4M02A

Middle fragment(residues 494-663) of the binding region of srap
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
169
structure length
169
Chain Sequence
b'AVTQVRYVDVTTGKDIIPPKTYSGNVDQVVTIDNQQSALTAKGYNYTSVDSSYASTYNDTNKTVKMTNAGQSVTYYFTDVKAPTVTVGNQTIEVGKTMNPIVLTTTDNGTGTVTNTVTGLPSGLSYDSATNSIIGTPTKIGQSTVTVVSTDQANNKSTTTFTINVVDTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine-rich adhesin for platelets
publication title Structural Insights into SraP-Mediated Staphylococcus aureus Adhesion to Host Cells
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Calcium binding protein
total genus 45
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2013-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m02A02
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 4m02A01
1KSRA 1ED3A 4EUPG 3T2PA 1TVHB 4H88L 3O8XB 3LKQA 35C8L 5CIPB 5LVEA 1V05A 3VXPA 3ZDYF 1AE6L 5D5MB 4PJGB 3C5JA 5FOBA 1OD7A 2YMXH 1S9VA 2Y7QA 5D7IE 1OGAD 1J1OL 3VGAB 2C3VB 1ZANH 3QCVH 3G9AB 5DD1L 4G6JH 3QFDB 1DBAL 4K8RL 4OD1L 3W39B 5DZOA 3VFRB 4YPGA 3QPQC 3T1WA 2X4UA 3EOYG 3FB5B 4RMRA 4C59B 4MDJB 1M6OB 2QHRL 3VXMA 1UCBH 3QIBA 4M43L 4R4FH 5JXEC 3BW9B 4X5LA 4LU5L 3VI3E 4EKXA 2Q1EA 4GRWF 4AENA 2C1OA 3BPOC 2RR3A 3HB3C 5FGCB 1MVUA 1SJEB 1X5YA 5JW5A 3UJTH 1SVCP 1DBBH 2G60L 1DUZB 5IMMA 1NFKA 5IVZA 4XRCA 1T4KB 5DMYA 2BMKB 2ZP0T 1JFQH 4DKEL 2EDEA 4S10A 3OR7A 4Q6YA 4BZ2H 4EDWH 1HWHB 4H8WC 4QRRB 4YZFF 3PDOB 5CGYD 3C2AH 1ERNA 1F4YL 4S1RL 1CDHA 2FWOA 3L3OB 2UUDK 4KUZL 4YC2B 2YD7A 1IE5A 1ZA6B 4K2UH 1RHFA 3TLRA 3OKKB 4H25A 2WP3T 2BVTA 2I9LB 2ZUYA 3U36B 3FN9A 1CFTB 2HH0H 4MXVF 1Q1JL 4L3ED 5E0QA 3THML 3MO1B 4Z7QE 3LZFH 2YD2A 3MLVH 1BZ9A 4D0BA 4JRYD 5D7LB 4P2RD 3ULUD 3GSOB 2YC1B 5ILTL 1C16B 5CINH 3KPRB 2R56H 3BP7A 1NCAH 1U91A 2APBA 1NGPL 1P5UA 4G8FB 3UYOD 2FJGB 4LQ1A 5DUMH 3BIBX 2MWCA 5BQ7B 3LKOB 4JPWL 4EXKA 3O9WC 3CZFB 3I75A 5TDOA 3GSXB 4RGNB 2EO1A 3MA9L 4U7SA 1ORSA 3CFJB 4HT1L 1BREA 4XT1C 4G9FA 5T5FH 2EO9A 2DQGH 1N8ZB 3GSWB 3L3KB 3HRZA 5I8KL 1U95B 3MGAA 4M1CC 3WNPA 1WCBB 4PJAA 5FUOL 5AZEL 4XHJD 2VLKB 5HHXH 2B39A 4UTBL 1NLBH 1MFBL 1XEDA 3ULVL 1FVEA 2M1KA 5DJ0B 4LLMA 3FONA 1N5AB 4PJHE 2NR6D 4XPFL 1D9KD 2GFBA 3VFPA 3RPIB 2AK4A 4K3JL 4RWHA 1JHKL 3PL6B 5GJSL 3UMTA 2DBJA 4LASL 1BMGA 5J1AB 2ESVB 1FZMA 2EXWD 3KAAA 3TFKC 4MAUH 3WS3B 2V7NB 4U1IB 5KTEL 3GGWB 3BQUA 4PJ5D 5FUZL 3ZKQD 1B2WL 3U0WH 5HD8D 4MA8H 3F6IA 4JM2F 3NCFB 2P47B 1CR9L 3SKOB 3O6ML 4AEIL 4JJHA 4LAJH 3TBWA 5CSZA 4PRBB 4HHAB 1S8DB 4N9GA 5HY9A 1YJDL 1ZV5A 1SEQL 1MQKL 3DUUB 4M4RA 3RBSA 1FN4B 1OTTD 2AV1B 1SHMA 3EDDA 4NQCA 3T4AB 1A14L 1OCWH 4GBXB 4M6NH 4AYFA 4DWHA 4QT5A 2CUMA 3C8KA 3OJMB 1CT8A 3LRSB 2Q76A 4Z7VA 1KTDA 1YDPB 2IPTH 2LV4A 4GG8A 3OQ3B 4U1SA 3UPRA 5D72H 1DCLA 1I1YA 3U0PB 3QIWC 4EI6A 1K2DB 2ARJQ 4Y89A 5JPNB 1QFPA 1T0NA 4P5KA 3IVKA 1P1ZA 5CMAB 3LN5A 3V5HB 2VXSL 5C0BE 2QADD 4HIEB 4IIQC 5SWSB 5KN5A 5GIRB 2VDRL 4RMWA 4WFFD 5J13B 1UZ8A 2A6JA 5INDA 1MJJB 1FH5H 1MELA 4EI5D 1UZ6F 4TSCL 3BKCL 3I50L 4PBWD 2DL9A 2Y25A 1JPFB 4O58L 4CRPA 4Q9BA 4WFGD 2PXYB 2PW1A 4KY1L 4WV1C 1HQRB 1FYTD 1FVCB 1W0VB 3I2CL 1T7ZA 3FQUB 3P9WB 4NO0D 1BZQK 3M8OH 4LPWA 4HIIA 2FD6H 1OWRM 2XZZA 1IJ9A 3T8XB 3O81A 3LIZH 1AHWB 5EORH 1F4XL 4YDIH 4AEEA 4GW1A 2UVEA 2O26U 2HJKA 5CIPA 1ZA3B 1NUGA 3HG1E 4GAJL 3WUWG 1TVBA 3ARRA 2K3TA 2NY6B 2XWBB 5D5MA 2F5AL 4OLVL 4L8BA 3G04B 1BFVL 3NA9H 4LSTL 3H0TA 3E8UL 3NABL 2CKBB 5KVEH 2HKFL 2BNQB 4MNGB 2WZPD 2VDNH 4Y5YC 4GW4A 1OSZA 4NHCH 4K3DH 1NC2A 2AAVA 4QEGA 1H5BA 4MDJA 3GUTA 5CBEB 4ORGB 4U1MB 3QFJB 3IU3B 4P2QD 5ANMB 5DJYA 1SJEA 3S3SA 4K9EC 3TBSB 4XGZB 3RTQA 3PP4L 5DDHA 4HWEL 4UB0L 5LAXB 3WKML 3RWGA 1X5HA 2NXZC 4XCNB 2FHFA 1UXSA 2BVYA 4L4TB 1CN4A 1OGAE 1FHGA 3M45A 4WVRA 2FEEL 4HMDA 4OZFH 1CGSL 1MNUH 5C9KA 3QUXB 3NCBB 2UZIH 4P46D 1I1FB 2APWA 1UJ3B 2FZ3B 2H6PB 3S5LA 1UG9A 3UC0H 1BJ1H 2FSEB 1XF2B 1OAKH 4H8WL 1ZSDA 5C0ND 2X4QA 4WUUD 3HMXA 4OUOA 2DN7A 1MCFA 3PHQA 3TT3L 1FPTH 4U6VL 2NNAA 1ZHLA 1B0RB 2DD8L 2PTUA 3S3PA 4IHOB 1DBML 2FJHB 1ZT4B 2AJXL 1MFEL 2W38A 3V8CA 1DSFH 1FO0L 1ZHBB 3QIUB 4KVNH 1MQ8A 4QXWA 1RVFH 4G8FA 5E6IB 1K3ZA 4Z7NE 3HUJE 1PG7L 3WXWH 2IPUK 1YUHB 5MENB 3TWCL 3CZFA 5DVNA 5EZIH 2DBLL 5EOCH 1HHGB 5GS0H 1JNHA 1N8ZA 3P11L 1FIEA 5D8JH 2ATKA 2ZCHL 4NUGH 2O5XH 2ZSWB 3V0VB 5CGTA 1DQJA 1FLTX 3H7BA 3B5GA 5D6CB 1F3JB 5EC2B 1S9YA 1ZT7A 3RUGA 4FNLL 3RWDA 3QB7C 5EO0B 1YECL 3X11B 4OI7A 5F71A 4JHZA 2GJ6D 4PY7A 5F3HB 5HTSA 4LNRA 1U8QA 5D1QD 4N5EC 5DUPH 4N0UB 1KB9J 1K3IA 2Q8AH 4FFYH 1G7LA 5I73B 1F42A 1VGKA 2VL4A 5GRZA 2NLJA 3C60B 5DMKA 3OJDB 5DD5H 1LHZA 1YEIH 15C8L 5I8OL 3S36H 3ET9F 4HZAA 2R4SH 5F89B 2VITA 4PJIB 5EOQL 3SKOA 1EUUA 1ZEAH 3QUZA 4F57H 3CFKA 1GZQB 4G5ZH 4HHAA 4PGDB 5I17A 1D6VH 1HHJA 5DZNA 3DUUA 1FN4A 1CQKA 2AV1A 4FQLL 1I7UA 3T4AA 2OQJA 3G5ZB 4GBXA 1K6QL 5GGVY 4E41B 3VFVA 4B7LA 4KVCL 2IWGA 5E4EC 5DGQA 4Z95L 1JL8A 3JZ7A 3HNTL 2DQIH 4FQ2L 1MJ8H 3QI9B 3MLSH 4PJ5E 5MI0B 3WMSA 1KLUB 2GIYA 1A6AA 4JDTL 3LY6A 4X6CF 4PBXA 5J11B 3K8LA 5D7JD 1SY6H 1F97A 5SWSA 4YDLB 5GIRA 4D2NA 1CD0A 3BHBA 4OGYL 3M1BB 3QDJD 2IH1A 4MA7L 1NSNL 2DQTH 4IDJH 1KJ2A 4J3TA 3DXAB 1N3NB 4ZXBB 