2CR5A

Solution structure of the ubx domain of d0h8s2298e protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
109
structure length
109
Chain Sequence
GSSGSSGEVPDLPEEPSETAEEVVTVALRCPNGRVLRRRFFKSWNSQVLLDWMMKVGYHKSLYRLSTSFPRRALEVEGGSSLEDIGITVDTVLNVEEKEQSSQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reproduction 8
publication title Solution structure of the UBX domain of D0H8S2298E protein
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 10
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00789 UBX UBX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2cr5A01
1ZGUB 2AL3A 3A1QA 4IC7B 4ASWC 1LQBA 4HPMB 3RCZA 4A3OA 1LM8B 2FCNA 5JHAA 4JQWC 4XZ4A 3ZVVA 2UWQA 1UH6A 1WGHA 2JRHA 4KDLB 2LZ6A 1WFYA 3IG3A 4M0WB 3V6EB 2W9NA 4IWQA 2D11A 1OEYJ 4F8CB 1C1YB 2CHWA 4IM0A 2GBJA 2ZCCA 3ZLZA 5L95C 2D2QA 4B95A 2M17A 2WWZA 4W9GA 3VVWB 2EMTA 3PVLA 2KFKB 2QHOA 2A5UA 4GN1A 3PHXB 3PRPB 4BVUC 2ZNVB 3UIOB 1JRUA 4EZJA 5JHBA 3PLVA 3TL5A 2IY1B 4M8MA 5KHQA 2MBQA 3KUDB 1GJZA 2K6QA 3QX1A 1UZXB 3A4RA 2BWFA 2NR2A 4XC2A 3TBLD 1X1MA 1V80A 3VQIA 1L2NA 4NY0A 4PYZA 3ENEA 4HDOA 1U4AA 3PRZA 2WX0A 4GDLB 2J0JA 4PS3A 4TV3A 3TMPB 2JPHA 3T8MA 2BKFA 2CHXA 2K39A 2KDBA 2N4FA 5DPRA 4GSWA 3PT2B 4AJYB 3NY5A 3VHTC 4DWFA 1V81A 3L0WB 3RD2A 3L54A 4K7WA 2AWTA 2M4NA 3KW5B 3IBEA 1KLVA 1EO6A 3QARA 2LRWA 2ZNVC 4PS8A 4TKNA 4W9DA 2FCQA 3VH3B 2DZJA 1YX5B 2IY0B 2KHWB 5G55A 4E3CA 2O6VD 3CSFA 4CO7A 4LDTB 2J0MA 1WI0A 2V1YA 3R7QA 4MGYE 3ZKJC 1WZ3A 4HPLB 2G45B 4N9F4 3VH4B 4K7UA 3ZDMC 2MA9B 2BGFA 3DVGY 3DCGA 5LLIA 3L08A 3L16A 2J0KA 3WALA 3HM3A 4FHJA 4FJYA 3WAPA 1WJ4A 5CHFA 5C1ZA 2LJ5A 2MBEA 2G3QB 4CYEA 4W9CA 4GDLA 1OEYA 4WWOA 2N7EA 2LGYA 1P98A 2NS5A 3VFKA 3APFA 4KIKB 3T9LA 2KXJA 2MWSB 4I6NB 4MGKE 3WIMA 2LASA 1YX6B 3AU4A 4II3B 4ICVA 4B9KA 2LVOA 2MP2B 1VD2A 3QCAA 4RM9A 2G4SA 4ZYNA 2MBHA 4FN2A 2LWPA 1WZ0A 1UELA 4I6LB 4NAWB 3X23A 2KFJA 1Q1OA 3APCA 2Z0EB 4AUQC 2Z59B 1L7YA 2C9WB 1LFDA 4BFRA 2KWCA 3DPDA 3QC8B 1WJNA 4KZCA 2LXAA 3BINA 2OOBB 3KYCD 3NHEB 4FBJB 2K8BA 3V61A 3RZWC 3PHWB 1YD8U 2KDIA 5LXHA 5D7GA 3LJ3A 3HHMA 3AU5A 2HJ8A 4G0NB 4NQKE 4AWJA 4BOZB 1TZ1A 3PSEB 3NS8A 3N3KB 1WGGA 1WXVA 3ZDTA 3EC8A 1SE9A 4WWNA 3QHTA 1IPGA 2MP2A 5BO4B 4EKUA 4KZ0A 3VUYA 2L7RA 2M1MA 2LGXA 2RD0A 1OGWA 3B0AA 3OJ4B 1GG3A 1VCBA 3ZUNA 4NAWA 3PLUA 2CHZA 2C5LC 2NPTB 1WR1A 4HK2A 2N9EB 4I6PA 2HD5B 3RUIB 2NBWB 2AEHA 3ZNHB 4BKSD 1J0GA 4W9LA 4JGHB 1IYFA 4BOSC 2JUOA 2K25A 4LDTD 4DHZE 5D94A 2NCNA 3GZNI 4P7IA 3DVNV 3DBHI 4IWOA 3C0RB 3MHSD 4K1RB 4NPNA 1C3TA 4HJKA 1WF9A 4IM3A 4K7SA 2CKHB 3VTUA 3U7DA 3IVFA 1V6EA 1WXAA 2XBBC 2RPQA 1D3ZA 3ZNID 2FIDA 3ECIA 1V9JA 4LJPB 3TIXA 3CSTA 3DQVA 2O2VB 5E6OA 1E8WA 2JF5A 1TTNA 2IO1B 1I35A 3DBSA 1TBEA 3JVZX 3IFWB 3O65B 3RZFA 2KWUB 4E71A 3MJWA 4W9EA 1P3QU 1WGDA 3AXCA 4GU2A 2NPTA 4GXBA 3U8ZA 1GC7A 3W1YA 3H7PB 4EZLA 3L13A 3PS6A 4IWPA 5DCNA 2FIFA 2LVPA 1KM7A 1E7VA 2BWES 1WX7A 1P1AA 5AZFA 2DAJA 2I1JA 3W1SA 4WWPA 3GOEA 4MGZE 4TUUA 4WJOA 1WH3A 4HXDA 4AOFA 4GGQA 2ZPYA 2BPSA 3A9JA 1WE7A 2DENB 1V5OA 2IYDB 2DAFA 4HWIB 3N30A 3I3TB 4W9FA 4HDQA 5CHWA 3UINB 4W9JA 2C7NB 2KC1A 2DZMA 5E6NA 3TJPA 4G3XB 4EOYA 3H7SA 4F1SA 2KOXA 2IO0B 3P2BA 1IP9A 4DHJB 2D3GA 2JZ3B 2O2VA 4GOCA 1WX9A 4MSQB 4MELA 2B3AA 3SHQA 3V6CB 1J19A 5LXIB 3SDLC 3UQBA 2CR5A 4TQ1A 1LXDA 1RFAA 2FCSA 2IO2B 1WJ6A 1T0YA 3H7PA 3UGBB 1OTRB 2BYEA 3M63B 4FADA 2KJHB 2D10A 2PPHA 4IG7B 5L83A 5CTRC 4GB9A 4M8NA 3UF8A 2LD9A 1P9DU 3PRMB 3RULA 2N7DA 3U30A 3BY4B 3K9PB 1WIAA 4BKGA 3PPAA 4G50A 1H8CA 3ZIMA 4JIOU 4OVVA 3VUXA 5EDSA 3SD5A 2Z0DB 1SGHA 2MX2A 3K9OB 1WJUA 3A9KB 4NJ6A 4MEMA 4EZKA 1OQYA 4X57B 2NVUI 2EKEC 2J7QB 2N1VA 5IAAC 5CHVC 2FCMA 5D6JB 1ISNA 2KDEB 4ANVA 1UD7A 4II2B 4TQ0A 3KVFB 1SIFA 2DZIA 2XEWA 1MG8A 3L17A 3PREA 3VTWA 1YJ1A 5C23A 1GUAB 1RLFA 2GBNA 3MTNB 1V86A 4MGIE 1WR6E 5D2MB 2L76A 3KUCB 2MCNB 2GBMA 2GBRA 5AZGA 4NQLB 2YVCA 2FAZA 1UGMA 2DYOA 3DOWA 2JY6A 3AI5A 2N1WA 3QQ8B 2NBUA 1EF5A 4KSKC 2Y5BB 2WX1A 4ZDVA 2XK5B 3PTFC 1NI2A 4W9KA 3VUWA 2DZKA 4WJNA 5JH5C 2KD0A 5CX3A 3V62A 2IBIB 1PQSA 2IZVB 4FHKA 1QZEA 1FXTB 2MSED 2BF8B 2DYBA 5HKHA 2AYOB 4NNJB 4WJPA 5KHOA 3A9KA 3PGEA 3N32A 3DBLI 4GMVA 2GOWA 3Q3JA 1WE6A 4MJSB 4YL8A 3VXWA 3LDZE 1WYWB 2REXA 1I42A 2LI5A 2KJ6A 2ASQA 4A3PA 5FR6A 2MQJA 2C60A 4BKTA 1Y8RC 2GMIC 4A20A 2D07B 5DPWA 2KNBA 2DX5B 4DHJD 2PE9A 1CMXB 4LCDE 3M3JA 4XX5A 2KX3A 3JW0X 3UIPB 2BYFA 1RAXA 5E6PA 2R2OA 2KMAA 2UYZB 3ML8A 4AJWA 1S3SG 2ZJDA 2KX0A 1UBIA 3A9JB 3QK0A 3VAWA 4IM2A 1UBQA 2XK5A 2KLCA 4FA6A 4G11A 4ANWA 4AP4C 4MDKE 4BBNF 2JZZA 2CU1A 5IA7A 4HLEA 2VRRB 4FJZA 4PYUA 2L3ZA 4WAAA 2MW5A 1WM3A 1XD3B 2CS4A 2HTHA 3DBRI 4MJSA 1G6JA 3A33B 3W1SC 2KQSA 4ZRIA 2KDFB 4CHKA 2MLBA 2ZVNA 2I1KA 2PEAA 2BKRB 2C7HA 2M8SA 5G2NA 2O6VA 4MSMB 2OJRA 3H9DA 1BT0A 3WANA 1WGYA 1GC6A 3ML9A 5J17A 1E8YA 3WAMA 4ANUA 5AZHA 2KZRA 1NBFC 1ZKHA 3Q3FA 4FULA 2KKCA 4JLCA 4URKA 2JT4B 4IUMB 2PE6B 2NBVB 1WM2A 3OLMD 2L05A 2JVCA 4IW0A 2V4LA 1V2YA 3EFUA 1WY8A 3KH0A 1WRDB 2ZPNA 3WA0A 2LXCA 4LJOB 2R2QA 2G4DB 1Q5WB 1F9JA 3A4SC 3QIJA 1M94A 3RT3B 2KO3A 3WAOA 1KJTA 1RRBA 4MM3A 4GDKA 4JL9A 2M0XA 1YQBA 2DHZA 4OVUA 3QA8A 4KDIC 2DYMA 3HM6X 4HCNB 3ONSA 3H1UA 1HE8A 2ZVOA 2LGDA 1R4MI 3NZSA 3PZDA 4EUTA 4KVGB 3ZW3A 2WYQA 3TCAA 3H6NA 3R66C 2KVRA 4B6WA 3QJZA 1WGRA 2N9PC 5GMVA 4DDID 3AULA 2N9XA 2GBKA 1H4RA 2L0TA 3S2AA 1KOTA 2K1FA 3ZRCA 4BBNC 1E5WA 1AARA 2KFKA 5TR5A 1S1QB 3M62B 4F7ZA 4GIVA 2JXXA 1WMHB 3JYUA 4HVBA 2K8CA 3QAQA 2ZZPB 4HCPB 1XT9B 2KC2A 2KJRA 4RMAA 5AEKB 2KLGA 5J2RA 3NZUA 3QWZB 1WXSA 2L00B 4E74A 1Z2MA 3HK0A 3OJ3A 2FUHB 4ICUA 2JRIB 4ANXA 1V5TA 4KV2A 4K81A 4RM8A 2RSUA 5DPSA 3KUZA 3NOBA 4DK5A 2KTRB 2LUEA 3DVGX 2V3SA 5J18A 3ZO5B 3B08A 4DBGA 4FLHA 3B1LX 4ZRJA 4EFOA 1WX8A 1EUVB 2K6DB 2KQ7A 3OAWA 2PJHA 4DDGD 1P0RA 2K8HA 2YLMA 3VTVA 2MBOA 3JSVB 2KMCA 4DHZB 2KTFA 2LRUA 2RR9A 3PV1A 3ZRFA 4BKSA 4EEWA 2AL6A 2EMSA 1GNUA 3VDZA 2ZCBA 1V49A 1ZW7A 3IHPC 4NJ7A 1WMHA 3DDCB 3ALBA 2MBBB 3L10B 3A1QB 3ZTCA 2MRPA 5DPTA 3D32A 4KSLC 3R7RA 3ZNZB 3UQAA 5JZEB 1E8ZA 1E90A 2L8JA 1XQQA 1WXMA 3KYDD 1Z5SB 1NDDA 3EECA 2KANA 4PS7A 2ZEQA 4W9IA 1K8RB 2O6VB 4WJQA 3EHVA 2KTRA 1YIWA 1R4NI 2HE7A 4KIKA 1EF1A 3SU8X 2JWZA 2C7MB 3ZNGC 2A4ZA 3APDA 4J6IA 1TGZB 2L0FA 2FNJB 2WDTB 4DXAB 4FJVB 4W9HA 3R3MA 3V60A 3CF6E 3HIZA 3JSVA 1E7UA 2IO3B 3DVNU 1E8XA 3RYTA 1Q0WB 4ZRKA 3X0WA 4WQOB 1A5RA 4MH0E 2RGFA 2KK8A 2LVQA 3CMMB 2KN5A 2BYVE 3ZTDA 1J8CA 4GDKB 3M95A 2KWVB
chains in the Genus database with same CATH superfamily
