2BWFA

Crystal sturcture of the ubl domain of dsk2 from s. cerevisiae
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
LDMSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLVKSQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Dsk2 Ubl and Uba Domains and Their Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords UBIQUITIN-LIKE PROTEIN DSK2
total genus 20
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2bwfA00
4WJQA 1V80A 4MGKE 3NHEB 1GC6A 3EECA 2MW5A 4EOYA 1OEYA 3M3JA 3KW5B 2MLBA 4BKGA 3MJWA 2M1MA 3WAPA 4FADA 2N9PC 1RLFA 4HPLB 2CKHB 4G11A 2KDEB 4FJVB 4FHJA 2JT4B 3V61A 1E8XA 4HXDA 1UGMA 3PTFC 2CHZA 2KKCA 5DPRA 2FCSA 3P2BA 3WALA 4AWJA 4W9CA 4ICUA 4CHKA 2O2VB 3PLUA 4BOSC 2CS4A 4FJYA 2MBBB 4GDLA 2LRWA 1Q0WB 3DVGX 3A9JB 3WIMA 2DYMA 3PLVA 4GOCA 2D11A 2D3GA 2KHWB 3UGBB 2JPHA 4KZ0A 2R2OA 3ZUNA 3RCZA 2L8JA 1WGDA 1WJUA 5L95C 4KDLB 5AZGA 4XC2A 3JSVA 4A20A 4DHJB 1RAXA 1IP9A 3ZLZA 4AP4C 3PGEA 5AZHA 1V49A 2CHXA 5BO4B 3VUYA 2MP2A 1K8RB 3JW0X 3QK0A 3B0AA 2D2QA 2KLGA 3ZVVA 1WXMA 1LXDA 3VH3B 2N9EB 3L10B 2JZZA 2QHOA 2MP2B 1E8WA 1EUVB 3L54A 3T9LA 3Q3JA 4W9EA 3X23A 1I35A 3HHMA 4IM2A 4EFOA 2Y5BB 3EFUA 1WF9A 2KNBA 2K6QA 4FN2A 2G45B 4BOZB 4XZ4A 2LZ6A 3ZDMC 1LFDA 2R2QA 3OJ3A 2PPHA 2VRRB 2A4ZA 4K7WA 3N3KB 2ZNVB 1V5OA 3WAOA 3U30A 3A9JA 2G4SA 2N9XA 3MHSD 3PRMB 5DCNA 1VD2A 4EZJA 3DPDA 2KFKB 4IW0A 1WY8A 2ZJDA 3ENEA 3H9DA 4JIOU 3KYDD 2IY1B 1P98A 2KFKA 2XBBC 3DBHI 3PHXB 4DK5A 2BKRB 2L3ZA 2GOWA 5G2NA 1EF5A 4KSKC 2LASA 4MSMB 3IHPC 4M0WB 2KQ7A 3C0RB 3APDA 3VAWA 2DZIA 3Q3FA 1WR6E 2REXA 2M0XA 2G4DB 4EKUA 2JF5A 1ZKHA 3TBLD 4MM3A 2KMCA 3L17A 2NBVB 1MG8A 4ZRJA 1XD3B 2M8SA 3RZFA 3ZTDA 4WJOA 2JY6A 2EMTA 3DBSA 3PZDA 3PRZA 2ZCBA 4EZKA 3UIOB 2DHZA 3ZW3A 2CR5A 2JVCA 2K25A 4OVUA 2PJHA 4TUUA 3KH0A 2XEWA 4YL8A 5DPTA 2MBHA 4W9JA 1ZW7A 1V9JA 2IY0B 3UINB 2C5LC 2JRHA 2RPQA 4K1RB 5DPSA 5L83A 2K39A 1I42A 2KANA 2O6VB 2XK5B 3APCA 2L05A 3JYUA 4J6IA 1HE8A 3VTVA 2DAJA 3APFA 2KZRA 4G50A 4HCNB 4MEMA 4NQKE 3ZIMA 5J18A 1OGWA 2AYOB 2DZKA 1GG3A 1T0YA 5JZEB 4B9KA 1WIAA 3PPAA 3GOEA 4IC7B 2KD0A 2MQJA 4W9IA 2MWSB 2LGYA 3QJZA 2KXJA 2FAZA 5KHQA 2KJ6A 4JGHB 3OJ4B 4MH0E 2NS5A 2LVOA 3DQVA 4GU2A 4HCPB 4PYZA 1OQYA 3K9OB 5E6NA 3TJPA 3V62A 2GBJA 1WXAA 4MSQB 3V60A 3KUCB 2RD0A 3VTWA 1VCBA 4FHKA 1TBEA 3ZNGC 4GIVA 4M8MA 5CTRC 2HE7A 4URKA 4W9HA 1KOTA 2IYDB 2NPTA 4MJSB 4AJWA 2V4LA 5J17A 3W1SC 3ZNID 2DYOA 2JRIB 5E6PA 3RZWC 4CYEA 3I3TB 5TR5A 1J8CA 1UH6A 2NPTB 3A9KA 2ZPYA 4ASWC 1LQBA 5HKHA 2DZMA 4KV2A 1E90A 1V86A 2MBOA 3ECIA 4NPNA 3U7DA 2GBKA 2BYEA 5AZFA 3UF8A 5JHAA 3RT3B 2KX3A 2L7RA 2RR9A 1E7VA 3AU5A 3AXCA 3KYCD 5CHVC 1H8CA 3UQBA 2Z0DB 3SDLC 2OOBB 2ZPNA 4OVVA 3V6EB 4BBNC 4IM3A 4DDGD 2KK8A 1H4RA 2KTRA 4KZCA 4ZRKA 2IO1B 2AL6A 1E5WA 4W9FA 2DAFA 1WX7A 4TKNA 2NVUI 2KLCA 5EDSA 2D10A 2DENB 3PSEB 4PS3A 4GDKB 4I6NB 2MCNB 1GC7A 4MGZE 1WJNA 2HJ8A 2NBWB 3ZNHB 4DDID 4RM9A 4GDKA 4BVUC 2WDTB 2KTFA 3BY4B 3ML8A 1C3TA 1P9DU 2K1FA 2L00B 2BPSA 2C7HA 2AWTA 2DYBA 2KVRA 3AI5A 4JL9A 1TTNA 4XX5A 3TCAA 4ICVA 1F9JA 1WGRA 4RMAA 2IO2B 3L16A 4HVBA 2V3SA 2UYZB 1ZGUB 3GZNI 3PVLA 3N30A 1NBFC 3QHTA 2EMSA 2LRUA 3L08A 2KC1A 3PV1A 4M8NA 5LXHA 2C60A 2M17A 1OTRB 4KVGB 3VDZA 1WRDB 2KDIA 3QC8B 1Y8RC 3ZO5B 1FXTB 2KX0A 4WJPA 4K81A 1WX9A 4ANXA 2ZNVC 3IBEA 2KN5A 1C1YB 2N4FA 2YLMA 3DBLI 3KVFB 3DBRI 3A33B 1WX8A 3CMMB 5C23A 1UZXB 2BWES 5AEKB 1Z2MA 2ZVNA 2V1YA 4II3B 4DHZE 3DVNV 2FIDA 4I6LB 2ZZPB 3ML9A 2ZEQA 2IO0B 2W9NA 3VQIA 1WGYA 4LDTB 3KUDB 3VTUA 3O65B 4NJ7A 3M63B 1SGHA 4PS7A 4WQOB 2HTHA 5JH5C 2WX0A 4NQLB 1J0GA 1WFYA 5FR6A 2OJRA 4E3CA 1ISNA 3CSFA 3PS6A 3VUXA 3PREA 1XT9B 4KSLC 2MSED 4MDKE 2EKEC 3DCGA 2D07B 1YIWA 3MTNB 4LJPB 4NAWB 3DOWA 5D94A 5KHOA 4TQ1A 1WGHA 3R3MA 2BF8B 3ZNZB 4EEWA 4I6PA 4W9GA 3EHVA 3VVWB 2KJHB 2BGFA 2XK5A 4GN1A 2ASQA 2Z0EB 4IG7B 3RD2A 2KJRA 2LWPA 4LDTD 5CHFA 2C7NB 2KOXA 4ZRIA 3D32A 3WAMA 4II2B 2LUEA 4PYUA 3AULA 2J7QB 3W1SA 2WYQA 5LXIB 3QAQA 1Q5WB 2FUHB 2RSUA 2MBQA 3EC8A 4FULA 4NNJB 4BBNF 1KLVA 4DHZB 4AJYB 2HD5B 4BKSD 4FJZA 5D2MB 4CO7A 3H7PB 3QCAA 5JHBA 2JXXA 2BKFA 2LGXA 2KWCA 3IG3A 3H7SA 4NJ6A 4WWOA 2WX1A 4TQ0A 4MJSA 2LD9A 4ZDVA 2IBIB 1J19A 3AU4A 4WAAA 1P0RA 3A9KB 2LJ5A 2A5UA 3QARA 3LJ3A 3TMPB 2KC2A 3L0WB 1UBQA 1WR1A 3PT2B 1KJTA 2K8CA 2KDBA 2CHWA 3B1LX 4HK2A 2YVCA 5LLIA 2AL3A 1GJZA 3B08A 1JRUA 1PQSA 1E8ZA 2O2VA 2GMIC 3NOBA 1WYWB 4PS8A 3DVGY 4IWOA 4KIKA 3U8ZA 5C1ZA 4WJNA 1WGGA 2FNJB 3VXWA 4F1SA 4AUQC 1KM7A 2AEHA 3NZSA 4WWPA 2B3AA 4GSWA 4HPMB 1L2NA 4RM8A 1X1MA 1WZ3A 3JSVB 4MGYE 4IM0A 3HM3A 4W9DA 3QQ8B 4N9F4 2JWZA 3ZRFA 2UWQA 3OAWA 3CSTA 1QZEA 1WE6A 2L0TA 2NR2A 2L0FA 1V2YA 1V81A 3S2AA 2LGDA 2K8HA 3QX1A 3IVFA 4ANUA 3H6NA 1P3QU 2O6VD 1WMHB 5D7GA 5DPWA 2KQSA 1WM3A 3WANA 4A3PA 3A4RA 1BT0A 4JLCA 3NS8A 4HLEA 3A1QB 3VUWA 4MGIE 1GNUA 2MRPA 2LVPA 4BFRA 3NY5A 3T8MA 3HK0A 1XQQA 2CU1A 3A1QA 4JQWC 2K8BA 1SIFA 4IWQA 4LCDE 5G55A 2J0KA 1Q1OA 4KIKB 4DBGA 3A4SC 4GDLB 3HM6X 3ALBA 5CX3A 1RFAA 4DXAB 4EUTA 3ZTCA 2KFJA 4HDQA 2LI5A 3WA0A 5IA7A 4HJKA 4BKTA 1WXSA 1NI2A 2LVQA 2BWFA 2GBNA 4ANWA 3QWZB 1S3SG 3X0WA 2KWVB 1YX6B 1OEYJ 3OLMD 1AARA 4ANVA 1V5TA 2PE6B 1WMHA 2J0JA 4EZLA 2IO3B 2ZCCA 4AOFA 1YX5B 2FIFA 2JUOA 1D3ZA 4IUMB 2C9WB 4KDIC 4W9KA 3QIJA 3V6CB 2DZJA 3ONSA 3R66C 1A5RA 3NZUA 4IWPA 4NAWA 2BYVE 3RUIB 3R7QA 3ZDTA 3TIXA 1S1QB 2N1VA 2ZVOA 2FCMA 2KMAA 4WWNA 2Z59B 2PE9A 3BINA 2NBUA 1Z5SB 2J0MA 3N32A 5CHWA 3SHQA 3RULA 1LM8B 3ZRCA 1U4AA 1WJ6A 2GBRA 1YJ1A 1YQBA 2M4NA 2O6VA 2FCQA 2N1WA 4W9LA 3ZKJC 3PRPB 1IYFA 4E74A 3L13A 4G3XB 2NCNA 3DVNU 4GGQA 4P7IA 2PEAA 1YD8U 3IFWB 3R7RA 4HWIB 2WWZA 2G3QB 1TZ1A 3JVZX 3TL5A 1WJ4A 1WE7A 5IAAC 3SU8X 1WI0A 3VH4B 4B95A 4F8CB 3HIZA 4LJOB 2BYFA 4F7ZA 1V6EA 5E6OA 3VFKA 1WH3A 1EF1A 2I1KA 3KUZA 3VHTC 2GBMA 2MX2A 1CMXB 1UD7A 2N7EA 4MELA 3M62B 5GMVA 1IPGA 4GXBA 1TGZB 2LXCA 3SD5A 4G0NB 1NDDA 4B6WA 4A3OA 1UELA 2MA9B 3H1UA 4E71A 1WM2A 2FCNA 1GUAB 2RGFA 3LDZE 2JZ3B 1M94A 4HDOA 5D6JB 4K7SA 4ZYNA 3QA8A 2N7DA 4BKSA 1R4MI 1E8YA 1EO6A 4DHJD 2I1JA 4DWFA 2L76A 4GB9A 4FBJB 3DDCB 2KO3A 3CF6E 1L7YA 3M95A 2K6DB 2MBEA 3PHWB 4NY0A 2KDFB 4GMVA 1WZ0A 2DX5B 4FA6A 4K7UA 3W1YA 2IZVB 1P1AA 3H7PA 1G6JA 2C7MB 1UBIA 3RYTA 3UIPB 3K9PB 4X57B 5J2RA 1E7UA 2KTRB 1RRBA 1R4NI 3UQAA 1SE9A 4FLHA 4TV3A 1WXVA 2KWUB 2LXAA
chains in the Genus database with same CATH superfamily
