2BWFA

Crystal sturcture of the ubl domain of dsk2 from s. cerevisiae
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
LDMSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLVKSQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Dsk2 Ubl and Uba Domains and Their Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords UBIQUITIN-LIKE PROTEIN DSK2
total genus 20
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2bwfA00
2D2QA 1GNUA 4LJPB 4KSKC 3ZNGC 1D3ZA 4BBNF 3U7DA 1WJUA 3APFA 4ZRKA 3TMPB 2KNBA 3PHXB 2KLGA 1LXDA 3A9KA 5TR5A 3KW5B 2JF5A 3A9JA 3HM6X 4GDLB 3NS8A 4URKA 2ZZPB 4M8MA 1LFDA 2L76A 2DYBA 3EECA 1P9DU 4W9EA 4DHJD 1V6EA 3A1QB 5KHOA 1E8YA 2PPHA 3MTNB 2KC1A 2HD5B 3VH3B 3VTUA 3WALA 2NCNA 3MHSD 4NJ7A 4LDTD 2VRRB 1UZXB 3ZW3A 4MGIE 1KOTA 2DX5B 1P0RA 4W9KA 4IWQA 3QX1A 3QAQA 1H4RA 2N1WA 4G0NB 4F1SA 5JHBA 1WF9A 3GZNI 3IFWB 3B0AA 1KJTA 3PT2B 3PV1A 3UF8A 2ZPYA 2KD0A 4BKSA 1WJNA 2V1YA 1GC6A 3R66C 4DDID 3L0WB 4MSMB 3A9JB 2WX1A 4FA6A 2JUOA 4MH0E 4TQ1A 4IUMB 4A3OA 1V9JA 1WXVA 2BYVE 4NAWB 1Y8RC 2BWFA 3ZTCA 2KFKA 1J0GA 4IM0A 4WWOA 4DK5A 2IO1B 1P98A 2DAJA 1EF5A 1V86A 4MDKE 4EZJA 3PSEB 4MJSB 1V2YA 3APCA 3NZUA 1LM8B 2AEHA 3PPAA 2J7QB 2N4FA 4GGQA 5LLIA 4W9GA 1WGYA 3X0WA 3KUCB 2GBKA 1RAXA 3DDCB 3ZDMC 4GB9A 3LDZE 4MGZE 1RRBA 3QWZB 3R7RA 2KTRA 3A33B 4HPMB 4IG7B 5AZHA 4BKSD 4NNJB 4MEMA 4ZRJA 5HKHA 4HCPB 4W9LA 2MBHA 2IY0B 4HPLB 2J0JA 1C3TA 1H8CA 1TTNA 2DZIA 3H7SA 3ML9A 2MWSB 5C23A 1RFAA 3OLMD 4EFOA 1WMHA 4JQWC 3A4RA 2NPTA 1WR6E 5DPSA 2L7RA 1XT9B 4MM3A 3DVNV 4X57B 1EO6A 3DVNU 1MG8A 2D10A 5DPTA 3B1LX 2MBEA 2D07B 5D6JB 4IWPA 1WFYA 2KFKB 4XC2A 3WA0A 2FCNA 1Q5WB 5L83A 1YIWA 4GDLA 2NPTB 2MX2A 1GUAB 3Q3JA 5LXHA 3ECIA 4JL9A 3SD5A 2O2VA 1E7VA 4WWPA 1WGDA 3L10B 4ICVA 4A20A 4DDGD 2J0KA 3CMMB 2LVOA 2LVQA 3PVLA 2JVCA 2G4SA 1XQQA 2C9WB 3HIZA 2BF8B 3DVGY 4LCDE 3RCZA 2MW5A 4OVVA 2HTHA 3CSTA 2XBBC 4DWFA 2C5LC 1UH6A 2CU1A 1VD2A 2KDFB 5KHQA 2FCSA 4ZYNA 2YVCA 2LJ5A 3A4SC 2FIFA 2LWPA 2V4LA 3KYDD 5CHVC 2FUHB 3NY5A 1LQBA 4KSLC 2GMIC 3B08A 1EF1A 1UELA 2Z0DB 3W1SC 2L0FA 2NBVB 1YX5B 2K39A 3QC8B 3ZVVA 3AXCA 3AI5A 2MCNB 3RUIB 1X1MA 4AP4C 2KQSA 3MJWA 4KZ0A 1SE9A 1IP9A 3UQBA 3VUXA 4MJSA 1YX6B 3PLVA 2BKFA 4AJYB 2K8BA 1WXAA 4WJQA 2KC2A 3RT3B 1WIAA 4ANXA 2IYDB 3QK0A 2IBIB 2B3AA 4MGYE 3UGBB 3JVZX 2BKRB 1WM2A 2JT4B 2LD9A 1HE8A 1C1YB 4PS7A 3RZWC 3M62B 3ZNID 4ZRIA 3VXWA 2WX0A 3D32A 3QARA 1GC7A 3IBEA 2N9XA 3V61A 2RR9A 1YQBA 2GBMA 3O65B 4NJ6A 4RMAA 3VUYA 2KWVB 2MBQA 2C60A 1NI2A 4HJKA 3A9KB 3RZFA 2KJRA 3X23A 3K9PB 4FJYA 3ZNZB 2C7MB 2KMCA 1R4MI 2LZ6A 2MBOA 2KOXA 3VTVA 4EKUA 4TUUA 2DZJA 2KANA 3CSFA 3U30A 3QA8A 4GOCA 4YL8A 3WANA 4HCNB 4PYUA 1J19A 1V81A 3W1SA 3ZNHB 3L08A 2KTRB 4E3CA 4GDKA 2RGFA 3EC8A 2XK5B 1G6JA 4MELA 4RM8A 2Z0EB 3UIOB 3S2AA 3AULA 2ZNVB 4JLCA 3H6NA 3V62A 3VTWA 4BOZB 2MLBA 2L00B 4NPNA 2GOWA 1WR1A 4WJPA 2KX3A 1GG3A 1R4NI 4K7SA 1WMHB 2M0XA 3R7QA 4AOFA 5DPWA 3QHTA 2CHZA 4FHKA 5J18A 4BFRA 5J17A 4FADA 3VDZA 2I1JA 2JY6A 2G3QB 4FJVB 1WE6A 2KDEB 2KK8A 2LGYA 2Y5BB 3GOEA 1V80A 2N7EA 3IHPC 5D2MB 4DHZE 3CF6E 2G45B 2JWZA 1EUVB 1V49A 3V60A 3PS6A 2KMAA 4EOYA 2KO3A 4DXAB 3PRZA 2N9EB 3TJPA 2RD0A 3P2BA 3L17A 2MBBB 3L54A 3I3TB 2PE9A 3NHEB 4ANWA 4I6NB 1KM7A 1WJ4A 2G4DB 4I6PA 4I6LB 5CHWA 5IAAC 4BBNC 5JH5C 4FULA 1WJ6A 3M95A 3QCAA 4GDKB 2LASA 5BO4B 2DHZA 2IY1B 3ZIMA 1SIFA 1WXSA 3AU4A 3DBLI 1WE7A 3UQAA 3KUZA 4JIOU 1AARA 2M4NA 1UBIA 4GSWA 4N9F4 3ZUNA 1FXTB 4DBGA 4DHJB 3AU5A 1OEYA 3QIJA 2KQ7A 3OAWA 3DQVA 3ZRCA 1E90A 3KUDB 4NY0A 2KLCA 2KXJA 2I1KA 2QHOA 2ZJDA 3A1QA 4W9IA 2O6VA 4HXDA 2BYFA 2ZVNA 4IWOA 1S3SG 2BYEA 2O6VD 1S1QB 3HM3A 3KYCD 4BVUC 2MP2B 2GBRA 3H7PB 2MP2A 1E7UA 1WXMA 3V6CB 3UIPB 1NDDA 4G11A 2ZCCA 3OJ4B 2CR5A 2KVRA 2MA9B 2KWUB 4HK2A 1CMXB 1OQYA 3DOWA 3JSVA 2IZVB 2CHWA 3JSVB 2J0MA 2K6DB 4NQKE 1WX9A 4NQLB 2KTFA 1OEYJ 2DAFA 1UD7A 2JZZA 4IM2A 4TKNA 4FJZA 5GMVA 1QZEA 3KH0A 5E6OA 3ZRFA 4K1RB 3ZO5B 3BINA 1ISNA 5IA7A 2BGFA 2NS5A 4W9CA 3PRMB 2N7DA 1WRDB 4W9JA 1IPGA 2FCMA 3W1YA 1I35A 3N3KB 2NBWB 3VAWA 1SGHA 4ANUA 1E8ZA 4J6IA 3U8ZA 1WI0A 1OTRB 2LXAA 2UWQA 3DCGA 3KVFB 4E74A 3PTFC 4A3PA 5CHFA 1BT0A 5L95C 1WGHA 2WDTB 4GU2A 1J8CA 3SDLC 5LXIB 1L2NA 2DENB 3WAPA 3EFUA 4EEWA 1TZ1A 1RLFA 2C7HA 2IO2B 2BPSA 4WQOB 4CHKA 2N1VA 2M1MA 3IVFA 2MSED 1T0YA 4FN2A 4PS3A 3WAOA 2AWTA 3PGEA 4HDOA 2GBJA 3IG3A 3N30A 4MGKE 4IW0A 1ZW7A 2ZCBA 4LJOB 2NR2A 4KV2A 1TGZB 2R2OA 4LDTB 4AJWA 1F9JA 3ENEA 5C1ZA 1P3QU 2FAZA 4CO7A 3M63B 1PQSA 2KJHB 1V5TA 4PS8A 4IC7B 2IO3B 2L3ZA 4GIVA 1VCBA 3VH4B 4F7ZA 2OJRA 3T8MA 3HK0A 4ANVA 4FBJB 3QQ8B 4HVBA 4E71A 5EDSA 3K9OB 3PZDA 4GMVA 3H1UA 3DVGX 1XD3B 4K81A 4EZLA 1L7YA 3VVWB 3HHMA 4II2B 2KWCA 4M0WB 1KLVA 2IO0B 2JRHA 3PRPB 2KJ6A 2AL6A 4KVGB 2Z59B 3ML8A 4XX5A 2K25A 2L8JA 2D3GA 2REXA 1WX8A 3LJ3A 2ZVOA 2LXCA 1YD8U 2O6VB 2MRPA 3NOBA 4JGHB 4KIKA 2A4ZA 1WY8A 2PE6B 2D11A 5J2RA 2DYMA 3TIXA 4BOSC 3ALBA 4EZKA 3R3MA 1JRUA 3VQIA 1E5WA 4BKGA 4EUTA 4B6WA 2JZ3B 4OVUA 1V5OA 5DCNA 2OOBB 2N9PC 3APDA 2LRWA 2CKHB 4G50A 3WAMA 4ZDVA 3PREA 4KDIC 2LUEA 4W9DA 3SHQA 4B9KA 3M3JA 1GJZA 3DBRI 3VUWA 4BKTA 4HLEA 2V3SA 5FR6A 1WGGA 1WYWB 4FLHA 3VHTC 3VFKA 3TL5A 1Q1OA 2K6QA 2JXXA 2RPQA 4GXBA 2M8SA 1WX7A 2C7NB 1YJ1A 5CTRC 3WIMA 2DYOA 3ZKJC 2R2QA 4WAAA 4AUQC 4KZCA 4P7IA 3TBLD 4FHJA 4PYZA 2ASQA 5DPRA 3H9DA 3TCAA 2DZKA 4WJOA 4M8NA 1WH3A 2EKEC 2LGXA 3OJ3A 2HJ8A 4KIKB 5CX3A 4B95A 4F8CB 5AZGA 3ZDTA 3L13A 1WZ3A 2K1FA 3N32A 3QJZA 4II3B 3SU8X 2GBNA 4HWIB 3JW0X 3ZTDA 2PEAA 2AYOB 2XK5A 2WWZA 2NBUA 3H7PA 2LI5A 2YLMA 2AL3A 2L0TA 2A5UA 3Q3FA 3RULA 2NVUI 2FNJB 2JPHA 2BWES 3NZSA 1OGWA 1ZKHA 4RM9A 2KDIA 2WYQA 3RD2A 2EMTA 3DPDA 1UGMA 3EHVA 1E8WA 3JYUA 2L05A 3UINB 2CS4A 1K8RB 2M17A 2HE7A 2ZNVC 2LVPA 2ZEQA 2JRIB 1NBFC 4KDLB 4K7WA 4MSQB 1I42A 5G55A 3PHWB 3L16A 2RSUA 2FCQA 4WWNA 2EMSA 5E6PA 3T9LA 2KHWB 4TQ0A 3DBHI 2O2VB 3ZLZA 1WM3A 1ZGUB 3BY4B 4WJNA 4W9FA 2W9NA 2LGDA 1E8XA 4HDQA 1Z2MA 4K7UA 4XZ4A 1U4AA 2K8CA 2KDBA 3DBSA 4AWJA 1TBEA 2PJHA 4ASWC 3V6EB 1M94A 3ONSA 2KX0A 1A5RA 2XEWA 1WGRA 2UYZB 4NAWA 1P1AA 2ZPNA 4W9HA 5D94A 5AEKB 4ICUA 5JHAA 2MQJA 4CYEA 1WZ0A 1Z5SB 2KN5A 4DHZB 2KFJA 2LRUA 2DZMA 5D7GA 5E6NA 2CHXA 3RYTA 5AZFA 2FIDA 2KZRA 1UBQA 4TV3A 1Q0WB 2K8HA 3C0RB 4G3XB 4GN1A 3PLUA 4IM3A 5G2NA 5JZEB 2KKCA 1IYFA
chains in the Genus database with same CATH superfamily