3A1QA 2D3CA 4HPMB 3RCZA 1XLOA 1ZE3D 4A3OA 3GE3C 4JQWC 4XZ4A 3ZVVA 3AM9A 5EE1A 1WFYA 4MH8A 3V6EB 2WDVB 2D11A 4IM0A 4PK1A 1V1PB 2Y5PA 2M17A 5LNK1 4W9GA 4K3CA 1MJDA 3BVGA 5HI1A 4BVUC 2WXPA 5JHBA 3TL5A 5KHQA 2MBQA 1GJZA 4LNKA 1SJHD 3NS1A 2XN9C 1X1MA 1V80A 4BAXA 1ROEA 3TMPB 4TV3A 3MJ5A 2ICIA 2CHXA 2NTSA 1GPXA 2KDBA 1ZDVA 4AJYB 1V81A 3L0WB 3RD2A 3L54A 4ACFA 5E6JA 2M4NA 2WHIA 3T3NA 3QARA 4GLSC 4TKNA 4ZHPA 2FCQA 2KMMA 4AQ7A 4JE3B 1FFVA 2J0MA 2V1YA 3R7QA 2G45B 3NVWA 3DCGA 1V97A 3L16A 3E9SA 3AEBB 2I2YA 1OEYA 4LNOA 2LGYA 1P98A 1UF0A 1FNVA 1M4VA 3P1MA 4MGKE 2LVOA 2L52A 1WRIA 1Y56A 2N9LA 1EM7A 4NAWB 4I6LB 2KFJA 2TSSA 3V3XA 4AUQC 1L7YA 3W2DA 4BFRA 3QC8B 2LXAA 3KYCD 4OW0A 3DBLB 4RF0A 4C7ZA 1C4CA 4RGMA 4BOZB 3AU5A 3Q3NC 1SE4A 5HHDG 1TZ1A 2M56B 1DYQA 1NYQA 1OQRA 3N3KB 1IGDA 1MPEA 1SE9A 4WWNA 2WXLA 4KZ0A 3VUYA 2RD0A 1OGWA 3ZUNA 1GG3A 1QOBA 1VCBA 4NAWA 4H2AA 1WR1A 2N9EB 4I6PA 1IYFA 1FCLA 5G5HA 2WXGA 2JQRB 1JW9D 4IWOA 5T8IA 3MHSD 1E6EB 4HJKA 2CKHB 3U7DA 2JU6X 4WQMA 2XBBC 3ZNID 1T6BX 3TIXA 3AE6B 3FAHA 5E6OA 1TTNA 2IO1B 1I35A 1TBEA 1C77A 4EZLA 1E7VA 3Q3MC 2BWES 1P1AA 3P4SB 1CJEA 4RH6A 4P1CC 3W1SA 3GOEA 1FNWA 4WJOA 1WH3A 2IGGA 3A9JA 1WE7A 1YN4A 1V5OA 2RDHA 2NTTA 3UINB 2DBYA 3TJPA 4EOYA 4HPPA 2IO0B 5BMGA 1UWXA 4DHJB 4GOCA 1WX9A 3RNCC 2E6XA 3BZDB 2SAKA 1RFAA 1WJ6A 3UGBB 2BYEA 3M63B 4FADA 3ZJTA 2D10A 4GB9A 2LD9A 4RGNA 2BB5A 5IP4D 4BKGA 2AQ2B 3R2IA 2MX2A 4XDCA 1WJUA 4NAMA 1FM0D 2FBWB 5EE3A 2N1VA 1ISNA 2HTME 3NVZA 3VTWA 3AE5B 1FXAA 1KTKA 2L76A 3KUCB 5TSSA 2OHFA 2YVCA 3HVZA 1UGMA 1FO4A 2AX5A 1EF5A 1KH0A 1NI3A 2RMMA 2WX1A 3PTFC 3VUWA 4FXCA 5JH5C 4WJNA 3IAS1 2IBIB 2IZVB 2MSED 2BF8B 4YTNB 5HKHA 2AYOB 4NNJB 4WJPA 3BYYB 1KRHA 3Q3JA 2K5PA 1JWAD 1I4XA 4NJCA 1I42A 2LI5A 2MQJA 1KLUD 4DHJD 3PZ7A 2R2OA 2K0PA 2KMAA 3ML8A 2ZJDA 1UBIA 3QK0A 3VAWA 4IM2A 1JMLA 4KKJA 1GB4A 2VRRB 4FJZA 1KFYB 2L3ZA 4WAAA 1L6VA 2CS4A 2KQSA 2I1KA 2KVZA 2M8SA 2O6VA 2OJRA 3H9DA 3I63C 1GC6A 1QILA 1E8YA 1T0RC 3GE8C 2KZRA 1NBFC 3Q3FA 1R4MB 4IUMB 3Q8CA 2BVCA 2L05A 4IW0A 4TSSA 3P4RB 1V2YA 2V3NA 2MEKA 1C4PA 4LJOB 4MM3A 2MJDA 4KDIC 2DYMA 3ONSA 3H1UA 1HE8A 2IDYA 3NZSA 1E0ZA 1C78A 1ZXHA 5GMVA 2N9XA 2WQYB 2L0TA 4D2KA 3NVVA 2K1FA 4YSZB 3ZRCA 1E5WA 1SE2A 5TR5A 4OVZA 5BYQA 4LTUA 3KLSX 2KJRA 5AEKB 2KWDA 1PGXA 2BS2B 2BBCA 4MT5A 1EU4A 1V5TA 1E9MA 4K81A 4RM8A 2RSUA 3KUZA 1D6EC 1SXTA 1TS5A 2QDFA 3NOBA 4DK5A 2KTRB 1TJEA 2XNAC 5HG2A 3B08A 3B1LX 4C00A 4EFOA 1WX8A 2PJHA 1B1ZA 2V4IB 1FFUA 3DHGC 4Q2JA 3W5UB 3N1ZC 2INNE 2E3TA 1GNUA 3VDZA 2ZCBA 1V49A 2WXJA 2D3AA 5AUIA 4OHJA 1ZUD2 1VZ8A 3D32A 4M00A 5BMIA 2L8JA 1XQQA 3HVDA 4ZHOA 3EECA 2KANA 2W3RA 4W9IA 1ET9A 3UI3A 3LB8C 2KTRA 4B0EA 1R4NI 3SU8X 3NVYA 2QIEB 2A4ZA 2M19A 4J6IA 1TGZB 2L0FA 4DXAB 3R3MA 1SBBB 3X0WA 4WQOB 1A5RA 3CMMB 1J8CA 4OZAA 1XLPA 2BQQA 4GDKB 2B76B 3AE4B 2AL3A 4IC7B 1SE3A 2FCNA 2INDC 2UWQA 2JRHA 2W9NA 4IWQA 4F8CB 1MHHE 1C1YB 2CHWA 2KT7A 2GBJA 3B9JA 5L95C 2WWZA 3VVWB 1L0XB 3PVLA 2KFKB 4LNNA 2A5UA 2ZNVB 4EZJA 4M8MA 3KUDB 2G1EA 1UZXB 2WXQA 2JWUA 2BWFA 1L2NA 3R2TA 4HDOA 3PRZA 5IOIA 2BKFA 2K39A 3VHTC 4JWSC 2MJ3A 2AWTA 3NZ3A 5H92C 1JWBD 1KLVA 1EO6A 2INPE 2LRWA 4PS8A 4M02A 4L1BA 1Q10A 4LDTB 5FK9C 1WI0A 1I4PA 4YT0B 4A6QA 1XCTL 4N9F4 2LFIA 2YEPB 3DVGY 2J0KA 3WALA 3Q8EA 4XGAB 5CHFA 4YTPB 2RDBC 2MBEA 3E56A 4WWOA 2N7EA 2LHDA 3RFZB 3APFA 2LJIA 3T9LA 3WIMA 2LGSA 3MHZA 3AU4A 2VH1A 4ICVA 4B9KA 2WGSA 1VJKA 2MBHA 2LWPA 1SIJA 3DWMA 5EE9A 2R61A 1LFDA 1R7SA 1CQVA 3RZWC 1J7BA 2JXTA 3P4PB 3P42A 5D7GA 4AWJA 2IGHA 1V1OA 3ZDTA 3MC9A 5C3JB 5BO4B 3GZNB 4EKUA 2LGXA 3OJ4B 4YTMB 5I4DA 3PLUA 2CHZA 1QLBB 4W9LA 4JGHB 4BOSC 1SF0A 4LDTD 3C19A 3Q6BA 1C3TA 4NPNA 1WF9A 4IM3A 4K7SA 3VTUA 1NVID 2CJOA 4ARIA 3IVFA 3BK2A 1V9JA 2O2VB 1YOVB 3DBSA 1BUIC 3RZFA 2KWUB 3MJWA 1P3QU 1WGDA 2D5GA 4GU2A 1GC7A 3W1YA 1YNTE 3PS6A 4IWPA 2LVPA 1KM7A 3N1XC 5AZFA 2DAJA 4TMAB 4MGZE 1ENFA 5MPOA 2ZPYA 2VH2A 3AH7A 2DENB 4YXDB 3I3TB 5CHWA 1PUTA 2HDEA 2KC1A 5E6NA 1F52A 1WGKA 3ZJUA 2D3GA 2JZ3B 2O2VA 3ABVB 4A8XC 1SB3C 4P6VF 3SDLC 2CR5A 2FCSA 2IO2B 1EWYC 2W54A 4S17A 4ARCA 4HEA1 3L4PA 3U52E 1P9DU 3PRMB 3RULA 3FC4A 3K9PB 2WU2B 3O13A 3PPAA 4G50A 3VUXA 3W5VB 4S0RA 3SD5A 1SGHA 1HTOA 2EKEC 5IAAC 2KDEB 1UD7A 1SIFA 2DLBA 4BZAA 1MG8A 3PREA 4ZRQA 1GUAB 4OZCA 1RLFA 2MCNB 2GBRA 5AZGA 2PW9A 2FAZA 4ZRPA 3MFGA 1CZPA 1DGJA 2NBUA 1JALA 1YJJA 4KSKC 4ZDVA 3KQ4A 1NI2A 2DZKA 2KD0A 3AE2B 3T3OA 4GMVA 3CWIA 4MJSB 4YL8A 5AUKA 3VXWA 4LLGM 4XDDA 2KJ6A 1DOYA 5FR6A 1VRAB 3NJTA 2C60A 4BKTA 1Y8RC 4A20A 2D07B 2KNBA 2DX5B 2PE9A 3WCQA 4XX5A 2KX3A 4RFBA 3UIPB 2BYFA 4RNAA 5E6PA 1FCCC 2HJ1A 3U2SC 3A9JB 2KX0A 4KGSA 4FA6A 3Q14C 4BBNF 2JZZA 3VRBB 4HLEA 4PYUA 2MW5A 1WM3A 1XD3B 3IXSA 1TS2A 2HTHA 1KLGD 1L0YB 3DBRI 4MJSA 2KDFB 4CHKA 2ZVNA 4ITKA 2QMTA 1BT0A 3U7ZA 1F77A 1C76A 5J17A 4ANUA 1PGBA 1ZKHA 4URKA 2JT4B 2PE6B 2NBVB 2WU5B 1JROA 3EFUA 1T5XD 1WRDB 3WA0A 2LXCA 2R2QA 2G4DB 1F9JA 2KO3A 4JL9A 2DHZA 4HCNB 2DWQA 2J52A 3PZDA 4KVGB 1YJIA 4B6WA 2KVRA 4KKIA 3AECB 1L4DB 3GS2A 2GBKA 3LYYA 1H4RA 1KOTA 1K51A 1N60A 4BBNC 1YQ3B 3M62B 4GIVA 3TUOA 2KC2A 4RMAA 3CIRB 3NZUA 1ESFA 2L00B 4E74A 1MI0A 3LXFA 1MG4A 2JRIB 4ANXA 2JZPA 3DVGX 4FLHA 1EUVB 1N5WA 4NZLB 4DDGD 1D5XC 1D5MC 3AEFB 2D3BA 4DHZB 3JSVB 2KMCA 3RN9C 2RR9A 2LRUA 4BKSA 3ZRFA 2GB1A 2AL6A 1T0QC 4NJ7A 4A55A 2JYEA 3DDCB 2FUG1 1K53A 3L10B 3ZTCA 1ACCA 1J7CA 4M01A 1E90A 4LK0M 1Z5SB 2K3UA 2LEKA 3VR9B 3DHHC 2L1AA 3NRZA 2O6VB 4KIKA 2WXKA 1EF1A 3HRDD 3APDA 2FNJB 2WDTB 5BYRA 3V60A 3JSVA 3RNFC 3DVNU 1Q0WB 1QF6A 2LVQA 2KN5A 2BYVE 4MM3B 2W3SA 3M95A 2QSDA 1IBXB 1LQBA 1BMLC 2PKOA 1LM8B 5JHAA 1JWUD 1UH6A 4KDLB 1XF5L 3MC8A 4M0WB 1AWDA 2OEDA 3Q69A 4PT5A 3FILB 2ZCCA 1JWSD 1TKGA 1HQRD 1B9RA 2AQ3B 3MP9A 3ZYYX 2IJ0A 1JRUA 3U4EG 1HA5A 1XLQA 2IY1B 3EUB2 3NUHB 2K6QA 3QX1A 2NR2A 4XC2A 3TBLD 4NY0A 4PYZA 3ENEA 1IBXA 2JPHA 2GLSA 1XXGA 1ZDXA 2N4FA 4GSWA 1VR9A 2Q5WD 4M0WA 2V3PA 3IBEA 2QJLA 3VH3B 3FILA 4C4VB 1YX5B 2IY0B 2KHWB 5G55A 2O6VD 4CO7A 2BTEA 4MGYE 3TEWA 2KYWA 2BGFA 5LLIA 4FHJA 4FJYA 2GI9A 5H8YE 1AW7A 2WP9B 2KAJA 5C1ZA 2G3QB 4CYEA 4W9CA 3BYTB 3VFKA 5BMHA 2KXJA 1RM6C 2J42A 2MWSB 1MVKA 4I6NB 2LASA 3AEDB 1D5ZC 3W9CB 2MP2B 1VD2A 3QCAA 4RM9A 4C4VA 4FN2A 2CU3A 3RMKC 3X23A 5IKCM 1JWMD 1Q1OA 3APCA 2Z0EB 1N5XA 2KWCA 1ZXIA 5GXGB 3V61A 4JX1C 3ZGZA 4YSXB 2V0GA 1YD8U 2KDIA 3LJ3A 1YN5A 4NQKE 3NS8A 1WGGA 3GP7A 4XYCA 4CQNA 2K22A 1EWCA 1IPGA 2MP2A 1CK1A 2L7RA 3ZXVA 4WWMA 4ZYSA 1RWSA 2C5LC 1I4GA 2AQ1B 2NPTB 1J0GA 2HD5B 4US8A 2K25A 2QCZA 3ZJVA 4DHZE 4K3BA 3EFCA 4P7IA 2H89B 3C0RB 4REZA 4IKGA 2PVGC 4P1BC 1V6EA 1VDVA 1D3ZA 2FIDA 4LJPB 3CSTA 3DQVA 5FKAC 1E8WA 4C7YA 1UGJA 1E7PB 4E71A 3IT6B 1LO5D 1TIFA 2NPTA 3U8ZA 3L13A 5DCNA 4KX6B 1L6UA 2I1JA 4WWPA 2BS4B 2Y5CA 2LMCA 4XE0A 4GGQA 2BPSA 1FPYA 2DAFA 4HWIB 4W9FA 2C7NB 2KACA 2DZMA 3H7SA 1IP9A 2WDQB 3SHQA 2WXMA 1J19A 1NEKB 3TEYA 1TZOA 1IGCA 1LXDA 3PO0A 3OWEB 2LUMA 4YSYB 2PPHA 1FMAD 4IG7B 5L83A 2EELA 4M8NA 3UF8A 2N7DA 1SJED 4JIOU 3NG0A 2Z0DB 3K9OB 2BS3B 4HROA 4EZKA 1HZ6A 2NVUI 1PGAA 2J7QB 3BWUD 5CHVC 2FCMA 5D6JB 3AMZA 4ANVA 3KVFB 1AN8A 1N63A 4DXFA 3L17A 1YJ1A 5C23A 1AYFA 3Q2AC 3MTNB 1I4HA 2N0SB 1JCKB 4MGIE 5D2MB 2QEJC 4NQLB 4A9AA 2DYOA 3AI5A 2KQ4X 2N1WA 2OJWA 4LNFA 5G5GA 2Y5BB 2XK5B 3AE7B 1PQSA 2L83A 3AE8B 3H8HA 2DYBA 4RF1A 3PGEA 2MJEA 3N32A 2G9HD 2GOWA 1WE6A 1C79A 1WYWB 2ASQA 3OG5A 1YN3A 2BW2A 2GMIC 5DPWA 5D3IB 1CMXB 3SFDB 2PVOD 4LCDE 3JW0X 1HTQA 4N6EB 2UYZB 1L0VB 2V9HA 1S3SG 1V8CA 2ZW1A 1UBQA 2XK5A 2WXRA 4G11A 4AP4C 5IA7A 1FRRA 1PFDA 3P63A 2K9XA 2SEBD 1G6JA 2FE8A 3A33B 2H88B 1PYWD 2PEAA 2BKRB 4MSMB 3ML9A 4WH4A 5AZHA 2BT6A 4FULA 1TKEA 1WM2A 3OLMD 2V4LA 3KH0A 1WY8A 2X8XX 3A4SC 3QIJA 1M94A 3WAOA 2M0XA 3BVMA 3QA8A 3HM6X 3AE1B 2VZKB 2ZVOA 2LGDA 1R4MI 2WYQA 3TCAA 3H6NA 2DNFA 4OZBA 2EKIA 1WGRA 3QJZA 2N9PC 1TYGB 1FNUA 2KDMA 3S2AA 1SSNA 2IGDA 3SR6A 1V1PA 2N7JA 1AARA 3RPFC 1L5PA 3IT4B 2JXXA 1TKYA 3JYUA 1FIQA 3QAQA 2ZZPB 1XT9B 1NYRA 4IOIE 3QWZB 2X38A 1FEHA 1HXYD 1WXSA 1TY2A 1Z2MA 4IDIA 1F1HA 1WSPA 3HK0A 