4M02A

Middle fragment(residues 494-663) of the binding region of srap
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
169
structure length
169
Chain Sequence
AVTQVRYVDVTTGKDIIPPKTYSGNVDQVVTIDNQQSALTAKGYNYTSVDSSYASTYNDTNKTVKMTNAGQSVTYYFTDVKAPTVTVGNQTIEVGKTMNPIVLTTTDNGTGTVTNTVTGLPSGLSYDSATNSIIGTPTKIGQSTVTVVSTDQANNKSTTTFTINVVDTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine-rich adhesin for platelets
publication title Structural Insights into SraP-Mediated Staphylococcus aureus Adhesion to Host Cells
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Calcium binding protein
total genus 45
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2013-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m02A02
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 4m02A01
5LGJA 5CLWA 4FQXC 3TPKA 2E8ZA 3VFMA 3OKDB 4XNZB 1WLHA 5CP3H 4Q74A 3KPLB 2BHUA 1H0DB 4DAGL 3T4AA 4F37F 3HUJA 2KKQA 3VH8G 4Q6IB 3VRIA 4C54A 3MLRL 5HTSA 2QL1A 3CNKA 2COQA 1EIBA 4BFBD 1TPXC 2ADFH 2V7NB 2AXHA 3RGHA 4QOKB 1CD9B 4IRSD 3N06B 5FECB 4KRNA 4ZUWA 3FB8A 2GITA 1DSFH 3WJJA 4I48B 4XWOD 5F3HB 4R4FH 3IDXL 4HSQA 3WN5C 3BN9D 5DK2A 3ARGB 1XGTB 2W60A 3IXTB 3QA3A 3PQYE 5KS9B 1RUAH 5I6XB 5TDOB 1PEWA 5I16B 1MWAB 2IAMD 4NNPH 3ARWA 2XZCL 4LLUB 3IF1B 4FQ2L 3MV7A 2X4QA 1RUPH 4XAWL 4JCMA 1SJHB 3MV8B 1E4XH 2OJZL 3VGDA 4O51A 1G6RL 1WFTA 3WIHH 5HBBA 1P4BL 1KJ3H 5DHVA 2OR7A 1IM9A 1S7SA 1T4KA 4HBCH 4MNGA 2VDKH 4Z7UE 1KB9K 2B1AH 3IDMA 3RGVB 1P4LB 2FJGA 4UILH 4M4RA 3SO5A 4Q9RH 3EBAA 3UTTA 2NY3D 3OKNB 4QKXB 1K4CB 5M95B 5BW7C 2YRPA 1F11B 4JM2F 1MJJB 4N8VG 1HILA 3H8NA 5E7FA 5DQDH 1T0NB 4LDEB 4WW2F 4TSCL 2GK0B 4PJXB 3EW3B 3CU1A 4QGYA 2ZPKH 4R0LA 3PWUB 1HOCB 2DMBA 3TYGH 1IRAY 1OSPH 2EIEA 3EFDL 4L29B 3VFTB 4DKFL 4TUOA 1IAIL 3OV6A 4WRLA 4ONGH 4HC1H 3CMGA 1OTSC 2V5YA 4K7PH 5HI3C 1OARH 3QPXL 4XXCC 3BH8B 5H94B 1QBML 1T7VA 2J6EL 4H1LG 5DXWA 3RNQB 4PGZA 1EO5A 4GG8B 3RWHA 5AEAA 43C9B 3W39B 5E2UL 2CKNA 5T3XE 3ARGD 1RJCA 2VLLA 3AM8A 3BD3A 3SCMC 4PJ7B 1KJMB 5DFWH 5IB1A 5GGTA 1CFNA 3CVIH 1X5AA 3MLXH 4ZFOB 4KTDL 1JF5A 2BOBA 2LVEA 2I24N 1FV1B 1JHLH 2QSVA 5J6GA 1WAAF 1HSBA 3MV8D 3VDAA 3KPSE 3O3BA 3D6GA 4JANB 3EAKA 4N90D 4QRTB 1DJSA 4ZXBB 4OD1L 1ZLVK 4NKIH 2XG5A 2X4PB 2XZQH 5EZOL 1LWRA 2NW3A 1U8KA 5GS2H 1SY6H 1FFRA 5CHNA 5GZND 5EPMA 4NHUA 4Z95L 4QXUH 2CK2A 3MBXH 1C5CL 3UTQA 5SWZA 5E4EC 4K3DL 4UT6H 1L0YA 1J5OH 2X70A 1A7OH 3D85B 4PRHE 4K9EH 3W9EA 4Y5YA 5KSBB 4JGJA 3HUJF 3T0EA 2DQHH 1KSRA 2DOCA 4K9EC 2YD3A 1N5AB 3BZ4A 2V2WB 1NMAH 1MJ8H 2X4OB 4JY5L 3S3PA 2NY2C 1QBBA 2R8SH 3UJTH 3T0DA 1SEQL 2O26U 2VL4A 1YEGH 1KJ2L 4BZ2H 4K23H 4BSJA 3WE6B 4U6HB 4ELMB 5DF0A 1A6ZA 3CD4A 1SMOA 2VLJE 3QCUL 1RVFH 5D5MB 3PV6B 1DBAH 4F80A 1NCWH 5BQ7A 3TO4C 4K3EL 4M02A 1KIQA 2N1KA 3D9AL 4FFYH 4R90H 3DUUB 2BRQA 1YN7A 5BV7H 4L4TA 4UDTB 1G7QA 1I9RH 3JZ7A 2FL5A 2MKLC 1VPOH 3G6AB 3BP4B 1CR9H 1PKQE 4ZXBD 3SJVD 1N6VA 5C0JA 2C1OA 5D1QC 3ZE2E 4D94A 5KSUA 3BQUD 3FTGA 5GGRY 4YNYB 1AKJB 2BY0A 5GGVH 5HHOE 3OKKB 1VADB 5F9WB 3LN9A 2H9GA 1WUNT 3B9AA 2C7UB 1IJ9A 2VXTH 3STZA 3F6IA 4IHOA 3EYQC 2YEZA 3HNTL 1C16B 2OTUB 3EYVB 4NWTL 5CKGA 2P5WE 5C0GA 2IQAB 3MA7B 3SE4C 2VKXA 3CFEA 1BLNA 1YMMA 5C1MB 1ZANH 4MB3A 2AJXH 2VXQH 1YQ2A 3V6FB 5ECJE 4K7PY 5I75C 5GJTH 5FAAA 3DMMC 4E41A 4ODHL 3WLWD 1LQSR 5J0BA 5C0AB 3B9KD 4KHTH 1A7RH 1YYLH 4JO3H 3WUWB 4TTDD 1V3KA 4U6XA 5EDXA 1M7DA 1T21B 3W2DH 3C2AL 3MOBL 5I19H 5IQ9A 1X6LA 4ZFGH 5HYIA 5BVJA 5L0QC 2RAMA 1YMHA 3ILQD 4MD0B 1YUHB 1JF6A 5FOBA 2NY0B 3U36A 1SJEA 3DSFL 4YXLH 2AKRA 4YHLL 3I6GA 5K9KB 5KVFH 4J12A 1J8HA 1MWAL 3O4OC 2OK0L 1QSFA 3G5VB 4NJ9H 4MWFA 2Q8BH 3QWRD 1KB9J 2DD8L 1FZJB 5ERWA 1XGPB 2BSSB 3BHBB 3OZ9L 3QEQB 4LCWB 3UTSE 1OSZB 3UC0H 3LEXB 3L3GB 4OGYL 3RJQB 1KENH 2H8PA 4G42A 5JORA 4XP9H 3U82B 2EXYD 4GFTB 1AKJD 1A1NB 3IU3A 3KG5A 4ELKA 3FO0L 1A6WH 3LQAC 1N5YH 5C7XL 1KV3A 5FGBC 3HPLA 4CAGA 3DUHA 3PDOA 4HD9A 5F21B 4PGDA 4JG1L 5IVNA 1SM3H 1T2XA 3CC5A 3NABH 3HFMH 3WCYA 2ICWB 3BKMH 1A4JB 2D2OA 3WNOA 2EDNA 4XMLH 1SYVA 3CDFA 2Q1EA 5F7EH 3FRPG 3RIFF 5GZOD 1RZ7H 4PJ8A 1AGDB 4F58L 3OR7B 3QULB 4V2BA 2F58L 2KYWA 3SDXE 3SDAB 3EDDA 5DJ2B 1ZOXA 4XPTH 4G8IB 4AQOA 5C0AD 4LSUL 4C83B 1A64A 4JHWH 1MFDH 4OV6F 5IWLA 4FQQB 5CEZE 2OL3B 2DYPD 2NXZD 4FXKA 1SVCP 2BDNH 3QNYB 3PV7A 2BY3A 4RNRB 5KSVA 3WKMH 4AMKH 4NRZB 4LARH 2NY0D 1DQQA 2FX9H 1OP9A 3MV9B 5EOQL 2X89D 4YFLF 3IFOB 1HK6A 2AEPL 5L2KD 1YN6A 2NXYB 4ZFOL 5C07A 4LLWA 3WL9A 4M00A 2IAMA 3FFDA 2VISA 3MBEC 2DDQL 3GMNA 3QDGE 1FH5H 3NCBB 5MP6H 1CGWA 1V5JA 32C2B 4X6CB 1NLBH 1CFVH 1Y0LA 3MRIA 1WBXA 3O8XC 3WNNA 5DVLA 2HYMA 4NIKB 2C4FT 1XGQA 4LU5H 1XH3B 1DDHB 2RB8A 3MLWL 2V5RA 3EFFB 3UBXB 4JHAH 3NZ8B 3PWVB 3WXVL 5IKCA 3LHPH 3PE9A 3GSWB 4BSVA 4TUKL 2APXA 1RUKH 5EC2A 3JV0A 5T33L 1Y6MR 4OGXL 4U7KA 5BS0E 4FRWA 1CBVH 2PNDA 1CFQB 2PYFA 4YBHA 3WFHB 5KVEL 3V2AR 3QHFH 1QFWM 1YEIH 5E08H 3GM8A 4YHPB 1YQVH 4XBEH 1EO8H 3PDDA 5FHBH 3PHOA 3VFVB 1A5FH 1PYWB 1IC5L 2D7TL 3HS0B 1LE9B 1J0YA 4K7FB 5F44A 3RWCB 4P59H 3G04A 3GUTB 3CFCH 3CIQA 1A1OB 1HCVA 3EO9H 1MRCL 3L5HA 3RVTC 43CAA 2VKWA 4DZBB 2R1WB 3AMKA 5GRUL 1JK8B 5ALBH 2HH0L 1VDGA 4LVOB 5JXEA 