2BWFA

Crystal sturcture of the ubl domain of dsk2 from s. cerevisiae
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
LDMSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLVKSQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords UBIQUITIN-LIKE PROTEIN DSK2
publication title Structures of the Dsk2 Ubl and Uba Domains and Their Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 20
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2bwfA00
4W9JA 1GC7A 3ZRCA 4I6LB 3ZNGC 2JZ3B 4MSQB 4ANXA 2GBRA 1KOTA 3GOEA 3C0RB 1GC6A 3HHMA 2DAFA 2IZVB 3CSTA 3PRZA 4LJOB 1WR6E 4EZJA 3PZDA 4DBGA 1YJ1A 1EF1A 2CU1A 3APFA 3PS6A 1YQBA 3QK0A 4HDQA 2KC2A 1BT0A 3VQIA 1U4AA 1XT9B 4ZYNA 1WJ6A 1TZ1A 3QIJA 3OJ4B 3RUIB 4EKUA 3L08A 4MSMB 3IHPC 3TIXA 4TQ0A 3BY4B 3H9DA 2HD5B 2JRIB 2LGXA 4HWIB 2C7MB 4NAWB 2IO0B 1L2NA 2K25A 4E74A 1Q5WB 4DWFA 4FLHA 3VTUA 4HK2A 1I35A 2KMCA 1JRUA 1WXAA 2KQSA 4EZKA 5LXHA 4PS8A 1V80A 1RFAA 2LVOA 2LRWA 4MJSA 2O6VD 4GDKB 1WJUA 2PPHA 3EC8A 2N7EA 3SD5A 3V61A 2A5UA 3K9OB 3QWZB 1WE7A 2K8BA 3SHQA 2IO3B 4WWOA 5FR6A 3QQ8B 3PTFC 4W9LA 2N9XA 4EOYA 5L95C 1J0GA 3QHTA 4K1RB 1SGHA 2BKFA 3M62B 4J6IA 3TCAA 3A9JB 4GSWA 4HCPB 3ZW3A 2REXA 3DBLI 4GDLB 4TQ1A 2CR5A 4BVUC 2LUEA 3JSVB 4W9CA 2LXAA 1C1YB 3V6EB 3UQAA 3M63B 2MSED 3DOWA 3CMMB 1E7VA 2KC1A 3DVNV 5JHBA 2PE6B 2ZEQA 3OLMD 4PS3A 2GBNA 2VRRB 2FIDA 3RD2A 1P3QU 5LLIA 2MBHA 1WX8A 3R7RA 1YX6B 1TTNA 4EUTA 1VCBA 2DHZA 5CHVC 3TL5A 3WA0A 1EO6A 3W1SC 1R4NI 3R7QA 4DDID 3A1QB 4KDLB 2IO1B 4HXDA 3L16A 1TGZB 1YX5B 2KDBA 2NS5A 4RM8A 3UIOB 4YL8A 2LGYA 2MP2A 2XK5A 2XEWA 5AZHA 2EKEC 2NBUA 4GN1A 4HJKA 4IM0A 5C1ZA 3QJZA 3AXCA 5C23A 4A3OA 3W1YA 2MLBA 3KUZA 2KDFB 3X0WA 4JLCA 1Q0WB 1NDDA 2KX0A 3VFKA 1T0YA 3A9JA 3MJWA 4AWJA 2JF5A 2QHOA 1WM3A 2EMSA 3M3JA 5E6NA 2BF8B 3IBEA 1ZKHA 3LJ3A 5EDSA 2CHZA 2L7RA 4IUMB 3UQBA 1J8CA 1G6JA 2NPTB 4G3XB 3HK0A 1OGWA 4BFRA 5CHWA 4BOZB 1A5RA 3VH3B 4AJWA 2DZKA 2AL3A 1XQQA 4M0WB 3JW0X 3PLVA 4NJ7A 1Q1OA 1WMHB 4B6WA 1J19A 3LDZE 2KOXA 1P1AA 1EF5A 2CKHB 4HPLB 4ZRIA 1E8ZA 4LDTD 2CS4A 1M94A 3H1UA 4XX5A 3R66C 2D10A 1S3SG 1CMXB 5DPTA 4HCNB 2M0XA 4OVVA 2V1YA 4GB9A 2BYVE 1WH3A 1LFDA 1LM8B 2JXXA 3KYCD 1V5TA 4MELA 4WJQA 3SU8X 3BINA 1S1QB 1L7YA 2K1FA 1E8XA 1FXTB 3KH0A 3H7PB 4XC2A 3A9KB 2M8SA 3QARA 2FNJB 1UD7A 2RR9A 2D11A 3RZWC 3X23A 2ZPYA 3U8ZA 2GBJA 2M1MA 2LD9A 4KSKC 4N9F4 3W1SA 2DYMA 5IAAC 2I1JA 1VD2A 4BOSC 1E7UA 1KJTA 3ZUNA 2JY6A 5KHOA 3ALBA 3SDLC 3NZUA 4WJNA 3HM6X 4WWPA 1WXSA 2FCQA 4IWPA 4NQKE 3V62A 1H4RA 3PHXB 1GUAB 3QC8B 3PSEB 2EMTA 4K7UA 3UF8A 2JRHA 1IYFA 1V9JA 1WF9A 1WGHA 2JT4B 4MM3A 2ASQA 1OTRB 3ZNZB 1UELA 1UH6A 1WE6A 3P2BA 4CO7A 4WJOA 5CHFA 3VAWA 4KIKA 1WFYA 2OJRA 3DBHI 3AI5A 3QAQA 4JGHB 2K6DB 2KZRA 2WX0A 2FCNA 2N9PC 5D94A 4ICVA 2KXJA 1V5OA 3RULA 1YIWA 3VTVA 4M8NA 3GZNI 1E5WA 4KV2A 2AYOB 2KDIA 3A9KA 3UIPB 3L13A 2G4SA 1GG3A 1E8WA 4MEMA 3DQVA 2IY1B 4PS7A 4ANWA 3ZNID 2Z0EB 3JYUA 4TV3A 5D2MB 2ZZPB 4XZ4A 2KHWB 4II3B 3L10B 4DHZE 2FIFA 3KUDB 1XD3B 2MCNB 3DCGA 4IM3A 1EUVB 1QZEA 4FJZA 4PYZA 4DK5A 4DHJB 1WIAA 3PV1A 5E6PA 5GMVA 3ZDMC 2R2OA 4EFOA 2BYEA 3PHWB 1D3ZA 3DBRI 4HLEA 3WAOA 5CTRC 1OQYA 2LVPA 3Q3FA 3MHSD 2GOWA 2LVQA 2J0MA 4GXBA 2ZCBA 5D7GA 4TUUA 2D2QA 2DAJA 2LXCA 2PEAA 2C5LC 4G0NB 2LWPA 3N3KB 4GIVA 2KWVB 3APCA 2MX2A 5AZGA 4URKA 1PQSA 2V4LA 4K81A 3KW5B 2KO3A 1V2YA 2N1WA 4NAWA 2DX5B 5IA7A 2AEHA 4BKSA 2ZNVB 5G2NA 3L0WB 4ASWC 1WY8A 3VUWA 3DBSA 3AU4A 2D07B 3VUYA 4PYUA 3OAWA 4EZLA 4GDKA 2KFKB 4AP4C 2LZ6A 3ML9A 2LJ5A 1WJNA 2O2VB 4LJPB 4NQLB 2LASA 3ZRFA 2L05A 2I1KA 2KTRB 3RT3B 2D3GA 4FHKA 2K8CA 2ZPNA 1P9DU 2BGFA 5J18A 3I3TB 4DHZB 3EECA 2KK8A 4E3CA 2MQJA 4GDLA 2NVUI 4MH0E 4W9DA 3JSVA 3KVFB 3ONSA 2UYZB 3KYDD 2O6VB 2KMAA 1ISNA 4G50A 5DPWA 2LRUA 2KDEB 5DPRA 5L83A 5KHQA 2ZVNA 4A3PA 2RSUA 3VTWA 3PRMB 4MGIE 3ZVVA 3WIMA 4IW0A 1HE8A 2C60A 2MRPA 2L3ZA 3T9LA 3A1QA 4NJ6A 5J2RA 3ML8A 3U7DA 2GBKA 4KZ0A 2NBWB 4AOFA 2ZJDA 4ZRKA 2CHXA 3EHVA 3B1LX 1I42A 3PPAA 4ICUA 3QX1A 4WAAA 3DVNU 3B08A 3APDA 1RAXA 1X1MA 1WXMA 3WAMA 4K7SA 3D32A 1OEYJ 1WZ0A 2NR2A 1UGMA 3DVGX 4W9EA 3RCZA 3QCAA 2L8JA 3CF6E 3A33B 3ECIA 2AL6A 3ZTCA 4KZCA 1UBIA 2KLGA 2NPTA 1WXVA 4W9GA 3RZFA 5DCNA 2BWES 3OJ3A 2CHWA 4FN2A 3VXWA 4F8CB 4AUQC 5JZEB 1UBQA 4JL9A 2FCSA 1V86A 5LXIB 1KLVA 2W9NA 2PE9A 2IYDB 2M17A 3N32A 4W9IA 4FBJB 1WMHA 2UWQA 2IY0B 2L0TA 3B0AA 1WGRA 2BWFA 3ZIMA 3H6NA 4FJVB 5JH5C 4W9HA 2KD0A 1R4MI 4IWQA 3DDCB 3NHEB 4II2B 1E8YA 2DENB 3QA8A 1NBFC 2PJHA 3TBLD 4MJSB 3ZLZA 4F7ZA 1WJ4A 2WX1A 3TJPA 1MG8A 3ZTDA 4W9KA 2DYOA 3H7PA 2KN5A 3VHTC 3ENEA 2KFJA 2JZZA 2HJ8A 1IPGA 3NOBA 3HM3A 3ZNHB 1V81A 2GMIC 4HDOA 4LDTB 3V6CB 2R2QA 3ZKJC 2J7QB 2JVCA 2M4NA 2ZNVC 2HTHA 3L54A 4G11A 3PVLA 4OVUA 3WANA 1UZXB 3R3MA 2BYFA 4BBNC 2GBMA 4KVGB 2WYQA 2FCMA 4GMVA 4IM2A 1Y8RC 2OOBB 2B3AA 2KLCA 2KQ7A 5DPSA 2DYBA 3HIZA 1Z2MA 2MW5A 2JWZA 3H7SA 1E90A 1P0RA 2KJRA 5CX3A 3PLUA 5HKHA 1P98A 2C9WB 5BO4B 2IBIB 4A20A 4BKTA 4ANUA 2KWCA 2N1VA 3VH4B 4ZDVA 1WM2A 2N9EB 2A4ZA 3V60A 3ZDTA 4BBNF 4MDKE 2MP2B 1KM7A 4E71A 3IVFA 4ZRJA 4DXAB 2XK5B 3NS8A 3WAPA 4CYEA 1WR1A 2JUOA 4FHJA 2MBQA 1WI0A 2BKRB 2KJ6A 2G45B 3KUCB 3TMPB 4JIOU 4F1SA 5J17A 5JHAA 1WZ3A 3U30A 2KVRA 1C3TA 4WQOB 3MTNB 4W9FA 1AARA 4WJPA 4K7WA 3VVWB 1LXDA 2LGDA 4LCDE 1H8CA 1RLFA 3UGBB 4MGZE 2J0KA 2MBEA 2N4FA 1Z5SB 2DZIA 4TKNA 4FJYA 4GOCA 2NCNA 4RM9A 1WYWB 1IP9A 3T8MA 2KWUB 4NPNA 3RYTA 2G3QB 4KDIC 2WWZA 4WWNA 5TR5A 3N30A 3Q3JA 4HVBA 2K6QA 4JQWC 3NZSA 1NI2A 3O65B 1GJZA 2Z59B 2Y5BB 3L17A 2KTFA 2KX3A 4MGKE 3S2AA 3M95A 1SE9A 4I6PA 3IFWB 4MGYE 1WGGA 2K8HA 4IG7B 2BPSA 4GU2A 2AWTA 3IG3A 2RGFA 4RMAA 3UINB 3DVGY 3PGEA 1RRBA 1WX9A 2C7NB 1TBEA 4IC7B 4FADA 1WGDA 2JPHA 1F9JA 2YLMA 4B9KA 5AEKB 2XBBC 5G55A 2KFKA 1WGYA 2O2VA 4HPMB 2KKCA 4IWOA 4FULA 1OEYA 2L00B 2G4DB 4P7IA 2KTRA 3AULA 2HE7A 5D6JB 4AJYB 3PREA 3PRPB 2KNBA 4I6NB 4ANVA 3DPDA 4EEWA 2MA9B 4DDGD 2J0JA 4M8MA 2KANA 1ZW7A 3CSFA 4NNJB 3K9PB 2O6VA 2RD0A 3PT2B 2K39A 2L0FA 4BKSD 3WALA 1SIFA 2V3SA 2ZVOA 3NY5A 4X57B 1GNUA 3EFUA 3ZO5B 2DZJA 1V6EA 2WDTB 3AU5A 2LI5A 2N7DA 2ZCCA 2DZMA 2MWSB 1V49A 1YD8U 1WX7A 2RPQA 4KIKB 2KJHB 4B95A 2MBOA 2FAZA 4FA6A 4CHKA 2C7HA 2Z0DB 3JVZX 3VUXA 4DHJD 5E6OA 1K8RB 4GGQA 3A4RA 1LQBA 4KSLC 2NBVB 3VDZA 5AZFA 4NY0A 2MBBB 1WRDB 1ZGUB 2FUHB 4BKGA 3A4SC 2L76A 2YVCA 2IO2B
chains in the Genus database with same CATH superfamily
