1JWBD

Structure of the covalent acyl-adenylate form of the moeb-moad protein complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
80
structure length
80
Chain Sequence
IKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
publication title Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 18
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2001-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwbD00
2Q5WD 1PFDA 3LB8C 1TYGB 3SFEB 4C7ZA 2W55A 3DWGC 2L52A 3P63A 4YSZB 5EE3A 1ZP0B 3CWIA 3AE9B 3NRZA 2WP9B 1AYFA 1N5WA 1NEKB 1UWMA 1GAQB 2E3TA 3AE1B 1JWAD 3HVZA 1E0ZA 1F0ZA 1NI3A 1CZPA 3AB5A 3VRAB 1SF0A 4WQMA 2BS2B 1E10A 3FC4A 2WDVB 3W5UB 1FRDA 1NVID 2PIAA 2MH7A 3AE6B 2W3RA 2JX5A 2EKIA 1I7HA 1XLOA 2L83A 3NVZA 5H92C 1XO3A 4WWMA 5AUIA 2WU5B 1RWSA 1QOFA 1N63A 1E6EB 1A70A 2N0SB 1RM6C 3P4RB 3SFDB 1J7AA 1KFYB 1ZOYB 5C3JB 1FO4A 1QF6A 1B9RA 1FXAA 3VR9B 1R7SA 1OFFA 1QOGA 1XLNA 2K9XA 2QIEB 4IDIA 4A9AA 1DOYA 4YSXB 4YSYB 1DOIA 4HRSA 4N6EB 3NVYA 2LEKA 4N59A 1L5PA 3AE8B 3VR8B 4JWUC 3HUIA 3NVWA 3P4QB 1KF6B 1SIJA 4ZOHC 4YXDB 1DGJA 4YTNB 1JALA 3AEBB 3PO0A 1JRPA 2PVGC 1J7BA 1NYRA 5C2TB 3NVVA 4US9A 2FBWB 3P1MA 3AMZA 3AE2B 2CJNA 3NS1A 3EUB2 1FMAD 1L6VA 1VJKA 1QOAA 4US8A 1IUEA 1WGKA 5G5GA 2CU3A 3ZYYX 1V97A 2KMMA 5H8YE 1YQ4B 5EE9A 4N58A 4C7YA 3B2FA 1JQ4A 1T3QA 1SB3C 1TJEA 4ITKA 2M56B 1RFKA 1QLBB 1J7CA 1PUTA 1JW9D 1YQ3B 2KAJA 5G5HA 3WCQA 3BIID 3L4PA 1JWBD 3B9JA 1WXQA 2BT6A 4P6VF 1L0VB 1N60A 3DWMA 2ACZB 1DOXA 2QJLA 1YJIA 4HROA 1KRHA 2WS3B 1N62A 2BS3B 3AEEB 3AV8A 2JQRB 5MPOA 2MJ3A 1PDXA 4KX6B 1TKYA 2WU2B 3AEAB 3AN1A 3LXFA 4C80A 1FXIA 1L6UA 4YTPB 2WDQB 2MJEA 2K22A 2W3SA 2H89B 2CJOA 2WLBA 2Y5CA 1ROEA 3AEDB 3AEFB 3W9CB 1XLQA 1WRIA 4ZHPA 1FFUA 2M19A 1XLPA 3AH7A 3P4SB 2AX5A 3AE3B 3AEGB 3W5VB 1QOBA 1E9MA 1TKEA 3AE4B 1VLBA 5EE1A 1QT9A 2H88B 3CIRB 4JX1C 1WYGA 1GPXA 4USAA 2DBYA 5EE0A 3AE5B 5AUKA 1EWYC 2WDRB 3AECB 1N61A 1N5XA 3ABVB 3FAHA 1VDVA 2BS4B 1TKGA 1OQQA 1FM0D 2PVOD 3RPFC 2MJDA 4JWSC 3HRDD 1CJEA 1WWTA 5GXGB 1FRRA 3KWLA 4FXCA 2W54A 1V8CA 1ZUD2 3ETRA 3VRBB 3B2GA 2WQYB 3SR6A 1NENB 2G1EA 1YJJA 2DWQA 2PKOA 2B76B 4ZHOA 1RYJA 2OHFA 1ZXIA 2K5PA 4YT0B 1FIQA 1NYQA 1OQRA 3AE7B 3AM9A 1E7PB 2HTME 1AWDA 3P4PB 4LTUA 1FFVA 4YTMB 1JROA
chains in the Genus database with same CATH superfamily
1F52A 4ARIA 2KQ7A 1M94A 3NS8A 2E3TA 1GAQB 3U2SC 3KYCD 1CZPA 1C4AA 5DPSA 4W9KA 4DK5A 2C7NB 1QOFA 2N0SB 1Z2MA 4XE0A 1SGHA 1DOYA 2FCMA 2FIFA 2JWZA 2JYEA 3CMMB 1Q1OA 3PO0A 3VUYA 2BVCA 1L0XB 2YVCA 2KK8A 3DBLB 4DDGD 4KIKA 4BAXA 3ZJTA 1YN3A 1SB3C 1KLVA 3QX1A 1PUTA 5FK9C 1ZXHA 5CX3A 1JWBD 2KDBA 2D07B 3N30A 4WAFA 4GN1A 2KJRA 4N9F4 5JZEB 1WJ6A 1QILA 3PRPB 2HTHA 4W9CA 3ZNHB 1N5XA 4KGSA 1PQSA 1IYFA 2WHIA 1FRRA 2D11A 2D3AA 4MELA 2PKOA 3TCAA 1R4NB 1K8RB 2K5PA 4YT0B 1SEBD 1SSNA 2EELA 2KO3A 1GNUA 3AE7B 4IG7B 2LJ5A 1JQ4A 1J7CA 3N1ZC 5EE3A 2C60A 2G9HD 1WRDB 1AYFA 3GB1A 1JWAD 2CHZA 4KKIA 4HPPA 1FRDA 1XXGA 2JX5A 4LNKA 4MH0E 2N7DA 4GIVA 3TUOA 4BKSD 4PYZA 3A9KB 3V62A 3ZGZA 1XF5L 2N9LA 4A9AA 1S1QB 1J8CA 2IO1B 3R7QA 2PEAA 2X8XX 4ZOHC 4W9HA 2REXA 5CHVC 4YTNB 2LD9A 2V0GA 2ZW1A 2O2VB 2FBWB 3VFKA 3TIXA 1C4CA 1VJKA 4TKNA 1VRAB 2LGIA 1FCLA 3QJZA 1E8ZA 4XDDA 4LNFA 1YJ1A 2C7MB 3RD2A 2XN9C 1STEA 3ZNGC 4MJSB 3VQIA 3BY4B 3ZTCA 1WX9A 5D7GA 1VD2A 5HHDG 3UGBB 1TKYA 3UIPB 2MEKA 5KHOA 1CK1A 3PZ7A 2EMSA 1I4HA 4W9IA 1I4XA 1I35A 4MGKE 1WGDA 3A1QB 5EE1A 2H88B 4JX1C 4USAA 1JWSD 1D4BA 2LJIA 4XC2A 1GC7A 2ASQA 3TL5A 2MX2A 3HRDD 4FXCA 2JU6X 3IHPC 2D3BA 3L08A 3RN9C 4C4VB 2IO2B 1GOZA 3NZUA 3H8HA 2ICIA 1J0GA 3P4PB 3ZJVA 1FFVA 2SAKA 1T0QC 5FR3A 2KACA 3IT6B 3V6EB 1WJUA 3FKYA 1E90A 2JRIB 1C4PA 2KWDA 1PGBA 1F0ZA 2LWPA 2KXJA 4PK1A 3KVFB 2EKIA 4JLCA 3ZJUA 4URKA 5JHBA 1ZOYB 4AWJA 3X0WA 2K9XA 3R2IA 4ACFA 4YWGG 4BKGA 3TMPB 2ZNVC 2L76A 4BFRA 1E7UA 4GDKB 3ZQ4A 4OVVA 3IXSA 4US9A 3H6NA 3P1MA 1WZ3A 2IO0B 1P0RA 1EF1A 4IKGA 1EUVB 1P98A 4AJWA 3ZXRA 2CU3A 3IVFA 3DVNU 3I3TB 5BO4B 2BKRB 1TJEA 3KH0A 3V6CB 4P6VF 3U7ZA 2QJLA 1YJIA 2N4FA 2KJ6A 4HLEA 2D2QA 3N3KB 1SJHD 1FXIA 3S2AA 4S0RA 2LGSA 3U8ZA 3GE3C 2AX5A 3AE3B 2K6DB 2LHEA 1WF9A 4FJZA 4BKTA 2I38A 1VLBA 4OZCA 1IP9A 4F7ZA 1WYGA 3ABVB 4JQWC 1FM0D 1V1PB 2J0JA 3VAWA 1LQBA 3Q8EA 2IZVB 3QIJA 1RRBA 1V1OA 1WGYA 1L7YA 5LXHA 1TY2A 4XWTA 1OQRA 1WI0A 5D94A 4KZ0A 3NZSA 2IY0B 1WIAA 2WYQA 4ZDVA 2QHOA 5IP4D 2W55A 2L52A 1ACCA 1NEKB 2PLPA 4MM3A 2DZJA 2YEPF 1NVID 1YN5A 2V9HA 3UI3A 4IM2A 3LDZE 1QF6A 2J52A 4LJPB 3RULA 1OTRB 2NBVB 3Q3JA 1JRUA 5AZGA 2IYDB 3NG0A 4MGYE 4I6PA 3X23A 3H7PB 1JRPA 1OEYA 3DPDA 3U52E 2LHDA 4KSLC 3AE2B 2KTRA 3DHIC 5G55A 3ZTDA 1QOAA 3OLMD 5JH5C 2GRIA 1C1YB 3VDZA 2BYEA 4BKSA 4II2B 3PHXB 1E8WA 2VZKB 1P7FA 3VTWA 4DQOC 2ZPNA 1XD3B 2L3ZA 3IFWB 4KX6B 3PZ8A 2NMQA 4B6WA 4FULA 1C9FA 3N9YC 4ANVA 1Q5WB 1TZOA 5C1ZA 1IGCA 2L32A 4XGAB 3KYDD 4H2AA 2LI5A 2WDRB 3TSSA 4RM9A 4K81A 2MJDA 1V49A 1EU4A 3UF8A 3H9DA 4KDIC 1WGHA 4WJPA 2MP2A 1V8CA 4C00A 3MP9A 2FIDA 2ZCCA 2AQ2B 3QQ8B 3EFCA 4RGMA 1WMHB 2NS5A 2LGXA 4HWIB 4EOYA 1SJED 2MWSB 4REZA 3SFEB 4C7ZA 3UIOB 3AI5A 1EF5A 2MA9B 1UWMA 2PTLA 1E0ZA 4OVUA 1F9JA 1TGZB 4O1NA 3KQ4A 3PT2B 1UD7A 2MH7A 3BVMA 3DBRI 1I7HA 3Q8CA 2BYTA 1QKZA 2W82A 4DHZE 1FXAA 1EM7A 1R7SA 2QILA 2QIEB 3ZLZA 3PTFC 2ZW0A 2J0KA 2M1MA 1K50A 2ZEQA 3KWVA 2WWZA 4MSQB 3ZW3A 1VZ7A 4FN2A 3VR8B 4EZJA 1TTNA 2L7RA 3EGRA 4IM3A 3PRMB 2GBRA 1NYRA 4FLHA 1YD8U 5D3DA 1JCKB 2DAJA 3NHEB 2XEWA 2K0PA 1C79A 3AXCA 3QAQA 3VUXA 3ZUNA 4XX5A 1YQ4B 2N9KA 5EE9A 4I6NB 1V6EA 4NQLB 5D3IB 1JW9D 2JRHA 2CS4A 3BIID 3IAS1 1H8CA 2Y5BB 2BT6A 2RMMA 1ZDVA 2V4IB 2KTFA 4EZLA 1OEYJ 1PDXA 3APFA 4OHJA 1WM2A 3DOWA 4C80A 1P9DU 1IBXB 