4B95A

Pvhl-elob-elob-eloc complex_(2s,4r)-1-(2-chlorophenyl)carbonyl-n-[(4-chlorophenyl)methyl]-4-oxidanyl-pyrrolidine-2-carboxamide bound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Small-Molecule Inhibitors of the Interaction between the E3 Ligase Vhl and Hif1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 22
structure length 104
sequence length 104
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4b95A00
3BINA 3TL5A 4AUQC 3D32A 2D11A 5C23A 3L16A 2MWSB 4HCNB 2ZNVC 3I3TB 1GNUA 3ONSA 3AU5A 2AWTA 1WGRA 2N1VA 4M8NA 1SGHA 5TR5A 2KJRA 4MH0E 3A4RA 4B95A 2L05A 1UBIA 3DOWA 2Y5BB 4MJSB 2JY6A 4GDKB 2N1WA 4K81A 1BT0A 1WX7A 1YX5B 4HLEA 3M3JA 2BGFA 2MW5A 3B08A 3B1LX 2DENB 3N30A 4W9LA 4ZDVA 3QX1A 3RZWC 4AP4C 2L8JA 3VTUA 2FNJB 4WWOA 4BKSD 5CX3A 1IPGA 2N9EB 3KYDD 3U8ZA 4E3CA 3CF6E 2JRIB 1FXTB 3UIPB 3ZRFA 2RD0A 2YLMA 2DYOA 4JQWC 2KO3A 2KC1A 3NY5A 2KHWB 3H7PA 3WALA 4FADA 2JZZA 4X57B 3X23A 3CSFA 1V6EA 3EHVA 2LD9A 2IO0B 1V80A 2XEWA 3KYCD 2M17A 2BYVE 1GC6A 4W9IA 2J0KA 3R66C 1YJ1A 2EMSA 1SE9A 3KW5B 4EZLA 2Z0DB 4A3OA 1WMHA 1WZ3A 3QC8B 3DBLI 4G3XB 2HJ8A 2L0FA 2C7MB 1RFAA 1P3QU 3Q3JA 3QQ8B 4FJVB 3HM6X 5AZHA 1ISNA 5AEKB 3NS8A 4EUTA 3R7QA 4W9CA 1WX9A 2LGDA 3T9LA 5CHFA 1WJ6A 5LLIA 3H6NA 5LXHA 2BPSA 3K9PB 1WJUA 2KMAA 4W9JA 4HWIB 3TIXA 3W1YA 3QA8A 2KX0A 3APDA 2B3AA 3NHEB 2KQ7A 2O2VA 3IG3A 4DBGA 4KSLC 2PEAA 3KVFB 3KUCB 2M1MA 3ZW3A 3V61A 2V4LA 4NQLB 3PREA 4B9KA 2R2OA 2KWCA 1U4AA 3H7PB 3LDZE 4FBJB 2HD5B 3TBLD 4ANUA 2GBMA 2JT4B 3QHTA 4GMVA 2N7DA 5G55A 5BO4B 3DPDA 2CHZA 1VD2A 2C60A 2NR2A 3GOEA 4LDTD 5D2MB 2Z0EB 3QWZB 4OVUA 2DYBA 2G45B 1WE7A 1WZ0A 1AARA 3L08A 1WMHB 3PPAA 3SDLC 3A9KA 1NBFC 2EMTA 1ZW7A 2LVOA 2ZPYA 1GG3A 3PLVA 4W9GA 2L76A 1WF9A 2KDFB 2REXA 4ASWC 2DHZA 4ZYNA 4GXBA 5JHBA 1VCBA 2IYDB 2KFKA 4GOCA 4BBNC 1P1AA 4EEWA 1HE8A 2KWUB 2AYOB 2O6VA 1SIFA 3L13A 1NDDA 5J18A 1WXVA 2IZVB 2JWZA 3DVNU 1WX8A 1MG8A 4F7ZA 4HXDA 2KDEB 1JRUA 3IFWB 4KDIC 3OAWA 4BOZB 3VQIA 4TQ1A 4CYEA 1P9DU 1WRDB 4FLHA 3WAPA 2V3SA 2KN5A 5J2RA 1OTRB 2BKRB 3AXCA 3H9DA 2ZVNA 1G6JA 2MBHA 4NQKE 1ZKHA 2DZJA 2OJRA 1KLVA 2AL6A 3ZO5B 1IYFA 1EF5A 4KZCA 1WE6A 1UELA 4JIOU 1E8WA 2DZKA 3KUZA 2YVCA 2EKEC 4E74A 1WJNA 2DZMA 2J7QB 2KLGA 2KXJA 2K8BA 4CO7A 1V5OA 3UIOB 3A9KB 2DX5B 2KMCA 1TTNA 2ZNVB 4G11A 5GMVA 2KFJA 2IBIB 4ICUA 4MDKE 4I6LB 3U7DA 2PE9A 5IAAC 1WGGA 2KFKB 4GGQA 2ZCBA 4NJ6A 2KX3A 5E6NA 3OJ3A 4FN2A 4II2B 2O6VB 1EO6A 3VAWA 1XQQA 4MM3A 2KKCA 4HCPB 2LASA 5DCNA 2HE7A 3PHWB 5DPSA 3PLUA 3T8MA 1WR1A 4IM3A 4WJNA 1WGHA 2MCNB 3HM3A 3IBEA 4MGYE 4BFRA 2HTHA 3B0AA 3PSEB 1WM3A 2M0XA 2C5LC 3V60A 2FCNA 2G4SA 1WGDA 2NBWB 1UZXB 4URKA 1M94A 4I6NB 3ZVVA 4W9FA 1WGYA 2K8CA 2NS5A 4MSQB 3PV1A 2DAJA 2CR5A 3PRMB 2IY1B 4MGZE 3TMPB 4I6PA 1IP9A 1GC7A 1C3TA 4MSMB 2WYQA 3PGEA 1UD7A 3NOBA 4K7WA 2JPHA 1K8RB 2KJHB 2R2QA 4TV3A 3JSVB 4K7SA 3X0WA 2N4FA 2FUHB 4W9DA 1J19A 4BBNF 4JL9A 4KZ0A 3HIZA 3JW0X 2IO1B 4FJYA 2DYMA 4KVGB 4A3PA 1YQBA 2KD0A 3VUXA 2K1FA 3DVGY 2KWVB 4GIVA 3OJ4B 4M0WB 5CHWA 2PE6B 3ZLZA 1WH3A 4DHJB 1OEYJ 1YIWA 2GBNA 2KC2A 1WXAA 2NPTB 3VTVA 2PPHA 3P2BA 1V81A 3QCAA 4MEMA 2ZCCA 1ZGUB 2GBRA 5AZGA 4J6IA 4LCDE 1V49A 2GBKA 2AEHA 4MGIE 2LWPA 4WJQA 4PS8A 5JH5C 3O65B 5D6JB 1XD3B 2FCSA 2CHXA 2MP2A 3MHSD 3WA0A 3ML9A 1KJTA 2JZ3B 2O6VD 1TZ1A 4W9HA 2BYFA 1D3ZA 3K9OB 3L54A 5G2NA 4BKGA 4KDLB 2BKFA 2K25A 4F1SA 3APFA 4JLCA 1TGZB 4FHKA 2FIFA 4ZRKA 3SD5A 3ZNGC 4DDID 5DPWA 2K8HA 1CMXB 2KTFA 4PS7A 5IA7A 1I35A 2KJ6A 2MBBB 2LRWA 3UQBA 4DDGD 3AULA 3QAQA 2MBEA 3PRPB 3RT3B 3VFKA 4HVBA 3EFUA 4FJZA 2BWES 2KDIA 4IWPA 5DPTA 2RGFA 1S1QB 1E7UA 2XK5B 3MJWA 2L00B 2KTRA 2WDTB 2K6DB 4AOFA 2VRRB 1I42A 4ICVA 3ZRCA 4W9KA 4FULA 3ZTDA 1E5WA 2MBQA 1LXDA 2KVRA 2D2QA 2DZIA 3R3MA 1WM2A 3ZTCA 5J17A 2C7NB 3HK0A 4PYZA 3DCGA 3WAMA 1WI0A 4DWFA 4FA6A 2K39A 2FCQA 2KZRA 4GU2A 4NJ7A 2W9NA 2LRUA 2LGYA 2A5UA 2IY0B 1YX6B 3QIJA 3WANA 3CSTA 4BKTA 1UBQA 3W1SC 3PRZA 2MP2B 4KSKC 2LI5A 4ZRIA 3UINB 1F9JA 1OQYA 2ZZPB 3C0RB 3V6CB 3M63B 1GJZA 2J0JA 1J8CA 1R4MI 1H4RA 4K7UA 3M62B 3Q3FA 3A9JB 4DK5A 2MA9B 4DHJD 4RMAA 1EUVB 4HPMB 3MTNB 5D94A 1WXMA 4GSWA 1C1YB 2KTRB 3NZUA 4WQOB 1L7YA 1Q1OA 1L2NA 3HHMA 1LM8B 1LFDA 1RLFA 3JSVA 2KK8A 2BWFA 4BVUC 1E8YA 3EECA 3N3KB 3V6EB 1XT9B 4ANWA 1P0RA 4IWOA 4NAWA 4NPNA 5E6PA 4IM2A 3PVLA 5E6OA 1PQSA 1OGWA 3OLMD 4KV2A 4AWJA 4EFOA 4EZKA 3ZNZB 1KM7A 3M95A 1P98A 2KQSA 3RUIB 3UQAA 3JVZX 5AZFA 2LJ5A 2N7EA 3DBRI 3JYUA 2NBUA 4GDLA 4WWPA 1H8CA 2NPTA 3ZDMC 4EZJA 1WYWB 4ANVA 4IM0A 4WJOA 2WX0A 4ZRJA 3TJPA 3VDZA 3SU8X 1YD8U 4JGHB 3VUYA 2ZVOA 2C7HA 2I1JA 3TCAA 4FHJA 1EF1A 3VH4B 3QJZA 3L17A 3V62A 2LUEA 2QHOA 2RSUA 3APCA 2D10A 3VXWA 3ZDTA 4F8CB 2UWQA 3DVNV 2KOXA 3VVWB 4CHKA 4KIKA 5C1ZA 3VH3B 1V86A 4LDTB 1QZEA 2IO2B 3ENEA 3U30A 1RRBA 2M8SA 4IUMB 2MX2A 2GBJA 4M8MA 1V2YA 5FR6A 1Z2MA 2XK5A 2Z59B 2L7RA 1Z5SB 3IVFA 2IO3B 2CS4A 1E8ZA 4LJOB 3IHPC 4NAWB 2C9WB 2PJHA 4HDOA 4TUUA 4XX5A 2KANA 3VTWA 1S3SG 4P7IA 3H1UA 4DHZE 3ZUNA 3N32A 4EOYA 2AL3A 4GDLB 5KHQA 2LVPA 3ZKJC 2MLBA 4DHZB 2M4NA 5HKHA 2XBBC 4W9EA 1Y8RC 2GMIC 2OOBB 3RYTA 2LVQA 4N9F4 3A4SC 3W1SA 1V9JA 4BKSA 1J0GA 2CHWA 3RCZA 3PT2B 2UYZB 3RD2A 3R7RA 3WAOA 5CTRC 1E90A 2D3GA 4NY0A 2D07B 2KLCA 2K6QA 4YL8A 2ZPNA 3A33B 5L83A 4KIKB 4IW0A 3PTFC 3RULA 4XC2A 3KUDB 3KH0A 2JUOA 4IC7B 2J0MA 3A9JA 1UGMA 3VUWA 1Q0WB 3ZIMA 2RR9A 2WX1A 4PS3A 4RM9A 4GB9A 2BYEA 2JF5A 4E71A 3UGBB 3ECIA 3LJ3A 2NCNA 1T0YA 3DBHI 1TBEA 1WR6E 1WXSA 3L0WB 2FCMA 3DDCB 4PYUA 1E7VA 3VHTC 3ZNID 3AI5A 4GN1A 2DAFA 2KNBA 4ANXA 4K1RB 2MBOA 2NVUI 3A1QA 2WWZA 2GOWA 2N9XA 4A20A 3PHXB 1KOTA 1V5TA 2LZ6A 4LJPB 4MELA 5KHOA 5CHVC 3QK0A 3AU4A 1A5RA 3H7SA 3CMMB 4HPLB 3WIMA 2FAZA 2JRHA 3DBSA 4MGKE 4II3B 3DVGX 2A4ZA 3QARA 2FIDA 4IWQA 4EKUA 5JZEB 2MSED 4HK2A 1WY8A 2N9PC 4OVVA 4TKNA 2L0TA 2LXAA 4G0NB 2RPQA 1LQBA 2JXXA 2MQJA 4NNJB 1WIAA 4BOSC 5D7GA 4DXAB 5L95C 2LXCA 1R4NI 3BY4B 4MJSA 3DQVA 4GDKA 3ZNHB 4WWNA 3PZDA 1NI2A 4RM8A 2ZJDA 4WJPA 2NBVB 3PS6A 3ML8A 1X1MA 2G3QB 2KDBA 3UF8A 2V1YA 2O2VB 4WAAA 2ZEQA 1WJ4A 3ALBA 3GZNI 3SHQA 4AJWA 2BF8B 2G4DB 4G50A 1GUAB 1E8XA 5DPRA 1OEYA 5JHAA 1Q5WB 2CU1A 3S2AA 4IG7B 2L3ZA 2CKHB 3A1QB 1WFYA 4AJYB 2I1KA 4TQ0A 5EDSA 5LXIB 3RZFA 4HJKA 2LGXA 3NZSA 1UH6A 4B6WA 4XZ4A 2ASQA 1RAXA 3L10B 2MRPA 3EC8A 2JVCA 4HDQA
chains in the Genus database with same CATH superfamily
