1E0ZA

[2fe-2s]-ferredoxin from halobacterium salinarum
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
128
structure length
127
Chain Sequence
PTVEYLNYETLDDQGWDMDDDDLFEKAADAGLDGEDYGTMEVAEGEYILEAAEAQGYDWPFSCRAGACANCASIVKEGEIDMDMQQILSDEEVEEKDVRLTCIGSPAADEVKIVYNAHLDYLQNRVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title A Two-Alpha-Helix Extra Domain Mediates the Halophilic Character of a Plant-Type Ferredoxin from Halophilic Archaea.
pubmed doi rcsb
molecule tags Electron transport
total genus 20
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2000-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1e0zA00
3AE2B 3LXFA 1EWYC 2KMMA 1NENB 3AE4B 1L6VA 5H92C 4ZHOA 4N58A 3B2FA 1AYFA 1DOXA 1E0ZA 2MJEA 1XLNA 4US9A 2CU3A 2WU5B 1FXIA 1J7AA 4JWSC 1TKGA 2H88B 1FMAD 1OQRA 3P63A 1KF6B 1OQQA 2PVGC 2L52A 1ZUD2 2BT6A 3VRAB 2PVOD 1GAQB 2WP9B 5MPOA 1N63A 2MJDA 1FFUA 1JROA 1NYRA 3NVYA 1V8CA 1PDXA 3AE6B 3DWGC 3HVZA 1L5PA 1QOBA 1CZPA 1R7SA 2CJOA 3AE8B 3FC4A 5EE9A 3LB8C 1SB3C 3P4QB 2WQYB 3B9JA 3AE3B 1CJEA 5AUKA 1QOGA 1JRPA 1QOFA 4YXDB 2H89B 3NVZA 1I7HA 1KFYB 1E10A 1JALA 1E6EB 4LTUA 1B9RA 1NEKB 2L83A 3FAHA 2FBWB 1E7PB 2W55A 3NVVA 5AUIA 1YJIA 3SFEB 1N60A 1RM6C 2K9XA 3VR9B 1QT9A 1YQ4B 3AN1A 4WWMA 4JWUC 1J7BA 1N61A 3P4RB 3B2GA 1NYQA 3P4SB 1FRDA 1FO4A 4YT0B 1TYGB 2MH7A 1JWBD 4C80A 2WDRB 1XLQA 3CIRB 3NS1A 1E9MA 3NVWA 1XLOA 1TKYA 2W3RA 1JWAD 4KX6B 2WU2B 4WQMA 5G5GA 1F0ZA 4N59A 1L0VB 4IDIA 1TKEA 1TJEA 3AE9B 4N6EB 3W9CB 2Q5WD 1JQ4A 2DBYA 1FXAA 4C7ZA 1YQ3B 2N0SB 3ABVB 3AEFB 1ZXIA 5EE3A 3AMZA 2WDVB 4USAA 2QIEB 2KAJA 1VJKA 1YJJA 3AH7A 1UWMA 2ACZB 1DOYA 4A9AA 1QF6A 1GPXA 3AM9A 2MJ3A 1FM0D 2HTME 4HROA 1L6UA 3AB5A 2JQRB 1OFFA 1PFDA 1SIJA 1XO3A 3AE7B 5G5HA 1N62A 1A70A 1QLBB 3ETRA 1KRHA 3WCQA 1N5XA 3HUIA 1WRIA 4FXCA 1DOIA 3DWMA 1VDVA 1WGKA 2E3TA 5C2TB 4JX1C 2BS4B 1FIQA 1T3QA 2BS3B 2CJNA 3AECB 5H8YE 3NRZA 1WXQA 1WWTA 2G1EA 4YSYB 3P1MA 2LEKA 1DGJA 2BS2B 4YSZB 2WLBA 4US8A 2B76B 4ITKA 4YSXB 2WS3B 1ZOYB 3W5UB 1JW9D 2JX5A 3AV8A 3SFDB 1AWDA 3AEBB 2PKOA 3EUB2 4C7YA 2M56B 4P6VF 2DWQA 3HRDD 1NI3A 3KWLA 5GXGB 3W5VB 2W54A 5C3JB 1NVID 5EE1A 5EE0A 3VRBB 1FFVA 2WDQB 4HRSA 3L4PA 2EKIA 3AE5B 1RFKA 2Y5CA 4YTNB 3AEGB 3ZYYX 1RYJA 1FRRA 3P4PB 1XLPA 3BIID 2AX5A 1VLBA 1WYGA 2PIAA 4YTPB 3VR8B 4YTMB 1J7CA 1QOAA 2K5PA 3AEAB 3CWIA 1SF0A 4ZOHC 1IUEA 1N5WA 1PUTA 1RWSA 3PO0A 3RPFC 1ZP0B 2QJLA 2K22A 2M19A 2W3SA 1V97A 2OHFA 1ROEA 3AEDB 3SR6A 4ZHPA 3AEEB 3AE1B
chains in the Genus database with same CATH superfamily
4HVBA 4MM3A 1BUIC 2WNMA 3MTNB 1MFWA 3ZDTA 3U52E 4KVGB 2BB6A 4W9JA 1C1YB 3DHHC 3DVGY 4NPNA 2BKFA 3PT2B 2AQ1B 5LXHA 3NVYA 5AUIA 2MA9B 2KDMA 2IDYA 3GZNB 2N7EA 1JRPA 2ZCCA 3PPAA 2Z0EB 1E10A 2PE9A 1SEBD 3S2AA 3OAWA 2ZPNA 2W55A 4M8MA 3VR9B 1WSPA 4AUQC 3ZRCA 3H9DA 2MRPA 1V49A 3IVFA 4LNFA 1MJDA 1C9FA 4IM2A 2DYMA 3T8MA 4ZRPA 2V0GA 2XNAC 3BYYB 3PREA 2MJ3A 3R7QA 2DZJA 2ZVNA 4ACFA 1EF1A 3MC9A 1XO3A 2N9EB 4MGZE 3WAPA 3RNAC 3VUYA 2JXTA 3IT6B 2I38A 2KNBA 2FE8A 3IHPC 2JX5A 2MX2A 2NBVB 4C7YA 3HM3A 5EE0A 2KFKA 2PLPA 2PW9A 3P2BA 1FRRA 2LXAA 2PIAA 3AEAB 3E9SA 4ZOHC 1C4PA 1TS2A 2L0TA 3QCAA 3AE2B 3LXFA 1EWYC 1L7YA 4HCPB 2JUOA 4ZYNA 4US9A 1TBEA 5HHDG 4JWSC 5CHFA 2KQ7A 4AJWA 1KF6B 2PVGC 4ANVA 1UGMA 3JW0X 5GMVA 3RMKC 5FKAC 2EMTA 4MACA 4A55A 1TS4A 1WGYA 2LD9A 4MGYE 3UIOB 4HPMB 1TIFA 2L7RA 3ZJUA 2MBOA 1HEZE 1KTKA 2FNJB 2K8CA 2RD0A 1YX6B 4LNNA 2Z59B 2K0PA 1IGCA 4A6QA 5CHVC 4C56C 2MH7A 1E7VA 3NOBA 2NMQA 1TKYA 1MVKA 4K7WA 1RRBA 1FXAA 3A1QB 3TEXA 1H4RA 2KAJA 3QX1A 4MJSB 3BZDB 1T0QC 2ACZB 4HK2A 4LNIA 3Q8AA 2HTME 5CHWA 3GB1A 3MFGA 1L0XB 2ONQA 3RI7C 2KJHB 3HVDA 4JX1C 3V6CB 3ZGZA 3WALA 4PS7A 5DPRA 4I6PA 4HDOA 1I42A 3N3KB 2K8HA 3PLUA 5E6PA 1R4MB 2LHDA 1QKZA 2YLMA 3L0WB 3U30A 3RNBC 2J0JA 5BYRA 4ZYSA 2DWQA 2BTEA 4BKTA 3DHGC 1P0RA 2IPKD 4GDLB 1C76A 3N1XC 1RFKA 2RMMA 2MLBA 1XLPA 1EU4A 3Q3FA 1VLBA 2BPSA 1J7CA 5T8IA 1U4AA 1SF0A 1K8RB 2D10A 2JZZA 4AS1A 1EM7A 4IM0A 4LJOB 4O1NA 4GDKB 3DBRB 4ZHOA 3RNCC 2MJEA 2VH1A 1UH6A 3BVGA 3L54A 3X23A 3GOEA 4PK1A 4MSQB 2WXLA 4W9EA 2NVUI 1JWMD 1P7EA 2DLBA 5IN7A 1LFDA 1JROA 1T6BX 2YEPB 1YN5A 1WR1A 4BOZB 4NJ6A 4DBGA 1OEYA 1MG8A 4XE0A 5IA7A 5EDSA 1HQRD 1WYWB 1TT5B 4GU2A 4H2AA 4WWMA 4ICVA 1UBQA 3C19A 4P7IA 4DHJD 1XLQA 3NVWA 2HTHA 2JWZA 1UWXA 1F0ZA 4RGMA 1V9JA 2ZVOA 4JIOU 2Q5WD 1E8WA 1KLGD 2QDFA 3AEFB 5KHOA 3PRPB 3AB5A 1IGDA 2KDFB 1PFDA 3AE7B 1QLBB 3Q14C 1L2NA 2MHJA 3HUIA 4MDKE 1F52A 3ZJVA 5JZEB 1KLUD 2CJNA 3HIZA 4G50A 1V1PB 4BZAA 3VUWA 3VUXA 1HZ6A 3SFDB 2C7MB 2M4NA 2J7QB 2V4IB 4AJYB 2JPHA 3PLVA 3H7PB 5EE1A 3VRBB 2C9WB 2YVCA 4EZJA 3ZVVA 4GIVA 4MT5A 2MEKA 3JVZX 4GDLA 3CWIA 1P9DU 2MSED 2RDBC 2REXA 3VAWA 3PSEB 2DENB 4IOIE 3A9KB 3TEZA 2N7JA 1J7AA 4W9HA 2O6VD 3ZKJC 4GDKA 4GMVA 4WWOA 1AW7A 3IBEA 1JMLA 3U4EG 5HG2A 1NYRA 4HJKA 1K52A 5BMGA 5J2RA 2V3SA 2KOXA 1EF5A 2IY0B 1I7HA 4EOYA 4RCOA 2JVCA 1SJHD 5G55A 3Q6BA 4NQLB 2HJ1A 2FBWB 1E7PB 4F8CB 2WWZA 1RM6C 2C7NB 3RNEC 3OLMD 2JXXA 1FO4A 4C80A 2NR2A 1C4CA 1ESFA 2INNE 1JWAD 3N20C 2BYTA 4FLHA 2XEWA 2DBYA 2Y5BB 3Q3JA 3DQVA 1YQ3B 3UI3A 2GBRA 2DZKA 2NBUA 3AH7A 2ZNVB 2FIDA 2EELA 2GBJA 2OOBB 2ZNVC 2D11A 2WXJA 3DWMA 1FXTB 5CX3A 3PTFC 2UWQA 1FIQA 1T3QA 1C3TA 3NZSA 2N7DA 2KWDA 1TZ1A 1J0GA 3TCAA 2BS2B 4WAAA 1ZOYB 4NNJB 3C0RB 3L17A 4P6VF 1V1PA 2JRHA 3HRDD 2RDGA 3R8BA 5AZFA 1M94A 2GBKA 1YQBA 1UD7A 2NPTB 4FJYA 4J6IA 4YTPB 2K5PA 2K8BA 1TY2A 2R61A 3AI5A 4K3BA 5D94A 5FR3A 4FHKA 5AZGA 4IWPA 2VZKB 3BK1A 3ZTCA 2FCSA 3A9KA 1E7UA 4WJQA 1V5OA 4IG7B 3VH4B 1HA5A 3AE8B 3B08A 2SAKA 2WQYB 4RM9A 4YXDB 3L08A 3QHTA 2IO1B 1K50A 2D3AA 2WXGA 4OVVA 1B1ZA 4IUMB 1KH0A 1FNWA 1N61A 3B2GA 