2CR5A

Solution structure of the ubx domain of d0h8s2298e protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
109
structure length
109
Chain Sequence
GSSGSSGEVPDLPEEPSETAEEVVTVALRCPNGRVLRRRFFKSWNSQVLLDWMMKVGYHKSLYRLSTSFPRRALEVEGGSSLEDIGITVDTVLNVEEKEQSSQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Reproduction 8
publication title Solution structure of the UBX domain of D0H8S2298E protein
rcsb
source organism Mus musculus
total genus 10
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00789 UBX UBX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2cr5A01
3DOWA 2N9EB 2WX0A 5AZHA 2MLBA 1WI0A 2J0KA 2ZCBA 4RM9A 4KV2A 3ZLZA 1V5TA 2D11A 1WX9A 2M4NA 3A9KB 1EO6A 2AL6A 1XQQA 4BKSA 1IPGA 1GNUA 2FUHB 3CF6E 4XZ4A 5DPSA 4BKGA 3DBSA 5JH5C 3A33B 3A9KA 3EECA 3AU4A 4FHJA 1GC7A 3JVZX 4HDOA 2LVPA 2KJ6A 3ZTCA 3UIOB 2QHOA 2EMTA 1E8ZA 3DCGA 1WGDA 4NNJB 2BWES 4W9IA 2Z59B 3RZFA 4BKTA 1UBIA 3PVLA 3ALBA 4HJKA 3NZSA 4KZCA 5E6OA 3SHQA 3MHSD 1LQBA 3KYDD 1WJNA 5G2NA 2G4DB 2EKEC 3VFKA 4E71A 2KMCA 3AXCA 4EEWA 2AL3A 3WIMA 5AEKB 3T9LA 2L0FA 2M8SA 3DBLI 3PHWB 4M8MA 3RULA 1WM3A 3TL5A 2KMAA 4ICUA 3UINB 4EOYA 3QARA 4WJNA 2WDTB 3SU8X 3PRZA 4K7SA 1IYFA 4LCDE 5CHVC 3PRMB 1I35A 3R7QA 2PEAA 3JW0X 3VAWA 3ZO5B 5CTRC 2KLGA 1V9JA 3HIZA 2JY6A 5JHAA 4WQOB 4MSQB 3TBLD 2KJHB 3AULA 4GN1A 4JIOU 3A9JA 1P3QU 1XT9B 3DBRI 3PZDA 3UF8A 3A1QB 3ZNHB 4G11A 3RYTA 3X23A 1GG3A 2BYFA 2MBHA 3CMMB 1OEYA 3UIPB 4FA6A 2W9NA 4K1RB 2LRWA 4IWPA 2NR2A 1V81A 3TIXA 4MGKE 1E8XA 2L05A 1MG8A 2GMIC 3OJ4B 2LVQA 4II3B 1WM2A 4DHZE 4A20A 1J0GA 2OOBB 4IM3A 4FJYA 4GDKA 4NY0A 3UGBB 4A3OA 1R4MI 2FCNA 4HK2A 2FCSA 1UBQA 1GC6A 4JGHB 3N32A 3ZTDA 2CHWA 1L7YA 1Q1OA 1YJ1A 3OAWA 2PPHA 3R66C 1TBEA 3IBEA 4OVUA 3VTWA 3WALA 2MP2B 2IO2B 5E6NA 4LJPB 5TR5A 2D10A 2JZZA 2K1FA 2MP2A 2IO0B 4FLHA 1V49A 3ZNGC 3KYCD 3MTNB 1L2NA 2CHZA 2DYOA 3BY4B 2N1WA 1WIAA 2NS5A 2V3SA 4W9FA 3M3JA 3IVFA 2DAJA 2LGDA 2MX2A 4IWOA 1C1YB 5LXHA 3L08A 2KFKB 5CX3A 4AOFA 2MBQA 4WWOA 2BKRB 4GIVA 4B9KA 3WAMA 1EUVB 3L10B 4DDID 4PYZA 1E90A 4EFOA 2I1JA 4BOZB 4LDTD 4DHJB 4ZRJA 2DX5B 4W9CA 2HD5B 1V2YA 2KX0A 3PPAA 4K7UA 1JRUA 3NS8A 2IYDB 3GOEA 3IHPC 4LJOB 5EDSA 5J18A 2BYVE 2OJRA 2FIDA 5IA7A 4AP4C 3ZDMC 2M17A 5G55A 4URKA 2KDEB 2BF8B 1E5WA 3DVGY 3V60A 2K8CA 3ONSA 1CMXB 4KVGB 5IAAC 2NBUA 5J2RA 3JYUA 3SDLC 3Q3JA 3HM6X 2KDIA 3ML9A 3WAOA 3VVWB 2KQSA 1NI2A 1R4NI 2KQ7A 3V62A 3M95A 4NQKE 2ZPYA 1YD8U 4AJWA 2KDBA 2BGFA 2HE7A 3H6NA 2Y5BB 2JPHA 3AU5A 2CHXA 3O65B 3ZDTA 4FJVB 2FIFA 3U7DA 3B1LX 2PJHA 3RD2A 3CSFA 3L17A 4ZYNA 4G50A 4IW0A 1KOTA 4PS8A 1YQBA 2G3QB 2KK8A 4GDLA 3U8ZA 2KNBA 2K6DB 3HK0A 4A3PA 2NCNA 3UQAA 2C7HA 3H1UA 1P98A 1WYWB 2KWVB 3A4SC 4GSWA 4MSMB 2KOXA 4NAWB 2LVOA 4ZRKA 3B08A 3K9PB 5LXIB 3ECIA 3QIJA 2MBOA 3ML8A 4ASWC 2BYEA 4G0NB 3ZNID 4NAWA 2KN5A 1SIFA 2MCNB 1GJZA 4FJZA 2KX3A 4K81A 4PS7A 1TGZB 3P2BA 2DENB 5DPRA 3VDZA 4GB9A 1WGGA 2LRUA 1NBFC 2IZVB 2HTHA 2IY1B 2K8BA 4MM3A 3APCA 1X1MA 4KIKB 4KZ0A 1YX5B 1TTNA 1M94A 2KD0A 4K7WA 4TUUA 1F9JA 4EZJA 3W1SC 1I42A 4B6WA 5KHOA 3VH4B 1TZ1A 3ZW3A 2LXCA 2KZRA 5L83A 4IM2A 2RD0A 5JHBA 2KFJA 2FAZA 4KIKA 3NZUA 4XX5A 3A9JB 4RM8A 4HCNB 4HVBA 3VTVA 3W1YA 1EF1A 2N1VA 4WWPA 3WA0A 2KO3A 4HCPB 3PLUA 1IP9A 1WXVA 2N7EA 4F8CB 3L13A 2KTFA 4TV3A 3EHVA 4W9EA 3QAQA 2JUOA 3UQBA 1D3ZA 4GDKB 2L8JA 1WXMA 3EC8A 4IWQA 1SGHA 3DVNU 4AJYB 2M0XA 2GBJA 1LM8B 3LDZE 2JF5A 4ZRIA 4JLCA 1WJ6A 2A5UA 4ANWA 4HLEA 4PYUA 2PE6B 4N9F4 1PQSA 5D2MB 1FXTB 2CKHB 4HDQA 2O6VD 4TKNA 2EMSA 2KDFB 2UWQA 1E8WA 2XK5A 2DHZA 2KC2A 2L0TA 2LGYA 3DDCB 1WX8A 5D7GA 3QK0A 2MW5A 4M0WB 1P1AA 4AWJA 1OTRB 3ZRFA 2AWTA 2KHWB 3LJ3A 1YX6B 4GMVA 4NJ7A 5BO4B 5CHWA 1RFAA 3OLMD 5D94A 3B0AA 3PV1A 2LUEA 2PE9A 1NDDA 5C23A 5AZFA 4DHJD 2K39A 4FADA 2CR5A 3C0RB 1LFDA 1WE6A 1WXSA 2LXAA 4IG7B 3L16A 2Z0EB 2WYQA 3PLVA 2KTRA 3KW5B 3H7SA 4FULA 3V6CB 3V6EB 2O2VB 3PT2B 3SD5A 2DZIA 5DCNA 3ZNZB 3PRPB 2JRIB 4KDIC 5C1ZA 1KLVA 1WZ0A 1V80A 2O2VA 4IC7B 1V5OA 2ZJDA 2ZNVC 2G45B 1WXAA 4ICVA 3TJPA 1WH3A 4BFRA 4EZLA 2KC1A 4KSKC 4DK5A 4RMAA 3DVGX 1Y8RC 3VHTC 3ZIMA 1UD7A 3ENEA 4MELA 3WANA 2BKFA 2NPTB 2D3GA 4MH0E 4F7ZA 1E8YA 4BKSD 3IFWB 2V1YA 1E7VA 5DPTA 2A4ZA 2MQJA 4NQLB 3X0WA 3NHEB 2NPTA 3PS6A 1WFYA 2GBRA 2J7QB 2YLMA 2R2QA 3KUZA 3L0WB 4ANVA 4II2B 4WJQA 3NOBA 2L7RA 4MGIE 1Q5WB 1S1QB 3GZNI 4W9LA 1KM7A 2FCMA 2JVCA 3QCAA 4JL9A 5GMVA 3M62B 2MA9B 2ZVNA 5FR6A 3RCZA 3S2AA 3VH3B 3N30A 2RPQA 4AUQC 3RZWC 1WJUA 4BOSC 4GDLB 4TQ1A 2BWFA 3AI5A 4W9KA 4EUTA 2HJ8A 2C7MB 2JXXA 1V86A 1WZ3A 1XD3B 4GXBA 4W9HA 1C3TA 4F1SA 2MBEA 5AZGA 1Z5SB 2K8HA 2DZJA 4DBGA 3A4RA 3KH0A 3DPDA 2ASQA 3ZKJC 2B3AA 3W1SA 4ANXA 5JZEB 2KLCA 2MSED 2BPSA 4G3XB 4KDLB 1UH6A 1UGMA 3QHTA 1SE9A 4WJPA 2L00B 2N7DA 4XC2A 4ZDVA 4W9GA 1ISNA 1WY8A 1BT0A 3MJWA 3Q3FA 2K25A 4MGZE 1H4RA 2JWZA 3QA8A 4NJ6A 1WRDB 2YVCA 3QC8B 2KKCA 4B95A 3M63B 1WGHA 1WGRA 1WF9A 4M8NA 2LWPA 4CO7A 2DZMA 2RGFA 5DPWA 4J6IA 4FN2A 4NPNA 2KVRA 3KVFB 2KJRA 3VQIA 1UZXB 1OEYJ 4EZKA 2LI5A 1WR1A 3PTFC 3K9OB 3EFUA 1RAXA 4GGQA 1GUAB 3DVNV 1ZGUB 2R2OA 2XEWA 3T8MA 2L76A 3U30A 5HKHA 3R3MA 4KSLC 4BBNF 3PSEB 1UELA 4IM0A 2IO1B 2J0JA 4WJOA 1P9DU 2GBNA 3PHXB 3RT3B 1J8CA 2C9WB 2VRRB 1U4AA 5LLIA 2MBBB 2WX1A 2KXJA 3V61A 4JQWC 1EF5A 1H8CA 4EKUA 2L3ZA 2CS4A 4DXAB 1HE8A 4FHKA 4I6PA 3RUIB 2IBIB 1WR6E 2G4SA 2C5LC 1YIWA 2IO3B 3TMPB 3JSVB 1J19A 2DYMA 4DHZB 4MDKE 2XK5B 4IUMB 4WWNA 2ZVOA 3VUXA 1WJ4A 2KANA 2ZPNA 5L95C 4TQ0A 2V4LA 4E3CA 2REXA 3JSVA 4DWFA 2GBKA 2CU1A 2IY0B 2LZ6A 1KJTA 3PREA 3KUCB 4PS3A 4MJSB 2JRHA 2ZCCA 3N3KB 1ZW7A 4BBNC 3A1QA 2KWUB 5D6JB 2LGXA 2KWCA 2WWZA 2ZNVB 1AARA 5E6PA 2N4FA 4I6NB 4MEMA 3QX1A 2XBBC 1V6EA 1Z2MA 2C7NB 3TCAA 5KHQA 4MJSA 3ZRCA 2FCQA 3KUDB 4HPMB 4CHKA 1A5RA 4MGYE 1G6JA 2MWSB 2KTRB 4E74A 3DQVA 2AEHA 3VUYA 1RRBA 2FNJB 4CYEA 3OJ3A 2GBMA 3PGEA 3D32A 4HPLB 4P7IA 2DZKA 2AYOB 2I1KA 5J17A 3VTUA 4OVVA 2JZ3B 2N9PC 4GOCA 2NBVB 1Q0WB 1WE7A 2N9XA 2O6VB 4YL8A 3NY5A 3R7RA 3ZVVA 3VXWA 3VUWA 2NVUI 2RR9A 4WAAA 4BVUC 2Z0DB 1LXDA 2O6VA 4W9DA 2C60A 2UYZB 2J0MA 3H7PB 1P0RA 1WGYA 3QWZB 3DBHI 4GU2A 1S3SG 2M1MA 1RLFA 3QJZA 3WAPA 2KFKA 3H7PA 1OGWA 2LD9A 3ZUNA 3IG3A 3APDA 1E7UA 3HHMA 1WMHB 2ZZPB 2GOWA 3QQ8B 3BINA 4ANUA 1K8RB 1ZKHA 4HXDA 1WX7A 1VCBA 1T0YA 4LDTB 2DAFA 1WMHA 3APFA 3HM3A 2ZEQA 4HWIB 4DDGD 1QZEA 2D07B 5CHFA 2MRPA 3CSTA 3L54A 2NBWB 3I3TB 2JT4B 2RSUA 4X57B 4FBJB 2D2QA 2K6QA 2LJ5A 4I6LB 1VD2A 3H9DA 4W9JA 2DYBA 2LASA 1OQYA
chains in the Genus database with same CATH superfamily
