2CR5A

Solution structure of the ubx domain of d0h8s2298e protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
109
structure length
109
Chain Sequence
GSSGSSGEVPDLPEEPSETAEEVVTVALRCPNGRVLRRRFFKSWNSQVLLDWMMKVGYHKSLYRLSTSFPRRALEVEGGSSLEDIGITVDTVLNVEEKEQSSQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the UBX domain of D0H8S2298E protein
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords Reproduction 8
total genus 10
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00789 UBX UBX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2cr5A01
3H7PB 3IVFA 1WJNA 4B6WA 2CU1A 4FULA 2CHXA 3APCA 2L3ZA 2W9NA 2JWZA 1H4RA 2DZKA 2ZZPB 2CHWA 1R4MI 2CS4A 4I6LB 4W9KA 5AEKB 3EFUA 3BINA 3QHTA 4FBJB 3VTWA 2IO0B 2N9EB 3QCAA 1WRDB 2K8CA 2FAZA 4IM2A 4GOCA 5IA7A 4WJNA 2WX0A 3RUIB 2GBKA 3ML9A 4ZYNA 2KMCA 4BBNF 2MRPA 2L0FA 2NPTA 2A5UA 3A1QA 2IY0B 4HDQA 5CX3A 3CSFA 1XT9B 3OJ3A 1U4AA 4HLEA 1YX5B 2J7QB 2KQSA 4N9F4 3ZUNA 1WGDA 3A9JA 3H6NA 3L16A 3MJWA 3VDZA 4EUTA 3ZTCA 4LJPB 3JVZX 3DOWA 3ZLZA 5JZEB 2KX3A 2LVQA 4BVUC 1E7VA 3PVLA 2MWSB 4G50A 3VUXA 1WXSA 4AOFA 2NCNA 4I6PA 3W1YA 4EZJA 1QZEA 4EZLA 3UIOB 2KLCA 4KVGB 2JY6A 4AWJA 3QAQA 2NS5A 1E8XA 3QWZB 1XD3B 2DYMA 2N1WA 1F9JA 1E7UA 4M0WB 4MGKE 1LXDA 4A3OA 1WZ0A 2MBOA 2O2VA 2N1VA 2LXAA 4PYUA 2C60A 1NDDA 1WE7A 2LRUA 1SIFA 1C1YB 5IAAC 1PQSA 4F1SA 2KJHB 2R2QA 2NBVB 2FCNA 1SGHA 4PYZA 4RM9A 5J2RA 3ML8A 5C1ZA 3PRZA 4KIKA 2CHZA 4II2B 3DBSA 4B95A 4HVBA 4F7ZA 4FA6A 4AP4C 4MJSB 2DHZA 2KZRA 1V6EA 2M4NA 2NR2A 2QHOA 2FNJB 4W9EA 4WQOB 4DHJB 2WWZA 2LGYA 1V80A 3PRMB 3R7QA 3DVNU 4ASWC 3B0AA 1V2YA 1K8RB 4KV2A 4GB9A 2KC2A 4HPLB 4ANWA 2JUOA 3QX1A 1WF9A 3A4RA 2RD0A 1S3SG 1WMHB 4JL9A 2KDFB 1WIAA 2D07B 1V5OA 2FIFA 4E74A 3PTFC 2D2QA 2D11A 4WWNA 2KD0A 2HE7A 3SDLC 2ASQA 2MLBA 2LWPA 4IG7B 2ZNVB 2L76A 1KLVA 4LJOB 1UELA 4HK2A 2KTRA 2OJRA 4G0NB 3RCZA 2BYFA 3SHQA 2M0XA 4DHJD 2PE6B 2G3QB 4W9CA 4GDLA 1WGHA 3EHVA 2KKCA 2IO3B 4DDID 3WAOA 3MHSD 1EF1A 2ZJDA 3MTNB 4TUUA 3NY5A 4EKUA 1YIWA 2KTFA 2Z0EB 3H7PA 4K7UA 3UGBB 3M3JA 2C7HA 4BKSD 3QC8B 1WJ4A 4BOSC 1P3QU 2CR5A 2KWVB 1GG3A 2KDIA 3WAPA 2CKHB 3PLVA 3JW0X 3B08A 1SE9A 4PS3A 4BKTA 4MELA 2MW5A 4KDLB 5JHAA 1LFDA 1BT0A 4FADA 4GXBA 5KHQA 2M17A 2JPHA 3GZNI 4IM0A 4CHKA 3OAWA 1WI0A 1UH6A 4K7SA 1Y8RC 1FXTB 2KFJA 3UINB 3PT2B 5DPWA 3DPDA 2MBQA 5DCNA 1GJZA 2ZVOA 2JRIB 5DPSA 2HTHA 2UWQA 4ICUA 1WX9A 4IUMB 2N7EA 4IWQA 3TCAA 3X0WA 2WX1A 4W9HA 4WAAA 4NAWA 1E8ZA 5AZFA 2Z59B 4IW0A 5D2MB 2L0TA 1LQBA 2JXXA 3RT3B 5EDSA 2N7DA 5LXIB 1D3ZA 1R4NI 2LI5A 2KHWB 2XBBC 1UGMA 3S2AA 5JHBA 3UIPB 3Q3FA 1UBIA 2KJRA 2GBJA 3PLUA 4RMAA 1LM8B 2AEHA 2JVCA 4W9DA 4EEWA 1WXVA 4BOZB 3OJ4B 2K6QA 2XEWA 3WA0A 2DX5B 2WDTB 3V6CB 5E6NA 3HK0A 3ENEA 4KIKB 3SU8X 1M94A 3I3TB 5KHOA 1V86A 2MA9B 4MGYE 2JRHA 3L13A 2ZPNA 3ZDMC 4HCPB 4EZKA 3C0RB 4X57B 3VVWB 4A20A 2HJ8A 3K9PB 2XK5A 3ALBA 4IWOA 3PZDA 1Z2MA 3PSEB 4OVVA 1VD2A 4W9JA 2K6DB 1IYFA 2EMTA 3KW5B 5CHWA 1KM7A 4NJ6A 3VUYA 3W1SC 4E3CA 1WM2A 3VH3B 4PS7A 3L54A 4NNJB 2GBMA 2EMSA 3ECIA 3DCGA 2L00B 2C5LC 4MGZE 2IY1B 3UQBA 4XZ4A 1WGYA 3ZNID 1P1AA 4XC2A 3AXCA 3ZNZB 2KXJA 2M8SA 2BKRB 3A9KB 2BF8B 5E6OA 2Y5BB 4LDTB 4YL8A 1WR1A 2ZCCA 4TV3A 5D6JB 2JT4B 3UQAA 4GIVA 3TL5A 1EUVB 3QJZA 4ZRJA 2J0KA 2KO3A 4WJOA 2KX0A 2KDEB 2MX2A 3U8ZA 4NQLB 1YD8U 2UYZB 2KLGA 3RYTA 3X23A 2C7NB 4HDOA 3IG3A 1ZW7A 2MSED 5C23A 1AARA 4DHZB 2NPTB 4HWIB 3V62A 3VTUA 4W9LA 5G55A 2PE9A 3APFA 3V61A 2V4LA 4P7IA 3QK0A 1I35A 5D94A 5DPRA 4MSQB 4IWPA 3KH0A 3PHXB 2FCQA 3TMPB 1NI2A 5DPTA 4MGIE 1J19A 2NBWB 1WR6E 2LZ6A 3EECA 3ZVVA 3EC8A 3N30A 1WX7A 3P2BA 2FUHB 4KSLC 5J18A 2FIDA 3V6EB 4GU2A 1Z5SB 3AULA 3QARA 3PRPB 3T9LA 4NJ7A 2MCNB 2O2VB 2IBIB 2PPHA 2AYOB 4CYEA 4GN1A 4DWFA 2O6VA 3K9OB 3KYCD 2NBUA 2Z0DB 3U7DA 3H9DA 3VXWA 2R2OA 5G2NA 2KOXA 2J0JA 3L17A 4AJWA 5J17A 5GMVA 2D3GA 2FCMA 4JGHB 4K1RB 1YJ1A 2KN5A 1UBQA 1WX8A 5TR5A 5L83A 4G3XB 2LGXA 3JSVA 2G4SA 3R7RA 3CMMB 4KZ0A 1GC6A 1WM3A 2ZPYA 2BYVE 3AU4A 3T8MA 2ZNVC 2RGFA 1TBEA 2ZVNA 2KVRA 2DAFA 4GDKB 5D7GA 4KDIC 2IYDB 3ZNHB 3IBEA 3M63B 2ZCBA 2KFKB 2KQ7A 2K25A 3TIXA 1TGZB 3DBRI 3DQVA 3ZRCA 2N4FA 4ZRIA 2REXA 2C9WB 1V9JA 3HM3A 3V60A 2BYEA 3ONSA 2V3SA 3CF6E 1A5RA 2JZZA 3DBHI 1TTNA 2G4DB 2RSUA 3JYUA 4MSMB 3A1QB 4ANXA 1WGGA 2BPSA 3A33B 3D32A 4RM8A 1XQQA 4DDGD 1KOTA 3QQ8B 4W9IA 4GMVA 3R3MA 3LJ3A 1JRUA 3DVGX 3KUCB 2LUEA 4W9FA 4EOYA 2K39A 4EFOA 1E8YA 4JIOU 2EKEC 1OGWA 2K8BA 4I6NB 5CHFA 2KC1A 3DVGY 4KSKC 1Q5WB 2IO1B 3WALA 3ZDTA 5HKHA 1V49A 4OVUA 5E6PA 5AZHA 2DENB 3OLMD 2K1FA 1X1MA 4DHZE 2KWCA 4IM3A 2DYOA 2N9PC 1E90A 3ZW3A 3WAMA 1E8WA 4FN2A 1WY8A 3NS8A 3DBLI 3NHEB 2LXCA 4LDTD 2KMAA 1MG8A 2LJ5A 4HJKA 1ISNA 3O65B 1UZXB 2KDBA 4HPMB 2D10A 4GDLB 2J0MA 4II3B 1VCBA 4A3PA 3DDCB 2GBRA 4TQ1A 4BFRA 2ZEQA 3PV1A 1I42A 2BWES 4FHKA 3SD5A 2XK5B 3ZO5B 2LRWA 3HHMA 3VQIA 4TQ0A 2KWUB 3M95A 4G11A 4DXAB 2MBEA 1WH3A 4MH0E 1GUAB 2V1YA 3N3KB 2BKFA 4BBNC 1RLFA 3ZNGC 1NBFC 1RAXA 1ZKHA 2VRRB 3HM6X 1P0RA 2K8HA 4K7WA 5CHVC 4W9GA 4AUQC 4WJPA 1GC7A 4URKA 2GMIC 1OEYJ 1GNUA 4ANUA 2MP2A 4HXDA 3N32A 1WZ3A 2DZIA 1WJUA 2MBHA 3A4SC 3RZFA 1WFYA 1RFAA 1ZGUB 1S1QB 5BO4B 3WIMA 3UF8A 3VFKA 2DYBA 2LGDA 1UD7A 2YVCA 2GOWA 4BKSA 1WGRA 2FCSA 4WWPA 3W1SA 4E71A 1G6JA 2N9XA 4WJQA 2NVUI 3BY4B 4NPNA 2DZMA 1V81A 2C7MB 3JSVB 3H1UA 1H8CA 1OQYA 1Q1OA 3HIZA 4MJSA 3VHTC 3L08A 2JZ3B 3APDA 4GDKA 5LLIA 2JF5A 1WXAA 3NZSA 3NZUA 2YLMA 3KVFB 4ZDVA 1E5WA 4FLHA 5JH5C 1IPGA 3PHWB 1YQBA 1OEYA 3A9JB 2HD5B 4ZRKA 2IZVB 3U30A 4M8MA 4DK5A 2MBBB 1TZ1A 4BKGA 2AWTA 1HE8A 3PPAA 3B1LX 4K81A 4WWOA 3ZIMA 3PREA 3VUWA 1WMHA 3AI5A 4IC7B 4ANVA 5AZGA 2WYQA 3KUZA 2KK8A 2A4ZA 2BGFA 2LD9A 2O6VD 1T0YA 1EO6A 4JLCA 5L95C 4M8NA 2KTRB 3LDZE 1L2NA 1WJ6A 1YX6B 3VH4B 4ICVA 3TBLD 1J8CA 3ZRFA 3IHPC 1J0GA 1RRBA 3L0WB 1EF5A 3PGEA 1WE6A 1P98A 2OOBB 3KYDD 4GGQA 4TKNA 1WYWB 5CTRC 5FR6A 4CO7A 1C3TA 3VAWA 3AU5A 4DBGA 2BWFA 2KANA 3PS6A 3QA8A 4NQKE 4B9KA 1P9DU 2I1JA 1V5TA 2L8JA 2PJHA 3ZKJC 3DVNV 4AJYB 2MQJA 3RULA 2KJ6A 3ZTDA 1KJTA 3RD2A 2DAJA 4FJZA 3IFWB 2PEAA 2KFKA 4MDKE 4J6IA 2AL3A 4JQWC 4LCDE 4F8CB 2AL6A 3GOEA 4XX5A 2G45B 3TJPA 3RZWC 4FJYA 4MM3A 2IO2B 3A9KA 2LVOA 4HCNB 3QIJA 3Q3JA 4NY0A 3WANA 4GSWA 4KZCA 1L7YA 2KNBA 2O6VB 3CSTA 2L05A 2DZJA 4FHJA 3M62B 1Q0WB 2M1MA 1OTRB 4PS8A 5LXHA 3R66C 2RR9A 3NOBA 4MEMA 3H7SA 2LVPA 2B3AA 1IP9A 4NAWB 2GBNA 2L7RA 4FJVB 3VTVA 2RPQA 3KUDB 1WXMA 2I1KA 3L10B 1CMXB 2MP2B 2LASA
chains in the Genus database with same CATH superfamily
