2AQ1B

Crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWHGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-cell receptor beta chain V
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Mus musculus
total genus 69
structure length 234
sequence length 234
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aq1B02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2aq1B01
3TSSA 1EU4A 2RDGA 3KLSX 3BVGA 5I4DA 1PYWD 4TSSA 1MD2D 1BCPB 1TY0A 5ELDA 2CHBD 1LTTD 1D5XC 2XRQD 3DWPA 3CHBD 1LO5D 1PRTF 1PRTB 1V1OA 5TSSA 2QILA 1KLGD 1S5CD 1YN5A 1HTLD 2TSSA 1LTBD 1B1ZA 1DJRD 1ET6A 1S5DD 1PTOC 1LT5D 1LT3D 1PTOF 3BYYB 1D5MC 1I4HA 3O13A 4UDUC 1PTOH 4BWGB 1CHPD 1TS4A 1V1PA 1I4GA 1S5BD 4DXFA 1CHQD 4NZLB 4O1NA 2IJ0A 2XN9C 3GP7A 1YN4A 2Z8LA 4RGTA 1TS3A 1M4VA 1SE2A 4DXGA 4C56C 4Z9CB 1CK1A 1ESFA 2NTTA 1FD7D 3BZDB 1RCVD 1D6EC 1JR0D 2AQ3B 2XNAC 3URYA 1SBBB 1SE3A 1EFID 4RGNA 1PZID 2SEBD 2O2LD 1TY2A 3R8BA 3W2DA 1EEID 1PTOB 1SJED 4OHJA 1XTCD 3BYTB 4RHRA 5ELBA 3V05A 1RD9D 2AQ1B 1ENFA 1HA5A 1KLUD 1L0YB 1EWCA 2XRSD 2IPKD 1YN3A 1LLRD 1AW7A 1UNSA 1UUPA 1KTKA 1LT4D 1SEBD 1SE4A 2G9HD 3MFGA 5ELEA 5ELCA 2ICIA 1BCPC 1I4PA 4RFBA 1AN8A 1BXTA 1TS5A 3R2TA 1FNUA 1BCPD 1S5ED 3DWQA 1LT6D 4RGMA 1LTID 1T5XD 1CT1D 3SEBA 2WV6D 2NTSA 3R2IA 4RH6A 3EA6A 1QILA 1STEA 1JCKB 5FK9C 1B44D 1HQRD 2J4XA 3OWEB 1CQVA 1L0XB 5D3IB 1EU3A 3MC0B 1V1PB 1F77A 1S5FD 2R61A 4L6TB 1SXTA 1SJHD 1JWMD 1LTAD 1FNVA 1I4RA 1D5ZC 1BCPF 1FGBD 2AQ2B 2RDHA 1JWSD 5ELFA 1TS2A 1I4XA 1PRTC 1JQYD 1ET9A 1I4QA 2QEJC 5D3DA 4RHSA 1FNWA 1JWUD 1G8ZD 4L63B 1RF2D 1PRTD 1EEFD 1HXYD 3BVMA 1XXGA 3EFXD 1LTRD 3DWAA 4K6LA 1LTGD 4ZYSA 1GOZA 1PTOD 4RCOA 5FKAC 1DYQA 1RDPD 1PZJD 1PZKD 4RGOS 3BVZA 1LTSD
chains in the Genus database with same CATH superfamily
1DGSA 1IBMQ 1YJ1A 2BKRB 4XC2A 4ZK9B 2FAZA 1PYWD 3C1EA 3F2CA 1T0YA 2F0TA 5IGDA 4JLCA 1FVIA 1QWYA 5HFYA 1F1HA 5C2TB 4JE3B 1IBKL 2N9XA 3B2FA 2F0IA 1NMGA 2PO4A 3AM9A 2LHEA 4WJOA 1V1QA 2UUAQ 2CHWA 1DM0B 3EIVA 4DV3L 3AEEB 3B08A 1LTBD 3PUZA 2F03A 1DJRD 4IWOA 3GQBA 1S3SG 3QX1A 1LT3D 3BYYB 4UY8C 2A69D 1PTOH 4DAYB 3VUWA 4LFAL 4GU2A 2CQAA 2DYMA 1ENAA 1YNNC 2K50A 4H02A 3C19A 3N32A 4C3JB 1A8VA 1OQQA 4L5QA 4DXFA 1RIPA 3MXGA 4FBJB 4XDCA 4GMVA 1GKHA 3H09A 4KDIC 2AHOB 3CCLA 1ZXTA 2C7MB 3CP0A 4QY7A 1N5XA 2DZMA 3KUCB 2BH2A 3D6CA 3J81L 4WQOB 4DV0Q 3J81E 2YTVA 5E3FA 4BBRH 4DR4L 2B8FA 1BO0A 2Q2HA 4W9JA 1VDZA 3J7A5 1D6EC 4B6WA 1C4QA 2K9XA 2E76C 1SNQA 3P7JA 4HIKA 3EGRA 3QK0A 5EE3A 2D3GA 4LF7L 4A3IG 4NJ6A 2IX3A 2L55A 1N36Q 1C4CA 1BMLC 1NR2A 3S1RB 1ZDXA 3A4SC 1YNJC 1L0VB 1OEYJ 1VQNA 3U52E 3K7AH 3PT2B 2G1EA 4C1NI 4WJQA 2XVSA 1N5WA 1VQOA 4A93H 3AU7A 2IYDB 4UP7A 2WDTB 1I3QH 3KJPA 4AYBG 1YI2A 1IW7C 4G57A 5KRUA 1WJ4A 3A9KA 1U4AA 1C77A 3KDFA 4HVBA 4DDID 3H3VH 2NVYB 2M00A 3IBEA 3CU7A 1LTID 2F0LA 1HRJA 1CT1D 4DK5A 3MXUA 2HDEA 4MHEA 3TMPB 4PS7A 2IY5B 1SGHA 2Q8RE 3CMAA 1T5EA 2IY1B 2ASBA 3PUVA 1STEA 3PUXA 3DUZA 1PFNA 3M9BA 3ALBA 3A54A 4GOCA 4NQLB 5COYA 4ULLA 5G3LD 4EX5A 4JL9A 1XPOA 1KH0A 1VRAB 4ANXA 3MJWA 3L2PA 3PCOB 1EY7A 2E8GA 1B50A 4FF3A 1LFDA 2WFWA 3CRKC 1JRPA 4H13C 4QQBX 4WWMA 4ANVA 4M0WB 4YHHL 2VUMB 2WAQG 5EKKA 1SYBA 2VQFQ 2EPBA 3A55A 5L37A 2HD3A 4MM3A 1J6QA 2JU6X 5CTRC 5AUKA 2LSSA 3CXCA 2OJWA 2JA7G 3P4RB 3RULA 1BDOA 3QARA 1YX6B 1IYFA 5EAYA 3TP6A 4KMUC 5E4WC 4AYBB 4AUQC 4ZUIA 4EOYA 2VY3A 2GBKA 2PKOA 4PYZA 4GKJL 4QB4A 2F0KA 2A73B 3RZOB 1PMRA 4B0EA 2EVBA 4GB9A 1P16A 3KLSX 4C3IH 5J22A 2LJ5A 2K6AA 1WOCA 3CCMA 1JT8A 4TRDA 1IKMA 2O2VA 1JRUA 3AE1B 4AP4C 1EYDA 4DBGA 3CHBD 3E0EA 2K8CA 4ZKBB 1PRTB 1TWCH 2JX5A 4WURA 4KY6A 2CS4A 2LGYA 4NKLA 3IXSA 5M3MG 2F4VL 5EE9A 3BK2A 3RD4A 5C3EH 1MHWC 4R4TA 1A63A 1HTOA 3GTOB 3HUIA 4DUZL 4JIOU 4EKUA 2DY7A 1F9PA 1NEKB 2UU7A 4N6EB 3RNCC 4XWTA 1WYDA 2WAQB 1F9QA 3PV1A 1G2SA 3S2HH 1CHQD 1QE6A 1MHXA 2KN4A 1E24A 3A5UA 2CJNA 1QB5D 2R6GA 2JA7B 1TT5B 3QC8B 4B9XA 4DDGD 1BNZA 2LD9A 4J3OD 1ZPSA 3AECB 1TS3A 4A9AA 1ZKHA 3CSFA 2YEPB 1FM0D 4KN7C 3HRDD 4ABNA 1XLPA 4JCVE 3NTKA 4N59A 4G7ZC 5CYUA 2AEHA 2A68C 4YY3Q 1EY8A 2F3VA 2KWDA 4B3ML 1TVXA 1VS0A 1FCCC 2CR5A 2RSUA 4BOSC 1IHZA 3P2BA 3UDFA 2CU3A 1KFYB 3WAOA 2PMZB 4YIJA 5ELBA 5C3WA 1Y1WG 4B9WA 4ANUA 3D4RA 4JI5L 2KWCA 4A3BH 1HA5A 4WIPA 3UDXA 1WZ0A 2C60A 4JI3L 3PF4A 4DR6L 5M3MB 3OWFA 2N1VA 4QIWE 2VZAA 1SE4A 1K3BC 4CKBA 1GPXA 4G50A 3Q22A 1I4PA 5CV5A 4GDLA 2TMPA 1JWAD 5EJWA 2NVTB 1K8AC 4FXCA 4LDTD 1LACA 2CCZA 1XX8A 3HOUG 3TP7A 3L54A 1XNQQ 3MC8A 3ZXRA 1J8IA 2RD0A 1S5ED 4NXMQ 1LT6D 4FJVB 3VXWA 2F0EA 1KAAA 2PE6B 3ZNHB 4UHVA 3PZDA 2G4SA 5L83A 2HHHL 3DWMA 1VR9A 4AJYB 1FJGL 2GLSA 1E8WA 4RNAA 1BBWA 3IL8A 1Q8KA 1B44D 3EECA 1CA5A 1E7PB 2WYQA 1SROA 4MJSB 5D94A 1SF0A 2BB5A 3DDCB 2OOBB 4FXGC 3RNUA 1WE7A 2QGQA 3CQZB 4O42A 4JOIA 2J7ZA 2NMQA 1HNZQ 2D0PA 4CJ2C 3Q3NC 3A8JE 1MHHE 2IGHA 1PH7A 1JWSD 4BZAA 2N55A 2FJ2A 3ZJVA 3WWVA 2BWES 3BWUD 3NSWA 3PIO3 1VQDA 2L0CA 3PIP3 2UXCL 3MHZA 2DY8A 3LJ3A 4C3HG 1VQ5A 2NCNA 4MACA 2EJGC 1XXGA 2FCMA 1TWFB 1YQ3B 4GN5A 4IPGA 3QG1A 1K83B 4IO9A 1K52A 1Y14B 3VHTC 1GB4A 2OHFA 1X1MA 4MGKE 3ZNZB 4FF4A 2B2TC 4DQOC 1TIID 2PZWA 