1E0ZA

[2fe-2s]-ferredoxin from halobacterium salinarum
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
128
structure length
127
Chain Sequence
PTVEYLNYETLDDQGWDMDDDDLFEKAADAGLDGEDYGTMEVAEGEYILEAAEAQGYDWPFSCRAGACANCASIVKEGEIDMDMQQILSDEEVEEKDVRLTCIGSPAADEVKIVYNAHLDYLQNRVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Two-Alpha-Helix Extra Domain Mediates the Halophilic Character of a Plant-Type Ferredoxin from Halophilic Archaea.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords FERREDOXIN
total genus 20
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2000-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1e0zA00
1TYGB 4ITKA 1JWAD 2WQYB 1TJEA 5G5GA 1ROEA 2W3RA 1YJJA 1VJKA 3P4QB 1TKEA 3DWGC 5EE1A 2DWQA 4KX6B 3SR6A 3CIRB 1AWDA 3P4PB 4C7YA 1SIJA 2E3TA 4N58A 3P4RB 1J7AA 4C7ZA 1JRPA 1WRIA 1QOAA 3NVYA 1XLPA 1KRHA 1L6VA 5G5HA 3P4SB 2K22A 3VRAB 4WWMA 2K5PA 5H92C 2L83A 1GAQB 3AEBB 1GPXA 3AMZA 1J7BA 2N0SB 2PKOA 4ZHOA 4YTNB 1PFDA 3ABVB 2L52A 1L5PA 3HVZA 4USAA 4ZHPA 1AYFA 1WWTA 2EKIA 2MJEA 3SFEB 2PIAA 1L6UA 4US8A 1NEKB 1E0ZA 2G1EA 3DWMA 1OQQA 3AE3B 2CJNA 3W5VB 1V8CA 2B76B 3PO0A 5GXGB 2MH7A 4HRSA 1F0ZA 1WXQA 1NYQA 1FFUA 4FXCA 3AEAB 3AE2B 1T3QA 3CWIA 1JQ4A 2MJDA 2JQRB 1ZP0B 1E10A 1XLQA 2QIEB 1XO3A 1FRRA 3FAHA 2FBWB 2OHFA 1N63A 1V97A 3AEEB 3VR8B 3WCQA 4N59A 1B9RA 4YXDB 5EE3A 1DOXA 1VLBA 2H89B 1FRDA 1L0VB 1NVID 2K9XA 3ZYYX 1R7SA 2WP9B 3HRDD 1N60A 3AN1A 1YQ4B 2MJ3A 4ZOHC 3AEFB 3B2GA 1CJEA 1DGJA 1OQRA 1FFVA 2ACZB 3AEDB 3NVVA 1N62A 1CZPA 3VRBB 1DOIA 2HTME 3SFDB 2JX5A 2CJOA 2PVGC 3EUB2 2PVOD 1NYRA 2KAJA 3BIID 3RPFC 4JWUC 3AH7A 1VDVA 3W9CB 2M19A 3FC4A 3W5UB 4LTUA 3B2FA 1I7HA 1FO4A 2WDQB 1QF6A 5C3JB 1E6EB 2BS2B 1ZXIA 1E7PB 1QOFA 4WQMA 2H88B 1N5XA 4P6VF 5AUKA 2BT6A 1J7CA 3AE5B 5EE0A 1KF6B 2WU2B 1RFKA 3ETRA 3NVZA 4IDIA 4YSYB 3NRZA 3AE4B 1TKGA 1JROA 3NVWA 5C2TB 4JWSC 1FXIA 2WS3B 3AE1B 2AX5A 3HUIA 2DBYA 4YTPB 3NS1A 1KFYB 3P63A 4YT0B 1JWBD 3KWLA 4N6EB 1RWSA 2Q5WD 1IUEA 1PUTA 2M56B 4YSZB 1SB3C 4YSXB 2KMMA 3L4PA 1FM0D 5AUIA 5MPOA 2CU3A 3AM9A 1YQ3B 3B9JA 2QJLA 2W54A 3AV8A 1E9MA 1YJIA 3VR9B 3AE6B 2LEKA 1DOYA 1QOBA 3AE7B 3AB5A 4A9AA 1OFFA 2Y5CA 3LXFA 3LB8C 1WYGA 1QOGA 1RYJA 1EWYC 1FMAD 1TKYA 2W3SA 1NENB 4YTMB 2WDRB 1FIQA 1SF0A 1ZOYB 1ZUD2 1UWMA 2BS4B 2WDVB 3AE8B 3AECB 2WLBA 2BS3B 5EE9A 1A70A 1XLOA 1N5WA 2W55A 3AEGB 1JALA 3P1MA 1RM6C 1N61A 1QLBB 1NI3A 3AE9B 4HROA 4JX1C 4C80A 1FXAA 5H8YE 1QT9A 1XLNA 1JW9D 4US9A 2WU5B 1PDXA 1WGKA
chains in the Genus database with same CATH superfamily
4KDLB 4IC7B 1XXGA 3GE3C 5C1ZA 4IWQA 1V2YA 2MBHA 4KIKA 3V6CB 2MCNB 2G4SA 1XLPA 2ZCCA 1L6VA 5G5HA 1J0GA 2NBUA 5H92C 3TUOA 2PKOA 5IAAC 1CQVA 2UWQA 2KJ6A 2PIAA 1NEKB 1MPEA 2XK5A 3QHTA 4KZ0A 1HZ6A 2GBJA 4HJGE 3W5VB 1NYQA 3AEAB 1EO6A 2KX3A 3OLMD 1TY0A 4I6PA 4K81A 2N4FA 3ZDTA 3RNAC 1TY2A 5DPTA 1ZXHA 1V81A 2D3BA 4GLSC 3T3NA 2MWSB 1OQRA 2RR9A 2D2QA 4DK5A 3EUB2 1VD2A 2K39A 5D94A 5FR6A 2M19A 2N9LA 3W5UB 1XD3B 2WXQA 3VAWA 2NS5A 1WE7A 2WX1A 4P6VF 2JZZA 2BT6A 2KX0A 2MEKA 4TKNA 4MSQB 3CSTA 1VRAB 2V1YA 4FHKA 4NAWA 3ZNHB 4DHZB 4YSZB 1MI0A 3PSEB 1BXTA 1GNUA 1EU3A 5AUIA 1BUIC 1F1HA 5MPOA 1HA5A 3EFCA 4DWFA 2W54A 2K25A 2PTLA 3MP9A 1RYJA 1V1PA 3NZUA 3NVYA 2C7HA 3ZO5B 1IGDA 1WGYA 3H9DA 1C9FA 2IDYA 1WR1A 3VRBB 1PDXA 1XF5L 2LJ5A 5BMIA 1V5OA 1E5WA 2DYBA 3QQ8B 1ET6A 3DWGC 4K7SA 4E3CA 5CHWA 1DYQA 2HTHA 1SSNA 1EF5A 4FBJB 4C7ZA 1WX8A 1FNUA 1JRPA 1V86A 1QOAA 2R61A 3P4SB 3DBRB 5LXHA 1WWTA 2WDTB 2JWZA 3AE3B 1KH0A 3D32A 3AI5A 5GXGB 2MH7A 1F0ZA 4FXCA 4I6NB 3ZJVA 5BYQA 2AYOB 3BVMA 1FRRA 3PPAA 2KJRA 1IPGA 4FULA 4HLEA 1PGAA 3U8ZA 1FRDA 3QAQA 2D5GA 3VHTC 1MHHE 2NTTA 2C5LC 4HKZE 1DOIA 4J6IA 3RPFC 3MC0B 2LUEA 4JIOU 3FC4A 1HTOA 1E8WA 2DZMA 4FN2A 2LZ6A 2QCZA 2YEPF 3EFUA 2CS4A 1F9JA 2ZVNA 1GOZA 3NRZA 3PZ7A 4RNAA 1EF1A 1ENFA 4JE3B 3UQAA 2HE7A 4NY0A 2J4XA 1J19A 1RWSA 4GOCA 2GB1A 2VZKB 1UWXA 1SB3C 3PHWB 5KHQA 1T0RC 2LEKA 1WZ0A 3U7DA 3PHXB 3LB8C 2KMCA 2IJ0A 4YTMB 2Z0DB 3EA6A 4DXAB 1N5WA 3Q14C 2Y3AA 1KLUD 2ZEQA 3APCA 4NQLB 4GDKB 2DENB 2INPE 1WGKA 4HDQA 2KTRA 2IY1B 1VJKA 2BYVE 3ZNGC 3PZDA 1OQYA 1YX6B 1ZDVA 2LRUA 2V3SA 3R3MA 2NTSA 2CHZA 3PT2B 2MP2B 1L5PA 1UBQA 4AP4C 1M4VA 3K9OB 4NJCA 1UELA 3FKYA 2WGSA 4DHJB 2MQJA 4MSMB 2JQRB 3TMPB 4DQOC 2KOXA 1RAXA 3WCQA 2JRIB 1YN3A 3KWVA 1VZ7A 5BMHA 2OJRA 1WMHB 4FADA 1E8XA 3RZFA 4ZOHC 3VFKA 2GBRA 3RULA 4LJOB 1JWSD 2WXMA 3VQIA 2J0MA 3A1QA 4TV3A 2DZJA 2ZCBA 1G6JA 3ZXRA 2KTFA 5HKHA 1E6EB 2BYTA 4M0WB 4CQNA 2RPQA 1WY8A 2CKHB 4C00A 3IXSA 2JVCA 4EKUA 2Y5PA 4WQOB 3M62B 1HEZE 4XWTA 4YSXB 3A9JA 3C8YA 4RH6A 1OTRB 3MJ5A 4NAMA 2YLMA 1EWYC 3KLSX 2WDRB 5DPWA 2RMMA 2QILA 1LGRA 2WYQA 4C80A 1WXSA 2VH2A 2XNAC 4WURA 3R7QA 4MGKE 1T0YA 3BY4B 1TKEA 1P98A 4ZRJA 2WXPA 3VUXA 3P4PB 1D5ZC 2L76A 3RN9C 1CMXB 3DHHC 4ICUA 1KRHA 1NI2A 2SAKA 3C19A 2L0FA 2GLSA 4L23A 4PS8A 1F77A 1JCKB 4G3XB 1P7FA 3ZTCA 4ZHOA 3B0AA 4CO7A 4OZCA 5E6OA 4IOIE 2UYZB 4DDID 2D07B 1UZXB 1XLQA 2KWCA 1QZEA 3KYDD 1WYWB 3FILB 3TEXA 4YXDB 3ZXVA 4GU2A 4MEMA 3QK0A 1H4RA 3SFDB 1NYRA 2MBEA 4F1SA 4LTUA 1YN5A 1Q10A 1WXVA 2FIDA 4BKGA 4DBGA 4XDDA 4YSYB 2CU1A 3AE4B 5C2TB 1A5RA 1IP9A 4W9LA 2V4LA 3PVLA 1WJ4A 3PV1A 2LRWA 1C79A 4ASWC 4W9DA 3L10B 3QIJA 1ZGUB 4S17A 3ZKJC 3OJ3A 2UU7A 2BTEA 2LGXA 1UBIA 2BS3B 5EE9A 1JALA 4HJKA 2KT7A 1XLNA 4OHJA 2RDGA 1E8YA 2R2QA 1SIFA 2IO2B 4NJ6A 5EE1A 3LYYA 2E3TA 3QWZB 3I3TB 2DLBA 3UIOB 4IG7B 3BINA 2J53A 3DBLB 3ZNID 4YTNB 1D5XC 1VZ6A 5KHOA 4IKGA 3BK1A 3APDA 1V8CA 3L0WB 2MX2A 3N9YC 4J3OD 1T6BX 2RGFA 3JW0X 3MFGA 2L1AA 3UQBA 3RMKC 4BBNF 4ZDVA 1MHXA 3AEEB 3T9LA 2IPKD 2ZZPB 2HD5B 3IBEA 4KGRA 2B3AA 1IGCA 1YMHE 3AEDB 1P7EA 1CZPA 