4M02A

Middle fragment(residues 494-663) of the binding region of srap
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
169
structure length
169
Chain Sequence
AVTQVRYVDVTTGKDIIPPKTYSGNVDQVVTIDNQQSALTAKGYNYTSVDSSYASTYNDTNKTVKMTNAGQSVTYYFTDVKAPTVTVGNQTIEVGKTMNPIVLTTTDNGTGTVTNTVTGLPSGLSYDSATNSIIGTPTKIGQSTVTVVSTDQANNKSTTTFTINVVDTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Calcium binding protein
molecule keywords Serine-rich adhesin for platelets
publication title Structural Insights into SraP-Mediated Staphylococcus aureus Adhesion to Host Cells
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 45
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2013-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m02A02
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 4m02A01
2D7QA 3FMGH 5D5MF 2R1WA 2QQNH 3HI1B 4KUCF 4PJ8C 4P4KA 2JJTA 1RFDH 2IAMD 1VACB 4CMMB 2CLRB 2YPLA 3MJ6A 5D7JB 2ZWLT 1UWGH 4UINL 2D4FA 1ZLUH 3MOBL 4HIXL 3HG1D 2BDNL 3B9EA 3GIVA 3MLZH 2YPVL 3ZL4H 2DQJH 4RRPA 5GGTH 1FJ1A 1I3GH 3HAEH 3HG1E 5CJOH 4XC3L 4V1DB 4HIHB 1CFNA 1YY9D 1FIEA 1A2YA 2CKBB 3QJFB 1JVKA 1LDPL 1Z2KA 2ZKHH 4XNUH 5DJ8A 5EOCL 4GXVH 4FFZH 3PQYB 5GS1B 1BVKA 4P2RE 1B88A 4QRUB 4PRPE 4KVNL 4DQOL 4F7EA 4JZNB 1XIWA 4EUPG 1MRDL 1FBIL 4Q6IA 4ELMA 3WNKA 4R7NA 4R3SB 1TPXC 2EDJA 5DLMH 3DETD 4JHWH 3HI5L 5DJAB 4Z8FH 4DKAA 1KYOJ 3ILQD 1HSAA 1YEEL 5B39B 3BH8A 1SYVA 1C5CL 1VA9A 2NZIA 3QUYC 5ID0A 3JWOL 4WCYL 2IMMA 2B7DT 5DJZA 3HNTH 1DL7H 3BDYL 3OJ2C 4Z7WF 1JI2A 3BQUD 4KUCD 3RY5A 1QSVA 1LO5B 1GIGH 2Y07L 2Z35A 4YUEH 5FUZH 4O2FB 3QH3B 3MNZA 3SDDC 4JPVL 4ZO8A 3GMQA 3L3IA 1WC7A 3RVTC 4MDJB 1DANU 1T0PB 2IAMB 2YXFA 3F6LA 3BPLB 4U3XA 5BOPA 5BMFL 3AFLA 1I1YA 5E2WH 3KPOA 4MB3A 1NMAH 1MI5D 5F7DA 3HG1B 2HT2D 3G5VB 5J13B 1DCLA 2IPTH 3ARGD 4JCMA 3LEVL 1MI5E 3FOLB 1NLBL 3WO4B 3D0VA 2DQFB 3OJDA 3QA3A 3QI9C 4Z7VE 3SDCC 3MRKB 2PW2A 2AI0L 5F1OB 2EXYC 2D7TL 3GRWL 2L7JA 3WSQH 3PABB 3NA4A 3NN8A 5I2IA 1R3IL 3CZFA 4JO2L 1T1XA 3PNWA 5L88H 4EN3C 4JFPB 3OZ9H 3WKMH 2WUCL 2VXVL 2FL5A 1KJVA 4G8EA 4PD4K 4PP2A 4F57L 4R2GC 4N8CH 4LLYA 1G7QB 1I1FA 1TJGL 3OBAA 3QDMA 1WBXA 3OPZL 2A6IB 1J8HA 3QPQC 4YE4L 1V7MH 3TVMC 4MJ5A 3TH4T 1JUFA 4PJHE 5CSBA 4U6XB 5T5FH 1LVEA 1H3PL 4P3DB 3MRPA 5C7XH 1ZT1B 1JTPA 4Z7WE 1C5DB 5D5MB 7FABL 4Y5XB 4LOUC 4FQ2L 2BVOB 3GMLB 2MOVA 4B7LA 5CEZL 4NO0A 1V5JA 1T2QH 1HI6A 3GDBA 4MAYD 1CFTB 1C5BL 2AJXL 4R90H 1AE6L 4WDIB 3BIKB 5AZ2H 5C0JA 1YUHB 2ZOLB 2QSTA 5IF0B 5IEHA 2CGRH 1XGPB 1CF8H 1U8LB 1NQBA 4WUKH 4G6ML 4PJCA 3NACH 4U6HB 1MI5B 1CDHA 4FRWA 4D0DA 3QULA 5F89A 3O2VL 3LVEA 4UBDD 3CU1A 3ARGB 3VFVA 1JN6A 1CGXA 1J86A 4DKFH 4P57A 2GITA 3S3JA 3G5XA 3FFDA 2VR5A 4OZIE 5CCKH 1F90H 3QBTB 4K9EH 4UZGA 1NGYB 3QXAA 1ZSDA 5BVJA 4X4XA 3GI9L 4XP1H 2ENSA 5EC1A 5I15H 4S1DC 4U2ZA 3OKLA 3PWJA 4WW1A 4LSUH 2R29L 3FT2B 1CL7L 2D0GA 5IEKB 2PCPA 1QHOA 1KCUL 4XZUA 5ENWA 2G9HA 2Y4SA 2EKSB 2X09A 2JE8A 2R1XB 1RULH 3D2UD 5D2LF 5CJ8A 4P2CG 4UQ3B 3FJTA 4UIMB 2ORBL 4HJJL 4NUGH 1BOGA 2HLAA 4Z7WB 1BMGA 1KB9J 1CL7I 5FM8A 1QSFD 2YD9A 5ICZA 2Q8BH 4A6YA 4PJ8D 2VC2H 2ICEA 1QSFE 1M6OB 5AYUH 2FYYB 5C0CD 5JDSA 1X5FA 4Y8AA 1KIPB 5C0CE 1HHGA 1WIUA 1XR8B 5C07A 3TLRA 1WAAA 3CPLA 4MAYB 1U41A 3TCLA 1GGIL 5ALBL 4QHUB 1R3JB 1T4KA 1ZOXA 4YC2B 4PJXF 1RIVH 4ZS6C 5T3XE 3EJZC 4S2SB 1A5FH 4HH9B 1KT2A 5IJKC 1A7PL 5CILH 3ARYA 2X89A 4PTTB 3HHRB 1GGBL 1A4JB 3RWHB 1HINH 4PJ7F 1RK0B 4J3TA 1GAFL 2GHWB 1QFHA 3OKEA 5IKCA 1D5BB 1AKJD 2ZUVA 3RJDA 5SX4H 2AP2A 2GI7A 5C86A 2AV7A 5TPWH 4R0LC 1LE5B 2GJJA 5FGCE 3KWWA 4JZJB 2P5WD 4RIRB 3EZJB 4ZUWA 1JGUH 4JVWA 3EOTL 2HJFB 5KSBA 3V6OC 4F2MA 4R26H 4U1MB 2WV3A 2WM0A 3QUYD 3SE3A 1DBAL 1EHXA 1CD8A 2C4FT 4Y4FC 1EMTL 2RFXA 1J1PH 2Q6WA 2UVEA 5E8EA 3ARWA 5C08A 1RK1A 5BVPL 2Y25A 3D2UB 2XZQL 3DI3B 4BSVB 1JMZA 5I74B 3QNYB 4YNYB 1X7QB 1MIML 4JPKH 5DA0B 3SDDD 5DJ6B 4HEME 1QSFB 1N7MH 3HR6A 3QDJD 3RVTD 5FB8A 4PJ8B 1UZ6F 4XBEL 1YEGL 4S1QH 1ZK9A 4MA3B 5C0CB 1DJSA 3OB0H 4PJIF 1PDKA 2C3GA 1JJUA 5LGHH 1JNNH 3VWJA 3GNML 1G9MC 2EDYA 2V7HB 3QUKB 4PJXE 1C1EL 5EOTA 3HRZB 3LIZL 3NZ8A 3QI9D 3A67L 4JM4H 3VXMA 2H41A 3QCUH 1OTSC 2EXYD 2Z4QB 3U7YH 4OFVA 1OAYL 4GKZA 1E6JH 4PJ7E 4JG0H 3T2PA 4HGWA 4EN3D 4MDIA 4ZTPH 3H42H 1RAMA 1A21A 5D2NC 3ZTJG 3FB8B 5GGTA 4QXGL 5INCB 3UO1L 2J4WH 1AKJB 2IBZY 5FGCB 3NTCH 1OGAE 4R2GD 4E5XA 4ZYKA 3OR6A 3WXWH 5GGRA 2P5WB 1N5AA 2BRQA 3QPQD 3NCJH 5GJTH 3TVMD 5JLZA 3OKYA 1A6ZB 4HMCA 3KLAB 4PRBB 5EPMA 4PJGE 4EEEA 1UWEH 2EDWA 3QUYB 5D2LB 1S7VB 3I02B 3GMRA 4Y4HA 4N8VB 4RSVA 5GJSH 1Z9MA 5DJCB 4FZEL 3DVNA 4LOUD 3CCHA 2H45A 3QWRD 4KUZH 2OX5A 1FGNL 1FAIH 2R9HC 2D7MA 1JGDA 2R4RL 3P73A 5F9OL 1TCMA 4HUNB 9CGTA 2H6PA 1BX2B 4GQ9H 1UZ6E 2Y7QA 1JF5A 3QDJB 4H1LG 3MGAA 3L9RB 1ES0B 3NCFB 3BD4A 4E42B 4YAQB 2CRIA 4R4NC 1BM3H 4PBWD 5DYOB 4PJXB 5ERWA 2XA3A 3IJSA 3QUXA 4MX7A 2ADIA 4YR6B 2NNAA 3O2DA 1XGYH 2BP3A 4FABH 1OVZA 3BHBA 1NKOA 2R4SH 2I9TB 1IAMA 3MODL 1WTLA 3WIIL 3G04B 1KXQE 4I3SH 3L5WA 5EOQH 1FFPB 4PJ7B 4RNRA 3MGTA 3MUJA 4CDHA 2OTWB 2C26A 1DLHB 4PB9L 3MSPA 2YS4A 2Q87A 3QFDB 4EN3B 2WIIB 4S1DD 3E6HB 2JCCF 1FIGH 5EBLB 3VMOA 4XH2A 3VDBA 3O6LL 4BFGA 4YIQA 4MLSA 