4JE3B 3AEDB 2NPTA 3ZNID 3PREA 2KMAA 1WSPA 4ZHPA 1MFWA 4RGTA 1QT9A 2R2QA 1L0YB 3ZDMC 2WXLA 1TS2A 4NZLB 2L05A 1WWTA 4HCNB 5HFYA 2G45B 4M00A 1E8YA 2WX0A 3B2GA 1XEEA 2DYMA 2ONQA 1RYJA 5C23A 1KOTA 2G4SA 1UGMA 3VTVA 2DZIA 2AQ1B 4L2YA 2IGGA 4WWOA 1HZ5A 2QMTA 1FO4A 2IPKD 2KWVB 3IAM1 1B9RA 3AU5A 1QOGA 3IBEA 2C5LC 2FUG1 5D2MB 1K52A 4DHJB 3RFZB 2WXRA 2R2OA 4PS3A 2BW2A 4KSKC 4ASWC 3CSTA 4JWUC 2KT7A 1T5XD 3MJ5A 4LDTB 1MHXA 1MVKA 1HTOA 3NS1A 3NUHB 3QA8A 3EUB2 4MT5A 4DHZB 2LVOA 1Z5SB 1G6JA 1T3QA 4A6QA 2Y5PA 2IGHA 1E8XA 3L0WB 2WXNA 3ALBA 2ACZB 1DOXA 4BOSC 2FE8A 4HROA 2WS3B 5KHQA 2JQRB 3V60A 2KX3A 2LGDA 2WDQB 2MJEA 2Y5CA 4LJOB 2GOWA 4DXGA 4CO7A 3PZDA 1WR6E 3PSEB 5AUKA 4XYCA 1V5OA 3WAMA 2XBBC 2AQ3B 2BWFA 2RR9A 3TEWA 2EMTA 2G1EA 4A55A 3NY5A 1MG4A 2MW5A 2KC1A 2LVQA 1FIQA 4HVBA 1AWDA 4S17A 4HK2A 1ET9A 4W9JA 2GBNA 4YSZB 1V86A 3CWIA 3W1SC 1U4AA 1I4QA 3AB5A 4WQMA 2WXQA 5C2TB 3W1YA 3PS6A 1I4GA 2L83A 3MC8A 2UWQA 4ZRKA 1E6EB 5I4DA 2JXTA 2O6VB 5C3JB 2I2YA 1OFFA 2LUMA 3VH4B 2RGFA 4LNNA 2KLCA 2MSED 4FJVB 3JSVA 1TBEA 4JPSA 3APCA 2IDYA 5LXIB 2KOXA 3JVZX 1L6VA 3SU8X 2PW9A 3R2TA 5HKHA 2UYZB 1V97A 5H8YE 4E3CA 5FR6A 3B2FA 3P2BA 1QLBB 1VZ8A 3HK0A 3RNEC 3A9JB 2QCZA 4ICVA 2NVUI 2I1KA 4ANUA 1L4DB 2AYOB 2WGSA 3HM6X 4IC7B 2KQSA 3L10B 1WFYA 4AP4C 3BK2A 3KW5B 4NAMA 1YMHE 1WRIA 1IGDA 1A5RA 2INNE 1FFUA 2LVPA 2N9EB 1F2RC 1GPXA 4LNIA 5EE0A 2J4XA 1EWYC 4C56C 5BYRA 4WJNA 2NTSA 2PVOD 1FCCC 3MC9A 1H4RA 4PT5A 1CQVA 2M0XA 3RNCC 4AJYB 1L2NA 3PGEA 3T8MA 2WXFA 5DPTA 1MG8A 3RZFA 3DBHB 1ZP0B 1AARA 2KHWB 3PPAA 1FEHA 2JVCA 1DYQA 5DPWA 1E10A 3FC4A 3TEXA 2RPQA 4W9DA 1N63A 1A70A 4XWWA 2VZKD 4JL9A 2IGDA 2KFJA 4OVZA 2BYFA 3O13A 1I4PA 2RPVA 1DOIA 4HRSA 1V9JA 3URYA 3RNFC 2O2VA 4M0WB 1FMAD 3RNAC 2V1YA 1CMXB 2ZPYA 2M56B 1YQ3B 2KAJA 1ZGUB 1LO5D 1YQBA 4NJ6A 2KVZA 1KRHA 1N62A 2KMCA 2V4LA 3MFGA 4G11A 4EEWA 4BZAA 2WXKA 3QWZB 2QEJC 1E7VA 3MTNB 3A1QA 3ECIA 2E6XA 4E71A 1E9MA 3AE4B 3A33B 1D6EC 2PPHA 1S3SG 1VDVA 2KZRA 2JZZA 4MGIE 2M4NA 4C4VA 1YJJA 2N7JA 2B76B 2BB5A 2IJ0A 1V80A 3FILA 4WJOA 4XDCA 2OEDA 2VRRB 4CHKA 1UUPA 3WALA 1JROA 1TS4A 4CQNA 1LGRA 4GXBA 3P63A 3Q8AA 3Q69A 2W9NA 2D3GA 1SF0A 1GC6A 2MLBA 2BS2B 5LLIA 2WDVB 1TIFA 2GMIC 1XO3A 4DDID 3SFDB 3U4EG 3ZRFA 5BYQA 1HA5A 2XK5B 3A4SC 4RM8A 1C3TA 1RFAA 2DZMA 2HE7A 1JMLA 3B1LX 4GDKA 4HKQA 2K8BA 1DGJA 1VR9A 2INDC 2WNMA 3B08A 1YX5B 1J7BA 3PRZA 4GU2A 4II3B 2ON8A 5EDSA 3VHTC 2LFIA 3PV1A 2KMMA 4MACA 2HD5B 4C7YA 2KWCA 2J7QB 2CKHB 1GG3A 4LLGM 4ITKA 4RMAA 1WE6A 4AUQC 4NQKE 4HPLB 1K51A 3HVDA 3PHWB 3AV8A 3ZNZB 5CHWA 2MP2B 3AN1A 3LXFA 4NAWA 2GB1A 3L54A 2C7HA 2KN5A 2X38A 1MPEA 2JUOA 1QOBA 4G50A 4K1RB 2Z59B 2K1FA 3ENEA 2V3SA 2CHWA 1C77A 3T3NA 1VZ6A 2L8JA 4W9GA 2LMCA 2RDGA 2GBKA 3AU4A 2DHZA 4W9LA 3ZVVA 1YOVB 4M8MA 2DWQA 2XNAC 3BVGA 4RF0A 1D5XC 4LTUA 1WYWB 4TQ1A 1I42A 1SBBB 2D3CA 3E9SA 4LDTD 2DAFA 1BT0A 1HZ6A 4R3DA 3TBLD 2LRUA 2ZJDA 4MDKE 3AE1B 3V05A 2EKEC 4BBNC 2MRPA 3I63C 4GDLA 1KLUD 1GJZA 5H92C 3NVZA 4P16A 5AUIA 2WU5B 3PVLA 2RSUA 3BYYB 1WXSA 3P4RB 1ESFA 2LXAA 3GS2A 1WZ0A 1BXTA 4YSYB 3C19A 4N6EB 4HCPB 4N59A 1OQYA 4B9KA 4M8NA 3H7PA 3P4QB 4WURA 1P1AA 2N9XA 3AEBB 2KFKB 5TR5A 2KD0A 3NVVA 4NJ7A 3GE8C 4GMVA 1FPYA 2IO3B 2K8CA 2NPTB 4KGRA 4OZAA 3EFUA 3RUIB 2KANA 2G4DB 4G3XB 3M95A 3Q6BA 3IG3A 5G5HA 4BOZB 1WXQA 1N60A 3U7DA 2GBJA 1LM8B 1TS5A 1V2YA 4DXFA 2UU7A 3AULA 1SXTA 2MBEA 3AEFB 1ROEA 3W9CB 4EKUA 1XLQA 1R4NI 1R4MI 4B0MA 3J9CA 4ARCA 3W5VB 4RFBA 4OW0A 3WAOA 1EWCA 4ICUA 4J3OD 1N61A 4RF1A 2YEPB 5CTRC 1QZEA 1YIWA 3EC8A 4TUUA 2KC2A 4KGTA 2O6VD 3K9OB 4GB9A 3ETRA 3DVNV 3BINA 1WMHA 1OGWA 3HIZA 2KWUB 1D5ZC 3UQBA 4YTMB 4P1CC 1ENFA 3VH3B 2FUHB 1NI2A 1RAXA 2NR2A 4KZCA 2WX1A 3M62B 3VRAB 3RCZA 1YNTE 3T9LA 2PIAA 2BB6A 3K9PB 3WIMA 2RDHA 2YLMA 1P3QU 4K7UA 5JHAA 2BBCA 5LNK1 3VTUA 2V3PA 3B0AA 3HUIA 3BZDB 1KF6B 4YXDB 1JALA 5AEKB 1WY8A 3KUCB 5L83A 3GZNI 3MJWA 3Q3NC 3ONSA 2AL6A 1WGKA 5G5GA 3ZYYX 2M8SA 3QC8B 4KIKB 1EO6A 2KKCA 2BPSA 1RFKA 4K7SA 4P7IA 3RI7C 2IY1B 4PS8A 3VUWA 4TV3A 1UF0A 4L1BA 4WAAA 1WX8A 2QSDA 4KV2A 4W9FA 5MPOA 2DENB 3QK0A 1QQRA 3IT4B 2K8HA 1L6UA 2CJOA 1K53A 4DBGA 2M19A 1XLPA 5E6NA 1TT5B 4ZRIA 1AW7A 2K25A 3V3XA 1YX6B 3CIRB 4FJYA 2N1VA 5GMVA 2LUEA 4M02A 1C76A 2BS4B 5DCNA 5J18A 1CJEA 2FCQA 1V5TA 2FNJB 2WXIA 3DQVA 3EHVA 4L23A 3RYTA 3SR6A 3DVGX 1PGAA 1YN4A 2J42A 4TQ0A 2D10A 5IA7A 1WX7A 2MQJA 2QC8A 1UBIA 3AE9B 4HEA1 3JSVB 2CHXA 4W9EA 3ML9A 2DYOA 1Y8RC 3OJ3A 5E6PA 2KDIA 3AE6B 2INPE 4GLSC 4ANWA 4ZRQA 1KFYB 2LGYA 2NCNA 1XLNA 2GBMA 3H1UA 4IOIE 1MJDA 2PJHA 4WIPA 3WAPA 1L5PA 2MBHA 5E6OA 3PLVA 3H7SA 3DBRB 1HXYD 2KDEB 3O65B 5HI1A 2JYTA 5AZHA 1BUIC 4DWFA 4E74A 5L95C 1L4ZB 4UDUC 4RH6A 1GB1A 3EA6A 4J6IA 1LFDA 5IN7A 2NBUA 2AL3A 5IO9A 3TEYA 4AQ7A 3L16A 3ZDTA 1VCBA 2MJ3A 3MHSD 3AEAB 1R4MB 3GOEA 1TS3A 2JF5A 2WXOA 3Q3OC 4LK0M 2D5GA 3CSFA 2JXXA 2K3UA 3P4SB 2KJHB 5IKCM 5AZFA 1ZW7A 1XCQL 4WWNA 1GB4A 2WXJA 2KNBA 2OJRA 4GSWA 2VH2A 2BGFA 2FAZA 4AS1A 4FADA 3JW0X 4HDQA 4RGNA 1NENB 2MHJA 2BTEA 5JXVA 2WXMA 2JWUA 3P42A 1FNUA 1ISNA 5E6JA 1ZXIA 4ZYNA 2HTME 5G2NA 3ZKJC 4KVGB 4NJCA 2BF8B 4EZKA 3DHHC 3BYTB 2BQQA 5GXGB 2Q5WD 1PFDA 2LZ6A 2ZZPB 1F2RI 2ZVOA 3DHGC 3NRZA 4A8XC 4WWPA 2KX0A 3HVZA 3Q8FA 4BVUC 3RNBC 3W5UB 2HJ1A 3LJ3A 2O6VA 4YL8A 1SIFA 5DPRA 2K6QA 3Q14C 1X1MA 4HPMB 3RNGC 1BMLC 1FNVA 4IWQA 2GI9A 4IWOA 3NVYA 2WDTB 3AE8B 4D2KA 3NVWA 1SIJA 1LXDA 2G3QB 3GZNB 5BMHA 4NPNA 4WJQA 1T0YA 3TJPA 2JZPA 1WR1A 4US8A 3A9KA 3Q3FA 1E5WA 1ZDXA 3LYYA 1EU3A 3A9JA 4EE2A 3C8YA 1JWMD 3T3OA 1C78A 1KTKA 1WM3A 4A20A 4HJGE 3AEEB 2BWES 2CU1A 2INCC 1Y56A 2RD0A 2PE9A 4LNOA 4WQOB 4B95A 1F77A 2JT4B 1UELA 1V81A 2W3SA 3R3MA 