5SWZA 2PXYA 4LVNB 4X6BB 3X3FH 1X44A 4JDZB 1UWEL 1FL6A 1KJ3H 3GIZL 1QFWM 3VH8B 1YQVH 3RIAF 4A2LA 4ORZC 1YMHA 1RZGA 2CSPA 1NMBL 3W11C 4NQEE 4UQ2B 5C92A 1AXTH 1BFSA 4MNHA 5DJ6B 2ENYA 4OIAA 5D71L 3CMGA 4JKPL 1AHWA 5I74C 2XZCH 1MCCA 3P4NB 5EU6D 1LO5A 5CGYC 3MRPB 3ME0A 1XGTA 2BOBA 1ZA3A 5J9PA 2OXHA 4JO1L 4WWKA 4ELMA 2XWBA 3TO2A 4LHUB 2PCPA 1Z9SA 1IVLA 2P4AB 3QJFA 5D2LA 1URLA 3HI6L 4LSQL 4NQXB 2IANB 4GOSA 4KV5F 5LCVH 5ITBH 1W72H 2OMNA 3L6FB 5CJXC 1T7VA 5CEZD 2VR4A 5ESQB 3GBLA 4PJFA 1OSPH 2P48B 1G7HB 5J8OA 3ULUC 2IFGA 1MRDH 5KVGH 1AR1D 1TNNA 4P3CL 1H3GA 4ORGA 1YPZE 3RA7L 4P9MH 3IU3A 1H3VA 5CJ5A 4QHKI 1X4YA 1YEJH 5ANMA 5DI8A 2HLAA 3D85B 2J5LB 2IEPA 1MFNA 2FYYB 4XGZA 3U7WH 5FKPA 3MLXL 5IQ9B 1AIFA 2WBKA 4OZIA 1F4HA 4M1GL 4NN6C 1XGPB 1HHHB 1AGEB 1WBZB 4H20H 3ECBA 3KLSA 3RWEA 1L9NA 2Q20A 1KNOA 1OAXL 4XHJC 4NWUH 4K9EL 3QH3B 1FZOB 5D7IF 3PWVB 2CRYA 2WSKA 3KR3L 2GYSA 5TDPA 5EOTB 2NR6C 4UT7L 1D9KC 2FZ3A 3JV6A 1IL1A 4H0GA 2FSEA 2R69L 3F8UB 4ESKA 3ETBF 2Y36H 1BQHA 3VXMD 2XA8H 1HN1A 3QIBD 1HZHH 1X5JA 1NDGA 3CPLB 3S37X 1R3IL 2VXTH 2EXWC 5CILL 3VI3F 2X89A 4K23L 1EEQA 2D7QA 4LSVL 4MJIA 4OT1H 3MYJB 2E9JA 5GISL 3VRJA 2YBRA 4PUBH 1EGJH 4IHOA 2FJHA 4JY4B 1ZT4A 1T0PB 5HD8C 5ADOL 4RZCA 5DUBB 3DJ9A 1P7QA 1L7TL 5KS9F 1DVFB 4UOJA 5DHXB 1D5MB 4H88H 4PD4K 2GSIA 4Z7UE 5D70L 35C8H 3F7QA 4OM0L 4EN3A 1DE4A 3LS5L 1WICA 1HKLL 1H15A 1AE6H 2XTLA 1HHGA 1OTTC 4RSVA 1KYOK 3N0PB 3NFSL 5FO7A 3VE0A 1U8KB 2YEZB 1JZ2A 2ZSWA 3TBVA 1NBYA 4WUUE 4KDVA 4DN4H 1F4AA 4P5TA 1FAIL 4QTIL 5D6CA 5DD1H 5I8EB 1DBAH 4K8RH 4OD1H 4Z7QF 1MCHA 4ZPTB 3WN5B 3V79C 2IGFL 2VZTA 4M6OL 4M43H 3CXDH 4LU5H 3QNXB 2QADC 3BEWB 3T1FB 2ID5A 5ENWA 2HRPH 3ZHKA 1KB5A 2XXMB 4FHBD 5HVHC 4GKZB 5EZOL 4EI5C 1MEXL 2G60H 1AY1L 3C60A 3OJDA 1TVDA 5F7WC 5FM5O 1ITBB 1MWAL 1IAII 1NLDL 4G9FD 4WO4A 1B4JL 2XZAH 4HKXB 3MSPA 2JCCB 1F4YH 4S1RH 3DMMA 3DNKA 4GAGL 4Q2ZB 4KUZH 4KHTH 2GJ6E 5A3ID 1VHPA 4F9LA 4Z78A 2YK1L 2X1WL 2XT1B 2X2YA 4HQQL 3FT4B 1BOYA 4WHTB 1LP9E 1XGQB 1BEYL 4LCCC 4YHKL 5EUOE 4ODVL 3TPKA 3TJEH 1DLFL 1F2XK 3QHTC 1IMHC 3QRFM 1CFNB 2AK4D 3THMH 4KUCF 4JR9L 3EOAB 2BNRA 2W1NA 4W68A 3L7EA 5A40E 3LKPB 4MS8D 5DS8B 2DIJA 2XKSA 5ILTH 5JORB 4YWGL 1KLUA 5SV4A 1TPXB 1NEZA 3BQUD 3BUTA 5FCSH 3GI8H 4NFCA 4Z7OF 2NW3B 1PW3A 1R6VA 3ZTNL 3DVNB 4JPWH 3QO1B 1CVSC 4P23B 3GMMA 3IU4H 3S35H 1NAMA 3S34H 2BC4A 3G6DL 5EN2B 3NIGE 4HT1H 1N3NA 4JDZA 3F7VB 4UBDD 2O93L 2BSRB 4NQCD 3S97C 1QRNB 1SM3L 1EFQA 2NY0B 5F96L 3LOWA 3IYLW 5FUOH 3KXFA 4BH7A 4LLVB 4UTBH 4DEPC 1RMFL 1NUFA 3ULVH 2R2EB 4U1HB 1QYGL 1A7NH 4XPFH 4Z9KB 5TQ0H 4YR6B 4K3JH 3FO2B 1BQSA 1PX4A 4WW2A 3I9GL 1JHKH 1Q9KB 5GJSH 2AEWA 4AM0A 4GS7C 4P46C 1U6AL 3CSYA 4I77L 1WJ3A 4XTRD 1MVFA 3NN8B 3S4SA 4UQ3A 3BRDA 2JJWA 1CD1B 4FQJH 5BJTA 1FJ1B 3IFPB 2IANA 3QEQA 1LO4L 3TYGL 5MEPA 3WIIL 3G6JE 4PR5A 2J4WH 2BHUA 1OVZA 1B2WH 4CVZA 2O5ZL 4RNRB 4XI5D 2K9UA 3VMOA 1D6EB 3J7HA 2EKJA 1CR9H 5GZOD 1Y0LA 3O6MH 3O2DA 2DF3A 4AEIH 5BW7C 3E1F1 3KNBA 2GTZB 1HH9A 3QEHA 1KIRB 5MP6L 1YJDH 1SEQH 5EU6E 4RAVA 3CLFL 3B3IA 4G6KL 1ZOXA 3D85A 4R4ND 4WEMB 5HGAB 1A14H 4M6ML 2FYYA 1MLCB 5E2VL 3ULUL 3G08A 4G9DB 4LRNL 5DRNB 1T5XB 5GS1B 1U3HB 2BRRH 1AGEA 4G6ML 5GJTL 5IJKC 1G7MB 5E94A 5DMGD 3LPGA 1HE7A 1H3UA 3W9EA 2B20A 4GRLB 4D9LH 3IJSA 4LDEB 3DBXB 4Y19B 3SDCC 5KW9H 2VXSH 1QPXA 5HJ3B 2F8VA 1OPGL 2VDRH 5DURD 5DFTA 2CLRB 4HIJB 5D1QC 5DC0A 1XH3A 4X8XA 4TSCH 1OHQA 3BKCH 3I50H 3MRKA 2EZ0C 2B1HH 3CPLA 5AG9A 4KGJA 1BJMA 1VEMA 5I1AA 3AS2A 2N4IA 4RMSA 4KY1H 5JW4N 4FP8L 4OLEA 1RJZB 3RTQD 5L8LB 2A77L 4FQ1H 3QQ9D 4J3XA 5FGSA 4ZUSA 3B2VL 3IAPA 1HSBA 1MAJA 1P4IL 2I24N 1C7TA 1UKTA 1D5MA 5J1SC 5KAQF 2ATPA 1AXIB 3QZWG 4AZ8A 4CMHC 4HJGA 5IK3B 4WI2A 4EZMA 4ELKA 2RQ8A 3VA6A 1G1CA 2FGWL 3O6FB 1XCQB 3GBNH 2F5AH 2F54B 5JW3L 4X7SH 1A1NB 1XR8A 5F9WB 1BFVH 2R0LL 2ARJA 4G8GE 4LSTH 1TQCB 4R7NB 4NCC2 4WI8A 3E8UH 3NABH 4RCAA 3WJJC 2HKFH 3QQ3A 3ILQC 2J2ZA 1AJ7L 3DX6A 3MA7B 1BD2E 4ZPTA 3HCVA 3WN5A 3LDBC 4HC1A 3MRIB 4UUJA 1A9EB 4LFHG 3SE4C 5D7JC 1JTPA 3TBTB 5B39B 5E00B 1CZ8L 2PW2B 3AREA 3T1FA 1MFCH 1IAMA 1VFBB 2O61B 4GKNB 5F7UA 1MCPH 4Q9CA 2D4DA 1ZMYA 4D9QD 3MV9B 3PP4H 1NBZA 2ICEB 4HWEH 4UB0H 2R1XB 3IDYB 1F6AB 1VPOL 2QQLH 3WNMA 2VR5A 1J7VR 2E8YA 5E03A 4AMKL 1FCCA 2R1YA 5EO9B 1A6WH 4XNYL 3H8NA 4YDVA 3IXAB 2APXA 4BSVA 1IEAB 1G7IB 4OLWL 1BQHG 4TN9A 4PFEA 1VACA 1G84A 3REWA 4PREB 1NDMB 3CD4A 3D87B 2IH3B 2FX8L 2VE6B 1K4DA 2YA2A 4LKXA 3FT4A 3SGJC 5F6IC 4CNIB 1BQLL 4D9RE 2VXVH 4HFWA 4JFXA 4RAHA 3Q48A 1QA9A 3DVFA 3TT3H 2AJ3A 4U6VH 5AD0A 5DS8A 4KDTA 2JB6B 3WLWD 4JVUA 4WGWB 3C5ZA 4G9FE 2IADA 4HLZH 2B0SH 1OT2A 1XT5A 1FO0H 3OWEA 4G7YL 4YXKL 3NPSB 3SDAB 3UZEA 4WI5A 1RJLB 1XF3B 2ERJC 1AR1C 1PKQA 5EU5B 1PG7H 3FT3B 3QO1A 3QUZD 3TWCH 2FECL 4OZFB 5IKCA 2J8OA 2DBLH 3F7YB 1A6PA 1H8NA 4ZD3L 3ISWA 3VWJC 3KPSE 3P11H 2AK4E 2ZCHH 2AEPL 1FGVL 1J1PL 2H26B 2XPGB 4GBXD 5E5MA 1I8MB 3MREA 4JAMB 3OX8A 1Q9WB 2E9BA 5I1IL 3K1DA 2DOCA 3I6KB 3V6OA 4TVPL 1YECH 2R23B 2R2EA 2XNAA 4U1HA 4NKOA 4D3CL 5T1MB 2F53A 4R97B 4YR6A 2SEBA 4P9HC 1MRCL 3VXOA 2PETA 5SWSD 3NN8A 3WD5L 2NW2A 4Y88A 2PTTB 3JWDC 2E6PA 3ZE0F 3IFPA 1L7IH 1IM9A 5JLZA 2P8PB 2X70A 3QIBC 2HVKB 