3IVFA 1C4CA 2JWZA 1AWDA 2CS4A 1FNWA 3IT4B 3EFUA 2QSDA 4YWGG 2FAZA 4YT0B 1F0ZA 3LB8C 4ZYSA 4ZYNA 3CWIA 3A1QA 1UWXA 1KH0A 2A5UA 1E0ZA 4KGSA 4WH4A 4HDQA 1U4AA 2J7QB 4N9F4 3ZUNA 1N5WA 4EUTA 4LJPB 3ZLZA 3DOWA 4YSXB 4G50A 1I4PA 2NCNA 4EZJA 1HA5A 1N61A 2JY6A 1ZXHA 1E8XA 2L32A 3AH7A 4QAYA 1F9JA 1WZ0A 1ZDXA 1GB4A 2LXAA 2WXGA 2NBVB 3O13A 4RM9A 5J2RA 3C8YA 1BUIC 3PRZA 4F7ZA 4FA6A 1V6EA 2J53A 2FNJB 4DHJB 2WWZA 2LGYA 1TKEA 1N62A 2CU3A 3FILB 3QX1A 2RD0A 1NEKB 2KDFB 2OHFA 2D07B 2FIFA 2LHDA 1LO5D 4WWNA 3SDLC 1TYGB 1V1PA 2MLBA 1KLVA 2W55A 3RCZA 4DHJD 2M0XA 4W9CA 3EHVA 2KKCA 2IO3B 3WAOA 1EF1A 1E7PB 4TUUA 1IGDA 3NY5A 4EKUA 1YIWA 3UGBB 3M3JA 4WURA 4ZHOA 1F1HA 2JU6X 2OEDA 1ZOYB 1GG3A 2KDIA 1TZOA 3WAPA 2ACZB 4C4VA 5AUIA 3NVZA 4PS3A 4FADA 3I9V1 4IM0A 3GZNI 4TSSA 4C7YA 3VR9B 3UINB 2WXIA 1GJZA 1TS4A 2UWQA 3AE4B 2CJOA 2FBWB 4YSZB 2WX1A 1MFWA 1C4AA 4NAWA 3ZXRA 3AE8B 4IW0A 4XYCA 4DXFA 2JXXA 3RT3B 3WCQA 2N7DA 5LXIB 5JXVA 1MJDA 1RWSA 2GBJA 2JVCA 1WXVA 4BOZB 2K6QA 2WDTB 2DBYA 3V6CB 1M94A 3DHHC 1YOVB 1IBXA 4S0RA 4A20A 1L0XB 1ZP0B 2H88B 3N1XC 1Z2MA 3PSEB 1VD2A 3ABVB 5BMGA 2EMTA 4Q2JA 5EE9A 2JYEA 4LLGM 1KM7A 3VUYA 1WM2A 1QLBB 3ECIA 1ET9A 1JQ4A 4R3DA 2C5LC 4MGZE 2IY1B 2E6XA 3ZNZB 2Y5BB 1KFYB 2JT4B 1EUVB 1YJIA 3VR8B 1YD8U 4A55A 2KLGA 1ZW7A 3ZQ4A 1CQVA 2AX5A 1JROA 2PE9A 1KF6B 5G55A 2V4LA 3QK0A 2HDEA 1YN4A 1RYJA 2FCQA 2PVGC 4MGIE 1J19A 1SEBD 1FEHA 3P2BA 2FUHB 2FIDA 3RI7C 1QKZA 2MJDA 4GN1A 2O6VA 3KYCD 3H9DA 2KOXA 2GLSA 5I4DA 2KN5A 1PGAA 1UBQA 2IDYA 2LGXA 1WM3A 2RGFA 1FNVA 2D3AA 2DAFA 4GDKB 3ZNHB 2ZCBA 2KFKB 1DOYA 2KQ7A 2K25A 4ZRIA 2RDBC 1V9JA 4OZAA 2XN9C 1QT9A 1A5RA 2WP9B 2RSUA 4ANXA 4MSMB 3A1QB 2BPSA 3D32A 4RM8A 1C78A 3QQ8B 2IPKD 4EOYA 3DVGX 4I6NB 4A9AA 3ZDTA 3Q14C 2ZW1A 5AZHA 2DENB 2KWCA 1VZ7A 2LXCA 3C19A 4HPMB 1FFVA 4II3B 2K3UA 4FHKA 1YN3A 2LRWA 2ICIA 2CJNA 3NVYA 4DXAB 2BS3B 1WH3A 2MBEA 1GUAB 2V1YA 1HZ5A 4LNFA 1NBFC 1P0RA 2WXJA 5CHVC 5HHDG 4W9GA 4PK1A 2LUMA 1GC7A 2GMIC 1NYQA 1ESFA 1WZ3A 2MBHA 1RFAA 1S1QB 3WIMA 3VFKA 2DYBA 1QOGA 1MG4A 1ZUD2 4JE3B 1CZPA 3DWGC 2LFIA 4JPSA 5BMIA 4BKSA 2FCSA 1G6JA 2V0GA 1T6BX 2C7MB 1H8CA 3L08A 3NZUA 4ZDVA 4FLHA 5JH5C 1YQBA 5EE0A 3URYA 2MBBB 2Z8LA 3PPAA 1E10A 2WYQA 3HVDA 3HRDD 2KN4A 2BGFA 2O6VD 3DBLB 1A70A 2IGHA 4M8NA 4LNKA 3TBLD 1L6VA 1VLBA 2PIAA 3PGEA 2OOBB 5CTRC 1C77A 4DBGA 1FPYA 3PS6A 3BK1A 4P16A 4B9KA 2FE8A 2I1JA 3BZDB 2N9KA 3IFWB 4LCDE 2AL6A 1TKYA 5H92C 2G45B 2AQ2B 2IO2B 3QIJA 4NY0A 4BAXA 4M00A 1IBXB 2L05A 1Q0WB 5BYQA 4PS8A 5HG2A 2LGIA 2HTME 4FJVB 3VTVA 3KUDB 1V1OA 3L10B 2ONQA 3BVZA 4FULA 4BZAA 3BWUD 1J7CA 2DLBA 3APCA 3GS2A 1HXYD 2K5PA 1H4RA 5C2TB 2DZKA 2ZZPB 2CHWA 4W9KA 1YQ3B 4FBJB 1F2RC 2IO0B 2N9EB 2K8CA 4OZCA 2K0PA 3ML9A 2KMCA 4BBNF 4A8XC 2MRPA 1EWYC 3AEEB 2NPTA 1I4GA 2IY0B 3TEZA 3OJ3A 5BMHA 3KWLA 3H6NA 2WXLA 3ZTCA 3MC9A 4BVUC 2MWSB 2N0SB 4I6PA 3EUB2 1GAQB 4EZLA 3UIOB 1VDVA 2D3BA 1D5MC 1C76A 2DYMA 2N1WA 4MGKE 3RPFC 1LXDA 1Y56A 2MBOA 1T0RC 2N1VA 4PYUA 1WE7A 2C60A 2LRUA 4KGTA 4LNIA 4PYZA 3GP7A 4KIKA 2CHZA 2QEJC 4II2B 1K53A 4NZLB 4B95A 4HVBA 2OJWA 4AP4C 4MJSB 1L4ZB 4W9EA 4H2AA 2JQRB 1ZPSA 1K52A 3R7QA 2KC2A 4HPLB 1FNUA 4JL9A 3PTFC 2D11A 2KD0A 2HE7A 1M4VA 2ASQA 2W54A 2ZNVB 1J7BA 4HK2A 1QILA 2BYFA 4GDLA 1WGHA 1C79A 3MHSD 2ZJDA 3P4PB 3W5UB 4B0MA 5C3JB 3QC8B 2CR5A 1VZ6A 3B08A 1ZDVA 4MELA 2MW5A 4KDLB 1LFDA 1B9RA 3Q8AA 4D2KA 2INCC 1UWMA 4K7SA 1FXTB 1TIFA 4ARCA 5DPWA 1TS3A 2MBQA 2JRIB 2MJ3A 5BYRA 4ICUA 5AZFA 2WU5B 4US8A 2LI5A 2KHWB 2W3RA 2XBBC 4XGAB 4EEWA 1GB1A 2XEWA 2QCZA 1JWMD 3Q8EA 2DX5B 2V3PA 1UF0A 3HK0A 3ENEA 3SU8X 3I3TB 2QMTA 1V86A 4L1BA 2JRHA 2BT6A 3C0RB 4ITKA 4X57B 3VVWB 1Q10A 3K9PB 2XK5A 3ALBA 4WAFA 2ZW0A 4OVVA 1IYFA 1KLUD 2LGSA 3W1SC 3VH3B 1L0VB 2EMSA 4CQNA 1LGRA 2YEPB 3ZNID 3AXCA 1AYFA 2KXJA 5E6OA 3A9KB 3RNBC 2D3CA 5D6JB 4JWUC 3QJZA 2KO3A 2KX0A 5G5GA 4NQLB 1FCLA 5BYSA 2UU7A 1TJEA 4M02A 2C7NB 4HDOA 3IG3A 5C23A 1JW9D 2ON8A 1AARA 4DHZB 1N6ZA 2NPTB 4HWIB 4W9LA 2RDGA 3FILA 1I35A 5D94A 5DPRA 4RGTA 4MSQB 4TMAB 4N59A 1WR6E 2LZ6A 1WX7A 4GLSC 3QARA 4AQ7A 2KAJA 4DWFA 3K9OB 3VXWA 2J0JA 3BYYB 4LNOA 5J17A 5GMVA 3MP9A 2FCMA 4JGHB 4K1RB 1EM7A 5TR5A 4G3XB 1XCQL 4KZ0A 2VZKD 4JWSC 1JCKB 2KVRA 1T0SC 3W9CB 2GI9A 2IYDB 3RN9C 1PFDA 1IUEA 1TGZB 3DBRI 3ZRCA 3HM3A 3V60A 3N1YC 2BYEA 3ONSA 2V3SA 2JZZA 1TTNA 2VZKB 1WGGA 4K3CA 4DDGD 1KOTA 4PT5A 4GMVA 3R3MA 4HKQA 2LUEA 1MHXA 4EFOA 2Q5WD 3SR6A 2K8BA 4KSKC 3WALA 1C9FA 4OVUA 5E6PA 3OLMD 3PO0A 1X1MA 4DHZE 4FN2A 4LDTD 2KMAA 1MG8A 2LJ5A 2D5GA 3O65B 4OVZA 1L0YB 2D10A 3AE9B 2JXTA 4TQ1A 3BIID 4MM3B 4BFRA 3AE7B 4HRSA 4KKIA 2BWES 2XK5B 3ZO5B 3M95A 3AEDB 4G11A 4RGMA 2M0AA 1ROEA 2Y5PA 4BBNC 2HJ1A 3ZNGC 2BVCA 1ZKHA 2VRRB 3HM6X 3GE8C 4WJPA 1K51A 4ANUA 2MP2A 4A6QA 1WJUA 2KACA 2QC8A 3UF8A 1HEZE 3RNAC 2M19A 3U2SC 2GOWA 5AUKA 3W1SA 4E71A 2N9XA 3N9YC 1NYRA 2NVUI 3BVMA 3JSVB 1MI0A 3Q69A 2WXHA 3HIZA 2WLBA 3GE3C 4USAA 2V4IB 1R4MB 4GDKA 5LNK1 5LLIA 2JF5A 2VH2A 3TUOA 3KVFB 1R7SA 1E5WA 2IGDA 2WDVB 4EE2A 3PHWB 1YJJA 3A9JB 2HD5B 4ZRKA 2IZVB 4BKGA 3B1LX 3ZIMA 3W5VB 3AI5A 2KK8A 3FAHA 1FXAA 3VRAB 1D4BA 2KTRB 3LDZE 1L2NA 4XE0A 3VH4B 4JX1C 4ICVA 1WGKA 3IHPC 3L0WB 1XLNA 1EF5A 2LJIA 1PYWD 4HROA 3KYDD 1WYWB 4CO7A 3AU5A 3VRBB 3DBRB 2GB1A 3R2IA 3DBHB 3ZKJC 2PJHA 3DVNV 2BYTA 2WXRA 3HUIA 3ZTDA 2DAJA 2N7JA 2KFKA 1QOAA 3OWEB 3TJPA 3NJTA 1YQ4B 1F2RI 3TEXA 3Q3JA 2QJLA 3MC0B 1XEEA 2KNBA 3CSTA 5FKAC 3N1ZC 3M62B 1OTRB 5LXHA 2RR9A 3NOBA 1PGBA 3H7SA 3P4SB 5D3DA 3MJ5A 3V3XA 3ZJUA 3H7PB 1WJNA 4B6WA 2CU1A 2MEKA 1R4MI 3QHTA 3VTWA 3QCAA 1WRDB 4GOCA 3RUIB 2GBKA 5IO9A 3U52E 2L0FA 1N60A 5CX3A 4C80A 1YX5B 1L6UA 3JVZX 2KX3A 2LVQA 1E7VA 2IGGA 3PVLA 1WXSA 2M56B 2KLCA 4KVGB 4AWJA 2Y5CA 3L4PA 3QWZB 1XD3B 1ZXIA 4M0WB 2O2VA 2N9LA 1NDDA 3MFGA 1C1YB 1PQSA 2MH7A 2WXNA 2DWQA 2R2QA 1SSNA 2FCNA 4OW0A 4L23A 2WXFA 3DBSA 4P6VF 2KVZA 2DHZA 2M4NA 2NR2A 2QHOA 4WQOB 2WXQA 2WHIA 4LK0M 3DVNU 2INPE 1V2YA 3B0AA 4KV2A 4GB9A 4RF1A 1WF9A 1QOFA 4XWTA 5H8YE 1WIAA 4E74A 1STEA 2D2QA 2Y3AA 2LWPA 4IG7B 3BYTB 1UELA 4RNAA 2KTRA 2OJRA 4G0NB 2KWDA 4MH8A 1TKGA 1V8CA 1I4QA 3TSSA 4DDID 2PTLA 3MTNB 2KTFA 2KDMA 4K7UA 1XLOA 1JWAD 2C7HA 1WJ4A 4BOSC 1SJHD 2MJEA 3PLVA 4RH6A 3P1MA 2QIEB 2AQ1B 1SE9A 2JWUA 1JWUD 5JHAA 2L52A 4GXBA 4O1NA 1FIQA 2MHJA 2JPHA 4CHKA 1UH6A 1Y8RC 1IGCA 2J4XA 5DCNA 2ZVOA 1FCCC 3NUHB 1SE4A 3TCAA 4IWQA 4IUMB 1E8ZA 1FXIA 5EDSA 4S17A 1MPEA 4AS1A 1D3ZA 1R4NI 1UGMA 3S2AA 3P4RB 3AE5B 3Q3FA 1UBIA 2NMQA 2KJRA 2BQQA 1LM8B 3AMZA 4A90A 4WWMA 1HQRD 5E6NA 4KIKB 1KTKA 5KHOA 1UNSA 1EWCA 2ZPNA 2TSSA 4HCPB 3ZDMC 4C7ZA 2VH1A 4EZKA 4XWWA 3B9JA 2HJ8A 2L83A 4IWOA 3RNCC 2K6DB 3W2DA 5IOIA 1N63A 4NJ6A 1D5ZC 3L54A 3Q6BA 2GBMA 4NNJB 3UQBA 4REZA 2V3NA 1P1AA 1V1PB 4XC2A 4ZOHC 2BKRB 2BF8B 4LDTB 1N5XA 4YL8A 2ZCCA 2R61A 3UQAA 3TL5A 2IJ0A 4ZRJA 2J0KA 1NI3A 2PW9A 2INNE 2BB5A 2UYZB 3X23A 1TY2A 4HKZE 3GZNB 5D3IB 2E3TA 3V61A 3LXFA 1MHHE 3KH0A 5MPOA 4KGRA 3EFCA 4GU2A 1Z5SB 4WIPA 4NJ7A 3CIRB 2O2VB 2MCNB 2PPHA 4CYEA 2PLPA 2W82A 2Z0DB 2R2OA 1EU4A 1FO4A 3L17A 4AJWA 1DOXA 3MC8A 2D3GA 3ETRA 3SEBA 4UDUC 1YJ1A 5L83A 1WX8A 3TEYA 2JYTA 2WXMA 2G4SA 3CMMB 3SFDB 3AE1B 2ZPYA 2BYVE 3AU4A 2ZNVC 1SXTA 1TBEA 1C4PA 3HVZA 4KDIC 3OG5A 4YTNB 1QOBA 3IBEA 3M63B 1D5XC 1CK1A 2W3SA 2XNAC 1JWBD 2REXA 4YTPB 2PKOA 1R4NB 1DYQA 3MHZA 1I4RA 2G4DB 3JYUA 1E9MA 1B1ZA 2WDRB 3A33B 1XQQA 2DNFA 4W9IA 1DOIA 1TY0A 2QILA 1OGWA 3AEFB 5CHFA 3DVGY 1Q5WB 3Q3OC 1V49A 4DQOC 2EKIA 1XLPA 4IM3A 2N9PC 1E90A 3NRZA 3ZW3A 3WAMA 1E8WA 3NS8A 3NHEB 4HJKA 1ISNA 4MT5A 4GDLB 4J3OD 4A3PA 3DDCB 2QDFA 2GBRA 1OFFA 3T3NA 3R8BA 3SD5A 2JX5A 1SE2A 4RFBA 3VQIA 4TQ0A 2KWUB 1JRPA 2BKFA 2K8HA 2AQ3B 4AUQC 1YMHE 2WU2B 3NG0A 4URKA 1OEYJ 1TT5B 4HPPA 3N32A 3E56A 3A4SC 3RZFA 2K9XA 1ZGUB 2WXOA 5BO4B 2LGDA 3AV8A 1KRHA 4KX6B 2L1AA 2DZMA 1V81A 4HJGE 3H1UA 1ZE3D 2PMVA 1Q1OA 3APDA 2YLMA 1IPGA 2BS2B 4US9A 1OEYA 4ZRPA 4DK5A 4M8MA 1HE8A 4K81A 4WWOA 4IDIA 3PREA 3VUWA 1WMHA 4ANVA 5AZGA 3FC4A 2WS3B 3I5JC 1EO6A 4JLCA 5L95C 2I2YA 3RNGC 1YX6B 1PDXA 1F52A 3NVWA 3DWMA 4GGQA 4TKNA 1WE6A 1P98A 