2AQ1B

Crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWHGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell receptor beta chain V
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 69
structure length 234
sequence length 234
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aq1B02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2aq1B01
1KLUD 1JCKB 2QEJC 1TS5A 4OHJA 1HQRD 1EEFD 1FNUA 1B44D 3BYTB 1GOZA 4RH6A 1D5ZC 1FD7D 3O13A 1D5XC 5D3IB 1PRTC 1V1PA 2RDGA 4Z9CB 1LTRD 1JQYD 2RDHA 1S5BD 2IPKD 1FNWA 1BCPF 1ET9A 3BVMA 1RD9D 1AW7A 2TSSA 1RCVD 1TY2A 5ELDA 1B1ZA 1S5FD 1S5CD 1PZID 2O2LD 4C56C 1DYQA 1EU4A 1SE4A 4ZYSA 1YN4A 1V1OA 1TS4A 3BVZA 4RHSA 1EWCA 1PTOD 2Z8LA 1LT4D 1RF2D 1PTOB 4RCOA 1LTAD 1XXGA 1F77A 1I4HA 4RGNA 2NTTA 2SEBD 1LTSD 5D3DA 5ELEA 1EU3A 3MFGA 1LTBD 3BYYB 4TSSA 1LT3D 1LT5D 4RGOS 1BXTA 1ENFA 1CHQD 1S5DD 2R61A 3DWPA 3TSSA 1L0YB 1I4QA 1PTOH 3V05A 1BCPD 1S5ED 1BCPB 1XTCD 1D5MC 5ELFA 1JWMD 1EFID 1KTKA 2CHBD 4DXFA 1PRTF 1FGBD 1JWSD 3DWQA 4L63B 3MC0B 1HTLD 1SE2A 1RDPD 3R2IA 4UDUC 1G8ZD 1PYWD 1TS2A 3CHBD 1FNVA 4K6LA 4RGMA 4DXGA 2G9HD 1MD2D 1TY0A 1PTOC 1UUPA 3URYA 2J4XA 1STEA 3KLSX 1PZJD 1JWUD 4RGTA 1CHPD 1LTID 2AQ2B 1LLRD 5ELCA 1YN5A 1CQVA 3GP7A 5ELBA 1M4VA 1CT1D 1I4RA 4BWGB 1EEID 2ICIA 1SE3A 4O1NA 1SXTA 1AN8A 3SEBA 1JR0D 1SEBD 2QILA 1LT6D 2XN9C 3BZDB 3R8BA 1T5XD 1HA5A 3EA6A 1BCPC 1LO5D 1YN3A 1PRTD 1SJED 4RFBA 1PRTB 2XNAC 1I4PA 2XRSD 3OWEB 4RHRA 1SJHD 1ESFA 1LTTD 5FKAC 2XRQD 3BVGA 1I4GA 2NTSA 1ET6A 1L0XB 1QILA 1HXYD 1UNSA 1CK1A 5TSSA 5I4DA 1KLGD 2WV6D 1LTGD 3W2DA 1I4XA 3DWAA 3R2TA 1SBBB 1V1PB 5FK9C 2AQ3B 4NZLB 1PZKD 1TS3A 2AQ1B 2IJ0A 1PTOF 3EFXD 4L6TB 1DJRD 1D6EC
chains in the Genus database with same CATH superfamily
4CGYB 4WJQA 4LJZC 4IM3A 3UDGA 1QVFA 1R9TH 2PPHA 4ZRQA 3KF8A 3TEHB 4URKA 1V86A 3O13A 2CQOA 3Q22A 1WJ4A 4OZBA 4KVGB 3APDA 2KKCA 1J8IA 1E5WA 1KM7A 1VQ5A 3UQAA 1KHIA 3KUPA 2V3PA 1B7YB 4QIWB 5CV4A 3KWLA 4C3JH 4TRDA 5C0XI 1ENAA 3KLRA 1R4NI 2WXLA 2HIXA 2VY3A 3H1UA 1TKYA 2PO4A 1N33Q 4BFRA 2IY1B 3DM1A 4ZYSA 4Y7NB 4XYOA 1XYIA 3I4NH 3ZLZA 3DHQA 4YL8A 4RKLA 4NP5A 2BDNA 2WHIA 2MP2A 2HDLA 2DZKA 3QOJA 3JYUA 3S1MB 4IOAA 3V60A 3FILA 3EROA 3PLVA 3TUOA 1DOLA 4LDTB 1A2UA 3J7ZC 4QAYA 3CAMA 2B39A 2JSOA 2INDC 2ZTCA 4J8QA 1QT9A 2LVQA 1XX8A 4NDXA 3ITPA 2NBVB 1V8QA 1TWHH 1YIJA 2QDFA 2M9VA 1K53A 3OMGA 2PI2A 1BKBA 2DZJA 1CM9A 1WTWA 1GUWA 2GRIA 2NN6H 1S3OA 4ME5A 5K36H 2MO1A 4GKKQ 5CBAE 4MGZE 4V190 1SGHA 2ZTEA 3DBLI 1XTCD 3MZ5A 4AJYB 5JHBA 5IODA 2K9XA 2NZ1D 4IM2A 4KSLC 2WU2B 4NKLA 3A9JA 1JWSD 3RNEC 3PO0A 3QCAA 2NVQB 4OX9Q 1C4CA 3PHWB 1H95A 4XDDA 2ZJRA 1D1IA 3P75A 2BH8A 3NBHA 2NVUI 1EQRA 2LMCB 2A5HA 2PQEA 4IQZA 5CR3A 4DXGA 1GHKA 2IY0B 2K6DB 2CH4A 2I5MX 4JYAL 3AE5B 1JB3A 1UUPA 5FO7B 3URYA 3J81c 4XQQA 2VRRB 2WXOA 3A0JA 4AQ7A 3IT4B 4TKOB 3FMCA 3UDIA 1GM5A 5DM73 1AYFA 1OQQA 3MC9A 2JZZA 4TKNA 4X62L 3M3YB 5KIXA 5C44H 2WFWA 1EOTA 4M02A 2RHSB 4C3JG 1KRHA 1I35A 5COYA 3PO3H 4JI3L 3ZNID 3QA8A 2Z6KC 1SEBD 1MI0A 3NUHB 2Z4HA 4NXNL 1H9RA 1JRPA 4KDLB 5CHVC 2GVAA 1YX5B 3W1GA 2HDEA 4BZAA 3I4NG 4IC7B 4HKZE 1SJED 3RNFC 4KY6A 2RSNA 5KGUA 5FOBB 4RHRA 3NZUA 1P16A 2HCIA 3TREA 4LNIA 5E4WC 3ZDMC 4HEDA 1ZDXA 4XE0A 4M8NA 3M4PA 4DK5A 1OQRA 3UI3A 2UXCL 4LAAA 1UNSA 2AL3A 2LJIA 2JXMB 2EXZA 2UU9L 3MA2B 1QG7A 3WAMA 2LGIA 4N59A 1B2TA 2DNFA 3CCSA 3CPFA 3Q3FA 1V2YA 1N36Q 4B9WA 3J81j 1V49A 3NTKA 2FXQA 4DV4L 1WMHB 2F3WA 1Q46A 1F2ZA 2A69C 4IURA 1PH1A 2NN6G 1XMQL 4R4IA 4R8IA 2L3ZA 2GOWA 4M0WA 3DXJC 4Y52H 3P4QB 2HHHQ 4P73A 1GJXA 1PH2A 3VRAB 5HURA 2KOXA 3RPFC 1LGRA 3I7FA 2VL6A 1UE6A 1U4PA 1KDBA 5HI1A 4HJ8A 2HIVA 4P6VF 2QW7A 2VXWA 2E2JB 3CQZH 1GG3A 4UPAA 4DV5Q 1XQQA 4A75A 1YJNA 1OQYA 4LK0M 5BMHA 1E7UA 2ON8A 3J81i 3PTFC 1ZEQX 2TSSA 1MIUA 1QKZA 3QQ8B 5C44G 1X56A 1FR3A 5M3MB 3AH7A 1HFGA 5EPKA 3EJIA 2MBOA 3PO3G 2DWQA 4XT1B 3JW0X 2HD3A 5L37A 4E3CA 4GB9A 1XXGA 1SLJA 1HZ6A 1WZ0A 1XNQL 1STNA 3PMFA 3ZJUA 3EQLC 1C76A 4BBRB 1NMGA 2KDEB 2GA4B 4IDIA 3GTJB 4DXAB 3TL5A 3ZQ4A 2K5NA 4S3SA 2IX1A 3B0AA 3HS0C 4DUYL 3P4RB 4YSXB 1N61A 4K7WA 1BCPD 2F0MA 1RM6C 1F9QA 3MP9A 4GDKA 2FE8A 2WQYB 4PQXA 3TMEA 3GTOH 4UP7A 2WU5B 4ANWA 1WE7A 1OTCA 3L0WB 3MC0B 2KEDA 1SE2A 4R4CA 3C3LA 3PZ8A 4YHHQ 1RDPD 3BDCA 1RWSA 1B3AA 1VCIA 3WOEA 3CHBD 1D3ZA 4IPCA 3SVMA 1N9WA 4GN5A 5IAAC 3FKYA 3PIP3 3H7PA 4BKSA 1MVKA 4XT3B 4REZA 1O78A 4GLVB 4FF1A 1PZJD 2JA6H 2JF5A 4DGZA 3GE8C 5LLIA 3UIOB 4ANVA 3BY4B 2UXBL 3BK1A 3MJ5A 3NE5B 1WI0A 3TJPA 1RYJA 1AE2A 3ZDTA 1CQVA 2BE5D 2AX5A 4I6PA 3PIPA 1NR4A 2CH4W 4AYBG 3SFDB 3QK0A 4HAEA 4A3IB 3Q0AA 2L11A 4LF4Q 3VR8B 1BDOA 1Y8NB 2BVCA 3VAWA 1T0SC 2KLGA 2B2YC 5C5MA 4CO7A 5CC4A 1PRTD 4KKUA 2RD0A 2CJOA 2OXPA 3DUZA 2RDBC 2XRQD 2O5JC 3KBGA 2ES2A 4TUUA 2IGHA 2LXCA 1Q12A 1MI2A 1HXYD 2KWUB 2PW9A 1X55A 2MJ8A 4WQOB 4EVOA 1HEZE 2KDBA 5IT9E 3U7ZA 4US8A 2OHFA 3H0GH 4DAMA 2F0FA 2JK8A 3P7JA 5C4HA 4Q5VA 4DR1L 4YCWA 4DV7L 4GOPB 3NS8A 3TS2A 1FD6A 1F2RC 1IXRA 2VQFQ 4GLSC 1PGBA 3S15B 1SDFA 4DR5L 3V2TA 3AYHB 1I94Q 1YJ1A 5FLXL 1EEFD 1E8YA 5A2QL 1ILPA 3TQYA 4NQLB 1KFYB 2YVCA 2WX0A 4A8XC 1PMRA 