4LMQE 4R2GB 1ZHNA 4LSTH 3HE6C 5CP7A 3OAUH 4M01A 4U1HB 5FYJL 4HUMB 3SGJC 5TDOA 3QHZH 4MJ6A 4HIJA 4MSWB 1PKQE 3GM8A 2FEDC 1MCWW 4XAKE 4YDJB 3TVMB 4BA8A 1RI8A 4LSRH 3GSVA 3P40A 3FO2B 3JV5A 4FQIL 2PYFA 4L9LC 2B39A 1IC7H 4XCEA 1G6RB 4UV4L 3IDJB 5SX5K 3X14B 5EZJA 4LSPH 5A2LH 1Y6MR 4NUJB 3UPRB 1BVZA 3L3HA 5FM4A 4MA7H 2XKNB 5ETUB 1Q9OA 2UWEA 1TZGH 5GGSB 3LKSB 2X70B 1WFTA 4EXPX 1PY9A 5IQ9A 3VH8B 5BJTA 4PJIB 4LLDA 4LLUA 4BSJA 4LRIC 3RWCA 1G6RL 1IQWH 1XGQA 3EDJA 1RUQH 3ZE1E 1CIUA 1R5IA 3OF6D 1ZGLP 5FV2A 4QO1A 2R23B 5EIVA 3ISWA 2XN9A 5HI5C 4K3EH 3WUWA 4F15C 1GGUA 3V6BR 5FOBB 3HNVH 3UDWC 5T1LD 3D69B 2A6JB 4LLVA 5B22A 1UYWL 3FTGA 4X5XA 3RTQC 4L4TE 4KHXH 4ODUB 1WTGT 1A14H 2NR6C 1IQDB 5I19H 4HUVA 2BX5A 3MRFA 3ROOA 4RA3A 3WL9B 4QRRD 4QRTB 4WHCA 3WDHA 4OUUB 2XY2A 4ISVB 1J0ZA 4QRRE 3FHAA 3RPIB 2Q86B 2AJ3B 3LN5B 1OF2A 5E2VH 1T20B 3HB3C 3T08A 2LQRA 2VAJA 1D5XA 2DJUA 4H25A 2R39A 3V6OE 12E8L 1SHMA 4ZFOB 1IC4L 4Y4FD 4GBXA 1KOAA 1RURH 1QSEE 3KPMA 3EYFA 2MCPL 3EYUL 3KPNB 3FHQA 4MWFA 5HHPA 3RWJB 5E8PB 4ZFZA 4XVSH 5IVXE 2R0KH 3QPXL 4U05A 4MNHB 4XXCC 4U1GB 1YEIL 5HY9A 2CUHA 1ZE3C 3KPLA 4MCZA 4BQBA 3RZCA 3UC0H 1F4AA 4ZFOL 3VD5A 3G6DL 2NW3B 3RIFK 5TFSL 1RIHL 4Z77B 3EGSB 4AEIL 3F7VB 1KEGL 1WCBB 3BE1H 3ELAT 2ZP0T 1A1MB 5C9JB 4NZUL 3H9HA 8CGTA 3MXWH 3ZKNC 5KTEL 2HAZA 3RQ3A 1GGYA 1OSZA 2OSLA 3CFEB 1OTSD 3P0YH 4NNXA 4LBEA 1ORSB 1IGIL 3ARDA 3MLWL 1P6FA 1VESA 4HWEL 2CLVB 3O0RH 5KANG 3RRQA 4PUBL 1KNOB 5T1LB 2FX9L 1JBJA 2HLFC 1OB1A 2JLLA 1OARH 3HPLB 3KYMB 4XWGL 4YDLC 4P2QD 5KSAA 3CFKA 5MEPB 5LBSH 2JCCB 1N8ZB 1GPOH 5HPOA 3IU3A 4R0LB 3UBXA 4CDGC 4QRRB 3MRDB 1YN7A 2BVEA 1I3UA 4I0CC 1PG7L 4LHQB 3QDGD 4ZAKC 2AJZA 2FD6L 2D9CA 1T1WB 5E00A 2Q76B 4U1NA 5E2TL 5ELIA 1JGVL 4JFYA 1MVUB 3ULVF 4Y4FB 1UKQA 3SE8H 3GEWB 4GXUM 4PJ9C 3QAZC 1T04B 4IRJA 2R9HD 1K3ZA 1W72A 3C5JA 3PWPA 4L3EE 3L5XH 4QXTB 4CU7A 1QNZH 4OLZH 3IDIA 1G7MA 1S7QA 4XBGB 5E8OB 5HYSB 3O2WH 3SBWC 4D3CH 2X05A 4R4ND 4NQXB 2IALB 1YYLL 5HGDB 3PGFH 4FQLL 3STZA 1LEKA 4JG1H 3PWNA 5HYQA 4XCYA 1DQLL 3LQZB 4LEOA 4NBYB 3VGDA 3L7EA 3IXTA 3TV3L 1QFUL 1KENH 4NN6B 4Y88A 2FJFA 3STBA 3T09A 3S5LA 1RJZA 4NJAL 4OFPA 2R15A 4ZXBC 4RX4D 1U8HB 5TE7L 1WBZA 3GMPB 4JFED 4X0KB 4BSWA 4C57C 5D2NB 2B0SH 2W9LA 4ZPTB 1IL1A 4D9LH 1YNKH 3SDXF 1TVHA 4P2QB 4OV5B 2HRPH 4JFEE 3HE6D 1G0DA 2H32B 5JZ7C 4OI7A 3IF1B 4OAWA 1NCCL 2X4PA 1D5IH 2FEDD 4XRCB 1AGCA 3VCLA 5CIPB 3ULVD 2VXQL 2EYSB 1T83C 1KACB 3QDGB 4HCRH 3VFUA 1I7ZB 3U0TB 4IOIB 1JF1B 3CFIC 4KVCL 1MLCB 1JPSL 5ANMA 2CIKB 1CFQB 1BLNB 3UAJC 4YHPB 4DGYL 4HKZA 3R8BB 4G8FA 5HJ3B 3MLTA 2JB5H 4FQJH 3RFZC 2HG5A 2GJZA 3L1OH 2R69L 5EO0B 2YC1A 2G5RA 2LU7A 5JXAH 4TOYL 1HXYA 2RBLA 5ITBH 4N0UE 1KN2H 5A1AA 5HI5D 5E94B 1JYXA 4UT7L 5C09E 3I84A 4JFOB 3ULSB 2C1OA 3O4LA 4F7MB 1XFPA 5GS0L 3RTQD 2C3XA 3W5NA 3HMWL 2QSCL 3TBSA 2UYLA 1HK6A 5HYIA 2VDKH 2NQCA 3OAYH 2QHRH 3BAEH 1CFSB 2ADFH 4YHMH 5ESQB 3MA9L 5E4IA 4JFEB 4F7PB 1MHCB 3E6FB 2OBGA 3FQXA 4TSBL 4BK4A 5EA0L 3HB3D 2XYCA 4CVWA 5D1XC 3FMGL 3DROA 4Z0XA 3HE6B 2QQNL 4CJ0A 4YEEA 3I9GL 4ZS7L 4BFEA 5FGBC 1VKXB 4CUCA 4LLAA 1UQSA 4YGAB 1UWGL 2FBJL 1RUKH 4X5WA 4X9HA 5DRXA 3HE7C 3MLZL 4OGYH 4L9LB 5D9SA 3TC9A 3D3VA 2DQJL 3NFNB 1T22A 5IB4A 5HXMA 3KS0H 4K3JL 2R0ZH 3DMMA 3KLSA 5CJOL 1SJHB 1G7HB 1WQVT 3MNVA 2A74B 3OQ3B 5IW6B 3RX8A 1CD1A 3SHSA 2GFBA 5DJ2B 4LSVH 3CK0H 4ZOBA 6CGTA 4RAVB 5DVKA 2AV1B 1FL5A 4TYUA 3MCLH 4GXVL 4WI6A 4FFZL 5KJRL 3ULVL 1EAPA 5JIKA 1XH3A 5E9DD 1FFNA 2X1OA 4LCIH 4J4PC 3ZKND 3REVA 3PWUB 3CX5J 2C1PB 4HLJA 3QIUB 5CBAB 1FDLL 1AIFB 5E9DE 4K7PY 4AM0B 1K4DA 2BVUA 1FYTA 4F15B 2IH1A 2VKXA 1SY6A 4V2CB 4UAOB 4JAMA 3FRPA 4Z8FL 1FNGA 2HLFD 4UTAH 3N1FC 3RTQB 4I3GA 5HPMB 2CR6A 4KJYB 4URTB 2AS5M 1YYMH 2FHBA 5EO9B 1DL7L 3SDXB 2Q7YB 3B5HA 4RFEB 1H3UA 1ZWIA 3O3DB 2DQDL 4U3HA 4OF8A 4WEMB 1HSBB 1VERA 3L7FA 5F9JA 2EO1A 4ZAKD 2O61B 1IEAB 5A3IC 3GSOB 5LVEA 1B9ZA 2MNUA 3IDUA 4JHBA 2A2QT 4R4FH 1NFIA 4PJ9D 3BZEA 1U92B 3RJQB 4X6BB 3BP7B 4RFNC 5DHYB 5D7IA 3MGOB 3DO7A 5IK3A 5DQDH 4J6RH 1A3RH 5D7LA 1SMOA 4KHTH 1MRFH 3TBVA 2E6JA 3E0GA 1EZVX 4X6DA 1LEIA 5ADPL 3QIBC 1VHPA 1U2CA 4AT6B 4NQDA 1EFQA 4O51B 1X3DA 2EE3A 4W4NA 2EZ0C 3IDMB 5E9DB 2HMID 4OZ4B 3F7PC 4QHKI 1R5VA 4N8CL 2A1WL 2V2TA 2WZPD 4FP8H 4M6ML 2UZYB 4ZXBD 4RGMC 2B20A 1TQCC 2H9GB 4Y1AD 4Y5VA 2W9EH 5I66A 2W0LA 4DJMA 2VLKD 4H5SA 4P3WA 5T5FL 3ZTJH 4TULL 2WUBL 4YDLB 2I5YL 4GW1B 4P0DA 3RDTC 1IAIM 2VLKE 1RUPL 3DIFA 3PIQA 5JZ7D 2G75B 4GH7B 3WO3B 4PGBA 4FXGA 4YHZH 1BF2A 1R6VA 1GC1C 4OGXH 3P9WB 3RUGA 5HVWA 4FXLA 4AY0A 4ZAKB 2H8PA 1BVLB 1HKLH 1T2QL 1N3NB 2VL5A 2ZNWA 2JB6B 1WIPA 4EUPA 3NIFF 2BOBB 3IDYB 2IWGA 3UAJD 2RR3A 4GG6F 4PJ9B 3FQTB 3DJ9A 3QAZB 5IJVA 1QFPA 1FG2B 4MNQA 1T7XA 1F6AA 1R3KB 5FM5M 2EKJA 1FO0B 1JPFB 1OTUC 3N1MC 4P9HC 4HT1L 4NM4L 1MEXL 4DKFL 4PBVC 4YBLC 3KHOA 4H1LH 4PYGA 2ZUQB 4FMFA 5CZVH 3WHXA 4K9EL 4D0BB 5ID1A 1AGBB 5J11C 2CUIA 1B4RA 4ODWA 2A83B 1T80A 2O26U 5I15L 1VFAB 3MYZA 3RKDC 5FM5O 4F9PA 1WLHA 1DLFL 3BH9B 5FFLA 1JFQL 4OIIH 3RI5F 2DTSA 2NY2D 5F8QC 5CEYA 1UC6A 5M94B 5DDHA 2X4TB 3CVHA 3HC0A 1PQZA 1RUAH 1KCSH 1PGRB 3O11A 2OP4H 4ZXBB 4Y1AB 1UJ3A 5E2JA 1KEMH 2ZSVA 4NUGL 5SWZE 1UWXH 4X6CE 