2AQ1B

Crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWHGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords T-cell receptor beta chain V
total genus 69
structure length 234
sequence length 234
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aq1B02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2aq1B01
1T5XD 1SJED 2R61A 1I4GA 3OWEB 3V05A 1BXTA 1EEFD 1JQYD 1S5FD 4O1NA 1RD9D 1I4XA 1TY0A 2IJ0A 3DWQA 1S5BD 4C56C 1DJRD 1LTID 1HQRD 2XN9C 3KLSX 4RCOA 1D5XC 1I4PA 1AN8A 3CHBD 2AQ1B 1EFID 1SXTA 1I4QA 5ELCA 1PTOB 2CHBD 2NTTA 1FNUA 1XTCD 1PTOD 1LTTD 1V1PB 4L6TB 4RH6A 1HTLD 4RFBA 5ELFA 1CT1D 5ELDA 1SE2A 4Z9CB 2XNAC 1PZID 1SE4A 1LO5D 1LT4D 3TSSA 1BCPC 1L0XB 5D3DA 2WV6D 1S5ED 3BYYB 3R8BA 1RF2D 1TS3A 4RGOS 1F77A 1SE3A 4DXGA 1LT6D 3BYTB 1JWSD 1JWMD 1YN3A 2AQ3B 4RGMA 1S5DD 1I4RA 1KTKA 4TSSA 1B44D 1DYQA 4RGNA 1PYWD 1RCVD 4ZYSA 1LT5D 4BWGB 2RDHA 1QILA 5D3IB 3W2DA 1KLGD 3R2TA 1D6EC 2QEJC 1FNVA 1ESFA 1EU4A 1L0YB 1KLUD 1PRTB 1JCKB 1TS5A 1YN5A 5ELEA 3DWAA 3URYA 1LTGD 1GOZA 1G8ZD 1LT3D 1UUPA 1PRTD 3BVZA 4RGTA 1LTBD 1LTRD 1ET9A 2ICIA 1LTSD 1CHPD 1FNWA 1HXYD 1D5MC 2TSSA 3O13A 1SBBB 1FD7D 1YN4A 1STEA 1M4VA 1TY2A 4DXFA 5I4DA 4RHRA 3BVGA 2IPKD 3EA6A 1MD2D 4L63B 1RDPD 1V1PA 1PZKD 2XRSD 3BVMA 3MC0B 1AW7A 1D5ZC 1ET6A 1PTOH 1EU3A 1EWCA 4UDUC 4RHSA 3GP7A 1S5CD 1CQVA 1TS4A 1TS2A 1ENFA 2G9HD 3SEBA 1JWUD 1PRTC 2J4XA 1I4HA 1PRTF 1JR0D 5TSSA 3R2IA 4OHJA 3DWPA 1PZJD 5FK9C 1SEBD 2RDGA 3BZDB 1CHQD 1BCPB 1SJHD 2AQ2B 1PTOF 1UNSA 1BCPD 2SEBD 1LLRD 2O2LD 5ELBA 2QILA 1EEID 1LTAD 2NTSA 1B1ZA 1BCPF 1V1OA 1XXGA 4K6LA 3MFGA 2Z8LA 2XRQD 5FKAC 1PTOC 1CK1A 1FGBD 1HA5A 3EFXD 4NZLB
chains in the Genus database with same CATH superfamily
2WP9B 1UE6A 5DEHA 2WB1G 4PYUA 2NVXH 3KUPA 2JA8G 4N9TA 3P1MA 3S1RH 4FN2A 1I4XA 3HOWH 2ZJPA 4RM9A 4GOPB 1DOIA 2F0JA 3FP9A 4QUCA 4Q5VA 1D5XC 2ZCCA 4W9LA 1Q82C 3H6NA 1XPRA 3K81C 2C5LC 3PHXB 4LF8L 1SXTA 4BAXA 1IBLQ 4K0KQ 1STBA 1XTCD 4LNKA 4KX6B 1QG7A 4JVZA 4N9PA 1B4OA 3SK5A 1V81A 2INPE 1PFBA 2KCNA 1WXSA 5BYQA 3RULA 1IBKL 3PO3B 1FXTB 3DVNU 4A93B 1LT4D 4G7ZC 2MBOA 5DNFA 2CU1A 3H8HA 2EYOA 1KD1C 2KQSA 1F2ZA 3CWIA 2ASBA 1DM0B 4JI7Q 1BBWA 2KLGA 4EE2A 3IT4B 4KIKA 1XYIA 1VZ8A 4XYOA 4EOYA 4JL9A 3A5UA 1FR3A 1O7ZA 2NN6I 4TVAB 1WI5A 4UP7A 2AYOB 3OJ4B 4G3XB 2EYMA 1T5EA 4WORA 1E90A 1FL0A 3PQIA 3CMMB 1VQ9A 1V97A 5DCNA 1TIFA 5HFYA 2BYVE 5CV8A 2D3GA 1TWCH 1GUTA 1V8QA 3CCEA 1WTPA 3FC4A 3MTSA 1HTOA 3APFA 3RNGC 1WOCA 2VQEQ 4DK3C 4U673 3J80L 1K8OA 1KDCA 1KDBA 5KNBA 2N7JA 4NW2A 1V9PA 3S17H 1BBXC 1TJEA 2LZ6A 5AZGA 2R7ZB 3QJZA 4CDFC 1PH7A 2OEDA 4G57A 4ZRJA 4KHPQ 1NTGA 1AH9A 3NTHA 1C48A 2N88A 4JWUC 4K7WA 3S24A 3GV6A 2JA5G 2KX0A 1TTNA 2WX0A 3I91A 3EECA 1PVOA 1KHIA 2LVQA 1QVGA 5J3BA 4ICVA 3Q8FA 3AB9A 2I2YA 4CDCC 4GNXA 4AQYL 2EY6A 3EA6A 1SSNA 2HIVA 5KEEA 2J53A 1V49A 3SK8A 2JU6X 2AKWB 4GSWA 4A4IA 4JI5Q 2KCMA 4RCNA 1KXLA 3GZNI 3K9OB 2IT1A 1CM9A 4NNJB 2FAZA 4MGYE 2XIWA 3H3VI 4L1BA 3ABVB 2VS1A 3A5ZB 1WTXA 1GPXA 4N58A 2PZUA 4B3MQ 3RT3B 2M17A 1I4HA 1NMGA 3QWZB 2K1BA 2G9DA 4KD3A 4OHJA 3VR5A 4X64Q 3A9KB 3CIRB 5IP9H 2EVBA 3DEPA 3L17A 1WE7A 1I94Q 1KJTA 1YHBA 2EJGC 1UNSA 5DM73 4NJCA 5HI1A 2B39A 1J7CA 3UINB 4QL5A 4IG7B 3RUIB 2QF7A 2LASA 4X65L 1CKMA 1KF6B 2K3UA 3DBRI 1OXSC 4KIKB 5FR6A 1TBEA 5LXIB 2AUJD 1YNJD 2PKOA 2XRQD 1E7VA 3ZTDA 1GXDC 2Z6BA 5IGCA 4IJLA 4MTNA 1FIQA 1MHXA 1PH4A 1IHZA 3JAML 4JI0L 1XTDA 5A2QL 3A8IE 1I94L 2JEAI 2IY1B 1GUSA 3V61A 1A70A 4WJWA 4HJ5A 4B0EA 3AM9A 1Q8IA 2WINB 3GTPH 4XWTA 4YT0B 3V05A 1OFFA 3W3AA 3GE3C 4H44C 2E6XA 5HHDG 1S3SG 4F88A 4W9FA 5C0XG 2DGYA 1TY0A 4MHEA 1PDQA 5EPJA 1Z47A 2K14A 3U4VA 2B63B 2KMCA 1BQQT 3Q24A 2MHVA 3ALBA 2MBHA 4A3JG 2HT1A 3CHBD 4XC2A 3GE8C 3VR2A 2WDVB 5GROA 4HMJA 1GO3E 2N8NA 4AQYQ 3NSWA 2DJFC 2IBIB 2K28A 1RRBA 3EFCA 4DK0A 4DV2Q 2Q2HA 2O5JC 3AE5B 1KAWA 5DLQE 4DXAB 3S15H 1BKBA 5G5HA 2JYEA 3NWSA 1RYJA 1WH3A 4CHKA 1C1YB 2JYOA 2WV6D 2Y0SG 2RQXA 1Y1VH 3ULJA 3K59A 1HE8A 2MP2B 2OJRA 3ZUNA 1TS3A 1WRIA 2KANA 2QMTA 2G45B 4ZHPA 2B2YC 2YEPB 2GVAA 5C4XG 3T1YQ 1I4RA 1KTKA 3N3KB 4AH6A 2LJIA 5JEAH 1YHQA 2EOTA 4ZYSA 4C7YA 1GHKA 4JI1Q 1OXVA 3HOWG 2CFMA 4LDTD 3CP0A 4HXDA 3TBLD 5FLXL 1QF6A 3QX1A 3ZDTA 4DAVA 4LF4Q 2QEJC 3M4OB 2CW0C 2V3NA 1NBWA 4DK5A 3RMHA 4EGVA 1QLBB 1WGRA 2Z0EB 2HQLA 1N5XA 4GN5A 3U9SA 2RA4A 3NS1A 1JQ4A 1SMYC 2ID0A 4ABNA 4HIDA 4ZRPA 5LXHA 3OHXC 4HEDA 3M62B 1E2VA 3H3VH 3EJIA 4NP5A 5CV5A 1DOYA 3T1HL 1L6UA 4A3CG 3WOFA 5C3WA 2L3ZA 2CH4W 2R93H 5D6JB 3C0RB 4XYQA 2KVRA 4GKJQ 1PH3A 1C78A 1K51A 1FD6A 4OZBA 5KNDA 3BDOA 2V3PA 3E56A 3MC0B 3HOXG 3A9KA 4BBNC 3HS0C 2GMIC 4A3DG 1SNPA 2C9OA 2BYFA 3H7PB 3E5SA 2M1MA 2VNUD 1RTOA 3GB1A 5KRUA 1E8YA 2JF5A 3HRDD 5EKIA 4NXML 4ZYNA 1PA6A 1CI3M 1EYCA 5FK9C 2MBBB 3L9AX 3S1QB 2RPVA 1VCIA 1O7IA 1SJHD 1EL0A 3VAWA 1HA6A 2BYEA 1AE2A 1BCPD 2NBWB 3AEDB 1N33Q 3J81E 2VW9A 3H3VC 1NYQA 2O2LD 3NZ3A 3S16B 3L2PA 3DPDA 2NTSA 3TBIB 1VQEA 1EIFA 4NXMQ 3MZ5A 1JOQA 3FKYA 3D0FA 2ZCBA 1QZEA 5EDSA 3WCQA 4BBRB 3MJWA 2W54A 1RKNA 1VQCA 1KRHA 4BKTA 3ZNHB 2L7RA 4C3HG 3MXUA 3VUWA 1IYVA 2H5XA 2F0LA 4R4CA 3S15B 1KLVA 