2CR5A

Solution structure of the ubx domain of d0h8s2298e protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
109
structure length
109
Chain Sequence
b'GSSGSSGEVPDLPEEPSETAEEVVTVALRCPNGRVLRRRFFKSWNSQVLLDWMMKVGYHKSLYRLSTSFPRRALEVEGGSSLEDIGITVDTVLNVEEKEQSSQSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reproduction 8
publication title Solution structure of the UBX domain of D0H8S2298E protein
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 10
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00789 UBX UBX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2cr5A01
2C7NB 1U4AA 2IO1B 2L8JA 4LDTB 2MX2A 4WJNA 4GN1A 4IW0A 4WJOA 3Q3JA 2CR5A 3PPAA 3H7SA 2D3GA 2IYDB 3A4SC 3QC8B 4MEMA 3TL5A 4WWNA 5E6OA 2MBBB 2M4NA 4FN2A 2LXCA 2WYQA 4G50A 2HTHA 4IWOA 4CO7A 1V86A 2MWSB 2JPHA 5FR6A 3VVWB 2AL6A 3IFWB 5CTRC 3VFKA 3ZLZA 4HJKA 4NPNA 3A9JB 2N1VA 4E74A 4BOSC 2K8BA 2DYBA 2L7RA 1WR6E 3QHTA 2J0JA 4CYEA 3H9DA 3JVZX 1RAXA 2C60A 2N9EB 1EO6A 2KFKA 2KC2A 4DBGA 3AXCA 1ZW7A 3VUWA 3UIOB 2LGDA 2GBKA 4AJWA 3I3TB 3CSTA 3R7QA 2NPTA 4MGKE 3NHEB 2JRIB 5J18A 4KDLB 3N30A 4F8CB 2FIDA 3DDCB 4ZDVA 3N3KB 2LGYA 2KQSA 1YD8U 4B9KA 3U30A 4DWFA 3RT3B 3PRMB 2KNBA 3IVFA 3K9PB 1WGGA 3PREA 3T9LA 3VH4B 2KDBA 3WIMA 4YL8A 3X0WA 4W9CA 2OOBB 3WAMA 3UQBA 2KANA 3V61A 2V1YA 2PPHA 1X1MA 2K25A 4PS3A 2VRRB 3M63B 4ANXA 1WJ6A 5TR5A 1OQYA 3QJZA 3R7RA 4KVGB 3ZNHB 4BOZB 4EKUA 4K7UA 4BBNF 4PS7A 2M17A 4AP4C 3ZNID 4II3B 2L0TA 4MH0E 1WE7A 3OJ4B 1YX5B 2KJHB 1WY8A 1WX8A 2KK8A 3JYUA 3VTUA 2KKCA 4DHJD 3APFA 3W1YA 2DHZA 4TQ0A 2KQ7A 3PVLA 2N4FA 4KIKB 2D2QA 2NS5A 3KYDD 2DZKA 5BO4B 3SDLC 3A1QA 2GBRA 3ZNZB 4HVBA 2CHZA 3HIZA 4K7SA 4KSKC 3PHWB 4WQOB 1OEYA 4HXDA 3DVGX 1WIAA 3ZUNA 5D7GA 2GBJA 2K8HA 2ZVOA 3CMMB 2ZNVC 2DENB 2KX0A 3EC8A 3WALA 5KHQA 3ZDTA 1R4MI 4EZJA 4MELA 4M0WB 2KOXA 2JVCA 2K6QA 2RSUA 2O2VA 3DBSA 3PHXB 4G0NB 2A4ZA 3UINB 2J7QB 4WJQA 1H4RA 4HCNB 4AUQC 2AYOB 3NZUA 3SU8X 1RFAA 4FHKA 2KTFA 3HHMA 4IG7B 3TIXA 4II2B 1GUAB 2K8CA 4FBJB 5LLIA 5IA7A 3IBEA 1EF5A 4BKGA 5C23A 2LJ5A 1AARA 5GMVA 3RZWC 4DDID 2MQJA 3JSVA 4NJ6A 2D07B 2LRUA 2FCMA 3H7PA 4NJ7A 2KZRA 3DVNU 4A20A 4W9LA 5C1ZA 1J19A 2RGFA 2GBNA 4PS8A 3PTFC 3U7DA 4LCDE 2EMSA 2KFKB 2JT4B 2D10A 4XX5A 4GIVA 4HLEA 3ZDMC 3ALBA 3PT2B 3RZFA 3SD5A 1WXSA 3L16A 4GDLA 4MGZE 2LZ6A 4EEWA 4AOFA 2NPTB 4KZ0A 1P1AA 3C0RB 1WXAA 4NAWB 1A5RA 1E8ZA 2N7DA 3L08A 1J0GA 1WZ3A 2KN5A 3APCA 4MJSA 3ZRFA 2MCNB 2ZNVB 2LWPA 2UWQA 3AI5A 3HM6X 3QA8A 2EKEC 4TUUA 5DPSA 2MP2A 3VTVA 2M1MA 2CHXA 3L10B 3N32A 1UH6A 2L00B 2LASA 1WZ0A 2KLCA 5L83A 4NY0A 2LUEA 4EUTA 2KFJA 3ZO5B 2FIFA 2FUHB 3V6EB 5DCNA 5CHFA 1RLFA 2BYVE 1E7VA 4XC2A 1P0RA 2HD5B 3QIJA 5AZGA 2LVOA 2IZVB 3U8ZA 3A9KA 4HDQA 5AZHA 1E8WA 3QARA 3DBLI 3EHVA 4W9KA 4DK5A 1GC7A 4MSQB 1WX7A 2CHWA 3BINA 3A1QB 1Q5WB 2DAJA 4K81A 2MA9B 1G6JA 4HWIB 4IM0A 2OJRA 1S3SG 3A33B 5AEKB 4ZYNA 4LJOB 1V5OA 1L7YA 1XD3B 2PE6B 3UIPB 1HE8A 3DOWA 5CX3A 4GDKB 4FLHA 1WRDB 1ZKHA 2O2VB 2ZCCA 2G4DB 4HPLB 3CF6E 2NCNA 1I42A 4IWQA 3TMPB 3PLUA 1WX9A 3DCGA 2N9XA 4A3PA 4TKNA 2XBBC 1J8CA 1VD2A 2JZZA 3W1SA 3V6CB 3QCAA 1WM2A 1LM8B 1WGYA 3JSVB 4OVVA 2NBVB 3H7PB 1KM7A 4DXAB 2KLGA 3PS6A 2KJRA 4RM8A 5J2RA 2QHOA 1WH3A 1C1YB 2HE7A 2BF8B 2WDTB 4MGYE 4WJPA 2IO3B 2MSED 3PZDA 2DYOA 2ZPYA 3O65B 4GU2A 2MBQA 2LD9A 4N9F4 2BPSA 2JXXA 3VAWA 2BKRB 4GDLB 3B1LX 3UF8A 1WJ4A 2KWVB 3ECIA 3JW0X 4KSLC 2NBUA 2ZJDA 1OTRB 1H8CA 3ML9A 3RULA 2LVQA 2LVPA 4F7ZA 1P9DU 4IWPA 4X57B 2KO3A 4MJSB 3KW5B 4ANWA 2MBOA 4I6PA 3ZTCA 4HDOA 3UQAA 3L54A 4HPMB 1FXTB 1CMXB 3W1SC 2MP2B 5DPWA 2JF5A 5D2MB 2KTRA 3MTNB 2GBMA 4ASWC 2BYEA 3AULA 4W9JA 5E6NA 4ANUA 3IHPC 5LXHA 2K1FA 2KDEB 4IUMB 4NNJB 2JY6A 5D6JB 3VHTC 3M3JA 1WJUA 3DQVA 3PSEB 4FADA 4XZ4A 4NQLB 2LRWA 4PYUA 4E71A 3A9KB 1NDDA 1V49A 1Z5SB 2BWES 3X23A 1SGHA 1EUVB 3AU4A 2DYMA 4EZLA 2LGXA 1WFYA 2KD0A 4W9DA 2R2OA 2C9WB 4EZKA 1WGHA 4W9FA 2ZZPB 2J0KA 1ZGUB 2ZEQA 3UGBB 2MRPA 4JQWC 1F9JA 4EFOA 1XQQA 2GOWA 1V81A 4LDTD 4P7IA 4GXBA 1OEYJ 2PJHA 1ISNA 2C7HA 5J17A 2KWCA 1BT0A 5G2NA 1I35A 1NBFC 2JWZA 3B08A 2REXA 1E90A 4K1RB 4RMAA 2Z0DB 3ZW3A 4KV2A 2EMTA 3KH0A 3L0WB 5E6PA 2YLMA 4OVUA 3SHQA 3WANA 4M8NA 2ASQA 1M94A 2C7MB 1E5WA 1P3QU 3BY4B 4BBNC 2O6VA 4GGQA 1WGRA 2LXAA 3DVGY 2N1WA 2WWZA 4WAAA 3LJ3A 3ZNGC 3L17A 1MG8A 2G45B 4BKSA 1T0YA 2LI5A 4A3OA 4FJZA 2G4SA 4G3XB 3QQ8B 2GMIC 2RD0A 1GC6A 1UZXB 2L05A 2O6VD 3KUZA 1E8YA 4DHJB 1VCBA 1WI0A 1Q0WB 4DHZE 3NS8A 3VTWA 4F1SA 2FNJB 4ZRIA 3WAPA 1LQBA 2MBHA 3NOBA 3V62A 4BKSD 1WXVA 1TBEA 4W9EA 2B3AA 3S2AA 2BGFA 3HK0A 4FJVB 2I1KA 1WJNA 3TBLD 2MLBA 2BYFA 4HK2A 3NY5A 2KTRB 1YX6B 3ZVVA 2IBIB 1UD7A 4I6NB 1RRBA 4ZRKA 1NI2A 4HCPB 1V5TA 3OLMD 1Q1OA 2JUOA 2R2QA 4ICVA 2L0FA 4WWPA 3EFUA 3L13A 4GMVA 3VQIA 5JZEB 2BKFA 1V9JA 4BFRA 4JIOU 3T8MA 5JH5C 4J6IA 1SE9A 4KDIC 2K6DB 2AWTA 3RYTA 3NZSA 4LJPB 1YQBA 5LXIB 3OJ3A 3ENEA 1WGDA 4GSWA 2NR2A 3M62B 1IYFA 4E3CA 2KX3A 4DHZB 2DZIA 1GNUA 4B6WA 4RM9A 1WYWB 2N9PC 5DPRA 1LFDA 4FULA 2FCSA 5HKHA 3TJPA 3WA0A 2IO2B 4TV3A 2KC1A 1TGZB 3DBRI 5G55A 4WWOA 2KXJA 4PYZA 3RUIB 3VUXA 2M8SA 1K8RB 1V80A 1KOTA 5D94A 2XEWA 5L95C 3CSFA 2AEHA 1WMHA 2O6VB 5CHVC 1C3TA 3PRZA 3MJWA 2ZPNA 4NAWA 3PV1A 4ICUA 4NQKE 1V6EA 3R66C 2K39A 3ZKJC 4IM3A 2ZVNA 4AWJA 2FAZA 1SIFA 3ZTDA 1Z2MA 3KVFB 4MSMB 2KMAA 3APDA 4URKA 1JRUA 3ZIMA 1EF1A 2L76A 2BWFA 2AL3A 2XK5A 4MGIE 2KDIA 3TCAA 1E7UA 2M0XA 1IP9A 4FJYA 3GOEA 1WE6A 3VDZA 1S1QB 1YIWA 3H6NA 1LXDA 1WF9A 4KZCA 2IY1B 4M8MA 4B95A 2IY0B 3KYCD 3EECA 1E8XA 3DBHI 3M95A 1OGWA 3ONSA 1WXMA 4FA6A 5JHBA 4IM2A 4W9IA 2MBEA 2KJ6A 1TTNA 2YVCA 4GB9A 1R4NI 3VUYA 2IO0B 1UGMA 2V3SA 2FCNA 2PEAA 5IAAC 4CHKA 1IPGA 3DVNV 1GJZA 2D11A 2JZ3B 4GOCA 2JRHA 3QK0A 5CHWA 1D3ZA 3A9JA 2HJ8A 2DAFA 3P2BA 2C5LC 4W9HA 4GDKA 5AZFA 2CS4A 5KHOA 2DZMA 3V60A 2KHWB 2WX0A 1PQSA 2A5UA 3GZNI 3HM3A 3RCZA 2KMCA 2NVUI 2UYZB 4ANVA 4ZRJA 4JGHB 3KUDB 2RR9A 1XT9B 3QX1A 3B0AA 3KUCB 5DPTA 4I6LB 3OAWA 1WR1A 3R3MA 3ZRCA 2L3ZA 2J0MA 2Y5BB 1UELA 4MM3A 4JL9A 2RPQA 3A4RA 3ML8A 1GG3A 2CU1A 3D32A 3MHSD 5JHAA 2MW5A 2DX5B 1UBIA 3DPDA 3PGEA 1WM3A 2V4LA 2NBWB 4W9GA 4AJYB 4EOYA 1YJ1A 3Q3FA 1V2YA 1WMHB 1Y8RC 2CKHB 3QAQA 3VXWA 4BVUC 2W9NA 2DZJA 3IG3A 3PLVA 4K7WA 4FHJA 2I1JA 2KDFB 2KVRA 3RD2A 3PRPB 3QWZB 4MDKE 4TQ1A 3K9OB 2N7EA 2PE9A 3LDZE 1P98A 1UBQA 4KIKA 1L2NA 4IC7B 4DDGD 1KJTA 1KLVA 5EDSA 2Z0EB 2XK5B 2KWUB 4BKTA 2G3QB 2ZCBA 2Z59B 3WAOA 3VH3B 3AU5A 1TZ1A 1QZEA 4G11A 2WX1A 2FCQA 4JLCA 3H1UA
chains in the Genus database with same CATH superfamily
