1E0ZA

[2fe-2s]-ferredoxin from halobacterium salinarum
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
128
structure length
127
Chain Sequence
PTVEYLNYETLDDQGWDMDDDDLFEKAADAGLDGEDYGTMEVAEGEYILEAAEAQGYDWPFSCRAGACANCASIVKEGEIDMDMQQILSDEEVEEKDVRLTCIGSPAADEVKIVYNAHLDYLQNRVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Two-Alpha-Helix Extra Domain Mediates the Halophilic Character of a Plant-Type Ferredoxin from Halophilic Archaea.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords FERREDOXIN
total genus 20
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2000-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1e0zA00
2WDRB 3AE1B 3SFEB 2WLBA 4YTPB 1V8CA 3HVZA 3AN1A 3EUB2 3NVZA 4YTNB 1YQ3B 3AE8B 4P6VF 1QOAA 2DBYA 1WGKA 2KAJA 2W55A 1NEKB 1R7SA 1YJIA 2PKOA 4US9A 4C80A 1DOIA 3P4RB 2ACZB 1CJEA 3LXFA 4WWMA 1L6UA 2K22A 3AE5B 3AM9A 1QOGA 3AE3B 3AV8A 3P4QB 3SR6A 1JQ4A 1TKGA 1E6EB 1XLQA 3W5UB 1DOXA 2E3TA 1FO4A 1FRRA 1NI3A 1CZPA 1DGJA 1OQRA 4LTUA 2LEKA 3VRAB 2M19A 1N61A 4IDIA 2PVOD 1WXQA 1SF0A 4N59A 2PIAA 5EE0A 5C2TB 4YSYB 1ZUD2 1PUTA 4C7ZA 5AUIA 3AE9B 4YSZB 4YTMB 5EE3A 1IUEA 2W3SA 1T3QA 1SIJA 2WP9B 3ABVB 3AE6B 3B2FA 1XO3A 1NYQA 3CWIA 3AMZA 3ETRA 1VDVA 2MH7A 3SFDB 1J7AA 2PVGC 1JW9D 2BS4B 2WQYB 1UWMA 4YSXB 3B9JA 4ZOHC 3NRZA 1JALA 5G5GA 3AEAB 1WRIA 1A70A 1ROEA 1TKYA 2G1EA 2M56B 2OHFA 3B2GA 3W9CB 3PO0A 1RYJA 4WQMA 2AX5A 5H92C 1N63A 2B76B 2Y5CA 1QLBB 3P63A 1KFYB 2H88B 3BIID 1E10A 3KWLA 4KX6B 4US8A 3AEBB 3LB8C 1JWAD 3L4PA 3VR8B 1VJKA 1RM6C 2JX5A 3HUIA 3VRBB 3AECB 3NVYA 2W54A 3P4PB 2EKIA 1F0ZA 1FFUA 1FIQA 1WYGA 2MJDA 1TYGB 2L52A 2L83A 1NVID 3AH7A 2QJLA 1PDXA 4JWSC 2CJOA 1QOFA 1JROA 2KMMA 1QF6A 2HTME 3WCQA 1GPXA 3AB5A 1WWTA 4ITKA 2BS3B 1RWSA 1GAQB 1FRDA 4HRSA 1FXIA 1VLBA 2BT6A 1E9MA 1OFFA 1QOBA 4YXDB 4C7YA 1KRHA 2N0SB 4YT0B 3HRDD 3CIRB 1YQ4B 1L0VB 1SB3C 1PFDA 4JWUC 1JRPA 5H8YE 2BS2B 2CJNA 5G5HA 3AE4B 1XLNA 1I7HA 4A9AA 1AYFA 3VR9B 3RPFC 2WDQB 1JWBD 1FMAD 1ZOYB 5GXGB 1E0ZA 1N5WA 5C3JB 4N6EB 3ZYYX 1KF6B 1XLPA 3FC4A 4HROA 4JX1C 2K5PA 2WU2B 4FXCA 1B9RA 3W5VB 1L6VA 1J7CA 3FAHA 3P4SB 1L5PA 3AEFB 5EE9A 3AE7B 1N62A 3DWMA 2QIEB 4ZHOA 1RFKA 2H89B 1E7PB 3AE2B 3AEEB 1V97A 2K9XA 2WU5B 1NENB 3DWGC 2WS3B 4N58A 4USAA 1ZXIA 3AEDB 5EE1A 2CU3A 3NS1A 1DOYA 1TKEA 2DWQA 1TJEA 1FFVA 1N60A 1FM0D 1ZP0B 2JQRB 3NVVA 1FXAA 2WDVB 3NVWA 5AUKA 1OQQA 4ZHPA 2FBWB 1N5XA 1EWYC 2W3RA 3P1MA 5MPOA 1XLOA 1J7BA 2Q5WD 1AWDA 3AEGB 2MJEA 2MJ3A 1NYRA 1YJJA 1QT9A
chains in the Genus database with same CATH superfamily
1N6ZA 2UU7A 3TEZA 1GUAB 1SXTA 3EFUA 3PTFC 1F77A 3Q8FA 2INNE 1HQRD 2DYOA 4PYUA 1P7EA 4KIKB 4TQ1A 4TV3A 2LEKA 2Y3AA 1V9JA 4N59A 4KV2A 5D2MB 4FULA 2KDIA 4URKA 3AXCA 2BB5A 2HTHA 3RN9C 3DOWA 3ML9A 2I1KA 4B9KA 3RI7C 2MH7A 1GC7A 3KLSX 3M95A 4YSXB 4FBJB 1ROEA 2KACA 2MBBB 3ZXRA 1WXVA 1RYJA 1N63A 1WR1A 3KWLA 2JZZA 3VR8B 1RM6C 3HUIA 2MSED 4RH6A 1ZDXA 4DHJB 1E8ZA 4A90A 4AWJA 2L0TA 2LUMA 3I57A 3UI3A 4B0EA 2C9WB 2CJOA 4EZKA 3NZ3A 3ALBA 3PV1A 4HJKA 2J4XA 3RYTA 2KJRA 3PRMB 2PTLA 3APFA 1JMLA 4DHZE 4IUMB 1I4GA 5H8YE 3AE4B 3QK0A 2YVCA 3PZ8A 3DHIC 4K3BA 4KSKC 2KTRA 3U7ZA 4GLSC 4JX1C 2V0GA 2LMCA 5EE9A 3TBLD 1N62A 4HVBA 4BAXA 4ZHOA 1RFKA 3AE2B 1T0YA 1IP9A 4USAA 2RPQA 1MI0A 2WYQA 2KJHB 1LQBA 2WDVB 5AUKA 3NVWA 4ZHPA 5CHWA 2YEPB 3AECB 1YJJA 1FXTB 3IFWB 3ZJVA 4YTNB 2XNAC 2W82A 3Q3FA 1WJNA 3WALA 2INDC 3PREA 2IO1B 1E6EB 1XLQA 2LD9A 1TY0A 3IT4B 1JWUD 4IDIA 2PVOD 2WXRA 3ZNZB 1WXAA 2DNFA 4YTMB 1GB4A 2K8HA 2IGDA 1J7AA 4OVVA 3NY5A 4LNNA 1R4MB 4M8NA 3JSVA 2M56B 4EOYA 2QHOA 3P63A 1VCBA 2MA9B 2KC2A 3BIID 3A33B 2JRHA 3V3XA 2G3QB 5IAAC 2JRIB 2DZIA 5LLIA 2QEJC 2EKIA 3MHSD 2KX0A 2L83A 1YIWA 5J17A 3CSFA 2L1AA 4FJVB 1WWTA 2LWPA 3X23A 2PPHA 4PT5A 5IP4D 2OJWA 3RNGC 3JVZX 5GMVA 4C56C 3I63C 3HRDD 3RD2A 2C7MB 4P7IA 1PFDA 3ZGZA 1JRUA 3U2SC 4MEMA 5C3JB 2D2QA 4HK2A 3H7PB 2RPVA 5E6PA 2WU2B 3EFCA 1OEYJ 4YL8A 2KVRA 3KQ4A 3Q3JA 3DWMA 3RT3B 4ARIA 4NJ7A 2WS3B 3VAWA 2KN5A 1WXMA 4M00A 1L4ZB 4XYCA 2JXXA 3AEGB 3U52E 4NAWB 5JHBA 2CKHB 2D3GA 4FADA 2MHJA 2WXMA 1YQ3B 3AE8B 4C4VA 4RCOA 4IC7B 4JL9A 2KJ6A 5D7GA 3QA8A 3P4RB 3TEYA 2GMIC 3EA6A 2BQQA 2G9HD 1DGJA 2QDFA 2M19A 1I4QA 1KTKA 2TSSA 2E6XA 2INCC 3VFKA 1T3QA 2WP9B 2D3CA 3ABVB 2KT7A 4A3OA 2DX5B 3TEWA 3RMKC 1KLVA 3ZW3A 1WMHA 4EUTA 4OHJA 1T0SC 2MQJA 5CX3A 4P16A 1E10A 1KM7A 3AEBB 2MJDA 2WX0A 1QILA 3OG5A 2GB1A 4JWSC 3LJ3A 3MHZA 1JROA 3Q8BA 1J8CA 5BO4B 1GAQB 1A5RA 4M8MA 2DLBA 3VUYA 1P7FA 4RM8A 2LGDA 5D3DA 3B08A 5E6OA 3TMPB 2JYTA 2KANA 1R4NI 5LXHA 1ENFA 1HTQA 2FCSA 1UBQA 2O2VA 3K9PB 3C19A 2GLSA 1I7HA 2KDFB 2WDQB 3B0AA 1J0GA 4JE3B 3EGRA 3I5JC 1C77A 1CQVA 1TT5B 3BVGA 2ZVOA 3QJZA 1TKEA 4KSLC 4ZYSA 2ONQA 4L1BA 2CR5A 4MJSA 2K1FA 2FCNA 4MSMB 1TS3A 4IKGA 2NCNA 3ZJUA 3N9YC 1STEA 3ZJTA 2MBOA 1QOAA 4W9LA 1TS4A 4US9A 1WSPA 2BVCA 3U8ZA 3AE5B 4BZAA 3W5UB 1VZ7A 1WRDB 4MGIE 4GN1A 4RFBA 1ZE3D 2J7QB 2KX3A 1YQBA 4ACFA 3MJWA 1PUTA 2FUG1 3H7PA 4XWTA 2WXKA 2NMQA 1IGDA 1CK1A 4OZCA 1VDVA 4AUQC 1JW9D 3QX1A 3NRZA 4KZ0A 1JALA 1SSNA 5C23A 1XQQA 1QLBB 3RCZA 4FA6A 1AN8A 4WJQA 4LJPB 1C4CA 1PQSA 1I4RA 4RGTA 3Q6BA 3DVGY 1D5XC 1FCCC 1Q5WB 4ZRPA 4RF0A 2KN4A 4I6LB 3U4EG 3ZTDA 3A4RA 1NDDA 2KK8A 1WM3A 4NZLB 3CIRB 1YQ4B 2Y5BB 2PE6B 2BWES 2GI9A 1B1ZA 1ZPSA 3W1SC 3VR9B 5GXGB 1C1YB 4S0RA 3RNBC 4KDLB 4DK5A 4FXCA 1SGHA 3L08A 1B9RA 1WE7A 3W1SA 3PGEA 3A9KB 4II3B 4L23A 2I38A 1N60A 3KUDB 4PS7A 4R3DA 2G4SA 4QAYA 1QZEA 2BPSA 3SFEB 1ZGUB 4JLCA 4MSQB 5L95C 3VXWA 2K39A 3H6NA 4KDIC 4UDUC 2BYTA 3AM9A 3SR6A 4BOZB 2E3TA 1NI2A 4HCNB 3GP7A 3FKYA 1FNVA 1ZUD2 3AE9B 5D3IB 5IO9A 2JY6A 2VH1A 4WIPA 3R8BA 1TS5A 2X38A 1NYQA 3M63B 5AEKB 2DZJA 