5FF6B 2E27L 1AC0A 1MY5A 4NQCE 15C8H 2V9QA 3DIFB 4QRSA 5HI5D 1YN7A 1AKJB 5SWZD 2PXYD 4ZFFA 4M8QA 2D7OA 3MJ8A 1PY9A 2DM2A 4UIMB 2IQ9L 4Z7VE 1JHLH 1BOGA 3D39E 4RDQG 5INCB 5H35B 5EOQH 5DFWH 1PGRB 5IOPA 5I0DA 4Y1AB 1FV1A 3GJEB 2PNDA 1KIRA 3MLZL 4ZQKA 3CFBA 3KPLA 2AXGB 2FB4L 3FO1A 3WE6A 2AXJA 2UZYB 4FQLH 1N5YH 2CLZB 4OF8A 2F58L 1CBVL 2AV7B 4KVCH 3RNQB 1T5XA 1NEZG 4Z95H 3LSOA 4W6YB 4WWKD 1I7TB 4XP4L 3HNTH 4TUJB 4FQ2H 2BVOB 4WNQA 4UNTA 1SJHB 3CC5B 3EOBB 4FXGA 1WF5A 5E2WH 3QEUB 4H0IA 3DBXA 4BM7A 4YXLL 5TPWL 5C0IA 2UYLA 4LPUA 2I9TB 3QXAB 3B9KA 4G8IA 1MI5B 1ONQA 1MCSA 4G8EB 4M7LT 1RIHL 4OGYH 2D7TL 5EG6C 1LK2B 3H9SB 1NSNH 3ROOB 3QFJD 4MVBD 1YPZF 1UWEH 2BFVL 3GMLA 1MCQA 4J23A 3KYNA 4HXAH 3QUMA 2UZXB 2XN9B 5EU4A 3GIZH 2XQYK 1NKOA 1RIUH 2DQEL 4MJ2A 4KI5F 1G7QA 3ZT5A 4MD0A 4MWFA 1CFBA 1N7MH 3GKZA 1CIUA 1T22A 5D71H 1CDIA 4JKPH 3TN0A 2LE9A 3WHE0 4FG6D 3RJDA 1P6FA 5J0BA 3L3GB 5A3IC 3WS6A 2W60A 1EEUA 3O6FA 1XCQA 2NY1D 1A1NA 1IGYA 4OJFL 3T04D 3ARBA 4ZDHB 1W0WA 4JZOA 4D0DA 3HI6H 4LSQH 5D96B 5JW4M 3OXSA 4RFOH 3TIEB 1HIML 3TO4B 1QZ1A 4MS8C 2X89D 4MJID 4MQ7B 4XNQA 1A21A 1D7FA 5F6HI 4P3CH 3PGFH 3HZVA 1C5CL 3BQUC 5C09B 3RA7H 2ED7A 2R8SH 4E5XA 1XGYL 5CLWA 5ERWB 2FGZA 1VFBA 2XYCA 4GKNA 4OIIL 2O61A 1P7QD 4R0LB 4ZFOB 3MLXH 2E7MA 1M71A 4YUEL 1BVKB 1KEML 1MHEB 3Q2CA 3X3GL 4EN3D 3B4NA 4YBLB 2EYRA 4M1GH 4Z7UF 4M93C 4X4YA 4UBDC 1KLFA 1CGWA 1JHTB 4FXKB 2V5MA 2DJSA 1OAXH 3K46A 3MUHL 4GRWB 4I0PA 2ENSA 4P5TD 4X5XA 4PREA 2EC9T 3BPCA 3PWLB 2VR9A 5DRWB 5IFJA 5FUCC 1DL7L 1PQZB 2X4OB 1JK8B 4H26B 2R69H 4N0RA 2NX5A 5I8CA 4LAQL 1CDJA 1X5XA 4YHZL 1R3IH 4OF6A 4XTRC 3L5XL 4F7TB 2MJWA 4F8QA 5CILH 3RVXD 4F8TA 3S8WA 1S78D 4KROB 4X4MA 5H94A 3AS3A 4PRHB 3EYOB 1KG0A 4HJJL 3C60D 2Z92B 4IOFD 4Z0XB 5LG1A 1G6RL 5A2LH 3LKNA 3OJVC 3H9YA 1FGNL 1D5BB 4XI5C 1TJGL 1T83A 3SDAA 1Q0YH 3E3QC 5K9JH 1XF3A 4WO4D 3SDXE 1L7TH 4WTXA 5IB3B 4I0CC 4PJEB 3N50A 5IMLB 4OM0H 3RUGE 3DMMD 3RVUD 4LGPB 4NYLA 1RUAL 5JOEA 4R4NC 5CEZL 4DKDC 5DJDB 3NFSH 4HX1B 3L3JB 2BSED 1WVZA 2XPGA 4QRTA 4OI8A 2VL5B 4DVBB 4QTIH 3OXRA 5EUOF 3UTTB 5CFHA 1JN6B 3TT1H 1DZBA 3AFLA 1J1XL 4ODWB 1WT5A 3CFEA 5DMGC 2BNRD 3MGTB 3WLBB 1F6FB 4TUKL 2IGFH 3VGAC 4DQOL 4M6OH 1WZMA 4XP6L 2CIIA 3GDBA 5F72S 3FFCE 2QQNL 1DQQB 2EKSB 4PLKD 3U46B 3VFUB 4TYUA 4J3SA 5E8EA 3BD3A 5IGXL 1KJVA 5HHNA 2PTVA 5IB5B 2YHGA 3SQOL 3HS0A 1C5DB 2WBJB 3K3QA 2HVKA 4M5YL 4UMGA 1JPSL 1PZ5A 1JYVA 4FQCL 1MWAH 5FGRA 4P9HL 3NIGF 3DI3B 3RTQC 5IHZB 5DEFA 3KPQB 4QRUA 2AEQH 2G5RA 3K2MC 5JOFB 3ARVA 1KV3A 1WWAX 2HAZA 1NGXB 3GJEA 4LIQE 3QXWA 4WJ5A 3JWDL 1LWRA 4GAGH 3KXFD 1RI8A 3WXVL 3BP4A 3SJVE 1QKZL 1VFUA 4MXWL 4XC1H 4BSWA 1J9CT 4HQQH 2CLZA 1P4BH 2YKLL 3C6LB 1EXUB 3OHXB 1OQOA 1BBJB 1T2XA 4YHKH 1CF8L 3IJYB 2P42B 2AV7A 1DLFH 4L1DA 4YC2C 1NANH 5FA4B 4JR9H 4JM2B 4Q9RL 5CCKH 4XCEB 1LEIA 2HYMA 2BVOA 3OR6B 1YNKL 1ZLWK 2CD0A 3CC5A 3P40A 1M05B 32C2B 2IAND 4YWGH 5SWZE 3QEQD 5IMKA 2QQKH 4QOKA 3UJJL 4H5SB 5AZ2H 5C1MB 1IGIL 4R90L 4IS6A 3FQNA 1ND0B 3ZO0A 3BIKA 3MRNB 2ADGB 3QXAA 1CGXA 3G6JF 3VGDA 4F7PA 3O2WL 1GIGH 4HCRH 3STLB 4JFDA 3SDDB 2FBJL 2OZ4A 4PYHA 4PLNC 3H9HA 3I84A 4J1UA 5FYJD 3ROOA 4EJ1C 5KSUA 1QFWL 4N90D 1YY9D 3D85D 4XVJH 4WGVB 5IBLD 2XN9A 1SM3H 3QULB 4JKMA 2K7QA 4MCYA 4ELME 4UOW0 4HUXB 4RGNC 5TH2A 4JY6B 1ZLWH 2FX9L 5D2LE 5DSCB 4FMKA 1FSKB 4R96B 2P5EE 1M7XA 2R0KH 4LSDA 1RMFH 2DQJL 1RUQL 4QNPF 1QYGH 4MGXA 4OF3A 4UDTB 1WFUA 3EYSH 1KLGA 1E6JL 3M07A 4JGJA 1JV5A 3I9GH 2J6EA 4PJFE 3L3GA 3ESVF 1U6AH 3HAEH 4I77H 4NO5A 2JE8A 3EO9L 3VXQB 1SY6A 4Z0BL 1FFPB 2OYPA 3BDXA 2YN5A 3TYGH 1LO4H 3G6AA 3Q5OA 1QLFA 3WIIH 1KFAL 5JPMB 4MXQD 2W91A 4Q0XL 3BYTA 3OAYK 1OW0A 1CU4H 5ACMA 2O5ZH 3RI5F 3LKRB 2ZOKA 4HSQA 2DWEB 1U8IB 4HS6B 3WLWC 3Q6FA 1Z5LB 5E6YA 1CGVA 3CU7A 5MP6H 2ADFL 1EBAA 3OKNB 5HHVL 5DC9B 5ISZB 3CLFH 5I19L 4G6KH 2EYSB 3NIDE 5C07E 4F7CB 2OK0H 5ERWA 1VADB 3CFCL 3I6LE 1RY7B 4JDVB 3T0VA 4UV4L 4X98B 3QUZC 4YHPA 5DO2D 4QO1A 1U8NB 3ULUH 4OZHF 4LRNH 3QO0B 3BJ91 2V2WB 3MV8B 4G6MH 5GJTH 4P4KA 2AVGA 4GBXC 1JHTA 3OAYH 1NMAH 1FZKA 1TETL 2XRAL 3L5WA 2LVEA 4MJIE 2LU3A 2KVZA 1KENL 2OTPA 4HF5L 2KYWA 2X4OA 1JK8A 1JZ4A 2E9WA 1H3PL 4JRXB 4OCSH 3HPLB 4PGCB 2Y23A 3U4BL 3ARED 3W5MA 1Z3GL 3MBXL 5J13C 5K9KB 2HFEA 3LEXB 5ID0A 3MNWB 4RGMB 4C83B 2A77H 4QRQA 5GRXG 5EZLB 1YEFL 5HI5C 2PXYC 2X1QA 1MJUH 3B2VH 2H1PH 5DJAB 5HHOB 4IMKA 1P4IH 5IB3A 4S1DD 3IFOB 3EO1A 2Z9TA 4NJ9H 1INEH 1EFXA 3QYCA 5E24E 4JVWA 1AHWC 2EDTA 3B8YA 1S9WB 4I1NB 3MUY1 5DJDA 4AJ0A 2P7TB 3MFFB 3ARQA 5GSVB 2E9IA 4EIGB 2GTWB 3P0YH 3SQBA 1T2QL 1NMCB 5GSRA 4I2XA 2NY6C 4XBPB 1U9KA 4ODWA 4DUXA 1HXMA 4BH8A 3TH2T 4XNZB 3MGTA 1AJ7H 3O3EA 3U9PL 3ILPA 1FFNB 4NRZA 2BVPB 1MHHA 3UYRL 4DKFL 5F9JA 1A1OB 3C5ZD 4HS8L 5F7LB 1DQQA 2HTLD 3PDDA 4FQXB 1ETZB 1CZ8H 5JA8B 3BH8A 5DLML 4G6AD 3VFUA 4EXPX 1J8HA 3S35X 4OSUH 1RZ7L 3BPLB 1C5DA 5GRVL 4FQQA 4MVBC 3V6BR 2QL1A 1PJ9A 1IAKA 4XNYH 4MAYB 5DMJB 3L7FB 4M3KB 4I48B 3TA3A 1BP3B 1KOAA 3AGVA 1QRND 3OB0K 4PP2B 4OLWH 2NY0D 1QLRB 3EGSA 2BNRE 1MHPH 2EDWA 1GXEA 5EO1A 2NQCA 1JWMA 1KIUA 4PY8J 4BFIA 2Y5TA 4FG6C 1BQLH 1A7QL 2F53D 2Z8WC 3IJYA 3T65A 4L4VB 3QUXC 3BAEL 4LPXA 2CLVB 5B3NA 4HD9A 4JM2A 