3DOWA 2N9EB 1V8CA 1WI0A 4RGTA 4RM9A 4KV2A 1V5TA 4A55A 1EM7A 2BS2B 1AYFA 2KDMA 5JH5C 3EECA 4HDOA 2LVPA 2KJ6A 2WHIA 1K53A 4LNOA 5E6OA 1FMAD 2AQ3B 1T0QC 5G2NA 3VFKA 2W55A 3LXFA 4BAXA 3T9LA 1WM3A 1EWCA 3VRBB 1C4CA 1FEHA 3QARA 2BB5A 3AE4B 3NRZA 3B2GA 3ZYYX 3AEDB 1IYFA 2BVCA 5IOIA 3R7QA 4P1BC 3H8HA 1T5XD 1PGBA 4GLSC 3W5UB 2KQ4X 4GN1A 4JIOU 5EE3A 3ZNHB 4JX1C 1OEYA 4HPPA 4NJCA 2BQQA 4REZA 2DLBA 4WQMA 5IO9A 4A20A 1J0GA 1R4MI 3ZTDA 3MFGA 3WALA 1ZOYB 2KYWA 5TR5A 3TEZA 2WXQA 1V49A 3MTNB 2CHZA 2NS5A 3W9CB 2DAJA 1NYQA 3HVDA 2QCZA 5EE9A 4AOFA 4WWOA 1XLQA 3AE9B 3WAMA 2YEPB 4PYZA 2BB6A 4BOZB 4LDTD 4DHJB 4ZRJA 3AEAB 1DOYA 2HD5B 4K7UA 1JRUA 2GLSA 5H92C 3NS8A 4IDIA 3IHPC 4C00A 2OJRA 2FIDA 2BF8B 3DVGY 3P63A 3V60A 1PYWD 2RMMA 1KF6B 4DQOC 3HM6X 3WAOA 1YN5A 4NQKE 4P6VF 4YSZB 2Y5BB 1UGJA 1K50A 3ZDTA 2FIFA 3U7DA 1AN8A 4RCOA 4IW0A 4PS8A 3U8ZA 3HK0A 4A3PA 1LGRA 4GSWA 4WH4A 2WXHA 4RGOS 4RGNA 3IXSA 2I2YA 1SXTA 1B1ZA 3VDZA 1WGGA 5FR3A 4WURA 2HTHA 2IY1B 2X38A 2KD0A 4K7WA 1F9JA 5JXVA 1TZ1A 5L83A 2KZRA 3P4SB 2FAZA 3NZUA 1CZPA 1TS4A 2DNFA 3WA0A 4HCPB 5TSSA 4OHJA 3KLSX 1IP9A 3AM9A 1WXVA 3KWLA 1F0ZA 4QAYA 3SFDB 5AUKA 1KLGD 1D3ZA 1SGHA 4JLCA 4ANWA 3PZ7A 2PE6B 3I63C 2IDYA 5BMGA 1HZ6A 2DHZA 1WX8A 2V4IB 3CIRB 3FAHA 1J7BA 1P1AA 4AWJA 1I4RA 3LJ3A 1YX6B 5BO4B 1DOXA 4PK1A 3B0AA 2CR5A 2WXNA 4M00A 3PLVA 2WXKA 2M19A 1C4PA 3W5VB 2DZIA 5DCNA 2JRIB 4KDIC 3OG5A 5C1ZA 3EGRA 1KLVA 4LTUA 3TEWA 2G45B 4ICVA 3TJPA 1HTQA 2KC1A 4KSKC 4DK5A 4RMAA 2K0PA 3WANA 1C76A 1FD6A 1OFFA 2D3GA 1E8YA 5DPTA 2W54A 2MQJA 3NHEB 2CU3A 2J7QB 3L0WB 4OVZA 4WJQA 2WDQB 2L7RA 1Q5WB 3GZNI 2WDRB 5GMVA 2MA9B 3NVZA 3S2AA 3VH3B 3N30A 3RZWC 4W9KA 4EUTA 1C3TA 1WZ3A 1XD3B 1N5XA 3GE8C 2MBEA 1I4XA 3AE7B 2L1AA 4ANXA 5JZEB 1B9RA 2BPSA 1UH6A 3QHTA 1SE9A 2KWDA 4HKQA 4W9GA 1BT0A 5GXGB 4MM3B 2K25A 3V3XA 1SEBD 1WGHA 4LNNA 4K3CA 4CO7A 2DZMA 2RGFA 5DPWA 4NPNA 2KVRA 4A6QA 3KVFB 3BWUD 2KJRA 1HA5A 1TY0A 1QOFA 4EZKA 3V05A 1EU4A 1SBBB 1GUAB 1MHHE 1XLNA 1FCLA 1AW7A 3IAS1 3PHXB 3RT3B 2VRRB 1E10A 1UNSA 1EF5A 1L6VA 1E0ZA 4FHKA 2IBIB 2C5LC 1YIWA 1QT9A 2XK5B 4OZAA 2J52A 1K52A 5BMIA 3P4PB 1OQRA 1KJTA 2MJ3A 2JRHA 1ZP0B 2QC8A 3N3KB 4BBNC 2PIAA 3GZNB 2KWUB 3A1QA 2HDEA 2LMCA 1AARA 3N9YC 3PO0A 4MEMA 2W3RA 1ZE3D 2SAKA 2C7NB 2JZPA 2PVOD 3ZRCA 4HPMB 1A5RA 1C4AA 5HHDG 1QILA 2MWSB 4E74A 4A90A 2AEHA 1MVKA 2WQYB 2FNJB 2GBMA 2CJOA 2V0GA 4HPLB 2DZKA 3R8BA 2N9XA 4TMAB 1HZ5A 2RR9A 4IOIE 4WAAA 3URYA 2Z0DB 3MC9A 4YTMB 1LXDA 2INPE 1C78A 2J0MA 4A9AA 1P0RA 2M1MA 1D5MC 2B76B 1VDVA 2FUG1 4JWUC 1TZOA 2KFKA 1OGWA 4OZBA 2ZZPB 5G5GA 4C80A 3RN9C 2LGSA 3BINA 1K8RB 1ZKHA 4KGRA 1WX7A 2QIEB 3APFA 3R2IA 2ZEQA 2QJLA 4HWIB 2MRPA 2NBWB 1DYQA 4HEA1 3I3TB 1GB4A 4X57B 4XWWA 2K6QA 1VD2A 3H9DA 4B0MA 4AS1A 3OWEB 2LASA 3J9CA 3AE8B 3AECB 1HXYD 1WX9A 3A9KB 2AL6A 2FUHB 3CF6E 4RNAA 2AQ1B 3A33B 3A9KA 3T3NA 1GC7A 1E7PB 3UIOB 3SFEB 1TIFA 1N61A 1LQBA 3Q8EA 3KYDD 2EKEC 1CJEA 4E71A 2KMCA 3AXCA 3DBLI 3PHWB 1T0RC 3RNCC 2KMAA 4ICUA 2DWQA 4K7SA 4LCDE 5CHVC 2PEAA 1F52A 3HIZA 4KKIA 4WQOB 3TBLD 4L1BA 2H88B 3PZDA 3Q69A 4G11A 3X23A 3Q3OC 1NVID 4FA6A 2LHEA 3AB5A 1NYRA 2NR2A 5AUIA 1T0SC 1E8XA 2L05A 2GMIC 2Z8LA 2AX5A 2LVQA 4II3B 1WM2A 4OW0A 4IM3A 4FJYA 4NY0A 3UGBB 4A3OA 4HK2A 1GC6A 1L7YA 3AE5B 4ACFA 4OVUA 3VTWA 2MP2B 4WAFA 5E6NA 2WXGA 2JZZA 2MP2A 2IO0B 4M02A 1L4ZB 3M3JA 2IGDA 3IVFA 2LGDA 1C1YB 5EE0A 1KFYB 2INNE 2BKRB 4N58A 2I1JA 4WWMA 5IN7A 2Y3AA 3EFCA 3IT6B 2DX5B 1GPXA 1PGXA 2IYDB 5J18A 4LJOB 5BYSA 2BYVE 5IA7A 3GP7A 2M17A 4XYCA 3DBLB 1XCQL 3Q2AC 2K8CA 3NZ3A 1TS5A 3ONSA 3Q14C 3VVWB 2KQSA 1YD8U 2BGFA 2JPHA 3NVYA 4FJVB 3Q3NC 3RMKC 3RD2A 4KGTA 1TKEA 2AQ2B 2G3QB 4GDLA 2KNBA 3H1UA 1P98A 4ZHPA 1STEA 4ZRKA 1KTKA 3K9PB 4ASWC 2KN5A 1SIFA 2KX3A 1ESFA 1YNTE 4KZ0A 1TTNA 3VH4B 3AE3B 3KQ4A 2LXCA 1Y56A 2RD0A 2KFJA 4XX5A 4RM8A 2WU2B 2K22A 4HCNB 3W1YA 2KO3A 3PLUA 4RF0A 2N7EA 3RFZB 3L13A 5IP4D 2JUOA 1WXMA 3EC8A 4A8XC 3DVNU 4AJYB 1MJDA 2MJDA 3LDZE 4H2AA 4ZRIA 1V97A 2WXIA 1PQSA 1KLUD 3P4QB 1TY2A 2J53A 1FNVA 2KC2A 1VZ7A 3DDCB 1JWBD 1RFKA 3P4RB 5BYQA 2MW5A 3VR9B 2XN9C 3U4EG 1E9MA 1JALA 3PV1A 2LUEA 2HTME 2PE9A 2IJ0A 2K39A 2D3BA 3MJ5A 3L16A 1ACCA 3GB1A 2Z0EB 2WYQA 3V6CB 1XO3A 2O2VB 3PT2B 2D5GA 1XEEA 2KAJA 2O2VA 3RNEC 2PW9A 2ZNVC 1WXAA 3DVGX 1TYGB 1UD7A 3ENEA 4MELA 1L0YB 5FKAC 2LGIA 2NPTB 4MH0E 4PT5A 4F7ZA 4YWGG 3IFWB 2V1YA 1WWTA 3PS6A 2NPTA 2VZKD 2YLMA 2R2QA 3KUZA 2NMQA 4II2B 2QSDA 2QEJC 3L4PA 4R3DA 4MGIE 3IAM1 2JVCA 2FCMA 2WXLA 2QILA 2ZVNA 1TS3A 3MP9A 4MT5A 1WJUA 2JXXA 4W9HA 1DGJA 4XE0A 2WNMA 3KH0A 1YN4A 3DPDA 2QDFA 2B3AA 3W1SA 1NI3A 1UF0A 1UGMA 1KRHA 2M0AA 4ZDVA 2PLPA 1ISNA 1JWAD 2IPKD 2V3PA 3MHZA 2LHDA 4NJ6A 3SEBA 1FXIA 2YVCA 4B95A 1JWMD 2ON8A 2OJWA 1WGRA 4M8NA 3DWGC 3VRAB 4J6IA 3VQIA 3PTFC 1BXTA 3HVZA 4YT0B 2XEWA 2KVZA 1FNWA 4KSLC 1UELA 2IO1B 1XLPA 2J0JA 1QOAA 1J8CA 2JU6X 5G5HA 5LLIA 3V61A 1HEZE 4JQWC 3AH7A 4DXAB 4YSXB 1SE2A 1WR6E 2IO3B 2WXPA 4DHZB 3DBHB 1J19A 2DYMA 1YOVB 3N20C 3VUXA 1ET6A 2ZPNA 4TQ0A 2ACZB 4MJSB 5H8YE 2EELA 5D6JB 2KWCA 2RDBC 4P1CC 4K3BA 1F1HA 4MJSA 1I4HA 4CHKA 4MGYE 3BYYB 1YQ4B 5J17A 2I1KA 4S17A 2JWUA 4OVVA 2N9PC 4GOCA 1RWSA 1Q0WB 5LNK1 3VXWA 2MEKA 4JPSA 1N5WA 2TSSA 4W9DA 2UYZB 3U7ZA 1WGYA 3QWZB 1S3SG 4B0EA 1JRPA 4L23A 1SE4A 3ZUNA 1E7UA 3QQ8B 3FC4A 4LDTB 3GS2A 2N7JA 5CHFA 3L54A 4FBJB 4W9JA 3TEXA 1I4GA 3ZJVA 2MLBA 2J0KA 3DBRB 3BK1A 1SSNA 1XQQA 1IPGA 1VZ8A 5DPSA 4RGMA 3DBSA 1L5PA 4FHJA 3ZTCA 2QHOA 2VH1A 3DCGA 1WGDA 4XDDA 4W9IA 2Z59B 4ZRQA 3RZFA 4BKTA 3PVLA 4KZCA 4HJKA 1WJNA 2G4DB 3Q8CA 1MPEA 1MFWA 4EEWA 3NG0A 4JE3B 1RM6C 1N62A 2WS3B 3UINB 4EOYA 3SU8X 2PTLA 3PRMB 1I35A 1UUPA 1V1OA 1JWUD 3E9SA 3ZO5B 2KLGA 1V9JA 2JY6A 1PUTA 2UU7A 3AULA 3A9JA 1XT9B 3UF8A 3A1QB 3TEYA 2J42A 3C19A 1FFUA 1RYJA 3UIPB 2W9NA 4K1RB 4IWPA 1V81A 4YSYB 3TIXA 2RDGA 1MG8A 3OJ4B 4DHZE 1ZDVA 2L83A 1ZDXA 4GDKA 1IGDA 4C4VA 2FCSA 2SEBD 3N32A 4DXGA 2CHWA 2WDVB 3OAWA 4DXFA 1R4NB 2Y5CA 3GE3C 2IO2B 3VR8B 4LJPB 2PVGC 1T6BX 2K1FA 3AEGB 2CJNA 1P7EA 3AEBB 3ZNGC 1L2NA 3KYCD 1YJIA 1FPYA 3BY4B 2N1WA 1WIAA 2MX2A 4IWOA 5LXHA 3L08A 2KFKB 1WSPA 5CX3A 4B9KA 4GIVA 4DDID 1K51A 4NZLB 5C2TB 4W9CA 1V2YA 3PPAA 3ZJUA 2OEDA 1HQRD 3GOEA 2FBWB 5EDSA 3RNFC 5G55A 3RNAC 2WGSA 5IAAC 2NBUA 5J2RA 1JROA 3SDLC 2KDIA 3DHHC 3V62A 3M95A 2KDBA 2HE7A 3AU5A 3O65B 1IBXA 4KKJA 3B1LX 1CK1A 2PJHA 4LNIA 3CSFA 3L17A 4ZYNA 4G50A 1FNUA 1FIQA 1VZ6A 2K6DB 1SJHD 1ZUD2 2WXFA 1PGAA 3UQAA 2C7HA 4ITKA 1WYWB 3A4SC 3ZJTA 3Q8AA 4MSMB 4NAWB 3ECIA 2MBOA 3ML8A 2BYEA 4G0NB 4NAWA 2MCNB 1GJZA 4K81A 4GB9A 1ROEA 1FCCC 2IZVB 3APCA 2MJEA 3Q8BA 4KIKB 3U52E 1QLBB 1YX5B 3NUHB 4B6WA 5KHOA 3ZW3A 2BW2A 3DWMA 4LNFA 4KIKA 3NVVA 3ZQ4A 3VTVA 2N1VA 4WWPA 1AWDA 1J7AA 1CQVA 4KGSA 4USAA 1XCTL 3EHVA 5HG2A 3N1ZC 4W9EA 1PFDA 1N6ZA 2M0XA 2GBJA 1LM8B 4TSSA 2ICIA 2INDC 3DHGC 2LUMA 4N6EB 2X8XX 4US8A 4LNKA 3RPFC 1FXTB 2CKHB 2O6VD 4TKNA 2EMSA 3AE2B 2UWQA 1E8WA 2LGYA 4ARCA 5D7GA 3QK0A 5I4DA 4M0WB 2BTEA 2GRIA 1HTOA 2XNAC 1OTRB 2AWTA 2KHWB 4GMVA 4NJ7A 4M0WA 5CHWA 1RFAA 5D94A 4ZYSA 4DHJD 1NDDA 5AZFA 1D4BA 4FADA 4HROA 3E56A 2LXAA 1WE6A 2KTRA 1TT5B 3KW5B 3V6EB 1TJEA 3EUB2 3PRPB 3N1YC 3Q8FA 1XXGA 1WZ0A 1V80A 4IC7B 2N9KA 3AEEB 4BFRA 1C77A 3VHTC 3ZIMA 2OHFA 4P16A 2BKFA 3ZXRA 4BKSD 4MH8A 1E7VA 2A4ZA 4NQLB 1WFYA 3NOBA 3AN1A 1H8CA 5FR6A 3RCZA 1F2RI 1KH0A 2RPQA 4GDLB 2BWFA 2C7MB 1V86A 4F1SA 1V1PB 2K8HA 1JW9D 4DBGA 2E6XA 3A4RA 1MHXA 2J4XA 2ASQA 2QMTA 3ZKJC 1V1PA 2KLCA 2G1EA 1BMLC 4WJPA 1FFVA 4XC2A 1WY8A 3MJWA 1TKGA 4IKGA 2VH2A 2KT7A 1H4RA 2JWZA 3QC8B 1QQRA 2RPVA 3M63B 2LWPA 4RH6A 1YJJA 1WGKA 1L0VB 1UWXA 3I9V1 1SJED 2LI5A 3AE1B 3K9OB 3EFUA 1RAXA 1E6EB 1SF0A 2L76A 4BBNF 3PSEB 1P9DU 2GBNA 4MACA 1T3QA 1I4PA 2L3ZA 1DOIA 4US9A 3RUIB 2G4SA 3TMPB 2ZVOA 4Q2JA 2KANA 2H89B 1SB3C 2BBCA 2GBKA 2IY0B 2LZ6A 3PREA 3KUCB 3NS1A 2ZCCA 2LGXA 2WWZA 3ETRA 5E6PA 2N4FA 3TCAA 2XBBC 4AQ7A 3KUDB 1VR9A 2M56B 1G6JA 5D3DA 3VUYA 1RRBA 2JX5A 4XWTA 3OJ3A 4CYEA 3PGEA 3D32A 4P7IA 3BYTB 2IGGA 3RNBC 1WXQA 2JZ3B 3LYYA 2NBVB 2GB1A 2O6VB 3NY5A 3R7RA 