3P4SB 1D6EC 2ZW1A 2FCMA 3QK0A 1XLOA 2JSVX 4WQMA 3M3JA 4N59A 1Z5SB 3AE9B 1BXTA 4XC2A 3TMPB 4FA6A 4C7ZA 2ZJDA 2IO3B 1ZXIA 3PZ8A 1WE6A 1YJJA 3AULA 1HE8A 2UYZB 3R2TA 3Q2AC 3UF8A 1SIJA 4DXFA 1AN8A 2IBIB 2J0KA 3APDA 2QHOA 1WRIA 4RFBA 1DOIA 2G3QB 1WX7A 3DVNV 3U7ZA 2N9KA 1UNSA 2BS3B 2N1WA 2BYFA 3RNFC 1OGWA 5IO9A 2IO2B 3KLSX 3RN9C 4W9DA 3AV8A 4FADA 3RZFA 1WFYA 4CQNA 4II2B 1IBXA 2WDQB 4QAYA 1ZDVA 2NTTA 3V05A 2XK5B 3DDCB 3V62A 2W3SA 3H7SA 2ON8A 3SR6A 4DHZE 4K1RB 2HDEA 2KYWA 4M00A 4XYCA 2WXKA 4EKUA 2TSSA 3TIXA 2RPVA 2BVCA 3W1SC 5MPOA 4EZLA 3AE6B 3DWGC 3Q8CA 1YN4A 3B9JA 3AE3B 3BINA 4W9LA 2PTLA 1GC6A 1EO6A 1VZ8A 4DXGA 4WURA 1WZ0A 3NVVA 1N60A 2INDC 2QCZA 2KQ4X 4RGOS 4HPPA 4BFRA 1L0VB 5J18A 5JXVA 1ZKHA 5D6JB 1VZ6A 2WDVB 3RCZA 2QIEB 3Q3MC 3V6EB 3ETRA 3IT4B 4FXCA 2KKCA 1YD8U 1RFAA 3T3NA 1WGKA 2NBWB 1WXQA 3AU5A 4LJPB 1WMHA 2G1EA 4RF1A 5LNK1 5TR5A 2WLBA 4ITKA 2N9XA 5FR6A 4XGAB 2PKOA 3EUB2 2M56B 1UBIA 5BO4B 4BKGA 3L16A 1VCBA 5E6OA 3L4PA 2E6XA 4ZRQA 1WGRA 3VR8B 1NBFC 1DYQA 4JQWC 1PUTA 4JE3B 2HE7A 1RAXA 3AE1B 5IP4D 2XK5A 1IYFA 4W9KA 4ZRIA 2GOWA 2JZ3B 2JZPA 5C23A 5J17A 3C8YA 2BF8B 4G3XB 3DOWA 3MC8A 4II3B 2XBBC 4RM8A 1Q5WB 4YL8A 2CJOA 3W1SA 1A5RA 3P4QB 4MH8A 2BQQA 2WXFA 2VH2A 4AP4C 1WJNA 1VR9A 1S3SG 3QAQA 1PGXA 3VH3B 2EKEC 2CKHB 2LRWA 3DVGX 4KSKC 4ZRKA 1UF0A 2WDRB 3ZNZB 2K39A 2ZEQA 3HK0A 2D3BA 5IKCM 2AQ2B 2SEBD 3ABVB 4BBNC 1E90A 4USAA 1ET9A 4K3CA 4MGIE 2WXRA 4M0WB 4DHZB 1GC7A 1X1MA 3TEYA 1FM0D 1WGGA 4N9F4 1LM8B 4P1CC 1NI2A 1KRHA 3JSVB 1XXGA 1F1HA 3I5JC 1F2RI 2BS4B 5TSSA 2OJWA 3DBSA 2NS5A 3NRZA 2QSDA 4M02A 3URYA 1HTQA 1TGZB 3ECIA 3OWEB 3W5UB 4GB9A 1K53A 2D3CA 2FIFA 1WXVA 1ZE3D 2WXPA 4DDID 3WANA 2LGXA 2C7HA 4DK5A 3VTWA 4WH4A 4GGQA 1YJ1A 3CMMB 3UGBB 4K7UA 2FUHB 2PE6B 2QJLA 2OHFA 4HPLB 1HTOA 3CF6E 1SBBB 1FCLA 4XDCA 2KC2A 4NJ7A 2D5GA 1G6JA 2LUEA 2WU5B 3P42A 3P63A 2D2QA 1STEA 4RF0A 1GAQB 2J42A 2WP9B 1CZPA 1V5TA 1WR6E 4L23A 3H6NA 3QJZA 2ZPYA 2IGHA 4OHJA 2IGGA 3DCGA 3EFCA 4FJZA 3L13A 2X8XX 3L10B 1JCKB 1WJ6A 2KMAA 3KUCB 2JT4B 1P1AA 3Q8FA 2WU2B 3T9LA 1TKEA 1EU3A 3W1YA 1PGBA 4A20A 3ENEA 3RULA 3X0WA 3I9V1 4XZ4A 5AZHA 2LHEA 3AM9A 1Q0WB 3QARA 4WIPA 4WWPA 1HXYD 1RLFA 1QZEA 4M0WA 1MPEA 2R2OA 2KMCA 4TKNA 3PGEA 1EWCA 3IG3A 2QC8A 3AECB 3JSVA 3V3XA 2JF5A 1OQYA 4RGTA 1D4BA 2LVPA 2WS3B 3R66C 1AARA 2OJRA 4TV3A 1JQ4A 3TL5A 2JY6A 4XWWA 3SD5A 3PV1A 4K7SA 4PYUA 3ZXRA 3PVLA 4ARIA 1I4HA 1VZ7A 2MP2B 5HFYA 3PO0A 1KLVA 3ONSA 1V97A 3BVMA 2PJHA 4KGSA 3ZIMA 2INPE 5BMIA 2KMMA 3ZO5B 2UU7A 2CHWA 3KYDD 4GN1A 1XLNA 3PZDA 1ZDXA 1TKGA 1FMAD 2BT6A 4HEA1 1PYWD 2IZVB 2G9HD 3SEBA 4I6NB 2L0FA 3LB8C 1JRUA 1WF9A 3QWZB 2M17A 4KGRA 3NVZA 3NZ3A 2ZZPB 4FULA 2AYOB 5L95C 1NEKB 1XEEA 2L32A 4FBJB 4HKZE 2QMTA 3PS6A 1YJIA 3NUHB 2VRRB 4PYZA 1YQ4B 5IOIA 3P4RB 1NYQA 2DNFA 1T0RC 1TYGB 5D3DA 4OZBA 3GS2A 3VTUA 4E3CA 4UDUC 2LMCA 3ZJTA 5G5GA 2RSUA 4HCNB 1T0SC 3ZNHB 3TEWA 4ARCA 3K9PB 2KWUB 1CMXB 2W9NA 1P3QU 1L6UA 1SXTA 4D2KA 2MBQA 1ENFA 1FD6A 1P7FA 1N5XA 3MHSD 4IM3A 2B3AA 4HXDA 4KIKB 4MGKE 4LDTD 3N32A 2I1JA 3U8ZA 4B0MA 3ZNGC 3EGRA 4US8A 4NAMA 1MHHE 1XD3B 2RPQA 3A33B 3AEBB 3OG5A 2PPHA 1FFVA 1C79A 3MJWA 3VDZA 2HJ8A 2LVQA 1NDDA 3KWVA 2WXHA 2M19A 3SDLC 3VQIA 4M01A 3AEDB 1R4NI 1XF5L 2KZRA 3TSSA 5L83A 2WGSA 4OW0A 1L6VA 1IBXB 4Q2JA 2KXJA 2GB1A 2JRIB 4F7ZA 1WX8A 2MP2A 3FKYA 2CU3A 1ZPSA 3KQ4A 4BKSA 4A3OA 2D07B 2L52A 1YOVB 3HM6X 2MJDA 2ZW0A 4HKQA 1K51A 3D32A 3KVFB 1QOBA 4EEWA 4KV2A 2LWPA 2KJRA 1KFYB 2WXOA 3JYUA 1SE2A 4RGNA 1ISNA 2CHZA 3MC0B 2CR5A 2G4DB 1YX5B 4YT0B 1SSNA 2KO3A 3IAS1 4KZ0A 2O6VA 3VVWB 4OZCA 1KM7A 4A90A 1Y56A 4N6EB 1TJEA 2GBMA 2N0SB 3DVNU 2A4ZA 2KTFA 3O65B 5E6NA 1QILA 3ZLZA 4DDGD 4OVUA 1D5XC 2KT7A 2LGYA 2KD0A 4G11A 1CQVA 2BGFA 3WCQA 1WIAA 1WY8A 2CS4A 2WHIA 5H8YE 2IY1B 2BYVE 4YSZB 4REZA 2GRIA 2RGFA 4KIKA 5G2NA 4CHKA 4ANXA 2B76B 5JHBA 1WXAA 1UGJA 5GXGB 2W54A 4JGHB 4YTNB 2V3NA 5JH5C 3R2IA 1WMHB 2DZMA 1WGDA 2V4LA 2V3PA 3MHZA 2GI9A 2FCNA 4C00A 1WI0A 5H92C 3ZRFA 1E0ZA 2L8JA 1C77A 2J53A 3WIMA 3BVZA 4EUTA 4CO7A 2ICIA 2BBCA 4URKA 4LCDE 1SB3C 1ET6A 1FPYA 5LXIB 2L83A 3BY4B 3CSFA 2KQSA 2XN9C 3EHVA 2K9XA 2KX0A 4GXBA 2Z0DB 4B9KA 1P98A 4B95A 3T3OA 3ZDMC 2D3GA 1LGRA 2A5UA 2W3RA 4PS3A 3IXSA 2Y5PA 1CK1A 4AQ7A 1LO5D 3W9CB 2FAZA 3IFWB 3ML9A 1YIWA 1TS5A 1KJTA 2KTRB 1UUPA 2LI5A 5D3IB 1FNUA 5G5HA 1N62A 1SIFA 2LFIA 1I35A 4JLCA 5DPTA 1T0YA 2E3TA 1F2RC 4MH0E 2IJ0A 3Q8BA 1E8ZA 1UZXB 2AQ3B 4RNAA 2QEJC 2FUG1 3IAM1 3DBHI 5BMHA 4NJCA 3CSTA 2L1AA 3KWLA 1ZGUB 2JYEA 5I4DA 4JPSA 1WXMA 4TQ1A 2LVOA 3I57A 1RWSA 3E56A 4IC7B 1ROEA 3AEEB 4PT5A 2BB5A 3AE4B 3GE3C 1QQRA 1AYFA 1FXIA 4EE2A 2BKRB 3U7DA 3ZXVA 3ZW3A 1GB4A 4P1BC 5EE9A 1LQBA 1PQSA 3EECA 3VFKA 1QOFA 4KDIC 1E6EB 1MG4A 1C4AA 2BYEA 2BWES 3BWUD 3LYYA 1FCCC 3SFEB 3NY5A 3GP7A 3CIRB 3DBLI 2IO0B 1V86A 2YEPF 4WWNA 4IKGA 3V60A 3AXCA 3AMZA 1I4RA 2KN4A 3ALBA 1J19A 5E6JA 1QF6A 4LLGM 5HI1A 3PRZA 2KTRA 2G4SA 3QQ8B 1LXDA 2KJ6A 2DHZA 2KVRA 2LUMA 4YSYB 2N4FA 2LJIA 2K1FA 4X57B 2KN5A 3Q8EA 3ZTDA 2JU6X 2JWUA 3RFZB 2QILA 5D2MB 2AWTA 4IW0A 4BVUC 4HWIB 3APCA 3PHWB 1F9JA 1WX9A 2DYOA 2G45B 3O13A 4NQKE 4ANUA 2K6QA 4DQOC 4XDDA 1FEHA 2H88B 4ZDVA 1WRDB 2PVOD 1GNUA 4AWJA 3HVZA 1D5ZC 1L5PA 3UIPB 3FC4A 4HLEA 2X38A 2DAFA 2WX1A 3BYTB 3GZNI 2MWSB 1QOGA 1JALA 4FN2A 1Q10A 4W9CA 4XX5A 5KHQA 4WQOB 5C1ZA 5BYQA 3WA0A 3VTVA 1H8CA 3EFUA 1FRDA 3NHEB 1JWBD 1E8YA 2AL3A 2K6DB 4TMAB 1V80A 2DX5B 2KVZA 3EC8A 2AL6A 1GB1A 3N1YC 4LNOA 4KSLC 2R2QA 4A9AA 4ICUA 1OFFA 5DPWA 2KX3A 1MI0A 4LK0M 4ZRJA 3OJ4B 4MELA 1I4XA 3TBLD 3NZUA 3N1ZC 1JWUD 4GSWA 1L4DB 2KLCA 1V6EA 2AEHA 4YSXB 4YWGG 4NZLB 1AWDA 1EUVB 2MBBB 1J8CA 3ZQ4A 4NAWB 4HRSA 2J52A 1VD2A 1F77A 4M8NA 4C4VB 