3VR4A 1Z7TA 1I50B 5KHOA 1S5BD 2PZWA 2HTME 4K5WA 1P98A 1J7AA 4OO1I 3OOCA 3V6EB 5D2MB 4BA2I 2FHTA 1HZBA 3WWVA 1WX7A 3SVMA 1L5PA 2KJRA 3SR1A 4HPLB 3AE4B 4US9A 3JVZX 2PIAA 3UE1A 3J81i 1RTNA 1PGXA 5ELFA 4A90A 3TREA 1VLBA 3JSVA 1NJIC 1CUKA 5M3FH 1WXVA 3DMUA 1M94A 3AEBB 2BWES 3KF8A 1N36L 2VB3X 1IW7D 2LXKA 4LF4L 4EFOA 2UU9L 4GMVA 1XX8A 3MXPA 4RF0A 2G1EA 1RF2D 5C2TB 2E2JB 1F77A 1TU2B 4F87A 2LHDA 2WP8J 2NBUA 4XZ4A 3BJUA 4DV2L 3NHHA 3ZQ4A 1H9KA 2KK8A 5IYDH 3T51B 1VJKA 2KT7A 2OF1A 4GGQA 1QOHA 4FYDA 3PPAA 2DBYA 4K7UA 4M0WA 2EYFA 3I72A 3NP8A 2LXJA 4KGSA 3ENEA 2ZEQA 1LT5D 2B8GA 2RHQB 3HOZB 5M5XH 4LMQD 4I7AA 1GJZA 3R2TA 5KYIA 5LL6X 1EQRA 1QVFA 2UXDQ 1PRTB 2B3GA 5LMNW 1WYGA 3IVFA 4W9KA 4C3IB 3RZDH 2LUMA 2E74C 2WB1E 3A8KE 4IQZA 3TEXA 2YTXA 3RNAC 5FOBB 4HJKA 5FLXE 1H8CA 3DVNV 3BVZA 4TV3A 2DYBA 2DY7A 1C4PA 1O78A 3K0YA 5JAVA 1CHPD 4ARCA 2JP1A 4FLHA 1BVSA 3DHIC 3BY4B 2M9VA 1RWSA 2D3BA 5KHQA 5IGDA 1E1TA 5E4XA 2K5WA 4OEMB 4GNXC 1ZW7A 3T4AC 4HDOA 4J1MA 3AECB 1C9FA 1WJUA 3K57A 2N1WA 1HTPA 2NB0A 1EIHA 2ZJDA 2E8GA 4XQQA 2F4VL 4GIVA 5IGFA 4IOCA 3D6WA 2CQAA 2ICEC 2LFNA 2R7ZH 1OGWA 2QGQA 1DCZA 5COYA 2GI9A 5G55A 3MAQA 1JR0D 3KWLA 2CWAA 2BBCA 4HTHA 4PQXA 4HMIA 1C9OA 1VQMA 3HOYH 1BCPB 3ZJYC 2DZMA 2KWDA 3UDGA 2F0VA 3IAS1 3I8ZA 5CV7A 3TRZA 1V5OA 4ZUJA 2HCCA 1GC7A 2J52A 2N9PC 4GU2A 4DUZQ 1WMHB 3S1MB 2QEXA 5DPTA 5EJWA 3FMCA 3NELA 3Q0AA 2OT2A 1XXGA 4C3IH 2CKZB 3RZDB 3ZXRA 4NB3A 2Z8LA 3KYDD 5FKAC 3RNEC 5JXVA 2Z9HA 3CPFA 3K5MA 4KHPL 2ZXRA 2ZNVC 1R4PB 1O7LA 3FPUB 3DVGY 1P3QU 2F0DA 4PMCA 2IHEA 1ZEQX 2B3AA 5IGGA 1V6EA 2VQEL 2F1MA 3MJ5A 1VQ4A 3ZJUA 2H89B 1S5FD 1ASZA 4W9DA 2BTEA 2IJ0A 2IYDB 1ZP0B 2EY2A 3AQQA 1XNQQ 2IHFA 3U58A 5C4JH 2CR5A 1K9MC 3L4PA 4NQKE 4AQ7A 1KNAA 4ODGA 2RSOA 4DAMA 3GTQH 1PTOB 1YJIA 1ESRA 2LS01 2PO4A 5I6WA 5LMNL 1EYGA 3FVQA 2WXRA 5C3EG 2X6LA 3ZXVA 3S14H 2DNEA 2QCPX 2FMCA 1S3OA 4ZUIA 5C0XI 1FRRA 2GB1A 4KKIA 4NJ7A 4BKSD 1B9NA 2Z0SA 1SE2A 5A35A 3MEFA 2PPBC 2E2IH 4JI7L 1VCBA 1DGSA 5AZHA 2JA5H 1QB5D 3U4ZA 3K6OA 1QUQB 1EM7A 1LO5D 5E7NA 2A5HA 2R92B 4OW0A 1SNDA 2AL3A 2NN6G 3EQLC 3PF4A 2D10A 5IP7H 4S3SA 5KYLA 2D3CA 2N4FA 1YNND 1E0ZA 2A68C 2EPBA 5HGTA 1X3QA 1FCCC 1JMLA 4ANWA 1YN3A 3W1SA 4A3IG 1UEAB 1KOTA 2Q8RE 5C4HA 3R93A 1K83H 2AQ3B 4JV5L 1UGJA 3QK0A 4M8MA 2R2OA 1DYQA 3D4DA 1Q0WB 1PYWD 3C19A 4JI8Q 4C3HB 1C79A 4UY8C 4A3CH 3PRMB 3VFKA 2OQ0A 2JRHA 1GUOA 4CJ1B 4BY1B 3DCGA 1KLGD 3IRBA 1D4BA 2K5NA 4MNOA 1D7QA 4ACFA 4WJQA 1TS5A 2UUAL 2L1AA 1E3PA 5KGUA 3RLFA 3T3OA 3AE8B 5CTRC 1FCLA 1PFMA 4L5QA 3A33B 3MXNA 4LF6Q 2G4SA 4OZCA 4A9AA 2MQHA 5BMGA 4DPGA 2GOWA 3VUYA 4DK6C 3IXSA 4MDKE 2JA9A 4S0RA 1C77A 5JPNC 3DOWA 5LNK1 3H6MA 2UXBL 1X65A 5IYBG 1SB3C 3HOUG 2WHIA 1MHWC 1EUJA 3L13A 2AEHA 2KD0A 1NMFA 1TWAH 2UUCQ 2AHOB 3W5VB 3TS2A 4EZLA 3CC4A 3MP9A 4LJOB 1Q1EA 3UF8A 2VXWA 2LGDA 1C4QA 3MC9A 1WTWA 5HKHA 1YJNA 2NVQH 1ET6A 1KNEA 3OYYA 4HCSA 4A3JB 2I1JA 2N55A 2WU5B 3PIP3 5JH5C 1Y1VG 1E24A 2WDRB 1J8CA 1ENFA 2IO1B 2IDYA 5G2NA 5C3EH 1BF4A 1QVCA 5M3FB 1JALA 1VD2A 1L1OA 1EF1A 4JOIC 2CH4A 1X56A 3NK9A 3TMPB 3PO3G 4ZKBB 2QDBA 3AMUA 3PMFA 4JI0Q 1QUQA 2AQ2B 4XXEA 4J6HA 3HOXH 2SEBD 2G3QB 3QQ8B 1VMCA 2FCMA 1F9PA 4APVA 1WJNA 3MXGA 3J7YW 5IIFA 1SYBA 1V1OA 3NBHA 1WGKA 2LXAA 2MH7A 1F2LA 2PE6B 3TP6A 5EQ0A 2PMVA 1CZGA 1AZPA 2L9HA 1TWGH 1B3QA 2LGIA 4ID6A 2E2HB 4MGIE 5I9PA 4DR6L 3EC8A 1SJED 4LNQA 3QARA 1I4GA 2JWZA 1WTOA 2MLBA 2KACA 4DHJB 4PS7A 2K8BA 3DDCB 4O42A 3S1MH 3KF6A 2H88B 1GHJA 2EXZA 3CPWA 2GVBA 3RNUA 2JYTA 1XPOA 4KDLB 1BNZA 1NEKB 3B08A 4LFBL 4U68A 1XT9B 2GBRA 1A15A 5EKLA 1YI2A 4JBKA 1PTOD 2BW2A 5J17A 1WE6A 4KV2A 5IYBH 3JW0X 4IFDH 5M3FG 4XDXA 1CT1D 3W1SC 3ZVVA 1VQ6A 5CV4A 3QR8A 2IGDA 2FE8A 1WWTA 1HZ5A 2YU9H 2K39A 2OOBB 1JRPA 4JI4L 1OXTA 1S5ED 2CHZA 1S40A 1PGAA 4DXGA 5AUIA 3ML9A 1MPEA 1OQYA 4IC7B 4DV5Q 4H13C 2WAQG 2ZTCA 2L83A 3NS8A 1GD7A 4X66Q 2PEAA 3RLNA 3AI5A 1L1OC 4JI8L 3CMEA 1WXMA 3AV8A 4DR1Q 1VQIA 1EU4A 2Z6KA 2KTRA 4B9KA 4DDGD 1GVPA 2H4OA 4KV6A 3W1GA 1MIUA 3K5OA 3QWNA 4HSPA 4KKSA 4R8IA 5A2QE 4LF5L 3NHEB 3VR9B 5C1ZA 1N34L 1I7HA 3AH7A 5AUKA 4OL7A 3UDXA 1SYCA 3KDFA 1J5EQ 2AWTA 1YHAA 3KQ4A 3NJTA 5BMIA 1DGJA 2C9WB 3GTLB 2X8XX 2A69C 3O13A 2ZTDA 4LF9Q 1YEZA 5CYUA 1A8VA 3F8TA 3PGZA 5HGQA 3KUZA 4GLSC 4NAMA 4PK1A 3U8ZA 2E76C 2X6GA 3LX0A 2F0QA 1VR9A 3D6CA 4KY7A 1PHJA 4HJAA 3NUCA 2VUMH 1I3QB 1ZPSA 1L1OB 3QJYA 3ZW3A 1EY4A 3DLLA 1PTOH 1EU3A 3L7ZC 3FRPB 2FNJB 3QOLA 2MJ8A 4H02A 5K36G 3VYTA 4BKGA 2QDLA 3NTIA 1VMPA 1EY8A 4P74A 4CJ2C 2OHFA 4TKOB 5FO8B 1HR0Q 1V8CA 3KYCD 3BZKA 5DAUA 4DAYB 1JWBD 3CCLA 1DOXA 2KC2A 3WALA 3EN2A 2KA7A 4DV3L 5EPKA 4QMGA 4FXGC 1PH8A 2K52A 2NR2A 5BO4B 3A54A 1BT0A 3FAHA 3RD2A 2A4ZA 4IFDI 3NENA 2DNFA 4YY3L 1N32Q 3AU4A 3NE5B 1KC8C 3E9IA 1AARA 3MHZA 2XEWA 3RNBC 2K32A 3GO5A 3N1YC 5DPRA 5EE0A 1EY5A 1WJ4A 4ANUA 5C4XH 3PUXA 3P4RB 1B9MA 3MFGA 2BVCA 2ZVOA 2YTYA 1XEEA 4Y7NH 2K6AA 1E0BA 3HOYG 1RJTA 2L00B 4QIWE 4YWMA 3J80c 4BY1H 4A3LG 3WAMA 5CBAE 1U0LA 1B2TA 2D3AA 2OQKA 1E9MA 3KK7A 3A7AB 1RD9D 2A68D 4C3IG 4XTCS 1IW7C 1C3TA 4IW0A 1LYLA 3OIPA 1HQMC 3K58A 4QY7A 5JVH3 1WGYA 4MH0E 