4B95A

Pvhl-elob-elob-eloc complex_(2s,4r)-1-(2-chlorophenyl)carbonyl-n-[(4-chlorophenyl)methyl]-4-oxidanyl-pyrrolidine-2-carboxamide bound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Small-Molecule Inhibitors of the Interaction between the E3 Ligase Vhl and Hif1Alpha
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 104
sequence length 104
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4b95A00
2KDIA 2XBBC 1WXMA 4ANWA 3ZTCA 4W9KA 5L95C 2MWSB 1FXTB 3SD5A 4ZRIA 1ZGUB 4HPMB 1NBFC 1YX6B 2J0MA 2KHWB 2PEAA 3A9JB 3R3MA 3S2AA 1KJTA 1WIAA 3QAQA 3PV1A 3WA0A 4AUQC 3JSVA 1AARA 3QIJA 5LXIB 2CKHB 1RLFA 2PE6B 3PLVA 1XT9B 1R4NI 1KOTA 2AL3A 3APCA 3ZO5B 2GMIC 4EZKA 4AOFA 1EF1A 4WAAA 4KVGB 5DPWA 2REXA 4IG7B 1UZXB 2FUHB 4W9LA 2LUEA 1L7YA 2IO0B 2LVQA 2LVPA 3N32A 4BOZB 3AULA 3M3JA 4F8CB 3V62A 1EF5A 2M17A 2LXAA 4ASWC 3CSFA 3N3KB 3RZFA 4AJYB 4A3PA 3I3TB 1S1QB 1YQBA 3N30A 3SDLC 1WR6E 3RUIB 2DZKA 3M62B 3VUWA 2KWCA 3QCAA 1GG3A 2C60A 2BYVE 4TV3A 3VFKA 3X23A 2KX0A 4NAWB 4KIKA 1TZ1A 2KQ7A 3DQVA 3KUCB 3MTNB 4TQ0A 5LXHA 2EMTA 2HTHA 2EKEC 3ONSA 4YL8A 4GSWA 1WGDA 4RMAA 2MW5A 3QARA 4MGZE 2DZMA 3NZSA 1UBQA 4DHZE 2IZVB 3QC8B 1WYWB 3A9KA 1WJ4A 2R2QA 4KZ0A 2AEHA 4GGQA 4RM9A 2K1FA 4HK2A 2RSUA 1OEYJ 3APFA 3L0WB 4HXDA 3VUYA 1K8RB 3AI5A 4GMVA 3P2BA 2DHZA 4CYEA 2O6VD 4FLHA 2JRHA 4JGHB 3CF6E 1GJZA 5AZFA 5CTRC 1SE9A 4GXBA 2MLBA 4WJPA 3GZNI 2D11A 2UYZB 4W9DA 4F1SA 3JW0X 4M8MA 2BGFA 4CO7A 4B9KA 4FN2A 2MBBB 4ZRJA 3TBLD 3JVZX 2FIDA 2W9NA 3UQAA 2IO1B 2KWVB 4N9F4 2KC1A 2DZIA 3KVFB 3V61A 4MSMB 3UIPB 3L13A 2MP2B 1OGWA 2ZJDA 2C5LC 2O2VB 4OVVA 3HHMA 3ZDTA 3T8MA 2WX1A 3ECIA 1SGHA 2RGFA 2FAZA 4EZLA 1CMXB 3BY4B 4IM2A 5G2NA 1EO6A 4BBNC 3WAOA 4PS8A 2KDFB 4CHKA 4FJYA 2RD0A 3VQIA 1LFDA 3O65B 4K7UA 3DDCB 2G4DB 4ICUA 3H6NA 2LASA 3PSEB 1E8YA 3L17A 1Q5WB 1IP9A 1WE7A 2Z0DB 2KOXA 1IPGA 4LDTD 4PS3A 4W9GA 4MEMA 2O6VB 2MSED 4RM8A 2ZNVC 5J17A 3D32A 4AP4C 3OJ3A 1OQYA 1WF9A 4FHJA 4ANVA 3VAWA 5CHFA 2ZVOA 2GBNA 3UINB 4WQOB 2KMCA 4JL9A 2L05A 2M8SA 2JPHA 1D3ZA 4W9JA 2DX5B 1V49A 3QQ8B 2A5UA 3DBLI 3DOWA 3DPDA 3HM6X 2FIFA 2Z59B 5IAAC 1P3QU 4HDOA 1J0GA 4EZJA 4K1RB 2JXXA 3IG3A 1V6EA 2K8CA 2KJRA 5JHBA 5J2RA 1TBEA 3CSTA 3K9OB 3AU5A 3IHPC 3ZKJC 2KXJA 1GC6A 2CR5A 2L00B 3NOBA 1UBIA 2BYEA 4GB9A 3VTUA 3ZLZA 4A3OA 1YX5B 1VCBA 2AWTA 2IO2B 3ZNHB 4DDGD 2K8HA 3PVLA 4K7SA 3GOEA 1WX8A 1UELA 2J0JA 2KKCA 4ANXA 4IC7B 2DYMA 2KANA 5LLIA 3TIXA 3TJPA 1V86A 1VD2A 3AU4A 2WX0A 5C1ZA 3NY5A 4X57B 2O2VA 3PT2B 2NPTB 4LDTB 4IUMB 1C3TA 4NQKE 3WAPA 2LJ5A 4KDLB 1E8ZA 2PJHA 1MG8A 4XZ4A 3DCGA 4MJSB 3MHSD 2BKRB 4FULA 4JLCA 1WY8A 4DWFA 4FADA 4MGIE 5JHAA 4JQWC 4KDIC 3VH4B 2NS5A 3RYTA 2DYOA 4NPNA 2DYBA 1P0RA 4I6PA 4II3B 1V80A 1A5RA 2BWFA 2PPHA 3NZUA 1C1YB 3DVGX 3UGBB 4WWNA 3UIOB 3QWZB 1WI0A 2D07B 2G45B 2LZ6A 4LJOB 3ZNZB 1XD3B 2O6VA 4DHJB 2IY1B 5DPTA 3PREA 4G50A 2RR9A 3RZWC 1LXDA 3U30A 4BKGA 3RT3B 3ZNGC 2NBVB 1I42A 3ZRFA 2IO3B 3A4SC 3H7PA 4P7IA 3UF8A 4XC2A 3ZW3A 4KSLC 2XEWA 4FA6A 1WXAA 4W9FA 4WJQA 2KFKB 2GBRA 2KX3A 2N9EB 4MDKE 4TUUA 2KZRA 1GC7A 2JZZA 1WE6A 3M95A 3Q3FA 4EOYA 4MGKE 5D2MB 1KM7A 4I6LB 5EDSA 2JF5A 2K6QA 2JRIB 1RAXA 4B95A 3VXWA 1F9JA 2V1YA 1OEYA 4MGYE 3PRPB 3R7QA 4ZDVA 2KWUB 1SIFA 3B0AA 3LJ3A 2DZJA 3TL5A 5AEKB 5CHWA 4ANUA 3QA8A 5L83A 1P9DU 3A9JA 3K9PB 2L76A 3PS6A 2FCNA 3ZDMC 1WJ6A 2K8BA 3ZVVA 4J6IA 5D6JB 1WGGA 1OTRB 4GDLB 5AZGA 4BBNF 5E6PA 1WM3A 1J8CA 3X0WA 1LQBA 2NPTA 1WZ0A 3DBRI 2JZ3B 1WJNA 1WFYA 2HD5B 2KVRA 4G11A 5GMVA 5J18A 1GUAB 4MJSA 2LXCA 4W9HA 2MBOA 2GOWA 1P98A 2LD9A 4W9EA 1WMHB 1RRBA 2NBWB 3RULA 3VTVA 4EKUA 3VDZA 1JRUA 1V9JA 4I6NB 3PLUA 1WR1A 3JSVB 2MX2A 1WZ3A 2D3GA 3R7RA 3B1LX 2K25A 1WX7A 4EUTA 2IBIB 3V6EB 5AZHA 3DVGY 4DDID 3IFWB 5BO4B 4NAWA 5IA7A 3QK0A 2L0FA 4HCNB 4HWIB 2BWES 4IWPA 5G55A 5TR5A 1L2NA 1TTNA 3L08A 4HLEA 2M4NA 4JIOU 2L3ZA 2XK5B 5E6NA 2ZEQA 3IVFA 4FJVB 1U4AA 2KK8A 2KJ6A 2I1JA 4ZRKA 3L16A 4PYZA 4WJNA 2JT4B 4LCDE 3HIZA 2KFKA 4W9CA 2CS4A 2GBJA 2N9PC 1V5TA 2BYFA 4M8NA 5E6OA 1TGZB 3W1YA 3DBSA 4DHJD 4GOCA 3HK0A 4IM3A 3IBEA 3QX1A 2MRPA 3ZTDA 4BKTA 2J7QB 4MH0E 4DBGA 2KTRB 4PS7A 2CU1A 2BF8B 2KTFA 5DCNA 3OLMD 2LRUA 3JYUA 5KHOA 3WALA 1PQSA 3DVNU 4EFOA 4K7WA 2N1VA 4ZYNA 2NBUA 3WANA 3A4RA 2JWZA 2FNJB 2G4SA 2BKFA 5CHVC 2V3SA 3VHTC 2FCQA 3C0RB 1ZW7A 1UH6A 4G3XB 2MP2A 4GN1A 2MA9B 3ZUNA 4E74A 1I35A 1WGRA 1WJUA 2N7EA 2WWZA 4GDKB 3OJ4B 3RCZA 2CHWA 4BFRA 3EHVA 4BVUC 4DK5A 2Z0EB 2J0KA 3L10B 2LGXA 1E8XA 1H8CA 4NQLB 1V2YA 2V4LA 1WH3A 2PE9A 4FJZA 4NJ7A 1WMHA 4MSQB 4W9IA 4TQ1A 3PRMB 1WM2A 1ZKHA 3VUXA 3EECA 3B08A 3OAWA 4NY0A 3VH3B 3AXCA 3LDZE 4K81A 1QZEA 3NHEB 2WDTB 1NDDA 3PGEA 2MQJA 3H9DA 3NS8A 2KLCA 3KYCD 2MBHA 3KW5B 4FBJB 1IYFA 4WJOA 2CHXA 1T0YA 4HPLB 2KQSA 4M0WB 1Z2MA 2ZPYA 2JUOA 1E8WA 3PHXB 3U7DA 2KLGA 2WYQA 2KDEB 4HDQA 3T9LA 3R66C 2ZNVB 3TMPB 3ZIMA 3U8ZA 3WAMA 4DHZB 1HE8A 2XK5A 2LI5A 4GIVA 3BINA 1GNUA 2HJ8A 3TCAA 2NCNA 3KH0A 4PYUA 4IW0A 1UD7A 2KJHB 4XX5A 1H4RA 2ZCBA 2KO3A 3CMMB 5DPSA 3PZDA 4WWOA 4KSKC 2M0XA 3M63B 4LJPB 2GBKA 2FCSA 4DXAB 1XQQA 2DENB 2LGDA 3EFUA 3PRZA 1WRDB 4URKA 2KTRA 2L0TA 4KZCA 3ZNID 4HJKA 2N1WA 1V81A 3V6CB 3VVWB 3SU8X 1WXVA 3A1QB 1ISNA 3ALBA 2AYOB 2LGYA 3L54A 2KD0A 2D10A 1EUVB 1E7UA 4TKNA 4FHKA 4GU2A 2B3AA 3PPAA 4GDKA 2DAJA 5CX3A 1M94A 2DAFA 4MM3A 2KDBA 2Y5BB 1X1MA 3Q3JA 1E7VA 5HKHA 2GBMA 2LRWA 3DVNV 1E90A 3ML8A 3PTFC 2OOBB 2JY6A 2KC2A 2ZPNA 5C23A 1BT0A 2G3QB 3HM3A 3ZRCA 1V5OA 2HE7A 1E5WA 2AL6A 1WX9A 1Z5SB 3H7SA 1LM8B 1R4MI 3W1SA 3UQBA 2D2QA 4OVUA 2KNBA 4AWJA 2MBQA 3EC8A 5D94A 4B6WA 4E71A 2C7MB 5JH5C 2BPSA 3APDA 2ASQA 2LVOA 4E3CA 2L7RA 2K6DB 2NVUI 1RFAA 2C9WB 2JVCA 2MBEA 2ZCCA 1J19A 1Y8RC 2ZZPB 4BKSA 3W1SC 1P1AA 1YIWA 2KMAA 1YJ1A 3KUZA 1Q0WB 2EMSA 2M1MA 3ML9A 1WGHA 2N7DA 4G0NB 4HCPB 4II2B 3RD2A 2CHZA 1NI2A 4NNJB 4A20A 5D7GA 5JZEB 2NR2A 2FCMA 2K39A 2R2OA 3QJZA 4ICVA 4WWPA 3SHQA 1UGMA 3QHTA 2VRRB 2QHOA 2N4FA 4NJ6A 5DPRA 3WIMA 2OJRA 2LWPA 2YLMA 4IWQA 4KIKB 1YD8U 2UWQA 4AJWA 1KLVA 2KFJA 2YVCA 2IYDB 3ENEA 3MJWA 4BKSD 1G6JA 3H7PB 2MCNB 2C7NB 3VTWA 2KN5A 4BOSC 1WXSA 3A9KB 2L8JA 3A33B 2I1KA 4HVBA 1WGYA 4IWOA 3KYDD 3PHWB 3V60A 3A1QA 4KV2A 2A4ZA 1Q1OA 2N9XA 2ZVNA 4EEWA 3DBHI 5FR6A 2RPQA 4GDLA 2IY0B 3KUDB 2C7HA 4MELA 4F7ZA 4IM0A 5KHQA 1S3SG 3H1UA
chains in the Genus database with same CATH superfamily