4JDZB 4KH2A 4OGZA 5F1IB 4TQEL 5D1XD 3FQUA 5C8JB 4HGMA 1LK2B 4WFFD 4UIKH 3EYVB 5CKAA 2PW1A 3VXRE 4NGHL 4GMTL 4NQUA 4OTXH 4JVPA 3ZTNH 1HE7A 3L3DB 3LS5H 3PJSB 1KJMA 3QQ4A 5I8KL 3V5DB 1KN4L 2P8MB 2Z91B 3HE7D 4NWTL 5JOFB 3LN4B 4M5YH 1SVZA 1AXTL 3ARXA 4J23A 2HA1A 3S8WA 1HCFX 4UUJA 5EZIH 3RWEB 4YQXH 2AK4D 3VJ6A 1MFNA 1D9KC 3L3OA 4HUUB 1OD7A 1H3GA 1U8OB 1IKFH 4G7VH 2AK4E 4HCRA 2DWEB 4JR9L 1MWAA 4XI5C 1S9YB 4J7RA 1P9MA 4K3DH 5DVLA 5F3BB 4J4PD 1B2WH 1A6UH 2EYTB 1SBSL 3ARBC 3EYSH 4OCRL 4ZD3L 1HEZB 1JZ3A 5E08L 5GZOC 3FN0H 4GKSB 1DTUA 3WN5A 4G43B 3VI3F 5AG9A 3G6JF 1X5AA 5GQBA 3CFBB 4N90E 2NY2B 4BQ8A 4DGIL 5EH1A 3IFOB 2NTFB 5SX4I 5JHLH 5JOEA 3GBLA 1F3DH 1J1PL 1L0YA 3BP4B 3HZMA 3DOSA 5J7CC 4X6CB 1CIDA 1IC5L 3T0EC 5BS0A 3AC0A 1MFCL 4ZTOL 4JPKL 3C2AH 5LCVL 5D1XB 5A3ID 4O4YH 1U6AH 3LQAH 1B0GA 1LNUB 3AS1A 2IG2L 3MUZ1 5J4MA 4OF3A 4QOKA 1JNNL 4M3JA 3HE7B 1W8OA 3O8XA 3UTTD 4N0RA 1K6QL 4MD4B 1GJIA 5GGVL 4M7JH 1MJUL 3ARTA 4R4BB 5C3LD 5L8JB 5DS8B 4NQTA 4HLZG 4DZBB 4ODVL 4MS8C 2OJEB 5DXWA 3TPUB 4JM4L 2AK4B 4PD4J 4JPIB 3QIBD 3U7YL 1IM9D 4W4OA 5KVEH 1E6JL 3Q3GB 3GSNB 3A6OA 5DJ0A 3H42L 3S36H 1JZ7A 4FTVD 2J4WL 3FRUA 3NTCL 4IEFB 1CT8A 1CXKA 3FT4A 3O3BA 3WXWL 1JZ2A 4H0GA 3KJ4C 4AG4L 3WUZA 1K8DB 2Z93B 5F7UA 5HHXH 2RIKA 3G6JE 5GJTL 2GUOA 1R3LB 2D31A 4HFWA 3GSNL 1MCFA 4LCYB 3MRRA 3W0WE 3RDTD 1UCBH 4MJ2A 4M6NH 3AU1A 2GSIA 1UZ8A 5EZLA 1MCRA 1D6EA 4Y2DC 4JKPL 1FVCB 3WJLC 4L4VA 4BUGA 4S1SH 1FCGA 2RJMA 4KUZL 1MJ8L 4ZSOE 2V9RA 3MRIB 5MHSD 3L3KA 5EUOA 2NX5A 1BECA 3K7UA 1LO0H 1XCQB 1X4YA 2WAHA 4W6XB 3VRJB 1CK0L 4P4KC 1J1XH 4MXVE 2JJTC 4NC0B 2W9DL 2KH2B 4ETQB 1KELH 3UTTB 1SM3L 4RFNB 4U1LA 1XGYL 1OTUD 3DX8A 1PSKH 3DUSA 5CSZB 1Q0YL 1HILA 2R4SL 4JJ5A 2HVJA 4JZOA 1IC1A 5DUML 1S9WA 4BELD 1KFAH 3LKPA 1CDGA 1JNLH 4I3SL 4CU8A 2JIXA 5F7FA 4LCWE 3C8DA 2VDLH 3P0VH 3QIBB 4WI7A 3D18B 1IM9B 1AO7B 1YQ2A 3QHTC 4AMKL 1E4XH 1VGEL 2J88L 4KJPC 4K71C 1LGVA 5JW4R 2A6DB 4FTVB 2OZ4A 1LE9A 4Z7UA 2EC9U 4YHIB 3BMVA 3K81A 1DQQB 1HH9B 3SKJL 3G6JB 1CZ8L 1ORQA 1XIWC 3FB5A 1TQCB 4Q6IC 2VXSH 5BZWB 2HH0H 5CGMA 4X4ME 5HGGS 3HUJA 3F7QA 3VFRB 5B4MC 5CWSB 5I75C 4UU9A 1WIOA 2UZIH 3GSUA 5FA4A 3RDTB 3VRLE 1J87A 1JHKL 4I4WB 5C9KA 5C0GA 2QQKH 3ROLB 1KCLA 1LP9E 1KIRB 4ZSOB 5K59F 2EDRA 2VDNH 3MACH 4D9QD 5GGUA 4HMEA 5IB5A 5DEFA 5TQ2H 3I2CH 4L4JA 4MJID 4D9QE 2X42A 4QTIL 4UTBH 5I1EH 1UXWB 2YPKB 3VG9C 3KPSA 2AXHA 3FQRB 1KIUA 3D0LB 5IT2H 1IQWL 1IJ9A 4P3CH 1B0RA 4IDJL 3GSWA 2EH7H 3WDJA 1D9KD 2IH3B 2VERN 4LNVA 3G5ZB 3M1BB 3IFPB 3P0GB 4ALAL 3EIFA 1GC1L 5ICXB 1F13A 3SY0B 1AC6A 5F3HB 1XF5B 4UMGA 4MCYA 4LASH 4XI5D 2EDXA 2HKHH 2V7NB 4YBLB 2FR4A 3ARFA 4TUOB 3MRCB 4OCSL 5T5NF 5HDOA 5I19L 4ONFH 4AJ0A 3QO1B 1TTFA 1R5WB 1DUYA 1RZFL 1YMMA 3ARBD 2VITA 2W60A 3T0AA 32C2B 5J11B 3G08B 3F7RA 4ZNEE 3ILPA 1DE4B 3VGFA 2HFFA 4KTDL 3RL1B 5GZOD 1IBGH 3IFLH 3RWFA 3BWAA 5E2VL 2SEBB 4H1LA 5TDNA 4FXKB 4Q2ZB 3VE0A 1I85A 3KG5A 4M9OA 1QEWA 3HCVB 2DRUA 5H35B 3LH2H 3T0ED 3T2NL 2OL3H 4PREA 4XVSL 3UTQA 1CVSC 4QNPF 3KLHC 2IBZX 5L2KA 1V3LA 2GAZA 1UM5H 4I13B 2YRLA 4KDTA 3SO3C 5IHZA 3UC0L 4U49A 4FQCH 2X4NB 4ZUTB 1FV1B 4RGOH 3TO2B 5E6IA 1NGZB 2B5IC 1JE6A 3CC5A 3BE1L 4MJIB 2Q20A 3IGAB 3ZMRA 4KAQH 1IAIH 3ZKSD 3MXWL 2I24N 4QF1B 4MS8D 4M8QB 5AZEH 1S8DB 4AK1A 5IMLA 5CAYB 1D9KB 5IHUH 1T0MB 1XGTA 1D5MA 2GJ6D 3MJ9A 3O0RL 3JWDC 3TT3L 2LVCA 4BKLB 1B0WA 4HZAA 3RWGA 1OARL 1FPTH 2EIZA 4PS4L 4NT6A 3VU2A 2JK5B 1GPOL 3ARBB 5FEBA 3EO0A 3DX7A 4FNLL 3QUMB 5J6HB 4M48H 2P43B 4YXLH 1NANH 2BNRE 4NM8L 1WWWX 3PHSA 1FNSH 1A8JH 5IW3A 3S7GA 1ZA3B 1RU9H 2VZ3A 5E24E 4Y2DD 4NQSB 3SE8L 5FKAB 2ID5A 5DR5H 1RZ8A 2XICA 4PFEA 3T0EB 2FX8H 2X41A 4P2RA 1MSPA 5ICYB 5I8EB 3RVVD 1A4KA 1EAJA 3QUML 1VFUA 3QNZA 3B8YA 1RJLB 4QNPE 4PRHA 4NYLB 4PJAF 5IFAL 1EUTA 1FH5H 3SKNB 1KB5H 5DMKA 1OWRM 1PX4A 3O2WL 4L3CA 4P4KD 4UB0H 1DR9A 4OD3L 4KKBC 4P46A 3MX0A 2YPLE 3KPPA 1EJOH 1BQSA 1FNFA 2V2XA 1HH6A 1FN4B 1O5DT 2BY2A 1UKSA 4LFHG 1IAKB 1FNLA 4GW4A 3MRMB 2AEQL 5L8LB 3WEXB 4TUKL 2GJ6B 4ODXA 4PLNC 2ATPA 4R6UA 2EECA 1OQOA 3D25A 4KJPD 5CP3H 5H94B 1Z5LB 1EXUA 4JANA 1EX0A 4OI8A 2B0SL 3MUGA 1GHFH 5CZKA 1M05B 3LDBC 1U91B 4HAGA 4NHUB 4JDVA 3KJ4B 3GO1H 5T3ZE 1NC4A 1GL4B 3KNBB 3HLAB 2XXMB 4ELME 1EEYB 1JNHB 3TNNA 4Z7VA 1DUZB 2FIKB 4RFOH 3QRGL 1HWHB 3VD7A 4FQPA 1F2QA 3OR7B 4Y2DB 1FZKA 4JFXB 1MFAH 5FYKE 4PRAB 1P4BH 4Y5YA 1F11B 5B38G 2X1WL 3NCBB 2N7AA 5TF1L 2FJGB 1WT5A 1WITA 4HX1B 4X83A 3OKKA 4JO3H 2ZG3A 3L1OL 3STLB 4J3WA 3V95A 1HWGB 5JXAL 2P24A 2IFFL 3K2UL 4KZEH 1IGML 1KN2L 4YX2H 4P4KB 1EEUA 1ZGLM 2MKLC 1WFOA 1KLUB 5ISZE 2G2RB 5HGAA 2F5BH 4M7LT 3QZWG 4XVUC 2VDMH 2FO4B 5HSFA 1ZS8A 3GIVB 3VWJC 1G9NH 2DBLH 1YC7A 2YMXL 4F58H 1FJ1B 4ZQKA 3H7BB 4PJCF 1SBBA 3OX8A 1QRKA 1AFVH 1W2KT 1ZXQA 2QHRL 4WFHE 2J2ZA 4KTEL 5JOPE 3H3PL 3BVNA 1IKNA 5F9AC 4K71B 4GW5A 1F58L 1TFHA 5DJ8B 3KPRE 5L8KB 3RGVA 2XA8H 3PDGA 5KN5B 1J05A 1HCVA 1BVKB 2OS7A 4YHNA 1YDPA 4GRLA 2YZ8A 1M1SA 5D1QA 4F7EB 3KS0J 3DURA 5TDPA 4Q6IB 2Z92A 4OZGA 4OLVL 3QDMD 4R7NB 3BI9X 5FAAA 1J8HD 1ND0A 5I75B 4OGYL 1CE1L 3QDME 3TH3T 1KUMA 5FYKU 1J8HE 3KLHD 4IIQA 3BH8B 1SYVB 2R0ZL 3VXQA 5L2JA 3TZVA 5ID0B 4X99A 4LARH 1FSKB 4BH8A 5GGSY 