2NMQA 3NHEB 1C77A 3WCQA 4RFBA 1SB3C 4HPLB 2CKHB 3NVYA 4G11A 2JT4B 1TKEA 1DOIA 3V61A 5G5HA 1YJIA 3PTFC 4LTUA 5DPRA 4RNAA 3WALA 2O2VB 1E10A 2BYTA 4GDLA 4O1NA 5FKAC 1JWUD 3WIMA 4GOCA 1WYGA 1QF6A 2L8JA 3AEBB 1F1HA 2XNAC 4KDLB 5AZGA 2I2YA 4A20A 1GAQB 3ZLZA 4AP4C 1K8RB 1L6UA 2MEKA 3ZVVA 3VH3B 1L4DB 2VZKD 4P1CC 2JZZA 2QHOA 2WP9B 4A9AA 4IM2A 1PGBA 2BW2A 4BOZB 2UU7A 4K7WA 1V5OA 3WAOA 1C4PA 3U30A 2G4SA 2I38A 2WDQB 4RGTA 2N9XA 4KGRA 1VD2A 1FRRA 3DPDA 2ZJDA 1JWMD 4JIOU 2KFKA 2BKRB 2L32A 4NZLB 4KSKC 2LASA 4KGTA 3IHPC 4M0WB 2KQ7A 3BK1A 1K51A 1MFWA 1FIQA 2KQ4X 1MG8A 1IUEA 1XD3B 2M19A 2JY6A 3DBSA 3PRZA 2G9HD 4RH6A 3ZW3A 2PJHA 2QSDA 1I4GA 3KH0A 2XEWA 1V1OA 2Q5WD 3UINB 3N1ZC 5JXVA 2K39A 2KANA 2O6VB 4J6IA 3AE1B 4HCNB 4NQKE 2JYTA 3ZIMA 4HJGE 1GG3A 4B9KA 4YTPB 2JSVX 2JXTA 5AUKA 3ZJVA 4JGHB 1L5PA 2WU2B 3TJPA 2KN4A 3V60A 3T3OA 4FHKA 3AE7B 5CTRC 1KOTA 4AJWA 2NPTA 1NVID 2V4LA 5TR5A 1J8CA 1UH6A 4KGSA 1LQBA 2DZMA 2WXKA 1I4RA 1HQRD 4NPNA 3GE8C 2BYEA 1CJEA 1YQ4B 2RR9A 5CHVC 2JQRB 1H8CA 2ZPNA 1C79A 3U7ZA 1C78A 4OVVA 4US9A 4IM3A 2QMTA 1D4BA 1XO3A 3DBRB 1WX7A 4TKNA 2D10A 1FM0D 4I6NB 2MCNB 2JYEA 1WJNA 2HJ8A 2X8XX 1OQQA 4BVUC 1QLBB 2KTFA 3ML8A 4LLGM 1VRAB 4XGAB 2K1FA 2L00B 2DYBA 2D3AA 1TTNA 4RMAA 3GZNB 1D5ZC 2ZW0A 3BVGA 1NBFC 2EMSA 2LRUA 4M8NA 2C60A 2Y5CA 2RPVA 3VDZA 3EFCA 1GPXA 1N6ZA 1Y8RC 1FMAD 2CJOA 4WJPA 4K81A 5MPOA 1XXGA 2GB1A 2N4FA 3DBLI 3A33B 5AEKB 1C4CA 4YTNB 3DVNV 4I6LB 3ML9A 2ZEQA 2IO0B 2W9NA 3KUDB 1HA5A 1OFFA 2OJRA 3CSFA 3C19A 3PS6A 3VUXA 1XT9B 1FRDA 4RF0A 1YIWA 5D94A 2OHFA 4TQ1A 1WGHA 1XLNA 2BF8B 3ZNZB 1B9RA 4W9GA 4GN1A 2ASQA 3AE6B 2V3PA 2MJ3A 3RNEC 3W1SA 1N5XA 3QAQA 1Q5WB 2RSUA 2MBQA 4FULA 4C00A 2IGDA 4BKSD 5D2MB 3VRBB 3AEAB 1SJED 2KWDA 2BKFA 2GRIA 2KWCA 2QC8A 3BYTB 2PLPA 4MJSA 4ZDVA 4ITKA 2IBIB 1J19A 3AU4A 2QILA 1P0RA 3A9KB 3J9CA 2A5UA 4C7ZA 1R4MB 3PT2B 1KJTA 2L52A 3GE3C 3GS2A 5LLIA 4WQMA 4JWUC 1GJZA 1LGRA 1JRUA 5HG2A 5HFYA 4AUQC 4GSWA 4HPMB 4WH4A 1WZ3A 2WXRA 3CSTA 3RPFC 2L0TA 3BYYB 1PGAA 2D3BA 1GOZA 1TS2A 2IDYA 3QX1A 3OWEB 2WHIA 4AS1A 2O6VD 1WM3A 3WANA 3LXFA 4A3PA 3A4RA 4JLCA 5BYQA 3A1QB 3VUWA 2X38A 3HK0A 3A1QA 3AM9A 3RN9C 4IWQA 4KIKB 2D5GA 1FFVA 2GI9A 3RNAC 3WA0A 2LHDA 1NI2A 2BWFA 3X0WA 1S3SG 2KWVB 1L0XB 3OLMD 2AQ2B 1AARA 4ANVA 2PE6B 2FUG1 2J0JA 2IO3B 1DGJA 3AN1A 1A5RA 3NZUA 3TIXA 1VJKA 1SBBB 2FCMA 2KMAA 1TS3A 1Z5SB 2J0MA 3RULA 2LFIA 3ZRCA 2KDMA 1T5XD 4USAA 1WJ6A 1IYFA 4E74A 1NEKB 4P7IA 2NCNA 3R7RA 4HWIB 3JVZX 3TL5A 3SU8X 3HIZA 1FNVA 4F7ZA 4TSSA 1AYFA 1VDVA 5HHDG 1TS5A 4A90A 3B2GA 1HZ6A 3I5JC 4E71A 1WM2A 2WXMA 4YTMB 4DWFA 3U2SC 3ZJTA 2W82A 2LGIA 1FXIA 2BS4B 1WZ0A 4FA6A 4K7UA 4RCOA 3W1YA 1G6JA 3RYTA 3K9PB 1RYJA 1DOXA 1E7UA 3KLSX 2KTRB 2SEBD 3RNCC 1R4NI 3UQAA 4FLHA 2KWUB 2LXAA 1UWMA 3RNBC 2MW5A 3HVDA 3TUOA 3MJWA 4FADA 3HRDD 2KDEB 4FJVB 1J7CA 1E6EB 4HXDA 1UGMA 3H8HA 2CHZA 3E9SA 2DWQA 3P2BA 4AWJA 2Y5PA 4CHKA 2CS4A 3AECB 1ROEA 3DVGX 4C4VA 1T0QC 3PLVA 2D3GA 4LNNA 3TEYA 3RCZA 1FEHA 1WJUA 5L95C 4YSZB 3RMKC 1I7HA 1IP9A 3R8BA 2CHXA 5BO4B 5BMHA 1MVKA 2MP2A 3P63A 3JW0X 3Q14C 1VR9A 3L10B 3MC9A 4YWGG 3T9LA 1EUVB 3L54A 3Q3JA 1A70A 1I35A 4EFOA 1QQRA 3NJTA 4FN2A 4HEA1 4XZ4A 3ZDMC 1V1PA 1LFDA 2PPHA 3AEDB 2VRRB 2A4ZA 3N3KB 1YN4A 4J3OD 3MHSD 2B76B 3Q3NC 5DCNA 4PK1A 4IW0A 1WY8A 1EU3A 4DK5A 5HI1A 4OZBA 3MP9A 3Q6BA 3APDA 4MM3B 1TY2A 1PGXA 2K22A 2REXA 2G4DB 1UWXA 4MM3A 3Q8CA 4ZRJA 1L6VA 3ZTDA 3P4RB 4YXDB 3FILB 1UF0A 1HEZE 2CR5A 2QJLA 3HVZA 1FCLA 2K25A 4OVUA 4TUUA 3EA6A 1YJJA 2MBHA 3DHHC 1OQRA 1V9JA 2IY0B 1PYWD 2C5LC 4LK0M 4K1RB 5DPSA 2XK5B 3APCA 3VTVA 4JX1C 2KZRA 1OGWA 2AYOB 2DZKA 1T0YA 1WIAA 3GOEA 2KJ6A 3OJ4B 4GU2A 3P1MA 3V62A 2AX5A 2GBJA 1TBEA 4M8MA 2HE7A 4W9HA 2IYDB 1CQVA 3W1SC 4YSXB 2DYOA 3DBHB 2AQ1B 3I3TB 2NPTB 5HKHA 1C4AA 2IPKD 1WGKA 1E90A 3UF8A 4N6EB 5AZFA 2WXHA 4H2AA 4IOIE 3AE8B 1DOYA 3AU5A 3ETRA 2INPE 2Z0DB 1TKYA 3T3NA 2OOBB 2J53A 3V6EB 4BBNC 4DDGD 1SEBD 2KTRA 4KZCA 2IO1B 1E5WA 4W9FA 2DAFA 4GDKB 1HXYD 1GC7A 4MGZE 1VZ7A 1ZDXA 2NBWB 4RM9A 3R2IA 1CZPA 2WDTB 3BY4B 2BPSA 1KFYB 2AWTA 2C7HA 2KVRA 3SEBA 2LJIA 1F9JA 2LMCA 1WGRA 2WQYB 4HVBA 2V3SA 2UYZB 1ZGUB 3GZNI 3AV8A 3L08A 1JMLA 1NI3A 4OHJA 4KVGB 1JW9D 4WIPA 1STEA 4ANXA 3KVFB 1C1YB 2YLMA 5EE0A 1WX8A 1T0SC 1UZXB 2BWES 3ZXVA 4II3B 2PW9A 2WXGA 3VTUA 4R3DA 3O65B 1SGHA 3R2TA 4WQOB 2HTHA 3FKYA 5JH5C 2WX0A 3VRAB 5FR6A 3DWGC 2ZW1A 5AUIA 3KWLA 3DOWA 1D6EC 3R3MA 1NYQA 4I6PA 3EHVA 3I9V1 2Z0EB 3RD2A 1I4XA 2KJRA 5CHFA 2E6XA 4Q2JA 4ZRIA 2QEJC 3WAMA 1KF6B 2Z8LA 2WYQA 1CK1A 2YEPF 2W55A 3Q8BA 3H7PB 5JHBA 4ZHOA 1QOAA 3H7SA 4NJ6A 1TYGB 3BVMA 3W2DA 2WX1A 4TQ0A 2LD9A 4OW0A 2KACA 4WAAA 3TMPB 1ZE3D 2KC2A 2VZKB 3AE9B 1UBQA 3L0WB 4REZA 3B1LX 4K3CA 1KH0A 3LB8C 2JWUA 1UUPA 4PS8A 3DVGY 4KIKA 3U8ZA 4WJNA 1WGGA 3NZSA 1L2NA 2BQQA 3JSVB 4IM0A 4W9DA 1JQ4A 3QQ8B 4N9F4 2JWZA 2UWQA 3OAWA 1K52A 1WE6A 4DXGA 1IGCA 1V2YA 3RI7C 4ANUA 1P3QU 1WMHB 2KQSA 5C2TB 4MGIE 1GNUA 2MRPA 4HRSA 2N7JA 4LNFA 1SXTA 5G55A 4DBGA 3A4SC 4GDLB 1XF5L 2MJEA 4OZCA 4BAXA 2KFJA 5IA7A 4BKTA 2WXIA 4RGMA 2R61A 4WURA 2M56B 2ZCCA 4AOFA 1BXTA 4IUMB 2IJ0A 3E56A 4NAWA 4PT5A 1EWCA 2BYVE 3RUIB 1AN8A 3ZDTA 3ZXRA 5FK9C 2CJNA 4WWNA 2Z59B 2NBUA 4S0RA 3SHQA 1FXAA 1LM8B 3IXSA 3ZKJC 1YQBA 3PRPB 3L13A 4GGQA 1YMHE 2FBWB 2PEAA 1YD8U 1WJ4A 3VH4B 4B95A 1WI0A 2PKOA 2BYFA 1Q10A 1V6EA 5E6OA 5FR3A 3KUZA 1ZOYB 2Y3AA 4MELA 5GMVA 2WU5B 1IPGA 3Q2AC 4ZHPA 4GXBA 3AE2B 1GB1A 4L1BA 5GXGB 1TZOA 4A3OA 1UELA 1VZ8A 3DBLB 3H1UA 2RGFA 5D6JB 4K7SA 2BS2B 4BKSA 2VH2A 1C9FA 1EO6A 2I1JA 2LHEA 2L76A 4FBJB 2L83A 3DDCB 2KO3A 3CF6E 1L7YA 3PHWB 1P1AA 3H7PA 1UBIA 3NVVA 3UIPB 5J2RA 2WXPA 3LYYA 1QOBA 3FC4A 4TV3A 1F2RI 4B6WA 4WJQA 1V80A 4MGKE 3EECA 3TEZA 3M3JA 1ENFA 3KW5B 2MLBA 4BKGA 1RLFA 2INCC 4FHJA 3N1YC 3NVZA 2BBCA 3C8YA 1ESFA 1JCKB 4W9CA 4N59A 2MBBB 2LRWA 4RGOS 1JWSD 1Q0WB 2GLSA 2DYMA 1WRIA 3UGBB 2D11A 2KHWB 2R2OA 1TT5B 1UNSA 2LGSA 1XLOA 4DHJB 3PGEA 5AZHA 3VUYA 4QAYA 4D2KA 3QK0A 2D2QA 2KLGA 3IAS1 2N9EB 2HJ1A 4XWTA 2L1AA 2MP2B 1E8WA 4W9EA 3X23A 3HHMA 2KNBA 2LZ6A 3OJ3A 2ZNVB 2AQ3B 3A9JA 2V0GA 1PFDA 3CIRB 3H9DA 1QOGA 4L23A 1F2RC 3KYDD 3PHXB 3AEEB 1QKZA 2L3ZA 1EF5A 4MSMB 4NAMA 3P4QB 2D3CA 2PTLA 3C0RB 3VAWA 2DZIA 3Q3FA 1WR6E 2PVOD 4M01A 2M0XA 4EKUA 2KMCA 3CWIA 3L17A 2NBVB 3RZFA 4EZKA 2ZCBA 1I4HA 2MH7A 1KLGD 4YL8A 5DPTA 3OG5A 1ZW7A 4XWWA 5BMIA 4EE2A 1I42A 4LNKA 2L05A 5IO9A 5G5GA 4G50A 3Q3MC 3P42A 3AE3B 1HTOA 1TIFA 4IC7B 2KD0A 2MQJA 5KHQA 2FAZA 4MH0E 1RWSA 4HCPB 4PYZA 3N20C 1OQYA 4WAFA 2RDHA 2INNE 5EE9A 3O13A 3KUCB 2RD0A 5D3IB 1N60A 3ZNGC 3PO0A 4GLSC 1TY0A 1YOVB 4URKA 1NENB 4MJSB 5J17A 3ZNID 2WDVB 4CYEA 3NRZA 3A9KA 2K3UA 1B1ZA 1V86A 3BWUD 2MBOA 5JHAA 4C4VB 1E7VA 3AXCA 3KYCD 4WWMA 1D5XC 3UQBA 1P7FA 1WSPA 4ZRKA 3ZGZA 3SFEB 2ON8A 2AL6A 1SJHD 1SIJA 3DHIC 2LEKA 1EWYC 2NVUI 1EM7A 2KLCA 2DENB 3FAHA 3PSEB 2KYWA 4GDKA 2WXNA 1C3TA 1HZ5A 2DLBA 1P9DU 2OJWA 3TCAA 2QIEB 2INDC 3N30A 2IGGA 3QHTA 2WXQA 2M17A 2BVCA 2KDIA 2ACZB 1FXTB 2KX0A 1ZPSA 2WLBA 3HUIA 2ZNVC 2KN5A 3DBRI 3CMMB 4ZYSA 1TJEA 5C23A 4DXFA 2ZVNA 2V1YA 2V3NA 4DHZE 2J4XA 1I4QA 2ZZPB 1WGYA 4LDTB 3I63C 4JWSC 3KQ4A 4NJ7A 3M63B 3L4PA 3W5VB 2YEPB 1WFYA 4E3CA 4MH8A 4YSYB 1V1PB 2W54A 3PREA 4KSLC 1XCTL 2EKEC 2D07B 3DCGA 2WXJA 5KHOA 1FNWA 3VVWB 2KJHB 2BGFA 2XK5A 4IG7B 1JALA 3GB1A 2LWPA 4LDTD 5H92C 2NTSA 2N0SB 3D32A 3Q8AA 2LUEA 4ARCA 2J7QB 5H8YE 4CQNA 4BBNF 1KLVA 4NNJB 2N9LA 4DHZB 4AJYB 3AE5B 3BK2A 4FJZA 3QCAA 1IBXB 1XLPA 2JXXA 2LGXA 3IG3A 4A6QA 3VR9B 3ZQ4A 4WWOA 3KWVA 1KRHA 3B9JA 1WXQA 3QARA 3NS1A 3LJ3A 5T8IA 1MHXA 1JWBD 1MG4A 2K8CA 2KDBA 2CHWA 4HK2A 3BIID 3TSSA 2YVCA 2AL3A 3B08A 1L0YB 1PQSA 1PDXA 1E8ZA 1FNUA 2O2VA 4B0EA 2KT7A 1WYWB 5IOIA 5D3DA 4IWOA 3SFDB 4F1SA 4S17A 4WWPA 2B3AA 4M02A 1X1MA 1SE2A 4MGYE 3V05A 4HKZE 3I57A 2QDFA 2NR2A 2L0FA 4JE3B 2K8HA 3IVFA 1L0VB 3H6NA 3IT6B 5D7GA 3V3XA 5DPWA 1BT0A 3NS8A 4HLEA 3N1XC 1N5WA 3ABVB 4AQ7A 3GP7A 2LVPA 2BB5A 2CU1A 4JQWC 1K53A 1J7BA 2K8BA 2J0KA 1Q1OA 2PIAA 4C7YA 3HM6X 1ACCA 5CX3A 4EUTA 3ZTCA 1E7PB 2EKIA 2BT6A 4HJKA 1N63A 4DQOC 3QWZB 4M00A 2KVZA 1V5TA 1ZP0B 1UGJA 1RFKA 2FIFA 2V4IB 1D3ZA 2C9WB 2EELA 3R66C 4IWPA 3R7QA 2BB6A 1S1QB 