3TL5A 3AE2B 5C23A 1TJEA 1BMLC 2WXLA 3IXSA 1E9MA 2QC8A 3I3TB 2AWTA 4M8NA 4A6QA 2L05A 1UBIA 3DOWA 4NZLB 1SJHD 1V97A 2N1WA 4K81A 3ZGZA 2WXGA 4S17A 5EE1A 2BGFA 3B08A 1IBXA 3B1LX 2DENB 3MC0B 3P4RB 4YTNB 4ZHOA 5CX3A 1IPGA 3KYDD 3CF6E 1FXTB 3UIPB 3ZRFA 4HKQA 2DYOA 4REZA 3AH7A 4JQWC 2KC1A 3NY5A 3RMKC 2XN9C 3CSFA 3EHVA 2JX5A 2IO0B 2XEWA 3KYCD 3DBRB 2BYVE 1GC6A 4W9IA 2EMSA 1FCLA 4EZLA 1WMHA 3ZXVA 2X8XX 2HJ8A 1RFAA 4MM3B 1P3QU 3Q3JA 4FJVB 1JRPA 5AEKB 1TT5B 1AYFA 3R7QA 4W9CA 2LGDA 3H6NA 2INDC 4LLGM 3K9PB 2MJEA 2KQ7A 2O2VA 3FILA 1OQQA 1FXIA 2PEAA 2M1MA 3V61A 3PREA 4B9KA 3DWMA 2WXQA 4RH6A 4ANUA 2HTME 1N6ZA 4RGNA 1AW7A 2C60A 2Z0EB 4OVUA 1ESFA 3PPAA 1QKZA 3A9KA 2EMTA 2LFIA 2LVOA 1GG3A 2REXA 1YJJA 1L0VB 4ASWC 5JHBA 2WDQB 3BIID 4A8XC 5IOIA 1HE8A 3VRBB 2O6VA 1RYJA 3DVNU 3LB8C 1TY2A 1YJIA 4HXDA 1NEKB 3IFWB 1K52A 1N63A 4KDIC 3VQIA 1P9DU 1WRDB 4FLHA 2V3SA 5J2RA 3AXCA 3IAS1 1G6JA 3Q3NC 3H8HA 3VR9B 2DZJA 2OJRA 1KLVA 1IYFA 1EF5A 1E8WA 4RF0A 2J42A 1T0SC 2J7QB 1UWMA 3U7DA 2W3RA 2BB6A 2KFKB 3BK2A 2WU5B 4JPSA 3Q8EA 3T8MA 2E6XA 2MCNB 1KLUD 4MGYE 4BFRA 2BVCA 2M0XA 1M94A 4I6NB 3ZVVA 2NS5A 5FK9C 4MSQB 3PV1A 2CR5A 2DNFA 2IY1B 3PRMB 4MGZE 3TMPB 1C3TA 3U2SC 2KVZA 2WYQA 4ARCA 4P1CC 1K8RB 2R2QA 3AEGB 3I5JC 3JSVB 2N4FA 1EM7A 3HIZA 5G5HA 2IO1B 4A3PA 3P1MA 3DVGY 3OJ4B 4M0WB 2PE6B 4DHJB 1WXQA 3VTVA 1JMLA 3QCAA 4RNAA 2GBKA 3AEAB 4WJQA 4PS8A 5JH5C 3O65B 5D6JB 2FCSA 2KAJA 1QOBA 1P7EA 1TZ1A 2O6VD 2BYFA 1I4XA 3RI7C 2BKFA 2K25A 4JLCA 3BZDB 4DDID 2PVOD 4NJCA 3VFKA 4WWMA 1S1QB 2LHDA 1I42A 1D5ZC 4HPPA 3ZRCA 1BUIC 1E5WA 1C4PA 1WM2A 3ZTCA 4DWFA 2IGDA 2VH2A 1DGJA 1SJED 4LNFA 3UI3A 2KQ4X 4EE2A 2LGYA 1YX6B 1CZPA 4BKTA 4ZYSA 3I63C 3PRZA 1XEEA 4ZRIA 1QLBB 1T0QC 3UINB 1GB1A 2PVGC 3V6CB 2BS3B 1M4VA 1PFDA 4DK5A 2MA9B 4A55A 1PGBA 2IGHA 2Z8LA 1WXMA 4OVZA 1C1YB 1E0ZA 2KTRB 3NZUA 4WQOB 1Q1OA 3FAHA 1K51A 2W54A 1MG4A 4IKGA 2WHIA 4ANWA 1P0RA 4IWOA 4IM2A 3PVLA 4AWJA 1PQSA 4KV2A 3M95A 1P98A 2KQSA 3RUIB 3JVZX 5AZFA 2WGSA 2NTSA 2ONQA 4GDLA 1RWSA 2NPTA 3T3NA 1ZPSA 1SEBD 4WJOA 3TJPA 1N62A 3SU8X 1GAQB 1ET6A 1OFFA 3AB5A 1FMAD 3NS1A 2ICIA 3TCAA 4FHJA 3L17A 1R4MB 2LUEA 2QHOA 1VZ7A 5BYQA 4F8CB 1V86A 4LDTB 1RRBA 2MX2A 2IDYA 4M8MA 1Z2MA 2XK5A 4HEA1 1K50A 4S0RA 1E8ZA 3J9CA 2C9WB 4K3BA 4N6EB 1IGCA 2JZPA 1AN8A 3ZUNA 4EOYA 3TEYA 1L0YB 2FUG1 2M4NA 2XBBC 2GMIC 2AQ3B 3RYTA 1VDVA 1V9JA 4BKSA 1J0GA 2CHWA 1ZDXA 2UYZB 2M19A 2SEBD 2WXJA 2Y5PA 2V9HA 2D07B 2DWQA 3N1XC 1IGDA 1F2RI 1T6BX 3KH0A 4IC7B 5IKCM 1UGMA 4RM9A 4HJGE 3ECIA 1T0YA 3DBHI 3L0WB 2PLPA 3DDCB 5LNK1 4GN1A 1DOIA 2KNBA 3R2IA 3ZYYX 4XGAB 3AU4A 2D3BA 2K22A 4HPLB 3DBSA 2WQYB 4II3B 2A4ZA 1GB4A 2FIDA 4IWQA 4C4VB 4TKNA 1SF0A 2LXAA 2MEKA 3AEDB 1LQBA 5D7GA 4DXAB 5L95C 4RM8A 1PYWD 2NBVB 3N9YC 2G3QB 3UF8A 2V1YA 1WJ4A 3GZNI 4AJWA 2GB1A 1Q5WB 3KLSX 2CKHB 1WFYA 5EDSA 3RZFA 1UH6A 4B6WA 1TY0A 2ASQA 4HDQA 3BINA 1YNTE 3AE1B 4AUQC 5D3IB 4HCNB 2SAKA 3AU5A 2VZKB 1WGRA 2N1VA 1SGHA 4YTMB 1KF6B 4B95A 1N5XA 4B0MA 4MJSB 2JY6A 4GDKB 3FKYA 1BT0A 1TS5A 2D5GA 4HLEA 2M56B 3LYYA 1FFVA 1SXTA 4W9LA 1E6EB 3QX1A 4LTUA 5BYRA 1PDXA 3GE8C 4WWOA 4BKSD 1D6EC 3OWEB 1UGJA 3PZ8A 3AEFB 4WURA 1TKGA 3W2DA 1F77A 2KO3A 4HROA 3WALA 4FADA 1HTQA 4A9AA 3NVYA 1XLQA 1XCQL 4TMAB 1FD6A 3EUB2 3R66C 1SE9A 4AS1A 4A3OA 1WZ3A 2QEJC 3LXFA 3DBLI 1TZOA 1WSPA 1T5XD 3RNFC 2L0FA 2WXIA 1TYGB 3HM6X 5AZHA 3AEBB 1SIJA 3NS8A 1V1PB 4C00A 1JWMD 1WJ6A 1WWTA 2KMAA 3HRDD 3TUOA 3AV8A 2B3AA 3NHEB 4US9A 1C77A 2V4LA 2R2OA 2I2YA 2HD5B 2N7DA 4DQOC 2INCC 3DPDA 2NR2A 1VD2A 4O1NA 3QWZB 2G45B 2VH1A 2YEPB 3L08A 4PK1A 3SDLC 3GB1A 2ZPYA 2OHFA 4ZYNA 2KFKA 1QOAA 4YXDB 1NDDA 3TEZA 5J18A 2IZVB 2KDEB 3TEXA 1PUTA 2N9LA 4TQ1A 1ZUD2 2LMCA 2BKRB 3RFZB 5C3JB 2MBHA 4N59A 1ZKHA 4NQKE 1F0ZA 4KZCA 2QCZA 4E74A 1SE2A 5HFYA 2K8BA 2V3PA 2KMCA 5GMVA 1VRAB 3RPFC 2IBIB 3BVMA 5E6JA 5E6NA 4FN2A 3VAWA 1EO6A 2RDBC 2LASA 5DCNA 1R4NB 2HE7A 3PHWB 3BWUD 4XDDA 3V05A 3IBEA 3ZJUA 2HTHA 3B0AA 3PSEB 3V60A 3WCQA 4URKA 2JWUA 4W9FA 1WGYA 2MH7A 2BT6A 3HVDA 1IP9A 3Q2AC 1UD7A 3NOBA 4K7WA 2WXOA 2KJHB 2WXMA 2WS3B 4K7SA 3X0WA 4W9DA 1J19A 4JL9A 1JWUD 3AMZA 3JW0X 5BYSA 2KD0A 2L52A 2KWVB 3Q8CA 4LK0M 4CQNA 2PPHA 2N0SB 1MJDA 1V49A 1QQRA 2AEHA 4MGIE 2LWPA 1I4PA 1XD3B 1DOXA 3ML9A 4W9HA 5G2NA 4BKGA 4KDLB 4F1SA 3AE3B 1TGZB 3SD5A 1I35A 2AQ1B 2Y3AA 1C78A 2NMQA 4DDGD 3QAQA 2MBEA 3PRPB 4HVBA 4P1BC 2BWES 4IWPA 5DPTA 1E7UA 2KTRA 1E7PB 4AOFA 2VRRB 4ICVA 4W9KA 1KLGD 3ZTDA 4XDCA 1VR9A 3R3MA 2K39A 4B0EA 2FCQA 2KZRA 2RDHA 4GU2A 4NJ7A 2LRUA 3NRZA 4YTPB 1L0XB 3CSTA 2WLBA 1T3QA 3W5VB 3BVZA 3C0RB 3M63B 5BMIA 1J8CA 1H4RA 2B76B 2WXRA 3C8YA 3M62B 4K7UA 4DHJD 2IJ0A 4HPMB 3DWGC 2CJNA 3ABVB 4OZBA 1L7YA 3HHMA 4M01A 2KK8A 1VZ8A 1T0RC 2BWFA 3V6EB 3P4SB 4NPNA 2WP9B 4YSYB 2WXKA 4EFOA 1OGWA 3FC4A 3ZNZB 2INPE 2PMVA 3DBRI 5HG2A 2K9XA 3JYUA 1H8CA 3ZDMC 4EZJA 1XF5L 1WYWB 4ZRJA 1TS2A 3MFGA 2C7HA 5BMGA 3VH4B 3V62A 3ZDTA 3APCA 3GP7A 2PKOA 3VH3B 1QZEA 2IO2B 3ENEA 2H89B 3U30A 2M8SA 2FBWB 1NENB 4BAXA 2RDGA 5GXGB 3AM9A 1Z5SB 1MHXA 2AQ2B 4LJOB 4NAWB 4HDOA 2KANA 3VTWA 1S3SG 2AL3A 1RM6C 2MJ3A 3ZKJC 4KGRA 4DHZB 2OOBB 2LVQA 2FE8A 1PGAA 3MC9A 2L83A 2MHJA 4H2AA 3RD2A 3WAOA 3KQ4A 4C4VA 3Q6BA 2D3GA 2KLCA 3AE9B 5L83A 4KIKB 1IBXB 3PTFC 2JUOA 3A9JA 4Q2JA 3MJ5A 4GB9A 3UGBB 2FCMA 4PYUA 1E7VA 3SEBA 3AI5A 1NI3A 4K1RB 4R3DA 3T3OA 1KOTA 1V5TA 1EU4A 2LZ6A 4LJPB 3PZ7A 3QK0A 4WIPA 1FPYA 1HZ5A 3WIMA 4QAYA 2JRHA 4ZRQA 5JZEB 2CU3A 2ZW1A 2N9PC 4LNOA 4G0NB 1JWAD 3U7ZA 2BW2A 2JXXA 4NNJB 1WIAA 3OG5A 2LXCA 4MJSA 4GDKA 1FIQA 1X1MA 1C9FA 2O2VB 1LO5D 2ZEQA 4HRSA 2J53A 1GUAB 1OEYA 3CWIA 4IG7B 2L3ZA 4TQ0A 5LXIB 2I1KA 4HJKA 1FNVA 4XZ4A 2CJOA 2JVCA 3CIRB 2MWSB 3V3XA 4OHJA 3VRAB 1FFUA 4MH8A 3A4RA 2WNMA 2Y5BB 1V1PA 1YX5B 1MVKA 3M3JA 2MW5A 3N30A 1SE4A 4AP4C 3AN1A 4HKZE 3VTUA 2FNJB 1QILA 1I7HA 4L2YA 1AWDA 4E3CA 3U8ZA 1WYGA 1NYQA 3Q8BA 3ZJTA 3VR8B 2JZZA 3X23A 2LD9A 3TEWA 1V80A 2M17A 1YJ1A 3KW5B 2Z0DB 4YSXB 2C7MB 3QQ8B 1ISNA 1P7FA 1EWCA 3BK1A 1WX9A 1ET9A 1WJUA 4W9JA 4HWIB 3TIXA 3QA8A 1EU3A 3IG3A 4DBGA 1XLPA 2V4IB 2JYEA 3KUCB 1VJKA 3Q8AA 1N61A 2KWCA 3TSSA 3H7PB 5EE9A 3LDZE 4RFBA 4FBJB 3TBLD 2JT4B 4GMVA 5G55A 2CHZA 2WDRB 4PT5A 2DYBA 1WE7A 1AARA 4US8A 4W9GA 3PLVA 5FR3A 2L76A 5H92C 2WXHA 4GXBA 1VCBA 2IYDB 3EFCA 3AECB 3BYYB 3AEEB 1P1AA 4EEWA 3DHGC 2AYOB 3L13A 3R8BA 1WXVA 5MPOA 1WX8A 4F7ZA 1JRUA 2IPKD 3OAWA 4BOZB 3WAPA 1NYRA 4WAFA 1FNUA 2KN5A 1MHHE 3ETRA 2ZVNA 3GS2A 2N7JA 1WE6A 1UELA 4JIOU 5AUIA 3KUZA 1WJNA 1ZDVA 3UIOB 1XLOA 2DX5B 1XCTL 2KFJA 4I6LB 3U4EG 4A90A 2PE9A 3NZ3A 4GGQA 2ZCBA 4NJ6A 2KX3A 2BS4B 4II2B 1V1OA 4MM3A 2KKCA 4HCPB 3PLUA 1WR1A 1ENFA 4IM3A 1ZE3D 1WGHA 3HM3A 1KTKA 1MI0A 2QJLA 1CJEA 1WM3A 4KGTA 2FCNA 1WGDA 1UZXB 4JWSC 3AE4B 2W3SA 2K8CA 2DAJA 4WQMA 1HA5A 4GLSC 2JU6X 1L4ZB 1XXGA 2EELA 4MSMB 4ZRPA 4UDUC 2INNE 3PGEA 2YEPF 2JPHA 2JYTA 4TSSA 4TV3A 2N9KA 2FUHB 2MJDA 1XO3A 5IP4D 3AE7B 4KZ0A 3IT6B 1YQ3B 4C7ZA 1HXYD 1J7BA 2DYMA 1YQBA 3VUXA 4GIVA 2QIEB 5CHWA 3ZLZA 2KMMA 1ACCA 1OEYJ 2GBNA 4KGSA 2D3AA 2GRIA 2NPTB 2W55A 2KWDA 1ZGUB 2GBRA 4ZOHC 2IGGA 2J4XA 3Q14C 3WA0A 4RGMA 2JZ3B 1ZXIA 2QDFA 3K9OB 3L54A 1FRDA 1IUEA 3ZXRA 4FHKA 3ZNGC 5DPWA 5IA7A 2KTFA 2KJ6A 3UQBA 2LRWA 3RT3B 1TIFA 1A5RA 3EFUA 2KDIA 2RGFA 1JWSD 2XK5B 3MJWA 1QOFA 1HZ6A 1YMHE 1C76A 4FULA 2MBQA 1LXDA 2AX5A 2D2QA 5H8YE 2DZIA 5J17A 1QF6A 2C7NB 2RMMA 3DCGA 4FA6A 4KX6B 2NTTA 5I4DA 2W9NA 3R2TA 2IY0B 2KYWA 1UBQA 3W1SC 2MP2B 4JX1C 4KSKC 2LI5A 2BB5A 2KN4A 3KWVA 3IAM1 1A70A 1GJZA 1ZOYB 1V8CA 4RMAA 3NVVA 3BYTB 5EE3A 1L2NA 1NVID 1LM8B 1LFDA 3JSVA 1TS3A 3N3KB 1MPEA 3I57A 4ACFA 3NJTA 4NAWA 1ZXHA 5E6PA 5E6OA 4M0WA 5FKAC 1YN3A 2LJ5A 2N7EA 4WWPA 3L4PA 1D4BA 2WX0A 3VDZA 2Q5WD 1YD8U 4JGHB 2ZVOA 1EF1A 4D2KA 1J7AA 2RSUA 4WH4A 2D10A 2UWQA 3DVNV 2KOXA 5JXVA 4KIKA 4IUMB 2WU2B 3P42A 2GBJA 3E9SA 4XE0A 1V2YA 3AE6B 3IVFA 3SR6A 1JQ4A 2WXPA 2CS4A 5BMHA 4XX5A 3Q8FA 3H1UA 4N58A 1QT9A 4L23A 2LVPA 4M00A 3URYA 1Y8RC 4USAA 4RF1A 3PT2B 5CTRC 1UUPA 1C79A 2PTLA 4NY0A 2K6QA 4YL8A 3P63A 1WRIA 5HHDG 2RR9A 4PS3A 2JF5A 4E71A 1KFYB 1TBEA 1WR6E 3VHTC 3ZNID 2LGIA 2NVUI 4C56C 3PO0A 1FNWA 1JALA 1DYQA 2FAZA 4RGOS 2QILA 3DVGX 4EKUA 2MSED 1WY8A 