4JWSC 3VUWA 2O6VA 2C60A 1NENB 1P7FA 4GU2A 3DBHI 1D5XC 2WXMA 3QJZA 3WAPA 3AMZA 2LD9A 3O13A 1JCKB 3IG3A 3APDA 1WMHB 2GOWA 4S0RA 2JXTA 4ANUA 1SE3A 1T0YA 1YN3A 2DAFA 1WMHA 1ENFA 3B2FA 3HM3A 3CWIA 4DDGD 5HFYA 2WU5B 3CSTA 2JT4B 2RSUA 1VJKA 2K3UA 1I4QA 2WX0A 5AZHA 3RI7C 4ARIA 1A70A 2BS4B 3BVZA 2ZCBA 3ZLZA 3R2TA 2D11A 2M4NA 1EO6A 2HJ1A 3TSSA 1FM0D 4BKSA 1GNUA 2W3SA 2G9HD 4XZ4A 4EE2A 4RF1A 4BKGA 3AU4A 3JVZX 4ZRPA 2EMTA 1E8ZA 4NNJB 2BWES 5FK9C 4YXDB 1UBIA 1WRIA 2PKOA 3ALBA 4CQNA 3NZSA 3SHQA 3Q3MC 1R4MB 3MHSD 1FRRA 2NTTA 1C9FA 3B9JA 2AL3A 3WIMA 5AEKB 2L0FA 2M8SA 3RULA 4M8MA 3MC0B 3TL5A 1WYGA 1R7SA 3BVMA 2WDTB 4WJNA 3PRZA 1XLOA 2BYTA 3VAWA 3JW0X 4NAMA 5CTRC 1FRDA 2JSVX 4ZOHC 5JHAA 4MSQB 4N59A 3WCQA 2KJHB 1P3QU 3DBRI 2NTSA 3BVGA 3RYTA 2LJIA 1GG3A 2BYFA 2MBHA 3CMMB 2N0SB 2E3TA 2LRWA 3BZDB 4MGKE 4LK0M 3AEFB 4C56C 2OOBB 5E6JA 2INCC 2FCNA 3KWVA 3RNGC 4JGHB 1UBQA 3P42A 1Q1OA 1YJ1A 2PPHA 3R66C 1TBEA 3IBEA 5BYRA 5MPOA 2D3CA 2D10A 2PMVA 1QF6A 5BMHA 4FLHA 4XDCA 2DYOA 4W9FA 2V3SA 2GI9A 4J3OD 4RFBA 2ONQA 2MBQA 2V3NA 1EUVB 3L10B 1E90A 4EFOA 5T8IA 3Q6BA 3EA6A 4D2KA 2KX0A 3BK2A 1TS2A 2L52A 1C79A 1F2RC 1ZXHA 3I57A 1J7CA 4AP4C 2N9LA 3ZDMC 4URKA 2KDEB 1E5WA 2MHJA 2WXJA 1CMXB 4KVGB 2K5PA 3JYUA 3Q3JA 3ML9A 1NI2A 1R4NI 2KQ7A 4HKZE 2ZPYA 4AJWA 3H6NA 2CHXA 2VZKB 2WP9B 1L0XB 4C7ZA 4HRSA 1KOTA 1YQBA 2KK8A 2RDHA 2NCNA 2MH7A 4O1NA 2KWVB 4M01A 2KOXA 2LVOA 1FO4A 3B08A 5LXIB 3QIJA 1LO5D 5EE1A 3MC8A 3ZNID 4LLGM 1EU3A 4FJZA 2JQRB 3P1MA 4PS7A 1TGZB 2LEKA 2DENB 3P2BA 4YTPB 5DPRA 2LRUA 4UDUC 1NBFC 4ZHOA 4MM3A 2K8BA 1X1MA 4TUUA 1M94A 4EZJA 3W1SC 1I42A 4IM2A 1SIJA 5JHBA 5C3JB 3A9JB 1MI0A 1I7HA 4HVBA 1EF1A 1BUIC 1QOGA 3C8YA 2DBYA 4FXCA 4F8CB 2V9HA 2KTFA 4TV3A 2L32A 3QAQA 3UQBA 4GDKB 2L8JA 4IWQA 1M4VA 4C7YA 4C4VB 1NEKB 1EWYC 2JF5A 3AE6B 4HLEA 1WJ6A 2A5UA 4PYUA 2FE8A 1MG4A 1ZPSA 4N9F4 5D2MB 4HDQA 5IKCM 3N1XC 2KDFB 2XK5A 2BT6A 2L0TA 2KMMA 2KACA 3ZRFA 1N60A 2JYTA 4YTNB 3ABVB 4XGAB 3OLMD 5C23A 1UWMA 3C0RB 3NJTA 1YMHE 1LFDA 1WXSA 2D3AA 1L6UA 3LB8C 4IG7B 3H7SA 4FULA 3UI3A 3SD5A 2BS3B 3ZNZB 3DHIC 1V5OA 2ZJDA 1WH3A 4EZLA 1Y8RC 1PDXA 4BZAA 2KN4A 2K9XA 1D5ZC 1JQ4A 3X0WA 2GBRA 4ANVA 2W82A 1IBXB 1YQ3B 1S1QB 4W9LA 1KM7A 4JL9A 2IGHA 3QCAA 3M62B 1ZXIA 4AUQC 4BOSC 3FILB 4TQ1A 3AI5A 2HJ8A 4WIPA 4GXBA 1D6EC 3PZ8A 5AZGA 1Z5SB 2DZJA 3I5JC 3FILA 2I38A 2WXRA 1Q10A 4KX6B 2MSED 4G3XB 4KDLB 2L00B 2N7DA 3Q3FA 3TUOA 5HI1A 2WXOA 2Y5PA 4MGZE 3QA8A 1WRDB 2KKCA 3BIID 1WF9A 4HJGE 2Q5WD 4FN2A 1UZXB 1OEYJ 3U2SC 2WLBA 1N63A 1WR1A 4GGQA 3DVNV 1ZGUB 2R2OA 3T8MA 3U30A 2ZW1A 5HKHA 3R3MA 4WJOA 4IM0A 2C9WB 1U4AA 2MBBB 2WX1A 2KXJA 3HRDD 3NVWA 3AV8A 1GAQB 3ZXVA 4EKUA 1JMLA 4OZCA 2CS4A 1HE8A 4I6PA 1TKYA 1ET9A 3JSVB 4MDKE 4IUMB 4WWNA 4L2YA 1WJ4A 5L95C 3HUIA 2V4LA 4E3CA 1FXAA 2REXA 3JSVA 4DWFA 2CU1A 4PS3A 1ZW7A 1IUEA 2JYEA 2ZNVB 4I6NB 3QX1A 1V6EA 1Z2MA 1OQQA 2LFIA 5KHQA 2FCQA 1L4DB 2KTRB 3DQVA 1JWSD 1QOBA 2ZW0A 3IT4B 1IGCA 3W2DA 2AYOB 3VTUA 2EKIA 3SR6A 3T3OA 1WE7A 4YL8A 2R61A 3ZVVA 2NVUI 4BVUC 3FKYA 3H7PB 1GB1A 2YEPF 1RLFA 3H7PA 3HHMA 1XF5L 1VLBA 4HXDA 3ZGZA 1VCBA 5D3IB 1GOZA 1QKZA 1F77A 1QZEA 2D07B 1VRAB 2D2QA 2LJ5A 4I6LB 2DYBA 1OQYA
chains in the Genus database with same CATH topology
3DOWA 2N9EB 2WX0A 5AZHA 2MLBA 1WI0A 2J0KA 2ZCBA 4RM9A 4KV2A 3ZLZA 1V5TA 2D11A 1WX9A 2M4NA 3A9KB 1EO6A 2AL6A 1XQQA 4BKSA 1IPGA 1GNUA 2FUHB 3CF6E 4XZ4A 5DPSA 4BKGA 3DBSA 5JH5C 3A33B 3A9KA 3EECA 3AU4A 4FHJA 1GC7A 3JVZX 4HDOA 2LVPA 2KJ6A 3ZTCA 3UIOB 2QHOA 2EMTA 1E8ZA 3DCGA 1WGDA 4NNJB 2BWES 4W9IA 2Z59B 3RZFA 4BKTA 1UBIA 3PVLA 3ALBA 4HJKA 3NZSA 4KZCA 5E6OA 3SHQA 3MHSD 1LQBA 3KYDD 1WJNA 5G2NA 2G4DB 2EKEC 3VFKA 4E71A 2KMCA 3AXCA 4EEWA 2AL3A 3WIMA 5AEKB 3T9LA 2L0FA 2M8SA 3DBLI 3PHWB 4M8MA 3RULA 1WM3A 3TL5A 2KMAA 4ICUA 3UINB 4EOYA 3QARA 4WJNA 2WDTB 3SU8X 3PRZA 4K7SA 1IYFA 4LCDE 5CHVC 3PRMB 1I35A 3R7QA 2PEAA 3JW0X 3VAWA 3ZO5B 5CTRC 2KLGA 1V9JA 3HIZA 2JY6A 5JHAA 4WQOB 4MSQB 3TBLD 2KJHB 3AULA 4GN1A 4JIOU 3A9JA 1P3QU 1XT9B 3DBRI 3PZDA 3UF8A 3A1QB 3ZNHB 4G11A 3RYTA 3X23A 1GG3A 2BYFA 2MBHA 3CMMB 1OEYA 3UIPB 4FA6A 2W9NA 4K1RB 2LRWA 4IWPA 2NR2A 1V81A 3TIXA 4MGKE 1E8XA 2L05A 1MG8A 2GMIC 3OJ4B 2LVQA 4II3B 1WM2A 4DHZE 4A20A 1J0GA 2OOBB 4IM3A 4FJYA 4GDKA 4NY0A 3UGBB 4A3OA 1R4MI 2FCNA 4HK2A 2FCSA 1UBQA 1GC6A 4JGHB 3N32A 3ZTDA 2CHWA 1L7YA 1Q1OA 1YJ1A 3OAWA 2PPHA 3R66C 1TBEA 3IBEA 4OVUA 3VTWA 3WALA 2MP2B 2IO2B 5E6NA 4LJPB 5TR5A 2D10A 2JZZA 2K1FA 2MP2A 2IO0B 4FLHA 1V49A 3ZNGC 3KYCD 3MTNB 1L2NA 2CHZA 2DYOA 3BY4B 2N1WA 1WIAA 2NS5A 2V3SA 4W9FA 3M3JA 3IVFA 2DAJA 2LGDA 2MX2A 4IWOA 1C1YB 5LXHA 3L08A 2KFKB 5CX3A 4AOFA 2MBQA 4WWOA 2BKRB 4GIVA 4B9KA 3WAMA 1EUVB 3L10B 4DDID 4PYZA 1E90A 4EFOA 2I1JA 4BOZB 4LDTD 4DHJB 4ZRJA 2DX5B 4W9CA 2HD5B 1V2YA 2KX0A 3PPAA 4K7UA 1JRUA 3NS8A 2IYDB 3GOEA 3IHPC 4LJOB 5EDSA 5J18A 2BYVE 2OJRA 2FIDA 5IA7A 4AP4C 3ZDMC 2M17A 5G55A 4URKA 2KDEB 2BF8B 1E5WA 3DVGY 3V60A 2K8CA 3ONSA 1CMXB 4KVGB 5IAAC 2NBUA 5J2RA 3JYUA 3SDLC 3Q3JA 3HM6X 2KDIA 3ML9A 3WAOA 3VVWB 2KQSA 1NI2A 1R4NI 2KQ7A 3V62A 3M95A 4NQKE 2ZPYA 1YD8U 4AJWA 2KDBA 2BGFA 2HE7A 3H6NA 2Y5BB 2JPHA 3AU5A 2CHXA 3O65B 3ZDTA 4FJVB 2FIFA 3U7DA 3B1LX 2PJHA 3RD2A 3CSFA 3L17A 4ZYNA 4G50A 4IW0A 1KOTA 4PS8A 1YQBA 2G3QB 2KK8A 4GDLA 3U8ZA 2KNBA 2K6DB 3HK0A 4A3PA 2NCNA 3UQAA 2C7HA 3H1UA 1P98A 1WYWB 2KWVB 3A4SC 4GSWA 4MSMB 2KOXA 4NAWB 2LVOA 4ZRKA 3B08A 3K9PB 5LXIB 3ECIA 3QIJA 2MBOA 3ML8A 4ASWC 2BYEA 4G0NB 3ZNID 4NAWA 2KN5A 1SIFA 2MCNB 1GJZA 4FJZA 2KX3A 4K81A 4PS7A 1TGZB 3P2BA 2DENB 5DPRA 3VDZA 4GB9A 1WGGA 2LRUA 1NBFC 2IZVB 2HTHA 2IY1B 2K8BA 4MM3A 3APCA 1X1MA 4KIKB 4KZ0A 1YX5B 1TTNA 1M94A 2KD0A 4K7WA 4TUUA 1F9JA 4EZJA 3W1SC 1I42A 4B6WA 5KHOA 3VH4B 1TZ1A 3ZW3A 2LXCA 2KZRA 5L83A 4IM2A 2RD0A 5JHBA 2KFJA 2FAZA 4KIKA 3NZUA 4XX5A 3A9JB 4RM8A 4HCNB 4HVBA 3VTVA 3W1YA 1EF1A 2N1VA 4WWPA 3WA0A 2KO3A 4HCPB 3PLUA 1IP9A 1WXVA 2N7EA 4F8CB 3L13A 2KTFA 4TV3A 3EHVA 4W9EA 3QAQA 2JUOA 3UQBA 1D3ZA 4GDKB 2L8JA 1WXMA 3EC8A 4IWQA 1SGHA 3DVNU 4AJYB 2M0XA 2GBJA 1LM8B 3LDZE 2JF5A 4ZRIA 4JLCA 1WJ6A 2A5UA 4ANWA 4HLEA 4PYUA 2PE6B 4N9F4 1PQSA 5D2MB 1FXTB 2CKHB 4HDQA 2O6VD 4TKNA 2EMSA 2KDFB 2UWQA 1E8WA 2XK5A 2DHZA 2KC2A 2L0TA 2LGYA 3DDCB 1WX8A 5D7GA 3QK0A 2MW5A 4M0WB 1P1AA 4AWJA 1OTRB 3ZRFA 2AWTA 2KHWB 3LJ3A 1YX6B 4GMVA 4NJ7A 5BO4B 5CHWA 1RFAA 3OLMD 5D94A 3B0AA 3PV1A 2LUEA 2PE9A 1NDDA 5C23A 5AZFA 4DHJD 2K39A 4FADA 2CR5A 3C0RB 1LFDA 1WE6A 1WXSA 2LXAA 4IG7B 3L16A 2Z0EB 2WYQA 3PLVA 2KTRA 3KW5B 3H7SA 4FULA 3V6CB 3V6EB 2O2VB 3PT2B 3SD5A 2DZIA 5DCNA 3ZNZB 3PRPB 2JRIB 4KDIC 5C1ZA 1KLVA 1WZ0A 1V80A 2O2VA 4IC7B 1V5OA 2ZJDA 2ZNVC 2G45B 1WXAA 4ICVA 3TJPA 1WH3A 4BFRA 4EZLA 2KC1A 4KSKC 4DK5A 4RMAA 3DVGX 1Y8RC 3VHTC 3ZIMA 1UD7A 3ENEA 4MELA 3WANA 2BKFA 2NPTB 2D3GA 4MH0E 4F7ZA 1E8YA 4BKSD 3IFWB 2V1YA 1E7VA 5DPTA 2A4ZA 2MQJA 4NQLB 3X0WA 3NHEB 2NPTA 3PS6A 1WFYA 2GBRA 2J7QB 2YLMA 2R2QA 3KUZA 3L0WB 4ANVA 4II2B 4WJQA 3NOBA 2L7RA 4MGIE 1Q5WB 1S1QB 3GZNI 4W9LA 1KM7A 2FCMA 2JVCA 3QCAA 4JL9A 5GMVA 3M62B 2MA9B 2ZVNA 5FR6A 3RCZA 3S2AA 3VH3B 3N30A 2RPQA 4AUQC 3RZWC 1WJUA 4BOSC 4GDLB 4TQ1A 2BWFA 3AI5A 4W9KA 4EUTA 2HJ8A 2C7MB 2JXXA 1V86A 1WZ3A 1XD3B 4GXBA 4W9HA 1C3TA 4F1SA 2MBEA 5AZGA 1Z5SB 2K8HA 2DZJA 4DBGA 3A4RA 3KH0A 3DPDA 2ASQA 