1JWBD

Structure of the covalent acyl-adenylate form of the moeb-moad protein complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
80
structure length
80
Chain Sequence
IKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
total genus 18
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2001-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwbD00
4YSYB 3SFDB 1JRPA 1PDXA 1ROEA 1QF6A 4C7ZA 3AE1B 4FXCA 2G1EA 1UWMA 2FBWB 3VRAB 5MPOA 2QIEB 3CWIA 4HROA 3ZYYX 4N6EB 1XO3A 2AX5A 4N58A 2WDRB 1JWAD 2PIAA 1AYFA 4YXDB 2Y5CA 1J7BA 3P63A 3AE3B 2BT6A 2PVGC 3ABVB 5H8YE 1T3QA 1OQRA 1WWTA 3AEFB 3AE6B 3DWMA 1TKGA 5EE3A 1L6UA 1N63A 1WRIA 1ZOYB 3KWLA 3PO0A 3AB5A 4JX1C 3B2FA 1FMAD 2KMMA 3AEEB 1ZP0B 4LTUA 1RYJA 1DOXA 1QLBB 3VR9B 2OHFA 3B2GA 4C80A 3NVYA 1TJEA 1EWYC 1CZPA 1XLPA 1YJIA 3DWGC 3LXFA 4IDIA 3AE5B 1SB3C 3W9CB 2WU5B 5G5HA 2WDQB 5AUKA 1YQ4B 3L4PA 3P4SB 1TKEA 1F0ZA 3P1MA 4YT0B 2JX5A 2WP9B 1E7PB 1IUEA 1QOFA 3NRZA 4KX6B 1RWSA 3AV8A 3AEBB 2H88B 4ZOHC 5EE9A 2MJEA 1GPXA 1FRDA 4YSXB 2W3SA 2BS4B 1R7SA 1RFKA 2MJDA 3FC4A 1TYGB 1XLOA 2K22A 3P4RB 2K5PA 3AE8B 2W3RA 1SF0A 4USAA 5G5GA 3LB8C 1L6VA 1DOYA 1E6EB 1PUTA 1RM6C 3AECB 3W5UB 2M56B 2L52A 1NENB 2BS3B 1JALA 1WYGA 1FRRA 2B76B 3AH7A 3VRBB 2WS3B 1YQ3B 4US8A 1N5XA 1NVID 2WU2B 3AEAB 1A70A 2H89B 2L83A 3BIID 5EE0A 1NYQA 2JQRB 1JW9D 3AE2B 4N59A 1KRHA 3HRDD 1PFDA 1E10A 1N5WA 3NVVA 3NVZA 2K9XA 1DGJA 1YJJA 2MH7A 4YTNB 1V97A 5H92C 2ACZB 5EE1A 2CJNA 1JROA 2Q5WD 1B9RA 1E0ZA 2W55A 3NVWA 2PVOD 2BS2B 1VLBA 2CJOA 3CIRB 1N61A 1NYRA 3VR8B 3AM9A 1VJKA 2HTME 1J7AA 3AMZA 1CJEA 2W54A 3FAHA 1FXIA 4ZHOA 1JQ4A 1DOIA 1N60A 1WGKA 3HVZA 3NS1A 1WXQA 1QOBA 1E9MA 4YTMB 2N0SB 1N62A 3ETRA 1ZXIA 1QOAA 3AE9B 3P4QB 3WCQA 4JWSC 1FO4A 1ZUD2 1FFVA 4C7YA 1I7HA 1OFFA 2WDVB 2WLBA 1FIQA 2M19A 4YTPB 1FXAA 3AEDB 3AN1A 1TKYA 1QT9A 3RPFC 4HRSA 1OQQA 3HUIA 3P4PB 1QOGA 1FM0D 2DBYA 4US9A 3AE7B 2CU3A 3SR6A 1NI3A 1AWDA 2EKIA 2LEKA 1J7CA 2WQYB 3AEGB 3EUB2 3SFEB 1GAQB 3W5VB 1JWBD 1L5PA 1V8CA 2DWQA 1KFYB 2E3TA 4JWUC 4WQMA 4P6VF 1SIJA 2MJ3A 3AE4B 5AUIA 5C3JB 5C2TB 4WWMA 4ITKA 1KF6B 1L0VB 1NEKB 1XLQA 1XLNA 2PKOA 2QJLA 4YSZB 4ZHPA 2KAJA 5GXGB 1VDVA 4A9AA 1FFUA 3B9JA
chains in the Genus database with same CATH superfamily
2K6DB 1WI0A 2MEKA 3DBSA 3R7RA 3LJ3A 4G50A 4OVUA 2WDRB 1E8WA 2IO0B 4W9FA 3TMPB 3P63A 4YXDB 2BT6A 1PGXA 1SSNA 2FE8A 5LNK1 2J4XA 3BYTB 1E8YA 1XXGA 4GLSC 2LRUA 1ZOYB 3MTNB 2WXRA 2N9EB 3QCAA 3UIPB 3R7QA 2AEHA 3VR9B 4LJOB 2C60A 1EWYC 3QARA 1XLPA 5E6JA 1CQVA 4PYUA 1TS4A 2JZPA 2KVZA 2L32A 1JWSD 1WGHA 4K3CA 1FRDA 2MJDA 3VTVA 3WAOA 2OEDA 4MJSA 5KHQA 3T3OA 4K81A 2LGXA 5BO4B 1YQ3B 5DPTA 1T5XD 1GB1A 4ZRQA 1RFAA 4KKJA 2W55A 3PRZA 1C78A 3N1ZC 4TUUA 4ZHOA 4NY0A 3BINA 3U7ZA 3H6NA 2K1FA 4ZRKA 1C4PA 4C7YA 1IBXB 2M19A 1WM2A 1YD8U 1T0YA 3A9KA 2MX2A 5HHDG 1D5ZC 3SU8X 1FD6A 2WQYB 3CF6E 3Q6BA 2KYWA 1JWBD 1KFYB 2RDBC 4P6VF 2MJ3A 3N30A 2IO2B 4BOZB 3VUXA 3ONSA 1B1ZA 2B3AA 3AU5A 2KJ6A 2QIEB 3CWIA 3PZ8A 4YL8A 1C77A 1YX5B 2LGSA 2WXJA 1J7BA 2PVGC 3A9KB 1EF1A 2HE7A 3PS6A 1WF9A 2RD0A 3PZDA 4XC2A 3BY4B 2NTTA 4HXDA 1TJEA 4C4VA 4RM8A 4TQ1A 3V62A 3KYDD 1EM7A 2LVOA 2LMCA 4GDKA 4M00A 3QWZB 5EE9A 3PREA 2K8BA 2DAJA 2XNAC 2K5PA 2D3BA 2L1AA 2WX0A 3C8YA 1UF0A 2CHWA 2JYTA 4L1BA 2M56B 3RZFA 1JALA 4ASWC 2B76B 1ZW7A 1BT0A 2NPTB 2AQ2B 1U4AA 3APCA 4IWOA 4NNJB 4HJGE 2D2QA 1MI0A 1HZ5A 4GDLB 2BKRB 2INDC 1UBQA 2JU6X 3BVMA 4XYCA 4RNAA 1VLBA 1GG3A 4IC7B 2CS4A 4AJYB 1CJEA 1LGRA 4JE3B 1HEZE 3V60A 2KDMA 2M17A 3KH0A 1ZUD2 5CTRC 1FFVA 4MJSB 1ZE3D 3UQBA 3GE3C 1Z5SB 3LDZE 1TKYA 1QT9A 1QOGA 2FIFA 1DYQA 4GN1A 1Y56A 2WXFA 1Z2MA 3ZNID 1SBBB 2GBNA 2ZZPB 3BK2A 2REXA 4MM3B 2HJ8A 4GOCA 3ZTCA 3AE4B 4WWMA 1VZ6A 4YSZB 2INNE 5EE0A 3GZNB 3R8BA 4DDGD 2KD0A 4TMAB 5MPOA 2KDBA 2FCNA 2JY6A 2PIAA 2PJHA 5JH5C 5JHBA 3ABVB 5H8YE 4KZ0A 3DWMA 3ZQ4A 1TTNA 3H1UA 1J0GA 1RYJA 2IO1B 2ZCCA 3B2GA 4F1SA 2LGYA 1X1MA 4IG7B 2L7RA 2RDHA 3OAWA 2AWTA 3TBLD 5AUKA 4MDKE 1F0ZA 2CR5A 1YMHE 3L10B 1QOFA 3VH4B 3ML8A 3MC8A 3ZLZA 1R4NB 2XK5A 4RM9A 4IOIE 4CYEA 2VZKD 1VZ8A 3AULA 2ZCBA 2VZKB 1H4RA 1STEA 4II3B 2KTRB 2H89B 1HE8A 1PFDA 2ACZB 4IWPA 3IT6B 2PEAA 3NVWA 4G3XB 2BYTA 2CJOA 5E6NA 1TS5A 1TS2A 1IPGA 1QOBA 2DZJA 3ZRFA 3WA0A 3N9YC 1K52A 3JYUA 2N1WA 2C9WB 3ZIMA 4D2KA 3AN1A 3ZNHB 4MGZE 4I6LB 1XF5L 2DBYA 2M1MA 4WJQA 2DYBA 2YEPB 2KWDA 3AEGB 1P7FA 3GB1A 1WJ4A 2INPE 4RGTA 1WY8A 2KAJA 4W9CA 5BYQA 3ZRCA 2EMTA 2JF5A 1P0RA 2MBOA 1GJZA 1ET6A 1TY2A 2G1EA 4E3CA 2QILA 1V5OA 4KDIC 3H8HA 2JSVX 4XWTA 2Y5CA 3NJTA 3NZUA 1T3QA 3U4EG 3QQ8B 4KKIA 3AE6B 1TKGA 2ZEQA 2BVCA 3AB5A 2JVCA 3B2FA 2KMMA 3R3MA 1F9JA 2MP2A 4ZDVA 1WMHB 4BAXA 3Q69A 2KVRA 1S3SG 5BMHA 1WH3A 4KV2A 3H7SA 2FNJB 4HPMB 3U7DA 2N4FA 3A9JB 4IM3A 3LYYA 2DX5B 4FHJA 3U8ZA 3UQAA 2MQJA 2NVUI 1R7SA 2LZ6A 4MEMA 4PK1A 1Q10A 1UZXB 5J18A 3APFA 3N20C 2KJRA 3HM6X 2IYDB 4JQWC 4N59A 3NHEB 4KGRA 3ZVVA 3N1YC 3AU4A 4LDTB 2BKFA 1E7VA 1ZXHA 2OOBB 2K0PA 2W54A 1SE9A 5D6JB 3HVZA 1WXQA 3TL5A 5HFYA 2GOWA 3ETRA 5DPSA 2GMIC 2O2VA 3TEZA 3EA6A 3AEDB 2MRPA 2QC8A 4HRSA 2XK5B 1IP9A 2C7MB 2IGHA 1EUVB 3OG5A 3PRPB 1P98A 5AUIA 1ZDXA 5C3JB 3A33B 3VXWA 2BYEA 3ZJVA 4EZJA 4ITKA 4C56C 1J19A 1L0VB 5JXVA 4OVZA 1TBEA 1G6JA 1VDVA 3L54A 4LCDE 1JRPA 1R4MI 2BGFA 4W9IA 4K7UA 1JMLA 2Y5PA 4ARIA 2PTLA 2QHOA 1K8RB 1XO3A 2DLBA 3PHXB 1QQRA 2ICIA 3RYTA 3ZGZA 3AEFB 3QAQA 4CO7A 2KX0A 5HKHA 2BB5A 3I5JC 2AYOB 2G4SA 1EU4A 1WJNA 4GDKB 3DWGC 3M95A 1SGHA 1L4ZB 4W9EA 3ZNZB 2V9HA 3ZXRA 3DVGX 3TJPA 1OQYA 2I1JA 3Q8CA 2N9KA 2DYMA 3I57A 3KW5B 2KWUB 1GC7A 2V0GA 4XX5A 3RMKC 2SEBD 1OEYA 3DBLB 4LNOA 1MG8A 1SIFA 2MWSB 4FN2A 4DXAB 4DXGA 5L95C 