3AE3B

Crystal structure of porcine heart mitochondrial complex ii bound with 2-nitro-n-phenyl-benzamide
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Nitro-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 63
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae3B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae3B01
2W54A 2M56B 3KWLA 1XLOA 1DOIA 3VRAB 3CF4A 1FM0D 5G5GA 2JQRB 5G5HA 3SFDB 1FXAA 1JWBD 3CWIA 1NVID 4YSZB 1JALA 1AWDA 1RWSA 4YXDB 1CJEA 1JWAD 3LB8C 4N59A 5AUKA 4KX6B 4ZOHC 1JRPA 1ZP0B 1L0VB 1N5WA 1EWYC 4WWMA 5MPOA 1E0ZA 1SB3C 1N61A 3AM9A 1WRIA 2PVGC 4IDIA 1FRRA 1PUTA 3NS1A 1E10A 1F0ZA 4N58A 1KRHA 2L83A 3AMZA 1N63A 1NEKB 1RM6C 3AEGB 2WDQB 1V8CA 2JX5A 1NENB 1E6EB 2CU3A 3NVZA 4A9AA 4C7YA 2WU2B 4YTPB 3AE3B 1QOFA 1VLBA 3HVZA 1FXIA 2OHFA 1YJIA 3W5VB 2CJNA 4LTUA 1DOXA 1NYQA 1T3QA 1TKEA 1UWMA 2QJLA 1VDVA 1ZOYB 1XLPA 1E7PB 1QLBB 1DOYA 2FBWB 3LXFA 1L6VA 3SR6A 3FAHA 5GXGB 3AE1B 2G1EA 2N0SB 4US9A 3AECB 1FRDA 2E3TA 2WDVB 1JW9D 2K22A 1J7AA 1E9MA 2B76B 4YTNB 1ROEA 3AEEB 1ZXIA 1GPXA 4WQMA 5H92C 1RYJA 1TJEA 1GT8A 3CIRB 1FFUA 2BT6A 2HTME 3B2GA 5EE1A 2WS3B 3NVWA 1A70A 2AX5A 3VR8B 1KF6B 3P4RB 2WP9B 3ZYYX 2QIEB 1JQ4A 1FMAD 2W55A 1L5PA 3B9JA 3AH7A 4JWSC 4ITKA 1ZUD2 3P4PB 1N60A 1XLQA 4HRSA 4YT0B 1FFVA 1YQ3B 1JROA 1I7HA 1SIJA 1XLNA 3AE9B 4ZHOA 1TYGB 1PFDA 1TKYA 2Q5WD 2MJEA 2BS3B 1B9RA 3P1MA 2WQYB 5H8YE 3W9CB 3SFEB 3B2FA 4YSXB 3NRZA 1PDXA 1QOBA 1V97A 3AE2B 3AN1A 3L4PA 5EE0A 5AUIA 4C7ZA 1FO4A 5EE3A 1J7BA 2KMMA 2L52A 2W3RA 3AEDB 2WLBA 1H7WA 2KAJA 3ABVB 3EUB2 1OQRA 1YQ4B 1QOAA 1SF0A 1AYFA 1H7XA 2H88B 3AE7B 3P4QB 1L6UA 1WYGA 2MH7A 4JX1C 1GTEA 3AE8B 4YTMB 3AEAB 1QT9A 2EKIA 4YSYB 1NYRA 4N6EB 2K5PA 3HRDD 2WU5B 4P6VF 2K9XA 3AE6B 5EE9A 5C2TB 4C80A 1VJKA 3ETRA 1R7SA 4ZHPA 3AE5B 3NVVA 3HUIA 3FC4A 4USAA 3AE4B 2MJ3A 1QOGA 3PO0A 3AEBB 2WDRB 2PVOD 3P4SB 4US8A 1FIQA 3VR9B 1N62A 1CZPA 1YJJA 1DGJA 2M19A 2W3SA 3VRBB 2H89B 2DBYA 1OFFA 3P63A 2BS4B 2BS2B 1WXQA 2MJDA 3DWMA 2PIAA 1IUEA 1WWTA 2ACZB 2CJOA 1XO3A 4HROA 4JWUC 3W5UB 2Y5CA 1OQQA 4FXCA 3RPFC 5C3JB 3AB5A 1NI3A 2LEKA 3AEFB 2PKOA 1KFYB 1J7CA 3BIID 2DWQA 3WCQA 1QF6A 3DWGC 1TKGA 3NVYA 1RFKA 1GTHA 1GAQB 1WGKA 3AV8A 1N5XA
chains in the Genus database with same CATH superfamily
3MTNB 1C79A 1GB4A 4EZJA 4AS1A 1JRPA 1HZ5A 3LYYA 1MJDA 1PUTA 3DVGY 1E10A 5JZEB 4ANUA 4AQ7A 3DVNU 3Q3FA 1TS5A 2JVCA 2N9LA 1RM6C 1V81A 3N1XC 4J6IA 4X57B 1I4QA 2DYBA 4KDIC 2XEWA 4E74A 2Y5PA 1YD8U 4NAMA 4G50A 3RNGC 3JVZX 2K25A 1QZEA 1YJIA 1S3SG 2QHOA 2GI9A 4B0EA 3LXFA 1D4BA 1WGGA 2WDVB 4NAWB 2WXNA 1GPXA 3AEEB 3ONSA 1FFUA 2BT6A 2WS3B 3VR8B 1HEZE 4IM2A 4GU2A 1WX8A 4NJ7A 3UQBA 2BGFA 4L2YA 1JROA 1XLNA 5BMHA 1E7VA 3TCAA 4MDKE 3I57A 2AYOB 3DCGA 3I5JC 1GG3A 5CTRC 2EKEC 3NZSA 3Q2AC 3JSVA 2CHXA 2LJIA 1T5XD 1P7FA 2BKRB 2J4XA 3AE8B 4LNIA 4CYEA 4YSYB 3PZ7A 1TZOA 3PZ8A 4OHJA 3QK0A 3DQVA 1R4NB 2NPTB 2L32A 2LXAA 3FC4A 1YOVB 2PVOD 1L4ZB 1WJ6A 4KKIA 2GOWA 1WXQA 3MHSD 4LDTB 4ARCA 3RNEC 2D10A 3I63C 2N7DA 1MG4A 4GN1A 2W54A 4TV3A 1WJUA 2DZMA 2IBIB 2MQJA 3V62A 5D7GA 4DHZE 1L0VB 5MPOA 3PT2B 2PVGC 1ZDXA 3PHWB 1F0ZA 1P98A 2ON8A 4C4VA 2EMSA 1WE7A 2K8HA 2L0TA 4KVGB 1E6EB 4IWOA 2DNFA 2KFKB 2G3QB 4WAFA 1BMLC 2IO0B 4AP4C 1T3QA 4FLHA 1WY8A 2KDIA 1YMHE 3IFWB 4ICUA 3T8MA 1E7PB 1RAXA 2PW9A 1G6JA 1VZ7A 2K39A 1FPYA 1MVKA 5BYRA 5T8IA 1RYJA 3PRMB 2AX5A 2DENB 4LCDE 3APCA 2W55A 2CHZA 3H8HA 2WWZA 3DBRI 4KSLC 2KKCA 3PGEA 2M0AA 4IG7B 4EE2A 2LVPA 4E3CA 3L4PA 1J7BA 1OQYA 1UGMA 2KMMA 2BB6A 2MLBA 2WXPA 4HXDA 2J52A 4DDGD 2KO3A 2IYDB 5CHVC 2BQQA 3H7PB 3BYYB 4NJCA 4XDDA 1NYRA 4W9CA 2L05A 1IBXB 2XBBC 3WAPA 2K9XA 1V1PA 5G55A 2Z59B 4C80A 4ZHPA 2M17A 3WIMA 4KGRA 3KUZA 1P9DU 4FHJA 4NY0A 1XT9B 3BY4B 5L95C 1MG8A 2BYEA 2Y3AA 2CS4A 3DDCB 3SHQA 3R3MA 4KIKA 4TMAB 1WYWB 2JUOA 4MSMB 1C78A 2I1JA 3NOBA 1MHXA 3C0RB 4Q2JA 5HKHA 1FCCC 2AQ1B 4GLSC 2K8BA 1IPGA 3ZIMA 4ASWC 2MRPA 5D6JB 3QJZA 4B0MA 1VD2A 3X0WA 2KDBA 2NPTA 4M8MA 2IO3B 1I4PA 3K9OB 1L0XB 4A9AA 3N30A 4YTPB 2VH2A 2ICIA 1ZDVA 3HIZA 2MBQA 2DYOA 1J0GA 3L0WB 3O65B 1VDVA 2LD9A 1C3TA 2E3TA 3J9CA 1J7AA 1E9MA 3WAOA 2BF8B 2LJ5A 4HJKA 3NZUA 2QDFA 1TJEA 1SE9A 4RGTA 4KV2A 1HTOA 3HK0A 4NQLB 1KF6B 2ASQA 3U30A 2QIEB 3GOEA 4GIVA 3HHMA 4YT0B 3IAM1 2PJHA 4LNFA 3RNCC 1FEHA 4IW0A 4ZRIA 2L0FA 1SSNA 1F2RI 2RPQA 2BS3B 3W9CB 4WIPA 4W9KA 4JE3B 2ZJDA 3AE2B 2KK8A 2VZKD 1WR1A 2Z8LA 3ZTCA 2OJRA 3Q3OC 1SF0A 1H7XA 3LDZE 1GNUA 2KLGA 3AEAB 2D2QA 2KWDA 3RUIB 4PYUA 5EE9A 4HLEA 2JRIB 2UWQA 3GZNB 4RF0A 4C56C 2LUEA 2V3NA 5LXHA 2V0GA 2SEBD 3NY5A 3RFZB 4EZKA 3N32A 5AZHA 3KYCD 1NI2A 3RPFC 2DWQA 2JT4B 3URYA 4TQ1A 1T0QC 4DHJD 3ZLZA 3CF4A 3Q3MC 3CWIA 3M63B 1WZ0A 2LHDA 2J0KA 4OZAA 2D3GA 2YEPB 3BYTB 3JSVB 4WQOB 2IGHA 2KZRA 3QQ8B 4RM8A 1WJ4A 2JX5A 4C7YA 2BWFA 2CU3A 2JYEA 4TSSA 1F2RC 3DHGC 3U7DA 3R66C 3GE3C 1SE4A 4WAAA 1UWMA 3ZTDA 1XLPA 2N7EA 1DOYA 3FAHA 5GXGB 4US9A 3KUCB 2N0SB 3V61A 1YIWA 2IJ0A 1YQBA 4WWOA 2X38A 5HHDG 1WF9A 2KJ6A 4MGZE 3H7SA 3ZYYX 4JWSC 1ZUD2 2LVQA 4GDLB 2KQSA 1YQ3B 4IM0A 2JRHA 4ZHOA 1TYGB 3DOWA 1VCBA 4MJSA 4CQNA 2WXKA 4C7ZA 2BTEA 1E8XA 4P7IA 2JYTA 3GE8C 1T0RC 4N9F4 1YQ4B 2H88B 3P4QB 3EGRA 2ONQA 2N9PC 3AE6B 1JWUD 1GJZA 2DAJA 4JLCA 3NVVA 1ET9A 1PGBA 