2RPQA 1GPXA 1J7CA 2MQJA 4BOSC 1R4NI 1F2RC 4WWNA 2L32A 3PZDA 1NI2A 2R61A 2J52A 2DBYA 2K0PA 1JCKB 3ALBA 4C7YA 2BF8B 2G4DB 4G50A 3S2AA 4AJYB 3A1QB 3RN9C 3NUHB 2LGXA 3RNBC 1L5PA 1RAXA 3L10B 5D3DA 4DXFA 3EC8A 2QMTA 3D32A 2D11A 3L16A 2ZNVC 1GNUA 3ONSA 5TR5A 2KJRA 4MH0E 2D3CA 1C4AA 1DOYA 1WX7A 1K53A 3RNCC 2G9HD 3IT4B 4ZDVA 3RZWC 1EWYC 2L8JA 3RNEC 1I4HA 1I4RA 1SBBB 2N9EB 2PW9A 1YQ4B 2OJWA 4YT0B 2JRIB 1B1ZA 2W82A 4YSZB 2RD0A 2YLMA 4MACA 2HJ1A 2KHWB 3H7PA 2BTEA 1I4GA 4X57B 1YN5A 1V6EA 1HEZE 1YOVB 2J0KA 1UF0A 2GLSA 3QC8B 4G3XB 2BBCA 1SSNA 4EUTA 5IN7A 1TKYA 2XNAC 3T9LA 4BZAA 2UU7A 5CHFA 1FEHA 1R7SA 4FXCA 5LLIA 4ZHPA 5LXHA 2BPSA 4L1BA 1SB3C 3W1YA 1OQRA 2KX0A 3APDA 4IDIA 1KRHA 4KSLC 3KVFB 4IOIE 3ZW3A 4NQLB 3SFEB 2H88B 1U4AA 3P4QB 1WGKA 2GBMA 3QHTA 2BYTA 5BO4B 2K5PA 3GOEA 4LDTD 5D2MB 5HI1A 1WZ0A 2X38A 1WMHB 3Q3MC 1NBFC 1ZW7A 1WF9A 2KDFB 2DHZA 3W9CB 4GOCA 4BBNC 5IO9A 2KWUB 1SIFA 4J3OD 1B9RA 2GI9A 1MFWA 2JWZA 1MG8A 1JROA 2KT7A 3FILB 1JWBD 4CYEA 2WDVB 3DBHB 3RNAC 1FO4A 2OEDA 1OTRB 3H9DA 4DXGA 3NVZA 3DHHC 3N20C 4RGTA 4C80A 4MT5A 2AL6A 3ZO5B 2WXFA 2DZKA 2YVCA 2EKEC 2DZMA 2KXJA 2KLGA 1CK1A 4CO7A 1V5OA 3A9KB 1TTNA 2ZNVB 4G11A 1L4DB 4ARIA 4ICUA 4MDKE 5IAAC 1WGGA 2LGSA 3OJ3A 2O6VB 1FXAA 1XQQA 3B2GA 5DPSA 4WJNA 4XWWA 3GZNB 4ITKA 2C5LC 2G4SA 2NBWB 1TS4A 3MHZA 1CQVA 3EGRA 4I6PA 1FM0D 2E3TA 1GC7A 3B9JA 1C4CA 3AE5B 4KKJA 1L6UA 2JXTA 1BXTA 3HVZA 3O13A 3NG0A 2KACA 3BVGA 1D5XC 4BBNF 1N5WA 4LNKA 4FJYA 4KVGB 2I38A 1HTOA 1SE3A 2M0AA 2K1FA 4KKIA 3N1YC 1WH3A 1N60A 4YWGG 1YIWA 2KC2A 1WXAA 2PIAA 3P2BA 1V81A 4MEMA 2ZCCA 5AZGA 4J6IA 4LCDE 3I9V1 2VZKD 2CHXA 2MP2A 3MHSD 1KJTA 4LNIA 2LJIA 1D3ZA 2Y5CA 1D5MC 3APFA 2FIFA 4ZRKA 2V0GA 2K8HA 1CMXB 3B2FA 4PS7A 1VZ6A 2MBBB 3W5UB 3AULA 4FJZA 3DBLB 3Q69A 2L00B 2WDTB 2K6DB 2LHEA 1ROEA 1GOZA 1Y56A 1TKEA 2KVRA 2L1AA 3KWLA 3HK0A 4PYZA 3WAMA 1WI0A 1STEA 2ON8A 4JWUC 1UWXA 2A5UA 2ACZB 2QSDA 3QIJA 3WANA 4NAMA 5AUKA 1F9JA 1OQYA 2ZZPB 3EA6A 1I4QA 2J0JA 1R4MI 4AQ7A 3Q3FA 3A9JB 2EKIA 1EUVB 3MTNB 5D94A 1KH0A 5G5GA 4GSWA 5EE0A 4JE3B 2LUMA 1RLFA 1Q10A 4BVUC 1E8YA 3EECA 1XT9B 5TSSA 3OLMD 4EZKA 1KM7A 1ZP0B 3UQAA 3NVWA 2NBUA 1F52A 3MC8A 4ANVA 3P4PB 4IM0A 1E10A 2G1EA 3VUYA 2I1JA 3QJZA 4RCOA 3VXWA 3DHIC 4K3CA 3VVWB 4CHKA 5C1ZA 1FCCC 2WXNA 2JQRB 5FR6A 2Z59B 2L7RA 1VLBA 2IO3B 3Q3OC 2DLBA 3IHPC 3SFDB 2PJHA 4TUUA 3HUIA 4P7IA 3ZQ4A 4DHZE 3N32A 3RNGC 4GDLB 5KHQA 2MLBA 5HKHA 4W9EA 3ZJVA 4LNNA 4N9F4 3A4SC 3W1SA 3RCZA 2LEKA 3R7RA 2BS2B 1E90A 1JW9D 2K3UA 2ZPNA 3A33B 3U52E 4XYCA 4IW0A 1UNSA 3RULA 3MP9A 4XC2A 3KUDB 2HDEA 2J0MA 2TSSA 3VUWA 1Q0WB 3ZIMA 2WX1A 4OW0A 2BYEA 2JSVX 3LJ3A 2NCNA 4XWTA 4P6VF 2BQQA 1WXSA 1PGXA 1YN4A 2DAFA 4ANXA 1LGRA 2MBOA 3A1QA 2WWZA 2GOWA 2N9XA 5C2TB 3PHXB 4A20A 3C19A 4MELA 5KHOA 1QOGA 5CHVC 5T8IA 2ZW0A 3H7SA 3GE3C 1RFKA 3CMMB 4MGKE 3N1ZC 3QARA 2KDMA 4HK2A 1FRRA 4OVVA 2L0TA 1HQRD 3BY4B 3DQVA 3ZNHB 4M02A 2ZJDA 4WJPA 1F1HA 2RPVA 3PS6A 3ML8A 2KDBA 4WAAA 3SHQA 4P16A 1E8XA 5DPRA 3AE8B 5JHAA 2CU1A 4OZCA 4OZAA 2V3NA 3NZSA 1XLNA 3E56A 2MRPA 1L6VA
chains in the Genus database with same CATH topology
3BINA 3TL5A 4AUQC 3D32A 2D11A 5C23A 3L16A 2MWSB 4HCNB 2ZNVC 3I3TB 1GNUA 3ONSA 3AU5A 2AWTA 1WGRA 2N1VA 4M8NA 1SGHA 5TR5A 2KJRA 4MH0E 3A4RA 4B95A 2L05A 1UBIA 3DOWA 2Y5BB 4MJSB 2JY6A 4GDKB 2N1WA 4K81A 1BT0A 1WX7A 1YX5B 4HLEA 3M3JA 2BGFA 2MW5A 3B08A 3B1LX 2DENB 3N30A 4W9LA 4ZDVA 3QX1A 3RZWC 4AP4C 2L8JA 3VTUA 2FNJB 4WWOA 4BKSD 5CX3A 1IPGA 2N9EB 3KYDD 3U8ZA 4E3CA 3CF6E 2JRIB 1FXTB 3UIPB 3ZRFA 2RD0A 2YLMA 2DYOA 4JQWC 2KO3A 2KC1A 3NY5A 2KHWB 3H7PA 3WALA 4FADA 2JZZA 4X57B 3X23A 3CSFA 1V6EA 3EHVA 2LD9A 2IO0B 1V80A 2XEWA 3KYCD 2M17A 2BYVE 1GC6A 4W9IA 2J0KA 3R66C 1YJ1A 2EMSA 1SE9A 3KW5B 4EZLA 2Z0DB 4A3OA 1WMHA 1WZ3A 3QC8B 3DBLI 4G3XB 2HJ8A 2L0FA 2C7MB 1RFAA 1P3QU 3Q3JA 3QQ8B 4FJVB 3HM6X 5AZHA 1ISNA 5AEKB 3NS8A 4EUTA 3R7QA 4W9CA 1WX9A 2LGDA 3T9LA 5CHFA 1WJ6A 5LLIA 3H6NA 5LXHA 2BPSA 3K9PB 1WJUA 2KMAA 4W9JA 4HWIB 3TIXA 3W1YA 3QA8A 2KX0A 3APDA 2B3AA 3NHEB 2KQ7A 2O2VA 3IG3A 4DBGA 4KSLC 2PEAA 3KVFB 3KUCB 2M1MA 3ZW3A 3V61A 2V4LA 4NQLB 3PREA 4B9KA 2R2OA 2KWCA 1U4AA 3H7PB 3LDZE 4FBJB 2HD5B 3TBLD 4ANUA 2GBMA 2JT4B 3QHTA 4GMVA 2N7DA 5G55A 5BO4B 3DPDA 2CHZA 1VD2A 2C60A 2NR2A 3GOEA 4LDTD 5D2MB 2Z0EB 3QWZB 4OVUA 2DYBA 2G45B 1WE7A 1WZ0A 1AARA 3L08A 1WMHB 3PPAA 3SDLC 3A9KA 1NBFC 2EMTA 1ZW7A 2LVOA 2ZPYA 1GG3A 3PLVA 4W9GA 2L76A 1WF9A 2KDFB 2REXA 4ASWC 2DHZA 4ZYNA 4GXBA 5JHBA 1VCBA 2IYDB 2KFKA 4GOCA 4BBNC 1P1AA 4EEWA 1HE8A 2KWUB 2AYOB 2O6VA 1SIFA 3L13A 1NDDA 5J18A 1WXVA 2IZVB 2JWZA 3DVNU 1WX8A 1MG8A 4F7ZA 4HXDA 2KDEB 1JRUA 3IFWB 4KDIC 3OAWA 4BOZB 3VQIA 4TQ1A 4CYEA 1P9DU 1WRDB 4FLHA 3WAPA 2V3SA 2KN5A 5J2RA 1OTRB 2BKRB 3AXCA 3H9DA 2ZVNA 1G6JA 2MBHA 4NQKE 1ZKHA 2DZJA 2OJRA 1KLVA 2AL6A 3ZO5B 1IYFA 1EF5A 4KZCA 1WE6A 1UELA 4JIOU 1E8WA 2DZKA 3KUZA 2YVCA 2EKEC 4E74A 1WJNA 2DZMA 2J7QB 2KLGA 2KXJA 2K8BA 4CO7A 1V5OA 3UIOB 3A9KB 2DX5B 2KMCA 1TTNA 2ZNVB 4G11A 5GMVA 2KFJA 2IBIB 4ICUA 4MDKE 4I6LB 3U7DA 2PE9A 5IAAC 1WGGA 2KFKB 4GGQA 2ZCBA 4NJ6A 2KX3A 5E6NA 3OJ3A 4FN2A 4II2B 2O6VB 1EO6A 3VAWA 1XQQA 4MM3A 2KKCA 4HCPB 2LASA 5DCNA 2HE7A 3PHWB 5DPSA 3PLUA 3T8MA 1WR1A 4IM3A 4WJNA 1WGHA 2MCNB 3HM3A 3IBEA 4MGYE 4BFRA 2HTHA 3B0AA 3PSEB 1WM3A 2M0XA 2C5LC 3V60A 2FCNA 2G4SA 1WGDA 2NBWB 1UZXB 4URKA 1M94A 4I6NB 3ZVVA 4W9FA 1WGYA 2K8CA 2NS5A 4MSQB 3PV1A 2DAJA 2CR5A 3PRMB 2IY1B 4MGZE 3TMPB 4I6PA 1IP9A 1GC7A 1C3TA 4MSMB 2WYQA 3PGEA 1UD7A 3NOBA 4K7WA 2JPHA 1K8RB 2KJHB 2R2QA 4TV3A 3JSVB 4K7SA 3X0WA 2N4FA 2FUHB 4W9DA 1J19A 4BBNF 4JL9A 4KZ0A 3HIZA 3JW0X 2IO1B 4FJYA 2DYMA 4KVGB 4A3PA 1YQBA 2KD0A 3VUXA 2K1FA 3DVGY 2KWVB 4GIVA 3OJ4B 4M0WB 5CHWA 2PE6B 3ZLZA 1WH3A 4DHJB 1OEYJ 1YIWA 2GBNA 2KC2A 1WXAA 2NPTB 3VTVA 2PPHA 3P2BA 1V81A 3QCAA 4MEMA 2ZCCA 1ZGUB 2GBRA 5AZGA 4J6IA 4LCDE 1V49A 2GBKA 2AEHA 4MGIE 2LWPA 4WJQA 4PS8A 5JH5C 3O65B 5D6JB 1XD3B 2FCSA 2CHXA 2MP2A 3MHSD 3WA0A 3ML9A 1KJTA 2JZ3B 2O6VD 1TZ1A 4W9HA 2BYFA 1D3ZA 3K9OB 3L54A 5G2NA 4BKGA 4KDLB 2BKFA 2K25A 4F1SA 3APFA 4JLCA 1TGZB 4FHKA 2FIFA 4ZRKA 3SD5A 3ZNGC 4DDID 5DPWA 2K8HA 1CMXB 2KTFA 4PS7A 5IA7A 1I35A 2KJ6A 2MBBB 2LRWA 3UQBA 4DDGD 3AULA 3QAQA 2MBEA 3PRPB 3RT3B 3VFKA 4HVBA 3EFUA 4FJZA 2BWES 2KDIA 4IWPA 5DPTA 2RGFA 1S1QB 1E7UA 2XK5B 3MJWA 2L00B 2KTRA 2WDTB 2K6DB 4AOFA 2VRRB 1I42A 4ICVA 3ZRCA 4W9KA 4FULA 3ZTDA 1E5WA 2MBQA 1LXDA 2KVRA 2D2QA 2DZIA 3R3MA 1WM2A 3ZTCA 5J17A 2C7NB 3HK0A 4PYZA 3DCGA 3WAMA 1WI0A 4DWFA 4FA6A 2K39A 2FCQA 2KZRA 4GU2A 4NJ7A 2W9NA 2LRUA 2LGYA 2A5UA 2IY0B 1YX6B 3QIJA 3WANA 3CSTA 4BKTA 1UBQA 3W1SC 3PRZA 2MP2B 4KSKC 2LI5A 4ZRIA 3UINB 1F9JA 1OQYA 2ZZPB 3C0RB 3V6CB 3M63B 1GJZA 2J0JA 1J8CA 1R4MI 1H4RA 4K7UA 3M62B 3Q3FA 3A9JB 4DK5A 2MA9B 4DHJD 4RMAA 1EUVB 4HPMB 3MTNB 5D94A 1WXMA 4GSWA 1C1YB 2KTRB 3NZUA 4WQOB 1L7YA 1Q1OA 1L2NA 3HHMA 1LM8B 1LFDA 1RLFA 3JSVA 2KK8A 2BWFA 4BVUC 1E8YA 3EECA 3N3KB 3V6EB 1XT9B 4ANWA 1P0RA 4IWOA 4NAWA 4NPNA 5E6PA 4IM2A 3PVLA 5E6OA 1PQSA 1OGWA 3OLMD 4KV2A 4AWJA 4EFOA 4EZKA 3ZNZB 1KM7A 3M95A 1P98A 2KQSA 3RUIB 3UQAA 3JVZX 5AZFA 2LJ5A 2N7EA 3DBRI 3JYUA 2NBUA 4GDLA 4WWPA 1H8CA 2NPTA 3ZDMC 4EZJA 1WYWB 4ANVA 4IM0A 4WJOA 2WX0A 4ZRJA 3TJPA 3VDZA 3SU8X 1YD8U 4JGHB 3VUYA 2ZVOA 2C7HA 