4US9A 4C56C 1J7AA 3AB5A 5DPSA 5IN7A 3Q3OC 2LUEA 1ZP0B 3AN1A 5J18A 3ZO5B 4DBGA 3OAWA 2K6DB 4P16A 2QC8A 1P0RA 3VTVA 2KTFA 1QOGA 3PV1A 1E10A 4EEWA 3KWLA 2J53A 1ZW7A 3IHPC 1R4NB 5EE0A 3RNBC 1QOAA 2MBBB 2MRPA 3N20C 3ZNZB 3UQAA 1E8ZA 3VRAB 1QOFA 1WWTA 1T0SC 1WXMA 1GAQB 3DWGC 2RPVA 2UU7A 3I57A 3EHVA 1YIWA 5JXVA 2VZKD 4N58A 3RNAC 3AEAB 3B2FA 4W9HA 4A90A 3CF6E 3HIZA 3KWVA 2IO3B 3RYTA 4JWUC 4EE2A 4MH0E 2RGFA 2KK8A 2WDRB 3ZTDA 1QKZA 3ZXRA 1ZGUB 4ASWC 1N6ZA 2L32A 1VLBA 1WGHA 3Q8BA 2LZ6A 3IG3A 5IO9A 1OEYJ 3ZLZA 2D2QA 4B95A 1K50A 2EMTA 2QHOA 4USAA 3BIID 4GN1A 3PHXB 3PRPB 3UIOB 3PLVA 3MC0B 3A4RA 3ZQ4A 3AE9B 3V05A 3VQIA 2I38A 1MFWA 2YEPF 1JRPA 1U4AA 4GDLB 2WX0A 4WIPA 2J0JA 4PS3A 3Q8FA 3T8MA 5BYSA 5DPRA 3PT2B 3NY5A 4DWFA 4K7WA 3KW5B 2JYTA 2ZNVC 4W9DA 1XEEA 3BK1A 2DZJA 2KN4A 4E3CA 3CSFA 3ZKJC 1WZ3A 4HPLB 1D4BA 2WNMA 1TY0A 3VH4B 4K7UA 1FXIA 3ZDMC 2MA9B 1HEZE 3L08A 3TEXA 3HM3A 2WXOA 3WAPA 1WJ4A 1N62A 2LJ5A 4GDLA 1UWMA 2NS5A 2BB6A 3I5JC 4KIKB 3PZ8A 1YX6B 1XLNA 4II3B 2G4SA 4ZYNA 2BYTA 1I4RA 1WZ0A 1UELA 1YQ4B 2W55A 2Z59B 2C9WB 2MHJA 3DPDA 4LNIA 3AEEB 1WJNA 4KZCA 3BINA 2OOBB 3NHEB 4FBJB 2K8BA 3PHWB 1TS3A 5LXHA 1I7HA 3HHMA 2HJ8A 4G0NB 2PLPA 3PSEB 3J9CA 1P7EA 1WXVA 3EC8A 3QHTA 2CJNA 2M1MA 3B0AA 2ACZB 1RFKA 4HK2A 3RUIB 1C9FA 3ZNHB 2NBWB 2AEHA 2PMVA 4ZOHC 3GB1A 4BKSD 2JUOA 3HUIA 1OFFA 3P4QB 4RGTA 3EGRA 5D3DA 5D94A 4C80A 2NCNA 3GZNI 2LHEA 3DVNV 3DBHI 4K1RB 1RYJA 4JPSA 1PDXA 2ZW0A 2WXHA 1WXAA 2RPQA 1ZOYB 3Q8AA 3ECIA 4HJGE 2JF5A 1P7FA 3JVZX 3IFWB 3O65B 4W9EA 1ET6A 3AXCA 4GXBA 3H7PB 1LGRA 5C2TB 1WXQA 2FIFA 2M0AA 2W82A 1WX7A 4XWTA 4TUUA 1WYGA 4HXDA 4AOFA 1MHXA 3EA6A 2GRIA 1QT9A 4WAFA 3BVZA 4HKZE 2IYDB 3N30A 4HDQA 4W9JA 4G3XB 3N9YC 4F1SA 2KOXA 3P2BA 3ETRA 4MSQB 4MELA 2B3AA 3V6CB 5LXIB 3UQBA 3R8BA 4TQ1A 2WS3B 1T0YA 3H7PA 1OTRB 2KJHB 2WXIA 5CTRC 3U30A 3BY4B 1WIAA 3SFEB 1H8CA 3ZIMA 4OVVA 4L23A 1K52A 5EDSA 2WXFA 3A9KB 4NJ6A 4MEMA 1OQYA 2PIAA 4X57B 4AS1A 1N61A 3IAM1 4II2B 4TQ0A 2DZIA 2XEWA 2Y3AA 3RI7C 2GBNA 1YMHE 4UDUC 1V86A 1QQRA 1WR6E 2NMQA 2GBMA 3N1YC 3RNGC 4HKQA 2N9KA 4KGRA 3DOWA 1VZ7A 2JY6A 4DQOC 3QQ8B 3TEZA 1XCQL 3URYA 4W9KA 5CX3A 3V62A 4FHKA 1QZEA 1FXTB 1T3QA 5KHOA 3A9KA 3DBLI 4L2YA 4QAYA 1EU3A 3LDZE 2REXA 4A3PA 1TS4A 2PTLA 3M3JA 1RAXA 4MACA 1UNSA 1L4ZB 3DBRB 4RGOS 4AJWA 1UUPA 3AEGB 5FR3A 2KLCA 1HZ5A 4ANWA 4MDKE 4R3DA 2CU1A 2QILA 4WURA 4N59A 3W1SC 4ZRIA 3SEBA 2Z8LA 2MLBA 3AV8A 2C7HA 5G2NA 1XO3A 3WANA 1WGYA 1IUEA 2IPKD 3WAMA 4JLCA 2KKCA 1FD6A 4XWWA 2JVCA 2ZPNA 1JQ4A 1Q5WB 3RT3B 1KJTA 1RRBA 4GDKA 1YQBA 4OVUA 4J3OD 3AE3B 3VR8B 4EUTA 3ZW3A 2RDGA 1F2RI 3R66C 2INCC 3RNEC 4DDID 3AULA 1OQQA 1GB1A 2ON8A 4B0MA 1F2RC 3TSSA 1STEA 4DXGA 2MH7A 2KFKA 4HVBA 1S1QB 4F7ZA 1WMHB 1VZ6A 2K8CA 1FRDA 4HCPB 2KLGA 1ZPSA 5J2RA 1C4AA 1BXTA 4YWGG 3B2GA 4HRSA 3OJ3A 2FUHB 4ICUA 1F0ZA 4KV2A 2JX5A 1DOIA 1GOZA 2V3SA 1SEBD 3DHIC 4ZRJA 2KQ7A 1DOXA 1A70A 2K8HA 2YLMA 2MBOA 2JSVX 2EMSA 4RCOA 1WMHA 3ALBA 2ONQA 3A1QB 5DPTA 4KGTA 4KSLC 3R7RA 5HFYA 5JZEB 1NENB 1I4QA 3KYDD 1NDDA 2LGIA 2WLBA 4PS7A 2ZEQA 1K8RB 4WJQA 3I9V1 2HE7A 3C8YA 2JWZA 2C7MB 3ZNGC 2WXNA 1KF6B 4FJVB 4O1NA 2J4XA 1E7UA 3DBHB 1E8XA 4ZRKA 3FKYA 1TT5B 2KWVB
chains in the Genus database with same CATH topology
1ZGUB 2AL3A 3A1QA 4IC7B 4ASWC 1LQBA 4HPMB 3RCZA 4A3OA 1LM8B 2FCNA 5JHAA 4JQWC 4XZ4A 3ZVVA 2UWQA 1UH6A 1WGHA 2JRHA 4KDLB 2LZ6A 1WFYA 3IG3A 4M0WB 3V6EB 2W9NA 4IWQA 2D11A 1OEYJ 4F8CB 1C1YB 2CHWA 4IM0A 2GBJA 2ZCCA 3ZLZA 5L95C 2D2QA 4B95A 2M17A 2WWZA 4W9GA 3VVWB 2EMTA 3PVLA 2KFKB 2QHOA 2A5UA 4GN1A 3PHXB 3PRPB 4BVUC 2ZNVB 3UIOB 1JRUA 4EZJA 5JHBA 3PLVA 3TL5A 2IY1B 4M8MA 5KHQA 2MBQA 3KUDB 1GJZA 2K6QA 3QX1A 1UZXB 3A4RA 2BWFA 2NR2A 4XC2A 3TBLD 1X1MA 1V80A 3VQIA 1L2NA 4NY0A 4PYZA 3ENEA 4HDOA 1U4AA 3PRZA 2WX0A 4GDLB 2J0JA 4PS3A 4TV3A 3TMPB 2JPHA 3T8MA 2BKFA 2CHXA 2K39A 2KDBA 2N4FA 5DPRA 4GSWA 3PT2B 4AJYB 3NY5A 3VHTC 4DWFA 1V81A 3L0WB 3RD2A 3L54A 4K7WA 2AWTA 2M4NA 3KW5B 3IBEA 1KLVA 1EO6A 3QARA 2LRWA 2ZNVC 4PS8A 4TKNA 4W9DA 2FCQA 3VH3B 2DZJA 1YX5B 2IY0B 2KHWB 5G55A 4E3CA 2O6VD 3CSFA 4CO7A 4LDTB 2J0MA 1WI0A 2V1YA 3R7QA 4MGYE 3ZKJC 1WZ3A 4HPLB 2G45B 4N9F4 3VH4B 4K7UA 3ZDMC 2MA9B 2BGFA 3DVGY 3DCGA 5LLIA 3L08A 3L16A 2J0KA 3WALA 3HM3A 4FHJA 4FJYA 3WAPA 1WJ4A 5CHFA 5C1ZA 2LJ5A 2MBEA 2G3QB 4CYEA 4W9CA 4GDLA 1OEYA 4WWOA 2N7EA 2LGYA 1P98A 2NS5A 3VFKA 3APFA 4KIKB 3T9LA 2KXJA 2MWSB 4I6NB 4MGKE 3WIMA 2LASA 1YX6B 3AU4A 4II3B 4ICVA 4B9KA 2LVOA 2MP2B 1VD2A 3QCAA 4RM9A 2G4SA 4ZYNA 2MBHA 4FN2A 2LWPA 1WZ0A 1UELA 4I6LB 4NAWB 3X23A 2KFJA 1Q1OA 3APCA 2Z0EB 4AUQC 2Z59B 1L7YA 2C9WB 1LFDA 4BFRA 2KWCA 3DPDA 3QC8B 1WJNA 4KZCA 2LXAA 3BINA 2OOBB 3KYCD 3NHEB 4FBJB 2K8BA 3V61A 3RZWC 3PHWB 1YD8U 2KDIA 5LXHA 5D7GA 3LJ3A 3HHMA 3AU5A 2HJ8A 4G0NB 4NQKE 4AWJA 4BOZB 1TZ1A 3PSEB 3NS8A 3N3KB 1WGGA 1WXVA 3ZDTA 3EC8A 1SE9A 4WWNA 3QHTA 1IPGA 2MP2A 5BO4B 4EKUA 4KZ0A 3VUYA 2L7RA 2M1MA 2LGXA 2RD0A 1OGWA 3B0AA 3OJ4B 1GG3A 1VCBA 3ZUNA 4NAWA 3PLUA 2CHZA 2C5LC 2NPTB 1WR1A 4HK2A 2N9EB 4I6PA 2HD5B 3RUIB 2NBWB 2AEHA 3ZNHB 4BKSD 1J0GA 4W9LA 4JGHB 1IYFA 4BOSC 2JUOA 2K25A 4LDTD 4DHZE 5D94A 2NCNA 3GZNI 4P7IA 3DVNV 3DBHI 4IWOA 3C0RB 3MHSD 4K1RB 4NPNA 1C3TA 4HJKA 1WF9A 4IM3A 4K7SA 2CKHB 3VTUA 3U7DA 3IVFA 1V6EA 1WXAA 2XBBC 2RPQA 1D3ZA 3ZNID 2FIDA 3ECIA 1V9JA 4LJPB 3TIXA 3CSTA 3DQVA 2O2VB 5E6OA 1E8WA 2JF5A 1TTNA 2IO1B 1I35A 3DBSA 1TBEA 3JVZX 3IFWB 3O65B 3RZFA 2KWUB 4E71A 3MJWA 4W9EA 1P3QU 1WGDA 3AXCA 4GU2A 2NPTA 4GXBA 3U8ZA 1GC7A 3W1YA 3H7PB 4EZLA 3L13A 3PS6A 4IWPA 5DCNA 2FIFA 2LVPA 1KM7A 1E7VA 2BWES 1WX7A 1P1AA 5AZFA 2DAJA 2I1JA 3W1SA 4WWPA 3GOEA 4MGZE 4TUUA 4WJOA 1WH3A 4HXDA 4AOFA 4GGQA 2ZPYA 2BPSA 3A9JA 1WE7A 2DENB 1V5OA 2IYDB 2DAFA 4HWIB 3N30A 3I3TB 4W9FA 4HDQA 5CHWA 3UINB 4W9JA 2C7NB 2KC1A 2DZMA 5E6NA 3TJPA 4G3XB 4EOYA 3H7SA 4F1SA 2KOXA 2IO0B 3P2BA 1IP9A 4DHJB 2D3GA 2JZ3B 2O2VA 4GOCA 1WX9A 4MSQB 4MELA 2B3AA 3SHQA 3V6CB 1J19A 5LXIB 3SDLC 3UQBA 2CR5A 4TQ1A 1LXDA 1RFAA 2FCSA 2IO2B 1WJ6A 1T0YA 3H7PA 3UGBB 1OTRB 2BYEA 3M63B 4FADA 2KJHB 2D10A 2PPHA 4IG7B 5L83A 5CTRC 4GB9A 4M8NA 3UF8A 2LD9A 1P9DU 3PRMB 3RULA 2N7DA 3U30A 3BY4B 3K9PB 1WIAA 4BKGA 3PPAA 4G50A 1H8CA 3ZIMA 4JIOU 4OVVA 3VUXA 5EDSA 3SD5A 2Z0DB 1SGHA 2MX2A 3K9OB 1WJUA 3A9KB 4NJ6A 4MEMA 4EZKA 1OQYA 4X57B 2NVUI 2EKEC 2J7QB 2N1VA 5IAAC 5CHVC 2FCMA 5D6JB 1ISNA 2KDEB 4ANVA 1UD7A 4II2B 4TQ0A 3KVFB 1SIFA 2DZIA 2XEWA 1MG8A 3L17A 3PREA 3VTWA 1YJ1A 5C23A 1GUAB 1RLFA 2GBNA 3MTNB 1V86A 4MGIE 1WR6E 5D2MB 2L76A 3KUCB 2MCNB 2GBMA 2GBRA 5AZGA 4NQLB 2YVCA 2FAZA 1UGMA 2DYOA 3DOWA 2JY6A 3AI5A 2N1WA 3QQ8B 2NBUA 1EF5A 4KSKC 2Y5BB 2WX1A 4ZDVA 2XK5B 3PTFC 1NI2A 4W9KA 3VUWA 2DZKA 4WJNA 5JH5C 2KD0A 5CX3A 3V62A 2IBIB 1PQSA 2IZVB 4FHKA 1QZEA 1FXTB 2MSED 2BF8B 2DYBA 5HKHA 2AYOB 4NNJB 4WJPA 5KHOA 3A9KA 3PGEA 3N32A 3DBLI 4GMVA 2GOWA 3Q3JA 1WE6A 4MJSB 4YL8A 3VXWA 3LDZE 1WYWB 2REXA 1I42A 2LI5A 2KJ6A 2ASQA 4A3PA 5FR6A 2MQJA 2C60A 4BKTA 1Y8RC 2GMIC 4A20A 2D07B 5DPWA 2KNBA 2DX5B 4DHJD 2PE9A 1CMXB 4LCDE 3M3JA 4XX5A 2KX3A 3JW0X 3UIPB 2BYFA 1RAXA 5E6PA 2R2OA 2KMAA 2UYZB 3ML8A 4AJWA 1S3SG 2ZJDA 2KX0A 1UBIA 3A9JB 3QK0A 3VAWA 4IM2A 1UBQA 2XK5A 2KLCA 4FA6A 4G11A 4ANWA 4AP4C 4MDKE 4BBNF 2JZZA 2CU1A 5IA7A 4HLEA 2VRRB 4FJZA 4PYUA 2L3ZA 4WAAA 2MW5A 1WM3A 