2CR5A

Solution structure of the ubx domain of d0h8s2298e protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
109
structure length
109
Chain Sequence
GSSGSSGEVPDLPEEPSETAEEVVTVALRCPNGRVLRRRFFKSWNSQVLLDWMMKVGYHKSLYRLSTSFPRRALEVEGGSSLEDIGITVDTVLNVEEKEQSSQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reproduction 8
publication title Solution structure of the UBX domain of D0H8S2298E protein
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 10
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00789 UBX UBX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2cr5A01
3PRPB 2QHOA 3KUCB 4K1RB 4AP4C 2ZPNA 3CSFA 2AWTA 4KV2A 2NR2A 2MBHA 3H9DA 3WANA 2V1YA 2ZEQA 4RM9A 5AEKB 4HCPB 4GN1A 2J0KA 3PZDA 4W9JA 3GZNI 2K39A 2Z59B 1WF9A 4GDKB 2Y5BB 3A9KA 3N3KB 3PVLA 2FAZA 4F1SA 2J0MA 1WIAA 4WQOB 2FIDA 2VRRB 1RLFA 2ZCBA 5C23A 2KWCA 3ENEA 1Q5WB 4MGZE 1LQBA 2AYOB 4NAWB 4W9GA 2KWVB 1XQQA 2RD0A 2LI5A 4MGYE 4MH0E 4II2B 2D3GA 2C7NB 2PEAA 3WAMA 3OJ3A 3IBEA 2D07B 4BKSD 3PRZA 3PV1A 4MEMA 1E5WA 2MBOA 4HLEA 4GDLA 3PLVA 4MJSA 3L08A 1OGWA 1V6EA 3VAWA 2KXJA 4GSWA 4KVGB 4K81A 2BYEA 3NZUA 4P7IA 5EDSA 1WJ4A 3MTNB 1J8CA 2M1MA 2C5LC 1AARA 3CF6E 3IVFA 1WGYA 1JRUA 2GBMA 1EF5A 2IO3B 3ZNGC 1E8WA 1GC7A 2DZJA 2ZPYA 1TBEA 2PPHA 3QAQA 4J6IA 2G3QB 3L0WB 3BY4B 3RYTA 3VTUA 3ZIMA 4LCDE 4X57B 3RUIB 3T9LA 3PS6A 4YL8A 1WGHA 2AL6A 3NY5A 4A3PA 4KDLB 4DBGA 1WM2A 3RULA 2K6QA 3WALA 3U8ZA 4IC7B 3OJ4B 1E90A 2FCSA 3P2BA 3SD5A 4IM3A 2KDIA 3TBLD 1V86A 4ZRKA 1C3TA 3A9KB 3PSEB 3V6CB 4LJPB 1Y8RC 4BKTA 3R7QA 1KJTA 3ECIA 4FA6A 3APCA 4WAAA 2K8BA 2K6DB 3ALBA 3KYDD 1VCBA 1OQYA 1WX7A 4XC2A 2NBVB 4EZJA 4WJNA 2NPTA 2C7HA 3H1UA 2W9NA 2DYOA 4GMVA 2L76A 5TR5A 2O6VD 3VDZA 4GDLB 4F7ZA 4MJSB 4AUQC 2KQ7A 3DCGA 4RM8A 1P1AA 1V2YA 3QHTA 2C60A 2LXAA 4NJ7A 5AZHA 4HK2A 3A9JA 3PHWB 4NQLB 2JT4B 4KZCA 2JXXA 5JHAA 4DHJB 4IWOA 2ASQA 1WM3A 4FADA 2DZMA 1WRDB 2D10A 2GBKA 2KD0A 3H6NA 4WWPA 4KZ0A 3JW0X 3QX1A 1UZXB 3UINB 3ZNHB 3EHVA 3LDZE 4AOFA 2EMSA 4DDGD 3ZDTA 1RRBA 2M8SA 3TIXA 2OJRA 4ICVA 4BOSC 4LJOB 4WJOA 3PHXB 1E7UA 3RZWC 4KDIC 4BFRA 3O65B 4RMAA 2KLGA 1KOTA 1H8CA 4ANUA 1V49A 1MG8A 2L3ZA 5D6JB 2L05A 4HDOA 3V61A 4TKNA 1BT0A 1H4RA 1NBFC 2KNBA 3PRMB 3QC8B 5J18A 4TQ1A 5D94A 4BVUC 2G45B 3TL5A 2LVPA 2IO0B 2DZKA 1GC6A 5J17A 1V5TA 4IM0A 5BO4B 3ML8A 2MBBB 1GUAB 2PJHA 4PS7A 2L0TA 2NPTB 1WR1A 1TGZB 1UBIA 3V62A 4BKSA 2N7DA 1V9JA 2KOXA 4HJKA 4G0NB 3EC8A 4W9IA 3QIJA 1WXAA 2FCMA 2PE9A 2OOBB 2HE7A 3SDLC 1G6JA 3A9JB 4EZLA 1V81A 3SHQA 2G4DB 2NCNA 2JRHA 3H7PA 2LWPA 3TCAA 1I35A 3PT2B 4W9HA 4ZRJA 1V80A 2BKRB 1EUVB 1OEYJ 3RCZA 5LXHA 3L10B 2JWZA 3VQIA 2B3AA 3DQVA 1WGRA 2C9WB 1WX9A 1WJNA 4ICUA 3ZTCA 3QCAA 3ZRFA 4GGQA 5E6NA 3WA0A 4M0WB 1S1QB 4HWIB 5CX3A 1X1MA 4TUUA 5KHOA 4DHZE 4W9LA 2CS4A 2MX2A 5LXIB 2IY0B 2N9EB 1IP9A 2DAFA 3NOBA 4I6LB 2N4FA 4BBNF 2KTRA 4DWFA 2N1VA 2ZZPB 2KLCA 3KUZA 3NZSA 4G3XB 4OVUA 4NPNA 2CU1A 2FIFA 1WR6E 2FCQA 4AJWA 5HKHA 4M8MA 1L2NA 3BINA 2BGFA 3W1SA 1YQBA 2K8CA 3M63B 2O6VA 4GOCA 3V60A 1WGGA 4EKUA 1F9JA 3EFUA 3Q3FA 1U4AA 1GG3A 4DDID 4MDKE 4M8NA 2CHXA 1ISNA 2LRUA 5DPWA 3B08A 3H7PB 4W9KA 1WE6A 3UF8A 3DVGY 1WJ6A 1RAXA 1LM8B 5CTRC 4ZDVA 3UQAA 5E6OA 1ZKHA 2L0FA 1YJ1A 3X23A 2NVUI 4MELA 5CHFA 2IO2B 4FHJA 3B1LX 1WGDA 5DPRA 2EMTA 3A1QA 4K7SA 4NNJB 2C7MB 2MW5A 2LASA 2KX3A 4K7WA 4GXBA 2KQSA 4WJPA 4PYUA 2IY1B 2MQJA 4XX5A 3HK0A 2BYVE 2K8HA 2GMIC 1OTRB 4BOZB 1TTNA 4JGHB 1EO6A 2Z0DB 2O2VA 3A4RA 4JL9A 1FXTB 2PE6B 4NQKE 4OVVA 3X0WA 3ZO5B 3JYUA 4WJQA 2JZ3B 2WYQA 2KTRB 3QARA 3ML9A 5CHVC 2LUEA 2D11A 2J0JA 2BPSA 2ZCCA 3OLMD 3QA8A 2IO1B 3DBHI 1E7VA 2K1FA 4PS8A 2CHZA 3IFWB 2MCNB 3DOWA 4HPMB 2DYMA 1UGMA 4K7UA 3PREA 1WMHA 2DAJA 2IBIB 1NI2A 4N9F4 4HPLB 2ZJDA 1UELA 2WX0A 2DHZA 3HM6X 3V6EB 4DK5A 4EFOA 2O6VB 4F8CB 1WFYA 2LGYA 5DPSA 1TZ1A 2WDTB 4GU2A 2MBEA 1A5RA 4A20A 2ZVNA 2CR5A 4HCNB 2LVQA 3CSTA 4KSKC 4NY0A 3OAWA 4GB9A 5DCNA 1WJUA 3H7SA 1V5OA 1HE8A 3AULA 4DXAB 3DVNV 2KFJA 1UD7A 3SU8X 4W9FA 1RFAA 4CYEA 4DHZB 3A1QB 2UYZB 1T0YA 4ANVA 3NHEB 2LRWA 1WX8A 1R4MI 3ZTDA 2YLMA 3HHMA 4EEWA 2MLBA 2ZNVB 2BYFA 3D32A 2O2VB 1K8RB 2LJ5A 1S3SG 1WH3A 4FHKA 5KHQA 1LFDA 3APDA 1E8ZA 3RZFA 1OEYA 3VHTC 5JZEB 2JF5A 3KYCD 2LD9A 4LDTB 2KZRA 3RD2A 2KMCA 1R4NI 2V3SA 3CMMB 4TV3A 2DYBA 4W9CA 3KH0A 2DX5B 3HIZA 4PYZA 1WMHB 3UIPB 1WZ3A 4B9KA 2KO3A 5JH5C 1YX6B 1P98A 2G4SA 2MP2A 1J19A 3KW5B 3M3JA 3VTWA 4FLHA 4EOYA 1XT9B 2JRIB 2KJ6A 3DBSA 3VVWB 4NJ6A 2L7RA 3L16A 3LJ3A 4MM3A 1WY8A 2I1KA 3PPAA 4HXDA 2WWZA 4I6NB 3B0AA 2KWUB 1YD8U 2LZ6A 2MWSB 4I6PA 4KIKA 3I3TB 3QQ8B 5LLIA 2JPHA 4IM2A 2LGXA 1KLVA 3ZVVA 2KVRA 3UIOB 4E3CA 2AL3A 2ZVOA 1I42A 1SE9A 3ZRCA 2KTFA 5G55A 1L7YA 3ZKJC 3K9PB 3AU5A 5L83A 1P9DU 1WXMA 1KM7A 3N32A 2DENB 1LXDA 3VUYA 2REXA 3IG3A 4ZRIA 3VH4B 2GOWA 2MA9B 3PTFC 2KDFB 3K9OB 2KK8A 3EECA 3TMPB 3MHSD 4G50A 2BWES 3ZUNA 3DBLI 3KUDB 4MGKE 1WI0A 1E8XA 1NDDA 2XK5A 1QZEA 2WX1A 2KJRA 2FUHB 3RT3B 2CKHB 1UBQA 2DZIA 3MJWA 3AI5A 3KVFB 4PS3A 2RR9A 2CHWA 4MSMB 1C1YB 2KC1A 1P0RA 2NS5A 2GBNA 2BF8B 4FN2A 4ANWA 2GBRA 2MP2B 3JSVA 3QWZB 2HTHA 3A4SC 4W9DA 3R7RA 2N9PC 2N1WA 4EZKA 3PGEA 4ANXA 2Z0EB 3DVGX 3VFKA 5D7GA 3ZNID 5E6PA 5IA7A 2BKFA 3R3MA 5DPTA 4KIKB 4HDQA 2YVCA 2K25A 3VUXA 4JQWC 3QK0A 1Z5SB 2KFKA 2D2QA 5G2NA 2IZVB 4G11A 4BBNC 4IUMB 3DVNU 1ZGUB 1SGHA 3M62B 3WAPA 2N7EA 1Q0WB 1Q1OA 2KJHB 2BWFA 4XZ4A 5AZFA 3WIMA 2LGDA 1YX5B 2NBWB 3C0RB 2UWQA 2NBUA 5C1ZA 2R2OA 3ZDMC 4FBJB 4CO7A 1IPGA 1UH6A 1EF1A 2L8JA 1SIFA 4ZYNA 3U30A 4IG7B 4EUTA 3DPDA 3ONSA 2KANA 1Z2MA 3W1YA 3N30A 3ZW3A 1WE7A 4IWQA 4AWJA 3AXCA 3TJPA 3UQBA 2MRPA 2XK5B 3Q3JA 4IW0A 3UGBB 4E74A 3W1SC 2AEHA 2A4ZA 3R66C 3IHPC 3ZNZB 2XEWA 2V4LA 2HJ8A 4FJVB 4WWOA 3T8MA 1WYWB 2IYDB 1VD2A 3QJZA 2KMAA 5GMVA 3S2AA 2J7QB 3JSVB 4DHJD 1J0GA 2MBQA 2KKCA 2KN5A 2JY6A 3L13A 3PLUA 4B6WA 1M94A 2M17A 3VH3B 2A5UA 3VXWA 1ZW7A 4URKA 1GJZA 1XD3B 1GNUA 2KDEB 2I1JA 5J2RA 5CHWA 3APFA 3L54A 4CHKA 1YIWA 5D2MB 1IYFA 4JLCA 4TQ0A 5JHBA 4ASWC 4JIOU 5IAAC 3ZLZA 2HD5B 2RPQA 3HM3A 2KFKB 3AU4A 4W9EA 1WZ0A 2ZNVC 4GDKA 4E71A 4BKGA 3M95A 4AJYB 1CMXB 4FULA 4II3B 2RSUA 1D3ZA 3JVZX 3VUWA 1P3QU 4FJZA 4HVBA 3WAOA 4MGIE 4A3OA 1WXVA 3VTVA 2KHWB 2JZZA 4MSQB 1PQSA 4NAWA 2M4NA 2LXCA 2KC2A 2EKEC 4IWPA 5AZGA 2KDBA 4KSLC 4LDTD 3U7DA 2R2QA 2KX0A 2LVOA 4FJYA 2L00B 2RGFA 1WXSA 3L17A 2JVCA 2M0XA 5L95C 4WWNA 3GOEA 3A33B 3NS8A 4B95A 2N9XA 3DDCB 2MSED 2GBJA 2FCNA 2JUOA 4GIVA 5FR6A 1E8YA 2XBBC 3DBRI 2FNJB
chains in the Genus database with same CATH superfamily