2K32A 3U9SA 1KAWA 4C3JH 3HOUB 5IYCG 3J80L 1QKZA 3G48A 3SVMA 1QZGA 2RKSA 3D31A 5KIXA 3WCQA 2NUCA 2RDGA 3SE0A 1SR3A 4KGSA 1EOVA 4TKOB 3UQBA 1DGJA 2F3WA 1HE8A 1MD2D 1STYA 2DYBA 2R7FA 3IFWB 4A3EG 3OOCA 3ZXVA 3B9JA 4IUVA 1FYCA 1QVFA 4TMAB 2TSSA 4L5RC 1QF6A 1GVPA 1WJ6A 1KXLA 4A3KG 2KXJA 4JV5Q 5IA7A 1YIWA 3RCZA 1A62A 1PTOF 1ACCA 1IYUA 2K01A 4FNFA 1BQQT 3N1ZC 2MP2A 5AZGA 3GV3A 1NBWA 2WX0A 2B2YA 1JJCB 3A74A 3PUYA 2XEWA 1RFKA 1A15A 1WMHA 5I6WA 1P7FA 1HUMA 3VYSA 2Q8TA 2A74C 4A3FG 2HCCA 2BQQA 1LM8B 1GC6A 4N58A 2BOSA 1WGGA 4LNFA 4ME5A 4XGAB 2EOTA 4EE2A 4IN3A 2KUMA 4JI0L 1L7YA 3QIJA 3U7DA 2Q2IA 3ULJA 3LWUA 1EY9A 3A56A 3I91A 2NWGA 4X65Q 2NVYH 3ICEA 3DVGY 1WYWB 3M7GA 2JA6B 4EQ5A 1JOOA 3URYA 2MSED 3PRZA 3QHTA 2N0SB 2IZVB 3E3XA 2B2VA 1PGAA 3NZ3A 3NELA 2BA1A 4FF1A 3M7NA 1YHBA 1LUZA 1V9JA 1FCLA 2K1FA 2K5PA 1ENFA 3QO2A 4A3EB 4K7WA 1AP0A 1UGMA 1LLRD 2LHDA 5IODA 4P73A 3RUIB 3EROA 1E6EB 5E1FA 4A3KB 1LQBA 1TS5A 1O80A 3H0GG 2ZW1A 4IFDG 5DEHA 3AE5B 2VUMH 1NY4A 2EE1A 3KQ4A 1JB7A 3OG5A 4NDXA 4II2B 3GE8C 5JEAG 5IT9c 4RGMA 1ZUD2 4IZ8A 4FYDA 3JAME 1MJDA 1QNUA 5T1IA 4GKKL 2XK5B 3R2IA 2GBNA 4EQOA 3B1LX 4L23A 1WFYA 3OAWA 4DAYA 1C78A 3EUB2 3TEXA 2KACA 4IUPA 3QCAA 3W1YA 3PZ8A 1PH6A 5KHOA 1VQHA 5BO4B 1QVGA 5GXGB 1E10A 1TWHB 3EFCA 3HIZA 2M0AA 2R61A 3JC66 1YQ4B 2Y5PA 1IL8A 4DV4L 5GAGC 4YCVA 1AZPA 3RZOH 3S17B 5E6OA 2BS4B 2KENA 1SXTA 4I6PA 5LLIA 2MEKA 5AUIA 3S14B 4WAFA 1WI0A 3QR8A 4I65A 1YOVB 2QEJC 1YHQA 1A2UA 3S24A 3PO3G 2GBJA 4N9F4 1FNWA 5CHWA 4JI6Q 3IVFA 1XNRQ 2KX3A 2A6EC 4Y52H 3L3OC 3GOEA 3GTOH 4K2LA 2C5CA 4BA2I 1JOQA 3NXWA 4APVA 1GO3E 4WJNA 5JJIA 1R4NB 1Y8RC 3K81C 2PMVA 5D14A 1L1OB 1A3UA 5AJ3L 2B39A 4G4KA 3PQIA 5C44H 2JA7H 3V6CB 2D9UA 1HNXQ 1YQBA 3HOWG 2WACA 2IT1A 1N32Q 3ML8A 4AQYL 1TY0A 1H4RA 3HOZG 3KLWA 1BKBA 2CU1A 4DHJD 2C9WB 1W3SA 1Q3LA 4I7AA 2AL6A 2DNFA 3CKIB 1UE1A 3Q3JA 3H94A 3RN2A 1K51A 3MWYW 2KDMA 5IWAQ 4FADA 1V8CA 1QOFA 3VR5A 2PLPA 3TCAA 1XMQL 4GZYC 4DUYQ 2WDVB 3A33B 1K0SA 1XCTL 1YVCA 1ZEQX 4X3TA 3HOYG 3PO3B 3PHWB 2N88A 3ZIMA 2QKIC 1JE5A 1UGJA 2M56B 3AH7A 2I0QA 5C1ZA 5KHQA 5M3MH 1FRRA 4NXML 4DAVA 2AWTA 4M0WA 4WWNA 2QDLA 2NBWB 2MHJA 4CO7A 3S1NB 4XT3B 3BG3A 3RPFC 4IUMB 2HTHA 1CK1A 2WP8J 2NVTH 3GTLB 1YMHE 1ESFA 2YTXA 2DBYA 4JBJA 4LNNA 2KLCA 1N9WA 3E9SA 4I6NB 3RNAC 1ML0D 1L0WA 3I56A 1ICWA 3VTWA 2WWZA 2IW3A 1XMOL 4MIUA 5IYDG 4A90A 4LFCL 1HNZL 3WOFA 2UWQA 3CCVA 3HOZB 4IPHA 2D3CA 4OVVA 4W9CA 3LGJA 4XIGS 1WH3A 3ZNID 3H1UA 4CQNA 2NZ1D 2WINB 1G291 3BDOA 3ENEA 5M3FH 4OXPA 2QEXA 3CQZH 1LT4D 3SXHA 2ICIA 4A3GG 2FUG1 4ASWC 1RODA 2O5IC 2EYHA 4U68A 1FIQA 3IT4B 1SMXA 1C9OA 1Y69U 3CPWA 4ZYNA 5J17A 1Z9FA 3NS1A 1KRHA 1HA6A 1Q46A 4YTNB 3BJUA 3HOYB 2NTSA 1PV4A 3FILB 3KOJA 4JWSC 4B9KA 1TWFH 2CWPA 1NNXA 2R2OA 2H4OA 1K83H 4JBWA 4U673 1K8GA 2HDMA 3H91A 4MSMB 1HQRD 2DYOA 4YCWA 3J81c 1E7VA 2EMTA 2KFJA 1OXVA 4ZOHC 3PIPA 5D3IB 4KZ0A 3HOUH 2VB3X 1STBA 4JOIC 1Z5SB 1KL9A 1CKOA 4ZDVA 2N7EA 3MXNB 2OTJA 2QIEB 1U0LA 4LFAQ 4GNXC 1SJHD 5FLXE 5EKIA 1SRUA 1WGDA 2LGXA 4OWXB 1UBQA 3VRBB 2WB1E 4LUOA 2M9VA 3TN2A 1STNA 3I70A 1EWHA 3R3MA 2KNBA 1U4MA 1RF2D 1PRTD 1EEFD 3FPPA 2K03A 4DR4Q 2FIFA 3FKIB 4XT1B 4TQ1A 4S17A 2N9KA 4A3GB 4A3LG 3K5NA 1F9RA 3V61A 1IPGA 1NVID 5C0XJ 1C0AA 3L10B 4RCOA 5IGEA 2GMIC 4LF7Q 3ABVB 4KVGB 2OQ0A 2JP1A 1WX8A 1HQMC 1WYGA 1S72A 5BN5A 2MA9B 2MCNB 2M17A 2VS1A 1VQGA 3BVGA 4V190 4RM8A 4TSSA 2DWQA 2LGSA 1KHIA 1P98A 2RDFA 4OWTB 2LGIA 3ZRCA 1LTTD 4CYEA 3DWPA 3ONAB 3VA7A 3K5LA 2M2LA 1R4QB 1KIXA 1G2TA 1A3TA 5IP7G 2JA6H 2KANA 3FPUB 3ZDMC 2UU9L 4W9LA 5IYCH 4FVMA 1PDQA 2RVLA 2OF1A 1CKMA 1I4HA 2A5UA 1P3QU 4MJSA 1M90C 3RNFC 2FXQA 2B2YC 3BDLA 3T9LA 3IAYA 1J7CA 1CHPD 3EQLC 4OGQC 1V86A 2CHXA 1J19A 1AE3A 3CF5A 3KFUA 3N6RA 1PFMA 3ML9A 1Z6HA 4A3EH 2ASQA 2O6VD 3FMCA 1HCZA 4BS9A 4CBVA 4YSZB 1EIFA 4QMGA 4HDQA 1QCBD 2KQ7A 5FLMH 4JWUC 4A3KH 1VQ9A 3Q8FA 5AZHA 1KOTA 1IW7D 5T1GA 2I5HA 3HVZA 3OIPA 1WCMG 4MTKA 2UUCL 4YHHQ 2GBRA 4GS3A 2KJHB 3UE0A 1VF5C 4JPBW 3UINB 1JE4A 2DZIA 4MZ9A 3J7ZC 3ZO5B 4F7ZA 1C7YA 1P7EA 4IM0A 5BN3A 1E7ZA 3AU4A 3APFA 3IFDA 3ZJTA 1UUPA 3S17H 3MC9A 3RI7C 1MI2A 5ELCA 1YITA 4GLXA 1PGBA 2K22A 5IGBA 1SYGA 4GKJQ 5M5WB 1K28A 2NPTB 2RCFA 3S14H 2MW5A 4PS3A 5J2RA 2CHZA 5E4XA 5KEEA 2E2HB 5IO9A 4LF9L 2JA9A 1WWTA 1STHA 1WTPA 2BS3B 3KUZA 1WF9A 3PLUA 5I6YA 2JA5G 1CZWA 3VRAB 1Y1VG 3CCQA 3PLVA 1EYGA 1NENB 2KJ6A 5M5YB 2KWUB 4IFDH 2H1EA 4I7ZC 3PO2G 3MZ5A 1N32L 1V43A 3RNBC 2ZXOA 1WRIA 4FO2A 4JI8L 3HFZB 2BH8A 2ZJPA 1WCMB 3GTJB 1DD2A 2I46A 1GD7A 1LTAD 3D0FA 1I4RA 4BY1H 2AQ2B 3E6ZX 3KYCD 4L5TA 2W3SA 3RZFA 1NTGA 2VB2X 2PIAA 5BYRA 2OEOA 2H88B 2MLBA 3PRPB 3GZNB 3T13A 4XZ4A 4DUYL 1IL2A 3CRLC 3J81i 1T9HA 4FP5D 1WY8A 2F0HA 2ES2A 1JMLA 2LUMA 3L9AX 3CIRB 4O0AA 4DV6Q 4TV3A 3VYUA 1MG8A 1B9RA 4GOPB 2MFIA 4K8JA 4MGIE 3EN2A 4MSQB 4OONA 5C4ZA 4B3MQ 4W9EA 3PO3H 2WLBA 4FULA 3Q6SA 3SK6A 3PVLA 4CDEC 4X64Q 4JI5Q 4DHZE 1SMYD 2F3IA 3U2SC 3S1NH 3E5SA 3W9CB 1EY0A 2V1CC 1Y1VB 4JI3Q 3GTLH 1C4AA 4DR6Q 2INPE 5L95C 1FFUA 4AOFA 3PF5A 2M4NA 1WI5A 2XK5A 1X3GA 3PO2B 1T6BX 1YN5A 4BKSD 5CBAE 1VQ8A 1AH9A 2L11A 2SDFA 4KD4A 3J7YW 