1GNUA 4LJPB 3ZNGC 1TJEA 3APFA 1KFYB 5D3DA 2KLGA 3AEFB 2JF5A 3A9JA 3HM6X 3VR8B 4DXGA 1RYJA 4M8MA 2QSDA 2DYBA 2INNE 2R61A 3EECA 4XDCA 2MJDA 2VH2A 2PPHA 2HD5B 3VTUA 2OJWA 3WALA 4RGTA 3ZW3A 1UGJA 1FRDA 4NAMA 4WAFA 2N1WA 1I4RA 5IKCM 2KD0A 4RGNA 4RGOS 1MVKA 2HDEA 2WX1A 1JRPA 2WXGA 1V9JA 2BYVE 3ZTCA 2KFKA 3SR6A 3MHZA 4MDKE 1NYQA 1SSNA 1V2YA 2AEHA 3PPAA 2J7QB 4W9GA 2VZKD 3DDCB 4MGZE 2JSVX 2K5PA 4IG7B 4BKSD 4NNJB 4ZRJA 2IY0B 4HPLB 5C23A 4ZYSA 1L0YB 4MM3A 3DVNV 2KAJA 1MG8A 3Q8FA 5DPTA 2D07B 3L4PA 2J53A 4XC2A 3WA0A 3EFCA 1WYGA 1T3QA 1SJHD 5LXHA 4L23A 1ZPSA 4JL9A 1EM7A 4WWPA 4A20A 2M19A 3HIZA 4EE2A 4DWFA 1UH6A 2CU1A 2YVCA 4C56C 3A4SC 1A70A 2LWPA 5CHVC 2NTTA 2INPE 2TSSA 3NY5A 1LQBA 2JWUA 1WSPA 2K3UA 2Z0DB 2L0FA 2NBVB 3ZVVA 3RNBC 1MPEA 4AP4C 1ACCA 1VZ6A 3Q6BA 4MJSA 3DBHB 3DWGC 4WJQA 2KC2A 5FR3A 4ANXA 3QK0A 3JVZX 2BKRB 4HKZE 1WM2A 2LD9A 1FRRA 1M4VA 3PZ7A 3W5VB 1VR9A 2RR9A 3O65B 2WS3B 3VUYA 3BVGA 2H88B 2C7MB 2MBOA 4EKUA 2DZJA 1N5WA 1Q10A 4GOCA 3WANA 4HCNB 4PYUA 1CK1A 3W1SA 3ZNHB 2RGFA 3BZDB 3V62A 1SE4A 4JLCA 2ZNVB 3VTWA 3H6NA 2MLBA 4NPNA 2IGGA 4WJPA 3CIRB 4AOFA 3QHTA 2CHZA 3LXFA 4FADA 3VDZA 1XF5L 1WE6A 4USAA 4OZAA 2Y5BB 1OQRA 1R7SA 1EUVB 1V49A 1QOGA 1ESFA 2PIAA 3L17A 4ANWA 1WJ4A 3U52E 4K3BA 1XCQL 3QCAA 4OHJA 2NMQA 3Q8AA 2PKOA 4JIOU 1UBIA 4DBGA 1FXTB 4YT0B 2INCC 3DQVA 1E90A 3KUDB 3R8BA 2AX5A 1T0RC 2ICIA 3HM3A 3AH7A 2WXPA 1E7UA 3UI3A 1MG4A 1WXMA 2IGDA 4G11A 2ZCCA 1D4BA 3OJ4B 2WHIA 1CMXB 3DOWA 1J7CA 3AEAB 2J52A 1QT9A 5FK9C 4ITKA 2JZZA 4LK0M 2KDMA 4M02A 2IJ0A 3Q3MC 3ZRFA 4K1RB 2BGFA 5H92C 1YQ4B 5HG2A 1J7BA 3N1ZC 2J42A 1FM0D 2NS5A 3IAM1 1ZDVA 2DLBA 3AMZA 1WRDB 2G9HD 1PFDA 1E8ZA 2LXAA 3GB1A 3KVFB 2N9KA 3PTFC 2G1EA 1BT0A 5LXIB 1HXYD 1L2NA 3KLSX 1VRAB 2OEDA 2LJIA 1FNWA 4LNIA 2M1MA 4B0EA 1LO5D 4US9A 3ZQ4A 2AWTA 2OHFA 3HVDA 3FILA 1PGAA 4MH8A 4MGKE 4IW0A 2BT6A 2PTLA 3E9SA 1F9JA 5C1ZA 1P3QU 2LMCA 1V5TA 4YTPB 4IC7B 4PT5A 2QILA 4A8XC 2IO3B 3GZNB 2WXKA 2WXFA 1CQVA 3FKYA 1NENB 1VCBA 2W3SA 1HEZE 4K81A 2QIEB 3PRPB 2KJ6A 2AL6A 1WRIA 4XX5A 2K25A 1UUPA 2ONQA 1WX8A 3LJ3A 1JMLA 3BVMA 2O6VB 4JGHB 2KQ4X 2PE6B 1I4HA 3VQIA 4XYCA 3BYYB 4YSZB 2WXNA 1FMAD 4W9DA 2LUEA 1GJZA 1SBBB 3DBRI 1FFVA 2W3RA 1PDXA 2VZKB 1WYWB 4XGAB 1TYGB 1WX7A 5CTRC 1YJ1A 2R2QA 3C8YA 4P7IA 3TBLD 4FHJA 5DPRA 1C79A 3DHHC 4M8NA 3OJ3A 4F8CB 4KIKB 5CX3A 1KRHA 1WZ3A 1P7FA 3SU8X 4HWIB 1IGCA 2ACZB 2BS4B 3JW0X 1XLOA 3ZTDA 3Q3FA 2PVOD 3IT6B 1SF0A 5HI1A 4HJGE 5BMGA 1E6EB 1ZKHA 3Q8EA 3AE3B 4ARIA 3VRAB 3UINB 2M17A 2ZEQA 4KDLB 3AE4B 1C78A 1I42A 2RSUA 4TSSA 1I4QA 3ZLZA 3BY4B 1OQQA 3RNGC 4WIPA 4HKQA 1E8XA 1Z2MA 4XZ4A 1ZXIA 2PJHA 1GB4A 2XEWA 2UYZB 1VJKA 4NAWA 1P1AA 5AEKB 1IYFA 4CYEA 2LRUA 4A9AA 4P6VF 5AZFA 1UBQA 1Q0WB 3I5JC 3AV8A 1L4ZB 2D2QA 4KSKC 1WJUA 4ZRKA 2KNBA 3A9KA 4GDLB 3NS8A 4URKA 2ZZPB 1V8CA 1LFDA 1ZP0B 5I4DA 2XN9C 2Y5CA 4ZRQA 5EE9A 3A1QB 4NJCA 2Z8LA 2E6XA 2FUG1 4NJ7A 4LDTD 1FXIA 1UZXB 2E3TA 1P0RA 1H4RA 4G0NB 5JHBA 4KGSA 1XEEA 3GZNI 2RPVA 2ZPYA 3I63C 1WJNA 5T8IA 4DDID 2RDBC 3A9JB 5G5HA 1F77A 4FA6A 3MFGA 4C7YA 2AQ2B 2RDGA 4WH4A 5EE0A 1J0GA 4IM0A 3Q69A 4DK5A 1EF5A 4EZJA 3APCA 5LLIA 3X0WA 2N4FA 1WGYA 1TKGA 4GB9A 3LDZE 2WXQA 2KTRA 4KGTA 4H2AA 3A33B 4UDUC 1XLPA 2DBYA 3VR9B 1TTNA 2DZIA 1YJJA 2MWSB 3Q8BA 2W82A 3OLMD 3W2DA 4JQWC 3A4RA 1NEKB 1WR6E 2L7RA 4X57B 2QCZA 3DVNU 4QAYA 3AE1B 2MBEA 1YJIA 3Q3NC 4FXCA 5AUKA 1EWYC 3IXSA 1Q5WB 1NYRA 1RWSA 4GDLA 3SD5A 2WXJA 2WXHA 3L10B 1QOBA 1T0QC 3CMMB 3PVLA 2G4SA 2BW2A 1IBXA 2MW5A 2LJ5A 3AEEB 1VLBA 2WU2B 1UELA 2UU7A 5C3JB 2L83A 1YN4A 1WXAA 5GXGB 1WIAA 2IYDB 3PO0A 3N9YC 4MGYE 4A6QA 2NTSA 4LNKA 2JT4B 1T6BX 1HE8A 1STEA 4ZRIA 1QQRA 1XCTL 2MH7A 2Y5PA 1GC7A 2N9XA 1YQBA 2GBMA 4RMAA 2MBQA 2C60A 3NVVA 3A9KB 3RZFA 3X23A 3K9PB 1WWTA 2KOXA 3VTVA 1JWAD 1L5PA 3CSFA 3U30A 1V81A 3EGRA 1FPYA 2AQ1B 1R4NB 5BYSA 3EC8A 1G6JA 2Z0EB 3UIOB 4BOZB 2GOWA 4LTUA 4KKIA 1WMHB 2M0XA 5G5GA 5DPWA 3RMKC 4B0MA 3ZJUA 2JY6A 4FJVB 3RFZB 3N20C 1PGBA 2KDEB 3U2SC 1V80A 3IHPC 5EE3A 2JWZA 2PLPA 3V60A 3PS6A 1F0ZA 4EOYA 2KO3A 4DXAB 3PRZA 2N9EB 2RD0A 5BMIA 3P2BA 3BIID 1TIFA 4I6NB 5CHWA 4C7ZA 4I6PA 2YEPF 3RNFC 1WJ6A 4GDKB 2WXRA 3DBLI 1K51A 3AB5A 3KUZA 4GSWA 4N9F4 4DHJB 1TY2A 4OZCA 1OEYA 1E9MA 1XXGA 2RMMA 1GOZA 2WQYB 2I1KA 3A1QA 2D3AA 3Q8CA 2O6VD 4RGMA 5E6JA 2MP2B 2RDHA 3UIPB 1SEBD 3TSSA 3JSVA 2IZVB 5IOIA 2WNMA 4YTMB 2DAFA 4LNNA 4IM2A 4TKNA 3KH0A 5E6OA 3ZO5B 1T5XD 2NBWB 2LHEA 2BB6A 3AEBB 3VAWA 4ANUA 4J6IA 1HQRD 2GRIA 1OTRB 2J4XA 3ZJTA 2WDRB 3ZYYX 4GU2A 2DENB 1LGRA 3B9JA 4EEWA 1JWUD 1QOFA 1RLFA 3H8HA 3RNCC 3PGEA 2GBJA 3IG3A 2DWQA 2ZCBA 1I4XA 4KV2A 2R2OA 4LDTB 2FAZA 3NG0A 1KTKA 3M63B 1PQSA 3W5UB 1SXTA 1NI3A 2L3ZA 4L1BA 4F7ZA 2OJRA 3T8MA 4FBJB 2JXTA 5EDSA 1UWXA 1IBXB 3DVGX 1XD3B 4EZLA 3GS2A 2EKIA 2IO0B 2JRHA 2AQ3B 4KVGB 2JZPA 2WXMA 1L0XB 2KWDA 2LXCA 3I9V1 1R4MB 1YD8U 2MRPA 1WY8A 2QJLA 3N1YC 4DQOC 4ZOHC 4BKGA 4B6WA 2JZ3B 3P4SB 5DCNA 2N9PC 3P4PB 2CKHB 3PREA 3SHQA 1FNVA 1WGKA 3VUWA 2BYTA 4BKTA 4FLHA 3VHTC 3BYTB 3MJ5A 1Q1OA 3TL5A 2JXXA 3ZKJC 1D5XC 1MI0A 1K53A 1V1PB 4A55A 1I4PA 5BYQA 2EKEC 3NVWA 2HJ8A 4B95A 5AZGA 3L13A 2WXLA 1PYWD 2PVGC 2GBNA 1JALA 1PUTA 2I38A 2PEAA 1HTQA 3H7PA 3RULA 2AL3A 2HTME 2KT7A 4S17A 2FNJB 2JPHA 2PW9A 2WYQA 2I2YA 2WDQB 3RD2A 1E8WA 3JYUA 2CS4A 2HE7A 3URYA 4K7WA 4MSQB 3AN1A 1YOVB 4TQ0A 2WXOA 1VZ8A 4WJNA 1ZUD2 1GPXA 2LGDA 1N5XA 4HDQA 4ASWC 3V6EB 1M94A 1WGRA 4ICUA 4AQ7A 1DYQA 1FIQA 2CHXA 4C00A 3RYTA 2D5GA 2LGIA 1UWMA 4XDDA 1N62A 2BVCA 4TV3A 1N61A 4GN1A 4K7SA 2XNAC 4CQNA 4BBNF 3U7DA 1YN5A 4YWGG 2LEKA 3TMPB 1LXDA 4HROA 1YMHE 1ZXHA 1P9DU 4W9EA 3MC8A 3R2IA 1V6EA 5KHOA 2M56B 3TEYA 3ZXVA 2NCNA 4ARCA 3LB8C 2MEKA 1HA5A 2MJEA 2VRRB 1F2RI 4REZA 2WXIA 3FAHA 4BZAA 4YSXB 4IWQA 2BBCA 3QX1A 3ABVB 1WXQA 5MPOA 1VDVA 1UF0A 3PT2B 3PV1A 4BKSA 4MSMB 2MJ3A 4MH0E 4IUMB 1SE2A 4OW0A 1WXVA 4WURA 2GB1A 3PZ8A 3TEXA 3EA6A 3AE6B 1TT5B 4WWOA 1P98A 1AN8A 4NZLB 2DAJA 1V86A 2WP9B 2MHJA 3PSEB 4MJSB 4GGQA 4WWNA 2L1AA 2JU6X 2GBKA 1RAXA 3OWEB 4RF0A 3I57A 3FC4A 3R7RA 4HEA1 4JX1C 4OVZA 5HKHA 4HCPB 3TEWA 2W54A 1MHHE 1ROEA 2QMTA 4EFOA 1WMHA 4O1NA 5DPSA 2DNFA 2N9LA 1EO6A 3B1LX 2INDC 5D6JB 4IWPA 5BMHA 2FCNA 3P4RB 5L83A 1YIWA 1J7AA 2NPTB 4RNAA 4R3DA 1GUAB 4KKJA 2O2VA 1E7VA 3NRZA 1WGDA 1IUEA 4DDGD 1FO4A 4K3CA 3HVZA 1D5ZC 2JVCA 1XQQA 3OG5A 3DVGY 4LCDE 4M00A 2HTHA 3KWVA 5KHQA 2KDFB 4ZYNA 1DOYA 1YNTE 1JWBD 1MFWA 4JE3B 3KYDD 4S0RA 1C77A 2FUHB 4IKGA 1L6VA 3B08A 3RNEC 1OFFA 1YX5B 2K39A 3AXCA 3AI5A 2MCNB 2SEBD 1F52A 1X1MA 5C2TB 3MJWA 3UQBA 3VUXA 1YX6B 3PLVA 4N59A 3O13A 2BKFA 4AJYB 5IO9A 1BUIC 2IBIB 2B3AA 3UGBB 4PS7A 1C1YB 3VXWA 3D32A 3IBEA 3V61A 4NJ6A 5D3IB 2KWVB 4HJKA 1HZ6A 2KJRA 4FJYA 2KMCA 1R4MI 1VZ7A 4TUUA 2KANA 3QA8A 4YL8A 4N58A 2KTRB 4GDKA 2ZW0A 2XK5B 4RM8A 1D6EC 3S2AA 5FKAC 2X38A 1WR1A 3TUOA 2K9XA 5J18A 4BFRA 3KQ4A 5J17A 1C76A 1ENFA 3RN9C 1AYFA 2G3QB 3ETRA 1SB3C 2KK8A 2N7EA 5D2MB 2G45B 1B9RA 1KLUD 3T3NA 3TJPA 3L54A 3MP9A 2MBBB 2JYTA 3I3TB 4GLSC 1P7EA 2G4DB 5IAAC 5JH5C 4FULA 3M95A 2LASA 2QEJC 3NZ3A 5HFYA 1SIFA 4ZHPA 3UQAA 1WE7A 3ZUNA 3AU5A 3QIJA 2V4IB 3RPFC 4XE0A 2KXJA 2QHOA 2ZJDA 4W9IA 4IWOA 3E56A 1S1QB 2GBRA 3BK2A 1XO3A 1AW7A 1NDDA 2IGHA 4HK2A 1OQYA 2J0MA 4NQKE 3W9CB 1WX9A 4NQLB 1C4AA 5IP4D 5LNK1 1F1HA 1QZEA 3BINA 1ISNA 2IDYA 1JQ4A 4W9CA 2N7DA 4W9JA 2W55A 1IPGA 3W1YA 1XLNA 1GB1A 1SGHA 2KVZA 3U8ZA 3IAS1 1WI0A 1TZOA 2UWQA 3DCGA 2KN4A 2FE8A 4E74A 2JYEA 5CHFA 3SFDB 1WGHA 1L4DB 1J8CA 3SDLC 3NS1A 2IO2B 2WGSA 1DOIA 2N1VA 1V1OA 3U4EG 3LYYA 4FN2A 4C80A 1ET6A 3P1MA 3N30A 4LJOB 1TGZB 3ENEA 2KJHB 2EELA 3B2GA 2CU3A 2D3CA 4L2YA 4C4VA 3QQ8B 4HVBA 4E71A 1E7PB 3K9OB 3PZDA 2ON8A 4US8A 1L7YA 3VVWB 4II2B 4M0WA 4M0WB 3ML8A 4D2KA 4WWMA 2D3GA 2REXA 2LHDA 1SIJA 3NOBA 2D11A 5J2RA 3TIXA 4BOSC 1V1PA 1JRUA 4EUTA 2BQQA 3NVYA 1V5OA 3DBRB 4PK1A 3GP7A 4G50A 3WAMA 4XWTA 3Q3OC 4B9KA 1YQ3B 4LLGM 1IGDA 3AEGB 3VFKA 2K6QA 2M8SA 3R2TA 1ZE3D 2DYOA 3AECB 4KZCA 4PYZA 2ASQA 3TCAA 3H9DA 2LGXA 4KGRA 3BVZA 3QJZA 2VH1A 2XK5A 4P1CC 2NBUA 2YLMA 2L0TA 1TS5A 2L32A 2V0GA 2BWES 1OGWA 4RM9A 3BWUD 1UNSA 4Q2JA 2QC8A 1EU3A 2KDIA 2EMTA 3EHVA 2L05A 1NVID 1CZPA 4YSYB 2M0AA 2WU5B 1NBFC 