4M01A 2WXHA 1KH0A 3FILB 2L1AA 1TKEA 3ZO5B 4MJSA 3AECB 1WGRA 2V3NA 4IW0A 4XZ4A 2WXGA 1ZUD2 3VRBB 5IOIA 4IUMB 3EECA 2J0MA 2K39A 1NYQA 1HTQA 4JGHB 1E7PB 2N9PC 3WA0A 4JWSC 4ANXA 4OZBA 2R61A 1ET6A 3DWGC 3QHTA 2JSVX 4A3PA 1NBFC 1ZPSA 1NI3A 4MSMB 1PGXA 4MM3B 2MBOA 1XLOA 4ZRPA 4WWMA 1TZ1A 2BYVE 1IPGA 4I6LB 3DBSA 1Q0WB 1WXAA 3A4RA 3OJ4B 3SEBA 1T6BX 4K3BA 2LRWA 1KM7A 1MHHE 4M0WA 1SE3A 2KVRA 2RDBC 3I5JC 4AOFA 4IM0A 4NAWB 5HG2A 4P1BC 2JZ3B 2KTRB 1IUEA 4HXDA 3Q2AC 3KUDB 2A4ZA 3GP7A 1ZE3D 2FCSA 4PS7A 4MH8A 1HEZE 1F1HA 4KDLB 3NOBA 2M0AA 3RT3B 2WLBA 2H89B 3Q3MC 4MGZE 2QDFA 2BKFA 3AEGB 4QAYA 1RLFA 2A5UA 3DVGY 3M3JA 3W1SA 2HDEA 2I1JA 5FKAC 1WJ4A 2DNFA 2AWTA 1TY0A 3E56A 4GDLB 5BYSA 2J53A 5TSSA 1SE2A 1HE8A 3I9V1 4WH4A 3LB8C 3U30A 2OOBB 4HKZE 1WXVA 1V1PA 3QARA 2N7EA 1UZXB 4HDOA 1WGGA 3JYUA 3SDLC 2W3RA 4RGOS 4DXAB 1P7EA 1RWSA 3VXWA 3ML8A 4DHJD 1KJTA 2XK5A 1J7AA 3HM3A 1Q10A 4IWPA 2ZVNA 4KKJA 3VVWB 2JY6A 4YSXB 4LCDE 4A90A 2PVGC 1GUAB 2DX5B 2CR5A 3AMZA 2CJNA 1PYWD 3R7RA 2Z8LA 3UQAA 2GLSA 1KLGD 3OWEB 1XCTL 4RCOA 3DBLI 1UH6A 3ZXVA 4FBJB 2KYWA 1T0SC 5J17A 3B9JA 1L0VB 5CHFA 3DWMA 2SEBD 4K7WA 4K3CA 4F1SA 1FD6A 2BS3B 1HQRD 4ZRJA 1D5MC 1I4RA 3DDCB 5T8IA 2KLGA 2DZKA 3AH7A 3ZRCA 4F8CB 1SE9A 2DLBA 3HHMA 2DBYA 3R8BA 3AE5B 1WXMA 3D32A 1T0RC 2ZNVB 3SD5A 2KN4A 3RPFC 3RZWC 3SHQA 4A3OA 3KWLA 2W54A 4CYEA 4EFOA 3APDA 4HJKA 4BBNF 4FHJA 3BK1A 2OHFA 1JWUD 2KDMA 3CF6E 2Y3AA 3AM9A 2L0FA 4RNAA 2M17A 2MCNB 1AN8A 1NDDA 3L13A 3KUZA 3DCGA 3MHZA 1TYGB 2TSSA 4MEMA 2PMVA 1UBQA 2WP9B 5D6JB 1N5WA 2L00B 2KDFB 3V61A 1J19A 1M4VA 1UWXA 3N1YC 3Q8BA 3UINB 1XT9B 5BMIA 2PE6B 2OJWA 2L0TA 3R66C 3M63B 1FXTB 4Q2JA 1RM6C 2LASA 3VR9B 3MC0B 4NNJB 2KQ4X 2Z0DB 2NBWB 1N6ZA 4IDIA 4FA6A 4PYUA 1WH3A 3C0RB 2LEKA 1SE4A 3PLUA 2KFKA 1WJNA 2ZCBA 4FHKA 3N1XC 3OG5A 3RMKC 2JPHA 3N20C 2C9WB 2N1WA 1FNWA 2Z0EB 4TMAB 3TEZA 4GGQA 3WANA 2B3AA 4N58A 2IBIB 2MBQA 2FCNA 3BWUD 3KLSX 4B0EA 2NTTA 3WCQA 3QCAA 4TSSA 3L4PA 3I57A 3OAWA 2AEHA 1B1ZA 1XQQA 2DYBA 1MI0A 4ZYSA 2WU2B 4NY0A 4X57B 4YTPB 4JIOU 2K22A 1WE7A 5J2RA 5BMGA 5IAAC 1ZKHA 2MBBB 4EUTA 3FAHA 1UNSA 3DBHI 3N32A 4GOCA 1TKGA 1OQQA 4G0NB 3L17A 2WXPA 1UGJA 2VH1A 2LXCA 3ZIMA 2WQYB 1IBXA 3NJTA 2HJ8A 4ZHOA 3BVZA 3NZ3A 3W2DA 1D3ZA
chains in the Genus database with same CATH topology
2Q5WD 1PFDA 1TS4A 4ARIA 1F2RI 3SFEB 4CQNA 4C7ZA 3P63A 3NRZA 3Q8AA 4A8XC 3Q69A 1UWMA 2E3TA 2PTLA 1E0ZA 1GAQB 3HVZA 3Q8FA 3U2SC 1CZPA 1SF0A 1C4AA 4O1NA 2BS2B 3KQ4A 2WDVB 3W5UB 2MH7A 3BVMA 1I7HA 3Q8CA 1XO3A 2BYTA 1QOFA 2N0SB 1QKZA 3SFDB 3U4EG 5BYQA 1HA5A 2W82A 1FXAA 1EM7A 1R7SA 2QILA 4XE0A 2QIEB 1JMLA 1BMLC 1DOYA 2ZW0A 1FNVA 2GI9A 1K50A 3KWVA 2JYEA 3NVYA 3AE8B 1VZ7A 4HKQA 4D2KA 3VR8B 3NVWA 1SIJA 3EGRA 1DGJA 1VR9A 3PO0A 5BMHA 2WNMA 1J7BA 1NYRA 5D3DA 1JCKB 2ON8A 1L0XB 2K0PA 1C79A 2JZPA 4US8A 2LFIA 2KMMA 4MACA 1ZDXA 3ZJTA 1YQ4B 2N9KA 5EE9A 4C7YA 1YN3A 1SB3C 4LLGM 4ITKA 3LYYA 1EU3A 1PUTA 1JW9D 5D3IB 4EE2A 1K51A 3C8YA 3HVDA 1JWMD 3BIID 1ZXHA 3IAS1 5FK9C 3T3OA 1C78A 1JWBD 2BT6A 2RMMA 1KTKA 1ZDVA 2V4IB 3AV8A 4HJGE 3AEEB 4WAFA 1PDXA 1Y56A 4OHJA 1F77A 3AN1A 3LXFA 4C80A 1IBXB 4JE3B 2W3SA 2GB1A 3AEDB 1WSPA 2WXHA 2X38A 4ZHPA 1MPEA 1KH0A 3FILB 1QILA 2L1AA 1QOBA 1TKEA 4RGTA 1QT9A 3AECB 1N5XA 1L0YB 2V3NA 4KGSA 1C77A 3T3NA 2WXLA 1TS2A 1VZ6A 4NZLB 2WXGA 2LMCA 1WWTA 2RDGA 5HFYA 1FRRA 1ZUD2 3VRBB 3B2GA 1XEEA 2DWQA 2PKOA 2XNAC 2DYMA 3BVGA 2ONQA 1RYJA 4RF0A 2K5PA 4YT0B 1SEBD 1SSNA 2EELA 1NYQA 1E7PB 1D5XC 4LTUA 3AE7B 4JWSC 1JQ4A 4OZBA 1J7CA 4TQ1A 1SBBB 2R61A 3E9SA 1ET6A 3DWGC 5EE3A 1HZ6A 2G9HD 4R3DA 2JSVX 1AYFA 3GB1A 3AE1B 1JWAD 3V05A 1ZPSA 4KKIA 1NI3A 1PGXA 2AQ1B 4L2YA 2IGGA 4MM3B 1FRDA 1XXGA 1HZ5A 1KLUD 2JX5A 1XLOA 4ZRPA 3NVZA 4P16A 5H92C 4WWMA 5AUIA 2WU5B 3BYYB 2QMTA 3TUOA 3P4RB 1FO4A 2IPKD 3IAM1 1B9RA 1ESFA 3ZGZA 1QOGA 1XF5L 2FUG1 2N9LA 3GS2A 1K52A 3SEBA 4A9AA 1BXTA 3RFZB 4YSYB 1T6BX 2WXRA 4N6EB 4N59A 2BW2A 4JWUC 1MHHE 4ZOHC 3P4QB 4M0WA 1SE3A 1T5XD 4WURA 4YTNB 3AEBB 3MJ5A 2V0GA 1MHXA 3NVVA 2ZW1A 1MVKA 2FBWB 3NS1A 3NUHB 3EUB2 4MT5A 4NAWB 5HG2A 1C4CA 1VJKA 1VRAB 4KGRA 4OZAA 1IUEA 2LGIA 1FCLA 4XDDA 1T3QA 4A6QA 2XN9C 2Y5PA 2IGHA 1STEA 3GP7A 5G5HA 1ZE3D 2WXNA 3VQIA 1WXQA 1N60A 2ACZB 1DOXA 5D7GA 2FE8A 4HROA 4MH8A 5HHDG 2WS3B 1HEZE 1TS5A 2JQRB 1TKYA 4DXFA 2M0AA 2MEKA 2WDQB 1CK1A 1SXTA 2MJEA 2WLBA 2H89B 2Y5CA 1ROEA 3AEFB 3PZ7A 3W9CB 1XLQA 1I4HA 4DXGA 4B0MA 1I4XA 3J9CA 4ARCA 3AEGB 3W5VB 4RFBA 4OW0A 5EE1A 1EWCA 2H88B 4JX1C 4USAA 5AUKA 4J3OD 1JWSD 1N61A 1D4BA 4RF1A 3W1SA 2YEPB 2LJIA 2HDEA 5FKAC 3HRDD 2AQ3B 4KGTA 4FXCA 2JU6X 1TY0A 3ETRA 3E56A 3TEWA 4GDLB 2G1EA 5BYSA 4A55A 2J53A 5TSSA 1D5ZC 1SE2A 1FIQA 1GOZA 3H8HA 2ICIA 1AWDA 3P4PB 3ZJVA 1FFVA 3I9V1 4WH4A 4YTMB 2SAKA 1ET9A 5FR3A 2KACA 3LB8C 4YSZB 1ENFA 3IT6B 4HKZE 3CWIA 1V1PA 1C4PA 2KWDA 1PGBA 1F0ZA 1I4QA 3AB5A 3VRAB 4WQMA 1YNTE 2WXQA 2PIAA 5C2TB 2W3RA 1I4GA 2EKIA 2L83A 4RGOS 2BB6A 1P7EA 3ZJUA 1RWSA 2RDHA 1E6EB 5I4DA 2JXTA 5C3JB 1J7AA 1ZOYB 1Q10A 2I2YA 1OFFA 2LUMA 4KKJA 2K9XA 3R2IA 2BBCA 4YWGG 5LNK1 4YSXB 4A90A 4JPSA 2V3PA 3HUIA 3BZDB 1KF6B 4GDKB 4YXDB 3ZQ4A 1JALA 3IXSA 2PVGC 2IDYA 4US9A 3P1MA 3AMZA 2CJNA 1PYWD 4IKGA 1L6VA 2Z8LA 1KLGD 2PW9A 1WGKA 3R2TA 3OWEB 2CU3A 5G5GA 3ZYYX 1V97A 5H8YE 1XCTL 4RCOA 3B2FA 1TJEA 1RFKA 1QLBB 1VZ8A 3B9JA 4P6VF 3U7ZA 1L0VB 3DWMA 4L1BA 1L4DB 2SEBD 2QJLA 2QSDA 1YJIA 1FD6A 2BS3B 5MPOA 1HQRD 1SJHD 1QQRA 3IT4B 1D5MC 1FXIA 1L6UA 1I4RA 2CJOA 1K53A 3BK2A 4NAMA 1YMHE 1WRIA 1IGDA 5T8IA 2INNE 1FFUA 2M19A 1XLPA 3AH7A 2AX5A 3AE3B 2LHEA 1AW7A 1F2RC 2I38A 1VLBA 4OZCA 2DLBA 3V3XA 3CIRB 1GPXA 1WYGA 2DBYA 5EE0A 3AE5B 2J4XA 1EWYC 3R8BA 3ABVB 4C56C 