2AQ1B

Crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWHGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords T-cell receptor beta chain V
total genus 69
structure length 234
sequence length 234
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aq1B02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2aq1B01
1LO5D 1I4HA 3V05A 3TSSA 1B1ZA 1SE2A 4RGOS 1LTRD 1BCPC 4L63B 1D6EC 4NZLB 3O13A 3BVZA 1PRTB 2XN9C 1L0YB 1RF2D 1KLUD 1JWMD 1CK1A 1JWUD 1SEBD 4RHRA 2J4XA 2G9HD 1HQRD 1PTOB 1EEFD 1RCVD 1D5XC 3W2DA 1TY2A 3KLSX 1SJHD 4DXFA 1LT6D 1TS5A 2SEBD 4O1NA 1XXGA 1PZID 2XRSD 1PRTD 1TS2A 1ENFA 1DJRD 2ICIA 1D5MC 3CHBD 1ESFA 1I4PA 5ELCA 1LTGD 1F77A 1FNVA 1PTOF 3R2IA 1HXYD 3MFGA 4K6LA 3R2TA 1EFID 5ELEA 5D3DA 4DXGA 1YN4A 4RGNA 4RCOA 1SJED 1BCPF 1LT4D 4L6TB 1B44D 3DWQA 1STEA 1DYQA 1HTLD 1PRTC 1TS3A 1CQVA 1S5BD 2QILA 1I4RA 1RDPD 3GP7A 2TSSA 1GOZA 1S5ED 1SE3A 1PZKD 1JR0D 1XTCD 2AQ2B 3BVMA 1S5CD 3BZDB 1EWCA 1D5ZC 4UDUC 1I4GA 1PYWD 1LTID 2RDGA 1YN3A 1EU4A 3BYTB 4C56C 2NTTA 4RGTA 4OHJA 1I4QA 1JCKB 2CHBD 1BCPB 1FD7D 3DWPA 4ZYSA 1SE4A 1PTOC 3MC0B 1LTBD 1ET6A 1YN5A 4RH6A 4Z9CB 3R8BA 5I4DA 1SXTA 3BVGA 2Z8LA 1V1PB 1KTKA 1V1PA 1AN8A 1LTTD 4TSSA 1FNUA 1T5XD 3EA6A 3OWEB 1TS4A 5TSSA 5ELBA 2AQ1B 1CHPD 4RHSA 2R61A 1PTOH 2XNAC 1QILA 2QEJC 1LLRD 1LT5D 3BYYB 2RDHA 4RFBA 1KLGD 1FNWA 2AQ3B 2IJ0A 1MD2D 1UUPA 5FK9C 5D3IB 1G8ZD 1EEID 1PTOD 1L0XB 1JWSD 4RGMA 3SEBA 2NTSA 1PZJD 1CHQD 2XRQD 3DWAA 1BCPD 1LTAD 1S5DD 1V1OA 2WV6D 4BWGB 2IPKD 1M4VA 1AW7A 1EU3A 1LT3D 1ET9A 1I4XA 1RD9D 1FGBD 5FKAC 1JQYD 1HA5A 1BXTA 1UNSA 1TY0A 1SBBB 3EFXD 3URYA 1LTSD 1PRTF 5ELFA 5ELDA 1CT1D 1S5FD 2O2LD
chains in the Genus database with same CATH superfamily
2N7DA 2QDLA 1PDXA 1PFSA 2ASBA 5JPMC 1PMRA 4C4VA 2Y0SB 4GDKA 1XMOL 1EFWA 1VQNA 2A74C 3QAQA 2MCNB 1WWTA 3X23A 1J7AA 3QCAA 5IT9E 3RZDH 4JBMA 1P3QU 1ZDVA 2FCSA 1A5RA 3QG1A 1E90A 1SFOH 1RTOA 1XX8A 1YNJC 4YWKA 2N55A 2JA8G 2MBEA 4OZCA 2KHSA 2RD0A 4PS8A 3TEWA 2A6HD 2WP9B 4RF1A 1F9QA 3J81j 4KLKA 4IUNA 4NJ6A 3A9JA 3DCGA 2MQHA 3HOVB 3SR6A 1SMXA 3GTKH 1CKNA 1RRBA 4DKAC 2A73B 3ITPA 3U9SA 4G7HC 1WZ3A 1ILQA 3OMCA 1WE6A 2N1VA 3CCMA 2Z0SA 1FNVA 4DV6Q 3IT4B 3GOEA 2IYDB 3MFGA 4K6LA 1F9PA 4V190 2BKRB 1EYGA 2CW0C 1CA5A 4W9DA 1LT4D 1RIPA 1SLJA 2N7JA 3IBEA 3HG9A 3K9OB 4EX5A 1Q12A 1FPYA 3D3RA 2LGSA 3MA2B 4G11A 1QOGA 1YNTE 2ICEC 3BU2A 1O78A 1S5CD 2R7FA 5FLXL 1L0VB 2PVOD 1D5ZC 2PW7A 5J22A 1MHHE 2GBRA 2PLPA 1I4GA 3DVGX 1CQFA 4XWWA 2RSUA 3ONSA 1WRDB 3DPDA 4FBJB 1JCKB 1HZAA 2Y3AA 1NTGA 2PTLA 2F0QA 3Q3FA 3GTQB 4A6QA 4C3JB 3JSVB 1YIJA 3M85A 5C3EB 1R9TB 4WH4A 4GOCA 4G57A 1S3OA 2ASQA 4NY0A 3VVWB 2E5LL 3B0AA 1N34Q 4LF5Q 3DBRB 4XWTA 4DR2Q 1FO4A 3D31A 4KD3A 4A3DB 2MH7A 4LNKA 4BY7H 2F52A 2AWTA 2H5XA 4GOPC 3PF4A 2B3AA 4HIOA 1V8CA 3AE8B 2CH4A 2KACA 5JPNC 3VRAB 1L4DB 2KANA 1LTLA 4H13C 5IO9A 1HHVA 1R4NB 1M1KC 5M5WB 1FNWA 1PLFA 4LF9L 1MPEA 4QIWB 2NPTA 1GUGA 1L7YA 2B39A 5KNDA 3DOWA 4C1NK 1PTOD 3VYSA 2JPHA 4A3KB 3VXWA 2BT6A 4HROA 4DDGD 2WXQA 1QOHA 5IE8A 1J5EL 4PS7A 2L15A 2WXMA 1HUNA 2IPKD 3JAMc 4KZ0A 3L16A 2B2TA 2FE8A 1I94Q 4HPMB 4DQOC 2EOTA 1K8OA 3QJYA 3SK6A 4B9XA 2WXLA 3ERSX 1JE4A 3CC7A 3AFQA 1GC7A 1QLBB 4OONA 4HAEA 4IALA 1F2MA 1IKMA 1ZDXA 5EDSA 3X3NA 4CDFC 2M17A 4OVUA 4AWJA 2G5DA 3ULJA 2AL6A 5ELFA 1Q86C 1KXLA 3Q6BA 1QOFA 5EKIA 1LM8B 2J42A 1EY8A 1YNNC 5NUCA 4UAIA 2J0TD 3KK7A 3WDNA 1TIID 1VQCA 2F0SA 3LGJA 3HOXB 3H3VH 3H6MA 5J39A 5K36H 2PNRC 3S9WA 1BMLC 4KHZA 2G1EA 3AU5A 5GMVA 1LTRD 4CBVA 4GKKL 3OAWA 3UIPB 4ULLA 3T3OA 1B9RA 3IRBA 2L55A 3PUVA 1RAXA 3HOYB 3VHTC 1G6JA 1U5KA 4NW2A 5LMUQ 2K4KA 5AUKA 1SEBD 3QB3A 3PO0A 2J4XA 1E8WA 5BYQA 4ARIA 1KAAA 1RCVD 2L00B 4HLEA 1D5XC 4IOCA 1QE6A 2CH4W 2MBOA 5AFWA 5BR8Q 1PRTD 1OEYJ 4IPCA 1PV4A 3H1UA 4NQKE 4LUVA 2D3CA 1D5MC 4EKUA 3U30A 4JK1C 2N9EB 2Z4HA 4PZ7A 4BY7B 1F77A 1B50A 2NVXH 2RSOA 4DXAB 1B3QA 2KJHB 4MH8A 1G51A 4XDXA 2KT7A 4FHJA 3R2TA 4IDIA 4LWCA 2F3VA 2D5DA 4RCOA 1SJED 3L3OC 5AJ3L 3GTOB 4L6TB 1VQLA 1C0AA 5IKCM 2RHSB 4NPSA 2QILA 1WXVA 1Z7TA 4BAXA 5BMIA 1F2ZA 1YMHE 2TSSA 1F1HA 5IGGA 1HQMC 5H1SE 1Q46A 2F0VA 4KKSA 1WH3A 1XLNA 4MSMB 3A54A 2JZ3B 5C44H 1LTID 1IYFA 4I65A 1MG4A 1SIFA 4C56C 3I57A 1I4QA 2KLGA 2KTRB 3KDFA 4IOIE 1HJPA 4LFAL 1NVID 4A3MG 3KDFB 1P9DU 4A3IG 1X9NA 4Z9CB 1WTRA 1NDDA 2WP8J 3KWLA 3BDLA 4YTMB 2B63G 2JZZA 1VQDA 3MEHA 4CJ0B 3NRZA 2JRIB 1S1QB 4TKOB 1XLPA 2QJLA 2EPBA 2EE1A 2V4LA 1BQQT 1Q1EA 2OJWA 1VQ7A 4MM3A 4ZRIA 2I2YA 4P74A 4A3EB 3AEDB 1TS4A 2LVOA 4MELA 1OXVA 4IFDG 4JV5Q 4MM3B 3TDQA 1I50B 4F88A 3HOUG 2JSVX 2E2JH 3EHVA 2JA7G 4IM2A 3DEOA 3I72A 2VB2X 4L8JA 1WX8A 1XTDA 2A19A 1WTVA 4GN1A 3HOZH 5KIXA 4DV0L 3H0GH 2NVYH 4DR1L 2K5VA 2PIAA 3QIJA 3T8MA 2GBMA 3AMUA 2L76A 2C35B 3TEXA 5D94A 1CHQD 3DWAA 3PUZA 3SK4A 1QJOA 3NTHA 4JI7L 1S5DD 4BY1B 3D4RA 1XNQL 3L17A 4MH0E 4BBNC 1FL0A 1YNXA 2HIVA 3T53B 2AEHA 2EJFC 3L4PA 3RYTA 5IGDA 1Q5WB 5ELOA 4KHPL 1U4AA 5HKHA 5CV6A 2WHIA 3RNCC 1PH5A 3EFUA 4B9WA 4RWSC 3PO3G 4YIJA 2OTLA 3NS1A 3NVVA 4C3IG 2IT1A 1XLQA 3HOUH 1BOSA 1I3QB 2MJ8A 3Q8DA 1WJ4A 1T9HA 4NXML 3PGEA 2NYZD 3CMEA 4XYCA 