5J2RA 1L0YB 5H92C 4NPNA 3UGBB 2CKHB 3ECIA 2NCNA 2WXMA 1C76A 2LUEA 3VTUA 4PT5A 4FA6A 1QOAA 4KGTA 2BYFA 3X23A 4EOYA 3D32A 1P3QU 3AE7B 2DENB 4RF0A 3Q3JA 3ML9A 3ZUNA 3SFEB 2E3TA 5IP4D 1UELA 3SHQA 4NAWB 2RPVA 1NEKB 3HVDA 4W9LA 3T9LA 2KFJA 5AEKB 4NAWA 5GXGB 1IYFA 2N9XA 2VH1A 3B9JA 4C7ZA 1UWMA 2FBWB 2FCQA 1E8XA 2D3GA 4FBJB 2V3NA 1I4QA 3GS2A 3FILB 3RD2A 1C1YB 2PE9A 1PGAA 3H7PA 4NQLB 3AEEB 2NS5A 5DPWA 2DHZA 2MLBA 2WGSA 4W9DA 3W1SC 4CQNA 2OHFA 4MM3A 3NVYA 3J9CA 3MHSD 4P16A 5G5HA 3Q8EA 3P4SB 1UGMA 2Z0EB 2M0XA 2MJEA 3CSFA 3ZTDA 2NTSA 4PYZA 1D3ZA 3A4SC 4AS1A 3P4RB 4KDLB 4B0EA 4RF1A 1SF0A 2K39A 3WANA 1SJHD 2FCSA 3VRBB 2WU2B 3E9SA 3UIOB 2IY0B 4YWGG 1V1PA 2ZJDA 5C23A 1KRHA 1E10A 4AQ7A 3NVVA 2GLSA 2ONQA 4MH8A 3PLVA 4M8MA 4HVBA 2J0KA 3AM9A 1J7AA 1FXIA 3Q8BA 3DCGA 1XCQL 3M63B 2N7DA 2M8SA 4BOSC 3SDLC 1C3TA 2LGIA 3AI5A 1EF5A 1ZXIA 1HZ6A 1V5TA 3P4QB 4JWSC 3MC9A 3N3KB 4Q2JA 4ZRPA 2OJRA 2KHWB 5E6PA 1KJTA 3VH3B 3ZNGC 2L00B 5JHAA 5KHOA 1AWDA 2FIDA 1R4MB 2QDFA 3MHZA 3EHVA 4S0RA 2L0TA 5LXIB 2HTME 4A9AA 4KSLC 2KNBA 1PDXA 2N9PC 1WXSA 4EUTA 2BQQA 2LFIA 5T8IA 5IOIA 1AYFA 1MHXA 4GDLA 5FKAC 1WRIA 4WWPA 2ZW0A 1FMAD 3EFCA 3M62B 1UWXA 1WFYA 3PHWB 1TZOA 4RGOS 4RGNA 2XEWA 3OWEB 4A20A 2EELA 4IDIA 1KH0A 2PMVA 1YQ4B 3L4PA 1JCKB 2XBBC 2PE6B 4YSXB 2BS4B 2CHXA 2IZVB 2IGGA 3ZW3A 1NDDA 3LB8C 1FNWA 4R3DA 4C4VB 1RRBA 1WYGA 4HCPB 2KWCA 4XZ4A 2L83A 3BIID 2W82A 3Q8AA 3AE2B 4F7ZA 4IWQA 2LASA 4LNKA 4ZYNA 2MH7A 4PS7A 4IM0A 4DHJD 5FR3A 3ZO5B 5BYRA 5TR5A 2ZNVB 3VTWA 4QAYA 1NYRA 4DK5A 2GI9A 1ISNA 3ALBA 1E7UA 2FCMA 4LDTD 1E9MA 5AZHA 2N0SB 4ANUA 3AE9B 1SE2A 3KWVA 3T8MA 2HD5B 5G55A 1WR1A 1GB4A 1ET9A 1FXAA 2N7JA 3HHMA 2AQ3B 1V80A 2ON8A 4HWIB 5IAAC 3SR6A 1V1PB 3I3TB 2WXGA 4M0WB 1GOZA 2LEKA 1J7CA 3K9PB 5CHFA 4AWJA 3PVLA 1YNTE 2DWQA 4NJCA 1WX8A 1S1QB 1ZGUB 4CHKA 5IO9A 1D5XC 4XGAB 3L13A 1VD2A 3O13A 1FFUA 3R2IA 1ROEA 3B0AA 1ACCA 4MACA 4S17A 1XQQA 1FEHA 1MPEA 3KYCD 1C9FA 3VQIA 2J0MA 1WGRA 3PRMB 1L6UA 4ARCA 1N63A 3ZXVA 1UUPA 2KDEB 4WAFA 2J7QB 3PTFC 1M94A 4GU2A 4ZRJA 1YX6B 4RH6A 1FNUA 4NAMA 4TSSA 3W9CB 2KWVB 2JX5A 2WDTB 1E7PB 2KK8A 3AV8A 2MBEA 4JL9A 1F77A 1TYGB 3WIMA 1DOYA 1Y8RC 2WS3B 4US8A 4M02A 4E74A 2RDGA 4PS8A 4K1RB 4HEA1 4RMAA 2K9XA 4YTNB 2CJNA 1WYWB 4EEWA 2KC1A 1KLGD 5D2MB 1JQ4A 1WGKA 2O2VB 2MHJA 1KLUD 4J6IA 1ZKHA 2Z8LA 4XDCA 4BKTA 4FADA 2BYVE 3L16A 1V2YA 4MT5A 3V05A 2C5LC 3GE8C 2MW5A 4GGQA 4AOFA 2KN5A 1HXYD 2X38A 1HTOA 4MH0E 1SIJA 3DPDA 2X8XX 3P42A 1XLQA 1YJ1A 1XCTL 4IUMB 3AE1B 3NUHB 3RNEC 3VRAB 2JWZA 3AE3B 3RZWC 5IKCM 3CSTA 5CX3A 4L2YA 2LUMA 2LI5A 2KQSA 5L83A 4XDDA 4WJNA 1V6EA 4A3PA 3DHGC 4RGMA 4JGHB 5BMGA 3MP9A 4C80A 1T0SC 3SEBA 4GSWA 1WRDB 2WU5B 3JVZX 2GB1A 4OW0A 4KX6B 4WAAA 3CMMB 3KLSX 2KDIA 4K7WA 5AZGA 2OJWA 3L0WB 4DQOC 4GIVA 5BYSA 3NZ3A 3PLUA 3SD5A 2QSDA 3DBHI 3PZ7A 3OJ3A 2HJ1A 3QJZA 4I6PA 3QC8B 3K9OB 2INCC 4DHJB 1UH6A 1WE7A 2LWPA 1B9RA 4JLCA 1N61A 3DVNU 4BBNC 2FUG1 3NS1A 2BW2A 3NZSA 1SXTA 1BUIC 2NBUA 1N62A 2KX3A 1OFFA 4A55A 2L3ZA 4M01A 3O65B 2KACA 1YQBA 4H2AA 1OQQA 3FILA 1P1AA 3I63C 1UD7A 3Q3NC 2MCNB 2G4DB 1V81A 1BXTA 2AL6A 4B95A 1SE4A 2KXJA 3ZDMC 1FXTB 2R2QA 5BMIA 2HDEA 3C0RB 4MGYE 1QILA 4B6WA 4OZAA 5CHWA 2WWZA 1P9DU 3KQ4A 1F52A 2JXXA 2PPHA 1OQRA 2KZRA 3KWLA 3UF8A 4K7SA 1I4GA 2MSED 1VR9A 4MSQB 3GP7A 1I4RA 4KIKA 2LD9A 2KN4A 3BVGA 3NRZA 2CHZA 2N7EA 2LJIA 2RGFA 3KUDB 4MGIE 2UU7A 1L6VA 3AECB 2LXCA 3IVFA 1YN4A 3W5UB 1MJDA 2L52A 2BS3B 3VVWB 3AH7A 2KQ4X 1YOVB 3W1YA 1Q0WB 1MVKA 3QA8A 1EU3A 2K3UA 4KSKC 3PSEB 2KMCA 3DHIC 1WGDA 2JYEA 4B0MA 4HDOA 3VAWA 2IGDA 2EMSA 1MHHE 4GMVA 2MA9B 1LM8B 2D3AA 1E8ZA 1P7EA 4LLGM 2VH2A 3IAS1 5HG2A 4ICVA 3QX1A 2CU3A 3A4RA 2V4IB 4KIKB 1R4NI 2IO3B 2C7NB 2MBHA 3EUB2 4BKGA 4BVUC 4WQMA 1ESFA 2L05A 5D3IB 1TY0A 3ZDTA 3PPAA 3TEWA 4N9F4 5C2TB 2D07B 2UWQA 3RNCC 4TQ0A 2L8JA 4F8CB 1VRAB 4FXCA 3URYA 2DNFA 2J53A 1I4HA 2BBCA 2GBJA 2BB6A 1D5MC 1KM7A 5LLIA 2V4LA 3DDCB 4M8NA 5EE3A 2W9NA 4P1BC 4NJ7A 2DZIA 2R61A 1QLBB 3A1QB 2WXQA 1OGWA 1N6ZA 2WDQB 2DYOA 2JPHA 2C7HA 1IUEA 3BWUD 3W2DA 4ZOHC 4BFRA 1WXMA 1WMHA 2W3SA 2MP2B 3DVNV 2MBQA 1WJ6A 4WJPA 4OHJA 1F1HA 1NENB 3VUYA 4BBNF 2Z59B 2ASQA 1N5XA 1A70A 3P2BA 4MELA 3IFWB 4JPSA 3DBRI 4KZCA 4ZYSA 1VJKA 2AQ1B 1FNVA 1N60A 1D4BA 4AP4C 1FCLA 2JRHA 2WXNA 4KGSA 4EZKA 2NR2A 1FIQA 4LK0M 1V1OA 1HA5A 3P4PB 4HKZE 2RR9A 1BMLC 2RSUA 2D10A 1J8CA 3DHHC 4L23A 4FJYA 2KANA 2R2OA 2WXKA 3L17A 1NI2A 2K6QA 4YTPB 1HQRD 4HROA 3NY5A 1EWCA 2EKEC 5HI1A 1PYWD 2N9LA 4A3OA 2GBKA 4OZBA 3RNFC 2WXIA 3KUZA 2KT7A 1MG4A 1YN5A 2JWUA 3X0WA 1TZ1A 2G9HD 2V1YA 4O1NA 3KVFB 4PS3A 2A4ZA 3EFUA 3I9V1 2IJ0A 4HDQA 1WX7A 3VFKA 3PV1A 2WXOA 4FHKA 3TEYA 3BYYB 4HJKA 1RFKA 3FC4A 2K22A 4BKSD 1TIFA 2WX1A 3ZJTA 1VCBA 1LFDA 4REZA 4WIPA 1JW9D 3HK0A 1V97A 3U52E 3M3JA 1K50A 2Q5WD 4DBGA 4ACFA 2CU1A 1L2NA 4KVGB 3W1SA 4HPLB 4DHZB 3MJ5A 1DOIA 5FK9C 1AW7A 2PLPA 4II2B 3TIXA 3WCQA 1FO4A 2O6VA 3QIJA 1I42A 1I7HA 2WDVB 4W9KA 4C00A 2M0AA 4LJPB 5C1ZA 3RPFC 3JW0X 3OJ4B 4J3OD 2LRWA 3DQVA 4LNFA 2L0FA 5D7GA 2LJ5A 3EGRA 5G2NA 3RNAC 2EKIA 2WXHA 3V3XA 1RLFA 3MFGA 3RFZB 1GAQB 3W5VB 2KDFB 1JWMD 2NBVB 3V6EB 4JWUC 3B08A 1WXVA 4FULA 2VRRB 1XLNA 2PKOA 2KLCA 2ZVOA 2KMAA 1T0QC 3DBLI 3SFDB 2GRIA 1WM3A 2DZKA 3U30A 3RI7C 2AX5A 3TCAA 2KLGA 2BWFA 2JZ3B 4WWOA 1MFWA 4BZAA 3A9JA 5GMVA 1WWTA 3RULA 1SJED 3WAPA 1F2RI 1QZEA 2BPSA 5D3DA 2IBIB 4FJZA 3VHTC 1A5RA 3LXFA 2NBWB 1SB3C 3AE5B 4ICUA 1L0XB 1E90A 2YVCA 3P1MA 3Q3FA 5IN7A 1C79A 3HM3A 1NBFC 3AEBB 1JRUA 3DBHB 1CK1A 3WALA 2D11A 4RFBA 1XLOA 1E5WA 4JIOU 1WZ3A 3H7PB 5CHVC 1HTQA 3Q2AC 1UNSA 3BZDB 5DCNA 2JQRB 2WNMA 2FUHB 3HRDD 2KTFA 1YJJA 2Y5BB 1IGDA 3H9DA 1LXDA 2SAKA 