3KLSX 1C3TA 3VAWA 2WNMA 1XCTL 1BXTA 1JWSD 1V5TA 2L8JA 3KWVA 2MQJA 2WGSA 2X38A 3AE2B 4FJZA 2AL3A 4JQWC 4F8CB 1YNTE 1QF6A 4FJYA 4MM3A 3GB1A 2BB6A 4RGNA 4GSWA 1L7YA 1RM6C 4FHJA 3B2GA 2BBCA 2RPVA 3R66C 3N20C 2LVPA 5IN7A 1IP9A 1WXQA 2L7RA 4FXCA 1QQRA 1OQRA 2NTSA 2LASA 3Q2AC 3AECB 1L5PA 2CHXA 2L3ZA 5IKCM 2W9NA 2KYWA 3KQ4A 4I6LB 5AEKB 3BINA 3Q8CA 4MACA 4IOIE 3Q3MC 4IM2A 5IA7A 4WJNA 2WX0A 5G5HA 3NVVA 3CSFA 1XT9B 4HLEA 2KQSA 1NVID 1WGDA 3A9JA 3L16A 3MJWA 3VDZA 4P1BC 5JZEB 3ZJVA 3VUXA 3P4QB 3U4EG 4AOFA 3W1YA 1QZEA 2I38A 3QAQA 2NS5A 1GPXA 4OHJA 3R2TA 1E7UA 4A3OA 3NS1A 3RNFC 5IAAC 1V97A 1SIFA 2LHEA 4F1SA 2KJHB 1SGHA 1TS5A 3Q8FA 4K3BA 3ML8A 4L2YA 5C1ZA 3AB5A 2KZRA 4NJCA 1WRIA 1V80A 2K22A 3PRMB 4ASWC 4P1CC 1K8RB 1MVKA 4ANWA 2JUOA 3A4RA 1S3SG 1WMHB 3AE6B 1V5OA 1HTQA 2L76A 4LJOB 3SHQA 3V05A 2PE6B 2G3QB 2V9HA 3LYYA 1XO3A 1FFUA 3AEBB 1XXGA 2INDC 2Z0EB 3H7PA 1FM0D 1ENFA 4BKSD 1CJEA 3AEGB 1P3QU 1D6EC 2KWVB 3B2FA 2CKHB 3JW0X 4YXDB 4BKTA 3BVGA 5HFYA 1BT0A 5KHQA 2M17A 2KMMA 3OAWA 3RFZB 1WI0A 2KFJA 3PT2B 3DPDA 4KKJA 5DPSA 1ET6A 2HTHA 2GRIA 1WX9A 2N7EA 2WXPA 3X0WA 2SAKA 4W9HA 4WAAA 2Z59B 5D2MB 2L0TA 1LQBA 1UGJA 1SIJA 5JHBA 3SFEB 3UIPB 1FRDA 2WDQB 3PLUA 4RMAA 2AEHA 4W9DA 3OJ4B 4OZBA 1DGJA 3WA0A 3ZYYX 2B76B 4ZHPA 1WYGA 1AW7A 2MA9B 4MGYE 3L13A 2LEKA 4LTUA 1AN8A 1VZ8A 3PZDA 5FR3A 4W9JA 3KW5B 5CHWA 4ARIA 4E3CA 1SF0A 2J42A 4PS7A 3DHGC 3DCGA 2L00B 4XZ4A 1WGYA 1L4DB 2NTTA 3DHIC 3ZGZA 2M8SA 2JZPA 4M0WA 1WR1A 4TV3A 4GIVA 1XF5L 1WWTA 4N6EB 4ACFA 4WJOA 5HI1A 1PGXA 2KDEB 2MX2A 3U8ZA 3RYTA 2WQYB 1TS2A 1KLGD 2MSED 4XDCA 3V62A 3VTUA 3IAS1 3APFA 4P7IA 3Q3NC 4YSYB 4IWPA 3PHXB 4ZRQA 3TMPB 1NI2A 5DPTA 2NBWB 3EECA 3ZVVA 3IXSA 1EU3A 3EC8A 3E9SA 3UI3A 3N30A 4KSLC 5J18A 5IP4D 1OQQA 3PZ8A 3V6EB 2X8XX 1FRRA 3AULA 3PRPB 3T9LA 4N58A 2IBIB 2AYOB 1FD6A 3P63A 2NBUA 3U7DA 2JSVX 5G2NA 1JMLA 1ACCA 1T0QC 2WXKA 4RGOS 3JSVA 1NENB 3R7RA 1GC6A 2RMMA 5GXGB 3T8MA 2LMCA 2G1EA 2ZVNA 1VRAB 5D7GA 4C56C 1K50A 3TIXA 3DQVA 2N4FA 2C9WB 2YEPF 1RFKA 2BS4B 3CF6E 3DBHI 4NAMA 3P42A 1P7FA 3LJ3A 1JRUA 3KUCB 3Q8BA 4W9FA 3U7ZA 2K39A 1E8YA 4JIOU 2EKEC 2KC1A 2IO1B 3BK2A 3PZ7A 5HKHA 1XLQA 1JALA 2K1FA 5EE1A 2DYOA 1WY8A 3DBLI 4C00A 1UZXB 2KDBA 3IAM1 5FK9C 3ZXVA 2BW2A 3I63C 1I4XA 2J0MA 1VCBA 1T5XD 4RCOA 2ZEQA 3PV1A 1I42A 3HHMA 4MH0E 3N3KB 1RLFA 1WSPA 1RAXA 4K7WA 3EA6A 1VR9A 1GNUA 4HXDA 2DZIA 1HZ6A 1SE3A 1WFYA 3RNEC 3AM9A 1UD7A 3IT6B 3AEAB 1GOZA 2YVCA 1WGRA 4WWPA 4WJQA 3BY4B 4NPNA 1YN5A 4B0EA 1J7AA 2EELA 2KT7A 1OQYA 4MJSA 3VHTC 1BMLC 2JZ3B 5T8IA 3NZSA 1WXAA 1FMAD 3AE3B 1F77A 1VJKA 3U30A 2BTEA 1SJED 1TZ1A 2AWTA 4IC7B 3I57A 4HEA1 3KUZA 2A4ZA 2LD9A 1PUTA 3J9CA 4YTMB 1T0YA 4XDDA 1I4HA 1WJ6A 1J8CA 3ZRFA 1HTOA 3ZJTA 1J0GA 1RRBA 4LNNA 2RDHA 2SEBD 3FKYA 5FR6A 2BWFA 2H89B 2KANA 3QA8A 4NQKE 5EE3A 3NZ3A 1P9DU 1SBBB 5TSSA 3AN1A 4AJYB 4DXGA 3RULA 2KJ6A 4C4VB 2FUG1 1KJTA 3RD2A 2J52A 2PEAA 1E6EB 4MDKE 4J6IA 3RMKC 3GOEA 4XX5A 3EGRA 1SB3C 1I7HA 3RZWC 3A9KA 2LVOA 4HCNB 3WANA 3H8HA 4KZCA 2O6VB 1UUPA 3TEWA 2DZJA 3T3OA 2M1MA 2G9HD 4WQMA 2PVOD 4MEMA 1T3QA 1P7EA 4RF0A 4M01A 2B3AA 4NAWB 2GBNA 2RPQA 5E6JA 4IKGA 1WXMA 2I1KA 1CMXB 2KQ4X 2MP2B
chains in the Genus database with same CATH topology
3H7PB 3IVFA 1WJNA 4B6WA 2CU1A 4FULA 2CHXA 3APCA 2L3ZA 2W9NA 2JWZA 1H4RA 2DZKA 2ZZPB 2CHWA 1R4MI 2CS4A 4I6LB 4W9KA 5AEKB 3EFUA 3BINA 3QHTA 4FBJB 3VTWA 2IO0B 2N9EB 3QCAA 1WRDB 2K8CA 2FAZA 4IM2A 4GOCA 5IA7A 4WJNA 2WX0A 3RUIB 2GBKA 3ML9A 4ZYNA 2KMCA 4BBNF 2MRPA 2L0FA 2NPTA 2A5UA 3A1QA 2IY0B 4HDQA 5CX3A 3CSFA 1XT9B 3OJ3A 1U4AA 4HLEA 1YX5B 2J7QB 2KQSA 4N9F4 3ZUNA 1WGDA 3A9JA 3H6NA 3L16A 3MJWA 3VDZA 4EUTA 3ZTCA 4LJPB 3JVZX 3DOWA 3ZLZA 5JZEB 2KX3A 2LVQA 4BVUC 1E7VA 3PVLA 2MWSB 4G50A 3VUXA 1WXSA 4AOFA 2NCNA 4I6PA 3W1YA 4EZJA 1QZEA 4EZLA 3UIOB 2KLCA 4KVGB 2JY6A 4AWJA 3QAQA 2NS5A 1E8XA 3QWZB 1XD3B 2DYMA 2N1WA 1F9JA 1E7UA 4M0WB 4MGKE 1LXDA 4A3OA 1WZ0A 2MBOA 2O2VA 2N1VA 2LXAA 4PYUA 2C60A 1NDDA 1WE7A 2LRUA 1SIFA 1C1YB 5IAAC 1PQSA 4F1SA 2KJHB 2R2QA 2NBVB 2FCNA 1SGHA 4PYZA 4RM9A 5J2RA 3ML8A 5C1ZA 3PRZA 4KIKA 2CHZA 4II2B 3DBSA 4B95A 4HVBA 4F7ZA 4FA6A 4AP4C 4MJSB 2DHZA 2KZRA 1V6EA 2M4NA 2NR2A 2QHOA 2FNJB 4W9EA 4WQOB 4DHJB 2WWZA 2LGYA 1V80A 3PRMB 3R7QA 3DVNU 4ASWC 3B0AA 1V2YA 1K8RB 4KV2A 4GB9A 2KC2A 4HPLB 4ANWA 2JUOA 3QX1A 1WF9A 3A4RA 2RD0A 1S3SG 1WMHB 4JL9A 2KDFB 1WIAA 2D07B 1V5OA 2FIFA 4E74A 3PTFC 2D2QA 2D11A 4WWNA 2KD0A 2HE7A 3SDLC 2ASQA 2MLBA 2LWPA 4IG7B 2ZNVB 2L76A 1KLVA 4LJOB 1UELA 4HK2A 2KTRA 2OJRA 4G0NB 3RCZA 2BYFA 3SHQA 2M0XA 4DHJD 2PE6B 2G3QB 4W9CA 4GDLA 1WGHA 3EHVA 2KKCA 2IO3B 4DDID 3WAOA 3MHSD 1EF1A 2ZJDA 3MTNB 4TUUA 3NY5A 4EKUA 1YIWA 2KTFA 2Z0EB 3H7PA 4K7UA 3UGBB 3M3JA 2C7HA 4BKSD 3QC8B 1WJ4A 4BOSC 1P3QU 2CR5A 2KWVB 1GG3A 2KDIA 3WAPA 2CKHB 3PLVA 3JW0X 3B08A 1SE9A 4PS3A 4BKTA 4MELA 2MW5A 4KDLB 5JHAA 1LFDA 1BT0A 4FADA 4GXBA 5KHQA 2M17A 2JPHA 3GZNI 4IM0A 4CHKA 3OAWA 1WI0A 1UH6A 4K7SA 1Y8RC 1FXTB 2KFJA 3UINB 3PT2B 5DPWA 3DPDA 2MBQA 5DCNA 1GJZA 2ZVOA 2JRIB 5DPSA 2HTHA 2UWQA 4ICUA 1WX9A 4IUMB 2N7EA 4IWQA 3TCAA 3X0WA 2WX1A 4W9HA 4WAAA 4NAWA 1E8ZA 5AZFA 2Z59B 4IW0A 5D2MB 2L0TA 1LQBA 2JXXA 3RT3B 5EDSA 2N7DA 5LXIB 1D3ZA 1R4NI 2LI5A 2KHWB 2XBBC 1UGMA 3S2AA 5JHBA 3UIPB 3Q3FA 1UBIA 2KJRA 2GBJA 3PLUA 4RMAA 1LM8B 2AEHA 2JVCA 4W9DA 4EEWA 1WXVA 4BOZB 3OJ4B 2K6QA 2XEWA 3WA0A 2DX5B 2WDTB 3V6CB 5E6NA 3HK0A 3ENEA 4KIKB 3SU8X 1M94A 3I3TB 5KHOA 1V86A 2MA9B 4MGYE 2JRHA 3L13A 2ZPNA 3ZDMC 4HCPB 4EZKA 3C0RB 4X57B 3VVWB 4A20A 2HJ8A 3K9PB 2XK5A 3ALBA 4IWOA 3PZDA 1Z2MA 3PSEB 4OVVA 1VD2A 4W9JA 2K6DB 1IYFA 2EMTA 3KW5B 5CHWA 1KM7A 4NJ6A 3VUYA 3W1SC 4E3CA 1WM2A 3VH3B 4PS7A 3L54A 4NNJB 2GBMA 2EMSA 3ECIA 3DCGA 2L00B 2C5LC 4MGZE 2IY1B 3UQBA 4XZ4A 1WGYA 3ZNID 1P1AA 4XC2A 3AXCA 3ZNZB 2KXJA 2M8SA 2BKRB 3A9KB 2BF8B 5E6OA 2Y5BB 4LDTB 4YL8A 1WR1A 2ZCCA 4TV3A 5D6JB 2JT4B 3UQAA 4GIVA 3TL5A 1EUVB 3QJZA 4ZRJA 2J0KA 2KO3A 4WJOA 2KX0A 2KDEB 2MX2A 3U8ZA 4NQLB 1YD8U 2UYZB 2KLGA 3RYTA 3X23A 2C7NB 4HDOA 3IG3A 1ZW7A 2MSED 5C23A 1AARA 4DHZB 2NPTB 4HWIB 3V62A 3VTUA 4W9LA 5G55A 2PE9A 3APFA 3V61A 2V4LA 4P7IA 3QK0A 1I35A 5D94A 5DPRA 4MSQB 4IWPA 3KH0A 3PHXB 2FCQA 3TMPB 1NI2A 5DPTA 4MGIE 1J19A 2NBWB 1WR6E 2LZ6A 3EECA 3ZVVA 3EC8A 3N30A 1WX7A 3P2BA 2FUHB 4KSLC 5J18A 2FIDA 3V6EB 4GU2A 1Z5SB 3AULA 3QARA 3PRPB 3T9LA 4NJ7A 2MCNB 2O2VB 2IBIB 2PPHA 2AYOB 4CYEA 4GN1A 4DWFA 2O6VA 3K9OB 3KYCD 2NBUA 2Z0DB 3U7DA 3H9DA 3VXWA 2R2OA 5G2NA 2KOXA 2J0JA 3L17A 4AJWA 5J17A 5GMVA 2D3GA 2FCMA 4JGHB 4K1RB 1YJ1A 2KN5A 1UBQA 1WX8A 5TR5A 5L83A 4G3XB 2LGXA 3JSVA 2G4SA 3R7RA 3CMMB 4KZ0A 1GC6A 1WM3A 2ZPYA 2BYVE 3AU4A 3T8MA 2ZNVC 2RGFA 1TBEA 2ZVNA 2KVRA 2DAFA 4GDKB 5D7GA 4KDIC 2IYDB 3ZNHB 3IBEA 3M63B 2ZCBA 2KFKB 2KQ7A 2K25A 3TIXA 1TGZB 3DBRI 3DQVA 3ZRCA 2N4FA 4ZRIA 2REXA 2C9WB 1V9JA 3HM3A 3V60A 2BYEA 3ONSA 2V3SA 3CF6E 1A5RA 2JZZA 3DBHI 1TTNA 2G4DB 2RSUA 3JYUA 4MSMB 3A1QB 4ANXA 1WGGA 2BPSA 3A33B 3D32A 4RM8A 1XQQA 4DDGD 1KOTA 3QQ8B 4W9IA 4GMVA 3R3MA 3LJ3A 1JRUA 3DVGX 3KUCB 2LUEA 4W9FA 4EOYA 2K39A 4EFOA 1E8YA 4JIOU 2EKEC 1OGWA 2K8BA 4I6NB 5CHFA 2KC1A 3DVGY 4KSKC 1Q5WB 2IO1B 3WALA 3ZDTA 5HKHA 1V49A 4OVUA 5E6PA 5AZHA 2DENB 3OLMD 2K1FA 1X1MA 4DHZE 2KWCA 4IM3A 2DYOA 2N9PC 1E90A 3ZW3A 3WAMA 1E8WA 4FN2A 1WY8A 3NS8A 