2CMRL 3NIGF 5LGHH 1GHFH 1KPUB 2HN7A 1R3IH 3GNMH 3MJ9A 3OB0K 3DROA 3TN0C 3FAWA 3M1BA 2MFNA 3MV9D 1JGUL 1KG0B 4NM8H 3TH3T 4JZOA 3IVKB 2NXYD 2Q6WA 1F4AA 3ROLA 1QD0A 3LN4A 5F89A 4ZTOL 4YDJA 1MCQA 5IGXL 4WO4B 4B5EA 1AD9A 1OD9A 2X10A 2ZUWA 4M7LT 1U6AL 4PUBL 1BQLH 5DO2D 3QG7H 2GJZB 4GW4A 4HS6A 5C0CB 3TPUB 4PG2C 3L3IB 4M6OH 3T65A 1P2CB 1FIEA 1OAKL 5T1LA 3IDJB 2QHRH 1YYMH 4UBDD 1UKTA 1FE8H 5AWNH 1A0QH 5FGRA 4FFVD 1XFPA 3KLSA 4IM8A 4WUUA 1DN2A 4L9LC 3IJYA 2VN7A 4HKZA 1MPAL 1FQ9C 1HHJB 5E99L 2XACC 3RWDB 1FYTB 1BVZA 1ND0B 3MLUL 5JPMA 3ARED 1NUNB 4XPAL 2D4DA 3EKCA 2ZUQB 4Y16C 3ULVD 4HV8A 3JWOH 4RAVA 3K2UL 4WI2A 1ZSDA 2WWMC 2HVJA 1H8SA 2DM2A 4LCYA 3JWOC 1R3JB 1FAIL 1ZMYA 1ZHKA 1FNHA 3TT1L 5DVNA 4WWKA 1UKSA 5JNYA 1TZIB 2WIMA 3FOLB 5SX5H 4BUGA 1E6OL 1YNLL 4X6FB 1KLUB 4O5LH 3HNVL 3UJJL 1U8JA 2OTPA 9CGTA 5ICZA 2IANA 4A2LA 4QHUA 4L5FH 1AI1H 1W72B 5ETUB 4NBZB 4MJ5A 1CGUA 2A73B 4P2QB 1D5IL 1DZBA 4RGNB 4JFOB 1RZGB 4WO4D 4OLUL 1NANH 1WIOA 4UU9A 4HIJA 3IB4A 1I1CA 3SJVA 3MA9L 5K9QG 5HI5D 1WBYB 4PG9A 3FB5A 2YPVH 4Z77A 1MCNA 2FHCA 1U9KA 3F12B 1NBVH 3VXPA 3ARRA 5MEPA 2FH6A 1FL6A 4HGWA 5LQBL 2V17H 1XCQA 2CGRL 3PP3K 5DZOA 4F9PA 1HHIA 1PBYA 3CFDA 5DA4A 2ADGB 1FYTD 4LSTL 1LO0H 4YC2C 3K8LA 5D1XA 2R2CA 2ZZUT 5L8JB 1JZ5A 1UWXK 2AK1L 4WW2B 4P49A 2BVQA 2GQHA 1UCBL 3QUYC 4I8DA 4JDTL 5FKAA 5HHPA 4YAQB 3B9KA 1MUJB 5IG7A 2CRYA 1F3DH 1CGSH 2OL3L 3BP6B 3IKCB 5FA3B 5JW4N 1FG2B 5F88B 3V6BR 2CJUL 4MAYA 3Q6FB 4GKZA 4GQPH 4E42B 4ZDHA 1I8MA 4CMMB 4G6KL 3V52L 4ONFL 1AGCB 4POZC 5ITBH 5HDBE 1Z9OA 4YH6A 4NFDA 2F53A 1IM3B 4OZIE 1KLGB 4NM4H 4P2QD 3PIQA 3C6LB 4RGND 5IB3A 3DGCR 3M07A 4ZUUA 3RPKA 5HYSB 4GLRH 4XHJC 1KIPA 4CDGC 3MQIA 2OP4H 1CYGA 4G8GE 3H9HB 4NQVB 3BGAA 3ME0A 4XHQA 2BNQB 2FX7L 3GMLB 4D3CL 5EIIB 3U46B 5KN5B 4JDVB 1A3LH 5J4MA 2AJYH 4XTRC 3OBAA 2BNRD 2VZTA 5CCKH 4ZFZA 3U6RA 3P0YH 1J1XH 5T1KB 1K2DA 3JV4A 1ADQH 2CDEA 3KJ4C 1I9IL 5CJOL 3GSVA 3FOMA 3BUYB 2VXSH 1JGEB 2X6MA 4I3SL 4WJ5A 3TBVB 3CSGA 4QTIH 5HVHB 2JELL 1RUQH 2JE8A 2UV3A 4J23A 3QUMB 5BO1H 4OCWL 3MYJB 5IFHL 4I0KA 2WBJB 2P8MA 1EEYA 3KPMB 4R96A 3D18A 1MLBA 5IOPA 2OZ4H 1IGIH 3QQ3B 1M6OB 3BWUC 4HXBH 4RWHA 3HI1A 3DXAD 3HC3H 3KPRE 3LD8C 3VRJB 2YMXH 1X9QA 3K0WA 4F7CA 5INCA 3BJLA 5KOMC 2H2SD 3GMQA 1V7MH 3LRGA 4I77H 5CWSB 5E6IC 4X4XA 1BFOB 1G7PB 3B5HA 5LKNA 1WBZA 1T1YB 1TTGA 5EBLA 2H1PH 3OB0H 5CILL 1Q94B 4CNIA 2W60B 5E1AA 4DJMA 5FYJD 3TT3H 4KRLB 1EJOH 4ZNEA 3U9UA 3S4SB 4RGMC 3CGTA 5CZVL 5BZWB 3RWJA 5GGQL 5L2KA 4HWEH 2X4QB 5D7LD 2YKLH 1FN4B 1FHGA 1NGYB 2A9ML 1RURH 5CJQH 4RFEB 3VXUA 2BNQD 4F57H 1YC8A 2DRUA 3EOAB 3BX7C 5CBEA 2AJVH 1D5ZA 1CIUA 3HE7C 2W0KA 5C9JA 3WSQL 3G9VA 4Y7MA 1FVEA 3FQRA 2GYSA 1F13A 2VDQL 3HZVA 3PNWB 4R7DA 2GJ6E 5BRZB 2FSEA 4P0DA 1GCFA 2R4SH 4KKBC 4Y5VB 3UTTB 4UUJB 4I2XA 1VKXA 1X5YA 2HFFB 2P47B 1KXQE 2WWKT 5M94B 1RI8A 3V7MA 1JGVL 5KTEL 2BFVL 3W0WD 4MNQD 2NTFA 3DX6B 3MACL 2BVOB 5KVMC 2CRIA 4DEPB 2WBJD 4L4VA 4W6XB 2F19L 2IH3B 4M6ML 4OGZA 1FFOB 1Q9KA 4P4RA 4AG4H 3LB6C 2A1WL 2J8UB 3U0WL 2GFBA 1JPGA 1V7NH 3PWNB 1ZVHA 4TVPH 4N0CC 3VW3L 3RPIB 4KVNH 1XCTB 5TGBB 1I1YA 3MXWH 4FQ1L 4NQSB 3M17B 4X99A 1DP0A 4JRXB 4LCUA 2GW5A 4M1CC 1PKOA 1XGRB 2B8OT 4J4PD 4AEHH 5I8CA 5EU7E 3C5JA 4CVUA 4BKLA 5MEQA 1BEYL 4XVSL 3B8SA 4NKOA 2DIJA 1VFBB 1R5VB 2I60H 1W72L 3LKRB 1JPSH 5DJDB 3PXHA 3VG9B 4IRJB 3EO1B 4OZFH 4JG0H 1EHNA 1ZLUH 1HSBB 3B9EA 3ARFD 4MJIE 3TH2T 2JIXB 2NX5B 3OXRB 5C2BH 1KN4L 4OQTL 2XXCB 1VA9A 5EO9A 1HQ4B 1T04A 4ZAKD 2EICA 3LZFH 1Q38A 2KUTA 2NW3B 4Y88A 2DWEA 4P9ML 5BCAA 4U1JB 3TVMC 4JQVC 5BRZD 3WFDL 2VZSA 1HH9A 1ZLSH 2APFA 1WIUA 5FIEA 2YC1B 1JGLH 1XIWD 2BJMH 4LOUC 3SDDB 3Q5OA 4NWUL 4U6TA 1AP2A 4ZG1A 3BXNB 3RY5A 1EUUA 2A0LC 3LIZL 5D7IB 3HAEA 5FDWB 4UQ2B 4OTXL 3VFWA 4KAQL 3UZVB 5D7JD 4CJ1A 1S5HA 4HLZG 4FQIH 2DM4A 2ID5A 3BKCH 3AREA 2UY7A 2P49B 3ZDZF 2J5LC 2XN9E 2X4UA 1P69B 2IFFL 1IBGH 3MJ8B 1M1SA 2D0FA 1QEWB 1TZHA 4YHIB 1IZJA 1CICA 1T7YA 4O2CA 3SGKA 3T1FA 3GBNL 1DQDH 4JRXD 2DQIL 1FVCB 4MCZB 1Y18B 2FZ3A 1A6ZB 5I8OH 2WIIA 4JKLA 2EXWC 3MREA 5F9JA 4HAGA 4OI7A 2IFGA 4G6ML 1OTUD 3DBXA 4IRJD 1ZAGA 4L4TB 4RA0C 3UAJC 4DGVH 1KBGH 3WIFB 5DEGA 1CDHA 2JIXD 1AGBB 2VDRL 5J12C 4G7VL 3FTGB 4P2RE 5C08B 2DTMH 5IMMB 3L1OH 1KELL 3BGMB 1UT9A 1N7ML 4WV1A 2R1XB 4NUGL 3D2UA 1TJGL 2CUMA 1LO4H 1ZHBB 2IQ9H 1AXTL 3STZB 1BQHG 1BZ9A 2E27H 3SDDD 2XKNB 4U05A 1BFTA 1X5IA 5ACMA 5J3HC 4WU5A 2I26N 4XP4L 4Q6YA 1CZ8L 5E00B 1IC1A 2D7QA 1TVDA 4I5BA 2OBGA 2X9WA 3LAFA 3QUML 3VFRB 4HHAA 4LEXL 4PJFA 4R2GD 3W9DA 2XZAH 4GRLC 4APQD 4ZUVB 2G75B 4JRYB 3PGCB 4PJBA 3KWWA 5IB5B 4WGWB 1JNHA 1EZVX 2VC2H 1J86A 5TF1L 1JI1A 1YEHH 4I9WE 2VZ3A 4OLXL 1HZHL 4LSSL 4RFOL 5IQ9B 1A6AA 1MJUL 2X1XR 3X3FL 3VXMB 5L9DL 4JDZB 3I75B 4EDXA 1TJIL 3B3IB 4ZNCD 4NOFA 1CK0L 2AKRB 4DKFH 2HVKA 1J8HB 2Y9RT 3WXWL 3CXHK 4TQEH 4TYUA 3SPVA 3TZVC 4GLRI 3VXSA 1HWHB 4U7MA 3K81A 1QBMH 3DYMA 3RIAK 2ZJSH 5HDLA 3TF7C 3LKOA 2WSKA 2KBGA 1MCDA 4HCRL 5E2UH 3QUKA 4PJAA 3G5XB 3SGDI 4HQQH 4QHMA 5HHMB 1UZ6F 5D96B 4YO0A 3VD9A 1D5BB 2OQJB 2VAJA 3PDOB 4WI7A 1L7IH 3P4OB 2BP3A 3NFPB 2K7PA 5L88L 4Y19B 1SYVB 3UTPD 4ZO6A 2OS7A 2HT3C 5DUML 3V0AC 3GB7B 3RTQD 5K9QI 1FDLH 1I85A 3ULVF 