2AQ1B

Crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWHGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell receptor beta chain V
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 69
structure length 234
sequence length 234
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aq1B02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2aq1B01
1I4PA 3KLSX 1PTOD 3MFGA 1L0XB 1SEBD 1FGBD 1PZID 3OWEB 2TSSA 1JWMD 1STEA 3DWAA 4L63B 2Z8LA 1UUPA 1DJRD 1CHPD 1AW7A 1LTGD 4TSSA 1EFID 2AQ3B 1HTLD 4RGMA 1LO5D 1I4HA 1HXYD 2QILA 5ELDA 1FD7D 4RCOA 1JQYD 4Z9CB 1QILA 1UNSA 2NTTA 1D5MC 4ZYSA 3EFXD 1M4VA 1SE4A 4DXGA 1ENFA 1V1PB 1TS5A 3SEBA 1YN3A 1YN4A 1TS4A 1LTRD 1CK1A 1XTCD 1TY2A 1LLRD 3EA6A 3R2TA 4L6TB 1JWSD 1LTTD 3BVZA 3DWPA 1JR0D 5I4DA 1F77A 3TSSA 1RCVD 4C56C 1LTAD 1L0YB 2XNAC 1PRTB 2NTSA 1V1PA 4UDUC 1I4RA 3BYTB 1SJHD 2XRSD 2XRQD 1CQVA 1PTOC 1HQRD 1LT4D 3BVMA 5ELFA 1TY0A 1PZJD 3BVGA 3W2DA 1YN5A 2AQ1B 3CHBD 1FNWA 1FNVA 1SJED 1EU4A 1LTSD 1S5CD 3O13A 1MD2D 2XN9C 4K6LA 1PTOH 1PRTF 4DXFA 1AN8A 1PRTD 1D5ZC 1BCPC 5ELCA 2AQ2B 4RFBA 3URYA 1I4QA 1EEID 1S5DD 2SEBD 2IPKD 3BZDB 1TS2A 1KLGD 3MC0B 1CHQD 1PYWD 2ICIA 2O2LD 1I4GA 4RHRA 1XXGA 1DYQA 1SE3A 1ESFA 1FNUA 1KTKA 4RGNA 3V05A 3R2IA 1G8ZD 3GP7A 4OHJA 5D3IB 5ELBA 4RH6A 1I4XA 1SBBB 1SE2A 1LT6D 1LTID 2CHBD 2J4XA 3DWQA 5FK9C 1CT1D 2RDGA 1D5XC 1JWUD 1LT3D 5TSSA 1EEFD 4RHSA 1EWCA 1LT5D 2RDHA 1T5XD 1JCKB 5FKAC 1HA5A 1LTBD 1SXTA 1ET9A 2IJ0A 1S5FD 1ET6A 1D6EC 2G9HD 1B1ZA 1PZKD 1RF2D 1PTOB 5ELEA 1PRTC 2WV6D 1EU3A 2R61A 2QEJC 1BCPF 3BYYB 1BCPD 1GOZA 4NZLB 1KLUD 1TS3A 1B44D 3R8BA 5D3DA 1V1OA 1S5BD 1RD9D 1BXTA 1RDPD 4BWGB 1S5ED 4RGOS 1BCPB 4O1NA 4RGTA 1PTOF
chains in the Genus database with same CATH superfamily
1GD7A 2KFJA 3NWTA 3DBLB 2C7MB 2FXQA 1ZE3D 3BDOA 3ZJYC 1DOIA 3H1UA 3U7DA 1GJXA 1J6QA 4LK1C 2PW5A 4XIGS 3J7A5 4K7UA 2AWTA 4OVUA 3SHQA 3W9CB 4JI5Q 4IFDI 3L7ZC 3AM9A 2BWFA 1DOKA 3U9SA 3RD4A 3K80C 4PS7A 3AI5A 3DXJC 4R1JA 4JC0A 4WJ4A 3NELA 3JAMi 1LO5D 3A7AB 1X3EA 4AUQC 1VQKA 4QF4A 4IURA 3ICEA 3PGZA 5FLXc 2FCNA 3H6NA 3GTPB 4MACA 4KHPL 5CGKA 1N60A 3EFXD 4ZAIA 4A93B 2NN6H 1Y8OB 1WH3A 3LGJA 4FJYA 3TZDA 4TQ0A 1XT9B 2VRRB 1NE3A 2N7JA 1OO9B 3NPPA 3OLMD 3EA6A 2MFIA 2EJGC 2GB1A 3Q3JA 1YJWA 1Y14B 3R3OA 4DBGA 2MWSB 1L0YB 3J80E 1X55A 4XQNA 3A1QB 1JWAD 1SJHD 2N1WA 1F52A 1TKWB 3D0FA 4CDFC 1WYGA 3OOCA 4MH8A 3HIZA 4OW0A 2VZAA 3GQBA 1G2SA 3KF6B 4MJSB 1JMCA 1P8LA 2LUEA 1C3TA 1Q0WB 3GTGB 3RR5A 2KWCA 1CZPA 4NXMQ 2UXDL 4BFRA 5JJKA 1YQBA 4A9AA 1XWEA 2M0AA 2WXQA 3MHZA 1NR2A 3BU2A 1TWHB 2KTFA 3GD7A 4BXXH 1Z7TA 4A20A 2ZXOA 3A5UA 2JT4B 4MHEA 1I6HB 1GO3E 1PYWD 4PG3A 4KGTA 3N52A 2N0SB 4LF6L 1FNUA 2R3ZA 1CI3M 3R2IA 2WNMA 3W1SC 2LI5A 3WOEA 3A9JA 5IY0A 2ALYB 4OEMB 4OHJA 5I6WA 1V9JA 3A9KA 4NPNA 1SBBB 3HOYB 2Q2UA 3DWQA 5FK9C 3UE1A 1D5XC 2Y5PA 1LT3D 1G91A 4M8MA 1AEXA 3ONAB 4PNYA 1KJTA 3W3AA 4DDID 2PMZB 1LT5D 1WRIA 4XYQA 3ZO5B 1J8IA 1FIQA 1UWVA 4ZYNA 1SXTA 4JV5Q 1NCVA 2IJ0A 1S5FD 3MP9A 4TKNA 1SNMA 3O65B 4PQXA 4QMGA 3SXHA 3HUIA 2IY1B 2FIDA 5GXGB 2B3AA 3WIMA 4K14A 1VQIA 4A3EH 2LXCA 4YY3Q 2F0FA 4LFBL 2WXJA 1EU3A 2JPHA 3RZWC 4C80A 3A8KE 1KL9A 4EGVA 4XGAB 4AS1A 2WAQB 2K4KA 4H7BA 3X3MA 2MBBB 4BBRG 1XQQA 4XTCS 1CMXB 2D0OA 4IM2A 2BBCA 1OQYA 1Q82C 2VB2X 2WXOA 4ME5A 4CGYB 4J6IA 1I3QB 2MP1A 1VCBA 1L6UA 1WR6E 3AE8B 2GOWA 4IWOA 4DHJB 4JLCA 1R4QB 3LNNA 3UDGA 1TT5B 1MHWC 5C5LA 1WXMA 1HCZA 1Q46A 1PTOF 4C4VB 1I4PA 2K0PA 4W9FA 2EYOA 1QWYA 2HQLA 2K03A 2VQEQ 2R7DA 1BBXC 3HOZB 2PTLA 5EJWA 5CV8A 5C3XA 1E5WA 2I5MX 4AQYQ 1YHAA 2Y0SG 5J39A 4CO7A 2Z8LA 3WAMA 1AE3A 1XO3A 2VY3A 2CJNA 4BBSG 1O7ZA 4EQNA 1NBFC 3BK1A 1RTNA 2RMMA 3QHTA 1WOCA 3V3XA 3ZJVA 3FPPA 3NBIA 2QDLA 4BY1G 2JA6G 1V8CA 4NKLA 5DAUA 4WJQA 3GTKB 3AEVA 2D2QA 1K8GA 2HJ1A 1V1PB 4Q5VA 1W2BA 2MX2A 2PE6B 2L1BA 3KQ4A 3NK9A 2E74C 4C3IH 1S72A 3A9JB 2IZVB 4PT5A 4DQOC 4YWMA 3K7AH 4TQ1A 3P20A 4TRDA 1WFYA 2FIFA 2WQYB 2O4XA 2NVTB 1EY8A 3TSSA 2KC2A 1F2LA 4C56C 2SOBA 4IUPA 1XMQQ 4WJ3M 2CU1A 2JZZA 3E9HA 2BKRB 4GZYC 3DVGX 1T3QA 2D3AA 1AZQA 5EPJA 4NXML 3OW2A 2WXIA 1IKLA 1LM0A 2WP8J 3F2CA 2REXA 1WGKA 1JJCB 3OG5A 4GDLA 2OEDA 5E6OA 1QF6A 4IUMB 1ASZA 1VZ6A 1O7YA 2FMCA 2AMCB 4JBJA 2EELA 3T3NA 2AQ1B 3J80c 3H9DA 2K22A 2F0UA 4DDGD 3M62B 3MC8A 5IGGA 1VQ6A 1E1TA 4PMCA 2AQ2B 2OJWA 2Q8RE 2N4FA 2YVCA 1E2WA 4RFBA 4WIPA 1NMFA 1EEID 1WTHA 3BZDB 4Y7NB 1TS2A 1JT8A 3GV3A 2NUCA 3KDFA 4KDIC 2B2WA 4DV3Q 4QGUA 4HK2A 2OQ0A 1FYCA 2VL6A 1FXIA 1C7YA 3EIVA 4N9PA 4PZ7A 3CCEA 3A4RA 3ZNGC 2M9VA 3DUZA 3I4OA 4JV5L 4BBRB 2KJHB 4X3UA 4DNRB 3V2TA 1STYA 3W1GA 2HTHA 2KQSA 2EOTA 1F9PA 3KJPA 3Q8BA 2WYQA 1K0SA 4YY3L 1XNQQ 1KABA 3I9V1 1X32A 4H44C 1LTBD 1L1OC 4GLSC 2KHJA 4KKTA 2ES2A 3OMGA 4GN3B 2R93H 5D94A 4YWGG 2Z4IA 4C2MB 3L13A 3TMPB 2BKFA 2UU9Q 1WM2A 4V190 3LWEA 2KCNA 4DR6Q 4BBSB 2L0TA 1DGSA 3CRKC 3PHWB 5EKKA 3QA8A 1G2TA 1DOMA 3OIPA 2F0JA 2WP9B 2MQJA 3PSEB 1LM8B 4NZLB 4BY1B 2VQEL 4M0WB 2JA6B 2E2HB 4LAAA 1PVOA 3R66C 4ZDVA 2L00B 2Y5BB 5IP9G 5ELNA 2PYKA 1X54A 3A54A 1XD3B 3HOXH 5DPRA 1T0SC 1P1AA 4EZKA 1KDBA 2GVAA 3SK8A 3AE6B 3MJWA 4LDTD 1SR3A 