2L52A 4JWUC 2FCQA 5E6PA 3DBHI 1QILA 2GI9A 2N0SB 2W9NA 1QKZA 3AE2B 2V3NA 1U4AA 3DHIC 3DBSA 3AEDB 4YXDB 3DWMA 3WCQA 5JHAA 2ZPNA 3TEZA 4N6EB 2KN5A 5D7GA 2DZMA 5E6NA 3AM9A 1ZOYB 4RF1A 2KMMA 3DHGC 1RFKA 4G3XB 3C0RB 5G2NA 4GIVA 5JZEB 4RH6A 1D3ZA 4ACFA 4DXFA 1TY0A 2BB5A 2FBWB 1FEHA 3PHXB 2YEPB 5TR5A 3KW5B 3EUB2 2L76A 1TKEA 1DOXA 4DHJD 1EU4A 3NUHB 1E8YA 3MTNB 3VH3B 2KC1A 3MHSD 1FD6A 4BAXA 4MGIE 3IT4B 1KOTA 2DX5B 4W9KA 2WLBA 3QAQA 4JPSA 4F1SA 1WF9A 3AE9B 3IFWB 1Y56A 3B0AA 1KJTA 3UF8A 1HZ5A 2V1YA 1GC6A 3R66C 3L0WB 2JUOA 4A3OA 4TQ1A 4NAWB 1Y8RC 3DBLB 2BWFA 4ZRPA 4JWSC 2IO1B 3ZXRA 3NZUA 1LM8B 4YTNB 1ZDXA 3KUCB 4HPPA 3ZDMC 1C4PA 1FCCC 1RRBA 3QWZB 3GE3C 3N1XC 4HPMB 5AZHA 4MEMA 4W9LA 2MBHA 2J0JA 1C3TA 1H8CA 1I4GA 3H7SA 3ML9A 3U7ZA 1RFAA 1CJEA 3RNAC 2NPTA 2HJ1A 1XT9B 2WDVB 2D10A 1WFYA 2KFKB 2KYWA 1B1ZA 2MX2A 2V3PA 3Q3JA 3ECIA 2LGSA 1JCKB 4ICVA 2J0KA 2LVOA 2LVQA 3P63A 1TKYA 2C9WB 5AUIA 2BF8B 2K22A 3RCZA 3ZJVA 4OVVA 3CSTA 2XBBC 1N63A 2C5LC 1VD2A 2FCSA 5JXVA 1DGJA 2FIFA 2V4LA 1AWDA 4KSLC 2GMIC 1N6ZA 1EF1A 2K0PA 3W1SC 3QC8B 4MT5A 1SJED 3RUIB 1BXTA 1XLQA 2KQSA 4KZ0A 1SE9A 1IP9A 5H8YE 5BYRA 2K8BA 3T3OA 3RT3B 1KLGD 3NJTA 5HHDG 3MC0B 3RZWC 3ZNID 3M62B 4IDIA 3RI7C 2WX0A 4P1BC 3QARA 2H89B 3J9CA 3CWIA 1NI2A 4XWWA 1FNUA 1SE3A 3ZNZB 1V97A 1BMLC 2LZ6A 1QOAA 1FFUA 1J19A 3L08A 3Q14C 3HUIA 4E3CA 1TS2A 4OZBA 4MELA 2LFIA 3AULA 4MM3B 2L00B 2KX3A 1GG3A 1R4NI 3R7QA 2X8XX 4FHKA 2BS3B 2I1JA 3VRBB 4LNOA 4J3OD 2LGYA 3GOEA 4DHZE 3CF6E 4ZHOA 2KMAA 3NHEB 1JWMD 2PE9A 3HRDD 1KM7A 2PMVA 3Q2AC 4I6LB 3PLUA 4BBNC 2JQRB 2V9HA 5BO4B 2DHZA 2IY1B 3ZIMA 2Q5WD 1WXSA 3AU4A 4AS1A 1I7HA 1AARA 2M4NA 2KQ7A 3OAWA 3ZRCA 1HTOA 4NY0A 2KLCA 3MC9A 2O6VA 4HXDA 2BYFA 2ZVNA 1S3SG 2BYEA 3KYCD 3KWLA 4BVUC 3H7PB 2MP2A 3V6CB 2CR5A 2KVRA 2MA9B 2KWUB 1F2RC 1GAQB 3JSVB 2CHWA 2K6DB 1PGXA 2KTFA 1OEYJ 3FILB 1UD7A 3GE8C 4FJZA 5GMVA 1TS4A 1MHXA 5IA7A 3PRMB 2FCMA 1I35A 3N3KB 3V3XA 2KACA 1K52A 4P16A 3ZGZA 4IOIE 2CJNA 1L6UA 1MJDA 1E0ZA 4A3PA 5L95C 2WDTB 3BK1A 4RCOA 3WAPA 3C19A 3EFUA 1TZ1A 2C7HA 4WQOB 4CHKA 2BPSA 3IVFA 1C4CA 2MSED 1T0YA 4HRSA 4PS3A 3WAOA 4HDOA 1FCLA 1L0VB 4C4VB 1N60A 1ZW7A 2NR2A 4AJWA 2N7JA 1JW9D 4CO7A 4PS8A 2IPKD 3VH4B 2GLSA 3HK0A 1T0SC 4ANVA 4M01A 4GMVA 3H1UA 2SAKA 3HHMA 5TSSA 2KWCA 1KLVA 2Z59B 2L8JA 3AE7B 2ZVOA 1E10A 1TS3A 4KIKA 2A4ZA 2DYMA 3AE8B 3ALBA 4EZKA 3R3MA 1QLBB 1E5WA 4OVUA 2OOBB 4A90A 3APDA 2LRWA 3SFEB 4ZDVA 2LUMA 4KDIC 4WQMA 3M3JA 5EE1A 1KH0A 4HLEA 2CJOA 2V3SA 1WGGA 5FR6A 2BS2B 2D3BA 1JROA 2QDFA 4GXBA 2RPQA 3WIMA 2C7NB 4AUQC 2B76B 3AE5B 4WAAA 4MACA 1QF6A 2DZKA 4WJOA 1WH3A 4RFBA 3ZDTA 2K1FA 3N32A 1YN3A 1C9FA 2Y3AA 4KX6B 2BTEA 2AYOB 2WWZA 2LI5A 2A5UA 3P4QB 2NVUI 1RM6C 3NZSA 4TMAB 1D5MC 3DPDA 1UGMA 3SEBA 1JWSD 1K8RB 5IN7A 2ZNVC 2LVPA 1K50A 2JRIB 1FXAA 5G55A 3PHWB 3L16A 2EMSA 3T9LA 2KHWB 2O2VB 1WM3A 1ZGUB 4W9FA 4LNFA 4K7UA 1ET9A 2K8CA 1EWCA 2KDBA 4AWJA 1TBEA 3V05A 3ONSA 2KX0A 3B2FA 4W9HA 1A5RA 5D94A 1KF6B 2MQJA 3P42A 1WZ0A 1Z5SB 4DHZB 2KFJA 2JX5A 2ZW1A 3NVZA 2FIDA 2KZRA 2K8HA 4IM3A 4II3B 2KKCA
chains in the Genus database with same CATH topology
2D2QA 1GNUA 4LJPB 4KSKC 3ZNGC 1D3ZA 4BBNF 3U7DA 1WJUA 3APFA 4ZRKA 3TMPB 2KNBA 3PHXB 2KLGA 1LXDA 3A9KA 5TR5A 3KW5B 2JF5A 3A9JA 3HM6X 4GDLB 3NS8A 4URKA 2ZZPB 4M8MA 1LFDA 2L76A 2DYBA 3EECA 1P9DU 4W9EA 4DHJD 1V6EA 3A1QB 5KHOA 1E8YA 2PPHA 3MTNB 2KC1A 2HD5B 3VH3B 3VTUA 3WALA 2NCNA 3MHSD 4NJ7A 4LDTD 2VRRB 1UZXB 3ZW3A 4MGIE 1KOTA 2DX5B 1P0RA 4W9KA 4IWQA 3QX1A 3QAQA 1H4RA 2N1WA 4G0NB 4F1SA 5JHBA 1WF9A 3GZNI 3IFWB 3B0AA 1KJTA 3PT2B 3PV1A 3UF8A 2ZPYA 2KD0A 4BKSA 1WJNA 2V1YA 1GC6A 3R66C 4DDID 3L0WB 4MSMB 3A9JB 2WX1A 4FA6A 2JUOA 4MH0E 4TQ1A 4IUMB 4A3OA 1V9JA 1WXVA 2BYVE 4NAWB 1Y8RC 2BWFA 3ZTCA 2KFKA 1J0GA 4IM0A 4WWOA 4DK5A 2IO1B 1P98A 2DAJA 1EF5A 1V86A 4MDKE 4EZJA 3PSEB 4MJSB 1V2YA 3APCA 3NZUA 1LM8B 2AEHA 3PPAA 2J7QB 2N4FA 4GGQA 5LLIA 4W9GA 1WGYA 3X0WA 3KUCB 2GBKA 1RAXA 3DDCB 3ZDMC 4GB9A 3LDZE 4MGZE 1RRBA 3QWZB 3R7RA 2KTRA 3A33B 4HPMB 4IG7B 5AZHA 4BKSD 4NNJB 4MEMA 4ZRJA 5HKHA 4HCPB 4W9LA 2MBHA 2IY0B 4HPLB 2J0JA 1C3TA 1H8CA 1TTNA 2DZIA 3H7SA 3ML9A 2MWSB 5C23A 1RFAA 3OLMD 4EFOA 1WMHA 4JQWC 3A4RA 2NPTA 1WR6E 5DPSA 2L7RA 1XT9B 4MM3A 3DVNV 4X57B 1EO6A 3DVNU 1MG8A 2D10A 5DPTA 3B1LX 2MBEA 2D07B 5D6JB 4IWPA 1WFYA 2KFKB 4XC2A 3WA0A 2FCNA 1Q5WB 5L83A 1YIWA 4GDLA 2NPTB 2MX2A 1GUAB 3Q3JA 5LXHA 3ECIA 4JL9A 3SD5A 2O2VA 1E7VA 4WWPA 1WGDA 3L10B 4ICVA 4A20A 4DDGD 2J0KA 3CMMB 2LVOA 2LVQA 3PVLA 2JVCA 2G4SA 1XQQA 2C9WB 3HIZA 2BF8B 3DVGY 4LCDE 3RCZA 2MW5A 4OVVA 2HTHA 3CSTA 2XBBC 4DWFA 2C5LC 1UH6A 2CU1A 1VD2A 2KDFB 5KHQA 2FCSA 4ZYNA 2YVCA 2LJ5A 3A4SC 2FIFA 2LWPA 2V4LA 3KYDD 5CHVC 2FUHB 3NY5A 1LQBA 4KSLC 2GMIC 3B08A 1EF1A 1UELA 2Z0DB 3W1SC 2L0FA 2NBVB 1YX5B 2K39A 3QC8B 3ZVVA 3AXCA 3AI5A 2MCNB 3RUIB 1X1MA 4AP4C 2KQSA 3MJWA 4KZ0A 1SE9A 1IP9A 3UQBA 3VUXA 4MJSA 1YX6B 3PLVA 2BKFA 4AJYB 2K8BA 1WXAA 4WJQA 2KC2A 3RT3B 1WIAA 4ANXA 2IYDB 3QK0A 2IBIB 2B3AA 4MGYE 3UGBB 3JVZX 2BKRB 1WM2A 2JT4B 2LD9A 1HE8A 1C1YB 4PS7A 3RZWC 3M62B 3ZNID 4ZRIA 3VXWA 2WX0A 3D32A 3QARA 1GC7A 3IBEA 2N9XA 3V61A 2RR9A 1YQBA 2GBMA 3O65B 4NJ6A 4RMAA 3VUYA 2KWVB 2MBQA 2C60A 1NI2A 4HJKA 3A9KB 3RZFA 2KJRA 3X23A 3K9PB 4FJYA 3ZNZB 2C7MB 2KMCA 1R4MI 2LZ6A 2MBOA 2KOXA 3VTVA 4EKUA 4TUUA 2DZJA 2KANA 3CSFA 3U30A 3QA8A 4GOCA 4YL8A 3WANA 4HCNB 4PYUA 1J19A 1V81A 3W1SA 3ZNHB 3L08A 2KTRB 4E3CA 4GDKA 2RGFA 3EC8A 2XK5B 1G6JA 4MELA 4RM8A 2Z0EB 3UIOB 3S2AA 3AULA 2ZNVB 4JLCA 3H6NA 3V62A 3VTWA 4BOZB 2MLBA 2L00B 4NPNA 2GOWA 1WR1A 4WJPA 2KX3A 1GG3A 1R4NI 4K7SA 1WMHB 2M0XA 3R7QA 4AOFA 5DPWA 3QHTA 2CHZA 4FHKA 5J18A 4BFRA 5J17A 4FADA 3VDZA 2I1JA 2JY6A 2G3QB 4FJVB 1WE6A 2KDEB 2KK8A 2LGYA 2Y5BB 3GOEA 1V80A 2N7EA 3IHPC 5D2MB 4DHZE 3CF6E 2G45B 2JWZA 1EUVB 1V49A 3V60A 3PS6A 2KMAA 4EOYA 2KO3A 4DXAB 3PRZA 2N9EB 3TJPA 2RD0A 3P2BA 3L17A 2MBBB 3L54A 3I3TB 2PE9A 3NHEB 4ANWA 4I6NB 1KM7A 1WJ4A 2G4DB 4I6PA 4I6LB 5CHWA 5IAAC 4BBNC 5JH5C 4FULA 1WJ6A 3M95A 3QCAA 4GDKB 2LASA 5BO4B 2DHZA 2IY1B 3ZIMA 1SIFA 1WXSA 3AU4A 3DBLI 1WE7A 3UQAA 3KUZA 4JIOU 1AARA 2M4NA 1UBIA 4GSWA 4N9F4 3ZUNA 1FXTB 4DBGA 4DHJB 3AU5A 1OEYA 3QIJA 2KQ7A 3OAWA 3DQVA 3ZRCA 1E90A 3KUDB 4NY0A 2KLCA 2KXJA 2I1KA 2QHOA 2ZJDA 3A1QA 4W9IA 2O6VA 4HXDA 2BYFA 2ZVNA 4IWOA 1S3SG 2BYEA 2O6VD 1S1QB 3HM3A 3KYCD 4BVUC 2MP2B 2GBRA 3H7PB 2MP2A 1E7UA 1WXMA 3V6CB 3UIPB 1NDDA 4G11A 2ZCCA 3OJ4B 2CR5A 2KVRA 2MA9B 2KWUB 4HK2A 1CMXB 1OQYA 3DOWA 3JSVA 2IZVB 2CHWA 3JSVB 2J0MA 2K6DB 4NQKE 1WX9A 4NQLB 2KTFA 1OEYJ 2DAFA 1UD7A 2JZZA 4IM2A 4TKNA 4FJZA 5GMVA 1QZEA 3KH0A 5E6OA 3ZRFA 4K1RB 3ZO5B 3BINA 1ISNA 5IA7A 2BGFA 2NS5A 4W9CA 3PRMB 2N7DA 1WRDB 4W9JA 1IPGA 2FCMA 3W1YA 1I35A 3N3KB 2NBWB 3VAWA 1SGHA 4ANUA 1E8ZA 4J6IA 3U8ZA 1WI0A 1OTRB 2LXAA 2UWQA 3DCGA 3KVFB 4E74A 3PTFC 4A3PA 5CHFA 1BT0A 5L95C 1WGHA 2WDTB 4GU2A 1J8CA 3SDLC 5LXIB 1L2NA 2DENB 3WAPA 3EFUA 4EEWA 1TZ1A 1RLFA 2C7HA 2IO2B 2BPSA 4WQOB 4CHKA 2N1VA 2M1MA 3IVFA 2MSED 1T0YA 4FN2A 4PS3A 3WAOA 2AWTA 3PGEA 4HDOA 2GBJA 3IG3A 3N30A 4MGKE 4IW0A 1ZW7A 2ZCBA 4LJOB 2NR2A 4KV2A 1TGZB 2R2OA 4LDTB 4AJWA 1F9JA 3ENEA 5C1ZA 1P3QU 2FAZA 4CO7A 3M63B 1PQSA 2KJHB 1V5TA 4PS8A 4IC7B 2IO3B 2L3ZA 4GIVA 1VCBA 3VH4B 4F7ZA 2OJRA 3T8MA 3HK0A 