1HNWL 1CMXB 2C35B 1TKEA 1Q10A 5A35A 2EZVA 1PVOA 1DOLA 1BT0A 3OTOL 3P1MA 1TS4A 1GHJA 2INDC 3K0XA 4DK0A 3HG9A 1AYFA 3C0RB 1S5BD 4TVAB 2AMCB 3IRBA 2HHHQ 3HOZH 3L13A 2MNAA 1P0RA 3VR4A 1FJGQ 3TEWA 2IJ0A 1B9NA 2BF8B 2WHIA 2E2IB 2QCPX 3D3RA 1X9NA 2E5LL 4XQJA 3NTIA 2LJIA 2ZCCA 2BCOA 4ZLTF 5AEKB 3H3VI 4MDKE 4LFBL 4QAYA 3I72A 1BUVT 1MSGA 1EF1A 1WD0A 1J5EL 1UE7A 2GBMA 1E1OA 4KV2A 4RGNA 4DKAC 3J80c 3HOXG 4RF1A 3HOYH 1AARA 2RA4A 2EYOA 4QIWB 2L52A 2NYZD 1VF7A 3KUDB 4KN4C 2Z6KA 3M4OB 1SDFA 4LNOA 2D0OA 1OXSC 2UXCQ 2L7RA 1EZ8A 1L1OA 4FHJA 1A5RA 2R93G 1VQBA 3Q0AA 3RZDH 1IXRA 3UE1A 5CC4A 1NUCA 2CJOA 2GB1A 1PYBA 5FR6A 3NQTA 5DLQE 3DVGX 3I4OA 4DHJB 5J18A 3W1SA 3SGIA 3DBRI 3L16A 4JGHB 1LYLA 2FE8A 1GAQB 4MTNA 3QWNA 4DR2L 1EIHA 3HM3A 2N8NA 1BCPD 3DWQA 3CC4A 1I35A 2GI9A 4CDFC 4FA6A 4X62L 2RCNA 1R4MI 2NVXB 4M01A 1PQSA 1X56A 2F0JA 2ZVNA 2BTEA 1LTLA 1AEXA 3NRZA 2EY6A 5ISRA 2V3SA 1FL0A 1B7YB 3FKIH 1FR3A 3X3NA 5FK9C 4AJWA 4KY5A 4PMWA 2YLMA 1UD7A 3MFYA 3UIPB 1EU3A 2LZ6A 2B3GA 4A3CG 4P75A 1EUVB 1PH8A 1VQEA 2NN6G 4AIMA 3HOXB 3AU5A 1IKLA 2RHQB 2KJXA 4ARIA 1JQYD 3Q69A 1WJJA 3Q3MC 3JVZX 1HFGA 4HJ7A 4PZ7A 3OMCA 1ZGUB 5IP4D 4PZ6A 3BVMA 4JI0Q 2R93B 1OTRB 1TGZB 4X57B 4LF4Q 3EFXD 4A3MG 5LL6S 1ASYA 5I9OA 4ZYSA 3HVDA 3ERQA 2HDLA 1WTVA 1U5KA 3CSTA 4R3DA 5CHFA 3MEHA 1SFOH 1WXAA 2NBUA 1VD2A 5C6AA 5FJ8G 4RKLA 2JA8H 2JY6A 3TSSA 4YWGG 3EBEA 5I2YA 3T1HL 4EVOA 4US8A 4A3IB 2SAKA 4WORA 1U4RA 5DM63 2BVCA 2JQOA 1R7SA 1MJEA 1CSQA 1QVCA 4AH6A 1D5XC 1ZOYB 1M1KC 4A3LH 1PH5A 4NPNA 3TZDA 4UAIA 3STBC 3FILA 3DBHI 2LRWA 2HIVA 2XIWA 3KF8B 4HCSA 2WXRA 4ZRIA 3B6YA 3UDIA 1E7UA 2KYWA 4AQ7A 3HHMA 4HMIA 4G7OC 2K75A 3GB1A 2JWUA 1Q90A 3GD7A 4YWMA 3M3JA 4R4IA 2K8BA 4GKKQ 2C9OA 2PVGC 3CW2C 3MXNA 1H9JA 1E2VA 5M5XB 1E8YA 2L00B 4CHTB 2K5DA 4EZLA 1YN4A 1JALA 5IP7H 2FHTA 4IOCA 2ZEQA 2ZVOA 3LWEA 4P16A 4F1SA 2KFKB 4HPLB 3N1YC 4A3MB 5M5WH 4DV4Q 1I7HA 2D11A 3W1GA 2WXMA 1VMPA 2B2WA 4IC7B 4GIVA 1I5FA 1WFQA 1SBBB 2CKHB 3ERSX 1X6OA 4BOZB 2E2HH 2ZJDA 1TY2A 1T3QA 1UWXA 3W2DA 2KMMA 3I9V1 4KKUA 1WR6E 5JJLA 4E74A 5LHY1 1SJED 3D4DA 5ELNA 1XJVA 2E75C 2DNEA 1V80A 5M5YH 2QC8A 2NBFA 3JYUA 5G2NA 1B53A 1I94L 1OGWA 1AW7A 3KBGA 3ZJYC 2DENB 3NG0A 4DPGA 4XWWA 3ZYYX 1CTMA 2KAJA 1XTDA 2LXKA 1WCMH 3CAMA 2AUKA 3GTJH 5TR5A 4K1RB 4A55A 4URKA 3NUHB 1FNUA 4MGYE 3I90A 2VZKD 4BAXA 3TL5A 3DHQA 3J80i 1CA6A 3EHVA 4W9KA 2Z1CA 3N20C 5MPOA 1S4ZA 4J8QA 5AJ3Q 4DV6L 1T5XD 3BU2A 3RLOA 2QDFA 4DV5L 3VTVA 4WAAA 2IHEA 1SYDA 1Q7YC 3I4MG 4AQYQ 3AEBB 2QA4A 3K7UC 3EA6A 4YCUA 2JZ3B 2A6ED 3RLFA 1Y56A 4A20A 1E3PA 4P71A 4ICVA 3RR5A 4NB3A 1E0BA 4X64L 2K33A 5H1SE 4PMBA 2O6VB 1GXDC 4TKNA 2IDYA 2BGFA 2BE5D 4GDKB 3MHBA 1SIFA 1T0QC 5AZFA 1VQJA 3KLSA 2O5JC 4LWCA 1XMQQ 1D2BA 3TREA 2KC1A 4HKZE 4RAUC 3E9HA 1FNVA 5C5MA 2MX2A 5HG2A 4B0MA 3CCEA 4YXDB 2ZXRA 3DBSA 2A6HD 5BMIA 3AE2B 1XD3B 1KF6B 2FIDA 1Y1VH 1K73C 5C5LA 4RHSA 4OEMB 3X0WA 1VQLA 1QOBA 3PO2H 1V97A 4KJNA 4H7BA 5G3LF 5IOCA 4BKGA 1MBYA 2KHSA 1BBUA 4RM9A 2R92G 4PYUA 3PMFA 1PZJD 4FLHA 4IM2A 3BVZA 3WIMA 5EE1A 1A2TA 1XMOQ 4K3CA 1GUAB 4LFCQ 4GN4B 1V5OA 4LJPB 3CCRA 4XQQA 3I4MB 5I4DA 4EGVA 3I3TB 1GC7A 2DHZA 2E2IH 2NPTA 3OW2A 1V5TA 4A3OA 3J81j 5CV8A 2RGFA 1G6ZA 5FO9B 1Y1WB 5EPJA 3A1QB 4FXDA 4RF0A 2A69C 3I73A 4TUUA 4ZHPA 1SAPA 4P72A 1LXDA 1WXQA 3FDTA 1S5DD 3TZUA 3BZCA 1WXSA 2HTME 4UDUC 2W3RA 4DV7L 4ZKCB 1MG4A 3RFZB 5D2MB 3W3AA 1ESRA 3M4OH 1KM7A 2BYTA 4WRDA 1W6KA 2LUEA 1KLVA 1XO3A 3MAQA 4K6DA 1AZQA 2D62A 1C4PA 4NNJB 4IG7B 2GVAA 2UUBL 2WB1G 1WTHA 2R92B 5CGKA 2LVOA 2LXAA 1WTQA 1PUTA 2IX0A 2NVXH 2ZNVC 2JEBI 3C46A 1ISNA 2K3UA 3DQVA 1PHJA 2L32A 3AB9A 3S1RH 5IGFA 2IO0B 5BMHA 4GOPA 2JF5A 2VH1A 1L1OC 4KSKC 4IM3A 4KDLB 1C9FA 5BR8L 3SK4A 2XRSD 2C7HA 2FINB 4OO1G 1N34L 2WXOA 3AN1A 1WJUA 4L1BA 1JC7A 4JI1L 3W1SC 4C3HB 1ICFB 3DEOA 5HURA 3HOXH 1RJTA 2JN4A 2BYVE 3DLLA 4LF4L 1J0GA 3M62B 3EC8A 4TQ0A 3F8TA 3I2ZA 1VZ6A 2F0NA 1TKGA 4BXXG 3CMMB 1FD6A 2JSOA 2R93H 3A5ZB 4JYAL 1HZ9A 2JK8A 1GG3A 4IW0A 1C8CA 1EQQA 2Q5WD 3AE8B 2AL3A 2OJRA 2Z4IA 1WTWA 2UU9Q 4HXDA 2OXPA 2WB1B 4I6LB 5EGTA 4BBSG 1HFNA 5EBCA 1X3QA 3N30A 2WXNA 4JI4L 2Z6BA 4FF2A 2AUJD 2VRRB 3UQAA 4A3IH 2HIXA 4IKGA 1FGBD 2OCEA 2RDHA 2XSCA 2BYEA 5K5PA 3AYHB 5I9PA 3DPDA 3KWLA 2OT2A 5FOBB 3JAML 4HAEA 4L63B 2N7DA 2FBWB 1L2NA 1HXYD 3V96A 1W2BA 3ZKJC 4EZKA 4ARCA 4A76A 4A3FB 2Z59B 5CX3A 2NVQB 2NN6H 2K5NA 3H7SA 4ZRQA 2BWFA 5C0XG 2OTLA 3HRZC 1ZYRD 2UUCQ 3M3YB 4RGOS 4RA8A 4PZ8A 3L08A 2B63G 5M5XH 2F4IA 3KYHC 1OQYA 1EM7A 2LXJA 1YHAA 2WX1A 5CV9A 1WTXA 1BCPB 4K3BA 2CHBD 5KNCA 1XLQA 2L83A 3CCUA 1NMFA 2JJQA 1TZ1A 1UZXB 4EQPA 3L4PA 5CV4A 2QDBA 5FJ8H 4FXKC 4BBSB 1PTOC 1LT5D 1F2RI 4F88A 5EPKA 1D5MC 5HI1A 2HCIA 1XEEA 5LMNW 3T3NA 3T1YQ 3H0GB 1R9TB 3HZXA 5JXVA 3T53B 4LF9Q 4NZLB 2L12A 4B3TL 2KCTA 4ZHOA 3I57A 5BMGA 3GTGB 2PMZE 4X3KA 3D6WA 1XQQA 3M95A 4JI7L 2WXFA 4RMAA 3LYYA 3VTUA 1VCIA 2MO0A 5D6JB 2L8JA 2B2WC 1FD7D 3NZSA 4XX5A 3KBXA 4JI8Q 4LF8L 4ACFA 3E9IA 2LWPA 1TKWB 3T3OA 2PYKA 1XLNA 3QJYA 4II3B 4N9TA 3A4RA 3RN9C 2UXBQ 1X65A 1Q1EA 2BA0A 4O2DA 4Q2JA 4TQUS 1NI2A 1PA6A 5ELOA 3TP8A 1YD8U 1JOKA 4CHKA 