1JROA 4GLSC 4HPMB 2J0MA 1SBBB 3PLVA 1QF6A 3MHZA 2AL3A 3APCA 3ZO5B 2GMIC 2FUG1 4WAAA 1L0VB 1VJKA 3E56A 5DPWA 1K50A 2WQYB 1UNSA 2LVPA 1TS3A 1XCTL 3CSFA 2WXIA 3W9CB 2DZKA 3ABVB 3LXFA 1GG3A 2KX0A 4TMAB 1FPYA 3TSSA 4TQ0A 5LXHA 4GSWA 2WU5B 1ET9A 3A9KA 4LTUA 2AEHA 2IGDA 2V0GA 4HK2A 1OEYJ 4HXDA 1K8RB 4GMVA 1PUTA 2WHIA 3H8HA 1KTKA 4GXBA 3HVZA 1C4CA 4W9DA 4F1SA 2E6XA 4NAMA 2MBBB 4ZRJA 3TBLD 5EE3A 2FIDA 2IO1B 2KWVB 1VRAB 3KVFB 4MSMB 5C3JB 1OGWA 5E6JA 3N9YC 4OVVA 3ZDTA 1MHHE 3T8MA 2WX1A 3AH7A 3NVYA 2RGFA 3SR6A 4M0WA 3NVZA 3VQIA 1SXTA 2G4DB 2WLBA 4ICUA 4JX1C 2Y3AA 3PSEB 1Q5WB 1WE7A 1QOBA 2KOXA 1XLOA 4MEMA 1N60A 4RM8A 4RGMA 5HG2A 3Q3MC 4AP4C 1OQYA 1WF9A 4FHJA 1LGRA 4ANVA 3VAWA 4WQOB 3RFZB 2L05A 4W9JA 4R3DA 4AS1A 1V49A 3HM6X 3P1MA 4ZRQA 1PGBA 4OVZA 5JHBA 2KJRA 5J2RA 1TBEA 1IGDA 2KXJA 2CR5A 3IT6B 2BYEA 3ZLZA 1SE4A 1T0SC 1I4XA 3GOEA 2J0JA 2SAKA 4IC7B 4PT5A 2DYMA 3AE5B 3TIXA 3NG0A 1HQRD 3OG5A 2WX0A 1E6EB 4X57B 4LDTB 3P63A 2QC8A 1C77A 1C3TA 1RM6C 4KDLB 1E8ZA 3CWIA 2BKRB 1WXQA 4DWFA 2Q5WD 3Q8EA 1FNVA 2PPHA 3NZUA 1C1YB 4WWNA 4HEA1 1I4HA 4LJOB 5DPTA 4BKGA 3RT3B 1FNUA 1I42A 3BZDB 1FXAA 3ZW3A 1AN8A 4FA6A 1C79A 4RCOA 4W9FA 2KFKB 2LJIA 1YN4A 3ZXRA 1YN3A 1GC7A 1K52A 1KM7A 1YN5A 1D5MC 2V1YA 2VZKB 4DXFA 1OEYA 3R7QA 2W54A 1QQRA 2DZJA 3A9JA 2MJEA 3K9PB 2QILA 3Q2AC 3N1YC 1QOGA 1OTRB 2PMVA 3PZ8A 2BS3B 1WZ0A 4G11A 2KVRA 2KWDA 1GUAB 2INCC 5IO9A 4W9EA 1RRBA 2NBWB 3IXSA 3RULA 1JRUA 3URYA 3DHHC 1ZDVA 2MX2A 3B1LX 4LK0M 2IBIB 1TYGB 5AZHA 2RPVA 1FRRA 4DDID 3IFWB 5IA7A 1MVKA 4IWPA 5TR5A 5G55A 1CK1A 4JIOU 2XK5B 2H89B 2ZEQA 3DWGC 4FJVB 3Q69A 2N9LA 4WJNA 4YTNB 2PVOD 3HIZA 3R2TA 2KFKA 3T3OA 2CS4A 2GBJA 1TGZB 3AE4B 4DHJD 2L52A 4GOCA 1GB1A 4XWTA 4US8A 3W5UB 3ZTDA 1L0XB 3MC0B 4LLGM 4DBGA 2L1AA 4PS7A 2KTFA 1V1OA 2LRUA 3JYUA 1OQRA 1PQSA 3DVNU 1NYQA 3SFEB 4K7WA 4ZYNA 3WANA 4YT0B 3A4RA 2BKFA 5CHVC 3VHTC 4QAYA 3C0RB 1ZW7A 2JWUA 4GDKB 2BQQA 3OJ4B 4BVUC 3L10B 3RNEC 1F0ZA 1V2YA 1WH3A 4MSQB 4S17A 2CU3A 3B08A 2FBWB 4K81A 1QZEA 1L4DB 2WDTB 1NDDA 2MQJA 3H9DA 2GB1A 2MBHA 3KW5B 1T0YA 2KQSA 2WYQA 3LYYA 1SEBD 5BYQA 3TMPB 5FR3A 3WAMA 2XK5A 3SFDB 4M01A 3KH0A 3KLSX 5HI1A 2ZCBA 4WWOA 1KH0A 2M0XA 3M63B 4LJPB 1BMLC 3Q6BA 1XQQA 1KLUD 2DENB 4A90A 3PRZA 2JYTA 3FKYA 4URKA 2WP9B 4P16A 3N1XC 1V81A 1ISNA 2LGYA 2D10A 2J53A 3VRBB 1KLGD 4TKNA 3NZ3A 1SJHD 4N6EB 3LB8C 3GE8C 4GDKA 3PPAA 5CX3A 2WXPA 4Q2JA 1MI0A 2PVGC 1Z5SB 1ZDXA 3H7SA 4PK1A 3UQBA 1I4RA 4A55A 3EC8A 4E71A 2X8XX 2WXRA 3C8YA 4B6WA 2L7RA 2NVUI 2JVCA 1WYGA 1PFDA 2ZCCA 3AMZA 1QOFA 3ML9A 3RD2A 4M02A 3RN9C 4ZYSA 1T0RC 3SHQA 3QJZA 4ICVA 1TZOA 1N61A 3QHTA 3WIMA 4IWQA 2KDMA 4HKZE 2IYDB 3ENEA 2WXHA 3RNFC 1G6JA 3NJTA 3VTWA 1PGXA 2X38A 1J7AA 2DWQA 4KV2A 3AV8A 1C76A 1L4ZB 1UWMA 3BVGA 3DBHI 2RPQA 4GDLA 3KUDB 2C7HA 2W82A 4F7ZA 1XEEA 1S3SG 3H1UA 2WXFA 4NZLB 2XBBC 1WXMA 2N7JA 2QMTA 5TSSA 1YX6B 3R3MA 3S2AA 1AARA 2DLBA 1DGJA 1RLFA 1KOTA 4EZKA 1P7EA 1JWBD 3B2GA 1FFVA 2LUEA 2LVQA 3AULA 2VH2A 2M17A 2LXAA 1IBXB 1TKEA 3RZFA 4A3PA 4AJYB 3I3TB 1S1QB 1YQBA 2XNAC 3N30A 2QEJC 3TEXA 2KYWA 3QCAA 3VFKA 3BWUD 4NAWB 4CQNA 2B76B 2LMCA 2EMTA 3ONSA 4IOIE 2DZMA 3NZSA 4DHZE 3QC8B 1WYWB 2R2QA 2K1FA 1CJEA 3L0WB 3AI5A 2O6VD 4FLHA 4JGHB 5AZFA 5CTRC 2J4XA 2NMQA 3RNBC 2D11A 2BGFA 4B9KA 2W9NA 5T8IA 2KC1A 1VZ7A 3V61A 3UIPB 1TS4A 3L13A 1B1ZA 4LNFA 2O2VB 1EU4A 3I57A 3EFCA 4ZHOA 5G2NA 4JE3B 4PS8A 2KDFB 4CHKA 2HJ1A 1HZ5A 3O65B 3UI3A 3DDCB 4OHJA 1QT9A 1I4PA 3NVWA 1E8YA 3FC4A 2MSED 3RNGC 4XGAB 5J17A 3D32A 1QKZA 1AW7A 3L4PA 5CHFA 2GBNA 2KMCA 1D3ZA 2DX5B 3DPDA 4YTMB 5IAAC 4H2AA 4IKGA 3N20C 1J0GA 4EZJA 2JXXA 3IG3A 1TKGA 1RWSA 1V6EA 3Q8FA 2KN4A 1D4BA 1JRPA 3AU5A 3IHPC 2L00B 1D5ZC 3AEEB 2K5PA 3ZNHB 2AQ1B 2MH7A 4K7SA 1WX8A 4ANXA 1JALA 3TEZA 5LNK1 2KANA 5LLIA 3TJPA 1V86A 1VD2A 2OEDA 3AU4A 5C1ZA 5I4DA 2O2VA 4JWUC 3B9JA 2R61A 1MG8A 1EU3A 4XZ4A 3DCGA 1ZE3D 5H92C 1FD6A 4JLCA 4FADA 5JHAA 1DOIA 2XN9C 2DYOA 3RYTA 2DYBA 3IAM1 1A5RA 3DVGX 3UGBB 4WIPA 3QWZB 1ACCA 2LZ6A 3AEFB 1XD3B 4DHJB 1F2RI 4XE0A 3ZNGC 3E9SA 2NBVB 3ZRFA 2QJLA 4P7IA 4XC2A 1JWSD 4KSLC 2XEWA 1L6UA 2VH1A 4ARCA 4OZAA 3DHIC 1TY2A 1HTOA 3AE7B 2N9EB 4WJQA 4MDKE 1GPXA 4A6QA 2W3RA 2LGIA 4JPSA 1WRIA 2BT6A 2JZZA 5D2MB 4I6LB 2K6QA 4B95A 4ITKA 2KVZA 3U2SC 3PRPB 4HRSA 4ZDVA 2KWUB 5AEKB 4IDIA 1P9DU 2QSDA 3PS6A 2FCNA 3ZDMC 1MJDA 2WS3B 4J6IA 5E6PA 2WDVB 1J8CA 3AE2B 3X0WA 2JZ3B 4ZRPA 3P4SB 5GMVA 4W9HA 1P98A 2LD9A 3DBRB 4I6NB 1WR1A 3JSVB 3I63C 4BAXA 2D3GA 3R7RA 2WDQB 2INDC 1WX7A 4EUTA 2AQ3B 3DVGY 3MFGA 2KAJA 4HCNB 1L2NA 1PYWD 1L5PA 4HLEA 5E6NA 2GRIA 3W2DA 2KJ6A 4ZRKA 2LHEA 4C4VB 3L16A 1ESFA 3KWVA 3DWMA 4PYZA 3V3XA 4W9CA 1V5TA 4M8NA 3HK0A 4MH0E 1JCKB 1E9MA 2KTRB 5DCNA 3OLMD 5KHOA 1F2RC 1CZPA 2N1VA 2NBUA 2JWZA 1ENFA 1QOAA 2V3PA 1M4VA 1UH6A 1SIJA 4E74A 5FK9C 1WGRA 4C56C 1UUPA 2QIEB 3IAS1 4TSSA 1V97A 4MM3B 4DK5A 2Z0EB 2V4LA 2JU6X 2QCZA 1TY0A 5BYSA 1WM2A 1ZKHA 3VUXA 3EECA 1NEKB 4NY0A 3LDZE 3NHEB 3Q8BA 3PGEA 3NS8A 3KYCD 2CHXA 4RGNA 2JUOA 1E8WA 3HRDD 3U7DA 1YQ3B 2KLGA 2Y5PA 1JQ4A 5IN7A 3U8ZA 4ACFA 1J7BA 2G1EA 2I38A 4RGTA 3BINA 4J3OD 3V05A 3BK2A 1T6BX 1UD7A 2KJHB 1H4RA 4KSKC 5HFYA 5EE9A 2FCSA 1WRDB 1FXIA 1MPEA 1JWUD 2KTRA 3T3NA 2N1WA 1C9FA 4D2KA 3BK1A 3ZJUA 3A1QB 1E0ZA 1FCCC 2KD0A 2WDRB 4P6VF 1M94A 2DAFA 1F1HA 4MM3A 2KDBA 2Y5BB 2RDHA 2GBMA 3DVNV 3Q3NC 1PGAA 3PTFC 2OOBB 2JY6A 2KC2A 2ZPNA 3ZRCA 2V9HA 1OFFA 2HE7A 3W1SA 1MG4A 1R4MI 3FAHA 2LHDA 2D2QA 2KNBA 2C7MB 3APDA 2J42A 2ASQA 4AQ7A 1N6ZA 1NI3A 2K6DB 2C9WB 4N59A 1J19A 2ZW1A 1YIWA 4HCPB 3KUZA 2EMSA 2PLPA 4LNKA 1WGHA 1NI2A 2AX5A 4NNJB 4C7ZA 5D7GA 5JZEB 1NVID 3C19A 1B9RA 2R2OA 2VRRB 2QHOA 2N4FA 2LWPA 4KIKB 1YD8U 3KQ4A 1A70A 2KFJA 2YVCA 1JW9D 4BKSD 3H7PB 2YEPF 2MCNB 1MFWA 2KN5A 4BOSC 2N9KA 1WGYA 3KYDD 3PHWB 3I5JC 3A1QA 3RPFC 2N9XA 2ZVNA 4EEWA 5FR6A 1GB4A 4MELA 4UDUC 1V1PB 1I4GA 4ANWA 5L95C 4W9KA 1FXTB 4ZRIA 2W55A 2KHWB 2PEAA 4L23A 1XF5L 1WIAA 3PV1A 3AE6B 1XT9B 1R4NI 2ON8A 2BVCA 4JWSC 4AOFA 4KVGB 2REXA 4IG7B 4KX6B 1L7YA 2IO0B 3N32A 3Q8AA 1N5WA 2WXKA 1DOXA 3N3KB 3SDLC 3AEBB 1WR6E 2RDGA 3RUIB 3M62B 2KWCA 2PTLA 2JXTA 4KIKA 1TZ1A 3DQVA 1C78A 2HTHA 2EKEC 4YL8A 1WGDA 4RMAA 2MW5A 3QARA 4M00A 2IDYA 1ZP0B 3P2BA 5EE1A 4CYEA 2V4IB 1V1PA 1SE9A 4WQMA 4HKQA 2Y5CA 2MLBA 3GZNI 2WXNA 4KKIA 4N9F4 1E10A 2Z8LA 3PO0A 2MP2B 2K9XA 3RI7C 3HHMA 3Q8CA 1BUIC 1XLPA 5H8YE 1SGHA 2FAZA 1CMXB 4USAA 4IM2A 1ZXHA 1KF6B 1EO6A 5BYRA 3WAOA 1OQQA 2RD0A 1HA5A 1C4AA 1LFDA 3RMKC 2LASA 1YJJA 3L17A 1IP9A 4B0EA 2DBYA 4PS3A 4LDTD 4W9GA 1I7HA 4DQOC 2ZNVC 3OJ3A 1F77A 3AE1B 2ZVOA 3UINB 4C7YA 4JL9A 2RMMA 3AEAB 3QQ8B 3DBLI 3DOWA 3BYTB 3ZXVA 3NVVA 2KQ4X 2K8CA 2KACA 3ZKJC 4RGOS 3DHGC 1YX5B 3AE9B 3GE3C 2AWTA 1DYQA 3PVLA 4HROA 2EELA 3EA6A 3NY5A 3AE8B 3PT2B 1YNTE 5C2TB 1EWYC 4NQKE 4RH6A 2LJ5A 3WAPA 2PJHA 2ACZB 3MHSD 5G5HA 1CQVA 3RNAC 4KDIC 3VH4B 2NS5A 2ICIA 1V80A 1L0YB 2CJOA 2D07B 3AN1A 2IY1B 4G50A 2RR9A 3U30A 1LXDA 1T5XD 2M56B 2IO3B 1FM0D 2JYEA 2KX3A 2NTTA 2KZRA 1WE6A 3M95A 4EOYA 5EDSA 2JF5A 2JRIB 3VXWA 1SIFA 3B0AA 3LJ3A 4ANUA 1EWCA 5L83A 2K3UA 3WCQA 2INPE 1YOVB 2PW9A 2K8BA 3ZVVA 3NS1A 5D6JB 5AZGA 4BBNF 1WM3A 1FO4A 5D3DA 2NTSA 1WJNA 1WFYA 2HD5B 5J18A 2MBOA 4P1CC 1WMHB 4EKUA 1IBXA 1WZ3A 1I4QA 5BMIA 5BO4B 4NAWA 2M0AA 3QK0A 4HWIB 2BWES 1ROEA 2JZPA 4LNNA 2L3ZA 1SJED 2KK8A 2WXJA 4XDDA 2I1JA 1FNWA 1IUEA 2JT4B 4LCDE 2OJWA 2N9PC 3AB5A 5E6OA 3W1YA 3IBEA 2J7QB 2CU1A 2BW2A 1GOZA 1VZ6A 2G4SA 5GXGB 2V3SA 2FCQA 5IP4D 4G3XB 3ZUNA 2WNMA 3P42A 2BTEA 3RCZA 4BFRA 1TKYA 2J0KA 2WXQA 4K3BA 2LGXA 1E8XA 5BMGA 4NQLB 4FJZA 4XDCA 4NJ7A 1WMHA 4TQ1A 1ZPSA 3OAWA 1C4PA 3IT4B 2K0PA 4FBJB 3KWLA 4M0WB 1Z2MA 3PHXB 4OW0A 3AM9A 4HDQA 1N5XA 2ZNVB 1R4NB 1JWMD 2BS2B 4WWMA 2WU2B 3ZGZA 1GNUA 2HJ8A 2ZW0A 1NYRA 3TCAA 3CMMB 3TEWA 5DPSA 1RFKA 2LGDA 3GP7A 4KZCA 5D3IB 3P4QB 3V6CB 3SU8X 1WXVA 2AQ2B 1T0QC 3Q14C 3GS2A 2AYOB 1Y56A 1KFYB 2K22A 3EUB2 1SE3A 1EUVB 1E7UA 1DOYA 4FHKA 4GU2A 4XYCA 2DAJA 1XLQA 1TJEA 1X1MA 4DXGA 3Q3JA 1E7VA 4L2YA 1E90A 2HDEA 3OWEB 3HM3A 4K3CA 1SE2A 2AL6A 4BZAA 3GZNB 2HTME 5D94A 1AWDA 5JH5C 2BPSA 2JX5A 2LVOA 1RFAA 2MBEA 2TSSA 1RYJA 4BKSA 1P1AA 1YJ1A 5LXIB 2M1MA 4G0NB 4II2B 3U7ZA 2NR2A 4WWPA 3PZ7A 