4AM0A 2OXGA 5E2WH 4JRYD 1CL7H 2CKBH 4Z95H 4Z7NF 5CUSL 3S34L 1VGEL 4OZHE 1WGOA 2LTQC 1FL5B 4MNHA 4C4KO 1R3KB 3DXAA 4HEPG 4NO0A 2Z35B 5I1HH 5LG1A 4XWGL 1IGMH 3REWB 4U1GB 4L3EA 2NY4C 3BO8A 4M3KB 3QXDA 3BVNB 4N0UE 3WLBB 3E2HC 3UXFA 1AGEB 3X3GH 4YQXH 3Q6GH 1JCKA 2A74B 3MCKA 4LLWB 3DV4A 3WL9B 1I7TA 2ITDA 3FFDB 3QXUA 3VGEA 1MNUH 2OTWB 4BH8A 4YPJA 5IB2A 3QPQD 1MHCB 5D7LA 3RWFA 3MRIB 4OF3A 5I2IB 2QSCH 2BY1A 5JOPD 2D7NA 3AU1B 1T5XA 3EGSA 1AC0A 4PRPA 2AABL 5HHMD 5KG9B 2XA8L 1NBYA 3D9AH 5C6PB 5TJWK 3ARDC 5DC4B 3P4MA 1DBMH 2W9DH 3KYKL 3QNZB 4LRNH 3P9MB 3O2WL 4JVWA 5EC2B 1U8QB 4Y19D 3TWCH 4PJFF 1P1ZB 2YA1A 1KT2A 2PYFB 4L8SA 4KUCF 3C8DA 3VFNA 3KXFD 5DFVC 3VFSB 5MENB 4PJBF 4YZFF 4MNQA 3IDGB 1OTTD 3F7VA 4HPOH 4L4JA 4P46D 2Z91B 5CAYB 1WFUA 5B22A 1I3RB 4LIQE 4DK6A 3FQUA 4P2OD 1M05A 3FHQA 5FKPB 3FO9A 5D2NA 5F1KC 1H3VA 1VFUA 4WHTA 3LKQA 4P5MB 1XGYL 5J56B 8FABA 2N7BA 3EIFA 5I17A 4AL8L 2DS4A 3LKPB 2ZCHH 4XNZC 2ZOKA 3B2UD 1YY9D 4HX1A 4JFHE 1ZA6A 2I9TA 4ACPA 1OT1A 4PJCB 2XKSA 3CVHB 4Q6IC 3WUZA 3L3JB 2ESVB 4LSPL 2YSSA 1PJ9A 5E9DB 4ZO7A 3F8UB 3Q5YA 4U3HA 2X7LB 1MHHB 3SKMA 5JIKA 3MOBH 2ZUUA 4G3YH 3WIIH 2VABA 1AY1L 5CIPH 1DTUA 4HXAH 1K8DA 4MCYA 4PJAF 4UAOB 4HWZB 3TA3A 2L7JA 5E7BA 2BHYA 3V4UL 1LO2H 2CD0A 3QFDA 3H9SD 3SKOA 5ITFA 2LV4A 5C86A 4Y4KB 2K9UA 5DRWB 5T1LB 4TUJA 1WF5A 5FGCE 1DUZB 3NMEA 1FGVH 1R0AH 4YBLB 3RWIA 4AIXA 4W6WB 1XIWA 4ORGB 5KAQF 1NCAL 2VDOH 4OGYH 5HI4C 3O4LA 5DRXB 4ENED 1S7TA 4HKZB 3I2CL 2PTUA 4X6DE 1Q0XL 1RJZB 1JTOA 2E3VA 4JB9H 1XZ0A 3Q5TA 5MEND 4LBEA 1SBSL 3GSQB 3TBWB 1PLGL 5DK0B 5D7JA 1UVQB 5JPMB 1NKOA 3RGVC 3QRGH 3O41A 5J89A 2YD8A 1WISA 4DKAA 3QIBB 3KPOB 5HYJB 5F9AC 4R7NB 1I7RA 3VXQB 3CXHJ 1MCSA 2V5TA 1FFNA 3VDBA 1OW0C 1LE5B 4P23D 4F7PA 2IANB 4U1SB 5JIPA 1H5BC 2ESVD 5D2LA 4MJ5B 2R0LL 5E9DD 2UYLB 3ARBA 5GRVL 1E4KA 3CSPA 4XPGL 2VXVH 5EBMA 1I1AB 1Z9LA 2YUVA 4MD5A 5CS7A 3V6OC 3ARSA 4HS3A 4RMRA 2MCPL 5EU6D 4RFNB 1G9NH 1X3DA 3PWPA 1Z3GH 2I07A 4OIIL 1G9NC 4BK4A 4OV5B 3NZHL 4JFQA 1O5DT 5TFSL 4QCIB 1Q9OB 5DSCA 3WDJA 2DDQH 1OOAA 4YPGB 1R5WA 2F74A 5ISZA 3R06A 5T1MB 1CE1H 1FLRH 4JR9L 4HGWB 1CDCA 4HIXL 3BH9A 3WO3B 4OSUH 4X7DC 5IROC 4F2MA 1X5JA 1NCBL 2GKIA 2ENYA 3CFDB 1NAMA 3JV5A 4XNUL 3QISA 4R4NC 1NMBL 3WUWG 3WXVH 4FABH 1JYWA 1U3HC 1TZGL 2ARJQ 2PW1B 4KQ3H 2WAHA 3P4NA 4DN4L 1LK2B 4M8QA 5HYJD 2HRLA 2BXYA 5HHPB 6CGTA 5KANG 2A6DA 3DGGA 4M61B 2FDBP 1FL3A 1M71A 2ZP0T 3V0WH 2UWEF 1T1WA 3IXAB 3QI9A 4ZDHB 1U8NA 1I8MB 4H26B 4DQOL 4MAUL 3LRSB 5GS0D 3GHBL 4MA1B 3L5WA 1J12A 2YHGA 3HI6L 1JPFB 4XGZA 1EAJA 1U8PB 1H3PH 1T0MA 1INEL 1BOYA 2NYYD 2YUXA 2AQ3A 2OMNA 4ISVA 5SWZE 4TTDC 1H3GA 1BOGB 5CSZB 4ZUUB 2HH0H 1JWMA 3KHOA 1KIPB 3T3MF 2CMRH 4PGBA 2ITCA 3ZKSD 4HIHA 4JQXC 3S3JA 3ZTJH 3T0EE 2W65A 5GRYA 4NKDA 4KK8D 3QO1B 4M48H 3T09A 4D8PB 1G9MH 2OJEB 1CLOL 4QXTB 1OPGH 2DB8A 3IAQA 2X1WL 1G9MC 1K2DB 5DHXB 3BP7A 5E94B 2CDEB 4MZ2A 3D1MC 4ODUA 4G9DA 3ECBB 4G8EB 1FYHB 3HCVA 3FOMB 5ILTL 5B39B 5KW9L 1J8KA 3BDYL 3EUUA 4H25B 3NH7H 3SE8L 5CEYA 3VMNA 2F54B 4G8FA 3ILPA 3IETB 2QQLH 4PUBH 2C1PA 5I15L 2VQTA 1CL7I 2ERJB 1ZA3A 2XWTB 3P0VH 4ETQB 5DTFB 2FJFA 2MPAL 4R9HA 3N1GC 4U3CA 1MLBB 1F58L 3GIVB 1RJYB 5KVDL 3QEHB 4X4XB 3OG4B 4YGVA 1WC7A 3V4PH 4X6EA 5E99H 1QLRB 5EBLB 2Z93A 2D7PA 3WYRA 2DQCL 3O6ML 2HLFD 1VEOA 5D2LF 4XPAH 2HKHH 5E1AB 1KFAH 4YDVA 1P7QB 3SE9L 3CVHL 5E6YA 5D1ZD 3P30H 3BSZH 1RZ8B 1GPOH 1ZT1A 1KYOK 1GGCH 3S37H 4BZ1L 1QLFA 2DM3A 4IOIB 4YHKL 2FD6L 5C0DA 3UBXG 3ULUF 4M43L 4H20L 4GAJL 2FGZA 5IBLC 5IQ7H 4YUEL 1YMME 4C56E 3QIWD 2X2YA 1N6UA 2FBJH 2IBGA 5GISL 4JLRB 3AUVA 1WJ3A 3MUGA 4EOWL 1UWGL 4JY6B 3IFLH 5I66B 5DI8B 1MQ8A 1T5WB 4XCFH 4L3CA 1QFWL 4MD4A 2ICWJ 3CFJA 5BZDB 4YR6A 4S2SA 2F54D 1U8IA 2W07A 5FHAL 4OGAD 4K3HA 3V0VB 5HY9B 1XF4A 3TYFA 3BZFB 3DX7B 1OGAE 3KXFA 5DDHB 2GTWA 4P3CH 3BDXA 5SWQA 3ZDXF 3IDNB 5IESH 3FN0L 4P4RB 1U92B 4DTGH 4JEGB 4P46A 1QSFE 2V6HA 3FQNA 4M7LL 2DQJH 1JPGB 1BFVL 5I1KL 3U1SL 1FJ1A 4XPFH 1QLEH 2XXMB 1NFIA 2W9EL 5IJKA 4P2OA 3SDCC 4F15B 5M7QA 2CGRH 3OTTA 4X99B 1X4ZA 1IAKA 1P5UA 1E0OB 3KPNB 3MGAA 4LSTH 4Y2DB 4HUKB 3ZDYE 3C5JB 1PSKL 5MEQB 4K71B 2VH5H 3SDAC 1ZWIB 5GS0L 4NKOB 4D0DA 1NMCB 1P7QD 3E8UL 1PY4A 3BW9A 1N2RB 1D9KD 2PW2A 3I6KA 4I0PC 4PJGE 3F58H 1VEMA 5JXAH 1IGTA 2FGWL 4HUVA 2FWOA 4NO3B 4OZGB 4PRAA 5H35A 4ZTPH 3B2VL 3QIUB 1F4XH 4IOFD 2FEDC 4HGMA 1EHAA 5JDSA 4CVZB 4KROB 3WS3B 2AEIT 3DETC 4X4ME 1HXMB 5FYKD 2FB4H 1F4HA 4UNUA 1CN4A 2IPKB 5EIVA 4DN3H 4Z7OF 3CFKA 5I9QB 4GRWF 4PLOB 5F96H 3H9SA 1NUGA 1S9XB 1L9MA 4KK6D 4QRRD 1CDJA 3ZT5A 4N9GB 1Q0YL 1HNGA 1CDBA 4PRNB 4LQFH 4PRIB 1PY9A 3EOTH 1IEBB 5AAWA 1XT5A 2MOVA 4P57A 3NAAH 3L95A 2F5AL 1CFTB 1FORH 4JJHA 5I1IL 3OL2A 4X6BA 4NN7C 2BOCA 3KYNA 4UOJA 1TETH 1S5HB 1WV7T 3MRHB 2VLRB 2H32H 4J1UA 1NDMA 1FNLA 4D0CA 3FQXB 4JFZL 3WNLA 4RAUB 4DGIH 2APTA 2IGFL 2JELH 3DURA 3MRDA 1MCOL 4O4YH 1TZHB 4P5TC 1F4YL 4P3DA 2BSRA 1VGKA 2MCG1 3MGOB 4UB0H 3EOBB 3RWGA 4RISH 2OR9H 5CMAB 4Y2DD 1KJVA 5F9JB 3T2NL 4GMSH 2BHZA 1DR9A 1T20A 1KPRB 4WUKL 3RZCA 5DHYA 3DBXB 4LAQH 1DBKL 4RGOH 5CZXC 4ODSL 4LSRL 1LEIA 3RVUD 4BQ9A 4DKEL 2BSTA 3QZWA 3WO4B 5INDB 3S37X 5J9PB 5DS8A 2IPUG 4RWYH 1LEGA 4PJIB 