4B95A

Pvhl-elob-elob-eloc complex_(2s,4r)-1-(2-chlorophenyl)carbonyl-n-[(4-chlorophenyl)methyl]-4-oxidanyl-pyrrolidine-2-carboxamide bound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
b'MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Small-Molecule Inhibitors of the Interaction between the E3 Ligase Vhl and Hif1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 22
structure length 104
sequence length 104
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4b95A00
4A3PA 1P9DU 2JRHA 2DYOA 2KX0A 1K8RB 2A4ZA 4TQ1A 2FCNA 3Q3JA 3QC8B 2DHZA 3VFKA 3PSEB 2ZVOA 4KDLB 1NDDA 4HLEA 4MGZE 3AULA 2ZCBA 3QIJA 5D6JB 4W9EA 2G4DB 4DBGA 3PVLA 4WQOB 3CF6E 2CR5A 2J0JA 2ZZPB 3H9DA 2KZRA 4JQWC 4E74A 1Z2MA 2L0FA 5JHAA 4GXBA 2KVRA 3KUCB 4RM9A 5TR5A 4BBNC 4FADA 2DYBA 4N9F4 2MCNB 4ANVA 2C7NB 2N1VA 1XD3B 4G0NB 4M8MA 3L54A 4FULA 1WE6A 5LXHA 3UINB 2IZVB 4IC7B 2EMSA 5HKHA 1G6JA 1WI0A 2JT4B 3ECIA 3PGEA 4I6NB 1V5TA 1WGDA 3L17A 4HPLB 1WIAA 3ZNHB 1E8ZA 2LD9A 5J2RA 4DHZE 2BF8B 1NI2A 2IY1B 2KN5A 2LZ6A 1L7YA 1PQSA 2UWQA 4ZRJA 2IYDB 3DVNV 3H7PA 3SU8X 3W1SC 4ANXA 3UQBA 1E8WA 3VAWA 3NY5A 4FJYA 2V4LA 3IFWB 3V60A 4DDGD 2KC1A 1WMHB 1YJ1A 1MG8A 2IO2B 2KDIA 2KDFB 2KOXA 2FAZA 3AU4A 3DVGX 4M0WB 3UQAA 4OVVA 4LCDE 1T0YA 2JZ3B 3K9PB 1E8YA 3RD2A 2EMTA 2L8JA 3QX1A 2IO3B 3VTWA 2KD0A 2MX2A 4FHJA 1TTNA 4GMVA 1V9JA 3DQVA 1P0RA 4FN2A 4II2B 2NVUI 1OTRB 1WX7A 3AI5A 3DBHI 2IO0B 1YD8U 2MSED 1EUVB 3A4SC 5CTRC 1AARA 4RM8A 2KWCA 4F7ZA 2PPHA 1R4MI 1SE9A 2BWES 2MWSB 4W9DA 2O2VB 2RSUA 1WM3A 3K9OB 2KO3A 2YLMA 3MJWA 4GB9A 3R3MA 2ASQA 3NS8A 2Z59B 4FJZA 4GDKB 3V6EB 4NAWB 4M8NA 3BINA 1HE8A 2LVPA 4AWJA 1P98A 4ICVA 4E3CA 1XT9B 5E6NA 2O6VB 5CHVC 2NR2A 2OJRA 2WDTB 4TV3A 3PLVA 5C1ZA 4MJSA 2MP2B 4WWOA 2QHOA 2ZVNA 4PS3A 1ISNA 1U4AA 3KH0A 4JL9A 4HJKA 3H6NA 3WALA 1OEYJ 3NHEB 2AL3A 4I6PA 3ZO5B 3IHPC 2J7QB 3UF8A 4HCNB 1GUAB 4MGIE 3DDCB 4ZYNA 3VDZA 2K39A 2DZKA 1R4NI 5AZFA 2G3QB 2FCMA 3O65B 5KHQA 4IW0A 2M1MA 4GDLB 3ZRCA 1WM2A 1H4RA 1NBFC 2NBWB 4BKSD 2I1JA 4AJYB 3V6CB 2M0XA 3ZNID 4IUMB 3ZTDA 2OOBB 2MA9B 4ANUA 5L83A 2CHZA 2D07B 4I6LB 2LGXA 2UYZB 5BO4B 4F1SA 3AU5A 3ZIMA 1EF1A 3DBLI 1ZGUB 2CHXA 3SDLC 1UBIA 2LUEA 2PE9A 3TJPA 1WGGA 3GZNI 4DHJB 2KFJA 5JH5C 3H7SA 3LJ3A 4JGHB 2JZZA 3A9KB 2KC2A 4EZJA 3W1SA 4BFRA 4BKTA 2G45B 4J6IA 3VTVA 5G55A 3WIMA 1WXMA 2NPTB 4FHKA 2L7RA 2O6VD 2ZPNA 1YQBA 4MH0E 1WXSA 2RR9A 1LQBA 4MELA 4WWNA 1GJZA 4KVGB 3JVZX 4HPMB 2DENB 3VUXA 1E5WA 1XQQA 4IM2A 4EEWA 3R7QA 1RRBA 4WAAA 4MM3A 3A1QB 4PS7A 2L3ZA 1V86A 3R66C 3APDA 3WAMA 1UELA 1Z5SB 1WJNA 2KQ7A 1WZ0A 3WAPA 4AOFA 4F8CB 5DPWA 1WH3A 1WXAA 2PE6B 4ZRIA 3DOWA 3HHMA 4KIKB 4W9JA 3JW0X 2KJRA 3ALBA 2R2OA 1S3SG 1WMHA 4IWOA 5L95C 4IM3A 3VUWA 4FA6A 4DK5A 2MRPA 2RD0A 3PT2B 3VTUA 1Q0WB 4EUTA 5CHFA 3TMPB 4KSLC 4DHJD 1F9JA 1L2NA 1WR6E 1UBQA 2K8HA 2LI5A 4BOSC 2KMAA 4KSKC 5CHWA 4GU2A 2BKRB 3ZRFA 4NJ7A 2KTRB 1A5RA 1WGRA 4MSQB 2KNBA 1WFYA 3HIZA 5JHBA 5AEKB 4K7WA 1WXVA 4W9FA 4OVUA 2IY0B 4WWPA 4G50A 5E6PA 2MW5A 4KZCA 2KLGA 2O2VA 3M63B 5DPTA 3WAOA 2BYEA 5C23A 3QHTA 2MLBA 2RGFA 2KWVB 4GDKA 2N9XA 3PV1A 2RPQA 4FLHA 4NAWA 2GBRA 3WANA 3DBSA 4URKA 1BT0A 4X57B 3CMMB 3KYDD 4HDOA 2O6VA 2C9WB 3B08A 4ICUA 4FJVB 2HD5B 1KJTA 1Y8RC 1D3ZA 2MP2A 1WR1A 4JLCA 2DAJA 4MSMB 4BKGA 3L13A 1P3QU 3L10B 2Z0EB 1CMXB 2JUOA 1WYWB 5AZHA 5G2NA 1P1AA 3OJ3A 4EZLA 5FR6A 1LXDA 3APCA 1KM7A 2M8SA 2WWZA 2FUHB 3Q3FA 3QJZA 2PJHA 4GDLA 2JVCA 2LWPA 2XBBC 4KZ0A 3ZLZA 2XK5A 2LRWA 3QARA 1KOTA 4TQ0A 2KTFA 2N4FA 4GGQA 3VHTC 3GOEA 2LVQA 2KFKB 3IBEA 5JZEB 2HE7A 4IWPA 3KUZA 2ZJDA 3EECA 2N7DA 2REXA 3X0WA 4MDKE 3R7RA 2K8BA 2FIFA 5IAAC 3A9KA 1UGMA 3CSFA 1IPGA 2BYFA 5D2MB 1LM8B 2BPSA 2C5LC 1WGYA 3VUYA 5AZGA 4MGYE 2MBEA 3TBLD 3TL5A 2GMIC 3BY4B 1UZXB 2NPTA 2JXXA 2K6QA 2BWFA 3TCAA 1IP9A 3DPDA 1S1QB 4XX5A 4ZDVA 2JRIB 3I3TB 1WF9A 3D32A 3P2BA 4P7IA 1C3TA 3OAWA 3QCAA 4MGKE 4RMAA 3VXWA 3ZKJC 5GMVA 4G11A 5DPSA 3A1QA 1VCBA 2WX1A 3B1LX 4KV2A 3W1YA 2ZEQA 1YX5B 1OGWA 1E7VA 2C7HA 1GC7A 2V3SA 1E7UA 3V62A 2NBVB 3VH3B 1I35A 2GOWA 3ML9A 2KQSA 1GNUA 2A5UA 3EFUA 3KYCD 3RZFA 3ZDTA 3ZDMC 1H8CA 4KIKA 4DWFA 3T8MA 2M4NA 2K1FA 1V2YA 3TIXA 1GG3A 2KANA 3QWZB 3ZW3A 3ZVVA 2D10A 2GBNA 4BVUC 2G4SA 2N1WA 2ZPYA 4TKNA 4W9IA 3T9LA 2LJ5A 4ASWC 2ZNVB 2PEAA 4NPNA 1RAXA 2J0KA 2MBBB 3CSTA 1OQYA 3VH4B 4HWIB 3PZDA 3A9JB 1EO6A 3RUIB 3X23A 2DX5B 3M3JA 4JIOU 4HDQA 4YL8A 2DAFA 2GBMA 4LDTB 4EFOA 1WX9A 2M17A 2KTRA 2XEWA 1WRDB 3PRMB 1LFDA 4IM0A 2L0TA 4G3XB 2K6DB 4CO7A 3PRZA 1ZW7A 1WY8A 4W9CA 4LJPB 1Q5WB 3JSVB 2KJHB 1TBEA 1OEYA 3APFA 2KHWB 3N32A 3PPAA 3L16A 4GIVA 4HK2A 2EKEC 2NS5A 4ANWA 4GSWA 2N7EA 3H1UA 1Q1OA 2FCQA 2K25A 2ZNVC 3MTNB 3PHWB 4II3B 4BKSA 3HK0A 2JY6A 3NZUA 3PREA 4NQKE 3V61A 3MHSD 1E8XA 3HM6X 4K81A 2V1YA 1WJ4A 4W9LA 5EDSA 1ZKHA 3UIPB 1WJUA 2KDBA 3ZNGC 2GBJA 2AYOB 3JYUA 3PS6A 4NY0A 3IVFA 2AWTA 1WX8A 1WE7A 3DVGY 3KVFB 3QA8A 2LVOA 2C60A 4B9KA 5J17A 3ENEA 4E71A 3SD5A 2KX3A 4CHKA 3L08A 3PTFC 2YVCA 2MBOA 3UIOB 1TZ1A 1TGZB 1YIWA 2Z0DB 2HJ8A 2GBKA 4PYZA 1V5OA 1J19A 4A3OA 2LXAA 2KK8A 4LDTD 4DHZB 2ZCCA 4B6WA 1X1MA 4BBNF 2KFKA 3U30A 2KMCA 4WJQA 3ML8A 2IBIB 4NNJB 4K7SA 5D94A 3QK0A 1YX6B 4IG7B 4K1RB 3VQIA 5DPRA 3RCZA 4DDID 2L00B 2MQJA 2NCNA 2FNJB 2R2QA 4W9HA 3U8ZA 3ZTCA 1RLFA 1V6EA 3H7PB 5DCNA 4B95A 4BOZB 1V80A 2Y5BB 3N3KB 2KDEB 2D11A 4WJNA 5CX3A 2D2QA 4A20A 1WJ6A 3ONSA 4WJOA 3RZWC 1QZEA 5KHOA 4PYUA 2DZIA 4KDIC 4EKUA 5E6OA 3U7DA 2WYQA 1JRUA 2JPHA 2VRRB 2DZJA 2JF5A 3EC8A 2JWZA 3OLMD 1GC6A 3NZSA 3M62B 2LASA 1V81A 2LGDA 5D7GA 3ZNZB 4IWQA 2N9PC 2BYVE 2NBUA 4GN1A 3SHQA 1FXTB 1SGHA 2CHWA 3L0WB 2KXJA 3IG3A 4MEMA 2LRUA 3OJ4B 1IYFA 2LGYA 4W9KA 2AL6A 4TUUA 4AUQC 3RULA 1WGHA 4NJ6A 3M95A 3PLUA 5LXIB 2D3GA 4GOCA 1VD2A 4AP4C 4ZRKA 2WX0A 2CKHB 2AEHA 1I42A 2MBHA 3NOBA 3EHVA 1EF5A 2K8CA 3PHXB 4HCPB 1M94A 3C0RB 1J8CA 1RFAA 2I1KA 3LDZE 3RYTA 4XZ4A 3AXCA 2J0MA 2DYMA 4K7UA 4DXAB 4XC2A 5LLIA 3QAQA 1UH6A 3KW5B 3S2AA 4NQLB 2XK5B 3DBRI 3A9JA 3DCGA 3A4RA 1KLVA 4MJSB 1J0GA 2BKFA 3A33B 3KUDB 4PS8A 4LJOB 2BGFA 2FIDA 3QQ8B 1V49A 2DZMA 1E90A 2KKCA 3B0AA 3ZUNA 2L76A 2IO1B 4HVBA 2CS4A 3N30A 3PRPB 3DVNU 2KWUB 4HXDA 4WJPA 3RT3B 4CYEA 1UD7A 3JSVA 3UGBB 2LXCA 4AJWA 1C1YB 4EOYA 2KJ6A 2W9NA 2N9EB 3WA0A 5J18A 2CU1A 2MBQA 3VVWB 2C7MB 1SIFA 2B3AA 4EZKA 2L05A 4FBJB 2FCSA 3HM3A 4W9GA 5IA7A 2KLCA 1WZ3A 2HTHA
chains in the Genus database with same CATH superfamily
