1JWBD

Structure of the covalent acyl-adenylate form of the moeb-moad protein complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
80
structure length
80
Chain Sequence
IKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
publication title Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 18
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2001-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwbD00
2W54A 4YTMB 3AE8B 1L0VB 3RPFC 1IUEA 1AYFA 1VJKA 2HTME 3AEGB 2EKIA 4US9A 1XLNA 1FO4A 1UWMA 1FXAA 2ACZB 1SIJA 2W55A 2WU5B 3EUB2 5C2TB 1DOIA 3AEAB 1QOGA 3VRAB 2B76B 2WQYB 4C7ZA 3P4PB 1FIQA 1L5PA 2WDVB 3DWMA 1DOYA 1RM6C 3AM9A 1DOXA 4WWMA 4N58A 1NVID 3AEFB 1N62A 1XLPA 4N59A 2L52A 1TYGB 2BS2B 3ABVB 1FM0D 1JWBD 1N61A 1OQQA 3WCQA 5EE1A 2PVOD 1TKGA 2LEKA 1YJIA 5EE0A 3AB5A 1FXIA 2K22A 1CZPA 3AECB 1VLBA 2Y5CA 2M56B 1TKYA 4YT0B 5H92C 1ZP0B 1JALA 4ITKA 2DWQA 1TJEA 1FFUA 2E3TA 1NYQA 4JWSC 2WU2B 2BT6A 3HUIA 3AEBB 3NVYA 3BIID 2CJNA 4IDIA 4YXDB 4KX6B 3NVVA 2MH7A 5GXGB 1OFFA 2WLBA 3AE2B 2QJLA 3NVZA 1A70A 1YJJA 2L83A 2QIEB 4YSXB 1V8CA 3LXFA 1R7SA 4YSZB 5EE3A 1I7HA 3AMZA 3P1MA 3AE5B 1KFYB 1PDXA 4HRSA 3VRBB 1ZOYB 1ROEA 1RFKA 3ETRA 3HVZA 5MPOA 1QF6A 2K9XA 2WS3B 1V97A 5AUIA 1N5WA 5G5GA 3B2GA 4US8A 3P63A 2AX5A 2OHFA 1QOFA 3AV8A 3P4RB 5H8YE 1F0ZA 1FMAD 3AE4B 4ZHOA 1N60A 1AWDA 3B2FA 1FRDA 1SB3C 1WRIA 2G1EA 1J7CA 2KMMA 1GAQB 2JQRB 5EE9A 1KRHA 1FFVA 1WWTA 2BS3B 3LB8C 1NEKB 4HROA 3SFEB 1J7BA 3AE7B 4JX1C 3SFDB 2KAJA 1EWYC 1ZUD2 2FBWB 1YQ3B 1NENB 1N5XA 4A9AA 1TKEA 1YQ4B 4ZHPA 3NRZA 3KWLA 3AEEB 2WDRB 1L6UA 1E9MA 1FRRA 2PVGC 4FXCA 4LTUA 4USAA 1ZXIA 1JQ4A 5C3JB 5G5HA 1OQRA 2N0SB 4YTNB 4C7YA 3NS1A 1B9RA 2PIAA 2M19A 2Q5WD 1PUTA 3FAHA 2MJDA 2K5PA 1WYGA 1DGJA 2CJOA 3VR8B 2H89B 1E10A 4ZOHC 2CU3A 3AE9B 1QOBA 3PO0A 3W9CB 2H88B 2WDQB 3SR6A 2WP9B 3P4SB 4N6EB 3AN1A 3VR9B 1JROA 1T3QA 2BS4B 2MJ3A 3B9JA 1VDVA 1JW9D 2DBYA 1E7PB 3NVWA 1JRPA 5AUKA 1E0ZA 4YTPB 1XLQA 1WXQA 1PFDA 1RWSA 2MJEA 3L4PA 3HRDD 3P4QB 4P6VF 1GPXA 1JWAD 3ZYYX 4C80A 1KF6B 1RYJA 1XLOA 3AEDB 1J7AA 3DWGC 1CJEA 1SF0A 1NI3A 2W3SA 3AE3B 3CIRB 4YSYB 2JX5A 3FC4A 4WQMA 3W5UB 1L6VA 3AH7A 1N63A 1QOAA 1QLBB 2PKOA 2W3RA 1WGKA 1E6EB 3CWIA 1XO3A 3AE6B 1NYRA 1QT9A 3W5VB 4JWUC 3AE1B
chains in the Genus database with same CATH superfamily
4YTMB 4M02A 1P0RA 2G4SA 2BYFA 2KJHB 4BOSC 1UWMA 1FXAA 2ACZB 1L0YB 1XEEA 2N1WA 3ZNGC 3RNGC 4KSKC 3DQVA 1JCKB 3V05A 2Z0DB 1YJIA 3QA8A 2FCQA 2AL6A 3TCAA 1V2YA 3N20C 4GU2A 2XK5B 1V80A 3HUIA 2L05A 2Y5PA 1SE9A 2LI5A 4II2B 2V3PA 1HXYD 2WLBA 4OZBA 4GIVA 4OVVA 1A70A 2AQ2B 3OWEB 4HDOA 3ZKJC 3NUHB 2MBOA 3ZUNA 1KFYB 2R61A 1ROEA 1WI0A 3TEYA 1TIFA 2LJIA 5G5GA 5G55A 1C4CA 3AI5A 2JQRB 1FFVA 3EC8A 3ML9A 4XDCA 1ZUD2 3SDLC 3WALA 4I6PA 1E9MA 4ANWA 5L83A 4ASWC 3DCGA 4FHJA 3NY5A 2C7NB 3LDZE 4PS3A 3IVFA 3K9PB 1IBXA 1YIWA 2HJ8A 3FAHA 3UQAA 5HKHA 1WZ3A 1UZXB 2D5GA 3VQIA 3ZTCA 1WX8A 3AN1A 2MJ3A 2LWPA 3T9LA 5AUKA 1WJ6A 1E0ZA 4EKUA 4DHJD 1G6JA 2LZ6A 4RFBA 1RFAA 1KLUD 3MTNB 4OZCA 3JSVA 3S2AA 2W3RA 3BYTB 4P1BC 1L0VB 1WJ4A 4WJNA 4US9A 1FO4A 3BYYB 3NHEB 1D5XC 2AYOB 4M00A 4N58A 1IPGA 2O2VA 3ABVB 2PPHA 1D5ZC 2L8JA 3TJPA 1P3QU 4HXDA 2PLPA 1ET9A 2KXJA 1SEBD 1FXIA 1VLBA 1HEZE 2M56B 2C60A 3GP7A 4L2YA 4ITKA 1K8RB 2DWQA 2KOXA 2AEHA 4GDLB 3HK0A 2BW2A 1WM3A 2G4DB 5E6JA 3ZIMA 5G2NA 2UWQA 1GC7A 1E8YA 2WXMA 5MPOA 3GZNB 4DDID 4GDKA 1WRIA 2BB6A 3PZ8A 2JUOA 4TUUA 3T3NA 5EE9A 4OVZA 2RGFA 2JSVX 2KAJA 2MCNB 3BK2A 3BVGA 1T5XD 3DBHB 1Q10A 2Z8LA 1Y8RC 3U52E 3RYTA 5C3JB 2VRRB 3QWZB 4WWOA 2PIAA 4L1BA 4B9KA 3VDZA 5KHQA 1WYGA 4X57B 4I6LB 2M0XA 3Q3NC 2WDQB 3CSFA 1STEA 1VDVA 1JRPA 1TBEA 1WXQA 2JZPA 3P4QB 4F7ZA 3A33B 1NDDA 4G0NB 1SXTA 1VZ8A 2ZNVB 1E5WA 1FCLA 3V61A 4FJVB 5T8IA 4F1SA 1WZ0A 1XLNA 4TQ1A 1FNVA 1YN4A 2DHZA 1P98A 2X8XX 3KLSX 3DHGC 1DOXA 1C79A 3AEFB 2JWUA 4MSQB 1TT5B 1J19A 2D3CA 1M4VA 2NMQA 1F9JA 3A9KA 3ZDMC 3QX1A 2N9KA 3NVYA 3BIID 4NAWA 3AE2B 2GBJA 4YSZB 3WAPA 4GDLA 1R4MB 4HRSA 4LNOA 4KDIC 3P2BA 4ZRPA 3VXWA 3QHTA 1FXTB 4MH0E 1V86A 1WIAA 3AV8A 4FLHA 2YEPB 1IGCA 4J6IA 1PYWD 4JIOU 2X38A 2VZKB 3SFEB 3AE7B 3ZQ4A 3UIOB 2KHWB 3C8YA 2HJ1A 1CMXB 1ENFA 2PVGC 1K52A 2N7JA 5G5HA 2B3AA 2HD5B 2INPE 4BOZB 4NJ6A 4DDGD 3PSEB 1PUTA 2MJDA 2WX0A 1DGJA 3DBRB 2I2YA 2CR5A 3IAS1 4K7SA 3ZJUA 3R8BA 2LXCA 1I4HA 2GMIC 5DPSA 4IG7B 2MHJA 2KWDA 4LNIA 1GG3A 2FAZA 1QOAA 3CWIA 3DPDA 1NYRA 3AEAB 1ZDXA 4HCNB 3RPFC 3DHIC 4WURA 3UQBA 3EUB2 4G3XB 5DPRA 2B76B 2N7DA 2JT4B 1ZDVA 2KDFB 3TL5A 3DOWA 2DZMA 4HPPA 1N61A 1H8CA 4FN2A 4W9FA 1TKGA 1UD7A 1P9DU 3T8MA 3HHMA 3DDCB 1IP9A 3Q3FA 3QAQA 4JL9A 2BT6A 4HPLB 1ZW7A 4KX6B 1JMLA 2GBMA 2L83A 4DXFA 3DBLB 3AMZA 3P1MA 4KV2A 3V6CB 5FK9C 4TMAB 1ZOYB 3Q14C 1ZKHA 2QILA 5C1ZA 2DNFA 4XWWA 3VH4B 2RPQA 2HE7A 1U4AA 2WXJA 1KH0A 4HJKA 4HROA 2DZJA 4REZA 4WAFA 4MACA 5D7GA 2WDRB 2DYMA 3IBEA 1MG4A 4NJCA 3U8ZA 2FCNA 4MELA 3QK0A 4Q2JA 1P1AA 1XT9B 3U7ZA 4GGQA 3K9OB 3A4SC 2JXTA 3AXCA 3P4SB 5AEKB 3B9JA 4HKQA 2BQQA 2QHOA 1RYJA 1C4AA 1OEYA 4PS8A 1CJEA 2W3SA 4HK2A 3GE8C 1N63A 2DENB 1WGKA 3PREA 3GOEA 1E7UA 1WRDB 4GMVA 1UBQA 3EFCA 1PGXA 3BINA 4EZJA 3SU8X 1Z5SB 2W9NA 4E74A 2LMCA 2WQYB 1FIQA 3BZDB 1YOVB 1NVID 3I57A 3TEZA 4MDKE 1FM0D 2EMTA 4KGRA 3SHQA 3WAOA 4KIKB 2J42A 3U30A 2Y3AA 4YT0B 2GRIA 3H8HA 2MQJA 5IKCM 1Q5WB 1I4GA 2R2OA 1IYFA 1OFFA 1LQBA 2V4IB 1L4ZB 2NTSA 2QIEB 2GBNA 3KWVA 3V3XA 2NPTB 4AUQC 1QZEA 1LXDA 1AW7A 2XEWA 2K6QA 5FKAC 1WX7A 2L76A 4BKSD 2MBQA 3RNCC 2C5LC 3PVLA 2KX3A 2RDHA 3TBLD 2KJRA 2MBEA 2ASQA 4GLSC 3DVGX 3PS6A 1C9FA 1D4BA 1OQRA 3TEXA 4MH8A 1B9RA 3A9JA 2R2QA 3ZNHB 2CJOA 1YD8U 2FUG1 3NVWA 2ZCBA 3KW5B 1V49A 1JWUD 3L4PA 