2AQ1B

Crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
234
structure length
234
Chain Sequence
b'SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWHGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell receptor beta chain V
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 69
structure length 234
sequence length 234
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aq1B02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2aq1B01
1ET6A 3O13A 2SEBD 1TS4A 3DWPA 3MFGA 2TSSA 2NTTA 5FK9C 1HXYD 4L6TB 1PRTB 1SEBD 1LO5D 4NZLB 1D5XC 1LT3D 3BVMA 3BVGA 1XXGA 3URYA 4RFBA 4OHJA 1RD9D 1B44D 1ENFA 1CQVA 1CK1A 3CHBD 1LT5D 1YN4A 2Z8LA 1LT6D 4DXFA 1ESFA 3DWAA 1CHPD 3V05A 1PTOF 5FKAC 1LTTD 1V1PA 4RHSA 4RH6A 3BYYB 3R8BA 1PRTD 1EFID 1BCPD 1PTOC 1FD7D 1SE2A 4RHRA 5ELEA 1TS5A 1EU3A 1I4RA 1JWSD 1LTAD 1I4QA 1SXTA 3GP7A 2QEJC 1FNWA 1JWMD 1KTKA 3EA6A 1LLRD 1PZJD 1TS3A 2O2LD 1QILA 1YN5A 1PYWD 1XTCD 1MD2D 1TY2A 2XN9C 4L63B 1YN3A 1SE4A 1AW7A 1D5ZC 2ICIA 3BYTB 2IPKD 1S5FD 2NTSA 2G9HD 1PTOB 3BZDB 1ET9A 3OWEB 1TY0A 2J4XA 1S5ED 5ELFA 1SE3A 5ELDA 3W2DA 5TSSA 4RGMA 1GOZA 3KLSX 1UUPA 1EEFD 1S5CD 3BVZA 4Z9CB 1L0XB 4DXGA 1FGBD 1EEID 1L0YB 1V1OA 5D3IB 1BCPC 4O1NA 1HQRD 1LTSD 1FNUA 2IJ0A 1LTBD 1M4VA 1B1ZA 1EU4A 1LTID 1CT1D 1HA5A 1PTOD 1CHQD 1S5BD 1SBBB 4BWGB 4TSSA 1I4HA 2AQ3B 4RCOA 3DWQA 2CHBD 4RGTA 1RDPD 1RF2D 4ZYSA 1UNSA 1LTRD 1TS2A 1SJHD 5ELBA 1G8ZD 5I4DA 1DYQA 1D5MC 5D3DA 1RCVD 3SEBA 1SJED 1V1PB 2RDGA 1LT4D 1PRTF 2AQ1B 1BCPB 1BXTA 1BCPF 1I4XA 1S5DD 1T5XD 2XRQD 1JR0D 3R2IA 4K6LA 1PTOH 2WV6D 1PZID 1STEA 1DJRD 1PRTC 3MC0B 3TSSA 1I4GA 1PZKD 1JCKB 2XNAC 2QILA 1KLGD 1JQYD 4UDUC 1HTLD 4RGOS 1JWUD 1F77A 2RDHA 5ELCA 4C56C 2XRSD 3EFXD 1EWCA 1I4PA 3R2TA 1D6EC 2R61A 1FNVA 1KLUD 2AQ2B 4RGNA 1AN8A 1LTGD
chains in the Genus database with same CATH superfamily
4DR3Q 2LXJA 4UP9A 1WGGA 4DNRB 4ZOHC 4K5WA 4PT5A 2R93G 1XWEA 1NUCA 2F0EA 2HT1A 4US8A 4A3IB 1A8VA 1ZYRC 4U673 1Q90A 4ICUA 4K6DA 1A3VA 1F9SA 1H9KA 1NY4A 2D9UA 4IFDG 1RD9D 4JI4Q 2LHDA 2MP2A 3PO0A 1VQKA 3P4SB 3FAHA 1K9MC 2E3TA 4IWQA 2MBQA 2FMCA 1EYAA 4ANVA 3FP9A 1PQSA 2GBJA 1TT5B 4PS8A 2F0GA 1VZ8A 4ZAIA 2DHZA 2MGSA 3FVQA 1JJGA 3WOFA 3IBEA 3S1NB 4RHSA 2UUCL 4WAAA 4A20A 2OT2A 2NWGA 5CV6A 4L5SA 1QT9A 1TJEA 2ZTDA 4RHRA 3T56B 2EJFC 4XQNA 2CHWA 4MSMB 2RCNA 2WDRB 4LNOA 2L12A 3RNBC 3EVQA 3PUYA 1C79A 1Q1OA 3K5OA 3GP7A 2WKDA 2EYMA 3EA6A 3KYHC 3W5OA 1I94Q 4GZYC 1V2YA 3LB8C 4C3HB 2VRRB 2KX0A 2CKHB 3ECIA 2M0XA 4JI6Q 4CO7A 3S17B 5LNK1 2XSCA 1VF5C 1TWGH 4H02A 1R7SA 1NTGA 5M3FH 4A3EH 1WJ4A 2DAJA 1EY5A 3BZDB 2Z9HA 3R66C 1DOXA 5D65A 1HNWL 3GO5A 1Y56A 2ZVOA 5KNCA 3I63C 3RCZA 2VH1A 1IZ6A 1STHA 1YQBA 5ELDA 2QDBA 2JXXA 1D1KA 3T13A 4H2AA 5LHY1 1P16A 2B76B 4FHJA 3T1YL 5C2TB 4BA1I 4C3IB 3UGBB 2UXDL 2JP1A 1I6HB 4YTNB 1YD8U 3M9BA 3NSWA 3SGIA 4DV2L 1XPUA 3VRBB 4DV1Q 2INDC 3L3OC 2Y3AA 3W9CB 1SBBB 2L52A 2Y5BB 3LYYA 1SE9A 1FCCC 1HR0L 2VY3A 4KDLB 3OIPA 1WXSA 4M0WB 3GTLB 4USAA 3HKSA 3P4RB 3J80i 3G48A 3MHBA 5M3MB 4GKJQ 4MGIE 2BH8A 1VQHA 1BR9A 1T0YA 3KLRA 1L6UA 2MHJA 3GTPB 2NVXB 2E5LQ 3A74A 1WJUA 4MT5A 1A0IA 3OG5A 4DHJD 2EYPA 5L83A 1WMHB 4OWXB 1KJTA 2M56B 1ZDVA 3PZ7A 2PPHA 2JN4A 2FBWB 1F2RI 4X57B 2MJ8A 1PH1A 4IURA 4EX5A 2KANA 2JA7G 3ULJA 2K5VA 1RL2A 1WCMG 1C77A 2Y5PA 3TN2A 3L10B 4WWMA 2R7FA 1WFQA 3HZXA 1MIUA 1MBYA 3I4NB 1E5WA 1T3QA 3A4SC 2P5ZX 4M02A 2Z1CA 3GTOB 1KXLA 3DWPA 2N0SB 4AJWA 4C3HH 3V2TA 2CS4A 2WDQB 3A1QA 4GDLB 2IL8A 2D2QA 1YJ9A 1TZOA 2RVLA 5M3FG 4JIOU 2YTVA 1N36L 2YLMA 2PZUA 4BY7H 4C1NK 2K3UA 1WJJA 2Q8TA 4DWFA 3A54A 3N30A 4HIDA 4AYBG 2K25A 4XWWA 1SFOH 2LMCB 1I50H 2KJRA 1OFFA 2OTLA 1STNA 1TKWB 2YEPB 3U52E 4XYQA 1HQMC 5CR3A 3QQ8B 4HPMB 1I7HA 3CW2C 2K9XA 3RNGC 1LT6D 4H7BA 5LL6X 4ZRZA 3C8YA 1B53A 1YIJA 4B9WA 4NJ7A 4IUNA 4X65Q 2HDLA 3KLSA 4QB4A 1HA6A 4X66Q 5C3EH 1JWBD 3HM6X 4B95A 1PRTD 4DN4M 3RN5A 2A6HC 4IPCA 1Z2MA 5K36G 2D3GA 3DVNU 2ZJRA 5CV4A 2F0QA 5GQOA 1TS5A 2JYOA 4A3IG 3LX0A 3HGBA 2ZXRA 4G4KA 4HJ9A 3MC8A 3CPFA 2MQHA 1FEHA 1FNWA 1YNJC 5AJ3Q 1JMLA 1HE8A 3A7LA 1DZ1A 1H4RA 2IO2B 4K7SA 1O7YA 1FXTB 2NVUI 3QG1A 1C9FA 3Q8CA 1E7PB 3UINB 1JROA 1DD2A 2W3SA 2IPKD 1S5FD 1E1OA 3S1RB 2UYZB 4BAXA 1XLOA 3ZDMC 3T53B 3OWEB 3AMZA 5FR3A 3VR4A 3HOVH 2XVSA 2B29A 5IYCH 2PTLA 2L1BA 3FMCA 4JV5L 3RZOB 1HNZQ 4TV3A 4Z9CB 5J1ZA 4DR7L 3MJWA 4KKIA 3HOXB 1CSQA 4ZLTF 3IFDA 3S9WA 4DUYL 4MGKE 1X54A 5BR8Q 1EZ8A 4C3HG 3T51B 2B63B 4NQKE 3GTOH 1JQ4A 3BIID 3EIVA 4CGYB 2BQQA 3QOJA 4G0NB 4FJVB 3BK2A 4WORA 2JVCA 3I7FA 4LWCA 4DDGD 2V1CC 4TSSA 3V96A 4BWGB 3CD6A 2BYFA 2HTHA 2N7EA 1WOCA 4B6WA 2L76A 3VH3B 2B3GA 4F7XA 4DBGA 2VQEL 5EGTA 1FFVA 4FXCA 2CQOA 1PH2A 1YJIA 4W9HA 3U7DA 2RA4A 2D07B 3EUB2 3BG3A 1C48A 2B2TC 3U58A 5EE9A 2NYZD 4I7ZC 3MAQA 2E2DC 4FBJB 4C3IG 4ANWA 1QVFA 2XRQD 3KK7A 3QJYA 2K0PA 1Y8PB 3F2UA 5KEEA 3D32A 4RG1A 3KJOA 1LYLA 2DNEA 5J22A 3GE8C 2JA6B 2EDGA 4HMJA 2OOBB 2D5GA 1B9NA 2K6QA 2ZZPB 3QIAA 4FXDA 1B3QA 2SNMA 2KVRA 2QDFA 3RNCC 5DNFA 3GS2A 4ILWA 1E22A 3NG0A 3ZJVA 3NY5A 5CX3A 2KACA 4P1CC 1O78A 5M3MG 3I4LA 1DGJA 2M00A 4C56C 3AE5B 3KUZA 3H94A 4OEMB 1WGRA 3PZDA 