5CILH 5GGSB 4U6VL 4CUCA 4KROD 3MMEA 1UZ8A 4GSDH 4H0GA 3TH4T 3N1MC 1I3GL 1KTKE 4HIIA 5EU6A 1XR9B 2MKWA 3D2UB 1GGYA 2Y07L 2VOTA 5L8LB 5GGQH 3ZHKA 3VI3E 4WFGD 1L0QA 4Q58C 5DJZB 2PXYD 2A9MH 1EV2E 7FABL 2XYCA 3BESR 5I1GL 1UM5L 3NFNA 3D3VA 3HRPA 4MXWH 4OAWA 3QQ4A 1A6VL 4B7LA 4RX4A 2KZ1B 2VLRD 15C8L 5ACZA 4ZYKA 3INUL 3BEWB 4PJBB 1I8LC 4PJ9B 5KS9E 1C8PA 1YDPA 3MRPA 5JR1H 3CLFH 4LLQB 1KYOJ 2BFVH 2UUDK 3O9WA 5A40E 4QHLB 4Z7VA 1UM4L 4ODBD 5EZJB 4BQCA 3MV8E 5C0EB 1JV5B 4N90E 5SV3A 2OI9C 3L3HA 4EDXB 2QQKH 3KLAA 4WU7B 1TJHL 2X40A 3L7EA 2RFXA 3RL1A 5HYSG 2JB5H 1BMGA 2FIRT 2Y6SC 3IGAA 5ANME 4ZQKA 3MRKB 4IIQC 4O58H 5FM5M 1PZ5B 4IDJL 3UTZA 2DQEH 4LPYA 4U1IB 3O0RH 5LJYH 3LH2H 3CAFA 4E9LA 2EH8H 2YPLB 1NAKL 3A0OA 4TNWF 5FYKL 1A02N 1CTOA 5IR1B 1NCDH 4WTZG 5ID1A 4NHCL 2XTJC 1X7QA 4YO0B 2R0WH 4PJXE 2IMNA 2OR8A 4OLZH 5GSVB 1F5WA 2FX8L 1RD6A 4P9HH 2VDPH 1BREA 4NKQB 1MAKA 4RGNC 3OKOB 3PQYA 3VXNB 3UO1H 5GJSH 5MEOB 4P9HC 4FQHA 4EQ2A 3GSNL 4I4WA 1I3UA 4L8CB 1MAMH 1PX3A 3BT2H 3F7YA 4MDJA 4Q97A 4AIOA 1EEZB 1TPXB 1MCIA 4MJ2A 4W81A 2HFGL 2EE3A 4KI5D 3K8MA 5C9KA 4KKCC 4JQIH 1RZKH 5GRJL 4PJ9D 1T89C 4PJ7E 3SQOL 2Z8WC 5T3ZH 3CFBB 4PP2A 1N3NB 1FO0A 3QXAA 3AVEA 1JL8A 4AJ0A 4NO0B 4GRMA 4Z7UA 4UINH 5A16A 3IAGC 5SWSB 3GIZL 3I9GL 3BO8B 3RIFK 4DUVA 2Z31D 1FNEA 4JM2C 1U41A 4ODWA 3S4SG 2R9HC 1EAPB 3QAZB 4R97C 1RFDH 2VQUA 2L7UA 2HMID 2IFFH 4PLJC 1RHFA 2NQCA 4WW2C 3QRFM 1HINH 5T5NF 3C9NB 4XNMA 5D1ZA 4N9OB 1WEJL 5B8CB 2ITDB 3HR5A 5LXGL 5KANI 4HFUL 1YNTA 4DVRH 4MS8C 1A9BB 5D9SA 3VFGL 1EA9C 3RWFB 3EZJB 3HB3C 4LCCB 3OR6A 1AGFB 4IMLA 5CD5D 4PRPB 3GSUA 4NCC2 4AY0A 1E28B 1DLFH 4EUPH 3ZKMC 2VAAA 3WFBH 3RWEA 5F3BB 1H15A 4FQXD 5EULV 3PWLB 3QIWA 2CRZA 1T7ZA 5DLMH 2H3NA 3C6LC 1L0XA 5K9JH 1BVLA 4GOSA 1MCRA 5FCSH 2P5EB 2VDRH 3TV3H 3UJIH 4L8SB 4Q2ZA 4UTBH 4BH7B 1JF1B 3SE3A 2QEJA 2JJTC 3MUZ1 4PRBB 5I1LA 4M7JH 1U8LB 3OKLA 4NUGH 4QHKJ 3F7VB 1Y6KR 3MRRA 3KPSA 1SEBA 3FN3A 1B0GA 4F3FA 2AJ3A 4Z7VF 1CZ8H 4NNXA 4FTVD 2G5BA 4NUJB 1MEXH 4BSWB 4WHTB 4TRPH 4WWID 4LEXH 1OAYL 3QCVL 5SWSD 3U4BH 4MSWB 1HIMH 2HJLA 4EN3B 1R24A 4UIMB 1MFEH 4MA7H 2NNAB 2ZOKB 2UWEB 5IFAH 4KMTL 1BIIA 4NQCD 2YRZA 2I9TB 2GSGB 3RNKA 3FJTA 3UZQA 1IQWL 3ZTNL 2G60L 4OLXH 3SKMB 3QT2A 3FMGH 3TLRA 1T2QH 1WZKA 3TO2A 3TA3B 3WJJC 4JM4L 5L9DH 3VFUB 1GGBL 2C4XA 1G7LB 1INQB 5MERA 3QH3B 1S78C 3GGWB 4YIQB 4JAMB 2FATH 2B5IB 3WXWH 3HZKA 2X1PA 4TULL 3O6LL 2EEAA 2V9RA 3QEUA 4HJ0C 1EXUA 1GZPA 4JHBA 3MCLL 3QFJB 4GMTL 5GRVK 4CADB 2CUHA 3L3OA 5EO0B 2VLJA 5ENWA 5F7UA 1ES0A 1EDQA 3H7LA 3HZMA 3RWIB 3DHMA 5FUOL 5C0AE 2P42B 2VDLL 4CN6A 5DGRA 1ED3B 2NY2B 4QRSA 2P5ED 5DHVH 4LKCA 1QFOA 5DJXA 4HUXA 2H6PA 3O2DA 4Z0XB 1XZ0B 1OTSD 3IJSB 2YPKA 5HI3D 4X4YA 4JO4H 2D03L 3K46A 2R2BB 3P9LB 4LKXB 4Z7UF 3DNKA 2B1HH 4ODTH 3NOIA 1N6QL 5HPOA 4UDUB 1E4WL 4ONOA 5L2KE 5GIRA 2UUDH 5HHOA 2Q86B 3TO4B 3SCMD 2ADIA 1JZ6A 1S9VA 1MCHA 4OT1L 1MSPA 3QDJB 3VFOB 2AJUL 4OJFL 5B38B 2Y5TB 5CD3B 1I1FA 1YJDH 2JCCE 1H8NA 4DEPC 3MLYL 1OQXA 5CUSH 5BV7B 1HCFX 2V2XB 3KPPB 2BCKA 1YJDC 3DIFA 4R0LC 2P5WA 5HGBB 5D2LB 5I73C 5I1JL 2P48B 2ZCKH 2E7LC 3T2PA 4KVCL 1NGQH 3O3DA 4U7SA 4I18A 2YS4A 3FAXA 3SGEH 4IJ3C 1QRKA 1NLDL 1Q8MA 4OLYL 3DVGA 1RIHL 1QO3A 5LWYH 1TVHA 3L3DA 4HWBA 2O5XL 5FK9A 4HS3B 1JTPA 2GSIB 3MLSH 3S5LA 4ZMAT 3MLZL 4L8DA 3K74B 4XVUC 5GGTH 4ERSL 3AM8C 3JSSA 4WHYG 5B3JE 4RMVA 2A77H 3QFJD 3PGFH 1IFHH 3R8QA 1BQSA 2DI9A 4XBGB 3QO0B 3MRGB 4O02H 3GMOB 1JBJA 1NCNA 4TPRH 1HYSC 2Y1VA 3GBLA 2NY2D 2PXYA 5CBAB 4MX7B 3RA7H 3FO2B 5I1DA 2AABH 1ORQB 2Z8RA 1SYSA 1S8DA 3TBTA 3QHZH 3HG1B 5DJ8A 1GJIA 1XGUB 2ADFL 1MCJA 3UTSA 1MCPH 2AV1B 3KNBA 1DSFL 2APBA 4OLVH 1AHWB 3MV9E 4NQTA 2Q3ZA 2QSQA 2A6DB 5MI0C 3TO4D 2ADJB 1ZHNB 5DJAB 3NCCB 5EOTB 2X4RA 4NQXA 4JVUA 1RUAL 4KY1H 5E2JA 3IS0X 4Y5YC 3ULSB 1JUFA 3VG0H 4X6CE 3QDJD 1Q9LA 4NNPL 5C0BB 4BFIA 4F7EA 2B0SH 1RUPL 2EDXA 5D1QD 1E4XL 1MFBH 5E8EB 3E3QE 1OAXH 3SDXA 4DGYH 3WIHL 2Q76A 2P8LB 4P4KA 1CU4H 2O93L 1KJ3L 4JFPA 3FHAA 1IGYB 4HBCL 2Y36L 1KEMH 4B53A 2ITCB 2VDKL 4RIRA 3FCTA 3BPOC 4R3SA 3QJFB 1BM3H 4GUPA 2W65B 4UILL 12E8H 3BD5A 5EN2A 3BIAX 4AENA 3LKNB 3H3KA 4Q9RL 1ZGLM 3EYQD 5FV1L 2FR4A 2EYTB 2FECL 3VD5A 2WANA 4N0RA 3IFPA 5DQDL 3Q2CA 1JRHH 3FT3A 5IK3B 2CH8A 4P5KA 3IDIB 4PGJA 3DMMD 4G8FB 4PY7A 2DBJA 5FUCC 2ZPKL 2C1PB 5DRNB 1A21A 3TYGL 1OSPL 3QXWA 5IEKA 3KYOA 3QDGA 3ZE2F 4ONGL 4HC1L 1F97A 3G9AB 4YXKL 1GAFL 5IMOA 3P40A 3QJHB 3OJ2C 3QCTH 2EDQA 2LU3A 5I8KL 3I2CH 3CH8A 1Q0XH 1CWVA 4K07A 4RRPA 4X6EB 4GW1B 3PL6A 2Z93B 3J8F7 4RZCA 3CVIL 3U4AA 2ARJA 3MBEB 3MLXL 2D9QB 1FFPA 2Z31A 1ZS8A 5BS0A 1R3HA 4LQ1A 4NZTH 1JHLL 1NGPL 1DEEA 3V9FA 1QRNB 2KT7A 1IKNA 4F8TA 2G2RA 1F00I 4JN2A 2W92A 4HKXA 1HHHA 4NKIL 4HKBA 3RI5F 4ZD3L 2XZQL 1ZGLA 1SY6L 2XG4A 3JV6B 4WDIA 2NY1C 4PJFE 2VTFA 5HGHA 5K59E 1W0WB 1NEZA 4JFFB 3MBXL 2R0ZH 1N0XH 1SJVA 1QHPA 4UT6L 1FYTE 5IVZB 3RJDA 3U7YH 4PJEA 1J5OL 3MUGB 1A7OL 4QXWA 2CQVA 4K9EL 4M1GH 2EE2A 4GG6B 2CLZA 4AZ8A 3NCFB 1A7QH 4MLSA 1F3JA 1DLHA 4MD4B 4MGXA 2MCPH 2ZG3A 1MJ8L 1A1MA 1KIUA 4XVJL 2E6QA 4GBXB 4PJ5B 5AG8A 3CJJA 1EHXA 3OQ3B 5AUMA 2FCBA 5IUSA 3ARYA 5DZNA 1K9TA 2ATPB 1YEGL 3B8YA 3KS0J 3TCXA 2DI8A 5D96C 4BZ2L 