1I7HA 2QJLA 3U52E 4LK0M 4UY8C 3OWEB 2JEBI 1TR5A 1STEA 4CDCC 5JVG3 3DHGC 4YIJA 4NAWA 4R8IA 2XGTA 3K5OA 1IBKQ 3K6OA 1D2BA 1E8ZA 2B29A 3UIOB 1FD7D 1RHPA 4RCOA 1WVLA 1R9TB 3KDFB 4B3TQ 1QILA 3UGBB 3ZDMC 5LXHA 3QWNA 1D5MC 2ON8A 5FR3A 4BKGA 4XX5A 2C7NB 1VQPA 1YN4A 3H0GH 1XMQL 3NS1A 1J8CA 4DXAB 1PLFA 3J7AF 5EPLA 5EAYA 1C4CA 1TWCH 2D0PA 4KI0A 5T8IA 1II3A 3R7RA 5IP4D 3F2DA 1XYIA 4RG1A 3U9OA 2Q2TA 3S1MB 4HR7B 2MP2B 3ZUNA 4A3PA 2VUMB 3TREA 2G45B 5DM63 3J81i 1VD2A 2RDBC 4BY7G 1OQRA 4ICUA 2JEAI 1TZOA 4DK3C 4QQBX 2Y5CA 4IWPA 3Q3MC 4DK6C 1N62A 2NVQB 2V1YA 4BA1I 3V61A 3BVMA 4KD4A 2GBJA 3P4PB 3P4RB 1KNEA 4NP5A 5CYUA 5CTRC 5JH5C 3NOBA 2X69A 4DV3L 4ZKBB 1SJED 1IW7D 1FNVA 2G9DA 1C9OA 2VZKD 3Q8EA 1IZ6A 1PTOH 2RVLA 5AUKA 1WGRA 4M8AA 1AZPA 3GZNI 4PZ8A 1UELA 4M1UB 1GKHA 2K6AA 3TP7A 1WJUA 3I57A 2DYMA 3ZIMA 1T5EA 4GLAC 4NPSA 1IBXA 2M4NA 3PCOB 4S17A 3GDEA 1PHJA 1V49A 3V05A 4IO9A 1KTKA 3HOWH 3CPFA 5C3EH 3CCQA 1XNQL 2K39A 3E9IA 4JI4Q 2MQHA 2OF1A 5JJZA 5M5XB 3ZNHB 1FM0D 2J4XA 3J7ZC 2KCCA 1T0YA 2ASQA 3UDXA 2B2TC 2NB0A 4A3BG 4A3DG 1EEFD 4BOSC 3GZNB 1VQGA 3B2GA 3NE5B 2UU9L 1T5XD 4BKSA 4DR6L 1WX7A 4X66Q 4H2AA 5T1GA 5JEAH 4BKSD 4P7IA 2RCNA 1K51A 4GKJQ 5DLQE 1GC6A 1G6ZA 4C3JB 2B2YA 2L15A 2EXZA 3NJTA 2D3CA 2JA7G 4JG2A 4BOZB 1NUCA 3IHPC 1YHBA 2L9HA 3VHTC 1GB4A 2INDC 3B9JA 2FUHB 3ZXRA 4A3KG 2KDBA 3AEFB 4G50A 4PZ6A 2VXWA 4HJGE 1Q7YC 3TL5A 2MHVA 3J81j 2GMIC 3WALA 1UE6A 2XK5A 1JALA 4W9LA 1KAAA 2RQXA 2JZPA 3NVWA 1OXSC 4RWSC 2QMTA 1LGRA 2KZRA 4A3JG 2LRWA 1S5ED 3G48A 3RZOB 2DAFA 1KHIA 1YBYA 2W82A 1IBKL 1PTOD 3T51B 4EQPA 4NJCA 1FGBD 3I55A 5BN5A 2J0JA 3N6RA 4B3TL 2DYBA 2KQ4X 2ENBA 5IA7A 1X6OA 4F87A 1YQ4B 5EDSA 1ZGUB 3L3OC 5I2YA 2JJQA 2KKCA 4FJZA 2IGGA 5K36H 3I4NB 5J2RA 1LABA 4IQZA 2GLSA 1RIPA 5E3FA 4JI2Q 5LMNQ 4J3OD 4TUUA 3WAPA 1YVCA 3H15A 2QILA 1X3FA 2ZJRA 2Z0DB 1Y1VG 3A33B 2G3QB 2KT7A 2KLCA 1UAPA 2Z0EB 1IHZA 1N34Q 4IPDA 3M4QA 1YITA 4MM3A 1WTXA 4FVMA 1XTCD 2Q5WD 2LHDA 2QCPX 1L2FA 5IYCH 2IBIB 3T56B 4L6TB 3PF5A 3PO3H 2BQQA 3UE0A 1YJ9A 1Y1WG 2K3UA 4W9HA 2V3NA 1MKHA 1JOOA 3C1EA 5ISRA 4G0NB 4G7HC 1ILQA 1LTAD 4ALPA 2XBBC 1WIAA 4LUOA 3GTJB 3K59A 5IP7H 4R4QA 4LF4Q 1SSNA 1D1IA 5M3MH 5FLMH 5FO7B 2PNRC 4XQQA 1WMHA 1LT4D 2IO3B 3VVWB 4JOIA 1AE2A 1K83B 1K28A 1HNZQ 2QW7A 2BYFA 2L8JA 4A3BB 3JAML 2I2YA 1JOKA 2RHSB 1NSNS 3CCUA 4LF8Q 2M19A 4GDKA 3SDZA 4KHZA 3O13A 4OWTB 1KH0A 2RSUA 3FRPB 4OO1H 2HHHQ 3TUOA 3G4SA 3R3MA 4GS3A 1OXVA 2K52A 4JI4L 3QIJA 1V1QA 5M5YH 2IPKD 5BYQA 2IO1B 5C4XH 3ZDTA 1O7LA 1B70B 1TT2A 1HEZE 2INNE 4IKGA 4POGA 1XXGA 1K53A 2DZKA 4A3KB 3P75A 1KIXA 1F2RC 4LNFA 2PZTA 3TN2A 3K58A 4X66L 4O2DA 3I5JC 3KF8A 4DV5Q 2CHBD 1HTPA 4GKJL 2D3GA 3AV8A 3H3VH 2PEAA 3AMUA 4HWIB 5TSSA 4UP7A 1WCMH 4IUNA 4X3KA 4HIKA 2X8XX 4IPHA 2O6VD 4A3JB 1WX8A 1JCKB 4IUVA 3KWVA 4DKAC 3GTQB 3S2HB 4KV6A 3DVGY 5HG2A 4YXDB 2D07B 3L16A 2E5LQ 1STAA 4KTAA 5EPKA 2WLBA 2WXFA 3ABVB 4FULA 4QAYA 4OL7A 2A5HA 2KC1A 5JHBA 3JW0X 2BF8B 3PRMB 1B1ZA 4L2YA 4CDEC 4R3DA 2LRUA 3QK0A 4MM3B 2WV6D 1F2ZA 2A4ZA 3CF5A 1N32Q 3S17B 2M17A 1Y1VB 4GNXB 1KD1C 2KDFB 2YEPF 3G6EA 3HOVB 1IYUA 2WDQB 2QSDA 1FGUA 1L0WA 3U50C 2PZWA 3RI7C 3KWLA 1E6EB 3RD2A 1GUSA 4RKBA 4LJPB 2EYLA 4JI2L 3HFZB 5LMNL 1DONA 3U4EG 1SEBD 3NSWA 3AU7A 4F7XA 1Y1WB 2BH2A 5C0XI 2Q2IA 3L0OA 4A3FH 2OWOA 5M3FG 1OGWA 2D11A 3CSTA 3MTNB 2F3IA 1CHPD 5A2QL 2MO0A 1EFID 1WD1A 1N34L 3NBHB 2FHTA 4FXCA 3ZJTA 2H5XA 3LDZE 2MBHA 3MFYA 1MSHA 4HJ8A 3U4VA 4JI0Q 1OEYA 2E3TA 1VF5C 2IT1A 4YSXB 1MFWA 3AULA 1GUWA 4DV2Q 4A3GG 1KXLA 2LXAA 3VYUA 3WWVA 2WXRA 1TS4A 1QQRA 3T53B 4AP4C 2ID0A 4AJYB 4LF4L 1Z2MA 2L0FA 4YTMB 2KCTA 1XCQL 3LX0A 3SFEB 2L3ZA 1HUMA 4JI1Q 5IGDA 1HNZL 3EGRA 1JR0D 4WQOB 3U4ZA 2OTJA 2KOLA 4LNQA 2MJ3A 4MH0E 1U4MA 5JVH3 2XWBB 3ZNZB 1BUIC 2LGSA 2UXCQ 2DX5B 4LF8L 1EWHA 3HVZA 1GG3A 2TMPA 4HJKA 2GBMA 4DAMA 1PH3A 2NS5A 2NVXB 3B1LX 1LFDA 2F0EA 2HHHL 3Q14C 3G71A 3L2PA 1QZEA 5HFYA 4JI7Q 1P9DU 1PZJD 2Z59B 5DPWA 4ITKA 4GOPA 4HPMB 1R4MI 4KV2A 1FNWA 2DNEA 5AUIA 1VS0A 2E2JB 3TBLD 1S5CD 1MG4A 4DXFA 3PO2G 2CWPA 2M0XA 1F9QA 1D5ZC 4OXPA 3KOJA 1IGDA 2CHWA 2JZ3B 2PLPA 4YT0B 2J52A 1EIHA 4W9JA 3SR6A 3GTMB 4B9XA 3CMAA 2I5LX 3GTPH 2MRPA 2KFKA 3AU4A 1LUZA 4A93H 3D4WA 5BO4B 3K81C 5KHOA 1C4PA 1C4AA 3W5VB 5JPNC 4W9IA 4E3CA 4NDXA 3I4MB 1BR9A 1JE5A 2C9OA 1ML0D 4RH6A 4IFDH 1R4MB 1UWMA 2E5LL 2HTME 3H7PB 2VNUD 1YQ3B 2BT6A 4KJNA 2QDBA 3PUWA 1EY5A 1PDQA 2L52A 2VQFQ 3I3TB 1GXDC 2LMCA 1FCLA 1E7ZA 4XDCA 4QB4A 1V9PA 2RKSA 5A35A 1Q81C 1NDDA 1N32L 2AEHA 2L1AA 3B0AA 4OVZA 3N1ZC 3AEAB 1EWYC 2YV5A 4LF5Q 2ZNVB 3H3VC 1PYSB 4DN4M 4ABNA 4AYBE 5M3FB 3HRZC 1RRBA 3KYCD 3STBD 3PV1A 1QOFA 3MXGA 3GTGH 1EY7A 1QJOA 1ACCA 1PRTC 1Q1BA 3CCVA 2ZZPB 1B4OA 3MAQA 1EQTA 1HH2P 4HMIA 3SGIA 1KLUD 3APCA 1A3TA 4EVOA 1R4NI 1F2MA 5D3DA 3PT2B 2V3PA 1I6HH 2JYEA 4A3GB 5EGTA 4EUTA 1CKOA 5A2QE 3IVFA 3RNFC 1Q12A 1F9JA 1BCPB 3U2SC 1EY9A 1CKNB 1TTNA 1WWTA 4ACFA 4LF7Q 2HIVA 4JI0L 3HOYH 2JF5A 1J19A 5LL6S 1CA6A 4USAA 1DM0B 1YJIA 2LGXA 2KX0A 3JSVB 4HTHA 3NVYA 3FKYA 5D65A 4B6WA 4ARIA 1IYFA 2N7DA 1KM7A 1R4NB 3CC7A 1S1QB 1TYGB 2VH2A 3V6CB 3M4PA 5I2XA 3QB3A 