2N1VA 5IN7A 2PE9A 3N32A 5CHWA 2LUMA 1YJ1A 2O6VA 3SR6A 2FCQA 3MHZA 4UDUC 4G3XB 2J42A 2K5PA 2W3RA 4F8CB 1WE7A 5IAAC 3NVWA 1VZ6A 1RM6C 3ZYYX 2SAKA 1WH3A 1EF1A 2I1KA 2PVGC 2GBMA 1MHHE 1HTQA 1CMXB 1UD7A 1IGDA 1ZDVA 1WWTA 4KX6B 1TGZB 1YN3A 4G0NB 1NDDA 1N62A 2MA9B 2NTTA 4HDOA 1M94A 4ZYNA 1FCCC 3QA8A 3BVZA 2N7DA 2TSSA 4XDCA 1R4MI 1E8YA 4K3BA 4GB9A 2OEDA 1QT9A 5C3JB 1M4VA 2K6DB 3W5UB 4GMVA 2DX5B 4MACA 4RGNA 1IBXA 2C7MB 1FD6A 1ZXHA 1RRBA 1T6BX 2VH1A 2WXLA 2K0PA 5BYSA 1GC6A 4EOYA 1OEYA 3WAPA 2M1MA 2N9PC 4LNIA 4C56C 1E8XA 2KKCA 2FCSA 2RDGA 4ICUA 1ET6A 3PLUA 4BOSC 1EU4A 4FJYA 3A9JB 2JPHA 4KZ0A 3ZUNA 1V8CA 1WGDA 4ZRQA 2HTME 4XC2A 3JSVA 3UI3A 1RAXA 1V49A 5E6JA 3Q8FA 3B0AA 1WXMA 1LXDA 3EUB2 4HROA 2Y5BB 3EFUA 1WF9A 2K6QA 2G45B 2HDEA 2R2QA 4JPSA 1JWAD 1XCQL 1FO4A 3PRMB 1T0RC 3VR8B 4EZJA 2KFKB 3ENEA 2XN9C 1FPYA 2IY1B 1P98A 2XBBC 3DBHI 4M0WA 2WNMA 1SSNA 2GOWA 1F77A 5G2NA 2FE8A 1JROA 1VLBA 2K9XA 2JF5A 1ZKHA 3TBLD 5EE3A 1K50A 2M8SA 4WJOA 2EMTA 3PZDA 3UIOB 2DHZA 2WDRB 1I4PA 2JVCA 1ET9A 3Q3OC 2WGSA 4XDDA 4W9JA 4A55A 4OZAA 2JRHA 2RPQA 5L83A 3JYUA 1HE8A 2DAJA 3APFA 5BMGA 4MEMA 5J18A 5JZEB 3PPAA 4KKIA 3RFZB 4W9IA 2MWSB 2JU6X 2LGYA 3QJZA 2KXJA 2NS5A 2LVOA 3DQVA 3K9OB 3AMZA 5E6NA 4P1BC 1WXAA 4MSQB 3VTWA 1VCBA 4GIVA 1GB4A 1R4NB 1N61A 4IKGA 2IGHA 4MT5A 2JRIB 5E6PA 3RZWC 2ZPYA 4ASWC 1SF0A 2V9HA 3MC8A 3TEWA 4XYCA 4KV2A 3ECIA 3U7DA 2GBKA 4ZRPA 1QILA 4BZAA 3RT3B 1JRPA 3DWMA 2KX3A 2L7RA 3EGRA 2PMVA 4XE0A 3SDLC 3PZ7A 1BMLC 2KK8A 1H4RA 3IT4B 1MJDA 1SE3A 5EDSA 2KMMA 5TSSA 4PS3A 2M0AA 4P6VF 3ZNHB 4DDID 1ZXIA 3P4PB 2RMMA 3AI5A 4JL9A 4XX5A 3Q8EA 4ICVA 2IO2B 3L16A 3PVLA 2MHJA 2DNFA 2KC1A 3PV1A 5LXHA 1OTRB 1WRDB 3QC8B 3ZO5B 1AWDA 1WX9A 1J7AA 3IBEA 4B0MA 3MC0B 1C76A 1P7EA 1Z2MA 2N9KA 2BTEA 3U52E 5EE1A 1AW7A 2FIDA 3URYA 3VQIA 2QCZA 4PS7A 3NUHB 4NQLB 1J0GA 4L2YA 1ISNA 3FILA 1F0ZA 3NZ3A 4US8A 2MSED 1DYQA 4MDKE 3MTNB 4LJPB 4NAWB 1E9MA 4EEWA 2JX5A 1TKGA 2W3SA 2C7NB 2KOXA 4II2B 4PYUA 1TS4A 3AULA 5LXIB 2FUHB 3EC8A 3N9YC 3NG0A 1XLQA 2HD5B 1NYRA 4CO7A 3AE4B 2ONQA 2WXFA 2DBYA 3IAM1 2LJ5A 1KTKA 3DHGC 4YT0B 1WR1A 2RDBC 3MJ5A 5BYRA 4LNOA 2GMIC 1BUIC 3NOBA 1QOFA 3AB5A 5C1ZA 4A8XC 2FNJB 3VXWA 1KM7A 2AEHA 4RM8A 2MJDA 1SE4A 3HM3A 2E3TA 3ZRFA 1QZEA 3AEFB 1V81A 2ICIA 3S2AA 4HKQA 2LGDA 1E0ZA 2WS3B 1D5MC 4KKJA 4P16A 4IDIA 3TEXA 4BFRA 3NY5A 3T8MA 1XQQA 2J52A 1SIFA 4LCDE 1R7SA 3U4EG 3ALBA 1XEEA 1RFAA 4DXAB 1MPEA 1T3QA 4HDQA 2LI5A 1WXSA 2LVQA 1F52A 2GBNA 4ANWA 4C80A 5LNK1 4FXCA 1YX6B 3RNFC 1OEYJ 3AH7A 1YN5A 4OVZA 4EZLA 1WMHA 3MFGA 3ZJUA 1YX5B 2JUOA 4KDIC 4W9KA 2JZPA 3QIJA 3V6CB 2DZJA 3ONSA 4RF1A 2H88B 2KAJA 2ZVOA 1L4ZB 3BINA 4HPPA 2WXOA 1U4AA 2GBRA 2M4NA 2N1WA 4W9LA 1MI0A 1KLUD 3DVNU 3IFWB 2WWZA 2G3QB 1TZ1A 5I4DA 5IKCM 4LJOB 4ARIA 3VFKA 3VHTC 2MX2A 2G1EA 1FFUA 2N7EA 3M62B 4ACFA 4ZOHC 2LXCA 1V97A 3SD5A 3RNGC 3AEGB 1Y56A 5IP4D 2FCNA 1GUAB 3LDZE 2JZ3B 1YNTE 4DHJD 1YQ3B 3B2FA 2CU3A 3P4SB 3PZ8A 3M95A 1ZUD2 2MBEA 4TMAB 4NJCA 4NY0A 2KDFB 3Q69A 3W9CB 3BZDB 2IZVB 2H89B 4X57B 4N58A 1SE9A 1LO5D 1PUTA 2BS3B 1WXVA
chains in the Genus database with same CATH topology
4WJQA 1V80A 4MGKE 3NHEB 1GC6A 3EECA 2MW5A 4EOYA 1OEYA 3M3JA 3KW5B 2MLBA 4BKGA 3MJWA 2M1MA 3WAPA 4FADA 2N9PC 1RLFA 4HPLB 2CKHB 4G11A 2KDEB 4FJVB 4FHJA 2JT4B 3V61A 1E8XA 4HXDA 1UGMA 3PTFC 2CHZA 2KKCA 5DPRA 2FCSA 3P2BA 3WALA 4AWJA 4W9CA 4ICUA 4CHKA 2O2VB 3PLUA 4BOSC 2CS4A 4FJYA 2MBBB 4GDLA 2LRWA 1Q0WB 3DVGX 3A9JB 3WIMA 2DYMA 3PLVA 4GOCA 2D11A 2D3GA 2KHWB 3UGBB 2JPHA 4KZ0A 2R2OA 3ZUNA 3RCZA 2L8JA 1WGDA 1WJUA 5L95C 4KDLB 5AZGA 4XC2A 3JSVA 4A20A 4DHJB 1RAXA 1IP9A 3ZLZA 4AP4C 3PGEA 5AZHA 1V49A 2CHXA 5BO4B 3VUYA 2MP2A 1K8RB 3JW0X 3QK0A 3B0AA 2D2QA 2KLGA 3ZVVA 1WXMA 1LXDA 3VH3B 2N9EB 3L10B 2JZZA 2QHOA 2MP2B 1E8WA 1EUVB 3L54A 3T9LA 3Q3JA 4W9EA 3X23A 1I35A 3HHMA 4IM2A 4EFOA 2Y5BB 3EFUA 1WF9A 2KNBA 2K6QA 4FN2A 2G45B 4BOZB 4XZ4A 2LZ6A 3ZDMC 1LFDA 2R2QA 3OJ3A 2PPHA 2VRRB 2A4ZA 4K7WA 3N3KB 2ZNVB 1V5OA 3WAOA 3U30A 3A9JA 2G4SA 2N9XA 3MHSD 3PRMB 5DCNA 1VD2A 4EZJA 3DPDA 2KFKB 4IW0A 1WY8A 2ZJDA 3ENEA 3H9DA 4JIOU 3KYDD 2IY1B 1P98A 2KFKA 2XBBC 3DBHI 3PHXB 4DK5A 2BKRB 2L3ZA 2GOWA 5G2NA 1EF5A 4KSKC 2LASA 4MSMB 3IHPC 4M0WB 2KQ7A 3C0RB 3APDA 3VAWA 2DZIA 3Q3FA 1WR6E 2REXA 2M0XA 2G4DB 4EKUA 2JF5A 1ZKHA 3TBLD 4MM3A 2KMCA 3L17A 2NBVB 1MG8A 4ZRJA 1XD3B 2M8SA 3RZFA 3ZTDA 4WJOA 2JY6A 2EMTA 3DBSA 3PZDA 3PRZA 2ZCBA 4EZKA 3UIOB 2DHZA 3ZW3A 2CR5A 2JVCA 2K25A 4OVUA 2PJHA 4TUUA 3KH0A 2XEWA 4YL8A 5DPTA 2MBHA 4W9JA 1ZW7A 1V9JA 2IY0B 3UINB 2C5LC 2JRHA 2RPQA 4K1RB 5DPSA 5L83A 2K39A 1I42A 2KANA 2O6VB 2XK5B 3APCA 2L05A 3JYUA 4J6IA 1HE8A 3VTVA 2DAJA 3APFA 2KZRA 4G50A 4HCNB 4MEMA 4NQKE 3ZIMA 5J18A 1OGWA 2AYOB 2DZKA 1GG3A 1T0YA 5JZEB 4B9KA 1WIAA 3PPAA 3GOEA 4IC7B 2KD0A 2MQJA 4W9IA 2MWSB 2LGYA 3QJZA 2KXJA 2FAZA 5KHQA 2KJ6A 4JGHB 3OJ4B 4MH0E 2NS5A 2LVOA 3DQVA 4GU2A 4HCPB 4PYZA 1OQYA 3K9OB 5E6NA 3TJPA 3V62A 2GBJA 1WXAA 4MSQB 3V60A 3KUCB 2RD0A 3VTWA 1VCBA 4FHKA 1TBEA 3ZNGC 4GIVA 4M8MA 5CTRC 2HE7A 4URKA 4W9HA 1KOTA 2IYDB 2NPTA 4MJSB 4AJWA 2V4LA 5J17A 3W1SC 3ZNID 2DYOA 2JRIB 5E6PA 3RZWC 4CYEA 3I3TB 5TR5A 1J8CA 1UH6A 2NPTB 3A9KA 2ZPYA 4ASWC 1LQBA 5HKHA 2DZMA 4KV2A 1E90A 1V86A 2MBOA 3ECIA 4NPNA 3U7DA 2GBKA 2BYEA 5AZFA 3UF8A 5JHAA 3RT3B 2KX3A 2L7RA 2RR9A 1E7VA 3AU5A 3AXCA 3KYCD 5CHVC 1H8CA 3UQBA 2Z0DB 3SDLC 2OOBB 2ZPNA 4OVVA 3V6EB 4BBNC 4IM3A 4DDGD 2KK8A 1H4RA 2KTRA 4KZCA 4ZRKA 2IO1B 2AL6A 1E5WA 4W9FA 2DAFA 1WX7A 4TKNA 2NVUI 2KLCA 5EDSA 2D10A 2DENB 3PSEB 4PS3A 4GDKB 4I6NB 2MCNB 1GC7A 4MGZE 1WJNA 2HJ8A 2NBWB 3ZNHB 4DDID 4RM9A 4GDKA 4BVUC 2WDTB 2KTFA 3BY4B 3ML8A 1C3TA 1P9DU 2K1FA 2L00B 2BPSA 2C7HA 2AWTA 2DYBA 2KVRA 3AI5A 4JL9A 1TTNA 4XX5A 3TCAA 4ICVA 1F9JA 1WGRA 4RMAA 2IO2B 3L16A 4HVBA 2V3SA 2UYZB 1ZGUB 3GZNI 3PVLA 3N30A 1NBFC 3QHTA 2EMSA 2LRUA 3L08A 2KC1A 3PV1A 4M8NA 5LXHA 2C60A 2M17A 1OTRB 4KVGB 3VDZA 1WRDB 2KDIA 3QC8B 1Y8RC 3ZO5B 1FXTB 2KX0A 4WJPA 4K81A 1WX9A 4ANXA 2ZNVC 3IBEA 2KN5A 1C1YB 2N4FA 2YLMA 3DBLI 3KVFB 3DBRI 3A33B 1WX8A 3CMMB 5C23A 1UZXB 2BWES 5AEKB 1Z2MA 2ZVNA 2V1YA 4II3B 4DHZE 3DVNV 2FIDA 4I6LB 2ZZPB 3ML9A 2ZEQA 2IO0B 2W9NA 3VQIA 1WGYA 4LDTB 3KUDB 3VTUA 3O65B 4NJ7A 3M63B 1SGHA 4PS7A 4WQOB 2HTHA 5JH5C 2WX0A 4NQLB 1J0GA 1WFYA 5FR6A 2OJRA 4E3CA 1ISNA 3CSFA 3PS6A 3VUXA 3PREA 1XT9B 4KSLC 2MSED 4MDKE 2EKEC 3DCGA 2D07B 1YIWA 3MTNB 4LJPB 4NAWB 3DOWA 5D94A 5KHOA 4TQ1A 1WGHA 3R3MA 2BF8B 3ZNZB 4EEWA 4I6PA 4W9GA 3EHVA 3VVWB 2KJHB 2BGFA 2XK5A 4GN1A 2ASQA 2Z0EB 4IG7B 3RD2A 2KJRA 2LWPA 4LDTD 5CHFA 2C7NB 2KOXA 4ZRIA 3D32A 3WAMA 4II2B 2LUEA 4PYUA 3AULA 2J7QB 3W1SA 2WYQA 5LXIB 3QAQA 1Q5WB 2FUHB 2RSUA 2MBQA 3EC8A 4FULA 4NNJB 4BBNF 1KLVA 4DHZB 4AJYB 2HD5B 4BKSD 4FJZA 5D2MB 4CO7A 3H7PB 3QCAA 5JHBA 2JXXA 2BKFA 2LGXA 2KWCA 3IG3A 3H7SA 4NJ6A 4WWOA 2WX1A 4TQ0A 4MJSA 2LD9A 4ZDVA 2IBIB 1J19A 3AU4A 4WAAA 1P0RA 3A9KB 2LJ5A 2A5UA 3QARA 3LJ3A 3TMPB 2KC2A 3L0WB 1UBQA 1WR1A 3PT2B 1KJTA 2K8CA 2KDBA 2CHWA 3B1LX 4HK2A 2YVCA 5LLIA 2AL3A 1GJZA 3B08A 1JRUA 1PQSA 1E8ZA 2O2VA 2GMIC 3NOBA 1WYWB 4PS8A 3DVGY 4IWOA 4KIKA 3U8ZA 5C1ZA 4WJNA 1WGGA 2FNJB 3VXWA 4F1SA 4AUQC 1KM7A 2AEHA 3NZSA 4WWPA 2B3AA 4GSWA 4HPMB 1L2NA 4RM8A 1X1MA 1WZ3A 3JSVB 4MGYE 4IM0A 3HM3A 4W9DA 3QQ8B 4N9F4 