4M02A

Middle fragment(residues 494-663) of the binding region of srap
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
169
structure length
169
Chain Sequence
AVTQVRYVDVTTGKDIIPPKTYSGNVDQVVTIDNQQSALTAKGYNYTSVDSSYASTYNDTNKTVKMTNAGQSVTYYFTDVKAPTVTVGNQTIEVGKTMNPIVLTTTDNGTGTVTNTVTGLPSGLSYDSATNSIIGTPTKIGQSTVTVVSTDQANNKSTTTFTINVVDTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into SraP-Mediated Staphylococcus aureus Adhesion to Host Cells
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Calcium binding protein
molecule keywords Serine-rich adhesin for platelets
total genus 45
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2013-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m02A02
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 4m02A01
4MNQD 3CVHH 3IDGA 2IADA 4F58L 4QT5B 3RWIB 3VDAA 1P4LB 5C0DB 2VSDA 3UC0H 5BRZB 4P23B 3VGDA 2MSPA 4J1UA 1YDPB 3TA3C 3LQZB 3LS4L 1XGTB 3V4VH 1DQLH 4PJ8A 1F00I 2WUCH 3B9KC 5F6HJ 1F3JB 4F2MB 4UOW1 2H2PD 4KK9D 4WWKD 3L5XL 4OLWL 2V17H 4ZNEA 5EZOL 2AVGA 1PGRB 3IDNA 5GZOC 5ADPH 2Y23A 2EO9A 2EXYC 4GG6B 2BXZA 4Q97A 2E8YA 3ME0A 5F6IC 2OMNA 5D2NC 4UILH 3T4AB 4OAWA 1INEH 4PJEF 1SMOA 1KN4H 3O45B 5J57B 2BSSA 4FTVD 1JPSL 1EJ6A 3LD8B 3HRZB 2J8UA 2VXSL 1DQDL 2Y07H 12E8H 3RRQA 3E1F1 1T7WA 1HHJB 5K9JL 2VXQL 2J88L 3MCLH 5IR1A 5D2LB 3M1BA 3BMWA 3JZ7A 4QRRE 2C3GA 4XP4H 4ODTL 1IAOB 5HI3D 5CUSL 4YFLI 3D2UD 5T3ZE 4KPHH 3I6KA 1QSFA 3KLSA 3N85L 1H5BA 1ZSDB 3QP3A 3T2NH 4WVRA 3GM8A 3MRQB 4PGDB 4OCLC 1XCQB 2O61B 3BKCH 4IDJH 1WBYB 5LBSL 2FH8A 5F7NC 2WV3A 2ZSWB 1BGXH 3QIWB 3BE1H 5BV7B 2P45B 2P5WB 3PABA 3D18B 3QUZD 1MWAL 3GEWB 4BZ2H 5DJ0B 5HD8C 3ARGA 1MFDH 1FV1B 2G60L 2AI0H 4NBYB 3BEWA 1T2QL 1QSFB 4U7MA 1E4XH 2DQCH 1N5YH 1UT9A 2Q7YB 4PGBA 3E6HB 4S1QL 1S9WB 2BCKB 2B1AH 4IDLA 5AZEL 1NGPL 4M8VA 3D85A 1AGFB 1X4YA 1SEQL 3GI9L 1QO3B 3DTXA 4TPRL 1WF5A 3MRCB 4P5MB 4GAYB 1GAFH 1YY9C 4LCIH 5EUOE 4PJCE 3HKFA 4R0LC 1NFDF 1HSBB 5C0AB 4WFFE 5CWSB 5HI4C 2EH8L 2NY7H 5FYLL 2A6IB 4ZDHB 4ELKB 2WUBH 4JDZB 2DI9A 4AIZA 5FCSH 3LB6C 2WSKA 3BSZH 3GGWB 1NBVH 4S1RL 5F3BA 4JKPL 3BQUC 1RIVL 1I85A 4DVRH 5E8EB 1JHLH 5F7YC 2C4FT 3E0GA 4BKLA 1YEKH 2A73B 1BOGA 3FB8A 4OCRL 4HXBH 3QSKB 3DO7B 3KWWB 5HPMA 4AQOA 5I71C 2IFGA 4F33B 2VDOL 4M3KB 5CKGA 4MA8L 2ADIB 4PV9B 4CVWA 5HDQL 4G8EB 4JDVA 3GUTB 2D2OA 2ZKHL 1BBJB 3RVUC 3SQOH 1G6RH 1S9XB 5DD3H 3L95A 2W9LA 1R3LA 1MWAB 2CUMA 4L8CA 4M7LT 4KRPC 2AJYL 1FP5A 3T3PE 4CKVX 5A2FA 3HUJF 2I9LB 3QUKB 4MDJA 4DN4H 1H0DA 1E6OH 2R0KH 2DTSA 4DKFH 2AKRA 3SE9H 3RTQB 4NPYA 1T2QH 1G9ML 5HDQH 3Q0HA 4JFYB 5K59E 1T1ZB 2DQFB 4NWUL 3DARA 1HN1A 5E6ZA 4MD4B 8FABB 1JYVA 1J12A 4JO2H 1T1XA 3PWUB 4OD1L 3S9DB 4W6WB 5D1ZB 1IRAY 5MERB 1TJHH 1IVLA 2C9AA 3QXUA 4PJDE 4LKCA 1H8NA 2I25N 4N8VB 4IS6B 1I1CA 3FN3A 5GRUH 2G9HB 4LVHB 2PW1B 3KYMA 1AIFB 4FFVC 1LDPL 4XCNB 1CLZH 3FB7A 1BJ1J 5JHLH 1JPTL 3WDJA 3RNKB 3GMLA 4NN5C 4O02H 1KCSL 1BEYL 4BFGA 5HGBB 1PLGL 1JN6B 1FZJA 3LS5H 2DQFA 3VI3E 1KB9K 3B3IB 1L6ZA 4HWZB 4MJ6B 1FVEB 3QEQE 1FZOB 1GAFL 3HZKA 4V1DB 3MCLL 3LH2H 1A4JA 3OKOA 2CQVA 2P8LB 2CIKB 3MACL 1YEIL 4N0UB 4MSWA 2OL3H 2XOTA 2B4CH 1RJYA 3BVNA 4MB3A 3U36A 3EOYG 2IALA 5HHVH 2HT3D 2BRRL 1NH6A 3AMKA 1B88A 4XAWL 2QQNH 3MLYH 3ZYJA 5IMMA 4XCYA 4YIQA 1IMHC 5D7JA 1MIEL 2EYTA 3DBXB 5F1SA 2AV1A 1VACB 4LHUA 1NMCB 2VWEC 2FGWH 2CK0L 5D6CB 2Y6SC 4ZO7A 4KKBC 3WYRA 4P2QA 4YXLL 1EHNA 4FP8H 2XA8H 4WI8A 1LD9B 5DJYB 5KJRH 5K9KA 5D7SL 4I3RH 2VITA 2YEZA 3C09B 1FH5L 2ARJB 5L9DH 3C60A 4XCCL 1YYMH 2NY3D 4HGKC 4O2CA 4M1CD 1HSAA 3LDBC 3ZTJG 1F4WH 5KN5B 5MEPA 4KJYB 4ZSOB 5DYOB 2VLRD 2FNBA 3UTSE 4JE4B 2BVPA 2GJ6E 1BBDH 3CFCH 4HJ0C 4NRXA 2BDNH 4Z5RB 2AK4D 1J9CT 3OBAA 3MLXL 5HHNB 1XT5A 2VXVH 5T3ZH 3B5GA 3QQ9C 4JLRA 4HG4J 3TT3L 5JHDE 4H26B 4OT1H 5HPOA 4U1MB 1TCRB 2HVKA 5HVHC 2OLDA 4HK0B 4P5TC 1S5IL 1EV2E 5HGGS 4X7TB 2XZQH 3BKYL 4JFDE 4K7FB 3GNML 1PLGH 3VFRA 5IKCB 3PGFH 3L3OA 4ZUUA 2VC2H 1FVCB 1OARL 4ONGH 4WI7A 3P0VH 1HZHL 3W9DB 4P5TB 4CAGA 4JRWA 2PO6C 5ID0A 1GPOH 2JB6A 2W1NA 4ZTOL 1MLBB 4A6YB 1DQQB 2D03L 5E1HB 2XYCA 3BDBA 3REWA 4MNHA 1A9EA 3R8QA 3RWJA 3WIHH 4I0CC 2AGJL 2B4CC 5KVGL 4YPGB 3RWGA 4ZAKD 5D6CA 2I26N 1JWMA 3VMPA 1MHHA 3QJFB 4H1LA 4JPIA 3RJQB 2F8XC 1XCTB 4MLIA 2F8OA 2V5MA 1CFQB 4ETYA 4BFEA 2YK1H 4HS3A 2L7UA 2ZUQC 1AD9A 4QOKA 4CUCA 4XMLL 2PR4H 2FYYA 2VIRA 5CBEA 3S35X 3WIIL 4QXUH 1EXUA 5C0AD 1UKQA 1BAFL 5F7FA 3QULA 4LARL 5LQBL 1KF9B 3MUY1 2D7OA 3HG1E 4Z77B 1AP2A 4JVWA 3VXSB 2AEPL 3EDFA 1OCWH 5C0BE 4PJEB 5F7EH 3MCKA 1OWRM 1DLHA 2CKBB 5GGVH 3KDMB 1A6AA 1PKQE 4GRWE 2RFXB 5DD1H 3VI3F 5J6HA 1KENL 3TVMC 3RZCC 1F45A 1MCBA 5KW9L 5F44A 4DKAA 4BQCA 4P2CG 1KT2A 3C6SB 4P4RA 4U1GB 5E7BA 4OQTH 1NLBL 1EZVY 5EUOB 1KCKA 2GI7A 1ORQB 4PB9L 3V2AR 1LEGA 1DTUA 2C3VB 1W0YT 5ETUA 5ICXA 1U8JB 2ICWJ 1YDPA 4DOHB 4P2RB 4OZGF 2WINB 1W0WB 3AU1A 1WFNA 4NDMB 1WWWX 1XF5A 4M6NH 4HS8L 4AENB 5IBLC 4R7DB 1NFDB 5GS1B 4F3FA 1Z6JT 4ZG1A 2GFBA 3W39B 1XR8A 4AM0B 5L2KB 2XFXA 4LF3A 1IBGL 1IQDA 4J8RB 1FNEB 1FVDA 3W9DA 4OM1H 5F71A 1HCFX 1LNUB 4GRLA 4MS8C 4ZD3H 3DSFH 1II4E 2CDEA 2VZTA 4HSQA 1MHCA 2WW8A 3LHPH 2YD2A 4QOKD 3OXRB 1D6EA 5LVEA 4DZ8B 