1UGMA 3BVMA 3N1ZC 4XWWA 4N58A 3BVZA 2UWQA 4AJWA 1KLVA 1WXSA 1IGCA 3A33B 2I1KA 2I2YA 4IWOA 4C00A 3GB1A 1LO5D 1Q1OA 2A4ZA 1NENB 3DBLB 3AEDB 2KDIA 4YSXB 1TT5B 4ZHPA 3ZTCA 2OHFA 3BYYB 3MC8A 2MWSB 3Q3OC 3SD5A 2IPKD 1XO3A 1ZGUB 1NBFC 3DBHB 3A9JB 1KJTA 1ET6A 3BIID 2WXMA 3QAQA 3WA0A 4AUQC 2D5GA 3JSVA 3QIJA 2CKHB 2PE6B 2L83A 5MPOA 3P4RB 1EF1A 1QILA 1UZXB 2FUHB 4W9LA 1JMLA 4BOZB 2INNE 1MHXA 4MH8A 3VR9B 3M3JA 4F8CB 1XLNA 3V62A 1KRHA 1EF5A 4ASWC 5IOIA 1FIQA 1TIFA 4C4VA 4MT5A 2M19A 2SEBD 1WGKA 1K53A 4L1BA 4TV3A 2C60A 1Q10A 2BYVE 3VUWA 3X23A 1SF0A 2KQ7A 4P1BC 3KUCB 1D5XC 3MTNB 4MGZE 1WWTA 1UBQA 2IZVB 2L32A 4YWGG 4MACA 4WH4A 1WJ4A 4KZ0A 4RM9A 4GGQA 1PDXA 2RSUA 3APFA 4REZA 3VUYA 2DHZA 1GJZA 4WAFA 2JRHA 3CF6E 4A9AA 4YXDB 2YEPB 4FXCA 4WJPA 4YSYB 2UYZB 3NRZA 3MJ5A 3JW0X 4M8MA 1FRDA 4CO7A 4FN2A 3JVZX 3UQAA 2DZIA 5HHDG 1STEA 2UU7A 1FCLA 2ZJDA 2C5LC 2JQRB 2LGSA 3ECIA 4EZLA 1EM7A 3BY4B 1UGJA 4BBNC 4FJYA 2IGGA 4LNOA 4A8XC 3ZYYX 5AUKA 4K7UA 1J7CA 3H6NA 1D6EC 3O13A 2Z0DB 1IPGA 4RF0A 2O6VB 3ZJTA 1E7PB 2M8SA 2JPHA 5EE0A 1HZ6A 2A5UA 2E3TA 2FIFA 2Z59B 1P3QU 2PKOA 4HDOA 3J9CA 4K1RB 3CSTA 1ZOYB 3K9OB 3R2IA 1GC6A 3NOBA 3W5VB 1UBIA 4A3OA 4GB9A 1N62A 3VTUA 5G5GA 1VCBA 3FILB 3VR8B 2IO2B 4HPPA 4DDGD 2H88B 2K8HA 1GAQB 2KKCA 1UELA 2JSVX 2NPTB 4IUMB 2KT7A 4US9A 4MJSB 3AECB 4FULA 1WY8A 4MGIE 4JQWC 1XXGA 4KGTA 4NPNA 3ZQ4A 1P0RA 4I6PA 4II3B 2BWFA 5JXVA 2LUMA 3P4PB 2WXOA 3UIOB 1WI0A 2G45B 3ZNZB 2O6VA 1SB3C 3PREA 3RZWC 2WGSA 1FFUA 3A4SC 3H7PA 3AE3B 2RDBC 3UF8A 2KMMA 2GLSA 1K51A 2W3SA 1VZ8A 1WXAA 2GBRA 1YJIA 4TUUA 3Q3FA 4MGKE 1WSPA 1RAXA 3HVDA 1F9JA 3MC9A 3FILA 4MGYE 1F52A 3TL5A 5CHWA 3QA8A 1HTQA 2L76A 1WJ6A 4OZCA 1V8CA 1WGGA 1QLBB 4GDLB 4ZOHC 4WURA 1LQBA 2NPTA 3DBRI 1TS5A 4MJSA 2LXCA 2GOWA 2DNFA 3VTVA 4EE2A 3VDZA 2IGHA 1V9JA 3PLUA 5BMHA 1FMAD 2K25A 3V6EB 2LFIA 2FE8A 5FKAC 2MJ3A 2L0FA 5IKCM 1TTNA 3L08A 2M4NA 1FEHA 3IVFA 1U4AA 1YQ4B 5AUIA 1HEZE 2MHJA 4OZBA 2J52A 2BYFA 3TUOA 3DBSA 3U4EG 2BBCA 3U52E 4IM3A 3QX1A 2MRPA 1ZUD2 4BKTA 2BF8B 4B0MA 1XCQL 4KGSA 3WALA 4C80A 4EFOA 2D3AA 3I9V1 4RFBA 2FNJB 1R7SA 2MP2A 4GN1A 2MA9B 1VLBA 1I35A 1WJUA 3ETRA 2N7EA 2WWZA 3SEBA 4RF1A 3CIRB 2CHWA 3EHVA 2VZKD 1SSNA 1UF0A 1H8CA 2PE9A 3NUHB 4W9IA 3PRMB 1VR9A 2LEKA 3MP9A 3RNCC 3VH3B 3AXCA 2MEKA 2KLCA 1IYFA 4WJOA 4HPLB 2CJNA 2ZPYA 3ZJVA 2KDEB 3T9LA 3R66C 2WXLA 3VRAB 3ZIMA 4DHZB 2BYTA 1JWAD 1HE8A 2LI5A 4GIVA 1YMHE 4KKJA 2NCNA 4PYUA 4IW0A 1TS2A 4XX5A 2D3BA 2KO3A 3PZDA 2PIAA 2GBKA 4DXAB 2D3CA 2MJDA 3EFUA 3R8BA 2L0TA 1VDVA 3ZNID 1T3QA 4HJKA 2ONQA 3VVWB 3ALBA 3L54A 3TEYA 2N0SB 4O1NA 4LNIA 2WXGA 2B3AA 2BB5A 4YSZB 4HJGE 5HKHA 4ARIA 2LRWA 3ML8A 5C23A 1BT0A 2G3QB 2EKIA 4NJCA 1V5OA 1E5WA 1WX9A 1LM8B 3HUIA 1N63A 4OVUA 4AWJA 1HXYD 2IJ0A 2MBQA 4RNAA 4E3CA 1UWXA 1P7FA 4S0RA 1R4MB 1Y8RC 2ZZPB 3W1SC 2KMAA 1L6VA 1Q0WB 2N7DA 3AEGB 1BXTA 2CHZA 4A20A 2FCMA 2K39A 2V3NA 4NJ6A 5DPRA 2OJRA 2YLMA 3EGRA 2GI9A 2G9HD 3MJWA 2BB6A 2BS4B 2C7NB 3A9KB 2L8JA 4HVBA 2QDFA 3B2FA 4KGRA 3V60A 1AYFA 1ZXIA 2IY0B 4YTPB 4IM0A 5KHQA
chains in the Genus database with same CATH topology
2KDIA 2XBBC 1WXMA 4ANWA 3ZTCA 4W9KA 5L95C 2MWSB 1FXTB 3SD5A 4ZRIA 1ZGUB 4HPMB 1NBFC 1YX6B 2J0MA 2KHWB 2PEAA 3A9JB 3R3MA 3S2AA 1KJTA 1WIAA 3QAQA 3PV1A 3WA0A 4AUQC 3JSVA 1AARA 3QIJA 5LXIB 2CKHB 1RLFA 2PE6B 3PLVA 1XT9B 1R4NI 1KOTA 2AL3A 3APCA 3ZO5B 2GMIC 4EZKA 4AOFA 1EF1A 4WAAA 4KVGB 5DPWA 2REXA 4IG7B 1UZXB 2FUHB 4W9LA 2LUEA 1L7YA 2IO0B 2LVQA 2LVPA 3N32A 4BOZB 3AULA 3M3JA 4F8CB 3V62A 1EF5A 2M17A 2LXAA 4ASWC 3CSFA 3N3KB 3RZFA 4AJYB 4A3PA 3I3TB 1S1QB 1YQBA 3N30A 3SDLC 1WR6E 3RUIB 2DZKA 3M62B 3VUWA 2KWCA 3QCAA 1GG3A 2C60A 2BYVE 4TV3A 3VFKA 3X23A 2KX0A 4NAWB 4KIKA 1TZ1A 2KQ7A 3DQVA 3KUCB 3MTNB 4TQ0A 5LXHA 2EMTA 2HTHA 2EKEC 3ONSA 4YL8A 4GSWA 1WGDA 4RMAA 2MW5A 3QARA 4MGZE 2DZMA 3NZSA 1UBQA 4DHZE 2IZVB 3QC8B 1WYWB 3A9KA 1WJ4A 2R2QA 4KZ0A 2AEHA 4GGQA 4RM9A 2K1FA 4HK2A 2RSUA 1OEYJ 3APFA 3L0WB 4HXDA 3VUYA 1K8RB 3AI5A 4GMVA 3P2BA 2DHZA 4CYEA 2O6VD 4FLHA 2JRHA 4JGHB 3CF6E 1GJZA 5AZFA 5CTRC 1SE9A 4GXBA 2MLBA 4WJPA 3GZNI 2D11A 2UYZB 4W9DA 4F1SA 3JW0X 4M8MA 2BGFA 4CO7A 4B9KA 4FN2A 2MBBB 4ZRJA 3TBLD 3JVZX 2FIDA 2W9NA 3UQAA 2IO1B 2KWVB 4N9F4 2KC1A 2DZIA 3KVFB 3V61A 4MSMB 3UIPB 3L13A 2MP2B 1OGWA 2ZJDA 2C5LC 2O2VB 4OVVA 3HHMA 3ZDTA 3T8MA 2WX1A 3ECIA 1SGHA 2RGFA 2FAZA 4EZLA 1CMXB 3BY4B 4IM2A 5G2NA 1EO6A 4BBNC 3WAOA 4PS8A 2KDFB 4CHKA 4FJYA 2RD0A 3VQIA 1LFDA 3O65B 4K7UA 3DDCB 2G4DB 4ICUA 3H6NA 2LASA 3PSEB 1E8YA 3L17A 1Q5WB 1IP9A 1WE7A 2Z0DB 2KOXA 1IPGA 4LDTD 4PS3A 4W9GA 4MEMA 2O6VB 2MSED 4RM8A 2ZNVC 5J17A 3D32A 4AP4C 3OJ3A 1OQYA 1WF9A 4FHJA 4ANVA 3VAWA 5CHFA 2ZVOA 2GBNA 3UINB 4WQOB 2KMCA 4JL9A 2L05A 2M8SA 2JPHA 1D3ZA 4W9JA 2DX5B 1V49A 3QQ8B 2A5UA 3DBLI 3DOWA 3DPDA 3HM6X 2FIFA 2Z59B 5IAAC 1P3QU 4HDOA 1J0GA 4EZJA 4K1RB 2JXXA 3IG3A 1V6EA 2K8CA 2KJRA 5JHBA 5J2RA 1TBEA 3CSTA 3K9OB 3AU5A 3IHPC 3ZKJC 2KXJA 1GC6A 2CR5A 2L00B 3NOBA 1UBIA 2BYEA 4GB9A 3VTUA 3ZLZA 4A3OA 1YX5B 1VCBA 2AWTA 2IO2B 3ZNHB 4DDGD 2K8HA 3PVLA 4K7SA 3GOEA 1WX8A 1UELA 2J0JA 2KKCA 4ANXA 4IC7B 2DYMA 2KANA 5LLIA 3TIXA 3TJPA 1V86A 1VD2A 3AU4A 2WX0A 5C1ZA 3NY5A 4X57B 2O2VA 3PT2B 2NPTB 4LDTB 4IUMB 1C3TA 4NQKE 3WAPA 2LJ5A 4KDLB 1E8ZA 2PJHA 1MG8A 4XZ4A 3DCGA 4MJSB 3MHSD 2BKRB 4FULA 4JLCA 1WY8A 4DWFA 4FADA 4MGIE 5JHAA 4JQWC 4KDIC 3VH4B 2NS5A 3RYTA 2DYOA 4NPNA 2DYBA 1P0RA 4I6PA 4II3B 1V80A 1A5RA 2BWFA 2PPHA 3NZUA 1C1YB 3DVGX 3UGBB 4WWNA 3UIOB 3QWZB 1WI0A 2D07B 2G45B 2LZ6A 4LJOB 3ZNZB 1XD3B 2O6VA 4DHJB 2IY1B 5DPTA 3PREA 4G50A 2RR9A 3RZWC 1LXDA 3U30A 4BKGA 3RT3B 3ZNGC 2NBVB 1I42A 3ZRFA 2IO3B 3A4SC 3H7PA 4P7IA 3UF8A 4XC2A 3ZW3A 4KSLC 2XEWA 4FA6A 1WXAA 4W9FA 4WJQA 2KFKB 2GBRA 2KX3A 2N9EB 4MDKE 4TUUA 2KZRA 1GC7A 2JZZA 1WE6A 3M95A 3Q3FA 4EOYA 4MGKE 5D2MB 1KM7A 4I6LB 5EDSA 2JF5A 2K6QA 2JRIB 1RAXA 4B95A 3VXWA 1F9JA 2V1YA 1OEYA 4MGYE 3PRPB 3R7QA 4ZDVA 2KWUB 1SIFA 3B0AA 3LJ3A 2DZJA 3TL5A 5AEKB 5CHWA 4ANUA 3QA8A 5L83A 1P9DU 3A9JA 3K9PB 2L76A 3PS6A 2FCNA 3ZDMC 1WJ6A 2K8BA 3ZVVA 4J6IA 5D6JB 1WGGA 1OTRB 4GDLB 5AZGA 4BBNF 5E6PA 1WM3A 1J8CA 3X0WA 1LQBA 2NPTA 1WZ0A 3DBRI 2JZ3B 1WJNA 1WFYA 2HD5B 2KVRA 4G11A 5GMVA 5J18A 1GUAB 4MJSA 2LXCA 4W9HA 2MBOA 2GOWA 1P98A 2LD9A 4W9EA 1WMHB 1RRBA 2NBWB 3RULA 3VTVA 4EKUA 3VDZA 1JRUA 1V9JA 4I6NB 3PLUA 1WR1A 3JSVB 2MX2A 1WZ3A 2D3GA 3R7RA 3B1LX 2K25A 1WX7A 4EUTA 2IBIB 3V6EB 5AZHA 3DVGY 4DDID 3IFWB 5BO4B 4NAWA 5IA7A 3QK0A 2L0FA 4HCNB 4HWIB 2BWES 4IWPA 5G55A 5TR5A 1L2NA 1TTNA 3L08A 4HLEA 2M4NA 4JIOU 2L3ZA 2XK5B 5E6NA 2ZEQA 3IVFA 4FJVB 1U4AA 2KK8A 2KJ6A 2I1JA 4ZRKA 3L16A 4PYZA 4WJNA 2JT4B 4LCDE 3HIZA 2KFKA 4W9CA 2CS4A 2GBJA 2N9PC 1V5TA 2BYFA 4M8NA 5E6OA 1TGZB 3W1YA 3DBSA 4DHJD 4GOCA 3HK0A 4IM3A 3IBEA 3QX1A 2MRPA 3ZTDA 4BKTA 2J7QB 4MH0E 4DBGA 2KTRB 4PS7A 2CU1A 2BF8B 2KTFA 5DCNA 3OLMD 2LRUA 3JYUA 5KHOA 3WALA 1PQSA 3DVNU 4EFOA 4K7WA 2N1VA 4ZYNA 2NBUA 3WANA 3A4RA 2JWZA 2FNJB 2G4SA 2BKFA 5CHVC 2V3SA 3VHTC 2FCQA 3C0RB 1ZW7A 1UH6A 4G3XB 2MP2A 4GN1A 2MA9B 3ZUNA 4E74A 1I35A 1WGRA 1WJUA 2N7EA 2WWZA 4GDKB 3OJ4B 3RCZA 2CHWA 4BFRA 3EHVA 4BVUC 4DK5A 2Z0EB 2J0KA 3L10B 2LGXA 1E8XA 1H8CA 4NQLB 1V2YA 2V4LA 1WH3A 2PE9A 4FJZA 4NJ7A 1WMHA 4MSQB 4W9IA 4TQ1A 3PRMB 1WM2A 1ZKHA 3VUXA 