D;  3NRZ A;  2XK5 A;  4K7S A;  2JQR B;  1P3Q U;  2IPK D;  3N1X C;  4W9I A;  3AEB B;  2K1F A;  1K8R B;  3RFZ B;  1S3S G;  1BT0 A;  2L7R A;  1WJU A;  2NBW B;  3C0R B;  3QQ8 B;  2G3Q B;  2WDQ B;  2EMS A;  4JX1 C;  2EKI A;  3BK1 A;  1E8Y A;  2GB1 A;  1QOA A;  1J7C A;  5LLI A;  5BYS A;  1WR1 A;  4WJO A;  2OJW A;  1B1Z A;  1SGH A;  3TJP A;  1DGJ A;  1BXT A;  4GB9 A;  4LJO B;  1KF6 B;  1V5T A;  3P1M A;  3VUX A;  3QWZ B;  3HM3 A;  1E7P B;  1L7Y A;  2J0M A;  1SE9 A;  4IM3 A;  2BW2 A;  2D3G A;  4TSS A;  2OJR A;  3OWE B;  4NJC A;  4IG7 B;  5CHW A;  2RDG A;  2KVR A;  1YNT E;  3SFE B;  4LLG M;  1IGC A;  2ZVN A;  2G4S A;  4FLH A;  2ZZP B;  2LGX A;  3ZIM A;  3A4R A;  3AH7 A;  1I4P A;  3ZXR A;  1OQQ A;  4DXA B;  2PKO A;  2JRH A;  3RZW C;  2WX1 A;  3RUI B;  4KV2 A;  2DZI A;  3RN9 C;  1ZE3 D;  2PJH A;  4ITK A;  1RRB A;  5TR5 A;  4BOS C;  1D5Z C;  1UWX A;  3BIN A;  4EFO A;  1TY0 A;  2JYE A;  4OW0 A;  3CIR B;  3MC8 A;  4GMV A;  2WYQ A;  4II3 B;  4RFB A;  4FAD A;  4YSY B;  1FCL A;  2AL3 A;  2O6V A;  3APD A;  2V4L A;  3WAM A;  2EKE C;  1LQB A;  2LRW A;  3U4E G;  3U2S C;  1R7S A;  3FIL B;  1WXA A;  3VDZ A;  4NNJ B;  2M1M A;  1TKG A;  3CWI A;  4C56 C;  3MHZ A;  5G55 A;  2PIA A;  3EUB 2;  1YN4 A;  4WJP A;  1JML A;  1T0R C;  3RD2 A;  4KKJ A;  4IW0 A;  4PYZ A;  4DXG A;  1WY8 A;  4BKS A;  2V1Y A;  3SDL C;  1HA5 A;  3KH0 A;  2GBR A;  2MP2 A;  3VUW A;  2G9H D;  4N6E B;  2BS2 B;  1CQV A;  4GGQ A;  2WXH A;  4W9C A;  4TMA B;  4X57 B;  4NJ7 A;  3QHT A;  5TSS A;  4JWS C;  4CO7 A;  3E9S A;  3Q2A C;  1AAR A;  1ACC A;  4A3O A;  3KW5 B;  2N9X A;  1EM7 A;  1FXT B;  1OEY A;  2FUH B;  2QCZ A;  1F77 A;  2J4X A;  1L4Z B;  2M0A A;  3APC A;  5HKH A;  1TIF A;  3Q3F A;  1WX9 A;  4DK5 A;  3U7Z A;  3AM9 A;  2M17 A;  2AX5 A; 
#chains in the Genus database with same CATH homology
 5T8I A;  1ZXH A;  2YEP F;  2MJD A;  3KLS X;  3PZ7 A;  1C9F A;  1NI3 A;  5EE1 A;  2LHE A;  4WH4 A;  3VQI A;  1FCC C;  2L1A A;  3H8H A;  3TSS A;  4WIP A;  4IOI E;  3NS1 A;  1T5X D;  3KWV A;  2J42 A;  1YN5 A;  2MJE A;  1VZ8 A;  2RDH A;  3TEW A;  1HZ5 A;  4NZL B;  4YT0 B;  2Z8L A;  4XWT A;  1L0V B;  4NAW B;  4KX6 B;  1PGA A;  4A90 A;  2JWU A;  4O1N A;  