2QHOA 4N6EB 4PT5A 2H89B 3CSFA 4YWGG 4XWTA 2NR2A 1P7EA 2MBHA 4LLGM 4RM9A 3GZNI 1GPXA 1D6EC 1WF9A 3A9KA 2J0MA 1FCLA 1WIAA 4JWSC 3ZQ4A 2FIDA 2KWCA 1NI3A 3AE7B 4MH0E 2XN9C 3OJ3A 4S17A 3DWMA 1NYQA 3R2TA 4HLEA 1SJED 1UF0A 3NZUA 3MTNB 2C5LC 1AARA 2INPE 5HI1A 1JRUA 3TUOA 1E8WA 1TBEA 2PPHA 3BVGA 3VTUA 4LCDE 4YL8A 1N60A 2AL6A 4DBGA 1WM2A 3SFEB 1C4AA 2XNAC 1V86A 4ZRKA 4XDDA 4A55A 4P16A 1I7HA 4WAAA 2K6DB 3NVVA 1D5XC 4XC2A 4EZJA 2WQYB 4GMVA 1LO5D 3VDZA 4MJSB 4YXDB 1P1AA 2MEKA 3QHTA 3SR6A 1XO3A 2DZMA 1WRDB 4MH8A 2GBKA 1V97A 1MHXA 3EHVA 3LDZE 2QC8A 3Q8EA 5FR3A 2KYWA 1VLBA 4RNAA 4WJOA 1E7UA 1I4PA 1L6VA 3AEEB 1CZPA 2ZW0A 1XEEA 1NBFC 2KNBA 3PRMB 4A90A 5J18A 3TL5A 1YJJA 3EGRA 1GC6A 3SEBA 1BMLC 3ML8A 3Q3MC 4BZAA 3V62A 4HJKA 4W9IA 1E9MA 1FNVA 2MJEA 2G4DB 2INNE 2NCNA 3TCAA 2AQ1B 1ROEA 4LNNA 3PT2B 3NS1A 3H8HA 1T6BX 2G1EA 2B3AA 3DQVA 4YTMB 2C9WB 1WJNA 2WXJA 3ZRFA 3I57A 3ZGZA 4DHZE 3ZJTA 2N9EB 3U4EG 3NOBA 2ZZPB 4OVUA 3NZSA 4G3XB 2HJ1A 3P4QB 4K3CA 1D5ZC 3J9CA 2W55A 4GOCA 3V60A 3EFUA 5G5HA 1GG3A 1PFDA 4MDKE 2CHXA 1TKYA 1OQRA 5BMGA 1WE6A 3UF8A 3DVGY 2D3AA 1LM8B 1E7PB 5E6OA 3X23A 3B1LX 1WGDA 4NNJB 4K7SA 1NEKB 2MW5A 4K7WA 4PYUA 4XX5A 4XE0A 2GRIA 3TEWA 2GMIC 1VR9A 1P7FA 2O2VA 4OVVA 1FXTB 2PE6B 4NQKE 2KTRB 5FK9C 5CHVC 3PZ7A 2J0JA 3ZXRA 1TJEA 3DOWA 2WDRB 4YTPB 2QEJC 2ZJDA 4EFOA 3V6EB 4DK5A 2O6VB 3RNBC 1A5RA 1SEBD 3P63A 2NTTA 4NY0A 3BYYB 4GB9A 1WJUA 4RCOA 1C4CA 1V5OA 1HE8A 3AULA 3DVNV 1YMHE 1QKZA 3AE5B 2BTEA 4A8XC 3CIRB 4W9FA 4CYEA 5AUKA 1D4BA 1DOXA 4S0RA 5BMIA 4HEA1 3HHMA 2LMCA 1IBXB 5D3IB 1OEYA 5BYSA 3VHTC 2BVCA 5C2TB 3E9SA 1R4NI 4WURA 2V3SA 2DX5B 2FUG1 1L4DB 1WMHB 1FNUA 4D2KA 2G4SA 5EE9A 1XT9B 3VVWB 1NVID 5HFYA 3PPAA 1UGJA 3RI7C 4I6NB 2LZ6A 4I6PA 5LLIA 2CJOA 3PO0A 5D3DA 1KLVA 2MH7A 1K51A 3UIOB 2ZVOA 2BQQA 2KTFA 2M19A 1SB3C 1LXDA 3VUYA 1J7AA 1XCQL 2REXA 4LTUA 3ZYYX 4B0EA 2W82A 3MHSD 1E8XA 1NDDA 2BBCA 1QZEA 2WX1A 3AI5A 3KVFB 4MSMB 4DXFA 1ZP0B 4ANWA 2GBRA 3W5VB 3P4SB 2MP2B 3JSVA 2RDGA 4W9DA 1FMAD 4MM3B 3DVGX 5D7GA 2R61A 2BKFA 2QCZA 2WXHA 2ICIA 3AB5A 1SF0A 5EE1A 2WXNA 4RH6A 2YVCA 2PVOD 2KFKA 4KKIA 2IZVB 3DVNU 1FIQA 1SGHA 2EKIA 1Q1OA 3WIMA 2LGDA 1FPYA 1YX5B 2WDQB 2LFIA 4CO7A 1IPGA 4ZYNA 2L8JA 1SIFA 1TS5A 3U30A 4EUTA 3NZ3A 1Z2MA 4IWQA 4AQ7A 2MRPA 2J52A 3Q3JA 1SE4A 1ZDVA 3ZNZB 2XEWA 2HJ8A 2BW2A 4WWOA 1TKEA 3QJZA 3P1MA 2KMAA 2KMMA 3S2AA 5LNK1 3I63C 4B6WA 1M94A 1PUTA 4URKA 1GNUA 5CHWA 2MHJA 1I4HA 4JIOU 1KLGD 3ZLZA 1L0YB 2BB6A 1DGJA 3AU4A 3DBLB 4WIPA 1WZ0A 4E71A 1QOAA 4BKGA 1L0VB 3RNAC 1ZUD2 2VH2A 1P3QU 2VZKB 2KHWB 4ZRPA 2R2QA 2KX0A 3IT4B 5C3JB 2WGSA 1WXSA 3L17A 2M0XA 1DOYA 2K0PA 3E56A 4RGOS 4WWNA 1N61A 4RF0A 3GOEA 1MVKA 2MSED 2FCNA 5FR6A 3RNCC 1QF6A 2WP9B 3PRPB 3EUB2 4AP4C 2ZPNA 1PDXA 2AWTA 2V1YA 5AEKB 1JWBD 3AECB 2D3BA 2K22A 4GN1A 4GDKB 3AE6B 4MACA 4F1SA 1HTQA 1T0QC 1RLFA 2ZCBA 4MGZE 1LQBA 2KWVB 4ZHOA 2W3SA 4CQNA 3PRZA 1E6EB 3RNFC 3PLVA 3N20C 3L08A 5I4DA 2KXJA 4KVGB 4K81A 2BYEA 1WJ4A 3CWIA 2M1MA 3CF6E 3WCQA 1WGYA 1EF5A 3T3OA 3ZNGC 2DZJA 2G3QB 3L0WB 3IXSA 2JYTA 3MHZA 1XLNA 4KDLB 1ZXIA 1E90A 4IM3A 2KDIA 1C3TA 1Y8RC 4BKTA 1N63A 3ECIA 2PTLA 1HTOA 2OEDA 3KYDD 1VCBA 3AE9B 3AE1B 1Q10A 2C7HA 5TR5A 4F7ZA 2JWUA 4GDLB 4AUQC 1SSNA 2KQ7A 3DCGA 2C60A 2LXAA 2FE8A 2JSVX 3A9JA 1NYRA 3PHWB 4YSYB 4WWPA 3H6NA 1XCTL 3GZNB 3JW0X 1UZXB 4C00A 1YNTE 1HA5A 1RFKA 2KLGA 5IO9A 1H8CA 1V49A 1MG8A 1H4RA 3QC8B 2G45B 1KF6B 2WS3B 2IGGA 1V5TA 5BO4B 2L0TA 2L1AA 2NPTB 1UBIA 2WXFA 2KOXA 4BKSA 4P1CC 3U7ZA 1I4XA 1ENFA 2HE7A 1L5PA 1V81A 5HHDG 3SHQA 3H7PA 3N1XC 3BWUD 2LGIA 4ZRJA 2BKRB 1EUVB 1C78A 1OEYJ 3RCZA 3L10B 2JWZA 3ZTCA 1WYGA 2LUMA 5E6NA 5AUIA 3OG5A 3WA0A 2PIAA 4M0WB 4OW0A 4HWIB 1X1MA 4W9LA 4I6LB 2N4FA 1MFWA 4ZRQA 2KLCA 2CU1A 4OZCA 1FFVA 2FCQA 4M8MA 1MHHE 3W1SA 1A70A 2DWQA 1WJ6A 1RAXA 2B76B 4ZDVA 3NG0A 4JPSA 2JX5A 3RFZB 1LGRA 4FHJA 2EMTA 3A1QA 2C7MB 3BVMA 2NTSA 1EU4A 2KX3A 4GXBA 4WJPA 3HK0A 1HXYD 4NAMA 4BOZB 1TTNA 1F77A 3Q8CA 2AQ2B 4O1NA 3U2SC 2WYQA 2N0SB 3UI3A 1RWSA 3OLMD 3QA8A 3DBHI 4PS8A 3WAOA 2K1FA 3IFWB 2OHFA 1SBBB 4HPPA 4IDIA 4N9F4 4HPLB 1UELA 1AN8A 2DHZA 2J53A 1N62A 2QILA 3PZ8A 5DPSA 1TZ1A 2WDTB 2MBEA 4A20A 3VR9B 1FO4A 5JXVA 2Q5WD 1YQ3B 2X8XX 3OAWA 5DCNA 2DNFA 3SFDB 1E0ZA 4DXAB 4FXCA 1F0ZA 3URYA 1XXGA 3SU8X 4C7YA 2WHIA 4DHZB 2ZW1A 1R4MI 1VZ8A 2IGDA 2BYFA 3AEDB 1S3SG 3APDA 1E8ZA 3RZFA 5FKAC 2JF5A 2LD9A 2K9XA 3CMMB 3GB1A 2JU6X 3NVYA 4TV3A 1C4PA 3KH0A 2NMQA 4PYZA 1WZ3A 3ZXVA 1YX6B 4C80A 2WU2B 2K5PA 1J19A 3VTWA 5E6JA 4FLHA 1QOFA 3MC9A 3N1YC 3O13A 3DHHC 1QILA 4HXDA 3B0AA 1GB1A 3C8YA 1JWAD 2JPHA 2LJIA 4IM2A 1FXAA 1SE9A 2JXTA 1B1ZA 3Q69A 2QSDA 3ZKJC 4L1BA 5L83A 3DHGC 1KM7A 2PKOA 1K53A 2MA9B 3K9OB 3ZUNA 3KUDB 2FUHB 4ACFA 4L23A 4US8A 1HZ5A 2NS5A 4EZKA 2N9LA 4ANXA 2CJNA 1MPEA 4KIKB 2WXKA 4HDQA 2K25A 2V0GA 1Z5SB 5G2NA 2D2QA 5HG2A 4IUMB 1XLPA 3M62B 1R4NB 2KJHB 4XZ4A 5AZFA 2W3RA 3C0RB 2NBUA 3L4PA 2R2OA 2H88B 2Z8LA 3N30A 3ZW3A 1VZ7A 2XK5B 3IAS1 3P4PB 3IHPC 3T8MA 1WYWB 5GMVA 2K3UA 2J7QB 4DHJD 2KKCA 1ZW7A 1ZPSA 2KDEB 3BZDB 3NRZA 3L54A 4CHKA 5D2MB 1IYFA 2HDEA 3GP7A 1N5WA 4RF1A 2RPQA 3B9JA 3FAHA 4NJCA 1L0XB 4W9EA 2IPKD 3N9YC 3M95A 1QT9A 5GXGB 2RSUA 2PVGC 4MGIE 1F2RI 4MSQB 2M4NA 2EKEC 3U7DA 4K3BA 1QLBB 1MI0A 4FJYA 2JVCA 3RMKC 5L95C 1VRAB 2JZPA 2LGSA 3A33B 4B95A 3DDCB 2JUOA 2XBBC 3DBRI 1AW7A 3P42A 2BT6A 1V1PB 3KUCB 4K1RB 4C4VB 4KV2A 5H8YE 2KVZA 3AMZA 3GS2A 2ACZB 4W9JA 1T0SC 2Y5BB 1F1HA 2LHDA 3FILB 4WQOB 2VRRB 3VRAB 5C23A 1ET9A 3ENEA 1Q5WB 2AYOB 4H2AA 4NAWB 2C7NB 3AE3B 4HKZE 4BKSD 4ZYSA 3PV1A 4MEMA 4HKQA 1E5WA 1XLOA 4MJSA 4HRSA 3VAWA 4GSWA 4P7IA 3IVFA 1FD6A 4ARIA 3NVZA 3R2IA 2IO3B 1GC7A 3QAQA 2QJLA 3ZIMA 3RUIB 3PS6A 4A3PA 1WGHA 4Q2JA 2K6QA 2YEPF 4EE2A 3W2DA 4IC7B 2FCSA 1EU3A 3SD5A 3A9KB 3PSEB 2DBYA 3V6CB 4LJPB 1KJTA 4FA6A 4PK1A 3ALBA 4RGTA 2WDVB 1OQYA 1WX7A 5TSSA 2NBVB 4WAFA 4WJNA 2W9NA 3NUHB 2JQRB 4RM8A 4NJ7A 1V2YA 5AZHA 4A6QA 4NQLB 2ON8A 5JHAA 1JW9D 1XF5L 2GB1A 5IN7A 2D10A 2KD0A 3FC4A 2M0AA 4C56C 1V1OA 4AOFA 2EMSA 5IOIA 2M8SA 2WXOA 1TS4A 2OJRA 4ICVA 4BOSC 4LJOB 4WH4A 3PHXB 3RZWC 4BFRA 4KDIC 1YN5A 1KOTA 2IDYA 4MT5A 2L3ZA 5D6JB 4TKNA 2J42A 3ZJUA 1C79A 2QDFA 2WXIA 2LVPA 2KWDA 2DZKA 3BYTB 3MFGA 4IM0A 3KWVA 4PS7A 1ESFA 3AEBB 4QAYA 2N7DA 1V9JA 4G0NB 3EC8A 2FCMA 4TSSA 3SDLC 1G6JA 3AEAB 1GAQB 2JRHA 2LWPA 1I35A 1J7CA 1T0RC 1V80A 4JX1C 1WGRA 2MJDA 4ICUA 1DYQA 1FRDA 4GGQA 1S1QB 5CX3A 4TUUA 2MX2A 3IT6B 5LXIB 2IY0B 3DWGC 3IAM1 4BBNF 2KTRA 4DWFA 3KUZA 1WXQA 3B2FA 5HKHA 3BINA 3OWEB 2BGFA 1FM0D 1YQBA 4NZLB 3M63B 2O6VA 1J7BA 1WGGA 4RGMA 2Y5CA 4EKUA 3Q3FA 1U4AA 4N58A 4DDID 4M8NA 1R7SA 3AV8A 5DPWA 3B08A 4JWUC 5CTRC 1IGCA 3AE2B 2NVUI 1FXIA 4OZAA 1PGAA 1C76A 2LASA 3MP9A 2IY1B 2K8HA 1OTRB 4REZA 4JGHB 1EO6A 3A4RA 4JL9A 4BAXA 2V4IB 1IBXA 4WJQA 2JZ3B 1SJHD 3QARA 4ZOHC 2LUEA 2BPSA 2IO1B 2MCNB 2JYEA 1ACCA 2DYMA 1QQRA 1WMHA 2IBIB 1NI2A 1TYGB 3W5UB 2WX0A 4F8CB 3HM6X 1JRPA 1WFYA 4HCNB 2LVQA 4LNIA 4LNFA 3CSTA 1JWSD 4KSKC 1VZ6A 4DXGA 1I4RA 3H7SA 2GLSA 2KFJA 1RFAA 2AQ3B 1T0YA 4ANVA 2BYTA 3GE8C 1HEZE 1YN4A 3Q8BA 3NHEB 2LRWA 4EEWA 2YLMA 2E3TA 3D32A 2O2VB 4KGSA 2D5GA 1FEHA 2INDC 4LDTB 3KYCD 2KZRA 2N7JA 3ZJVA 2DYBA 4LNKA 3HIZA 3UIPB 2KO3A 1KH0A 4RGNA 3P4RB 2MP2A 3M3JA 4WQMA 4EOYA 2JRIB 3DBSA 4YTNB 1NENB 2L7RA 3L16A 3LJ3A 4MM3A 2I1KA 2WXLA 2WWZA 1KLUD 1XLQA 2MWSB 3I3TB 2WXPA 2LGXA 1AYFA 3Q8AA 3ZVVA 4XGAB 1I42A 2FBWB 3B2GA 3BK2A 3ZRCA 3K9PB 3DBHB 2D3CA 1WXMA 3AEGB 2DENB 3IG3A 4ZRIA 3PTFC 2E6XA 2KDFB 2KK8A 3EECA 2BWES 4MGKE 3BK1A 1BXTA 3HRDD 2KJRA 4HJGE 3RT3B 1UBQA 2DZIA 4PS3A 2CHWA 1P0RA 1VJKA 4FN2A 1QOGA 2BF8B 4P1BC 3A4SC 1OFFA 3R7RA 2N9PC 2N1WA 1RM6C 3PGEA 5MPOA 3VFKA 3R3MA 5DPTA 1R4MB 1YN3A 1N5XA 5IKCM 3QK0A 4B0MA 4G11A 2VH1A 1ET6A 3WAPA 2N7EA 1Q0WB 2BWFA 2UWQA 5C1ZA 4FBJB 1PYWD 2WXQA 4IG7B 3DPDA 3W1YA 1WE7A 3TJPA 3UQBA 3UGBB 4E74A 4GLSC 1K50A 2AEHA 2GI9A 3DHIC 2IYDB 1VD2A 2SEBD 2LEKA 1SXTA 3JSVB 1J0GA 2MBQA 3Q6BA 2KN5A 3PLUA 2M17A 3VXWA 4OZBA 1C9FA 2I38A 2PW9A 1I4GA 2I1JA 5J2RA 1L4ZB 3APFA 2Y5PA 1YIWA 