4ZYSA 3TEYA 1YIWA 2PVOD 2LASA 4JL9A 4KIKB 4OVZA 1EU4A 1Q0WB 2K1FA 1Q1OA 1WX9A 3L13A 4BZAA 1FO4A 3UF8A 2FCNA 1ZXIA 4WQMA 5AUKA 3MC9A 3AE5B 2WU2B 3DPDA 3ETRA 4LNIA 4M8NA 4WAAA 1WM3A 1JWBD 2KYWA 3U4EG 3C0RB 4LNFA 1PUTA 2PJHA 5I4DA 1XCTL 2M0AA 2LGDA 2DYMA 1S3SG 4EFOA 2JY6A 1E9MA 3ALBA 3QARA 4AWJA 3UIPB 4XGAB 4W9GA 3PLUA 5FK9C 1TKYA 3PGEA 2BB6A 5AZFA 2BS4B 4ZRPA 1C1YB 1IBXB 5FR3A 1A70A 1RLFA 4HVBA 2YEPB 4WWNA 2L05A 1N61A 1NI3A 1N6ZA 2C9WB 4OZAA 1JMLA 4IWOA 5BYRA 4TSSA 2XEWA 1JWAD 2JT4B 1TJEA 4XX5A 4RGTA 3CIRB 2M1MA 1P0RA 2KZRA 3H7SA 4E71A 3NZSA 3H6NA 3V60A 2KQ4X 1TZ1A 2KN5A 3BK2A 1XQQA 1SBBB 4HWIB 2NBWB 3DVGY 1FEHA 2O2VB 3A9JB 1E90A 4NJ7A 3PLVA 1VR9A 4LNOA 4F8CB 4XC2A 2BVCA 2JZ3B 2KC1A 3KUZA 3CWIA 1F52A 2IGDA 1B9RA 1DOXA 4FHJA 3WALA 2C7MB 3IG3A 3ZVVA 3MHSD 2V4IB 2DZKA 5BYSA 1XCQL 3M3JA 5E6PA 2HTME 4P1CC 5HI1A 2KAJA 4X57B 3QX1A 2D11A 3DHGC 1LQBA 1QF6A 1BMLC 4YWGG 1P9DU 2H88B 3WA0A 1KLGD 4BKSA 3N1ZC 2K8CA 1FCCC 3UINB 2NMQA 2A5UA 3SEBA 2FAZA 2FUG1 2JWUA 2D3AA 4MM3B 5IA7A 2ZVOA 4JWSC 2AX5A 5JZEB 2DBYA 4TQ0A 3DBHB 1IUEA 1TS4A 3P42A 2FCQA 2XN9C 3KUCB 4WWPA 3AB5A 3L54A 4OZBA 1ZOYB 3AE8B 3DOWA 3AECB 2KQ7A 3HM3A 4ACFA 2W82A 3P1MA 4HROA 3JVZX 5H8YE 2V3NA 4TMAB 1V80A 3RZWC 2KDMA 3MTNB 3P4QB 4B0EA 3KUDB 4EEWA 3H7PB 4LLGM 2K22A 2PPHA 2M0XA 1E7UA 1GPXA 3RNGC 5JHAA 3RNCC 1PFDA 1WF9A 2ZJDA 4ZHPA 2EKIA 2DNFA 3I57A 4FLHA 2HJ8A 1H8CA 2K6DB 1BT0A 4W9JA 3VR8B 4N59A 2KDBA 1L0VB 1TTNA 3R8BA 3V62A 1CJEA 2RSUA 3DHIC 4DXFA 5C3JB 3NG0A 4ARIA 3JYUA 3TBLD 3T8MA 4BBNC 3HVDA 1VCBA 2RPVA 2DAJA 5C23A 3NVWA 3U7ZA 2WXOA 1KFYB 2KLGA 3KWLA 4KKIA 4RF1A 3VTVA 3AULA 2PE9A 2WXFA 4ZRKA 2LHEA 3I5JC 1K53A 1MVKA 1V9JA 3Q8FA 4L2YA 4RF0A 1LM8B 1QOGA 1TS3A 1FMAD 1V6EA 1WXAA 3VDZA 1NBFC 2LMCA 3A9KA 4KV2A 3AE9B 4H2AA 2D3GA 1SE9A 2KACA 2WU5B 1YOVB 2WXGA 4FJZA 3WANA 1WR6E 3ECIA 1FD6A 2FCMA 1ACCA 4RCOA 3VH4B 1AWDA 3VH3B 2L3ZA 4N58A 2TSSA 3IFWB 2D3CA 3TEZA 3HK0A 3X0WA 2MLBA 3AU4A 3HVZA 4W9IA 3ZJTA 1C3TA 3Q6BA 3I63C 4BVUC 1GG3A 1SEBD 2K3UA 2WHIA 3CMMB 2A4ZA 2K8HA 1GB1A 1IBXA 4P1BC 1NVID 1WI0A 1R7SA 1YQ4B 3OJ4B 4ZYNA 4GIVA 2ACZB 2KC2A 5CHFA 4K3BA 2BW2A 3N32A 3ZW3A 3AH7A 2C7NB 3NOBA 5DCNA 4DHZE 2Z0EB 3O65B 1K51A 3IT4B 1R4NI 4NNJB 3TJPA 3LDZE 3N1YC 3RNBC 2J0JA 4XYCA 1JWMD 2INNE 3HUIA 3SFEB 1M94A 3P63A 2G9HD 4EE2A 4MELA 2KMMA 2M4NA 3RD2A 4WJQA 3SDLC 2I2YA 3VR9B 2BKFA 1WXMA 2LJIA 4ANUA 1Q5WB 3IAS1 4NAWB 1Y56A 3OAWA 1JWUD 2WDVB 2DZIA 3KW5B 1FXTB 4D2KA 4YT0B 4ITKA 4MGIE 3W1SA 3NJTA 4KGTA 2KJHB 2LD9A 4C7YA 2KTRB 2ZW0A 4RGMA 4WWMA 2Z8LA 4LNNA 1GAQB 2N0SB 2WXRA 2IBIB 3DWMA 3QCAA 2CJNA 5DPSA 3PO0A 2MW5A 1WE6A 4KVGB 3E9SA 1TT5B 2MJDA 3ONSA 2QIEB 3FAHA 2JYTA 2REXA 2JSVX 5AZHA 1N63A 1V97A 4ANXA 2DAFA 2EMTA 1VLBA 5D2MB 2N1WA 1KM7A 1YD8U 1PGBA 4MH8A 3JSVB 1I4RA 2J52A 2K0PA 2CJOA 3EHVA 4W9EA 1VDVA 1TS2A 5IO9A 3ZIMA 4G0NB 3EGRA 2BKRB 5EE0A 2KLCA 1QQRA 2OOBB 1JROA 1B1ZA 3V6EB 4A20A 4DHJD 5GMVA 4CHKA 3CSFA 3ZJUA 4M00A 3PTFC 3L4PA 3PRZA 4K7UA 1WSPA 2CU3A 3BVGA 1K50A 3IAM1 2FCSA 2NPTB 3KQ4A 4WJPA 3KH0A 4HDOA 4FJVB 2C60A 2JXTA 3NUHB 4URKA 3UI3A 2WLBA 2W55A 4AS1A 1FNWA 1C76A 1JW9D 1MG4A 3ZLZA 3MJWA 3A33B 4MT5A 5EDSA 2BWES 3A4SC 4GDKA 1YX5B 2VRRB 4HPPA 1J7AA 2KD0A 4B9KA 2X8XX 1FPYA 1UF0A 1UGMA 2JYEA 3WAOA 1OQQA 2IO0B 3PZ8A 2N9KA 3N20C 5BMGA 1WXQA 3LJ3A 4IM3A 3WAMA 1ZP0B 4R3DA 2QHOA 3A1QB 2FBWB 2KO3A 5EE3A 1SJHD 3ZRCA 2GBNA 3NZ3A 4PT5A 2INCC 1DGJA 4GSWA 5L95C 2JPHA 1Z5SB 2LWPA 2YVCA 4GDLA 2OJWA 2WXIA 5J2RA 1V49A 1I7HA 5HHDG 2WDQB 3GS2A 2IO1B 4EUTA 1QOFA 1N5XA 2LI5A 3S2AA 5L83A 2V3PA 1J8CA 4Q2JA 3U30A 1FXIA 4N6EB 1T5XD 2Q5WD 1C4CA 1K52A 2N9PC 4REZA 2AQ3B 2L0TA 1YJIA 4C4VB 3E56A 4KDIC 4PYUA 1UGJA 1UWMA 2PEAA 2KWVB 2LGIA 3AEGB 3O13A 3Q8CA 3TIXA 1QT9A 4M02A 4WAFA 2IY0B 5CX3A 4BOSC 2KFKA 1ET9A 2AQ2B 3NHEB 5LLIA 1WJUA 2DWQA 2MRPA 4I6LB 3DCGA 2GI9A 2I1JA 3ZQ4A 1AW7A 3TCAA 5AEKB 2MHJA 2N1VA 4MGYE 4TQ1A 2PLPA 1AN8A 4P7IA 1J7BA 2WXHA 3ABVB 4NQKE 3P2BA 1AYFA 2WXJA 2ZPYA 4EZLA 3R2IA 4K1RB 3ML8A 2JRHA 2PMVA 4A6QA 1UH6A 4HRSA 3SD5A 2KDFB 5E6JA 3N30A 3RNFC 2IZVB 4EZJA 3I9V1 2AEHA 2WP9B 1HE8A 2L32A 3A9KB 1FFVA 3DQVA 2BPSA 3RCZA 3MHZA 2JX5A 2PVGC 5CHVC 2ICIA 1GJZA 1PGXA 1KOTA 1XEEA 3B2FA 4JGHB 3BVZA 1TS5A 1D5MC 2LVQA 4IWPA 3Q8EA 4AJYB 4B95A 4FJYA 1D6EC 4ANWA 2FE8A 1WFYA 1T0QC 2N7JA 3AE1B 4HPMB 3VTUA 3NS1A 1X1MA 3GE8C 3QJZA 4WWOA 3RT3B 4EZKA 3Q3MC 4LDTB 1GB4A 2E6XA 2N9EB 1I4QA 1WGRA 3AM9A 3U52E 2FNJB 2LHDA 4II2B 4A3PA 2LVPA 2LVOA 4W9CA 2QMTA 2ONQA 2K8BA 1WYGA 2AWTA 4QAYA 2ZPNA 1NENB 2MSED 1YN4A 2KHWB 1I4XA 1ISNA 4G11A 1STEA 4AUQC 4IUMB 4XWWA 1TYGB 2WQYB 3KVFB 5G55A 2AL6A 3GOEA 4PK1A 4KKJA 1LFDA 4NPNA 2WXLA 4IM2A 4A3OA 3T3OA 2KKCA 2BWFA 5E6NA 5D7GA 2Z59B 1F2RI 1L0XB 2OEDA 2KDEB 2KK8A 1JRUA 3QA8A 4BAXA 2N7EA 4NZLB 4OVVA 4MGZE 1JQ4A 3BYYB 2BF8B 1EUVB 2I38A 2K9XA 2H89B 4GGQA 4CYEA 1N60A 1T0SC 4LNKA 1WGGA 1QILA 3R66C 3TSSA 1WM2A 3H8HA 1I4HA 4W9HA 1GC6A 1HQRD 2O6VB 2MBBB 3N1XC 2NR2A 4JWUC 4O1NA 1P1AA 4WH4A 3W9CB 1R4MI 2JF5A 3ZDMC 3A4RA 3GP7A 4DDGD 3OG5A 2KANA 4RGOS 5FKAC 4GXBA 1YNTE 1TKGA 3W1YA 2BGFA 3VUYA 1UUPA 1C4PA 2M56B 3APFA 3BYTB 2QEJC 1GC7A 5J18A 4JPSA 4WJOA 3B9JA 1SE2A 2JU6X 2KMAA 1ZW7A 1L7YA 3VTWA 1OFFA 2IO3B 2W3SA 4OW0A 4HXDA 1KLVA 3VVWB 2VH1A 4XDCA 2IGGA 3H1UA 5DPRA 2KNBA 3Q3FA 1V5TA 5G5GA 2WX0A 2O6VA 4ICVA 3CF6E 4FA6A 4KX6B 4A8XC 2MA9B 1HTQA 4YL8A 4A90A 4LK0M 1WGDA 2LFIA 4BKTA 2J7QB 2LUMA 4HKQA 2G45B 1SXTA 2HDEA 3PRPB 1TIFA 2FUHB 2WNMA 4C4VA 3AE2B 4ZRQA 4GMVA 3ZGZA 2BBCA 5IP4D 4PYZA 1E10A 1XO3A 1C78A 1I42A 4PS3A 3VUWA 3PREA 4BOZB 2MJ3A 4JLCA 3B2GA 3DBHI 4K3CA 4S0RA 1IYFA 2K6QA 3NVVA 1LO5D 2LXCA 2NVUI 3DBLI 3QC8B 3RI7C 1QKZA 