2IX0A 1R4MB 2AMCB 1MG8A 2MRPA 2NPTB 2CCZA 2DAJA 2BH8A 4IJHA 2D07B 3DBRB 4A3OA 1VDVA 3N6RA 4XX5A 2XNAC 3SU8X 3T53B 3RUZA 1M90C 2GBKA 2CS4A 4ZK9B 1U5KA 1UAPA 1KRTA 5M3MB 2M8SA 1FFVA 1N63A 1WFQA 3V3XA 3PTFC 3VR3A 2QW7A 4L23A 2K8HA 4IUNA 3OWFA 3N9YC 4L5TA 3VRAB 3U4EG 3ZIMA 2KDBA 3CU7A 5M5YB 3U9OA 4DHZB 1AYFA 1TVXA 3H91A 3HHMA 1CTMA 1FRDA 3D8GA 3HOYB 1SNMA 1L4ZB 1NCVA 3ZKJC 4TUUA 2R93B 2XBBC 2L0FA 4MN3A 3NQTA 2OXPA 4OWTB 1CA5A 2VH2A 1EWIA 2KQ7A 1QILA 1Y56A 1NDDA 3M7NA 1H4RA 4BBNF 1D6EC 3N1ZC 2NZ1D 4DR2Q 1FNVA 2F0NA 3X3NA 3S17B 1J0GA 5FJ8H 4ZLTF 3B2FA 3A0JA 1R4NI 2Z4HA 5L37A 3AN1A 4A76A 4LK0M 4K2KA 2WDTB 5LLIA 2PVOD 2FFKB 1X32A 2PPHA 4RGTA 3GTKH 2KN5A 3DBLB 1ET9A 2N7EA 3KUDB 1R4NB 2B8FA 5C6AA 1E6EB 1SBBB 2C7MB 1STEA 3CF5A 1BDOA 4YWLA 2LY7A 2MO1A 1X6OA 4A93G 1MD2D 1V1PA 4B3TQ 4JI6Q 4NJ6A 3VTWA 1MKHA 3D32A 3N30A 3W5UB 2L05A 3HFZB 4K7SA 4RMAA 4RHSA 4X62Q 3AFQA 1ZKOA 3F2CA 1Y8OB 4MM3A 4W9GA 1HZCA 1A63A 2FMMA 1Y14B 2EYLA 4FNFA 4M8AA 4DUZL 1JWUD 3VDYA 4B3ML 1ZDVA 2LFIA 3Q3JA 4LJPB 3HOUH 2WAQB 1E8ZA 5CHWA 5DPWA 5J2RA 2CJOA 3DHQA 3R2IA 3A9JA 1RAXA 3L16A 3V2TA 2EY1A 2O6VA 3GZNB 2ZXOA 1R9TB 4V190 4WJ4A 3R3OA 5CV9A 3IAYA 1YD8U 1EZ6A 1PYBA 2NVYH 4IN3A 2JA6H 3AEEB 1QCBD 3I4LA 4YIJA 5C0XH 4XT3B 1RIPA 4JGHB 3TUOA 1KRSA 2V3SA 2KFKA 4RMFA 4DV1Q 4ANVA 4DWFA 2L55A 2CU3A 4HIKA 2HUGA 1QOFA 4LK1C 1BCPF 2F4VQ 2EZVA 4X64L 4OVVA 3B2GA 3TS0A 4HVBA 5E1FA 3C46A 2L52A 3NQIA 2HD5B 1PTOC 4NY0A 2F52A 2D0OA 1WZ0A 2B2YA 1ENCA 1E8WA 5K5PA 3KWVA 1NAPA 3G48A 4P1CC 5AFWA 1SGHA 5AJ3Q 2PI2E 3CC7A 4QUFA 1L4DB 1ISNA 4XT1B 3NUHB 3S16H 1C76A 4EQPA 3JAMi 3HKZG 4K2LA 1U4RA 3RYTA 1LFDA 1I35A 2D2QA 3N32A 1YNNC 4K14A 1SYEA 3VR8B 1KDAA 2CHBD 4L5SA 3TZUA 3K8AA 4YXDB 3NOBA 2I46A 2Z4IA 3TP5A 4DR3L 1TIID 3AE9B 4JC0A 4PMBA 2KMAA 1N60A 1O7YA 2K25A 3G71A 2PZTA 4M02A 2E75C 3HOUB 3I7FA 2R92H 3RN9C 3K9PB 3S14B 4KSKC 3ZLZA 1XMQQ 1Y8RC 4GS3A 5C0XJ 4HCNB 1BCPC 1L0XB 5BN5A 2ZJQA 3I4MB 3Q2AC 4DAPA 1X3EA 3PZ7A 4TKNA 4IPCA 4RGOS 3FDTA 5D65A 1CSPA 2JJQA 3EVQA 1AZQA 3TL5A 4IM3A 4W9IA 2EY5A 4JCVE 5E4WC 4WWMA 5IKCM 3TP7A 1OTRB 2DWQA 1WD1A 1WGGA 2EE1A 4BBRG 4MJSA 2GBNA 4A3LH 2F0PA 2K04A 4NXNL 5I9OA 3I2ZA 1RCVD 1V2YA 2FCSA 3E9HA 2HIXA 3TN2A 3JAME 4K6DA 1KFYB 2Y5PA 3W2DA 2FUG1 1VQ7A 4GNXB 4AJWA 1CKOA 1DOMA 2J7ZA 1TZOA 2KFJA 3VH3B 2GA4B 2VY3A 1V80A 2WNMA 2RSUA 1YQ3B 4YSXB 1SLJA 4DA2A 2NZHA 4DV7L 2N9LA 3VHTC 2WXQA 1HUMA 2IO3B 3MXNB 1JB3A 4A3IH 3DBHI 4J3OD 2Y3AA 1QNKA 1WZ3A 1K8RB 3O65B 2FUHB 2LRWA 3BWUD 1MSHA 3I57A 2PMZE 3W9CB 1TY2A 2D5DA 4DXFA 4QQBX 1SSOA 4C1NI 3DQVA 3PIOA 4UAIA 4II3B 4WH4A 2M2LA 2ASQA 1VF5C 2KLCA 3NVYA 4AYBB 2W3SA 4JI3L 4JIOU 1EY9A 2LVPA 1GC6A 4XQNA 4WQMA 4X6AH 4KJNA 3GD7A 3I3CA 1TZ1A 3U7DA 4UDUC 4W9EA 2GN5A 1S5CD 4LFAL 2Y0SE 4YY3Q 1N32L 2I5HA 2DN8A 3Q69A 2N0SB 3A4SC 4GDLA 3RLOA 2HDEA 3ZJVA 5GXGB 2D62A 1PZJD 4N59A 2C7NB 3PZ8A 2R93G 2RDGA 3J81c 1C7YA 3KLSA 1ZYRC 4M01A 3UQBA 4KZCA 2MUYA 3PZDA 4WWPA 1YZ6A 1ILPA 2PE9A 4YWGG 2JA7H 4YSYB 2K8CA 2M19A 2WIIB 3TEHB 1TWGB 1A2UA 1PH9A 3HIZA 1JJGA 3A4RA 3ND8A 3Q3MC 2I38A 4NPNA 3GTGB 1WCMG 2Q2IA 3DBSA 1WX9A 4A3KB 2NZOA 2MPMA 2F0WA 3OSOA 1UF0A 1LQBA 1XQQA 3GDEA 3CCUA 1EY7A 1T0QC 3PO3H 3H9DA 3H94A 5C3JB 1H95A 4HJ8A 1IPGA 4LNNA 1QKZA 2FIDA 5JJKA 1WTVA 2OEOA 1QQRA 2RGFA 4F7XA 2NBFA 1XNRQ 4DR4Q 3EGRA 4A3DB 1GB4A 4PZ6A 3ZJTA 2LGYA 4JLCA 4DU9A 3Q8BA 4OWXB 3G6EA 2XTIA 4M00A 1N9WA 1HFNA 1V1PB 3OW2A 4TRDA 1PH1A 4RH6A 2MQJA 2RPQA 1TGZB 3LB8C 4PT5A 1PFNA 5JJIA 3A8JE 1A5RA 4B0MA 1SNQA 1OTCA 3H7SA 1X55A 2K1FA 4PYZA 3T1YL 1EZ8A 1EY6A 1KL9A 3TSSA 4XE0A 4DV5L 1XMOQ 3P4SB 3PUYA 2W9NA 4HJGE 1IBXB 4B3RQ 1OXXK 3B6YA 1MG4A 2KYWA 2K33A 2N3SA 1S4ZA 1LGRA 4EEWA 3I63C 1X3PA 3L54A 1RLFA 3H0GB 2VL6A 2K50A 4BFRA 3J81L 3BYTB 4P7IA 1YOVB 1F9QA 4DV6L 4PZ7A 2LJ5A 1P16A 5JJLA 3AMZA 4HCEA 4RGMA 4Y52H 3GTLH 1QE6A 1D2BA 4L5RC 3M63B 1STYA 2PI2A 3RZFA 4C4VA 1K8GA 3D31A 2M4NA 4AYBE 2PW9A 4XGAB 1TXYA 2VZAA 4GLXA 4LDTB 5DPSA 4GDLB 1ESFA 1SN8A 2V9HA 4GDKB 1MJDA 5EE3A 1I6HB 3VH4B 5ELEA 2WXFA 2F0HA 3DWAA 4RWSC 4BBSH 3F2BA 4B3RL 1GOZA 3Q23A 2ES2A 4HEA1 1IBMQ 4QGUA 1U4AA 1HUNA 4DUYQ 2HCIA 3PO2B 2MEKA 3SDZA 4MSMB 3RPFC 2L4NA 1WTQA 1B3AA 1A6XA 1UGMA 1YQBA 3W5OA 4UPAA 1XWEA 2ZJRA 2DNCA 4E6IA 4IO9A 3PLVA 4DQOC 1C4AA 1Q7YC 1QJOA 5IT9c 3AU5A 1EOTA 1IBLL 3WIMA 2PQAB 4ZHOA 1B8AA 1R7SA 1AEXA 1IL2A 3RFZB 3AULA 5IN7A 2ALYB 2EJMA 1L2NA 1EWCA 3P2BA 4IDIA 3S2DH 4IWPA 4GKKL 2BB6A 2G9HD 1RL2A 3Q8DA 2HTHA 4B9WA 4QJFA 1VQLA 1PRTF 1P1AA 2J0KA 3VTVA 1AE3A 4EQ5A 2K5QA 3DEOA 3I55A 2E2IB 2KTFA 1SEBD 3TJPA 1G6PA 1SNOA 5J22A 3I56A 2WXIA 3VYRA 3M7GA 5CR3A 5HY6A 3ONSA 2K6DB 4CYEA 3CQZH 3HZXA 4A3EB 3IG3A 3M4OH 3KW5B 3HEJA 1YNJC 4POGA 3BZCA 4K81A 3CQZB 2BE5D 2KJHB 2L8JA 3NTKA 4IUMB 1FXAA 4B95A 3RN5A 4X3UA 3ZTCA 5C4XB 3QB3A 2UUCL 2KVZA 2IY5B 5JEAG 1J19A 3Q14C 3G4SA 1WGHA 1YQ4B 4BKSA 1F9SA 2ZXPA 4GDKA 2LMCB 1Y69U 2IGGA 1T3QA 2ON8A 4TMAB 1OEYA 3CRLC 5IYCH 1Q10A 4PNYA 2BF8B 4KLKA 4KGRA 2MFIA 3MHBA 3E0JA 4C80A 2DYMA 3DHGC 2I5MX 1E7PB 4X3TA 2W82A 1JOKA 1W2BA 3HKZE 4HK2A 3F1ZA 4R9WA 1AN8A 1CQFA 4OIJA 2HHHL 2MBEA 