3AEGB 4DHJB 1WE7A 2LRUA 3P4PB 1BT0A 2C5LC 1T5XD 1R4NB 4KDLB 2K22A 2LXCA 2KLGA 2I2YA 1WJ4A 4HJGE 5JHAA 4E71A 4N58A 3B2FA 3N9YC 1YMHE 2Z8LA 3R7RA 3RT3B 1WM2A 2MBEA 4OZAA 1C78A 2Y3AA 3PZ7A 2CHXA 1OQQA 2WXNA 4L1BA 1KOTA 3KUDB 1PDXA 2L00B 3RYTA 1R7SA 1BMLC 2J4XA 3VHTC 4FJVB 2BW2A 2WDTB 1CJEA 2O2VB 2KANA 1M4VA 4KGTA 1V1OA 3DPDA 5HKHA 4MEMA 2L76A 3A1QA 1V2YA 3B0AA 4JWUC 1J7BA 2INCC 4MJSA 1PGAA 4S0RA 1YN3A 3VXWA 2PEAA 3FILB 3ML8A 3V61A 4A8XC 3TUOA 1WGHA 1I4PA 1VRAB 2OEDA 2MQJA 1MHXA 4RMAA 2KK8A 4BAXA 4BKSD 2M0AA 3PHXB 3DHIC 1ACCA 1UWMA 2MBHA 2WX0A 3SHQA 1YNTE 2O6VB 2JQRB 3B1LX 2RDHA 1IPGA 4I6LB 2KACA 2PMVA 2M1MA 1FNVA 2C60A 4BOSC 3UQAA 3WAMA 1VDVA 1SE3A 4WJPA 2LGSA 4TUUA 3U2SC 2MW5A 1V81A 1E8XA 4L2YA 1GG3A 3P1MA 1IP9A 1Q1OA 1DGJA 2IYDB 4E74A 1R4MI 1NVID 2KDIA 2EKIA 3AE5B 3ZYYX 4LNKA 4CYEA 2AX5A 4KKJA 1E5WA 3I63C 1ZXHA 4DXAB 4YTMB 2I1KA 4NAWA 4LDTB 4C4VA 3UQBA 4ZHPA 3QIJA 3MP9A 5FK9C 4TQ0A 1NENB 3AU4A 3ZNID 1Z2MA 3DBRI 2JYTA 1DOXA 2LJ5A 4R3DA 3A4RA 3NS8A 5D7GA 4F1SA 2M0XA 4EFOA 1L4ZB 4W9GA 5IAAC 1N63A 1FFUA 4GLSC 1GUAB 4EZKA 2RR9A 3QC8B 1B9RA 4LTUA 3FAHA 4G0NB 2O2VA 2WXIA 3LJ3A 1N6ZA 3AN1A 1TY0A 3MJ5A 1UELA 3OJ3A 5DCNA 4OVZA 1SGHA 1WXSA 2WXMA 2V1YA 3FILA 1L0YB 1OEYJ 2DAJA 1WH3A 1SE9A 3KW5B 1WZ3A 3J9CA 1DOYA 2FCQA 4HROA 3RZWC 1I4QA 2CU1A 1OTRB 2DYBA 1A70A 4S17A 3HHMA 2LZ6A 1SJED 3RNGC 3I3TB 2V9HA 2K3UA 3H7PA 2LGIA 1SE4A 1WJUA 2M8SA 2KHWB 3A9JB 1Y8RC 1WWTA 3Q3NC 3PRMB 3DBHB 4MSMB 5AEKB 5CTRC 5DPSA 4J3OD 3QA8A 4P16A 2VZKD 1WM3A 2KDEB 2KC1A 2L05A 4A3PA 4KKIA 2L3ZA 1NI3A 3W5VB 2ASQA 1D3ZA 5LLIA 3ZUNA 1XCTL 2GMIC 1QOAA 3W2DA 4MM3B 3M63B 2LGDA 3APFA 2WXQA 2WYQA 3GE8C 5BYSA 2KWCA 2BWFA 3Q3OC 2HD5B 3KH0A 1TS3A 3SU8X 1OQRA 2KWVB 3EA6A 1ZUD2 3VRAB 1GOZA 2J0MA 1ZW7A 2MCNB 4JL9A 2N9PC 4AOFA 1V8CA 2EMSA 4B0EA 3M95A 5AUKA 3H8HA 2H89B 3BK2A 4PS8A 3LDZE 1GJZA 3Q69A 3NG0A 3K9OB 3KYCD 3M62B 1QT9A 1I4GA 1TTNA 4ASWC 3WAOA 4TSSA 3TJPA 3NS1A 4IWQA 1E9MA 4KX6B 3DBLB 3KUZA 1XT9B 4IDIA 3UINB 1HZ5A 5EE3A 4WJNA 4KZCA 2LASA 2N1VA 4FHJA 4NY0A 3NJTA 1VJKA 1GPXA 4W9FA 2KFJA 4WJOA 1JWSD 4WAFA 2KDBA 2ZCBA 4W9IA 3RUIB 4HDQA 2GLSA 2NTSA 1D5MC 3N30A 2IGDA 4XWTA 2NCNA 2GBNA 5C2TB 2NPTA 4BBNF 3A4SC 1XQQA 2W82A 2LEKA 3RD2A 2KFKB 1JW9D 3A9JA 1XCQL 4ANWA 5C3JB 2Y5CA 3H1UA 1TZOA 4DWFA 1RYJA 1S1QB 4IWOA 4B6WA 3BIID 4GOCA 1WYGA 2K25A 1IUEA 1N5WA 2N9LA 4K81A 3RPFC 1ZP0B 2DZIA 3R3MA 4RH6A
chains in the Genus database with same CATH topology
5BMIA 2KMMA 1BUIC 5FR3A 2WNMA 2VZKB 3BK1A 4DQOC 1XLNA 4XDDA 1FEHA 1ZDXA 3U52E 1TKGA 2H88B 1FMAD 2BB6A 2BT6A 2PVOD 4HEA1 1PYWD 2AQ1B 2G9HD 3NVYA 3SEBA 5AUIA 1HA5A 3HVZA 1D5ZC 1L5PA 2KDMA 2IDYA 3AE8B 3FC4A 2X38A 3LB8C 2SAKA 3BYTB 2WQYB 4YXDB 1QOGA 1JRPA 4KGRA 3NVZA 3NZ3A 1K50A 1E10A 1JALA 2WXGA 1NEKB 1SEBD 1XEEA 2L32A 1Q10A 4HKZE 1B1ZA 2QMTA 2W55A 1YJIA 3NUHB 1KH0A 3VR9B 1WSPA 1FNWA 1YQ4B 5BYQA 1N61A 3P4RB 3B2GA 1NYQA 3P4SB 1FRDA 1D6EC 1TYGB 2ZW1A 1JWBD 5D3DA 4OZBA 3GS2A 1XLOA 4UDUC 2JSVX 2LMCA 3ZJTA 4WQMA 5G5GA 1C9FA 4N59A 3AE9B 4TMAB 1BXTA 2DYMA 4C7ZA 1ZXIA 3PZ8A 4ZRPA 3TEWA 4ARCA 1GB1A 2V0GA 1YJJA 2XNAC 3BYYB 4A9AA 2MJ3A 3R2TA 1L6UA 1SXTA 4D2KA 1OFFA 1SIJA 1XO3A 1ENFA 4DXFA 1AN8A 1FD6A 1MI0A 1P7FA 1N5XA 1WRIA 4RFBA 4LK0M 1DOIA 2JXTA 3U7ZA 2N9KA 1I4XA 3IT6B 1UNSA 2BS3B 1JWUD 4B0MA 2I38A 3KLSX 1L4DB 2FE8A 3EGRA 4US8A 4NAMA 1MHHE 4YSXB 4YWGG 2JX5A 3AV8A 4NZLB 1AWDA 3AEBB 4C7YA 4CQNA 3ZQ4A 5EE0A 1IBXA 4NAWB 1FFVA 2WDQB 4HRSA 2J52A 1C79A 1F77A 3AEGB 2PLPA 2PW9A 1FRRA 3P4PB 1ZDVA 2NTTA 2PIAA 3V05A 3AEAB 1T5XD 3E9SA 3KWVA 4ZOHC 1C4PA 2WXHA 2K22A 2M19A 2W3SA 1TS2A 3VQIA 3AEDB 2I2YA 1XF5L 2ON8A 3SR6A 4HJGE 3TSSA 3AE2B 3LXFA 1EWYC 2HDEA 4OW0A 1L6VA 1IBXB 4N58A 3B2FA 4Q2JA 2WXKA 3N9YC 1YMHE 2GB1A 2Z8LA 4US9A 2CU3A 5HHDG 2TSSA 4OZAA 4JWSC 1ZPSA 1C78A 2Y3AA 3KQ4A 2RPVA 3PZ7A 1KF6B 1OQQA 2WXNA 2PVGC 2L52A 4L1BA 5MPOA 2MJDA 2ZW0A 4HKQA 1K51A 1PDXA 3AE6B 3DWGC 1QOBA 1R7SA 1BMLC 5FKAC 2J4XA 3Q8CA 1YN4A 4MACA 4A55A 3B9JA 2BW2A 3AE3B 1CJEA 1TS4A 2PTLA 1KFYB 1M4VA 2WXOA 4KGTA 1V1OA 1VZ8A 1SE2A 4DXGA 4RGNA 4WURA 3ZJUA 3NVVA 1HEZE 1KTKA 1N60A 2K0PA 1IGCA 3MC0B 4A6QA 4JWUC 1J7BA 1PGAA 4YT0B 4C56C 1YN3A 2MH7A 1SSNA 2KQ4X 2NMQA 4RGOS 3FILB 3IAS1 1TKYA 4A8XC 1MVKA 4OZCA 3TUOA 4A90A 1Y56A 1I4PA 1L0VB 4N6EB 1TJEA 1VRAB 5JXVA 1FXAA 2OEDA 2N0SB 1MHXA 1VZ6A 2WDVB 2QIEB 3TEXA 2M0AA 2KAJA 1ACCA 3BZDB 1UWMA 2ACZB 1QILA 3Q8AA 2HTME 1YNTE 2JQRB 3GB1A 3MFGA 1D5XC 2RDHA 1L0XB 2KACA 2ONQA 2PMVA 3ETRA 3IT4B 1CQVA 1FNVA 3WCQA 4FXCA 3T3NA 1VDVA 1WGKA 1SE3A 3HVDA 4JX1C 3ZGZA 3U2SC 5H8YE 1WXQA 2G1EA 4RF1A 4L2YA 3P1MA 5LNK1 1DGJA 4REZA 2GRIA 4YSZB 2WLBA 2B76B 4ITKA 2LHDA 1QKZA 2PKOA 3EUB2 2M56B 5BYRA 4ZYSA 2DWQA 2BTEA 1UGJA 5GXGB 2IPKD 2W54A 4GDLB 1NVID 4YTNB 1C76A 2EKIA 3AE5B 1RFKA 3L4PA 2E6XA 2RMMA 2V3NA 3R2IA 3ZYYX 4ZRQA 1XLPA 1EU4A 2AX5A 1VLBA 4KKJA 3VR8B 1ZXHA 4YTMB 1J7CA 5T8IA 1SF0A 1DYQA 2V3PA 1PUTA 3MHZA 1EM7A 4JE3B 4AS1A 4ZHPA 2GI9A 4O1NA 3MP9A 3AE1B 5FK9C 4GDKB 4TQ0A 4ZHOA 1NENB 5H92C 2JYTA 1DOXA 2MJEA 1E0ZA 1C77A 3BVGA 2J53A 4R3DA 3BVZA 2JZPA 2WXLA 3C8YA 5D7GA 2ICIA 1L4ZB 1JWMD 1P7EA 2DLBA 1N63A 2BBCA 1FFUA 1JROA 1T6BX 4GLSC 2CJOA 3W1SA 2YEPB 1YN5A 1SB3C 3P4QB 4MH8A 2WXFA 1ET6A 1B9RA 4LTUA 4XE0A 2L83A 1VR9A 2XN9C 3FAHA 1PGXA 2K9XA 1HQRD 2WXIA 3AN1A 4H2AA 4WWMA 3T3OA 1TY0A 2WDRB 1XLQA 3MJ5A 3NVWA 2W3RA 3IXSA 2Y5PA 1CK1A 4AQ7A 1UWXA 1LO5D 1F0ZA 4OVZA 3W9CB 4RGMA 2Q5WD 2WXMA 2AQ2B 2SEBD 3FILA 1L0YB 1KLGD 3ABVB 1TS5A 3AEFB 4USAA 1ET9A 1UUPA 2WXRA 3J9CA 1DOYA 3TEYA 1FM0D 4HROA 1I4QA 3AB5A 1IGDA 1FNUA 1PFDA 5D3IB 5G5HA 3AE7B 1N62A 1A70A 1QLBB 1KRHA 1SJED 3HUIA 2LFIA 1XXGA 3ZJVA 2K3UA 