2AQ1B 3W2DA 4B0MA 2N9XA 2KFJA 1E7PB 3JSVA 1D4BA 1KF6B 4HPLB 4IDIA 4MJSA 5IOIA 1V1OA 2EELA 4W9KA 3DVNU 1OEYA 2ASQA 2SEBD 5LXIB 5AZGA 5JH5C 2MBQA 1MG8A 1WX7A 2QDFA 2V0GA 2IGHA 2ZNVC 1DOYA 3ZRFA 2Y5CA 3M95A 1K8RB 5IKCM 2L8JA 5LNK1 1SE3A 1FCLA 1RM6C 2KVRA 1RFAA 2DHZA 4HEA1 4US9A 2CHWA 3GZNB 2WWZA 3U2SC 2BYFA 2I1KA 4RM9A 3PRMB 3BWUD 2KWDA 4ARCA 3V61A 1R4NB 2BB5A 3P4RB 2QC8A 1S1QB 3ZUNA 3DVNV 3VRAB 3KYCD 3AEBB 1HZ5A 3MC8A 4USAA 4US8A 1L6UA 2JZPA 2G1EA 2B76B 3EC8A 2PE6B 2KWUB 2M17A 2LGSA 1T3QA 4N9F4 1L2NA 5IN7A 4IM0A 1MFWA 3V05A 1MJDA 1OGWA 1I4PA 3TEWA 3ENEA 3AEFB 1OEYJ 4DXGA 2ZNVB 3GZNI 1N62A 1TBEA 2EKEC 1KJTA 4LDTD 1WZ3A 1NDDA 1D3ZA 2GBKA 2WXKA 4OVUA 3FILA 5D3IB 2KFKB 4GDLB 1I4GA 1EWCA 5JHBA 3GB1A 1TZOA 5HFYA 1L0YB 2R2OA 3IVFA 1YJ1A 2DX5B 2WS3B 3L08A 1Z2MA 3ZYYX 4YTPB 2JUOA 1ZE3D 4KSLC 4II3B 2CR5A 2JXXA 3AU5A 2VZKD 3X23A 4ANVA 1SJED 4P16A 1FM0D 3WIMA 1YQ3B 2GBMA 3AV8A 5BO4B 2G3QB 5G2NA 1ZPSA 4BFRA 1E8ZA 3J9CA 3ZTDA 2DYOA 1WH3A 2KDIA 1UD7A 3N3KB 1E7VA 1LXDA 2LGYA 4TUUA 1FXAA 3NS8A 1ESFA 3HIZA 4WJNA 2W3RA 1YJJA 4K7WA 1WJNA 1ZKHA 4E74A 4RFBA 3ML9A 2XK5B 1SIJA 4RGNA 1WRIA 2N7DA 3HHMA 4HCPB 4MJSB 3V3XA 2K5PA 2XBBC 3AXCA 2CHXA 4M0WA 3DVGX 3SHQA 2RDHA 2MJEA 3RFZB 2FIFA 1GUAB 3K9PB 2BYEA 5JXVA 1FFUA 2NBVB 2O2VA 1UNSA 5TR5A 4AQ7A 2KQSA 3B08A 2OHFA 4KSKC 3HRDD 3AN1A 1F2RC 4M8MA 3URYA 1L4DB 2D10A 3IHPC 1WJ6A 2WXNA 2GOWA 1XT9B 3Q69A 2BS2B 2KN4A 3OWEB 2Y5BB 1SGHA 3L16A 2L00B 3Q3NC 4HCNB 1J7CA 2GRIA 2J0KA 4XZ4A 4MH0E 3BZDB 3L17A 3UGBB 1C4AA 2EMSA 3R7RA 3M63B 2J42A 3B1LX 3Q8AA 3EECA 4PS7A 4GN1A 4AJWA 2QJLA 4L1BA 3SU8X 4RM8A 3W1SC 3RUIB 3AE7B 2AL3A 4AOFA 4MDKE 1WIAA 3LXFA 2RDBC 2O6VD 4B6WA 1I35A 1SE4A 1FIQA 1SF0A 4ZRIA 4C56C 3TL5A 1R4MB 4KZCA 1FNVA 4JX1C 1WMHA 1L4ZB 3Q8BA 1V1PB 2RD0A 4EOYA 3DDCB 2KXJA 2MBOA 2L7RA 3H7PA 1ROEA 4F7ZA 2X38A 4BKSD 3SR6A 4XE0A 4GB9A 2NCNA 1WGHA 4LCDE 2L83A 2PW9A 3AMZA 1AARA 2L52A 4G50A 1E0ZA 2V9HA 2GMIC 1HXYD 4KGSA 2ZW1A 3HM6X 1CK1A 1VZ8A 4A55A 3NY5A 1TGZB 4HK2A 2HJ1A 3DBSA 1WRDB 4JQWC 3Q3OC 2IYDB 4IW0A 1C77A 2LXAA 4W9FA 5J17A 3VXWA 3BIID 3DBRI 3WAPA 1PQSA 4LJPB 3IT6B 2G4DB 2INDC 5D6JB 1P3QU 2MP2A 4M01A 1RFKA 3NVZA 2ON8A 3RYTA 5CTRC 1Y8RC 2NPTA 3RNEC 1EM7A 1KTKA 2BQQA 4WIPA 2M8SA 5T8IA 4MACA 1YQBA 1RRBA 3AE6B 3Q3JA 4MM3A 1QOBA 4A9AA 3PS6A 5D3DA 2KVZA 3ZNZB 5TSSA 2W9NA 1ZUD2 4UDUC 1XLOA 3R2TA 1PYWD 1ZDXA 1QLBB 4RMAA 1U4AA 5HG2A 2QSDA 3Q2AC
chains in the Genus database with same CATH topology
4ITKA 5G5GA 1XXGA 5EE1A 3W1SA 3LYYA 4KGTA 4KX6B 4A8XC 4C7YA 2E3TA 4A90A 2DLBA 2ZW0A 1XLPA 1L6VA 4RGMA 5G5HA 4LK0M 4WWMA 2Z8LA 5H92C 2J53A 1GAQB 3TUOA 2LFIA 2N0SB 2LUMA 2PKOA 4HKQA 1CQVA 4YTNB 2WXRA 1D5XC 1VZ6A 2PIAA 1SXTA 1NEKB 1MPEA 3DWMA 4IKGA 2HDEA 3BK1A 2CJNA 3W5VB 1V8CA 1HZ6A 4HJGE 3PO0A 2WNMA 1NYQA 3N9YC 4J3OD 1T6BX 3AEAB 3AE2B 4ZRQA 3ZGZA 3E9SA 2BBCA 1TY0A 2MJDA 1E10A 2QIEB 3MFGA 1XO3A 2L1AA 1C78A 3FAHA 2JYTA 2JSVX 1MHXA 1N63A 1TY2A 1V97A 3AEEB 1ZXHA 2IPKD 1VLBA 4KGRA 2MJ3A 3B2GA 4GLSC 1PGBA 3T3NA 4MH8A 1IGCA 3NVVA 1OQRA 1LO5D 1YMHE 3AEDB 1P7EA 1CZPA 1I4RA 2J52A 4ZYSA 2K0PA 1QKZA 2AQ1B 2CJOA 3EUB2 3TEYA 2PVOD 3W2DA 4B0MA 4OVZA 1VDVA 1EU4A 2M19A 2N9LA 3W5UB 1TS2A 1FO4A 2WXQA 3EGRA 1ZXIA 1E7PB 4WQMA 4P6VF 5AUKA 2BT6A 1D4BA 3AE5B 5EE0A 2MEKA 1KF6B 2WU2B 3ETRA 4IDIA 1QQRA 1JROA 1V1OA 1VRAB 1B1ZA 2EELA 1JWBD 3U4EG 1PUTA 4YSZB 1MI0A 5I4DA 3ZJUA 2SEBD 1BXTA 1XCTL 2M0AA 3L4PA 5AUIA 1EU3A 1WSPA 1BUIC 2CU3A 3BVGA 5MPOA 2DYMA 1HA5A 1K50A 3IAM1 2W54A 1E9MA 3KQ4A 2V0GA 2IGHA 1DOYA 2PTLA 5FK9C 2Y5CA 2JXTA 3MP9A 1TKYA 1RYJA 2BB6A 1V1PA 5LNK1 3NVYA 2BS4B 3NUHB 1SE3A 4ZRPA 1IBXB 3UI3A 2WLBA 5FR3A 1IGDA 1A70A 2YEPB 1FCLA 2W55A 4AS1A 1C9FA 1N61A 1RM6C 1NI3A 1FNWA 1C76A 4OZAA 1JMLA 2IDYA 4HEA1 5BYRA 1JW9D 4US9A 3VRBB 1PDXA 4TSSA 1XF5L 1JWAD 5BMIA 1TJEA 3U2SC 4RGTA 1ET6A 3DWGC 4MT5A 3BWUD 3CIRB 2KWDA 4ARCA 1DYQA 1SSNA 2BB5A 3P4RB 1J7AA 1FNUA 4C7ZA 1JRPA 1QOAA 2R61A 2KQ4X 3P4SB 3VRAB 3AEBB 1HZ5A 3BK2A 2JYEA 1SBBB 4USAA 1WWTA 1FEHA 4US8A 1L6UA 2JZPA 2G1EA 1OQQA 3PZ8A 2N9KA 3AE3B 5BMGA 1KH0A 2B76B 5GXGB 2MH7A 1F0ZA 1VR9A 1WXQA 4FXCA 1T3QA 3ZJVA 3CWIA 5BYQA 1ZP0B 3BVMA 2IGDA 4R3DA 1FRRA 2FBWB 1B9RA 1PGAA 5EE3A 3V05A 1SJHD 1DOXA 1FRDA 1I4PA 3NZ3A 2D5GA 3TEWA 3AEFB 4PT5A 1MHHE 1DGJA 4DXGA 2NTTA 2V4IB 1N62A 5BYSA 4HKZE 1XCQL 1DOIA 2HTME 2WXKA 2WXIA 5HI1A 3RPFC 2KAJA 3MC0B 3FILA 5D3IB 3FC4A 1I7HA 5HHDG 2WDQB 3GS2A 4GDLB 1I4GA 1QF6A 1BMLC 4YWGG 1EWCA 3GB1A 1QOFA 2H88B 1N5XA 1TZOA 1KLGD 2YEPF 5HFYA 2V3PA 1L0YB 1FCCC 4Q2JA 2NMQA 3SEBA 1GOZA 2FUG1 2JWUA 3NRZA 3PZ7A 4RNAA 1ENFA 4JE3B 4JWSC 1FXIA 2WS3B 4MM3B 2AX5A 2DBYA 4YTPB 3ZYYX 2J4XA 1ZE3D 1T5XD 4N6EB 1RWSA 4TQ0A 2Q5WD 2GB1A 1IUEA 1C4CA 1K52A 2VZKD 2VZKB 1UWXA 1SB3C 1SJED 4P16A 1FM0D 1TS4A 1YQ3B 3P42A 4REZA 2AQ3B 3AV8A 1YJIA 2XN9C 1ZPSA 2LEKA 3AB5A 3J9CA 3E56A 3LB8C 2DYOA 2IJ0A 4OZBA 4YTMB 1UGJA 1ZOYB 3AE8B 1UWMA 3AECB 3EA6A 1N5WA 2LGIA 2Y3AA 2W82A 1KLUD 3AEGB 3P1MA 4HROA 3O13A 3Q8CA 1FXAA 5H8YE 1QT9A 4WAFA 2V3NA 1ESFA 4GDKB 4TMAB 2INPE 1WGKA 1ET9A 2AQ2B 2W3RA 1YJJA 1VJKA 2KDMA 3P4QB 4B0EA 2DWQA 4RFBA 2GI9A 1SIJA 4RGNA 3ZQ4A 1ZDVA 1AW7A 1WRIA 4LLGM 2K22A 4TQ1A 3V3XA 2K5PA 2NTSA 2PLPA 1AN8A 4M0WA 1GPXA 1J7BA 1PFDA 2WXHA 3ABVB 1L5PA 4ZHPA 2RDHA 1AYFA 2WXJA 2EKIA 2MJEA 3I57A 3RFZB 3R2IA 1M4VA 4NJCA 2PMVA 4A6QA 4HRSA 5JXVA 1FFUA 5E6JA 1UNSA 2JQRB 4AQ7A 4DQOC 2OHFA 3I9V1 3VR8B 3WCQA 4N59A 1YN3A 3KWVA 1VZ7A 5BMHA 1L0VB 2WP9B 3HRDD 3AN1A 1F2RC 4ZOHC 3URYA 1L4DB 2L32A 3R8BA 1CJEA 1FFVA 3MHZA 1JWSD 2JX5A 2WXMA 2PVGC 3VQIA 2WXNA 2ICIA 1PGXA 3Q69A 1XEEA 3B2FA 4DXFA 3BVZA 1E6EB 2BS2B 5C3JB 2KN4A 3OWEB 1TS5A 2BYTA 1D5MC 4ARIA 