2I1JA 3TCAA 4FHJA 1EF1A 3VH4B 3QJZA 3L17A 3V62A 2LUEA 2QHOA 2RSUA 3APCA 2D10A 3VXWA 3ZDTA 4F8CB 2UWQA 3DVNV 2KOXA 3VVWB 4CHKA 4KIKA 5C1ZA 3VH3B 1V86A 4LDTB 1QZEA 2IO2B 3ENEA 3U30A 1RRBA 2M8SA 4IUMB 2MX2A 2GBJA 4M8MA 1V2YA 5FR6A 1Z2MA 2XK5A 2Z59B 2L7RA 1Z5SB 3IVFA 2IO3B 2CS4A 1E8ZA 4LJOB 3IHPC 4NAWB 2C9WB 2PJHA 4HDOA 4TUUA 4XX5A 2KANA 3VTWA 1S3SG 4P7IA 3H1UA 4DHZE 3ZUNA 3N32A 4EOYA 2AL3A 4GDLB 5KHQA 2LVPA 3ZKJC 2MLBA 4DHZB 2M4NA 5HKHA 2XBBC 4W9EA 1Y8RC 2GMIC 2OOBB 3RYTA 2LVQA 4N9F4 3A4SC 3W1SA 1V9JA 4BKSA 1J0GA 2CHWA 3RCZA 3PT2B 2UYZB 3RD2A 3R7RA 3WAOA 5CTRC 1E90A 2D3GA 4NY0A 2D07B 2KLCA 2K6QA 4YL8A 2ZPNA 3A33B 5L83A 4KIKB 4IW0A 3PTFC 3RULA 4XC2A 3KUDB 3KH0A 2JUOA 4IC7B 2J0MA 3A9JA 1UGMA 3VUWA 1Q0WB 3ZIMA 2RR9A 2WX1A 4PS3A 4RM9A 4GB9A 2BYEA 2JF5A 4E71A 3UGBB 3ECIA 3LJ3A 2NCNA 1T0YA 3DBHI 1TBEA 1WR6E 1WXSA 3L0WB 2FCMA 3DDCB 4PYUA 1E7VA 3VHTC 3ZNID 3AI5A 4GN1A 2DAFA 2KNBA 4ANXA 4K1RB 2MBOA 2NVUI 3A1QA 2WWZA 2GOWA 2N9XA 4A20A 3PHXB 1KOTA 1V5TA 2LZ6A 4LJPB 4MELA 5KHOA 5CHVC 3QK0A 3AU4A 1A5RA 3H7SA 3CMMB 4HPLB 3WIMA 2FAZA 2JRHA 3DBSA 4MGKE 4II3B 3DVGX 2A4ZA 3QARA 2FIDA 4IWQA 4EKUA 5JZEB 2MSED 4HK2A 1WY8A 2N9PC 4OVVA 4TKNA 2L0TA 2LXAA 4G0NB 2RPQA 1LQBA 2JXXA 2MQJA 4NNJB 1WIAA 4BOSC 5D7GA 4DXAB 5L95C 2LXCA 1R4NI 3BY4B 4MJSA 3DQVA 4GDKA 3ZNHB 4WWNA 3PZDA 1NI2A 4RM8A 2ZJDA 4WJPA 2NBVB 3PS6A 3ML8A 1X1MA 2G3QB 2KDBA 3UF8A 2V1YA 2O2VB 4WAAA 2ZEQA 1WJ4A 3ALBA 3GZNI 3SHQA 4AJWA 2BF8B 2G4DB 4G50A 1GUAB 1E8XA 5DPRA 1OEYA 5JHAA 1Q5WB 2CU1A 3S2AA 4IG7B 2L3ZA 2CKHB 3A1QB 1WFYA 4AJYB 2I1KA 4TQ0A 5EDSA 5LXIB 3RZFA 4HJKA 2LGXA 3NZSA 1UH6A 4B6WA 4XZ4A 2ASQA 1RAXA 3L10B 2MRPA 3EC8A 2JVCA 4HDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BIN A;  3TL5 A;  4AUQ C;  3D32 A;  2D11 A;  5C23 A;  3L16 A;  2MWS B;  4HCN B;  2ZNV C;  3I3T B;  1GNU A;  3ONS A;  3AU5 A;  2AWT A;  1WGR A;  2N1V A;  4M8N A;  1SGH A;  5TR5 A;  2KJR A;  4MH0 E;  3A4R A;  4B95 A;  2L05 A;  1UBI A;  3DOW A;  2Y5B B;  4MJS B;  2JY6 A;  4GDK B;  2N1W A;  4K81 A;  1BT0 A;  1WX7 A;  1YX5 B;  4HLE A;  3M3J A;  2BGF A;  2MW5 A;  3B08 A;  3B1L X;  2DEN B;  3N30 A;  4W9L A;  4ZDV A;  3QX1 A;  3RZW C;  4AP4 C;  2L8J A;  3VTU A;  2FNJ B;  4WWO A;  4BKS D;  5CX3 A;  1IPG A;  2N9E B;  3KYD D;  3U8Z A;  4E3C A;  3CF6 E;  2JRI B;  1FXT B;  3UIP B;  3ZRF A;  2RD0 A;  2YLM A;  2DYO A;  4JQW C;  2KO3 A;  2KC1 A;  3NY5 A;  2KHW B;  3H7P A;  3WAL A;  4FAD A;  2JZZ A;  4X57 B;  3X23 A;  3CSF A;  1V6E A;  3EHV A;  2LD9 A;  2IO0 B;  1V80 A;  2XEW A;  3KYC D;  2M17 A;  2BYV E;  1GC6 A;  4W9I A;  2J0K A;  3R66 C;  1YJ1 A;  2EMS A;  1SE9 A;  3KW5 B;  4EZL A;  2Z0D B;  4A3O A;  1WMH A;  1WZ3 A;  3QC8 B;  3DBL I;  4G3X B;  2HJ8 A;  2L0F A;  2C7M B;  1RFA A;  1P3Q U;  3Q3J A;  3QQ8 B;  4FJV B;  3HM6 X;  5AZH A;  1ISN A;  5AEK B;  3NS8 A;  4EUT A;  3R7Q A;  4W9C A;  1WX9 A;  2LGD A;  3T9L A;  5CHF A;  1WJ6 A;  5LLI A;  3H6N A;  5LXH A;  2BPS A;  3K9P B;  1WJU A;  2KMA A;  4W9J A;  4HWI B;  3TIX A;  3W1Y A;  3QA8 A;  2KX0 A;  3APD A;  2B3A A;  3NHE B;  2KQ7 A;  2O2V A;  3IG3 A;  4DBG A;  4KSL C;  2PEA A;  3KVF B;  3KUC B;  2M1M A;  3ZW3 A;  3V61 A;  2V4L A;  4NQL B;  3PRE A;  4B9K A;  2R2O A;  2KWC A;  1U4A A;  3H7P B;  3LDZ E;  4FBJ B;  2HD5 B;  3TBL D;  4ANU A;  2GBM A;  2JT4 B;  3QHT A;  4GMV A;  2N7D A;  5G55 A;  5BO4 B;  3DPD A;  2CHZ A;  1VD2 A;  2C60 A;  2NR2 A;  3GOE A;  4LDT D;  5D2M B;  2Z0E B;  3QWZ B;  4OVU A;  2DYB A;  2G45 B;  1WE7 A;  1WZ0 A;  1AAR A;  3L08 A;  1WMH B;  3PPA A;  3SDL C;  3A9K A;  1NBF C;  2EMT A;  1ZW7 A;  2LVO A;  2ZPY A;  1GG3 A;  3PLV A;  4W9G A;  2L76 A;  1WF9 A;  2KDF B;  2REX A;  4ASW C;  2DHZ A;  4ZYN A;  4GXB A;  5JHB A;  1VCB A;  2IYD B;  2KFK A;  4GOC A;  4BBN C;  1P1A A;  4EEW A;  1HE8 A;  2KWU B;  2AYO B;  2O6V A;  1SIF A;  3L13 A;  1NDD A;  5J18 A;  1WXV A;  2IZV B;  2JWZ A;  3DVN U;  1WX8 A;  1MG8 A;  4F7Z A;  4HXD A;  2KDE B;  1JRU A;  3IFW B;  4KDI C;  3OAW A;  4BOZ B;  3VQI A;  4TQ1 A;  4CYE A;  1P9D U;  1WRD B;  4FLH A;  3WAP A;  2V3S A;  2KN5 A;  5J2R A;  1OTR B;  2BKR B;  3AXC A;  3H9D A;  2ZVN A;  1G6J A;  2MBH A;  4NQK E;  1ZKH A;  2DZJ A;  2OJR A;  1KLV A;  2AL6 A;  3ZO5 B;  1IYF A;  1EF5 A;  4KZC A;  1WE6 A;  1UEL A;  4JIO U;  1E8W A;  2DZK A;  3KUZ A;  2YVC A;  2EKE C;  4E74 A;  1WJN A;  2DZM A;  2J7Q B;  2KLG A;  2KXJ A;  2K8B A;  4CO7 A;  1V5O A;  3UIO B;  3A9K B;  2DX5 B;  2KMC A;  1TTN A;  2ZNV B;  4G11 A;  5GMV A;  2KFJ A;  2IBI B;  4ICU A;  4MDK E;  4I6L B;  3U7D A;  2PE9 A;  5IAA C;  1WGG A;  2KFK B;  4GGQ A;  2ZCB A;  4NJ6 A;  2KX3 A;  5E6N A;  3OJ3 A;  4FN2 A;  4II2 B;  2O6V B;  1EO6 A;  3VAW A;  1XQQ A;  4MM3 A;  2KKC A;  4HCP B;  2LAS A;  5DCN A;  2HE7 A;  3PHW B;  5DPS A;  3PLU A;  3T8M A;  1WR1 A;  4IM3 A;  4WJN A;  1WGH A;  2MCN B;  3HM3 A;  3IBE A;  4MGY E;  4BFR A;  2HTH A;  3B0A A;  3PSE B;  1WM3 A;  2M0X A;  2C5L C;  3V60 A;  2FCN A;  2G4S A;  1WGD A;  2NBW B;  1UZX B;  4URK A;  1M94 A;  4I6N B;  3ZVV A;  4W9F A;  1WGY A;  2K8C A;  2NS5 A;  4MSQ B;  3PV1 A;  2DAJ A;  2CR5 A;  3PRM B;  2IY1 B;  4MGZ E;  3TMP B;  4I6P A;  1IP9 A;  1GC7 A;  1C3T A;  4MSM B;  2WYQ A;  3PGE A;  1UD7 A;  3NOB A;  4K7W A;  2JPH A;  1K8R B;  2KJH B;  2R2Q A;  4TV3 A;  3JSV B;  4K7S A;  3X0W A;  2N4F A;  2FUH B;  4W9D A;  1J19 A;  4BBN F;  4JL9 A;  4KZ0 A;  3HIZ A;  3JW0 X;  2IO1 B;  4FJY A;  2DYM A;  4KVG B;  4A3P A;  1YQB A;  2KD0 A;  3VUX A;  2K1F A;  3DVG Y;  2KWV B;  4GIV A;  3OJ4 B;  4M0W B;  5CHW A;  2PE6 B;  3ZLZ A;  1WH3 A;  4DHJ B;  1OEY J;  1YIW A;  2GBN A;  2KC2 A;  1WXA A;  2NPT B;  3VTV A;  2PPH A;  3P2B A;  1V81 A;  3QCA A;  4MEM A;  2ZCC A;  1ZGU B;  2GBR A;  5AZG A;  4J6I A;  4LCD E;  1V49 A;  2GBK A;  2AEH A;  4MGI E;  2LWP A;  4WJQ A;  4PS8 A;  5JH5 C;  3O65 B;  5D6J B;  1XD3 B;  2FCS A;  2CHX A;  2MP2 A;  3MHS D;  3WA0 A;  3ML9 A;  1KJT A;  2JZ3 B;  2O6V D;  1TZ1 A;  4W9H A;  2BYF A;  1D3Z A;  3K9O B;  3L54 A;  5G2N A;  4BKG A;  4KDL B;  2BKF A;  2K25 A;  4F1S A;  3APF A;  4JLC A;  1TGZ B;  4FHK A;  2FIF A;  4ZRK A;  3SD5 A;  3ZNG C;  4DDI D;  5DPW A;  2K8H A;  1CMX B;  2KTF A;  4PS7 A;  5IA7 A;  1I35 A;  2KJ6 A;  2MBB B;  2LRW A;  3UQB A;  4DDG D;  3AUL A;  3QAQ A;  2MBE A;  3PRP B;  3RT3 B;  3VFK A;  4HVB A;  3EFU A;  4FJZ A;  2BWE S;  2KDI A;  4IWP A;  5DPT A;  2RGF A;  1S1Q B;  1E7U A;  2XK5 B;  3MJW A;  2L00 B;  2KTR A;  2WDT B;  2K6D B;  4AOF A;  2VRR B;  1I42 A;  4ICV A;  3ZRC A;  4W9K A;  4FUL A;  3ZTD A;  1E5W A;  2MBQ A;  1LXD A;  2KVR A;  2D2Q A;  2DZI A;  3R3M A;  1WM2 A;  3ZTC A;  5J17 A;  2C7N B;  3HK0 A;  4PYZ A;  3DCG A;  3WAM A;  1WI0 A;  4DWF A;  4FA6 A;  2K39 A;  2FCQ A;  2KZR A;  4GU2 A;  4NJ7 A;  2W9N A;  2LRU A;  2LGY A;  2A5U A;  2IY0 B;  1YX6 B;  3QIJ A;  3WAN A;  3CST A;  4BKT A;  1UBQ A;  3W1S C;  3PRZ A;  2MP2 B;  4KSK C;  2LI5 A;  4ZRI A;  3UIN B;  1F9J A;  1OQY A;  2ZZP B;  3C0R B;  3V6C B;  3M63 B;  1GJZ A;  2J0J A;  1J8C A;  1R4M I;  1H4R A;  4K7U A;  3M62 B;  3Q3F A;  3A9J B;  4DK5 A;  2MA9 B;  4DHJ D;  4RMA A;  1EUV B;  4HPM B;  3MTN B;  5D94 A;  