2Z0DB 1HXYD 1UF0A 5G5GA 2Y5PA 1YMHE 3Q8CA 4GDKA 2MWSB 3UGBB 1F9JA 4RMAA 2D07B 4ZRJA 3NOBA 2IPKD 2R2QA 1UELA 4RNAA 1E90A 2O6VA 3X0WA 3PLVA 2KVZA 2NPTB 5BMHA 1I42A 5DCNA 2AQ3B 2M4NA 3AU4A 4E71A 4IG7B 4A9AA 2LUEA 1XLPA 3A9JA 1ZXHA 3IXSA 1L6VA 5BYSA 1Z2MA 4DHJD 4DHZB 1IGCA 3PS6A 2C60A 4HDQA 2XN9C 3BWUD 3ZNGC 2KDMA 3GB1A 4W9HA 4OVUA 1FM0D 2DAFA 2JQRB 5FK9C 1YD8U 3QAQA 1EWYC 5MPOA 2Q5WD 2KQ7A 3W2DA 2CHXA 4MM3A 2MW5A 1PYWD 4MGZE 1YJ1A 2L8JA 1K53A 2FNJB 1WZ3A 2PMVA 3R7RA 2OOBB 1JQ4A 1WMHB 2LXCA 3AU5A 3T9LA 2AQ1B 3ENEA 4LCDE 1OTRB 5AUIA 4LJOB 1YN3A 3AE6B 1YNTE 2PVGC 3B9JA 3QCAA 3VUXA 1EF1A 3AI5A 1YX5B 2J0MA 3TJPA 4K3CA 5AZHA 2G4DB 1SJED 3DHGC 1P9DU 2SEBD 1D3ZA 3NS8A 1ACCA 2NBVB 3TUOA 4WWNA 1GPXA 2GRIA 2JF5A 3FILB 2MP2B 4HRSA 3SDLC 4N9F4 1WZ0A 4DWFA 1KRHA 4L2YA 4IW0A 1H8CA 2O6VD 3APDA 4ZRKA 4EKUA 2L0FA 2KWVB 4W9IA 3UQAA 4MH0E 2B3AA 2J42A 1K52A 3W5VB 3P4SB 2JUOA 4G3XB 3RNAC 3RUIB 2CU1A 1T0RC 2I1JA 3AEEB 1K8RB 3AEDB 1LGRA 3GE8C 2HDEA 3P1MA 1XLOA 4HXDA 5HG2A 2DYBA 1V1OA 4Q2JA 1P1AA 2G45B 2PW9A 4RM9A 5JHAA 2IZVB 4GMVA 4FHKA 4P6VF 1SE9A 1YJIA 3BZDB 3WAPA 3WAMA 4TKNA 1DOIA 2DYMA 3LXFA 2NPTA 2ZNVB 1TKGA 1XXGA 2NS5A 5FKAC 1LFDA 2KXJA 3GOEA 4DDGD 4YWGG 4W9DA 2C7HA 3N1ZC 5EE3A 2JXTA 2LGXA 4FHJA 1SIJA 3A1QA 1IPGA 1XT9B 5L83A 4ZOHC 3D32A 3B2GA 1EU3A 2B76B 2JSVX 2H88B 4LK0M 1Y56A 2IYDB 3TCAA 4US8A 2M0XA 2PEAA 2JWUA 3NVYA 3Q8AA 3N20C 3R66C 2LHEA 3AH7A 2WXGA 4PYZA 3Q14C 4GDKB 3DPDA 2HTME 3LYYA 2L3ZA 2KZRA 4K81A 3UF8A 1E9MA 1D5MC 2WXJA 4XGAB 1V80A 1WIAA 1VZ8A 4MGYE 3PSEB 1SB3C 2C7NB 1TZ1A 2K3UA 2JU6X 2XEWA 2BBCA 2LGYA 2WXIA 1WYWB 1ZOYB 4CO7A 1E0ZA 4N6EB 3Q3NC 3Q8EA 4M0WA 4LNIA 2R2OA 2LFIA 2JT4B 1EF5A 3HVDA 2CS4A 4MDKE 5G55A 2ZVNA 3TSSA 2H89B 1NENB 2X8XX 3NS1A 1ZDVA 4D2KA 1WXSA 2OJRA 2W3RA 3L0WB 2FAZA 1J7BA 4B0MA 1WJUA 1VZ6A 2WXOA 4ZRIA 1EWCA 4IOIE 4P1CC 3NG0A 4FJZA 3AN1A 2FCQA 1T5XD 1UNSA 3FILA 2KAJA 2W55A 3M62B 4NAWA 1L7YA 1HZ5A 1GJZA 1CZPA 1OQRA 4W9KA 2O2VB 5TR5A 4XX5A 2D3BA 4PS8A 3E9SA 3GZNB 4REZA 3SD5A 1C79A 3B2FA 1YOVB 3AEAB 2KFJA 5H92C 2Y5CA 2DENB 4FLHA 3R2IA 2ZEQA 3OWEB 4GB9A 5G2NA 3ZDMC 3PHXB 3MJ5A 4MT5A 2JVCA 1TBEA 4ZDVA 1WYGA 4GSWA 4GOCA 4II2B 3N32A 2KD0A 4MACA 2N7DA 4LNKA 2JZ3B 1BUIC 3Q3OC 2CHWA 4OW0A 5AZFA 3U30A 1QQRA 3S2AA 4HEA1 2JPHA 4BKGA 4JGHB 2RR9A 3C8YA 4YT0B 4P1BC 1I4HA 3Q3MC 2L76A 3H1UA 1IBXA 1K50A 3RPFC 1HEZE 2XBBC 1FMAD 5JXVA 3FC4A 3QIJA 1WI0A 4BBNC 3A1QB 3NJTA 3FAHA 1J7CA 4ICVA 5J2RA 4G50A 1YN4A 2KQSA 4DBGA 1R4MI 4AS1A 2LGIA 2NTTA 5CHVC 4HPLB 3V05A 4NJCA 1ISNA 3DHHC 1BXTA 1EU4A 2WDRB 3AE1B 3VVWB 3HM6X 4EE2A 3I3TB 3HVZA 5KHQA 1XD3B 1NEKB 2L00B 3DVNV 4C80A 3MTNB 1ZW7A 1XF5L 1FO4A 4ANVA 4LTUA 1ET6A 3VRAB 2LASA 3GZNI 2XK5B 3RFZB 1WXQA 2PIAA 5C2TB 4YSZB 1KOTA 2SAKA 2AYOB 3AMZA 1VR9A 3IG3A 1HZ6A 3W1YA 3H8HA 3VTUA 3IVFA 5KHOA 2AX5A 1RAXA 4W9CA 3HIZA 2LRUA 3V6CB 5IN7A 1P3QU 4HWIB 3QWZB 1DYQA 2W54A 4RGNA 2MCNB 4GDLA 1PGBA 3QQ8B 2KKCA 4XDCA 4I6PA 5CHFA 2V3PA 3RULA 2JZPA 3L13A 3ZKJC 4MGKE 3NUHB 3UIOB 2WXPA 2GBKA 4ZYNA 4JWUC 2IGGA 4WWPA 4GXBA 2N9EB 3IAS1 5I4DA 2L05A 1UD7A 2LJIA 3UQBA 1D6EC 4O1NA 4WH4A 1J19A 4JPSA 2WU5B 4LDTD 2BKRB 3BYYB 2AQ2B 3DBHI 5LNK1 2N1VA 3L54A 3DBHB 5TSSA 3GE3C 4H2AA 3H9DA 1ESFA 1X1MA 2MJ3A 3V60A 3DBRI 1GG3A 3N30A 1UBIA 1V8CA 1UZXB 2M1MA 3RNFC 3A9JB 2DBYA 3KVFB 4BFRA 2K8BA 1MHXA 2RSUA 2ACZB 2IDYA 4ZRQA 2J53A 1V5TA 2ON8A 1DOXA 2LVQA 3V62A 4EZJA 3PVLA 1L4DB 4DQOC 3IT6B 2I2YA 4W9JA 1P98A 4TQ0A 4MM3B 2NR2A 4WJNA 3O65B 1TTNA 1WY8A 3CWIA 4KZCA 3ETRA 2HJ1A 1BT0A 1UWMA 4BOSC 4AP4C 3IAM1 2MBEA 3BVZA 1WGGA 3MC8A 4XZ4A 2GBRA 3OJ3A 3CF6E 2JX5A 4MELA 3P4PB 3T3OA 2KWDA 1HA5A 2KOXA 2UWQA 1TYGB 1RRBA 3M3JA 1T6BX 1E7VA 2BYEA 1WR6E 1VRAB 1P0RA 2DAJA 2VH2A 4GGQA 3QHTA 1R4NB 1V49A 2IY0B 4C7YA 4RF1A 1FD6A 4OZBA 1UGJA 2UYZB 2IY1B 1GNUA 4RGMA 4A20A 1WGYA 3HK0A 1V2YA 1C4AA 3KYDD 1N5WA 2AEHA 2ZPYA 4TMAB 3EECA 3SHQA 3DBLB 3RNCC 3WAOA 2LHDA 1ZXIA 2PE9A 3PZ7A 2QILA 1I35A 1EUVB 1WFYA 4WWOA 3VQIA 3ZUNA 2GBNA 2MJEA 1NYRA 2MEKA 4YTPB 4TSSA 5JZEB 3JW0X 1GB1A 2CHZA 4K7SA 2NBWB 2ZPNA 4A3PA 2VRRB 1QOGA 2ICIA 3RZFA 1NI3A 2K8CA 2BTEA 1N61A 1XCQL 1V6EA 4AOFA 1UWXA 2V4IB 4AJWA 4C7ZA 3DVNU 4NPNA 1IYFA 3UIPB 4XE0A 2OHFA 3SU8X 3U7DA 4WQMA 1H4RA 3R2TA 1L2NA 3BVMA 3NZUA 1WX9A 1JWAD 3L4PA 4HDOA 4ICUA 3V6EB 1F1HA 1FNUA 4K7WA 1V5OA 2BF8B 4A6QA 1NVID 2N9LA 5JH5C 4WAFA 1OQYA 2QSDA 1OEYA 1QOBA 2V3SA 2N0SB 4IWPA 3V61A 4I6NB 2Z0EB 3ZVVA 4E3CA 2MP2A 2FE8A 3VTVA 4J6IA 1IBXB 1V1PA 1AYFA 4NQLB 3JSVB 2KTRB 2IO0B 1TY2A 4S17A 5E6JA 3SEBA 3ZTCA 2N9PC 3GS2A 2K6DB 1V97A 4IM3A 3PRZA 1WJ4A 1TJEA 3PPAA 2O6VB 5DPWA 3ZDTA 2K0PA 1S3SG 4JIOU 1S1QB 2ZZPB 2V3NA 2MBHA 3PZDA 2BYVE 2J0KA 3VTWA 3KH0A 3EC8A 4XC2A 2MBQA 4M0WB 3ONSA 2M0AA 3P4QB 1JWSD 2BGFA 3KYCD 4CHKA 2KQ4X 2A4ZA 4LLGM 4MH8A 3ZNID 5HI1A 2ZNVC 4LDTB 3O13A 2W3SA 4J3OD 2ZW1A 2MRPA 2WQYB 4TUUA 2BWFA 2NVUI 1I4PA 1E7UA 2KWUB 5CTRC 3TIXA 1VJKA 4C4VB 3HHMA 1F0ZA 1WGHA 4RGOS 3DBRB 3H7SA 1QKZA 3R3MA 1YN5A 3J9CA 2BS3B 2AWTA 1TIFA 1VLBA 2BT6A 2WXLA 3VH3B 5J18A 1SE4A 1WE6A 2LVOA 2BYFA 4KIKA 2D11A 3N3KB 1PGXA 2KO3A 2PJHA 1L5PA 3AEFB 4NJ6A 2KLCA 3DVGX 4NNJB 2K9XA 3N1XC 1L0YB 3WIMA 1ZP0B 1SIFA 1SEBD 1SJHD 1FPYA 1AWDA 4DXGA 4WQOB 3BY4B 2KYWA 4NAMA 2KLGA 4BKSA 2L7RA 4DDID 2PKOA 1R7SA 3LDZE 2ZCBA 2M8SA 2FIFA 1FCLA 1LM8B 2ZW0A 4W9EA 3VHTC 2WNMA 4IM2A 4M01A 1C3TA 3WANA 4A8XC 1WGDA 1V81A 3AULA 1TGZB 2PLPA 2BS4B 1D4BA 4W9FA 2D3AA 1A70A 3C0RB 2G1EA 4OZAA 1KFYB 4WJOA 2EKEC 4F1SA 2K25A 1FIQA 1YX6B 1QOFA 5D94A 2YLMA 5BYRA 3AB5A 2DHZA 4OVZA 3ZRFA 3ZNHB 1OFFA 1FNWA 2R61A 1M4VA 4G11A 2RGFA 3WA0A 2WHIA 1XCTL 3I9V1 2BS2B 2CJNA 3T3NA 1EM7A 3ECIA 1U4AA 2KFKB 3BK1A 