4TQ0A 5JHBA 4XDCA 3HM3A 2KFKB 4XWWA 3AM9A 1YJIA 1CQVA 4GDKA 2CU3A 4AJYB 3KLSX 1GOZA 1D3ZA 2HTME 3JVZX 3VUWA 2JZZA 2KC2A 4IWPA 2KDBA 4ZHPA 4KSLC 2LVOA 3LB8C 2L00B 3KQ4A 1TS3A 3T3NA 3BIID 3AEFB 1MG4A 2N9XA 2GBJA 4GIVA 2WXGA 1E8YA 4DQOC 3Q3OC 3WANA 3H9DA 1GB4A 2RPVA 2ZEQA 2L83A 2TSSA 4HCPB 3AE4B 2J0KA 3PZDA 1FRRA 2K39A 2Z59B 3MJ5A 3N3KB 3PVLA 2FAZA 2V9HA 4W9GA 1XQQA 2RD0A 2LI5A 4N59A 4MGYE 4II2B 2D3GA 2KQ4X 2PEAA 2W54A 3WAMA 3IBEA 2D07B 2MBOA 4C7ZA 4GDLA 4KKJA 1OGWA 1V6EA 3RPFC 3HVDA 5EDSA 1J8CA 1QOBA 2GBMA 1KRHA 3FKYA 2BB5A 2ZPYA 4J6IA 2EELA 3BY4B 3RYTA 1ZDXA 4X57B 3T9LA 1TY0A 3NY5A 2WLBA 3RULA 3WALA 3U8ZA 3OJ4B 1FFUA 3P2BA 2IGHA 4USAA 3TBLD 1C77A 3MC8A 4RFBA 3R7QA 4JE3B 3APCA 1JALA 1F52A 2K8BA 2RMMA 3Q3NC 1TS2A 2NPTA 2WXMA 2BS4B 3H1UA 4AS1A 2DYOA 3TEZA 2L76A 2O6VD 3DBRB 2KDMA 4HK2A 2JT4B 4KZCA 2JXXA 4DHJB 1ZE3D 4IWOA 2ASQA 1WM3A 1SIJA 4FADA 4J3OD 5BYRA 2YEPB 2KT7A 4KZ0A 3QX1A 1UWMA 3UINB 3ZNHB 2BS3B 1YOVB 3AH7A 3ZDTA 1RRBA 4DDGD 3TIXA 3O65B 4RMAA 1WSPA 4ANUA 4M0WA 2L05A 1TIFA 4HDOA 3V61A 1BT0A 1WRIA 4TQ1A 5D94A 4BVUC 4YT0B 2IO0B 1YQ4B 2ONQA 3U52E 4XYCA 5J17A 3Q14C 2MBBB 1GUAB 2PJHA 1FCCC 1WR1A 1TGZB 1JWUD 3I9V1 3QIJA 1WXAA 2PE9A 2OOBB 2RDHA 1DOIA 3A9JB 4EZLA 1L6UA 4P6VF 4W9HA 1MJDA 2I2YA 5LXHA 3RNEC 3VQIA 1T5XD 1WX9A 3LXFA 3QCAA 1D5MC 5BMHA 5KHOA 3RNGC 2G9HD 2CS4A 2PLPA 1IP9A 2DAFA 2UU7A 3MC0B 2N1VA 1PGBA 4NPNA 4TMAB 5EE3A 2FIFA 1WR6E 1UNSA 3NVWA 2RDBC 4AJWA 1L2NA 2LHEA 5IP4D 1UUPA 2K8CA 2M56B 1B9RA 1F9JA 3W9CB 1ISNA 2LRUA 1CK1A 1IGDA 3H7PB 4W9KA 3UQAA 1ZKHA 3KWLA 2L0FA 1YJ1A 1AWDA 4MELA 5CHFA 2IO2B 5DPRA 1WWTA 3ABVB 1F2RC 2KQSA 2MQJA 2BYVE 1KFYB 1STEA 2Z0DB 3X0WA 3ZO5B 3JYUA 3AN1A 4KGTA 3ML9A 4UDUC 2D11A 1WGKA 2ZCCA 1E7VA 2CHZA 4HPMB 4R3DA 2KN4A 1UGMA 4K7UA 2SAKA 2DAJA 3PREA 1RYJA 2LGYA 5EE0A 3TEXA 4GU2A 2ZVNA 2CR5A 3Q2AC 4KGRA 3HVZA 3EFCA 2QMTA 2WU5B 4OHJA 2KACA 1UD7A 3HUIA 1VDVA 3A1QB 2UYZB 3GE3C 1WX8A 3ZTDA 2WXRA 2MLBA 4US9A 2ZNVB 1JROA 1JMLA 1M4VA 1K8RB 2LJ5A 5BYQA 1WH3A 2VZKD 3I5JC 4FHKA 4LK0M 1LFDA 5KHQA 1K52A 5JZEB 1T3QA 2WNMA 2L32A 3RD2A 2KMCA 3N1ZC 5G5GA 3TEYA 4W9CA 4OVZA 2QIEB 4B9KA 2PMVA 5JH5C 1P98A 3KW5B 1TY2A 2KJ6A 4NJ6A 1WY8A 2MJ3A 3C19A 2KWUB 1YD8U 4KIKA 3QQ8B 2KAJA 2KVRA 4E3CA 2AL3A 4ARCA 3AE8B 5G55A 1L7YA 1ZOYB 1OQQA 3AU5A 1E10A 1P9DU 1I4QA 3N32A 4HROA 3VH4B 2GOWA 1HZ6A 1KTKA 3TMPB 4G50A 4YSXB 3DBLI 1WI0A 2X38A 2XK5A 3V05A 2CKHB 2V3NA 3MJWA 5T8IA 2RR9A 1C1YB 2KC1A 2GBNA 3QWZB 2HTHA 4YSZB 2Z0EB 4A9AA 3VRBB 3ZNID 5IA7A 5E6PA 1CJEA 3ETRA 3VUXA 1BUIC 4JQWC 1Y56A 4BBNC 4M01A 1ZGUB 1JCKB 4WWMA 2NBWB 3NJTA 2DLBA 3ZDMC 1UH6A 1EF1A 2INCC 2BS2B 1FNWA 3ONSA 1PGXA 2KANA 1UWXA 4M02A 1JQ4A 4AWJA 3AXCA 3BVZA 4IW0A 2V3PA 3W1SC 2A4ZA 3R66C 1JWMD 2V4LA 4FJVB 1EM7A 3EA6A 1ZXHA 3R8BA 3Q8FA 4ITKA 2JY6A 3L13A 5H92C 3VH3B 2A5UA 4IKGA 3VR8B 1XD3B 1GJZA 4IOIE 1V1PA 4JLCA 2Y3AA 4ASWC 5IAAC 3V3XA 2HD5B 4C4VA 2AX5A 3TSSA 2ZNVC 4LNOA 1CMXB 1TT5B 4FULA 4II3B 3FILA 4M00A 1V8CA 2L52A 2J4XA 1SE3A 4FJZA 4HVBA 4A3OA 1WXVA 4KX6B 4L2YA 3VTVA 4NAWA 1PQSA 2OJWA 2LXCA 2IJ0A 5AZGA 1IUEA 4LDTD 2N9KA 1N6ZA 3RN9C 1EWYC 1TZOA 2RGFA 1HQRD 1SE2A 1TKGA 3NS8A 3LYYA 2FNJB 1EWCA
chains in the Genus database with same CATH topology
3PRPB 2QHOA 3KUCB 4K1RB 4AP4C 2ZPNA 3CSFA 2AWTA 4KV2A 2NR2A 2MBHA 3H9DA 3WANA 2V1YA 2ZEQA 4RM9A 5AEKB 4HCPB 4GN1A 2J0KA 3PZDA 4W9JA 3GZNI 2K39A 2Z59B 1WF9A 4GDKB 2Y5BB 3A9KA 3N3KB 3PVLA 2FAZA 4F1SA 2J0MA 1WIAA 4WQOB 2FIDA 2VRRB 1RLFA 2ZCBA 5C23A 2KWCA 3ENEA 1Q5WB 4MGZE 1LQBA 2AYOB 4NAWB 4W9GA 2KWVB 1XQQA 2RD0A 2LI5A 4MGYE 4MH0E 4II2B 2D3GA 2C7NB 2PEAA 3WAMA 3OJ3A 3IBEA 2D07B 4BKSD 3PRZA 3PV1A 4MEMA 1E5WA 2MBOA 4HLEA 4GDLA 3PLVA 4MJSA 3L08A 1OGWA 1V6EA 3VAWA 2KXJA 4GSWA 4KVGB 4K81A 2BYEA 3NZUA 4P7IA 5EDSA 1WJ4A 3MTNB 1J8CA 2M1MA 2C5LC 1AARA 3CF6E 3IVFA 1WGYA 1JRUA 2GBMA 1EF5A 2IO3B 3ZNGC 1E8WA 1GC7A 2DZJA 2ZPYA 1TBEA 2PPHA 3QAQA 4J6IA 2G3QB 3L0WB 3BY4B 3RYTA 3VTUA 3ZIMA 4LCDE 4X57B 3RUIB 3T9LA 3PS6A 4YL8A 1WGHA 2AL6A 3NY5A 4A3PA 4KDLB 4DBGA 1WM2A 3RULA 2K6QA 3WALA 3U8ZA 4IC7B 3OJ4B 1E90A 2FCSA 3P2BA 3SD5A 4IM3A 2KDIA 3TBLD 1V86A 4ZRKA 1C3TA 3A9KB 3PSEB 3V6CB 4LJPB 1Y8RC 4BKTA 3R7QA 1KJTA 3ECIA 4FA6A 3APCA 4WAAA 2K8BA 2K6DB 3ALBA 3KYDD 1VCBA 1OQYA 1WX7A 4XC2A 2NBVB 4EZJA 4WJNA 2NPTA 2C7HA 3H1UA 2W9NA 2DYOA 4GMVA 2L76A 5TR5A 2O6VD 3VDZA 4GDLB 4F7ZA 4MJSB 4AUQC 2KQ7A 3DCGA 4RM8A 1P1AA 1V2YA 3QHTA 2C60A 2LXAA 4NJ7A 5AZHA 4HK2A 3A9JA 3PHWB 4NQLB 2JT4B 4KZCA 2JXXA 5JHAA 4DHJB 4IWOA 2ASQA 1WM3A 4FADA 2DZMA 1WRDB 2D10A 2GBKA 2KD0A 3H6NA 4WWPA 4KZ0A 3JW0X 3QX1A 1UZXB 3UINB 3ZNHB 3EHVA 3LDZE 4AOFA 2EMSA 4DDGD 3ZDTA 1RRBA 2M8SA 3TIXA 2OJRA 4ICVA 4BOSC 4LJOB 4WJOA 3PHXB 1E7UA 3RZWC 4KDIC 4BFRA 3O65B 4RMAA 2KLGA 1KOTA 1H8CA 4ANUA 1V49A 1MG8A 2L3ZA 5D6JB 2L05A 4HDOA 3V61A 4TKNA 1BT0A 1H4RA 1NBFC 2KNBA 3PRMB 3QC8B 5J18A 4TQ1A 5D94A 4BVUC 2G45B 3TL5A 2LVPA 2IO0B 2DZKA 1GC6A 5J17A 1V5TA 4IM0A 5BO4B 3ML8A 2MBBB 1GUAB 2PJHA 4PS7A 2L0TA 2NPTB 1WR1A 1TGZB 1UBIA 3V62A 4BKSA 2N7DA 1V9JA 2KOXA 4HJKA 4G0NB 3EC8A 4W9IA 3QIJA 1WXAA 2FCMA 2PE9A 2OOBB 2HE7A 3SDLC 1G6JA 3A9JB 4EZLA 1V81A 3SHQA 2G4DB 2NCNA 2JRHA 3H7PA 2LWPA 3TCAA 1I35A 3PT2B 4W9HA 4ZRJA 1V80A 2BKRB 1EUVB 1OEYJ 3RCZA 5LXHA 3L10B 2JWZA 3VQIA 2B3AA 3DQVA 1WGRA 2C9WB 1WX9A 1WJNA 4ICUA 3ZTCA 3QCAA 3ZRFA 4GGQA 5E6NA 3WA0A 4M0WB 1S1QB 4HWIB 5CX3A 1X1MA 4TUUA 5KHOA 4DHZE 4W9LA 2CS4A 2MX2A 5LXIB 2IY0B 2N9EB 1IP9A 2DAFA 3NOBA 4I6LB 2N4FA 4BBNF 2KTRA 4DWFA 2N1VA 2ZZPB 2KLCA 3KUZA 3NZSA 4G3XB 4OVUA 4NPNA 2CU1A 2FIFA 1WR6E 2FCQA 4AJWA 5HKHA 4M8MA 1L2NA 3BINA 2BGFA 3W1SA 1YQBA 2K8CA 3M63B 2O6VA 4GOCA 3V60A 1WGGA 4EKUA 1F9JA 3EFUA 3Q3FA 1U4AA 1GG3A 4DDID 4MDKE 4M8NA 2CHXA 1ISNA 2LRUA 5DPWA 3B08A 3H7PB 4W9KA 1WE6A 3UF8A 3DVGY 1WJ6A 1RAXA 1LM8B 5CTRC 4ZDVA 3UQAA 5E6OA 1ZKHA 2L0FA 1YJ1A 3X23A 2NVUI 4MELA 5CHFA 2IO2B 4FHJA 3B1LX 1WGDA 5DPRA 2EMTA 3A1QA 4K7SA 4NNJB 2C7MB 2MW5A 2LASA 2KX3A 4K7WA 4GXBA 2KQSA 4WJPA 4PYUA 2IY1B 2MQJA 4XX5A 3HK0A 2BYVE 2K8HA 2GMIC 1OTRB 4BOZB 1TTNA 4JGHB 1EO6A 2Z0DB 2O2VA 3A4RA 4JL9A 1FXTB 2PE6B 4NQKE 4OVVA 3X0WA 3ZO5B 3JYUA 4WJQA 2JZ3B 2WYQA 2KTRB 3QARA 3ML9A 5CHVC 2LUEA 2D11A 2J0JA 2BPSA 2ZCCA 3OLMD 3QA8A 2IO1B 3DBHI 1E7VA 2K1FA 4PS8A 2CHZA 3IFWB 2MCNB 3DOWA 4HPMB 2DYMA 1UGMA 4K7UA 3PREA 1WMHA 2DAJA 2IBIB 1NI2A 4N9F4 4HPLB 2ZJDA 1UELA 2WX0A 2DHZA 3HM6X 3V6EB 4DK5A 4EFOA 2O6VB 4F8CB 1WFYA 2LGYA 5DPSA 1TZ1A 2WDTB 4GU2A 2MBEA 1A5RA 4A20A 2ZVNA 2CR5A 4HCNB 2LVQA 3CSTA 4KSKC 4NY0A 3OAWA 4GB9A 5DCNA 1WJUA 3H7SA 1V5OA 1HE8A 3AULA 4DXAB 3DVNV 2KFJA 1UD7A 3SU8X 4W9FA 1RFAA 4CYEA 4DHZB 3A1QB 2UYZB 1T0YA 4ANVA 3NHEB 2LRWA 1WX8A 1R4MI 3ZTDA 2YLMA 3HHMA 4EEWA 2MLBA 2ZNVB 2BYFA 3D32A 2O2VB 1K8RB 2LJ5A 1S3SG 1WH3A 4FHKA 5KHQA 1LFDA 3APDA 1E8ZA 3RZFA 1OEYA 3VHTC 5JZEB 2JF5A 3KYCD 2LD9A 4LDTB 2KZRA 3RD2A 2KMCA 1R4NI 2V3SA 3CMMB 4TV3A 2DYBA 4W9CA 3KH0A 2DX5B 3HIZA 4PYZA 1WMHB 3UIPB 1WZ3A 4B9KA 2KO3A 5JH5C 1YX6B 1P98A 2G4SA 2MP2A 1J19A 3KW5B 3M3JA 3VTWA 4FLHA 4EOYA 1XT9B 2JRIB 2KJ6A 3DBSA 3VVWB 4NJ6A 2L7RA 3L16A 3LJ3A 4MM3A 1WY8A 2I1KA 3PPAA 4HXDA 2WWZA 4I6NB 3B0AA 2KWUB 1YD8U 2LZ6A 2MWSB 4I6PA 4KIKA 3I3TB 3QQ8B 5LLIA 2JPHA 4IM2A 2LGXA 1KLVA 3ZVVA 2KVRA 3UIOB 4E3CA 