3H0GG 2K7VA 5KEEA 3JVZX 4N6EB 4B0MA 2Y0SG 3HOWH 2ZNVC 2E75C 4HJ8A 5DCNA 1O7IA 4JI0L 3IXSA 3ZNGC 2LKVA 3IHPC 1SDFA 1PRTB 1KHIA 2L4NA 5CORA 1H9RA 1L1OC 2CQOA 2A6ED 1CK1A 3RR5A 1VLBA 2WXFA 4UP8A 4NAWB 4A20A 5ISRA 1FD6A 1STBA 4EFOA 4QL5A 1E2WA 1K8RB 2VL6A 2MBQA 1LACA 1X3FA 4QCLA 3RI7C 2L1AA 2KWUB 4A3OA 4ZKBB 1SJHD 5ELNA 1PA6A 1IKLA 1X6OA 3W1GA 1XPOA 1XXGA 2W54A 3UGBB 3ZDMC 4M0WA 4C3IH 2ON8A 4RM9A 2IBIB 2R93G 2DZJA 2KX0A 3AB9A 1ESFA 4DR5Q 3RNUA 1SNQA 2A1AA 1YJIA 3LWEA 4CQNA 4CHTB 1HXYD 4BXXG 2BA1A 2RQXA 1W6KA 4DXGA 5C3JB 1HZBA 4KDIC 3UI3A 3CRKC 1YNJD 5GXGB 2ZTEA 3TMPB 1HR0W 1STEA 4HSVA 1CQVA 4MIUA 2E2IH 1A0IA 2RHQB 1H9SA 2ZXOA 3QQ8B 4JQWC 1OXXK 4KGRA 4BA2I 2OXPA 5BMHA 1TWGB 1TKGA 2PQEA 4K7WA 5JEAH 1EU4A 4JBJA 4X62Q 2NS5A 2WX0A 4GLXA 1HTPA 1FD7D 3TRZA 2DZMA 3I70A 5KHOA 1HEZE 4BKTA 1KABA 1Z9FA 2JN4A 3N52A 4LFBQ 1EO6A 2IGDA 2KFKB 4DHJD 4RH6A 3Q22A 3R8BA 4AQYQ 1J7BA 2YVCA 3OMGA 2NZHA 2L11A 2CW0D 3VA7A 2ZJQA 5FJ8H 2CWAA 2Z8LA 3WANA 4K81A 2B63B 2MWSB 1EY6A 4J8QA 4EEWA 1L1OA 4ME5A 3CPWA 4NXNQ 3RLFA 1I7HA 2C7MB 3I55A 1V8QA 3ULLA 1W3SA 2H89B 2LMCB 3OTOL 5J18A 2R61A 2XNAC 3VUWA 4LK1C 5CMDA 2F0NA 1X1MA 2M1MA 2D11A 4I7ZC 2UU9Q 2WXHA 3N1XC 3AE9B 2REXA 4M8MA 3Q3NC 3OHXC 5CBEE 4BKSA 1EEID 1TVXA 4LF7Q 3GQBA 4DNIA 1GNUA 2JU6X 2YEPF 2WKDA 4N58A 3B2FA 2C7NB 4HJ9A 4K6DA 1JMCA 1J9OA 3HHMA 2B3GA 4OIJA 4OL7A 1UE1A 4A3FH 1XO3A 3Q8FA 3S2DB 2JWUA 3PV0A 2L83A 3H9DA 5LNK1 3CQZB 2XK5A 3AE3B 4B08A 2JXMB 3ZUNA 1FGBD 1WI0A 4EQ5A 5I6YA 2X8XX 1ISNA 2RGFA 3V60A 3FKIB 4ZUJA 1BXTA 3ZO5B 2A4ZA 1WGKA 3OOCA 3DVGY 4J15A 4DAPA 2O2LD 1PVOA 2WXRA 3ZTDA 3H0GB 4C00A 4B3TL 3A7LA 3V05A 4KK7A 4OGQC 3HOVG 4W9IA 2MPMA 3S1NH 1KJTA 1GC6A 1PGAA 4M8NA 5D6JB 5CGKA 1E1TA 2JA9A 2RCFA 2C9WB 4A3CG 1X56A 2UXDQ 1IL8A 5CV4A 5IP9G 5KYLA 1XNRQ 3KUCB 4JE3B 2NZ1D 4NPNA 3RNBC 1H95A 4M1UB 4JPBW 5CTRC 1P1AA 3SDZA 1PYBA 2BYTA 2A5HA 3E0JA 3V2TA 1FR3A 3F8TA 2WU5B 4ZHPA 1LYLA 4P6VF 1SE9A 2KLCA 5M5WH 4ODGA 5EQ0A 1NR4A 5FLMG 4HJKA 3ZNHB 2J52A 2XWBB 2DNEA 4HN7A 2BWES 2JP1A 2PW9A 1RKNA 1YN4A 2PPHA 3X0WA 3GTPH 2FIDA 4OO1G 3VTVA 4F8MA 3DWQA 4Q2JA 1FM0D 1NMFA 1TS3A 5EJWA 2MBHA 4B0EA 2RVLA 3K7UC 1E7ZA 2AQ2B 2OWOA 1NYRA 2BYFA 1EWCA 4GN5A 2UUAL 5EPLA 1R7SA 1ZYRD 2K8HA 3L08A 5M5YH 1P16A 2D0OA 4A90A 4DR4Q 2FAZA 4YTNB 4QY7A 3TP6A 1FRDA 1I5FA 2EVBA 3C1FA 1BCPB 1SROA 2D62A 3CW2C 5C3WA 4HCPB 3FPPA 1PHJA 1VF7A 1IBKQ 3PV1A 3S1RB 4IQZA 1VQPA 1UGMA 4HPPA 1KDBA 4K1RB 3AEVA 4MJSA 1JOOA 4BOZB 4A3IB 2X6LA 1XQQA 3CSFA 5CHWA 3W5VB 3M7NA 1Q8IA 2PQAA 2XSCA 3IVFA 3RD2A 2EJGC 5IYCG 2C5LC 4POGA 3HP3A 2E2IB 1KNAA 4AQYL 2YLMA 3CSTA 1RHPA 4JC0A 3VAWA 1EZ8A 1CHPD 2CU3A 3IAM1 3FPUB 4A3JG 3IFWB 1KNEA 5C3XA 1EIYB 4DR7Q 3P42A 1LT5D 1UF0A 1RWSA 3QOJA 4TQ1A 1EF1A 2WB1G 4DV1Q 2DJGC 1E9MA 2FNJB 1F2LA 5GQOA 3BINA 1SFOB 3WAPA 1QNKA 2DJFC 3PLUA 4IUPA 3VR4A 1CKNB 1D4BA 1E7VA 3DMUA 3CKIB 2VNUD 4KJNA 3LXFA 1IZ6A 3N1YC 4GXBA 4GMVA 4BS9A 4PMCA 1BBUA 2B63H 2L0CA 4RMAA 2IGGA 5HI1A 2PZTA 2F0EA 2B2TC 3A0JA 3GTOH 2VRRB 2INCC 4DK0A 4C2MB 2XK5B 5CBAE 5FKAC 5HFYA 3EFXD 3LJ3A 1Z47A 4X64Q 1S5FD 1GAQB 4HK2A 1LO5D 1HZCA 2JA7H 1I4HA 5GAHC 1Z2MA 2KMMA 3GE8C 4IUMB 3I73A 2F0IA 1PFMA 1TR5A 2BE5C 2OTJA 3GZNI 1OQYA 4MGKE 5TR5A 3WAMA 1CKOA 1RFAA 4HSPA 4X3SA 3Q0AA 4QGUA 2K8BA 4KIKB 4B3TQ 2GRIA 4NXMQ 1JALA 2RF4A 3BY4B 1BCPC 5IGEA 2R93B 1PQSA 2KD0A 3L54A 3UI2A 2F0WA 3I4OA 2VQEQ 2AKWB 2HTHA 1TKYA 1CA6A 2PJHA 1XNRL 1A6XA 3GTMH 2WWZA 4DHZE 5E3FA 2R92H 1CJEA 2N49A 4OVZA 2PMZB 3K8AA 3S1RH 3HZXA 1IBXB 1WYDA 4IUTA 4KHVA 2QA4A 3N1ZC 2JA5H 3KF6A 4DR3L 1TS2A 1Y1VB 4A3LG 1ENFA 3PSIA 3AM9A 2ICIA 1FCLA 1I4PA 3BWUD 2J0MA 5ELCA 2NVYB 1U4LA 1RJTA 2L0TA 4DPGA 3WOEA 1E5WA 4B3MQ 2KQ4X 2BTEA 3NVZA 2FHTA 1N5XA 4XQNA 3PZ8A 3EFCA 4E3CA 3HOWG 1AFPA 1J6QA 5CV5A 4CJ1B 3U4EG 2EELA 2KWDA 1SRUA 3A33B 2MSED 3G4SA 4LDTD 4MDKE 1EWHA 3G7LA 4JI7Q 4OZAA 3RZFA 5JOBA 1HNZQ 5H8YE 1KDCA 1KH0A 4W9CA 2VZKD 3P4RB 2KN5A 2WU2B 3RN9C 4CDDC 1WD0A 1G291 1WTHA 4JI8Q 2KQSA 3NBHB 3RFZB 2ZM6Q 4RGTA 4CKEA 1JICA 5C4ZA 3A9KA 3L7ZC 5IWAQ 4CDCC 1F9JA 4RAUC 5J17A 2K5WA 4YCVA 4XX5A 2EQSA 3D8GA 2GBKA 4DR4L 1XMQL 1Q1BA 3LX0A 3KUZA 1UE5A 2WS3B 4US9A 5IN7A 1PH3A 1IBLL 2UU7A 4GOPA 1KTKA 2BCOA 2LSSA 2BDOA 3U7DA 5FLXc 1T5XD 1WXQA 2WQYB 5L83A 2W3SA 2K14A 4QJFA 2AQ1B 3I9V1 1IBML 1NUCA 4KKJA 3D6WA 2DGYA 4HTHA 4DV5Q 3BK1A 3Q2AC 2KKCA 1VMPA 1MD2D 3BK2A 5I9PA 3P4QB 1G6PA 3KF8A 3VDYA 1VZ6A 1JE5A 1F52A 1OXSC 4R3DA 3NK9A 3IAYA 1D2BA 2D07B 5HY6A 1ONLA 3TZUA 3H7PA 2YYZA 3KUPA 2YTVA 2NTSA 4OELB 2JY6A 5D14A 2R92B 2K6DB 4DF7A 4DV4Q 1QF6A 5DM73 2KCCA 2HDMA 4F87A 3DM1A 4OX9Q 2INNE 3HM6X 3R7RA 1BF4A 2JA5B 2K5NA 3F2DA 4YXDB 1EIHA 1YITA 1BNZA 2Q2TA 4DR6L 1UWMA 2Z6KC 4A93B 4ME3A 2IHFA 3HKZE 2HCCA 1PRTF 2KHJA 1ZKHA 1CT1D 1N6ZA 3ZJVA 5EPJA 4PG3A 5C4XG 3FP9A 4MT5A 2TMPA 1JROA 4ACFA 4PZ8A 3SK5A 1CZPA 3G48A 4LF6L 1B70B 2BOSA 1K3BC 1U4RA 2PE9A 4GKJL 4NJCA 2LS01 2Q2IA 4HWIB 3FEWX 1GVPA 1VQMA 5GAGC 1QUQB 1TWHB 5CV7A 3APCA 1L0YB 1RL2A 1YHAA 4FF4A 3ZVVA 1KOTA 1KLUD 3H6NA 1JWMD 4KZCA 4WRDA 1JMLA 3U52E 4HR7B 1R4MI 1XCQL 4II3B 1JWAD 2C60A 2WAQB 