3EECA 3B08A 3OAWA 4NY0A 3VH3B 3AXCA 3LDZE 4K81A 1QZEA 3NHEB 2WDTB 1NDDA 3PGEA 2MQJA 3H9DA 3NS8A 2KLCA 3KYCD 2MBHA 3KW5B 4FBJB 1IYFA 4WJOA 2CHXA 1T0YA 4HPLB 2KQSA 4M0WB 1Z2MA 2ZPYA 2JUOA 1E8WA 3PHXB 3U7DA 2KLGA 2WYQA 2KDEB 4HDQA 3T9LA 3R66C 2ZNVB 3TMPB 3ZIMA 3U8ZA 3WAMA 4DHZB 1HE8A 2XK5A 2LI5A 4GIVA 3BINA 1GNUA 2HJ8A 3TCAA 2NCNA 3KH0A 4PYUA 4IW0A 1UD7A 2KJHB 4XX5A 1H4RA 2ZCBA 2KO3A 3CMMB 5DPSA 3PZDA 4WWOA 4KSKC 2M0XA 3M63B 4LJPB 2GBKA 2FCSA 4DXAB 1XQQA 2DENB 2LGDA 3EFUA 3PRZA 1WRDB 4URKA 2KTRA 2L0TA 4KZCA 3ZNID 4HJKA 2N1WA 1V81A 3V6CB 3VVWB 3SU8X 1WXVA 3A1QB 1ISNA 3ALBA 2AYOB 2LGYA 3L54A 2KD0A 2D10A 1EUVB 1E7UA 4TKNA 4FHKA 4GU2A 2B3AA 3PPAA 4GDKA 2DAJA 5CX3A 1M94A 2DAFA 4MM3A 2KDBA 2Y5BB 1X1MA 3Q3JA 1E7VA 5HKHA 2GBMA 2LRWA 3DVNV 1E90A 3ML8A 3PTFC 2OOBB 2JY6A 2KC2A 2ZPNA 5C23A 1BT0A 2G3QB 3HM3A 3ZRCA 1V5OA 2HE7A 1E5WA 2AL6A 1WX9A 1Z5SB 3H7SA 1LM8B 1R4MI 3W1SA 3UQBA 2D2QA 4OVUA 2KNBA 4AWJA 2MBQA 3EC8A 5D94A 4B6WA 4E71A 2C7MB 5JH5C 2BPSA 3APDA 2ASQA 2LVOA 4E3CA 2L7RA 2K6DB 2NVUI 1RFAA 2C9WB 2JVCA 2MBEA 2ZCCA 1J19A 1Y8RC 2ZZPB 4BKSA 3W1SC 1P1AA 1YIWA 2KMAA 1YJ1A 3KUZA 1Q0WB 2EMSA 2M1MA 3ML9A 1WGHA 2N7DA 4G0NB 4HCPB 4II2B 3RD2A 2CHZA 1NI2A 4NNJB 4A20A 5D7GA 5JZEB 2NR2A 2FCMA 2K39A 2R2OA 3QJZA 4ICVA 4WWPA 3SHQA 1UGMA 3QHTA 2VRRB 2QHOA 2N4FA 4NJ6A 5DPRA 3WIMA 2OJRA 2LWPA 2YLMA 4IWQA 4KIKB 1YD8U 2UWQA 4AJWA 1KLVA 2KFJA 2YVCA 2IYDB 3ENEA 3MJWA 4BKSD 1G6JA 3H7PB 2MCNB 2C7NB 3VTWA 2KN5A 4BOSC 1WXSA 3A9KB 2L8JA 3A33B 2I1KA 4HVBA 1WGYA 4IWOA 3KYDD 3PHWB 3V60A 3A1QA 4KV2A 2A4ZA 1Q1OA 2N9XA 2ZVNA 4EEWA 3DBHI 5FR6A 2RPQA 4GDLA 2IY0B 3KUDB 2C7HA 4MELA 4F7ZA 4IM0A 5KHQA 1S3SG 3H1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDI A;  2XBB C;  1WXM A;  4ANW A;  3ZTC A;  4W9K A;  5L95 C;  2MWS B;  1FXT B;  3SD5 A;  4ZRI A;  1ZGU B;  4HPM B;  1NBF C;  1YX6 B;  2J0M A;  2KHW B;  2PEA A;  3A9J B;  3R3M A;  3S2A A;  1KJT A;  1WIA A;  3QAQ A;  3PV1 A;  3WA0 A;  4AUQ C;  3JSV A;  1AAR A;  3QIJ A;  5LXI B;  2CKH B;  1RLF A;  2PE6 B;  3PLV A;  1XT9 B;  1R4N I;  1KOT A;  2AL3 A;  3APC A;  3ZO5 B;  2GMI C;  4EZK A;  4AOF A;  1EF1 A;  4WAA A;  4KVG B;  5DPW A;  2REX A;  4IG7 B;  1UZX B;  2FUH B;  4W9L A;  2LUE A;  1L7Y A;  2IO0 B;  2LVQ A;  2LVP A;  3N32 A;  4BOZ B;  3AUL A;  3M3J A;  4F8C B;  3V62 A;  1EF5 A;  2M17 A;  2LXA A;  4ASW C;  3CSF A;  3N3K B;  3RZF A;  4AJY B;  4A3P A;  3I3T B;  1S1Q B;  1YQB A;  3N30 A;  3SDL C;  1WR6 E;  3RUI B;  2DZK A;  3M62 B;  3VUW A;  2KWC A;  3QCA A;  1GG3 A;  2C60 A;  2BYV E;  4TV3 A;  3VFK A;  3X23 A;  2KX0 A;  4NAW B;  4KIK A;  1TZ1 A;  2KQ7 A;  3DQV A;  3KUC B;  3MTN B;  4TQ0 A;  5LXH A;  2EMT A;  2HTH A;  2EKE C;  3ONS A;  4YL8 A;  4GSW A;  1WGD A;  4RMA A;  2MW5 A;  3QAR A;  4MGZ E;  2DZM A;  3NZS A;  1UBQ A;  4DHZ E;  2IZV B;  3QC8 B;  1WYW B;  3A9K A;  1WJ4 A;  2R2Q A;  4KZ0 A;  2AEH A;  4GGQ A;  4RM9 A;  2K1F A;  4HK2 A;  2RSU A;  1OEY J;  3APF A;  3L0W B;  4HXD A;  3VUY A;  1K8R B;  3AI5 A;  4GMV A;  3P2B A;  2DHZ A;  4CYE A;  2O6V D;  4FLH A;  2JRH A;  4JGH B;  3CF6 E;  1GJZ A;  5AZF A;  5CTR C;  1SE9 A;  4GXB A;  2MLB A;  4WJP A;  3GZN I;  2D11 A;  2UYZ B;  4W9D A;  4F1S A;  3JW0 X;  4M8M A;  2BGF A;  4CO7 A;  4B9K A;  4FN2 A;  2MBB B;  4ZRJ A;  3TBL D;  3JVZ X;  2FID A;  2W9N A;  3UQA A;  2IO1 B;  2KWV B;  4N9F 4;  2KC1 A;  2DZI A;  3KVF B;  3V61 A;  4MSM B;  3UIP B;  3L13 A;  2MP2 B;  1OGW A;  2ZJD A;  2C5L C;  2O2V B;  4OVV A;  3HHM A;  3ZDT A;  3T8M A;  2WX1 A;  3ECI A;  1SGH A;  2RGF A;  2FAZ A;  4EZL A;  1CMX B;  3BY4 B;  4IM2 A;  5G2N A;  1EO6 A;  4BBN C;  3WAO A;  4PS8 A;  2KDF B;  4CHK A;  4FJY A;  2RD0 A;  3VQI A;  1LFD A;  3O65 B;  4K7U A;  3DDC B;  2G4D B;  4ICU A;  3H6N A;  2LAS A;  3PSE B;  1E8Y A;  3L17 A;  1Q5W B;  1IP9 A;  1WE7 A;  2Z0D B;  2KOX A;  1IPG A;  4LDT D;  4PS3 A;  4W9G A;  4MEM A;  2O6V B;  2MSE D;  4RM8 A;  2ZNV C;  5J17 A;  3D32 A;  4AP4 C;  3OJ3 A;  1OQY A;  1WF9 A;  4FHJ A;  4ANV A;  3VAW A;  5CHF A;  2ZVO A;  2GBN A;  3UIN B;  4WQO B;  2KMC A;  4JL9 A;  2L05 A;  2M8S A;  2JPH A;  1D3Z A;  4W9J A;  2DX5 B;  1V49 A;  3QQ8 B;  2A5U A;  3DBL I;  3DOW A;  3DPD A;  3HM6 X;  2FIF A;  2Z59 B;  5IAA C;  1P3Q U;  4HDO A;  1J0G A;  4EZJ A;  4K1R B;  2JXX A;  3IG3 A;  1V6E A;  2K8C A;  2KJR A;  5JHB A;  5J2R A;  1TBE A;  3CST A;  3K9O B;  3AU5 A;  3IHP C;  3ZKJ C;  2KXJ A;  1GC6 A;  2CR5 A;  2L00 B;  3NOB A;  1UBI A;  2BYE A;  4GB9 A;  3VTU A;  3ZLZ A;  4A3O A;  1YX5 B;  1VCB A;  2AWT A;  2IO2 B;  3ZNH B;  4DDG D;  2K8H A;  3PVL A;  4K7S A;  3GOE A;  1WX8 A;  1UEL A;  2J0J A;  2KKC A;  4ANX A;  4IC7 B;  2DYM A;  2KAN A;  5LLI A;  3TIX A;  3TJP A;  1V86 A;  1VD2 A;  3AU4 A;  2WX0 A;  5C1Z A;  3NY5 A;  4X57 B;  2O2V A;  3PT2 B;  2NPT B;  4LDT B;  4IUM B;  1C3T A;  4NQK E;  3WAP A;  2LJ5 A;  4KDL B;  1E8Z A;  2PJH A;  1MG8 A;  4XZ4 A;  3DCG A;  4MJS B;  3MHS D;  2BKR B;  4FUL A;  4JLC A;  1WY8 A;  4DWF A;  4FAD A;  4MGI E;  5JHA A;  4JQW C;  4KDI C;  3VH4 B;  2NS5 A;  3RYT A;  2DYO A;  4NPN A;  2DYB A;  1P0R A;  4I6P A;  4II3 B;  1V80 A;  1A5R A;  2BWF A;  2PPH A;  3NZU A;  1C1Y B;  3DVG X;  3UGB B;  4WWN A;  3UIO B;  3QWZ B;  1WI0 A;  2D07 B;  2G45 B;  2LZ6 A;  4LJO B;  3ZNZ B;  1XD3 B;  2O6V A;  4DHJ B;  2IY1 B;  5DPT A;  3PRE A;  4G50 A;  2RR9 A;  3RZW C;  1LXD A;  3U30 A;  4BKG A;  3RT3 B;  3ZNG C;  2NBV B;  1I42 A;  3ZRF A;  2IO3 B;  3A4S C;  3H7P A;  4P7I A;  3UF8 A;  4XC2 A;  3ZW3 A;  4KSL C;  2XEW A;  4FA6 A;  1WXA A;  4W9F A;  4WJQ A;  2KFK B;  2GBR A;  2KX3 A;  2N9E B;  4MDK E;  4TUU A;  2KZR A;  1GC7 A;  2JZZ A;  1WE6 A;  3M95 A;  3Q3F A;  4EOY A;  4MGK E;  5D2M B;  1KM7 A;  4I6L B;  5EDS A;  2JF5 A;  2K6Q A;  2JRI B;  1RAX A;  4B95 A;  3VXW A;  1F9J A;  2V1Y A;  1OEY A;  4MGY E;  3PRP B;  3R7Q A;  4ZDV A;  2KWU B;  1SIF A;  3B0A A;  3LJ3 A;  2DZJ A;  3TL5 A;  5AEK B;  5CHW A;  4ANU A;  3QA8 A;  5L83 A;  1P9D U;  3A9J A;  3K9P B;  2L76 A;  3PS6 A;  2FCN A;  3ZDM C;  1WJ6 A;  2K8B A;  3ZVV A;  4J6I A;  5D6J B;  1WGG A;  1OTR B;  4GDL B;  5AZG A;  4BBN F;  5E6P A;  1WM3 A;  1J8C A;  3X0W A;  1LQB A;  2NPT A;  1WZ0 A;  3DBR I;  2JZ3 B;  1WJN A;  1WFY A;  2HD5 B;  2KVR A;  4G11 A;  5GMV A;  5J18 A;  1GUA B;  4MJS A;  2LXC A;  4W9H A;  2MBO A;  2GOW A;  1P98 A;  2LD9 A;  4W9E A;  1WMH B;  1RRB A;  2NBW B;  3RUL A;  3VTV A;  4EKU A;  3VDZ A;  1JRU A;  1V9J A;  4I6N B;  3PLU A;  1WR1 A;  3JSV B;  2MX2 A;  1WZ3 A;  2D3G A;  3R7R A;  3B1L X;  2K25 A;  1WX7 A;  4EUT A;  2IBI B;  3V6E B;  5AZH A;  3DVG Y;  4DDI D;  3IFW B;  5BO4 B;  4NAW A;  5IA7 A;  3QK0 A;  2L0F A;  4HCN B;  4HWI B;  2BWE S;  4IWP A;  5G55 A;  5TR5 A;  1L2N A;  1TTN A;  3L08 A;  4HLE A;  2M4N A;  4JIO U;  2L3Z A;  2XK5 B;  5E6N A;  2ZEQ A;  3IVF A;  4FJV B;  1U4A A;  2KK8 A;  2KJ6 A;  2I1J A;  4ZRK A;  3L16 A;  4PYZ A;  4WJN A;  2JT4 B;  4LCD E;  3HIZ A;  2KFK A;  4W9C A;  2CS4 A;  2GBJ A;  2N9P C;  1V5T A;  2BYF A;  4M8N A;  5E6O A;  1TGZ B;  3W1Y A;  3DBS A;  4DHJ D;  4GOC A;  3HK0 A;  4IM3 A;  3IBE A;  3QX1 A;  2MRP A;  3ZTD A;  4BKT A;  2J7Q B;  4MH0 