3ZKJC 2B3AA 3W1SA 4ANXA 5JZEB 2KLCA 2MSED 2BPSA 4G3XB 4KDLB 1UH6A 1UGMA 3QHTA 1SE9A 4WJPA 2L00B 2N7DA 4XC2A 4ZDVA 4W9GA 1ISNA 1WY8A 1BT0A 3MJWA 3Q3FA 2K25A 4MGZE 1H4RA 2JWZA 3QA8A 4NJ6A 1WRDB 2YVCA 3QC8B 2KKCA 4B95A 3M63B 1WGHA 1WGRA 1WF9A 4M8NA 2LWPA 4CO7A 2DZMA 2RGFA 5DPWA 4J6IA 4FN2A 4NPNA 2KVRA 3KVFB 2KJRA 3VQIA 1UZXB 1OEYJ 4EZKA 2LI5A 1WR1A 3PTFC 3K9OB 3EFUA 1RAXA 4GGQA 1GUAB 3DVNV 1ZGUB 2R2OA 2XEWA 3T8MA 2L76A 3U30A 5HKHA 3R3MA 4KSLC 4BBNF 3PSEB 1UELA 4IM0A 2IO1B 2J0JA 4WJOA 1P9DU 2GBNA 3PHXB 3RT3B 1J8CA 2C9WB 2VRRB 1U4AA 5LLIA 2MBBB 2WX1A 2KXJA 3V61A 4JQWC 1EF5A 1H8CA 4EKUA 2L3ZA 2CS4A 4DXAB 1HE8A 4FHKA 4I6PA 3RUIB 2IBIB 1WR6E 2G4SA 2C5LC 1YIWA 2IO3B 3TMPB 3JSVB 1J19A 2DYMA 4DHZB 4MDKE 2XK5B 4IUMB 4WWNA 2ZVOA 3VUXA 1WJ4A 2KANA 2ZPNA 5L95C 4TQ0A 2V4LA 4E3CA 2REXA 3JSVA 4DWFA 2GBKA 2CU1A 2IY0B 2LZ6A 1KJTA 3PREA 3KUCB 4PS3A 4MJSB 2JRHA 2ZCCA 3N3KB 1ZW7A 4BBNC 3A1QA 2KWUB 5D6JB 2LGXA 2KWCA 2WWZA 2ZNVB 1AARA 5E6PA 2N4FA 4I6NB 4MEMA 3QX1A 2XBBC 1V6EA 1Z2MA 2C7NB 3TCAA 5KHQA 4MJSA 3ZRCA 2FCQA 3KUDB 4HPMB 4CHKA 1A5RA 4MGYE 1G6JA 2MWSB 2KTRB 4E74A 3DQVA 2AEHA 3VUYA 1RRBA 2FNJB 4CYEA 3OJ3A 2GBMA 3PGEA 3D32A 4HPLB 4P7IA 2DZKA 2AYOB 2I1KA 5J17A 3VTUA 4OVVA 2JZ3B 2N9PC 4GOCA 2NBVB 1Q0WB 1WE7A 2N9XA 2O6VB 4YL8A 3NY5A 3R7RA 3ZVVA 3VXWA 3VUWA 2NVUI 2RR9A 4WAAA 4BVUC 2Z0DB 1LXDA 2O6VA 4W9DA 2C60A 2UYZB 2J0MA 3H7PB 1P0RA 1WGYA 3QWZB 3DBHI 4GU2A 1S3SG 2M1MA 1RLFA 3QJZA 3WAPA 2KFKA 3H7PA 1OGWA 2LD9A 3ZUNA 3IG3A 3APDA 1E7UA 3HHMA 1WMHB 2ZZPB 2GOWA 3QQ8B 3BINA 4ANUA 1K8RB 1ZKHA 4HXDA 1WX7A 1VCBA 1T0YA 4LDTB 2DAFA 1WMHA 3APFA 3HM3A 2ZEQA 4HWIB 4DDGD 1QZEA 2D07B 5CHFA 2MRPA 3CSTA 3L54A 2NBWB 3I3TB 2JT4B 2RSUA 4X57B 4FBJB 2D2QA 2K6QA 2LJ5A 4I6LB 1VD2A 3H9DA 4W9JA 2DYBA 2LASA 1OQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DOW A;  2N9E B;  2WX0 A;  5AZH A;  2MLB A;  1WI0 A;  2J0K A;  2ZCB A;  4RM9 A;  4KV2 A;  3ZLZ A;  1V5T A;  2D11 A;  1WX9 A;  2M4N A;  3A9K B;  1EO6 A;  2AL6 A;  1XQQ A;  4BKS A;  1IPG A;  1GNU A;  2FUH B;  3CF6 E;  4XZ4 A;  5DPS A;  4BKG A;  3DBS A;  5JH5 C;  3A33 B;  3A9K A;  3EEC A;  3AU4 A;  4FHJ A;  1GC7 A;  3JVZ X;  4HDO A;  2LVP A;  2KJ6 A;  3ZTC A;  3UIO B;  2QHO A;  2EMT A;  1E8Z A;  3DCG A;  1WGD A;  4NNJ B;  2BWE S;  4W9I A;  2Z59 B;  3RZF A;  4BKT A;  1UBI A;  3PVL A;  3ALB A;  4HJK A;  3NZS A;  4KZC A;  5E6O A;  3SHQ A;  3MHS D;  1LQB A;  3KYD D;  1WJN A;  5G2N A;  2G4D B;  2EKE C;  3VFK A;  4E71 A;  2KMC A;  3AXC A;  4EEW A;  2AL3 A;  3WIM A;  5AEK B;  3T9L A;  2L0F A;  2M8S A;  3DBL I;  3PHW B;  4M8M A;  3RUL A;  1WM3 A;  3TL5 A;  2KMA A;  4ICU A;  3UIN B;  4EOY A;  3QAR A;  4WJN A;  2WDT B;  3SU8 X;  3PRZ A;  4K7S A;  1IYF A;  4LCD E;  5CHV C;  3PRM B;  1I35 A;  3R7Q A;  2PEA A;  3JW0 X;  3VAW A;  3ZO5 B;  5CTR C;  2KLG A;  1V9J A;  3HIZ A;  2JY6 A;  5JHA A;  4WQO B;  4MSQ B;  3TBL D;  2KJH B;  3AUL A;  4GN1 A;  4JIO U;  3A9J A;  1P3Q U;  1XT9 B;  3DBR I;  3PZD A;  3UF8 A;  3A1Q B;  3ZNH B;  4G11 A;  3RYT A;  3X23 A;  1GG3 A;  2BYF A;  2MBH A;  3CMM B;  1OEY A;  3UIP B;  4FA6 A;  2W9N A;  4K1R B;  2LRW A;  4IWP A;  2NR2 A;  1V81 A;  3TIX A;  4MGK E;  1E8X A;  2L05 A;  1MG8 A;  2GMI C;  3OJ4 B;  2LVQ A;  4II3 B;  1WM2 A;  4DHZ E;  4A20 A;  1J0G A;  2OOB B;  4IM3 A;  4FJY A;  4GDK A;  4NY0 A;  3UGB B;  4A3O A;  1R4M I;  2FCN A;  4HK2 A;  2FCS A;  1UBQ A;  1GC6 A;  4JGH B;  3N32 A;  3ZTD A;  2CHW A;  1L7Y A;  1Q1O A;  1YJ1 A;  3OAW A;  2PPH A;  3R66 C;  1TBE A;  3IBE A;  4OVU A;  3VTW A;  3WAL A;  2MP2 B;  2IO2 B;  5E6N A;  4LJP B;  5TR5 A;  2D10 A;  2JZZ A;  2K1F A;  2MP2 A;  2IO0 B;  4FLH A;  1V49 A;  3ZNG C;  3KYC D;  3MTN B;  1L2N A;  2CHZ A;  2DYO A;  3BY4 B;  2N1W A;  1WIA A;  2NS5 A;  2V3S A;  4W9F A;  3M3J A;  3IVF A;  2DAJ A;  2LGD A;  2MX2 A;  4IWO A;  1C1Y B;  5LXH A;  3L08 A;  2KFK B;  5CX3 A;  4AOF A;  2MBQ A;  4WWO A;  2BKR B;  4GIV A;  4B9K A;  3WAM A;  1EUV B;  3L10 B;  4DDI D;  4PYZ A;  1E90 A;  4EFO A;  2I1J A;  4BOZ B;  4LDT D;  4DHJ B;  4ZRJ A;  2DX5 B;  4W9C A;  2HD5 B;  1V2Y A;  2KX0 A;  3PPA A;  4K7U A;  1JRU A;  3NS8 A;  2IYD B;  3GOE A;  3IHP C;  4LJO B;  5EDS A;  5J18 A;  2BYV E;  2OJR A;  2FID A;  5IA7 A;  4AP4 C;  3ZDM C;  2M17 A;  5G55 A;  4URK A;  2KDE B;  2BF8 B;  1E5W A;  3DVG Y;  3V60 A;  2K8C A;  3ONS A;  1CMX B;  4KVG B;  5IAA C;  2NBU A;  5J2R A;  3JYU A;  3SDL C;  3Q3J A;  3HM6 X;  2KDI A;  3ML9 A;  3WAO A;  3VVW B;  2KQS A;  1NI2 A;  1R4N I;  2KQ7 A;  3V62 A;  3M95 A;  4NQK E;  2ZPY A;  1YD8 U;  4AJW A;  2KDB A;  2BGF A;  2HE7 A;  3H6N A;  2Y5B B;  2JPH A;  3AU5 A;  2CHX A;  3O65 B;  3ZDT A;  4FJV B;  2FIF A;  3U7D A;  3B1L X;  2PJH A;  3RD2 A;  3CSF A;  3L17 A;  4ZYN A;  4G50 A;  4IW0 A;  1KOT A;  4PS8 A;  1YQB A;  2G3Q B;  2KK8 A;  4GDL A;  3U8Z A;  2KNB A;  2K6D B;  3HK0 A;  4A3P A;  2NCN A;  3UQA A;  2C7H A;  3H1U A;  1P98 A;  1WYW B;  2KWV B;  3A4S C;  4GSW A;  4MSM B;  2KOX A;  4NAW B;  2LVO A;  4ZRK A;  3B08 A;  3K9P B;  5LXI B;  3ECI A;  3QIJ A;  2MBO A;  3ML8 A;  4ASW C;  2BYE A;  4G0N B;  3ZNI D;  4NAW A;  2KN5 A;  1SIF A;  2MCN B;  1GJZ A;  4FJZ A;  2KX3 A;  4K81 A;  4PS7 A;  1TGZ B;  3P2B A;  2DEN B;  5DPR A;  3VDZ A;  4GB9 A;  1WGG A;  2LRU A;  1NBF C;  2IZV B;  2HTH A;  2IY1 B;  2K8B A;  4MM3 A;  3APC A;  1X1M A;  4KIK B;  4KZ0 A;  1YX5 B;  1TTN A;  1M94 A;  2KD0 A;  4K7W A;  4TUU A;  1F9J A;  4EZJ A;  3W1S C;  1I42 A;  4B6W A;  5KHO A;  3VH4 B;  1TZ1 A;  3ZW3 A;  2LXC A;  2KZR A;  5L83 A;  4IM2 A;  2RD0 A;  5JHB A;  2KFJ A;  2FAZ A;  4KIK A;  3NZU A;  4XX5 A;  3A9J B;  4RM8 A;  4HCN B;  4HVB A;  3VTV A;  3W1Y A;  1EF1 A;  2N1V A;  4WWP A;  3WA0 A;  2KO3 A;  4HCP B;  3PLU A;  1IP9 A;  1WXV A;  2N7E A;  4F8C B;  3L13 A;  2KTF A;  4TV3 A;  3EHV A;  4W9E A;  3QAQ A;  2JUO A;  3UQB A;  1D3Z A;  4GDK B;  2L8J A;  1WXM A;  3EC8 A;  4IWQ A;  1SGH A;  3DVN U;  4AJY B;  2M0X A;  2GBJ A;  1LM8 B;  3LDZ E;  2JF5 A;  4ZRI A;  4JLC A;  1WJ6 A;  2A5U A;  4ANW A;  4HLE A;  4PYU A;  2PE6 B;  4N9F 4;  1PQS A;  5D2M B;  1FXT B;  2CKH B;  4HDQ A;  2O6V D;  4TKN A;  2EMS A;  2KDF B;  2UWQ A;  1E8W A;  2XK5 A;  2DHZ A;  2KC2 A;  2L0T A;  2LGY A;  3DDC B;  1WX8 A;  5D7G A;  3QK0 A;  2MW5 A;  4M0W B;  1P1A A;  4AWJ A;  1OTR B;  3ZRF A;  2AWT A;  2KHW B;  3LJ3 A;  1YX6 B;  4GMV A;  4NJ7 A;  5BO4 B;  5CHW A;  1RFA A;  3OLM D;  5D94 A;  3B0A A;  3PV1 A;  2LUE A;  2PE9 A;  1NDD A;  5C23 A;  5AZF A;  4DHJ D;  2K39 A;  4FAD A;  2CR5 A;  3C0R B;  1LFD A;  1WE6 A;  1WXS A;  2LXA A;  4IG7 B;  3L16 A;  2Z0E B;  2WYQ A;  3PLV A;  2KTR A;  3KW5 B;  3H7S A;  4FUL A;  3V6C B;  3V6E B;  2O2V B;  3PT2 B;  3SD5 A;  2DZI A;  5DCN A;  3ZNZ B;  3PRP B;  2JRI B;  4KDI C;  5C1Z A;  1KLV A;  1WZ0 A;  1V80 A;  2O2V A;  4IC7 B;  1V5O A;  2ZJD A;  2ZNV C;  2G45 B;  1WXA A;  4ICV A;  3TJP A;  1WH3 A;  4BFR A;  4EZL A;  2KC1 A;  4KSK C;  4DK5 A;  4RMA A;  3DVG X;  1Y8R C;  3VHT C;  3ZIM A;  1UD7 A;  3ENE A;  4MEL A;  3WAN A;  2BKF A;  2NPT B;  2D3G A;  4MH0 E;  4F7Z A;  1E8Y A;  4BKS D;  3IFW B;  2V1Y A;  1E7V A;  5DPT A;  2A4Z A;  2MQJ A;  4NQL B;  3X0W A;  3NHE