2K8CA 4W9JA 3AMZA 3V6CB 3GZNI 3BVZA 2RPQA 2WYQA 4A8XC 4LNNA 2JUOA 1Q1OA 2ZVNA 1LQBA 4AUQC 1F2RC 2KO3A 2IY1B 1JWUD 4NJ6A 2Y3AA 3KUCB 1H8CA 2E6XA 4EFOA 2K25A 1OEYJ 1V8CA 1L5PA 1C4CA 2WXPA 5TSSA 1SEBD 2QJLA 1WE6A 4ZHPA 2H88B 1ZDVA 3N1XC 4DDID 3ZYYX 4N6EB 4N58A 4GB9A 1QKZA 2GBMA 4W9HA 4TKNA 4AJWA 1UBIA 2JRIB 2LXAA 1ZP0B 4LTUA 1TT5B 3UI3A 1T6BX 1XEEA 1CZPA 4FJVB 1YJIA 4WWNA 1RAXA 2WXLA 2WP9B 4I6NB 3ZKJC 1WX9A 1PGBA 1TS3A 1RWSA 1WXAA 2JT4B 2KJHB 3IT4B 5IA7A 2L76A 1ZPSA 3GOEA 3AE8B 2W3RA 1E6EB 1RM6C 3S2AA 1SE3A 3EC8A 1FRRA 2PW9A 4P7IA 1YN3A 1V49A 4M0WA 1NYQA 4A6QA 1K51A 2FAZA 1LO5D 3NVZA 1DGJA 5EE1A 1E0ZA 5EDSA 5JZEB 2PVOD 2BS2B 1AN8A 3CIRB 5J17A 4A90A 2DZMA 4IKGA 4FLHA 3N32A 2O6VD 2J52A 5AZFA 1FCCC 4OZCA 2A5UA 3MJWA 2NMQA 4HCNB 3ENEA 3PGEA 4WH4A 4EE2A 2YLMA 3L08A 4ZRIA 4E71A 3APDA 2IDYA 2QCZA 4BKSA 2NPTA 1V9JA 4IM2A 3NOBA 4YSYB 1TGZB 3R66C 4X57B 2BTEA 5LXHA 4ANVA 1JWAD 3PT2B 1WGGA 2Z0DB 1ENFA 2DAFA 1KOTA 3RCZA 3PO0A 3Q14C 3NS8A 3VUWA 3RT3B 4XE0A 1I4PA 1T0RC 3TUOA 3IBEA 3EECA 2WHIA 1EO6A 1Q5WB 4OVVA 1UGJA 4WURA 2LGDA 2XN9C 1PQSA 3Q3MC 5E6OA 1GUAB 1OTRB 3IHPC 1GPXA 4XWWA 4EKUA 3BK1A 2JXTA 3B1LX 2YEPF 3RNBC 5G5GA 1M4VA 2GBRA 2O6VB 2KQ7A 3DBRB 3AEAB 3DOWA 1XD3B 1XT9B 3JSVB 4G11A 1D6EC 1JROA 2AL3A 2IPKD 5FR6A 2QMTA 4LNIA 4WJOA 2ZW1A 3C19A 3IAM1 1IBXA 3E56A 2LHEA 5I4DA 1I35A 4P1CC 3UINB 1WSPA 2TSSA 5D94A 4ANXA 4IW0A 3HUIA 1WIAA 4W9GA 1KLVA 2D5GA 4G0NB 1L7YA 4WQOB 3VDZA 2HTHA 3V61A 2K8HA 3QK0A 4EZLA 4GXBA 4HK2A 1QF6A 4DWFA 2KOXA 2ZPNA 1I4XA 3MC0B 2ZPYA 1WZ0A 3IG3A 1L4DB 4JX1C 1V86A 3R2TA 4NQKE 4K3BA 3ZJUA 2LVQA 1DOXA 4HKQA 2UYZB 4DHZE 3T3NA 1WGYA 2G3QB 1GNUA 1TKEA 2KC2A 4YT0B 4NZLB 2I38A 3TEXA 3JSVA 3AXCA 3Q3OC 2N1VA 3A1QA 3DVGY 1IGCA 4USAA 1YIWA 4HLEA 2KFKB 3HIZA 1PUTA 2BWES 1WR6E 1NVID 1CMXB 2G45B 2V3PA 3RNGC 1C4AA 1AARA 1N5WA 4TV3A 4MSMB 3VR8B 2I1KA 2LVPA 3FAHA 2JZZA 2J0JA 2BF8B 4DXFA 3IXSA 4UDUC 2KTRA 5DPRA 2LHDA 2QEJC 4YTMB 2MBBB 3RN9C 3RUIB 3NG0A 2KFKA 3TSSA 2WLBA 2I2YA 3OLMD 4RCOA 4B9KA 2V3SA 4URKA 1GC6A 1WJUA 2KKCA 1FM0D 4US9A 1NI3A 3FKYA 2M4NA 1FPYA 3Q8FA 3QHTA 3WAMA 1VZ7A 2RMMA 1KTKA 4HPPA 2ZNVC 1KF6B 3U2SC 4ANWA 2J42A 2D3CA 4MGKE 1K53A
chains in the Genus database with same CATH topology
2MEKA 3SFDB 1JRPA 2GRIA 3AE1B 3NUHB 1JMLA 3VRAB 2Y5PA 4ARIA 2PTLA 1XO3A 2AX5A 2DLBA 2WDRB 4YXDB 3P63A 1QQRA 3AE3B 2BT6A 2ICIA 3ZGZA 1PGXA 1SSNA 2FE8A 5LNK1 2J4XA 3BYTB 4L2YA 1WWTA 3AEFB 1XXGA 2LUMA 4GLSC 1SJED 1ZOYB 2WXRA 4XDDA 1F2RI 2BB5A 4RGMA 3VR9B 5D3DA 5BMGA 3MP9A 4C80A 1EU4A 1EWYC 4GDKB 1XLPA 3DWGC 3LXFA 5E6JA 1CQVA 3AE5B 1SB3C 3SEBA 1L0XB 1TS4A 2JZPA 2WU5B 2GB1A 2L32A 1L4ZB 3P1MA 1JWSD 1C79A 4OW0A 4KX6B 3KLSX 3AEBB 1FRDA 4DQOC 1CK1A 4RFBA 2MJDA 1XLOA 2OEDA 3Q8CA 5BYSA 2N9KA 2DYMA 3I57A 3NZ3A 3T3OA 2QSDA 2V0GA 1YQ3B 3PZ7A 2SEBD 1T5XD 1UNSA 1GB1A 3BZDB 2JQRB 2WNMA 3HRDD 4ZRQA 4DXGA 4KKJA 1YJJA 1L0YB 1IGDA 5H92C 1B9RA 2W55A 1C78A 2SAKA 1N61A 3AMZA 4ZHOA 2FUG1 3NS1A 2BW2A 2WXMA 3BVZA 1C76A 1SXTA 1BUIC 3U7ZA 4PT5A 4A8XC 1N62A 1QOAA 4KGTA 1C4PA 4C7YA 1IBXB 1OFFA 4A55A 2M19A 1F2RC 2KACA 4H2AA 1OQQA 3FILA 3AE7B 1JWUD 5HHDG 2Y3AA 4RF0A 2E6XA 1D5ZC 1FD6A 2WQYB 3SFEB 1JWBD 1L5PA 2E3TA 1V8CA 1KFYB 1C4CA 2WXPA 4P6VF 2MJ3A 1BXTA 4NAWB 2RPVA 1NEKB 1SE4A 3HVDA 5TSSA 1SEBD 2QJLA 4ZHPA 5GXGB 2H88B 3B9JA 5BMIA 2HDEA 1ZDVA 1QILA 4C7ZA 1B1ZA 1UWMA 2FBWB 4OZAA 2QIEB 3CWIA 3PZ8A 3ZYYX 4N6EB 4N58A 1C77A 1QKZA 2WXJA 1J7BA 3KQ4A 2V3NA 2PVGC 1I4QA 3GS2A 3FILB 1OQRA 1PGAA 3KWLA 3AEEB 1ZP0B 2NTTA 4LTUA 1I4GA 3UI3A 4CQNA 2OHFA 1T6BX 1VR9A 3NVYA 1TJEA 3GP7A 1XEEA 1CZPA 1YJIA 1I4RA 3J9CA 4P16A 5G5HA 2WXLA 3Q8EA 2KN4A 3P4SB 3BVGA 4TQ1A 1EM7A 2WP9B 3NRZA 2LMCA 1PGBA 1TS3A 1RWSA 2LJIA 3IT4B 5EE9A 2MJEA 2NTSA 2XNAC 1ZPSA 4AS1A 3P4RB 2K5PA 2L1AA 2W3RA 1SF0A 3AE8B 4RF1A 3C8YA 1L6VA 2JYTA 4B0EA 1E6EB 1RM6C 1SJHD 3AECB 4L1BA 1YN4A 2M56B 3W5UB 1SE3A 2L52A 2BS3B 1JALA 1FRRA 2B76B 3AH7A 2KQ4X 3VRBB 2PW9A 2WU2B 3E9SA 1YN3A 2AQ2B 4YWGG 1MVKA 4HJGE 1EU3A 2K3UA 4M0WA 1NYQA 1V1PA 4A6QA 1K51A 1KRHA 1E10A 4AQ7A 1LO5D 3NVVA 3NVZA 2JYEA 1MI0A 1DGJA 4B0MA 1HZ5A 2ONQA 4MH8A 5EE1A 4GDLB 1E0ZA 2JU6X 3BVMA 2PVOD 4RNAA 2BS2B 1AN8A 1VLBA 3CIRB 2IGDA 3AM9A 1J7AA 1MHHE 1CJEA 1FXIA 3Q8BA 4JE3B 1HEZE 4A90A 4IKGA 1XCQL 2KDMA 2LGIA 2J52A 1ZXIA 1HZ6A 3P4QB 1FCCC 4OZCA 4JWSC 1ZUD2 4ZRPA 1FFVA 4Q2JA 2NMQA 1ZE3D 1P7EA 4LLGM 3IAS1 5HG2A 1TKYA 1QT9A 1QOGA 1DYQA 4WH4A 4EE2A 1Y56A 2WXFA 2CU3A 1SBBB 2V4IB 1AWDA 3EUB2 2IDYA 3BK2A 4WQMA 1ESFA 5D3IB 3MHZA 4MM3B 1TY0A 3TEWA 3AE4B 5C2TB 4WWMA 1VZ6A 4YSZB 2INNE 4TQ0A 2HTME 5EE0A 4A9AA 4YSYB 3R8BA 1PDXA 1VRAB 4TMAB 4FXCA 5MPOA 3URYA 2J53A 2LFIA 1I4HA 2BTEA 5T8IA 2BBCA 1JWAD 2PIAA 1AYFA 2BB6A 1D5MC 3ABVB 5H8YE 1ENFA 3DWMA 3ZQ4A 5EE3A 1MHXA 5FKAC 1WRIA 3PO0A 2ZW0A 1FMAD 1UWXA 4XE0A 1RYJA 2R61A 1QLBB 1TZOA 4RGNA 4RGOS 1I4PA 3TUOA 3OWEB 3B2GA 2EELA 2WXQA 4IDIA 2RDHA 1UGJA 1KH0A 4WURA 2PMVA 2WDQB 2XN9C 1YQ4B 3L4PA 5AUKA 1F0ZA 1YMHE 2DYOA 1JCKB 1IUEA 1QOFA 3BWUD 3W2DA 4ZOHC 1GPXA 4XWWA 4YSXB 2W3SA 2BS4B 3BK1A 2JXTA 2IGGA 2YEPF 5G5GA 4IOIE 1M4VA 4OHJA 3LB8C 1FNWA 2VZKD 4R3DA 1VZ8A 1K53A 1NENB 2VZKB 1WYGA 1STEA 1N5XA 3AEAB 1A70A 2H89B 2L83A 3BIID 2W82A 3Q8AA 3AE2B 1PFDA 2MH7A 2ACZB 1D6EC 1JROA 3IT6B 5FR3A 4JPSA 3NVWA 5BYRA 2BYTA 2CJOA 4ZYSA 2IPKD 1NYRA 2GI9A 2QMTA 1VJKA 2AQ1B 1FNVA 1TS5A 2ZW1A 1TS2A 1N60A 3IAM1 1D4BA 1IBXA 3E56A 1QOBA 2LHEA 5I4DA 1E9MA 1FCLA 2N0SB 3N9YC 1K52A 2WXNA 4KGSA 3AE9B 1SE2A 1WSPA 2TSSA 3KWVA 1FIQA 4LK0M 1V1OA 4D2KA 1GB4A 1ET9A 1FXAA 3AN1A 2N7JA 1HA5A 3HUIA 3P4PB 1XF5L 2DBYA 4HKZE 2AQ3B 1BMLC 2ON8A 3SR6A 1V1PB 2D5GA 