E;  4DBG A;  2KTR B;  4PS7 A;  2CU1 A;  2BF8 B;  2KTF A;  5DCN A;  3OLM D;  2LRU A;  3JYU A;  5KHO A;  3WAL A;  1PQS A;  3DVN U;  4EFO A;  4K7W A;  2N1V A;  4ZYN A;  2NBU A;  3WAN A;  3A4R A;  2JWZ A;  2FNJ B;  2G4S A;  2BKF A;  5CHV C;  2V3S A;  3VHT C;  2FCQ A;  3C0R B;  1ZW7 A;  1UH6 A;  4G3X B;  2MP2 A;  4GN1 A;  2MA9 B;  3ZUN A;  4E74 A;  1I35 A;  1WGR A;  1WJU A;  2N7E A;  2WWZ A;  4GDK B;  3OJ4 B;  3RCZ A;  2CHW A;  4BFR A;  3EHV A;  4BVU C;  4DK5 A;  2Z0E B;  2J0K A;  3L10 B;  2LGX A;  1E8X A;  1H8C A;  4NQL B;  1V2Y A;  2V4L A;  1WH3 A;  2PE9 A;  4FJZ A;  4NJ7 A;  1WMH A;  4MSQ B;  4W9I A;  4TQ1 A;  3PRM B;  1WM2 A;  1ZKH A;  3VUX A;  3EEC A;  3B08 A;  3OAW A;  4NY0 A;  3VH3 B;  3AXC A;  3LDZ E;  4K81 A;  1QZE A;  3NHE B;  2WDT B;  1NDD A;  3PGE A;  2MQJ A;  3H9D A;  3NS8 A;  2KLC A;  3KYC D;  2MBH A;  3KW5 B;  4FBJ B;  1IYF A;  4WJO A;  2CHX A;  1T0Y A;  4HPL B;  2KQS A;  4M0W B;  1Z2M A;  2ZPY A;  2JUO A;  1E8W A;  3PHX B;  3U7D A;  2KLG A;  2WYQ A;  2KDE B;  4HDQ A;  3T9L A;  3R66 C;  2ZNV B;  3TMP B;  3ZIM A;  3U8Z A;  3WAM A;  4DHZ B;  1HE8 A;  2XK5 A;  2LI5 A;  4GIV A;  3BIN A;  1GNU A;  2HJ8 A;  3TCA A;  2NCN A;  3KH0 A;  4PYU A;  4IW0 A;  1UD7 A;  2KJH B;  4XX5 A;  1H4R A;  2ZCB A;  2KO3 A;  3CMM B;  5DPS A;  3PZD A;  4WWO A;  4KSK C;  2M0X A;  3M63 B;  4LJP B;  2GBK A;  2FCS A;  4DXA B;  1XQQ A;  2DEN B;  2LGD A;  3EFU A;  3PRZ A;  1WRD B;  4URK A;  2KTR A;  2L0T A;  4KZC A;  3ZNI D;  4HJK A;  2N1W A;  1V81 A;  3V6C B;  3VVW B;  3SU8 X;  1WXV A;  3A1Q B;  1ISN A;  3ALB A;  2AYO B;  2LGY A;  3L54 A;  2KD0 A;  2D10 A;  1EUV B;  1E7U A;  4TKN A;  4FHK A;  4GU2 A;  2B3A A;  3PPA A;  4GDK A;  2DAJ A;  5CX3 A;  1M94 A;  2DAF A;  4MM3 A;  2KDB A;  2Y5B B;  1X1M A;  3Q3J A;  1E7V A;  5HKH A;  2GBM A;  2LRW A;  3DVN V;  1E90 A;  3ML8 A;  3PTF C;  2OOB B;  2JY6 A;  2KC2 A;  2ZPN A;  5C23 A;  1BT0 A;  2G3Q B;  3HM3 A;  3ZRC A;  1V5O A;  2HE7 A;  1E5W A;  2AL6 A;  1WX9 A;  1Z5S B;  3H7S A;  1LM8 B;  1R4M I;  3W1S A;  3UQB A;  2D2Q A;  4OVU A;  2KNB A;  4AWJ A;  2MBQ A;  3EC8 A;  5D94 A;  4B6W A;  4E71 A;  2C7M B;  5JH5 C;  2BPS A;  3APD A;  2ASQ A;  2LVO A;  4E3C A;  2L7R A;  2K6D B;  2NVU I;  1RFA A;  2C9W B;  2JVC A;  2MBE A;  2ZCC A;  1J19 A;  1Y8R C;  2ZZP B;  4BKS A;  3W1S C;  1P1A A;  1YIW A;  2KMA A;  1YJ1 A;  3KUZ A;  1Q0W B;  2EMS A;  2M1M A;  3ML9 A;  1WGH A;  2N7D A;  4G0N B;  4HCP B;  4II2 B;  3RD2 A;  2CHZ A;  1NI2 A;  4NNJ B;  4A20 A;  5D7G A;  5JZE B;  2NR2 A;  2FCM A;  2K39 A;  2R2O A;  3QJZ A;  4ICV A;  4WWP A;  3SHQ A;  1UGM A;  3QHT A;  2VRR B;  2QHO A;  2N4F A;  4NJ6 A;  5DPR A;  3WIM A;  2OJR A;  2LWP A;  2YLM A;  4IWQ A;  4KIK B;  1YD8 U;  2UWQ A;  4AJW A;  1KLV A;  2KFJ A;  2YVC A;  2IYD B;  3ENE A;  3MJW A;  4BKS D;  1G6J A;  3H7P B;  2MCN B;  2C7N B;  3VTW A;  2KN5 A;  4BOS C;  1WXS A;  3A9K B;  2L8J A;  3A33 B;  2I1K A;  4HVB A;  1WGY A;  4IWO A;  3KYD D;  3PHW B;  3V60 A;  3A1Q A;  4KV2 A;  2A4Z A;  1Q1O A;  2N9X A;  2ZVN A;  4EEW A;  3DBH I;  5FR6 A;  2RPQ A;  4GDL A;  2IY0 B;  3KUD B;  2C7H A;  4MEL A;  4F7Z A;  4IM0 A;  5KHQ A;  1S3S G;  3H1U A; 
#chains in the Genus database with same CATH topology
 1JRO A;  4GLS C;  4HPM B;  2J0M A;  1SBB B;  3PLV A;  1QF6 A;  3MHZ A;  2AL3 A;  3APC A;  3ZO5 B;  2GMI C;  2FUG 1;  4WAA A;  1L0V B;  1VJK A;  3E56 A;  5DPW A;  1K50 A;  2WQY B;  1UNS A;  2LVP A;  1TS3 A;  1XCT L;  3CSF A;  2WXI A;  3W9C B;  2DZK A;  3ABV B;  3LXF A;  1GG3 A;  2KX0 A;  4TMA B;  1FPY A;  3TSS A;  4TQ0 A;  5LXH A;  4GSW A;  2WU5 B;  1ET9 A;  3A9K A;  4LTU A;  2AEH A;  2IGD A;  2V0G A;  4HK2 A;  1OEY J;  4HXD A;  1K8R B;  4GMV A;  1PUT A;  2WHI A;  3H8H A;  1KTK A;  4GXB A;  3HVZ A;  1C4C A;  4W9D A;  4F1S A;  2E6X A;  4NAM A;  2MBB B;  4ZRJ A;  3TBL D;  5EE3 A;  2FID A;  2IO1 B;  2KWV B;  1VRA B;  3KVF B;  4MSM B;  5C3J B;  1OGW A;  5E6J A;  3N9Y C;  4OVV A;  3ZDT A;  1MHH E;  3T8M A;  2WX1 A;  3AH7 A;  3NVY A;  2RGF A;  3SR6 A;  4M0W A;  3NVZ A;  3VQI A;  1SXT A;  2G4D B;  2WLB A;  4ICU A;  4JX1 C;  2Y3A A;  3PSE B;  1Q5W B;  1WE7 A;  1QOB A;  2KOX A;  1XLO A;  4MEM A;  1N60 A;  4RM8 A;  4RGM A;  5HG2 A;  3Q3M C;  4AP4 C;  1OQY A;  1WF9 A;  4FHJ A;  1LGR A;  4ANV A;  3VAW A;  4WQO B;  3RFZ B;  2L05 A;  4W9J A;  4R3D A;  4AS1 A;  1V49 A;  3HM6 X;  3P1M A;  4ZRQ A;  1PGB A;  4OVZ A;  5JHB A;  2KJR A;  5J2R A;  1TBE A;  1IGD A;  2KXJ A;  2CR5 A;  3IT6 B;  2BYE A;  3ZLZ A;  1SE4 A;  1T0S C;  1I4X A;  3GOE A;  2J0J A;  2SAK A;  4IC7 B;  4PT5 A;  2DYM A;  3AE5 B;  3TIX A;  3NG0 A;  1HQR D;  3OG5 A;  2WX0 A;  1E6E B;  4X57 B;  4LDT B;  3P63 A;  2QC8 A;  1C77 A;  1C3T A;  1RM6 C;  4KDL B;  1E8Z A;  3CWI A;  2BKR B;  1WXQ A;  4DWF A;  2Q5W D;  3Q8E A;  1FNV A;  2PPH A;  3NZU A;  1C1Y B;  4WWN A;  4HEA 1;  1I4H A;  4LJO B;  5DPT A;  4BKG A;  3RT3 B;  1FNU A;  1I42 A;  3BZD B;  1FXA A;  3ZW3 A;  1AN8 A;  4FA6 A;  1C79 A;  4RCO A;  4W9F A;  2KFK B;  2LJI A;  1YN4 A;  3ZXR A;  1YN3 A;  1GC7 A;  1K52 A;  1KM7 A;  1YN5 A;  1D5M C;  2V1Y A;  2VZK B;  4DXF A;  1OEY A;  3R7Q A;  2W54 A;  1QQR A;  2DZJ A;  3A9J A;  2MJE A;  3K9P B;  2QIL A;  3Q2A C;  3N1Y C;  1QOG A;  1OTR B;  2PMV A;  3PZ8 A;  2BS3 B;  1WZ0 A;  4G11 A;  2KVR A;  2KWD A;  1GUA B;  2INC C;  5IO9 A;  4W9E A;  1RRB A;  2NBW B;  3IXS A;  3RUL A;  1JRU A;  3URY A;  3DHH C;  1ZDV A;  2MX2 A;  3B1L X;  4LK0 M;  2IBI B;  1TYG B;  5AZH A;  2RPV A;  1FRR A;  4DDI D;  3IFW B;  5IA7 A;  1MVK A;  4IWP A;  5TR5 A;  5G55 A;  1CK1 A;  4JIO U;  2XK5 B;  2H89 B;  2ZEQ A;  3DWG C;  4FJV B;  3Q69 A;  2N9L A;  4WJN A;  4YTN B;  2PVO D;  3HIZ A;  3R2T A;  2KFK A;  3T3O A;  2CS4 A;  2GBJ A;  1TGZ B;  3AE4 B;  4DHJ D;  2L52 A;  4GOC A;  1GB1 A;  4XWT A;  4US8 A;  3W5U B;  3ZTD A;  1L0X B;  3MC0 B;  4LLG M;  4DBG A;  2L1A A;  4PS7 A;  2KTF A;  1V1O A;  2LRU A;  3JYU A;  1OQR A;  1PQS A;  3DVN U;  1NYQ A;  3SFE B;  4K7W A;  4ZYN A;  3WAN A;  4YT0 B;  3A4R A;  2BKF A;  5CHV C;  3VHT C;  4QAY A;  3C0R B;  1ZW7 A;  2JWU A;  4GDK B;  2BQQ A;  3OJ4 B;  4BVU C;  3L10 B;  3RNE C;  1F0Z A;  1V2Y A;  1WH3 A;  4MSQ B;  4S17 A;  2CU3 A;  3B08 A;  2FBW B;  4K81 A;  1QZE A;  1L4D B;  2WDT B;  1NDD A;  2MQJ A;  3H9D A;  2GB1 A;  2MBH A;  3KW5 B;  1T0Y A;  2KQS A;  2WYQ A;  3LYY A;  1SEB D;  5BYQ A;  3TMP B;  5FR3 A;  3WAM A;  2XK5 A;  3SFD B;  4M01 A;  3KH0 A;  3KLS X;  5HI1 A;  2ZCB A;  4WWO A;  1KH0 A;  2M0X A;  3M63 B;  4LJP B;  1BML C;  3Q6B A;  1XQQ A;  1KLU D;  2DEN B;  4A90 A;  3PRZ A;  2JYT A;  3FKY A;  4URK A;  2WP9 B;  4P16 A;  3N1X C;  1V81 A;  1ISN A;  2LGY A;  2D10 A;  2J53 A;  3VRB B;  1KLG D;  4TKN A;  3NZ3 A;  1SJH D;  4N6E B;  3LB8 C;  3GE8 C;  4GDK A;  3PPA A;  5CX3 A;  2WXP A;  4Q2J A;  1MI0 A;  2PVG C;  1Z5S B;  1ZDX A;  3H7S A;  4PK1 A;  3UQB A;  1I4R A;  4A55 A;  3EC8 A;  4E71 A;  2X8X X;  2WXR A;  3C8Y A;  4B6W A;  2L7R A;  2NVU I;  2JVC A;  1WYG A;  1PFD A;  2ZCC A;  3AMZ A;  1QOF A;  3ML9 A;  3RD2 A;  4M02 A;  3RN9 C;  4ZYS A;  1T0R C;  3SHQ A;  3QJZ A;  4ICV A;  1TZO A;  1N61 A;  3QHT