4ANVA 4FBJB 3QQ8B 4HVBA 4E71A 5EDSA 3K9OB 3PZDA 4GMVA 3H1UA 3DVGX 1XD3B 4K81A 4EZLA 1L7YA 3VVWB 3HHMA 4II2B 2KWCA 4M0WB 1KLVA 2IO0B 2JRHA 3PRPB 2KJ6A 2AL6A 4KVGB 2Z59B 3ML8A 4XX5A 2K25A 2L8JA 2D3GA 2REXA 1WX8A 3LJ3A 2ZVOA 2LXCA 1YD8U 2O6VB 2MRPA 3NOBA 4JGHB 4KIKA 2A4ZA 1WY8A 2PE6B 2D11A 5J2RA 2DYMA 3TIXA 4BOSC 3ALBA 4EZKA 3R3MA 1JRUA 3VQIA 1E5WA 4BKGA 4EUTA 4B6WA 2JZ3B 4OVUA 1V5OA 5DCNA 2OOBB 2N9PC 3APDA 2LRWA 2CKHB 4G50A 3WAMA 4ZDVA 3PREA 4KDIC 2LUEA 4W9DA 3SHQA 4B9KA 3M3JA 1GJZA 3DBRI 3VUWA 4BKTA 4HLEA 2V3SA 5FR6A 1WGGA 1WYWB 4FLHA 3VHTC 3VFKA 3TL5A 1Q1OA 2K6QA 2JXXA 2RPQA 4GXBA 2M8SA 1WX7A 2C7NB 1YJ1A 5CTRC 3WIMA 2DYOA 3ZKJC 2R2QA 4WAAA 4AUQC 4KZCA 4P7IA 3TBLD 4FHJA 4PYZA 2ASQA 5DPRA 3H9DA 3TCAA 2DZKA 4WJOA 4M8NA 1WH3A 2EKEC 2LGXA 3OJ3A 2HJ8A 4KIKB 5CX3A 4B95A 4F8CB 5AZGA 3ZDTA 3L13A 1WZ3A 2K1FA 3N32A 3QJZA 4II3B 3SU8X 2GBNA 4HWIB 3JW0X 3ZTDA 2PEAA 2AYOB 2XK5A 2WWZA 2NBUA 3H7PA 2LI5A 2YLMA 2AL3A 2L0TA 2A5UA 3Q3FA 3RULA 2NVUI 2FNJB 2JPHA 2BWES 3NZSA 1OGWA 1ZKHA 4RM9A 2KDIA 2WYQA 3RD2A 2EMTA 3DPDA 1UGMA 3EHVA 1E8WA 3JYUA 2L05A 3UINB 2CS4A 1K8RB 2M17A 2HE7A 2ZNVC 2LVPA 2ZEQA 2JRIB 1NBFC 4KDLB 4K7WA 4MSQB 1I42A 5G55A 3PHWB 3L16A 2RSUA 2FCQA 4WWNA 2EMSA 5E6PA 3T9LA 2KHWB 4TQ0A 3DBHI 2O2VB 3ZLZA 1WM3A 1ZGUB 3BY4B 4WJNA 4W9FA 2W9NA 2LGDA 1E8XA 4HDQA 1Z2MA 4K7UA 4XZ4A 1U4AA 2K8CA 2KDBA 3DBSA 4AWJA 1TBEA 2PJHA 4ASWC 3V6EB 1M94A 3ONSA 2KX0A 1A5RA 2XEWA 1WGRA 2UYZB 4NAWA 1P1AA 2ZPNA 4W9HA 5D94A 5AEKB 4ICUA 5JHAA 2MQJA 4CYEA 1WZ0A 1Z5SB 2KN5A 4DHZB 2KFJA 2LRUA 2DZMA 5D7GA 5E6NA 2CHXA 3RYTA 5AZFA 2FIDA 2KZRA 1UBQA 4TV3A 1Q0WB 2K8HA 3C0RB 4G3XB 4GN1A 3PLUA 4IM3A 5G2NA 5JZEB 2KKCA 1IYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D2Q A;  1GNU A;  4LJP B;  4KSK C;  3ZNG C;  1D3Z A;  4BBN F;  3U7D A;  1WJU A;  3APF A;  4ZRK A;  3TMP B;  2KNB A;  3PHX B;  2KLG A;  1LXD A;  3A9K A;  5TR5 A;  3KW5 B;  2JF5 A;  3A9J A;  3HM6 X;  4GDL B;  3NS8 A;  4URK A;  2ZZP B;  4M8M A;  1LFD A;  2L76 A;  2DYB A;  3EEC A;  1P9D U;  4W9E A;  4DHJ D;  1V6E A;  3A1Q B;  5KHO A;  1E8Y A;  2PPH A;  3MTN B;  2KC1 A;  2HD5 B;  3VH3 B;  3VTU A;  3WAL A;  2NCN A;  3MHS D;  4NJ7 A;  4LDT D;  2VRR B;  1UZX B;  3ZW3 A;  4MGI E;  1KOT A;  2DX5 B;  1P0R A;  4W9K A;  4IWQ A;  3QX1 A;  3QAQ A;  1H4R A;  2N1W A;  4G0N B;  4F1S A;  5JHB A;  1WF9 A;  3GZN I;  3IFW B;  3B0A A;  1KJT A;  3PT2 B;  3PV1 A;  3UF8 A;  2ZPY A;  2KD0 A;  4BKS A;  1WJN A;  2V1Y A;  1GC6 A;  3R66 C;  4DDI D;  3L0W B;  4MSM B;  3A9J B;  2WX1 A;  4FA6 A;  2JUO A;  4MH0 E;  4TQ1 A;  4IUM B;  4A3O A;  1V9J A;  1WXV A;  2BYV E;  4NAW B;  1Y8R C;  2BWF A;  3ZTC A;  2KFK A;  1J0G A;  4IM0 A;  4WWO A;  4DK5 A;  2IO1 B;  1P98 A;  2DAJ A;  1EF5 A;  1V86 A;  4MDK E;  4EZJ A;  3PSE B;  4MJS B;  1V2Y A;  3APC A;  3NZU A;  1LM8 B;  2AEH A;  3PPA A;  2J7Q B;  2N4F A;  4GGQ A;  5LLI A;  4W9G A;  1WGY A;  3X0W A;  3KUC B;  2GBK A;  1RAX A;  3DDC B;  3ZDM C;  4GB9 A;  3LDZ E;  4MGZ E;  1RRB A;  3QWZ B;  3R7R A;  2KTR A;  3A33 B;  4HPM B;  4IG7 B;  5AZH A;  4BKS D;  4NNJ B;  4MEM A;  4ZRJ A;  5HKH A;  4HCP B;  4W9L A;  2MBH A;  2IY0 B;  4HPL B;  2J0J A;  1C3T A;  1H8C A;  1TTN A;  2DZI A;  3H7S A;  3ML9 A;  2MWS B;  5C23 A;  1RFA A;  3OLM D;  4EFO A;  1WMH A;  4JQW C;  3A4R A;  2NPT A;  1WR6 E;  5DPS A;  2L7R A;  1XT9 B;  4MM3 A;  3DVN V;  4X57 B;  1EO6 A;  3DVN U;  1MG8 A;  2D10 A;  5DPT A;  3B1L X;  2MBE A;  2D07 B;  5D6J B;  4IWP A;  1WFY A;  2KFK B;  4XC2 A;  3WA0 A;  2FCN A;  1Q5W B;  5L83 A;  1YIW A;  4GDL A;  2NPT B;  2MX2 A;  1GUA B;  3Q3J A;  5LXH A;  3ECI A;  4JL9 A;  3SD5 A;  2O2V A;  1E7V A;  4WWP A;  1WGD A;  3L10 B;  4ICV A;  4A20 A;  4DDG D;  2J0K A;  3CMM B;  2LVO A;  2LVQ A;  3PVL A;  2JVC A;  2G4S A;  1XQQ A;  2C9W B;  3HIZ A;  2BF8 B;  3DVG Y;  4LCD E;  3RCZ A;  2MW5 A;  4OVV A;  2HTH A;  3CST A;  2XBB C;  4DWF A;  2C5L C;  1UH6 A;  2CU1 A;  1VD2 A;  2KDF B;  5KHQ A;  2FCS A;  4ZYN A;  2YVC A;  2LJ5 A;  3A4S C;  2FIF A;  2LWP A;  2V4L A;  3KYD D;  5CHV C;  2FUH B;  3NY5 A;  1LQB A;  4KSL C;  2GMI C;  3B08 A;  1EF1 A;  1UEL A;  2Z0D B;  3W1S C;  2L0F A;  2NBV B;  1YX5 B;  2K39 A;  3QC8 B;  3ZVV A;  3AXC A;  3AI5 A;  2MCN B;  3RUI B;  1X1M A;  4AP4 C;  2KQS A;  3MJW A;  4KZ0 A;  1SE9 A;  1IP9 A;  3UQB A;  3VUX A;  4MJS A;  1YX6 B;  3PLV A;  2BKF A;  4AJY B;  2K8B A;  1WXA A;  4WJQ A;  2KC2 A;  3RT3 B;  1WIA A;  4ANX A;  2IYD B;  3QK0 A;  2IBI B;  2B3A A;  4MGY E;  3UGB B;  3JVZ X;  2BKR B;  1WM2 A;  2JT4 B;  2LD9 A;  1HE8 A;  1C1Y B;  4PS7 A;  3RZW C;  3M62 B;  3ZNI D;  4ZRI A;  3VXW A;  2WX0 A;  3D32 A;  3QAR A;  1GC7 A;  3IBE A;  2N9X A;  3V61 A;  2RR9 A;  1YQB A;  2GBM A;  3O65 B;  4NJ6 A;  4RMA A;  3VUY A;  2KWV B;  2MBQ A;  2C60 A;  1NI2 A;  4HJK A;  3A9K B;  3RZF A;  2KJR A;  3X23 A;  3K9P B;  4FJY A;  3ZNZ B;  2C7M B;  2KMC A;  1R4M I;  2LZ6 A;  2MBO A;  2KOX A;  3VTV A;  4EKU A;  4TUU A;  2DZJ A;  2KAN A;  3CSF A;  3U30 A;  3QA8 A;  4GOC A;  4YL8 A;  3WAN A;  4HCN B;  4PYU A;  1J19 A;  1V81 A;  3W1S A;  3ZNH B;  3L08 A;  2KTR B;  4E3C A;  4GDK A;  2RGF A;  3EC8 A;  2XK5 B;  1G6J A;  4MEL A;  4RM8 A;  2Z0E B;  3UIO B;  3S2A A;  3AUL A;  2ZNV B;  4JLC A;  3H6N A;  3V62 A;  3VTW A;  4BOZ B;  2MLB A;  2L00 B;  4NPN A;  2GOW A;  1WR1 A;  4WJP A;  2KX3 A;  1GG3 A;  1R4N I;  4K7S A;  1WMH B;  2M0X A;  3R7Q A;  4AOF A;  5DPW A;  3QHT A;  2CHZ A;  4FHK A;  5J18 A;  4BFR A;  5J17 A;  4FAD A;  3VDZ A;  2I1J A;  2JY6 A;  2G3Q B;  4FJV B;  1WE6 A;  2KDE B;  2KK8 A;  2LGY A;  2Y5B B;  3GOE A;  1V80 A;  2N7E A;  3IHP C;  5D2M B;  4DHZ E;  3CF6 E;  2G45 B;  2JWZ A;  1EUV B;  1V49 A;  3V60 A;  3PS6 A;  2KMA A;  4EOY A;  2KO3 A;  4DXA B;  3PRZ A;  2N9E B;  3TJP A;  2RD0 A;  3P2B A;  3L17 A;  2MBB B;  3L54 A;  3I3T B;  2PE9 A;  3NHE B;  4ANW A;  4I6N B;  1KM7 A;  1WJ4 A;  2G4D B;  4I6P A;  4I6L B;  5CHW A;  5IAA C;  4BBN C;  5JH5 C;  4FUL A;  1WJ6 A;  3M95 A;  3QCA A;  4GDK B;  2LAS A;  5BO4 B;  2DHZ A;  2IY1 B;  3ZIM A;  1SIF A;  1WXS A;  3AU4 A;  3DBL I;  1WE7 A;  3UQA A;  3KUZ A;  4JIO U;  1AAR A;  2M4N A;  1UBI A;  4GSW A;  4N9F 4;  3ZUN A;  1FXT B;  4DBG A;  4DHJ B;  3AU5 A;  1OEY A;  3QIJ A;  2KQ7 A;  3OAW A;  3DQV A;  3ZRC A;  1E90 A;  3KUD B;  4NY0 A;  2KLC A;  2KXJ A;  2I1K A;  2QHO A;  2ZJD A;  3A1Q A;  4W9I A;  2O6V A;  4HXD A;  2BYF A;  2ZVN A;  4IWO A;  1S3S G;  2BYE A;  2O6V D;  1S1Q B;  3HM3 A;  3KYC D;  4BVU C;  2MP2 B;  2GBR A;  3H7P B;  2MP2 A;  1E7U A;  1WXM A;  3V6C B;  3UIP B;  1NDD A;  4G11 A;  2ZCC A;  3OJ4 B;  2CR5 A;  2KVR A;  2MA9 B;  2KWU B;  4HK2 A;  1CMX B;  1OQY A;  3DOW A;  3JSV A;  2IZV B;  2CHW A;  3JSV B;  2J0M A;  2K6D B;  4NQK E;  1WX9 A;  4NQL B;  2KTF A;  1OEY J;  2DAF A;  1UD7 A;  2JZZ A;  4IM2 A;  4TKN A;  4FJZ A;  5GMV A;  1QZE A;  3KH0 A;  5E6O A;  3ZRF A;  4K1R B;  3ZO5 B;  3BIN A;  1ISN A;  5IA7 A;  2BGF A;  2NS5 A;  4W9C A;  3PRM B;  2N7D A;  1WRD B;  4W9J A;  1IPG A;  2FCM A;  3W1Y A;  1I35 A;  3N3K B;  2NBW B;  3VAW A;  1SGH A;  4ANU A;  1E8Z A;  4J6I A;  3U8Z A;  1WI0 A;  1OTR B;  2LXA A;  2UWQ A;  3DCG