5DUPH 2G9HA 3RY6C 2XQYK 4K23L 1TTUA 1FJ1B 4HK3N 3UDWC 1NGWA 4HZAA 2EZ0C 4P2QE 3QEGH 4HIXH 4KUZL 1RVFL 4RGNE 5ICXB 2GJJA 3WN5A 1DBAL 1NCBH 2DQTH 4PJ8C 1NCWL 3Q3GA 3SKUD 4K2UH 1G84A 4UT7H 4FFYL 2DL9A 4R90L 1BVKA 3MBED 4KK5C 1A8JH 3UPRA 4CW1A 2V9TA 5BV7L 5FXCH 2IWGA 2P8PA 2Q87A 1I9RL 3SDXF 4DN4H 2LFGA 4KV5E 1X44A 1VPOL 2EYSA 2ZCLH 1QRND 2O5ZH 3O8XD 4EBQH 4EVNB 5KZCB 2BNRE 4K94L 1CR9L 1WIPA 2FWOB 5J6HA 5J11C 1RV6X 4HG4J 5GGVL 4U1GC 1MCBA 1UB6A 2WQ8A 4HJGA 4W6YB 1QSZA 4BQ6A 4ZPTB 1YY9C 5IMLB 2VXTL 2YK1H 3WHXB 3VXTB 3CFKB 4L9LB 5C0NC 1C7SA 4LMQE 4HUWA 5IMKB 1ZGLP 3T04D 1CT8A 4QY8B 4R6UA 5F1NA 1HEZA 2E6JA 2NMSA 5F7DB 2NLJB 1G7HA 1Z2KA 1M7IA 1TMCB 1ZANL 2A6JB 2VXQL 4BYHA 5I1AB 1LD9A 2Y7QA 3MRFB 5GJTL 3MODH 1ITCA 5E03A 4PJ5D 1T1XB 2BOCB 1CLOH 2DLFH 3RVTD 2RQ8A 4KHTL 5E2TH 1A7RL 1YYLL 5DYOA 4JO3L 5KSAA 2D31A 1EGJA 3W2DL 5FYJE 1FVDB 5I19L 4QEGA 1MF2L 1CXKA 5EUKA 4NOBA 4ZFGL 2X1OA 4LASH 4M1DL 5HDQH 5JPNA 3TN0D 5IBUB 2BSRB 2QR0A 3VXOA 4C4KT 5TE7H 5D7LE 2R29H 5TE6L 3RWGB 5KVFL 2A6IA 2LAGB 3GMMB 4NJ9L 2Q8BL 1BX2B 2BNQE 1F58H 4YGAB 3GSRA 5E8DH 2AK4D 2VUYA 3VH8A 3MLTA 2Z4QB 2Q7YB 1CLYH 3SGEI 2NW2A 3STBA 3UC0L 1B0RA 1KENL 2AERT 5FF6B 5LAXA 1CF8L 3OJDA 4XP9L 5ESAA 5IEHB 3O6MH 4J3SA 1N5YL 5JXEC 3CX2A 3MJ9H 4R4BA 1LP9E 5I8EB 2WINA 5D6CB 1B2WH 1FBIH 1N8ZB 1SM3L 3NABL 3W0WE 2GTZA 4PJEF 1JWUB 4MNQE 1S7WB 3BKML 3MR9A 2I5YH 3H7BA 7CGTA 3JUZA 1OY3B 4XMLL 4FZEH 5EBWA 4MA8H 5F7EL 1XR8B 1RZ7L 2HKFL 5DD1H 3DV6A 2E9JA 5C0FB 4OF7A 2CK0H 3MX0A 3W5NA 4YC2B 1G0XA 4ZUSB 5D2NE 4BM7A 4Y16D 4ZUTB 1G7MB 3W81A 4UAOC 3G5YA 1UXSA 4OZIA 2WWMD 3QUYB 2AXGA 1FG9C 4XPTL 5IV2A 4JHWL 1MFDL 4MHHI 1KPVA 3A6OA 1B6DA 4G8GA 2J3SA 1QVOB 4ZYKB 2HJFA 4Y4KC 4CU8A 3X12A 3MZTA 5F9DC 3MRPB 3QWOB 3BD4A 3V5KA 1A4KB 2BDNL 4CDHA 4YBLC 2FIKA 1A6UH 1CE6B 3ZLQC 5CEXB 4DKDC 1H8OA 3WKML 4AMKL 2WM0A 3MRNA 4LARL 2WUBH 4N8VA 3T0BA 2FX9L 3JTSA 1AQKH 3MRCA 1A6TA 2FEEL 3MYZA 3RL1B 3MNVB 4JO2H 2ENSA 1FH5L 4G6JH 4UNVA 1X6NA 5MP6L 1S5IH 4F7TA 3QIBC 1CFVL 4X0KA 5BRZE 4E5XA 2FYYA 2JK5A 1GYAA 4OD3H 4HDIB 2EYRA 4LU5L 2YXFA 3L3KA 1UA6H 4WWKC 4EI5B 1FSKB 4H1LA 4JHAL 2APWA 3FFCB 3KJ4B 5J1AA 3LHPL 1ITBB 3BUTA 1FNAA 3SKJH 2CRMA 4G5ZH 1LDPH 5B39G 5DMYA 1RUKL 5T5FL 4KTYA 1A2YA 4LLMA 1CBVL 4WI8A 4Y4HA 2J8UE 1MLCA 2WBWB 3QHFL 3PQYB 3PHQA 1YEIL 5E08L 4XT1C 1YQVL 3OJMB 1EO8L 4XBEL 5FHBL 1I1AC 2FNBA 1A5FL 3IJHA 3DMMA 2DQFA 3OAYK 3QUYD 4RFNC 4JRXE 2FO4A 4P59L 3MUY1 3CFCL 4ODXA 3EO9L 5C09B 1P7KA 4XH2B 3LS4H 3BIKA 1IQDA 3GI9H 5GGUA 5J8OA 3FO1A 5ALBL 1OB1A 4M9PA 3X13A 3DX9A 2CIKA 3MJ7A 4POZD 5EUOE 5FO9A 4GRMB 4Z7UB 4ZFFB 5LGHL 2F5AH 4X80H 2R56L 5JO5A 1GHFL 2GJ6A 3GNML 4JFDD 5I1IH 2XPGA 1U91A 1SBBA 3CSYA 4RGMB 1QQDA 4F9PC 2FJHA 5HSFA 3O3EB 2XWJB 3U2SB 5D1XC 5DC0A 2BVYA 2ICES 2RCSH 4RSVA 1MI5B 3K4AA 1S9KC 5DJ0B 4XNMB 3GHEH 4IS6A 5H2BB 5TQ2H 5ID0B 3VE0B 4ZS6C 4XTRD 1BQLL 3QG7L 3QP3A 3ZT6A 3RVXC 3EYUH 4X8JB 4MAYC 3OKMA 5IJVA 5FGBA 2AXFB 2C3HA 1BJ1H 1QA9A 1U8OB 3GSUB 5D7IE 1UM6L 2QHRL 1YYML 1FE8L 4WIQA 5AWNL 3RUGA 4MA1C 4S0SD 4MA3B 3P3YA 5HDBF 5GRZA 4DZ8A 2H3NB 4OZIF 2OCFD 2R4RH 5E5MB 1ZTXH 1WWWX 3VRLE 1W0VA 3KPTA 1KLFA 1QACA 3S96A 1NSNH 4GO6B 1DN0A 2EKSA 3ETBF 2MHAB 3GJFA 1KCKA 2CIIA 1I3GH 4PJHB 4D2NA 3VJ6B 1Q72H 3JWOL 3OKLB 4Q9CA 2V2TB 5E6ID 5C09D 3H42H 4QRPB 5SV4A 4LL9A 4MJIA 3B4NA 5KBNC 2VDMH 2R23A 3VFPB 3N50A 2BVPA 4FXGA 1U93A 1KTLB 4O5LL 5AYQA 4OGAC 1MCKA 2EDJA 4L5FL 3MGTB 1CD1B 1AI1L 5IM7A 2ERJC 1J11A 1I9EA 2CDFA 2GT9A 4OZFB 4PRHB 3DARA 4TSBL 1QPPA 1MI5D 4MJ6B 1QBLH 3HE7D 3PGDB 3LVEA 4FQCH 1WZ1H 1JPTH 3HMXA 4X98A 4JPIB 3UTOA 3TVMB 4V1DD 3OAZK 1DVFB 1TCRB 4LVEA 4KKBD 1DQJB 2W0LA 1KTDA 5IHLB 3RU8H 3UTPE 2CXGA 2XN9A 1TJHH 2XZZA 2YPVL 5IW3A 1LEKA 1NBVL 2VL5A 4MXVE 4S10A 1AD0A 1HDMA 1U58A 4S1RL 5E8OB 3GI8H 4JRYE 3SKNA 2VLJB 2V17L 3SN6N 4LCIH 1CLCA 1K8IB 4EI6A 2F8VA 3LB6D 2J88H 5AD0A 4YE4H 1NAKH 1LO0L 1T22A 3VGFA 2MQCA 2J5LB 5BXFB 2E8YA 4N0CD 4PRDA 2DJUA 1UYWH 3GRWA 2YPKB 3CH1B 4UZGA 1QR1A 3DOSA 5FB8A 3C8KA 4TVPD 4QRPD 4HK0A 1PEZA 3CLEH 1PKQB 1FRGH 4M1CD 3C08H 5FM4A 4P2RA 3OPZH 3DX8A 5DMIH 4HFWB 2P7TA 4K8RL 4JREB 5SX4H 1KB5A 3FRPA 2X44D 5ITBL 3TN0A 1G7JA 2XFXA 2CPCA 5DMKB 3VD7A 1P84K 1I1FB 4XP6H 4NM4L 2W1NA 1L7TH 3UYPA 1EFXA 5JOPE 3T4YA 1VFAA 4X7TA 4PJDB 2A6KA 2GK2A 5HHME 5EB9A 3VWKA 1IGJA 2AK4A 5J12B 5JHDD 3O3DB 4TVSa 4N5UA 3G5ZA 3TVMD 1A3LL 4F15C 3VXRD 2AJYL 4Y19E 1A3QA 4LHUB 4HJJH 4OCSH 5CCKL 2R2HB 1D5XA 4EIGB 4LOUD 3P0YL 4L8DB 5IW6A 1J1XL 1RU9L 4KQ4H 1U95B 3KXFE 1ADQL 4K71C 3O6KH 5EZLA 2A0LD 3DUSA 4UI2A 1A7BA 4QTIL 3LDBB 5IVXA 5K9OB 1UB5A 3N85H 5LXGH 4GRLB 1V3LA 1RUQL 2P24B 5BO1L 5I74C 2KDGA 1CVRA 1MIEH 2QQNH 2WK2A 3PABB 3OAYH 3QIUC 1NC2A 1SYSB 3K1DA 1LNUA 2OZ4L 3FT4A 1IGIL 4HXBL 3GFUA 3HC3L 4Z5RB 5DJ8B 2IH1B 2YMXL 5IHUH 1G7IA 1QFWI 3X14A 2UVEA 5I9QC 3LSOB 2DI7A 2EH7H 3ROOB 5J13B 1V7ML 2WBKA 4I77L 5DD0H 1QTYT 2EXWD 5CZKA 2B39A 1HHKA 1U3YA 5JUEH 2H1PL 3HAEH 3DO7A 3KPQB 5HXMA 2X4RB 2VUOA 4RA3A 3TT3L 4JKKA 1EJOL 3V5HA 5C8JB 3UAJD 1VACA 4XX1E 4H8WH 4F7EB 3BGFB 3NN8A 3ULVH 1KGCD 4HWEL 3REVB 1ZXQA 2YKLL 5E5RB 3H9SE 4XCNA 4CVXA 4H8WC 4LLYA 5FO7A 2CDGA 5CJQL 2Q76B 4F57L 4O9HH 