1MG8A 1GPXA 4J3OD 4LJOB 1ESFA 1SF0A 3AE3B 2JX5A 3W5UB 4GOCA 3VTVA 2JRHA 4OW0A 1QT9A 3W5VB 3AE1B 3O13A 4KVGB 4N9F4 5D94A 2WXGA 4FJYA 4JGHB 5D3DA 5C2TB 4W9KA 1DOIA 1VRAB 2ZZPB 3ZO5B 4I6NB 3MC8A 2WHIA 2PW9A 3L13A 2LGYA 5DPTA 1R4NI 2LEKA 1QQRA 4WWPA 4IM3A 3ZW3A 1SGHA 4RM9A 3PRPB 2FCSA 4HPMB 3N9YC 4A6QA 2XN9C 3DVGY 3NVZA 2ZW0A 4HCPB 2D10A 1RRBA 1ET6A 3SEBA 3AE5B 4YL8A 5HFYA 4P16A 3UI3A 5AUIA 2IGHA 2NPTA 3P4RB 2LVOA 1SB3C 1WM2A 3UINB 4BKSA 3HM3A 2KDIA 1WH3A 1T0QC 2O6VB 5IN7A 4MJSB 2L7RA 3ZDTA 3HVDA 3R66C 4K7UA 3IT6B 3HIZA 3BVZA 4LNFA 3W1SA 1UWXA 4NJ7A 3EECA 4JE3B 3RT3B 3L10B 3HM6X 4K81A 4PYZA 3VR8B 3ZVVA 1HTOA 2ICIA 4W9GA 1GNUA 1KM7A 2BS4B 4DQOC 2PTLA 1KTKA 3I5JC 1WXAA 3BWUD 4KZCA 1Z2MA 1RWSA 4M0WB 1I4XA 2WXIA 3IG3A 4YSYB 2Y5BB 5E6NA 2ZPYA 3RNEC 1WGGA 4W9EA 1C4PA 1QLBB 1E7VA 2K1FA 2GLSA 2NR2A 2BB5A 1JWSD 1WGHA 4TSSA 5TR5A 2ZPNA 1AYFA 2HTME 1WX9A 3AEGB 2BF8B 3N1YC 1EU3A 4ZDVA 2KMAA 3MJ5A 1GOZA 3W1YA 3RD2A 1N6ZA 3H6NA 1OQQA 3M63B 3WCQA 2J4XA 1L4DB 3AU5A 3Q3OC 1JALA 5JXVA 3ZNID 3H7PB 4BBNF 3CSTA 1D3ZA 1VZ6A 4M8NA 2K0PA 3N1XC 3N1ZC 1HA5A 3VFKA 4HKZE 1HQRD 5D3IB 2RPVA 3C0RB 3JW0X 4US8A 1WR6E 4URKA 3B2FA 2AL3A 4W9JA 2PEAA 2G1EA 4C56C 3LB8C 2JWZA 3RZWC 4JX1C 3SFDB 1NENB 2YVCA 2KN5A 3PPAA 3IT4B 4G11A 4ZHPA 3JYUA 2XK5A 2ZJDA 1TY2A 1V81A 2RR9A 4G50A 2KACA 2O6VA 2IYDB 2MW5A 4MJSA 4RGNA 4C7YA 2JF5A 5CX3A 4ANUA 1FNUA 4ARCA 2KK8A 4BVUC 2IO1B 1QOBA 4IUMB 5TSSA 2WP9B 4XC2A 1TS3A 3WAMA 1E8XA 2LGXA 4KGTA 2DX5B 3KUDB 2ZVNA 4XWTA 4M0WA 2LUMA 4JWUC 3D32A 1OQYA 2G9HD 2INDC 2QDFA 1PQSA 1XCQL 4BBNC 2LHEA 3A4RA 3PHXB 4KZ0A 4JPSA 5CHVC 1KLVA 3IFWB 1UUPA 1JWBD 2ON8A 1I4QA 3DVNU 4R3DA 2XNAC 3PGEA 4F8CB 4WJPA 3EHVA 5L95C 3A1QB 1FFUA 1NYQA 5GXGB 4EZKA 3L54A 2K8CA 4CO7A 2EKEC 4HDQA 4W9LA 1PDXA 3PZ7A 3V6EB 4EFOA 3P63A 3H7SA 3PTFC 1TZOA 2ZW1A 3PRMB 3U7DA 1BT0A 4FHKA 1DYQA 3Q8CA 2N9EB 4AWJA 4BAXA 2FBWB 1HE8A 3Q8AA 1MPEA 3VTUA 1V1OA 4USAA 2WGSA 1JQ4A 2YLMA 4K3CA 2E6XA 2MSED 4MGZE 1YJ1A 4RGTA 2V1YA 1K50A 3T3OA 1E10A 4ZOHC 1EM7A 2KDEB 2KLGA 4OVUA 2NTTA 1VZ7A 3AULA 2DZIA 2VZKD 2REXA 4DXAB 5DCNA 2UYZB 1JWAD 3ZYYX 4C80A 1XLOA 3PRZA 1J7AA 1NI3A 5IOIA 5CTRC 2J0JA 1UF0A 3IAM1 3MP9A 3PT2B 1I4RA 3H9DA 1YN3A 2D07B 3WA0A 1VJKA 4RGMA 4XYCA 1T0YA 5J17A 3ZLZA 3L08A 4HVBA 3V60A 1TGZB 1L5PA 2WDVB 3DWMA 4K3BA 3KQ4A 2QC8A 3RULA 2MRPA 2KFKB 2JU6X 3NG0A 3CMMB 2MA9B 4WH4A 3EA6A 5FR3A 3AB5A 2K25A 1E8WA 4LDTB 3AECB 4LDTD 2V9HA 3LYYA 3Q8EA 3VHTC 3B08A 3GE3C 4JWSC 3RNFC 1XCTL 1V6EA 1NI2A 1TS5A 2KC1A 3RUIB 4MGIE 1RFKA 3HVZA 3KUZA 2KQ4X 2WS3B 4RMAA 3B2GA 2BKRB 5H8YE 1F0ZA 5C23A 5J2RA 1WE7A 2C9WB 1XXGA 2W82A 1J7CA 1KRHA 2WXQA 4IKGA 3Q6BA 1JWMD 1SJED 2G45B 2EMSA 5JHAA 2NCNA 4FULA 4RF1A 3NZ3A 3TSSA 4DHZB 1WSPA 4IC7B 1ZPSA 2K5PA 2WXLA 2RDGA 2H89B 2BWFA 3MFGA 2KANA 3SR6A 3N3KB 2MP2B 4MEMA 4NZLB 4E71A 3ENEA 5GMVA 1WMHB 3R3MA 3AEDB 3DWGC 4O1NA 4HJGE 4D2KA 3AH7A 1I4PA 1ZXHA 2W54A 2C7MB 2D11A 5FR6A 1WFYA 2K3UA 4AJYB 4IM0A 2K8HA 2JPHA 1TY0A 2BTEA 1WGYA 2KVRA 1MHXA 2WYQA 4B6WA 5EE0A 2Y5CA 4A90A 2KFKA 5LXIB 3GZNI 1IGDA 2KFJA 3CF6E 4KKIA 1SE2A 4OHJA 4YWGG 3B1LX 2YEPF 4ICVA 1YJJA 2K39A 5BYRA 4A3PA 1J8CA 2LGSA 5EE3A 1I7HA 2FCMA 3ZRCA 3DBHI 3PHWB 1QF6A 2HTHA 3DVNV 3ZJTA 4CHKA 4IW0A 1EWCA 2SEBD 1AARA 3RFZB 1FMAD 1LM8B 1N60A 4IWPA 5BMIA 2OOBB 5HHDG 1H4RA 3MJWA 4P1CC 5LXHA 1WWTA 4LK0M 2D3GA 5CHWA 1YQ4B 5DPWA 1BMLC 5EDSA 1UGJA 2A4ZA 4FJZA 2N4FA 2JZZA 2WXOA 4MSMB 4UDUC 2Z0EB 3L17A 4EEWA 2RDBC 3BK1A 3NOBA 1V9JA 2DBYA 1JW9D 4XE0A 2M1MA 2HDEA 1FCCC 1BXTA 1PFDA 2MJEA 3RI7C 1KF6B 3NZSA 2MP2A 4M01A 4B0MA 1WMHA 3SD5A 4AJWA 1E90A 4A3OA 2KD0A 3AE8B 3VH3B 2SAKA 2EKIA 2FE8A 1T0RC 3PZDA 3E9SA 1QOGA 4W9HA 2MWSB 1WR1A 1GB1A 2IY1B 2PE6B 3ZJVA 3AM9A 2JY6A 4A20A 2PE9A 4GB9A 3RCZA 4BKGA 2KTRB 2LASA 2KQ7A 1YX6B 3QIJA 1F52A 3L0WB 1P7FA 1GUAB 2CJNA 2L00B 2MH7A 1WYWB 3V62A 3LXFA 1R7SA 1SBBB 4HWIB 2TSSA 2G3QB 3RNBC 1D6EC 2JRIB 4L23A 2OEDA 2K9XA 3RN9C 4S17A 3NJTA 2KTFA 3I63C 4IWQA 4ZHOA 2N1VA 3DBRI 3LJ3A 4KIKA 3Q3JA 3UF8A 4RNAA 2IY0B 1TKEA 4A8XC 3NRZA 2DYOA 4LTUA 1FRRA 1UELA 4FXCA 2AQ1B 3M3JA 4TV3A 3L16A 2L32A 2N0SB 4WIPA 3NS1A 1XQQA 2KC2A 4LCDE 1MVKA 2BBCA 3U2SC 4S0RA 2O2VB 1JROA 2KZRA 1SE4A 4PYUA 2INNE 5I4DA 2KWCA 4K7WA 2O6VD 1L6VA 1X1MA 2PKOA 4FA6A 1E6EB 3MC0B 1MJDA 3AE6B 2FNJB 2LVPA 2DYBA 1NBFC 5HG2A 1SJHD 3DBSA 1HTQA 1M94A 4MT5A 3ZTDA 4DHZE 4ANXA 2V3NA 4TKNA 3DHHC 4ZRKA 1RLFA 2GBKA 3VVWB 3P4PB 2DAFA 3H1UA 3VUXA 4WJQA 3OLMD 3M95A 1N62A 1JRUA 1Y56A 2L52A 1TYGB 2BS2B 2VH1A 3ZXRA 3J9CA 2DLBA 3DBLI 4GDKB 5AZFA 2L1AA 3OG5A 2LRUA 4ACFA 2KTRA 2AQ3B 3ALBA 2E3TA 4HLEA 3KVFB 3OJ3A 2Z59B 2OJRA 2V4LA 3KYDD 1A5RA 2QCZA 3U4EG 1KJTA 1MI0A 3I9V1 2ZVOA 4MM3B 2D3BA 2GOWA 4LLGM 4II3B 1WGRA 1YX5B 4B0EA 4RH6A 2FIDA 4WQOB 1C76A 3Q8BA 4KGSA 1GAQB 4DHJB 1EF1A 1L0XB 1UH6A 2I1KA 4GSWA 3UGBB 2CS4A 4XDDA 2M17A 4HEA1 2KMCA 2M4NA 1D5MC 2WXHA 3EGRA 3QCAA 1B1ZA 3AE9B 2KO3A 3RMKC 2J52A 1ZGUB 1K51A 3C19A 2KX0A 2ZCCA 1WF9A 2JYEA 4GN1A 3IHPC 1LFDA 3A9KB 2CU1A 3FC4A 3B0AA 4JQWC 4XGAB 2V0GA 3M62B 3TIXA 1SE3A 2N9PC 1IUEA 4IM2A 4NAWB 1GB4A 5D6JB 5CHFA 3APFA 2K6DB 2NS5A 3QC8B 4A55A 2RSUA 2CHXA 3TUOA 1YN5A 1VD2A 4CQNA 2MLBA 1V5TA 4MGYE 3W1SC 2I38A 4KSLC 4BKTA 2VH2A 1UGMA 3TMPB 2KYWA 2PVOD 4C00A 2KQSA 3N32A 4W9IA 3EFUA 3PV1A 3FKYA 3JVZX 1TZ1A 2KNBA 2C7HA 2EELA 4W9DA 4M8MA 4IDIA 5KHOA 1HZ5A 2CHZA 1AN8A 1TS4A 4DBGA 2J53A 3ETRA 1WGDA 5LLIA 1N5WA 4MM3A 1YNTE 2BYVE 3AE4B 3UIPB 2MBHA 1FRDA 1RAXA 3BY4B 1OEYJ 2RD0A 2KMMA 3VTWA 1J7BA 4PS7A 2FUHB 3AU4A 1WJUA 2IPKD 3R7QA 1N5XA 1LO5D 4MGKE 3APCA 1L6UA 3H7PA 3ZRFA 4E3CA 4ANVA 4YTNB 1EF5A 3MHZA 3ZXVA 3WIMA 2CU3A 