1XD3B 2CS4A 2HTHA 3DBRI 4MJSA 1G6JA 3A33B 3W1SC 2KQSA 4ZRIA 2KDFB 4CHKA 2MLBA 2ZVNA 2I1KA 2PEAA 2BKRB 2C7HA 2M8SA 5G2NA 2O6VA 4MSMB 2OJRA 3H9DA 1BT0A 3WANA 1WGYA 1GC6A 3ML9A 5J17A 1E8YA 3WAMA 4ANUA 5AZHA 2KZRA 1NBFC 1ZKHA 3Q3FA 4FULA 2KKCA 4JLCA 4URKA 2JT4B 4IUMB 2PE6B 2NBVB 1WM2A 3OLMD 2L05A 2JVCA 4IW0A 2V4LA 1V2YA 3EFUA 1WY8A 3KH0A 1WRDB 2ZPNA 3WA0A 2LXCA 4LJOB 2R2QA 2G4DB 1Q5WB 1F9JA 3A4SC 3QIJA 1M94A 3RT3B 2KO3A 3WAOA 1KJTA 1RRBA 4MM3A 4GDKA 4JL9A 2M0XA 1YQBA 2DHZA 4OVUA 3QA8A 4KDIC 2DYMA 3HM6X 4HCNB 3ONSA 3H1UA 1HE8A 2ZVOA 2LGDA 1R4MI 3NZSA 3PZDA 4EUTA 4KVGB 3ZW3A 2WYQA 3TCAA 3H6NA 3R66C 2KVRA 4B6WA 3QJZA 1WGRA 2N9PC 5GMVA 4DDID 3AULA 2N9XA 2GBKA 1H4RA 2L0TA 3S2AA 1KOTA 2K1FA 3ZRCA 4BBNC 1E5WA 1AARA 2KFKA 5TR5A 1S1QB 3M62B 4F7ZA 4GIVA 2JXXA 1WMHB 3JYUA 4HVBA 2K8CA 3QAQA 2ZZPB 4HCPB 1XT9B 2KC2A 2KJRA 4RMAA 5AEKB 2KLGA 5J2RA 3NZUA 3QWZB 1WXSA 2L00B 4E74A 1Z2MA 3HK0A 3OJ3A 2FUHB 4ICUA 2JRIB 4ANXA 1V5TA 4KV2A 4K81A 4RM8A 2RSUA 5DPSA 3KUZA 3NOBA 4DK5A 2KTRB 2LUEA 3DVGX 2V3SA 5J18A 3ZO5B 3B08A 4DBGA 4FLHA 3B1LX 4ZRJA 4EFOA 1WX8A 1EUVB 2K6DB 2KQ7A 3OAWA 2PJHA 4DDGD 1P0RA 2K8HA 2YLMA 3VTVA 2MBOA 3JSVB 2KMCA 4DHZB 2KTFA 2LRUA 2RR9A 3PV1A 3ZRFA 4BKSA 4EEWA 2AL6A 2EMSA 1GNUA 3VDZA 2ZCBA 1V49A 1ZW7A 3IHPC 4NJ7A 1WMHA 3DDCB 3ALBA 2MBBB 3L10B 3A1QB 3ZTCA 2MRPA 5DPTA 3D32A 4KSLC 3R7RA 3ZNZB 3UQAA 5JZEB 1E8ZA 1E90A 2L8JA 1XQQA 1WXMA 3KYDD 1Z5SB 1NDDA 3EECA 2KANA 4PS7A 2ZEQA 4W9IA 1K8RB 2O6VB 4WJQA 3EHVA 2KTRA 1YIWA 1R4NI 2HE7A 4KIKA 1EF1A 3SU8X 2JWZA 2C7MB 3ZNGC 2A4ZA 3APDA 4J6IA 1TGZB 2L0FA 2FNJB 2WDTB 4DXAB 4FJVB 4W9HA 3R3MA 3V60A 3CF6E 3HIZA 3JSVA 1E7UA 2IO3B 3DVNU 1E8XA 3RYTA 1Q0WB 4ZRKA 3X0WA 4WQOB 1A5RA 4MH0E 2RGFA 2KK8A 2LVQA 3CMMB 2KN5A 2BYVE 3ZTDA 1J8CA 4GDKB 3M95A 2KWVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZGU B;  2AL3 A;  3A1Q A;  4IC7 B;  4ASW C;  1LQB A;  4HPM B;  3RCZ A;  4A3O A;  1LM8 B;  2FCN A;  5JHA A;  4JQW C;  4XZ4 A;  3ZVV A;  2UWQ A;  1UH6 A;  1WGH A;  2JRH A;  4KDL B;  2LZ6 A;  1WFY A;  3IG3 A;  4M0W B;  3V6E B;  2W9N A;  4IWQ A;  2D11 A;  1OEY J;  4F8C B;  1C1Y B;  2CHW A;  4IM0 A;  2GBJ A;  2ZCC A;  3ZLZ A;  5L95 C;  2D2Q A;  4B95 A;  2M17 A;  2WWZ A;  4W9G A;  3VVW B;  2EMT A;  3PVL A;  2KFK B;  2QHO A;  2A5U A;  4GN1 A;  3PHX B;  3PRP B;  4BVU C;  2ZNV B;  3UIO B;  1JRU A;  4EZJ A;  5JHB A;  3PLV A;  3TL5 A;  2IY1 B;  4M8M A;  5KHQ A;  2MBQ A;  3KUD B;  1GJZ A;  2K6Q A;  3QX1 A;  1UZX B;  3A4R A;  2BWF A;  2NR2 A;  4XC2 A;  3TBL D;  1X1M A;  1V80 A;  3VQI A;  1L2N A;  4NY0 A;  4PYZ A;  3ENE A;  4HDO A;  1U4A A;  3PRZ A;  2WX0 A;  4GDL B;  2J0J A;  4PS3 A;  4TV3 A;  3TMP B;  2JPH A;  3T8M A;  2BKF A;  2CHX A;  2K39 A;  2KDB A;  2N4F A;  5DPR A;  4GSW A;  3PT2 B;  4AJY B;  3NY5 A;  3VHT C;  4DWF A;  1V81 A;  3L0W B;  3RD2 A;  3L54 A;  4K7W A;  2AWT A;  2M4N A;  3KW5 B;  3IBE A;  1KLV A;  1EO6 A;  3QAR A;  2LRW A;  2ZNV C;  4PS8 A;  4TKN A;  4W9D A;  2FCQ A;  3VH3 B;  2DZJ A;  1YX5 B;  2IY0 B;  2KHW B;  5G55 A;  4E3C A;  2O6V D;  3CSF A;  4CO7 A;  4LDT B;  2J0M A;  1WI0 A;  2V1Y A;  3R7Q A;  4MGY E;  3ZKJ C;  1WZ3 A;  4HPL B;  2G45 B;  4N9F 4;  3VH4 B;  4K7U A;  3ZDM C;  2MA9 B;  2BGF A;  3DVG Y;  3DCG A;  5LLI A;  3L08 A;  3L16 A;  2J0K A;  3WAL A;  3HM3 A;  4FHJ A;  4FJY A;  3WAP A;  1WJ4 A;  5CHF A;  5C1Z A;  2LJ5 A;  2MBE A;  2G3Q B;  4CYE A;  4W9C A;  4GDL A;  1OEY A;  4WWO A;  2N7E A;  2LGY A;  1P98 A;  2NS5 A;  3VFK A;  3APF A;  4KIK B;  3T9L A;  2KXJ A;  2MWS B;  4I6N B;  4MGK E;  3WIM A;  2LAS A;  1YX6 B;  3AU4 A;  4II3 B;  4ICV A;  4B9K A;  2LVO A;  2MP2 B;  1VD2 A;  3QCA A;  4RM9 A;  2G4S A;  4ZYN A;  2MBH A;  4FN2 A;  2LWP A;  1WZ0 A;  1UEL A;  4I6L B;  4NAW B;  3X23 A;  2KFJ A;  1Q1O A;  3APC A;  2Z0E B;  4AUQ C;  2Z59 B;  1L7Y A;  2C9W B;  1LFD A;  4BFR A;  2KWC A;  3DPD A;  3QC8 B;  1WJN A;  4KZC A;  2LXA A;  3BIN A;  2OOB B;  3KYC D;  3NHE B;  4FBJ B;  2K8B A;  3V61 A;  3RZW C;  3PHW B;  1YD8 U;  2KDI A;  5LXH A;  5D7G A;  3LJ3 A;  3HHM A;  3AU5 A;  2HJ8 A;  4G0N B;  4NQK E;  4AWJ A;  4BOZ B;  1TZ1 A;  3PSE B;  3NS8 A;  3N3K B;  1WGG A;  1WXV A;  3ZDT A;  3EC8 A;  1SE9 A;  4WWN A;  3QHT A;  1IPG A;  2MP2 A;  5BO4 B;  4EKU A;  4KZ0 A;  3VUY A;  2L7R A;  2M1M A;  2LGX A;  2RD0 A;  1OGW A;  3B0A A;  3OJ4 B;  1GG3 A;  1VCB A;  3ZUN A;  4NAW A;  3PLU A;  2CHZ A;  2C5L C;  2NPT B;  1WR1 A;  4HK2 A;  2N9E B;  4I6P A;  2HD5 B;  3RUI B;  2NBW B;  2AEH A;  3ZNH B;  4BKS D;  1J0G A;  4W9L A;  4JGH B;  1IYF A;  4BOS C;  2JUO A;  2K25 A;  4LDT D;  4DHZ E;  5D94 A;  2NCN A;  3GZN I;  4P7I A;  3DVN V;  3DBH I;  4IWO A;  3C0R B;  3MHS D;  4K1R B;  4NPN A;  1C3T A;  4HJK A;  1WF9 A;  4IM3 A;  4K7S A;  2CKH B;  3VTU A;  3U7D A;  3IVF A;  1V6E A;  1WXA A;  2XBB C;  2RPQ A;  1D3Z A;  3ZNI D;  2FID A;  3ECI A;  1V9J A;  4LJP B;  3TIX A;  3CST A;  3DQV A;  2O2V B;  5E6O A;  1E8W A;  2JF5 A;  1TTN A;  2IO1 B;  1I35 A;  3DBS A;  1TBE A;  3JVZ X;  3IFW B;  3O65 B;  3RZF A;  2KWU B;  4E71 A;  3MJW A;  4W9E A;  1P3Q U;  1WGD A;  3AXC A;  4GU2 A;  2NPT A;  4GXB A;  3U8Z A;  1GC7 A;  3W1Y A;  3H7P B;  4EZL A;  3L13 A;  3PS6 A;  4IWP A;  5DCN A;  2FIF A;  2LVP A;  1KM7 A;  1E7V A;  2BWE S;  1WX7 A;  1P1A A;  5AZF A;  2DAJ A;  2I1J A;  3W1S A;  4WWP A;  3GOE A;  4MGZ E;  4TUU A;  4WJO A;  1WH3 A;  4HXD A;  4AOF A;  4GGQ A;  2ZPY A;  2BPS A;  3A9J A;  1WE7 A;  2DEN B;  1V5O A;  2IYD B;  2DAF A;  4HWI B;  3N30 A;  3I3T B;  4W9F A;  4HDQ A;  5CHW A;  3UIN B;  4W9J A;  2C7N B;  2KC1 A;  2DZM A;  5E6N A;  3TJP A;  4G3X B;  4EOY A;  3H7S A;  4F1S A;  2KOX A;  2IO0 B;  3P2B A;  1IP9 A;  4DHJ B;  2D3G A;  2JZ3 B;  2O2V A;  4GOC A;  1WX9 A;  4MSQ B;  4MEL A;  2B3A A;  3SHQ A;  3V6C B;  1J19 A;  5LXI B;  3SDL C;  3UQB A;  2CR5 A;  4TQ1 A;  1LXD A;  1RFA A;  2FCS A;  2IO2 B;  1WJ6 A;  1T0Y A;  3H7P A;  3UGB B;  1OTR B;  2BYE A;  3M63 B;  4FAD A;  2KJH B;  2D10 A;  2PPH A;  4IG7 B;  5L83 A;  5CTR C;  4GB9 A;  4M8N A;  3UF8 A;  2LD9 A;  1P9D U;  3PRM B;  3RUL A;  2N7D A;  3U30 A;  3BY4 B;  3K9P B;  1WIA A;  4BKG A;  3PPA A;  4G50 A;  1H8C A;  3ZIM A;  4JIO U;  4OVV A;  3VUX A;  5EDS A;  3SD5 A;  2Z0D B;  1SGH A;  2MX2 A;  3K9O B;  1WJU A;  3A9K B;  4NJ6 A;  4MEM A;  4EZK A;  1OQY A;  4X57 B;  2NVU I;  2EKE C;  2J7Q B;  2N1V A;  5IAA C;  5CHV C;  2FCM A;  5D6J B;  1ISN A;  2KDE B;  4ANV A;  1UD7 A;  4II2 B;  4TQ0 A;  3KVF B;  1SIF A;  2DZI A;  2XEW A;  1MG8 A;  3L17 A;  3PRE A;  3VTW A;  1YJ1 A;  5C23 A;  1GUA B;  1RLF A;  2GBN A;  3MTN B;  1V86 A;  4MGI E;  1WR6 E;  5D2M B;  2L76 A;  3KUC B;  2MCN B;  2GBM A;  2GBR A;  5AZG A;  4NQL B;  2YVC A;  2FAZ A;  1UGM A;  2DYO A;  3DOW A;  2JY6 A;  3AI5 A;  2N1W A;  3QQ8 B;  2NBU A;  1EF5 A;  4KSK C;  2Y5B B;  2WX1 A;  4ZDV A;  2XK5 B;  3PTF C;  1NI2 A;  4W9K A;  3VUW A;  2DZK A;  4WJN A;  5JH5 C;  2KD0 A;  5CX3 A;  3V62 A;  2IBI B;  1PQS A;  2IZV B;  4FHK A;  1QZE A;  1FXT B;  2MSE D;  2BF8 B;  2DYB A;  5HKH A;  2AYO B;  4NNJ B;  4WJP A;  5KHO A;  3A9K A;  3PGE A;  3N32 A;  3DBL I;  4GMV A;  2GOW A;  3Q3J A;  1WE6 A;  4MJS B;  4YL8 A;  3VXW A;  