A;  3WIM A;  4IWQ A;  2KDM A;  4HKZ E;  2IYD B;  3ENE A;  2WXH A;  3RNF C;  1G6J A;  3NJT A;  3VTW A;  1PGX A;  2X38 A;  1J7A A;  2DWQ A;  4KV2 A;  3AV8 A;  1C76 A;  1L4Z B;  1UWM A;  3BVG A;  3DBH I;  2RPQ A;  4GDL A;  3KUD B;  2C7H A;  2W82 A;  4F7Z A;  1XEE A;  1S3S G;  3H1U A;  2WXF A;  4NZL B;  2XBB C;  1WXM A;  2N7J A;  2QMT A;  5TSS A;  1YX6 B;  3R3M A;  3S2A A;  1AAR A;  2DLB A;  1DGJ A;  1RLF A;  1KOT A;  4EZK A;  1P7E A;  1JWB D;  3B2G A;  1FFV A;  2LUE A;  2LVQ A;  3AUL A;  2VH2 A;  2M17 A;  2LXA A;  1IBX B;  1TKE A;  3RZF A;  4A3P A;  4AJY B;  3I3T B;  1S1Q B;  1YQB A;  2XNA C;  3N30 A;  2QEJ C;  3TEX A;  2KYW A;  3QCA A;  3VFK A;  3BWU D;  4NAW B;  4CQN A;  2B76 B;  2LMC A;  2EMT A;  3ONS A;  4IOI E;  2DZM A;  3NZS A;  4DHZ E;  3QC8 B;  1WYW B;  2R2Q A;  2K1F A;  1CJE A;  3L0W B;  3AI5 A;  2O6V D;  4FLH A;  4JGH B;  5AZF A;  5CTR C;  2J4X A;  2NMQ A;  3RNB C;  2D11 A;  2BGF A;  4B9K A;  2W9N A;  5T8I A;  2KC1 A;  1VZ7 A;  3V61 A;  3UIP B;  1TS4 A;  3L13 A;  1B1Z A;  4LNF A;  2O2V B;  1EU4 A;  3I57 A;  3EFC A;  4ZHO A;  5G2N A;  4JE3 B;  4PS8 A;  2KDF B;  4CHK A;  2HJ1 A;  1HZ5 A;  3O65 B;  3UI3 A;  3DDC B;  4OHJ A;  1QT9 A;  1I4P A;  3NVW A;  1E8Y A;  3FC4 A;  2MSE D;  3RNG C;  4XGA B;  5J17 A;  3D32 A;  1QKZ A;  1AW7 A;  3L4P A;  5CHF A;  2GBN A;  2KMC A;  1D3Z A;  2DX5 B;  3DPD A;  4YTM B;  5IAA C;  4H2A A;  4IKG A;  3N20 C;  1J0G A;  4EZJ A;  2JXX A;  3IG3 A;  1TKG A;  1RWS A;  1V6E A;  3Q8F A;  2KN4 A;  1D4B A;  1JRP A;  3AU5 A;  3IHP C;  2L00 B;  1D5Z C;  3AEE B;  2K5P A;  3ZNH B;  2AQ1 B;  2MH7 A;  4K7S A;  1WX8 A;  4ANX A;  1JAL A;  3TEZ A;  5LNK 1;  2KAN A;  5LLI A;  3TJP A;  1V86 A;  1VD2 A;  2OED A;  3AU4 A;  5C1Z A;  5I4D A;  2O2V A;  4JWU C;  3B9J A;  2R61 A;  1MG8 A;  1EU3 A;  4XZ4 A;  3DCG A;  1ZE3 D;  5H92 C;  1FD6 A;  4JLC A;  4FAD A;  5JHA A;  1DOI A;  2XN9 C;  2DYO A;  3RYT A;  2DYB A;  3IAM 1;  1A5R A;  3DVG X;  3UGB B;  4WIP A;  3QWZ B;  1ACC A;  2LZ6 A;  3AEF B;  1XD3 B;  4DHJ B;  1F2R I;  4XE0 A;  3ZNG C;  3E9S A;  2NBV B;  3ZRF A;  2QJL A;  4P7I A;  4XC2 A;  1JWS D;  4KSL C;  2XEW A;  1L6U A;  2VH1 A;  4ARC A;  4OZA A;  3DHI C;  1TY2 A;  1HTO A;  3AE7 B;  2N9E B;  4WJQ A;  4MDK E;  1GPX A;  4A6Q A;  2W3R A;  2LGI A;  4JPS A;  1WRI A;  2BT6 A;  2JZZ A;  5D2M B;  4I6L B;  2K6Q A;  4B95 A;  4ITK A;  2KVZ A;  3U2S C;  3PRP B;  4HRS A;  4ZDV A;  2KWU B;  5AEK B;  4IDI A;  1P9D U;  2QSD A;  3PS6 A;  2FCN A;  3ZDM C;  1MJD A;  2WS3 B;  4J6I A;  5E6P A;  2WDV B;  1J8C A;  3AE2 B;  3X0W A;  2JZ3 B;  4ZRP A;  3P4S B;  5GMV A;  4W9H A;  1P98 A;  2LD9 A;  3DBR B;  4I6N B;  1WR1 A;  3JSV B;  3I63 C;  4BAX A;  2D3G A;  3R7R A;  2WDQ B;  2IND C;  1WX7 A;  4EUT A;  2AQ3 B;  3DVG Y;  3MFG A;  2KAJ A;  4HCN B;  1L2N A;  1PYW D;  1L5P A;  4HLE A;  5E6N A;  2GRI A;  3W2D A;  2KJ6 A;  4ZRK A;  2LHE A;  4C4V B;  3L16 A;  1ESF A;  3KWV A;  3DWM A;  4PYZ A;  3V3X A;  4W9C A;  1V5T A;  4M8N A;  3HK0 A;  4MH0 E;  1JCK B;  1E9M A;  2KTR B;  5DCN A;  3OLM D;  5KHO A;  1F2R C;  1CZP A;  2N1V A;  2NBU A;  2JWZ A;  1ENF A;  1QOA A;  2V3P A;  1M4V A;  1UH6 A;  1SIJ A;  4E74 A;  5FK9 C;  1WGR A;  4C56 C;  1UUP A;  2QIE B;  3IAS 1;  4TSS A;  1V97 A;  4MM3 B;  4DK5 A;  2Z0E B;  2V4L A;  2JU6 X;  2QCZ A;  1TY0 A;  5BYS A;  1WM2 A;  1ZKH A;  3VUX A;  3EEC A;  1NEK B;  4NY0 A;  3LDZ E;  3NHE B;  3Q8B A;  3PGE A;  3NS8 A;  3KYC D;  2CHX A;  4RGN A;  2JUO A;  1E8W A;  3HRD D;  3U7D A;  1YQ3 B;  2KLG A;  2Y5P A;  1JQ4 A;  5IN7 A;  3U8Z A;  4ACF A;  1J7B A;  2G1E A;  2I38 A;  4RGT A;  3BIN A;  4J3O D;  3V05 A;  3BK2 A;  1T6B X;  1UD7 A;  2KJH B;  1H4R A;  4KSK C;  5HFY A;  5EE9 A;  2FCS A;  1WRD B;  1FXI A;  1MPE A;  1JWU D;  2KTR A;  3T3N A;  2N1W A;  1C9F A;  4D2K A;  3BK1 A;  3ZJU A;  3A1Q B;  1E0Z A;  1FCC C;  2KD0 A;  2WDR B;  4P6V F;  1M94 A;  2DAF A;  1F1H A;  4MM3 A;  2KDB A;  2Y5B B;  2RDH A;  2GBM A;  3DVN V;  3Q3N C;  1PGA A;  3PTF C;  2OOB B;  2JY6 A;  2KC2 A;  2ZPN A;  3ZRC A;  2V9H A;  1OFF A;  2HE7 A;  3W1S A;  1MG4 A;  1R4M I;  3FAH A;  2LHD A;  2D2Q A;  2KNB A;  2C7M B;  3APD A;  2J42 A;  2ASQ A;  4AQ7 A;  1N6Z A;  1NI3 A;  2K6D B;  2C9W B;  4N59 A;  1J19 A;  2ZW1 A;  1YIW A;  4HCP B;  3KUZ A;  2EMS A;  2PLP A;  4LNK A;  1WGH A;  1NI2 A;  2AX5 A;  4NNJ B;  4C7Z A;  5D7G A;  5JZE B;  1NVI D;  3C19 A;  1B9R A;  2R2O A;  2VRR B;  2QHO A;  2N4F A;  2LWP A;  4KIK B;  1YD8 U;  3KQ4 A;  1A70 A;  2KFJ A;  2YVC A;  1JW9 D;  4BKS D;  3H7P B;  2YEP F;  2MCN B;  1MFW A;  2KN5 A;  4BOS C;  2N9K A;  1WGY A;  3KYD D;  3PHW B;  3I5J C;  3A1Q A;  3RPF C;  2N9X A;  2ZVN A;  4EEW A;  5FR6 A;  1GB4 A;  4MEL A;  4UDU C;  1V1P B;  1I4G A;  4ANW A;  5L95 C;  4W9K A;  1FXT B;  4ZRI A;  2W55 A;  2KHW B;  2PEA A;  4L23 A;  1XF5 L;  1WIA A;  3PV1 A;  3AE6 B;  1XT9 B;  1R4N I;  2ON8 A;  2BVC A;  4JWS C;  4AOF A;  4KVG B;  2REX A;  4IG7 B;  4KX6 B;  1L7Y A;  2IO0 B;  3N32 A;  3Q8A A;  1N5W A;  2WXK A;  1DOX A;  3N3K B;  3SDL C;  3AEB B;  1WR6 E;  2RDG A;  3RUI B;  3M62 B;  2KWC A;  2PTL A;  2JXT A;  4KIK A;  1TZ1 A;  3DQV A;  1C78 A;  2HTH A;  2EKE C;  4YL8 A;  1WGD A;  4RMA A;  2MW5 A;  3QAR A;  4M00 A;  2IDY A;  1ZP0 B;  3P2B A;  5EE1 A;  4CYE A;  2V4I B;  1V1P A;  1SE9 A;  4WQM A;  4HKQ A;  2Y5C A;  2MLB A;  3GZN I;  2WXN A;  4KKI A;  4N9F 4;  1E10 A;  2Z8L A;  3PO0 A;  2MP2 B;  2K9X A;  3RI7 C;  3HHM A;  3Q8C A;  1BUI C;  1XLP A;  5H8Y E;  1SGH A;  2FAZ A;  1CMX B;  4USA A;  4IM2 A;  1ZXH A;  1KF6 B;  1EO6 A;  5BYR A;  3WAO A;  1OQQ A;  2RD0 A;  1HA5 A;  1C4A A;  1LFD A;  3RMK C;  2LAS A;  1YJJ A;  3L17 A;  1IP9 A;  4B0E A;  2DBY A;  4PS3 A;  4LDT D;  4W9G A;  1I7H A;  4DQO C;  2ZNV C;  3OJ3 A;  1F77 A;  3AE1 B;  2ZVO A;  3UIN B;  4C7Y A;  4JL9 A;  2RMM A;  3AEA B;  3QQ8 B;  3DBL I;  3DOW A;  3BYT B;  3ZXV A;  3NVV A;  2KQ4 X;  2K8C A;  2KAC A;  3ZKJ C;  4RGO S;  3DHG C;  1YX5 B;  3AE9 B;  3GE3 C;  2AWT A;  1DYQ A;  3PVL A;  4HRO A;  2EEL A;  3EA6 A;  3NY5 A;  3AE8 B;  3PT2 B;  1YNT E;  5C2T B;  1EWY C;  4NQK E;  4RH6 A;  2LJ5 A;  3WAP A;  2PJH A;  2ACZ B;  3MHS D;  5G5H A;  1CQV A;  3RNA C;  4KDI C;  3VH4 B;  2NS5 A;  2ICI A;  1V80 A;  1L0Y B;  2CJO A;  2D07 B;  3AN1 A;  2IY1 B;  4G50 A;  2RR9 A;  3U30 A;  1LXD A;  1T5X D;  2M56 B;  2IO3 B;  1FM0 D;  2JYE A;  2KX3 A;  2NTT A;  2KZR A;  1WE6 A;  3M95 A;  4EOY A;  5EDS A;  2JF5 A;  2JRI B;  3VXW A;  1SIF A;  3B0A A;  3LJ3 A;  4ANU A;  1EWC A;  5L83 A;  2K3U A;  3WCQ A;  2INP E;  1YOV B;  2PW9 A;  2K8B A;  3ZVV A;  3NS1 A;  5D6J B;  5AZG A;  4BBN F;  1WM3 A;  1FO4 A;  5D3D A;  2NTS A;  1WJN A;  1WFY A;  2HD5 B;  5J18 A;  2MBO A;  4P1C C;  1WMH B;  4EKU A;  1IBX A;  1WZ3 A;  1I4Q A;  5BMI A;  5BO4 B;  4NAW A;  2M0A A;  3QK0 A;  4HWI B;  2BWE S;  1ROE A;  2JZP A;  4LNN A;  2L3Z A;  1SJE D;  2KK8 A;  2WXJ A;  4XDD A;  2I1J A;  1FNW A;  1IUE A;  2JT4 B;  4LCD E;  2OJW A;  2N9P C;  3AB5 A;  5E6O A;  3W1Y A;  3IBE A;  2J7Q B;  2CU1 A;  2BW2 A;  1GOZ A;  1VZ6 A;  2G4S A;  5GXG B;  2V3S A;  2FCQ A;  5IP4 D;  4G3X B;  3ZUN A;  2WNM A;  