3R2IA 3W9CB 3QQ8B 1OGWA 2H88B 4OZAA 1WXVA 5HI1A 1K53A 1E8ZA 2JXXA 2WXFA 3GS2A 5J18A 2LVQA 1Q1OA 2QSDA 4QAYA 3FILB 2KJ6A 4JLCA 4B95A 2WNMA 4WQMA 2MX2A 3Q69A 5JZEB 3KYCD 1WXMA 1C77A 1GJZA 3E56A 4NQKE 3ONSA 4AS1A 3ZNZB 5IAAC 4WWMA 2BYTA 1TTNA 3PLUA 5BMGA 1VCBA 2LHDA 3KH0A 2K22A 1CZPA 2JZ3B 2WXRA 4FBJB 5H92C 4AQ7A 2K8BA 2KWVB 1TJEA 2XBBC 1P7EA 3TEWA 4NPNA 5BYSA 2WU2B 2BPSA 2D3AA 4NAMA 1EU4A 2IDYA 4XX5A 1UBIA 3URYA 4YSXB 1V8CA 2KDMA 2WXPA 1R4NB 1YMHE 3ZGZA 2IO0B 3VRBB 1VR9A 1FEHA 4DXGA 1UNSA 2INCC 2AX5A 2M8SA 1QOFA 1FNWA 1AWDA 3Q3MC 1F1HA 5D2MB 2J7QB 2QEJC 2BS3B 3RZFA 1NEKB 2IO2B 3NS8A 3VUYA 4NY0A 5IP4D 2LUEA 4ZYSA 4KKJA 4ZRIA 3A1QA 3MC9A 3KWLA 3I3TB 3NZUA 4EUTA 1L2NA 1Q0WB 4P7IA 4ZYNA 1ZXIA 2IO3B 2UU7A 4TQ0A 2M19A 2JYTA 2I1JA 2IZVB 1TS2A 3PO0A 2L0TA 4XZ4A 2N9LA 3VR9B 5E6OA 4PK1A 4WJOA 2LJ5A 1ISNA 3HRDD 1S3SG 2L0FA 3CIRB 1QKZA 1T0SC 2RMMA 1FPYA 2PJHA 1XO3A 2FIFA 1T6BX 3FILA 1PGBA 3APDA 2IGDA 1WY8A 1V5OA 1KLGD 2WU5B 4CYEA 4C7ZA 4AP4C 3WANA 4WAAA 4LNKA 1XLPA 4N59A 4RM8A 2KLCA 1QILA 2BWES 3MHSD 5AZGA 1ACCA 1OTRB 2M0AA 2NBUA 3Q8FA 4BFRA 5BMHA 1ZP0B 3RNAC 4LJPB 4BZAA 1WE6A 4RGOS 2MEKA 4H2AA 2NVUI 3AEBB 3GB1A 1F77A 4YXDB 4KDLB 1C1YB 1GC6A 2MBBB 1BUIC 2LGIA 1L7YA 3A9JB 1S1QB 2A5UA 2GBRA 1V97A 2V3SA 1XF5L 3KUCB 2J0MA 5BYQA 2BYEA 4C4VB 2N7EA 4FADA 2ONQA 3IXSA 4AOFA 3AEEB 4IWOA 3QJZA 2D2QA 2LGDA 2Q5WD 4ZRJA 1CK1A 1V1PB 3ML8A 4LNNA 2ZNVC 4IOIE 1KOTA 5BO4B 2ZEQA 3OAWA 4EE2A 4W9CA 1E7PB 2CHWA 5AZHA 3R2TA 3OJ4B 2GB1A 2CKHB 1SSNA 1YQBA 2LFIA 2IBIB 2WDTB 2OJWA 5JH5C 5JHBA 1J0GA 4ICUA 4RF0A 2QMTA 1CQVA 3X0WA 1ZE3D 2W55A 1SIJA 5IO9A 2JVCA 3VRAB 5IA7A 2KT7A 3PLVA 4ZRQA 1I35A 2AWTA 1DOYA 1RM6C 2DZKA 1XD3B 2BVCA 4WWNA 5E6PA 2KDBA 2PMVA 5EE1A 1FD6A 2NBVB 1TKYA 2DAJA 2J0KA 2IGGA 3BVMA 4DK5A 3Q2AC 3NVVA 4PT5A 2LRWA 4RCOA 4DWFA 1EUVB 2LXAA 2QJLA 2WXNA 3QARA 4EOYA 4NNJB 1F2RC 3O65B 1I42A 4K1RB 1R4MI 2OHFA 3X23A 2LD9A 2WX1A 1WJNA 2KVZA 1C78A 3N30A 1MHHE 2WXKA 1EWYC 3VAWA 2GI9A 1WXSA 1YQ3B 4A9AA 2KKCA 1IBXB 1F2RI 4NQLB 4C4VA 3ECIA 2N9XA 3VUWA 1MFWA 4ARIA 1SIFA 4N6EB 3P42A 1V1PA 1T3QA 1PGAA 4GXBA 2IJ0A 2WWZA 3JSVB 1XLQA 4YTPB 4P6VF 4EZLA 1LGRA 2L3ZA 1EO6A 2BGFA 3R7RA 2KN4A 1C3TA 2NBWB 3W2DA 5LNK1 2BKFA 2KWUB 1HZ6A
chains in the Genus database with same CATH topology
4YTMB 1PGXA 1IUEA 1VJKA 4NAWB 4RGMA 1GB4A 1UWMA 1FXAA 2ACZB 1L0YB 1XEEA 2LMCA 2WQYB 4A55A 1FIQA 3BZDB 1L5PA 3TUOA 1YN5A 2WDVB 3DWMA 3KQ4A 4CQNA 1NVID 3I57A 3TEZA 1FM0D 4KGRA 2I38A 2JU6X 1JCKB 4WH4A 2PVOD 3EA6A 3V05A 5FR3A 1YJIA 3AB5A 2J42A 3AECB 2Y3AA 4YT0B 2GRIA 3H8HA 3LYYA 3Q8EA 1I4GA 4JWSC 2EELA 3HUIA 2Y5PA 1XCTL 2V3PA 1HXYD 4IDIA 1OFFA 2WLBA 4OZBA 1HZ5A 1A70A 1L4ZB 2AQ2B 2NTSA 2QIEB 2V4IB 3NUHB 3OWEB 1AN8A 1TS4A 3KWVA 1TS5A 2J53A 3V3XA 1KFYB 2R61A 1ROEA 1RFKA 3ETRA 3HVZA 3TEYA 2KQ4X 2WS3B 1AW7A 1N5WA 2LJIA 3B2GA 5G5GA 5FKAC 5H8YE 1YNTE 1F0ZA 3AE4B 1C4CA 1FRDA 1XXGA 2W82A 1J7CA 2KMMA 2JQRB 2RDHA 1KRHA 1FFVA 2WXQA 1J7BA 4XDCA 4IKGA 1JWMD 1SJED 1ZUD2 2IPKD 4GLSC 1N5XA 1LO5D 1C9FA 1D4BA 1L6UA 1E9MA 4RF1A 3NZ3A 1OQRA 3TSSA 3TEXA 4MH8A 4YTNB 1B9RA 1IBXA 1WSPA 3MHZA 3FAHA 1ZPSA 2K5PA 2WXLA 2CJOA 2D5GA 2RDGA 3VQIA 2H89B 2CU3A 3R2IA 3W9CB 3MFGA 2H88B 4OZAA 3SR6A 2FUG1 3AN1A 5HI1A 1K53A 2MJ3A 3NVWA 2WXFA 3GS2A 5AUKA 4NZLB 1E0ZA 1JWUD 3L4PA 1GPXA 4RFBA 2QSDA 3AEDB 3DWGC 1ESFA 4J3OD 4HJGE 3FILB 1SF0A 3AE3B 4O1NA 1KLUD 2WNMA 2JX5A 4D2KA 4OZCA 4WQMA 3W5UB 3AH7A 1I4PA 1ZXHA 2W3RA 3Q69A 4OW0A 1QT9A 3W5VB 3AE1B 3BYTB 1C77A 2W54A 3O13A 1L0VB 3E56A 2WXGA 4AS1A 4US9A 1FO4A 2K3UA 3BYYB 5D3DA 5C2TB 1DOIA 1D5XC 1VRAB 4WWMA 4N58A 2BYTA 2PW9A 3ABVB 1TY0A 2BTEA 1D5ZC 5BMGA 2LHDA 2PLPA 1MHXA 1ET9A 2LEKA 5EE0A 1QQRA 1SEBD 1FXIA 2K22A 1CZPA 2WXRA 1VLBA 1HEZE 2M56B 2Y5CA 5H92C 3GP7A 4A90A 4AQ7A 4L2YA 4ITKA 1IGDA 2DWQA 1TJEA 1P7EA 3TEWA 5BYSA 2WU2B 1SE2A 4KKIA 4OHJA 4YWGG 4GDLB 4A6QA 2BW2A 3N9YC 2YEPF 4NAMA 1EU4A 2XN9C 2IDYA 3NVZA 5BYRA 1YJJA 2ZW0A 3URYA 4YSXB 1V8CA 5E6JA 5EE3A 1I7HA 2KDMA 1ET6A 3SEBA 2WXPA 1YMHE 2WXMA 3AE5B 5HFYA 4P16A 3UI3A 3VRBB 3ZGZA 5MPOA 1VR9A 1QF6A 3ZJTA 1FEHA 5AUIA 4DXGA 2IGHA 1UNSA 2AX5A 1EWCA 2SEBD 1QOFA 3P4RB 3RFZB 1FMAD 1FNWA 1N60A 5BMIA 1AWDA 1SB3C 5HHDG 1WRIA 2BB6A 3PZ8A 3T3NA 5EE9A 2QEJC 2BS3B 4OVZA 1WWTA 4LK0M 1NEKB 2JSVX 2KAJA 3BK2A 4ZYSA 4KKJA 3BVGA 1T5XD 1YQ4B 3HVDA 3KWLA 1Q10A 2Z8LA 1BMLC 3IT6B 3U52E 1UGJA 1ZXIA 3BVZA 5C3JB 4TQ0A 3W1SA 2PIAA 1UWXA 2M19A 4L1BA 2JYTA 2WXOA 4JE3B 1WYGA 4UDUC 3VR8B 1TS2A 3PO0A 2ICIA 2WDQB 2N9LA 3BK1A 1STEA 3VR9B 2BS4B 4DQOC 1VDVA 1JW9D 2DBYA 2PTLA 1JRPA 1KTKA 4XE0A 2HDEA 1FCCC 3BWUD 1BXTA 1PFDA 1RWSA 1WXQA 2JZPA 2MJEA 3HRDD 3P4QB 1I4XA 1KF6B 2WXIA 4YSYB 3CIRB 1QKZA 4B0MA 1SXTA 2RMMA 1C4PA 1QLBB 1VZ8A 1XO3A 1T6BX 1FCLA 3FILA 1PGBA 2BB5A 3AE8B 1JWSD 5T8IA 2IGDA 4TSSA 1AYFA 2HTME 2SAKA 3AEGB 2EKIA 4TQ1A 1XLNA 1KLGD 2FE8A 1FNVA 1EU3A 1YN4A 2WU5B 3E9SA 3KLSX 1QOGA 4C7ZA 3MJ5A 1GB1A 3ZJVA 3AM9A 1DOXA 1C79A 1GOZA 3AEFB 1XLPA 4N59A 2JWUA 1QILA 1OQQA 3WCQA 2J4XA 1M4VA 1ACCA 2M0AA 1L4DB 2NMQA 3Q8FA 5BMHA 1ZP0B 1JALA 2N9KA 5JXVA 4RGOS 1P7FA 2MEKA 4H2AA 3AEBB 3NVYA 3BIID 2CJNA 1VZ6A 1F77A 3GB1A 4YXDB 2MH7A 3AE2B 2K0PA 1BUIC 2LGIA 3LXFA 1R7SA 1SBBB 4YSZB 1HA5A 2TSSA 4HRSA 1D6EC 4HKZE 1HQRD 5D3IB 4L23A 2OEDA 2K9XA 1V97A 2RPVA 4ZRPA 4US8A 3AV8A 1XF5L 4ZHOA 3B2FA 2YEPB 2G1EA 1IGCA 4C56C 1PYWD 5BYQA 2X38A 2VZKB 3LB8C 3SFEB 3AE7B 4JX1C 3SFDB 3ZQ4A 3C8YA 1NENB 4RNAA 1TKEA 3IT4B 4A8XC 2ONQA 4ZHPA 2DYOA 3IXSA 3NRZA 1ENFA 3AEEB 4LTUA 1FRRA 1K52A 1TY2A 2AQ1B 2PVGC 2N7JA 4FXCA 2KACA 2L32A 5G5HA 2N0SB 2INPE 4RGNA 4WIPA 4C7YA 3NS1A 2Q5WD 1FNUA 1CK1A 1MVKA 1PUTA 