2WXQA 1SNDA 1MG4A 1WGKA 4OVVA 4AUQC 1E9MA 1BR9A 5IGCA 1K0RA 3PIO3 2DHZA 3GO5A 5LMNQ 4YXDB 1HUMA 2F4IA 2BDOA 5M9OA 3BJUA 2E76C 3MXPA 1P7EA 2RGFA 4HK2A 2JA6G 3BVMA 3QB3A 2DZIA 2GLSA 3HOYB 3K9OB 1S5FD 1TKGA 1NR2A 3RMHA 3L2PA 2K39A 3M85A 2G3QB 1OXTA 4OONA 5JOBA 1L2FA 4KGRA 5C3EH 4GXBA 3S2HB 1KOTA 1V9JA 1WZ3A 2MFIA 3VUXA 3U2SC 4YTMB 4DR6L 1YQ4B 4HR7B 3PRPB 1AH9A 4HPPA 4WWPA 1WM3A 2V0GA 1PLFA 1XMOL 2NPTB 2PE6B 2SEBD 4NB3A 3I4MH 3E56A 2PNRC 2EY6A 2LGXA 3EN2A 1ZYRD 4Q2JA 2MSED 3V62A 2BT6A 2D5GA 4LNNA 3PF5A 2JA9A 2NS5A 5EPJA 1EYAA 4FXGC 2K5HA 1AWDA 3Q2AC 1PH5A 3CCEA 3U4VA 4JI8Q 1QOAA 4IWPA 4A90A 4O2DA 2OCEA 1YX6B 2KT7A 4LWCA 1BMLC 3W5VB 5CV5A 5LXHA 1QUQB 4BY1H 3ZUNA 2N49A 4K2KA 2RMMA 4JI1L 2WINB 1PFDA 2LD9A 3DVGX 4G50A 2KLCA 1NVID 1Q0WB 1HTPA 1IKMA 3PLUA 1WX7A 1KAWA 2QCZA 1WE6A 4IUTA 1G8ZD 2C9WB 1MFWA 2YTYA 3S2DB 4C7YA 1EZ6A 1DD2A 3DEOA 4H7BA 3AXCA 1N5XA 3JAME 3WALA 4UHVA 1X3GA 4WJ3M 1SN8A 4N9F4 3CCMA 3QWNA 3S16H 3N52A 5JJLA 2V9HA 4JI0Q 3P1MA 1XCQL 1E3PA 5ELBA 4GNXA 2BOSA 3M7GA 3NK9A 1TWAB 4YCVA 4XQJA 3GTMH 1K83B 1TWCH 1BNZA 2B3AA 3K7AH 4A3EH 3AEBB 4KZ0A 4EOYA 4K3BA 4BOZB 4IALA 2N7EA 2WXKA 3HVDA 3NS1A 3QHTA 4KKIA 3QJYA 2B2TA 4DR3Q 1N33L 1VZ6A 2KFKA 1IYFA 1PXUA 2XEWA 2VQEQ 1YIWA 1XNRQ 1PUTA 4GDLB 4MEMA 5C3EG 1ESFA 1PFBA 2NVYH 3OSOA 2E2HH 4YIJA 4A55A 3D4RA 1YJIA 3CC2A 2PVGC 3AE6B 1X65A 2HQEA 1ASYA 5CMDA 3DHIC 4R9WA 1JE4A 1Q82C 2QCPX 3I4MG 1XO3A 2DYOA 5C23A 5KYLA 1YNJC 5E3FA 3TMPB 3AE7B 3GTPB 1X1MA 1GVPA 1E7VA 1I50B 1PGXA 1Q5WB 2EJFC 4KHVA 4QUCA 2EE1A 2F0SA 5IYDH 1L1OB 3LWUA 1SB3C 2G4DB 3KUZA 4ZRJA 1F2RI 2O5IC 3QR8A 2INPE 2KBNA 3M63B 4RM8A 4GN1A 3W3AA 4HDQA 5AEKB 2XWBB 4GKKL 2JYOA 4K0KQ 2H5XA 5D65A 2WGSA 3T3NA 1TWGH 4QQBX 4BY1G 1PVOA 3E5SA 3A33B 3DBRI 5HKHA 4AIMA 2JA5G 4CBVA 2Z4IA 4IFDG 1IBXB 4I7ZC 1Y8PB 2FINB 4OX9L 1SSOA 3ZTDA 5ELOA 3W9CB 1H9MA 3PT2B 3KW5B 3DQVA 2B2WA 3RZOB 1NTGA 1TKWB 3LJ3A 4MM3A 1EFWA 3J80L 1KDAA 3R3OA 4QGUA 1YQ3B 2LXJA 3NELA 2L0FA 1F9RA 3QIJA 5CYUA 1TY2A 5AUIA 3UF8A 3MC8A 3QO2A 2FCQA 5E7NA 1V1QA 2SOBA 3IFWB 2RA4A 2A8VA 4EZLA 1UGMA 2Q2HA 4K3CA 1ML0D 2JXXA 3VHTC 4KMUC 4A3EG 1J6QA 1PA6A 3UIPB 4MJSB 2DLBA 4IFDJ 1V80A 3I72A 4RM9A 2F4VQ 1K9MC 2Q2TA 4ULLA 5AZHA 4DK0A 2A73B 2A6HD 1FFUA 4A93B 4EQPA 4DR2Q 4AQYQ 5ELEA 3FKIH 2D0PA 1K8GA 2V1YA 1PH4A 1VR9A 2BW2A 3H15A 1VQ7A 4BBSB 5KNCA 3MFYA 1MJEA 1YD8U 3L7ZC 3VYUA 1CKOA 1C79A 5CORA 4A3JB 2D10A 4KY7A 2MJEA 4JVZA 1PTOH 2L9HA 1FGUA 4ZCKA 3RUZA 5C4XH 2KQSA 3M4YA 4FLHA 2F0DA 2LHDA 3DBRB 1TXYA 1N36L 1P0RA 2ID0A 2JZPA 2JE6I 2Z59B 3HOZB 2Z0EB 2D2CC 1K8RB 2C7HA 2D11A 2WXHA 2V4DA 3WOFA 4LNQA 3D0FA 3PUXA 1U0LA 3JSVB 5FR6A 4K2LA 5J39A 2HHHL 2UU9Q 1PTOC 5M5YH 4IM0A 2H88B 1BQQT 1JOQA 1PYBA 1Y1WH 3TBLD 5IP7G 2RBMA 3OW2A 2F0VA 4IFDI 5JVH3 3RN2A 3IVFA 3GTGH 3CSFA 4ARCA 4DV4Q 1J8CA 3S1QH 2KUMA 1CKNA 3OTOQ 1HPCA 1YN5A 3AI5A 1E22A 3GTKB 1XMQQ 1IL2A 2EELA 4FYDA 4JX1C 3NWSA 4DV5L 1M4VA 1FJGQ 3BZCA 3NG0A 3HEJA 4BWGB 1LFDA 2WS3B 3GQBA 4OL7A 1XLOA 1Y56A 1J7AA 1P3QU 2CU1A 3ZTCA 4A20A 3CC4A 1EWYC 4WRDA 5EJWA 1HA5A 4IPDA 1VF7A 3HOXH 2I1JA 1QB5D 3HHMA 1QLBB 2MCNB 3UDXA 3AU4A 2XVSA 4FHJA 4OIKA 2ZVNA 4L5TA 2UWQA 3FILB 1SNOA 2WAQG 5EKLA 1PH8A 2V3SA 4M8MA 3Q8FA 1GUSA 1ENCA 3T3OA 2KWCA 1GUOA 2SNSA 1QOGA 1TTNA 2KC2A 2K75A 2MBHA 3C0RB 3Q3MC 5EE0A 1EY4A 1R4PB 2B3GA 5C6AA 3FKIG 5DPSA 4LFAL 2N9EB 2A1AA 2J7ZA 1Q1OA 4K81A 3X3NA 2F0QA 3HOWB 2Q8RE 5I6WA 4WJPA 4AS1A 1JE5A 2YV5A 4IKGA 2WXMA 1PTOF 1ZYRC 1F9JA 1GD7A 2K01A 4S17A 1WR6E 5C4ZA 5C4XG 2J7QB 2KN4A 1CUKA 2X69A 3AE3B 1JJCB 1STYA 1TYGB 4C3HG 4FXCA 3NBHB 1YI2A 1C78A 2BF8B 2HTME 3N3KB 4MH8A 4YHHL 2F3IA 1DGJA 4ANXA 2H89B 1EIGA 1D7QA 4KKJA 1TWFH 5CGKA 5BO4B 3SDLC 1Y1WG 1HH2P 4DQOC 3VR3A 1LV9A 3ZKJC 4CDEC 4WFN3 3I90A 2NVXH 3S1MH 1II3A 1PH7A 1NENB 2XSCA 4DDGD 2ZPNA 1PZID 3CU7A 5AZFA 3NZ3A 3RUIB 4K8IA 3KLWA 3AEEB 4B0EA 3ML9A 3KF6A 3WIMA 2KMAA 4MSQB 1IYUA 2EYMA 2B2VA 4LF4L 2HJ1A 2JZ3B 2L7RA 4JBJA 2I0QA 1F77A 2F52A 1WXVA 4CKBA 1GO3E 3HOXG 4DK1A 3N9YC 2GMIC 5H1SE 1EU3A 3V6CB 1B9NA 1SNQA 1DZ1A 4KDIC 1H4RA 2EJMA 1ENFA 3N20C 4U673 3G71A 1FXIA 3NEMA 1WWTA 2NVQH 4C1NI 2EMTA 2JA8B 2YEPB 1WD1A 1BCPB 1PFSA 2KCTA 5H8YE 1JT8A 5ELFA 1DONA 1KTKA 4I65A 4G7OC 2HDMA 1W6JA 1WVLA 4RF1A 2C60A 3M3JA 4IJLA 4HIMA 3EFCA 4LNFA 1Z9FA 3T53B 4CJ1B 4A3MG 2N7JA 3S1NH 1TS2A 2H1EA 2N78A 2VQFL 3CCUA 4WURA 3HOVB 1KNEA 4K1RB 1MJCA 3S1RH 1I94L 2PQAA 1PFMA 2J4XA 2LY7A 1N8RC 1JJ2A 4JIOU 4XTCS 1V8CA 4A76A 4A3FB 2AQ2B 5KRUA 4A3BB 2A69D 1E2VA 3S2AA 5HFYA 3U4ZA 2WACA 1E7ZA 1K28A 1Q8KA 1UELA 3EBEA 2KMCA 3V6EB 5LMNL 1WTXA 5D2MB 3EGRA 4O1NA 4RWSC 1WJNA 4DR5Q 1A2TA 1JR0D 4LFBQ 1T0YA 4O42A 4G3XB 2VZKD 3IAM1 2EZVA 5CV6A 2UYZB 3STBC 1PRTB 4GNXC 2KDFB 3AE9B 5IP4D 4AH6A 1G2TA 4ZUJA 1HZBA 3R7RA 2ALYB 3F2CA 3I57A 3ICEA 1W2BA 3TZUA 2BH2A 1Y14B 2LJ5A 3S14B 3SE0A 2B2TC 2EKEC 1KLGD 1O7ZA 5LMNW 1V43A 2MLBA 1I4XA 2DYBA 3UE1A 1SBBB 2P5ZX 3K0YA 3LWEA 2CW0C 2LGSA 4I7AA 1A3TA 2FNJB 2V4IB 1ONLA 4L2YA 1L7YA 1QVCA 4EX5A 2AQ1B 3OHXC 3H9DA 1CA6A 1WFQA 1HRJA 2J0TD 3AM9A 1QE6A 2QDLA 1PDQA 1SYGA 3I4OA 1MG8A 1KLUD 1U4RA 2KX0A 