4XDCA 4W9JA 1GC7A 3ZRCA 4MSQB 1T0QC 2GBRA 3KQ4A 1JWBD 3CSTA 3PRZA 1YQBA 1V97A 3VQIA 4O1NA 2KACA 1XT9B 3U4EG 3QIJA 3OJ4B 3RUIB 4EKUA 2ONQA 1JWUD 4MSMB 4TQ0A 1TS4A 1L2NA 2LGXA 4HWIB 2IO0B 1FRRA 4DWFA 4FLHA 4HK2A 2QCZA 1JRUA 4EZKA 4KGTA 2LVOA 2LRWA 3BVMA 1WJUA 3EC8A 2A5UA 3AE6B 1YMHE 3QWZB 3MFGA 3SHQA 2IO3B 2PIAA 5L95C 3QHTA 1SGHA 2BKFA 3TCAA 3DBLI 2DLBA 2CR5A 2LUEA 4W9CA 2LXAA 3V6EB 1K51A 4YTPB 3CMMB 1E7VA 3Q3OC 1TZOA 2PE6B 4PS3A 2HJ1A 3AE1B 1DOIA 4L1BA 1HXYD 1GB4A 1E7PB 2XN9C 1UGJA 2RDHA 1BMLC 2WXMA 1YX5B 2KDBA 2NS5A 4YL8A 2LGYA 5C1ZA 2NTSA 3QJZA 3J9CA 3AXCA 2K0PA 2RMMA 3KUZA 3VFKA 3A9JA 3MJWA 2JF5A 4YWGG 4BZAA 2QHOA 3M3JA 5E6NA 3IBEA 1IBXA 1G6JA 2NPTB 4ARCA 4LTUA 1XCTL 4MT5A 3ZXRA 4G3XB 1OGWA 4BFRA 5CHWA 2DWQA 3IT4B 1L6UA 2KOXA 2AQ2B 2CKHB 2M0XA 4OVVA 2BYVE 1PYWD 4MELA 1IGDA 2SAKA 3KH0A 2M8SA 5BMGA 3RZWC 2RR9A 2D11A 4KSKC 2BBCA 3RNGC 1VD2A 1F0ZA 1E7UA 3ZUNA 3SDLC 3NZUA 2BW2A 1WXSA 3FC4A 4IWPA 4NQKE 4P6VF 2JT4B 1WGHA 2ASQA 1OTRB 4JWUC 3RNAC 3RN9C 3P2BA 1LGRA 2WXQA 3VAWA 4JGHB 2K6DB 5D94A 2FCNA 3NG0A 2H88B 2D3CA 1TIFA 3UIPB 4MEMA 4PS7A 3HUIA 2Z0EB 1PGAA 4XZ4A 4II3B 4DHZE 2UU7A 4PYZA 4DK5A 1FEHA 5GMVA 4MACA 1HZ6A 1F77A 1WRIA 4J3OD 3B9JA 3Q3FA 2GOWA 2J0MA 2LGSA 1J7BA 4OZBA 4G0NB 2KWVB 4URKA 1WXQA 2V4LA 4K81A 4YT0B 5TSSA 3AB5A 2N1WA 1ZDXA 2AEHA 4BKSA 1TS5A 3DBSA 4EZLA 3OAWA 4YSYB 4GDKA 3VR9B 2LZ6A 2LJ5A 2WDQB 3ZRFA 4C56C 1UNSA 3LB8C 2FE8A 2KTRB 3RT3B 1N60A 1CK1A 2D3GA 2K8CA 2IGGA 3I3TB 2IGDA 1HTQA 2N7JA 2KK8A 3JSVA 1F2RI 1WSPA 2LFIA 2UYZB 3ONSA 3Q3MC 5DPWA 2LRUA 2KDEB 2VH2A 4QAYA 5KHQA 3HVDA 2RSUA 5AUIA 3VTWA 3ZVVA 3WIMA 1HE8A 2C60A 2L3ZA 1C4PA 5J2RA 3ML8A 2NBWB 1T0SC 1QOBA 4A8XC 5JXVA 2M0AA 3AE5B 1UGMA 1ZXHA 3DVGX 2DBYA 2MEKA 3ZXVA 3ECIA 4KZCA 2KLGA 1WXVA 4W9GA 4REZA 3RZFA 3OJ3A 4H2AA 1D5ZC 1KH0A 4JL9A 3N32A 2IYDB 1I4PA 2L0TA 2BWFA 3H6NA 2JWUA 2WU5B 4A55A 3DDCB 1E8YA 2KT7A 2PLPA 1BXTA 4W9KA 3VHTC 1JWMD 2KFJA 2JZZA 2HJ8A 1IPGA 3NOBA 1EU3A 1V81A 1TT5B 4G11A 3L54A 3PVLA 4OVUA 4BBNC 1VZ6A 4KVGB 2OOBB 2B3AA 3Q2AC 2KQ7A 3OWEB 1Z2MA 2JWZA 2KJRA 3PLUA 3P4QB 1ZE3D 2IBIB 2WHIA 3AH7A 2NTTA 4L23A 1FM0D 4DXAB 4CYEA 3Q3NC 3KUCB 1TY0A 4WQOB 3MTNB 4W9FA 1SE2A 1IBXB 4K7WA 1AWDA 2IPKD 1Z5SB 2DZIA 4GOCA 4RM9A 3T8MA 1FO4A 4WWNA 4HVBA 3O65B 2Z59B 3AV8A 3AE2B 2KX3A 1SE9A 3N9YC 2IGHA 2K3UA 2K8HA 1NYRA 4GU2A 3UINB 3LXFA 3PGEA 1OFFA 5AEKB 5G55A 1FNUA 2PMVA 1B1ZA 2EKIA 4AJYB 3PRPB 1I4RA 4I6NB 3IAM1 4EEWA 2J53A 2MA9B 4M8MA 3O13A 1ZW7A 4ZRPA 3Q8EA 3PT2B 2K39A 4WIPA 4BKSD 3LYYA 2V3SA 3EFUA 3GP7A 1V6EA 3AU5A 3EGRA 1HA5A 1EM7A 2LI5A 2N7DA 2DZMA 2BB6A 1V49A 1MG4A 4B95A 2MBOA 4FA6A 2C7HA 2Z0DB 5HFYA 3VUXA 1C9FA 3A4RA 3BK2A 1VR9A 3RNFC 3ZJVA 5AZFA 1WRDB 5BYQA 2YVCA 2IO2B 2AX5A 4US8A 2ON8A 3V05A 3MC0B 2DAFA 1XLQA 4EZJA 3PZDA 4DBGA 2PW9A 2KC2A 1QT9A 2JXTA 2WXLA 4TSSA 1KTKA 2R61A 4XYCA 2JRIB 1AYFA 2L83A 2WU2B 1SBBB 5LXHA 4GDKB 2PPHA 1MFWA 3SD5A 3N1XC 3ZJTA 1YQ4B 2K8BA 4WWOA 3QQ8B 4EOYA 2N9XA 1F1HA 3M62B 4J6IA 4NZLB 4HCPB 4GSWA 1D5XC 1YJJA 4C4VA 3JSVB 3ZQ4A 3M63B 2MSED 3DOWA 2KC1A 2YEPB 4P1BC 2MBHA 1TTNA 4EUTA 2WXOA 1VCBA 2BQQA 2DHZA 3TL5A 2JU6X 2E6XA 3W1SC 5BMHA 2IO1B 2CU3A 4RM8A 4WAFA 1SJED 2XK5A 2NBUA 4HJKA 2OJWA 2GRIA 2BYTA 1Q0WB 1NDDA 3UI3A 1DOXA 2KX0A 1FFVA 3FAHA 2EMSA 1ZKHA 2CHZA 2L7RA 4DQOC 3UQBA 1YJIA 1CQVA 3CIRB 4RH6A 3AE7B 1A5RA 3PLVA 4NJ7A 2J4XA 1NEKB 1P1AA 1EF5A 4ZRIA 2EELA 4LDTD 2CS4A 2Y5PA 3P4SB 2BTEA 2G9HD 1CMXB 2V1YA 4GB9A 1LFDA 1I4GA 1V5TA 3SU8X 4XC2A 1YN5A 4HKZE 3U8ZA 1KF6B 3MJ5A 4N9F4 2FUG1 2I1JA 5IAAC 3U52E 1PFDA 1L6VA 3AE3B 3T3NA 1GPXA 2D5GA 3HM6X 2MJEA 5C3JB 3V62A 1H4RA 3MHZA 3QC8B 3PSEB 3V3XA 2JRHA 1V9JA 2WXHA 1WE6A 5CHFA 4L2YA 2OJRA 2DNFA 3AI5A 4P16A 4ICVA 1SE4A 3VTVA 2Q5WD 2KDIA 3A9KA 3AEFB 2SEBD 3L13A 3DQVA 1JW9D 4ANWA 2ZZPB 1L5PA 3Q69A 1XF5L 5BMIA 3DCGA 1EUVB 4DHJB 4XE0A 5E6PA 2IJ0A 2JYTA 3C8YA 3TEWA 2JQRB 3AECB 3PHWB 3DBRI 4HLEA 3WAOA 5CTRC 5D7GA 3I5JC 4A6QA 1F52A 2LXCA 2PEAA 2C5LC 2QC8A 5H8YE 2MX2A 1PQSA 3AEDB 2E3TA 2KO3A 1E6EB 2RDBC 4JX1C 2ZNVB 1JQ4A 3NUHB 4ASWC 2D07B 3VUYA 1AW7A 4LNNA 3R2TA 3ML9A 4AP4C 4NQLB 2LASA 2I1KA 3NS1A 3W2DA 4FHKA 1P9DU 4DHZB 2GB1A 1K52A 2MQJA 3RNEC 4MH0E 1ISNA 5DPRA 5G5GA 3PRMB 4MGIE 3BVGA 4IW0A 2V3PA 1KLUD 2MRPA 3A1QA 3TEZA 4NJ6A 3U7DA 4K3CA 2CHXA 1YN3A 3NVVA 2QSDA 2WXPA 3EHVA 2JX5A 1L4DB 1I42A 3QX1A 4WAAA 1T6BX 2K22A 1X1MA 1WXMA 3WAMA 2LHEA 1ET6A 2LUMA 1WZ0A 4W9EA 4LNOA 3ZTCA 1JALA 3GB1A 1N61A 3PZ7A 4WH4A 4F8CB 2CHWA 2AQ1B 3DBLB 5JZEB 1QF6A 1XEEA 1V86A 2CJOA 2W9NA 2PE9A 4FBJB 1WMHA 1VRAB 1P7EA 4W9HA 2KD0A 1R4MI 4II2B 1NBFC 1JMLA 3TBLD 1WJ4A 4OZAA 4B0MA 2DYOA 3H7PA 4WURA 3ZNHB 4R3DA 2GMIC 3V6CB 2R2QA 2JVCA 2M4NA 3TUOA 4C4VB 4XDDA 3KWVA 3WANA 3R3MA 2BYFA 1DGJA 5HI1A 2GBMA 3P4PB 2WYQA 2FCMA 4GMVA 4IM2A 3ETRA 1E90A 5HKHA 1MHHE 5BO4B 4A20A 1WM2A 4JWSC 2N9EB 3DHIC 4ZHPA 1YN4A 4BBNF 5C2TB 4E71A 2XK5B 3NS8A 3WAPA 1CZPA 1WI0A 2KJ6A 4F1SA 1FRDA 1WZ3A 1J7CA 1YQ3B 1V8CA 2KVRA 5EE9A 1AARA 1ESFA 1LXDA 3VR8B 1NI3A 1H8CA 2N4FA 1E10A 2NCNA 1XCQL 3T3OA 2KWUB 2G3QB 3IT6B 2K6QA 4JQWC 1D5MC 1VZ8A 1NI2A 1GJZA 3S2AA 4ZHOA 3M95A 4ITKA 3IFWB 4WWMA 4MGYE 4LNIA 1TKYA 4IG7B 1PGXA 3IG3A 2RGFA 4ZOHC 1WX9A 4FADA 1F9JA 1SB3C 1C4CA 3W5VB 2KAJA 2KFKA 3Q8CA 2O2VA 4HPMB 2L00B 2G4DB 4P7IA 2HE7A 3N1ZC 3PREA 2KNBA 1VLBA 2KANA 3CSFA 3NRZA 4NNJB 3K9PB 3ABVB 1GAQB 2L0FA 3C19A 4WQMA 2WDTB 3PZ8A 4RF1A 5FR3A 1YD8U 1WX7A 1ZPSA 3H8HA 3W5UB 2K5PA 2WLBA 3JVZX 2QMTA 5E6OA 4GGQA 1RFKA 3SEBA 2WXNA 2PKOA 1XO3A 4XWTA 1TKGA 3C0RB 1GC6A 3HHMA 2IZVB 4LJOB 2INDC 5G5HA 1JRPA 2W3SA 3P4RB 2MHJA 3QK0A 3BWUD 2X38A 1BT0A 4ZYNA 5HG2A 3L08A 5LNK1 2AQ3B 3AE9B 4ACFA 2HD5B 2K25A 2Y3AA 3GE3C 1FPYA 2V3NA 1I4QA 1V80A 4MJSA 2O6VD 1SXTA 4HEA1 2N7EA 3V61A 2LGIA 1WE7A 3PTFC 4W9LA 1RYJA 1UF0A 3A9JB 1SIJA 2REXA 2D3AA 4TQ1A 2GI9A 2V4IB 1C1YB 3UQAA 2KMMA 1KFYB 3RD2A 2VRRB 2FIDA 1P3QU 2VZKD 5LLIA 1WX8A 1YX6B 4A90A 4HPPA 1ZXIA 3WA0A 1EO6A 1ZUD2 2QILA 3I57A 4IKGA 5GXGB 1OQQA 1R4NI 3R7QA 3A1QB 4DDID 1KRHA 4HXDA 5MPOA 2MP2A 5FK9C 4LLGM 4GN1A 4IM0A 5C23A 5EE0A 4A3OA 2MLBA 2RDGA 3MP9A 3X0WA 5D3DA 1C4AA 1T0YA 2KQ4X 4AWJA 1ROEA 1WM3A 1C77A 3LJ3A 5EDSA 4IUMB 1I4HA 4BOZB 3URYA 3N20C 2DZKA 1XQQA 1IUEA 3JW0X 1Q1OA 1WMHB 4PK1A 5IO9A 1E8ZA 3U7ZA 2D10A 2ICIA 4HCNB 3KYCD 2JXXA 4WJQA 2K1FA 1E8XA 1K53A 3H7PB 3QARA 1UD7A 3X23A 3TSSA 2ZPYA 2GBJA 2LD9A 2DYMA 1SE3A 4BOSC 1D6EC 5IN7A 3RNCC 1VJKA 5KHOA 1FCLA 1FD6A 3ALBA 4LK0M 3RI7C 4WWPA 2FCQA 4UDUC 4S17A 3PHXB 1QILA 3UF8A 1WF9A 4MM3A 3ZNZB 4C7ZA 1UH6A 4CO7A 4WJOA 4YSXB 1PUTA 3DBHI 3QAQA 2LHDA 3TEXA 2KXJA 1V5OA 1YIWA 4M8NA 3GZNI 4KV2A 1FXAA 4AQ7A 1GG3A 1E8WA 1TY2A 3JYUA 4TV3A 5EE3A 3E9SA 1RM6C 3KUDB 1XD3B 1N5WA 2MCNB 4IM3A 4FJZA 4RF0A 1T0RC 3ZDMC 1T3QA 2R2OA 1KLGD 1D3ZA 1OQYA 2PVGC 4GXBA 2ZCBA 4TMAB 4ZYSA 1MHXA 2BVCA 2LWPA 3APCA 5AZGA 2XNAC 1V2YA 4NAWA 3WCQA 5G2NA 3L0WB 4LNFA 1WY8A 3AU4A 4PYUA 2BS4B 2KFKB 3FKYA 4M01A 1WJNA 2O2VB 4LJPB 4C80A 3GS2A 3R8BA 2CJNA 3EECA 4E3CA 4GDLA 3KVFB 3DHGC 1WGKA 2LMCA 3I9V1 4DXGA 2ZVNA 1ET9A 2MJ3A 4RGMA 1R7SA 4KZ0A 2INPE 2BB5A 1NYQA 1IGCA 1TS2A 3PPAA 4FXCA 3DVNU 2QJLA 4K7SA 1J7AA 1AN8A 2L1AA 3AE8B 5EE1A 1QOFA 2NR2A 3QCAA 2L8JA 3A33B 1E0ZA 1N63A 4NAMA 5DCNA 4FN2A 4M00A 2D3BA 5LXIB 3NZ3A 4M0WA 2M17A 2QEJC 2UWQA 3ZIMA 1WGRA 5T8IA 3KLSX 1N6ZA 3NHEB 4F7ZA 4MJSB 3TEYA 4CQNA 3FILA 2WX1A 2HDEA 3TJPA 2TSSA 2KN5A 4YTNB 1SEBD 1GOZA 3HM3A 4HDOA 4LDTB 1ZOYB 2J7QB 2ZNVC 2HTHA 1UZXB 4K3BA 2W3RA 3BIID 5DPSA 2DYBA 3H7SA 1ACCA 4KGRA 5CX3A 1P98A 2C9WB 2FBWB 2GLSA 5IP4D 2N1VA 1MI0A 1C79A 2A4ZA 3V60A 2MP2B 1KM7A 3IVFA 1WR1A 2BKRB 2G45B 3TMPB 2V9HA 4DXFA 3U30A 1Y56A 1V1OA 2VH1A 4WJPA 3VVWB 1RLFA 2J0KA 2MBEA 3AEGB 4D2KA 3GE8C 4FJYA 1WYWB 4KDIC 2WWZA 5TR5A 1HEZE 3N30A 5AUKA 5IKCM 3NZSA 1ZDVA 3U2SC 1EWCA 2Z8LA 2KYWA 4C7YA 2BPSA 4RMAA 4IC7B 1TBEA 2JPHA 2YLMA 4B9KA 2XBBC 1WGYA 5HHDG 2KKCA 4IWOA 1OEYA 5D3IB 5D6JB 4ANVA 2KWDA 3PO0A 4DDGD 2H89B 2O6VA 2NMQA 2RD0A 1SIFA 4MM3B 1FNVA 2DZJA 3DBRB 2ZCCA 2MWSB 4XGAB 2KJHB 2QIEB 1K50A 4CHKA 2PVOD 1K8RB 1LQBA 2NBVB 2L32A 4NY0A 2FUHB 1HTOA 2N9LA 3E56A 4I6LB 3P63A 3ZNGC 