1ET6A 1P9DU 2JRHA 2KX0A 1V1OA 3ZJTA 1QOAA 3AEDB 4YWGG 1NDDA 1XCQL 4HLEA 5HG2A 1OQRA 1FCLA 4MGZE 2G4DB 1Q10A 3PVLA 1K51A 2ZZPB 5EE1A 2DWQA 3KUCB 3MC8A 4RM9A 2C7NB 3AH7A 4MT5A 4MM3B 2EMSA 3AEGB 1WGDA 4HPLB 1L6VA 1WIAA 3ZNHB 5J2RA 2BF8B 2IY1B 1PQSA 2IYDB 3H7PA 3SU8X 3W1SC 2V4LA 3V60A 3NZ3A 4BAXA 3BVGA 4M0WB 3DVGX 2KMMA 3LYYA 2JZ3B 3RD2A 4YSXB 1WGKA 3VTWA 2L83A 1VZ6A 1WX7A 4C7YA 1M4VA 2IO0B 2LGSA 1YD8U 3A4SC 4RM8A 4F7ZA 5HI1A 3BK2A 1ENFA 1QKZA 3RN9C 2KO3A 1I4RA 4FJZA 2ASQA 3NS8A 4GDKB 4WIPA 2HTME 3BINA 1P98A 4ICVA 1LO5D 3Q3OC 1XXGA 2O6VB 2NR2A 5C1ZA 4YT0B 4JL9A 2AL3A 2J7QB 2XNAC 3ZJVA 1OQQA 2J52A 2K39A 4A8XC 3O65B 4P16A 4ZRPA 3ZRCA 4BKSD 2I1JA 3V6CB 4IUMB 3ZTDA 1VZ8A 2MA9B 2WXIA 4N6EB 3E56A 5BO4B 4I6LB 2LGXA 2UYZB 4OHJA 4ZOHC 1L4DB 2LUEA 1IBXA 2PE9A 4DHJB 5JH5C 2V3NA 1IGDA 2JZZA 2PTLA 3A9KB 2I38A 4BZAA 1V1PA 1J7AA 2RDBC 2PIAA 2G45B 1I4PA 5G55A 3SR6A 1SSNA 2BYTA 1GJZA 4MELA 4HPMB 3VUXA 4C4VA 4RFBA 2J53A 1L0VB 2NTTA 3DWMA 1P7FA 3WAMA 1CK1A 1Z5SB 4LNNA 2KAJA 3BYYB 4KIKB 2KJRA 3DBRB 1PYWD 1STEA 5L95C 2D5GA 4IM3A 2QDFA 3PT2B 3VTUA 5CHFA 4KSLC 1DYQA 1UBQA 1ROEA 3E9SA 3ZRFA 3RMKC 4ARCA 2LHDA 1RM6C 5GXGB 4P6VF 4MSQB 2KNBA 3V05A 1FIQA 2IY0B 5E6PA 2JZPA 1WRIA 4YTPB 3MC0B 4NZLB 3M63B 5DPTA 3WAOA 3RNGC 4B0MA 3P42A 2MLBA 4NAWA 1VLBA 2RPQA 3BYTB 1RWSA 2FE8A 1K50A 3B08A 4ICUA 1F0ZA 3ZXRA 3N20C 3L10B 2SAKA 2EKIA 3Q8CA 5FR6A 1LXDA 3W5VB 1KM7A 3QJZA 2PJHA 4GDLA 2JVCA 2LWPA 1CQVA 4N59A 4TQ0A 2N4FA 2LVQA 3IBEA 3BVZA 2REXA 3NUHB 1J7CA 5IP4D 4ARIA 3VUYA 4MGYE 3RI7C 3TL5A 2GMIC 2JXXA 1JWSD 3DPDA 1S1QB 4ZDVA 2KT7A 3DBHB 1PGXA 2IPKD 3QCAA 1I4GA 4RMAA 4G11A 1N60A 3W1YA 1TKGA 3VH3B 4RH6A 3V62A 4USAA 1XLPA 2Y5PA 3ZDMC 1H8CA 1A70A 1GG3A 1KFYB 3QWZB 3ZW3A 3ZVVA 1F2RI 4HKQA 2N1WA 2PEAA 2X8XX 2J0KA 3CSTA 4HWIB 5AUKA 1YNTE 1LFDA 4IM0A 2L0TA 4CO7A 3PRZA 1OEYA 2KHWB 4HK2A 2EKEC 2AQ1B 3BZDB 4YSZB 4AQ7A 3N1XC 4GSWA 4CQNA 2K25A 4BKSA 1GAQB 3HK0A 2JY6A 4WWMA 3ABVB 4NQKE 1HQRD 4K81A 3UIPB 2KDBA 2GBJA 3PS6A 2HJ1A 5E6JA 5BMHA 1WE7A 3KVFB 3ENEA 1L0YB 2WHIA 4A9AA 1T0RC 4XWTA 4A3OA 4DHZB 4MH8A 4MACA 2KFKA 3U30A 1FRDA 4OVZA 5IN7A 4IG7B 1C79A 3IT6B 4WAFA 3U8ZA 1SXTA 1RLFA 4BOZB 3HVDA 1V80A 5TSSA 2K9XA 3AE5B 2WS3B 3N3KB 2KDEB 2KWDA 3I5JC 1HTQA 1WJ6A 3RZWC 3FC4A 1ESFA 1XO3A 4KDIC 1YN5A 2WYQA 1KTKA 3J9CA 2KDMA 2DZJA 3EC8A 2LASA 1V81A 2M19A 5D7GA 4C80A 2N9PC 2NBUA 1E7PB 1EM7A 3SHQA 1FXTB 2CHWA 2OHFA 1VDVA 4MEMA 4W9KA 4TUUA 4AUQC 4ZRQA 1WGHA 3RULA 5LXIB 4GOCA 1VD2A 1DOXA 4RF1A 3PHXB 3C0RB 1J8CA 1RFAA 1T0SC 4K7UA 2J0MA 2DYMA 1ACCA 1UH6A 3A9JA 4OZCA 2N7JA 3DCGA 2XN9C 3A4RA 4PS8A 5H8YE 4LJOB 1VR9A 1TYGB 3AECB 3P63A 1F52A 5G5GA 2KKCA 1E90A 2IO1B 1QOFA 1ZUD2 1NYRA 2KWUB 4WJPA 4FXCA 3RT3B 1MHHE 3Q3NC 3Q8FA 2N9EB 1C77A 3W9CB 1FNUA 2BB6A 3NVZA 1K8RB 2A4ZA 3Q3JA 4R3DA 1BXTA 2DHZA 3VFKA 3NVYA 4KDLB 2TSSA 2WXOA 3AULA 2ZCBA 4W9EA 4DBGA 2CR5A 2IGHA 1P7EA 3H9DA 4E74A 1Z2MA 4M00A 3UI3A 5JHAA 4S0RA 3FILB 5TR5A 3P4PB 2DYBA 1XD3B 4G0NB 1AYFA 5LXHA 3UINB 2IZVB 4IC7B 4YTMB 1TS3A 1WI0A 3PGEA 1V5TA 3L17A 1PFDA 3P4SB 3GE8C 1E8ZA 2LD9A 1NI2A 2KN5A 1L7YA 2UWQA 3KQ4A 1I42A 5FKAC 1EU3A 3UQBA 3VAWA 4DDGD 2KC1A 1WMHB 3NJTA 3UQAA 3AU4A 2WXLA 1EWCA 2L8JA 2X38A 1UWMA 4FHJA 1TTNA 1K52A 2NVUI 5JXVA 1F2RC 1HTOA 3T3OA 1AARA 2KWCA 2N9LA 2PPHA 2BVCA 2WU5B 2MWSB 4W9DA 2O2VB 1HE8A 2LVPA 2WDTB 1E6EB 3PLVA 4MJSA 2MP2B 2WGSA 4PS3A 1U4AA 3KH0A 3WALA 1OEYJ 3NHEB 4I6PA 1TY0A 3GE3C 3IHPC 4HCNB 3ETRA 2LFIA 2CJOA 3RNEC 2FCMA 4HRSA 4IW0A 1GB4A 1AW7A 3GB1A 1NBFC 1ZXHA 2BS3B 2M0XA 5H92C 5L83A 2D07B 4F1SA 1GOZA 1TJEA 1EF1A 3DBLI 2CHXA 1UBIA 2E3TA 4OZBA 3TJPA 3B2FA 4PT5A 3LJ3A 4O1NA 1YMHE 1WXMA 2NPTB 4FHKA 2L7RA 2ZPNA 2PKOA 1HZ5A 1FNVA 4KVGB 2BS4B 3JVZX 4EEWA 1I4HA 4MM3A 3A1QB 4PS7A 4XDCA 2L3ZA 3VRAB 1V86A 4C7ZA 2K5PA 5IOIA 1UELA 1WJNA 4ZHOA 2KQ7A 1WZ0A 3WAPA 5DPWA 1F1HA 4W9JA 1L6UA 2LEKA 2QILA 4TSSA 4M0WA 3VUWA 4DK5A 4M01A 4DQOC 4EUTA 1N63A 1L2NA 1WR6E 1QQRA 5CHWA 4GU2A 2BKRB 4NJ7A 1WYGA 2KTRB 2QJLA 1EU4A 3HIZA 5JHBA 1WXVA 5EE3A 2MW5A 2KLGA 5G5HA 3U2SC 3ZXVA 4LTUA 2BYEA 4GDKA 3PV1A 3WANA 3DBSA 4X57B 3CMMB 4HDOA 2O6VA 1WWTA 1ZDXA 2PW9A 4B0EA 2BBCA 4LNIA 3L13A 4L23A 5D3IB 1CMXB 2WXQA 2QEJC 1VJKA 1AWDA 1FFVA 3ZYYX 5G2NA 3APCA 2M8SA 2FUHB 3Q3FA 2XBBC 2BW2A 1HA5A 2FBWB 1UWXA 1XEEA 4D2KA 1C76A 3W5UB 2ZJDA 2H89B 4MDKE 3Q8EA 2FIFA 5IAAC 3A9KA 3U4EG 1LM8B 2BPSA 2C5LC 5AZGA 1NYQA 4WQMA 1YOVB 3BY4B 5BYQA 1IP9A 3P2BA 4XGAB 1C3TA 3Q8AA 3OAWA 3MP9A 4MGKE 3ZKJC 2ON8A 1R4MB 5DPSA 1E10A 2WX1A 3B1LX 2ZEQA 1E7VA 2ZW0A 1MHXA 2V3SA 1C78A 1E7UA 4XE0A 2KQSA 3CWIA 1GNUA 3KYCD 3EFUA 4KIKA 1T3QA 4US8A 3EGRA 3C8YA 4ASWC 3RNCC 2MBBB 2RDHA 3VH4B 2WXJA 3RUIB 4RGOS 1R4NB 4YL8A 4OZAA 4LDTB 2M17A 1JWMD 1T0QC 1IBXB 4W9CA 3JSVB 2KJHB 1TBEA 3APFA 2D3BA 4LNFA 2LMCA 2NS5A 3GZNB 2FCQA 2ZNVC 3PHWB 4II3B 1FCCC 3NZUA 3MHSD 1C4AA 3HM6X 2V1YA 1WJ4A 4W9LA 5EDSA 3JYUA 1FNWA 4OW0A 1J7BA 4B9KA 3GS2A 4KGRA 3SD5A 1FO4A 2WLBA 2MBOA 4HPPA 1SIJA 2GBKA 1J19A 2KK8A 2V0GA 1X1MA 4BBNF 2I2YA 1YQ4B 3ML8A 4NNJB 4K7SA 2VH2A 3QK0A 4K1RB 4K3CA 2MQJA 2NCNA 5DCNA 4WH4A 4B95A 1C4CA 2ONQA 2D3CA 4WJNA 5LNK1 5CX3A 2D2QA 4A20A 5KHOA 2GRIA 2QIEB 2VZKB 5E6OA 2W54A 1QOBA 2BQQA 2JF5A 5IKCM 3NZSA 4IWQA 2KXJA 4YSYB 2LRUA 2WU2B 2L1AA 3OJ4B 4NJ6A 3M95A 4A55A 3IAS1 5BMGA 3NRZA 3NOBA 1EF5A 2K8CA 3R2TA 2N9KA 1AN8A 1M94A 3NG0A 3LDZE 3I63C 3RYTA 1MPEA 3BWUD 3QAQA 3S2AA 3DBRI 2QSDA 2Y3AA 2VH1A 2LJIA 4XDDA 1QOGA 3QQ8B 2INDC 3DVNU 4CYEA 2M56B 4S17A 2LXCA 4AJWA 4DXGA 2KJ6A 5J18A 4RGNA 2CU1A 2MBQA 2YEPF 3VVWB 2C7MB 1SIFA 3AE7B 2FCSA 3RPFC 1TS2A 3N1YC 5IA7A 2KLCA 5HFYA 2W82A 4TQ1A 1BMLC 2FCNA 3QC8B 3PSEB 4HROA 1CZPA 1KRHA 3KLSX 3CF6E 2WXFA 2J0JA 1FMAD 4JQWC 2L0FA 4GXBA 2WXKA 2JU6X 2MCNB 4ANVA 1E9MA 4M8MA 3L54A 4FULA 1IUEA 5HKHA 1G6JA 2JT4B 3ECIA 1TT5B 4Q2JA 4DHZE 3O13A 4EZJA 1ZP0B 3NY5A 4FJYA 1C9FA 1YJ1A 2Q5WD 2IO2B 2MJDA 2KOXA 3ZQ4A 2FAZA 2RDGA 4OVVA 5I4DA 1JWAD 3QX1A 3HRDD 2IO3B 2MX2A 4II2B 1V9JA 1P0RA 3V3XA 1PDXA 3DBHI 5FR3A 4JPSA 5BMIA 3BVMA 1SE9A 3EA6A 3B9JA 2CJNA 4WURA 4L2YA 3R3MA 3V6EB 4M8NA 5BYSA 1NENB 5E6NA 5CHVC 2RMMA 4WWOA 2PVGC 1ISNA 2JYTA 4HJKA 3H6NA 1HXYD 1XLOA 3ZO5B 1GUAB 4MGIE 1SEBD 4ZYNA 3VDZA 2G3QB 1D5ZC 2M1MA 3MJ5A 1JROA 1K53A 2NBWB 3RNAC 4AJYB 4XYCA 3ZNID 2OOBB 3AEBB 3RNBC 3AU5A 3ZIMA 1KH0A 1WGGA 2W3SA 1GPXA 4JGHB 2E6XA 2KC2A 1RFKA 4J6IA 3VTVA 1YN4A 2O6VD 2LHEA 3OWEB 3FILA 1WXSA 2RR9A 1LQBA 2WXRA 3AM9A 4WWNA 1WXQA 1E5WA 4IM2A 3R7QA 1RRBA 1SBBB 4K3BA 3MFGA 4P1CC 3RFZB 3R66C 3APDA 2WXGA 4F8CB 1WH3A 1WXAA 4ZRIA 4KGTA 3HHMA 1S3SG 1WMHA 4IWOA 4FA6A 5FK9C 2MRPA 2RD0A 3HUIA 1Q0WB 4ZHPA 1QF6A 3TMPB 5BYRA 4DHJD 1F9JA 2AQ3B 2K8HA 2LI5A 4BOSC 4HKZE 2RPVA 1A5RA 1WFYA 5AEKB 3U7ZA 4WWPA 3RNFC 1N6ZA 3KWLA 4KZCA 2O2VA 4AS1A 1SE4A 3QHTA 2RGFA 2N9XA 4FLHA 2GBRA 1TKYA 2INCC 1UUPA 3KYDD 2C9WB 2IGGA 3W2DA 4FJVB 2HD5B 2KYWA 1D3ZA 2MP2A 2MH7A 2PMVA 4MSMB 4ACFA 1P3QU 2Z0EB 2JUOA 1UGJA 1WYWB 1B1ZA 2WWZA 1XCTL 4IDIA 2V4IB 2K22A 2XK5A 1KOTA 2KTFA 4GGQA 1YJIA 3GOEA 1FPYA 5JZEB 4IWPA 2WDVB 2N7DA 3R7RA 2K8BA 2MHJA 4LK0M 5EE0A 1NVID 1UGMA 3HVZA 2INNE 2B76B 1NI3A 3TUOA 1UZXB 2NPTA 3P4QB 1MFWA 2BWFA 3CIRB 2JYEA 2JRIB 1WF9A 4ZYSA 4P7IA 1TKEA 4EE2A 3A1QA 4XWWA 3LB8C 2C7HA 1GC7A 1FEHA 2NBVB 1I35A 3ML9A 2A5UA 3ZGZA 3PZ8A 4LNKA 3RZFA 2GLSA 1V2YA 2K1FA 3R8BA 4A6QA 4BVUC 2D10A 2GBNA 3PO0A 1D5MC 2ZPYA 3T9LA 4H2AA 4NPNA 3AEFB 1V97A 1SE2A 1EO6A 3X23A 2DX5B 4JIOU 2DAFA 3AB5A 4P1BC 4EFOA 2KTRA 1WRDB 3PRMB 2W3RA 4G3XB 4RF0A 1ZW7A 1WY8A 2OEDA 2LUMA 3PPAA 1FFUA 1I4XA 2KQ4X 4GIVA 4QAYA 1Y56A 2N7EA 3H1UA 1Q1OA 2R61A 2WXMA 4N58A 3PREA 2WXNA 1E8XA 1ZKHA 2QMTA 2AYOB 3DHIC 2AWTA 1QILA 1WX8A 2LVOA 5J17A 4E71A 2KX3A 2W55A 1TZ1A 1MG4A 1EWYC 1YIWA 3IXSA 3IAM1 2FUG1 4PYZA 1V5OA 2LXAA 2MEKA 4RGTA 1JALA 2JSVX 4US9A 3ZJUA 2KMCA 1DGJA 2IBIB 2Z8LA 2H88B 5D94A 4JX1C 2INPE 3VQIA 2FNJB 2R2QA 4W9HA 2GB1A 3H7PB 3URYA 1D6EC 4WJOA 1SE3A 1QZEA 2DZIA 4JWSC 3P1MA 1L5PA 3VRBB 3OLMD 1GC6A 2N0SB 4C00A 1SGHA 3L0WB 4KGSA 3PLUA 1PGAA 2L52A 4KKJA 2WX0A 2CKHB 2AEHA 4ZRKA 1VZ7A 4PK1A 4HCPB 1UNSA 2JQRB 3AXCA 2WDQB 