1EFID 4ZKCB 2R7ZG 1DD2A 4HRSA 4OVZA 3CF6E 1Q81C 4A3FG 4ARIA 2NWGA 4F8CB 4W9JA 4J15A 3RNCC 4DBGA 4J6IA 2E2HH 4RFBA 3KOJA 3NY5A 1SMXA 3GTMH 4QF4A 4KY5A 3ERQA 3LJ3A 2BA0A 5EE1A 1YIWA 1I50H 3G6JB 4DV0L 3CCVA 3V60A 1FO4A 2NVQB 2B63H 4MGKE 3TEWA 1ZKHA 3I4NB 1XLNA 1LM0A 4RKLA 3S2AA 4G11A 2EMTA 2LWPA 1W3SA 3GQBA 1WYWB 2UYZB 4HDQA 2OTJA 1HZ6A 4R4QA 4ZRQA 4HWIB 2K5VA 4DR7Q 3D3RA 1S5DD 2DUDA 5ELOA 4JYAL 1B44D 3Q8AA 4GXBA 4Y7NB 3Q8CA 2HHHQ 3UDIA 2CQOA 3U52E 4NXNQ 4JWSC 1JWAD 2LSSA 5IE8A 3HM6X 4JOIA 2KECA 4ZCKA 3TZDA 4BXXH 1ZDXA 1HTQA 4FULA 3T16A 4LF7L 4C3HH 2ENBA 1XCQL 2LXCA 2NPTA 2FJ2A 1KLUD 2CVRA 1WGDA 4PS3A 4HCPB 1TKWB 1SMYD 3H0GH 2VQFL 4BS9A 1WF9A 2F0TA 1LTGD 1G8ZD 2Y5BB 3NBIA 5LL6S 4PS8A 3M9BA 3KDFB 4IUPA 1QZHA 3K0XA 3PV1A 1LTBD 5FR3A 4LFBQ 4G0NB 2O5IC 4I65A 1EWYC 2EQSA 1C0AA 1BBUA 2EKIA 4I6LB 4F1SA 1VZ7A 2QDFA 1K3RA 1PH6A 3A55A 1AP0A 3PT2B 1ZYRD 1R9TH 3P20A 1W6JA 1WRDB 3WAOA 1X3FA 4FP5D 2KDMA 1NR2A 5GAHC 1RFAA 2E2DC 3WAPA 4C7ZA 4FXCA 1II3A 3IAM1 3QAQA 2XRSD 2NN6H 1MJCA 1YNXA 4LTUA 4AS1A 4WJ3M 3NZSA 3TMEA 2OCEA 2ZT9C 1CQVA 1TS2A 2B2WC 3QCAA 3Q3NC 3PRZA 4DHZE 2UXCL 3WANA 3AE3B 3HOVG 4G4KA 3P4QB 2JA6B 1T6BX 2QHOA 2XSCA 4OELB 1ML0D 1HNZQ 3AEVA 3PGEA 1NY4A 4M0WB 2K4KA 5M3MG 2Y0SB 4JI2L 1O80A 3DM3A 3RZOH 2FIFA 5L83A 1JROA 3P4PB 1F2MA 1R4MI 1QZGA 2QCZA 4POFA 4LF9L 3Q3FA 5JVG3 3VQIA 4B08A 4P16A 1YITA 2G5DA 2D9UA 4DNTB 2FXQA 2KEDA 2GRIA 1X54A 1TKGA 4DDID 1HH2P 1HA5A 3EFXD 2OWOA 4HLEA 1DXMA 1T5XD 2KOLA 4BOSC 5BR8Q 1IZ6A 2R61A 3IL8A 2Q8TA 4GOPC 3EHVA 3KF6B 3OTOQ 5CV6A 3MVVA 1GB1A 4ZDVA 1EEFD 1B53A 4YCVA 3K80C 4K5XA 1UBIA 3QHTA 1F0ZA 4YSZB 2KOXA 1F2RC 3I4MH 1JT8A 4KHVA 2O2VB 1XLOA 2DZIA 3AEFB 1EWHA 1YX5B 2RBMA 2QIEB 1I4PA 3ECIA 4YTPB 4B6WA 4EKUA 2B29A 3J80i 5IAAC 3IBEA 4OIKA 1QT9A 1QWYA 5EAYA 3R7RA 2KO3A 3M3YH 1P7FA 1WR1A 3OAWA 2BS2B 2E5LL 3I5JC 1FVIA 5CC4A 1HHVA 1XD3B 3UQAA 2JA6G 2BOSA 1SROA 3M3YB 2MO0A 3KJOA 3F2UA 4TQUS 1FFUA 2UUAQ 2J0JA 4HR7B 1SE4A 5IYCG 1VS0A 1XMOL 2C35B 2YYZA 2DHZA 2F0UA 1W6KA 1ZOYB 1V9JA 3PREA 3K7UC 5IOCA 3HOXB 4YL8A 4P71A 3IFTA 3RZWC 1Q86C 3OW7A 3M4YA 2R7FA 2WACA 2SAKA 1JWSD 2K03A 4A3MB 2RMMA 4OONA 4KN7C 4A3FH 2IY0B 3KH0A 5C5LA 3T8MA 1VF7A 1JICA 4RKBA 4UHVA 4RGNA 2J42A 3UE0A 3PUVA 2BKFA 4XWWA 1SIFA 3AEGB 2WU2B 5BMHA 2GBMA 3NXWA 1VDZA 2KENA 3NWTA 5DM63 4MJSB 4ZRIA 1PXUA 4DHJD 2MJDA 1UD7A 1HCZA 1KM7A 1X1MA 2XVSA 1NUCA 3QIJA 1LT3D 3CRKC 4IUTA 3VYUA 4MEMA 3TQYA 1WTRA 5EGTA 1OO9B 4Q0FA 4K0KL 4K3CA 3NPPA 1YJ9A 1ZXTA 4EZKA 1NI2A 3GTOH 3IFWB 2LRUA 3PHWB 4ZRKA 1MVKA 1Q12A 3MC8A 3RN2A 4LUOA 2EJFC 3M3JA 5I4DA 3CD6A 1BO0A 4HAEA 3C2PA 5H92C 5J1ZA 3H1UA 1J9OA 1PZKD 4HIOA 1K8AC 2C7HA 4A3DH 3PSIA 3Q8EA 3UIPB 1X3GA 5J39A 4DFAA 3GP7A 1I3QH 3LXFA 3WA0A 3MFYA 3SEBA 4AWJA 1PRTC 1FJGQ 3DM1A 1LM8B 5BN3A 1PFDA 2IGHA 3GTMB 2B2TC 4QAYA 4C2MH 5GQOA 1GUWA 4K8JA 1E5WA 3JYUA 3N1XC 2F3IA 1TQOA 5JJZA 3V96A 4XQJA 2DLBA 2MHJA 3P42A 4DV3Q 2R2QA 1TWFH 1YVCA 2WAQE 1OQQA 1IKLA 3WOEA 1N5WA 2KHWB 1GG3A 1JW9D 4AP4C 1LTAD 3RMKC 1VQNA 1YIJA 1E2ZA 5IODA 4EQNA 3U2SC 1H9RA 4DR5L 3D4WA 3KBGA 3PV0A 5E3FA 1KIXA 2E3TA 1MHHE 3HVDA 2F3VA 3QO2A 5EBCA 2MP2A 1EQQA 4F7ZA 3ZGZA 1VQFA 5E6NA 1JMCA 2CWPA 1NVID 2ZPNA 3HOVH 4RAUC 5AEKB 1P0RA 2WX1A 4QB4A 4H2AA 3T1HQ 2KQ4X 3A9JB 4DUYL 4O1NA 2EXDA 4IM2A 4JBWA 1UE7A 1ACCA 4LF5Q 2L5TA 4HJ9A 1FEHA 2K9XA 3C8YA 1IYUA 1STHA 4R4TA 3CC2A 4LUZA 2NTTA 3FILB 4N8X1 5G3LF 1WI0A 2JRIB 4JW0A 4OO1H 3PUZA 1HTLD 3T3NA 1EYAA 2O4XA 4JI1L 3KVFB 2O6VD 3SDLC 2A6EC 1BUIC 1H9MA 1D8LA 2INDC 2JEBI 2RVLA 1MI2A 2N78A 3DXJC 5IP4D 3MEHA 1IBML 2PCFB 2M00A 3C3LA 3SFEB 3CCMA 4ME5A 1SE3A 1D3ZA 3NBHB 3GTQB 2D2CC 4E71A 4WWNA 4FXDA 3SFDB 1XCTL 5LMNQ 4KZ0A 4CQNA 5C5MA 4DNRB 4IURA 3SGIA 1SDFA 4LWCA 4B9XA 2LGXA 2IX3A 5D3IB 1F2RI 2K5DA 1Q1BA 3ULLA 1GJXA 1L0YB 1XO3A 2LGSA 2PMZB 1J8IA 2KWVB 1IP9A 1YN5A 2QJLA 4HKZE 2NUCA 3CCQA 3NG0A 5I2YA 2N7DA 2IO0B 3HKZB 3VRBB 1Q5WB 4BY7H 2K01A 1UEBA 1P9DU 4YTNB 5C23A 4MELA 1GUGA 3EUB2 3RD4A 2WWZA 2BDNA 2UUBL 2OTLA 3KF8B 4C1NK 1EFWA 4KVGB 1FD7D 2F3WA 3UIOB 1WJJA 4RF1A 4EZJA 3ZRCA 4DV1L 4IFDG 3OLMD 1B7YB 1ZXHA 2I5LX 3TIXA 3BVMA 2BYTA 4OWWB 3L08A 4DV4Q 4UP9A 3AEAB 1D5ZC 1K3BC 5KIXA 1HNZL 3BS1A 5JEAJ 1A3VA 2F0FA 2WXPA 3X3MA 1S1QB 1IYJB 3ULPA 1HNWL 2JXXA 5FLMG 1B50A 4HSVA 2LVOA 5CORA 2PVGC 1M1KC 4CKBA 2MWSB 1WM3A 4IPHA 2WXGA 4B3TL 4JI2Q 1ILQA 1OEYJ 3HRZC 1N33L 2JWUA 3J9CA 4KKUA 4BZAA 2VUMB 2BQQA 1XJVA 1WM2A 1UE5A 4P6VF 1PQSA 2KHJA 5IGEA 1NENB 2A19A 2BPSA 2A6HD 3J81j 2K5PA 3MWYW 1Z2MA 2XWJB 2YV5A 3J80E 1FGBD 1F9RA 2KAJA 1DZ1A 4FDBA 4BY7B 5MPOA 2NVXB 1WSPA 1N61A 3ND9A 2JK8A 3OWEB 2NS5A 1LXDA 1Y1WG 3PCOB 2B2UA 3VVWB 2F03A 1H9SA 1G51A 3GV3A 4LFAQ 2YU9B 1TWHB 2Z6KC 4AYBG 1DJRD 1LV9A 4QCLA 3AE2B 5IGBA 3N20C 3E6ZX 5H1SE 3STBC 3APDA 2YVCA 2WKDA 1HJPA 5ELCA 3N52A 3LNNA 2RHSB 3TP8A 1KQSA 2JN4A 3PO2G 2I07B 3PF5A 1IYFA 1UWXA 1LTLA 3M85A 2JA5B 1X9NA 3D4RA 1MGSA 3S1NH 2UXBQ 1UELA 3L10B 1B9RA 4H7BA 2YEPF 5IWAQ 3HVZA 1AWDA 1A0IA 3I70A 3I4NH 2UU9Q 2TMPA 3OPOA 1YBYA 5IWAL 5BN4A 2KXJA 4GZYC 3NRZA 4KY6A 1EYDA 1GUAB 2B76B 2L32A 3LYYA 1JWMD 