2N7JA 1TZOA 2IGHA 2N1WA 4KVGB 4ARCA 4K1RB 3ZYYX 1V86A 1VD2A 3KW5B 2K5PA 3ZO5B 1WF9A 2Z59B 4WURA 2W9NA 1E7PB 3DWGC 3DBLI 4LNOA 1C78A 2CU3A 2MLBA 2N9XA 4EZLA 4HCPB 1FFVA 2VZKD 2ZCCA 3HM3A 2WXQA 4DXFA 2FBWB 2OEDA 2RD0A 4GDLB 2LGSA 3OLMD 3EUB2 4KKIA 3NVZA 1XEEA 1CMXB 1WGKA 4IWOA 2IJ0A 3APCA 1NBFC 1G6JA 4K7UA 4WWMA 2K22A 2LVPA 3AV8A 2REXA 3QC8B 4PK1A 2IO2B 1WJ6A 5EDSA 4ASWC 2IBIB 2KWCA 3Q69A 1SF0A 2V9HA 4GIVA 3A9KA 3IBEA 3EHVA 1F52A 5IA7A 1WX8A 1UH6A 1KLUD 4KGSA 2EELA 5D6JB 5T8IA 3B1LX 3DCGA 3P42A 2WWZA 1WRIA 1MG8A 3W9CB 1LXDA 4BVUC 3RNEC 2AL6A 1HTOA 2BW2A 1TS2A 1WM2A 4KX6B 1UGMA 1FFUA 2HE7A 3BINA 2L52A 1M94A 1E8XA 2N4FA 2ASQA 2QJLA 1PDXA 1L0XB 1Z5SB 2KDBA 1QF6A 3PLUA 1GOZA 2INPE 2RDGA 1RWSA 2KFKA 4DXAB 1LO5D 4KKJA 1WGRA 4XWWA 1FXIA 2K6QA 4NY0A 1AARA 3MP9A 2DZMA 1SE2A 2WXNA 3OJ4B 4ANXA 1RFAA 2GBJA 3JYUA 5G5HA 1V1PB 1XLNA 5DPRA 1D5ZC 1JCKB 3IHPC 3DDCB 1WX7A 2WGSA 1I4XA 3URYA 4A55A 2J52A 1DOYA 3DQVA 5E6NA 1OQQA 2HD5B 1SE3A 3ZLZA 1Q10A 1HE8A 3PT2B 4WJPA 4BKTA 2BB6A 4X57B 3PHWB 4ANUA 4IM0A 3A4SC 1C9FA 2LJ5A 3DBSA 4ANWA 2KHWB 3AE3B 2C5LC 1FRRA 3ZIMA 4HPPA 3L10B 4W9GA 4YSYB 1GC6A 1BMLC 1IUEA 4PS3A 2FIDA 1XO3A 3L17A 3VDZA 2KDEB 1UUPA 2D5GA 4AJYB 3NZSA 3PO0A 4NQKE 2LI5A 5FR6A 3VH4B 2QMTA 3LB8C 2RMMA 3ZRCA 1Q1OA 3N1YC 3Q2AC 3MFGA 5FR3A 2FUHB 2KMMA 1KLGD 3WCQA 1RLFA 3ZXVA 1E8WA 2LZ6A 1FRDA 1KH0A 2V1YA 2YEPF 2KTFA 3BYTB 3R7QA 5LXIB 3KWVA 2A5UA 2D10A 1E8YA 4HKQA 3T8MA 1C76A 1C4PA 2WXHA 4BBNF 1MJDA 2Z8LA 4G0NB 1JWBD 4IWQA 2EMTA 2LXAA 1KF6B 4HROA 3P2BA 1EO6A 3AE7B 2GOWA 3RZWC 1F2RC 2BKFA 1K51A 3MC9A 4N58A 2J0JA 5EE1A 1AW7A 2KNBA 3L16A 5IOIA 3NVVA 4XDDA 2JWZA 4KGTA 2DZKA 2NBUA 3UINB 3OAWA 3QARA 3KUZA 4M02A 5IKCM 2RDHA 5C1ZA 2WLBA 4C00A 4GU2A 4JQWC 5DPSA 2QC8A 2N7EA 2RDBC 2WX1A 2JYEA 1CJEA 1L6UA 2ZJDA 4F7ZA 2LRWA 4EEWA 2NTSA 4CQNA 4EFOA 5AZGA 5EE0A 4WAAA 2M17A 1KJTA 2IO3B 3BK2A 1F2RI 3SFDB 1MG4A 5DPTA 3CSTA 4HKZE 1TKYA 3KUCB 5BYQA 2KMAA 4E74A 1MVKA 3VRBB 4FN2A 4F8CB 2XK5A 3VUWA 3CMMB 3PRPB 2AL3A 2V4LA 2KMCA 2N9KA 5HHDG 2WXFA 4HLEA 4ITKA 3TL5A 1ET9A 3K9OB 2GBMA 1FEHA 1ZKHA 4YXDB 2EMSA 1Q0WB 2VZKB 1T0QC 3ML8A 4LNFA 1L0VB 4BKSD 2MX2A 1JWMD 2FCMA 1JRPA 4CYEA 3TEXA 5HFYA 1SBBB 1MFWA 2QCZA 2HJ8A 5BMIA 1MPEA 1OGWA 1WH3A 4B95A 5HKHA 4AQ7A 2WDTB 4B6WA 2QIEB 2L32A 4KGRA 3E56A 3NHEB 1PGAA 1Y8RC 1MHHE 3MC0B 4HPMB 2DWQA 4HJGE 2KC1A 4FJYA 1FXAA 1N5XA 3ZQ4A 4MJSB 1E5WA 5BMGA 1QT9A
chains in the Genus database with same CATH topology
1BXTA 1EU4A 2WDRB 3AE1B 3SFEB 4NAMA 3TEZA 4EE2A 3HVZA 1SXTA 1F77A 1NEKB 1R7SA 2PKOA 3Q8FA 4C80A 2INNE 4UDUC 2BYTA 3AM9A 1FCLA 3SR6A 1XF5L 1HQRD 2DYOA 1P7EA 2ZW0A 2E3TA 1FO4A 4LTUA 4TQ1A 1ET6A 2LEKA 2Y3AA 3VRAB 2WNMA 3RFZB 1WXQA 3GP7A 4N59A 2PIAA 5C2TB 1FNVA 1ZUD2 2BB5A 4YSZB 3AE9B 4A8XC 5D3IB 2SAKA 4WIPA 3R8BA 1TS5A 2X38A 3AMZA 1VR9A 1NYQA 2MH7A 2PLPA 1HZ6A 3KLSX 2BS4B 4YSXB 3H8HA 1HXYD 1D4BA 5G5GA 1A70A 1ROEA 2G1EA 2KACA 2Y5PA 4OZAA 1RYJA 1YMHE 2AX5A 3Q8CA 1N63A 1KFYB 3KWLA 3VR8B 1RM6C 3HUIA 4RH6A 1ZDXA 1DYQA 2W54A 4RGNA 1FIQA 4A90A 2IPKD 2LUMA 3I57A 3UI3A 4B0EA 1PGBA 4XDCA 2CJOA 2V3PA 1QOFA 4RNAA 5BYRA 3NZ3A 3AB5A 2JZPA 4OVZA 2J4XA 1OFFA 5BMHA 1FNWA 2R61A 1M4VA 3NUHB 2WXPA 1XCTL 2PTLA 3I9V1 2AQ3B 1JMLA 4JWUC 1I4GA 2IGGA 5H8YE 2BS2B 2CJNA 3T3NA 1EM7A 3AE4B 3PZ8A 3BK1A 4A9AA 2N7JA 1TZOA 2IGHA 3IAS1 5I4DA 3U7ZA 4ARCA 3ZYYX 1XLPA 4GLSC 2LJIA 4JX1C 2V0GA 1D6EC 4O1NA 2K5PA 1ZXHA 3IXSA 4WH4A 1L6VA 2LMCA 5BYSA 5EE9A 1N62A 4WURA 4ZHOA 1RFKA 1IGCA 1E7PB 3AE2B 2XN9C 3DWGC 2WU5B 4JPSA 3BWUD 4USAA 1C78A 2CU3A 1MI0A 2KDMA 3BYYB 3GB1A 1FFVA 2AQ2B 1FM0D 2JQRB 2VZKD 5FK9C 5LNK1 2WDVB 5AUKA 3NVWA 5TSSA 2WXQA 4DXFA 2FBWB 4ZHPA 1EWYC 5MPOA 4H2AA 2OEDA 2Q5WD 2YEPB 1ESFA 3AECB 3W2DA 2MJ3A 4GDLB 1YJJA 1PYWD 1V8CA 3ZJVA 3EUB2 4KKIA 3NVZA 4YTNB 1K53A 1XEEA 2DBYA 1WGKA 2XNAC 2W82A 2IJ0A 1MHXA 2ACZB 2PMVA 4WWMA 2IDYA 2K22A 4ZRQA 2J53A 3AV8A 1JQ4A 1E6EB 1XLQA 2ON8A 1DOXA 1TY0A 3IT4B 1JWUD 2AQ1B 4IDIA 2PVOD 3Q69A 1SF0A 2WXRA 1L4DB 4DQOC 3IT6B 2I2YA 5AUIA 4YTMB 4TQ0A 4MM3B 1GB4A 1YN3A 4KGSA 1KLUD 3AE6B 3CWIA 3ETRA 2IGDA 1YNTE 2EELA 1J7AA 5T8IA 2PVGC 1UWMA 3B9JA 3P42A 1WRIA 2M56B 3IAM1 3W9CB 3P63A 3BVZA 3BIID 3V3XA 2BW2A 1TS2A 4KX6B 2JX5A 2QEJC 1SJED 3P4PB 2EKIA 3T3OA 1FFUA 2KWDA 2SEBD 1HA5A 1TYGB 2L52A 2L83A 1T6BX 2QJLA 1ACCA 1PDXA 1L0XB 3TUOA 1VRAB 1QF6A 2L1AA 1GPXA 1GOZA 2GRIA 1WWTA 2INPE 3FILB 2RDGA 1RWSA 1LO5D 4KKJA 4HRSA 4PT5A 4XWWA 1FXIA 4C7YA 1KRHA 4RF1A 4C56C 4L2YA 3HRDD 1FD6A 4OZBA 3MP9A 1SE2A 2WXNA 1PFDA 1UGJA 3ZGZA 4RGMA 5G5HA 1V1PB 1XLNA 1C4AA 3U2SC 1D5ZC 1JCKB 1N5WA 5C3JB 2J42A 4TMAB 1K52A 2RPVA 2WU2B 3W5VB 3KQ4A 3P4SB 3DWMA 1I4XA 3URYA 4A55A 2J52A 2LHDA 3AEEB 4ARIA 2WS3B 1ZXIA 3AEDB 3PZ7A 1DOYA 2QILA 2HDEA 1L4ZB 3VQIA 1OQQA 1SE3A 1Q10A 3P1MA 1XLOA 5HG2A 3AEGB 3U52E 1V1OA 4NAWB 2MJEA 2MEKA 1NYRA 2BB6A 4Q2JA 2PW9A 4YTPB 4TSSA 2WXMA 1YQ3B 3AE8B 4P6VF 4RCOA 1GB1A 1YJIA 3BZDB 5D7GA 1C9FA 1DOIA 3P4RB 2DYMA 3LXFA 3TEYA 1QOGA 3AE3B 3EA6A 2G9HD 1TKGA 2ICIA 1FRRA 1NI3A 1XXGA 1DGJA 5FKAC 2M19A 2BTEA 1N61A 1XCQL 1I4QA 4YWGG 1UWXA 2V4IB 1KTKA 2TSSA 4YSYB 2E6XA 4C7ZA 5EE3A 2JXTA 1BMLC 1IUEA 1T3QA 1SIJA 2WP9B 3ABVB 1XO3A 4XE0A 1UUPA 4ZOHC 3TEWA 2D5GA 2OHFA 3B2GA 3PO0A 4WQMA 1EU3A 4OHJA 3R2TA 2B76B 2JSVX 3BVMA 2H88B 4LK0M 4P16A 1E10A 1Y56A 4US8A 2QMTA 3AEBB 1JWAD 3LB8C 3L4PA 2RMMA 2JWUA 3NVYA 3Q8AA 1FNUA 2MJDA 1QILA 4A6QA 1NVID 2LHEA 2GB1A 2N9LA 3AH7A 4JWSC 2WXGA 3MFGA 4GDKB 4WAFA 5FR3A 3MHZA 1JROA 2KMMA 1KLGD 2HTME 3LYYA 3WCQA 3Q8BA 2QSDA 1GAQB 1FRDA 2DLBA 1P7FA 1KH0A 1E9MA 1D5MC 1QOBA 2WXJA 2YEPF 3BYTB 1VZ8A 3KWVA 5D3DA 2N0SB 4HKQA 2JYTA 1ENFA 1C76A 1SB3C 1C4PA 2FE8A 