3Q8EA 4CQNA 1J7CA 2GRIA 3HVDA 2RPVA 1D6EC 3IXSA 2FE8A 3NVWA 3U7ZA 2N7JA 3AE1B 4D2KA 3BZDB 2WXOA 3NS1A 1KFYB 3KWLA 1C4AA 2Y5PA 4KKIA 4RF1A 2J42A 1HEZE 4XWTA 4YSXB 3Q8AA 2WXFA 1GB4A 2E6XA 3AM9A 1I4QA 2LHEA 3C8YA 3U52E 2LHDA 1K53A 2QJLA 4RH6A 4L1BA 3MJ5A 1MVKA 2QMTA 2ONQA 3Q8FA 3AE7B 4L2YA 4NAMA 4RF0A 3LXFA 1WYGA 1QOGA 1TS3A 1EWYC 1FMAD 1NENB 3KLSX 1SE4A 2WDRB 1FIQA 1SF0A 1YN4A 2LMCA 2RMMA 2QILA 1I4XA 4C56C 1FNVA 4JX1C 3AE9B 1L4ZB 4H2AA 3Q8BA 4C80A 1V1PB 1STEA 2KACA 2XNAC 2WU5B 4WURA 4XWWA 2WXGA 1TYGB 2WQYB 1ROEA 1TKEA 1FD6A 2X38A 1ACCA 3SR6A 4RCOA 2WXPA 1AWDA 3P4PB 1D5ZC 4KKJA 2WXLA 4N58A 4XE0A 3T3OA 1KRHA 2TSSA 2SAKA 2L83A 4L23A 2PW9A 1JCKB 1F77A 3AMZA 5D7GA 3TEZA 1P7FA 4ZHOA 1F2RI 3HVZA 1L0XB 2L52A 2OEDA 3ZJTA 1E0ZA 4OZCA 1HXYD 4KGSA 2ZW1A 1CK1A 1VZ8A 4A55A 4IOIE 1SEBD 4NZLB 2K3UA 1JQ4A 3BYYB 1XLQA 3FILB 3TEXA 1GB1A 2I38A 1IBXA 4YXDB 2K9XA 2H89B 1NVID 1R7SA 1N60A 1YQ4B 1QILA 1C77A 3TSSA 2ACZB 3H8HA 1I4HA 3SFDB 2BW2A 1HQRD 1NYRA 3BIID 4JWUC 3AH7A 4O1NA 4WH4A 3W9CB 4LTUA 1YN5A 3GP7A 3IT6B 1Q10A 4RGOS 5FKAC 1K51A 3IT4B 1RFKA 3NVZA 1YNTE 2ON8A 4XDDA 3AE4B 1TKGA 4YSYB 5C2TB 1JWMD 2INNE 3HUIA 3SFEB 3P63A 2G9HD 4EE2A 1UUPA 1C4PA 2M56B 3BYTB 2QEJC 2KMMA 1C79A 1EM7A 1KTKA 4JPSA 4WIPA 5T8IA 3B9JA 1SE2A 4MACA 2I2YA 2JU6X 3VR9B 3AE6B 2LJIA 1QOBA 4A9AA 2BTEA 1OFFA 5D3DA 3IAS1 2W3SA 4OW0A 4NAWB 5TSSA 1Y56A 1ZUD2 1JWUD 4UDUC 2WDVB 2BS3B 5EE9A 1XLOA 3R2TA 1PYWD 1JALA 1ZDXA 1QLBB 4XDCA 2IGGA 1XLNA 5HG2A 4OHJA 2RDGA 2QSDA 4YT0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TYG B;  4ITK A;  1JWA D;  2WQY B;  1TJE A;  5G5G A;  1ROE A;  2W3R A;  1YJJ A;  1VJK A;  3P4Q B;  1TKE A;  3DWG C;  5EE1 A;  2DWQ A;  4KX6 B;  3SR6 A;  3CIR B;  1AWD A;  3P4P B;  4C7Y A;  1SIJ A;  2E3T A;  4N58 A;  3P4R B;  1J7A A;  4C7Z A;  1JRP A;  1WRI A;  1QOA A;  3NVY A;  1XLP A;  1KRH A;  1L6V A;  5G5H A;  3P4S B;  2K22 A;  3VRA B;  4WWM A;  2K5P A;  5H92 C;  2L83 A;  1GAQ B;  3AEB B;  1GPX A;  3AMZ A;  1J7B A;  2N0S B;  2PKO A;  4ZHO A;  4YTN B;  1PFD A;  3ABV B;  2L52 A;  1L5P A;  3HVZ A;  4USA A;  4ZHP A;  1AYF A;  1WWT A;  2EKI A;  2MJE A;  3SFE B;  2PIA A;  1L6U A;  4US8 A;  1NEK B;  1E0Z A;  2G1E A;  3DWM A;  1OQQ A;  3AE3 B;  2CJN A;  3W5V B;  1V8C A;  2B76 B;  3PO0 A;  5GXG B;  2MH7 A;  4HRS A;  1F0Z A;  1WXQ A;  1NYQ A;  1FFU A;  4FXC A;  3AEA B;  3AE2 B;  1T3Q A;  3CWI A;  1JQ4 A;  2MJD A;  2JQR B;  1ZP0 B;  1E10 A;  1XLQ A;  2QIE B;  1XO3 A;  1FRR A;  3FAH A;  2FBW B;  2OHF A;  1N63 A;  1V97 A;  3AEE B;  3VR8 B;  3WCQ A;  4N59 A;  1B9R A;  4YXD B;  5EE3 A;  1DOX A;  1VLB A;  2H89 B;  1FRD A;  1L0V B;  1NVI D;  2K9X A;  3ZYY X;  1R7S A;  2WP9 B;  3HRD D;  1N60 A;  3AN1 A;  1YQ4 B;  2MJ3 A;  4ZOH C;  3AEF B;  3B2G A;  1CJE A;  1DGJ A;  1OQR A;  1FFV A;  2ACZ B;  3AED B;  3NVV A;  1N62 A;  1CZP A;  3VRB B;  1DOI A;  2HTM E;  3SFD B;  2JX5 A;  2CJO A;  2PVG C;  3EUB 2;  2PVO D;  1NYR A;  2KAJ A;  3BII D;  3RPF C;  4JWU C;  3AH7 A;  1VDV A;  3W9C B;  2M19 A;  3FC4 A;  3W5U B;  4LTU A;  3B2F A;  1I7H A;  1FO4 A;  2WDQ B;  1QF6 A;  5C3J B;  1E6E B;  2BS2 B;  1ZXI A;  1E7P B;  1QOF A;  4WQM A;  2H88 B;  1N5X A;  4P6V F;  5AUK A;  2BT6 A;  1J7C A;  3AE5 B;  5EE0 A;  1KF6 B;  2WU2 B;  1RFK A;  3ETR A;  3NVZ A;  4IDI A;  4YSY B;  3NRZ A;  3AE4 B;  1TKG A;  1JRO A;  3NVW A;  5C2T B;  4JWS C;  1FXI A;  2WS3 B;  3AE1 B;  2AX5 A;  3HUI A;  2DBY A;  4YTP B;  3NS1 A;  1KFY B;  3P63 A;  4YT0 B;  1JWB D;  3KWL A;  4N6E B;  1RWS A;  2Q5W D;  1IUE A;  1PUT A;  2M56 B;  4YSZ B;  1SB3 C;  4YSX B;  2KMM A;  3L4P A;  1FM0 D;  5AUI A;  5MPO A;  2CU3 A;  3AM9 A;  1YQ3 B;  3B9J A;  2QJL A;  2W54 A;  3AV8 A;  1E9M A;  1YJI A;  3VR9 B;  3AE6 B;  2LEK A;  1DOY A;  1QOB A;  3AE7 B;  3AB5 A;  4A9A A;  1OFF A;  2Y5C A;  3LXF A;  3LB8 C;  1WYG A;  1QOG A;  1RYJ A;  1EWY C;  1FMA D;  1TKY A;  2W3S A;  1NEN B;  4YTM B;  2WDR B;  1FIQ A;  1SF0 A;  1ZOY B;  1ZUD 2;  1UWM A;  2BS4 B;  2WDV B;  3AE8 B;  3AEC B;  2WLB A;  2BS3 B;  5EE9 A;  1A70 A;  1XLO A;  1N5W A;  2W55 A;  3AEG B;  1JAL A;  3P1M A;  1RM6 C;  1N61 A;  1QLB B;  1NI3 A;  3AE9 B;  4HRO A;  4JX1 C;  4C80 A;  1FXA A;  5H8Y E;  1QT9 A;  1XLN A;  1JW9 D;  4US9 A;  2WU5 B;  1PDX A;  1WGK A; 
#chains in the Genus database with same CATH topology
 4KDL B;  4IC7 B;  1XXG A;  3GE3 C;  5C1Z A;  4IWQ A;  1V2Y A;  2MBH A;  4KIK A;  3V6C B;  2MCN B;  2G4S A;  1XLP A;  2ZCC A;  1L6V A;  5G5H A;  1J0G A;  2NBU A;  5H92 C;  3TUO A;  2PKO A;  5IAA C;  1CQV A;  2UWQ A;  2KJ6 A;  2PIA A;  1NEK B;  1MPE A;  2XK5 A;  3QHT A;  4KZ0 A;  1HZ6 A;  2GBJ A;  4HJG E;  3W5V B;  1NYQ A;  3AEA B;  1EO6 A;  2KX3 A;  3OLM D;  1TY0 A;  4I6P A;  4K81 A;  2N4F A;  3ZDT A;  3RNA C;  1TY2 A;  5DPT A;  1ZXH A;  1V81 A;  2D3B A;  4GLS C;  3T3N A;  2MWS B;  1OQR A;  2RR9 A;  2D2Q A;  4DK5 A;  3EUB 2;  1VD2 A;  2K39 A;  5D94 A;  5FR6 A;  2M19 A;  2N9L A;  3W5U B;  1XD3 B;  2WXQ A;  3VAW A;  2NS5 A;  1WE7 A;  2WX1 A;  4P6V F;  2JZZ A;  2BT6 A;  2KX0 A;  2MEK A;  4TKN A;  4MSQ B;  3CST A;  1VRA B;  2V1Y A;  4FHK A;  4NAW A;  3ZNH B;  4DHZ B;  4YSZ B;  1MI0 A;  3PSE B;  1BXT A;  1GNU A;  1EU3 A;  5AUI A;  1BUI C;  1F1H A;  5MPO A;  1HA5 A;  3EFC A;  4DWF A;  2W54 A;  2K25 A;  2PTL A;  3MP9 A;  1RYJ A;  1V1P A;  3NZU A;  3NVY A;  2C7H A;  3ZO5 B;  1IGD A;  1WGY A;  3H9D A;  1C9F A;  2IDY A;  1WR1 A;  3VRB B;  1PDX A;  1XF5 L;  2LJ5 A;  5BMI A;  1V5O A;  1E5W A;  2DYB A;  3QQ8 B;  1ET6 A;  3DWG C;  4K7S A;  4E3C A;  5CHW A;  1DYQ A;  2HTH A;  1SSN A;  1EF5 A;  4FBJ B;  4C7Z A;  