3LDZ E;  1WYW B;  2REX A;  1I42 A;  2LI5 A;  2KJ6 A;  2ASQ A;  4A3P A;  5FR6 A;  2MQJ A;  2C60 A;  4BKT A;  1Y8R C;  2GMI C;  4A20 A;  2D07 B;  5DPW A;  2KNB A;  2DX5 B;  4DHJ D;  2PE9 A;  1CMX B;  4LCD E;  3M3J A;  4XX5 A;  2KX3 A;  3JW0 X;  3UIP B;  2BYF A;  1RAX A;  5E6P A;  2R2O A;  2KMA A;  2UYZ B;  3ML8 A;  4AJW A;  1S3S G;  2ZJD A;  2KX0 A;  1UBI A;  3A9J B;  3QK0 A;  3VAW A;  4IM2 A;  1UBQ A;  2XK5 A;  2KLC A;  4FA6 A;  4G11 A;  4ANW A;  4AP4 C;  4MDK E;  4BBN F;  2JZZ A;  2CU1 A;  5IA7 A;  4HLE A;  2VRR B;  4FJZ A;  4PYU A;  2L3Z A;  4WAA A;  2MW5 A;  1WM3 A;  1XD3 B;  2CS4 A;  2HTH A;  3DBR I;  4MJS A;  1G6J A;  3A33 B;  3W1S C;  2KQS A;  4ZRI A;  2KDF B;  4CHK A;  2MLB A;  2ZVN A;  2I1K A;  2PEA A;  2BKR B;  2C7H A;  2M8S A;  5G2N A;  2O6V A;  4MSM B;  2OJR A;  3H9D A;  1BT0 A;  3WAN A;  1WGY A;  1GC6 A;  3ML9 A;  5J17 A;  1E8Y A;  3WAM A;  4ANU A;  5AZH A;  2KZR A;  1NBF C;  1ZKH A;  3Q3F A;  4FUL A;  2KKC A;  4JLC A;  4URK A;  2JT4 B;  4IUM B;  2PE6 B;  2NBV B;  1WM2 A;  3OLM D;  2L05 A;  2JVC A;  4IW0 A;  2V4L A;  1V2Y A;  3EFU A;  1WY8 A;  3KH0 A;  1WRD B;  2ZPN A;  3WA0 A;  2LXC A;  4LJO B;  2R2Q A;  2G4D B;  1Q5W B;  1F9J A;  3A4S C;  3QIJ A;  1M94 A;  3RT3 B;  2KO3 A;  3WAO A;  1KJT A;  1RRB A;  4MM3 A;  4GDK A;  4JL9 A;  2M0X A;  1YQB A;  2DHZ A;  4OVU A;  3QA8 A;  4KDI C;  2DYM A;  3HM6 X;  4HCN B;  3ONS A;  3H1U A;  1HE8 A;  2ZVO A;  2LGD A;  1R4M I;  3NZS A;  3PZD A;  4EUT A;  4KVG B;  3ZW3 A;  2WYQ A;  3TCA A;  3H6N A;  3R66 C;  2KVR A;  4B6W A;  3QJZ A;  1WGR A;  2N9P C;  5GMV A;  4DDI D;  3AUL A;  2N9X A;  2GBK A;  1H4R A;  2L0T A;  3S2A A;  1KOT A;  2K1F A;  3ZRC A;  4BBN C;  1E5W A;  1AAR A;  2KFK A;  5TR5 A;  1S1Q B;  3M62 B;  4F7Z A;  4GIV A;  2JXX A;  1WMH B;  3JYU A;  4HVB A;  2K8C A;  3QAQ A;  2ZZP B;  4HCP B;  1XT9 B;  2KC2 A;  2KJR A;  4RMA A;  5AEK B;  2KLG A;  5J2R A;  3NZU A;  3QWZ B;  1WXS A;  2L00 B;  4E74 A;  1Z2M A;  3HK0 A;  3OJ3 A;  2FUH B;  4ICU A;  2JRI B;  4ANX A;  1V5T A;  4KV2 A;  4K81 A;  4RM8 A;  2RSU A;  5DPS A;  3KUZ A;  3NOB A;  4DK5 A;  2KTR B;  2LUE A;  3DVG X;  2V3S A;  5J18 A;  3ZO5 B;  3B08 A;  4DBG A;  4FLH A;  3B1L X;  4ZRJ A;  4EFO A;  1WX8 A;  1EUV B;  2K6D B;  2KQ7 A;  3OAW A;  2PJH A;  4DDG D;  1P0R A;  2K8H A;  2YLM A;  3VTV A;  2MBO A;  3JSV B;  2KMC A;  4DHZ B;  2KTF A;  2LRU A;  2RR9 A;  3PV1 A;  3ZRF A;  4BKS A;  4EEW A;  2AL6 A;  2EMS A;  1GNU A;  3VDZ A;  2ZCB A;  1V49 A;  1ZW7 A;  3IHP C;  4NJ7 A;  1WMH A;  3DDC B;  3ALB A;  2MBB B;  3L10 B;  3A1Q B;  3ZTC A;  2MRP A;  5DPT A;  3D32 A;  4KSL C;  3R7R A;  3ZNZ B;  3UQA A;  5JZE B;  1E8Z A;  1E90 A;  2L8J A;  1XQQ A;  1WXM A;  3KYD D;  1Z5S B;  1NDD A;  3EEC A;  2KAN A;  4PS7 A;  2ZEQ A;  4W9I A;  1K8R B;  2O6V B;  4WJQ A;  3EHV A;  2KTR A;  1YIW A;  1R4N I;  2HE7 A;  4KIK A;  1EF1 A;  3SU8 X;  2JWZ A;  2C7M B;  3ZNG C;  2A4Z A;  3APD A;  4J6I A;  1TGZ B;  2L0F A;  2FNJ B;  2WDT B;  4DXA B;  4FJV B;  4W9H A;  3R3M A;  3V60 A;  3CF6 E;  3HIZ A;  3JSV A;  1E7U A;  2IO3 B;  3DVN U;  1E8X A;  3RYT A;  1Q0W B;  4ZRK A;  3X0W A;  4WQO B;  1A5R A;  4MH0 E;  2RGF A;  2KK8 A;  2LVQ A;  3CMM B;  2KN5 A;  2BYV E;  3ZTD A;  1J8C A;  4GDK B;  3M95 A;  2KWV B; 
#chains in the Genus database with same CATH topology
 3A1Q A;  2D3C A;  4HPM B;  3RCZ A;  1XLO A;  1ZE3 D;  4A3O A;  3GE3 C;  4JQW C;  4XZ4 A;  3ZVV A;  3AM9 A;  5EE1 A;  1WFY A;  4MH8 A;  3V6E B;  2WDV B;  2D11 A;  4IM0 A;  4PK1 A;  1V1P B;  2Y5P A;  2M17 A;  5LNK 1;  4W9G A;  4K3C A;  1MJD A;  3BVG A;  5HI1 A;  4BVU C;  2WXP A;  5JHB A;  3TL5 A;  5KHQ A;  2MBQ A;  1GJZ A;  4LNK A;  1SJH D;  3NS1 A;  2XN9 C;  1X1M A;  1V80 A;  4BAX A;  1ROE A;  3TMP B;  4TV3 A;  3MJ5 A;  2ICI A;  2CHX A;  2NTS A;  1GPX A;  2KDB A;  1ZDV A;  4AJY B;  1V81 A;  3L0W B;  3RD2 A;  3L54 A;  4ACF A;  5E6J A;  2M4N A;  2WHI A;  3T3N A;  3QAR A;  4GLS C;  4TKN A;  4ZHP A;  2FCQ A;  2KMM A;  4AQ7 A;  4JE3 B;  1FFV A;  2J0M A;  2V1Y A;  3R7Q A;  2G45 B;  3NVW A;  3DCG A;  1V97 A;  3L16 A;  3E9S A;  3AEB B;  2I2Y A;  1OEY A;  4LNO A;  2LGY A;  1P98 A;  1UF0 A;  1FNV A;  1M4V A;  3P1M A;  4MGK E;  2LVO A;  2L52 A;  1WRI A;  1Y56 A;  2N9L A;  1EM7 A;  4NAW B;  4I6L B;  2KFJ A;  2TSS A;  3V3X A;  4AUQ C;  1L7Y A;  3W2D A;  4BFR A;  3QC8 B;  2LXA A;  3KYC D;  4OW0 A;  3DBL B;  4RF0 A;  4C7Z A;  1C4C A;  4RGM A;  4BOZ B;  3AU5 A;  3Q3N C;  1SE4 A;  5HHD G;  1TZ1 A;  2M56 B;  1DYQ A;  1NYQ A;  1OQR A;  3N3K B;  1IGD A;  1MPE A;  1SE9 A;  4WWN A;  2WXL A;  4KZ0 A;  3VUY A;  2RD0 A;  1OGW A;  3ZUN A;  1GG3 A;  1QOB A;  1VCB A;  4NAW A;  4H2A A;  1WR1 A;  2N9E B;  4I6P A;  1IYF A;  1FCL A;  5G5H A;  2WXG A;  2JQR B;  1JW9 D;  4IWO A;  5T8I A;  3MHS D;  1E6E B;  4HJK A;  2CKH B;  3U7D A;  2JU6 X;  4WQM A;  2XBB C;  3ZNI D;  1T6B X;  3TIX A;  3AE6 B;  3FAH A;  5E6O A;  1TTN A;  2IO1 B;  1I35 A;  1TBE A;  1C77 A;  4EZL A;  1E7V A;  3Q3M C;  2BWE S;  1P1A A;  3P4S B;  1CJE A;  4RH6 A;  4P1C C;  3W1S A;  3GOE A;  1FNW A;  4WJO A;  1WH3 A;  2IGG A;  3A9J A;  1WE7 A;  1YN4 A;  1V5O A;  2RDH A;  2NTT A;  3UIN B;  2DBY A;  3TJP A;  4EOY A;  4HPP A;  2IO0 B;  5BMG A;  1UWX A;  4DHJ B;  4GOC A;  1WX9 A;  3RNC C;  2E6X A;  3BZD B;  2SAK A;  1RFA A;  1WJ6 A;  3UGB B;  2BYE A;  3M63 B;  4FAD A;  3ZJT A;  2D10 A;  4GB9 A;  2LD9 A;  4RGN A;  2BB5 A;  5IP4 D;  4BKG A;  2AQ2 B;  3R2I A;  2MX2 A;  4XDC A;  1WJU A;  4NAM A;  1FM0 D;  2FBW B;  5EE3 A;  2N1V A;  1ISN A;  2HTM E;  3NVZ A;  3VTW A;  3AE5 B;  1FXA A;  1KTK A;  2L76 A;  3KUC B;  5TSS A;  2OHF A;  2YVC A;  3HVZ A;  1UGM A;  1FO4 A;  2AX5 A;  1EF5 A;  1KH0 A;  1NI3 A;  2RMM A;  2WX1 A;  3PTF C;  3VUW A;  4FXC A;  5JH5 C;  4WJN A;  3IAS 1;  2IBI B;  2IZV B;  2MSE D;  2BF8 B;  4YTN B;  5HKH A;  2AYO B;  4NNJ B;  4WJP A;  3BYY B;  1KRH A;  3Q3J A;  2K5P A;  1JWA D;  1I4X A;  4NJC A;  1I42 A;  2LI5 A;  2MQJ A;  1KLU D;  4DHJ D;  3PZ7 A;  2R2O A;  2K0P A;  2KMA A;  3ML8 A;  2ZJD A;  1UBI A;  3QK0 A;  3VAW A;  4IM2 A;  1JML A;  4KKJ A;  1GB4 A;  2VRR B;  4FJZ A;  1KFY B;  2L3Z A;  4WAA A;  1L6V A;  2CS4 A;  2KQS A;  2I1K A;  2KVZ A;  2M8S A;  2O6V A;  2OJR A;  3H9D A;  3I63 C;  1GC6 A;  1QIL A;  1E8Y A;  1T0R C;  3GE8 C;  2KZR A;  1NBF C;  3Q3F A;  1R4M B;  4IUM B;  3Q8C A;  2BVC A;  2L05 A;  4IW0 A;  4TSS A;  3P4R B;  1V2Y A;  2V3N A;  2MEK A;  1C4P A;  4LJO B;  4MM3 A;  2MJD A;  4KDI C;  2DYM A;  3ONS A;  3H1U A;  1HE8 A;  2IDY A;  3NZS A;  1E0Z A;  1C78 A;  1ZXH A;  5GMV A;  2N9X A;  2WQY B;  2L0T A;  4D2K A;  3NVV A;  2K1F A;  4YSZ B;  3ZRC A;  1E5W A;  1SE2 A;  5TR5 A;  4OVZ A;  5BYQ A;  4LTU A;  3KLS X;  2KJR A;  5AEK B;  2KWD A;  1PGX A;  2BS2 B;  2BBC A;  4MT5 A;  1EU4 A;  1V5T A;  1E9M A;  4K81 A;  4RM8 A;  2RSU A;  3KUZ A;  1D6E C;  1SXT A;  1TS5 A;  2QDF A;  3NOB A;  4DK5 A;  2KTR B;  1TJE A;  2XNA C;  5HG2 A;  3B08 A;  3B1L X;  4C00 A;  4EFO A;  1WX8 A;  2PJH A;  1B1Z A;  2V4I B;  1FFU A;  3DHG C;  4Q2J A;  3W5U B;  3N1Z C;  2INN E;  2E3T A;  1GNU A;  3VDZ A;  2ZCB A;  1V49 A;  2WXJ A;  2D3A A;  5AUI A;  4OHJ A;  