4KKCD 2OR9L 1NMAL 1M71A 2JE8A 2CLRA 4YHYB 4OCSH 4L9LC 4ZS7H 4Y16C 5EZJB 3TO2A 4O2FA 4ZUTA 2ESVE 3KPRE 1X6LA 2BNUA 1U93A 4IRSD 2ZCLL 4DGYH 2F5BH 2VQUA 4UOW0 1S9KC 4I3GA 3K0WA 2NY4B 4X4YA 1CFBA 1CK0L 4M6AA 5DYOA 5EORH 2MQ3A 4NO0D 1CFTB 3ARBA 2EC9T 1P7KB 4MQ7B 2VUOA 1RJZB 3MLRL 3FAWA 3R0MA 4M5ZL 2WMPA 4D9RD 3TPUB 4UBDD 2WZPD 1K8IB 4GRMA 4MQXD 1U8LB 3T0EE 2H41A 4DN3L 4ELMF 5DJDB 5EDXA 1RZKC 3LRSA 3QNZA 3LN5A 3BOVA 3WFCL 4KKAD 1EBAA 2HG5A 1PBYA 4MNQB 4HPYH 4X0KB 4LVOC 5J6HB 4HUXB 4ZXBB 3GSOB 1GVIA 4GLRH 2H3NB 4K9EL 2HJLA 3CFEA 1QBBA 4M61A 3T0BA 2YD4A 5I1GL 3ARVA 5F9JA 5E6ID 3GFUA 2ZZUT 2OP4H 3IXTB 3QQ4B 1RSFA 1AXSB 2GY5A 3HC4H 2FEEI 5FCUL 3SGDH 2VLRE 4UMGA 1OGAA 1X5GA 1GGUA 3KPSA 3DXAA 4PY8J 5LWYH 2ZSWA 1A0QH 1OP5K 5I0ZA 3O3UN 4PJFA 1XF4B 2C3WA 4UZGA 4K3DL 3V7AE 5F7DA 2AK1L 2UYLB 4OCWH 4OZFB 2ZJSH 1SBSH 3ILQC 3EYSL 2X1PA 1MRCL 2PXYB 1NMBH 3FO9B 5FOJA 1C7TA 5IQ7L 4MCZB 4S1DD 3ZMRA 1ZHLA 4DUXA 1D9KB 4JPKL 5DUPH 1PQZB 5GQBA 1QFOA 4RWYL 1TVDA 4JZNB 3HAEA 5FDWB 2MNUA 4PREA 4RZCA 3HB3C 2X70B 3EHBD 3WKNA 1IGTB 3D3VB 1PW3A 1J8HA 3KPSB 3W2DL 1HILB 3SDAC 2YRZA 3IXTA 4LCCC 2VLKA 1QSZA 1OPGH 2DI7A 2AXFA 3T0AA 4XXCA 2AGJH 3NGBC 2R8SL 1U2CA 3EHBC 3LCYA 2X42A 2YBRA 3LRHA 3ZKQD 2R2BA 5CMAB 1U3HB 1DQTA 1YPZF 3SJVB 4P23A 3PE9A 4HUXA 2VXUL 4GKNA 3G9AB 1KTLA 2ERJC 4HXAH 4LSQL 1YMMA 1BQUA 1S7TB 4Q9QH 4I3SL 5EZOH 4QRPD 3L6FA 4G9FD 3BAEL 3OKKA 1NSNH 3D25B 5E6IB 5J13B 3PWVB 3VXMB 1ZT7A 4U4BA 3BT2L 1MH5A 5F7MC 1BBJA 4OJFL 5L6YH 1WAAA 4UDTB 2GCYB 2B2XH 2BC4A 2W9EL 4ZTPH 3U82B 5EO1A 3VFUA 2FO4B 3MNWA 1UEYA 1UXWB 3MXWH 1SJHA 5CJ8A 3ZDZF 2DLHA 2HKHH 3GBLA 3QRGH 3PGDA 2PYED 3U1SL 1A2YB 3B83A 1PAMA 2E3VA 2X41A 4W4NA 3QHZH 3O6LL 1EO8H 4NGHL 2H32H 1W8OA 5AG8A 2B4CL 3OF6A 1WAAF 5A3IC 1HH9B 3X11A 1GZQA 5EFIB 1XF2B 1BFTA 4EN3C 5I18H 1TDQA 5J9PB 2CLVB 5DO2D 1D5IH 3KXFB 5B3NA 3RFZC 2X4NB 4M62L 3T65B 4X4ME 4NN7B 2OCFD 4Q9BA 4PB0H 3SDXF 3S5LB 2CUIA 1F58L 3UEZA 3VFPA 3SEPA 2W92A 4GRWB 3DBXA 4KI5D 2XZZA 4AEFA 3KPNA 3VXQA 4YHKH 4E41E 1WZ1L 1D5ZA 4RFOL 3SJVA 5E2WL 2J2ZA 3ZE2F 1HYSC 4TNVF 1JN6A 3QXTA 4OLVL 2NZ9D 3SGKA 3FT2A 2CJUL 4QHNA 3DIFB 1U8IB 1G6VK 3JV0A 4K9EH 2OL3L 5I17B 1FV1A 2VLRA 3F7YA 3OKKB 1I7ZB 2NR6C 5D8JH 3S8WA 1UM4L 4GW1B 3S7GA 1ZGLA 5JHDD 4Z7OE 3A0OA 1EEZB 1RIHL 4I5BA 4ODWA 1I7TA 3DRQB 3E2HC 1G9MH 4C58B 3FQRA 3E8UL 2JELH 3QIUA 4ODUB 1ADQH 3WLWD 2XQYG 3O9WC 1JHTA 3AB0C 1WZKA 5D93B 5D1XD 3X3FH 5C6WH 2XNAB 3K46A 4LSQH 3A67L 3G6DL 3ULUF 1EXUB 1F5WA 4FQXC 4HCRA 3CFIC 4FABH 2Q3ZA 2ZUXA 3O2VL 1UCBL 4QXTB 4LK4A 2WP3O 3G04A 4KHXL 4F80A 5EO0B 5JPNB 2HRPL 1K4DB 4OCSL 2NQCA 1OF2A 4OD1H 1C8PA 4YDJB 1CCZA 4HK3J 1S9XA 4MD4A 1U6AL 2Q86B 5ICZA 1HEZB 4RGNC 3QZWG 1RMFH 3N1QC 1YEKL 1VFUA 5C86A 2I9TB 3DX8B 5DRNA 1U8NB 5JOPE 2J7LA 3SDCC 4ZD3L 4HIHB 4RWYH 2QR0B 4HMCA 3PWNA 4FQJL 1HQ4B 3D2UB 3GSXA 3MRGB 1JNHB 3ZL4L 3S96B 4KQ3L 4JFEE 1KFAH 3AS2A 3IT8D 4FQPA 5EIIA 5L8JB 1JF6A 3HUJA 3MR9A 3EFFA 4JHAL 3HMXL 4UDUA 4L8DA 1FVCA 3ULUL 1V3LA 4M6NL 5DD3L 4D9LH 4JO3L 3EYUH 4ZPTB 1A3LL 4KK8C 4LNVA 4I2XE 2YC1A 3GMOA 1RURH 3VU2A 1YEDB 1QTYT 3MUGB 4PV8B 1A5FL 4OCXL 1A22B 4V2CB 1NEZG 4JLRB 1TZHB 5JTWA 4GRLC 2P48B 2DQUL 4E5XB 5E8EA 5DJ6B 4FQCH 2IPKB 1JYXA 1AGFA 2QBWA 5DEFB 1A7OL 3WFDH 1YY8A 5KSBF 1N4XL 4ZAKC 1LK3H 5IM7B 1TENA 1RURL 1L7IL 3STBA 5KVFL 4R90H 3JV4A 3KLHC 4KV5F 1CXKA 2ID5A 4FABL 5GIRB 5KSAD 3RAJL 5CIPA 3EFFB 4UDUB 4ZFOA 2Q8BL 3O4LD 3G6DH 1IQDB 4ZQKB 3GSVB 2X05A 3MJGX 5KSAC 3C60D 1GIGH 2DLGA 2BY3A 3VXUA 4QRRA 1CBVH 4C56A 5B38A 3HN3A 3DVNB 3MRLA 1EMTH 5I15L 5DI8A 2PXYD 4JO4H 5HYJA 2DQJH 4HCRH 4HWBH 3ULSA 5E2VL 2QJDA 4U6YA 3VRIA 1IC1A 3HI6L 1GGCL 4AEHH 1CDGA 3WLBA 4GRLD 4OF8A 2ZSVA 4MAUH 5ENWB 2CGRL 4NHUA 5M7QA 1FGVH 1ADQA 1KJVB 2ENYA 4YFLF 2BOBA 3X3GH 4IDJL 1JF1B 2FJHB 3I6GB 4DVRL 2W9DH 5GS1A 3EAKA 2CXKA 1SY6A 3H7LA 5E03A 1U8NA 1QACA 2CIKA 4RGOH 1H3XA 3QIBC 1ZLUK 1YECH 3MXVH 1V3MA 4Y1AE 3S34L 2EKSB 5CSBA 5C07D 4MAYB 1OD7A 5C0JA 3GSNB 5CUSH 2GJZA 1AR2A 2P8PB 1ADQL 4HS8H 1MPAL 1FZJB 1LDSA 2VLJB 2NY2D 5HYSA 1IEAA 1DQLL 5IV2A 3MV9E 1F42A 5I1EL 1RIHH 3M1BB 4YHNA 5KVEH 1A7QH 2IH1B 5DJAA 1AQDA 3NCJH 1I8LA 5J7CC 4JM2C 4RGND 8CGTA 1FPTH 3Q6FA 2AXGA 4RISL 4O51B 4H88L 4UQ3B 5J1TC 1YEHH 2EEDA 2KZWA 5I76B 2AJVL 4F37F 1NBQA 1A1MA 2EDRA 4PJEA 4JQVC 3D3VE 4KKLD 4RFOH 5C0DA 3O4LA 4YC2B 3MRJA 3RVWD 1MCLA 2L0DA 2HFFB 3BHBB 4PGZA 1SM3L 3RKDD 5FOBB 5J12B 2CRMA 2DLIA 3V6OC 4X98B 3T4YA 4PB0L 4PRIA 1GZPB 3MJ7A 4F2MA 2APTA 3KXFE 1UJ3A 2VABA 3IDIB 5DWUL 1LP9B 3ARSA 3V4VL 4LRIA 4M6OL 4ZO9A 3O3BB 2V5RA 3WLWC 2FEDC 2A6KB 3PQYB 3C09C 4JM4L 2KUTA 2CUHA 1B0GA 3VD4A 3Q5OA 1MFAH 4P57B 1BHGA 1H15B 3IDMA 3RY5A 3ZYIA 1JNLH 3BUYA 5GGVY 1OGTB 4GXUN 5EU4A 1CD0A 2PNDA 4TUOB 4Y19B 4D94A 2XI9A 4KZDH 3LMJH 2Z4QB 2X4RA 4NSKA 4Z76B 3GBML 4WU7B 4OUOA 3ZDXE 4U1GC 4NFCA 1KN2L 1H3UA 1WVZA 5CSZB 1PKQA 2BVUA 4QTHA 4AM0A 3IB4A 4GQ9L 3GMMA 3AS0A 4U1JB 1B6UA 3GM0A 3RWDB 1U8PA 1IAIM 3ULVD 3HMWL 3QDMB 4LP5A 5IP4A 2ADFL 3ABZA 4URTB 5FO9A 3HA0A 3B8YA 1OTSC 1J88A 4KZDL 4M5YL 2FX7L 3CFDB 2QL1A 3MJ9H 2DTML 2APWA 1FIEA 2IANA 5E2VH 3CGTA 3U1SH 2H6PA 2BSRA 3BQUD 1W72L 1L0YA 3ESUF 4OSUL 2F58L 