4US8A 2ZPNA 1FIQA 4MJSB 3RNAC 1C9FA 2CJOA 1C1YB 3L10B 2LEKA 4EZLA 4KZ0A 3TEWA 2LGDA 3KWLA 2R2OA 1C76A 1EM7A 3TEZA 1FM0D 5G5HA 4HJGE 1AWDA 1P3QU 1HQRD 3IT4B 3RD2A 1FXTB 1Q0WB 4W9GA 4HPLB 2L83A 5D3IB 1R4MI 2WU2B 1F1HA 1MHHE 4WJNA 2CKHB 2KX0A 3JYUA 4LTUA 2LMCA 1TS3A 4RFBA 1QLBB 2C7MB 4MELA 4GOCA 4K81A 2YVCA 3DBHI 4GDKA 3TEYA 1SJED 1BT0A 4XX5A 3ZJUA 3A1QB 3B9JA 5IA7A 2KACA 4D2KA 1I7HA 3RNFC 2Q5WD 1TKYA 5BMIA 1I4HA 4DQOC 4P1BC 1IGCA 1QOBA 3EHVA 3VVWB 4XZ4A 1E7UA 4RMAA 2W3RA 1SE3A 2R2QA 4O1NA 3ZKJC 2WGSA 4MGIE 4B9KA 4II2B 3V60A 3Q6BA 3WANA 5LXIB 4XDCA 2WU5B 3KWVA 4L23A 2MJ3A 1CQVA 5BYQA 3A9JB 2M19A 2MA9B 2RDHA 3Q8AA 2BVCA 1OFFA 1WGHA 2WXOA 4FULA 4M00A 1GOZA 2L8JA 3DWGC 1M94A 1SIFA 1VZ6A 1WGRA 4W9LA 2WLBA 3V6CB 2K8CA 4S17A 4WJQA 3B1LX 3TSSA 1ZW7A 2LRUA 5HFYA 3ECIA 1CJEA 1WRDB 2KMAA 1T6BX 2G9HD 2K3UA 3GB1A 1HE8A 3E56A 4K3CA 3AMZA 2N9EB 3AI5A 3VFKA 4QAYA 4BBNC 2FAZA 1FNWA 1V5OA 4RM9A 5JH5C 2BYVE 2M1MA 1I35A 1L4DB 2LGXA 2WXQA 1AN8A 4LJOB 2KTRA 4OZBA 3IBEA 4HVBA 5LNK1 3ZNHB 1WXSA 2HJ1A 3DVGX 3U4EG 3AH7A 3T3OA 1D5XC 3TUOA 2AWTA 4JL9A 4J3OD 2C5LC 3SFEB 5DPRA 2KC2A 3V05A 1H7WA 3B08A 3W2DA 1UGJA 3PREA 2LGIA 2WXHA 2K5PA 3HRDD 2O6VB 1LFDA 1XCTL 2ZVOA 1WR6E 2IGGA 2J53A 2W82A 3BVMA 3UINB 4OVZA 2WXIA 1TS4A 2GBNA 1WXVA 3UIOB 1DYQA 4W9DA 1WXMA 2BWES 2MEKA 1STEA 3BIID 3I3TB 3NVYA 1GAQB 3JW0X 5E6OA 4XC2A 1TS2A 4KIKB 1TBEA 1DOIA 4NJ6A 2LXCA 5C1ZA 4YSZB 4KX6B 2NTSA 2BPSA 4FN2A 4HEA1 4BKGA 2IO2B 5J2RA 4N58A 2GBJA 1NEKB 4IKGA 1ESFA 5L83A 1JRUA 2JWUA 2KWUB 3UGBB 4KGSA 4URKA 3KVFB 4WJOA 2HDEA 2G1EA 2ZW0A 1E90A 3BWUD 4MM3B 2C60A 2FNJB 2MBBB 4RGMA 3Q8EA 3OJ3A 2GRIA 4PT5A 3PS6A 4F8CB 1XLQA 1I4XA 1PFDA 1QKZA 4TUUA 3DPDA 1RRBA 3RZFA 4YSXB 1V97A 2MWSB 5EE3A 1SEBD 4KSKC 1EUVB 1UH6A 4YTMB 1KLUD 4HDQA 4YL8A 3QX1A 4USAA 3VTVA 2DLBA 2WDRB 2GBRA 2FUHB 2LI5A 3P2BA 3N3KB 1N62A 3OJ4B 3VRBB 4GMVA 2MJDA 1IUEA 2ACZB 3QIJA 2RDBC 3ZNZB 1A5RA 1OQQA 1V9JA 4GXBA 4MT5A 4WH4A 3CSFA 1QF6A 3RN9C 2KDEB 2PEAA 5JXVA 1FNUA 2M56B 1GC7A 2QMTA 2IGDA 3SFDB 1FXAA 1JWBD 1WM3A 2BKFA 1AARA 1N5WA 3ZGZA 1E0ZA 1JCKB 2QEJC 4XGAB 2DAFA 2EMTA 2ZEQA 3NS1A 1LQBA 5G2NA 3DBLI 3U52E 2FCMA 1VRAB 4G3XB 1GUAB 4NNJB 1JWMD 3KYDD 4F1SA 3PHXB 5IAAC 1WX9A 3RI7C 3AE3B 1VLBA 4P16A 3K9PB 1OGWA 5C23A 2C9WB 2JSVX 4M01A 3S2AA 3PPAA 1PYWD 3A9JA 2IY0B 2J7QB 2KANA 4MGKE 2WXJA 3U7ZA 1ROEA 5IKCM 1E8ZA 3DHIC 3MC9A 2B3AA 4MSQB 4WQMA 4I6NB 1C4AA 3GS2A 4I6LB 4FJVB 3N1YC 1ET6A 3DVNV 4HDOA 2M4NA 5JHAA 3P4PB 2C7HA 1R4NI 1EU3A 1SIJA 4W9HA 2IZVB 4ZDVA 3P1MA 2WXGA 3ZNID 4RGOS 2M0XA 2L52A 1OEYA 3QARA 3AEDB 2NVUI 3L08A 2N9KA 3EUB2 2XK5A 3WALA 3NS8A 2DZKA 3ML9A 1YNTE 2K1FA 4IM3A 2WNMA 2AL3A 2I2YA 3BVGA 2JZ3B 4IC7B 1PGAA 3HUIA 2QCZA 4ZRKA 3ZRFA 1LM8B 1TY2A 3ZJVA 2H89B 5DCNA 2WDTB 4HROA 1RLFA 4XWWA 1XEEA 3L16A 4KGTA 3WA0A 1J7CA 1WH3A 1NDDA 3PRPB 2D3BA 5D94A 3QCAA 2NBWB 2CHWA 1XLOA 4K3BA 3CMMB 4W9JA 1TGZB 1KTKA 1EWYC 2FCQA 2L3ZA 2JWZA 4LK0M 4HPMB 4A3PA 3NVZA 4GDLA 3VXWA 3UIPB 4BZAA 1ZGUB 3MC0B 1H4RA 3AU5A 3W5VB 2AEHA 1TKEA 5FK9C 1ZOYB 2INNE 3M95A 1N6ZA 1YN4A 2V3SA 1TIFA 3AECB 4MH0E 2MHJA 4W9IA 3PRZA 3IT6B 1EWCA 3UF8A 1ISNA 4ZRJA 1F9JA 2LUMA 3P4RB 1P1AA 2V3PA 1L5PA 4FJZA 1FFVA 1K53A 4REZA 1P0RA 4DXFA 2MJEA 3KH0A 1JWSD 2VRRB 2XN9C 2TSSA 1KJTA 3BK2A 4BFRA 1VZ8A 2KAJA 1MFWA 1ZPSA 2N1WA 1V80A 1MI0A 2UU7A 2KHWB 3MJ5A 1VJKA 3AE5B 2REXA 1ZE3D 1YN3A 3PO0A 3CSTA 3P63A 3DWMA 1F52A 2E6XA 1ZKHA 3W5UB 1IP9A 3ZNGC 2BB5A 4JQWC 1NI3A 2FE8A 1XD3B 4BKTA 1K8RB 3TIXA 2PMVA 1LGRA 4WJPA 5AUKA 1ZP0B 4WWMA 3O13A 1SB3C 2BYTA 3R2TA 4WWPA 3CF6E 2AQ2B 4AJWA 2WDQB 4FA6A 4CHKA 4IWQA 2KTRB 3TMPB 2IO1B 3HVZA 2K6QA 5BO4B 4RCOA 3AULA 5IOIA 2MSED 1E8YA 3IVFA 3TBLD 3Q8BA 2ZCBA 2FBWB 1L6VA 3AE1B 2RGFA 3MHZA 4XE0A 3IHPC 1KLVA 4A8XC 2D3AA 1V86A 2FIDA 2HTME 2N4FA 3EFCA 4LDTD 3HM6X 2WP9B 1IGDA 2D11A 3A1QA 3FILB 1V1OA 3HM3A 5LLIA 2FIFA 5J18A 1V2YA 1B9RA 3MC8A 3OWEB 3PTFC 1QQRA 2ZW1A 1C77A 3N20C 5BYSA 1T0YA 3Q3NC 4GB9A 4ZRQA 4M0WB 1L6UA 2G4SA 1HZ6A 2G45B 1GTEA 4KZCA 1CK1A 4P6VF 1C4PA 1UELA 3N1ZC 4TKNA 5GMVA 3C8YA 3NG0A 3QC8B 2OOBB 3SDLC 1FD6A 2QSDA 3VR9B 1WE6A 3VUXA 2DZJA 4K1RB 4EFOA 4ZYSA 2PIAA 1WWTA 2QC8A 4HCNB 2FUG1 1JMLA 1WMHB 2R61A 4ICVA 3H7PA 1D3ZA 3VHTC 4FHKA 4P1CC 2JQRB 4HPPA 4DBGA 3U8ZA 4YXDB 4N59A 4ZOHC 5AZGA 3RT3B 2O6VD 2RSUA 2KNBA 3T9LA 1C4CA 3Q69A 2ZVNA 2INCC 3H6NA 4DXGA 2HJ8A 1NBFC 2LASA 2GBMA 3OG5A 2OHFA 1WIAA 4AUQC 2IDYA 4RF1A 4E71A 3SR6A 3SU8X 3WAMA 2OJWA 1V5TA 3ALBA 2B76B 3NJTA 2J0JA 5IO9A 4FADA 3ZW3A 1FCLA 1EU4A 4JGHB 5E6NA 4IOIE 1N60A 1ACCA 2KJRA 2SAKA 2W9NA 1UBQA 1KLGD 1FNVA 3VH4B 1L0YB 3P42A 1QOAA 3RNBC 5I4DA 4XYCA 1AYFA 1TZ1A 4JX1C 1BUIC 1H8CA 3FILA 4HKQA 1RFAA 4B95A 4FJYA 4GDKB 3TEXA 1XQQA 1R7SA 2BBCA 1BXTA 2O2VA 2KN4A 4LNKA 3P4SB 2ZNVB 3SD5A 2VZKB 3ZXRA 2DBYA 1HTQA 3RYTA 2JF5A 3ZQ4A 2Z0DB 2N7JA 1R4MB 3QA8A 3AEFB 4HK2A 1KFYB 4BVUC 2LHEA 2INPE 4OVUA 2PTLA 3GP7A 1WGKA 2RD0A 1UD7A 3A4RA 3ML8A 1JALA 2JZZA 2HD5B 3VTWA 1I42A 4LJPB 5J17A 2WHIA 4A3OA 2GLSA 5DPWA 1J8CA 2INDC 2D07B 3AEGB 1NENB 2I38A 2HE7A 2VH1A 2DYMA 2L7RA 3QWZB 3PV1A 1CMXB 2KXJA 2MW5A 2ZCCA 2QJLA 3B0AA 4BOZB 2V4LA 5BMGA 3Q8CA 4A55A 4MGYE 4DDID 2K22A 4MACA 3APDA 4L1BA 3CIRB 3U2SC 4EOYA 