1I4HA 1V43A 4LFAQ 2AUKA 1R4PB 4QCLA 4YCWA 2JWUA 4MEMA 4NNJB 1WYDA 3H6MA 4DF7A 5AZGA 4JI1L 4V0BA 4B3MQ 3KUCB 2O2VB 1X65A 5IYBH 3TBIB 1PFBA 3DVNU 4JYAQ 3W1SA 2KOXA 2UXCL 3PGEA 4DUZL 3PO2B 1FD6A 5CV9A 4WORA 2UYZB 2CKHB 3E56A 4XQJA 1UEBA 3RMHA 4FF4A 2J42A 1KOTA 4G3XB 4B9WA 4JI7L 4OGQC 2KJRA 4L8JA 4W9GA 1I3QH 1TU2B 3PUYA 2QEXA 2R2OA 2JA5H 1YHQA 3N3KB 4N8FA 4J1MA 3P1HA 4NXNQ 1N33Q 2KWDA 1D4BA 2F4IA 3K5NA 4MGKE 4DA2A 4S3SA 4XDXA 3NWSA 3HOZH 4R8NA 5AZFA 3VR4A 4HCSA 4XE0A 3W2DA 3STBC 1QVGA 2LWPA 2Y3AA 2E76C 1Q10A 3AE3B 4DAYA 1E7UA 1RJTA 1V80A 1XJVA 2K9XA 4WQMA 3KBGA 4JBKA 2IO0B 4TVAB 1EIFA 4IUUA 3RLOA 4GMVA 1J5EQ 2CH4W 3GTKH 5IWAQ 2F3WA 2K01A 2NBWB 3P42A 2KDEB 3RT3B 2AX5A 4DHZE 1K3BC 1N5XA 4OX9Q 2VQFL 2QHOA 1BBWA 4GLXA 1NY4A 4C1NK 4UAIA 1BBUA 3TP5A 2RF4A 2PIAA 1GB1A 3U8ZA 1GVPA 4YHHQ 5JJLA 4N59A 3RULA 1Z6HA 2NVTH 3PRZA 2WB1E 3CCSA 3VAWA 3C19A 4LF5L 4JPBW 1A70A 4WAAA 4DPGA 3DQVA 1TWGH 5G55A 2EZVA 3W5UB 1N8RC 1OFFA 1KRSA 2ZCBA 4JCVE 3APFA 3UINB 5IGEA 5CHVC 2BS4B 5D6JB 2HE7A 1L6VA 2OQKA 1V6EA 1RL2A 3DHIC 1A3VA 2O5JC 1P3QU 2NN6G 2EIFA 4BS9A 2G9HD 4CDDC 2F3VA 4DR7Q 2GBNA 2JU6X 1E0BA 4EEWA 3RLNA 5CV6A 1YNNC 1EYAA 2ZCCA 3AXCA 2ZTDA 2F0TA 5CV5A 2EE1A 4KN7C 1WJ6A 4DHJD 3KH0A 1VJKA 1N61A 3ULLA 1JJGA 3VFKA 4LF7L 5IKCM 2IX0A 2MLBA 4K5WA 3CCMA 1HZ6A 2LVOA 3WCQA 4HAEA 3PUVA 1U4AA 1BXTA 2JVCA 5EBCA 2WIIB 4GN1A 2N9LA 1CFMA 3AE2B 3E0JA 3SE0A 2CHZA 4LFAL 3ONSA 2X6GA 4LNNA 4BBRH 2N9PC 4M02A 1JWMD 1LYLA 5LLIA 4OIKA 4B3ML 2EMSA 4REZA 1PFNA 1O7IA 2GN5A 4KK7A 3I8ZA 1K8AC 5J22A 3I90A 1AW7A 2WKDA 2WU5B 4HXDA 4JYAL 3PF4A 1EFWA 2OTLA 3TCAA 2AQ3B 1K50A 4BXXG 2NBVB 1WGHA 3RNAC 1WI5A 4C2MH 2CW0D 3MXNA 4J8QA 1SYBA 3C8YA 3UIPB 1Q90A 4A8XC 2ZW0A 2NBFA 4RAUC 3IFDA 3PREA 1DCZA 2OOBB 4JI5L 4BBSH 4IC7B 1VQMA 2J0MA 2ZM6Q 4KKIA 3TEXA 2LHEA 1CK1A 3Q23A 1HE8A 4HIDA 2IGHA 2C7HA 4EKUA 4NXNL 1N33L 5FR6A 2JA8G 4BY1H 1D7QA 1QNUA 1EYCA 3CW2C 2JA6H 2E2HH 2PQAA 3E3XA 1WYWB 1DGJA 3LYYA 2A6HD 5IO9A 4KMUC 3I73A 3M4OB 4UDUC 1SE9A 1HRJA 3PZDA 3VR5A 1L1OA 2IHEA 2IW3A 1EQRA 1PH9A 3DWMA 3ERQA 2LEKA 1PH5A 3QIAA 2HUGA 3PVLA 4G7ZC 1L5PA 1PDXA 3TDQA 5E4XA 4A3EG 4BA2I 2RPVA 4KY7A 1STNA 1PGXA 4JK1C 4I6PA 1J5EL 1KNAA 5IWAL 2FE8A 3J9CA 3SK6A 3ZNID 1IKMA 3Q2AC 4OX9L 3S1QB 1WJNA 1VF7A 3M95A 3A9KB 1PQSA 2AUJD 3QWZB 1MHHE 2VW9A 3HKZE 5EE9A 2LY7A 3URYA 1S5DD 1R9TH 4YHHL 2E2IB 2BYEA 1SDFA 1A63A 3DM3A 1EQQA 3EQLC 2INCC 2KMAA 5CX3A 1Q8KA 4FHJA 4XYOA 2Z4HA 2IYDB 4K7SA 2DYOA 4II3B 3N30A 1S3OA 3A5ZB 1B8AA 5D3IB 4W9CA 4HEDA 5EQ0A 4QY7A 4NMZA 2SNSA 5EKLA 1IYVA 2J0KA 3NY5A 2XIWA 3S1MH 5KEEA 1RFAA 5JZEB 2VUMH 4QL5A 1YNJD 2NYZD 1EO6A 3VDZA 4DR7L 3CRLC 1OXTA 4PMWA 2RDHA 1IBLQ 2L32A 3WAOA 3X0WA 3ZTCA 4GXBA 5DEHA 3LB8C 2NVQH 3HOUH 3K0XA 4HSVA 1VQ8A 3S15B 1HFGA 1G6JA 1BNZA 2MEKA 4GKKQ 4XZ4A 4EZJA 1WXVA 4F88A 1L2NA 2CW0C 1PFDA 3T8MA 2G5DA 3BDLA 3CWIA 1JOQA 2NCNA 4OZBA 5AZHA 3DHHC 5I6YA 1E7VA 2KN4A 3IAM1 2CVRA 2WAQE 5IYDG 4JI8Q 4OELB 4UP8A 2DHZA 4NQKE 4ZUIA 4LJZC 1VQJA 1WX9A 2I1JA 3C2PA 3PV0A 1JB7A 1T6BX 3J80i 1CA5A 5E7NA 3AB9A 1WTOA 1VRAB 3G6JB 4NJ7A 3V62A 3VUWA 2A6HC 5H1SE 1SB3C 2CHXA 3AEGB 3DBRI 4DFAA 3S1NH 1ISNA 3TRZA 4N9F4 1RM6C 2KBNA 4OONA 2R7ZG 4DK5A 4BBNF 3TEZA 5I9OA 5G2NA 2K5DA 3ND9A 5IGCA 1L0XB 5M5XH 2JA8B 4A55A 4LW1A 2JP1A 1E0ZA 2MO1A 5IAAC 2YU9B 2Y0SB 1MG8A 1KAWA 2A68C 3FKIG 3VH4B 4YSZB 2EJMA 3GO5A 2MNAA 1TKGA 5JJIA 1SYEA 1XCTL 1BVSA 4A3LH 4ZRKA 2KEDA 2ZM6L 4GGQA 1QOHA 1M8AA 1DOLA 4JI6Q 3DBRB 3EUB2 4K6DA 3IG3A 5KNDA 4C3JH 1JROA 1UNSA 1K8OA 2K50A 1QUQA 1D1KA 1OXXK 2XVSA 3GE3C 4DXGA 3TEHB 4AQYL 1TS5A 4A3IG 3VRAB 3ZVVA 1WSPA 5T1IA 2INPE 3Q24A 3QCAA 4A3MH 1VLBA 4DR5Q 2DY7A 4MSQB 4CKEA 1HZAA 4OZCA 2QGQA 3VUXA 4GDLB 1LTTD 2B2TA 4A6QA 1YNJC 3ZKJC 4MN3A 4F8CB 2PI2A 1FFUA 3J7YW 4XXEA 4B3RQ 1H9SA 2ZXPA 4LCDE 1B50A 1CQVA 3MEFA 4WURA 3VRBB 3QARA 2R93G 3TEWA 4RKLA 4HJ5A 1FPYA 2I38A 3RCZA 3PQIA 2DZJA 1SNCA 3Q8FA 2ZT9C 4WFN3 3GOEA 3Q3NC 4MELA 4L23A 4WWOA 1QZGA 2V9HA 4HPPA 3B6YA 5IN7A 1PRTF 2DN8A 3I4NH 4EZLA 2BOSA 2WXGA 2FINB 2A6ED 1GM5A 1ZUD2 2N1VA 2Z1CA 2G4DB 3VYSA 3Q0AA 2BYTA 5CR3A 1P7EA 2V4IB 2JRIB 2EJFC 1BOSA 1VMCA 2JXXA 4DR3Q 2BTEA 1V97A 3OSOA 1DYQA 1YIWA 2YYZA 1IBLL 2B2UC 3GP7A 4K2LA 4F1SA 2K05A 1LT6D 2KHSA 4KHVA 5DM73 1CKMA 4GKKL 1HA6A 4NAMA 3ZRFA 1JRUA 3S1RB 2LASA 2DJGC 1VQOA 4OZAA 4JGHB 2DBYA 2GBRA 4PS3A 3GTJH 4ZHPA 4JI8L 3IL8A 2R7ZB 3ZGZA 3ENEA 4C00A 1ZEQX 5E1FA 2EYPA 5LNK1 3ZJUA 2IDYA 2B8FA 4DAPA 1IP9A 1ASYA 4A3BH 4JQWC 2LGDA 2AKWB 3FKIB 3S24A 1TKEA 4RM9A 4LDTB 5ELEA 2EPBA 2A1AA 1F1HA 3Q8AA 2D10A 1MPEA 4IG7B 1BCPF 1WGDA 1GOZA 1O80A 4IN3A 3KYDD 3AFPA 3E0EA 1VQ5A 4XWTA 4KKUA 4LWCA 4HIOA 2MBOA 3M3YB 3BDCA 3R7QA 1UH6A 1S5BD 1RAXA 4A3IB 3P1MA 4P1BC 1W3SA 4NAWB 1GUNA 4RGOS 4NW2A 2J7ZA 4ZRZA 4ZKCB 1VQEA 1A0IA 2I5HA 4YCUA 1VQLA 4JI6L 5C5MA 2K5WA 5LXIB 3EN2A 2TSSA 2EY5A 4L5QA 5GQOA 1SYGA 4IOIE 2V1CC 3AE9B 1DJRD 3CQZH 4UPAA 3TS0A 2G1EA 4CBVA 2F0DA 2B63H 3MZ5A 3KUPA 4J15A 1E8WA 4P1CC 3GTQH 3S2HH 1N63A 2A6EC 4DR5L 2H89B 3HK0A 1C76A 4HJ7A 2R93B 5ELDA 3S14B 2F1MA 5DCNA 3VH3B 2WS3B 2ZEQA 4ZYSA 1E8XA 4ZK9B 