2J8UF 1CXFA 1G9MH 4TPRH 4XP1H 3BWAA 1UJ3C 3OAUH 3FO9A 1M05A 1IM9D 6FABL 1A6VH 1ND0A 1WITA 2GUOB 3OB0H 4KTEL 4G7YH 4X9BA 4OQ1A 2IBZX 5I1LB 2WANA 1HOCA 5IR1B 1ZTXL 1X7QB 1Q0XL 4HH9B 1YY8B 1TTUA 1KXQE 4XBEH 4ZD3H 2GSGA 5J6GB 2R15A 5TE7H 5C0JA 2AEPH 1FGVH 1J1PH 1TJHH 4J3VA 4HUXA 5I1IH 4MJ6A 2ZSVB 4MA1C 3QEQE 2IALB 4UDTA 3P30L 2RAMA 4P5TC 2WBWB 1MRCH 4XB7A 2MOVA 2RGSA 3G5VB 3SN6N 4HUVA 3WNNA 5HDOA 3B9KD 4N0YH 1H8OA 2EE3A 4NJAH 5FYJE 3T3PF 3VXQA 1FO0B 1HI6A 1FFPA 1G7PB 2H3NA 3LKSB 4OF0A 1DQMH 3QG6A 1IILE 3BGMB 1I8KB 3RVXC 2KUTA 2QSVA 4OLZL 4OTXL 1J0KA 1N2RB 1S78C 2IQ9H 2DWEA 3CXHK 4HS6A 2ZKHL 3C60C 4IOFC 3LPWA 3EO0A 1L0QA 5CP7B 3UTZA 3OKNA 3MLZH 3KLAA 1ODAA 5ISZA 2DWDB 4X9GA 2FB4H 4WO4C 1K8DB 4JDVA 5J6HB 3TN0D 4NZDA 2F58H 4X98A 4EEEA 3BE1L 1C12B 1G0DA 2VO5A 3RVUC 1PZUB 1A0QL 3MYZA 4LLDB 2E7CA 5KZCB 4F9LC 5T3XD 2P5WA 5E8PB 3O6FD 4XP4H 3VXNB 5I71B 3F6LA 4WW1B 5M7QA 1K5NB 3ARBD 1IC4H 3O4LE 4KJQD 5F3BB 4GH7B 2PKDA 2UWEB 4LMQE 3IETB 7FABH 5IESL 4MNQB 4YXLH 5TPWH 4WIQA 5ALCL 3INUL 1LEKB 3FB6B 3X14B 1RIHH 3W2DH 5MI0C 1ZHKA 1ES0B 1EPFA 3WNOA 1T5WB 4WHYG 5J11C 5F7DB 4PLKC 4C4KT 3RVWD 2XWTA 4WHDA 5GGSB 1PDKA 3O3DB 3LEXA 3TZVA 4Z7WE 3V0AC 4WWID 2WIIA 4G3YL 5D7IB 4G6FB 2DQEH 1S7QB 4LHQB 5A43C 1PEWA 4GMSL 5E5RB 5F7EL 3TIDB 5HHOA 4POUB 5DWUL 4G42A 4HWBA 2Y07L 3EIFA 2ICES 4KKBD 2G9HA 5BMFL 3DO7B 1QBML 5GZND 2DTML 2VLLB 4UV7L 1S9WA 4K07A 5HGDB 2P7TA 3MFFA 1EH9A 1TTGA 2CRIA 4NC0B 1C08A 2JJTC 1T1ZB 4CBPA 2MQ3A 3MRMB 2NX5D 3SO3B 2F8XC 25C8H 1HIMH 1T1WB 2VNCA 4KK9D 3RIFF 4QXTA 3RKDC 1O5DT 5EH1A 2R29H 5GGVL 4AL8L 3MRHB 4IIQB 4KQ3H 2YD8A 1NJ9B 4JFYB 3L1OL 3SDAD 3PABA 4OIIH 1PG7X 1NC4B 3KPNB 5BRZA 2B5IC 2BY3A 1N59A 3UTQA 5TFSL 2IG2L 2M8XA 4YUEH 3SDXF 1KEMH 3KG5A 5JDSB 3X3GH 4NQDA 2Y4SA 4WV1B 3HNVL 4ZUUB 1JF1A 5F93C 1YY9C 2J5LC 1MIEL 1TCMA 4NQVA 4H1LA 2ZG3A 3VXTB 3DV4A 2IAMA 1FNGA 5IG7A 4JQIL 4PP2A 5CJBA 4XH2B 4KXZH 2N7AA 5CZKA 2FEEI 1BBDL 5FHAL 4ZSOB 4KGLA 1DL7H 3DSNA 2A1WL 2J3SA 3V9FA 2MKLC 4L4VA 4OGXL 4LAQH 4U1LB 2OI9B 3UDWA 4YHZH 1PKQE 5ID1B 3ZYJA 1DQTA 3BVNB 2QR0B 4KJYB 2X7LA 2H32H 4HJJH 4MQTB 5GRWA 4P57B 3QWRA 1G6RH 4MXQC 1I7RA 4JFOA 5E9DE 4Y5YB 1RPQA 5HYSB 2GUOA 4QY8B 1AKJD 1QSFA 2EE9A 4X99B 2C9AA 5FK9B 1NFIA 4PJHB 1MRFH 4OZ4B 5E99H 4UI2A 1RIVL 1WK0A 1YY8A 4HH9A 4HWNA 2VQUA 2Z31B 4X4XB 1RUAH 5ELIA 3U6RA 3MNZA 2VZ1A 5SWQB 2F53E 5CEZH 3LRHA 1BAFL 3TH4T 3IFLL 5B3JF 3EZJB 4X6CA 5DO2C 4OI9A 1JGVH 3MJ7B 1WBXB 3FHQA 5FV2A 1J1XH 3O3UN 4WENB 4ZPVA 2M2DA 3MR9B 4Y16B 5TJWK 5CUSL 3VI4E 3RHWF 4JO4L 4PJCF 1T20A 4QOKD 2AGJL 4XWOD 3CVIH 2P43B 3FB7B 4QCIA 1MI5D 4NKIL 3TESA 3PV6A 4RISL 3WN5C 5IGXH 3TYFB 4PRDB 1F02I 1I3GL 2DYPB 3MCG1 1A4JA 4M5YH 4Z6AT 5I1GH 1JPSH 3IS0X 4X80H 4FQCH 4NIKB 1G0YR 1IFHH 3JWOC 1N2RA 5E1AA 1SMOA 3UTSE 5GGSY 2XN9D 3GI9L 3JWDH 2MCG1 4HLJA 1ZLUK 3LEVL 2DWDA 5C0BB 4GW5B 1QKZH 1QR1A 4MXWH 4S1DC 4LP4A 3RX5A 3LD8C 1KB5L 1J0IA 4LVEA 1C12A 4XX1E 2JTDA 3BXNB 4NZRH 1TZIA 1KACB 1FG2A 3N85L 5T1KA 5L8KB 2YR3A 3WJLC 3Q5TA 3GIVB 1NEUA 4HWZB 3EW3B 2KL6A 2IJ0C 3ELAT 3BP5A 1IC5H 4L1HA 3UJJH 4M5ZL 1IGIH 4R90H 4MNQA 2JIXB 3BMWA 4L8DB 1JPTL 3JWNC 2GITB 4KDTC 1ZLUH 2FBJH 3JV4B 4YHIA 1TPXC 1T5WA 3QXTA 3HG1B 1FYHB 2VQ1A 3QP3A 2HTLC 5F7DA 4CN4A 1CI5A 1KIQA 1I3RA 3LEYL 2ARWA 4G6AC 3QWQB 1QFWH 4K7PH 3O3DA 3EFFA 1KCKA 3EHBD 4LBEB 4JPIB 1RHHA 3NIDF 5I1EH 3KDMB 5D7IA 4QTHA 1A6UL 4LSSL 5T3XE 1UM4H 4GG6F 2JELH 1S7QA 2D0GA 3S37L 2FX9H 2HT3D 3UCRA 1MPAH 5F9OL 5DJ8B 5K33A 1RUQH 4P4KD 3T0EA 1YZZA 3L3DB 3M17B 3RVTD 2HFFA 5DGRA 2NY0C 1R3HB 1E6JH 1R3JA 1A6ZA 3DO7A 4ODBD 1MY7A 4ZUTB 1Z9OA 5SV3A 3V6OC 2VLLA 1NAML 4RRPG 4WUKL 1SYSA 2RIKA 1T03L 3BEVB 4WFEE 1T0MA 5HGDA 4XPAL 4Z0BH 4U33A 2NY7H 2KDGA 5E4EB 3VW3L 2C1PA 3VRIB 1KFAH 4TUOB 1PYWB 2BSTA 4UT9H 4W4NA 1T21B 4MQSB 5KS9A 5JXAL 1OGAB 2BVEA 4GKSB 4IOSD 2V17H 2WK2A 3ARGA 4DTGL 5AUMA 3KYMA 3KPPA 1HQ4B 1LDPL 4WU5A 2AXHA 1G0XA 2ADFH 5HHVH 4XMLL 5D7KD 3C6SB 5C3LD 1KBGL 4U7KA 3SY0A 2RCSL 4ZFGL 3KPNA 4UV4H 1Q9OA 2DLHA 4ZO8A 5B38A 3Q3GB 4IBLT 4M1DL 1Q9LA 3SGDH 1EFXD 1UH2A 4ZUUA 4AT6B 1HXYB 1F11A 1JJUA 1DBKL 3VXTA 3DROA 4MB4A 3HAEB 2NX5E 1C1EL 1TETH 2FLBT 4K7FA 3O2DL 1U3HC 3QUKA 4JO2H 3UTTD 4JFEA 5I74B 2X4RB 2B7DT 4X4ME 1NL0L 2VDML 2XQBH 1KENH 1AQKL 3HUJB 1H3PH 1VKXA 2M26A 1AQDB 3ZKXB 4ZMAT 4MQXD 2PO6B 1MLBA 3B9KC 2AJSL 4U4BA 4WY7L 4GRMB 1U93B 1J8HD 3EFDH 1JP5A 4UTAL 3MUZ1 5LWYH 5T1LB 1HINL 5FA3B 5KJRL 1TIUA 1YEFH 5HYFA 5HYSA 1A4KB 5JO5B 4YDKL 4BQBA 4BKLB 4QY8A 3KLDA 1GPOH 4KKLC 3D0VB 1N0XL 3TA3D 1AO7E 5HHMD 3VGBA 5IFAL 1I8IA 4PG9B 1CLZL 1EHAA 5T1DL 1CL7L 4JFFA 3QXVA 2MPAL 3ZMRA 1YYML 4HS3A 4Y4FA 5AEAA 3TNNB 1P2CA 4PB0L 4PJBE 4GQPH 5F88A 1QSZA 5DTFA 2E8ZA 3MBEA 3NTCH 4N8CL 1CXHA 3AVEA 3WFZA 1WBXA 1DEEB 4HGWB 3WS6C 1DQLH 5GGUB 3O6FC 4JM2D 4N8PA 2G5BB 2P1YA 5FYKD 4BFGA 2I5YL 4X8JB 2HT2D 3ARBC 5F9WC 2PYEE 3SHSA 4KJQC 2NYYD 4Y16A 1NCCH 3UYRH 1S3KH 4HKJA 2C3GA 2VIRA 4DKFH 1XR9A 5TE4H 3L5IA 5FHBH 2V5SA 4HS8H 3MOAH 3QT2A 4XP9L 4NO2A 3PWUA 4F15C 4HUUB 4Z5RB 1J05A 1LD9A 2OL3A 3MODH 5DLMH 3RU8H 1CDYA 3S9DB 4YGVB 3IKCB 3FQXB 2XKUA 1RZIB 2Q7NA 1P84J 2N56A 3V5KA 5ICYB 1U8JA 2GY7B 3RVWC 4U1JB 