1WX8 A;  1FNU A;  1JRP A;  1V86 A;  1QOA A;  2R61 A;  3P4S B;  3DBR B;  5LXH A;  1WWT A;  2WDT B;  2JWZ A;  3AE3 B;  1KH0 A;  3D32 A;  3AI5 A;  5GXG B;  2MH7 A;  1F0Z A;  4FXC A;  4I6N B;  3ZJV A;  5BYQ A;  2AYO B;  3BVM A;  1FRR A;  3PPA A;  2KJR A;  1IPG A;  4FUL A;  4HLE A;  1PGA A;  3U8Z A;  1FRD A;  3QAQ A;  2D5G A;  3VHT C;  1MHH E;  2NTT A;  2C5L C;  4HKZ E;  1DOI A;  4J6I A;  3RPF C;  3MC0 B;  2LUE A;  4JIO U;  3FC4 A;  1HTO A;  1E8W A;  2DZM A;  4FN2 A;  2LZ6 A;  2QCZ A;  2YEP F;  3EFU A;  2CS4 A;  1F9J A;  2ZVN A;  1GOZ A;  3NRZ A;  3PZ7 A;  4RNA A;  1EF1 A;  1ENF A;  4JE3 B;  3UQA A;  2HE7 A;  4NY0 A;  2J4X A;  1J19 A;  1RWS A;  4GOC A;  2GB1 A;  2VZK B;  1UWX A;  1SB3 C;  3PHW B;  5KHQ A;  1T0R C;  2LEK A;  1WZ0 A;  3U7D A;  3PHX B;  3LB8 C;  2KMC A;  2IJ0 A;  4YTM B;  2Z0D B;  3EA6 A;  4DXA B;  1N5W A;  3Q14 C;  2Y3A A;  1KLU D;  2ZEQ A;  3APC A;  4NQL B;  4GDK B;  2DEN B;  2INP E;  1WGK A;  4HDQ A;  2KTR A;  2IY1 B;  1VJK A;  2BYV E;  3ZNG C;  3PZD A;  1OQY A;  1YX6 B;  1ZDV A;  2LRU A;  2V3S A;  3R3M A;  2NTS A;  2CHZ A;  3PT2 B;  2MP2 B;  1L5P A;  1UBQ A;  4AP4 C;  1M4V A;  3K9O B;  4NJC A;  1UEL A;  3FKY A;  2WGS A;  4DHJ B;  2MQJ A;  4MSM B;  2JQR B;  3TMP B;  4DQO C;  2KOX A;  1RAX A;  3WCQ A;  2JRI B;  1YN3 A;  3KWV A;  1VZ7 A;  5BMH A;  2OJR A;  1WMH B;  4FAD A;  1E8X A;  3RZF A;  4ZOH C;  3VFK A;  2GBR A;  3RUL A;  4LJO B;  1JWS D;  2WXM A;  3VQI A;  2J0M A;  3A1Q A;  4TV3 A;  2DZJ A;  2ZCB A;  1G6J A;  3ZXR A;  2KTF A;  5HKH A;  1E6E B;  2BYT A;  4M0W B;  4CQN A;  2RPQ A;  1WY8 A;  2CKH B;  4C00 A;  3IXS A;  2JVC A;  4EKU A;  2Y5P A;  4WQO B;  3M62 B;  1HEZ E;  4XWT A;  4YSX B;  3A9J A;  3C8Y A;  4RH6 A;  1OTR B;  3MJ5 A;  4NAM A;  2YLM A;  1EWY C;  3KLS X;  2WDR B;  5DPW A;  2RMM A;  2QIL A;  1LGR A;  2WYQ A;  4C80 A;  1WXS A;  2VH2 A;  2XNA C;  4WUR A;  3R7Q A;  4MGK E;  1T0Y A;  3BY4 B;  1TKE A;  1P98 A;  4ZRJ A;  2WXP A;  3VUX A;  3P4P B;  1D5Z C;  2L76 A;  3RN9 C;  1CMX B;  3DHH C;  4ICU A;  1KRH A;  1NI2 A;  2SAK A;  3C19 A;  2L0F A;  2GLS A;  4L23 A;  4PS8 A;  1F77 A;  1JCK B;  4G3X B;  1P7F A;  3ZTC A;  4ZHO A;  3B0A A;  4CO7 A;  4OZC A;  5E6O A;  4IOI E;  2UYZ B;  4DDI D;  2D07 B;  1UZX B;  1XLQ A;  2KWC A;  1QZE A;  3KYD D;  1WYW B;  3FIL B;  3TEX A;  4YXD B;  3ZXV A;  4GU2 A;  4MEM A;  3QK0 A;  1H4R A;  3SFD B;  1NYR A;  2MBE A;  4F1S A;  4LTU A;  1YN5 A;  1Q10 A;  1WXV A;  2FID A;  4BKG A;  4DBG A;  4XDD A;  4YSY B;  2CU1 A;  3AE4 B;  5C2T B;  1A5R A;  1IP9 A;  4W9L A;  2V4L A;  3PVL A;  1WJ4 A;  3PV1 A;  2LRW A;  1C79 A;  4ASW C;  4W9D A;  3L10 B;  3QIJ A;  1ZGU B;  4S17 A;  3ZKJ C;  3OJ3 A;  2UU7 A;  2BTE A;  2LGX A;  1UBI A;  2BS3 B;  5EE9 A;  1JAL A;  4HJK A;  2KT7 A;  1XLN A;  4OHJ A;  2RDG A;  1E8Y A;  2R2Q A;  1SIF A;  2IO2 B;  4NJ6 A;  5EE1 A;  3LYY A;  2E3T A;  3QWZ B;  3I3T B;  2DLB A;  3UIO B;  4IG7 B;  3BIN A;  2J53 A;  3DBL B;  3ZNI D;  4YTN B;  1D5X C;  1VZ6 A;  5KHO A;  4IKG A;  3BK1 A;  3APD A;  1V8C A;  3L0W B;  2MX2 A;  3N9Y C;  4J3O D;  1T6B X;  2RGF A;  3JW0 X;  3MFG A;  2L1A A;  3UQB A;  3RMK C;  4BBN F;  4ZDV A;  1MHX A;  3AEE B;  3T9L A;  2IPK D;  2ZZP B;  2HD5 B;  3IBE A;  4KGR A;  2B3A A;  1IGC A;  1YMH E;  3AED B;  1P7E A;  1CZP A;  4ZYS A;  3TEY A;  1YIW A;  2PVO D;  2LAS A;  4JL9 A;  4KIK B;  4OVZ A;  1EU4 A;  1Q0W B;  2K1F A;  1Q1O A;  1WX9 A;  3L13 A;  4BZA A;  1FO4 A;  3UF8 A;  2FCN A;  1ZXI A;  4WQM A;  5AUK A;  3MC9 A;  3AE5 B;  2WU2 B;  3DPD A;  3ETR A;  4LNI A;  4M8N A;  4WAA A;  1WM3 A;  1JWB D;  2KYW A;  3U4E G;  3C0R B;  4LNF A;  1PUT A;  2PJH A;  5I4D A;  1XCT L;  2M0A A;  2LGD A;  2DYM A;  1S3S G;  4EFO A;  2JY6 A;  1E9M A;  3ALB A;  3QAR A;  4AWJ A;  3UIP B;  4XGA B;  4W9G A;  3PLU A;  5FK9 C;  1TKY A;  3PGE A;  2BB6 A;  5AZF A;  2BS4 B;  4ZRP A;  1C1Y B;  1IBX B;  5FR3 A;  1A70 A;  1RLF A;  4HVB A;  2YEP B;  4WWN A;  2L05 A;  1N61 A;  1NI3 A;  1N6Z A;  2C9W B;  4OZA A;  1JML A;  4IWO A;  5BYR A;  4TSS A;  2XEW A;  1JWA D;  2JT4 B;  1TJE A;  4XX5 A;  4RGT A;  3CIR B;  2M1M A;  1P0R A;  2KZR A;  3H7S A;  4E71 A;  3NZS A;  3H6N A;  3V60 A;  2KQ4 X;  1TZ1 A;  2KN5 A;  3BK2 A;  1XQQ A;  1SBB B;  4HWI B;  2NBW B;  3DVG Y;  1FEH A;  2O2V B;  3A9J B;  1E90 A;  4NJ7 A;  3PLV A;  1VR9 A;  4LNO A;  4F8C B;  4XC2 A;  2BVC A;  2JZ3 B;  2KC1 A;  3KUZ A;  3CWI A;  1F52 A;  2IGD A;  1B9R A;  1DOX A;  4FHJ A;  3WAL A;  2C7M B;  3IG3 A;  3ZVV A;  3MHS D;  2V4I B;  2DZK A;  5BYS A;  1XCQ L;  3M3J A;  5E6P A;  2HTM E;  4P1C C;  5HI1 A;  2KAJ A;  4X57 B;  3QX1 A;  2D11 A;  3DHG C;  1LQB A;  1QF6 A;  1BML C;  4YWG G;  1P9D U;  2H88 B;  3WA0 A;  1KLG D;  4BKS A;  3N1Z C;  2K8C A;  1FCC C;  3UIN B;  2NMQ A;  2A5U A;  3SEB A;  2FAZ A;  2FUG 1;  2JWU A;  2D3A A;  4MM3 B;  5IA7 A;  2ZVO A;  4JWS C;  2AX5 A;  5JZE B;  2DBY A;  4TQ0 A;  3DBH B;  1IUE A;  1TS4 A;  3P42 A;  2FCQ A;  2XN9 C;  3KUC B;  4WWP A;  3AB5 A;  3L54 A;  4OZB A;  1ZOY B;  3AE8 B;  3DOW A;  3AEC B;  2KQ7 A;  3HM3 A;  4ACF A;  2W82 A;  3P1M A;  4HRO A;  3JVZ X;  5H8Y E;  2V3N A;  4TMA B;  1V80 A;  3RZW C;  2KDM A;  3MTN B;  3P4Q B;  4B0E A;  3KUD B;  4EEW A;  3H7P B;  4LLG M;  2K22 A;  2PPH A;  2M0X A;  1E7U A;  1GPX A;  3RNG C;  5JHA A;  3RNC C;  1PFD A;  1WF9 A;  2ZJD A;  4ZHP A;  2EKI A;  2DNF A;  3I57 A;  4FLH A;  2HJ8 A;  1H8C A;  2K6D B;  1BT0 A;  4W9J A;  3VR8 B;  4N59 A;  2KDB A;  1L0V B;  1TTN A;  3R8B A;  3V62 A;  1CJE A;  2RSU A;  3DHI C;  4DXF A;  5C3J B;  3NG0 A;  4ARI A;  3JYU A;  3TBL D;  3T8M A;  