1ZUD 2;  1VZ8 A;  3D32 A;  4M00 A;  5BMI A;  2L8J A;  1XQQ A;  3HVD A;  4ZHO A;  3EEC A;  2KAN A;  2W3R A;  4W9I A;  1ET9 A;  3UI3 A;  3LB8 C;  2KTR A;  4B0E A;  1R4N I;  3SU8 X;  3NVY A;  2QIE B;  2A4Z A;  2M19 A;  4J6I A;  1TGZ B;  2L0F A;  4DXA B;  3R3M A;  1SBB B;  3X0W A;  4WQO B;  1A5R A;  3CMM B;  1J8C A;  4OZA A;  1XLP A;  2BQQ A;  4GDK B;  2B76 B;  3AE4 B;  2AL3 A;  4IC7 B;  1SE3 A;  2FCN A;  2IND C;  2UWQ A;  2JRH A;  2W9N A;  4IWQ A;  4F8C B;  1MHH E;  1C1Y B;  2CHW A;  2KT7 A;  2GBJ A;  3B9J A;  5L95 C;  2WWZ A;  3VVW B;  1L0X B;  3PVL A;  2KFK B;  4LNN A;  2A5U A;  2ZNV B;  4EZJ A;  4M8M A;  3KUD B;  2G1E A;  1UZX B;  2WXQ A;  2JWU A;  2BWF A;  1L2N A;  3R2T A;  4HDO A;  3PRZ A;  5IOI A;  2BKF A;  2K39 A;  3VHT C;  4JWS C;  2MJ3 A;  2AWT A;  3NZ3 A;  5H92 C;  1JWB D;  1KLV A;  1EO6 A;  2INP E;  2LRW A;  4PS8 A;  4M02 A;  4L1B A;  1Q10 A;  4LDT B;  5FK9 C;  1WI0 A;  1I4P A;  4YT0 B;  4A6Q A;  1XCT L;  4N9F 4;  2LFI A;  2YEP B;  3DVG Y;  2J0K A;  3WAL A;  3Q8E A;  4XGA B;  5CHF A;  4YTP B;  2RDB C;  2MBE A;  3E56 A;  4WWO A;  2N7E A;  2LHD A;  3RFZ B;  3APF A;  2LJI A;  3T9L A;  3WIM A;  2LGS A;  3MHZ A;  3AU4 A;  2VH1 A;  4ICV A;  4B9K A;  2WGS A;  1VJK A;  2MBH A;  2LWP A;  1SIJ A;  3DWM A;  5EE9 A;  2R61 A;  1LFD A;  1R7S A;  1CQV A;  3RZW C;  1J7B A;  2JXT A;  3P4P B;  3P42 A;  5D7G A;  4AWJ A;  2IGH A;  1V1O A;  3ZDT A;  3MC9 A;  5C3J B;  5BO4 B;  3GZN B;  4EKU A;  2LGX A;  3OJ4 B;  4YTM B;  5I4D A;  3PLU A;  2CHZ A;  1QLB B;  4W9L A;  4JGH B;  4BOS C;  1SF0 A;  4LDT D;  3C19 A;  3Q6B A;  1C3T A;  4NPN A;  1WF9 A;  4IM3 A;  4K7S A;  3VTU A;  1NVI D;  2CJO A;  4ARI A;  3IVF A;  3BK2 A;  1V9J A;  2O2V B;  1YOV B;  3DBS A;  1BUI C;  3RZF A;  2KWU B;  3MJW A;  1P3Q U;  1WGD A;  2D5G A;  4GU2 A;  1GC7 A;  3W1Y A;  1YNT E;  3PS6 A;  4IWP A;  2LVP A;  1KM7 A;  3N1X C;  5AZF A;  2DAJ A;  4TMA B;  4MGZ E;  1ENF A;  5MPO A;  2ZPY A;  2VH2 A;  3AH7 A;  2DEN B;  4YXD B;  3I3T B;  5CHW A;  1PUT A;  2HDE A;  2KC1 A;  5E6N A;  1F52 A;  1WGK A;  3ZJU A;  2D3G A;  2JZ3 B;  2O2V A;  3ABV B;  4A8X C;  1SB3 C;  4P6V F;  3SDL C;  2CR5 A;  2FCS A;  2IO2 B;  1EWY C;  2W54 A;  4S17 A;  4ARC A;  4HEA 1;  3L4P A;  3U52 E;  1P9D U;  3PRM B;  3RUL A;  3FC4 A;  3K9P B;  2WU2 B;  3O13 A;  3PPA A;  4G50 A;  3VUX A;  3W5V B;  4S0R A;  3SD5 A;  1SGH A;  1HTO A;  2EKE C;  5IAA C;  2KDE B;  1UD7 A;  1SIF A;  2DLB A;  4BZA A;  1MG8 A;  3PRE A;  4ZRQ A;  1GUA B;  4OZC A;  1RLF A;  2MCN B;  2GBR A;  5AZG A;  2PW9 A;  2FAZ A;  4ZRP A;  3MFG A;  1CZP A;  1DGJ A;  2NBU A;  1JAL A;  1YJJ A;  4KSK C;  4ZDV A;  3KQ4 A;  1NI2 A;  2DZK A;  2KD0 A;  3AE2 B;  3T3O A;  4GMV A;  3CWI A;  4MJS B;  4YL8 A;  5AUK A;  3VXW A;  4LLG M;  4XDD A;  2KJ6 A;  1DOY A;  5FR6 A;  1VRA B;  3NJT A;  2C60 A;  4BKT A;  1Y8R C;  4A20 A;  2D07 B;  2KNB A;  2DX5 B;  2PE9 A;  3WCQ A;  4XX5 A;  2KX3 A;  4RFB A;  3UIP B;  2BYF A;  4RNA A;  5E6P A;  1FCC C;  2HJ1 A;  3U2S C;  3A9J B;  2KX0 A;  4KGS A;  4FA6 A;  3Q14 C;  4BBN F;  2JZZ A;  3VRB B;  4HLE A;  4PYU A;  2MW5 A;  1WM3 A;  1XD3 B;  3IXS A;  1TS2 A;  2HTH A;  1KLG D;  1L0Y B;  3DBR I;  4MJS A;  2KDF B;  4CHK A;  2ZVN A;  4ITK A;  2QMT A;  1BT0 A;  3U7Z A;  1F77 A;  1C76 A;  5J17 A;  4ANU A;  1PGB A;  1ZKH A;  4URK A;  2JT4 B;  2PE6 B;  2NBV B;  2WU5 B;  1JRO A;  3EFU A;  1T5X D;  1WRD B;  3WA0 A;  2LXC A;  2R2Q A;  2G4D B;  1F9J A;  2KO3 A;  4JL9 A;  2DHZ A;  4HCN B;  2DWQ A;  2J52 A;  3PZD A;  4KVG B;  1YJI A;  4B6W A;  2KVR A;  4KKI A;  3AEC B;  1L4D B;  3GS2 A;  2GBK A;  3LYY A;  1H4R A;  1KOT A;  1K51 A;  1N60 A;  4BBN C;  1YQ3 B;  3M62 B;  4GIV A;  3TUO A;  2KC2 A;  4RMA A;  3CIR B;  3NZU A;  1ESF A;  2L00 B;  4E74 A;  1MI0 A;  3LXF A;  1MG4 A;  2JRI B;  4ANX A;  2JZP A;  3DVG X;  4FLH A;  1EUV B;  1N5W A;  4NZL B;  4DDG D;  1D5X C;  1D5M C;  3AEF B;  2D3B A;  4DHZ B;  3JSV B;  2KMC A;  3RN9 C;  2RR9 A;  2LRU A;  4BKS A;  3ZRF A;  2GB1 A;  2AL6 A;  1T0Q C;  4NJ7 A;  4A55 A;  2JYE A;  3DDC B;  2FUG 1;  1K53 A;  3L10 B;  3ZTC A;  1ACC A;  1J7C A;  4M01 A;  1E90 A;  4LK0 M;  1Z5S B;  2K3U A;  2LEK A;  3VR9 B;  3DHH C;  2L1A A;  3NRZ A;  2O6V B;  4KIK A;  2WXK A;  1EF1 A;  3HRD D;  3APD A;  2FNJ B;  2WDT B;  5BYR A;  3V60 A;  3JSV A;  3RNF C;  3DVN U;  1Q0W B;  1QF6 A;  2LVQ A;  2KN5 A;  2BYV E;  4MM3 B;  2W3S A;  3M95 A;  2QSD A;  1IBX B;  1LQB A;  1BML C;  2PKO A;  1LM8 B;  5JHA A;  1JWU D;  1UH6 A;  4KDL B;  1XF5 L;  3MC8 A;  4M0W B;  1AWD A;  2OED A;  3Q69 A;  4PT5 A;  3FIL B;  2ZCC A;  1JWS D;  1TKG A;  1HQR D;  1B9R A;  2AQ3 B;  3MP9 A;  3ZYY X;  2IJ0 A;  1JRU A;  3U4E G;  1HA5 A;  1XLQ A;  2IY1 B;  3EUB 2;  3NUH B;  2K6Q A;  3QX1 A;  2NR2 A;  4XC2 A;  3TBL D;  4NY0 A;  4PYZ A;  3ENE A;  1IBX A;  2JPH A;  2GLS A;  1XXG A;  1ZDX A;  2N4F A;  4GSW A;  1VR9 A;  2Q5W D;  4M0W A;  2V3P A;  3IBE A;  2QJL A;  3VH3 B;  3FIL A;  4C4V B;  1YX5 B;  2IY0 B;  2KHW B;  5G55 A;  2O6V D;  4CO7 A;  2BTE A;  4MGY E;  3TEW A;  2KYW A;  2BGF A;  5LLI A;  4FHJ A;  4FJY A;  2GI9 A;  5H8Y E;  1AW7 A;  2WP9 B;  2KAJ A;  5C1Z A;  2G3Q B;  4CYE A;  4W9C A;  3BYT B;  3VFK A;  5BMH A;  2KXJ A;  1RM6 C;  2J42 A;  2MWS B;  1MVK A;  4I6N B;  2LAS A;  3AED B;  1D5Z C;  3W9C B;  2MP2 B;  1VD2 A;  3QCA A;  4RM9 A;  4C4V A;  4FN2 A;  2CU3 A;  3RMK C;  3X23 A;  5IKC M;  1JWM D;  1Q1O A;  3APC A;  2Z0E B;  1N5X A;  2KWC A;  1ZXI A;  5GXG B;  3V61 A;  4JX1 C;  3ZGZ A;  4YSX B;  2V0G A;  1YD8 U;  2KDI A;  3LJ3 A;  1YN5 A;  4NQK E;  3NS8 A;  1WGG A;  3GP7 A;  4XYC A;  4CQN A;  2K22 A;  1EWC A;  1IPG A;  2MP2 A;  1CK1 A;  2L7R A;  3ZXV A;  4WWM A;  4ZYS A;  1RWS A;  2C5L C;  1I4G A;  2AQ1 B;  2NPT B;  1J0G A;  2HD5 B;  4US8 A;  2K25 A;  2QCZ A;  3ZJV A;  4DHZ E;  4K3B A;  3EFC A;  4P7I A;  2H89 B;  3C0R B;  4REZ A;  4IKG A;  2PVG C;  4P1B C;  1V6E A;  1VDV A;  1D3Z A;  2FID A;  4LJP B;  3CST A;  3DQV A;  5FKA C;  1E8W A;  4C7Y A;  1UGJ A;  1E7P B;  4E71 A;  3IT6 B;  1LO5 D;  1TIF A;  2NPT A;  3U8Z A;  3L13 A;  5DCN A;  4KX6 B;  1L6U A;  2I1J A;  4WWP A;  2BS4 B;  2Y5C A;  2LMC A;  4XE0 A;  4GGQ A;  2BPS A;  1FPY A;  2DAF A;  4HWI B;  4W9F A;  2C7N B;  2KAC A;  2DZM A;  3H7S A;  1IP9 A;  2WDQ B;  3SHQ A;  2WXM A;  1J19 A;  1NEK B;  3TEY A;  1TZO A;  1IGC A;  1LXD A;  3PO0 A;  3OWE B;  2LUM A;  4YSY B;  2PPH A;  1FMA D;  4IG7 B;  5L83 A;  2EEL A;  4M8N A;  3UF8 A;  2N7D A;  1SJE D;  4JIO U;  3NG0 A;  2Z0D B;  3K9O B;  2BS3 B;  4HRO A;  4EZK A;  1HZ6 A;  2NVU I;  1PGA A;  2J7Q B;  3BWU D;  5CHV C;  2FCM A;  5D6J B;  3AMZ A;  4ANV A;  3KVF B;  1AN8 A;  1N63 A;  4DXF A;  3L17 A;  1YJ1 A;  5C23 A;  1AYF A;  3Q2A C;  3MTN B;  1I4H A;  2N0S B;  1JCK B;  4MGI E;  5D2M B;  2QEJ C;  4NQL B;  4A9A A;  2DYO A;  3AI5 A;  2KQ4 X;  2N1W A;  2OJW A;  4LNF A;  5G5G A;  2Y5B B;  2XK5 B;  3AE7 B;  1PQS A;  2L83 A;  3AE8 B;  3H8H A;  2DYB A;  4RF1 A;  3PGE A;  2MJE A;  3N32 A;  2G9H D;  2GOW A;  1WE6 A;  1C79 A;  1WYW B;  2ASQ A;  3OG5 A;  1YN3 A;  2BW2 A;  2GMI C;  5DPW A;  5D3I B;  1CMX B;  3SFD B;  2PVO D;  4LCD E;  3JW0 X;  1HTQ A;  4N6E