4XXDA 3SGJA 3SGKC 1CICC 5ALCH 1FFQA 3RDTA 3D5OF 4LHUD 2C3XA 4OZHA 1QKZH 1D6VH 2R4SL 4PGCA 4HIEA 5DVKA 2O5YH 5J3HD 4E0RB 2VJXA 4LVNB 4NN6B 5MENE 3SOBH 3ZHDA 1S7XB 5DD5H 2G60H 2QSTA 2PN5A 3CPLA 4GRLD 3R1GH 4LSDA 3F7PC 4ALAL 3BWAB 1MHEB 3GEWB 1UQSB 3V5DA 3LQZB 2I9LA 2CKBB 4AG4L 4JY4A 4JZNB 1CDUA 5EO1A 3B5GA 3H9YA 4GW5B 4RMSA 3L5IA 5EU4A 2EO9A 4Z7WA 1TVBB 3QDGB 1V7NL 3DSNA 3LPGA 5CP7A 4PGEB 1MFAH 4WV1C 1TDQA 4KVNL 3MXWL 3MRQA 4PR5A 3B9VA 2EE9A 2EC9T 2ESVE 3D39B 3WS6A 3U4EA 3C6SA 3E2HB 5E9DE 3EYFA 2IADA 4AEHL 1BBDH 2HFEA 4X9BA 5CGTA 1JHTA 1TTFA 3SBWA 5FO8A 3TZVD 4KRPC 3G6JB 3PL6B 2I60L 3D25B 4X7SH 1MIMH 4RZCB 1JPSL 4LNRA 2ARJB 4W70A 2XKUA 1KIRA 5EU6E 1R3HB 4GAGH 3VWJA 2NY6B 3ARTA 3LN5A 2E9WA 3FB6A 3X11B 5C2BL 1T3FB 1IKFH 4HZLA 4LLVB 4XCEA 4HKBB 3OAZH 3WFCH 3LZFL 3ARDB 2EEDA 3SDYL 1BBJA 4OJFH 1ZGLB 4QHNA 1D6EA 1J18A 4WDIB 5JIIA 5HGHB 1ZLSL 1QOKA 1U3ZA 5DGQA 1JGLL 5IHZA 2BJML 5IVXF 1NEZB 1Q9WB 4XBPA 5MHSD 2NZ9C 5IB4A 2HT3D 5EC1A 3VCLB 4TSAH 2HJKB 1OP3K 4PS4L 2D0GA 3BZEA 1DLHB 4KJYA 5HYJE 3DTXB 3EO0B 3I02A 3DVNA 3J7HA 5HHQB 1QSED 1YEDA 4FQIL 4JFED 1REIA 3BRFA 4LPWA 2AVGA 3BKCL 2I25N 1UACL 1S7QA 1P4IH 1P84J 1IBGL 2NY4D 1I8KB 1RK1B 5E6IA 2G9HB 4L9DA 3U7AA 3GK8L 1DQDL 4OFIA 2ATKB 3D39D 5JZ7C 4KK9C 5IFJA 5I8OL 1BGXL 5FYJU 5K93A 1KCLA 4XZUA 4CU6A 3S97C 2GAZA 3HLAA 2H26B 3QQ9C 1KXTB 1NH6A 5ADOH 1K6QH 2EC8A 1I85C 2MWCA 2CLRB 2VLKB 4X6DA 5CIPB 4DGVL 1I8IA 1KBGL 3N1FC 2PYEB 3T2QA 4N0FB 1C5BH 1U0QA 1ONQB 3ZE1F 1FPTH 1WWCA 4OZHF 3TIDA 2DTML 4JO1H 3ARDD 5F6IC 3L1OL 1VENA 4XMKH 4V1DA 1LO4L 3BP5B 4ESKA 2IQ9L 3KYMA 4R8WH 4G6AC 3QAZC 2VB5A 4IBLT 2E27L 5FYJH 2J1KA 2XIDA 1OVZA 1P53A 3CDGB 5GGSY 5HGAA 1UEMA 1YPZB 5DFVD 4H5SA 2OYPA 3BPCB 2X4NA 2Y36H 4G9FB 5B8CC 1J0IA 1G7HB 2XZAL 4WY7H 2ZSWA 4NZRH 1MQKL 2HG5A 2WLYA 4Z7WF 4LCCC 1CG9A 3JXAA 2VC2L 3BAEL 3MROA 4KHXL 3KVQA 3TBSB 3QUZA 4M9OA 4QXGL 1YEHL 1Z9MA 2D31B 3BEVB 4PYHA 1JNLL 1OAZH 4BA8A 5C6WH 2EDHA 5SX4I 5FM8A 5B38G 4WEBH 4Z76B 1H5BB 2R1YB 1J0HA 4L8SC 1RK0A 1T03H 4U1NA 4TQEL 4YXKH 1WCBA 1MFNA 4QOKD 1GAFH 3TIEA 3U30B 4LFHD 3TM6A 2ZJSL 1DANT 2VLKD 2LABA 4TN9A 3HZYA 1HSAA 3BPNB 2PYED 1I4FA 5I8KH 4NT6B 1K4DB 4JZJA 3QDAA 3MLPA 5JHDA 4S1SH 4LP5A 3OJDB 4HQQL 4RAHA 4D9RD 4LDOB 5JLZA 2A83B 4EN3C 1A6PA 1MCWM 2F54E 3GBMH 3JTTB 3VXRA 2VERN 2VXUH 1L7IL 3NCMA 3DVIA 1MFCH 1TCMA 2IBZX 3QDMB 1NGPH 5HI4D 3THMH 2EDYA 1A9EA 4Y1AB 3H7BB 3SY0B 3HC0B 1QFUH 1PQZA 3LS5L 1UJ3A 5EU3B 1HXYA 4ZD3H 4WTWA 3L9RB 4L8BB 4JFXA 4G9FD 5JW5A 1U3HB 1FDLL 3RGVD 5KJRH 4OZIB 2EIZA 3TA3C 5E2WL 1CL7L 3F6LA 2CKBL 5HGDB 3IFNH 3WD5L 3AS3A 2B5IC 2PTTA 2VQ1B 3HE6A 3UYRL 2X4TB 5I1HL 1RZFH 1IGML 3MNWB 2VWEC 3KDMA 5IW1A 3O3AB 1S9YB 2FIKB 1X5ZA 1AIFB 4MZ3A 4XVJH 3H0TB 5FUZH 3TNMA 5IF0A 3X3GL 4YQXL 3MO1A 3Q6GL 1AXSA 1R5IB 1OD7A 5HYEA 4X6DF 2Z92B 4U1KB 1A6TB 5D6DA 3MRJB 5BVPH 2B7DT 2XI9A 1MNUL 5D70H 5FYKE 1YY8A 4O2EB 2VITA 1IAIM 4KUZH 1XF3A 4E5XB 4LP4A 3D0LB 2JK5B 1JN6B 2QSCL 3ARZA 4QRRE 1L6XA 1C1EH 3VI4E 6FABH 3VGGA 1DANU 4JE4B 4YDKH 3KPRB 2IALA 2PCPA 3P4LA 2XNAB 4XCYA 4QRQA 1AC6A 1DBML 2W9DL 3STLA 2NCMA 4LRNL 3QDMD 4N1EA 1LO5B 4NO5B 4Y1AD 5BV7C 4G80B 4K94H 3TWCL 2QQQA 4LLMB 1OP3H 3WJLC 4K94C 1YC7A 3MRLB 5DEFA 3KLHC 3ARBC 1E4KC 3JWDH 1G6RA 1MLCB 4R4ND 5FA4A 2JJSA 4X5WB 1U3HD 1ETZB 2XWBB 2ZOLA 3JWDC 1OF2B 1ZLWK 4HPOL 1JWSB 2EEBA 3IRZA 4NQEB 3ULUH 5LVEA 4NYLA 1GC1H 3GSXA 4NO2A 4CMHB 3ULUC 2CLVA 1GC1C 4TNWK 1SJXA 2V5MA 3D85D 1P7KB 4QWWC 4LEOA 3TFKC 1NKRA 3BIKB 1BD2B 3GSOA 4HUUB 3FONA 2Y23A 4C56A 3NIFE 3IRPX 1CLZH 2ZCHL 3HRZB 1JHKH 4JKPH 5D8JH 3PJSA 3G08A 1MCLA 1NAMH 3LMJH 4OZGE 5DUBB 4AH2B 2AJSH 5E8NB 2BMKA 5L7XH 4HWUA 4MQXC 1X4YA 2NPLX 3VGAB 3WIIL 2NY7H 4G3YL 3U0TA 2PO6A 4RQQA 1MCEA 4HXAL 1MF2H 5SX5K 3ZYOA 2J6EA 4M1DH 4NSKB 1OGAA 1AHWC 1KNOA 4JFYB 1IC4H 1LO2L 4WFGE 5TE6H 1RZIA 3S36H 1IAOA 4PRIE 2EDTA 5IJVB 5GQBA 3QI9C 2E9IA 4PV8B 1P5VA 3D69B 3CK0L 1FGVL 4W68A 5A2FA 1R0AL 3OHXA 3OKEA 3E6FB 2VDOL 2W0FB 1T80A 2VLRE 2GUOA 4XRCB 4LLDA 4JPKH 4NNYB 1CF8H 1S7VA 4JB9L 1FP5A 5GXBB 3O45B 4WTXA 1CFSB 4LF3A 2VE6B 4PJGA 2W9LA 4NQED 2UZXB 3QRGL 3RAJH 1QSEA 4HKJA 4JFEA 4OCYH 3LKSA 4ZODA 3OAUH 4Y4FA 4A6YA 1O7VA 1CGTA 3SDCB 2UZYB 4MJIB 2HKFH 3NVQA 4GRWH 1F3RB 4JJ5A 3P77B 1RZJH 4OFDA 4X4MA 2BVPB 1N64H 1GL4B 3IU4H 1RHHA 1RZJC 5F1IB 3IKKA 1UXWA 2V9QA 2KVZA 4I0PB 4QF1B 1ZT4B 3OMZA 1I7UB 1GRWA 4PJIE 4AT6B 3BI9X 1NGXB 3O6FB 2VXVL 1KJ2A 1U8MB 4M62L 3CMOL 4IRSA 1NUDA 1T1ZA 5IBLD 4QYOA 3B6SB 2D7OA 1IVLA 1FIGH 3TNNB 5HJ3A 1G9NL 3ORJA 5L2JB 2SEBA 3C60B 1Z3GL 4YHNB 2DN7A 5JA9A 5E24E 4OB5H 2JTDA 1E4XI 2AV7B 1FZKB 3QNXB 3QEQD 4LCWD 5GGVY 2NR6C 4KI5E 2RIKA 4PB0H 4KMLB 2IG2H 1CE1L 3L5XL 4FNLH 1FLRL 3SKNB 2DWDA 4NN7B 1I7ZA 4OSUL 2HLAA 5IIEA 1UFUA 5JHLH 3F5WB 3DVFA 1T22B 2H32B 4FABL 2FECI 1GZQA 4KQ3L 3EYOA 3T77A 5JOFA 5T5FH 5DD6A 4ZPVB 3O2VH 4P5TB 3SDCD 3FB7B 2AP2A 5IBUG 4NKMA 5FYLH 2Q8AH 3V0WL 3CXDH 1Z9SA 2WUCH 4POYA 4PTUA 3DX8B 3SDAD 1E27B 4OZ4B 2FRGP 1AO7B 3OKDA 3ARVA 3KPLA 1S9WB 3EHBC 1H0DA 1OGTB 3D0VB 4FG6C 1S7UB 4I0PD 4Q6IA 4GBXC 1H3PL 2A6KB 1B88A 4QOKA 2FEDD 4FXLA 4PJEE 1CDIA 4J8RB 2YZ1A 1KN2H 4I48A 1NFDB 3DETD 2R56H 5F3HA 