2L1AA 3A1QB 3D32A 4A3KG 5GXGB 1BO0A 1SNPA 2E2JH 4ZDVA 3DBSA 1XMOQ 2KWDA 1C8CA 1PV4A 4XC2A 3H09A 2Q8IB 4A3DB 3WAPA 3AEGB 2DX5B 2KHSA 5IGGA 1G51A 1CSQA 2IHEA 5G2NA 2R7ZB 2F1MA 3M9BA 4HWIB 2JYEA 3APFA 1FYCA 3T9LA 3CW2C 1YNNC 5CV7A 4KV2A 3PUYA 3VH4B 1IL8A 3GOEA 4NJ7A 1RCVD 2EYOA 5IOIA 3RI7C 4JI1Q 1KDCA 1DYQA 4KY5A 2AEHA 3L13A 2Z9HA 4JI0L 1F2YA 3MJWA 2B2WC 2Q8TA 1WF9A 2ZT9C 1RTOA 4F7XA 1H9SA 4BBRH 2BS4B 3UINB 3HOUB 3D6CA 3K5OA 3H6NA 3TEXA 2A4ZA 4CHTB 3E9SA 1XPOA 3FPPA 2KA7A 3BK2A 4DR3L 4EZJA 4IUPA 4LJPB 1EIHA 2F3VA 1WGGA 2VQEL 3BS1A 1XNRL 5M3FH 2LRWA 5T1GA 2M0AA 2PJHA 4NAWA 3WANA 2GBJA 2B63B 4YY3Q 4FF4A 1AFPA 1S1QB 3L08A 4B6WA 2HCCA 1ZKHA 4IWOA 4ZK9B 3I56A 1WTVA 5EE1A 4JI5Q 1VDVA 4P1BC 2JSVX 3D8GA 1C3TA 4A3LH 1RAXA 1M90C 3HM6X 2C7NB 1WI5A 1X9NA 4L23A 2AHOB 2ZNVB 2KN5A 1Y8OB 4H2AA 3F1ZA 5I9OA 3X23A 3D31A 2BB6A 3TP6A 1QZHA 2RSUA 4HKQA 4OO1H 2CR5A 4C4VA 2R92B 4DR7L 1JOOA 2Z0DB 3NZSA 1HTLD 4FBJB 1L2NA 3CRKC 4KGSA 4ITKA 1F9SA 3NVZA 2DAJA 3A8IE 4K0KL 2V3NA 3A9KA 5C3WA 1Y8RC 3KUCB 1T9HA 4DU9A 2OOBB 2CHXA 4XDCA 1WTOA 1YNTE 4YWGG 2RQXA 1KD1C 3ZVVA 2JWUA 5IT9L 2EYHA 3KFUA 3R7QA 2B8FA 4FJVB 3M7NA 5LHY1 1N34L 2HD5B 1I4RA 5JPNC 4NJCA 1JC7A 4JOIA 2ICIA 1UAPA 1HNWL 5AZGA 3ULJA 4HEA1 4DV3Q 1Q10A 2OWOA 4XQNA 1L5PA 2RR9A 1E90A 5F2DA 5IOCA 3GS2A 3PZ7A 2K7VA 4RKBA 5LMUQ 1FVIA 2VUMG 2ATWA 1H8CA 2EPBA 1P1AA 3H91A 1D2BA 1SJHD 2IX3A 1RFKA 1UBQA 3AV8A 3P4PB 4IN3A 4W9DA 3PO2B 4II3B 2W82A 2KTRA 4Q0FA 1F9PA 1FEHA 2F4VL 2VB3X 2R93B 2WV6D 1UWVA 1R4NB 4DR2L 2M4NA 5M3FG 4AQYL 3PCOB 3E3XA 3P20A 4F8MA 3MVVA 1P8LA 1ROEA 5E6OA 1PZKD 5IA7A 1RKNA 4ASWC 3M4OB 4B3RL 4A3LG 4HSPA 3Q6BA 2Y5CA 1JALA 3B6YA 1HZ5A 2KNBA 4G11A 2NBFA 4ICVA 5CTRC 2CFMA 2SNMA 3DBHI 2JVCA 3TEYA 1CJEA 5BN5A 4GLXA 2MQHA 4OO1G 3WA0A 1D5ZC 1JB7A 4NJ6A 3ULPA 4C3IH 3CCVA 1WSPA 4W9LA 2IGDA 1WYDA 4B08A 1N32L 3KJPA 4EEWA 5FR3A 2NR2A 1W6KA 2WYQA 4FNFA 1J5EQ 5KHOA 1MHXA 2IPKD 4DAYA 4LF6Q 1HNZQ 3IHPC 1J0GA 1TJEA 3DBLB 4UAIA 3S2HH 5DM63 3I9V1 4FXKC 4A4IA 4C56C 4HIOA 1BF4A 2JA7B 1SE9A 2CHZA 3OTOL 4GNXB 3GTLH 2L1BA 1IZ6A 2A19A 5K36G 1FJGL 3J81E 1N62A 3J7AV 4R4QA 2AWNA 3OPOA 2N1VA 1FL0A 3DDCB 4XYCA 3F8TA 3IXSA 1MJDA 3ZGZA 2E2IH 3AECB 2QMTA 4GOCA 3L10B 1WTHA 4X6AH 4OZCA 3JAML 2KFJA 4FN2A 1QOFA 2JT4B 4FDBA 3HZXA 4WWMA 2B2VC 4TSSA 3I4LA 1F52A 1L4ZB 2J53A 2KWVB 1EF1A 1TIFA 4BXXH 1LABA 4M00A 2CCZA 1RJTA 4A6QA 2NZHA 2M1MA 3TRZA 3ECIA 3M4QA 3DBHB 2RSOA 2ZEQA 3S2DH 1EFID 1G6PA 4ID6A 3DVNV 2X6LA 2C35B 4HCPB 3Q14C 4UDUC 1EO6A 2E5LQ 1FXTB 4RGMA 3NTIA 2K3UA 4UP9A 2AUJD 4JI6Q 1EY8A 1YNJD 1FM0D 4OO1I 2XK5A 2GN5A 4C3IG 1KC8C 1TWAH 1WCMH 4DDID 2CWPA 2Z1CA 4LFAQ 4DV1Q 3FVQA 1O7YA 1HR0L 2QJLA 2B29A 5IYBH 5AJ3L 4E71A 2PPBC 2WDVB 3NRZA 4HPLB 3AEDB 4IUVA 3JC66 2K52A 2G5DA 1EWIA 3NY5A 3SEBA 2PEAA 4P74A 1AZPA 3KVFB 4JW0A 2OQKA 4FJYA 1C48A 1PHJA 3NHHA 4MELA 1WYWB 1JICA 3VR4A 5BYRA 4ZYNA 4FP5D 1JWAD 3P4SB 4J6HA 2NN6I 4JBWA 4RFBA 3I5JC 1ZDVA 5D94A 3I73A 4HJKA 4N58A 2K28A 1QOBA 1A70A 1WRIA 1R9TB 1TZOA 1NE3A 2EKIA 2MJDA 2ZCCA 5EGTA 2LFIA 3HKZG 2R6GA 1YMHE 2DUDA 1WH3A 2N4FA 4DV2Q 4E6IA 2MP1A 3TEZA 1VQAA 5GROA 5DEHA 3R2TA 1V1PB 2ZTDA 4HMJA 3Q24A 2KZRA 4EUTA 2BTEA 2NYZD 1E24A 4JC0A 1IBLQ 2UU7A 1Q1EA 2OT2A 2LASA 4MDKE 3OOCA 4C3JB 1K3BC 2F0WA 4L6TB 3M95A 4BXXG 1WXQA 4HJ9A 2Z6BA 2FFKB 3K81C 4C1NK 1WGDA 2WP8J 1EYDA 3RZOH 3I4NB 4QY7A 2K5DA 1QF6A 3SXHA 5BYQA 1C9OA 4NW2A 2IBIB 2KX3A 4KHZA 4AYBE 2G4SA 2BS3B 1Q90A 4TV3A 2NWGA 3AFPA 4JI4L 1WCMG 2JX5A 1UGJA 1TWHB 3KDFB 1C4QA 5IYBG 1ILQA 4L5SA 4ZOHC 2CKZB 2RKSA 3SR6A 4A93H 1TS4A 4KSKC 4YT0B 1GXDC 3JVZX 1PTOD 2Z8LA 4ILWA 2R7DA 4HCSA 4LFBL 2PYKA 1WTQA 2RVLA 3RZDH 4BBSH 2JU6X 5I9PA 1WRDB 3EFUA 1I4HA 4GS3A 2MHJA 3BWUD 1SSNA 2RPQA 2EDGA 4IPHA 3RNUA 3A74A 3G6EA 1HZ9A 2AKWB 2EQSA 1SYBA 4G57A 2O2VB 4GU2A 5CHWA 1GJZA 1KXLA 4BKSD 2INNE 1Z5SB 3MFGA 4XWWA 1EY6A 2BGFA 3DHHC 1JWBD 1LT5D 3ZIMA 2V1CC 2ZJQA 1KF6B 4DHJD 3HOZH 3VDZA 2JYTA 1SFOH 3CF5A 1XD3B 1I4QA 3A56A 1UBIA 1VCBA 2XIWA 1S5ED 3RR5A 2BYTA 1G6ZA 1JWMD 1N60A 5C44B 4CQNA 4HPMB 4ZLTF 1YJ9A 1IW7C 2B2UA 2OTLA 1SF0A 3AE8B 1E8XA 4OWTB 3PO3B 2IO1B 4KI0A 1HQMC 3APCA 4MSMB 1E10A 5IN7A 2OQ0A 2D0OA 4V0BA 3GTKH 4OWXB 3TDQA 5JJIA 4H02A 1AZQA 4HCNB 2I2YA 1LACA 2F0LA 1VQCA 3MXNB 1G91A 3K9PB 2WP9B 1LLRD 4HIKA 2YLMA 2A74C 4X64Q 3S9WA 3GTQH 1EWHA 4OIJA 5ISRA 1J9OA 2E8GA 4QMGA 3JAMc 2K32A 4EGVA 3PUVA 4DNIA 1YITA 1AE3A 4HCEA 1IGDA 3AN1A 1VQHA 5J2RA 3I3CA 2KD0A 3ENEA 3H0GG 1NUCA 3NVYA 4MTKA 2WXIA 2CU3A 3FRPB 2VZKB 1QJOA 2BS2B 2CVRA 4JOIC 3RLFA 2VH2A 1YEZA 1TKEA 3VYSA 2MJ3A 5IP9H 1L4DB 3SD5A 3VXWA 1WXMA 1ZPSA 3HOWH 3HP3A 1CK1A 4BBNC 4IUNA 2K25A 2QF7A 2UUBQ 4G4KA 4FHKA 2W54A 3DVNU 5FK9C 1LM0A 1BVSA 3KYHC 4YY3L 3CQZB 3GV6A 2ZW1A 3A4RA 1E2WA 4XWTA 2IJ0A 1J7BA 4JI5L 1SYDA 1VQBA 4AYBB 5M5WB 2K6QA 1DJRD 2KTFA 3QWZB 2W9NA 5M5XH 5LNK1 1WM2A 4R8NA 3B2FA 1D4BA 5JZEB 4K14A 4M8AA 4USAA 1EQQA 2ZCBA 4ZRIA 2J0JA 3VYRA 1K51A 5D3IB 3K5LA 3RLNA 2M0XA 4DPGA 4LF9L 3OW7A 4KN4C 3RN5A 3A7LA 1LTRD 2IO3B 2A6EC 4J6IA 4LF7Q 1WMHA 3AEAB 1WR1A 5D7GA 3N1ZC 1EF5A 3RNCC 1GAQB 4WJ4A 1UWMA 1X6OA 