A;  3KVF B;  4E74 A;  3PTF C;  4A3P A;  5CHF A;  1BT0 A;  5L95 C;  1WGH A;  2WDT B;  4GU2 A;  1J8C A;  3SDL C;  5LXI B;  1L2N A;  2DEN B;  3WAP A;  3EFU A;  4EEW A;  1TZ1 A;  1RLF A;  2C7H A;  2IO2 B;  2BPS A;  4WQO B;  4CHK A;  2N1V A;  2M1M A;  3IVF A;  2MSE D;  1T0Y A;  4FN2 A;  4PS3 A;  3WAO A;  2AWT A;  3PGE A;  4HDO A;  2GBJ A;  3IG3 A;  3N30 A;  4MGK E;  4IW0 A;  1ZW7 A;  2ZCB A;  4LJO B;  2NR2 A;  4KV2 A;  1TGZ B;  2R2O A;  4LDT B;  4AJW A;  1F9J A;  3ENE A;  5C1Z A;  1P3Q U;  2FAZ A;  4CO7 A;  3M63 B;  1PQS A;  2KJH B;  1V5T A;  4PS8 A;  4IC7 B;  2IO3 B;  2L3Z A;  4GIV A;  1VCB A;  3VH4 B;  4F7Z A;  2OJR A;  3T8M A;  3HK0 A;  4ANV A;  4FBJ B;  3QQ8 B;  4HVB A;  4E71 A;  5EDS A;  3K9O B;  3PZD A;  4GMV A;  3H1U A;  3DVG X;  1XD3 B;  4K81 A;  4EZL A;  1L7Y A;  3VVW B;  3HHM A;  4II2 B;  2KWC A;  4M0W B;  1KLV A;  2IO0 B;  2JRH A;  3PRP B;  2KJ6 A;  2AL6 A;  4KVG B;  2Z59 B;  3ML8 A;  4XX5 A;  2K25 A;  2L8J A;  2D3G A;  2REX A;  1WX8 A;  3LJ3 A;  2ZVO A;  2LXC A;  1YD8 U;  2O6V B;  2MRP A;  3NOB A;  4JGH B;  4KIK A;  2A4Z A;  1WY8 A;  2PE6 B;  2D11 A;  5J2R A;  2DYM A;  3TIX A;  4BOS C;  3ALB A;  4EZK A;  3R3M A;  1JRU A;  3VQI A;  1E5W A;  4BKG A;  4EUT A;  4B6W A;  2JZ3 B;  4OVU A;  1V5O A;  5DCN A;  2OOB B;  2N9P C;  3APD A;  2LRW A;  2CKH B;  4G50 A;  3WAM A;  4ZDV A;  3PRE A;  4KDI C;  2LUE A;  4W9D A;  3SHQ A;  4B9K A;  3M3J A;  1GJZ A;  3DBR I;  3VUW A;  4BKT A;  4HLE A;  2V3S A;  5FR6 A;  1WGG A;  1WYW B;  4FLH A;  3VHT C;  3VFK A;  3TL5 A;  1Q1O A;  2K6Q A;  2JXX A;  2RPQ A;  4GXB A;  2M8S A;  1WX7 A;  2C7N B;  1YJ1 A;  5CTR C;  3WIM A;  2DYO A;  3ZKJ C;  2R2Q A;  4WAA A;  4AUQ C;  4KZC A;  4P7I A;  3TBL D;  4FHJ A;  4PYZ A;  2ASQ A;  5DPR A;  3H9D A;  3TCA A;  2DZK A;  4WJO A;  4M8N A;  1WH3 A;  2EKE C;  2LGX A;  3OJ3 A;  2HJ8 A;  4KIK B;  5CX3 A;  4B95 A;  4F8C B;  5AZG A;  3ZDT A;  3L13 A;  1WZ3 A;  2K1F A;  3N32 A;  3QJZ A;  4II3 B;  3SU8 X;  2GBN A;  4HWI B;  3JW0 X;  3ZTD A;  2PEA A;  2AYO B;  2XK5 A;  2WWZ A;  2NBU A;  3H7P A;  2LI5 A;  2YLM A;  2AL3 A;  2L0T A;  2A5U A;  3Q3F A;  3RUL A;  2NVU I;  2FNJ B;  2JPH A;  2BWE S;  3NZS A;  1OGW A;  1ZKH A;  4RM9 A;  2KDI A;  2WYQ A;  3RD2 A;  2EMT A;  3DPD A;  1UGM A;  3EHV A;  1E8W A;  3JYU A;  2L05 A;  3UIN B;  2CS4 A;  1K8R B;  2M17 A;  2HE7 A;  2ZNV C;  2LVP A;  2ZEQ A;  2JRI B;  1NBF C;  4KDL B;  4K7W A;  4MSQ B;  1I42 A;  5G55 A;  3PHW B;  3L16 A;  2RSU A;  2FCQ A;  4WWN A;  2EMS A;  5E6P A;  3T9L A;  2KHW B;  4TQ0 A;  3DBH I;  2O2V B;  3ZLZ A;  1WM3 A;  1ZGU B;  3BY4 B;  4WJN A;  4W9F A;  2W9N A;  2LGD A;  1E8X A;  4HDQ A;  1Z2M A;  4K7U A;  4XZ4 A;  1U4A A;  2K8C A;  2KDB A;  3DBS A;  4AWJ A;  1TBE A;  2PJH A;  4ASW C;  3V6E B;  1M94 A;  3ONS A;  2KX0 A;  1A5R A;  2XEW A;  1WGR A;  2UYZ B;  4NAW A;  1P1A A;  2ZPN A;  4W9H A;  5D94 A;  5AEK B;  4ICU A;  5JHA A;  2MQJ A;  4CYE A;  1WZ0 A;  1Z5S B;  2KN5 A;  4DHZ B;  2KFJ A;  2LRU A;  2DZM A;  5D7G A;  5E6N A;  2CHX A;  3RYT A;  5AZF A;  2FID A;  2KZR A;  1UBQ A;  4TV3 A;  1Q0W B;  2K8H A;  3C0R B;  4G3X B;  4GN1 A;  3PLU A;  4IM3 A;  5G2N A;  5JZE B;  2KKC A;  1IYF A; 
#chains in the Genus database with same CATH topology
 1GNU A;  4LJP B;  3ZNG C;  1TJE A;  3APF A;  1KFY B;  5D3D A;  2KLG A;  3AEF B;  2JF5 A;  3A9J A;  3HM6 X;  3VR8 B;  4DXG A;  1RYJ A;  4M8M A;  2QSD A;  2DYB A;  2INN E;  2R61 A;  3EEC A;  4XDC A;  2MJD A;  2VH2 A;  2PPH A;  2HD5 B;  3VTU A;  2OJW A;  3WAL A;  4RGT A;  3ZW3 A;  1UGJ A;  1FRD A;  4NAM A;  4WAF A;  2N1W A;  1I4R A;  5IKC M;  2KD0 A;  4RGN A;  4RGO S;  1MVK A;  2HDE A;  2WX1 A;  1JRP A;  2WXG A;  1V9J A;  2BYV E;  3ZTC A;  2KFK A;  3SR6 A;  3MHZ A;  4MDK E;  1NYQ A;  1SSN A;  1V2Y A;  2AEH A;  3PPA A;  2J7Q B;  4W9G A;  2VZK D;  3DDC B;  4MGZ E;  2JSV X;  2K5P A;  4IG7 B;  4BKS D;  4NNJ B;  4ZRJ A;  2IY0 B;  4HPL B;  5C23 A;  4ZYS A;  1L0Y B;  4MM3 A;  3DVN V;  2KAJ A;  1MG8 A;  3Q8F A;  5DPT A;  2D07 B;  3L4P A;  2J53 A;  4XC2 A;  3WA0 A;  3EFC A;  1WYG A;  1T3Q A;  1SJH D;  5LXH A;  4L23 A;  1ZPS A;  4JL9 A;  1EM7 A;  4WWP A;  4A20 A;  2M19 A;  3HIZ A;  4EE2 A;  4DWF A;  1UH6 A;  2CU1 A;  2YVC A;  4C56 C;  3A4S C;  1A70 A;  2LWP A;  5CHV C;  2NTT A;  2INP E;  2TSS A;  3NY5 A;  1LQB A;  2JWU A;  1WSP A;  2K3U A;  2Z0D B;  2L0F A;  2NBV B;  3ZVV A;  3RNB C;  1MPE A;  4AP4 C;  1ACC A;  1VZ6 A;  3Q6B A;  4MJS A;  3DBH B;  3DWG C;  4WJQ A;  2KC2 A;  5FR3 A;  4ANX A;  3QK0 A;  3JVZ X;  2BKR B;  4HKZ E;  1WM2 A;  2LD9 A;  1FRR A;  1M4V A;  3PZ7 A;  3W5V B;  1VR9 A;  2RR9 A;  3O65 B;  2WS3 B;  3VUY A;  3BVG A;  2H88 B;  2C7M B;  2MBO A;  4EKU A;  2DZJ A;  1N5W A;  1Q10 A;  4GOC A;  3WAN A;  4HCN B;  4PYU A;  1CK1 A;  3W1S A;  3ZNH B;  2RGF A;  3BZD B;  3V62 A;  1SE4 A;  4JLC A;  2ZNV B;  3VTW A;  3H6N A;  2MLB A;  4NPN A;  2IGG A;  4WJP A;  3CIR B;  4AOF A;  3QHT A;  2CHZ A;  3LXF A;  4FAD A;  3VDZ A;  1XF5 L;  1WE6 A;  4USA A;  4OZA A;  2Y5B B;  1OQR A;  1R7S A;  1EUV B;  1V49 A;  1QOG A;  1ESF A;  2PIA A;  3L17 A;  4ANW A;  1WJ4 A;  3U52 E;  4K3B A;  1XCQ L;  3QCA A;  4OHJ A;  2NMQ A;  3Q8A A;  2PKO A;  4JIO U;  1UBI A;  4DBG A;  1FXT B;  4YT0 B;  2INC C;  3DQV A;  1E90 A;  3KUD B;  3R8B A;  2AX5 A;  1T0R C;  2ICI A;  3HM3 A;  3AH7 A;  2WXP A;  1E7U A;  3UI3 A;  1MG4 A;  1WXM A;  2IGD A;  4G11 A;  2ZCC A;  1D4B A;  3OJ4 B;  2WHI A;  1CMX B;  3DOW A;  1J7C A;  3AEA B;  2J52 A;  1QT9 A;  5FK9 C;  4ITK A;  2JZZ A;  4LK0 M;  2KDM A;  4M02 A;  2IJ0 A;  3Q3M C;  3ZRF A;  4K1R B;  2BGF A;  5H92 C;  1YQ4 B;  5HG2 A;  1J7B A;  3N1Z C;  2J42 A;  1FM0 D;  2NS5 A;  3IAM 1;  1ZDV A;  2DLB A;  3AMZ A;  1WRD B;  2G9H D;  1PFD A;  1E8Z A;  2LXA A;  3GB1 A;  3KVF B;  2N9K A;  3PTF C;  2G1E A;  1BT0 A;  5LXI B;  1HXY D;  1L2N A;  3KLS X;  1VRA B;  2OED A;  2LJI A;  1FNW A;  4LNI A;  2M1M A;  4B0E A;  1LO5 D;  4US9 A;  3ZQ4 A;  2AWT A;  2OHF A;  3HVD A;  3FIL A;  1PGA A;  4MH8 A;  4MGK E;  4IW0 A;  2BT6 A;  2PTL A;  3E9S A;  1F9J A;  5C1Z A;  1P3Q U;  2LMC A;  1V5T A;  4YTP B;  4IC7 B;  4PT5 A;  2QIL A;  4A8X C;  2IO3 B;  3GZN B;  2WXK A;  2WXF A;  1CQV A;  3FKY A;  1NEN B;  1VCB A;  2W3S A;  1HEZ E;  4K81 A;  2QIE B;  3PRP B;  2KJ6 A;  2AL6 A;  1WRI A;  4XX5 A;  2K25 A;  1UUP A;  2ONQ A;  1WX8 A;  3LJ3 A;  1JML A;  3BVM A;  2O6V B;  4JGH B;  2KQ4 X;  2PE6 B;  1I4H A;  3VQI A;  4XYC A;  3BYY B;  4YSZ B;  2WXN A;  1FMA D;  4W9D A;  2LUE A;  1GJZ A;  1SBB B;  3DBR I;  1FFV A;  2W3R A;  1PDX A;  2VZK B;  1WYW B;  4XGA B;  1TYG B;  1WX7 A;  5CTR C;  1YJ1 A;  2R2Q A;  3C8Y A;  4P7I A;  3TBL D;  4FHJ A;  5DPR A;  1C79 A;  3DHH C;  4M8N A;  3OJ3 A;  4F8C B;  4KIK B;  5CX3 A;  1KRH A;  1WZ3 A;  1P7F A;  3SU8 X;  4HWI B;  1IGC A;  2ACZ B;  2BS4 B;  3JW0 X;  1XLO A;  3ZTD A;  3Q3F A;  2PVO D;  3IT6 B;  1SF0 A;  5HI1 A;  4HJG E;  5BMG A;  1E6E B;  1ZKH A;  3Q8E A;  3AE3 B;  4ARI A;  3VRA B;  3UIN B;  2M17 A;  2ZEQ A;  4KDL B;  3AE4 B;  1C78 A;  1I42 A;  2RSU A;  4TSS A;  1I4Q A;  3ZLZ A;  3BY4 B;  1OQQ A;  3RNG C;  4WIP A;  4HKQ A;  1E8X A;  1Z2M