1UD7A 2Z59B 2V3NA 1WMHA 4OO1I 2SEBD 2MJEA 4KZ0A 3RNAC 2KZRA 4LUZA 3GQBA 3PIO3 4NJ6A 4HJ8A 3A9JA 4HPLB 1EY7A 3OW7A 4QF4A 5LMNL 1PXUA 2MSED 4LF8Q 1C7YA 4RMFA 3CXCA 1LT3D 1J7AA 1EM7A 3URYA 1L0WA 2BH2A 1ACCA 4HIOA 2IDYA 2NBUA 3AFPA 2YEPF 1CQVA 3ZJYC 2WXPA 3CHBD 1JORA 4B9KA 1RIPA 1EY9A 2WQYB 4DAMA 2DJFC 1YNTE 4X62L 2DLBA 3ZNGC 2E2IH 3I4NG 5IYBH 2RF4A 1U4MA 2N9LA 1F2MA 2PLPA 4GDLA 3APDA 4LNNA 5DPWA 4DR2Q 2FCNA 3VQIA 1NENB 2K03A 2JA5B 4A90A 3MEHA 1TWAH 2L0CA 1IKMA 1P0RA 3PHXB 3WAOA 2LMCA 2PCFB 2L7RA 4DV5L 2BYEA 1C1YB 4B0MA 1EU3A 4KDIC 5AUIA 4K0KQ 1RFAA 1VLBA 3BDOA 3DHQA 3HS0C 5CBAE 3H9DA 2IO3B 1U4LA 1EIYB 4URKA 2NPTA 1ZPSA 1IP9A 3B9JA 4A3GB 3U8ZA 4IZ8A 2JQRB 1V5OA 3D4RA 3AEVA 4HCNB 3SHQA 2LXCA 3BYTB 1K0RA 5BYRA 4DPGA 1J19A 1J5EL 2D2CC 5HI1A 2QMTA 3RZFA 1FRDA 1TY0A 1L5PA 2G4SA 1S5ED 4P71A 4HJ7A 3GTKH 1FVIA 4C00A 1VQCA 3UE1A 3DDCB 2Q2TA 1UUPA 1EEFD 2FNJB 4N9F4 1HPCA 2V3PA 2V9HA 2VZKB 1YBYA 3VDYA 3NS1A 4YWMA 2A5UA 1MKHA 1CKNA 3MXGA 2FCMA 3AE7B 2OQKA 3I4MH 2Z6KC 2R92H 1F2RC 4EE2A 1LTSD 1VQ5A 1LTID 1WGKA 2XEWA 1VQPA 3OJ4B 1NR4A 2JRIB 1RHPA 1UWXA 1IW7D 5HURA 3N3KB 4WQOB 3I73A 2EIFA 2MRPA 4BKGA 1TKGA 1MSGA 1X55A 5IWAL 3W1SA 2JA8B 2EXZA 1X6OA 2DENB 4POGA 3VAWA 2X8XX 1UEBA 2F03A 5JEAG 2E74C 3ND8A 1WXVA 1IBLL 3A56A 5IYBG 2LS01 1SRUA 2MHVA 4BBRB 1WZ0A 3HOXG 2K33A 3AEEB 3I3TB 4B3MQ 4TRDA 4XZ4A 2B63G 3D3RA 2GBKA 1CA6A 4EQPA 4OWTB 3ZQ4A 2A73B 3U4VA 4MGZE 2J7ZA 2JEAI 1H95A 1HEZE 1A3UA 3W5VB 1WE7A 2JXMB 4HN7A 1QOBA 1Y8OB 3FEWX 4NW2A 3NBIA 4OZBA 4RGOS 1Z5SB 2DN8A 2K28A 2A6ED 1F77A 3K6OA 3SE0A 3M85A 3TEYA 3HFZB 4CDEC 1AP0A 3ZRCA 3CWIA 2LXKA 5CBEE 4BZAA 2RDFA 2AUJD 2O2VB 4YTMB 3CRLC 1VQIA 2BE5D 4DA2A 2J52A 1ET6A 2Z6KA 3W3AA 1JB7A 3I5JC 2E2HB 4KN4C 2G4DB 4ZYNA 4DV4L 4DV7L 4A76A 3ML9A 3UQAA 1AH9A 2PE6B 3ERQA 3PUXA 3I3CA 2UXCL 3SXHA 4I6NB 3WANA 4A3PA 2LGXA 5IP9G 2JA6G 4EZLA 4JK1C 2L0FA 3G4SA 1TT2A 4JBJA 4NXMQ 2X6GA 3T1HQ 3AXCA 1J8IA 2AEHA 2B39A 1JJ2A 2J0JA 4LFBQ 1WD1A 3VTWA 2E76C 2VUMH 1YX6B 3GV6A 4MJSA 3N9YC 2QGQA 2K5DA 1CFMA 1DGSA 1WR1A 1PH9A 1UGMA 3OAWA 4HDOA 2WINB 1F9PA 3BYYB 3ER0A 1ASZA 3M7NA 3SHLA 3C0RB 3AE4B 3ZGZA 5IODA 3S14B 2L4NA 1YZ6A 1PVOA 2JY6A 4FHKA 2K8CA 5E3FA 2K50A 5M5XB 3GTGB 3F2DA 1SDFA 1LTAD 4PZ6A 1WYGA 2KDFB 1E1TA 3MWYW 5JVH3 3IAS1 4GOCA 1HHVA 3RLNA 3M4QA 1PH3A 3MJ5A 3NWTA 1TWFB 1TS3A 2KHIA 4JI2L 1QILA 1BDOA 2KOLA 3RPFC 2EJGC 4F87A 1AW7A 1H9SB 4OIJA 1SR3A 4NAWB 3PIP3 2JA5G 3I55A 2CJNA 2BA1A 4QIWB 2KWVB 2MBEA 4KVGB 2K14A 1Y1WB 1NDDA 3ENEA 5FJ8H 1ILPA 5EKLA 2QCPX 1PGXA 4MM3B 2C7HA 4N9TA 3W2DA 3AU4A 3GDEA 1F1HA 3KH0A 2CH4A 2CQAA 1DOKA 4J6IA 2A68C 3FRPB 3AH7A 3PO3B 3M3JA 4X64Q 2DZIA 3K9OB 4RF0A 4KHPQ 2Q5WD 3V62A 4RMAA 2LSSA 1BO0A 5LLIA 1RWSA 4A3GG 3ABVB 2O5JC 1E2ZA 1NNXA 3ZTCA 4DKAC 1ZXIA 2XTIA 1IGDA 2LGSA 3L54A 4CQNA 2N9PC 5LMUQ 1EWIA 4BY1H 2I2YA 1VQ9A 2N8NA 1D2BA 2JXTA 3KYDD 1UE7A 1RDPD 4HKZE 5C4JH 2KJHB 4MH0E 4RWSC 2LVOA 2M8SA 1VMCA 3ML8A 1TXYA 1DONA 4DU9A 3UIPB 2NN6H 2D3BA 4A3LG 3CQZB 4JWUC 3ETRA 3SK5A 2CW0D 1KQSA 4JBMA 3TIXA 1SJED 4H13C 2MNAA 3PS6A 3UI2A 2HJ8A 2DGYA 2V4IB 1XYIA 2V4LA 4WAFA 4I65A 5FKAC 1AARA 3R2IA 2KHJA 3V3XA 4J8QA 3E6ZX 2WV6D 2BBCA 2KDIA 3N1YC 2A19A 2CWAA 2LY7A 5CV8A 4IOCA 3STBD 4B08A 2EYJA 2PMZE 5IT9E 2OWOA 1UELA 4JVZA 4GDKB 2R7DA 3A55A 4R8IA 1JRUA 1HTLD 1YNNC 5JPMC 1N32L 2LASA 3VH4B 2JA8G 2V4DA 1NE3A 4RNAA 1JW9D 2I5LX 4C1NI 4EQNA 5C4HA 3BVMA 2O4XA 1FFUA 4AH6A 4PYZA 4TKNA 3UQBA 3T3NA 3NXWA 1BBWA 4KKUA 4ME3A 1TWFH 4BBRG 1N60A 1QZEA 2KTFA 3GTJB 4FA6A 3H8HA 3Q3NC 4KHVA 3A8JE 4NMZA 2DY8A 1SMYD 3TMPB 1SEBD 4R4IA 1FL0A 4DAPA 3EECA 4XTCS 4DK5A 4R9WA 1KM7A 4UP8A 3LXFA 2PQAA 2WU5B 4RFBA 3MXPA 4LF5L 1O80A 3HOWH 1V8CA 2DAFA 4P6VF 1C9OA 4OO1G 2O2VA 1H8CA 1U4RA 3DMUA 4KIKA 4JI1L 5FO8B 4KSKC 5IGGA 5E4XA 2UU9L 4OW0A 4FF1A 2JSVX 3AE6B 1LTTD 3E0JA 3U4EG 5FLMH 5AFWA 1S1QB 2B2WA 5E7NA 1GHKA 1YHBA 4YHHL 1BCPD 2M19A 3R93A 5ELEA 2KT7A 3E9IA 2JQOA 1FJGL 1C78A 3QARA 2K22A 3TP5A 4GOPA 1V49A 3CCVA 4KY7A 1RYJA 3ERSX 2Z0EB 4DR5L 2F0NA 2EYHA 2SNSA 1PH8A 4LF4L 3CCSA 1N33Q 3QHTA 3TS2A 1P7FA 1QOHA 3J81E 4JV5Q 1ICWA 1MD2D 5BN3A 1IL8A 5IOCA 1QOGA 1WYWB 2MBBB 1OXXK 4HTHA 4BA2I 3UIOB 4Y7NH 1GKHA 3K5MA 2N9EB 1MGSA 3VVWB 2IHFA 2KOXA 1IUEA 1YJNA 3NBHB 1WTOA 1SYCA 2G9HD 1ZKOA 4APVA 1PFMA 2B2YC 1ET9A 4FYDA 5AZHA 1AYFA 1WTPA 1S40A 4AJYB 4W9CA 1MI0A 4PZ8A 5C44H 1GOZA 2BA0A 2F0LA 2Z0SA 3M7GA 4FN2A 1D7QA 3ZW3A 1FGBD 2FIFA 3H7PB 3CCEA 3MHZA 2NVTH 3NVVA 1TWHB 4FXKC 1H9SA 1MHXA 1C4PA 1HQRD 1V9JA 2IX0A 2J7QB 2PE9A 1MJCA 2IJ0A 2QDLA 4H44C 1EU4A 5DAUA 2FINB 5EKKA 3WIMA 4ZHOA 1PTOD 3RULA 4GKKL 4AWJA 5JPNC 2GVBA 2NZHA 3L0OA 4AIMA 1WYDA 4POFA 3M4PA 4A3FH 2A69C 1OXTA 1Y1WG 1HCZA 2F1MA 2LD9A 1BVSA 1UNSA 3FKIH 1QUQB 4C2MH 2VNUD 2GN5A 1CI3M 5I4DA 5IO9A 4ITKA 1EIGA 2KTRB 4II2B 3PO3G 2AL3A 1WJNA 1S5DD 1JR0D 2JEBI 2F0IA 4A3MH 4UY8C 3KW5B 4F8CB 5HGTA 4DK0A 3RN9C 4OELB 3VHTC 1BUVT 2JE6I 1XO3A 3CSFA 2DJGC 4TQUS 2WKCA 2KENA 3R7RA 2OTJA 1U0LA 3E3XA 4Q5VA 2WAQE 1JQYD 1F2LA 1MPEA 3ZIMA 1IBXB 3H91A 2XIWA 1GC7A 2F0OA 1VQEA 2VXWA 4P72A 3M4OH 1L6VA 1FYCA 3ULPA 5FLXc 1JWAD 2HJ1A 