2LI5A 1TQOA 2IZVB 4DR7Q 4BY7H 2WXRA 4RA8A 1XLQA 2BYFA 4JLCA 1FCCC 4IWQA 5JPMC 3KK7A 4BBNF 3DWMA 3P63A 4K7UA 4W9JA 3MHSD 3N1YC 4DBGA 1K8MA 4DV3L 3GTOB 1WXAA 1HZCA 1STHA 2PI2E 2AMCB 3B08A 4GLAC 4MTNA 3VTVA 2NTTA 3KH0A 4KJOA 2BA1A 5LMUL 1VQMA 4OELB 1C4PA 2L83A 4RMAA 1C77A 4KIKA 2DY8A 4K5VA 2ZZPB 3RNBC 2I5HA 1N34Q 3NJTA 1DGSA 1BXTA 4BA2I 1HNWQ 3B2GA 3Q8AA 3EHVA 2NUCA 3N6RA 4QB4A 2NVTH 5I2YA 2JA6B 5DNFA 4F87A 1IGCA 2KK8A 3ETRA 4L1BA 2E3TA 4WJNA 2L0CA 3STBD 4XDXA 1VQ4A 4A3GH 1U5KA 1EUVB 2K5VA 3D4DA 1G6JA 4DK3C 3D3RA 4KX6B 3FAHA 2B76B 3NXWA 3C1EA 4JGHB 5LXIB 1C7YA 3RNGC 1IYJB 1YJJA 2Z0SA 2G9HD 2M8SA 4PS7A 5J17A 2F0TA 4B3TQ 2C7MB 2WXNA 2CW0D 2O6VA 2YTVA 4RF0A 4RGTA 2GBKA 3LYYA 4P16A 3OWFA 5FLXc 1FIQA 2ASQA 1F0ZA 3TN2A 3RZWC 2R7FA 4B3RQ 2O4XA 2IO2B 5GMVA 5IWAQ 2AL6A 2LZ6A 3WWVA 1J5EL 1SYEA 3ML8A 5JJZA 2WB1E 4LF6L 1U4AA 4JQWC 1HNZL 4IPGA 2KQ7A 5JAVA 5C3XA 2ZXOA 5IYDG 3OLMD 4BY7G 3G6JB 2WXGA 2K33A 1N32Q 3M62B 4MIUA 4FF3A 1MPEA 3ONSA 2XGTA 1NAPA 3KF8B 1YNND 1NI3A 2NZOA 5HGTA 2QKIC 2NTSA 4LCDE 1SROA 1DOYA 5IIFA 3GE3C 4R3DA 2MQJA 5EKIA 3ER0A 2IY5B 4PMWA 5IY0A 2A68C 2FCNA 5CX3A 1QNUA 4WJWA 5L95C 1R4MI 2KOLA 2NB0A 3F2DA 2YU9B 3UDFA 1STBA 1Y1VH 3EFXD 1EUJA 2KCMA 5I2XA 1TBEA 3TBIB 5FLMH 4PYUA 4JI7L 1QOHA 5A2QE 2ACZB 2R7ZH 4A3GG 3A4SC 1VQ8A 4C4VB 1QNKA 1OTRB 2MP2B 2M00A 5I6YA 5C3EB 2JQRB 1EQVA 2E5LL 4Z9CB 1JW9D 2WLBA 5KHQA 2EMSA 4ZHPA 3FEWX 2Q5WD 1DCZA 1S5BD 4JI6L 2PNHA 4GOPA 5KYIA 4KZCA 1VQLA 3I4MB 2QSDA 4DV1L 1WGHA 5ELDA 2F0UA 1VQGA 4OXPA 2DN8A 2HJ8A 1SE4A 2QGQA 1A15A 1XJVA 2WAQE 4HLEA 5G3LF 3J7YW 3AEVA 1NYQA 3SR1A 4RCOA 4DUZQ 2OEDA 4BS9A 2KECA 3A9JB 4BY1B 1B50A 1ZKOA 2HTHA 1Q1BA 1YQBA 3C1FA 4FA6A 2JA5B 1FRDA 1FO4A 2IT1A 1HR0Q 3VUWA 4CDFC 1VQKA 5AJ3Q 4IOCA 4IOIE 4K7SA 1ZXTA 5GADC 2K5PA 5C5LA 3LNNA 2LHEA 1R4MB 4EQNA 4Y7NH 2I1KA 3DEPA 2BKRB 1LM8B 1ESRA 4PZ8A 3A55A 5L83A 1CKMA 1X32A 4KD4A 1STGA 2R92H 3DLLA 4QCLA 4HIDA 2K04A 2Y0SG 2MGSA 3Q8DA 4DV2L 3V05A 4P71A 2QHOA 1V97A 3AE4B 3KUDB 2MBBB 1NJIC 3NENA 1FGBD 1IBLL 5JH5C 3T51B 1Y1VG 3GTMB 3MEFA 2ICEC 1TWCB 4GN3B 5J3BA 3K7AB 4A3EB 2NPTA 4GSWA 1PYWD 1XF5L 2L5TA 4ZRKA 1NBWA 1JMCA 1MD2D 2WB1B 3UI2A 1S72A 2PVOD 5ELNA 2B2UC 1WTRA 1WGRA 2LGDA 1LTID 4X3TA 1SMXA 3T4AC 1O80A 2NVYB 2F0OA 2E2HB 1VQEA 1KLVA 1V5TA 5E6PA 1QUQA 4QJFA 2N7DA 4M1UB 1E1TA 1ICFB 3ZNHB 2E2DC 4MZ9A 4DR4L 3GZNI 2FIDA 2GBNA 3OJ3A 3MTSA 3ALBA 1Z47A 2L32A 3J80c 3E9IA 1AP0A 4HJ7A 4NPNA 2BYVE 1CMXB 5E6JA 2L15A 2R93H 4M0WB 3K5NA 1K52A 1P9DU 2MBEA 2MEKA 4WAFA 4BKGA 1STAA 3K57A 1SNCA 3M3YH 1GC6A 3NSWA 4PMBA 1VDZA 3ZNZB 1BBXC 2AUKA 4JI4Q 2WIIB 2G9DA 1WX8A 3ZJTA 2IHFA 1LTGD 1O7IA 2W55A 2FCMA 2LKVA 2PW5A 1I5FA 3L3OC 1AEXA 1O7LA 1CZWA 4MN3A 4OEMB 2R3ZA 4C2MB 2UUAQ 4LK1C 4NZLB 4W9FA 2M56B 3K8AA 4EFOA 1HE8A 1YOVB 4NMZA 2PTLA 3SFEB 4GDLA 1B53A 4X3SA 3J81L 3PSIA 4YCUA 3GDEA 1TS5A 4PMCA 3ERSX 5T1IA 1IKLA 2FAZA 2FCSA 3I63C 1I42A 3NQIA 4DV0Q 5CV9A 4NY0A 2L4NA 2GBRA 1EY9A 3TZDA 1IUEA 4JI2Q 1IBMQ 2WAQB 4R4TA 3AE1B 2OTJA 3ZJVA 4MGIE 4CJ0B 3W1SA 2UUCQ 2HT1A 4J1MA 1SMYC 1ZE3D 4GGQA 1L1OA 1ET9A 1UF0A 2EYLA 5E6NA 4L5QA 1B70B 1IP9A 3FKIB 1M8AA 1OXVA 4DNRB 3Q23A 4ZHOA 3IKJA 1KRSA 4X64L 2KJRA 1OEYA 1N63A 4WJOA 3H3VH 2PMZE 4GDKB 1LT4D 1C1YB 1PTOB 1VQIA 3PV1A 1IBXA 3CMEA 5C4XB 5KNBA 2KDMA 3TEWA 3J80i 3R3MA 4QF4A 1KABA 1MBYA 3PGZA 4C3HB 1NBFC 1LTSD 2ZXRA 2ZPYA 1X3QA 5AUKA 1EIFA 2GVBA 3MWYW 1N6ZA 2CKHB 3NVVA 3H7PB 5EPLA 1LTBD 3H3VC 3PPAA 3S17B 2NCNA 1WGYA 5M3MH 1H9JA 4X66Q 5GAEC 5M5YB 2Y3AA 1S5DD 4DHJB 4DF7A 1Y1WB 2WKCA 3PZDA 2MHVA 2UUBL 5IGEA 3GTGB 1Q8IA 5D6JB 2X6GA 3VDYA 3SDZA 4N9TA 2XWJB 1VRAB 5CV8A 3VR5A 4KD3A 5J22A 3KBXA 1XLPA 1AARA 1LXDA 4MT5A 4CHKA 1DOIA 4PT5A 1A3VA 3SHQA 4ZRZA 3GTJH 1VMCA 1M94A 2KACA 3FC4A 2AYOB 4P72A 1I7HA 3HOXB 2M19A 1WTPA 4DA2A 3A54A 2F0JA 1J7CA 5IGBA 2N8NA 2NBUA 3RT3B 4B3SQ 5ELCA 3S24A 3Q69A 3P1HA 3SGIA 4JE3B 1R7SA 3Q3JA 3CCLA 5J18A 4JWUC 4LF7L 3B1LX 3TIXA 1SXTA 1FCLA 3IAYA 1K8OA 1B3QA 4IUMB 4DN4M 4F7ZA 4K6DA 3BDLA 4LUZA 1MHHE 3V3XA 1VQ6A 4N6EB 3JSVA 3Q3OC 2N9LA 5IKCM 3T8MA 2XRSD 5CBEE 3L4PA 4LF9Q 4S0RA 3E9HA 4A3MB 1GUNA 2LRUA 5BMGA 3VQIA 4LF8Q 4D2KA 3LXFA 1PGAA 1TT2A 1E2ZA 1IBKQ 2JWZA 2F0PA 1DOXA 3OAWA 2LWPA 1YBYA 4A3IH 1E8ZA 4HDOA 4KJNA 1OXUA 4ZKBB 2MH7A 5DPWA 2OF1A 2VH1A 2M2LA 1WD0A 3PUZA 3QAQA 5M3MG 4X65Q 1TWFB 2INCC 1GUGA 2D9UA 5TR5A 2BQQA 1F2MA 2LGYA 3PGEA 2MPMA 4A3PA 2EY2A 5BR8Q 2EVBA 2QEJC 5DAUA 1WJJA 3L0OA 4OHJA 3SK5A 2NVXB 4K8JA 1A6XA 1B44D 4WAAA 4YWMA 3BIID 4GKJQ 1HJPA 1VJKA 4ZAIA 1GUAB 1E8WA 1D5XC 2I5LX 2EOTA 1BBUA 1KL9A 1MGSA 2DNEA 3HRZC 3I2ZA 3LX0A 4H0LC 4BBRG 1P7FA 4FVMA 1Q86C 1RRBA 2D3GA 5EAYA 2R2OA 4A3OA 2LEKA 1VD2A 1HHVA 4NXMQ 2ZM6Q 4GZYC 2PMZB 1A3UA 4B3TL 1I6HB 4HRSA 2KENA 3CRLC 3EVQA 1VMPA 2VZAA 3S15H 1IW7D 3WAOA 4BKTA 4HROA 2QDBA 3AMUA 4N8FA 3DMUA 3RMKC 1LTLA 1Q7YC 1IPGA 4E74A 4TQ0A 1PFNA 5BYSA 1S40A 2V4LA 5IWAL 3OYYA 4MHEA 3U58A 2DBYA 2DJGC 4OVUA 1YNXA 2SAKA 2UXDQ 1D1KA 1EYGA 2JUOA 4GOPC 3AEFB 4A3KB 1E6EB 4N8X1 5T8IA 1EIYB 2KVZA 1SIFA 3F2UA 3RLOA 2PW7A 2REXA 1K8AC 4F8CB 4RGNA 3FDTA 1GUTA 1A62A 2E6XA 