3TJPA 1FMAD 1WM2A 2JZPA 3OAWA 4HRSA 3SEBA 3AU4A 4C00A 1WGYA 3Q14C 5EE0A 3W1SA 3APFA 3C19A 2LVOA 3VUWA 1EO6A 4BAXA 1V1PB 4TQ0A 3VH3B 1UBIA 1Y8RC 2L1AA 3AE7B 3BK1A 5HG2A 5D3DA 2A4ZA 3ZDMC 2LZ6A 3ZJTA 4PS8A 3KW5B 4A90A 1EF1A 3EFUA 5FR3A 2BS2B 3A9KB 1IYFA 4OZCA 1XO3A 1SJHD 5DPSA 1XCQL 2Y5CA 2FCNA 2D5GA 1YN5A 2KC1A 3R7QA 1WGDA 2D3CA 5G5GA 1YX6B 3RMKC 5DPTA 2V4IB 2M8SA 2KVZA 3GZNI 2NS5A 2WX1A 4BBNF 3AM9A 4IDIA 1FRRA 1D5MC 4UDUC 2RDGA 4F7ZA 5JHBA 1J19A 1VR9A 1WMHA 3I9V1 2OEDA 2KWCA 4HWIB 3DBRB 3BZDB 1K50A 1XXGA 2CJNA 1UWXA 5KHOA 4M0WA 4HCPB 4ZYNA 4DK5A 3OLMD 4MEMA 3W1YA 2PE6B 2WYQA 3QAQA 2RR9A 2WXLA 3ZVVA 2KN5A 1A70A 1SBBB 2WXMA 1E5WA 2KWVB 3MJWA 4ITKA 4CO7A 3VAWA 4AJYB 2NBUA 1KOTA 2KQ4X 3DHHC 3X23A 4MM3A 1KM7A 2GB1A 5HI1A 3B2FA 1FO4A 3ZXVA 1OQRA 1GB1A 1QT9A 2KJHB 2KQ7A 5EDSA 1D6EC 3L13A 4N6EB 4OVVA 3Q8FA 2FCSA 2ZPYA 1PQSA 2GMIC 3ETRA 1QOGA 3AEBB 1TT5B 4FBJB 2W3SA 4KKJA 2YLMA 2BS4B 1SE2A 2UYZB 4ANWA 4XWTA 5C3JB 3AB5A 3MP9A 4W9FA 1IBXA 2DHZA 5AZFA 2WX0A 2A5UA 4GSWA 3AV8A 3V6EB 4PYZA 1XF5L 1X1MA 1EF5A 1NVID 3EECA 1RWSA 1JWAD 1F77A 4AWJA 1SXTA 4PS7A 3T3NA 4JPSA 1S1QB 3VDZA 1UZXB 1WSPA 5IN7A 2O2VB 4OW0A 2EELA 1V8CA 3KQ4A 4BKSA 4GGQA 1Y56A 4BOSC 1QOFA 3A33B 5TSSA 4BKSD 2BW2A 3FKYA 2LGYA 1T0SC 2CU1A 2J0MA 2IY1B 2V1YA 3A9KA 3VTUA 3HVDA 2IPKD 4ARIA 3M62B 1JW9D 1UUPA 2KLCA 3BINA 1WXAA 4K7SA 1WFYA 2NR2A 1V49A 3E9SA 2MCNB 4AOFA 3VQIA 3N9YC 2KTFA 2N9XA 1YJ1A 2RPVA 3RCZA 5E6PA 2L76A 1WX7A 4R3DA 2ZNVC 3AE9B 4ZRPA 3RULA 3ZUNA 1P7EA 1UF0A 1M4VA 2Z0EB 1Q5WB 1OEYJ 4JWUC 3R7RA 3NRZA 4ANVA 4M8NA 3BVZA 4PK1A 2DX5B 3DBHB 1HXYD 2JU6X 2RMMA 3ABVB 5E6JA 3D32A 2MBHA 3IXSA 1K52A 5C2TB 2K0PA 4NAWA 3W1SC 1U4AA 2WXRA 5CX3A 4NZLB 3V3XA 2NTTA 3DBSA 1DGJA 1PGXA 4LNOA 2KT7A 5KHQA 1Q10A 5IP4D 1MPEA 4JIOU 3DBLB 4FXCA 1ENFA 2X8XX 3UI3A 3VUYA 3WCQA 5FKAC 2WXFA 2I1KA 2KX3A 1TY0A 4PS3A 2KD0A 3VRAB 1ZXHA 2MX2A 2ZZPB 4ACFA 4I6PA 2DZIA 3NHEB 3QHTA 1WRIA 4M02A 1N63A 4K7UA 2MBOA 2KDMA 2KOXA 1FXIA 2BYFA 2LRWA 3IG3A 2AQ3B 2MP2B 3A4SC 5CHWA 5CHFA 1FRDA 1E8WA 4YTNB 3PZDA 4G11A 4MH8A 5H92C 3EA6A 3LJ3A 2O6VA 3NVWA 2N1VA 4II3B 4HKZE 1JQ4A 2J42A 5D2MB 2XK5B 4ANXA 2CR5A 1Q1OA 3ZO5B 1WJNA 5H8YE 1I4RA 2G4DB 1L7YA 1PDXA 2MP2A 5FR6A 4EUTA 2Y5BB 2KFKA 4RH6A 1V6EA 1WYGA 2MH7A 2NMQA 1I4GA 3TL5A 3ZDTA 3PLUA 3PVLA 4YWGG 3RZWC 3AE4B 4RGNA 1YJJA 4EEWA 3EC8A 2QILA 2NBVB 1Z5SB 1LXDA 3ENEA 4LNNA 2AL6A 3L17A 1TTNA 2PPHA 2PKOA 1TKGA 1RFKA 2L00B 4WURA 1N5XA 4K7WA 4IWPA 3R8BA 4NPNA 1D5ZC 2JPHA 3H9DA 1LO5D 3H1UA 3LB8C 1QILA 2JXXA 3M3JA 4LLGM 1N61A 2LGSA 1KRHA 1WI0A 1SGHA 3UQAA 2V9HA 1UNSA 1WZ3A 3PLVA 2LFIA 4H2AA 4C4VB 1DOXA 1NYQA 2KMCA 3KLSX 4WWNA 1YX5B 4DHZB 1GC6A 3Q3JA 4A6QA 1ZXIA 5AEKB 3IAS1 1GT8A 3B2GA 3MFGA 5EE1A 2KDFB 1Z2MA 2KFJA 1L2NA 4S0RA 2GBKA 4DXAB 4RNAA 2KVRA 2K6DB 2NCNA 2WQYB 1KH0A 2HTHA 4B6WA 1K51A 3AN1A 5TR5A 5AUIA 2JXTA 2YEPF 4KDLB 2JY6A 2EKIA 4A20A 3PSEB 2C7NB 4W9EA 3KUDB 4NQKE 3NUHB 1AW7A 2LWPA 2PE9A 4IUMB 4EKUA 1CZPA 4DWFA 1HA5A 2PLPA 3R2IA 2XNAC 1B1ZA 2MBEA 3NZ3A 2KYWA 1OTRB 3L54A 3ZRCA 4G0NB 3AXCA 1GTHA 4DHJB
chains in the Genus database with same CATH topology
3KWLA 1XLOA 1C76A 1EM7A 3TEZA 1FM0D 1C79A 5G5GA 5G5HA 4HJGE 1GB4A 1AWDA 2V4IB 4AS1A 1HQRD 1JRPA 1KTKA 1EWYC 1HZ5A 3LYYA 3AM9A 3IT4B 4IDIA 1FRRA 1PUTA 1E10A 1D5MC 4AQ7A 2L83A 4UDUC 2RDGA 4LK0M 5D3IB 1TS5A 2N9LA 1RM6C 3NVZA 1I4QA 2WU2B 1VR9A 1MHHE 2Y5PA 3I9V1 4NAMA 2OEDA 3MC0B 3BZDB 1K50A 1XXGA 1YJIA 2CJNA 4LTUA 3W5VB 1UWXA 2LMCA 1TS3A 4RFBA 4M0WA 1TKEA 5FK9C 1ZOYB 2INNE 2GI9A 1QLBB 4B0EA 3LXFA 1D4BA 1YN4A 3AECB 2WDVB 4NAWB 2WXNA 3IT6B 3AEEB 2WXLA 1GPXA 1EWCA 1FFUA 2BT6A 2WS3B 1A70A 1SBBB 2LUMA 3VR8B 1HEZE 1SJED 2WXMA 3P4RB 3TEYA 3ZJUA 2V3PA 1L5PA 3B9JA 4ITKA 2KACA 4L2YA 1FFVA 1JROA 4D2KA 1I7HA 1XLNA 1K53A 5BMHA 4REZA 3I57A 4DXFA 2Q5WD 1TKYA 5BMIA 2KQ4X 1I4HA 2MJEA 4DQOC 2GB1A 1IGCA 5HI1A 3B2FA 1QOBA 1FO4A 1JWSD 2XN9C 2TSSA 3BK2A 1VZ8A 1SE3A 2W3RA 2LJIA 4O1NA 1T5XD 2KAJA 1OQRA 1P7FA 1ZPSA 2J4XA 3AE8B 1GB1A 1QT9A 1D6EC 4YSYB 3PZ7A 1TZOA 1MI0A 3PZ8A 4N6EB 4XDCA 2WU5B 3KWVA 3Q8FA 4OHJA 4L23A 3MJ5A 1VJKA 3ETRA 3AE5B 2L32A 3FC4A 2MJ3A 1ZE3D 1QOGA 1YN3A 3AEBB 3PO0A 2PVOD 1L4ZB 1CQVA 5BYQA 4KKIA 2M19A 2W3SA 4KKJA 2RDHA 3Q8AA 1OFFA 3P63A 2BS4B 3DWMA 1WXQA 1SE2A 2E6XA 2WXOA 3W5UB 4ARCA 4XWTA 5C3JB 2BB5A 3AB5A 1NI3A 2FE8A 1GOZA 3MP9A 3DWGC 1IBXA 1VZ6A 3AV8A 2WLBA 2W54A 1XF5L 2PMVA 3TSSA 1NVID 5HFYA 1RWSA 1CJEA 1F77A 1JWAD 5AUKA 1SXTA 5D7GA 1ZP0B 1L0VB 4WWMA 1T6BX 3O13A 5MPOA 3T3NA 1SB3C 4JPSA 2BYTA 2PVGC 1WSPA 2G9HD 1ZDXA 2K3UA 3R2TA 4OW0A 3GB1A 1F0ZA 2ON8A 3E56A 2EELA 2AQ2B 3AMZA 2WDQB 1V8CA 3KQ4A 1E6EB 1Y56A 1QOFA 5TSSA 2BW2A 3HVZA 1FNWA 4WAFA 1BMLC 4RCOA 1T3QA 1YMHE 3HVDA 3Q8BA 1E7PB 2PW9A 2FBWB 1L6VA 2IPKD 3AE1B 4ARIA 1JW9D 1VZ7A 1L4DB 3MHZA 4XE0A 1UUPA 2WXQA 1MVKA 4A8XC 1AN8A 5BYRA 5T8IA 1RYJA 4OZBA 2HTME 3E9SA 2AX5A 3VQIA 5LNK1 3N9YC 2WP9B 1IGDA 3U4EG 2RPVA 3FILB 2W55A 1V1OA 3AH7A 3H8HA 4R3DA 2M0AA 3T3OA 1D5XC 3AE9B 4ZRPA 3TUOA 4EE2A 1P7EA 4J3OD 1B9RA 1M4VA 3OWEB 1QQRA 3SFEB 2ZW1A 4JWUC 3NRZA 3L4PA 1C77A 1J7BA 2WXPA 2KMMA 3BVZA 2BB6A 5BYSA 3V05A 1HXYD 2J52A 1H7WA 2JU6X 2RMMA 4ZRQA 3ABVB 5E6JA 3W2DA 1UGJA 1L6UA 