2JZ3B 4ANXA 1KOTA 3GOEA 1WR6E 2WXRA 1YJ1A 1EF1A 2CU1A 3APFA 2W54A 3PS6A 1I7HA 5IOIA 1N62A 4HDQA 4P1CC 1U4AA 4YXDB 1WJ6A 3NVWA 1TZ1A 3VRAB 2M19A 1YNTE 3IHPC 3TIXA 4NJCA 3BY4B 3H9DA 4NAWB 2C7MB 4USAA 4E74A 1Q5WB 2M56B 3VTUA 3Q6BA 1I35A 2KMCA 1WXAA 2KQSA 1TKEA 2MJDA 4PS8A 1RFAA 3MC8A 4HJGE 3R2IA 2W55A 1HQRD 3BYTB 1C76A 3K9OB 3KWLA 3ZYYX 5FR6A 2Y5CA 1J0GA 1EU4A 4K1RB 1PGBA 3ZW3A 3CWIA 2KN4A 4GDLB 4BVUC 1DOYA 3DVNV 2BS3B 5JHBA 2ZEQA 3OLMD 2GBNA 2I2YA 3R7RA 2OHFA 5CHVC 3ZGZA 1XLPA 4KDLB 2WDRB 2WDVB 3L16A 1TGZB 1QQRA 3UIOB 2G1EA 2L52A 1TYGB 2XEWA 5AZHA 2EKEC 4C00A 2WS3B 3W1YA 1R4MB 2KDFB 3IXSA 4JLCA 1DYQA 4KX6B 3I63C 1QKZA 1P7FA 3W9CB 1FCCC 2BF8B 2J52A 3OG5A 1J8CA 4MH8A 3HK0A 4HROA 3VH3B 4AJWA 2AL3A 4M0WB 1L0VB 3ZJUA 4B6WA 1J19A 3LDZE 4HPLB 2JYEA 1M94A 3AM9A 3H1UA 4XX5A 1WYGA 3R66C 1S3SG 5DPTA 1C78A 3Q8AA 1WH3A 2INNE 1LM8B 3FILB 1UWXA 3BINA 1S1QB 1L7YA 1F2RC 1FXTB 3A9KB 2WQYB 2FNJB 1M4VA 4BAXA 1NENB 2M1MA 1I4XA 3W1SA 4N58A 1KJTA 2JY6A 4HKQA 1OQRA 5I4DA 1A70A 4WJNA 4XWWA 1XLOA 4M02A 3Q8BA 4YSZB 3BYYB 4N6EB 1GUAB 2EMTA 4K7UA 1IYFA 1UELA 1FIQA 4KIKA 1WFYA 3NVYA 2KZRA 2WX0A 2N9PC 3RULA 1E5WA 4RNAA 2AYOB 2G4SA 2IY1B 1V1PA 3ZNID 4KKJA 5D2MB 1L0YB 2KHWB 3L10B 2FIFA 5H92C 4ZRQA 1JCKB 1QZEA 4S0RA 1WIAA 3PV1A 2N9KA 4EFOA 2YEPF 2BYEA 5FKAC 4HRSA 2LVPA 1RWSA 3MHSD 2LVQA 2WNMA 4TUUA 2D2QA 2DAJA 2WXGA 4PT5A 1BUIC 1HZ5A 3N3KB 4GIVA 2K9XA 1ENFA 3KW5B 2WXFA 3EA6A 2DX5B 5IA7A 3VUWA 3AN1A 3DWGC 2IDYA 3DWMA 4B0EA 2L05A 3HRDD 3N1YC 2ZPNA 5J18A 2BGFA 4AS1A 1Q10A 2OEDA 2NVUI 4W9DA 3KYDD 2KDMA 2O6VB 2KMAA 4G50A 2KVZA 5L83A 2ZW1A 2ACZB 4A3PA 2N0SB 1UUPA 2V0GA 3AE4B 4IOIE 3P1MA 3T9LA 3RFZB 2GBKA 4AOFA 2ZJDA 4ZRKA 2J42A 1EWYC 1VZ7A 3BVZA 2I38A 3B1LX 2VZKB 2WXIA 4ICUA 1QOGA 3B08A 3APDA 1RAXA 1T5XD 2HTME 3D32A 1OEYJ 1MPEA 1TS3A 4LNKA 3RCZA 3CF6E 2AL6A 1CJEA 4RCOA 4OZCA 1UBIA 2NPTA 3EFCA 4EE2A 3B2FA 2BS2B 2B76B 2BWES 3VXWA 4OHJA 4AUQC 1SSNA 1UBQA 2FCSA 1KLVA 4W9IA 3HVZA 4US9A 3BK1A 2IY0B 2WGSA 3B0AA 2BT6A 4FJVB 5JH5C 1L4ZB 1UWMA 4IWQA 3AEBB 3L4PA 4Q2JA 4OVZA 1R4NB 3QA8A 2DENB 5E6JA 3ZLZA 2PJHA 1PDXA 1MG8A 3ZTDA 3NVZA 3ENEA 3ZKJC 4YTMB 3Q14C 3NJTA 3SR6A 4RGOS 4JE3B 1FNWA 1FXIA 4KKIA 1WWTA 1Y8RC 2KLCA 1ZP0B 3VRBB 3RPFC 4JPSA 3B2GA 1STEA 3HIZA 2MW5A 1P0RA 4BKTA 4ANUA 2KWCA 3VH4B 4ZDVA 1JWSD 4OW0A 3ZDTA 4MDKE 4RGTA 2LJIA 4ZRJA 3BZDB 2JUOA 1QOAA 4FHJA 2MBQA 3RMKC 3AEAB 4JIOU 5J17A 4N59A 5JHAA 3SFDB 1C3TA 1SJHD 2ZW0A 1L0XB 1JROA 1XXGA 2INCC 1XLNA 2LGDA 4LCDE 3UGBB 4MGZE 1MJDA 2RPVA 3AEEB 2WXJA 4TKNA 1IP9A 4NPNA 3RYTA 1SF0A 3Q3JA 1NVID 2JSVX 3EUB2 2Y5BB 3L17A 2KTFA 4MGKE 1N5XA 1TJEA 1YOVB 2JZPA 4I6PA 2PTLA 1WGGA 3AMZA 4A9AA 2AWTA 3DVGY 3SFEB 1RRBA 1QLBB 2C7NB 1B9RA 1WGDA 3DBHB 3DHHC 2MH7A 1E9MA 2WXKA 3GZNB 4FULA 3Q8FA 1MVKA 3RNBC 2KTRA 3AULA 3IAS1 5BYSA 3DPDA 2J0JA 2X8XX 2W82A 5BYRA 4ARIA 1FMAD 1GB1A 3WALA 4X57B 2ZVOA 3NY5A 1GNUA 3ZO5B 2QDFA 3MC9A 4IDIA 1LO5D 4RFBA 3P42A 2LEKA 2RPQA 4KIKB 4RGNA 1D4BA 1JWAD 2WP9B 2FAZA 4DHJD 4KSLC 1VDVA 3VDZA 4GLSC 2MBBB 1ZGUB 4BKGA 3A4SC 2L76A 4KGSA 1FFUA 1V1PB
chains in the Genus database with same CATH topology
4W9JA 1GC7A 3ZRCA 4I6LB 3ZNGC 2JZ3B 4MSQB 4ANXA 2GBRA 1KOTA 3GOEA 3C0RB 1GC6A 3HHMA 2DAFA 2IZVB 3CSTA 3PRZA 4LJOB 1WR6E 4EZJA 3PZDA 4DBGA 1YJ1A 1EF1A 2CU1A 3APFA 3PS6A 1YQBA 3QK0A 4HDQA 2KC2A 1BT0A 3VQIA 1U4AA 1XT9B 4ZYNA 1WJ6A 1TZ1A 3QIJA 3OJ4B 3RUIB 4EKUA 3L08A 4MSMB 3IHPC 3TIXA 4TQ0A 3BY4B 3H9DA 2HD5B 2JRIB 2LGXA 4HWIB 2C7MB 4NAWB 2IO0B 1L2NA 2K25A 4E74A 1Q5WB 4DWFA 4FLHA 3VTUA 4HK2A 1I35A 2KMCA 1JRUA 1WXAA 2KQSA 4EZKA 5LXHA 4PS8A 1V80A 1RFAA 2LVOA 2LRWA 4MJSA 2O6VD 4GDKB 1WJUA 2PPHA 3EC8A 2N7EA 3SD5A 3V61A 2A5UA 3K9OB 3QWZB 1WE7A 2K8BA 3SHQA 2IO3B 4WWOA 5FR6A 3QQ8B 3PTFC 4W9LA 2N9XA 4EOYA 5L95C 1J0GA 3QHTA 4K1RB 1SGHA 2BKFA 3M62B 4J6IA 3TCAA 3A9JB 4GSWA 4HCPB 3ZW3A 2REXA 3DBLI 4GDLB 4TQ1A 2CR5A 4BVUC 2LUEA 3JSVB 4W9CA 2LXAA 1C1YB 3V6EB 3UQAA 3M63B 2MSED 3DOWA 3CMMB 1E7VA 2KC1A 3DVNV 5JHBA 2PE6B 2ZEQA 3OLMD 4PS3A 2GBNA 2VRRB 2FIDA 3RD2A 1P3QU 5LLIA 2MBHA 1WX8A 3R7RA 1YX6B 1TTNA 4EUTA 1VCBA 2DHZA 5CHVC 3TL5A 3WA0A 1EO6A 3W1SC 1R4NI 3R7QA 4DDID 3A1QB 4KDLB 2IO1B 4HXDA 3L16A 1TGZB 1YX5B 2KDBA 2NS5A 4RM8A 3UIOB 4YL8A 2LGYA 2MP2A 2XK5A 2XEWA 5AZHA 2EKEC 2NBUA 4GN1A 4HJKA 4IM0A 5C1ZA 3QJZA 3AXCA 5C23A 4A3OA 3W1YA 2MLBA 3KUZA 2KDFB 3X0WA 4JLCA 1Q0WB 1NDDA 2KX0A 3VFKA 1T0YA 3A9JA 3MJWA 4AWJA 2JF5A 2QHOA 1WM3A 2EMSA 3M3JA 5E6NA 2BF8B 3IBEA 1ZKHA 3LJ3A 5EDSA 2CHZA 2L7RA 4IUMB 3UQBA 1J8CA 1G6JA 2NPTB 4G3XB 3HK0A 1OGWA 4BFRA 5CHWA 4BOZB 1A5RA 3VH3B 4AJWA 2DZKA 2AL3A 1XQQA 4M0WB 3JW0X 3PLVA 4NJ7A 1Q1OA 1WMHB 4B6WA 1J19A 3LDZE 2KOXA 1P1AA 1EF5A 2CKHB 4HPLB 4ZRIA 1E8ZA 4LDTD 2CS4A 1M94A 3H1UA 4XX5A 3R66C 2D10A 1S3SG 1CMXB 5DPTA 4HCNB 2M0XA 4OVVA 2V1YA 4GB9A 2BYVE 1WH3A 1LFDA 1LM8B 2JXXA 3KYCD 1V5TA 4MELA 4WJQA 3SU8X 3BINA 1S1QB 1L7YA 2K1FA 1E8XA 1FXTB 3KH0A 3H7PB 4XC2A 3A9KB 2M8SA 3QARA 2FNJB 1UD7A 2RR9A 2D11A 3RZWC 3X23A 2ZPYA 3U8ZA 2GBJA 2M1MA 2LD9A 4KSKC 4N9F4 3W1SA 2DYMA 5IAAC 2I1JA 1VD2A 4BOSC 1E7UA 1KJTA 3ZUNA 2JY6A 5KHOA 3ALBA 3SDLC 3NZUA 4WJNA 3HM6X 4WWPA 1WXSA 2FCQA 4IWPA 4NQKE 3V62A 1H4RA 3PHXB 1GUAB 3QC8B 3PSEB 2EMTA 4K7UA 3UF8A 2JRHA 1IYFA 1V9JA 1WF9A 1WGHA 2JT4B 4MM3A 2ASQA 1OTRB 3ZNZB 1UELA 1UH6A 1WE6A 3P2BA 4CO7A 4WJOA 5CHFA 3VAWA 4KIKA 1WFYA 2OJRA 3DBHI 3AI5A 3QAQA 4JGHB 2K6DB 2KZRA 2WX0A 2FCNA 2N9PC 5D94A 4ICVA 2KXJA 1V5OA 3RULA 1YIWA 3VTVA 4M8NA 3GZNI 1E5WA 4KV2A 2AYOB 2KDIA 3A9KA 3UIPB 3L13A 2G4SA 1GG3A 1E8WA 4MEMA 3DQVA 2IY1B 4PS7A 4ANWA 3ZNID 2Z0EB 3JYUA 4TV3A 5D2MB 2ZZPB 4XZ4A 2KHWB 4II3B 3L10B 4DHZE 2FIFA 3KUDB 1XD3B 2MCNB 3DCGA 4IM3A 1EUVB 1QZEA 4FJZA 4PYZA 4DK5A 4DHJB 1WIAA 3PV1A 5E6PA 5GMVA 3ZDMC 2R2OA 4EFOA 2BYEA 3PHWB 1D3ZA 3DBRI 4HLEA 3WAOA 5CTRC 1OQYA 2LVPA 3Q3FA 3MHSD 2GOWA 2LVQA 2J0MA 4GXBA 2ZCBA 5D7GA 4TUUA 2D2QA 2DAJA 2LXCA 2PEAA 2C5LC 4G0NB 2LWPA 3N3KB 4GIVA 2KWVB 3APCA 2MX2A 5AZGA 4URKA 1PQSA 2V4LA 4K81A 3KW5B 2KO3A 1V2YA 2N1WA 4NAWA 2DX5B 5IA7A 2AEHA 4BKSA 2ZNVB 5G2NA 3L0WB 4ASWC 1WY8A 3VUWA 3DBSA 3AU4A 2D07B 3VUYA 4PYUA 3OAWA 4EZLA 4GDKA 2KFKB 4AP4C 2LZ6A 3ML9A 2LJ5A 1WJNA 2O2VB 4LJPB 4NQLB 2LASA 3ZRFA 2L05A 2I1KA 2KTRB 3RT3B 2D3GA 4FHKA 2K8CA 2ZPNA 1P9DU 2BGFA 5J18A 3I3TB 4DHZB 3EECA 2KK8A 4E3CA 2MQJA 4GDLA 2NVUI 4MH0E 4W9DA 3JSVA 3KVFB 3ONSA 2UYZB 3KYDD 2O6VB 2KMAA 1ISNA 4G50A 5DPWA 2LRUA 2KDEB 5DPRA 5L83A 5KHQA 2ZVNA 4A3PA 2RSUA 3VTWA 3PRMB 4MGIE 3ZVVA 3WIMA 4IW0A 1HE8A 2C60A 2MRPA 2L3ZA 3T9LA 3A1QA 4NJ6A 5J2RA 3ML8A 3U7DA 2GBKA 4KZ0A 2NBWB 4AOFA 2ZJDA 4ZRKA 2CHXA 3EHVA 3B1LX 1I42A 3PPAA 4ICUA 3QX1A 4WAAA 3DVNU 3B08A 3APDA 1RAXA 1X1MA 1WXMA 3WAMA 4K7SA 3D32A 1OEYJ 1WZ0A 2NR2A 1UGMA 3DVGX 4W9EA 3RCZA 3QCAA 2L8JA 3CF6E 3A33B 3ECIA 2AL6A 3ZTCA 4KZCA 1UBIA 2KLGA 2NPTA 1WXVA 4W9GA 3RZFA 5DCNA 2BWES 3OJ3A 2CHWA 4FN2A 3VXWA 4F8CB 4AUQC 5JZEB 1UBQA 4JL9A 2FCSA 1V86A 5LXIB 1KLVA 2W9NA 2PE9A 2IYDB 2M17A 3N32A 4W9IA 4FBJB 1WMHA 2UWQA 2IY0B 2L0TA 3B0AA 1WGRA 2BWFA 3ZIMA 3H6NA 4FJVB 5JH5C 4W9HA 2KD0A 1R4MI 4IWQA 3DDCB 3NHEB 4II2B 1E8YA 2DENB 3QA8A 1NBFC 2PJHA 3TBLD 4MJSB 3ZLZA 4F7ZA 1WJ4A 2WX1A 3TJPA 1MG8A 3ZTDA 4W9KA 2DYOA 3H7PA 2KN5A 3VHTC 3ENEA 2KFJA 