2YEPB 2WXGA 2KWDA 1GOZA 2LEKA 1J7CA 3AEGB 1P7FA 1YNTE 2DWQA 4L23A 4NJCA 3GB1A 2INPE 2WXKA 1D5XC 4RGTA 2KAJA 4YTPB 3O13A 5BYQA 1FFUA 1HQRD 3R2IA 1ROEA 1QF6A 1ET6A 1TY2A 2G1EA 2QILA 4HROA 1ACCA 3H8HA 4MACA 1EWCA 2JSVX 4XWTA 5HI1A 2Y5CA 1I4XA 1PYWD 3MC0B 2N9LA 1T3QA 3U4EG 1FEHA 1MPEA 4OZBA 1C9FA 1L4DB 3AE6B 1TKGA 4KKIA 3VQIA 1L6UA 2WXIA 1N63A 4JX1C 4ARCA 3AB5A 3R2TA 3B2FA 1UUPA 2KMMA 4WAFA 3ZJUA 1DOXA 4HKQA 4RH6A 1FNUA 1YN5A 2JWUA 3Q69A 4NAMA 5BMHA 2G9HD 4TSSA 3W9CB 4O1NA 3T3NA 1TKEA 3I9V1 4YT0B 2IJ0A 3LYYA 2JX5A 4NZLB 1E7PB 2I38A 3TEXA 3AV8A 2WXOA 3TEYA 3BYYB 1R7SA 1RFKA 1F77A 1IGCA 1Q10A 1TYGB 2K22A 3FC4A 4USAA 1DOYA 1PUTA 3ZJTA 2WS3B 4US8A 1NVID 4REZA 2V3PA 2RDGA 4WIPA 1JW9D 4N59A 1C4AA 4KGRA 1N5WA 4HEA1 2K9XA 4YTNB 1V97A 3U52E 2CJNA 1K50A 2Q5WD 1ZXHA 3VR8B 3W1SA 2K0PA 2W54A 1KLGD 3FAHA 3MJ5A 1JQ4A 4DXFA 1DOIA 1WGKA 3HVZA 3IXSA 5FK9C 1AW7A 1WXQA 4UDUC 2PLPA 5HFYA 1KLUD 2LHDA 2QEJC 4YTMB 3ETRA 3WCQA 2Z8LA 1FO4A 4XDCA 1I7HA 2WDVB 3TSSA 2WLBA 3TEZA 2I2YA 3EA6A 2M0AA 4RCOA 3AEDB 3RPFC 4MT5A 4HRSA 3V05A 1FM0D 4J3OD 4US9A 1NI3A 2IGHA 5D7GA 1HXYD 3EGRA 2EKIA 2WXHA 3V3XA 3MFGA 2X38A 3RFZB 1GAQB 3W5VB 3Q8FA 1JWMD 5AUIA 1ZDXA 1VZ7A 4JWUC 5C3JB 1SIJA 3ZJVA 2RMMA 1KTKA 3P42A 4ITKA 4C56C 1KF6B 1L0VB 1XLQA 1XLNA 2PKOA 3U2SC 5JXVA 2J42A 4OVZA 1XCTL 1VDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YSY B;  3SFD B;  1JRP A;  1PDX A;  1ROE A;  1QF6 A;  4C7Z A;  3AE1 B;  4FXC A;  2G1E A;  1UWM A;  2FBW B;  3VRA B;  5MPO A;  2QIE B;  3CWI A;  4HRO A;  3ZYY X;  4N6E B;  1XO3 A;  2AX5 A;  4N58 A;  2WDR B;  1JWA D;  2PIA A;  1AYF A;  4YXD B;  2Y5C A;  1J7B A;  3P63 A;  3AE3 B;  2BT6 A;  2PVG C;  3ABV B;  5H8Y E;  1T3Q A;  1OQR A;  1WWT A;  3AEF B;  3AE6 B;  3DWM A;  1TKG A;  5EE3 A;  1L6U A;  1N63 A;  1WRI A;  1ZOY B;  3KWL A;  3PO0 A;  3AB5 A;  4JX1 C;  3B2F A;  1FMA D;  2KMM A;  3AEE B;  1ZP0 B;  4LTU A;  1RYJ A;  1DOX A;  1QLB B;  3VR9 B;  2OHF A;  3B2G A;  4C80 A;  3NVY A;  1TJE A;  1EWY C;  1CZP A;  1XLP A;  1YJI A;  3DWG C;  3LXF A;  4IDI A;  3AE5 B;  1SB3 C;  3W9C B;  2WU5 B;  5G5H A;  2WDQ B;  5AUK A;  1YQ4 B;  3L4P A;  3P4S B;  1TKE A;  1F0Z A;  3P1M A;  4YT0 B;  2JX5 A;  2WP9 B;  1E7P B;  1IUE A;  1QOF A;  3NRZ A;  4KX6 B;  1RWS A;  3AV8 A;  3AEB B;  2H88 B;  4ZOH C;  5EE9 A;  2MJE A;  1GPX A;  1FRD A;  4YSX B;  2W3S A;  2BS4 B;  1R7S A;  1RFK A;  2MJD A;  3FC4 A;  1TYG B;  1XLO A;  2K22 A;  3P4R B;  2K5P A;  3AE8 B;  2W3R A;  1SF0 A;  4USA A;  5G5G A;  3LB8 C;  1L6V A;  1DOY A;  1E6E B;  1PUT A;  1RM6 C;  3AEC B;  3W5U B;  2M56 B;  2L52 A;  1NEN B;  2BS3 B;  1JAL A;  1WYG A;  1FRR A;  2B76 B;  3AH7 A;  3VRB B;  2WS3 B;  1YQ3 B;  4US8 A;  1N5X A;  1NVI D;  2WU2 B;  3AEA B;  1A70 A;  2H89 B;  2L83 A;  3BII D;  5EE0 A;  1NYQ A;  2JQR B;  1JW9 D;  3AE2 B;  4N59 A;  1KRH A;  3HRD D;  1PFD A;  1E10 A;  1N5W A;  3NVV A;  3NVZ A;  2K9X A;  1DGJ A;  1YJJ A;  2MH7 A;  4YTN B;  1V97 A;  5H92 C;  2ACZ B;  5EE1 A;  2CJN A;  1JRO A;  2Q5W D;  1B9R A;  1E0Z A;  2W55 A;  3NVW A;  2PVO D;  2BS2 B;  1VLB A;  2CJO A;  3CIR B;  1N61 A;  1NYR A;  3VR8 B;  3AM9 A;  1VJK A;  2HTM E;  1J7A A;  3AMZ A;  1CJE A;  2W54 A;  3FAH A;  1FXI A;  4ZHO A;  1JQ4 A;  1DOI A;  1N60 A;  1WGK A;  3HVZ A;  3NS1 A;  1WXQ A;  1QOB A;  1E9M A;  4YTM B;  2N0S B;  1N62 A;  3ETR A;  1ZXI A;  1QOA A;  3AE9 B;  3P4Q B;  3WCQ A;  4JWS C;  1FO4 A;  1ZUD 2;  1FFV A;  4C7Y A;  1I7H A;  1OFF A;  2WDV B;  2WLB A;  1FIQ A;  2M19 A;  4YTP B;  1FXA A;  3AED B;  3AN1 A;  1TKY A;  1QT9 A;  3RPF C;  4HRS A;  1OQQ A;  3HUI A;  3P4P B;  1QOG A;  1FM0 D;  2DBY A;  4US9 A;  3AE7 B;  2CU3 A;  3SR6 A;  1NI3 A;  1AWD A;  2EKI A;  2LEK A;  1J7C A;  2WQY B;  3AEG B;  3EUB 2;  3SFE B;  1GAQ B;  3W5V B;  1JWB D;  1L5P A;  1V8C A;  2DWQ A;  1KFY B;  2E3T A;  4JWU C;  4WQM A;  4P6V F;  1SIJ A;  2MJ3 A;  3AE4 B;  5AUI A;  5C3J B;  5C2T B;  4WWM A;  4ITK A;  1KF6 B;  1L0V B;  1NEK B;  1XLQ A;  1XLN A;  2PKO A;  2QJL A;  4YSZ B;  4ZHP A;  2KAJ A;  5GXG B;  1VDV A;  4A9A A;  1FFU A;  3B9J A; 
#chains in the Genus database with same CATH topology
 2K6D B;  1WI0 A;  2MEK A;  3DBS A;  3R7R A;  3LJ3 A;  4G50 A;  4OVU A;  2WDR B;  1E8W A;  2IO0 B;  4W9F A;  3TMP B;  3P63 A;  4YXD B;  2BT6 A;  1PGX A;  1SSN A;  2FE8 A;  5LNK 1;  2J4X A;  3BYT B;  1E8Y A;  1XXG A;  4GLS C;  2LRU A;  1ZOY B;  3MTN B;  2WXR A;  2N9E B;  3QCA A;  3UIP B;  3R7Q A;  2AEH A;  3VR9 B;  4LJO B;  2C60 A;  1EWY C;  3QAR A;  1XLP A;  5E6J A;  1CQV A;  4PYU A;  1TS4 A;  2JZP A;  2KVZ A;  2L32 A;  1JWS D;  1WGH A;  4K3C A;  1FRD A;  2MJD A;  3VTV A;  3WAO A;  2OED A;  4MJS A;  5KHQ A;  3T3O A;  4K81 A;  2LGX A;  5BO4 B;  1YQ3 B;  5DPT A;  1T5X D;  1GB1 A;  4ZRQ A;  1RFA A;  4KKJ A;  2W55 A;  3PRZ A;  1C78 A;  3N1Z C;  4TUU A;  4ZHO A;  4NY0 A;  3BIN A;  3U7Z A;  3H6N A;  2K1F A;  4ZRK A;  1C4P A;  4C7Y A;  1IBX B;  2M19 A;  1WM2 A;  1YD8 U;  1T0Y A;  3A9K A;  2MX2 A;  5HHD G;  1D5Z C;  3SU8 X;  1FD6 A;  2WQY B;  3CF6 E;  3Q6B A;  2KYW A;  1JWB D;  1KFY B;  2RDB C;  4P6V F;  2MJ3 A;  3N30 A;  2IO2 B;  4BOZ B;  3VUX A;  3ONS A;  1B1Z A;  2B3A A;  3AU5 A;  2KJ6 A;  2QIE B;  3CWI A;  3PZ8 A;  4YL8 A;  1C77 A;  1YX5 B;  2LGS A;  2WXJ A;  1J7B A;  2PVG C;  3A9K B;  1EF1 A;  2HE7 A;  3PS6 A;  1WF9 A;  2RD0 A;  3PZD A;  4XC2 A;  3BY4 B;  2NTT A;  4HXD A;  1TJE A;  4C4V A;  4RM8 A;  4TQ1 A;  3V62 A;  3KYD D;  1EM7 A;  2LVO A;  2LMC A;  4GDK A;  4M00 A;  3QWZ B;  5EE9 A;  3PRE A;  2K8B A;  2DAJ A;  2XNA C;  2K5P A;  2D3B A;  