1V1PB 2MJDA 4ARCA 1DGJA 2I2YA 4IOIE 2BBCA 3IAS1 3ZJUA 1QOBA 3U2SC 3R8BA 5TSSA 1I4HA 2WP9B 4EE2A 1JROA 1SE4A 1TS3A 1E7PB 2KWDA 2INNE 3R2TA 5I4DA 2GB1A 1SSNA 1L6VA 4KGTA 2LFIA 1QOAA 2PKOA 4XWTA 4M0WA 1E6EB 2LUMA 3CWIA 3MC0B 3AE6B 1NYRA 4JWUC 3AEAB 4RF0A 5HG2A 1SJHD 1ZDXA 3RPFC 2G9HD 1CQVA 2QMTA 4MT5A 1ZE3D 2V3NA 4WURA 2W55A 1SIJA 3EUB2 1XCQL 2LHEA 3VRAB 2B76B 3P4PB 4ZRQA 4JPSA 1DOYA 1ZDVA 1RM6C 1UUPA 1N62A 1Y56A 2L52A 1TYGB 2BS2B 1JWBD 2ON8A 1I4QA 4R3DA 2XNAC 1N61A 3J9CA 2DLBA 4GDKB 2PMVA 5EE1A 2L1AA 1FD6A 1TKGA 1TKYA 2AQ3B 2IGGA 1FFUA 2E3TA 1NYQA 3BVMA 2BT6A 4KX6B 1JMLA 3NVVA 4PT5A 5GXGB 4RCOA 2QJLA 2WXNA 3U4EG 2L83A 1MI0A 3I9V1 4DXFA 1F2RC 4MM3B 3AMZA 3P1MA 5FK9C 1PDXA 4TMAB 4LLGM 1ZOYB 3PZ7A 2QILA 4B0EA 4XWWA 3P63A 2OHFA 4RH6A 1TZOA 1C76A 2ZW1A 3Q8BA 1C78A 4KGSA 1GAQB 2WXJA 1KH0A 1DYQA 4HROA 1MHHE 3Q8CA 2WXKA 1EWYC 1L0XB 4REZA 2FBWB 2GI9A 4WAFA 1YQ3B 4A9AA 4MACA 5D7GA 3Q8AA 1MPEA 4XDDA 2WDRB 1F2RI 1V1OA 1IBXB 2DYMA 4HEA1 4USAA 4NJCA 1JQ4A 2E6XA 4Q2JA 1D5MC 4RGTA 4ARIA 2WXHA 3EGRA 3U7ZA 1K50A 3T3OA 1B1ZA 1E10A 4ZOHC 3AE9B 1EM7A 2JXTA 3P4SB 2NTTA 3P42A 4N6EB 1V1PA 1T3QA 1PGAA 2J52A 3B9JA 1K51A 1VZ7A 4HKQA 2IJ0A 2VZKD 4YTPB 1XLQA 4P6VF 2JYEA 1JWAD 3ZYYX 4C80A 1XLOA 1RYJA 1C4AA 1J7AA 1CJEA 1NI3A 2W3SA 3FC4A 2V0GA 2KN4A 1N63A 3IAM1 3MP9A 1WGKA 3W2DA 1I4RA 5LNK1 1SE3A 1HZ6A 1YN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W54 A;  4YTM B;  3AE8 B;  1L0V B;  3RPF C;  1IUE A;  1AYF A;  1VJK A;  2HTM E;  3AEG B;  2EKI A;  4US9 A;  1XLN A;  1FO4 A;  1UWM A;  1FXA A;  2ACZ B;  1SIJ A;  2W55 A;  2WU5 B;  3EUB 2;  5C2T B;  1DOI A;  3AEA B;  1QOG A;  3VRA B;  2B76 B;  2WQY B;  4C7Z A;  3P4P B;  1FIQ A;  1L5P A;  2WDV B;  3DWM A;  1DOY A;  1RM6 C;  3AM9 A;  1DOX A;  4WWM A;  4N58 A;  1NVI D;  3AEF B;  1N62 A;  1XLP A;  4N59 A;  2L52 A;  1TYG B;  2BS2 B;  3ABV B;  1FM0 D;  1JWB D;  1N61 A;  1OQQ A;  3WCQ A;  5EE1 A;  2PVO D;  1TKG A;  2LEK A;  1YJI A;  5EE0 A;  3AB5 A;  1FXI A;  2K22 A;  1CZP A;  3AEC B;  1VLB A;  2Y5C A;  2M56 B;  1TKY A;  4YT0 B;  5H92 C;  1ZP0 B;  1JAL A;  4ITK A;  2DWQ A;  1TJE A;  1FFU A;  2E3T A;  1NYQ A;  4JWS C;  2WU2 B;  2BT6 A;  3HUI A;  3AEB B;  3NVY A;  3BII D;  2CJN A;  4IDI A;  4YXD B;  4KX6 B;  3NVV A;  2MH7 A;  5GXG B;  1OFF A;  2WLB A;  3AE2 B;  2QJL A;  3NVZ A;  1A70 A;  1YJJ A;  2L83 A;  2QIE B;  4YSX B;  1V8C A;  3LXF A;  1R7S A;  4YSZ B;  5EE3 A;  1I7H A;  3AMZ A;  3P1M A;  3AE5 B;  1KFY B;  1PDX A;  4HRS A;  3VRB B;  1ZOY B;  1ROE A;  1RFK A;  3ETR A;  3HVZ A;  5MPO A;  1QF6 A;  2K9X A;  2WS3 B;  1V97 A;  5AUI A;  1N5W A;  5G5G A;  3B2G A;  4US8 A;  3P63 A;  2AX5 A;  2OHF A;  1QOF A;  3AV8 A;  3P4R B;  5H8Y E;  1F0Z A;  1FMA D;  3AE4 B;  4ZHO A;  1N60 A;  1AWD A;  3B2F A;  1FRD A;  1SB3 C;  1WRI A;  2G1E A;  1J7C A;  2KMM A;  1GAQ B;  2JQR B;  5EE9 A;  1KRH A;  1FFV A;  1WWT A;  2BS3 B;  3LB8 C;  1NEK B;  4HRO A;  3SFE B;  1J7B A;  3AE7 B;  4JX1 C;  3SFD B;  2KAJ A;  1EWY C;  1ZUD 2;  2FBW B;  1YQ3 B;  1NEN B;  1N5X A;  4A9A A;  1TKE A;  1YQ4 B;  4ZHP A;  3NRZ A;  3KWL A;  3AEE B;  2WDR B;  1L6U A;  1E9M A;  1FRR A;  2PVG C;  4FXC A;  4LTU A;  4USA A;  1ZXI A;  1JQ4 A;  5C3J B;  5G5H A;  1OQR A;  2N0S B;  4YTN B;  4C7Y A;  3NS1 A;  1B9R A;  2PIA A;  2M19 A;  2Q5W D;  1PUT A;  3FAH A;  2MJD A;  2K5P A;  1WYG A;  1DGJ A;  2CJO A;  3VR8 B;  2H89 B;  1E10 A;  4ZOH C;  2CU3 A;  3AE9 B;  1QOB A;  3PO0 A;  3W9C B;  2H88 B;  2WDQ B;  3SR6 A;  2WP9 B;  3P4S B;  4N6E B;  3AN1 A;  3VR9 B;  1JRO A;  1T3Q A;  2BS4 B;  2MJ3 A;  3B9J A;  1VDV A;  1JW9 D;  2DBY A;  1E7P B;  3NVW A;  1JRP A;  5AUK A;  1E0Z A;  4YTP B;  1XLQ A;  1WXQ A;  1PFD A;  1RWS A;  2MJE A;  3L4P A;  3HRD D;  3P4Q B;  4P6V F;  1GPX A;  1JWA D;  3ZYY X;  4C80 A;  1KF6 B;  1RYJ A;  1XLO A;  3AED B;  1J7A A;  3DWG C;  1CJE A;  1SF0 A;  1NI3 A;  2W3S A;  3AE3 B;  3CIR B;  4YSY B;  2JX5 A;  3FC4 A;  4WQM A;  3W5U B;  1L6V A;  3AH7 A;  1N63 A;  1QOA A;  1QLB B;  2PKO A;  2W3R A;  1WGK A;  1E6E B;  3CWI A;  1XO3 A;  3AE6 B;  1NYR A;  1QT9 A;  3W5V B;  4JWU C;  3AE1 B; 
#chains in the Genus database with same CATH topology
 4YTM B;  4M02 A;  1P0R A;  2G4S A;  2BYF A;  2KJH B;  4BOS C;  1UWM A;  1FXA A;  2ACZ B;  1L0Y B;  1XEE A;  2N1W A;  3ZNG C;  3RNG C;  4KSK C;  3DQV A;  1JCK B;  3V05 A;  2Z0D B;  1YJI A;  3QA8 A;  2FCQ A;  2AL6 A;  3TCA A;  1V2Y A;  3N20 C;  4GU2 A;  2XK5 B;  1V80 A;  3HUI A;  2L05 A;  2Y5P A;  1SE9 A;  2LI5 A;  4II2 B;  2V3P A;  1HXY D;  2WLB A;  4OZB A;  4GIV A;  4OVV A;  1A70 A;  2AQ2 B;  3OWE B;  4HDO A;  3ZKJ C;  3NUH B;  2MBO A;  3ZUN A;  1KFY B;  2R61 A;  1ROE A;  1WI0 A;  3TEY A;  1TIF A;  2LJI A;  5G5G A;  5G55 A;  1C4C A;  3AI5 A;  2JQR B;  1FFV A;  3EC8 A;  3ML9 A;  4XDC A;  1ZUD 2;  3SDL C;  3WAL A;  4I6P A;  1E9M A;  4ANW A;  5L83 A;  4ASW C;  3DCG A;  4FHJ A;  3NY5 A;  2C7N B;  3LDZ E;  4PS3 A;  3IVF A;  3K9P B;  1IBX A;  1YIW A;  2HJ8 A;  3FAH A;  3UQA A;  5HKH A;  1WZ3 A;  1UZX B;  2D5G A;  3VQI A;  3ZTC A;  1WX8 A;  3AN1 A;  2MJ3 A;  2LWP A;  3T9L A;  5AUK A;  1WJ6 A;  1E0Z A;  4EKU A;  4DHJ D;  1G6J A;  2LZ6 A;  4RFB A;  1RFA A;  1KLU D;  3MTN B;  4OZC A;  3JSV A;  3S2A A;  2W3R A;  3BYT B;  4P1B C;  1L0V B;  1WJ4 A;  4WJN A;  4US9 A;  1FO4 A;  3BYY B;  3NHE B;  1D5X C;  2AYO B;  4M00 A;  4N58 A;  1IPG A;  2O2V A;  3ABV B;  2PPH A;  1D5Z C;  2L8J A;  3TJP A;  1P3Q U;  4HXD A;  2PLP A;  1ET9 A;  2KXJ A;  1SEB D;  1FXI A;  1VLB A;  1HEZ E;  2M56 B;  2C60 A;  3GP7 A;  4L2Y A;  4ITK A;  1K8R