2PNRC 5CGKA 1CKNA 3CKIB 4MZ9A 1L2FA 1VQOA 2EMSA 4MGZE 1V1QA 3NEMA 2J0TD 2D11A 2IL8A 1XMQL 4II2B 1ZUD2 1IBKQ 4GN1A 1YMHE 4P75A 4IWOA 2QC8A 2MNAA 4XYCA 3AE7B 4WRDA 4MTKA 3MHSD 3P63A 1Y1WB 1HEZE 2BS3B 5D94A 4IUVA 4ZQ3A 3P1HA 2PJHA 3CW2C 1VQ5A 3P75A 3APCA 1Q90A 2FCNA 3DVGX 2KWUB 4K5VA 3EBEA 4ME3A 4N9F4 1UH6A 2JZZA 2N1VA 5FLMH 1WD0A 1EOVA 1PRTD 4O2DA 1PMRA 1BOSA 2XGTA 4K8IA 4DNIA 3CMAA 3J7A5 4P2CB 4XDCA 1HXYD 4LAAA 2PW5A 1LUZA 4IKGA 2N49A 4NPSA 5C44G 1SYGA 5M5XB 2NVUI 2H1EA 3QC8B 2KHIA 3F2DA 2B2UC 1NBFC 4TQ0A 3HK0A 3NVVA 3SHLA 1RM6C 4NMZA 2YLMA 3TEZA 1ENAA 3S2HB 1N8RC 2B63G 1EUVB 1TWAB 5GAEC 1HRJA 3FILA 4RG1A 2Z0DB 1B70B 2X69A 4G7OC 4MACA 4Q2JA 4OZAA 1TS4A 2D0PA 3I90A 4NDXA 2Z1CA 4X57B 1A3UA 3VXWA 3RR5A 3PO2H 2L76A 2B2WA 4URKA 5IOIA 2R7DA 1HNWQ 1F52A 1Z9FA 2RSNA 2REXA 5CBEE 2V4LA 4LNOA 3Q6SA 1UWMA 3BZDB 1CHQD 3TDQA 2AX5A 2K6QA 4DV4L 1K0SA 2JZ3B 5BYSA 3VYSA 1UBQA 3KLRA 1WTHA 5G5GA 2WXHA 1CFMA 4AIMA 3HM3A 3RI7C 4HJ7A 2WDQB 1WJ6A 2MJ3A 2L12A 3ONAB 3I3TB 4E3CA 4NAWA 4IUUA 2V4DA 4GN3B 1CK1A 1UE1A 4A3KH 1P7EA 4HPMB 3U30A 4P73A 3E3XA 3HOZH 4LNFA 4YTMB 1N34Q 2JA8H 2M0XA 3JSVB 1H9SB 2L11A 4KJOA 1JE4A 3I9V1 1T9HA 1K73C 2I1KA 3GOEA 3HG9A 2WXNA 3DWQA 4A3BG 3MTNB 4X62L 4N6EB 2EIFA 3ERSX 1LTID 3U50C 1SIJA 4QIWB 2KEEA 3C1FA 2LD9A 3DHHC 3RCZA 4GN4B 2AQ1B 5CMDA 1I4QA 4IPGA 2KDIA 4LNIA 4A6QA 3L3OC 4B3SL 2PYKA 2WXOA 4FBJB 2RR9A 1FPYA 4XIGS 5FO9B 1I5FA 2JSOA 1OXUA 4KI0A 5IY0A 3AU7A 1XF5L 3OMCA 3PRPB 1WYDA 3PLUA 4WAAA 2EYPA 2DENB 2KHSA 2A8VA 3BYYB 3WDNA 1EO6A 3ZDMC 2HD3A 4JG2A 2KC1A 5IA7A 2IZVB 4BBSG 1T0YA 4W9CA 2MW5A 1Q1OA 4OO1G 2ZW0A 2KCCA 1Z6HA 4C3JG 1E7UA 4LF7Q 2R6GA 2ACZB 1HPCA 3OJ3A 4BY7G 5ELNA 1WCMB 3Q3OC 3VA7A 4MT5A 4WJOA 4L2YA 3M4PA 4YWKA 2RCNA 2N9XA 1MSGA 3Q6BA 3ZNID 4JYAQ 4MH8A 3X0WA 2RDHA 2JA8B 4AJYB 2V0GA 4DAYA 1PGBA 4CO7A 2BH2A 4YCWA 3SK6A 2VZKD 5E6PA 2WXLA 1CA6A 4WAFA 3OG5A 1U9RA 4FHKA 3PS6A 4FF1A 3URYA 1SAPA 2HQEA 3E9SA 2Q2TA 2J0MA 1EIGA 3SE0A 1SNCA 2KUMA 4R8NA 1K83B 2I0QA 4IPDA 2HDMA 5T1GA 1MJEA 4DR4L 1MFWA 5I6YA 1K8MA 2W3RA 1TWCB 2JQOA 1DOLA 4X3KA 1HR0W 4FO2A 1T0SC 2R92G 2X38A 1SFOB 1G6JA 4IFDJ 4CGYB 5D7GA 3UI3A 3R7QA 2KCTA 3BU2A 3IT6B 5F2DA 5EKKA 4BBSB 4M1UB 1SF0A 2WYQA 5D14A 2JE6I 4RNAA 1Y8NB 1RHPA 1VQ8A 2KMMA 2UWQA 4MIUA 2ZVNA 1NE3A 4A3IB 3CSFA 4WQOB 2GBJA 4GOPA 2EYJA 4DR5Q 3S2DB 1R4QB 2Q5WD 4CDDC 4ZRZA 4NKLA 1E22A 4ULLA 1LABA 3PIO3 1P8LA 1PTOF 4YCUA 3BIID 2MSED 4FJVB 2QKIC 3IKJA 2BWFA 1ZE3D 1PH5A 1CKNB 1TWHH 3LWUA 1E7ZA 1VQPA 2ZNVB 3A1QA 3DWGC 2JXTA 2KDEB 3A74A 4C3JH 2LHEA 2M56B 2VZKB 1VQJA 3SHQA 1WMHA 1SE9A 4I6PA 2Q8IB 1L7YA 5C3XA 4LF6L 4R4IA 3UDFA 3B0AA 1RODA 2RCFA 1ASYA 5C44B 1ROEA 3HOWB 2HJ8A 2JUOA 5J18A 2KNBA 4JX1C 1HR0L 2V1CC 2F0IA 1NNXA 4ILWA 3R66C 1J5EL 4AUQC 2RF4A 1VQHA 4R1JA 4C56C 2G4DB 3KLSX 2F0GA 4A8XC 2WXJA 2J7QB 3X23A 1VQGA 1K53A 4HIMA 4R3DA 2SNSA 1K0RA 1K52A 3AB5A 5GMVA 4JV5Q 5G3LD 1FNUA 4FHJA 2DX5B 4GKJL 4L6TB 1EIYB 5K36H 3A1QB 4A55A 4I7ZC 1G6ZA 3ER0A 2MCNB 3GTJH 1V86A 2Y5CA 4A93H 4BVUC 3JC66 3VR6A 4C2MB 4OX9L 4W9HA 1CZWA 4KMUC 2IO2B 1DOKA 2E2JH 4H0LC 2K05A 3PSEB 1K28A 3OIQA 1QOAA 3FKIB 4CKEA 3DUZA 1N6ZA 1U4MA 2E5LQ 4IOIE 2EELA 3I4OA 3B1LX 4DN4M 3EIVA 3KLWA 4L8JA 1OQRA 5E6JA 3PVLA 2N9EB 2CHWA 4LF8Q 1IGCA 4KGTA 3HUIA 1TYGB 2FBWB 4X66L 2K5HA 1QNUA 4PZ8A 4ALPA 1JORA 1GKHA 1JE5A 4A3BH 4WJPA 4ANXA 2A73B 2BCOA 4DF7A 4GLVB 1XNQL 4A3PA 4D2KA 5KNCA 1VQAA 2F0MA 4FXKC 1ICWA 3JAMc 4A3BB 4FJYA 1C4CA 3ZNGC 2MP1A 2ATWA 2XK5B 2LUEA 4C00A 1D1KA 1J7BA 2MBQA 2JVCA 5BR8L 1ZGUB 3DBLI 4KN4C 4JE3B 4JI4Q 3BK1A 2B2TA 2L0CA 1IUEA 3BDLA 4A3FB 1LTRD 1KABA 4TQ1A 1J6QA 5FLXc 3CXCA 3RNFC 1Q46A 3KUCB 4KTAA 2TSSA 3HGBA 1JRUA 2QA4A 4MSQB 4IALA 1GUNA 2A69D 3G7LA 2WGSA 5TR5A 1ICFB 4RHRA 2JY6A 2AUKA 2MGSA 3AYHB 5JOBA 3EROA 2K22A 1RDPD 1T0RC 1YJWA 3OTOL 3J7AF 5AJ3L 3FKIG 4YHHL 1AW7A 1CJEA 1NSNS 3I4NG 4LJZC 5JHAA 1XLQA 1H9JA 2IX1A 3IFDA 1V5TA 1PFSA 4C3JB 1WXAA 3AE6B 2L15A 3CSTA 4KHZA 5TSSA 2MA9B 2JQRB 4E74A 1ONLA 2PW7A 2EYHA 3LWEA 1PUTA 2CKHB 2BDOA 4JI6L 4HN7A 2LMCA 4ZOHC 1CSQA 4JPSA 4BXXG 1A2TA 1STNA 4O0AA 3I4MG 1LLRD 2WKCA 2KDFB 5ELBA 2QILA 2EKEC 2WFWA 2F0SA 3H0GG 4X65Q 3W1YA 1Q3LA 1JJ2A 4YHHQ 4HKQA 4K6LA 3TCAA 3W1BA 2A74C 5FJ8G 1PH2A 2UXCQ 1TKYA 3KFUA 4PMWA 1Y8PB 3SR6A 1STAA 2V4IB 3FPPA 1Q8KA 3T56B 3S9WA 3GTKB 2K0PA 3PO0A 2JXMB 2VQFQ 2KTRB 2M0AA 2O2VA 1BXTA 1SRUA 1TWFB 3MA2B 4OXPA 4LLGM 3L0WB 2VH1A 4WWOA 2BS4B 5IO9A 3ITPA 5M3MH 1WX8A 3FHWA 1YJ1A 5LHY1 3RZOB 2A1AA 5IP7G 2Q2UA 2WXKA 3P7JA 5ISRA 3T9LA 5L95C 3H7PA 4NQLB 2LI5A 4JI5L 2KWCA 5M9OA 1GM5A 4EX5A 4A3GG 4KDIC 2INNE 4FVMA 1LTTD 2PQAA 2W55A 4J8QA 2BKRB 3HOVB 5ELDA 2DZJA 4UP8A 2JT4B 4XDDA 1SFOH 1EQTA 1PZID 2RDFA 4V0BA 1VQBA 2LKVA 3S1NB 2BGFA 5E6OA 3BK2A 4DV0Q 2C5CA 5CX3A 2BB5A 1NYRA 1IGDA 4GOCA 1LT6D 1HNXL 1Y1VB 1F9JA 1L0VB 5EE9A 4K1RB 4BA1I 3K7AB 5T8IA 4DR7L 3NZUA 4RM8A 3VDZA 4MM3B 2SOBA 1FYCA 2IW3A 4TSSA 4ZAIA 4CKCA 3GTJB 1PLFA 4OX9Q 3ICEA 1QOGA 2DYOA 2VRRB 1PV4A 4BWGB 1CMXB 2JA7G 1I42A 3LGJA 2FINB 1C8CA 3IHPC 1TR5A 1VQKA 1JB7A 3ETRA 4FA6A 4ITKA 4A3EG 1JCKB 3ZYYX 4EVOA 4I6NB 