2JWZA 3ZRFA 2UWQA 3OAWA 3CSTA 1QZEA 1WE6A 2L0TA 2NR2A 2L0FA 1V2YA 1V81A 3S2AA 2LGDA 2K8HA 3QX1A 3IVFA 4ANUA 3H6NA 1P3QU 2O6VD 1WMHB 5D7GA 5DPWA 2KQSA 1WM3A 3WANA 4A3PA 3A4RA 1BT0A 4JLCA 3NS8A 4HLEA 3A1QB 3VUWA 4MGIE 1GNUA 2MRPA 2LVPA 4BFRA 3NY5A 3T8MA 3HK0A 1XQQA 2CU1A 3A1QA 4JQWC 2K8BA 1SIFA 4IWQA 4LCDE 5G55A 2J0KA 1Q1OA 4KIKB 4DBGA 3A4SC 4GDLB 3HM6X 3ALBA 5CX3A 1RFAA 4DXAB 4EUTA 3ZTCA 2KFJA 4HDQA 2LI5A 3WA0A 5IA7A 4HJKA 4BKTA 1WXSA 1NI2A 2LVQA 2BWFA 2GBNA 4ANWA 3QWZB 1S3SG 3X0WA 2KWVB 1YX6B 1OEYJ 3OLMD 1AARA 4ANVA 1V5TA 2PE6B 1WMHA 2J0JA 4EZLA 2IO3B 2ZCCA 4AOFA 1YX5B 2FIFA 2JUOA 1D3ZA 4IUMB 2C9WB 4KDIC 4W9KA 3QIJA 3V6CB 2DZJA 3ONSA 3R66C 1A5RA 3NZUA 4IWPA 4NAWA 2BYVE 3RUIB 3R7QA 3ZDTA 3TIXA 1S1QB 2N1VA 2ZVOA 2FCMA 2KMAA 4WWNA 2Z59B 2PE9A 3BINA 2NBUA 1Z5SB 2J0MA 3N32A 5CHWA 3SHQA 3RULA 1LM8B 3ZRCA 1U4AA 1WJ6A 2GBRA 1YJ1A 1YQBA 2M4NA 2O6VA 2FCQA 2N1WA 4W9LA 3ZKJC 3PRPB 1IYFA 4E74A 3L13A 4G3XB 2NCNA 3DVNU 4GGQA 4P7IA 2PEAA 1YD8U 3IFWB 3R7RA 4HWIB 2WWZA 2G3QB 1TZ1A 3JVZX 3TL5A 1WJ4A 1WE7A 5IAAC 3SU8X 1WI0A 3VH4B 4B95A 4F8CB 3HIZA 4LJOB 2BYFA 4F7ZA 1V6EA 5E6OA 3VFKA 1WH3A 1EF1A 2I1KA 3KUZA 3VHTC 2GBMA 2MX2A 1CMXB 1UD7A 2N7EA 4MELA 3M62B 5GMVA 1IPGA 4GXBA 1TGZB 2LXCA 3SD5A 4G0NB 1NDDA 4B6WA 4A3OA 1UELA 2MA9B 3H1UA 4E71A 1WM2A 2FCNA 1GUAB 2RGFA 3LDZE 2JZ3B 1M94A 4HDOA 5D6JB 4K7SA 4ZYNA 3QA8A 2N7DA 4BKSA 1R4MI 1E8YA 1EO6A 4DHJD 2I1JA 4DWFA 2L76A 4GB9A 4FBJB 3DDCB 2KO3A 3CF6E 1L7YA 3M95A 2K6DB 2MBEA 3PHWB 4NY0A 2KDFB 4GMVA 1WZ0A 2DX5B 4FA6A 4K7UA 3W1YA 2IZVB 1P1AA 3H7PA 1G6JA 2C7MB 1UBIA 3RYTA 3UIPB 3K9PB 4X57B 5J2RA 1E7UA 2KTRB 1RRBA 1R4NI 3UQAA 1SE9A 4FLHA 4TV3A 1WXVA 2KWUB 2LXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WJQ A;  1V80 A;  4MGK E;  3NHE B;  1GC6 A;  3EEC A;  2MW5 A;  4EOY A;  1OEY A;  3M3J A;  3KW5 B;  2MLB A;  4BKG A;  3MJW A;  2M1M A;  3WAP A;  4FAD A;  2N9P C;  1RLF A;  4HPL B;  2CKH B;  4G11 A;  2KDE B;  4FJV B;  4FHJ A;  2JT4 B;  3V61 A;  1E8X A;  4HXD A;  1UGM A;  3PTF C;  2CHZ A;  2KKC A;  5DPR A;  2FCS A;  3P2B A;  3WAL A;  4AWJ A;  4W9C A;  4ICU A;  4CHK A;  2O2V B;  3PLU A;  4BOS C;  2CS4 A;  4FJY A;  2MBB B;  4GDL A;  2LRW A;  1Q0W B;  3DVG X;  3A9J B;  3WIM A;  2DYM A;  3PLV A;  4GOC A;  2D11 A;  2D3G A;  2KHW B;  3UGB B;  2JPH A;  4KZ0 A;  2R2O A;  3ZUN A;  3RCZ A;  2L8J A;  1WGD A;  1WJU A;  5L95 C;  4KDL B;  5AZG A;  4XC2 A;  3JSV A;  4A20 A;  4DHJ B;  1RAX A;  1IP9 A;  3ZLZ A;  4AP4 C;  3PGE A;  5AZH A;  1V49 A;  2CHX A;  5BO4 B;  3VUY A;  2MP2 A;  1K8R B;  3JW0 X;  3QK0 A;  3B0A A;  2D2Q A;  2KLG A;  3ZVV A;  1WXM A;  1LXD A;  3VH3 B;  2N9E B;  3L10 B;  2JZZ A;  2QHO A;  2MP2 B;  1E8W A;  1EUV B;  3L54 A;  3T9L A;  3Q3J A;  4W9E A;  3X23 A;  1I35 A;  3HHM A;  4IM2 A;  4EFO A;  2Y5B B;  3EFU A;  1WF9 A;  2KNB A;  2K6Q A;  4FN2 A;  2G45 B;  4BOZ B;  4XZ4 A;  2LZ6 A;  3ZDM C;  1LFD A;  2R2Q A;  3OJ3 A;  2PPH A;  2VRR B;  2A4Z A;  4K7W A;  3N3K B;  2ZNV B;  1V5O A;  3WAO A;  3U30 A;  3A9J A;  2G4S A;  2N9X A;  3MHS D;  3PRM B;  5DCN A;  1VD2 A;  4EZJ A;  3DPD A;  2KFK B;  4IW0 A;  1WY8 A;  2ZJD A;  3ENE A;  3H9D A;  4JIO U;  3KYD D;  2IY1 B;  1P98 A;  2KFK A;  2XBB C;  3DBH I;  3PHX B;  4DK5 A;  2BKR B;  2L3Z A;  2GOW A;  5G2N A;  1EF5 A;  4KSK C;  2LAS A;  4MSM B;  3IHP C;  4M0W B;  2KQ7 A;  3C0R B;  3APD A;  3VAW A;  2DZI A;  3Q3F A;  1WR6 E;  2REX A;  2M0X A;  2G4D B;  4EKU A;  2JF5 A;  1ZKH A;  3TBL D;  4MM3 A;  2KMC A;  3L17 A;  2NBV B;  1MG8 A;  4ZRJ A;  1XD3 B;  2M8S A;  3RZF A;  3ZTD A;  4WJO A;  2JY6 A;  2EMT A;  3DBS A;  3PZD A;  3PRZ A;  2ZCB A;  4EZK A;  3UIO B;  2DHZ A;  3ZW3 A;  2CR5 A;  2JVC A;  2K25 A;  4OVU A;  2PJH A;  4TUU A;  3KH0 A;  2XEW A;  4YL8 A;  5DPT A;  2MBH A;  4W9J A;  1ZW7 A;  1V9J A;  2IY0 B;  3UIN B;  2C5L C;  2JRH A;  2RPQ A;  4K1R B;  5DPS A;  5L83 A;  2K39 A;  1I42 A;  2KAN A;  2O6V B;  2XK5 B;  3APC A;  2L05 A;  3JYU A;  4J6I A;  1HE8 A;  3VTV A;  2DAJ A;  3APF A;  2KZR A;  4G50 A;  4HCN B;  4MEM A;  4NQK E;  3ZIM A;  5J18 A;  1OGW A;  2AYO B;  2DZK A;  1GG3 A;  1T0Y A;  5JZE B;  4B9K A;  1WIA A;  3PPA A;  3GOE A;  4IC7 B;  2KD0 A;  2MQJ A;  4W9I A;  2MWS B;  2LGY A;  3QJZ A;  2KXJ A;  2FAZ A;  5KHQ A;  2KJ6 A;  4JGH B;  3OJ4 B;  4MH0 E;  2NS5 A;  2LVO A;  3DQV A;  4GU2 A;  4HCP B;  4PYZ A;  1OQY A;  3K9O B;  5E6N A;  3TJP A;  3V62 A;  2GBJ A;  1WXA A;  4MSQ B;  3V60 A;  3KUC B;  2RD0 A;  3VTW A;  1VCB A;  4FHK A;  1TBE A;  3ZNG C;  4GIV A;  4M8M A;  5CTR C;  2HE7 A;  4URK A;  4W9H A;  1KOT A;  2IYD B;  2NPT A;  4MJS B;  4AJW A;  2V4L A;  5J17 A;  3W1S C;  3ZNI D;  2DYO A;  2JRI B;  5E6P A;  3RZW C;  4CYE A;  3I3T B;  5TR5 A;  1J8C A;  1UH6 A;  2NPT B;  3A9K A;  2ZPY A;  4ASW C;  1LQB A;  5HKH A;  2DZM A;  4KV2 A;  1E90 A;  1V86 A;  2MBO A;  3ECI A;  4NPN A;  3U7D A;  2GBK A;  2BYE A;  5AZF A;  3UF8 A;  5JHA A;  3RT3 B;  2KX3 A;  2L7R A;  2RR9 A;  1E7V A;  3AU5 A;  3AXC A;  3KYC D;  5CHV C;  1H8C A;  3UQB A;  2Z0D B;  3SDL C;  2OOB B;  2ZPN A;  4OVV A;  3V6E B;  4BBN C;  4IM3 A;  4DDG D;  2KK8 A;  1H4R A;  2KTR A;  4KZC A;  4ZRK A;  2IO1 B;  2AL6 A;  1E5W A;  4W9F A;  2DAF A;  1WX7 A;  4TKN A;  2NVU I;  2KLC A;  5EDS A;  2D10 A;  2DEN B;  3PSE B;  4PS3 A;  4GDK B;  4I6N B;  2MCN B;  1GC7 A;  4MGZ E;  1WJN A;  2HJ8 A;  2NBW B;  3ZNH B;  4DDI D;  4RM9 A;  4GDK A;  4BVU C;  2WDT B;  2KTF A;  3BY4 B;  3ML8 A;  1C3T A;  1P9D U;  2K1F A;  2L00 B;  2BPS A;  2C7H A;  2AWT A;  2DYB A;  2KVR A;  3AI5 A;  4JL9 A;  1TTN A;  4XX5 A;  3TCA A;  4ICV A;  1F9J A;  1WGR A;  4RMA A;  2IO2 B;  3L16 A;  4HVB A;  2V3S A;  2UYZ B;  1ZGU B;  3GZN I;  3PVL A;  3N30 A;  1NBF C;  3QHT A;  2EMS A;  2LRU A;  3L08 A;  2KC1 A;  3PV1 A;  4M8N A;  5LXH A;  2C60 A;  2M17 A;  1OTR B;  4KVG B;  3VDZ A;  1WRD B;  2KDI A;  3QC8 B;  1Y8R C;  3ZO5 B;  1FXT B;  2KX0 A;  4WJP A;  4K81 A;  1WX9 A;  4ANX A;  2ZNV C;  3IBE A;  2KN5 A;  1C1Y B;  2N4F A;  2YLM A;  3DBL I;  3KVF B;  3DBR I;  3A33 B;  1WX8 A;  3CMM B;  5C23 A;  1UZX B;  2BWE S;  5AEK B;  1Z2M A;  2ZVN A;  2V1Y A;  4II3 B;  4DHZ E;  3DVN V;  2FID A;  4I6L B;  2ZZP B;  3ML9 A;  2ZEQ A;  2IO0 B;  2W9N A;  3VQI A;  1WGY A;  4LDT B;  3KUD B;  3VTU A;  3O65 B;  4NJ7 A;  3M63 B;  1SGH A;  4PS7 A;  4WQO B;  2HTH A;  5JH5 C;  2WX0 A;  4NQL B;  1J0G A;  1WFY A;  5FR6 A;  2OJR A;  4E3C A;  1ISN A;  3CSF A;  3PS6 A;  3VUX A;  3PRE A;  1XT9 B;  4KSL C;  2MSE D;  4MDK E;  2EKE C;  3DCG A;  2D07 B;  1YIW A;  3MTN B;  4LJP B;  4NAW B;  3DOW A;  5D94 A;  5KHO A;  4TQ1 A;  1WGH A;  3R3M A;  2BF8 B;  3ZNZ B;  4EEW A;  4I6P A;  4W9G A;  3EHV A;  3VVW B;  2KJH B;  2BGF A;  2XK5 A;  4GN1 A;  2ASQ A;  2Z0E B;  4IG7 B;  3RD2 A;  2KJR A;  2LWP A;  4LDT D;  5CHF A;  2C7N B;  2KOX A;  4ZRI A;  3D32 A;  3WAM A;  4II2 B;  2LUE A;  4PYU A;  3AUL A;  2J7Q B;  3W1S A;  2WYQ A;  5LXI B;  3QAQ A;  1Q5W B;  2FUH B;  2RSU A;  2MBQ A;  3EC8 A;  4FUL A;  4NNJ B;  4BBN F;  1KLV A;  4DHZ B;  4AJY B;  2HD5 B;  4BKS D;  4FJZ A;  5D2M B;  4CO7 A;  3H7P B;  3QCA A;  5JHB A;  2JXX A;  2BKF A;  2LGX A;  2KWC A;  3IG3 A;  3H7S