1F2RI 2LGIA 1SE4A 2E3TA 2BS4B 1F2RC 1KLUD 5TSSA 2CJNA 2IJ0A 3NRZA 3Q8BA 2AQ3B 4RNAA 1WWTA 2QEJC 2QSDA 1V1PB 2FUG1 1HZ6A 3IAM1 3URYA 3OWEB 3W5UB 3SFDB 5BMHA 4J3OD 1K53A 4NJCA 4P16A 2VZKD 1ZE3D 2L1AA 2V4IB 4KKIA 2WXPA 1NI3A 3KWLA 3W5VB 5EE1A 3VRBB 2JYEA 4WH4A 5I4DA 1XCTL 4MT5A 2MEKA 1QOAA 3W2DA 4MM3B 3CWIA 4JPSA 4TQ1A 3I57A 1RWSA 2QJLA 3E56A 2OHFA 1ROEA 2WXQA 3AEEB 4PT5A 2BB5A 3AE4B 1SBBB 5BYSA 1QQRA 1AYFA 4IOIE 1FCLA 4XDCA 3TEZA 2D5GA 2WU5B 1FXIA 2N7JA 1J7AA 3P42A 1TS3A 4EE2A 1OQRA 3P63A 3EA6A 1AW7A 1ZUD2 3VRAB 1STEA 1JMLA 4RF0A 1GAQB 1GOZA 2J42A 2WP9B 3U4EG 5HG2A 1NYRA 1GB4A 1V8CA 5EE9A 1K52A 1CZPA 5BMGA 4B0EA 4L23A 5AUKA 1QOFA 3H8HA 2H89B 2IGHA 1I7HA 3BK2A 4RCOA 4OHJA 1E6EB 1SJHD 2IGGA 1C4AA 3Q69A 3BWUD 3LYYA 2FBWB 1E7PB 1FCCC 3SFEB 1RM6C 1QT9A 1JCKB 1I4GA 3GP7A 1FO4A 4C80A 1C4CA 1ESFA 3CIRB 3NS1A 1E9MA 4TSSA 2INNE 1JWAD 4KX6B 3Q8FA 2WU2B 2BYTA 4IDIA 1TKEA 2YEPF 1EU3A 4IKGA 2DBYA 1HZ5A 1PGBA 1YQ3B 5EE3A 3UI3A 3AMZA 1I4RA 3I9V1 2KN4A 1VJKA 3AH7A 5E6JA 2LHEA 1GPXA 1QF6A 3AM9A 4LLGM 4WIPA 5HI1A 1JWSD 4WAFA 1HXYD 2EELA 4M0WA 1MPEA 2NTSA 1D5MC 3DWMA 2WXJA 2IGDA 4XWTA 5C2TB 1EWCA 1FIQA 1T3QA 3AECB 2KWDA 3V3XA 2LUMA 4YSYB 2W82A 4RGTA 2LEKA 2LJIA 2BS2B 1D4BA 2WS3B 1ZOYB 1JW9D 4P6VF 1V1PA 3HRDD 2RDGA 1XCQL 3R8BA 3Q8EA 5C3JB 1JQ4A 2JU6X 2Y5CA 1TZOA 2JWUA 3RFZB 2QILA 4XWWA 1RYJA 3BIID 1WYGA 4YTPB 2K5PA 4ARIA 1TY2A 1IUEA 1I4HA 1N5WA 1VZ7A 2N9LA 5HFYA 3RPFC 3PO0A 1ZP0B 2R61A 1V97A 2DYOA 3BVMA 4RH6A 4KGSA 3O13A 2INPE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE2 B;  3LXF A;  1EWY C;  2KMM A;  1NEN B;  3AE4 B;  1L6V A;  5H92 C;  4ZHO A;  4N58 A;  3B2F A;  1AYF A;  1DOX A;  1E0Z A;  2MJE A;  1XLN A;  4US9 A;  2CU3 A;  2WU5 B;  1FXI A;  1J7A A;  4JWS C;  1TKG A;  2H88 B;  1FMA D;  1OQR A;  3P63 A;  1KF6 B;  1OQQ A;  2PVG C;  2L52 A;  1ZUD 2;  2BT6 A;  3VRA B;  2PVO D;  1GAQ B;  2WP9 B;  5MPO A;  1N63 A;  2MJD A;  1FFU A;  1JRO A;  1NYR A;  3NVY A;  1V8C A;  1PDX A;  3AE6 B;  3DWG C;  3HVZ A;  1L5P A;  1QOB A;  1CZP A;  1R7S A;  2CJO A;  3AE8 B;  3FC4 A;  5EE9 A;  3LB8 C;  1SB3 C;  3P4Q B;  2WQY B;  3B9J A;  3AE3 B;  1CJE A;  5AUK A;  1QOG A;  1JRP A;  1QOF A;  4YXD B;  2H89 B;  3NVZ A;  1I7H A;  1KFY B;  1E10 A;  1JAL A;  1E6E B;  4LTU A;  1B9R A;  1NEK B;  2L83 A;  3FAH A;  2FBW B;  1E7P B;  2W55 A;  3NVV A;  5AUI A;  1YJI A;  3SFE B;  1N60 A;  1RM6 C;  2K9X A;  3VR9 B;  1QT9 A;  1YQ4 B;  3AN1 A;  4WWM A;  4JWU C;  1J7B A;  1N61 A;  3P4R B;  3B2G A;  1NYQ A;  3P4S B;  1FRD A;  1FO4 A;  4YT0 B;  1TYG B;  2MH7 A;  1JWB D;  4C80 A;  2WDR B;  1XLQ A;  3CIR B;  3NS1 A;  1E9M A;  3NVW A;  1XLO A;  1TKY A;  2W3R A;  1JWA D;  4KX6 B;  2WU2 B;  4WQM A;  5G5G A;  1F0Z A;  4N59 A;  1L0V B;  4IDI A;  1TKE A;  1TJE A;  3AE9 B;  4N6E B;  3W9C B;  2Q5W D;  1JQ4 A;  2DBY A;  1FXA A;  4C7Z A;  1YQ3 B;  2N0S B;  3ABV B;  3AEF B;  1ZXI A;  5EE3 A;  3AMZ A;  2WDV B;  4USA A;  2QIE B;  2KAJ A;  1VJK A;  1YJJ A;  3AH7 A;  1UWM A;  2ACZ B;  1DOY A;  4A9A A;  1QF6 A;  1GPX A;  3AM9 A;  2MJ3 A;  1FM0 D;  2HTM E;  4HRO A;  1L6U A;  3AB5 A;  2JQR B;  1OFF A;  1PFD A;  1SIJ A;  1XO3 A;  3AE7 B;  5G5H A;  1N62 A;  1A70 A;  1QLB B;  3ETR A;  1KRH A;  3WCQ A;  1N5X A;  3HUI A;  1WRI A;  4FXC A;  1DOI A;  3DWM A;  1VDV A;  1WGK A;  2E3T A;  5C2T B;  4JX1 C;  2BS4 B;  1FIQ A;  1T3Q A;  2BS3 B;  2CJN A;  3AEC B;  5H8Y E;  3NRZ A;  1WXQ A;  1WWT A;  2G1E A;  4YSY B;  3P1M A;  2LEK A;  1DGJ A;  2BS2 B;  4YSZ B;  2WLB A;  4US8 A;  2B76 B;  4ITK A;  4YSX B;  2WS3 B;  1ZOY B;  3W5U B;  1JW9 D;  2JX5 A;  3AV8 A;  3SFD B;  1AWD A;  3AEB B;  2PKO A;  3EUB 2;  4C7Y A;  2M56 B;  4P6V F;  2DWQ A;  3HRD D;  1NI3 A;  3KWL A;  5GXG B;  3W5V B;  2W54 A;  5C3J B;  1NVI D;  5EE1 A;  5EE0 A;  3VRB B;  1FFV A;  2WDQ B;  4HRS A;  3L4P A;  2EKI A;  3AE5 B;  1RFK A;  2Y5C A;  4YTN B;  3AEG B;  3ZYY X;  1RYJ A;  1FRR A;  3P4P B;  1XLP A;  3BII D;  2AX5 A;  1VLB A;  1WYG A;  2PIA A;  4YTP B;  3VR8 B;  4YTM B;  1J7C A;  1QOA A;  2K5P A;  3AEA B;  3CWI A;  1SF0 A;  4ZOH C;  1IUE A;  1N5W A;  1PUT A;  1RWS A;  3PO0 A;  3RPF C;  1ZP0 B;  2QJL A;  2K22 A;  2M19 A;  2W3S A;  1V97 A;  2OHF A;  1ROE A;  3AED B;  3SR6 A;  4ZHP A;  3AEE B;  3AE1 B; 
#chains in the Genus database with same CATH topology
 4HVB A;  4MM3 A;  1BUI C;  2WNM A;  3MTN B;  1MFW A;  3ZDT A;  3U52 E;  4KVG B;  2BB6 A;  4W9J A;  1C1Y B;  3DHH C;  3DVG Y;  4NPN A;  2BKF A;  3PT2 B;  2AQ1 B;  5LXH A;  3NVY A;  5AUI A;  2MA9 B;  2KDM A;  2IDY A;  3GZN B;  2N7E A;  1JRP A;  2ZCC A;  3PPA A;  2Z0E B;  1E10 A;  2PE9 A;  1SEB D;  3S2A A;  3OAW A;  2ZPN A;  2W55 A;  4M8M A;  3VR9 B;  1WSP A;  4AUQ C;  3ZRC A;  3H9D A;  2MRP A;  1V49 A;  3IVF A;  4LNF A;  1MJD A;  1C9F A;  4IM2 A;  2DYM A;  3T8M A;  4ZRP A;  2V0G A;  2XNA C;  3BYY B;  3PRE A;  2MJ3 A;  3R7Q A;  2DZJ A;  2ZVN A;  4ACF A;  1EF1 A;  3MC9 A;  1XO3 A;  2N9E B;  4MGZ E;  3WAP A;  3RNA C;  3VUY A;  2JXT A;  3IT6 B;  2I38 A;  2KNB A;  2FE8 A;  3IHP C;  2JX5 A;  2MX2 A;  2NBV B;  4C7Y A;  3HM3 A;  5EE0 A;  2KFK A;  2PLP A;  2PW9 A;  3P2B A;  1FRR A;  2LXA A;  2PIA A;  3AEA B;  3E9S A;  4ZOH C;  1C4P A;  1TS2 A;  2L0T A;  3QCA A;  3AE2 B;  3LXF A;  1EWY C;  1L7Y A;  4HCP B;  2JUO A;  4ZYN A;  4US9 A;  1TBE A;  5HHD G;  4JWS C;  5CHF A;  2KQ7 A;  4AJW A;  1KF6 B;  2PVG C;  4ANV A;  1UGM A;  3JW0 X;  5GMV A;  3RMK C;  5FKA C;  2EMT A;  4MAC A;  4A55 A;  1TS4 A;  1WGY A;  2LD9 A;  4MGY E;  3UIO B;  4HPM B;  1TIF A;  2L7R A;  3ZJU A;  2MBO A;  1HEZ E;  1KTK A;  2FNJ B;  2K8C A;  2RD0 A;  