2AL3A 2ZVOA 1I42A 1SE9A 3ZRCA 2KTFA 5G55A 1L7YA 3ZKJC 3K9PB 3AU5A 5L83A 1P9DU 1WXMA 1KM7A 3N32A 2DENB 1LXDA 3VUYA 2REXA 3IG3A 4ZRIA 3VH4B 2GOWA 2MA9B 3PTFC 2KDFB 3K9OB 2KK8A 3EECA 3TMPB 3MHSD 4G50A 2BWES 3ZUNA 3DBLI 3KUDB 4MGKE 1WI0A 1E8XA 1NDDA 2XK5A 1QZEA 2WX1A 2KJRA 2FUHB 3RT3B 2CKHB 1UBQA 2DZIA 3MJWA 3AI5A 3KVFB 4PS3A 2RR9A 2CHWA 4MSMB 1C1YB 2KC1A 1P0RA 2NS5A 2GBNA 2BF8B 4FN2A 4ANWA 2GBRA 2MP2B 3JSVA 3QWZB 2HTHA 3A4SC 4W9DA 3R7RA 2N9PC 2N1WA 4EZKA 3PGEA 4ANXA 2Z0EB 3DVGX 3VFKA 5D7GA 3ZNID 5E6PA 5IA7A 2BKFA 3R3MA 5DPTA 4KIKB 4HDQA 2YVCA 2K25A 3VUXA 4JQWC 3QK0A 1Z5SB 2KFKA 2D2QA 5G2NA 2IZVB 4G11A 4BBNC 4IUMB 3DVNU 1ZGUB 1SGHA 3M62B 3WAPA 2N7EA 1Q0WB 1Q1OA 2KJHB 2BWFA 4XZ4A 5AZFA 3WIMA 2LGDA 1YX5B 2NBWB 3C0RB 2UWQA 2NBUA 5C1ZA 2R2OA 3ZDMC 4FBJB 4CO7A 1IPGA 1UH6A 1EF1A 2L8JA 1SIFA 4ZYNA 3U30A 4IG7B 4EUTA 3DPDA 3ONSA 2KANA 1Z2MA 3W1YA 3N30A 3ZW3A 1WE7A 4IWQA 4AWJA 3AXCA 3TJPA 3UQBA 2MRPA 2XK5B 3Q3JA 4IW0A 3UGBB 4E74A 3W1SC 2AEHA 2A4ZA 3R66C 3IHPC 3ZNZB 2XEWA 2V4LA 2HJ8A 4FJVB 4WWOA 3T8MA 1WYWB 2IYDB 1VD2A 3QJZA 2KMAA 5GMVA 3S2AA 2J7QB 3JSVB 4DHJD 1J0GA 2MBQA 2KKCA 2KN5A 2JY6A 3L13A 3PLUA 4B6WA 1M94A 2M17A 3VH3B 2A5UA 3VXWA 1ZW7A 4URKA 1GJZA 1XD3B 1GNUA 2KDEB 2I1JA 5J2RA 5CHWA 3APFA 3L54A 4CHKA 1YIWA 5D2MB 1IYFA 4JLCA 4TQ0A 5JHBA 4ASWC 4JIOU 5IAAC 3ZLZA 2HD5B 2RPQA 3HM3A 2KFKB 3AU4A 4W9EA 1WZ0A 2ZNVC 4GDKA 4E71A 4BKGA 3M95A 4AJYB 1CMXB 4FULA 4II3B 2RSUA 1D3ZA 3JVZX 3VUWA 1P3QU 4FJZA 4HVBA 3WAOA 4MGIE 4A3OA 1WXVA 3VTVA 2KHWB 2JZZA 4MSQB 1PQSA 4NAWA 2M4NA 2LXCA 2KC2A 2EKEC 4IWPA 5AZGA 2KDBA 4KSLC 4LDTD 3U7DA 2R2QA 2KX0A 2LVOA 4FJYA 2L00B 2RGFA 1WXSA 3L17A 2JVCA 2M0XA 5L95C 4WWNA 3GOEA 3A33B 3NS8A 4B95A 2N9XA 3DDCB 2MSED 2GBJA 2FCNA 2JUOA 4GIVA 5FR6A 1E8YA 2XBBC 3DBRI 2FNJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRP B;  2QHO A;  3KUC B;  4K1R B;  4AP4 C;  2ZPN A;  3CSF A;  2AWT A;  4KV2 A;  2NR2 A;  2MBH A;  3H9D A;  3WAN A;  2V1Y A;  2ZEQ A;  4RM9 A;  5AEK B;  4HCP B;  4GN1 A;  2J0K A;  3PZD A;  4W9J A;  3GZN I;  2K39 A;  2Z59 B;  1WF9 A;  4GDK B;  2Y5B B;  3A9K A;  3N3K B;  3PVL A;  2FAZ A;  4F1S A;  2J0M A;  1WIA A;  4WQO B;  2FID A;  2VRR B;  1RLF A;  2ZCB A;  5C23 A;  2KWC A;  3ENE A;  1Q5W B;  4MGZ E;  1LQB A;  2AYO B;  4NAW B;  4W9G A;  2KWV B;  1XQQ A;  2RD0 A;  2LI5 A;  4MGY E;  4MH0 E;  4II2 B;  2D3G A;  2C7N B;  2PEA A;  3WAM A;  3OJ3 A;  3IBE A;  2D07 B;  4BKS D;  3PRZ A;  3PV1 A;  4MEM A;  1E5W A;  2MBO A;  4HLE A;  4GDL A;  3PLV A;  4MJS A;  3L08 A;  1OGW A;  1V6E A;  3VAW A;  2KXJ A;  4GSW A;  4KVG B;  4K81 A;  2BYE A;  3NZU A;  4P7I A;  5EDS A;  1WJ4 A;  3MTN B;  1J8C A;  2M1M A;  2C5L C;  1AAR A;  3CF6 E;  3IVF A;  1WGY A;  1JRU A;  2GBM A;  1EF5 A;  2IO3 B;  3ZNG C;  1E8W A;  1GC7 A;  2DZJ A;  2ZPY A;  1TBE A;  2PPH A;  3QAQ A;  4J6I A;  2G3Q B;  3L0W B;  3BY4 B;  3RYT A;  3VTU A;  3ZIM A;  4LCD E;  4X57 B;  3RUI B;  3T9L A;  3PS6 A;  4YL8 A;  1WGH A;  2AL6 A;  3NY5 A;  4A3P A;  4KDL B;  4DBG A;  1WM2 A;  3RUL A;  2K6Q A;  3WAL A;  3U8Z A;  4IC7 B;  3OJ4 B;  1E90 A;  2FCS A;  3P2B A;  3SD5 A;  4IM3 A;  2KDI A;  3TBL D;  1V86 A;  4ZRK A;  1C3T A;  3A9K B;  3PSE B;  3V6C B;  4LJP B;  1Y8R C;  4BKT A;  3R7Q A;  1KJT A;  3ECI A;  4FA6 A;  3APC A;  4WAA A;  2K8B A;  2K6D B;  3ALB A;  3KYD D;  1VCB A;  1OQY A;  1WX7 A;  4XC2 A;  2NBV B;  4EZJ A;  4WJN A;  2NPT A;  2C7H A;  3H1U A;  2W9N A;  2DYO A;  4GMV A;  2L76 A;  5TR5 A;  2O6V D;  3VDZ A;  4GDL B;  4F7Z A;  4MJS B;  4AUQ C;  2KQ7 A;  3DCG A;  4RM8 A;  1P1A A;  1V2Y A;  3QHT A;  2C60 A;  2LXA A;  4NJ7 A;  5AZH A;  4HK2 A;  3A9J A;  3PHW B;  4NQL B;  2JT4 B;  4KZC A;  2JXX A;  5JHA A;  4DHJ B;  4IWO A;  2ASQ A;  1WM3 A;  4FAD A;  2DZM A;  1WRD B;  2D10 A;  2GBK A;  2KD0 A;  3H6N A;  4WWP A;  4KZ0 A;  3JW0 X;  3QX1 A;  1UZX B;  3UIN B;  3ZNH B;  3EHV A;  3LDZ E;  4AOF A;  2EMS A;  4DDG D;  3ZDT A;  1RRB A;  2M8S A;  3TIX A;  2OJR A;  4ICV A;  4BOS C;  4LJO B;  4WJO A;  3PHX B;  1E7U A;  3RZW C;  4KDI C;  4BFR A;  3O65 B;  4RMA A;  2KLG A;  1KOT A;  1H8C A;  4ANU A;  1V49 A;  1MG8 A;  2L3Z A;  5D6J B;  2L05 A;  4HDO A;  3V61 A;  4TKN A;  1BT0 A;  1H4R A;  1NBF C;  2KNB A;  3PRM B;  3QC8 B;  5J18 A;  4TQ1 A;  5D94 A;  4BVU C;  2G45 B;  3TL5 A;  2LVP A;  2IO0 B;  2DZK A;  1GC6 A;  5J17 A;  1V5T A;  4IM0 A;  5BO4 B;  3ML8 A;  2MBB B;  1GUA B;  2PJH A;  4PS7 A;  2L0T A;  2NPT B;  1WR1 A;  1TGZ B;  1UBI A;  3V62 A;  4BKS A;  2N7D A;  1V9J A;  2KOX A;  4HJK A;  4G0N B;  3EC8 A;  4W9I A;  3QIJ A;  1WXA A;  2FCM A;  2PE9 A;  2OOB B;  2HE7 A;  3SDL C;  1G6J A;  3A9J B;  4EZL A;  1V81 A;  3SHQ A;  2G4D B;  2NCN A;  2JRH A;  3H7P A;  2LWP A;  3TCA A;  1I35 A;  3PT2 B;  4W9H A;  4ZRJ A;  1V80 A;  2BKR B;  1EUV B;  1OEY J;  3RCZ A;  5LXH A;  3L10 B;  2JWZ A;  3VQI A;  2B3A A;  3DQV A;  1WGR A;  2C9W B;  1WX9 A;  1WJN A;  4ICU A;  3ZTC A;  3QCA A;  3ZRF A;  4GGQ A;  5E6N A;  3WA0 A;  4M0W B;  1S1Q B;  4HWI B;  5CX3 A;  1X1M A;  4TUU A;  5KHO A;  4DHZ E;  4W9L A;  2CS4 A;  2MX2 A;  5LXI B;  2IY0 B;  2N9E B;  1IP9 A;  2DAF A;  3NOB A;  4I6L B;  2N4F A;  4BBN F;  2KTR A;  4DWF A;  2N1V A;  2ZZP B;  2KLC A;  3KUZ A;  3NZS A;  4G3X B;  4OVU A;  4NPN A;  2CU1 A;  2FIF A;  1WR6 E;  2FCQ A;  4AJW A;  5HKH A;  4M8M A;  1L2N A;  3BIN A;  2BGF A;  3W1S A;  1YQB A;  2K8C A;  3M63 B;  2O6V A;  4GOC A;  3V60 A;  1WGG A;  4EKU A;  1F9J A;  3EFU A;  3Q3F A;  1U4A A;  1GG3 A;  4DDI D;  4MDK E;  4M8N A;  2CHX A;  1ISN A;  2LRU A;  5DPW A;  3B08 A;  3H7P B;  4W9K A;  1WE6 A;  3UF8 A;  3DVG Y;  1WJ6 A;  1RAX A;  1LM8 B;  5CTR C;  4ZDV A;  3UQA A;  5E6O A;  1ZKH A;  2L0F A;  1YJ1 A;  3X23 A;  2NVU I;  4MEL A;  5CHF A;  2IO2 B;  4FHJ A;  3B1L X;  1WGD A;  5DPR A;  2EMT A;  3A1Q A;  4K7S A;  4NNJ B;  2C7M B;  2MW5 A;  2LAS A;  2KX3 A;  4K7W A;  4GXB A;  2KQS A;  4WJP A;  4PYU A;  2IY1 B;  2MQJ A;  4XX5 A;  3HK0 A;  2BYV E;  2K8H A;  2GMI C;  1OTR B;  4BOZ B;  1TTN A;  4JGH B;  1EO6 A;  2Z0D B;  2O2V A;  3A4R A;  4JL9 A;  1FXT B;  2PE6 B;  4NQK E;  4OVV A;  3X0W A;  3ZO5 B;  3JYU A;  4WJQ A;  2JZ3 B;  2WYQ A;  2KTR B;  3QAR A;  3ML9 A;  5CHV C;  2LUE A;  2D11 A;  2J0J A;  2BPS A;  2ZCC A;  3OLM D;  3QA8 A;  2IO1 B;  3DBH I;  1E7V A;  2K1F A;  4PS8 A;  2CHZ A;  3IFW B;  2MCN B;  3DOW A;  4HPM B;  2DYM A;  1UGM A;  4K7U A;  3PRE A;  1WMH A;  2DAJ A;  2IBI B;  1NI2 A;  4N9F 4;  4HPL B;  2ZJD A;  1UEL A;  2WX0 A;  2DHZ A;  3HM6 X;  3V6E B;  4DK5 A;  4EFO A;  2O6V B;  4F8C B;  1WFY A;  2LGY A;  5DPS A;  1TZ1 A;  2WDT B;  4GU2 A;  2MBE A;  1A5R A;  4A20 A;  2ZVN A;  2CR5 A;  4HCN B;  2LVQ A;  3CST A;  4KSK C;  4NY0 A;  3OAW A;  4GB9 A;  5DCN A;  1WJU A;  3H7S A;  1V5O A;  1HE8 A;  3AUL A;  4DXA B;  3DVN V;  2KFJ A;  1UD7 A;  3SU8 X;  4W9F A;  1RFA A;  4CYE A;  4DHZ B;  3A1Q B;  2UYZ B;  1T0Y A;  4ANV A;  3NHE B;  2LRW A;  1WX8 A;  1R4M I;  3ZTD A;  2YLM A;  3HHM A;  4EEW A;  2MLB A;  2ZNV B;  2BYF A;  3D32 A;  2O2V B;  1K8R B;  2LJ5 A;  1S3S G;  1WH3 A;  4FHK A;  5KHQ A;  1LFD A;  3APD A;  1E8Z A;  3RZF A;  1OEY A;  3VHT C;  5JZE B;  2JF5 A;  3KYC D;  2LD9 A;  