B;  2DWQ A;  2KOX A;  2AEH A;  4GDL B;  3HK0 A;  2BW2 A;  1WM3 A;  2G4D B;  5E6J A;  3ZIM A;  5G2N A;  2UWQ A;  1GC7 A;  1E8Y A;  2WXM A;  5MPO A;  3GZN B;  4DDI D;  4GDK A;  1WRI A;  2BB6 A;  3PZ8 A;  2JUO A;  4TUU A;  3T3N A;  5EE9 A;  4OVZ A;  2RGF A;  2JSV X;  2KAJ A;  2MCN B;  3BK2 A;  3BVG A;  1T5X D;  3DBH B;  1Q10 A;  2Z8L A;  1Y8R C;  3U52 E;  3RYT A;  5C3J B;  2VRR B;  3QWZ B;  4WWO A;  2PIA A;  4L1B A;  4B9K A;  3VDZ A;  5KHQ A;  1WYG A;  4X57 B;  4I6L B;  2M0X A;  3Q3N C;  2WDQ B;  3CSF A;  1STE A;  1VDV A;  1JRP A;  1TBE A;  1WXQ A;  2JZP A;  3P4Q B;  4F7Z A;  3A33 B;  1NDD A;  4G0N B;  1SXT A;  1VZ8 A;  2ZNV B;  1E5W A;  1FCL A;  3V61 A;  4FJV B;  5T8I A;  4F1S A;  1WZ0 A;  1XLN A;  4TQ1 A;  1FNV A;  1YN4 A;  2DHZ A;  1P98 A;  2X8X X;  3KLS X;  3DHG C;  1DOX A;  1C79 A;  3AEF B;  2JWU A;  4MSQ B;  1TT5 B;  1J19 A;  2D3C A;  1M4V A;  2NMQ A;  1F9J A;  3A9K A;  3ZDM C;  3QX1 A;  2N9K A;  3NVY A;  3BII D;  4NAW A;  3AE2 B;  2GBJ A;  4YSZ B;  3WAP A;  4GDL A;  1R4M B;  4HRS A;  4LNO A;  4KDI C;  3P2B A;  4ZRP A;  3VXW A;  3QHT A;  1FXT B;  4MH0 E;  1V86 A;  1WIA A;  3AV8 A;  4FLH A;  2YEP B;  1IGC A;  4J6I A;  1PYW D;  4JIO U;  2X38 A;  2VZK B;  3SFE B;  3AE7 B;  3ZQ4 A;  3UIO B;  2KHW B;  3C8Y A;  2HJ1 A;  1CMX B;  1ENF A;  2PVG C;  1K52 A;  2N7J A;  5G5H A;  2B3A A;  2HD5 B;  2INP E;  4BOZ B;  4NJ6 A;  4DDG D;  3PSE B;  1PUT A;  2MJD A;  2WX0 A;  1DGJ A;  3DBR B;  2I2Y A;  2CR5 A;  3IAS 1;  4K7S A;  3ZJU A;  3R8B A;  2LXC A;  1I4H A;  2GMI C;  5DPS A;  4IG7 B;  2MHJ A;  2KWD A;  4LNI A;  1GG3 A;  2FAZ A;  1QOA A;  3CWI A;  3DPD A;  1NYR A;  3AEA B;  1ZDX A;  4HCN B;  3RPF C;  3DHI C;  4WUR A;  3UQB A;  3EUB 2;  4G3X B;  5DPR A;  2B76 B;  2N7D A;  2JT4 B;  1ZDV A;  2KDF B;  3TL5 A;  3DOW A;  2DZM A;  4HPP A;  1N61 A;  1H8C A;  4FN2 A;  4W9F A;  1TKG A;  1UD7 A;  1P9D U;  3T8M A;  3HHM A;  3DDC B;  1IP9 A;  3Q3F A;  3QAQ A;  4JL9 A;  2BT6 A;  4HPL B;  1ZW7 A;  4KX6 B;  1JML A;  2GBM A;  2L83 A;  4DXF A;  3DBL B;  3AMZ A;  3P1M A;  4KV2 A;  3V6C B;  5FK9 C;  4TMA B;  1ZOY B;  3Q14 C;  1ZKH A;  2QIL A;  5C1Z A;  2DNF A;  4XWW A;  3VH4 B;  2RPQ A;  2HE7 A;  1U4A A;  2WXJ A;  1KH0 A;  4HJK A;  4HRO A;  2DZJ A;  4REZ A;  4WAF A;  4MAC A;  5D7G A;  2WDR B;  2DYM A;  3IBE A;  1MG4 A;  4NJC A;  3U8Z A;  2FCN A;  4MEL A;  3QK0 A;  4Q2J A;  1P1A A;  1XT9 B;  3U7Z A;  4GGQ A;  3K9O B;  3A4S C;  2JXT A;  3AXC A;  3P4S B;  5AEK B;  3B9J A;  4HKQ A;  2BQQ A;  2QHO A;  1RYJ A;  1C4A A;  1OEY A;  4PS8 A;  1CJE A;  2W3S A;  4HK2 A;  3GE8 C;  1N63 A;  2DEN B;  1WGK A;  3PRE A;  3GOE A;  1E7U A;  1WRD B;  4GMV A;  1UBQ A;  3EFC A;  1PGX A;  3BIN A;  4EZJ A;  3SU8 X;  1Z5S B;  2W9N A;  4E74 A;  2LMC A;  2WQY B;  1FIQ A;  3BZD B;  1YOV B;  1NVI D;  3I57 A;  3TEZ A;  4MDK E;  1FM0 D;  2EMT A;  4KGR A;  3SHQ A;  3WAO A;  4KIK B;  2J42 A;  3U30 A;  2Y3A A;  4YT0 B;  2GRI A;  3H8H A;  2MQJ A;  5IKC M;  1Q5W B;  1I4G A;  2R2O A;  1IYF A;  1OFF A;  1LQB A;  2V4I B;  1L4Z B;  2NTS A;  2QIE B;  2GBN A;  3KWV A;  3V3X A;  2NPT B;  4AUQ C;  1QZE A;  1LXD A;  1AW7 A;  2XEW A;  2K6Q A;  5FKA C;  1WX7 A;  2L76 A;  4BKS D;  2MBQ A;  3RNC C;  2C5L C;  3PVL A;  2KX3 A;  2RDH A;  3TBL D;  2KJR A;  2MBE A;  2ASQ A;  4GLS C;  3DVG X;  3PS6 A;  1C9F A;  1D4B A;  1OQR A;  3TEX A;  4MH8 A;  1B9R A;  3A9J A;  2R2Q A;  3ZNH B;  2CJO A;  1YD8 U;  2FUG 1;  3NVW A;  2ZCB A;  3KW5 B;  1V49 A;  1JWU D;  3L4P A;  1MG8 A;  1GPX A;  4J3O D;  4LJO B;  1ESF A;  1SF0 A;  3AE3 B;  2JX5 A;  3W5U B;  4GOC A;  3VTV A;  2JRH A;  4OW0 A;  1QT9 A;  3W5V B;  3AE1 B;  3O13 A;  4KVG B;  4N9F 4;  5D94 A;  2WXG A;  4FJY A;  4JGH B;  5D3D A;  5C2T B;  4W9K A;  1DOI A;  1VRA B;  2ZZP B;  3ZO5 B;  4I6N B;  3MC8 A;  2WHI A;  2PW9 A;  3L13 A;  2LGY A;  5DPT A;  1R4N I;  2LEK A;  1QQR A;  4WWP A;  4IM3 A;  3ZW3 A;  1SGH A;  4RM9 A;  3PRP B;  2FCS A;  4HPM B;  3N9Y C;  4A6Q A;  2XN9 C;  3DVG Y;  3NVZ A;  2ZW0 A;  4HCP B;  2D10 A;  1RRB A;  1ET6 A;  3SEB A;  3AE5 B;  4YL8 A;  5HFY A;  4P16 A;  3UI3 A;  5AUI A;  2IGH A;  2NPT A;  3P4R B;  2LVO A;  1SB3 C;  1WM2 A;  3UIN B;  4BKS A;  3HM3 A;  2KDI A;  1WH3 A;  1T0Q C;  2O6V B;  5IN7 A;  4MJS B;  2L7R A;  3ZDT A;  3HVD A;  3R66 C;  4K7U A;  3IT6 B;  3HIZ A;  3BVZ A;  4LNF A;  3W1S A;  1UWX A;  4NJ7 A;  3EEC A;  4JE3 B;  3RT3 B;  3L10 B;  3HM6 X;  4K81 A;  4PYZ A;  3VR8 B;  3ZVV A;  1HTO A;  2ICI A;  4W9G A;  1GNU A;  1KM7 A;  2BS4 B;  4DQO C;  2PTL A;  1KTK A;  3I5J C;  1WXA A;  3BWU D;  4KZC A;  1Z2M A;  1RWS A;  4M0W B;  1I4X A;  2WXI A;  3IG3 A;  4YSY B;  2Y5B B;  5E6N A;  2ZPY A;  3RNE C;  1WGG A;  4W9E A;  1C4P A;  1QLB B;  1E7V A;  2K1F A;  2GLS A;  2NR2 A;  2BB5 A;  1JWS D;  1WGH A;  4TSS A;  5TR5 A;  2ZPN A;  1AYF A;  2HTM E;  1WX9 A;  3AEG B;  2BF8 B;  3N1Y C;  1EU3 A;  4ZDV A;  2KMA A;  3MJ5 A;  1GOZ A;  3W1Y A;  3RD2 A;  1N6Z A;  3H6N A;  1OQQ A;  3M63 B;  3WCQ A;  2J4X A;  1L4D B;  3AU5 A;  3Q3O C;  1JAL A;  5JXV A;  3ZNI D;  3H7P B;  4BBN F;  3CST A;  1D3Z A;  1VZ6 A;  4M8N A;  2K0P A;  3N1X C;  3N1Z C;  1HA5 A;  3VFK A;  4HKZ E;  1HQR D;  5D3I B;  2RPV A;  3C0R B;  3JW0 X;  4US8 A;  1WR6 E;  4URK A;  3B2F A;  2AL3 A;  4W9J A;  2PEA A;  2G1E A;  4C56 C;  3LB8 C;  2JWZ A;  3RZW C;  4JX1 C;  3SFD B;  1NEN B;  2YVC A;  2KN5 A;  3PPA A;  3IT4 B;  4G11 A;  4ZHP A;  3JYU A;  2XK5 A;  2ZJD A;  1TY2 A;  1V81 A;  2RR9 A;  4G50 A;  2KAC A;  2O6V A;  2IYD B;  2MW5 A;  4MJS A;  4RGN A;  4C7Y A;  2JF5 A;  5CX3 A;  4ANU