1YX6 B;  4LNN A;  2Z59 B;  2K0P A;  1IGC A;  4A6Q A;  5CHV C;  4C56 C;  2MH7 A;  1E7V A;  3NOB A;  2NMQ A;  1TKY A;  1MVK A;  4K7W A;  1RRB A;  1FXA A;  3A1Q B;  3TEX A;  1H4R A;  2KAJ A;  3QX1 A;  4MJS B;  3BZD B;  1T0Q C;  2ACZ B;  4HK2 A;  4LNI A;  3Q8A A;  2HTM E;  5CHW A;  3GB1 A;  3MFG A;  1L0X B;  2ONQ A;  3RI7 C;  2KJH B;  3HVD A;  4JX1 C;  3V6C B;  3ZGZ A;  3WAL A;  4PS7 A;  5DPR A;  4I6P A;  4HDO A;  1I42 A;  3N3K B;  2K8H A;  3PLU A;  5E6P A;  1R4M B;  2LHD A;  1QKZ A;  2YLM A;  3L0W B;  3U30 A;  3RNB C;  2J0J A;  5BYR A;  4ZYS A;  2DWQ A;  2BTE A;  4BKT A;  3DHG C;  1P0R A;  2IPK D;  4GDL B;  1C76 A;  3N1X C;  1RFK A;  2RMM A;  2MLB A;  1XLP A;  1EU4 A;  3Q3F A;  1VLB A;  2BPS A;  1J7C A;  5T8I A;  1U4A A;  1SF0 A;  1K8R B;  2D10 A;  2JZZ A;  4AS1 A;  1EM7 A;  4IM0 A;  4LJO B;  4O1N A;  4GDK B;  3DBR B;  4ZHO A;  3RNC C;  2MJE A;  2VH1 A;  1UH6 A;  3BVG A;  3L54 A;  3X23 A;  3GOE A;  4PK1 A;  4MSQ B;  2WXL A;  4W9E A;  2NVU I;  1JWM D;  1P7E A;  2DLB A;  5IN7 A;  1LFD A;  1JRO A;  1T6B X;  2YEP B;  1YN5 A;  1WR1 A;  4BOZ B;  4NJ6 A;  4DBG A;  1OEY A;  1MG8 A;  4XE0 A;  5IA7 A;  5EDS A;  1HQR D;  1WYW B;  1TT5 B;  4GU2 A;  4H2A A;  4WWM A;  4ICV A;  1UBQ A;  3C19 A;  4P7I A;  4DHJ D;  1XLQ A;  3NVW A;  2HTH A;  2JWZ A;  1UWX A;  1F0Z A;  4RGM A;  1V9J A;  2ZVO A;  4JIO U;  2Q5W D;  1E8W A;  1KLG D;  2QDF A;  3AEF B;  5KHO A;  3PRP B;  3AB5 A;  1IGD A;  2KDF B;  1PFD A;  3AE7 B;  1QLB B;  3Q14 C;  1L2N A;  2MHJ A;  3HUI A;  4MDK E;  1F52 A;  3ZJV A;  5JZE B;  1KLU D;  2CJN A;  3HIZ A;  4G50 A;  1V1P B;  4BZA A;  3VUW A;  3VUX A;  1HZ6 A;  3SFD B;  2C7M B;  2M4N A;  2J7Q B;  2V4I B;  4AJY B;  2JPH A;  3PLV A;  3H7P B;  5EE1 A;  3VRB B;  2C9W B;  2YVC A;  4EZJ A;  3ZVV A;  4GIV A;  4MT5 A;  2MEK A;  3JVZ X;  4GDL A;  3CWI A;  1P9D U;  2MSE D;  2RDB C;  2REX A;  3VAW A;  3PSE B;  2DEN B;  4IOI E;  3A9K B;  3TEZ A;  2N7J A;  1J7A A;  4W9H A;  2O6V D;  3ZKJ C;  4GDK A;  4GMV A;  4WWO A;  1AW7 A;  3IBE A;  1JML A;  3U4E G;  5HG2 A;  1NYR A;  4HJK A;  1K52 A;  5BMG A;  5J2R A;  2V3S A;  2KOX A;  1EF5 A;  2IY0 B;  1I7H A;  4EOY A;  4RCO A;  2JVC A;  1SJH D;  5G55 A;  3Q6B A;  4NQL B;  2HJ1 A;  2FBW B;  1E7P B;  4F8C B;  2WWZ A;  1RM6 C;  2C7N B;  3RNE C;  3OLM D;  2JXX A;  1FO4 A;  4C80 A;  2NR2 A;  1C4C A;  1ESF A;  2INN E;  1JWA D;  3N20 C;  2BYT A;  4FLH A;  2XEW A;  2DBY A;  2Y5B B;  3Q3J A;  3DQV A;  1YQ3 B;  3UI3 A;  2GBR A;  2DZK A;  2NBU A;  3AH7 A;  2ZNV B;  2FID A;  2EEL A;  2GBJ A;  2OOB B;  2ZNV C;  2D11 A;  2WXJ A;  3DWM A;  1FXT B;  5CX3 A;  3PTF C;  2UWQ A;  1FIQ A;  1T3Q A;  1C3T A;  3NZS A;  2N7D A;  2KWD A;  1TZ1 A;  1J0G A;  3TCA A;  2BS2 B;  4WAA A;  1ZOY B;  4NNJ B;  3C0R B;  3L17 A;  4P6V F;  1V1P A;  2JRH A;  3HRD D;  2RDG A;  3R8B A;  5AZF A;  1M94 A;  2GBK A;  1YQB A;  1UD7 A;  2NPT B;  4FJY A;  4J6I A;  4YTP B;  2K5P A;  2K8B A;  1TY2 A;  2R61 A;  3AI5 A;  4K3B A;  5D94 A;  5FR3 A;  4FHK A;  5AZG A;  4IWP A;  2VZK B;  3BK1 A;  3ZTC A;  2FCS A;  3A9K A;  1E7U A;  4WJQ A;  1V5O A;  4IG7 B;  3VH4 B;  1HA5 A;  3AE8 B;  3B08 A;  2SAK A;  2WQY B;  4RM9 A;  4YXD B;  3L08 A;  3QHT A;  2IO1 B;  1K50 A;  2D3A A;  2WXG A;  4OVV A;  1B1Z A;  4IUM B;  1KH0 A;  1FNW A;  1N61 A;  3B2G A;  3P4S B;  1D6E C;  2ZW1 A;  2FCM A;  3QK0 A;  1XLO A;  2JSV X;  4WQM A;  3M3J A;  4N59 A;  1Z5S B;  3AE9 B;  1BXT A;  4XC2 A;  3TMP B;  4FA6 A;  4C7Z A;  2ZJD A;  2IO3 B;  1ZXI A;  3PZ8 A;  1WE6 A;  1YJJ A;  3AUL A;  1HE8 A;  2UYZ B;  3R2T A;  3Q2A C;  3UF8 A;  1SIJ A;  4DXF A;  1AN8 A;  2IBI B;  2J0K A;  3APD A;  2QHO A;  1WRI A;  4RFB A;  1DOI A;  2G3Q B;  1WX7 A;  3DVN V;  3U7Z A;  2N9K A;  1UNS A;  2BS3 B;  2N1W A;  2BYF A;  3RNF C;  1OGW A;  5IO9 A;  2IO2 B;  3KLS X;  3RN9 C;  4W9D A;  3AV8 A;  4FAD A;  3RZF A;  1WFY A;  4CQN A;  4II2 B;  1IBX A;  2WDQ B;  4QAY A;  1ZDV A;  2NTT A;  3V05 A;  2XK5 B;  3DDC B;  3V62 A;  2W3S A;  3H7S A;  2ON8 A;  3SR6 A;  4DHZ E;  4K1R B;  2HDE A;  2KYW A;  4M00 A;  4XYC A;  2WXK A;  4EKU A;  2TSS A;  3TIX A;  2RPV A;  2BVC A;  3W1S C;  5MPO A;  4EZL A;  3AE6 B;  3DWG C;  3Q8C A;  1YN4 A;  3B9J A;  3AE3 B;  3BIN A;  4W9L A;  2PTL A;  1GC6 A;  1EO6 A;  1VZ8 A;  4DXG A;  4WUR A;  1WZ0 A;  3NVV A;  1N60 A;  2IND C;  2QCZ A;  2KQ4 X;  4RGO S;  4HPP A;  4BFR A;  1L0V B;  5J18 A;  5JXV A;  1ZKH A;  5D6J B;  1VZ6 A;  2WDV B;  3RCZ A;  2QIE B;  3Q3M C;  3V6E B;  3ETR A;  3IT4 B;  4FXC A;  2KKC A;  1YD8 U;  1RFA A;  3T3N A;  1WGK A;  2NBW B;  1WXQ A;  3AU5 A;  4LJP B;  1WMH A;  2G1E A;  4RF1 A;  5LNK 1;  5TR5 A;  2WLB A;  4ITK A;  2N9X A;  5FR6 A;  4XGA B;  2PKO A;  3EUB 2;  2M56 B;  1UBI A;  5BO4 B;  4BKG A;  3L16 A;  1VCB A;  5E6O A;  3L4P A;  2E6X A;  4ZRQ A;  1WGR A;  3VR8 B;  1NBF C;  1DYQ A;  4JQW C;  1PUT A;  4JE3 B;  2HE7 A;  1RAX A;  3AE1 B;  5IP4 D;  2XK5 A;  1IYF A;  4W9K A;  4ZRI A;  2GOW A;  2JZ3 B;  2JZP A;  5C23 A;  5J17 A;  3C8Y A;  2BF8 B;  4G3X B;  3DOW A;  3MC8 A;  4II3 B;  2XBB C;  4RM8 A;  1Q5W B;  4YL8 A;  2CJO A;  3W1S A;  1A5R A;  3P4Q B;  4MH8 A;  2BQQ A;  2WXF A;  2VH2 A;  4AP4 C;  1WJN A;  1VR9 A;  1S3S G;  3QAQ A;  1PGX A;  3VH3 B;  2EKE C;  2CKH B;  2LRW A;  3DVG X;  4KSK C;  4ZRK A;  1UF0 A;  2WDR B;  3ZNZ B;  2K39 A;  2ZEQ A;  3HK0 A;  2D3B A;  5IKC M;  2AQ2 B;  2SEB D;  3ABV B;  4BBN C;  1E90 A;  4USA A;  1ET9 A;  4K3C A;  4MGI E;  2WXR A;  4M0W B;  4DHZ B;  1GC7 A;  1X1M A;  3TEY A;  1FM0 D;  1WGG A;  4N9F 4;  1LM8 B;  4P1C C;  1NI2 A;  1KRH A;  3JSV B;  1XXG A;  1F1H A;  