A;  4NJ6 A;  4WWO A;  2WX1 A;  4TQ0 A;  4MJS A;  2LD9 A;  4ZDV A;  2IBI B;  1J19 A;  3AU4 A;  4WAA A;  1P0R A;  3A9K B;  2LJ5 A;  2A5U A;  3QAR A;  3LJ3 A;  3TMP B;  2KC2 A;  3L0W B;  1UBQ A;  1WR1 A;  3PT2 B;  1KJT A;  2K8C A;  2KDB A;  2CHW A;  3B1L X;  4HK2 A;  2YVC A;  5LLI A;  2AL3 A;  1GJZ A;  3B08 A;  1JRU A;  1PQS A;  1E8Z A;  2O2V A;  2GMI C;  3NOB A;  1WYW B;  4PS8 A;  3DVG Y;  4IWO A;  4KIK A;  3U8Z A;  5C1Z A;  4WJN A;  1WGG A;  2FNJ B;  3VXW A;  4F1S A;  4AUQ C;  1KM7 A;  2AEH A;  3NZS A;  4WWP A;  2B3A A;  4GSW A;  4HPM B;  1L2N A;  4RM8 A;  1X1M A;  1WZ3 A;  3JSV B;  4MGY E;  4IM0 A;  3HM3 A;  4W9D A;  3QQ8 B;  4N9F 4;  2JWZ A;  3ZRF A;  2UWQ A;  3OAW A;  3CST A;  1QZE A;  1WE6 A;  2L0T A;  2NR2 A;  2L0F A;  1V2Y A;  1V81 A;  3S2A A;  2LGD A;  2K8H A;  3QX1 A;  3IVF A;  4ANU A;  3H6N A;  1P3Q U;  2O6V D;  1WMH B;  5D7G A;  5DPW A;  2KQS A;  1WM3 A;  3WAN A;  4A3P A;  3A4R A;  1BT0 A;  4JLC A;  3NS8 A;  4HLE A;  3A1Q B;  3VUW A;  4MGI E;  1GNU A;  2MRP A;  2LVP A;  4BFR A;  3NY5 A;  3T8M A;  3HK0 A;  1XQQ A;  2CU1 A;  3A1Q A;  4JQW C;  2K8B A;  1SIF A;  4IWQ A;  4LCD E;  5G55 A;  2J0K A;  1Q1O A;  4KIK B;  4DBG A;  3A4S C;  4GDL B;  3HM6 X;  3ALB A;  5CX3 A;  1RFA A;  4DXA B;  4EUT A;  3ZTC A;  2KFJ A;  4HDQ A;  2LI5 A;  3WA0 A;  5IA7 A;  4HJK A;  4BKT A;  1WXS A;  1NI2 A;  2LVQ A;  2BWF A;  2GBN A;  4ANW A;  3QWZ B;  1S3S G;  3X0W A;  2KWV B;  1YX6 B;  1OEY J;  3OLM D;  1AAR A;  4ANV A;  1V5T A;  2PE6 B;  1WMH A;  2J0J A;  4EZL A;  2IO3 B;  2ZCC A;  4AOF A;  1YX5 B;  2FIF A;  2JUO A;  1D3Z A;  4IUM B;  2C9W B;  4KDI C;  4W9K A;  3QIJ A;  3V6C B;  2DZJ A;  3ONS A;  3R66 C;  1A5R A;  3NZU A;  4IWP A;  4NAW A;  2BYV E;  3RUI B;  3R7Q A;  3ZDT A;  3TIX A;  1S1Q B;  2N1V A;  2ZVO A;  2FCM A;  2KMA A;  4WWN A;  2Z59 B;  2PE9 A;  3BIN A;  2NBU A;  1Z5S B;  2J0M A;  3N32 A;  5CHW A;  3SHQ A;  3RUL A;  1LM8 B;  3ZRC A;  1U4A A;  1WJ6 A;  2GBR A;  1YJ1 A;  1YQB A;  2M4N A;  2O6V A;  2FCQ A;  2N1W A;  4W9L A;  3ZKJ C;  3PRP B;  1IYF A;  4E74 A;  3L13 A;  4G3X B;  2NCN A;  3DVN U;  4GGQ A;  4P7I A;  2PEA A;  1YD8 U;  3IFW B;  3R7R A;  4HWI B;  2WWZ A;  2G3Q B;  1TZ1 A;  3JVZ X;  3TL5 A;  1WJ4 A;  1WE7 A;  5IAA C;  3SU8 X;  1WI0 A;  3VH4 B;  4B95 A;  4F8C B;  3HIZ A;  4LJO B;  2BYF A;  4F7Z A;  1V6E A;  5E6O A;  3VFK A;  1WH3 A;  1EF1 A;  2I1K A;  3KUZ A;  3VHT C;  2GBM A;  2MX2 A;  1CMX B;  1UD7 A;  2N7E A;  4MEL A;  3M62 B;  5GMV A;  1IPG A;  4GXB A;  1TGZ B;  2LXC A;  3SD5 A;  4G0N B;  1NDD A;  4B6W A;  4A3O A;  1UEL A;  2MA9 B;  3H1U A;  4E71 A;  1WM2 A;  2FCN A;  1GUA B;  2RGF A;  3LDZ E;  2JZ3 B;  1M94 A;  4HDO A;  5D6J B;  4K7S A;  4ZYN A;  3QA8 A;  2N7D A;  4BKS A;  1R4M I;  1E8Y A;  1EO6 A;  4DHJ D;  2I1J A;  4DWF A;  2L76 A;  4GB9 A;  4FBJ B;  3DDC B;  2KO3 A;  3CF6 E;  1L7Y A;  3M95 A;  2K6D B;  2MBE A;  3PHW B;  4NY0 A;  2KDF B;  4GMV A;  1WZ0 A;  2DX5 B;  4FA6 A;  4K7U A;  3W1Y A;  2IZV B;  1P1A A;  3H7P A;  1G6J A;  2C7M B;  1UBI A;  3RYT A;  3UIP B;  3K9P B;  4X57 B;  5J2R A;  1E7U A;  2KTR B;  1RRB A;  1R4N I;  3UQA A;  1SE9 A;  4FLH A;  4TV3 A;  1WXV A;  2KWU B;  2LXA A; 
#chains in the Genus database with same CATH topology
 2NMQ A;  3NHE B;  1C77 A;  3WCQ A;  4RFB A;  1SB3 C;  4HPL B;  2CKH B;  3NVY A;  4G11 A;  2JT4 B;  1TKE A;  1DOI A;  3V61 A;  5G5H A;  1YJI A;  3PTF C;  4LTU A;  5DPR A;  4RNA A;  3WAL A;  2O2V B;  1E10 A;  2BYT A;  4GDL A;  4O1N A;  5FKA C;  1JWU D;  3WIM A;  4GOC A;  1WYG A;  1QF6 A;  2L8J A;  3AEB B;  1F1H A;  2XNA C;  4KDL B;  5AZG A;  2I2Y A;  4A20 A;  1GAQ B;  3ZLZ A;  4AP4 C;  1K8R B;  1L6U A;  2MEK A;  3ZVV A;  3VH3 B;  1L4D B;  2VZK D;  4P1C C;  2JZZ A;  2QHO A;  2WP9 B;  4A9A A;  4IM2 A;  1PGB A;  2BW2 A;  4BOZ B;  2UU7 A;  4K7W A;  1V5O A;  3WAO A;  1C4P A;  3U30 A;  2G4S A;  2I38 A;  2WDQ B;  4RGT A;  2N9X A;  4KGR A;  1VD2 A;  1FRR A;  3DPD A;  2ZJD A;  1JWM D;  4JIO U;  2KFK A;  2BKR B;  2L32 A;  4NZL B;  4KSK C;  2LAS A;  4KGT A;  3IHP C;  4M0W B;  2KQ7 A;  3BK1 A;  1K51 A;  1MFW A;  1FIQ A;  2KQ4 X;  1MG8 A;  1IUE A;  1XD3 B;  2M19 A;  2JY6 A;  3DBS A;  3PRZ A;  2G9H D;  4RH6 A;  3ZW3 A;  2PJH A;  2QSD A;  1I4G A;  3KH0 A;  2XEW A;  1V1O A;  2Q5W D;  3UIN B;  3N1Z C;  5JXV A;  2K39 A;  2KAN A;  2O6V B;  4J6I A;  3AE1 B;  4HCN B;  4NQK E;  2JYT A;  3ZIM A;  4HJG E;  1GG3 A;  4B9K A;  4YTP B;  2JSV X;  2JXT A;  5AUK A;  3ZJV A;  4JGH B;  1L5P A;  2WU2 B;  3TJP A;  2KN4 A;  3V60 A;  3T3O A;  4FHK A;  3AE7 B;  5CTR C;  1KOT A;  4AJW A;  2NPT A;  1NVI D;  2V4L A;  5TR5 A;  1J8C A;  1UH6 A;  4KGS A;  1LQB A;  2DZM A;  2WXK A;  1I4R A;  1HQR D;  4NPN A;  3GE8 C;  2BYE A;  1CJE A;  1YQ4 B;  2RR9 A;  5CHV C;  2JQR B;  1H8C A;  2ZPN A;  1C79 A;  3U7Z A;  1C78 A;  4OVV A;  4US9 A;  4IM3 A;  2QMT A;  1D4B A;  1XO3 A;  3DBR B;  1WX7 A;  4TKN A;  2D10 A;  1FM0 D;  4I6N B;  2MCN B;  2JYE A;  1WJN A;  2HJ8 A;  2X8X X;  1OQQ A;  4BVU C;  1QLB B;  2KTF A;  3ML8 A;  4LLG M;  1VRA B;  4XGA B;  2K1F A;  2L00 B;  2DYB A;  2D3A A;  1TTN A;  4RMA A;  3GZN B;  1D5Z C;  2ZW0 A;  3BVG A;  1NBF C;  2EMS A;  2LRU A;  4M8N A;  2C60 A;  2Y5C A;  2RPV A;  3VDZ A;  3EFC A;  1GPX A;  1N6Z A;  1Y8R C;  1FMA D;  2CJO A;  4WJP A;  4K81 A;  5MPO A;  1XXG A;  2GB1 A;  2N4F A;  3DBL I;  3A33 B;  5AEK B;  1C4C A;  4YTN B;  3DVN V;  4I6L B;  3ML9 A;  2ZEQ A;  2IO0 B;  2W9N A;  3KUD B;  1HA5 A;  1OFF A;  2OJR A;  3CSF A;  3C19 A;  3PS6 A;  3VUX A;  1XT9 B;  1FRD A;  4RF0 A;  1YIW A;  5D94 A;  2OHF A;  4TQ1 A;  1WGH A;  1XLN A;  2BF8 B;  3ZNZ B;  1B9R A;  4W9G A;  4GN1 A;  2ASQ A;  3AE6 B;  2V3P A;  2MJ3 A;  3RNE C;  3W1S A;  1N5X A;  3QAQ A;  1Q5W B;  2RSU A;  2MBQ A;  4FUL A;  4C00 A;  2IGD A;  4BKS D;  5D2M B;  3VRB B;  3AEA B;  1SJE D;  2KWD A;  2BKF A;  2GRI A;  2KWC A;  2QC8 A;  3BYT B;  2PLP A;  4MJS A;  4ZDV A;  4ITK A;  2IBI B;  1J19 A;  3AU4 A;  2QIL A;  1P0R A;  3A9K B;  3J9C A;  2A5U A;  4C7Z A;  1R4M B;  3PT2 B;  1KJT A;  2L52 A;  3GE3 C;  3GS2 A;  5LLI A;  4WQM A;  4JWU C;  1GJZ A;  1LGR A;  1JRU A;  5HG2 A;  5HFY A;  4AUQ C;  4GSW A;  4HPM B;  4WH4 A;  1WZ3 A;  2WXR A;  3CST A;  3RPF C;  2L0T A;  3BYY B;  1PGA A;  2D3B A;  1GOZ A;  1TS2 A;  2IDY A;  3QX1 A;  3OWE B;  2WHI A;  4AS1 A;  2O6V D;  1WM3 A;  3WAN A;  3LXF A;  4A3P A;  3A4R A;  4JLC A;  5BYQ A;  3A1Q B;  3VUW A;  2X38 A;  3HK0 A;  3A1Q A;  3AM9 A;  3RN9 C;  4IWQ A;  4KIK B;  2D5G A;  1FFV A;  2GI9 A;  3RNA C;  3WA0 A;  2LHD A;  1NI2 A;  2BWF A;  3X0W A;  1S3S G;  2KWV B;  1L0X B;  3OLM D;  2AQ2 B;  1AAR A;  4ANV A;  2PE6 B;  2FUG 1;  2J0J A;  2IO3 B;  1DGJ A;  3AN1 A;  1A5R A;  3NZU A;  3TIX A;  1VJK A;  1SBB B;  2FCM A;  2KMA A;  1TS3 A;  1Z5S B;  2J0M A;  3RUL A;  2LFI A;  3ZRC A;  2KDM A;  1T5X D;  4USA A;  1WJ6 A;  1IYF A;  4E74 A;  1NEK B;  4P7I A;  2NCN A;  3R7R A;  4HWI B;  3JVZ X;  3TL5 A;  3SU8 X;  3HIZ A;  1FNV A;  4F7Z A;  4TSS A;  1AYF A;  1VDV A;  5HHD G;  1TS5 A;  4A90 A;  3B2G A;  1HZ6 A;  3I5J C;  4E71 A;  1WM2 A;  2WXM A;  4YTM B;  4DWF A;  3U2S C;  3ZJT A;  2W82 