3NVVA 3NUCA 4DR2Q 3HOWG 1OTRB 3HM3A 4DUYQ 5C3EG 1I35A 2KMCA 4B3RL 3RNGC 3J7AV 3S2AA 5JOBA 5C6AA 2F0QA 5J3BA 1P7FA 2MBQA 3S17H 2LZ6A 2JXMB 3I91A 3R2TA 2UUBQ 1NYRA 2LGYA 2ZPNA 2F0IA 2KA7A 4R4CA 3CCLA 3HOVH 3CC2A 4FYDA 3A4SC 5BR8Q 4BY7B 2NTSA 3EROA 5LHY1 2J0TD 2JX5A 3K9PB 1U4PA 4K8JA 1RFKA 3C1FA 4C7YA 2BA0A 3LJ3A 3PIPA 2PI2E 3PTFC 3RN5A 4GN5A 1NAPA 1E8YA 3IFTA 3BVGA 4C3HH 5C4JH 2K8CA 2QDFA 4RF0A 4WAFA 4JPSA 1IBXB 1OEYJ 2R7FA 2PJHA 5FJ8G 3CHBD 3M85A 4DR3L 4K5XA 1ONLA 1LTSD 3SDLC 1EY6A 4H0LC 1ICWA 2QCZA 3KBXA 2KHWB 4WWPA 2BPSA 4F7ZA 2X6LA 1OXUA 2MHJA 5IOIA 1F9SA 4RHRA 2MW5A 2YTVA 1VQ7A 5GAHC 5E6JA 4IM3A 2XSCA 1G8ZD 4KGRA 1S3SG 3EJIA 3K5LA 5C0XH 2HDMA 4WRDA 1IL2A 5ELBA 1LTID 3GTLB 4OVVA 1YNTE 5D7GA 4GU2A 3FILA 1RLFA 4A3DB 1FEHA 2DUDA 1YNXA 2DJFC 1GUAB 3WDNA 2OEOA 3A0JA 1PH7A 3PIO3 1Z5SB 2NVXH 3Q69A 3ZLZA 2D5DA 5DNFA 2K8BA 2FNJB 2XK5B 3UQAA 2XEWA 4CJ2C 1D6EC 5F2DA 4K2KA 2JA7B 1ZP0B 2AL3A 3LXFA 4KIKA 2K75A 5GADC 4FF2A 2KLGA 1PTOB 3L17A 4ASWC 1CZGA 4AYBG 1VQ4A 1SFOH 2F4VQ 2WINB 3PHXB 3FP9A 1HPCA 1XMOQ 3GTMH 4IALA 5FLXL 2KHIA 3L4PA 1SE8A 2O6VA 4JIOU 1RODA 5C1ZA 3NHHA 5EKIA 4H13C 1RDPD 1IPGA 5C3EB 2UUCQ 2HD3A 2IX3A 1ILPA 1FXTB 1STHA 1K0RA 2PE9A 3NHEB 3RNBC 4B08A 2KECA 3EBEA 1HZ5A 4A3OA 2BS2B 2QC8A 2F0KA 3NTKA 3I4MH 3IT6B 3I7FA 4P16A 4US8A 4FBJB 1UEAB 3M63B 1ZXIA 2K7VA 2M8SA 1MHXA 2WKCA 4LUZA 3T4AC 3QG1A 5D14A 2Q8IB 3AMZA 4YWLA 3KVFB 2BDNA 4DR2L 4HVBA 3CAMA 4TSSA 4XT1B 5KYIA 4DUYL 2CCZA 4MSMB 3VTVA 5EE1A 1YI2A 4X3TA 2A73B 4JWUC 1JQYD 4Z9CB 5C4XG 2N8NA 4NY0A 2UUBL 3C3LA 1Q1OA 2I1KA 1M4VA 1SAPA 2HCCA 5M3FH 1A6XA 4E71A 5C3JB 3NEMA 1XNRQ 2MH7A 1KDAA 4IWQA 5BR8L 1TGZB 4RA8A 1SIJA 1LTRD 4P73A 3TQYA 2WXPA 1WMHB 3BG3A 2NMQA 1PH6A 4MTKA 1YJNA 3W5OA 3AU5A 1HNXQ 1BF4A 4W9DA 1CM9A 4I7ZC 1MJDA 2K8HA 1WCMG 3TP6A 4GDKB 5CBEE 2EQSA 1KQSA 3JVZX 1TBEA 4EOYA 2PCFB 1J7AA 1I42A 2D5GA 2XRQD 1G6PA 4FXGC 1STGA 3D32A 3H7SA 4MT5A 3RYTA 5ELFA 2DZIA 2L7RA 1MBYA 2PPHA 4GNXC 2SDFA 3OW7A 4IFDJ 1L0VB 2JN4A 2KUMA 4M00A 1E22A 2KNBA 1IBMQ 2BB5A 1QVCA 4HJAA 2JSVX 2SNMA 1UZXB 3K57A 1WGYA 2XN9C 3VR9B 1WJJA 3KLRA 1B9RA 1PRTD 2HDEA 1QE6A 3KF8B 1VCIA 2I0QA 2HD5B 3CPWA 4E74A 4LLGM 1WFQA 1NI2A 4LFCQ 4ARCA 3RLFA 5L95C 4FP5D 1ZYRD 3JAME 3FEWX 2D9UA 4HCPB 2O2LD 1FJGQ 3L10B 3HP3A 3NZ3A 1ESFA 4AYBB 2PPBC 4DR1Q 2E2DC 4BBNC 3KLWA 3FVQA 1SIFA 4WWMA 5E6PA 5L83A 2DY8A 4A3FG 1O78A 2LS01 3CKIB 1WTWA 1ZKHA 1A2UA 3NS8A 2XTIA 1LXDA 2LJ5A 3ND8A 2WB1G 1F9RA 2CQOA 4EQOA 4F8MA 1D8LA 3N1XC 2KQ7A 4JE3B 1DOXA 3CSFA 4LUVA 3KUDB 5BN3A 1XX8A 4L5SA 1VQBA 2F4VL 4KGSA 3FMCA 2D62A 1WR1A 3ITPA 1XMOL 3IKJA 4DV5L 4GIVA 2DZMA 2PVGC 2ACZB 1JE4A 2BDOA 4K7WA 2OJRA 3CIRB 4CHTB 2KENA 2UUCL 3S2DB 1H9MA 2K32A 3D31A 3D3RA 5CV4A 1JMLA 1F2YA 2N55A 1BCPD 4IPCA 4ICVA 1JC7A 2EYFA 1P0RA 2NWGA 2RA4A 1WXSA 4MGYE 2PNHA 1BKBA 1HZ9A 3MA2B 3X23A 1I6VC 3S16B 1FMAD 5AFWA 3N20C 2CS4A 2GBKA 2PZUA 1TWAB 3L54A 3EVQA 1CSQA 1X3QA 3M7GA 1ICFB 4O1NA 2FCSA 4RGTA 1I5FA 1TVXA 1UE1A 1EL0A 3T9LA 1HTQA 1YEZA 3MFGA 3BZCA 1WTQA 1SROA 1WCMB 4JI3Q 1PXUA 2FCQA 1WE7A 2ZVOA 5J18A 4A3CG 5KHQA 3DWAA 1QLBB 5CORA 3PMFA 4QIWE 1NTGA 3VUYA 1XNRL 3NENA 1EQVA 5M5WB 3UI3A 3CCRA 2R92G 5BYRA 1V5OA 2MA9B 3MEHA 3Q3FA 2I46A 1HNXL 3M3JA 1TWHH 5H8YE 1H8CA 3R93A 1ZYRC 2NTTA 2AL6A 1WTRA 2L5TA 4A93G 2OT2A 2F52A 1SE4A 2EYJA 3J80L 1XEEA 1UD7A 4ZQ3A 2KANA 4IFDG 2DAJA 2F0VA 1E24A 5NUCA 2BA1A 2EY6A 4DK1A 5AEKB 1C48A 3RN9C 1LACA 3T1HQ 5I4DA 1F77A 1U5KA 2A74C 4DV1Q 3TIXA 4GOPB 4HCEA 3P63A 2IO2B 2ZNVC 3QJYA 3NQTA 4DV2L 1IBML 2OCEA 1HHVA 1NYQA 1WM3A 3WOFA 1XPOA 1JORA 1TIFA 4DHZB 1E3PA 2KTRA 4AJWA 2IL8A 1V2YA 1X9NA 2DENB 3A8IE 2K5QA 4O42A 4B0MA 3QOLA 3HVDA 1GC7A 2KFKB 3CXCA 1WY8A 4LFCL 3A8JE 3Q3OC 3NP8A 2WB1B 1FJGL 2PQEA 3GV6A 1MD2D 1YNND 2PVOD 3PLVA 3UF8A 1QT9A 1BCPC 4DR1L 1FFVA 1T0RC 4EFOA 2BYVE 1MI0A 3A7LA 4MJSA 3KF6A 3GTOB 3AN1A 3PLUA 3HKZG 2ICIA 1EY4A 3U30A 3I63C 4ZRQA 2LMCB 3L08A 1L4ZB 4RCNA 2K14A 2Z6KC 1NBWA 4XDDA 4CKBA 3P2BA 4GSWA 4BAXA 5EE0A 4MZ9A 1SYFA 2H4OA 2HJ8A 4KZ0A 2LKVA 3BY4B 2RDGA 2GI9A 3JAMc 1QKZA 3SVMA 4G7OC 1KF6B 1QOAA 3DOWA 3SK4A 3Q8CA 4PMBA 3VR3A 3M4OH 3DMUA 5HGQA 4IJLA 1PV4A 4JW0A 1PYBA 1YX6B 3IAS1 2EY2A 2FFKB 4WJWA 2YLMA 5BYSA 2MGSA 3RPFC 1I50B 5IYBG 3NTIA 2MJDA 2W3SA 1B9NA 2H1EA 1MI2A 4MGZE 1EZ6A 1B3AA 3F1ZA 5C44G 1RF2D 1SF0A 5TR5A 2NVYB 4R4IA 1CJEA 2Q2HA 1WZ0A 2C5LC 2R92B 3S1QH 1FR3A 3J81L 3OHXC 3S9WA 2WAQG 3BIID 4X62Q 2YTXA 1WF9A 3FHWA 3I2ZA 1AP0A 3F8TA 2BVCA 2E6XA 3OMCA 2E2IH 3Q8DA 4JI3L 4DNTB 1RD9D 1HR0Q 2CKZB 2FBWB 2N49A 2JA5G 3H09A 2WXNA 1OQQA 2KTRB 2A5UA 1EUJA 3B2FA 4H02A 1STBA 3KLSX 1K9MC 3I56A 3EECA 3HOZG 3K9OB 4M8NA 1XTDA 3E9SA 3F2UA 3DHQA 2ZPYA 2C35B 4DK0A 1Q1EA 2B2VC 4DGZA 1VQDA 1BMLC 1QOGA 3VXWA 2JQRB 4PS8A 3MHSD 3FAHA 5C4ZA 3RUIB 5AJ3Q 1S40A 1XPUA 2KVZA 4A90A 4C4VA 3S15H 1YZ6A 2WACA 1WTPA 1IYJB 2AWOA 4ZRJA 1FCCC 1Q5WB 4Y7NH 3T1HL 1K73C 4TMAB 4DV1L 3PUZA 1L7YA 4TV3A 3SEBA 4POFA 1UE5A 4FA6A 1SNOA 1CTMA 2N88A 3L9AX 4I7AA 1FXAA 2N7EA 4IDIA 2WWZA 4K5VA 5J1ZA 3Q22A 1QOBA 4HDQA 2PMVA 4X64Q 3VR6A 2MUYA 2GA4B 2Z9HA 2D3BA 4IUTA 2F0HA 