A;  4XZ4 A;  1ZXI A;  2PJH A;  1GB4 A;  2XEW A;  2UYZ B;  1VJK A;  4NAW A;  1P1A A;  5AEK B;  1IYF A;  4CYE A;  2LRU A;  4A9A A;  4P6V F;  5AZF A;  1UBQ A;  1Q0W B;  3I5J C;  3AV8 A;  1L4Z B;  2D2Q A;  4KSK C;  1WJU A;  4ZRK A;  2KNB A;  3A9K A;  4GDL B;  3NS8 A;  4URK A;  2ZZP B;  1V8C A;  1LFD A;  1ZP0 B;  5I4D A;  2XN9 C;  2Y5C A;  4ZRQ A;  5EE9 A;  3A1Q B;  4NJC A;  2Z8L A;  2E6X A;  2FUG 1;  4NJ7 A;  4LDT D;  1FXI A;  1UZX B;  2E3T A;  1P0R A;  1H4R A;  4G0N B;  5JHB A;  4KGS A;  1XEE A;  3GZN I;  2RPV A;  2ZPY A;  3I63 C;  1WJN A;  5T8I A;  4DDI D;  2RDB C;  3A9J B;  5G5H A;  1F77 A;  4FA6 A;  3MFG A;  4C7Y A;  2AQ2 B;  2RDG A;  4WH4 A;  5EE0 A;  1J0G A;  4IM0 A;  3Q69 A;  4DK5 A;  1EF5 A;  4EZJ A;  3APC A;  5LLI A;  3X0W A;  2N4F A;  1WGY A;  1TKG A;  4GB9 A;  3LDZ E;  2WXQ A;  2KTR A;  4KGT A;  4H2A A;  3A33 B;  4UDU C;  1XLP A;  2DBY A;  3VR9 B;  1TTN A;  2DZI A;  1YJJ A;  2MWS B;  3Q8B A;  2W82 A;  3OLM D;  3W2D A;  4JQW C;  3A4R A;  1NEK B;  1WR6 E;  2L7R A;  4X57 B;  2QCZ A;  3DVN U;  4QAY A;  3AE1 B;  2MBE A;  1YJI A;  3Q3N C;  4FXC A;  5AUK A;  1EWY C;  3IXS A;  1Q5W B;  1NYR A;  1RWS A;  4GDL A;  3SD5 A;  2WXJ A;  2WXH A;  3L10 B;  1QOB A;  1T0Q C;  3CMM B;  3PVL A;  2G4S A;  2BW2 A;  1IBX A;  2MW5 A;  2LJ5 A;  3AEE B;  1VLB A;  2WU2 B;  1UEL A;  2UU7 A;  5C3J B;  2L83 A;  1YN4 A;  1WXA A;  5GXG B;  1WIA A;  2IYD B;  3PO0 A;  3N9Y C;  4MGY E;  4A6Q A;  2NTS A;  4LNK A;  2JT4 B;  1T6B X;  1HE8 A;  1STE A;  4ZRI A;  1QQR A;  1XCT L;  2MH7 A;  2Y5P A;  1GC7 A;  2N9X A;  1YQB A;  2GBM A;  4RMA A;  2MBQ A;  2C60 A;  3NVV A;  3A9K B;  3RZF A;  3X23 A;  3K9P B;  1WWT A;  2KOX A;  3VTV A;  1JWA D;  1L5P A;  3CSF A;  3U30 A;  1V81 A;  3EGR A;  1FPY A;  2AQ1 B;  1R4N B;  5BYS A;  3EC8 A;  1G6J A;  2Z0E B;  3UIO B;  4BOZ B;  2GOW A;  4LTU A;  4KKI A;  1WMH B;  2M0X A;  5G5G A;  5DPW A;  3RMK C;  4B0M A;  3ZJU A;  2JY6 A;  4FJV B;  3RFZ B;  3N20 C;  1PGB A;  2KDE B;  3U2S C;  1V80 A;  3IHP C;  5EE3 A;  2JWZ A;  2PLP A;  3V60 A;  3PS6 A;  1F0Z A;  4EOY A;  2KO3 A;  4DXA B;  3PRZ A;  2N9E B;  2RD0 A;  5BMI A;  3P2B A;  3BII D;  1TIF A;  4I6N B;  5CHW A;  4C7Z A;  4I6P A;  2YEP F;  3RNF C;  1WJ6 A;  4GDK B;  2WXR A;  3DBL I;  1K51 A;  3AB5 A;  3KUZ A;  4GSW A;  4N9F 4;  4DHJ B;  1TY2 A;  4OZC A;  1OEY A;  1E9M A;  1XXG A;  2RMM A;  1GOZ A;  2WQY B;  2I1K A;  3A1Q A;  2D3A A;  3Q8C A;  2O6V D;  4RGM A;  5E6J A;  2MP2 B;  2RDH A;  3UIP B;  1SEB D;  3TSS A;  3JSV A;  2IZV B;  5IOI A;  2WNM A;  4YTM B;  2DAF A;  4LNN A;  4IM2 A;  4TKN A;  3KH0 A;  5E6O A;  3ZO5 B;  1T5X D;  2NBW B;  2LHE A;  2BB6 A;  3AEB B;  3VAW A;  4ANU A;  4J6I A;  1HQR D;  2GRI A;  1OTR B;  2J4X A;  3ZJT A;  2WDR B;  3ZYY X;  4GU2 A;  2DEN B;  1LGR A;  3B9J A;  4EEW A;  1JWU D;  1QOF A;  1RLF A;  3H8H A;  3RNC C;  3PGE A;  2GBJ A;  3IG3 A;  2DWQ A;  2ZCB A;  1I4X A;  4KV2 A;  2R2O A;  4LDT B;  2FAZ A;  3NG0 A;  1KTK A;  3M63 B;  1PQS A;  3W5U B;  1SXT A;  1NI3 A;  2L3Z A;  4L1B A;  4F7Z A;  2OJR A;  3T8M A;  4FBJ B;  2JXT A;  5EDS A;  1UWX A;  1IBX B;  3DVG X;  1XD3 B;  4EZL A;  3GS2 A;  2EKI A;  2IO0 B;  2JRH A;  2AQ3 B;  4KVG B;  2JZP A;  2WXM A;  1L0X B;  2KWD A;  2LXC A;  3I9V 1;  1R4M B;  1YD8 U;  2MRP A;  1WY8 A;  2QJL A;  3N1Y C;  4DQO C;  4ZOH C;  4BKG A;  4B6W A;  2JZ3 B;  3P4S B;  5DCN A;  2N9P C;  3P4P B;  2CKH B;  3PRE A;  3SHQ A;  1FNV A;  1WGK A;  3VUW A;  2BYT A;  4BKT A;  4FLH A;  3VHT C;  3BYT B;  3MJ5 A;  1Q1O A;  3TL5 A;  2JXX A;  3ZKJ C;  1D5X C;  1MI0 A;  1K53 A;  1V1P B;  4A55 A;  1I4P A;  5BYQ A;  2EKE C;  3NVW A;  2HJ8 A;  4B95 A;  5AZG A;  3L13 A;  2WXL A;  1PYW D;  2PVG C;  2GBN A;  1JAL A;  1PUT A;  2I38 A;  2PEA A;  1HTQ A;  3H7P A;  3RUL A;  2AL3 A;  2HTM E;  2KT7 A;  4S17 A;  2FNJ B;  2JPH A;  2PW9 A;  2WYQ A;  2I2Y A;  2WDQ B;  3RD2 A;  1E8W A;  3JYU A;  2CS4 A;  2HE7 A;  3URY A;  4K7W A;  4MSQ B;  3AN1 A;  1YOV B;  4TQ0 A;  2WXO A;  1VZ8 A;  4WJN A;  1ZUD 2;  1GPX A;  2LGD A;  1N5X A;  4HDQ A;  4ASW C;  3V6E B;  1M94 A;  1WGR A;  4ICU A;  4AQ7 A;  1DYQ A;  1FIQ A;  2CHX A;  4C00 A;  3RYT A;  2D5G A;  2LGI A;  1UWM A;  4XDD A;  1N62 A;  2BVC A;  4TV3 A;  1N61 A;  4GN1 A;  4K7S A;  2XNA C;  4CQN A;  4BBN F;  3U7D A;  1YN5 A;  4YWG G;  2LEK A;  3TMP B;  1LXD A;  4HRO A;  1YMH E;  1ZXH A;  1P9D U;  4W9E A;  3MC8 A;  3R2I A;  1V6E A;  5KHO A;  2M56 B;  3TEY A;  3ZXV A;  2NCN A;  4ARC A;  3LB8 C;  2MEK A;  1HA5 A;  2MJE A;  2VRR B;  1F2R I;  4REZ A;  2WXI A;  3FAH A;  4BZA A;  4YSX B;  4IWQ A;  2BBC A;  3QX1 A;  3ABV B;  1WXQ A;  5MPO A;  1VDV A;  1UF0 A;  3PT2 B;  3PV1 A;  4BKS A;  4MSM B;  2MJ3 A;  4MH0 E;  4IUM B;  1SE2 A;  4OW0 A;  1WXV A;  4WUR A;  2GB1 A;  3PZ8 A;  3TEX A;  3EA6 A;  3AE6 B;  1TT5 B;  4WWO A;  1P98 A;  1AN8 A;  4NZL B;  2DAJ A;  1V86 A;  2WP9 B;  2MHJ A;  3PSE B;  4MJS B;  4GGQ A;  4WWN A;  2L1A A;  2JU6 X;  2GBK A;  1RAX A;  3OWE B;  4RF0 A;  3I57 A;  3FC4 A;  3R7R A;  4HEA 1;  4JX1 C;  4OVZ A;  5HKH A;  4HCP B;  3TEW A;  2W54 A;  1MHH E;  1ROE A;  2QMT A;  4EFO A;  1WMH A;  4O1N A;  5DPS A;  2DNF A;  2N9L A;  1EO6 A;  3B1L X;  2IND C;  5D6J B;  4IWP A;  5BMH A;  2FCN A;  3P4R B;  5L83 A;  1YIW A;  1J7A A;  2NPT B;  4RNA A;  4R3D A;  1GUA B;  4KKJ A;  2O2V A;  1E7V A;  3NRZ A;  1WGD A;  1IUE A;  4DDG D;  1FO4 A;  4K3C A;  3HVZ A;  1D5Z C;  2JVC A;  1XQQ A;  3OG5 A;  3DVG Y;  4LCD E;  4M00 A;  2HTH A;  3KWV A;  5KHQ A;  2KDF B;  4ZYN A;  1DOY A;  1YNT E;  1JWB D;  1MFW A;  4JE3 B;  3KYD D;  4S0R A;  1C77 A;  2FUH B;  4IKG A;  1L6V A;  3B08 A;  3RNE C;  1OFF A;  1YX5 B;  2K39 A;  3AXC A;  3AI5 A;  2MCN B;  2SEB D;  1F52 A;  1X1M A;  5C2T B;  3MJW A;  3UQB A;  3VUX A;  1YX6 B;  3PLV A;  4N59 A;  3O13 A;  2BKF A;  4AJY B;  5IO9 A;  1BUI C;  2IBI B;  2B3A A;  3UGB B;  4PS7 A;  1C1Y B;  3VXW A;  3D32 A;  3IBE A;  3V61 A;  4NJ6 A;  5D3I B;  2KWV B;  4HJK A;  1HZ6 A;  2KJR A;  4FJY A;  2KMC A;  1R4M I;  1VZ7 A;  4TUU A;  2KAN A;  3QA8 A;  4YL8 A;  4N58 A;  2KTR B;  4GDK A;  2ZW0 A;  2XK5 B;  4RM8 A;  1D6E C;  3S2A A;  5FKA C;  2X38 A;  1WR1 A;  3TUO A;  2K9X A;  5J18 A;  4BFR A;  3KQ4 A;  5J17 A;  1C76 A;  1ENF A;  3RN9 C;  1AYF A;  2G3Q B;  3ETR A;  1SB3 C;  2KK8 A;  2N7E A;  5D2M B;  2G45 B;  1B9R A;  1KLU D;  3T3N A;  3TJP A;  3L54 A;  3MP9 A;  2MBB B;  2JYT A;  3I3T B;  4GLS C;  1P7E A;  2G4D B;  5IAA C;  5JH5 C;  4FUL A;  3M95 A;  2LAS A;  2QEJ C;  3NZ3 A;  5HFY A;  1SIF A;  4ZHP A;  3UQA A;  1WE7 A;  3ZUN A;  3AU5 A;  3QIJ A;  2V4I B;  3RPF C;  4XE0 A;  2KXJ A;  2QHO A;  2ZJD A;  4W9I A;  4IWO A;  3E56 A;  1S1Q B;  2GBR A;  3BK2 A;  1XO3 A;  1AW7 A;  1NDD A;  2IGH A;  4HK2 A;  1OQY A;  2J0M A;  4NQK E;  3W9C B;  1WX9 A;  4NQL B;  1C4A A;  5IP4 D;  5LNK 1;  1F1H A;  1QZE A;  3BIN A;  1ISN A;  2IDY A;  1JQ4 A;  4W9C A;  2N7D A;  4W9J A;  2W55 A;  1IPG A;  3W1Y A;  1XLN A;  1GB1 A;  1SGH A;  2KVZ A;  3U8Z A;  3IAS 1;  1WI0 A;  1TZO A;  2UWQ A;  3DCG A;  2KN4 A;  2FE8 A;  4E74 A;  2JYE A;  5CHF A;  3SFD B;  1WGH A;  1L4D B;  1J8C A;  3SDL C;  3NS1 A;  2IO2 