3K3QA 3R0MA 3FQTB 3TGXA 5IJKC 4NDMA 1ZK9A 4WI5A 3ARGA 1XGTA 1PG7H 3IXTA 4M48L 2FO1A 1G9ML 5KS9A 1JZ4A 1T7WA 3S36X 3CU7A 1OPGL 5I16A 3QG6B 1IL1B 1MWAA 2BVEA 2JB6A 4AEEA 3AS2A 1D3CA 5EZLB 4LLUA 3ZDYF 5F9OH 3NH7L 2OMBA 1SJHA 2BRRH 3MV8A 2QQLL 1INDH 3C2SA 2L4OA 4PJGF 3OF6D 1J1PH 4OF5A 4YDIH 5EOCH 3P0VL 3B43A 1ZLWH 4FTVE 1C5DB 4OKVA 5ANMA 1UM6H 3RGVA 1P9MA 1LNUB 5SWSE 3FT4B 5FM5O 5T1DH 2C4FU 1X5GA 4P5TD 2YD7A 1G7IB 3OKNA 4MMZC 5DQ9B 4PBXA 4NQCE 1F11A 1F6AB 1MJJA 2OI9B 4NC0B 5E8PB 3V4PL 1OW0A 2PR4L 1T0NA 2Z8VC 4BQBA 3KR3H 1AO7D 2B20A 3DO7B 2HKHL 2GK0A 1KFAL 3N9GH 4PJXA 2DMCA 5CZXD 1JTTA 3FT2B 4GKOA 3PWUA 1HOCA 3P30L 4IIQB 3BSZL 4L29A 3VFTA 1GPOL 1GGCL 5GHWH 3RKDC 3S37L 4ZSOB 1ZHLB 3BH8A 5H94A 4CVXB 3RNQA 3L6FB 1ORSA 4GG8A 5JDJA 4QT5B 2XTJB 3W39A 5IQ7L 2GEEA 4S11A 4NC1C 5C0RL 4MQSB 4HWNA 4JPWH 3D87B 3V8CA 4PJ7A 2FBJL 1KJMA 4OZHB 2ZUTA 2P5EE 5F7MC 5I30H 4O2FB 1DE4B 4TSBH 3IFLL 1RIUH 1ZLUK 5I18H 4XCFL 3FRUB 3RZCC 5F7FA 4WW1B 2DF3A 4UIKH 3CPLB 2GCYB 4JANA 2FHFA 4QRTA 4ZXBA 1XF2A 1YEKL 4N0UB 5C0CD 3BQUA 2X4PA 4LPTA 4GKSB 4P3CL 5DRZB 2AGJH 5HYQB 3V5DB 4GS7C 5IESL 2I9LB 1WTLA 4DTGL 2DQJL 2ICEA 3ALWA 4S1RH 4XPFL 1QLEL 1C12A 2H2PC 1EK3A 2DJ4A 3D85A 4JM2B 1F3DJ 5GSRB 4NBXB 4R97B 3QDHA 3C6SB 2DBLH 3EYFB 2IADB 2UVFA 1D5MB 3VI3F 5D7SH 2V2WA 1J1OH 2VH5L 1JHTB 2X4OA 2Y6SD 3BFOA 3CUPB 4WNQA 3F58L 4J6RH 2X4SB 2Q7NA 5JXAL 2VIRB 3C5ZB 3QUXB 3VWJB 3I84A 1NC4B 2RR3A 4OCMC 4K8RH 4ZTPL 3WE6A 1F4XL 4ELMA 3QFJE 5KS9F 4HF5H 2YBRB 2XTJD 4K8RC 5D5MA 3O9WC 3GJEB 2FB4L 3OXSB 3PV6A 4EUPB 1QNZL 4DN3L 4KPHH 4QHNB 4KKAC 1PG7X 1O0VA 5F96L 3T0AA 1HI6B 1FNFA 3QWRA 4WHCA 4XBPB 4GKNB 1HH6B 4LQFL 3EOTL 3G6AA 3BP4A 5EC1B 4NQDB 4OUUB 3AAZB 3NAAL 2NY5L 4Z6AT 1FORL 1S3KH 2OSLB 4YNYA 4KKCD 5GPRA 1TETL 1AKJA 1BIHA 4LPUA 4ODVH 3RI5K 4EI5C 2F5BH 1FSKC 1RU9H 3OKKA 1VADA 5F71A 4MYWB 1R3LB 1K85A 3I3EA 4HH9B 2C7UA 2EO1A 4DGIL 2WWKO 3QDJE 5T3ZD 5LGJB 4O4YL 1C16A 3EYVA 5E0QA 4JM2D 3VFMB 4UB0L 3HI5H 2R9HD 4PJXF 4RISL 2OR9L 3UYOD 2IQAA 3MA7A 3T4AB 3HUJB 3T0XA 4FFZH 3V6FA 4GMSL 3VRIB 4OZFG 4PLJD 1RPQA 5FGCB 4JRWA 1TFHA 4LAQL 4LPVA 4RGOL 5C0AA 2MTPA 1CQYA 2OXHA 5E6ZA 1MRDH 1PZUB 4HS8H 4MS8D 4ZUWB 3FB8B 4LNVA 3WUWA 2GITB 3HB3D 2DYPA 2ZKHH 1FO0H 1RJLA 1T21A 4RWYL 1QBAA 1X5HA 5DK2B 3ZKMD 4PJ7F 1JI2A 1VHPA 3QA3B 4GSDL 4L1HA 4MD0A 2FEEI 1YUHA 1RUML 1JZ2A 3NFSH 4OFYD 2X89A 3S88H 2HT4C 3C6LD 3KYMB 3BMWA 3RVWC 3MV7B 4QTHA 2EDFA 3W11C 1UH4A 1XGPA 2BSSA 3BHBA 3RVVC 4LCWA 3HC4H 4O51B 4NQDD 5DQJA 5DHVB 5EBGA 3VD3A 1IM9B 1S7SB 1T4KB 2JCCA 3LEXA 4MNGB 4R26H 4YHMH 2J4WH 4MXWL 3IDMB 4X8XA 2FJGB 2C3GA 4UMGA 5T1KD 4WHDA 1IEAA 4Q9QH 4KC3B 3MROB 3CZJA 5D71H 2CR6A 2ICWA 5JR1L 1HILB 3CLFL 3ET9F 1MY5A 5C0BE 3LEYH 5T3XH 4ALAH 1AGDA 4XC1H 3EZ8A 5C6TH 3OR7A 3KAAA 3QULA 4N8CH 1RULL 4EEEA 4R0LB 1B4JH 3ESUF 2HRPL 2QQKL 4KZEH 1TQBC 3AFLA 1KCUL 4RCAA 5I73B 1RK0B 4TUOB 2JB5L 3SE3C 5DJ2A 4G8IA 3BE1H 5CGYC 4EDWH 4IJ3B 3RUGE 4FQQA 4O58L 4ELMF 2OL3A 3WFEH 5DURB 5J1TC 3RWHB 1S78D 4LHUG 2DQEL 2KZWA 5D5MF 4X83A 3O0RL 3LH2L 5FYKU 3P73A 1FNSH 3HPJA 2EH8L 3MRBA 4Z0BH 2VLLB 2PTVA 3MOAH 4PLKC 4RNRA 5IB1B 4HJ0D 1CFNB 1NCDL 4NRZA 2X09A 4FQJH 5EZIH 3MV9A 2BOBB 3DRTA 2R0WL 3IFOA 3MV7D 4OLZL 4XNXH 5J6GB 4P9HL 2VDPL 2NZIA 4MQ7A 1EERB 3MTRA 3O3BB 3UO1L 5GJSL 1LDSA 1H9VA 1UJ3B 32C2A 4X6CA 5F7NC 1MAML 1HXYB 3V8OA 1IM9D 3BT2L 5JW5B 35C8L 3SDYH 1U8KB 4JPVL 5GS1A 1XH3A 1DDHA 1DVFC 3DPBA 3OF6A 5CHNB 3EFFA 4N5EC 3UBXA 4MDIA 1J05A 4JQIL 5EPMB 3UTTD 3NZ8A 3PWVA 1RZKL 4NHUB 3UTQB 5SWZB 5MI0B 3GSWA 3QBTB 5T3ZL 4QRUA 2X70B 3W9EB 4PS4H 1OAUH 4W4NA 4Y5YB 1N4XH 4UINL 3T0EB 1M7XA 1CFQA 2UZIH 3WFHA 3BZ4B 1QRNE 3CX5K 4YHPA 3O2DH 2V7HA 3VFVA 4A2MA 1PYWA 1RFDL 3DHJA 1ODAA 3SO3B 1LO3L 3HS0A 1LE9A 5DT1H 4K7FA 1CDGA 3RWCA 1X5KA 1UACH 1XEDA 1HINL 3GUTA 1A1OA 3GK8H 4M6AA 3BPOB 2VYRE 2VITB 5DURD 3NPSB 4DVRL 4DZBA 4FMFA 1BGXH 1JK8A 4XVUD 3IDYC 5BQ7B 4JREC 5A43C 5DWUH 1DLFL 1KPUA 1KIQB 3WFBL 2ED9A 3LV3A 4BFGA 2PCPB 1KG0A 2XV6B 1NANI 1YN7B 1G7QB 1HYSD 2FL5B 5C3LD 4PJ5E 5DLML 2JCCF 4LRIC 3Q1SL 5K9JL 4NFCA 1OAQH 4FQPA 5K33A 4CU7A 2NX5D 1ACYH 4WO4A 5C0JB 2C1OB 2KPNA 3TV3L 1OCWL 4WFHD 4MVBC 3UJIL 5KSUB 4UTBL 3HA0A 4FZ8H 4WEUD 4I18C 4HWBH 5H37H 1F4WH 4N1CA 4M7JL 2GJZA 1PGRB 2ZOLB 1KF9B 2H9GB 5C0CA 3TPUA 1SHMA 3RP1A 1YECH 1I8LA 2DIAA 1L6ZA 3IDJA 3RRQA 4IHOB 2YEZB 4XMPH 2ZNXA 4LEOB 1MEXL 1EZVY 3T1WA 2W91A 4RRPG 5C0GB 4TRPL 2J7LA 3GSOB 2AK4E 5B3JF 3LDBC 3U4BL 3CFEB 1BLNB 1HIML 1YMMB 1MQKH 3ZSSA 4C56B 4KZDH 1HHJA 1DQLL 1MFEL 3A6BH 4MA7L 2E7CA 5IFAL 4E41B 3RWDA 1FYTA 1JZ3A 4OCXH 1ND0A 1GOFA 4OFPA 3BAEH 2YOCA 4KHXH 5F97E 1BP3B 4C59B 3C5SA 4QXGH 4U6XB 2BMKB 4ONHA 4U2YA 1GSMA 1M7DB 1AJ7L 1R3JA 1JNLH 3NCJH 3U0TB 3FMGL 1T2QL 5EG6C 5J13C 4WFFD 2NY1B 5IVXE 5BVJB 1TZIA 1YMHB 3FOLA 2R69L 4I3RH 5FOBB 3U36B 1SJEB 1KLUA 2MQ3A 3I6GB 1NEZG 2FATL 3GZKA 2OM5A 5ESQA 25C8H 1NBQA 1QSFB 4MWFB 1PD6A 3WNPA 1W72A 4L4TD 5ERWB 2A73A 4LSQH 4P2QA 4X6CF 3T8XA 4HPYH 5DJYA 3BJ91 5DA0B 2RJMA 3BGFC 4XNYH 1ACZA 1FNGA 3H3PH 2H8PB 1F6LL 4WCYL 5IT2H 4G42B 5JORB 5C08D 4P4KC 3RX7A 4OQTA 3IU3B 4ELKB 1WBYA 4EXKA 4I3GA 3HPLB 4PGDB 1NCCL 2BNRA 3CC5B 4JO4L 