1AD0B 4LSVL 3TBYA 3CK0L 3DHMA 2XY1A 1TVBA 4I48B 4OFYA 3M17A 2HP4A 4NO0D 2Z35B 2KQNA 1TJHH 4FS0A 2BXZA 3MNZB 4IRZH 5AD0B 3GMQB 1WC7B 1Z3GH 5J06A 1T7ZA 4QT5B 4PTUA 5DSCB 1FORL 3TBWB 1BFVL 4L8CA 1WBYA 4HPYH 1U3ZA 1WAAF 3KPOB 4QWWC 5F7DB 2PF6A 4MJ4A 3QUXC 4UNUA 1HZHL 2M26A 2C3WA 4LVEA 4PJCE 3QXUA 5EIIA 4JHZA 5HVFB 5SWQB 1RUML 3D0VB 3OJDB 5BQ7A 3FO0H 4WWKA 5EU5B 4C55A 4KROC 2PW2B 5FO8A 1MFDH 2P8LA 4WW2C 1C08A 3NN8B 3BGMA 4ZDHA 1T1XB 3PNWB 4DVRH 4I5BA 5F6HJ 3MBXH 2FL5B 1KJVB 1MCLA 4PP2B 1L4IA 4LLYB 1I1FB 1JHTA 1MJ7H 3EDKA 4GAGH 4OD1H 5KSBF 3QDMB 4G8GE 1WBXB 3BUTA 1FZMA 5CUSH 4TNVF 4M6AA 1J8HB 1M7DA 2R1YA 4YDKH 3L95A 5C70A 4LLQA 4L8DB 5DQDL 4E41A 3I85A 3N85H 3SO3B 3MRPB 4N5UA 2ZUSA 4ODTL 2YD6A 4AENA 1UXSA 2CXGA 1NL0H 4JFFD 2EDBA 5IVZA 2B5IB 4UI2A 5F6HI 4P59H 2OL3A 3VW3H 4TVPL 1SVCP 4NO0B 4N9OB 1SYSA 3MZGB 1HI6B 4JGUA 1XF1A 5CGYC 5F7EH 5C0JB 5C07E 2YBRA 3F8UB 3NPSC 5D70L 2WP3T 3EO1A 5HD8C 4LVHC 4PJCB 2DQEL 1S7SA 2MMXA 1TJIH 1HOCB 3KAAA 5DTFA 2GT9A 2F5AH 2R2EB 5DMIL 2PO6A 2X89D 5F89B 2HJKB 2V6HA 3OL2A 3VFVB 2AJSL 2ZOKB 4F37F 2KT7A 1DFBL 3G5XB 4F7CA 3FFDB 4P2OD 2J8UA 4KGLA 1MRCL 5IOPA 2N1KA 1X5LA 4XVTL 1AJ7H 5BVJB 4OGXL 2EC9T 2WWKT 4WUUA 4X4XB 5JIIA 5EC1B 3ULUC 3AGVA 5FO7A 3OKLB 5C0AA 3WFEL 3BRGC 4WW1B 2X7LA 3ZSTA 1MCBA 2XPGB 1PYWB 1MCPL 1EBAA 4ETYA 4TSCL 2PCPB 3I6KB 5KSBE 2F15A 5HI4C 3GJEA 5ENWB 4GBXC 1AC0A 1AXSA 3R1GL 2DYPA 5C08D 4GLRI 5CD3B 5T33L 4TRPH 1XEDA 4DWHA 2HLAB 2O5XH 5C08E 2WINA 3K1DA 2WP3O 5CZVL 4O02H 1YEJL 4PB0L 3RZCC 3WMSA 1JZ8A 4JFFB 5JDSB 5IM7A 2J6EH 3UROR 4XVUD 1DQTA 2N7BA 3VWJD 1HHGB 1F3JB 3TCLB 1T4KB 4PGEB 4IM8A 3ARVA 4HXBL 3CDCA 3MV7A 2WWKO 1T21B 4CVZA 1D6VH 4YZFE 1ADQH 4DN4L 3SE4A 3L3GA 4LPVA 1KT2B 1XMWA 3ARDC 3QEGL 4KKCC 3VXME 3NAAH 1KEML 1E4WL 2DQHL 3I50H 4K7PH 1KTRL 4WW2F 5M95B 3OKEB 5IKCB 4P2OB 4UIKL 4XPBL 3QQ9D 4H26A 4KJWC 3C08L 2FH6A 1MVFA 1J0HA 2VNCA 4LAQL 3SOBH 4OTXL 3ZTNL 1NC2A 4OKVA 3W5MA 3L5IA 4R96A 1RJCA 5I8OH 4FFYL 5KSBB 1FNEA 4BZ1H 4F2MB 3ABZA 4M9PA 3TP4A 4B7IA 1QD0A 3JV4B 3FT3A 5EZIL 2ERJB 4Y7MA 3TIEA 3NIDE 5E8EB 5C08B 3UZEA 1K85A 1RK1B 1TMCB 1Z0MA 4G7VL 3RVUC 3UPCA 3BZFA 4JKWA 2XWTA 2OR8A 3OKNA 4IRJC 3V0VA 4FG6C 2BHYA 3X17A 2ARJB 1MNUL 4OCXL 1B2WL 3D39A 3F7YA 1PKQA 1A6UL 2QLVB 2UWEF 3UCRA 3EYSL 3EW3B 4ZOAA 5B8CA 4NO5A 3VFWA 3LPFA 4QWWD 5ILTL 1F3DJ 3QUXD 3EJJX 3LRHA 1P4IH 3VWJB 3AREC 1NCNA 5EOTB 1MFEH 3LSOA 3V8CA 1D5ZA 3NZ8B 4KROD 4PG2A 4U1IA 4WFEE 5C6WH 5EU4A 1QSZA 3CSYB 2B1HH 4GKZB 5BZDA 4N9GA 1KYOK 3MMEA 2X4OA 4MDIB 4DOHE 2VN4A 4JM2A 1NFDA 3FKUS 1JIBA 4O4YL 4XGZA 4PRNA 4GT7A 4E5XB 3LOWA 4ZYKB 3DV4A 5DHXB 3ARQA 3ULUF 1A64A 4PLKC 5B3JF 1YC8A 2CLZA 5GGRB 4JQVA 4N8VG 5JLZB 1VFBA 4L4TA 3QQ3A 1CXFA 3B3IA 5DWUH 2F19L 4XPTL 1C12A 4IRSA 4M7JL 3PHQB 5EPMB 1NAKL 3WHE0 3DVGA 5HVHC 2OM5A 4NSKA 3T3MF 3O3UN 2B1AL 3O9WD 1OAXH 5HYJA 1IGFH 3TFKC 4U6VH 1IFHH 3GKWH 1NDGA 2FATH 3CCHB 1HHJA 2MSPA 2E8YA 3P73B 4RA0C 2AGJL 2H6PB 2UWEE 2Y7QB 4L3AA 5CGYD 4OLEA 3DX6B 3Q6GL 5J12C 5HD8D 2D3VA 1BFOB 5IVXA 1N6QL 5HHVL 2XN9D 4Q97A 3IJSB 3QUXB 4PYHA 5HHXL 4MX7B 2ADIB 2NNAB 1LEGA 2XI9A 5IMOA 4JGMA 5DJDA 3QEQE 4W70A 3OGCA 3WFZA 2XN9E 2ITDA 1A9BA 3O3EA 2VDPH 1J5OL 4XNYH 1WZMA 1CI5A 2GTWA 5JIPA 3F62A 2Z8SA 3JTTA 4NKDB 4TSAH 3AVEA 3MGTB 3MLYH 4DOHB 4WW2B 1Q9LB 4U1SA 3BYYA 2F54A 4NJ9L 1T1ZA 4YDIL 3ULUD 4XVJL 3MRHB 5MP6L 4HMDA 3V4VL 5FV1L 3ZE0E 1R24A 4XH2B 3G9AB 4YIQB 4CADA 3N1PC 1B4JH 5B3JE 1ZHNB 3PP3K 2UUDK 1AGEA 2VXTH 3Q1SH 1FVDA 1MLBB 2DTMH 5KAQG 1J1XL 3QEUA 1GOGA 5TDOB 1TZHA 4GBXD 5JO5A 4MJ6B 4NN7B 1A7NH 2EC8A 4HIJB 4CMHC 5T1DH 4GAJH 3MUHL 5DRZA 5T1KA 1FLRL 3GSVB 4HKXA 2ADJB 1ITCA 2XQBL 4WGVB 1F2XK 3MCKA 2A38A 1OP3K 4M62L 3DMMC 2IPUG 1F97A 2VDLL 3O9WB 3P0VL 4LQFH 4EDWH 3RZCD 4Y4KA 5I1HL 3L3HB 2CDFB 3HZYA 5LGJA 2UWEB 3DLQR 3JTSB 5BJTB 4POZC 3H9SA 3RWDA 4LLDB 4LLUB 1F4WH 1I8KA 5I18L 3NPSB 3BEVB 3DXAA 4QCIA 3IS1X 4LVHB 3P30H 3RPKA 5K33A 1EJ6A 2XN9B 3ARDD 1OSPL 3CVIL 4KKCD 2FWOA 4MD0A 3JXAA 3LKNA 5GRWA 5FECA 1FL6B 4LLVB 3QNXA 1E27A 4HKJA 4NZJA 3UTSD 4RDQG 2YN5A 2J12B 3A6CL 3QUZA 5F72S 4KJWD 3ROOB 2PTVA 4JFDE 4DEPB 1C16A 4AH2A 1H3XA 5F44A 2KDGA 4HIXH 3I2CL 1KB9K 1WFNA 2HYMA 2YPVH 1HDMA 3WIHA 1OF2B 1TZIA 4HC1A 2NY5C 3CD4A 4P5TA 1D5XB 2LU3A 4H25B 5MI0C 1J1OL 2CDEA 1QOKA 1HHIA 4XC3H 5D7KD 2XTJE 3B6SB 4W68A 3JVGA 3CH1B 4GBXB 5EBMA 3KPMB 2Y9RT 4OZFG 1ZHBB 3EYFB 5D7KE 4MWFB 3DVFA 1CG9A 3T1FA 3RVUD 5HHPB 5E99L 1OHQA 4IRJD 3ZE2E 5EOCH 3I75A 3ULUL 4FG6D 4LCUA 5JTWA 5D7SH 3ALXA 4YHKL 5DJXA 5HY9B 4MHHI 2VLJB 3JBG7 3PWPE 3MJ8A 5H37G 4DQOH 4MCZB 3RZCB 2M2DA 1FBIH 4Q9BA 3SKMB 5ACZA 3MLRL 4LDEB 2W59A 3WIFA 3IFLL 5JPNB 3HI5H 2NY3C 3HS0A 2ZG1A 5F96H 2CKBH 3VXPA 3ARED 5F21B 4OCNC 5DZOA 1EV2E 5GS2D 5JDJA 2DIJA 1C5CH 3T2QA 3JWOH 4WCYH 2COQA 1OY3B 2OSLB 1ZEAL 3BDYH 4GKOA 3ARDB 1HHKA 1SJVA 4Y5VC 2XIDA 2J6EA 3SCMD 4KKLC 2DI7A 3KDMA 4N0UA 1W8NA 3UTSB 1A1OA 1IILE 4HG4J 3J7HA 1TETH 4JPVH 5I1DB 5BOZG 1KBGL 1UM5L 3CFKB 2BJML 4XMLL 1U42A 4G9FE 3IU3B 1NH6A 3UBXB 3ZYIA 3OXRA 5CBEA 4QGTA 1T2JA 3WS6A 3KXFD 3BDBA 5GSRA 1F6LL 2BVYA 3MRJA 5FGSA 2AJZB 4MVBC 3HZKA 2DLIA 5E00B 5FHAH 3LEVH 2JJSC 3VFSA 1BBDH 1FP5A 3EFFA 