2BB5A 5LLIA 2M0AA 1BUIC 3KW5B 4NQLB 1KLVA 1J0GA 2BKFA 3A33B 2BGFA 2PVOD 2UU7A 2FIDA 2DZMA 3ZUNA 2L76A 3PRPB 4HXDA 4REZA 3SFEB 1UD7A 3JSVA 3VR9B 1C1YB 1OFFA 3WA0A 4GLSC 2AX5A 4EZKA 4FBJB 3HM3A 2KVZA 3AE1B 1WZ3A 2HTHA 4A3PA 2DYOA 3AE2B 1QLBB 3MHZA 1D4BA 2NTSA 2ZVOA 4RGMA 4TMAB 1V1PB 2BTEA 3QIJA 5D6JB 1NEKB 1ZPSA 4WQOB 2KZRA 3AE8B 2KVRA 1ZE3D 4FADA 4BBNC 4N9F4 2N1VA 4KX6B 1V8CA 5C3JB 1MVKA 1KF6B 4C4VB 1WE6A 2ICIA 1T6BX 1TIFA 2ACZB 4I6NB 5D3DA 1RYJA 2J4XA 3Q14C 5C2TB 2LZ6A 4ZRJA 4ANXA 2NMQA 3DVNV 1E8WA 2IJ0A 1PUTA 3IFWB 1MG8A 2KDIA 2KDFB 1FXAA 1JCKB 1TS4A 4KKIA 1T0YA 4LCDE 3K9PB 1E8YA 2EMTA 2ZW1A 2OJWA 3BK1A 2Y5CA 2KD0A 4GMVA 2QCZA 3DQVA 4FN2A 1OTRB 1N5XA 3AI5A 1ZOYB 2MSED 2CU3A 1EUVB 5CTRC 2J42A 1I4QA 1R4MI 2BWES 2RSUA 1WM3A 3K9OB 3VR8B 2YLMA 3FAHA 3MJWA 4GB9A 1SB3C 2Z59B 4NAWB 1DOIA 4AWJA 4E3CA 3BIID 3I57A 1XT9B 2OJRA 4TV3A 1T5XD 2QHOA 2ZVNA 1XLQA 3DHHC 3NVWA 3UF8A 3DDCB 1HEZE 2WNMA 3WCQA 2DZKA 1R4NI 5AZFA 4IOIE 5KHQA 4GDLB 1WM2A 1H4RA 1E0ZA 3AEEB 1N61A 3TEWA 4ANUA 2CHZA 3AE6B 1ZGUB 3FKYA 3SDLC 1YN3A 2GI9A 3Q6BA 3GZNI 1UF0A 2LGIA 2JWUA 2KFJA 3TSSA 3H7SA 1L0XB 3TEYA 1C4PA 2K3UA 3W1SA 4BFRA 4BKTA 3WIMA 1YQBA 1JMLA 4MH0E 4DXFA 3AEAB 2DENB 3AE4B 1XQQA 2WQYB 2WP9B 2JXTA 3R2IA 4WAAA 3N9YC 3MC9A 1TY2A 3C19A 5MPOA 4AOFA 2PE6B 4YXDB 3DOWA 3JW0X 3NS1A 3ALBA 2R2OA 4NAMA 2DNFA 3Q3MC 4RCOA 1MI0A 2KACA 2KMAA 4KSKC 3SEBA 3TEZA 1KLUD 1GB1A 1WGRA 4K7WA 1SJED 4W9FA 1LGRA 4OVUA 1N5WA 4G50A 2V9HA 3N1ZC 5C23A 2KWVB 3AMZA 4URKA 1BT0A 3AE3B 3TEXA 1FXIA 2AQ2B 1KJTA 1Y8RC 1WR1A 4JWUC 4JLCA 2L32A 2DAJA 4BKGA 1HZ6A 1XF5L 5AZHA 1P1AA 3OJ3A 4EZLA 3PZ7A 2D3AA 2WDRB 4KZ0A 3ZLZA 2LRWA 3QARA 3VHTC 1WSPA 2KFKB 3Q2AC 2HE7A 3OG5A 3KUZA 3EECA 4L1BA 3X0WA 1JW9D 3CSFA 1IPGA 2BYFA 5D2MB 1WGYA 2MBEA 3TBLD 3AN1A 2K6QA 3TCAA 4HJGE 4XX5A 3I3TB 3D32A 1XLNA 3AE9B 1D5XC 4UDUC 3VXWA 5GMVA 1VCBA 4KV2A 2BS2B 1YX5B 1DOYA 1OGWA 4A90A 1QT9A 3I9V1 4LLGM 2GOWA 2IGDA 2DBYA 3ZDTA 4DWFA 3T8MA 2DLBA 2M4NA 3EFCA 3TIXA 2KANA 4J3OD 2G4SA 4TKNA 4W9IA 1SJHD 2LJ5A 4M02A 2ZNVB 2KN4A 1RAXA 2G9HD 1OQYA 2IDYA 1YQ3B 1I7HA 1YJJA 3DHGC 3PZDA 5T8IA 1PGBA 3A9JB 2SEBD 3M3JA 4HDQA 2GBMA 1WX9A 3Q69A 2XEWA 2JX5A 2EELA 5AUIA 2K6DB 4LJPB 1Q5WB 3DBLB 3B2GA 3N32A 3L16A 3SFDB 5IO9A 4ANWA 1N62A 2PLPA 3MTNB 1F77A 3V61A 4ITKA 1ZDVA 1FM0D 1WJUA 4JE3B 3ZNGC 2MJEA 2G1EA 1B9RA 4NY0A 3IVFA 3DVGY 3LXFA 3QA8A 2C60A 1JWUD 4CHKA 3L08A 3PTFC 2YVCA 1VRAB 3P4RB 3UIOB 1TGZB 2MJ3A 2Z0DB 2HJ8A 1JRPA 1ET9A 1MJDA 4LDTD 3IT4B 2ZCCA 4B6WA 1FD6A 3H8HA 3DWGC 4WJQA 3Q8BA 1YX6B 4NJCA 3KWVA 5DPRA 3RCZA 4DDID 2L00B 2WXHA 3ZTCA 1V6EA 1JWBD 2Y5BB 3EUB2 3NVVA 2D11A 2K0PA 4YTNB 2QC8A 2WXPA 3ONSA 4PYUA 2YEPB 4EKUA 3U7DA 1JRUA 2JPHA 2HDEA 2VRRB 2JWZA 1FRRA 3M62B 2LGDA 3ZNZB 1CJEA 2BYVE 4GN1A 1KLGD 2V3PA 3IG3A 4RNAA 1IYFA 2LGYA 2AL6A 2BT6A 1ZXIA 5EE9A 1JQ4A 2D3GA 4HEA1 4IKGA 4AP4C 1TZOA 2MBHA 3EHVA 3L4PA 2I1KA 4XZ4A 4DXAB 1L4ZB 1R7SA 4XC2A 3AV8A 2XK5B 1SF0A 3GP7A 5HHDG 4MJSB 3KUDB 4C56C 1V49A 3B0AA 4HVBA 2CS4A 1TS5A 2VZKD 3N30A 3U52E 4LNOA 3UGBB 4EOYA 2W9NA 1IGCA 2B3AA 2L05A 4W9GA 3T3NA
chains in the Genus database with same CATH topology
4A3PA 1P9DU 2JRHA 2DYOA 2KX0A 1K8RB 2A4ZA 4TQ1A 2FCNA 3Q3JA 3QC8B 2DHZA 3VFKA 3PSEB 2ZVOA 4KDLB 1NDDA 4HLEA 4MGZE 3AULA 2ZCBA 3QIJA 5D6JB 4W9EA 2G4DB 4DBGA 3PVLA 4WQOB 3CF6E 2CR5A 2J0JA 2ZZPB 3H9DA 2KZRA 4JQWC 4E74A 1Z2MA 2L0FA 5JHAA 4GXBA 2KVRA 3KUCB 4RM9A 5TR5A 4BBNC 4FADA 2DYBA 4N9F4 2MCNB 4ANVA 2C7NB 2N1VA 1XD3B 4G0NB 4M8MA 3L54A 4FULA 1WE6A 5LXHA 3UINB 2IZVB 4IC7B 2EMSA 5HKHA 1G6JA 1WI0A 2JT4B 3ECIA 3PGEA 4I6NB 1V5TA 1WGDA 3L17A 4HPLB 1WIAA 3ZNHB 1E8ZA 2LD9A 5J2RA 4DHZE 2BF8B 1NI2A 2IY1B 2KN5A 2LZ6A 1L7YA 1PQSA 2UWQA 4ZRJA 2IYDB 3DVNV 3H7PA 3SU8X 3W1SC 4ANXA 3UQBA 1E8WA 3VAWA 3NY5A 4FJYA 2V4LA 3IFWB 3V60A 4DDGD 2KC1A 1WMHB 1YJ1A 1MG8A 2IO2B 2KDIA 2KDFB 2KOXA 2FAZA 3AU4A 3DVGX 4M0WB 3UQAA 4OVVA 4LCDE 1T0YA 2JZ3B 3K9PB 1E8YA 3RD2A 2EMTA 2L8JA 3QX1A 2IO3B 3VTWA 2KD0A 2MX2A 4FHJA 1TTNA 4GMVA 1V9JA 3DQVA 1P0RA 4FN2A 4II2B 2NVUI 1OTRB 1WX7A 3AI5A 3DBHI 2IO0B 1YD8U 2MSED 1EUVB 3A4SC 5CTRC 1AARA 4RM8A 2KWCA 4F7ZA 2PPHA 1R4MI 1SE9A 2BWES 2MWSB 4W9DA 2O2VB 2RSUA 1WM3A 3K9OB 2KO3A 2YLMA 3MJWA 4GB9A 3R3MA 2ASQA 3NS8A 2Z59B 4FJZA 4GDKB 3V6EB 4NAWB 4M8NA 3BINA 1HE8A 2LVPA 4AWJA 1P98A 4ICVA 4E3CA 1XT9B 5E6NA 2O6VB 5CHVC 2NR2A 2OJRA 2WDTB 4TV3A 3PLVA 5C1ZA 4MJSA 2MP2B 4WWOA 2QHOA 2ZVNA 4PS3A 1ISNA 1U4AA 3KH0A 4JL9A 4HJKA 3H6NA 3WALA 1OEYJ 3NHEB 2AL3A 4I6PA 3ZO5B 3IHPC 2J7QB 3UF8A 4HCNB 1GUAB 4MGIE 3DDCB 4ZYNA 3VDZA 2K39A 2DZKA 1R4NI 5AZFA 2G3QB 2FCMA 3O65B 5KHQA 4IW0A 2M1MA 4GDLB 3ZRCA 1WM2A 1H4RA 1NBFC 2NBWB 4BKSD 2I1JA 4AJYB 3V6CB 2M0XA 3ZNID 4IUMB 3ZTDA 2OOBB 2MA9B 4ANUA 5L83A 2CHZA 2D07B 4I6LB 2LGXA 2UYZB 5BO4B 4F1SA 3AU5A 3ZIMA 1EF1A 3DBLI 1ZGUB 2CHXA 3SDLC 1UBIA 2LUEA 2PE9A 3TJPA 1WGGA 3GZNI 4DHJB 2KFJA 5JH5C 3H7SA 3LJ3A 4JGHB 2JZZA 3A9KB 2KC2A 4EZJA 3W1SA 4BFRA 4BKTA 2G45B 4J6IA 3VTVA 5G55A 3WIMA 1WXMA 2NPTB 4FHKA 2L7RA 2O6VD 2ZPNA 1YQBA 4MH0E 1WXSA 2RR9A 1LQBA 4MELA 4WWNA 1GJZA 4KVGB 3JVZX 4HPMB 2DENB 3VUXA 1E5WA 1XQQA 4IM2A 4EEWA 3R7QA 1RRBA 4WAAA 4MM3A 3A1QB 4PS7A 2L3ZA 1V86A 3R66C 3APDA 3WAMA 1UELA 1Z5SB 1WJNA 2KQ7A 1WZ0A 3WAPA 4AOFA 4F8CB 5DPWA 1WH3A 1WXAA 2PE6B 4ZRIA 3DOWA 3HHMA 4KIKB 4W9JA 3JW0X 2KJRA 3ALBA 2R2OA 1S3SG 1WMHA 4IWOA 5L95C 4IM3A 3VUWA 4FA6A 4DK5A 2MRPA 2RD0A 3PT2B 3VTUA 1Q0WB 4EUTA 5CHFA 3TMPB 4KSLC 4DHJD 1F9JA 1L2NA 1WR6E 1UBQA 2K8HA 2LI5A 4BOSC 2KMAA 4KSKC 5CHWA 4GU2A 2BKRB 3ZRFA 4NJ7A 2KTRB 1A5RA 1WGRA 4MSQB 2KNBA 1WFYA 3HIZA 5JHBA 5AEKB 4K7WA 1WXVA 4W9FA 4OVUA 2IY0B 4WWPA 4G50A 5E6PA 2MW5A 4KZCA 2KLGA 2O2VA 3M63B 5DPTA 3WAOA 2BYEA 5C23A 3QHTA 2MLBA 2RGFA 2KWVB 4GDKA 2N9XA 3PV1A 2RPQA 4FLHA 4NAWA 2GBRA 3WANA 3DBSA 4URKA 1BT0A 4X57B 3CMMB 3KYDD 4HDOA 2O6VA 2C9WB 3B08A 4ICUA 4FJVB 2HD5B 1KJTA 1Y8RC 1D3ZA 2MP2A 1WR1A 4JLCA 2DAJA 4MSMB 4BKGA 3L13A 1P3QU 3L10B 2Z0EB 1CMXB 2JUOA 1WYWB 5AZHA 5G2NA 1P1AA 3OJ3A 4EZLA 5FR6A 1LXDA 3APCA 1KM7A 2M8SA 2WWZA 2FUHB 3Q3FA 3QJZA 2PJHA 4GDLA 2JVCA 2LWPA 2XBBC 4KZ0A 3ZLZA 2XK5A 2LRWA 3QARA 1KOTA 4TQ0A 2KTFA 2N4FA 4GGQA 3VHTC 3GOEA 2LVQA 2KFKB 3IBEA 5JZEB 2HE7A 4IWPA 3KUZA 2ZJDA 3EECA 2N7DA 2REXA 3X0WA 4MDKE 3R7RA 2K8BA 2FIFA 5IAAC 3A9KA 1UGMA 3CSFA 1IPGA 2BYFA 5D2MB 1LM8B 2BPSA 2C5LC 1WGYA 3VUYA 5AZGA 4MGYE 2MBEA 3TBLD 3TL5A 2GMIC 3BY4B 1UZXB 2NPTA 2JXXA 2K6QA 2BWFA 3TCAA 1IP9A 3DPDA 1S1QB 4XX5A 4ZDVA 2JRIB 3I3TB 1WF9A 3D32A 3P2BA 4P7IA 1C3TA 3OAWA 3QCAA 4MGKE 4RMAA 3VXWA 3ZKJC 5GMVA 4G11A 5DPSA 3A1QA 1VCBA 2WX1A 3B1LX 4KV2A 3W1YA 2ZEQA 1YX5B 1OGWA 1E7VA 2C7HA 1GC7A 2V3SA 1E7UA 3V62A 2NBVB 3VH3B 1I35A 2GOWA 3ML9A 2KQSA 1GNUA 2A5UA 3EFUA 3KYCD 3RZFA 3ZDTA 3ZDMC 1H8CA 4KIKA 4DWFA 3T8MA 2M4NA 2K1FA 1V2YA 3TIXA 1GG3A 2KANA 3QWZB 3ZW3A 3ZVVA 2D10A 2GBNA 4BVUC 2G4SA 2N1WA 2ZPYA 4TKNA 4W9IA 3T9LA 2LJ5A 4ASWC 2ZNVB 2PEAA 4NPNA 1RAXA 2J0KA 2MBBB 3CSTA 1OQYA 3VH4B 4HWIB 3PZDA 3A9JB 1EO6A 3RUIB 3X23A 2DX5B 3M3JA 4JIOU 4HDQA 4YL8A 2DAFA 2GBMA 4LDTB 4EFOA 1WX9A 2M17A 2KTRA 2XEWA 1WRDB 3PRMB 1LFDA 4IM0A 2L0TA 4G3XB 2K6DB 4CO7A 3PRZA 1ZW7A 1WY8A 4W9CA 4LJPB 1Q5WB 3JSVB 2KJHB 1TBEA 1OEYA 3APFA 2KHWB 3N32A 3PPAA 3L16A 4GIVA 