2G9HD 2KHIA 3IG3A 4XC2A 1QOAA 4F1SA 4NXNL 2GLSA 1SF0A 2FXQA 4HIDA 3U4ZA 1T0YA 5JJKA 1HNWL 1SYCA 3DXJC 2EXZA 3WOFA 2JQRB 3CHBD 3TMEA 1NJIC 1L4ZB 1GPXA 1FFVA 4P7IA 1PH4A 3TQYA 2KVZA 1CTMA 4FNFA 1HRJA 4DV0Q 4L23A 3V6EB 2KFJA 3LB8C 5E6JA 1XD3B 3A74A 4A3FG 3WCQA 4R8IA 2VQFQ 1M90C 4LF4L 1NI2A 1PH6A 4OWTB 2CVRA 4PNYA 1MIUA 1WJNA 1CSQA 1XNQQ 4BKSD 1RDPD 3GP7A 3MJWA 3ND9A 1H8CA 1YIWA 1XTCD 2F4IA 2VZAA 1HUMA 2Z6BA 1Y8NB 2FMMA 4DN4M 2J0JA 1YN3A 3CPFA 2ATWA 3OLMD 3HS0C 4V0BA 5DPRA 1F2RI 2F0LA 1CI3M 4G3XB 2W82A 2EY6A 5G5GA 3UDXA 1VRAB 4GN4B 2GN5A 3NWSA 4GN3B 4ICUA 3S14H 3MC0B 2HQLA 2LZ6A 4Y7NB 1A3TA 2VB3X 4YWLA 2QCZA 4YWMA 2BH8A 2OT2A 3VFKA 1X65A 4HCSA 2FCNA 2MHJA 3U50C 2ZXRA 3DWMA 3ZTCA 2OQKA 2MX2A 4A93G 2MA9B 1FIQA 1KDAA 2N9XA 4F7ZA 3RNGC 4DUYL 3LDZE 4FYDA 3N32A 3Q8EA 1GKHA 2N7EA 2I07B 3BYYB 4NDXA 4BA1I 4IOAA 2UUCL 1UBQA 3K58A 4BY1G 2QSDA 1LXDA 3HEJA 1L0XB 3W5OA 2FCMA 2X69A 3AE2B 2V0GA 1V49A 2KQ3A 1F9RA 1DOMA 3KOJA 4TKNA 4DV3L 2EY2A 4WFN3 4XE0A 4HPLB 1AP0A 3A5ZB 2ZVOA 2Q2UA 2D9UA 1BUIC 1EM7A 2I1JA 1WRIA 2WDRB 2IHEA 3NVWA 4OIKA 1OEYA 5FO7B 2CFMA 2MNAA 4HJAA 1R4NI 2FUG1 1K50A 1VQIA 1R4QB 1EY0A 4JI0Q 3Q23A 1QVFA 3BJUA 1ZUD2 3KLSA 2NWGA 2WDQB 1EIFA 1WM2A 3M3JA 1V1PB 3TP5A 2FCQA 5JHAA 2V3PA 2B8GA 3FRPB 5JEAG 2F0HA 2XIWA 1PH8A 3HOZB 3E9IA 1V86A 1OFFA 1VQBA 2M0XA 2M19A 2AYOB 4JL9A 2RDFA 2DAFA 1D8LA 1PGXA 5C0XI 4X3UA 3CCEA 3TS0A 1DCZA 3I4MB 2KOLA 2MO1A 5C3EH 4IWQA 1NMGA 5IOCA 2JRHA 5GAEC 3CD6A 3LNNA 3MXNA 4LNIA 2F3WA 3P1HA 2J7QB 3M95A 3MXNB 4HEA1 2Y5BB 4CYEA 2IDYA 4L1BA 1K3RA 3P4PB 4LJZC 4MJSB 1EEFD 3OIPA 1P98A 2N3SA 4IJHA 4DK3C 1YJJA 4A3GG 3KLSX 4P16A 1YEZA 2CCZA 4LFCL 3S14B 3V3XA 5JAVA 4DV7L 2PQAB 4ID6A 3I2ZA 1XYIA 2YU9H 3ETRA 3S2HB 3NZSA 5A35A 1JJGA 3WAOA 3QWZB 1AEXA 3ML8A 1T0RC 1LUZA 1N32Q 4IUUA 1B8AA 2UWQA 3PHWB 3ZNZB 1TWHH 2F0DA 1JT8A 1N5WA 4H2AA 4QIWE 2W3RA 1GD7A 4UPAA 2MGSA 4PQXA 2WXJA 2WACA 1GOZA 3K81C 4W9GA 2DZIA 2UYZB 5HGTA 2QC8A 1XJVA 2O6VA 2ID0A 1Y1WB 2EYMA 3J80c 4K0KL 2ZCCA 4X65L 2BH2A 5DNFA 2B2WC 4WWNA 5T1IA 1EWIA 1SMYD 4I7AA 1HH2P 1PFBA 2B2WA 4ZK9B 1BUVT 4KY6A 3SFEB 3HVDA 2QKIC 2LI5A 4ZYSA 4JI8L 4A3FB 5JH5C 2D2CC 3EJIA 4K0KQ 1HA6A 3H91A 1ASYA 2LJIA 4K7SA 2DNFA 1PUTA 2IX3A 1PXUA 2VUMB 4EOYA 3FKIH 4JGHB 3J7ZC 4JI2Q 4ALPA 2HE7A 4GDLB 5LL6S 4DR2L 1AN8A 3HOYH 1M94A 4K8JA 1V97A 1VQAA 4R4CA 3W1BA 3F2UA 5I6WA 4FVMA 3KJPA 4HIMA 4Q5VA 2E2DC 1TWGH 3PHXB 2K5DA 5L37A 2L8JA 4KGTA 2K28A 2N88A 2C9OA 3PO2G 1LLRD 2ES2A 4A3LH 3TJPA 3AFPA 1N36L 1ACCA 2AQ3B 2K05A 2A8VA 3DHIC 1PYSB 4PZ6A 4YSYB 2HT1A 2LGIA 1A2UA 4L5QA 2KBNA 4IUVA 5HGQA 4BBSG 1PH9A 1C79A 4XGAB 1WMHB 1PH1A 4DR5L 1WGGA 3RNFC 4WWOA 5DM63 1IBXA 3B1LX 1PZJD 3MAQA 2MW5A 2EXDA 2MQJA 2F4VQ 4AH6A 1V1QA 3S1QB 1L6VA 2BYVE 3KYDD 4OZBA 1A3UA 2M4NA 3OYYA 1TYGB 2WYQA 3NZUA 1TWAB 2J0KA 2JUOA 1Q81C 2YV5A 5JJZA 1WOCA 1XMQQ 2ZJDA 1EYDA 1Q10A 5D65A 4UY8C 1HA5A 4DAVA 1AZPA 4L2YA 4JI1L 5G5HA 1LGRA 3NELA 3NY5A 2CHXA 2MRPA 3PO2H 4JI4L 4A3PA 4DGZA 1VQ5A 3TSSA 5F2DA 3J9CA 4FP5D 1ROEA 2MP2A 1N9WA 4JI5L 4AYBB 1K83B 4EUTA 1EQVA 1H9SB 4FADA 5C5MA 4DK6C 5IGBA 2MP2B 2EMSA 2RDBC 1GUWA 3H09A 3L2PA 2XN9C 1JORA 3GB1A 3VQIA 1RF2D 1CM9A 1D7QA 3S2AA 5AZGA 1ZP0B 4AOFA 1FGUA 3UDFA 2E3TA 4RA8A 1PTOB 3RN2A 1J5EQ 4CGYB 2M56B 1YJ9A 4M00A 2XBBC 4K3CA 4G7ZC 1R4MB 4XXEA 2SEBD 1QWYA 2KFKA 3QIAA 1VZ7A 4C4VB 5DPTA 1E10A 3HM3A 5LMNW 1VQ4A 3M4YA 1NYQA 2Z0EB 1DJRD 2FINB 3STBD 4LFCQ 4O0AA 1SNOA 2A6HC 4WJ3M 5EGTA 5M9OA 1HFNA 4YCUA 1Q3LA 3N20C 2QMTA 1VQEA 4RGNA 1G2TA 2F0PA 3T56B 3IFDA 4DFAA 1V80A 4N8FA 3H94A 4IN3A 4FF1A 4IFDJ 3A9JB 5EKKA 5KNBA 3MC9A 1IXRA 4PV1C 3K57A 1MVKA 1F2YA 3GTJH 2KVMA 3C0RB 2IY0B 3AEEB 2EY1A 3J7A5 4B3SQ 3S1MH 1U9RA 2KDBA 5IOIA 1B53A 1N60A 2E6XA 4GSWA 3ZXVA 1VQFA 2NN6G 3DWPA 4JI3L 2BQQA 4U68A 1GUAB 2VH1A 4X65Q 1NI3A 2UU9L 5CC4A 2WFWA 2HJ1A 3PRMB 2A6EC 2JSOA 4REZA 4EE2A 2BA0A 2B2UC 4ZRPA 1I6HB 2OEDA 3ZXRA 1E2VA 1Q0WB 4WORA 3VDZA 4IUQA 2KN4A 2Q8TA 2N9LA 4IPGA 5E6OA 1UBIA 1Z6HA 1MFWA 2KJ6A 3CMMB 4L5RC 3V62A 3R93A 4AUQC 1BR9A 2INPE 5M5YB 3VYUA 2QEJC 3RN5A 3UDGA 4FLHA 1CMXB 1SSOA 2KTRA 1F9SA 1WXSA 3CRLC 3KLRA 4HIKA 1C4AA 1WIAA 3E5SA 2KCMA 4JLCA 4KN4C 2DAJA 5KGUA 4K2LA 1JQ4A 1AE3A 4WQOB 4DR3Q 3SHLA 1KD1C 4TUUA 2XRQD 3DWGC 1Z5SB 4GGQA 4A3IH 1LTAD 1V1OA 4R4OA 2INDC 3QOLA 2ZVNA 2LGXA 3KH0A 3N30A 1B2TA 2JJQA 2UXCL 4YY3L 1YVCA 2EYHA 4EZLA 1H9KA 3RNEC 4DK5A 3RZWC 4K7UA 3F1ZA 1QCBD 4ZUIA 2KCTA 4M02A 3TBIB 5C44G 5M3FB 1FCCC 1IPGA 3URYA 1TWCB 4LF6Q 1VF5C 4A3KG 3AECB 1SAPA 1R9TH 4AJYB 2BYEA 4N9TA 4N9PA 4IO9A 4FJZA 2R2QA 4DAYA 2HHHL 5I2XA 1QVGA 2LY7A 3HOZG 3I4MG 1F2RC 5EBCA 4OXPA 1OQRA 4DNTB 3PZDA 3QHTA 3UINB 4A3DH 1H9MA 3K0XA 5IGCA 3OG5A 1AWDA 2KA7A 1XF5L 4JX1C 5EBDA 5EE1A 3K5NA 3Q14C 2ALYB 3W5UB 3K0YA 4W9LA 2V1YA 2CHWA 3MTNB 4B9KA 1A63A 3I91A 1YNND 5T8IA 4FA6A 4A3GB 3AEBB 1QKZA 2GBJA 3S16B 3PRPB 4EQPA 4JI6L 1EYAA 4DV3Q 1YJNA 2KQ7A 4EZJA 4JG2A 2QCPX 4KY5A 1QZEA 4MEMA 3UIOB 5EPKA 1ML0D 4LF7L 3PT2B 3HRZC 5AZFA 4AYBG 2F3IA 2GVBA 2HUGA 5LMNQ 4TMAB 3P4SB 3VR6A 5CV9A 1I6HH 1IYJB 3FVQA 4KKUA 3AMZA 4KDLB 1MHXA 3RPFC 4A8XC 