2QHRH 4JM4H 4PRIE 1IM9D 4GRWF 3HZVB 4PJAF 3PHQA 5JQ6H 2R15A 2DLFL 3TNMA 4HZLA 3ARBD 2C7UB 3IS0X 4XP5H 2XXCB 1LMKA 3MNZA 1IM3B 2PN5A 1HKLL 1BQLH 4F7TB 2H9GB 4ZFFA 4R7NB 5EPMA 1CT8B 2KPNA 3OTTA 4I3SH 1T66D 4CADA 2CPCA 1Z5LB 2Y36L 2Q8AL 4R4NC 3DXAB 3DMMD 2R1YA 5FO9B 4OD3H 1I9RL 5FYKH 5FV1L 3ZKND 5FV2A 5HVGB 5CJ5A 4XBEL 4IMLA 2HVJA 4MA3B 4N0CD 3CAFA 2DS4A 5IFAL 3V5DA 4YHOL 2VJXA 5B39A 2X1XR 4NKMB 4Z7VF 1U0QA 4PP2A 4JFXA 2BSSB 1ACYH 3UTPD 4FXLA 4WO4C 1UZ8A 1XR9B 2Z91A 3QXVA 4FQ2H 3MZGB 1G7PA 3NABH 4NSKB 5FUZH 1N26A 4S2SA 3O8XB 1AFVH 3OL2A 2G5BB 2ICEB 4JPKH 1NCBL 2D7TL 5BZWA 2H8PB 1G7HB 5HHMB 2GSIA 4FTVB 4D9QE 4OFYA 3EDDA 2WQ8A 3FL7A 4O5LH 4PS4L 2O5ZL 3QUXB 2NXZD 3OKNB 3QUXA 4PJIE 2X4OB 1ZVYA 3K8LA 1RHHB 3BQUA 4OUUB 2RJMA 5DD5L 5FKPB 5I8OL 3TWCL 4N5EC 4LLDA 4YAQA 2XQBL 1G7HA 4NIKB 5CD5D 1S7XA 3NTCH 3FB8B 4N90E 3MRHA 2OTPA 5TQ0L 5MEPB 1PZ5A 5KN5A 5ANMA 3SDAA 3FFCB 1CDHA 2JB5L 4DKEL 5I15H 1XR9A 2N1KA 2EXYD 1KJMB 4Q58C 4S1RH 4P23D 3RA7L 2R2HB 3UTTA 2A9ML 1L9NA 5ALBL 5F3HA 5TH2A 4YFDB 4RQQA 1EGJL 1SJEB 1LGVA 1ITBB 3VD5A 5IGXH 3RIAK 3TBVB 2Q6WB 3EYUL 1CICB 2BVEA 4GMSL 3TP4A 2V2TB 3VXRD 5EBLA 3DSNA 2V2WA 4N5ED 4P2OC 2RBLA 3BXNA 3ULUC 4OF6A 3M17B 5EORL 5EPMB 5F3BB 4QNPF 5ALBH 1JYNA 3UTZA 1TNNA 4U2YA 5DRXA 5DLML 5JZ7D 3EO1A 1JNJA 3C5ZA 4JANA 4YEEA 4NCC1 1BQHA 1X4XA 3VCLB 1NANH 1QR1B 1DFBH 4P9ML 3QG6B 4KKCC 2FHBA 4U6VH 5JUEL 1VDGA 5E5RB 4Y4KC 2ARWA 1ZLVK 1NGWB 1GC1C 3E6FB 3QWRD 4WWKA 5KG9A 1G7LA 4LLVB 1YMHB 4U1HA 1WBYA 4DGVH 2V5SA 1L0XA 1KJ2L 2J5LC 3D9AH 2XWBB 5C2BH 3LN4B 3B9AA 1VEPA 5H37G 3CFDA 4TPRH 2ZOLA 3S4SA 3RPKA 1KFAL 4H1LH 5KANI 3ARGB 2VZOA 2UY6A 1G7QB 1YEFH 1FO0A 4AG4L 3DVNA 5CBEB 2FR4A 5CZVH 1OGAE 3VWJB 3NH7L 4EVNA 1ORSB 4HIIA 5CEXA 1J1OH 2DQHL 4HEPG 2VH5H 4Y4FA 3QISA 1RUQL 3ULVL 2YUWA 5F96H 2P24A 4S1DC 5DUMH 5F89B 3MO1A 5JOFB 3A6OA 2FCBA 3RWCB 4Y16A 5K59F 2Y1VA 4JCMA 2AKRB 4MJ4A 4IEFB 1S7XB 5LXGL 3ULVF 3G5VB 4HIJB 3STLB 2CIIA 3AM8C 3EJYD 1FE8H 3OAUL 5L88L 5E5MA 4X6DF 3HLAB 3O6MH 4TYUA 1LE5B 4LRIC 3TO4A 1E0OB 4E5XA 1FZMB 4WFGE 3N85H 3L95B 3FB5B 3GNMH 1KCRL 3V5HB 1MCOH 5F1IA 3AAZB 4Y2DA 4X6CF 3SGEI 4HWNA 2BNQD 3HNVH 2KKQA 4P3WA 5FO7B 4M6ML 3SGEH 4L3EE 4C56B 1Y0LA 2J88H 5CP7B 5C3LD 3I02A 1CVRA 4DAGH 3IU3B 1FJ1A 2WLYA 1GHFH 3QDHA 4FN0A 3UP1A 4F7CA 3AREB 12E8L 4F8QA 3I3BA 1FZMA 4RGNE 3DNKA 1BQHG 3HS0B 2GYSA 2J6EL 2QSTA 5C0IA 1HK6A 4AYFA 5IW6B 2QQNL 3MLYL 1YEGH 4YHOH 4HKZB 4OLVH 1X5KA 1FG2A 4KROD 4KMTL 3MXWL 1OLZA 2P8MA 4DK6A 3LKSB 3D87B 4OLZH 1XZ0A 1YN6B 2Z31C 4XNYL 2R4RH 4ELKA 3BWAB 1I3RB 3UTTE 3WO4B 1IGIH 1LE9B 4XX1E 1KXTB 3NFSL 4G6ML 4GW5A 4JFPB 3OJDA 1PX4A 1FDLL 1HKLH 2XKSA 2EDTA 2DYPA 4K9EC 2F9BT 2A6DB 4ONHB 4NNXB 4R26L 5HHNA 4Y4FD 4UIKH 5DJAB 4IIQC 1JGUH 1H5BC 2HLAA 2EYTB 3GKWL 3G6JF 4J4PA 4ZSOA 2YZ1A 4PRHE 5E2TH 1VFBB 2EDFA 4Z8FL 5I1IL 3W5NA 4XCYB 4LSPH 3DX6B 2BOCA 4PJXB 3HC4L 4YZFE 5GRUL 5C0JB 5C0ND 4MS8D 1DSFH 4U3HA 2E27H 4LLYB 3W9EB 4BUHA 1JHTB 1TQBC 3BFOA 4NM8L 5DRZB 2ATPA 4AT6A 3H3PL 2VZ3A 1EVTC 5FGCE 1OD9A 3TYGH 5KOVC 4FQIH 4I48A 4PYHA 2V9QA 3RU8L 4ODVL 5C71A 4MVBD 3D69A 4ODSL 4PJ7B 4LVNB 4GJTB 2BNQA 1FFNB 4FFZL 1H8OA 2H2SD 4DKFL 4E41A 5KSAA 4OZGA 4X7EC 4N90D 5ESAA 4D0DB 2Y7QA 4XNQA 2DQGL 3U36B 1YEEL 1ZWIA 3PV7A 5GHWH 5FGBC 4PRHB 3IVKB 4WENB 1F58H 4JVUA 4TVPL 3W0WE 1LDPH 1JK8B 4CMHC 1RK1B 4HV8A 4Y89A 3D69B 2G9HA 4KRNA 1B90A 7FABH 3HNSH 4WUKH 4WWKB 4DGVL 2RGSA 4J7RA 2H45A 2CGRH 4DEPB 1MI5A 1HCVA 3K2UH 1EHAA 1UM5L 1ZK9A 3KR3L 1HDMA 4XVUC 3IDJB 4AEHL 2XN9D 2HH0L 3VXRE 4EQ3A 4LLUA 3OG6B 4CW1B 2J1KA 2HYMA 3KNBB 4ZUSA 1RFDL 2P5WE 4JR9L 1G9NH 4UT6L 1JNLL 4HUVB 1DFBL 4XBGA 5T1KB 4BYHA 4MX7B 2DM2A 1T04A 3RY4A 5EH1A 5FYKU 4NN5B 3TBWA 1ED3B 2EEAA 4HT1L 1QSEB 5ACMA 1FG2B 1NAKH 1NFIB 3UAJC 3NCCB 3PGCA 3HUJE 5CEZD 1MFCL 4KXZI 1BIIA 2EIZB 2NMSA 3NCJL 4WW2B 3BUYB 3ZSTA 4WHTB 5IMKB 2EKJA 3P9LB 1KPRB 3FZUD 4H25B 4KUCF 1X5ZA 2X5PA 2XN9B 4PY7A 3ALPA 5FECA 1AKJA 1NCUA 4HW6A 2X4SA 2X4UB 5FUOL 1RUAL 1PZUB 5CJOL 4Z9KB 1ZHKB 4U6HB 5GSVB 4NHCL 3QUMB 3RWJB 1S7VA 3SDDA 5I1DA 1B2WL 2ZUVA 3FT3A 5DJ8B 3HCVB 3QNXB 2G60H 1FGVL 1J0ZA 4N0YH 5FKAB 4UNTA 5C0CB 1JIBA 4HUVA 3I84A 1YUHB 1MAML 1EFXD 4Z7WE 1A1MB 2I5YH 4NZTL 3LEXA 5HBBA 1JGVL 1RUQH 3ULVH 4NM4H 1OP5H 3UYRL 3OMZA 4RWHA 4I0PB 2D3VA 4HZAA 1MFBH 1RZFH 1TIUA 4G8GA 2BSTA 2QSCL 4EXPX 5ACZB 1BF2A 4NZDA 3LKPA 5D1XB 2XTJD 5AUMB 2R1YB 2AEQH 3AMLA 3CSGA 4LPVA 4LCUA 1S7WA 1SEQH 3OAYK 5DHXB 3K74B 4HH8A 5HYSB 3VFWA 4G6FD 4EN3A 3QQ9D 4XBGB 2AJ3A 1WSST 4OFIA 2FATL 1CT8A 3BKMH 5SWSE 4XPBH 2FZ3B 3RVTD 5F9DC 4JZOA 1AGDB 4N9GB 1YJDC 3VGAB 5DSCA 3UJIH 3T0WA 4NZTH 4LEOA 3EYQD 4NNPH 2VTFA 3H0TA 3GSNH 4FMFA 4IRSA 2FJFA 5J1AA 3MUHL 3O2DH 3RPIA 5DD5H 1KTDB 1I9IH 1BJ8A 3G5YB 2H6PB 3DV6A 1BFVH 4YJZL 1QR1A 4PG2C 4M4RA 4TSAL 3QDGE 3ZDYF 4MJ5A 4MXVF 3DIFA 4ONGL 3L5XH 2QQLL 5J89A 2XT1B 3VH8A 2R0WL 2Q20A 4OI8A 4NNYB 4XPHH 4LNRA 4WGWB 2HT3C 4YBLC 1N64H 4U1HB 4KVNL 2E7BA 5DMIH 1UH4A 1MCWW 4G6JH 2VQ1B 5D7KD 4BQ6A 3O6KH 1MI5E 3UYOD 2FJFB 5J1AB 4LQFL 2I5YL 5JO5A 4PRPE 3H9ZA 5JW5B 1QLFA 1CICC 1JPSH 4Y1AB 5HD8D 2CJUH 1OB1B 1XF1A 2FDBP 2Q76B 4EZMA 3LY6A 3H3BC 1U58A 1QPXA 3TM6A 