4HK2A 2EKEC 2NS5A 4ANWA 4GSWA 2N7EA 3H1UA 1Q1OA 2FCQA 2K25A 2ZNVC 3MTNB 3PHWB 4II3B 4BKSA 3HK0A 2JY6A 3NZUA 3PREA 4NQKE 3V61A 3MHSD 1E8XA 3HM6X 4K81A 2V1YA 1WJ4A 4W9LA 5EDSA 1ZKHA 3UIPB 1WJUA 2KDBA 3ZNGC 2GBJA 2AYOB 3JYUA 3PS6A 4NY0A 3IVFA 2AWTA 1WX8A 1WE7A 3DVGY 3KVFB 3QA8A 2LVOA 2C60A 4B9KA 5J17A 3ENEA 4E71A 3SD5A 2KX3A 4CHKA 3L08A 3PTFC 2YVCA 2MBOA 3UIOB 1TZ1A 1TGZB 1YIWA 2Z0DB 2HJ8A 2GBKA 4PYZA 1V5OA 1J19A 4A3OA 2LXAA 2KK8A 4LDTD 4DHZB 2ZCCA 4B6WA 1X1MA 4BBNF 2KFKA 3U30A 2KMCA 4WJQA 3ML8A 2IBIB 4NNJB 4K7SA 5D94A 3QK0A 1YX6B 4IG7B 4K1RB 3VQIA 5DPRA 3RCZA 4DDID 2L00B 2MQJA 2NCNA 2FNJB 2R2QA 4W9HA 3U8ZA 3ZTCA 1RLFA 1V6EA 3H7PB 5DCNA 4B95A 4BOZB 1V80A 2Y5BB 3N3KB 2KDEB 2D11A 4WJNA 5CX3A 2D2QA 4A20A 1WJ6A 3ONSA 4WJOA 3RZWC 1QZEA 5KHOA 4PYUA 2DZIA 4KDIC 4EKUA 5E6OA 3U7DA 2WYQA 1JRUA 2JPHA 2VRRB 2DZJA 2JF5A 3EC8A 2JWZA 3OLMD 1GC6A 3NZSA 3M62B 2LASA 1V81A 2LGDA 5D7GA 3ZNZB 4IWQA 2N9PC 2BYVE 2NBUA 4GN1A 3SHQA 1FXTB 1SGHA 2CHWA 3L0WB 2KXJA 3IG3A 4MEMA 2LRUA 3OJ4B 1IYFA 2LGYA 4W9KA 2AL6A 4TUUA 4AUQC 3RULA 1WGHA 4NJ6A 3M95A 3PLUA 5LXIB 2D3GA 4GOCA 1VD2A 4AP4C 4ZRKA 2WX0A 2CKHB 2AEHA 1I42A 2MBHA 3NOBA 3EHVA 1EF5A 2K8CA 3PHXB 4HCPB 1M94A 3C0RB 1J8CA 1RFAA 2I1KA 3LDZE 3RYTA 4XZ4A 3AXCA 2J0MA 2DYMA 4K7UA 4DXAB 4XC2A 5LLIA 3QAQA 1UH6A 3KW5B 3S2AA 4NQLB 2XK5B 3DBRI 3A9JA 3DCGA 3A4RA 1KLVA 4MJSB 1J0GA 2BKFA 3A33B 3KUDB 4PS8A 4LJOB 2BGFA 2FIDA 3QQ8B 1V49A 2DZMA 1E90A 2KKCA 3B0AA 3ZUNA 2L76A 2IO1B 4HVBA 2CS4A 3N30A 3PRPB 3DVNU 2KWUB 4HXDA 4WJPA 3RT3B 4CYEA 1UD7A 3JSVA 3UGBB 2LXCA 4AJWA 1C1YB 4EOYA 2KJ6A 2W9NA 2N9EB 3WA0A 5J18A 2CU1A 2MBQA 3VVWB 2C7MB 1SIFA 2B3AA 4EZKA 2L05A 4FBJB 2FCSA 3HM3A 4W9GA 5IA7A 2KLCA 1WZ3A 2HTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3P A;  1P9D U;  2JRH A;  2DYO A;  2KX0 A;  1K8R B;  2A4Z A;  4TQ1 A;  2FCN A;  3Q3J A;  3QC8 B;  2DHZ A;  3VFK A;  3PSE B;  2ZVO A;  4KDL B;  1NDD A;  4HLE A;  4MGZ E;  3AUL A;  2ZCB A;  3QIJ A;  5D6J B;  4W9E A;  2G4D B;  4DBG A;  3PVL A;  4WQO B;  3CF6 E;  2CR5 A;  2J0J A;  2ZZP B;  3H9D A;  2KZR A;  4JQW C;  4E74 A;  1Z2M A;  2L0F A;  5JHA A;  4GXB A;  2KVR A;  3KUC B;  4RM9 A;  5TR5 A;  4BBN C;  4FAD A;  2DYB A;  4N9F 4;  2MCN B;  4ANV A;  2C7N B;  2N1V A;  1XD3 B;  4G0N B;  4M8M A;  3L54 A;  4FUL A;  1WE6 A;  5LXH A;  3UIN B;  2IZV B;  4IC7 B;  2EMS A;  5HKH A;  1G6J A;  1WI0 A;  2JT4 B;  3ECI A;  3PGE A;  4I6N B;  1V5T A;  1WGD A;  3L17 A;  4HPL B;  1WIA A;  3ZNH B;  1E8Z A;  2LD9 A;  5J2R A;  4DHZ E;  2BF8 B;  1NI2 A;  2IY1 B;  2KN5 A;  2LZ6 A;  1L7Y A;  1PQS A;  2UWQ A;  4ZRJ A;  2IYD B;  3DVN V;  3H7P A;  3SU8 X;  3W1S C;  4ANX A;  3UQB A;  1E8W A;  3VAW A;  3NY5 A;  4FJY A;  2V4L A;  3IFW B;  3V60 A;  4DDG D;  2KC1 A;  1WMH B;  1YJ1 A;  1MG8 A;  2IO2 B;  2KDI A;  2KDF B;  2KOX A;  2FAZ A;  3AU4 A;  3DVG X;  4M0W B;  3UQA A;  4OVV A;  4LCD E;  1T0Y A;  2JZ3 B;  3K9P B;  1E8Y A;  3RD2 A;  2EMT A;  2L8J A;  3QX1 A;  2IO3 B;  3VTW A;  2KD0 A;  2MX2 A;  4FHJ A;  1TTN A;  4GMV A;  1V9J A;  3DQV A;  1P0R A;  4FN2 A;  4II2 B;  2NVU I;  1OTR B;  1WX7 A;  3AI5 A;  3DBH I;  2IO0 B;  1YD8 U;  2MSE D;  1EUV B;  3A4S C;  5CTR C;  1AAR A;  4RM8 A;  2KWC A;  4F7Z A;  2PPH A;  1R4M I;  1SE9 A;  2BWE S;  2MWS B;  4W9D A;  2O2V B;  2RSU A;  1WM3 A;  3K9O B;  2KO3 A;  2YLM A;  3MJW A;  4GB9 A;  3R3M A;  2ASQ A;  3NS8 A;  2Z59 B;  4FJZ A;  4GDK B;  3V6E B;  4NAW B;  4M8N A;  3BIN A;  1HE8 A;  2LVP A;  4AWJ A;  1P98 A;  4ICV A;  4E3C A;  1XT9 B;  5E6N A;  2O6V B;  5CHV C;  2NR2 A;  2OJR A;  2WDT B;  4TV3 A;  3PLV A;  5C1Z A;  4MJS A;  2MP2 B;  4WWO A;  2QHO A;  2ZVN A;  4PS3 A;  1ISN A;  1U4A A;  3KH0 A;  4JL9 A;  4HJK A;  3H6N A;  3WAL A;  1OEY J;  3NHE B;  2AL3 A;  4I6P A;  3ZO5 B;  3IHP C;  2J7Q B;  3UF8 A;  4HCN B;  1GUA B;  4MGI E;  3DDC B;  4ZYN A;  3VDZ A;  2K39 A;  2DZK A;  1R4N I;  5AZF A;  2G3Q B;  2FCM A;  3O65 B;  5KHQ A;  4IW0 A;  2M1M A;  4GDL B;  3ZRC A;  1WM2 A;  1H4R A;  1NBF C;  2NBW B;  4BKS D;  2I1J A;  4AJY B;  3V6C B;  2M0X A;  3ZNI D;  4IUM B;  3ZTD A;  2OOB B;  2MA9 B;  4ANU A;  5L83 A;  2CHZ A;  2D07 B;  4I6L B;  2LGX A;  2UYZ B;  5BO4 B;  4F1S A;  3AU5 A;  3ZIM A;  1EF1 A;  3DBL I;  1ZGU B;  2CHX A;  3SDL C;  1UBI A;  2LUE A;  2PE9 A;  3TJP A;  1WGG A;  3GZN I;  4DHJ B;  2KFJ A;  5JH5 C;  3H7S A;  3LJ3 A;  4JGH B;  2JZZ A;  3A9K B;  2KC2 A;  4EZJ A;  3W1S A;  4BFR A;  4BKT A;  2G45 B;  4J6I A;  3VTV A;  5G55 A;  3WIM A;  1WXM A;  2NPT B;  4FHK A;  2L7R A;  2O6V D;  2ZPN A;  1YQB A;  4MH0 E;  1WXS A;  2RR9 A;  1LQB A;  4MEL A;  4WWN A;  1GJZ A;  4KVG B;  3JVZ X;  4HPM B;  2DEN B;  3VUX A;  1E5W A;  1XQQ A;  4IM2 A;  4EEW A;  3R7Q A;  1RRB A;  4WAA A;  4MM3 A;  3A1Q B;  4PS7 A;  2L3Z A;  1V86 A;  3R66 C;  3APD A;  3WAM A;  1UEL A;  1Z5S B;  1WJN A;  2KQ7 A;  1WZ0 A;  3WAP A;  4AOF A;  4F8C B;  5DPW A;  1WH3 A;  1WXA A;  2PE6 B;  4ZRI A;  3DOW A;  3HHM A;  4KIK B;  4W9J A;  3JW0 X;  2KJR A;  3ALB A;  2R2O A;  1S3S G;  1WMH A;  4IWO A;  5L95 C;  4IM3 A;  3VUW A;  4FA6 A;  4DK5 A;  2MRP A;  2RD0 A;  3PT2 B;  3VTU A;  1Q0W B;  4EUT A;  5CHF A;  3TMP B;  4KSL C;  4DHJ D;  1F9J A;  1L2N A;  1WR6 E;  1UBQ A;  2K8H A;  2LI5 A;  4BOS C;  2KMA A;  4KSK C;  5CHW A;  4GU2 A;  2BKR B;  3ZRF A;  4NJ7 A;  2KTR B;  1A5R A;  1WGR A;  4MSQ B;  2KNB A;  1WFY A;  3HIZ A;  5JHB A;  5AEK B;  4K7W A;  1WXV A;  4W9F A;  4OVU A;  2IY0 B;  4WWP A;  4G50 A;  5E6P A;  2MW5 A;  4KZC A;  2KLG A;  2O2V A;  3M63 B;  5DPT A;  3WAO A;  2BYE A;  5C23 A;  3QHT A;  2MLB A;  2RGF A;  2KWV B;  4GDK A;  2N9X A;  3PV1 A;  2RPQ A;  4FLH A;  4NAW A;  2GBR A;  3WAN A;  3DBS A;  4URK A;  1BT0 A;  4X57 B;  3CMM B;  3KYD D;  4HDO A;  2O6V A;  2C9W B;  3B08 A;  4ICU A;  4FJV B;  2HD5 B;  1KJT A;  1Y8R C;  1D3Z A;  2MP2 A;  1WR1 A;  4JLC A;  2DAJ A;  4MSM B;  4BKG A;  3L13 A;  1P3Q U;  3L10 B;  2Z0E B;  1CMX B;  2JUO A;  1WYW B;  5AZH A;  5G2N A;  1P1A A;  3OJ3 A;  4EZL A;  5FR6 A;  1LXD A;  3APC A;  1KM7 A;  2M8S A;  2WWZ A;  2FUH B;  3Q3F A;  3QJZ A;  2PJH A;  4GDL A;  2JVC A;  2LWP A;  2XBB C;  4KZ0 A;  3ZLZ A;  2XK5 A;  2LRW A;  3QAR A;  1KOT A;  4TQ0 A;  2KTF A;  2N4F A;  4GGQ A;  3VHT C;  3GOE A;  2LVQ A;  2KFK B;  3IBE A;  5JZE B;  2HE7 A;  4IWP A;  3KUZ A;  2ZJD A;  3EEC A;  2N7D A;  2REX A;  3X0W A;  4MDK E;  3R7R A;  2K8B A;  2FIF A;  5IAA C;  3A9K A;  1UGM A;  3CSF A;  1IPG A;  2BYF A;  5D2M B;  1LM8 B;  2BPS A;  2C5L C;  1WGY A;  3VUY A;  5AZG A;  4MGY E;  2MBE A;  3TBL D;  3TL5 A;  2GMI C;  3BY4 B;  1UZX B;  2NPT A;  2JXX A;  2K6Q A;  2BWF A;  3TCA A;  1IP9 A;  3DPD A;  1S1Q B;  4XX5 A;  4ZDV A;  2JRI B;  3I3T B;  1WF9 A;  3D32 A;  3P2B A;  4P7I A;  1C3T A;  3OAW A;  3QCA A;  4MGK E;  4RMA A;  3VXW A;  3ZKJ C;  5GMV A;  4G11 A;  5DPS A;  3A1Q A;  1VCB A;  2WX1 A;  3B1L X;  4KV2 A;  3W1Y A;  2ZEQ A;  1YX5 B;  1OGW A;  1E7V A;  2C7H A;  1GC7 A;  2V3S A;  1E7U A;  3V62 A;  2NBV B;  3VH3 B;  1I35 A;  2GOW A;  3ML9 A;  2KQS A;  1GNU A;  2A5U A;  3EFU A;  3KYC D;  3RZF A;  3ZDT A;  3ZDM C;  1H8C A;  4KIK A;  4DWF A;  3T8M A;  2M4N A;  2K1F A;  1V2Y