3DBLI 3NHEB 2LXCA 4LDTD 2KMAA 1MG8A 2LJ5A 4HJKA 1ISNA 3O65B 1UZXB 2KDBA 4HPMB 2D10A 4GDLB 2J0MA 4II3B 1VCBA 4A3PA 3DDCB 2GBRA 4TQ1A 4BFRA 2ZEQA 3PV1A 1I42A 2BWES 4FHKA 3SD5A 2XK5B 3ZO5B 2LRWA 3HHMA 3VQIA 4TQ0A 2KWUB 3M95A 4G11A 4DXAB 2MBEA 1WH3A 4MH0E 1GUAB 2V1YA 3N3KB 2BKFA 4BBNC 1RLFA 3ZNGC 1NBFC 1RAXA 1ZKHA 2VRRB 3HM6X 1P0RA 2K8HA 4K7WA 5CHVC 4W9GA 4AUQC 4WJPA 1GC7A 4URKA 2GMIC 1OEYJ 1GNUA 4ANUA 2MP2A 4HXDA 3N32A 1WZ3A 2DZIA 1WJUA 2MBHA 3A4SC 3RZFA 1WFYA 1RFAA 1ZGUB 1S1QB 5BO4B 3WIMA 3UF8A 3VFKA 2DYBA 2LGDA 1UD7A 2YVCA 2GOWA 4BKSA 1WGRA 2FCSA 4WWPA 3W1SA 4E71A 1G6JA 2N9XA 4WJQA 2NVUI 3BY4B 4NPNA 2DZMA 1V81A 2C7MB 3JSVB 3H1UA 1H8CA 1OQYA 1Q1OA 3HIZA 4MJSA 3VHTC 3L08A 2JZ3B 3APDA 4GDKA 5LLIA 2JF5A 1WXAA 3NZSA 3NZUA 2YLMA 3KVFB 4ZDVA 1E5WA 4FLHA 5JH5C 1IPGA 3PHWB 1YQBA 1OEYA 3A9JB 2HD5B 4ZRKA 2IZVB 3U30A 4M8MA 4DK5A 2MBBB 1TZ1A 4BKGA 2AWTA 1HE8A 3PPAA 3B1LX 4K81A 4WWOA 3ZIMA 3PREA 3VUWA 1WMHA 3AI5A 4IC7B 4ANVA 5AZGA 2WYQA 3KUZA 2KK8A 2A4ZA 2BGFA 2LD9A 2O6VD 1T0YA 1EO6A 4JLCA 5L95C 4M8NA 2KTRB 3LDZE 1L2NA 1WJ6A 1YX6B 3VH4B 4ICVA 3TBLD 1J8CA 3ZRFA 3IHPC 1J0GA 1RRBA 3L0WB 1EF5A 3PGEA 1WE6A 1P98A 2OOBB 3KYDD 4GGQA 4TKNA 1WYWB 5CTRC 5FR6A 4CO7A 1C3TA 3VAWA 3AU5A 4DBGA 2BWFA 2KANA 3PS6A 3QA8A 4NQKE 4B9KA 1P9DU 2I1JA 1V5TA 2L8JA 2PJHA 3ZKJC 3DVNV 4AJYB 2MQJA 3RULA 2KJ6A 3ZTDA 1KJTA 3RD2A 2DAJA 4FJZA 3IFWB 2PEAA 2KFKA 4MDKE 4J6IA 2AL3A 4JQWC 4LCDE 4F8CB 2AL6A 3GOEA 4XX5A 2G45B 3TJPA 3RZWC 4FJYA 4MM3A 2IO2B 3A9KA 2LVOA 4HCNB 3QIJA 3Q3JA 4NY0A 3WANA 4GSWA 4KZCA 1L7YA 2KNBA 2O6VB 3CSTA 2L05A 2DZJA 4FHJA 3M62B 1Q0WB 2M1MA 1OTRB 4PS8A 5LXHA 3R66C 2RR9A 3NOBA 4MEMA 3H7SA 2LVPA 2B3AA 1IP9A 4NAWB 2GBNA 2L7RA 4FJVB 3VTVA 2RPQA 3KUDB 1WXMA 2I1KA 3L10B 1CMXB 2MP2B 2LASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H7P B;  3IVF A;  1WJN A;  4B6W A;  2CU1 A;  4FUL A;  2CHX A;  3APC A;  2L3Z A;  2W9N A;  2JWZ A;  1H4R A;  2DZK A;  2ZZP B;  2CHW A;  1R4M I;  2CS4 A;  4I6L B;  4W9K A;  5AEK B;  3EFU A;  3BIN A;  3QHT A;  4FBJ B;  3VTW A;  2IO0 B;  2N9E B;  3QCA A;  1WRD B;  2K8C A;  2FAZ A;  4IM2 A;  4GOC A;  5IA7 A;  4WJN A;  2WX0 A;  3RUI B;  2GBK A;  3ML9 A;  4ZYN A;  2KMC A;  4BBN F;  2MRP A;  2L0F A;  2NPT A;  2A5U A;  3A1Q A;  2IY0 B;  4HDQ A;  5CX3 A;  3CSF A;  1XT9 B;  3OJ3 A;  1U4A A;  4HLE A;  1YX5 B;  2J7Q B;  2KQS A;  4N9F 4;  3ZUN A;  1WGD A;  3A9J A;  3H6N A;  3L16 A;  3MJW A;  3VDZ A;  4EUT A;  3ZTC A;  4LJP B;  3JVZ X;  3DOW A;  3ZLZ A;  5JZE B;  2KX3 A;  2LVQ A;  4BVU C;  1E7V A;  3PVL A;  2MWS B;  4G50 A;  3VUX A;  1WXS A;  4AOF A;  2NCN A;  4I6P A;  3W1Y A;  4EZJ A;  1QZE A;  4EZL A;  3UIO B;  2KLC A;  4KVG B;  2JY6 A;  4AWJ A;  3QAQ A;  2NS5 A;  1E8X A;  3QWZ B;  1XD3 B;  2DYM A;  2N1W A;  1F9J A;  1E7U A;  4M0W B;  4MGK E;  1LXD A;  4A3O A;  1WZ0 A;  2MBO A;  2O2V A;  2N1V A;  2LXA A;  4PYU A;  2C60 A;  1NDD A;  1WE7 A;  2LRU A;  1SIF A;  1C1Y B;  5IAA C;  1PQS A;  4F1S A;  2KJH B;  2R2Q A;  2NBV B;  2FCN A;  1SGH A;  4PYZ A;  4RM9 A;  5J2R A;  3ML8 A;  5C1Z A;  3PRZ A;  4KIK A;  2CHZ A;  4II2 B;  3DBS A;  4B95 A;  4HVB A;  4F7Z A;  4FA6 A;  4AP4 C;  4MJS B;  2DHZ A;  2KZR A;  1V6E A;  2M4N A;  2NR2 A;  2QHO A;  2FNJ B;  4W9E A;  4WQO B;  4DHJ B;  2WWZ A;  2LGY A;  1V80 A;  3PRM B;  3R7Q A;  3DVN U;  4ASW C;  3B0A A;  1V2Y A;  1K8R B;  4KV2 A;  4GB9 A;  2KC2 A;  4HPL B;  4ANW A;  2JUO A;  3QX1 A;  1WF9 A;  3A4R A;  2RD0 A;  1S3S G;  1WMH B;  4JL9 A;  2KDF B;  1WIA A;  2D07 B;  1V5O A;  2FIF A;  4E74 A;  3PTF C;  2D2Q A;  2D11 A;  4WWN A;  2KD0 A;  2HE7 A;  3SDL C;  2ASQ A;  2MLB A;  2LWP A;  4IG7 B;  2ZNV B;  2L76 A;  1KLV A;  4LJO B;  1UEL A;  4HK2 A;  2KTR A;  2OJR A;  4G0N B;  3RCZ A;  2BYF A;  3SHQ A;  2M0X A;  4DHJ D;  2PE6 B;  2G3Q B;  4W9C A;  4GDL A;  1WGH A;  3EHV A;  2KKC A;  2IO3 B;  4DDI D;  3WAO A;  3MHS D;  1EF1 A;  2ZJD A;  3MTN B;  4TUU A;  3NY5 A;  4EKU A;  1YIW A;  2KTF A;  2Z0E B;  3H7P A;  4K7U A;  3UGB B;  3M3J A;  2C7H A;  4BKS D;  3QC8 B;  1WJ4 A;  4BOS C;  1P3Q U;  2CR5 A;  2KWV B;  1GG3 A;  2KDI A;  3WAP A;  2CKH B;  3PLV A;  3JW0 X;  3B08 A;  1SE9 A;  4PS3 A;  4BKT A;  4MEL A;  2MW5 A;  4KDL B;  5JHA A;  1LFD A;  1BT0 A;  4FAD A;  4GXB A;  5KHQ A;  2M17 A;  2JPH A;  3GZN I;  4IM0 A;  4CHK A;  3OAW A;  1WI0 A;  1UH6 A;  4K7S A;  1Y8R C;  1FXT B;  2KFJ A;  3UIN B;  3PT2 B;  5DPW A;  3DPD A;  2MBQ A;  5DCN A;  1GJZ A;  2ZVO A;  2JRI B;  5DPS A;  2HTH A;  2UWQ A;  4ICU A;  1WX9 A;  4IUM B;  2N7E A;  4IWQ A;  3TCA A;  3X0W A;  2WX1 A;  4W9H A;  4WAA A;  4NAW A;  1E8Z A;  5AZF A;  2Z59 B;  4IW0 A;  5D2M B;  2L0T A;  1LQB A;  2JXX A;  3RT3 B;  5EDS A;  2N7D A;  5LXI B;  1D3Z A;  1R4N I;  2LI5 A;  2KHW B;  2XBB C;  1UGM A;  3S2A A;  5JHB A;  3UIP B;  3Q3F A;  1UBI A;  2KJR A;  2GBJ A;  3PLU A;  4RMA A;  1LM8 B;  2AEH A;  2JVC A;  4W9D A;  4EEW A;  1WXV A;  4BOZ B;  3OJ4 B;  2K6Q A;  2XEW A;  3WA0 A;  2DX5 B;  2WDT B;  3V6C B;  5E6N A;  3HK0 A;  3ENE A;  4KIK B;  3SU8 X;  1M94 A;  3I3T B;  5KHO A;  1V86 A;  2MA9 B;  4MGY E;  2JRH A;  3L13 A;  2ZPN A;  3ZDM C;  4HCP B;  4EZK A;  3C0R B;  4X57 B;  3VVW B;  4A20 A;  2HJ8 A;  3K9P B;  2XK5 A;  3ALB A;  4IWO A;  3PZD A;  1Z2M A;  3PSE B;  4OVV A;  1VD2 A;  4W9J A;  2K6D B;  1IYF A;  2EMT A;  3KW5 B;  5CHW A;  1KM7 A;  4NJ6 A;  3VUY A;  3W1S C;  4E3C A;  1WM2 A;  3VH3 B;  4PS7 A;  3L54 A;  4NNJ B;  2GBM A;  2EMS A;  3ECI A;  3DCG A;  2L00 B;  2C5L C;  4MGZ E;  2IY1 B;  3UQB A;  4XZ4 A;  1WGY A;  3ZNI D;  1P1A A;  4XC2 A;  3AXC A;  3ZNZ B;  2KXJ A;  2M8S A;  2BKR B;  3A9K B;  2BF8 B;  5E6O A;  2Y5B B;  4LDT B;  4YL8 A;  1WR1 A;  2ZCC A;  4TV3 A;  5D6J B;  2JT4 B;  3UQA A;  4GIV A;  3TL5 A;  1EUV B;  3QJZ A;  4ZRJ A;  2J0K A;  2KO3 A;  4WJO A;  2KX0 A;  2KDE B;  2MX2 A;  3U8Z A;  4NQL B;  1YD8 U;  2UYZ B;  2KLG A;  3RYT A;  3X23 A;  2C7N B;  4HDO A;  3IG3 A;  1ZW7 A;  2MSE D;  5C23 A;  1AAR A;  4DHZ B;  2NPT B;  4HWI B;  3V62 A;  3VTU A;  4W9L A;  5G55 A;  2PE9 A;  3APF A;  3V61 A;  2V4L A;  4P7I A;  3QK0 A;  1I35 A;  5D94 A;  5DPR A;  4MSQ B;  4IWP A;  3KH0 A;  3PHX B;  2FCQ A;  3TMP B;  1NI2 A;  5DPT A;  4MGI E;  1J19 A;  2NBW B;  1WR6 E;  2LZ6 A;  3EEC A;  3ZVV A;  3EC8 A;  3N30 A;  1WX7 A;  3P2B A;  2FUH B;  4KSL C;  5J18 A;  2FID A;  3V6E B;  4GU2 A;  1Z5S B;  3AUL A;  3QAR A;  3PRP B;  3T9L A;  4NJ7 A;  2MCN B;  2O2V B;  2IBI B;  2PPH A;  2AYO B;  4CYE A;  4GN1 A;  4DWF A;  2O6V A;  3K9O B;  3KYC D;  2NBU A;  2Z0D B;  3U7D A;  3H9D A;  3VXW A;  2R2O A;  5G2N A;  2KOX A;  2J0J A;  3L17 A;  4AJW A;  5J17 A;  5GMV A;  2D3G A;  2FCM A;  4JGH B;  4K1R B;  1YJ1 A;  2KN5 A;  1UBQ A;  1WX8 A;  5TR5 A;  5L83 A;  4G3X B;  2LGX A;  3JSV A;  2G4S A;  3R7R A;  3CMM B;  4KZ0 A;  1GC6 A;  1WM3 A;  2ZPY A;  2BYV E;  3AU4 A;  3T8M A;  2ZNV C;  2RGF A;  1TBE A;  2ZVN A;  2KVR A;  2DAF A;  4GDK B;  5D7G A;  4KDI C;  2IYD B;  3ZNH B;  3IBE A;  3M63 B;  2ZCB A;  2KFK B;  2KQ7 A;  2K25 A;  3TIX A;  1TGZ B;  3DBR I;  3DQV A;  3ZRC A;  2N4F A;  4ZRI A;  2REX A;  2C9W B;  1V9J A;  3HM3 A;  3V60 A;  2BYE A;  3ONS A;  2V3S A;  3CF6 E;  1A5R