2L1A A;  2WX0 A;  3C8Y A;  1UF0 A;  2CHW A;  2JYT A;  4L1B A;  2M56 B;  3RZF A;  1JAL A;  4ASW C;  2B76 B;  1ZW7 A;  1BT0 A;  2NPT B;  2AQ2 B;  1U4A A;  3APC A;  4IWO A;  4NNJ B;  4HJG E;  2D2Q A;  1MI0 A;  1HZ5 A;  4GDL B;  2BKR B;  2IND C;  1UBQ A;  2JU6 X;  3BVM A;  4XYC A;  4RNA A;  1VLB A;  1GG3 A;  4IC7 B;  2CS4 A;  4AJY B;  1CJE A;  1LGR A;  4JE3 B;  1HEZ E;  3V60 A;  2KDM A;  2M17 A;  3KH0 A;  1ZUD 2;  5CTR C;  1FFV A;  4MJS B;  1ZE3 D;  3UQB A;  3GE3 C;  1Z5S B;  3LDZ E;  1TKY A;  1QT9 A;  1QOG A;  2FIF A;  1DYQ A;  4GN1 A;  1Y56 A;  2WXF A;  1Z2M A;  3ZNI D;  1SBB B;  2GBN A;  2ZZP B;  3BK2 A;  2REX A;  4MM3 B;  2HJ8 A;  4GOC A;  3ZTC A;  3AE4 B;  4WWM A;  1VZ6 A;  4YSZ B;  2INN E;  5EE0 A;  3GZN B;  3R8B A;  4DDG D;  2KD0 A;  4TMA B;  5MPO A;  2KDB A;  2FCN A;  2JY6 A;  2PIA A;  2PJH A;  5JH5 C;  5JHB A;  3ABV B;  5H8Y E;  4KZ0 A;  3DWM A;  3ZQ4 A;  1TTN A;  3H1U A;  1J0G A;  1RYJ A;  2IO1 B;  2ZCC A;  3B2G A;  4F1S A;  2LGY A;  1X1M A;  4IG7 B;  2L7R A;  2RDH A;  3OAW A;  2AWT A;  3TBL D;  5AUK A;  4MDK E;  1F0Z A;  2CR5 A;  1YMH E;  3L10 B;  1QOF A;  3VH4 B;  3ML8 A;  3MC8 A;  3ZLZ A;  1R4N B;  2XK5 A;  4RM9 A;  4IOI E;  4CYE A;  2VZK D;  1VZ8 A;  3AUL A;  2ZCB A;  2VZK B;  1H4R A;  1STE A;  4II3 B;  2KTR B;  2H89 B;  1HE8 A;  1PFD A;  2ACZ B;  4IWP A;  3IT6 B;  2PEA A;  3NVW A;  4G3X B;  2BYT A;  2CJO A;  5E6N A;  1TS5 A;  1TS2 A;  1IPG A;  1QOB A;  2DZJ A;  3ZRF A;  3WA0 A;  3N9Y C;  1K52 A;  3JYU A;  2N1W A;  2C9W B;  3ZIM A;  4D2K A;  3AN1 A;  3ZNH B;  4MGZ E;  4I6L B;  1XF5 L;  2DBY A;  2M1M A;  4WJQ A;  2DYB A;  2YEP B;  2KWD A;  3AEG B;  1P7F A;  3GB1 A;  1WJ4 A;  2INP E;  4RGT A;  1WY8 A;  2KAJ A;  4W9C A;  5BYQ A;  3ZRC A;  2EMT A;  2JF5 A;  1P0R A;  2MBO A;  1GJZ A;  1ET6 A;  1TY2 A;  2G1E A;  4E3C A;  2QIL A;  1V5O A;  4KDI C;  3H8H A;  2JSV X;  4XWT A;  2Y5C A;  3NJT A;  3NZU A;  1T3Q A;  3U4E G;  3QQ8 B;  4KKI A;  3AE6 B;  1TKG A;  2ZEQ A;  2BVC A;  3AB5 A;  2JVC A;  3B2F A;  2KMM A;  3R3M A;  1F9J A;  2MP2 A;  4ZDV A;  1WMH B;  4BAX A;  3Q69 A;  2KVR A;  1S3S G;  5BMH A;  1WH3 A;  4KV2 A;  3H7S A;  2FNJ B;  4HPM B;  3U7D A;  2N4F A;  3A9J B;  4IM3 A;  3LYY A;  2DX5 B;  4FHJ A;  3U8Z A;  3UQA A;  2MQJ A;  2NVU I;  1R7S A;  2LZ6 A;  4MEM A;  4PK1 A;  1Q10 A;  1UZX B;  5J18 A;  3APF A;  3N20 C;  2KJR A;  3HM6 X;  2IYD B;  4JQW C;  4N59 A;  3NHE B;  4KGR A;  3ZVV A;  3N1Y C;  3AU4 A;  4LDT B;  2BKF A;  1E7V A;  1ZXH A;  2OOB B;  2K0P A;  2W54 A;  1SE9 A;  5D6J B;  3HVZ A;  1WXQ A;  3TL5 A;  5HFY A;  2GOW A;  3ETR A;  5DPS A;  2GMI C;  2O2V A;  3TEZ A;  3EA6 A;  3AED B;  2MRP A;  2QC8 A;  4HRS A;  2XK5 B;  1IP9 A;  2C7M B;  2IGH A;  1EUV B;  3OG5 A;  3PRP B;  1P98 A;  5AUI A;  1ZDX A;  5C3J B;  3A33 B;  3VXW A;  2BYE A;  3ZJV A;  4EZJ A;  4ITK A;  4C56 C;  1J19 A;  1L0V B;  5JXV A;  4OVZ A;  1TBE A;  1G6J A;  1VDV A;  3L54 A;  4LCD E;  1JRP A;  1R4M I;  2BGF A;  4W9I A;  4K7U A;  1JML A;  2Y5P A;  4ARI A;  2PTL A;  2QHO A;  1K8R B;  1XO3 A;  2DLB A;  3PHX B;  1QQR A;  2ICI A;  3RYT A;  3ZGZ A;  3AEF B;  3QAQ A;  4CO7 A;  2KX0 A;  5HKH A;  2BB5 A;  3I5J C;  2AYO B;  2G4S A;  1EU4 A;  1WJN A;  4GDK B;  3DWG C;  3M95 A;  1SGH A;  1L4Z B;  4W9E A;  3ZNZ B;  2V9H A;  3ZXR A;  3DVG X;  3TJP A;  1OQY A;  2I1J A;  3Q8C A;  2N9K A;  2DYM A;  3I57 A;  3KW5 B;  2KWU B;  1GC7 A;  2V0G A;  4XX5 A;  3RMK C;  2SEB D;  1OEY A;  3DBL B;  4LNO A;  1MG8 A;  1SIF A;  2MWS B;  4FN2 A;  4DXA B;  4DXG A;  5L95 C;  5J2R A;  1L0Y B;  5H92 C;  4NPN A;  3UGB B;  2CKH B;  3ECI A;  2NCN A;  2WXM A;  1C76 A;  2LUE A;  3VTU A;  4PT5 A;  4FA6 A;  1QOA A;  4KGT A;  2BYF A;  3X23 A;  4EOY A;  3D32 A;  1P3Q U;  3AE7 B;  2DEN B;  4RF0 A;  3Q3J A;  3ML9 A;  3ZUN A;  3SFE B;  2E3T A;  5IP4 D;  1UEL A;  3SHQ A;  4NAW B;  2RPV A;  1NEK B;  3HVD A;  4W9L A;  3T9L A;  2KFJ A;  5AEK B;  4NAW A;  5GXG B;  1IYF A;  2N9X A;  2VH1 A;  3B9J A;  4C7Z A;  1UWM A;  2FBW B;  2FCQ A;  1E8X A;  2D3G A;  4FBJ B;  2V3N A;  1I4Q A;  3GS2 A;  3FIL B;  3RD2 A;  1C1Y B;  2PE9 A;  1PGA A;  3H7P A;  4NQL B;  3AEE B;  2NS5 A;  5DPW A;  2DHZ A;  2MLB A;  2WGS A;  4W9D A;  3W1S C;  4CQN A;  2OHF A;  4MM3 A;  3NVY A;  3J9C A;  3MHS D;  4P16 A;  5G5H A;  3Q8E A;  3P4S B;  1UGM A;  2Z0E B;  2M0X A;  2MJE A;  3CSF A;  3ZTD A;  2NTS A;  4PYZ A;  1D3Z A;  3A4S C;  4AS1 A;  3P4R B;  4KDL B;  4B0E A;  4RF1 A;  1SF0 A;  2K39 A;  3WAN A;  1SJH D;  2FCS A;  3VRB B;  2WU2 B;  3E9S A;  3UIO B;  2IY0 B;  4YWG G;  1V1P A;  2ZJD A;  5C23 A;  1KRH A;  1E10 A;  4AQ7 A;  3NVV A;  2GLS A;  2ONQ A;  4MH8 A;  3PLV A;  4M8M A;  4HVB A;  2J0K A;  3AM9 A;  1J7A A;  1FXI A;  3Q8B A;  3DCG A;  1XCQ L;  3M63 B;  2N7D A;  2M8S A;  4BOS C;  3SDL C;  1C3T A;  2LGI A;  3AI5 A;  1EF5 A;  1ZXI A;  1HZ6 A;  1V5T A;  3P4Q B;  4JWS C;  3MC9 A;  3N3K B;  4Q2J A;  4ZRP A;  2OJR A;  2KHW B;  5E6P A;  1KJT A;  3VH3 B;  3ZNG C;  2L00 B;  5JHA A;  5KHO A;  1AWD A;  2FID A;  1R4M B;  2QDF A;  3MHZ A;  3EHV A;  4S0R A;  2L0T A;  5LXI B;  2HTM E;  4A9A A;  4KSL C;  2KNB A;  1PDX A;  2N9P C;  1WXS A;  4EUT A;  2BQQ A;  2LFI A;  5T8I A;  5IOI A;  1AYF A;  1MHX A;  4GDL A;  5FKA C;  1WRI A;  4WWP A;  2ZW0 A;  1FMA D;  3EFC A;  3M62 B;  1UWX A;  1WFY A;  3PHW B;  1TZO A;  4RGO S;  4RGN A;  2XEW A;  3OWE B;  4A20 A;  2EEL A;  4IDI A;  1KH0 A;  2PMV A;  1YQ4 B;  3L4P A;  1JCK B;  2XBB C;  2PE6 B;  4YSX B;  2BS4 B;  2CHX A;  2IZV B;  2IGG A;  3ZW3 A;  1NDD A;  3LB8 C;  1FNW A;  4R3D A;  