4WJNA 1HZ5A 4IW0A 3Q3JA 3A4SC 1F2RI 1XF5L 4WWNA 1D4BA 1I4RA 1JWAD 2WYQA 4M01A 3VVWB 3IFWB 5MPOA 4YTMB 3VFKA 3FILB 1QOBA 2FUG1 4NPNA 1V1OA 2PLPA 4E74A 3BK2A 1WR6E 2PKOA 2J0JA 4ZOHC 3MP9A 3H9DA 2D5GA 2N9EB 4JWSC 2KFKA 5I4DA 3VUWA 2LGDA 3CWIA 2GBKA 3I3TB 3LYYA 2G9HD 2JRIB 4XYCA 2WDVB 3RNFC 2N9KA 3DDCB 2LGYA 3DBLB 4B9KA 1WGGA 1FNUA 4YL8A 1FFUA 2OOBB 3V61A 1X1MA 3M63B 1UWXA 5TR5A 3QJZA 4KVGB 4PS7A 2M17A 1JALA 3EUB2 2IJ0A 1KH0A 1WE7A 3TEXA 3JYUA 4DHJD 4TQ0A 3PVLA 4ZHPA 2D2QA 2NS5A 5BYQA 3AE3B 4US9A 2GBRA 3ZUNA 5D7GA 2X38A 3CMMB 2DENB 2KX0A 3EGRA 3WALA 5HFYA 3ZDTA 4M0WB 3NVWA 3DBSA 1STEA 1H4RA 4HCNB 4XGAB 4FHKA 1E9MA 3HHMA 2K8CA 1FCLA 4FBJB 3GP7A 5LLIA 5IA7A 3RZWC 5FKAC 2FCMA 1V8CA 3DVNU 1J19A 1I4XA 2BB5A 1VLBA 3U7DA 2QCZA 1LGRA 4WAFA 3AEGB 4C80A 3PT2B 1MHXA 4EEWA 2LZ6A 2NPTB 2Z8LA 1WXAA 3H8HA 4NAWB 1A5RA 1WZ3A 1E6EB 4KKJA 3U52E 1PGXA 1WZ0A 1IBXA 4NY0A 2BYTA 3IT6B 4EUTA 3ZGZA 3P63A 2KN4A 1KLGD 2BVCA 3BIID 1ZP0B 4HDQA 1UF0A 3EHVA 1WX7A 1YOVB 3A1QB 5JXVA 1IGDA 3SFEB 5AEKB 1L7YA 1MG4A 4TSSA 4GDKB 4ZYSA 1I4GA 3MC9A 4HPLB 3TMPB 3PLUA 1IGCA 3DCGA 2G1EA 4TKNA 4HJGE 1J8CA 1NEKB 2ON8A 3DWMA 1WM2A 4RGOS 2K5PA 2NBVB 4DXAB 3PS6A 5E6JA 2HE7A 2QMTA 2WDTB 4WJPA 2DYOA 2ZPYA 5G5GA 2BPSA 3DWGC 3VAWA 2BKRB 4GDLB 1WJ4A 3ECIA 2NBUA 3VRAB 1MVKA 2KO3A 3LXFA 4ANWA 1FXTB 5D2MB 3MTNB 4AS1A 1XLOA 5E6NA 1EWCA 1NVID 2JY6A 3VHTC 1WJUA 2ONQA 4NQLB 4PYUA 2KMMA 1V49A 1Z5SB 4H2AA 3DBRB 1EUVB 2EKIA 4EZLA 2VZKB 1WFYA 2KD0A 1UUPA 3Q3OC 3J9CA 2C9WB 4W9FA 2J0KA 2LGSA 2HDEA 1TJEA 3ZJUA 1SBBB 3P4RB 2PJHA 2C7HA 1JCKB 1BT0A 5G2NA 1I35A 4RMAA 5BYRA 2EMTA 3W2DA 3WANA 1MJDA 3B2GA 2O6VA 1FNWA 4WAAA 3L17A 3I57A 4HROA 2QDFA 1QQRA 4BKSA 3N9YC 3PZ7A 2GMIC 1GC6A 1UZXB 2O6VD 3TEZA 1E8YA 3RI7C 1WI0A 1Q0WB 3NS8A 2D3AA 3I9V1 4C00A 4BKSD 1ZOYB 1TBEA 1NYQA 1XXGA 1WJNA 3TBLD 4LNNA 3VR8B 2K22A 5IKCM 1YX6B 1FIQA 2L1AA 1C4AA 2IBIB 2V3NA 4HCPB 1V5TA 1ENFA 1Q1OA 4HKZE 4WWPA 3VQIA 2BKFA 3W5UB 3AEBB 4J6IA 4LNOA 1SE9A 1TS4A 2AWTA 5LXIB 3Q8FA 1WGDA 4Q2JA 4YT0B 2DBYA 3M62B 1IYFA 4E3CA 2DZIA 3T3OA 2JSVX 3AB5A 4B6WA 3KWLA 1WYWB 2BS3B 4ZRPA 2N9PC 1LFDA 4FULA 4RGMA 3W5VB 3TJPA 2KC1A 1TGZB 5HHDG 4NAMA 3P4QB 3RUIB 2HJ1A 2M8SA 1K8RB 2BW2A 1V80A 3AH7A 1C3TA 5CHVC 4NQKE 4NAWA 3PV1A 1EU3A 4XWWA 5BMGA 3ZKJC 4AWJA 2FAZA 3P42A 1SIFA 1PGBA 3ZTDA 3KVFB 4URKA 1EF1A 2BWFA 4MGIE 2KDIA 1E7UA 4FJYA 3VDZA 1WE6A 1VDVA 2KVZA 1NENB 2MJ3A 4B95A 3AN1A 3DBHI 5H8YE 3FKYA 2J4XA 2KJ6A 1R4NI 2IO0B 5IAAC 2OEDA 2DAFA 2C5LC 1F1HA 4GDKA 2CS4A 2DZMA 2WXGA 3TEYA 2ZW1A 3HRDD 3RCZA 4ANVA 3V05A 1DOIA 3DHGC 3AE5B 3QX1A 3KUCB 4IKGA 1EWYC 4I6LB 1V97A 4JL9A 1I7HA 3D32A 1VR9A 3GE8C 2DX5B 3PGEA 1WM3A 4W9GA 1GOZA 2WXNA 3Q3FA 2CKHB 3VXWA 2VH2A 2WXHA 4YTNB 2W9NA 3ZJTA 2PVOD 4RGNA 4FHJA 2KDFB 2KVRA 3BK1A 3RD2A 2LHEA 4MDKE 4DQOC 1QKZA 3LDZE 2VH1A 4IC7B 4DDGD 5EDSA 1C79A 3Q3NC 3AECB 3WAOA 1IUEA 3AU5A 1F2RC 4JLCA 3MJ5A 4LNKA 2IO1B 2WDQB 3HUIA 2CR5A 2D3GA 3I5JC 3QC8B 2EELA 2MBBB 4FN2A 4IWOA 2LXCA 4QAYA 3NVYA 5CTRC 2NTTA 1DYQA 2DYBA 1JWSD 1C77A 1RAXA 1TYGB 2KC2A 3AXCA 3Q8AA 4MGKE 3NHEB 4KDLB 1MHHE 3BVMA 2FIDA 3N3KB 2KQSA 1YD8U 4MM3B 3U30A 3PRMB 4A90A 3PREA 3VH4B 2KDBA 3WIMA 2GLSA 3WAMA 3UQBA 2KANA 2V1YA 4LNIA 2VRRB 4PS3A 4BOZB 1SB3C 4K7UA 3GB1A 4AP4C 1FEHA 2INDC 3OJ4B 1WY8A 1C4PA 1SE4A 4YXDB 4US8A 1YN5A 4KIKB 3KYDD 3NZ3A 5BO4B 3UI3A 3ZNZB 4LK0M 4HVBA 2CHZA 3HIZA 4O1NA 2W55A 1WIAA 1LO5D 2GBJA 2K8HA 2ZNVC 2OHFA 5KHQA 5IN7A 2O2VA 4WJQA 3SU8X 1RFAA 4IG7B 1SJED 1XCQL 1GUAB 4C4VA 3NVVA 3IBEA 4BKGA 5GMVA 2KWDA 3JSVA 1AW7A 2LRUA 3H7PA 4NJ7A 3EFCA 4MH8A 5C1ZA 2RGFA 3W9CB 1K50A 3RNEC 3ABVB 1TZOA 4HLEA 3RZFA 4AOFA 1E8ZA 3L08A 3N1YC 3HM6X 4XDDA 1YQ4B 4J3OD 2EKEC 4RFBA 3VTVA 3N32A 3Q8CA 2L00B 2LASA 2FIFA 4A9AA 5DCNA 1RLFA 3QIJA 3A9KA 3VRBB 1E8WA 4W9KA 4DK5A 4MSQB 1RYJA 1TS3A 3BINA 2CJOA 2MA9B 4HWIB 2OJRA 1S3SG 1ZXIA 3KQ4A 2AQ2B 4ZYNA 1VZ8A 1XD3B 1HE8A 5CX3A 4XDCA 4RF0A 3RMKC 2NCNA 1FMAD 2JXTA 1I42A 2KDMA 1V1PB 2W3RA 1TY0A 2DLBA 3RNCC 2N9LA 1LM8B 2L52A 5FR3A 2UU7A 2Q5WD 2KJRA 2RDBC 1C1YB 2BF8B 1JW9D 2MBQA 3Q3MC 2JQRB 4N9F4 4KSLC 1OTRB 4PK1A 3ML9A 2LVPA 3AM9A 1P9DU 4X57B 4MJSB 3KW5B 1SSNA 2WXLA 2JZPA 1CMXB 2MP2B 5DPWA 2KTRA 2GBMA 2BYEA 4B0MA 3AULA 3PSEB 2LRWA 4E71A 1NDDA 2BWES 1SIJA 1I4PA 1P7FA 4EZKA 2RDHA 2ZEQA 4JQWC 2KYWA 1XQQA 4EFOA 1V81A 4GXBA 1OEYJ 3AE9B 2KQ4X 3AE1B 5J17A 1T0SC 2KWCA 1NBFC 5TSSA 2W54A 4KV2A 5E6PA 2YLMA 1NI3A 1TKGA 3ZXRA 5EE9A 4M8NA 4YWGG 1M94A 1E5WA 4BBNC 3BY4B 2N1WA 2WWZA 4A8XC 3LJ3A 3ZNGC 1MG8A 1SE3A 4ITKA 3DBHB 4G3XB 3QQ8B 3BYTB 1R4NB 2RD0A 3KUZA 1VCBA 4DHZE 3VTWA 3NOBA 1T0RC 4OW0A 2QSDA 2BGFA 3HK0A 4FJVB 2I1KA 2BYFA 1WGKA 4M00A 3NY5A 4XE0A 2JUOA 2WS3B 1QLBB 3L13A 1XLQA 3Q14C 5AUIA 4JIOU 3T8MA 5JH5C 4KDIC 2K6DB 3RYTA 4LJPB 3TSSA 3VR9B 1YQBA 2NR2A 4JPSA 3NJTA 4DHZB 1GNUA 1M4VA 3I63C 4RM9A 2NTSA 2FCSA 4A6QA 1QOFA 3ZXVA 4N59A 4WWOA 1N62A 4PYZA 1J7CA 4USAA 5D94A 5L95C 2AEHA 1WMHA 3PRZA 3R8BA 2ZPNA 4ICUA 2K3UA 1V6EA 3R66C 2ZVNA 4JWUC 1J7BA 2KMAA 1TS5A 3APDA 5IO9A 1JRUA 2E3TA 2LFIA 2N0SB 2LGIA 1ROEA 2AL3A 4L2YA 3SR6A 2Y3AA 2L83A 2M0XA 1N6ZA 1T0QC 1IP9A 1S1QB 1YIWA 2MEKA 1LXDA 4BAXA 2IY1B 4C7ZA 3EECA 3M95A 1WXMA 5JHBA 2MBEA 3ETRA 3VUYA 1VJKA 2PEAA 1GJZA 2E6XA 2BS2B 2W3SA 4GOCA 3FILA 3P2BA 3AE6B 1MPEA 1T6BX 4WQMA 2OJWA 2K0PA 1PQSA 1V1PA 1L6VA 2UYZB 2NVUI 1GB1A 1QILA 4JGHB 3KUDB 5HI1A 2J53A 2IGHA 3OAWA 1WR1A 2L3ZA 2AX5A 2J0MA 2Y5BB 1UELA 1RM6C 1PFDA 2RPQA 3A4RA 3ML8A 1GG3A 5JHAA 1B1ZA 1D5ZC 4MT5A 4AJYB 4EOYA 2H89B 3OG5A 2YEPB 4K7WA 4P6VF 1R7SA 1N5WA 3K9OB 2N7EA 2PE9A 2K9XA 2Z0EB 2XK5B 1OFFA 1QF6A 1TZ1A 4FXCA 4G11A 2FCQA 3U7ZA 1HEZE 4M0WA 4LDTB 4WJOA 4GN1A 3H7SA 1SJHD 1AWDA 4MEMA 3TL5A 4DXFA 5E6OA 4G50A 4CO7A 2HTHA 1V86A 3RNBC 3U4EG 4ACFA 2AL6A 3NRZA 4HJKA 3A9JB 1ZE3D 4OZCA 3QHTA 1B9RA 1ZW7A 3UIOB 1YN3A 2WU2B 3MFGA 3CSTA 3R7QA 2NPTA 1SE2A 2WHIA 1C76A 4DWFA 3RT3B 2XN9C 1VZ7A 3IVFA 3T9LA 4W9CA 3R2TA 2PPHA 2GRIA 2K25A 2PVGC 4ANXA 1WJ6A 3R7RA 1OQYA 2LEKA 3ZNHB 4EKUA 3WCQA 4II3B 2L0TA 4IOIE 1L0XB 3DHHC 1FRRA 3SDLC 2DZKA 3A1QA 4WQOB 4K7SA 3PHWB 4HXDA 3DVGX 2ZVOA 3EC8A 1R4MI 1CK1A 2KOXA 2J52A 2RSUA 3IAM1 4G0NB 2A4ZA 2J7QB 4AUQC 2AYOB 2KTFA 3TIXA 1TIFA 1E7PB 5C23A 2LJ5A 1AARA 4DDID 2MQJA 3GE3C 1FXAA 4A20A 4W9LA 2V0GA 2GBNA 4PS8A 1EU4A 1KRHA 1WSPA 4LCDE 2EMSA 2KFKB 1FNVA 2D10A 3ZDMC 3ALBA 3L16A 4GDLA 1P1AA 3C0RB 2N7DA 1J0GA 2TSSA 1AN8A 3NG0A 3APCA 3ZRFA 2ZNVB 2LWPA 4CQNA 4TUUA 5DPSA 1EM7A 2M1MA 2CHXA 1TT5B 5L83A 3ZO5B 1I4HA 1GAQB 5CHFA 3MC8A 2BYVE 1E7VA 1P0RA 5AZGA 2LVOA 1YNTE 1F0ZA 3AE2B 2WLBA 3AV8A 1GC7A 2I2YA 1XLPA 1G6JA 5LNK1 2WXIA 1E10A 4LJOB 2PW9A 2PE6B 3UIPB 2V3PA 3DOWA 2VZKD 1WRDB 3RPFC 2G4DB 4IWQA 1BUIC 1WX9A 1DGJA 2WQYB 4A3PA 5BMIA 4EE2A 1VD2A 2JZZA 2YEPF 3V6CB 3QCAA 3W1SA 1ACCA 1N61A 1KM7A 2KLGA 1CQVA 2QHOA 4MGYE 2BTEA 2LMCA 2IO3B 2MSED 3PZDA 2Y5PA 3O65B 4GU2A 4OZBA 2BS4B 1L0VB 4N6EB 1BXTA 1MFWA 2BB6A 2ZJDA 2QILA 2MBOA 2KAJA 3ZTCA 1MI0A 4HDOA 3L54A 1UNSA 2JF5A 4ASWC 1C78A 3RNGC 2R61A 1IBXB 2QEJC 1QOGA 4IUMB 2SAKA 4NZLB 4NNJB 5D6JB 2FBWB 4FADA 1JQ4A 2MHJA 3TUOA 1SGHA 2FE8A 2DYMA 2LGXA 3KLSX 2R2OA 2ZZPB 1AYFA 2WDRB 4LDTD 4P7IA 1ZDXA 4JE3B 4UDUC 1ISNA 1A70A 1FRDA 3B08A 2REXA 1E90A 4K1RB 2Z0DB 3ZW3A 3KH0A 1Y56A 3SHQA 2CU3A 4M02A 4MACA 2WXOA 2C7MB 1P3QU 1YMHE 1WGRA 3DVGY 2PTLA 3BWUD 3DHIC 2LI5A 5G5HA 2G4SA 4YTPB 3U2SC 2L05A 1ESFA 2DNFA 2AQ3B 4F1SA 1LQBA 3V62A 1WXVA 3AEDB 5D3IB 3CIRB 1FD6A 1PGAA 3Q8EA 3ZVVA 3L4PA 3O13A 1UD7A 4I6NB 4ZRKA 1NI2A 1F52A 1L4ZB 1SF0A 4ICVA 3EFUA 5JZEB 1JROA 2RPVA 1V9JA 2SEBD 5AUKA 1L0YB 1HTQA 2D3CA 3AMZA 2QJLA 3ENEA 4GSWA 3KWVA 1CJEA 1OQQA 1PDXA 4P1CC 2WXJA 5DPRA 3Q8BA 5HKHA 2IO2B 1QT9A 2AQ1B 3E56A 4RNAA 1PYWD 1UGJA 1VZ6A 1KLUD 1N5XA 3VUXA 3CSFA 2O6VB 3N20C 4RCOA 2K39A 4IM3A 4KKIA 4MSMB 2QC8A 3C19A 2NMQA 4HEA1 3ZIMA 1ZXHA 1C4CA 3TCAA 4KGRA 1PUTA 4RH6A 3H6NA 1WF9A 4KZCA 4M8MA 3MHZA 4AQ7A 2V4IB 1E8XA 3ONSA 1OGWA 2INNE 1TTNA 1UGMA 2V3SA 4CHKA 1JWUD 3DVNV 2D11A 2JZ3B 2WXRA 2JRHA 1D3ZA 2PMVA 