1C76A 2BS4B 5BYRA 1FM0D 1V1PB 2KN4A 2NTSA 2PVOD 3RPFC 1FCCC 1CJEA 4PT5A 3Q8EA 5GXGB 3KWLA 2W54A 2WXIA 1CQVA 4L23A 1V1OA 3SR6A 1PGAA 1YN4A 2J42A 4TQ0A 3BK1A 2OHFA 1JWUD 2KDMA 1TY2A 2Y3AA 4XWTA 1OQRA 3AM9A 4RNAA 2WXFA 1AN8A 3MHZA 1TYGB 2TSSA 2W55A 2L52A 1ACCA 1ZP0B 3AE9B 2PMVA 4HEA1 2WP9B 1NEKB 1N5WA 2PLPA 2DYOA 1FEHA 1UWXA 1M4VA 1DYQA 1E10A 3FC4A 2YEPF 3Q8BA 1NVID 3AE6B 2INPE 5BMIA 4GLSC 1YN5A 3TEXA 1N63A 1A70A 4Q2JA 4ZRQA 2VZKD 1RM6C 4XWWA 3UI3A 1KFYB 1QF6A 2IGDA 2J52A 3VR9B 3MC0B 2KQ4X 1XLNA 4OVZA 4IDIA 3O13A 1I4PA 2RPVA 4IOIE 1DOIA 4HRSA 4WIPA 2LEKA 1L5PA 1SE4A 3URYA 1JRPA 1HXYD 3U52E 2LHDA 4TMAB 3AE2B 1FNWA 5HI1A 1FMAD 2JYTA 3TEZA 1BUIC 1QOAA 4N58A 2GRIA 1L4ZB 3BWUD 3KLSX 2M56B 4UDUC 4B0EA 4RH6A 1GB1A 1YQ3B 2KAJA 2NTTA 2VZKB 3EA6A 4TSSA 3WCQA 3L4PA 1LO5D 1P7FA 3I57A 4DQOC 1B1ZA 3TEYA 4AQ7A 1KRHA 1N62A 1MI0A 4ZYSA 2MJ3A 4KX6B 2WU2B 3PZ8A 2NMQA 3AEAB 3MFGA 1TS3A 2WXOA 4YTPB 2WXKA 2K22A 2QEJC 3N9YC 4LK0M 1C9FA 2D5GA 1TZOA 2K3UA 3P4SB 1IGCA 5BMGA 2E6XA 1E9MA 2L32A 3AE4B 1D6EC 4H2AA 2WDRB 3TSSA 3FAHA 1UNSA 1VDVA 1TKGA 1XCQL 1OQQA 1GB4A 2WXJA 2MJDA 2WXPA 1EU4A 1UGJA 1V8CA 4AS1A 3MP9A 2WQYB 4RGNA 1NENB 1IBXA 2AQ2B 2BTEA 4RGMA 1YJJA 2WXMA 5JXVA 2JWUA 2N7JA 2B76B 3P42A 4ZHOA 2BB5A 1FNUA 3BVZA 5E6JA 1ZXIA 2IJ0A 3FILA 3NZ3A 4XDCA 2OEDA 3W2DA 2HTME 4NJCA 1UUPA 1SJED 4REZA 3BYTB 1JROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q5W D;  1PFD A;  3LB8 C;  1TYG B;  3SFE B;  4C7Z A;  2W55 A;  3DWG C;  2L52 A;  3P63 A;  4YSZ B;  5EE3 A;  1ZP0 B;  3CWI A;  3AE9 B;  3NRZ A;  2WP9 B;  1AYF A;  1N5W A;  1NEK B;  1UWM A;  1GAQ B;  2E3T A;  3AE1 B;  1JWA D;  3HVZ A;  1E0Z A;  1F0Z A;  1NI3 A;  1CZP A;  3AB5 A;  3VRA B;  1SF0 A;  4WQM A;  2BS2 B;  1E10 A;  3FC4 A;  2WDV B;  3W5U B;  1FRD A;  1NVI D;  2PIA A;  2MH7 A;  3AE6 B;  2W3R A;  2JX5 A;  2EKI A;  1I7H A;  1XLO A;  2L83 A;  3NVZ A;  5H92 C;  1XO3 A;  4WWM A;  5AUI A;  2WU5 B;  1RWS A;  1QOF A;  1N63 A;  1E6E B;  1A70 A;  2N0S B;  1RM6 C;  3P4R B;  3SFD B;  1J7A A;  1KFY B;  1ZOY B;  5C3J B;  1FO4 A;  1QF6 A;  1B9R A;  1FXA A;  3VR9 B;  1R7S A;  1OFF A;  1QOG A;  1XLN A;  2K9X A;  2QIE B;  4IDI A;  4A9A A;  1DOY A;  4YSX B;  4YSY B;  1DOI A;  4HRS A;  4N6E B;  3NVY A;  2LEK A;  4N59 A;  1L5P A;  3AE8 B;  3VR8 B;  4JWU C;  3HUI A;  3NVW A;  3P4Q B;  1KF6 B;  1SIJ A;  4ZOH C;  4YXD B;  1DGJ A;  4YTN B;  1JAL A;  3AEB B;  3PO0 A;  1JRP A;  2PVG C;  1J7B A;  1NYR A;  5C2T B;  3NVV A;  4US9 A;  2FBW B;  3P1M A;  3AMZ A;  3AE2 B;  2CJN A;  3NS1 A;  3EUB 2;  1FMA D;  1L6V A;  1VJK A;  1QOA A;  4US8 A;  1IUE A;  1WGK A;  5G5G A;  2CU3 A;  3ZYY X;  1V97 A;  2KMM A;  5H8Y E;  1YQ4 B;  5EE9 A;  4N58 A;  4C7Y A;  3B2F A;  1JQ4 A;  1T3Q A;  1SB3 C;  1TJE A;  4ITK A;  2M56 B;  1RFK A;  1QLB B;  1J7C A;  1PUT A;  1JW9 D;  1YQ3 B;  2KAJ A;  5G5H A;  3WCQ A;  3BII D;  3L4P A;  1JWB D;  3B9J A;  1WXQ A;  2BT6 A;  4P6V F;  1L0V B;  1N60 A;  3DWM A;  2ACZ B;  1DOX A;  2QJL A;  1YJI A;  4HRO A;  1KRH A;  2WS3 B;  1N62 A;  2BS3 B;  3AEE B;  3AV8 A;  2JQR B;  5MPO A;  2MJ3 A;  1PDX A;  4KX6 B;  1TKY A;  2WU2 B;  3AEA B;  3AN1 A;  3LXF A;  4C80 A;  1FXI A;  1L6U A;  4YTP B;  2WDQ B;  2MJE A;  2K22 A;  2W3S A;  2H89 B;  2CJO A;  2WLB A;  2Y5C A;  1ROE A;  3AED B;  3AEF B;  3W9C B;  1XLQ A;  1WRI A;  4ZHP A;  1FFU A;  2M19 A;  1XLP A;  3AH7 A;  3P4S B;  2AX5 A;  3AE3 B;  3AEG B;  3W5V B;  1QOB A;  1E9M A;  1TKE A;  3AE4 B;  1VLB A;  5EE1 A;  1QT9 A;  2H88 B;  3CIR B;  4JX1 C;  1WYG A;  1GPX A;  4USA A;  2DBY A;  5EE0 A;  3AE5 B;  5AUK A;  1EWY C;  2WDR B;  3AEC B;  1N61 A;  1N5X A;  3ABV B;  3FAH A;  1VDV A;  2BS4 B;  1TKG A;  1OQQ A;  1FM0 D;  2PVO D;  3RPF C;  2MJD A;  4JWS C;  3HRD D;  1CJE A;  1WWT A;  5GXG B;  1FRR A;  3KWL A;  4FXC A;  2W54 A;  1V8C A;  1ZUD 2;  3ETR A;  3VRB B;  3B2G A;  2WQY B;  3SR6 A;  1NEN B;  2G1E A;  1YJJ A;  2DWQ A;  2PKO A;  2B76 B;  4ZHO A;  1RYJ A;  2OHF A;  1ZXI A;  2K5P A;  4YT0 B;  1FIQ A;  1NYQ A;  1OQR A;  3AE7 B;  3AM9 A;  1E7P B;  2HTM E;  1AWD A;  3P4P B;  4LTU A;  1FFV A;  4YTM B;  1JRO A; 
#chains in the Genus database with same CATH topology
 1F52 A;  4ARI A;  2KQ7 A;  1M94 A;  3NS8 A;  2E3T A;  1GAQ B;  3U2S C;  3KYC D;  1CZP A;  1C4A A;  5DPS A;  4W9K A;  4DK5 A;  2C7N B;  1QOF A;  2N0S B;  1Z2M A;  4XE0 A;  1SGH A;  1DOY A;  2FCM A;  2FIF A;  2JWZ A;  2JYE A;  3CMM B;  1Q1O A;  3PO0 A;  3VUY A;  2BVC A;  1L0X B;  2YVC A;  2KK8 A;  3DBL B;  4DDG D;  4KIK A;  4BAX A;  3ZJT A;  1YN3 A;  1SB3 C;  1KLV A;  3QX1 A;  1PUT A;  5FK9 C;  1ZXH A;  5CX3 A;  1JWB D;  2KDB A;  2D07 B;  3N30 A;  4WAF A;  4GN1 A;  2KJR A;  4N9F 4;  5JZE B;  1WJ6 A;  1QIL A;  3PRP B;  2HTH A;  4W9C A;  3ZNH B;  1N5X A;  4KGS A;  1PQS A;  1IYF A;  2WHI A;  1FRR A;  2D11 A;  2D3A A;  4MEL A;  2PKO A;  3TCA A;  1R4N B;  1K8R B;  2K5P A;  4YT0 B;  1SEB D;  1SSN A;  2EEL A;  2KO3 A;  1GNU A;  3AE7 B;  4IG7 B;  2LJ5 A;  1JQ4 A;  1J7C A;  3N1Z C;  5EE3 A;  2C60 A;  2G9H D;  1WRD B;  1AYF A;  3GB1 A;  1JWA D;  2CHZ A;  4KKI A;  4HPP A;  1FRD A;  1XXG A;  2JX5 A;  4LNK A;  4MH0 E;  2N7D A;  4GIV A;  3TUO A;  4BKS D;  4PYZ A;  3A9K B;  3V62 A;  3ZGZ A;  1XF5 L;  2N9L A;  4A9A A;  1S1Q B;  1J8C A;  2IO1 B;  3R7Q A;  2PEA A;  2X8X X;  4ZOH C;  4W9H A;  2REX A;  5CHV C;  4YTN B;  2LD9 A;  2V0G A;  2ZW1 A;  2O2V B;  2FBW B;  3VFK A;  3TIX A;  1C4C A;  1VJK A;  4TKN A;  1VRA B;  2LGI A;  1FCL A;  3QJZ A;  1E8Z A;  4XDD A;  4LNF A;  1YJ1 A;  2C7M B;  3RD2 A;  2XN9 C;  1STE A;  3ZNG C;  4MJS