3IXSA 1HZ6A 1GTEA 2LGIA 3BYYB 4NJCA 2WXHA 4XDDA 1CK1A 1NYRA 2K5PA 1IBXB 1K52A 3HRDD 1C4PA 1XCTL 4P6VF 2K9XA 1V1PA 2IGGA 2J53A 5C2TB 2K0PA 2W82A 4C80A 4ZHPA 3C8YA 3BVMA 4KGRA 1FD6A 2QSDA 2WXRA 4NZLB 3V3XA 3VR9B 2NTTA 4OVZA 2WXIA 1DGJA 1PGXA 1TS4A 4ZYSA 2PIAA 2Y3AA 1Q10A 1DYQA 1WWTA 1MPEA 4FXCA 1ENFA 2FUG1 1JMLA 4TMAB 2MEKA 1STEA 3BIID 3UI3A 3WCQA 2R61A 5FKAC 3NVYA 2WXFA 1C78A 1TY0A 1GAQB 1TS2A 1DOIA 3VRAB 1MHXA 1ZXHA 2JQRB 4YSZB 4YXDB 4Q2JA 4N59A 4KX6B 4ZOHC 1FCCC 2AQ1B 2NTSA 4GLSC 1WRIA 4HEA1 4N58A 4B0MA 1N63A 1NEKB 4IKGA 1C4CA 1ESFA 3Q69A 1I4PA 1L0XB 4A9AA 2JWUA 4DXGA 2KDMA 4YTPB 2ICIA 1FXIA 1ZDVA 2OHFA 2IDYA 4KGSA 2DYOA 4RF1A 1VDVA 2AQ3B 3SR6A 2HDEA 2G1EA 2ZW0A 1FRDA 2E3TA 3J9CA 3BWUD 4MM3B 1J7AA 1E9MA 2B76B 4YTNB 4MH8A 5H92C 1TJEA 3EA6A 4RGTA 3NVWA 4HKZE 1KF6B 4RGMA 2QIEB 1FCLA 1JQ4A 1EU4A 2J42A 3Q8EA 2GRIA 4IOIE 4PT5A 1N60A 1XLQA 1ACCA 4YT0B 1I4XA 3IAM1 1FEHA 1PFDA 1QKZA 1SSNA 1F2RI 2SAKA 2BS3B 5H8YE 3W9CB 4WIPA 1KLGD 1I4RA 4YSXB 4JE3B 1PDXA 1V97A 3AE2B 1FNVA 1L0YB 2VZKD 5EE3A 2Z8LA 3P42A 1SEBD 1QOAA 1SF0A 5I4DA 4RH6A 1AYFA 1H7XA 1WYGA 2MH7A 4JX1C 1BUIC 2NMQA 4YTMB 3AEAB 1I4GA 1KLUD 3FILA 4HKQA 2KWDA 4GDKB 5EE9A 3TEXA 1R7SA 2BBCA 4YWGG 4USAA 1BXTA 3AE4B 2DLBA 4RGNA 2WDRB 2KN4A 3P4SB 2VZKB 1N62A 4RF0A 4C56C 1YJJA 2V3NA 3VRBB 2QILA 2DBYA 2V0GA 2MJDA 2SEBD 1IUEA 3ZQ4A 2ACZB 3RFZB 2N7JA 1OQQA 3RPFC 4MT5A 4WH4A 2PKOA 3AEFB 1QF6A 1KFYB 2LHEA 2DWQA 2INPE 1TKGA 3URYA 1RFKA 2PTLA 4TQ1A 4WURA 5JXVA 3GP7A 1WGKA 1FNUA 1N5XA 2M56B 3R8BA 1D5ZC 3CF4A 2QMTA 2IGDA 3SFDB 1FXAA 1JWBD 3CWIA 1JALA 1LO5D 2LHDA 3LB8C 1QILA 1N5WA 4OZAA 3ZGZA 1E0ZA 1JCKB 2QEJC 2YEPB 3BYTB 4LLGM 1N61A 3NS1A 1KRHA 3U52E 2IGHA 1VRAB 3AEGB 2JX5A 4C7YA 1NENB 1JWMD 1UNSA 2CU3A 2I38A 2JYEA 4TSSA 1F2RC 3AE3B 2DYMA 2LFIA 1VLBA 4H2AA 4P16A 1SE4A 1DOXA 1NYQA 1UWMA 2QJLA 1XLPA 2JSVX 1DOYA 3KLSX 3FAHA 1PYWD 5GXGB 4US9A 2N0SB 5BMGA 3Q8CA 2IJ0A 2WXJA 3U7ZA 4A55A 2K22A 4MACA 1ROEA 1ZXIA 4A6QA 3IAS1 4WQMA 4L1BA 2X38A 1GT8A 3CIRB 3U2SC 3B2GA 1C4AA 3MFGA 3GS2A 5EE1A 5HHDG 3ZYYX 1ET6A 1FMAD 2JZPA 4JWSC 1ZUD2 3P4PB 4GDLB 4HRSA 3SEBA 1EU3A 4RNAA 1YQ3B 1SIJA 4ZHOA 1TYGB 3P1MA 2WQYB 1KH0A 4CQNA 2WXGA 1K51A 3AN1A 2WXKA 5EE0A 5AUIA 2JXTA 4C7ZA 2BTEA 3W1SA 4RGOS 2YEPF 2L52A 2JYTA 3AEDB 1V1PB 4TQ0A 2N9KA 3EUB2 1YQ4B 2L1AA 2H88B 3AE7B 3P4QB 1YNTE 3EGRA 3BK1A 2EKIA 2WNMA 5HG2A 2I2YA 2ONQA 5D3DA 3BVGA 1PGAA 3AE6B 1JWUD 3NUHB 3NVVA 3HUIA 1AW7A 3ZJTA 1ET9A 1PGBA 4A90A 4US8A 1FIQA 1CZPA 1HA5A 2PLPA 1TY2A 3R2IA 3ZJVA 2H89B 2XNAC 5FR3A 2BS2B 1C9FA 2CJOA 4HROA 1XO3A 4OZCA 1SJHD 1XCQL 2Y5CA 4XWWA 1B1ZA 1XEEA 3NZ3A 4KGTA 2LEKA 1J7CA 2D5GA 1YN5A 1GTHA 3TEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W54 A;  2M56 B;  3KWL A;  1XLO A;  1DOI A;  3VRA B;  3CF4 A;  1FM0 D;  5G5G A;  2JQR B;  5G5H A;  3SFD B;  1FXA A;  1JWB D;  3CWI A;  1NVI D;  4YSZ B;  1JAL A;  1AWD A;  1RWS A;  4YXD B;  1CJE A;  1JWA D;  3LB8 C;  4N59 A;  5AUK A;  4KX6 B;  4ZOH C;  1JRP A;  1ZP0 B;  1L0V B;  1N5W A;  1EWY C;  4WWM A;  5MPO A;  1E0Z A;  1SB3 C;  1N61 A;  3AM9 A;  1WRI A;  2PVG C;  4IDI A;  1FRR A;  1PUT A;  3NS1 A;  1E10 A;  1F0Z A;  4N58 A;  1KRH A;  2L83 A;  3AMZ A;  1N63 A;  1NEK B;  1RM6 C;  3AEG B;  2WDQ B;  1V8C A;  2JX5 A;  1NEN B;  1E6E B;  2CU3 A;  3NVZ A;  4A9A A;  4C7Y A;  2WU2 B;  4YTP B;  3AE3 B;  1QOF A;  1VLB A;  3HVZ A;  1FXI A;  2OHF A;  1YJI A;  3W5V B;  2CJN A;  4LTU A;  1DOX A;  1NYQ A;  1T3Q A;  1TKE A;  1UWM A;  2QJL A;  1VDV A;  1ZOY B;  1XLP A;  1E7P B;  1QLB B;  1DOY A;  2FBW B;  3LXF A;  1L6V A;  3SR6 A;  3FAH A;  5GXG B;  3AE1 B;  2G1E A;  2N0S B;  4US9 A;  3AEC B;  1FRD A;  2E3T A;  2WDV B;  1JW9 D;  2K22 A;  1J7A A;  1E9M A;  2B76 B;  4YTN B;  1ROE A;  3AEE B;  1ZXI A;  1GPX A;  4WQM A;  5H92 C;  1RYJ A;  1TJE A;  1GT8 A;  3CIR B;  1FFU A;  2BT6 A;  2HTM E;  3B2G A;  5EE1 A;  2WS3 B;  3NVW A;  1A70 A;  2AX5 A;  3VR8 B;  1KF6 B;  3P4R B;  2WP9 B;  3ZYY X;  2QIE B;  1JQ4 A;  1FMA D;  2W55 A;  1L5P A;  3B9J A;  3AH7 A;  4JWS C;  4ITK A;  1ZUD 2;  3P4P B;  1N60 A;  1XLQ A;  4HRS A;  4YT0 B;  1FFV A;  1YQ3 B;  1JRO A;  1I7H A;  1SIJ A;  1XLN A;  3AE9 B;  4ZHO A;  1TYG B;  1PFD A;  1TKY A;  2Q5W D;  2MJE A;  2BS3 B;  1B9R A;  3P1M A;  2WQY B;  5H8Y E;  3W9C B;  3SFE B;  3B2F A;  4YSX B;  3NRZ A;  1PDX A;  1QOB A;  1V97 A;  3AE2 B;  3AN1 A;  3L4P A;  5EE0 A;  5AUI A;  4C7Z A;  1FO4 A;  5EE3 A;  1J7B A;  2KMM A;  2L52 A;  2W3R A;  3AED B;  2WLB A;  1H7W A;  2KAJ A;  3ABV B;  3EUB 2;  1OQR A;  1YQ4 B;  1QOA A;  1SF0 A;  1AYF A;  1H7X A;  2H88 B;  3AE7 B;  3P4Q B;  1L6U A;  1WYG A;  2MH7 A;  4JX1 C;  1GTE A;  3AE8 B;  4YTM B;  3AEA B;  1QT9 A;  2EKI A;  4YSY B;  1NYR A;  4N6E B;  2K5P A;  3HRD D;  2WU5 B;  4P6V F;  2K9X A;  3AE6 B;  5EE9 A;  5C2T B;  4C80 A;  1VJK A;  3ETR A;  1R7S A;  4ZHP A;  3AE5 B;  3NVV A;  3HUI A;  3FC4 A;  4USA A;  3AE4 B;  2MJ3 A;  1QOG A;  3PO0 A;  3AEB B;  2WDR B;  2PVO D;  3P4S B;  4US8 A;  1FIQ A;  3VR9 B;  1N62 A;  1CZP A;  1YJJ A;  1DGJ A;  2M19 A;  2W3S A;  3VRB B;  2H89 B;  2DBY A;  1OFF A;  3P63 A;  2BS4 B;  2BS2 B;  1WXQ A;  2MJD A;  3DWM A;  2PIA A;  1IUE A;  1WWT A;  2ACZ B;  2CJO A;  1XO3 A;  4HRO A;  4JWU C;  3W5U B;  2Y5C A;  1OQQ A;  4FXC A;  3RPF C;  5C3J B;  3AB5 A;  1NI3 A;  2LEK A;  3AEF B;  2PKO A;  1KFY B;  1J7C A;  3BII D;  2DWQ A;  3WCQ A;  1QF6 A;  3DWG C;  1TKG A;  3NVY A;  1RFK A;  1GTH A;  1GAQ B;  1WGK A;  3AV8 A;  1N5X A; 