3N1XC 4CJ2C 2N55A 2EXDA 3CXCA 3UGBB 3HOYH 1UEBA 3H3VI 2D3CA 4X3KA 3KWVA 4PZ7A 1VQ9A 3S1NB 3UQBA 2PMVA 3S1RB 5HG2A 1ZOYB 3IFTA 1ZP0B 1EY7A 3TSSA 2Q2UA 1Z7TA 4A3IG 1L0YB 3CPWA 3RULA 3SK6A 4P7IA 3EUB2 2WDRB 2CHBD 2KDIA 1T0RC 3WCQA 3N32A 1QCBD 4L63B 1GHJA 2KYWA 1EM7A 1DOMA 4AP4C 3W5OA 3BINA 1X3FA 1E7PB 2M17A 2IGGA 2KFKB 2H4OA 1QZGA 3N30A 3HG9A 1GPXA 3ONAB 4MH0E 3HGBA 2A5UA 2FUG1 3VH3B 4G7ZC 1WX9A 2IW3A 3DVGY 3ZXRA 1CHPD 2D3BA 2ZVOA 3IFDA 1WYGA 3VYTA 3C19A 1L6UA 2KJ6A 1IHZA 2DY7A 1BUVT 2BB5A 4IUQA 1RHPA 1UH6A 1X54A 1EEID 2K4KA 1HNXQ 2GBMA 1VS0A 2WKDA 4JI7Q 1RTNA 4TMAB 5C4JB 4FADA 3J7AF 5DPRA 3L17A 1PH6A 1T5XD 1JROA 2KO3A 5EE9A 4TQ1A 4HTHA 4HJGE 3EA6A 1BUIC 4ARIA 3VRBB 3TP5A 5E4XA 5EE3A 3CCJA 2A6ED 4BA1I 3Q8EA 4XX5A 2K03A 5FKAC 3GV3A 4KK7A 1I4GA 2LXAA 4DUZL 2N3SA 5GAGC 2DGYA 2KHWB 5TSSA 5I4DA 4ZKCB 1ZW7A 3QARA 3I70A 1CI3M 1I3QB 4AWJA 1K83H 2NMQA 5M5WH 1X3PA 4KIKB 3HOYG 4WWOA 2MUYA 3FHWA 3OIQA 4QUFA 2D3AA 4LJOB 2EYJA 1NDDA 4MM3B 3BG3A 4OW0A 4DV6Q 3T1HQ 4LW1A 4CDDC 4B3MQ 1YJWA 2BPSA 1P98A 4KHPQ 1MKHA 2RDFA 3CC7A 1V6EA 2L0TA 1FNUA 2WXJA 1GOZA 3J7A5 3MXGA 1JMLA 4OWWB 2VUMB 2CHWA 3X0WA 5JXVA 4RG1A 4JG2A 1HR0W 1BT0A 4ZRPA 3KOJA 4EQ5A 3GTPH 1NEKB 1I50H 3HM3A 2K8BA 2RDGA 3AB9A 4XZ4A 2DENB 1JQYD 2O6VB 1YHQA 3C8YA 4ICUA 1ACCA 1Q3LA 3L9AX 1VQPA 4PS3A 3W5UB 3ZYYX 2ZJDA 1AW7A 5M3FB 3CIRB 3IL8A 3A1QA 4JCVE 1S5CD 1HTOA 2PLPA 5KEEA 1GB1A 3PVLA 1VLBA 1EU4A 1T0QC 4JL9A 5IYCH 2ZW0A 3W1SC 3KLSA 5IT9c 1RL2A 2XTIA 3BVZA 2DJFC 5DLQE 1LYLA 1L1OC 3HKZE 3K59A 1RF2D 3K5MA 1WY8A 4RMFA 4POGA 4N9PA 4PK1A 2ONQA 1V81A 3RNAC 5EBDA 3DCGA 3W1BA 3TP7A 3A8KE 3Q8CA 2F0HA 1YHBA 4OZAA 3MTNB 1KIXA 3T1YQ 2MBQA 4XIGS 2D2QA 4P2CB 3QX1A 2RPVA 2OJWA 2VW9A 3AULA 2JN4A 4DR4Q 4JBKA 4F1SA 4YTPB 2TMPA 5FJ8H 3ZRCA 1C9FA 2WXFA 3ZW3A 2CQAA 3KJOA 1UE7A 2RF4A 1CKNB 1WJUA 1HZAA 2F03A 3NVWA 2KVRA 1WOCA 4DXFA 2UUAL 4M01A 1L0VB 1KJTA 2PZUA 3DWQA 4KTAA 1QWYA 2LUMA 5G55A 2FHTA 5BN4A 4P75A 1EL0A 2VS1A 5G3LD 3P2BA 3HUIA 1FNVA 3K7UC 2A68D 4ABNA 2CWAA 3OIPA 3OMCA 3AU7A 5JVG3 4A3JH 1VF5C 2GB1A 1STEA 1ZXHA 1CQFA 2PZWA 1JQ4A 1HTQA 1C4AA 4PG3A 3DWGC 5GQOA 1VQNA 3KQ4A 4DV0L 3T56B 4J3OD 1IBML 4JI2L 2BA0A 1FFVA 3RYTA 2UUCL 3V96A 3A5ZB 4YWLA 1T3QA 4JV5L 1LUZA 2QILA 4DFAA 4BVUC 3H6MA 2D62A 1EOVA 3ULLA 2K8HA 3AU5A 5IYCG 5A35A 2K14A 1ASZA 1SR3A 2XNAC 3U9OA 4IG7B 4CYEA 2F0KA 4G0NB 3BVGA 4YTNB 4FF2A 2JQOA 4FO2A 1QILA 1PQSA 2BWES 2YU9H 4ANUA 3CMAA 4C3IB 4EQOA 2KHJA 3KYCD 3PS6A 2D5DA 2JJQA 1YVCA 4LUOA 3MAQA 2L05A 1J19A 2LVOA 4HSVA 4LFCQ 2JXTA 4HJ5A 1CSPA 3G48A 1L0WA 3PIOA 4P1CC 3VVWB 4X66L 1NSNS 5FJ8G 3FP9A 1OEYJ 3BU2A 3AFQA 4LF5Q 1OGWA 4LLGM 4OVZA 1JCKB 1SIJA 4RAUC 2LMCA 2C5LC 3OJ4B 1HFNA 3CMMB 3KF6B 4W9GA 1ICWA 1FD7D 4A93G 1KAAA 1OXSC 2DNCA 4KKTA 3X3MA 5JEAH 3GTLB 1QVGA 2WWZA 3T13A 4FULA 3CSTA 1XWEA 5HHDG 4YWKA 2F0GA 1JORA 4H44C 3O65B 5IO9A 4BBSG 2ENBA 1XPRA 1S3SG 2HQLA 3HKZB 2I46A 3K0XA 2F0EA 3MXUA 4A3JG 2E2IB 3QJZA 4DWFA 1NI2A 1KH0A 2FMCA 5AFWA 3U4EG 2FIFA 1N5WA 3LDZE 4IUUA 1NCVA 1B1ZA 4B3SL 3AB5A 4LNKA 1MSGA 4W9HA 2KMMA 1YN4A 1Y69U 3SK4A 2J42A 1L6VA 4XGAB 4TVAB 3HOZG 2JA5H 4IFDH 3TCAA 1D8LA 4JBMA 1EWCA 1VQJA 3MEHA 5C2TB 1LTAD 3PV0A 3F2BA 4LDTD 2KCNA 1X3EA 4DNTB 1ZXIA 1PH9A 3A8JE 4CKCA 4POFA 2K05A 4I6NB 1Q81C 2OEOA 2IWHA 2PQAB 2MW5A 3BYYB 1TU2B 4RGOS 3DPDA 4LF8L 1W3SA 2R61A 4ACFA 3DWPA 3RFZB 3AQQA 1IBKL 1HCZA 2L12A 1WCMB 1FMAD 4HXDA 1A8VA 4W9KA 5IGFA 1SRUA 3K6OA 3VTUA 5HY6A 3KYDD 1HA6A 3E0JA 4DAVA 3NQTA 1XTDA 4X3UA 2YYZA 4W9EA 1U4MA 5LL6X 4WH4A 4X65L 3JAMi 2I07B 3AMZA 3ZXVA 2L55A 3EIVA 4K6LA 5BN3A 5BR8L 3E0EA 1TT5B 5EQ0A 2ZJPA 2QA4A 3HRDD 1B4OA 3U50C 2EY1A 3I91A 4GKJL 3KLSX 3ND9A 1E1OA 1JWUD 5JEAG 4I6LB 3HKSA 4ZUIA 3Q8BA 2JA8H 3SHLA 4AOFA 3NPPA 1E0ZA 3IRBA 1B8AA 4JK1C 5IP9G 2DZMA 2J52A 1SAPA 4LMQD 2KXJA 1BBWA 2FMMA 3HOWG 2AWTA 4NXML 4A3CH 2ZM6L 3OG5A 4LNOA 4CKEA 1AN8A 4IJHA 2MX2A 3HOVH 4J15A 3CD6A 1TR5A 2G1EA 2ZXPA 5G5HA 2MO0A 3ND8A 2KJHB 1BCPC 3E6ZX 1YN3A 3NHEB 3OWEB 2PZTA 1I4PA 5IP7H 4A3FH 1EY5A 2E75C 1SMYD 4A3BH 2UXDL 4B9XA 3NBIA 5JEAJ 1IYVA 4C2MH 2N9KA 3Q3NC 3VUYA 2Y5PA 1R4QB 2KJXA 4WWNA 2JP1A 1FRRA 1FPYA 5E1FA 2KHIA 3CCQA 1C0AA 1VZ8A 2X8XX 2LUEA 4EZKA 3DWAA 5FO9B 1U9RA 2AQ3B 2VB2X 3DOWA 3A5UA 3U52E 2F0NA 1TS3A 2JPHA 3PRMB 1H9KA 2D07B 3CWIA 2K0PA 4MGYE 2BE5C 3WDNA 3VR2A 3IAS1 3H0GB 4JYAQ 3NP8A 1QQRA 1A63A 2EYPA 3BYTB 3ABVB 3S14H 3PQIA 2WB1G 1H9SB 1KNAA 1I6VC 4NPSA 2K5WA 4HJAA 1CZPA 1GNUA 3NOBA 4B0MA 1A5RA 4U68A 4DKAC 5DPTA 4X62Q 3HK0A 3PHXB 4B9KA 1PRTC 2N9XA 4BOSC 1DM0B 1V1PA 1WFYA 2MWSB 3RZDB 5EDSA 1UEAB 4TQUS 2RDHA 3K58A 1UD7A 2PE9A 2YEPF 4JI3Q 1EY0A 4EE2A 4NAWB 1BCPF 4R4OA 1K0SA 3DM3A 2FJ2A 4NXNQ 2JA8G 3L54A 1DOKA 1VZ7A 2R2QA 3V61A 2KCCA 4C7ZA 1VQDA 5JJKA 4A3CG 4A3DH 2W3RA 2PIAA 4ODGA 5DCNA 4C3HH 3PF4A 1SFOB 1V5OA 1HNXL 4F88A 5FLXE 3SU8X 3ZNGC 3RZFA 5BMIA 3MHBA 3HOVG 2UXCQ 2CS4A 2DYMA 3VFKA 3S17H 3D4WA 4UY8C 4JWSC 2WXPA 3SK8A 2K1BA 1YZ6A 4WIPA 3B9JA 4H13C 4HVBA 1OO9B 5D3DA 4A3FG 3I55A 4A3BG 4L8JA 2BCOA 1KRTA 3A9KB 1XLNA 2O6VD 1K50A 3KDFA 2F0IA 1LT3D 4FXDA 4APVA 2FUHB 1HUNA 5JHAA 3QC8B 