3C46A 1WGHA 3LYYA 2L1BA 1FXTB 1DOKA 2K0PA 3T3NA 2FMCA 4KV6A 2UUCQ 2KC2A 2EIFA 2JVCA 1EZ6A 1STNA 2JYTA 2QGQA 1KRHA 1B44D 1ENAA 2L9HA 2RMMA 1SYGA 3A56A 1CZWA 3H7PB 2DLBA 4B3RQ 4K14A 1WCMB 2NZOA 3PO3H 1WTXA 3L13A 1WGRA 2LASA 1SNMA 1HPCA 3BZDB 3J7AF 2LHDA 1TT2A 4NP5A 2WLBA 1ESRA 1PYWD 2K3UA 2PW5A 3CQZH 2B2YA 1GJZA 1KLVA 4TQUS 5DPSA 4ICVA 1Y1VH 2E74C 1PFNA 4H44C 3CWIA 1RFKA 2HQEA 4DR7L 2LXJA 2GOWA 4B3SL 4UP7A 2XTIA 4RCNA 2LJ5A 1NE3A 1Q82C 5JVG3 1IUEA 4C3JG 2FJ2A 1GJXA 1OO9B 4DV5L 4PK1A 4C7ZA 2YTXA 5I2YA 5I4DA 1VCBA 3S1NB 3SXHA 4XYOA 1QZGA 3ABVB 2SOBA 3M7GA 2MBBB 2JEBI 3AU4A 4IM0A 4A4IA 1K0RA 4CHKA 1XPUA 1II3A 5TSSA 4FXKC 3RZDB 3M3YH 4JI2L 4I6NB 1PH7A 4GLAC 4JVZA 4ZAIA 3RZOB 4WJ4A 1WSPA 4R8NA 3ECIA 2JK8A 4XYQA 3JAML 2NVXB 3Q3MC 2IJ0A 1ZGUB 4LK0M 3AULA 3S15B 4ARCA 2L0FA 1V9JA 3K59A 1OTCA 1HNWQ 2KVRA 2OCEA 3J7YW 2KK8A 4JYAQ 3MHSD 3FDTA 3SEBA 2KDFB 4AQ7A 3AE6B 1P8LA 3S16H 2KNBA 1V43A 1DD2A 5KNCA 2WV6D 2YEPB 4ANVA 4RF0A 2IO1B 1WR6E 2BF8B 4WWMA 2V4IB 4MSQB 3DBHB 1WXMA 4DA2A 5AJ3Q 1B4OA 5FOBB 2EKIA 2JA8B 4IURA 3D6CA 3KLWA 4PMWA 3I8ZA 3CCVA 2OOBB 2I5HA 3MHBA 1Y1WH 5FO8B 3M4OH 3OSOA 1FJGL 3QARA 4HXDA 3MZ5A 2LVQA 1QOBA 3MFYA 2JA6H 3UE0A 1BKBA 1EOVA 3H3VC 1T0SC 2ZW1A 3ZYYX 3I4NB 5FR6A 2I46A 4BBSB 2BS4B 4IPDA 3ERQA 4LJPB 4JOIA 1N36Q 4HCNB 3BVZA 2LXKA 4E6IA 1N8RC 2L52A 3FC4A 4O42A 1XPRA 1E7UA 1O7LA 3OIQA 5C4HA 3NQTA 3Q3OC 4QAYA 2B29A 5M3MG 2L3ZA 1IGCA 2G4DB 1E24A 4RHRA 3F2CA 3MJ5A 3ZKJC 3A9KB 3AE1B 4X66Q 3M62B 2KEEA 3CAMA 1C4PA 2NVUI 5M3FH 1ZE3D 3GZNB 2HIXA 1JOQA 4RNAA 1EY5A 2PPBC 2B76B 5FR3A 2JT4B 1XWEA 3RLOA 1V6EA 5EE0A 1SE8A 4XT3B 5HURA 4A3BB 3PRZA 4DR1Q 3E56A 2O5JC 1E0BA 4WWPA 2MFIA 2JA6G 2NVQH 4K5WA 5LXHA 4EQOA 4A3BG 2R7ZG 1MI0A 2F0OA 4IW0A 3OW2A 2LFNA 4MACA 2F0UA 1BBWA 2ACZB 2AUKA 1EOTA 4XQJA 1UE6A 4FXCA 2Z9HA 5IP9H 2BDNA 3A55A 1HTLD 3CC2A 1FXIA 1TZ1A 4IFDI 2BS3B 2GB1A 5COYA 1TWAH 2D3AA 2LRWA 5M3MH 5KRUA 1PZKD 3CCQA 4R4QA 2XEWA 2BBCA 4EZKA 2R2OA 1WJUA 1K28A 2WKCA 2EYJA 4HMIA 3PPAA 3DBHI 3ALBA 3VUYA 3A1QB 4KGSA 5IODA 3SU8X 4JI1Q 2JA7B 1IBMQ 1TKWB 2RA4A 3V61A 2PYKA 5IAAC 1ET6A 1YN5A 1OGWA 1P0RA 1K83H 3PGZA 3NS8A 3DHGC 1ILPA 2B2VC 4ZKCB 1J0GA 1HZ6A 1N33Q 1IW7C 1K53A 2NN6I 2BE5D 2DENB 3Q8CA 2XVSA 2HDLA 3FHWA 2WXNA 4C3IB 4M8AA 1PFDA 3L0WB 4N8X1 4ZRQA 3KYHC 3GTMB 3VYTA 2DYBA 2RDHA 1DONA 2KAJA 2NMQA 3A4RA 1TWFB 2L5TA 2MP1A 5IYBG 5FLMH 5HHDG 4YCWA 3VH4B 4A3JB 5BR8L 4JBWA 4KD4A 2EDGA 2EMTA 1HE8A 5M5XB 4AIMA 1TXYA 3PQIA 3FAHA 2M2LA 3I3TB 5J2RA 1L5PA 2QDBA 1AH9A 1BDOA 5G3LF 4BXXH 3UDIA 2VW9A 1WFQA 2K33A 2CJNA 2LGDA 1ASZA 3TS2A 1X3QA 4QUFA 1HR0Q 2E2HH 3NG0A 4FXGC 4AP4C 4NQLB 4OX9L 2B2YC 2DN8A 1KF6B 1UNSA 1UD7A 5BMGA 2ZCBA 3UQAA 2NVQB 2EY5A 1YQ4B 4LNQA 3APDA 4J6IA 4XDDA 3S15H 3DHQA 3P20A 3J80L 4K5VA 2O6VB 1KC8C 2EKEC 4X64L 4ZDVA 3GTLH 3I56A 4KSKC 5IYDH 4KX6B 1UWVA 4GNXB 3TEYA 5M3MB 1XLOA 2AMCB 3GV3A 5IYCH 4GNXA 1YJ1A 4IWOA 3JAME 2JXXA 1QB5D 2EYLA 2N0SB 2SAKA 2HCIA 3A8JE 2OHFA 2QIEB 4XQQA 1HQRD 1WVLA 1YHQA 1LQBA 2PZUA 3LWUA 1UH6A 5E7NA 1J8IA 4JYAL 2BS2B 2F0GA 2DHZA 4G50A 3H7SA 1S4ZA 5LLIA 3VTUA 2IGHA 2Q2HA 5J1ZA 3CXCA 4W9HA 4II2B 3NHHA 5C4XB 4KIKA 1A3VA 3DM3A 2DUDA 4KMUC 2WB1E 1HNXQ 3L9AX 3JSVA 4BBSH 1ZYRC 3J7AV 3I4MH 2BB5A 1FMAD 4ITKA 1O7YA 4DR6Q 4CKCA 4KV2A 4K5XA 3AH7A 4BY7G 1KAWA 1SR3A 1RTNA 3EROA 4PS3A 1E8YA 4DAMA 2ZTCA 2ENBA 1PRTC 4W9KA 1BT0A 2XWJB 2JE6I 1WYWB 2P5ZX 5JHBA 1CSPA 3WIMA 1SE3A 3U58A 3BVMA 1DOIA 2ZNVB 2KDIA 2Y5CA 3FMCA 5M5XH 2NBUA 2RDGA 1VQ6A 1X32A 1JJCB 3BYTB 5E4WC 3Q24A 5BYRA 5IGFA 4OHJA 4WJNA 3CCUA 1HZ5A 3NTKA 4MTKA 4HCEA 1YX6B 2EYOA 4KJOA 5A2QE 4DV2L 3T1YL 3D4DA 1SE4A 3A1QA 4J6HA 5IWAL 1JRUA 1LTBD 5K36G 3OJ4B 4JOIC 2B8FA 2A68D 5C0XH 1TJEA 2K25A 4PYZA 2ZJRA 1MHWC 2VXWA 3T1HQ 1Y8RC 4E74A 2PI2E 2NUCA 3OWFA 3A8IE 3HOWB 2EYPA 1IBLQ 1V1PA 5L95C 1WR1A 1ZPSA 1C76A 2KDMA 3W9CB 1ZEQX 3OWEB 3O65B 5EKLA 3PMFA 1QZHA 4MGIE 2FFKB 5CR3A 4C3HB 4LFBL 2JA5G 1RLFA 3E0EA 3GTLB 2K32A 5C6AA 2H1EA 3KBGA 4RFBA 3Q69A 4FF2A 1UUPA 3EN2A 3T16A 5I9OA 4CO7A 1DXMA 1ZKOA 2FBWB 4MGYE 1MGSA 2DYMA 4GLSC 1K8MA 4GS3A 2V9HA 4W9EA 2R3ZA 3UF8A 3K9PB 4DHJB 1G2SA 2O4XA 4ILWA 2ZM6L 2JXTA 3OTOQ 2JZPA 3IT6B 3QR8A 2NVTB 3D0FA 3EIVA 1UEBA 2VUMH 2RR9A 2ZXPA 3I3CA 4W9JA 2OJRA 4FF3A 3MXPA 1VDZA 4OO1H 1A15A 4QF4A 2E5LQ 4ZRKA 3CIRB 5FLXE 1N61A 3AN1A 1WTQA 1FEHA 2RSNA 1I42A 1LTSD 3NVYA 1S40A 1G6ZA 3MTSA 1TT5B 3AB5A 2ZW0A 5LXIB 4IJLA 1UELA 2M9VA 4JWUC 4KVGB 3R3MA 5C4JB 3FKYA 2I1KA 1SE2A 1HCZA 3BDCA 1VR9A 3TREA 1AE2A 2NN6H 4HJ5A 4WQMA 4TRDA 2I5LX 5KYIA 2X38A 3RULA 2KENA 1D6EC 1JOKA 4NZLB 2NCNA 1DZ1A 3I90A 3AI5A 2QEXA 1AYFA 2G3QB 3PSEB 5LMUL 1JWUD 1GB4A 2JEAI 1C48A 1X54A 2ZT9C 4KSLC 2K5PA 5AEKB 1K73C 3T9LA 3W2DA 4PYUA 4NMZA 2CWPA 4X3TA 5DAUA 3J81c 5E1FA 4DV4L 4BFRA 4IFDH 1TS5A 1WGYA 2KDEB 3RZOH 2PCFB 3NOBA 4GU2A 2KECA 3DQVA 1OXTA 5IT9L 5G55A 4R4TA 1YI2A 2LUMA 3A7AB 2KZRA 4P72A 1V2YA 1AARA 1NSNS 1YOVB 3AU7A 2Q8RE 1HR0L 5D7GA 1STYA 1VQ8A 4OO1I 1U4MA 3T51B 4JPSA 1FVIA 1R4PB 4C2MH 1WE7A 3N3KB 1SN8A 5E6NA 4I6LB 4DUYQ 3WA0A 1VQ9A 3CC4A 3TN2A 2K50A 2JQOA 1TKEA 3NJTA 