4LDT B;  2KZR A;  3RD2 A;  2KMC A;  1R4N I;  2V3S A;  3CMM B;  4TV3 A;  2DYB A;  4W9C A;  3KH0 A;  2DX5 B;  3HIZ A;  4PYZ A;  1WMH B;  3UIP B;  1WZ3 A;  4B9K A;  2KO3 A;  5JH5 C;  1YX6 B;  1P98 A;  2G4S A;  2MP2 A;  1J19 A;  3KW5 B;  3M3J A;  3VTW A;  4FLH A;  4EOY A;  1XT9 B;  2JRI B;  2KJ6 A;  3DBS A;  3VVW B;  4NJ6 A;  2L7R A;  3L16 A;  3LJ3 A;  4MM3 A;  1WY8 A;  2I1K A;  3PPA A;  4HXD A;  2WWZ A;  4I6N B;  3B0A A;  2KWU B;  1YD8 U;  2LZ6 A;  2MWS B;  4I6P A;  4KIK A;  3I3T B;  3QQ8 B;  5LLI A;  2JPH A;  4IM2 A;  2LGX A;  1KLV A;  3ZVV A;  2KVR A;  3UIO B;  4E3C A;  2AL3 A;  2ZVO A;  1I42 A;  1SE9 A;  3ZRC A;  2KTF A;  5G55 A;  1L7Y A;  3ZKJ C;  3K9P B;  3AU5 A;  5L83 A;  1P9D U;  1WXM A;  1KM7 A;  3N32 A;  2DEN B;  1LXD A;  3VUY A;  2REX A;  3IG3 A;  4ZRI A;  3VH4 B;  2GOW A;  2MA9 B;  3PTF C;  2KDF B;  3K9O B;  2KK8 A;  3EEC A;  3TMP B;  3MHS D;  4G50 A;  2BWE S;  3ZUN A;  3DBL I;  3KUD B;  4MGK E;  1WI0 A;  1E8X A;  1NDD A;  2XK5 A;  1QZE A;  2WX1 A;  2KJR A;  2FUH B;  3RT3 B;  2CKH B;  1UBQ A;  2DZI A;  3MJW A;  3AI5 A;  3KVF B;  4PS3 A;  2RR9 A;  2CHW A;  4MSM B;  1C1Y B;  2KC1 A;  1P0R A;  2NS5 A;  2GBN A;  2BF8 B;  4FN2 A;  4ANW A;  2GBR A;  2MP2 B;  3JSV A;  3QWZ B;  2HTH A;  3A4S C;  4W9D A;  3R7R A;  2N9P C;  2N1W A;  4EZK A;  3PGE A;  4ANX A;  2Z0E B;  3DVG X;  3VFK A;  5D7G A;  3ZNI D;  5E6P A;  5IA7 A;  2BKF A;  3R3M A;  5DPT A;  4KIK B;  4HDQ A;  2YVC A;  2K25 A;  3VUX A;  4JQW C;  3QK0 A;  1Z5S B;  2KFK A;  2D2Q A;  5G2N A;  2IZV B;  4G11 A;  4BBN C;  4IUM B;  3DVN U;  1ZGU B;  1SGH A;  3M62 B;  3WAP A;  2N7E A;  1Q0W B;  1Q1O A;  2KJH B;  2BWF A;  4XZ4 A;  5AZF A;  3WIM A;  2LGD A;  1YX5 B;  2NBW B;  3C0R B;  2UWQ A;  2NBU A;  5C1Z A;  2R2O A;  3ZDM C;  4FBJ B;  4CO7 A;  1IPG A;  1UH6 A;  1EF1 A;  2L8J A;  1SIF A;  4ZYN A;  3U30 A;  4IG7 B;  4EUT A;  3DPD A;  3ONS A;  2KAN A;  1Z2M A;  3W1Y A;  3N30 A;  3ZW3 A;  1WE7 A;  4IWQ A;  4AWJ A;  3AXC A;  3TJP A;  3UQB A;  2MRP A;  2XK5 B;  3Q3J A;  4IW0 A;  3UGB B;  4E74 A;  3W1S C;  2AEH A;  2A4Z A;  3R66 C;  3IHP C;  3ZNZ B;  2XEW A;  2V4L A;  2HJ8 A;  4FJV B;  4WWO A;  3T8M A;  1WYW B;  2IYD B;  1VD2 A;  3QJZ A;  2KMA A;  5GMV A;  3S2A A;  2J7Q B;  3JSV B;  4DHJ D;  1J0G A;  2MBQ A;  2KKC A;  2KN5 A;  2JY6 A;  3L13 A;  3PLU A;  4B6W A;  1M94 A;  2M17 A;  3VH3 B;  2A5U A;  3VXW A;  1ZW7 A;  4URK A;  1GJZ A;  1XD3 B;  1GNU A;  2KDE B;  2I1J A;  5J2R A;  5CHW A;  3APF A;  3L54 A;  4CHK A;  1YIW A;  5D2M B;  1IYF A;  4JLC A;  4TQ0 A;  5JHB A;  4ASW C;  4JIO U;  5IAA C;  3ZLZ A;  2HD5 B;  2RPQ A;  3HM3 A;  2KFK B;  3AU4 A;  4W9E A;  1WZ0 A;  2ZNV C;  4GDK A;  4E71 A;  4BKG A;  3M95 A;  4AJY B;  1CMX B;  4FUL A;  4II3 B;  2RSU A;  1D3Z A;  3JVZ X;  3VUW A;  1P3Q U;  4FJZ A;  4HVB A;  3WAO A;  4MGI E;  4A3O A;  1WXV A;  3VTV A;  2KHW B;  2JZZ A;  4MSQ B;  1PQS A;  4NAW A;  2M4N A;  2LXC A;  2KC2 A;  2EKE C;  4IWP A;  5AZG A;  2KDB A;  4KSL C;  4LDT D;  3U7D A;  2R2Q A;  2KX0 A;  2LVO A;  4FJY A;  2L00 B;  2RGF A;  1WXS A;  3L17 A;  2JVC A;  2M0X A;  5L95 C;  4WWN A;  3GOE A;  3A33 B;  3NS8 A;  4B95 A;  2N9X A;  3DDC B;  2MSE D;  2GBJ A;  2FCN A;  2JUO A;  4GIV A;  5FR6 A;  1E8Y A;  2XBB C;  3DBR I;  2FNJ B; 
#chains in the Genus database with same CATH topology
 2QHO A;  4N6E B;  4PT5 A;  2H89 B;  3CSF A;  4YWG G;  4XWT A;  2NR2 A;  1P7E A;  2MBH A;  4LLG M;  4RM9 A;  3GZN I;  1GPX A;  1D6E C;  1WF9 A;  3A9K A;  2J0M A;  1FCL A;  1WIA A;  4JWS C;  3ZQ4 A;  2FID A;  2KWC A;  1NI3 A;  3AE7 B;  4MH0 E;  2XN9 C;  3OJ3 A;  4S17 A;  3DWM A;  1NYQ A;  3R2T A;  4HLE A;  1SJE D;  1UF0 A;  3NZU A;  3MTN B;  2C5L C;  1AAR A;  2INP E;  5HI1 A;  1JRU A;  3TUO A;  1E8W A;  1TBE A;  2PPH A;  3BVG A;  3VTU A;  4LCD E;  4YL8 A;  1N60 A;  2AL6 A;  4DBG A;  1WM2 A;  3SFE B;  1C4A A;  2XNA C;  1V86 A;  4ZRK A;  4XDD A;  4A55 A;  4P16 A;  1I7H A;  4WAA A;  2K6D B;  3NVV A;  1D5X C;  4XC2 A;  4EZJ A;  2WQY B;  4GMV A;  1LO5 D;  3VDZ A;  4MJS B;  4YXD B;  1P1A A;  2MEK A;  3QHT A;  3SR6 A;  1XO3 A;  2DZM A;  1WRD B;  4MH8 A;  2GBK A;  1V97 A;  1MHX A;  3EHV A;  3LDZ E;  2QC8 A;  3Q8E A;  5FR3 A;  2KYW A;  1VLB A;  4RNA A;  4WJO A;  1E7U A;  1I4P A;  1L6V A;  3AEE B;  1CZP A;  2ZW0 A;  1XEE A;  1NBF C;  2KNB A;  3PRM B;  4A90 A;  5J18 A;  3TL5 A;  1YJJ A;  3EGR A;  1GC6 A;  3SEB A;  1BML C;  3ML8 A;  3Q3M C;  4BZA A;  3V62 A;  4HJK A;  4W9I A;  1E9M A;  1FNV A;  2MJE A;  2G4D B;  2INN E;  2NCN A;  3TCA A;  2AQ1 B;  1ROE A;  4LNN A;  3PT2 B;  3NS1 A;  3H8H A;  1T6B X;  2G1E A;  2B3A A;  3DQV A;  4YTM B;  2C9W B;  1WJN A;  2WXJ A;  3ZRF A;  3I57 A;  3ZGZ A;  4DHZ E;  3ZJT A;  2N9E B;  3U4E G;  3NOB A;  2ZZP B;  4OVU A;  3NZS A;  4G3X B;  2HJ1 A;  3P4Q B;  4K3C A;  1D5Z C;  3J9C A;  2W55 A;  4GOC A;  3V60 A;  3EFU A;  5G5H A;  1GG3 A;  1PFD A;  4MDK E;  2CHX A;  1TKY A;  1OQR A;  5BMG A;  1WE6 A;  3UF8 A;  3DVG Y;  2D3A A;  1LM8 B;  1E7P B;  5E6O A;  3X23 A;  3B1L X;  1WGD A;  4NNJ B;  4K7S A;  1NEK B;  2MW5 A;  4K7W A;  4PYU A;  4XX5 A;  4XE0 A;  2GRI A;  3TEW A;  2GMI C;  1VR9 A;  1P7F A;  2O2V A;  4OVV A;  1FXT B;  2PE6 B;  4NQK E;  2KTR B;  5FK9 C;  5CHV C;  3PZ7 A;  2J0J A;  3ZXR A;  1TJE A;  3DOW A;  2WDR B;  4YTP B;  2QEJ C;  2ZJD A;  4EFO A;  3V6E B;  4DK5 A;  2O6V B;  3RNB C;  1A5R A;  1SEB D;  3P63 A;  2NTT A;  4NY0 A;  3BYY B;  4GB9 A;  1WJU A;  4RCO A;  1C4C A;  1V5O A;  1HE8 A;  3AUL A;  3DVN V;  1YMH E;  1QKZ A;  3AE5 B;  2BTE A;  4A8X C;  3CIR B;  4W9F A;  4CYE A;  5AUK A;  1D4B A;  1DOX A;  4S0R A;  5BMI A;  4HEA 1;  3HHM A;  2LMC A;  1IBX B;  5D3I B;  1OEY A;  5BYS A;  3VHT C;  2BVC A;  5C2T B;  3E9S A;  1R4N I;  4WUR A;  2V3S A;  2DX5 B;  2FUG 1;  1L4D B;  1WMH B;  1FNU A;  4D2K A;  2G4S A;  5EE9 A;  1XT9 B;  3VVW B;  1NVI D;  5HFY A;  3PPA A;  1UGJ A;  3RI7 C;  4I6N B;  2LZ6 A;  4I6P A;  5LLI A;  2CJO A;  3PO0 A;  5D3D A;  1KLV A;  2MH7 A;  1K51 A;  3UIO B;  2ZVO A;  2BQQ A;  2KTF A;  2M19 A;  1SB3 C;  1LXD A;  3VUY A;  1J7A A;  1XCQ L;  2REX A;  4LTU A;  3ZYY X;  4B0E A;  2W82 A;  3MHS D;  1E8X A;  1NDD A;  2BBC A;  1QZE A;  2WX1 A;  3AI5 A;  3KVF B;  4MSM B;  4DXF A;  1ZP0 B;  4ANW A;  2GBR A;  3W5V B;  3P4S B;  2MP2 B;  3JSV A;  2RDG A;  4W9D A;  1FMA D;  4MM3 B;  3DVG X;  5D7G A;  2R61 A;  2BKF A;  2QCZ A;  2WXH A;  2ICI A;  3AB5 A;  1SF0 A;  5EE1 A;  2WXN A;  4RH6 A;  2YVC A;  2PVO D;  2KFK A;  4KKI A;  2IZV B;  3DVN U;  1FIQ A;  1SGH A;  2EKI A;  1Q1O A;  3WIM A;  2LGD A;  1FPY A;  1YX5 B;  2WDQ B;  2LFI A;  4CO7 A;  1IPG A;  4ZYN A;  2L8J A;  1SIF A;  1TS5 A;  3U30 A;  4EUT A;  3NZ3 A;  1Z2M A;  4IWQ A;  4AQ7 A;  2MRP A;  2J52 A;  3Q3J A;  1SE4 A;  1ZDV A;  3ZNZ B;  2XEW A;  2HJ8 A;  2BW2 A;  4WWO A;  1TKE A;  3QJZ A;  3P1M A;  2KMA A;  2KMM A;  3S2A A;  5LNK 1;  3I63 C;  4B6W A;  1M94 A;  1PUT A;  4URK A;  1GNU A;  5CHW A;  2MHJ A;  1I4H A;  4JIO U;  1KLG D;  3ZLZ A;  1L0Y B;  2BB6 A;  1DGJ A;  3AU4 A;  3DBL B;  4WIP A;  1WZ0 A;  4E71 A;  1QOA A;  4BKG A;  1L0V B;  3RNA C;  1ZUD 2;  2VH2 A;  1P3Q U;  2VZK B;  2KHW B;  4ZRP A;  