1X3PA 3HKZB 1X1MA 1TWFB 2JY6A 3U7ZA 1PGBA 4DAYB 1V86A 1V1PA 1OTCA 3L0WB 3CU7A 1SMYD 1EIGA 5GAGC 2L76A 3K5MA 5ELOA 1TKYA 2MPMA 5E4WC 5J17A 2JA8H 4K81A 5IOCA 3ECIA 3ERSX 1EWIA 2JSOA 4DU9A 3ETRA 2K1BA 2YU9H 3VYTA 2W54A 1H95A 5IGBA 1MVKA 2KCMA 1WRDB 3TEYA 3MC9A 4KSLC 4IOAA 2WDVB 3MXPA 3RZDB 1QVFA 4HCNB 1J7BA 4I6LB 4ZUJA 4L5TA 5IT9L 3ZQ4A 4ANWA 1I4QA 1CSPA 2SEBD 3NTHA 3KW5B 2DNCA 3MHBA 4CQNA 1A5RA 2F0LA 4I65A 4J6HA 5C44B 4D2KA 3N9YC 3QQ8B 3ZW3A 1SE3A 3D4DA 1C8CA 1MSGA 3H8HA 3Q6BA 3NRZA 4FLHA 2ZTCA 2NN6I 3G7LA 3PPAA 2F0PA 1ROEA 4RM8A 2QF7A 3C46A 2PKOA 4FXKC 2FUG1 2UUAQ 1SNDA 1AH9A 3T3OA 4US9A 4JX1C 4L1BA 4RHSA 2L11A 1E90A 3I70A 2JA5B 1Q3LA 1EOTA 2A68D 3J81E 1A62A 4KDLB 1HR0W 4P72A 2DGYA 4IZ8A 3QAQA 2YEPB 2FMMA 1Y69U 3VA7A 2IY0B 4FNFA 2CJOA 4X62L 4KJOA 2BH8A 2K5NA 1S4ZA 4HDOA 4FADA 4I6NB 2DLBA 1HR0L 3FPUB 1TJEA 1XLQA 2RGFA 3SK5A 2KO3A 1W6JA 2QEJC 2QIEB 1DXMA 1C78A 1ZDXA 1IL8A 3SD5A 3QX1A 4MDKE 2PMZE 1XF5L 1U4LA 1SMYC 1UE7A 5IYDH 2WGSA 4A76A 2NPTB 2CR5A 1SSOA 2W55A 5AJ3L 3IXSA 4XYCA 2SAKA 3BINA 1J7CA 4M0WA 2N9XA 1NMGA 3MXNB 2W9NA 1F0ZA 1TWGB 4W9EA 4AWJA 1SRUA 2F0GA 3S1RH 3PS6A 2ZW1A 1VDVA 1SMXA 4C3IG 1VQNA 1T9HA 1ENAA 2R7ZH 3M4YA 2BW2A 5L37A 2K5PA 1HXYD 1J9OA 3UDFA 1E2ZA 2GRIA 2V3SA 1YJ1A 3AECB 3TZUA 3KJOA 2PQAB 2N3SA 4X64L 1VQHA 3PRPB 2HQEA 4IM0A 5GROA 1V8QA 2Z0SA 3FKIH 1ENFA 2CQAA 3A74A 1PH2A 1CUKA 3QJZA 3AEBB 1GAQB 4CJ1B 2B2UA 1L1OB 3K8AA 1KLVA 2BGFA 4DV6Q 1LLRD 4AQ7A 2K5VA 2CFMA 1EYDA 2VUMG 3BVZA 3K7UC 4DR4Q 1NI3A 2L83A 1CQFA 3PZ8A 4YWKA 4HEA1 3M3YH 3KYHC 5IP9H 1DD2A 2KEEA 1B7YB 4A3IH 3FDTA 4AH6A 2KACA 3OYYA 3HOUG 5IT9E 2JRHA 1HTOA 5M9OA 2DWQA 2VS1A 3W1YA 2IHFA 3BZKA 2MP2A 4R4OA 3A56A 2ZJPA 2JA9A 3UI2A 3HRDD 4A3EB 1EF5A 3RNCC 1K52A 5BMHA 3AFQA 1BO0A 2D2CC 4N9TA 1ZXHA 2L4NA 1BT0A 4NJ6A 1AN8A 1H4RA 3QOJA 1SNQA 3NXWA 5ELCA 1QG7A 1JQ4A 1P16A 2F0MA 3QC8B 3UQBA 3S14H 3AE1B 2RR9A 1CHQD 2PW9A 2UUAL 3HS0C 1I4GA 3ULPA 5I9PA 2M1MA 1GJZA 4WH4A 1BQQT 2NVUI 1MIUA 1Y8RC 4Q2JA 3W1BA 3RZOH 4QUFA 5HKHA 3VR8B 4R4TA 3NG0A 5IODA 3IT4B 4LF9Q 1N5WA 3H91A 1Y8NB 1WXQA 1JICA 2EXDA 4BY7H 4TQUS 4A3LG 3GB1A 3AB5A 4K0KQ 4EE2A 5BMGA 5LL6X 1C9FA 1FRDA 4C3JG 5KGUA 2EYMA 2F0NA 5JEAJ 3CF6E 1N36Q 3RZFA 5DPTA 5BN4A 5G3LF 2KD0A 1JB3A 4A3MG 1D3ZA 4C3IB 3J81c 4S0RA 3HOXG 4EX5A 3K7AB 2KWUB 2K1FA 4QUCA 3MWYW 4KX6B 3RMKC 1B44D 3OWFA 3SU8X 1MGSA 2KDIA 1EM7A 3DBSA 4A4IA 3UDIA 1CZWA 1C77A 2B2WC 3QO2A 3VQIA 1WZ3A 1VQAA 2X38A 3A55A 4ID6A 2EYHA 2Y0SE 4ZRPA 5GMVA 5D2MB 1ZDVA 4B3SQ 1N6ZA 1K83H 4ZOHC 2IX1A 2FCMA 1QUQB 3GTLH 3TMEA 3BS1A 4G57A 4X57B 3VTWA 4L63B 1A2TA 1H9KA 1UUPA 3TP8A 4A3DH 3IFWB 3H0GG 4LNOA 5H92C 3RNEC 3PIOA 1LTGD 1PH1A 4L5RC 3I4NG 3HOUB 2R6GA 2ZTEA 3X3NA 4GOCA 1PFSA 2M00A 1E7PB 1HTLD 4RGMA 3AYHB 3SHLA 5IE8A 5KYLA 4DV6L 3VDYA 2ATWA 1AWDA 1PGAA 2G4SA 4YTPB 3WA0A 2EKIA 4LNKA 3LWUA 2F03A 4DR4L 1PH4A 2JA7H 2DNFA 1V81A 1YN3A 2MJEA 1H9SB 2CWAA 4JL9A 4ILWA 4A3KH 3NVZA 1PMRA 2CU3A 2AHOB 1TY2A 2LXKA 4DWFA 5IIFA 4YSYB 3RNUA 4A75A 1JWSD 2EY1A 2V0GA 2JYOA 4KY6A 1TZ1A 4UHVA 3S1NB 3M9BA 1MJCA 1Q8IA 2RSNA 1C0AA 4Y52H 1QCBD 2ZXRA 1U0LA 2EKEC 3BYTB 1BUVT 4IPGA 4A3JH 4ZHOA 4ODGA 4ANXA 3DEOA 5FO8B 4U673 1M1KC 2K6DB 4N6EB 1NNXA 1HFNA 3EFUA 1SYDA 1ZXTA 2PO4A 3HGBA 5C0XJ 4OIJA 1YX5B 1M94A 4KY5A 2WX1A 5MPOA 5FO9B 3OAWA 3KLSA 3CD6A 1YN5A 4LJOB 3WANA 5JAVA 1XLNA 3BK2A 1EU4A 4K6LA 4KD3A 2KAJA 5IT9c 1PFMA 4DV7Q 1WD0A 3C0RB 2QA4A 1Y1VH 3RN2A 3CC4A 1GNUA 4LF9L 1C79A 2VZKB 5FJ8H 2Z6BA 4A3MB 1ENCA 2BE5D 4RGNA 2L0CA 3HOXB 2KX3A 4II2B 4KVGB 1GHJA 5JHAA 1GPXA 4CKCA 4IJHA 3PSIA 5JEAG 2IWHA 5HURA 1AFPA 4K0KL 4PV1C 4ANUA 4HJ9A 3CMEA 2A8VA 2EVBA 3F2BA 4X65Q 1QNKA 1EY0A 1Y1WH 3OJ3A 3I3CA 4IOCA 1N36L 2ICEC 1YIJA 2B63G 4W9KA 3Q6SA 3HM6X 1SN8A 4ANVA 1FO4A 2BCOA 2HCIA 5CBAE 2LFNA 3I72A 1WTVA 2IY5B 3DPDA 3NUHB 4WWNA 2WU2B 1DOYA 3T1YQ 1PH8A 4GB9A 4N8X1 1MJEA 1IW7C 5HI1A 4B95A 1PZKD 3H0GB 4KSKC 3NZUA 5FOBB 1UBQA 4MGIE 4C7ZA 3DLLA 1TWCB 1E10A 4AOFA 1F2RI 2KJ6A 2E75C 4XC2A 4KN4C 1WI0A 2A19A 3VTUA 3AQQA 2F0SA 4B3SL 3HOVG 1RWSA 4KKSA 2N9KA 1EF1A 2KK8A 4NB3A 2M2LA 1TIID 4K8IA 1AYFA 4X3SA 5K36G 4HN7A 4ZCKA 3DCGA 4RNAA 5HY6A 2LFIA 3MJ5A 4IW0A 1N9WA 1YJJA 1QB5D 2RD0A 2LVQA 3K0YA 2F0OA 2EMTA 2KYWA 4GNXA 2UWQA 4C3HG 3AEEB 3SR1A 2JQOA 1GHKA 4N58A 2VB3X 1KC8C 2IGDA 2L05A 4PYUA 1KDCA 1KRTA 3D4RA 5CC4A 5LMUQ 4P2CB 1U9RA 3HZXA 2E2JH 4FN2A 5IYCG 2VH1A 1K8RB 3PO3G 4DV0Q 4EQ5A 1SGHA 2B2YC 3VYRA 4RMFA 3U58A 1ZPSA 2RBMA 3DVNV 2WX0A 2BE5C 4DAVA 3HOWB 2KQ3A 4DV4Q 1I94Q 1EYGA 5IP7G 5C0XG 1GUOA 5M3MG 5FLMG 1P98A 3NBHA 3S2DH 1HNWQ 4Q0FA 2WDRB 5BMIA 5IGFA 1C4QA 2M56B 3DBHI 4K1RB 1EUVB 3ZRCA 4UP9A 4FXDA 4CHKA 5CHWA 3EFCA 5CHFA 3S16H 1WJ4A 2FAZA 3N1YC 4BZAA 1I4RA 4WJPA 1TWAH 4OO1G 2JWZA 3NZSA 1PTOC 1HQRD 4C1NI 2WXLA 3MTSA 1HZCA 3T13A 4DV7L 1VDZA 1E1OA 2A69D 2W3RA 1SNPA 2EDGA 5COYA 2B8GA 5KNCA 1R7SA 3APDA 2KN5A 1GUGA 3CQZB 5C3WA 2LJIA 3DBHB 2B63B 2RSOA 4GN4B 2YTYA 1T0QC 3QR8A 1B2TA 2OHFA 1NEKB 1ZW7A 5M5WH 1VMPA 1K3RA 2LXJA 2NZ1D 5KRUA 1VQ9A 2ASBA 1KLGD 3AH7A 4RMAA 4HKQA 4KZCA 3FILB 4X65L 3KFUA 4MIUA 2C9WB 4A3GH 2KWVB 2V4LA 