2JZZA 2HJ8A 1IPGA 3NOBA 3HM3A 3ZNHB 1V81A 2GMIC 4HDOA 4LDTB 3V6CB 2R2QA 3ZKJC 2J7QB 2JVCA 2M4NA 2ZNVC 2HTHA 3L54A 4G11A 3PVLA 4OVUA 3WANA 1UZXB 3R3MA 2BYFA 4BBNC 2GBMA 4KVGB 2WYQA 2FCMA 4GMVA 4IM2A 1Y8RC 2OOBB 2B3AA 2KLCA 2KQ7A 5DPSA 2DYBA 3HIZA 1Z2MA 2MW5A 2JWZA 3H7SA 1E90A 1P0RA 2KJRA 5CX3A 3PLUA 5HKHA 1P98A 2C9WB 5BO4B 2IBIB 4A20A 4BKTA 4ANUA 2KWCA 2N1VA 3VH4B 4ZDVA 1WM2A 2N9EB 2A4ZA 3V60A 3ZDTA 4BBNF 4MDKE 2MP2B 1KM7A 4E71A 3IVFA 4ZRJA 4DXAB 2XK5B 3NS8A 3WAPA 4CYEA 1WR1A 2JUOA 4FHJA 2MBQA 1WI0A 2BKRB 2KJ6A 2G45B 3KUCB 3TMPB 4JIOU 4F1SA 5J17A 5JHAA 1WZ3A 3U30A 2KVRA 1C3TA 4WQOB 3MTNB 4W9FA 1AARA 4WJPA 4K7WA 3VVWB 1LXDA 2LGDA 4LCDE 1H8CA 1RLFA 3UGBB 4MGZE 2J0KA 2MBEA 2N4FA 1Z5SB 2DZIA 4TKNA 4FJYA 4GOCA 2NCNA 4RM9A 1WYWB 1IP9A 3T8MA 2KWUB 4NPNA 3RYTA 2G3QB 4KDIC 2WWZA 4WWNA 5TR5A 3N30A 3Q3JA 4HVBA 2K6QA 4JQWC 3NZSA 1NI2A 3O65B 1GJZA 2Z59B 2Y5BB 3L17A 2KTFA 2KX3A 4MGKE 3S2AA 3M95A 1SE9A 4I6PA 3IFWB 4MGYE 1WGGA 2K8HA 4IG7B 2BPSA 4GU2A 2AWTA 3IG3A 2RGFA 4RMAA 3UINB 3DVGY 3PGEA 1RRBA 1WX9A 2C7NB 1TBEA 4IC7B 4FADA 1WGDA 2JPHA 1F9JA 2YLMA 4B9KA 5AEKB 2XBBC 5G55A 2KFKA 1WGYA 2O2VA 4HPMB 2KKCA 4IWOA 4FULA 1OEYA 2L00B 2G4DB 4P7IA 2KTRA 3AULA 2HE7A 5D6JB 4AJYB 3PREA 3PRPB 2KNBA 4I6NB 4ANVA 3DPDA 4EEWA 2MA9B 4DDGD 2J0JA 4M8MA 2KANA 1ZW7A 3CSFA 4NNJB 3K9PB 2O6VA 2RD0A 3PT2B 2K39A 2L0FA 4BKSD 3WALA 1SIFA 2V3SA 2ZVOA 3NY5A 4X57B 1GNUA 3EFUA 3ZO5B 2DZJA 1V6EA 2WDTB 3AU5A 2LI5A 2N7DA 2ZCCA 2DZMA 2MWSB 1V49A 1YD8U 1WX7A 2RPQA 4KIKB 2KJHB 4B95A 2MBOA 2FAZA 4FA6A 4CHKA 2C7HA 2Z0DB 3JVZX 3VUXA 4DHJD 5E6OA 1K8RB 4GGQA 3A4RA 1LQBA 4KSLC 2NBVB 3VDZA 5AZFA 4NY0A 2MBBB 1WRDB 1ZGUB 2FUHB 4BKGA 3A4SC 2L76A 2YVCA 2IO2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9J A;  1GC7 A;  3ZRC A;  4I6L B;  3ZNG C;  2JZ3 B;  4MSQ B;  4ANX A;  2GBR A;  1KOT A;  3GOE A;  3C0R B;  1GC6 A;  3HHM A;  2DAF A;  2IZV B;  3CST A;  3PRZ A;  4LJO B;  1WR6 E;  4EZJ A;  3PZD A;  4DBG A;  1YJ1 A;  1EF1 A;  2CU1 A;  3APF A;  3PS6 A;  1YQB A;  3QK0 A;  4HDQ A;  2KC2 A;  1BT0 A;  3VQI A;  1U4A A;  1XT9 B;  4ZYN A;  1WJ6 A;  1TZ1 A;  3QIJ A;  3OJ4 B;  3RUI B;  4EKU A;  3L08 A;  4MSM B;  3IHP C;  3TIX A;  4TQ0 A;  3BY4 B;  3H9D A;  2HD5 B;  2JRI B;  2LGX A;  4HWI B;  2C7M B;  4NAW B;  2IO0 B;  1L2N A;  2K25 A;  4E74 A;  1Q5W B;  4DWF A;  4FLH A;  3VTU A;  4HK2 A;  1I35 A;  2KMC A;  1JRU A;  1WXA A;  2KQS A;  4EZK A;  5LXH A;  4PS8 A;  1V80 A;  1RFA A;  2LVO A;  2LRW A;  4MJS A;  2O6V D;  4GDK B;  1WJU A;  2PPH A;  3EC8 A;  2N7E A;  3SD5 A;  3V61 A;  2A5U A;  3K9O B;  3QWZ B;  1WE7 A;  2K8B A;  3SHQ A;  2IO3 B;  4WWO A;  5FR6 A;  3QQ8 B;  3PTF C;  4W9L A;  2N9X A;  4EOY A;  5L95 C;  1J0G A;  3QHT A;  4K1R B;  1SGH A;  2BKF A;  3M62 B;  4J6I A;  3TCA A;  3A9J B;  4GSW A;  4HCP B;  3ZW3 A;  2REX A;  3DBL I;  4GDL B;  4TQ1 A;  2CR5 A;  4BVU C;  2LUE A;  3JSV B;  4W9C A;  2LXA A;  1C1Y B;  3V6E B;  3UQA A;  3M63 B;  2MSE D;  3DOW A;  3CMM B;  1E7V A;  2KC1 A;  3DVN V;  5JHB A;  2PE6 B;  2ZEQ A;  3OLM D;  4PS3 A;  2GBN A;  2VRR B;  2FID A;  3RD2 A;  1P3Q U;  5LLI A;  2MBH A;  1WX8 A;  3R7R A;  1YX6 B;  1TTN A;  4EUT A;  1VCB A;  2DHZ A;  5CHV C;  3TL5 A;  3WA0 A;  1EO6 A;  3W1S C;  1R4N I;  3R7Q A;  4DDI D;  3A1Q B;  4KDL B;  2IO1 B;  4HXD A;  3L16 A;  1TGZ B;  1YX5 B;  2KDB A;  2NS5 A;  4RM8 A;  3UIO B;  4YL8 A;  2LGY A;  2MP2 A;  2XK5 A;  2XEW A;  5AZH A;  2EKE C;  2NBU A;  4GN1 A;  4HJK A;  4IM0 A;  5C1Z A;  3QJZ A;  3AXC A;  5C23 A;  4A3O A;  3W1Y A;  2MLB A;  3KUZ A;  2KDF B;  3X0W A;  4JLC A;  1Q0W B;  1NDD A;  2KX0 A;  3VFK A;  1T0Y A;  3A9J A;  3MJW A;  4AWJ A;  2JF5 A;  2QHO A;  1WM3 A;  2EMS A;  3M3J A;  5E6N A;  2BF8 B;  3IBE A;  1ZKH A;  3LJ3 A;  5EDS A;  2CHZ A;  2L7R A;  4IUM B;  3UQB A;  1J8C A;  1G6J A;  2NPT B;  4G3X B;  3HK0 A;  1OGW A;  4BFR A;  5CHW A;  4BOZ B;  1A5R A;  3VH3 B;  4AJW A;  2DZK A;  2AL3 A;  1XQQ A;  4M0W B;  3JW0 X;  3PLV A;  4NJ7 A;  1Q1O A;  1WMH B;  4B6W A;  1J19 A;  3LDZ E;  2KOX A;  1P1A A;  1EF5 A;  2CKH B;  4HPL B;  4ZRI A;  1E8Z A;  4LDT D;  2CS4 A;  1M94 A;  3H1U A;  4XX5 A;  3R66 C;  2D10 A;  1S3S G;  1CMX B;  5DPT A;  4HCN B;  2M0X A;  4OVV A;  2V1Y A;  4GB9 A;  2BYV E;  1WH3 A;  1LFD A;  1LM8 B;  2JXX A;  3KYC D;  1V5T A;  4MEL A;  4WJQ A;  3SU8 X;  3BIN A;  1S1Q B;  1L7Y A;  2K1F A;  1E8X A;  1FXT B;  3KH0 A;  3H7P B;  4XC2 A;  3A9K B;  2M8S A;  3QAR A;  2FNJ B;  1UD7 A;  2RR9 A;  2D11 A;  3RZW C;  3X23 A;  2ZPY A;  3U8Z A;  2GBJ A;  2M1M A;  2LD9 A;  4KSK C;  4N9F 4;  3W1S A;  2DYM A;  5IAA C;  2I1J A;  1VD2 A;  4BOS C;  1E7U A;  1KJT A;  3ZUN A;  2JY6 A;  5KHO A;  3ALB A;  3SDL C;  3NZU A;  4WJN A;  3HM6 X;  4WWP A;  1WXS A;  2FCQ A;  4IWP A;  4NQK E;  3V62 A;  1H4R A;  3PHX B;  1GUA B;  3QC8 B;  3PSE B;  2EMT A;  4K7U A;  3UF8 A;  2JRH A;  1IYF A;  1V9J A;  1WF9 A;  1WGH A;  2JT4 B;  4MM3 A;  2ASQ A;  1OTR B;  3ZNZ B;  1UEL A;  1UH6 A;  1WE6 A;  3P2B A;  4CO7 A;  4WJO A;  5CHF A;  3VAW A;  4KIK A;  1WFY A;  2OJR A;  3DBH I;  3AI5 A;  3QAQ A;  4JGH B;  2K6D B;  2KZR A;  2WX0 A;  2FCN A;  2N9P C;  5D94 A;  4ICV A;  2KXJ A;  1V5O A;  3RUL A;  1YIW A;  3VTV A;  4M8N A;  3GZN I;  1E5W A;  4KV2 A;  2AYO B;  2KDI A;  3A9K A;  3UIP B;  3L13 A;  2G4S A;  1GG3 A;  1E8W A;  4MEM A;  3DQV A;  2IY1 B;  4PS7 A;  4ANW A;  3ZNI D;  2Z0E B;  3JYU A;  4TV3 A;  5D2M B;  2ZZP B;  4XZ4 A;  2KHW B;  4II3 B;  3L10 B;  4DHZ E;  2FIF A;  3KUD B;  1XD3 B;  2MCN B;  3DCG A;  4IM3 A;  1EUV B;  1QZE A;  4FJZ A;  4PYZ A;  4DK5 A;  4DHJ B;  1WIA A;  3PV1 A;  5E6P A;  5GMV A;  3ZDM C;  2R2O A;  4EFO A;  2BYE A;  3PHW B;  1D3Z A;  3DBR I;  4HLE A;  3WAO A;  5CTR C;  1OQY A;  2LVP A;  3Q3F A;  3MHS D;  2GOW A;  2LVQ A;  2J0M A;  4GXB A;  2ZCB A;  5D7G A;  4TUU A;  2D2Q A;  2DAJ A;  2LXC A;  2PEA A;  2C5L C;  4G0N B;  2LWP A;  3N3K B;  4GIV A;  2KWV B;  3APC A;  2MX2 A;  5AZG A;  4URK A;  1PQS A;  2V4L A;  4K81 A;  3KW5 B;  2KO3 A;  1V2Y A;  2N1W A;  4NAW A;  2DX5 B;  5IA7 A;  2AEH A;  4BKS A;  2ZNV B;  5G2N A;  3L0W B;  4ASW C;  1WY8 A;  3VUW A;  3DBS A;  3AU4 A;  2D07 B;  3VUY A;  4PYU A;  3OAW A;  4EZL A;  4GDK A;  2KFK B;  4AP4 C;  2LZ6 A;  3ML9 A;  2LJ5 A;  1WJN A;  2O2V B;  4LJP B;  4NQL B;  2LAS A;  3ZRF A;  2L05 A;  2I1K A;  2KTR B;  3RT3 B;  2D3G A;  4FHK A;  2K8C A;  2ZPN A;  1P9D U;  2BGF A;  5J18 A;  3I3T B;  4DHZ B;  3EEC A;  2KK8 A;  4E3C A;  2MQJ A;  4GDL A;  2NVU I;  4MH0 E;  4W9D A;  3JSV A;  3KVF B;  3ONS A;  2UYZ B;  3KYD D;  2O6V B;  2KMA A;  1ISN A;  4G50 A;  5DPW A;  2LRU A;  2KDE B;  5DPR A;  5L83 A;  5KHQ A;  2ZVN A;  4A3P A;  2RSU A;  3VTW A;  3PRM B;  4MGI E;  3ZVV A;  3WIM A;  4IW0 A;  1HE8 A;  2C60 A;  2MRP A;  2L3Z A;  3T9L A;  3A1Q A;  4NJ6 A;  5J2R A;  3ML8 A;  3U7D A;  2GBK A;  4KZ0 A;  2NBW B;  4AOF A;  2ZJD A;  4ZRK A;  2CHX A;  3EHV A;  3B1L X;  1I42 A;  3PPA A;  4ICU A;  3QX1 A;  4WAA A;  3DVN U;  3B08 A;  3APD A;  1RAX A;  1X1M A;  1WXM A;  3WAM A;  4K7S A;  3D32 A;  1OEY J;  1WZ0 A;  2NR2 A;  1UGM A;  3DVG X;  4W9E A;  3RCZ A;  3QCA A;  2L8J A;  3CF6 E;  3A33 B;  3ECI A;  