B;  3VQI A;  3BY4 B;  3ZTC A;  1WX9 A;  5D7G A;  1VD2 A;  5HHD G;  3UGB B;  1TKY A;  3UIP B;  2MEK A;  5KHO A;  1CK1 A;  3PZ7 A;  2EMS A;  1I4H A;  4W9I A;  1I4X A;  1I35 A;  4MGK E;  1WGD A;  3A1Q B;  5EE1 A;  2H88 B;  4JX1 C;  4USA A;  1JWS D;  1D4B A;  2LJI A;  4XC2 A;  1GC7 A;  2ASQ A;  3TL5 A;  2MX2 A;  3HRD D;  4FXC A;  2JU6 X;  3IHP C;  2D3B A;  3L08 A;  3RN9 C;  4C4V B;  2IO2 B;  1GOZ A;  3NZU A;  3H8H A;  2ICI A;  1J0G A;  3P4P B;  3ZJV A;  1FFV A;  2SAK A;  1T0Q C;  5FR3 A;  2KAC A;  3IT6 B;  3V6E B;  1WJU A;  3FKY A;  1E90 A;  2JRI B;  1C4P A;  2KWD A;  1PGB A;  1F0Z A;  2LWP A;  2KXJ A;  4PK1 A;  3KVF B;  2EKI A;  4JLC A;  3ZJU A;  4URK A;  5JHB A;  1ZOY B;  4AWJ A;  3X0W A;  2K9X A;  3R2I A;  4ACF A;  4YWG G;  4BKG A;  3TMP B;  2ZNV C;  2L76 A;  4BFR A;  1E7U A;  4GDK B;  3ZQ4 A;  4OVV A;  3IXS A;  4US9 A;  3H6N A;  3P1M A;  1WZ3 A;  2IO0 B;  1P0R A;  1EF1 A;  4IKG A;  1EUV B;  1P98 A;  4AJW A;  3ZXR A;  2CU3 A;  3IVF A;  3DVN U;  3I3T B;  5BO4 B;  2BKR B;  1TJE A;  3KH0 A;  3V6C B;  4P6V F;  3U7Z A;  2QJL A;  1YJI A;  2N4F A;  2KJ6 A;  4HLE A;  2D2Q A;  3N3K B;  1SJH D;  1FXI A;  3S2A A;  4S0R A;  2LGS A;  3U8Z A;  3GE3 C;  2AX5 A;  3AE3 B;  2K6D B;  2LHE A;  1WF9 A;  4FJZ A;  4BKT A;  2I38 A;  1VLB A;  4OZC A;  1IP9 A;  4F7Z A;  1WYG A;  3ABV B;  4JQW C;  1FM0 D;  1V1P B;  2J0J A;  3VAW A;  1LQB A;  3Q8E A;  2IZV B;  3QIJ A;  1RRB A;  1V1O A;  1WGY A;  1L7Y A;  5LXH A;  1TY2 A;  4XWT A;  1OQR A;  1WI0 A;  5D94 A;  4KZ0 A;  3NZS A;  2IY0 B;  1WIA A;  2WYQ A;  4ZDV A;  2QHO A;  5IP4 D;  2W55 A;  2L52 A;  1ACC A;  1NEK B;  2PLP A;  4MM3 A;  2DZJ A;  2YEP F;  1NVI D;  1YN5 A;  2V9H A;  3UI3 A;  4IM2 A;  3LDZ E;  1QF6 A;  2J52 A;  4LJP B;  3RUL A;  1OTR B;  2NBV B;  3Q3J A;  1JRU A;  5AZG A;  2IYD B;  3NG0 A;  4MGY E;  4I6P A;  3X23 A;  3H7P B;  1JRP A;  1OEY A;  3DPD A;  3U52 E;  2LHD A;  4KSL C;  3AE2 B;  2KTR A;  3DHI C;  5G55 A;  3ZTD A;  1QOA A;  3OLM D;  5JH5 C;  2GRI A;  1C1Y B;  3VDZ A;  2BYE A;  4BKS A;  4II2 B;  3PHX B;  1E8W A;  2VZK B;  1P7F A;  3VTW A;  4DQO C;  2ZPN A;  1XD3 B;  2L3Z A;  3IFW B;  4KX6 B;  3PZ8 A;  2NMQ A;  4B6W A;  4FUL A;  1C9F A;  3N9Y C;  4ANV A;  1Q5W B;  1TZO A;  5C1Z A;  1IGC A;  2L32 A;  4XGA B;  3KYD D;  4H2A A;  2LI5 A;  2WDR B;  3TSS A;  4RM9 A;  4K81 A;  2MJD A;  1V49 A;  1EU4 A;  3UF8 A;  3H9D A;  4KDI C;  1WGH A;  4WJP A;  2MP2 A;  1V8C A;  4C00 A;  3MP9 A;  2FID A;  2ZCC A;  2AQ2 B;  3QQ8 B;  3EFC A;  4RGM A;  1WMH B;  2NS5 A;  2LGX A;  4HWI B;  4EOY A;  1SJE D;  2MWS B;  4REZ A;  3SFE B;  4C7Z A;  3UIO B;  3AI5 A;  1EF5 A;  2MA9 B;  1UWM A;  2PTL A;  1E0Z A;  4OVU A;  1F9J A;  1TGZ B;  4O1N A;  3KQ4 A;  3PT2 B;  1UD7 A;  2MH7 A;  3BVM A;  3DBR I;  1I7H A;  3Q8C A;  2BYT A;  1QKZ A;  2W82 A;  4DHZ E;  1FXA A;  1EM7 A;  1R7S A;  2QIL A;  2QIE B;  3ZLZ A;  3PTF C;  2ZW0 A;  2J0K A;  2M1M A;  1K50 A;  2ZEQ A;  3KWV A;  2WWZ A;  4MSQ B;  3ZW3 A;  1VZ7 A;  4FN2 A;  3VR8 B;  4EZJ A;  1TTN A;  2L7R A;  3EGR A;  4IM3 A;  3PRM B;  2GBR A;  1NYR A;  4FLH A;  1YD8 U;  5D3D A;  1JCK B;  2DAJ A;  3NHE B;  2XEW A;  2K0P A;  1C79 A;  3AXC A;  3QAQ A;  3VUX A;  3ZUN A;  4XX5 A;  1YQ4 B;  2N9K A;  5EE9 A;  4I6N B;  1V6E A;  4NQL B;  5D3I B;  1JW9 D;  2JRH A;  2CS4 A;  3BII D;  3IAS 1;  1H8C A;  2Y5B B;  2BT6 A;  2RMM A;  1ZDV A;  2V4I B;  2KTF A;  4EZL A;  1OEY J;  1PDX A;  3APF A;  4OHJ A;  1WM2 A;  3DOW A;  4C80 A;  1P9D U;  1IBX B;  4JE3 B;  3AED B;  2NPT A;  3ZNI D;  3PRE A;  2KMA A;  1WSP A;  4ZHP A;  1MFW A;  4RGT A;  1QT9 A;  2R2Q A;  1L0Y B;  3ZDM C;  2WXL A;  1TS2 A;  4NZL B;  2L05 A;  1WWT A;  4HCN B;  5HFY A;  2G45 B;  4M00 A;  1E8Y A;  2WX0 A;  3B2G A;  1XEE A;  2DYM A;  2ONQ A;  1RYJ A;  5C23 A;  1KOT A;  2G4S A;  1UGM A;  3VTV A;  2DZI A;  2AQ1 B;  4L2Y A;  2IGG A;  4WWO A;  1HZ5 A;  2QMT A;  1FO4 A;  2IPK D;  2KWV B;  3IAM 1;  1B9R A;  3AU5 A;  1QOG A;  3IBE A;  2C5L C;  2FUG 1;  5D2M B;  1K52 A;  4DHJ B;  3RFZ B;  2WXR A;  2R2O A;  4PS3 A;  2BW2 A;  4KSK C;  4ASW C;  3CST A;  4JWU C;  2KT7 A;  1T5X D;  3MJ5 A;  4LDT B;  1MHX A;  1MVK A;  1HTO A;  3NS1 A;  3NUH B;  3QA8 A;  3EUB 2;  4MT5 A;  4DHZ B;  2LVO A;  1Z5S B;  1G6J A;  1T3Q A;  4A6Q A;  2Y5P A;  2IGH A;  1E8X A;  3L0W B;  2WXN A;  3ALB A;  2ACZ B;  1DOX A;  4BOS C;  2FE8 A;  4HRO A;  2WS3 B;  5KHQ A;  2JQR B;  3V60 A;  2KX3 A;  2LGD A;  2WDQ B;  2MJE A;  2Y5C A;  4LJO B;  2GOW A;  4DXG A;  4CO7 A;  3PZD A;  1WR6 E;  3PSE B;  5AUK A;  4XYC A;  1V5O A;  3WAM A;  2XBB C;  2AQ3 B;  2BWF A;  2RR9 A;  3TEW A;  2EMT A;  2G1E A;  4A55 A;  3NY5 A;  1MG4 A;  2MW5 A;  2KC1 A;  2LVQ A;  1FIQ A;  4HVB A;  1AWD A;  4S17 A;  4HK2 A;  1ET9 A;  4W9J A;  2GBN A;  4YSZ B;  1V86 A;  3CWI A;  3W1S C;  1U4A A;  1I4Q A;  3AB5 A;  4WQM A;  2WXQ A;  5C2T B;  3W1Y A;  3PS6 A;  1I4G A;  2L83 A;  3MC8 A;  2UWQ A;  4ZRK A;  1E6E B;  5I4D A;  2JXT A;  2O6V B;  5C3J B;  2I2Y A;  1OFF A;  2LUM A;  3VH4 B;  2RGF A;  4LNN A;  2KLC A;  2MSE D;  4FJV B;  3JSV A;  1TBE A;  4JPS A;  3APC A;  2IDY A;  5LXI B;  2KOX A;  3JVZ X;  1L6V A;  3SU8 X;  2PW9 A;  3R2T A;  5HKH A;  2UYZ B;  1V97 A;  5H8Y E;  4E3C A;  5FR6 A;  3B2F A;  3P2B A;  1QLB B;  1VZ8 A;  3HK0 A;  3RNE C;  3A9J B;  2QCZ A;  4ICV A;  2NVU I;  2I1K A;  4ANU A;  1L4D B;  2AYO B;  2WGS A;  3HM6 X;  4IC7 B;  2KQS A;  3L10 B;  1WFY A;  4AP4 C;  3BK2 A;  3KW5 B;  4NAM A;  1YMH E;  1WRI A;  1IGD A;  1A5R A;  2INN E;  1FFU A;  2LVP A;  2N9E B;  1F2R C;  1GPX A;  4LNI A;  5EE0 