1E0ZA

[2fe-2s]-ferredoxin from halobacterium salinarum
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
128
structure length
127
Chain Sequence
b'PTVEYLNYETLDDQGWDMDDDDLFEKAADAGLDGEDYGTMEVAEGEYILEAAEAQGYDWPFSCRAGACANCASIVKEGEIDMDMQQILSDEEVEEKDVRLTCIGSPAADEVKIVYNAHLDYLQNRVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title A Two-Alpha-Helix Extra Domain Mediates the Halophilic Character of a Plant-Type Ferredoxin from Halophilic Archaea.
pubmed doi rcsb
molecule tags Electron transport
total genus 20
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2000-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1e0zA00
3AEAB 3P63A 3AN1A 3W9CB 1ZP0B 3DWMA 4C7ZA 1DOYA 1TKGA 3NRZA 1QOAA 5MPOA 3AE8B 4WQMA 2DWQA 4A9AA 1PDXA 2PIAA 3P4PB 4YTNB 1CJEA 4ZHOA 3AE4B 1F0ZA 4YT0B 3KWLA 1N5XA 1NENB 3NVWA 4JX1C 2CJNA 1EWYC 2W55A 5H92C 3AE6B 1RM6C 1QOFA 4N6EB 2PVOD 1N63A 4C80A 2H88B 1XLOA 1FIQA 1OQQA 3CIRB 2KAJA 3AE2B 1V97A 2W54A 1IUEA 2WDRB 3AEGB 1XO3A 3HVZA 1FM0D 1RWSA 1XLNA 4ZHPA 1AYFA 2OHFA 3ABVB 5G5GA 1JWAD 3W5VB 2K22A 1SF0A 1FXAA 1OQRA 1DOIA 1ZUD2 2K9XA 4HRSA 1PFDA 3AE9B 1WXQA 1TJEA 1L6VA 2MH7A 1FXIA 1SIJA 3NVZA 2W3RA 3FAHA 3WCQA 1E10A 3B2FA 2Y5CA 1VJKA 2BS2B 1L0VB 1TYGB 3AECB 2DBYA 3LXFA 2W3SA 2H89B 2WS3B 1NYQA 1YJIA 1FRRA 1FMAD 3VRAB 3AE7B 3SFEB 4YSYB 4USAA 1L6UA 3AE3B 4C7YA 4JWSC 2L83A 1WYGA 1E6EB 3LB8C 2PVGC 3P4QB 3FC4A 1TKEA 4N58A 4IDIA 1V8CA 1A70A 4YSXB 1JWBD 2BS3B 3EUB2 2JQRB 5G5HA 3AEEB 2EKIA 1SB3C 2MJDA 3NVVA 1I7HA 2E3TA 1NEKB 3AE5B 3W5UB 1QOGA 4YXDB 4WWMA 1TKYA 3ETRA 3NS1A 1JRPA 2WU2B 2M56B 3AMZA 1DGJA 1KF6B 1WRIA 5EE9A 3RPFC 3VR9B 1NVID 1QOBA 2K5PA 3AEFB 5EE3A 1PUTA 1FFVA 3AEDB 2BT6A 3HUIA 1QT9A 4US9A 4YTPB 2KMMA 1GAQB 1RFKA 3DWGC 1FRDA 1N5WA 1NYRA 1YQ4B 1L5PA 3NVYA 4HROA 2G1EA 3CWIA 1RYJA 3SFDB 4YSZB 2N0SB 1WGKA 2WU5B 1CZPA 2CJOA 2JX5A 5EE0A 1T3QA 1ZOYB 1N60A 1XLQA 1VLBA 5EE1A 3AH7A 1YJJA 1UWMA 3L4PA 1XLPA 2PKOA 2CU3A 4FXCA 3AM9A 3B2GA 1J7CA 1JQ4A 2HTME 4ITKA 5AUIA 2MJ3A 3BIID 3P4SB 1B9RA 2WQYB 1KRHA 5AUKA 5C3JB 3B9JA 2WLBA 1E7PB 2FBWB 4N59A 1QLBB 2MJEA 1WWTA 1N61A 2WDVB 5H8YE 1QF6A 3ZYYX 1N62A 1NI3A 2QJLA 1FFUA 1KFYB 2WP9B 4LTUA 1E9MA 5GXGB 3P4RB 5C2TB 2BS4B 2QIEB 3VRBB 1J7BA 1J7AA 1FO4A 3PO0A 4US8A 2B76B 1OFFA 1R7SA 1E0ZA 3AV8A 3VR8B 2L52A 3HRDD 1ZXIA 1JROA 3AE1B 1AWDA 2M19A 4ZOHC 3P1MA 1JW9D 1YQ3B 2ACZB 4YTMB 1VDVA 3SR6A 2Q5WD 4KX6B 1GPXA 1JALA 1ROEA 2LEKA 4JWUC 4P6VF 3AEBB 1DOXA 2WDQB 2AX5A 3AB5A
chains in the Genus database with same CATH superfamily
4Q2JA 1SE4A 5GMVA 3LYYA 5D94A 1VZ6A 4KSKC 4EEWA 3VFKA 2C60A 1N6ZA 2I38A 2REXA 1WGRA 1TGZB 2KDFB 5IO9A 3NJTA 4ZRJA 3E9SA 4N6EB 3RI7C 1P9DU 4C56C 2DZMA 4HLEA 5JHBA 1HEZE 1D4BA 3AEGB 4EUTA 1XO3A 4CYEA 3W5VB 2JWZA 2FUHB 3AE9B 4AS1A 2KYWA 3TSSA 2N7JA 1F2RI 1R4NI 1BT0A 2W3SA 1VCBA 1LM8B 3VRAB 3PPAA 1TS3A 2ZEQA 3T3NA 2QILA 4RF0A 1KM7A 1GB4A 4FN2A 1WGYA 1JMLA 4CHKA 4MACA 2BS3B 1L0YB 2RPVA 1I35A 5G5HA 3NVVA 3A4SC 1OEYA 1P98A 1WJNA 5FK9C 3MC9A 2KKCA 4NQLB 2L00B 1QKZA 3DWGC 4LDTB 2G1EA 1TS2A 1RYJA 1FD6A 4PYZA 4IC7B 2FIDA 1N60A 2J4XA 2FAZA 1U4AA 5TR5A 2FCQA 2BQQA 3PGEA 3A9KA 4URKA 1FFUA 2WP9B 1I4QA 1J7AA 2I1KA 3ZVVA 3P1MA 2NBVB 1TS5A 4YTMB 2BB5A 3IXSA 2KMAA 5IOIA 4D2KA 1JALA 4J3OD 4I6LB 2LVQA 2K3UA 3NRZA 2FCMA 3PZ7A 3RNEC 3P42A 2PIAA 3UIPB 4M8MA 1F77A 3VUYA 4YT0B 3OAWA 2YVCA 2GBKA 1UUPA 4GDKB 1EWYC 4GIVA 3Q2AC 3KYCD 4ASWC 1SE9A 3CIRB 4LDTD 2MX2A 3O65B 3DBHB 1XLNA 2LGSA 3IT4B 2KTRB 3U7ZA 2KN4A 2LD9A 2PMVA 2W3RA 1P3QU 3ZUNA 1GOZA 3LXFA 2RGFA 2EMTA 1WX8A 1YJIA 4C00A 4HCPB 2KACA 4TV3A 3WA0A 3FC4A 4N58A 4MGIE 1FNWA 2SEBD 2LGYA 5BMIA 4F1SA 3WAOA 4DDID 2J0MA 3JW0X 2XEWA 4GDLA 3Q3MC 4LJPB 3UGBB 1YQ4B 4HKQA 3QC8B 3CWIA 1I4HA 2MBBB 1ZOYB 2WX0A 1T0RC 1AN8A 1ISNA 1XLPA 1UH6A 1C76A 4DXGA 2FNJB 2N9LA 3ENEA 2MWSB 2AWTA 4MM3B 2K6DB 3HHMA 4AJYB 4DDGD 2LUEA 2JU6X 3AULA 4RGOS 1FXTB 1YD8U 3VR8B 2ICIA 4MSQB 1ZXIA 3APDA 1XT9B 3ZKJC 3A9JB 5E6NA 4BKTA 3T3OA 5DPSA 1KLGD 4JIOU 4XGAB 1IBXA 3ZJVA 1SXTA 1ZP0B 4WWNA 2RDHA 2GMIC 4UDUC 1I4GA 2A4ZA 2UU7A 3RCZA 4LNIA 2EELA 3RD2A 2M0AA 1QOFA 3V62A 1FIQA 2W54A 3P2BA 3SHQA 3W1SC 2V3SA 1R4NB 3PHXB 3I5JC 5LNK1 2BKRB 5DCNA 1OTRB 1J0GA 3TMPB 2C7MB 4K3BA 4DHJB 4KIKA 3FILA 1TJEA 4G50A 1E10A 2E6XA 1TYGB 4L1BA 1E8XA 2INCC 2VH2A 1V86A 4I6NB 1I4RA 1FCLA 2IO0B 4HDQA 2MP2A 1V8CA 2WXMA 2JQRB 3B08A 3W1SA 3TUOA 1FCCC 1QOGA 4LCDE 4KKIA 2MA9B 3DBSA 3SU8X 1XF5L 2KWUB 1V80A 2AQ1B 2J42A 4YTPB 2KK8A 2BYEA 2XN9C 3ML8A 1QZEA 3L4PA 5TSSA 3RNAC 3IBEA 2WXIA 4ITKA 3QQ8B 4HJKA 1OQYA 2RSUA 1N62A 2QJLA 4C4VB 3A4RA 3TL5A 1T0YA 3V6CB 2BVCA 2JZPA 2NPTB 3IAM1 5HI1A 1VDVA 3SR6A 2D2QA 2JYTA 4KX6B 5CHFA 1ROEA 2DX5B 4ZYNA 2L8JA 3V6EB 3NUHB 1MHXA 3L54A 4BAXA 4DK5A 1ZXHA 2CHZA 1CJEA 1V1PB 2N1VA 4MEMA 3L13A 4BKSD 3PLUA 2XK5A 4FJYA 1N5XA 2KNBA 3U8ZA 4XYCA 1VD2A 5H92C 1PGXA 3BZDB 3IAS1 5HFYA 1OQQA 3HIZA 2Z59B 2ZJDA 1GC6A 4XE0A 2V1YA 1ESFA 4HCNB 3QA8A 2L0TA 2BYFA 1FRRA 3AE7B 1PQSA 3N1XC 2J0KA 2KDEB 2L83A 3PTFC 4IW0A 4NJ6A 1XXGA 3KW5B 1WXVA 2QEJC 1ZE3D 5C23A 2MJDA 3L16A 4NAWA 3MP9A 1NEKB 3KWVA 2IGDA 1GB1A 2WXKA 3O13A 5LLIA 1WGDA 1UF0A 2BT6A 2DZJA 3APCA 4A55A 4HKZE 2L0FA 5IN7A 5J17A 3R2IA 3Q69A 1HZ5A 1Q1OA 1J7CA 2VZKB 2N9PC 2ZZPB 3PREA 2FE8A 2ZW0A 1EU3A 4XDCA 3RYTA 2KJRA 4WAAA 1FPYA 2LGXA 3M63B 4RF1A 1J7BA 3Q14C 1JWSD 3PS6A 2NTSA 2B76B 2PE6B 2D3CA 2BWFA 1JROA 1MI0A 2BPSA 3AE1B 3NOBA 4R3DA 4TKNA 4DXAB 3N20C 3AXCA 2Q5WD 4ANUA 3ZNZB 3W9CB 4EZKA 1Q10A 1YN3A 1TZOA 2BWES 4IWOA 2IYDB 1TZ1A 2QC8A 2PEAA 2INNE 2IO2B 2O2VA 4W9IA 3KYDD 1WZ0A 2N9XA 2KD0A 4TQ0A 3Q8EA 2FCSA 4C80A 2H88B 2V4IB 3OJ3A 4IUMB 2PW9A 3BK1A 1RWSA 