5TGBB 1XF1A 2AJYH 3HLAA 5AWNL 5I1CL 4PJ5B 1FE8L 4NN7B 3TCXA 2RFXB 2I26N 4J2XA 4HC1L 3GKWH 3BI9X 4R2GB 4N5UA 4HKZA 1FL5B 1MFDL 4FZ8L 4RMUA 4KKBC 1A7QH 3JWOL 3EJJX 4I18A 3C5SB 3BXNA 4L8SB 4X9FA 3MJ9A 3BKYH 5CEXA 1I9EA 3VCLB 4JFDE 2Y5EA 2GK0B 1LE9B 1H0DB 3LN4B 4OF5A 3VH8G 3SKMA 3CK0L 6FABH 5C0AA 4KK9C 3BWUC 1L4IA 5IVXF 4NQEB 3KYOA 2WLZA 4PY8I 3VXRA 1ZE3C 1ZANL 3QCVL 2GITA 4LCYB 1AR2A 1ZTXH 3R8QA 2YUZA 1Q0XH 2QADB 2OR7A 4KU1A 3SDAC 5HVHB 4KK8C 5ISZD 2KZWA 3ZE1F 3HMXH 1AGFA 3EYVB 4JPIA 4R4FL 3NGBB 4KRPD 2FJFB 2VZVA 1IAIM 4LSUL 3KDMA 5ITFA 3UAJD 5EWIL 4M61A 4POZD 3WL9A 4U1KA 1FYTB 4AIXA 3NH7L 1GAFL 3MOBH 4M7KL 2P5WD 4NO0B 2PF6A 3M17A 2HG5B 4XHQA 2GJJA 3P30H 3A6BL 1Q94B 5EBMB 1S7XA 1ZS8A 2ICWJ 3HTLX 3BZFB 1JF6A 1JFQL 4L3CA 5H8DA 1YPZB 4ZUTA 5FGCE 2DIBA 5ACZB 5F1NA 3ZDYE 3OL2A 2BVQB 4YPJA 4I5BB 1CD8A 3NA4A 2D9CA 4RX4A 4R97C 3SKNA 4X6DB 4HCRA 4LCUA 2Z93B 4K2UL 4EDXA 4TUOA 1YMME 4JQVA 4O51A 3CFIC 4QRRE 2CDGB 3BDBA 5EIIA 2HH0L 4OTXH 4GKSA 1O0VA 4PB9H 4ZYKA 1OLLA 3TZVD 5KSBE 2WWKT 1JGDA 4RIRA 3LZFL 3GM0A 1HQ4A 2B2XL 5FM8A 4Z7WF 4HH8A 1PVHA 5TDNB 5C0GB 4G80A 3B6SA 4ODSL 1A2YA 4YFDB 4ZAKA 1CFQB 5DQJB 3C6SA 4OFDA 2X05A 5IMOA 4AEHH 2NTFB 5GS0C 5HHOD 3FQWA 2X41A 1M7IA 1NCAL 3BE1H 2YOCA 2ZPKH 1I85A 3PWNB 1A0QH 3ALWA 3AAZB 3V4UH 1JUFA 3KPRE 4E0RB 1D5ZB 3U48A 4TNWK 1ADQH 3AM8A 3AS1A 4YZFE 1FDLL 4O2EA 2DQFB 2X4RA 3MRBB 4LRIA 1ZVHA 3INUH 1S7RA 4LSPL 3F7RA 5D7KE 3GJFA 2YN3A 1J18A 4Z7UB 5C8JB 4LARH 4P46B 3QSKB 1AQDA 3LN9A 4MXVE 4ZTOL 5CJ8A 1K8IA 3BDYH 3T0XA 1U93A 4NT6B 4YIQB 5BRZD 4WUUB 4DK6A 3NMEA 4YJZL 5T1LA 3DSFH 4M48L 3HPJA 4GAYA 1HHKA 4C56A 4NQDD 2H2PD 3H3BC 4NKMB 5HGBB 1LILA 1XGUB 4HZLB 1KT2B 4UAOB 2IAMD 1YNTA 4MX7B 4I2XE 4OLUH 3D2UA 2ESVE 1SEBA 3WIHA 1SVZA 1EHLL 2DTMH 3PJSB 4UV7H 5ALBH 1KJ2H 2BK8A 5DFVD 1ZLSL 3JBG7 3TNNA 5C9JA 4CGTA 3P2TA 4KRMB 1ZKAA 4L4VD 3GMPA 4RQQB 4OGZA 4KMTH 4WEBL 1J8HE 1MCJA 3DX7A 2JK5A 3IDGB 4IEFB 5FKAB 1I4FB 3UBXB 3W9DB 5D96C 5GGVH 1U8LB 5C86A 5IQ7L 1AD9A 4IOIB 4L29A 5E7FA 4JKWA 3QWRD 5D72L 4JFPA 1OW0C 5J3HD 3DETC 3E6HA 4XXDA 3DGGB 2GJ6B 4BSJA 1EX0A 3L1OH 5HHME 3HC4L 2JJVA 4WTZA 5D1QB 4PV9A 2MCPH 3SE3A 4LHJB 1LP9B 3H6JA 3KPMA 5EUOB 5TFSH 2IG2H 4YGVA 2V9RA 1RZIA 5DRZA 1R5WB 4U6YA 1EEZB 3MOQA 1FH5L 1MIEH 4EBQL 3EHBC 4YDJB 2C26A 2GT9B 4JQIH 3SBWA 1RV6X 4YO0B 2HT3C 4YBLC 3RAJH 2NY3D 1QQDB 3KS0J 1BBDH 4P4KC 2RHEA 4WI7A 1BLNB 3NOIA 3QAZB 3RVTC 4JHWH 2A1WH 3M8OL 2VWEC 4OGXH 3VI4F 4U6HA 3VCLA 2P44B 3EYFB 4YDIL 2ZUUA 2GK0A 3OTTA 4IMLA 5C2BH 1LE9A 1U36A 4Q9QL 3T4YB 1F8TL 4RAUB 3FCTB 1R5IA 4NSKA 3ZKMD 3P77B 3RWJB 1G7JA 4NQEA 43CAB 4ZFZA 4MA3A 3MV01 4EUPA 3HN3A 3LDBB 1UB6A 4N8VA 4KROC 1XF5B 1ACYH 3KJ4B 2L7JA 4LCYA 5D7JB 4U0RB 1CLCA 1RIVH 3Q1SL 5E5UB 5DK0B 4NHCL 2J7LA 1UZ6E 4K3DL 5C0EA 4Z77A 4J8RB 3QDJB 3IFLH 4IMKC 2FECI 4R3SA 4LLWA 4Q6IA 5A2FA 2FJFA 5EU3A 1A7RH 2OJEB 3G6JB 3OGCB 2APVA 5T1KD 1MCLA 4ZS7L 2HG5A 4XCYB 4B5EA 5D4QA 5CUSH 3FRUB 4JO4H 3BZFA 1AP2B 3DX9A 5I16A 2H32B 1YPZA 2AGJH 5CLTA 1BFOA 5EU6B 4MNQD 3X12B 5F6IB 3CUPB 4LMQI 3ZKND 3V6FB 8FABB 4I5BA 4NKIH 1T3FB 3ZYZA 4RISH 2E7HA 1QBBA 2BNUB 3I02B 5E7BA 2UZIL 1I3GH 2Z93A 4MQXC 3AY4A 4F7MB 2CDGA 4MDIB 4P2OB 1DUYA 1HILB 4U05A 2BP3A 1OAKL 1B4RA 3ULSA 4ODUB 2HLFC 2WBJC 3GI9H 2GEEA 4FOMA 5TDNA 1CFSB 5M94B 1DP0A 4ZOEA 2FR4B 5DQJA 2ERJB 4C55A 3KWWB 4JG1H 2EIZB 4QLRA 3T0ED 3BIAX 3TA3C 1KB5H 5L2JB 1DSFL 3X13A 3PWNA 4CVXA 1OF2B 4AIZA 3N85H 3AAZA 4FZEL 3LKQB 1S9XA 4K8RC 2A74B 2HTKD 3VXPB 1T66D 5GS0L 3C5JB 5FOBB 4M5ZH 4JM2C 1S9VB 4LCIH 5D8JL 4NUGL 1JPTH 2R0WH 4GO6B 3SKUD 5C8JA 3HR5A 3VMNA 1UFUA 3VXMB 4KRNA 1A6UH 4G8GB 5SX4I 4APQA 4FFYL 4AENB 1IQDB 4TULH 2C1OB 4AEFA 1T04A 1MVUB 2DQDL 3L95A 1RUPL 2VABA 5F9OH 1H9VA 3K4ZA 1XGUA 5DD5L 5IMMB 1IQWL 1YEIL 5IVZB 3H3KA 1RZFL 4N0UE 4XRCB 3S36L 1CXIA 2R4SL 5D6DA 5FDWA 1KPRA 1QO3B 4JFED 1NAMH 4WUKH 1ZEAL 1T03H 2DM4A 2FWOB 4XPAH 2BOCB 2R0ZL 1D6VL 4LDLB 3UPAA 3VW3H 3RNKA 4RQQA 3UTPD 4OZGE 4Y5VB 4D94A 5BRZE 2HJLB 5JXAH 4LKCA 5MEOA 4DTGH 3IJHA 4WRLA 5HGHB 5HHQA 1U8LA 3HE7B 2FX7H 1LDPH 5GGRB 4NQSA 1BZ9B 1UB5A 2DQIL 4CU7A 4XMLH 3DGGA 3PV7A 3WUZA 2J6EL 1KBGH 2FHCA 4F3FB 2RCSH 2F19L 4DN3L 3BP7B 3HA0A 1U91B 3B83A 5EUOA 2VAAA 1SY6L 4KUCD 4J4PA 4M1DH 4ODXA 4FFWD 5HYEA 4JFFD 2AJVL 2ZUVA 4X83A 2L7UA 1TITA 4P59H 2B1AL 4DGVL 4Y4FD 4IRJA 5HVWA 1DBKH 3I75B 5TDOB 2DQTL 1C1EH 4PGEA 1ORSB 3UAJC 4PJBF 5I18L 1IGMH 3MBED 3LRGA 3X3FL 4DAGH 4G9FB 3O2DH 4HPYH 1J0YA 1WV7T 4POZC 4YK4B 5FYJH 1QQDA 5BXFA 2WLYA 4I3SL 1NL0H 2VDMH 3W0WA 1KJ3L 4ISVB 2CJUH 3P9LA 1YQVL 5KANI 1AQKH 5HSFA 4Y16D 1GVIA 1TENA 1QSFE 1FVEB 4LLMB 3FONB 2R4RL 2GFBB 2AJSH 4WY7H 4BELD 3VFPB 1CGTA 4HK0A 2AK4B 4LEXH 3T4YA 4RAUA 5I15H 2IBGA 4UTAH 1WFOA 1HINH 5KJRH 1TZHB 3X17A 4YLQT 1FZMB 3CCHA 4GUPA 3IDJA 43CAA 1LK3L 4X6CE 2CDEA 2WNGA 2H2SD 1N0XH 3WUWA 3BQUB 4AG4H 2Z0BA 3ZDXE 1N6QL 5IFAH 1CLZH 1CL7H 1OSPL 5DK0A 2A83B 2BCKA 1KN4H 1JWUA 4J8RA 2KBGA 3TBWB 3BFOA 4PB0H 2YPVH 5CSZB 5A1AA 3NZHL 4N9GB 4LVOC 5HY9B 3EKCA 4R7DA 2YD6A 2XWJA 4N8CH 3PGCA 3G6JA 4UILL 3FTGA 3OGCA 2ZWLT 4NQCB 3GSUA 2Q8BH 1CDBA 1CG9A 3WCYA 4QT5B 3K81A 4PIRF 1MH5B 2Q76B 4EIZC 4Z7VB 3D39B 4OLXH 