A;  2J4X A;  1EWY C;  4C56 C;  5BYR A;  4WJN A;  2NTS A;  2PVO D;  1FCC C;  3MC9 A;  1H4R A;  4PT5 A;  1CQV A;  2M0X A;  3RNC C;  4AJY B;  1L2N A;  3PGE A;  3T8M A;  2WXF A;  5DPT A;  1MG8 A;  3RZF A;  3DBH B;  1ZP0 B;  1AAR A;  2KHW B;  3PPA A;  1FEH A;  2JVC A;  1DYQ A;  5DPW A;  1E10 A;  3FC4 A;  3TEX A;  2RPQ A;  4W9D A;  1N63 A;  1A70 A;  4XWW A;  2VZK D;  4JL9 A;  2IGD A;  2KFJ A;  4OVZ A;  2BYF A;  3O13 A;  1I4P A;  2RPV A;  1DOI A;  4HRS A;  1V9J A;  3URY A;  3RNF C;  2O2V A;  4M0W B;  1FMA D;  3RNA C;  2V1Y A;  1CMX B;  2ZPY A;  2M56 B;  1YQ3 B;  2KAJ A;  1ZGU B;  1LO5 D;  1YQB A;  4NJ6 A;  2KVZ A;  1KRH A;  1N62 A;  2KMC A;  2V4L A;  3MFG A;  4G11 A;  4EEW A;  4BZA A;  2WXK A;  3QWZ B;  2QEJ C;  1E7V A;  3MTN B;  3A1Q A;  3ECI A;  2E6X A;  4E71 A;  1E9M A;  3AE4 B;  3A33 B;  1D6E C;  2PPH A;  1S3S G;  1VDV A;  2KZR A;  2JZZ A;  4MGI E;  2M4N A;  4C4V A;  1YJJ A;  2N7J A;  2B76 B;  2BB5 A;  2IJ0 A;  1V80 A;  3FIL A;  4WJO A;  4XDC A;  2OED A;  2VRR B;  4CHK A;  1UUP A;  3WAL A;  1JRO A;  1TS4 A;  4CQN A;  1LGR A;  4GXB A;  3P63 A;  3Q8A A;  3Q69 A;  2W9N A;  2D3G A;  1SF0 A;  1GC6 A;  2MLB A;  2BS2 B;  5LLI A;  2WDV B;  1TIF A;  2GMI C;  1XO3 A;  4DDI D;  3SFD B;  3U4E G;  3ZRF A;  5BYQ A;  1HA5 A;  2XK5 B;  3A4S C;  4RM8 A;  1C3T A;  1RFA A;  2DZM A;  2HE7 A;  1JML A;  3B1L X;  4GDK A;  4HKQ A;  2K8B A;  1DGJ A;  1VR9 A;  2IND C;  2WNM A;  3B08 A;  1YX5 B;  1J7B A;  3PRZ A;  4GU2 A;  4II3 B;  2ON8 A;  5EDS A;  3VHT C;  2LFI A;  3PV1 A;  2KMM A;  4MAC A;  2HD5 B;  4C7Y A;  2KWC A;  2J7Q B;  2CKH B;  1GG3 A;  4LLG M;  4ITK A;  4RMA A;  1WE6 A;  4AUQ C;  4NQK E;  4HPL B;  1K51 A;  3HVD A;  3PHW B;  3AV8 A;  3ZNZ B;  5CHW A;  2MP2 B;  3AN1 A;  3LXF A;  4NAW A;  2GB1 A;  3L54 A;  2C7H A;  2KN5 A;  2X38 A;  1MPE A;  2JUO A;  1QOB A;  4G50 A;  4K1R B;  2Z59 B;  2K1F A;  3ENE A;  2V3S A;  2CHW A;  1C77 A;  3T3N A;  1VZ6 A;  2L8J A;  4W9G A;  2LMC A;  2RDG A;  2GBK A;  3AU4 A;  2DHZ A;  4W9L A;  3ZVV A;  1YOV B;  4M8M A;  2DWQ A;  2XNA C;  3BVG A;  4RF0 A;  1D5X C;  4LTU A;  1WYW B;  4TQ1 A;  1I42 A;  1SBB B;  2D3C A;  3E9S A;  4LDT D;  2DAF A;  1BT0 A;  1HZ6 A;  4R3D A;  3TBL D;  2LRU A;  2ZJD A;  4MDK E;  3AE1 B;  3V05 A;  2EKE C;  4BBN C;  2MRP A;  3I63 C;  4GDL A;  1KLU D;  1GJZ A;  5H92 C;  3NVZ A;  4P16 A;  5AUI A;  2WU5 B;  3PVL A;  2RSU A;  3BYY B;  1WXS A;  3P4R B;  1ESF A;  2LXA A;  3GS2 A;  1WZ0 A;  1BXT A;  4YSY B;  3C19 A;  4N6E B;  4HCP B;  4N59 A;  1OQY A;  4B9K A;  4M8N A;  3H7P A;  3P4Q B;  4WUR A;  1P1A A;  2N9X A;  3AEB B;  2KFK B;  5TR5 A;  2KD0 A;  3NVV A;  4NJ7 A;  3GE8 C;  4GMV A;  1FPY A;  2IO3 B;  2K8C A;  2NPT B;  4KGR A;  4OZA A;  3EFU A;  3RUI B;  2KAN A;  2G4D B;  4G3X B;  3M95 A;  3Q6B A;  3IG3 A;  5G5H A;  4BOZ B;  1WXQ A;  1N60 A;  3U7D A;  2GBJ A;  1LM8 B;  1TS5 A;  1V2Y A;  4DXF A;  2UU7 A;  3AUL A;  1SXT A;  2MBE A;  3AEF B;  1ROE A;  3W9C B;  4EKU A;  1XLQ A;  1R4N I;  1R4M I;  4B0M A;  3J9C A;  4ARC A;  3W5V B;  4RFB A;  4OW0 A;  3WAO A;  1EWC A;  4ICU A;  4J3O D;  1N61 A;  4RF1 A;  2YEP B;  5CTR C;  1QZE A;  1YIW A;  3EC8 A;  4TUU A;  2KC2 A;  4KGT A;  2O6V D;  3K9O B;  4GB9 A;  3ETR A;  3DVN V;  3BIN A;  1WMH A;  1OGW A;  3HIZ A;  2KWU B;  1D5Z C;  3UQB A;  4YTM B;  4P1C C;  1ENF A;  3VH3 B;  2FUH B;  1NI2 A;  1RAX A;  2NR2 A;  4KZC A;  2WX1 A;  3M62 B;  3VRA B;  3RCZ A;  1YNT E;  3T9L A;  2PIA A;  2BB6 A;  3K9P B;  3WIM A;  2RDH A;  2YLM A;  1P3Q U;  4K7U A;  5JHA A;  2BBC A;  5LNK 1;  3VTU A;  2V3P A;  3B0A A;  3HUI A;  3BZD B;  1KF6 B;  4YXD B;  1JAL A;  5AEK B;  1WY8 A;  3KUC B;  5L83 A;  3GZN I;  3MJW A;  3Q3N C;  3ONS A;  2AL6 A;  1WGK A;  5G5G A;  3ZYY X;  2M8S A;  3QC8 B;  4KIK B;  1EO6 A;  2KKC A;  2BPS A;  1RFK A;  4K7S A;  4P7I A;  3RI7 C;  2IY1 B;  4PS8 A;  3VUW A;  4TV3 A;  1UF0 A;  4L1B A;  4WAA A;  1WX8 A;  2QSD A;  4KV2 A;  4W9F A;  5MPO A;  2DEN B;  3QK0 A;  1QQR A;  3IT4 B;  2K8H A;  1L6U A;  2CJO A;  1K53 A;  4DBG A;  2M19 A;  1XLP A;  5E6N A;  1TT5 B;  4ZRI A;  1AW7 A;  2K25 A;  3V3X A;  1YX6 B;  3CIR B;  4FJY A;  2N1V A;  5GMV A;  2LUE A;  4M02 A;  1C76 A;  2BS4 B;  5DCN A;  5J18 A;  1CJE A;  2FCQ A;  1V5T A;  2FNJ B;  2WXI A;  3DQV A;  3EHV A;  4L23 A;  3RYT A;  3SR6 A;  3DVG X;  1PGA A;  1YN4 A;  2J42 A;  4TQ0 A;  2D10 A;  5IA7 A;  1WX7 A;  2MQJ A;  2QC8 A;  1UBI A;  3AE9 B;  4HEA 1;  3JSV B;  2CHX A;  4W9E A;  3ML9 A;  2DYO A;  1Y8R C;  3OJ3 A;  5E6P A;  2KDI A;  3AE6 B;  2INP E;  4GLS C;  4ANW A;  4ZRQ A;  1KFY B;  2LGY A;  2NCN A;  1XLN A;  2GBM A;  3H1U A;  4IOI E;  1MJD A;  2PJH A;  4WIP A;  3WAP A;  1L5P A;  2MBH A;  5E6O A;  3PLV A;  3H7S A;  3DBR B;  1HXY D;  2KDE B;  3O65 B;  5HI1 A;  2JYT A;  5AZH A;  1BUI C;  4DWF A;  4E74 A;  5L95 C;  1L4Z B;  4UDU C;  4RH6 A;  1GB1 A;  3EA6 A;  4J6I A;  1LFD A;  5IN7 A;  2NBU A;  2AL3 A;  5IO9 A;  3TEY A;  4AQ7 A;  3L16 A;  3ZDT A;  1VCB A;  2MJ3 A;  3MHS D;  3AEA B;  1R4M B;  3GOE A;  1TS3 A;  2JF5 A;  2WXO A;  3Q3O C;  4LK0 M;  2D5G A;  3CSF A;  2JXX A;  2K3U A;  3P4S B;  2KJH B;  5IKC M;  5AZF A;  1ZW7 A;  1XCQ L;  4WWN A;  1GB4 A;  2WXJ A;  2KNB A;  2OJR A;  4GSW A;  2VH2 A;  2BGF A;  2FAZ A;  4AS1 A;  4FAD A;  3JW0 X;  4HDQ A;  4RGN A;  1NEN B;  2MHJ A;  2BTE A;  5JXV A;  2WXM A;  2JWU A;  3P42 A;  1FNU A;  1ISN A;  5E6J A;  1ZXI A;  4ZYN A;  2HTM E;  5G2N A;  3ZKJ C;  4KVG B;  4NJC A;  2BF8 B;  4EZK A;  3DHH C;  3BYT B;  2BQQ A;  5GXG B;  2Q5W D;  1PFD A;  2LZ6 A;  2ZZP B;  1F2R I;  2ZVO