1Q1BA 3BYTB 4IALA 5JPNC 1YJJA 2WKCA 3VR2A 1PH1A 2X38A 2W54A 4WWOA 4H44C 1E2ZA 4IOAA 3GTKB 4M00A 2JE6I 2HT1A 5IYBG 1QT9A 2IY0B 2KEEA 3ZTDA 2BYFA 4C00A 4L5SA 4DR3L 2JZZA 3TEZA 3H3VC 1VQ6A 3DHHC 4MH8A 2BDOA 1KABA 2CVRA 3F2DA 3PGEA 2H5XA 4XYCA 3U7ZA 1DOXA 4EFOA 2O4XA 1C48A 2N49A 2X6GA 1SE8A 4P74A 3KF8A 3I4NG 4QGUA 1WTRA 1SE9A 1K9MC 1N60A 2EKIA 2L76A 1OTCA 3GTMB 2V1YA 3NOBA 1VQFA 4C4VB 2MJDA 3BK1A 4P7IA 4DWFA 2MP1A 5JVG3 4LNQA 3CC7A 3HOWB 3VR3A 2J0JA 1V1PB 2AYOB 1S5FD 4QUFA 1HNWQ 2CW0D 3EFUA 3OW7A 1SYCA 5JOBA 1GJZA 2EXDA 2KFKA 3ND8A 3OTOQ 2KCCA 2QF7A 4HJAA 3I4MH 2E74C 1WRDB 1J7AA 1IP9A 1QOAA 1WX7A 2EY5A 2N78A 4X3UA 1Y1WH 3NP8A 2M1MA 4R8NA 3LXFA 3ZDTA 4HRSA 1OO9B 2E5LQ 4FHKA 3C1FA 1WGKA 2I1JA 2R7DA 1ZKOA 3KLRA 4HJ5A 4LFBQ 5IN7A 1CSPA 1VZ7A 2K6QA 3P4SB 1J5EQ 1VZ8A 4DHZB 3WDNA 1JB3A 4X6AH 4K81A 3K59A 5LMNL 1DYQA 1K8OA 2FCNA 2EYJA 3A8KE 4K14A 2I38A 1PZKD 2XTIA 1IYJB 2CFMA 4HKQA 3PPAA 2JSVX 3I4NB 1TKYA 4FJYA 2MPMA 2QHOA 4KGRA 2D5GA 3OLMD 2ZTEA 3U58A 2VZKB 5FLXL 4X66L 3S16B 2W55A 2BT6A 1TIFA 2KX0A 3AEGB 2KDFB 3TP5A 4KIKB 1A6XA 2KECA 3HOVG 1TTNA 3AEVA 1V1OA 2QILA 1CZGA 1ASZA 3NS8A 4M8MA 1PYSB 1GUNA 1S5CD 2R92H 2DGYA 2KDEB 4NXNL 1B1ZA 3HS0C 5LXHA 2MQHA 4DR2Q 4R8IA 3I8ZA 2NVUI 3FKYA 3IAM1 1U9RA 1C1YB 3E0JA 4LLGM 2EY2A 2O6VA 4X62Q 1PH9A 1NYQA 3ULLA 1I4GA 2KMCA 4GDKA 3HK0A 2V0GA 1TZOA 1GJXA 5GAEC 1MIUA 1V6EA 1Q82C 1FGUA 2F0PA 4O1NA 1VQCA 4S3SA 3AULA 1YNND 3CCSA 2XN9C 3DM3A 2JEAI 2F0MA 2INCC 3HGBA 1CUKA 4IFDJ 3AV8A 3IG3A 3I63C 2CKZB 4C3HH 4OVZA 4C56C 2Z0DB 2F0QA 3BINA 2LEKA 4HIMA 1VQMA 2IGDA 5EQ0A 2RMMA 4MNOA 2PPBC 3FC4A 3N9YC 3CC2A 1XYIA 4OX9Q 5LNK1 2O2LD 4W9FA 2IO1B 3DHGC 3TJPA 2B8GA 1JROA 2KC2A 1DOMA 2RBMA 5IP9G 1WGYA 3IAS1 3MTNB 4GOPC 3N3KB 3ZW3A 1A70A 2ONQA 1BVSA 3DBLB 3K9PB 4BVUC 1Y8NB 4OIKA 5CV6A 4IFDI 1ZE3D 2NR2A 2DNCA 3NBHB 4QL5A 1YNJD 3HOVB 1R4NI 3V60A 2F1MA 4MEMA 1RYJA 2Y5CA 1L6VA 5LL6X 2K5HA 2EDGA 2UYZB 2RSNA 4GN1A 3SU8X 4IPCA 3OHXC 1EOTA 5ELEA 5KNBA 1WZ3A 2HE7A 3MP9A 1RTNA 2V4DA 4LK1C 2N7JA 3AI5A 1K8MA 4IQZA 3A7AB 5IGGA 4KJOA 3A1QA 1DOYA 3T1HQ 4NP5A 3K9OB 1SNOA 3LX0A 2KA7A 4ILWA 4C3IG 1EL0A 1H95A 1VJKA 2Y0SE 2MJ8A 3NQIA 2L0FA 3RNEC 4RKBA 3KJOA 2IBIB 2B2VC 2PZUA 4A3FH 5A2QE 1QZHA 2KHJA 4HEDA 2J4XA 5CMDA 2NVQH 2J0KA 5GADC 5C3EG 2H89B 3IT6B 3G7LA 1QLBB 2K0PA 1F77A 4GXBA 4Q0FA 1BR9A 1TWHH 1WVLA 1RHPA 3M3YH 1SIJA 4DA2A 3TEYA 1G6PA 1GHKA 2KZRA 4WJ3M 4DGZA 4BXXH 1J7BA 3I5JC 3J7AF 4P1CC 5J1ZA 3I55A 2DLBA 1I4QA 4R4QA 2WKDA 2FCQA 3B2GA 1ZW7A 4DR1L 5C3XA 2REXA 4RCNA 4YWLA 3OPOA 3T1YL 3ZTCA 4PMCA 2E2DC 5C4JB 3H8HA 4B3RQ 4P2CB 1JMCA 1X32A 3VH3B 2F0DA 4KKSA 1LTRD 4BBSH 1XLOA 5DM73 4K6LA 3TBIB 5K36G 2MJEA 2WXKA 5IT9E 2G3QB 4C1NK 2L05A 1YZ6A 2MO1A 3L0WB 2YU9B 5C3JB 3H0GH 4G0NB 3TIXA 4HSPA 1R9TH 3PUWA 3TQYA 2KJRA 3A9JB 3TMEA 1FPYA 4J6HA 1E9MA 2QMTA 2HUGA 5JEAH 4LW1A 2HJ1A 1QOHA 2KO3A 2WXPA 2A4ZA 4A3BG 4XYQA 3UIOB 4GNXB 5I2XA 3CCJA 2UXBL 4DAMA 4HJKA 5ELDA 3CPFA 4BKSA 1I94Q 4F7XA 2K14A 3QAQA 1PRTF 3K0YA 1UELA 1QZEA 3NWTA 1E0ZA 3DOWA 1IGDA 5GAHC 2PZTA 2CQOA 4ID6A 4R4OA 3EJIA 1B4OA 3V6EB 3O13A 2VL6A 4K0KL 2M0XA 4YTPB 2VW9A 1DONA 3QJZA 2WXLA 1IZ6A 3S2HB 2R3ZA 4DV5Q 4Y7NB 1S40A 2FMCA 1Q5WB 4KI0A 3NE5B 3GTKH 5HHDG 3DXJC 4DV1L 3FAHA 1YNTE 4OELB 2PVOD 3GP7A 1TBEA 3SD5A 2A8VA 2LFIA 2Z8LA 3NPPA 4F87A 2FFKB 4HN7A 2LI5A 3Q8DA 2KD0A 1L2FA 1EF5A 2D2CC 1KJTA 2YEPF 3AE7B 5H8YE 2JA5B 3BZDB 1RCVD 1XWEA 1JR0D 2WDRB 4CKCA 4ITKA 3K58A 3R93A 4M8NA 4KHPL 3ZQ4A 1L4ZB 1F9JA 5KYLA 1Q1OA 3OJ4B 5H92C 5JHAA 1ILQA 3GTMH 4DR7L 3KVFB 2WXIA 4NJ7A 3V05A 2A68D 2EXZA 4ODGA 3SDZA 3SK5A 3CD6A 2PQAB 3S2DB 1ZP0B 4BBNF 1SNPA 3HOWH 1KLUD 1I42A 1EWCA 4XQNA 2IPKD 1NCVA 1NR4A 4BA1I 1RKNA 3ULPA 1HUNA 2AX5A 2L3ZA 3X23A 4PV1C 4C2MB 2RDBC 1MFWA 2KOLA 4NJCA 4LTUA 3QOJA 2R7ZG 3AE4B 2VXWA 1V8QA 4C3JG 2J53A 5G5HA 4WJWA 4BKTA 1EIYB 4PK1A 5CV7A 5EDSA 1VMCA 1XPRA 3AMUA 2MGSA 2DN8A 3FVQA 3VQIA 5IYBH 1MI0A 1E1TA 3KYDD 1JCKB 2I5LX 1F2MA 4CKEA 3DBLI 2KHIA 2MQJA 4NPSA 3K57A 4JVZA 2SNMA 5EBDA 4OL7A 3Q24A 3GDEA 2ZTCA 2HJ8A 4KV6A 2ID0A 1GUOA 2JXXA 4DV7Q 3I4NH 1K3RA 2ZPYA 5CR3A 4CGYB 1QG7A 1RFAA 3AEDB 4W9HA 5IOIA 1WXMA 2I07B 5ELFA 3S16H 1YJWA 4KTAA 1IUEA 5E6NA 1PRTC 3JSVB 1KRTA 2WU2B 1MPEA 5IAAC 3S9WA 5IYDH 3Q3OC 4HWIB 1LV9A 5JVH3 2JUOA 1MSHA 1ONLA 4R1JA 4H2AA 4ZQ3A 2ZM6Q 2PW5A 1B3QA 1S1QB 1TWGB 2VQEQ 3U50C 3DWAA 3S2AA 1LTGD 2F0SA 2UUBQ 2R7ZB 1TYGB 2KMAA 2QSDA 3GO5A 1HZBA 4JK1C 4RWSC 1WD1A 5FKAC 1YBYA 4A3GH 5KNDA 2DX5B 4LK0M 1VQ4A 3DVNV 1ZXIA 4A3PA 1AWDA 1VQAA 2OWOA 1STGA 2B29A 3NK9A 3H15A 1UF0A 1W6JA 2K39A 3P42A 3VYRA 4PT5A 5J39A 1SNDA 3M63B 4NAWB 4D2KA 2L1BA 4DR5L 3WOEA 4OX9L 5BR8Q 1WGRA 2DZJA 2INNE 1DZ1A 4HSVA 4M1UB 1N34Q 4BY7G 3A7LA 4JW0A 3KW5B 4JI1Q 1HTLD 1GB1A 2MRPA 2VUMG 2DUDA 4C4VA 3VA5A 2P5ZX 3GTQB 2M8SA 1WX9A 2BPSA 1HR0L 4HCEA 2PPHA 2N1WA 1K50A 3TBLD 1HTQA 4BBNC 2JZPA 5HGTA 1V1PA 1SN8A 4K8IA 2D3BA 2RPVA 3RZWC 2GVBA 4G7HC 1F52A 4JYAQ 1PH2A 3HOVH 2WP9B 2ENBA 1SSOA 1N33L 4GSWA 3V3XA 1KNEA 4HMJA 3IKJA 3W1BA 3JAMc 1FRDA 4KKTA 3VYTA 1EO6A 3PHXB 3ONSA 4YTMB 4LF6Q 4IOIE 1F0ZA 4IJLA 4J6IA 3G4SA 