3EFDH 4JFYB 4NFBA 1ZLWK 5IHUL 4PJBA 2D7TH 3BW9A 3TFKD 5DJYA 5ANME 2H26A 4F33A 5HYSG 1H9VA 1JWSA 1R3IH 4JO2H 4IRJB 1W72B 2PYED 3C5JB 4HHAB 3TBTB 2YEZA 2WUCH 4KY1H 3KYKL 2VXVH 1FPTL 2GIYA 2ENYA 4OF5A 1G7MB 1S7QB 2GSGB 4XP6L 3VXUD 5C71A 5F7KC 4JRYA 4ZFFB 2VR4A 1LEKB 4X9BA 3S3PA 4YE4H 4YXLL 2OMBA 3AREB 1FAKT 2F8VA 3PWNB 5HYQB 2YK1L 4XCYB 4LEOB 2CIIA 3ZKMC 1OWWA 5CJ5A 1FNSL 3IXTB 3RY6A 3O4LE 4HWNA 5KBNC 1GXEA 3RA7H 1RJZB 3NIGF 3TA3C 5GGVY 1E0OB 3EOBA 2FX8L 5IWLA 4X6FA 4G8IA 1UJ3C 3SCMB 4LVNC 4WIQA 3MV01 1T89A 1WICA 3TM6A 1NGXB 4BSWB 1RMFL 1FH5L 4RMVA 1Q94A 1C5BH 2AJXH 1KB5L 5DRNA 4RWYL 1AE6H 2UUDH 3K74B 3A6BL 4YDVB 2VDQH 1U8KB 4DGVL 4YBQC 1PW3A 1P5UA 4I2XB 5ACLA 3VFPB 5J56B 2X4PB 4X4ZA 4G6MH 3ZDXF 2EIDA 6FABL 3KXFB 3MREA 1AGCB 3VCLB 4EVNB 1A6PA 3IT8D 2QTEA 4I8DA 3WFDL 2VTFA 3VFUB 1EJOL 3IFNL 3CLFL 3D3VD 2APFA 4KMTL 2VIRA 5F9WC 5FYLD 5FA3A 1LILA 3DMMD 5MENA 3WHE1 3H6JA 2DLEA 1J0IA 4MLIA 3ZYOA 5D7IF 3I6LD 4IS6A 4KPHL 4G8FB 2WBJA 4YHYC 3MLTB 2PYEB 2HG5B 1H0DA 2GJZB 3I6LE 4POZD 4X6DF 2YC1B 2R29H 1P9MC 1CL7H 1HXYB 5E7BA 4K7FA 4O2EB 5J12B 3T4AA 3VXUB 1KCUH 4JRXA 3MJ7A 3RNQB 4NKMA 1FYTD 4NRYA 2X4RA 1RZ7L 4HJJH 5INDA 3VFTA 4L29B 3BIAX 1X5KA 2I26N 4YHLL 1I9RH 5IMMB 3REWA 4Q74A 1XF3A 2E9IA 3HAEG 3TBSB 2D7OA 4GMSH 1I7RB 1P7KB 5J89A 3ECBA 2VABA 1P4BL 1JWMB 3IS0X 2DKMA 3IVKA 2NY1C 4JO3L 3EZ8A 3EUUA 3W9EB 2OCFD 1GGIH 3W11C 4GFTB 3DROB 4Z0XB 1EHLH 1JK8B 3V9FA 3AM8A 1ZGLA 1FFOA 1KPVB 1MCOH 4CGTA 1UQSB 1MF2H 4U6TA 1A7PH 2F5BL 5EZOH 4X5WB 3O8XC 3EOYG 4MMZC 5F93C 3S35X 1GGBH 3D3VB 1T22B 4F58L 5IB4B 1EHAA 5HDBE 2C3HA 3LKRB 4JKKA 3DMMB 5KS9A 1AFVL 2IPUK 4OCYL 2EDQA 4XNQA 5D7IE 3WCYA 5C6TL 1EPFA 1MQ8A 1WZ1L 3GB7A 5DRWB 5AYQA 5IQ7L 4WO4A 4W4OC 5D7LE 1JZ5A 5C92A 2HFGL 4NQDD 2AEPH 3BPOC 4X6DE 2WNGA 3EOTH 3VI4F 3HZVA 4AZ8A 5TQ0L 4DKEL 2XA8L 1EAPB 3THML 1WEJH 3HMXA 1FFNB 5DQ9A 3REVB 3S4SB 5FYLL 2XWBA 25C8H 4JGJA 5DMYA 4PPTA 4HJ0C 1DBAH 4LVOC 1IGTA 4WTWA 5DZNA 2N4IA 1FYTB 4QXWA 2IH1B 5BVPH 2XZQH 3E3QE 3MA7A 2IPKA 1MIMH 1MH5A 2V5MA 3KYOA 2VZOA 3AUVA 3LHPL 1S7RB 4JN1H 3B9KA 2BC4B 5DURD 4XBEH 1LWRA 4HWZA 1YEGH 4CU6A 5TGBA 2HVKA 1J8KA 3L7FB 5F9JB 3WLBB 3GNMH 4MVBD 4MAUL 1TJHL 1C1EH 5J1TC 1QA9A 1Q1JL 1CGYA 2DJSA 3RUGE 2VISA 3LIZH 3ESVF 1ZLWH 3A67H 1ZVSA 1CFVH 1GOHA 4UT6L 4I1NB 4HPYL 1NFIB 3BZEB 4MNQD 2CD0A 2FBOJ 3VXNA 2EDFA 4WFGD 3P4MA 4XX1G 3BJ91 5D7IB 4MNQE 4LKXA 5IK3B 3Q5TA 3UO1H 4QXGH 4WFGE 4YFLF 3ZYJA 1VGKA 4LK4A 4OZHA 1YPZE 3TBVB 4F7TB 1GVIA 4X6DB 3HI1A 5B38A 2X4QB 4QRSA 1V3MA 5GRXG 3OJVC 2CLRA 2VXUL 4NQDB 3G5YB 1PX3A 3MRNA 1PZ5B 2DMKA 3DBXA 3ZKMD 3MBXL 3E1F1 4LGSB 1YJDC 3C6LA 2DF3A 1R5VB 4PR5A 1CLZL 1TQBC 2V2TB 4U31A 2E9WA 3TA3D 4NDMB 1NBYA 4V1DA 4HIHA 4CNIB 4FZEH 4Y5VB 1S3KL 5I66B 4YDKL 2QR0A 4ORGB 3WDIA 2AXGA 1FGNH 4H5SB 2QV2A 2P49B 3BJLA 4OB5H 5F9OH 5CJQL 4KQ3L 5D72L 5TJWK 4G6AC 5GS1A 3PIQB 3DIFB 5DURB 1NDMA 1PY4A 2IADA 4P48A 1PD6A 5DVOA 1MCDA 4PGBB 1YNLH 4JZNA 1NL0L 1J12A 4K55A 4P59L 1KG0B 1DQML 2WIMA 4P5KA 3GIZL 4S11A 1YN6B 2VL5B 1BIHA 2X1QA 3MODH 3PGDB 4EUPB 2AQ2A 4HJGB 1NJ9A 2DM3A 3H0TA 5HTSA 5LKNA 5D96C 1F6AB 1ZVHA 4QYOB 3FQWA 3O6LH 5IB3B 1ACZA 3ARFC 2J8OA 4XNMA 4PJEA 4MDJA 5LXGH 5DD5H 2WLYA 2IAMA 3GRWA 5E7FA 1PKOA 4FQIH 3HC3L 4PGZA 1MFBH 3G5VA 2VRAA 5CEYB 2YUXA 3FOLA 5DDHB 3CVHB 1I85C 1PQZB 3TA3B 5FCSH 3K8KA 3O11B 4MB5A 1G84A 1UJ3B 2X5PA 2BVTA 4QEGA 3MFFA 3EDDA 5BS0D 1I8LA 1QQDA 5BRZD 2ZSVB 3SPVA 3S9DB 1J18A 2Z8RA 5BS0E 3W11D 4AL8H 4U7SA 2L7UA 3WYRA 2DQTL 1R3HA 1ZT7A 1G6RH 4X80L 4KDTC 3QFJA 1FHGA 4KV5F 3O41A 2PW1B 3CVHL 3WJJA 4PRID 1A3QA 3MV11 3DNKA 4QOKD 1U8IB 3QQ4B 1IEBB 2AAVA 3O8XD 2A6IA 4UQ2B 5E6IC 4QY8B 4JY5H 1UYWH 2OQJB 2VLRA 3C5ZB 4KK8C 4X8JA 4HZLA 1ZT1A 1ADQL 3VJ6B 3L3OB 5KVDL 3BRDA 4YHYB 5D5MA 3HC4L 5H2BB 2A0LC 2W38A 1MWAB 1O7VA 2BVOA 3GMLA 3BUYA 2IQ9L 4X7TA 1CFTA 3LB6D 4HJ0D 1IC4H 4WDIA 3BIKA 2ZOLA 3DHJA 5IF0A 3EYUH 4QHNA 4Z7UF 5FKPB 3V7MA 1XGPA 1U8LA 5I8OL 2BVQA 2LTQC 4HUXA 2HN7B 4BZ1L 2DKSA 3QPXH 1MWAL 4I0KA 3SN6N 3ARGA 1P1ZB 5GRYA 1YEIH 2A9NL 5L7XL 2J1KA 2IBBA 3FAXA 3HZMB 4L4VD 3G6DH 3O4OC 1CLOL 4YFLI 5BS0B 2AXFB 5BRZB 4PV8A 3MV8E 4M4RA 4XHJD 4AEIH 1KEGH 4L4VE 2Y06L 3ZHKA 4PJFF 3PG2A 5J9PA 2NX5D 4NZUH 1ZLVH 1A7OL 2BSSA 3FT2A 5KTEH 4S1RL 4X4MA 3E8UL 1MAML 1OLZA 5EUOE 1B0GB 3DTXB 2NX5E 4PRIB 3T8XA 4QOKB 4X98A 5E2UH 4CN6A 1JL8A 3O8XB 5F1NA 1KTDA 2FX9H 4MZ3A 1Y6NR 4P46C 4BQ9A 1Y0LA 3EAKA 3CX5K 2GY5A 3RKPA 4MD5A 1MFEL 4CAGA 3U82B 2JIXD 3LQAC 3ZDZF 1U3JA 1F00I 1OAZL 4HDIA 3TN0B 3BPOB 4L1DA 5DJ0B 3SDYL 2P45B 1PG7H 1K3IA 1X5ZA 3D9AL 1KIPA 2FD6H 3VWKA 1JGLL 35C8L 3FRUB 5E2TH 1CT8B 4QHUA 1R3JA 3FT4B 2JELL 3O3BB 4LVOB 5DK0B 4PLJC 1KLGB 4S2SA 5IV2A 4HFWB 1OLLA 3RX5A 5C0BA 3MRRB 3T0VA 3HUJE 1A4JA 5F6IC 5GRUL 4DW2L 4G6AD 1RK0A 2GSIB 3MO1A 5EZLB 1KJ2A 4OLXH 2RCSL 5JQHC 3UPAA 4X9FA 3UYRL 1SJEA 2LFGA 4L4VB 2YWZA 1YYLH 5EORL 4Y5YC 1QKZL 1IFHL 3GKWL 1LE5A 1WT5C 2DS4A 4JZJA 4RIRA 2XZAL 2I27N 1DQLH 2F9BT 2HJFA 3L3KB 5EUOB 2NX5B 3TV3H 5LAXB 4C54A 2AKRA 3KPSE 4TN9A 4NJAH 1MIEL 2X10A 2XZCH 4BH7A 1EFXA 4RMSA 5C0RL 1OAQL 5TE7H 4NKOB 3FCTA 1HILB 1G9MH 4JJ5B 1Z9OA 3ARFD 4FN0A 3ZDZE 3LKPB 5DC4B 1WWBX 