B;  2UYZ B;  1L0V B;  2V9H A;  1S3S G;  1V8C A;  2ZW1 A;  1UBQ A;  2XK5 A;  2WXR A;  4G11 A;  4AP4 C;  5IA7 A;  1FRR A;  1PFD A;  3P63 A;  2K9X A;  2SEB D;  1G6J A;  2FE8 A;  3A33 B;  2H88 B;  1PYW D;  2PEA A;  2BKR B;  4MSM B;  3ML9 A;  4WH4 A;  5AZH A;  2BT6 A;  4FUL A;  1TKE A;  1WM2 A;  3OLM D;  2V4L A;  3KH0 A;  1WY8 A;  2X8X X;  3A4S C;  3QIJ A;  1M94 A;  3WAO A;  2M0X A;  3BVM A;  3QA8 A;  3HM6 X;  3AE1 B;  2VZK B;  2ZVO A;  2LGD A;  1R4M I;  2WYQ A;  3TCA A;  3H6N A;  2DNF A;  4OZB A;  2EKI A;  1WGR A;  3QJZ A;  2N9P C;  1TYG B;  1FNU A;  2KDM A;  3S2A A;  1SSN A;  2IGD A;  3SR6 A;  1V1P A;  2N7J A;  1AAR A;  3RPF C;  1L5P A;  3IT4 B;  2JXX A;  1TKY A;  3JYU A;  1FIQ A;  3QAQ A;  2ZZP B;  1XT9 B;  1NYR A;  4IOI E;  3QWZ B;  2X38 A;  1FEH A;  1HXY D;  1WXS A;  1TY2 A;  1Z2M A;  4IDI A;  1F1H A;  1WSP A;  3HK0 A;  4US9 A;  4C56 C;  1J7A A;  3AB5 A;  5DPS A;  5IN7 A;  3Q3O C;  2LUE A;  1ZP0 B;  3AN1 A;  5J18 A;  3ZO5 B;  4DBG A;  3OAW A;  2K6D B;  4P16 A;  2QC8 A;  1P0R A;  3VTV A;  2KTF A;  1QOG A;  3PV1 A;  1E10 A;  4EEW A;  3KWL A;  2J53 A;  1ZW7 A;  3IHP C;  1R4N B;  5EE0 A;  3RNB C;  1QOA A;  2MBB B;  2MRP A;  3N20 C;  3ZNZ B;  3UQA A;  1E8Z A;  3VRA B;  1QOF A;  1WWT A;  1T0S C;  1WXM A;  1GAQ B;  3DWG C;  2RPV A;  2UU7 A;  3I57 A;  3EHV A;  1YIW A;  5JXV A;  2VZK D;  4N58 A;  3RNA C;  3AEA B;  3B2F A;  4W9H A;  4A90 A;  3CF6 E;  3HIZ A;  3KWV A;  2IO3 B;  3RYT A;  4JWU C;  4EE2 A;  4MH0 E;  2RGF A;  2KK8 A;  2WDR B;  3ZTD A;  1QKZ A;  3ZXR A;  1ZGU B;  4ASW C;  1N6Z A;  2L32 A;  1VLB A;  1WGH A;  3Q8B A;  2LZ6 A;  3IG3 A;  5IO9 A;  1OEY J;  3ZLZ A;  2D2Q A;  4B95 A;  1K50 A;  2EMT A;  2QHO A;  4USA A;  3BII D;  4GN1 A;  3PHX B;  3PRP B;  3UIO B;  3PLV A;  3MC0 B;  3A4R A;  3ZQ4 A;  3AE9 B;  3V05 A;  3VQI A;  2I38 A;  1MFW A;  2YEP F;  1JRP A;  1U4A A;  4GDL B;  2WX0 A;  4WIP A;  2J0J A;  4PS3 A;  3Q8F A;  3T8M A;  5BYS A;  5DPR A;  3PT2 B;  3NY5 A;  4DWF A;  4K7W A;  3KW5 B;  2JYT A;  2ZNV C;  4W9D A;  1XEE A;  3BK1 A;  2DZJ A;  2KN4 A;  4E3C A;  3CSF A;  3ZKJ C;  1WZ3 A;  4HPL B;  1D4B A;  2WNM A;  1TY0 A;  3VH4 B;  4K7U A;  1FXI A;  3ZDM C;  2MA9 B;  1HEZ E;  3L08 A;  3TEX A;  3HM3 A;  2WXO A;  3WAP A;  1WJ4 A;  1N62 A;  2LJ5 A;  4GDL A;  1UWM A;  2NS5 A;  2BB6 A;  3I5J C;  4KIK B;  3PZ8 A;  1YX6 B;  1XLN A;  4II3 B;  2G4S A;  4ZYN A;  2BYT A;  1I4R A;  1WZ0 A;  1UEL A;  1YQ4 B;  2W55 A;  2Z59 B;  2C9W B;  2MHJ A;  3DPD A;  4LNI A;  3AEE B;  1WJN A;  4KZC A;  3BIN A;  2OOB B;  3NHE B;  4FBJ B;  2K8B A;  3PHW B;  1TS3 A;  5LXH A;  1I7H A;  3HHM A;  2HJ8 A;  4G0N B;  2PLP A;  3PSE B;  3J9C A;  1P7E A;  1WXV A;  3EC8 A;  3QHT A;  2CJN A;  2M1M A;  3B0A A;  2ACZ B;  1RFK A;  4HK2 A;  3RUI B;  1C9F A;  3ZNH B;  2NBW B;  2AEH A;  2PMV A;  4ZOH C;  3GB1 A;  4BKS D;  2JUO A;  3HUI A;  1OFF A;  3P4Q B;  4RGT A;  3EGR A;  5D3D A;  5D94 A;  4C80 A;  2NCN A;  3GZN I;  2LHE A;  3DVN V;  3DBH I;  4K1R B;  1RYJ A;  4JPS A;  1PDX A;  2ZW0 A;  2WXH A;  1WXA A;  2RPQ A;  1ZOY B;  3Q8A A;  3ECI A;  4HJG E;  2JF5 A;  1P7F A;  3JVZ X;  3IFW B;  3O65 B;  4W9E A;  1ET6 A;  3AXC A;  4GXB A;  3H7P B;  1LGR A;  5C2T B;  1WXQ A;  2FIF A;  2M0A A;  2W82 A;  1WX7 A;  4XWT A;  4TUU A;  1WYG A;  4HXD A;  4AOF A;  1MHX A;  3EA6 A;  2GRI A;  1QT9 A;  4WAF A;  3BVZ A;  4HKZ E;  2IYD B;  3N30 A;  4HDQ A;  4W9J A;  4G3X B;  3N9Y C;  4F1S A;  2KOX A;  3P2B A;  3ETR A;  4MSQ B;  4MEL A;  2B3A A;  3V6C B;  5LXI B;  3UQB A;  3R8B A;  4TQ1 A;  2WS3 B;  1T0Y A;  3H7P A;  1OTR B;  2KJH B;  2WXI A;  5CTR C;  3U30 A;  3BY4 B;  1WIA A;  3SFE B;  1H8C A;  3ZIM A;  4OVV A;  4L23 A;  1K52 A;  5EDS A;  2WXF A;  3A9K B;  4NJ6 A;  4MEM A;  1OQY A;  2PIA A;  4X57 B;  4AS1 A;  1N61 A;  3IAM 1;  4II2 B;  4TQ0 A;  2DZI A;  2XEW A;  2Y3A A;  3RI7 C;  2GBN A;  1YMH E;  4UDU C;  1V86 A;  1QQR A;  1WR6 E;  2NMQ A;  2GBM A;  3N1Y C;  3RNG C;  4HKQ A;  2N9K A;  4KGR A;  3DOW A;  1VZ7 A;  2JY6 A;  4DQO C;  3QQ8 B;  3TEZ A;  1XCQ L;  3URY A;  4W9K A;  5CX3 A;  3V62 A;  4FHK A;  1QZE A;  1FXT B;  1T3Q A;  5KHO A;  3A9K A;  3DBL I;  4L2Y A;  4QAY A;  1EU3 A;  3LDZ E;  2REX A;  4A3P A;  1TS4 A;  2PTL A;  3M3J A;  1RAX A;  4MAC A;  1UNS A;  1L4Z B;  3DBR B;  4RGO S;  4AJW A;  1UUP A;  3AEG B;  5FR3 A;  2KLC A;  1HZ5 A;  4ANW A;  4MDK E;  4R3D A;  2CU1 A;  2QIL A;  4WUR A;  4N59 A;  3W1S C;  4ZRI A;  3SEB A;  2Z8L A;  2MLB A;  3AV8 A;  2C7H A;  5G2N A;  1XO3 A;  3WAN A;  1WGY A;  1IUE A;  2IPK D;  3WAM A;  4JLC A;  2KKC A;  1FD6 A;  4XWW A;  2JVC A;  2ZPN A;  1JQ4 A;  1Q5W B;  3RT3 B;  1KJT A;  1RRB A;  4GDK A;  1YQB A;  4OVU A;  4J3O D;  3AE3 B;  3VR8 B;  4EUT A;  3ZW3 A;  2RDG A;  1F2R I;  3R66 C;  2INC C;  3RNE C;  4DDI D;  3AUL A;  1OQQ A;  1GB1 A;  2ON8 A;  4B0M A;  1F2R C;  3TSS A;  1STE A;  4DXG A;  2MH7 A;  2KFK A;  4HVB A;  1S1Q B;  4F7Z A;  1WMH B;  1VZ6 A;  2K8C A;  1FRD A;  4HCP B;  2KLG A;  1ZPS A;  5J2R A;  1C4A A;  1BXT A;  4YWG G;  3B2G A;  4HRS A;  3OJ3 A;  2FUH B;  4ICU A;  1F0Z A;  4KV2 A;  2JX5 A;  1DOI A;  1GOZ A;  2V3S A;  1SEB D;  3DHI C;  4ZRJ A;  2KQ7 A;  1DOX A;  1A70 A;  2K8H A;  2YLM A;  2MBO A;  2JSV X;  2EMS A;  4RCO A;  1WMH A;  3ALB A;  2ONQ A;  3A1Q B;  5DPT A;  4KGT A;  4KSL C;  3R7R A;  5HFY A;  5JZE B;  1NEN B;  1I4Q A;  3KYD D;  1NDD A;  2LGI A;  2WLB A;  4PS7 A;  2ZEQ A;  1K8R B;  4WJQ A;  3I9V 1;  2HE7 A;  3C8Y A;  2JWZ A;  2C7M B;  3ZNG C;  2WXN A;  1KF6 B;  4FJV B;  4O1N A;  2J4X A;  1E7U A;  3DBH B;  1E8X A;  4ZRK A;  3FKY A;  1TT5 B;  2KWV B; 
#chains in the Genus database with same CATH homology
 1ZGU B;  2AL3 A;  3A1Q A;  4IC7 B;  4ASW C;  1LQB A;  4HPM B;  3RCZ A;  4A3O A;  1LM8 B;  2FCN A;  5JHA A;  4JQW C;  4XZ4 A;  3ZVV A;  2UWQ A;  1UH6 A;  1WGH A;  2JRH A;  4KDL B;  2LZ6 A;  1WFY A;  3IG3 A;  4M0W B;  3V6E B;  2W9N A;  4IWQ A;  2D11 A;  1OEY J;  4F8C B;  1C1Y B;  2CHW A;  4IM0 A;  2GBJ A;  2ZCC A;  3ZLZ A;  5L95 C;  2D2Q A;  4B95 A;  2M17 A;  2WWZ A;  4W9G A;  3VVW B;  2EMT A;  3PVL A;  2KFK B;  2QHO A;  2A5U A;  4GN1 A;  3PHX B;  3PRP B;  4BVU C;  2ZNV B;  3UIO B;  1JRU A;  4EZJ A;  5JHB A;  3PLV A;  3TL5 A;  2IY1 B;  4M8M A;  5KHQ A;  2MBQ A;  3KUD B;  1GJZ A;  2K6Q A;  3QX1 A;  1UZX B;  3A4R A;  2BWF A;  2NR2 A;  4XC2 A;  3TBL D;  1X1M A;  1V80 A;  3VQI A;  1L2N A;  4NY0 A;  4PYZ A;  3ENE A;  4HDO A;  1U4A A;  3PRZ A;  2WX0 A;  4GDL B;  2J0J A;  4PS3 A;  4TV3 A;  3TMP B;  2JPH A;  3T8M A;  2BKF A;  2CHX A;  2K39 A;  2KDB A;  2N4F A;  5DPR A;  4GSW A;  3PT2 B;  4AJY B;  3NY5 A;  3VHT C;  4DWF A;  1V81 A;  3L0W B;  3RD2 A;  3L54 A;  4K7W A;  2AWT A;  2M4N A;  3KW5 B;  3IBE A;  1KLV A;  1EO6 A;  3QAR A;  2LRW A;  2ZNV C;  4PS8 A;  4TKN A;  4W9D A;  2FCQ A;  3VH3 B;  2DZJ A;  1YX5 B;  2IY0 B;  2KHW B;  5G55 A;  4E3C A;  2O6V D;  3CSF A;  4CO7 A;  4LDT B;  2J0M A;  1WI0 A;  2V1Y A;  3R7Q A;  4MGY E;  3ZKJ C;  1WZ3 A;  4HPL B;  2G45 B;  4N9F 4;  3VH4 B;  4K7U A;  3ZDM C;  2MA9 B;  2BGF A;  3DVG Y;  3DCG A;  5LLI A;  3L08 A;  3L16 A;  2J0K A;  3WAL A;  3HM3 A;  4FHJ A;  4FJY A;  3WAP A;  1WJ4 