5AZFA 4YSZB 3Q69A 5EE3A 2A5UA 3GZNI 2XNAC 4ZRJA 3AE4B 2JX5A 4WH4A 3MC0B 5DPTA 3E9SA 3R3MA 3ZRCA 4MM3A 1VRAB 2MW5A 4C7YA 1UBIA 2WP9B 4GLSC 4KGSA 4WWMA 1YJ1A 1V2YA 2ICIA 1Y8RC 4LLGM 1TS2A 1R4MB 4BVUC 2DZJA 2WXKA 3IG3A 3TEWA 2I1JA 3QWZB 3T3NA 4TMAB 1XLNA 1JMLA 1FCCC 1ET9A 1P98A 4KIKA 4LTUA 1N60A 1K53A 1KJTA 2PIAA 2ZCBA 2Z59B 3VH3B 1I4QA 1QZEA 1WXQA 3ZYYX 2WX1A 4OZAA 3H1UA 1D6EC 2C7NB 1U4AA 2L8JA 2MX2A 3PPAA 3R2IA 2WXPA 2IYDB 4L23A 1TKEA 2M4NA 1L6UA 2MWSB 2JPHA 5FR6A 2ACZB 3ZLZA 2N1VA 1FPYA 2B76B 4BOSC 2K8BA 2L7RA 4CYEA 3JVZX 2C60A 1EO6A 1KF6B 4DBGA 2JU6X 1WWTA 4AJWA 4LNFA 5J18A 3N30A 1D5XC 4F8CB 4ZDVA 1HQRD 3ZQ4A 2HTME 2KNBA 3K9PB 1XCTL 3X0WA 4ZRQA 4ARCA 3B2FA 3FAHA 2LUMA 2M19A 4BBNF 3ZNID 1J7AA 4MH0E 1YX5B 2KJHB 2KK8A 1WX8A 3VTUA 3NVZA 2KKCA 3HVDA 3APFA 3W1YA 2DHZA 2KQ7A 2N4FA 1OQRA 3V3XA 4KSKC 1QOAA 1OEYA 2D3BA 3AEFB 4PT5A 5EE1A 4EZJA 4MELA 2JVCA 2K6QA 3C8YA 3PHXB 3B9JA 3UINB 1TKYA 3NS1A 3NZUA 3RNAC 1FFVA 4II2B 3AE8B 1EF5A 1YJJA 2MJEA 4NJ6A 2D07B 2IPKD 2KZRA 2DWQA 1XO3A 3PTFC 2LJIA 4S17A 4RGTA 3IAS1 2JT4B 4XX5A 1DOYA 4GIVA 3SD5A 1WXSA 4MGZE 4KZ0A 1N63A 2RDGA 2KN5A 4MJSA 2MCNB 2UWQA 3AI5A 3QA8A 4C56C 2MP2A 4HKQA 3OWEB 1WYGA 2RMMA 3L10B 1UH6A 2WXMA 3AEAB 2GI9A 2KLCA 2LUEA 2KFJA 1SEBD 1ZPSA 2H88B 2QIEB 2FUHB 4P1BC 3V6EB 4K3CA 4WURA 4XC2A 2HD5B 3U8ZA 2IZVB 5AZHA 3QARA 3DBLI 1NYRA 3N1ZC 2CHWA 1Q5WB 2DAJA 4K81A 4IM0A 5HG2A 2W82A 3A33B 1V5OA 3P1MA 1YN4A 3BZDB 4FLHA 1ZKHA 2O2VB 2ZCCA 1TY2A 3CF6E 3Q6BA 3Q2AC 4C4VB 5GXGB 3PZ8A 2N9XA 2N7JA 2XBBC 1WGYA 4YSXB 2BT6A 3JSVB 4N58A 4OVVA 3H7PB 1GB4A 1YJIA 4RM8A 5J2RA 2WXFA 1WH3A 1WRIA 3NUHB 3EA6A 3LB8C 1HA5A 2LD9A 2JXXA 3FC4A 3P4SB 3UF8A 3B1LX 3JW0X 2KWVB 5D3DA 1Q10A 1FO4A 1H8CA 3RULA 2LVQA 4F7ZA 2X8XX 4IWPA 1P7EA 4I6PA 3UQAA 4HPMB 2M0AA 3W1SC 4P16A 2CJNA 1HTOA 4W9JA 1E0ZA 4ANUA 3IHPC 5LXHA 2K1FA 2KDEB 4OHJA 1K52A 3M3JA 1CZPA 3DQVA 4XZ4A 2WNMA 3A9KB 2IGGA 4RF1A 3X23A 3AU4A 4D2KA 2JWUA 4W9DA 4OVZA 1WGHA 3PO0A 1UWMA 2INPE 1ZGUB 4A55A 3UGBB 2MRPA 4HPPA 1F9JA 2GOWA 3GS2A 2JWZA 5C3JB 3IXSA 3L0WB 4OVUA 4REZA 1K51A 2ASQA 3SEBA 3ZJVA 1ZDVA 4GGQA 2LXAA 4JX1C 2G45B 2BQQA 1T0YA 4A3OA 2KACA 4FJZA 2IDYA 3BVGA 5EE0A 4DHJB 3IT4B 2FNJB 4ZRIA 3WAPA 4XWTA 2MBHA 4L1BA 4W9EA 2B3AA 3S2AA 1FM0D 2MLBA 3GZNB 4HK2A 2KTRB 5BYSA 3RFZB 1JWBD 1RRBA 2V9HA 4KGTA 3OLMD 5IP4D 2R2QA 2L0FA 4ARIA 4GMVA 1YQ3B 1T3QA 1RWSA 4BFRA 2Y5CA 4WIPA 3BYYB 3NZSA 1D5MC 1L4DB 3AEEB 3OJ3A 3HVZA 4S0RA 2MH7A 2KX3A 4YSYB 4DXGA 1C9FA 1SXTA 1XEEA 1KTKA 2J42A 3WA0A 4TV3A 3DBRI 5G55A 1KFYB 2KXJA 4NJCA 5H92C 4R3DA 1KOTA 2I38A 2XEWA 3MJWA 1ET6A 3AE7B 2KT7A 2MJDA 1Z2MA 3SFDB 1RFKA 1BMLC 1JRPA 2L76A 2ZW0A 2INCC 2XK5A 1GPXA 3RN9C 3GOEA 4KX6B 2WXQA 4IDIA 5C2TB 2IY0B 2LHDA 3KYCD 4FA6A 5FK9C 1DOXA 4IM2A 4W9IA 4B0EA 3BVZA 1HZ6A 2YVCA 4GB9A 2FCNA 2WGSA 1IPGA 5T8IA 4HRSA 3QK0A 5CHWA 1L5PA 3A9JA 2HJ8A 4W9HA 5KHOA 3V60A 2KHWB 2IGDA 1F77A 2WX0A 3HM3A 4BZAA 2L32A 2KMCA 2RR9A 1XT9B 4K3BA 3B0AA 1T5XD 2WU5B 2CU1A 3MHSD 1ZUD2 3DPDA 2V4LA 2NBWB 1WMHB 3QAQA 3PLVA 4ZHOA 2GB1A 5IOIA 3N1XC 3URYA 3PRPB 3P4PB 2BBCA 4TQ1A 1UBQA 2JYTA 1L2NA 2M56B 1KLVA 2KWUB 1JWMD 4BKTA 2G3QB 5BMHA 1FXIA 1HXYD 2JYEA
chains in the Genus database with same CATH topology
2C7NB 1U4AA 2IO1B 2L8JA 4LDTB 2MX2A 4WJNA 4GN1A 4IW0A 4WJOA 3Q3JA 2CR5A 3PPAA 3H7SA 2D3GA 2IYDB 3A4SC 3QC8B 4MEMA 3TL5A 4WWNA 5E6OA 2MBBB 2M4NA 4FN2A 2LXCA 2WYQA 4G50A 2HTHA 4IWOA 4CO7A 1V86A 2MWSB 2JPHA 5FR6A 3VVWB 2AL6A 3IFWB 5CTRC 3VFKA 3ZLZA 4HJKA 4NPNA 3A9JB 2N1VA 4E74A 4BOSC 2K8BA 2DYBA 2L7RA 1WR6E 3QHTA 2J0JA 4CYEA 3H9DA 3JVZX 1RAXA 2C60A 2N9EB 1EO6A 2KFKA 2KC2A 4DBGA 3AXCA 1ZW7A 3VUWA 3UIOB 2LGDA 2GBKA 4AJWA 3I3TB 3CSTA 3R7QA 2NPTA 4MGKE 3NHEB 2JRIB 5J18A 4KDLB 3N30A 4F8CB 2FIDA 3DDCB 4ZDVA 3N3KB 2LGYA 2KQSA 1YD8U 4B9KA 3U30A 4DWFA 3RT3B 3PRMB 2KNBA 3IVFA 3K9PB 1WGGA 3PREA 3T9LA 3VH4B 2KDBA 3WIMA 4YL8A 3X0WA 4W9CA 2OOBB 3WAMA 3UQBA 2KANA 3V61A 2V1YA 2PPHA 1X1MA 2K25A 4PS3A 2VRRB 3M63B 4ANXA 1WJ6A 5TR5A 1OQYA 3QJZA 3R7RA 4KVGB 3ZNHB 4BOZB 4EKUA 4K7UA 4BBNF 4PS7A 2M17A 4AP4C 3ZNID 4II3B 2L0TA 4MH0E 1WE7A 3OJ4B 1YX5B 2KJHB 1WY8A 1WX8A 2KK8A 3JYUA 3VTUA 2KKCA 4DHJD 3APFA 3W1YA 2DHZA 4TQ0A 2KQ7A 3PVLA 2N4FA 4KIKB 2D2QA 2NS5A 3KYDD 2DZKA 5BO4B 3SDLC 3A1QA 2GBRA 3ZNZB 4HVBA 2CHZA 3HIZA 4K7SA 4KSKC 3PHWB 4WQOB 1OEYA 4HXDA 3DVGX 1WIAA 3ZUNA 5D7GA 2GBJA 2K8HA 2ZVOA 3CMMB 2ZNVC 2DENB 2KX0A 3EC8A 3WALA 5KHQA 3ZDTA 1R4MI 4EZJA 4MELA 4M0WB 2KOXA 2JVCA 2K6QA 2RSUA 2O2VA 3DBSA 3PHXB 4G0NB 2A4ZA 3UINB 2J7QB 4WJQA 1H4RA 4HCNB 4AUQC 2AYOB 3NZUA 3SU8X 1RFAA 4FHKA 2KTFA 3HHMA 4IG7B 3TIXA 4II2B 1GUAB 2K8CA 4FBJB 5LLIA 5IA7A 3IBEA 1EF5A 4BKGA 5C23A 2LJ5A 1AARA 5GMVA 3RZWC 4DDID 2MQJA 3JSVA 4NJ6A 2D07B 2LRUA 2FCMA 3H7PA 4NJ7A 2KZRA 3DVNU 4A20A 4W9LA 5C1ZA 1J19A 2RGFA 2GBNA 4PS8A 3PTFC 3U7DA 4LCDE 2EMSA 2KFKB 2JT4B 2D10A 4XX5A 4GIVA 4HLEA 3ZDMC 3ALBA 3PT2B 3RZFA 3SD5A 1WXSA 3L16A 4GDLA 4MGZE 2LZ6A 4EEWA 4AOFA 2NPTB 4KZ0A 1P1AA 3C0RB 1WXAA 4NAWB 1A5RA 1E8ZA 2N7DA 3L08A 1J0GA 1WZ3A 2KN5A 3APCA 4MJSA 3ZRFA 2MCNB 2ZNVB 2LWPA 2UWQA 3AI5A 3HM6X 3QA8A 2EKEC 4TUUA 5DPSA 2MP2A 3VTVA 2M1MA 2CHXA 3L10B 3N32A 1UH6A 2L00B 2LASA 1WZ0A 2KLCA 5L83A 4NY0A 2LUEA 4EUTA 2KFJA 3ZO5B 2FIFA 2FUHB 3V6EB 5DCNA 5CHFA 1RLFA 2BYVE 1E7VA 4XC2A 1P0RA 2HD5B 3QIJA 5AZGA 2LVOA 2IZVB 3U8ZA 3A9KA 4HDQA 5AZHA 1E8WA 3QARA 3DBLI 3EHVA 4W9KA 4DK5A 1GC7A 4MSQB 1WX7A 2CHWA 3BINA 3A1QB 1Q5WB 2DAJA 4K81A 2MA9B 1G6JA 4HWIB 4IM0A 2OJRA 1S3SG 3A33B 5AEKB 4ZYNA 4LJOB 1V5OA 1L7YA 1XD3B 2PE6B 3UIPB 1HE8A 3DOWA 5CX3A 4GDKB 4FLHA 1WRDB 1ZKHA 2O2VB 2ZCCA 2G4DB 4HPLB 3CF6E 2NCNA 1I42A 4IWQA 3TMPB 3PLUA 1WX9A 3DCGA 2N9XA 4A3PA 4TKNA 2XBBC 1J8CA 1VD2A 2JZZA 3W1SA 3V6CB 3QCAA 1WM2A 1LM8B 1WGYA 3JSVB 4OVVA 2NBVB 3H7PB 1KM7A 4DXAB 2KLGA 3PS6A 2KJRA 4RM8A 5J2RA 2QHOA 1WH3A 1C1YB 2HE7A 2BF8B 2WDTB 4MGYE 4WJPA 2IO3B 2MSED 3PZDA 2DYOA 2ZPYA 3O65B 4GU2A 2MBQA 2LD9A 4N9F4 2BPSA 2JXXA 3VAWA 2BKRB 4GDLB 3B1LX 3UF8A 1WJ4A 2KWVB 3ECIA 3JW0X 4KSLC 2NBUA 2ZJDA 1OTRB 1H8CA 3ML9A 3RULA 2LVQA 2LVPA 4F7ZA 1P9DU 4IWPA 4X57B 2KO3A 4MJSB 3KW5B 4ANWA 2MBOA 4I6PA 3ZTCA 4HDOA 3UQAA 3L54A 4HPMB 1FXTB 1CMXB 3W1SC 2MP2B 5DPWA 2JF5A 5D2MB 2KTRA 3MTNB 2GBMA 4ASWC 2BYEA 3AULA 4W9JA 5E6NA 4ANUA 3IHPC 5LXHA 2K1FA 2KDEB 4IUMB 4NNJB 2JY6A 5D6JB 3VHTC 3M3JA 1WJUA 3DQVA 3PSEB 4FADA 4XZ4A 4NQLB 2LRWA 4PYUA 4E71A 3A9KB 1NDDA 1V49A 1Z5SB 2BWES 3X23A 1SGHA 1EUVB 3AU4A 2DYMA 4EZLA 2LGXA 1WFYA 2KD0A 4W9DA 2R2OA 2C9WB 4EZKA 1WGHA 4W9FA 2ZZPB 2J0KA 1ZGUB 2ZEQA 3UGBB 2MRPA 4JQWC 1F9JA 4EFOA 1XQQA 2GOWA 1V81A 4LDTD 4P7IA 4GXBA 1OEYJ 2PJHA 1ISNA 2C7HA 5J17A 2KWCA 1BT0A 5G2NA 1I35A 1NBFC 2JWZA 3B08A 2REXA 1E90A 4K1RB 4RMAA 2Z0DB 3ZW3A 4KV2A 2EMTA 3KH0A 3L0WB 5E6PA 2YLMA 4OVUA 3SHQA 3WANA 4M8NA 2ASQA 1M94A 2C7MB 1E5WA 1P3QU 3BY4B 4BBNC 2O6VA 4GGQA 1WGRA 2LXAA 3DVGY 2N1WA 2WWZA 4WAAA 3LJ3A 3ZNGC 3L17A 1MG8A 2G45B 4BKSA 1T0YA 2LI5A 4A3OA 4FJZA 2G4SA 4G3XB 3QQ8B 2GMIC 2RD0A 1GC6A 1UZXB 2L05A 2O6VD 3KUZA 1E8YA 4DHJB 1VCBA 1WI0A 1Q0WB 4DHZE 3NS8A 3VTWA 4F1SA 2FNJB 4ZRIA 3WAPA 1LQBA 2MBHA 3NOBA 3V62A 4BKSD 1WXVA 1TBEA 4W9EA 2B3AA 3S2AA 2BGFA 3HK0A 4FJVB 2I1KA 1WJNA 3TBLD 2MLBA 2BYFA 4HK2A 3NY5A 2KTRB 1YX6B 3ZVVA 2IBIB 