4BBN C;  3HVD A;  1VCB A;  2RPV A;  2DAJ A;  5C23 A;  3NVW A;  3U7Z A;  2WXO A;  1KFY B;  2KLG A;  3KWL A;  4KKI A;  4RF1 A;  3VTV A;  3AUL A;  2PE9 A;  2WXF A;  4ZRK A;  2LHE A;  3I5J C;  1K53 A;  1MVK A;  1V9J A;  3Q8F A;  4L2Y A;  4RF0 A;  1LM8 B;  1QOG A;  1TS3 A;  1FMA D;  1V6E A;  1WXA A;  3VDZ A;  1NBF C;  2LMC A;  3A9K A;  4KV2 A;  3AE9 B;  4H2A A;  2D3G A;  1SE9 A;  2KAC A;  2WU5 B;  1YOV B;  2WXG A;  4FJZ A;  3WAN A;  1WR6 E;  3ECI A;  1FD6 A;  2FCM A;  1ACC A;  4RCO A;  3VH4 B;  1AWD A;  3VH3 B;  2L3Z A;  4N58 A;  2TSS A;  3IFW B;  2D3C A;  3TEZ A;  3HK0 A;  3X0W A;  2MLB A;  3AU4 A;  3HVZ A;  4W9I A;  3ZJT A;  1C3T A;  3Q6B A;  3I63 C;  4BVU C;  1GG3 A;  1SEB D;  2K3U A;  2WHI A;  3CMM B;  2A4Z A;  2K8H A;  1GB1 A;  1IBX A;  4P1B C;  1NVI D;  1WI0 A;  1R7S A;  1YQ4 B;  3OJ4 B;  4ZYN A;  4GIV A;  2ACZ B;  2KC2 A;  5CHF A;  4K3B A;  2BW2 A;  3N32 A;  3ZW3 A;  3AH7 A;  2C7N B;  3NOB A;  5DCN A;  4DHZ E;  2Z0E B;  3O65 B;  1K51 A;  3IT4 B;  1R4N I;  4NNJ B;  3TJP A;  3LDZ E;  3N1Y C;  3RNB C;  2J0J A;  4XYC A;  1JWM D;  2INN E;  3HUI A;  3SFE B;  1M94 A;  3P63 A;  2G9H D;  4EE2 A;  4MEL A;  2KMM A;  2M4N A;  3RD2 A;  4WJQ A;  3SDL C;  2I2Y A;  3VR9 B;  2BKF A;  1WXM A;  2LJI A;  4ANU A;  1Q5W B;  3IAS 1;  4NAW B;  1Y56 A;  3OAW A;  1JWU D;  2WDV B;  2DZI A;  3KW5 B;  1FXT B;  4D2K A;  4YT0 B;  4ITK A;  4MGI E;  3W1S A;  3NJT A;  4KGT A;  2KJH B;  2LD9 A;  4C7Y A;  2KTR B;  2ZW0 A;  4RGM A;  4WWM A;  2Z8L A;  4LNN A;  1GAQ B;  2N0S B;  2WXR A;  2IBI B;  3DWM A;  3QCA A;  2CJN A;  5DPS A;  3PO0 A;  2MW5 A;  1WE6 A;  4KVG B;  3E9S A;  1TT5 B;  2MJD A;  3ONS A;  2QIE B;  3FAH A;  2JYT A;  2REX A;  2JSV X;  5AZH A;  1N63 A;  1V97 A;  4ANX A;  2DAF A;  2EMT A;  1VLB A;  5D2M B;  2N1W A;  1KM7 A;  1YD8 U;  1PGB A;  4MH8 A;  3JSV B;  1I4R A;  2J52 A;  2K0P A;  2CJO A;  3EHV A;  4W9E A;  1VDV A;  1TS2 A;  5IO9 A;  3ZIM A;  4G0N B;  3EGR A;  2BKR B;  5EE0 A;  2KLC A;  1QQR A;  2OOB B;  1JRO A;  1B1Z A;  3V6E B;  4A20 A;  4DHJ D;  5GMV A;  4CHK A;  3CSF A;  3ZJU A;  4M00 A;  3PTF C;  3L4P A;  3PRZ A;  4K7U A;  1WSP A;  2CU3 A;  3BVG A;  1K50 A;  3IAM 1;  2FCS A;  2NPT B;  3KQ4 A;  4WJP A;  3KH0 A;  4HDO A;  4FJV B;  2C60 A;  2JXT A;  3NUH B;  4URK A;  3UI3 A;  2WLB A;  2W55 A;  4AS1 A;  1FNW A;  1C76 A;  1JW9 D;  1MG4 A;  3ZLZ A;  3MJW A;  3A33 B;  4MT5 A;  5EDS A;  2BWE S;  3A4S C;  4GDK A;  1YX5 B;  2VRR B;  4HPP A;  1J7A A;  2KD0 A;  4B9K A;  2X8X X;  1FPY A;  1UF0 A;  1UGM A;  2JYE A;  3WAO A;  1OQQ A;  2IO0 B;  3PZ8 A;  2N9K A;  3N20 C;  5BMG A;  1WXQ A;  3LJ3 A;  4IM3 A;  3WAM A;  1ZP0 B;  4R3D A;  2QHO A;  3A1Q B;  2FBW B;  2KO3 A;  5EE3 A;  1SJH D;  3ZRC A;  2GBN A;  3NZ3 A;  4PT5 A;  2INC C;  1DGJ A;  4GSW A;  5L95 C;  2JPH A;  1Z5S B;  2LWP A;  2YVC A;  4GDL A;  2OJW A;  2WXI A;  5J2R A;  1V49 A;  1I7H A;  5HHD G;  2WDQ B;  3GS2 A;  2IO1 B;  4EUT A;  1QOF A;  1N5X A;  2LI5 A;  3S2A A;  5L83 A;  2V3P A;  1J8C A;  4Q2J A;  3U30 A;  1FXI A;  4N6E B;  1T5X D;  2Q5W D;  1C4C A;  1K52 A;  2N9P C;  4REZ A;  2AQ3 B;  2L0T A;  1YJI A;  4C4V B;  3E56 A;  4KDI C;  4PYU A;  1UGJ A;  1UWM A;  2PEA A;  2KWV B;  2LGI A;  3AEG B;  3O13 A;  3Q8C A;  3TIX A;  1QT9 A;  4M02 A;  4WAF A;  2IY0 B;  5CX3 A;  4BOS C;  2KFK A;  1ET9 A;  2AQ2 B;  3NHE B;  5LLI A;  1WJU A;  2DWQ A;  2MRP A;  4I6L B;  3DCG A;  2GI9 A;  2I1J A;  3ZQ4 A;  1AW7 A;  3TCA A;  5AEK B;  2MHJ A;  2N1V A;  4MGY E;  4TQ1 A;  2PLP A;  1AN8 A;  4P7I A;  1J7B A;  2WXH A;  3ABV B;  4NQK E;  3P2B A;  1AYF A;  2WXJ A;  2ZPY A;  4EZL A;  3R2I A;  4K1R B;  3ML8 A;  2JRH A;  2PMV A;  4A6Q A;  1UH6 A;  4HRS A;  3SD5 A;  2KDF B;  5E6J A;  3N30 A;  3RNF C;  2IZV B;  4EZJ A;  3I9V 1;  2AEH A;  2WP9 B;  1HE8 A;  2L32 A;  3A9K B;  1FFV A;  3DQV A;  2BPS A;  3RCZ A;  3MHZ A;  2JX5 A;  2PVG C;  5CHV C;  2ICI A;  1GJZ A;  1PGX A;  1KOT A;  1XEE A;  3B2F A;  4JGH B;  3BVZ A;  1TS5 A;  1D5M C;  2LVQ A;  4IWP A;  3Q8E A;  4AJY B;  4B95 A;  4FJY A;  1D6E C;  4ANW A;  2FE8 A;  1WFY A;  1T0Q C;  2N7J A;  3AE1 B;  4HPM B;  3VTU A;  3NS1 A;  1X1M A;  3GE8 C;  3QJZ A;  4WWO A;  3RT3 B;  4EZK A;  3Q3M C;  4LDT B;  1GB4 A;  2E6X A;  2N9E B;  1I4Q A;  1WGR A;  3AM9 A;  3U52 E;  2FNJ B;  2LHD A;  4II2 B;  4A3P A;  2LVP A;  2LVO A;  4W9C A;  2QMT A;  2ONQ A;  2K8B A;  1WYG A;  2AWT A;  4QAY A;  2ZPN A;  1NEN B;  2MSE D;  1YN4 A;  2KHW B;  1I4X A;  1ISN A;  4G11 A;  1STE A;  4AUQ C;  4IUM B;  4XWW A;  1TYG B;  2WQY B;  3KVF B;  5G55 A;  2AL6 A;  3GOE A;  4PK1 A;  4KKJ A;  1LFD A;  4NPN A;  2WXL A;  4IM2 A;  4A3O A;  3T3O A;  2KKC A;  2BWF A;  5E6N A;  5D7G A;  2Z59 B;  1F2R I;  1L0X B;  2OED A;  2KDE B;  2KK8 A;  1JRU A;  3QA8 A;  4BAX A;  2N7E A;  4NZL B;  4OVV A;  4MGZ E;  1JQ4 A;  3BYY B;  2BF8 B;  1EUV B;  2I38 A;  2K9X A;  2H89 B;  4GGQ A;  4CYE A;  1N60 A;  1T0S C;  4LNK A;  1WGG A;  1QIL A;  3R66 C;  3TSS A;  1WM2 A;  3H8H A;  1I4H A;  4W9H A;  1GC6 A;  1HQR D;  2O6V B;  2MBB B;  3N1X C;  2NR2 A;  4JWU C;  4O1N A;  1P1A A;  4WH4 A;  3W9C B;  1R4M I;  2JF5 A;  3ZDM C;  3A4R A;  3GP7 A;  4DDG D;  3OG5 A;  2KAN A;  4RGO S;  5FKA C;  4GXB A;  1YNT E;  1TKG A;  3W1Y A;  2BGF A;  3VUY A;  1UUP A;  1C4P A;  2M56 B;  3APF A;  3BYT B;  2QEJ C;  1GC7 A;  5J18 A;  4JPS A;  4WJO A;  3B9J A;  1SE2 A;  2JU6 X;  2KMA A;  1ZW7 A;  1L7Y A;  3VTW A;  1OFF A;  2IO3 B;  2W3S A;  4OW0 A;  4HXD A;  1KLV A;  3VVW B;  2VH1 A;  4XDC A;  2IGG A;  3H1U A;  5DPR A;  2KNB A;  3Q3F A;  1V5T A;  5G5G A;  2WX0 A;  2O6V A;  4ICV A;  3CF6 