2JZ3B 2WXOA 2VQFL 4OVUA 2BS4B 3O65B 5DPSA 2TSSA 3CCJA 5BYQA 4OONA 1HUNA 3F2BA 1OQYA 3ZNHB 5IYDG 3APFA 1MG4A 4A3KH 1TWGB 1WTXA 3JAME 2CHXA 3PT2B 3KUPA 1XX8A 4A3EB 1E7UA 4WH4A 5IP4D 3RNUA 5BO4B 3T8MA 2EYOA 5CYUA 1VQ7A 1K8RB 5KHOA 3TEHB 3ZLZA 1B44D 4DAYA 1NCVA 3PPAA 1NI2A 1WI5A 1XCQL 4RM8A 2XK5B 4CHKA 4EVOA 1CA5A 1ESFA 4K7WA 2HHHL 1F52A 3NVZA 1EZ6A 3L17A 1YQ3B 3G7LA 1SLJA 4KKTA 1FXIA 3Q8FA 3AE2B 4CJ1B 2DBYA 2MO1A 3M63B 1F0ZA 3NUCA 1A2TA 2VZAA 2ENBA 1AE3A 3C2PA 3NWSA 2KHSA 3PV1A 1FGUA 1F2ZA 5I6YA 2UUAQ 3KUCB 4ANXA 1OEYJ 3ND9A 4ODGA 4IUUA 2L05A 1SSNA 4RAUC 5H8YE 2LRUA 1I3QH 2SAKA 3RMKC 1LLRD 3GZNI 2F0TA 1LFDA 3RNEC 5C0XG 1R4PB 3H09A 3MXUA 1YJ1A 2MW5A 4HCSA 3JC66 2D11A 4ME5A 4HLEA 1U5KA 1N5XA 1WIAA 3JYUA 1L2NA 1YHQA 4XDDA 3K80C 3P4PB 4DR1Q 2JYEA 1ZXHA 4QUCA 1ZYRD 3SR1A 4DF7A 3AV8A 5JOBA 4S3SA 4JL9A 1VD2A 5CV7A 1HTQA 2XGTA 3AE1B 2PI2A 4LF6Q 2NVYH 3T9LA 1HJPA 3TEWA 3MVVA 1QF6A 5IE8A 2CU3A 1LACA 1L0YB 3HOYH 2EELA 2L0TA 4IM0A 4A3CG 1R9TH 2BB6A 4IALA 5M5WH 2F0PA 3TZUA 5J18A 4JYAL 1IBLQ 2PVGC 4WWNA 2LZ6A 1CZGA 3NBHA 3NHHA 4YY3L 2LXAA 1A62A 4AQYQ 1K28A 3K0YA 1Q0WB 1WRDB 1V6EA 3X3MA 3AB5A 3DVNV 1W2BA 4XYCA 1JE5A 3X3NA 1E2WA 1SIJA 1Q86C 4MTNA 1XMOQ 3MA2B 3DWQA 3AEGB 4BY7B 4II3B 1XJVA 1RF2D 4A93H 4FJYA 3KDFA 1DM0B 2AL6A 1KOTA 3I56A 1OQQA 5LMNW 1SFOB 1YIWA 1I50B 3PO2H 2M0AA 4IW0A 4IPHA 3T16A 1YVCA 1R4MB 3CKIB 4XQQA 4IJLA 2PVOD 3Q3FA 4GU2A 1KDCA 3BDCA 5JHBA 2ZT9C 2IX3A 4LJOB 1YQ4B 1X32A 3LNNA 1PZID 4IFDJ 5C3EB 2OQ0A 5G55A 3MC0B 1HZCA 4JI5Q 1ZKHA 3E0EA 3AU5A 1DCZA 2RCFA 1T5EA 2UXBL 2R2QA 1NMGA 5IGFA 3DM1A 2LI5A 5GMVA 2RDHA 2MO0A 4QCLA 2XRSD 1V5TA 2D3AA 3VYSA 4M0WA 1QNUA 4JW0A 3CC4A 2WXIA 3BJUA 1WX9A 1F9QA 3TDQA 1C76A 1WD0A 2EY5A 2V1YA 3H0GH 1G2TA 4LF7L 4B3RQ 4IN3A 3H15A 2VL6A 1HXYD 1N63A 1T6BX 5IGDA 1K52A 4NJCA 1T0RC 1PFBA 5EBCA 4MACA 1STYA 5E4WC 4XXEA 3W1GA 1E8WA 2EKIA 2AWNA 1IBXA 4IUPA 3VYTA 4IO9A 1E6EB 4NXNL 2XBBC 3HOVB 3AM9A 2RD0A 4S0RA 2IW3A 2UUBQ 4ZRKA 4C4VA 1VQDA 4WQMA 1OXSC 5K5PA 2ZPYA 4LNIA 4LFCL 1N34Q 4KJOA 2WXFA 1A5RA 3IL8A 2EYLA 3FDTA 1V1PA 3QX1A 2WXGA 3ZNZB 4ZHPA 4JI2Q 2L83A 2KECA 2D10A 2IO0B 3F1ZA 2L00B 1RODA 4G11A 1JJCB 3J81i 2F4VL 5H92C 3GZNB 1P98A 4BBSH 3VXWA 1GPXA 2G5DA 5I6WA 2WGSA 2PZWA 4A3EG 4BVUC 1V80A 4IWPA 1ZP0B 3DVGY 4FVMA 1VQJA 4CDDC 1GUTA 1NR2A 1IL2A 3T4AC 1NYQA 3MZ5A 2O2LD 2BKRB 3P20A 4KV2A 2ZEQA 2MA9B 2KDMA 1O7ZA 2AHOB 1G6ZA 4LJPB 2QKIC 3ZRFA 3S2AA 3D4DA 2XWJB 2OCEA 2EVBA 4DV3L 1YMHE 3EFUA 3I90A 3OHXC 1GXDC 3A5ZB 2MWSB 1B8AA 2RPVA 1QCBD 3GE3C 4C7ZA 1EYGA 4K1RB 3UI3A 3EBEA 3BZKA 2PMVA 4FO2A 4GNXB 2LGIA 3BZCA 5IP7H 1UH6A 4RKBA 2R7ZH 2NB0A 3N1ZC 1VQLA 3WWVA 4Y52H 1X56A 1GD7A 3MEFA 1LGRA 3PRPB 4NQLB 1B1ZA 2IGDA 3RI7C 1ENCA 1EIHA 2IGHA 4ANUA 2X6LA 5D14A 3ONSA 3ZNID 5I2YA 4JWSC 2K6AA 4X6AH 4ICVA 2WFWA 1R4NI 4DV6L 4KJNA 4MN3A 2ZW1A 4ZDVA 1WX8A 1YNJD 1UBIA 1SJHD 2IYDB 3HEJA 1PFDA 1ZE3D 5J2RA 4OWWB 3I72A 3B2GA 1YITA 1N32Q 2YU9B 1LM0A 3L9AX 3N20C 2PNHA 1AWDA 1O7LA 1PRTF 3HKZE 2AQ1B 3D8GA 1BXTA 4JBWA 2E2IB 4BXXH 5JJIA 1S72A 4OVZA 2N7JA 3E9HA 3MTSA 4W9KA 3KYCD 4IUTA 4NAMA 2G3QB 3IAM1 3U30A 5EE3A 3SK6A 5EPKA 4S17A 1TWAB 4B3TQ 2A1AA 2K5HA 1X3FA 3K7AB 1K8AC 1GG3A 2N1VA 1KRHA 1YX5B 2N88A 1B9RA 4OX9L 1P8LA 4BY7G 1GAQB 3I91A 1Q5WB 1SF0A 1WF9A 3WOEA 2BS3B 3M62B 3VTUA 1YHAA 4B3SQ 1XNQQ 4K81A 3EFXD 2R61A 5KYLA 1SB3C 1OQRA 2RSUA 1AN8A 3JAMi 3U7ZA 4GS3A 3K0XA 2KEDA 1A3TA 2DYBA 4N59A 3ZDTA 4L23A 2J0TD 4NZLB 5GXGB 2I5MX 5C3EG 3OTOQ 1VZ7A 4HK2A 3NQIA 3VUXA 1S4ZA 4OHJA 3GTKB 4G7OC 2WHIA 3DPDA 3HK0A 5JHAA 3L08A 3TJPA 4HR7B 3VR3A 2IHEA 3CRKC 1ZUD2 4HAEA 2WWZA 4TKOB 4ULLA 4K7UA 1S3OA 1XT9B 3DWAA 4ZKBB 3I9V1 4PZ7A 2ONQA 3D4WA 2JSOA 2NVQH 3TREA 3ZO5B 1GC6A 3KF6B 5M5YH 2CCZA 1PDXA 3J81c 4A3JH 1ENAA 3I4MB 2R92B 4LF9L 2KLGA 5C3XA 2C35B 3Q6BA 4OZAA 4YCWA 3DBLI 4C3JB 3UDXA 3Q14C 2FXQA 4PYUA 1AEXA 2WXNA 2KCTA 1IGCA 1Q82C 3CIRB 5E6OA 1TQOA 1EQQA 4IOAA 2CR5A 3OMCA 3HOVG 3ONAB 5IYCG 4ZRJA 3J7ZC 4GNXC 2MBHA 2C9OA 3K5NA 1YN3A 2N4FA 2XN9C 3HOZH 2TMPA 2B2TA 4NB3A 2YU9H 3L4PA 3CPWA 3B1LX 2PYKA 4KHZA 1XMQQ 3PIOA 2NN6I 4LCDE 1D8LA 3J7AV 2EY6A 3MHSD 4JC0A 2GOWA 4JLCA 1VQ6A 1LQBA 1PUTA 4JI8L 2GA4B 5T8IA 4L5RC 2KMAA 3HRZC 4QIWE 4GKKQ 3K7AH 3M3YH 2NBWB 3ZTDA 1V43A 4EFOA 2VB3X 2JWUA 3JVZX 4YWKA 1WY8A 1OXUA 1K3RA 5FLXL 1UWMA 1ZXTA 4B9XA 4FXGC 2WXLA 3HIZA 1EWYC 3PLUA 3PLVA 3QWZB 4YTPB 3NE5B 1YJWA 2DY7A 3MXNB 3PUWA 1GB1A 2BWES 2FMMA 2E8GA 4IKGA 2ZXOA 1TWCH 1X3GA 1TBEA 2BT6A 2WDVB 1FD6A 3AFQA 2KVZA 2LUMA 5EKIA 1WI0A 1MSHA 4EZJA 4N6EB 5HGQA 3CU7A 2WB1B 3TBLD 4LNQA 1QJOA 1IBML 4GNXA 5I9OA 3HG9A 1DYQA 4JI3L 3Q69A 1N9WA 5IAAC 1J0GA 2W82A 4E71A 1IYFA 3RN2A 2E75C 1FM0D 1TR5A 3V61A 2KQSA 2VUMB 1RTOA 2F0WA 4JI7L 5JZEB 1I5FA 4LFAQ 1E10A 3HOUH 1JE4A 2KA7A 4DR4L 2WNMA 2A74C 2KBNA 1ILQA 3ZJUA 2OF1A 3H6MA 4A75A 2I0QA 1FR3A 2K04A 2K7VA 4DR3L 4E3CA 4FF4A 4R4TA 3D31A 5FO9B 4UDUC 4C3JH 2QA4A 2DX5B 1ZW7A 3JAMc 1PFSA 2EOTA 2KDEB 5L95C 4CDCC 2Y0SB 3U9OA 5J3BA 1J7CA 2NS5A 2WACA 4LLGM 2AWOA 2WDTB 4JI4L 3RLOA 4FULA 1X3QA 4GN4B 4R4OA 1PFNA 4KY6A 2CJOA 3P75A 4TVAB 3H3VI 1EL0A 4ZRQA 2PQEA 