1C4CA 1C4PA 1RAXA 1PFDA 1YN4A 3AU5A 3C19A 4NPNA 4K1RB 2VZKD 4IM3A 1QQRA 2WXGA 2KFJA 3TCAA 3B0AA 2OJRA 3VAWA 2MBEA 3VTUA 1BXTA 2JXTA 1A70A 2KJHB 1FEHA 1S1QB 1Q0WB 2KFKB 1NBFC 5D7GA 4WWPA 1KF6B 1V6EA 1LQBA 2BYVE 2VRRB 4ZDVA 3BY4B 3HK0A 2K39A 1N5WA 3ZGZA 1L5PA 2ZCBA 2BYTA 1CZPA 1WMHA 4W9CA 4ANWA 5IKCM 4PT5A 1UWMA 5CHWA 3UIOB 4K3CA 4N9F4 2K6QA 2WQYB 3VH3B 4MH0E 4WJOA 2RDGA 5G55A 3ZLZA 3U30A 1YX5B 2DZIA 4LTUA 4II3B 2INPE 4K7WA 4TQ1A 4KGRA 1R7SA 3AV8A 3WAPA 1WY8A 3GS2A 3Q3NC 4ZOHC 1JW9D 3S2AA 4BBNF 4AOFA 2RD0A 1DOXA 3RNGC 3AEBB 2LRWA 1A5RA 1V49A 4KZ0A 3AE8B 3I57A 2V3NA 1OGWA 4G11A 1E7UA 1F0ZA 2PE9A 1OEYJ 3WIMA 3HM6X 2MCNB 1FNUA 2KAJA 4RMAA 2KN5A 2JZZA 1I4XA 4L2YA 4PS8A 3IT6B 5J18A 4K7SA 4S0RA 1STEA 3TEZA 1HZ6A 4H2AA 1XD3B 1V5TA 2Y5CA 1L0VB 3RMKC 2H89B 2WS3B 2GOWA 3BYYB 2KWVB 3ONSA 4FHJA 2LHEA 1WJ4A 3PVLA 4A90A 1JWBD 2V9HA 3QCAA 1C78A 3NS1A 5L83A 4B0EA 3Q6BA 1QOBA 2KMMA 2DYBA 2DNFA 1FRDA 3ZXRA 3H1UA 3DHGC 3LDZE 3UI3A 3DVNV 2JXXA 2G4SA 3EHVA 4K7UA 1WYWB 4JPSA 4P1BC 3MTNB 2ZCCA 5JZEB 2G4DB 2VH1A 2KO3A 2CHXA 3Q8AA 1C3TA 5H8YE 3KUDB 5GXGB 5C2TB 1MPEA 2WWZA 4BOSC 4W9JA 3CMMB 4HVBA 2N1WA 3UF8A 2TSSA 1ZDXA 3ZNHB 4OZCA 3ZDTA 4KGTA 2CJOA 3W2DA 4KDIC 1TY2A 2LGDA 4OZBA 2WHIA 2DAJA 4XX5A 3U7DA 3PHWB 3EFUA 2N7EA 3I3TB 1TTNA 3KWLA 2NS5A 3NVWA 1C9FA 3RZFA 3VTVA 3QAQA 1NDDA 2KQ4X 1UZXB 2DYOA 3OG5A 1G6JA 1E8ZA 3R8BA 4KDLB 5KHQA 2K9XA 4LNNA 2RDBC 5JH5C 1HQRD 1SE3A 2D5GA 1MHHE 2O6VB 3U2SC 1WH3A 2J7QB 2PVGC 2KANA 2K1FA 4KGSA 3RNFC 4WWMA 3D32A 2XBBC 4RH6A 4NY0A 1E5WA 1UWXA 1H4RA 5EE3A 3N3KB 1PUTA 4FJZA 4CO7A 4LNOA 1TY0A 4AP4C 4GDKA 2J0JA 3GP7A 2DENB 1WGHA 1Q5WB 3A33B 3ZNID 3GZNI 1XLQA 2C9WB 5AZFA 3EC8A 1RFAA 4FXCA 4MGZE 2KTRA 3BIID 2KDIA 3PRZA 2L7RA 3UINB 3L10B 4GDLB 2KHWB 2KLCA 5DPWA 4MDKE 2BS4B 2V0GA 2UWQA 4EKUA 2L32A 4LNKA 4OZAA 4GSWA 1YQ3B 2O6VD 2M8SA 2ACZB 4DBGA 2LEKA 3AB5A 5HHDG 3URYA 1V81A 1DOYA 1F52A 5CHVC 1XCTL 2DWQA 2MW5A 1XQQA 2NVUI 1L2NA 2NCNA 4GXBA 4ICUA 4LJOB 2ZPYA 4J6IA 1T0SC 1NENB 1Z2MA 5CX3A 2W55A 4DWFA 1WRDB 2MLBA 5T8IA 1RM6C 4MGKE 1V97A 3N1YC 3ZJTA 2R2QA 2Y5PA 2K0PA 4FHKA 4MELA 2JZ3B 4MGYE 1IBXB 1QILA 1P7EA 3ZNGC 2NBWB 3B2FA 1JWUD 3AECB 2JY6A 3A1QA 4KZCA 4P7IA 1WX9A 2AEHA 2Y5BB 3P4QB 2PJHA 1UD7A 2AX5A 3QIJA 2AQ3B 4S17A 5G2NA 2DZKA 3N9YC 2WU2B 2PPHA 3BWUD 3FILB 1SJHD 1D6EC 2NMQA 1GAQB 5BMGA 2LHDA 3EECA 2JX5A 1M94A 1ET6A 4KV2A 5EE1A 2LVOA 3M62B 2ZNVC 1V2YA 2MJ3A 3P4SB 5LXIB 5E6PA 3QHTA 2IZVB 4XWTA 2KZRA 2WXFA 2FUG1 3K9PB 1D5MC 4W9HA 1SEBD 4TSSA 4DQOC 4LNFA 5IAAC 2X38A 5L95C 4P6VF 2W9NA 1WJUA 4WIPA 1I4PA 4BKSA 3VXWA 3U52E 1KH0A 5MPOA 1YX6B 3TEYA 3AI5A 5JXVA 4FULA 4HXDA 3L17A 4YTNB 3AE4B 2GI9A 5EDSA 4DHJD 3H7PB 2AL3A 2WXJA 3IHPC 2QCZA 3AE2B 2LI5A 4KKJA 1FM0D 4MJSB 3BINA 2B3AA 5G5GA 1JWAD 3BK2A 3KH0A 3NY5A 3VTWA 3KLSX 4C4VA 1K52A 3PZ8A 1ENFA 2KJ6A 2NPTA 1VRAB 5DPTA 4HEA1 2Z0EB 4GLSC 5E6JA 4IG7B 4W9EA 4EZLA 1SB3C 4IKGA 3AE5B 5BMHA 1ZPSA 3BVMA 3RZWC 3AMZA 2M56B 2BB6A 1DGJA 4A20A 3VR9B 3GZNB 2MEKA 2IY0B 4MSMB 1RRBA 1WR6E 5C1ZA 1NYRA 4YWGG 3APFA 1WGKA 2WU5B 1J8CA 2GRIA 1BUIC 4RFBA 2INDC 3HVDA 3KVFB 3B2GA 2G45B 1WM2A 3KQ4A 4NAWB 1E90A 1C79A 4MH8A 1WWTA 3KUZA 3DBLI 4TUUA 1NI3A 2PLPA 1WSPA 2LZ6A 2NTTA 3PO0A 2N4FA 4BKGA 4PS3A 2FCNA 1TIFA 3V61A 2LRUA 1GJZA 4IM2A 3MC8A 3DDCB 5D3DA 3AN1A 1MG8A 1WR1A 4X57B 1K50A 2OEDA 3ZQ4A 1WZ3A 2V4LA 1D5XC 1K8RB 2GLSA 2KQSA 2WDRB 2OHFA 3ABVB 3UQAA 2ONQA 3MC0B 3EGRA 3PSEB 3WALA 4IWPA 1L6VA 2N7DA 4BFRA 4REZA 3MFGA 1XEEA 4M02A 4W9KA 2Z8LA 4NQKE 2K8BA 1T5XD 4AQ7A 4USAA 4JWSC 2W82A 2KVRA 3H6NA 3QK0A 4WJQA 4YSXB 2KLGA 2KT7A 3EUB2 5IA7A 1IPGA 3ML9A 4HPMB 3CSFA 2RMMA 1P0RA 2PTLA 5EE9A 2N9KA 1YOVB 3HUIA 3U4EG 1K53A 1V1OA 4MT5A 1ZDVA 4DXFA 2CU1A 2BKFA 2HTME 3C8YA 1B9RA 3W1YA 1SE2A 2RPQA 1N61A 3EFCA 3V60A 3ZIMA 2QIEB 2L3ZA 1HE8A 2ZVNA 1WX7A 4XWWA 2A5UA 1WMHB 3DVGY 4RCOA 2KFKA 3TEWA 3N30A 2KX0A 3K9OB 4E3CA 2OJWA 1WXMA 1WE6A 1IYFA 3TJPA 1KLVA 4WURA 2SAKA 4M0WB 2L05A 2J52A 4ANVA 2PVOD 4M01A 2K22A 3DPDA 1ZUD2 2KXJA 3QWZB 1GG3A 2RR9A 1LXDA 2M4NA 3VVWB 2QMTA 1HXYD 3ZXVA 3X23A 1Y56A 3VUWA 3Q3OC 4HWIB 3DHHC 3TBLD 1C77A 4ZRIA 2BBCA 4B95A 2KDBA 2LWPA 4HPLB 2I2YA 4YXDB 2LJIA 1MFWA 3I9V1 3JSVB 2LVPA 2WXPA 3RPFC 2IGHA 2K5PA 2IPKD 1QT9A 2YLMA 3NVYA 4E71A 3GB1A 3Q8CA 2L1AA 1ACCA 1JWMD 1T3QA 3R7RA 3R2TA 1YJJA 2D11A 3PZDA 2PKOA 3DBLB 1I42A 1CQVA 1TS4A 2KWDA 3IFWB 1CMXB 2YEPB 2WYQA 4N59A 5I4DA 3ECIA 2L76A 1VR9A 1KFYB 2HJ1A 2CR5A 3OLMD 1SBBB 4L23A 1B1ZA 1E0ZA 2WXNA 2IJ0A 3ZTDA 1F9JA 2WXRA 2YEPF 1EUVB 1NI2A 1VZ8A 3DVNU 2J53A 2WDQB 2MHJA 1X1MA 3M3JA 3TEXA 3ZO5B 4HK2A 1TKGA 1L4ZB 2JRIB 3PV1A 4GN1A 3RFZB 1TBEA 1C4AA 4A9AA 4I6PA 1ZGUB 3P4PB 4NNJB 4KVGB 2ASQA 3H7SA 1GNUA 4EZJA 3VUXA 2HTHA 4BVUC 2JPHA 4HDOA 3IG3A 1J19A 4A3PA 4PS7A 1KJTA 1SF0A 1DOIA 1S3SG 1WF9A 1EO6A 3NVZA 1FXIA 1SIJA 3A9KB 4F8CB 3FAHA 3Q8FA 2ZVOA 1V9JA 3L0WB 2LFIA 3NZ3A 4C7YA 3E56A 1E6EB 3MJWA 2NR2A 1EU4A 3ZDMC 2X8XX 2UYZB 3QARA 4RNAA 3VHTC 3AEEB 2M0XA 4DHZB 4WH4A 1I7HA 3W5UB 3ZW3A 1KLUD 1RLFA 3AEFB 3WANA 4WAFA 4US9A 1YMHE 2WXQA 4A8XC 2EMSA 2WXHA 2IBIB 5CTRC 3H8HA 1HA5A 1EWCA 2K25A 1ZKHA 2KTFA 4XZ4A 3T9LA 4W9FA 2ZPNA 3Q8BA 1YIWA 2G9HD 1QF6A 2O6VA 5AZHA 2JF5A 2R61A 4HJGE 2LGIA 2L52A 3HRDD 2GB1A 4EFOA 1YN5A 2ON8A 2IY1B 1R4MI 2KC2A 4IOIE 2LXCA 4WJPA 2WXLA 2BTEA 1DYQA 3UQBA 4AWJA 4JX1C 1HTOA 4GGQA 3ZRCA 4BZAA 2JYEA 1PGAA 2HE7A 4W9GA 3HVZA 1IUEA 5FKAC 1UBQA 1LGRA 4WQOB 3DHIC 2D07B 2KOXA 1WXQA 1WJ6A 3OWEB 3WCQA 4FBJB 2BS2B 4B9KA 1NYQA 2CHWA 3ALBA 3CSTA 3M95A 1TKEA 1LO5D 4OVUA 1WI0A 5J2RA 1ZW7A 1L7YA 2KVZA 2EKIA 1MVKA 2MBOA 4RGMA 1TT5B 1TKYA 4K81A 3PRPB 4MM3A 1YJ1A 4WJNA 4B6WA 4JE3B 1RFKA 3A1QB 