4IMKA 2JIXB 3UZVB 1CDJA 3V4UL 2DL2A 3I3DA 4WEBL 1EZVY 1YMMD 4TSAL 5DFVC 4QKXB 4LNRA 5BXFA 3IAGC 2CO6B 1IKNC 5D71H 2VH5H 2E7CA 1TCRB 2YUVA 4EI6A 2HWZH 2W65A 1LE9B 4LCCA 3RGVC 4Z7UB 4P2YA 4PGCB 1ETZA 4KVCH 3VDAA 2DM4A 1TQBB 4GRLC 2VXTL 5FF6B 3HRZA 2H32H 2IC2A 3C60A 1XF2A 5T1DL 4FFWC 1A22B 4YGVB 2Z4QA 1AGFA 2A73A 4M1DL 1RZJC 4UU9B 1YMHA 2R69H 5CIPH 5DK2B 3FB7A 5FA4B 3VD9A 1WZLA 4TOYH 2OZ4L 4IIQC 1DBKL 5L2KD 1YJDL 5TE4L 5C0GB 7CGTA 3TZVC 1X5XA 4LQFL 1CR9L 2BNRA 4PJFB 5L2KE 4ZFGL 4UT7H 5GGUB 1WISA 4G6JL 2P5WA 5J6GA 5E6ID 5AWNL 4FQXA 3MROA 2VDOL 5GS0H 1BFSA 1F4WL 2P44B 3BIBX 4O00A 4Z78A 4KK8D 5IESL 3HMWH 1KSRA 5IR1A 2QSCH 2ZNXA 5D2LA 3VXTB 1X5YA 1ZANL 2OMNA 3UTPD 4HUWA 4N8VA 1NBZA 1FC2D 5AAWA 2A0LD 1PFCA 4MCYB 5FDYA 3UTPE 1CU4H 2F74A 2R2CA 3CFCH 4TSBH 2FR4B 3ARFB 2PXYA 5LWYL 3FZUC 4GG8A 4OM1L 5ECJE 4DZ8A 3I9GH 3QDJA 4WWKC 1YEFH 1DUYB 1YMMB 4ZS7H 3F12B 5F7NC 2VITB 2W60B 5L6YH 1ES0A 4LF3A 2QSQA 3ILPB 3T4YA 2FBJH 2HFFB 4YPJA 4Q9RL 3RWFB 1B3JA 1I75A 3OHXA 2ZUYA 3RX7A 2AQ1A 2MCG1 4PY8I 4DTGL 5EOCJ 1T3FB 4YK4C 5TDNB 3ZT5A 4IMLA 4K3JH 3VE0B 2I9TA 2QSVA 1OTTC 4HEPG 5GHWL 4PP1C 1IGJA 1QEWB 4Z7VF 3MCG1 1KPRA 5FGRA 4P2RD 1DBJH 5DD1L 2WBKA 5TH2B 4PREB 3BPNC 4GKNB 4PRPD 5KJRH 2CDGB 4U7KA 3UTQB 3ULVH 5D7SL 3FN9A 3W39B 5I9QC 3LEXB 5B3NA 3EOAB 4PRHE 3QO0A 1FDLH 5IHZB 2MHAA 5D93C 3O45B 2IEPA 5I1JL 5F96L 5E6IB 2CKBL 4P46D 3CC5B 3SJVA 4JO1L 4UILL 4PJHF 2ATKA 3FO2A 4J3SA 8FABB 4XXDA 1HNGA 4C4KT 2Q7NA 1CICB 1CQYA 5IMLB 4U4BA 5JR1H 1X44A 1XGTB 1D5MB 4JJHA 2K7PA 1WGOA 1H15A 2DQDH 2XKNA 2PO6C 1KTKE 1TETL 3VH8A 3IETB 4PJIA 3X3GL 4NT6B 4U2YA 5ISZA 4FQQA 3D48R 1OPGL 3EO0B 1FE8L 3DX7B 4PLJD 4Z7OE 3OB0K 3ESUF 1NC4D 2LTQB 4HQQL 4H8WC 3V0AC 4XCFH 5FOBA 1S9XA 5FHAL 4OZGF 3D85A 1BBDL 4NCC1 3EFDL 5DEZA 5F71A 1ITBB 4LDLB 1X6NA 5M7QA 5ADPH 5KSVB 1S5HB 4OZIF 3KPRA 1N5YL 3O4OB 1RZ8B 4P2RB 3MBEA 4WV1A 2L4OA 3QNZB 4PRPB 5KOMC 3TCXA 4C4KO 3U46A 4KY1L 5DUPH 3QJHA 4AEFA 3RPIA 2Q86A 5DMKB 5A2FA 1N4XH 3ZSSA 2A1WH 1S9KC 3HTLX 4M6MH 1BQHB 3QXDA 2ESVE 5ITFA 4ZPVA 4HWBL 5T5NG 4P46B 2VQTA 5E8PA 3KPPB 4TULH 2WUBH 2E7LA 1HH6B 1K4CA 2I5YH 4MNHA 2VZTA 4GW4B 1RUPH 2KVZA 1OT1A 1DEDA 3RA7L 5K9JH 4OZFA 4F3FA 2VWEC 4LIQE 5DFVD 1NCTA 3EKCA 4KGJA 4ODXB 3SE4C 3UP1A 4KXZI 4B41A 3BQUB 3ET9F 3AXLB 2Z9TA 3RI5K 3V5KB 2VSCA 3IRPX 3EGSA 3D6GA 3RGVD 1S9VB 3F7VA 1WCBA 5GGRY 1T5WA 4OT1L 1A1MA 4GRLD 1NGPL 2VDQL 3X13B 2BMKB 4KJQC 1B6DA 4UNVA 4FFWD 3CFEA 1NC4B 1ORSA 2XRAL 3TJEH 4OZGE 4RMQA 3TNNB 1KNOA 4HT1H 1F3RB 4NM4H 4Z7VB 5T1LA 5F6IB 1MEXH 3MOAH 3FO9B 2RB8A 3TZVD 3HPLA 3KYMA 5MEPA 2JCCA 4AQ1B 1QP1A 1N8ZA 4Y5YB 3SGKA 4R0LA 3MRDA 4OFYD 1A6TA 2BFVL 2QQLH 4EKXA 1DLFH 1FO0H 3UYPA 1KXVC 1JFQH 4G8GA 3JUZA 2XOTA 3V8OA 2DB8A 4OQTH 4JDTL 4PJHB 5I1KL 1NCAH 5K93A 4Y4FA 1A9EA 5HGHB 5B8CC 2EE9A 4QRPA 5DC0A 4M02A 1I9RL 4TQEH 1A3LL 3FZUD 4ZQKB 4QXTA 3OX8B 4GMSL 5ESAB 5I73C 3DRQA 4WWKD 2Z0BA 3D5OF 3Q2CA 1DQJB 4NGHH 4GMTH 4Z95L 5HYSA 1BF8A 3DECA 4NQXA 3BX7C 2IALA 3BVNB 2NPLX 1UB5A 2D2OA 3P3YA 5HGDA 1KN4H 5I8KH 4NWTH 4GW5B 4HIIB 4OCWL 3RGVB 4ZOEA 4B53A 4UT9H 5T3XD 1NFKA 1J05B 2B4CC 4JM2C 2K3TA 1AXTH 3LQZA 1EHLL 1YDPB 4GRLB 4LIQL 4PP1D 4UDTB 1UM4L 5DF0A 4OKDA 3DURB 4X8XA 5TDPB 1MCOL 4OZGB 4JQVC 1MF2L 2ITCA 5EZOL 1I7TA 1ND0B 2IQAA 4JR9H 1U8HA 2MQCA 4XTRC 4OZIB 3GMPA 4IRSC 2QL1A 4IIQB 2OJZL 4E41D 4KKAC 5L2JB 4LQ1A 3TZVB 4P2QA 4X99B 1SBSH 2H32A 4FOMA 4E41E 4OCRH 4ZD3H 1TVBB 4JY6A 2AEPL 5D1ZA 2CK0L 5E08H 3GBNH 1MHHB 3M17B 5BV7C 2EYSA 4WHTA 3QDGA 1WEJL 3U0TA 4YO0B 4DGIH 4PJGF 25C8L 1ZVYA 3I3BA 4PTUB 5ABDE 4L8CB 4HH8A 1N0XH 2CIKA 2YSSA 2X4UA 4AQOA 4OLWH 1CFQA 1IC5H 3R0NA 3LEYH 4YHPA 1MFCH 2XFXA 2PO6D 3BN9C 4ZTOH 1XZ0A 3FOMA 1UM6L 5LCVH 5L0QC 3T3PE 5EIIB 4NO3A 4RISL 4Y8DC 4JN1L 1WF5A 3DX9B 5BQ7B 4WWKB 4HBCL 3MFGB 3DYMA 4NO2A 5CSGA 1T03L 2IG2H 2P8LB 4NOBA 1C08B 2J8UE 4WUUD 3BGMB 3F5WA 4ZDHB 1K6QH 3WLWC 3ULSA 4WUUE 1V7NL 5GGVH 1EEZB 1MJUH 2KKQA 2M1KA 3U79A 4ODVH 5C0AE 3SDCD 1XCTA 1CFVL 1JHTB 5C0DB 1X9QA 1W0YT 4KK6C 3V0WL 2DYPD 4U0RC 4L8SA 1JHLH 3IU4L 1M7DB 3BPNB 3DVIA 3L95B 1OGAD 3EO9L 4WHDA 4DN3H 4F7PA 1MHCA 3E6FA 5I9QB 3NFPB 3HAEA 1TXKA 1KULA 1FC1A 4E41B 1M7IA 5T3XL 1J11A 4AENB 3K4DA 4ZUUB 1UXSB 4AG4H 1TPXB 4Y4KC 2FHFA 1FRGL 4JO4L 1VKXA 4XT1C 4M1GH 1AGDB 3C2SA 2KQMA 3GSNH 4HW6A 4L9LA 1U58A 4PJ5E 5E8NA 5MERA 3NCMA 3V6FB 1NUGA 2YBRB 2YD8A 1G7HA 4JKPH 4EIGB 5IW6A 2HTLC 3MV7E 2VWEE 5DTFB 2GT9B 2PO6B 1MJ8H 4OB5L 3SDDB 2AV1A 2AJVL 5FO9B 3PF2A 1GGCL 3CDGA 4F7CB 3QUZC 5EUKA 5IOPB 1CK0H 4KJQD 3K80A 1YNLL 3QIUA 2W9DH 3ZE1F 5CBAA 5L9DL 1AIFA 1NFDF 4WUUB 1BFTA 1AHWA 1SM3H 3AY4A 1WCQA 2EDTA 1Q0YH 1QLFB 4NRZB 3TIDA 2X7LB 2AK1L 5GISH 3KGRA 5DUMH 4P5TC 3C5SA 4OGAC 4XAWL 3HN3A 3QI9B 3SDCB 4K94C 4KJYA 1P2CA 3GJEB 3GMNA 5A43C 3JVGC 3O6KL 1AXSB 2DYPB 4AMKH 4OF6A 3SDXA 1VGEH 2J88H 1ZKAA 5LGKA 4I18A 1OGAB 4LRNL 3U4EA 3VFMA 2P48B 3QDAA 2WINB 4J8RB 5I1AB 1G7PB 1IEAA 3D39D 4OD2A 4XAKD 3SKJH 5JW5B 1CZ8H 1K9TA 2OXGA 5IP4A 5LXGL 5DD5L 3PWLB 3D39E 5JW3H 4PJGB 1NBVL 5IM7B 3TYFA 1U92A 1CLCA 1MFBL 4HF5L 4XC1H 3CAFA 5IVXF 4Z5RB 1JHKH 4CKVX 4DCQA 4LDOB 4XCNA 1BBJA 3L3GB 2M8XA 1S7UB 4RBPH 3T77A 4O51A 4P23A 