5IIFA 4FDBA 4DUZQ 2KKCA 4ZK9B 2X38A 4BBNF 4H0LC 1YJJA 1DOIA 3KLWA 3IVFA 4F88A 2BCOA 4GLSC 5JJLA 3VA5A 1G6PA 2WXRA 2L9HA 4BOSC 1VQ8A 1QOFA 3ZJTA 1TYGB 3VYRA 3ZVVA 1B70B 3C19A 1FIQA 2K4KA 3OYYA 3A5UA 4FF2A 1C4QA 3K5LA 2KVMA 3X0WA 3PSIA 2H88B 2ZJQA 3C46A 1I94L 1AFPA 2MLBA 2C9WB 5LXHA 3PREA 1ASYA 2A6EC 4JI6L 4BY1B 5DPRA 2F3WA 1SYBA 5JJKA 2PW9A 1EY6A 2BE5C 5NUCA 3EGRA 1IYUA 5C4JB 2UUCQ 5BN5A 1IBKL 4G7HC 1Q8IA 2KMCA 2KYWA 5BYSA 3BWUD 2L55A 1L1OB 2PI2E 2NZ1D 3LGJA 3KF6A 4MNOA 2N49A 4ZUJA 3RZDH 4M1UB 1EO6A 3FPUB 4ZRIA 4P16A 4P74A 1H9RA 2JPHA 3AEAB 4I6PA 3I70A 3EC8A 3U2SC 3I4MG 1QZGA 2R92G 1Q12A 4R4QA 4DNTB 1KC8C 5CHWA 3S2HH 3NHEB 4G7ZC 4WJQA 4C3JG 1JC7A 2D5DA 2J0KA 1Y1VH 2QJLA 1S5CD 4DV1L 5E1FA 3N1XC 4DXGA 1EEID 1RAXA 1SNDA 1HNWQ 5D3IB 4YCVA 2K5QA 4MSQB 1NBFC 4GKJL 2IY1B 4ZRPA 1C4CA 3CF5A 4HIKA 3PRMB 3NVWA 2KUMA 2HDEA 3T1YQ 3PHWB 1S5BD 1SNCA 3IT6B 5CHVC 4DFAA 5IN7A 2N1WA 4RCNA 2UXDQ 4DHZE 2I38A 3I57A 4PQXA 2EXDA 2ATWA 1VCBA 2DNCA 5ELBA 2VZKD 3HOWB 2BGFA 3Q22A 4DV2Q 2C5CA 2LJ5A 2O6VB 3P42A 1D5MC 1L4DB 4Q2JA 2KEEA 1L7YA 1HR0Q 3MXNA 4IM2A 4PK1A 1BCPB 4BKSD 1BUIC 4OGQC 4P7IA 1LABA 3G71A 5CMDA 1P9DU 2H5XA 1EWHA 1KIXA 4W9GA 3KUDB 3L13A 3TCAA 5L37A 4TQ0A 1I4GA 2KCNA 3VRAB 3AECB 3BS1A 2K39A 5KGUA 5C6AA 3IXSA 2F52A 1PLFA 2C7MB 2Q2IA 3WALA 1JWUD 4DK1A 1JOQA 5IGCA 1MVKA 2WB1G 1D6EC 4NXNQ 4DR6L 1E0BA 4D2KA 4E74A 5J39A 3WDNA 4HCEA 4F1SA 1E7ZA 3CMAA 2KWUB 3QC8B 2LWPA 2IT1A 3GOEA 2KLCA 2KFKB 2EY1A 2VUMG 2KWDA 4QJFA 4Y7NB 1OXVA 4BKSA 1A70A 5BMIA 2ID0A 3N6RA 2LJIA 1K51A 3KF8B 4X65L 2K6DB 3OSOA 4P75A 2CW0C 5G3LF 4X66L 1ICFB 2M9VA 5EPLA 4JCVE 4YCUA 4IPDA 2F4VQ 1JOKA 3N52A 5C44B 1LT5D 4XT3B 3PF4A 4XT1B 1WFYA 2CHZA 1N36Q 4EOYA 4U68A 2REXA 1L1OC 5CV9A 4AYBE 2Y0SG 1CHPD 4ZCKA 2HE7A 3A4RA 2NVTB 5DM73 2N9KA 2KN4A 4HRSA 3STBC 4GGQA 1Q10A 5AJ3L 4K2KA 3IG3A 1HZBA 3DBHI 4GLVB 2QCZA 2V0GA 2HIVA 2ZCCA 3SD5A 4P1BC 1VS0A 1YNND 3EQLC 4DV3Q 4A3FB 3UDFA 5C1ZA 2HD3A 2BYVE 1I4QA 1PH4A 4XE0A 2D0PA 5FJ8G 1PH6A 5A2QL 1JWMD 2PW7A 3FKIB 3ULLA 4C2MB 1JRPA 2EMSA 3E56A 1NSNS 1RFKA 1PZJD 3NTIA 1YN5A 3FILB 4DK6C 1PYWD 4MHEA 2G45B 3DBRI 5EE0A 1V9PA 3CSTA 1SNOA 2UU7A 4QY7A 3S1QH 2ICIA 1HFGA 4A3DH 1HNZL 1TKEA 2R6GA 2IBIB 1TKYA 3QWNA 1B50A 2GBRA 4HMIA 4A3MB 1U4PA 1TVXA 1B9MA 1LXDA 1BBUA 5CC4A 2GMIC 5ELFA 1SE3A 1PA6A 4BY1G 2K1FA 2EYFA 4X3SA 1G51A 1E2VA 3S15H 3QB3A 3J80E 3GTQH 1N5WA 3HP3A 1K8OA 2I5HA 3PCOB 4IUVA 2L15A 4YIJA 2JWZA 3M4OB 4REZA 1GUGA 1X65A 2EY2A 2NN6G 4KMUC 2DYMA 1D3ZA 1BCPC 3CCQA 4ASWC 2IZVB 1SNMA 5KNDA 3H3VH 1MI2A 1FNUA 1EQTA 3VR2A 5BMHA 2KNBA 1MHWC 1NBWA 1QZHA 2WYQA 3RD2A 5KHQA 4DR7Q 3Q8AA 4A3BH 1WGHA 2ZVNA 3SR6A 4DUYQ 3KQ4A 3DWGC 4ZUIA 4A3KB 4HROA 3SVMA 3VR8B 3DBSA 5I9PA 1MFWA 4CBVA 4LDTB 3WAMA 2KFJA 3TEZA 3IFWB 1G8ZD 4F7ZA 4QUFA 4XGAB 1WH3A 3QCAA 5D3DA 3WAPA 4GMVA 4QGUA 3K57A 4WJ3M 2OJRA 2ZNVC 3H3VC 1LT4D 4XYOA 3IAYA 4M8AA 1BCPF 4K6LA 3S2DH 2LGDA 2VQEQ 2I1KA 2JRHA 4W9DA 2DZKA 3J81L 4MELA 1PTOH 3RT3B 4KI0A 2H89B 2F4IA 2LRWA 3RMHA 1W6JA 1V8QA 4NAWA 2MP1A 3MC9A 4UP7A 4PS7A 2QILA 2FE8A 2F3IA 3C1EA 1GUWA 1W3SA 3SK8A 1VQBA 1E3PA 3HOWG 4LF8L 1I3QB 3KJPA 1K8MA 3DLLA 3NELA 4JG2A 3MFGA 2ON8A 3ZKJC 2W54A 3CCLA 2KX3A 4GSWA 3PZ8A 4J3OD 4R3DA 2L11A 3ALBA 2FCSA 1DOMA 4PV1C 1EY8A 5EDSA 1UE6A 2IO1B 1UE1A 5C4XH 3NUHB 5FLMG 1B7YB 4MDKE 4W9JA 2A69D 3OOCA 3CCRA 4NY0A 1XXGA 4GLAC 2B2YA 4KY5A 1XF5L 4W9EA 2K52A 1JB3A 1CK1A 3KWLA 2NVYB 1YN4A 3NJTA 4LNFA 1E90A 2A4ZA 5LMNQ 1I42A 1N62A 3AYHB 3GTMH 3HOYB 3DBHB 1PTOF 4K0KL 1R9TB 2R93H 5M5WB 1Y14B 1K83H 2ZTCA 2M2LA 4O0AA 4OIKA 3NS8A 1EFID 4IFDH 3H6NA 2F0HA 3KF8A 5D7GA 4X62Q 1AZQA 5EAYA 1SYEA 2F0JA 2KN5A 2AMCB 1Q1BA 1OTRB 2D62A 2PEAA 3VUYA 4GDKA 2F0VA 4NDXA 3DBRB 5J17A 2CU1A 4A93B 1XLNA 1IXRA 4A9AA 1Q8KA 3S16H 2ALYB 3K81C 4J6HA 3HVZA 4P73A 1D4BA 5C44G 3PO2B 4DV5Q 3DXJC 2ZTEA 5LL6S 2NMQA 4EQOA 5A35A 3P2BA 1VMPA 3PSEB 4OXPA 1PHJA 1B2TA 1PGBA 2Z6BA 4CHTB 2HDMA 3W1BA 1L0VB 2BF8B 1I35A 5CTRC 3JAML 4A3FG 2HCIA 1FCLA 4JOIC 1V1OA 3FILA 1J5EQ 5BN4A 3FKIG 4CJ0B 3A1QB 2PMZB 3TS0A 1J8CA 1IBMQ 1PGAA 4DHJB 3NRZA 3NENA 4MTKA 1PYSB 1XEEA 1M4VA 3A0JA 1HA5A 3H0GB 1PV4A 5HG2A 1WGDA 1BNZA 2WXJA 4A3MG 4G3XB 2CHBD 1MJDA 2PZTA 4B3ML 1X1MA 2WP9B 2WU2B 4UPAA 1BT0A 3L7ZC 5C3JB 2RSNA 1GUOA 4IJHA 3VA7A 2K05A 1JALA 3N32A 1XLPA 4HEDA 2E6XA 4ACFA 1DOYA 5HFYA 5JAVA 4MZ9A 4WJWA 3QOLA 3DEPA 1A2UA 3RLFA 5IWAQ 2AWTA 4QAYA 2PNRC 2LKVA 1Y8NB 3FHWA 2IX1A 1ZGUB 1XQQA 2K5PA 1FRRA 2Z0DB 1UBQA 4TQ1A 2A8VA 2FCQA 4JQWC 4IG7B 2AKWB 4A3KG 4IUQA 4BBSB 2RDBC 4O2DA 5AZGA 4JOIA 5IY0A 5ELCA 1PH5A 1K53A 5M9OA 2B8GA 2WXMA 2LVQA 4RGNA 4WFN3 4JPBW 3O13A 3V6EB 4X3KA 3A7AB 4BS9A 1LUZA 1ONLA 4NP5A 3NQTA 3C3LA 3C1FA 1CJEA 2DNFA 1VR9A 3H7PA 3TUOA 2N9XA 4KZCA 4NXML 2CWPA 3FPPA 3T1HL 2AX5A 1PRTB 2JA7H 2DZMA 4LFBL 4G57A 2VS1A 3TP6A 1WM3A 5DCNA 4ARIA 1LTLA 1WCMH 2MJDA 2YTXA 4LK1C 4DV4Q 4DV7Q 2F3VA 5C0XJ 4EKUA 4HVBA 3RNFC 1SN8A 1TU2B 1WSPA 1ESRA 1EIFA 5KYIA 1SYDA 2FJ2A 3OLMD 2UXCQ 1VQOA 1QUQA 2JYTA 2KQ7A 1IBKQ 1PYBA 3QJZA 3TQYA 2KTRA 1VRAB 3RR5A 3KOJA 1G6JA 1WR6E 1UEAB 4I7AA 3ZYYX 4ZKCB 2R7ZB 1L4ZB 4R8NA 5IGBA 