2KVMA 2WLBA 1G91A 1E2WA 1MI0A 2D5GA 2KZRA 3M95A 2HJ1A 3V62A 5JHBA 3FEWX 4BBRH 3GTGH 4P72A 4S17A 3AXCA 5HG2A 4PV1C 5FO7B 4FF4A 1HFGA 2HE7A 3SK4A 2B2VA 4A3KG 2CJNA 3KJPA 2WB1B 2NYZD 1UZXB 1M4VA 2A6ED 2KQ3A 3S2HH 2QSDA 4DR3Q 2KBNA 5IP9G 3CCJA 1EY0A 4CHTB 2IPKD 1VZ6A 1FMAD 2NVYB 1L6VA 4A3JH 4DK1A 4L63B 2F4IA 4KK7A 1U4LA 3NVWA 4JPBW 4FF2A 1YJJA 5IT9E 3BINA 2K7VA 3KYHC 1EF5A 2F0KA 5CHFA 2L0TA 4A3GH 4JQWC 4REZA 2AL6A 4GB9A 2JSVX 2YTVA 4KD4A 2UU7A 4FF3A 1VRAB 4IM0A 3DWPA 3GTPB 2OJWA 4GLAC 3H09A 5LMUL 4A75A 2NVTH 2FCQA 5H8YE 4IZ8A 1WFYA 2ZW1A 2L1BA 5C44H 2KN4A 2JA7B 1HZ9A 3R3MA 1FJGL 2RKSA 1YX6B 2PNHA 4P1BC 3ZO5B 1SE8A 1Y1WH 2NBVB 4LFCL 2KJ6A 1SYDA 1TKEA 1IL8A 2BE5C 5C4JB 1NR4A 3J7ZC 3CCRA 1FM0D 2MX2A 3B9JA 3SD5A 1SR3A 2F0OA 5GAGC 1BMLC 1XLPA 3GS2A 5M5WB 5JZEB 4EUTA 1KH0A 1JJCB 2C60A 2INCC 1VQDA 3UGBB 1WR6E 2XWBB 4HROA 4GKKQ 2ZM6L 1CZPA 3EFUA 4NZLB 3NVZA 5CHVC 3S1QH 3E0EA 1LACA 4BY1G 2K75A 5JPMC 2EDGA 1XPUA 3L0OA 1JQYD 2ZZPB 1G2SA 1YNTE 2GLSA 4A3EH 2PTLA 4FADA 1TT2A 1GAQB 4DKAC 1HQRD 2PQEA 2XN9C 4RCOA 5EBDA 5I2XA 1BUVT 1G2TA 2UUBQ 1D1IA 5T1IA 1ZXIA 4A3MH 2AWOA 3K7AH 1EQVA 3M4QA 3CAMA 3HKSA 4LUVA 2RDBC 2DAFA 5M5YH 4WJNA 3A7LA 1U4PA 4OVUA 1F1HA 4DV6Q 4IOAA 4CBVA 4A20A 4OGQC 2IWHA 3QA8A 1HNXQ 1WIAA 4Z9CB 3V6CB 4HPPA 1AFPA 2V1YA 4DGZA 5D3DA 3S1RB 2VUMG 4DR1L 4LCDE 1E1OA 2Z59B 4KKTA 3R8BA 4R4OA 2NMQA 3PIPA 4ICUA 4NAWB 1PYSB 4LW1A 2KJXA 1E10A 2JZPA 2CHXA 4USAA 1FGUA 1I6VC 2A6HC 4DR2L 2SNMA 1F2YA 1M8AA 4RA8A 4IUQA 1A62A 3J7AV 2UXDL 2BT6A 2XK5A 4IWQA 3C1EA 1RFKA 3QG1A 2BA1A 5M5WH 1N36Q 4US8A 3TEYA 1UWVA 5EPLA 1Z5SB 2ONQA 2JPHA 1XNRL 3HP3A 1WCMH 4B3SQ 2WXMA 3ZNZB 3VA5A 3QIAA 4CJ0B 2A5UA 2DZKA 2B2VC 3LDZE 3VTUA 4N8FA 1KAAA 3BDCA 3K5LA 1HZAA 1S72A 2PLPA 2N9KA 5HURA 3K5NA 3DBHB 1UUPA 4DR6Q 1WY8A 1I6HH 3OMGA 2ZPYA 3STBD 3U7ZA 4ASWC 1GNUA 4A3GB 2F0EA 3KBXA 2ICIA 5IYDG 5C3EB 1LTSD 2WS3B 3DWMA 1FXIA 1STGA 4CDEC 5NUCA 1FNWA 1TT5B 1D5MC 1MBYA 2P5ZX 5C4ZA 1PDXA 2KX3A 2NVTB 1G291 1YN4A 2VB2X 2MJEA 4KKJA 1BR9A 2DY8A 5GADC 3BVGA 3A56A 4JBJA 2KKCA 3CCSA 4JBMA 1NI3A 2O6VB 4C4VB 3ML8A 1WXQA 4BOZB 2CW0D 2R3ZA 2SDFA 2WQYB 4WIPA 1DONA 1E8XA 3VUXA 1K50A 5AZFA 3SXHA 4X3SA 3PUWA 3H15A 4M8NA 2J4XA 3GTOB 1JOOA 2RD0A 4K3BA 3UI2A 3AFPA 5IT9L 4WFN3 4EQOA 2NCNA 4AOFA 3BG3A 5LMUQ 1WVLA 4PG3A 4FJZA 2AWNA 1A3TA 1IBXA 1V43A 4G7HC 2ZM6Q 1SYFA 2LEKA 3HOZG 3QOJA 3T13A 4JI3Q 3I73A 3FKIH 1JC7A 1L0WA 3AE1B 2ZTEA 4G50A 1EEID 2HDLA 2DJGC 4F8MA 5BYRA 1IXRA 1B1ZA 4LFCQ 1IKMA 4KSLC 4A3MG 4WURA 1N62A 4JK1C 3ZRFA 1QOBA 3Q22A 2KFKB 2JX5A 4DV7Q
chains in the Genus database with same CATH topology
2WP9B 5DEHA 3KUPA 4N9TA 3P1MA 1I4XA 1DOIA 2F0JA 4QUCA 4Q5VA 1D5XC 1SXTA 1STBA 1XTCD 4KX6B 1QG7A 4N9PA 1B4OA 3SK5A 2INPE 1PFBA 2KCNA 5BYQA 3PO3B 4A93B 1LT4D 4G7ZC 5DNFA 3H8HA 2EYOA 1F2ZA 3CWIA 1DM0B 4EE2A 3IT4B 1XYIA 1VZ8A 4XYOA 1FR3A 1O7ZA 2NN6I 2EYMA 1T5EA 4WORA 1V97A 5HFYA 5CV8A 1GUTA 1V8QA 1WTPA 3FC4A 3MTSA 3J80L 4U673 1K8OA 1KDCA 1KDBA 5KNBA 2N7JA 4NW2A 1TJEA 1BBXC 2R7ZB 2OEDA 4G57A 3NTHA 1C48A 2N88A 4JWUC 3GV6A 3I91A 3Q8FA 3AB9A 2I2YA 2EY6A 3EA6A 1SSNA 5KEEA 2J53A 2JU6X 3SK8A 4RCNA 2IT1A 1CM9A 2XIWA 4L1BA 3ABVB 1WTXA 1GPXA 4N58A 2PZUA 1I4HA 2K1BA 2G9DA 4KD3A 4OHJA 3VR5A 3CIRB 2EVBA 3DEPA 2EJGC 1UNSA 5DM73 4NJCA 5HI1A 2B39A 1J7CA 2QF7A 2K3UA 1KF6B 1OXSC 2AUJD 1YNJD 2PKOA 2XRQD 1GXDC 5IGCA 1FIQA 1MHXA 1IHZA 3JAML 5A2QL 3A8IE 2JEAI 1GUSA 1A70A 4WJWA 4B0EA 3AM9A 1Q8IA 2WINB 4XWTA 4YT0B 3V05A 1OFFA 3W3AA 4H44C 2E6XA 5HHDG 4F88A 5C0XG 1TY0A 4MHEA 1PDQA 5EPJA 1Z47A 2B63B 1BQQT 3Q24A 2MHVA 3CHBD 3VR2A 2WDVB 4HMJA 3NSWA 2K28A 4DK0A 2O5JC 3AE5B 5G5HA 2JYEA 3NWSA 1RYJA 2JYOA 2WV6D 3K59A 2RQXA 1TS3A 1WRIA 2QMTA 4ZHPA 2B2YC 2YEPB 1I4RA 1KTKA 2LJIA 5JEAH 2EOTA 4ZYSA 4C7YA 1GHKA 1OXVA 5FLXL 1QF6A 4DAVA 2QEJC 3M4OB 2CW0C 2V3NA 3RMHA 4EGVA 1QLBB 1N5XA 1JQ4A 3U9SA 2RA4A 3NS1A 1SMYC 2ID0A 4ABNA 4ZRPA 3OHXC 4HEDA 1E2VA 3EJIA 4NP5A 5CV5A 1DOYA 1L6UA 3WOFA 5C3WA 4XYQA 1K51A 1C78A 1FD6A 4OZBA 5KNDA 3BDOA 2V3PA 3E56A 3MC0B 3HS0C 1SNPA 2C9OA 3E5SA 2VNUD 1RTOA 3GB1A 5KRUA 3HRDD 5EKIA 1CI3M 1EYCA 5FK9C 3L9AX 3S1QB 2RPVA 1VCIA 1EL0A 1SJHD 1HA6A 1BCPD 3AEDB 3J81E 3H3VC 1NYQA 2O2LD 3NZ3A 3S16B 2NTSA 3TBIB 1JOQA 3MZ5A 3WCQA 4BBRB 2W54A 1RKNA 1KRHA 4C3HG 3MXUA 1IYVA 2F0LA 3S15B 3VR4A 1Z7TA 1I50B 1S5BD 2PZWA 2HTME 4K5WA 1J7AA 4OO1I 3OOCA 4BA2I 2FHTA 3SVMA 1L5PA 3SR1A 3AE4B 4US9A 2PIAA 4A90A 1RTNA 1PGXA 5ELFA 1VLBA 3DMUA 3AEBB 3KF8A 2VB3X 1IW7D 1XX8A 3MXPA 4RF0A 2G1EA 1RF2D 5C2TB 2E2JB 1F77A 1TU2B 4F87A 2LHDA 2WP8J 3NHHA 3ZQ4A 1H9KA 1VJKA 3T51B 2OF1A 1QOHA 4FYDA 2DBYA 4M0WA 2EYFA 3I72A 3NP8A 4KGSA 1LT5D 2B8GA 3HOZB 4LMQD 3R2TA 5KYIA 5LL6X 1PRTB 1WYGA 4C3IB 2LUMA 2E74C 3A8KE 4IQZA 3TEXA 5FOBB 5FLXE 3BVZA 2DY7A 1C4PA 1O78A 3K0YA 5JAVA 1CHPD 4ARCA 2JP1A 2M9VA 1RWSA 5IGDA 5E4XA 2K5WA 1C9FA 3T4AC 4J1MA 3AECB 3K57A 1HTPA 2NB0A 1EIHA 4XQQA 5IGFA 3D6WA 2CQAA 2ICEC 2LFNA 1DCZA 5COYA 2GI9A 3MAQA 1JR0D 3KWLA 2BBCA 4HTHA 4PQXA 4HMIA 1BCPB 2KWDA 2F0VA 3IAS1 3I8ZA 5CV7A 4ZUJA 2HCCA 2J52A 3S1MB 5EJWA 3FMCA 3Q0AA 2OT2A 