2X4RB 5I1IH 3VFWB 4WU7A 1KCVH 1KIPB 2WM0A 1R6VA 1FNGA 4FQLH 1QBLL 5DVKA 5CEZL 1OGAB 1QNZL 1FLRH 5GGRA 5KW9H 3K2UL 5KVGH 2PTTB 3OXSA 3SDDB 3VH8G 3MV8A 4GUPA 4QHKI 4OFPA 3SE4A 3BPLC 1IGFH 1M4KA 2XA8L 2YPKA 4PJIF 2EDOA 5HHOD 4NN7C 3T2PA 4X6CE 1R5IB 2YXMA 1G6RB 2H3NA 2W0PA 3NZHH 2VDML 2EDEA 3HZYB 1FSKC 4PRDA 1NGQL 3QPQD 4DJMA 3KYKH 5LCVH 1OTUC 4MGXA 3LRSB 1NEZA 1YNTB 3KYOA 2A1WL 1AFVL 2V7HA 4G6AD 5EIIB 4XXCC 1B4RA 3RL1A 5BQ7B 1XGPB 2YK1L 5TFSL 3KLAA 4MWFB 4BUGA 3IJYA 3KLAB 1NGZA 1MCPL 1P7KA 3S36H 1OGTA 3MJ9L 3OPZL 5E2UL 5HGDB 2F53B 3QDJE 3TESA 3B9DA 3GSQA 1MLCA 4Z7VE 3QIWD 3VFGH 3W0WD 1D9KD 3HE7C 4I4WA 1A64A 3FFCD 3SKJL 5GRVL 1CU4H 2GSIB 4FTVA 4M9OA 3HFMH 1AJ7H 5IB5A 2VDKL 3TZVD 1OARH 2ICEA 3DO7A 3QRFM 5ADOL 1Y6NR 1AC6A 5FB8B 1BZ9B 2NNAA 4R26H 5KJRL 2OQJA 4O00A 2R69L 1KN2H 2ZUSA 1Y6MR 3LKNB 1OAXL 4IOIA 2W59A 1J0JA 5DC0A 2VQTA 3GGWA 4YR6A 1MJUH 3CDCA 3FO2A 4PJ9B 3BRGC 4KTDH 4PD4K 1UWEL 3ZHLA 1OM3H 1F4HA 1HXMA 4ZDHA 1G7MA 5ACLA 3TIEB 5HVHB 2F53E 2R4RL 5B39B 3N1PC 4GFTB 1JTPA 4WV1B 4OTXL 4W70A 3TCLB 5E4EC 3TZVC 3PJSA 1FO0B 5KVDH 3X13B 1MQKH 2VZUA 3OF6D 3D48R 4L8BB 4TUJB 4BSJA 3VCLA 3NH7H 5H2BB 3CCHA 3HE7D 4MNGE 3ILPA 4Y4HA 1D9KC 4U6YB 5JW4N 4OKVB 1O0VA 2H32A 2VDNL 1RZJC 5CD3A 3D39E 2C7UA 1T7VA 3V4UH 2YRPA 3OSKA 1RI8A 2IPTH 3QIBB 3QXDB 1U92B 4Z78B 4PJ7A 5DMYA 4PY8I 4AQ1B 2YD1A 1QP1A 1HZHH 4OFVA 4WV1A 4ZPVB 4U7KA 1ZLUH 5ESQA 1R3HA 2GTZA 5IVZA 3T77A 4LLQB 1KTDA 5JR1L 4PRHD 5GGUA 1GGYA 1B3JA 1N2RA 3IXAA 1BFVL 4APQB 4BZYA 4ALAH 2X4NA 4OV6F 3QPQC 3LZFH 4LLYA 5I9QB 1K9TA 5I30L 2LE9A 1JYWA 4XWGL 1JGDB 1IC5H 1LWRA 3L9RB 4NQDB 3P4LA 1NLDH 1I9EA 4HDIB 4PTUB 5C9KA 5J8OA 4HWEH 1OPGL 1TQCC 1QHPA 3KJ6H 2DMBA 1HQRA 1VFAA 3WS6C 5JW4R 3U2SB 1NGYA 3VFMB 3IFPB 1X5FA 2DYPB 4UNUA 2P7TA 2VZSA 2GUOA 3CFCL 1I3GL 4J3SA 4LFHG 5D2LA 5IFHL 2GCYA 3PHSA 5CZVL 3WUWB 3VGFA 2OXHA 2BNRB 2O5YH 1CD1A 3IKCB 1KIQA 4HMDA 3SDYH 5I8KH 3MREA 3TIDA 1JZ4A 3VXMA 1U36A 3KVQA 3BI9X 5E6IC 3BMVA 2YC1B 4FQQA 1BREA 3VWKC 1MFEH 4MZ3A 3FT4A 1QQDB 2BJMH 4MMZC 2RHEA 3IRPX 2J3SA 2VDOH 3QQ3B 3WV0A 3GSXB 1OL0A 1DL7H 1QUNA 5DUML 4TNWF 5MI0C 1MRDH 5DR5L 4FQHB 1R3IL 3CXHK 4YUEH 1MI5D 1JPGB 5F1IB 1ZEAL 2FEEL 3IKCA 1V7NL 2CLZA 1YEHL 4XMPH 4NBXB 2HTLD 4U1MA 1GC1H 2LVCA 5JLZA 3BPNC 5E8NA 5EA0L 3OR6A 4AL8L 1ZANL 1UVQA 4H20L 5JIKA 5CEXB 1MCEA 4H25A 3ILPB 1OF2B 4NZJA 4OLUL 4RZCB 4Y4HB 2D7TH 1JRHH 2E6QA 4FXGB 2OSLB 2I27N 3FFDB 3TA3A 3X13A 4OZIE 1LEKA 2JIXA 3GSRB 4I0PC 4CVUA 2PYEA 3TBWB 35C8H 4HBCL 5D7IB 3STZA 2HWZL 5JDSB 3QI9C 3VG9C 1N4XH 2VXSH 4Y4FB 1V8HA 3KPPA 4OCMC 1N2RB 3GHEH 1KN4L 1HDMB 1QOKA 4WTZA 4QRUA 1LD9A 3SGKC 1AKJD 4BQ9A 5C70A 2HTKD 5DD6A 5IUSA 2Q87A 2OP4L 4HLZH 1RZ7L 3RNKA 5I1LB 3X12B 4ZFOL 2F19L 1TJHL 1RZJL 1WWBX 1VACA 1U91A 1AGEB 4EBQH 1PKOA 1UM6L 5I1CL 5C08E 1T0NA 1WCQA 3T1FB 3JTTB 3DGCR 2AJUL 5DJZA 4U6XA 3U9UA 3WMSA 4JO4L 3UMTA 1H3TA 1CE6A 1JMXA 3SDCA 1AH1A 3FHQA 4RFEA 4LEXL 3WJJC 4PJ5D 5DS8B 3QXAA 1EGJH 3QUXC 4GW4B 3RGVD 3MA7B 1KIRB 4Q74A 3VXUB 5IB3A 1CDJA 4PRAA 2JB5H 4DKEH 1BOYA 1CXEA 2VISB 2JB6B 2EDJA 4EDXB 4OI7A 2XICA 1SY6L 3CU1A 1O5DT 4WGVB 3VFNB 1F4YH 4DQOH 3WLBB 6FABL 4C55A 4KK5D 5IKCA 1T80A 4MAYD 3IF1A 3F12B 5J4MA 4XVSL 4FHBD 5FM4A 5C6TL 1FYTD 5E00A 5JMOC 5IOPA 5E99L 3C08H 4TTDC 3H42L 4K3GA 5DI8B 5GS2H 5HYJB 3BH8B 2V6HA 3QUZA 2R56L 4QRPB 4U49A 2Z9TA 3BPCB 4HGMA 2NY6C 1S7QB 3NFNB 1S9YA 4YHPB 2GJJA 3CX2A 3IDXL 3SOBL 3Q5YA 2VKWA 3CPLA 2WUBL 3ROOB 3VE0A 1G0XA 4JZJA 5IT2H 2QV2A 1DP0A 1U3HD 4HS6B 4RIRB 1KIPA 3VXME 4GRLB 1NCBH 3C8HA 2PYEE 2A6KA 3MQIA 3O3BA 5E94B 4Z7VB 4YHLH 4JO3H 2E7LA 1TXKA 1TTUA 3FRPA 3VFGL 3S88H 2VDNH 2W0FA 4TN9A 3MJ7B 1KIRA 3BP4A 5C0GA 3NIFE 3CLEH 5KSBE 3NFPA 3TN0C 3BD4A 2R29L 3CX5K 5ERWA 5T5NG 4HT1H 1I1RA 4XMLH 5C0BB 4YBQD 1R3LB 1XIWD 2MCPH 2YWYA 5I30H 3HPJA 3MOBH 1BWWA 3QRGL 4LNRB 5GGSA 2XZCL 3UBXI 2Z35A 2QEJA 1I1YB 1IC4H 2X1OA 2X89D 4V1DD 3V7MA 4OGAC 5H8DA 3MRKB 1U91B 1EEYA 4PRIB 5B38G 1CR9H 3QYCA 1J11A 1BIIB 4WW2A 5D7SH 2UWEF 3D18A 3HI5H 1BFSA 3OB8A 1ZA3A 4WNQB 3D0LB 1I8MB 2D4FA 1AGBB 4GOSA 1EEQA 3V8CA 3MODH 1C16B 1YEEH 4JFXB 3KNBA 1IGIL 2IJ0C 1JBJA 4HJGA 4OB5H 1A02N 1IQWH 4G7VH 3VXRB 3WIHA 3MV01 1EO8L 5BCAA 5BZDA 2X4PA 4M48H 4Y8AA 1S8DB 5K9QG 4M1CC 4GAYA 1IZKA 3QG7H 1HOCA 4Z7NF 3IU4L 1UZ6F 1IFHH 3TT3H 2JJTA 2ZCHL 2E6JA 4LHJB 5E2UH 1RV6X 3BISA 3BESR 3OHXB 4NRYA 1JTOA 1M7XA 4ZOEA 4QY8A 2ORBL 5GZNC 5ACZA 4F7PA 3WSQL 3RGVB 3BZEB 1BBDL 3WUWG 1KIUA 3QCVL 4LASL 4LLWA 1QBML 3ZKSD 1OP9A 3CSBA 4JN1H 4MNGB 3QIWA 4K71B 2DWEB 3S34H 2HT4D 3QCTL 1C5CH 1U41A 2EIBA 3QH3B 1T7ZA 5DJDA 4IRSB 1ZLSH 1HHKA 2EH7L 1U8PB 4LLVA 3LN5B 5ID0B 4NQUA 2MCG1 3X3GL 2UWEE 4CRPA 2MKWA 1NMCC 1S7VB 3WS3A 2UZIH 3NVQA 5J6GA 1GCFA 2J4WL 2W0FB 3NMEA 3AXLA 4G8FA 4UB0H 1MIEH 3ARBB 3QQ4A 4MQ7A 4X6EB 5HSFA 3KJ4B 4XNYH 1JWSA 4F7EA 1AD0A 4QRQB 5KSVA 1E4KA 1JV5B 1R24B 1NCAH 3KHOA 1QRND 1AO7A 4MXWH 3MRNB 1FL5B 4I0PA 3ARDD 1WGOA 5EN2A 1U3ZA 3QJHB 5ELIA 2EIZA 1HWGB 3HE6A 4QTHB 1D3CA 2AQ2A 4PGJA 2RR3A 3EGSB 4DZ8A 2A38A 1RZFL 4UINH 1CGWA 4IOFD 5C0CA 4X4ZA 3B6SB 5ESVA 4LLUB 5IT2L 4HKBB 1N8ZB 1QNZH 4GT7A 3PWVA 5DC9B 4QF1A 1AXTL 1B0RB 4JFFA 3UZVB 4ZFZB 