3GB1A 3VFKA 4TMAB 1KLVA 1GUNA 4GIVA 5C5LA 2VH2A 1KDBA 2ICEC 3MTNB 5ELNA 1G91A 4L5QA 2F0MA 1U4AA 4IDIA 4KD3A 1WTRA 2JZZA 1RTNA 4HJ5A 1UZXB 1IYJB 1SXTA 1HRJA 1JMCA 1J6QA 4OL7A 1L2FA 3ZXRA 3DM3A 4LTUA 2RPQA 2M1MA 1TIFA 4FADA 2B8FA 4L63B 1TY2A 5K36H 4HKQA 3UDGA 3HOYG 1WXMA 1QE6A 3EFCA 4XIGS 1KD1C 4M01A 4X64L 4A3IH 2KQ4X 4KHPL 5F2DA 2WLBA 1M1KC 2L8JA 1X9NA 3M95A 2I07B 1C8CA 1WTQA 2HQEA 2KC2A 4K3BA 4BFRA 2BVCA 3MP9A 5JVG3 1BF4A 2H1EA 5LMUL 1MG8A 3NP8A 4A93G 2ZPNA 1SAPA 2GBMA 2EJMA 3CMEA 2BB5A 2XK5A 2WAQB 3S1NH 3PO2G 3ZUNA 3A9JB 2MFIA 2JZPA 5FOBB 1RKNA 4LAAA 2NUCA 4PG3A 1WGYA 5C3WA 3I2ZA 3F8TA 1V97A 4DV0L 2AQ3B 5HHDG 1HZ5A 1EF5A 1E8YA 1FXAA 2ZXPA 5IOIA 4HSPA 2I1JA 4DDID 3NEMA 1LTRD 1KL9A 1TS2A 1EUVB 3HRDD 3A8KE 1QG7A 1UGJA 2YVCA 5JJZA 4GLXA 3S17H 2WB1E 2RDGA 4KGRA 2PJHA 4KV6A 1HNXL 2BYTA 3FKYA 1NI3A 4K8IA 4DGZA 1XNRL 2WIIB 4DR6Q 2MEKA 1T9HA 1RLFA 2RSOA 2QF7A 4W9FA 2NVQB 3TBIB 2FUG1 3TP8A 1PRTC 1G291 3IFTA 1QNKA 4A3JB 5M5YB 1KF6B 1YOVB 4YSZB 3H0GG 1X3PA 5E6JA 2DZJA 1JCKB 4JE3B 3GD7A 1HH2P 2A6HD 4OVVA 4AS1A 2NPTB 4X3TA 4EGVA 4DUZL 1JOOA 1SYFA 2G9DA 5T1IA 3P7JA 4C3IH 1VQGA 3HM3A 2F0FA 3D6WA 1V1QA 1I6HH 1FNVA 2AQ2B 1Z9FA 2RHQB 2JA9A 3UDIA 1UWVA 3OWFA 2Y0SE 2JF5A 5GADC 1WVLA 1MHHE 5IT9c 2G1EA 2WX0A 3AEDB 2SOBA 3Q3JA 3HOZB 1GUAB 4LK0M 5DEHA 2KWCA 1R4QB 1EUJA 4KKSA 4R1JA 3SK4A 1KH0A 1LO5D 1PDQA 3GTLH 1QVGA 2KMMA 1IYVA 5M3MH 1N8RC 2RQXA 3IKJA 3SU8X 4NKLA 1K3BC 2BW2A 4M00A 5CV5A 2IWHA 2YTYA 2NVXH 3GTPH 1CKNB 1PMRA 4BBSG 3M3YB 4FP5D 2J0MA 4N58A 3W5UB 1WE6A 3A9KB 2GI9A 1ROEA 2QEXA 2YV5A 4CDFC 1A63A 4JX1C 3B6YA 4LF5Q 2OEOA 1H9JA 3R8BA 1W6KA 1N33L 1XCTL 4GN5A 4HDQA 5D94A 2L5TA 3PQIA 2KCMA 1FD7D 4JI1Q 4YSXB 3NOBA 1TWCB 2UU9Q 1I4RA 1JWSD 3G6JB 4AUQC 2NR2A 2D3CA 2K5WA 1YNXA 3GV3A 5IGEA 2LUEA 3I4NH 2ZW0A 5C5MA 1F2YA 1KABA 4CKBA 4ARCA 4YHHQ 1QLBB 1STGA 3OPOA 3J80c 1FJGQ 2GVAA 3CCMA 4DNIA 1SE4A 3DVGX 4AP4C 4K5XA 1RRBA 5IP7G 4DR5Q 4KKJA 4LF4Q 2R7ZG 2NTSA 1WTWA 3HOUB 3Q2AC 1Z6HA 4GXBA 1FMAD 3J81j 3NTKA 1VJKA 2JX5A 1GJZA 1OTCA 1WZ3A 4J15A 2N3SA 5TSSA 2KJ6A 4RGMA 5C23A 2MQJA 1Z7TA 5ELOA 4HCPB 4WWOA 3EHVA 2WX1A 3PGZA 3T3OA 4QQBX 1L0XB 2B2VC 3RD4A 1DXMA 2BWFA 3OW2A 3PTFC 3HUIA 4LUVA 2JJQA 4FF3A 1U9RA 1Z47A 4O1NA 4WIPA 3E5SA 2NZOA 3LWEA 4HIMA 1WX7A 1CT1D 3DOWA 2ZM6L 4BXXG 2IGGA 1XD3B 4PMBA 3EROA 2Q8IB 1VCIA 1STAA 3TP7A 4A3OA 2N55A 4ZYSA 1WTVA 3P4QB 5FO7B 4CKCA 1AZPA 5T1GA 5KNBA 4FNFA 1STBA 2MPMA 1BMLC 4MJSB 3UF8A 3LWUA 1Q46A 4WJOA 4V0BA 3Q23A 3G6EA 2QHOA 2WAQG 3J9CA 3S1RH 2JUOA 5JXVA 5EE1A 4G50A 1STEA 3RUZA 5FLXE 4JGHB 1T0SC 1EY4A 2HTME 1UAPA 3VUWA 1HZ9A 1PZKD 2F0UA 1YI2A 3J7A5 1R4NB 2XNAC 3R3OA 5JEAH 4HJKA 5TR5A 1RJTA 1KLGD 4LW1A 3RZOH 3AEFB 4YT0B 4BOZB 2CVRA 2N78A 1EFWA 1OGWA 2C5LC 4HWIB 2B2VA 4PMWA 3HOXH 1K0SA 3R2TA 1EWCA 3RUIB 1CZPA 2JU6X 1KNEA 2B63H 2KHWB 4WJ4A 4J1MA 1K73C 1DOLA 3VR6A 4KX6B 1M94A 5FK9C 3RZDB 2WXHA 1SYGA 5HKHA 3CC2A 2V3SA 1QVCA 3D6CA 2EZVA 3W1SC 1QQRA 2KC1A 1D5XC 2NBFA 5AZFA 4A3JG 2VQFQ 4JI0L 1WWTA 3S2HB 3PUVA 4NNJB 2AYOB 1ML0D 1Y1VB 4BBNC 3B0AA 4OZCA 4DXFA 3PUZA 4MIUA 2MX2A 3V05A 2PPBC 2EMTA 2LEKA 2UUAL 1A15A 3DUZA 1SIFA 2MCNB 4M8NA 1HFNA 2Q2HA 3LJ3A 5ISRA 5IP9H 3QIJA 1E24A 1WRIA 2JA6H 2K8BA 2BS2B 2ES2A 2FHTA 2K5NA 3HOZG 2WXQA 3NTHA 4ID6A 3P1HA 1J9OA 1GJXA 3Q8DA 1IW7C 2D0OA 4L2YA 5C4ZA 2HHHQ 1CUKA 2M4NA 3Q6SA 4P2CB 3BINA 1B4OA 4XDXA 4ABNA 2VB2X 2YYZA 1AE2A 3BDLA 4DR1L 3A9KA 1E0ZA 5CGKA 3K7UC 3SFEB 3JW0X 2IY0B 3TZDA 2FFKB 5AUKA 2INCC 5G5HA 1GHJA 2E2JB 1NAPA 4LF6L 4I6LB 1OO9B 2RMMA 3R3MA 5EQ0A 2IY5B 4UAIA 3DBLB 3NK9A 1IKLA 1CTMA 1YEZA 3U50C 3HKZB 2MJ3A 3U9SA 3S24A 1V86A 4KN7C 3VR5A 4AQYL 3I8ZA 1B3AA 3BVZA 3K59A 5DM63 1HTOA 3DHGC 1XLQA 1XMOL 1SROA 1F9RA 5GAHC 2VW9A 4HJAA 2JA5H 2GB1A 4DXAB 4Q0FA 4AQ7A 4F8MA 2INNE 1GNUA 4FLHA 4E6IA 3RFZB 3M4YA 2FUHB 2DUDA 3J7AF 2N7DA 1CHQD 2PQAB 4NPSA 2KK8A 3RZWC 1KDAA 2BDNA 1I4HA 2QW7A 3ZXVA 3CCUA 4KLKA 3HOUG 1E8ZA 1HZAA 1CQFA 4JYAQ 4GN3B 4KIKB 3DHHC 4YY3Q 4A3GH 4M8MA 5JEAJ 3APCA 4JI5L 2EPBA 3JSVB 4HEA1 3SEBA 4RKLA 5GAGC 1EY0A 4X3UA 4CKEA 1WJ6A 3IHPC 4CJ2C 5E6PA 4WJNA 2QIEB 4HXDA 1FO4A 1VQNA 1RM6C 4PS3A 4LMQD 1KAAA 4RF1A 2KJXA 1XPRA 1IHZA 2JT4B 3RYTA 3DQVA 4N8X1 4KGSA 4GOPB 4YWLA 2BKFA 2PW5A 3P1MA 4IWOA 1EQVA 1CSPA 1D1IA 4A3LH 4A8XC 1QKZA 4GB9A 2PO4A 1N61A 3V6CB 1EYDA 4R4CA 2NBVB 4EZKA 4B3RL 2E5LL 1M90C 2CKZB 1JT8A 4XX5A 4IFDI 5C0XI 4QL5A 1VQMA 2BTEA 4O42A 1LTGD 1TS4A 5EJWA 1Q1EA 3QR8A 5G2NA 3TEXA 2NTTA 3AEBB 2UXBQ 3H7SA 4US9A 2UUBL 2E2JH 1TTNA 3S1QB 4L6TB 1SGHA 4XWTA 4A3DB 1HTPA 2INPE 1N34L 2JK8A 1GO3E 2LHEA 2RBMA 2JA8H 2L32A 2OHFA 3VR9B 3AE3B 3PIPA 5G5GA 1EOVA 1CZWA 3DWMA 1ENFA 4WWPA 4LF7Q 3NZ3A 3WCQA 4BBRH 2DYOA 1EYCA 2Z8LA 3S15B 3BU2A 1UE5A 2KXJA 3GTQB 3LDZE 4MEMA 3QAQA 1GB4A 2BOSA 2A68D 2QC8A 4W9LA 5GROA 3TMEA 5FR6A 3P63A 4KK7A 4RH6A 4A55A 3AULA 4XDCA 1HZ6A 2F0SA 2GRIA 1VDZA 2ZNVB 3J7YW 1SE2A 4LFCQ 3SFDB 2ZJDA 4OO1H 4KD4A 3PVLA 2C7NB 2LFIA 4A3BB 5G3LD 4HPPA 3WA0A 1Q7YC 1BQQT 5H1SE 1PH7A 3AE9B 4RM9A 1P3QU 2FIDA 4CYEA 4EQ5A 1S3SG 3X23A 3NZUA 2MH7A 3BY4B 2E2HH 1ZEQX 2RHSB 1Y1VG 1G2SA 3VYUA 1NJIC 