1UD7A 4I6NB 1RRBA 4ZRKA 1NI2A 4HCPB 1V5TA 3OLMD 1Q1OA 2JUOA 2R2QA 4ICVA 2L0FA 4WWPA 3EFUA 3L13A 4GMVA 3VQIA 5JZEB 2BKFA 1V9JA 4BFRA 4JIOU 3T8MA 5JH5C 4J6IA 1SE9A 4KDIC 2K6DB 2AWTA 3RYTA 3NZSA 4LJPB 1YQBA 5LXIB 3OJ3A 3ENEA 1WGDA 4GSWA 2NR2A 3M62B 1IYFA 4E3CA 2KX3A 4DHZB 2DZIA 1GNUA 4B6WA 4RM9A 1WYWB 2N9PC 5DPRA 1LFDA 4FULA 2FCSA 5HKHA 3TJPA 3WA0A 2IO2B 4TV3A 2KC1A 1TGZB 3DBRI 5G55A 4WWOA 2KXJA 4PYZA 3RUIB 3VUXA 2M8SA 1K8RB 1V80A 1KOTA 5D94A 2XEWA 5L95C 3CSFA 2AEHA 1WMHA 2O6VB 5CHVC 1C3TA 3PRZA 3MJWA 2ZPNA 4NAWA 3PV1A 4ICUA 4NQKE 1V6EA 3R66C 2K39A 3ZKJC 4IM3A 2ZVNA 4AWJA 2FAZA 1SIFA 3ZTDA 1Z2MA 3KVFB 4MSMB 2KMAA 3APDA 4URKA 1JRUA 3ZIMA 1EF1A 2L76A 2BWFA 2AL3A 2XK5A 4MGIE 2KDIA 3TCAA 1E7UA 2M0XA 1IP9A 4FJYA 3GOEA 1WE6A 3VDZA 1S1QB 1YIWA 3H6NA 1LXDA 1WF9A 4KZCA 2IY1B 4M8MA 4B95A 2IY0B 3KYCD 3EECA 1E8XA 3DBHI 3M95A 1OGWA 3ONSA 1WXMA 4FA6A 5JHBA 4IM2A 4W9IA 2MBEA 2KJ6A 1TTNA 2YVCA 4GB9A 1R4NI 3VUYA 2IO0B 1UGMA 2V3SA 2FCNA 2PEAA 5IAAC 4CHKA 1IPGA 3DVNV 1GJZA 2D11A 2JZ3B 4GOCA 2JRHA 3QK0A 5CHWA 1D3ZA 3A9JA 2HJ8A 2DAFA 3P2BA 2C5LC 4W9HA 4GDKA 5AZFA 2CS4A 5KHOA 2DZMA 3V60A 2KHWB 2WX0A 1PQSA 2A5UA 3GZNI 3HM3A 3RCZA 2KMCA 2NVUI 2UYZB 4ANVA 4ZRJA 4JGHB 3KUDB 2RR9A 1XT9B 3QX1A 3B0AA 3KUCB 5DPTA 4I6LB 3OAWA 1WR1A 3R3MA 3ZRCA 2L3ZA 2J0MA 2Y5BB 1UELA 4MM3A 4JL9A 2RPQA 3A4RA 3ML8A 1GG3A 2CU1A 3D32A 3MHSD 5JHAA 2MW5A 2DX5B 1UBIA 3DPDA 3PGEA 1WM3A 2V4LA 2NBWB 4W9GA 4AJYB 4EOYA 1YJ1A 3Q3FA 1V2YA 1WMHB 1Y8RC 2CKHB 3QAQA 3VXWA 4BVUC 2W9NA 2DZJA 3IG3A 3PLVA 4K7WA 4FHJA 2I1JA 2KDFB 2KVRA 3RD2A 3PRPB 3QWZB 4MDKE 4TQ1A 3K9OB 2N7EA 2PE9A 3LDZE 1P98A 1UBQA 4KIKA 1L2NA 4IC7B 4DDGD 1KJTA 1KLVA 5EDSA 2Z0EB 2XK5B 2KWUB 4BKTA 2G3QB 2ZCBA 2Z59B 3WAOA 3VH3B 3AU5A 1TZ1A 1QZEA 4G11A 2WX1A 2FCQA 4JLCA 3H1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C7N B;  1U4A A;  2IO1 B;  2L8J A;  4LDT B;  2MX2 A;  4WJN A;  4GN1 A;  4IW0 A;  4WJO A;  3Q3J A;  2CR5 A;  3PPA A;  3H7S A;  2D3G A;  2IYD B;  3A4S C;  3QC8 B;  4MEM A;  3TL5 A;  4WWN A;  5E6O A;  2MBB B;  2M4N A;  4FN2 A;  2LXC A;  2WYQ A;  4G50 A;  2HTH A;  4IWO A;  4CO7 A;  1V86 A;  2MWS B;  2JPH A;  5FR6 A;  3VVW B;  2AL6 A;  3IFW B;  5CTR C;  3VFK A;  3ZLZ A;  4HJK A;  4NPN A;  3A9J B;  2N1V A;  4E74 A;  4BOS C;  2K8B A;  2DYB A;  2L7R A;  1WR6 E;  3QHT A;  2J0J A;  4CYE A;  3H9D A;  3JVZ X;  1RAX A;  2C60 A;  2N9E B;  1EO6 A;  2KFK A;  2KC2 A;  4DBG A;  3AXC A;  1ZW7 A;  3VUW A;  3UIO B;  2LGD A;  2GBK A;  4AJW A;  3I3T B;  3CST A;  3R7Q A;  2NPT A;  4MGK E;  3NHE B;  2JRI B;  5J18 A;  4KDL B;  3N30 A;  4F8C B;  2FID A;  3DDC B;  4ZDV A;  3N3K B;  2LGY A;  2KQS A;  1YD8 U;  4B9K A;  3U30 A;  4DWF A;  3RT3 B;  3PRM B;  2KNB A;  3IVF A;  3K9P B;  1WGG A;  3PRE A;  3T9L A;  3VH4 B;  2KDB A;  3WIM A;  4YL8 A;  3X0W A;  4W9C A;  2OOB B;  3WAM A;  3UQB A;  2KAN A;  3V61 A;  2V1Y A;  2PPH A;  1X1M A;  2K25 A;  4PS3 A;  2VRR B;  3M63 B;  4ANX A;  1WJ6 A;  5TR5 A;  1OQY A;  3QJZ A;  3R7R A;  4KVG B;  3ZNH B;  4BOZ B;  4EKU A;  4K7U A;  4BBN F;  4PS7 A;  2M17 A;  4AP4 C;  3ZNI D;  4II3 B;  2L0T A;  4MH0 E;  1WE7 A;  3OJ4 B;  1YX5 B;  2KJH B;  1WY8 A;  1WX8 A;  2KK8 A;  3JYU A;  3VTU A;  2KKC A;  4DHJ D;  3APF A;  3W1Y A;  2DHZ A;  4TQ0 A;  2KQ7 A;  3PVL A;  2N4F A;  4KIK B;  2D2Q A;  2NS5 A;  3KYD D;  2DZK A;  5BO4 B;  3SDL C;  3A1Q A;  2GBR A;  3ZNZ B;  4HVB A;  2CHZ A;  3HIZ A;  4K7S A;  4KSK C;  3PHW B;  4WQO B;  1OEY A;  4HXD A;  3DVG X;  1WIA A;  3ZUN A;  5D7G A;  2GBJ A;  2K8H A;  2ZVO A;  3CMM B;  2ZNV C;  2DEN B;  2KX0 A;  3EC8 A;  3WAL A;  5KHQ A;  3ZDT A;  1R4M I;  4EZJ A;  4MEL A;  4M0W B;  2KOX A;  2JVC A;  2K6Q A;  2RSU A;  2O2V A;  3DBS A;  3PHX B;  4G0N B;  2A4Z A;  3UIN B;  2J7Q B;  4WJQ A;  1H4R A;  4HCN B;  4AUQ C;  2AYO B;  3NZU A;  3SU8 X;  1RFA A;  4FHK A;  2KTF A;  3HHM A;  4IG7 B;  3TIX A;  4II2 B;  1GUA B;  2K8C A;  4FBJ B;  5LLI A;  5IA7 A;  3IBE A;  1EF5 A;  4BKG A;  5C23 A;  2LJ5 A;  1AAR A;  5GMV A;  3RZW C;  4DDI D;  2MQJ A;  3JSV A;  4NJ6 A;  2D07 B;  2LRU A;  2FCM A;  3H7P A;  4NJ7 A;  2KZR A;  3DVN U;  4A20 A;  4W9L A;  5C1Z A;  1J19 A;  2RGF A;  2GBN A;  4PS8 A;  3PTF C;  3U7D A;  4LCD E;  2EMS A;  2KFK B;  2JT4 B;  2D10 A;  4XX5 A;  4GIV A;  4HLE A;  3ZDM C;  3ALB A;  3PT2 B;  3RZF A;  3SD5 A;  1WXS A;  3L16 A;  4GDL A;  4MGZ E;  2LZ6 A;  4EEW A;  4AOF A;  2NPT B;  4KZ0 A;  1P1A A;  3C0R B;  1WXA A;  4NAW B;  1A5R A;  1E8Z A;  2N7D A;  3L08 A;  1J0G A;  1WZ3 A;  2KN5 A;  3APC A;  4MJS A;  3ZRF A;  2MCN B;  2ZNV B;  2LWP A;  2UWQ A;  3AI5 A;  3HM6 X;  3QA8 A;  2EKE C;  4TUU A;  5DPS A;  2MP2 A;  3VTV A;  2M1M A;  2CHX A;  3L10 B;  3N32 A;  1UH6 A;  2L00 B;  2LAS A;  1WZ0 A;  2KLC A;  5L83 A;  4NY0 A;  2LUE A;  4EUT A;  2KFJ A;  3ZO5 B;  2FIF A;  2FUH B;  3V6E B;  5DCN A;  5CHF A;  1RLF A;  2BYV E;  1E7V A;  4XC2 A;  1P0R A;  2HD5 B;  3QIJ A;  5AZG A;  2LVO A;  2IZV B;  3U8Z A;  3A9K A;  4HDQ A;  5AZH A;  1E8W A;  3QAR A;  3DBL I;  3EHV A;  4W9K A;  4DK5 A;  1GC7 A;  4MSQ B;  1WX7 A;  2CHW A;  3BIN A;  3A1Q B;  1Q5W B;  2DAJ A;  4K81 A;  2MA9 B;  1G6J A;  4HWI B;  4IM0 A;  2OJR A;  1S3S G;  3A33 B;  5AEK B;  4ZYN A;  4LJO B;  1V5O A;  1L7Y A;  1XD3 B;  2PE6 B;  3UIP B;  1HE8 A;  3DOW A;  5CX3 A;  4GDK B;  4FLH A;  1WRD B;  1ZKH A;  2O2V B;  2ZCC A;  2G4D B;  4HPL B;  3CF6 E;  2NCN A;  1I42 A;  4IWQ A;  3TMP B;  3PLU A;  1WX9 A;  3DCG A;  2N9X A;  4A3P A;  4TKN A;  2XBB C;  1J8C A;  1VD2 A;  2JZZ A;  3W1S A;  3V6C B;  3QCA A;  1WM2 A;  1LM8 B;  1WGY A;  3JSV B;  4OVV A;  2NBV B;  3H7P B;  1KM7 A;  4DXA B;  2KLG A;  3PS6 A;  2KJR A;  4RM8 A;  5J2R A;  2QHO A;  1WH3 A;  1C1Y B;  2HE7 A;  2BF8 B;  2WDT B;  4MGY E;  4WJP A;  2IO3 B;  2MSE D;  3PZD A;  2DYO A;  2ZPY A;  3O65 B;  4GU2 A;  2MBQ A;  2LD9 A;  4N9F 4;  2BPS A;  2JXX A;  3VAW A;  2BKR B;  4GDL B;  3B1L X;  3UF8 A;  1WJ4 A;  2KWV B;  3ECI A;  3JW0 X;  4KSL C;  2NBU A;  2ZJD A;  1OTR B;  1H8C A;  3ML9 A;  3RUL A;  2LVQ A;  2LVP A;  4F7Z A;  1P9D U;  4IWP A;  4X57 B;  2KO3 A;  4MJS B;  3KW5 B;  4ANW A;  2MBO A;  4I6P A;  3ZTC A;  4HDO A;  3UQA A;  3L54 A;  4HPM B;  1FXT B;  1CMX B;  3W1S C;  2MP2 B;  5DPW A;  2JF5 A;  5D2M B;  2KTR A;  3MTN B;  2GBM A;  4ASW C;  2BYE A;  3AUL A;  4W9J A;  5E6N A;  4ANU A;  3IHP C;  5LXH A;  2K1F A;  2KDE B;  4IUM B;  4NNJ B;  2JY6 A;  5D6J B;  3VHT C;  3M3J A;  1WJU A;  3DQV A;  3PSE B;  4FAD A;  4XZ4 A;  4NQL B;  2LRW A;  4PYU A;  4E71 A;  3A9K B;  1NDD A;  1V49 A;  1Z5S B;  2BWE S;  3X23 A;  1SGH A;  1EUV B;  3AU4 A;  2DYM A;  4EZL A;  2LGX A;  1WFY A;  2KD0 A;  4W9D A;  2R2O A;  2C9W B;  4EZK A;  1WGH A;  4W9F A;  2ZZP B;  2J0K A;  1ZGU B;  2ZEQ A;  3UGB B;  2MRP A;  4JQW C;  1F9J A;  4EFO A;  1XQQ A;  2GOW A;  1V81 A;  4LDT D;  4P7I A;  4GXB A;  1OEY J;  2PJH A;  1ISN A;  2C7H A;  5J17 A;  2KWC A;  1BT0 A;  5G2N A;  1I35 A;  1NBF C;  2JWZ A;  3B08 A;  2REX A;  1E90 A;  4K1R B;  4RMA A;  2Z0D B;  3ZW3 A;  4KV2 A;  2EMT A;  3KH0 A;  3L0W B;  5E6P A;  2YLM A;  4OVU A;  3SHQ A;  3WAN A;  4M8N A;  2ASQ A;  1M94 A;  2C7M B;  1E5W A;  1P3Q U;  3BY4 B;  4BBN C;  