1PYWD 4HROA 5AEKB 5FR3A 2M17A 1E8YA 2C7HA 4YL8A 2WGSA 1V5OA 3A9JA 3DBRI 4P1CC 2CU3A 1F2RC 2EKEC 2LJ5A 1SJED 3R7QA 3DOWA 2JUOA 3I63C 4PYUA 1KRHA 2CKHB 5D2MB 3B9JA 1WXAA 4KIKB 1IGDA 4ACFA 3T8MA 4ARCA 4ANXA 2QDFA 1VZ7A 2JSVX 4II2B 4IWQA 1D3ZA 3NG0A 1PGBA 4JGHB 2JVCA 2MP2B 1GPXA 4JWUC 1WE7A 4OW0A 1GC7A 3AEAB 3P63A 4GB9A 4C7ZA 5BO4B 4WQMA 1L4DB 1PDXA 2QHOA 2HDEA 3BVZA 4WWOA 2IDYA 3J9CA 2LUMA 2LXAA 2ZNVB 3X0WA 3AU4A 1FXAA 1OQRA 2K8HA 4HRSA 2R2OA 3BVGA 2MH7A 3N1ZC 1VJKA 1C1YB 3GE3C 5BYQA 2D3GA 4XC2A 1FMAD 4PK1A 2AYOB 4YSYB 1L6UA 3LB8C 4DHZE 4RGTA 2GBJA 2V3PA 4NJ7A 3RNCC 2Z0DB 1WXSA 1KOTA 2FIFA 2MRPA 3JYUA 2E3TA 2D3AA 2DLBA 1ET9A 2KQ7A 1NVID 3VQIA 1SGHA 1FFVA 1WGGA 2N9EB 4NZLB 3SEBA 4GOCA 1WFYA 3VDZA 3H7PA 5FR6A 3PT2B 2XK5B 5EE0A 2D3BA 5E6OA 2D10A 2HD5B 5D6JB 4ZRPA 1LFDA 4MJSA 3AM9A 5AUIA 1WM3A 3GE8C 5AUKA 2K8CA 2M1MA 2FBWB 3IVFA 1P1AA 2MJEA 2WDVB 4RM8A 3ZYYX 1E9MA 1UBIA 1FO4A 3ZRFA 1V1PA 2WDTB 1EF5A 1R4MB 2WNMA 4W9DA 3R3MA 4JL9A 3ZJUA 4LLGM 2JT4B 3QX1A 4NJCA 3WAMA 3SFEB 3Q3FA 4OHJA 3KUCB 1QOAA 4ZRKA 3NHEB 3QJZA 1IGCA 1K51A 3DQVA 1SIFA 3Q3JA 1FNVA 1YQBA 3DVGX 4LK0M 2CJNA 3AE6B 4G3XB 4FJVB 1AW7A 3V3XA 3V05A 4OVZA 4HPPA 1AYFA 4XDDA 4G0NB 3B1LX 1CK1A 5D3IB 2IO3B 4IM0A 3FKYA 4W9LA 4OVVA 1P7FA 4CQNA 4RGNA 1UELA 3SDLC 1EM7A 2HJ8A 4JQWC 4GMVA 2GBRA 4AJWA 1Y8RC 3ETRA 1AARA 1JRPA 4E74A 4JLCA 1WRIA 3NZUA 4ICVA 4M8NA 3DBRB 2ZW1A 3C0RB 3SFDB 2N0SB 2O2VB 2DHZA 4ZRQA 1VLBA 2BF8B 2OOBB 5DPRA 4A3OA 1JQ4A 5HG2A 5BYSA 3R66C 2WX1A 4ZYSA 5C3JB 1IP9A 2WLBA 3JVZX 1E7PB 2GBNA 1QLBB 2KDMA 4O1NA 3N32A 3RT3B 4BOZB 1H8CA 2I1JA 3P4RB 2AL6A 4TMAB 3RNBC 2WXOA 4US8A 1OFFA 4P16A 2BW2A 2IGGA 1AWDA 4ARIA 1UNSA 1HTQA 2LASA 4RM9A 4FLHA 2C7NB 2MSED 3GOEA 3DCGA 3DWMA 3VH4B 4NAMA 4EOYA 3EA6A 1Z5SB 2MBQA 4ZHOA 5JHAA 3PRMB 3RN9C 2MBHA 2KMCA 1L0XB 3H9DA 2DYMA 1N63A 1XLOA 1MG4A 4B0MA 1EF1A 1E7VA 2LMCA 4ZHPA 3OJ4B 2XNAC 3MHZA 2BGFA 4QAYA 3MHSD 4BBNC 3LJ3A 1JRUA 1MJDA 1KTKA 2KX3A 2C5LC 1WIAA 3DBHI 2DBYA 4KSLC 3NZSA 2JRHA 2Y3AA 3RULA 3BYTB 4FA6A 3MJ5A 4A6QA 1T0QC 2KWCA 3AE3B 1WYGA 3NS8A 4IDIA 1UGMA 2AQ2B 4F7ZA 4GU2A 5KHOA 1F1HA 4FADA 1D5ZC 3SD5A 5LXHA 3AEDB 3HM3A 1SSNA 2MQJA 4M0WA 4YSZB 2IO1B 3L08A 1XCQL 2G3QB 5BYRA 2QSDA 3PLVA 5AZGA 5HKHA 3AH7A 2GBMA 1M4VA 3CF6E 1GUAB 1YNTE 4M00A 2DAFA 4EE2A 3TIXA 3VRBB 1T6BX 1UGJA 2KC1A 2NBUA 1E8WA 3RUIB 1BMLC 2M19A 1JCKB 3ZTCA 2CS4A 4AUQC 5IP4D 2JWUA 3JSVA
chains in the Genus database with same CATH topology
4Q2JA 1I4PA 4IOIE 3W9CB 1SE4A 3U52E 1KH0A 5MPOA 3TEYA 1Q10A 1YN3A 1TZOA 3LYYA 2WXLA 5JXVA 1VZ6A 4YTNB 2BTEA 3AE4B 1DYQA 2I38A 2GI9A 2INNE 4JX1C 2WXJA 4TQ0A 3E9SA 4N6EB 3Q8EA 4C56C 2JYEA 1PGAA 2H88B 4C80A 2V4IB 2PW9A 1HEZE 3AE2B 3BK1A 3HVZA 1IUEA 3AEGB 1D4BA 1XO3A 4KKJA 5FKAC 1FM0D 1RWSA 1C4CA 1C4PA 5G5GA 1JWAD 3BK2A 3W5VB 3KLSX 1PFDA 3AE9B 1WXQA 1YN4A 3OWEB 4AS1A 3WCQA 3TSSA 2VZKD 2BS2B 1QQRA 2N7JA 1K52A 2WXGA 1F2RI 2W3SA 3PZ8A 1NYQA 1ENFA 3VRAB 1VRAB 1TS3A 4HEA1 3T3NA 1BXTA 4GLSC 2QILA 4RF0A 2JXTA 1TKEA 1GB4A 5E6JA 1LO5D 1A70A 1FEHA 1JMLA 4MACA 2BS3B 1L0YB 2RPVA 5G5HA 2EKIA 1MVKA 1SB3C 4IKGA 3NVVA 3AE5B 4RGMA 5BMHA 1ZPSA 3BVMA 1TKYA 5D7GA 3AMZA 2M56B 2BB6A 1DGJA 5FK9C 1KF6B 3VR9B 2MEKA 4JE3B 1RFKA 1QKZA 3DWGC 1N5WA 3ZGZA 1NYRA 1PYWD 1L5PA 4HROA 2G1EA 1TS2A 1RYJA 5FR3A 1FD6A 4YWGG 2BYTA 1WGKA 2WU5B 1CZPA 2GRIA 1N60A 2J4XA 1BUIC 4PT5A 1UWMA 4RFBA 2CU3A 3HVDA 3B2GA 1F2RC 1SJED 3KQ4A 4NAWB 2WQYB 1KRHA 3B9JA 1C79A 4MH8A 2RDGA 1WWTA 1NI3A 2PLPA 1FFUA 1IGDA 1WSPA 2WP9B 4LTUA 2NTTA 1I4QA 1J7AA 2INPE 4ARCA 3PO0A 4TQ1A 4KGRA 1R7SA 3AV8A 1VZ7A 2JSVX 3GS2A 4ZOHC 3P1MA 1JW9D 1PGBA 1TS5A 4YTMB 2BB5A 3IXSA 1GPXA 4D2KA 1JALA 4JWUC 4OW0A 1DOXA 3AEBB 4J3OD 3AEAB 3P63A 5D3DA 3AN1A 2K3UA 4C7ZA 3NRZA 3AE8B 4WQMA 3I57A 1K50A 3PZ7A 2OEDA 2V3NA 1L4DB 3P42A 1PDXA 2PIAA 3ZQ4A 1F0ZA 1F77A 1D5XC 4YT0B 2HDEA 3BVZA 1UUPA 4GDKB 1EWYC 2IDYA 3J9CA 2LUMA 3CIRB 1FNUA 2KAJA 2WDRB 1XLNA 1I4XA 4L2YA 2OHFA 3ABVB 3IT4B 2ONQA 3MC0B 3IT6B 3EGRA 1STEA 3TEZA 1FXAA 1OQRA 3U7ZA 4HRSA 1HZ6A 2KN4A 2PMVA 1L6VA 2MH7A 3BVGA 4H2AA 2W3RA 2Y5CA 1VJKA 1GOZA 1L0VB 3LXFA 3MFGA 4REZA 1XEEA 5BYQA 2H89B 2WS3B 2Z8LA 1YJIA 1FMAD 1T5XD 2KACA 4AQ7A 3BYYB 4YSYB 4USAA 1L6UA 4JWSC 3LB8C 2W82A 4RGTA 2V3PA 3FC4A 4N58A 2LHEA 4A90A 4YSXB 1JWBD 1FNWA 3EUB2 2SEBD 5BMIA 2E3TA 2RMMA 2DLBA 1C78A 3NS1A 2PTLA 1ET9A 5EE9A 2N9KA 4B0EA 1NVID 1QOBA 3VQIA 1FFVA 3HUIA 4NZLB 3U4EG 3SEBA 2KMMA 1FRDA 1YQ4B 4HKQA 3UI3A 3CWIA 1K53A 1V1OA 1I4HA 4MT5A 1ZDVA 4DXFA 5EE0A 1ZOYB 4ZRPA 1AN8A 1XLPA 4JPSA 1C76A 3AM9A 4DXGA 2HTME 5AUIA 3C8YA 1B9RA 5AUKA 2N9LA 2FBWB 1SE2A 2MJEA 4MM3B 1N61A 3Q8AA 2WDVB 5H8YE 3ZYYX 5GXGB 1E9MA 5C2TB 1MPEA 1FO4A 2QIEB 1V1PA 2JU6X 4RGOS 3VR8B 2WNMA 4XWWA 2ICIA 1ZXIA 3ZJUA 4LLGM 2TSSA 4RCOA 1ZDXA 4OZCA 4NJCA 3TEWA 3T3OA 4KGTA 3SFEB 2CJOA 1KLGD 3W2DA 4OHJA 1IBXA 3ZJVA 1SXTA 1TY2A 1ZP0B 1QOAA 4OZBA 2RDHA 4UDUC 1I4GA 1IGCA 1K51A 4WURA 2SAKA 3KWLA 1FNVA 3NVWA 4LK0M 2CJNA 2EELA 1C9FA 2J52A 2M0AA 2KQ4X 1QOFA 3AE6B 2PVOD 1AW7A 1FIQA 3V3XA 3V05A 2DYOA 2W54A 4OVZA 1AYFA 4XDDA 2K22A 3R8BA 5LNK1 1CK1A 1ZUD2 2K9XA 3FILA 1TJEA 1HQRD 1E10A 2QMTA 5D3IB 2E6XA 1SE3A 1TYGB 1HXYD 2D5GA 1MHHE 4L1BA 1Y56A 1P7FA 4CQNA 3U2SC 1I4RA 1FCLA 2PVGC 1C77A 4RGNA 1V8CA 2BBCA 2WXMA 4KGSA 1EM7A 2JQRB 3W1SA 2I2YA 3TUOA 1FCCC 1QOGA 2LJIA 4WWMA 4YXDB 3I9V1 3ETRA 4RH6A 1JRPA 4KKIA 1UWXA 1WRIA 2WXPA 3RPFC 1XF5L 5EE3A 2IGHA 2K5PA 2IPKD 1PUTA 2AQ1B 1QT9A 2J42A 4YTPB 2ZW1A 1TY0A 3NVYA 3SFDB 2N0SB 3GB1A 3GP7A 3Q8CA 2L1AA 1ACCA 1JWMD 2XN9C 1T3QA 4ZRQA 1XLQA 1VLBA 3R2TA 1YJJA 3L4PA 2PKOA 5TSSA 4FXCA 1CQVA 2WXIA 1TS4A 1JQ4A 5HG2A 4ITKA 2KWDA 3BIID 5BYSA 4ZYSA 