E;  4FA6 A;  4KX6 B;  4A8X C;  2MA9 B;  1HTQ A;  4YL8 A;  4A90 A;  4LK0 M;  1WGD A;  2LFI A;  4BKT A;  2J7Q B;  2LUM A;  4HKQ A;  2G45 B;  1SXT A;  2HDE A;  3PRP B;  1TIF A;  2FUH B;  2WNM A;  4C4V A;  3AE2 B;  4ZRQ A;  4GMV A;  3ZGZ A;  2BBC A;  5IP4 D;  4PYZ A;  1E10 A;  1XO3 A;  1C78 A;  1I42 A;  4PS3 A;  3VUW A;  3PRE A;  4BOZ B;  2MJ3 A;  4JLC A;  3B2G A;  3DBH I;  4K3C A;  4S0R A;  1IYF A;  2K6Q A;  3NVV A;  1LO5 D;  2LXC A;  2NVU I;  3DBL I;  3QC8 B;  3RI7 C;  1QKZ A;  2AQ1 B;  3W2D A;  4B0M A;  2N9X A;  2KFJ A;  1E7P B;  3JSV A;  1D4B A;  1KF6 B;  4HPL B;  4IDI A;  4MJS A;  5IOI A;  1V1O A;  2EEL A;  4W9K A;  3DVN U;  1OEY A;  2ASQ A;  2SEB D;  5LXI B;  5AZG A;  5JH5 C;  2MBQ A;  1MG8 A;  1WX7 A;  2QDF A;  2V0G A;  2IGH A;  2ZNV C;  1DOY A;  3ZRF A;  2Y5C A;  3M95 A;  1K8R B;  5IKC M;  2L8J A;  5LNK 1;  1SE3 A;  1FCL A;  1RM6 C;  2KVR A;  1RFA A;  2DHZ A;  4HEA 1;  4US9 A;  2CHW A;  3GZN B;  2WWZ A;  3U2S C;  2BYF A;  2I1K A;  4RM9 A;  3PRM B;  3BWU D;  2KWD A;  4ARC A;  3V61 A;  1R4N B;  2BB5 A;  3P4R B;  2QC8 A;  1S1Q B;  3ZUN A;  3DVN V;  3VRA B;  3KYC D;  3AEB B;  1HZ5 A;  3MC8 A;  4USA A;  4US8 A;  1L6U A;  2JZP A;  2G1E A;  2B76 B;  3EC8 A;  2PE6 B;  2KWU B;  2M17 A;  2LGS A;  1T3Q A;  4N9F 4;  1L2N A;  5IN7 A;  4IM0 A;  1MFW A;  3V05 A;  1MJD A;  1OGW A;  1I4P A;  3TEW A;  3ENE A;  3AEF B;  1OEY J;  4DXG A;  2ZNV B;  3GZN I;  1N62 A;  1TBE A;  2EKE C;  1KJT A;  4LDT D;  1WZ3 A;  1NDD A;  1D3Z A;  2GBK A;  2WXK A;  4OVU A;  3FIL A;  5D3I B;  2KFK B;  4GDL B;  1I4G A;  1EWC A;  5JHB A;  3GB1 A;  1TZO A;  5HFY A;  1L0Y B;  2R2O A;  3IVF A;  1YJ1 A;  2DX5 B;  2WS3 B;  3L08 A;  1Z2M A;  3ZYY X;  4YTP B;  2JUO A;  1ZE3 D;  4KSL C;  4II3 B;  2CR5 A;  2JXX A;  3AU5 A;  2VZK D;  3X23 A;  4ANV A;  1SJE D;  4P16 A;  1FM0 D;  3WIM A;  1YQ3 B;  2GBM A;  3AV8 A;  5BO4 B;  2G3Q B;  5G2N A;  1ZPS A;  4BFR A;  1E8Z A;  3J9C A;  3ZTD A;  2DYO A;  1WH3 A;  2KDI A;  1UD7 A;  3N3K B;  1E7V A;  1LXD A;  2LGY A;  4TUU A;  1FXA A;  3NS8 A;  1ESF A;  3HIZ A;  4WJN A;  2W3R A;  1YJJ A;  4K7W A;  1WJN A;  1ZKH A;  4E74 A;  4RFB A;  3ML9 A;  2XK5 B;  1SIJ A;  4RGN A;  1WRI A;  2N7D A;  3HHM A;  4HCP B;  4MJS B;  3V3X A;  2K5P A;  2XBB C;  3AXC A;  2CHX A;  4M0W A;  3DVG X;  3SHQ A;  2RDH A;  2MJE A;  3RFZ B;  2FIF A;  1GUA B;  3K9P B;  2BYE A;  5JXV A;  1FFU A;  2NBV B;  2O2V A;  1UNS A;  5TR5 A;  4AQ7 A;  2KQS A;  3B08 A;  2OHF A;  4KSK C;  3HRD D;  3AN1 A;  1F2R C;  4M8M A;  3URY A;  1L4D B;  2D10 A;  3IHP C;  1WJ6 A;  2WXN A;  2GOW A;  1XT9 B;  3Q69 A;  2BS2 B;  2KN4 A;  3OWE B;  2Y5B B;  1SGH A;  3L16 A;  2L00 B;  3Q3N C;  4HCN B;  1J7C A;  2GRI A;  2J0K A;  4XZ4 A;  4MH0 E;  3BZD B;  3L17 A;  3UGB B;  1C4A A;  2EMS A;  3R7R A;  3M63 B;  2J42 A;  3B1L X;  3Q8A A;  3EEC A;  4PS7 A;  4GN1 A;  4AJW A;  2QJL A;  4L1B A;  3SU8 X;  4RM8 A;  3W1S C;  3RUI B;  3AE7 B;  2AL3 A;  4AOF A;  4MDK E;  1WIA A;  3LXF A;  2RDB C;  2O6V D;  4B6W A;  1I35 A;  1SE4 A;  1FIQ A;  1SF0 A;  4ZRI A;  4C56 C;  3TL5 A;  1R4M B;  4KZC A;  1FNV A;  4JX1 C;  1WMH A;  1L4Z B;  3Q8B A;  1V1P B;  2RD0 A;  4EOY A;  3DDC B;  2KXJ A;  2MBO A;  2L7R A;  3H7P A;  1ROE A;  4F7Z A;  2X38 A;  4BKS D;  3SR6 A;  4XE0 A;  4GB9 A;  2NCN A;  1WGH A;  4LCD E;  2L83 A;  2PW9 A;  3AMZ A;  1AAR A;  2L52 A;  4G50 A;  1E0Z A;  2V9H A;  2GMI C;  1HXY D;  4KGS A;  2ZW1 A;  3HM6 X;  1CK1 A;  1VZ8 A;  4A55 A;  3NY5 A;  1TGZ B;  4HK2 A;  2HJ1 A;  3DBS A;  1WRD B;  4JQW C;  3Q3O C;  2IYD B;  4IW0 A;  1C77 A;  2LXA A;  4W9F A;  5J17 A;  3VXW A;  3BII D;  3DBR I;  3WAP A;  1PQS A;  4LJP B;  3IT6 B;  2G4D B;  2IND C;  5D6J B;  1P3Q U;  2MP2 A;  4M01 A;  1RFK A;  3NVZ A;  2ON8 A;  3RYT A;  5CTR C;  1Y8R C;  2NPT A;  3RNE C;  1EM7 A;  1KTK A;  2BQQ A;  4WIP A;  2M8S A;  5T8I A;  4MAC A;  1YQB A;  1RRB A;  3AE6 B;  3Q3J A;  4MM3 A;  1QOB A;  4A9A A;  3PS6 A;  5D3D A;  2KVZ A;  3ZNZ B;  5TSS A;  2W9N A;  1ZUD 2;  4UDU C;  1XLO A;  3R2T A;  1PYW D;  1ZDX A;  1QLB B;  4RMA A;  1U4A A;  5HG2 A;  2QSD A;  3Q2A C; 
#chains in the Genus database with same CATH homology
 4ITK A;  5G5G A;  1XXG A;  5EE1 A;  3W1S A;  3LYY A;  4KGT A;  4KX6 B;  4A8X C;  4C7Y A;  2E3T A;  4A90 A;  2DLB A;  2ZW0 A;  1XLP A;  1L6V A;  4RGM A;  5G5H A;  4LK0 M;  4WWM A;  2Z8L A;  5H92 C;  2J53 A;  1GAQ B;  3TUO A;  2LFI A;  2N0S B;  2LUM A;  2PKO A;  4HKQ A;  1CQV A;  4YTN B;  2WXR A;  1D5X C;  1VZ6 A;  2PIA A;  1SXT A;  1NEK B;  1MPE A;  3DWM A;  4IKG A;  2HDE A;  3BK1 A;  2CJN A;  3W5V B;  1V8C A;  1HZ6 A;  4HJG E;  3PO0 A;  2WNM A;  1NYQ A;  3N9Y C;  4J3O D;  1T6B X;  3AEA B;  3AE2 B;  4ZRQ A;  3ZGZ A;  3E9S A;  2BBC A;  1TY0 A;  2MJD A;  1E10 A;  2QIE B;  3MFG A;  1XO3 A;  2L1A A;  1C78 A;  3FAH A;  2JYT A;  2JSV X;  1MHX A;  1N63 A;  1TY2 A;  1V97 A;  3AEE B;  1ZXH A;  2IPK D;  1VLB A;  4KGR A;  2MJ3 A;  3B2G A;  4GLS C;  1PGB A;  3T3N A;  4MH8 A;  1IGC A;  3NVV A;  1OQR A;  1LO5 D;  1YMH E;  3AED B;  1P7E A;  1CZP A;  1I4R A;  2J52 A;  4ZYS A;  2K0P A;  1QKZ A;  2AQ1 B;  2CJO A;  3EUB 2;  3TEY A;  2PVO D;  3W2D A;  4B0M A;  4OVZ A;  1VDV A;  1EU4 A;  2M19 A;  2N9L A;  3W5U B;  1TS2 A;  1FO4 A;  2WXQ A;  3EGR A;  1ZXI A;  1E7P B;  4WQM A;  4P6V F;  5AUK A;  2BT6 A;  1D4B A;  3AE5 B;  5EE0 A;  2MEK A;  1KF6 B;  2WU2 B;  3ETR A;  4IDI A;  1QQR A;  1JRO A;  1V1O A;  1VRA B;  1B1Z A;  2EEL A;  1JWB D;  3U4E G;  1PUT A;  4YSZ B;  1MI0 A;  5I4D A;  3ZJU A;  2SEB D;  1BXT A;  1XCT L;  2M0A A;  3L4P A;  5AUI A;  1EU3 A;  1WSP A;  1BUI