3P42 A;  2BTE A;  3RCZ A;  4BFR A;  1TKY A;  2J0K A;  2WXQ A;  4K3B A;  2LGX A;  1E8X A;  5BMG A;  4NQL B;  4FJZ A;  4XDC A;  4NJ7 A;  1WMH A;  4TQ1 A;  1ZPS A;  3OAW A;  1C4P A;  3IT4 B;  2K0P A;  4FBJ B;  3KWL A;  4M0W B;  1Z2M A;  3PHX B;  4OW0 A;  3AM9 A;  4HDQ A;  1N5X A;  2ZNV B;  1R4N B;  1JWM D;  2BS2 B;  4WWM A;  2WU2 B;  3ZGZ A;  1GNU A;  2HJ8 A;  2ZW0 A;  1NYR A;  3TCA A;  3CMM B;  3TEW A;  5DPS A;  1RFK A;  2LGD A;  3GP7 A;  4KZC A;  5D3I B;  3P4Q B;  3V6C B;  3SU8 X;  1WXV A;  2AQ2 B;  1T0Q C;  3Q14 C;  3GS2 A;  2AYO B;  1Y56 A;  1KFY B;  2K22 A;  3EUB 2;  1SE3 A;  1EUV B;  1E7U A;  1DOY A;  4FHK A;  4GU2 A;  4XYC A;  2DAJ A;  1XLQ A;  1TJE A;  1X1M A;  4DXG A;  3Q3J A;  1E7V A;  4L2Y A;  1E90 A;  2HDE A;  3OWE B;  3HM3 A;  4K3C A;  1SE2 A;  2AL6 A;  4BZA A;  3GZN B;  2HTM E;  5D94 A;  1AWD A;  5JH5 C;  2BPS A;  2JX5 A;  2LVO A;  1RFA A;  2MBE A;  2TSS A;  1RYJ A;  4BKS A;  1P1A A;  1YJ1 A;  5LXI B;  2M1M A;  4G0N B;  4II2 B;  3U7Z A;  2NR2 A;  4WWP A;  3PZ7 A;  1UGM A;  3BVM A;  3N1Z C;  4XWW A;  4N58 A;  3BVZ A;  2UWQ A;  4AJW A;  1KLV A;  1WXS A;  1IGC A;  3A33 B;  2I1K A;  2I2Y A;  4IWO A;  4C00 A;  3GB1 A;  1LO5 D;  1Q1O A;  2A4Z A;  1NEN B;  3DBL B;  3AED B;  2KDI A;  4YSX B;  1TT5 B;  4ZHP A;  3ZTC A;  2OHF A;  3BYY B;  3MC8 A;  2MWS B;  3Q3O C;  3SD5 A;  2IPK D;  1XO3 A;  1ZGU B;  1NBF C;  3DBH B;  3A9J B;  1KJT A;  1ET6 A;  3BII D;  2WXM A;  3QAQ A;  3WA0 A;  4AUQ C;  2D5G A;  3JSV A;  3QIJ A;  2CKH B;  2PE6 B;  2L83 A;  5MPO A;  3P4R B;  1EF1 A;  1QIL A;  1UZX B;  2FUH B;  4W9L A;  1JML A;  4BOZ B;  2INN E;  1MHX A;  4MH8 A;  3VR9 B;  3M3J A;  4F8C B;  1XLN A;  3V62 A;  1KRH A;  1EF5 A;  4ASW C;  5IOI A;  1FIQ A;  1TIF A;  4C4V A;  4MT5 A;  2M19 A;  2SEB D;  1WGK A;  1K53 A;  4L1B A;  4TV3 A;  2C60 A;  1Q10 A;  2BYV E;  3VUW A;  3X23 A;  1SF0 A;  2KQ7 A;  4P1B C;  3KUC B;  1D5X C;  3MTN B;  4MGZ E;  1WWT A;  1UBQ A;  2IZV B;  2L32 A;  4YWG G;  4MAC A;  4WH4 A;  1WJ4 A;  4KZ0 A;  4RM9 A;  4GGQ A;  1PDX A;  2RSU A;  3APF A;  4REZ A;  3VUY A;  2DHZ A;  1GJZ A;  4WAF A;  2JRH A;  3CF6 E;  4A9A A;  4YXD B;  2YEP B;  4FXC A;  4WJP A;  4YSY B;  2UYZ B;  3NRZ A;  3MJ5 A;  3JW0 X;  4M8M A;  1FRD A;  4CO7 A;  4FN2 A;  3JVZ X;  3UQA A;  2DZI A;  5HHD G;  1STE A;  2UU7 A;  1FCL A;  2ZJD A;  2C5L C;  2JQR B;  2LGS A;  3ECI A;  4EZL A;  1EM7 A;  3BY4 B;  1UGJ A;  4BBN C;  4FJY A;  2IGG A;  4LNO A;  4A8X C;  3ZYY X;  5AUK A;  4K7U A;  1J7C A;  3H6N A;  1D6E C;  3O13 A;  2Z0D B;  1IPG A;  4RF0 A;  2O6V B;  3ZJT A;  1E7P B;  2M8S A;  2JPH A;  5EE0 A;  1HZ6 A;  2A5U A;  2E3T A;  2FIF A;  2Z59 B;  1P3Q U;  2PKO A;  4HDO A;  3J9C A;  4K1R B;  3CST A;  1ZOY B;  3K9O B;  3R2I A;  1GC6 A;  3NOB A;  3W5V B;  1UBI A;  4A3O A;  4GB9 A;  1N62 A;  3VTU A;  5G5G A;  1VCB A;  3FIL B;  3VR8 B;  2IO2 B;  4HPP A;  4DDG D;  2H88 B;  2K8H A;  1GAQ B;  2KKC A;  1UEL A;  2JSV X;  2NPT B;  4IUM B;  2KT7 A;  4US9 A;  4MJS B;  3AEC B;  4FUL A;  1WY8 A;  4MGI E;  4JQW C;  1XXG A;  4KGT A;  4NPN A;  3ZQ4 A;  1P0R A;  4I6P A;  4II3 B;  2BWF A;  5JXV A;  2LUM A;  3P4P B;  2WXO A;  3UIO B;  1WI0 A;  2G45 B;  3ZNZ B;  2O6V A;  1SB3 C;  3PRE A;  3RZW C;  2WGS A;  1FFU A;  3A4S C;  3H7P A;  3AE3 B;  2RDB C;  3UF8 A;  2KMM A;  2GLS A;  1K51 A;  2W3S A;  1VZ8 A;  1WXA A;  2GBR A;  1YJI A;  4TUU A;  3Q3F A;  4MGK E;  1WSP A;  1RAX A;  3HVD A;  1F9J A;  3MC9 A;  3FIL A;  4MGY E;  1F52 A;  3TL5 A;  5CHW A;  3QA8 A;  1HTQ A;  2L76 A;  1WJ6 A;  4OZC A;  1V8C A;  1WGG A;  1QLB B;  4GDL B;  4ZOH C;  4WUR A;  1LQB A;  2NPT A;  3DBR I;  1TS5 A;  4MJS A;  2LXC A;  2GOW A;  2DNF A;  3VTV A;  4EE2 A;  3VDZ A;  2IGH A;  1V9J A;  3PLU A;  5BMH A;  1FMA D;  2K25 A;  3V6E B;  2LFI A;  2FE8 A;  5FKA C;  2MJ3 A;  2L0F A;  5IKC M;  1TTN A;  3L08 A;  2M4N A;  1FEH A;  3IVF A;  1U4A A;  1YQ4 B;  5AUI A;  1HEZ E;  2MHJ A;  4OZB A;  2J52 A;  2BYF A;  3TUO A;  3DBS A;  3U4E G;  2BBC A;  3U52 E;  4IM3 A;  3QX1 A;  2MRP A;  1ZUD 2;  4BKT A;  2BF8 B;  4B0M A;  1XCQ L;  4KGS A;  3WAL A;  4C80 A;  4EFO A;  2D3A A;  3I9V 1;  4RFB A;  2FNJ B;  1R7S A;  2MP2 A;  4GN1 A;  2MA9 B;  1VLB A;  1I35 A;  1WJU A;  3ETR A;  2N7E A;  2WWZ A;  3SEB A;  4RF1 A;  3CIR B;  2CHW A;  3EHV A;  2VZK D;  1SSN A;  1UF0 A;  1H8C A;  2PE9 A;  3NUH B;  4W9I A;  3PRM B;  1VR9 A;  2LEK A;  3MP9 A;  3RNC C;  3VH3 B;  3AXC A;  2MEK A;  2KLC A;  1IYF A;  4WJO A;  4HPL B;  2CJN A;  2ZPY A;  3ZJV A;  2KDE B;  3T9L A;  3R66 C;  2WXL A;  3VRA B;  3ZIM A;  4DHZ B;  2BYT A;  1JWA D;  1HE8 A;  2LI5 A;  4GIV A;  1YMH E;  4KKJ A;  2NCN A;  4PYU A;  4IW0 A;  1TS2 A;  4XX5 A;  2D3B A;  2KO3 A;  3PZD A;  2PIA A;  2GBK A;  4DXA B;  2D3C A;  2MJD A;  3EFU A;  3R8B A;  2L0T A;  1VDV A;  3ZNI D;  1T3Q A;  4HJK A;  2ONQ A;  3VVW B;  3ALB A;  3L54 A;  3TEY A;  2N0S B;  4O1N A;  4LNI A;  2WXG A;  2B3A A;  2BB5 A;  4YSZ B;  4HJG E;  5HKH A;  4ARI A;  2LRW A;  3ML8 A;  5C23 A;  1BT0 A;  2G3Q B;  2EKI A;  4NJC A;  1V5O A;  1E5W A;  1WX9 A;  1LM8 B;  3HUI A;  1N63 A;  4OVU A;  4AWJ A;  1HXY D;  2IJ0 A;  2MBQ A;  4RNA A;  4E3C A;  1UWX A;  1P7F A;  4S0R A;  1R4M B;  1Y8R C;  2ZZP B;  3W1S C;  2KMA A;  1L6V A;  1Q0W B;  2N7D A;  3AEG B;  1BXT A;  2CHZ A;  4A20 A;  2FCM A;  2K39 A;  2V3N A;  4NJ6 A;  5DPR A;  2OJR A;  2YLM A;  3EGR A;  2GI9 A;  2G9H D;  3MJW A;  2BB6 A;  2BS4 B;  2C7N B;  3A9K B;  2L8J A;  4HVB A;  2QDF A;  3B2F A;  4KGR A;  3V60 A;  1AYF A;  1ZXI A;  2IY0 B;  4YTP B;  4IM0 A;  5KHQ A; 
#chains in the Genus database with same CATH homology
 2KDI A;  2XBB C;  1WXM A;  4ANW A;  3ZTC A;  4W9K A;  5L95 C;  2MWS B;  1FXT B;  3SD5 A;  4ZRI A;  1ZGU B;  4HPM B;  1NBF C;  1YX6 B;  2J0M A;  2KHW B;  2PEA A;  3A9J B;  3R3M A;  3S2A A;  1KJT A;  1WIA A;  3QAQ A;  3PV1 A;  3WA0 A;  4AUQ C;  3JSV A;  1AAR A;  3QIJ A;  5LXI B;  2CKH B;  1RLF A;  2PE6 B;  3PLV A;  1XT9 B;  1R4N I;  1KOT A;  2AL3 A;  3APC A;  3ZO5 B;  2GMI C;  4EZK A;  4AOF A;  1EF1 A;  4WAA A;  4KVG B;  5DPW A;  2REX A;  4IG7 B;  1UZX B;  2FUH B;  4W9L A;  2LUE A;  1L7Y A;  2IO0 B;  2LVQ A;  2LVP A;  3N32 A;  4BOZ B;  3AUL A;  3M3J A;  4F8C B;  3V62 A;  1EF5 A;  2M17 A;  2LXA A;  4ASW C;  3CSF A;  3N3K B;  3RZF A;  4AJY B;  4A3P A;  3I3T B;  1S1Q B;  1YQB A;  3N30 A;  3SDL C;  1WR6 E;  3RUI B;  2DZK A;  3M62 B;  3VUW A;  2KWC A;  3QCA A;  1GG3 A;  2C60 A;  2BYV E;  4TV3 A;  3VFK A;  3X23 A;  2KX0 A;  4NAW B;  4KIK A;  1TZ1 A;  2KQ7 A;  3DQV A;  3KUC B;  3MTN B;  4TQ0 A;  5LXH A;  2EMT A;  2HTH A;  2EKE C;  3ONS A;  4YL8 A;  4GSW A;  1WGD A;  4RMA A;  2MW5 A;  3QAR A;  4MGZ E;  2DZM A;  3NZS A;  1UBQ A;  4DHZ E;  2IZV B;  3QC8 B;  1WYW B;  3A9K A;  1WJ4 A;  2R2Q A;  4KZ0 A;  2AEH A;  4GGQ A;  4RM9 A;  2K1F A;  4HK2 A;  2RSU A;  1OEY J;  3APF A;  3L0W B;  4HXD A;  3VUY A;  1K8R B;  3AI5 A;  4GMV A;  3P2B A;  2DHZ A;  4CYE A;  2O6V D;  4FLH A;  2JRH A;  4JGH B;  3CF6 E;  1GJZ A;  5AZF A;  5CTR C;  1SE9 A;  4GXB A;  2MLB A;  4WJP A;  3GZN I;  2D11 A;  2UYZ B;  4W9D A;  4F1S A;  3JW0 X;  4M8M A;  2BGF A;  4CO7 A;  