A;  3TIX A;  1GG3 A;  2KAN A;  3QWZ B;  3ZW3 A;  3ZVV A;  2D10 A;  2GBN A;  4BVU C;  2G4S A;  2N1W A;  2ZPY A;  4TKN A;  4W9I A;  3T9L A;  2LJ5 A;  4ASW C;  2ZNV B;  2PEA A;  4NPN A;  1RAX A;  2J0K A;  2MBB B;  3CST A;  1OQY A;  3VH4 B;  4HWI B;  3PZD A;  3A9J B;  1EO6 A;  3RUI B;  3X23 A;  2DX5 B;  3M3J A;  4JIO U;  4HDQ A;  4YL8 A;  2DAF A;  2GBM A;  4LDT B;  4EFO A;  1WX9 A;  2M17 A;  2KTR A;  2XEW A;  1WRD B;  3PRM B;  1LFD A;  4IM0 A;  2L0T A;  4G3X B;  2K6D B;  4CO7 A;  3PRZ A;  1ZW7 A;  1WY8 A;  4W9C A;  4LJP B;  1Q5W B;  3JSV B;  2KJH B;  1TBE A;  1OEY A;  3APF A;  2KHW B;  3N32 A;  3PPA A;  3L16 A;  4GIV A;  4HK2 A;  2EKE C;  2NS5 A;  4ANW A;  4GSW A;  2N7E A;  3H1U A;  1Q1O A;  2FCQ A;  2K25 A;  2ZNV C;  3MTN B;  3PHW B;  4II3 B;  4BKS A;  3HK0 A;  2JY6 A;  3NZU A;  3PRE A;  4NQK E;  3V61 A;  3MHS D;  1E8X A;  3HM6 X;  4K81 A;  2V1Y A;  1WJ4 A;  4W9L A;  5EDS A;  1ZKH A;  3UIP B;  1WJU A;  2KDB A;  3ZNG C;  2GBJ A;  2AYO B;  3JYU A;  3PS6 A;  4NY0 A;  3IVF A;  2AWT A;  1WX8 A;  1WE7 A;  3DVG Y;  3KVF B;  3QA8 A;  2LVO A;  2C60 A;  4B9K A;  5J17 A;  3ENE A;  4E71 A;  3SD5 A;  2KX3 A;  4CHK A;  3L08 A;  3PTF C;  2YVC A;  2MBO A;  3UIO B;  1TZ1 A;  1TGZ B;  1YIW A;  2Z0D B;  2HJ8 A;  2GBK A;  4PYZ A;  1V5O A;  1J19 A;  4A3O A;  2LXA A;  2KK8 A;  4LDT D;  4DHZ B;  2ZCC A;  4B6W A;  1X1M A;  4BBN F;  2KFK A;  3U30 A;  2KMC A;  4WJQ A;  3ML8 A;  2IBI B;  4NNJ B;  4K7S A;  5D94 A;  3QK0 A;  1YX6 B;  4IG7 B;  4K1R B;  3VQI A;  5DPR A;  3RCZ A;  4DDI D;  2L00 B;  2MQJ A;  2NCN A;  2FNJ B;  2R2Q A;  4W9H A;  3U8Z A;  3ZTC A;  1RLF A;  1V6E A;  3H7P B;  5DCN A;  4B95 A;  4BOZ B;  1V80 A;  2Y5B B;  3N3K B;  2KDE B;  2D11 A;  4WJN A;  5CX3 A;  2D2Q A;  4A20 A;  1WJ6 A;  3ONS A;  4WJO A;  3RZW C;  1QZE A;  5KHO A;  4PYU A;  2DZI A;  4KDI C;  4EKU A;  5E6O A;  3U7D A;  2WYQ A;  1JRU A;  2JPH A;  2VRR B;  2DZJ A;  2JF5 A;  3EC8 A;  2JWZ A;  3OLM D;  1GC6 A;  3NZS A;  3M62 B;  2LAS A;  1V81 A;  2LGD A;  5D7G A;  3ZNZ B;  4IWQ A;  2N9P C;  2BYV E;  2NBU A;  4GN1 A;  3SHQ A;  1FXT B;  1SGH A;  2CHW A;  3L0W B;  2KXJ A;  3IG3 A;  4MEM A;  2LRU A;  3OJ4 B;  1IYF A;  2LGY A;  4W9K A;  2AL6 A;  4TUU A;  4AUQ C;  3RUL A;  1WGH A;  4NJ6 A;  3M95 A;  3PLU A;  5LXI B;  2D3G A;  4GOC A;  1VD2 A;  4AP4 C;  4ZRK A;  2WX0 A;  2CKH B;  2AEH A;  1I42 A;  2MBH A;  3NOB A;  3EHV A;  1EF5 A;  2K8C A;  3PHX B;  4HCP B;  1M94 A;  3C0R B;  1J8C A;  1RFA A;  2I1K A;  3LDZ E;  3RYT A;  4XZ4 A;  3AXC A;  2J0M A;  2DYM A;  4K7U A;  4DXA B;  4XC2 A;  5LLI A;  3QAQ A;  1UH6 A;  3KW5 B;  3S2A A;  4NQL B;  2XK5 B;  3DBR I;  3A9J A;  3DCG A;  3A4R A;  1KLV A;  4MJS B;  1J0G A;  2BKF A;  3A33 B;  3KUD B;  4PS8 A;  4LJO B;  2BGF A;  2FID A;  3QQ8 B;  1V49 A;  2DZM A;  1E90 A;  2KKC A;  3B0A A;  3ZUN A;  2L76 A;  2IO1 B;  4HVB A;  2CS4 A;  3N30 A;  3PRP B;  3DVN U;  2KWU B;  4HXD A;  4WJP A;  3RT3 B;  4CYE A;  1UD7 A;  3JSV A;  3UGB B;  2LXC A;  4AJW A;  1C1Y B;  4EOY A;  2KJ6 A;  2W9N A;  2N9E B;  3WA0 A;  5J18 A;  2CU1 A;  2MBQ A;  3VVW B;  2C7M B;  1SIF A;  2B3A A;  4EZK A;  2L05 A;  4FBJ B;  2FCS A;  3HM3 A;  4W9G A;  5IA7 A;  2KLC A;  1WZ3 A;  2HTH A; 
#chains in the Genus database with same CATH topology
 1ET6 A;  1P9D U;  2JRH A;  2KX0 A;  1V1O A;  3ZJT A;  1QOA A;  3AED B;  4YWG G;  1NDD A;  1XCQ L;  4HLE A;  5HG2 A;  1OQR A;  1FCL A;  4MGZ E;  2G4D B;  1Q10 A;  3PVL A;  1K51 A;  2ZZP B;  5EE1 A;  2DWQ A;  3KUC B;  3MC8 A;  4RM9 A;  2C7N B;  3AH7 A;  4MT5 A;  4MM3 B;  2EMS A;  3AEG B;  1WGD A;  4HPL B;  1L6V A;  1WIA A;  3ZNH B;  5J2R A;  2BF8 B;  2IY1 B;  1PQS A;  2IYD B;  3H7P A;  3SU8 X;  3W1S C;  2V4L A;  3V60 A;  3NZ3 A;  4BAX A;  3BVG A;  4M0W B;  3DVG X;  2KMM A;  3LYY A;  2JZ3 B;  3RD2 A;  4YSX B;  1WGK A;  3VTW A;  2L83 A;  1VZ6 A;  1WX7 A;  4C7Y A;  1M4V A;  2IO0 B;  2LGS A;  1YD8 U;  3A4S C;  4RM8 A;  4F7Z A;  5HI1 A;  3BK2 A;  1ENF A;  1QKZ A;  3RN9 C;  2KO3 A;  1I4R A;  4FJZ A;  2ASQ A;  3NS8 A;  4GDK B;  4WIP A;  2HTM E;  3BIN A;  1P98 A;  4ICV A;  1LO5 D;  3Q3O C;  1XXG A;  2O6V B;  2NR2 A;  5C1Z A;  4YT0 B;  4JL9 A;  2AL3 A;  2J7Q B;  2XNA C;  3ZJV A;  1OQQ A;  2J52 A;  2K39 A;  4A8X C;  3O65 B;  4P16 A;  4ZRP A;  3ZRC A;  4BKS D;  2I1J A;  3V6C B;  4IUM B;  3ZTD A;  1VZ8 A;  2MA9 B;  2WXI A;  4N6E B;  3E56 A;  5BO4 B;  4I6L B;  2LGX A;  2UYZ B;  4OHJ A;  4ZOH C;  1L4D B;  2LUE A;  1IBX A;  2PE9 A;  4DHJ B;  5JH5 C;  2V3N A;  1IGD A;  2JZZ A;  2PTL A;  3A9K B;  2I38 A;  4BZA A;  1V1P A;  1J7A A;  2RDB C;  2PIA A;  2G45 B;  1I4P A;  5G55 A;  3SR6 A;  1SSN A;  2BYT A;  1GJZ A;  4MEL A;  4HPM B;  3VUX A;  4C4V A;  4RFB A;  2J53 A;  1L0V B;  2NTT A;  3DWM A;  1P7F A;  3WAM A;  1CK1 A;  1Z5S B;  4LNN A;  2KAJ A;  3BYY B;  4KIK B;  2KJR A;  3DBR B;  1PYW D;  1STE A;  5L95 C;  2D5G A;  4IM3 A;  2QDF A;  3PT2 B;  3VTU A;  5CHF A;  4KSL C;  1DYQ A;  1UBQ A;  1ROE A;  3E9S A;  3ZRF A;  3RMK C;  4ARC A;  2LHD A;  1RM6 C;  5GXG B;  4P6V F;  4MSQ B;  2KNB A;  3V05 A;  1FIQ A;  2IY0 B;  5E6P A;  2JZP A;  1WRI A;  4YTP B;  3MC0 B;  4NZL B;  3M63 B;  5DPT A;  3WAO A;  3RNG C;  4B0M A;  3P42 A;  2MLB A;  4NAW A;  1VLB A;  2RPQ A;  3BYT B;  1RWS A;  2FE8 A;  1K50 A;  3B08 A;  4ICU A;  1F0Z A;  3ZXR A;  3N20 C;  3L10 B;  2SAK A;  2EKI A;  3Q8C A;  5FR6 A;  1LXD A;  3W5V B;  1KM7 A;  3QJZ A;  2PJH A;  4GDL A;  2JVC A;  2LWP A;  1CQV A;  4N59 A;  4TQ0 A;  2N4F A;  2LVQ A;  3IBE A;  3BVZ A;  2REX A;  3NUH B;  1J7C A;  5IP4 D;  4ARI A;  3VUY A;  4MGY E;  3RI7 C;  3TL5 A;  2GMI C;  2JXX A;  1JWS D;  3DPD A;  1S1Q B;  4ZDV A;  2KT7 A;  3DBH B;  1PGX A;  2IPK D;  3QCA A;  1I4G A;  4RMA A;  4G11 A;  1N60 A;  3W1Y A;  1TKG A;  3VH3 B;  4RH6 A;  3V62 A;  4USA A;  1XLP A;  2Y5P A;  3ZDM C;  1H8C A;  1A70 A;  1GG3 A;  1KFY B;  3QWZ B;  3ZW3 A;  3ZVV A;  1F2R I;  4HKQ A;  2N1W A;  2PEA A;  2X8X X;  2J0K A;  3CST A;  4HWI B;  5AUK A;  1YNT E;  1LFD A;  4IM0 A;  2L0T A;  4CO7 A;  3PRZ A;  1OEY A;  2KHW B;  4HK2 A;  2EKE C;  2AQ1 B;  3BZD B;  4YSZ B;  4AQ7 A;  3N1X C;  4GSW A;  4CQN A;  2K25 A;  4BKS A;  1GAQ B;  3HK0 A;  2JY6 A;  4WWM A;  3ABV B;  4NQK E;  1HQR D;  4K81 A;  3UIP B;  2KDB A;  2GBJ A;  3PS6 A;  2HJ1 A;  5E6J A;  5BMH A;  1WE7 A;  3KVF B;  3ENE A;  1L0Y B;  2WHI A;  4A9A A;  1T0R C;  4XWT A;  4A3O A;  4DHZ B;  4MH8 A;  4MAC A;  2KFK A;  3U30 A;  1FRD A;  4OVZ A;  5IN7 A;  4IG7 B;  1C79 A;  3IT6 B;  4WAF A;  3U8Z A;  1SXT A;  1RLF A;  4BOZ B;  3HVD A;  1V80 A;  5TSS A;  2K9X A;  3AE5 B;  2WS3 B;  3N3K B;  2KDE B;  2KWD A;  3I5J C;  1HTQ A;  1WJ6 A;  3RZW C;  3FC4 A;  1ESF A;  1XO3 A;  4KDI C;  1YN5 A;  2WYQ A;  1KTK A;  3J9C A;  2KDM A;  2DZJ A;  3EC8 A;  2LAS A;  1V81 A;  2M19 A;  5D7G A;  4C80 A;  2N9P C;  2NBU A;  1E7P B;  1EM7 A;  3SHQ A;  1FXT B;  2CHW A;  2OHF A;  1VDV A;  4MEM A;  4W9K A;  4TUU A;  4AUQ C;  4ZRQ A;  1WGH A;  3RUL A;  5LXI B;  4GOC A;  1VD2 A;  1DOX A;  4RF1 A;  3PHX B;  3C0R B;  1J8C A;  1RFA A;  1T0S C;  4K7U A;  2J0M A;  2DYM A;  1ACC A;  1UH6 A;  3A9J A;  4OZC A;  2N7J A;  3DCG A;  2XN9 