4GG8B 4U1SB 1HEZB 3B9VA 3LPFA 3UPRB 1OT1A 5C0AD 1I1YB 4EI6B 2JIXD 3DRTB 4XP9H 1DN0A 5ESVA 2VAJA 4XNZC 1NCTA 3VXRD 4NWUL 1T0NB 4P5KB 3IVKB 1P1ZB 2VXUH 3LN5B 1L0XA 4JRWA 3SPVA 5IROC 3QR2A 5KN5B 4KV5E 3NFPA 4FQXC 1UZ8B 2A6JB 4PJGF 5INDB 4K7PX 4P2OA 2DI9A 3U30B 2OP4H 1OGTA 1A6TA 2C7UA 3TF7C 5AWNH 1HZHL 3D18B 3BGAA 1FE8H 2VXTL 2PW1B 4YNYA 1DFBH 4HC1H 2EH7L 1KPVA 4HFUL 4MAYC 2IAMC 4HUKB 3ZTJG 4ZODA 3DWTA 4HIIB 5JNYA 3JWOH 1RZ8A 3LV3A 1OF2A 3K0WA 3EJYD 2MHAA 5DFVC 2YD3A 4N8VG 4GW1B 1ZT1A 2HJKB 4X4ZA 5IW1A 2A74A 2CGRL 3U9UB 1TVBB 4RX4D 4POYA 3CK0H 3PQYA 2V2XA 2EXYD 3RZCB 2UY7A 4PJ9A 4YEEA 4L8BB 5F9DC 3HMWL 4LEOB 4DN4L 5CHNA 3H0TB 4OZHA 3CH8A 3NPZB 5E8NA 3B5HA 1GOHA 3NBNA 4PJ7E 5JZ7C 5KSBF 5DURB 3VFOA 4NNXA 3NCJH 5J3HC 4GW4B 4K7PY 5GGRY 3T0EE 1OSZB 4ZAKD 5JR1L 4XVUD 4LLYA 1NC2B 3V5DB 1H5BB 2YPLA 2A9NL 5FYKL 3GUTB 2VUOA 4ONGH 1FP5A 3BGFC 3CXDL 4LSUH 4G8GA 4X7CC 1LVEA 1IQDA 5DJYB 5EWIH 2HRPL 2H8PB 4AQ1B 4OD3L 3U79A 3NH7H 1GAFH 5EFIA 3RTQB 1CWVA 4M7KH 4CVUA 5DDHB 1BVLB 1V8HA 4PV8A 2G2RA 4MLSA 1BD2A 3RWGB 3A6BH 4JN1L 1UXSB 5KS9E 5EPMA 4OAWA 2Z4QB 5DMIH 2NY3C 4PRIA 3JTTA 3B2UD 1QO3A 2XZAL 3OBAA 4NN5B 3EJZD 3KHOA 3FOMA 4M7ZB 4OCYH 2BOCA 3P0GB 3Q0HA 4KHTL 5HDQL 3BD5A 4DGYH 3IGAA 4Y5VA 4PRPA 2PO6D 3S5LB 2HJLA 1KN2H 4C4KO 3TJEL 2JCCE 1JI1A 5HGHA 5C0FA 1ZSDB 3ZKMC 3HE7A 1JVKA 2B2XH 2X4QB 5GGRA 3SGKC 5FFLA 3D69A 2ICWI 5T1LD 4U6XA 3PHQB 4OD2B 1SBBA 1BGXL 1YEGH 2WINB 2NNAB 4ODSH 1KC5L 1ZHLB 4C56D 3QQ4A 2ITCB 1E4XI 4F3FA 4NHUA 5D1ZA 2VDKL 3MLWH 3HKFA 4MSWA 4JFEE 2CK0L 3GI8L 3D2UD 2PR4L 1N4XH 3GZKA 2UUDH 4NUJB 5C0CA 1R3LA 4D8PA 2VN7A 3IU4L 4XCFH 3UTPE 3S35L 3S34L 1WC7B 4HMCA 1JNHB 1FDLH 2ATKB 1K4CA 5I71C 4ISVA 1DQJB 3H7BB 3MLTA 1ITCA 4LSPH 5FDYA 4N0CD 4TNVF 3VGEA 1S9YB 1ZT7B 3RUGB 3RWDB 3ARFA 3DVIA 1A7NL 4ZTOH 5JQ6H 3ZKNC 5TQ0L 3TBYB 3KPTA 4PY7B 3KPSA 4LGSB 4LNRB 4KAQL 5E8OA 1U8QB 4JFFE 1LO3L 1MREL 1JPST 4M48H 1G7LB 1TZHA 3OV6A 1VGKB 5I1DA 4FQJL 1QTYT 4HAFA 2NLJB 3MZTA 5DMKB 5FO9A 4CN1A 1GC1C 4Z7OE 5H2BA 2J4WL 1EVTC 4JG0L 2W0FA 1HWGB 4W4OA 3FZUD 2HA1A 2J8UA 2VITB 3FFCB 2JJSA 1EHLH 1CD9B 1I3UA 2A83A 3T0EC 4R2GD 1KCRL 3LMJL 3QUZB 1ZLSH 3CFKB 3SE8L 5I17B 2Z35A 2HN7A 1HHJB 3MRQA 3QUMH 2DM7A 1V7NL 1NKRA 1P84K 4WEBH 1I7UB 5H37G 1WWCA 2OQJB 4XB8A 3BP6A 3CJJA 1NFDE 2A6DA 5DVKA 3D5OF 3V8OA 2HTKC 1MH5A 3VFVB 2YRPA 4EQ3A 3D39A 1T66C 1W8NA 2BRRL 1HEZA 5IQ7H 3VFWB 4HG4K 4HWBL 3SO3C 4HPOL 4KKAC 3DRTA 4JHAL 4NQED 3VXUE 4XVTL 2VN4A 3SJVB 5DHVA 3HC4H 1A6AB 5T3XH 3VGGA 5FOJA 4D9LL 5BV7B 2ZUSA 5KW9L 3P4OA 5IB1A 4DZ8A 1ZHNA 1UWGL 2DM3A 2QKIB 3BHBB 1F90H 2E7LA 4EBQH 4JZJA 2IH1B 2X42A 3MNVA 4KDWA 1IBGL 1KJ2B 2B1HL 4P48A 3D18A 5IW3A 5SWZB 1WUNT 4NO3A 5DJ2A 3MGOA 2DLIA 1FL6B 1FL3A 1MHCA 2XY2A 4FQ1L 5C0AE 1YMHB 1RZGB 4O2FA 4MNHB 2AEIT 1EK3A 3LH2L 4FQHA 3VXRE 4BK4A 1BVZA 3VXSE 1KXVC 1LO5B 4I4WA 1ACZA 1XGTB 4HV8A 3Q6GL 4OV5B 3JSSA 4Q9QH 1FNEB 1QHPA 2BOBB 4CADA 5J9PB 1UM5H 3U9UA 4LLQA 1F8TH 4UNUA 4WWKB 1BJ8A 3DYOA 4KI5D 4ELMB 1INDH 1E4WL 3TO2B 1TXKA 3GBNL 2PCPB 3RZCA 2OI9C 2ZNWA 5D2LB 3PWPA 3QJFB 1JCKA 4X7SL 2P5EB 5DD6A 3OB8A 4OIBA 1EMTL 3MRRA 3FRPG 1U42A 4WEUD 4LEOA 4Y4HA 5C2UB 3NZ8B 1UYWL 3SE9H 5ECJE 4RGOL 1FZJA 5AG8A 4Y8AA 3Q1SH 2P8LA 1RZKC 2F54E 1X4ZA 4PJFB 4QHMA 4XBGA 4HUNB 2Y6SD 5IFHL 1IAIL 1IM3B 3V5DA 3FQRA 2D7MA 1TCRA 3DV6A 4FFWC 3RWCA 3STZA 3N1PC 2QBWA 2OTWB 1IC7H 2Z31C 2HLAB 1MFCL 5DI8B 2H8PA 1MCPL 2XFXA 5DEGA 2GKIA 4Y4FC 4GLRI 5FKPB 1V7MH 1BVLA 4C54A 1QFUL 4ZS7H 5FAAA 1AIFB 4OZIB 1CLOL 3MBEC 1YA5A 2QQLL 3ECBB 2Z4QA 1A6WL 3RWEB 1MUJA 1KNOB 1UQSB 5C07B 4XAWH 5I1JL 3FN0H 3QG7L 4GXVL 4Y16C 3SCMB 1K85A 4P3DA 3EYUH 1JF5A 5TDPB 3CDGA 1M1SA 2DICA 2NY1B 2EC8A 5ESAA 3PIQA 3WFBL 3JV6B 4IRSA 3HZKB 1IL1B 2VXVL 2YWYA 1N0LA 3DOSA 3RRQA 1BQHB 1NDGB 43C9A 4Y5XA 4MZ2A 4APQD 4OD2A 3U0TB 2WINA 4MJIB 2ITCA 5E2TH 5FM4A 2H2SC 4CKVX 1GOFA 3VRJB 2YBRB 5C3TA 3CH1A 2B0SL 5DVMA 1CCZA 4RZCB 1WSST 5FYKU 3VGFA 1WTGT 3HRPA 4NUJA 1P7QB 3GSQB 2CH8A 3ZSTA 4FZEH 5GGTA 1KGCE 1NBQA 2GSIB 2O5YH 4EN3B 1DE4B 1WC7A 1H15B 4I18C 4MA1B 5FO7B 3VE0B 3S96A 3TBVB 4OZGF 1NBYB 5IVOA 3CZJA 4P5TB 3SDXA 3WFCL 5IHBA 4P4RB 4C56E 1CGUA 4Q97A 3FB8A 1U3JA 5DHYB 3QRGL 2VTFA 3TBYA 1LO2H 3W5NA 5EUKA 1FNHA 5KVDL 2Q6WB 3BRFA 4WI3A 2XKNA 1OAZH 4J4PD 5ENWB 4X6EA 1KB5B 3IRPX 4QXUL 2DQDH 3S88L 1RUPH 1L7IL 3OKDA 4IRJD 1YNLL 4PS4L 1IQWH 4OFPA 1RZFH 4QHUA 2EDFA 4O2CB 5E2UL 3BRGC 1HNGA 5I75C 2OZ4H 5CZXD 4WO4B 3FFCA 5KOMC 1JHLL 1ADQA 3MROB 2OLDA 3VG9C 3BH9A 3W0WD 1CDGA 5DVOA 3DMMB 4UU9A 2R0ZH 1RU9H 4LPTA 2LTQC 2V5RA 2YA1A 3EJYC 1GC1L 1Q72L 4Z78B 1N5YL 3UP1A 2KT7A 4KZEL 4WHYH 3DTXA 3CX5K 3BISA 2EXYC 3VFWA 4GMTL 1VESA 1WEJL 2BNRB 4JQVC 2Y06H 3L7EB 5A2IH 1JRHI 2W65A 2J6EH 4JJ5A 3SJVA 2IC2A 1CXKA 5E2WL 2P24A 2F19H 4DN3H 1B88A 1NEZB 5DJCA 4JN2A 4MD5B 3F58L 1U3ZA 3ZE0E 4ZAKC 2YXFA 2QKIA 2AJVH 3VD7A 3ZDXF 2DQUH 2B1AH 4DGVH 5JIPA 3GMMB 1NAMB 4PJCA 2BC4B 1NBVH 4U3HA 3V52L 5I18H 1EEYA 1Y6KR 4U1GC 3NAAL 4UIKH 5CD5D 1JYWA 4HXAL 2NY5H 4I3SH 5GRUH 4M8VA 1L9MA 1NGWA 3RX7A 1V3KA 3JV0A 1RIUL 2VB5A 3MX0A 4YHYB 3ROLA 1JNNL 3KXFB 1MCOL 4BH7B 1MCDA 1N7ML 2J88H 4NRXA 4C58B 4LRIC 1T89A 1NGZB 2R4RH 