4QTIH 5EDXA 1MCQA 4AL8L 5KW9H 4PY7B 1QR4A 4MQ7B 3MLVH 4ZS6D 4H26B 4IDJH 4YXKL 1NFDE 3EJZD 3V52H 3QEQA 4AEEA 1DP0A 4OKVB 4ALAH 1GC1H 4R96B 3WS6C 1OGTB 4L4TD 4JY5L 4XTRD 2VAAA 4XNXH 1FNEB 3K8LA 4IRSD 2FLBT 1DEEA 4OCSH 2GEEA 4GW1A 5EC2B 3FT3B 1RZFH 3OAYK 2G75A 5HYJD 5JQ6H 4KTDH 2XWTB 4KI5C 2J5LC 3BKJL 3V0VB 5HYJE 3CIQA 3U0WL 1LO3H 2ZG2A 5DO2C 3RHWF 3ARRA 1N3NA 1QSED 5ALCL 1MPAH 3F7YB 3D39B 3RIAF 1PKQB 2JB6A 3R06B 1GH7A 5DGRA 5KZCD 3U30C 2AXJA 5B8CB 4NO5B 43CAB 3VFWB 3FQTA 2XKUA 3CH8A 1FG2A 3BN9D 3T2NH 3VD3A 4RAHA 1TENA 3QWOA 1U9KA 1R3KA 5EN2B 1JPFA 3ZO0A 3L3JB 3RY6C 3LSOB 5EBWB 1D5ZB 4NQEA 5HGBB 5EU4B 3SQOH 3H2WA 4U6YB 2F54D 5BZDB 1AGBA 5IWLC 2A6KA 3MMEB 2X4OB 3BZDA 3WLWD 1T89C 1T66C 3VRIA 4LMQI 2F54E 1NFDB 4XGZB 3BH9A 3DV4B 5FDWA 4H88L 2X4TA 3LS4H 4L8BA 4NQCA 1L0QA 4MNGE 4LKCA 5E2UL 4FFVC 2ARWA 1XGRB 3TT3H 4Y1AA 1VFBB 3P77A 4L4TB 4RMWA 5T1KD 1BD2A 1QO3A 2QHLA 3B3IB 4E9LA 5GS3A 1C12B 4IRSB 4JFDA 3DVGB 4PS4H 3BGFC 2R0WL 4HWUA 2BHZA 4Y4KD 5HYJB 4FNLH 1C7SA 4UDUB 1FZOA 1NDGB 4KDVA 1G6VK 5BV7B 2WBJC 1HHJB 4KK9C 1RZIA 1U8JA 4NM8H 1BAFH 1EGJL 1QR1B 3H9SD 4U1JA 1QSEB 1HKFA 4TUJB 3DXAD 2NY0C 3H9SE 5KZCB 5IVXB 4F9LC 1A1NA 2HTLD 4HUUA 3DXAE 5IG7A 4L3ED 2DI8A 1U8OA 1LEGB 5IMOB 5DJDB 3QUMH 3NFSL 3OGCB 3NABH 1H3WM 5BV7L 5L0QB 5IFAH 2ITDB 1A9BB 3T0DA 1S9YA 1BIIA 3QUZD 1FFQA 4OLXL 4O9HL 3BMWA 1U8NA 4OCMC 4U1SB 1ZMYA 2F54B 1HEZA 4OD3H 1T1ZB 2EICA 1IT9L 4OFDA 1R24B 2HFTA 4XPAL 4P5TD 4D8PA 4CADB 4OGAD 3BYTA 1UFUA 1AGEB 2BOCB 1FVDB 2AEQH 3QEUB 3AM8C 1QLRA 5JO5B 4TUKH 2XZCL 4U0RB 3SGDH 3UJJL 3WS3A 3BP4A 1U8QA 2AJUL 5I0DA 4MA1C 1AR2A 5AAMA 5T1KB 1IE5A 1G9ML 4G9FA 1QFWH 1BP3B 4A2MA 1JV5B 1AY1H 1NCDL 1EA9C 2CKNA 4NHCL 4A2LA 4Y4KB 3HNSH 3HZYB 4WO4C 4CBPA 5LGJB 3CDYA 5CFHA 3U36A 5D71L 2VH5L 3TNMA 1NCWL 2HWZL 2APBA 3H9SB 4MD4A 3RWDB 4GG6A 2EDKA 1G7LB 3GJFB 3QRGH 1I8KB 4OQ1A 3GZKA 3DXAB 4QCIB 1S7TA 4KDWA 1Q0XH 4JPIA 5HHNA 5TF1H 4L3EB 3S6CA 2BVPB 2NW2B 4Y16A 2FWOB 3BPCA 5FOJA 3BXNA 1J0KA 1CXLA 4FMKA 1ODAA 4BZ2L 2DQIH 3P2TA 3QNXB 1E27B 4HKJB 4W6YB 1RZKC 3OKDB 2IFFH 3QUZB 1MQKH 3K2UH 1INQA 1BGXL 1IGMH 5C09D 2D03L 2FLRT 5C2BL 1YQVL 2ADGA 3BP5A 1P7HL 1U93A 4JHAL 1OP9A 2HT3C 4K07A 2Z93A 2NLJA 1HDMB 4IHOB 2BNQA 3QB7C 2HT4C 4P5TB 2YMXH 1F4XL 2NR6D 5E56A 5EIQA 3VXOB 2CDEB 1HHIB 2CUMA 3F58L 4Q0XH 1VEPA 5EBMB 4ZO9A 4KTEH 3X11A 4ZOCA 1BPVA 3H3PH 4LEXL 2YN3A 4PJBE 1NEUA 3CGTA 1CU4L 1F58H 4KRLB 3CFCL 3I75B 4R97C 1UWXK 1HHHB 5TE6L 4L5FL 3DWTA 4KI5E 5DO2D 4V2BA 1YEDB 3WIHL 4HC1L 1YEFL 3MRLB 4K94L 5L6YL 4OLVH 4LLWA 2WQ8A 2H3NA 4JRYD 1UJTA 2CR3A 2F8OA 3HS0B 1MHEA 3VXPB 1CE1H 3UTTA 4JRYE 2PR4L 2FIRT 2DD8L 2DN7A 2ZCHL 4XBPA 3MTRA 3C6LC 3BD5A 3V5HB 5F88B 5LG1A 4YPGA 2IF7A 5I71C 3BD3A 2YXMA 4GUPA 1HHKB 3VG0L 1AD9B 2BRRL 1IM9A 3AS0A 3TO4C 1AO7A 1DBJL 3KDMB 4N0UB 1T66D 3IKCB 1KCVH 5I1CL 3SKUD 4FTVA 1IGYB 4AEHH 3VXSA 5C09B 5GS1C 4TNVK 3U1SH 1FORH 1HH9A 1BFVH 3C8KA 3RNKA 3QIWA 4FFVD 5CS7A 1HZHH 4JFQA 5GSRB 3QG7L 3MRJB 5CEXB 3T2OA 3HZKB 1IAOB 3BEWA 3VFSB 1RUMH 3GGWB 3IAPA 5MEND 2D0HA 1U8PA 4I4WA 4PJBB 5JR1L 3U9UA 4Z0BL 2FDBP 5MENE 1KIRA 2J5LB 2WBJD 4J3OC 4KK9D 4L1HA 3KYNA 5D6CA 4NNPL 2DM7A 3JUYA 1UXWA 4OF7A 3V4PH 2MPAL 2AQ3A 2ICWB 2NY0D 5IFJA 2EDOA 1S78C 4M4PA 4QHKJ 4JRXD 5CJBA 4JRYB 2IH3A 2IAMC 3DO3A 5FK9A 1NLDH 3UTOA 2ICWJ 4JRXE 5AUMA 5ICXA 4YLQT 1JPTL 3BP6B 4HK0B 4XCFL 3PGCB 5IGXL 1EVUA 2V7NA 5J13C 3BISA 3ARPA 3S96A 3LZFH 4N5EC 1UEMA 4ODTH 3TT1H 2X9XA 3WO4C 3QO1A 1VSCA 3EOBB 4X6FB 4G8IB 32C2A 3NH7L 3UTZB 4C59B 3NA9L 1OAKL 4TVPH 1I8LC 2FSEA 3G9VA 3KVQA 5DUPL 2Y72A 1Q94B 2VE6A 4BUHA 5DRNB 4AYFA 2SEBA 3PV7A 15C8L 3IAQA 1N4XL 4FXKA 4Q2ZA 5D70H 1LO2L 4NZRH 2ICWI 3OG4B 1KPUA 1DN2A 3WJJC 5J1AA 2DQEH 2IANE 3MREB 3Q6FA 5DMIH 5A40E 4M5ZL 4OM0L 5IFHL 2AJSH 3BESR 1EK3A 2VIRB 3JSSA 4J2XA 1AI1L 1DFBH 4I0PC 4X6CF 3BGFB 3ILQC 5FA3B 5MENB 5K9JL 3TESA 1MRCH 5E4EC 5IB1A 3LRSA 1UG9A 4XVTH 5KS9E 4WO4D 4IS6B 1LO4H 4GLRH 2WBJB 4QXUL 3JWDH 3RVWC 4GAYA 5KVFH 1FV1A 3RBSA 4XP5L 3WFEH 1NGZA 4MJIA 4NN5C 3GKZA 1MCPH 1T1YA 5I1IL 4TSCH 1JWUA 4K7FB 2NY0B 4GRWF 4QF1A 4WENB 4M8QA 4ZODA 3MJ7B 4NKMB 1PZUB 3R1GH 1T0MA 5DFWH 3QCTL 3Q0HA 1D3CA 3TJEL 3N0PB 5JNYA 5T33H 3VFTB 2DQCL 1YPZA 4BKLA 4C83A 3MOAL 4LFHD 4NFCA 3REWB 3ARGC 1L7IL 2MQ3A 1YEJH 2DDQL 4PB0H 3I6GB 2HT3D 3BT2L 2DWDA 2ZCKL 3QUMA 1XGUB 2QQLL 5J6HA 1BREA 1T0NB 1FO0L 4GRMA 3SE9L 4G7YL 4K8RC 2E6PA 4HXBH 4OQTL 1NAMB 1ZGLB 2BNUA 1NCAL 1ZA3A 5KVGL 4DN4H 5SWZD 4XP9L 2Z8VC 3QEGH 2VLKB 1E4WH 2DQHH 1H5BA 2XG4A 5ICYA 2EH8H 4FQ1L 4NYLA 4P99A 3VXRD 1CXIA 3IDNB 5BO1L 4XPBH 4CN1A 4Y0GA 4XNQB 2JJVA 3MRGA 3C08H 3GB7B 3OKOA 3S4SG 4XB8A 1NAML 1WVZA 4LAQH 4WO4B 2V5YA 1Z6JT 4OZHE 2FNBA 2ZJSL 3BKML 4LPTA 4FFYH 3HZVB 2B2XH 4Q9QH 2I9LB 4HKBB 4UT9L 1FVEB 4GRWE 3VWKC 5DQ9B 1F4HA 3C6LD 2V17L 1DBML 1FN4A 2XWBB 4NRXA 1IAKA 2XWJB 1IGTB 2P7TA 3D1MC 5HYEA 3WEXA 3TO4D 4FQHB 2IGFL 3KYAA 2GJ6A 2O5YL 3UJIL 4ONHA 4V1DE 1E4JA 2QKIA 3GSQA 5FUOH 1MNUH 4OCXH 2V2WB 4OBRA 2Y5TA 3SDAC 4ODSL 4HWZB 3S37X 1GCFA 3WNMA 4M7LL 3PQYE 4X4YA 5ILTH 2P5EA 1F02I 4N90D 5TGBB 3GBNL 4B5EA 1S7XB 2ED7A 3KNBA 3ALWA 4G6FD 5IMKB 1JNHA 3CNKA 1INEH 5DVNA 1Z9LA 