A;  2LGI A;  1FXI A;  2BS4 B;  1WZ0 A;  4FA6 A;  4K7U A;  4RCO A;  3W1Y A;  1G6J A;  3RYT A;  3K9P B;  1RYJ A;  1DOX A;  1E7U A;  3KLS X;  2KTR B;  2SEB D;  3RNC C;  1R4N I;  3UQA A;  4FLH A;  2KWU B;  2LXA A;  1UWM A;  3RNB C;  2MW5 A;  3HVD A;  3TUO A;  3MJW A;  4FAD A;  3HRD D;  2KDE B;  4FJV B;  1J7C A;  1E6E B;  4HXD A;  1UGM A;  3H8H A;  2CHZ A;  3E9S A;  2DWQ A;  3P2B A;  4AWJ A;  2Y5P A;  4CHK A;  2CS4 A;  3AEC B;  1ROE A;  3DVG X;  4C4V A;  1T0Q C;  3PLV A;  2D3G A;  4LNN A;  3TEY A;  3RCZ A;  1FEH A;  1WJU A;  5L95 C;  4YSZ B;  3RMK C;  1I7H A;  1IP9 A;  3R8B A;  2CHX A;  5BO4 B;  5BMH A;  1MVK A;  2MP2 A;  3P63 A;  3JW0 X;  3Q14 C;  1VR9 A;  3L10 B;  3MC9 A;  4YWG G;  3T9L A;  1EUV B;  3L54 A;  3Q3J A;  1A70 A;  1I35 A;  4EFO A;  1QQR A;  3NJT A;  4FN2 A;  4HEA 1;  4XZ4 A;  3ZDM C;  1V1P A;  1LFD A;  2PPH A;  3AED B;  2VRR B;  2A4Z A;  3N3K B;  1YN4 A;  4J3O D;  3MHS D;  2B76 B;  3Q3N C;  5DCN A;  4PK1 A;  4IW0 A;  1WY8 A;  1EU3 A;  4DK5 A;  5HI1 A;  4OZB A;  3MP9 A;  3Q6B A;  3APD A;  4MM3 B;  1TY2 A;  1PGX A;  2K22 A;  2REX A;  2G4D B;  1UWX A;  4MM3 A;  3Q8C A;  4ZRJ A;  1L6V A;  3ZTD A;  3P4R B;  4YXD B;  3FIL B;  1UF0 A;  1HEZ E;  2CR5 A;  2QJL A;  3HVZ A;  1FCL A;  2K25 A;  4OVU A;  4TUU A;  3EA6 A;  1YJJ A;  2MBH A;  3DHH C;  1OQR A;  1V9J A;  2IY0 B;  1PYW D;  2C5L C;  4LK0 M;  4K1R B;  5DPS A;  2XK5 B;  3APC A;  3VTV A;  4JX1 C;  2KZR A;  1OGW A;  2AYO B;  2DZK A;  1T0Y A;  1WIA A;  3GOE A;  2KJ6 A;  3OJ4 B;  4GU2 A;  3P1M A;  3V62 A;  2AX5 A;  2GBJ A;  1TBE A;  4M8M A;  2HE7 A;  4W9H A;  2IYD B;  1CQV A;  3W1S C;  4YSX B;  2DYO A;  3DBH B;  2AQ1 B;  3I3T B;  2NPT B;  5HKH A;  1C4A A;  2IPK D;  1WGK A;  1E90 A;  3UF8 A;  4N6E B;  5AZF A;  2WXH A;  4H2A A;  4IOI E;  3AE8 B;  1DOY A;  3AU5 A;  3ETR A;  2INP E;  2Z0D B;  1TKY A;  3T3N A;  2OOB B;  2J53 A;  3V6E B;  4BBN C;  4DDG D;  1SEB D;  2KTR A;  4KZC A;  2IO1 B;  1E5W A;  4W9F A;  2DAF A;  4GDK B;  1HXY D;  1GC7 A;  4MGZ E;  1VZ7 A;  1ZDX A;  2NBW B;  4RM9 A;  3R2I A;  1CZP A;  2WDT B;  3BY4 B;  2BPS A;  1KFY B;  2AWT A;  2C7H A;  2KVR A;  3SEB A;  2LJI A;  1F9J A;  2LMC A;  1WGR A;  2WQY B;  4HVB A;  2V3S A;  2UYZ B;  1ZGU B;  3GZN I;  3AV8 A;  3L08 A;  1JML A;  1NI3 A;  4OHJ A;  4KVG B;  1JW9 D;  4WIP A;  1STE A;  4ANX A;  3KVF B;  1C1Y B;  2YLM A;  5EE0 A;  1WX8 A;  1T0S C;  1UZX B;  2BWE S;  3ZXV A;  4II3 B;  2PW9 A;  2WXG A;  3VTU A;  4R3D A;  3O65 B;  1SGH A;  3R2T A;  4WQO B;  2HTH A;  3FKY A;  5JH5 C;  2WX0 A;  3VRA B;  5FR6 A;  3DWG C;  2ZW1 A;  5AUI A;  3KWL A;  3DOW A;  1D6E C;  3R3M A;  1NYQ A;  4I6P A;  3EHV A;  3I9V 1;  2Z0E B;  3RD2 A;  1I4X A;  2KJR A;  5CHF A;  2E6X A;  4Q2J A;  4ZRI A;  2QEJ C;  3WAM A;  1KF6 B;  2Z8L A;  2WYQ A;  1CK1 A;  2YEP F;  2W55 A;  3Q8B A;  3H7P B;  5JHB A;  4ZHO A;  1QOA A;  3H7S A;  4NJ6 A;  1TYG B;  3BVM A;  3W2D A;  2WX1 A;  4TQ0 A;  2LD9 A;  4OW0 A;  2KAC A;  4WAA A;  3TMP B;  1ZE3 D;  2KC2 A;  2VZK B;  3AE9 B;  1UBQ A;  3L0W B;  4REZ A;  3B1L X;  4K3C A;  1KH0 A;  3LB8 C;  2JWU A;  1UUP A;  4PS8 A;  3DVG Y;  4KIK A;  3U8Z A;  4WJN A;  1WGG A;  3NZS A;  1L2N A;  2BQQ A;  3JSV B;  4IM0 A;  4W9D A;  1JQ4 A;  3QQ8 B;  4N9F 4;  2JWZ A;  2UWQ A;  3OAW A;  1K52 A;  1WE6 A;  4DXG A;  1IGC A;  1V2Y A;  3RI7 C;  4ANU A;  1P3Q U;  1WMH B;  2KQS A;  5C2T B;  4MGI E;  1GNU A;  2MRP A;  4HRS A;  2N7J A;  4LNF A;  1SXT A;  5G55 A;  4DBG A;  3A4S C;  4GDL B;  1XF5 L;  2MJE A;  4OZC A;  4BAX A;  2KFJ A;  5IA7 A;  4BKT A;  2WXI A;  4RGM A;  2R61 A;  4WUR A;  2M56 B;  2ZCC A;  4AOF A;  1BXT A;  4IUM B;  2IJ0 A;  3E56 A;  4NAW A;  4PT5 A;  1EWC A;  2BYV E;  3RUI B;  1AN8 A;  3ZDT A;  3ZXR A;  5FK9 C;  2CJN A;  4WWN A;  2Z59 B;  2NBU A;  4S0R A;  3SHQ A;  1FXA A;  1LM8 B;  3IXS A;  3ZKJ C;  1YQB A;  3PRP B;  3L13 A;  4GGQ A;  1YMH E;  2FBW B;  2PEA A;  1YD8 U;  1WJ4 A;  3VH4 B;  4B95 A;  1WI0 A;  2PKO A;  2BYF A;  1Q10 A;  1V6E A;  5E6O A;  5FR3 A;  3KUZ A;  1ZOY B;  2Y3A A;  4MEL A;  5GMV A;  2WU5 B;  1IPG A;  3Q2A C;  4ZHP A;  4GXB A;  3AE2 B;  1GB1 A;  4L1B A;  5GXG B;  1TZO A;  4A3O A;  1UEL A;  1VZ8 A;  3DBL B;  3H1U A;  2RGF A;  5D6J B;  4K7S A;  2BS2 B;  4BKS A;  2VH2 A;  1C9F A;  1EO6 A;  2I1J A;  2LHE A;  2L76 A;  4FBJ B;  2L83 A;  3DDC B;  2KO3 A;  3CF6 E;  1L7Y A;  3PHW B;  1P1A A;  3H7P A;  1UBI A;  3NVV A;  3UIP B;  5J2R A;  2WXP A;  3LYY A;  1QOB A;  3FC4 A;  4TV3 A;  1F2R I;  4B6W A;  4WJQ A;  1V80 A;  4MGK E;  3EEC A;  3TEZ A;  3M3J A;  1ENF A;  3KW5 B;  2MLB A;  4BKG A;  1RLF A;  2INC C;  4FHJ A;  3N1Y C;  3NVZ A;  2BBC A;  3C8Y A;  1ESF A;  1JCK B;  4W9C A;  4N59 A;  2MBB B;  2LRW A;  4RGO S;  1JWS D;  1Q0W B;  2GLS A;  2DYM A;  1WRI A;  3UGB B;  2D11 A;  2KHW B;  2R2O A;  1TT5 B;  1UNS A;  2LGS A;  1XLO A;  4DHJ B;  3PGE A;  5AZH A;  3VUY A;  4QAY A;  4D2K A;  3QK0 A;  2D2Q A;  2KLG A;  3IAS 1;  2N9E B;  2HJ1 A;  4XWT A;  2L1A A;  2MP2 B;  1E8W A;  4W9E A;  3X23 A;  3HHM A;  2KNB A;  2LZ6 A;  3OJ3 A;  2ZNV B;  2AQ3 B;  3A9J A;  2V0G A;  1PFD A;  3CIR B;  3H9D A;  1QOG A;  4L23 A;  1F2R C;  3KYD D;  3PHX B;  3AEE B;  1QKZ A;  2L3Z A;  1EF5 A;  4MSM B;  4NAM A;  3P4Q B;  2D3C A;  2PTL A;  3C0R B;  3VAW A;  2DZI A;  3Q3F A;  1WR6 E;  2PVO D;  4M01 A;  2M0X A;  4EKU A;  2KMC A;  3CWI A;  3L17 A;  2NBV B;  3RZF A;  4EZK A;  2ZCB A;  1I4H A;  2MH7 A;  1KLG D;  4YL8 A;  5DPT A;  3OG5 A;  1ZW7 A;  4XWW A;  5BMI A;  4EE2 A;  1I42 A;  4LNK A;  2L05 A;  5IO9 A;  5G5G A;  4G50 A;  3Q3M C;  3P42 A;  3AE3 B;  1HTO A;  1TIF A;  4IC7 B;  2KD0 A;  2MQJ A;  5KHQ A;  2FAZ A;  4MH0 E;  1RWS A;  4HCP B;  4PYZ A;  3N20 C;  1OQY A;  4WAF A;  2RDH A;  2INN E;  5EE9 A;  3O13 A;  3KUC B;  2RD0 A;  5D3I B;  1N60 A;  3ZNG C;  3PO0 A;  4GLS C;  1TY0 A;  1YOV B;  4URK A;  1NEN B;  4MJS B;  5J17 A;  3ZNI D;  2WDV B;  4CYE A;  3NRZ A;  3A9K A;  2K3U A;  1B1Z A;  1V86 A;  3BWU D;  2MBO A;  5JHA A;  4C4V B;  1E7V A;  3AXC A;  3KYC D;  4WWM A;  1D5X C;  3UQB A;  1P7F A;  1WSP A;  4ZRK A;  3ZGZ A;  3SFE B;  2ON8 A;  2AL6 A;  1SJH D;  1SIJ A;  3DHI C;  2LEK A;  1EWY C;  2NVU I;  1EM7 A;  2KLC A;  2DEN B;  3FAH A;  3PSE B;  2KYW A;  4GDK A;  2WXN A;  1C3T A;  1HZ5 A;  2DLB A;  1P9D U;  2OJW A;  3TCA A;  2QIE B;  2IND C;  3N30 A;  2IGG A;  3QHT A;  2WXQ A;  2M17 A;  2BVC A;  2KDI A;  2ACZ B;  1FXT B;  2KX0 A;  1ZPS A;  2WLB A;  3HUI A;  2ZNV C;  2KN5 A;  3DBR I;  3CMM B;  4ZYS A;  1TJE A;  5C23 A;  4DXF A;  2ZVN A;  2V1Y A;  2V3N A;  4DHZ E;  2J4X A;  1I4Q A;  2ZZP B;  1WGY A;  4LDT B;  3I63 C;  4JWS C;  3KQ4 A;  4NJ7 A;  3M63 B;  3L4P A;  3W5V B;  2YEP B;  1WFY A;  4E3C A;  4MH8 A;  4YSY B;  1V1P B;  2W54 A;  3PRE A;  4KSL C;  1XCT L;  2EKE C;  2D07 B;  3DCG A;  2WXJ A;  5KHO A;  1FNW A;  3VVW B;  2KJH B;  2BGF A;  2XK5 A;  4IG7 B;  1JAL A;  3GB1 A;  2LWP A;  4LDT D;  5H92 C;  2NTS A;  2N0S B;  3D32 A;  3Q8A A;  2LUE A;  4ARC A;  2J7Q B;  5H8Y E;  4CQN A;  4BBN F;  1KLV A;  4NNJ B;  2N9L A;  4DHZ B;  4AJY B;  3AE5 B;  3BK2 A;  4FJZ A;  3QCA A;  1IBX B;  1XLP A;  2JXX A;  2LGX A;  3IG3 