3I5J C;  1F2R I;  2BS4 B;  5TSS A;  2OJW A;  3DBS A;  2NS5 A;  3NRZ A;  2QSD A;  4M02 A;  3URY A;  1HTQ A;  1TGZ B;  3ECI A;  3OWE B;  3W5U B;  4GB9 A;  1K53 A;  2D3C A;  2FIF A;  1WXV A;  1ZE3 D;  2WXP A;  4DDI D;  3WAN A;  2LGX A;  2C7H A;  4DK5 A;  3VTW A;  4WH4 A;  4GGQ A;  1YJ1 A;  3CMM B;  3UGB B;  4K7U A;  2FUH B;  2PE6 B;  2QJL A;  2OHF A;  4HPL B;  1HTO A;  3CF6 E;  1SBB B;  1FCL A;  4XDC A;  2KC2 A;  4NJ7 A;  2D5G A;  1G6J A;  2LUE A;  2WU5 B;  3P42 A;  3P63 A;  2D2Q A;  1STE A;  4RF0 A;  1GAQ B;  2J42 A;  2WP9 B;  1CZP A;  1V5T A;  1WR6 E;  4L23 A;  3H6N A;  3QJZ A;  2ZPY A;  2IGH A;  4OHJ A;  2IGG A;  3DCG A;  3EFC A;  4FJZ A;  3L13 A;  2X8X X;  3L10 B;  1JCK B;  1WJ6 A;  2KMA A;  3KUC B;  2JT4 B;  1P1A A;  3Q8F A;  2WU2 B;  3T9L A;  1TKE A;  1EU3 A;  3W1Y A;  1PGB A;  4A20 A;  3ENE A;  3RUL A;  3X0W A;  3I9V 1;  4XZ4 A;  5AZH A;  2LHE A;  3AM9 A;  1Q0W B;  3QAR A;  4WIP A;  4WWP A;  1HXY D;  1RLF A;  1QZE A;  4M0W A;  1MPE A;  2R2O A;  2KMC A;  4TKN A;  3PGE A;  1EWC A;  3IG3 A;  2QC8 A;  3AEC B;  3JSV A;  3V3X A;  2JF5 A;  1OQY A;  4RGT A;  1D4B A;  2LVP A;  2WS3 B;  3R66 C;  1AAR A;  2OJR A;  4TV3 A;  1JQ4 A;  3TL5 A;  2JY6 A;  4XWW A;  3SD5 A;  3PV1 A;  4K7S A;  4PYU A;  3ZXR A;  3PVL A;  4ARI A;  1I4H A;  1VZ7 A;  2MP2 B;  5HFY A;  3PO0 A;  1KLV A;  3ONS A;  1V97 A;  3BVM A;  2PJH A;  4KGS A;  3ZIM A;  2INP E;  5BMI A;  2KMM A;  3ZO5 B;  2UU7 A;  2CHW A;  3KYD D;  4GN1 A;  1XLN A;  3PZD A;  1ZDX A;  1TKG A;  1FMA D;  2BT6 A;  4HEA 1;  1PYW D;  2IZV B;  2G9H D;  3SEB A;  4I6N B;  2L0F A;  3LB8 C;  1JRU A;  1WF9 A;  3QWZ B;  2M17 A;  4KGR A;  3NVZ A;  3NZ3 A;  2ZZP B;  4FUL A;  2AYO B;  5L95 C;  1NEK B;  1XEE A;  2L32 A;  4FBJ B;  4HKZ E;  2QMT A;  3PS6 A;  1YJI A;  3NUH B;  2VRR B;  4PYZ A;  1YQ4 B;  5IOI A;  3P4R B;  1NYQ A;  2DNF A;  1T0R C;  1TYG B;  5D3D A;  4OZB A;  3GS2 A;  3VTU A;  4E3C A;  4UDU C;  2LMC A;  3ZJT A;  5G5G A;  2RSU A;  4HCN B;  1T0S C;  3ZNH B;  3TEW A;  4ARC A;  3K9P B;  2KWU B;  1CMX B;  2W9N A;  1P3Q U;  1L6U A;  1SXT A;  4D2K A;  2MBQ A;  1ENF A;  1FD6 A;  1P7F A;  1N5X A;  3MHS D;  4IM3 A;  2B3A A;  4HXD A;  4KIK B;  4MGK E;  4LDT D;  3N32 A;  2I1J A;  3U8Z A;  4B0M A;  3ZNG C;  3EGR A;  4US8 A;  4NAM A;  1MHH E;  1XD3 B;  2RPQ A;  3A33 B;  3AEB B;  3OG5 A;  2PPH A;  1FFV A;  1C79 A;  3MJW A;  3VDZ A;  2HJ8 A;  2LVQ A;  1NDD A;  3KWV A;  2WXH A;  2M19 A;  3SDL C;  3VQI A;  4M01 A;  3AED B;  1R4N I;  1XF5 L;  2KZR A;  3TSS A;  5L83 A;  2WGS A;  4OW0 A;  1L6V A;  1IBX B;  4Q2J A;  2KXJ A;  2GB1 A;  2JRI B;  4F7Z A;  1WX8 A;  2MP2 A;  3FKY A;  2CU3 A;  1ZPS A;  3KQ4 A;  4BKS A;  4A3O A;  2D07 B;  2L52 A;  1YOV B;  3HM6 X;  2MJD A;  2ZW0 A;  4HKQ A;  1K51 A;  3D32 A;  3KVF B;  1QOB A;  4EEW A;  4KV2 A;  2LWP A;  2KJR A;  1KFY B;  2WXO A;  3JYU A;  1SE2 A;  4RGN A;  1ISN A;  2CHZ A;  3MC0 B;  2CR5 A;  2G4D B;  1YX5 B;  4YT0 B;  1SSN A;  2KO3 A;  3IAS 1;  4KZ0 A;  2O6V A;  3VVW B;  4OZC A;  1KM7 A;  4A90 A;  1Y56 A;  4N6E B;  1TJE A;  2GBM A;  2N0S B;  3DVN U;  2A4Z A;  2KTF A;  3O65 B;  5E6N A;  1QIL A;  3ZLZ A;  4DDG D;  4OVU A;  1D5X C;  2KT7 A;  2LGY A;  2KD0 A;  4G11 A;  1CQV A;  2BGF A;  3WCQ A;  1WIA A;  1WY8 A;  2CS4 A;  2WHI A;  5H8Y E;  2IY1 B;  2BYV E;  4YSZ B;  4REZ A;  2GRI A;  2RGF A;  4KIK A;  5G2N A;  4CHK A;  4ANX A;  2B76 B;  5JHB A;  1WXA A;  1UGJ A;  5GXG B;  2W54 A;  4JGH B;  4YTN B;  2V3N A;  5JH5 C;  3R2I A;  1WMH B;  2DZM A;  1WGD A;  2V4L A;  2V3P A;  3MHZ A;  2GI9 A;  2FCN A;  4C00 A;  1WI0 A;  5H92 C;  3ZRF A;  1E0Z A;  2L8J A;  1C77 A;  2J53 A;  3WIM A;  3BVZ A;  4EUT A;  4CO7 A;  2ICI A;  2BBC A;  4URK A;  4LCD E;  1SB3 C;  1ET6 A;  1FPY A;  5LXI B;  2L83 A;  3BY4 B;  3CSF A;  2KQS A;  2XN9 C;  3EHV A;  2K9X A;  2KX0 A;  4GXB A;  2Z0D B;  4B9K A;  1P98 A;  4B95 A;  3T3O A;  3ZDM C;  2D3G A;  1LGR A;  2A5U A;  2W3R A;  4PS3 A;  3IXS A;  2Y5P A;  1CK1 A;  4AQ7 A;  1LO5 D;  3W9C B;  2FAZ A;  3IFW B;  3ML9 A;  1YIW A;  1TS5 A;  1KJT A;  2KTR B;  1UUP A;  2LI5 A;  5D3I B;  1FNU A;  5G5H A;  1N62 A;  1SIF A;  2LFI A;  1I35 A;  4JLC A;  5DPT A;  1T0Y A;  2E3T A;  1F2R C;  4MH0 E;  2IJ0 A;  3Q8B A;  1E8Z A;  1UZX B;  2AQ3 B;  4RNA A;  2QEJ C;  2FUG 1;  3IAM 1;  3DBH I;  5BMH A;  4NJC A;  3CST A;  2L1A A;  3KWL A;  1ZGU B;  2JYE A;  5I4D A;  4JPS A;  1WXM A;  4TQ1 A;  2LVO A;  3I57 A;  1RWS A;  3E56 A;  4IC7 B;  1ROE A;  3AEE B;  4PT5 A;  2BB5 A;  3AE4 B;  3GE3 C;  1QQR A;  1AYF A;  1FXI A;  4EE2 A;  2BKR B;  3U7D A;  3ZXV A;  3ZW3 A;  1GB4 A;  4P1B C;  5EE9 A;  1LQB A;  1PQS A;  3EEC A;  3VFK A;  1QOF A;  4KDI C;  1E6E B;  1MG4 A;  1C4A A;  2BYE A;  2BWE S;  3BWU D;  3LYY A;  1FCC C;  3SFE B;  3NY5 A;  3GP7 A;  3CIR B;  3DBL I;  2IO0 B;  1V86 A;  2YEP F;  4WWN A;  4IKG A;  3V60 A;  3AXC A;  3AMZ A;  1I4R A;  2KN4 A;  3ALB A;  1J19 A;  5E6J A;  1QF6 A;  4LLG M;  5HI1 A;  3PRZ A;  2KTR A;  2G4S A;  3QQ8 B;  1LXD A;  2KJ6 A;  2DHZ A;  2KVR A;  2LUM A;  4YSY B;  2N4F A;  2LJI A;  2K1F A;  4X57 B;  2KN5 A;  3Q8E A;  3ZTD A;  2JU6 X;  2JWU A;  3RFZ B;  2QIL A;  5D2M B;  2AWT A;  4IW0 A;  4BVU C;  4HWI B;  3APC A;  3PHW B;  1F9J A;  1WX9 A;  2DYO A;  2G45 B;  3O13 A;  4NQK E;  4ANU A;  2K6Q A;  4DQO C;  4XDD A;  1FEH A;  2H88 B;  4ZDV A;  1WRD B;  2PVO D;  1GNU A;  4AWJ A;  3HVZ A;  1D5Z C;  1L5P A;  3UIP B;  3FC4 A;  4HLE A;  2X38 A;  2DAF A;  2WX1 A;  3BYT B;  3GZN I;  2MWS B;  1QOG A;  1JAL A;  4FN2 A;  1Q10 A;  4W9C A;  4XX5 A;  5KHQ A;  4WQO B;  5C1Z A;  5BYQ A;  3WA0 A;  