5F6HJ 3EJZC 4OV5A 2MMXA 3OG4B 3P9MA 1FNEA 4WW2B 4CN6A 4AM0B 2JKXA 3JVGA 3BZ4A 4JB9L 3NCEB 1MAKA 3CSYB 4J6RH 3ZKXC 2PO6C 3S4SB 3P0VL 4K94C 4UQ3B 2P5EA 4KI1A 5LQBL 1LK3H 4GRWH 2VJXA 4YE4L 4P2OD 5BJTB 1NQBA 3QEQB 4IRZL 5MEPB 3NZ8A 3GFUA 3QZWA 4PR5B 4RFOL 7CGTA 5LXGL 1N6QH 4CVZB 5CS7A 4ZNEA 2KH2B 1JBJA 4HLZG 1Y0LB 1FORH 1DDHA 1IM3A 2B5IB 4I8DA 3PGFL 3KNBB 5C7XL 3NZHH 1HH9B 3QEHB 5ICZA 5ETUA 3NACL 4RAVB 5BS0E 2D9QB 3B3IB 2R8SL 2EDRA 4G43B 2OTWA 4JPVL 3DVGA 4UILH 3ARXA 2CMRH 1EHNA 1CE6B 5L88L 1RZKL 3OF6A 4KI5E 4BQCA 4JO3L 3G08B 4ERSL 5A2KH 5EBLB 3VFNB 3PQYD 3SOBH 4J7RA 5E94B 1U92A 4PJ9D 2BY1A 3T2OA 4QRPE 4MMXC 4WHCA 1UQSA 5C07A 3W9EB 3SO5A 1SMAA 5I76B 4N0CC 4GG6A 3IJSB 4TNVK 3SCMA 4HDIA 3L3HA 2KPNA 3GMQA 3TCLB 1TTFA 2XTJD 4KPHL 2F9BT 3BKJL 3AXLA 4WDIB 4PJ7F 3HZKA 3EOTL 4XNMB 1EAPA 2I25N 1XH3B 2QV2A 2NXYD 4UZGA 3MRKB 3O4LB 2AKRA 3U2SA 4QHLA 5I1AB 1A7PL 2HWZL 1N6VA 4G8GD 2Q7YA 1YEEL 5LKNA 1QBAA 1BX2A 1B90A 5CWSA 3U0TA 1MCIA 5DF0A 4LGRB 2Z8RA 2VDPL 5E70A 2EH7H 2FIKB 1ZLVK 1J5OL 3RKPA 2EE2A 3OKEA 4HFUH 5EOCJ 5JMOC 4HUWB 1OB1A 1NUDA 4GT7A 3SBWC 4QHNB 1BD2D 2OL3L 3FZUC 4UDUA 4NN7C 4ZUSB 1Q0YL 4PRID 5K9JL 3GSQA 1HSBB 4R2GC 2CKNA 3MQIA 4LCWE 1AI1L 2ATPB 2AABL 2BVUA 4X0KA 2WUBH 4Z7WB 2CGRH 3C09B 4HJGB 4OQTA 2A6IA 4ELKB 4L5FL 4L8SC 5DQDL 2GI7A 4JANA 4PGBA 1CVRA 3BMVA 3TNMB 1XR8B 2OTUB 4PRPD 5KSAA 4PJEE 3HMWH 2ARJB 4NBZB 3PHOA 1YEDA 5FYLD 1QP1A 3SGEI 4E9LA 2FATL 1ZLVH 3V4PH 4P4RA 2WWKO 3TT1L 1X5KA 2JCCF 4LVHC 5CJXA 4ZO7A 1UADC 3HE7D 3QQ3B 4FABL 5DHYA 3DX6B 5J12C 5JR1H 3HCVB 3MJ9L 2CK2A 2A9NH 5FYKH 5D1ZD 4UUJB 4D9RD 2Q6WA 3AROA 5HYJA 3AREB 5IEHB 4DCQA 5IJVA 4RFNB 4OD3H 5L2KA 1NBZB 4ZOCA 5I30L 3MJGX 3NGBC 1VSCA 4OF7A 4JN1H 4O2CA 1RJCA 4WU7A 2NZ9D 2R1YB 3T08A 3WFEH 3GMNB 4YDVB 3MROA 2AEQL 3GO1L 4BSVB 3LD8B 1JGEA 1S5IH 4HIXH 1G9MC 1VACB 5A16A 3REWB 5CD3A 4J3UA 3T3ME 2DI8A 3O2VL 3WV0A 4A6YH 5HDQH 3LAFA 3IB4A 4XC1L 4I9WD 3ARFD 5F1IA 1K4DB 3FFDA 1P4BL 5DYOA 4LKXB 1D9KA 4HFWB 4JFXB 2ITDA 2QSQA 3A67H 1A3QA 3KPSD 1QA9B 2J8HA 4TVSa 12E8L 3RDTA 1PLGL 5CCKL 3OKLB 2JLLA 2AJ3B 1BGXH 5AD0B 1KC5H 2CDFB 5F1KC 3HB3D 5F1OB 5KSVA 3F5WA 1U8PA 2XQYG 1PG7W 4V2CB 2VDKH 2QQKL 2FIRT 5JW4R 3C5ZB 2IADB 5AZ2L 4R8WH 1E28A 2WUCL 1OAYH 2CUIA 4Y7MA 2CK0H 4MD5A 2PR4H 3W0WE 1GIGL 2Y6SC 5J7CC 4HCRL 3ZDZF 1PKQB 5A2JH 3BSZL 2OSLA 2DQHL 1H3TA 2X4SA 5IKCB 1SYVA 1GYAA 3D0LA 5FECA 3JV5A 4XVJL 5E9DB 1G9EA 1IEHA 4YBQD 1WAAF 2AQ3A 5E5MB 3VMPA 4PBVC 3MREB 3C9NB 4Y4KA 3OX8B 1NFDF 3D39D 4PTUA 4R4BA 3C8DA 2DRUA 2EEDA 2E6JA 2R0KL 4XP5L 1S5HB 2XIDA 2XNAB 3O3BA 3MRGA 4NKOB 1NGZA 2XICA 2F53B 3EYSL 1P4LA 4KAQH 2SEBB 4L8CA 1LO3H 1MREH 5LGHH 3VXOB 2PYFA 4NRYB 3WDHA 2NW2B 3P4MA 4QWWD 1IM9B 5JLZB 2FHBA 2X70B 5L7XL 4QF1A 5C0NC 4JG0H 4FTVA 4QRSB 4APQC 1CU4L 1M4KA 4Z76A 1YN7B 5I66A 4ZFFB 1VEOA 3IAGC 4M8QB 4ENED 3MJ8B 4TTGA 4OCWH 1BOGB 4LLUA 3CFDB 3T0DA 5IOPB 4JVPA 5DT1H 2N1KA 4S0TD 1FV1B 1KCRH 3LMJH 4K94L 4UAOC 5HDBF 2FDBP 3SE8H 4DZBA 1CL7I 4ZQKB 5BOPA 5IVXA 3CFBB 2R1WA 3VG0L 3RGVA 1V7NH 4HGKC 4G43A 2DAVA 3FO1B 3KPLB 3WE6B 2C4FU 5D6DC 2OK0L 3L3IA 2P8MA 3BD4A 1CE6A 1GZPA 3F65A 3BO8A 3TC9A 4U7MA 2OS7A 3LCYA 1A22B 4QNPE 3LSOB 1JGUL 5EBLA 3VFNA 4HWBH 5HBBA 3RZCD 4WNQB 3PWPD 4HPOH 2X40A 3HNSL 3N1QC 4JHAH 4OCLC 4F2MA 4XVTH 4FXGB 4EOWL 1E27B 1NMAL 3DECA 2UVFA 2D7PA 5I76A 4Y4HD 3EUUA 5ADPH 3CDCA 3TCLA 1G1YA 5C0IB 2UYLB 3ARSA 3B9KB 4G8IB 4FA8A 1KXTB 5C08A 1UWGH 4WDIA 1ONQB 1Y6NR 4XNMA 4IM8A 3OKMB 1NC2D 3TM6A 4OCSL 1IBGH 1FLRH 3I3EA 3VFTA 3G5XA 3O4LA 2X4NA 2J12B 2LABA 4J4PC 4UINL 1FIGL 3GMLB 4HKBB 3KYNB 2FIKA 3QUMB 4O02H 5HVGB 2C3WA 5EU4B 2FEDD 3AU1A 4HUWA 1RK1A 4JRXE 3D25A 5I1KH 3PQYE 4KTDH 1HCVA 2ICCA 4JFHD 4QHNA 1G7QB 1I8LA 1IGFH 3QCUL 4MD0B 4MWFB 2CUHA 5CZXC 2YZ1A 1MJUL 2H1PL 1T22B 5DR5H 2W92A 2GHWB 3LH2H 3TN0B 5CSGA 4OZHE 1U8OB 1EO5A 5JHDA 2XTJE 1P5VA 3Q6GH 3QAZC 5ICXA 1GGBH 1HH6B 4NJ9L 4Z7WA 2EDBA 4XPBL 1INEL 2XG4A 4H1LH 2W60B 5FM5M 1E4WH 1QSEA 3OAZK 3I85A 2H9GA 5J57B 3TNMA 2YPLE 1X5ZA 1IGYB 2OTUA 3ARBB 3I3BA 3GSVA 1W0WB 4JZOB 4IRSD 4D0DB 1EMTH 2NTSP 3P0YL 4PD4J 1NCUA 1UYWH 3QNYA 3OXSB 4RGOH 3ZT7A 1WTLA 4TQEL 1KYOJ 1F58L 4F15B 4XNQB 3V95A 1IAIH 5IFHH 1JZ3A 4OV6F 5T5NF 3KJ4C 3HZVB 5M95B 1I75A 2VERN 4PRIE 4U0RC 3VDAA 4PRNB 5I2IA 4E5XB 3V4VL 5IEHA 4ZO9A 5J89A 2VZUA 1DLHA 2D31B 2HVJA 3G5YB 1CK0H 1M71B 4OSUL 3VWKB 5GGQL 5EU7E 1QFUH 1EA9C 2D03L 1CLOH 4BUGA 4PRPE 2EYRB 2FBOJ 4CU6A 1ZVSB 4X4YB 3TGXA 3ZZ1A 5CD5C 5IJKA 5FYLE 1S7TA 2ZNXA 3GMNA 1YEHL 4FQIL 5IBUG 5I1JH 3QG7H 3RIAK 4GXVH 4I0PB 4X5XB 1MHPL 3SDCA 4MZ3A 3UZVB 2DS4A 1EJOL 3BPCB 5IFJB 3WFBH 3WSQL 3PP3K 1YN6A 4FFZL 1S7UA 4AY0A 1P69B 2NX5B 5I8CB 3MV7A 5C0CE 4BQ8A 1Q8MA 5E95B 4PTTA 1G9ML 2KKQA 3OKLA 4TPRL 5DQ9A 4B7IA 4XP1L 3JTSA 3OAUL 2CDFA 4P2OC 5H94B 4I3RL 1I7ZA 4S1QL 1KG0B 3VD5A 3LKNB 3R1GL 1A6VL 3IDNB 1UEYA 3FOLA 3VD3A 3FFCD 2NY2D 4L9DA 3ES6A 4BK5A 3ARDA 4I9WE 3PP3H 4NYLB 5TF0A 2AJZA 2A6KA 4XBEL 3R06A 2ZJSH 4WFHD 5E9DA 5TE7L 2FNBA 2YUWA 4X5WB 1BM3H 1TJHL 3C9NA 3O6LH 4QRTB 5F8QC 3OXRB 3WJJA 3WFCH 1KPUA 5E4IA 2EDDA 1J0JA 5IWLA 3CFEB 4AH2A 4PJ9C 1S5HA 3D3VA 2A2QT 1CIDA 4N1EA 2DIAA 3QRGH 4MHHI 4E42B 