4C4V B;  1RRB A;  1WYG A;  4HCP B;  2KWC A;  4XZ4 A;  2L83 A;  3BII D;  2W82 A;  3Q8A A;  3AE2 B;  4F7Z A;  4IWQ A;  2LAS A;  4LNK A;  4ZYN A;  2MH7 A;  4PS7 A;  4IM0 A;  4DHJ D;  5FR3 A;  3ZO5 B;  5BYR A;  5TR5 A;  2ZNV B;  3VTW A;  4QAY A;  1NYR A;  4DK5 A;  2GI9 A;  1ISN A;  3ALB A;  1E7U A;  2FCM A;  4LDT D;  1E9M A;  5AZH A;  2N0S B;  4ANU A;  3AE9 B;  1SE2 A;  3KWV A;  3T8M A;  2HD5 B;  5G55 A;  1WR1 A;  1GB4 A;  1ET9 A;  1FXA A;  2N7J A;  3HHM A;  2AQ3 B;  1V80 A;  2ON8 A;  4HWI B;  5IAA C;  3SR6 A;  1V1P B;  3I3T B;  2WXG A;  4M0W B;  1GOZ A;  2LEK A;  1J7C A;  3K9P B;  5CHF A;  4AWJ A;  3PVL A;  1YNT E;  2DWQ A;  4NJC A;  1WX8 A;  1S1Q B;  1ZGU B;  4CHK A;  5IO9 A;  1D5X C;  4XGA B;  3L13 A;  1VD2 A;  3O13 A;  1FFU A;  3R2I A;  1ROE A;  3B0A A;  1ACC A;  4MAC A;  4S17 A;  1XQQ A;  1FEH A;  1MPE A;  3KYC D;  1C9F A;  3VQI A;  2J0M A;  1WGR A;  3PRM B;  1L6U A;  4ARC A;  1N63 A;  3ZXV A;  1UUP A;  2KDE B;  4WAF A;  2J7Q B;  3PTF C;  1M94 A;  4GU2 A;  4ZRJ A;  1YX6 B;  4RH6 A;  1FNU A;  4NAM A;  4TSS A;  3W9C B;  2KWV B;  2JX5 A;  2WDT B;  1E7P B;  2KK8 A;  3AV8 A;  2MBE A;  4JL9 A;  1F77 A;  1TYG B;  3WIM A;  1DOY A;  1Y8R C;  2WS3 B;  4US8 A;  4M02 A;  4E74 A;  2RDG A;  4PS8 A;  4K1R B;  4HEA 1;  4RMA A;  2K9X A;  4YTN B;  2CJN A;  1WYW B;  4EEW A;  2KC1 A;  1KLG D;  5D2M B;  1JQ4 A;  1WGK A;  2O2V B;  2MHJ A;  1KLU D;  4J6I A;  1ZKH A;  2Z8L A;  4XDC A;  4BKT A;  4FAD A;  2BYV E;  3L16 A;  1V2Y A;  4MT5 A;  3V05 A;  2C5L C;  3GE8 C;  2MW5 A;  4GGQ A;  4AOF A;  2KN5 A;  1HXY D;  2X38 A;  1HTO A;  4MH0 E;  1SIJ A;  3DPD A;  2X8X X;  3P42 A;  1XLQ A;  1YJ1 A;  1XCT L;  4IUM B;  3AE1 B;  3NUH B;  3RNE C;  3VRA B;  2JWZ A;  3AE3 B;  3RZW C;  5IKC M;  3CST A;  5CX3 A;  4L2Y A;  2LUM A;  2LI5 A;  2KQS A;  5L83 A;  4XDD A;  4WJN A;  1V6E A;  4A3P A;  3DHG C;  4RGM A;  4JGH B;  5BMG A;  3MP9 A;  4C80 A;  1T0S C;  3SEB A;  4GSW A;  1WRD B;  2WU5 B;  3JVZ X;  2GB1 A;  4OW0 A;  4KX6 B;  4WAA A;  3CMM B;  3KLS X;  2KDI A;  4K7W A;  5AZG A;  2OJW A;  3L0W B;  4DQO C;  4GIV A;  5BYS A;  3NZ3 A;  3PLU A;  3SD5 A;  2QSD A;  3DBH I;  3PZ7 A;  3OJ3 A;  2HJ1 A;  3QJZ A;  4I6P A;  3QC8 B;  3K9O B;  2INC C;  4DHJ B;  1UH6 A;  1WE7 A;  2LWP A;  1B9R A;  4JLC A;  1N61 A;  3DVN U;  4BBN C;  2FUG 1;  3NS1 A;  2BW2 A;  3NZS A;  1SXT A;  1BUI C;  2NBU A;  1N62 A;  2KX3 A;  1OFF A;  4A55 A;  2L3Z A;  4M01 A;  3O65 B;  2KAC A;  1YQB A;  4H2A A;  1OQQ A;  3FIL A;  1P1A A;  3I63 C;  1UD7 A;  3Q3N C;  2MCN B;  2G4D B;  1V81 A;  1BXT A;  2AL6 A;  4B95 A;  1SE4 A;  2KXJ A;  3ZDM C;  1FXT B;  2R2Q A;  5BMI A;  2HDE A;  3C0R B;  4MGY E;  1QIL A;  4B6W A;  4OZA A;  5CHW A;  2WWZ A;  1P9D U;  3KQ4 A;  1F52 A;  2JXX A;  2PPH A;  1OQR A;  2KZR A;  3KWL A;  3UF8 A;  4K7S A;  1I4G A;  2MSE D;  1VR9 A;  4MSQ B;  3GP7 A;  1I4R A;  4KIK A;  2LD9 A;  2KN4 A;  3BVG A;  3NRZ A;  2CHZ A;  2N7E A;  2LJI A;  2RGF A;  3KUD B;  4MGI E;  2UU7 A;  1L6V A;  3AEC B;  2LXC A;  3IVF A;  1YN4 A;  3W5U B;  1MJD A;  2L52 A;  2BS3 B;  3VVW B;  3AH7 A;  2KQ4 X;  1YOV B;  3W1Y A;  1Q0W B;  1MVK A;  3QA8 A;  1EU3 A;  2K3U A;  4KSK C;  3PSE B;  2KMC A;  3DHI C;  1WGD A;  2JYE A;  4B0M A;  4HDO A;  3VAW A;  2IGD A;  2EMS A;  1MHH E;  4GMV A;  2MA9 B;  1LM8 B;  2D3A A;  1E8Z A;  1P7E A;  4LLG M;  2VH2 A;  3IAS 1;  5HG2 A;  4ICV A;  3QX1 A;  2CU3 A;  3A4R A;  2V4I B;  4KIK B;  1R4N I;  2IO3 B;  2C7N B;  2MBH A;  3EUB 2;  4BKG A;  4BVU C;  4WQM A;  1ESF A;  2L05 A;  5D3I B;  1TY0 A;  3ZDT A;  3PPA A;  3TEW A;  4N9F 4;  5C2T B;  2D07 B;  2UWQ A;  3RNC C;  4TQ0 A;  2L8J A;  4F8C B;  1VRA B;  4FXC A;  3URY A;  2DNF A;  2J53 A;  1I4H A;  2BBC A;  2GBJ A;  2BB6 A;  1D5M C;  1KM7 A;  5LLI A;  2V4L A;  3DDC B;  4M8N A;  5EE3 A;  2W9N A;  4P1B C;  4NJ7 A;  2DZI A;  2R61 A;  1QLB B;  3A1Q B;  2WXQ A;  1OGW A;  1N6Z A;  2WDQ B;  2DYO A;  2JPH A;  2C7H A;  1IUE A;  3BWU D;  3W2D A;  4ZOH C;  4BFR A;  1WXM A;  1WMH A;  2W3S A;  2MP2 B;  3DVN V;  2MBQ A;  1WJ6 A;  4WJP A;  4OHJ A;  1F1H A;  1NEN B;  3VUY A;  4BBN F;  2Z59 B;  2ASQ A;  1N5X A;  1A70 A;  3P2B A;  4MEL A;  3IFW B;  4JPS A;  3DBR I;  4KZC A;  4ZYS A;  1VJK A;  2AQ1 B;  1FNV A;  1N60 A;  1D4B A;  4AP4 C;  1FCL A;  2JRH A;  2WXN A;  4KGS A;  4EZK A;  2NR2 A;  1FIQ A;  4LK0 M;  1V1O A;  1HA5 A;  3P4P B;  4HKZ E;  2RR9 A;  1BML C;  2RSU A;  2D10 A;  1J8C A;  3DHH C;  4L23 A;  4FJY A;  2KAN A;  2R2O A;  2WXK A;  3L17 A;  1NI2 A;  2K6Q A;  4YTP B;  1HQR D;  4HRO A;  3NY5 A;  1EWC A;  2EKE C;  5HI1 A;  1PYW D;  2N9L A;  4A3O A;  2GBK A;  4OZB A;  3RNF C;  2WXI A;  3KUZ A;  2KT7 A;  1MG4 A;  1YN5 A;  2JWU A;  3X0W A;  1TZ1 A;  2G9H D;  2V1Y A;  4O1N A;  3KVF B;  4PS3 A;  2A4Z A;  3EFU A;  3I9V 1;  2IJ0 A;  4HDQ A;  1WX7 A;  3VFK A;  3PV1 A;  2WXO A;  4FHK A;  3TEY A;  3BYY B;  4HJK A;  1RFK A;  3FC4 A;  2K22 A;  4BKS D;  1TIF A;  2WX1 A;  3ZJT A;  1VCB A;  1LFD A;  4REZ A;  4WIP A;  1JW9 D;  3HK0 A;  1V97 A;  3U52 E;  3M3J A;  1K50 A;  2Q5W D;  4DBG A;  4ACF A;  2CU1 A;  1L2N A;  4KVG B;  3W1S A;  4HPL B;  4DHZ B;  3MJ5 A;  1DOI A;  5FK9 C;  1AW7 A;  2PLP A;  4II2 B;  3TIX A;  3WCQ A;  1FO4 A;  2O6V A;  3QIJ A;  1I42 A;  1I7H A;  2WDV B;  4W9K A;  4C00 A;  2M0A A;  4LJP B;  5C1Z A;  3RPF C;  3JW0 X;  3OJ4 B;  4J3O D;  2LRW A;  3DQV A;  4LNF A;  2L0F A;  5D7G A;  2LJ5 A;  3EGR A;  5G2N A;  3RNA C;  2EKI A;  2WXH A;  3V3X A;  1RLF A;  3MFG A;  3RFZ B;  1GAQ B;  3W5V B;  2KDF B;  1JWM D;  2NBV B;  3V6E B;  4JWU C;  