2AL6 A;  3ZTC A;  4KZC A;  1UBI A;  2KLG A;  2NPT A;  1WXV A;  4W9G A;  3RZF A;  5DCN A;  2BWE S;  3OJ3 A;  2CHW A;  4FN2 A;  3VXW A;  4F8C B;  4AUQ C;  5JZE B;  1UBQ A;  4JL9 A;  2FCS A;  1V86 A;  5LXI B;  1KLV A;  2W9N A;  2PE9 A;  2IYD B;  2M17 A;  3N32 A;  4W9I A;  4FBJ B;  1WMH A;  2UWQ A;  2IY0 B;  2L0T A;  3B0A A;  1WGR A;  2BWF A;  3ZIM A;  3H6N A;  4FJV B;  5JH5 C;  4W9H A;  2KD0 A;  1R4M I;  4IWQ A;  3DDC B;  3NHE B;  4II2 B;  1E8Y A;  2DEN B;  3QA8 A;  1NBF C;  2PJH A;  3TBL D;  4MJS B;  3ZLZ A;  4F7Z A;  1WJ4 A;  2WX1 A;  3TJP A;  1MG8 A;  3ZTD A;  4W9K A;  2DYO A;  3H7P A;  2KN5 A;  3VHT C;  3ENE A;  2KFJ A;  2JZZ A;  2HJ8 A;  1IPG A;  3NOB A;  3HM3 A;  3ZNH B;  1V81 A;  2GMI C;  4HDO A;  4LDT B;  3V6C B;  2R2Q A;  3ZKJ C;  2J7Q B;  2JVC A;  2M4N A;  2ZNV C;  2HTH A;  3L54 A;  4G11 A;  3PVL A;  4OVU A;  3WAN A;  1UZX B;  3R3M A;  2BYF A;  4BBN C;  2GBM A;  4KVG B;  2WYQ A;  2FCM A;  4GMV A;  4IM2 A;  1Y8R C;  2OOB B;  2B3A A;  2KLC A;  2KQ7 A;  5DPS A;  2DYB A;  3HIZ A;  1Z2M A;  2MW5 A;  2JWZ A;  3H7S A;  1E90 A;  1P0R A;  2KJR A;  5CX3 A;  3PLU A;  5HKH A;  1P98 A;  2C9W B;  5BO4 B;  2IBI B;  4A20 A;  4BKT A;  4ANU A;  2KWC A;  2N1V A;  3VH4 B;  4ZDV A;  1WM2 A;  2N9E B;  2A4Z A;  3V60 A;  3ZDT A;  4BBN F;  4MDK E;  2MP2 B;  1KM7 A;  4E71 A;  3IVF A;  4ZRJ A;  4DXA B;  2XK5 B;  3NS8 A;  3WAP A;  4CYE A;  1WR1 A;  2JUO A;  4FHJ A;  2MBQ A;  1WI0 A;  2BKR B;  2KJ6 A;  2G45 B;  3KUC B;  3TMP B;  4JIO U;  4F1S A;  5J17 A;  5JHA A;  1WZ3 A;  3U30 A;  2KVR A;  1C3T A;  4WQO B;  3MTN B;  4W9F A;  1AAR A;  4WJP A;  4K7W A;  3VVW B;  1LXD A;  2LGD A;  4LCD E;  1H8C A;  1RLF A;  3UGB B;  4MGZ E;  2J0K A;  2MBE A;  2N4F A;  1Z5S B;  2DZI A;  4TKN A;  4FJY A;  4GOC A;  2NCN A;  4RM9 A;  1WYW B;  1IP9 A;  3T8M A;  2KWU B;  4NPN A;  3RYT A;  2G3Q B;  4KDI C;  2WWZ A;  4WWN A;  5TR5 A;  3N30 A;  3Q3J A;  4HVB A;  2K6Q A;  4JQW C;  3NZS A;  1NI2 A;  3O65 B;  1GJZ A;  2Z59 B;  2Y5B B;  3L17 A;  2KTF A;  2KX3 A;  4MGK E;  3S2A A;  3M95 A;  1SE9 A;  4I6P A;  3IFW B;  4MGY E;  1WGG A;  2K8H A;  4IG7 B;  2BPS A;  4GU2 A;  2AWT A;  3IG3 A;  2RGF A;  4RMA A;  3UIN B;  3DVG Y;  3PGE A;  1RRB A;  1WX9 A;  2C7N B;  1TBE A;  4IC7 B;  4FAD A;  1WGD A;  2JPH A;  1F9J A;  2YLM A;  4B9K A;  5AEK B;  2XBB C;  5G55 A;  2KFK A;  1WGY A;  2O2V A;  4HPM B;  2KKC A;  4IWO A;  4FUL A;  1OEY A;  2L00 B;  2G4D B;  4P7I A;  2KTR A;  3AUL A;  2HE7 A;  5D6J B;  4AJY B;  3PRE A;  3PRP B;  2KNB A;  4I6N B;  4ANV A;  3DPD A;  4EEW A;  2MA9 B;  4DDG D;  2J0J A;  4M8M A;  2KAN A;  1ZW7 A;  3CSF A;  4NNJ B;  3K9P B;  2O6V A;  2RD0 A;  3PT2 B;  2K39 A;  2L0F A;  4BKS D;  3WAL A;  1SIF A;  2V3S A;  2ZVO A;  3NY5 A;  4X57 B;  1GNU A;  3EFU A;  3ZO5 B;  2DZJ A;  1V6E A;  2WDT B;  3AU5 A;  2LI5 A;  2N7D A;  2ZCC A;  2DZM A;  2MWS B;  1V49 A;  1YD8 U;  1WX7 A;  2RPQ A;  4KIK B;  2KJH B;  4B95 A;  2MBO A;  2FAZ A;  4FA6 A;  4CHK A;  2C7H A;  2Z0D B;  3JVZ X;  3VUX A;  4DHJ D;  5E6O A;  1K8R B;  4GGQ A;  3A4R A;  1LQB A;  4KSL C;  2NBV B;  3VDZ A;  5AZF A;  4NY0 A;  2MBB B;  1WRD B;  1ZGU B;  2FUH B;  4BKG A;  3A4S C;  2L76 A;  2YVC A;  2IO2 B; 
#chains in the Genus database with same CATH topology
 4XDC A;  4W9J A;  1GC7 A;  3ZRC A;  4MSQ B;  1T0Q C;  2GBR A;  3KQ4 A;  1JWB D;  3CST A;  3PRZ A;  1YQB A;  1V97 A;  3VQI A;  4O1N A;  2KAC A;  1XT9 B;  3U4E G;  3QIJ A;  3OJ4 B;  3RUI B;  4EKU A;  2ONQ A;  1JWU D;  4MSM B;  4TQ0 A;  1TS4 A;  1L2N A;  2LGX A;  4HWI B;  2IO0 B;  1FRR A;  4DWF A;  4FLH A;  4HK2 A;  2QCZ A;  1JRU A;  4EZK A;  4KGT A;  2LVO A;  2LRW A;  3BVM A;  1WJU A;  3EC8 A;  2A5U A;  3AE6 B;  1YMH E;  3QWZ B;  3MFG A;  3SHQ A;  2IO3 B;  2PIA A;  5L95 C;  3QHT A;  1SGH A;  2BKF A;  3TCA A;  3DBL I;  2DLB A;  2CR5 A;  2LUE A;  4W9C A;  2LXA A;  3V6E B;  1K51 A;  4YTP B;  3CMM B;  1E7V A;  3Q3O C;  1TZO A;  2PE6 B;  4PS3 A;  2HJ1 A;  3AE1 B;  1DOI A;  4L1B A;  1HXY D;  1GB4 A;  1E7P B;  2XN9 C;  1UGJ A;  2RDH A;  1BML C;  2WXM A;  1YX5 B;  2KDB A;  2NS5 A;  4YL8 A;  2LGY A;  5C1Z A;  2NTS A;  3QJZ A;  3J9C A;  3AXC A;  2K0P A;  2RMM A;  3KUZ A;  3VFK A;  3A9J A;  3MJW A;  2JF5 A;  4YWG G;  4BZA A;  2QHO A;  3M3J A;  5E6N A;  3IBE A;  1IBX A;  1G6J A;  2NPT B;  4ARC A;  4LTU A;  1XCT L;  4MT5 A;  3ZXR A;  4G3X B;  1OGW A;  4BFR A;  5CHW A;  2DWQ A;  3IT4 B;  1L6U A;  2KOX A;  2AQ2 B;  2CKH B;  2M0X A;  4OVV A;  2BYV E;  1PYW D;  4MEL A;  1IGD A;  2SAK A;  3KH0 A;  2M8S A;  5BMG A;  3RZW C;  2RR9 A;  2D11 A;  4KSK C;  2BBC A;  3RNG C;  1VD2 A;  1F0Z A;  1E7U A;  3ZUN A;  3SDL C;  3NZU A;  2BW2 A;  1WXS A;  3FC4 A;  4IWP A;  4NQK E;  4P6V F;  2JT4 B;  1WGH A;  2ASQ A;  1OTR B;  4JWU C;  3RNA C;  3RN9 C;  3P2B A;  1LGR A;  2WXQ A;  3VAW A;  4JGH B;  2K6D B;  5D94 A;  2FCN A;  3NG0 A;  2H88 B;  2D3C A;  1TIF A;  3UIP B;  4MEM A;  4PS7 A;  3HUI A;  2Z0E B;  1PGA A;  4XZ4 A;  4II3 B;  4DHZ E;  2UU7 A;  4PYZ A;  4DK5 A;  1FEH A;  5GMV A;  4MAC A;  1HZ6 A;  1F77 A;  1WRI A;  4J3O D;  3B9J A;  3Q3F A;  2GOW A;  2J0M A;  2LGS A;  1J7B A;  4OZB A;  4G0N B;  2KWV B;  4URK A;  1WXQ A;  2V4L A;  4K81 A;  4YT0 B;  5TSS A;  3AB5 A;  2N1W A;  1ZDX A;  2AEH A;  4BKS A;  1TS5 A;  3DBS A;  4EZL A;  3OAW A;  4YSY B;  4GDK A;  3VR9 B;  2LZ6 A;  2LJ5 A;  2WDQ B;  3ZRF A;  4C56 C;  1UNS A;  3LB8 C;  2FE8 A;  2KTR B;  3RT3 B;  1N60 A;  1CK1 A;  2D3G A;  2K8C A;  2IGG A;  3I3T B;  2IGD A;  1HTQ A;  2N7J A;  2KK8 A;  3JSV A;  1F2R I;  1WSP A;  2LFI A;  2UYZ B;  3ONS A;  3Q3M C;  5DPW A;  2LRU A;  2KDE B;  2VH2 A;  4QAY A;  5KHQ A;  3HVD A;  2RSU A;  5AUI A;  3VTW A;  3ZVV A;  3WIM A;  1HE8 A;  2C60 A;  2L3Z A;  1C4P A;  5J2R A;  3ML8 A;  2NBW B;  1T0S C;  1QOB A;  4A8X C;  5JXV A;  2M0A A;  3AE5 B;  1UGM A;  1ZXH A;  3DVG X;  2DBY A;  2MEK A;  3ZXV A;  3ECI A;  4KZC A;  2KLG A;  1WXV A;  4W9G A;  4REZ A;  3RZF A;  3OJ3 A;  4H2A A;  1D5Z C;  1KH0 A;  4JL9 A;  3N32 A;  2IYD B;  1I4P A;  2L0T A;  2BWF A;  3H6N A;  2JWU A;  2WU5 B;  4A55 A;  3DDC B;  1E8Y A;  2KT7 A;  2PLP A;  1BXT A;  4W9K A;  3VHT C;  1JWM D;  2KFJ A;  2JZZ A;  2HJ8 A;  1IPG A;  3NOB A;  1EU3 A;  1V81 A;  1TT5 B;  4G11 A;  3L54 A;  3PVL A;  4OVU A;  4BBN C;  1VZ6 A;  4KVG B;  2OOB B;  2B3A A;  3Q2A C;  2KQ7 A;  3OWE B;  1Z2M A;  2JWZ A;  2KJR A;  3PLU A;  3P4Q B;  1ZE3 D;  2IBI B;  2WHI A;  3AH7 A;  2NTT A;  4L23 A;  1FM0 D;  4DXA B;  4CYE A;  3Q3N C;  3KUC B;  1TY0 A;  4WQO B;  3MTN B;  4W9F A;  1SE2 A;  1IBX B;  4K7W A;  1AWD A;  2IPK D;  1Z5S B;  2DZI A;  4GOC A;  4RM9 A;  3T8M A;  1FO4 A;  4WWN A;  4HVB A;  3O65 B;  2Z59 B;  3AV8 A;  3AE2 B;  2KX3 A;  1SE9 A;  3N9Y C;  2IGH A;  2K3U A;  2K8H A;  1NYR A;  4GU2 A;  3UIN B;  3LXF A;  3PGE A;  1OFF A;  5AEK B;  5G55 A;  1FNU A;  2PMV A;  1B1Z A;  2EKI A;  4AJY B;  3PRP B;  1I4R A;  4I6N B;  3IAM 1;  4EEW A;  2J53 A;  2MA9 B;  4M8M A;  3O13 A;  1ZW7 A;  4ZRP A;  3Q8E A;  3PT2 B;  2K39 A;  4WIP A;  4BKS D;  3LYY A;  2V3S A;  3EFU A;  3GP7 A;  1V6E A;  3AU5 A;  3EGR A;  1HA5 A;  1EM7 A;  2LI5 A;  2N7D A;  2DZM A;  2BB6 