A;  4A6Q A;  3VR9 B;  3ZQ4 A;  4WWO A;  3KWV A;  1KRH A;  3B9J A;  1WXQ A;  3QAR A;  3NS1 A;  3LJ3 A;  5T8I A;  1MHX A;  1JWB D;  1MG4 A;  2K8C A;  2KDB A;  2CHW A;  4HK2 A;  3BII D;  3TSS A;  2YVC A;  2AL3 A;  3B08 A;  1L0Y B;  1PQS A;  1PDX A;  1E8Z A;  1FNU A;  2O2V A;  4B0E A;  2KT7 A;  1WYW B;  5IOI A;  5D3D A;  4IWO A;  3SFD B;  4F1S A;  4S17 A;  4WWP A;  2B3A A;  4M02 A;  1X1M A;  1SE2 A;  4MGY E;  3V05 A;  4HKZ E;  3I57 A;  2QDF A;  2NR2 A;  2L0F A;  4JE3 B;  2K8H A;  3IVF A;  1L0V B;  3H6N A;  3IT6 B;  5D7G A;  3V3X A;  5DPW A;  1BT0 A;  3NS8 A;  4HLE A;  3N1X C;  1N5W A;  3ABV B;  4AQ7 A;  3GP7 A;  2LVP A;  2BB5 A;  2CU1 A;  4JQW C;  1K53 A;  1J7B A;  2K8B A;  2J0K A;  1Q1O A;  2PIA A;  4C7Y A;  3HM6 X;  1ACC A;  5CX3 A;  4EUT A;  3ZTC A;  1E7P B;  2EKI A;  2BT6 A;  4HJK A;  1N63 A;  4DQO C;  3QWZ B;  4M00 A;  2KVZ A;  1V5T A;  1ZP0 B;  1UGJ A;  1RFK A;  2FIF A;  2V4I B;  1D3Z A;  2C9W B;  2EEL A;  3R66 C;  4IWP A;  3R7Q A;  2BB6 A;  1S1Q B;  2N1V A;  5IN7 A;  2PE9 A;  3N32 A;  5CHW A;  2LUM A;  1YJ1 A;  2O6V A;  3SR6 A;  2FCQ A;  3MHZ A;  4UDU C;  4G3X B;  2J42 A;  2K5P A;  2W3R A;  4F8C B;  1WE7 A;  5IAA C;  3NVW A;  1VZ6 A;  1RM6 C;  3ZYY X;  2SAK A;  1WH3 A;  1EF1 A;  2I1K A;  2PVG C;  2GBM A;  1MHH E;  1HTQ A;  1CMX B;  1UD7 A;  1IGD A;  1ZDV A;  1WWT A;  4KX6 B;  1TGZ B;  1YN3 A;  4G0N B;  1NDD A;  1N62 A;  2MA9 B;  2NTT A;  4HDO A;  1M94 A;  4ZYN A;  1FCC C;  3QA8 A;  3BVZ A;  2N7D A;  2TSS A;  4XDC A;  1R4M I;  1E8Y A;  4K3B A;  4GB9 A;  2OED A;  1QT9 A;  5C3J B;  1M4V A;  2K6D B;  3W5U B;  4GMV A;  2DX5 B;  4MAC A;  4RGN A;  1IBX A;  2C7M B;  1FD6 A;  1ZXH A;  1RRB A;  1T6B X;  2VH1 A;  2WXL A;  2K0P A;  5BYS A;  1GC6 A;  4EOY A;  1OEY A;  3WAP A;  2M1M A;  2N9P C;  4LNI A;  4C56 C;  1E8X A;  2KKC A;  2FCS A;  2RDG A;  4ICU A;  1ET6 A;  3PLU A;  4BOS C;  1EU4 A;  4FJY A;  3A9J B;  2JPH A;  4KZ0 A;  3ZUN A;  1V8C A;  1WGD A;  4ZRQ A;  2HTM E;  4XC2 A;  3JSV A;  3UI3 A;  1RAX A;  1V49 A;  5E6J A;  3Q8F A;  3B0A A;  1WXM A;  1LXD A;  3EUB 2;  4HRO A;  2Y5B B;  3EFU A;  1WF9 A;  2K6Q A;  2G45 B;  2HDE A;  2R2Q A;  4JPS A;  1JWA D;  1XCQ L;  1FO4 A;  3PRM B;  1T0R C;  3VR8 B;  4EZJ A;  2KFK B;  3ENE A;  2XN9 C;  1FPY A;  2IY1 B;  1P98 A;  2XBB C;  3DBH I;  4M0W A;  2WNM A;  1SSN A;  2GOW A;  1F77 A;  5G2N A;  2FE8 A;  1JRO A;  1VLB A;  2K9X A;  2JF5 A;  1ZKH A;  3TBL D;  5EE3 A;  1K50 A;  2M8S A;  4WJO A;  2EMT A;  3PZD A;  3UIO B;  2DHZ A;  2WDR B;  1I4P A;  2JVC A;  1ET9 A;  3Q3O C;  2WGS A;  4XDD A;  4W9J A;  4A55 A;  4OZA A;  2JRH A;  2RPQ A;  5L83 A;  3JYU A;  1HE8 A;  2DAJ A;  3APF A;  5BMG A;  4MEM A;  5J18 A;  5JZE B;  3PPA A;  4KKI A;  3RFZ B;  4W9I A;  2MWS B;  2JU6 X;  2LGY A;  3QJZ A;  2KXJ A;  2NS5 A;  2LVO A;  3DQV A;  3K9O B;  3AMZ A;  5E6N A;  4P1B C;  1WXA A;  4MSQ B;  3VTW A;  1VCB A;  4GIV A;  1GB4 A;  1R4N B;  1N61 A;  4IKG A;  2IGH A;  4MT5 A;  2JRI B;  5E6P A;  3RZW C;  2ZPY A;  4ASW C;  1SF0 A;  2V9H A;  3MC8 A;  3TEW A;  4XYC A;  4KV2 A;  3ECI A;  3U7D A;  2GBK A;  4ZRP A;  1QIL A;  4BZA A;  3RT3 B;  1JRP A;  3DWM A;  2KX3 A;  2L7R A;  3EGR A;  2PMV A;  4XE0 A;  3SDL C;  3PZ7 A;  1BML C;  2KK8 A;  1H4R A;  3IT4 B;  1MJD A;  1SE3 A;  5EDS A;  2KMM A;  5TSS A;  4PS3 A;  2M0A A;  4P6V F;  3ZNH B;  4DDI D;  1ZXI A;  3P4P B;  2RMM A;  3AI5 A;  4JL9 A;  4XX5 A;  3Q8E A;  4ICV A;  2IO2 B;  3L16 A;  3PVL A;  2MHJ A;  2DNF A;  2KC1 A;  3PV1 A;  5LXH A;  1OTR B;  1WRD B;  3QC8 B;  3ZO5 B;  1AWD A;  1WX9 A;  1J7A A;  3IBE A;  4B0M A;  3MC0 B;  1C76 A;  1P7E A;  1Z2M A;  2N9K A;  2BTE A;  3U52 E;  5EE1 A;  1AW7 A;  2FID A;  3URY A;  3VQI A;  2QCZ A;  4PS7 A;  3NUH B;  4NQL B;  1J0G A;  4L2Y A;  1ISN A;  3FIL A;  1F0Z A;  3NZ3 A;  4US8 A;  2MSE D;  1DYQ A;  4MDK E;  3MTN B;  4LJP B;  4NAW B;  1E9M A;  4EEW A;  2JX5 A;  1TKG A;  2W3S A;  2C7N B;  2KOX A;  4II2 B;  4PYU A;  1TS4 A;  3AUL A;  5LXI B;  2FUH B;  3EC8 A;  3N9Y C;  3NG0 A;  1XLQ A;  2HD5 B;  1NYR A;  4CO7 A;  3AE4 B;  2ONQ A;  2WXF A;  2DBY A;  3IAM 1;  2LJ5 A;  1KTK A;  3DHG C;  4YT0 B;  1WR1 A;  2RDB C;  3MJ5 A;  5BYR A;  4LNO A;  2GMI C;  1BUI C;  3NOB A;  1QOF A;  3AB5 A;  5C1Z A;  4A8X C;  2FNJ B;  3VXW A;  1KM7 A;  2AEH A;  4RM8 A;  2MJD A;  1SE4 A;  3HM3 A;  2E3T A;  3ZRF A;  1QZE A;  3AEF B;  1V81 A;  2ICI A;  3S2A A;  4HKQ A;  2LGD A;  1E0Z A;  2WS3 B;  1D5M C;  4KKJ A;  4P16 A;  4IDI A;  3TEX A;  4BFR A;  3NY5 A;  3T8M A;  1XQQ A;  2J52 A;  1SIF A;  4LCD E;  1R7S A;  3U4E G;  3ALB A;  1XEE A;  1RFA A;  4DXA B;  1MPE A;  1T3Q A;  4HDQ A;  2LI5 A;  1WXS A;  2LVQ A;  1F52 A;  2GBN A;  4ANW A;  4C80 A;  5LNK 1;  4FXC A;  1YX6 B;  3RNF C;  1OEY J;  3AH7 A;  1YN5 A;  4OVZ A;  4EZL A;  1WMH A;  3MFG A;  3ZJU A;  1YX5 B;  2JUO A;  4KDI C;  4W9K A;  2JZP A;  3QIJ A;  3V6C B;  2DZJ A;  3ONS A;  4RF1 A;  2H88 B;  2KAJ A;  2ZVO A;  1L4Z B;  3BIN A;  4HPP A;  2WXO A;  1U4A A;  2GBR A;  2M4N A;  2N1W A;  4W9L A;  1MI0 A;  1KLU D;  3DVN U;  3IFW B;  2WWZ A;  2G3Q B;  1TZ1 A;  5I4D A;  5IKC M;  4LJO B;  4ARI A;  3VFK A;  3VHT C;  2MX2 A;  2G1E A;  1FFU A;  2N7E A;  3M62 B;  4ACF A;  4ZOH C;  2LXC A;  1V97 A;  3SD5 A;  3RNG C;  3AEG B;  1Y56 A;  5IP4 D;  2FCN A;  1GUA B;  3LDZ E;  2JZ3 B;  1YNT E;  4DHJ D;  1YQ3 B;  3B2F A;  2CU3 A;  3P4S B;  3PZ8 A;  3M95 A;  1ZUD 2;  2MBE A;  4TMA B;  4NJC A;  4NY0 A;  2KDF B;  3Q69 A;  3W9C B;  3BZD B;  2IZV B;  2H89 B;  4X57 B;  4N58 A;  1SE9 A;  1LO5 D;  1PUT A;  2BS3 B;  1WXV A; 
#chains in the Genus database with same CATH homology
 4WJQ A;  1V80 A;  4MGK E;  3NHE B;  1GC6 A;  3EEC A;  2MW5 A;  4EOY A;  1OEY A;  3M3J A;  3KW5 B;  2MLB A;  4BKG A;  3MJW A;  2M1M A;  3WAP A;  4FAD A;  2N9P C;  1RLF A;  4HPL B;  2CKH B;  4G11 A;  2KDE B;  4FJV B;  4FHJ A;  2JT4 B;  3V61 A;  1E8X A;  4HXD A;  1UGM A;  3PTF C;  2CHZ A;  2KKC A;  5DPR A;  2FCS A;  3P2B A;  3WAL A;  4AWJ A;  4W9C A;  4ICU A;  4CHK A;  2O2V B;  3PLU A;  4BOS C;  2CS4 A;  4FJY A;  2MBB B;  4GDL A;  2LRW A;  1Q0W B;  3DVG X;  3A9J B;  3WIM A;  2DYM A;  3PLV A;  4GOC A;  2D11 A;  2D3G A;  2KHW B;  3UGB B;  2JPH A;  4KZ0 A;  2R2O A;  3ZUN A;  3RCZ A;  2L8J A;  1WGD A;  1WJU A;  5L95 C;  4KDL B;  5AZG A;  4XC2 A;  3JSV A;  4A20 A;  4DHJ B;  1RAX A;  1IP9 A;  3ZLZ A;  4AP4 C;  3PGE A;  5AZH A;  1V49 A;  2CHX A;  5BO4 B;  3VUY A;  2MP2 A;  1K8R B;  3JW0 X;  3QK0 A;  3B0A A;  2D2Q A;  2KLG A;  3ZVV A;  1WXM A;  1LXD A;  3VH3 B;  2N9E B;  3L10 B;  2JZZ A;  2QHO A;  2MP2 B;  1E8W A;  1EUV B;  3L54 A;  3T9L A;  3Q3J A;  4W9E A;  3X23 A;  1I35 A;  3HHM A;  4IM2 A;  4EFO A;  2Y5B B;  3EFU A;  1WF9 A;  2KNB A;  2K6Q A;  4FN2 A;  2G45 B;  4BOZ B;  4XZ4 A;  2LZ6 A;  3ZDM C;  1LFD A;  2R2Q A;  3OJ3 A;  2PPH A;  2VRR B;  2A4Z A;  4K7W A;  3N3K B;  2ZNV B;  1V5O A;  3WAO A;  3U30 A;  3A9J A;  2G4S A;  2N9X A;  3MHS D;  3PRM B;  5DCN A;  1VD2 A;  4EZJ A;  3DPD A;  2KFK B;  4IW0 A;  1WY8 A;  2ZJD A;  3ENE A;  3H9D A;  4JIO U;  3KYD D;  2IY1 B;  1P98 A;  2KFK A;  2XBB C;  3DBH I;  3PHX B;  4DK5 A;  2BKR B;  2L3Z