2HQLA 1WXQA 1X3EA 2UWQA 4IOIE 2LFNA 3D0FA 1WM2A 5I2XA 2W9NA 1TGZB 3S2DB 1ZDXA 4ZQ3A 2Y5CA 4XQJA 4L8JA 3A33B 5D2MB 1PTOB 1SMXA 2W3RA 2GLSA 1KRTA 2K32A 1P7EA 2B3AA 4C80A 4LNKA 2J4XA 4BKTA 3Q3OC 2HCCA 4DV0Q 3KLSX 3OJ3A 5BMGA 2ACZB 3A8IE 2ASQA 3KBXA 2K75A 1XPOA 1EF1A 1BKBA 3Q8EA 4A6QA 1BBXC 2WP8J 4WRDA 2B2WC 3PMFA 5IT9L 2A5HA 5A2QE 4HSVA 4LJZC 3B2FA 4MM3A 1LTBD 1HNXQ 3S14H 2ASBA 1EOTA 3L2PA 2WXKA 5CHFA 1SMYC 2EE1A 5M5XH 4GOPC 4JBKA 1XNRQ 1CKMA 1II3A 1GVPA 4DAYB 2Q2UA 3GTGH 4KSLC 2C60A 4RGTA 1XTDA 2AUKA 5C4XB 2J42A 3E9SA 2WS3B 4EEWA 3HKZG 2PIAA 2RKSA 4WURA 1WTHA 1KFYB 4YXDB 2X69A 3TL5A 5BR8L 4K2LA 4K3CA 4N8FA 2I46A 4B3TL 2K1BA 4YWGG 4DV6Q 1E7VA 3VTVA 1I4XA 1L1OA 3GTMB 2L1AA 3KWVA 4B3SL 2R93B 1Y1WH 3NPPA 4K8JA 1XNQL 1K83B 5MPOA 3UE0A 4UHVA 2ZCBA 1ZOYB 4FJZA 3PGEA 4L1BA 3Q3MC 3TSSA 1ISNA 1LM8B 1UF0A 3K8AA 1NYRA 1KNAA 3PO3H 3K9PB 1SNPA 3SDLC 3S1MB 2Q8RE 3JSVA 2L3ZA 1SE8A 2MP2B 2O6VD 5AEKB 3AE8B 3OTOL 2Z4IA 3S16B 2EQSA 3AN1A 5KIXA 2CFMA 3J80L 4WJPA 1F9JA 4AOFA 4OX9Q 1FPYA 1CKOA 1M8AA 4LUOA 1KAWA 3SDZA 1C0AA 2LGYA 5DPTA 4N9PA 1SSOA 1GM5A 2QSDA 1HR0W 2B2UC 3BVGA 2PKOA 2F0KA 2KD0A 3CQZH 1NEKB 3MFYA 1K50A 4MH8A 3L0WB 4KGTA 1VF7A 2H4OA 2Z4HA 1VQFA 4W9IA 4A4IA 2LVPA 5EBDA 3CC7A 2J53A 3HVDA 1GUSA 5IYDH 2GBNA 2O6VA 3AMUA 3U4ZA 5KRUA 4RA8A 3KFUA 1NMFA 3L16A 4L5TA 4PMCA 3CP0A 1C4AA 1MJEA 3PV0A 2HUGA 4V190 3PF5A 3NZSA 1PTOC 5GAEC 3KDFB 4A3DG 3AI5A 4KTAA 4MGYE 4GN1A 5COYA 1Y8RC 3DCGA 1XMQL 3PRZA 2QEJC 3B08A 1V81A 1KTKA 4LF9Q 3DHIC 1HUMA 4DR2L 3R7QA 1QB5D 1Q81C 2NCNA 1WXAA 2MUYA 1SNQA 2W55A 3GTJH 4DHZB 1C3TA 1XTCD 3ICEA 2OEDA 1A6XA 3QO2A 3HHMA 1D5ZC 3IRBA 2K8HA 1VQAA 2KAJA 2BDOA 1VDVA 3H1UA 2M17A 4EUTA 2FAZA 5D6JB 2B2UA 3AU7A 2XWBB 4ALPA 1VQ4A 3K58A 2KFKA 3BK1A 1BOSA 4YL8A 5LXIB 2EKEC 3I4OA 2ZM6Q 1EQRA 1K8GA 3Q0AA 2BPSA 2R2OA 2CH4W 5C0XH 1KRSA 4A3BG 1J7BA 1OEYA 2OJWA 3Q24A 4PNYA 4IM3A 2OXPA 5DLQE 2RGFA 4XC2A 2KO3A 2HD5B 4IPGA 3S1MH 1TIID 3FC4A 4TUUA 5CORA 3DEOA 4IQZA 1R4MI 2R3ZA 4JI8Q 2HIXA 4K5VA 4JPSA 5IA7A 3VDZA 4C7YA 3NVYA 3CAMA 2DWQA 1KHIA 4IUMB 2O5IC 1JICA 4YSYB 3CF6E 5IKCM 4RCOA 5JH5C 2JA7B 3F2CA 4C4VB 1WCMB 3OMGA 2KQ3A 4A3CH 2KDBA 4LFAL 3AQQA 1E8XA 4HJGE 4NPNA 3KVFB 4QMGA 3TRZA 4DK3C 1Y69U 1QWYA 1QOAA 1P1AA 1CM9A 1RCVD 1Q3LA 2ZJPA 1V1PB 4DQOC 3IT4B 1O7IA 1LV9A 1H9MA 1T5XD 3OIQA 1CMXB 2SDFA 4IC7B 5M3FB 3QK0A 3AB9A 3KBGA 1VZ6A 5E6NA 1T0QC 1DJRD 3ITPA 2KCCA 3EJIA 4AYBB 3EN2A 4JI3Q 3CMMB 3Q8BA 1NVID 4B0EA 4LDTD 5EPJA 2MBOA 4K14A 1IPGA 1E9MA 5C4XG 2RR9A 2K01A 4JI7Q 1TZ1A 3W1YA 1I6VC 4DR4Q 4JI0Q 1N6ZA 1I4PA 1TWHH 4DAVA 3QA8A 1KLUD 2F0DA 3V60A 5HY6A
chains in the Genus database with same CATH topology
4DNRB 4ZOHC 4K5WA 4PT5A 1XWEA 1NUCA 2F0EA 4US8A 4A3IB 1ZYRC 4U673 1Q90A 4K6DA 1A3VA 1F9SA 1H9KA 2D9UA 4IFDG 1RD9D 2LHDA 3PO0A 3P4SB 3FAHA 2E3TA 2FMCA 1EYAA 2F0GA 1VZ8A 4ZAIA 2MGSA 3FVQA 3WOFA 3S1NB 4RHSA 2OT2A 2NWGA 5CV6A 1QT9A 1TJEA 3T56B 4RHRA 4XQNA 2EJFC 2WDRB 2L12A 3EVQA 3PUYA 1C79A 3K5OA 3GP7A 2WKDA 2EYMA 3EA6A 4GZYC 3LB8C 4C3HB 3S17B 5LNK1 2XSCA 1VF5C 1R7SA 1EY5A 3BZDB 1DOXA 5D65A 3GO5A 1Y56A 5KNCA 1STHA 5ELDA 2QDBA 1D1KA 3T13A 4H2AA 5LHY1 2B76B 5C2TB 4BA1I 4C3IB 2JP1A 1I6HB 4YTNB 3NSWA 3VRBB 3L3OC 2Y3AA 3W9CB 1SBBB 2L52A 3LYYA 1FCCC 3OIPA 3GTLB 4USAA 3P4RB 3MHBA 5M3MB 1BR9A 3KLRA 1L6UA 3GTPB 2NVXB 4MT5A 2EYPA 2M56B 1ZDVA 3PZ7A 2FBWB 1F2RI 2MJ8A 4IURA 2Y5PA 1C77A 3TN2A 4WWMA 3HZXA 3I4NB 1MBYA 1T3QA 2Z1CA 3GTOB 3DWPA 2N0SB 3V2TA 2WDQB 4GDLB 2IL8A 1TZOA 2RVLA 2PZUA 4C1NK 2K3UA 2Q8TA 3A54A 4XWWA 2LMCB 1OFFA 2YEPB 1STNA 1TKWB 3U52E 4XYQA 1HQMC 5CR3A 1I7HA 2K9XA 1LT6D 4H7BA 5LL6X 4ZRZA 3C8YA 1B53A 4B9WA 4IUNA 2HDLA 3KLSA 4QB4A 1HA6A 1JWBD 1PRTD 4DN4M 2A6HC 5K36G 5CV4A 2F0QA 1TS5A 2JYOA 3LX0A 3HGBA 2ZXRA 4G4KA 1FEHA 1FNWA 1YNJC 1JMLA 3A7LA 1DZ1A 1O7YA 3QG1A 1C9FA 3Q8CA 1E7PB 1JROA 1DD2A 2W3SA 2IPKD 1S5FD 3S1RB 1XLOA 3T53B 3OWEB 3AMZA 5FR3A 3VR4A 2XVSA 2PTLA 2L1BA 3FMCA 3RZOB 4Z9CB 5J1ZA 4KKIA 3HOXB 4ZLTF 3IFDA 3S9WA 1EZ8A 4C3HG 3T51B 2B63B 1JQ4A 3BIID 4CGYB 3QOJA 3BK2A 4WORA 4BWGB 4TSSA 3V96A 4F7XA 5EGTA 1FFVA 4FXCA 1YJIA 2RA4A 3EUB2 3BG3A 1C48A 2B2TC 5EE9A 2NYZD 4I7ZC 3MAQA 2E2DC 4C3IG 2XRQD 3KK7A 3QJYA 2K0PA 1Y8PB 3F2UA 5KEEA 2DNEA 5J22A 2JA6B 2EDGA 4HMJA 2D5GA 1B9NA 3QIAA 4FXDA 2SNMA 5DNFA 3GS2A 4ILWA 3ZJVA 2KACA 1O78A 1DGJA 3I4LA 2M00A 4C56C 3AE5B 3H94A 2V3NA 4OO1I 2SEBD 2MJEA 3GQBA 3PIO3 1EY7A 3OW7A 4QF4A 1PXUA 1LT3D 1J7AA 1EM7A 3URYA 1ACCA 2IDYA 2YEPF 1CQVA 2WXPA 3CHBD 1JORA 1EY9A 2WQYB 1YNTE 2DLBA 1U4MA 2N9LA 1F2MA 2PLPA 3VQIA 1NENB 2K03A 2JA5B 4A90A 3MEHA 2L0CA 1IKMA 2LMCA 2PCFB 4B0MA 1EU3A 5AUIA 1VLBA 3BDOA 3DHQA 3HS0C 5CBAE 1U4LA 1ZPSA 3B9JA 4A3GB 4IZ8A 2JQRB 3D4RA 3BYTB 5BYRA 2D2CC 5HI1A 2QMTA 1FRDA 1TY0A 1L5PA 1S5ED 1UUPA 1EEFD 1HPCA 2V3PA 2VZKB 3NS1A 3MXGA 3AE7B 1F2RC 4EE2A 1LTSD 1LTID 1WGKA 1NR4A 1RHPA 1UWXA 1IW7D 5HURA 3I73A 1TKGA 1MSGA 3W1SA 2JA8B 2EXZA 2F03A 5JEAG 2E74C 3ND8A 3A56A 2LS01 4BBRB 2MHVA 2K33A 3AEEB 4TRDA 3D3RA 1CA6A 4EQPA 3ZQ4A 2A73B 2J7ZA 2JEAI 1HEZE 1A3UA 3W5VB 2JXMB 4HN7A 1QOBA 1Y8OB 3FEWX 4NW2A 3NBIA 4OZBA 