B;  2WGS A;  1DOI A;  2N1V A;  1V1O A;  3U4E G;  3LYY A;  4FN2 A;  4C80 A;  1ET6 A;  3P1M A;  3N30 A;  4LJO B;  1TGZ B;  3ENE A;  2KJH B;  2EEL A;  3B2G A;  2CU3 A;  2D3C A;  4L2Y A;  4C4V A;  3QQ8 B;  4HVB A;  4E71 A;  1E7P B;  3K9O B;  3PZD A;  2ON8 A;  4US8 A;  1L7Y A;  3VVW B;  4II2 B;  4M0W A;  4M0W B;  3ML8 A;  4D2K A;  4WWM A;  2D3G A;  2REX A;  2LHD A;  1SIJ A;  3NOB A;  2D11 A;  5J2R A;  3TIX A;  4BOS C;  1V1P A;  1JRU A;  4EUT A;  2BQQ A;  3NVY A;  1V5O A;  3DBR B;  4PK1 A;  3GP7 A;  4G50 A;  3WAM A;  4XWT A;  3Q3O C;  4B9K A;  1YQ3 B;  4LLG M;  1IGD A;  3AEG B;  3VFK A;  2K6Q A;  2M8S A;  3R2T A;  1ZE3 D;  2DYO A;  3AEC B;  4KZC A;  4PYZ A;  2ASQ A;  3TCA A;  3H9D A;  2LGX A;  4KGR A;  3BVZ A;  3QJZ A;  2VH1 A;  2XK5 A;  4P1C C;  2NBU A;  2YLM A;  2L0T A;  1TS5 A;  2L32 A;  2V0G A;  2BWE S;  1OGW A;  4RM9 A;  3BWU D;  1UNS A;  4Q2J A;  2QC8 A;  1EU3 A;  2KDI A;  2EMT A;  3EHV A;  2L05 A;  1NVI D;  1CZP A;  4YSY B;  2M0A A;  2WU5 B;  1NBF C;  2L52 A;  4JWU C;  2FCQ A;  5E6P A;  3DBH I;  1QIL A;  2GI9 A;  2N0S B;  2W9N A;  1QKZ A;  3AE2 B;  2V3N A;  1U4A A;  3DHI C;  3DBS A;  3AED B;  4YXD B;  3DWM A;  3WCQ A;  5JHA A;  2ZPN A;  3TEZ A;  4N6E B;  2KN5 A;  5D7G A;  2DZM A;  5E6N A;  3AM9 A;  1ZOY B;  4RF1 A;  2KMM A;  3DHG C;  1RFK A;  4G3X B;  3C0R B;  5G2N A;  4GIV A;  5JZE B;  4RH6 A;  1D3Z A;  4ACF A;  4DXF A;  1TY0 A;  2BB5 A;  2FBW B;  1FEH A;  3PHX B;  2YEP B;  5TR5 A;  3KW5 B;  3EUB 2;  2L76 A;  1TKE A;  1DOX A;  4DHJ D;  1EU4 A;  3NUH B;  1E8Y A;  3MTN B;  3VH3 B;  2KC1 A;  3MHS D;  1FD6 A;  4BAX A;  4MGI E;  3IT4 B;  1KOT A;  2DX5 B;  4W9K A;  2WLB A;  3QAQ A;  4JPS A;  4F1S A;  1WF9 A;  3AE9 B;  3IFW B;  1Y56 A;  3B0A A;  1KJT A;  3UF8 A;  1HZ5 A;  2V1Y A;  1GC6 A;  3R66 C;  3L0W B;  2JUO A;  4A3O A;  4TQ1 A;  4NAW B;  1Y8R C;  3DBL B;  2BWF A;  4ZRP A;  4JWS C;  2IO1 B;  3ZXR A;  3NZU A;  1LM8 B;  4YTN B;  1ZDX A;  3KUC B;  4HPP A;  3ZDM C;  1C4P A;  1FCC C;  1RRB A;  3QWZ B;  3GE3 C;  3N1X C;  4HPM B;  5AZH A;  4MEM A;  4W9L A;  2MBH A;  2J0J A;  1C3T A;  1H8C A;  1I4G A;  3H7S A;  3ML9 A;  3U7Z A;  1RFA A;  1CJE A;  3RNA C;  2NPT A;  2HJ1 A;  1XT9 B;  2WDV B;  2D10 A;  1WFY A;  2KFK B;  2KYW A;  1B1Z A;  2MX2 A;  2V3P A;  3Q3J A;  3ECI A;  2LGS A;  1JCK B;  4ICV A;  2J0K A;  2LVO A;  2LVQ A;  3P63 A;  1TKY A;  2C9W B;  5AUI A;  2BF8 B;  2K22 A;  3RCZ A;  3ZJV A;  4OVV A;  3CST A;  2XBB C;  1N63 A;  2C5L C;  1VD2 A;  2FCS A;  5JXV A;  1DGJ A;  2FIF A;  2V4L A;  1AWD A;  4KSL C;  2GMI C;  1N6Z A;  1EF1 A;  2K0P A;  3W1S C;  3QC8 B;  4MT5 A;  1SJE D;  3RUI B;  1BXT A;  1XLQ A;  2KQS A;  4KZ0 A;  1SE9 A;  1IP9 A;  5H8Y E;  5BYR A;  2K8B A;  3T3O A;  3RT3 B;  1KLG D;  3NJT A;  5HHD G;  3MC0 B;  3RZW C;  3ZNI D;  3M62 B;  4IDI A;  3RI7 C;  2WX0 A;  4P1B C;  3QAR A;  2H89 B;  3J9C A;  3CWI A;  1NI2 A;  4XWW A;  1FNU A;  1SE3 A;  3ZNZ B;  1V97 A;  1BML C;  2LZ6 A;  1QOA A;  1FFU A;  1J19 A;  3L08 A;  3Q14 C;  3HUI A;  4E3C A;  1TS2 A;  4OZB A;  4MEL A;  2LFI A;  3AUL A;  4MM3 B;  2L00 B;  2KX3 A;  1GG3 A;  1R4N I;  3R7Q A;  2X8X X;  4FHK A;  2BS3 B;  2I1J A;  3VRB B;  4LNO A;  4J3O D;  2LGY A;  3GOE A;  4DHZ E;  3CF6 E;  4ZHO A;  2KMA A;  3NHE B;  1JWM D;  2PE9 A;  3HRD D;  1KM7 A;  2PMV A;  3Q2A C;  4I6L B;  3PLU A;  4BBN C;  2JQR B;  2V9H A;  5BO4 B;  2DHZ A;  2IY1 B;  3ZIM A;  2Q5W D;  1WXS A;  3AU4 A;  4AS1 A;  1I7H A;  1AAR A;  2M4N A;  2KQ7 A;  3OAW A;  3ZRC A;  1HTO A;  4NY0 A;  2KLC A;  3MC9 A;  2O6V A;  4HXD A;  2BYF A;  2ZVN A;  1S3S G;  2BYE A;  3KYC D;  3KWL A;  4BVU C;  3H7P B;  2MP2 A;  3V6C B;  2CR5 A;  2KVR A;  2MA9 B;  2KWU B;  1F2R C;  1GAQ B;  3JSV B;  2CHW A;  2K6D B;  1PGX A;  2KTF A;  1OEY J;  3FIL B;  1UD7 A;  3GE8 C;  4FJZ A;  5GMV A;  1TS4 A;  1MHX A;  5IA7 A;  3PRM B;  2FCM A;  1I35 A;  3N3K B;  3V3X A;  2KAC A;  1K52 A;  4P16 A;  3ZGZ A;  4IOI E;  2CJN A;  1L6U A;  1MJD A;  1E0Z A;  4A3P A;  5L95 C;  2WDT B;  3BK1 A;  4RCO A;  3WAP A;  3C19 A;  3EFU A;  1TZ1 A;  2C7H A;  4WQO B;  4CHK A;  2BPS A;  3IVF A;  1C4C A;  2MSE D;  1T0Y A;  4HRS A;  4PS3 A;  3WAO A;  4HDO A;  1FCL A;  1L0V B;  4C4V B;  1N60 A;  1ZW7 A;  2NR2 A;  4AJW A;  2N7J A;  1JW9 D;  4CO7 A;  4PS8 A;  2IPK D;  3VH4 B;  2GLS A;  3HK0 A;  1T0S C;  4ANV A;  4M01 A;  4GMV A;  3H1U A;  2SAK A;  3HHM A;  5TSS A;  2KWC A;  1KLV A;  2Z59 B;  2L8J A;  3AE7 B;  2ZVO A;  1E10 A;  1TS3 A;  4KIK A;  2A4Z A;  2DYM A;  3AE8 B;  3ALB A;  4EZK A;  3R3M A;  1QLB B;  1E5W A;  4OVU A;  2OOB B;  4A90 A;  3APD A;  2LRW A;  3SFE B;  4ZDV A;  2LUM A;  4KDI C;  4WQM A;  3M3J A;  5EE1 A;  1KH0 A;  4HLE A;  2CJO A;  2V3S A;  1WGG A;  5FR6 A;  2BS2 B;  2D3B A;  1JRO A;  2QDF A;  4GXB A;  2RPQ A;  3WIM A;  2C7N B;  4AUQ C;  2B76 B;  3AE5 B;  4WAA A;  4MAC A;  1QF6 A;  2DZK A;  4WJO A;  1WH3 A;  4RFB A;  3ZDT A;  2K1F A;  3N32 A;  1YN3 A;  1C9F A;  2Y3A A;  4KX6 B;  2BTE A;  2AYO B;  2WWZ A;  2LI5 A;  2A5U A;  3P4Q B;  2NVU I;  1RM6 C;  3NZS A;  4TMA B;  1D5M C;  3DPD A;  1UGM A;  3SEB A;  1JWS D;  1K8R B;  5IN7 A;  2ZNV C;  2LVP A;  1K50 A;  2JRI B;  1FXA A;  5G55 A;  3PHW B;  3L16 A;  2EMS A;  3T9L A;  2KHW B;  2O2V B;  1WM3 A;  1ZGU B;  4W9F A;  4LNF A;  4K7U A;  1ET9 A;  2K8C A;  1EWC A;  2KDB A;  4AWJ A;  1TBE A;  3V05 A;  3ONS A;  2KX0 A;  3B2F A;  4W9H A;  1A5R A;  5D94 A;  1KF6 B;  2MQJ A;  3P42 A;  1WZ0 A;  1Z5S B;  4DHZ B;  2KFJ A;  2JX5 A;  2ZW1 A;  3NVZ A;  2FID A;  2KZR A;  2K8H A;  4IM3 A;  4II3 B;  2KKC A; 
#chains in the Genus database with same CATH homology
 2D2Q A;  1GNU A;  4LJP B;  4KSK C;  3ZNG C;  1D3Z A;  4BBN F;  3U7D A;  1WJU A;  3APF A;  4ZRK A;  3TMP B;  2KNB A;  3PHX B;  2KLG A;  1LXD A;  3A9K A;  5TR5 A;  3KW5 B;  2JF5 A;  3A9J A;  3HM6 X;  4GDL B;  3NS8 A;  4URK A;  2ZZP B;  4M8M A;  1LFD A;  2L76 A;  2DYB A;  3EEC A;  1P9D U;  4W9E A;  4DHJ D;  1V6E A;  3A1Q B;  5KHO A;  1E8Y A;  2PPH A;  3MTN B;  2KC1 A;  2HD5 B;  3VH3 B;  3VTU A;  3WAL A;  2NCN A;  3MHS D;  4NJ7 A;  4LDT D;  2VRR B;  1UZX B;  3ZW3 A;  4MGI E;  1KOT A;  2DX5 B;  1P0R A;  4W9K A;  4IWQ A;  3QX1 A;  3QAQ A;  1H4R A;  2N1W A;  4G0N B;  4F1S A;  5JHB A;  1WF9 A;  3GZN I;  3IFW B;  3B0A A;  1KJT A;  3PT2 B;  3PV1 A;  3UF8 A;  2ZPY A;  2KD0 A;  4BKS A;  1WJN A;  2V1Y A;  1GC6 A;  3R66 C;  4DDI D;  3L0W B;  4MSM B;  3A9J B;  2WX1 A;  4FA6 A;  2JUO A;  4MH0 E;  4TQ1 A;  4IUM B;  4A3O A;  1V9J A;  1WXV A;  2BYV E;  4NAW B;  1Y8R C;  2BWF A;  3ZTC A;  2KFK A;  1J0G A;  4IM0 A;  4WWO A;  4DK5 A;  2IO1 B;  1P98 A;  2DAJ A;  1EF5 A;  1V86 A;  4MDK E;  4EZJ A;  3PSE B;  4MJS B;  1V2Y A;  3APC A;  3NZU A;  1LM8 B;  2AEH A;  3PPA A;  2J7Q B;  2N4F A;  4GGQ A;  5LLI A;  4W9G A;  1WGY A;  3X0W A;  3KUC B;  2GBK A;  1RAX A;  3DDC B;  3ZDM C;  4GB9 A;  3LDZ E;  4MGZ E;  1RRB A;  3QWZ B;  3R7R A;  2KTR A;  3A33 B;  4HPM B;  4IG7 B;  5AZH A;  4BKS D;  4NNJ B;  4MEM A;  4ZRJ A;  5HKH A;  4HCP B;  4W9L A;  2MBH A;  2IY0 B;  4HPL B;  2J0J A;  1C3T A;  1H8C A;  1TTN A;  2DZI A;  3H7S A;  3ML9 A;  2MWS B;  5C23 A;  1RFA