2K3UA 2JU6X 2WXHA 2BBCA 1I7HA 1IBXB 1V1PA 1AYFA 2Z8LA 2WXIA 2WDQB 1JWBD 1ZOYB 1E0ZA 4N6EB 1KF6B 1TY2A 4HROA 3Q8EA 5E6JA 4M0WA 3SEBA 2LFIA 4JE3B 3EGRA 3GS2A 3HVDA 3AE7B 1C77A 1CQVA 1F2RC 3TSSA 2H89B 1V97A 1K51A 1NENB 4N58A 5EE1A 1AW7A 3BVGA 3NS1A 4ZYSA 1TKEA 1TJEA 1ZDVA 2ONQA 4L1BA 3NVVA 4XDDA 4D2KA 4KGTA 2W3RA 1J7BA 4B0MA 2K0PA 1VZ6A 2WXOA 1TS3A 1EWCA 4IKGA 4IOIE 2RDHA 2WLBA 3ZJUA 2V3NA 3N9YC 1STEA 3ZJTA 3AN1A 1T5XD 1UNSA 3FILA 1QOAA 2KAJA 2W55A 1TS4A 2JYEA 4US9A 2M0AA 1CJEA 1WSPA 1HZ5A 1L6UA 3AE5B 3P4QB 1JWSD 3W5UB 1VZ7A 1CZPA 1OQRA 4RFBA 2KQ4X 1ZE3D 2NTSA 4LLGM 4CQNA 4MH8A 3E9SA 5HI1A 5EE0A 1PUTA 2FUG1 3O13A 4XWTA 2W3SA 2WXKA 2NMQA 4REZA 1C79A 3B2FA 1IGDA 4J3OD 1CK1A 1F2RI 3BK2A 3SFDB 4OZCA 1VDVA 2ZW1A 1JW9D 2WQYB 4HKZE 3NRZA 1JALA 3AEAB 1SSNA 1I4PA 1TKYA 5H92C 5BYQA 2Y5CA 1QLBB 1AN8A 1MVKA 3R2IA 3OWEB 1VJKA 3VRBB 3MJ5A 4MT5A 1F0ZA 1C4CA 1WYGA 4RGOS 1I4RA 4RGTA 1QKZA 1D5XC 1FCCC 4MACA 4ZRPA 1YN5A 2N9KA 5HHDG 3J9CA 4RF0A 1BUIC 2WXFA 4ITKA 2BS3B 2KN4A 1ET9A 4OW0A 3U4EG 1QQRA 1VLBA 4HEA1 1FEHA 2BT6A 4YXDB 2WXLA 2VZKB 3C8YA 4NZLB 4YT0B 3CIRB 1YQ4B 1I4HA 1L0VB 1SE4A 1JWMD 1JRPA 2GI9A 1B1ZA 3TEXA 5HFYA 1SBBB 1ZPSA 1PGXA 3VR9B 1IBXA 1K50A 3RPFC 1HEZE 1FMAD 5GXGB 5BMIA 5JXVA 1MPEA 3FC4A 4FXCA 1B9RA 4AQ7A 3FAHA 1J7CA 1L5PA 3AEFB 3W1SA 2QIEB 2L32A 4L23A 1YN4A 4KGRA 3E56A 2K9XA 1PGAA 4AS1A 2LGIA 1MHHE 2I38A 2NTTA 3MC0B 1L0YB 2DWQA 1N60A 1ZP0B 4HJGE 1FXAA 3V05A 1N5XA 1SEBD 3ZQ4A 1SJHD 4NJCA 4R3DA 1AWDA 4DXGA 5BMGA 1QT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WDR B;  3AE1 B;  3SFE B;  2WLB A;  4YTP B;  1V8C A;  3HVZ A;  3AN1 A;  3EUB 2;  3NVZ A;  4YTN B;  1YQ3 B;  3AE8 B;  4P6V F;  1QOA A;  2DBY A;  1WGK A;  2KAJ A;  2W55 A;  1NEK B;  1R7S A;  1YJI A;  2PKO A;  4US9 A;  4C80 A;  1DOI A;  3P4R B;  2ACZ B;  1CJE A;  3LXF A;  4WWM A;  1L6U A;  2K22 A;  3AE5 B;  3AM9 A;  1QOG A;  3AE3 B;  3AV8 A;  3P4Q B;  3SR6 A;  1JQ4 A;  1TKG A;  1E6E B;  1XLQ A;  3W5U B;  1DOX A;  2E3T A;  1FO4 A;  1FRR A;  1NI3 A;  1CZP A;  1DGJ A;  1OQR A;  4LTU A;  2LEK A;  3VRA B;  2M19 A;  1N61 A;  4IDI A;  2PVO D;  1WXQ A;  1SF0 A;  4N59 A;  2PIA A;  5EE0 A;  5C2T B;  4YSY B;  1ZUD 2;  1PUT A;  4C7Z A;  5AUI A;  3AE9 B;  4YSZ B;  4YTM B;  5EE3 A;  1IUE A;  2W3S A;  1T3Q A;  1SIJ A;  2WP9 B;  3ABV B;  3AE6 B;  3B2F A;  1XO3 A;  1NYQ A;  3CWI A;  3AMZ A;  3ETR A;  1VDV A;  2MH7 A;  3SFD B;  1J7A A;  2PVG C;  1JW9 D;  2BS4 B;  2WQY B;  1UWM A;  4YSX B;  3B9J A;  4ZOH C;  3NRZ A;  1JAL A;  5G5G A;  3AEA B;  1WRI A;  1A70 A;  1ROE A;  1TKY A;  2G1E A;  2M56 B;  2OHF A;  3B2G A;  3W9C B;  3PO0 A;  1RYJ A;  4WQM A;  2AX5 A;  5H92 C;  1N63 A;  2B76 B;  2Y5C A;  1QLB B;  3P63 A;  1KFY B;  2H88 B;  3BII D;  1E10 A;  3KWL A;  4KX6 B;  4US8 A;  3AEB B;  3LB8 C;  1JWA D;  3L4P A;  3VR8 B;  1VJK A;  1RM6 C;  2JX5 A;  3HUI A;  3VRB B;  3AEC B;  3NVY A;  2W54 A;  3P4P B;  2EKI A;  1F0Z A;  1FFU A;  1FIQ A;  1WYG A;  2MJD A;  1TYG B;  2L52 A;  2L83 A;  1NVI D;  3AH7 A;  2QJL A;  1PDX A;  4JWS C;  2CJO A;  1QOF A;  1JRO A;  2KMM A;  1QF6 A;  2HTM E;  3WCQ A;  1GPX A;  3AB5 A;  1WWT A;  4ITK A;  2BS3 B;  1RWS A;  1GAQ B;  1FRD A;  4HRS A;  1FXI A;  1VLB A;  2BT6 A;  1E9M A;  1OFF A;  1QOB A;  4YXD B;  4C7Y A;  1KRH A;  2N0S B;  4YT0 B;  3HRD D;  3CIR B;  1YQ4 B;  1L0V B;  1SB3 C;  1PFD A;  4JWU C;  1JRP A;  5H8Y E;  2BS2 B;  2CJN A;  5G5H A;  3AE4 B;  1XLN A;  1I7H A;  4A9A A;  1AYF A;  3VR9 B;  3RPF C;  2WDQ B;  1JWB D;  1FMA D;  1ZOY B;  5GXG B;  1E0Z A;  1N5W A;  5C3J B;  4N6E B;  3ZYY X;  1KF6 B;  1XLP A;  3FC4 A;  4HRO A;  4JX1 C;  2K5P A;  2WU2 B;  4FXC A;  1B9R A;  3W5V B;  1L6V A;  1J7C A;  3FAH A;  3P4S B;  1L5P A;  3AEF B;  5EE9 A;  3AE7 B;  1N62 A;  3DWM A;  2QIE B;  4ZHO A;  1RFK A;  2H89 B;  1E7P B;  3AE2 B;  3AEE B;  1V97 A;  2K9X A;  2WU5 B;  1NEN B;  3DWG C;  2WS3 B;  4N58 A;  4USA A;  1ZXI A;  3AED B;  5EE1 A;  2CU3 A;  3NS1 A;  1DOY A;  1TKE A;  2DWQ A;  1TJE A;  1FFV A;  1N60 A;  1FM0 D;  1ZP0 B;  2JQR B;  3NVV A;  1FXA A;  2WDV B;  3NVW A;  5AUK A;  1OQQ A;  4ZHP A;  2FBW B;  1N5X A;  1EWY C;  2W3R A;  3P1M A;  5MPO A;  1XLO A;  1J7B A;  2Q5W D;  1AWD A;  3AEG B;  2MJE A;  2MJ3 A;  1NYR A;  1YJJ A;  1QT9 A; 
#chains in the Genus database with same CATH topology
 1N6Z A;  2UU7 A;  3TEZ A;  1GUA B;  1SXT A;  3EFU A;  3PTF C;  1F77 A;  3Q8F A;  2INN E;  1HQR D;  2DYO A;  4PYU A;  1P7E A;  4KIK B;  4TQ1 A;  4TV3 A;  2LEK A;  2Y3A A;  1V9J A;  4N59 A;  4KV2 A;  5D2M B;  4FUL A;  2KDI A;  4URK A;  3AXC A;  2BB5 A;  2HTH A;  3RN9 C;  3DOW A;  3ML9 A;  2I1K A;  4B9K A;  3RI7 C;  2MH7 A;  1GC7 A;  3KLS X;  3M95 A;  4YSX B;  4FBJ B;  1ROE A;  2KAC A;  2MBB B;  3ZXR A;  1WXV A;  1RYJ A;  1N63 A;  1WR1 A;  3KWL A;  2JZZ A;  3VR8 B;  1RM6 C;  3HUI A;  2MSE D;  4RH6 A;  1ZDX A;  4DHJ B;  1E8Z A;  4A90 A;  4AWJ A;  2L0T A;  2LUM A;  3I57 A;  3UI3 A;  4B0E A;  2C9W B;  2CJO A;  4EZK A;  3NZ3 A;  3ALB A;  3PV1 A;  4HJK A;  2J4X A;  3RYT A;  2KJR A;  3PRM B;  2PTL A;  3APF A;  1JML A;  4DHZ E;  4IUM B;  1I4G A;  5H8Y E;  3AE4 B;  3QK0 A;  2YVC A;  3PZ8 A;  3DHI C;  4K3B A;  4KSK C;  2KTR A;  3U7Z A;  4GLS C;  4JX1 C;  2V0G A;  2LMC A;  5EE9 A;  3TBL D;  1N62 A;  4HVB A;  4BAX A;  4ZHO A;  1RFK A;  3AE2 B;  1T0Y A;  1IP9 A;  4USA A;  2RPQ A;  1MI0 A;  2WYQ A;  2KJH B;  1LQB A;  2WDV B;  5AUK A;  3NVW A;  4ZHP A;  5CHW A;  2YEP B;  3AEC B;  1YJJ A;  1FXT B;  3IFW B;  3ZJV A;  4YTN B;  2XNA C;  2W82 A;  3Q3F A;  1WJN A;  3WAL A;  2IND C;  3PRE A;  2IO1 B;  1E6E B;  1XLQ A;  