2Z4HA 2DJGC 2NTTA 3GV6A 4DK1A 2PI2A 5HKHA 4HIDA 2XNAC 3SFDB 3OMGA 4IPDA 3Q8CA 3GZNI 4JI4Q 1XPUA 1F2RC 4JG2A 1M94A 1GUTA 3R8BA 2JT4B 3P20A 2EYPA 1HH2P 2EELA 2G4DB 4B95A 2K5WA 3S15B 4OHJA 1B3AA 1XTCD 1UEAB 4OVUA 2BS2B 4JI2L 4X3SA 4LF5Q 2AQ1B 1UE6A 4KKJA 1EY5A 5CBEE 1C79A 3C8YA 4ZUJA 1L0YB 4B3SQ 4BY7B 2UXDL 5JH5C 1K0RA 1P9DU 2V9HA 3MFGA 3VR8B 2WIIB 4DN4M 1P1AA 3R7QA 3PSEB 4GN3B 5GQOA 1BXTA 1TU2B 4L8JA 3TS0A 4IUQA 3P4QB 4OIJA 4KIKA 4B3RL 2MBOA 5IP9H 2JPHA 1E8XA 3ZGZA 1F9SA 1V9PA 4KHZA 2B2UA 5C44G 3HKZE 3M4QA 1O7ZA 1EQRA 3VDYA 2KN5A 1CKNB 1X3EA 1O7YA 2E2JB 1IBLL 3NWSA 5G55A 4YT0B 5C4JH 1VQKA 1UBIA 4H0LC 1N63A 2AKWB 3X3MA 3P1HA 1BBXC 1ENCA 1A0IA 1E2WA 1L0XB 3KWVA 2MBQA 4HJ8A 4POGA 3EVQA 2YU9H 4L6TB 2EJFC 4G3XB 5DCNA 1QJOA 2F0FA 1BUIC 1BF4A 3QWZB 4FJZA 2ZXPA 4IURA 1PFBA 3HP3A 2PE9A 4L2YA 1BCPF 4K5XA 2KWVB 2EQSA 1I50B 1YNXA 2KT7A 1I4XA 3CWIA 3UGBB 1E90A 3MJ5A 4B3TQ 4YSXB 4XTCS 2BW2A 3J9CA 2IWHA 1IBXB 1K53A 2RQXA 5G5GA 4JI7Q 1NSNS 4DV2L 3QQ8B 2ZTDA 2VH2A 1HPCA 4XXEA 4DNRB 4LF8Q 3GE3C 3AQQA 4A6QA 3ZJUA 2K1BA 4J1MA 1PTOD 3NBHA 2VNUD 1RM6C 4HDOA 5DAUA 3AXCA 1FMAD 4XE0A 4F8CB 1G6JA 4DF7A 4Y7NH 1U4PA 1SMYC 3QOLA 5C44B 3AE3B 1UE5A 5F2DA 3NJTA 3AB5A 1V2YA 1EFWA 3DEPA 3SK8A 3LNNA 2KTFA 4WJPA 2N3SA 2IHFA 3I7FA 5M3FG 4NW2A 4M8AA 1R4PB 5K36H 2JA5H 3T56B 1H9SB 1JW9D 1UWMA 4HPPA 1KLGD 4POFA 2AWNA 4DR3Q 5LMUL 1ZDVA 2LASA 2KHWB 4ZRKA 1CZPA 1Y8OB 4K5VA 2Y5BB 4USAA 1H9MA 3PO0A 3P75A 1TQOA 4BWGB 1Q81C 2IO2B 3HEJA 2Q8IB 3RYTA 3S2DH 4A8XC 1GM5A 2EJMA 1B70B 4ZRZA 3APCA 1WXVA 1MJCA 1UWVA 3D4WA 2HQLA 3BZKA 3NBIA 4C2MH 3FRPB 2IX1A 4K7SA 5BYQA 2PW7A 1EY4A 1UAPA 3VR9B 3L0OA 4HK2A 4MT5A 5KGUA 2ICEC 2AQ3B 2RPQA 5JJZA 5C23A 1PZID 2JRHA 4MN3A 3VUXA 1IBML 2E3TA 1EEID 1SNMA 4DFAA 1F2YA 2NZHA 5FLXc 4KX6B 2MH7A 4JX1C 1X3PA 4M02A 3JAMi 5M3FB 2RSOA 1LM0A 1NJIC 3A9JA 3D32A 3SDLC 2D3AA 3PS6A 4GGQA 3ZNGC 3NHEB 1SEBD 4KK7A 2ZW0A 3RUZA 2D2QA 4GNXA 1BCPC 2UUAL 4K7UA 3NVYA 2YVCA 5LMNQ 2E6XA 1Z2MA 1OEYA 2JYTA 2ZM6L 1GNUA 3SHQA 2VQEL 3FHWA 2N9PC 4UP9A 3LDZE 2D07B 4QF4A 3RT3B 4PNYA 2LMCB 2C7NB 1HTPA 2WV6D 4X66Q 1CJEA 2WXQA 4LUVA 1TWAB 1NI3A 2YTYA 2F0VA 1FXAA 1C76A 5E7NA 4US9A 2NN6I 1TWGH 2YYZA 3CMEA 3CF6E 3G71A 2Z6KC 2R7ZH 2JA6G 4DXAB 3DWGC 2PNRC 2L1AA 5IKCM 1HZ6A 4DV0L 2HD5B 4NXNQ 2DAFA 3MC0B 2PNHA 3J80E 3NVVA 1H8CA 4KGTA 3T4AC 4ZCKA 2L4NA 2IGGA 1JWMD 5NUCA 3W5OA 4A3JG 1N36L 2PJHA 1B9MA 2FUHB 5DPSA 4KY7A 4P1BC 1DOKA 2ZJQA 1YJNA 1XF5L 2XWBB 1PLFA 2DJFC 1HHVA 5D3DA 1D3ZA 4AWJA 5FLMG 3OSOA 4XDDA 4S0RA 3ZLZA 1D1IA 1I6HB 1AFPA 4YSYB 3D8GA 1OQRA 2F0GA 3GTQH 3IFTA 2ZCBA 2PQAA 3AFQA 1JQ4A 2K04A 1SLJA 4LF6L 1H9RA 3PGZA 3M4YA 2WDQB 5C4XG 2WXJA 4AYBE 2KVMA 3G6JB 1L4DB 4CDDC 5EKLA 1EY6A 1KRSA 4GLAC 2Z9HA 2XRQD 4IUTA 1RL2A 3Q14C 4EZJA 5HGQA 1HZCA 4KKIA 3NVZA 4LF5L 2GN5A 3Q8EA 1OXXK 2KBNA 1EWIA 2Y0SG 1N61A 2K6DB 1FXTB 2XGTA 4A3CH 4B3SL 3H9DA 2D10A 2MBEA 4A3JB 3S15H 4E71A 1SB3C 4QCLA 2X8XX 1Q8IA 3N52A 1QUQB 3F2BA 2VQFL 2JQRB 1F2LA 4R4CA 2R2QA 2EIFA 5AFWA 1RTOA 2JYEA 1EYAA 2Z0SA 4BY7H 2MBBB 1VCBA 1VDVA 2KTRB 3P4PB 1EUJA 2WAQE 4A75A 2L15A 3JSVA 1CM9A 4DXGA 3KF6B 3WAMA 1VQ7A 1NYRA 4HPMB 3VH4B 1B2TA 4A3MH 1X54A 2LGDA 1RAXA 4WWPA 4P6VF 2G5DA 2PQEA 1D7QA 2ZZPB 1SE3A 4BY1G 4WH4A 4WFN3 2LXCA 5DNFA 2KCNA 5C4XB 1E5WA 2LRUA 3JW0X 2E2JH 3MTSA 5JPMC 4A3DG 5HY6A 2N9EB 1N8RC 3P63A 4W9GA 2LS01 3MEFA 2N4FA 1HJPA 1DCZA 2CH4W 2DAJA 4DR1Q 3H7PB 1RD9D 4JBKA 4NAMA 1J9OA 1MKHA 2W9NA 1A3VA 3R66C 1KTKA 3A0JA 4NAWA 2Y0SB 4RFBA 3BIID 3L17A 3GTPB 2G9DA 3K6OA 4CDCC 1WM2A 2KOXA 1WJNA 2K28A 1I50H 3A8IE 2SNSA 4IWPA 4V0BA 4HCPB 3WAPA 3PREA 1EQTA 2B2UC 3KK7A 1KDBA 3K5OA 2LVPA 3QB3A 3PZ7A 2ON8A 2ZPNA 4KZCA 2LY7A 2A1AA 3VDZA 3BY4B 2JVCA 4IDIA 4ZRPA 2B63B 2ZNVB 4OZCA 1WGHA 2BE5C 2FMMA 4REZA 3F2UA 4AS1A 4PQXA 2F0UA 4DK6C 3NTHA 2LVQA 2ZJRA 2KLGA 2RR9A 1KC8C 3QIAA 4YWKA 3J7AV 2L9HA 4PG3A 3OJ3A 1D1KA 2K4KA 2FNJB 5E6PA 3BS1A 1P8LA 2A6HC 3E56A 4BY1B 4K0KQ 2BKFA 3NUCA 3Q3FA 5GROA 4A3DB 1J8CA 1D5ZC 4YY3L 5KYIA 1ILPA 4FN2A 3W5UB 4QJFA 2JXMB 2KCMA 1WE6A 1Q12A 2OEDA 4K2KA 4DV1Q 4EEWA 3TUOA 1WR1A 3AEAB 5IE8A 4IUNA 4DAPA 2KKCA 3N1XC 4LJOB 1G8ZD 1KDCA 1NDDA 2KQ3A 2NS5A 4B08A 1LGRA 1KDAA 1YJ9A 1UEBA 3DM1A 3MVVA 4ZAIA 3S1QB 3VUYA 1GOZA 2L0TA 3SR6A 2EYFA 4CJ0B 4KHPQ 1RDPD 5C4HA 3NEMA 2C5LC 1NAPA 1XNQL 1OFFA 4DR7Q 3M85A 2BBCA 4WQMA 3RD2A 1WTOA 1RWSA 4EUTA 2MBHA 3UDGA 3ER0A 3A9KB 2DZKA 2N9LA 2RF4A 3KDFB 2EMSA 2OQKA 1PH4A 3TS2A 4XYOA 1LO5D 5TSSA 2IO3B 5EE0A 4OWWB 2JWZA 1LABA 1PXUA 1CKNA 1Z7TA 2FCSA 4HROA 3NENA 4KSLC 4NMZA 3RMKC 4E6IA 2WU5B 2ACZB 3U4ZA 4BBRG 4DNIA 1C3TA 4DNTB 3S1MB 2HQEA 1VQIA 1H9KA 3AE6B 4ICUA 1RRBA 2JXTA 3R3OA 2KVZA 4IWQA 3NHHA 3VR6A 1B8AA 5D65A 3U30A 3FKIG 4IJHA 3VVWB 2PCFB 3UI2A 2K05A 3M4PA 2LKVA 1E8ZA 1TJEA 1JJ2A 1KD1C 1M4VA 2EYLA 1WSPA 1WIAA 4Z9CB 1MVKA 4A93G 4C80A 1UH6A 1IBXA 4G11A 2K8HA 1IYVA 1D4BA 1YX5B 5CHVC 4MM3B 2ATWA 3GS2A 2YV5A 2SEBD 3APDA 5D7GA 3ZVVA 4OO1I 1TWAH 3H6MA 2WQYB 1IBKQ 1PTOB 1RLFA 4RHRA 2JYOA 3PIOA 2EYMA 3MXPA 1DOIA 4DV3Q 3R7RA 4LJZC 3AEFB 3K80C 4CJ1B 5DPRA 3RZDB 4HJGE 1CI3M 1D8LA 1OXTA 1Q0WB 