A;  2JZZ A;  3DBH I;  1TTN A;  2G4D B;  2RSU A;  3JYU A;  4MSM B;  3A1Q B;  4ANX A;  1WGG A;  2BPS A;  3A33 B;  3D32 A;  4RM8 A;  1XQQ A;  4DDG D;  1KOT A;  3QQ8 B;  4W9I A;  4GMV A;  3R3M A;  3LJ3 A;  1JRU A;  3DVG X;  3KUC B;  2LUE A;  4W9F A;  4EOY A;  2K39 A;  4EFO A;  1E8Y A;  4JIO U;  2EKE C;  1OGW A;  2K8B A;  4I6N B;  5CHF A;  2KC1 A;  3DVG Y;  4KSK C;  1Q5W B;  2IO1 B;  3WAL A;  3ZDT A;  5HKH A;  1V49 A;  4OVU A;  5E6P A;  5AZH A;  2DEN B;  3OLM D;  2K1F A;  1X1M A;  4DHZ E;  2KWC A;  4IM3 A;  2DYO A;  2N9P C;  1E90 A;  3ZW3 A;  3WAM A;  1E8W A;  4FN2 A;  1WY8 A;  3NS8 A;  3DBL I;  3NHE B;  2LXC A;  4LDT D;  2KMA A;  1MG8 A;  2LJ5 A;  4HJK A;  1ISN A;  3O65 B;  1UZX B;  2KDB A;  4HPM B;  2D10 A;  4GDL B;  2J0M A;  4II3 B;  1VCB A;  4A3P A;  3DDC B;  2GBR A;  4TQ1 A;  4BFR A;  2ZEQ A;  3PV1 A;  1I42 A;  2BWE S;  4FHK A;  3SD5 A;  2XK5 B;  3ZO5 B;  2LRW A;  3HHM A;  3VQI A;  4TQ0 A;  2KWU B;  3M95 A;  4G11 A;  4DXA B;  2MBE A;  1WH3 A;  4MH0 E;  1GUA B;  2V1Y A;  3N3K B;  2BKF A;  4BBN C;  1RLF A;  3ZNG C;  1NBF C;  1RAX A;  1ZKH A;  2VRR B;  3HM6 X;  1P0R A;  2K8H A;  4K7W A;  5CHV C;  4W9G A;  4AUQ C;  4WJP A;  1GC7 A;  4URK A;  2GMI C;  1OEY J;  1GNU A;  4ANU A;  2MP2 A;  4HXD A;  3N32 A;  1WZ3 A;  2DZI A;  1WJU A;  2MBH A;  3A4S C;  3RZF A;  1WFY A;  1RFA A;  1ZGU B;  1S1Q B;  5BO4 B;  3WIM A;  3UF8 A;  3VFK A;  2DYB A;  2LGD A;  1UD7 A;  2YVC A;  2GOW A;  4BKS A;  1WGR A;  2FCS A;  4WWP A;  3W1S A;  4E71 A;  1G6J A;  2N9X A;  4WJQ A;  2NVU I;  3BY4 B;  4NPN A;  2DZM A;  1V81 A;  2C7M B;  3JSV B;  3H1U A;  1H8C A;  1OQY A;  1Q1O A;  3HIZ A;  4MJS A;  3VHT C;  3L08 A;  2JZ3 B;  3APD A;  4GDK A;  5LLI A;  2JF5 A;  1WXA A;  3NZS A;  3NZU A;  2YLM A;  3KVF B;  4ZDV A;  1E5W A;  4FLH A;  5JH5 C;  1IPG A;  3PHW B;  1YQB A;  1OEY A;  3A9J B;  2HD5 B;  4ZRK A;  2IZV B;  3U30 A;  4M8M A;  4DK5 A;  2MBB B;  1TZ1 A;  4BKG A;  2AWT A;  1HE8 A;  3PPA A;  3B1L X;  4K81 A;  4WWO A;  3ZIM A;  3PRE A;  3VUW A;  1WMH A;  3AI5 A;  4IC7 B;  4ANV A;  5AZG A;  2WYQ A;  3KUZ A;  2KK8 A;  2A4Z A;  2BGF A;  2LD9 A;  2O6V D;  1T0Y A;  1EO6 A;  4JLC A;  5L95 C;  4M8N A;  2KTR B;  3LDZ E;  1L2N A;  1WJ6 A;  1YX6 B;  3VH4 B;  4ICV A;  3TBL D;  1J8C A;  3ZRF A;  3IHP C;  1J0G A;  1RRB A;  3L0W B;  1EF5 A;  3PGE A;  1WE6 A;  1P98 A;  2OOB B;  3KYD D;  4GGQ A;  4TKN A;  1WYW B;  5CTR C;  5FR6 A;  4CO7 A;  1C3T A;  3VAW A;  3AU5 A;  4DBG A;  2BWF A;  2KAN A;  3PS6 A;  3QA8 A;  4NQK E;  4B9K A;  1P9D U;  2I1J A;  1V5T A;  2L8J A;  2PJH A;  3ZKJ C;  3DVN V;  4AJY B;  2MQJ A;  3RUL A;  2KJ6 A;  3ZTD A;  1KJT A;  3RD2 A;  2DAJ A;  4FJZ A;  3IFW B;  2PEA A;  2KFK A;  4MDK E;  4J6I A;  2AL3 A;  4JQW C;  4LCD E;  4F8C B;  2AL6 A;  3GOE A;  4XX5 A;  2G45 B;  3TJP A;  3RZW C;  4FJY A;  4MM3 A;  2IO2 B;  3A9K A;  2LVO A;  4HCN B;  3QIJ A;  3Q3J A;  4NY0 A;  3WAN A;  4GSW A;  4KZC A;  1L7Y A;  2KNB A;  2O6V B;  3CST A;  2L05 A;  2DZJ A;  4FHJ A;  3M62 B;  1Q0W B;  2M1M A;  1OTR B;  4PS8 A;  5LXH A;  3R66 C;  2RR9 A;  3NOB A;  4MEM A;  3H7S A;  2LVP A;  2B3A A;  1IP9 A;  4NAW B;  2GBN A;  2L7R A;  4FJV B;  3VTV A;  2RPQ A;  3KUD B;  1WXM A;  2I1K A;  3L10 B;  1CMX B;  2MP2 B;  2LAS A; 
#chains in the Genus database with same CATH topology
 3IVF A;  1C4C A;  2JWZ A;  1AWD A;  2CS4 A;  1FNW A;  3IT4 B;  3EFU A;  2QSD A;  4YWG G;  2FAZ A;  4YT0 B;  1F0Z A;  3LB8 C;  4ZYS A;  4ZYN A;  3CWI A;  3A1Q A;  1UWX A;  1KH0 A;  2A5U A;  1E0Z A;  4KGS A;  4WH4 A;  4HDQ A;  1U4A A;  2J7Q B;  4N9F 4;  3ZUN A;  1N5W A;  4EUT A;  4LJP B;  3ZLZ A;  3DOW A;  4YSX B;  4G50 A;  1I4P A;  2NCN A;  4EZJ A;  1HA5 A;  1N61 A;  2JY6 A;  1ZXH A;  1E8X A;  2L32 A;  3AH7 A;  4QAY A;  1F9J A;  1WZ0 A;  1ZDX A;  1GB4 A;  2LXA A;  2WXG A;  2NBV B;  3O13 A;  4RM9 A;  5J2R A;  3C8Y A;  1BUI C;  3PRZ A;  4F7Z A;  4FA6 A;  1V6E A;  2J53 A;  2FNJ B;  4DHJ B;  2WWZ A;  2LGY A;  1TKE A;  1N62 A;  2CU3 A;  3FIL B;  3QX1 A;  2RD0 A;  1NEK B;  2KDF B;  2OHF A;  2D07 B;  2FIF A;  2LHD A;  1LO5 D;  4WWN A;  3SDL C;  1TYG B;  1V1P A;  2MLB A;  1KLV A;  2W55 A;  3RCZ A;  4DHJ D;  2M0X A;  4W9C A;  3EHV A;  2KKC A;  2IO3 B;  3WAO A;  1EF1 A;  1E7P B;  4TUU A;  1IGD A;  3NY5 A;  4EKU A;  1YIW A;  3UGB B;  3M3J A;  4WUR A;  4ZHO A;  1F1H A;  2JU6 X;  2OED A;  1ZOY B;  1GG3 A;  2KDI A;  1TZO A;  3WAP A;  2ACZ B;  4C4V A;  5AUI A;  3NVZ A;  4PS3 A;  4FAD A;  3I9V 1;  4IM0 A;  3GZN I;  4TSS A;  4C7Y A;  3VR9 B;  3UIN B;  2WXI A;  1GJZ A;  1TS4 A;  2UWQ A;  3AE4 B;  2CJO A;  2FBW B;  4YSZ B;  2WX1 A;  1MFW A;  1C4A A;  4NAW A;  3ZXR A;  3AE8 B;  4IW0 A;  4XYC A;  4DXF A;  2JXX A;  3RT3 B;  3WCQ A;  2N7D A;  5LXI B;  5JXV A;  1MJD A;  1RWS A;  2GBJ A;  2JVC A;  1WXV A;  4BOZ B;  2K6Q A;  2WDT B;  2DBY A;  3V6C B;  1M94 A;  3DHH C;  1YOV B;  1IBX A;  4S0R A;  4A20 A;  1L0X B;  1ZP0 B;  2H88 B;  3N1X C;  1Z2M A;  3PSE B;  1VD2 A;  3ABV B;  5BMG A;  2EMT A;  4Q2J A;  5EE9 A;  2JYE A;  4LLG M;  1KM7 A;  3VUY A;  1WM2 A;  1QLB B;  3ECI A;  1ET9 A;  1JQ4 A;  4R3D A;  2C5L C;  4MGZ E;  2IY1 B;  2E6X A;  3ZNZ B;  2Y5B B;  1KFY B;  2JT4 B;  1EUV B;  1YJI A;  3VR8 B;  1YD8 U;  4A55 A;  2KLG A;  1ZW7 A;  3ZQ4 A;  1CQV A;  2AX5 A;  1JRO A;  2PE9 A;  1KF6 B;  5G55 A;  2V4L A;  3QK0 A;  2HDE A;  1YN4 A;  1RYJ A;  2FCQ A;  2PVG C;  4MGI E;  1J19 A;  1SEB D;  1FEH A;  3P2B A;  2FUH B;  2FID A;  3RI7 C;  1QKZ A;  2MJD A;  4GN1 A;  2O6V A;  3KYC D;  3H9D A;  2KOX A;  2GLS A;  5I4D A;  2KN5 A;  1PGA A;  1UBQ A;  2IDY A;  2LGX A;  1WM3 A;  2RGF A;  1FNV A;  2D3A A;  2DAF A;  4GDK B;  3ZNH B;  2ZCB A;  2KFK B;  1DOY A;  2KQ7 A;  2K25 A;  4ZRI A;  2RDB C;  1V9J A;  4OZA A;  2XN9 C;  1QT9 A;  1A5R A;  2WP9 B;  2RSU A;  4ANX A;  4MSM B;  3A1Q B;  2BPS A;  3D32 A;  4RM8 A;  1C78 A;  3QQ8 B;  2IPK D;  4EOY A;  3DVG X;  4I6N B;  4A9A A;  3ZDT A;  3Q14 C;  2ZW1 A;  5AZH A;  2DEN B;  2KWC A;  1VZ7 A;  2LXC A;  3C19 A;  4HPM B;  1FFV A;  4II3 B;  2K3U A;  4FHK A;  1YN3 A;  2LRW A;  2ICI A;  2CJN A;  3NVY A;  4DXA B;  2BS3 B;  1WH3 A;  2MBE A;  1GUA B;  2V1Y A;  1HZ5 A;  4LNF A;  1NBF C;  1P0R A;  2WXJ A;  5CHV C;  5HHD G;  4W9G A;  4PK1 A;  2LUM A;  1GC7 A;  2GMI C;  1NYQ A;  1ESF A;  1WZ3 A;  2MBH A;  1RFA A;  1S1Q B;  3WIM A;  3VFK A;  2DYB A;  1QOG A;  1MG4 A;  1ZUD 2;  4JE3 B;  1CZP A;  3DWG C;  2LFI A;  4JPS A;  5BMI A;  4BKS A;  2FCS A;  1G6J A;  2V0G A;  1T6B X;  2C7M B;  1H8C A;  3L08 A;  3NZU A;  4ZDV A;  4FLH A;  5JH5 C;  1YQB A;  5EE0 A;  3URY A;  2MBB B;  2Z8L A;  3PPA A;  1E10 A;  2WYQ A;  3HVD A;  3HRD D;  2KN4 A;  2BGF A;  2O6V D;  3DBL B;  1A70 A;  2IGH A;  4M8N A;  4LNK A;  3TBL D;  1L6V A;  1VLB A;  2PIA A;  3PGE A;  2OOB B;  5CTR C;  1C77 A;  4DBG A;  1FPY A;  3PS6 A;  3BK1 A;  4P16 A;  4B9K A;  2FE8 A;  2I1J A;  3BZD B;  2N9K A;  3IFW B;  4LCD E;  2AL6 A;  1TKY A;  5H92 C;  2G45 B;  2AQ2 B;  2IO2 B;  3QIJ A;  4NY0 A;  4BAX A;  4M00 A;  1IBX B;  2L05 A;  1Q0W B;  5BYQ A;  4PS8 A;  5HG2 A;  2LGI A;  2HTM E;  4FJV B;  3VTV A;  3KUD B;  1V1O A;  3L10 B;  2ONQ A;  3BVZ A;  4FUL A;  