4RGOS 2DN8A 2K28A 2A6ED 1F77A 3K6OA 3SE0A 3M85A 3TEYA 1AP0A 3CWIA 5CBEE 2RDFA 2AUJD 4YTMB 3CRLC 2BE5D 4DA2A 2J52A 1ET6A 3W3AA 2E2HB 4KN4C 3ERQA 3PUXA 3I3CA 3SXHA 4JK1C 1TT2A 2X6GA 1J8IA 2B39A 1WD1A 2E76C 3GV6A 3N9YC 2K5DA 1CFMA 2WINB 1F9PA 3BYYB 3M7NA 3ZGZA 3SHLA 3AE4B 5IODA 3S14B 2L4NA 5E3FA 5M5XB 3GTGB 1SDFA 1LTAD 1WYGA 3MWYW 5JVH3 3IAS1 1HHVA 3MJ5A 3NWTA 1TWFB 1TS3A 1QILA 1BDOA 2KOLA 3RPFC 2EJGC 4F87A 1AW7A 1H9SB 4OIJA 4NAWB 3PIP3 2CJNA 2BA1A 4QIWB 1Y1WB 1ILPA 5EKLA 2QCPX 1PGXA 4MM3B 4N9TA 3W2DA 2CQAA 1DOKA 2A68C 3FRPB 3AH7A 3PO3B 4RF0A 2Q5WD 1BO0A 1RWSA 3ABVB 2O5JC 1E2ZA 1ZXIA 1IGDA 4CQNA 2I2YA 1D2BA 2JXTA 1RDPD 4HKZE 4RWSC 1VMCA 1DONA 4DU9A 2NN6H 3CQZB 4JWUC 3ETRA 3SK5A 2CW0D 1SJED 4H13C 4WAFA 3UI2A 2V4IB 1XYIA 5FKAC 4I65A 3R2IA 3V3XA 4J8QA 3E6ZX 2WV6D 2BBCA 2LY7A 5CV8A 4GDKB 4B08A 2EYJA 5IT9E 3A55A 4R8IA 1HTLD 1YNNC 5JPMC 2V4DA 4RNAA 1JW9D 4C1NI 4EQNA 5C4HA 3BVMA 2O4XA 1FFUA 3T3NA 3NXWA 4KKUA 1N60A 3GTJB 3H8HA 4KHVA 3A8JE 4NMZA 2DY8A 1SMYD 1SEBD 4DAPA 4XTCS 4R9WA 3LXFA 2WU5B 4RFBA 3MXPA 1O80A 1V8CA 4P6VF 4OO1G 1U4RA 3DMUA 5FO8B 5IGGA 5E4XA 4OW0A 4FF1A 2JSVX 3AE6B 1LTTD 3E0JA 3U4EG 5AFWA 2B2WA 1GHKA 1BCPD 2M19A 3R93A 5ELEA 1C78A 2K22A 3TP5A 4KY7A 1RYJA 2F0NA 2EYHA 2SNSA 1P7FA 1QOHA 3J81E 1ICWA 1MD2D 5BN3A 1IL8A 5IOCA 1QOGA 1OXXK 4HTHA 4BA2I 3K5MA 1MGSA 1IUEA 1WTOA 1SYCA 2G9HD 1ZKOA 1PFMA 2B2YC 1ET9A 4FYDA 1AYFA 1WTPA 1MI0A 1GOZA 2BA0A 2F0LA 3M7GA 1FGBD 3MHZA 3NVVA 1TWHB 4FXKC 1H9SA 1MHXA 1C4PA 1HQRD 2IX0A 2IJ0A 4H44C 5EKKA 1EU4A 5DAUA 2FINB 4ZHOA 1PTOD 5JPNC 2A69C 1OXTA 1HCZA 2F1MA 1UNSA 2VNUD 1CI3M 5I4DA 4ITKA 1EIGA 1S5DD 1JR0D 2JEBI 2F0IA 5HGTA 4DK0A 1BUVT 2JE6I 1XO3A 4TQUS 2WKCA 4Q5VA 1JQYD 1F2LA 1MPEA 1IBXB 3H91A 2XIWA 2F0OA 2VXWA 1L6VA 1FYCA 1JWAD 2WXOA 2BS4B 2TSSA 5BYQA 1HUNA 1TWGB 1WTXA 3JAME 3KUPA 1XX8A 4A3EB 4WH4A 2EYOA 5CYUA 1B44D 4DAYA 1NCVA 1XCQL 4EVOA 1CA5A 1ESFA 3NVZA 1EZ6A 1YQ3B 3G7LA 4KKTA 1FXIA 3Q8FA 3AE2B 4CJ1B 2DBYA 1F0ZA 3NUCA 1A2TA 2ENBA 3C2PA 3NWSA 2KHSA 5I6YA 1F2ZA 3ND9A 4ODGA 4IUUA 1SSNA 4RAUC 5H8YE 2SAKA 1LLRD 2F0TA 5C0XG 1R4PB 3H09A 3MXUA 4HCSA 4ME5A 1N5XA 4XDDA 3P4PB 2JYEA 1ZXHA 3SR1A 1ZYRD 4DF7A 4QUCA 3AV8A 5JOBA 4S3SA 5CV7A 3AE1B 3TEWA 3MVVA 1QF6A 2CU3A 1LACA 1L0YB 2EELA 2BB6A 4IALA 2F0PA 3TZUA 2PVGC 1CZGA 3NBHA 3NHHA 3K0YA 3X3MA 3AB5A 3X3NA 1E2WA 1SIJA 3MA2B 3DWQA 3AEGB 4BY7B 1RF2D 1DM0B 1OQQA 1SFOB 1I50B 2M0AA 3T16A 3CKIB 4XQQA 2PVOD 1KDCA 3BDCA 2ZT9C 2IX3A 1YQ4B 1X32A 3LNNA 1PZID 4IFDJ 5C3EB 3MC0B 1DCZA 1T5EA 5IGFA 3DM1A 2RDHA 4QCLA 2XRSD 3VYSA 4M0WA 1QNUA 2WXIA 1F9QA 3TDQA 1C76A 1WD0A 2EY5A 1G2TA 4IN3A 1N63A 1HXYD 1T6BX 5IGDA 1K52A 4NJCA 1PFBA 5EBCA 4MACA 1STYA 5E4WC 4XXEA 2EKIA 2AWNA 1IBXA 4IUPA 3VYTA 1E6EB 3HOVB 3AM9A 2IW3A 4WQMA 1OXSC 5K5PA 4KJOA 2WXFA 3IL8A 2EYLA 3FDTA 1V1PA 2WXGA 4ZHPA 2L83A 2KECA 1RODA 5H92C 1GPXA 5I6WA 2PZWA 1ZP0B 4FVMA 1GUTA 1NR2A 3T4AC 1NYQA 3MZ5A 2O2LD 3P20A 2KDMA 1O7ZA 1G6ZA 2QKIC 3D4DA 2XWJB 2EVBA 1YMHE 3I90A 3OHXC 1GXDC 2RPVA 1QCBD 4C7ZA 3UI3A 2PMVA 4FO2A 2LGIA 4RKBA 2NB0A 1B1ZA 2IGDA 1ENCA 1EIHA 2IGHA 2X6LA 5D14A 5I2YA 4JWSC 2K6AA 4KJNA 4MN3A 2ZW1A 1YNJD 1SJHD 3HEJA 1PFDA 1ZE3D 3I72A 3B2GA 2YU9B 3L9AX 1AWDA 1O7LA 1PRTF 4OVZA 2AQ1B 3D8GA 1BXTA 4JBWA 2E2IB 2N7JA 3MTSA 4IUTA 4NAMA 3IAM1 5EE3A 3SK6A 5EPKA 1TWAB 3K7AB 1KRHA 2N88A 1B9RA 1GAQB 2BS3B 3I91A 1SF0A 3WOEA 3EFXD 2R61A 5KYLA 1SB3C 1OQRA 1AN8A 3U7ZA 2KEDA 1A3TA 4N59A 4L23A 2J0TD 4NZLB 5GXGB 1VZ7A 3NQIA 1S4ZA 4OHJA 3GTKB 4G7OC 3VR3A 4HR7B 3CRKC 1ZUD2 4HAEA 4TKOB 4ULLA 3DWAA 4ZKBB 3I9V1 2ONQA 3D4WA 2JSOA 1PDXA 3I4MB 1ENAA 2R92B 5C3XA 4OZAA 4C3JB 1AEXA 2WXNA 1IGCA 3CIRB 1TQOA 3OMCA 3ONAB 2C9OA 3K5NA 1YN3A 2XN9C 2TMPA 2B2TA 3L4PA 2PYKA 4KHZA 2NN6I 3J7AV 2EY6A 1PUTA 2GA4B 5T8IA 3HRZC 1V43A 2VB3X 2JWUA 3RFZB 1OXUA 1UWMA 5FLXL 2WXLA 1ZXTA 4B9XA 4FXGC 1EWYC 4YTPB 3NE5B 2DY7A 3PUWA 1GB1A 2FMMA 4IKGA 2ZXOA 1FD6A 2BT6A 2WDVB 2LUMA 5EKIA 1MSHA 4N6EB 3CU7A 2WB1B 1QJOA 5I9OA 3HG9A 1DYQA 3Q69A 2W82A 2E75C 1FM0D 1TR5A 2VUMB 1RTOA 2F0WA 1E10A 2WNMA 1JE4A 2KA7A 2A74C 3ZJUA 1ILQA 2OF1A 3H6MA 1FR3A 2K04A 2K7VA 4FF4A 5FO9B 3D31A 4UDUC 2EOTA 2Y0SB 3U9OA 1J7CA 2WACA 4LLGM 2AWOA 1X3QA 1PFNA 4KY6A 2CJOA 3P75A 4ZRQA 1EL0A 2PQEA 5IIFA 2X38A 4ZK9B 4H0LC 1YJJA 1DOIA 4F88A 2BCOA 4GLSC 2WXRA 3VA5A 2L9HA 1QOFA 3ZJTA 1TYGB 3VYRA 1FIQA 4FF2A 1C4QA 3K5LA 2KVMA 2H88B 3C46A 1AFPA 2A6EC 4BY1B 2F3WA 1SYBA 2PW9A 1EY6A 2BE5C 5NUCA 3EGRA 1IYUA 5C4JB 5BN5A 4G7HC 1Q8IA 5BYSA 3BWUD 2L55A 2NZ1D 4ZUJA 4M1UB 3FPUB 4P16A 1H9RA 3AEAB 3I70A 3U2SC 1Q12A 4DNTB 4G7ZC 4C3JG 1JC7A 2D5DA 2QJLA 1S5CD 5E1FA 4DXGA 1EEID 1SNDA 5D3IB 2K5QA 4ZRPA 1C4CA 3NVWA 2KUMA 2HDEA 1S5BD 1SNCA 3IT6B 4DFAA 4RCNA 2I38A 3I57A 4PQXA 2DNCA 5ELBA 2VZKD 3HOWB 3Q22A 2C5CA 3P42A 1D5MC 1L4DB 4Q2JA 2KEEA 3MXNA 1BCPB 1BUIC 4OGQC 1LABA 5CMDA 1EWHA 4TQ0A 1I4GA 2KCNA 3VRAB 3AECB 3BS1A 5KGUA 5C6AA 3IXSA 1PLFA 1JWUD 4DK1A 1JOQA 5IGCA 1MVKA 1D6EC 1E0BA 4D2KA 5J39A 3WDNA 4HCEA 2IT1A 2EY1A 2KWDA 4Y7NB 1OXVA 1A70A 5BMIA 2ID0A 3N6RA 2LJIA 1K51A 3OSOA 5G3LF 2CW0C 2M9VA 5EPLA 1JOKA 3N52A 5C44B 1LT5D 