5C3JB 2WLBA 1E7PB 2YEPB 4N59A 1QLBB 2KDMA 4GDLB 4O1NA 5I4DA 1VR9A 1N62A 2QJLA 1KFYB 3P4RB 2BS4B 4TMAB 2V0GA 1SBBB 4L23A 1B1ZA 2WXOA 4US8A 1OFFA 1E0ZA 4P16A 2WXNA 2BW2A 2IGGA 2L32A 2IJ0A 2JZPA 3IAM1 4OZAA 1AWDA 2WXRA 5HI1A 2YEPF 1YQ3B 1UNSA 4ARIA 2ACZB 1VDVA 3SR6A 2JYTA 1VZ8A 4KX6B 1ROEA 2LEKA 2J53A 2WDQB 3AB5A 5HHDG 3URYA 3TEXA 3DWMA 3NUHB 1TKGA 1L4ZB 1MHXA 4NAMA 3RFZB 1DOYA 1C4AA 1XCTL 2DWQA 4A9AA 1ZXHA 3P4PB 3EA6A 1CJEA 1V1PB 4ZHOA 1N5XA 1NENB 2W55A 5H92C 5T8IA 1RM6C 1PGXA 1L0XB 3BZDB 2DYMA 1N63A 3IAS1 1XLOA 5HFYA 1OQQA 1V97A 4B0MA 3ZJTA 2LMCA 4ZHPA 2XNAC 2Y5PA 3MHZA 2K0PA 1SF0A 4XE0A 1DOIA 1IBXB 1ESFA 1QILA 3NVZA 1KTKA 1P7EA 1FXIA 1SIJA 3FAHA 3B2FA 1JWUD 3AECB 3Q8FA 2DBYA 1FRRA 2LFIA 2Y3AA 3AE7B 3BYTB 3MJ5A 4A6QA 3AE3B 3NZ3A 4C7YA 2L83A 3E56A 1WYGA 1E6EB 3P4QB 1EU4A 1XXGA 4IDIA 2QEJC 4RNAA 2AX5A 1ZE3D 2AQ2B 3AEEB 2MJDA 2AQ3B 4WH4A 1I7HA 3MP9A 1NEKB 3KWVA 3W5UB 2IGDA 3N9YC 1GB1A 2WU2B 2WXKA 1KLUD 3O13A 1D5ZC 3BWUD 3FILB 3AEFB 3AEDB 2BT6A 4WAFA 1SJHD 1D6EC 2NMQA 4US9A 1GAQB 1YMHE 2WXQA 4A8XC 4A55A 4HKZE 5BMGA 2WXHA 1SSNA 4M0WA 4YSZB 2LHDA 3R2IA 3H8HA 1XCQL 1HA5A 1EWCA 3Q69A 5BYRA 2JX5A 2QSDA 1HZ5A 1ET6A 5EE1A 3AH7A 1M4VA 1J7CA 2VZKB 2MJ3A 3P4SB 2FE8A 1YNTE 2ZW0A 1EU3A 3Q8BA 4XDCA 2G9HD 4XWTA 1QF6A 4EE2A 2WXFA 2FUG1 4RF1A 3VRBB 1J7BA 1JWSD 1T6BX 2NTSA 2R61A 2B76B 4HJGE 1D5MC 1UGJA 2LGIA 2L52A 3HRDD 1JROA 1MI0A 2GB1A 1BMLC 3AE1B 2M19A 1SEBD 4R3DA 4TSSA 4DQOC 2Q5WD 1JCKB 2X38A 4P6VF 1YN5A 2ON8A 4WIPA 2JWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEA B;  3P63 A;  3AN1 A;  3W9C B;  1ZP0 B;  3DWM A;  4C7Z A;  1DOY A;  1TKG A;  3NRZ A;  1QOA A;  5MPO A;  3AE8 B;  4WQM A;  2DWQ A;  4A9A A;  1PDX A;  2PIA A;  3P4P B;  4YTN B;  1CJE A;  4ZHO A;  3AE4 B;  1F0Z A;  4YT0 B;  3KWL A;  1N5X A;  1NEN B;  3NVW A;  4JX1 C;  2CJN A;  1EWY C;  2W55 A;  5H92 C;  3AE6 B;  1RM6 C;  1QOF A;  4N6E B;  2PVO D;  1N63 A;  4C80 A;  2H88 B;  1XLO A;  1FIQ A;  1OQQ A;  3CIR B;  2KAJ A;  3AE2 B;  1V97 A;  2W54 A;  1IUE A;  2WDR B;  3AEG B;  1XO3 A;  3HVZ A;  1FM0 D;  1RWS A;  1XLN A;  4ZHP A;  1AYF A;  2OHF A;  3ABV B;  5G5G A;  1JWA D;  3W5V B;  2K22 A;  1SF0 A;  1FXA A;  1OQR A;  1DOI A;  1ZUD 2;  2K9X A;  4HRS A;  1PFD A;  3AE9 B;  1WXQ A;  1TJE A;  1L6V A;  2MH7 A;  1FXI A;  1SIJ A;  3NVZ A;  2W3R A;  3FAH A;  3WCQ A;  1E10 A;  3B2F A;  2Y5C A;  1VJK A;  2BS2 B;  1L0V B;  1TYG B;  3AEC B;  2DBY A;  3LXF A;  2W3S A;  2H89 B;  2WS3 B;  1NYQ A;  1YJI A;  1FRR A;  1FMA D;  3VRA B;  3AE7 B;  3SFE B;  4YSY B;  4USA A;  1L6U A;  3AE3 B;  4C7Y A;  4JWS C;  2L83 A;  1WYG A;  1E6E B;  3LB8 C;  2PVG C;  3P4Q B;  3FC4 A;  1TKE A;  4N58 A;  4IDI A;  1V8C A;  1A70 A;  4YSX B;  1JWB D;  2BS3 B;  3EUB 2;  2JQR B;  5G5H A;  3AEE B;  2EKI A;  1SB3 C;  2MJD A;  3NVV A;  1I7H A;  2E3T A;  1NEK B;  3AE5 B;  3W5U B;  1QOG A;  4YXD B;  4WWM A;  1TKY A;  3ETR A;  3NS1 A;  1JRP A;  2WU2 B;  2M56 B;  3AMZ A;  1DGJ A;  1KF6 B;  1WRI A;  5EE9 A;  3RPF C;  3VR9 B;  1NVI D;  1QOB A;  2K5P A;  3AEF B;  5EE3 A;  1PUT A;  1FFV A;  3AED B;  2BT6 A;  3HUI A;  1QT9 A;  4US9 A;  4YTP B;  2KMM A;  1GAQ B;  1RFK A;  3DWG C;  1FRD A;  1N5W A;  1NYR A;  1YQ4 B;  1L5P A;  3NVY A;  4HRO A;  2G1E A;  3CWI A;  1RYJ A;  3SFD B;  4YSZ B;  2N0S B;  1WGK A;  2WU5 B;  1CZP A;  2CJO A;  2JX5 A;  5EE0 A;  1T3Q A;  1ZOY B;  1N60 A;  1XLQ A;  1VLB A;  5EE1 A;  3AH7 A;  1YJJ A;  1UWM A;  3L4P A;  1XLP A;  2PKO A;  2CU3 A;  4FXC A;  3AM9 A;  3B2G A;  1J7C A;  1JQ4 A;  2HTM E;  4ITK A;  5AUI A;  2MJ3 A;  3BII D;  3P4S B;  1B9R A;  2WQY B;  1KRH A;  5AUK A;  5C3J B;  3B9J A;  2WLB A;  1E7P B;  2FBW B;  4N59 A;  1QLB B;  2MJE A;  1WWT A;  1N61 A;  2WDV B;  5H8Y E;  1QF6 A;  3ZYY X;  1N62 A;  1NI3 A;  2QJL A;  1FFU A;  1KFY B;  2WP9 B;  4LTU A;  1E9M A;  5GXG B;  3P4R B;  5C2T B;  2BS4 B;  2QIE B;  3VRB B;  1J7B A;  1J7A A;  1FO4 A;  3PO0 A;  4US8 A;  2B76 B;  1OFF A;  1R7S A;  1E0Z A;  3AV8 A;  3VR8 B;  2L52 A;  3HRD D;  1ZXI A;  1JRO A;  3AE1 B;  1AWD A;  2M19 A;  4ZOH C;  3P1M A;  1JW9 D;  1YQ3 B;  2ACZ B;  4YTM B;  1VDV A;  3SR6 A;  2Q5W D;  4KX6 B;  1GPX A;  1JAL A;  1ROE A;  2LEK A;  4JWU C;  4P6V F;  3AEB B;  1DOX A;  2WDQ B;  2AX5 A;  3AB5 A; 
#chains in the Genus database with same CATH topology
 4Q2J A;  1SE4 A;  5GMV A;  3LYY A;  5D94 A;  1VZ6 A;  4KSK C;  4EEW A;  3VFK A;  2C60 A;  1N6Z A;  2I38 A;  2REX A;  1WGR A;  1TGZ B;  2KDF B;  5IO9 A;  3NJT A;  4ZRJ A;  3E9S A;  4N6E B;  3RI7 C;  1P9D U;  4C56 C;  2DZM A;  4HLE A;  5JHB A;  1HEZ E;  1D4B A;  3AEG B;  4EUT A;  1XO3 A;  4CYE A;  3W5V B;  2JWZ A;  2FUH B;  3AE9 B;  4AS1 A;  2KYW A;  3TSS A;  2N7J A;  1F2R I;  1R4N I;  1BT0 A;  2W3S A;  1VCB A;  1LM8 B;  3VRA B;  3PPA A;  1TS3 A;  2ZEQ A;  3T3N A;  2QIL A;  4RF0 A;  1KM7 A;  1GB4 A;  4FN2 A;  1WGY A;  1JML A;  4CHK A;  4MAC A;  2BS3 B;  1L0Y B;  2RPV A;  1I35 A;  5G5H A;  3NVV A;  3A4S C;  1OEY A;  1P98 A;  1WJN A;  5FK9 C;  3MC9 A;  2KKC A;  4NQL B;  2L00 B;  1QKZ A;  3DWG C;  4LDT B;  2G1E A;  1TS2 A;  1RYJ A;  1FD6 A;  4PYZ A;  4IC7 B;  2FID A;  1N60 A;  2J4X A;  2FAZ A;  1U4A A;  5TR5 A;  2FCQ A;  2BQQ A;  3PGE A;  3A9K A;  4URK A;  1FFU A;  2WP9 B;  1I4Q A;  1J7A A;  2I1K A;  3ZVV A;  3P1M A;  2NBV B;  1TS5 A;  4YTM B;  2BB5 A;  3IXS A;  2KMA A;  5IOI A;  4D2K A;  1JAL A;  4J3O D;  4I6L B;  2LVQ A;  2K3U A;  3NRZ A;  2FCM A;  3PZ7 A;  3RNE C;  3P42 A;  2PIA A;  3UIP B;  4M8M A;  1F77 A;  3VUY A;  4YT0 B;  3OAW A;  2YVC A;  2GBK A;  1UUP A;  4GDK B;  1EWY C;  4GIV A;  3Q2A C;  3KYC