A;  3DHG C;  3NRZ A;  4A8X C;  4WWP A;  2KX0 A;  3HVZ A;  3Q8F A;  4BVU C;  3RNB C;  3W5U B;  2HJ1 A;  3LJ3 A;  2O6V A;  4YL8 A;  1SIF A;  5DPR A;  2K6Q A;  3Q14 C;  1X1M A;  4HPM B;  3RNG C;  1BML C;  1FNV A;  4IWQ A;  2GI9 A;  4IWO A;  3NVY A;  2WDT B;  3AE8 B;  4D2K A;  3NVW A;  1SIJ A;  1LXD A;  2G3Q B;  3GZN B;  5BMH A;  4NPN A;  4WJQ A;  1T0Y A;  3TJP A;  2JZP A;  1WR1 A;  4US8 A;  3A9K A;  3Q3F A;  1E5W A;  1ZDX A;  3LYY A;  1EU3 A;  3A9J A;  4EE2 A;  3C8Y A;  1JWM D;  3T3O A;  1C78 A;  1KTK A;  1WM3 A;  4A20 A;  4HJG E;  3AEE B;  2BWE S;  2CU1 A;  2INC C;  1Y56 A;  2RD0 A;  2PE9 A;  4LNO A;  4WQO B;  4B95 A;  1F77 A;  2JT4 B;  1UEL A;  1V81 A;  2W3S A;  3R3M A;  4M01 A;  2WXH A;  1KH0 A;  3FIL B;  2L1A A;  1TKE A;  3ZO5 B;  4MJS A;  3AEC B;  1WGR A;  2V3N A;  4IW0 A;  4XZ4 A;  2WXG A;  1ZUD 2;  3VRB B;  5IOI A;  4IUM B;  3EEC A;  2J0M A;  2K39 A;  1NYQ A;  1HTQ A;  4JGH B;  1E7P B;  2N9P C;  3WA0 A;  4JWS C;  4ANX A;  4OZB A;  2R61 A;  1ET6 A;  3DWG C;  3QHT A;  2JSV X;  4A3P A;  1NBF C;  1ZPS A;  1NI3 A;  4MSM B;  1PGX A;  4MM3 B;  2MBO A;  1XLO A;  4ZRP A;  4WWM A;  1TZ1 A;  2BYV E;  1IPG A;  4I6L B;  3DBS A;  1Q0W B;  1WXA A;  3A4R A;  3OJ4 B;  3SEB A;  1T6B X;  4K3B A;  2LRW A;  1KM7 A;  1MHH E;  4M0W A;  1SE3 A;  2KVR A;  2RDB C;  3I5J C;  4AOF A;  4IM0 A;  4NAW B;  5HG2 A;  4P1B C;  2JZ3 B;  2KTR B;  1IUE A;  4HXD A;  3Q2A C;  3KUD B;  2A4Z A;  3GP7 A;  1ZE3 D;  2FCS A;  4PS7 A;  4MH8 A;  1HEZ E;  1F1H A;  4KDL B;  3NOB A;  2M0A A;  3RT3 B;  2WLB A;  2H89 B;  3Q3M C;  4MGZ E;  2QDF A;  2BKF A;  3AEG B;  4QAY A;  1RLF A;  2A5U A;  3DVG Y;  3M3J A;  3W1S A;  2HDE A;  2I1J A;  5FKA C;  1WJ4 A;  2DNF A;  2AWT A;  1TY0 A;  3E56 A;  4GDL B;  5BYS A;  2J53 A;  5TSS A;  1SE2 A;  1HE8 A;  3I9V 1;  4WH4 A;  3LB8 C;  3U30 A;  2OOB B;  4HKZ E;  1WXV A;  1V1P A;  3QAR A;  2N7E A;  1UZX B;  4HDO A;  1WGG A;  3JYU A;  3SDL C;  2W3R A;  4RGO S;  4DXA B;  1P7E A;  1RWS A;  3VXW A;  3ML8 A;  4DHJ D;  1KJT A;  2XK5 A;  1J7A A;  3HM3 A;  1Q10 A;  4IWP A;  2ZVN A;  4KKJ A;  3VVW B;  2JY6 A;  4YSX B;  4LCD E;  4A90 A;  2PVG C;  1GUA B;  2DX5 B;  2CR5 A;  3AMZ A;  2CJN A;  1PYW D;  3R7R A;  2Z8L A;  3UQA A;  2GLS A;  1KLG D;  3OWE B;  1XCT L;  4RCO A;  3DBL I;  1UH6 A;  3ZXV A;  4FBJ B;  2KYW A;  1T0S C;  5J17 A;  3B9J A;  1L0V B;  5CHF A;  3DWM A;  2SEB D;  4K7W A;  4K3C A;  4F1S A;  1FD6 A;  2BS3 B;  1HQR D;  4ZRJ A;  1D5M C;  1I4R A;  3DDC B;  5T8I A;  2KLG A;  2DZK A;  3AH7 A;  3ZRC A;  4F8C B;  1SE9 A;  2DLB A;  3HHM A;  2DBY A;  3R8B A;  3AE5 B;  1WXM A;  3D32 A;  1T0R C;  2ZNV B;  3SD5 A;  2KN4 A;  3RPF C;  3RZW C;  3SHQ A;  4A3O A;  3KWL A;  2W54 A;  4CYE A;  4EFO A;  3APD A;  4HJK A;  4BBN F;  4FHJ A;  3BK1 A;  2OHF A;  1JWU D;  2KDM A;  3CF6 E;  2Y3A A;  3AM9 A;  2L0F A;  4RNA A;  2M17 A;  2MCN B;  1AN8 A;  1NDD A;  3L13 A;  3KUZ A;  3DCG A;  3MHZ A;  1TYG B;  2TSS A;  4MEM A;  2PMV A;  1UBQ A;  2WP9 B;  5D6J B;  1N5W A;  2L00 B;  2KDF B;  3V61 A;  1J19 A;  1M4V A;  1UWX A;  3N1Y C;  3Q8B A;  3UIN B;  1XT9 B;  5BMI A;  2PE6 B;  2OJW A;  2L0T A;  3R66 C;  3M63 B;  1FXT B;  4Q2J A;  1RM6 C;  2LAS A;  3VR9 B;  3MC0 B;  4NNJ B;  2KQ4 X;  2Z0D B;  2NBW B;  1N6Z A;  4IDI A;  4FA6 A;  4PYU A;  1WH3 A;  3C0R B;  2LEK A;  1SE4 A;  3PLU A;  2KFK A;  1WJN A;  2ZCB A;  4FHK A;  3N1X C;  3OG5 A;  3RMK C;  2JPH A;  3N20 C;  2C9W B;  2N1W A;  1FNW A;  2Z0E B;  4TMA B;  3TEZ A;  4GGQ A;  3WAN A;  2B3A A;  4N58 A;  2IBI B;  2MBQ A;  2FCN A;  3BWU D;  3KLS X;  4B0E A;  2NTT A;  3WCQ A;  3QCA A;  4TSS A;  3L4P A;  3I57 A;  3OAW A;  2AEH A;  1B1Z A;  1XQQ A;  2DYB A;  1MI0 A;  4ZYS A;  2WU2 B;  4NY0 A;  4X57 B;  4YTP B;  4JIO U;  2K22 A;  1WE7 A;  5J2R A;  5BMG A;  5IAA C;  1ZKH A;  2MBB B;  4EUT A;  3FAH A;  1UNS A;  3DBH I;  3N32 A;  4GOC A;  1TKG A;  1OQQ A;  4G0N B;  3L17 A;  2WXP A;  1UGJ A;  2VH1 A;  2LXC A;  3ZIM A;  2WQY B;  1IBX A;  3NJT A;  2HJ8 A;  4ZHO A;  3BVZ A;  3NZ3 A;  3W2D A;  1D3Z A; 
#chains in the Genus database with same CATH homology
 2Q5W D;  1PFD A;  1TS4 A;  4ARI A;  1F2R I;  3SFE B;  4CQN A;  4C7Z A;  3P63 A;  3NRZ A;  3Q8A A;  4A8X C;  3Q69 A;  1UWM A;  2E3T A;  2PTL A;  1E0Z A;  1GAQ B;  3HVZ A;  3Q8F A;  3U2S C;  1CZP A;  1SF0 A;  1C4A A;  4O1N A;  2BS2 B;  3KQ4 A;  2WDV B;  3W5U B;  2MH7 A;  3BVM A;  1I7H A;  3Q8C A;  1XO3 A;  2BYT A;  1QOF A;  2N0S B;  1QKZ A;  3SFD B;  3U4E G;  5BYQ A;  1HA5 A;  2W82 A;  1FXA A;  1EM7 A;  1R7S A;  2QIL A;  4XE0 A;  2QIE B;  1JML A;  1BML C;  1DOY A;  2ZW0 A;  1FNV A;  2GI9 A;  1K50 A;  3KWV A;  2JYE A;  3NVY A;  3AE8 B;  1VZ7 A;  4HKQ A;  4D2K A;  3VR8 B;  3NVW A;  1SIJ A;  3EGR A;  1DGJ A;  1VR9 A;  3PO0 A;  5BMH A;  2WNM A;  1J7B A;  1NYR A;  5D3D A;  1JCK B;  2ON8 A;  1L0X B;  2K0P A;  1C79 A;  2JZP A;  4US8 A;  2LFI A;  2KMM A;  4MAC A;  1ZDX A;  3ZJT A;  1YQ4 B;  2N9K A;  5EE9 A;  4C7Y A;  1YN3 A;  1SB3 C;  4LLG M;  4ITK A;  3LYY A;  1EU3 A;  1PUT A;  1JW9 D;  5D3I B;  4EE2 A;  1K51 A;  3C8Y A;  3HVD A;  1JWM D;  3BII D;  1ZXH A;  3IAS 1;  5FK9 C;  3T3O A;  1C78 A;  1JWB D;  2BT6 A;  2RMM A;  1KTK A;  1ZDV A;  2V4I B;  3AV8 A;  4HJG E;  3AEE B;  4WAF A;  1PDX A;  1Y56 A;  4OHJ A;  1F77 A;  3AN1 A;  3LXF A;  4C80 A;  1IBX B;  4JE3 B;  2W3S A;  2GB1 A;  3AED B;  1WSP A;  2WXH A;  2X38 A;  4ZHP A;  1MPE A;  1KH0 A;  3FIL B;  1QIL A;  2L1A A;  1QOB A;  1TKE A;  4RGT A;  1QT9 A;  3AEC B;  1N5X A;  1L0Y B;  2V3N A;  4KGS A;  1C77 A;  3T3N A;  2WXL A;  1TS2 