C;  3A4R A;  4PS8 A;  5H8Y E;  4LJO B;  1VR9 A;  1TYG B;  3AEC B;  3P63 A;  1F52 A;  5G5G A;  2KKC A;  1E90 A;  2IO1 B;  1QOF A;  1ZUD 2;  1NYR A;  2KWU B;  4WJP A;  4FXC A;  3RT3 B;  1MHH E;  3Q3N C;  3Q8F A;  2N9E B;  1C77 A;  3W9C B;  1FNU A;  2BB6 A;  3NVZ A;  1K8R B;  2A4Z A;  3Q3J A;  4R3D A;  1BXT A;  2DHZ A;  3VFK A;  3NVY A;  4KDL B;  2TSS A;  2WXO A;  3AUL A;  2ZCB A;  4W9E A;  4DBG A;  2CR5 A;  2IGH A;  1P7E A;  3H9D A;  4E74 A;  1Z2M A;  4M00 A;  3UI3 A;  5JHA A;  4S0R A;  3FIL B;  5TR5 A;  3P4P B;  2DYB A;  1XD3 B;  4G0N B;  1AYF A;  5LXH A;  3UIN B;  2IZV B;  4IC7 B;  4YTM B;  1TS3 A;  1WI0 A;  3PGE A;  1V5T A;  3L17 A;  1PFD A;  3P4S B;  3GE8 C;  1E8Z A;  2LD9 A;  1NI2 A;  2KN5 A;  1L7Y A;  2UWQ A;  3KQ4 A;  1I42 A;  5FKA C;  1EU3 A;  3UQB A;  3VAW A;  4DDG D;  2KC1 A;  1WMH B;  3NJT A;  3UQA A;  3AU4 A;  2WXL A;  1EWC A;  2L8J A;  2X38 A;  1UWM A;  4FHJ A;  1TTN A;  1K52 A;  2NVU I;  5JXV A;  1F2R C;  1HTO A;  3T3O A;  1AAR A;  2KWC A;  2N9L A;  2PPH A;  2BVC A;  2WU5 B;  2MWS B;  4W9D A;  2O2V B;  1HE8 A;  2LVP A;  2WDT B;  1E6E B;  3PLV A;  4MJS A;  2MP2 B;  2WGS A;  4PS3 A;  1U4A A;  3KH0 A;  3WAL A;  1OEY J;  3NHE B;  4I6P A;  1TY0 A;  3GE3 C;  3IHP C;  4HCN B;  3ETR A;  2LFI A;  2CJO A;  3RNE C;  2FCM A;  4HRS A;  4IW0 A;  1GB4 A;  1AW7 A;  3GB1 A;  1NBF C;  1ZXH A;  2BS3 B;  2M0X A;  5H92 C;  5L83 A;  2D07 B;  4F1S A;  1GOZ A;  1TJE A;  1EF1 A;  3DBL I;  2CHX A;  1UBI A;  2E3T A;  4OZB A;  3TJP A;  3B2F A;  4PT5 A;  3LJ3 A;  4O1N A;  1YMH E;  1WXM A;  2NPT B;  4FHK A;  2L7R A;  2ZPN A;  2PKO A;  1HZ5 A;  1FNV A;  4KVG B;  2BS4 B;  3JVZ X;  4EEW A;  1I4H A;  4MM3 A;  3A1Q B;  4PS7 A;  4XDC A;  2L3Z A;  3VRA B;  1V86 A;  4C7Z A;  2K5P A;  5IOI A;  1UEL A;  1WJN A;  4ZHO A;  2KQ7 A;  1WZ0 A;  3WAP A;  5DPW A;  1F1H A;  4W9J A;  1L6U A;  2LEK A;  2QIL A;  4TSS A;  4M0W A;  3VUW A;  4DK5 A;  4M01 A;  4DQO C;  4EUT A;  1N63 A;  1L2N A;  1WR6 E;  1QQR A;  5CHW A;  4GU2 A;  2BKR B;  4NJ7 A;  1WYG A;  2KTR B;  2QJL A;  1EU4 A;  3HIZ A;  5JHB A;  1WXV A;  5EE3 A;  2MW5 A;  2KLG A;  5G5H A;  3U2S C;  3ZXV A;  4LTU A;  2BYE A;  4GDK A;  3PV1 A;  3WAN A;  3DBS A;  4X57 B;  3CMM B;  4HDO A;  2O6V A;  1WWT A;  1ZDX A;  2PW9 A;  4B0E A;  2BBC A;  4LNI A;  3L13 A;  4L23 A;  5D3I B;  1CMX B;  2WXQ A;  2QEJ C;  1VJK A;  1AWD A;  1FFV A;  3ZYY X;  5G2N A;  3APC A;  2M8S A;  2FUH B;  3Q3F A;  2XBB C;  2BW2 A;  1HA5 A;  2FBW B;  1UWX A;  1XEE A;  4D2K A;  1C76 A;  3W5U B;  2ZJD A;  2H89 B;  4MDK E;  3Q8E A;  2FIF A;  5IAA C;  3A9K A;  3U4E G;  1LM8 B;  2BPS A;  2C5L C;  5AZG A;  1NYQ A;  4WQM A;  1YOV B;  3BY4 B;  5BYQ A;  1IP9 A;  3P2B A;  4XGA B;  1C3T A;  3Q8A A;  3OAW A;  3MP9 A;  4MGK E;  3ZKJ C;  2ON8 A;  1R4M B;  5DPS A;  1E10 A;  2WX1 A;  3B1L X;  2ZEQ A;  1E7V A;  2ZW0 A;  1MHX A;  2V3S A;  1C78 A;  1E7U A;  4XE0 A;  2KQS A;  3CWI A;  1GNU A;  3KYC D;  3EFU A;  4KIK A;  1T3Q A;  4US8 A;  3EGR A;  3C8Y A;  4ASW C;  3RNC C;  2MBB B;  2RDH A;  3VH4 B;  2WXJ A;  3RUI B;  4RGO S;  1R4N B;  4YL8 A;  4OZA A;  4LDT B;  2M17 A;  1JWM D;  1T0Q C;  1IBX B;  4W9C A;  3JSV B;  2KJH B;  1TBE A;  3APF A;  2D3B A;  4LNF A;  2LMC A;  2NS5 A;  3GZN B;  2FCQ A;  2ZNV C;  3PHW B;  4II3 B;  1FCC C;  3NZU A;  3MHS D;  1C4A A;  3HM6 X;  2V1Y A;  1WJ4 A;  4W9L A;  5EDS A;  3JYU A;  1FNW A;  4OW0 A;  1J7B A;  4B9K A;  3GS2 A;  4KGR A;  3SD5 A;  1FO4 A;  2WLB A;  2MBO A;  4HPP A;  1SIJ A;  2GBK A;  1J19 A;  2KK8 A;  2V0G A;  1X1M A;  4BBN F;  2I2Y A;  1YQ4 B;  3ML8 A;  4NNJ B;  4K7S A;  2VH2 A;  3QK0 A;  4K1R B;  4K3C A;  2MQJ A;  2NCN A;  5DCN A;  4WH4 A;  4B95 A;  1C4C A;  2ONQ A;  2D3C A;  4WJN A;  5LNK 1;  5CX3 A;  2D2Q A;  4A20 A;  5KHO A;  2GRI A;  2QIE B;  2VZK B;  5E6O A;  2W54 A;  1QOB A;  2BQQ A;  2JF5 A;  5IKC M;  3NZS A;  4IWQ A;  2KXJ A;  4YSY B;  2LRU A;  2WU2 B;  2L1A A;  3OJ4 B;  4NJ6 A;  3M95 A;  4A55 A;  3IAS 1;  5BMG A;  3NRZ A;  3NOB A;  1EF5 A;  2K8C A;  3R2T A;  2N9K A;  1AN8 A;  1M94 A;  3NG0 A;  3LDZ E;  3I63 C;  3RYT A;  1MPE A;  3BWU D;  3QAQ A;  3S2A A;  3DBR I;  2QSD A;  2Y3A A;  2VH1 A;  2LJI A;  4XDD A;  1QOG A;  3QQ8 B;  2IND C;  3DVN U;  4CYE A;  2M56 B;  4S17 A;  2LXC A;  4AJW A;  4DXG A;  2KJ6 A;  5J18 A;  4RGN A;  2CU1 A;  2MBQ A;  2YEP F;  3VVW B;  2C7M B;  1SIF A;  3AE7 B;  2FCS A;  3RPF C;  1TS2 A;  3N1Y C;  5IA7 A;  2KLC A;  5HFY A;  2W82 A;  4TQ1 A;  1BML C;  2FCN A;  3QC8 B;  3PSE B;  4HRO A;  1CZP A;  1KRH A;  3KLS X;  3CF6 E;  2WXF A;  2J0J A;  1FMA D;  4JQW C;  2L0F A;  4GXB A;  2WXK A;  2JU6 X;  2MCN B;  4ANV A;  1E9M A;  4M8M A;  3L54 A;  4FUL A;  1IUE A;  5HKH A;  1G6J A;  2JT4 B;  3ECI A;  1TT5 B;  4Q2J A;  4DHZ E;  3O13 A;  4EZJ A;  1ZP0 B;  3NY5 A;  4FJY A;  1C9F A;  1YJ1 A;  2Q5W D;  2IO2 B;  2MJD A;  2KOX A;  3ZQ4 A;  2FAZ A;  2RDG A;  4OVV A;  5I4D A;  1JWA D;  3QX1 A;  3HRD D;  2IO3 B;  2MX2 A;  4II2 B;  1V9J A;  1P0R A;  3V3X A;  1PDX A;  3DBH I;  5FR3 A;  4JPS A;  5BMI A;  3BVM A;  1SE9 A;  3EA6 A;  3B9J A;  2CJN A;  4WUR A;  4L2Y A;  3R3M A;  3V6E B;  4M8N A;  5BYS A;  1NEN B;  5E6N A;  5CHV C;  2RMM A;  4WWO A;  2PVG C;  1ISN A;  2JYT A;  4HJK A;  3H6N A;  1HXY D;  1XLO A;  3ZO5 B;  1GUA B;  4MGI E;  1SEB D;  4ZYN A;  3VDZ A;  2G3Q B;  1D5Z C;  2M1M A;  3MJ5 A;  1JRO A;  1K53 A;  2NBW B;  3RNA C;  4AJY B;  4XYC A;  3ZNI D;  2OOB B;  3AEB B;  3RNB C;  3AU5 A;  3ZIM A;  1KH0 A;  1WGG A;  2W3S A;  1GPX A;  4JGH B;  2E6X A;  2KC2 A;  1RFK A;  4J6I A;  3VTV A;  1YN4 A;  2O6V D;  2LHE A;  3OWE B;  3FIL A;  1WXS A;  2RR9 A;  1LQB A;  2WXR A;  3AM9 A;  4WWN A;  1WXQ A;  1E5W A;  4IM2 A;  3R7Q A;  1RRB A;  1SBB B;  4K3B A;  3MFG A;  4P1C C;  3RFZ B;  3R66 C;  3APD A;  2WXG A;  4F8C B;  1WH3 A;  1WXA A;  4ZRI A;  4KGT A;  3HHM A;  1S3S G;  1WMH A;  4IWO A;  4FA6 A;  5FK9 C;  2MRP A;  2RD0 A;  3HUI A;  1Q0W B;  4ZHP A;  1QF6 A;  3TMP B;  5BYR A;  4DHJ D;  1F9J A;  2AQ3 B;  2K8H A;  2LI5 A;  4BOS C;  4HKZ E;  2RPV A;  1A5R A;  1WFY A;  5AEK B;  3U7Z A;  4WWP A;  3RNF C;  1N6Z A;  3KWL A;  4KZC A;  2O2V A;  4AS1 A;  1SE4 A;  3QHT A;  2RGF A;  2N9X A;  4FLH A;  2GBR A;  1TKY A;  2INC C;  1UUP A;  3KYD D;  2C9W B;  2IGG A;  3W2D A;  4FJV B;  2HD5 B;  2KYW A;  1D3Z A;  2MP2 A;  2MH7 A;  2PMV A;  4MSM B;  4ACF A;  1P3Q U;  2Z0E B;  2JUO A;  1UGJ A;  1WYW B;  1B1Z A;  2WWZ A;  1XCT L;  4IDI A;  2V4I B;  2K22 A;  2XK5 A;  1KOT A;  2KTF A;  4GGQ A;  1YJI A;  3GOE A;  1FPY A;  5JZE B;  4IWP A;  2WDV B;  2N7D A;  3R7R A;  2K8B A;  2MHJ A;  4LK0 M;  5EE0 A;  1NVI D;  1UGM A;  3HVZ A;  2INN E;  2B76 B;  1NI3 A;  3TUO A;  1UZX B;  2NPT A;  3P4Q B;  1MFW A;  2BWF A;  3CIR B;  2JYE A;  2JRI B;  1WF9 A;  4ZYS A;  4P7I A;  1TKE A;  4EE2 A;  3A1Q A;  4XWW A;  3LB8 C;  2C7H A;  1GC7 A;  1FEH A;  2NBV B;  1I35 A;  3ML9 A;  2A5U A;  3ZGZ A;  3PZ8 A;  4LNK A;  3RZF A;  2GLS A;  1V2Y A;  2K1F A;  3R8B A;  4A6Q A;  4BVU C;  2D10 A;  2GBN A;  3PO0 A;  1D5M C;  2ZPY A;  3T9L A;  4H2A A;  4NPN A;  3AEF B;  1V97 A;  1SE2 A;  1EO6 A;  3X23 A;  2DX5 B;  4JIO U;  2DAF A;  