2FIKA 1YY8B 2VISB 4Z6AT 2AJYL 2YD5A 5SWZB 4GSDL 1N0XL 4Z76B 3IJYB 4OLWL 3RL2B 3F6IA 3WJLA 3LEYL 1P6AB 1QBMH 3VMPA 2GW5A 2FJGA 3P4MB 4R97B 4HX1A 5JW4N 4OLUL 2VDRL 3VXRB 3BZ4A 1VGKB 4OZHB 4IMKC 2GTZA 1S78D 5B38B 4JKMA 4QRSB 5CKGA 4HGKC 1MCJA 4MXVF 3VGBA 4GRWB 2MKWA 4DVBA 1KLUA 4PJEE 1TVDA 4KFZC 2G2RA 1IM3A 3MRNB 4HG4K 3P11L 1UADC 1RQ5A 3DBXB 2F19H 4XPTH 2FO4A 1WUNT 1PLGL 1NAKH 4LCCC 3C6LB 3L6FA 2FGWL 4NC2B 4PR5B 4R7DB 4N5ED 5I71B 3H7BA 2B1AH 4LPXA 3MXVH 1NBYB 5IBUB 3DGCR 3C60C 3QZWB 4HD9A 3TO4B 3KLDA 2FHCA 1JHLL 2VJXA 1WV7T 2QR0B 2APVA 2AXGB 1E4KA 2E7MA 2X2YA 4HXAL 4DN3L 2EZ0D 5C3TA 2AGJH 1JTTA 1T5XA 1U95A 1JNJA 4CW1A 5KN5A 1Y18B 1NDMB 5E95B 2IADB 3U6RA 5JPMA 3Q6GH 3QFJD 2Q1EA 1Q8MA 1N6QH 5HHVH 3QFJE 1K8IB 4M1GL 3W0WD 4ONGL 4XB7A 5CZXC 5CEZD 1URLA 5EU6A 3VA6A 1CLYL 4P5KB 2I07A 4LP4A 4FQXC 4NZTL 4PGDA 4G6FB 3GUTA 2VLRD 4I0PD 5CEZE 1J5OH 1QBLH 3VRLF 1NJ9B 4NP4H 1INDL 2VLRE 3MV8A 3H0TB 4PJAA 1T7WA 1FL3B 4NJ9H 1LP9F 1AD0A 2Y6SC 4ODHH 3RVWD 5BCAA 4YDIH 3U7WL 4XVJH 3FQWB 5MP6H 5D8JH 4I48A 1NCUA 5SV3A 3O2DH 3V4VH 5C0EA 4B0MM 1IMHC 5I30L 5F9DC 5D5ME 2PXYC 5AD0A 4XNMB 4JEGB 2APWA 3CFJA 4PJEB 4DK6A 3RGHA 5KG9B 4QT5A 5DSCA 3TBWA 3S88H 2E27L 2F58H 2I25N 4PRDB 5B21A 3SGEI 3CDFA 1FLRH 3V6ZA 5EO1A 1VEMA 4LCWD 3FB6A 2XQBH 5GISL 3GHBH 1CDUA 1RIUH 4YWGL 4M62H 5SWQA 1J0JA 1QYGL 5GGQL 5EU5A 5I1HH 4N0CC 4P4RA 1QLEH 3MFFB 1QQDB 3CMOL 5MEOB 2IMNA 3RKDD 3SPVB 4UNTA 5EFIA 4HS8L 4K8RD 5CHNA 4PLOB 2LVEA 1R3HB 1ZT7B 5I18H 2C3VA 3QFJB 1ZT4A 2FJHA 3O41B 4QHLB 4RGMB 1I4FB 4LHUD 5JW3L 1OSPH 3CVIH 1L9NA 3W0WB 1UB6B 4UOJA 2YD3A 2OXHA 4XC1L 2VLRB 4I0PB 5I6XC 4L8DA 3A6CH 2BHUA 4X8JB 1DN0A 4HZLB 1K2DA 3P4NB 5E4EB 5IIEA 3WNNA 2NY6C 5IW1A 3QQNA 4TTGA 1DSFH 1I1CA 1E28A 1MELA 4NN5B 4CL7A 3VWKD 3BUYB 5KW9L 1BZ7B 4X7TB 3MLVL 4M7KH 1UACH 3GK8L 1J1OH 3K4AA 2CJUH 4C56A 3BKCL 2VQUA 3V52L 2X1PA 2YHGA 1EERB 1VCAA 4QHNB 4RQQA 4N1HB 5E99H 2BVQB 4HUXB 1HOCA 1Q9WA 4XNXL 2R2EA 4YFEA 4LCWB 1CFBA 3ULUH 1CDBA 5C0BD 3UXFA 2HJKA 3PV6A 4YHKH 2ZOKA 5C0BE 3SDAD 4DFIA 1K5NB 4Z7NF 4JN2B 3QWQB 2FRGP 5JQ6L 3MLRH 5I76A 4TPRL 4PV8B 4GS7C 5BW7A 3MBEC 4WV1C 3DUUB 1LK3H 4PG9A 3NPZB 1ZAGA 1LO3L 4P9HL 2ARJQ 5J9PB 1MPAL 5GSVA 2BSSB 2XPGA 1PYWA 2VR9A 3I6KA 1KIQA 2PKDA 1ZEAH 4LHUB 1KLFA 2GCYA 1DBBH 3T8XB 4X98B 5DT1L 2PTTA 1GOFA 1EFXD 5DZLA 4XWOC 2WQRA 2BSTA 1KTDB 3FQNB 4MB4A 4OIBA 5E1AB 5F1NB 5CD3A 4Z7QF 1Y0LB 5JMRA 2EDLA 1LP9B 4K2UL 2E7LC 4K8RL 4MD5B 4M3KB 1SEBA 1KBGH 5JORA 2BJMH 4G5ZL 4XMLH 4U1GC 3LV3A 1HQRA 4X6EA 1RHHB 1UKTA 2C9AA 4HDIB 3SQOL 4EBQL 3OB8A 2LABA 3K1KC 3BKYL 4JFFA 3PHOA 2K1MA 1VADA 3OV6A 2DAVA 4N68A 3VWKB 2WMPA 1F3JA 2O93L 5DD3L 4Z18A 4PGEA 2VUYA 3LS4L 4MQSB 1T21A 5T1MB 3C60D 1A6WH 3GMOA 1ONQA 5EU3A 2VB5A 5IV2B 5C0BB 1OD9A 2ZSWA 5DQJA 3KYKH 1QVOB 1JRHL 3BRFA 1OAUL 4Z7NE 3SDAB 3MO1B 1KJ2B 4JE4B 1I3RA 4P2OA 4XP6H 2G5BB 3IDXH 2BNRD 1SJEB 3N9GH 3SGKC 2GK0A 1AQDA 1N59A 3X3FH 5CZXD 1BAFL 1GYAA 2YK1H 3MYJA 4FQXD 4ELMF 5I16A 1W72H 2P5WE 4W6WB 1JRHI 1LDSA 3MRQA 4P5MB 2GKIA 2ZPKL 4H0HB 2HFEA 1KC5L 1KTLB 2AKRB 1EVTC 3JV4A 1KJ2L 2YKLL 4N0FA 1XR9A 2Y6SD 4BH7B 5D2LE 1EFXB 4Z7QE 2DM2A 1ULVA 5KAQF 3FCTB 3NABL 2DBJA 4TTDC 5DHVB 1RMFH 4AIXA 2PXYD 4RWYH 2ARJA 3A6BH 5GS2H 4DGVH 4KU1A 1I1AA 4UV7L 3MC0A 4NQVA 4ELKA 2FX7H 2YPLD 4LNRB 5BXFB 6FABH 3QDJE 5H8DA 5JA9A 1UVQA 3WFDH 4EI6B 3BO8B 2W65B 3IFNH 4LCCB 3CLFH 4KMTH 5J0BA 3PDOA 3PWVA 5DUBB 5GRVK 1ETZB 4XPGL 5KVMC 1BOYA 2DOCA 2W91A 2Q8AL 4JB9H 3DRTA 5FYJD 4U0QB 4N0CD 4NN6C 3C60B 1XF2B 1M7XA 1NEZB 4KPHH 1AGFB 2A73B 5FYJE 1W0WB 3CSYA 5K9KB 3WV0A 5F8RC 1YMHB 4WI9A 3PDDA 3FB7B 4YBHA 1QFWL 5T3ZD 3B43A 1AY1L 2CSPA 1G7IA 2XNAA 4JLRB 1XIWD 2BNRB 3VFOA 3P9MA 4LPUA 4RDQF 3HNSL 5FHBH 3SGDI 2DQGH 2CQVA 2AABL 3M8OH 2I60H 2XV6B 5J6GB 5B4MD 5D1ZC 4X7FC 1RZ7H 3N50A 3MROB 4FQXB 3SJVD 4LPYA 1NCBL 4YHLH 1QFWI 5FYKD 4Z78B 3PHQA 5IR1B 4O2CA 3SJVE 2R8SH 1J10A 3SE3C 1N26A 1I8IA 1LD9A 5I8CA 1Q0XL 3CLEL 4HUWB 2NY6D 3KR3L 3M07A 1NBZB 2NZ9C 4HFUL 1BJ1H 4ZUSA 2F74B 2DQIL 3W9DA 3RP1A 5GS0C 4Q6YA 2PXYB 3VFGL 3WBDA 5HBBA 4NBXB 3U4AA 1MQKL 2R1WB 1U0QA 1DQDL 2ESVA 3U4BL 4GG8B 5HDQL 5ISZD 4DZ8B 4JRWA 1LQSR 3DX6A 3OKMA 4LF3B 4PJIE 2YPLB 4H20H 3T4YB 1BFOA 1UGNA 1T7VA 3OHXB 4WFHD 3R0MA 3MNWA 3D85D 4IMLB 4HULB 5FYJU 5JOPD 4OCYH 1CFNB 5DD6A 1IGJB 5C6TH 4Q0XL 4LL9A 5F7LB 1WZ1H 5IQ7H 3KPRD 1A2YB 4NKDA 5MEQA 1KPRB 2E5EA 2HFGH 1A7QL 1YEHL 4WW2A 1A0QL 1Q9LA 4L8SC 3MBED 3B8SA 5TQ0H 1IGCL 4DKEH 3MRHA 5F1KC 3THMH 3P4LA 1B6UA 3BWUC 4RMUA 5FYLH 3QO0B 5B39G 1XIWB 4ELMB 1MLBA 2MHAB 3RZWA 2A9ML 3TH2T 2GQHA 3P9LA 3IXAA 4XWOD 2Z31A 2ZUWA 3DUHA 3SJVB 2FB4L 3RAJH 2FZ3A 1HSAB 3ULVC 5CGTA 5I6XB 2ATKB 2EIEA 4XXDB 2ADJA 2UY6A 3LHPH 3MLUL 3W81A 3QT2A 5T3ZL 1ZA6A 5DJZB 3O9WA 4Y4HC 2NY6B 2R0LH 2WWMC 5E6YA 3B5GA 1H15B 1QFOA 1CXHA 2CDFA 1QZ1A 1A7RH 1SY6H 1KCVL 3VG9B 4MAUH 1C8PA 4X5LA 3O3AA 3JTSA 4OV6F 1Q1JH 2DJ4A 3L3IB 4AEHL 5ISZB 5E70A 5FYKL 4FQQB 3U1SL 4XMKL 2X40A 3BEVA 4UT6H 1UCTA 3NMEA 3QIUC 4Q7DA 5JXEA 1I1YB 4ZUVA 1NMCC 3DSNA 1UA6L 1AHWC 4N0YH 1KCRL 3GSXA 1S9XB 2FGZA 4UAOC 3AY4C 2NTSP 1FL6A 2NY5H 3D85B 3UYOD 5A2JH 1BQLH 4HV8A 3QA3B 2XZZA 4NOFA 1J0YA 3U48A 3QXVA