2BNUB 4R4BB 1CU4L 2YA2A 4RGOL 3QI9B 3VI4E 2F5BL 4G6KH 1ZHKA 4QGYA 5GSVA 3BPCA 5J06A 3PWPD 1IC7L 2D7QA 2XPGA 4Y4HC 5GISH 1M71B 1UJTA 3PUCA 1NCTA 3VGHA 5I19H 2EC8A 5INDB 1FNHA 3JWDC 3P4NB 3MGOB 3F6IA 4KAQL 2NY1C 4J3XA 4PJ5E 5CJOH 5ICXB 4U1SA 3K4DA 5I16A 1K8DA 4IMKA 4P4KB 3FN0H 4LAQH 5D9SA 4PLNC 1W0VA 5T3XH 2YD5A 3L3HB 1RUKL 4Z18A 4XPHL 2GSGB 1HILA 4WUUD 5I73B 4ENED 1FRGH 1DN0B 4L3CA 3T09A 1FYTE 2YPLA 1KYOJ 2HMID 1M6OB 2NY0D 3LEYH 3NCYS 1I7RA 3U30B 3MV11 4KQ3H 4KRPB 3FB6B 5T1LD 4RA3A 2BNQE 1FGNH 2OL3B 1A4KB 4L3ED 1JE6A 1RVFH 2DQIL 3C2AL 4G8IB 2GJ6A 2OQJB 1RFDH 5D7LB 3HG1D 4XVSH 2YPLB 5J0BA 1EGJA 4K3EL 4P46D 4G8GE 1FHGA 4KDVA 4NQEA 4KDWA 2FL5A 2FIKB 1EUTA 1KEML 1XGYH 2VL5A 4D3CH 1BM3L 2BY1A 4DUWA 4TOYH 3FQUA 4U1NB 1I8IB 3SKUD 4M1DH 4XXDB 1EJOL 3C6LB 3QFJE 5DQ9A 3PDGA 1NLBH 3UTTD 1K8DB 5DLMH 4YHML 2YSSB 1CBVL 3MRBA 4PJBE 1ZHBB 5D7IF 2ATKB 3DURB 3QIUB 2EDQA 4NN6C 3VDBA 5F7DB 1LO0H 1YMME 4IRZL 1YYLH 3PP3H 3GSRA 5IFHH 4KQ4L 4DEPC 5FYLD 3D3VD 2R0WH 2DLFH 1NEZB 4LSVL 5E8PB 1IT9H 5DGRA 3T0VA 3R06A 5IVOA 3OR6B 1JVKA 2CLVA 3CFKB 4YDVA 5J9PA 4C54A 4HQQH 2EXWD 4G9FA 2YKLH 4PV9A 5D72L 5DFWH 3AVEA 2M26A 2OJEA 2DDQH 1GH7A 4L8SB 1MRFL 4YHIB 1JHLL 2XPGB 4PJIA 5HPMB 5I8CA 5KAQG 4DK3A 4U1KA 3QDGB 3PL6B 3UROR 3QUMH 2EXWC 1PYWB 5AYQA 2AJZA 4ZFZA 1NMAH 3U6RA 1FO0L 2NY5L 4CNIA 2NY7L 5FYLH 4EI5D 3EIFA 2FX8H 1LVEA 1UEMA 1K6QH 1MCNA 1MH5B 5IJKC 3K8MA 4PJ8D 3HPLB 4YQXL 4PJGB 5KZCD 1FDLH 2G75B 3K1KC 3QHFL 4O2CB 1U8HA 4Y1AA 3D25A 2R2CA 1HSBA 4XPTL 3PGDB 2IPUK 3FQTA 4FNLL 4WEUD 1W8NA 3O6LH 4A6YH 5DJ6A 4RAHA 4U1KB 3ARYA 1CLOH 3MLTA 3NABL 4OF5A 5DJYA 5DK3A 2X4OA 4Z7UA 5HGAB 5JW3L 1LO4H 2H2PC 4WWKC 5BVPL 3LPGA 3B9KD 4HC1A 2IPUG 3PWJA 3WFHB 4U31A 3DJ9A 2NY4D 2PF6A 1SYSB 5DA0B 3BDXA 2BJML 4EJ1C 4W68A 4Q0XL 4JHBA 3R06B 4ACPA 4YDKH 1BQSA 1B9ZA 4TSBH 3G04B 5GXBB 3KS0J 3JUYA 1S7UA 1Q1JH 5ADPL 1PQZA 5DFVD 3T2QA 3SDYL 1JNHA 1MJJB 2YRLA 5JPMB 1AY1L 4FXKA 5EUKB 4XP4L 1H8SA 3ECBA 4HPOL 4M62H 1T20B 4NP4L 2EE9A 3MRBB 3WXWL 4KHTH 3ALXA 5I18L 1X5HA 4HFUL 3QHTC 1ZKAA 4MA7L 2FSEB 1FC1A 1E6JH 5L2KD 4HUMB 4XCNA 1I7ZA 3MOBL 3KGRA 4ZFGL 3ZYZA 4WHYG 4BK5A 4HX1A 3WHE1 3FO9A 3BRFA 1JP5A 5AYUH 1ZS8A 2C26A 1A4JB 5A16A 3HTLX 4N8VA 2P46B 4C57C 2B2XL 3WNKA 1A4KA 1AE6L 4QHMA 1YYML 4KHTL 3KPPB 3MACH 2NX5B 1T20A 1UYWH 3RVXC 3DXAD 4IOFC 5D7JD 5E6YA 2AAVA 5DJ8A 1I1FA 3KPOB 4JDTL 4JJ5B 4J4PD 4PLOB 3FFDA 2VXTL 3P11L 1M7DA 1BEYH 4WW2F 1MSPA 4U6HA 5CEZH 1X5IA 1ZGLB 1T21B 3JSSA 5MEQA 1T1WA 2B20A 5IMOA 2NW3A 3CLFL 5FHAH 5J3HD 4XC1H 3TBYB 4BH7A 2IBBA 3NACL 1CGYA 3FTGB 3P77B 4UT9L 5LXGH 4Z95L 3W5MA 4G80A 3X11B 3CXHJ 4M43H 4CMMB 4JN2A 4L4TE 2YD8A 3LKRA 1JPGA 4XC3L 3EOBB 3NPZB 2WIIB 2NLJB 1TETL 2CO6B 3CDGB 1UWEH 4UIMA 5EC2A 3TBVA 1ZOXA 4WUUB 5IEKB 4LSVH 4QRRB 1A3RL 1QA9B 1QSEA 1KULA 3BYTA 5D1QB 5E00B 4P4KD 4U1LB 4WEBH 3WIFA 3ULUE 1FSKB 5DVNA 2UZXB 1ZT1A 4NUGH 1MHEA 4XPTH 2DMKA 5AG9A 3D85D 4K7FA 4PJBF 2OZ4H 3K7UA 3MPCA 1P84K 5H94A 3NIGE 5TE7H 4B7LA 4D0CB 5L9DL 4GAGL 1T5XB 2ZJSL 3BPLB 4YHMH 5AAMA 1CZ8L 1MQ8A 3O6ML 2D7PA 4ZAKB 4ERSL 3MLUL 5E70A 4G3YH 2QQKL 5I1JL 2I60L 1AHWC 3QUZB 1CR9L 3CDGA 4PRPD 2YMXH 5I66B 1H15A 3G6JB 4P57A 3P4MB 1KEMH 1XGYL 2IGFL 1TZHA 3VGEA 1R3JB 3GHBH 4QRQA 4CMMA 5KS9B 1F4AA 4XT1C 5CIPH 2ZG1A 2I07A 4QWWD 2R1XA 2GQHA 4ZS6D 3IFOA 3U0TA 5ICYB 5E08H 2V9TA 3A6BL 4MNQE 4JQIH 1UWXH 2BNRD 4YE4H 2JF1A 2YPLE 3I75B 1IT9L 3RWFA 1Q9LA 1EX0A 3JWOL 3KPTA 5ITBL 4RFEB 4HUUA 5FIEA 3QB7C 5TPWH 3RI5K 1UZ8B 4FG6D 3W9EA 1ROWA 3KDMA 2ZG2A 2VO5A 4UV4L 4J6RL 1QSVA 1I75A 3GMPB 1U8JA 2FX8L 1WC7A 2FHCA 4CJ1A 4ODBD 4AL8H 1I85C 1HEZA 4WI9A 4ZUWA 4MXVE 1VSCA 2HLAB 4TUKH 5HXMA 4U6VL 3VDCA 3MRFA 2XWJB 4N0YL 3VWKA 2XWJA 5HJ3B 4QRUB 4PJ9C 5SV3A 5DR5H 3RPIB 2RIKA 3UJJH 2RFXA 2WWMD 3OX8A 4KJWD 1BFOA 3W11D 2A83B 3VXNB 3HI6H 5TDPA 5D7LA 5GSRA 4G42A 4L4VE 3ECBB 2Z31D 4IRJC 5SWZB 3VXNA 1EEUA 2PYEB 2X9XA 3OJVC 5ID1A 1MJ8L 4UV4H 1QLEL 4H8WH 4P2QD 3DSFL 2FECI 4LCIL 3DI2B 3O2DA 5IVXA 3OKMB 1YUHA 1A47A 2OBGA 1BAFH 4GRMB 1ZLWK 5CGYC 5IGXL 5MENE 1K8IA 5EA0H 4LCUB 5DXWA 1RULH 5TF1H 2PR4L 2YWZA 4XTRC 3NA4A 1YQVL 1CFTA 2C4FU 2YZ8A 3BIAX 4K23H 2P43B 5C09D 3WKML 5J11B 3IJSB 4M1DL 1ES0A 2E7HA 4RAVB 4NO5B 2X4TB 1V7ML 4MNHB 4KMQA 3PIQA 1PEWA 4BFIB 1HXYB 5C0RL 3P4MA 3CSPA 3K80A 5CP3H 2R2EB 1LP9A 2GW5A 3WBDA 4ZFOB 3UO1H 2FIRT 1DN0A 1M05B 3GMMB 3P3YA 4XC1L 1ZLSL 3ZKMC 4U3CA 1W0VB 2A73A 5D9SB 1RUAH 1JGDA 3L9RA 1CDCA 3BX7C 2ICWB 35C8L 1FFOB 1ZVHA 2NY5C 5DJ2B 5EBMB 3NCEB 2X1WL 1A3LH 1F02I 3R8BB 1JUFB 5TPWL 4WFFD 3LKQB 4D0BB 3FN0L 4LAQL 5GS3A 2OXGA 4OLXL 3MRDB 3B2UD 5K33A 4FQ2L 5EOTA 3TO2B 5HTSA 4FQXD 1FL5A 4WHTA 5IMKA 1NUNB 3VFTA 4LSRL 3H7BB 4NO0B 2ZNWA 4LOUD 5GPRA 1ZLWH 3FOMB 4DCQA 1UB5A 25C8L 1KACB 2AK4A 5K9OB 1AD0B 3ARFD 3L3JB 4XCEB 2QQQA 1T22B 1LEGB 2VAAB 5DRWA 5T5NF 1QRNA 3WS6A 5KTEL 5L7XL 1MEXH 4OIBA 3KYNA 5JW5A 3ZKXC 4AENA 5IBTL 3HE6D 3MNVB 3UTQB 3OG4B 3HC3H 2VQ1A 7FABL 3PV6A 1F97A 5E56A 4ZTOH 3SE4C 3LS4H 5E1AA 1ZGLP 3A67H 4N0FB 5I6XC 1NQBA 4NNYA 1HYSD 4K8RH 4LSSL 5BJTA 3V6OE 3GJFA 5F9AC 2E6PA 3ZTNL 3PHOA 4K3JH 4AMKL 2PO6A 1N59B 1OQXA 3DV6B 4Y1AD 3VXUD 5A2LH 2LTQC 2W60B 3MRPB 