3B08 A;  1WXV A;  4FUL A;  2VRR B;  1XLN A;  2PKO A;  2KLC A;  2ZVO A;  2KMA A;  1T0Q C;  3DBL I;  3SFD B;  2GRI A;  1WM3 A;  2DZK A;  3U30 A;  3RI7 C;  2AX5 A;  3TCA A;  2KLG A;  2BWF A;  2JZ3 B;  4WWO A;  1MFW A;  4BZA A;  3A9J A;  5GMV A;  1WWT A;  3RUL A;  1SJE D;  3WAP A;  1F2R I;  1QZE A;  2BPS A;  5D3D A;  2IBI B;  4FJZ A;  3VHT C;  1A5R A;  3LXF A;  2NBW B;  1SB3 C;  3AE5 B;  4ICU A;  1L0X B;  1E90 A;  2YVC A;  3P1M A;  3Q3F A;  5IN7 A;  1C79 A;  3HM3 A;  1NBF C;  3AEB B;  1JRU A;  3DBH B;  1CK1 A;  3WAL A;  2D11 A;  4RFB A;  1XLO A;  1E5W A;  4JIO U;  1WZ3 A;  3H7P B;  5CHV C;  1HTQ A;  3Q2A C;  1UNS A;  3BZD B;  5DCN A;  2JQR B;  2WNM A;  2FUH B;  3HRD D;  2KTF A;  1YJJ A;  2Y5B B;  1IGD A;  3H9D A;  1LXD A;  2SAK A;  2K8C A;  4W9J A;  3AMZ A;  3V6C B;  3GZN I;  3BVZ A;  2RPQ A;  2WYQ A;  4A8X C;  4LNN A;  2JUO A;  1Q1O A;  2ZVN A;  1LQB A;  4AUQ C;  1F2R C;  2KO3 A;  2IY1 B;  1JWU D;  4NJ6 A;  2Y3A A;  3KUC B;  1H8C A;  2E6X A;  4EFO A;  2K25 A;  1OEY J;  1V8C A;  1L5P A;  1C4C A;  2WXP A;  5TSS A;  1SEB D;  2QJL A;  1WE6 A;  4ZHP A;  2H88 B;  1ZDV A;  3N1X C;  4DDI D;  3ZYY X;  4N6E B;  4N58 A;  4GB9 A;  1QKZ A;  2GBM A;  4W9H A;  4TKN A;  4AJW A;  1UBI A;  2JRI B;  2LXA A;  1ZP0 B;  4LTU A;  1TT5 B;  3UI3 A;  1T6B X;  1XEE A;  1CZP A;  4FJV B;  1YJI A;  4WWN A;  1RAX A;  2WXL A;  2WP9 B;  4I6N B;  3ZKJ C;  1WX9 A;  1PGB A;  1TS3 A;  1RWS A;  1WXA A;  2JT4 B;  2KJH B;  3IT4 B;  5IA7 A;  2L76 A;  1ZPS A;  3GOE A;  3AE8 B;  2W3R A;  1E6E B;  1RM6 C;  3S2A A;  1SE3 A;  3EC8 A;  1FRR A;  2PW9 A;  4P7I A;  1YN3 A;  1V49 A;  4M0W A;  1NYQ A;  4A6Q A;  1K51 A;  2FAZ A;  1LO5 D;  3NVZ A;  1DGJ A;  5EE1 A;  1E0Z A;  5EDS A;  5JZE B;  2PVO D;  2BS2 B;  1AN8 A;  3CIR B;  5J17 A;  4A90 A;  2DZM A;  4IKG A;  4FLH A;  3N32 A;  2O6V D;  2J52 A;  5AZF A;  1FCC C;  4OZC A;  2A5U A;  3MJW A;  2NMQ A;  4HCN B;  3ENE A;  3PGE A;  4WH4 A;  4EE2 A;  2YLM A;  3L08 A;  4ZRI A;  4E71 A;  3APD A;  2IDY A;  2QCZ A;  4BKS A;  2NPT A;  1V9J A;  4IM2 A;  3NOB A;  4YSY B;  1TGZ B;  3R66 C;  4X57 B;  2BTE A;  5LXH A;  4ANV A;  1JWA D;  3PT2 B;  1WGG A;  2Z0D B;  1ENF A;  2DAF A;  1KOT A;  3RCZ A;  3PO0 A;  3Q14 C;  3NS8 A;  3VUW A;  3RT3 B;  4XE0 A;  1I4P A;  1T0R C;  3TUO A;  3IBE A;  3EEC A;  2WHI A;  1EO6 A;  1Q5W B;  4OVV A;  1UGJ A;  4WUR A;  2LGD A;  2XN9 C;  1PQS A;  3Q3M C;  5E6O A;  1GUA B;  1OTR B;  3IHP C;  1GPX A;  4XWW A;  4EKU A;  3BK1 A;  2JXT A;  3B1L X;  2YEP F;  3RNB C;  5G5G A;  1M4V A;  2GBR A;  2O6V B;  2KQ7 A;  3DBR B;  3AEA B;  3DOW A;  1XD3 B;  1XT9 B;  3JSV B;  4G11 A;  1D6E C;  1JRO A;  2AL3 A;  2IPK D;  5FR6 A;  2QMT A;  4LNI A;  4WJO A;  2ZW1 A;  3C19 A;  3IAM 1;  1IBX A;  3E56 A;  2LHE A;  5I4D A;  1I35 A;  4P1C C;  3UIN B;  1WSP A;  2TSS A;  5D94 A;  4ANX A;  4IW0 A;  3HUI A;  1WIA A;  4W9G A;  1KLV A;  2D5G A;  4G0N B;  1L7Y A;  4WQO B;  3VDZ A;  2HTH A;  3V61 A;  2K8H A;  3QK0 A;  4EZL A;  4GXB A;  4HK2 A;  1QF6 A;  4DWF A;  2KOX A;  2ZPN A;  1I4X A;  3MC0 B;  2ZPY A;  1WZ0 A;  3IG3 A;  1L4D B;  4JX1 C;  1V86 A;  3R2T A;  4NQK E;  4K3B A;  3ZJU A;  2LVQ A;  1DOX A;  4HKQ A;  2UYZ B;  4DHZ E;  3T3N A;  1WGY A;  2G3Q B;  1GNU A;  1TKE A;  2KC2 A;  4YT0 B;  4NZL B;  2I38 A;  3TEX A;  3JSV A;  3AXC A;  3Q3O C;  2N1V A;  3A1Q A;  3DVG Y;  1IGC A;  4USA A;  1YIW A;  4HLE A;  2KFK B;  3HIZ A;  1PUT A;  2BWE S;  1WR6 E;  1NVI D;  1CMX B;  2G45 B;  2V3P A;  3RNG C;  1C4A A;  1AAR A;  1N5W A;  4TV3 A;  4MSM B;  3VR8 B;  2I1K A;  2LVP A;  3FAH A;  2JZZ A;  2J0J A;  2BF8 B;  4DXF A;  3IXS A;  4UDU C;  2KTR A;  5DPR A;  2LHD A;  2QEJ C;  4YTM B;  2MBB B;  3RN9 C;  3RUI B;  3NG0 A;  2KFK A;  3TSS A;  2WLB A;  2I2Y A;  3OLM D;  4RCO A;  4B9K A;  2V3S A;  4URK A;  1GC6 A;  1WJU A;  2KKC A;  1FM0 D;  4US9 A;  1NI3 A;  3FKY A;  2M4N A;  1FPY A;  3Q8F A;  3QHT A;  3WAM A;  1VZ7 A;  2RMM A;  1KTK A;  4HPP A;  2ZNV C;  1KF6 B;  3U2S C;  4ANW A;  2J42 A;  2D3C A;  4MGK E;  1K53 A; 
#chains in the Genus database with same CATH homology
 2MEK A;  3SFD B;  1JRP A;  2GRI A;  3AE1 B;  3NUH B;  1JML A;  3VRA B;  2Y5P A;  4ARI A;  2PTL A;  1XO3 A;  2AX5 A;  2DLB A;  2WDR B;  4YXD B;  3P63 A;  1QQR A;  3AE3 B;  2BT6 A;  2ICI A;  3ZGZ A;  1PGX A;  1SSN A;  2FE8 A;  5LNK 1;  2J4X A;  3BYT B;  4L2Y A;  1WWT A;  3AEF B;  1XXG A;  2LUM A;  4GLS C;  1SJE D;  1ZOY B;  2WXR A;  4XDD A;  1F2R I;  2BB5 A;  4RGM A;  3VR9 B;  5D3D A;  5BMG A;  3MP9 A;  4C80 A;  1EU4 A;  1EWY C;  4GDK B;  1XLP A;  3DWG C;  3LXF A;  5E6J A;  1CQV A;  3AE5 B;  1SB3 C;  3SEB A;  1L0X B;  1TS4 A;  2JZP A;  2WU5 B;  2GB1 A;  2L32 A;  1L4Z B;  3P1M A;  1JWS D;  1C79 A;  4OW0 A;  4KX6 B;  3KLS X;  3AEB B;  1FRD A;  4DQO C;  1CK1 A;  4RFB A;  2MJD A;  1XLO A;  2OED A;  3Q8C A;  5BYS A;  2N9K A;  2DYM A;  3I57 A;  3NZ3 A;  3T3O A;  2QSD A;  2V0G A;  1YQ3 B;  3PZ7 A;  2SEB D;  1T5X D;  1UNS A;  1GB1 A;  3BZD B;  2JQR B;  2WNM A;  3HRD D;  4ZRQ A;  4DXG A;  4KKJ A;  1YJJ A;  1L0Y B;  1IGD A;  5H92 C;  1B9R A;  2W55 A;  1C78 A;  2SAK A;  1N61 A;  3AMZ A;  4ZHO A;  2FUG 1;  3NS1 A;  2BW2 A;  2WXM A;  3BVZ A;  1C76 A;  1SXT A;  1BUI C;  3U7Z A;  4PT5 A;  4A8X C;  1N62 A;  1QOA A;  4KGT A;  1C4P A;  4C7Y A;  1IBX B;  1OFF A;  4A55 A;  2M19 A;  1F2R C;  2KAC A;  4H2A A;  1OQQ A;  3FIL A;  3AE7 B;  1JWU D;  5HHD G;  2Y3A A;  4RF0 A;  2E6X A;  1D5Z C;  1FD6 A;  2WQY B;  3SFE B;  1JWB D;  1L5P A;  2E3T A;  1V8C A;  1KFY B;  1C4C A;  2WXP A;  4P6V F;  2MJ3 A;  1BXT