4BZA A;  3BWU D;  1J7C A;  2DLB A;  3APC A;  3GS2 A;  1HXY D;  2K5P A;  1H4R A;  5C2T B;  2DZK A;  2ZZP B;  2CHW A;  4W9K A;  1YQ3 B;  4FBJ B;  1F2R C;  2IO0 B;  2N9E B;  2K8C A;  4OZC A;  2K0P A;  3ML9 A;  2KMC A;  4BBN F;  4A8X C;  2MRP A;  1EWY C;  3AEE B;  2NPT A;  1I4G A;  2IY0 B;  3TEZ A;  3OJ3 A;  5BMH A;  3KWL A;  3H6N A;  2WXL A;  3ZTC A;  3MC9 A;  4BVU C;  2MWS B;  2N0S B;  4I6P A;  3EUB 2;  1GAQ B;  4EZL A;  3UIO B;  1VDV A;  2D3B A;  1D5M C;  1C76 A;  2DYM A;  2N1W A;  4MGK E;  3RPF C;  1LXD A;  1Y56 A;  2MBO A;  1T0R C;  2N1V A;  4PYU A;  1WE7 A;  2C60 A;  2LRU A;  4KGT A;  4LNI A;  4PYZ A;  3GP7 A;  4KIK A;  2CHZ A;  2QEJ C;  4II2 B;  1K53 A;  4NZL B;  4B95 A;  4HVB A;  2OJW A;  4AP4 C;  4MJS B;  1L4Z B;  4W9E A;  4H2A A;  2JQR B;  1ZPS A;  1K52 A;  3R7Q A;  2KC2 A;  4HPL B;  1FNU A;  4JL9 A;  3PTF C;  2D11 A;  2KD0 A;  2HE7 A;  1M4V A;  2ASQ A;  2W54 A;  2ZNV B;  1J7B A;  4HK2 A;  1QIL A;  2BYF A;  4GDL A;  1WGH A;  1C79 A;  3MHS D;  2ZJD A;  3P4P B;  3W5U B;  4B0M A;  5C3J B;  3QC8 B;  2CR5 A;  1VZ6 A;  3B08 A;  1ZDV A;  4MEL A;  2MW5 A;  4KDL B;  1LFD A;  1B9R A;  3Q8A A;  4D2K A;  2INC C;  1UWM A;  4K7S A;  1FXT B;  1TIF A;  4ARC A;  5DPW A;  1TS3 A;  2MBQ A;  2JRI B;  2MJ3 A;  5BYR A;  4ICU A;  5AZF A;  2WU5 B;  4US8 A;  2LI5 A;  2KHW B;  2W3R A;  2XBB C;  4XGA B;  4EEW A;  1GB1 A;  2XEW A;  2QCZ A;  1JWM D;  3Q8E A;  2DX5 B;  2V3P A;  1UF0 A;  3HK0 A;  3ENE A;  3SU8 X;  3I3T B;  2QMT A;  1V86 A;  4L1B A;  2JRH A;  2BT6 A;  3C0R B;  4ITK A;  4X57 B;  3VVW B;  1Q10 A;  3K9P B;  2XK5 A;  3ALB A;  4WAF A;  2ZW0 A;  4OVV A;  1IYF A;  1KLU D;  2LGS A;  3W1S C;  3VH3 B;  1L0V B;  2EMS A;  4CQN A;  1LGR A;  2YEP B;  3ZNI D;  3AXC A;  1AYF A;  2KXJ A;  5E6O A;  3A9K B;  3RNB C;  2D3C A;  5D6J B;  4JWU C;  3QJZ A;  2KO3 A;  2KX0 A;  5G5G A;  4NQL B;  1FCL A;  5BYS A;  2UU7 A;  1TJE A;  4M02 A;  2C7N B;  4HDO A;  3IG3 A;  5C23 A;  1JW9 D;  2ON8 A;  1AAR A;  4DHZ B;  1N6Z A;  2NPT B;  4HWI B;  4W9L A;  2RDG A;  3FIL A;  1I35 A;  5D94 A;  5DPR A;  4RGT A;  4MSQ B;  4TMA B;  4N59 A;  1WR6 E;  2LZ6 A;  1WX7 A;  4GLS C;  3QAR A;  4AQ7 A;  2KAJ A;  4DWF A;  3K9O B;  3VXW A;  2J0J A;  3BYY B;  4LNO A;  5J17 A;  5GMV A;  3MP9 A;  2FCM A;  4JGH B;  4K1R B;  1EM7 A;  5TR5 A;  4G3X B;  1XCQ L;  4KZ0 A;  2VZK D;  4JWS C;  1JCK B;  2KVR A;  1T0S C;  3W9C B;  2GI9 A;  2IYD B;  3RN9 C;  1PFD A;  1IUE A;  1TGZ B;  3DBR I;  3ZRC A;  3HM3 A;  3V60 A;  3N1Y C;  2BYE A;  3ONS A;  2V3S A;  2JZZ A;  1TTN A;  2VZK B;  1WGG A;  4K3C A;  4DDG D;  1KOT A;  4PT5 A;  4GMV A;  3R3M A;  4HKQ A;  2LUE A;  1MHX A;  4EFO A;  2Q5W D;  3SR6 A;  2K8B A;  4KSK C;  3WAL A;  1C9F A;  4OVU A;  5E6P A;  3OLM D;  3PO0 A;  1X1M A;  4DHZ E;  4FN2 A;  4LDT D;  2KMA A;  1MG8 A;  2LJ5 A;  2D5G A;  3O65 B;  4OVZ A;  1L0Y B;  2D10 A;  3AE9 B;  2JXT A;  4TQ1 A;  3BII D;  4MM3 B;  4BFR A;  3AE7 B;  4HRS A;  4KKI A;  2BWE S;  2XK5 B;  3ZO5 B;  3M95 A;  3AED B;  4G11 A;  4RGM A;  2M0A A;  1ROE A;  2Y5P A;  4BBN C;  2HJ1 A;  3ZNG C;  2BVC A;  1ZKH A;  2VRR B;  3HM6 X;  3GE8 C;  4WJP A;  1K51 A;  4ANU A;  2MP2 A;  4A6Q A;  1WJU A;  2KAC A;  2QC8 A;  3UF8 A;  1HEZ E;  3RNA C;  2M19 A;  3U2S C;  2GOW A;  5AUK A;  3W1S A;  4E71 A;  2N9X A;  3N9Y C;  1NYR A;  2NVU I;  3BVM A;  3JSV B;  1MI0 A;  3Q69 A;  2WXH A;  3HIZ A;  2WLB A;  3GE3 C;  4USA A;  2V4I B;  1R4M B;  4GDK A;  5LNK 1;  5LLI A;  2JF5 A;  2VH2 A;  3TUO A;  3KVF B;  1R7S A;  1E5W A;  2IGD A;  2WDV B;  4EE2 A;  3PHW B;  1YJJ A;  3A9J B;  2HD5 B;  4ZRK A;  2IZV B;  4BKG A;  3B1L X;  3ZIM A;  3W5V B;  3AI5 A;  2KK8 A;  3FAH A;  1FXA A;  3VRA B;  1D4B A;  2KTR B;  3LDZ E;  1L2N A;  4XE0 A;  3VH4 B;  4JX1 C;  4ICV A;  1WGK A;  3IHP C;  3L0W B;  1XLN A;  1EF5 A;  2LJI A;  1PYW D;  4HRO A;  3KYD D;  1WYW B;  4CO7 A;  3AU5 A;  3VRB B;  3DBR B;  2GB1 A;  3R2I A;  3DBH B;  3ZKJ C;  2PJH A;  3DVN V;  2BYT A;  2WXR A;  3HUI A;  3ZTD A;  2DAJ A;  2N7J A;  2KFK A;  1QOA A;  3OWE B;  3TJP A;  3NJT A;  1YQ4 B;  1F2R I;  3TEX A;  3Q3J A;  2QJL A;  3MC0 B;  1XEE A;  2KNB A;  3CST A;  5FKA C;  3N1Z C;  3M62 B;  1OTR B;  5LXH A;  2RR9 A;  3NOB A;  1PGB A;  3H7S A;  3P4S B;  5D3D A;  3MJ5 A;  3V3X A;  3ZJU A;  3H7P B;  1WJN A;  4B6W A;  2CU1 A;  2MEK A;  1R4M I;  3QHT A;  3VTW A;  3QCA A;  1WRD B;  4GOC A;  3RUI B;  2GBK A;  5IO9 A;  3U52 E;  2L0F A;  1N60 A;  5CX3 A;  4C80 A;  1YX5 B;  1L6U A;  3JVZ X;  2KX3 A;  2LVQ A;  1E7V A;  2IGG A;  3PVL A;  1WXS A;  2M56 B;  2KLC A;  4KVG B;  4AWJ A;  2Y5C A;  3L4P A;  3QWZ B;  1XD3 B;  1ZXI A;  4M0W B;  2O2V A;  2N9L A;  1NDD A;  3MFG A;  1C1Y B;  1PQS A;  2MH7 A;  2WXN A;  2DWQ A;  2R2Q A;  1SSN A;  2FCN A;  4OW0 A;  4L23 A;  2WXF A;  3DBS A;  4P6V F;  2KVZ A;  2DHZ A;  2M4N A;  2NR2 A;  2QHO A;  4WQO B;  2WXQ A;  2WHI A;  4LK0 M;  3DVN U;  2INP E;  1V2Y A;  3B0A A;  4KV2 A;  4GB9 A;  4RF1 A;  1WF9 A;  1QOF A;  4XWT A;  5H8Y E;  1WIA A;  4E74 A;  1STE A;  2D2Q A;  2Y3A A;  2LWP A;  4IG7 B;  3BYT B;  1UEL A;  4RNA A;  2KTR A;  2OJR A;  4G0N B;  2KWD A;  4MH8 A;  1TKG A;  1V8C A;  1I4Q A;  3TSS A;  4DDI D;  2PTL A;  3MTN B;  2KTF A;  2KDM A;  4K7U A;  1XLO A;  1JWA D;  2C7H A;  1WJ4 A;  4BOS C;  1SJH D;  2MJE A;  3PLV A;  4RH6 A;  3P1M A;  2QIE B;  2AQ1 B;  1SE9 A;  2JWU A;  1JWU D;  5JHA A;  2L52 A;  4GXB A;  4O1N A;  1FIQ A;  2MHJ A;  2JPH A;  4CHK A;  1UH6 A;  1Y8R C;  1IGC A;  2J4X A;  5DCN A;  2ZVO A;  1FCC C;  3NUH B;  1SE4 A;  3TCA A;  4IWQ A;  4IUM B;  1E8Z A;  1FXI A;  5EDS A;  4S17 A;  1MPE A;  4AS1 A;  1D3Z A;  1R4N I;  1UGM A;  3S2A A;  3P4R B;  3AE5 B;  3Q3F A;  1UBI A;  2NMQ A;  2KJR A;  2BQQ A;  1LM8 B;  3AMZ A;  4A90 A;  4WWM A;  1HQR D;  5E6N A;  4KIK B;  1KTK A;  5KHO A;  1UNS A;  1EWC A;  2ZPN A;  2TSS A;  4HCP B;  3ZDM C;  4C7Z A;  2VH1 A;  4EZK A;  4XWW A;  3B9J A;  2HJ8 A;  2L83 A;  4IWO A;  3RNC C;  2K6D B;  3W2D A;  5IOI A;  1N63 A;  4NJ6 A;  1D5Z C;  3L54 A;  3Q6B A;  2GBM A;  4NNJ B;  3UQB A;  4REZ A;  2V3N A;  1P1A A;  1V1P B;  4XC2 A;  4ZOH C;  2BKR B;  2BF8 B;  4LDT B;  1N5X A;  4YL8 A;  2ZCC A;  2R61 A;  3UQA A;  3TL5 A;  2IJ0 A;  4ZRJ A;  2J0K A;  1NI3 A;  2PW9 A;  2INN E;  2BB5 A;  2UYZ B;  3X23 A;  1TY2 A;  4HKZ E;  3GZN B;  5D3I B;  2E3T A;  3V61 A;  3LXF A;  1MHH E;  3KH0 A;  5MPO A;  4KGR A;  3EFC A;  4GU2 A;  1Z5S B;  4WIP A;  4NJ7 A;  3CIR B;  2O2V B;  2MCN B;  2PPH A;  4CYE A;  2PLP A;  2W82 A;  2Z0D B;  2R2O A;  1EU4 A;  1FO4 A;  3L17 A;  4AJW A;  1DOX A;  3MC8 A;  2D3G A;  3ETR A;  3SEB A;  4UDU C;  1YJ1 A;  5L83 A;  1WX8 A;  3TEY A;  2JYT A;  2WXM A;  2G4S A;  3CMM B;  3SFD B;  3AE1 B;  2ZPY A;  2BYV E;  3AU4 A;  2ZNV C;  1SXT A;  1TBE A;  1C4P A;  3HVZ A;  4KDI C;  3OG5 A;  4YTN B;  1QOB A;  3IBE A;  3M63 B;  1D5X C;  1CK1 A;  2W3S A;  2XNA C;  1JWB D;  2REX A;  4YTP B;  2PKO A;  1R4N B;  1DYQ A;  3MHZ A;  1I4R A;  2G4D B;  3JYU A;  1E9M A;  1B1Z A;  2WDR B;  3A33 B;  1XQQ A;  2DNF A;  4W9I A;  1DOI A;  1TY0 A;  2QIL A;  1OGW A;  3AEF B;  5CHF A;  3DVG Y;  1Q5W B;  3Q3O C;  1V49 A;  4DQO C;  2EKI A;  1XLP A;  