1UE5A 2PKOA 3HOUH 2QC8A 2WX1A 3PSEB 3IT6B 5D14A 2LVPA 1D5MC 1TIID 2SDFA 2HUGA 3GTQB 1PRTF 5K5PA 1M1KC 3ZO5B 1ZUD2 4DV6L 3T1HL 1GB4A 3HIZA 2LXKA 1JOKA 4IZ8A 2KVMA 4B3ML 2MRPA 2B63H 1Z6HA 3CCRA 2KC1A 4NAMA 2RCNA 4KHPL 2O2VA 4II2B 1ZGUB 1UE1A 2WDTB 1TY0A 1TZ1A 4LTUA 4KKSA 4C80A 4DK6C 3GB1A 4ZQ3A 2J0KA 2N88A 5C1ZA 1SNMA 2Z6KA 4YSYB 3U30A 2NBWB 4DHZE 4QL5A 2KTRB 4CDCC 1T6BX 1UWXA 4PV1C 2J0MA 3GP7A 3U7DA 3VA5A 1Z2MA 2W3SA 1B9MA 4O0AA 3IBEA 1WJ6A 2IO0B 5MPOA 4AJWA 5FO8B 1NY4A 3S16B 4US9A 4A3MH 4IW0A 1XNQQ 5G5GA 1SE8A 4MGKE 2ZNVC 4PNYA 3MHZA 1LO5D 2JRHA 4A3DG 1K3RA 2MA9B 3VA7A 1JRUA 4K5WA 3J9CA 1EQTA 2L00B 3MXNA 4XXEA 1K73C 1XT9B 3LGJA 5FLMG 2K5QA 5M5XB 2K1FA 1OFFA 3CF6E 2Y0SE 1KQSA 2R7ZG 3VR6A 1ET6A 1L0XB 4R1JA 4DUYQ 4C00A 2EIFA 4OGQC 2K6AA 1NMFA 1EZ8A 2XBBC 3W2DA 1TVXA 1PYSB 2EYFA 4GMVA 1RODA 2KQ4X 4PZ6A 3T1YL 4MACA 1CTMA 1G2SA 2PCFB 3DHGC 3HVZA 4A9AA 2QEXA 2IX0A 4DAYB 2IYDB 5IGDA 2LSSA 3ERQA 3HOUG 1ISNA 3T16A 3PO2H 1HQRD 1NYRA 4W9CA 1VQFA 5HGQA 4BAXA 5C0XH 4RH6A 4BY7B 1NNXA 1TGZB 2K22A 3LB8C 4MNOA 5EBCA 4X57B 4EKUA 1I6HH 1WXSA 2IL8A 2UXBQ 5J1ZA 2L52A 2B63G 3G4SA 1TWGB 2BKFA 4RCNA 3NUCA 3U8ZA 4NQKE 5CHFA 1G291 3CKIB 1B9RA 3M4OH 3RN9C 1GKHA 2KAJA 3H7SA 2RHQB 1LQBA 1FNWA 2MNAA 5KNDA 1RD9D 3RD4A 2OJRA 4PYZA 4A3KH 4JPSA 3VR9B 2K8CA 2O2LD 3ZJYC 2L8JA 3P42A 4G7HC 3A7AB 2BWFA 4QIWE 3QIAA 1V1OA 2R92G 2QIEB 3R93A 4RHSA 1FXAA 4FJZA 2EY5A 4XYQA 2NVTB 1JJGA 2DAFA 5EKKA 1E0BA 3HFZB 4A3GB 5NUCA 4W9IA 4YSZB 2KANA 3FPUB 3TP8A 3NTHA 1T5EA 2GI9A 2I38A 1A0IA 1EYCA 3C46A 4WQMA 3QG1A 1OXXK 4DAPA 3L16A 1RIPA 3H94A 2N1WA 2JA7H 4DR1Q 2N9PC 4DV7Q 3I8ZA 5GAHC 3J80E 2XK5B 2Y5BB 3I3TB 1CHQD 5C3JB 1XCTL 4JV5Q 3GZNB 4KGTA 2FBWB 2KQ3A 2EJGC 3TS0A 1CA5A 3C2PA 1XEEA 3R66C 1YHAA 2X38A 1F1HA 1XPUA 4K5XA 2JY6A 3VTWA 3CP0A 1UZXB 1SYCA 2JRIB 4DHZB 4LFCL 4PS8A 4GN4B 3RCZA 3R2IA 4JPBW 2BBCA 2C9OA 4LF5L 3PO2G 3EC8A 1RLFA 3BDOA 1PH3A 1MHWC 1DXMA 4IO9A 3H8HA 1BOSA 5C0XG 4L5RC 2LFNA 4B95A 2R93G 2N0SB 4LUVA 3K80C 2K50A 3GD7A 2C5CA 2BYEA 2L76A 1MSHA 2JEBI 1CZGA 4UP8A 1SYFA 2A6HC 2AWOA 5C4JH 3QOLA 2JEAI 2HE7A 3IG3A 2B2YA 4HN7A 4NNJB 3U9SA 2IDYA 1CT1D 2Q2IA 2CJNA 3G7LA 2E74C 1RFAA 1SE3A 2B8GA 2Y0SB 2ASBA 5LL6S 3RD2A 3PRZA 4JI8L 1LT6D 2XN9C 3BZDB 3UE0A 1CFMA 1S4ZA 3R8BA 3S1QB 4DR6Q 4GIVA 4MJSA 3D6WA 4KV6A 4KLKA 1QZEA 1Y1VB 1I3QH 3NWTA 2VNUD 2LS01 2WDQB 5C0XJ 3ZRFA 4KN7C 1LTTD 3PREA 4ALPA 3W1YA 1PDXA 2G45B 1U4LA 1GC7A 3AE2B 3Q6SA 3PUWA 2RCFA 1VQOA 1WIAA 2WNMA 1V9PA 1F2LA 5H92C 4HMIA 3EECA 4ME3A 2JA7G 4WORA 4RNAA 2YTXA 2KEEA 2VUMH 5IE8A 1D6EC 3BZKA
chains in the Genus database with same CATH topology
4CGYB 4LJZC 4ZRQA 3KF8A 3O13A 3Q22A 4OZBA 1J8IA 3KUPA 2V3PA 4QIWB 5CV4A 3KWLA 4TRDA 5C0XI 1ENAA 3KLRA 2WXLA 2PO4A 3DM1A 4ZYSA 4Y7NB 4XYOA 1XYIA 3DHQA 4RKLA 4NP5A 2BDNA 2HDLA 3QOJA 3S1MB 3FILA 3EROA 3TUOA 1DOLA 1A2UA 2B39A 2JSOA 4J8QA 1QT9A 1XX8A 4NDXA 3ITPA 1V8QA 2M9VA 1K53A 3OMGA 1CM9A 1WTWA 1GUWA 2GRIA 2NN6H 4ME5A 5K36H 5CBAE 4V190 1XTCD 3MZ5A 5IODA 2K9XA 2NZ1D 2WU2B 4NKLA 1JWSD 3PO0A 2NVQB 1C4CA 4XDDA 1D1IA 3P75A 3NBHA 2LMCB 2A5HA 2PQEA 4IQZA 5CR3A 4DXGA 1GHKA 3AE5B 3ZJTA 1JB3A 1UUPA 5FO7B 3URYA 4AQ7A 4XQQA 2WXOA 4TKOB 3FMCA 1OQQA 5DM73 1AYFA 3M3YB 5KIXA 1EOTA 4C3JG 1KRHA 5COYA 1SEBD 1MI0A 3NUHB 2Z4HA 1H9RA 1JRPA 2HDEA 4HKZE 1SJED 4KY6A 2RSNA 5KGUA 5FOBB 4RHRA 2HCIA 5E4WC 4HEDA 1ZDXA 4XE0A 1OQRA 3UI3A 4LAAA 1UNSA 2LJIA 2JXMB 2EXZA 3MA2B 1QG7A 2LGIA 4N59A 1B2TA 4B9WA 3NTKA 2F3WA 1F2ZA 2A69C 4IURA 2NN6G 4R8IA 4M0WA 3DXJC 3P4QB 1GJXA 3VRAB 5HURA 3RPFC 1U4PA 1KDBA 5HI1A 4P6VF 2VXWA 2E2JB 4LK0M 5BMHA 2ON8A 1ZEQX 2TSSA 1QKZA 1FR3A 5M3MB 3AH7A 1HFGA 5EPKA 3EJIA 2DWQA 4XT1B 1XXGA 1HZ6A 1STNA 3PMFA 3ZJUA 3EQLC 1C76A 4BBRB 2GA4B 4IDIA 3GTJB 3ZQ4A 4S3SA 2IX1A 3HS0C 3P4RB 4YSXB 1N61A 1BCPD 2F0MA 1RM6C 1F9QA 3MP9A 2FE8A 2WQYB 4PQXA 3TMEA 2WU5B 3MC0B 2KEDA 1SE2A 3C3LA 3PZ8A 1RDPD 3BDCA 1RWSA 1B3AA 1VCIA 3WOEA 3CHBD 3SVMA 3PIP3 1MVKA 4XT3B 4REZA 1O78A 4FF1A 1PZJD 4DGZA 3MJ5A 3BK1A 3NE5B 1RYJA 1CQVA 2BE5D 2AX5A 1NR4A 3VR8B 3SFDB 4HAEA 4A3IB 3Q0AA 2L11A 1BDOA 1Y8NB 2B2YC 5C5MA 5CC4A 1PRTD 4KKUA 2CJOA 2OXPA 3DUZA 2XRQD 2O5JC 3KBGA 2IGHA 1Q12A 1MI2A 1HXYD 2PW9A 2MJ8A 4EVOA 1HEZE 5IT9E 3U7ZA 4US8A 2OHFA 2F0FA 3P7JA 5C4HA 4Q5VA 1FD6A 1F2RC 4GLSC 1PGBA 3S15B 1SDFA 3V2TA 5FLXL 1EEFD 5A2QL 1ILPA 1KFYB 4A8XC 1PMRA 2WXQA 1SNDA 1WGKA 1E9MA 1BR9A 5IGCA 3PIO3 3GO5A 4YXDB 1HUMA 2F4IA 2BDOA 5M9OA 1P7EA 2E76C 3MXPA 3BVMA 3QB3A 3HOYB 1S5FD 1TKGA 1NR2A 3RMHA 3M85A 1OXTA 5JOBA 4KGRA 3S2HB 3U2SC 4YTMB 1YQ4B 4HR7B 2V0GA 1PLFA 2SEBD 3E56A 2PNRC 2EY6A 1ZYRD 4Q2JA 2BT6A 2D5GA 5EPJA 1EYAA 4FXGC 1AWDA 1FCLA 4A90A 1QOAA 1BMLC 3W5VB 5CV5A 4K2KA 2RMMA 2WINB 1PFDA 1NVID 1HTPA 1IKMA 4IUTA 1G8ZD 3S2DB 4C7YA 1EZ6A 1DD2A 3DEOA 4H7BA 1N5XA 3JAME 3QWNA 3N52A 3P1MA 1XCQL 5ELBA 2BOSA 3M7GA 3NK9A 1TWAB 4XQJA 3AEBB 3IT4B 1K83B 1BNZA 4IALA 2WXKA 3HVDA 3NS1A 4KKIA 3QJYA 2B2TA 1VZ6A 1PXUA 4GDLB 1PUTA 1ESFA 1PFBA 3OSOA 4YIJA 4A55A 3D4RA 1YJIA 2PVGC 3AE6B 2HQEA 5CMDA 4R9WA 1JE4A 2QCPX 1XO3A 2DYOA 5KYLA 1YNJC 5E3FA 3AE7B 