1WXM A;  4GSW A;  1C1Y B;  2KTR B;  3NZU A;  4WQO B;  1L7Y A;  1Q1O A;  1L2N A;  3HHM A;  1LM8 B;  1LFD A;  1RLF A;  3JSV A;  2KK8 A;  2BWF A;  4BVU C;  1E8Y A;  3EEC A;  3N3K B;  3V6E B;  1XT9 B;  4ANW A;  1P0R A;  4IWO A;  4NAW A;  4NPN A;  5E6P A;  4IM2 A;  3PVL A;  5E6O A;  1PQS A;  1OGW A;  3OLM D;  4KV2 A;  4AWJ A;  4EFO A;  4EZK A;  3ZNZ B;  1KM7 A;  3M95 A;  1P98 A;  2KQS A;  3RUI B;  3UQA A;  3JVZ X;  5AZF A;  2LJ5 A;  2N7E A;  3DBR I;  3JYU A;  2NBU A;  4GDL A;  4WWP A;  1H8C A;  2NPT A;  3ZDM C;  4EZJ A;  1WYW B;  4ANV A;  4IM0 A;  4WJO A;  2WX0 A;  4ZRJ A;  3TJP A;  3VDZ A;  3SU8 X;  1YD8 U;  4JGH B;  3VUY A;  2ZVO A;  2C7H A;  2I1J A;  3TCA A;  4FHJ A;  1EF1 A;  3VH4 B;  3QJZ A;  3L17 A;  3V62 A;  2LUE A;  2QHO A;  2RSU A;  3APC A;  2D10 A;  3VXW A;  3ZDT A;  4F8C B;  2UWQ A;  3DVN V;  2KOX A;  3VVW B;  4CHK A;  4KIK A;  5C1Z A;  3VH3 B;  1V86 A;  4LDT B;  1QZE A;  2IO2 B;  3ENE A;  3U30 A;  1RRB A;  2M8S A;  4IUM B;  2MX2 A;  2GBJ A;  4M8M A;  1V2Y A;  5FR6 A;  1Z2M A;  2XK5 A;  2Z59 B;  2L7R A;  1Z5S B;  3IVF A;  2IO3 B;  2CS4 A;  1E8Z A;  4LJO B;  3IHP C;  4NAW B;  2C9W B;  2PJH A;  4HDO A;  4TUU A;  4XX5 A;  2KAN A;  3VTW A;  1S3S G;  4P7I A;  3H1U A;  4DHZ E;  3ZUN A;  3N32 A;  4EOY A;  2AL3 A;  4GDL B;  5KHQ A;  2LVP A;  3ZKJ C;  2MLB A;  4DHZ B;  2M4N A;  5HKH A;  2XBB C;  4W9E A;  1Y8R C;  2GMI C;  2OOB B;  3RYT A;  2LVQ A;  4N9F 4;  3A4S C;  3W1S A;  1V9J A;  4BKS A;  1J0G A;  2CHW A;  3RCZ A;  3PT2 B;  2UYZ B;  3RD2 A;  3R7R A;  3WAO A;  5CTR C;  1E90 A;  2D3G A;  4NY0 A;  2D07 B;  2KLC A;  2K6Q A;  4YL8 A;  2ZPN A;  3A33 B;  5L83 A;  4KIK B;  4IW0 A;  3PTF C;  3RUL A;  4XC2 A;  3KUD B;  3KH0 A;  2JUO A;  4IC7 B;  2J0M A;  3A9J A;  1UGM A;  3VUW A;  1Q0W B;  3ZIM A;  2RR9 A;  2WX1 A;  4PS3 A;  4RM9 A;  4GB9 A;  2BYE A;  2JF5 A;  4E71 A;  3UGB B;  3ECI A;  3LJ3 A;  2NCN A;  1T0Y A;  3DBH I;  1TBE A;  1WR6 E;  1WXS A;  3L0W B;  2FCM A;  3DDC B;  4PYU A;  1E7V A;  3VHT C;  3ZNI D;  3AI5 A;  4GN1 A;  2DAF A;  2KNB A;  4ANX A;  4K1R B;  2MBO A;  2NVU I;  3A1Q A;  2WWZ A;  2GOW A;  2N9X A;  4A20 A;  3PHX B;  1KOT A;  1V5T A;  2LZ6 A;  4LJP B;  4MEL A;  5KHO A;  5CHV C;  3QK0 A;  3AU4 A;  1A5R A;  3H7S A;  3CMM B;  4HPL B;  3WIM A;  2FAZ A;  2JRH A;  3DBS A;  4MGK E;  4II3 B;  3DVG X;  2A4Z A;  3QAR A;  2FID A;  4IWQ A;  4EKU A;  5JZE B;  2MSE D;  4HK2 A;  1WY8 A;  2N9P C;  4OVV A;  4TKN A;  2L0T A;  2LXA A;  4G0N B;  2RPQ A;  1LQB A;  2JXX A;  2MQJ A;  4NNJ B;  1WIA A;  4BOS C;  5D7G A;  4DXA B;  5L95 C;  2LXC A;  1R4N I;  3BY4 B;  4MJS A;  3DQV A;  4GDK A;  3ZNH B;  4WWN A;  3PZD A;  1NI2 A;  4RM8 A;  2ZJD A;  4WJP A;  2NBV B;  3PS6 A;  3ML8 A;  1X1M A;  2G3Q B;  2KDB A;  3UF8 A;  2V1Y A;  2O2V B;  4WAA A;  2ZEQ A;  1WJ4 A;  3ALB A;  3GZN I;  3SHQ A;  4AJW A;  2BF8 B;  2G4D B;  4G50 A;  1GUA B;  1E8X A;  5DPR A;  1OEY A;  5JHA A;  1Q5W B;  2CU1 A;  3S2A A;  4IG7 B;  2L3Z A;  2CKH B;  3A1Q B;  1WFY A;  4AJY B;  2I1K A;  4TQ0 A;  5EDS A;  5LXI B;  3RZF A;  4HJK A;  2LGX A;  3NZS A;  1UH6 A;  4B6W A;  4XZ4 A;  2ASQ A;  1RAX A;  3L10 B;  2MRP A;  3EC8 A;  2JVC A;  4HDQ A; 
#chains in the Genus database with same CATH topology
 3TL5 A;  3AE2 B;  5C23 A;  1TJE A;  1BML C;  2WXL A;  3IXS A;  1E9M A;  2QC8 A;  3I3T B;  2AWT A;  4M8N A;  4A6Q A;  2L05 A;  1UBI A;  3DOW A;  4NZL B;  1SJH D;  1V97 A;  2N1W A;  4K81 A;  3ZGZ A;  2WXG A;  4S17 A;  5EE1 A;  2BGF A;  3B08 A;  1IBX A;  3B1L X;  2DEN B;  3MC0 B;  3P4R B;  4YTN B;  4ZHO A;  5CX3 A;  1IPG A;  3KYD D;  3CF6 E;  1FXT B;  3UIP B;  3ZRF A;  4HKQ A;  2DYO A;  4REZ A;  3AH7 A;  4JQW C;  2KC1 A;  3NY5 A;  3RMK C;  2XN9 C;  3CSF A;  3EHV A;  2JX5 A;  2IO0 B;  2XEW A;  3KYC D;  3DBR B;  2BYV E;  1GC6 A;  4W9I A;  2EMS A;  1FCL A;  4EZL A;  1WMH A;  3ZXV A;  2X8X X;  2HJ8 A;  1RFA A;  4MM3 B;  1P3Q U;  3Q3J A;  4FJV B;  1JRP A;  5AEK B;  1TT5 B;  1AYF A;  3R7Q A;  4W9C A;  2LGD A;  3H6N A;  2IND C;  4LLG M;  3K9P B;  2MJE A;  2KQ7 A;  2O2V A;  3FIL A;  1OQQ A;  1FXI A;  2PEA A;  2M1M A;  3V61 A;  3PRE A;  4B9K A;  3DWM A;  2WXQ A;  4RH6 A;  4ANU A;  2HTM E;  1N6Z A;  4RGN A;  1AW7 A;  2C60 A;  2Z0E B;  4OVU A;  1ESF A;  3PPA A;  1QKZ A;  3A9K A;  2EMT A;  2LFI A;  2LVO A;  1GG3 A;  2REX A;  1YJJ A;  1L0V B;  4ASW C;  5JHB A;  2WDQ B;  3BII D;  4A8X C;  5IOI A;  1HE8 A;  3VRB B;  2O6V A;  1RYJ A;  3DVN U;  3LB8 C;  1TY2 A;  1YJI A;  4HXD A;  1NEK B;  3IFW B;  1K52 A;  1N63 A;  4KDI C;  3VQI A;  1P9D U;  1WRD B;  4FLH A;  2V3S A;  5J2R A;  3AXC A;  3IAS 1;  1G6J A;  3Q3N C;  3H8H A;  3VR9 B;  2DZJ A;  2OJR A;  1KLV A;  1IYF A;  1EF5 A;  1E8W A;  4RF0 A;  2J42 A;  1T0S C;  2J7Q B;  1UWM A;  3U7D A;  2W3R A;  2BB6 A;  2KFK B;  3BK2 A;  2WU5 B;  4JPS A;  3Q8E A;  3T8M A;  2E6X A;  2MCN B;  1KLU D;  4MGY E;  4BFR A;  2BVC A;  2M0X A;  1M94 A;  4I6N B;  3ZVV A;  2NS5 A;  5FK9 C;  4MSQ B;  3PV1 A;  2CR5 A;  2DNF A;  2IY1 B;  3PRM B;  4MGZ E;  3TMP B;  1C3T A;  3U2S C;  2KVZ A;  2WYQ A;  4ARC A;  4P1C C;  1K8R B;  2R2Q A;  3AEG B;  3I5J C;  3JSV B;  2N4F A;  1EM7 A;  3HIZ A;  5G5H A;  2IO1 B;  4A3P A;  3P1M A;  3DVG Y;  3OJ4 B;  4M0W B;  2PE6 B;  4DHJ B;  1WXQ A;  3VTV A;  1JML A;  3QCA A;  4RNA A;  2GBK A;  3AEA B;  4WJQ A;  4PS8 A;  5JH5 C;  3O65 B;  5D6J B;  2FCS A;  2KAJ A;  1QOB A;  1P7E A;  1TZ1 A;  2O6V D;  2BYF A;  1I4X A;  3RI7 C;  2BKF A;  2K25 A;  4JLC A;  3BZD B;  4DDI D;  2PVO D;  4NJC A;  3VFK A;  4WWM A;  1S1Q B;  2LHD A;  1I42 A;  1D5Z C;  4HPP A;  3ZRC A;  1BUI C;  1E5W A;  1C4P A;  1WM2 A;  3ZTC A;  4DWF A;  2IGD A;  2VH2 A;  1DGJ A;  1SJE D;  4LNF A;  3UI3 A;  2KQ4 X;  4EE2 A;  2LGY A;  1YX6 B;  1CZP A;  4BKT A;  4ZYS A;  3I63 C;  3PRZ A;  1XEE A;  4ZRI A;  1QLB B;  1T0Q C;  3UIN B;  1GB1 A;  2PVG C;  3V6C B;  2BS3 B;  1M4V A;  1PFD A;  4DK5 A;  2MA9 B;  4A55 A;  1PGB A;  2IGH A;  2Z8L A;  1WXM A;  4OVZ A;  1C1Y B;  1E0Z A;  2KTR B;  3NZU A;  4WQO B;  1Q1O A;  3FAH A;  1K51 A;  2W54 A;  1MG4 A;  4IKG A;  2WHI A;  4ANW A;  1P0R A;  4IWO A;  4IM2 A;  3PVL A;  4AWJ A;  1PQS A;  4KV2 A;  3M95 A;  1P98 A;  2KQS A;  3RUI B;  3JVZ X;  5AZF A;  2WGS A;  2NTS A;  2ONQ A;  4GDL A;  1RWS A;  2NPT A;  3T3N A;  1ZPS A;  1SEB D;  4WJO A;  3TJP A;  1N62 A;  3SU8 X;  1GAQ B;  1ET6 A;  1OFF A;  3AB5 A;  1FMA D;  3NS1 A;  2ICI A;  3TCA A;  4FHJ A;  3L17 A;  1R4M B;  2LUE A;  2QHO A;  1VZ7 A;  5BYQ A;  4F8C B;  1V86 A;  4LDT B;  1RRB A;  2MX2 A;  2IDY A;  4M8M A;  1Z2M A;  2XK5 A;  4HEA 1;  1K50 A;  4S0R A;  1E8Z A;  3J9C A;  2C9W B;  4K3B A;  4N6E B;  1IGC A;  2JZP A;  1AN8 A;  3ZUN A;  4EOY A;  3TEY A;  1L0Y B;  2FUG 1;  2M4N A;  2XBB C;  2GMI C;  2AQ3 B;  3RYT A;  1VDV A;  1V9J A;  4BKS A;  1J0G A;  2CHW A;  1ZDX A;  2UYZ B;  2M19 A;  2SEB D;  2WXJ A;  2Y5P A;  2V9H A;  2D07 B;  2DWQ A;  3N1X C;  1IGD A;  1F2R I;  1T6B X;  3KH0 A;  4IC7 B;  5IKC M;  1UGM A;  4RM9 A;  4HJG E;  3ECI A;  1T0Y A;  3DBH I;  3L0W B;  2PLP A;  3DDC B;  5LNK 1;  4GN1 A;  1DOI A;  2KNB A;  3R2I A;  3ZYY X;  4XGA B;  3AU4 A;  2D3B A;  2K22 