2LD9 A;  1TY0 A;  3IT4 B;  1JWU D;  4IDI A;  2PVO D;  2WXR A;  3ZNZ B;  1WXA A;  2DNF A;  4YTM B;  1GB4 A;  2K8H A;  2IGD A;  1J7A A;  4OVV A;  3NY5 A;  4LNN A;  1R4M B;  4M8N A;  3JSV A;  2M56 B;  4EOY A;  2QHO A;  3P63 A;  1VCB A;  2MA9 B;  2KC2 A;  3BII D;  3A33 B;  2JRH A;  3V3X A;  2G3Q B;  5IAA C;  2JRI B;  2DZI A;  5LLI A;  2QEJ C;  2EKI A;  3MHS D;  2KX0 A;  2L83 A;  1YIW A;  5J17 A;  3CSF A;  2L1A A;  4FJV B;  1WWT A;  2LWP A;  3X23 A;  2PPH A;  4PT5 A;  5IP4 D;  2OJW A;  3RNG C;  3JVZ X;  5GMV A;  4C56 C;  3I63 C;  3HRD D;  3RD2 A;  2C7M B;  4P7I A;  1PFD A;  3ZGZ A;  1JRU A;  3U2S C;  4MEM A;  5C3J B;  2D2Q A;  4HK2 A;  3H7P B;  2RPV A;  5E6P A;  2WU2 B;  3EFC A;  1OEY J;  4YL8 A;  2KVR A;  3KQ4 A;  3Q3J A;  3DWM A;  3RT3 B;  4ARI A;  4NJ7 A;  2WS3 B;  3VAW A;  2KN5 A;  1WXM A;  4M00 A;  1L4Z B;  4XYC A;  2JXX A;  3AEG B;  3U52 E;  4NAW B;  5JHB A;  2CKH B;  2D3G A;  4FAD A;  2MHJ A;  2WXM A;  1YQ3 B;  3AE8 B;  4C4V A;  4RCO A;  4IC7 B;  4JL9 A;  2KJ6 A;  5D7G A;  3QA8 A;  3P4R B;  3TEY A;  2GMI C;  3EA6 A;  2BQQ A;  2G9H D;  1DGJ A;  2QDF A;  2M19 A;  1I4Q A;  1KTK A;  2TSS A;  2E6X A;  2INC C;  3VFK A;  1T3Q A;  2WP9 B;  2D3C A;  3ABV B;  2KT7 A;  4A3O A;  2DX5 B;  3TEW A;  3RMK C;  1KLV A;  3ZW3 A;  1WMH A;  4EUT A;  4OHJ A;  1T0S C;  2MQJ A;  5CX3 A;  4P16 A;  1E10 A;  1KM7 A;  3AEB B;  2MJD A;  2WX0 A;  1QIL A;  3OG5 A;  2GB1 A;  4JWS C;  3LJ3 A;  3MHZ A;  1JRO A;  3Q8B A;  1J8C A;  5BO4 B;  1GAQ B;  1A5R A;  4M8M A;  2DLB A;  3VUY A;  1P7F A;  4RM8 A;  2LGD A;  5D3D A;  3B08 A;  5E6O A;  3TMP B;  2JYT A;  2KAN A;  1R4N I;  5LXH A;  1ENF A;  1HTQ A;  2FCS A;  1UBQ A;  2O2V A;  3K9P B;  3C19 A;  2GLS A;  1I7H A;  2KDF B;  2WDQ B;  3B0A A;  1J0G A;  4JE3 B;  3EGR A;  3I5J C;  1C77 A;  1CQV A;  1TT5 B;  3BVG A;  2ZVO A;  3QJZ A;  1TKE A;  4KSL C;  4ZYS A;  2ONQ A;  4L1B A;  2CR5 A;  4MJS A;  2K1F A;  2FCN A;  4MSM B;  1TS3 A;  4IKG A;  2NCN A;  3ZJU A;  3N9Y C;  1STE A;  3ZJT A;  2MBO A;  1QOA A;  4W9L A;  1TS4 A;  4US9 A;  1WSP A;  2BVC A;  3U8Z A;  3AE5 B;  4BZA A;  3W5U B;  1VZ7 A;  1WRD B;  4MGI E;  4GN1 A;  4RFB A;  1ZE3 D;  2J7Q B;  2KX3 A;  1YQB A;  4ACF A;  3MJW A;  1PUT A;  2FUG 1;  3H7P A;  4XWT A;  2WXK A;  2NMQ A;  1IGD A;  1CK1 A;  4OZC A;  1VDV A;  4AUQ C;  1JW9 D;  3QX1 A;  3NRZ A;  4KZ0 A;  1JAL A;  1SSN A;  5C23 A;  1XQQ A;  1QLB B;  3RCZ A;  4FA6 A;  1AN8 A;  4WJQ A;  4LJP B;  1C4C A;  1PQS A;  1I4R A;  4RGT A;  3Q6B A;  3DVG Y;  1D5X C;  1FCC C;  1Q5W B;  4ZRP A;  4RF0 A;  2KN4 A;  4I6L B;  3U4E G;  3ZTD A;  3A4R A;  1NDD A;  2KK8 A;  1WM3 A;  4NZL B;  3CIR B;  1YQ4 B;  2Y5B B;  2PE6 B;  2BWE S;  2GI9 A;  1B1Z A;  1ZPS A;  3W1S C;  3VR9 B;  5GXG B;  1C1Y B;  4S0R A;  3RNB C;  4KDL B;  4DK5 A;  4FXC A;  1SGH A;  3L08 A;  1B9R A;  1WE7 A;  3W1S A;  3PGE A;  3A9K B;  4II3 B;  4L23 A;  2I38 A;  1N60 A;  3KUD B;  4PS7 A;  4R3D A;  2G4S A;  4QAY A;  1QZE A;  2BPS A;  3SFE B;  1ZGU B;  4JLC A;  4MSQ B;  5L95 C;  3VXW A;  2K39 A;  3H6N A;  4KDI C;  4UDU C;  2BYT A;  3AM9 A;  3SR6 A;  4BOZ B;  2E3T A;  1NI2 A;  4HCN B;  3GP7 A;  3FKY A;  1FNV A;  1ZUD 2;  3AE9 B;  5D3I B;  5IO9 A;  2JY6 A;  2VH1 A;  4WIP A;  3R8B A;  1TS5 A;  2X38 A;  1NYQ A;  3M63 B;  5AEK B;  2DZJ A;  2Z0D B;  1HXY D;  1UF0 A;  5G5G A;  2Y5P A;  1YMH E;  3Q8C A;  4GDK A;  2MWS B;  3UGB B;  1F9J A;  4RMA A;  2D07 B;  4ZRJ A;  3NOB A;  2IPK D;  2R2Q A;  1UEL A;  4RNA A;  1E90 A;  2O6V A;  3X0W A;  3PLV A;  2KVZ A;  2NPT B;  5BMH A;  1I42 A;  5DCN A;  2AQ3 B;  2M4N A;  3AU4 A;  4E71 A;  4IG7 B;  4A9A A;  2LUE A;  1XLP A;  3A9J A;  1ZXH A;  3IXS A;  1L6V A;  5BYS A;  1Z2M A;  4DHJ D;  4DHZ B;  1IGC A;  3PS6 A;  2C60 A;  4HDQ A;  2XN9 C;  3BWU D;  3ZNG C;  2KDM A;  3GB1 A;  4W9H A;  4OVU A;  1FM0 D;  2DAF A;  2JQR B;  5FK9 C;  1YD8 U;  3QAQ A;  1EWY C;  5MPO A;  2Q5W D;  2KQ7 A;  3W2D A;  2CHX A;  4MM3 A;  2MW5 A;  1PYW D;  4MGZ E;  1YJ1 A;  2L8J A;  1K53 A;  2FNJ B;  1WZ3 A;  2PMV A;  3R7R A;  2OOB B;  1JQ4 A;  1WMH B;  2LXC A;  3AU5 A;  3T9L A;  2AQ1 B;  3ENE A;  4LCD E;  1OTR B;  5AUI A;  4LJO B;  1YN3 A;  3AE6 B;  1YNT E;  2PVG C;  3B9J A;  3QCA A;  3VUX A;  1EF1 A;  3AI5 A;  1YX5 B;  2J0M A;  3TJP A;  4K3C A;  5AZH A;  2G4D B;  1SJE D;  3DHG C;  1P9D U;  2SEB D;  1D3Z A;  3NS8 A;  1ACC A;  2NBV B;  3TUO A;  4WWN A;  1GPX A;  2GRI A;  2JF5 A;  3FIL B;  2MP2 B;  4HRS A;  3SDL C;  4N9F 4;  1WZ0 A;  4DWF A;  1KRH A;  4L2Y A;  4IW0 A;  1H8C A;  2O6V D;  3APD A;  4ZRK A;  4EKU A;  2L0F A;  2KWV B;  4W9I A;  3UQA A;  4MH0 E;  2B3A A;  2J42 A;  1K52 A;  3W5V B;  3P4S B;  2JUO A;  4G3X B;  3RNA C;  3RUI B;  2CU1 A;  1T0R C;  2I1J A;  3AEE B;  1K8R B;  3AED B;  1LGR A;  3GE8 C;  2HDE A;  3P1M A;  1XLO A;  4HXD A;  5HG2 A;  2DYB A;  1V1O A;  4Q2J A;  1P1A A;  2G45 B;  2PW9 A;  4RM9 A;  5JHA A;  2IZV B;  4GMV A;  4FHK A;  4P6V F;  1SE9 A;  1YJI A;  3BZD B;  3WAP A;  3WAM A;  4TKN A;  1DOI A;  2DYM A;  3LXF A;  2NPT A;  2ZNV B;  1TKG A;  1XXG A;  2NS5 A;  5FKA C;  1LFD A;  2KXJ A;  3GOE A;  4DDG D;  4YWG G;  4W9D A;  2C7H A;  3N1Z C;  5EE3 A;  2JXT A;  2LGX A;  4FHJ A;  1SIJ A;  3A1Q A;  1IPG A;  1XT9 B;  5L83 A;  4ZOH C;  3D32 A;  3B2G A;  1EU3 A;  2B76 B;  2JSV X;  2H88 B;  4LK0 M;  1Y56 A;  2IYD B;  3TCA A;  4US8 A;  2M0X A;  2PEA A;  2JWU A;  3NVY A;  3Q8A A;  3N20 C;  3R66 C;  2LHE A;  3AH7 A;  2WXG A;  4PYZ A;  3Q14 C;  4GDK B;  3DPD A;  2HTM E;  3LYY A;  2L3Z A;  2KZR A;  4K81 A;  3UF8 A;  1E9M A;  1D5M C;  2WXJ A;  4XGA B;  1V80 A;  1WIA A;  