B;  2NPT A;  3PS6 A;  1WFY A;  2GBR A;  2J7Q B;  2YLM A;  2R2Q A;  3KUZ A;  3L0W B;  4ANV A;  4II2 B;  4WJQ A;  3NOB A;  2L7R A;  4MGI E;  1Q5W B;  1S1Q B;  3GZN I;  4W9L A;  1KM7 A;  2FCM A;  2JVC A;  3QCA A;  4JL9 A;  5GMV A;  3M62 B;  2MA9 B;  2ZVN A;  5FR6 A;  3RCZ A;  3S2A A;  3VH3 B;  3N30 A;  2RPQ A;  4AUQ C;  3RZW C;  1WJU A;  4BOS C;  4GDL B;  4TQ1 A;  2BWF A;  3AI5 A;  4W9K A;  4EUT A;  2HJ8 A;  2C7M B;  2JXX A;  1V86 A;  1WZ3 A;  1XD3 B;  4GXB A;  4W9H A;  1C3T A;  4F1S A;  2MBE A;  5AZG A;  1Z5S B;  2K8H A;  2DZJ A;  4DBG A;  3A4R A;  3KH0 A;  3DPD A;  2ASQ A;  3ZKJ C;  2B3A A;  3W1S A;  4ANX A;  5JZE B;  2KLC A;  2MSE D;  2BPS A;  4G3X B;  4KDL B;  1UH6 A;  1UGM A;  3QHT A;  1SE9 A;  4WJP A;  2L00 B;  2N7D A;  4XC2 A;  4ZDV A;  4W9G A;  1ISN A;  1WY8 A;  1BT0 A;  3MJW A;  3Q3F A;  2K25 A;  4MGZ E;  1H4R A;  2JWZ A;  3QA8 A;  4NJ6 A;  1WRD B;  2YVC A;  3QC8 B;  2KKC A;  4B95 A;  3M63 B;  1WGH A;  1WGR A;  1WF9 A;  4M8N A;  2LWP A;  4CO7 A;  2DZM A;  2RGF A;  5DPW A;  4J6I A;  4FN2 A;  4NPN A;  2KVR A;  3KVF B;  2KJR A;  3VQI A;  1UZX B;  1OEY J;  4EZK A;  2LI5 A;  1WR1 A;  3PTF C;  3K9O B;  3EFU A;  1RAX A;  4GGQ A;  1GUA B;  3DVN V;  1ZGU B;  2R2O A;  2XEW A;  3T8M A;  2L76 A;  3U30 A;  5HKH A;  3R3M A;  4KSL C;  4BBN F;  3PSE B;  1UEL A;  4IM0 A;  2IO1 B;  2J0J A;  4WJO A;  1P9D U;  2GBN A;  3PHX B;  3RT3 B;  1J8C A;  2C9W B;  2VRR B;  1U4A A;  5LLI A;  2MBB B;  2WX1 A;  2KXJ A;  3V61 A;  4JQW C;  1EF5 A;  1H8C A;  4EKU A;  2L3Z A;  2CS4 A;  4DXA B;  1HE8 A;  4FHK A;  4I6P A;  3RUI B;  2IBI B;  1WR6 E;  2G4S A;  2C5L C;  1YIW A;  2IO3 B;  3TMP B;  3JSV B;  1J19 A;  2DYM A;  4DHZ B;  4MDK E;  2XK5 B;  4IUM B;  4WWN A;  2ZVO A;  3VUX A;  1WJ4 A;  2KAN A;  2ZPN A;  5L95 C;  4TQ0 A;  2V4L A;  4E3C A;  2REX A;  3JSV A;  4DWF A;  2GBK A;  2CU1 A;  2IY0 B;  2LZ6 A;  1KJT A;  3PRE A;  3KUC B;  4PS3 A;  4MJS B;  2JRH A;  2ZCC A;  3N3K B;  1ZW7 A;  4BBN C;  3A1Q A;  2KWU B;  5D6J B;  2LGX A;  2KWC A;  2WWZ A;  2ZNV B;  1AAR A;  5E6P A;  2N4F A;  4I6N B;  4MEM A;  3QX1 A;  2XBB C;  1V6E A;  1Z2M A;  2C7N B;  3TCA A;  5KHQ A;  4MJS A;  3ZRC A;  2FCQ A;  3KUD B;  4HPM B;  4CHK A;  1A5R A;  4MGY E;  1G6J A;  2MWS B;  2KTR B;  4E74 A;  3DQV A;  2AEH A;  3VUY A;  1RRB A;  2FNJ B;  4CYE A;  3OJ3 A;  2GBM A;  3PGE A;  3D32 A;  4HPL B;  4P7I A;  2DZK A;  2AYO B;  2I1K A;  5J17 A;  3VTU A;  4OVV A;  2JZ3 B;  2N9P C;  4GOC A;  2NBV B;  1Q0W B;  1WE7 A;  2N9X A;  2O6V B;  4YL8 A;  3NY5 A;  3R7R A;  3ZVV A;  3VXW A;  3VUW A;  2NVU I;  2RR9 A;  4WAA A;  4BVU C;  2Z0D B;  1LXD A;  2O6V A;  4W9D A;  2C60 A;  2UYZ B;  2J0M A;  3H7P B;  1P0R A;  1WGY A;  3QWZ B;  3DBH I;  4GU2 A;  1S3S G;  2M1M A;  1RLF A;  3QJZ A;  3WAP A;  2KFK A;  3H7P A;  1OGW A;  2LD9 A;  3ZUN A;  3IG3 A;  3APD A;  1E7U A;  3HHM A;  1WMH B;  2ZZP B;  2GOW A;  3QQ8 B;  3BIN A;  4ANU A;  1K8R B;  1ZKH A;  4HXD A;  1WX7 A;  1VCB A;  1T0Y A;  4LDT B;  2DAF A;  1WMH A;  3APF A;  3HM3 A;  2ZEQ A;  4HWI B;  4DDG D;  1QZE A;  2D07 B;  5CHF A;  2MRP A;  3CST A;  3L54 A;  2NBW B;  3I3T B;  2JT4 B;  2RSU A;  4X57 B;  4FBJ B;  2D2Q A;  2K6Q A;  2LJ5 A;  4I6L B;  1VD2 A;  3H9D A;  4W9J A;  2DYB A;  2LAS A;  1OQY A; 
#chains in the Genus database with same CATH topology
 3DOW A;  2N9E B;  1V8C A;  1WI0 A;  4RGT A;  4RM9 A;  4KV2 A;  1V5T A;  4A55 A;  1EM7 A;  2BS2 B;  1AYF A;  2KDM A;  5JH5 C;  3EEC A;  4HDO A;  2LVP A;  2KJ6 A;  2WHI A;  1K53 A;  4LNO A;  5E6O A;  1FMA D;  2AQ3 B;  1T0Q C;  5G2N A;  3VFK A;  2W55 A;  3LXF A;  4BAX A;  3T9L A;  1WM3 A;  1EWC A;  3VRB B;  1C4C A;  1FEH A;  3QAR A;  2BB5 A;  3AE4 B;  3NRZ A;  3B2G A;  3ZYY X;  3AED B;  1IYF A;  2BVC A;  5IOI A;  3R7Q A;  4P1B C;  3H8H A;  1T5X D;  1PGB A;  4GLS C;  3W5U B;  2KQ4 X;  4GN1 A;  4JIO U;  5EE3 A;  3ZNH B;  4JX1 C;  1OEY A;  4HPP A;  4NJC A;  2BQQ A;  4REZ A;  2DLB A;  4WQM A;  5IO9 A;  4A20 A;  1J0G A;  1R4M I;  3ZTD A;  3MFG A;  3WAL A;  1ZOY B;  2KYW A;  5TR5 A;  3TEZ A;  2WXQ A;  1V49 A;  3MTN B;  2CHZ A;  2NS5 A;  3W9C B;  2DAJ A;  1NYQ A;  3HVD A;  2QCZ A;  5EE9 A;  4AOF A;  4WWO A;  1XLQ A;  3AE9 B;  3WAM A;  2YEP B;  4PYZ A;  2BB6 A;  4BOZ B;  4LDT D;  4DHJ B;  4ZRJ A;  3AEA B;  1DOY A;  2HD5 B;  4K7U A;  1JRU A;  2GLS A;  5H92 C;  3NS8 A;  4IDI A;  3IHP C;  4C00 A;  2OJR A;  2FID A;  2BF8 B;  3DVG Y;  3P63 A;  3V60 A;  1PYW D;  2RMM A;  1KF6 B;  4DQO C;  3HM6 X;  3WAO A;  1YN5 A;  4NQK E;  4P6V F;  4YSZ B;  2Y5B B;  1UGJ A;  1K50 A;  3ZDT A;  2FIF A;  3U7D A;  1AN8 A;  4RCO A;  4IW0 A;  4PS8 A;  3U8Z A;  3HK0 A;  4A3P A;  1LGR A;  4GSW A;  4WH4 A;  2WXH A;  4RGO S;  4RGN A;  3IXS A;  2I2Y A;  1SXT A;  1B1Z A;  3VDZ A;  1WGG A;  5FR3 A;  4WUR A;  2HTH A;  2IY1 B;  2X38 A;  2KD0 A;  4K7W A;  1F9J A;  5JXV A;  1TZ1 A;  5L83 A;  2KZR A;  3P4S B;  2FAZ A;  3NZU A;  1CZP A;  1TS4 A;  2DNF A;  3WA0 A;  4HCP B;  5TSS A;  4OHJ A;  3KLS X;  1IP9 A;  3AM9 A;  1WXV A;  3KWL A;  1F0Z A;  4QAY A;  3SFD B;  5AUK A;  1KLG D;  1D3Z A;  1SGH A;  4JLC A;  4ANW A;  3PZ7 A;  2PE6 B;  3I63 C;  2IDY A;  5BMG A;  1HZ6 A;  2DHZ A;  1WX8 A;  2V4I B;  3CIR B;  3FAH A;  1J7B A;  1P1A A;  4AWJ A;  1I4R A;  3LJ3 A;  1YX6 B;  5BO4 B;  1DOX A;  4PK1 A;  3B0A A;  2CR5 A;  2WXN A;  4M00 A;  3PLV A;  2WXK A;  2M19 A;  1C4P A;  3W5V B;  2DZI A;  5DCN A;  2JRI B;  4KDI C;  3OG5 A;  5C1Z A;  3EGR A;  1KLV A;  4LTU A;  3TEW A;  2G45 B;  4ICV A;  3TJP A;  1HTQ A;  2KC1 A;  4KSK C;  4DK5 A;  4RMA A;  2K0P A;  3WAN A;  1C76 A;  1FD6 A;  1OFF A;  2D3G A;  1E8Y A;  5DPT A;  2W54 A;  2MQJ A;  3NHE B;  2CU3 A;  2J7Q B;  3L0W B;  4OVZ A;  4WJQ A;  2WDQ B;  2L7R A;  1Q5W B;  3GZN I;  2WDR B;  5GMV A;  2MA9 B;  3NVZ A;  3S2A A;  3VH3 B;  3N30 A;  3RZW C;  4W9K A;  4EUT A;  1C3T A;  1WZ3 A;  1XD3 B;  1N5X A;  3GE8 C;  2MBE A;  1I4X A;  3AE7 B;  2L1A A;  4ANX A;  5JZE B;  1B9R A;  2BPS A;  1UH6 A;  3QHT A;  1SE9 A;  2KWD A;  4HKQ A;  4W9G A;  1BT0 A;  5GXG B;  4MM3 B;  2K25 A;  3V3X A;  1SEB D;  1WGH A;  4LNN A;  4K3C A;  4CO7 A;  2DZM A;  2RGF A;  5DPW A;  4NPN A;  2KVR A;  4A6Q A;  3KVF B;  3BWU D;  2KJR A;  1HA5 A;  1TY0 A;  1QOF A;  4EZK A;  3V05 A;  1EU4 A;  1SBB B;  1GUA B;  1MHH E;  1XLN A;  1FCL A;  1AW7 A;  3IAS 1;  3PHX B;  3RT3 B;  2VRR B;  1E10 A;  1UNS A;  1EF5 A;  1L6V A;  1E0Z A;  4FHK A;  2IBI B;  2C5L C;  1YIW A;  1QT9 A;  2XK5 B;  4OZA A;  2J52 A;  1K52 A;  5BMI A;  3P4P B;  1OQR A;  1KJT A;  2MJ3 A;  2JRH A;  1ZP0 B;  2QC8 A;  3N3K B;  4BBN C;  2PIA A;  3GZN B;  2KWU B;  3A1Q A;  2HDE A;  2LMC A;  1AAR A;  3N9Y C;  3PO0 A;  4MEM A;  2W3R A;  1ZE3 D;  2SAK A;  2C7N B;  2JZP A;  2PVO D;  3ZRC A;  4HPM B;  1A5R A;  1C4A A;  5HHD G;  1QIL A;  2MWS B;  4E74 A;  4A90 A;  2AEH A;  1MVK A;  2WQY B;  2FNJ B;  2GBM A;  2CJO A;  2V0G A;  4HPL B;  2DZK A;  3R8B A;  2N9X A;  4TMA B;  1HZ5 A;  2RR9 A;  4IOI E;  4WAA A;  3URY A;  2Z0D B;  3MC9 A;  4YTM B;  1LXD A;  2INP E;  1C78 A;  2J0M A;  4A9A A;  1P0R A;  2M1M A;  1D5M C;  2B76 B;  1VDV A;  2FUG 1;  4JWU C;  1TZO A;  2KFK A;  1OGW A;  4OZB A;  2ZZP