2R2Q A;  2KX0 A;  3IT4 B;  5C3J B;  2WGS A;  1WXS A;  3L17 A;  2M0X A;  1DOY A;  2K0P A;  3E56 A;  4RGO S;  4WWN A;  1N61 A;  4RF0 A;  3GOE A;  1MVK A;  2MSE D;  2FCN A;  5FR6 A;  3RNC C;  1QF6 A;  2WP9 B;  3PRP B;  3EUB 2;  4AP4 C;  2ZPN A;  1PDX A;  2AWT A;  2V1Y A;  5AEK B;  1JWB D;  3AEC B;  2D3B A;  2K22 A;  4GN1 A;  4GDK B;  3AE6 B;  4MAC A;  4F1S A;  1HTQ A;  1T0Q C;  1RLF A;  2ZCB A;  4MGZ E;  1LQB A;  2KWV B;  4ZHO A;  2W3S A;  4CQN A;  3PRZ A;  1E6E B;  3RNF C;  3PLV A;  3N20 C;  3L08 A;  5I4D A;  2KXJ A;  4KVG B;  4K81 A;  2BYE A;  1WJ4 A;  3CWI A;  2M1M A;  3CF6 E;  3WCQ A;  1WGY A;  1EF5 A;  3T3O A;  3ZNG C;  2DZJ A;  2G3Q B;  3L0W B;  3IXS A;  2JYT A;  3MHZ A;  1XLN A;  4KDL B;  1ZXI A;  1E90 A;  4IM3 A;  2KDI A;  1C3T A;  1Y8R C;  4BKT A;  1N63 A;  3ECI A;  2PTL A;  1HTO A;  2OED A;  3KYD D;  1VCB A;  3AE9 B;  3AE1 B;  1Q10 A;  2C7H A;  5TR5 A;  4F7Z A;  2JWU A;  4GDL B;  4AUQ C;  1SSN A;  2KQ7 A;  3DCG A;  2C60 A;  2LXA A;  2FE8 A;  2JSV X;  3A9J A;  1NYR A;  3PHW B;  4YSY B;  4WWP A;  3H6N A;  1XCT L;  3GZN B;  3JW0 X;  1UZX B;  4C00 A;  1YNT E;  1HA5 A;  1RFK A;  2KLG A;  5IO9 A;  1H8C A;  1V49 A;  1MG8 A;  1H4R A;  3QC8 B;  2G45 B;  1KF6 B;  2WS3 B;  2IGG A;  1V5T A;  5BO4 B;  2L0T A;  2L1A A;  2NPT B;  1UBI A;  2WXF A;  2KOX A;  4BKS A;  4P1C C;  3U7Z A;  1I4X A;  1ENF A;  2HE7 A;  1L5P A;  1V81 A;  5HHD G;  3SHQ A;  3H7P A;  3N1X C;  3BWU D;  2LGI A;  4ZRJ A;  2BKR B;  1EUV B;  1C78 A;  1OEY J;  3RCZ A;  3L10 B;  2JWZ A;  3ZTC A;  1WYG A;  2LUM A;  5E6N A;  5AUI A;  3OG5 A;  3WA0 A;  2PIA A;  4M0W B;  4OW0 A;  4HWI B;  1X1M A;  4W9L A;  4I6L B;  2N4F A;  1MFW A;  4ZRQ A;  2KLC A;  2CU1 A;  4OZC A;  1FFV A;  2FCQ A;  4M8M A;  1MHH E;  3W1S A;  1A70 A;  2DWQ A;  1WJ6 A;  1RAX A;  2B76 B;  4ZDV A;  3NG0 A;  4JPS A;  2JX5 A;  3RFZ B;  1LGR A;  4FHJ A;  2EMT A;  3A1Q A;  2C7M B;  3BVM A;  2NTS A;  1EU4 A;  2KX3 A;  4GXB A;  4WJP A;  3HK0 A;  1HXY D;  4NAM A;  4BOZ B;  1TTN A;  1F77 A;  3Q8C A;  2AQ2 B;  4O1N A;  3U2S C;  2WYQ A;  2N0S B;  3UI3 A;  1RWS A;  3OLM D;  3QA8 A;  3DBH I;  4PS8 A;  3WAO A;  2K1F A;  3IFW B;  2OHF A;  1SBB B;  4HPP A;  4IDI A;  4N9F 4;  4HPL B;  1UEL A;  1AN8 A;  2DHZ A;  2J53 A;  1N62 A;  2QIL A;  3PZ8 A;  5DPS A;  1TZ1 A;  2WDT B;  2MBE A;  4A20 A;  3VR9 B;  1FO4 A;  5JXV A;  2Q5W D;  1YQ3 B;  2X8X X;  3OAW A;  5DCN A;  2DNF A;  3SFD B;  1E0Z A;  4DXA B;  4FXC A;  1F0Z A;  3URY A;  1XXG A;  3SU8 X;  4C7Y A;  2WHI A;  4DHZ B;  2ZW1 A;  1R4M I;  1VZ8 A;  2IGD A;  2BYF A;  3AED B;  1S3S G;  3APD A;  1E8Z A;  3RZF A;  5FKA C;  2JF5 A;  2LD9 A;  2K9X A;  3CMM B;  3GB1 A;  2JU6 X;  3NVY A;  4TV3 A;  1C4P A;  3KH0 A;  2NMQ A;  4PYZ A;  1WZ3 A;  3ZXV A;  1YX6 B;  4C80 A;  2WU2 B;  2K5P A;  1J19 A;  3VTW A;  5E6J A;  4FLH A;  1QOF A;  3MC9 A;  3N1Y C;  3O13 A;  3DHH C;  1QIL A;  4HXD A;  3B0A A;  1GB1 A;  3C8Y A;  1JWA D;  2JPH A;  2LJI A;  4IM2 A;  1FXA A;  1SE9 A;  2JXT A;  1B1Z A;  3Q69 A;  2QSD A;  3ZKJ C;  4L1B A;  5L83 A;  3DHG C;  1KM7 A;  2PKO A;  1K53 A;  2MA9 B;  3K9O B;  3ZUN A;  3KUD B;  2FUH B;  4ACF A;  4L23 A;  4US8 A;  1HZ5 A;  2NS5 A;  4EZK A;  2N9L A;  4ANX A;  2CJN A;  1MPE A;  4KIK B;  2WXK A;  4HDQ A;  2K25 A;  2V0G A;  1Z5S B;  5G2N A;  2D2Q A;  5HG2 A;  4IUM B;  1XLP A;  3M62 B;  1R4N B;  2KJH B;  4XZ4 A;  5AZF A;  2W3R A;  3C0R B;  2NBU A;  3L4P A;  2R2O A;  2H88 B;  2Z8L A;  3N30 A;  3ZW3 A;  1VZ7 A;  2XK5 B;  3IAS 1;  3P4P B;  3IHP C;  3T8M A;  1WYW B;  5GMV A;  2K3U A;  2J7Q B;  4DHJ D;  2KKC A;  1ZW7 A;  1ZPS A;  2KDE B;  3BZD B;  3NRZ A;  3L54 A;  4CHK A;  5D2M B;  1IYF A;  2HDE A;  3GP7 A;  1N5W A;  4RF1 A;  2RPQ A;  3B9J A;  3FAH A;  4NJC A;  1L0X B;  4W9E A;  2IPK D;  3N9Y C;  3M95 A;  1QT9 A;  5GXG B;  2RSU A;  2PVG C;  4MGI E;  1F2R I;  4MSQ B;  2M4N A;  2EKE C;  3U7D A;  4K3B A;  1QLB B;  1MI0 A;  4FJY A;  2JVC A;  3RMK C;  5L95 C;  1VRA B;  2JZP A;  2LGS A;  3A33 B;  4B95 A;  3DDC B;  2JUO A;  2XBB C;  3DBR I;  1AW7 A;  3P42 A;  2BT6 A;  1V1P B;  3KUC B;  4K1R B;  4C4V B;  4KV2 A;  5H8Y E;  2KVZ A;  3AMZ A;  3GS2 A;  2ACZ B;  4W9J A;  1T0S C;  2Y5B B;  1F1H A;  2LHD A;  3FIL B;  4WQO B;  2VRR B;  3VRA B;  5C23 A;  1ET9 A;  3ENE A;  1Q5W B;  2AYO B;  4H2A A;  4NAW B;  2C7N B;  3AE3 B;  4HKZ E;  4BKS D;  4ZYS A;  3PV1 A;  4MEM A;  4HKQ A;  1E5W A;  1XLO A;  4MJS A;  4HRS A;  3VAW A;  4GSW A;  4P7I A;  3IVF A;  1FD6 A;  4ARI A;  3NVZ A;  3R2I A;  2IO3 B;  1GC7 A;  3QAQ A;  2QJL A;  3ZIM A;  3RUI B;  3PS6 A;  4A3P A;  1WGH A;  4Q2J A;  2K6Q A;  2YEP F;  4EE2 A;  3W2D A;  4IC7 B;  2FCS A;  1EU3 A;  3SD5 A;  3A9K B;  3PSE B;  2DBY A;  3V6C B;  4LJP B;  1KJT A;  4FA6 A;  4PK1 A;  3ALB A;  4RGT A;  2WDV B;  1OQY A;  1WX7 A;  5TSS A;  2NBV B;  4WAF A;  4WJN A;  2W9N A;  3NUH B;  2JQR B;  4RM8 A;  4NJ7 A;  1V2Y A;  5AZH A;  4A6Q A;  4NQL B;  2ON8 A;  5JHA A;  1JW9 D;  1XF5 L;  2GB1 A;  5IN7 A;  2D10 A;  2KD0 A;  3FC4 A;  2M0A A;  4C56 C;  1V1O A;  4AOF A;  2EMS A;  5IOI A;  2M8S A;  2WXO A;  1TS4 A;  2OJR A;  4ICV A;  4BOS C;  4LJO B;  4WH4 A;  3PHX B;  3RZW C;  4BFR A;  4KDI C;  1YN5 A;  1KOT A;  2IDY A;  4MT5 A;  2L3Z A;  5D6J B;  4TKN A;  2J42 A;  3ZJU A;  1C79 A;  2QDF A;  2WXI A;  2LVP A;  2KWD A;  2DZK A;  3BYT B;  3MFG A;  4IM0 A;  3KWV A;  4PS7 A;  1ESF A;  3AEB B;  4QAY A;  2N7D A;  1V9J A;  4G0N B;  3EC8 A;  2FCM A;  4TSS A;  3SDL C;  1G6J A;  3AEA B;  1GAQ B;  2JRH A;  2LWP A;  1I35 A;  1J7C A;  1T0R C;  1V80 A;  4JX1 C;  1WGR A;  2MJD A;  4ICU A;  1DYQ A;  1FRD A;  4GGQ A;  1S1Q B;  5CX3 A;  4TUU A;  2MX2 A;  3IT6 B;  5LXI B;  2IY0 B;  3DWG C;  3IAM 1;  4BBN F;  2KTR A;  4DWF A;  3KUZ A;  1WXQ A;  3B2F A;  5HKH A;  3BIN A;  3OWE B;  2BGF A;  1FM0 D;  1YQB A;  4NZL B;  3M63 B;  2O6V A;  1J7B A;  1WGG A;  4RGM A;  2Y5C A;  4EKU A;  3Q3F A;  1U4A A;  4N58 A;  4DDI D;  4M8N A;  1R7S A;  3AV8 A;  5DPW A;  3B08 A;  4JWU C;  5CTR C;  1IGC A;  3AE2 B;  2NVU I;  1FXI A;  4OZA A;  1PGA A;  1C76 A;  2LAS A;  3MP9 A;  2IY1 B;  2K8H A;  1OTR B;  4REZ A;  4JGH B;  1EO6 A;  3A4R A;  4JL9 A;  4BAX A;  2V4I B;  1IBX A;  4WJQ A;  2JZ3 B;  1SJH D;  3QAR A;  4ZOH C;  2LUE A;  2BPS A;  2IO1 B;  2MCN B;  2JYE A;  1ACC A;  2DYM A;  1QQR A;  1WMH A;  2IBI B;  1NI2 A;  1TYG B;  3W5U B;  2WX0 A;  4F8C B;  3HM6 X;  1JRP A;  1WFY A;  4HCN B;  2LVQ A;  4LNI A;  4LNF A;  3CST A;  1JWS D;  4KSK C;  1VZ6 A;  4DXG A;  1I4R A;  3H7S A;  2GLS A;  2KFJ A;  1RFA A;  2AQ3 B;  1T0Y A;  4ANV A;  2BYT A;  3GE8 C;  1HEZ E;  1YN4 A;  3Q8B A;  3NHE B;  2LRW A;  4EEW A;  2YLM A;  2E3T A;  3D32 A;  2O2V B;  4KGS A;  2D5G A;  1FEH A;  2IND C;  4LDT B;  3KYC D;  2KZR A;  2N7J A;  3ZJV A;  2DYB A;  4LNK A;  3HIZ A;  3UIP B;  2KO3 A;  1KH0 A;  4RGN A;  3P4R B;  2MP2 A;  3M3J A;  4WQM A;  4EOY A;  2JRI B;  3DBS A;  4YTN B;  1NEN B;  2L7R A;  3L16 A;  3LJ3 A;  4MM3 A;  2I1K A;  2WXL A;  2WWZ A;  1KLU D;  1XLQ A;  2MWS B;  3I3T B;  2WXP A;  2LGX A;  1AYF A;  3Q8A A;  3ZVV A;  4XGA B;  1I42 A;  2FBW B;  3B2G A;  3BK2 A;  3ZRC A;  3K9P B;  3DBH B;  2D3C A;  1WXM A;  3AEG