1VZ8 A;  4MGY E;  3PSE B;  1SB3 C;  2C7N B;  1TZ1 A;  2K3U A;  2JU6 X;  2XEW A;  2BBC A;  2LGY A;  2WXI A;  1WYW B;  1ZOY B;  4CO7 A;  1E0Z A;  4N6E B;  3Q3N C;  3Q8E A;  4M0W A;  4LNI A;  2R2O A;  2LFI A;  2JT4 B;  1EF5 A;  3HVD A;  2CS4 A;  4MDK E;  5G55 A;  2ZVN A;  3TSS A;  2H89 B;  1NEN B;  2X8X X;  3NS1 A;  1ZDV A;  4D2K A;  1WXS A;  2OJR A;  2W3R A;  3L0W B;  2FAZ A;  1J7B A;  4B0M A;  1WJU A;  1VZ6 A;  2WXO A;  4ZRI A;  1EWC A;  4IOI E;  4P1C C;  3NG0 A;  4FJZ A;  3AN1 A;  2FCQ A;  1T5X D;  1UNS A;  3FIL A;  2KAJ A;  2W55 A;  3M62 B;  4NAW A;  1L7Y A;  1HZ5 A;  1GJZ A;  1CZP A;  1OQR A;  4W9K A;  2O2V B;  5TR5 A;  4XX5 A;  2D3B A;  4PS8 A;  3E9S A;  3GZN B;  4REZ A;  3SD5 A;  1C79 A;  3B2F A;  1YOV B;  3AEA B;  2KFJ A;  5H92 C;  2Y5C A;  2DEN B;  4FLH A;  3R2I A;  2ZEQ A;  3OWE B;  4GB9 A;  5G2N A;  3ZDM C;  3PHX B;  3MJ5 A;  4MT5 A;  2JVC A;  1TBE A;  4ZDV A;  1WYG A;  4GSW A;  4GOC A;  4II2 B;  3N32 A;  2KD0 A;  4MAC A;  2N7D A;  4LNK A;  2JZ3 B;  1BUI C;  3Q3O C;  2CHW A;  4OW0 A;  5AZF A;  3U30 A;  1QQR A;  3S2A A;  4HEA 1;  2JPH A;  4BKG A;  4JGH B;  2RR9 A;  3C8Y A;  4YT0 B;  4P1B C;  1I4H A;  3Q3M C;  2L76 A;  3H1U A;  1IBX A;  1K50 A;  3RPF C;  1HEZ E;  2XBB C;  1FMA D;  5JXV A;  3FC4 A;  3QIJ A;  1WI0 A;  4BBN C;  3A1Q B;  3NJT A;  3FAH A;  1J7C A;  4ICV A;  5J2R A;  4G50 A;  1YN4 A;  2KQS A;  4DBG A;  1R4M I;  4AS1 A;  2LGI A;  2NTT A;  5CHV C;  4HPL B;  3V05 A;  4NJC A;  1ISN A;  3DHH C;  1BXT A;  1EU4 A;  2WDR B;  3AE1 B;  3VVW B;  3HM6 X;  4EE2 A;  3I3T B;  3HVZ A;  5KHQ A;  1XD3 B;  1NEK B;  2L00 B;  3DVN V;  4C80 A;  3MTN B;  1ZW7 A;  1XF5 L;  1FO4 A;  4ANV A;  4LTU A;  1ET6 A;  3VRA B;  2LAS A;  3GZN I;  2XK5 B;  3RFZ B;  1WXQ A;  2PIA A;  5C2T B;  4YSZ B;  1KOT A;  2SAK A;  2AYO B;  3AMZ A;  1VR9 A;  3IG3 A;  1HZ6 A;  3W1Y A;  3H8H A;  3VTU A;  3IVF A;  5KHO A;  2AX5 A;  1RAX A;  4W9C A;  3HIZ A;  2LRU A;  3V6C B;  5IN7 A;  1P3Q U;  4HWI B;  3QWZ B;  1DYQ A;  2W54 A;  4RGN A;  2MCN B;  4GDL A;  1PGB A;  3QQ8 B;  2KKC A;  4XDC A;  4I6P A;  5CHF A;  2V3P A;  3RUL A;  2JZP A;  3L13 A;  3ZKJ C;  4MGK E;  3NUH B;  3UIO B;  2WXP A;  2GBK A;  4ZYN A;  4JWU C;  2IGG A;  4WWP A;  4GXB A;  2N9E B;  3IAS 1;  5I4D A;  2L05 A;  1UD7 A;  2LJI A;  3UQB A;  1D6E C;  4O1N A;  4WH4 A;  1J19 A;  4JPS A;  2WU5 B;  4LDT D;  2BKR B;  3BYY B;  2AQ2 B;  3DBH I;  5LNK 1;  2N1V A;  3L54 A;  3DBH B;  5TSS A;  3GE3 C;  4H2A A;  3H9D A;  1ESF A;  1X1M A;  2MJ3 A;  3V60 A;  3DBR I;  1GG3 A;  3N30 A;  1UBI A;  1V8C A;  1UZX B;  2M1M A;  3RNF C;  3A9J B;  2DBY A;  3KVF B;  4BFR A;  2K8B A;  1MHX A;  2RSU A;  2ACZ B;  2IDY A;  4ZRQ A;  2J53 A;  1V5T A;  2ON8 A;  1DOX A;  2LVQ A;  3V62 A;  4EZJ A;  3PVL A;  1L4D B;  4DQO C;  3IT6 B;  2I2Y A;  4W9J A;  1P98 A;  4TQ0 A;  4MM3 B;  2NR2 A;  4WJN A;  3O65 B;  1TTN A;  1WY8 A;  3CWI A;  4KZC A;  3ETR A;  2HJ1 A;  1BT0 A;  1UWM A;  4BOS C;  4AP4 C;  3IAM 1;  2MBE A;  3BVZ A;  1WGG A;  3MC8 A;  4XZ4 A;  2GBR A;  3OJ3 A;  3CF6 E;  2JX5 A;  4MEL A;  3P4P B;  3T3O A;  2KWD A;  1HA5 A;  2KOX A;  2UWQ A;  1TYG B;  1RRB A;  3M3J A;  1T6B X;  1E7V A;  2BYE A;  1WR6 E;  1VRA B;  1P0R A;  2DAJ A;  2VH2 A;  4GGQ A;  3QHT A;  1R4N B;  1V49 A;  2IY0 B;  4C7Y A;  4RF1 A;  1FD6 A;  4OZB A;  1UGJ A;  2UYZ B;  2IY1 B;  1GNU A;  4RGM A;  4A20 A;  1WGY A;  3HK0 A;  1V2Y A;  1C4A A;  3KYD D;  1N5W A;  2AEH A;  2ZPY A;  4TMA B;  3EEC A;  3SHQ A;  3DBL B;  3RNC C;  3WAO A;  2LHD A;  1ZXI A;  2PE9 A;  3PZ7 A;  2QIL A;  1I35 A;  1EUV B;  1WFY A;  4WWO A;  3VQI A;  3ZUN A;  2GBN A;  2MJE A;  1NYR A;  2MEK A;  4YTP B;  4TSS A;  5JZE B;  3JW0 X;  1GB1 A;  2CHZ A;  4K7S A;  2NBW B;  2ZPN A;  4A3P A;  2VRR B;  1QOG A;  2ICI A;  3RZF A;  1NI3 A;  2K8C A;  2BTE A;  1N61 A;  1XCQ L;  1V6E A;  4AOF A;  1UWX A;  2V4I B;  4AJW A;  4C7Z A;  3DVN U;  4NPN A;  1IYF A;  3UIP B;  4XE0 A;  2OHF A;  3SU8 X;  3U7D A;  4WQM A;  1H4R A;  3R2T A;  1L2N A;  3BVM A;  3NZU A;  1WX9 A;  1JWA D;  3L4P A;  4HDO A;  4ICU A;  3V6E B;  1F1H A;  1FNU A;  4K7W A;  1V5O A;  2BF8 B;  4A6Q A;  1NVI D;  2N9L A;  5JH5 C;  4WAF A;  1OQY A;  2QSD A;  1OEY A;  1QOB A;  2V3S A;  2N0S B;  4IWP A;  3V61 A;  4I6N B;  2Z0E B;  3ZVV A;  4E3C A;  2MP2 A;  2FE8 A;  3VTV A;  4J6I A;  1IBX B;  1V1P A;  1AYF A;  4NQL B;  3JSV B;  2KTR B;  2IO0 B;  1TY2 A;  4S17 A;  5E6J A;  3SEB A;  3ZTC A;  2N9P C;  3GS2 A;  2K6D B;  1V97 A;  4IM3 A;  3PRZ A;  1WJ4 A;  1TJE A;  3PPA A;  2O6V B;  5DPW A;  3ZDT A;  2K0P A;  1S3S G;  4JIO U;  1S1Q B;  2ZZP B;  2V3N A;  2MBH A;  3PZD A;  2BYV E;  2J0K A;  3VTW A;  3KH0 A;  3EC8 A;  4XC2 A;  2MBQ A;  4M0W B;  3ONS A;  2M0A A;  3P4Q B;  1JWS D;  2BGF A;  3KYC D;  4CHK A;  2KQ4 X;  2A4Z A;  4LLG M;  4MH8 A;  3ZNI D;  5HI1 A;  2ZNV C;  4LDT B;  3O13 A;  2W3S A;  4J3O D;  2ZW1 A;  2MRP A;  2WQY B;  4TUU A;  2BWF A;  2NVU I;  1I4P A;  1E7U A;  2KWU B;  5CTR C;  3TIX A;  1VJK A;  4C4V B;  3HHM A;  1F0Z A;  1WGH A;  4RGO S;  3DBR B;  3H7S A;  1QKZ A;  3R3M A;  1YN5 A;  3J9C A;  2BS3 B;  2AWT A;  1TIF A;  1VLB A;  2BT6 A;  2WXL A;  3VH3 B;  5J18 A;  1SE4 A;  1WE6 A;  2LVO A;  2BYF A;  4KIK A;  2D11 A;  3N3K B;  1PGX A;  2KO3 A;  2PJH A;  1L5P A;  3AEF B;  4NJ6 A;  2KLC A;  3DVG X;  4NNJ B;  2K9X A;  3N1X C;  1L0Y B;  3WIM A;  1ZP0 B;  1SIF A;  1SEB D;  1SJH D;  1FPY A;  1AWD A;  4DXG A;  4WQO B;  3BY4 B;  2KYW A;  4NAM A;  2KLG A;  4BKS A;  2L7R A;  4DDI D;  2PKO A;  1R7S A;  3LDZ E;  2ZCB A;  2M8S A;  2FIF A;  1FCL A;  1LM8 B;  2ZW0 A;  4W9E A;  3VHT