4IM3 A;  2N9P C;  1E90 A;  3NRZ A;  3ZW3 A;  3WAM A;  1E8W A;  3NS8 A;  3NHE B;  4HJK A;  1ISN A;  4MT5 A;  4GDL B;  4J3O D;  4A3P A;  3DDC B;  2QDF A;  2GBR A;  1OFF A;  3T3N A;  3R8B A;  3SD5 A;  2JX5 A;  1SE2 A;  4RFB A;  3VQI A;  4TQ0 A;  2KWU B;  1JRP A;  2BKF A;  2K8H A;  2AQ3 B;  4AUQ C;  1YMH E;  2WU2 B;  3NG0 A;  4URK A;  1OEY J;  1TT5 B;  4HPP A;  3N32 A;  3E56 A;  3A4S C;  3RZF A;  2K9X A;  1ZGU B;  2WXO A;  5BO4 B;  2LGD A;  3AV8 A;  1KRH A;  4KX6 B;  2L1A A;  2DZM A;  1V81 A;  4HJG E;  3H1U A;  1ZE3 D;  2PMV A;  1Q1O A;  3APD A;  2YLM A;  1IPG A;  2BS2 B;  4US9 A;  1OEY A;  4ZRP A;  4DK5 A;  4M8M A;  1HE8 A;  4K81 A;  4WWO A;  4IDI A;  3PRE A;  3VUW A;  1WMH A;  4ANV A;  5AZG A;  3FC4 A;  2WS3 B;  3I5J C;  1EO6 A;  4JLC A;  5L95 C;  2I2Y A;  3RNG C;  1YX6 B;  1PDX A;  1F52 A;  3NVW A;  3DWM A;  4GGQ A;  4TKN A;  1WE6 A;  1P98 A;  3KLS X;  1C3T A;  3VAW A;  2WNM A;  1XCT L;  1BXT A;  1JWS D;  1V5T A;  2L8J A;  3KWV A;  2MQJ A;  2WGS A;  2X38 A;  3AE2 B;  4FJZ A;  2AL3 A;  4JQW C;  4F8C B;  1YNT E;  1QF6 A;  4FJY A;  4MM3 A;  3GB1 A;  2BB6 A;  4RGN A;  4GSW A;  1L7Y A;  1RM6 C;  4FHJ A;  3B2G A;  2BBC A;  2RPV A;  3R66 C;  3N20 C;  2LVP A;  5IN7 A;  1IP9 A;  1WXQ A;  2L7R A;  4FXC A;  1QQR A;  1OQR A;  2NTS A;  2LAS A;  3Q2A C;  3AEC B;  1L5P A;  2CHX A;  2L3Z A;  5IKC M;  2W9N A;  2KYW A;  3KQ4 A;  4I6L B;  5AEK B;  3BIN A;  3Q8C A;  4MAC A;  4IOI E;  3Q3M C;  4IM2 A;  5IA7 A;  4WJN A;  2WX0 A;  5G5H A;  3NVV A;  3CSF A;  1XT9 B;  4HLE A;  2KQS A;  1NVI D;  1WGD A;  3A9J A;  3L16 A;  3MJW A;  3VDZ A;  4P1B C;  5JZE B;  3ZJV A;  3VUX A;  3P4Q B;  3U4E G;  4AOF A;  3W1Y A;  1QZE A;  2I38 A;  3QAQ A;  2NS5 A;  1GPX A;  4OHJ A;  3R2T A;  1E7U A;  4A3O A;  3NS1 A;  3RNF C;  5IAA C;  1V97 A;  1SIF A;  2LHE A;  4F1S A;  2KJH B;  1SGH A;  1TS5 A;  3Q8F A;  4K3B A;  3ML8 A;  4L2Y A;  5C1Z A;  3AB5 A;  2KZR A;  4NJC A;  1WRI A;  1V80 A;  2K22 A;  3PRM B;  4ASW C;  4P1C C;  1K8R B;  1MVK A;  4ANW A;  2JUO A;  3A4R A;  1S3S G;  1WMH B;  3AE6 B;  1V5O A;  1HTQ A;  2L76 A;  4LJO B;  3SHQ A;  3V05 A;  2PE6 B;  2G3Q B;  2V9H A;  3LYY A;  1XO3 A;  1FFU A;  3AEB B;  1XXG A;  2IND C;  2Z0E B;  3H7P A;  1FM0 D;  1ENF A;  4BKS D;  1CJE A;  3AEG B;  1P3Q U;  1D6E C;  2KWV B;  3B2F A;  2CKH B;  3JW0 X;  4YXD B;  4BKT A;  3BVG A;  5HFY A;  1BT0 A;  5KHQ A;  2M17 A;  2KMM A;  3OAW A;  3RFZ B;  1WI0 A;  2KFJ A;  3PT2 B;  3DPD A;  4KKJ A;  5DPS A;  1ET6 A;  2HTH A;  2GRI A;  1WX9 A;  2N7E A;  2WXP A;  3X0W A;  2SAK A;  4W9H A;  4WAA A;  2Z59 B;  5D2M B;  2L0T A;  1LQB A;  1UGJ A;  1SIJ A;  5JHB A;  3SFE B;  3UIP B;  1FRD A;  2WDQ B;  3PLU A;  4RMA A;  2AEH A;  4W9D A;  3OJ4 B;  4OZB A;  1DGJ A;  3WA0 A;  3ZYY X;  2B76 B;  4ZHP A;  1WYG A;  1AW7 A;  2MA9 B;  4MGY E;  3L13 A;  2LEK A;  4LTU A;  1AN8 A;  1VZ8 A;  3PZD A;  5FR3 A;  4W9J A;  3KW5 B;  5CHW A;  4ARI A;  4E3C A;  1SF0 A;  2J42 A;  4PS7 A;  3DHG C;  3DCG A;  2L00 B;  4XZ4 A;  1WGY A;  1L4D B;  2NTT A;  3DHI C;  3ZGZ A;  2M8S A;  2JZP A;  4M0W A;  1WR1 A;  4TV3 A;  4GIV A;  1XF5 L;  1WWT A;  4N6E B;  4ACF A;  4WJO A;  5HI1 A;  1PGX A;  2KDE B;  2MX2 A;  3U8Z A;  3RYT A;  2WQY B;  1TS2 A;  1KLG D;  2MSE D;  4XDC A;  3V62 A;  3VTU A;  3IAS 1;  3APF A;  4P7I A;  3Q3N C;  4YSY B;  4IWP A;  3PHX B;  4ZRQ A;  3TMP B;  1NI2 A;  5DPT A;  2NBW B;  3EEC A;  3ZVV A;  3IXS A;  1EU3 A;  3EC8 A;  3E9S A;  3UI3 A;  3N30 A;  4KSL C;  5J18 A;  5IP4 D;  1OQQ A;  3PZ8 A;  3V6E B;  2X8X X;  1FRR A;  3AUL A;  3PRP B;  3T9L A;  4N58 A;  2IBI B;  2AYO B;  1FD6 A;  3P63 A;  2NBU A;  3U7D A;  2JSV X;  5G2N A;  1JML A;  1ACC A;  1T0Q C;  2WXK A;  4RGO S;  3JSV A;  1NEN B;  3R7R A;  1GC6 A;  2RMM A;  5GXG B;  3T8M A;  2LMC A;  2G1E A;  2ZVN A;  1VRA B;  5D7G A;  4C56 C;  1K50 A;  3TIX A;  3DQV A;  2N4F A;  2C9W B;  2YEP F;  1RFK A;  2BS4 B;  3CF6 E;  3DBH I;  4NAM A;  3P42 A;  1P7F A;  3LJ3 A;  1JRU A;  3KUC B;  3Q8B A;  4W9F A;  3U7Z A;  2K39 A;  1E8Y A;  4JIO U;  2EKE C;  2KC1 A;  2IO1 B;  3BK2 A;  3PZ7 A;  5HKH A;  1XLQ A;  1JAL A;  2K1F A;  5EE1 A;  2DYO A;  1WY8 A;  3DBL I;  4C00 A;  1UZX B;  2KDB A;  3IAM 1;  5FK9 C;  3ZXV A;  2BW2 A;  3I63 C;  1I4X A;  2J0M A;  1VCB A;  1T5X D;  4RCO A;  2ZEQ A;  3PV1 A;  1I42 A;  3HHM A;  4MH0 E;  3N3K B;  1RLF A;  1WSP A;  1RAX A;  4K7W A;  3EA6 A;  1VR9 A;  1GNU A;  4HXD A;  2DZI A;  1HZ6 A;  1SE3 A;  1WFY A;  3RNE C;  3AM9 A;  1UD7 A;  3IT6 B;  3AEA B;  1GOZ A;  2YVC A;  1WGR A;  4WWP A;  4WJQ A;  3BY4 B;  4NPN A;  1YN5 A;  4B0E A;  1J7A A;  2EEL A;  2KT7 A;  1OQY A;  4MJS A;  3VHT C;  1BML C;  2JZ3 B;  5T8I A;  3NZS A;  1WXA A;  1FMA D;  3AE3 B;  1F77 A;  1VJK A;  3U30 A;  2BTE A;  1SJE D;  1TZ1 A;  2AWT A;  4IC7 B;  3I57 A;  4HEA 1;  3KUZ A;  2A4Z A;  2LD9 A;  1PUT A;  3J9C A;  4YTM B;  1T0Y A;  4XDD A;  1I4H A;  1WJ6 A;  1J8C A;  3ZRF A;  1HTO A;  3ZJT A;  1J0G A;  1RRB A;  4LNN A;  2RDH A;  2SEB D;  3FKY A;  5FR6 A;  2BWF A;  2H89 B;  2KAN A;  3QA8 A;  4NQK E;  5EE3 A;  3NZ3 A;  1P9D U;  1SBB B;  5TSS A;  3AN1 A;  4AJY B;  4DXG A;  3RUL A;  2KJ6 A;  4C4V B;  2FUG 1;  1KJT A;  3RD2 A;  2J52 A;  2PEA A;  1E6E B;  4MDK E;  4J6I A;  3RMK C;  3GOE A;  4XX5 A;  3EGR A;  1SB3 C;  1I7H A;  3RZW C;  3A9K A;  2LVO A;  4HCN B;  3WAN A;  3H8H A;  4KZC A;  2O6V B;  1UUP A;  3TEW A;  2DZJ A;  3T3O A;  2M1M A;  2G9H D;  4WQM A;  2PVO D;  4MEM A;  1T3Q A;  1P7E A;  4RF0 A;  4M01 A;  2B3A A;  4NAW B;  2GBN A;  2RPQ A;  5E6J A;  4IKG A;  1WXM A;  2I1K A;  1CMX B;  2KQ4 X;  2MP2 B; 
#chains in the Genus database with same CATH homology
 3H7P B;  3IVF A;  1WJN A;  4B6W A;  2CU1 A;  4FUL A;  2CHX A;  3APC A;  2L3Z A;  2W9N A;  2JWZ A;  1H4R A;  2DZK A;  2ZZP B;  2CHW A;  1R4M I;  2CS4 A;  4I6L B;  4W9K A;  5AEK B;  3EFU A;  3BIN A;  3QHT A;  4FBJ B;  3VTW A;  2IO0 B;  2N9E B;  3QCA A;  1WRD B;  2K8C A;  2FAZ A;  4IM2 A;  4GOC A;  5IA7 A;  4WJN A;  2WX0 A;  3RUI B;  2GBK A;  3ML9 A;  4ZYN A;  2KMC A;  4BBN F;  2MRP A;  2L0F A;  2NPT A;  2A5U A;  3A1Q A;  2IY0 B;  4HDQ A;  5CX3 A;  3CSF A;  1XT9 B;  3OJ3 A;  1U4A A;  4HLE A;  1YX5 B;  2J7Q B;  2KQS A;  4N9F 4;  3ZUN A;  1WGD A;  3A9J A;  3H6N A;  3L16 A;  3MJW A;  3VDZ A;  4EUT A;  3ZTC A;  4LJP B;  3JVZ X;  3DOW A;  3ZLZ A;  5JZE B;  2KX3 A;  2LVQ A;  4BVU C;  1E7V A;  3PVL A;  2MWS B;  4G50 A;  3VUX A;  1WXS A;  4AOF A;  2NCN A;  4I6P A;  3W1Y A;  4EZJ A;  1QZE A;  4EZL A;  3UIO B;  2KLC A;  4KVG B;  2JY6 A;  4AWJ A;  3QAQ A;  2NS5 A;  1E8X A;  3QWZ B;  1XD3 B;  2DYM A;  2N1W A;  1F9J A;  1E7U A;  4M0W B;  4MGK E;  1LXD A;  4A3O A;  1WZ0 A;  2MBO A;  2O2V A;  2N1V A;  2LXA A;  4PYU A;  2C60 A;  1NDD A;  1WE7 A;  2LRU A;  1SIF A;  1C1Y B;  5IAA C;  1PQS A;  4F1S A;  2KJH B;  2R2Q A;  2NBV B;  2FCN A;  1SGH A;  4PYZ A;  4RM9 A;  5J2R A;  3ML8 A;  5C1Z A;  3PRZ A;  4KIK A;  2CHZ A;  4II2 B;  3DBS A;  4B95 A;  4HVB A;  4F7Z A;  4FA6 A;  4AP4 C;  4MJS B;  2DHZ A;  2KZR A;  1V6E A;  2M4N A;  2NR2 A;  2QHO A;  2FNJ B;  4W9E A;  4WQO B;  4DHJ B;  2WWZ A;  2LGY A;  1V80 A;  3PRM B;  3R7Q A;  3DVN