A;  4HPL B;  3DBS A;  2WQY B;  4II3 B;  2A4Z A;  1GB4 A;  2FID A;  4IWQ A;  4C4V B;  4TKN A;  1SF0 A;  2LXA A;  2MEK A;  3AED B;  1LQB A;  5D7G A;  4DXA B;  5L95 C;  4RM8 A;  1PYW D;  2NBV B;  3N9Y C;  2G3Q B;  3UF8 A;  2V1Y A;  1WJ4 A;  3GZN I;  4AJW A;  2GB1 A;  1Q5W B;  3KLS X;  2CKH B;  1WFY A;  5EDS A;  3RZF A;  1UH6 A;  4B6W A;  1TY0 A;  2ASQ A;  4HDQ A;  3BIN A;  1YNT E;  3AE1 B;  4AUQ C;  5D3I B;  4HCN B;  2SAK A;  3AU5 A;  2VZK B;  1WGR A;  2N1V A;  1SGH A;  4YTM B;  1KF6 B;  4B95 A;  1N5X A;  4B0M A;  4MJS B;  2JY6 A;  4GDK B;  3FKY A;  1BT0 A;  1TS5 A;  2D5G A;  4HLE A;  2M56 B;  3LYY A;  1FFV A;  1SXT A;  4W9L A;  1E6E B;  3QX1 A;  4LTU A;  5BYR A;  1PDX A;  3GE8 C;  4WWO A;  4BKS D;  1D6E C;  3OWE B;  1UGJ A;  3PZ8 A;  3AEF B;  4WUR A;  1TKG A;  3W2D A;  1F77 A;  2KO3 A;  4HRO A;  3WAL A;  4FAD A;  1HTQ A;  4A9A A;  3NVY A;  1XLQ A;  1XCQ L;  4TMA B;  1FD6 A;  3EUB 2;  3R66 C;  1SE9 A;  4AS1 A;  4A3O A;  1WZ3 A;  2QEJ C;  3LXF A;  3DBL I;  1TZO A;  1WSP A;  1T5X D;  3RNF C;  2L0F A;  2WXI A;  1TYG B;  3HM6 X;  5AZH A;  3AEB B;  1SIJ A;  3NS8 A;  1V1P B;  4C00 A;  1JWM D;  1WJ6 A;  1WWT A;  2KMA A;  3HRD D;  3TUO A;  3AV8 A;  2B3A A;  3NHE B;  4US9 A;  1C77 A;  2V4L A;  2R2O A;  2I2Y A;  2HD5 B;  2N7D A;  4DQO C;  2INC C;  3DPD A;  2NR2 A;  1VD2 A;  4O1N A;  3QWZ B;  2G45 B;  2VH1 A;  2YEP B;  3L08 A;  4PK1 A;  3SDL C;  3GB1 A;  2ZPY A;  2OHF A;  4ZYN A;  2KFK A;  1QOA A;  4YXD B;  1NDD A;  3TEZ A;  5J18 A;  2IZV B;  2KDE B;  3TEX A;  1PUT A;  2N9L A;  4TQ1 A;  1ZUD 2;  2LMC A;  2BKR B;  3RFZ B;  5C3J B;  2MBH A;  4N59 A;  1ZKH A;  4NQK E;  1F0Z A;  4KZC A;  2QCZ A;  4E74 A;  1SE2 A;  5HFY A;  2K8B A;  2V3P A;  2KMC A;  5GMV A;  1VRA B;  3RPF C;  2IBI B;  3BVM A;  5E6J A;  5E6N A;  4FN2 A;  3VAW A;  1EO6 A;  2RDB C;  2LAS A;  5DCN A;  1R4N B;  2HE7 A;  3PHW B;  3BWU D;  4XDD A;  3V05 A;  3IBE A;  3ZJU A;  2HTH A;  3B0A A;  3PSE B;  3V60 A;  3WCQ A;  4URK A;  2JWU A;  4W9F A;  1WGY A;  2MH7 A;  2BT6 A;  3HVD A;  1IP9 A;  3Q2A C;  1UD7 A;  3NOB A;  4K7W A;  2WXO A;  2KJH B;  2WXM A;  2WS3 B;  4K7S A;  3X0W A;  4W9D A;  1J19 A;  4JL9 A;  1JWU D;  3AMZ A;  3JW0 X;  5BYS A;  2KD0 A;  2L52 A;  2KWV B;  3Q8C A;  4LK0 M;  4CQN A;  2PPH A;  2N0S B;  1MJD A;  1V49 A;  1QQR A;  2AEH A;  4MGI E;  2LWP A;  1I4P A;  1XD3 B;  1DOX A;  3ML9 A;  4W9H A;  5G2N A;  4BKG A;  4KDL B;  4F1S A;  3AE3 B;  1TGZ B;  3SD5 A;  1I35 A;  2AQ1 B;  2Y3A A;  1C78 A;  2NMQ A;  4DDG D;  3QAQ A;  2MBE A;  3PRP B;  4HVB A;  4P1B C;  2BWE S;  4IWP A;  5DPT A;  1E7U A;  2KTR A;  1E7P B;  4AOF A;  2VRR B;  4ICV A;  4W9K A;  1KLG D;  3ZTD A;  4XDC A;  1VR9 A;  3R3M A;  2K39 A;  4B0E A;  2FCQ A;  2KZR A;  2RDH A;  4GU2 A;  4NJ7 A;  2LRU A;  3NRZ A;  4YTP B;  1L0X B;  3CST A;  2WLB A;  1T3Q A;  3W5V B;  3BVZ A;  3C0R B;  3M63 B;  5BMI A;  1J8C A;  1H4R A;  2B76 B;  2WXR A;  3C8Y A;  3M62 B;  4K7U A;  4DHJ D;  2IJ0 A;  4HPM B;  3DWG C;  2CJN A;  3ABV B;  4OZB A;  1L7Y A;  3HHM A;  4M01 A;  2KK8 A;  1VZ8 A;  1T0R C;  2BWF A;  3V6E B;  3P4S B;  4NPN A;  2WP9 B;  4YSY B;  2WXK A;  4EFO A;  1OGW A;  3FC4 A;  3ZNZ B;  2INP E;  2PMV A;  3DBR I;  5HG2 A;  2K9X A;  3JYU A;  1H8C A;  3ZDM C;  4EZJ A;  1XF5 L;  1WYW B;  4ZRJ A;  1TS2 A;  3MFG A;  2C7H A;  5BMG A;  3VH4 B;  3V62 A;  3ZDT A;  3APC A;  3GP7 A;  2PKO A;  3VH3 B;  1QZE A;  2IO2 B;  3ENE A;  2H89 B;  3U30 A;  2M8S A;  2FBW B;  1NEN B;  4BAX A;  2RDG A;  5GXG B;  3AM9 A;  1Z5S B;  1MHX A;  2AQ2 B;  4LJO B;  4NAW B;  4HDO A;  2KAN A;  3VTW A;  1S3S G;  2AL3 A;  1RM6 C;  2MJ3 A;  3ZKJ C;  4KGR A;  4DHZ B;  2OOB B;  2LVQ A;  2FE8 A;  1PGA A;  3MC9 A;  2L83 A;  2MHJ A;  4H2A A;  3RD2 A;  3WAO A;  3KQ4 A;  4C4V A;  3Q6B A;  2D3G A;  2KLC A;  3AE9 B;  5L83 A;  4KIK B;  1IBX B;  3PTF C;  2JUO A;  3A9J A;  4Q2J A;  3MJ5 A;  4GB9 A;  3UGB B;  2FCM A;  4PYU A;  1E7V A;  3SEB A;  3AI5 A;  1NI3 A;  4K1R B;  4R3D A;  3T3O A;  1KOT A;  1V5T A;  1EU4 A;  2LZ6 A;  4LJP B;  3PZ7 A;  3QK0 A;  4WIP A;  1FPY A;  1HZ5 A;  3WIM A;  4QAY A;  2JRH A;  4ZRQ A;  5JZE B;  2CU3 A;  2ZW1 A;  2N9P C;  4LNO A;  4G0N B;  1JWA D;  3U7Z A;  2BW2 A;  2JXX A;  4NNJ B;  1WIA A;  3OG5 A;  2LXC A;  4MJS A;  4GDK A;  1FIQ A;  1X1M A;  1C9F A;  2O2V B;  1LO5 D;  2ZEQ A;  4HRS A;  2J53 A;  1GUA B;  1OEY A;  3CWI A;  4IG7 B;  2L3Z A;  4TQ0 A;  5LXI B;  2I1K A;  4HJK A;  1FNV A;  4XZ4 A;  2CJO A;  2JVC A;  3CIR B;  2MWS B;  3V3X A;  4OHJ A;  3VRA B;  1FFU A;  4MH8 A;  3A4R A;  2WNM A;  2Y5B B;  1V1P A;  1YX5 B;  1MVK A;  3M3J A;  2MW5 A;  3N30 A;  1SE4 A;  4AP4 C;  3AN1 A;  4HKZ E;  3VTU A;  2FNJ B;  1QIL A;  1I7H A;  4L2Y A;  1AWD A;  4E3C A;  3U8Z A;  1WYG A;  1NYQ A;  3Q8B A;  3ZJT A;  3VR8 B;  2JZZ A;  3X23 A;  2LD9 A;  3TEW A;  1V80 A;  2M17 A;  1YJ1 A;  3KW5 B;  2Z0D B;  4YSX B;  2C7M B;  3QQ8 B;  1ISN A;  1P7F A;  1EWC A;  3BK1 A;  1WX9 A;  1ET9 A;  1WJU A;  4W9J A;  4HWI B;  3TIX A;  3QA8 A;  1EU3 A;  3IG3 A;  4DBG A;  1XLP A;  2V4I B;  2JYE A;  3KUC B;  1VJK A;  3Q8A A;  1N61 A;  2KWC A;  3TSS A;  3H7P B;  5EE9 A;  3LDZ E;  4RFB A;  4FBJ B;  3TBL D;  2JT4 B;  4GMV A;  5G55 A;  2CHZ A;  2WDR B;  4PT5 A;  2DYB A;  1WE7 A;  1AAR A;  4US8 A;  4W9G A;  3PLV A;  5FR3 A;  2L76 A;  5H92 C;  2WXH A;  4GXB A;  1VCB A;  2IYD B;  3EFC A;  3AEC B;  3BYY B;  3AEE B;  1P1A A;  4EEW A;  3DHG C;  2AYO B;  3L13 A;  3R8B A;  1WXV A;  5MPO A;  1WX8 A;  4F7Z A;  1JRU A;  2IPK D;  3OAW A;  4BOZ B;  3WAP A;  1NYR A;  4WAF A;  1FNU A;  2KN5 A;  1MHH E;  3ETR A;  2ZVN A;  3GS2 A;  2N7J A;  1WE6 A;  1UEL A;  4JIO U;  5AUI A;  3KUZ A;  1WJN A;  1ZDV A;  3UIO B;  1XLO A;  2DX5 B;  1XCT L;  2KFJ A;  4I6L B;  3U4E G;  4A90 A;  2PE9 A;  3NZ3 A;  4GGQ A;  2ZCB A;  4NJ6 A;  2KX3 A;  2BS4 B;  4II2 B;  1V1O A;  4MM3 A;  2KKC A;  4HCP B;  3PLU A;  1WR1 A;  1ENF A;  4IM3 A;  1ZE3 D;  1WGH A;  3HM3 A;  1KTK A;  1MI0 A;  2QJL A;  1CJE A;  1WM3 A;  4KGT A;  2FCN A;  1WGD A;  1UZX B;  4JWS C;  3AE4 B;  2W3S A;  2K8C A;  2DAJ A;  4WQM A;  1HA5 A;  4GLS C;  2JU6 X;  1L4Z B;  1XXG A;  2EEL A;  4MSM B;  4ZRP A;  4UDU C;  2INN E;  3PGE A;  2YEP F;  2JPH A;  2JYT A;  4TSS A;  4TV3 A;  2N9K A;  2FUH B;  2MJD A;  1XO3 A;  5IP4 D;  3AE7 B;  4KZ0 A;  3IT6 B;  1YQ3 B;  4C7Z A;  1HXY D;  1J7B A;  2DYM A;  1YQB A;  3VUX A;  4GIV A;  2QIE B;  5CHW A;  3ZLZ A;  2KMM A;  1ACC A;  1OEY J;  2GBN A;  4KGS A;  2D3A A;  2GRI A;  2NPT B;  2W55 A;  2KWD A;  1ZGU B;  2GBR A;  4ZOH C;  2IGG A;  2J4X A;  3Q14 C;  3WA0 A;  4RGM A;  2JZ3 B;  1ZXI A;  2QDF A;  3K9O B;  3L54 A;  1FRD A;  1IUE A;  3ZXR A;  4FHK A;  3ZNG C;  5DPW A;  5IA7 A;  2KTF A;  2KJ6 A;  3UQB A;  2LRW A;  3RT3 B;  1TIF A;  1A5R A;  3EFU A;  2KDI A;  2RGF A;  1JWS D;  2XK5 B;  3MJW A;  1QOF A;  1HZ6 A;  1YMH E;  1C76 A;  4FUL A;  2MBQ A;  1LXD A;  2AX5 A;  2D2Q A;  5H8Y E;  2DZI A;  5J17 A;  1QF6 A;  2C7N B;  2RMM A;  3DCG A;  4FA6 A;  4KX6 B;  2NTT A;  5I4D A;  2W9N A;  3R2T A;  2IY0 B;  2KYW A;  1UBQ A;  3W1S C;  2MP2 B;  4JX1 C;  4KSK C;  2LI5 A;  2BB5 A;  2KN4 A;  3KWV A;  3IAM 