3VYRA 2I0QA 3K6OA 4GKJQ 1W2BA 2WDTB 3NP8A 1KL9A 4XDCA 3ML9A 1J7CA 4UDUC 4ABNA 3ER0A 2K8CA 2NVTH 3PUYA 3CP0A 1HTQA 4QB4A 3L10B 5EAYA 4RKLA 1KM7A 2MJDA 2D10A 3E9HA 2LD9A 1UEAB 1GM5A 2PEAA 4A3CH 2JWZA 5JJLA 2VH2A 1VQGA 1LFDA 1MG8A 3PLVA 3P1MA 2A69D 2NPTB 3R3OA 5AZHA 5DEHA 3NENA 1IL2A 3BZCA 2GA4B 4P75A 4DK1A 3H15A 4QQBX 4JV5L 2LEKA 3I4LA 4WIPA 3RNAC 4A9AA 4RG1A 1X3GA 4GNXC 3T1HL 4TSSA 2F0KA 4C3HG 4Y52H 2KTFA 5E6PA 4ANWA 5C0XJ 1I6VC 1LABA 4CJ2C 1Y69U 2IL8A 1YQBA 3TP8A 5AUIA 3PIO3 1MSGA 3HK0A 2Y0SE 1FRRA 1HNXL 3I7FA 1LM0A 1MJCA 1V81A 3PZ7A 1JW9D 5A2QL 2N9PC 3TUOA 3VUXA 4OWXB 1D1IA 3OW7A 1MJDA 1PDQA 3S2HH 2ZEQA 4A3BH 1SNDA 5EE3A 2YU9B 3MXGA 1Q1OA 4X3KA 4MGZE 4WJOA 4M01A 3FILB 4GOPB 4QMGA 1UAPA 1N62A 4OEMB 3EBEA 3K7AB 4D2KA 2PMVA 2M0AA 2DYOA 2AL3A 3Q8BA 2IO0B 5EE9A 3PUXA 3ZJUA 1RM6C 3C2PA 3B2GA 4C7YA 1LT3D 1X55A 1ZW7A 4P1CC 2Z6KA 3BG3A 3MVVA 1C1YB 4C3HH 1IYUA 1GUNA 1WJ6A 4LMQD 3AE5B 3BIID 1TY0A 4YHHL 3KF8B 1ICFB 2D3BA 2WXKA 1TTNA 3B08A 3CMAA 4G7OC 4LCDE 3AXCA 2AUJD 2OF1A 3VR8B 4LUZA 3HOXG 4ANXA 5IP7H 2ZPNA 4POFA 1YD8U 2WX1A 5CHFA 3CCSA 4YHHQ 2B2VA 4JI6Q 1E0ZA 1L2FA 3BS1A 2UXBQ 1S3SG 3CF6E 2KMCA 2K6AA 4FN2A 4A3EH 1Q8KA 2R7ZB 4ZCKA 2BW2A 3IFTA 2KUMA 2RCNA 3M4QA 1O7ZA 3VR2A 2E2JB 3HKZG 4R1JA 2WDVB 1KQSA 1VZ8A 2LFIA 1VQKA 1LT6D 5IYBH 1H9JA 1C8CA 2NBWB 4YSXB 3VR5A 3S17B 4P71A 1STGA 3J80E 3I5JC 2PMZE 1EQRA 3QWNA 1BBXC 1K9MC 1TWFH 4C3JH 4DU9A 1IHZA 2VY3A 4WJPA 2OQ0A 3VA5A 5G3LD 4ASWC 5IIFA 3CCRA 3M3YB 3B6YA 3GE3C 4DUZL 3NEMA 2NBVB 4TQ0A 2F0FA 2E8GA 1UZXB 1TBEA 1SNCA 3V6CB 4XTCS 3PUWA 1C9FA 1JC7A 1FFUA 1ICWA 3HOUB 3S1QH 3QJZA 1MSHA 3ZLZA 1JR0D 4LLGM 1WY8A 1YBYA 3P2BA 2DZKA 4JI5Q 2LMCA 4ANUA 1ZOYB 3AV8A 4GZYC 1V5TA 2CU1A 4IWPA 3SK8A 1WF9A 1DGJA 1EUJA 1NCVA 3M63B 1KRSA 3GO5A 1Y8PB 1XEEA 2N4FA 4R9WA 2Y5PA 3PS6A 3K7AH 4YWGG 4FDBA 2D2QA 4LW1A 1WTOA 3AYHB 1TQOA 4Q0FA 3HOVH 1DOYA 3DVNU 3QC8B 3SR1A 2KEDA 3R66C 1NR2A 1VJKA 1SXTA 2SDFA 1WX9A 2JA8H 3PIPA 1YQ3B 4N59A 4UP9A 5BYSA 3M4OB 4N9F4 4ZYNA 2ZJPA 1NNXA 4MHEA 4DAYB 4KTAA 4RHSA 1EUVB 1WFYA 4LF5L 1PTOH 4X6AH 3T4AC 1C4CA 4G4KA 1F0ZA 4G0NB 5CYUA 4S0RA 2C7HA 1Q90A 1A70A 1KLGD 2K01A 3EVQA 5E4XA 3STBC 4B3ML 1L2NA 2KWVB 2Q8IB 2K22A 2MEKA 3KQ4A 1L0WA 5HG2A 3SFDB 1EF5A 3W1SC 2LGYA 3R7QA 3QA8A 1P7EA 1ZXHA 2X6GA 4GDLA 2AHOB 3RLNA 3TEHB 2R6GA 2HD5B 3DDCB 3NXWA 3GV6A 1A2TA 1L6UA 3A8KE 2VQFL 4LF4Q 3S17H 3HKZB 4ZLTF 2BPSA 1ET9A 1I4XA 2KCNA 3HOYG 3IAS1 4US8A 2SNSA 3VH3B 3C3LA 3QO2A 2UXCQ 2DX5B 1IBKL 2HD3A 2ONQA 1EY9A 4HJ7A 3KFUA 3ZGZA 3KJOA 1NY4A 3R2IA 4S3SA 5ELDA 4NAWA 4Y7NH 2KYWA 4E71A 2G4SA 2KC1A 1A62A 2K52A 3U4VA 3GTGB 2N8NA 1FXAA 2WXPA 2WXOA 1B1ZA 3S1MB 4ZHOA 5C0XG 3EQLC 4RGOS 3UQBA 4WURA 3ZRCA 2FUHB 3PIP3 3RUIB 4L63B 1RODA 4JWSC 1GUSA 1JB3A 1KRTA 2KXJA 4C1NI 2JYOA 2MLBA 2VQEL 1EWYC 1O80A 3SDLC 3ZQ4A 3TCAA 2SNMA 4RKBA 3CCLA 1WYGA 4P73A 1CZGA 2K5HA 4GKKQ 2IX1A 1E8ZA 3HFZB 1K8AC 3M9BA 1TY2A 3D4WA 1QG7A 2L12A 3RMKC 1S72A 2V3NA 5C44B 1W6JA 4IG7B 3H3VI 1U0LA 1C78A 2BVCA 2XRSD 3ND8A 3ZDTA 1X3PA 2F1MA 1HTOA 1GXDC 2BKFA 4QUCA 1SYBA 3NBHA 4XZ4A 4K8IA 1LTGD 3J81i 2F03A 1BO0A 2K04A 5J3BA 1K8GA 3IKJA 1U4PA 4U673 4OWWB 3PTFC 3EGRA 2WINB 4LF8Q 1JB7A 1VS0A 1SMYC 3PF5A 1CUKA 2V4DA 1SYFA 1BCPF 3G6JB 4IM3A 4HVBA 3BDOA 4WJQA 3RMHA 2Z0DB 2UXDL 1C9OA 1A8VA 2A5UA 1I4RA 4HDQA 3AEGB 4X57B 4A3JH 5IY0A 3WALA 2OEOA 3HGBA 1I50H 3ENEA 5K5PA 3EC8A 1XMOQ 2UUBQ 2AX5A 2GMIC 2DY8A 4DV1L 5BN3A 3DVNV 1L1OB 3D32A 3DLLA 4DV2Q 3T1YQ 2MJEA 2W55A 2HJ8A 3APFA 2AWOA 4FHKA 1DOLA 4TVAB 4H7BA 2JF5A 1EL0A 5H92C 1TZOA 2ZPYA 2UUBL 1VCIA 4K3BA 3TIXA 1P7FA 4LDTB 4PMBA 5D2MB 3J80i 1MBYA 4M0WB 3DHHC 3BVGA 4URKA 4IKGA 1GB1A 2B2UA 2QF7A 1N34L 3MHZA 1MJEA 4I6PA 3N9YC 1KFYB 3EA6A 4HKQA 1NBFC 2IY1B 4APVA 1WCMG 3ONAB 3DBLI 5CHVC 5BN5A 3GTKB 3SD5A 5IP4D 4EVOA 1QVCA 4A3GH 3AE4B 5DLQE 2QW7A 1ZXIA 2LHEA 4DV6L 2KMAA 1JJ2A 1STHA 3QK0A 3BZKA 3KUDB 4NB3A 4IC7B 4OW0A 4PT5A 3IL8A 3J81L 1IYVA 2LWPA 2KX3A 5IYDG 3PREA 3HVZA 1JWSD 1LV9A 3MXUA 3P7JA 4AYBE 3SGIA 4B6WA 2A69C 3GTPB 3B9JA 1DGSA 2K1BA 4BWGB 5LHY1 1HNZL 1WXAA 2HDEA 3K5LA 2O2VA 1E22A 5LL6X 3F2BA 1AW7A 4CKBA 1CFMA 5C1ZA 1QUQA 4MNOA 3U8ZA 1JRPA 2R92G 1OQQA 2O2VB 4LAAA 4L5SA 2PI2A 1SSNA 2YTYA 2O6VD 4F8CB 1B9MA 3KBXA 1V9PA 4ZRZA 1SBBB 5GROA 5JXVA 4P2CB 2MO0A 2W9NA 1WCMH 3CU7A 3PO3B 2IX0A 3VR9B 3ZJTA 1WZ0A 1WMHA 4GIVA 4ZRJA 1WM3A 2EYFA 1E7PB 1D1KA 1NENB 3TEZA 2A68C 4RM8A 3NZ3A 1WJJA 2I5MX 3C19A 3P63A 2K1FA 1GHKA 1C7YA 1STAA 1GUTA 1PH2A 4TV3A 1FJGQ 4WAAA 5IA7A 3MP9A 2PZWA 4B3RL 5C2TB 3EECA 4BBRG 4UHVA 4IPHA 2K39A 2LVPA 3KWVA 3S24A 4A75A 4FO2A 3OJ3A 3FKIG 1UGJA 2HTME 4LNOA 5FO9B 1E6EB 1TIFA 4YTPB 2UXBL 4YT0B 3ICEA 3J81E 1EY7A 1DM0B 4YY3Q 2L05A 2CQAA 3DEPA 3I63C 4HKZE 4O1NA 5JEAJ 3A4SC 1EQQA 1PZID 3M4PA 1SB3C 2Z1CA 3AE7B 3T13A 4DWFA 3HRDD 1VQHA 3GTGH 3DBLB 4MTNA 4A3KH 4K2KA 1X3EA 2QHOA 4W9FA 4NAMA 2FIFA 4BVUC 1J8CA 2WXIA 3AEFB 4IZ8A 2NR2A 2IZVB 1PTOF 4A76A 2L32A 1I3QH 2V3SA 1BVSA 4USAA 2NBFA 1E1OA 1EFID 1NBWA 4A3DG 5D3DA 2NB0A 4DBGA 2E76C 1GG3A 4LJOB 5T1GA 1NAPA 2UUAQ 3ZW3A 5JZEB 2H88B 4BBRH 1GHJA 4EGVA 1V5OA 