2O6V A;  4GGQ A;  1WGR A;  2LXA A;  3DVG Y;  2N1W A;  2WWZ A;  4WAA A;  3LJ3 A;  3ZNG C;  3L17 A;  1MG8 A;  2G45 B;  4BKS A;  1T0Y A;  2LI5 A;  4A3O A;  4FJZ A;  2G4S A;  4G3X B;  3QQ8 B;  2GMI C;  2RD0 A;  1GC6 A;  1UZX B;  2L05 A;  2O6V D;  3KUZ A;  1E8Y A;  4DHJ B;  1VCB A;  1WI0 A;  1Q0W B;  4DHZ E;  3NS8 A;  3VTW A;  4F1S A;  2FNJ B;  4ZRI A;  3WAP A;  1LQB A;  2MBH A;  3NOB A;  3V62 A;  4BKS D;  1WXV A;  1TBE A;  4W9E A;  2B3A A;  3S2A A;  2BGF A;  3HK0 A;  4FJV B;  2I1K A;  1WJN A;  3TBL D;  2MLB A;  2BYF A;  4HK2 A;  3NY5 A;  2KTR B;  1YX6 B;  3ZVV A;  2IBI B;  1UD7 A;  4I6N B;  1RRB A;  4ZRK A;  1NI2 A;  4HCP B;  1V5T A;  3OLM D;  1Q1O A;  2JUO A;  2R2Q A;  4ICV A;  2L0F A;  4WWP A;  3EFU A;  3L13 A;  4GMV A;  3VQI A;  5JZE B;  2BKF A;  1V9J A;  4BFR A;  4JIO U;  3T8M A;  5JH5 C;  4J6I A;  1SE9 A;  4KDI C;  2K6D B;  2AWT A;  3RYT A;  3NZS A;  4LJP B;  1YQB A;  5LXI B;  3OJ3 A;  3ENE A;  1WGD A;  4GSW A;  2NR2 A;  3M62 B;  1IYF A;  4E3C A;  2KX3 A;  4DHZ B;  2DZI A;  1GNU A;  4B6W A;  4RM9 A;  1WYW B;  2N9P C;  5DPR A;  1LFD A;  4FUL A;  2FCS A;  5HKH A;  3TJP A;  3WA0 A;  2IO2 B;  4TV3 A;  2KC1 A;  1TGZ B;  3DBR I;  5G55 A;  4WWO A;  2KXJ A;  4PYZ A;  3RUI B;  3VUX A;  2M8S A;  1K8R B;  1V80 A;  1KOT A;  5D94 A;  2XEW A;  5L95 C;  3CSF A;  2AEH A;  1WMH A;  2O6V B;  5CHV C;  1C3T A;  3PRZ A;  3MJW A;  2ZPN A;  4NAW A;  3PV1 A;  4ICU A;  4NQK E;  1V6E A;  3R66 C;  2K39 A;  3ZKJ C;  4IM3 A;  2ZVN A;  4AWJ A;  2FAZ A;  1SIF A;  3ZTD A;  1Z2M A;  3KVF B;  4MSM B;  2KMA A;  3APD A;  4URK A;  1JRU A;  3ZIM A;  1EF1 A;  2L76 A;  2BWF A;  2AL3 A;  2XK5 A;  4MGI E;  2KDI A;  3TCA A;  1E7U A;  2M0X A;  1IP9 A;  4FJY A;  3GOE A;  1WE6 A;  3VDZ A;  1S1Q B;  1YIW A;  3H6N A;  1LXD A;  1WF9 A;  4KZC A;  2IY1 B;  4M8M A;  4B95 A;  2IY0 B;  3KYC D;  3EEC A;  1E8X A;  3DBH I;  3M95 A;  1OGW A;  3ONS A;  1WXM A;  4FA6 A;  5JHB A;  4IM2 A;  4W9I A;  2MBE A;  2KJ6 A;  1TTN A;  2YVC A;  4GB9 A;  1R4N I;  3VUY A;  2IO0 B;  1UGM A;  2V3S A;  2FCN A;  2PEA A;  5IAA C;  4CHK A;  1IPG A;  3DVN V;  1GJZ A;  2D11 A;  2JZ3 B;  4GOC A;  2JRH A;  3QK0 A;  5CHW A;  1D3Z A;  3A9J A;  2HJ8 A;  2DAF A;  3P2B A;  2C5L C;  4W9H A;  4GDK A;  5AZF A;  2CS4 A;  5KHO A;  2DZM A;  3V60 A;  2KHW B;  2WX0 A;  1PQS A;  2A5U A;  3GZN I;  3HM3 A;  3RCZ A;  2KMC A;  2NVU I;  2UYZ B;  4ANV A;  4ZRJ A;  4JGH B;  3KUD B;  2RR9 A;  1XT9 B;  3QX1 A;  3B0A A;  3KUC B;  5DPT A;  4I6L B;  3OAW A;  1WR1 A;  3R3M A;  3ZRC A;  2L3Z A;  2J0M A;  2Y5B B;  1UEL A;  4MM3 A;  4JL9 A;  2RPQ A;  3A4R A;  3ML8 A;  1GG3 A;  2CU1 A;  3D32 A;  3MHS D;  5JHA A;  2MW5 A;  2DX5 B;  1UBI A;  3DPD A;  3PGE A;  1WM3 A;  2V4L A;  2NBW B;  4W9G A;  4AJY B;  4EOY A;  1YJ1 A;  3Q3F A;  1V2Y A;  1WMH B;  1Y8R C;  2CKH B;  3QAQ A;  3VXW A;  4BVU C;  2W9N A;  2DZJ A;  3IG3 A;  3PLV A;  4K7W A;  4FHJ A;  2I1J A;  2KDF B;  2KVR A;  3RD2 A;  3PRP B;  3QWZ B;  4MDK E;  4TQ1 A;  3K9O B;  2N7E A;  2PE9 A;  3LDZ E;  1P98 A;  1UBQ A;  4KIK A;  1L2N A;  4IC7 B;  4DDG D;  1KJT A;  1KLV A;  5EDS A;  2Z0E B;  2XK5 B;  2KWU B;  4BKT A;  2G3Q B;  2ZCB A;  2Z59 B;  3WAO A;  3VH3 B;  3AU5 A;  1TZ1 A;  1QZE A;  4G11 A;  2WX1 A;  2FCQ A;  4JLC A;  3H1U A; 
#chains in the Genus database with same CATH topology
 4WJN A;  1HZ5 A;  4IW0 A;  3Q3J A;  3A4S C;  1F2R I;  1XF5 L;  4WWN A;  1D4B A;  1I4R A;  1JWA D;  2WYQ A;  4M01 A;  3VVW B;  3IFW B;  5MPO A;  4YTM B;  3VFK A;  3FIL B;  1QOB A;  2FUG 1;  4NPN A;  1V1O A;  2PLP A;  4E74 A;  3BK2 A;  1WR6 E;  2PKO A;  2J0J A;  4ZOH C;  3MP9 A;  3H9D A;  2D5G A;  2N9E B;  4JWS C;  2KFK A;  5I4D A;  3VUW A;  2LGD A;  3CWI A;  2GBK A;  3I3T B;  3LYY A;  2G9H D;  2JRI B;  4XYC A;  2WDV B;  3RNF C;  2N9K A;  3DDC B;  2LGY A;  3DBL B;  4B9K A;  1WGG A;  1FNU A;  4YL8 A;  1FFU A;  2OOB B;  3V61 A;  1X1M A;  3M63 B;  1UWX A;  5TR5 A;  3QJZ A;  4KVG B;  4PS7 A;  2M17 A;  1JAL A;  3EUB 2;  2IJ0 A;  1KH0 A;  1WE7 A;  3TEX A;  3JYU A;  4DHJ D;  4TQ0 A;  3PVL A;  4ZHP A;  2D2Q A;  2NS5 A;  5BYQ A;  3AE3 B;  4US9 A;  2GBR A;  3ZUN A;  5D7G A;  2X38 A;  3CMM B;  2DEN B;  2KX0 A;  3EGR A;  3WAL A;  5HFY A;  3ZDT A;  4M0W B;  3NVW A;  3DBS A;  1STE A;  1H4R A;  4HCN B;  4XGA B;  4FHK A;  1E9M A;  3HHM A;  2K8C A;  1FCL A;  4FBJ B;  3GP7 A;  5LLI A;  5IA7 A;  3RZW C;  5FKA C;  2FCM A;  1V8C A;  3DVN U;  1J19 A;  1I4X A;  2BB5 A;  1VLB A;  3U7D A;  2QCZ A;  1LGR A;  4WAF A;  3AEG B;  4C80 A;  3PT2 B;  1MHX A;  4EEW A;  2LZ6 A;  2NPT B;  2Z8L A;  1WXA A;  3H8H A;  4NAW B;  1A5R A;  1WZ3 A;  1E6E B;  4KKJ A;  3U52 E;  1PGX A;  1WZ0 A;  1IBX A;  4NY0 A;  2BYT A;  3IT6 B;  4EUT A;  3ZGZ A;  3P63 A;  2KN4 A;  1KLG D;  2BVC A;  3BII D;  1ZP0 B;  4HDQ A;  1UF0 A;  3EHV A;  1WX7 A;  1YOV B;  3A1Q B;  5JXV A;  1IGD A;  3SFE B;  5AEK B;  1L7Y A;  1MG4 A;  4TSS A;  4GDK B;  4ZYS A;  1I4G A;  3MC9 A;  4HPL B;  3TMP B;  3PLU A;  1IGC A;  3DCG A;  2G1E A;  4TKN A;  4HJG E;  1J8C A;  1NEK B;  2ON8 A;  3DWM A;  1WM2 A;  4RGO S;  2K5P A;  2NBV B;  4DXA B;  3PS6 A;  5E6J A;  2HE7 A;  2QMT A;  2WDT B;  4WJP A;  2DYO A;  2ZPY A;  5G5G A;  2BPS A;  3DWG C;  3VAW A;  2BKR B;  4GDL B;  1WJ4 A;  3ECI A;  2NBU A;  3VRA B;  1MVK A;  2KO3 A;  3LXF A;  4ANW A;  1FXT B;  5D2M B;  3MTN B;  4AS1 A;  1XLO A;  5E6N A;  1EWC A;  1NVI D;  2JY6 A;  3VHT C;  1WJU A;  2ONQ A;  4NQL B;  4PYU A;  2KMM A;  1V49 A;  1Z5S B;  4H2A A;  3DBR B;  1EUV B;  2EKI A;  4EZL A;  2VZK B;  1WFY A;  2KD0 A;  1UUP A;  3Q3O C;  3J9C A;  2C9W B;  4W9F A;  2J0K A;  2LGS A;  2HDE A;  1TJE A;  3ZJU A;  1SBB B;  3P4R B;  2PJH A;  2C7H A;  1JCK B;  1BT0 A;  5G2N A;  1I35 A;  4RMA A;  5BYR A;  2EMT A;  3W2D A;  3WAN A;  1MJD A;  3B2G A;  2O6V A;  1FNW A;  4WAA A;  3L17 A;  3I57 A;  4HRO A;  2QDF A;  1QQR A;  4BKS A;  3N9Y C;  3PZ7 A;  2GMI C;  1GC6 A;  1UZX B;  2O6V D;  3TEZ A;  1E8Y A;  3RI7 C;  1WI0 A;  1Q0W B;  3NS8 A;  2D3A A;  3I9V 1;  4C00 A;  4BKS D;  1ZOY B;  1TBE A;  1NYQ A;  1XXG A;  1WJN A;  3TBL D;  4LNN A;  3VR8 B;  2K22 A;  5IKC M;  1YX6 B;  1FIQ A;  2L1A A;  1C4A A;  2IBI B;  2V3N A;  4HCP B;  1V5T A;  1ENF A;  1Q1O A;  4HKZ E;  4WWP A;  3VQI A;  2BKF A;  3W5U B;  3AEB B;  4J6I A;  4LNO A;  1SE9 A;  1TS4 A;  2AWT A;  5LXI B;  3Q8F A;  1WGD A;  4Q2J A;  4YT0 B;  2DBY A;  3M62 B;  1IYF A;  4E3C A;  2DZI A;  3T3O A;  2JSV X;  3AB5 A;  4B6W A;  3KWL A;  1WYW B;  2BS3 B;  4ZRP A;  2N9P C;  1LFD A;  4FUL A;  4RGM A;  3W5V B;  3TJP A;  2KC1 A;  1TGZ B;  5HHD G;  4NAM A;  3P4Q B;  3RUI B;  2HJ1 A;  2M8S A;  1K8R B;  2BW2 A;  1V80 A;  3AH7 A;  1C3T A;  5CHV C;  4NQK E;  4NAW A;  3PV1 A;  1EU3 A;  4XWW A;  5BMG A;  3ZKJ C;  4AWJ A;  2FAZ A;  3P42 A;  1SIF A;  1PGB A;  3ZTD A;  3KVF B;  4URK A;  1EF1 A;  2BWF A;  4MGI E;  2KDI A;  1E7U A;  4FJY A;  3VDZ A;  1WE6 A;  1VDV A;  2KVZ A;  1NEN B;  2MJ3 A;  4B95 A;  3AN1 A;  3DBH I;  5H8Y E;  3FKY A;  2J4X A;  2KJ6 A;  1R4N I;  2IO0 B;  5IAA C;  2OED A;  2DAF A;  2C5L C;  1F1H A;  4GDK A;  2CS4 A;  2DZM A;  2WXG A;  3TEY A;  2ZW1 A;  3HRD D;  3RCZ A;  4ANV A;  3V05 A;  