A;  3OLM D;  4EFO A;  1WMH A;  4JQW C;  3A4R A;  2NPT A;  1WR6 E;  5DPS A;  2L7R A;  1XT9 B;  4MM3 A;  3DVN V;  4X57 B;  1EO6 A;  3DVN U;  1MG8 A;  2D10 A;  5DPT A;  3B1L X;  2MBE A;  2D07 B;  5D6J B;  4IWP A;  1WFY A;  2KFK B;  4XC2 A;  3WA0 A;  2FCN A;  1Q5W B;  5L83 A;  1YIW A;  4GDL A;  2NPT B;  2MX2 A;  1GUA B;  3Q3J A;  5LXH A;  3ECI A;  4JL9 A;  3SD5 A;  2O2V A;  1E7V A;  4WWP A;  1WGD A;  3L10 B;  4ICV A;  4A20 A;  4DDG D;  2J0K A;  3CMM B;  2LVO A;  2LVQ A;  3PVL A;  2JVC A;  2G4S A;  1XQQ A;  2C9W B;  3HIZ A;  2BF8 B;  3DVG Y;  4LCD E;  3RCZ A;  2MW5 A;  4OVV A;  2HTH A;  3CST A;  2XBB C;  4DWF A;  2C5L C;  1UH6 A;  2CU1 A;  1VD2 A;  2KDF B;  5KHQ A;  2FCS A;  4ZYN A;  2YVC A;  2LJ5 A;  3A4S C;  2FIF A;  2LWP A;  2V4L A;  3KYD D;  5CHV C;  2FUH B;  3NY5 A;  1LQB A;  4KSL C;  2GMI C;  3B08 A;  1EF1 A;  1UEL A;  2Z0D B;  3W1S C;  2L0F A;  2NBV B;  1YX5 B;  2K39 A;  3QC8 B;  3ZVV A;  3AXC A;  3AI5 A;  2MCN B;  3RUI B;  1X1M A;  4AP4 C;  2KQS A;  3MJW A;  4KZ0 A;  1SE9 A;  1IP9 A;  3UQB A;  3VUX A;  4MJS A;  1YX6 B;  3PLV A;  2BKF A;  4AJY B;  2K8B A;  1WXA A;  4WJQ A;  2KC2 A;  3RT3 B;  1WIA A;  4ANX A;  2IYD B;  3QK0 A;  2IBI B;  2B3A A;  4MGY E;  3UGB B;  3JVZ X;  2BKR B;  1WM2 A;  2JT4 B;  2LD9 A;  1HE8 A;  1C1Y B;  4PS7 A;  3RZW C;  3M62 B;  3ZNI D;  4ZRI A;  3VXW A;  2WX0 A;  3D32 A;  3QAR A;  1GC7 A;  3IBE A;  2N9X A;  3V61 A;  2RR9 A;  1YQB A;  2GBM A;  3O65 B;  4NJ6 A;  4RMA A;  3VUY A;  2KWV B;  2MBQ A;  2C60 A;  1NI2 A;  4HJK A;  3A9K B;  3RZF A;  2KJR A;  3X23 A;  3K9P B;  4FJY A;  3ZNZ B;  2C7M B;  2KMC A;  1R4M I;  2LZ6 A;  2MBO A;  2KOX A;  3VTV A;  4EKU A;  4TUU A;  2DZJ A;  2KAN A;  3CSF A;  3U30 A;  3QA8 A;  4GOC A;  4YL8 A;  3WAN A;  4HCN B;  4PYU A;  1J19 A;  1V81 A;  3W1S A;  3ZNH B;  3L08 A;  2KTR B;  4E3C A;  4GDK A;  2RGF A;  3EC8 A;  2XK5 B;  1G6J A;  4MEL A;  4RM8 A;  2Z0E B;  3UIO B;  3S2A A;  3AUL A;  2ZNV B;  4JLC A;  3H6N A;  3V62 A;  3VTW A;  4BOZ B;  2MLB A;  2L00 B;  4NPN A;  2GOW A;  1WR1 A;  4WJP A;  2KX3 A;  1GG3 A;  1R4N I;  4K7S A;  1WMH B;  2M0X A;  3R7Q A;  4AOF A;  5DPW A;  3QHT A;  2CHZ A;  4FHK A;  5J18 A;  4BFR A;  5J17 A;  4FAD A;  3VDZ A;  2I1J A;  2JY6 A;  2G3Q B;  4FJV B;  1WE6 A;  2KDE B;  2KK8 A;  2LGY A;  2Y5B B;  3GOE A;  1V80 A;  2N7E A;  3IHP C;  5D2M B;  4DHZ E;  3CF6 E;  2G45 B;  2JWZ A;  1EUV B;  1V49 A;  3V60 A;  3PS6 A;  2KMA A;  4EOY A;  2KO3 A;  4DXA B;  3PRZ A;  2N9E B;  3TJP A;  2RD0 A;  3P2B A;  3L17 A;  2MBB B;  3L54 A;  3I3T B;  2PE9 A;  3NHE B;  4ANW A;  4I6N B;  1KM7 A;  1WJ4 A;  2G4D B;  4I6P A;  4I6L B;  5CHW A;  5IAA C;  4BBN C;  5JH5 C;  4FUL A;  1WJ6 A;  3M95 A;  3QCA A;  4GDK B;  2LAS A;  5BO4 B;  2DHZ A;  2IY1 B;  3ZIM A;  1SIF A;  1WXS A;  3AU4 A;  3DBL I;  1WE7 A;  3UQA A;  3KUZ A;  4JIO U;  1AAR A;  2M4N A;  1UBI A;  4GSW A;  4N9F 4;  3ZUN A;  1FXT B;  4DBG A;  4DHJ B;  3AU5 A;  1OEY A;  3QIJ A;  2KQ7 A;  3OAW A;  3DQV A;  3ZRC A;  1E90 A;  3KUD B;  4NY0 A;  2KLC A;  2KXJ A;  2I1K A;  2QHO A;  2ZJD A;  3A1Q A;  4W9I A;  2O6V A;  4HXD A;  2BYF A;  2ZVN A;  4IWO A;  1S3S G;  2BYE A;  2O6V D;  1S1Q B;  3HM3 A;  3KYC D;  4BVU C;  2MP2 B;  2GBR A;  3H7P B;  2MP2 A;  1E7U A;  1WXM A;  3V6C B;  3UIP B;  1NDD A;  4G11 A;  2ZCC A;  3OJ4 B;  2CR5 A;  2KVR A;  2MA9 B;  2KWU B;  4HK2 A;  1CMX B;  1OQY A;  3DOW A;  3JSV A;  2IZV B;  2CHW A;  3JSV B;  2J0M A;  2K6D B;  4NQK E;  1WX9 A;  4NQL B;  2KTF A;  1OEY J;  2DAF A;  1UD7 A;  2JZZ A;  4IM2 A;  4TKN A;  4FJZ A;  5GMV A;  1QZE A;  3KH0 A;  5E6O A;  3ZRF A;  4K1R B;  3ZO5 B;  3BIN A;  1ISN A;  5IA7 A;  2BGF A;  2NS5 A;  4W9C A;  3PRM B;  2N7D A;  1WRD B;  4W9J A;  1IPG A;  2FCM A;  3W1Y A;  1I35 A;  3N3K B;  2NBW B;  3VAW A;  1SGH A;  4ANU A;  1E8Z A;  4J6I A;  3U8Z A;  1WI0 A;  1OTR B;  2LXA A;  2UWQ A;  3DCG A;  3KVF B;  4E74 A;  3PTF C;  4A3P A;  5CHF A;  1BT0 A;  5L95 C;  1WGH A;  2WDT B;  4GU2 A;  1J8C A;  3SDL C;  5LXI B;  1L2N A;  2DEN B;  3WAP A;  3EFU A;  4EEW A;  1TZ1 A;  1RLF A;  2C7H A;  2IO2 B;  2BPS A;  4WQO B;  4CHK A;  2N1V A;  2M1M A;  3IVF A;  2MSE D;  1T0Y A;  4FN2 A;  4PS3 A;  3WAO A;  2AWT A;  3PGE A;  4HDO A;  2GBJ A;  3IG3 A;  3N30 A;  4MGK E;  4IW0 A;  1ZW7 A;  2ZCB A;  4LJO B;  2NR2 A;  4KV2 A;  1TGZ B;  2R2O A;  4LDT B;  4AJW A;  1F9J A;  3ENE A;  5C1Z A;  1P3Q U;  2FAZ A;  4CO7 A;  3M63 B;  1PQS A;  2KJH B;  1V5T A;  4PS8 A;  4IC7 B;  2IO3 B;  2L3Z A;  4GIV A;  1VCB A;  3VH4 B;  4F7Z A;  2OJR A;  3T8M A;  3HK0 A;  4ANV A;  4FBJ B;  3QQ8 B;  4HVB A;  4E71 A;  5EDS A;  3K9O B;  3PZD A;  4GMV A;  3H1U A;  3DVG X;  1XD3 B;  4K81 A;  4EZL A;  1L7Y A;  3VVW B;  3HHM A;  4II2 B;  2KWC A;  4M0W B;  1KLV A;  2IO0 B;  2JRH A;  3PRP B;  2KJ6 A;  2AL6 A;  4KVG B;  2Z59 B;  3ML8 A;  4XX5 A;  2K25 A;  2L8J A;  2D3G A;  2REX A;  1WX8 A;  3LJ3 A;  2ZVO A;  2LXC A;  1YD8 U;  2O6V B;  2MRP A;  3NOB A;  4JGH B;  4KIK A;  2A4Z A;  1WY8 A;  2PE6 B;  2D11 A;  5J2R A;  2DYM A;  3TIX A;  4BOS C;  3ALB A;  4EZK A;  3R3M A;  1JRU A;  3VQI A;  1E5W A;  4BKG A;  4EUT A;  4B6W A;  2JZ3 B;  4OVU A;  1V5O A;  5DCN A;  2OOB B;  2N9P C;  3APD A;  2LRW A;  2CKH B;  4G50 A;  3WAM A;  4ZDV A;  3PRE A;  4KDI C;  2LUE A;  4W9D A;  3SHQ A;  4B9K A;  3M3J A;  1GJZ A;  3DBR I;  3VUW A;  4BKT A;  4HLE A;  2V3S A;  5FR6 A;  1WGG A;  1WYW B;  4FLH A;  3VHT C;  3VFK A;  3TL5 A;  1Q1O A;  2K6Q A;  2JXX A;  2RPQ A;  4GXB A;  2M8S A;  1WX7 A;  2C7N B;  1YJ1 A;  5CTR C;  3WIM A;  2DYO A;  3ZKJ C;  2R2Q A;  4WAA A;  4AUQ C;  4KZC A;  4P7I A;  3TBL D;  4FHJ A;  4PYZ A;  2ASQ A;  5DPR A;  3H9D A;  3TCA A;  2DZK A;  4WJO A;  4M8N A;  1WH3 A;  2EKE C;  2LGX A;  3OJ3 A;  2HJ8 A;  4KIK B;  5CX3 A;  4B95 A;  4F8C B;  5AZG A;  3ZDT A;  3L13 A;  1WZ3 A;  2K1F A;  3N32 A;  3QJZ A;  4II3 B;  3SU8 X;  2GBN A;  4HWI B;  3JW0 X;  3ZTD A;  2PEA A;  2AYO B;  2XK5 A;  2WWZ A;  2NBU A;  3H7P A;  2LI5 A;  2YLM A;  2AL3 A;  2L0T A;  2A5U A;  3Q3F A;  3RUL A;  2NVU I;  2FNJ B;  2JPH A;  2BWE S;  3NZS A;  1OGW A;  1ZKH A;  4RM9 A;  2KDI A;  2WYQ A;  3RD2 A;  2EMT A;  3DPD A;  1UGM A;  3EHV A;  1E8W A;  3JYU A;  2L05 A;  3UIN B;  2CS4 A;  1K8R B;  2M17 A;  2HE7 A;  2ZNV C;  2LVP A;  2ZEQ A;  2JRI B;  1NBF C;  4KDL B;  4K7W A;  4MSQ B;  1I42 A;  5G55 A;  3PHW B;  3L16 A;  2RSU A;  2FCQ A;  4WWN A;  2EMS A;  5E6P A;  3T9L A;  2KHW B;  4TQ0 A;  3DBH I;  2O2V B;  3ZLZ A;  1WM3 A;  1ZGU B;  3BY4 B;  4WJN A;  4W9F A;  2W9N A;  2LGD A;  1E8X A;  4HDQ A;  1Z2M A;  4K7U A;  4XZ4 A;  1U4A A;  2K8C A;  2KDB A;  3DBS A;  4AWJ A;  1TBE A;  2PJH A;  4ASW C;  3V6E B;  1M94 A;  3ONS A;  2KX0 A;  1A5R A;  2XEW A;  1WGR A;  2UYZ B;  4NAW A;  1P1A A;  2ZPN A;  4W9H A;  5D94 A;  5AEK B;  4ICU A;  5JHA A;  2MQJ A;  4CYE A;  1WZ0 A;  1Z5S B;  2KN5 A;  4DHZ B;  2KFJ A;  2LRU A;  2DZM A;  5D7G A;  5E6N A;  2CHX A;  3RYT A;  5AZF A;  2FID A;  2KZR A;  1UBQ A;  4TV3 A;  1Q0W B;  2K8H A;  3C0R B;  4G3X B;  4GN1 A;  3PLU A;  4IM3 A;  5G2N A;  5JZE B;  2KKC A;  1IYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...