4XT3B 4XT1B 4U68A 5CV9A 1CHPD 2NVTB 5DM73 2N9KA 2KN4A 4HRSA 1Q10A 4K2KA 2V0GA 1YNND 3EQLC 4A3FB 1I4QA 4XE0A 5A2QL 1JWMD 2PW7A 3FKIB 4C2MB 1JRPA 3E56A 1NSNS 1RFKA 1PZJD 3NTIA 1YN5A 3FILB 1PYWD 4MHEA 5EE0A 1SNOA 2ICIA 1HFGA 1TKEA 2R6GA 1TKYA 3QWNA 1B50A 4HMIA 4A3MB 1U4PA 1TVXA 1B9MA 5CC4A 5ELFA 1SE3A 2EYFA 4X3SA 1E2VA 3QB3A 3J80E 1N5WA 3HP3A 1K8OA 4IUVA 4YIJA 4REZA 3M4OB 1GUGA 2EY2A 2NN6G 4KMUC 2DYMA 1BCPC 1SNMA 5KNDA 1MI2A 1FNUA 1EQTA 3VR2A 5BMHA 3Q8AA 3SR6A 3KQ4A 4HROA 3DWGC 4ZUIA 4A3KB 3VR8B 3SVMA 5I9PA 4CBVA 3TEZA 1G8ZD 4QUFA 5D3DA 3K57A 3H3VC 1LT4D 4XYOA 3IAYA 4M8AA 1BCPF 4K6LA 3J81L 1PTOH 4KI0A 2H89B 2F4IA 3RMHA 1W6JA 1V8QA 2MP1A 2QILA 2FE8A 3C1EA 1GUWA 3SK8A 1I3QB 1K8MA 2ON8A 3MFGA 2W54A 4J3OD 3PZ8A 4R3DA 2L11A 1DOMA 4PV1C 1EY8A 3NUHB 2A69D 3OOCA 1XXGA 2B2YA 4KY5A 1XF5L 1JB3A 1CK1A 3KWLA 2NVYB 1YN4A 1N62A 3HOYB 1PTOF 1R9TB 5M5WB 2M2LA 4OIKA 1EFID 4IFDH 2F0HA 3KF8A 5D7GA 1AZQA 1SYEA 2F0JA 1Q1BA 2D62A 2F0VA 4NDXA 4A93B 1XLNA 4A9AA 4J6HA 3HVZA 1D4BA 3PO2B 3DXJC 5LL6S 2NMQA 4EQOA 5A35A 1VMPA 1B2TA 1PGBA 4CHTB 2HDMA 1L0VB 3JAML 2HCIA 1FCLA 1V1OA 3FILA 5BN4A 4CJ0B 2PMZB 1PGAA 3NRZA 1XEEA 1M4VA 1HA5A 3H0GB 5HG2A 1BNZA 2WXJA 2CHBD 2WU2B 2PZTA 2WP9B 3L7ZC 5C3JB 2RSNA 1GUOA 1JALA 3VA7A 2K05A 1XLPA 4HEDA 2E6XA 1DOYA 5HFYA 5JAVA 4WJWA 3QOLA 3DEPA 1A2UA 3RLFA 2PNRC 2LKVA 1Y8NB 2IX1A 2K5PA 1FRRA 4TQ1A 4IUQA 4BBSB 5ELCA 1K53A 5M9OA 2B8GA 2WXMA 4RGNA 4WFN3 3O13A 4X3KA 3A7AB 4BS9A 1ONLA 4NP5A 3NQTA 3C3LA 3C1FA 1CJEA 1VR9A 3TUOA 2AX5A 3FPPA 1PRTB 4G57A 4ARIA 3TP6A 2MJDA 4LK1C 2F3VA 5C0XJ 1TU2B 1WSPA 1ESRA 5KYIA 1SYDA 2FJ2A 2JYTA 1VRAB 1UEAB 1L4ZB 3ZYYX 4ZKCB 2R7ZB 3GB1A 4R8NA 5IGBA 4TMAB 1GUNA 5C5LA 1KDBA 2ICEC 1G91A 2F0MA 4IDIA 4KD3A 1WTRA 1RTNA 1SXTA 1HRJA 4OL7A 4LTUA 2B8FA 4L63B 1TY2A 5K36H 4HKQA 1QE6A 4XIGS 2KQ4X 5F2DA 2WLBA 2I07B 1C8CA 1WTQA 2HQEA 3MP9A 5JVG3 1BF4A 2H1EA 3NP8A 1SAPA 2EJMA 2BB5A 2WAQB 2JZPA 5FOBB 1RKNA 4LAAA 2NUCA 5C3WA 1V97A 2AQ3B 5HHDG 1HZ5A 1FXAA 2ZXPA 4HSPA 1LTRD 1TS2A 3HRDD 3A8KE 1QG7A 1UGJA 5JJZA 4KGRA 2RDGA 4KV6A 2BYTA 1NI3A 4K8IA 4DGZA 2WIIB 2MEKA 2RSOA 2QF7A 2NVQB 3TBIB 2FUG1 3TP8A 1PRTC 1G291 3IFTA 1QNKA 4A3JB 5M5YB 1KF6B 4YSZB 1X3PA 5E6JA 1JCKB 4JE3B 3GD7A 2A6HD 4AS1A 4X3TA 4EGVA 1JOOA 1SYFA 2G9DA 5T1IA 3P7JA 2F0FA 3D6WA 1FNVA 2AQ2B 3OWFA 1WVLA 1MHHE 2G1EA 3AEDB 2SOBA 3HOZB 4LK0M 5DEHA 1R4QB 4KKSA 3SK4A 1KH0A 1LO5D 1PDQA 2KMMA 1IYVA 2RQXA 3IKJA 4NKLA 2BW2A 5CV5A 2IWHA 3M3YB 1PMRA 3W5UB 4N58A 4FP5D 2GI9A 1ROEA 4JX1C 2OEOA 1H9JA 3R8BA 1W6KA 1XCTL 2L5TA 1FD7D 4YSXB 1TWCB 1I4RA 1JWSD 3G6JB 2K5WA 5IGEA 3GV3A 2ZW0A 5C5MA 1F2YA 1KABA 4CKBA 4ARCA 1QLBB 1STGA 3OPOA 1SE4A 4K5XA 4KKJA 2NTSA 1WTWA 3HOUB 1Z6HA 1FMAD 3NTKA 1VJKA 2JX5A 5TSSA 4RGMA 1Z7TA 3T3OA 1L0XB 2B2VC 3RD4A 1DXMA 3HUIA 4FF3A 1U9RA 1Z47A 4O1NA 4WIPA 3E5SA 3LWEA 1CT1D 2IGGA 4PMBA 3EROA 2Q8IB 1VCIA 1STAA 3TP7A 2N55A 4ZYSA 1WTVA 3P4QB 5FO7B 4CKCA 1AZPA 5T1GA 5KNBA 4FNFA 1STBA 2MPMA 1BMLC 3LWUA 4V0BA 3Q23A 3J9CA 5JXVA 5EE1A 1STEA 3RUZA 5FLXE 2HTME 1EY4A 1UAPA 1PZKD 2F0UA 2XNAC 3R3OA 5JEAH 1RJTA 1KLGD 3AEFB 4YT0B 2CVRA 2B2VA 4PMWA 3R2TA 1EWCA 1CZPA 2JU6X 1KNEA 4J1MA 1DOLA 3VR6A 4KX6B 5FK9C 3RZDB 2WXHA 1SYGA 3D6CA 2EZVA 1QQRA 1D5XC 2NBFA 1WWTA 3S2HB 3PUVA 1ML0D 1Y1VB 4OZCA 4DXFA 3PUZA 4MIUA 3V05A 2PPBC 2LEKA 1A15A 3DUZA 1HFNA 5ISRA 1WRIA 2BS2B 2FHTA 2WXQA 3NTHA 4ID6A 3P1HA 1J9OA 1GJXA 4L2YA 1IW7C 5C4ZA 3Q6SA 4P2CB 1B4OA 4XDXA 4ABNA 2VB2X 2YYZA 3BDLA 1E0ZA 5CGKA 3SFEB 3TZDA 2FFKB 5AUKA 5G5HA 1GHJA 2E2JB 1NAPA 1OO9B 2RMMA 5EQ0A 4UAIA 3NK9A 1IKLA 1CTMA 3HKZB 2MJ3A 3U9SA 4KN7C 3VR5A 3I8ZA 1B3AA 3BVZA 3K59A 5DM63 1XLQA 1F9RA 2GB1A 4Q0FA 4AQ7A 4F8MA 2INNE 4E6IA 3M4YA 3J7AF 1CHQD 1KDAA 2BDNA 1I4HA 1CQFA 5JEAJ 2EPBA 4HEA1 3SEBA 4RKLA 1EY0A 4X3UA 4CKEA 4CJ2C 1FO4A 2QIEB 1RM6C 4LMQD 1KAAA 4RF1A 2KJXA 1IHZA 4KGSA 2PW5A 3P1MA 1EQVA 1D1IA 4A8XC 1QKZA 2PO4A 1N61A 1EYDA 4IFDI 5C0XI 2BTEA 4O42A 1LTGD 1TS4A 5EJWA 1Q1EA 3TEXA 2NTTA 3AEBB 4US9A 3S1QB 4L6TB 4XWTA 4A3DB 1HTPA 2INPE 2LHEA 2RBMA 2OHFA 2L32A 3VR9B 3AE3B 5G5GA 1CZWA 3DWMA 1ENFA 3NZ3A 3WCQA 2DYOA 1EYCA 2Z8LA 3S15B 3GTQB 1GB4A 2BOSA 2A68D 3TMEA 3P63A 4KK7A 4RH6A 4A55A 4XDCA 1HZ6A 2F0SA 2GRIA 1VDZA 3J7YW 1SE2A 3SFDB 4OO1H 4KD4A 2LFIA 4A3BB 5G3LD 1BQQT 3AE9B 2MH7A 1ZEQX 1G2SA 3VYUA 1WXQA 4IOIE 2LFNA 5I2XA 3S2DB 1ZDXA 4ZQ3A 2Y5CA 4XQJA 4L8JA 1PTOB 2W3RA 4C80A 2K32A 1P7EA 2J4XA 2HCCA 3KLSX 5BMGA 2ACZB 3A8IE 3KBXA 3Q8EA 4A6QA 1BBXC 2WP8J 4WRDA 2B2WC 3PMFA 5IT9L 2A5HA 5A2QE 4HSVA 4LJZC 3B2FA 1LTBD 1EOTA 2WXKA 1SMYC 2EE1A 1II3A 4RGTA 2J42A 2AUKA 5C4XB 3E9SA 2WS3B 2PIAA 2RKSA 4WURA 1KFYB 4YXDB 2X69A 4K2LA 2I46A 2K1BA 4YWGG 1I4XA 3GTMB 2L1AA 3KWVA 2R93B 3NPPA 4K8JA 1K83B 5MPOA 1ZOYB 4L1BA 3TSSA 1NYRA 1KNAA 1SNPA 3S1MB 2Q8RE 3AE8B 2Z4IA 3S16B 3AN1A 5KIXA 3J80L 1M8AA 3SDZA 4N9PA 1SSOA 2QSDA 2B2UC 3BVGA 2PKOA 2F0KA 1NEKB 3MFYA 1K50A 4MH8A 4KGTA 1VF7A 2H4OA 2Z4HA 5EBDA 2J53A 3HVDA 1GUSA 3AMUA 5KRUA 4RA8A 4PMCA 1C4AA 3PV0A 2HUGA 4V190 1PTOC 4KTAA 5COYA 2QEJC 1KTKA 1HUMA 1QB5D 2MUYA 1SNQA 2W55A 1XTCD 2OEDA 1A6XA 3QO2A 1D5ZC <