1MCWW 3O0RL 3SJVD 4PJBB 2J8UE 1U8MA 2CIIB 4ZO6A 5KVDH 2ZCKL 4F9PA 5CGMA 3IDIA 3UO1L 4N0YL 4NRYA 2YPKA 3GSNA 4NJAL 5E8EB 4QXUH 3S88H 4P2CG 1FFOA 1KJVB 2G75A 5HHNB 1DQML 2NXYC 3HS0B 4K3EH 1YNLH 2PYEB 3BUYA 4PS4H 1PZ5B 1KTLA 5E2UH 1F5WA 1BWMA 3PNWA 3MUJA 3CFDA 5DEFB 1MCBA 1QNZL 4L9LB 4QRUB 2LU7A 4Y2DB 5D2NA 3KYAA 1EUTA 5BZDB 3RFZC 4KJWD 4WJ5B 2X4PB 2EEAA 3SKJL 4CMMB 3BP4B 1GC1H 1Q72H 2VLJA 1ZGLB 4BSWB 3GM8A 4JFZL 1U8HA 3SGJA 1X5AA 5LJYH 4KZEH 3QA3B 1ZVYA 4XNXL 4JKKA 3EDKA 1QEWB 3UTSA 4OKVB 1T2JA 5EU7C 4GMTH 1WEJH 4Y5VC 1LEIB 3S7GA 3MXWH 2P5ED 1IC4L 1OL0A 1E27A 1YYLL 5IMKB 1JI2A 4QOKB 1S9KC 4ONFL 7FABL 3HE7C 4IS6B 3FQNB 3CX2A 3FL7A 1QBLH 3T3PE 5CEYA 3BIKB 3T77A 3F58H 1VERA 4F7PB 3V2AR 1QOKA 5IW6A 1KIPA 1QRKA 5DA4A 3W2DL 4JFDB 3TJHD 3OKMA 2IBBA 3I6GA 2UWEE 3H9HB 4J1UB 4DFHA 2OJZL 4LQFL 3V52H 1N64H 3U4AA 5KSUB 3NAAH 3VWJA 4HKBA 2F15A 3QHZL 4EQ2A 1ZGLP 4NOFA 5JHLH 2YA0A 1JTOA 3OF6D 4MCYB 1CXLA 5TH2B 5MERA 1PSKH 1JNNH 4JHBA 3RVVD 3MTRA 1MCOH 3PWPE 4LFHD 2NZ9C 2V5YA 4YK4C 4EVNA 1FBIL 3O3AA 3GBMH 4CW1A 5B4MD 1U8OA 3BESR 5JDJA 1KLGB 5C07D 1UACL 3REVA 1HH6A 3I6LD 1JV5B 4Q74A 3GHEL 3CSPA 4JB9H 4ZTPH 5HI4D 2GCYA 3RWIA 3SCMD 3QDGA 1QFOA 5IBTL 3ARFC 4NO5B 3NCMA 3BN3B 4TRPL 4NKDA 3P0VH 2Z91B 4QYOA 5LQBH 1DQDL 3IAQA 4YE4H 3R8BB 4IRZH 3G6AB 4M7LH 5C70A 1QLFB 25C8L 4FQPA 5LXGH 3HZYA 2ZOKB 1HYSD 3FO0L 4JFHE 1KTKE 4WI9A 1XIWB 3Q6FB 2R29L 2EICA 3RY6A 2X9YA 2JJUA 5C7XH 5JW4Q 4KQ3L 4W4OC 3NACH 3W11D 4PRNA 4JPVH 2JJSC 1YMMB 3MRJA 2D31A 5L88H 1RZKH 2OBGA 3C08L 3G5YA 4YHPB 2YZ8A 3BKML 3VWKA 4JO3H 5KSBB 1PAMA 4ERSH 1KF9B 1AXSB 1ZVSA 4P4KB 4YBQC 1RJYA 1UVQA 5KSAD 5CP3A 1FZKB 1CICB 4U1NB 4TSBL 4PJEF 2A0LD 3L5WB 1TQBC 5MHSE 4KPHH 2AK1L 3BKJH 2YRZA 5JQHC 5FO8A 1LDSA 3EOTH 4Y0GA 2X4TA 3HE6A 1F3RB 3W81A 1UXWA 3MFGB 3DURA 4U31A 2NCMA 4ZSOE 5DD0L 5BO1L 5HYJD 1A7PH 2HWZH 1YEEH 2HFEB 2VDPH 4QWWC 2E7LC 3N1FC 3U30C 5ID0B 1J5OH 4JZJC 5L2KD 2HT4D 4QRQB 4DOHE 3S36X 2RJMA 2VSDA 3BZEA 2OL3H 3IDNA 5IHUH 4ENEC 4LSRH 3PWJA 5K9OB 5GZOC 1MRFL 5CJQH 3P73A 4MCZB 5JIIA 5E99L 3EO1B 1AI1H 1TMCB 2AABH 2ICWA 3IFNL 1EFXB 1KB9K 1RUML 4L5FH 5DQDH 1GHFL 3RWHA 3T3MF 4X5WA 5EB9A 1VCAA 3DARA 1JGVL 4R6UA 2FATH 5GSRB 1EHXA 4I2XB 1AO7A 3RDTD 1HXMB 4BH8B 3RZCC 5HYQB 4RA3A 4GKOA 4FABH 3O3EB 4PGZA 4H0HB 3ILPB 3MJ9H 4E42A 4JLRB 4Y4HC 4NRZB 1MHHB 4V1DE 2F5BH 4PJBA 5F9JB 3CVIL 3BH8B 1GH7A 1IEBA 1REIA 1J8HB 4P3WA 1H5BC 3UBXG 4WFHE 5I30H 3VRLF 5B21A 2PYEA 2ZUQB 4FQQB 5I1GL 5CAYB 4X80L 1IFHL 1IAKB 3HFML 2FEDC 4L9LA 3TA3B 1S7VA 4B53A 3GO1H 3K4DA 4Y2DA 5IB2A 1BZ7A 5HHMB 5BZDA 3WHXA 1ROWA 3EGSB 3QQ9C 4Y4KD 1TJIH 1WWBX 2X4PA 4HJ0D 5B3JE 3WFHA 1IGJA 4CMMA 4YHMH 3O2VH 5EO1B 4TTDD 1JWMB 1ZGLA 2NY4B 1E4KA 4BFIB 3VU2A 2Y5TB 4YFLF 4XWGL 1JTTA 5EBGA 3MRLA 5K93A 4NN5C 1QVOB 1F2QA 5IIEA 4N68A 3T65B 3QA3A 2APTA 4M00A 4M7ZC 12E8H 1LEGA 4NZRL 1QEWA 2V2TA 4OKVA 3OZ9H 1PLGH 5TF1H 4KQ4H 1LE5A 1FVDB 3BWAB 4NZUL 4JE4B 3MRFA 4IRSC 4PJCE 3FO9B 4MD4A 1IC5L 1OQXA 3WDJA 1RULH 3A0OA 4KH2A 2WUCH 1EVUA 3ZLQC 4Y5XC 2Q86A 4FTVD 1HSAB 3QDME 1KTRL 5T3ZD 2OCFD 1OOAA 4DUWA 1ORQA 3QNZA 1HOCB 1I9RL 3BSZH 2DQHH 3GB7A 1FC1A 3V7AG 5BVJA 3TV3H 5FYLL 4W70A 3FQTA 1R3KA 2GSGB 3RGVD 4I3GA 4K7PL 4DUVA 4A6YB 1RFDH 5F7YC 5C0JB 1TVHA 1A3RL 3O8XA 5I1EL 1UM4L 4OLYH 2JELL 4XPGH 3GJFK 4U3CA 2VOTA 4ALAL 4MJ6B 1MPAL 4PJGA 4XP5H 1UKSA 5KANG 2VLRE 1X9QA 2C3VA 5C6TH 2BHZA 5DJXB 3ULVF 4ZNEE 5DVLA 3DI2B 2WWMD 3QFDA 4HUVB 5F70A 3W39A 3VFRA 2ED8A 5C08D 2AQ2A 5HHPB 2Z91A 3FKUS 5DD3L 1HI6B 4F58L 2H3NB 2NY7L 3FB5A 5J06A 2ZUWA 2VLME 1M6OA 3FAXA 3QG6B 3H42L 5L7XH 3DGCR 4TVPD 3BW9A 2X09A 1I3VA 1EDQA 2E3VA 4UT9L 3O4LD 1TNMA 2CRZA 2BXYA 3GJFH 1M7DB 2V17L 1XIWA 1F13A 3H3PH 4K94H 1DUZA 4M6AA 3EO0B 1T4KA 2KQNA 3UTZB 2BMKA 3KLAB 4HMEA 3VG0H 2NY2C 1YMMA 5HPMB 4GG6E 4O00A 4KRPB 3WFDL 4YFEA 4QRRA 3V7MA 3PDOA 5JHDD 4MB5A 1GGIL 2J1KA 2BSSB 1BIIB 3L3OA 5KSBA 1OM3L 1I9IL 2VH5H 1J11A 1ZA6A 2YD5A 1JGUH 4P99A 3S3JA 1AXSA 2IF7A 2P5WB 3OKKA 2BZDA 2I9LA 1QSED 5AYUL 3U36A 3HNSH 1CFTA 3MRCB 3WIHH 4EOWH 3KGRA 1CICA 1X5IA 4M01A 4U1NA 4KZDL 3MO1A 3WHE1 4JO2L 4FS0A 4KJPD 5D7LA 2XQBL 3GSOA 2YC1A 1C16A 1ZHKB 3O11B 3KPRA 3QISA 5BV7C 2X9XA 4UINH 1FIGH 4M4PA 2FJGA 2XWTB 3TZVB 5BQ7A 3EFDL 1WFTA 2WIIB 3LKOA 4V2BA 2LAAA 5LWYL 1JZ6A 3GSXA 1C7SA 3CFJA 3QCUH 2EDNA 2YSSB 2EH8H 1OARH 1NAKL 2JB5L 3GSWA 3L3KA 1GPOL 4L3EE 5K9OA 1U95A 1WISA 4BQ9A 4MCZA 4G42B 1LMKA 4KJWC 4LVOB 5LBSH 1WCBA 1WFNA 2G9HB 4JRYE 5E1HB 1TZGL 4XPBH 3CLEL 5EBWB 2VLKA 4P2RE 3SDCD 1WZ1H 3ULUE 1T89C 5DJ0A 1N5AA 1HYRC 3EAKA 1C08B 5HYJE 3RPIA 5J4MA 3NTCL 2Z8VC 3R0NA 3JVGC 3PL6A 4WWKC 1DQLL 2EZ0D 3MV7D 2DLFL 5J1AA 5L2KE 4TQEH 2ESVA 1F58H 4QXTB 5HYQA 2P45B 1NCCL 3WS3A 4JLRA 1S3KL 2V7NA 4U1IA 5TE4L 3GGWA 5FHBL 5F7FA 3MOAL 3TVMB 3ZTJH 1ULVA 4KK6D 2COQA 1P7KB 3V4VH 3V0WL 3MODL 4OZGB 3PABB 4HULB 4DW2L 3TJHC 3RU8L 5BRZB 4YBHA 1N59B 1G9NH 3UTQB 4PRBA 5EA0L 5GGQH 1S8DA 3ARDD 4EUPH 2EDJA 1W2KT 2D03H 4NQDB 4KC3B 1JZ8A 1JF1B 3ARZA 4OCXL 2W9EH 4NQVB 4NQUA 4H1LB 2AJYL 3DV4B 5E9DD 2IAMB 1FNGB 2W9DL 1YEHH 5IG7B 1J86A 5DJZB 4FQIH 1CLYL 4B50A 3LRSA 4LPCA 3VFSB 1SBSL 3RVVC 1YDPA 1B0GB 3GKWL 1EJOH 1MF2L