1FFU A;  3AE9 B;  5LNK 1;  5BMH A;  1FFV A;  1KRH A;  4A8X C;  2RMM A;  1MHX A;  3KWL A;  1QIL A;  3V3X A;  1ROE A;  1SIJ A;  1DOI A;  5E6J A;  1SXT A;  2AQ1 B;  3VR8 B;  1FXI A;  3EA6 A;  4YTM B;  1JWS D;  3HVZ A;  1N62 A;  4JWU C;  1C4C A;  1A70 A;  4HKZ E;  4RGT A;  1GB1 A;  1OQR A;  4L23 A;  1ZP0 B;  2W55 A;  1OFF A;  5D3D A;  1N63 A;  3MFG A;  1V1P B;  3BYY B;  3P4P B;  1I4Q A;  3NVW A;  1VZ6 A;  2IJ0 A;  3Q8C A;  2ONQ A;  2INN E;  4N58 A;  2Q5W D;  1I4R A;  3NUH B;  4C80 A;  1TS3 A;  1C76 A;  4ZHP A;  1JQ4 A;  1ENF A;  1WWT A;  1KTK A;  4KGS A;  4IKG A;  2XNA C;  1C4P A;  2WXF A;  1C79 A;  3NVV A;  3PZ8 A;  3Q8E A;  3FC4 A;  1GB4 A;  1QQR A;  3P4R B;  1JW9 D;  2IGG A;  2WDR B;  1EWC A;  2BYT A;  1FIQ A;  2WLB A;  3AEA B;  4TQ1 A;  3IXS A;  4D2K A;  2K9X A;  2H88 B;  2NTT A;  3W1S A;  1MPE A;  2LGI A;  3MJ5 A;  1EU3 A;  4L2Y A;  2HTM E;  2DBY A;  2D5G A;  1L5P A;  3DWM A;  1NEK B;  2L52 A;  2QIL A;  3L4P A;  1FRD A;  1L4D B;  3Q8F A;  4ZHO A;  1D6E C;  1K51 A;  4MAC A;  1E6E B;  4RF1 A;  2YEP B;  2V4I B;  2CU3 A;  3RPF C;  3HRD D;  3AE5 B;  3Q8B A;  2I2Y A;  1ZPS A;  3NVY A;  2PTL A;  2E6X A;  1QOG A;  3AE4 B;  1FM0 D;  2ICI A;  5FK9 C;  2QIE B;  1DOY A;  3LB8 C;  1ESF A;  1FEH A;  3NZ3 A;  4WWM A;  3TEY A;  2KMM A;  1K53 A;  1QKZ A;  4OZC A;  1JRP A;  1TY2 A;  1SF0 A;  2EEL A;  1HZ6 A;  1TKY A;  2ZW1 A;  4P16 A;  3ZJU A;  3AEG B;  1XCT L;  4C7Y A;  2XN9 C;  2DYO A;  1V97 A;  3URY A;  1MHH E;  1V1O A;  4OZA A;  2ON8 A;  4ZRQ A;  1I7H A;  2PVO D;  1WRI A;  2WXG A;  2JYT A;  1UUP A;  4PT5 A;  1IUE A;  5G5H A;  4AQ7 A;  1JWA D;  4GDL B;  4HKQ A;  3R8B A;  1D5M C;  2QSD A;  5JXV A;  1D4B A;  3BII D;  1YJI A;  3BK2 A;  4B0E A;  3MC0 B;  2OHF A;  1JRO A;  2N9L A;  4WUR A;  3O13 A;  2SEB D;  1LO5 D;  4C7Z A;  1AN8 A;  4KGR A;  4R3D A;  1EWY C;  2J53 A;  1WGK A;  1QLB B;  4XDC A;  1PFD A;  2J52 A;  4TQ0 A;  2W82 A;  1NYQ A;  4UDU C;  1C78 A;  5BMG A;  2K5P A;  1PGB A;  2LEK A;  1ZUD 2;  2FUG 1;  2PLP A;  1C77 A;  4MT5 A;  2V0G A;  3BVZ A;  4HJG E;  1F2R I;  4RGO S;  2QEJ C;  2OED A;  1T3Q A;  4WQM A;  2W3S A;  3TEZ A;  1RFK A;  1HQR D;  3R2T A;  2JXT A;  5D7G A;  1VZ7 A;  2JX5 A;  