2ORBH 3PABB 4ODVH 2BVQB 4ZOAA 5IW1B 1IGTA 3QPXH 4AJ0A 2EO1A 4PJDF 4NQDE 2YUZA 1D9KA 4PJ9A 4PP1C 5A2JH 3CNKA 5JDSA 4TVPD 1A6AB 3C6LD 2DWDB 4HFWA 2R1WA 4TRPH 1Q0XH 1AGDA 4N9GA 5FGSA 3PL6C 4F15B 2VMFA 5FYKL 2XWTA 3MFGB 4LSSH 1NGQH 4FQXA 2P8MB 4OGZA 2GSGA 2VC2L 2IFFL 2P5WD 5IFJA 3BP5B 4NKOA 3SKOB 2IEPA 4X8XA 5HJ3A 4LKCB 3ZLQC 5AWNH 4KI1A 4I4WB 3DUSB 2NXZC 1VEOA 4HHAB 4LCYB 5GJSL 2UY7A 2Y9RT 3EYVA 3MRIA 3RU8H 4NJ9H 3G5XA 3IJHA 5T1MB 2YPVL 4NM8H 1MVFA 2AK4E 1Q9KA 3KS0H 3OKLB 4PPTA 1NGZB 1MOEA 3C5ZC 1NDMB 4ZXBC 2VB5A 3KWWA 3MV7D 2VL4A 1H0DB 1QSEE 1YPZB 4JRYD 1V5JA 3MMEA 3HE7A 1PEZA 4ODXB 1TMCB 5DUPL 3PWLA 5C0EB 4HKBA 4P2RD 3MLZH 4DN4L 1Z3GH 2R29H 1KPVB 1WWAX 4WO4D 3T3PF 3MA9H 5D96C 4WJ5B 1IL1B 3JVGA 4PIRF 3V0WH 1MUJA 1AHWA 5D6DA 4XBPB 3PF2A 3RAJH 5EG6C 5FO7A 4Y16B 1XGTA 3BP6B 1OSPH 5AD0A 2HVKB 1AXIB 4PJHE 2AJUH 3TN0A 1IGML 4K3HA 1D5MB 3OGCA 1P4LA 2ZCKH 3BN9C 5HHXL 3MRMA 4N1EA 2AJZB 4I1NB 3DMMC 1INQA 3B8SA 1T66C 3TO4B 5J13C 2L7JA 2Z92B 4QTIH 4TSCL 5L88H 1OT1A 2C5DC 4NQDA 1NUDA 5CJQL 3M07A 2AQ3A 5E2JA 1RJLA 4JKPH 2ZOLB 3S4SB 5DEGB 1ULVA 5AZ2L 1KB5A 1ONQA 1CD8A 5C0CE 2IWGA 3IXAB 3W2DH 2UUDK 2UUDH 1PYWA 5D1ZC 4ODUA 3ARWA 2R0LH 4PGEB 5ESQB 3T77B 5C09E 1KCRH 4P99A 3VXMD 2ESVD 3KPRD 5DRNB 1G7QA 4KVCL 1SVCP 2D7MA 1F3DH 5AZEH 4LEXH 1ZSDA 3FOLA 5E8PA 1QLRA 3CCHB 4E42B 3B2UC 5T1DL 3D39A 5JPNA 3W0WA 3DI3B 3UPCA 3WJJA 4UBDC 3KJ4C 5IF0A 4HK3N 1VADB 2FBJH 3WNMA 3TZVB 1G7MB 4O58L 3LV3B 3UTSB 5MERA 3BJ91 3C6SA 4YPJA 4EXKA 1L9MA 3VXRA 1FZOA 1IC7H 3ZKMD 2MHAB 1FVEA 3CU7A 1RIVH 1H5BB 3W82A 1YQVH 2ICCA 1E28A 3DMMB 2YS4A 4I2XA 5KOMC 1FPTL 3SBWA 3DVIA 3FO2B 5T3ZD 5BW7A 4IRSC 4LMQI 5FGBA 3LEVH 4I9WE 2EH8H 3X3FL 4Y16D 2XZAH 4R0LB 3V4PH 1IJ9A 2DL2A 4NC1E 1AGEA 5CJBA 2W60A 2JIXB 1NGXB 2P5EE 5EU3B 1MFBL 4UU9B 4N0RA 2OSLA 5HVWA 2J8UB 4IRZH 3WL9B 4ONHA 2CKBL 4K71C 3L3GA 1WLHA 3F7VB 1D5MA 2IAMD 3OGCB 1J1XL 2C1OA 3M45A 1UENA 2X6MA 3EJZD 5CKAA 1MCQA 4JFYA 1NC2A 1J0HA 3S37L 3BP7B 2Q1EA 3OR7B 1LP9E 1QEWB 2CSPA 2EICA 1XZ0B 3AS1A 1YNLL 4NWTL 5MHSE 4PGCA 5C0RH 5FOBA 1ZT4B 3GJFK 2XQBH 1F3DJ 3QNYA 4CMHB 5IHZA 4AH2B 2ZUWA 4KHXH 1HI6A 1I8LC 3O3EA 4DZBB 5F1NA 5GRJL 1N7ML 4LKXB 3T8XA 4RIRA 4G9FE 3QO0B 4XVJH 1XH3A 3VE0B 2N7AA 1U93B 2VLME 3P0YH 3UTPE 3AAZA 2ZOKA 3DRTB 3QO1A 1T2JA 1CD1B 4UU9A 4G43B 3FRUB 3MBEB 1AO7B 4KK6D 1TCRA 1A6VL 4YWGL 1XF3A 4Y5YC 3REVA 4ZUVA 3RUGA 5IVXB 5KSBB 2Z8WC 4EEEA 5I2IA 2YPVH 4MA7H 5CBAA 5IVNA 3WFDL 3PG2A 4WEMB 1FNEA 4HGWA 1IFHL 4NZUL 4PRAB 5CJQH 1M05A 3I2CH 4Q6IB 2A83A 5C3TA 3U4BH 4NQCE 4OFDA 3IFLL 4QTIL 4X7CC 4MB5A 3GB7B 5J56B 1Z9MA 3T3MF 3IAGC 3R4DA 4QWWC 5I8KL 1CE6B 3VH8B 3CFJB 43C9A 4UQ2A 2B39A 1Q1JL 1KCUL 5F7EL 4XI5D 2EDBA 2NY0B 5E4IA 3P2TA 4OV5B 3MV7E 4FA8A 2AS5M 1OQOA 4JFDA 1QPPA 2E9WA 1ZE3C 4KK6C 2V5TA 1CQYA 1Z9LA 2FWOB 2FB4H 1KC5L 3KJ6L 1Z3GL 1XGQA 4G6FB 1UGNA 4XC3H 3MLVH 2GKIA 1KT2B 4UTAL 5E08L 4XZUA 4MCZA 1A21A 3V52L 2FD6L 5TFSH 2CRIA 4UILL 3H0TB 3MCKB 3SE8L 3W81A 4HGWB 1A6UH 2EIDA 1XCQA 4JO1L 3VXSE 3WN5B 5D7IA 3JV4B 3STZB 3L3DB 4OAWB 2BMKB 1YN6A 3PDOB 3QULB 1NCWH 2ENSA 3O41A 3L1OL 4GG6A 1UCBH 3D0LA 3EJJX 4KZEH 5C07B 3RZCA 1ZHNB 1HOCB 3UCRA 1G7IA 2BFVL 5IG7B 2WLZA 1R0AL 5D1XA 2OZ4L 1R5VA 4FQLL 2VDRL 2JJUA 5I1HL 3CVHL 5KS9E 4JN1L 5BXFB 1SJEA 3T4AA 5CSZA 1BVZA 4MYWB 2FLRT 3QO0A 4XNZC 1S5IH 3VXPA 5C0BA 1ZT1B 2R39A 4HJJH 4IJ3C 3TJHD 4LSRH 2BY2A 4J8RA 3OPZH 1CDBA 2UVFA 5JXAL 3F6LA 4KKBD 3SPVA 1A8JH 5M94B 1I7UB 2Y6SD 1DDHB 2ESVB 3KPRB 2Z31A 1BX2B 2FX9H 3HI1A 2R2EA 2CH8A 5CAYB 4I77L 1AY1H 1E27B 3MSPA 4PJHA 5E2TL 5JXEA 3PIQB 4FFYL 4BFIA 1WV7T 3T0EC 4NUJA 1JGEA 4L4TB 1CGTA 4QKXB 2HLFD 3O0RH 5BMFH 5EU5B 1CD9B 2I24N 3V0VA 3EDEA 5SX4H 1A6ZA 2NW2B 3UTSD 2Z31B 4Q0XH 2GEEA 5DK0A 1OAYL 1U9KA 4ZAKA 3QIBD 3BGFB 3BZFB 1UC6A 1DBML 2ZNXA 5IEHB 5D7LE 4P0DA 4FMKA 4WU5B 3L7EB 4NT6A 3VXPB 2RCSH 4I9WD 4ZODA 2X44D 3HZYA 4XAWH 4AIZB 5IK3A 4RAUA 4CW1A 1P5UA 1OB1A 5DDHB 5TDPB 4MJIB 5CILL 5EO9B 1HINL 4LIQE 3CUPA 3MRPA 3WXVH 3BN9D 2NR6D 1JK8A 5DMKB 4LCWD 4DAGL 3CC5B 3BW9A 4XH2B 1S7SA 3NZHL 5I17A 4G6JL 5HI5C 1FL3B 2MQ0A 1KBGL 4OCWL 3VFVA 4Y4FC 1JV5A 3C60C 2H9GA 2XIDA 4RSVA 1FL6B 1KJ3H 1NUGA 3BGMA 5IHLB 3MLRH 1IM3A 2Q7YA 2CDGB 4YO0A 4POYA 1KCSH 3G5ZA 4JY6A 3HZMA 4RGMB 1CK0H 1PVHA 5F8QC 3PHQB 2JK5A 4LVNC 5L2JB 4DVBA 3PJSB 1IILE 3G5YA 1Q9WB 5TDOB 2DN7A 4MJIA 4P9HC 4CDGC 2ZCLH 4R97B 3KPQB 3QEQB 5DHYB 4K7PX 4KJQD 3RWFB 5IB2A 4RAUB 2BVOA 2JJTC 4Y8DC 1EHLL 3RX5A 4S0SD 2FJGA 1FCCA 5FYJH 3ES6B 1FZKB 4HWBL 2E9JA 4GMSH 1RVFL 2DQIH 3QR2A 3O6FB 4KROB 1BD2E 5MENA 3DROA 3ZT6A 4YGVB 1OSZA 4GKZB 3IETB 3TYFB 1P6AB 3WHE0 3GSWB 1QHOA 4L3AA 4QRTB 5E4EB 1CFQA 3QHFH 3TN0B 5TH2B 1SBSL 2CRYA 1FFPA 5C9JA 1LE9A 3D9AL 4HWBA 4M8QB 4GW5B 4G9DB 4NO2B 4WW2C 1MUJB 3B5HA 3CH1B 1QFWI 3Q6GH 5DEGA 3C2SA 4WCYL 3LEXB 2GT9B 5ITFB 3U4AA 1RIUL 3H2WA 4UB0L 2LABA 4I18B 3V9FA 4S2SB 1EFQA 3PQYD 1SMAA 3MJ8B 3UDWC 1OAQH 5I19L 3PWLB 3SO3B 4NQEE 1U8OA 1IAIH 2H26A 3FT4B 1FORL 1YPZA 4YZFF 5C7XL 4PRDB 3DUUB 2EC9U 4JDVB 3GUTA 3I02B 3IAPA 3G5XB 1VA9A 5BXFA 5T1MA 4Y2DB 4QRSA 1CXIA 2H8PA 4J1UB 4N8CL 5I1AA 3HB3D 4LCYA 1OTTD 1P4IL 4WI4A 4XB8A 1S7RB 2VDPL 1KBGH 3BP5A 