A;  1VZ6 A;  4NZL B;  2WXG A;  2LMC A;  1WWT A;  2RDG A;  5HFY A;  1FRR A;  1ZUD 2;  3VRB B;  3B2G A;  1XEE A;  2DWQ A;  2PKO A;  2XNA C;  2DYM A;  3BVG A;  2ONQ A;  1RYJ A;  4RF0 A;  2K5P A;  4YT0 B;  1SEB D;  1SSN A;  2EEL A;  1NYQ A;  1E7P B;  1D5X C;  4LTU A;  3AE7 B;  4JWS C;  1JQ4 A;  4OZB A;  1J7C A;  4TQ1 A;  1SBB B;  2R61 A;  3E9S A;  1ET6 A;  3DWG C;  5EE3 A;  1HZ6 A;  2G9H D;  4R3D A;  2JSV X;  1AYF A;  3GB1 A;  3AE1 B;  1JWA D;  3V05 A;  1ZPS A;  4KKI A;  1NI3 A;  1PGX A;  2AQ1 B;  4L2Y A;  2IGG A;  4MM3 B;  1FRD A;  1XXG A;  1HZ5 A;  1KLU D;  2JX5 A;  1XLO A;  4ZRP A;  3NVZ A;  4P16 A;  5H92 C;  4WWM A;  5AUI A;  2WU5 B;  3BYY B;  2QMT A;  3TUO A;  3P4R B;  1FO4 A;  2IPK D;  3IAM 1;  1B9R A;  1ESF A;  3ZGZ A;  1QOG A;  1XF5 L;  2FUG 1;  2N9L A;  3GS2 A;  1K52 A;  3SEB A;  4A9A A;  1BXT A;  3RFZ B;  4YSY B;  1T6B X;  2WXR A;  4N6E B;  4N59 A;  2BW2 A;  4JWU C;  1MHH E;  4ZOH C;  3P4Q B;  4M0W A;  1SE3 A;  1T5X D;  4WUR A;  4YTN B;  3AEB B;  3MJ5 A;  2V0G A;  1MHX A;  3NVV A;  2ZW1 A;  1MVK A;  2FBW B;  3NS1 A;  3NUH B;  3EUB 2;  4MT5 A;  4NAW B;  5HG2 A;  1C4C A;  1VJK A;  1VRA B;  4KGR A;  4OZA A;  1IUE A;  2LGI A;  1FCL A;  4XDD A;  1T3Q A;  4A6Q A;  2XN9 C;  2Y5P A;  2IGH A;  1STE A;  3GP7 A;  5G5H A;  1ZE3 D;  2WXN A;  3VQI A;  1WXQ A;  1N60 A;  2ACZ B;  1DOX A;  5D7G A;  2FE8 A;  4HRO A;  4MH8 A;  5HHD G;  2WS3 B;  1HEZ E;  1TS5 A;  2JQR B;  1TKY A;  4DXF A;  2M0A A;  2MEK A;  2WDQ B;  1CK1 A;  1SXT A;  2MJE A;  2WLB A;  2H89 B;  2Y5C A;  1ROE A;  3AEF B;  3PZ7 A;  3W9C B;  1XLQ A;  1I4H A;  4DXG A;  4B0M A;  1I4X A;  3J9C A;  4ARC A;  3AEG B;  3W5V B;  4RFB A;  4OW0 A;  5EE1 A;  1EWC A;  2H88 B;  4JX1 C;  4USA A;  5AUK A;  4J3O D;  1JWS D;  1N61 A;  1D4B A;  4RF1 A;  3W1S A;  2YEP B;  2LJI A;  2HDE A;  5FKA C;  3HRD D;  2AQ3 B;  4KGT A;  4FXC A;  2JU6 X;  1TY0 A;  3ETR A;  3E56 A;  3TEW A;  4GDL B;  2G1E A;  5BYS A;  4A55 A;  2J53 A;  5TSS A;  1D5Z C;  1SE2 A;  1FIQ A;  1GOZ A;  3H8H A;  2ICI A;  1AWD A;  3P4P B;  3ZJV A;  1FFV A;  3I9V 1;  4WH4 A;  4YTM B;  2SAK A;  1ET9 A;  5FR3 A;  2KAC A;  3LB8 C;  4YSZ B;  1ENF A;  3IT6 B;  4HKZ E;  3CWI A;  1V1P A;  1C4P A;  2KWD A;  1PGB A;  1F0Z A;  1I4Q A;  3AB5 A;  3VRA B;  4WQM A;  1YNT E;  2WXQ A;  2PIA A;  5C2T B;  2W3R A;  1I4G A;  2EKI A;  2L83 A;  4RGO S;  2BB6 A;  1P7E A;  3ZJU A;  1RWS A;  2RDH A;  1E6E B;  5I4D A;  2JXT A;  5C3J B;  1J7A A;  1ZOY B;  1Q10 A;  2I2Y A;  1OFF A;  2LUM A;  4KKJ A;  2K9X A;  3R2I A;  2BBC A;  4YWG G;  5LNK 1;  4YSX B;  4A90 A;  4JPS A;  2V3P A;  3HUI A;  3BZD B;  1KF6 B;  4GDK B;  4YXD B;  3ZQ4 A;  1JAL A;  3IXS A;  2PVG C;  2IDY A;  4US9 A;  3P1M A;  3AMZ A;  2CJN A;  1PYW D;  4IKG A;  1L6V A;  2Z8L A;  1KLG D;  2PW9 A;  1WGK A;  3R2T A;  3OWE B;  2CU3 A;  5G5G A;  3ZYY X;  1V97 A;  5H8Y E;  1XCT L;  4RCO A;  3B2F A;  1TJE A;  1RFK A;  1QLB B;  1VZ8 A;  3B9J A;  4P6V F;  3U7Z A;  1L0V B;  3DWM A;  4L1B A;  1L4D B;  2SEB D;  2QJL A;  2QSD A;  1YJI A;  1FD6 A;  2BS3 B;  5MPO A;  1HQR D;  1SJH D;  1QQR A;  3IT4 B;  1D5M C;  1FXI A;  1L6U A;  1I4R A;  2CJO A;  1K53 A;  3BK2 A;  4NAM A;  1YMH E;  1WRI A;  1IGD A;  5T8I A;  2INN E;  1FFU A;  2M19 A;  1XLP A;  3AH7 A;  2AX5 A;  3AE3 B;  2LHE A;  1AW7 A;  1F2R C;  2I38 A;  1VLB A;  4OZC A;  2DLB A;  3V3X A;  3CIR B;  1GPX A;  1WYG A;  2DBY A;  5EE0 A;  3AE5 B;  2J4X A;  1EWY C;  3R8B A;  3ABV B;  4C56 C;  1C76 A;  2BS4 B;  5BYR A;  1FM0 D;  1V1P B;  2KN4 A;  2NTS A;  2PVO D;  3RPF C;  1FCC C;  1CJE A;  4PT5 A;  3Q8E A;  5GXG B;  3KWL A;  2W54 A;  2WXI A;  1CQV A;  4L23 A;  1V1O A;  3SR6 A;  1PGA A;  1YN4 A;  2J42 A;  4TQ0 A;  3BK1 A;  2OHF A;  1JWU D;  2KDM A;  1TY2 A;  2Y3A A;  4XWT A;  1OQR A;  3AM9 A;  4RNA A;  2WXF A;  1AN8 A;  3MHZ A;  1TYG B;  2TSS A;  2W55 A;  2L52 A;  1ACC A;  1ZP0 B;  3AE9 B;  2PMV A;  4HEA 1;  2WP9 B;  1NEK B;  1N5W A;  2PLP A;  2DYO A;  1FEH A;  1UWX A;  1M4V A;  1DYQ A;  1E10 A;  3FC4 A;  2YEP F;  3Q8B A;  1NVI D;  3AE6 B;  2INP E;  5BMI A;  4GLS C;  1YN5 A;  3TEX A;  1N63 A;  1A70 A;  4Q2J A;  4ZRQ A;  2VZK D;  1RM6 C;  4XWW A;  3UI3 A;  1KFY B;  1QF6 A;  2IGD A;  2J52 A;  3VR9 B;  3MC0 B;  2KQ4 X;  1XLN A;  4OVZ A;  4IDI A;  3O13 A;  1I4P A;  2RPV A;  4IOI E;  1DOI A;  4HRS A;  4WIP A;  2LEK A;  1L5P A;  1SE4 A;  3URY A;  1JRP A;  1HXY D;  3U52 E;  2LHD A;  4TMA B;  3AE2 B;  1FNW A;  5HI1 A;  1FMA D;  2JYT A;  3TEZ A;  1BUI C;  1QOA A;  4N58 A;  2GRI A;  1L4Z B;  3BWU D;  3KLS X;  2M56 B;  4UDU C;  4B0E A;  4RH6 A;  1GB1 A;  1YQ3 B;  2KAJ A;  2NTT A;  2VZK B;  3EA6 A;  4TSS A;  3WCQ A;  3L4P A;  1LO5 D;  1P7F A;  3I57 A;  4DQO C;  1B1Z A;  3TEY A;  4AQ7 A;  1KRH A;  1N62 A;  1MI0 A;  4ZYS A;  2MJ3 A;  4KX6 B;  2WU2 B;  3PZ8 A;  2NMQ A;  3AEA B;  3MFG A;  1TS3 A;  2WXO A;  4YTP B;  2WXK A;  2K22 A;  2QEJ C;  3N9Y C;  4LK0 M;  1C9F A;  2D5G A;  1TZO A;  2K3U A;  3P4S B;  1IGC A;  5BMG A;  2E6X A;  1E9M A;  2L32 A;  3AE4 B;  1D6E C;  4H2A A;  2WDR B;  3TSS A;  3FAH A;  1UNS A;  1VDV A;  1TKG A;  1XCQ L;  1OQQ A;  1GB4 A;  2WXJ A;  2MJD A;  2WXP A;  1EU4 A;  1UGJ A;  1V8C A;  4AS1 A;  3MP9 A;  2WQY B;  4RGN A;  1NEN B;  1IBX A;  2AQ2 B;  2BTE A;  4RGM A;  1YJJ A;  2WXM A;  5JXV A;  2JWU A;  2N7J A;  2B76 B;  3P42 A;  4ZHO A;  2BB5 A;  1FNU A;  3BVZ A;  5E6J A;  1ZXI A;  2IJ0 A;  3FIL A;  3NZ3 A;  4XDC A;  2OED A;  3W2D A;  2HTM E;  4NJC A;  1UUP A;  1SJE D;  4REZ A;  3BYT B;  1JRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...