A;  1V49 A;  1MG4 A;  4B95 A;  2MBO A;  4FA6 A;  2C7H A;  2Z0D B;  5HFY A;  3VUX A;  1C9F A;  3A4R A;  3BK2 A;  1VR9 A;  3RNF C;  3ZJV A;  5AZF A;  1WRD B;  5BYQ A;  2YVC A;  2IO2 B;  2AX5 A;  4US8 A;  2ON8 A;  3V05 A;  3MC0 B;  2DAF A;  1XLQ A;  4EZJ A;  3PZD A;  4DBG A;  2PW9 A;  2KC2 A;  1QT9 A;  2JXT A;  2WXL A;  4TSS A;  1KTK A;  2R61 A;  4XYC A;  2JRI B;  1AYF A;  2L83 A;  2WU2 B;  1SBB B;  5LXH A;  4GDK B;  2PPH A;  1MFW A;  3SD5 A;  3N1X C;  3ZJT A;  1YQ4 B;  2K8B A;  4WWO A;  3QQ8 B;  4EOY A;  2N9X A;  1F1H A;  3M62 B;  4J6I A;  4NZL B;  4HCP B;  4GSW A;  1D5X C;  1YJJ A;  4C4V A;  3JSV B;  3ZQ4 A;  3M63 B;  2MSE D;  3DOW A;  2KC1 A;  2YEP B;  4P1B C;  2MBH A;  1TTN A;  4EUT A;  2WXO A;  1VCB A;  2BQQ A;  2DHZ A;  3TL5 A;  2JU6 X;  2E6X A;  3W1S C;  5BMH A;  2IO1 B;  2CU3 A;  4RM8 A;  4WAF A;  1SJE D;  2XK5 A;  2NBU A;  4HJK A;  2OJW A;  2GRI A;  2BYT A;  1Q0W B;  1NDD A;  3UI3 A;  1DOX A;  2KX0 A;  1FFV A;  3FAH A;  2EMS A;  1ZKH A;  2CHZ A;  2L7R A;  4DQO C;  3UQB A;  1YJI A;  1CQV A;  3CIR B;  4RH6 A;  3AE7 B;  1A5R A;  3PLV A;  4NJ7 A;  2J4X A;  1NEK B;  1P1A A;  1EF5 A;  4ZRI A;  2EEL A;  4LDT D;  2CS4 A;  2Y5P A;  3P4S B;  2BTE A;  2G9H D;  1CMX B;  2V1Y A;  4GB9 A;  1LFD A;  1I4G A;  1V5T A;  3SU8 X;  4XC2 A;  1YN5 A;  4HKZ E;  3U8Z A;  1KF6 B;  3MJ5 A;  4N9F 4;  2FUG 1;  2I1J A;  5IAA C;  3U52 E;  1PFD A;  1L6V A;  3AE3 B;  3T3N A;  1GPX A;  2D5G A;  3HM6 X;  2MJE A;  5C3J B;  3V62 A;  1H4R A;  3MHZ A;  3QC8 B;  3PSE B;  3V3X A;  2JRH A;  1V9J A;  2WXH A;  1WE6 A;  5CHF A;  4L2Y A;  2OJR A;  2DNF A;  3AI5 A;  4P16 A;  4ICV A;  1SE4 A;  3VTV A;  2Q5W D;  2KDI A;  3A9K A;  3AEF B;  2SEB D;  3L13 A;  3DQV A;  1JW9 D;  4ANW A;  2ZZP B;  1L5P A;  3Q69 A;  1XF5 L;  5BMI A;  3DCG A;  1EUV B;  4DHJ B;  4XE0 A;  5E6P A;  2IJ0 A;  2JYT A;  3C8Y A;  3TEW A;  2JQR B;  3AEC B;  3PHW B;  3DBR I;  4HLE A;  3WAO A;  5CTR C;  5D7G A;  3I5J C;  4A6Q A;  1F52 A;  2LXC A;  2PEA A;  2C5L C;  2QC8 A;  5H8Y E;  2MX2 A;  1PQS A;  3AED B;  2E3T A;  2KO3 A;  1E6E B;  2RDB C;  4JX1 C;  2ZNV B;  1JQ4 A;  3NUH B;  4ASW C;  2D07 B;  3VUY A;  1AW7 A;  4LNN A;  3R2T A;  3ML9 A;  4AP4 C;  4NQL B;  2LAS A;  2I1K A;  3NS1 A;  3W2D A;  4FHK A;  1P9D U;  4DHZ B;  2GB1 A;  1K52 A;  2MQJ A;  3RNE C;  4MH0 E;  1ISN A;  5DPR A;  5G5G A;  3PRM B;  4MGI E;  3BVG A;  4IW0 A;  2V3P A;  1KLU D;  2MRP A;  3A1Q A;  3TEZ A;  4NJ6 A;  3U7D A;  4K3C A;  2CHX A;  1YN3 A;  3NVV A;  2QSD A;  2WXP A;  3EHV A;  2JX5 A;  1L4D B;  1I42 A;  3QX1 A;  4WAA A;  1T6B X;  2K22 A;  1X1M A;  1WXM A;  3WAM A;  2LHE A;  1ET6 A;  2LUM A;  1WZ0 A;  4W9E A;  4LNO A;  3ZTC A;  1JAL A;  3GB1 A;  1N61 A;  3PZ7 A;  4WH4 A;  4F8C B;  2CHW A;  2AQ1 B;  3DBL B;  5JZE B;  1QF6 A;  1XEE A;  1V86 A;  2CJO A;  2W9N A;  2PE9 A;  4FBJ B;  1WMH A;  1VRA B;  1P7E A;  4W9H A;  2KD0 A;  1R4M I;  4II2 B;  1NBF C;  1JML A;  3TBL D;  1WJ4 A;  4OZA A;  4B0M A;  2DYO A;  3H7P A;  4WUR A;  3ZNH B;  4R3D A;  2GMI C;  3V6C B;  2R2Q A;  2JVC A;  2M4N A;  3TUO A;  4C4V B;  4XDD A;  3KWV A;  3WAN A;  3R3M A;  2BYF A;  1DGJ A;  5HI1 A;  2GBM A;  3P4P B;  2WYQ A;  2FCM A;  4GMV A;  4IM2 A;  3ETR A;  1E90 A;  5HKH A;  1MHH E;  5BO4 B;  4A20 A;  1WM2 A;  4JWS C;  2N9E B;  3DHI C;  4ZHP A;  1YN4 A;  4BBN F;  5C2T B;  4E71 A;  2XK5 B;  3NS8 A;  3WAP A;  1CZP A;  1WI0 A;  2KJ6 A;  4F1S A;  1FRD A;  1WZ3 A;  1J7C A;  1YQ3 B;  1V8C A;  2KVR A;  5EE9 A;  1AAR A;  1ESF A;  1LXD A;  3VR8 B;  1NI3 A;  1H8C A;  2N4F A;  1E10 A;  2NCN A;  1XCQ L;  3T3O A;  2KWU B;  2G3Q B;  3IT6 B;  2K6Q A;  4JQW C;  1D5M C;  1VZ8 A;  1NI2 A;  1GJZ A;  3S2A A;  4ZHO A;  3M95 A;  4ITK A;  3IFW B;  4WWM A;  4MGY E;  4LNI A;  1TKY A;  4IG7 B;  1PGX A;  3IG3 A;  2RGF A;  4ZOH C;  1WX9 A;  4FAD A;  1F9J A;  1SB3 C;  1C4C A;  3W5V B;  2KAJ A;  2KFK A;  3Q8C A;  2O2V A;  4HPM B;  2L00 B;  2G4D B;  4P7I A;  2HE7 A;  3N1Z C;  3PRE A;  2KNB A;  1VLB A;  2KAN A;  3CSF A;  3NRZ A;  4NNJ B;  3K9P B;  3ABV B;  1GAQ B;  2L0F A;  3C19 A;  4WQM A;  2WDT B;  3PZ8 A;  4RF1 A;  5FR3 A;  1YD8 U;  1WX7 A;  1ZPS A;  3H8H A;  3W5U B;  2K5P A;  2WLB A;  3JVZ X;  2QMT A;  5E6O A;  4GGQ A;  1RFK A;  3SEB A;  2WXN A;  2PKO A;  1XO3 A;  4XWT A;  1TKG A;  3C0R B;  1GC6 A;  3HHM A;  2IZV B;  4LJO B;  2IND C;  5G5H A;  1JRP A;  2W3S A;  3P4R B;  2MHJ A;  3QK0 A;  3BWU D;  2X38 A;  1BT0 A;  4ZYN A;  5HG2 A;  3L08 A;  5LNK 1;  2AQ3 B;  3AE9 B;  4ACF A;  2HD5 B;  2K25 A;  2Y3A A;  3GE3 C;  1FPY A;  2V3N A;  1I4Q A;  1V80 A;  4MJS A;  2O6V D;  1SXT A;  4HEA 1;  2N7E A;  3V61 A;  2LGI A;  1WE7 A;  3PTF C;  4W9L A;  1RYJ A;  1UF0 A;  3A9J B;  1SIJ A;  2REX A;  2D3A A;  4TQ1 A;  2GI9 A;  2V4I B;  1C1Y B;  3UQA A;  2KMM A;  1KFY B;  3RD2 A;  2VRR B;  2FID A;  1P3Q U;  2VZK D;  5LLI A;  1WX8 A;  1YX6 B;  4A90 A;  4HPP A;  1ZXI A;  3WA0 A;  1EO6 A;  1ZUD 2;  2QIL A;  3I57 A;  4IKG A;  5GXG B;  1OQQ A;  1R4N I;  3R7Q A;  3A1Q B;  4DDI D;  1KRH A;  4HXD A;  5MPO A;  2MP2 A;  5FK9 C;  4LLG M;  4GN1 A;  4IM0 A;  5C23 A;  5EE0 A;  4A3O A;  2MLB A;  2RDG A;  3MP9 A;  3X0W A;  5D3D A;  1C4A A;  1T0Y A;  2KQ4 X;  4AWJ A;  1ROE A;  1WM3 A;  1C77 A;  3LJ3 A;  5EDS A;  4IUM B;  1I4H A;  4BOZ B;  3URY A;  3N20 C;  2DZK A;  1XQQ A;  1IUE A;  3JW0 X;  1Q1O A;  1WMH B;  4PK1 A;  5IO9 A;  1E8Z A;  3U7Z A;  2D10 A;  2ICI A;  4HCN B;  3KYC D;  2JXX A;  4WJQ A;  2K1F A;  1E8X A;  1K53 A;  3H7P B;  3QAR A;  1UD7 A;  3X23 A;  3TSS A;  2ZPY A;  2GBJ A;  2LD9 A;  2DYM A;  1SE3 A;  4BOS C;  1D6E C;  5IN7 A;  3RNC C;  1VJK A;  5KHO A;  1FCL A;  1FD6 A;  3ALB A;  4LK0 M;  3RI7 C;  4WWP A;  2FCQ A;  4UDU C;  4S17 A;  3PHX B;  1QIL A;  3UF8 A;  1WF9 A;  4MM3 A;  3ZNZ B;  4C7Z A;  1UH6 A;  4CO7 A;  4WJO A;  4YSX B;  1PUT A;  3DBH I;  3QAQ A;  2LHD A;  3TEX A;  2KXJ A;  1V5O A;  1YIW A;  4M8N A;  3GZN I;  4KV2 A;  1FXA A;  4AQ7 A;  1GG3 A;  1E8W A;  1TY2 A;  3JYU A;  4TV3 A;  5EE3 A;  3E9S A;  1RM6 C;  3KUD B;  1XD3 B;  1N5W A;  2MCN B;  4IM3 A;  4FJZ A;  4RF0 A;  1T0R C;  3ZDM C;  1T3Q A;  2R2O A;  1KLG D;  1D3Z A;  1OQY A;  2PVG C;  4GXB A;  2ZCB A;  4TMA B;  4ZYS A;  1MHX A;  2BVC A;  2LWP A;  3APC A;  5AZG A;  2XNA C;  1V2Y A;  4NAW A;  3WCQ A;  5G2N A;  3L0W B;  4LNF A;  1WY8 A;  3AU4 A;  4PYU A;  2BS4 B;  2KFK B;  3FKY A;  4M01 A;  1WJN A;  2O2V B;  4LJP B;  4C80 A;  3GS2 A;  3R8B A;  2CJN A;  3EEC A;  4E3C A;  4GDL A;  3KVF B;  3DHG C;  1WGK A;  2LMC A;  3I9V 1;  4DXG A;  2ZVN A;  1ET9 A;  2MJ3 A;  4RGM A;  1R7S A;  4KZ0 A;  2INP E;  2BB5 A;  1NYQ A;  1IGC A;  1TS2 A;  3PPA A;  4FXC A;  3DVN U;  2QJL A;  4K7S A;  1J7A A;  1AN8 A;  2L1A A;  3AE8 B;  5EE1 A;  1QOF A;  2NR2 A;  3QCA A;  2L8J A;  3A33 B;  1E0Z A;  1N63 A;  4NAM A;  5DCN A;  4FN2 A;  4M00 A;  2D3B A;  5LXI B;  3NZ3 A;  4M0W A;  2M17 A;  2QEJ C;  2UWQ A;  3ZIM A;  1WGR A;  5T8I A;  3KLS X;  1N6Z A;  3NHE B;  4F7Z A;  4MJS B;  3TEY A;  4CQN A;  3FIL A;  2WX1 A;  2HDE A;  3TJP A;  2TSS A;  2KN5 A;  4YTN B;  1SEB D;  1GOZ A;  3HM3 A;  4HDO A;  4LDT B;  1ZOY B;  2J7Q B;  2ZNV C;  2HTH A;  