2KH2B 4K7PY 4M5ZH 5CEZE 5L8KB 3L7FB 4JAMA 1LE5A 2CR6A 3TFKC 3EYFB 3SCMA 1GGTA 4QXTA 4JHWH 4NQVB 1AO7D 1JWUB 1DQJB 1J1PL 3BIKA 3UJJL 1QVOA 1IKFL 4U1IB 1QEWA 2IQAA 3HPLA 1X4ZA 5JIPA 5GISL 2QKIB 3B3IA 4K8RC 1CGUA 1F90L 1T7XA 2ATKA 3DURA 4M00A 4M03A 1B6DA 4ONFH 1A6PA 2XA3A 1Z0MA 3U6RB 2CRZA 1QFUH 2GTZB 5IVZB 4M7JL 5JOEA 1K5NB 4OZHB 5F9WC 1JI1A 5ILTL 2EYSA 3ULUD 5I8OH 1VFAB 2YN5A 4HIIB 4P2OD 3N0PB 2HLFC 3O2VH 5IF0B 2PO6B 4YHIA 1A1NA 3MLUH 4L8SA 1C5BL 3L3KB 4LOUC 1AR1D 4JRXD 5HHME 5C07E 2AP2A 5HYSG 3WEXB 2HJKB 5TE6H 4EQ2A 3UPRB 3CFEB 5HYQA 5DJ0A 3P0VL 1DEEB 2YOCA 1WUNT 3RDTA 3TPKA 2VWEE 2KBGA 3Q2CA 4XP9L 3CZJA 4EN3D 4YXHL 1MJJA 2DM7A 5JPMA 1GJIA 4PJFE 2MCPL 3V6ZA 5A3ID 4LCCA 3OKDB 2R4SL 1RJZA 1HWHB 3QWQB 4HF5H 3QG6A 3LIZH 4KTDL 4OD2A 5L6YL 1F6LL 2NY2B 2EDLA 4F57L 5EBWB 4TVSa 2BOCB 5JW4M 3O11A 3BD3A 1T0NB 3MOQA 1GOFA 1KCUH 5C0AE 2ADIA 2PYFB 3VXQB 5HGAA 3GKWH 3LKOB 4XB7A 4OCYH 3OAZH 4EDWH 2V2TA 3BWUC 4O2EB 3U9PL 5DD0H 1OSPL 5EC1A 3MFFA 1KJMA 4IIQA 5GIRA 5F3HB 3QDGD 4OLYL 3LIZL 4P5KB 4NPYB 5D8JL 4LCWB 4Y5YB 1UKTA 1CF8L 1V3JA 1KPUB 1NKRA 3O6FD 1XFPA 2HT4C 5IBLD 3U46B 1R3KA 3MC0A 5IW6A 2V2XB 4YNYA 5HI5D 1G9NC 2EECA 2HFFA 4ODXA 4L4VD 3MRMB 4GMTH 2A9NL 3SGJA 3AREA 1NC4D 3SHSA 1T7YA 4NO5A 4LKXA 4QNPE 3O6KL 5GS0D 2UVEA 3OKNA 3JUZA 4XHJD 3AUVA 2VDPH 1DBJL 2LU4A 1G6RL 15C8L 4LVOB 4WW1B 4JKMA 3X14A 2B0SH 1M7DB 5I74B 4ZPTA 1N6UA 3MLWL 5HY9A 3CFBB 5EOQL 4EUPG 1I1FB 1NFIA 2CK0H 3ET9F 3MGTB 4X4XB 4BFBD 4N0UE 4HD9A 3IDXH 3SOBH 2ITDB 2JCCB 1F6AA 3OR7A 2CMRL 2F19H 3PNWB 5T3XE 2CIIB 4XCFL 2KT7A 1Q0XL 3AGVA 1FJ1B 3IU3A 3SE3C 3GJEB 5CLTA 3GSNL 1J1PH 3WE6B 5GS2D 4G42B 5BVPH 1UCTA 4HX1B 5MEOB 3AM8A 4XPAH 2ED9A 2R4SH 4QXWA 2QTEA 4MB4A 5H37H 2FYYB 2VIRB 4EUPB 5DGQA 1UB6A 5DURD 5T1LB 4A6YL 4KKAC 5GGTH 2LFGA 3CK0L 1T03L 2QQLH 3GSNA 4HC1H 1KNOB 4EI6A 3LEVL 4O02L 5MEOA 2XRAH 4OD2B 4ZMAT 3TJHC 1KV3A 2P47B 3OGOE 1GGBH 3T0ED 5BZDB 2WWKO 2BMKA 1P7QB 3ARRA 4E41D 4KTEH 3B9KA 1A14H 1V7NH 2GIYA 3GBNH 4LAJH 2ZKHH 2VRAA 4MJIE 1DBAL 4A6YA 1A6WL 5IHUL 4AT6B 1AI1L 1MIMH 2JKXA 1QFWM 3F58H 4P5TA 2BZDA 4QLRA 4HUKB 1EVUA 3OAZK 3AC0A 4U7SA 4ONOA 1KNOA 5GS1C 3IFOB 2FATH 1C12A 1ODAA 2Z93B 1SYVB 3EDJA 3B5TA 4Y4KA 2Z35B 4M02A 4AG4H 1GIGL 1UB6B 1DR9A 1XF3B 1FL3A 1VESA 4OIAA 4NNXA 3DYPA 1AO7E 1DE4A 5TDNA 3O9WA 1FNAA 5D2LE 5T3XL 1NDGA 4KQ4H 3RWDA 3IS1X 2XY2A 4JRXB 1NCCH 4WHCA 1BD2B 5C0GB 1DQMH 3F8UB 3SGJC 1ZTXH 1I3RA 4KJYA 1DN2A 2JJSC 2HRLA 2OTUB 1QFHA 4KDTC 4XPAL 4CVZA 5FA4A 4HWEL 3F7PC 4ZUVB 4FQJH 3RGVC 5A1AA 4W4OA 1KELL 4IRJD 5B3JF 2ICES 3WIFB 1UB5B 5KSBA 2ITDA 1BZ7A 1OOAA 3MTRA 3EGSA 1I9IL 1MRFH 1EJOH 4PBXA 3RVXD 4QRPE 1EHXA 4WFEE 3NCBB 1MWAH 4HWUA 1INDH 3QO1B 2XACC 3QUYB 1OAZL 3BDYL 1J1XH 5D2NE 3MBEA 4WY7L 2MJWA 3WFCH 2GK2A 2BC4B 1BQLL 3MBXH 1HXYA 5TQ2H 4ZO6A 1MHCB 5BS0A 2M8XA 4BSVA 4DZBA 1QBAA 3SJVD 2ICWA 3RZCD 4RAVA 3E3QC 4OM1L 1WITA 1G0DA 1GGBL 5ETUB 2E7LC 1FVDB 1WBZA 1LO2L 4XPFH 4RGNB 3QDME 3Q48A 4X6FB 3S3PA 2Q8BH 5EIQA 1I7UA 5C2UB 5SX5H 4GW4A 2BVTA 1G1CA 2X4UA 4HIHA 1J05B 2APXA 1HHKB 1G1YA 1N0XH 1ZEAH 5LGHL 3MBXL 3BHBA 1XGRB 2X40A 3C5JB 1P6FA 1MRDL 3I6LE 4WY7H 4IM8A 3RVVD 3CPLB 1S5HB 2Y07L 1P9MC 2K1MA 4QRTA 1C7SA 5E8DH 5DTFA 3SKOA 4XHJC 1IAII 3OJ2C 3FAXA 1BFOB 1JZ2A 2D03H 3LQAC 4GKZA 3VD9A 5D93C 4GSDH 1MHPH 1YEJL 3L5HA 4XCFH 43CAB 4ZNEE 1CE1H 1WQVT 4M1GH 3U7YL 5C07A 4NQXB 1IGJB 2C1PA 2ZG3A 3O4OC 4RMRA 1LO3H 2HWZH 3ARTA 2B5IC 3RUGE 4GQ9H 4FFWD 5F9WB 3SDDC 4N0FA 3SKJH 2PXYA 2JELL 5HHPB 2KQNA 2AEPH 3LN9A 1EAPA 4GG8A 5IBUB 3WO3B 4Z77A 4OQTA 5C0FB 3MOAL 3WN5A 2EZ0C 3EJZC 5A2KH 4FQIL 3CH8A 4QXUL 1VFMA 2IAMC 3S5LA 3SKMB 2A74A 4OZHF 4F58H 4ZXBD 3RBSA 3I6GA 4YDLC 1NL0L 3PDDA 1MCJA 4XWGH 2BSRB 5FF6B 1YEGL 4YC2C 1FL6A 3QEQD 1AXSA 1NBZB 5FHAL 1NAMB 1CFVH 1FN4B 4ALAL 2A77H 3THML 1FNFA 3PP4L 1I9RH 4OB5L 3FO1B 1S7SB 5B38B 1BGXL 3MV9A 4K8RL 2VDMH 3VFTB 2YMXL 4NQSB 5TE6L 2Z92A 2EDXA 1CYGA 1A7BA 4JG0H 3TJEH 1SJHB 4X9GA 4TVPH 4X7FC 3QDMA 1FYHB 1T22A 1I8KB 4XCEA 5FUCE 2DD8L 3MV8D 5DJCB 3ARDA 4OSUH 3FOMA 4DCQB 2A9NH 2NX5E 3CK0H 4FS0A 5ICYA 1Q72L 5AYUL 5EU7C 1CDUA 4UT7H 1I9JL 2AJVH 2XTLA 1JHKL 5F88B 1KGCD 3ROOA 2YXFA 1UXWA 5T1KD 1S7RA 4Z7OF 1OVZA 1JJUA 5BV7H 1R24A 2FB4L 2XV6B 1RU9L 4I13B 3TLRA 4PJIB 4CBPA 5KVEL 1S9WA 2BCKA 1OAUH 1UFUA 1FG9C 4K7PH 1I4FA 3MV9B 2XN9E 3BEWB 4XAKD 1MFAL 4WJ5A 5AAWA 2DJSA 5J6GB 4FZ8L 3U79A 1FAKT 1IQWL 4XBPA 5D5MA 5T33H 1AHWB 3QUZC 5F7HA 2IFFH 2VDKH 4MD5B 3S37X 2SEBB 4ENEC 1I8KA 1PD6A 4PREB 5CINH 5IHZB 2KDGA 15C8H 1IGFL 4CNIB 3VA6A 4LLQA 1U3HA 3HI5L 4Y0GA 2VKXA 5ITFA 4L9DA 2AJSH 4AIOA 3PWPB 1OAQL 3LAFA 2YPLD 2NY5H 4BJLA 1HE7A 5CJXC 1KJ2B 1BLNA 1X3DA 1OTTC 4NKMA 3BZEA 4U33A 5SWQB 3R1GH 1WAAE 4RDQF 4QO1A 1YNLH 4OZIB 1IAOA 2CDFA 5ALCL 25C8H 3VD7A 3FMGL 2ZP0T 3IFPA 3J7HA 5GS0L 1TPXB 3U2SA 1J8HE 3L5IA 1YEFL 4JHWL 5DMGD 3DHMA 3SKMA 3I9GL 1S8DA 3VW3L 2FSEA 1Q0YL 4MZ2A 4JY5L 4LSUL 3WUZA 2IANE 4MDIA 3BIBX 5IESH 3C9NA 5DK2A 3TJEL 1S5HA 1PDKA 3S35L 2OL3A 4EDWL 1RZIB 4B0MM 1KB5L 1G7LB 3NA9H 1EEZA 4M1GL 3U7YH 1KG0B 4ODWB 1GOGA 3JV6A 2Y06L 2JK5B 3ARGC 4GRWH 4KDTA 5IW1A 1G7JB 4MCYB 2BRRH 4JKLA 2JJVA 5GGQL 1A1OA 3RHWK 3SJVE 3LN4A 