B;  5G5G A;  4C80 A;  3RN9 C;  2LGS A;  3BIN A;  1K8R B;  1ZKH A;  4KGR A;  1WX7 A;  2QIE B;  3APF A;  3R2I A;  2ZEQ A;  2QJL A;  4HWI B;  2MRP A;  2NBW B;  1DYQ A;  4HEA 1;  3I3T B;  1GB4 A;  4X57 B;  4XWW A;  2K6Q A;  1VD2 A;  3H9D A;  4B0M A;  4AS1 A;  3OWE B;  2LAS A;  3J9C A;  3AE8 B;  3AEC B;  1HXY D;  1WX9 A;  3A9K B;  2AL6 A;  2FUH B;  3CF6 E;  4RNA A;  2AQ1 B;  3A33 B;  3A9K A;  3T3N A;  1GC7 A;  1E7P B;  3UIO B;  3SFE B;  1TIF A;  1N61 A;  1LQB A;  3Q8E A;  3KYD D;  2EKE C;  1CJE A;  4E71 A;  2KMC A;  3AXC A;  3DBL I;  3PHW B;  1T0R C;  3RNC C;  2KMA A;  4ICU A;  2DWQ A;  4K7S A;  4LCD E;  5CHV C;  2PEA A;  1F52 A;  3HIZ A;  4KKI A;  4WQO B;  3TBL D;  4L1B A;  2H88 B;  3PZD A;  3Q69 A;  4G11 A;  3X23 A;  3Q3O C;  1NVI D;  4FA6 A;  2LHE A;  3AB5 A;  1NYR A;  2NR2 A;  5AUI A;  1T0S C;  1E8X A;  2L05 A;  2GMI C;  2Z8L A;  2AX5 A;  2LVQ A;  4II3 B;  1WM2 A;  4OW0 A;  4IM3 A;  4FJY A;  4NY0 A;  3UGB B;  4A3O A;  4HK2 A;  1GC6 A;  1L7Y A;  3AE5 B;  4ACF A;  4OVU A;  3VTW A;  2MP2 B;  4WAF A;  5E6N A;  2WXG A;  2JZZ A;  2MP2 A;  2IO0 B;  4M02 A;  1L4Z B;  3M3J A;  2IGD A;  3IVF A;  2LGD A;  1C1Y B;  5EE0 A;  1KFY B;  2INN E;  2BKR B;  4N58 A;  2I1J A;  4WWM A;  5IN7 A;  2Y3A A;  3EFC A;  3IT6 B;  2DX5 B;  1GPX A;  1PGX A;  2IYD B;  5J18 A;  4LJO B;  5BYS A;  2BYV E;  5IA7 A;  3GP7 A;  2M17 A;  4XYC A;  3DBL B;  1XCQ L;  3Q2A C;  2K8C A;  3NZ3 A;  1TS5 A;  3ONS A;  3Q14 C;  3VVW B;  2KQS A;  1YD8 U;  2BGF A;  2JPH A;  3NVY A;  4FJV B;  3Q3N C;  3RMK C;  3RD2 A;  4KGT A;  1TKE A;  2AQ2 B;  2G3Q B;  4GDL A;  2KNB A;  3H1U A;  1P98 A;  4ZHP A;  1STE A;  4ZRK A;  1KTK A;  3K9P B;  4ASW C;  2KN5 A;  1SIF A;  2KX3 A;  1ESF A;  1YNT E;  4KZ0 A;  1TTN A;  3VH4 B;  3AE3 B;  3KQ4 A;  2LXC A;  1Y56 A;  2RD0 A;  2KFJ A;  4XX5 A;  4RM8 A;  2WU2 B;  2K22 A;  4HCN B;  3W1Y A;  2KO3 A;  3PLU A;  4RF0 A;  2N7E A;  3RFZ B;  3L13 A;  5IP4 D;  2JUO A;  1WXM A;  3EC8 A;  4A8X C;  3DVN U;  4AJY B;  1MJD A;  2MJD A;  3LDZ E;  4H2A A;  4ZRI A;  1V97 A;  2WXI A;  1PQS A;  1KLU D;  3P4Q B;  1TY2 A;  2J53 A;  1FNV A;  2KC2 A;  1VZ7 A;  3DDC B;  1JWB D;  1RFK A;  3P4R B;  5BYQ A;  2MW5 A;  3VR9 B;  2XN9 C;  3U4E G;  1E9M A;  1JAL A;  3PV1 A;  2LUE A;  2HTM E;  2PE9 A;  2IJ0 A;  2K39 A;  2D3B A;  3MJ5 A;  3L16 A;  1ACC A;  3GB1 A;  2Z0E B;  2WYQ A;  3V6C B;  1XO3 A;  2O2V B;  3PT2 B;  2D5G A;  1XEE A;  2KAJ A;  2O2V A;  3RNE C;  2PW9 A;  2ZNV C;  1WXA A;  3DVG X;  1TYG B;  1UD7 A;  3ENE A;  4MEL A;  1L0Y B;  5FKA C;  2LGI A;  2NPT B;  4MH0 E;  4PT5 A;  4F7Z A;  4YWG G;  3IFW B;  2V1Y A;  1WWT A;  3PS6 A;  2NPT A;  2VZK D;  2YLM A;  2R2Q A;  3KUZ A;  2NMQ A;  4II2 B;  2QSD A;  2QEJ C;  3L4P A;  4R3D A;  4MGI E;  3IAM 1;  2JVC A;  2FCM A;  2WXL A;  2QIL A;  2ZVN A;  1TS3 A;  3MP9 A;  4MT5 A;  1WJU A;  2JXX A;  4W9H A;  1DGJ A;  4XE0 A;  2WNM A;  3KH0 A;  1YN4 A;  3DPD A;  2QDF A;  2B3A A;  3W1S A;  1NI3 A;  1UF0 A;  1UGM A;  1KRH A;  2M0A A;  4ZDV A;  2PLP A;  1ISN A;  1JWA D;  2IPK D;  2V3P A;  3MHZ A;  2LHD A;  4NJ6 A;  3SEB A;  1FXI A;  2YVC A;  4B95 A;  1JWM D;  2ON8 A;  2OJW A;  1WGR A;  4M8N A;  3DWG C;  3VRA B;  4J6I A;  3VQI A;  3PTF C;  1BXT A;  3HVZ A;  4YT0 B;  2XEW A;  2KVZ A;  1FNW A;  4KSL C;  1UEL A;  2IO1 B;  1XLP A;  2J0J A;  1QOA A;  1J8C A;  2JU6 X;  5G5H A;  5LLI A;  3V61 A;  1HEZ E;  4JQW C;  3AH7 A;  4DXA B;  4YSX B;  1SE2 A;  1WR6 E;  2IO3 B;  2WXP A;  4DHZ B;  3DBH B;  1J19 A;  2DYM A;  1YOV B;  3N20 C;  3VUX A;  1ET6 A;  2ZPN A;  4TQ0 A;  2ACZ B;  4MJS B;  5H8Y E;  2EEL A;  5D6J B;  2KWC A;  2RDB C;  4P1C C;  4K3B A;  1F1H A;  4MJS A;  1I4H A;  4CHK A;  4MGY E;  3BYY B;  1YQ4 B;  5J17 A;  2I1K A;  4S17 A;  2JWU A;  4OVV A;  2N9P C;  4GOC A;  1RWS A;  1Q0W B;  5LNK 1;  3VXW A;  2MEK A;  4JPS A;  1N5W A;  2TSS A;  4W9D A;  2UYZ B;  3U7Z A;  1WGY A;  3QWZ B;  1S3S G;  4B0E A;  1JRP A;  4L23 A;  1SE4 A;  3ZUN A;  1E7U A;  3QQ8 B;  3FC4 A;  4LDT B;  3GS2 A;  2N7J A;  5CHF A;  3L54 A;  4FBJ B;  4W9J A;  3TEX A;  1I4G A;  3ZJV A;  2MLB A;  2J0K A;  3DBR B;  3BK1 A;  1SSN A;  1XQQ A;  1IPG A;  1VZ8 A;  5DPS A;  4RGM A;  3DBS A;  1L5P A;  4FHJ A;  3ZTC A;  2QHO A;  2VH1 A;  3DCG A;  1WGD A;  4XDD A;  4W9I A;  2Z59 B;  4ZRQ A;  3RZF A;  4BKT A;  3PVL A;  4KZC A;  4HJK A;  1WJN A;  2G4D B;  3Q8C A;  1MPE A;  1MFW A;  4EEW A;  3NG0 A;  4JE3 B;  1RM6 C;  1N62 A;  2WS3 B;  3UIN B;  4EOY A;  3SU8 X;  2PTL A;  3PRM B;  1I35 A;  1UUP A;  1V1O A;  1JWU D;  3E9S A;  3ZO5 B;  2KLG A;  1V9J A;  2JY6 A;  1PUT A;  2UU7 A;  3AUL A;  3A9J A;  1XT9 B;  3UF8 A;  3A1Q B;  3TEY A;  2J42 A;  3C19 A;  1FFU A;  1RYJ A;  3UIP B;  2W9N A;  4K1R B;  4IWP A;  1V81 A;  4YSY B;  3TIX A;  2RDG A;  1MG8 A;  3OJ4 B;  4DHZ E;  1ZDV A;  2L83 A;  1ZDX A;  4GDK A;  1IGD A;  4C4V A;  2FCS A;  2SEB D;  3N32 A;  4DXG A;  2CHW A;  2WDV B;  3OAW A;  4DXF A;  1R4N B;  2Y5C A;  3GE3 C;  2IO2 B;  3VR8 B;  4LJP B;  2PVG C;  1T6B X;  2K1F A;  3AEG B;  2CJN A;  1P7E A;  3AEB B;  3ZNG C;  1L2N A;  3KYC D;  1YJI A;  1FPY A;  3BY4 B;  2N1W A;  1WIA A;  2MX2 A;  4IWO A;  5LXH A;  3L08 A;  2KFK B;  1WSP A;  5CX3 A;  4B9K A;  4GIV A;  4DDI D;  1K51 A;  4NZL B;  5C2T B;  4W9C A;  1V2Y A;  3PPA A;  3ZJU A;  2OED A;  1HQR D;  3GOE A;  2FBW B;  5EDS A;  3RNF C;  5G55 A;  3RNA C;  2WGS A;  5IAA C;  2NBU A;  5J2R A;  1JRO A;  3SDL C;  2KDI A;  3DHH C;  3V62 A;  3M95 A;  2KDB A;  2HE7 A;  3AU5 A;  3O65 B;  1IBX A;  4KKJ A;  3B1L X;  1CK1 A;  2PJH A;  4LNI A;  3CSF A;  3L17 A;  4ZYN A;  4G50 A;  1FNU A;  1FIQ A;  1VZ6 A;  2K6D B;  1SJH D;  1ZUD 2;  2WXF A;  1PGA A;  3UQA A;  2C7H A;  4ITK A;  1WYW B;  3A4S C;  3ZJT A;  3Q8A A;  4MSM B;  4NAW B;  3ECI A;  2MBO A;  3ML8 A;  2BYE A;  4G0N B;  4NAW A;  2MCN B;  1GJZ A;  4K81 A;  4GB9 A;  1ROE A;  1FCC C;  2IZV B;  3APC A;  2MJE A;  3Q8B A;  4KIK B;  3U52 E;  1QLB B;  1YX5 B;  3NUH B;  4B6W A;  5KHO A;  3ZW3 A;  2BW2 A;  3DWM A;  4LNF A;  4KIK A;  3NVV A;  3ZQ4 A;  3VTV A;  2N1V A;  4WWP A;  1AWD A;  1J7A A;  1CQV A;  4KGS A;  4USA A;  1XCT L;  3EHV A;  5HG2 A;  3N1Z C;  4W9E A;  1PFD A;  1N6Z A;  2M0X A;  2GBJ A;  1LM8 B;  4TSS A;  2ICI A;  2IND C;  3DHG C;  2LUM A;  4N6E B;  2X8X X;  4US8 A;  4LNK A;  3RPF C;  1FXT B;  2CKH B;  2O6V D;  4TKN A;  2EMS A;  3AE2 B;  2UWQ A;  1E8W A;  2LGY A;  4ARC A;  5D7G A;  3QK0 A;  5I4D A;  4M0W B;  2BTE A;  2GRI A;  1HTO A;  2XNA C;  1OTR B;  2AWT A;  2KHW B;  4GMV A;  4NJ7 A;  4M0W A;  5CHW A;  1RFA A;  5D94 A;  4ZYS A;  4DHJ D;  1NDD A;  5AZF A;  1D4B A;  4FAD A;  4HRO A;  3E56 A;  2LXA A;  1WE6 A;  2KTR A;  1TT5 B;  3KW5 B;  3V6E B;  1TJE A;  3EUB 2;  3PRP B;  3N1Y C;  3Q8F A;  1XXG A;  1WZ0 A;  1V80 A;  4IC7 B;  2N9K A;  3AEE B;  4BFR A;  1C77 A;  3VHT C;  3ZIM A;  2OHF A;  4P16 A;  2BKF A;  3ZXR A;  4BKS D;  4MH8 A;  1E7V A;  2A4Z A;  4NQL B;  1WFY A;  3NOB A;  3AN1 A;  1H8C A;  5FR6 A;  3RCZ A;  1F2R I;  1KH0 A;  2RPQ A;  4GDL B;  2BWF A;  2C7M B;  1V86 A;  4F1S A;  1V1P B;  2K8H A;  1JW9 D;  4DBG A;  2E6X A;  3A4R A;  1MHX A;  2J4X A;  2ASQ A;  2QMT A;  3ZKJ C;  1V1P