1DOI A;  3DHG C;  3AE5 B;  3QX1 A;  3KUC B;  4IKG A;  1EWY C;  4I6L B;  1V97 A;  4JL9 A;  1I7H A;  3D32 A;  1VR9 A;  3GE8 C;  2DX5 B;  3PGE A;  1WM3 A;  4W9G A;  1GOZ A;  2WXN A;  3Q3F A;  2CKH B;  3VXW A;  2VH2 A;  2WXH A;  4YTN B;  2W9N A;  3ZJT A;  2PVO D;  4RGN A;  4FHJ A;  2KDF B;  2KVR A;  3BK1 A;  3RD2 A;  2LHE A;  4MDK E;  4DQO C;  1QKZ A;  3LDZ E;  2VH1 A;  4IC7 B;  4DDG D;  5EDS A;  1C79 A;  3Q3N C;  3AEC B;  3WAO A;  1IUE A;  3AU5 A;  1F2R C;  4JLC A;  3MJ5 A;  4LNK A;  2IO1 B;  2WDQ B;  3HUI A;  2CR5 A;  2D3G A;  3I5J C;  3QC8 B;  2EEL A;  2MBB B;  4FN2 A;  4IWO A;  2LXC A;  4QAY A;  3NVY A;  5CTR C;  2NTT A;  1DYQ A;  2DYB A;  1JWS D;  1C77 A;  1RAX A;  1TYG B;  2KC2 A;  3AXC A;  3Q8A A;  4MGK E;  3NHE B;  4KDL B;  1MHH E;  3BVM A;  2FID A;  3N3K B;  2KQS A;  1YD8 U;  4MM3 B;  3U30 A;  3PRM B;  4A90 A;  3PRE A;  3VH4 B;  2KDB A;  3WIM A;  2GLS A;  3WAM A;  3UQB A;  2KAN A;  2V1Y A;  4LNI A;  2VRR B;  4PS3 A;  4BOZ B;  1SB3 C;  4K7U A;  3GB1 A;  4AP4 C;  1FEH A;  2IND C;  3OJ4 B;  1WY8 A;  1C4P A;  1SE4 A;  4YXD B;  4US8 A;  1YN5 A;  4KIK B;  3KYD D;  3NZ3 A;  5BO4 B;  3UI3 A;  3ZNZ B;  4LK0 M;  4HVB A;  2CHZ A;  3HIZ A;  4O1N A;  2W55 A;  1WIA A;  1LO5 D;  2GBJ A;  2K8H A;  2ZNV C;  2OHF A;  5KHQ A;  5IN7 A;  2O2V A;  4WJQ A;  3SU8 X;  1RFA A;  4IG7 B;  1SJE D;  1XCQ L;  1GUA B;  4C4V A;  3NVV A;  3IBE A;  4BKG A;  5GMV A;  2KWD A;  3JSV A;  1AW7 A;  2LRU A;  3H7P A;  4NJ7 A;  3EFC A;  4MH8 A;  5C1Z A;  2RGF A;  3W9C B;  1K50 A;  3RNE C;  3ABV B;  1TZO A;  4HLE A;  3RZF A;  4AOF A;  1E8Z A;  3L08 A;  3N1Y C;  3HM6 X;  4XDD A;  1YQ4 B;  4J3O D;  2EKE C;  4RFB A;  3VTV A;  3N32 A;  3Q8C A;  2L00 B;  2LAS A;  2FIF A;  4A9A A;  5DCN A;  1RLF A;  3QIJ A;  3A9K A;  3VRB B;  1E8W A;  4W9K A;  4DK5 A;  4MSQ B;  1RYJ A;  1TS3 A;  3BIN A;  2CJO A;  2MA9 B;  4HWI B;  2OJR A;  1S3S G;  1ZXI A;  3KQ4 A;  2AQ2 B;  4ZYN A;  1VZ8 A;  1XD3 B;  1HE8 A;  5CX3 A;  4XDC A;  4RF0 A;  3RMK C;  2NCN A;  1FMA D;  2JXT A;  1I42 A;  2KDM A;  1V1P B;  2W3R A;  1TY0 A;  2DLB A;  3RNC C;  2N9L A;  1LM8 B;  2L52 A;  5FR3 A;  2UU7 A;  2Q5W D;  2KJR A;  2RDB C;  1C1Y B;  2BF8 B;  1JW9 D;  2MBQ A;  3Q3M C;  2JQR B;  4N9F 4;  4KSL C;  1OTR B;  4PK1 A;  3ML9 A;  2LVP A;  3AM9 A;  1P9D U;  4X57 B;  4MJS B;  3KW5 B;  1SSN A;  2WXL A;  2JZP A;  1CMX B;  2MP2 B;  5DPW A;  2KTR A;  2GBM A;  2BYE A;  4B0M A;  3AUL A;  3PSE B;  2LRW A;  4E71 A;  1NDD A;  2BWE S;  1SIJ A;  1I4P A;  1P7F A;  4EZK A;  2RDH A;  2ZEQ A;  4JQW C;  2KYW A;  1XQQ A;  4EFO A;  1V81 A;  4GXB A;  1OEY J;  3AE9 B;  2KQ4 X;  3AE1 B;  5J17 A;  1T0S C;  2KWC A;  1NBF C;  5TSS A;  2W54 A;  4KV2 A;  5E6P A;  2YLM A;  1NI3 A;  1TKG A;  3ZXR A;  5EE9 A;  4M8N A;  4YWG G;  1M94 A;  1E5W A;  4BBN C;  3BY4 B;  2N1W A;  2WWZ A;  4A8X C;  3LJ3 A;  3ZNG C;  1MG8 A;  1SE3 A;  4ITK A;  3DBH B;  4G3X B;  3QQ8 B;  3BYT B;  1R4N B;  2RD0 A;  3KUZ A;  1VCB A;  4DHZ E;  3VTW A;  3NOB A;  1T0R C;  4OW0 A;  2QSD A;  2BGF A;  3HK0 A;  4FJV B;  2I1K A;  2BYF A;  1WGK A;  4M00 A;  3NY5 A;  4XE0 A;  2JUO A;  2WS3 B;  1QLB B;  3L13 A;  1XLQ A;  3Q14 C;  5AUI A;  4JIO U;  3T8M A;  5JH5 C;  4KDI C;  2K6D B;  3RYT A;  4LJP B;  3TSS A;  3VR9 B;  1YQB A;  2NR2 A;  4JPS A;  3NJT A;  4DHZ B;  1GNU A;  1M4V A;  3I63 C;  4RM9 A;  2NTS A;  2FCS A;  4A6Q A;  1QOF A;  3ZXV A;  4N59 A;  4WWO A;  1N62 A;  4PYZ A;  1J7C A;  4USA A;  5D94 A;  5L95 C;  2AEH A;  1WMH A;  3PRZ A;  3R8B A;  2ZPN A;  4ICU A;  2K3U A;  1V6E A;  3R66 C;  2ZVN A;  4JWU C;  1J7B A;  2KMA A;  1TS5 A;  3APD A;  5IO9 A;  1JRU A;  2E3T A;  2LFI A;  2N0S B;  2LGI A;  1ROE A;  2AL3 A;  4L2Y A;  3SR6 A;  2Y3A A;  2L83 A;  2M0X A;  1N6Z A;  1T0Q C;  1IP9 A;  1S1Q B;  1YIW A;  2MEK A;  1LXD A;  4BAX A;  2IY1 B;  4C7Z A;  3EEC A;  3M95 A;  1WXM A;  5JHB A;  2MBE A;  3ETR A;  3VUY A;  1VJK A;  2PEA A;  1GJZ A;  2E6X A;  2BS2 B;  2W3S A;  4GOC A;  3FIL A;  3P2B A;  3AE6 B;  1MPE A;  1T6B X;  4WQM A;  2OJW A;  2K0P A;  1PQS A;  1V1P A;  1L6V A;  2UYZ B;  2NVU I;  1GB1 A;  1QIL A;  4JGH B;  3KUD B;  5HI1 A;  2J53 A;  2IGH A;  3OAW A;  1WR1 A;  2L3Z A;  2AX5 A;  2J0M A;  2Y5B B;  1UEL A;  1RM6 C;  1PFD A;  2RPQ A;  3A4R A;  3ML8 A;  1GG3 A;  5JHA A;  1B1Z A;  1D5Z C;  4MT5 A;  4AJY B;  4EOY A;  2H89 B;  3OG5 A;  2YEP B;  4K7W A;  4P6V F;  1R7S A;  1N5W A;  3K9O B;  2N7E A;  2PE9 A;  2K9X A;  2Z0E B;  2XK5 B;  1OFF A;  1QF6 A;  1TZ1 A;  4FXC A;  4G11 A;  2FCQ A;  3U7Z A;  1HEZ E;  4M0W A;  4LDT B;  4WJO A;  4GN1 A;  3H7S A;  1SJH D;  1AWD A;  4MEM A;  3TL5 A;  4DXF A;  5E6O A;  4G50 A;  4CO7 A;  2HTH A;  1V86 A;  3RNB C;  3U4E G;  4ACF A;  2AL6 A;  3NRZ A;  4HJK A;  3A9J B;  1ZE3 D;  4OZC A;  3QHT A;  1B9R A;  1ZW7 A;  3UIO B;  1YN3 A;  2WU2 B;  3MFG A;  3CST A;  3R7Q A;  2NPT A;  1SE2 A;  2WHI A;  1C76 A;  4DWF A;  3RT3 B;  2XN9 C;  1VZ7 A;  3IVF A;  3T9L A;  4W9C A;  3R2T A;  2PPH A;  2GRI A;  2K25 A;  2PVG C;  4ANX A;  1WJ6 A;  3R7R A;  1OQY A;  2LEK A;  3ZNH B;  4EKU A;  3WCQ A;  4II3 B;  2L0T A;  4IOI E;  1L0X B;  3DHH C;  1FRR A;  3SDL C;  2DZK A;  3A1Q A;  4WQO B;  4K7S A;  3PHW B;  4HXD A;  3DVG X;  2ZVO A;  3EC8 A;  1R4M I;  1CK1 A;  2KOX A;  2J52 A;  2RSU A;  3IAM 1;  4G0N B;  2A4Z A;  2J7Q B;  4AUQ C;  2AYO B;  2KTF A;  3TIX A;  1TIF A;  1E7P B;  5C23 A;  2LJ5 A;  1AAR A;  4DDI D;  2MQJ A;  3GE3 C;  1FXA A;  4A20 A;  4W9L A;  2V0G A;  2GBN A;  4PS8 A;  1EU4 A;  1KRH A;  1WSP A;  4LCD E;  2EMS A;  2KFK B;  1FNV A;  2D10 A;  3ZDM C;  3ALB A;  3L16 A;  4GDL A;  1P1A A;  3C0R B;  2N7D A;  1J0G A;  2TSS A;  1AN8 A;  3NG0 A;  3APC A;  3ZRF A;  2ZNV B;  2LWP A;  4CQN A;  4TUU A;  5DPS A;  1EM7 A;  2M1M A;  2CHX A;  1TT5 B;  5L83 A;  3ZO5 B;  1I4H A;  1GAQ B;  5CHF A;  3MC8 A;  2BYV E;  1E7V A;  1P0R A;  5AZG A;  2LVO A;  1YNT E;  1F0Z A;  3AE2 B;  2WLB A;  3AV8 A;  1GC7 A;  2I2Y A;  1XLP A;  1G6J A;  5LNK 1;  2WXI A;  1E10 A;  4LJO B;  2PW9 A;  2PE6 B;  3UIP B;  2V3P A;  3DOW A;  2VZK D;  1WRD B;  3RPF C;  2G4D B;  4IWQ A;  1BUI C;  1WX9 A;  1DGJ A;  2WQY B;  4A3P A;  5BMI A;  4EE2 A;  1VD2 A;  2JZZ A;  2YEP F;  3V6C B;  3QCA A;  3W1S A;  1ACC A;  1N61 A;  1KM7 A;  2KLG A;  1CQV A;  2QHO A;  4MGY E;  2BTE A;  2LMC A;  2IO3 B;  2MSE D;  3PZD A;  2Y5P A;  3O65 B;  4GU2 A;  4OZB A;  2BS4 B;  1L0V B;  4N6E B;  1BXT A;  1MFW A;  2BB6 A;  2ZJD A;  2QIL A;  2MBO A;  2KAJ A;  3ZTC A;  1MI0 A;  4HDO A;  3L54 A;  1UNS A;  2JF5 A;  4ASW C;  1C78 A;  3RNG C;  2R61 A;  1IBX B;  2QEJ C;  1QOG A;  4IUM B;  2SAK A;  4NZL B;  4NNJ B;  5D6J B;  2FBW B;  4FAD A;  1JQ4 A;  2MHJ A;  3TUO A;  1SGH A;  2FE8 A;  2DYM A;  2LGX A;  3KLS X;  2R2O A;  2ZZP B;  1AYF A;  2WDR B;  4LDT D;  4P7I A;  1ZDX A;  4JE3 B;  4UDU C;  1ISN A;  1A70 A;  1FRD A;  3B08 A;  2REX A;  1E90 A;  4K1R B;  2Z0D B;  3ZW3 A;  3KH0 A;  1Y56 A;  3SHQ A;  2CU3 A;  4M02 A;  4MAC A;  2WXO A;  2C7M B;  1P3Q U;  1YMH E;  1WGR A;  3DVG Y;  2PTL A;  3BWU D;  3DHI C;  2LI5 A;  5G5H A;  2G4S A;  4YTP B;  3U2S C;  2L05 A;  1ESF A;  2DNF A;  2AQ3 B;  4F1S A;  1LQB A;  3V62 A;  1WXV A;  