2JRIB 1YN3A 2WGSA 3SFEB 1UNSA 5FO8B 3BDCA 2K25A 1Y8PB 3RMHA 2AWOA 1WM3A 1AN8A 2BDNA 4Q5VA 4BBRB 1JWBD 3R2TA 2LFNA 2KDBA 4JV5L 3Q2AC 2JA8G 2GOWA 1T0RC 2NZOA 3ETRA 1QNKA 2O2VB 1H9SA 3DMUA 2K7VA 2D5DA 5JEAJ 4HJ9A 1G91A 1V49A 2J42A 1VLBA 2KQSA 5JZEB 3K8AA 2V4IB 1F2ZA 3SEBA 2F0OA 2K52A 1V81A 3LB8C 4DR5Q 2GRIA 1I6HH 1EWYC 4OW0A 1QILA 3UI3A 4HTHA 4W9DA 3WANA 4R9WA 3K7AB 1L5PA 1ZXHA 3OWEB 1CQVA 2A5HA 2W82A 5FR3A 3TEHB 4A93B 1FO4A 5BN4A 2X69A 1Z47A 3MA2B 2XWJB 4X65L 1I3QB 5T8IA 2KK8A 1HR0Q 1MGSA 1EQVA 3Q23A 4LDTB 2L5TA 1CQFA 3C2PA 2WS3B 1I6VC 2SOBA 3HM6X 2NBVB 1HZAA 4A4IA 2M19A 3V62A 3PRMB 4C7YA 3ZUNA 1BOSA 2PTLA 1N33Q 1GUWA 1E22A 4OZBA 1TXYA 5C0XI 2B3AA 1JICA 2B76B 1YEZA 2V4LA 3ND9A 1ZYRC 1STAA 2MHVA 1YIJA 4GLVB 3NY5A 3U4VA 3L7ZC 4OO1H 5A2QL 2Q2UA 1SFOB 4LAAA 4ALPA 4A3JH 2WXGA 4NQKE 4RG1A 4W9IA 2JA8B 3RNGC 3SHLA 3PTFC 1TR5A 1HZ5A 1LTSD 3U9OA 5IIFA 1PDXA 1PGXA 2XBBC 1EU4A 3AMZA 4LCDE 4PS8A 2GA4B 4WJ4A 4RMFA 2EKEC 2BB6A 4JI2Q 4ANWA 4FDBA 1Q86C 1L6UA 4GLSC 1CFMA 3OYYA 3PV0A 3DBRB 5BYSA 2F0WA 4GDLB 2I2YA 1EIGA 2UXDQ 1FXIA 2G45B 4ZRJA 3DVNU 2LMCA 4N8FA 3Q6BA 4C7ZA 3HKZG 1R4MB 1ET6A 1PH3A 5C4XH 1G51A 3OIQA 4OZAA 4HIOA 1EYCA 3STBD 1XT9B 4KLKA 3WALA 3NZUA 3RLNA 2ZT9C 5IT9L 1SSNA 4K5WA 2Y3AA 4NY0A 2J0MA 1IBLQ 3F1ZA 3ECIA 2ALYB 4N8X1 1SYFA 3K5MA 4HR7B 1ROEA 2A19A 4LUZA 1II3A 4C3IB 4JPSA 4JI6L 2J0TD 1XNRL 3GTGH 1FEHA 4RGTA 5M9OA 3U4EG 4HLEA 5JHBA 3GTPH 2Z0EB 1SE2A 2F52A 1JORA 5E6JA 1TWCB 3DCGA 3T51B 4LNIA 3U8ZA 1O78A 2CH4A 4YL8A 1PFSA 1AE2A 5C0XH 5C3EB 3KUPA 1EFID 1N6ZA 4F8MA 4MH0E 3Q8AA 2I5MX 2RHSB 4XDXA 4EQNA 2KDIA 3FEWX 4HCNB 1KQSA 1N62A 2B63H 1QQRA 4HEA1 4LNKA 2F4VQ 2QJLA 2MWSB 1HNXL 3TRZA 2J7QB 2X6LA 3WA0A 4DUZQ 4DV2Q 2IL8A 3HKSA 1YJIA 5IGCA 3W5VB 5JAVA 1NBFC 3SR1A 3KH0A 4E3CA 2G9HD 1M8AA 3HKZB 3AE9B 1OXUA 4IUUA 5FO7B 5IWAL 1IGCA 3TDQA 4A3DH 1PFDA 1SYEA 3I4LA 4ME3A 3RN5A 4JQWC 3UF8A 3I3CA 2K5QA 2K5VA 2QW7A 4JBMA 3IHPC 2PEAA 3Q8BA 5CORA 3DBHB 5LXIB 1FFVA 2NB0A 5DPTA 4RH6A 3DHIC 1K8RB 1HR0W 2QCZA 2KEDA 2PI2E 3PSIA 2CW0C 4KHVA 2I1KA 1XCQL 1QUQA 4A3BB 4JC0A 2Q2TA 3S1QH 3B0AA 2MP2B 5JJKA 5LMUQ 3ITPA 2WNMA 3V2TA 1X3FA 1NE3A 3C3LA 3ZRFA 4DU9A 2EY1A 1WMHB 1DXMA 2KTRA 3T16A 1GUGA 3MHSD 5GMVA 1KNAA 1U4LA 3G6EA 3H6NA 1HEZE 3O65B 3VAWA 1O7IA 3KF6A 1JJGA 4KD3A 5DPWA 3NVWA 3AFPA 1TT2A 1TS2A 2WXHA 5IY0A 4BFRA 2J52A 1ET9A 1GUSA 2V3NA 5EPLA 2CWAA 1JWUD 2MUYA 4N9PA 4LMQD 5J3BA 3QA8A 1VQPA 1T0SC 1QOGA 3T8MA 3FP9A 4QUCA 4DK3C 4J15A 1X55A 1S3OA 2MJ3A 2KVRA 3S1MH 2PW9A 3H7PA 1SNCA 2V3PA 1EZ6A 3VFKA 4UPAA 2B2TA 4MGZE 2KQ4X 4MELA 4UP8A 1O7LA
chains in the Genus database with same CATH topology
4ZK9B 1PYWD 3C1EA 2F0TA 5IGDA 1QWYA 5HFYA 5C2TB 4JE3B 3B2FA 2F0IA 2PO4A 3AM9A 2LHEA 1DM0B 3AEEB 1LTBD 3PUZA 2F03A 1DJRD 3GQBA 1LT3D 3BYYB 2A69D 1PTOH 2CQAA 2DYMA 1ENAA 1YNNC 4C3JB 1OQQA 4DXFA 3MXGA 4XDCA 3H09A 1ZXTA 1N5XA 3D6CA 3J81L 3J81E 5E3FA 2B8FA 1BO0A 1VDZA 1D6EC 1C4QA 2K9XA 2E76C 1SNQA 3P7JA 3EGRA 5EE3A 2IX3A 2L55A 1C4CA 1BMLC 1NR2A 3S1RB 1ZDXA 1YNJC 1L0VB 3U52E 2G1EA 4C1NI 2XVSA 1N5WA 3AU7A 1IW7C 4G57A 5KRUA 1C77A 2NVYB 2M00A 3CU7A 1LTID 2F0LA 1HRJA 1CT1D 3MXUA 2HDEA 4MHEA 2Q8RE 1T5EA 3PUVA 1STEA 3PUXA 3DUZA 1PFNA 3A54A 5COYA 4ULLA 5G3LD 1KH0A 1VRAB 1EY7A 1B50A 4FF3A 3CRKC 1JRPA 4H13C 4WWMA 2VUMB 5EKKA 1SYBA 2EPBA 3A55A 2JU6X 5AUKA 3P4RB 1BDOA 3TP6A 4KMUC 5E4WC 4AYBB 4ZUIA 2PKOA 4QB4A 2F0KA 2A73B 3RZOB 1PMRA 4B0EA 2EVBA 3KLSX 5J22A 2K6AA 4TRDA 1IKMA 3AE1B 1EYDA 3CHBD 4ZKBB 1PRTB 2JX5A 4WURA 4KY6A 4NKLA 3IXSA 5EE9A 3BK2A 3RD4A 3HUIA 3GTOB 2DY7A 1F9PA 1NEKB 4N6EB 4XWTA 2WAQB 1F9QA 1G2SA 1CHQD 1QE6A 1MHXA 2KN4A 2CJNA 1QB5D 2R6GA 2JA7B 4B9XA 1BNZA 4J3OD 1ZPSA 3AECB 1TS3A 4A9AA 2YEPB 1FM0D 4KN7C 3HRDD 4ABNA 1XLPA 3NTKA 4N59A 4G7ZC 5CYUA 2A68C 1EY8A 2F3VA 2KWDA 1TVXA 1FCCC 1IHZA 2CU3A 1KFYB 2PMZB 4YIJA 5ELBA 5C3WA 4B9WA 3D4RA 1HA5A 4WIPA 5M3MB 3OWFA 4CKBA 1SE4A 1GPXA 3Q22A 1I4PA 5CV5A 2TMPA 1JWAD 5EJWA 2NVTB 4FXCA 1LACA 1XX8A 3TP7A 1J8IA 1S5ED 1LT6D 2F0EA 1KAAA 3DWMA 1VR9A 4RNAA 3IL8A 1B44D 1CA5A 1E7PB 1SF0A 2BB5A 4FXGC 2NMQA 3CQZB 4O42A 2J7ZA 4CJ2C 3A8JE 1MHHE 2IGHA 1JWSD 2N55A 2FJ2A 3ZJVA 3BWUD 3NSWA 3PIO3 2L0CA 3PIP3 3MHZA 2DY8A 4C3HG 4MACA 2EJGC 1XXGA 1TWFB 1YQ3B 3QG1A 1K83B 1K52A 1GB4A 2OHFA 4DQOC 4FF4A 2B2TC 1TIID 2PZWA 2K32A 3U9SA 3HOUB 3J80L 1QKZA 3SVMA 2RKSA 3D31A 5KIXA 3WCQA 2NUCA 2RDGA 3SE0A 4KGSA 4TKOB 1DGJA 2F3WA 1MD2D 1STYA 3OOCA 3B9JA 4IUVA 1FYCA 4TMAB 2TSSA 1QF6A 1PTOF 1ACCA 1IYUA 2K01A 4FNFA 1BQQT 3GV3A 2B2YA 3PUYA 1RFKA 1A15A 5I6WA 1P7FA 1HUMA 3VYSA 2Q8TA 2A74C 2HCCA 4N58A 2BOSA 4ME5A 2EOTA 4EE2A 4IN3A 2KUMA 3LWUA 1EY9A 3A56A 3I91A 2NWGA 3M7GA 2JA6B 1JOOA 3URYA 2N0SB 3NZ3A 2B2VA 1PGAA 2BA1A 4FF1A 3M7NA 1FCLA 2K5PA 1ENFA 3QO2A 4A3EB 1AP0A 1LLRD 2LHDA 5IODA 3EROA 1E6EB 5E1FA 4A3KB 1TS5A 1O80A 2ZW1A 4IFDG 5DEHA 3AE5B 2EE1A 3KQ4A 4NDXA 5JEAG 1ZUD2 4RGMA 4IZ8A 4FYDA 3JAME 1QNUA 5T1IA 3R2IA 4EQOA 4L23A 4DAYA 1C78A 3EUB2 3TEXA 2KACA 4IUPA 3PZ8A 5GXGB 1E10A 1TWHB 2M0AA 2R61A 2Y5PA 1YQ4B 1IL8A 1AZPA 3S17B 2BS4B 1SXTA 2MEKA 5AUIA 3S14B 4WAFA 4I65A 