#chains in the Genus database with same CATH topology
 3MTN B;  1C79 A;  1GB4 A;  4EZJ A;  4AS1 A;  1JRP A;  1HZ5 A;  3LYY A;  1MJD A;  1PUT A;  3DVG Y;  1E10 A;  5JZE B;  4ANU A;  4AQ7 A;  3DVN U;  3Q3F A;  1TS5 A;  2JVC A;  2N9L A;  1RM6 C;  1V81 A;  3N1X C;  4J6I A;  4X57 B;  1I4Q A;  2DYB A;  4KDI C;  2XEW A;  4E74 A;  2Y5P A;  1YD8 U;  4NAM A;  4G50 A;  3RNG C;  3JVZ X;  2K25 A;  1QZE A;  1YJI A;  1S3S G;  2QHO A;  2GI9 A;  4B0E A;  3LXF A;  1D4B A;  1WGG A;  2WDV B;  4NAW B;  2WXN A;  1GPX A;  3AEE B;  3ONS A;  1FFU A;  2BT6 A;  2WS3 B;  3VR8 B;  1HEZ E;  4IM2 A;  4GU2 A;  1WX8 A;  4NJ7 A;  3UQB A;  2BGF A;  4L2Y A;  1JRO A;  1XLN A;  5BMH A;  1E7V A;  3TCA A;  4MDK E;  3I57 A;  2AYO B;  3DCG A;  3I5J C;  1GG3 A;  5CTR C;  2EKE C;  3NZS A;  3Q2A C;  3JSV A;  2CHX A;  2LJI A;  1T5X D;  1P7F A;  2BKR B;  2J4X A;  3AE8 B;  4LNI A;  4CYE A;  4YSY B;  3PZ7 A;  1TZO A;  3PZ8 A;  4OHJ A;  3QK0 A;  3DQV A;  1R4N B;  2NPT B;  2L32 A;  2LXA A;  3FC4 A;  1YOV B;  2PVO D;  1L4Z B;  1WJ6 A;  4KKI A;  2GOW A;  1WXQ A;  3MHS D;  4LDT B;  4ARC A;  3RNE C;  2D10 A;  3I63 C;  2N7D A;  1MG4 A;  4GN1 A;  2W54 A;  4TV3 A;  1WJU A;  2DZM A;  2IBI B;  2MQJ A;  3V62 A;  5D7G A;  4DHZ E;  1L0V B;  5MPO A;  3PT2 B;  2PVG C;  1ZDX A;  3PHW B;  1F0Z A;  1P98 A;  2ON8 A;  4C4V A;  2EMS A;  1WE7 A;  2K8H A;  2L0T A;  4KVG B;  1E6E B;  4IWO A;  2DNF A;  2KFK B;  2G3Q B;  4WAF A;  1BML C;  2IO0 B;  4AP4 C;  1T3Q A;  4FLH A;  1WY8 A;  2KDI A;  1YMH E;  3IFW B;  4ICU A;  3T8M A;  1E7P B;  1RAX A;  2PW9 A;  1G6J A;  1VZ7 A;  2K39 A;  1FPY A;  1MVK A;  5BYR A;  5T8I A;  1RYJ A;  3PRM B;  2AX5 A;  2DEN B;  4LCD E;  3APC A;  2W55 A;  2CHZ A;  3H8H A;  2WWZ A;  3DBR I;  4KSL C;  2KKC A;  3PGE A;  2M0A A;  4IG7 B;  4EE2 A;  2LVP A;  4E3C A;  3L4P A;  1J7B A;  1OQY A;  1UGM A;  2KMM A;  2BB6 A;  2MLB A;  2WXP A;  4HXD A;  2J52 A;  4DDG D;  2KO3 A;  2IYD B;  5CHV C;  2BQQ A;  3H7P B;  3BYY B;  4NJC A;  4XDD A;  1NYR A;  4W9C A;  2L05 A;  1IBX B;  2XBB C;  3WAP A;  2K9X A;  1V1P A;  5G55 A;  2Z59 B;  4C80 A;  4ZHP A;  2M17 A;  3WIM A;  4KGR A;  3KUZ A;  1P9D U;  4FHJ A;  4NY0 A;  1XT9 B;  3BY4 B;  5L95 C;  1MG8 A;  2BYE A;  2Y3A A;  2CS4 A;  3DDC B;  3SHQ A;  3R3M A;  4KIK A;  4TMA B;  1WYW B;  2JUO A;  4MSM B;  1C78 A;  2I1J A;  3NOB A;  1MHX A;  3C0R B;  4Q2J A;  5HKH A;  1FCC C;  2AQ1 B;  4GLS C;  2K8B A;  1IPG A;  3ZIM A;  4ASW C;  2MRP A;  5D6J B;  3QJZ A;  4B0M A;  1VD2 A;  3X0W A;  2KDB A;  2NPT A;  4M8M A;  2IO3 B;  1I4P A;  3K9O B;  1L0X B;  4A9A A;  3N30 A;  4YTP B;  2VH2 A;  2ICI A;  1ZDV A;  3HIZ A;  2MBQ A;  2DYO A;  1J0G A;  3L0W B;  3O65 B;  1VDV A;  2LD9 A;  1C3T A;  2E3T A;  3J9C A;  1J7A A;  1E9M A;  3WAO A;  2BF8 B;  2LJ5 A;  4HJK A;  3NZU A;  2QDF A;  1TJE A;  1SE9 A;  4RGT A;  4KV2 A;  1HTO A;  3HK0 A;  4NQL B;  1KF6 B;  2ASQ A;  3U30 A;  2QIE B;  3GOE A;  4GIV A;  3HHM A;  4YT0 B;  3IAM 1;  2PJH A;  4LNF A;  3RNC C;  1FEH A;  4IW0 A;  4ZRI A;  2L0F A;  1SSN A;  1F2R I;  2RPQ A;  2BS3 B;  3W9C B;  4WIP A;  4W9K A;  4JE3 B;  2ZJD A;  3AE2 B;  2KK8 A;  2VZK D;  1WR1 A;  2Z8L A;  3ZTC A;  2OJR A;  3Q3O C;  1SF0 A;  1H7X A;  3LDZ E;  1GNU A;  2KLG A;  3AEA B;  2D2Q A;  2KWD A;  3RUI B;  4PYU A;  5EE9 A;  4HLE A;  2JRI B;  2UWQ A;  3GZN B;  4RF0 A;  4C56 C;  2LUE A;  2V3N A;  5LXH A;  2V0G A;  2SEB D;  3NY5 A;  3RFZ B;  4EZK A;  3N32 A;  5AZH A;  3KYC D;  1NI2 A;  3RPF C;  2DWQ A;  2JT4 B;  3URY A;  4TQ1 A;  1T0Q C;  4DHJ D;  3ZLZ A;  3CF4 A;  3Q3M C;  3CWI A;  3M63 B;  1WZ0 A;  2LHD A;  2J0K A;  4OZA A;  2D3G A;  2YEP B;  3BYT B;  3JSV B;  4WQO B;  2IGH A;  2KZR A;  3QQ8 B;  4RM8 A;  1WJ4 A;  2JX5 A;  4C7Y A;  2BWF A;  2CU3 A;  2JYE A;  4TSS A;  1F2R C;  3DHG C;  3U7D A;  3R66 C;  3GE3 C;  1SE4 A;  4WAA A;  1UWM A;  3ZTD A;  1XLP A;  2N7E A;  1DOY A;  3FAH A;  5GXG B;  4US9 A;  3KUC B;  2N0S B;  3V61 A;  1YIW A;  2IJ0 A;  1YQB A;  4WWO A;  2X38 A;  5HHD G;  1WF9 A;  2KJ6 A;  4MGZ E;  3H7S A;  3ZYY X;  4JWS C;  1ZUD 2;  2LVQ A;  4GDL B;  2KQS A;  1YQ3 B;  4IM0 A;  2JRH A;  4ZHO A;  1TYG B;  3DOW A;  1VCB A;  4MJS A;  4CQN A;  2WXK A;  4C7Z A;  2BTE A;  1E8X A;  4P7I A;  2JYT A;  3GE8 C;  1T0R C;  4N9F 4;  1YQ4 B;  2H88 B;  3P4Q B;  3EGR A;  2ONQ A;  2N9P C;  3AE6 B;  1JWU D;  1GJZ A;  2DAJ A;  4JLC A;  3NVV A;  1ET9 A;  1PGB A;  4US8 A;  2ZPN A;  1FIQ A;  4MJS B;  3RNA C;  1C9F A;  2CJO A;  1C1Y B;  3L10 B;  2LEK A;  4EZL A;  4KZ0 A;  3TEW A;  2LGD A;  3KWL A;  2R2O A;  1C76 A;  1EM7 A;  3TEZ A;  1FM0 D;  5G5H A;  4HJG E;  1AWD A;  1P3Q U;  1HQR D;  3IT4 B;  3RD2 A;  1FXT B;  1Q0W B;  4W9G A;  4HPL B;  2L83 A;  5D3I B;  1R4M I;  2WU2 B;  1F1H A;  1MHH E;  4WJN A;  2CKH B;  2KX0 A;  3JYU A;  4LTU A;  2LMC A;  1TS3 A;  4RFB A;  1QLB B;  