1VMCA 3K5MA 2IO2B 4GB9A 2IW3A 4LNFA 5C23A 2F4VL 1AZQA 3W3AA 2G45B 1B3AA 3NTIA 3PO2B 3Q6SA 1CKMA 4L5TA 3GS2A 4BZAA 3NWTA 3DBSA 4OVVA 1E2ZA 2G9DA 2RBMA 3SHQA 4JI4Q 1MKHA 2KJRA 2DY7A 3L0OA 2LXAA 3ZRFA 2CHBD 3AEAB 1NEKB 1VQOA 2Z4IA 3NQIA 3JYUA 2MJ3A 5C4XH 5DPWA 3G71A 1Q7YC 2F0MA 4HMJA 2M8SA 3DBRI 1PTOC 2R93H 3W1YA 2J7ZA 4JW0A 3E3XA 2VUMG 3NBIA 2LXCA 4DHZB 4HEDA 4P1BC 3I4NH 4X62L 1C3TA 3ZJYC 2JA6B 4A3EG 4A3MB 4LTUA 2Z59B 3KVFB 3EUB2 2K75A 4JBKA 3PIOA 3UE1A 3HUIA 3SE0A 1N33L 2WNMA 5ELBA 1SIJA 2DNCA 4O2DA 3PVLA 1Y56A 1QILA 4JI3Q 1DOXA 1WD1A 4LF8L 4NNJB 1SGHA 1MI2A 5FK9C 5D3IB 2PE6B 1G8ZD 3VRBB 3RUZA 1C77A 2PVGC 4KN7C 4HDOA 4KKTA 1K51A 2GBNA 4HRSA 3AQQA 2PO4A 1HZ9A 3W1SA 4ZOHC 3C8YA 1M4VA 2CKZB 3K80C 3I4NG 2I38A 4X66L 3GTJB 4GLVB 4DDID 1WX7A 4MN3A 5FJ8G 1RYJA 3RT3B 2VZKB 3NSWA 1VD2A 1EIGA 2BWFA 3NPPA 3JW0X 1ZXTA 1JQYD 3TZDA 4MZ9A 4LFAQ 3N6RA 3NUCA 1OXUA 1Y1VG 4NKLA 3NHEB 2KHWB 3Q8AA 2K5QA 4BBNF 1YZ6A 2QDFA 4GDKB 1T5EA 2K6QA 3MC8A 2KJXA 2Q5WD 5BO4B 2RPVA 5CX3A 1SNPA 4BBRB 3RCZA 2L7RA 1KIXA 1T6BX 4DNRB 2ZZPB 4FXDA 4XIGS 3E9SA 4KKIA 2BGFA 3GDEA 3KF6B 3O13A 4JIOU 4LNNA 4AJWA 3V96A 2RKSA 4CDEC 5KHQA 4YSZB 2KWCA 1WTPA 2WXGA 1IGDA 2AWNA 1VDVA 3U9OA 4WAFA 1XCTL 1QNUA 4JCVE 3QX1A 2N78A 2XGTA 2ZTDA 1E8XA 2EJMA 1YX5B 4KI0A 4EQNA 1EQTA 1T0QC 4WJWA 4DXFA 2HHHQ 2KOXA 3WWVA 4B95A 2LUEA 2CS4A 3S2DH 2IO3B 2PKOA 4BKGA 2K03A 2D3GA 3CF5A 1G91A 2EZVA 1Y1WG 1K0SA 1QT9A 1B9NA 4A3MH 5C4JH 3TBLD 1VQJA 4J1MA 3ULPA 1IP9A 3TL5A 4LF9Q 1UWXA 4BY1H 2DWQA 3PCOB 1H4RA 1SYDA 4RMFA 3K5OA 2MUYA 4ZQ3A 1T3QA 1EYCA 3X3MA 5ELEA 4KHPQ 2D0PA 4KY7A 5G2NA 4A93H 4YL8A 2GVAA 1DYQA 3RD4A 1IW7D 1S5BD 2N9KA 1TWCH 3C1EA 3FILA 1GO3E 1I94L 1S5ED 2O5IC 2D5GA 3H8HA 4HJGE 3GD7A 2R7DA 1C4QA 3HIZA 5BN4A 1TGZB 2RPQA 5IT9c 3U7ZA 2WIIB 3SVMA 5JVH3 2NTTA 2E2HB 1K52A 1PGBA 3OPOA 3TP7A 1JWBD 3ZIMA 1FYCA 1HFGA 3G6EA 2F0JA 4J3OD 2N1WA 4A55A 1WGDA 2J53A 4AS1A 1E3PA 5IP7G 1XT9B 3CCJA 1GUOA 3MWYW 2F0TA 3A5UA 1D3ZA 3P75A 5C3EG 4H02A 5JJIA 4NJ7A 3U2SC 1J19A 1OTRB 1LTTD 1WTWA 2BB6A 1FNUA 1ENCA 1TU2B 5M3FG 1QQRA 2WAQE 4H0LC 4S17A 3DUZA 1WI5A 2VS1A 2GI9A 4R4IA 2JYEA 2KO3A 3NE5B 3JAMi 1SYEA 3ZNID 2DBYA 2CHZA 4F7XA 2H4OA 2V1CC 1N32L 3NUHB 1Y8OB 3HOXH 1B7YB 2CKHB 1EY4A 3JC66 1M8AA 4FJVB 2WB1B 1UE7A 2R7ZH 5LMNL 2PNHA 4RGMA 5C5LA 4BOSC 5CV8A 1BCPD 3VTWA 2C5CA 4LUOA 4DV7Q 2JX5A 1YHBA 2M00A 2MHVA 1EU3A 3GTQH 2WGSA 3Q3JA 4C80A 2WAQG 5GADC 2IWHA 4DUZQ 1YJWA 1I35A 1RD9D 2K9XA 5MPOA 2CJOA 3VR3A 3MEFA 2LRUA 2CR5A 3E6ZX 3HKSA 4XT1B 2IY5B 1N63A 3KW5B 1Y14B 4FJYA 4FULA 3KYCD
chains in the Genus database with same CATH topology
1PDXA 5JPMC 1PMRA 2Y0SB 2A74C 1WWTA 1J7AA 5IT9E 1ZDVA 3QG1A 1RTOA 1XX8A 1YNJC 4OZCA 2N55A 3TEWA 2KHSA 2A6HD 2WP9B 4RF1A 1F9QA 4IUNA 3HOVB 3SR6A 2A73B 3ITPA 3U9SA 4G7HC 1ILQA 3OMCA 1FNVA 3IT4B 3MFGA 4K6LA 1F9PA 4V190 2CW0C 1CA5A 1LT4D 2N7JA 3HG9A 1Q12A 3D3RA 3MA2B 1QOGA 1YNTE 2ICEC 1O78A 1S5CD 5FLXL 1L0VB 2PVOD 1D5ZC 2PW7A 5J22A 1MHHE 2PLPA 4XWWA 1I4GA 1CQFA 1JCKB 2Y3AA 2PTLA 2F0QA 4A6QA 3GTQB 4C3JB 3M85A 5C3EB 1R9TB 4WH4A 4G57A 4XWTA 1FO4A 3D31A 4KD3A 4A3DB 2MH7A 1V8CA 3AE8B 2KACA 5JPNC 3VRAB 1L4DB 4H13C 1HHVA 5M5WB 1FNWA 1PLFA 1MPEA 4QIWB 1GUGA 2B39A 5KNDA 4C1NK 1PTOD 3VYSA 4A3KB 2BT6A 4HROA 2WXQA 1QOHA 2WXMA 1HUNA 2IPKD 2B2TA 2FE8A 4DQOC 2EOTA 1K8OA 3QJYA 3SK6A 4B9XA 2WXLA 1JE4A 1QLBB 4HAEA 4IALA 1F2MA 1IKMA 1ZDXA 3X3NA 5ELFA 1QOFA 5EKIA 2J42A 1EY8A 1YNNC 5NUCA 4UAIA 2J0TD 3KK7A 3WDNA 1TIID 2F0SA 3HOXB 2G1EA 5K36H 3H6MA 5J39A 1BMLC 2PNRC 3S9WA 4KHZA 1LTRD 4CBVA 1B9RA 4ULLA 3T3OA 2L55A 3PUVA 3HOYB 4NW2A 5AUKA 1SEBD 3QB3A 3PO0A 2J4XA 4ARIA 5BYQA 1KAAA 1RCVD 1D5XC 1QE6A 5AFWA 1PRTD 1D5MC 4JK1C 2Z4HA 4BY7B 1F77A 1B50A 2RSOA 4MH8A 4XDXA 4IDIA 3R2TA 2F3VA 2D5DA 4RCOA 1SJED 3L3OC 3GTOB 4L6TB 2QILA 5BMIA 1Z7TA 1F2ZA 1YMHE 2TSSA 5IGGA 1HQMC 1XLNA 2F0VA 4KKSA 3A54A 1LTID 4I65A 4C56C 3I57A 1I4QA 4IOIE 1NVID 4Z9CB 1WTRA 3KWLA 2WP8J 4YTMB 3BDLA 3MEHA 4CJ0B 3NRZA 2QJLA 4TKOB 1XLPA 2EPBA 2EE1A 1BQQT 1Q1EA 2I2YA 4A3EB 3AEDB 1TS4A 1OXVA 4IFDG 4MM3B 3TDQA 1I50B 4F88A 2JSVX 3DEOA 3I72A 2VB2X 4L8JA 1WTVA 5KIXA 2PIAA 3AMUA 3TEXA 1CHQD 3DWAA 3PUZA 3SK4A 1QJOA 3NTHA 4BY1B 1S5DD 3D4RA 3T53B 3L4PA 2EJFC 5IGDA 5CV6A 4B9WA 4RWSC 4YIJA 3NS1A 3NVVA 4C3IG 2IT1A 1XLQA 1BOSA 1I3QB 2MJ8A 2NYZD 5KEEA 2K7VA 4N6EB 4B0MA 2E75C 3IXSA 2LKVA 1SDFA 1PRTB 2L4NA 5CORA 1H9RA 2A6ED 1CK1A 1VLBA 2WXFA 4NAWB 1FD6A 5ISRA 1STBA 1E2WA 1LACA 4QCLA 2L1AA 4ZKBB 1SJHD 1IKLA 2W54A 1XXGA 4M0WA 2ON8A 3AB9A 1ESFA 1SNQA 1YJIA 3LWEA 4CQNA 4CHTB 1HXYD 2BA1A 2RQXA 1W6KA 4DXGA 5C3JB 3UI3A 3CRKC 1YNJD 5GXGB 1STEA 4HSVA 1CQVA 4MIUA 1H9SA 2ZXOA 1OXXK 4KGRA 4BA2I 2OXPA 5BMHA 1TWGB 1TKGA 2PQEA 5JEAH 1EU4A 1HTPA 1FD7D 3I70A 1HEZE 1KABA 3N52A 2IGDA 4RH6A 3Q22A 3R8BA 1J7BA 3OMGA 2L11A 2CW0D 3VA7A 2Z8LA 2B63B 1EY6A 4J8QA 1I7HA 4ME5A 3RLFA 1V8QA 2H89B 2LMCB 2R61A 2XNAC 4LK1C 5CMDA 2F0NA 4I7ZC 2WXHA 3AE9B 3OHXC 5CBEE 1EEID 1TVXA 3GQBA 2JU6X 2YEPF 2WKDA 4N58A 3B2FA 4K6DA 1J9OA 3Q8FA 1XO3A 4OIJA 4OL7A 3S2DB 2JWUA 3PV0A 2L83A 5LNK1 3CQZB 3AE3B 4B08A 