5CEZH 2WP3O 4HUNB 2B1HL 4ODTL 3LKSB 4A6YB 5TQ0H 2ZUYA 4NN6C 4LVNC 3F12A 1TLKA 4UV7H 4U1MA 3LS5H 4PJ8B 1CD0A 3LEVH 4PV9A 2GY5A 1B6UA 1YJDL 4E41D 1W0YT 2ADGA 4LFHG 1V3MA 2DLHA 5I1CH 1CTNA 1IEHA 3ZE1E 5E56A 2XQBH 3WD5H 5HHNA 2E6PA 3UYRH 2ZCKL 5J11B 1NGQL 4FXKB 1KJ2B 4YAQA 4X5LA 1MUJA 3FZUC 4RDQG 3IKCA 5FA3A 1FG2A 5F88A 4KJQC 2NY1D 4X9GA 3VXMD 5LWYL 1T0PB 3Q6FA 1DBBH 4LPCA 5KSVB 3TEUA 4E42A 1OT2A 3MLSL 1DQQB 1PW3A 4XPHH 4IRZH 5GGTL 1AGCA 1J8HD 3T0VA 4UQ3A 3NTCH 1YN6B 3PL6C 5C07B 2A77L 1IM3A 2IAMB 3PGFL 1IFHL 1KLGA 2VISB 3DECA 4Z7WE 4OFYA 3GMNB 1MJ7H 4O02L 2B4CH 1EO7A 1VFOA 1Y0LB 4TPRL 5HYSA 1WBXB 1HYRC 4XVTH 1IKNC 2NY6C 3H9HA 4LGRB 2B4CC 1A7NH 4NQVA 1XGQB 3RA7L 2BNQA 3BKJH 3GMLA 3U46A 5EIIA 4JDVA 5FOJA 3JVGA 3QHZL 5IKCB 3CX5J 3IDUA 4BSVB 3EYOB 4JFDE 1MCPL 5CJXA 2EZ0D 1G6VK 4OLVL 4WTZA 5F7KC 5K59F 4BELD 4PJ8D 4AEIH 1JGEA 1YEFH 3LRHA 1UH2A 3TBVA 2R0KL 1MY7A 1LP9A 4PTUB 4WENB 4UOW0 4KY1L 4KK5D 3W0WA 3PHOB 3QUMA 1DL7H 3VG0L 3MYJA 2HTLC 2WBJA 2VR9A 2VSCA 3KPMA 3G04B 2B0SL 4Y0GA 2AQ2A 1M6OA 1MFBL 3QQ3A 3VU2A 43CAB 5D72H 3FFCE 5AYUH 1OAXL 3VRJA 4DGYL 1E6JH 2FLRT 3O11A 1CU4L 5CINH 5JMRA 5CWSA 1KEML 1BFOA 1G7PA 5E2VL 1BM3L 1T1YA 2HN7B 5CJBA 3DROB 12E8L 4J4PA 5C0ND 3M1BB 4NDMB 1Q94A 4JZOB 4HUMB 2Q6WB 5C07D 3ROLB 3Q48A 2JB6B 2CSPA 2ZWLT 3LN4B 4P2CG 5F89B 4MMXC 4YDJB 3S4SA 1B4RA 1JYVA 1AE6L 1JRHL 5BZWA 1AD9B 1A14H 4Z7QF 1FN4A 5C09E 3ARFA 3QWQB 1NGYA 3PF2A 4HCRA 4KV5F 2JJWA 3WNMA 4RFEA 4GW4B 4HS6B 3P0GB 3WBDA 3EOAA 1I1RA 3ARPA 4ZAKA 3ALPA 3T65B 3MV01 4OKVB 1MCFA 3PNWA 5ANMB 3CK0H 5BRZA 3DI2B 4Y5VA 1WTGT 3QCTL 2QV2A 4WUUB 4UUJA 2Z8SA 1FGNH 3RKPA 4TNVF 3IJYB 4HT1H 3SEPA 2HFFA 3F62A 4Y89A 4GXVH 1MI5E 3PG2A 3DX6A 3NBNA 2BVOA 5E70A 3GJFK 4HV8B 2IH3A 4M6NH 4NZTL 4RAVB 3NIDE 1FFOA 4V1DE 1ZSDB 4KU1A 2HVJB 2J8UA 4LCYB 5A3IC 2E7LA 3ZL4H 2DQGH 3PWNA 3ZTJG 1ZHKB 1EGJH 5KSAC 4WWKB 5JNYB 3RPIA 1QP1A 1XCTA 5TGBA 1H3WM 5JXED 1PAMA 4NQSA 3M17A 1U3JA 4JRXA 4I13B 1ORSB 4XP1H 1XGRA 4LGSB 1MHPH 1U8JB 5ICZB 4F8QA 4QHUB 1VFMA 3BPLB 2R0ZL 1VFBA 1R5VA 4OD2A 1N0XL 4FP8H 4UNTA 3LKRA 2Y06H 3U7YL 5DJDA 5EUOA 4IRJA 4M62H 4LK4A 4M1GL 4PJHE 3EO1A 3CMOH 4NFBA 3U30C 1A7QL 4UU9B 5KVGH 4HIJB 5B21A 2EDOA 4XPBH 4PP1C 4QRPE 4TVPE 4OLWH 3BPNC 1A22B 2JIXA 2NX5A 3OXRA 3SJVB 1XF2B 3HHRB 4PG9B 2BNUA 1HQ4A 3BQUB 3FB5B 2IJ0C 4Y4KD 5T1LD 4U1JA 4Z77B 2OX5A 5DUPL 1OQOA 3VXPB 4A6YL 2YC1A 2YA2A 3CCHA 2ICEB 3IT8D 3RQ3A 1LP9F 4WUUD 3SDDA 3N1PC 3L5XH 5MEPB 1A3RH 1C12B 1FL6B 3QEGL 3BXNA 1XCQB 4UOW1 2DQTL 1HHIB 5D7IA 5FDWA 4UQ2A 4K2UL 1WT5A 3A6CH 4UT7L 5C0IA 4ZOBA 5D1XB 1D7FA 5JHDE 3U7WH 4APQA 2YWZA 5LBSH 2BVQB 3QIBD 5D7KD 2YWYA 3VXRE 4WNQB 1WCQA 2ZCLL 2O5ZL 3IS1X 5FKAB 4EBQL 3B9KB 3E0GA 4PB9H 5IG7B 5A2LH 4QNPF 2CUIA 5TE4H 4WWKD 3MJ8A 4MAYB 1QEWA 4GKZB 4YHIA 1L4IA 2M1KA 4X4ZA 1FVCA 4MCZA 1Y18A 1ZKAA 1MREL 2ZUSA 4Q0XL 2IAND 2RHEA 3NA4A 1UWEH 3T0WA 2YK1L 1ZEAL 2F53B 4OF8A 4GQ9H 3PIQB 2N7AA 4LDLB 5IB3B 1QYGH 4FHBD 1I1AD 2CO6B 2YZ8A 2X1QA 3WIFA 3MLVH 4DW2L 3MODL 1AGBA 3ZSTA 4NJAH 2XTLA 5C08A 4H1LH 2DLFL 5E2TL 5IMMA 1YNKL 3DO3A 4ZFZB 3EYSH 2YD1A 3U6RB 3BGMA 2R1XA 3JV4B 2ZG1A 1ZHBA 3GSVB 3NACH 1HKLH 4QO1A 4WJ5B 1CXIA 2XKNA 4UTAH 4NP4H 4LASL 5HDQL 4K3JH 5E00A 3WFZA 1KGCE 4PJDE 5TE7L 2R29L 4Y4HC 3VFRA 2P8MB 3S9DB 3RTQA 1EEYB 5D1XD 4ZUVA 2J8UF 4R96B 3D18B 5IOPB 1EUTA 5AZ2H 2G75A 3NGBB 5E8DL 4JRYA 4N8PA 3HI1B 3PGCA 5C92A 2VO5A 5IB5A 4F7CB 4ZS6D 1CLYL 5INCB 3ZKNC 3MUJA 3GMQB 1UEYA 4CMHC 4WEMB 3RVXD 3LPWA 3AGVA 1DUYA 5I1EH 4MAYD 1QFPA 2DYPB 2NXZB 1WBZB 1RJLB 2PR4H 4K7PX 2ED8A 4N0YH 4KI1A 4KJWC 1X4XA 4AQ1B 1EHLH 3MJ9L 3VXMA 4CNIB 1P6FA 4JDZA 1B2WL 1FBIL 2A2QT 3I75A 5JW4Q 1X5XA 3B3IA 4F37K 5EUOF 2F53D 1EMTH 2I5YL 3U9UB 1Z6JT 2DQUH 4FZEL 4MA8L 2DTSA 3A67H 3RWJB 5L2KB 5DD1L 1DQMH 2JF1A 4QTHB 4NRYA 3VGAC 2CK0L 2C5DC 2ORBH 3WNKA 1FC2D 3RY4A 1WSST 3VXUB 5DQJB 5CBEB 5C0RH 1D5ZB 2JCCB 5C9JB 4ZO9A 1KCRH 3LQAH 1FVEB 3FQRB 1N26A 3G5XA 3HZVB 5BOPA 4R7DB 2FSEB 4OCNC 1D5BA 3MCG1 2OQJA 4WVRA 1Z0MA 3RY6A 1IEAB 4I2XB 2BC4A 3P4OA 1VKXB 3NFPA 5CKAA 3UDWA 3BYTA 1LGVA 1A6UL 4Y19A 1U2HA 5D7IF 1YEEH 1YEKH 2NTFB 4FOMA 3GO1H 2GIYA 2WUBL 5EU7C 4L4VB 3GM0A 4IMKC 3GB7A 3GJFH 1AQKL 1Q9KB 3AMLA 3H2WA 1U8HA 3VRLF 2GFBB 4JO2L 4OBRA 5I0ZA 4G6JL 1S5IL 4AYFA 1I1YB 4OD3L 1FL5A 1TQCC 1F2XK 1R3KA 1O7SA 2Z35A 3N1QC 4LCUB 5FCUH 3K7UA 5MHSE 1UA6L 3RL2A 3REWA 3PHSA 4UV4H 4AEFA 5I8CB 3P73B 3HPJB 4BKLB 3MRBB 3PDGA 3SKJL 4KKNA 4G5ZL 2NTSP 1LDPL 3BVNA 3WLBA 1AGEA 3DRTB 2A74A 1QSEE 4NCDA 5I74B 1J0JA 4JFEE 1BF8A 2AEQH 4W4OA 4CN1A 4OLEA 4MQ7B 4U4BA 2E9BA 3O6FC 2OTWA 3HMXH 3VXUD 1BPVA 4S0TD 1MHCA 5EO9B 1T04B 5I2IA 1ZLVH 4OFVA 2DWEB 1QNZH 3AU1A 2APVA 5GS1B 3D39E 5KG9A 3H3BC 3C60C 5TPWH 1HH9B 2D3VA 4MDIB 1J05B 4Z18A 1TITA 3LS4L 3GI9L 3QNZA 1ZT7A 1AP2B 3G6JE 3P9MA 4JGUA 4QRUB 1U8QA 1FCCA 1HKFA 2NY5H 3E6HA 2Q20A 3HAEB 1P1ZA 4X80L 3VFWB 4MXVF 1A7PH 2NY5C 1WFNA 4L4VD 3VFSA 1I9JH 5MENA 1CI5A 2V7HB 3IDGA 3GRWH 2Z91A 3AREB 2RCSL 2X4UB 1I3RA 3GHEL 1ZVSA 1IZKA 5TQ2L 3T1FB 1CICB 2H41A 2EDEA 4O2CB 5FKPA 4XNQA 3QYCA 2HFTA 4EZMA 4P5MA 2FZ3B 2WIIB 3EYUL 5ACLA 3MREB 1J87A 1KB5H 5J7CC 3LKPA 4P23A 4HK3J 1B3JA 4PJCA 5F72S