D;  4ASW C;  1SE9 A;  3CIR B;  4LDT D;  2MX2 A;  3O65 B;  3DBH B;  1XLN A;  2LGS A;  3IT4 B;  2KTR B;  3U7Z A;  2KN4 A;  2LD9 A;  2PMV A;  2W3R A;  1P3Q U;  3ZUN A;  1GOZ A;  3LXF A;  2RGF A;  2EMT A;  1WX8 A;  1YJI A;  4C00 A;  4HCP B;  2KAC A;  4TV3 A;  3WA0 A;  3FC4 A;  4N58 A;  4MGI E;  1FNW A;  2SEB D;  2LGY A;  5BMI A;  4F1S A;  3WAO A;  4DDI D;  2J0M A;  3JW0 X;  2XEW A;  4GDL A;  3Q3M C;  4LJP B;  3UGB B;  1YQ4 B;  4HKQ A;  3QC8 B;  3CWI A;  1I4H A;  2MBB B;  1ZOY B;  2WX0 A;  1T0R C;  1AN8 A;  1ISN A;  1XLP A;  1UH6 A;  1C76 A;  4DXG A;  2FNJ B;  2N9L A;  3ENE A;  2MWS B;  2AWT A;  4MM3 B;  2K6D B;  3HHM A;  4AJY B;  4DDG D;  2LUE A;  2JU6 X;  3AUL A;  4RGO S;  1FXT B;  1YD8 U;  3VR8 B;  2ICI A;  4MSQ B;  1ZXI A;  3APD A;  1XT9 B;  3ZKJ C;  3A9J B;  5E6N A;  4BKT A;  3T3O A;  5DPS A;  1KLG D;  4JIO U;  4XGA B;  1IBX A;  3ZJV A;  1SXT A;  1ZP0 B;  4WWN A;  2RDH A;  2GMI C;  4UDU C;  1I4G A;  2A4Z A;  2UU7 A;  3RCZ A;  4LNI A;  2EEL A;  3RD2 A;  2M0A A;  1QOF A;  3V62 A;  1FIQ A;  2W54 A;  3P2B A;  3SHQ A;  3W1S C;  2V3S A;  1R4N B;  3PHX B;  3I5J C;  5LNK 1;  2BKR B;  5DCN A;  1OTR B;  1J0G A;  3TMP B;  2C7M B;  4K3B A;  4DHJ B;  4KIK A;  3FIL A;  1TJE A;  4G50 A;  1E10 A;  2E6X A;  1TYG B;  4L1B A;  1E8X A;  2INC C;  2VH2 A;  1V86 A;  4I6N B;  1I4R A;  1FCL A;  2IO0 B;  4HDQ A;  2MP2 A;  1V8C A;  2WXM A;  2JQR B;  3B08 A;  3W1S A;  3TUO A;  1FCC C;  1QOG A;  4LCD E;  4KKI A;  2MA9 B;  3DBS A;  3SU8 X;  1XF5 L;  2KWU B;  1V80 A;  2AQ1 B;  2J42 A;  4YTP B;  2KK8 A;  2BYE A;  2XN9 C;  3ML8 A;  1QZE A;  3L4P A;  5TSS A;  3RNA C;  3IBE A;  2WXI A;  4ITK A;  3QQ8 B;  4HJK A;  1OQY A;  2RSU A;  1N62 A;  2QJL A;  4C4V B;  3A4R A;  3TL5 A;  1T0Y A;  3V6C B;  2BVC A;  2JZP A;  2NPT B;  3IAM 1;  5HI1 A;  1VDV A;  3SR6 A;  2D2Q A;  2JYT A;  4KX6 B;  5CHF A;  1ROE A;  2DX5 B;  4ZYN A;  2L8J A;  3V6E B;  3NUH B;  1MHX A;  3L54 A;  4BAX A;  4DK5 A;  1ZXH A;  2CHZ A;  1CJE A;  1V1P B;  2N1V A;  4MEM A;  3L13 A;  4BKS D;  3PLU A;  2XK5 A;  4FJY A;  1N5X A;  2KNB A;  3U8Z A;  4XYC A;  1VD2 A;  5H92 C;  1PGX A;  3BZD B;  3IAS 1;  5HFY A;  1OQQ A;  3HIZ A;  2Z59 B;  2ZJD A;  1GC6 A;  4XE0 A;  2V1Y A;  1ESF A;  4HCN B;  3QA8 A;  2L0T A;  2BYF A;  1FRR A;  3AE7 B;  1PQS A;  3N1X C;  2J0K A;  2KDE B;  2L83 A;  3PTF C;  4IW0 A;  4NJ6 A;  1XXG A;  3KW5 B;  1WXV A;  2QEJ C;  1ZE3 D;  5C23 A;  2MJD A;  3L16 A;  4NAW A;  3MP9 A;  1NEK B;  3KWV A;  2IGD A;  1GB1 A;  2WXK A;  3O13 A;  5LLI A;  1WGD A;  1UF0 A;  2BT6 A;  2DZJ A;  3APC A;  4A55 A;  4HKZ E;  2L0F A;  5IN7 A;  5J17 A;  3R2I A;  3Q69 A;  1HZ5 A;  1Q1O A;  1J7C A;  2VZK B;  2N9P C;  2ZZP B;  3PRE A;  2FE8 A;  2ZW0 A;  1EU3 A;  4XDC A;  3RYT A;  2KJR A;  4WAA A;  1FPY A;  2LGX A;  3M63 B;  4RF1 A;  1J7B A;  3Q14 C;  1JWS D;  3PS6 A;  2NTS A;  2B76 B;  2PE6 B;  2D3C A;  2BWF A;  1JRO A;  1MI0 A;  2BPS A;  3AE1 B;  3NOB A;  4R3D A;  4TKN A;  4DXA B;  3N20 C;  3AXC A;  2Q5W D;  4ANU A;  3ZNZ B;  3W9C B;  4EZK A;  1Q10 A;  1YN3 A;  1TZO A;  2BWE S;  4IWO A;  2IYD B;  1TZ1 A;  2QC8 A;  2PEA A;  2INN E;  2IO2 B;  2O2V A;  4W9I A;  3KYD D;  1WZ0 A;  2N9X A;  2KD0 A;  4TQ0 A;  3Q8E A;  2FCS A;  4C80 A;  2H88 B;  2V4I B;  3OJ3 A;  4IUM B;  2PW9 A;  3BK1 A;  1RWS A;  1C4C A;  1C4P A;  1RAX A;  1PFD A;  1YN4 A;  3AU5 A;  3C19 A;  4NPN A;  4K1R B;  2VZK D;  4IM3 A;  1QQR A;  2WXG A;  2KFJ A;  3TCA A;  3B0A A;  2OJR A;  3VAW A;  2MBE A;  3VTU A;  1BXT A;  2JXT A;  1A70 A;  2KJH B;  1FEH A;  1S1Q B;  1Q0W B;  2KFK B;  1NBF C;  5D7G A;  4WWP A;  1KF6 B;  1V6E A;  1LQB A;  2BYV E;  2VRR B;  4ZDV A;  3BY4 B;  3HK0 A;  2K39 A;  1N5W A;  3ZGZ A;  1L5P A;  2ZCB A;  2BYT A;  1CZP A;  1WMH A;  4W9C A;  4ANW A;  5IKC M;  4PT5 A;  1UWM A;  5CHW A;  3UIO B;  4K3C A;  4N9F 4;  2K6Q A;  2WQY B;  3VH3 B;  4MH0 E;  4WJO A;  2RDG A;  5G55 A;  3ZLZ A;  3U30 A;  1YX5 B;  2DZI A;  4LTU A;  4II3 B;  2INP E;  4K7W A;  4TQ1 A;  4KGR A;  1R7S A;  3AV8 A;  3WAP A;  1WY8 A;  3GS2 A;  3Q3N C;  4ZOH C;  1JW9 D;  3S2A A;  4BBN F;  4AOF A;  2RD0 A;  1DOX A;  3RNG C;  3AEB B;  2LRW A;  1A5R A;  1V49 A;  4KZ0 A;  3AE8 B;  3I57 A;  2V3N A;  1OGW A;  4G11 A;  1E7U A;  1F0Z A;  2PE9 A;  1OEY J;  3WIM A;  3HM6 X;  2MCN B;  1FNU A;  2KAJ A;  4RMA A;  2KN5 A;  2JZZ A;  1I4X A;  4L2Y A;  4PS8 A;  3IT6 B;  5J18 A;  4K7S A;  4S0R A;  1STE A;  3TEZ A;  1HZ6 A;  4H2A A;  1XD3 B;  1V5T A;  2Y5C A;  1L0V B;  3RMK C;  2H89 B;  2WS3 B;  2GOW A;  3BYY B;  2KWV B;  3ONS A;  4FHJ A;  2LHE A;  1WJ4 A;  3PVL A;  4A90 A;  1JWB D;  2V9H A;  3QCA A;  1C78 A;  3NS1 A;  5L83 A;  4B0E A;  3Q6B A;  1QOB A;  2KMM A;  2DYB A;  2DNF A;  1FRD A;  3ZXR A;  3H1U A;  3DHG C;  3LDZ E;  3UI3 A;  3DVN V;  2JXX A;  2G4S A;  3EHV A;  4K7U A;  1WYW B;  4JPS A;  4P1B C;  3MTN B;  2ZCC A;  5JZE B;  2G4D B;  2VH1 A;  2KO3 A;  2CHX A;  3Q8A A;  1C3T A;  5H8Y E;  3KUD B;  5GXG B;  5C2T B;  1MPE A;  2WWZ A;  4BOS C;  4W9J A;  3CMM B;  4HVB A;  2N1W A;  3UF8 A;  2TSS A;  1ZDX A;  3ZNH B;  4OZC A;  3ZDT A;  4KGT A;  2CJO A;  3W2D A;  4KDI C;  1TY2 A;  2LGD A;  4OZB A;  2WHI A;  2DAJ A;  4XX5 A;  3U7D A;  3PHW B;  3EFU A;  2N7E A;  3I3T B;  1TTN A;  3KWL A;  2NS5 A;  3NVW A;  1C9F A;  3RZF A;  3VTV A;  3QAQ A;  1NDD A;  2KQ4 X;  1UZX B;  2DYO A;  3OG5 A;  1G6J A;  1E8Z A;  3R8B A;  4KDL B;  5KHQ A;  2K9X A;  4LNN A;  2RDB C;  5JH5 C;  1HQR D;  1SE3 A;  2D5G A;  1MHH E;  2O6V B;  3U2S C;  1WH3 A;  2J7Q B;  2PVG C;  2KAN A;  2K1F A;  4KGS A;  3RNF C;  4WWM A;  3D32 A;  2XBB C;  4RH6 