2JXMB 1FGBD 5I6YA 3FKIB 4ZUJA 1BXTA 1WGKA 3OOCA 4DAPA 2O2LD 2WXRA 3H0GB 3A7LA 3V05A 4KK7A 4OGQC 2MPMA 1PGAA 5CGKA 1IL8A 5CV4A 5KYLA 4JE3B 2NZ1D 4M1UB 3SDZA 2BYTA 2A5HA 3E0JA 3V2TA 1FR3A 2WU5B 4P6VF 4ODGA 5EQ0A 1NR4A 2J52A 2XWBB 2DNEA 4HN7A 2JP1A 2PW9A 1RKNA 1YN4A 4OO1G 4F8MA 3DWQA 4Q2JA 1FM0D 1TS3A 5EJWA 2RVLA 2AQ2B 1NYRA 1EWCA 5EPLA 1R7SA 1ZYRD 4A90A 4YTNB 3TP6A 1FRDA 2EVBA 3C1FA 1BCPB 2D62A 5C3WA 3FPPA 1VF7A 3S1RB 4IQZA 1KDBA 1JOOA 4A3IB 2X6LA 3W5VB 3M7NA 1Q8IA 2XSCA 2EJGC 3HP3A 2E2IB 1KNAA 1RHPA 1EZ8A 1CHPD 2CU3A 3IAM1 3FPUB 1KNEA 5C3XA 3P42A 1LT5D 1RWSA 3QOJA 4TQ1A 1E9MA 1F2LA 1SFOB 1QNKA 4IUPA 3VR4A 1D4BA 3LXFA 3DMUA 3CKIB 2VNUD 4KJNA 4BS9A 4PMCA 5HI1A 2L0CA 2IGGA 2PZTA 2F0EA 2B2TC 4DK0A 4C2MB 5CBAE 5FKAC 5HFYA 3EFXD 1Z47A 1S5FD 1GAQB 1LO5D 1I4HA 2KMMA 3I73A 2F0IA 1PFMA 1TR5A 2BE5C 4HSPA 4X3SA 3Q0AA 2GRIA 1JALA 1BCPC 5IGEA 2R93B 3UI2A 2F0WA 1TKYA 1CA6A 1A6XA 5E3FA 1CJEA 4OVZA 2PMZB 3HZXA 1IBXB 4IUTA 4KHVA 1TS2A 1Y1VB 3AM9A 1ENFA 2ICIA 1FCLA 1I4PA 3BWUD 5ELCA 2NVYB 1U4LA 1RJTA 3WOEA 2KQ4X 2BTEA 3NVZA 2FHTA 1N5XA 4XQNA 3PZ8A 1AFPA 5CV5A 4CJ1B 3U4EG 2EELA 2KWDA 1EWHA 3G7LA 4OZAA 5JOBA 5H8YE 1KDCA 1KH0A 2VZKD 3P4RB 2WU2B 1WD0A 1G291 3RFZB 4RGTA 4CKEA 1JICA 5C4ZA 3L7ZC 4RAUC 2K5WA 3D8GA 1Q1BA 3LX0A 2WS3B 4US9A 1KTKA 2BCOA 2BDOA 1T5XD 1WXQA 2WQYB 2W3SA 2AQ1B 3I9V1 4KKJA 1NUCA 3D6WA 4HTHA 3BK1A 1VMPA 1MD2D 3BK2A 5I9PA 3P4QB 3KF8A 1VZ6A 1OXSC 4R3DA 3NK9A 3IAYA 1D2BA 1ONLA 3TZUA 2YYZA 3KUPA 2NTSA 5D14A 2R92B 4DF7A 1QF6A 5DM73 2KCCA 2HDMA 4F87A 3DM1A 2INNE 1BF4A 2JA5B 4YXDB 1EIHA 1BNZA 1UWMA 4A93B 2HCCA 1PRTF 1CT1D 3ZJVA 5EPJA 4MT5A 2TMPA 1JROA 1CZPA 3SK5A 2BOSA 1U4RA 4NJCA 2LS01 3FEWX 1TWHB 5CV7A 1L0YB 4FF4A 1KLUD 1JWMD 4WRDA 1JMLA 3U52E 4HR7B 1XCQL 1JWAD 2WAQB 2G9HD 1QOAA 1SF0A 1SYCA 3DXJC 2EXZA 3WOFA 2JQRB 3CHBD 3TMEA 1L4ZB 1GPXA 1FFVA 1CTMA 4FNFA 1HRJA 4L23A 3LB8C 5E6JA 3WCQA 4R8IA 2CVRA 4PNYA 1RDPD 3GP7A 3ND9A 1XTCD 2F4IA 1HUMA 1Y8NB 2FMMA 4DN4M 1YN3A 3HS0C 4V0BA 1F2RI 2F0LA 1CI3M 2W82A 2EY6A 5G5GA 1VRAB 3NWSA 3MC0B 4Y7NB 1A3TA 2VB3X 2OT2A 4HCSA 2ZXRA 3DWMA 1FIQA 1KDAA 4FYDA 3Q8EA 2I07B 3BYYB 4NDXA 4BA1I 3K58A 2QSDA 3HEJA 1L0XB 3AE2B 2V0GA 2X69A 2KQ3A 1F9RA 1DOMA 2EY2A 4WFN3 4XE0A 1AP0A 2D9UA 1BUIC 1EM7A 1WRIA 2WDRB 3NVWA 4OIKA 5FO7B 2FUG1 1K50A 1R4QB 1EY0A 3Q23A 1ZUD2 3KLSA 2NWGA 2WDQB 1V1PB 3TP5A 2V3PA 2B8GA 3FRPB 5JEAG 2F0HA 2XIWA 3HOZB 2M19A 1OFFA 2RDFA 1PGXA 5C0XI 4X3UA 1DCZA 3I4MB 2KOLA 5IOCA 3LNNA 3MXNA 2F3WA 3P1HA 4HEA1 2IDYA 4L1BA 3P4PB 4LJZC 1EEFD 3OIPA 1YJJA 4P16A 3KLSX 3S14B 3V3XA 5JAVA 4ID6A 1XYIA 3ETRA 3S2HB 5A35A 1AEXA 4IUUA 2F0DA 1N5WA 4H2AA 2W3RA 2MGSA 4PQXA 2WXJA 2WACA 1GOZA 5HGTA 2ID0A 1Y1WB 2EYMA 5DNFA 2B2WC 5T1IA 4ZK9B 1SMYD 1PFBA 3SFEB 2B2WA 1BUVT 4KY6A 3HVDA 2QKIC 4ZYSA 4A3FB 2D2CC 3EJIA 1HA6A 3H91A 2LJIA 1PUTA 2IX3A 1PXUA 2VUMB 4GDLB 5LL6S 1AN8A 4K8JA 1V97A 3F2UA 5I6WA 4FVMA 4Q5VA 2E2DC 2K5DA 4KGTA 2K28A 2N88A 2C9OA 1LLRD 1ACCA 2AQ3B 2K05A 4YSYB 2LGIA 1A2UA 4IUVA 1C79A 5DM63 1IBXA 1PZJD 3MAQA 3S1QB 1L6VA 4OZBA 1A3UA 1TYGB 1TWAB 5JJZA 1EYDA 1Q10A 5D65A 1HA5A 1AZPA 4DAVA 4L2YA 5G5HA 4DGZA 3TSSA 5F2DA 3J9CA 4FP5D 1ROEA 4AYBB 1K83B 1EQVA 1H9SB 5C5MA 5IGBA 1GUWA 3H09A 1JORA 2XN9C 3VQIA 3GB1A 1RF2D 1CM9A 1ZP0B 2E3TA 4RA8A 1PTOB 2M56B 4CGYB 4G7ZC 4XXEA 2SEBD 1QWYA 3QIAA 1VZ7A 1E10A 3M4YA 1NYQA 1DJRD 2FINB 1SNOA 2A6HC 5EGTA 5M9OA 1HFNA 1Q3LA 2QMTA 4RGNA 1G2TA 2F0PA 3T56B 3IFDA 4DFAA 3H94A 4IN3A 4FF1A 4IFDJ 5EKKA 5KNBA 4PV1C 3K57A 1MVKA 1F2YA 2KVMA 3AEEB 2EY1A 1U9RA 1B53A 1N60A 2E6XA 2NN6G 3DWPA 4U68A 1NI3A 5CC4A 2A6EC 2JSOA 4REZA 4EE2A 2BA0A 2B2UC 4ZRPA 1I6HB 2OEDA 1E2VA 4WORA 4IUQA 2KN4A 2Q8TA 2N9LA 1Z6HA 3R93A 1BR9A 2INPE 5M5YB 3VYUA 2QEJC 1SSOA 1F9SA 3CRLC 3KLRA 1C4AA 3E5SA 4KN4C 5KGUA 4K2LA 1JQ4A 3SHLA 2XRQD 3DWGC 1LTAD 1V1OA 3QOLA 1B2TA 2EYHA 1H9KA 1QCBD 4ZUIA 3TBIB 5M3FB 1FCCC 3URYA 1TWCB 1VF5C 3AECB 1SAPA 4N9TA 4N9PA 4DAYA 5I2XA 2LY7A 1OQRA 1F2RC 5EBCA 4DNTB 1H9MA 5IGCA 1AWDA 2KA7A 1XF5L 4JX1C 5EBDA 5EE1A 3K5NA 3W5UB 3K0YA 3I91A 1YNND 5T8IA 4A3GB 3AEBB 1QKZA 3S16B 4EQPA 1EYAA 2QCPX 4KY5A 5EPKA 1ML0D 3HRZC 4TMAB 2HUGA 3P4SB 3VR6A 5CV9A 3AMZA 3FVQA 3RPFC 4KKUA 4A8XC 1MHXA 3C46A 3LYYA 2L1BA 2K0PA 1DOKA 3T3NA 2FMCA 4KV6A 1EZ6A 1STNA 2JYTA 1KRHA 1B44D 1ENAA 2L9HA 2RMMA 1SYGA 3A56A 1CZWA 2DLBA 4K14A 1WCMB 1WTXA 1SNMA 1HPCA 3BZDB 3J7AF 2LHDA 1TT2A 4NP5A 2WLBA 1ESRA 1PYWD 2K3UA 2PW5A 2B2YA 4TQUS 2E74C 1PFNA 4H44C 3CWIA 1RFKA 2HQEA 3HVZA 4RCNA 5JVG3 1IUEA 4C3JG 2FJ2A 1GJXA 1OO9B 4C7ZA 5I2YA 5I4DA 3S1NB 3SXHA 4XYOA 3ABVB 2SOBA 3M7GA 2JEBI 1II3A 5TSSA 4FXKC 3RZDB 4ZAIA 3RZOB 1WSPA 4R8NA 4XYQA 3JAML 2NVXB 4LK0M 2IJ0A 3S15B 4ARCA 3K59A 3J7YW 3FDTA 3SEBA 4AQ7A 3AE6B 1V43A 1DD2A 5KNCA 2WV6D 2YEPB 4RF0A 4WWMA 2V4IB 4DA2A 1B4OA 5FOBB 2EKIA 2JA8B 4IURA 3D6CA 4PMWA 3I8ZA 3MHBA 5FO8B 3OSOA 3MZ5A 1QOBA 3MFYA 3H3VC 2ZW1A 3ZYYX 3I4NB 2I46A 4BBSB 2BS4B 3ERQA 3BVZA 4E6IA 2L52A 3FC4A 4O42A 1O7LA 3OIQA 5C4HA 3NQTA 1IGCA 4RHRA 3MJ5A 3AE1B 2KEEA 1C4PA 1ZE3D 1JOQA 4RNAA 1EY5A 2PPBC 2B76B 5FR3A 1XWEA 5EE0A 