1;  1A70 A;  1GJZ A;  1ZOY B;  1V8C A;  4RMA A;  3NVV A;  3BYT B;  5EE3 A;  1L2N A;  1NVI D;  1LM8 B;  1LFD A;  3JSV A;  1TS3 A;  3N3K B;  1MPE A;  3I57 A;  4ACF A;  3NJT A;  4NAW A;  1ZXH A;  5E6P A;  5E6O A;  4M0W A;  5FKA C;  1YN3 A;  2LJ5 A;  2N7E A;  4WWP A;  3L4P A;  1D4B A;  2WX0 A;  3VDZ A;  2Q5W D;  1YD8 U;  4JGH B;  2ZVO A;  1EF1 A;  4D2K A;  1J7A A;  2RSU A;  4WH4 A;  2D10 A;  2UWQ A;  3DVN V;  2KOX A;  5JXV A;  4KIK A;  4IUM B;  2WU2 B;  3P42 A;  2GBJ A;  3E9S A;  4XE0 A;  1V2Y A;  3AE6 B;  3IVF A;  3SR6 A;  1JQ4 A;  2WXP A;  2CS4 A;  5BMH A;  4XX5 A;  3Q8F A;  3H1U A;  4N58 A;  1QT9 A;  4L23 A;  2LVP A;  4M00 A;  3URY A;  1Y8R C;  4USA A;  4RF1 A;  3PT2 B;  5CTR C;  1UUP A;  1C79 A;  2PTL A;  4NY0 A;  2K6Q A;  4YL8 A;  3P63 A;  1WRI A;  5HHD G;  2RR9 A;  4PS3 A;  2JF5 A;  4E71 A;  1KFY B;  1TBE A;  1WR6 E;  3VHT C;  3ZNI D;  2LGI A;  2NVU I;  4C56 C;  3PO0 A;  1FNW A;  1JAL A;  1DYQ A;  2FAZ A;  4RGO S;  2QIL A;  3DVG X;  4EKU A;  2MSE D;  1WY8 A;  2RPQ A;  1GPX A;  1J7C A;  2MQJ A;  4BOS C;  1R4N I;  1F2R C;  4WWN A;  2L32 A;  3PZD A;  1NI2 A;  2R61 A;  2J52 A;  2DBY A;  2K0P A;  1JCK B;  3ALB A;  4C7Y A;  2BF8 B;  2G4D B;  4G50 A;  3S2A A;  4AJY B;  3A1Q B;  3RN9 C;  3NUH B;  2LGX A;  3RNB C;  1L5P A;  1RAX A;  3L10 B;  5D3D A;  4DXF A;  3EC8 A;  2QMT A;  3D32 A;  2D11 A;  3L16 A;  2ZNV C;  1GNU A;  3ONS A;  5TR5 A;  2KJR A;  4MH0 E;  2D3C A;  1C4A A;  1DOY A;  1WX7 A;  1K53 A;  3RNC C;  2G9H D;  3IT4 B;  4ZDV A;  3RZW C;  1EWY C;  2L8J A;  3RNE C;  1I4H A;  1I4R A;  1SBB B;  2N9E B;  2PW9 A;  1YQ4 B;  2OJW A;  4YT0 B;  2JRI B;  1B1Z A;  2W82 A;  4YSZ B;  2RD0 A;  2YLM A;  4MAC A;  2HJ1 A;  2KHW B;  3H7P A;  2BTE A;  1I4G A;  4X57 B;  1YN5 A;  1V6E A;  1HEZ E;  1YOV B;  2J0K A;  1UF0 A;  2GLS A;  3QC8 B;  4G3X B;  2BBC A;  1SSN A;  4EUT A;  5IN7 A;  1TKY A;  2XNA C;  3T9L A;  4BZA A;  2UU7 A;  5CHF A;  1FEH A;  1R7S A;  4FXC A;  5LLI A;  4ZHP A;  5LXH A;  2BPS A;  4L1B A;  1SB3 C;  3W1Y A;  1OQR A;  2KX0 A;  3APD A;  4IDI A;  1KRH A;  4KSL C;  3KVF B;  4IOI E;  3ZW3 A;  4NQL B;  3SFE B;  2H88 B;  1U4A A;  3P4Q B;  1WGK A;  2GBM A;  3QHT A;  2BYT A;  5BO4 B;  2K5P A;  3GOE A;  4LDT D;  5D2M B;  5HI1 A;  1WZ0 A;  2X38 A;  1WMH B;  3Q3M C;  1NBF C;  1ZW7 A;  1WF9 A;  2KDF B;  2DHZ A;  3W9C B;  4GOC A;  4BBN C;  5IO9 A;  2KWU B;  1SIF A;  4J3O D;  1B9R A;  2GI9 A;  1MFW A;  2JWZ A;  1MG8 A;  1JRO A;  2KT7 A;  3FIL B;  1JWB D;  4CYE A;  2WDV B;  3DBH B;  3RNA C;  1FO4 A;  2OED A;  1OTR B;  3H9D A;  4DXG A;  3NVZ A;  3DHH C;  3N20 C;  4RGT A;  4C80 A;  4MT5 A;  2AL6 A;  3ZO5 B;  2WXF A;  2DZK A;  2YVC A;  2EKE C;  2DZM A;  2KXJ A;  2KLG A;  1CK1 A;  4CO7 A;  1V5O A;  3A9K B;  1TTN A;  2ZNV B;  4G11 A;  1L4D B;  4ARI A;  4ICU A;  4MDK E;  5IAA C;  1WGG A;  2LGS A;  3OJ3 A;  2O6V B;  1FXA A;  1XQQ A;  3B2G A;  5DPS A;  4WJN A;  4XWW A;  3GZN B;  4ITK A;  2C5L C;  2G4S A;  2NBW B;  1TS4 A;  3MHZ A;  1CQV A;  3EGR A;  4I6P A;  1FM0 D;  2E3T A;  1GC7 A;  3B9J A;  1C4C A;  3AE5 B;  4KKJ A;  1L6U A;  2JXT A;  1BXT A;  3HVZ A;  3O13 A;  3NG0 A;  2KAC A;  3BVG A;  1D5X C;  4BBN F;  1N5W A;  4LNK A;  4FJY A;  4KVG B;  2I38 A;  1HTO A;  1SE3 A;  2M0A A;  2K1F A;  4KKI A;  3N1Y C;  1WH3 A;  1N60 A;  4YWG G;  1YIW A;  2KC2 A;  1WXA A;  2PIA A;  3P2B A;  1V81 A;  4MEM A;  2ZCC A;  5AZG A;  4J6I A;  4LCD E;  3I9V 1;  2VZK D;  2CHX A;  2MP2 A;  3MHS D;  1KJT A;  4LNI A;  2LJI A;  1D3Z A;  2Y5C A;  1D5M C;  3APF A;  2FIF A;  4ZRK A;  2V0G A;  2K8H A;  1CMX B;  3B2F A;  4PS7 A;  1VZ6 A;  2MBB B;  3W5U B;  3AUL A;  4FJZ A;  3DBL B;  3Q69 A;  2L00 B;  2WDT B;  2K6D B;  2LHE A;  1ROE A;  1GOZ A;  1Y56 A;  1TKE A;  2KVR A;  2L1A A;  3KWL A;  3HK0 A;  4PYZ A;  3WAM A;  1WI0 A;  1STE A;  2ON8 A;  4JWU C;  1UWX A;  2A5U A;  2ACZ B;  2QSD A;  3QIJ A;  3WAN A;  4NAM A;  5AUK A;  1F9J A;  1OQY A;  2ZZP B;  3EA6 A;  1I4Q A;  2J0J A;  1R4M I;  4AQ7 A;  3Q3F A;  3A9J B;  2EKI A;  1EUV B;  3MTN B;  5D94 A;  1KH0 A;  5G5G A;  4GSW A;  5EE0 A;  4JE3 B;  2LUM A;  1RLF A;  1Q10 A;  4BVU C;  1E8Y A;  3EEC A;  1XT9 B;  5TSS A;  3OLM D;  4EZK A;  1KM7 A;  1ZP0 B;  3UQA A;  3NVW A;  2NBU A;  1F52 A;  3MC8 A;  4ANV A;  3P4P B;  4IM0 A;  1E10 A;  2G1E A;  3VUY A;  2I1J A;  3QJZ A;  4RCO A;  3VXW A;  3DHI C;  4K3C A;  3VVW B;  4CHK A;  5C1Z A;  1FCC C;  2WXN A;  2JQR B;  5FR6 A;  2Z59 B;  2L7R A;  1VLB A;  2IO3 B;  3Q3O C;  2DLB A;  3IHP C;  3SFD B;  2PJH A;  4TUU A;  3HUI A;  4P7I A;  3ZQ4 A;  4DHZ E;  3N32 A;  3RNG C;  4GDL B;  5KHQ A;  2MLB A;  5HKH A;  4W9E A;  3ZJV A;  4LNN A;  4N9F 4;  3A4S C;  3W1S A;  3RCZ A;  2LEK A;  3R7R A;  2BS2 B;  1E90 A;  1JW9 D;  2K3U A;  2ZPN A;  3A33 B;  3U52 E;  4XYC A;  4IW0 A;  1UNS A;  3RUL A;  3MP9 A;  4XC2 A;  3KUD B;  2HDE A;  2J0M A;  2TSS A;  3VUW A;  1Q0W B;  3ZIM A;  2WX1 A;  4OW0 A;  2BYE A;  2JSV X;  3LJ3 A;  2NCN A;  4XWT A;  4P6V F;  2BQQ A;  1WXS A;  1PGX A;  1YN4 A;  2DAF A;  4ANX A;  1LGR A;  2MBO A;  3A1Q A;  2WWZ A;  2GOW A;  2N9X A;  5C2T B;  3PHX B;  4A20 A;  3C19 A;  4MEL A;  5KHO A;  1QOG A;  5CHV C;  5T8I A;  2ZW0 A;  3H7S A;  3GE3 C;  1RFK A;  3CMM B;  4MGK E;  3N1Z C;  3QAR A;  2KDM A;  4HK2 A;  1FRR A;  4OVV A;  2L0T A;  1HQR D;  3BY4 B;  3DQV A;  3ZNH B;  4M02 A;  2ZJD A;  4WJP A;  1F1H A;  2RPV A;  3PS6 A;  3ML8 A;  2KDB A;  4WAA A;  3SHQ A;  4P16 A;  1E8X A;  5DPR A;  3AE8 B;  5JHA A;  2CU1 A;  4OZC A;  4OZA A;  2V3N A;  3NZS A;  1XLN A;  3E56 A;  2MRP A;  1L6V A; 
#chains in the Genus database with same CATH homology
 3BIN A;  3TL5 A;  4AUQ C;  3D32 A;  2D11 A;  5C23 A;  3L16 A;  2MWS B;  4HCN B;  2ZNV C;  3I3T B;  1GNU A;  3ONS A;  3AU5 A;  2AWT A;  1WGR A;  2N1V A;  4M8N A;  1SGH A;  5TR5 A;  2KJR A;  4MH0 E;  3A4R A;  4B95 A;  2L05 A;  1UBI A;  3DOW A;  2Y5B B;  4MJS B;  2JY6 A;  4GDK B;  2N1W A;  4K81 A;  1BT0 A;  1WX7 A;  1YX5 B;  4HLE A;  3M3J A;  2BGF A;  2MW5 A;  3B08 A;  3B1L X;  2DEN B;  3N30 A;  4W9L A;  4ZDV A;  3QX1 A;  3RZW C;  4AP4 C;  2L8J A;  3VTU A;  2FNJ B;  4WWO A;  4BKS D;  5CX3 A;  1IPG A;  2N9E B;  3KYD D;  3U8Z A;  4E3C A;  3CF6 E;  2JRI B;  1FXT B;  3UIP B;  3ZRF A;  2RD0 A;  2YLM A;  2DYO A;  4JQW C;  2KO3 A;  2KC1 A;  3NY5 A;  2KHW B;  3H7P A;  3WAL A;  4FAD A;  2JZZ A;  4X57 B;  3X23 A;  3CSF A;  1V6E A;  3EHV A;  2LD9 A;  2IO0 B;  1V80 A;  2XEW A;  3KYC D;  2M17 A;  2BYV E;  1GC6 A;  4W9I A;  2J0K A;  3R66 C;  1YJ1 A;  2EMS A;  1SE9 A;  3KW5 B;  4EZL A;  2Z0D B;  4A3O A;  1WMH A;  1WZ3 A;  3QC8 B;  3DBL I;  4G3X B;  2HJ8 A;  2L0F A;  2C7M B;  1RFA A;  1P3Q U;  3Q3J A;  3QQ8 B;  4FJV B;  3HM6 X;  5AZH A;  1ISN A;  5AEK B;  3NS8 A;  4EUT A;  3R7Q A;  4W9C A;  1WX9 A;  2LGD A;  3T9L A;  5CHF A;  1WJ6 A;  5LLI A;  3H6N A;  5LXH A;  2BPS A;  3K9P B;  1WJU A;  2KMA A;  4W9J A;  4HWI B;  3TIX A;  3W1Y A;  3QA8 A;  2KX0 A;  3APD A;  2B3A A;  3NHE B;  2KQ7 A;  2O2V A;  3IG3 A;  4DBG A;  4KSL C;  2PEA A;  3KVF B;  3KUC B;  2M1M A;  3ZW3 A;  3V61 A;  2V4L A;  4NQL B;  3PRE A;  4B9K A;  2R2O A;  2KWC A;  1U4A A;  3H7P