A;  4NY0 A;  1E5W A;  1UWX A;  1H4R A;  5EE3 A;  3N3K B;  1PUT A;  4FJZ A;  4CO7 A;  4LNO A;  1TY0 A;  4AP4 C;  4GDK A;  2J0J A;  3GP7 A;  2DEN B;  1WGH A;  1Q5W B;  3A33 B;  3ZNI D;  3GZN I;  1XLQ A;  2C9W B;  5AZF A;  3EC8 A;  1RFA A;  4FXC A;  4MGZ E;  2KTR A;  3BII D;  2KDI A;  3PRZ A;  2L7R A;  3UIN B;  3L10 B;  4GDL B;  2KHW B;  2KLC A;  5DPW A;  4MDK E;  2BS4 B;  2V0G A;  2UWQ A;  4EKU A;  2L32 A;  4LNK A;  4OZA A;  4GSW A;  1YQ3 B;  2O6V D;  2M8S A;  2ACZ B;  4DBG A;  2LEK A;  3AB5 A;  5HHD G;  3URY A;  1V81 A;  1DOY A;  1F52 A;  5CHV C;  1XCT L;  2DWQ A;  2MW5 A;  1XQQ A;  2NVU I;  1L2N A;  2NCN A;  4GXB A;  4ICU A;  4LJO B;  2ZPY A;  4J6I A;  1T0S C;  1NEN B;  1Z2M A;  5CX3 A;  2W55 A;  4DWF A;  1WRD B;  2MLB A;  5T8I A;  1RM6 C;  4MGK E;  1V97 A;  3N1Y C;  3ZJT A;  2R2Q A;  2Y5P A;  2K0P A;  4FHK A;  4MEL A;  2JZ3 B;  4MGY E;  1IBX B;  1QIL A;  1P7E A;  3ZNG C;  2NBW B;  3B2F A;  1JWU D;  3AEC B;  2JY6 A;  3A1Q A;  4KZC A;  4P7I A;  1WX9 A;  2AEH A;  2Y5B B;  3P4Q B;  2PJH A;  1UD7 A;  2AX5 A;  3QIJ A;  2AQ3 B;  4S17 A;  5G2N A;  2DZK A;  3N9Y C;  2WU2 B;  2PPH A;  3BWU D;  3FIL B;  1SJH D;  1D6E C;  2NMQ A;  1GAQ B;  5BMG A;  2LHD A;  3EEC A;  2JX5 A;  1M94 A;  1ET6 A;  4KV2 A;  5EE1 A;  2LVO A;  3M62 B;  2ZNV C;  1V2Y A;  2MJ3 A;  3P4S B;  5LXI B;  5E6P A;  3QHT A;  2IZV B;  4XWT A;  2KZR A;  2WXF A;  2FUG 1;  3K9P B;  1D5M C;  4W9H A;  1SEB D;  4TSS A;  4DQO C;  4LNF A;  5IAA C;  2X38 A;  5L95 C;  4P6V F;  2W9N A;  1WJU A;  4WIP A;  1I4P A;  4BKS A;  3VXW A;  3U52 E;  1KH0 A;  5MPO A;  1YX6 B;  3TEY A;  3AI5 A;  5JXV A;  4FUL A;  4HXD A;  3L17 A;  4YTN B;  3AE4 B;  2GI9 A;  5EDS A;  4DHJ D;  3H7P B;  2AL3 A;  2WXJ A;  3IHP C;  2QCZ A;  3AE2 B;  2LI5 A;  4KKJ A;  1FM0 D;  4MJS B;  3BIN A;  2B3A A;  5G5G A;  1JWA D;  3BK2 A;  3KH0 A;  3NY5 A;  3VTW A;  3KLS X;  4C4V A;  1K52 A;  3PZ8 A;  1ENF A;  2KJ6 A;  2NPT A;  1VRA B;  5DPT A;  4HEA 1;  2Z0E B;  4GLS C;  5E6J A;  4IG7 B;  4W9E A;  4EZL A;  1SB3 C;  4IKG A;  3AE5 B;  5BMH A;  1ZPS A;  3BVM A;  3RZW C;  3AMZ A;  2M56 B;  2BB6 A;  1DGJ A;  4A20 A;  3VR9 B;  3GZN B;  2MEK A;  2IY0 B;  4MSM B;  1RRB A;  1WR6 E;  5C1Z A;  1NYR A;  4YWG G;  3APF A;  1WGK A;  2WU5 B;  1J8C A;  2GRI A;  1BUI C;  4RFB A;  2IND C;  3HVD A;  3KVF B;  3B2G A;  2G45 B;  1WM2 A;  3KQ4 A;  4NAW B;  1E90 A;  1C79 A;  4MH8 A;  1WWT A;  3KUZ A;  3DBL I;  4TUU A;  1NI3 A;  2PLP A;  1WSP A;  2LZ6 A;  2NTT A;  3PO0 A;  2N4F A;  4BKG A;  4PS3 A;  2FCN A;  1TIF A;  3V61 A;  2LRU A;  1GJZ A;  4IM2 A;  3MC8 A;  3DDC B;  5D3D A;  3AN1 A;  1MG8 A;  1WR1 A;  4X57 B;  1K50 A;  2OED A;  3ZQ4 A;  1WZ3 A;  2V4L A;  1D5X C;  1K8R B;  2GLS A;  2KQS A;  2WDR B;  2OHF A;  3ABV B;  3UQA A;  2ONQ A;  3MC0 B;  3EGR A;  3PSE B;  3WAL A;  4IWP A;  1L6V A;  2N7D A;  4BFR A;  4REZ A;  3MFG A;  1XEE A;  4M02 A;  4W9K A;  2Z8L A;  4NQK E;  2K8B A;  1T5X D;  4AQ7 A;  4USA A;  4JWS C;  2W82 A;  2KVR A;  3H6N A;  3QK0 A;  4WJQ A;  4YSX B;  2KLG A;  2KT7 A;  3EUB 2;  5IA7 A;  1IPG A;  3ML9 A;  4HPM B;  3CSF A;  2RMM A;  1P0R A;  2PTL A;  5EE9 A;  2N9K A;  1YOV B;  3HUI A;  3U4E G;  1K53 A;  1V1O A;  4MT5 A;  1ZDV A;  4DXF A;  2CU1 A;  2BKF A;  2HTM E;  3C8Y A;  1B9R A;  3W1Y A;  1SE2 A;  2RPQ A;  1N61 A;  3EFC A;  3V60 A;  3ZIM A;  2QIE B;  2L3Z A;  1HE8 A;  2ZVN A;  1WX7 A;  4XWW A;  2A5U A;  1WMH B;  3DVG Y;  4RCO A;  2KFK A;  3TEW A;  3N30 A;  2KX0 A;  3K9O B;  4E3C A;  2OJW A;  1WXM A;  1WE6 A;  1IYF A;  3TJP A;  1KLV A;  4WUR A;  2SAK A;  4M0W B;  2L05 A;  2J52 A;  4ANV A;  2PVO D;  4M01 A;  2K22 A;  3DPD A;  1ZUD 2;  2KXJ A;  3QWZ B;  1GG3 A;  2RR9 A;  1LXD A;  2M4N A;  3VVW B;  2QMT A;  1HXY D;  3ZXV A;  3X23 A;  1Y56 A;  3VUW A;  3Q3O C;  4HWI B;  3DHH C;  3TBL D;  1C77 A;  4ZRI A;  2BBC A;  4B95 A;  2KDB A;  2LWP A;  4HPL B;  2I2Y A;  4YXD B;  2LJI A;  1MFW A;  3I9V 1;  3JSV B;  2LVP A;  2WXP A;  3RPF C;  2IGH A;  2K5P A;  2IPK D;  1QT9 A;  2YLM A;  3NVY A;  4E71 A;  3GB1 A;  3Q8C A;  2L1A A;  1ACC A;  1JWM D;  1T3Q A;  3R7R A;  3R2T A;  1YJJ A;  2D11 A;  3PZD A;  2PKO A;  3DBL B;  1I42 A;  1CQV A;  1TS4 A;  2KWD A;  3IFW B;  1CMX B;  2YEP B;  2WYQ A;  4N59 A;  5I4D A;  3ECI A;  2L76 A;  1VR9 A;  1KFY B;  2HJ1 A;  2CR5 A;  3OLM D;  1SBB B;  4L23 A;  1B1Z A;  1E0Z A;  2WXN A;  2IJ0 A;  3ZTD A;  1F9J A;  2WXR A;  2YEP F;  1EUV B;  1NI2 A;  1VZ8 A;  3DVN U;  2J53 A;  2WDQ B;  2MHJ A;  1X1M A;  3M3J A;  3TEX A;  3ZO5 B;  4HK2 A;  1TKG A;  1L4Z B;  2JRI B;  3PV1 A;  4GN1 A;  3RFZ B;  1TBE A;  1C4A A;  4A9A A;  4I6P A;  1ZGU B;  3P4P B;  4NNJ B;  4KVG B;  2ASQ A;  3H7S A;  1GNU A;  4EZJ A;  3VUX A;  2HTH A;  4BVU C;  2JPH A;  4HDO A;  3IG3 A;  1J19 A;  4A3P A;  4PS7 A;  1KJT A;  1SF0 A;  1DOI A;  1S3S G;  1WF9 A;  1EO6 A;  3NVZ A;  1FXI A;  1SIJ A;  3A9K B;  4F8C B;  3FAH A;  3Q8F A;  2ZVO A;  1V9J A;  3L0W B;  2LFI A;  3NZ3 A;  4C7Y A;  3E56 A;  1E6E B;  3MJW A;  2NR2 A;  1EU4 A;  3ZDM C;  2X8X X;  2UYZ B;  3QAR A;  4RNA A;  3VHT C;  3AEE B;  2M0X A;  4DHZ B;  4WH4 A;  1I7H A;  3W5U B;  3ZW3 A;  1KLU D;  1RLF A;  3AEF B;  3WAN A;  4WAF A;  4US9 A;  1YMH E;  2WXQ A;  4A8X C;  2EMS A;  2WXH A;  2IBI B;  5CTR C;  3H8H A;  1HA5 A;  1EWC A;  2K25 A;  1ZKH A;  2KTF A;  4XZ4 A;  3T9L A;  4W9F A;  2ZPN A;  3Q8B A;  1YIW A;  2G9H D;  1QF6 A;  2O6V A;  5AZH A;  2JF5 A;  2R61 A;  4HJG E;  2LGI A;  2L52 A;  3HRD D;  2GB1 A;  4EFO A;  1YN5 A;  2ON8 A;  2IY1 B;  1R4M I;  2KC2 A;  4IOI E;  2LXC A;  4WJP A;  2WXL A;  2BTE A;  1DYQ A;  3UQB