C;  2WNM A;  4IM2 A;  4M01 A;  1C3T A;  3WAN A;  4A8X C;  1WGD A;  1V81 A;  3AUL A;  1TGZ B;  2PLP A;  2BS4 B;  1D4B A;  4W9F A;  2D3A A;  1A70 A;  3C0R B;  2G1E A;  4OZA A;  1KFY B;  4WJO A;  2EKE C;  4F1S A;  2K25 A;  1FIQ A;  1YX6 B;  1QOF A;  5D94 A;  2YLM A;  5BYR A;  3AB5 A;  2DHZ A;  4OVZ A;  3ZRF A;  3ZNH B;  1OFF A;  1FNW A;  2R61 A;  1M4V A;  4G11 A;  2RGF A;  3WA0 A;  2WHI A;  1XCT L;  3I9V 1;  2BS2 B;  2CJN A;  3T3N A;  1EM7 A;  3ECI A;  1U4A A;  2KFK B;  3BK1 A;  2N7J A;  1TZO A;  2IGH A;  2N1W A;  4KVG B;  4ARC A;  4K1R B;  3ZYY X;  1V86 A;  1VD2 A;  3KW5 B;  2K5P A;  3ZO5 B;  1WF9 A;  2Z59 B;  4WUR A;  2W9N A;  1E7P B;  3DWG C;  3DBL I;  4LNO A;  1C78 A;  2CU3 A;  2MLB A;  2N9X A;  4EZL A;  4HCP B;  1FFV A;  2VZK D;  2ZCC A;  3HM3 A;  2WXQ A;  4DXF A;  2FBW B;  2OED A;  2RD0 A;  4GDL B;  2LGS A;  3OLM D;  3EUB 2;  4KKI A;  3NVZ A;  1XEE A;  1CMX B;  1WGK A;  4IWO A;  2IJ0 A;  3APC A;  1NBF C;  1G6J A;  4K7U A;  4WWM A;  2K22 A;  2LVP A;  3AV8 A;  2REX A;  3QC8 B;  4PK1 A;  2IO2 B;  1WJ6 A;  5EDS A;  4ASW C;  2IBI B;  2KWC A;  3Q69 A;  1SF0 A;  2V9H A;  4GIV A;  3A9K A;  3IBE A;  3EHV A;  1F52 A;  5IA7 A;  1WX8 A;  1UH6 A;  1KLU D;  4KGS A;  2EEL A;  5D6J B;  5T8I A;  3B1L X;  3DCG A;  3P42 A;  2WWZ A;  1WRI A;  1MG8 A;  3W9C B;  1LXD A;  4BVU C;  3RNE C;  2AL6 A;  1HTO A;  2BW2 A;  1TS2 A;  1WM2 A;  4KX6 B;  1UGM A;  1FFU A;  2HE7 A;  3BIN A;  2L52 A;  1M94 A;  1E8X A;  2N4F A;  2ASQ A;  2QJL A;  1PDX A;  1L0X B;  1Z5S B;  2KDB A;  1QF6 A;  3PLU A;  1GOZ A;  2INP E;  2RDG A;  1RWS A;  2KFK A;  4DXA B;  1LO5 D;  4KKJ A;  1WGR A;  4XWW A;  1FXI A;  2K6Q A;  4NY0 A;  1AAR A;  3MP9 A;  2DZM A;  1SE2 A;  2WXN A;  3OJ4 B;  4ANX A;  1RFA A;  2GBJ A;  3JYU A;  5G5H A;  1V1P B;  1XLN A;  5DPR A;  1D5Z C;  1JCK B;  3IHP C;  3DDC B;  1WX7 A;  2WGS A;  1I4X A;  3URY A;  4A55 A;  2J52 A;  1DOY A;  3DQV A;  5E6N A;  1OQQ A;  2HD5 B;  1SE3 A;  3ZLZ A;  1Q10 A;  1HE8 A;  3PT2 B;  4WJP A;  4BKT A;  2BB6 A;  4X57 B;  3PHW B;  4ANU A;  4IM0 A;  3A4S C;  1C9F A;  2LJ5 A;  3DBS A;  4ANW A;  2KHW B;  3AE3 B;  2C5L C;  1FRR A;  3ZIM A;  4HPP A;  3L10 B;  4W9G A;  4YSY B;  1GC6 A;  1BML C;  1IUE A;  4PS3 A;  2FID A;  1XO3 A;  3L17 A;  3VDZ A;  2KDE B;  1UUP A;  2D5G A;  4AJY B;  3NZS A;  3PO0 A;  4NQK E;  2LI5 A;  5FR6 A;  3VH4 B;  2QMT A;  3LB8 C;  2RMM A;  3ZRC A;  1Q1O A;  3N1Y C;  3Q2A C;  3MFG A;  5FR3 A;  2FUH B;  2KMM A;  1KLG D;  3WCQ A;  1RLF A;  3ZXV A;  1E8W A;  2LZ6 A;  1FRD A;  1KH0 A;  2V1Y A;  2YEP F;  2KTF A;  3BYT B;  3R7Q A;  5LXI B;  3KWV A;  2A5U A;  2D10 A;  1E8Y A;  4HKQ A;  3T8M A;  1C76 A;  1C4P A;  2WXH A;  4BBN F;  1MJD A;  2Z8L A;  4G0N B;  1JWB D;  4IWQ A;  2EMT A;  2LXA A;  1KF6 B;  4HRO A;  3P2B A;  1EO6 A;  3AE7 B;  2GOW A;  3RZW C;  1F2R C;  2BKF A;  1K51 A;  3MC9 A;  4N58 A;  2J0J A;  5EE1 A;  1AW7 A;  2KNB A;  3L16 A;  5IOI A;  3NVV A;  4XDD A;  2JWZ A;  4KGT A;  2DZK A;  2NBU A;  3UIN B;  3OAW A;  3QAR A;  3KUZ A;  4M02 A;  5IKC M;  2RDH A;  5C1Z A;  2WLB A;  4C00 A;  4GU2 A;  4JQW C;  5DPS A;  2QC8 A;  2N7E A;  2RDB C;  2WX1 A;  2JYE A;  1CJE A;  1L6U A;  2ZJD A;  4F7Z A;  2LRW A;  4EEW A;  2NTS A;  4CQN A;  4EFO A;  5AZG A;  5EE0 A;  4WAA A;  2M17 A;  1KJT A;  2IO3 B;  3BK2 A;  1F2R I;  3SFD B;  1MG4 A;  5DPT A;  3CST A;  4HKZ E;  1TKY A;  3KUC B;  5BYQ A;  2KMA A;  4E74 A;  1MVK A;  3VRB B;  4FN2 A;  4F8C B;  2XK5 A;  3VUW A;  3CMM B;  3PRP B;  2AL3 A;  2V4L A;  2KMC A;  2N9K A;  5HHD G;  2WXF A;  4HLE A;  4ITK A;  3TL5 A;  1ET9 A;  3K9O B;  2GBM A;  1FEH A;  1ZKH A;  4YXD B;  2EMS A;  1Q0W B;  2VZK B;  1T0Q C;  3ML8 A;  4LNF A;  1L0V B;  4BKS D;  2MX2 A;  1JWM D;  2FCM A;  1JRP A;  4CYE A;  3TEX A;  5HFY A;  1SBB B;  1MFW A;  2QCZ A;  2HJ8 A;  5BMI A;  1MPE A;  1OGW A;  1WH3 A;  4B95 A;  5HKH A;  4AQ7 A;  2WDT B;  4B6W A;  2QIE B;  2L32 A;  4KGR A;  3E56 A;  3NHE B;  1PGA A;  1Y8R C;  1MHH E;  3MC0 B;  4HPM B;  2DWQ A;  4HJG E;  2KC1 A;  4FJY A;  1FXA A;  1N5X A;  3ZQ4 A;  4MJS B;  1E5W A;  5BMG A;  1QT9 A; 
#chains in the Genus database with same CATH homology
 1BXT A;  1EU4 A;  2WDR B;  3AE1 B;  3SFE B;  4NAM A;  3TEZ A;  4EE2 A;  3HVZ A;  1SXT A;  1F77 A;  1NEK B;  1R7S A;  2PKO A;  3Q8F A;  4C80 A;  2INN E;  4UDU C;  2BYT A;  3AM9 A;  1FCL A;  3SR6 A;  1XF5 L;  1HQR D;  2DYO A;  1P7E A;  2ZW0 A;  2E3T A;  1FO4 A;  4LTU A;  4TQ1 A;  1ET6 A;  2LEK A;  2Y3A A;  3VRA B;  2WNM A;  3RFZ B;  1WXQ A;  3GP7 A;  4N59 A;  2PIA A;  5C2T B;  1FNV A;  1ZUD 2;  2BB5 A;  4YSZ B;  3AE9 B;  4A8X C;  5D3I B;  2SAK A;  4WIP A;  3R8B A;  1TS5 A;  2X38 A;  3AMZ A;  1VR9 A;  1NYQ A;  2MH7 A;  2PLP A;  1HZ6 A;  3KLS X;  2BS4 B;  4YSX B;  3H8H A;  1HXY D;  1D4B A;  5G5G A;  1A70 A;  1ROE A;  2G1E A;  2KAC A;  2Y5P A;  4OZA A;  1RYJ A;  1YMH E;  2AX5 A;  3Q8C A;  1N63 A;  1KFY B;  3KWL A;  3VR8 B;  1RM6 C;  3HUI A;  4RH6 A;  1ZDX A;  1DYQ A;  2W54 A;  4RGN A;  1FIQ A;  4A90 A;  2IPK D;  2LUM A;  3I57 A;  3UI3 A;  4B0E A;  1PGB A;  4XDC A;  2CJO A;  2V3P A;  1QOF A;  4RNA A;  5BYR A;  3NZ3 A;  3AB5 A;  2JZP A;  4OVZ A;  2J4X A;  1OFF A;  5BMH A;  1FNW A;  2R61 A;  1M4V A;  3NUH B;  2WXP A;  1XCT L;  2PTL A;  3I9V 1;  2AQ3 B;  1JML A;  4JWU C;  1I4G A;  2IGG A;  5H8Y E;  2BS2 B;  2CJN A;  3T3N A;  1EM7 A;  3AE4 B;  3PZ8 A;  3BK1 A;  4A9A A;  2N7J A;  1TZO A;  2IGH A;  3IAS 1;  5I4D A;  3U7Z A;  4ARC A;  3ZYY X;  1XLP A;  4GLS C;  2LJI A;  4JX1 C;  2V0G A;  1D6E C;  4O1N A;  2K5P A;  1ZXH A;  3IXS A;  4WH4 A;  1L6V A;  2LMC