C;  2CU3 A;  3BVG A;  5MPO A;  2DYM A;  1HA5 A;  1K50 A;  3IAM 1;  2W54 A;  1E9M A;  3KQ4 A;  2V0G A;  2IGH A;  1DOY A;  2PTL A;  5FK9 C;  2Y5C A;  2JXT A;  3MP9 A;  1TKY A;  1RYJ A;  2BB6 A;  1V1P A;  5LNK 1;  3NVY A;  2BS4 B;  3NUH B;  1SE3 A;  4ZRP A;  1IBX B;  3UI3 A;  2WLB A;  5FR3 A;  1IGD A;  1A70 A;  2YEP B;  1FCL A;  2W55 A;  4AS1 A;  1C9F A;  1N61 A;  1RM6 C;  1NI3 A;  1FNW A;  1C76 A;  4OZA A;  1JML A;  2IDY A;  4HEA 1;  5BYR A;  1JW9 D;  4US9 A;  3VRB B;  1PDX A;  4TSS A;  1XF5 L;  1JWA D;  5BMI A;  1TJE A;  3U2S C;  4RGT A;  1ET6 A;  3DWG C;  4MT5 A;  3BWU D;  3CIR B;  2KWD A;  4ARC A;  1DYQ A;  1SSN A;  2BB5 A;  3P4R B;  1J7A A;  1FNU A;  4C7Z A;  1JRP A;  1QOA A;  2R61 A;  2KQ4 X;  3P4S B;  3VRA B;  3AEB B;  1HZ5 A;  3BK2 A;  2JYE A;  1SBB B;  4USA A;  1WWT A;  1FEH A;  4US8 A;  1L6U A;  2JZP A;  2G1E A;  1OQQ A;  3PZ8 A;  2N9K A;  3AE3 B;  5BMG A;  1KH0 A;  2B76 B;  5GXG B;  2MH7 A;  1F0Z A;  1VR9 A;  1WXQ A;  4FXC A;  1T3Q A;  3ZJV A;  3CWI A;  5BYQ A;  1ZP0 B;  3BVM A;  2IGD A;  4R3D A;  1FRR A;  2FBW B;  1B9R A;  1PGA A;  5EE3 A;  3V05 A;  1SJH D;  1DOX A;  1FRD A;  1I4P A;  3NZ3 A;  2D5G A;  3TEW A;  3AEF B;  4PT5 A;  1MHH E;  1DGJ A;  4DXG A;  2NTT A;  2V4I B;  1N62 A;  5BYS A;  4HKZ E;  1XCQ L;  1DOI A;  2HTM E;  2WXK A;  2WXI A;  5HI1 A;  3RPF C;  2KAJ A;  3MC0 B;  3FIL A;  5D3I B;  3FC4 A;  1I7H A;  5HHD G;  2WDQ B;  3GS2 A;  4GDL B;  1I4G A;  1QF6 A;  1BML C;  4YWG G;  1EWC A;  3GB1 A;  1QOF A;  2H88 B;  1N5X A;  1TZO A;  1KLG D;  2YEP F;  5HFY A;  2V3P A;  1L0Y B;  1FCC C;  4Q2J A;  2NMQ A;  3SEB A;  1GOZ A;  2FUG 1;  2JWU A;  3NRZ A;  3PZ7 A;  4RNA A;  1ENF A;  4JE3 B;  4JWS C;  1FXI A;  2WS3 B;  4MM3 B;  2AX5 A;  2DBY A;  4YTP B;  3ZYY X;  2J4X A;  1ZE3 D;  1T5X D;  4N6E B;  1RWS A;  4TQ0 A;  2Q5W D;  2GB1 A;  1IUE A;  1C4C A;  1K52 A;  2VZK D;  2VZK B;  1UWX A;  1SB3 C;  1SJE D;  4P16 A;  1FM0 D;  1TS4 A;  1YQ3 B;  3P42 A;  4REZ A;  2AQ3 B;  3AV8 A;  1YJI A;  2XN9 C;  1ZPS A;  2LEK A;  3AB5 A;  3J9C A;  3E56 A;  3LB8 C;  2DYO A;  2IJ0 A;  4OZB A;  4YTM B;  1UGJ A;  1ZOY B;  3AE8 B;  1UWM A;  3AEC B;  3EA6 A;  1N5W A;  2LGI A;  2Y3A A;  2W82 A;  1KLU D;  3AEG B;  3P1M A;  4HRO A;  3O13 A;  3Q8C A;  1FXA A;  5H8Y E;  1QT9 A;  4WAF A;  2V3N A;  1ESF A;  4GDK B;  4TMA B;  2INP E;  1WGK A;  1ET9 A;  2AQ2 B;  2W3R A;  1YJJ A;  1VJK A;  2KDM A;  3P4Q B;  4B0E A;  2DWQ A;  4RFB A;  2GI9 A;  1SIJ A;  4RGN A;  3ZQ4 A;  1ZDV A;  1AW7 A;  1WRI A;  4LLG M;  2K22 A;  4TQ1 A;  3V3X A;  2K5P A;  2NTS A;  2PLP A;  1AN8 A;  4M0W A;  1GPX A;  1J7B A;  1PFD A;  2WXH A;  3ABV B;  1L5P A;  4ZHP A;  2RDH A;  1AYF A;  2WXJ A;  2EKI A;  2MJE A;  3I57 A;  3RFZ B;  3R2I A;  1M4V A;  4NJC A;  2PMV A;  4A6Q A;  4HRS A;  5JXV A;  1FFU A;  5E6J A;  1UNS A;  2JQR B;  4AQ7 A;  4DQO C;  2OHF A;  3I9V 1;  3VR8 B;  3WCQ A;  4N59 A;  1YN3 A;  3KWV A;  1VZ7 A;  5BMH A;  1L0V B;  2WP9 B;  3HRD D;  3AN1 A;  1F2R C;  4ZOH C;  3URY A;  1L4D B;  2L32 A;  3R8B A;  1CJE A;  1FFV A;  3MHZ A;  1JWS D;  2JX5 A;  2WXM A;  2PVG C;  3VQI A;  2WXN A;  2ICI A;  1PGX A;  3Q69 A;  1XEE A;  3B2F A;  4DXF A;  3BVZ A;  1E6E B;  2BS2 B;  5C3J B;  2KN4 A;  3OWE B;  1TS5 A;  2BYT A;  1D5M C;  4ARI A;  3Q8E A;  4CQN A;  1J7C A;  2GRI A;  3HVD A;  2RPV A;  1D6E C;  3IXS A;  2FE8 A;  3NVW A;  3U7Z A;  2N7J A;  3AE1 B;  4D2K A;  3BZD B;  2WXO A;  3NS1 A;  1KFY B;  3KWL A;  1C4A A;  2Y5P A;  4KKI A;  4RF1 A;  2J42 A;  1HEZ E;  4XWT A;  4YSX B;  3Q8A A;  2WXF A;  1GB4 A;  2E6X A;  3AM9 A;  1I4Q A;  2LHE A;  3C8Y A;  3U52 E;  2LHD A;  1K53 A;  2QJL A;  4RH6 A;  4L1B A;  3MJ5 A;  1MVK A;  2QMT A;  2ONQ A;  3Q8F A;  3AE7 B;  4L2Y A;  4NAM A;  4RF0 A;  3LXF A;  1WYG A;  1QOG A;  1TS3 A;  1EWY C;  1FMA D;  1NEN B;  3KLS X;  1SE4 A;  2WDR B;  1FIQ A;  1SF0 A;  1YN4 A;  2LMC A;  2RMM A;  2QIL A;  1I4X A;  4C56 C;  1FNV A;  4JX1 C;  3AE9 B;  1L4Z B;  4H2A A;  3Q8B A;  4C80 A;  1V1P B;  1STE A;  2KAC A;  2XNA C;  2WU5 B;  4WUR A;  4XWW A;  2WXG A;  1TYG B;  2WQY B;  1ROE A;  1TKE A;  1FD6 A;  2X38 A;  1ACC A;  3SR6 A;  4RCO A;  2WXP A;  1AWD A;  3P4P B;  1D5Z C;  4KKJ A;  2WXL A;  4N58 A;  4XE0 A;  3T3O A;  1KRH A;  2TSS A;  2SAK A;  2L83 A;  4L23 A;  2PW9 A;  1JCK B;  1F77 A;  3AMZ A;  5D7G A;  3TEZ A;  1P7F A;  4ZHO A;  1F2R I;  3HVZ A;  1L0X B;  2L52 A;  2OED A;  3ZJT A;  1E0Z A;  4OZC A;  1HXY D;  4KGS A;  2ZW1 A;  1CK1 A;  1VZ8 A;  4A55 A;  4IOI E;  1SEB D;  4NZL B;  2K3U A;  1JQ4 A;  3BYY B;  1XLQ A;  3FIL B;  3TEX A;  1GB1 A;  2I38 A;  1IBX A;  4YXD B;  2K9X A;  2H89 B;  1NVI D;  1R7S A;  1N60 A;  1YQ4 B;  1QIL A;  1C77 A;  3TSS A;  2ACZ B;  3H8H A;  1I4H A;  3SFD B;  2BW2 A;  1HQR D;  1NYR A;  3BII D;  4JWU C;  3AH7 A;  4O1N A;  4WH4 A;  3W9C B;  4LTU A;  1YN5 A;  3GP7 A;  3IT6 B;  1Q10 A;  4RGO S;  5FKA C;  1K51 A;  3IT4 B;  1RFK A;  3NVZ A;  1YNT E;  2ON8 A;  4XDD A;  3AE4 B;  1TKG A;  4YSY B;  5C2T B;  1JWM D;  2INN E;  3HUI A;  3SFE B;  3P63 A;  2G9H D;  4EE2 A;  1UUP A;  1C4P A;  2M56 B;  3BYT B;  2QEJ C;  2KMM A;  1C79 A;  1EM7 A;  1KTK A;  4JPS A;  4WIP A;  5T8I A;  3B9J A;  1SE2 A;  4MAC A;  2I2Y A;  2JU6 X;  3VR9 B;  3AE6 B;  2LJI A;  1QOB A;  4A9A A;  2BTE A;  1OFF A;  5D3D A;  3IAS 1;  2W3S A;  4OW0 A;  4NAW B;  5TSS A;  1Y56 A;  1ZUD 2;  1JWU D;  4UDU C;  2WDV B;  2BS3 B;  5EE9 A;  1XLO A;  3R2T A;  1PYW D;  1JAL A;  1ZDX A;  1QLB B;  4XDC A;  2IGG A;  1XLN A;  5HG2 A;  4OHJ A;  2RDG A;  2QSD A;  4YT0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...