A;  4AWJ A;  4JX1 C;  1HTO A;  4GGQ A;  3ZRC A;  4BZA A;  2JYE A;  1PGA A;  2HE7 A;  4W9G A;  3HVZ A;  1IUE A;  5FKA C;  1UBQ A;  1LGR A;  4WQO B;  3DHI C;  2D07 B;  2KOX A;  1WXQ A;  1WJ6 A;  3OWE B;  3WCQ A;  4FBJ B;  2BS2 B;  4B9K A;  1NYQ A;  2CHW A;  3ALB A;  3CST A;  3M95 A;  1TKE A;  1LO5 D;  4OVU A;  1WI0 A;  5J2R A;  1ZW7 A;  1L7Y A;  2KVZ A;  2EKI A;  1MVK A;  2MBO A;  4RGM A;  1TT5 B;  1TKY A;  4K81 A;  3PRP B;  4MM3 A;  1YJ1 A;  4WJN A;  4B6W A;  4JE3 B;  1RFK A;  3A1Q B;  1PYW D;  4HRO A;  5AEK B;  5FR3 A;  2M17 A;  1E8Y A;  2C7H A;  4YL8 A;  2WGS A;  1V5O A;  3A9J A;  3DBR I;  4P1C C;  2CU3 A;  1F2R C;  2EKE C;  2LJ5 A;  1SJE D;  3R7Q A;  3DOW A;  2JUO A;  3I63 C;  4PYU A;  1KRH A;  2CKH B;  5D2M B;  3B9J A;  1WXA A;  4KIK B;  1IGD A;  4ACF A;  3T8M A;  4ARC A;  4ANX A;  2QDF A;  1VZ7 A;  2JSV X;  4II2 B;  4IWQ A;  1D3Z A;  3NG0 A;  1PGB A;  4JGH B;  2JVC A;  2MP2 B;  1GPX A;  4JWU C;  1WE7 A;  4OW0 A;  1GC7 A;  3AEA B;  3P63 A;  4GB9 A;  4C7Z A;  5BO4 B;  4WQM A;  1L4D B;  1PDX A;  2QHO A;  2HDE A;  3BVZ A;  4WWO A;  2IDY A;  3J9C A;  2LUM A;  2LXA A;  2ZNV B;  3X0W A;  3AU4 A;  1FXA A;  1OQR A;  2K8H A;  4HRS A;  2R2O A;  3BVG A;  2MH7 A;  3N1Z C;  1VJK A;  1C1Y B;  3GE3 C;  5BYQ A;  2D3G A;  4XC2 A;  1FMA D;  4PK1 A;  2AYO B;  4YSY B;  1L6U A;  3LB8 C;  4DHZ E;  4RGT A;  2GBJ A;  2V3P A;  4NJ7 A;  3RNC C;  2Z0D B;  1WXS A;  1KOT A;  2FIF A;  2MRP A;  3JYU A;  2E3T A;  2D3A A;  2DLB A;  1ET9 A;  2KQ7 A;  1NVI D;  3VQI A;  1SGH A;  1FFV A;  1WGG A;  2N9E B;  4NZL B;  3SEB A;  4GOC A;  1WFY A;  3VDZ A;  3H7P A;  5FR6 A;  3PT2 B;  2XK5 B;  5EE0 A;  2D3B A;  5E6O A;  2D10 A;  2HD5 B;  5D6J B;  4ZRP A;  1LFD A;  4MJS A;  3AM9 A;  5AUI A;  1WM3 A;  3GE8 C;  5AUK A;  2K8C A;  2M1M A;  2FBW B;  3IVF A;  1P1A A;  2MJE A;  2WDV B;  4RM8 A;  3ZYY X;  1E9M A;  1UBI A;  1FO4 A;  3ZRF A;  1V1P A;  2WDT B;  1EF5 A;  1R4M B;  2WNM A;  4W9D A;  3R3M A;  4JL9 A;  3ZJU A;  4LLG M;  2JT4 B;  3QX1 A;  4NJC A;  3WAM A;  3SFE B;  3Q3F A;  4OHJ A;  3KUC B;  1QOA A;  4ZRK A;  3NHE B;  3QJZ A;  1IGC A;  1K51 A;  3DQV A;  1SIF A;  3Q3J A;  1FNV A;  1YQB A;  3DVG X;  4LK0 M;  2CJN A;  3AE6 B;  4G3X B;  4FJV B;  1AW7 A;  3V3X A;  3V05 A;  4OVZ A;  4HPP A;  1AYF A;  4XDD A;  4G0N B;  3B1L X;  1CK1 A;  5D3I B;  2IO3 B;  4IM0 A;  3FKY A;  4W9L A;  4OVV A;  1P7F A;  4CQN A;  4RGN A;  1UEL A;  3SDL C;  1EM7 A;  2HJ8 A;  4JQW C;  4GMV A;  2GBR A;  4AJW A;  1Y8R C;  3ETR A;  1AAR A;  1JRP A;  4E74 A;  4JLC A;  1WRI A;  3NZU A;  4ICV A;  4M8N A;  3DBR B;  2ZW1 A;  3C0R B;  3SFD B;  2N0S B;  2O2V B;  2DHZ A;  4ZRQ A;  1VLB A;  2BF8 B;  2OOB B;  5DPR A;  4A3O A;  1JQ4 A;  5HG2 A;  5BYS A;  3R66 C;  2WX1 A;  4ZYS A;  5C3J B;  1IP9 A;  2WLB A;  3JVZ X;  1E7P B;  2GBN A;  1QLB B;  2KDM A;  4O1N A;  3N32 A;  3RT3 B;  4BOZ B;  1H8C A;  2I1J A;  3P4R B;  2AL6 A;  4TMA B;  3RNB C;  2WXO A;  4US8 A;  1OFF A;  4P16 A;  2BW2 A;  2IGG A;  1AWD A;  4ARI A;  1UNS A;  1HTQ A;  2LAS A;  4RM9 A;  4FLH A;  2C7N B;  2MSE D;  3GOE A;  3DCG A;  3DWM A;  3VH4 B;  4NAM A;  4EOY A;  3EA6 A;  1Z5S B;  2MBQ A;  4ZHO A;  5JHA A;  3PRM B;  3RN9 C;  2MBH A;  2KMC A;  1L0X B;  3H9D A;  2DYM A;  1N63 A;  1XLO A;  1MG4 A;  4B0M A;  1EF1 A;  1E7V A;  2LMC A;  4ZHP A;  3OJ4 B;  2XNA C;  3MHZ A;  2BGF A;  4QAY A;  3MHS D;  4BBN C;  3LJ3 A;  1JRU A;  1MJD A;  1KTK A;  2KX3 A;  2C5L C;  1WIA A;  3DBH I;  2DBY A;  4KSL C;  3NZS A;  2JRH A;  2Y3A A;  3RUL A;  3BYT B;  4FA6 A;  3MJ5 A;  4A6Q A;  1T0Q C;  2KWC A;  3AE3 B;  1WYG A;  3NS8 A;  4IDI A;  1UGM A;  2AQ2 B;  4F7Z A;  4GU2 A;  5KHO A;  1F1H A;  4FAD A;  1D5Z C;  3SD5 A;  5LXH A;  3AED B;  3HM3 A;  1SSN A;  2MQJ A;  4M0W A;  4YSZ B;  2IO1 B;  3L08 A;  1XCQ L;  2G3Q B;  5BYR A;  2QSD A;  3PLV A;  5AZG A;  5HKH A;  3AH7 A;  2GBM A;  1M4V A;  3CF6 E;  1GUA B;  1YNT E;  4M00 A;  2DAF A;  4EE2 A;  3TIX A;  3VRB B;  1T6B X;  1UGJ A;  2KC1 A;  2NBU A;  1E8W A;  3RUI B;  1BML C;  2M19 A;  1JCK B;  3ZTC A;  2CS4 A;  4AUQ C;  5IP4 D;  2JWU A;  3JSV A; 
#chains in the Genus database with same CATH homology
 4Q2J A;  1I4P A;  4IOI E;  3W9C B;  1SE4 A;  3U52 E;  1KH0 A;  5MPO A;  3TEY A;  1Q10 A;  1YN3 A;  1TZO A;  3LYY A;  2WXL A;  5JXV A;  1VZ6 A;  4YTN B;  2BTE A;  3AE4 B;  1DYQ A;  2I38 A;  2GI9 A;  2INN E;  4JX1 C;  2WXJ A;  4TQ0 A;  3E9S A;  4N6E B;  3Q8E A;  4C56 C;  2JYE A;  1PGA A;  2H88 B;  4C80 A;  2V4I B;  2PW9 A;  1HEZ E;  3AE2 B;  3BK1 A;  3HVZ A;  1IUE A;  3AEG B;  1D4B A;  1XO3 A;  4KKJ A;  5FKA C;  1FM0 D;  1RWS A;  1C4C A;  1C4P A;  5G5G A;  1JWA D;  3BK2 A;  3W5V B;  3KLS X;  1PFD A;  3AE9 B;  1WXQ A;  1YN4 A;  3OWE B;  4AS1 A;  3WCQ A;  3TSS A;  2VZK D;  2BS2 B;  1QQR A;  2N7J A;  1K52 A;  2WXG A;  1F2R I;  2W3S A;  3PZ8 A;  1NYQ A;  1ENF A;  3VRA B;  1VRA B;  1TS3 A;  4HEA 1;  3T3N A;  1BXT A;  4GLS C;  2QIL A;  4RF0 A;  2JXT A;  1TKE A;  1GB4 A;  5E6J A;  1LO5 D;  1A70 A;  1FEH A;  1JML A;  4MAC A;  2BS3 B;  1L0Y B;  2RPV A;  5G5H A;  2EKI A;  1MVK A;  1SB3 C;  4IKG A;  3NVV A;  3AE5 B;  4RGM A;  5BMH A;  1ZPS A;  3BVM A;  1TKY A;  5D7G A;  3AMZ A;  2M56 B;  2BB6 A;  1DGJ A;  5FK9 C;  1KF6 B;  3VR9 B;  2MEK A;  4JE3 B;  1RFK A;  1QKZ A;  3DWG C;  1N5W A;  3ZGZ A;  1NYR A;  1PYW D;  1L5P A;  4HRO A;  2G1E A;  1TS2 A;  1RYJ A;  5FR3 A;  1FD6 A;  4YWG G;  2BYT A;  1WGK A;  2WU5 B;  1CZP A;  2GRI A;  1N60 A;  2J4X A;  1BUI C;  4PT5 A;  1UWM A;  4RFB A;  2CU3 A;  3HVD A;  3B2G A;  1F2R C;  1SJE D;  3KQ4 A;  4NAW B;  2WQY B;  1KRH