3AED B;  5D3I B;  3CIR B;  1FD6 A;  1PGA A;  3Q8E A;  3ZVV A;  3L4P A;  3O13 A;  1UD7 A;  4I6N B;  4ZRK A;  1NI2 A;  1F52 A;  1L4Z B;  1SF0 A;  4ICV A;  3EFU A;  5JZE B;  1JRO A;  2RPV A;  1V9J A;  2SEB D;  5AUK A;  1L0Y B;  1HTQ A;  2D3C A;  3AMZ A;  2QJL A;  3ENE A;  4GSW A;  3KWV A;  1CJE A;  1OQQ A;  1PDX A;  4P1C C;  2WXJ A;  5DPR A;  3Q8B A;  5HKH A;  2IO2 B;  1QT9 A;  2AQ1 B;  3E56 A;  4RNA A;  1PYW D;  1UGJ A;  1VZ6 A;  1KLU D;  1N5X A;  3VUX A;  3CSF A;  2O6V B;  3N20 C;  4RCO A;  2K39 A;  4IM3 A;  4KKI A;  4MSM B;  2QC8 A;  3C19 A;  2NMQ A;  4HEA 1;  3ZIM A;  1ZXH A;  1C4C A;  3TCA A;  4KGR A;  1PUT A;  4RH6 A;  3H6N A;  1WF9 A;  4KZC A;  4M8M A;  3MHZ A;  4AQ7 A;  2V4I B;  1E8X A;  3ONS A;  1OGW A;  2INN E;  1TTN A;  1UGM A;  2V3S A;  4CHK A;  1JWU D;  3DVN V;  2D11 A;  2JZ3 B;  2WXR A;  2JRH A;  1D3Z A;  2PMV A;  5AZF A;  4YSZ B;  3Q69 A;  5EE3 A;  2A5U A;  3GZN I;  2XNA C;  4ZRJ A;  3AE4 B;  2JX5 A;  4WH4 A;  3MC0 B;  5DPT A;  3E9S A;  3R3M A;  3ZRC A;  4MM3 A;  1VRA B;  2MW5 A;  4C7Y A;  1UBI A;  2WP9 B;  4GLS C;  4KGS A;  4WWM A;  1YJ1 A;  1V2Y A;  2ICI A;  1Y8R C;  4LLG M;  1TS2 A;  1R4M B;  4BVU C;  2DZJ A;  2WXK A;  3IG3 A;  3TEW A;  2I1J A;  3QWZ B;  3T3N A;  4TMA B;  1XLN A;  1JML A;  1FCC C;  1ET9 A;  1P98 A;  4KIK A;  4LTU A;  1N60 A;  1K53 A;  1KJT A;  2PIA A;  2ZCB A;  2Z59 B;  3VH3 B;  1I4Q A;  1QZE A;  1WXQ A;  3ZYY X;  2WX1 A;  4OZA A;  3H1U A;  1D6E C;  2C7N B;  1U4A A;  2L8J A;  2MX2 A;  3PPA A;  3R2I A;  2WXP A;  2IYD B;  4L23 A;  1TKE A;  2M4N A;  1L6U A;  2MWS B;  2JPH A;  5FR6 A;  2ACZ B;  3ZLZ A;  2N1V A;  1FPY A;  2B76 B;  4BOS C;  2K8B A;  2L7R A;  4CYE A;  3JVZ X;  2C60 A;  1EO6 A;  1KF6 B;  4DBG A;  2JU6 X;  1WWT A;  4AJW A;  4LNF A;  5J18 A;  3N30 A;  1D5X C;  4F8C B;  4ZDV A;  1HQR D;  3ZQ4 A;  2HTM E;  2KNB A;  3K9P B;  1XCT L;  3X0W A;  4ZRQ A;  4ARC A;  3B2F A;  3FAH A;  2LUM A;  2M19 A;  4BBN F;  3ZNI D;  1J7A A;  4MH0 E;  1YX5 B;  2KJH B;  2KK8 A;  1WX8 A;  3VTU A;  3NVZ A;  2KKC A;  3HVD A;  3APF A;  3W1Y A;  2DHZ A;  2KQ7 A;  2N4F A;  1OQR A;  3V3X A;  4KSK C;  1QOA A;  1OEY A;  2D3B A;  3AEF B;  4PT5 A;  5EE1 A;  4EZJ A;  4MEL A;  2JVC A;  2K6Q A;  3C8Y A;  3PHX B;  3B9J A;  3UIN B;  1TKY A;  3NS1 A;  3NZU A;  3RNA C;  1FFV A;  4II2 B;  3AE8 B;  1EF5 A;  1YJJ A;  2MJE A;  4NJ6 A;  2D07 B;  2IPK D;  2KZR A;  2DWQ A;  1XO3 A;  3PTF C;  2LJI A;  4S17 A;  4RGT A;  3IAS 1;  2JT4 B;  4XX5 A;  1DOY A;  4GIV A;  3SD5 A;  1WXS A;  4MGZ E;  4KZ0 A;  1N63 A;  2RDG A;  2KN5 A;  4MJS A;  2MCN B;  2UWQ A;  3AI5 A;  3QA8 A;  4C56 C;  2MP2 A;  4HKQ A;  3OWE B;  1WYG A;  2RMM A;  3L10 B;  1UH6 A;  2WXM A;  3AEA B;  2GI9 A;  2KLC A;  2LUE A;  2KFJ A;  1SEB D;  1ZPS A;  2H88 B;  2QIE B;  2FUH B;  4P1B C;  3V6E B;  4K3C A;  4WUR A;  4XC2 A;  2HD5 B;  3U8Z A;  2IZV B;  5AZH A;  3QAR A;  3DBL I;  1NYR A;  3N1Z C;  2CHW A;  1Q5W B;  2DAJ A;  4K81 A;  4IM0 A;  5HG2 A;  2W82 A;  3A33 B;  1V5O A;  3P1M A;  1YN4 A;  3BZD B;  4FLH A;  1ZKH A;  2O2V B;  2ZCC A;  1TY2 A;  3CF6 E;  3Q6B A;  3Q2A C;  4C4V B;  5GXG B;  3PZ8 A;  2N9X A;  2N7J A;  2XBB C;  1WGY A;  4YSX B;  2BT6 A;  3JSV B;  4N58 A;  4OVV A;  3H7P B;  1GB4 A;  1YJI A;  4RM8 A;  5J2R A;  2WXF A;  1WH3 A;  1WRI A;  3NUH B;  3EA6 A;  3LB8 C;  1HA5 A;  2LD9 A;  2JXX A;  3FC4 A;  3P4S B;  3UF8 A;  3B1L X;  3JW0 X;  2KWV B;  5D3D A;  1Q10 A;  1FO4 A;  1H8C A;  3RUL A;  2LVQ A;  4F7Z A;  2X8X X;  4IWP A;  1P7E A;  4I6P A;  3UQA A;  4HPM B;  2M0A A;  3W1S C;  4P16 A;  2CJN A;  1HTO A;  4W9J A;  1E0Z A;  4ANU A;  3IHP C;  5LXH A;  2K1F A;  2KDE B;  4OHJ A;  1K52 A;  3M3J A;  1CZP A;  3DQV A;  4XZ4 A;  2WNM A;  3A9K B;  2IGG A;  4RF1 A;  3X23 A;  3AU4 A;  4D2K A;  2JWU A;  4W9D A;  4OVZ A;  1WGH A;  3PO0 A;  1UWM A;  2INP E;  1ZGU B;  4A55 A;  3UGB B;  2MRP A;  4HPP A;  1F9J A;  2GOW A;  3GS2 A;  2JWZ A;  5C3J B;  3IXS A;  3L0W B;  4OVU A;  4REZ A;  1K51 A;  2ASQ A;  3SEB A;  3ZJV A;  1ZDV A;  4GGQ A;  2LXA A;  4JX1 C;  2G45 B;  2BQQ A;  1T0Y A;  4A3O A;  2KAC A;  4FJZ A;  2IDY A;  3BVG A;  5EE0 A;  4DHJ B;  3IT4 B;  2FNJ B;  4ZRI A;  3WAP A;  4XWT A;  2MBH A;  4L1B A;  4W9E A;  2B3A A;  3S2A A;  1FM0 D;  2MLB A;  3GZN B;  4HK2 A;  2KTR B;  5BYS A;  3RFZ B;  1JWB D;  1RRB A;  2V9H A;  4KGT A;  3OLM D;  5IP4 D;  2R2Q A;  2L0F A;  4ARI A;  4GMV A;  1YQ3 B;  1T3Q A;  1RWS A;  4BFR A;  2Y5C A;  4WIP A;  3BYY B;  3NZS A;  1D5M C;  1L4D B;  3AEE B;  3OJ3 A;  3HVZ A;  4S0R A;  2MH7 A;  2KX3 A;  4YSY B;  4DXG A;  1C9F A;  1SXT A;  1XEE A;  1KTK A;  2J42 A;  3WA0 A;  4TV3 A;  3DBR I;  5G55 A;  1KFY B;  2KXJ A;  4NJC A;  5H92 C;  4R3D A;  1KOT A;  2I38 A;  2XEW A;  3MJW A;  1ET6 A;  3AE7 B;  2KT7 A;  2MJD A;  1Z2M A;  3SFD B;  1RFK A;  1BML C;  1JRP A;  2L76 A;  2ZW0 A;  2INC C;  2XK5 A;  1GPX A;  3RN9 C;  3GOE A;  4KX6 B;  2WXQ A;  4IDI A;  5C2T B;  2IY0 B;  2LHD A;  3KYC D;  4FA6 A;  5FK9 C;  1DOX A;  4IM2 A;  4W9I A;  4B0E A;  3BVZ A;  1HZ6 A;  2YVC A;  4GB9 A;  2FCN A;  2WGS A;  1IPG A;  5T8I A;  4HRS A;  3QK0 A;  5CHW A;  1L5P A;  3A9J A;  2HJ8 A;  4W9H A;  5KHO A;  3V60 A;  2KHW B;  2IGD A;  1F77 A;  2WX0 A;  3HM3 A;  4BZA A;  2L32 A;  2KMC A;  2RR9 A;  1XT9 B;  4K3B A;  3B0A A;  1T5X D;  2WU5 B;  2CU1 A;  3MHS D;  1ZUD 2;  3DPD A;  2V4L A;  2NBW B;  1WMH B;  3QAQ A;  3PLV A;  4ZHO A;  2GB1 A;  5IOI A;  3N1X C;  3URY A;  3PRP B;  3P4P B;  2BBC A;  4TQ1 A;  1UBQ A;  2JYT A;  1L2N A;  2M56 B;  1KLV A;  2KWU B;  1JWM D;  4BKT A;  2G3Q B;  5BMH A;  1FXI A;  1HXY D;  2JYE A; 
#chains in the Genus database with same CATH homology
 2C7N B;  1U4A A;  2IO1 B;  2L8J A;  4LDT B;  2MX2 A;  4WJN A;  4GN1 A;  4IW0 A;  4WJO A;  3Q3J A;  2CR5 A;  3PPA A;  3H7S A;  2D3G A;  2IYD B;  3A4S C;  3QC8 B;  4MEM A;  3TL5 A;  4WWN A;  5E6O A;  2MBB B;  2M4N A;  4FN2 A;  2LXC A;  2WYQ A;  4G50 A;  2HTH A;  4IWO A;  4CO7 A;  1V86 A;  2MWS B;  2JPH A;  5FR6 A;  3VVW B;  2AL6 A;  3IFW B;  5CTR C;  3VFK A;  3ZLZ A;  4HJK A;  4NPN A;  3A9J B;  2N1V A;  4E74 A;  4BOS C;  2K8B A;  2DYB A;  2L7R A;  1WR6 E;  3QHT A;  2J0J A;  4CYE A;  3H9D A;  3JVZ X;  1RAX A;  2C60 A;  2N9E B;  1EO6 A;  2KFK A;  2KC2 A;  4DBG A;  3AXC A;  1ZW7 A;  3VUW A;  3UIO B;  2LGD A;  2GBK A;  4AJW A;  3I3T B;  3CST A;  3R7Q A;  2NPT A;  4MGK E;  3NHE B;  2JRI B;  5J18 A;  4KDL B;  3N30 A;  4F8C B;  2FID A;  3DDC B;  4ZDV A;  3N3K B;  2LGY A;  2KQS A;  1YD8 U;  4B9K A;  3U30 A;  4DWF A;  3RT3 B;  3PRM B;  2KNB A;  3IVF A;  3K9P B;  1WGG A;  3PRE A;  3T9L A;  3VH4 B;  2KDB A;  3WIM A;  4YL8 A;  3X0W A;  4W9C A;  2OOB B;  3WAM A;  3UQB A;  2KAN A;  3V61 A;  2V1Y A;  2PPH A;  1X1M A;  2K25 A;  4PS3 A;  2VRR B;  3M63 B;  4ANX A;  1WJ6 A;  5TR5 A;  1OQY A;  3QJZ A;  3R7R A;  4KVG B;  3ZNH B;  4BOZ B;  4EKU A;  4K7U A;  4BBN F;  4PS7 A;  2M17 A;  4AP4 C;  3ZNI D;  4II3 B;  2L0T A;  4MH0 E;  1WE7 A;  3OJ4 B;  1YX5 B;  2KJH B;  1WY8 A;  1WX8 A;  2KK8 A;  3JYU A;  3VTU A;  2KKC A;  4DHJ D;  3APF A;  3W1Y A;  2DHZ A;  4TQ0 A;  2KQ7 A;  3PVL A;  2N4F A;  4KIK B;  2D2Q A;  2NS5 A;  3KYD D;  2DZK