2QEJC 1A2UA 1FNWA 2A6EC 3L3OC 4K2LA 2C5CA 4BA2I 1JOQA 3NXWA 2PMVA 5D14A 1A3UA 2B39A 4G4KA 2D9UA 2WACA 2IT1A 1TY0A 1Q3LA 3CKIB 3H94A 1K51A 3MWYW 2KDMA 1V8CA 1QOFA 3VR5A 2PLPA 4GZYC 2WDVB 1XCTL 1ZEQX 4X3TA 3PO3B 2N88A 2QKIC 1UGJA 2M56B 3AH7A 1FRRA 4DAVA 4M0WA 3S1NB 4XT3B 3BG3A 3RPFC 1CK1A 2WP8J 3GTLB 2DBYA 1YMHE 1ESFA 3E9SA 1ML0D 1ICWA 2IW3A 4MIUA 4A90A 3WOFA 3HOZB 4XIGS 4CQNA 2NZ1D 2WINB 1G291 3BDOA 1LT4D 3SXHA 2ICIA 2FUG1 1RODA 2O5IC 2EYHA 4U68A 1FIQA 3IT4B 1Y69U 3NS1A 1KRHA 1HA6A 4YTNB 3HOYB 2NTSA 3FILB 4JWSC 2H4OA 4JBWA 4U673 2HDMA 3H91A 1HQRD 2DYOA 1OXVA 4ZOHC 5D3IB 2VB3X 1STBA 2QIEB 1SJHD 5FLXE 5EKIA 3VRBB 2M9VA 3TN2A 1STNA 3I70A 1EWHA 1U4MA 1RF2D 1PRTD 1EEFD 3FPPA 2K03A 3FKIB 4XT1B 4TQ1A 2N9KA 4A3GB 3K5NA 1F9RA 1NVID 5C0XJ 4RCOA 5IGEA 3ABVB 2JP1A 1HQMC 1WYGA 5BN5A 3BVGA 4V190 4TSSA 2DWQA 2RDFA 2LGIA 1LTTD 3DWPA 3ONAB 3VA7A 3K5LA 2M2LA 1R4QB 1G2TA 1A3TA 3FPUB 4FVMA 1PDQA 2RVLA 2OF1A 1I4HA 3BDLA 2B2YC 3IAYA 1J7CA 1CHPD 3EQLC 4OGQC 3N6RA 1PFMA 1Z6HA 3FMCA 1HCZA 4BS9A 4CBVA 4YSZB 4QMGA 1QCBD 4JWUC 3Q8FA 1IW7D 5T1GA 3HVZA 3OIPA 1VF5C 1JE4A 1P7EA 5BN3A 3ZJTA 3IFDA 1UUPA 1MI2A 5ELCA 1PGBA 2K22A 5IGBA 1SYGA 5M5WB 5E4XA 5KEEA 2E2HB 1WWTA 1STHA 1WTPA 2BS3B 5I6YA 1CZWA 3VRAB 1NENB 5M5YB 4IFDH 2H1EA 4I7ZC 3MZ5A 1V43A 2ZXOA 1WRIA 4FO2A 1WCMB 3GTJB 1DD2A 2I46A 1LTAD 1I4RA 2AQ2B 3E6ZX 2W3SA 2VB2X 2PIAA 5BYRA 2OEOA 2H88B 3T13A 3CRLC 4FP5D 2F0HA 1JMLA 2LUMA 3L9AX 3CIRB 3VYUA 1B9RA 4K8JA 5C4ZA 2WLBA 3Q6SA 3SK6A 1SMYD 3U2SC 3E5SA 3W9CB 1EY0A 1Y1VB 2INPE 1C4AA 1FFUA 1T6BX 3PO2B 1YN5A 5CBAE 2L11A 2SDFA 4KD4A 3J7YW 1TKEA 1Q10A 5A35A 2EZVA 1DOLA 3P1MA 1TS4A 1GHJA 4DK0A 3HG9A 1AYFA 1S5BD 3VR4A 3TEWA 2IJ0A 1B9NA 2E2IB 2QCPX 3D3RA 2LJIA 4XQJA 3NTIA 2BCOA 4ZLTF 3I72A 1BUVT 1MSGA 1WD0A 4RGNA 4RF1A 2RA4A 2EYOA 4QIWB 2L52A 2NYZD 1VF7A 4KN4C 3M4OB 1SDFA 1OXSC 1EZ8A 3Q0AA 5CC4A 1NUCA 2CJOA 2GB1A 3NQTA 3W1SA 2FE8A 1GAQB 3QWNA 1EIHA 1BCPD 3DWQA 2GI9A 2NVXB 2F0JA 2BTEA 1AEXA 3NRZA 2EY6A 5ISRA 3X3NA 1FR3A 5FK9C 4KY5A 4PMWA 3MFYA 1EU3A 2NN6G 3HOXB 1IKLA 2KJXA 4ARIA 1JQYD 3Q69A 1HFGA 3OMCA 3BVMA 2R93B 3EFXD 5LL6S 5I9OA 4ZYSA 3HVDA 3ERQA 2HDLA 1WTVA 4R3DA 3MEHA 5C6AA 4RKLA 3TSSA 4YWGG 5I2YA 4US8A 4EVOA 4A3IB 2SAKA 4WORA 1U4RA 5DM63 1R7SA 1D5XC 1ZOYB 3TZDA 4UAIA 3FILA 2XIWA 4HCSA 2WXRA 4AQ7A 4HMIA 4G7OC 3GB1A 2JWUA 1Q90A 3GD7A 2C9OA 2PVGC 3MXNA 1H9JA 1E2VA 5M5XB 4CHTB 2K5DA 1YN4A 1JALA 4P16A 2FHTA 3LWEA 4A3MB 1I7HA 2WXMA 1VMPA 2B2WA 1SBBB 1TY2A 1T3QA 1UWXA 3W2DA 2KMMA 3I9V1 4KKUA 5LHY1 1SJED 3D4DA 2E75C 2DNEA 2NBFA 1B53A 1AW7A 3KBGA 4XWWA 3ZYYX 1CTMA 2KAJA 2AUKA 4A55A 3NUHB 1FNUA 3I90A 2VZKD 3DHQA 1CA6A 2Z1CA 5MPOA 1S4ZA 4J8QA 1T5XD 1SYDA 3AEBB 3EA6A 2A6ED 3RLFA 1Y56A 1E0BA 2K33A 4PMBA 1GXDC 2IDYA 4GDKB 2BE5D 3MHBA 3KLSA 2O5JC 1D2BA 4HKZE 4RAUC 1FNVA 5C5MA 4B0MA 5HG2A 4YXDB 2ZXRA 2A6HD 5BMIA 3AE2B 1KF6B 5C5LA 4RHSA 1QOBA 1V97A 4KJNA 4H7BA 5G3LF 5IOCA 1MBYA 2KHSA 3PMFA 1PZJD 3BVZA 5EE1A 1A2TA 4XQQA 3I4MB 5I4DA 4EGVA 5CV8A 1G6ZA 5FO9B 1Y1WB 5EPJA 4FXDA 4RF0A 2A69C 3I73A 4ZHPA 1SAPA 1WXQA 3FDTA 1S5DD 3TZUA 2HTME 4UDUC 2W3RA 4ZKCB 3RFZB 2BYTA 3W3AA 1ESRA 4WRDA 1W6KA 1XO3A 3MAQA 4K6DA 1AZQA 2D62A 1C4PA 2R92B 5CGKA 1WTQA 1PUTA 2IX0A 2JEBI 3C46A 2K3UA 2L32A 3AB9A 5IGFA 5BMHA 1C9FA 3SK4A 2XRSD 2FINB 4OO1G 2WXOA 3AN1A 4L1BA 1JC7A 4C3HB 3DEOA 5HURA 1RJTA 4TQ0A 1VZ6A 2F0NA 1TKGA 1FD6A 2JSOA 1C8CA 2Q5WD 3AE8B 2Z4IA 1WTWA 2OXPA 2WB1B 5EGTA 1HFNA 5EBCA 1X3QA 2WXNA 4FF2A 2AUJD 4IKGA 1FGBD 2RDHA 2XSCA 5K5PA 5I9PA 3KWLA 5FOBB 2OT2A 3JAML 4HAEA 4L63B 2FBWB 1HXYD 3V96A 4ARCA 4A3FB 2NVQB 2NN6H 4ZRQA 5C0XG 3HRZC 1ZYRD 3M3YB 4RGOS 4RA8A 2F4IA 1EM7A 5CV9A 1WTXA 1BCPB 2CHBD 5KNCA 1XLQA 2L83A 4EQPA 3L4PA 5CV4A 2QDBA 4FXKC 4BBSB 1PTOC 1LT5D 1F2RI 4F88A 5EPKA 1D5MC 5HI1A 2HCIA 1XEEA 3T3NA 3H0GB 1R9TB 3HZXA 5JXVA 3T53B 4NZLB 2L12A 4ZHOA 3I57A 5BMGA 3GTGB 4X3KA 3D6WA 2WXFA 3LYYA 1VCIA 2B2WC 1FD7D 3KBXA 3T3OA 1TKWB 2PYKA 1XLNA 3QJYA 4N9TA 1Q1EA 2BA0A 4Q2JA 4TQUS 3TP8A 1JOKA 1Q1BA 3BYTB 4IALA 5JPNC 1YJJA 2WKCA 3VR2A 2X38A 2W54A 4H44C 1E2ZA 3GTKB 2JE6I 1QT9A 2KEEA 3TEZA 3H3VC 4MH8A 2BDOA 1KABA 2CVRA 3U7ZA 1DOXA 2O4XA 1C48A 2X6GA 3KF8A 1WTRA 1N60A 2EKIA 3GTMB 2MJDA 3BK1A 2MP1A 5JVG3 3HOWB 3VR3A 1V1PB 1S5FD 4QUFA 2CW0D 3OW7A 1SYCA 5JOBA 3ND8A 2KCCA 2QF7A 2E74C 1J7AA 1QOAA 2EY5A 4X3UA 3NP8A 3LXFA 4R8NA 4HRSA 1OO9B 3C1FA 1WGKA 1ZKOA 3KLRA 1VZ7A 3P4SB 1VZ8A 3WDNA 1JB3A 3K59A 3VQIA 1DYQA 1K8OA 2EYJA 3A8KE 4K14A 2I38A 1PZKD 4HKQA 2JSVX 3I4NB 1TKYA 4KGRA 2MPMA 2D5GA 2VZKB 5FLXL 3S16B 2W55A 2BT6A 3AEGB 3TP5A 1A6XA 2KECA 1V1OA 2QILA 1CZGA 1GUNA 1S5CD 1B1ZA 3HS0C 4R8IA 3I8ZA 3IAM1 1U9RA 3E0JA 4LLGM 2EY2A 1NYQA 1I4GA 2V0GA 1TZOA 1GJXA 2F0PA 4O1NA 4S3SA 1YNND 2JEAI 2XN9C 2F0MA 3HGBA 4IFDJ 3AV8A 4OVZA 4C56C 2F0QA 2LEKA 2IGDA 5EQ0A 2RMMA 2PPBC 3FC4A 3N9YC 1XYIA 5LNK1 2O2LD 2B8GA 1JROA 3IAS1 1DOMA 2RBMA 1A70A 2ONQA 1Y8NB 4OIKA 5CV6A 4IFDI 1ZE3D 2DNCA 3HOVB 1YNJD 2F1MA 1RYJA 2Y5CA 1L6VA 5LL6X 2EDGA 2RSNA 3OHXC 1EOTA 5ELEA 5KNBA 3MP9A 1RTNA 2V4DA 4LK1C 2N7JA 1K8MA 4IQZA 3A7AB 5IGGA 4KJOA 1DOYA 