2K5HA 3ALBA 5JPMC 4R9WA 4LNIA 4RF1A 4B9KA 4NQLB 4BKTA 1L4DB 4YCVA 3ULJA 5KIXA 3I4MG 5C23A 3P4SB 5CV7A 3HKSA 5LMNW 4FF3A 2K25A 2MBEA 1SE2A 2E8GA 2WXMA 4B0EA 1VQCA 4FF1A 1JWUD 3T1YL 2KDMA 2K28A 1IUEA 1EWCA 1NR4A 4JBWA 4XT3B 4KIKB 1XPRA 4WJNA 4IUQA 3M7NA 1HA5A 2B3GA 4AIMA 1E2VA 3EC8A 2K04A 2LVPA 3H7PA 4JOIC 1FVIA 3V6EB 3H94A 4C3HB 5C4JB 3D8GA 3PIP3 2LUMA 3AEDB 1B53A 2KMMA 2O6VB 3CP0A 3DDCB 2B76B 1KFYB 2XWJB 5G3LD 2QKIC 5G5GA 1Q86C 4K3BA 1VQFA 4QIWB 1JJ2A 2ZJQA 3PO2H 2JK8A 3E6ZX 1M90C 3RUZA 3V96A 1FL0A 3PO3B 4ZLTF 4QJFA 3IRBA 5EBDA 4OO1I 4FDBA 2UXBQ 1X3GA 1HQMC 3GTOH 1X56A 2KVRA 1V1OA 3OTOQ 4BVUC 1A3UA 3RFZB 4BWGB 1TXYA 4OWXB 5DPSA 2N9EB 1HJPA 4HRSA 1G51A 2KJXA 5LMUL 5M3MB 1LQBA 1V5TA 4YTNB 1AARA 1ESRA 3B08A 2NZHA 2HDLA 3D6WA 1PZID 2A69C 4JVZA 5FLXE 3V60A 1YD8U 4DV0L 3ML9A 4HKZE 4ULLA 3GE8C 1E9MA 2LD9A 4DUZQ 4FJVB 2BS3B 3KK7A 3H3VI 1ZKOA 2WXHA 3OIQA 3E5SA 4DV4L 1I94L 2KXJA 1CKNA 2Q8TA 3IAYA 1HNWL 1LV9A 5M5YB 1WGGA 4FHKA 1H9RA 4ME3A 5C4XB 1I50H 4JBMA 1KRHA 1U4RA 3AE7B 4YL8A 4PK1A 1FRRA 5JXVA 3JSVA 2L55A 1J0GA 4A3CH 2F0WA 3NQIA 5GAEC 4G4KA 2FJ2A 2Z6KA 3JC66 1HZBA 4CJ0B 1PA6A 2JYTA 2B39A 2NVYH 5EE3A 1SFOB 2RDFA 3ER0A 1IGCA 1XLPA 2WDTB 3CMMB 1G291 1IXRA 4HMJA 2R92H 3BWUD 1YOVB 1JWBD 3GS2A 1DZ1A 3DWGC 1VZ7A 3FC4A 2L12A 4G11A 3DWPA 3EHVA 4KHPQ 3HEJA 2WXKA 5K5PA 3PUXA 2BB6A 4CYEA 1RCVD 2JUOA 3AE5B 2MSED 1RKNA 2O2VA 5HHDG 2P5ZX 2K33A 2XNAC 2JE6I 1PRTB 1WXAA 4URKA 1RYJA 2XRSD 1Z47A 2OXPA 2RCFA 3PO0A 2NPTA 1NENB 3ZYYX 1ZOYB 1A15A 1TY0A 2WHIA 4KKJA 5E6NA 1YMHE 3DEPA 3ML8A 2NBUA 3N32A 4M01A 2JXTA 3JYUA 3BJUA 3AE4B 3P7JA 4HROA 3HHMA 1W6KA 4ZRIA 5C2TB 3OPOA 1Y8PB 4FO2A 3VR2A 1NJIC 4HPLB 1GUTA 1SLJA 2J53A 2NR2A 4E6IA 4P71A 3MC0B 2LGIA 2RPQA 2ZJDA 3P4QB 2N78A 5CMDA 2UU7A 4HIMA 1TQOA 2UXDQ 4APVA 3CCJA 5HGTA 1UGJA 2O5IC 2K6QA 2AWNA 2HIXA 2ONQA 2C5CA 4DNIA 1I4XA 1BDOA 4PYZA 3ZXVA 4JWSC 3VA5A 1CT1D 4A3FB 4MNOA 4XWWA 2B2VA 4U68A 4OWWB 1SYCA 4LF6Q 1PUTA 2LSSA 1XLOA 1TWFH 2AYOB 2ZVNA 3KUZA 4HLEA 2RHQB 1UBIA 2HT1A 5FKAC 2GVBA 4GLVB 4P74A 1VR9A 3A1QA 3TS2A 4LTUA 3DM1A 1B3QA 2BWES 4X6AH 2NZOA 1ET9A 2MJ8A 5KNBA 1HUNA 1WE6A 1EIYB 2MCNB 4TKOB 1ET6A 4O0AA 2UXBL 2WFWA 2C60A 1UF0A 3OJ4B 1EOVA 1K8MA 2I07B 1UGMA 3DBLI 2KVMA 3OTOL 1EZ8A 4GOPC 3PZ7A 4HSPA 1C1YB 1JRPA 3I4LA 4WJOA 3TJPA 3ZTDA 3MXUA 2R61A 3MVVA 4LMQD 3RZDH 2R2QA 1H9JA 3BYYB 1Y56A 1A8VA 3IBEA 1QZHA 5G5HA 1TS3A 3R8BA 1RTOA 5C4HA 4P75A 3HOYG 4MTNA 4P6VF 4KLKA 1B9MA 1VZ8A 1JW9D 3T16A 1NVID 3HG9A 5C44H 2H88B 1LTLA 4LFBQ 2J7QB 2CH4A 2V4DA 1UWXA 3D6CA 4K3CA 2PW7A 1Z9FA 3SFDB
chains in the Genus database with same CATH topology
3NWTA 1ZE3D 3BDOA 1DOIA 1GJXA 4LK1C 2PW5A 4XIGS 3W9CB 4IFDI 3L7ZC 3AM9A 1DOKA 3U9SA 3RD4A 3DXJC 1LO5D 3A7AB 4QF4A 4IURA 4MACA 3GTPB 5CGKA 1N60A 3EFXD 4ZAIA 4A93B 2NN6H 1Y8OB 4TQ0A 3TZDA 2N7JA 1OO9B 3NPPA 3EA6A 2EJGC 2GB1A 3R3OA 1L0YB 3J80E 4XQNA 1JWAD 1SJHD 1TKWB 1WYGA 3OOCA 4MH8A 4OW0A 3GQBA 1G2SA 3GTGB 1CZPA 4A9AA 1XWEA 2M0AA 2WXQA 3MHZA 1NR2A 1TWHB 3GD7A 1Z7TA 2ZXOA 4MHEA 1I6HB 1PYWD 4KGTA 3N52A 2N0SB 1FNUA 2R3ZA 1CI3M 3R2IA 2WNMA 3WOEA 4OHJA 5I6WA 1SBBB 3HOYB 3DWQA 5FK9C 1D5XC 2Y5PA 1LT3D 1G91A 1AEXA 3ONAB 4PNYA 3W3AA 2PMZB 1LT5D 1WRIA 4XYQA 1J8IA 1FIQA 1SXTA 1NCVA 2IJ0A 1S5FD 3MP9A 1SNMA 4PQXA 4QMGA 3SXHA 3HUIA 5GXGB 4K14A 2F0FA 2WXJA 1EU3A 4C80A 3A8KE 4EGVA 2WAQB 4H7BA 3X3MA 4NJCA 4XTCS 2BBCA 2WXOA 2VB2X 4ME5A 4CGYB 1I3QB 2MP1A 1L6UA 3AE8B 1R4QB 3LNNA 5C5LA 1HCZA 1PTOF 1I4PA 2K0PA 2EYOA 1QWYA 2K03A 1BBXC 3HOZB 2PTLA 5EJWA 5CV8A 5C3XA 5J39A 2Z8LA 1XO3A 2CJNA 1O7ZA 4EQNA 3BK1A 1RTNA 2RMMA 3ZJVA 3V3XA 3FPPA 3NBIA 1V8CA 4NKLA 5DAUA 3GTKB 3KQ4A 1V1PB 4Q5VA 2L1BA 3NK9A 2E74C 4DQOC 4PT5A 4TQ1A 3P20A 4TRDA 2WQYB 2O4XA 2NVTB 1EY8A 3TSSA 1F2LA 4C56C 2SOBA 4IUPA 4GZYC 1T3QA 1AZQA 5EPJA 2WXIA 1IKLA 2WP8J 1WGKA 2OEDA 1QF6A 1VZ6A 1O7YA 2FMCA 2EELA 3T3NA 2AQ1B 2K22A 2F0UA 5IGGA 4PMCA 2AQ2B 2Q8RE 1E2WA 4RFBA 4WIPA 1EEID 3BZDB 4Y7NB 1TS2A 3GV3A 2NUCA 2B2WA 1FYCA 1FXIA 4N9PA 2M9VA 3DUZA 4BBRB 4X3UA 4DNRB 3V2TA 1STYA 2EOTA 1F9PA 3Q8BA 1KABA 3I9V1 1X32A 4H44C 1LTBD 4GLSC 4KKTA 3OMGA 4YWGG 2Z4IA 4C2MB 4V190 3LWEA 2KCNA 4BBSB 3CRKC 5EKKA 1G2TA 1DOMA 3OIPA 2F0JA 2WP9B 4NZLB 4BY1B 2JA6B 2E2HB 4LAAA 2PYKA 3A54A 1KDBA 3SK8A 3AE6B 3U52E 1I7HA 2QJLA 4LK0M 3OWEB 2JEBI 1TR5A 1STEA 5JVG3 4YIJA 4R8IA 3K5OA 3K6OA 1D2BA 1FD7D 1RHPA 4RCOA 1WVLA 1R9TB 1QILA 3QWNA 1D5MC 2ON8A 5FR3A 1YN4A 3NS1A 1PLFA 3J7AF 5EPLA 1C4CA 5T8IA 4KI0A 1II3A 1XYIA 3U9OA 3S1MB 4HR7B 2VUMB 5DM63 1OQRA 2JEAI 1TZOA 2Y5CA 1N62A 2NVQB 4BA1I 3BVMA 4KD4A 3P4PB 3P4RB 1KNEA 4NP5A 5CYUA 2X69A 4ZKBB 1SJED 1IW7D 1FNVA 2G9DA 2VZKD 3Q8EA 1PTOH 2RVLA 5AUKA 4M8AA 1AZPA 4M1UB 2K6AA 3TP7A 3I57A 2DYMA 1T5EA 1IBXA 3V05A 1KTKA 2OF1A 5JJZA 5M5XB 1FM0D 2J4XA 2KCCA 2B2TC 2NB0A 1EEFD 3B2GA 3NE5B 1T5XD 4H2AA 5T1GA 5JEAH 1K51A 1G6ZA 4C3JB 2B2YA 2EXZA 1NUCA 2L9HA 1GB4A 3B9JA 3AEFB 2VXWA 4HJGE 2MHVA 1JALA 1KAAA 2RQXA 2JZPA 3NVWA 1OXSC 4RWSC 2QMTA 1S5ED 3RZOB 2W82A 1PTOD 3T51B 4EQPA 1FGBD 5BN5A 3N6RA 2KQ4X 2ENBA 4F87A 1YQ4B 3L3OC 5I2YA 2IGGA 5K36H 