3VTV A;  1H8C A;  3EFU A;  1FRD A;  3NHE B;  1JWB D;  1E8Y A;  2AL3 A;  2K6D B;  4TMA B;  1V80 A;  2DX5 B;  2KVZ A;  3EC8 A;  2AL6 A;  1GB1 A;  3N1Y C;  4LNO A;  4KSL C;  2R2Q A;  4A9A A;  4ICU A;  1OFF A;  5DPW A;  2KX3 A;  1MI0 A;  4LK0 M;  4ZRJ A;  3OJ4 B;  4MEL A;  1I4X A;  3TBL D;  3NZU A;  3N1Z C;  1JWU D;  4GSW A;  1L4D B;  2KLC A;  1V6E A;  2AEH A;  4YSX B;  4YWG G;  4NZL B;  1AWD A;  1EUV B;  2MBB B;  1J8C A;  3ZQ4 A;  4NAW B;  4HRS A;  2J52 A;  1VD2 A;  1F77 A;  4M8N A;  4C4V B;  3AEG B;  4DHJ B;  1WE7 A;  2LRU A;  3P4P B;  1BT0 A;  2C5L C;  1T5X D;  1R4N B;  4KDL B;  2K22 A;  2LXC A;  2KLG A;  2I2Y A;  1WJ4 A;  4HJG E;  5JHA A;  4E71 A;  4N58 A;  3B2F A;  3N9Y C;  1YMH E;  2Z8L A;  3R7R A;  3RT3 B;  1WM2 A;  2MBE A;  4OZA A;  1C78 A;  2Y3A A;  3PZ7 A;  2CHX A;  1OQQ A;  2WXN A;  4L1B A;  1KOT A;  3KUD B;  1PDX A;  2L00 B;  3RYT A;  1R7S A;  1BML C;  2J4X A;  3VHT C;  4FJV B;  2BW2 A;  2WDT B;  1CJE A;  2O2V B;  2KAN A;  1M4V A;  4KGT A;  1V1O A;  3DPD A;  5HKH A;  4MEM A;  2L76 A;  3A1Q A;  1V2Y A;  3B0A A;  4JWU C;  1J7B A;  2INC C;  4MJS A;  1PGA A;  4S0R A;  1YN3 A;  3VXW A;  2PEA A;  3FIL B;  3ML8 A;  3V61 A;  4A8X C;  3TUO A;  1WGH A;  1I4P A;  1VRA B;  2OED A;  2MQJ A;  1MHX A;  4RMA A;  2KK8 A;  4BAX A;  4BKS D;  2M0A A;  3PHX B;  3DHI C;  1ACC A;  1UWM A;  2MBH A;  2WX0 A;  3SHQ A;  1YNT E;  2O6V B;  2JQR B;  3B1L X;  2RDH A;  1IPG A;  4I6L B;  2KAC A;  2PMV A;  2M1M A;  1FNV A;  2C60 A;  4BOS C;  3UQA A;  3WAM A;  1VDV A;  1SE3 A;  4WJP A;  2LGS A;  4TUU A;  3U2S C;  2MW5 A;  1V81 A;  1E8X A;  4L2Y A;  1GG3 A;  3P1M A;  1IP9 A;  1Q1O A;  1DGJ A;  2IYD B;  4E74 A;  1R4M I;  1NVI D;  2KDI A;  2EKI A;  3AE5 B;  3ZYY X;  4LNK A;  4CYE A;  2AX5 A;  4KKJ A;  1E5W A;  3I63 C;  1ZXH A;  4DXA B;  4YTM B;  2I1K A;  4NAW A;  4LDT B;  4C4V A;  3UQB A;  4ZHP A;  3QIJ A;  3MP9 A;  5FK9 C;  4TQ0 A;  1NEN B;  3AU4 A;  3ZNI D;  1Z2M A;  3DBR I;  2JYT A;  1DOX A;  2LJ5 A;  4R3D A;  3A4R A;  3NS8 A;  5D7G A;  4F1S A;  2M0X A;  4EFO A;  1L4Z B;  4W9G A;  5IAA C;  1N63 A;  1FFU A;  4GLS C;  1GUA B;  4EZK A;  2RR9 A;  3QC8 B;  1B9R A;  4LTU A;  3FAH A;  4G0N B;  2O2V A;  2WXI A;  3LJ3 A;  1N6Z A;  3AN1 A;  1TY0 A;  3MJ5 A;  1UEL A;  3OJ3 A;  5DCN A;  4OVZ A;  1SGH A;  1WXS A;  2WXM A;  2V1Y A;  3FIL A;  1L0Y B;  1OEY J;  2DAJ A;  1WH3 A;  1SE9 A;  3KW5 B;  1WZ3 A;  3J9C A;  1DOY A;  2FCQ A;  4HRO A;  3RZW C;  1I4Q A;  2CU1 A;  1OTR B;  2DYB A;  1A70 A;  4S17 A;  3HHM A;  2LZ6 A;  1SJE D;  3RNG C;  3I3T B;  2V9H A;  2K3U A;  3H7P A;  2LGI A;  1SE4 A;  1WJU A;  2M8S A;  2KHW B;  3A9J B;  1Y8R C;  1WWT A;  3Q3N C;  3PRM B;  3DBH B;  4MSM B;  5AEK B;  5CTR C;  5DPS A;  4J3O D;  3QA8 A;  4P16 A;  2VZK D;  1WM3 A;  2KDE B;  2KC1 A;  2L05 A;  4A3P A;  4KKI A;  2L3Z A;  1NI3 A;  3W5V B;  2ASQ A;  1D3Z A;  5LLI A;  3ZUN A;  1XCT L;  2GMI C;  1QOA A;  3W2D A;  4MM3 B;  3M63 B;  2LGD A;  3APF A;  2WXQ A;  2WYQ A;  3GE8 C;  5BYS A;  2KWC A;  2BWF A;  3Q3O C;  2HD5 B;  3KH0 A;  1TS3 A;  3SU8 X;  1OQR A;  2KWV B;  3EA6 A;  1ZUD 2;  3VRA B;  1GOZ A;  2J0M A;  1ZW7 A;  2MCN B;  4JL9 A;  2N9P C;  4AOF A;  1V8C A;  2EMS A;  4B0E A;  3M95 A;  5AUK A;  3H8H A;  2H89 B;  3BK2 A;  4PS8 A;  3LDZ E;  1GJZ A;  3Q69 A;  3NG0 A;  3K9O B;  3KYC D;  3M62 B;  1QT9 A;  1I4G A;  1TTN A;  4ASW C;  3WAO A;  4TSS A;  3TJP A;  3NS1 A;  4IWQ A;  1E9M A;  4KX6 B;  3DBL B;  3KUZ A;  1XT9 B;  4IDI A;  3UIN B;  1HZ5 A;  5EE3 A;  4WJN A;  4KZC A;  2LAS A;  2N1V A;  4FHJ A;  4NY0 A;  3NJT A;  1VJK A;  1GPX A;  4W9F A;  2KFJ A;  4WJO A;  1JWS D;  4WAF A;  2KDB A;  2ZCB A;  4W9I A;  3RUI B;  4HDQ A;  2GLS A;  2NTS A;  1D5M C;  3N30 A;  2IGD A;  4XWT A;  2NCN A;  2GBN A;  5C2T B;  2NPT A;  4BBN F;  3A4S C;  1XQQ A;  2W82 A;  2LEK A;  3RD2 A;  2KFK B;  1JW9 D;  3A9J A;  1XCQ L;  4ANW A;  5C3J B;  2Y5C A;  3H1U A;  1TZO A;  4DWF A;  1RYJ A;  1S1Q B;  4IWO A;  4B6W A;  3BII D;  4GOC A;  1WYG A;  2K25 A;  1IUE A;  1N5W A;  2N9L A;  4K81 A;  3RPF C;  1ZP0 B;  2DZI A;  3R3M A;  4RH6 A; 
#chains in the Genus database with same CATH homology
 5BMI A;  2KMM A;  1BUI C;  5FR3 A;  2WNM A;  2VZK B;  3BK1 A;  4DQO C;  1XLN A;  4XDD A;  1FEH A;  1ZDX A;  3U52 E;  1TKG A;  2H88 B;  1FMA D;  2BB6 A;  2BT6 A;  2PVO D;  4HEA 1;  1PYW D;  2AQ1 B;  2G9H D;  3NVY A;  3SEB A;  5AUI A;  1HA5 A;  3HVZ A;  1D5Z C;  1L5P A;  2KDM A;  2IDY A;  3AE8 B;  3FC4 A;  2X38 A;  3LB8 C;  2SAK A;  3BYT B;  2WQY B;  4YXD B;  1QOG A;  1JRP A;  4KGR A;  3NVZ A;  3NZ3 A;  1K50 A;  1E10 A;  1JAL A;  2WXG A;  1NEK B;  1SEB D;  1XEE A;  2L32 A;  1Q10 A;  4HKZ E;  1B1Z A;  2QMT A;  2W55 A;  1YJI A;  3NUH B;  1KH0 A;  3VR9 B;  1WSP A;  1FNW A;  1YQ4 B;  5BYQ A;  1N61 A;  3P4R B;  3B2G A;  1NYQ A;  3P4S B;  1FRD A;  1D6E C;  1TYG B;  2ZW1 A;  1JWB D;  5D3D A;  4OZB A;  3GS2 A;  1XLO A;  4UDU C;  2JSV X;  2LMC A;  3ZJT A;  4WQM A;  5G5G A;  1C9F A;  4N59 A;  3AE9 B;  4TMA B;  1BXT A;  2DYM A;  4C7Z A;  1ZXI A;  3PZ8 A;  4ZRP A;  3TEW A;  4ARC A;  1GB1 A;  2V0G A;  1YJJ A;  2XNA C;  3BYY B;  4A9A A;  2MJ3 A;  3R2T A;  1L6U A;  1SXT A;  4D2K A;  1OFF A;  1SIJ A;  1XO3 A;  1ENF A;  4DXF A;  1AN8 A;  1FD6 A;  1MI0 A;  1P7F A;  1N5X A;  1WRI A;  4RFB A;  4LK0 M;  1DOI A;  2JXT A;  3U7Z A;  2N9K A;  1I4X A;  3IT6 B;  1UNS A;  2BS3 B;  1JWU D;  4B0M A;  2I38 A;  3KLS X;  1L4D B;  2FE8 A;  3EGR A;  4US8 A;  4NAM A;  1MHH E;  4YSX B;  4YWG G;  2JX5 A;  3AV8 A;  4NZL B;  1AWD A;  3AEB B;  4C7Y A;  4CQN A;  3ZQ4 A;  5EE0 A;  1IBX A;  