4NP5A 1SNOA 3LX0A 2KA7A 4ILWA 4C3IG 1EL0A 1VJKA 2MJ8A 3NQIA 4RKBA 2B2VC 2PZUA 5A2QE 4HEDA 2J4XA 5CMDA 2H89B 3IT6B 3G7LA 1QLBB 2K0PA 1F77A 4Q0FA 1BR9A 1WVLA 1RHPA 1SIJA 4DA2A 3TEYA 1GHKA 4DGZA 1J7BA 3J7AF 5J1ZA 2DLBA 1I4QA 2WKDA 3B2GA 5C3XA 4RCNA 3OPOA 4PMCA 2E2DC 5C4JB 3H8HA 4P2CB 1X32A 2F0DA 4KKSA 1LTRD 1XLOA 2MJEA 5DM73 4K6LA 3TBIB 5K36G 2WXKA 5IT9E 4C1NK 2YU9B 5C3JB 4HSPA 3PUWA 3TMEA 4J6HA 1E9MA 2QMTA 2HUGA 5JEAH 1QOHA 2WXPA 4XYQA 5I2XA 5ELDA 4F7XA 1PRTF 3K0YA 3NWTA 1E0ZA 1IGDA 2PZTA 4ID6A 3EJIA 1B4OA 3O13A 4YTPB 1DONA 2WXLA 3S2HB 2R3ZA 4Y7NB 2FMCA 4KI0A 3NE5B 5HHDG 3DXJC 3FAHA 1YNTE 2PVOD 3GP7A 2LFIA 2Z8LA 3NPPA 4F87A 2FFKB 4HN7A 2D2CC 3AE7B 2YEPF 5H8YE 2JA5B 3BZDB 1RCVD 1XWEA 1JR0D 2WDRB 4CKCA 4ITKA 3K58A 3R93A 3ZQ4A 1L4ZB 5KYLA 5H92C 1ILQA 2WXIA 3V05A 2A68D 2EXZA 4ODGA 3SDZA 3SK5A 3S2DB 1ZP0B 1SNPA 1KLUD 1EWCA 4XQNA 2IPKD 1NCVA 1NR4A 4BA1I 1RKNA 1HUNA 2AX5A 4PV1C 4C2MB 2KOLA 4NJCA 4LTUA 3QOJA 3AE4B 2VXWA 1V8QA 4C3JG 2J53A 5G5HA 4WJWA 5CV7A 1VMCA 3AMUA 2MGSA 2DN8A 3FVQA 1MI0A 1JCKB 1F2MA 4CKEA 3K57A 2SNMA 5EBDA 4OL7A 3Q24A 4KV6A 2ID0A 1GUOA 3AEDB 5CR3A 4CGYB 1QG7A 2I07B 5ELFA 4KTAA 1IUEA 1PRTC 2WU2B 1MPEA 3S9WA 1LV9A 5JVH3 1MSHA 1ONLA 4H2AA 4ZQ3A 2PW5A 1TWGB 3DWAA 1LTGD 2F0SA 1TYGB 2R7ZB 2QSDA 3GO5A 1WD1A 4JK1C 4RWSC 5FKAC 5KNDA 4LK0M 1ZXIA 1AWDA 1STGA 3NK9A 3P42A 1W6JA 3VYRA 4PT5A 5J39A 1SNDA 4NAWB 4D2KA 2L1BA 3WOEA 2INNE 1DZ1A 4HSVA 4M1UB 3A7LA 1HTLD 1GB1A 3VA5A 3GTQB 4HCEA 1K50A 2JZPA 5HGTA 1V1PA 4K8IA 2RPVA 4G7HC 2WP9B 2ENBA 1SSOA 3V3XA 1KNEA 4HMJA 3IKJA 1FRDA 4KKTA 3VYTA 4YTMB 4IOIE 1F0ZA 2Z4HA 4DK1A 2NTTA 3GV6A 2XNAC 3SFDB 3OMGA 3Q8CA 1F2RC 1GUTA 3R8BA 3P20A 2EYPA 2EELA 2K5WA 3S15B 4OHJA 1B3AA 1XTCD 1UEAB 2BS2B 4X3SA 2AQ1B 4KKJA 1EY5A 5CBEE 1C79A 3C8YA 4ZUJA 1L0YB 4BY7B 3MFGA 3VR8B 2WIIB 4DN4M 3P4QB 1BXTA 1TU2B 4L8JA 4IUQA 4OIJA 3ZGZA 1F9SA 4KHZA 2B2UA 1O7ZA 1O7YA 2E2JB 3NWSA 4YT0B 4H0LC 1N63A 3X3MA 3P1HA 1BBXC 1ENCA 1E2WA 1L0XB 3KWVA 3EVQA 4L6TB 2EJFC 1QJOA 2F0FA 1BUIC 1BF4A 2ZXPA 4IURA 1PFBA 3HP3A 4L2YA 1BCPF 4K5XA 1I50B 1I4XA 3CWIA 3MJ5A 4YSXB 4XTCS 2BW2A 3J9CA 2IWHA 1IBXB 1K53A 2RQXA 5G5GA 1NSNS 1HPCA 4XXEA 4DNRB 4A6QA 3ZJUA 2K1BA 4J1MA 1PTOD 3NBHA 2VNUD 1RM6C 4XE0A 5DAUA 1FMAD 4DF7A 1U4PA 1SMYC 3QOLA 5C44B 3AE3B 5F2DA 3AB5A 3DEPA 3SK8A 3LNNA 4NW2A 4M8AA 1R4PB 5K36H 3T56B 1H9SB 1JW9D 1UWMA 1KLGD 2AWNA 1ZDVA 1CZPA 1Y8OB 4K5VA 4USAA 1H9MA 3PO0A 3P75A 1TQOA 4BWGB 3HEJA 2Q8IB 4A8XC 2EJMA 4ZRZA 3D4WA 3NBIA 3FRPB 2IX1A 5BYQA 2PW7A 1EY4A 1UAPA 3VR9B 4MT5A 5KGUA 2ICEC 2AQ3B 5JJZA 1PZID 4MN3A 2E3TA 1EEID 1SNMA 4DFAA 1F2YA 4KX6B 2MH7A 4JX1C 1X3PA 5M3FB 2RSOA 1SEBD 4KK7A 2ZW0A 3RUZA 1BCPC 3NVYA 2E6XA 2JYTA 4QF4A 4PNYA 2LMCB 1HTPA 2WV6D 1CJEA 2WXQA 1TWAB 1NI3A 2F0VA 1FXAA 1C76A 4US9A 2NN6I 2YYZA 3DWGC 2PNRC 2L1AA 1HZ6A 3MC0B 3J80E 3NVVA 4KGTA 3T4AC 2L4NA 2IGGA 1JWMD 5NUCA 1B9MA 4KY7A 1DOKA 1XF5L 2XWBB 1PLFA 1HHVA 5D3DA 3OSOA 4XDDA 1D1IA 1I6HB 1AFPA 4YSYB 3D8GA 1OQRA 2F0GA 3IFTA 1JQ4A 2K04A 1H9RA 3M4YA 2WDQB 2WXJA 2KVMA 3G6JB 1L4DB 5EKLA 1EY6A 2XRQD 4IUTA 4KKIA 3NVZA 3Q8EA 1OXXK 1N61A 4A3JB 1SB3C 4QCLA 1Q8IA 3N52A 2JQRB 1F2LA 5AFWA 1RTOA 2JYEA 1EYAA 1VDVA 3P4PB 1CM9A 4DXGA 1NYRA 1B2TA 4P6VF 2PQEA 1SE3A 4WH4A 4WFN3 5DNFA 2KCNA 5C4XB 3MTSA 5JPMC 3P63A 2LS01 1DCZA 1RD9D 4NAMA 1J9OA 1A3VA 1KTKA 2Y0SB 4RFBA 3BIID 3GTPB 2G9DA 3K6OA 2K28A 3A8IE 2SNSA 4V0BA 1EQTA 2B2UC 3KK7A 1KDBA 3K5OA 3QB3A 3PZ7A 2ON8A 2LY7A 4IDIA 4ZRPA 2B63B 4OZCA 2BE5C 2FMMA 4REZA 3F2UA 4AS1A 4PQXA 2F0UA 3NTHA 3J7AV 3QIAA 2L9HA 1D1KA 3BS1A 3E56A 2A6HC 4BY1B 3NUCA 4A3DB 1D5ZC 5KYIA 1ILPA 3W5UB 2JXMB 2OEDA 1Q12A 4K2KA 3TUOA 3AEAB 4IUNA 4DAPA 1G8ZD 1KDCA 2KQ3A 4B08A 1KDAA 3DM1A 3MVVA 4ZAIA 3S1QB 1GOZA 3SR6A 2EYFA 4CJ0B 1RDPD 5C4HA 1NAPA 1OFFA 4WQMA 3M85A 2BBCA 1WTOA 1RWSA 2N9LA 4XYOA 1LO5D 5TSSA 5EE0A 1LABA 1PXUA 1Z7TA 4HROA 4NMZA 4E6IA 2WU5B 2ACZB 4DNTB 3S1MB 2HQEA 1H9KA 3AE6B 2JXTA 3R3OA 3NHHA 3VR6A 5D65A 2PCFB 3UI2A 2K05A 2LKVA 1TJEA 1M4VA 2EYLA 1WSPA 4C80A 4Z9CB 1MVKA 1IBXA 1IYVA 1D4BA 4MM3B 3GS2A 2SEBD 5D7GA 4OO1I 2WQYB 3H6MA 1PTOB 4RHRA 2JYOA 2EYMA 3MXPA 1DOIA 4LJZC 3AEFB 4CJ1B 3RZDB 4HJGE 1CI3M 1OXTA 1YN3A 3SFEB 1UNSA 5FO8B 3BDCA 1Y8PB 3RMHA 2AWOA 1AN8A 2BDNA 4Q5VA 4BBRB 1JWBD 3R2TA 2LFNA 3ETRA 1QNKA 1H9SA 3DMUA 2K7VA 2D5DA 5JEAJ 1G91A 2J42A 1VLBA 2V4IB 1F2ZA 3SEBA 2F0OA 3LB8C 2GRIA 1EWYC 4OW0A 1QILA 3UI3A 4HTHA 4R9WA 3K7AB 1L5PA 1ZXHA 3OWEB 1CQVA 2A5HA 2W82A 5FR3A 1FO4A 4A93B 5BN4A 2X69A 1Z47A 3MA2B 2XWJB 1I3QB 5T8IA 1MGSA 1EQVA 3Q23A 2L5TA 1CQFA 3C2PA 2WS3B 1I6VC 2SOBA 2M19A 4C7YA 1BOSA 2PTLA 1GUWA 4OZBA 5C0XI 1JICA 2B76B 3ND9A 1ZYRC 1STAA 2MHVA 3L7ZC 4OO1H 5A2QL 1SFOB 4LAAA 2WXGA 2JA8B 3SHLA 1TR5A 1HZ5A 1LTSD 3U9OA 5IIFA 1PDXA 1PGXA 3AMZA 1EU4A 2GA4B 2BB6A 1L6UA 4GLSC 1CFMA 3PV0A 5BYSA 2F0WA 4GDLB 2I2YA 1EIGA 1FXIA 2LMCA 4C7ZA 1ET6A 3OIQA 4OZAA 1EYCA 5IT9L 2ZT9C 2Y3AA 1SSNA 4K5WA 1SYFA 3K5MA 4HR7B 1ROEA 1II3A 4C3IB 4JPSA 2J0TD 1FEHA 4RGTA 5M9OA 3U4EG 1SE2A 1JORA 5E6JA 1TWCB 3T51B 1O78A 5C0XH 5C3EB 3KUPA 1EFID 4F8MA 3Q8AA 4XDXA 4EQNA 3FEWX