1N60 A;  3AN1 A;  1FO4 A;  3GS2 A;  3B9J A;  1C4A A;  1WYG A;  3VRA B;  2WXP A;  1JCK B;  4LTU A;  2K3U A;  2QJL A;  3ETR A;  1I4X A;  1P7E A;  1JWU D;  4JE3 B;  1ZDX A;  4RF0 A;  4M0W A;  5HFY A;  1UWM A;  2DYM A;  1XEE A;  3W5V B;  1FNW A;  5C3J B;  1VLB A;  3U52 E;  1GOZ A;  1MVK A;  4MH8 A;  1TYG B;  4HRO A;  5MPO A;  1V1P A;  1PDX A;  4IDI A;  3GB1 A;  2NTS A;  1BML C;  1QF6 A;  1VR9 A;  4NAM A;  1XLP A;  3UI3 A;  1I4H A;  2BBC A;  1GAQ B;  2Y3A A;  4N59 A;  1BUI C;  2KDM A;  1JAL A;  3GP7 A;  1ZXI A;  3ZJT A;  1JWM D;  2BB6 A;  3AMZ A;  4A55 A;  1GPX A;  2FE8 A;  1Q10 A;  2L83 A;  4CQN A;  3SEB A;  1WXQ A;  2MEK A;  2WS3 B;  4REZ A;  2MJ3 A;  4RNA A;  1FRR A;  5FR3 A;  4US8 A;  1NVI D;  1KLG D;  4JPS A;  1TJE A;  3AE1 B;  3BWU D;  3AED B;  1F2R C;  1TS5 A;  1L0Y B;  2PMV A;  1HEZ E;  1E10 A;  1SJE D;  3ZJV A;  4ZOH C;  3NVZ A;  1AWD A;  1SB3 C;  4H2A A;  1YJJ A;  2K22 A;  4OVZ A;  1L0X B;  5EE9 A;  4KGT A;  5AUI A;  3I9V 1;  1STE A;  5H92 C;  2W54 A;  4L1B A;  1RYJ A;  1PUT A;  1FXA A;  1N61 A;  2K0P A;  1FD6 A;  2N7J A;  1CJE A;  2M56 B;  3FAH A;  1IGD A;  3B2G A;  3P42 A;  5HG2 A;  3AEF B;  3LXF A;  4XWW A;  5AUK A;  1XCQ L;  2KAJ A;  1TKE A;  1M4V A;  3AV8 A;  2IGH A;  4GLS C;  3IT6 B;  5D3I B;  1TZO A;  1E0Z A;  3KQ4 A;  1NEN B;  2GRI A;  1YQ4 B;  1FNU A;  2I38 A;  3W5U B;  2R61 A;  2Y5P A;  2LHD A;  3AE6 B;  1ZOY B;  2GI9 A;  3W9C B;  1JWB D;  1ZDV A;  2VZK D;  4ZYS A;  1SEB D;  2Y5C A;  3NRZ A;  2LMC A;  5BMI A;  2KN4 A;  2JQR B;  3AE3 B;  2IPK D;  5C2T B;  1D5X C;  3AEB B;  3P4S B;  3RFZ B;  1SE2 A;  1KLU D;  1SE3 A;  2WXJ A;  2WXR A;  3ZGZ A;  2DLB A;  3N9Y C;  2ACZ B;  2WDQ B;  3IT4 B;  4JX1 C;  1DOX A;  3TEX A;  2EKI A;  2WXQ A;  1XLQ A;  3BK1 A;  2GB1 A;  1SSN A;  1IBX A;  2WU5 B;  1QOA A;  1J7C A;  1WSP A;  3HUI A;  1IBX B;  4GDK B;  2AQ3 B;  4FXC A;  5BYS A;  1SJH D;  3B2F A;  2N0S B;  2WU2 B;  1B1Z A;  1SE4 A;  3I57 A;  1XF5 L;  4AS1 A;  1DGJ A;  1BXT A;  1VJK A;  3PO0 A;  1KF6 B;  2PW9 A;  4DXF A;  2B76 B;  2WDV B;  3P1M A;  3MP9 A;  5FKA C;  2ZW0 A;  1E7P B;  4XDD A;  2VZK B;  5I4D A;  1B9R A;  2SAK A;  1RWS A;  3ZQ4 A;  2KQ4 X;  4YTN B;  2BW2 A;  2KAC A;  