A;  2KLC A;  2G1E A;  1BML C;  4WJP A;  1FFV A;  4XC2 A;  1WY8 A;  3MJW A;  1TKG A;  4IKG A;  2VH2 A;  2KT7 A;  1H4R A;  2JWZ A;  3QC8 B;  1QQR A;  2RPV A;  3M63 B;  2LWP A;  4RH6 A;  1YJJ A;  1WGK A;  1L0V B;  1UWX A;  3I9V 1;  1SJE D;  2LI5 A;  3AE1 B;  3K9O B;  3EFU A;  1RAX A;  1E6E B;  1SF0 A;  2L76 A;  4BBN F;  3PSE B;  1P9D U;  2GBN A;  4MAC A;  1T3Q A;  1I4P A;  2L3Z A;  1DOI A;  4US9 A;  3RUI B;  2G4S A;  3TMP B;  2ZVO A;  4Q2J A;  2KAN A;  2H89 B;  1SB3 C;  2BBC A;  2GBK A;  2IY0 B;  2LZ6 A;  3PRE A;  3KUC B;  3NS1 A;  2ZCC A;  2LGX A;  2WWZ A;  3ETR A;  5E6P A;  2N4F A;  3TCA A;  2XBB C;  4AQ7 A;  3KUD B;  1VR9 A;  2M56 B;  1G6J A;  5D3D A;  3VUY A;  1RRB A;  2JX5 A;  4XWT A;  3OJ3 A;  4CYE A;  3PGE A;  3D32 A;  4P7I A;  3BYT B;  2IGG A;  3RNB C;  1WXQ A;  2JZ3 B;  3LYY A;  2NBV B;  2GB1 A;  2O6V B;  3NY5 A;  3R7R A;  4JWS C;  3VUW A;  2O6V A;  2C60 A;  1NEN B;  1P7F A;  4GU2 A;  3DBH I;  1D5X C;  2WXM A;  3QJZ A;  3WAP A;  3AMZ A;  2LD9 A;  3O13 A;  1JCK B;  3IG3 A;  3APD A;  1WMH B;  2GOW A;  4S0R A;  2JXT A;  4ANU A;  1SE3 A;  1T0Y A;  1YN3 A;  2DAF A;  1WMH A;  1ENF A;  3B2F A;  3HM3 A;  3CWI A;  4DDG D;  5HFY A;  2WU5 B;  3CST A;  2JT4 B;  2RSU A;  1VJK A;  2K3U A;  1I4Q A;  2WX0 A;  5AZH A;  3RI7 C;  4ARI A;  1A70 A;  2BS4 B;  3BVZ A;  2ZCB A;  3ZLZ A;  3R2T A;  2D11 A;  2M4N A;  1EO6 A;  2HJ1 A;  3TSS A;  1FM0 D;  4BKS A;  1GNU A;  2W3S A;  2G9H D;  4XZ4 A;  4EE2 A;  4RF1 A;  4BKG A;  3AU4 A;  3JVZ X;  4ZRP A;  2EMT A;  1E8Z A;  4NNJ B;  2BWE S;  5FK9 C;  4YXD B;  1UBI A;  1WRI A;  2PKO A;  3ALB A;  4CQN A;  3NZS A;  3SHQ A;  3Q3M C;  1R4M B;  3MHS D;  1FRR A;  2NTT A;  1C9F A;  3B9J A;  2AL3 A;  3WIM A;  5AEK B;  2L0F A;  2M8S A;  3RUL A;  4M8M A;  3MC0 B;  3TL5 A;  1WYG A;  1R7S A;  3BVM A;  2WDT B;  4WJN A;  3PRZ A;  1XLO A;  2BYT A;  3VAW A;  3JW0 X;  4NAM A;  5CTR C;  1FRD A;  2JSV X;  4ZOH C;  5JHA A;  4MSQ B;  4N59 A;  3WCQ A;  2KJH B;  1P3Q U;  3DBR I;  2NTS A;  3BVG A;  3RYT A;  2LJI A;  1GG3 A;  2BYF A;  2MBH A;  3CMM B;  2N0S B;  2E3T A;  2LRW A;  3BZD B;  4MGK E;  4LK0 M;  3AEF B;  4C56 C;  2OOB B;  5E6J A;  2INC C;  2FCN A;  3KWV A;  3RNG C;  4JGH B;  1UBQ A;  3P42 A;  1Q1O A;  1YJ1 A;  2PPH A;  3R66 C;  1TBE A;  3IBE A;  5BYR A;  5MPO A;  2D3C A;  2D10 A;  2PMV A;  1QF6 A;  5BMH A;  4FLH A;  4XDC A;  2DYO A;  4W9F A;  2V3S A;  2GI9 A;  4J3O D;  4RFB A;  2ONQ A;  2MBQ A;  2V3N A;  1EUV B;  3L10 B;  1E90 A;  4EFO A;  5T8I A;  3Q6B A;  3EA6 A;  4D2K A;  2KX0 A;  3BK2 A;  1TS2 A;  2L52 A;  1C79 A;  1F2R C;  1ZXH A;  3I57 A;  1J7C A;  4AP4 C;  2N9L A;  3ZDM C;  4URK A;  2KDE B;  1E5W A;  2MHJ A;  2WXJ A;  1CMX B;  4KVG B;  2K5P A;  3JYU A;  3Q3J A;  3ML9 A;  1NI2 A;  1R4N I;  2KQ7 A;  4HKZ E;  2ZPY A;  4AJW A;  3H6N A;  2CHX A;  2VZK B;  2WP9 B;  1L0X B;  4C7Z A;  4HRS A;  1KOT A;  1YQB A;  2KK8 A;  2RDH A;  2NCN A;  2MH7 A;  4O1N A;  2KWV B;  4M01 A;  2KOX A;  2LVO A;  1FO4 A;  3B08 A;  5LXI B;  3QIJ A;  1LO5 D;  5EE1 A;  3MC8 A;  3ZNI D;  4LLG M;  1EU3 A;  4FJZ A;  2JQR B;  3P1M A;  4PS7 A;  1TGZ B;  2LEK A;  2DEN B;  3P2B A;  4YTP B;  5DPR A;  2LRU A;  4UDU C;  1NBF C;  4ZHO A;  4MM3 A;  2K8B A;  1X1M A;  4TUU A;  1M94 A;  4EZJ A;  3W1S C;  1I42 A;  4IM2 A;  1SIJ A;  5JHB A;  5C3J B;  3A9J B;  1MI0 A;  1I7H A;  4HVB A;  1EF1 A;  1BUI C;  1QOG A;  3C8Y A;  2DBY A;  4FXC A;  4F8C B;  2V9H A;  2KTF A;  4TV3 A;  2L32 A;  3QAQ A;  3UQB A;  4GDK B;  2L8J A;  4IWQ A;  1M4V A;  4C7Y A;  4C4V B;  1NEK B;  1EWY C;  2JF5 A;  3AE6 B;  4HLE A;  1WJ6 A;  2A5U A;  4PYU A;  2FE8 A;  1MG4 A;  1ZPS A;  4N9F 4;  5D2M B;  4HDQ A;  5IKC M;  3N1X C;  2KDF B;  2XK5 A;  2BT6 A;  2L0T A;  2KMM A;  2KAC A;  3ZRF A;  1N60 A;  2JYT A;  4YTN B;  3ABV B;  4XGA B;  3OLM D;  5C23 A;  1UWM A;  3C0R B;  3NJT A;  1YMH E;  1LFD A;  1WXS A;  2D3A A;  1L6U A;  3LB8 C;  4IG7 B;  3H7S A;  4FUL A;  3UI3 A;  3SD5 A;  2BS3 B;  3ZNZ B;  3DHI C;  1V5O A;  2ZJD A;  1WH3 A;  4EZL A;  1Y8R C;  1PDX A;  4BZA A;  2KN4 A;  2K9X A;  1D5Z C;  1JQ4 A;  3X0W A;  2GBR A;  4ANV A;  2W82 A;  1IBX B;  1YQ3 B;  1S1Q B;  4W9L A;  1KM7 A;  4JL9 A;  2IGH A;  3QCA A;  3M62 B;  1ZXI A;  4AUQ C;  4BOS C;  3FIL B;  4TQ1 A;  3AI5 A;  2HJ8 A;  4WIP A;  4GXB A;  1D6E C;  3PZ8 A;  5AZG A;  1Z5S B;  2DZJ A;  3I5J C;  3FIL A;  2I38 A;  2WXR A;  1Q10 A;  4KX6 B;  2MSE D;  4G3X B;  4KDL B;  2L00 B;  2N7D A;  3Q3F A;  3TUO A;  5HI1 A;  2WXO A;  2Y5P A;  4MGZ E;  3QA8 A;  1WRD B;  2KKC A;  3BII D;  1WF9 A;  4HJG E;  2Q5W D;  4FN2 A;  1UZX B;  1OEY J;  3U2S C;  2WLB A;  1N63 A;  1WR1 A;  4GGQ A;  3DVN V;  1ZGU B;  2R2O A;  3T8M A;  3U30 A;  2ZW1 A;  5HKH A;  3R3M A;  4WJO A;  4IM0 A;  2C9W B;  1U4A A;  2MBB B;  2WX1 A;  2KXJ A;  3HRD D;  3NVW A;  3AV8 A;  1GAQ B;  3ZXV A;  4EKU A;  1JML A;  4OZC A;  2CS4 A;  1HE8 A;  4I6P A;  1TKY A;  1ET9 A;  3JSV B;  4MDK E;  4IUM B;  4WWN A;  4L2Y A;  1WJ4 A;  5L95 C;  3HUI A;  2V4L A;  4E3C A;  1FXA A;  2REX A;  3JSV A;  4DWF A;  2CU1 A;  4PS3 A;  1ZW7 A;  1IUE A;  2JYE A;  2ZNV B;  4I6N B;  3QX1 A;  1V6E A;  1Z2M A;  1OQQ A;  2LFI A;  5KHQ A;  2FCQ A;  1L4D B;  2KTR B;  3DQV A;  1JWS D;  1QOB A;  2ZW0 A;  3IT4 B;  1IGC A;  3W2D A;  2AYO B;  3VTU A;  2EKI A;  3SR6 A;  3T3O A;  1WE7 A;  4YL8 A;  2R61 A;  3ZVV A;  2NVU I;  4BVU C;  3FKY A;  3H7P B;  1GB1 A;  2YEP F;  1RLF A;  3H7P A;  3HHM A;  1XF5 L;  1VLB A;  4HXD A;  3ZGZ A;  1VCB A;  5D3I B;  1GOZ A;  1QKZ A;  1F77 A;  1QZE A;  2D07 B;  1VRA B;  2D2Q A;  2LJ5 A;  4I6L B;  2DYB A;  1OQY A; 
#chains in the Genus database with same CATH homology
 3DOW A;  2N9E B;  2WX0 A;  5AZH A;  2MLB A;  1WI0 A;  2J0K A;  2ZCB A;  4RM9 A;  4KV2 A;  3ZLZ A;  1V5T A;  2D11 A;  1WX9 A;  2M4N A;  3A9K B;  1EO6 A;  2AL6 A;  1XQQ A;  4BKS A;  1IPG A;  1GNU A;  2FUH B;  3CF6 E;  4XZ4 A;  5DPS A;  4BKG A;  3DBS A;  5JH5 C;  3A33 B;  3A9K A;  3EEC A;  3AU4 A;  4FHJ A;  1GC7 A;  3JVZ X;  4HDO A;  2LVP A;  2KJ6 A;  3ZTC A;  3UIO B;  2QHO A;  2EMT A;  1E8Z A;  3DCG A;  1WGD A;  4NNJ B;  2BWE S;  4W9I A;  2Z59 B;  3RZF A;  4BKT A;  1UBI A;  3PVL A;  3ALB A;  4HJK A;  3NZS A;  4KZC A;  5E6O A;  3SHQ A;  3MHS D;  1LQB A;  3KYD D;  1WJN A;  5G2N A;  2G4D B;  2EKE C;  3VFK A;  4E71 A;  2KMC A;  3AXC A;  4EEW A;  2AL3 A;  3WIM A;  5AEK B;  3T9L A;  2L0F A;  2M8S A;  3DBL I;  3PHW B;  4M8M A;  3RUL A;  1WM3 A;  3TL5 A;  2KMA A;  4ICU A;  3UIN B;  4EOY A;  3QAR A;  4WJN A;  2WDT B;  3SU8 X;  3PRZ A;  4K7S A;  1IYF A;  4LCD E;  5CHV C;  3PRM B;  1I35 A;  3R7Q A;  2PEA A;  3JW0 X;  3VAW A;  3ZO5 B;  5CTR C;  2KLG A;  1V9J A;  3HIZ A;  2JY6 A;  5JHA A;  4WQO B;  4MSQ B;  3TBL D;  2KJH B;  3AUL A;  4GN1 A;  4JIO U;  3A9J A;  1P3Q U;  1XT9 B;  3DBR I;  3PZD A;  3UF8 A;  3A1Q B;  3ZNH B;  4G11 A;  3RYT A;  3X23 A;  1GG3 A;  2BYF A;  2MBH A;  3CMM B;  1OEY A;  3UIP B;  4FA6 A;  2W9N A;  4K1R B;  2LRW A;  4IWP A;  2NR2 A;  1V81 A;  3TIX A;  4MGK E;  1E8X A;  2L05 A;  1MG8 A;  2GMI C;  3OJ4 B;  2LVQ A;  4II3 B;  1WM2 A;  4DHZ E;  4A20 A;  1J0G A;  2OOB B;  4IM3 A;  4FJY A;  4GDK A;  4NY0 