3AB5 A;  4P1B C;  4EFO A;  2KTR A;  1WRD B;  3PRM B;  2W3R A;  4G3X B;  4RF0 A;  1ZW7 A;  1WY8 A;  2OED A;  2LUM A;  3PPA A;  1FFU A;  1I4X A;  2KQ4 X;  4GIV A;  4QAY A;  1Y56 A;  2N7E A;  3H1U A;  1Q1O A;  2R61 A;  2WXM A;  4N58 A;  3PRE A;  2WXN A;  1E8X A;  1ZKH A;  2QMT A;  2AYO B;  3DHI C;  2AWT A;  1QIL A;  1WX8 A;  2LVO A;  5J17 A;  4E71 A;  2KX3 A;  2W55 A;  1TZ1 A;  1MG4 A;  1EWY C;  1YIW A;  3IXS A;  3IAM 1;  2FUG 1;  4PYZ A;  1V5O A;  2LXA A;  2MEK A;  4RGT A;  1JAL A;  2JSV X;  4US9 A;  3ZJU A;  2KMC A;  1DGJ A;  2IBI B;  2Z8L A;  2H88 B;  5D94 A;  4JX1 C;  2INP E;  3VQI A;  2FNJ B;  2R2Q A;  4W9H A;  2GB1 A;  3H7P B;  3URY A;  1D6E C;  4WJO A;  1SE3 A;  1QZE A;  2DZI A;  4JWS C;  3P1M A;  1L5P A;  3VRB B;  3OLM D;  1GC6 A;  2N0S B;  4C00 A;  1SGH A;  3L0W B;  4KGS A;  3PLU A;  1PGA A;  2L52 A;  4KKJ A;  2WX0 A;  2CKH B;  2AEH A;  4ZRK A;  1VZ7 A;  4PK1 A;  4HCP B;  1UNS A;  2JQR B;  3AXC A;  2WDQ B;  2BB5 A;  5LLI A;  2M0A A;  1BUI C;  3KW5 B;  4NQL B;  1KLV A;  1J0G A;  2BKF A;  3A33 B;  2BGF A;  2PVO D;  2UU7 A;  2FID A;  2DZM A;  3ZUN A;  2L76 A;  3PRP B;  4HXD A;  4REZ A;  3SFE B;  1UD7 A;  3JSV A;  3VR9 B;  1C1Y B;  1OFF A;  3WA0 A;  4GLS C;  2AX5 A;  4EZK A;  4FBJ B;  3HM3 A;  2KVZ A;  3AE1 B;  1WZ3 A;  2HTH A;  4A3P A;  2DYO A;  3AE2 B;  1QLB B;  3MHZ A;  1D4B A;  2NTS A;  2ZVO A;  4RGM A;  4TMA B;  1V1P B;  2BTE A;  3QIJ A;  5D6J B;  1NEK B;  1ZPS A;  4WQO B;  2KZR A;  3AE8 B;  2KVR A;  1ZE3 D;  4FAD A;  4BBN C;  4N9F 4;  2N1V A;  4KX6 B;  1V8C A;  5C3J B;  1MVK A;  1KF6 B;  4C4V B;  1WE6 A;  2ICI A;  1T6B X;  1TIF A;  2ACZ B;  4I6N B;  5D3D A;  1RYJ A;  2J4X A;  3Q14 C;  5C2T B;  2LZ6 A;  4ZRJ A;  4ANX A;  2NMQ A;  3DVN V;  1E8W A;  2IJ0 A;  1PUT A;  3IFW B;  1MG8 A;  2KDI A;  2KDF B;  1FXA A;  1JCK B;  1TS4 A;  4KKI A;  1T0Y A;  4LCD E;  3K9P B;  1E8Y A;  2EMT A;  2ZW1 A;  2OJW A;  3BK1 A;  2Y5C A;  2KD0 A;  4GMV A;  2QCZ A;  3DQV A;  4FN2 A;  1OTR B;  1N5X A;  3AI5 A;  1ZOY B;  2MSE D;  2CU3 A;  1EUV B;  5CTR C;  2J42 A;  1I4Q A;  1R4M I;  2BWE S;  2RSU A;  1WM3 A;  3K9O B;  3VR8 B;  2YLM A;  3FAH A;  3MJW A;  4GB9 A;  1SB3 C;  2Z59 B;  4NAW B;  1DOI A;  4AWJ A;  4E3C A;  3BII D;  3I57 A;  1XT9 B;  2OJR A;  4TV3 A;  1T5X D;  2QHO A;  2ZVN A;  1XLQ A;  3DHH C;  3NVW A;  3UF8 A;  3DDC B;  1HEZ E;  2WNM A;  3WCQ A;  2DZK A;  1R4N I;  5AZF A;  4IOI E;  5KHQ A;  4GDL B;  1WM2 A;  1H4R A;  1E0Z A;  3AEE B;  1N61 A;  3TEW A;  4ANU A;  2CHZ A;  3AE6 B;  1ZGU B;  3FKY A;  3SDL C;  1YN3 A;  2GI9 A;  3Q6B A;  3GZN I;  1UF0 A;  2LGI A;  2JWU A;  2KFJ A;  3TSS A;  3H7S A;  1L0X B;  3TEY A;  1C4P A;  2K3U A;  3W1S A;  4BFR A;  4BKT A;  3WIM A;  1YQB A;  1JML A;  4MH0 E;  4DXF A;  3AEA B;  2DEN B;  3AE4 B;  1XQQ A;  2WQY B;  2WP9 B;  2JXT A;  3R2I A;  4WAA A;  3N9Y C;  3MC9 A;  1TY2 A;  3C19 A;  5MPO A;  4AOF A;  2PE6 B;  4YXD B;  3DOW A;  3JW0 X;  3NS1 A;  3ALB A;  2R2O A;  4NAM A;  2DNF A;  3Q3M C;  4RCO A;  1MI0 A;  2KAC A;  2KMA A;  4KSK C;  3SEB A;  3TEZ A;  1KLU D;  1GB1 A;  1WGR A;  4K7W A;  1SJE D;  4W9F A;  1LGR A;  4OVU A;  1N5W A;  4G50 A;  2V9H A;  3N1Z C;  5C23 A;  2KWV B;  3AMZ A;  4URK A;  1BT0 A;  3AE3 B;  3TEX A;  1FXI A;  2AQ2 B;  1KJT A;  1Y8R C;  1WR1 A;  4JWU C;  4JLC A;  2L32 A;  2DAJ A;  4BKG A;  1HZ6 A;  1XF5 L;  5AZH A;  1P1A A;  3OJ3 A;  4EZL A;  3PZ7 A;  2D3A A;  2WDR B;  4KZ0 A;  3ZLZ A;  2LRW A;  3QAR A;  3VHT C;  1WSP A;  2KFK B;  3Q2A C;  2HE7 A;  3OG5 A;  3KUZ A;  3EEC A;  4L1B A;  3X0W A;  1JW9 D;  3CSF A;  1IPG A;  2BYF A;  5D2M B;  1WGY A;  2MBE A;  3TBL D;  3AN1 A;  2K6Q A;  3TCA A;  4HJG E;  4XX5 A;  3I3T B;  3D32 A;  1XLN A;  3AE9 B;  1D5X C;  4UDU C;  3VXW A;  5GMV A;  1VCB A;  4KV2 A;  2BS2 B;  1YX5 B;  1DOY A;  1OGW A;  4A90 A;  1QT9 A;  3I9V 1;  4LLG M;  2GOW A;  2IGD A;  2DBY A;  3ZDT A;  4DWF A;  3T8M A;  2DLB A;  2M4N A;  3EFC A;  3TIX A;  2KAN A;  4J3O D;  2G4S A;  4TKN A;  4W9I A;  1SJH D;  2LJ5 A;  4M02 A;  2ZNV B;  2KN4 A;  1RAX A;  2G9H D;  1OQY A;  2IDY A;  1YQ3 B;  1I7H A;  1YJJ A;  3DHG C;  3PZD A;  5T8I A;  1PGB A;  3A9J B;  2SEB D;  3M3J A;  4HDQ A;  2GBM A;  1WX9 A;  3Q69 A;  2XEW A;  2JX5 A;  2EEL A;  5AUI A;  2K6D B;  4LJP B;  1Q5W B;  3DBL B;  3B2G A;  3N32 A;  3L16 A;  3SFD B;  5IO9 A;  4ANW A;  1N62 A;  2PLP A;  3MTN B;  1F77 A;  3V61 A;  4ITK A;  1ZDV A;  1FM0 D;  1WJU A;  4JE3 B;  3ZNG C;  2MJE A;  2G1E A;  1B9R A;  4NY0 A;  3IVF A;  3DVG Y;  3LXF A;  3QA8 A;  2C60 A;  1JWU D;  4CHK A;  3L08 A;  3PTF C;  2YVC A;  1VRA B;  3P4R B;  3UIO B;  1TGZ B;  2MJ3 A;  2Z0D B;  2HJ8 A;  1JRP A;  1ET9 A;  1MJD A;  4LDT D;  3IT4 B;  2ZCC A;  4B6W A;  1FD6 A;  3H8H A;  3DWG C;  4WJQ A;  3Q8B A;  1YX6 B;  4NJC A;  3KWV A;  5DPR A;  3RCZ A;  4DDI D;  2L00 B;  2WXH A;  3ZTC A;  1V6E A;  1JWB D;  2Y5B B;  3EUB 2;  3NVV A;  2D11 A;  2K0P A;  4YTN B;  2QC8 A;  2WXP A;  3ONS A;  4PYU A;  2YEP B;  4EKU A;  3U7D A;  1JRU A;  2JPH A;  2HDE A;  2VRR B;  2JWZ A;  1FRR A;  3M62 B;  2LGD A;  3ZNZ B;  1CJE A;  2BYV E;  4GN1 A;  1KLG D;  2V3P A;  3IG3 A;  4RNA A;  1IYF A;  2LGY A;  2AL6 A;  2BT6 A;  1ZXI A;  5EE9 A;  1JQ4 A;  2D3G A;  4HEA 1;  4IKG A;  4AP4 C;  1TZO A;  2MBH A;  3EHV A;  3L4P A;  2I1K A;  4XZ4 A;  4DXA B;  1L4Z B;  1R7S A;  4XC2 A;  3AV8 A;  2XK5 B;  1SF0 A;  3GP7 A;  5HHD G;  4MJS B;  3KUD B;  4C56 C;  1V49 A;  3B0A A;  4HVB A;  2CS4 A;  1TS5 A;  2VZK D;  3N30 A;  3U52 E;  4LNO A;  3UGB B;  4EOY A;  2W9N A;  1IGC A;  2B3A A;  2L05 A;  4W9G A;  3T3N A; 
#chains in the Genus database with same CATH homology
 4A3P A;  1P9D U;  2JRH A;  2DYO A;  2KX0 A;  1K8R B;  2A4Z A;  4TQ1 A;  2FCN A;  3Q3J A;  3QC8 B;  2DHZ A;  3VFK A;  3PSE B;  2ZVO A;  4KDL B;  1NDD A;  4HLE A;  4MGZ E;  3AUL A;  2ZCB A;  3QIJ A;  5D6J B;  4W9E A;  2G4D B;  4DBG A;  3PVL A;  4WQO B;  3CF6 E;  2CR5 A;  2J0J A;  2ZZP B;  3H9D A;  2KZR A;  4JQW C;  4E74 A;  1Z2M A;  2L0F A;  5JHA A;  4GXB A;  2KVR A;  3KUC B;  4RM9 A;  5TR5 A;  4BBN C;  4FAD A;  2DYB A;  4N9F 4;  2MCN B;  4ANV A;  2C7N B;  2N1V A;  1XD3 B;  4G0N B;  4M8M A;  3L54 A;  4FUL A;  1WE6 A;  5LXH A;  3UIN B;  2IZV B;  4IC7 B;  2EMS A;  5HKH A;  1G6J A;  1WI0 A;  2JT4 B;  3ECI A;  3PGE A;  4I6N B;  1V5T A;  1WGD A;  3L17 A;  4HPL B;  1WIA A;  3ZNH B;  1E8Z A;  2LD9 A;  5J2R A;  4DHZ E;  2BF8 B;  1NI2 A;  2IY1 B;  2KN5 A;  2LZ6 A;  1L7Y A;  1PQS A;  2UWQ A;  4ZRJ A;  2IYD B;  3DVN V;  3H7P A;  3SU8 X;  3W1S C;  4ANX A;  3UQB A;  1E8W A;  3VAW A;  3NY5 A;  4FJY A;  2V4L A;  3IFW B;  3V60 A;  4DDG D;  2KC1 A;  1WMH B;  1YJ1 A;  1MG8 A;  2IO2 B;  2KDI A;  2KDF B;  2KOX A;  2FAZ A;  3AU4 A;  3DVG X;  4M0W B;  3UQA A;  4OVV A;  4LCD E;  1T0Y A;  2JZ3 B;  3K9P B;  1E8Y A;  3RD2 A;  2EMT A;  2L8J A;  3QX1 A;  2IO3 B;  3VTW A;  2KD0 A;  2MX2 A;  4FHJ A;  1TTN A;  4GMV A;  1V9J A;  3DQV A;  1P0R A;  4FN2 A;  4II2 B;  2NVU I;  1OTR B;  1WX7 A;  3AI5 A;  3DBH I;  2IO0 B;  1YD8 U;  2MSE D;  1EUV B;  3A4S C;  5CTR C;  1AAR A;  4RM8 A;  2KWC A;  4F7Z A;  2PPH A;  1R4M I;  1SE9 A;  2BWE S;  2MWS B;  4W9D A;  