4TSS A;  3IAS 1;  4DQO C;  2WXI A;  1XO3 A;  3SR6 A;  2LUM A;  1SBB B;  3E56 A;  1CK1 A;  1QT9 A;  5HI1 A;  3OWE B;  4NJC A;  4RGM A;  2CJN A;  2RPV A;  2X38 A;  2RDG A;  2LJI A;  1YNT E;  3SFE B;  4LLG M;  3WCQ A;  1IGC A;  2WQY B;  2BB5 A;  1PYW D;  1VRA B;  4P6V F;  2E3T A;  2WXN A;  1AW7 A;  4US9 A;  2AQ2 B;  3AB5 A;  3BVG A;  5EE0 A;  4RCO A;  4OZB A;  3AH7 A;  2V3P A;  1XLN A;  2WXL A;  2WP9 B;  1I4P A;  1OQQ A;  3P63 A;  2PKO A;  4OHJ A;  2JSV X;  4B0M A;  3TUO A;  4A6Q A;  1ZE3 D;  3C8Y A;  2V3N A;  4ITK A;  1L6V A;  1UNS A;  3ABV B;  1D5Z C;  1UWX A;  1TY0 A;  2JYE A;  4OW0 A;  4ARC A;  2QMT A;  3CIR B;  3AE7 B;  4LK0 M;  3T3N A;  1V8C A;  4RFB A;  3W2D A;  4YSY B;  2MH7 A;  2WXO A;  4YWG G;  2HDE A;  3R2I A;  1FCL A;  2IDY A;  2BTE A;  2L32 A;  1J7A A;  1CZP A;  1UGJ A;  1L6U A;  4YTP B;  4YXD B;  1FMA D;  3U4E G;  3FIL A;  3U2S C;  3AE2 B;  1R7S A;  3FIL B;  1Y56 A;  1YMH E;  1FNV A;  4HEA 1;  1TS2 A;  5GXG B;  1K50 A;  5BYQ A;  1HXY D;  3AEE B;  4YSZ B;  3IAM 1;  1DYQ A;  3SFD B;  2WXM A;  1KH0 A;  4J3O D;  1EU4 A;  2H89 B;  1TKG A;  2WNM A;  4KKI A;  3CWI A;  4A9A A;  1RM6 C;  4C56 C;  2FBW B;  3MHZ A;  1AYF A;  1I4G A;  2PIA A;  1P7F A;  3EUB 2;  5G5G A;  2IGD A;  3V05 A;  1TS4 A;  1YN4 A;  3BVM A;  4RH6 A;  1QOB A;  4XE0 A;  3VRB B;  2W3R A;  1JML A;  1KFY B;  3AEC B;  2M19 A;  4KKJ A;  1N5W A;  4DXG A;  1N5X A;  1YQ3 B;  3EGR A;  1ET6 A;  3P4Q B;  1E9M A;  3AE8 B;  1HA5 A;  1F0Z A;  3BYT B;  2G1E A;  1XXG A;  2G9H D;  2CJO A;  3HVD A;  4N6E B;  2INP E;  1J7B A;  2TSS A;  2BS2 B;  4EE2 A;  1CQV A;  2N9K A;  4MM3 B;  2WXH A;  2NMQ A;  3DWG C;  4TMA B;  2KWD A;  2PVG C;  5TSS A;  1QOF A;  4JWS C;  3J9C A;  1PGX A;  1NYR A;  1VDV A;  3E9S A;  1ET9 A;  3LYY A;  5EE3 A;  3VR9 B;  2BT6 A;  1ACC A;  3Q8A A;  1YN3 A;  4ZRP A;  5HHD G;  1EM7 A;  3Q69 A;  5BYR A;  4ARI A;  1T6B X;  3ZYY X;  3T3O A;  4USA A;  5H8Y E;  1MI0 A;  4HRS A;  2BS4 B;  2WXK A;  1XLO A;  1F77 A;  2DWQ A;  2J4X A;  4WAF A;  1L4Z B;  2M0A A;  3BZD B;  4RGN A;  2JZP A;  2LFI A;  2BS3 B;  2JU6 X;  3U7Z A;  3AM9 A;  4Q2J A;  4YSX B;  2AX5 A;  1K52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...