1XXGA 3RZDB 2Z8LA 5FKAC 5JXVA 3K5MA 2ZXRA 1R4PB 1O7LA 3FPUB 2F0DA 4PMCA 1ZEQX 5IGGA 2F1MA 3MJ5A 3ZJUA 2H89B 1S5FD 2BTEA 2IJ0A 1ZP0B 2EY2A 3L4PA 1KNAA 4ODGA 2RSOA 1YJIA 1PTOB 1ESRA 2LS01 2PO4A 5I6WA 2WXRA 3FVQA 2X6LA 1FRRA 2DNEA 2QCPX 2FMCA 4ZUIA 5C0XI 2GB1A 4KKIA 1B9NA 5A35A 1SE2A 2PPBC 1QB5D 3K6OA 1EM7A 1LO5D 2R92B 2A5HA 4OW0A 1SNDA 2NN6G 3EQLC 5KYLA 4S3SA 1E0ZA 1YNND 2A68C 2EPBA 5HGTA 1X3QA 1FCCC 1JMLA 1YN3A 3W1SA 1UEAB 2Q8RE 5C4HA 3R93A 2AQ3B 1UGJA 1DYQA 3D4DA 1PYWD 4C3HB 1C79A 1GUOA 4CJ1B 4BY1B 1KLGD 1D4BA 1TS5A 2L1AA 5KGUA 3RLFA 3T3OA 3AE8B 1FCLA 1PFMA 3MXNA 4OZCA 4A9AA 5BMGA 3IXSA 1C77A 5JPNC 5LNK1 3H6MA 1SB3C 3W5VB 3MP9A 1Q1EA 2VXWA 1C4QA 1WTWA 1ET6A 1KNEA 4HCSA 2WU5B 4A3JB 2N55A 3PIP3 2WDRB 1ENFA 2IDYA 1BF4A 5M3FB 1JALA 3NK9A 4ZKBB 3AMUA 2QDBA 3PMFA 2AQ2B 4XXEA 4J6HA 2SEBD 1VMCA 1F9PA 3MXGA 3J7YW 5IIFA 1SYBA 1V1OA 3NBHA 1WGKA 2MH7A 1F2LA 3TP6A 5EQ0A 2PMVA 1CZGA 1AZPA 2L9HA 2LGIA 4ID6A 2E2HB 5I9PA 1SJED 1I4GA 1WTOA 2KACA 4O42A 2H88B 1GHJA 2EXZA 2JYTA 1BNZA 1NEKB 4U68A 1A15A 5EKLA 1PTOD 2BW2A 4IFDH 4XDXA 1CT1D 5CV4A 2IGDA 2FE8A 1WWTA 1HZ5A 1JRPA 1OXTA 1S5ED 1PGAA 4DXGA 5AUIA 1MPEA 4H13C 2L83A 3AV8A 1EU4A 2H4OA 4KV6A 3K5OA 3QWNA 4HSPA 4KKSA 4R8IA 5A2QE 3VR9B 1I7HA 3AH7A 5AUKA 4OL7A 1SYCA 3KQ4A 5BMIA 1DGJA 3GTLB 2A69C 3O13A 5CYUA 4GLSC 4NAMA 2E76C 2X6GA 3LX0A 2F0QA 1VR9A 3D6CA 4KY7A 3NUCA 1I3QB 1ZPSA 3QJYA 1EY4A 1PTOH 1EU3A 3L7ZC 3FRPB 3QOLA 2MJ8A 5K36G 3VYTA 3NTIA 1VMPA 1EY8A 4CJ2C 2OHFA 4TKOB 5FO8B 1V8CA 5DAUA 1JWBD 1DOXA 2KA7A 5EPKA 4QMGA 4FXGC 3A54A 3FAHA 4IFDI 3NE5B 3MHZA 2K32A 3GO5A 5EE0A 1EY5A 3PUXA 3P4RB 1B9MA 3MFGA 1XEEA 2K6AA 1E0BA 1RJTA 5CBAE 1B2TA 1E9MA 3KK7A 3A7AB 1RD9D 2A68D 4C3IG 4XTCS 1IW7C 3OIPA 1HQMC 3K58A 5JVH3 2IX0A 1VDVA 3N6RA 2XNAC 3T53B 3RUZA 4ZK9B 1UAPA 5M3MB 1FFVA 1N63A 3V3XA 3VR3A 4L23A 4IUNA 3OWFA 3N9YC 3VRAB 3U4EG 3CU7A 5M5YB 3U9OA 1AYFA 1TVXA 3H91A 1CTMA 1FRDA 3D8GA 3HOYB 1SNMA 1L4ZB 1NCVA 2R93B 4MN3A 3NQTA 2OXPA 1CA5A 1QILA 1Y56A 3M7NA 1D6EC 2NZ1D 1FNVA 2F0NA 3X3NA 3S17B 3B2FA 4ZLTF 2Z4HA 3AN1A 4LK0M 4K2KA 2PVOD 2FFKB 1X32A 4RGTA 1ET9A 2B8FA 5C6AA 1E6EB 1SBBB 1STEA 1BDOA 2LY7A 1MD2D 1V1PA 3W5UB 4RHSA 1ZKOA 1Y8OB 2FMMA 2EYLA 4FNFA 4M8AA 1ZDVA 1JWUD 2LFIA 2WAQB 2CJOA 3DHQA 3R2IA 3V2TA 2EY1A 2ZXOA 1R9TB 4V190 3R3OA 5CV9A 3IAYA 1EZ6A 4IN3A 3AEEB 1QCBD 3I4LA 4YIJA 5C0XH 4XT3B 3TUOA 2L55A 2CU3A 2HUGA 1QOFA 4LK1C 1BCPF 2EZVA 3B2GA 3C46A 5E1FA 2L52A 3NQIA 1PTOC 2B2YA 1ENCA 5K5PA 3KWVA 1NAPA 5AFWA 4QUFA 1L4DB 4XT1B 3NUHB 1C76A 4EQPA 4K2LA 1U4RA 3VR8B 1YNNC 4K14A 1SYEA 1KDAA 2CHBD 4YXDB 3TZUA 2I46A 2Z4IA 3TP5A 1TIID 3AE9B 4PMBA 4DQOC 1N60A 1O7YA 2PZTA 2E75C 3HOUB 3S14B 5C0XJ 1BCPC 1L0XB 3I4MB 5BN5A 4DAPA 3PZ7A 4RGOS 3FDTA 5D65A 3EVQA 1AZQA 2EY5A 5E4WC 4WWMA 3TP7A 2DWQA 1WD1A 2EE1A 2F0PA 2K04A 5I9OA 1RCVD 1KFYB 3TN2A 3JAME 4K6DA 2Y5PA 3W2DA 2FUG1 1DOMA 2J7ZA 1TZOA 2GA4B 2WNMA 1YQ3B 4YSXB 4DA2A 2N9LA 2WXQA 1HUMA 1JB3A 4J3OD 2Y3AA 1QNKA 3BWUD 1MSHA 3I57A 3W9CB 1TY2A 2D5DA 4DXFA 1SSOA 4C1NI 4UAIA 4WH4A 2M2LA 1VF5C 3NVYA 4AYBB 2W3SA 1EY9A 4XQNA 4WQMA 4KJNA 3GD7A 3I3CA 4UDUC 1S5CD 2DN8A 3Q69A 2N0SB 2HDEA 3ZJVA 5GXGB 2D62A 1PZJD 4N59A 3PZ8A 2RDGA 3KLSA 1ZYRC 2MUYA 1ILPA 4YWGG 4YSYB 2M19A 2WIIB 1TWGB 1A2UA 3ND8A 2I38A 3GTGB 4A3KB 2MPMA 2F0WA 3OSOA 1EY7A 3H94A 5C3JB 1QKZA 1WTVA 2OEOA 1QQRA 4F7XA 2NBFA 3EGRA 4A3DB 1GB4A 3ZJTA 4DU9A 3Q8BA 1HFNA 1V1PB 4TRDA 4RH6A 3LB8C 4PT5A 1PFNA 3A8JE 4B0MA 1SNQA 1EZ8A 1EY6A 3TSSA 4XE0A 3P4SB 3PUYA 4HJGE 1IBXB 1OXXK 1B9RA 2K33A 1S4ZA 1X3PA 3H0GB 3J81L 3BYTB 1F9QA 3AMZA 4HCEA 4RGMA 1QE6A 1D2BA 1STYA 3D31A 2PW9A 4GDLB 1ESFA 4GDKB 5EE3A 1I6HB 5ELEA 2WXFA 2F0HA 3DWAA 4RWSC 1GOZA 3Q23A 4HEA1 1HUNA 2HCIA 3PO2B 2MEKA 3SDZA 3RPFC 2L4NA 1WTQA 1B3AA 1A6XA 1XWEA 2DNCA 4E6IA 1C4AA 1QJOA 1EOTA 4ZHOA 1R7SA 1AEXA 3RFZB 2EJMA 1EWCA 4IDIA 2BB6A 2G9HD 4B9WA 1PRTF 2E2IB 2K5QA 3DEOA 1SEBD 1SNOA 5J22A 2WXIA 3VYRA 3M7GA 5CR3A 3HZXA 4A3EB 3HEJA 1YNJC 3CQZB 2BE5D 3NTKA 1FXAA 4X3UA 5C4XB 3QB3A 5JEAG 1YQ4B 1F9SA 2ZXPA 2LMCB 1Y69U 2IGGA 1T3QA 2ON8A 4TMAB 3CRLC 1Q10A 4KGRA 4PNYA 3MHBA 3E0JA 4C80A 2DYMA 1E7PB 4X3TA 2W82A 1JOKA 4R9WA 1AN8A 1CQFA 4OIJA 4HRSA 1EFID 4ZKCB 1DD2A 4OVZA 4ARIA 2NWGA 4RFBA 4QF4A 4KY5A 3ERQA 2BA0A 5EE1A 3G6JB 1FO4A 2NVQB 3TEWA 3I4NB 1XLNA 4RKLA 3GQBA 1HZ6A 4ZRQA 3D3RA 1S5DD 1B44D 3Q8AA 4Y7NB 3Q8CA 3U52E 4JWSC 1JWAD 3TZDA 2KECA 1ZDXA 3T16A 2ENBA 1XCQL 2FJ2A 1KLUD 2CVRA 1TKWB 1SMYD 4BS9A 2F0TA 1LTGD 1G8ZD 3NBIA 5LL6S 4IUPA 1LTBD 5FR3A 2O5IC 4I65A 1EWYC 2EKIA 1VZ7A 3A55A 1AP0A 1ZYRD 3P20A 1W6JA 4FP5D 2KDMA 1NR2A 2E2DC 4C7ZA 4FXCA 1II3A 3IAM1 2XRSD 2NN6H 4LTUA 4AS1A 3TMEA 2ZT9C 1CQVA 1TS2A 2B2WC 3AE3B 4G4KA 3P4QB 2JA6B 1T6BX 2XSCA 1ML0D 2Y0SB 1O80A 1JROA 3P4PB 1F2MA 3VQIA 5JVG3 4B08A 4P16A 2D9UA 4DNTB 2KEDA 2GRIA 1TKGA 1HA5A 3EFXD 1DXMA 1T5XD 2KOLA 2R61A 3IL8A 2Q8TA 5CV6A 3MVVA 1GB1A 1EEFD 1B53A 1F0ZA 4K5XA 4YSZB 1F2RC 4KHVA 1XLOA 3AEFB 1EWHA 2RBMA 2QIEB 1I4PA 4YTPB 4OIKA 1QT9A 1QWYA 1P7FA 2BS2B 5CC4A 1HHVA 2BOSA 3M3YB 1FFUA 3F2UA 4TQUS 4HR7B 1SE4A 2YYZA 2F0UA 