A;  5BYS A;  5EE9 A;  1N62 A;  4WUR A;  4ZHO A;  1RFK A;  1IGC A;  1E7P B;  3AE2 B;  2XN9 C;  3DWG C;  2WU5 B;  4JPS A;  3BWU D;  4USA A;  1C78 A;  2CU3 A;  1MI0 A;  2KDM A;  3BYY B;  3GB1 A;  1FFV A;  2AQ2 B;  1FM0 D;  2JQR B;  2VZK D;  5FK9 C;  5LNK 1;  2WDV B;  5AUK A;  3NVW A;  5TSS A;  2WXQ A;  4DXF A;  2FBW B;  4ZHP A;  1EWY C;  5MPO A;  4H2A A;  2OED A;  2Q5W D;  2YEP B;  1ESF A;  3AEC B;  3W2D A;  2MJ3 A;  4GDL B;  1YJJ A;  1PYW D;  1V8C A;  3ZJV A;  3EUB 2;  4KKI A;  3NVZ A;  4YTN B;  1K53 A;  1XEE A;  2DBY A;  1WGK A;  2XNA C;  2W82 A;  2IJ0 A;  1MHX A;  2ACZ B;  2PMV A;  4WWM A;  2IDY A;  2K22 A;  4ZRQ A;  2J53 A;  3AV8 A;  1JQ4 A;  1E6E B;  1XLQ A;  2ON8 A;  1DOX A;  1TY0 A;  3IT4 B;  1JWU D;  2AQ1 B;  4IDI A;  2PVO D;  3Q69 A;  1SF0 A;  2WXR A;  1L4D B;  4DQO C;  3IT6 B;  2I2Y A;  5AUI A;  4YTM B;  4TQ0 A;  4MM3 B;  1GB4 A;  1YN3 A;  4KGS A;  1KLU D;  3AE6 B;  3CWI A;  3ETR A;  2IGD A;  1YNT E;  2EEL A;  1J7A A;  5T8I A;  2PVG C;  1UWM A;  3B9J A;  3P42 A;  1WRI A;  2M56 B;  3IAM 1;  3W9C B;  3P63 A;  3BVZ A;  3BII D;  3V3X A;  2BW2 A;  1TS2 A;  4KX6 B;  2JX5 A;  2QEJ C;  1SJE D;  3P4P B;  2EKI A;  3T3O A;  1FFU A;  2KWD A;  2SEB D;  1HA5 A;  1TYG B;  2L52 A;  2L83 A;  1T6B X;  2QJL A;  1ACC A;  1PDX A;  1L0X B;  3TUO A;  1VRA B;  1QF6 A;  2L1A A;  1GPX A;  1GOZ A;  2GRI A;  1WWT A;  2INP E;  3FIL B;  2RDG A;  1RWS A;  1LO5 D;  4KKJ A;  4HRS A;  4PT5 A;  4XWW A;  1FXI A;  4C7Y A;  1KRH A;  4RF1 A;  4C56 C;  4L2Y A;  3HRD D;  1FD6 A;  4OZB A;  3MP9 A;  1SE2 A;  2WXN A;  1PFD A;  1UGJ A;  3ZGZ A;  4RGM A;  5G5H A;  1V1P B;  1XLN A;  1C4A A;  3U2S C;  1D5Z C;  1JCK B;  1N5W A;  5C3J B;  2J42 A;  4TMA B;  1K52 A;  2RPV A;  2WU2 B;  3W5V B;  3KQ4 A;  3P4S B;  3DWM A;  1I4X A;  3URY A;  4A55 A;  2J52 A;  2LHD A;  3AEE B;  4ARI A;  2WS3 B;  1ZXI A;  3AED B;  3PZ7 A;  1DOY A;  2QIL A;  2HDE A;  1L4Z B;  3VQI A;  1OQQ A;  1SE3 A;  1Q10 A;  3P1M A;  1XLO A;  5HG2 A;  3AEG B;  3U52 E;  1V1O A;  4NAW B;  2MJE A;  2MEK A;  1NYR A;  2BB6 A;  4Q2J A;  2PW9 A;  4YTP B;  4TSS A;  2WXM A;  1YQ3 B;  3AE8 B;  4P6V F;  4RCO A;  1GB1 A;  1YJI A;  3BZD B;  5D7G A;  1C9F A;  1DOI A;  3P4R B;  2DYM A;  3LXF A;  3TEY A;  1QOG A;  3AE3 B;  3EA6 A;  2G9H D;  1TKG A;  2ICI A;  1FRR A;  1NI3 A;  1XXG A;  1DGJ A;  5FKA C;  2M19 A;  2BTE A;  1N61 A;  1XCQ L;  1I4Q A;  4YWG G;  1UWX A;  2V4I B;  1KTK A;  2TSS A;  4YSY B;  2E6X A;  4C7Z A;  5EE3 A;  2JXT A;  1BML C;  1IUE A;  1T3Q A;  1SIJ A;  2WP9 B;  3ABV B;  1XO3 A;  4XE0 A;  1UUP A;  4ZOH C;  3TEW A;  2D5G A;  2OHF A;  3B2G A;  3PO0 A;  4WQM A;  1EU3 A;  4OHJ A;  3R2T A;  2B76 B;  2JSV X;  3BVM A;  2H88 B;  4LK0 M;  4P16 A;  1E10 A;  1Y56 A;  4US8 A;  2QMT A;  3AEB B;  1JWA D;  3LB8 C;  3L4P A;  2RMM A;  2JWU A;  3NVY A;  3Q8A A;  1FNU A;  2MJD A;  1QIL A;  4A6Q A;  1NVI D;  2LHE A;  2GB1 A;  2N9L A;  3AH7 A;  4JWS C;  2WXG A;  3MFG A;  4GDK B;  4WAF A;  5FR3 A;  3MHZ A;  1JRO A;  2KMM A;  1KLG D;  2HTM E;  3LYY A;  3WCQ A;  3Q8B A;  2QSD A;  1GAQ B;  1FRD A;  2DLB A;  1P7F A;  1KH0 A;  1E9M A;  1D5M C;  1QOB A;  2WXJ A;  2YEP F;  3BYT B;  1VZ8 A;  3KWV A;  5D3D A;  2N0S B;  4HKQ A;  2JYT A;  1ENF A;  1C76 A;  1SB3 C;  1C4P A;  2FE8 A;  2K3U A;  2JU6 X;  2WXH A;  2BBC A;  1I7H A;  1IBX B;  1V1P A;  1AYF A;  2Z8L A;  2WXI A;  2WDQ B;  1JWB D;  1ZOY B;  1E0Z A;  4N6E B;  1KF6 B;  1TY2 A;  4HRO A;  3Q8E A;  5E6J A;  4M0W A;  3SEB A;  2LFI A;  4JE3 B;  3EGR A;  3GS2 A;  3HVD A;  3AE7 B;  1C77 A;  1CQV A;  1F2R C;  3TSS A;  2H89 B;  1V97 A;  1K51 A;  1NEN B;  4N58 A;  5EE1 A;  1AW7 A;  3BVG A;  3NS1 A;  4ZYS A;  1TKE A;  1TJE A;  1ZDV A;  2ONQ A;  4L1B A;  3NVV A;  4XDD A;  4D2K A;  4KGT A;  2W3R A;  1J7B A;  4B0M A;  2K0P A;  1VZ6 A;  2WXO A;  1TS3 A;  1EWC A;  4IKG A;  4IOI E;  2RDH A;  2WLB A;  3ZJU A;  2V3N A;  3N9Y C;  1STE A;  3ZJT A;  3AN1 A;  1T5X D;  1UNS A;  3FIL A;  1QOA A;  2KAJ A;  2W55 A;  1TS4 A;  2JYE A;  4US9 A;  2M0A A;  1CJE A;  1WSP A;  1HZ5 A;  1L6U A;  3AE5 B;  3P4Q B;  1JWS D;  3W5U B;  1VZ7 A;  1CZP A;  1OQR A;  4RFB A;  2KQ4 X;  1ZE3 D;  2NTS A;  4LLG M;  4CQN A;  4MH8 A;  3E9S A;  5HI1 A;  5EE0 A;  1PUT A;  2FUG 1;  3O13 A;  4XWT A;  2W3S A;  2WXK A;  2NMQ A;  4REZ A;  1C79 A;  3B2F A;  1IGD A;  4J3O D;  1CK1 A;  1F2R I;  3BK2 A;  3SFD B;  4OZC A;  1VDV A;  2ZW1 A;  1JW9 D;  2WQY B;  4HKZ E;  3NRZ A;  1JAL A;  3AEA B;  1SSN A;  1I4P A;  1TKY A;  5H92 C;  5BYQ A;  2Y5C A;  1QLB B;  1AN8 A;  1MVK A;  3R2I A;  3OWE B;  1VJK A;  3VRB B;  3MJ5 A;  4MT5 A;  1F0Z A;  1C4C A;  1WYG A;  4RGO S;  1I4R A;  4RGT A;  1QKZ A;  1D5X C;  1FCC C;  4MAC A;  4ZRP A;  1YN5 A;  2N9K A;  5HHD G;  3J9C A;  4RF0 A;  1BUI C;  2WXF A;  4ITK A;  2BS3 B;  2KN4 A;  1ET9 A;  4OW0 A;  3U4E G;  1QQR A;  1VLB A;  4HEA 1;  1FEH A;  2BT6 A;  4YXD B;  2WXL A;  2VZK B;  3C8Y A;  4NZL B;  4YT0 B;  3CIR B;  1YQ4 B;  1I4H A;  1L0V B;  1SE4 A;  1JWM D;  1JRP A;  2GI9 A;  1B1Z A;  3TEX A;  5HFY A;  1SBB B;  1ZPS A;  1PGX A;  3VR9 B;  1IBX A;  1K50 A;  3RPF C;  1HEZ E;  1FMA D;  5GXG B;  5BMI A;  5JXV A;  1MPE A;  3FC4 A;  4FXC A;  1B9R A;  4AQ7 A;  3FAH A;  1J7C A;  1L5P A;  3AEF B;  3W1S A;  2QIE B;  2L32 A;  4L23 A;  1YN4 A;  4KGR A;  3E56 A;  2K9X A;  1PGA A;  4AS1 A;  2LGI A;  1MHH E;  2I38 A;  2NTT A;  3MC0 B;  1L0Y B;  2DWQ A;  1N60 A;  1ZP0 B;  4HJG E;  1FXA A;  3V05 A;  1N5X A;  1SEB D;  3ZQ4 A;  1SJH D;  4NJC A;  4R3D A;  1AWD A;  4DXG A;  5BMG A;  1QT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...