3I4NB 1LABA 4IQZA 5E3FA 4J3OD 2QILA 1UAPA 1IHZA 1WTXA 4FVMA 1XTCD 2Q5WD 2LHDA 2QCPX 3T56B 4L6TB 2K3UA 2V3NA 1JOOA 3C1EA 5ISRA 4G7HC 1ILQA 1LTAD 3GTJB 3K59A 1SSNA 1D1IA 5FO7B 2PNRC 4XQQA 1LT4D 1K83B 4A3BB 3JAML 2I2YA 1JOKA 1NSNS 2M19A 3SDZA 4KHZA 3O13A 1KH0A 3FRPB 4OO1H 3TUOA 1OXVA 5BYQA 2IPKD 1O7LA 2INNE 1TT2A 1HEZE 4IKGA 1XXGA 1K53A 4A3KB 3P75A 1F2RC 2PZTA 3TN2A 3K58A 3KF8A 2CHBD 1HTPA 3AV8A 3AMUA 5TSSA 4IUNA 4X3KA 4A3JB 1JCKB 4IUVA 3KWVA 3GTQB 3S2HB 4KV6A 5HG2A 4YXDB 1STAA 4KTAA 5EPKA 2WLBA 2WXFA 3ABVB 4OL7A 2A5HA 1B1ZA 4L2YA 4R3DA 4MM3B 2WV6D 1F2ZA 3S17B 1Y1VB 2YEPF 3HOVB 1IYUA 2WDQB 2QSDA 2PZWA 3KWLA 1E6EB 4RKBA 1GUSA 2EYLA 1DONA 3U4EG 1SEBD 3NSWA 3AU7A 4F7XA 1Y1WB 5C0XI 1CHPD 5A2QL 1EFID 1WD1A 2FHTA 4FXCA 3ZJTA 3MFYA 1MSHA 2E3TA 1VF5C 2IT1A 4YSXB 1GUWA 3VYUA 2WXRA 1TS4A 1QQRA 3T53B 2ID0A 4YTMB 1XCQL 3LX0A 3SFEB 1HUMA 5IGDA 3EGRA 1JR0D 2MJ3A 2KOLA 1U4MA 5JVH3 2XWBB 1BUIC 1EWHA 3HVZA 2TMPA 2NVXB 2F0EA 5HFYA 1PZJD 4ITKA 1FNWA 2DNEA 5AUIA 2E2JB 1S5CD 4DXFA 1F9QA 1D5ZC 1IGDA 4YT0B 2PLPA 2J52A 1EIHA 3SR6A 3GTMB 4B9XA 3D4WA 1C4PA 1C4AA 3W5VB 5JPNC 4NDXA 3I4MB 1BR9A 2C9OA 4IFDH 1ML0D 4RH6A 1UWMA 2HTME 2VNUD 1YQ3B 2BT6A 4KJNA 2QDBA 3PUWA 1EY5A 1PDQA 2L52A 1GXDC 2LMCA 1FCLA 4XDCA 4QB4A 2RKSA 5A35A 2L1AA 4OVZA 3AEAB 1EWYC 3H3VC 3VR8B 4DN4M 4ABNA 5M3FB 3HRZC 1QOFA 3MXGA 1EY7A 1QJOA 1ACCA 1PRTC 1Q1BA 1B4OA 3MAQA 1EQTA 4HMIA 1KLUD 1A3TA 4EVOA 1F2MA 5D3DA 2V3PA 2JYEA 4A3GB 5EGTA 5A2QE 1Q12A 1BCPB 3U2SC 1EY9A 1WWTA 4USAA 5LL6S 1CA6A 1DM0B 1YJIA 4HTHA 3NVYA 4ARIA 5D65A 1TYGB 5I2XA 3QB3A 1I4HA 1V43A 2AUKA 1R4PB 4QCLA 2JWUA 3H6MA 4DF7A 4V0BA 3TBIB 1PFBA 3W1SA 3PO2B 1FD6A 5CV9A 4WORA 3E56A 4XQJA 3RMHA 4FF4A 2J42A 4B9WA 4OGQC 4L8JA 1TU2B 3PUYA 4J1MA 3P1HA 2KWDA 1D4BA 2F4IA 3K5NA 4DA2A 4S3SA 4XDXA 3NWSA 4R8NA 3VR4A 4HCSA 4XE0A 3W2DA 2Y3AA 3AE3B 2E76C 1Q10A 4DAYA 1RJTA 4WQMA 2K9XA 3KBGA 4IUUA 3P42A 2F3WA 2K01A 2AX5A 1N5XA 4C1NK 4UAIA 3TP5A 2PIAA 1GB1A 4N59A 1Z6HA 1A70A 2EZVA 3W5UB 1OFFA 5IGEA 2BS4B 1L6VA 1A3VA 2O5JC 2NN6G 4BS9A 2G9HD 2JU6X 2F3VA 1E0BA 5CV6A 1YNNC 1EYAA 2F0TA 5CV5A 2EE1A 4KN7C 1VJKA 1N61A 2IX0A 4K5WA 1HZ6A 3WCQA 4HAEA 3PUVA 1BXTA 5EBCA 2WIIB 2N9LA 1CFMA 3AE2B 3E0JA 3SE0A 2X6GA 1JWMD 4OIKA 4REZA 1PFNA 4KK7A 3I8ZA 5J22A 3I90A 1AW7A 2WKDA 2WU5B 2AQ3B 1K50A 3C8YA 2CW0D 3MXNA 4J8QA 1SYBA 4A8XC 1Q90A 2ZW0A 2NBFA 4RAUC 3IFDA 1DCZA 4KKIA 3TEXA 2LHEA 1CK1A 3Q23A 2IGHA 1QNUA 1EYCA 1DGJA 3LYYA 2A6HD 4KMUC 3I73A 3M4OB 4UDUC 1HRJA 3VR5A 2IW3A 3DWMA 3ERQA 2LEKA 3QIAA 2HUGA 4G7ZC 1L5PA 1PDXA 3TDQA 5E4XA 2RPVA 4BA2I 4KY7A 1STNA 1PGXA 4JK1C 1KNAA 2FE8A 3J9CA 3SK6A 1IKMA 3S1QB 1VF7A 2AUJD 1MHHE 5EE9A 2LY7A 3URYA 1S5DD 2E2IB 1SDFA 3EQLC 4XYOA 2Z4HA 2DYOA 5D3IB 4HEDA 5EQ0A 5EKLA 4NMZA 2SNSA 1IYVA 2XIWA 5KEEA 1YNJD 2NYZD 3CRLC 1OXTA 4PMWA 2RDHA 2L32A 5DEHA 3LB8C 4HSVA 3S15B 1HFGA 1BNZA 2MEKA 4F88A 2CW0C 1PFDA 3BDLA 3CWIA 1JOQA 4OZBA 5I6YA 2KN4A 3IAM1 2CVRA 4ZUIA 4LJZC 3C2PA 3PV0A 1T6BX 1CA5A 3AB9A 1WTOA 1VRAB 3G6JB 2A6HC 1SB3C 3AEGB 4DFAA 1RM6C 3TEZA 5I9OA 2K5DA 3ND9A 5IGCA 1L0XB 2JA8B 4A55A 2JP1A 1E0ZA 2YU9B 2Y0SB 2A68C 4YSZB 2EJMA 3GO5A 1TKGA 1SYEA 1XCTL 2KEDA 1QOHA 1M8AA 1DOLA 3EUB2 4K6DA 5KNDA 1JROA 1UNSA 1K8OA 1D1KA 1OXXK 2XVSA 3VRAB 4DXGA 1TS5A 1WSPA 5T1IA 2INPE 3Q24A 1VLBA 2DY7A 4CKEA 4OZCA 4GDLB 1LTTD 2B2TA 4A6QA 1YNJC 4MN3A 1FFUA 3J7YW 4XXEA 1H9SA 2ZXPA 1B50A 1CQVA 4WURA 3VRBB 3TEWA 4RKLA 2I38A 1SNCA 3Q8FA 2ZT9C 4WFN3 4L23A 1PRTF 2DN8A 2BOSA 2WXGA 2FINB 2A6ED 1ZUD2 2Z1CA 3VYSA 3Q0AA 2BYTA 5CR3A 1P7EA 2V4IB 2EJFC 1BOSA 1VMCA 2BTEA 1V97A 3OSOA 1DYQA 2YYZA 2B2UC 3GP7A 4K2LA 2K05A 1LT6D 2KHSA 4KHVA 5DM73 1HA6A 4NAMA 3S1RB 4OZAA 2DBYA 4ZHPA 2R7ZB 3IL8A 3ZGZA 1ZEQX 5E1FA 2EYPA 5LNK1 3ZJUA 2IDYA 2B8FA 4DAPA 1TKEA 3FKIB 5ELEA 2EPBA 3Q8AA 1MPEA 1BCPF 1GOZA 1O80A 4IN3A 4XWTA 4KKUA 3M3YB 3BDCA 1S5BD 4A3IB 3P1MA 4NAWB 1GUNA 4RGOS 4NW2A 2J7ZA 4ZRZA 4ZKCB 5C5MA 2K5WA 2TSSA 2EY5A 1SYGA 4IOIE 3AE9B 1DJRD 2G1EA 4CBVA 2F0DA 3MZ5A 3KUPA 3RPFC 1N63A 2A6EC 2H89B 1C76A 2R93B 5ELDA 3S14B 2F1MA 2WS3B 4ZYSA 3NVVA 4ZK9B 3NUCA 3J7AV 5JOBA 5C6AA 2F0QA 1P7FA 2JXMB 3I91A 3R2TA 1NYRA 2F0IA 2KA7A 4FYDA 4BY7B 2NTSA 3EROA 5LHY1 2J0TD 2JX5A 1U4PA 4K8JA 1RFKA 3C1FA 4C7YA 2BA0A 1NAPA 3IFTA 3BVGA 1IBXB 4RF0A 4WAFA 4JPSA 3CHBD 3M85A 4K5XA 1ONLA 1LTSD 1EY6A 4H0LC 1ICWA 3KBXA 2X6LA 1OXUA 1F9SA 4RHRA 5E6JA 2XSCA 1G8ZD 4KGRA 3EJIA 3K5LA 5C0XH 2HDMA 4WRDA 5ELBA 1LTID 3GTLB 1YNTE 5D7GA 3FILA 4A3DB 1FEHA 3WDNA 2OEOA 3PIO3 3Q69A 2D5DA 5DNFA 4CJ2C 1D6EC 5F2DA 4K2KA 2JA7B 1ZP0B 3LXFA 4FF2A 1PTOB 1CZGA 2WINB 1HPCA 4IALA 5FLXL 3L4PA 1RODA 3NHHA 5EKIA 4H13C 1RDPD 5C3EB 1ILPA 2IX3A 1STHA 4B08A 2KECA 1HZ5A 2BS2B 2F0KA 3NTKA 3IT6B 4P16A 4US8A 1UEAB 1ZXIA 2K7VA 1MHXA 2WKCA 3T4AC 3QG1A 5D14A 2Q8IB 3AMZA 2BDNA 4XT1B 4TSSA 5KYIA 5EE1A 4X3TA 2A73B 4JWUC 1JQYD 4Z9CB 3C3LA 1M4VA 1SAPA 2HCCA 1A6XA 5C3JB 2MH7A 1KDAA 1SIJA 4RA8A 2WXPA 1LTRD 3BG3A 2NMQA 1BF4A 1CM9A 4I7ZC 3TP6A 4GDKB 5CBEE 2PCFB 1J7AA 2D5GA 2XRQD 4FXGC 1STGA 4MT5A 5ELFA 1MBYA 2SDFA 3OW7A 4IFDJ 1L0VB 2KUMA 2BB5A 2JSVX 2SNMA 