A;  3B9J A;  1C79 A;  4MH8 A;  2RDG A;  1WWT A;  1NI3 A;  2PLP A;  1FFU A;  1IGD A;  1WSP A;  2WP9 B;  4LTU A;  2NTT A;  1I4Q A;  1J7A A;  2INP E;  4ARC A;  3PO0 A;  4TQ1 A;  4KGR A;  1R7S A;  3AV8 A;  1VZ7 A;  2JSV X;  3GS2 A;  4ZOH C;  3P1M A;  1JW9 D;  1PGB A;  1TS5 A;  4YTM B;  2BB5 A;  3IXS A;  1GPX A;  4D2K A;  1JAL A;  4JWU C;  4OW0 A;  1DOX A;  3AEB B;  4J3O D;  3AEA B;  3P63 A;  5D3D A;  3AN1 A;  2K3U A;  4C7Z A;  3NRZ A;  3AE8 B;  4WQM A;  3I57 A;  1K50 A;  3PZ7 A;  2OED A;  2V3N A;  1L4D B;  3P42 A;  1PDX A;  2PIA A;  3ZQ4 A;  1F0Z A;  1F77 A;  1D5X C;  4YT0 B;  2HDE A;  3BVZ A;  1UUP A;  4GDK B;  1EWY C;  2IDY A;  3J9C A;  2LUM A;  3CIR B;  1FNU A;  2KAJ A;  2WDR B;  1XLN A;  1I4X A;  4L2Y A;  2OHF A;  3ABV B;  3IT4 B;  2ONQ A;  3MC0 B;  3IT6 B;  3EGR A;  1STE A;  3TEZ A;  1FXA A;  1OQR A;  3U7Z A;  4HRS A;  1HZ6 A;  2KN4 A;  2PMV A;  1L6V A;  2MH7 A;  3BVG A;  4H2A A;  2W3R A;  2Y5C A;  1VJK A;  1GOZ A;  1L0V B;  3LXF A;  3MFG A;  4REZ A;  1XEE A;  5BYQ A;  2H89 B;  2WS3 B;  2Z8L A;  1YJI A;  1FMA D;  1T5X D;  2KAC A;  4AQ7 A;  3BYY B;  4YSY B;  4USA A;  1L6U A;  4JWS C;  3LB8 C;  2W82 A;  4RGT A;  2V3P A;  3FC4 A;  4N58 A;  2LHE A;  4A90 A;  4YSX B;  1JWB D;  1FNW A;  3EUB 2;  2SEB D;  5BMI A;  2E3T A;  2RMM A;  2DLB A;  1C78 A;  3NS1 A;  2PTL A;  1ET9 A;  5EE9 A;  2N9K A;  4B0E A;  1NVI D;  1QOB A;  3VQI A;  1FFV A;  3HUI A;  4NZL B;  3U4E G;  3SEB A;  2KMM A;  1FRD A;  1YQ4 B;  4HKQ A;  3UI3 A;  3CWI A;  1K53 A;  1V1O A;  1I4H A;  4MT5 A;  1ZDV A;  4DXF A;  5EE0 A;  1ZOY B;  4ZRP A;  1AN8 A;  1XLP A;  4JPS A;  1C76 A;  3AM9 A;  4DXG A;  2HTM E;  5AUI A;  3C8Y A;  1B9R A;  5AUK A;  2N9L A;  2FBW B;  1SE2 A;  2MJE A;  4MM3 B;  1N61 A;  3Q8A A;  2WDV B;  5H8Y E;  3ZYY X;  5GXG B;  1E9M A;  5C2T B;  1MPE A;  1FO4 A;  2QIE B;  1V1P A;  2JU6 X;  4RGO S;  3VR8 B;  2WNM A;  4XWW A;  2ICI A;  1ZXI A;  3ZJU A;  4LLG M;  2TSS A;  4RCO A;  1ZDX A;  4OZC A;  4NJC A;  3TEW A;  3T3O A;  4KGT A;  3SFE B;  2CJO A;  1KLG D;  3W2D A;  4OHJ A;  1IBX A;  3ZJV A;  1SXT A;  1TY2 A;  1ZP0 B;  1QOA A;  4OZB A;  2RDH A;  4UDU C;  1I4G A;  1IGC A;  1K51 A;  4WUR A;  2SAK A;  3KWL A;  1FNV A;  3NVW A;  4LK0 M;  2CJN A;  2EEL A;  1C9F A;  2J52 A;  2M0A A;  2KQ4 X;  1QOF A;  3AE6 B;  2PVO D;  1AW7 A;  1FIQ A;  3V3X A;  3V05 A;  2DYO A;  2W54 A;  4OVZ A;  1AYF A;  4XDD A;  2K22 A;  3R8B A;  5LNK 1;  1CK1 A;  1ZUD 2;  2K9X A;  3FIL A;  1TJE A;  1HQR D;  1E10 A;  2QMT A;  5D3I B;  2E6X A;  1SE3 A;  1TYG B;  1HXY D;  2D5G A;  1MHH E;  4L1B A;  1Y56 A;  1P7F A;  4CQN A;  3U2S C;  1I4R A;  1FCL A;  2PVG C;  1C77 A;  4RGN A;  1V8C A;  2BBC A;  2WXM A;  4KGS A;  1EM7 A;  2JQR B;  3W1S A;  2I2Y A;  3TUO A;  1FCC C;  1QOG A;  2LJI A;  4WWM A;  4YXD B;  3I9V 1;  3ETR A;  4RH6 A;  1JRP A;  4KKI A;  1UWX A;  1WRI A;  2WXP A;  3RPF C;  1XF5 L;  5EE3 A;  2IGH A;  2K5P A;  2IPK D;  1PUT A;  2AQ1 B;  1QT9 A;  2J42 A;  4YTP B;  2ZW1 A;  1TY0 A;  3NVY A;  3SFD B;  2N0S B;  3GB1 A;  3GP7 A;  3Q8C A;  2L1A A;  1ACC A;  1JWM D;  2XN9 C;  1T3Q A;  4ZRQ A;  1XLQ A;  1VLB A;  3R2T A;  1YJJ A;  3L4P A;  2PKO A;  5TSS A;  4FXC A;  1CQV A;  2WXI A;  1TS4 A;  1JQ4 A;  5HG2 A;  4ITK A;  2KWD A;  3BII D;  5BYS A;  4ZYS A;  5C3J B;  2WLB A;  1E7P B;  2YEP B;  4N59 A;  1QLB B;  2KDM A;  4GDL B;  4O1N A;  5I4D A;  1VR9 A;  1N62 A;  2QJL A;  1KFY B;  3P4R B;  2BS4 B;  4TMA B;  2V0G A;  1SBB B;  4L23 A;  1B1Z A;  2WXO A;  4US8 A;  1OFF A;  1E0Z A;  4P16 A;  2WXN A;  2BW2 A;  2IGG A;  2L32 A;  2IJ0 A;  2JZP A;  3IAM 1;  4OZA A;  1AWD A;  2WXR A;  5HI1 A;  2YEP F;  1YQ3 B;  1UNS A;  4ARI A;  2ACZ B;  1VDV A;  3SR6 A;  2JYT A;  1VZ8 A;  4KX6 B;  1ROE A;  2LEK A;  2J53 A;  2WDQ B;  3AB5 A;  5HHD G;  3URY A;  3TEX A;  3DWM A;  3NUH B;  1TKG A;  1L4Z B;  1MHX A;  4NAM A;  3RFZ B;  1DOY A;  1C4A A;  1XCT L;  2DWQ A;  4A9A A;  1ZXH A;  3P4P B;  3EA6 A;  1CJE A;  1V1P B;  4ZHO A;  1N5X A;  1NEN B;  2W55 A;  5H92 C;  5T8I A;  1RM6 C;  1PGX A;  1L0X B;  3BZD B;  2DYM A;  1N63 A;  3IAS 1;  1XLO A;  5HFY A;  1OQQ A;  1V97 A;  4B0M A;  3ZJT A;  2LMC A;  4ZHP A;  2XNA C;  2Y5P A;  3MHZ A;  2K0P A;  1SF0 A;  4XE0 A;  1DOI A;  1IBX B;  1ESF A;  1QIL A;  3NVZ A;  1KTK A;  1P7E A;  1FXI A;  1SIJ A;  3FAH A;  3B2F A;  1JWU D;  3AEC B;  3Q8F A;  2DBY A;  1FRR A;  2LFI A;  2Y3A A;  3AE7 B;  3BYT B;  3MJ5 A;  4A6Q A;  3AE3 B;  3NZ3 A;  4C7Y A;  2L83 A;  3E56 A;  1WYG A;  1E6E B;  3P4Q B;  1EU4 A;  1XXG A;  4IDI A;  2QEJ C;  4RNA A;  2AX5 A;  1ZE3 D;  2AQ2 B;  3AEE B;  2MJD A;  2AQ3 B;  4WH4 A;  1I7H A;  3MP9 A;  1NEK B;  3KWV A;  3W5U B;  2IGD A;  3N9Y C;  1GB1 A;  2WU2 B;  2WXK A;  1KLU D;  3O13 A;  1D5Z C;  3BWU D;  3FIL B;  3AEF B;  3AED B;  2BT6 A;  4WAF A;  1SJH D;  1D6E C;  2NMQ A;  4US9 A;  1GAQ B;  1YMH E;  2WXQ A;  4A8X C;  4A55 A;  4HKZ E;  5BMG A;  2WXH A;  1SSN A;  4M0W A;  4YSZ B;  2LHD A;  3R2I A;  3H8H A;  1XCQ L;  1HA5 A;  1EWC A;  3Q69 A;  5BYR A;  2JX5 A;  2QSD A;  1HZ5 A;  1ET6 A;  5EE1 A;  3AH7 A;  1M4V A;  1J7C A;  2VZK B;  2MJ3 A;  3P4S B;  2FE8 A;  1YNT E;  2ZW0 A;  1EU3 A;  3Q8B A;  4XDC A;  2G9H D;  4XWT A;  1QF6 A;  4EE2 A;  2WXF A;  2FUG 1;  4RF1 A;  3VRB B;  1J7B A;  1JWS D;  1T6B X;  2NTS A;  2R61 A;  2B76 B;  4HJG E;  1D5M C;  1UGJ A;  2LGI A;  2L52 A;  3HRD D;  1JRO A;  1MI0 A;  2GB1 A;  1BML C;  3AE1 B;  2M19 A;  1SEB D;  4R3D A;  4TSS A;  4DQO C;  2Q5W D;  1JCK B;  2X38 A;  4P6V F;  1YN5 A;  2ON8 A;  4WIP A;  2JWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...