A;  5BO4 B;  3SDL C;  3A1Q A;  2GBR A;  3ZNZ B;  4HVB A;  2CHZ A;  3HIZ A;  4K7S A;  4KSK C;  3PHW B;  4WQO B;  1OEY A;  4HXD A;  3DVG X;  1WIA A;  3ZUN A;  5D7G A;  2GBJ A;  2K8H A;  2ZVO A;  3CMM B;  2ZNV C;  2DEN B;  2KX0 A;  3EC8 A;  3WAL A;  5KHQ A;  3ZDT A;  1R4M I;  4EZJ A;  4MEL A;  4M0W B;  2KOX A;  2JVC A;  2K6Q A;  2RSU A;  2O2V A;  3DBS A;  3PHX B;  4G0N B;  2A4Z A;  3UIN B;  2J7Q B;  4WJQ A;  1H4R A;  4HCN B;  4AUQ C;  2AYO B;  3NZU A;  3SU8 X;  1RFA A;  4FHK A;  2KTF A;  3HHM A;  4IG7 B;  3TIX A;  4II2 B;  1GUA B;  2K8C A;  4FBJ B;  5LLI A;  5IA7 A;  3IBE A;  1EF5 A;  4BKG A;  5C23 A;  2LJ5 A;  1AAR A;  5GMV A;  3RZW C;  4DDI D;  2MQJ A;  3JSV A;  4NJ6 A;  2D07 B;  2LRU A;  2FCM A;  3H7P A;  4NJ7 A;  2KZR A;  3DVN U;  4A20 A;  4W9L A;  5C1Z A;  1J19 A;  2RGF A;  2GBN A;  4PS8 A;  3PTF C;  3U7D A;  4LCD E;  2EMS A;  2KFK B;  2JT4 B;  2D10 A;  4XX5 A;  4GIV A;  4HLE A;  3ZDM C;  3ALB A;  3PT2 B;  3RZF A;  3SD5 A;  1WXS A;  3L16 A;  4GDL A;  4MGZ E;  2LZ6 A;  4EEW A;  4AOF A;  2NPT B;  4KZ0 A;  1P1A A;  3C0R B;  1WXA A;  4NAW B;  1A5R A;  1E8Z A;  2N7D A;  3L08 A;  1J0G A;  1WZ3 A;  2KN5 A;  3APC A;  4MJS A;  3ZRF A;  2MCN B;  2ZNV B;  2LWP A;  2UWQ A;  3AI5 A;  3HM6 X;  3QA8 A;  2EKE C;  4TUU A;  5DPS A;  2MP2 A;  3VTV A;  2M1M A;  2CHX A;  3L10 B;  3N32 A;  1UH6 A;  2L00 B;  2LAS A;  1WZ0 A;  2KLC A;  5L83 A;  4NY0 A;  2LUE A;  4EUT A;  2KFJ A;  3ZO5 B;  2FIF A;  2FUH B;  3V6E B;  5DCN A;  5CHF A;  1RLF A;  2BYV E;  1E7V A;  4XC2 A;  1P0R A;  2HD5 B;  3QIJ A;  5AZG A;  2LVO A;  2IZV B;  3U8Z A;  3A9K A;  4HDQ A;  5AZH A;  1E8W A;  3QAR A;  3DBL I;  3EHV A;  4W9K A;  4DK5 A;  1GC7 A;  4MSQ B;  1WX7 A;  2CHW A;  3BIN A;  3A1Q B;  1Q5W B;  2DAJ A;  4K81 A;  2MA9 B;  1G6J A;  4HWI B;  4IM0 A;  2OJR A;  1S3S G;  3A33 B;  5AEK B;  4ZYN A;  4LJO B;  1V5O A;  1L7Y A;  1XD3 B;  2PE6 B;  3UIP B;  1HE8 A;  3DOW A;  5CX3 A;  4GDK B;  4FLH A;  1WRD B;  1ZKH A;  2O2V B;  2ZCC A;  2G4D B;  4HPL B;  3CF6 E;  2NCN A;  1I42 A;  4IWQ A;  3TMP B;  3PLU A;  1WX9 A;  3DCG A;  2N9X A;  4A3P A;  4TKN A;  2XBB C;  1J8C A;  1VD2 A;  2JZZ A;  3W1S A;  3V6C B;  3QCA A;  1WM2 A;  1LM8 B;  1WGY A;  3JSV B;  4OVV A;  2NBV B;  3H7P B;  1KM7 A;  4DXA B;  2KLG A;  3PS6 A;  2KJR A;  4RM8 A;  5J2R A;  2QHO A;  1WH3 A;  1C1Y B;  2HE7 A;  2BF8 B;  2WDT B;  4MGY E;  4WJP A;  2IO3 B;  2MSE D;  3PZD A;  2DYO A;  2ZPY A;  3O65 B;  4GU2 A;  2MBQ A;  2LD9 A;  4N9F 4;  2BPS A;  2JXX A;  3VAW A;  2BKR B;  4GDL B;  3B1L X;  3UF8 A;  1WJ4 A;  2KWV B;  3ECI A;  3JW0 X;  4KSL C;  2NBU A;  2ZJD A;  1OTR B;  1H8C A;  3ML9 A;  3RUL A;  2LVQ A;  2LVP A;  4F7Z A;  1P9D U;  4IWP A;  4X57 B;  2KO3 A;  4MJS B;  3KW5 B;  4ANW A;  2MBO A;  4I6P A;  3ZTC A;  4HDO A;  3UQA A;  3L54 A;  4HPM B;  1FXT B;  1CMX B;  3W1S C;  2MP2 B;  5DPW A;  2JF5 A;  5D2M B;  2KTR A;  3MTN B;  2GBM A;  4ASW C;  2BYE A;  3AUL A;  4W9J A;  5E6N A;  4ANU A;  3IHP C;  5LXH A;  2K1F A;  2KDE B;  4IUM B;  4NNJ B;  2JY6 A;  5D6J B;  3VHT C;  3M3J A;  1WJU A;  3DQV A;  3PSE B;  4FAD A;  4XZ4 A;  4NQL B;  2LRW A;  4PYU A;  4E71 A;  3A9K B;  1NDD A;  1V49 A;  1Z5S B;  2BWE S;  3X23 A;  1SGH A;  1EUV B;  3AU4 A;  2DYM A;  4EZL A;  2LGX A;  1WFY A;  2KD0 A;  4W9D A;  2R2O A;  2C9W B;  4EZK A;  1WGH A;  4W9F A;  2ZZP B;  2J0K A;  1ZGU B;  2ZEQ A;  3UGB B;  2MRP A;  4JQW C;  1F9J A;  4EFO A;  1XQQ A;  2GOW A;  1V81 A;  4LDT D;  4P7I A;  4GXB A;  1OEY J;  2PJH A;  1ISN A;  2C7H A;  5J17 A;  2KWC A;  1BT0 A;  5G2N A;  1I35 A;  1NBF C;  2JWZ A;  3B08 A;  2REX A;  1E90 A;  4K1R B;  4RMA A;  2Z0D B;  3ZW3 A;  4KV2 A;  2EMT A;  3KH0 A;  3L0W B;  5E6P A;  2YLM A;  4OVU A;  3SHQ A;  3WAN A;  4M8N A;  2ASQ A;  1M94 A;  2C7M B;  1E5W A;  1P3Q U;  3BY4 B;  4BBN C;  2O6V A;  4GGQ A;  1WGR A;  2LXA A;  3DVG Y;  2N1W A;  2WWZ A;  4WAA A;  3LJ3 A;  3ZNG C;  3L17 A;  1MG8 A;  2G45 B;  4BKS A;  1T0Y A;  2LI5 A;  4A3O A;  4FJZ A;  2G4S A;  4G3X B;  3QQ8 B;  2GMI C;  2RD0 A;  1GC6 A;  1UZX B;  2L05 A;  2O6V D;  3KUZ A;  1E8Y A;  4DHJ B;  1VCB A;  1WI0 A;  1Q0W B;  4DHZ E;  3NS8 A;  3VTW A;  4F1S A;  2FNJ B;  4ZRI A;  3WAP A;  1LQB A;  2MBH A;  3NOB A;  3V62 A;  4BKS D;  1WXV A;  1TBE A;  4W9E A;  2B3A A;  3S2A A;  2BGF A;  3HK0 A;  4FJV B;  2I1K A;  1WJN A;  3TBL D;  2MLB A;  2BYF A;  4HK2 A;  3NY5 A;  2KTR B;  1YX6 B;  3ZVV A;  2IBI B;  1UD7 A;  4I6N B;  1RRB A;  4ZRK A;  1NI2 A;  4HCP B;  1V5T A;  3OLM D;  1Q1O A;  2JUO A;  2R2Q A;  4ICV A;  2L0F A;  4WWP A;  3EFU A;  3L13 A;  4GMV A;  3VQI A;  5JZE B;  2BKF A;  1V9J A;  4BFR A;  4JIO U;  3T8M A;  5JH5 C;  4J6I A;  1SE9 A;  4KDI C;  2K6D B;  2AWT A;  3RYT A;  3NZS A;  4LJP B;  1YQB A;  5LXI B;  3OJ3 A;  3ENE A;  1WGD A;  4GSW A;  2NR2 A;  3M62 B;  1IYF A;  4E3C A;  2KX3 A;  4DHZ B;  2DZI A;  1GNU A;  4B6W A;  4RM9 A;  1WYW B;  2N9P C;  5DPR A;  1LFD A;  4FUL A;  2FCS A;  5HKH A;  3TJP A;  3WA0 A;  2IO2 B;  4TV3 A;  2KC1 A;  1TGZ B;  3DBR I;  5G55 A;  4WWO A;  2KXJ A;  4PYZ A;  3RUI B;  3VUX A;  2M8S A;  1K8R B;  1V80 A;  1KOT A;  5D94 A;  2XEW A;  5L95 C;  3CSF A;  2AEH A;  1WMH A;  2O6V B;  5CHV C;  1C3T A;  3PRZ A;  3MJW A;  2ZPN A;  4NAW A;  3PV1 A;  4ICU A;  4NQK E;  1V6E A;  3R66 C;  2K39 A;  3ZKJ C;  4IM3 A;  2ZVN A;  4AWJ A;  2FAZ A;  1SIF A;  3ZTD A;  1Z2M A;  3KVF B;  4MSM B;  2KMA A;  3APD A;  4URK A;  1JRU A;  3ZIM A;  1EF1 A;  2L76 A;  2BWF A;  2AL3 A;  2XK5 A;  4MGI E;  2KDI A;  3TCA A;  1E7U A;  2M0X A;  1IP9 A;  4FJY A;  3GOE A;  1WE6 A;  3VDZ A;  1S1Q B;  1YIW A;  3H6N A;  1LXD A;  1WF9 A;  4KZC A;  2IY1 B;  4M8M A;  4B95 A;  2IY0 B;  3KYC D;  3EEC A;  1E8X A;  3DBH I;  3M95 A;  1OGW A;  3ONS A;  1WXM A;  4FA6 A;  5JHB A;  4IM2 A;  4W9I A;  2MBE A;  2KJ6 A;  1TTN A;  2YVC A;  4GB9 A;  1R4N I;  3VUY A;  2IO0 B;  1UGM A;  2V3S A;  2FCN A;  2PEA A;  5IAA C;  4CHK A;  1IPG A;  3DVN V;  1GJZ A;  2D11 A;  2JZ3 B;  4GOC A;  2JRH A;  3QK0 A;  5CHW A;  1D3Z A;  3A9J A;  2HJ8 A;  2DAF A;  3P2B A;  2C5L C;  4W9H A;  4GDK A;  5AZF A;  2CS4 A;  5KHO A;  2DZM A;  3V60 A;  2KHW B;  2WX0 A;  1PQS A;  2A5U A;  3GZN I;  3HM3 A;  3RCZ A;  2KMC A;  2NVU I;  2UYZ B;  4ANV A;  4ZRJ A;  4JGH B;  3KUD B;  2RR9 A;  1XT9 B;  3QX1 A;  3B0A A;  3KUC B;  5DPT A;  4I6L B;  3OAW A;  1WR1 A;  3R3M A;  3ZRC A;  2L3Z A;  2J0M A;  2Y5B B;  1UEL A;  4MM3 A;  4JL9 A;  2RPQ A;  3A4R A;  3ML8 A;  1GG3 A;  2CU1 A;  3D32 A;  3MHS D;  5JHA A;  2MW5 A;  2DX5 B;  1UBI A;  3DPD A;  3PGE A;  1WM3 A;  2V4L A;  2NBW B;  4W9G A;  4AJY B;  4EOY A;  1YJ1 A;  3Q3F A;  1V2Y A;  1WMH B;  1Y8R C;  2CKH B;  3QAQ A;  3VXW A;  4BVU C;  2W9N A;  2DZJ A;  3IG3 A;  3PLV A;  4K7W A;  4FHJ A;  2I1J A;  2KDF B;  2KVR A;  3RD2 A;  3PRP B;  3QWZ B;  4MDK E;  4TQ1 A;  3K9O B;  2N7E A;  2PE9 A;  3LDZ E;  1P98 A;  1UBQ A;  4KIK A;  1L2N A;  4IC7 B;  4DDG D;  1KJT A;  1KLV A;  5EDS A;  2Z0E B;  2XK5 B;  2KWU B;  4BKT A;  2G3Q B;  2ZCB A;  2Z59 B;  3WAO A;  3VH3 B;  3AU5 A;  1TZ1 A;  1QZE A;  4G11 A;  2WX1 A;  2FCQ A;  4JLC A;  3H1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...