2C7M B;  4MEL A;  4GOC A;  4K81 A;  2YVC A;  3DBH I;  4GDK A;  3TEY A;  1SJE D;  1BT0 A;  4XX5 A;  3ZJU A;  3A1Q B;  3B9J A;  5IA7 A;  2KAC A;  4D2K A;  1I7H A;  3RNF C;  2Q5W D;  1TKY A;  5BMI A;  1I4H A;  4DQO C;  4P1B C;  1IGC A;  1QOB A;  3EHV A;  3VVW B;  4XZ4 A;  1E7U A;  4RMA A;  2W3R A;  1SE3 A;  2R2Q A;  4O1N A;  3ZKJ C;  2WGS A;  4MGI E;  4B9K A;  4II2 B;  3V60 A;  3Q6B A;  3WAN A;  5LXI B;  4XDC A;  2WU5 B;  3KWV A;  4L23 A;  2MJ3 A;  1CQV A;  5BYQ A;  3A9J B;  2M19 A;  2MA9 B;  2RDH A;  3Q8A A;  2BVC A;  1OFF A;  1WGH A;  2WXO A;  4FUL A;  4M00 A;  1GOZ A;  2L8J A;  3DWG C;  1M94 A;  1SIF A;  1VZ6 A;  1WGR A;  4W9L A;  2WLB A;  3V6C B;  2K8C A;  4S17 A;  4WJQ A;  3B1L X;  3TSS A;  1ZW7 A;  2LRU A;  5HFY A;  3ECI A;  1CJE A;  1WRD B;  2KMA A;  1T6B X;  2G9H D;  2K3U A;  3GB1 A;  1HE8 A;  3E56 A;  4K3C A;  3AMZ A;  2N9E B;  3AI5 A;  3VFK A;  4QAY A;  4BBN C;  2FAZ A;  1FNW A;  1V5O A;  4RM9 A;  5JH5 C;  2BYV E;  2M1M A;  1I35 A;  1L4D B;  2LGX A;  2WXQ A;  1AN8 A;  4LJO B;  2KTR A;  4OZB A;  3IBE A;  4HVB A;  5LNK 1;  3ZNH B;  1WXS A;  2HJ1 A;  3DVG X;  3U4E G;  3AH7 A;  3T3O A;  1D5X C;  3TUO A;  2AWT A;  4JL9 A;  4J3O D;  2C5L C;  3SFE B;  5DPR A;  2KC2 A;  3V05 A;  1H7W A;  3B08 A;  3W2D A;  1UGJ A;  3PRE A;  2LGI A;  2WXH A;  2K5P A;  3HRD D;  2O6V B;  1LFD A;  1XCT L;  2ZVO A;  1WR6 E;  2IGG A;  2J53 A;  2W82 A;  3BVM A;  3UIN B;  4OVZ A;  2WXI A;  1TS4 A;  2GBN A;  1WXV A;  3UIO B;  1DYQ A;  4W9D A;  1WXM A;  2BWE S;  2MEK A;  1STE A;  3BII D;  3I3T B;  3NVY A;  1GAQ B;  3JW0 X;  5E6O A;  4XC2 A;  1TS2 A;  4KIK B;  1TBE A;  1DOI A;  4NJ6 A;  2LXC A;  5C1Z A;  4YSZ B;  4KX6 B;  2NTS A;  2BPS A;  4FN2 A;  4HEA 1;  4BKG A;  2IO2 B;  5J2R A;  4N58 A;  2GBJ A;  1NEK B;  4IKG A;  1ESF A;  5L83 A;  1JRU A;  2JWU A;  2KWU B;  3UGB B;  4KGS A;  4URK A;  3KVF B;  4WJO A;  2HDE A;  2G1E A;  2ZW0 A;  1E90 A;  3BWU D;  4MM3 B;  2C60 A;  2FNJ B;  2MBB B;  4RGM A;  3Q8E A;  3OJ3 A;  2GRI A;  4PT5 A;  3PS6 A;  4F8C B;  1XLQ A;  1I4X A;  1PFD A;  1QKZ A;  4TUU A;  3DPD A;  1RRB A;  3RZF A;  4YSX B;  1V97 A;  2MWS B;  5EE3 A;  1SEB D;  4KSK C;  1EUV B;  1UH6 A;  4YTM B;  1KLU D;  4HDQ A;  4YL8 A;  3QX1 A;  4USA A;  3VTV A;  2DLB A;  2WDR B;  2GBR A;  2FUH B;  2LI5 A;  3P2B A;  3N3K B;  1N62 A;  3OJ4 B;  3VRB B;  4GMV A;  2MJD A;  1IUE A;  2ACZ B;  3QIJ A;  2RDB C;  3ZNZ B;  1A5R A;  1OQQ A;  1V9J A;  4GXB A;  4MT5 A;  4WH4 A;  3CSF A;  1QF6 A;  3RN9 C;  2KDE B;  2PEA A;  5JXV A;  1FNU A;  2M56 B;  1GC7 A;  2QMT A;  2IGD A;  3SFD B;  1FXA A;  1JWB D;  1WM3 A;  2BKF A;  1AAR A;  1N5W A;  3ZGZ A;  1E0Z A;  1JCK B;  2QEJ C;  4XGA B;  2DAF A;  2EMT A;  2ZEQ A;  3NS1 A;  1LQB A;  5G2N A;  3DBL I;  3U52 E;  2FCM A;  1VRA B;  4G3X B;  1GUA B;  4NNJ B;  1JWM D;  3KYD D;  4F1S A;  3PHX B;  5IAA C;  1WX9 A;  3RI7 C;  3AE3 B;  1VLB A;  4P16 A;  3K9P B;  1OGW A;  5C23 A;  2C9W B;  2JSV X;  4M01 A;  3S2A A;  3PPA A;  1PYW D;  3A9J A;  2IY0 B;  2J7Q B;  2KAN A;  4MGK E;  2WXJ A;  3U7Z A;  1ROE A;  5IKC M;  1E8Z A;  3DHI C;  3MC9 A;  2B3A A;  4MSQ B;  4WQM A;  4I6N B;  1C4A A;  3GS2 A;  4I6L B;  4FJV B;  3N1Y C;  1ET6 A;  3DVN V;  4HDO A;  2M4N A;  5JHA A;  3P4P B;  2C7H A;  1R4N I;  1EU3 A;  1SIJ A;  4W9H A;  2IZV B;  4ZDV A;  3P1M A;  2WXG A;  3ZNI D;  4RGO S;  2M0X A;  2L52 A;  1OEY A;  3QAR A;  3AED B;  2NVU I;  3L08 A;  2N9K A;  3EUB 2;  2XK5 A;  3WAL A;  3NS8 A;  2DZK A;  3ML9 A;  1YNT E;  2K1F A;  4IM3 A;  2WNM A;  2AL3 A;  2I2Y A;  3BVG A;  2JZ3 B;  4IC7 B;  1PGA A;  3HUI A;  2QCZ A;  4ZRK A;  3ZRF A;  1LM8 B;  1TY2 A;  3ZJV A;  2H89 B;  5DCN A;  2WDT B;  4HRO A;  1RLF A;  4XWW A;  1XEE A;  3L16 A;  4KGT A;  3WA0 A;  1J7C A;  1WH3 A;  1NDD A;  3PRP B;  2D3B A;  5D94 A;  3QCA A;  2NBW B;  2CHW A;  1XLO A;  4K3B A;  3CMM B;  4W9J A;  1TGZ B;  1KTK A;  1EWY C;  2FCQ A;  2L3Z A;  2JWZ A;  4LK0 M;  4HPM B;  4A3P A;  3NVZ A;  4GDL A;  3VXW A;  3UIP B;  4BZA A;  1ZGU B;  3MC0 B;  1H4R A;  3AU5 A;  3W5V B;  2AEH A;  1TKE A;  5FK9 C;  1ZOY B;  2INN E;  3M95 A;  1N6Z A;  1YN4 A;  2V3S A;  1TIF A;  3AEC B;  4MH0 E;  2MHJ A;  4W9I A;  3PRZ A;  3IT6 B;  1EWC A;  3UF8 A;  1ISN A;  4ZRJ A;  1F9J A;  2LUM A;  3P4R B;  1P1A A;  2V3P A;  1L5P A;  4FJZ A;  1FFV A;  1K53 A;  4REZ A;  1P0R A;  4DXF A;  2MJE A;  3KH0 A;  1JWS D;  2VRR B;  2XN9 C;  2TSS A;  1KJT A;  3BK2 A;  4BFR A;  1VZ8 A;  2KAJ A;  1MFW A;  1ZPS A;  2N1W A;  1V80 A;  1MI0 A;  2UU7 A;  2KHW B;  3MJ5 A;  1VJK A;  3AE5 B;  2REX A;  1ZE3 D;  1YN3 A;  3PO0 A;  3CST A;  3P63 A;  3DWM A;  1F52 A;  2E6X A;  1ZKH A;  3W5U B;  1IP9 A;  3ZNG C;  2BB5 A;  4JQW C;  1NI3 A;  2FE8 A;  1XD3 B;  4BKT A;  1K8R B;  3TIX A;  2PMV A;  1LGR A;  4WJP A;  5AUK A;  1ZP0 B;  4WWM A;  3O13 A;  1SB3 C;  2BYT A;  3R2T A;  4WWP A;  3CF6 E;  2AQ2 B;  4AJW A;  2WDQ B;  4FA6 A;  4CHK A;  4IWQ A;  2KTR B;  3TMP B;  2IO1 B;  3HVZ A;  2K6Q A;  5BO4 B;  4RCO A;  3AUL A;  5IOI A;  2MSE D;  1E8Y A;  3IVF A;  3TBL D;  3Q8B A;  2ZCB A;  2FBW B;  1L6V A;  3AE1 B;  2RGF A;  3MHZ A;  4XE0 A;  3IHP C;  1KLV A;  4A8X