A;  3UGB B;  4A3O A;  1R4M I;  2FCN A;  4HK2 A;  2FCS A;  1UBQ A;  1GC6 A;  4JGH B;  3N32 A;  3ZTD A;  2CHW A;  1L7Y A;  1Q1O A;  1YJ1 A;  3OAW A;  2PPH A;  3R66 C;  1TBE A;  3IBE A;  4OVU A;  3VTW A;  3WAL A;  2MP2 B;  2IO2 B;  5E6N A;  4LJP B;  5TR5 A;  2D10 A;  2JZZ A;  2K1F A;  2MP2 A;  2IO0 B;  4FLH A;  1V49 A;  3ZNG C;  3KYC D;  3MTN B;  1L2N A;  2CHZ A;  2DYO A;  3BY4 B;  2N1W A;  1WIA A;  2NS5 A;  2V3S A;  4W9F A;  3M3J A;  3IVF A;  2DAJ A;  2LGD A;  2MX2 A;  4IWO A;  1C1Y B;  5LXH A;  3L08 A;  2KFK B;  5CX3 A;  4AOF A;  2MBQ A;  4WWO A;  2BKR B;  4GIV A;  4B9K A;  3WAM A;  1EUV B;  3L10 B;  4DDI D;  4PYZ A;  1E90 A;  4EFO A;  2I1J A;  4BOZ B;  4LDT D;  4DHJ B;  4ZRJ A;  2DX5 B;  4W9C A;  2HD5 B;  1V2Y A;  2KX0 A;  3PPA A;  4K7U A;  1JRU A;  3NS8 A;  2IYD B;  3GOE A;  3IHP C;  4LJO B;  5EDS A;  5J18 A;  2BYV E;  2OJR A;  2FID A;  5IA7 A;  4AP4 C;  3ZDM C;  2M17 A;  5G55 A;  4URK A;  2KDE B;  2BF8 B;  1E5W A;  3DVG Y;  3V60 A;  2K8C A;  3ONS A;  1CMX B;  4KVG B;  5IAA C;  2NBU A;  5J2R A;  3JYU A;  3SDL C;  3Q3J A;  3HM6 X;  2KDI A;  3ML9 A;  3WAO A;  3VVW B;  2KQS A;  1NI2 A;  1R4N I;  2KQ7 A;  3V62 A;  3M95 A;  4NQK E;  2ZPY A;  1YD8 U;  4AJW A;  2KDB A;  2BGF A;  2HE7 A;  3H6N A;  2Y5B B;  2JPH A;  3AU5 A;  2CHX A;  3O65 B;  3ZDT A;  4FJV B;  2FIF A;  3U7D A;  3B1L X;  2PJH A;  3RD2 A;  3CSF A;  3L17 A;  4ZYN A;  4G50 A;  4IW0 A;  1KOT A;  4PS8 A;  1YQB A;  2G3Q B;  2KK8 A;  4GDL A;  3U8Z A;  2KNB A;  2K6D B;  3HK0 A;  4A3P A;  2NCN A;  3UQA A;  2C7H A;  3H1U A;  1P98 A;  1WYW B;  2KWV B;  3A4S C;  4GSW A;  4MSM B;  2KOX A;  4NAW B;  2LVO A;  4ZRK A;  3B08 A;  3K9P B;  5LXI B;  3ECI A;  3QIJ A;  2MBO A;  3ML8 A;  4ASW C;  2BYE A;  4G0N B;  3ZNI D;  4NAW A;  2KN5 A;  1SIF A;  2MCN B;  1GJZ A;  4FJZ A;  2KX3 A;  4K81 A;  4PS7 A;  1TGZ B;  3P2B A;  2DEN B;  5DPR A;  3VDZ A;  4GB9 A;  1WGG A;  2LRU A;  1NBF C;  2IZV B;  2HTH A;  2IY1 B;  2K8B A;  4MM3 A;  3APC A;  1X1M A;  4KIK B;  4KZ0 A;  1YX5 B;  1TTN A;  1M94 A;  2KD0 A;  4K7W A;  4TUU A;  1F9J A;  4EZJ A;  3W1S C;  1I42 A;  4B6W A;  5KHO A;  3VH4 B;  1TZ1 A;  3ZW3 A;  2LXC A;  2KZR A;  5L83 A;  4IM2 A;  2RD0 A;  5JHB A;  2KFJ A;  2FAZ A;  4KIK A;  3NZU A;  4XX5 A;  3A9J B;  4RM8 A;  4HCN B;  4HVB A;  3VTV A;  3W1Y A;  1EF1 A;  2N1V A;  4WWP A;  3WA0 A;  2KO3 A;  4HCP B;  3PLU A;  1IP9 A;  1WXV A;  2N7E A;  4F8C B;  3L13 A;  2KTF A;  4TV3 A;  3EHV A;  4W9E A;  3QAQ A;  2JUO A;  3UQB A;  1D3Z A;  4GDK B;  2L8J A;  1WXM A;  3EC8 A;  4IWQ A;  1SGH A;  3DVN U;  4AJY B;  2M0X A;  2GBJ A;  1LM8 B;  3LDZ E;  2JF5 A;  4ZRI A;  4JLC A;  1WJ6 A;  2A5U A;  4ANW A;  4HLE A;  4PYU A;  2PE6 B;  4N9F 4;  1PQS A;  5D2M B;  1FXT B;  2CKH B;  4HDQ A;  2O6V D;  4TKN A;  2EMS A;  2KDF B;  2UWQ A;  1E8W A;  2XK5 A;  2DHZ A;  2KC2 A;  2L0T A;  2LGY A;  3DDC B;  1WX8 A;  5D7G A;  3QK0 A;  2MW5 A;  4M0W B;  1P1A A;  4AWJ A;  1OTR B;  3ZRF A;  2AWT A;  2KHW B;  3LJ3 A;  1YX6 B;  4GMV A;  4NJ7 A;  5BO4 B;  5CHW A;  1RFA A;  3OLM D;  5D94 A;  3B0A A;  3PV1 A;  2LUE A;  2PE9 A;  1NDD A;  5C23 A;  5AZF A;  4DHJ D;  2K39 A;  4FAD A;  2CR5 A;  3C0R B;  1LFD A;  1WE6 A;  1WXS A;  2LXA A;  4IG7 B;  3L16 A;  2Z0E B;  2WYQ A;  3PLV A;  2KTR A;  3KW5 B;  3H7S A;  4FUL A;  3V6C B;  3V6E B;  2O2V B;  3PT2 B;  3SD5 A;  2DZI A;  5DCN A;  3ZNZ B;  3PRP B;  2JRI B;  4KDI C;  5C1Z A;  1KLV A;  1WZ0 A;  1V80 A;  2O2V A;  4IC7 B;  1V5O A;  2ZJD A;  2ZNV C;  2G45 B;  1WXA A;  4ICV A;  3TJP A;  1WH3 A;  4BFR A;  4EZL A;  2KC1 A;  4KSK C;  4DK5 A;  4RMA A;  3DVG X;  1Y8R C;  3VHT C;  3ZIM A;  1UD7 A;  3ENE A;  4MEL A;  3WAN A;  2BKF A;  2NPT B;  2D3G A;  4MH0 E;  4F7Z A;  1E8Y A;  4BKS D;  3IFW B;  2V1Y A;  1E7V A;  5DPT A;  2A4Z A;  2MQJ A;  4NQL B;  3X0W A;  3NHE B;  2NPT A;  3PS6 A;  1WFY A;  2GBR A;  2J7Q B;  2YLM A;  2R2Q A;  3KUZ A;  3L0W B;  4ANV A;  4II2 B;  4WJQ A;  3NOB A;  2L7R A;  4MGI E;  1Q5W B;  1S1Q B;  3GZN I;  4W9L A;  1KM7 A;  2FCM A;  2JVC A;  3QCA A;  4JL9 A;  5GMV A;  3M62 B;  2MA9 B;  2ZVN A;  5FR6 A;  3RCZ A;  3S2A A;  3VH3 B;  3N30 A;  2RPQ A;  4AUQ C;  3RZW C;  1WJU A;  4BOS C;  4GDL B;  4TQ1 A;  2BWF A;  3AI5 A;  4W9K A;  4EUT A;  2HJ8 A;  2C7M B;  2JXX A;  1V86 A;  1WZ3 A;  1XD3 B;  4GXB A;  4W9H A;  1C3T A;  4F1S A;  2MBE A;  5AZG A;  1Z5S B;  2K8H A;  2DZJ A;  4DBG A;  3A4R A;  3KH0 A;  3DPD A;  2ASQ A;  3ZKJ C;  2B3A A;  3W1S A;  4ANX A;  5JZE B;  2KLC A;  2MSE D;  2BPS A;  4G3X B;  4KDL B;  1UH6 A;  1UGM A;  3QHT A;  1SE9 A;  4WJP A;  2L00 B;  2N7D A;  4XC2 A;  4ZDV A;  4W9G A;  1ISN A;  1WY8 A;  1BT0 A;  3MJW A;  3Q3F A;  2K25 A;  4MGZ E;  1H4R A;  2JWZ A;  3QA8 A;  4NJ6 A;  1WRD B;  2YVC A;  3QC8 B;  2KKC A;  4B95 A;  3M63 B;  1WGH A;  1WGR A;  1WF9 A;  4M8N A;  2LWP A;  4CO7 A;  2DZM A;  2RGF A;  5DPW A;  4J6I A;  4FN2 A;  4NPN A;  2KVR A;  3KVF B;  2KJR A;  3VQI A;  1UZX B;  1OEY J;  4EZK A;  2LI5 A;  1WR1 A;  3PTF C;  3K9O B;  3EFU A;  1RAX A;  4GGQ A;  1GUA B;  3DVN V;  1ZGU B;  2R2O A;  2XEW A;  3T8M A;  2L76 A;  3U30 A;  5HKH A;  3R3M A;  4KSL C;  4BBN F;  3PSE B;  1UEL A;  4IM0 A;  2IO1 B;  2J0J A;  4WJO A;  1P9D U;  2GBN A;  3PHX B;  3RT3 B;  1J8C A;  2C9W B;  2VRR B;  1U4A A;  5LLI A;  2MBB B;  2WX1 A;  2KXJ A;  3V61 A;  4JQW C;  1EF5 A;  1H8C A;  4EKU A;  2L3Z A;  2CS4 A;  4DXA B;  1HE8 A;  4FHK A;  4I6P A;  3RUI B;  2IBI B;  1WR6 E;  2G4S A;  2C5L C;  1YIW A;  2IO3 B;  3TMP B;  3JSV B;  1J19 A;  2DYM A;  4DHZ B;  4MDK E;  2XK5 B;  4IUM B;  4WWN A;  2ZVO A;  3VUX A;  1WJ4 A;  2KAN A;  2ZPN A;  5L95 C;  4TQ0 A;  2V4L A;  4E3C A;  2REX A;  3JSV A;  4DWF A;  2GBK A;  2CU1 A;  2IY0 B;  2LZ6 A;  1KJT A;  3PRE A;  3KUC B;  4PS3 A;  4MJS B;  2JRH A;  2ZCC A;  3N3K B;  1ZW7 A;  4BBN C;  3A1Q A;  2KWU B;  5D6J B;  2LGX A;  2KWC A;  2WWZ A;  2ZNV B;  1AAR A;  5E6P A;  2N4F A;  4I6N B;  4MEM A;  3QX1 A;  2XBB C;  1V6E A;  1Z2M A;  2C7N B;  3TCA A;  5KHQ A;  4MJS A;  3ZRC A;  2FCQ A;  3KUD B;  4HPM B;  4CHK A;  1A5R A;  4MGY E;  1G6J A;  2MWS B;  2KTR B;  4E74 A;  3DQV A;  2AEH A;  3VUY A;  1RRB A;  2FNJ B;  4CYE A;  3OJ3 A;  2GBM A;  3PGE A;  3D32 A;  4HPL B;  4P7I A;  2DZK A;  2AYO B;  2I1K A;  5J17 A;  3VTU A;  4OVV A;  2JZ3 B;  2N9P C;  4GOC A;  2NBV B;  1Q0W B;  1WE7 A;  2N9X A;  2O6V B;  4YL8 A;  3NY5 A;  3R7R A;  3ZVV A;  3VXW A;  3VUW A;  2NVU I;  2RR9 A;  4WAA A;  4BVU C;  2Z0D B;  1LXD A;  2O6V A;  4W9D A;  2C60 A;  2UYZ B;  2J0M A;  3H7P B;  1P0R A;  1WGY A;  3QWZ B;  3DBH I;  4GU2 A;  1S3S G;  2M1M A;  1RLF A;  3QJZ A;  3WAP A;  2KFK A;  3H7P A;  1OGW A;  2LD9 A;  3ZUN A;  3IG3 A;  3APD A;  1E7U A;  3HHM A;  1WMH B;  2ZZP B;  2GOW A;  3QQ8 B;  3BIN A;  4ANU A;  1K8R B;  1ZKH A;  4HXD A;  1WX7 A;  1VCB A;  1T0Y A;  4LDT B;  2DAF A;  1WMH A;  3APF A;  3HM3 A;  2ZEQ A;  4HWI B;  4DDG D;  1QZE A;  2D07 B;  5CHF A;  2MRP A;  3CST A;  3L54 A;  2NBW B;  3I3T B;  2JT4 B;  2RSU A;  4X57 B;  4FBJ B;  2D2Q A;  2K6Q A;  2LJ5 A;  4I6L B;  1VD2 A;  3H9D A;  4W9J A;  2DYB A;  2LAS A;  1OQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...