3GTPB 1PGXA 1I50B 2EJFC 4QUCA 4KHVA 2EE1A 2F0SA 1SB3C 3LWUA 1F2RI 2O5IC 2INPE 3W3AA 2XWBB 2JYOA 3T3NA 5D65A 3E5SA 4CBVA 2Z4IA 4IFDG 1IBXB 4I7ZC 1Y8PB 2FINB 1SSOA 3W9CB 1H9MA 2B2WA 3RZOB 1TKWB 3J80L 1KDAA 3R3OA 1YQ3B 1F9RA 5CYUA 1TY2A 5AUIA 3QO2A 2SOBA 2RA4A 1ML0D 4KMUC 2DLBA 4IFDJ 3I72A 4ULLA 4DK0A 2A73B 2A6HD 1FFUA 4A93B 4EQPA 5ELEA 1VR9A 2BW2A 4BBSB 5KNCA 3MFYA 3L7ZC 3VYUA 1C79A 5CORA 4A3JB 4KY7A 2MJEA 1PTOH 2L9HA 3RUZA 3M4YA 2F0DA 2LHDA 2ID0A 2JZPA 2JE6I 3HOZB 2D2CC 2WXHA 2V4DA 3WOFA 3PUXA 4K2LA 5J39A 1PTOC 2H88B 1BQQT 1JOQA 2RBMA 2F0VA 4IFDI 5JVH3 4ARCA 2KUMA 1YN5A 1HPCA 4JX1C 3GTKB 2EELA 4FYDA 3NWSA 1M4VA 3HEJA 4BWGB 2WS3B 3GQBA 4OL7A 1XLOA 1Y56A 1J7AA 1EWYC 4WRDA 5EJWA 1HA5A 1VF7A 1QB5D 1QLBB 2XVSA 4OIKA 3FILB 1SNOA 5EKLA 3Q8FA 1GUSA 1ENCA 3T3OA 1GUOA 2SNSA 1QOGA 4C80A 5EE0A 1EY4A 1R4PB 5C6AA 2J7ZA 3X3NA 2F0QA 3HOWB 2Q8RE 5I6WA 4AS1A 4IKGA 2WXMA 1PTOF 1ZYRC 2K01A 5C4ZA 2KN4A 2X69A 3AE3B 1STYA 1TYGB 4C3HG 4FXCA 4MH8A 1C78A 2HTME 1DGJA 2H89B 1EIGA 4KKJA 5CGKA 4DQOC 3VR3A 1LV9A 4WFN3 3I90A 1II3A 1NENB 2XSCA 1PZID 3CU7A 3NZ3A 4K8IA 3AEEB 4B0EA 1IYUA 2EYMA 2B2VA 1F77A 4CKBA 4DK1A 3N9YC 1EU3A 1B9NA 1SNQA 1DZ1A 2EJMA 1ENFA 4U673 1FXIA 1WWTA 4C1NI 2JA8B 2YEPB 1WD1A 1BCPB 5H8YE 5ELFA 1DONA 1KTKA 4I65A 4G7OC 2HDMA 1W6JA 1WVLA 4RF1A 3T53B 4CJ1B 2N7JA 1TS2A 2H1EA 4WURA 3HOVB 1KNEA 1PFMA 2J4XA 2LY7A 4XTCS 1V8CA 4A3FB 2AQ2B 5KRUA 4A3BB 2A69D 1E2VA 5HFYA 2WACA 1WTXA 3EGRA 4O1NA 4RWSC 1A2TA 1JR0D 4O42A 2VZKD 3IAM1 2EZVA 5CV6A 1PRTB 3AE9B 1G2TA 4ZUJA 3I57A 3TZUA 3S14B 3SE0A 2B2TC 1KLGD 1O7ZA 1V43A 1I4XA 1SBBB 3K0YA 3LWEA 2CW0C 2V4IB 1A3TA 1ONLA 4L2YA 2AQ1B 3OHXC 1CA6A 1HRJA 2J0TD 3AM9A 1QE6A 1SYGA 1PDQA 2L1AA 1KLUD 1U4RA 5GXGB 1BO0A 1SNPA 2KWDA 1C8CA 3H09A 2Q8IB 4A3DB 3AEGB 2KHSA 5IGGA 2R7ZB 2F1MA 2JYEA 1FYCA 1YNNC 5CV7A 3PUYA 1IL8A 1RCVD 2EYOA 1KDCA 1DYQA 4KY5A 1F2YA 2B2WC 2Q8TA 2ZT9C 1RTOA 4F7XA 1H9SA 2BS4B 3HOUB 3D6CA 3K5OA 3TEXA 4CHTB 3E9SA 3FPPA 2KA7A 3BK2A 4IUPA 1EIHA 2F3VA 3BS1A 2M0AA 5T1GA 2B63B 4FF4A 1AFPA 2HCCA 5EE1A 4ZK9B 1WTVA 1VDVA 2JSVX 3D8GA 4L23A 4H2AA 1Y8OB 5I9OA 3D31A 3TP6A 4HKQA 4OO1H 2R92B 1JOOA 1HTLD 3CRKC 4KGSA 4ITKA 1F9SA 3NVZA 3A8IE 2V3NA 5C3WA 4DU9A 4XDCA 1WTOA 1YNTE 4YWGG 2RQXA 2JWUA 5IT9L 2EYHA 2B8FA 3M7NA 5LHY1 1I4RA 5JPNC 4NJCA 1JC7A 2ICIA 1UAPA 4HEA1 1Q10A 4XQNA 1L5PA 5F2DA 5IOCA 3GS2A 3PZ7A 2K7VA 4RKBA 2EPBA 3AV8A 3H91A 1D2BA 1SJHD 2IX3A 1RFKA 3P4PB 4IN3A 3PO2B 2W82A 4Q0FA 1F9PA 1FEHA 2VB3X 2R93B 2WV6D 3P20A 4F8MA 3MVVA 1ROEA 1PZKD 1RKNA 3M4OB 4HSPA 2Y5CA 1JALA 1HZ5A 2NBFA 2SNMA 3TEYA 1CJEA 5BN5A 4OO1G 1D5ZC 1WSPA 2IGDA 4B08A 5FR3A 1W6KA 4FNFA 1MHXA 2IPKD 4DAYA 1TJEA 4UAIA 5DM63 3I9V1 4FXKC 4C56C 1BF4A 2JA7B 2L1BA 5K36G 3J81E 1N62A 3J7AV 2AWNA 3OPOA 3IXSA 3ZGZA 3AECB 2QMTA 4OZCA 3JAML 1QOFA 4WWMA 3HZXA 2B2VC 4TSSA 3I4LA 1L4ZB 2J53A 1LABA 1RJTA 4A6QA 2RSOA 1EFID 4ID6A 2X6LA 4UDUC 4RGMA 3NTIA 2K3UA 2AUJD 1EY8A 1YNJD 1FM0D 4OO1I 4C3IG 2Z1CA 3FVQA 1O7YA 2QJLA 2PPBC 2WDVB 3NRZA 3AEDB 4IUVA 3SEBA 1AZPA 1C48A 3NHHA 1JICA 3VR4A 5BYRA 4FP5D 1JWAD 3P4SB 4J6HA 2NN6I 4JBWA 4RFBA 1ZDVA 3I73A 4N58A 2K28A 1QOBA 1A70A 1WRIA 1R9TB 1TZOA 2EKIA 2MJDA 5EGTA 2LFIA 2R6GA 1YMHE 3TEZA 4E6IA 2MP1A 5DEHA 3R2TA 1V1PB 4HMJA 3Q24A 2BTEA 2NYZD 1Q1EA 2OT2A 3OOCA 4C3JB 2F0WA 4L6TB 1WXQA 2FFKB 4C1NK 2WP8J 1EYDA 3I4NB 2K5DA 1QF6A 3SXHA 5BYQA 4NW2A 4KHZA 2BS3B 1Q90A 2NWGA 2JX5A 1UGJA 1TWHB 1C4QA 1ILQA 4ZOHC 2RKSA 3SR6A 1TS4A 4YT0B 1GXDC 1PTOD 2Z8LA 4ILWA 4HCSA 2PYKA 1WTQA 2RVLA 2JU6X 5I9PA 1I4HA 3BWUD 1SSNA 2EDGA 1SYBA 4G57A 2INNE 3MFGA 4XWWA 1EY6A 1JWBD 1LT5D 1KF6B 2JYTA 1I4QA 3A56A 2XIWA 1S5ED 2BYTA 1G6ZA 1JWMD 1N60A 5C44B 4CQNA 4ZLTF 1IW7C 2B2UA 1SF0A 3AE8B 3PO3B 4KI0A 1HQMC 1E10A 4V0BA 2I2YA 3TDQA 1AZQA 1LACA 2F0LA 1G91A 2WP9B 1LLRD 2A74C 3S9WA 1EWHA 4OIJA 5ISRA 1J9OA 4QMGA 4EGVA 2K32A 3PUVA 4HCEA 1IGDA 3AN1A 3I3CA 1NUCA 3NVYA 2WXIA 2CU3A 3FRPB 2VZKB 1QJOA 2BS2B 2CVRA 3RLFA 2MJ3A 1TKEA 3VYSA 1L4DB 1ZPSA 3HP3A 1CK1A 4IUNA 2QF7A 4G4KA 2W54A 5FK9C 3CQZB 3GV6A 2ZW1A 1E2WA 4XWTA 2IJ0A 1J7BA 1SYDA 4AYBB 5M5WB 1DJRD 5LNK1 3B2FA 4R8NA 1D4BA 4K14A 4M8AA 4USAA 3VYRA 1K51A 5D3IB 3K5LA 3OW7A 4KN4C 3A7LA 1LTRD 2A6EC 3AEAB 5D7GA 1GAQB 1UWMA 1TQOA 2WXRA 4RA8A 1XLQA 1FCCC 5JPMC 3KK7A 3DWMA 3P63A 1K8MA 3GTOB 1STHA 2NTTA 4KJOA 2BA1A 2L83A 1C4PA 1C77A 2DY8A 4K5VA 1BXTA 4BA2I 3B2GA 3Q8AA 2NUCA 3N6RA 4QB4A 3ETRA 5I2YA 2JA6B 5DNFA 4F87A 1IGCA 4L1BA 2E3TA 2L0CA 4XDXA 3D4DA 3D3RA 4KX6B 3FAHA 2B76B 3NXWA 3C1EA 1YJJA 2G9HD 2F0TA 2WXNA 2CW0D 4RF0A 4RGTA 3LYYA 4P16A 1F0ZA 3OWFA 1FIQA 3TN2A 2O4XA 1SYEA 5JJZA 5JAVA 5C3XA 2ZXOA 3G6JB 2WXGA 2K33A 4MIUA 4FF3A 1MPEA 1NAPA 1YNND 1NI3A 5HGTA 2QKIC 2NTSA 1DOYA 5IIFA 4R3DA 5EKIA 4PMWA 2A68C 1QNUA 4WJWA 2KOLA 2NB0A 2YU9B 1STBA 3EFXD 5I2XA 3TBIB 1QOHA 5A2QE 2ACZB 1QNKA 2M00A 5I6YA 5C3EB 2JQRB 1EQVA 4Z9CB 1JW9D 2WLBA 4ZHPA 3FEWX 2Q5WD 1DCZA 1S5BD 5KYIA 3I4MB 2QSDA 5ELDA 2F0UA 2DN8A 1SE4A 1A15A 5G3LF 3J7YW 1NYQA 3SR1A 4RCOA 2OEDA 4BS9A 2KECA 4BY1B 1B50A 1ZKOA 1Q1BA 3C1FA 2JA5B 1FRDA 1FO4A 2IT1A 4IOIE 1ZXTA 2K5PA 