1W6KA 1ZOYB 5IOCA 3HOXB 3IFTA 3OW7A 3M4YA 2WACA 2SAKA 1JWSD 2K03A 4A3MB 2RMMA 4KN7C 5C5LA 1VF7A 1JICA 4RKBA 4RGNA 2J42A 3PUVA 4XWWA 3AEGB 2WU2B 5BMHA 3NXWA 1VDZA 3NWTA 5DM63 1PXUA 2MJDA 1HCZA 2XVSA 1NUCA 1LT3D 3CRKC 4IUTA 3VYUA 1WTRA 5EGTA 1OO9B 4Q0FA 3NPPA 1ZXTA 1MVKA 1Q12A 2EJFC 5I4DA 1BO0A 4HAEA 3C2PA 5H92C 5J1ZA 1J9OA 1PZKD 3Q8EA 5J39A 4DFAA 3GP7A 3LXFA 3MFYA 3SEBA 1PRTC 3DM1A 5BN3A 1PFDA 2IGHA 3GTMB 2B2TC 1GUWA 4K8JA 5JJZA 1TQOA 4XQJA 3V96A 2DLBA 3P42A 1OQQA 1IKLA 3WOEA 1N5WA 1JW9D 1LTAD 1E2ZA 5IODA 4EQNA 3U2SC 1H9RA 3D4WA 3KBGA 3PV0A 5E3FA 2E3TA 1MHHE 3HVDA 2F3VA 3QO2A 5EBCA 3ZGZA 1NVID 4RAUC 4QB4A 4H2AA 2KQ4X 4O1NA 4JBWA 1ACCA 2L5TA 1FEHA 2K9XA 3C8YA 1IYUA 1STHA 2NTTA 3FILB 5G3LF 4OO1H 3PUZA 1HTLD 3T3NA 1EYAA 2O4XA 2A6EC 1BUIC 1H9MA 2JEBI 2RVLA 1MI2A 3DXJC 3MEHA 2PCFB 2M00A 3C3LA 3SFEB 4ME5A 1SE3A 3GTQB 2D2CC 4FXDA 3SFDB 1XCTL 4CQNA 5C5MA 4DNRB 4IURA 1SDFA 4B9XA 2IX3A 5D3IB 1F2RI 2K5DA 1Q1BA 1GJXA 1L0YB 1XO3A 2PMZB 1J8IA 1YN5A 2QJLA 4HKZE 2NUCA 5I2YA 3HKZB 3VRBB 2K01A 4YTNB 1GUGA 3EUB2 3RD4A 2BDNA 4C1NK 1FD7D 2F3WA 4RF1A 4IFDG 1ZXHA 3BVMA 2BYTA 3AEAB 1D5ZC 5KIXA 3BS1A 5JEAJ 1A3VA 2F0FA 2WXPA 3X3MA 1B50A 4HSVA 5CORA 2PVGC 4CKBA 2WXGA 1ILQA 2JWUA 3HRZC 3J9CA 4AQ7A 4KKUA 2VUMB 4P6VF 5IGEA 1NENB 2A6HD 2K5PA 3MWYW 2XWJB 3J80E 1FGBD 1F9RA 2KAJA 1DZ1A 4BY7B 5MPOA 2NVXB 1WSPA 1N61A 3ND9A 3OWEB 2B2UA 2F03A 1H9SA 3GV3A 2YU9B 1TWHB 1DJRD 1LV9A 4QCLA 3AE2B 5IGBA 3E6ZX 2WKDA 5ELCA 3N52A 3LNNA 3TP8A 2I07B 1UWXA 3M85A 2JA5B 3D4RA 1MGSA 4H7BA 2YEPF 3HVZA 1AWDA 3I70A 2TMPA 3OPOA 5BN4A 4GZYC 3NRZA 4KY6A 1EYDA 2B76B 2L32A 3LYYA 1JWMD 2PNRC 5CGKA 3CKIB 2J0TD 2IL8A 1ZUD2 1YMHE 3AE7B 4WRDA 3P63A 1Y1WB 1HEZE 2BS3B 4IUVA 4ZQ3A 3P1HA 3P75A 1Q90A 4K5VA 1WD0A 1PRTD 1PMRA 1BOSA 4K8IA 4P2CB 4XDCA 1HXYD 4LAAA 2PW5A 4IKGA 5M5XB 1SYGA 2H1EA 2B2UC 4TQ0A 3NVVA 3TEZA 3SHLA 1RM6C 4NMZA 1ENAA 3S2HB 1TWAB 1HRJA 3FILA 2X69A 4G7OC 4MACA 4Q2JA 4OZAA 1TS4A 3I90A 4NDXA 2Z1CA 1A3UA 2B2WA 2RSNA 5CBEE 3Q6SA 1UWMA 3BZDB 1CHQD 3TDQA 2AX5A 5BYSA 3VYSA 3KLRA 2WXHA 1CFMA 2WDQB 2MJ3A 2L12A 3ONAB 4IUUA 2V4DA 1CK1A 1P7EA 4YTMB 1H9SB 2L11A 4KJOA 1JE4A 3I9V1 3HG9A 2WXNA 3DWQA 4N6EB 1LTID 1SIJA 4QIWB 2KEEA 3C1FA 2AQ1B 5CMDA 1I4QA 4A6QA 3L3OC 2PYKA 2WXOA 4XIGS 5FO9B 1XF5L 2JSOA 1OXUA 4KI0A 3AU7A 3OMCA 2EYPA 2KHSA 3BYYB 3WDNA 4OO1G 2ZW0A 2KCCA 1Z6HA 4C3JG 2R6GA 2ACZB 1HPCA 4MT5A 1WCMB 3VA7A 4L2YA 1MSGA 4MH8A 2RDHA 2JA8B 2V0GA 4DAYA 1PGBA 3SK6A 2VZKD 2WXLA 1CA6A 4WAFA 1U9RA 4FF1A 3URYA 1SAPA 2HQEA 3E9SA 1EIGA 3SE0A 1SNCA 2KUMA 4R8NA 1K83B 2HDMA 5T1GA 5I6YA 1K8MA 2W3RA 1TWCB 1DOLA 4X3KA 4FO2A 2X38A 1SFOB 4IFDJ 4CGYB 5D7GA 3UI3A 3IT6B 5F2DA 5EKKA 4BBSB 4M1UB 1SF0A 5D14A 2JE6I 4RNAA 1Y8NB 1RHPA 2KMMA 4MIUA 4A3IB 2EYJA 3S2DB 1R4QB 2Q5WD 4ZRZA 4NKLA 4ULLA 1LABA 3PIO3 1PTOF 3BIID 2QKIC 3IKJA 1ZE3D 3LWUA 3DWGC 2JXTA 2M56B 2LHEA 2VZKB 2Q8IB 5C3XA 1RODA 5C44B 1ROEA 3HOWB 4JX1C 2F0IA 4ILWA 4C56C 3KLSX 2F0GA 4A8XC 2WXJA 1K53A 4R3DA 2SNSA 1K52A 3AB5A 5G3LD 1FNUA 4L6TB 5K36H 4A55A 4I7ZC 1G6ZA 2Y5CA 3VR6A 4C2MB 1CZWA 4KMUC 1DOKA 4H0LC 2K05A 3OIQA 1QOAA 3FKIB 4CKEA 3DUZA 1U4MA 4IOIE 2EELA 4DN4M 4L8JA 1OQRA 5E6JA 1IGCA 4KGTA 3HUIA 1TYGB 2FBWB 1QNUA 1JORA 2A73B 2BCOA 4DF7A 4D2KA 5KNCA 2F0MA 4FXKC 1ICWA 4A3BB 1C4CA 2MP1A 1D1KA 1J7BA 4KN4C 4JE3B 3BK1A 2B2TA 2L0CA 1IUEA 3BDLA 4A3FB 1LTRD 1KABA 4TQ1A 4KTAA 2TSSA 3HGBA 4IALA 1GUNA 2A69D 3G7LA 4RHRA 2AUKA 2MGSA 5JOBA 3EROA 2K22A 1RDPD 3J7AF 1AW7A 1CJEA 1NSNS 4LJZC 1XLQA 1H9JA 2IX1A 3IFDA 4C3JB 3AE6B 4KHZA 5TSSA 2JQRB 1ONLA 2PW7A 2EYHA 3LWEA 1PUTA 2BDOA 2LMCA 4HN7A 4ZOHC 4JPSA 1A2TA 1STNA 1LLRD 2WKCA 5ELBA 2QILA 2F0SA 1Q3LA 4HKQA 4K6LA 2A74C 1TKYA 4PMWA 1Y8PB 3SR6A 1STAA 2V4IB 3FPPA 3T56B 3S9WA 3GTKB 2K0PA 3PO0A 2JXMB 2M0AA 1BXTA 1TWFB 3MA2B 4LLGM 2BS4B 3ITPA 5LHY1 3RZOB 2WXKA 3P7JA 5ISRA 5M9OA 2INNE 4FVMA 1LTTD 2W55A 4J8QA 3HOVB 5ELDA 4XDDA 1EQTA 1PZID 2RDFA 4V0BA 2LKVA 3S1NB 3BK2A 2C5CA 2BB5A 1NYRA 1IGDA 1LT6D 1Y1VB 1L0VB 5EE9A 5T8IA 4BA1I 3K7AB 4MM3B 2SOBA 1FYCA 2IW3A 4TSSA 4ZAIA 4CKCA 3GTJB 1PLFA 1QOGA 2DYOA 4BWGB 2FINB 1C8CA 1TR5A 3ETRA 4ITKA 1JCKB 3ZYYX 4EVOA 2KVMA 2WLBA 1G91A 1E2WA 1MI0A 2D5GA 3FEWX 5HG2A 4PV1C 5FO7B 4FF4A 1HFGA 3SK4A 2B2VA 2CJNA 2WB1B 2NYZD 1M4VA 2A6ED 2KQ3A 2QSDA 1VZ6A 1EY0A 4CHTB 2IPKD 1FMAD 2NVYB 1L6VA 4DK1A 4L63B 2F4IA 4KK7A 1U4LA 3NVWA 4FF2A 1YJJA 5IT9E 2K7VA 2F0KA 4REZA 2JSVX 4KD4A 4FF3A 1VRAB 3DWPA 3GTPB 3H09A 5H8YE 4IZ8A 2ZW1A 2L1BA 2KN4A 2JA7B 2RKSA 1SYDA 1TKEA 1IL8A 2BE5C 5C4JB 1NR4A 1FM0D 3B9JA 2F0OA 3GS2A 1BMLC 1XLPA 5M5WB 1KH0A 2XWBB 4HROA 1CZPA 4NZLB 3NVZA 1LACA 5JPMC 2EDGA 1JQYD 1G2SA 1YNTE 2PTLA 1TT2A 1GAQB 1HQRD 2PQEA 2XN9C 4RCOA 5EBDA 5I2XA 1BUVT 1G2TA 1D1IA 5T1IA 1ZXIA 2AWOA 1EQVA 3A7LA 1U4PA 4CBVA 4OGQC 2IWHA 4Z9CB 1AFPA 4DGZA 5D3DA 3S1RB 4KKTA 3R8BA 2NMQA 4NAWB 2KJXA 1E10A 2JZPA 4USAA 2A6HC 1I6VC 2SNMA 1F2YA 1M8AA 4RA8A 4IUQA 2BT6A 3J7AV 3C1EA 1RFKA 3QG1A 2BA1A 4US8A 3TEYA 5EPLA 2ONQA 3HP3A 2WXMA 3VA5A 3QIAA 4CJ0B 2B2VC 1KAAA 3BDCA 3K5LA 2PLPA 2N9KA 5HURA 3K5NA 1UUPA 3OMGA 3U7ZA 4A3GB