A;  5CHF A;  5C1Z A;  2LJ5 A;  2MBE A;  2G3Q B;  4CYE A;  4W9C A;  4GDL A;  1OEY A;  4WWO A;  2N7E A;  2LGY A;  1P98 A;  2NS5 A;  3VFK A;  3APF A;  4KIK B;  3T9L A;  2KXJ A;  2MWS B;  4I6N B;  4MGK E;  3WIM A;  2LAS A;  1YX6 B;  3AU4 A;  4II3 B;  4ICV A;  4B9K A;  2LVO A;  2MP2 B;  1VD2 A;  3QCA A;  4RM9 A;  2G4S A;  4ZYN A;  2MBH A;  4FN2 A;  2LWP A;  1WZ0 A;  1UEL A;  4I6L B;  4NAW B;  3X23 A;  2KFJ A;  1Q1O A;  3APC A;  2Z0E B;  4AUQ C;  2Z59 B;  1L7Y A;  2C9W B;  1LFD A;  4BFR A;  2KWC A;  3DPD A;  3QC8 B;  1WJN A;  4KZC A;  2LXA A;  3BIN A;  2OOB B;  3KYC D;  3NHE B;  4FBJ B;  2K8B A;  3V61 A;  3RZW C;  3PHW B;  1YD8 U;  2KDI A;  5LXH A;  5D7G A;  3LJ3 A;  3HHM A;  3AU5 A;  2HJ8 A;  4G0N B;  4NQK E;  4AWJ A;  4BOZ B;  1TZ1 A;  3PSE B;  3NS8 A;  3N3K B;  1WGG A;  1WXV A;  3ZDT A;  3EC8 A;  1SE9 A;  4WWN A;  3QHT A;  1IPG A;  2MP2 A;  5BO4 B;  4EKU A;  4KZ0 A;  3VUY A;  2L7R A;  2M1M A;  2LGX A;  2RD0 A;  1OGW A;  3B0A A;  3OJ4 B;  1GG3 A;  1VCB A;  3ZUN A;  4NAW A;  3PLU A;  2CHZ A;  2C5L C;  2NPT B;  1WR1 A;  4HK2 A;  2N9E B;  4I6P A;  2HD5 B;  3RUI B;  2NBW B;  2AEH A;  3ZNH B;  4BKS D;  1J0G A;  4W9L A;  4JGH B;  1IYF A;  4BOS C;  2JUO A;  2K25 A;  4LDT D;  4DHZ E;  5D94 A;  2NCN A;  3GZN I;  4P7I A;  3DVN V;  3DBH I;  4IWO A;  3C0R B;  3MHS D;  4K1R B;  4NPN A;  1C3T A;  4HJK A;  1WF9 A;  4IM3 A;  4K7S A;  2CKH B;  3VTU A;  3U7D A;  3IVF A;  1V6E A;  1WXA A;  2XBB C;  2RPQ A;  1D3Z A;  3ZNI D;  2FID A;  3ECI A;  1V9J A;  4LJP B;  3TIX A;  3CST A;  3DQV A;  2O2V B;  5E6O A;  1E8W A;  2JF5 A;  1TTN A;  2IO1 B;  1I35 A;  3DBS A;  1TBE A;  3JVZ X;  3IFW B;  3O65 B;  3RZF A;  2KWU B;  4E71 A;  3MJW A;  4W9E A;  1P3Q U;  1WGD A;  3AXC A;  4GU2 A;  2NPT A;  4GXB A;  3U8Z A;  1GC7 A;  3W1Y A;  3H7P B;  4EZL A;  3L13 A;  3PS6 A;  4IWP A;  5DCN A;  2FIF A;  2LVP A;  1KM7 A;  1E7V A;  2BWE S;  1WX7 A;  1P1A A;  5AZF A;  2DAJ A;  2I1J A;  3W1S A;  4WWP A;  3GOE A;  4MGZ E;  4TUU A;  4WJO A;  1WH3 A;  4HXD A;  4AOF A;  4GGQ A;  2ZPY A;  2BPS A;  3A9J A;  1WE7 A;  2DEN B;  1V5O A;  2IYD B;  2DAF A;  4HWI B;  3N30 A;  3I3T B;  4W9F A;  4HDQ A;  5CHW A;  3UIN B;  4W9J A;  2C7N B;  2KC1 A;  2DZM A;  5E6N A;  3TJP A;  4G3X B;  4EOY A;  3H7S A;  4F1S A;  2KOX A;  2IO0 B;  3P2B A;  1IP9 A;  4DHJ B;  2D3G A;  2JZ3 B;  2O2V A;  4GOC A;  1WX9 A;  4MSQ B;  4MEL A;  2B3A A;  3SHQ A;  3V6C B;  1J19 A;  5LXI B;  3SDL C;  3UQB A;  2CR5 A;  4TQ1 A;  1LXD A;  1RFA A;  2FCS A;  2IO2 B;  1WJ6 A;  1T0Y A;  3H7P A;  3UGB B;  1OTR B;  2BYE A;  3M63 B;  4FAD A;  2KJH B;  2D10 A;  2PPH A;  4IG7 B;  5L83 A;  5CTR C;  4GB9 A;  4M8N A;  3UF8 A;  2LD9 A;  1P9D U;  3PRM B;  3RUL A;  2N7D A;  3U30 A;  3BY4 B;  3K9P B;  1WIA A;  4BKG A;  3PPA A;  4G50 A;  1H8C A;  3ZIM A;  4JIO U;  4OVV A;  3VUX A;  5EDS A;  3SD5 A;  2Z0D B;  1SGH A;  2MX2 A;  3K9O B;  1WJU A;  3A9K B;  4NJ6 A;  4MEM A;  4EZK A;  1OQY A;  4X57 B;  2NVU I;  2EKE C;  2J7Q B;  2N1V A;  5IAA C;  5CHV C;  2FCM A;  5D6J B;  1ISN A;  2KDE B;  4ANV A;  1UD7 A;  4II2 B;  4TQ0 A;  3KVF B;  1SIF A;  2DZI A;  2XEW A;  1MG8 A;  3L17 A;  3PRE A;  3VTW A;  1YJ1 A;  5C23 A;  1GUA B;  1RLF A;  2GBN A;  3MTN B;  1V86 A;  4MGI E;  1WR6 E;  5D2M B;  2L76 A;  3KUC B;  2MCN B;  2GBM A;  2GBR A;  5AZG A;  4NQL B;  2YVC A;  2FAZ A;  1UGM A;  2DYO A;  3DOW A;  2JY6 A;  3AI5 A;  2N1W A;  3QQ8 B;  2NBU A;  1EF5 A;  4KSK C;  2Y5B B;  2WX1 A;  4ZDV A;  2XK5 B;  3PTF C;  1NI2 A;  4W9K A;  3VUW A;  2DZK A;  4WJN A;  5JH5 C;  2KD0 A;  5CX3 A;  3V62 A;  2IBI B;  1PQS A;  2IZV B;  4FHK A;  1QZE A;  1FXT B;  2MSE D;  2BF8 B;  2DYB A;  5HKH A;  2AYO B;  4NNJ B;  4WJP A;  5KHO A;  3A9K A;  3PGE A;  3N32 A;  3DBL I;  4GMV A;  2GOW A;  3Q3J A;  1WE6 A;  4MJS B;  4YL8 A;  3VXW A;  3LDZ E;  1WYW B;  2REX A;  1I42 A;  2LI5 A;  2KJ6 A;  2ASQ A;  4A3P A;  5FR6 A;  2MQJ A;  2C60 A;  4BKT A;  1Y8R C;  2GMI C;  4A20 A;  2D07 B;  5DPW A;  2KNB A;  2DX5 B;  4DHJ D;  2PE9 A;  1CMX B;  4LCD E;  3M3J A;  4XX5 A;  2KX3 A;  3JW0 X;  3UIP B;  2BYF A;  1RAX A;  5E6P A;  2R2O A;  2KMA A;  2UYZ B;  3ML8 A;  4AJW A;  1S3S G;  2ZJD A;  2KX0 A;  1UBI A;  3A9J B;  3QK0 A;  3VAW A;  4IM2 A;  1UBQ A;  2XK5 A;  2KLC A;  4FA6 A;  4G11 A;  4ANW A;  4AP4 C;  4MDK E;  4BBN F;  2JZZ A;  2CU1 A;  5IA7 A;  4HLE A;  2VRR B;  4FJZ A;  4PYU A;  2L3Z A;  4WAA A;  2MW5 A;  1WM3 A;  1XD3 B;  2CS4 A;  2HTH A;  3DBR I;  4MJS A;  1G6J A;  3A33 B;  3W1S C;  2KQS A;  4ZRI A;  2KDF B;  4CHK A;  2MLB A;  2ZVN A;  2I1K A;  2PEA A;  2BKR B;  2C7H A;  2M8S A;  5G2N A;  2O6V A;  4MSM B;  2OJR A;  3H9D A;  1BT0 A;  3WAN A;  1WGY A;  1GC6 A;  3ML9 A;  5J17 A;  1E8Y A;  3WAM A;  4ANU A;  5AZH A;  2KZR A;  1NBF C;  1ZKH A;  3Q3F A;  4FUL A;  2KKC A;  4JLC A;  4URK A;  2JT4 B;  4IUM B;  2PE6 B;  2NBV B;  1WM2 A;  3OLM D;  2L05 A;  2JVC A;  4IW0 A;  2V4L A;  1V2Y A;  3EFU A;  1WY8 A;  3KH0 A;  1WRD B;  2ZPN A;  3WA0 A;  2LXC A;  4LJO B;  2R2Q A;  2G4D B;  1Q5W B;  1F9J A;  3A4S C;  3QIJ A;  1M94 A;  3RT3 B;  2KO3 A;  3WAO A;  1KJT A;  1RRB A;  4MM3 A;  4GDK A;  4JL9 A;  2M0X A;  1YQB A;  2DHZ A;  4OVU A;  3QA8 A;  4KDI C;  2DYM A;  3HM6 X;  4HCN B;  3ONS A;  3H1U A;  1HE8 A;  2ZVO A;  2LGD A;  1R4M I;  3NZS A;  3PZD A;  4EUT A;  4KVG B;  3ZW3 A;  2WYQ A;  3TCA A;  3H6N A;  3R66 C;  2KVR A;  4B6W A;  3QJZ A;  1WGR A;  2N9P C;  5GMV A;  4DDI D;  3AUL A;  2N9X A;  2GBK A;  1H4R A;  2L0T A;  3S2A A;  1KOT A;  2K1F A;  3ZRC A;  4BBN C;  1E5W A;  1AAR A;  2KFK A;  5TR5 A;  1S1Q B;  3M62 B;  4F7Z A;  4GIV A;  2JXX A;  1WMH B;  3JYU A;  4HVB A;  2K8C A;  3QAQ A;  2ZZP B;  4HCP B;  1XT9 B;  2KC2 A;  2KJR A;  4RMA A;  5AEK B;  2KLG A;  5J2R A;  3NZU A;  3QWZ B;  1WXS A;  2L00 B;  4E74 A;  1Z2M A;  3HK0 A;  3OJ3 A;  2FUH B;  4ICU A;  2JRI B;  4ANX A;  1V5T A;  4KV2 A;  4K81 A;  4RM8 A;  2RSU A;  5DPS A;  3KUZ A;  3NOB A;  4DK5 A;  2KTR B;  2LUE A;  3DVG X;  2V3S A;  5J18 A;  3ZO5 B;  3B08 A;  4DBG A;  4FLH A;  3B1L X;  4ZRJ A;  4EFO A;  1WX8 A;  1EUV B;  2K6D B;  2KQ7 A;  3OAW A;  2PJH A;  4DDG D;  1P0R A;  2K8H A;  2YLM A;  3VTV A;  2MBO A;  3JSV B;  2KMC A;  4DHZ B;  2KTF A;  2LRU A;  2RR9 A;  3PV1 A;  3ZRF A;  4BKS A;  4EEW A;  2AL6 A;  2EMS A;  1GNU A;  3VDZ A;  2ZCB A;  1V49 A;  1ZW7 A;  3IHP C;  4NJ7 A;  1WMH A;  3DDC B;  3ALB A;  2MBB B;  3L10 B;  3A1Q B;  3ZTC A;  2MRP A;  5DPT A;  3D32 A;  4KSL C;  3R7R A;  3ZNZ B;  3UQA A;  5JZE B;  1E8Z A;  1E90 A;  2L8J A;  1XQQ A;  1WXM A;  3KYD D;  1Z5S B;  1NDD A;  3EEC A;  2KAN A;  4PS7 A;  2ZEQ A;  4W9I A;  1K8R B;  2O6V B;  4WJQ A;  3EHV A;  2KTR A;  1YIW A;  1R4N I;  2HE7 A;  4KIK A;  1EF1 A;  3SU8 X;  2JWZ A;  2C7M B;  3ZNG C;  2A4Z A;  3APD A;  4J6I A;  1TGZ B;  2L0F A;  2FNJ B;  2WDT B;  4DXA B;  4FJV B;  4W9H A;  3R3M A;  3V60 A;  3CF6 E;  3HIZ A;  3JSV A;  1E7U A;  2IO3 B;  3DVN U;  1E8X A;  3RYT A;  1Q0W B;  4ZRK A;  3X0W A;  4WQO B;  1A5R A;  4MH0 E;  2RGF A;  2KK8 A;  2LVQ A;  3CMM B;  2KN5 A;  2BYV E;  3ZTD A;  1J8C A;  4GDK B;  3M95 A;  2KWV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...