4NAW B;  1FFV A;  2WDQ B;  4HRS A;  2J52 A;  1C79 A;  1F77 A;  3AEG B;  2PLP A;  2PW9 A;  1FRR A;  3P4P B;  1ZDV A;  2NTT A;  2PIA A;  3V05 A;  3AEA B;  1T5X D;  3E9S A;  3KWV A;  4ZOH C;  1C4P A;  2WXH A;  2K22 A;  2M19 A;  2W3S A;  1TS2 A;  3VQI A;  3AED B;  2I2Y A;  1XF5 L;  2ON8 A;  3SR6 A;  4HJG E;  3TSS A;  3AE2 B;  3LXF A;  1EWY C;  2HDE A;  4OW0 A;  1L6V A;  1IBX B;  4N58 A;  3B2F A;  4Q2J A;  2WXK A;  3N9Y C;  1YMH E;  2GB1 A;  2Z8L A;  4US9 A;  2CU3 A;  5HHD G;  2TSS A;  4OZA A;  4JWS C;  1ZPS A;  1C78 A;  2Y3A A;  3KQ4 A;  2RPV A;  3PZ7 A;  1KF6 B;  1OQQ A;  2WXN A;  2PVG C;  2L52 A;  4L1B A;  5MPO A;  2MJD A;  2ZW0 A;  4HKQ A;  1K51 A;  1PDX A;  3AE6 B;  3DWG C;  1QOB A;  1R7S A;  1BML C;  5FKA C;  2J4X A;  3Q8C A;  1YN4 A;  4MAC A;  4A55 A;  3B9J A;  2BW2 A;  3AE3 B;  1CJE A;  1TS4 A;  2PTL A;  1KFY B;  1M4V A;  2WXO A;  4KGT A;  1V1O A;  1VZ8 A;  1SE2 A;  4DXG A;  4RGN A;  4WUR A;  3ZJU A;  3NVV A;  1HEZ E;  1KTK A;  1N60 A;  2K0P A;  1IGC A;  3MC0 B;  4A6Q A;  4JWU C;  1J7B A;  1PGA A;  4YT0 B;  4C56 C;  1YN3 A;  2MH7 A;  1SSN A;  2KQ4 X;  2NMQ A;  4RGO S;  3FIL B;  3IAS 1;  1TKY A;  4A8X C;  1MVK A;  4OZC A;  3TUO A;  4A90 A;  1Y56 A;  1I4P A;  1L0V B;  4N6E B;  1TJE A;  1VRA B;  5JXV A;  1FXA A;  2OED A;  2N0S B;  1MHX A;  1VZ6 A;  2WDV B;  2QIE B;  3TEX A;  2M0A A;  2KAJ A;  1ACC A;  3BZD B;  1UWM A;  2ACZ B;  1QIL A;  3Q8A A;  2HTM E;  1YNT E;  2JQR B;  3GB1 A;  3MFG A;  1D5X C;  2RDH A;  1L0X B;  2KAC A;  2ONQ A;  2PMV A;  3ETR A;  3IT4 B;  1CQV A;  1FNV A;  3WCQ A;  4FXC A;  3T3N A;  1VDV A;  1WGK A;  1SE3 A;  3HVD A;  4JX1 C;  3ZGZ A;  3U2S C;  5H8Y E;  1WXQ A;  2G1E A;  4RF1 A;  4L2Y A;  3P1M A;  5LNK 1;  1DGJ A;  4REZ A;  2GRI A;  4YSZ B;  2WLB A;  2B76 B;  4ITK A;  2LHD A;  1QKZ A;  2PKO A;  3EUB 2;  2M56 B;  5BYR A;  4ZYS A;  2DWQ A;  2BTE A;  1UGJ A;  5GXG B;  2IPK D;  2W54 A;  4GDL B;  1NVI D;  4YTN B;  1C76 A;  2EKI A;  3AE5 B;  1RFK A;  3L4P A;  2E6X A;  2RMM A;  2V3N A;  3R2I A;  3ZYY X;  4ZRQ A;  1XLP A;  1EU4 A;  2AX5 A;  1VLB A;  4KKJ A;  3VR8 B;  1ZXH A;  4YTM B;  1J7C A;  5T8I A;  1SF0 A;  1DYQ A;  2V3P A;  1PUT A;  3MHZ A;  1EM7 A;  4JE3 B;  4AS1 A;  4ZHP A;  2GI9 A;  4O1N A;  3MP9 A;  3AE1 B;  5FK9 C;  4GDK B;  4TQ0 A;  4ZHO A;  1NEN B;  5H92 C;  2JYT A;  1DOX A;  2MJE A;  1E0Z A;  1C77 A;  3BVG A;  2J53 A;  4R3D A;  3BVZ A;  2JZP A;  2WXL A;  3C8Y A;  5D7G A;  2ICI A;  1L4Z B;  1JWM D;  1P7E A;  2DLB A;  1N63 A;  2BBC A;  1FFU A;  1JRO A;  1T6B X;  4GLS C;  2CJO A;  3W1S A;  2YEP B;  1YN5 A;  1SB3 C;  3P4Q B;  4MH8 A;  2WXF A;  1ET6 A;  1B9R A;  4LTU A;  4XE0 A;  2L83 A;  1VR9 A;  2XN9 C;  3FAH A;  1PGX A;  2K9X A;  1HQR D;  2WXI A;  3AN1 A;  4H2A A;  4WWM A;  3T3O A;  1TY0 A;  2WDR B;  1XLQ A;  3MJ5 A;  3NVW A;  2W3R A;  3IXS A;  2Y5P A;  1CK1 A;  4AQ7 A;  1UWX A;  1LO5 D;  1F0Z A;  4OVZ A;  3W9C B;  4RGM A;  2Q5W D;  2WXM A;  2AQ2 B;  2SEB D;  3FIL A;  1L0Y B;  1KLG D;  3ABV B;  1TS5 A;  3AEF B;  4USA A;  1ET9 A;  1UUP A;  2WXR A;  3J9C A;  1DOY A;  3TEY A;  1FM0 D;  4HRO A;  1I4Q A;  3AB5 A;  1IGD A;  1FNU A;  1PFD A;  5D3I B;  5G5H A;  3AE7 B;  1N62 A;  1A70 A;  1QLB B;  1KRH A;  1SJE D;  3HUI A;  2LFI A;  1XXG A;  3ZJV A;  2K3U A;  1F2R I;  2LGI A;  1SE4 A;  2E3T A;  2BS4 B;  1F2R C;  1KLU D;  5TSS A;  2CJN A;  2IJ0 A;  3NRZ A;  3Q8B A;  2AQ3 B;  4RNA A;  1WWT A;  2QEJ C;  2QSD A;  1V1P B;  2FUG 1;  1HZ6 A;  3IAM 1;  3URY A;  3OWE B;  3W5U B;  3SFD B;  5BMH A;  4J3O D;  1K53 A;  4NJC A;  4P16 A;  2VZK D;  1ZE3 D;  2L1A A;  2V4I B;  4KKI A;  2WXP A;  1NI3 A;  3KWL A;  3W5V B;  5EE1 A;  3VRB B;  2JYE A;  4WH4 A;  5I4D A;  1XCT L;  4MT5 A;  2MEK A;  1QOA A;  3W2D A;  4MM3 B;  3CWI A;  4JPS A;  4TQ1 A;  3I57 A;  1RWS A;  2QJL A;  3E56 A;  2OHF A;  1ROE A;  2WXQ A;  3AEE B;  4PT5 A;  2BB5 A;  3AE4 B;  1SBB B;  5BYS A;  1QQR A;  1AYF A;  4IOI E;  1FCL A;  4XDC A;  3TEZ A;  2D5G A;  2WU5 B;  1FXI A;  2N7J A;  1J7A A;  3P42 A;  1TS3 A;  4EE2 A;  1OQR A;  3P63 A;  3EA6 A;  1AW7 A;  1ZUD 2;  3VRA B;  1STE A;  1JML A;  4RF0 A;  1GAQ B;  1GOZ A;  2J42 A;  2WP9 B;  3U4E G;  5HG2 A;  1NYR A;  1GB4 A;  1V8C A;  5EE9 A;  1K52 A;  1CZP A;  5BMG A;  4B0E A;  4L23 A;  5AUK A;  1QOF A;  3H8H A;  2H89 B;  2IGH A;  1I7H A;  3BK2 A;  4RCO A;  4OHJ A;  1E6E B;  1SJH D;  2IGG A;  1C4A A;  3Q69 A;  3BWU D;  3LYY A;  2FBW B;  1E7P B;  1FCC C;  3SFE B;  1RM6 C;  1QT9 A;  1JCK B;  1I4G A;  3GP7 A;  1FO4 A;  4C80 A;  1C4C A;  1ESF A;  3CIR B;  3NS1 A;  1E9M A;  4TSS A;  2INN E;  1JWA D;  4KX6 B;  3Q8F A;  2WU2 B;  2BYT A;  4IDI A;  1TKE A;  2YEP F;  1EU3 A;  4IKG A;  2DBY A;  1HZ5 A;  1PGB A;  1YQ3 B;  5EE3 A;  3UI3 A;  3AMZ A;  1I4R A;  3I9V 1;  2KN4 A;  1VJK A;  3AH7 A;  5E6J A;  2LHE A;  1GPX A;  1QF6 A;  3AM9 A;  4LLG M;  4WIP A;  5HI1 A;  1JWS D;  4WAF A;  1HXY D;  2EEL A;  4M0W A;  1MPE A;  2NTS A;  1D5M C;  3DWM A;  2WXJ A;  2IGD A;  4XWT A;  5C2T B;  1EWC A;  1FIQ A;  1T3Q A;  3AEC B;  2KWD A;  3V3X A;  2LUM A;  4YSY B;  2W82 A;  4RGT A;  2LEK A;  2LJI A;  2BS2 B;  1D4B A;  2WS3 B;  1ZOY B;  1JW9 D;  4P6V F;  1V1P A;  3HRD D;  2RDG A;  1XCQ L;  3R8B A;  3Q8E A;  5C3J B;  1JQ4 A;  2JU6 X;  2Y5C A;  1TZO A;  2JWU A;  3RFZ B;  2QIL A;  4XWW A;  1RYJ A;  3BII D;  1WYG A;  4YTP B;  2K5P A;  4ARI A;  1TY2 A;  1IUE A;  1I4H A;  1N5W A;  1VZ7 A;  2N9L A;  5HFY A;  3RPF C;  3PO0 A;  1ZP0 B;  2R61 A;  1V97 A;  2DYO A;  3BVM A;  4RH6 A;  4KGS A;  3O13 A;  2INP E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...