1UZX B;  4K3B A;  2W3R A;  3BII D;  5DPS A;  2DYB A;  3H7S A;  1ACC A;  4KGR A;  5CX3 A;  1P98 A;  2C9W B;  2FBW B;  2GLS A;  5IP4 D;  2N1V A;  1MI0 A;  1C79 A;  2A4Z A;  3V60 A;  2MP2 B;  1KM7 A;  3IVF A;  1WR1 A;  2BKR B;  2G45 B;  3TMP B;  2V9H A;  4DXF A;  3U30 A;  1Y56 A;  1V1O A;  2VH1 A;  4WJP A;  3VVW B;  1RLF A;  2J0K A;  2MBE A;  3AEG B;  4D2K A;  3GE8 C;  4FJY A;  1WYW B;  4KDI C;  2WWZ A;  5TR5 A;  1HEZ E;  3N30 A;  5AUK A;  5IKC M;  3NZS A;  1ZDV A;  3U2S C;  1EWC A;  2Z8L A;  2KYW A;  4C7Y A;  2BPS A;  4RMA A;  4IC7 B;  1TBE A;  2JPH A;  2YLM A;  4B9K A;  2XBB C;  1WGY A;  5HHD G;  2KKC A;  4IWO A;  1OEY A;  5D3I B;  5D6J B;  4ANV A;  2KWD A;  3PO0 A;  4DDG D;  2H89 B;  2O6V A;  2NMQ A;  2RD0 A;  1SIF A;  4MM3 B;  1FNV A;  2DZJ A;  3DBR B;  2ZCC A;  2MWS B;  4XGA B;  2KJH B;  2QIE B;  1K50 A;  4CHK A;  2PVO D;  1K8R B;  1LQB A;  2NBV B;  2L32 A;  4NY0 A;  2FUH B;  1HTO A;  2N9L A;  3E56 A;  4I6L B;  3P63 A;  3ZNG C;  2JZ3 B;  4ANX A;  1KOT A;  3GOE A;  1WR6 E;  2WXR A;  1YJ1 A;  1EF1 A;  2CU1 A;  3APF A;  2W54 A;  3PS6 A;  1I7H A;  5IOI A;  1N62 A;  4HDQ A;  4P1C C;  1U4A A;  4YXD B;  1WJ6 A;  3NVW A;  1TZ1 A;  3VRA B;  2M19 A;  1YNT E;  3IHP C;  3TIX A;  4NJC A;  3BY4 B;  3H9D A;  4NAW B;  2C7M B;  4USA A;  4E74 A;  1Q5W B;  2M56 B;  3VTU A;  3Q6B A;  1I35 A;  2KMC A;  1WXA A;  2KQS A;  1TKE A;  2MJD A;  4PS8 A;  1RFA A;  3MC8 A;  4HJG E;  3R2I A;  2W55 A;  1HQR D;  3BYT B;  1C76 A;  3K9O B;  3KWL A;  3ZYY X;  5FR6 A;  2Y5C A;  1J0G A;  1EU4 A;  4K1R B;  1PGB A;  3ZW3 A;  3CWI A;  2KN4 A;  4GDL B;  4BVU C;  1DOY A;  3DVN V;  2BS3 B;  5JHB A;  2ZEQ A;  3OLM D;  2GBN A;  2I2Y A;  3R7R A;  2OHF A;  5CHV C;  3ZGZ A;  1XLP A;  4KDL B;  2WDR B;  2WDV B;  3L16 A;  1TGZ B;  1QQR A;  3UIO B;  2G1E A;  2L52 A;  1TYG B;  2XEW A;  5AZH A;  2EKE C;  4C00 A;  2WS3 B;  3W1Y A;  1R4M B;  2KDF B;  3IXS A;  4JLC A;  1DYQ A;  4KX6 B;  3I63 C;  1QKZ A;  1P7F A;  3W9C B;  1FCC C;  2BF8 B;  2J52 A;  3OG5 A;  1J8C A;  4MH8 A;  3HK0 A;  4HRO A;  3VH3 B;  4AJW A;  2AL3 A;  4M0W B;  1L0V B;  3ZJU A;  4B6W A;  1J19 A;  3LDZ E;  4HPL B;  2JYE A;  1M94 A;  3AM9 A;  3H1U A;  4XX5 A;  1WYG A;  3R66 C;  1S3S G;  5DPT A;  1C78 A;  3Q8A A;  1WH3 A;  2INN E;  1LM8 B;  3FIL B;  1UWX A;  3BIN A;  1S1Q B;  1L7Y A;  1F2R C;  1FXT B;  3A9K B;  2WQY B;  2FNJ B;  1M4V A;  4BAX A;  1NEN B;  2M1M A;  1I4X A;  3W1S A;  4N58 A;  1KJT A;  2JY6 A;  4HKQ A;  1OQR A;  5I4D A;  1A70 A;  4WJN A;  4XWW A;  1XLO A;  4M02 A;  3Q8B A;  4YSZ B;  3BYY B;  4N6E B;  1GUA B;  2EMT A;  4K7U A;  1IYF A;  1UEL A;  1FIQ A;  4KIK A;  1WFY A;  3NVY A;  2KZR A;  2WX0 A;  2N9P C;  3RUL A;  1E5W A;  4RNA A;  2AYO B;  2G4S A;  2IY1 B;  1V1P A;  3ZNI D;  4KKJ A;  5D2M B;  1L0Y B;  2KHW B;  3L10 B;  2FIF A;  5H92 C;  4ZRQ A;  1JCK B;  1QZE A;  4S0R A;  1WIA A;  3PV1 A;  2N9K A;  4EFO A;  2YEP F;  2BYE A;  5FKA C;  4HRS A;  2LVP A;  1RWS A;  3MHS D;  2LVQ A;  2WNM A;  4TUU A;  2D2Q A;  2DAJ A;  2WXG A;  4PT5 A;  1BUI C;  1HZ5 A;  3N3K B;  4GIV A;  2K9X A;  1ENF A;  3KW5 B;  2WXF A;  3EA6 A;  2DX5 B;  5IA7 A;  3VUW A;  3AN1 A;  3DWG C;  2IDY A;  3DWM A;  4B0E A;  2L05 A;  3HRD D;  3N1Y C;  2ZPN A;  5J18 A;  2BGF A;  4AS1 A;  1Q10 A;  2OED A;  2NVU I;  4W9D A;  3KYD D;  2KDM A;  2O6V B;  2KMA A;  4G50 A;  2KVZ A;  5L83 A;  2ZW1 A;  2ACZ B;  4A3P A;  2N0S B;  1UUP A;  2V0G A;  3AE4 B;  4IOI E;  3P1M A;  3T9L A;  3RFZ B;  2GBK A;  4AOF A;  2ZJD A;  4ZRK A;  2J42 A;  1EWY C;  1VZ7 A;  3BVZ A;  2I38 A;  3B1L X;  2VZK B;  2WXI A;  4ICU A;  1QOG A;  3B08 A;  3APD A;  1RAX A;  1T5X D;  2HTM E;  3D32 A;  1OEY J;  1MPE A;  1TS3 A;  4LNK A;  3RCZ A;  3CF6 E;  2AL6 A;  1CJE A;  4RCO A;  4OZC A;  1UBI A;  2NPT A;  3EFC A;  4EE2 A;  3B2F A;  2BS2 B;  2B76 B;  2BWE S;  3VXW A;  4OHJ A;  4AUQ C;  1SSN A;  1UBQ A;  2FCS A;  1KLV A;  4W9I A;  3HVZ A;  4US9 A;  3BK1 A;  2IY0 B;  2WGS A;  3B0A A;  2BT6 A;  4FJV B;  5JH5 C;  1L4Z B;  1UWM A;  4IWQ A;  3AEB B;  3L4P A;  4Q2J A;  4OVZ A;  1R4N B;  3QA8 A;  2DEN B;  5E6J A;  3ZLZ A;  2PJH A;  1PDX A;  1MG8 A;  3ZTD A;  3NVZ A;  3ENE A;  3ZKJ C;  4YTM B;  3Q14 C;  3NJT A;  3SR6 A;  4RGO S;  4JE3 B;  1FNW A;  1FXI A;  4KKI A;  1WWT A;  1Y8R C;  2KLC A;  1ZP0 B;  3VRB B;  3RPF C;  4JPS A;  3B2G A;  1STE A;  3HIZ A;  2MW5 A;  1P0R A;  4BKT A;  4ANU A;  2KWC A;  3VH4 B;  4ZDV A;  1JWS D;  4OW0 A;  3ZDT A;  4MDK E;  4RGT A;  2LJI A;  4ZRJ A;  3BZD B;  2JUO A;  1QOA A;  4FHJ A;  2MBQ A;  3RMK C;  3AEA B;  4JIO U;  5J17 A;  4N59 A;  5JHA A;  3SFD B;  1C3T A;  1SJH D;  2ZW0 A;  1L0X B;  1JRO A;  1XXG A;  2INC C;  1XLN A;  2LGD A;  4LCD E;  3UGB B;  4MGZ E;  1MJD A;  2RPV A;  3AEE B;  2WXJ A;  4TKN A;  1IP9 A;  4NPN A;  3RYT A;  1SF0 A;  3Q3J A;  1NVI D;  2JSV X;  3EUB 2;  2Y5B B;  3L17 A;  2KTF A;  4MGK E;  1N5X A;  1TJE A;  1YOV B;  2JZP A;  4I6P A;  2PTL A;  1WGG A;  3AMZ A;  4A9A A;  2AWT A;  3DVG Y;  3SFE B;  1RRB A;  1QLB B;  2C7N B;  1B9R A;  1WGD A;  3DBH B;  3DHH C;  2MH7 A;  1E9M A;  2WXK A;  3GZN B;  4FUL A;  3Q8F A;  1MVK A;  3RNB C;  2KTR A;  3AUL A;  3IAS 1;  5BYS A;  3DPD A;  2J0J A;  2X8X X;  2W82 A;  5BYR A;  4ARI A;  1FMA D;  1GB1 A;  3WAL A;  4X57 B;  2ZVO A;  3NY5 A;  1GNU A;  3ZO5 B;  2QDF A;  3MC9 A;  4IDI A;  1LO5 D;  4RFB A;  3P42 A;  2LEK A;  2RPQ A;  4KIK B;  4RGN A;  1D4B A;  1JWA D;  2WP9 B;  2FAZ A;  4DHJ D;  4KSL C;  1VDV A;  3VDZ A;  4GLS C;  2MBB B;  1ZGU B;  4BKG A;  3A4S C;  2L76 A;  4KGS A;  1FFU A;  1V1P B; 
#chains in the Genus database with same CATH homology
 4W9J A;  1GC7 A;  3ZRC A;  4I6L B;  3ZNG C;  2JZ3 B;  4MSQ B;  4ANX A;  2GBR A;  1KOT A;  3GOE A;  3C0R B;  1GC6 A;  3HHM A;  2DAF A;  2IZV B;  3CST A;  3PRZ A;  4LJO B;  1WR6 E;  4EZJ A;  3PZD A;  4DBG A;  1YJ1 A;  1EF1 A;  2CU1 A;  3APF A;  3PS6 A;  1YQB A;  3QK0 A;  4HDQ A;  2KC2 A;  1BT0 A;  3VQI A;  1U4A A;  1XT9 B;  4ZYN A;  1WJ6 A;  1TZ1 A;  3QIJ A;  3OJ4 B;  3RUI B;  4EKU A;  3L08 A;  4MSM B;  3IHP C;  3TIX A;  4TQ0 A;  3BY4 B;  3H9D A;  2HD5 B;  2JRI B;  2LGX A;  4HWI B;  2C7M B;  4NAW B;  2IO0 B;  1L2N A;  2K25 A;  4E74 A;  1Q5W B;  4DWF A;  4FLH A;  3VTU A;  4HK2 A;  1I35 A;  2KMC A;  1JRU A;  1WXA A;  2KQS A;  4EZK A;  5LXH A;  4PS8 A;  1V80 A;  1RFA A;  2LVO A;  2LRW A;  4MJS A;  2O6V D;  4GDK B;  1WJU A;  2PPH A;  3EC8 A;  2N7E A;  3SD5 A;  3V61 A;  2A5U A;  3K9O B;  3QWZ B;  1WE7 A;  2K8B A;  3SHQ A;  2IO3 B;  4WWO A;  5FR6 A;  3QQ8 B;  3PTF C;  4W9L A;  2N9X A;  4EOY A;  5L95 C;  1J0G A;  3QHT A;  4K1R B;  1SGH A;  2BKF A;  3M62 B;  4J6I A;  3TCA A;  3A9J B;  4GSW A;  4HCP B;  3ZW3 A;  2REX A;  3DBL I;  4GDL B;  4TQ1 A;  2CR5 A;  4BVU C;  2LUE A;  3JSV B;  4W9C A;  2LXA A;  1C1Y B;  3V6E B;  3UQA A;  3M63 B;  2MSE D;  3DOW A;  3CMM B;  1E7V A;  2KC1 A;  3DVN V;  5JHB A;  2PE6 B;  2ZEQ A;  3OLM D;  4PS3 A;  2GBN A;  2VRR B;  2FID A;  3RD2 A;  1P3Q U;  5LLI A;  2MBH A;  1WX8 A;  3R7R A;  1YX6 B;  1TTN A;  4EUT A;  1VCB A;  2DHZ A;  5CHV C;  3TL5 A;  3WA0 A;  1EO6 A;  3W1S C;  1R4N I;  3R7Q A;  4DDI D;  