3QDJA 2VLJA 4A2MA 4E42A 1MY7A 5DUBA 5F7LB 4QHNB 4NYLB 4LQ1A 3TBSA 3BPOB 4LIQL 2EDDA 3LB6D 4YXHH 2YR3A 4MA1B 5FXCH 1X7QB 1A7PL 4IMKC 5TF1L 3FJTA 4FNLH 4LPCA 4PLJD 3VFPB 1LO0L 3V6BR 3V5KB 1RZGA 4X8JB 4XPGH 1IGYA 2P44B 5TF0A 3P0YL 3AREC 5F70A 2YD7A 1VPOH 1YZZA 3M17A 1SYSA 5EZIL 3CVHB 2JTDA 3NZ8B 3BKJH 1J5OL 1BZ9A 4YGAB 5IJVA 4MA8H 3MROA 1RUMH 5KSUA 1KIQB 1ZVSA 1BD2A 5F6HI 2FH6A 1JFQL 1A7OH 5FCUH 5EU6B 2IPKA 4XNXL 3DX9A 4NWUH 3RIFK 3SDAD 2GUOB 32C2A 1T4KA 1BMGA 3LDBB 3ZKXB 2DL9A 2K7QA 2QQKH 3L3IB 1J10A 3A6CL 3NZ8A 4Y5XB 3S5LG 1N8ZA 4X6CB 1VGKB 4XBEH 3FTGA 3FFCA 3P77A 4NRXB 2VDQL 1CGSL 3BWAA 1WFUA 4Y19D 4FG6C 1FQ9C 1FNLA 4M4PA 3T2OA 5FYKE 4S1SH 4MLSA 4RMUA 4PJ7E 1R5WB 5HDLA 4JFEA 4Y2DC 4S0TD 4PBVC 4LLDB 4MJ2A 3QXAB 3QCUH 5FAAA 2HJFA 3TEUA 2Y5EA 1GYAA 5HI3C 2DAVA 3RDTB 2VLJD 3V0WL 3GI9H 3TBSB 1XGQB 3MRGA 2YUXA 1DANU 3S36X 4GO6B 4L9LB 2NX5A 4ORZC 2R2BB 1INDL 4MNGA 3GSUB 4R8WH 4PGBB 3UJTL 3DX8A 4JFFD 2E27L 4RDQG 4WV1C 2B5IB 1FNSL 2DB8A 4F37K 1YNKH 3FO0L 2NY3B 3ZDZE 5KVMC 4JJ5A 3SBWC 1P2CA 4JFOA 3UJIL 2X2YA 2ZCKL 4KGLA 1AI1H 4JGUA 4CGTA 3TWCH 4FZEH 3VG0L 1YC7A 2DMCA 3HNSL 4WUKL 5IESL 1KJ3L 2X4PB 2DM4A 1OCWL 3K1DA 5C8JB 4DW2L 1WC7B 1BLNB 4PRNA 4DWHA 3ARPA 2ZUQB 1QVOB 4KUZL 3WFBL 3EBAA 5D70H 3TZVA 5BOZG 1C5DA 3WIIH 3KPSD 4GXVL 2HT2D 3ZZ1A 2C1PB 3GK8H 1Q9LB 5T1LA 2XQYK 2E7MA 3OZ9L 1ORSA 2F53D 2DKSA 2P5EA 4RCAA 3U83A 5M95B 1K3ZA 5E8NB 4RX4D 5F7WC 1U3HC 1I3UA 1RU9H 3VFRB 1FFQA 3IYLW 4N1CA 1KTRL 5SV4A 3QFDB 5CGTA 3IDUA 3ARUA 5D1ZA 2VXVL 4FXKB 1CIUA 2XWBA 5KS9A 3MRLB 2JJWA 2HJLB 1GGIH 4WI5A 3C8KA 4WDIA 4OZFG 1X6NA 4RBPH 1EBPA 2P49B 4N8PA 1F11B 3O3EB 3U9PH 4X6BA 3QQ3A 1JL8A 4G5ZH 2DKUA 4MAYC 3UZQA 5D7JC 3W11C 4XNMB 4XP1L 1N5AB 5EOQH 3SDXA 2AJXL 2EE3A 2EIEA 4BELD 3EUUA 1R3KB 2ZUYA 4I3RL 3QZWA 3HG1B 3ZYOA 5IIEA 1JZ5A 1ZA6A 2Z8SA 4ODHH 5IB4B 4LPYA 1NKOA 3I85A 3L1OH 4OZGE 3B43A 1AE6H 5E8OB 1Q8MA 3F7VA 2P7TB 1MCDA 4JPVH 3P40A 4TUOA 4QRPA 4JGMA 4P2QB 4FQ1H 3JVGC 3BZ4B 2WIIA 4XP9H 5LG1A 2ZOKB 2D0FA 2J6EH 5H94B 1RD6A 1JZ3A 3GMOB 5IOPB 4R3SA 5B4MC 1T5XA 2DQTH 4KI5E 1J87A 3KPMB 3VWJC 5JNYB 3KAAA 2IG2L 4RMQA 3CVHA 3X17A 1JMZA 3WIHL 4M6OH 5IB4A 1MHEB 4Y2DD 2IQ9H 2D7NA 1JNNH 3R0NA 4LF3B 1NFDE 3JBG7 4JY4A 3SO5A 3QUYD 1TVHA 2EYRA 4X83A 1WTLA 3EDKA 1SM3H 2Y5TB 4Z0BL 5KTEH 5L7XH 2AV1B 3QDAA 3SGDI 2X4SB 5C0FA 3QUML 1IC4L 5E24E 1LEIA 2WINA 3AU1B 3CVIL 4OGAD 4Y4KB 4CU8A 5F1KC 4F7EB 1ORQA 5D72H 3OV6A 2O5XL 5ECJE 3VFNA 1CI5A 4JFHD 5BV7L 2OTWA 5GRXG 1UXSA 1N0LA 1I1AD 4JG1L 4X5XB 4ELME 3KPOA 1HH6A 5LGHH 4ZSOE 4P4KC 2Z0BA 3OKMA 4YWGH 5BS0D 3BO8B 5IK3B 1RULL 1HKFA 3VXSA 4LVHC 5I73C 3I50H 3IDJA 4H0HB 2E9BA 3UDWA 3QFDA 5DT1H 5JORB 2NNAB 3HFML 2BFVH 4Q2ZB 1YMMD 1J05A 2FZ3A 5I71B 4JPWL 1KJ2H 2APBA 4MQTB 1MHPL 3BZFA 4XWOC 5EOCH 3I2CL 3V6FA 3IDYC 5DA4A 3PHOB 3MUZ1 4BK4A 5LGJA 4HKXA 3QQNA 5DQDH 4MAYA 4TTDD 1RZJH 1CG9A 5BS0B 2VZVA 3MNZB 3ZE2E 2VH5L 1IE5A 2DQJL 1CTOA 4HKJA 1G9EA 4KK5C 3MLVL 4UTAH 1DDHA 3MLTB 5LCVL 3IJYB 5FYJD 4X0KA 4JFDD 4R4BA 3B2VH 5BRZD 3WNPA 3S98A 2DJUA 3SDXE 4XRCB 3FHAA 1X5AA 5I1EH 4J4PC 3G9VA 2VR5A 1N64L 1JPST 1WT5A 5CHNA 3VRIB 4MD5A 4U3XA 4KY1L 2E7CA 1FBIH 2IBZY 4G8EA 5INDA 4RBPK 4WI3A 2FRGP 4KI5F 1V05A 4PJ5A 4X4YB 4TSAH 1SJVA 3HE6B 3FQWB 3WUWA 1MAMH 5EN2B 4BH8A 4ZXBA 1LHZA 4HXBL 1T83A 5CSGA 3MRCA 3KHQA 4P5MA 4XVTH 1BOGB 3H8NA 5IB1B 4YUEL 1WTGT 2EDHA 3ARFB 1DZBA 1A5FH 2MWCA 1WICA 4OCXH 3ZTJH 5ESVB 5KSVB 5DFVC 4GG6F 3H9SD 2IGFH 3LSOA 1V7MH 4WHYH 4YDIL 3LSOB 3IGAB 1DBAH 3BKCL 2FJGB 4K23L 1IAKB 4JB9H 3QJHA 3BUTA 4L4TD 4KTEL 3ARFA 5DJCA 1R3HB 1RZGB 3HE7B 2WIMA 5C0BD 3PL6A 4APQA 4YXKH 3W39A 1MCCA 5EZJA 3BEVB 2DWEA 1NGYB 1A7PH 3VFMA 3QEHA 1T3FA 3QA3B 2NY1D 5B8CC 1IAIL 4PG9A 4G9FB 3V5HA 3O11B 2OJEB 4J3UA 3I6KB 4NYLA 3AFLA 3O3AB 3T0DA 4WFHE 2XKNB 4XXDA 4X8JA 4TUJA 2EDNA 5IFJB 2ICWI 3IDIA 1JCKA 1JI2A 3HR6A 5GGUB 4N8VG 1KLUB 3GHEL 2XWTB 3MYJB 2GTWA 2DRUA 5EZLB 3MNVA 3UTQA 5CINL 3C87A 4O5LL 3OKYA 2BY0A 1HIMH 3LQAH 5DT1L 3HAEG 3DO3A 5GHWL 2N56A 2UYLA 4LHUD 3IFNH 3LEYL 1CG9B 1SJXA 2OS7A 3Q5TA 4KY1H 4QXGH 4J6RH 5LGKA 3UPRA 1SVZA 4FFZH 3C6LA 5K9OA 1PSKH 1YA5A 3D0VB 3SCMD 1AIFA 4NM4L 3TVMA 1A1NB 4P59H 4MQSB 5HYFA 4U1NA 4QOKE 5DMKA 4KJPC 3RNQA 4O9HH 1HINH 5KZCB 3TCLA 1H3GA 2J8UF 4PJ8B 1DVFD 2NTSP 3PWUA 4UNVA 4M61B 1JHKH 1WZLA 5IFAH 3DETD 5ALCH 1RY7B 4WTWA 1MFDL 4K3JL 4O4YH 1JGEB 4L4TA 5E1AB 5E2WH 1PY9A 1MLCB 1BWMA 1I7TB 3DRQA 3PL6D 3EZJB 3RP1A 3SDAB 2VUYA 2MMXA 3RWGB 3C6LC 5EZLA 1U8LA 3O2WH 2GTWB 4EIZC 4JFEB 3TA3B 2IH3A 5IMLB 4J2XA 2COQA 3V4UL 4WW1A 3X14B 2R69H 2AXHA 1FYTB 2OI9C 4FFWC 3FT2B 2EH7H 5ANME 1QKZH 2ADGB 2MOVA 1VEMA 1D5ZB 4HC1L 1AJ7L 4R2GC 3PWJB 1IZJA 4JFZH 3GSQB 3DUHA 4QYOA 3QEGH 5AEAA 4F9LC 4TRPL 5F9OH 4X7TA 2HFTA 5KVDL 4ZFGH 4LHQB 1NGXA 5BOPA 1EDQA 3H6JA 5BZWB 4OT1L 1DQQA 3EYQC 1LO5A 3ZT5A 4GUPB 1ZMYA 1Q9OB 2J8HA 1MY5A 2OMBA 4NRZA 2HMIC 4A2LA 4P46C 4Y5VB 3FQTB 5L0QB 1XEDA 4GAJH 1DBKL 1XF2A 1X5XA 4W81A 5EC1B 3TO4C 3MLPA 5EU6D 1VENA 3I3EA 1WZ1H 4GS7C 3V5KA 2F8VA 1MI5B 3BZ4A 4XNMA 3VFOA 4ISVA 5IQ7H 1MNUL 1VADA 3MA7A 3S6CA 1YMMB 3MNWB 4UIMB 3OX8B 2YEZB 5EC2B 5T33L 4HV8B 2VITB 4OKDA 1LK2A 1JNNL 2D4D