A;  4NAW B;  2RPV A;  1NEK B;  1SE4 A;  3HVD A;  5TSS A;  1SEB D;  2QJL A;  4ZHP A;  5GXG B;  2H88 B;  3B9J A;  5BMI A;  2HDE A;  1ZDV A;  1QIL A;  4C7Z A;  1B1Z A;  1UWM A;  2FBW B;  4OZA A;  2QIE B;  3CWI A;  3PZ8 A;  3ZYY X;  4N6E B;  4N58 A;  1C77 A;  1QKZ A;  2WXJ A;  1J7B A;  3KQ4 A;  2V3N A;  2PVG C;  1I4Q A;  3GS2 A;  3FIL B;  1OQR A;  1PGA A;  3KWL A;  3AEE B;  1ZP0 B;  2NTT A;  4LTU A;  1I4G A;  3UI3 A;  4CQN A;  2OHF A;  1T6B X;  1VR9 A;  3NVY A;  1TJE A;  3GP7 A;  1XEE A;  1CZP A;  1YJI A;  1I4R A;  3J9C A;  4P16 A;  5G5H A;  2WXL A;  3Q8E A;  2KN4 A;  3P4S B;  3BVG A;  4TQ1 A;  1EM7 A;  2WP9 B;  3NRZ A;  2LMC A;  1PGB A;  1TS3 A;  1RWS A;  2LJI A;  3IT4 B;  5EE9 A;  2MJE A;  2NTS A;  2XNA C;  1ZPS A;  4AS1 A;  3P4R B;  2K5P A;  2L1A A;  2W3R A;  1SF0 A;  3AE8 B;  4RF1 A;  3C8Y A;  1L6V A;  2JYT A;  4B0E A;  1E6E B;  1RM6 C;  1SJH D;  3AEC B;  4L1B A;  1YN4 A;  2M56 B;  3W5U B;  1SE3 A;  2L52 A;  2BS3 B;  1JAL A;  1FRR A;  2B76 B;  3AH7 A;  2KQ4 X;  3VRB B;  2PW9 A;  2WU2 B;  3E9S A;  1YN3 A;  2AQ2 B;  4YWG G;  1MVK A;  4HJG E;  1EU3 A;  2K3U A;  4M0W A;  1NYQ A;  1V1P A;  4A6Q A;  1K51 A;  1KRH A;  1E10 A;  4AQ7 A;  1LO5 D;  3NVV A;  3NVZ A;  2JYE A;  1MI0 A;  1DGJ A;  4B0M A;  1HZ5 A;  2ONQ A;  4MH8 A;  5EE1 A;  4GDL B;  1E0Z A;  2JU6 X;  3BVM A;  2PVO D;  4RNA A;  2BS2 B;  1AN8 A;  1VLB A;  3CIR B;  2IGD A;  3AM9 A;  1J7A A;  1MHH E;  1CJE A;  1FXI A;  3Q8B A;  4JE3 B;  1HEZ E;  4A90 A;  4IKG A;  1XCQ L;  2KDM A;  2LGI A;  2J52 A;  1ZXI A;  1HZ6 A;  3P4Q B;  1FCC C;  4OZC A;  4JWS C;  1ZUD 2;  4ZRP A;  1FFV A;  4Q2J A;  2NMQ A;  1ZE3 D;  1P7E A;  4LLG M;  3IAS 1;  5HG2 A;  1TKY A;  1QT9 A;  1QOG A;  1DYQ A;  4WH4 A;  4EE2 A;  1Y56 A;  2WXF A;  2CU3 A;  1SBB B;  2V4I B;  1AWD A;  3EUB 2;  2IDY A;  3BK2 A;  4WQM A;  1ESF A;  5D3I B;  3MHZ A;  4MM3 B;  1TY0 A;  3TEW A;  3AE4 B;  5C2T B;  4WWM A;  1VZ6 A;  4YSZ B;  2INN E;  4TQ0 A;  2HTM E;  5EE0 A;  4A9A A;  4YSY B;  3R8B A;  1PDX A;  1VRA B;  4TMA B;  4FXC A;  5MPO A;  3URY A;  2J53 A;  2LFI A;  1I4H A;  2BTE A;  5T8I A;  2BBC A;  1JWA D;  2PIA A;  1AYF A;  2BB6 A;  1D5M C;  3ABV B;  5H8Y E;  1ENF A;  3DWM A;  3ZQ4 A;  5EE3 A;  1MHX A;  5FKA C;  1WRI A;  3PO0 A;  2ZW0 A;  1FMA D;  1UWX A;  4XE0 A;  1RYJ A;  2R61 A;  1QLB B;  1TZO A;  4RGN A;  4RGO S;  1I4P A;  3TUO A;  3OWE B;  3B2G A;  2EEL A;  2WXQ A;  4IDI A;  2RDH A;  1UGJ A;  1KH0 A;  4WUR A;  2PMV A;  2WDQ B;  2XN9 C;  1YQ4 B;  3L4P A;  5AUK A;  1F0Z A;  1YMH E;  2DYO A;  1JCK B;  1IUE A;  1QOF A;  3BWU D;  3W2D A;  4ZOH C;  1GPX A;  4XWW A;  4YSX B;  2W3S A;  2BS4 B;  3BK1 A;  2JXT A;  2IGG A;  2YEP F;  5G5G A;  4IOI E;  1M4V A;  4OHJ A;  3LB8 C;  1FNW A;  2VZK D;  4R3D A;  1VZ8 A;  1K53 A;  1NEN B;  2VZK B;  1WYG A;  1STE A;  1N5X A;  3AEA B;  1A70 A;  2H89 B;  2L83 A;  3BII D;  2W82 A;  3Q8A A;  3AE2 B;  1PFD A;  2MH7 A;  2ACZ B;  1D6E C;  1JRO A;  3IT6 B;  5FR3 A;  4JPS A;  3NVW A;  5BYR A;  2BYT A;  2CJO A;  4ZYS A;  2IPK D;  1NYR A;  2GI9 A;  2QMT A;  1VJK A;  2AQ1 B;  1FNV A;  1TS5 A;  2ZW1 A;  1TS2 A;  1N60 A;  3IAM 1;  1D4B A;  1IBX A;  3E56 A;  1QOB A;  2LHE A;  5I4D A;  1E9M A;  1FCL A;  2N0S B;  3N9Y C;  1K52 A;  2WXN A;  4KGS A;  3AE9 B;  1SE2 A;  1WSP A;  2TSS A;  3KWV A;  1FIQ A;  4LK0 M;  1V1O A;  4D2K A;  1GB4 A;  1ET9 A;  1FXA A;  3AN1 A;  2N7J A;  1HA5 A;  3HUI A;  3P4P B;  1XF5 L;  2DBY A;  4HKZ E;  2AQ3 B;  1BML C;  2ON8 A;  3SR6 A;  1V1P B;  2D5G A;  2YEP B;  2WXG A;  2KWD A;  1GOZ A;  2LEK A;  1J7C A;  3AEG B;  1P7F A;  1YNT E;  2DWQ A;  4L23 A;  4NJC A;  3GB1 A;  2INP E;  2WXK A;  1D5X C;  4RGT A;  2KAJ A;  4YTP B;  3O13 A;  5BYQ A;  1FFU A;  1HQR D;  3R2I A;  1ROE A;  1QF6 A;  1ET6 A;  1TY2 A;  2G1E A;  2QIL A;  4HRO A;  1ACC A;  3H8H A;  4MAC A;  1EWC A;  2JSV X;  4XWT A;  5HI1 A;  2Y5C A;  1I4X A;  1PYW D;  3MC0 B;  2N9L A;  1T3Q A;  3U4E G;  1FEH A;  1MPE A;  4OZB A;  1C9F A;  1L4D B;  3AE6 B;  1TKG A;  4KKI A;  3VQI A;  1L6U A;  2WXI A;  1N63 A;  4JX1 C;  4ARC A;  3AB5 A;  3R2T A;  3B2F A;  1UUP A;  2KMM A;  4WAF A;  3ZJU A;  1DOX A;  4HKQ A;  4RH6 A;  1FNU A;  1YN5 A;  2JWU A;  3Q69 A;  4NAM A;  5BMH A;  2G9H D;  4TSS A;  3W9C B;  4O1N A;  3T3N A;  1TKE A;  3I9V 1;  4YT0 B;  2IJ0 A;  3LYY A;  2JX5 A;  4NZL B;  1E7P B;  2I38 A;  3TEX A;  3AV8 A;  2WXO A;  3TEY A;  3BYY B;  1R7S A;  1RFK A;  1F77 A;  1IGC A;  1Q10 A;  1TYG B;  2K22 A;  3FC4 A;  4USA A;  1DOY A;  1PUT A;  3ZJT A;  2WS3 B;  4US8 A;  1NVI D;  4REZ A;  2V3P A;  2RDG A;  4WIP A;  1JW9 D;  4N59 A;  1C4A A;  4KGR A;  1N5W A;  4HEA 1;  2K9X A;  4YTN B;  1V97 A;  3U52 E;  2CJN A;  1K50 A;  2Q5W D;  1ZXH A;  3VR8 B;  3W1S A;  2K0P A;  2W54 A;  1KLG D;  3FAH A;  3MJ5 A;  1JQ4 A;  4DXF A;  1DOI A;  1WGK A;  3HVZ A;  3IXS A;  5FK9 C;  1AW7 A;  1WXQ A;  4UDU C;  2PLP A;  5HFY A;  1KLU D;  2LHD A;  2QEJ C;  4YTM B;  3ETR A;  3WCQ A;  2Z8L A;  1FO4 A;  4XDC A;  1I7H A;  2WDV B;  3TSS A;  2WLB A;  3TEZ A;  2I2Y A;  3EA6 A;  2M0A A;  4RCO A;  3AED B;  3RPF C;  4MT5 A;  4HRS A;  3V05 A;  1FM0 D;  4J3O D;  4US9 A;  1NI3 A;  2IGH A;  5D7G A;  1HXY D;  3EGR A;  2EKI A;  2WXH A;  3V3X A;  3MFG A;  2X38 A;  3RFZ B;  1GAQ B;  3W5V B;  3Q8F A;  1JWM D;  5AUI A;  1ZDX A;  1VZ7 A;  4JWU C;  5C3J B;  1SIJ A;  3ZJV A;  2RMM A;  1KTK A;  3P42 A;  4ITK A;  4C56 C;  1KF6 B;  1L0V B;  1XLQ A;  1XLN A;  2PKO A;  3U2S C;  5JXV A;  2J42 A;  4OVZ A;  1XCT L;  1VDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...