B;  2DEN B;  3IG3 A;  4ZRI A;  3PTF C;  2E6X A;  2KDF B;  2KK8 A;  3EEC A;  2BWE S;  4MGK E;  3BK1 A;  1BXT A;  3HRD D;  2KJR A;  4HJG E;  3RT3 B;  1UBQ A;  2DZI A;  4PS3 A;  2CHW A;  1P0R A;  1VJK A;  4FN2 A;  1QOG A;  2BF8 B;  4P1B C;  3A4S C;  1OFF A;  3R7R A;  2N9P C;  2N1W A;  1RM6 C;  3PGE A;  5MPO A;  3VFK A;  3R3M A;  5DPT A;  1R4M B;  1YN3 A;  1N5X A;  5IKC M;  3QK0 A;  4B0M A;  4G11 A;  2VH1 A;  1ET6 A;  3WAP A;  2N7E A;  1Q0W B;  2BWF A;  2UWQ A;  5C1Z A;  4FBJ B;  1PYW D;  2WXQ A;  4IG7 B;  3DPD A;  3W1Y A;  1WE7 A;  3TJP A;  3UQB A;  3UGB B;  4E74 A;  4GLS C;  1K50 A;  2AEH A;  2GI9 A;  3DHI C;  2IYD B;  1VD2 A;  2SEB D;  2LEK A;  1SXT A;  3JSV B;  1J0G A;  2MBQ A;  3Q6B A;  2KN5 A;  3PLU A;  2M17 A;  3VXW A;  4OZB A;  1C9F A;  2I38 A;  2PW9 A;  1I4G A;  2I1J A;  5J2R A;  1L4Z B;  3APF A;  2Y5P A;  1YIW A;  4TQ0 A;  5JHB A;  4XDC A;  3HM3 A;  2KFK B;  4XWW A;  3AM9 A;  1YJI A;  1CQV A;  4GDK A;  2CU3 A;  4AJY B;  3KLS X;  1GOZ A;  1D3Z A;  2HTM E;  3JVZ X;  3VUW A;  2JZZ A;  2KC2 A;  4IWP A;  2KDB A;  4ZHP A;  4KSL C;  2LVO A;  3LB8 C;  2L00 B;  3KQ4 A;  1TS3 A;  3T3N A;  3BII D;  3AEF B;  1MG4 A;  2N9X A;  2GBJ A;  4GIV A;  2WXG A;  1E8Y A;  4DQO C;  3Q3O C;  3WAN A;  3H9D A;  1GB4 A;  2RPV A;  2ZEQ A;  2L83 A;  2TSS A;  4HCP B;  3AE4 B;  2J0K A;  3PZD A;  1FRR A;  2K39 A;  2Z59 B;  3MJ5 A;  3N3K B;  3PVL A;  2FAZ A;  2V9H A;  4W9G A;  1XQQ A;  2RD0 A;  2LI5 A;  4N59 A;  4MGY E;  4II2 B;  2D3G A;  2KQ4 X;  2PEA A;  2W54 A;  3WAM A;  3IBE A;  2D07 B;  2MBO A;  4C7Z A;  4GDL A;  4KKJ A;  1OGW A;  1V6E A;  3RPF C;  3HVD A;  5EDS A;  1J8C A;  1QOB A;  2GBM A;  1KRH A;  3FKY A;  2BB5 A;  2ZPY A;  4J6I A;  2EEL A;  3BY4 B;  3RYT A;  1ZDX A;  4X57 B;  3T9L A;  1TY0 A;  3NY5 A;  2WLB A;  3RUL A;  3WAL A;  3U8Z A;  3OJ4 B;  1FFU A;  3P2B A;  2IGH A;  4USA A;  3TBL D;  1C77 A;  3MC8 A;  4RFB A;  3R7Q A;  4JE3 B;  3APC A;  1JAL A;  1F52 A;  2K8B A;  2RMM A;  3Q3N C;  1TS2 A;  2NPT A;  2WXM A;  2BS4 B;  3H1U A;  4AS1 A;  2DYO A;  3TEZ A;  2L76 A;  2O6V D;  3DBR B;  2KDM A;  4HK2 A;  2JT4 B;  4KZC A;  2JXX A;  4DHJ B;  1ZE3 D;  4IWO A;  2ASQ A;  1WM3 A;  1SIJ A;  4FAD A;  4J3O D;  5BYR A;  2YEP B;  2KT7 A;  4KZ0 A;  3QX1 A;  1UWM A;  3UIN B;  3ZNH B;  2BS3 B;  1YOV B;  3AH7 A;  3ZDT A;  1RRB A;  4DDG D;  3TIX A;  3O65 B;  4RMA A;  1WSP A;  4ANU A;  4M0W A;  2L05 A;  1TIF A;  4HDO A;  3V61 A;  1BT0 A;  1WRI A;  4TQ1 A;  5D94 A;  4BVU C;  4YT0 B;  2IO0 B;  1YQ4 B;  2ONQ A;  3U52 E;  4XYC A;  5J17 A;  3Q14 C;  2MBB B;  1GUA B;  2PJH A;  1FCC C;  1WR1 A;  1TGZ B;  1JWU D;  3I9V 1;  3QIJ A;  1WXA A;  2PE9 A;  2OOB B;  2RDH A;  1DOI A;  3A9J B;  4EZL A;  1L6U A;  4P6V F;  4W9H A;  1MJD A;  2I2Y A;  5LXH A;  3RNE C;  3VQI A;  1T5X D;  1WX9 A;  3LXF A;  3QCA A;  1D5M C;  5BMH A;  5KHO A;  3RNG C;  2G9H D;  2CS4 A;  2PLP A;  1IP9 A;  2DAF A;  2UU7 A;  3MC0 B;  2N1V A;  1PGB A;  4NPN A;  4TMA B;  5EE3 A;  2FIF A;  1WR6 E;  1UNS A;  3NVW A;  2RDB C;  4AJW A;  1L2N A;  2LHE A;  5IP4 D;  1UUP A;  2K8C A;  2M56 B;  1B9R A;  1F9J A;  3W9C B;  1ISN A;  2LRU A;  1CK1 A;  1IGD A;  3H7P B;  4W9K A;  3UQA A;  1ZKH A;  3KWL A;  2L0F A;  1YJ1 A;  1AWD A;  4MEL A;  5CHF A;  2IO2 B;  5DPR A;  1WWT A;  3ABV B;  1F2R C;  2KQS A;  2MQJ A;  2BYV E;  1KFY B;  1STE A;  2Z0D B;  3X0W A;  3ZO5 B;  3JYU A;  3AN1 A;  4KGT A;  3ML9 A;  4UDU C;  2D11 A;  1WGK A;  2ZCC A;  1E7V A;  2CHZ A;  4HPM B;  4R3D A;  2KN4 A;  1UGM A;  4K7U A;  2SAK A;  2DAJ A;  3PRE A;  1RYJ A;  2LGY A;  5EE0 A;  3TEX A;  4GU2 A;  2ZVN A;  2CR5 A;  3Q2A C;  4KGR A;  3HVZ A;  3EFC A;  2QMT A;  2WU5 B;  4OHJ A;  2KAC A;  1UD7 A;  3HUI A;  1VDV A;  3A1Q B;  2UYZ B;  3GE3 C;  1WX8 A;  3ZTD A;  2WXR A;  2MLB A;  4US9 A;  2ZNV B;  1JRO A;  1JML A;  1M4V A;  1K8R B;  2LJ5 A;  5BYQ A;  1WH3 A;  2VZK D;  3I5J C;  4FHK A;  4LK0 M;  1LFD A;  5KHQ A;  1K52 A;  5JZE B;  1T3Q A;  2WNM A;  2L32 A;  3RD2 A;  2KMC A;  3N1Z C;  5G5G A;  3TEY A;  4W9C A;  4OVZ A;  2QIE B;  4B9K A;  2PMV A;  5JH5 C;  1P98 A;  3KW5 B;  1TY2 A;  2KJ6 A;  4NJ6 A;  1WY8 A;  2MJ3 A;  3C19 A;  2KWU B;  1YD8 U;  4KIK A;  3QQ8 B;  2KAJ A;  2KVR A;  4E3C A;  2AL3 A;  4ARC A;  3AE8 B;  5G55 A;  1L7Y A;  1ZOY B;  1OQQ A;  3AU5 A;  1E10 A;  1P9D U;  1I4Q A;  3N32 A;  4HRO A;  3VH4 B;  2GOW A;  1HZ6 A;  1KTK A;  3TMP B;  4G50 A;  4YSX B;  3DBL I;  1WI0 A;  2X38 A;  2XK5 A;  3V05 A;  2CKH B;  2V3N A;  3MJW A;  5T8I A;  2RR9 A;  1C1Y B;  2KC1 A;  2GBN A;  3QWZ B;  2HTH A;  4YSZ B;  2Z0E B;  4A9A A;  3VRB B;  3ZNI D;  5IA7 A;  5E6P A;  1CJE A;  3ETR A;  3VUX A;  1BUI C;  4JQW C;  1Y56 A;  4BBN C;  4M01 A;  1ZGU B;  1JCK B;  4WWM A;  2NBW B;  3NJT A;  2DLB A;  3ZDM C;  1UH6 A;  1EF1 A;  2INC C;  2BS2 B;  1FNW A;  3ONS A;  1PGX A;  2KAN A;  1UWX A;  4M02 A;  1JQ4 A;  4AWJ A;  3AXC A;  3BVZ A;  4IW0 A;  2V3P A;  3W1S C;  2A4Z A;  3R66 C;  1JWM D;  2V4L A;  4FJV B;  1EM7 A;  3EA6 A;  1ZXH A;  3R8B A;  3Q8F A;  4ITK A;  2JY6 A;  3L13 A;  5H92 C;  3VH3 B;  2A5U A;  4IKG A;  3VR8 B;  1XD3 B;  1GJZ A;  4IOI E;  1V1P A;  4JLC A;  2Y3A A;  4ASW C;  5IAA C;  3V3X A;  2HD5 B;  4C4V A;  2AX5 A;  3TSS A;  2ZNV C;  4LNO A;  1CMX B;  1TT5 B;  4FUL A;  4II3 B;  3FIL A;  4M00 A;  1V8C A;  2L52 A;  2J4X A;  1SE3 A;  4FJZ A;  4HVB A;  4A3O A;  1WXV A;  4KX6 B;  4L2Y A;  3VTV A;  4NAW A;  1PQS A;  2OJW A;  2LXC A;  2IJ0 A;  5AZG A;  1IUE A;  4LDT D;  2N9K A;  1N6Z A;  3RN9 C;  1EWY C;  1TZO A;  2RGF A;  1HQR D;  1SE2 A;  1TKG A;  3NS8 A;  3LYY A;  2FNJ B;  1EWC A; 
#chains in the Genus database with same CATH homology
 3PRP B;  2QHO A;  3KUC B;  4K1R B;  4AP4 C;  2ZPN A;  3CSF A;  2AWT A;  4KV2 A;  2NR2 A;  2MBH A;  3H9D A;  3WAN A;  2V1Y A;  2ZEQ A;  4RM9 A;  5AEK B;  4HCP B;  4GN1 A;  2J0K A;  3PZD A;  4W9J A;  3GZN I;  2K39 A;  2Z59 B;  1WF9 A;  4GDK B;  2Y5B B;  3A9K A;  3N3K B;  3PVL A;  2FAZ A;  4F1S A;  2J0M A;  1WIA A;  4WQO B;  2FID A;  2VRR B;  1RLF A;  2ZCB A;  5C23 A;  2KWC A;  3ENE A;  1Q5W B;  4MGZ E;  1LQB A;  2AYO B;  4NAW B;  4W9G A;  2KWV B;  1XQQ A;  2RD0 A;  2LI5 A;  4MGY E;  4MH0 E;  4II2 B;  2D3G A;  2C7N B;  2PEA A;  3WAM A;  3OJ3 A;  3IBE A;  2D07 B;  4BKS D;  3PRZ A;  3PV1 A;  4MEM A;  1E5W A;  2MBO A;  4HLE A;  4GDL A;  3PLV A;  4MJS A;  3L08 A;  1OGW A;  1V6E A;  3VAW A;  2KXJ A;  4GSW A;  4KVG B;  4K81 A;  2BYE A;  3NZU A;  4P7I A;  5EDS A;  1WJ4 A;  3MTN B;  1J8C A;  2M1M A;  2C5L C;  1AAR A;  3CF6 E;  3IVF A;  1WGY A;  1JRU A;  2GBM A;  1EF5 A;  2IO3 B;  3ZNG C;  1E8W A;  1GC7 A;  2DZJ A;  2ZPY A;  1TBE A;  2PPH A;  3QAQ A;  4J6I A;  2G3Q B;  3L0W B;  3BY4 B;  3RYT A;  3VTU A;  3ZIM A;  4LCD E;  4X57 B;  3RUI B;  3T9L A;  3PS6 A;  4YL8 A;  1WGH A;  2AL6 A;  3NY5 A;  4A3P A;  4KDL B;  4DBG A;  1WM2 A;  3RUL A;  2K6Q A;  3WAL A;  3U8Z A;  4IC7 B;  3OJ4 B;  1E90 A;  2FCS A;  3P2B A;  3SD5 A;  4IM3 A;  2KDI A;  3TBL D;  1V86 A;  4ZRK A;  1C3T A;  3A9K B;  3PSE B;  3V6C B;  4LJP B;  1Y8R C;  4BKT A;  3R7Q A;  1KJT A;  3ECI A;  4FA6 A;  3APC A;  4WAA A;  2K8B A;  2K6D B;  3ALB A;  3KYD D;  1VCB