C;  2D3A A;  1V86 A;  2FID A;  2HTM E;  2N4F A;  3EFC A;  4LDT D;  3HM6 X;  2WP9 B;  1IGD A;  2D11 A;  3A1Q A;  3FIL B;  1V1O A;  3HM3 A;  5LLI A;  2FIF A;  5J18 A;  1V2Y A;  1B9R A;  3MC8 A;  3OWE B;  3PTF C;  1QQR A;  2ZW1 A;  1C77 A;  3N20 C;  5BYS A;  1T0Y A;  3Q3N C;  4GB9 A;  4ZRQ A;  4M0W B;  1L6U A;  2G4S A;  1HZ6 A;  2G45 B;  1GTE A;  4KZC A;  1CK1 A;  4P6V F;  1C4P A;  1UEL A;  3N1Z C;  4TKN A;  5GMV A;  3C8Y A;  3NG0 A;  3QC8 B;  2OOB B;  3SDL C;  1FD6 A;  2QSD A;  3VR9 B;  1WE6 A;  3VUX A;  2DZJ A;  4K1R B;  4EFO A;  4ZYS A;  2PIA A;  1WWT A;  2QC8 A;  4HCN B;  2FUG 1;  1JML A;  1WMH B;  2R61 A;  4ICV A;  3H7P A;  1D3Z A;  3VHT C;  4FHK A;  4P1C C;  2JQR B;  4HPP A;  4DBG A;  3U8Z A;  4YXD B;  4N59 A;  4ZOH C;  5AZG A;  3RT3 B;  2O6V D;  2RSU A;  2KNB A;  3T9L A;  1C4C A;  3Q69 A;  2ZVN A;  2INC C;  3H6N A;  4DXG A;  2HJ8 A;  1NBF C;  2LAS A;  2GBM A;  3OG5 A;  2OHF A;  1WIA A;  4AUQ C;  2IDY A;  4RF1 A;  4E71 A;  3SR6 A;  3SU8 X;  3WAM A;  2OJW A;  1V5T A;  3ALB A;  2B76 B;  3NJT A;  2J0J A;  5IO9 A;  4FAD A;  3ZW3 A;  1FCL A;  1EU4 A;  4JGH B;  5E6N A;  4IOI E;  1N60 A;  1ACC A;  2KJR A;  2SAK A;  2W9N A;  1UBQ A;  1KLG D;  1FNV A;  3VH4 B;  1L0Y B;  3P42 A;  1QOA A;  3RNB C;  5I4D A;  4XYC A;  1AYF A;  1TZ1 A;  4JX1 C;  1BUI C;  1H8C A;  3FIL A;  4HKQ A;  1RFA A;  4B95 A;  4FJY A;  4GDK B;  3TEX A;  1XQQ A;  1R7S A;  2BBC A;  1BXT A;  2O2V A;  2KN4 A;  4LNK A;  3P4S B;  2ZNV B;  3SD5 A;  2VZK B;  3ZXR A;  2DBY A;  1HTQ A;  3RYT A;  2JF5 A;  3ZQ4 A;  2Z0D B;  2N7J A;  1R4M B;  3QA8 A;  3AEF B;  4HK2 A;  1KFY B;  4BVU C;  2LHE A;  2INP E;  4OVU A;  2PTL A;  3GP7 A;  1WGK A;  2RD0 A;  1UD7 A;  3A4R A;  3ML8 A;  1JAL A;  2JZZ A;  2HD5 B;  3VTW A;  1I42 A;  4LJP B;  5J17 A;  2WHI A;  4A3O A;  2GLS A;  5DPW A;  1J8C A;  2IND C;  2D07 B;  3AEG B;  1NEN B;  2I38 A;  2HE7 A;  2VH1 A;  2DYM A;  2L7R A;  3QWZ B;  3PV1 A;  1CMX B;  2KXJ A;  2MW5 A;  2ZCC A;  2QJL A;  3B0A A;  4BOZ B;  2V4L A;  5BMG A;  3Q8C A;  4A55 A;  4MGY E;  4DDI D;  2K22 A;  4MAC A;  3APD A;  4L1B A;  3CIR B;  3U2S C;  4EOY A;  3TJP A;  1FMA D;  1WM2 A;  2JZP A;  3OAW A;  4HRS A;  3SEB A;  3AU4 A;  4C00 A;  1WGY A;  3Q14 C;  5EE0 A;  3W1S A;  3APF A;  3C19 A;  2LVO A;  3VUW A;  1EO6 A;  4BAX A;  1V1P B;  4TQ0 A;  3VH3 B;  1UBI A;  1Y8R C;  2L1A A;  3AE7 B;  3BK1 A;  5HG2 A;  5D3D A;  2A4Z A;  3ZDM C;  2LZ6 A;  3ZJT A;  4PS8 A;  3KW5 B;  4A90 A;  1EF1 A;  3EFU A;  5FR3 A;  2BS2 B;  3A9K B;  1IYF A;  4OZC A;  1XO3 A;  1SJH D;  5DPS A;  1XCQ L;  2Y5C A;  2FCN A;  2D5G A;  1YN5 A;  2KC1 A;  3R7Q A;  1WGD A;  2D3C A;  5G5G A;  1YX6 B;  3RMK C;  5DPT A;  2V4I B;  2M8S A;  2KVZ A;  3GZN I;  2NS5 A;  2WX1 A;  4BBN F;  3AM9 A;  4IDI A;  1FRR A;  1D5M C;  4UDU C;  2RDG A;  4F7Z A;  5JHB A;  1J19 A;  1VR9 A;  1WMH A;  3I9V 1;  2OED A;  2KWC A;  4HWI B;  3DBR B;  3BZD B;  1K50 A;  1XXG A;  2CJN A;  1UWX A;  5KHO A;  4M0W A;  4HCP B;  4ZYN A;  4DK5 A;  3OLM D;  4MEM A;  3W1Y A;  2PE6 B;  2WYQ A;  3QAQ A;  2RR9 A;  2WXL A;  3ZVV A;  2KN5 A;  1A70 A;  1SBB B;  2WXM A;  1E5W A;  2KWV B;  3MJW A;  4ITK A;  4CO7 A;  3VAW A;  4AJY B;  2NBU A;  1KOT A;  2KQ4 X;  3DHH C;  3X23 A;  4MM3 A;  1KM7 A;  2GB1 A;  5HI1 A;  3B2F A;  1FO4 A;  3ZXV A;  1OQR A;  1GB1 A;  1QT9 A;  2KJH B;  2KQ7 A;  5EDS A;  1D6E C;  3L13 A;  4N6E B;  4OVV A;  3Q8F A;  2FCS A;  2ZPY A;  1PQS A;  2GMI C;  3ETR A;  1QOG A;  3AEB B;  1TT5 B;  4FBJ B;  2W3S A;  4KKJ A;  2YLM A;  2BS4 B;  1SE2 A;  2UYZ B;  4ANW A;  4XWT A;  5C3J B;  3AB5 A;  3MP9 A;  4W9F A;  1IBX A;  2DHZ A;  5AZF A;  2WX0 A;  2A5U A;  4GSW A;  3AV8 A;  3V6E B;  4PYZ A;  1XF5 L;  1X1M A;  1EF5 A;  1NVI D;  3EEC A;  1RWS A;  1JWA D;  1F77 A;  4AWJ A;  1SXT A;  4PS7 A;  3T3N A;  4JPS A;  1S1Q B;  3VDZ A;  1UZX B;  1WSP A;  5IN7 A;  2O2V B;  4OW0 A;  2EEL A;  1V8C A;  3KQ4 A;  4BKS A;  4GGQ A;  1Y56 A;  4BOS C;  1QOF A;  3A33 B;  5TSS A;  4BKS D;  2BW2 A;  3FKY A;  2LGY A;  1T0S C;  2CU1 A;  2J0M A;  2IY1 B;  2V1Y A;  3A9K A;  3VTU A;  3HVD A;  2IPK D;  4ARI A;  3M62 B;  1JW9 D;  1UUP A;  2KLC A;  3BIN A;  1WXA A;  4K7S A;  1WFY A;  2NR2 A;  1V49 A;  3E9S A;  2MCN B;  4AOF A;  3VQI A;  3N9Y C;  2KTF A;  2N9X A;  1YJ1 A;  2RPV A;  3RCZ A;  5E6P A;  2L76 A;  1WX7 A;  4R3D A;  2ZNV C;  3AE9 B;  4ZRP A;  3RUL A;  3ZUN A;  1P7E A;  1UF0 A;  1M4V A;  2Z0E B;  1Q5W B;  1OEY J;  4JWU C;  3R7R A;  3NRZ A;  4ANV A;  4M8N A;  3BVZ A;  4PK1 A;  2DX5 B;  3DBH B;  1HXY D;  2JU6 X;  2RMM A;  3ABV B;  5E6J A;  3D32 A;  2MBH A;  3IXS A;  1K52 A;  5C2T B;  2K0P A;  4NAW A;  3W1S C;  1U4A A;  2WXR A;  5CX3 A;  4NZL B;  3V3X A;  2NTT A;  3DBS A;  1DGJ A;  1PGX A;  4LNO A;  2KT7 A;  5KHQ A;  1Q10 A;  5IP4 D;  1MPE A;  4JIO U;  3DBL B;  4FXC A;  1ENF A;  2X8X X;  3UI3 A;  3VUY A;  3WCQ A;  5FKA C;  2WXF A;  2I1K A;  2KX3 A;  1TY0 A;  4PS3 A;  2KD0 A;  3VRA B;  1ZXH A;  2MX2 A;  2ZZP B;  4ACF A;  4I6P A;  2DZI A;  3NHE B;  3QHT A;  1WRI A;  4M02 A;  1N63 A;  4K7U A;  2MBO A;  2KDM A;  2KOX A;  1FXI A;  2BYF A;  2LRW A;  3IG3 A;  2AQ3 B;  2MP2 B;  