1B9RA 3K57A 2XN9C 3VR9B 3KLRA 1PRTD 2HDEA 1QE6A 1VCIA 4LLGM 4ARCA 3RLFA 1ZYRD 4FP5D 3JAME 3FEWX 2D9UA 2O2LD 3HP3A 3NZ3A 1ESFA 4AYBB 2PPBC 2E2DC 3FVQA 4WWMA 2DY8A 1O78A 2LS01 3CKIB 1WTWA 1A2UA 3ND8A 1F9RA 4EQOA 4F8MA 4JE3B 1DOXA 5BN3A 1XX8A 4KGSA 3FMCA 2D62A 3ITPA 3IKJA 2PVGC 2ACZB 1JE4A 2BDOA 3CIRB 4CHTB 3S2DB 1H9MA 2K32A 3D31A 3D3RA 5CV4A 1JMLA 1F2YA 2N55A 1BCPD 1JC7A 2EYFA 2NWGA 2RA4A 3MA2B 1I6VC 3S16B 1FMAD 5AFWA 2PZUA 1TWAB 3EVQA 1X3QA 3M7GA 4O1NA 4RGTA 1TVXA 1EL0A 3MFGA 1WTQA 1WCMB 1PXUA 3DWAA 1QLBB 5CORA 3PMFA 1EQVA 5M5WB 3UI3A 5BYRA 3MEHA 2I46A 5H8YE 3R93A 1ZYRC 2NTTA 1WTRA 2L5TA 2OT2A 1SE4A 2EYJA 3J80L 1XEEA 4ZQ3A 4IFDG 2F0VA 5NUCA 2BA1A 2EY6A 4DK1A 1C48A 1LACA 5I4DA 1F77A 2A74C 4HCEA 3P63A 3QJYA 3NQTA 1NYQA 1HHVA 3WOFA 1JORA 2IL8A 3A8IE 2K5QA 4O42A 4B0MA 3QOLA 3HVDA 3A8JE 3NP8A 2WB1B 2PQEA 3GV6A 1MD2D 1YNND 2PVOD 1QT9A 1BCPC 1FFVA 1MI0A 3A7LA 3GTOB 3AN1A 2ICIA 1EY4A 4ZRQA 2LMCB 1L4ZB 4RCNA 4XDDA 4CKBA 5EE0A 1SYFA 2H4OA 2LKVA 2RDGA 2GI9A 1QKZA 3SVMA 4G7OC 1KF6B 1QOAA 3SK4A 3Q8CA 4PMBA 3VR3A 3DMUA 3IAS1 2EY2A 2FFKB 4WJWA 5BYSA 2MGSA 1I50B 3NTIA 2MJDA 2W3SA 1B9NA 2H1EA 1MI2A 1EZ6A 1B3AA 1RF2D 1SF0A 2NVYB 1CJEA 2R92B 1FR3A 3J81L 3OHXC 3S9WA 3BIID 2E6XA 1AP0A 3OMCA 4DNTB 1RD9D 2FBWB 3H09A 2WXNA 1OQQA 3B2FA 1STBA 3KLSX 3E9SA 3F2UA 3DHQA 4DK0A 1Q1EA 2B2VC 4DGZA 1BMLC 1QOGA 2JQRB 3FAHA 5C4ZA 4A90A 2WACA 1WTPA 2AWOA 1FCCC 4TMAB 3PUZA 3SEBA 1SNOA 1CTMA 2N88A 3L9AX 1FXAA 4IDIA 4K5VA 5J1ZA 3Q22A 1QOBA 2PMVA 3VR6A 2MUYA 2GA4B 4IUTA 2F0HA 1X3PA 3HKZB 1TWFB 3U7ZA 1PGBA 1V1PA 3CU7A 1SMYD 1EIGA 3K5MA 1TKYA 2MPMA 5E4WC 5IOCA 3ETRA 2JSOA 4DU9A 2K1BA 2W54A 3VYTA 5IGBA 1MVKA 3TEYA 2WDVB 3MXPA 3RZDB 1J7BA 3ZQ4A 4ZUJA 5IT9L 1I4QA 2SEBD 3NTHA 2DNCA 3MHBA 4CQNA 2F0LA 4I65A 4J6HA 5C44B 4D2KA 3N9YC 1SE3A 3D4DA 1C8CA 1MSGA 3H8HA 3NRZA 2NN6I 3G7LA 2F0PA 1ROEA 2QF7A 3C46A 2PKOA 4FXKC 2FUG1 3T3OA 1SNDA 4US9A 4JX1C 4L1BA 4RHSA 2L11A 3I70A 2JA5B 1Q3LA 1EOTA 2A68D 3J81E 4IZ8A 2YEPB 2FMMA 1Y69U 3VA7A 4FNFA 2CJOA 4KJOA 1S4ZA 2DLBA 3FPUB 1TJEA 1XLQA 3SK5A 1W6JA 2QEJC 2QIEB 1DXMA 1C78A 1ZDXA 1IL8A 1XF5L 1U4LA 1SMYC 1SSOA 2W55A 3IXSA 2SAKA 1J7CA 4M0WA 1F0ZA 1TWGB 2F0GA 2ZW1A 1VDVA 4C3IG 1ENAA 3M4YA 2BW2A 2K5PA 1HXYD 1J9OA 1E2ZA 2GRIA 3AECB 3TZUA 2HQEA 1V8QA 1ENFA 2CQAA 3AEBB 1GAQB 4CJ1B 2B2UA 1LLRD 4AQ7A 1EYDA 3BVZA 1NI3A 2L83A 1CQFA 3PZ8A 4HEA1 1DD2A 2KACA 2KEEA 3FDTA 5IT9E 5M9OA 2DWQA 3A56A 3UI2A 3HRDD 4A3EB 1K52A 5BMHA 1BO0A 2D2CC 4N9TA 1ZXHA 2L4NA 1AN8A 3QOJA 1SNQA 3NXWA 5ELCA 1QG7A 1JQ4A 2F0MA 3AE1B 1CHQD 2PW9A 3HS0C 1I4GA 5I9PA 4WH4A 1BQQT 4Q2JA 4QUFA 5IODA 3IT4B 1N5WA 3H91A 1Y8NB 1WXQA 1JICA 4TQUS 3GB1A 3AB5A 4EE2A 5BMGA 5LL6X 1C9FA 1FRDA 4C3JG 5KGUA 2EYMA 2F0NA 5JEAJ 5BN4A 5G3LF 1JB3A 4C3IB 3K7AB 4QUCA 3MWYW 4KX6B 1B44D 3OWFA 1MGSA 1EM7A 1C77A 1CZWA 2B2WC 3QO2A 3VQIA 2X38A 3A55A 4ID6A 2EYHA 4ZRPA 1ZDVA 4ZOHC 2IX1A 3TMEA 3BS1A 4G57A 4L63B 1A2TA 1H9KA 1UUPA 3TP8A 5H92C 1LTGD 3HOUB 2R6GA 3X3NA 2M00A 1E7PB 1HTLD 4RGMA 3SHLA 5KYLA 1AWDA 1PGAA 4YTPB 2EKIA 3LWUA 2F03A 1YN3A 2MJEA 1H9SB 4ILWA 3NVZA 1PMRA 2CU3A 1TY2A 5IIFA 4YSYB 1JWSD 2EY1A 2V0GA 2JYOA 4KY6A 3S1NB 1Q8IA 2RSNA 1QCBD 2ZXRA 3BYTB 1BUVT 4ZHOA 4ODGA 3DEOA 5FO8B 4U673 4N6EB 1HFNA 1SYDA 1ZXTA 2PO4A 3HGBA 5C0XJ 4OIJA 4KY5A 5MPOA 5FO9B 3KLSA 1YN5A 5JAVA 1XLNA 3BK2A 1EU4A 4K6LA 4KD3A 2KAJA 1PFMA 1WD0A 1C79A 2VZKB 4A3MB 1ENCA 2BE5D 4RGNA 2L0CA 3HOXB 1GPXA 1GHJA 4CKCA 5JEAG 2IWHA 5HURA 1AFPA 4PV1C 2EVBA 1QNKA 1EY0A 3I3CA 2ICEC 3Q6SA 1FO4A 2BCOA 2HCIA 5CBAE 2LFNA 3I72A 1WTVA 3NUHB 2WU2B 1DOYA 1IW7C 5HI1A 1PZKD 3H0GB 5FOBB 4C7ZA 1TWCB 1E10A 1F2RI 2E75C 4KN4C 2F0SA 1RWSA 4KKSA 2N9KA 2M2LA 1TIID 4K8IA 1AYFA 4X3SA 5K36G 4HN7A 4RNAA 2LFIA 3MJ5A 1YJJA 1QB5D 3K0YA 2F0OA 3AEEB 4N58A 4C3HG 3SR1A 1GHKA 2VB3X 2IGDA 1KDCA 3D4RA 5CC4A 4P2CB 1U9RA 3HZXA 2B2YC 3VYRA 1ZPSA 2RBMA 2BE5C 4DAVA 3HOWB 2KQ3A 5C0XG 1GUOA 3NBHA 2WDRB 4Q0FA 5BMIA 5IGFA 1C4QA 2M56B 4FXDA 1I4RA 4OO1G 1PTOC 1HQRD 4C1NI 2WXLA 3MTSA 3T13A 1VDZA 2A69D 2W3RA 1SNPA 2EDGA 5COYA 2B8GA 5KNCA 1R7SA 1GUGA 3CQZB 5C3WA 2LJIA 2B63B 2RSOA 1B2TA 2OHFA 1NEKB 1VMPA 2NZ1D 5KRUA 3AH7A 1KLGD 4HKQA 3FILB 4MIUA 5JPMC 4R9WA 4RF1A 1L4DB 5KIXA 3P4SB 5CV7A 4FF3A 2WXMA 1SE2A 4B0EA 4FF1A 1JWUD 2KDMA 2K28A 1IUEA 1EWCA 1NR4A 4JBWA 4XT3B 4IUQA 3M7NA 1HA5A 1E2VA 2K04A 3H94A 4C3HB 5C4JB 3D8GA 3PIP3 2LUMA 3AEDB 1B53A 2KMMA 2B76B 1KFYB 2XWJB 5G3LD 2QKIC 5G5GA 4QIWB 3E6ZX 3RUZA 3V96A 3PO3B 4ZLTF 5EBDA 4OO1I 1HQMC 1V1OA 1A3UA 3RFZB 4BWGB 4HRSA 2KJXA 5M3MB 4YTNB 1ESRA 2HDLA 3D6WA 1PZID 2A69C 5FLXE 4HKZE 4ULLA 1E9MA 2BS3B 3KK7A 1ZKOA 2WXHA 3OIQA 3E5SA 2Q8TA 3IAYA 1LV9A 5M5YB 1H9RA 5C4XB 1KRHA 3AE7B 1U4RA 5JXVA 1FRRA 2L55A 2F0WA 3NQIA 4G4KA 2FJ2A 4CJ0B 2JYTA 2B39A 5EE3A 1SFOB 2RDFA 1IGCA 1XLPA 1G291 4HMJA 3BWUD 1JWBD 3GS2A 1DZ1A 3DWGC 1VZ7A 3FC4A 2L12A 3DWPA 3HEJA 2WXKA 5K5PA 3PUXA 2BB6A 1RCVD 3AE5B 1RKNA 5HHDG 2K33A 2XNAC 2JE6I 1PRTB 1RYJA 2XRSD 1Z47A 2OXPA 3PO0A 1NENB 3ZYYX 1ZOYB 1A15A 1TY0A 4KKJA 1YMHE 3DEPA 2JXTA 3AE4B 3P7JA 4HROA 1W6KA 5C2TB 3OPOA 1Y8PB 4FO2A