A;  1OQY A;  1WX7 A;  4XC2 A;  2NBV B;  4EZJ A;  4WJN A;  2NPT A;  2C7H A;  3H1U A;  2W9N A;  2DYO A;  4GMV A;  2L76 A;  5TR5 A;  2O6V D;  3VDZ A;  4GDL B;  4F7Z A;  4MJS B;  4AUQ C;  2KQ7 A;  3DCG A;  4RM8 A;  1P1A A;  1V2Y A;  3QHT A;  2C60 A;  2LXA A;  4NJ7 A;  5AZH A;  4HK2 A;  3A9J A;  3PHW B;  4NQL B;  2JT4 B;  4KZC A;  2JXX A;  5JHA A;  4DHJ B;  4IWO A;  2ASQ A;  1WM3 A;  4FAD A;  2DZM A;  1WRD B;  2D10 A;  2GBK A;  2KD0 A;  3H6N A;  4WWP A;  4KZ0 A;  3JW0 X;  3QX1 A;  1UZX B;  3UIN B;  3ZNH B;  3EHV A;  3LDZ E;  4AOF A;  2EMS A;  4DDG D;  3ZDT A;  1RRB A;  2M8S A;  3TIX A;  2OJR A;  4ICV A;  4BOS C;  4LJO B;  4WJO A;  3PHX B;  1E7U A;  3RZW C;  4KDI C;  4BFR A;  3O65 B;  4RMA A;  2KLG A;  1KOT A;  1H8C A;  4ANU A;  1V49 A;  1MG8 A;  2L3Z A;  5D6J B;  2L05 A;  4HDO A;  3V61 A;  4TKN A;  1BT0 A;  1H4R A;  1NBF C;  2KNB A;  3PRM B;  3QC8 B;  5J18 A;  4TQ1 A;  5D94 A;  4BVU C;  2G45 B;  3TL5 A;  2LVP A;  2IO0 B;  2DZK A;  1GC6 A;  5J17 A;  1V5T A;  4IM0 A;  5BO4 B;  3ML8 A;  2MBB B;  1GUA B;  2PJH A;  4PS7 A;  2L0T A;  2NPT B;  1WR1 A;  1TGZ B;  1UBI A;  3V62 A;  4BKS A;  2N7D A;  1V9J A;  2KOX A;  4HJK A;  4G0N B;  3EC8 A;  4W9I A;  3QIJ A;  1WXA A;  2FCM A;  2PE9 A;  2OOB B;  2HE7 A;  3SDL C;  1G6J A;  3A9J B;  4EZL A;  1V81 A;  3SHQ A;  2G4D B;  2NCN A;  2JRH A;  3H7P A;  2LWP A;  3TCA A;  1I35 A;  3PT2 B;  4W9H A;  4ZRJ A;  1V80 A;  2BKR B;  1EUV B;  1OEY J;  3RCZ A;  5LXH A;  3L10 B;  2JWZ A;  3VQI A;  2B3A A;  3DQV A;  1WGR A;  2C9W B;  1WX9 A;  1WJN A;  4ICU A;  3ZTC A;  3QCA A;  3ZRF A;  4GGQ A;  5E6N A;  3WA0 A;  4M0W B;  1S1Q B;  4HWI B;  5CX3 A;  1X1M A;  4TUU A;  5KHO A;  4DHZ E;  4W9L A;  2CS4 A;  2MX2 A;  5LXI B;  2IY0 B;  2N9E B;  1IP9 A;  2DAF A;  3NOB A;  4I6L B;  2N4F A;  4BBN F;  2KTR A;  4DWF A;  2N1V A;  2ZZP B;  2KLC A;  3KUZ A;  3NZS A;  4G3X B;  4OVU A;  4NPN A;  2CU1 A;  2FIF A;  1WR6 E;  2FCQ A;  4AJW A;  5HKH A;  4M8M A;  1L2N A;  3BIN A;  2BGF A;  3W1S A;  1YQB A;  2K8C A;  3M63 B;  2O6V A;  4GOC A;  3V60 A;  1WGG A;  4EKU A;  1F9J A;  3EFU A;  3Q3F A;  1U4A A;  1GG3 A;  4DDI D;  4MDK E;  4M8N A;  2CHX A;  1ISN A;  2LRU A;  5DPW A;  3B08 A;  3H7P B;  4W9K A;  1WE6 A;  3UF8 A;  3DVG Y;  1WJ6 A;  1RAX A;  1LM8 B;  5CTR C;  4ZDV A;  3UQA A;  5E6O A;  1ZKH A;  2L0F A;  1YJ1 A;  3X23 A;  2NVU I;  4MEL A;  5CHF A;  2IO2 B;  4FHJ A;  3B1L X;  1WGD A;  5DPR A;  2EMT A;  3A1Q A;  4K7S A;  4NNJ B;  2C7M B;  2MW5 A;  2LAS A;  2KX3 A;  4K7W A;  4GXB A;  2KQS A;  4WJP A;  4PYU A;  2IY1 B;  2MQJ A;  4XX5 A;  3HK0 A;  2BYV E;  2K8H A;  2GMI C;  1OTR B;  4BOZ B;  1TTN A;  4JGH B;  1EO6 A;  2Z0D B;  2O2V A;  3A4R A;  4JL9 A;  1FXT B;  2PE6 B;  4NQK E;  4OVV A;  3X0W A;  3ZO5 B;  3JYU A;  4WJQ A;  2JZ3 B;  2WYQ A;  2KTR B;  3QAR A;  3ML9 A;  5CHV C;  2LUE A;  2D11 A;  2J0J A;  2BPS A;  2ZCC A;  3OLM D;  3QA8 A;  2IO1 B;  3DBH I;  1E7V A;  2K1F A;  4PS8 A;  2CHZ A;  3IFW B;  2MCN B;  3DOW A;  4HPM B;  2DYM A;  1UGM A;  4K7U A;  3PRE A;  1WMH A;  2DAJ A;  2IBI B;  1NI2 A;  4N9F 4;  4HPL B;  2ZJD A;  1UEL A;  2WX0 A;  2DHZ A;  3HM6 X;  3V6E B;  4DK5 A;  4EFO A;  2O6V B;  4F8C B;  1WFY A;  2LGY A;  5DPS A;  1TZ1 A;  2WDT B;  4GU2 A;  2MBE A;  1A5R A;  4A20 A;  2ZVN A;  2CR5 A;  4HCN B;  2LVQ A;  3CST A;  4KSK C;  4NY0 A;  3OAW A;  4GB9 A;  5DCN A;  1WJU A;  3H7S A;  1V5O A;  1HE8 A;  3AUL A;  4DXA B;  3DVN V;  2KFJ A;  1UD7 A;  3SU8 X;  4W9F A;  1RFA A;  4CYE A;  4DHZ B;  3A1Q B;  2UYZ B;  1T0Y A;  4ANV A;  3NHE B;  2LRW A;  1WX8 A;  1R4M I;  3ZTD A;  2YLM A;  3HHM A;  4EEW A;  2MLB A;  2ZNV B;  2BYF A;  3D32 A;  2O2V B;  1K8R B;  2LJ5 A;  1S3S G;  1WH3 A;  4FHK A;  5KHQ A;  1LFD A;  3APD A;  1E8Z A;  3RZF A;  1OEY A;  3VHT C;  5JZE B;  2JF5 A;  3KYC D;  2LD9 A;  4LDT B;  2KZR A;  3RD2 A;  2KMC A;  1R4N I;  2V3S A;  3CMM B;  4TV3 A;  2DYB A;  4W9C A;  3KH0 A;  2DX5 B;  3HIZ A;  4PYZ A;  1WMH B;  3UIP B;  1WZ3 A;  4B9K A;  2KO3 A;  5JH5 C;  1YX6 B;  1P98 A;  2G4S A;  2MP2 A;  1J19 A;  3KW5 B;  3M3J A;  3VTW A;  4FLH A;  4EOY A;  1XT9 B;  2JRI B;  2KJ6 A;  3DBS A;  3VVW B;  4NJ6 A;  2L7R A;  3L16 A;  3LJ3 A;  4MM3 A;  1WY8 A;  2I1K A;  3PPA A;  4HXD A;  2WWZ A;  4I6N B;  3B0A A;  2KWU B;  1YD8 U;  2LZ6 A;  2MWS B;  4I6P A;  4KIK A;  3I3T B;  3QQ8 B;  5LLI A;  2JPH A;  4IM2 A;  2LGX A;  1KLV A;  3ZVV A;  2KVR A;  3UIO B;  4E3C A;  2AL3 A;  2ZVO A;  1I42 A;  1SE9 A;  3ZRC A;  2KTF A;  5G55 A;  1L7Y A;  3ZKJ C;  3K9P B;  3AU5 A;  5L83 A;  1P9D U;  1WXM A;  1KM7 A;  3N32 A;  2DEN B;  1LXD A;  3VUY A;  2REX A;  3IG3 A;  4ZRI A;  3VH4 B;  2GOW A;  2MA9 B;  3PTF C;  2KDF B;  3K9O B;  2KK8 A;  3EEC A;  3TMP B;  3MHS D;  4G50 A;  2BWE S;  3ZUN A;  3DBL I;  3KUD B;  4MGK E;  1WI0 A;  1E8X A;  1NDD A;  2XK5 A;  1QZE A;  2WX1 A;  2KJR A;  2FUH B;  3RT3 B;  2CKH B;  1UBQ A;  2DZI A;  3MJW A;  3AI5 A;  3KVF B;  4PS3 A;  2RR9 A;  2CHW A;  4MSM B;  1C1Y B;  2KC1 A;  1P0R A;  2NS5 A;  2GBN A;  2BF8 B;  4FN2 A;  4ANW A;  2GBR A;  2MP2 B;  3JSV A;  3QWZ B;  2HTH A;  3A4S C;  4W9D A;  3R7R A;  2N9P C;  2N1W A;  4EZK A;  3PGE A;  4ANX A;  2Z0E B;  3DVG X;  3VFK A;  5D7G A;  3ZNI D;  5E6P A;  5IA7 A;  2BKF A;  3R3M A;  5DPT A;  4KIK B;  4HDQ A;  2YVC A;  2K25 A;  3VUX A;  4JQW C;  3QK0 A;  1Z5S B;  2KFK A;  2D2Q A;  5G2N A;  2IZV B;  4G11 A;  4BBN C;  4IUM B;  3DVN U;  1ZGU B;  1SGH A;  3M62 B;  3WAP A;  2N7E A;  1Q0W B;  1Q1O A;  2KJH B;  2BWF A;  4XZ4 A;  5AZF A;  3WIM A;  2LGD A;  1YX5 B;  2NBW B;  3C0R B;  2UWQ A;  2NBU A;  5C1Z A;  2R2O A;  3ZDM C;  4FBJ B;  4CO7 A;  1IPG A;  1UH6 A;  1EF1 A;  2L8J A;  1SIF A;  4ZYN A;  3U30 A;  4IG7 B;  4EUT A;  3DPD A;  3ONS A;  2KAN A;  1Z2M A;  3W1Y A;  3N30 A;  3ZW3 A;  1WE7 A;  4IWQ A;  4AWJ A;  3AXC A;  3TJP A;  3UQB A;  2MRP A;  2XK5 B;  3Q3J A;  4IW0 A;  3UGB B;  4E74 A;  3W1S C;  2AEH A;  2A4Z A;  3R66 C;  3IHP C;  3ZNZ B;  2XEW A;  2V4L A;  2HJ8 A;  4FJV B;  4WWO A;  3T8M A;  1WYW B;  2IYD B;  1VD2 A;  3QJZ A;  2KMA A;  5GMV A;  3S2A A;  2J7Q B;  3JSV B;  4DHJ D;  1J0G A;  2MBQ A;  2KKC A;  2KN5 A;  2JY6 A;  3L13 A;  3PLU A;  4B6W A;  1M94 A;  2M17 A;  3VH3 B;  2A5U A;  3VXW A;  1ZW7 A;  4URK A;  1GJZ A;  1XD3 B;  1GNU A;  2KDE B;  2I1J A;  5J2R A;  5CHW A;  3APF A;  3L54 A;  4CHK A;  1YIW A;  5D2M B;  1IYF A;  4JLC A;  4TQ0 A;  5JHB A;  4ASW C;  4JIO U;  5IAA C;  3ZLZ A;  2HD5 B;  2RPQ A;  3HM3 A;  2KFK B;  3AU4 A;  4W9E A;  1WZ0 A;  2ZNV C;  4GDK A;  4E71 A;  4BKG A;  3M95 A;  4AJY B;  1CMX B;  4FUL A;  4II3 B;  2RSU A;  1D3Z A;  3JVZ X;  3VUW A;  1P3Q U;  4FJZ A;  4HVB A;  3WAO A;  4MGI E;  4A3O A;  1WXV A;  3VTV A;  2KHW B;  2JZZ A;  4MSQ B;  1PQS A;  4NAW A;  2M4N A;  2LXC A;  2KC2 A;  2EKE C;  4IWP A;  5AZG A;  2KDB A;  4KSL C;  4LDT D;  3U7D A;  2R2Q A;  2KX0 A;  2LVO A;  4FJY A;  2L00 B;  2RGF A;  1WXS A;  3L17 A;  2JVC A;  2M0X A;  5L95 C;  4WWN A;  3GOE A;  3A33 B;  3NS8 A;  4B95 A;  2N9X A;  3DDC B;  2MSE D;  2GBJ A;  2FCN A;  2JUO A;  4GIV A;  5FR6 A;  1E8Y A;  2XBB C;  3DBR I;  2FNJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...