U;  4ASW C;  3B0A A;  1V2Y A;  1K8R B;  4KV2 A;  4GB9 A;  2KC2 A;  4HPL B;  4ANW A;  2JUO A;  3QX1 A;  1WF9 A;  3A4R A;  2RD0 A;  1S3S G;  1WMH B;  4JL9 A;  2KDF B;  1WIA A;  2D07 B;  1V5O A;  2FIF A;  4E74 A;  3PTF C;  2D2Q A;  2D11 A;  4WWN A;  2KD0 A;  2HE7 A;  3SDL C;  2ASQ A;  2MLB A;  2LWP A;  4IG7 B;  2ZNV B;  2L76 A;  1KLV A;  4LJO B;  1UEL A;  4HK2 A;  2KTR A;  2OJR A;  4G0N B;  3RCZ A;  2BYF A;  3SHQ A;  2M0X A;  4DHJ D;  2PE6 B;  2G3Q B;  4W9C A;  4GDL A;  1WGH A;  3EHV A;  2KKC A;  2IO3 B;  4DDI D;  3WAO A;  3MHS D;  1EF1 A;  2ZJD A;  3MTN B;  4TUU A;  3NY5 A;  4EKU A;  1YIW A;  2KTF A;  2Z0E B;  3H7P A;  4K7U A;  3UGB B;  3M3J A;  2C7H A;  4BKS D;  3QC8 B;  1WJ4 A;  4BOS C;  1P3Q U;  2CR5 A;  2KWV B;  1GG3 A;  2KDI A;  3WAP A;  2CKH B;  3PLV A;  3JW0 X;  3B08 A;  1SE9 A;  4PS3 A;  4BKT A;  4MEL A;  2MW5 A;  4KDL B;  5JHA A;  1LFD A;  1BT0 A;  4FAD A;  4GXB A;  5KHQ A;  2M17 A;  2JPH A;  3GZN I;  4IM0 A;  4CHK A;  3OAW A;  1WI0 A;  1UH6 A;  4K7S A;  1Y8R C;  1FXT B;  2KFJ A;  3UIN B;  3PT2 B;  5DPW A;  3DPD A;  2MBQ A;  5DCN A;  1GJZ A;  2ZVO A;  2JRI B;  5DPS A;  2HTH A;  2UWQ A;  4ICU A;  1WX9 A;  4IUM B;  2N7E A;  4IWQ A;  3TCA A;  3X0W A;  2WX1 A;  4W9H A;  4WAA A;  4NAW A;  1E8Z A;  5AZF A;  2Z59 B;  4IW0 A;  5D2M B;  2L0T A;  1LQB A;  2JXX A;  3RT3 B;  5EDS A;  2N7D A;  5LXI B;  1D3Z A;  1R4N I;  2LI5 A;  2KHW B;  2XBB C;  1UGM A;  3S2A A;  5JHB A;  3UIP B;  3Q3F A;  1UBI A;  2KJR A;  2GBJ A;  3PLU A;  4RMA A;  1LM8 B;  2AEH A;  2JVC A;  4W9D A;  4EEW A;  1WXV A;  4BOZ B;  3OJ4 B;  2K6Q A;  2XEW A;  3WA0 A;  2DX5 B;  2WDT B;  3V6C B;  5E6N A;  3HK0 A;  3ENE A;  4KIK B;  3SU8 X;  1M94 A;  3I3T B;  5KHO A;  1V86 A;  2MA9 B;  4MGY E;  2JRH A;  3L13 A;  2ZPN A;  3ZDM C;  4HCP B;  4EZK A;  3C0R B;  4X57 B;  3VVW B;  4A20 A;  2HJ8 A;  3K9P B;  2XK5 A;  3ALB A;  4IWO A;  3PZD A;  1Z2M A;  3PSE B;  4OVV A;  1VD2 A;  4W9J A;  2K6D B;  1IYF A;  2EMT A;  3KW5 B;  5CHW A;  1KM7 A;  4NJ6 A;  3VUY A;  3W1S C;  4E3C A;  1WM2 A;  3VH3 B;  4PS7 A;  3L54 A;  4NNJ B;  2GBM A;  2EMS A;  3ECI A;  3DCG A;  2L00 B;  2C5L C;  4MGZ E;  2IY1 B;  3UQB A;  4XZ4 A;  1WGY A;  3ZNI D;  1P1A A;  4XC2 A;  3AXC A;  3ZNZ B;  2KXJ A;  2M8S A;  2BKR B;  3A9K B;  2BF8 B;  5E6O A;  2Y5B B;  4LDT B;  4YL8 A;  1WR1 A;  2ZCC A;  4TV3 A;  5D6J B;  2JT4 B;  3UQA A;  4GIV A;  3TL5 A;  1EUV B;  3QJZ A;  4ZRJ A;  2J0K A;  2KO3 A;  4WJO A;  2KX0 A;  2KDE B;  2MX2 A;  3U8Z A;  4NQL B;  1YD8 U;  2UYZ B;  2KLG A;  3RYT A;  3X23 A;  2C7N B;  4HDO A;  3IG3 A;  1ZW7 A;  2MSE D;  5C23 A;  1AAR A;  4DHZ B;  2NPT B;  4HWI B;  3V62 A;  3VTU A;  4W9L A;  5G55 A;  2PE9 A;  3APF A;  3V61 A;  2V4L A;  4P7I A;  3QK0 A;  1I35 A;  5D94 A;  5DPR A;  4MSQ B;  4IWP A;  3KH0 A;  3PHX B;  2FCQ A;  3TMP B;  1NI2 A;  5DPT A;  4MGI E;  1J19 A;  2NBW B;  1WR6 E;  2LZ6 A;  3EEC A;  3ZVV A;  3EC8 A;  3N30 A;  1WX7 A;  3P2B A;  2FUH B;  4KSL C;  5J18 A;  2FID A;  3V6E B;  4GU2 A;  1Z5S B;  3AUL A;  3QAR A;  3PRP B;  3T9L A;  4NJ7 A;  2MCN B;  2O2V B;  2IBI B;  2PPH A;  2AYO B;  4CYE A;  4GN1 A;  4DWF A;  2O6V A;  3K9O B;  3KYC D;  2NBU A;  2Z0D B;  3U7D A;  3H9D A;  3VXW A;  2R2O A;  5G2N A;  2KOX A;  2J0J A;  3L17 A;  4AJW A;  5J17 A;  5GMV A;  2D3G A;  2FCM A;  4JGH B;  4K1R B;  1YJ1 A;  2KN5 A;  1UBQ A;  1WX8 A;  5TR5 A;  5L83 A;  4G3X B;  2LGX A;  3JSV A;  2G4S A;  3R7R A;  3CMM B;  4KZ0 A;  1GC6 A;  1WM3 A;  2ZPY A;  2BYV E;  3AU4 A;  3T8M A;  2ZNV C;  2RGF A;  1TBE A;  2ZVN A;  2KVR A;  2DAF A;  4GDK B;  5D7G A;  4KDI C;  2IYD B;  3ZNH B;  3IBE A;  3M63 B;  2ZCB A;  2KFK B;  2KQ7 A;  2K25 A;  3TIX A;  1TGZ B;  3DBR I;  3DQV A;  3ZRC A;  2N4F A;  4ZRI A;  2REX A;  2C9W B;  1V9J A;  3HM3 A;  3V60 A;  2BYE A;  3ONS A;  2V3S A;  3CF6 E;  1A5R A;  2JZZ A;  3DBH I;  1TTN A;  2G4D B;  2RSU A;  3JYU A;  4MSM B;  3A1Q B;  4ANX A;  1WGG A;  2BPS A;  3A33 B;  3D32 A;  4RM8 A;  1XQQ A;  4DDG D;  1KOT A;  3QQ8 B;  4W9I A;  4GMV A;  3R3M A;  3LJ3 A;  1JRU A;  3DVG X;  3KUC B;  2LUE A;  4W9F A;  4EOY A;  2K39 A;  4EFO A;  1E8Y A;  4JIO U;  2EKE C;  1OGW A;  2K8B A;  4I6N B;  5CHF A;  2KC1 A;  3DVG Y;  4KSK C;  1Q5W B;  2IO1 B;  3WAL A;  3ZDT A;  5HKH A;  1V49 A;  4OVU A;  5E6P A;  5AZH A;  2DEN B;  3OLM D;  2K1F A;  1X1M A;  4DHZ E;  2KWC A;  4IM3 A;  2DYO A;  2N9P C;  1E90 A;  3ZW3 A;  3WAM A;  1E8W A;  4FN2 A;  1WY8 A;  3NS8 A;  3DBL I;  3NHE B;  2LXC A;  4LDT D;  2KMA A;  1MG8 A;  2LJ5 A;  4HJK A;  1ISN A;  3O65 B;  1UZX B;  2KDB A;  4HPM B;  2D10 A;  4GDL B;  2J0M A;  4II3 B;  1VCB A;  4A3P A;  3DDC B;  2GBR A;  4TQ1 A;  4BFR A;  2ZEQ A;  3PV1 A;  1I42 A;  2BWE S;  4FHK A;  3SD5 A;  2XK5 B;  3ZO5 B;  2LRW A;  3HHM A;  3VQI A;  4TQ0 A;  2KWU B;  3M95 A;  4G11 A;  4DXA B;  2MBE A;  1WH3 A;  4MH0 E;  1GUA B;  2V1Y A;  3N3K B;  2BKF A;  4BBN C;  1RLF A;  3ZNG C;  1NBF C;  1RAX A;  1ZKH A;  2VRR B;  3HM6 X;  1P0R A;  2K8H A;  4K7W A;  5CHV C;  4W9G A;  4AUQ C;  4WJP A;  1GC7 A;  4URK A;  2GMI C;  1OEY J;  1GNU A;  4ANU A;  2MP2 A;  4HXD A;  3N32 A;  1WZ3 A;  2DZI A;  1WJU A;  2MBH A;  3A4S C;  3RZF A;  1WFY A;  1RFA A;  1ZGU B;  1S1Q B;  5BO4 B;  3WIM A;  3UF8 A;  3VFK A;  2DYB A;  2LGD A;  1UD7 A;  2YVC A;  2GOW A;  4BKS A;  1WGR A;  2FCS A;  4WWP A;  3W1S A;  4E71 A;  1G6J A;  2N9X A;  4WJQ A;  2NVU I;  3BY4 B;  4NPN A;  2DZM A;  1V81 A;  2C7M B;  3JSV B;  3H1U A;  1H8C A;  1OQY A;  1Q1O A;  3HIZ A;  4MJS A;  3VHT C;  3L08 A;  2JZ3 B;  3APD A;  4GDK A;  5LLI A;  2JF5 A;  1WXA A;  3NZS A;  3NZU A;  2YLM A;  3KVF B;  4ZDV A;  1E5W A;  4FLH A;  5JH5 C;  1IPG A;  3PHW B;  1YQB A;  1OEY A;  3A9J B;  2HD5 B;  4ZRK A;  2IZV B;  3U30 A;  4M8M A;  4DK5 A;  2MBB B;  1TZ1 A;  4BKG A;  2AWT A;  1HE8 A;  3PPA A;  3B1L X;  4K81 A;  4WWO A;  3ZIM A;  3PRE A;  3VUW A;  1WMH A;  3AI5 A;  4IC7 B;  4ANV A;  5AZG A;  2WYQ A;  3KUZ A;  2KK8 A;  2A4Z A;  2BGF A;  2LD9 A;  2O6V D;  1T0Y A;  1EO6 A;  4JLC A;  5L95 C;  4M8N A;  2KTR B;  3LDZ E;  1L2N A;  1WJ6 A;  1YX6 B;  3VH4 B;  4ICV A;  3TBL D;  1J8C A;  3ZRF A;  3IHP C;  1J0G A;  1RRB A;  3L0W B;  1EF5 A;  3PGE A;  1WE6 A;  1P98 A;  2OOB B;  3KYD D;  4GGQ A;  4TKN A;  1WYW B;  5CTR C;  5FR6 A;  4CO7 A;  1C3T A;  3VAW A;  3AU5 A;  4DBG A;  2BWF A;  2KAN A;  3PS6 A;  3QA8 A;  4NQK E;  4B9K A;  1P9D U;  2I1J A;  1V5T A;  2L8J A;  2PJH A;  3ZKJ C;  3DVN V;  4AJY B;  2MQJ A;  3RUL A;  2KJ6 A;  3ZTD A;  1KJT A;  3RD2 A;  2DAJ A;  4FJZ A;  3IFW B;  2PEA A;  2KFK A;  4MDK E;  4J6I A;  2AL3 A;  4JQW C;  4LCD E;  4F8C B;  2AL6 A;  3GOE A;  4XX5 A;  2G45 B;  3TJP A;  3RZW C;  4FJY A;  4MM3 A;  2IO2 B;  3A9K A;  2LVO A;  4HCN B;  3QIJ A;  3Q3J A;  4NY0 A;  3WAN A;  4GSW A;  4KZC A;  1L7Y A;  2KNB A;  2O6V B;  3CST A;  2L05 A;  2DZJ A;  4FHJ A;  3M62 B;  1Q0W B;  2M1M A;  1OTR B;  4PS8 A;  5LXH A;  3R66 C;  2RR9 A;  3NOB A;  4MEM A;  3H7S A;  2LVP A;  2B3A A;  1IP9 A;  4NAW B;  2GBN A;  2L7R A;  4FJV B;  3VTV A;  2RPQ A;  3KUD B;  1WXM A;  2I1K A;  3L10 B;  1CMX B;  2MP2 B;  2LAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...