2O2V B;  2RSU A;  1WM3 A;  3K9O B;  2KO3 A;  2YLM A;  3MJW A;  4GB9 A;  3R3M A;  2ASQ A;  3NS8 A;  2Z59 B;  4FJZ A;  4GDK B;  3V6E B;  4NAW B;  4M8N A;  3BIN A;  1HE8 A;  2LVP A;  4AWJ A;  1P98 A;  4ICV A;  4E3C A;  1XT9 B;  5E6N A;  2O6V B;  5CHV C;  2NR2 A;  2OJR A;  2WDT B;  4TV3 A;  3PLV A;  5C1Z A;  4MJS A;  2MP2 B;  4WWO A;  2QHO A;  2ZVN A;  4PS3 A;  1ISN A;  1U4A A;  3KH0 A;  4JL9 A;  4HJK A;  3H6N A;  3WAL A;  1OEY J;  3NHE B;  2AL3 A;  4I6P A;  3ZO5 B;  3IHP C;  2J7Q B;  3UF8 A;  4HCN B;  1GUA B;  4MGI E;  3DDC B;  4ZYN A;  3VDZ A;  2K39 A;  2DZK A;  1R4N I;  5AZF A;  2G3Q B;  2FCM A;  3O65 B;  5KHQ A;  4IW0 A;  2M1M A;  4GDL B;  3ZRC A;  1WM2 A;  1H4R A;  1NBF C;  2NBW B;  4BKS D;  2I1J A;  4AJY B;  3V6C B;  2M0X A;  3ZNI D;  4IUM B;  3ZTD A;  2OOB B;  2MA9 B;  4ANU A;  5L83 A;  2CHZ A;  2D07 B;  4I6L B;  2LGX A;  2UYZ B;  5BO4 B;  4F1S A;  3AU5 A;  3ZIM A;  1EF1 A;  3DBL I;  1ZGU B;  2CHX A;  3SDL C;  1UBI A;  2LUE A;  2PE9 A;  3TJP A;  1WGG A;  3GZN I;  4DHJ B;  2KFJ A;  5JH5 C;  3H7S A;  3LJ3 A;  4JGH B;  2JZZ A;  3A9K B;  2KC2 A;  4EZJ A;  3W1S A;  4BFR A;  4BKT A;  2G45 B;  4J6I A;  3VTV A;  5G55 A;  3WIM A;  1WXM A;  2NPT B;  4FHK A;  2L7R A;  2O6V D;  2ZPN A;  1YQB A;  4MH0 E;  1WXS A;  2RR9 A;  1LQB A;  4MEL A;  4WWN A;  1GJZ A;  4KVG B;  3JVZ X;  4HPM B;  2DEN B;  3VUX A;  1E5W A;  1XQQ A;  4IM2 A;  4EEW A;  3R7Q A;  1RRB A;  4WAA A;  4MM3 A;  3A1Q B;  4PS7 A;  2L3Z A;  1V86 A;  3R66 C;  3APD A;  3WAM A;  1UEL A;  1Z5S B;  1WJN A;  2KQ7 A;  1WZ0 A;  3WAP A;  4AOF A;  4F8C B;  5DPW A;  1WH3 A;  1WXA A;  2PE6 B;  4ZRI A;  3DOW A;  3HHM A;  4KIK B;  4W9J A;  3JW0 X;  2KJR A;  3ALB A;  2R2O A;  1S3S G;  1WMH A;  4IWO A;  5L95 C;  4IM3 A;  3VUW A;  4FA6 A;  4DK5 A;  2MRP A;  2RD0 A;  3PT2 B;  3VTU A;  1Q0W B;  4EUT A;  5CHF A;  3TMP B;  4KSL C;  4DHJ D;  1F9J A;  1L2N A;  1WR6 E;  1UBQ A;  2K8H A;  2LI5 A;  4BOS C;  2KMA A;  4KSK C;  5CHW A;  4GU2 A;  2BKR B;  3ZRF A;  4NJ7 A;  2KTR B;  1A5R A;  1WGR A;  4MSQ B;  2KNB A;  1WFY A;  3HIZ A;  5JHB A;  5AEK B;  4K7W A;  1WXV A;  4W9F A;  4OVU A;  2IY0 B;  4WWP A;  4G50 A;  5E6P A;  2MW5 A;  4KZC A;  2KLG A;  2O2V A;  3M63 B;  5DPT A;  3WAO A;  2BYE A;  5C23 A;  3QHT A;  2MLB A;  2RGF A;  2KWV B;  4GDK A;  2N9X A;  3PV1 A;  2RPQ A;  4FLH A;  4NAW A;  2GBR A;  3WAN A;  3DBS A;  4URK A;  1BT0 A;  4X57 B;  3CMM B;  3KYD D;  4HDO A;  2O6V A;  2C9W B;  3B08 A;  4ICU A;  4FJV B;  2HD5 B;  1KJT A;  1Y8R C;  1D3Z A;  2MP2 A;  1WR1 A;  4JLC A;  2DAJ A;  4MSM B;  4BKG A;  3L13 A;  1P3Q U;  3L10 B;  2Z0E B;  1CMX B;  2JUO A;  1WYW B;  5AZH A;  5G2N A;  1P1A A;  3OJ3 A;  4EZL A;  5FR6 A;  1LXD A;  3APC A;  1KM7 A;  2M8S A;  2WWZ A;  2FUH B;  3Q3F A;  3QJZ A;  2PJH A;  4GDL A;  2JVC A;  2LWP A;  2XBB C;  4KZ0 A;  3ZLZ A;  2XK5 A;  2LRW A;  3QAR A;  1KOT A;  4TQ0 A;  2KTF A;  2N4F A;  4GGQ A;  3VHT C;  3GOE A;  2LVQ A;  2KFK B;  3IBE A;  5JZE B;  2HE7 A;  4IWP A;  3KUZ A;  2ZJD A;  3EEC A;  2N7D A;  2REX A;  3X0W A;  4MDK E;  3R7R A;  2K8B A;  2FIF A;  5IAA C;  3A9K A;  1UGM A;  3CSF A;  1IPG A;  2BYF A;  5D2M B;  1LM8 B;  2BPS A;  2C5L C;  1WGY A;  3VUY A;  5AZG A;  4MGY E;  2MBE A;  3TBL D;  3TL5 A;  2GMI C;  3BY4 B;  1UZX B;  2NPT A;  2JXX A;  2K6Q A;  2BWF A;  3TCA A;  1IP9 A;  3DPD A;  1S1Q B;  4XX5 A;  4ZDV A;  2JRI B;  3I3T B;  1WF9 A;  3D32 A;  3P2B A;  4P7I A;  1C3T A;  3OAW A;  3QCA A;  4MGK E;  4RMA A;  3VXW A;  3ZKJ C;  5GMV A;  4G11 A;  5DPS A;  3A1Q A;  1VCB A;  2WX1 A;  3B1L X;  4KV2 A;  3W1Y A;  2ZEQ A;  1YX5 B;  1OGW A;  1E7V A;  2C7H A;  1GC7 A;  2V3S A;  1E7U A;  3V62 A;  2NBV B;  3VH3 B;  1I35 A;  2GOW A;  3ML9 A;  2KQS A;  1GNU A;  2A5U A;  3EFU A;  3KYC D;  3RZF A;  3ZDT A;  3ZDM C;  1H8C A;  4KIK A;  4DWF A;  3T8M A;  2M4N A;  2K1F A;  1V2Y A;  3TIX A;  1GG3 A;  2KAN A;  3QWZ B;  3ZW3 A;  3ZVV A;  2D10 A;  2GBN A;  4BVU C;  2G4S A;  2N1W A;  2ZPY A;  4TKN A;  4W9I A;  3T9L A;  2LJ5 A;  4ASW C;  2ZNV B;  2PEA A;  4NPN A;  1RAX A;  2J0K A;  2MBB B;  3CST A;  1OQY A;  3VH4 B;  4HWI B;  3PZD A;  3A9J B;  1EO6 A;  3RUI B;  3X23 A;  2DX5 B;  3M3J A;  4JIO U;  4HDQ A;  4YL8 A;  2DAF A;  2GBM A;  4LDT B;  4EFO A;  1WX9 A;  2M17 A;  2KTR A;  2XEW A;  1WRD B;  3PRM B;  1LFD A;  4IM0 A;  2L0T A;  4G3X B;  2K6D B;  4CO7 A;  3PRZ A;  1ZW7 A;  1WY8 A;  4W9C A;  4LJP B;  1Q5W B;  3JSV B;  2KJH B;  1TBE A;  1OEY A;  3APF A;  2KHW B;  3N32 A;  3PPA A;  3L16 A;  4GIV A;  4HK2 A;  2EKE C;  2NS5 A;  4ANW A;  4GSW A;  2N7E A;  3H1U A;  1Q1O A;  2FCQ A;  2K25 A;  2ZNV C;  3MTN B;  3PHW B;  4II3 B;  4BKS A;  3HK0 A;  2JY6 A;  3NZU A;  3PRE A;  4NQK E;  3V61 A;  3MHS D;  1E8X A;  3HM6 X;  4K81 A;  2V1Y A;  1WJ4 A;  4W9L A;  5EDS A;  1ZKH A;  3UIP B;  1WJU A;  2KDB A;  3ZNG C;  2GBJ A;  2AYO B;  3JYU A;  3PS6 A;  4NY0 A;  3IVF A;  2AWT A;  1WX8 A;  1WE7 A;  3DVG Y;  3KVF B;  3QA8 A;  2LVO A;  2C60 A;  4B9K A;  5J17 A;  3ENE A;  4E71 A;  3SD5 A;  2KX3 A;  4CHK A;  3L08 A;  3PTF C;  2YVC A;  2MBO A;  3UIO B;  1TZ1 A;  1TGZ B;  1YIW A;  2Z0D B;  2HJ8 A;  2GBK A;  4PYZ A;  1V5O A;  1J19 A;  4A3O A;  2LXA A;  2KK8 A;  4LDT D;  4DHZ B;  2ZCC A;  4B6W A;  1X1M A;  4BBN F;  2KFK A;  3U30 A;  2KMC A;  4WJQ A;  3ML8 A;  2IBI B;  4NNJ B;  4K7S A;  5D94 A;  3QK0 A;  1YX6 B;  4IG7 B;  4K1R B;  3VQI A;  5DPR A;  3RCZ A;  4DDI D;  2L00 B;  2MQJ A;  2NCN A;  2FNJ B;  2R2Q A;  4W9H A;  3U8Z A;  3ZTC A;  1RLF A;  1V6E A;  3H7P B;  5DCN A;  4B95 A;  4BOZ B;  1V80 A;  2Y5B B;  3N3K B;  2KDE B;  2D11 A;  4WJN A;  5CX3 A;  2D2Q A;  4A20 A;  1WJ6 A;  3ONS A;  4WJO A;  3RZW C;  1QZE A;  5KHO A;  4PYU A;  2DZI A;  4KDI C;  4EKU A;  5E6O A;  3U7D A;  2WYQ A;  1JRU A;  2JPH A;  2VRR B;  2DZJ A;  2JF5 A;  3EC8 A;  2JWZ A;  3OLM D;  1GC6 A;  3NZS A;  3M62 B;  2LAS A;  1V81 A;  2LGD A;  5D7G A;  3ZNZ B;  4IWQ A;  2N9P C;  2BYV E;  2NBU A;  4GN1 A;  3SHQ A;  1FXT B;  1SGH A;  2CHW A;  3L0W B;  2KXJ A;  3IG3 A;  4MEM A;  2LRU A;  3OJ4 B;  1IYF A;  2LGY A;  4W9K A;  2AL6 A;  4TUU A;  4AUQ C;  3RUL A;  1WGH A;  4NJ6 A;  3M95 A;  3PLU A;  5LXI B;  2D3G A;  4GOC A;  1VD2 A;  4AP4 C;  4ZRK A;  2WX0 A;  2CKH B;  2AEH A;  1I42 A;  2MBH A;  3NOB A;  3EHV A;  1EF5 A;  2K8C A;  3PHX B;  4HCP B;  1M94 A;  3C0R B;  1J8C A;  1RFA A;  2I1K A;  3LDZ E;  3RYT A;  4XZ4 A;  3AXC A;  2J0M A;  2DYM A;  4K7U A;  4DXA B;  4XC2 A;  5LLI A;  3QAQ A;  1UH6 A;  3KW5 B;  3S2A A;  4NQL B;  2XK5 B;  3DBR I;  3A9J A;  3DCG A;  3A4R A;  1KLV A;  4MJS B;  1J0G A;  2BKF A;  3A33 B;  3KUD B;  4PS8 A;  4LJO B;  2BGF A;  2FID A;  3QQ8 B;  1V49 A;  2DZM A;  1E90 A;  2KKC A;  3B0A A;  3ZUN A;  2L76 A;  2IO1 B;  4HVB A;  2CS4 A;  3N30 A;  3PRP B;  3DVN U;  2KWU B;  4HXD A;  4WJP A;  3RT3 B;  4CYE A;  1UD7 A;  3JSV A;  3UGB B;  2LXC A;  4AJW A;  1C1Y B;  4EOY A;  2KJ6 A;  2W9N A;  2N9E B;  3WA0 A;  5J18 A;  2CU1 A;  2MBQ A;  3VVW B;  2C7M B;  1SIF A;  2B3A A;  4EZK A;  2L05 A;  4FBJ B;  2FCS A;  3HM3 A;  4W9G A;  5IA7 A;  2KLC A;  1WZ3 A;  2HTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...