A;  1FNU A;  4ARC A;  2KK8 A;  4BVU C;  2IO1 B;  1QOB A;  4IUM B;  5TSS A;  2WP9 B;  4XC2 A;  1TS3 A;  3WAM A;  1E8X A;  2LGX A;  4KGT A;  2DX5 B;  3KUD B;  2ZVN A;  4XWT A;  4M0W A;  2LUM A;  4JWU C;  3D32 A;  1OQY A;  2G9H D;  2IND C;  2QDF A;  1PQS A;  1XCQ L;  4BBN C;  2LHE A;  3A4R A;  3PHX B;  4KZ0 A;  4JPS A;  5CHV C;  1KLV A;  3IFW B;  1UUP A;  1JWB D;  2ON8 A;  1I4Q A;  3DVN U;  4R3D A;  2XNA C;  3PGE A;  4F8C B;  4WJP A;  3EHV A;  5L95 C;  3A1Q B;  1FFU A;  1NYQ A;  5GXG B;  4EZK A;  3L54 A;  2K8C A;  4CO7 A;  2EKE C;  4HDQ A;  4W9L A;  1PDX A;  3PZ7 A;  3V6E B;  4EFO A;  3P63 A;  3H7S A;  3PTF C;  1TZO A;  2ZW1 A;  3PRM B;  3U7D A;  1BT0 A;  4FHK A;  1DYQ A;  3Q8C A;  2N9E B;  4AWJ A;  4BAX A;  2FBW B;  1HE8 A;  3Q8A A;  1MPE A;  3VTU A;  1V1O A;  4USA A;  2WGS A;  1JQ4 A;  2YLM A;  4K3C A;  2E6X A;  2MSE D;  4MGZ E;  1YJ1 A;  4RGT A;  2V1Y A;  1K50 A;  3T3O A;  1E10 A;  4ZOH C;  1EM7 A;  2KDE B;  2KLG A;  4OVU A;  2NTT A;  1VZ7 A;  3AUL A;  2DZI A;  2VZK D;  2REX A;  4DXA B;  5DCN A;  2UYZ B;  1JWA D;  3ZYY X;  4C80 A;  1XLO A;  3PRZ A;  1J7A A;  1NI3 A;  5IOI A;  5CTR C;  2J0J A;  1UF0 A;  3IAM 1;  3MP9 A;  3PT2 B;  1I4R A;  3H9D A;  1YN3 A;  2D07 B;  3WA0 A;  1VJK A;  4RGM A;  4XYC A;  1T0Y A;  5J17 A;  3ZLZ A;  3L08 A;  4HVB A;  3V60 A;  1TGZ B;  1L5P A;  2WDV B;  3DWM A;  4K3B A;  3KQ4 A;  2QC8 A;  3RUL A;  2MRP A;  2KFK B;  2JU6 X;  3NG0 A;  3CMM B;  2MA9 B;  4WH4 A;  3EA6 A;  5FR3 A;  3AB5 A;  2K25 A;  1E8W A;  4LDT B;  3AEC B;  4LDT D;  2V9H A;  3LYY A;  3Q8E A;  3VHT C;  3B08 A;  3GE3 C;  4JWS C;  3RNF C;  1XCT L;  1V6E A;  1NI2 A;  1TS5 A;  2KC1 A;  3RUI B;  4MGI E;  1RFK A;  3HVZ A;  3KUZ A;  2KQ4 X;  2WS3 B;  4RMA A;  3B2G A;  2BKR B;  5H8Y E;  1F0Z A;  5C23 A;  5J2R A;  1WE7 A;  2C9W B;  1XXG A;  2W82 A;  1J7C A;  1KRH A;  2WXQ A;  4IKG A;  3Q6B A;  1JWM D;  1SJE D;  2G45 B;  2EMS A;  5JHA A;  2NCN A;  4FUL A;  4RF1 A;  3NZ3 A;  3TSS A;  4DHZ B;  1WSP A;  4IC7 B;  1ZPS A;  2K5P A;  2WXL A;  2RDG A;  2H89 B;  2BWF A;  3MFG A;  2KAN A;  3SR6 A;  3N3K B;  2MP2 B;  4MEM A;  4NZL B;  4E71 A;  3ENE A;  5GMV A;  1WMH B;  3R3M A;  3AED B;  3DWG C;  4O1N A;  4HJG E;  4D2K A;  3AH7 A;  1I4P A;  1ZXH A;  2W54 A;  2C7M B;  2D11 A;  5FR6 A;  1WFY A;  2K3U A;  4AJY B;  4IM0 A;  2K8H A;  2JPH A;  1TY0 A;  2BTE A;  1WGY A;  2KVR A;  1MHX A;  2WYQ A;  4B6W A;  5EE0 A;  2Y5C A;  4A90 A;  2KFK A;  5LXI B;  3GZN I;  1IGD A;  2KFJ A;  3CF6 E;  4KKI A;  1SE2 A;  4OHJ A;  4YWG G;  3B1L X;  2YEP F;  4ICV A;  1YJJ A;  2K39 A;  5BYR A;  4A3P A;  1J8C A;  2LGS A;  5EE3 A;  1I7H A;  2FCM A;  3ZRC A;  3DBH I;  3PHW B;  1QF6 A;  2HTH A;  3DVN V;  3ZJT A;  4CHK A;  4IW0 A;  1EWC A;  2SEB D;  1AAR A;  3RFZ B;  1FMA D;  1LM8 B;  1N60 A;  4IWP A;  5BMI A;  2OOB B;  5HHD G;  1H4R A;  3MJW A;  4P1C C;  5LXH A;  1WWT A;  4LK0 M;  2D3G A;  5CHW A;  1YQ4 B;  5DPW A;  1BML C;  5EDS A;  1UGJ A;  2A4Z A;  4FJZ A;  2N4F A;  2JZZ A;  2WXO A;  4MSM B;  4UDU C;  2Z0E B;  3L17 A;  4EEW A;  2RDB C;  3BK1 A;  3NOB A;  1V9J A;  2DBY A;  1JW9 D;  4XE0 A;  2M1M A;  2HDE A;  1FCC C;  1BXT A;  1PFD A;  2MJE A;  3RI7 C;  1KF6 B;  3NZS A;  2MP2 A;  4M01 A;  4B0M A;  1WMH A;  3SD5 A;  4AJW A;  1E90 A;  4A3O A;  2KD0 A;  3AE8 B;  3VH3 B;  2SAK A;  2EKI A;  2FE8 A;  1T0R C;  3PZD A;  3E9S A;  1QOG A;  4W9H A;  2MWS B;  1WR1 A;  1GB1 A;  2IY1 B;  2PE6 B;  3ZJV A;  3AM9 A;  2JY6 A;  4A20 A;  2PE9 A;  4GB9 A;  3RCZ A;  4BKG A;  2KTR B;  2LAS A;  2KQ7 A;  1YX6 B;  3QIJ A;  1F52 A;  3L0W B;  1P7F A;  1GUA B;  2CJN A;  2L00 B;  2MH7 A;  1WYW B;  3V62 A;  3LXF A;  1R7S A;  1SBB B;  4HWI B;  2TSS A;  2G3Q B;  3RNB C;  1D6E C;  2JRI B;  4L23 A;  2OED A;  2K9X A;  3RN9 C;  4S17 A;  3NJT A;  2KTF A;  3I63 C;  4IWQ A;  4ZHO A;  2N1V A;  3DBR I;  3LJ3 A;  4KIK A;  3Q3J A;  3UF8 A;  4RNA A;  2IY0 B;  1TKE A;  4A8X C;  3NRZ A;  2DYO A;  4LTU A;  1FRR A;  1UEL A;  4FXC A;  2AQ1 B;  3M3J A;  4TV3 A;  3L16 A;  2L32 A;  2N0S B;  4WIP A;  3NS1 A;  1XQQ A;  2KC2 A;  4LCD E;  1MVK A;  2BBC A;  3U2S C;  4S0R A;  2O2V B;  1JRO A;  2KZR A;  1SE4 A;  4PYU A;  2INN E;  5I4D A;  2KWC A;  4K7W A;  2O6V D;  1L6V A;  1X1M A;  2PKO A;  4FA6 A;  1E6E B;  3MC0 B;  1MJD A;  3AE6 B;  2FNJ B;  2LVP A;  2DYB A;  1NBF C;  5HG2 A;  1SJH D;  3DBS A;  1HTQ A;  1M94 A;  4MT5 A;  3ZTD A;  4DHZ E;  4ANX A;  2V3N A;  4TKN A;  3DHH C;  4ZRK A;  1RLF A;  2GBK A;  3VVW B;  3P4P B;  2DAF A;  3H1U A;  3VUX A;  4WJQ A;  3OLM D;  3M95 A;  1N62 A;  1JRU A;  1Y56 A;  2L52 A;  1TYG B;  2BS2 B;  2VH1 A;  3ZXR A;  3J9C A;  2DLB A;  3DBL I;  4GDK B;  5AZF A;  2L1A A;  3OG5 A;  2LRU A;  4ACF A;  2KTR A;  2AQ3 B;  3ALB A;  2E3T A;  4HLE A;  3KVF B;  3OJ3 A;  2Z59 B;  2OJR A;  2V4L A;  3KYD D;  1A5R A;  2QCZ A;  3U4E G;  1KJT A;  1MI0 A;  3I9V 1;  2ZVO A;  4MM3 B;  2D3B A;  2GOW A;  4LLG M;  4II3 B;  1WGR A;  1YX5 B;  4B0E A;  4RH6 A;  2FID A;  4WQO B;  1C76 A;  3Q8B A;  4KGS A;  1GAQ B;  4DHJ B;  1EF1 A;  1L0X B;  1UH6 A;  2I1K A;  4GSW A;  3UGB B;  2CS4 A;  4XDD A;  2M17 A;  4HEA 1;  2KMC A;  2M4N A;  1D5M C;  2WXH A;  3EGR A;  3QCA A;  1B1Z A;  3AE9 B;  2KO3 A;  3RMK C;  2J52 A;  1ZGU B;  1K51 A;  3C19 A;  2KX0 A;  2ZCC A;  1WF9 A;  2JYE A;  4GN1 A;  3IHP C;  1LFD A;  3A9K B;  2CU1 A;  3FC4 A;  3B0A A;  4JQW C;  4XGA B;  2V0G A;  3M62 B;  3TIX A;  1SE3 A;  2N9P C;  1IUE A;  4IM2 A;  4NAW B;  1GB4 A;  5D6J B;  5CHF A;  3APF A;  2K6D B;  2NS5 A;  3QC8 B;  4A55 A;  2RSU A;  2CHX A;  3TUO A;  1YN5 