B;  3LDZ E;  4FBJ B;  2HD5 B;  3TBL D;  4ANU A;  2GBM A;  2JT4 B;  3QHT A;  4GMV A;  2N7D A;  5G55 A;  5BO4 B;  3DPD A;  2CHZ A;  1VD2 A;  2C60 A;  2NR2 A;  3GOE A;  4LDT D;  5D2M B;  2Z0E B;  3QWZ B;  4OVU A;  2DYB A;  2G45 B;  1WE7 A;  1WZ0 A;  1AAR A;  3L08 A;  1WMH B;  3PPA A;  3SDL C;  3A9K A;  1NBF C;  2EMT A;  1ZW7 A;  2LVO A;  2ZPY A;  1GG3 A;  3PLV A;  4W9G A;  2L76 A;  1WF9 A;  2KDF B;  2REX A;  4ASW C;  2DHZ A;  4ZYN A;  4GXB A;  5JHB A;  1VCB A;  2IYD B;  2KFK A;  4GOC A;  4BBN C;  1P1A A;  4EEW A;  1HE8 A;  2KWU B;  2AYO B;  2O6V A;  1SIF A;  3L13 A;  1NDD A;  5J18 A;  1WXV A;  2IZV B;  2JWZ A;  3DVN U;  1WX8 A;  1MG8 A;  4F7Z A;  4HXD A;  2KDE B;  1JRU A;  3IFW B;  4KDI C;  3OAW A;  4BOZ B;  3VQI A;  4TQ1 A;  4CYE A;  1P9D U;  1WRD B;  4FLH A;  3WAP A;  2V3S A;  2KN5 A;  5J2R A;  1OTR B;  2BKR B;  3AXC A;  3H9D A;  2ZVN A;  1G6J A;  2MBH A;  4NQK E;  1ZKH A;  2DZJ A;  2OJR A;  1KLV A;  2AL6 A;  3ZO5 B;  1IYF A;  1EF5 A;  4KZC A;  1WE6 A;  1UEL A;  4JIO U;  1E8W A;  2DZK A;  3KUZ A;  2YVC A;  2EKE C;  4E74 A;  1WJN A;  2DZM A;  2J7Q B;  2KLG A;  2KXJ A;  2K8B A;  4CO7 A;  1V5O A;  3UIO B;  3A9K B;  2DX5 B;  2KMC A;  1TTN A;  2ZNV B;  4G11 A;  5GMV A;  2KFJ A;  2IBI B;  4ICU A;  4MDK E;  4I6L B;  3U7D A;  2PE9 A;  5IAA C;  1WGG A;  2KFK B;  4GGQ A;  2ZCB A;  4NJ6 A;  2KX3 A;  5E6N A;  3OJ3 A;  4FN2 A;  4II2 B;  2O6V B;  1EO6 A;  3VAW A;  1XQQ A;  4MM3 A;  2KKC A;  4HCP B;  2LAS A;  5DCN A;  2HE7 A;  3PHW B;  5DPS A;  3PLU A;  3T8M A;  1WR1 A;  4IM3 A;  4WJN A;  1WGH A;  2MCN B;  3HM3 A;  3IBE A;  4MGY E;  4BFR A;  2HTH A;  3B0A A;  3PSE B;  1WM3 A;  2M0X A;  2C5L C;  3V60 A;  2FCN A;  2G4S A;  1WGD A;  2NBW B;  1UZX B;  4URK A;  1M94 A;  4I6N B;  3ZVV A;  4W9F A;  1WGY A;  2K8C A;  2NS5 A;  4MSQ B;  3PV1 A;  2DAJ A;  2CR5 A;  3PRM B;  2IY1 B;  4MGZ E;  3TMP B;  4I6P A;  1IP9 A;  1GC7 A;  1C3T A;  4MSM B;  2WYQ A;  3PGE A;  1UD7 A;  3NOB A;  4K7W A;  2JPH A;  1K8R B;  2KJH B;  2R2Q A;  4TV3 A;  3JSV B;  4K7S A;  3X0W A;  2N4F A;  2FUH B;  4W9D A;  1J19 A;  4BBN F;  4JL9 A;  4KZ0 A;  3HIZ A;  3JW0 X;  2IO1 B;  4FJY A;  2DYM A;  4KVG B;  4A3P A;  1YQB A;  2KD0 A;  3VUX A;  2K1F A;  3DVG Y;  2KWV B;  4GIV A;  3OJ4 B;  4M0W B;  5CHW A;  2PE6 B;  3ZLZ A;  1WH3 A;  4DHJ B;  1OEY J;  1YIW A;  2GBN A;  2KC2 A;  1WXA A;  2NPT B;  3VTV A;  2PPH A;  3P2B A;  1V81 A;  3QCA A;  4MEM A;  2ZCC A;  1ZGU B;  2GBR A;  5AZG A;  4J6I A;  4LCD E;  1V49 A;  2GBK A;  2AEH A;  4MGI E;  2LWP A;  4WJQ A;  4PS8 A;  5JH5 C;  3O65 B;  5D6J B;  1XD3 B;  2FCS A;  2CHX A;  2MP2 A;  3MHS D;  3WA0 A;  3ML9 A;  1KJT A;  2JZ3 B;  2O6V D;  1TZ1 A;  4W9H A;  2BYF A;  1D3Z A;  3K9O B;  3L54 A;  5G2N A;  4BKG A;  4KDL B;  2BKF A;  2K25 A;  4F1S A;  3APF A;  4JLC A;  1TGZ B;  4FHK A;  2FIF A;  4ZRK A;  3SD5 A;  3ZNG C;  4DDI D;  5DPW A;  2K8H A;  1CMX B;  2KTF A;  4PS7 A;  5IA7 A;  1I35 A;  2KJ6 A;  2MBB B;  2LRW A;  3UQB A;  4DDG D;  3AUL A;  3QAQ A;  2MBE A;  3PRP B;  3RT3 B;  3VFK A;  4HVB A;  3EFU A;  4FJZ A;  2BWE S;  2KDI A;  4IWP A;  5DPT A;  2RGF A;  1S1Q B;  1E7U A;  2XK5 B;  3MJW A;  2L00 B;  2KTR A;  2WDT B;  2K6D B;  4AOF A;  2VRR B;  1I42 A;  4ICV A;  3ZRC A;  4W9K A;  4FUL A;  3ZTD A;  1E5W A;  2MBQ A;  1LXD A;  2KVR A;  2D2Q A;  2DZI A;  3R3M A;  1WM2 A;  3ZTC A;  5J17 A;  2C7N B;  3HK0 A;  4PYZ A;  3DCG A;  3WAM A;  1WI0 A;  4DWF A;  4FA6 A;  2K39 A;  2FCQ A;  2KZR A;  4GU2 A;  4NJ7 A;  2W9N A;  2LRU A;  2LGY A;  2A5U A;  2IY0 B;  1YX6 B;  3QIJ A;  3WAN A;  3CST A;  4BKT A;  1UBQ A;  3W1S C;  3PRZ A;  2MP2 B;  4KSK C;  2LI5 A;  4ZRI A;  3UIN B;  1F9J A;  1OQY A;  2ZZP B;  3C0R B;  3V6C B;  3M63 B;  1GJZ A;  2J0J A;  1J8C A;  1R4M I;  1H4R A;  4K7U A;  3M62 B;  3Q3F A;  3A9J B;  4DK5 A;  2MA9 B;  4DHJ D;  4RMA A;  1EUV B;  4HPM B;  3MTN B;  5D94 A;  1WXM A;  4GSW A;  1C1Y B;  2KTR B;  3NZU A;  4WQO B;  1L7Y A;  1Q1O A;  1L2N A;  3HHM A;  1LM8 B;  1LFD A;  1RLF A;  3JSV A;  2KK8 A;  2BWF A;  4BVU C;  1E8Y A;  3EEC A;  3N3K B;  3V6E B;  1XT9 B;  4ANW A;  1P0R A;  4IWO A;  4NAW A;  4NPN A;  5E6P A;  4IM2 A;  3PVL A;  5E6O A;  1PQS A;  1OGW A;  3OLM D;  4KV2 A;  4AWJ A;  4EFO A;  4EZK A;  3ZNZ B;  1KM7 A;  3M95 A;  1P98 A;  2KQS A;  3RUI B;  3UQA A;  3JVZ X;  5AZF A;  2LJ5 A;  2N7E A;  3DBR I;  3JYU A;  2NBU A;  4GDL A;  4WWP A;  1H8C A;  2NPT A;  3ZDM C;  4EZJ A;  1WYW B;  4ANV A;  4IM0 A;  4WJO A;  2WX0 A;  4ZRJ A;  3TJP A;  3VDZ A;  3SU8 X;  1YD8 U;  4JGH B;  3VUY A;  2ZVO A;  2C7H A;  2I1J A;  3TCA A;  4FHJ A;  1EF1 A;  3VH4 B;  3QJZ A;  3L17 A;  3V62 A;  2LUE A;  2QHO A;  2RSU A;  3APC A;  2D10 A;  3VXW A;  3ZDT A;  4F8C B;  2UWQ A;  3DVN V;  2KOX A;  3VVW B;  4CHK A;  4KIK A;  5C1Z A;  3VH3 B;  1V86 A;  4LDT B;  1QZE A;  2IO2 B;  3ENE A;  3U30 A;  1RRB A;  2M8S A;  4IUM B;  2MX2 A;  2GBJ A;  4M8M A;  1V2Y A;  5FR6 A;  1Z2M A;  2XK5 A;  2Z59 B;  2L7R A;  1Z5S B;  3IVF A;  2IO3 B;  2CS4 A;  1E8Z A;  4LJO B;  3IHP C;  4NAW B;  2C9W B;  2PJH A;  4HDO A;  4TUU A;  4XX5 A;  2KAN A;  3VTW A;  1S3S G;  4P7I A;  3H1U A;  4DHZ E;  3ZUN A;  3N32 A;  4EOY A;  2AL3 A;  4GDL B;  5KHQ A;  2LVP A;  3ZKJ C;  2MLB A;  4DHZ B;  2M4N A;  5HKH A;  2XBB C;  4W9E A;  1Y8R C;  2GMI C;  2OOB B;  3RYT A;  2LVQ A;  4N9F 4;  3A4S C;  3W1S A;  1V9J A;  4BKS A;  1J0G A;  2CHW A;  3RCZ A;  3PT2 B;  2UYZ B;  3RD2 A;  3R7R A;  3WAO A;  5CTR C;  1E90 A;  2D3G A;  4NY0 A;  2D07 B;  2KLC A;  2K6Q A;  4YL8 A;  2ZPN A;  3A33 B;  5L83 A;  4KIK B;  4IW0 A;  3PTF C;  3RUL A;  4XC2 A;  3KUD B;  3KH0 A;  2JUO A;  4IC7 B;  2J0M A;  3A9J A;  1UGM A;  3VUW A;  1Q0W B;  3ZIM A;  2RR9 A;  2WX1 A;  4PS3 A;  4RM9 A;  4GB9 A;  2BYE A;  2JF5 A;  4E71 A;  3UGB B;  3ECI A;  3LJ3 A;  2NCN A;  1T0Y A;  3DBH I;  1TBE A;  1WR6 E;  1WXS A;  3L0W B;  2FCM A;  3DDC B;  4PYU A;  1E7V A;  3VHT C;  3ZNI D;  3AI5 A;  4GN1 A;  2DAF A;  2KNB A;  4ANX A;  4K1R B;  2MBO A;  2NVU I;  3A1Q A;  2WWZ A;  2GOW A;  2N9X A;  4A20 A;  3PHX B;  1KOT A;  1V5T A;  2LZ6 A;  4LJP B;  4MEL A;  5KHO A;  5CHV C;  3QK0 A;  3AU4 A;  1A5R A;  3H7S A;  3CMM B;  4HPL B;  3WIM A;  2FAZ A;  2JRH A;  3DBS A;  4MGK E;  4II3 B;  3DVG X;  2A4Z A;  3QAR A;  2FID A;  4IWQ A;  4EKU A;  5JZE B;  2MSE D;  4HK2 A;  1WY8 A;  2N9P C;  4OVV A;  4TKN A;  2L0T A;  2LXA A;  4G0N B;  2RPQ A;  1LQB A;  2JXX A;  2MQJ A;  4NNJ B;  1WIA A;  4BOS C;  5D7G A;  4DXA B;  5L95 C;  2LXC A;  1R4N I;  3BY4 B;  4MJS A;  3DQV A;  4GDK A;  3ZNH B;  4WWN A;  3PZD A;  1NI2 A;  4RM8 A;  2ZJD A;  4WJP A;  2NBV B;  3PS6 A;  3ML8 A;  1X1M A;  2G3Q B;  2KDB A;  3UF8 A;  2V1Y A;  2O2V B;  4WAA A;  2ZEQ A;  1WJ4 A;  3ALB A;  3GZN I;  3SHQ A;  4AJW A;  2BF8 B;  2G4D B;  4G50 A;  1GUA B;  1E8X A;  5DPR A;  1OEY A;  5JHA A;  1Q5W B;  2CU1 A;  3S2A A;  4IG7 B;  2L3Z A;  2CKH B;  3A1Q B;  1WFY A;  4AJY B;  2I1K A;  4TQ0 A;  5EDS A;  5LXI B;  3RZF A;  4HJK A;  2LGX A;  3NZS A;  1UH6 A;  4B6W A;  4XZ4 A;  2ASQ A;  1RAX A;  3L10 B;  2MRP A;  3EC8 A;  2JVC A;  4HDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...