A;  2GOW A;  5G2N A;  1EF5 A;  4KSK C;  2LAS A;  4MSM B;  3IHP C;  4M0W B;  2KQ7 A;  3C0R B;  3APD A;  3VAW A;  2DZI A;  3Q3F A;  1WR6 E;  2REX A;  2M0X A;  2G4D B;  4EKU A;  2JF5 A;  1ZKH A;  3TBL D;  4MM3 A;  2KMC A;  3L17 A;  2NBV B;  1MG8 A;  4ZRJ A;  1XD3 B;  2M8S A;  3RZF A;  3ZTD A;  4WJO A;  2JY6 A;  2EMT A;  3DBS A;  3PZD A;  3PRZ A;  2ZCB A;  4EZK A;  3UIO B;  2DHZ A;  3ZW3 A;  2CR5 A;  2JVC A;  2K25 A;  4OVU A;  2PJH A;  4TUU A;  3KH0 A;  2XEW A;  4YL8 A;  5DPT A;  2MBH A;  4W9J A;  1ZW7 A;  1V9J A;  2IY0 B;  3UIN B;  2C5L C;  2JRH A;  2RPQ A;  4K1R B;  5DPS A;  5L83 A;  2K39 A;  1I42 A;  2KAN A;  2O6V B;  2XK5 B;  3APC A;  2L05 A;  3JYU A;  4J6I A;  1HE8 A;  3VTV A;  2DAJ A;  3APF A;  2KZR A;  4G50 A;  4HCN B;  4MEM A;  4NQK E;  3ZIM A;  5J18 A;  1OGW A;  2AYO B;  2DZK A;  1GG3 A;  1T0Y A;  5JZE B;  4B9K A;  1WIA A;  3PPA A;  3GOE A;  4IC7 B;  2KD0 A;  2MQJ A;  4W9I A;  2MWS B;  2LGY A;  3QJZ A;  2KXJ A;  2FAZ A;  5KHQ A;  2KJ6 A;  4JGH B;  3OJ4 B;  4MH0 E;  2NS5 A;  2LVO A;  3DQV A;  4GU2 A;  4HCP B;  4PYZ A;  1OQY A;  3K9O B;  5E6N A;  3TJP A;  3V62 A;  2GBJ A;  1WXA A;  4MSQ B;  3V60 A;  3KUC B;  2RD0 A;  3VTW A;  1VCB A;  4FHK A;  1TBE A;  3ZNG C;  4GIV A;  4M8M A;  5CTR C;  2HE7 A;  4URK A;  4W9H A;  1KOT A;  2IYD B;  2NPT A;  4MJS B;  4AJW A;  2V4L A;  5J17 A;  3W1S C;  3ZNI D;  2DYO A;  2JRI B;  5E6P A;  3RZW C;  4CYE A;  3I3T B;  5TR5 A;  1J8C A;  1UH6 A;  2NPT B;  3A9K A;  2ZPY A;  4ASW C;  1LQB A;  5HKH A;  2DZM A;  4KV2 A;  1E90 A;  1V86 A;  2MBO A;  3ECI A;  4NPN A;  3U7D A;  2GBK A;  2BYE A;  5AZF A;  3UF8 A;  5JHA A;  3RT3 B;  2KX3 A;  2L7R A;  2RR9 A;  1E7V A;  3AU5 A;  3AXC A;  3KYC D;  5CHV C;  1H8C A;  3UQB A;  2Z0D B;  3SDL C;  2OOB B;  2ZPN A;  4OVV A;  3V6E B;  4BBN C;  4IM3 A;  4DDG D;  2KK8 A;  1H4R A;  2KTR A;  4KZC A;  4ZRK A;  2IO1 B;  2AL6 A;  1E5W A;  4W9F A;  2DAF A;  1WX7 A;  4TKN A;  2NVU I;  2KLC A;  5EDS A;  2D10 A;  2DEN B;  3PSE B;  4PS3 A;  4GDK B;  4I6N B;  2MCN B;  1GC7 A;  4MGZ E;  1WJN A;  2HJ8 A;  2NBW B;  3ZNH B;  4DDI D;  4RM9 A;  4GDK A;  4BVU C;  2WDT B;  2KTF A;  3BY4 B;  3ML8 A;  1C3T A;  1P9D U;  2K1F A;  2L00 B;  2BPS A;  2C7H A;  2AWT A;  2DYB A;  2KVR A;  3AI5 A;  4JL9 A;  1TTN A;  4XX5 A;  3TCA A;  4ICV A;  1F9J A;  1WGR A;  4RMA A;  2IO2 B;  3L16 A;  4HVB A;  2V3S A;  2UYZ B;  1ZGU B;  3GZN I;  3PVL A;  3N30 A;  1NBF C;  3QHT A;  2EMS A;  2LRU A;  3L08 A;  2KC1 A;  3PV1 A;  4M8N A;  5LXH A;  2C60 A;  2M17 A;  1OTR B;  4KVG B;  3VDZ A;  1WRD B;  2KDI A;  3QC8 B;  1Y8R C;  3ZO5 B;  1FXT B;  2KX0 A;  4WJP A;  4K81 A;  1WX9 A;  4ANX A;  2ZNV C;  3IBE A;  2KN5 A;  1C1Y B;  2N4F A;  2YLM A;  3DBL I;  3KVF B;  3DBR I;  3A33 B;  1WX8 A;  3CMM B;  5C23 A;  1UZX B;  2BWE S;  5AEK B;  1Z2M A;  2ZVN A;  2V1Y A;  4II3 B;  4DHZ E;  3DVN V;  2FID A;  4I6L B;  2ZZP B;  3ML9 A;  2ZEQ A;  2IO0 B;  2W9N A;  3VQI A;  1WGY A;  4LDT B;  3KUD B;  3VTU A;  3O65 B;  4NJ7 A;  3M63 B;  1SGH A;  4PS7 A;  4WQO B;  2HTH A;  5JH5 C;  2WX0 A;  4NQL B;  1J0G A;  1WFY A;  5FR6 A;  2OJR A;  4E3C A;  1ISN A;  3CSF A;  3PS6 A;  3VUX A;  3PRE A;  1XT9 B;  4KSL C;  2MSE D;  4MDK E;  2EKE C;  3DCG A;  2D07 B;  1YIW A;  3MTN B;  4LJP B;  4NAW B;  3DOW A;  5D94 A;  5KHO A;  4TQ1 A;  1WGH A;  3R3M A;  2BF8 B;  3ZNZ B;  4EEW A;  4I6P A;  4W9G A;  3EHV A;  3VVW B;  2KJH B;  2BGF A;  2XK5 A;  4GN1 A;  2ASQ A;  2Z0E B;  4IG7 B;  3RD2 A;  2KJR A;  2LWP A;  4LDT D;  5CHF A;  2C7N B;  2KOX A;  4ZRI A;  3D32 A;  3WAM A;  4II2 B;  2LUE A;  4PYU A;  3AUL A;  2J7Q B;  3W1S A;  2WYQ A;  5LXI B;  3QAQ A;  1Q5W B;  2FUH B;  2RSU A;  2MBQ A;  3EC8 A;  4FUL A;  4NNJ B;  4BBN F;  1KLV A;  4DHZ B;  4AJY B;  2HD5 B;  4BKS D;  4FJZ A;  5D2M B;  4CO7 A;  3H7P B;  3QCA A;  5JHB A;  2JXX A;  2BKF A;  2LGX A;  2KWC A;  3IG3 A;  3H7S A;  4NJ6 A;  4WWO A;  2WX1 A;  4TQ0 A;  4MJS A;  2LD9 A;  4ZDV A;  2IBI B;  1J19 A;  3AU4 A;  4WAA A;  1P0R A;  3A9K B;  2LJ5 A;  2A5U A;  3QAR A;  3LJ3 A;  3TMP B;  2KC2 A;  3L0W B;  1UBQ A;  1WR1 A;  3PT2 B;  1KJT A;  2K8C A;  2KDB A;  2CHW A;  3B1L X;  4HK2 A;  2YVC A;  5LLI A;  2AL3 A;  1GJZ A;  3B08 A;  1JRU A;  1PQS A;  1E8Z A;  2O2V A;  2GMI C;  3NOB A;  1WYW B;  4PS8 A;  3DVG Y;  4IWO A;  4KIK A;  3U8Z A;  5C1Z A;  4WJN A;  1WGG A;  2FNJ B;  3VXW A;  4F1S A;  4AUQ C;  1KM7 A;  2AEH A;  3NZS A;  4WWP A;  2B3A A;  4GSW A;  4HPM B;  1L2N A;  4RM8 A;  1X1M A;  1WZ3 A;  3JSV B;  4MGY E;  4IM0 A;  3HM3 A;  4W9D A;  3QQ8 B;  4N9F 4;  2JWZ A;  3ZRF A;  2UWQ A;  3OAW A;  3CST A;  1QZE A;  1WE6 A;  2L0T A;  2NR2 A;  2L0F A;  1V2Y A;  1V81 A;  3S2A A;  2LGD A;  2K8H A;  3QX1 A;  3IVF A;  4ANU A;  3H6N A;  1P3Q U;  2O6V D;  1WMH B;  5D7G A;  5DPW A;  2KQS A;  1WM3 A;  3WAN A;  4A3P A;  3A4R A;  1BT0 A;  4JLC A;  3NS8 A;  4HLE A;  3A1Q B;  3VUW A;  4MGI E;  1GNU A;  2MRP A;  2LVP A;  4BFR A;  3NY5 A;  3T8M A;  3HK0 A;  1XQQ A;  2CU1 A;  3A1Q A;  4JQW C;  2K8B A;  1SIF A;  4IWQ A;  4LCD E;  5G55 A;  2J0K A;  1Q1O A;  4KIK B;  4DBG A;  3A4S C;  4GDL B;  3HM6 X;  3ALB A;  5CX3 A;  1RFA A;  4DXA B;  4EUT A;  3ZTC A;  2KFJ A;  4HDQ A;  2LI5 A;  3WA0 A;  5IA7 A;  4HJK A;  4BKT A;  1WXS A;  1NI2 A;  2LVQ A;  2BWF A;  2GBN A;  4ANW A;  3QWZ B;  1S3S G;  3X0W A;  2KWV B;  1YX6 B;  1OEY J;  3OLM D;  1AAR A;  4ANV A;  1V5T A;  2PE6 B;  1WMH A;  2J0J A;  4EZL A;  2IO3 B;  2ZCC A;  4AOF A;  1YX5 B;  2FIF A;  2JUO A;  1D3Z A;  4IUM B;  2C9W B;  4KDI C;  4W9K A;  3QIJ A;  3V6C B;  2DZJ A;  3ONS A;  3R66 C;  1A5R A;  3NZU A;  4IWP A;  4NAW A;  2BYV E;  3RUI B;  3R7Q A;  3ZDT A;  3TIX A;  1S1Q B;  2N1V A;  2ZVO A;  2FCM A;  2KMA A;  4WWN A;  2Z59 B;  2PE9 A;  3BIN A;  2NBU A;  1Z5S B;  2J0M A;  3N32 A;  5CHW A;  3SHQ A;  3RUL A;  1LM8 B;  3ZRC A;  1U4A A;  1WJ6 A;  2GBR A;  1YJ1 A;  1YQB A;  2M4N A;  2O6V A;  2FCQ A;  2N1W A;  4W9L A;  3ZKJ C;  3PRP B;  1IYF A;  4E74 A;  3L13 A;  4G3X B;  2NCN A;  3DVN U;  4GGQ A;  4P7I A;  2PEA A;  1YD8 U;  3IFW B;  3R7R A;  4HWI B;  2WWZ A;  2G3Q B;  1TZ1 A;  3JVZ X;  3TL5 A;  1WJ4 A;  1WE7 A;  5IAA C;  3SU8 X;  1WI0 A;  3VH4 B;  4B95 A;  4F8C B;  3HIZ A;  4LJO B;  2BYF A;  4F7Z A;  1V6E A;  5E6O A;  3VFK A;  1WH3 A;  1EF1 A;  2I1K A;  3KUZ A;  3VHT C;  2GBM A;  2MX2 A;  1CMX B;  1UD7 A;  2N7E A;  4MEL A;  3M62 B;  5GMV A;  1IPG A;  4GXB A;  1TGZ B;  2LXC A;  3SD5 A;  4G0N B;  1NDD A;  4B6W A;  4A3O A;  1UEL A;  2MA9 B;  3H1U A;  4E71 A;  1WM2 A;  2FCN A;  1GUA B;  2RGF A;  3LDZ E;  2JZ3 B;  1M94 A;  4HDO A;  5D6J B;  4K7S A;  4ZYN A;  3QA8 A;  2N7D A;  4BKS A;  1R4M I;  1E8Y A;  1EO6 A;  4DHJ D;  2I1J A;  4DWF A;  2L76 A;  4GB9 A;  4FBJ B;  3DDC B;  2KO3 A;  3CF6 E;  1L7Y A;  3M95 A;  2K6D B;  2MBE A;  3PHW B;  4NY0 A;  2KDF B;  4GMV A;  1WZ0 A;  2DX5 B;  4FA6 A;  4K7U A;  3W1Y A;  2IZV B;  1P1A A;  3H7P A;  1G6J A;  2C7M B;  1UBI A;  3RYT A;  3UIP B;  3K9P B;  4X57 B;  5J2R A;  1E7U A;  2KTR B;  1RRB A;  1R4N I;  3UQA A;  1SE9 A;  4FLH A;  4TV3 A;  1WXV A;  2KWU B;  2LXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...