A;  1VD2 A;  4CQN A;  2MLB A;  1V5T A;  4MGY E;  3W1S C;  2I38 A;  4KSL C;  4BKT A;  2VH2 A;  1UGM A;  3TMP B;  2KYW A;  2PVO D;  4C00 A;  2KQS A;  3N32 A;  4W9I A;  3EFU A;  3PV1 A;  3FKY A;  3JVZ X;  1TZ1 A;  2KNB A;  2C7H A;  2EEL A;  4W9D A;  4M8M A;  4IDI A;  5KHO A;  1HZ5 A;  2CHZ A;  1AN8 A;  1TS4 A;  4DBG A;  2J53 A;  3ETR A;  1WGD A;  5LLI A;  1N5W A;  4MM3 A;  1YNT E;  2BYV E;  3AE4 B;  3UIP B;  2MBH A;  1FRD A;  1RAX A;  3BY4 B;  1OEY J;  2RD0 A;  2KMM A;  3VTW A;  1J7B A;  4PS7 A;  2FUH B;  3AU4 A;  1WJU A;  2IPK D;  3R7Q A;  1N5X A;  1LO5 D;  4MGK E;  3APC A;  1L6U A;  3H7P A;  3ZRF A;  4E3C A;  4ANV A;  4YTN B;  1EF5 A;  3MHZ A;  3ZXV A;  3WIM A;  2CU3 A;  3R2I A;  3W9C B;  3QQ8 B;  1OGW A;  2H88 B;  4OZA A;  1WXV A;  5HI1 A;  1K53 A;  1E8Z A;  2JXX A;  2WXF A;  3GS2 A;  5J18 A;  2LVQ A;  1Q1O A;  2QSD A;  4QAY A;  3FIL B;  2KJ6 A;  4JLC A;  4B95 A;  2WNM A;  4WQM A;  2MX2 A;  3Q69 A;  5JZE B;  3KYC D;  1WXM A;  1C77 A;  1GJZ A;  3E56 A;  4NQK E;  3ONS A;  4AS1 A;  3ZNZ B;  5IAA C;  4WWM A;  2BYT A;  1TTN A;  3PLU A;  5BMG A;  1VCB A;  2LHD A;  3KH0 A;  2K22 A;  1CZP A;  2JZ3 B;  2WXR A;  4FBJ B;  5H92 C;  4AQ7 A;  2K8B A;  2KWV B;  1TJE A;  2XBB C;  1P7E A;  3TEW A;  4NPN A;  5BYS A;  2WU2 B;  2BPS A;  2D3A A;  4NAM A;  1EU4 A;  2IDY A;  4XX5 A;  1UBI A;  3URY A;  4YSX B;  1V8C A;  2KDM A;  2WXP A;  1R4N B;  1YMH E;  3ZGZ A;  2IO0 B;  3VRB B;  1VR9 A;  1FEH A;  4DXG A;  1UNS A;  2INC C;  2AX5 A;  2M8S A;  1QOF A;  1FNW A;  1AWD A;  3Q3M C;  1F1H A;  5D2M B;  2J7Q B;  2QEJ C;  2BS3 B;  3RZF A;  1NEK B;  2IO2 B;  3NS8 A;  3VUY A;  4NY0 A;  5IP4 D;  2LUE A;  4ZYS A;  4KKJ A;  4ZRI A;  3A1Q A;  3MC9 A;  3KWL A;  3I3T B;  3NZU A;  4EUT A;  1L2N A;  1Q0W B;  4P7I A;  4ZYN A;  1ZXI A;  2IO3 B;  2UU7 A;  4TQ0 A;  2M19 A;  2JYT A;  2I1J A;  2IZV B;  1TS2 A;  3PO0 A;  2L0T A;  4XZ4 A;  2N9L A;  3VR9 B;  5E6O A;  4PK1 A;  4WJO A;  2LJ5 A;  1ISN A;  3HRD D;  1S3S G;  2L0F A;  3CIR B;  1QKZ A;  1T0S C;  2RMM A;  1FPY A;  2PJH A;  1XO3 A;  2FIF A;  1T6B X;  3FIL A;  1PGB A;  3APD A;  2IGD A;  1WY8 A;  1V5O A;  1KLG D;  2WU5 B;  4CYE A;  4C7Z A;  4AP4 C;  3WAN A;  4WAA A;  4LNK A;  1XLP A;  4N59 A;  4RM8 A;  2KLC A;  1QIL A;  2BWE S;  3MHS D;  5AZG A;  1ACC A;  1OTR B;  2M0A A;  2NBU A;  3Q8F A;  4BFR A;  5BMH A;  1ZP0 B;  3RNA C;  4LJP B;  4BZA A;  1WE6 A;  4RGO S;  2MEK A;  4H2A A;  2NVU I;  3AEB B;  3GB1 A;  1F77 A;  4YXD B;  4KDL B;  1C1Y B;  1GC6 A;  2MBB B;  1BUI C;  2LGI A;  1L7Y A;  3A9J B;  1S1Q B;  2A5U A;  2GBR A;  1V97 A;  2V3S A;  1XF5 L;  3KUC B;  2J0M A;  5BYQ A;  2BYE A;  4C4V B;  2N7E A;  4FAD A;  2ONQ A;  3IXS A;  4AOF A;  3AEE B;  4IWO A;  3QJZ A;  2D2Q A;  2LGD A;  2Q5W D;  4ZRJ A;  1CK1 A;  1V1P B;  3ML8 A;  4LNN A;  2ZNV C;  4IOI E;  1KOT A;  5BO4 B;  2ZEQ A;  3OAW A;  4EE2 A;  4W9C A;  1E7P B;  2CHW A;  5AZH A;  3R2T A;  3OJ4 B;  2GB1 A;  2CKH B;  1SSN A;  1YQB A;  2LFI A;  2IBI B;  2WDT B;  2OJW A;  5JH5 C;  5JHB A;  1J0G A;  4ICU A;  4RF0 A;  2QMT A;  1CQV A;  3X0W A;  1ZE3 D;  2W55 A;  1SIJ A;  5IO9 A;  2JVC A;  3VRA B;  5IA7 A;  2KT7 A;  3PLV A;  4ZRQ A;  1I35 A;  2AWT A;  1DOY A;  1RM6 C;  2DZK A;  1XD3 B;  2BVC A;  4WWN A;  5E6P A;  2KDB A;  2PMV A;  5EE1 A;  1FD6 A;  2NBV B;  1TKY A;  2DAJ A;  2J0K A;  2IGG A;  3BVM A;  4DK5 A;  3Q2A C;  3NVV A;  4PT5 A;  2LRW A;  4RCO A;  4DWF A;  1EUV B;  2LXA A;  2QJL A;  2WXN A;  3QAR A;  4EOY A;  4NNJ B;  1F2R C;  3O65 B;  1I42 A;  4K1R B;  1R4M I;  2OHF A;  3X23 A;  2LD9 A;  2WX1 A;  1WJN A;  2KVZ A;  1C78 A;  3N30 A;  1MHH E;  2WXK A;  1EWY C;  3VAW A;  2GI9 A;  1WXS A;  1YQ3 B;  4A9A A;  2KKC A;  1IBX B;  1F2R I;  4NQL B;  4C4V A;  3ECI A;  2N9X A;  3VUW A;  1MFW A;  4ARI A;  1SIF A;  4N6E B;  3P42 A;  1V1P A;  1T3Q A;  1PGA A;  4GXB A;  2IJ0 A;  2WWZ A;  3JSV B;  1XLQ A;  4YTP B;  4P6V F;  4EZL A;  1LGR A;  2L3Z A;  1EO6 A;  2BGF A;  3R7R A;  2KN4 A;  1C3T A;  2NBW B;  3W2D A;  5LNK 1;  2BKF A;  2KWU B;  1HZ6 A; 
#chains in the Genus database with same CATH homology
 4YTM B;  1PGX A;  1IUE A;  1VJK A;  4NAW B;  4RGM A;  1GB4 A;  1UWM A;  1FXA A;  2ACZ B;  1L0Y B;  1XEE A;  2LMC A;  2WQY B;  4A55 A;  1FIQ A;  3BZD B;  1L5P A;  3TUO A;  1YN5 A;  2WDV B;  3DWM A;  3KQ4 A;  4CQN A;  1NVI D;  3I57 A;  3TEZ A;  1FM0 D;  4KGR A;  2I38 A;  2JU6 X;  1JCK B;  4WH4 A;  2PVO D;  3EA6 A;  3V05 A;  5FR3 A;  1YJI A;  3AB5 A;  2J42 A;  3AEC B;  2Y3A A;  4YT0 B;  2GRI A;  3H8H A;  3LYY A;  3Q8E A;  1I4G A;  4JWS C;  2EEL A;  3HUI A;  2Y5P A;  1XCT L;  2V3P A;  1HXY D;  4IDI A;  1OFF A;  2WLB A;  4OZB A;  1HZ5 A;  1A70 A;  1L4Z B;  2AQ2 B;  2NTS A;  2QIE B;  2V4I B;  3NUH B;  3OWE B;  1AN8 A;  1TS4 A;  3KWV A;  1TS5 A;  2J53 A;  3V3X A;  1KFY B;  2R61 A;  1ROE A;  1RFK A;  3ETR A;  3HVZ A;  3TEY A;  2KQ4 X;  2WS3 B;  1AW7 A;  1N5W A;  2LJI A;  3B2G A;  5G5G A;  5FKA C;  5H8Y E;  1YNT E;  1F0Z A;  3AE4 B;  1C4C A;  1FRD A;  1XXG A;  2W82 A;  1J7C A;  2KMM A;  2JQR B;  2RDH A;  1KRH A;  1FFV A;  2WXQ A;  1J7B A;  4XDC A;  4IKG A;  1JWM D;  1SJE D;  1ZUD 2;  2IPK D;  4GLS C;  1N5X A;  1LO5 D;  1C9F A;  1D4B A;  1L6U A;  1E9M A;  4RF1 A;  3NZ3 A;  1OQR A;  3TSS A;  3TEX A;  4MH8 A;  4YTN B;  1B9R A;  1IBX A;  1WSP A;  3MHZ A;  3FAH A;  1ZPS A;  2K5P A;  2WXL A;  2CJO A;  2D5G A;  2RDG A;  3VQI A;  2H89 B;  2CU3 A;  3R2I A;  3W9C B;  3MFG A;  2H88 B;  4OZA A;  3SR6 A;  2FUG 1;  3AN1 A;  5HI1 A;  1K53 A;  2MJ3 A;  3NVW A;  2WXF A;  3GS2 A;  5AUK A;  4NZL