4B9K A;  4FN2 A;  2MBB B;  4ZRJ A;  3TBL D;  3JVZ X;  2FID A;  2W9N A;  3UQA A;  2IO1 B;  2KWV B;  4N9F 4;  2KC1 A;  2DZI A;  3KVF B;  3V61 A;  4MSM B;  3UIP B;  3L13 A;  2MP2 B;  1OGW A;  2ZJD A;  2C5L C;  2O2V B;  4OVV A;  3HHM A;  3ZDT A;  3T8M A;  2WX1 A;  3ECI A;  1SGH A;  2RGF A;  2FAZ A;  4EZL A;  1CMX B;  3BY4 B;  4IM2 A;  5G2N A;  1EO6 A;  4BBN C;  3WAO A;  4PS8 A;  2KDF B;  4CHK A;  4FJY A;  2RD0 A;  3VQI A;  1LFD A;  3O65 B;  4K7U A;  3DDC B;  2G4D B;  4ICU A;  3H6N A;  2LAS A;  3PSE B;  1E8Y A;  3L17 A;  1Q5W B;  1IP9 A;  1WE7 A;  2Z0D B;  2KOX A;  1IPG A;  4LDT D;  4PS3 A;  4W9G A;  4MEM A;  2O6V B;  2MSE D;  4RM8 A;  2ZNV C;  5J17 A;  3D32 A;  4AP4 C;  3OJ3 A;  1OQY A;  1WF9 A;  4FHJ A;  4ANV A;  3VAW A;  5CHF A;  2ZVO A;  2GBN A;  3UIN B;  4WQO B;  2KMC A;  4JL9 A;  2L05 A;  2M8S A;  2JPH A;  1D3Z A;  4W9J A;  2DX5 B;  1V49 A;  3QQ8 B;  2A5U A;  3DBL I;  3DOW A;  3DPD A;  3HM6 X;  2FIF A;  2Z59 B;  5IAA C;  1P3Q U;  4HDO A;  1J0G A;  4EZJ A;  4K1R B;  2JXX A;  3IG3 A;  1V6E A;  2K8C A;  2KJR A;  5JHB A;  5J2R A;  1TBE A;  3CST A;  3K9O B;  3AU5 A;  3IHP C;  3ZKJ C;  2KXJ A;  1GC6 A;  2CR5 A;  2L00 B;  3NOB A;  1UBI A;  2BYE A;  4GB9 A;  3VTU A;  3ZLZ A;  4A3O A;  1YX5 B;  1VCB A;  2AWT A;  2IO2 B;  3ZNH B;  4DDG D;  2K8H A;  3PVL A;  4K7S A;  3GOE A;  1WX8 A;  1UEL A;  2J0J A;  2KKC A;  4ANX A;  4IC7 B;  2DYM A;  2KAN A;  5LLI A;  3TIX A;  3TJP A;  1V86 A;  1VD2 A;  3AU4 A;  2WX0 A;  5C1Z A;  3NY5 A;  4X57 B;  2O2V A;  3PT2 B;  2NPT B;  4LDT B;  4IUM B;  1C3T A;  4NQK E;  3WAP A;  2LJ5 A;  4KDL B;  1E8Z A;  2PJH A;  1MG8 A;  4XZ4 A;  3DCG A;  4MJS B;  3MHS D;  2BKR B;  4FUL A;  4JLC A;  1WY8 A;  4DWF A;  4FAD A;  4MGI E;  5JHA A;  4JQW C;  4KDI C;  3VH4 B;  2NS5 A;  3RYT A;  2DYO A;  4NPN A;  2DYB A;  1P0R A;  4I6P A;  4II3 B;  1V80 A;  1A5R A;  2BWF A;  2PPH A;  3NZU A;  1C1Y B;  3DVG X;  3UGB B;  4WWN A;  3UIO B;  3QWZ B;  1WI0 A;  2D07 B;  2G45 B;  2LZ6 A;  4LJO B;  3ZNZ B;  1XD3 B;  2O6V A;  4DHJ B;  2IY1 B;  5DPT A;  3PRE A;  4G50 A;  2RR9 A;  3RZW C;  1LXD A;  3U30 A;  4BKG A;  3RT3 B;  3ZNG C;  2NBV B;  1I42 A;  3ZRF A;  2IO3 B;  3A4S C;  3H7P A;  4P7I A;  3UF8 A;  4XC2 A;  3ZW3 A;  4KSL C;  2XEW A;  4FA6 A;  1WXA A;  4W9F A;  4WJQ A;  2KFK B;  2GBR A;  2KX3 A;  2N9E B;  4MDK E;  4TUU A;  2KZR A;  1GC7 A;  2JZZ A;  1WE6 A;  3M95 A;  3Q3F A;  4EOY A;  4MGK E;  5D2M B;  1KM7 A;  4I6L B;  5EDS A;  2JF5 A;  2K6Q A;  2JRI B;  1RAX A;  4B95 A;  3VXW A;  1F9J A;  2V1Y A;  1OEY A;  4MGY E;  3PRP B;  3R7Q A;  4ZDV A;  2KWU B;  1SIF A;  3B0A A;  3LJ3 A;  2DZJ A;  3TL5 A;  5AEK B;  5CHW A;  4ANU A;  3QA8 A;  5L83 A;  1P9D U;  3A9J A;  3K9P B;  2L76 A;  3PS6 A;  2FCN A;  3ZDM C;  1WJ6 A;  2K8B A;  3ZVV A;  4J6I A;  5D6J B;  1WGG A;  1OTR B;  4GDL B;  5AZG A;  4BBN F;  5E6P A;  1WM3 A;  1J8C A;  3X0W A;  1LQB A;  2NPT A;  1WZ0 A;  3DBR I;  2JZ3 B;  1WJN A;  1WFY A;  2HD5 B;  2KVR A;  4G11 A;  5GMV A;  5J18 A;  1GUA B;  4MJS A;  2LXC A;  4W9H A;  2MBO A;  2GOW A;  1P98 A;  2LD9 A;  4W9E A;  1WMH B;  1RRB A;  2NBW B;  3RUL A;  3VTV A;  4EKU A;  3VDZ A;  1JRU A;  1V9J A;  4I6N B;  3PLU A;  1WR1 A;  3JSV B;  2MX2 A;  1WZ3 A;  2D3G A;  3R7R A;  3B1L X;  2K25 A;  1WX7 A;  4EUT A;  2IBI B;  3V6E B;  5AZH A;  3DVG Y;  4DDI D;  3IFW B;  5BO4 B;  4NAW A;  5IA7 A;  3QK0 A;  2L0F A;  4HCN B;  4HWI B;  2BWE S;  4IWP A;  5G55 A;  5TR5 A;  1L2N A;  1TTN A;  3L08 A;  4HLE A;  2M4N A;  4JIO U;  2L3Z A;  2XK5 B;  5E6N A;  2ZEQ A;  3IVF A;  4FJV B;  1U4A A;  2KK8 A;  2KJ6 A;  2I1J A;  4ZRK A;  3L16 A;  4PYZ A;  4WJN A;  2JT4 B;  4LCD E;  3HIZ A;  2KFK A;  4W9C A;  2CS4 A;  2GBJ A;  2N9P C;  1V5T A;  2BYF A;  4M8N A;  5E6O A;  1TGZ B;  3W1Y A;  3DBS A;  4DHJ D;  4GOC A;  3HK0 A;  4IM3 A;  3IBE A;  3QX1 A;  2MRP A;  3ZTD A;  4BKT A;  2J7Q B;  4MH0 E;  4DBG A;  2KTR B;  4PS7 A;  2CU1 A;  2BF8 B;  2KTF A;  5DCN A;  3OLM D;  2LRU A;  3JYU A;  5KHO A;  3WAL A;  1PQS A;  3DVN U;  4EFO A;  4K7W A;  2N1V A;  4ZYN A;  2NBU A;  3WAN A;  3A4R A;  2JWZ A;  2FNJ B;  2G4S A;  2BKF A;  5CHV C;  2V3S A;  3VHT C;  2FCQ A;  3C0R B;  1ZW7 A;  1UH6 A;  4G3X B;  2MP2 A;  4GN1 A;  2MA9 B;  3ZUN A;  4E74 A;  1I35 A;  1WGR A;  1WJU A;  2N7E A;  2WWZ A;  4GDK B;  3OJ4 B;  3RCZ A;  2CHW A;  4BFR A;  3EHV A;  4BVU C;  4DK5 A;  2Z0E B;  2J0K A;  3L10 B;  2LGX A;  1E8X A;  1H8C A;  4NQL B;  1V2Y A;  2V4L A;  1WH3 A;  2PE9 A;  4FJZ A;  4NJ7 A;  1WMH A;  4MSQ B;  4W9I A;  4TQ1 A;  3PRM B;  1WM2 A;  1ZKH A;  3VUX A;  3EEC A;  3B08 A;  3OAW A;  4NY0 A;  3VH3 B;  3AXC A;  3LDZ E;  4K81 A;  1QZE A;  3NHE B;  2WDT B;  1NDD A;  3PGE A;  2MQJ A;  3H9D A;  3NS8 A;  2KLC A;  3KYC D;  2MBH A;  3KW5 B;  4FBJ B;  1IYF A;  4WJO A;  2CHX A;  1T0Y A;  4HPL B;  2KQS A;  4M0W B;  1Z2M A;  2ZPY A;  2JUO A;  1E8W A;  3PHX B;  3U7D A;  2KLG A;  2WYQ A;  2KDE B;  4HDQ A;  3T9L A;  3R66 C;  2ZNV B;  3TMP B;  3ZIM A;  3U8Z A;  3WAM A;  4DHZ B;  1HE8 A;  2XK5 A;  2LI5 A;  4GIV A;  3BIN A;  1GNU A;  2HJ8 A;  3TCA A;  2NCN A;  3KH0 A;  4PYU A;  4IW0 A;  1UD7 A;  2KJH B;  4XX5 A;  1H4R A;  2ZCB A;  2KO3 A;  3CMM B;  5DPS A;  3PZD A;  4WWO A;  4KSK C;  2M0X A;  3M63 B;  4LJP B;  2GBK A;  2FCS A;  4DXA B;  1XQQ A;  2DEN B;  2LGD A;  3EFU A;  3PRZ A;  1WRD B;  4URK A;  2KTR A;  2L0T A;  4KZC A;  3ZNI D;  4HJK A;  2N1W A;  1V81 A;  3V6C B;  3VVW B;  3SU8 X;  1WXV A;  3A1Q B;  1ISN A;  3ALB A;  2AYO B;  2LGY A;  3L54 A;  2KD0 A;  2D10 A;  1EUV B;  1E7U A;  4TKN A;  4FHK A;  4GU2 A;  2B3A A;  3PPA A;  4GDK A;  2DAJ A;  5CX3 A;  1M94 A;  2DAF A;  4MM3 A;  2KDB A;  2Y5B B;  1X1M A;  3Q3J A;  1E7V A;  5HKH A;  2GBM A;  2LRW A;  3DVN V;  1E90 A;  3ML8 A;  3PTF C;  2OOB B;  2JY6 A;  2KC2 A;  2ZPN A;  5C23 A;  1BT0 A;  2G3Q B;  3HM3 A;  3ZRC A;  1V5O A;  2HE7 A;  1E5W A;  2AL6 A;  1WX9 A;  1Z5S B;  3H7S A;  1LM8 B;  1R4M I;  3W1S A;  3UQB A;  2D2Q A;  4OVU A;  2KNB A;  4AWJ A;  2MBQ A;  3EC8 A;  5D94 A;  4B6W A;  4E71 A;  2C7M B;  5JH5 C;  2BPS A;  3APD A;  2ASQ A;  2LVO A;  4E3C A;  2L7R A;  2K6D B;  2NVU I;  1RFA A;  2C9W B;  2JVC A;  2MBE A;  2ZCC A;  1J19 A;  1Y8R C;  2ZZP B;  4BKS A;  3W1S C;  1P1A A;  1YIW A;  2KMA A;  1YJ1 A;  3KUZ A;  1Q0W B;  2EMS A;  2M1M A;  3ML9 A;  1WGH A;  2N7D A;  4G0N B;  4HCP B;  4II2 B;  3RD2 A;  2CHZ A;  1NI2 A;  4NNJ B;  4A20 A;  5D7G A;  5JZE B;  2NR2 A;  2FCM A;  2K39 A;  2R2O A;  3QJZ A;  4ICV A;  4WWP A;  3SHQ A;  1UGM A;  3QHT A;  2VRR B;  2QHO A;  2N4F A;  4NJ6 A;  5DPR A;  3WIM A;  2OJR A;  2LWP A;  2YLM A;  4IWQ A;  4KIK B;  1YD8 U;  2UWQ A;  4AJW A;  1KLV A;  2KFJ A;  2YVC A;  2IYD B;  3ENE A;  3MJW A;  4BKS D;  1G6J A;  3H7P B;  2MCN B;  2C7N B;  3VTW A;  2KN5 A;  4BOS C;  1WXS A;  3A9K B;  2L8J A;  3A33 B;  2I1K A;  4HVB A;  1WGY A;  4IWO A;  3KYD D;  3PHW B;  3V60 A;  3A1Q A;  4KV2 A;  2A4Z A;  1Q1O A;  2N9X A;  2ZVN A;  4EEW A;  3DBH I;  5FR6 A;  2RPQ A;  4GDL A;  2IY0 B;  3KUD B;  2C7H A;  4MEL A;  4F7Z A;  4IM0 A;  5KHQ A;  1S3S G;  3H1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...