4XT3B 5HURA 4A3BB 3E56A 2O5JC 1E0BA 4K5WA 4EQOA 1MI0A 2F0OA 2LFNA 4MACA 2F0UA 2ACZB 2AUKA 1EOTA 4XQJA 4FXCA 2BS3B 2BDNA 3A55A 1HTLD 1FXIA 2GB1A 4IFDI 5COYA 5KRUA 1PZKD 2BBCA 2WKCA 4HMIA 2EYJA 4KGSA 5IODA 2JA7B 1TKWB 2RA4A 2PYKA 1ET6A 1YN5A 1ILPA 2B2VC 4ZKCB 1HZ6A 1IW7C 1K53A 2NN6I 2BE5D 3Q8CA 2XVSA 2HDLA 2WXNA 4C3IB 4M8AA 1PFDA 4ZRQA 3GTMB 3VYTA 2KAJA 2RDHA 1DONA 2NMQA 1TWFB 2L5TA 2MP1A 5HHDG 4A3JB 4JBWA 4KD4A 2EDGA 5M5XB 3FAHA 2M2LA 1L5PA 2QDBA 1BDOA 5G3LF 2K33A 2CJNA 1X3QA 4QUFA 4FXGC 2B2YC 2DN8A 1KF6B 1UNSA 5BMGA 2NVQB 2EY5A 1YQ4B 4XDDA 3DHQA 3P20A 3J80L 4K5VA 4KX6B 3TEYA 5M3MB 1XLOA 3GV3A 3JAME 1QB5D 2EYLA 2N0SB 2SAKA 2HCIA 3A8JE 2OHFA 2QIEB 4XQQA 1HQRD 1WVLA 2PZUA 3LWUA 1J8IA 2BS2B 2F0GA 1S4ZA 2IGHA 5J1ZA 3NHHA 5C4XB 1A3VA 4KMUC 3L9AX 2BB5A 1ZYRC 3J7AV 1FMAD 4ITKA 1O7YA 4CKCA 4K5XA 3AH7A 1RTNA 3EROA 2ENBA 1PRTC 2XWJB 2JE6I 1SE3A 3BVMA 1DOIA 2Y5CA 3FMCA 2RDGA 1X32A 3BYTB 3Q24A 5E4WC 5BYRA 5IGFA 4OHJA 1HZ5A 3NTKA 4HCEA 2EYOA 4KJOA 5A2QE 3D4DA 1SE4A 4J6HA 1LTBD 5K36G 2B8FA 2A68D 5C0XH 1TJEA 2VXWA 2NUCA 3OWFA 3A8IE 3HOWB 2EYPA 1V1PA 1ZPSA 1C76A 2KDMA 3W9CB 1ZEQX 3OWEB 5EKLA 3PMFA 2FFKB 5CR3A 4C3HB 3GTLB 2K32A 5C6AA 2H1EA 3KBGA 4RFBA 3Q69A 4FF2A 1UUPA 3T16A 5I9OA 1DXMA 1ZKOA 2FBWB 4ZHPA 1MGSA 2DYMA 4GLSC 1K8MA 2R3ZA 1G2SA 2O4XA 4ILWA 2JZPA 2JXTA 3IT6B 2NVTB 2ZXPA 3I3CA 4FF3A 3MXPA 1VDZA 4OO1H 1A15A 4QF4A 3CIRB 5FLXE 1N61A 3AN1A 1WTQA 1FEHA 2RSNA 1LTSD 3NVYA 1G6ZA 3MTSA 3AB5A 2ZW0A 2M9VA 4JWUC 5C4JB 1SE2A 1HCZA 3BDCA 1VR9A 2NN6H 4WQMA 4TRDA 5KYIA 2X38A 1D6EC 1JOKA 4NZLB 1DZ1A 3I90A 1AYFA 1GB4A 1JWUD 2JEAI 1C48A 2ZT9C 2K5PA 3W2DA 4NMZA 5DAUA 4X3TA 5E1FA 4IFDH 1TS5A 2PCFB 2KECA 1OXTA 5IT9L 2LUMA 3A7AB 1NSNS 3AU7A 2Q8RE 5D7GA 1STYA 4OO1I 1U4MA 3T51B 4JPSA 1R4PB 3TN2A 1TKEA 3VYRA 3K6OA 3NP8A 4XDCA 1J7CA 4UDUC 4ABNA 3PUYA 4QB4A 4RKLA 2MJDA 1UEAB 3P1MA 2A69D 3R3OA 5DEHA 2GA4B 4DK1A 4A9AA 2LEKA 3I4LA 4WIPA 4TSSA 2F0KA 4C3HG 5C0XJ 1I6VC 1LABA 1Y69U 4CJ2C 2IL8A 5AUIA 3TP8A 3PIO3 1MSGA 1FRRA 3PZ7A 1JW9D 5A2QL 3TUOA 1D1IA 3OW7A 1PDQA 1SNDA 5EE3A 2YU9B 3MXGA 4X3KA 3FILB 4QMGA 1UAPA 1N62A 3K7AB 4D2KA 2PMVA 2M0AA 2DYOA 3Q8BA 5EE9A 3PUXA 3ZJUA 1RM6C 3C2PA 3B2GA 4C7YA 1LT3D 3BG3A 3MVVA 1IYUA 1GUNA 3BIID 4LMQD 3AE5B 1TY0A 2WXKA 4G7OC 2AUJD 2OF1A 3VR8B 2B2VA 1E0ZA 3BS1A 2K6AA 2R7ZB 2BW2A 3IFTA 2KUMA 1O7ZA 3VR2A 2E2JB 2WDVB 1VZ8A 2LFIA 1LT6D 4YSXB 1H9JA 1C8CA 3VR5A 3S17B 1STGA 3J80E 1BBXC 3QWNA 4DU9A 1IHZA 3VA5A 5G3LD 5IIFA 3M3YB 4TQ0A 2F0FA 1SNCA 4XTCS 3PUWA 1C9FA 1JC7A 1FFUA 1ICWA 3HOUB 1MSHA 1JR0D 4LLGM 2LMCA 1ZOYB 3AV8A 4GZYC 3SK8A 1DGJA 1NCVA 3GO5A 1Y8PB 1XEEA 2Y5PA 4R9WA 4YWGG 1WTOA 1TQOA 4Q0FA 1DOYA 3SR1A 2KEDA 1NR2A 1VJKA 1SXTA 2SDFA 1YQ3B 4N59A 5BYSA 3M4OB 4MHEA 4KTAA 4RHSA 1PTOH 3T4AC 1C4CA 4G4KA 1F0ZA 5CYUA 1Q90A 1A70A 1KLGD 2K01A 3EVQA 5E4XA 2Q8IB 2K22A 2MEKA 3KQ4A 5HG2A 3SFDB 1P7EA 1ZXHA 2X6GA 2R6GA 3NXWA 3GV6A 1A2TA 1L6UA 3A8KE 4B0EA 3HKZB 4ZLTF 1ET9A 1I4XA 2KCNA 3IAS1 4US8A 2SNSA 3C3LA 3QO2A 2ONQA 1EY9A 3ZGZA 4S3SA 3R2IA 5ELDA 3GTGB 1FXAA 2WXPA 2WXOA 1B1ZA 3S1MB 4ZHOA 5C0XG 3EQLC 4RGOS 4WURA 3PIP3 4L63B 1RODA 4JWSC 1GUSA 1JB3A 4C1NI 2JYOA 3ZQ4A 1EWYC 1O80A 2SNMA 4RKBA 1WYGA 1CZGA 2IX1A 1TY2A 3D4WA 1QG7A 2L12A 2V3NA 5C44B 1W6JA 1C78A 2XRSD 3ND8A 1X3PA 2F1MA 1GXDC 4QUCA 1SYBA 3NBHA 4K8IA 1LTGD 2F03A 1BO0A 2K04A 3IKJA 1U4PA 4U673 3EGRA 2WINB 1SMYC 2V4DA 1SYFA 1BCPF 3G6JB 3BDOA 3RMHA 1I4RA 3AEGB 2OEOA 3HGBA 5K5PA 2AX5A 2DY8A 5BN3A 2W55A 2MJEA 2AWOA 1DOLA 4H7BA 1EL0A 5H92C 1TZOA 1VCIA 1P7FA 4PMBA 1MBYA 3BVGA 4IKGA 1GB1A 2B2UA 2QF7A 3MHZA 3N9YC 1KFYB 3EA6A 4HKQA 3ONAB 5BN5A 3GTKB 4EVOA 3AE4B 1ZXIA 2LHEA 1STHA 4OW0A 4PT5A 3IL8A 3J81L 1IYVA 1JWSD 1LV9A 3MXUA 3P7JA 2A69C 3GTPB 3B9JA 2K1BA 5LHY1 4BWGB 2HDEA 3K5LA 5LL6X 1AW7A 4CKBA 1CFMA 1JRPA 1OQQA 4LAAA 1SSNA 1B9MA 3KBXA 4ZRZA 1SBBB 5JXVA 4P2CB 3PO3B 3CU7A 2IX0A 3VR9B 3ZJTA 2EYFA 1E7PB 1D1KA 1NENB 3TEZA 2A68C 3NZ3A 3P63A 1GHKA 1STAA 1GUTA 3MP9A 2PZWA 5C2TB 3KWVA 4FO2A 1UGJA 2HTME 5FO9B 1E6EB 4YTPB 4YT0B 3J81E 1EY7A 1DM0B 2CQAA 3DEPA 4HKZE 4O1NA 5JEAJ 1PZID 1SB3C 2Z1CA 3AE7B 3T13A 3HRDD 4K2KA 4NAMA 2WXIA 3AEFB 4IZ8A 2L32A 1PTOF 4USAA 2NBFA 1EFID 5D3DA 2NB0A 2E76C 5T1GA 1NAPA 2H88B 1GHJA 4EGVA 3K5MA 1VMCA 2IW3A 1AZQA 3W3AA 1B3AA 3NTIA 3PO2B 3Q6SA 3GS2A 3NWTA 1E2ZA 2G9DA 2RBMA 2DY7A 2CHBD 3AEAB 1NEKB 2Z4IA 3NQIA 2MJ3A 2F0MA 4HMJA 1PTOC 2J7ZA 3NBIA 4HEDA 2JA6B 4A3MB 4LTUA 3EUB2 3HUIA 3SE0A 2WNMA 5ELBA 1SIJA 2DNCA 1Y56A 1QILA 1DOXA 1WD1A 1MI2A 5FK9C 5D3IB 1G8ZD 3VRBB 3RUZA 1C77A 2PVGC 4KN7C 4HRSA 4KKTA 1K51A 2PO4A 3W1SA 4ZOHC 3C8YA 1M4VA 2I38A 3GTJB 4MN3A 1RYJA 2VZKB 3NSWA 1EIGA 3NPPA 1ZXTA 1JQYD 3TZDA 3N6RA 3NUCA 1OXUA 4NKLA 3Q8AA 2K5QA 4GDKB 1T5EA 2KJXA 2Q5WD 2RPVA 1SNPA 4BBRB 1T6BX 4DNRB 4FXDA 4XIGS 3E9SA 4KKIA 3O13A 3V96A 2RKSA 4YSZB 1WTPA 2WXGA 1IGDA 2AWNA 1VDVA 3U9OA 4WAFA 1XCTL 1QNUA 2EJMA 4KI0A 4EQNA 1EQTA 4WJWA 4DXFA 2PKOA 2K03A 1G91A 2EZVA 1QT9A 1B9NA 4J1MA 1UWXA 2DWQA 1SYDA 4ZQ3A 3K5OA 2MUYA 1T3QA 1EYCA 3X3MA 5ELEA 4KY7A 1DYQA 3RD4A 1IW7D 1S5BD 2N9KA 3C1EA 3FILA