B;  1E0Z A;  1JWU D;  3L4P A;  1GPX A;  4RFB A;  2QSD A;  3AED B;  3DWG C;  1ESF A;  4J3O D;  4HJG E;  3FIL B;  1SF0 A;  3AE3 B;  4O1N A;  1KLU D;  2WNM A;  2JX5 A;  4D2K A;  4OZC A;  4WQM A;  3W5U B;  3AH7 A;  1I4P A;  1ZXH A;  2W3R A;  3Q69 A;  4OW0 A;  1QT9 A;  3W5V B;  3AE1 B;  3BYT B;  1C77 A;  2W54 A;  3O13 A;  1L0V B;  3E56 A;  2WXG A;  4AS1 A;  4US9 A;  1FO4 A;  2K3U A;  3BYY B;  5D3D A;  5C2T B;  1DOI A;  1D5X C;  1VRA B;  4WWM A;  4N58 A;  2BYT A;  2PW9 A;  3ABV B;  1TY0 A;  2BTE A;  1D5Z C;  5BMG A;  2LHD A;  2PLP A;  1MHX A;  1ET9 A;  2LEK A;  5EE0 A;  1QQR A;  1SEB D;  1FXI A;  2K22 A;  1CZP A;  2WXR A;  1VLB A;  1HEZ E;  2M56 B;  2Y5C A;  5H92 C;  3GP7 A;  4A90 A;  4AQ7 A;  4L2Y A;  4ITK A;  1IGD A;  2DWQ A;  1TJE A;  1P7E A;  3TEW A;  5BYS A;  2WU2 B;  1SE2 A;  4KKI A;  4OHJ A;  4YWG G;  4GDL B;  4A6Q A;  2BW2 A;  3N9Y C;  2YEP F;  4NAM A;  1EU4 A;  2XN9 C;  2IDY A;  3NVZ A;  5BYR A;  1YJJ A;  2ZW0 A;  3URY A;  4YSX B;  1V8C A;  5E6J A;  5EE3 A;  1I7H A;  2KDM A;  1ET6 A;  3SEB A;  2WXP A;  1YMH E;  2WXM A;  3AE5 B;  5HFY A;  4P16 A;  3UI3 A;  3VRB B;  3ZGZ A;  5MPO A;  1VR9 A;  1QF6 A;  3ZJT A;  1FEH A;  5AUI A;  4DXG A;  2IGH A;  1UNS A;  2AX5 A;  1EWC A;  2SEB D;  1QOF A;  3P4R B;  3RFZ B;  1FMA D;  1FNW A;  1N60 A;  5BMI A;  1AWD A;  1SB3 C;  5HHD G;  1WRI A;  2BB6 A;  3PZ8 A;  3T3N A;  5EE9 A;  2QEJ C;  2BS3 B;  4OVZ A;  1WWT A;  4LK0 M;  1NEK B;  2JSV X;  2KAJ A;  3BK2 A;  4ZYS A;  4KKJ A;  3BVG A;  1T5X D;  1YQ4 B;  3HVD A;  3KWL A;  1Q10 A;  2Z8L A;  1BML C;  3IT6 B;  3U52 E;  1UGJ A;  1ZXI A;  3BVZ A;  5C3J B;  4TQ0 A;  3W1S A;  2PIA A;  1UWX A;  2M19 A;  4L1B A;  2JYT A;  2WXO A;  4JE3 B;  1WYG A;  4UDU C;  3VR8 B;  1TS2 A;  3PO0 A;  2ICI A;  2WDQ B;  2N9L A;  3BK1 A;  1STE A;  3VR9 B;  2BS4 B;  4DQO C;  1VDV A;  1JW9 D;  2DBY A;  2PTL A;  1JRP A;  1KTK A;  4XE0 A;  2HDE A;  1FCC C;  3BWU D;  1BXT A;  1PFD A;  1RWS A;  1WXQ A;  2JZP A;  2MJE A;  3HRD D;  3P4Q B;  1I4X A;  1KF6 B;  2WXI A;  4YSY B;  3CIR B;  1QKZ A;  4B0M A;  1SXT A;  2RMM A;  1C4P A;  1QLB B;  1VZ8 A;  1XO3 A;  1T6B X;  1FCL A;  3FIL A;  1PGB A;  2BB5 A;  3AE8 B;  1JWS D;  5T8I A;  2IGD A;  4TSS A;  1AYF A;  2HTM E;  2SAK A;  3AEG B;  2EKI A;  4TQ1 A;  1XLN A;  1KLG D;  2FE8 A;  1FNV A;  1EU3 A;  1YN4 A;  2WU5 B;  3E9S A;  3KLS X;  1QOG A;  4C7Z A;  3MJ5 A;  1GB1 A;  3ZJV A;  3AM9 A;  1DOX A;  1C79 A;  1GOZ A;  3AEF B;  1XLP A;  4N59 A;  2JWU A;  1QIL A;  1OQQ A;  3WCQ A;  2J4X A;  1M4V A;  1ACC A;  2M0A A;  1L4D B;  2NMQ A;  3Q8F A;  5BMH A;  1ZP0 B;  1JAL A;  2N9K A;  5JXV A;  4RGO S;  1P7F A;  2MEK A;  4H2A A;  3AEB B;  3NVY A;  3BII D;  2CJN A;  1VZ6 A;  1F77 A;  3GB1 A;  4YXD B;  2MH7 A;  3AE2 B;  2K0P A;  1BUI C;  2LGI A;  3LXF A;  1R7S A;  1SBB B;  4YSZ B;  1HA5 A;  2TSS A;  4HRS A;  1D6E C;  4HKZ E;  1HQR D;  5D3I B;  4L23 A;  2OED A;  2K9X A;  1V97 A;  2RPV A;  4ZRP A;  4US8 A;  3AV8 A;  1XF5 L;  4ZHO A;  3B2F A;  2YEP B;  2G1E A;  1IGC A;  4C56 C;  1PYW D;  5BYQ A;  2X38 A;  2VZK B;  3LB8 C;  3SFE B;  3AE7 B;  4JX1 C;  3SFD B;  3ZQ4 A;  3C8Y A;  1NEN B;  4RNA A;  1TKE A;  3IT4 B;  4A8X C;  2ONQ A;  4ZHP A;  2DYO A;  3IXS A;  3NRZ A;  1ENF A;  3AEE B;  4LTU A;  1FRR A;  1K52 A;  1TY2 A;  2AQ1 B;  2PVG C;  2N7J A;  4FXC A;  2KAC A;  2L32 A;  5G5H A;  2N0S B;  2INP E;  4RGN A;  4WIP A;  4C7Y A;  3NS1 A;  2Q5W D;  1FNU A;  1CK1 A;  1MVK A;  1PUT A;  1V1P B;  2MJD A;  4ARC A;  1DGJ A;  2I2Y A;  4IOI E;  2BBC A;  3IAS 1;  3ZJU A;  1QOB A;  3U2S C;  3R8B A;  5TSS A;  1I4H A;  2WP9 B;  4EE2 A;  1JRO A;  1SE4 A;  1TS3 A;  1E7P B;  2KWD A;  2INN E;  3R2T A;  5I4D A;  2GB1 A;  1SSN A;  1L6V A;  4KGT A;  2LFI A;  1QOA A;  2PKO A;  4XWT A;  4M0W A;  1E6E B;  2LUM A;  3CWI A;  3MC0 B;  3AE6 B;  1NYR A;  4JWU C;  3AEA B;  4RF0 A;  5HG2 A;  1SJH D;  1ZDX A;  3RPF C;  2G9H D;  1CQV A;  2QMT A;  4MT5 A;  1ZE3 D;  2V3N A;  4WUR A;  2W55 A;  1SIJ A;  3EUB 2;  1XCQ L;  2LHE A;  3VRA B;  2B76 B;  3P4P B;  4ZRQ A;  4JPS A;  1DOY A;  1ZDV A;  1RM6 C;  1UUP A;  1N62 A;  1Y56 A;  2L52 A;  1TYG B;  2BS2 B;  1JWB D;  2ON8 A;  1I4Q A;  4R3D A;  2XNA C;  1N61 A;  3J9C A;  2DLB A;  4GDK B;  2PMV A;  5EE1 A;  2L1A A;  1FD6 A;  1TKG A;  1TKY A;  2AQ3 B;  2IGG A;  1FFU A;  2E3T A;  1NYQ A;  3BVM A;  2BT6 A;  4KX6 B;  1JML A;  3NVV A;  4PT5 A;  5GXG B;  4RCO A;  2QJL A;  2WXN A;  3U4E G;  2L83 A;  1MI0 A;  3I9V 1;  4DXF A;  1F2R C;  4MM3 B;  3AMZ A;  3P1M A;  5FK9 C;  1PDX A;  4TMA B;  4LLG M;  1ZOY B;  3PZ7 A;  2QIL A;  4B0E A;  4XWW A;  3P63 A;  2OHF A;  4RH6 A;  1TZO A;  1C76 A;  2ZW1 A;  3Q8B A;  1C78 A;  4KGS A;  1GAQ B;  2WXJ A;  1KH0 A;  1DYQ A;  4HRO A;  1MHH E;  3Q8C A;  2WXK A;  1EWY C;  1L0X B;  4REZ A;  2FBW B;  2GI9 A;  4WAF A;  1YQ3 B;  4A9A A;  4MAC A;  5D7G A;  3Q8A A;  1MPE A;  4XDD A;  2WDR B;  1F2R I;  1V1O A;  1IBX B;  2DYM A;  4HEA 1;  4USA A;  4NJC A;  1JQ4 A;  2E6X A;  4Q2J A;  1D5M C;  4RGT A;  4ARI A;  2WXH A;  3EGR A;  3U7Z A;  1K50 A;  3T3O A;  1B1Z A;  1E10 A;  4ZOH C;  3AE9 B;  1EM7 A;  2JXT A;  3P4S B;  2NTT A;  3P42 A;  4N6E B;  1V1P A;  1T3Q A;  1PGA A;  2J52 A;  3B9J A;  1K51 A;  1VZ7 A;  4HKQ A;  2IJ0 A;  2VZK D;  4YTP B;  1XLQ A;  4P6V F;  2JYE A;  1JWA D;  3ZYY X;  4C80 A;  1XLO A;  1RYJ A;  1C4A A;  1J7A A;  1CJE A;  1NI3 A;  2W3S A;  3FC4 A;  2V0G A;  2KN4 A;  1N63 A;  3IAM 1;  3MP9 A;  1WGK A;  3W2D A;  1I4R A;  5LNK 1;  1SE3 A;  1HZ6 A;  1YN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...