3A1Q B;  4KDL B;  2IO1 B;  4HXD A;  3L16 A;  1TGZ B;  1YX5 B;  2KDB A;  2NS5 A;  4RM8 A;  3UIO B;  4YL8 A;  2LGY A;  2MP2 A;  2XK5 A;  2XEW A;  5AZH A;  2EKE C;  2NBU A;  4GN1 A;  4HJK A;  4IM0 A;  5C1Z A;  3QJZ A;  3AXC A;  5C23 A;  4A3O A;  3W1Y A;  2MLB A;  3KUZ A;  2KDF B;  3X0W A;  4JLC A;  1Q0W B;  1NDD A;  2KX0 A;  3VFK A;  1T0Y A;  3A9J A;  3MJW A;  4AWJ A;  2JF5 A;  2QHO A;  1WM3 A;  2EMS A;  3M3J A;  5E6N A;  2BF8 B;  3IBE A;  1ZKH A;  3LJ3 A;  5EDS A;  2CHZ A;  2L7R A;  4IUM B;  3UQB A;  1J8C A;  1G6J A;  2NPT B;  4G3X B;  3HK0 A;  1OGW A;  4BFR A;  5CHW A;  4BOZ B;  1A5R A;  3VH3 B;  4AJW A;  2DZK A;  2AL3 A;  1XQQ A;  4M0W B;  3JW0 X;  3PLV A;  4NJ7 A;  1Q1O A;  1WMH B;  4B6W A;  1J19 A;  3LDZ E;  2KOX A;  1P1A A;  1EF5 A;  2CKH B;  4HPL B;  4ZRI A;  1E8Z A;  4LDT D;  2CS4 A;  1M94 A;  3H1U A;  4XX5 A;  3R66 C;  2D10 A;  1S3S G;  1CMX B;  5DPT A;  4HCN B;  2M0X A;  4OVV A;  2V1Y A;  4GB9 A;  2BYV E;  1WH3 A;  1LFD A;  1LM8 B;  2JXX A;  3KYC D;  1V5T A;  4MEL A;  4WJQ A;  3SU8 X;  3BIN A;  1S1Q B;  1L7Y A;  2K1F A;  1E8X A;  1FXT B;  3KH0 A;  3H7P B;  4XC2 A;  3A9K B;  2M8S A;  3QAR A;  2FNJ B;  1UD7 A;  2RR9 A;  2D11 A;  3RZW C;  3X23 A;  2ZPY A;  3U8Z A;  2GBJ A;  2M1M A;  2LD9 A;  4KSK C;  4N9F 4;  3W1S A;  2DYM A;  5IAA C;  2I1J A;  1VD2 A;  4BOS C;  1E7U A;  1KJT A;  3ZUN A;  2JY6 A;  5KHO A;  3ALB A;  3SDL C;  3NZU A;  4WJN A;  3HM6 X;  4WWP A;  1WXS A;  2FCQ A;  4IWP A;  4NQK E;  3V62 A;  1H4R A;  3PHX B;  1GUA B;  3QC8 B;  3PSE B;  2EMT A;  4K7U A;  3UF8 A;  2JRH A;  1IYF A;  1V9J A;  1WF9 A;  1WGH A;  2JT4 B;  4MM3 A;  2ASQ A;  1OTR B;  3ZNZ B;  1UEL A;  1UH6 A;  1WE6 A;  3P2B A;  4CO7 A;  4WJO A;  5CHF A;  3VAW A;  4KIK A;  1WFY A;  2OJR A;  3DBH I;  3AI5 A;  3QAQ A;  4JGH B;  2K6D B;  2KZR A;  2WX0 A;  2FCN A;  2N9P C;  5D94 A;  4ICV A;  2KXJ A;  1V5O A;  3RUL A;  1YIW A;  3VTV A;  4M8N A;  3GZN I;  1E5W A;  4KV2 A;  2AYO B;  2KDI A;  3A9K A;  3UIP B;  3L13 A;  2G4S A;  1GG3 A;  1E8W A;  4MEM A;  3DQV A;  2IY1 B;  4PS7 A;  4ANW A;  3ZNI D;  2Z0E B;  3JYU A;  4TV3 A;  5D2M B;  2ZZP B;  4XZ4 A;  2KHW B;  4II3 B;  3L10 B;  4DHZ E;  2FIF A;  3KUD B;  1XD3 B;  2MCN B;  3DCG A;  4IM3 A;  1EUV B;  1QZE A;  4FJZ A;  4PYZ A;  4DK5 A;  4DHJ B;  1WIA A;  3PV1 A;  5E6P A;  5GMV A;  3ZDM C;  2R2O A;  4EFO A;  2BYE A;  3PHW B;  1D3Z A;  3DBR I;  4HLE A;  3WAO A;  5CTR C;  1OQY A;  2LVP A;  3Q3F A;  3MHS D;  2GOW A;  2LVQ A;  2J0M A;  4GXB A;  2ZCB A;  5D7G A;  4TUU A;  2D2Q A;  2DAJ A;  2LXC A;  2PEA A;  2C5L C;  4G0N B;  2LWP A;  3N3K B;  4GIV A;  2KWV B;  3APC A;  2MX2 A;  5AZG A;  4URK A;  1PQS A;  2V4L A;  4K81 A;  3KW5 B;  2KO3 A;  1V2Y A;  2N1W A;  4NAW A;  2DX5 B;  5IA7 A;  2AEH A;  4BKS A;  2ZNV B;  5G2N A;  3L0W B;  4ASW C;  1WY8 A;  3VUW A;  3DBS A;  3AU4 A;  2D07 B;  3VUY A;  4PYU A;  3OAW A;  4EZL A;  4GDK A;  2KFK B;  4AP4 C;  2LZ6 A;  3ML9 A;  2LJ5 A;  1WJN A;  2O2V B;  4LJP B;  4NQL B;  2LAS A;  3ZRF A;  2L05 A;  2I1K A;  2KTR B;  3RT3 B;  2D3G A;  4FHK A;  2K8C A;  2ZPN A;  1P9D U;  2BGF A;  5J18 A;  3I3T B;  4DHZ B;  3EEC A;  2KK8 A;  4E3C A;  2MQJ A;  4GDL A;  2NVU I;  4MH0 E;  4W9D A;  3JSV A;  3KVF B;  3ONS A;  2UYZ B;  3KYD D;  2O6V B;  2KMA A;  1ISN A;  4G50 A;  5DPW A;  2LRU A;  2KDE B;  5DPR A;  5L83 A;  5KHQ A;  2ZVN A;  4A3P A;  2RSU A;  3VTW A;  3PRM B;  4MGI E;  3ZVV A;  3WIM A;  4IW0 A;  1HE8 A;  2C60 A;  2MRP A;  2L3Z A;  3T9L A;  3A1Q A;  4NJ6 A;  5J2R A;  3ML8 A;  3U7D A;  2GBK A;  4KZ0 A;  2NBW B;  4AOF A;  2ZJD A;  4ZRK A;  2CHX A;  3EHV A;  3B1L X;  1I42 A;  3PPA A;  4ICU A;  3QX1 A;  4WAA A;  3DVN U;  3B08 A;  3APD A;  1RAX A;  1X1M A;  1WXM A;  3WAM A;  4K7S A;  3D32 A;  1OEY J;  1WZ0 A;  2NR2 A;  1UGM A;  3DVG X;  4W9E A;  3RCZ A;  3QCA A;  2L8J A;  3CF6 E;  3A33 B;  3ECI A;  2AL6 A;  3ZTC A;  4KZC A;  1UBI A;  2KLG A;  2NPT A;  1WXV A;  4W9G A;  3RZF A;  5DCN A;  2BWE S;  3OJ3 A;  2CHW A;  4FN2 A;  3VXW A;  4F8C B;  4AUQ C;  5JZE B;  1UBQ A;  4JL9 A;  2FCS A;  1V86 A;  5LXI B;  1KLV A;  2W9N A;  2PE9 A;  2IYD B;  2M17 A;  3N32 A;  4W9I A;  4FBJ B;  1WMH A;  2UWQ A;  2IY0 B;  2L0T A;  3B0A A;  1WGR A;  2BWF A;  3ZIM A;  3H6N A;  4FJV B;  5JH5 C;  4W9H A;  2KD0 A;  1R4M I;  4IWQ A;  3DDC B;  3NHE B;  4II2 B;  1E8Y A;  2DEN B;  3QA8 A;  1NBF C;  2PJH A;  3TBL D;  4MJS B;  3ZLZ A;  4F7Z A;  1WJ4 A;  2WX1 A;  3TJP A;  1MG8 A;  3ZTD A;  4W9K A;  2DYO A;  3H7P A;  2KN5 A;  3VHT C;  3ENE A;  2KFJ A;  2JZZ A;  2HJ8 A;  1IPG A;  3NOB A;  3HM3 A;  3ZNH B;  1V81 A;  2GMI C;  4HDO A;  4LDT B;  3V6C B;  2R2Q A;  3ZKJ C;  2J7Q B;  2JVC A;  2M4N A;  2ZNV C;  2HTH A;  3L54 A;  4G11 A;  3PVL A;  4OVU A;  3WAN A;  1UZX B;  3R3M A;  2BYF A;  4BBN C;  2GBM A;  4KVG B;  2WYQ A;  2FCM A;  4GMV A;  4IM2 A;  1Y8R C;  2OOB B;  2B3A A;  2KLC A;  2KQ7 A;  5DPS A;  2DYB A;  3HIZ A;  1Z2M A;  2MW5 A;  2JWZ A;  3H7S A;  1E90 A;  1P0R A;  2KJR A;  5CX3 A;  3PLU A;  5HKH A;  1P98 A;  2C9W B;  5BO4 B;  2IBI B;  4A20 A;  4BKT A;  4ANU A;  2KWC A;  2N1V A;  3VH4 B;  4ZDV A;  1WM2 A;  2N9E B;  2A4Z A;  3V60 A;  3ZDT A;  4BBN F;  4MDK E;  2MP2 B;  1KM7 A;  4E71 A;  3IVF A;  4ZRJ A;  4DXA B;  2XK5 B;  3NS8 A;  3WAP A;  4CYE A;  1WR1 A;  2JUO A;  4FHJ A;  2MBQ A;  1WI0 A;  2BKR B;  2KJ6 A;  2G45 B;  3KUC B;  3TMP B;  4JIO U;  4F1S A;  5J17 A;  5JHA A;  1WZ3 A;  3U30 A;  2KVR A;  1C3T A;  4WQO B;  3MTN B;  4W9F A;  1AAR A;  4WJP A;  4K7W A;  3VVW B;  1LXD A;  2LGD A;  4LCD E;  1H8C A;  1RLF A;  3UGB B;  4MGZ E;  2J0K A;  2MBE A;  2N4F A;  1Z5S B;  2DZI A;  4TKN A;  4FJY A;  4GOC A;  2NCN A;  4RM9 A;  1WYW B;  1IP9 A;  3T8M A;  2KWU B;  4NPN A;  3RYT A;  2G3Q B;  4KDI C;  2WWZ A;  4WWN A;  5TR5 A;  3N30 A;  3Q3J A;  4HVB A;  2K6Q A;  4JQW C;  3NZS A;  1NI2 A;  3O65 B;  1GJZ A;  2Z59 B;  2Y5B B;  3L17 A;  2KTF A;  2KX3 A;  4MGK E;  3S2A A;  3M95 A;  1SE9 A;  4I6P A;  3IFW B;  4MGY E;  1WGG A;  2K8H A;  4IG7 B;  2BPS A;  4GU2 A;  2AWT A;  3IG3 A;  2RGF A;  4RMA A;  3UIN B;  3DVG Y;  3PGE A;  1RRB A;  1WX9 A;  2C7N B;  1TBE A;  4IC7 B;  4FAD A;  1WGD A;  2JPH A;  1F9J A;  2YLM A;  4B9K A;  5AEK B;  2XBB C;  5G55 A;  2KFK A;  1WGY A;  2O2V A;  4HPM B;  2KKC A;  4IWO A;  4FUL A;  1OEY A;  2L00 B;  2G4D B;  4P7I A;  2KTR A;  3AUL A;  2HE7 A;  5D6J B;  4AJY B;  3PRE A;  3PRP B;  2KNB A;  4I6N B;  4ANV A;  3DPD A;  4EEW A;  2MA9 B;  4DDG D;  2J0J A;  4M8M A;  2KAN A;  1ZW7 A;  3CSF A;  4NNJ B;  3K9P B;  2O6V A;  2RD0 A;  3PT2 B;  2K39 A;  2L0F A;  4BKS D;  3WAL A;  1SIF A;  2V3S A;  2ZVO A;  3NY5 A;  4X57 B;  1GNU A;  3EFU A;  3ZO5 B;  2DZJ A;  1V6E A;  2WDT B;  3AU5 A;  2LI5 A;  2N7D A;  2ZCC A;  2DZM A;  2MWS B;  1V49 A;  1YD8 U;  1WX7 A;  2RPQ A;  4KIK B;  2KJH B;  4B95 A;  2MBO A;  2FAZ A;  4FA6 A;  4CHK A;  2C7H A;  2Z0D B;  3JVZ X;  3VUX A;  4DHJ D;  5E6O A;  1K8R B;  4GGQ A;  3A4R A;  1LQB A;  4KSL C;  2NBV B;  3VDZ A;  5AZF A;  4NY0 A;  2MBB B;  1WRD B;  1ZGU B;  2FUH B;  4BKG A;  3A4S C;  2L76 A;  2YVC A;  2IO2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...