2LHEA 5C5LA 3LNNA 4EQNA 3DEPA 1ESRA 3A55A 4KD4A 1X32A 1STGA 4QCLA 2BB6A 2K04A 2MGSA 3V05A 1V97A 3AE4B 1FGBD 3T51B 3GTMB 2ICEC 1TWCB 3K7AB 4A3EB 1PYWD 1XF5L 2L5TA 1MD2D 2WB1B 3UI2A 2PVOD 2B2UC 1WTRA 1LTID 4X3TA 3T4AC 1O80A 2NVYB 2F0OA 2E2HB 4M1UB 2E2DC 3MTSA 1Z47A 2L32A 1AP0A 5E6JA 3K5NA 1K52A 2MEKA 4WAFA 1STAA 3K57A 1SNCA 3NSWA 4PMBA 1VDZA 1BBXC 2AUKA 2WIIB 2G9DA 1LTGD 2W55A 2LKVA 2PW5A 3L3OC 1AEXA 1O7LA 1CZWA 4MN3A 2R3ZA 4C2MB 4LK1C 4NZLB 2M56B 4NMZA 2PTLA 3SFEB 1B53A 4X3SA 3J81L 1TS5A 4PMCA 5T1IA 1IKLA 3NQIA 5CV9A 2L4NA 1EY9A 3TZDA 1IUEA 3AE1B 2WAQB 3ZJVA 4CJ0B 3W1SA 4J1MA 1SMYC 1ZE3D 1ET9A 2EYLA 3FKIB 1M8AA 1OXVA 4DNRB 3Q23A 4ZHOA 3IKJA 1N63A 4GDKB 1LT4D 1IBXA 1PTOB 5C4XB 5KNBA 2KDMA 3TEWA 4QF4A 1KABA 1MBYA 4C3HB 5AUKA 1LTSD 2ZXRA 1X3QA 3MWYW 3NVVA 5EPLA 1LTBD 3H3VC 3S17B 1H9JA 5M5YB 2Y3AA 1S5DD 4DF7A 1Y1WB 2WKCA 2MHVA 5IGEA 3GTGB 1Q8IA 2X6GA 3SDZA 4N9TA 2XWJB 1VRAB 5CV8A 3VR5A 4KD3A 5J22A 3KBXA 1XLPA 4MT5A 1DOIA 4PT5A 1A3VA 4ZRZA 1VMCA 2KACA 3FC4A 1I7HA 3HOXB 2M19A 1WTPA 4DA2A 3A54A 2F0JA 1J7CA 5IGBA 5ELCA 3Q69A 3P1HA 4JE3B 1R7SA 4JWUC 1SXTA 3IAYA 1K8OA 4DN4M 4K6DA 3BDLA 1MHHE 3V3XA 4N6EB 2N9LA 2XRSD 5CBEE 3L4PA 4A3MB 1GUNA 5BMGA 3VQIA 4D2KA 3LXFA 1PGAA 1TT2A 1E2ZA 2F0PA 1DOXA 4KJNA 1OXUA 4ZKBB 2MH7A 2OF1A 2M2LA 1WD0A 3PUZA 1TWFB 1GUGA 2D9UA 1F2MA 2MPMA 2EY2A 2EVBA 2QEJC 5DAUA 2NVXB 3SK5A 4OHJA 4K8JA 1A6XA 1B44D 3BIID 1VJKA 4ZAIA 1D5XC 2EOTA 1MGSA 2DNEA 3HRZC 3LX0A 4H0LC 1TKYA 1P7FA 4FVMA 2LEKA 1HHVA 4GZYC 2PMZB 1A3UA 1I6HB 4HRSA 3CRLC 3EVQA 1VMPA 1IW7D 4HROA 2QDBA 3AMUA 4TQ0A 3DMUA 5BYSA 1PFNA 4MHEA 2DBYA 2SAKA 1D1KA 3AEFB 4A3KB 1E6EB 5T8IA 3F2UA 2PW7A 4RGNA 3FDTA 1GUTA 2E6XA 4CJ2C 2N55A 4X3KA 3KWVA 3S1NB 2PMVA 3S1RB 5HG2A 1ZOYB 3IFTA 1ZP0B 1EY7A 3TSSA 1Z7TA 1L0YB 3SK6A 3EUB2 2WDRB 2CHBD 3WCQA 1QCBD 4L63B 1GHJA 1EM7A 1DOMA 1E7PB 2IGGA 2H4OA 3HG9A 1GPXA 3ONAB 3HGBA 2FUG1 4G7ZC 2IW3A 1CHPD 3IFDA 1WYGA 3VYTA 1L6UA 1IHZA 2DY7A 1BUVT 2BB5A 4IUQA 1RHPA 1EEID 2WKDA 1RTNA 4TMAB 5C4JB 3J7AF 1T5XD 1JROA 5EE9A 4TQ1A 4HTHA 4HJGE 3EA6A 1BUIC 4ARIA 3VRBB 3TP5A 5E4XA 5EE3A 2A6ED 4BA1I 3Q8EA 2K03A 5FKAC 3GV3A 4KK7A 1I4GA 5I4DA 5TSSA 4ZKCB 3I70A 1CI3M 1I3QB 2NMQA 1X3PA 2MUYA 3OIQA 4QUFA 2EYJA 4MM3B 3BG3A 4OW0A 2RDFA 1FNUA 2WXJA 1GOZA 3MXGA 1JMLA 2VUMB 5JXVA 4ZRPA 1NEKB 2RDGA 3AB9A 1JQYD 3C8YA 1ACCA 1Q3LA 3L9AX 3W5UB 3ZYYX 1AW7A 5M3FB 3CIRB 3IL8A 1S5CD 2PLPA 5KEEA 1GB1A 1VLBA 1EU4A 2ZW0A 3KLSA 3BVZA 3K59A 1RF2D 3K5MA 4N9PA 2ONQA 5EBDA 3TP7A 3A8KE 3Q8CA 2F0HA 4OZAA 4XIGS 4P2CB 2RPVA 4YTPB 2TMPA 1C9FA 2WXFA 2CQAA 2F03A 3NVWA 4DXFA 1L0VB 2PZUA 3DWQA 4KTAA 1QWYA 2LUMA 2FHTA 5BN4A 1EL0A 5G3LD 3HUIA 1FNVA 2A68D 4ABNA 3OIPA 3OMCA 3AU7A 5JVG3 1VF5C 2GB1A 1STEA 1ZXHA 1CQFA 2PZWA 1JQ4A 1C4AA 3DWGC 3KQ4A 3T56B 4J3OD 2BA0A 1FFVA 3V96A 1T3QA 2QILA 4DFAA 3H6MA 2D62A 5A35A 3U9OA 2XNAC 2F0KA 3BVGA 4YTNB 4FF2A 4FO2A 1QILA 4C3IB 4EQOA 2D5DA 3MAQA 4HSVA 2JXTA 1NSNS 4OVZA 4LLGM 1JCKB 1SIJA 4RAUC 2LMCA 1HFNA 1ICWA 1FD7D 1KAAA 1OXSC 2DNCA 4KKTA 3X3MA 5JEAH 3GTLB 3T13A 1XWEA 5HHDG 2F0GA 1JORA 4H44C 2ENBA 3HKZB 2I46A 3MXUA 2F0EA 2E2IB 1KH0A 2FMCA 5AFWA 3U4EG 1N5WA 4IUUA 1NCVA 1B1ZA 3AB5A 1MSGA 2KMMA 1YN4A 1Y69U 3SK4A 2J42A 1L6VA 4IFDH 1EWCA 3MEHA 5C2TB 1LTAD 3PV0A 2KCNA 4DNTB 1ZXIA 3A8JE 4CKCA 2K05A 2OEOA 2IWHA 3BYYB 1TU2B 4RGOS 2R61A 3RFZB 3DWPA 1HCZA 2L12A 1WCMB 1FMAD 5IGFA 3K6OA 1HA6A 3E0JA 4DAVA 3NQTA 4X3UA 2YYZA 1U4MA 5LL6X 4WH4A 2I07B 3AMZA 2L55A 5BN3A 4K6LA 5EQ0A 3HRDD 1B4OA 2EY1A 3I91A 3KLSX 3ND9A 1JWUD 5JEAG 3Q8BA 4ZUIA 3SHLA 3NPPA 1E0ZA 4JK1C 2J52A 1SAPA 4LMQD 2FMMA 4CKEA 1AN8A 1TR5A 2G1EA 2ZXPA 5G5HA 3ND8A 1BCPC 3E6ZX 1YN3A 3OWEB 2PZTA 1I4PA 1EY5A 2E75C 1SMYD 4B9XA 3NBIA 5JEAJ 1IYVA 2N9KA 2Y5PA 1R4QB 2KJXA 2JP1A 1FRRA 1VZ8A 5E1FA 3DWAA 5FO9B 1U9RA 2AQ3B 2VB2X 3U52E 2F0NA 1TS3A 1H9KA 3CWIA 2K0PA 2BE5C 3WDNA 3VR2A 3IAS1 3H0GB 3NP8A 1QQRA 3ABVB 2EYPA 3BYTB 1H9SB 1KNAA 1I6VC 2K5WA 1CZPA 4B0MA 4U68A 1PRTC 1DM0B 1V1PA 3RZDB 1UEAB 4TQUS 2RDHA 3K58A 2YEPF 1EY0A 4EE2A 4NAWB 1BCPF 2FJ2A 1DOKA 1VZ7A 2KCCA 4C7ZA 2W3RA 2PIAA 4ODGA 1SFOB 4F88A 5FLXE 5BMIA 3MHBA 2DYMA 3D4WA 4JWSC 2WXPA 3SK8A 2K1BA 4WIPA 3B9JA 4H13C 1OO9B 5D3DA 4L8JA 2BCOA 1XLNA 1K50A 2F0IA 1LT3D 4FXDA 1HUNA 2PKOA 3IT6B 5D14A 1D5MC 1TIID 2SDFA 2HUGA 3GTQB 1PRTF 5K5PA 1ZUD2 1GB4A 1JOKA 4IZ8A 2KVMA 1Z6HA 4NAMA 1TY0A 4LTUA 4KKSA 3GB1A 4ZQ3A 2N88A 1SNMA 4YSYB 1T6BX 1UWXA 4PV1C 3GP7A 3VA5A 2W3SA 1B9MA 5MPOA 5FO8B 3S16B 4US9A 5G5GA 4PNYA 3MHZA 1LO5D 3VA7A 4K5WA 3J9CA 1EQTA 3MXNA 4XXEA 5M5XB 2K5QA 1OFFA 3VR6A 1ET6A 1L0XB 4OGQC 2K6AA 1EZ8A 3W2DA 1TVXA 2EYFA 1RODA 2KQ4X 4MACA 1CTMA 1G2SA 2PCFB 3HVZA 4A9AA 2IX0A 5IGDA 3ERQA 3T16A 1HQRD 1NYRA 5C0XH 4RH6A 4BY7B 2K22A 3LB8C 5EBCA 2IL8A 5J1ZA 2L52A 1TWGB 4RCNA 3NUCA 1G291 3CKIB 1B9RA 2KAJA 1FNWA 5KNDA 1RD9D 3RD4A 4JPSA 3VR9B 2O2LD 3P42A 4G7HC 3A7AB 3QIAA 1V1OA 2QIEB 3R93A 4RHSA 1FXAA 2EY5A 4XYQA 2NVTB 5EKKA 1E0BA 4A3GB 5NUCA 4YSZB 3FPUB 3TP8A 3NTHA 1T5EA 2GI9A 2I38A 1EYCA 4WQMA 3C46A 3QG1A 1OXXK 4DAPA 3H94A 3I8ZA 3J80E 1CHQD 5C3JB 1XCTL 4KGTA