3A4S C;  5CHW A;  5CHF A;  1FRD A;  1E8W A;  4YTN B;  3PZD A;  4G11 A;  4MH8 A;  5H92 C;  3EA6 A;  3LJ3 A;  2O6V A;  3NVW A;  2N1V A;  4II3 B;  4HKZ E;  1JQ4 A;  2J42 A;  5D2M B;  2XK5 B;  4ANX A;  2CR5 A;  1Q1O A;  3ZO5 B;  1WJN A;  5H8Y E;  1I4R A;  2G4D B;  1L7Y A;  1PDX A;  2MP2 A;  5FR6 A;  4EUT A;  2Y5B B;  2KFK A;  4RH6 A;  1V6E A;  1WYG A;  2MH7 A;  2NMQ A;  1I4G A;  3TL5 A;  3ZDT A;  3PLU A;  3PVL A;  4YWG G;  3RZW C;  3AE4 B;  4RGN A;  1YJJ A;  4EEW A;  3EC8 A;  2QIL A;  2NBV B;  1Z5S B;  1LXD A;  3ENE A;  4LNN A;  2AL6 A;  3L17 A;  1TTN A;  2PPH A;  2PKO A;  1TKG A;  1RFK A;  2L00 B;  4WUR A;  1N5X A;  4K7W A;  4IWP A;  3R8B A;  4NPN A;  1D5Z C;  2JPH A;  3H9D A;  1LO5 D;  3H1U A;  3LB8 C;  1QIL A;  2JXX A;  3M3J A;  4LLG M;  1N61 A;  2LGS A;  1KRH A;  1WI0 A;  1SGH A;  3UQA A;  2V9H A;  1UNS A;  1WZ3 A;  3PLV A;  2LFI A;  4H2A A;  4C4V B;  1DOX A;  1NYQ A;  2KMC A;  3KLS X;  4WWN A;  1YX5 B;  4DHZ B;  1GC6 A;  3Q3J A;  4A6Q A;  1ZXI A;  5AEK B;  3IAS 1;  1GT8 A;  3B2G A;  3MFG A;  5EE1 A;  2KDF B;  1Z2M A;  2KFJ A;  1L2N A;  4S0R A;  2GBK A;  4DXA B;  4RNA A;  2KVR A;  2K6D B;  2NCN A;  2WQY B;  1KH0 A;  2HTH A;  4B6W A;  1K51 A;  3AN1 A;  5TR5 A;  5AUI A;  2JXT A;  2YEP F;  4KDL B;  2JY6 A;  2EKI A;  4A20 A;  3PSE B;  2C7N B;  4W9E A;  3KUD B;  4NQK E;  3NUH B;  1AW7 A;  2LWP A;  2PE9 A;  4IUM B;  4EKU A;  1CZP A;  4DWF A;  1HA5 A;  2PLP A;  3R2I A;  2XNA C;  1B1Z A;  2MBE A;  3NZ3 A;  2KYW A;  1OTR B;  3L54 A;  3ZRC A;  4G0N B;  3AXC A;  1GTH A;  4DHJ B; 
#chains in the Genus database with same CATH homology
 3KWL A;  1XLO A;  1C76 A;  1EM7 A;  3TEZ A;  1FM0 D;  1C79 A;  5G5G A;  5G5H A;  4HJG E;  1GB4 A;  1AWD A;  2V4I B;  4AS1 A;  1HQR D;  1JRP A;  1KTK A;  1EWY C;  1HZ5 A;  3LYY A;  3AM9 A;  3IT4 B;  4IDI A;  1FRR A;  1PUT A;  1E10 A;  1D5M C;  4AQ7 A;  2L83 A;  4UDU C;  2RDG A;  4LK0 M;  5D3I B;  1TS5 A;  2N9L A;  1RM6 C;  3NVZ A;  1I4Q A;  2WU2 B;  1VR9 A;  1MHH E;  2Y5P A;  3I9V 1;  4NAM A;  2OED A;  3MC0 B;  3BZD B;  1K50 A;  1XXG A;  1YJI A;  2CJN A;  4LTU A;  3W5V B;  1UWX A;  2LMC A;  1TS3 A;  4RFB A;  4M0W A;  1TKE A;  5FK9 C;  1ZOY B;  2INN E;  2GI9 A;  1QLB B;  4B0E A;  3LXF A;  1D4B A;  1YN4 A;  3AEC B;  2WDV B;  4NAW B;  2WXN A;  3IT6 B;  3AEE B;  2WXL A;  1GPX A;  1EWC A;  1FFU A;  2BT6 A;  2WS3 B;  1A70 A;  1SBB B;  2LUM A;  3VR8 B;  1HEZ E;  1SJE D;  2WXM A;  3P4R B;  3TEY A;  3ZJU A;  2V3P A;  1L5P A;  3B9J A;  4ITK A;  2KAC A;  4L2Y A;  1FFV A;  1JRO A;  4D2K A;  1I7H A;  1XLN A;  1K53 A;  5BMH A;  4REZ A;  3I57 A;  4DXF A;  2Q5W D;  1TKY A;  5BMI A;  2KQ4 X;  1I4H A;  2MJE A;  4DQO C;  2GB1 A;  1IGC A;  5HI1 A;  3B2F A;  1QOB A;  1FO4 A;  1JWS D;  2XN9 C;  2TSS A;  3BK2 A;  1VZ8 A;  1SE3 A;  2W3R A;  2LJI A;  4O1N A;  1T5X D;  2KAJ A;  1OQR A;  1P7F A;  1ZPS A;  2J4X A;  3AE8 B;  1GB1 A;  1QT9 A;  1D6E C;  4YSY B;  3PZ7 A;  1TZO A;  1MI0 A;  3PZ8 A;  4N6E B;  4XDC A;  2WU5 B;  3KWV A;  3Q8F A;  4OHJ A;  4L23 A;  3MJ5 A;  1VJK A;  3ETR A;  3AE5 B;  2L32 A;  3FC4 A;  2MJ3 A;  1ZE3 D;  1QOG A;  1YN3 A;  3AEB B;  3PO0 A;  2PVO D;  1L4Z B;  1CQV A;  5BYQ A;  4KKI A;  2M19 A;  2W3S A;  4KKJ A;  2RDH A;  3Q8A A;  1OFF A;  3P63 A;  2BS4 B;  3DWM A;  1WXQ A;  1SE2 A;  2E6X A;  2WXO A;  3W5U B;  4ARC A;  4XWT A;  5C3J B;  2BB5 A;  3AB5 A;  1NI3 A;  2FE8 A;  1GOZ A;  3MP9 A;  3DWG C;  1IBX A;  1VZ6 A;  3AV8 A;  2WLB A;  2W54 A;  1XF5 L;  2PMV A;  3TSS A;  1NVI D;  5HFY A;  1RWS A;  1CJE A;  1F77 A;  1JWA D;  5AUK A;  1SXT A;  5D7G A;  1ZP0 B;  1L0V B;  4WWM A;  1T6B X;  3O13 A;  5MPO A;  3T3N A;  1SB3 C;  4JPS A;  2BYT A;  2PVG C;  1WSP A;  2G9H D;  1ZDX A;  2K3U A;  3R2T A;  4OW0 A;  3GB1 A;  1F0Z A;  2ON8 A;  3E56 A;  2EEL A;  2AQ2 B;  3AMZ A;  2WDQ B;  1V8C A;  3KQ4 A;  1E6E B;  1Y56 A;  1QOF A;  5TSS A;  2BW2 A;  3HVZ A;  1FNW A;  4WAF A;  1BML C;  4RCO A;  1T3Q A;  1YMH E;  3HVD A;  3Q8B A;  1E7P B;  2PW9 A;  2FBW B;  1L6V A;  2IPK D;  3AE1 B;  4ARI A;  1JW9 D;  1VZ7 A;  1L4D B;  3MHZ A;  4XE0 A;  1UUP A;  2WXQ A;  1MVK A;  4A8X C;  1AN8 A;  5BYR A;  5T8I A;  1RYJ A;  4OZB A;  2HTM E;  3E9S A;  2AX5 A;  3VQI A;  5LNK 1;  3N9Y C;  2WP9 B;  1IGD A;  3U4E G;  2RPV A;  3FIL B;  2W55 A;  1V1O A;  3AH7 A;  3H8H A;  4R3D A;  2M0A A;  3T3O A;  1D5X C;  3AE9 B;  4ZRP A;  3TUO A;  4EE2 A;  1P7E A;  4J3O D;  1B9R A;  1M4V A;  3OWE B;  1QQR A;  3SFE B;  2ZW1 A;  4JWU C;  3NRZ A;  3L4P A;  1C77 A;  1J7B A;  2WXP A;  2KMM A;  3BVZ A;  2BB6 A;  5BYS A;  3V05 A;  1HXY D;  2J52 A;  1H7W A;  2JU6 X;  2RMM A;  4ZRQ A;  3ABV B;  5E6J A;  3W2D A;  1UGJ A;  1L6U A;  3IXS A;  1HZ6 A;  1GTE A;  2LGI A;  3BYY B;  4NJC A;  2WXH A;  4XDD A;  1CK1 A;  1NYR A;  2K5P A;  1IBX B;  1K52 A;  3HRD D;  1C4P A;  1XCT L;  4P6V F;  2K9X A;  1V1P A;  2IGG A;  2J53 A;  5C2T B;  2K0P A;  2W82 A;  4C80 A;  4ZHP A;  3C8Y A;  3BVM A;  4KGR A;  1FD6 A;  2QSD A;  2WXR A;  4NZL B;  3V3X A;  3VR9 B;  2NTT A;  4OVZ A;  2WXI A;  1DGJ A;  1PGX A;  1TS4 A;  4ZYS A;  2PIA A;  2Y3A A;  1Q10 A;  1DYQ A;  1WWT A;  1MPE A;  4FXC A;  1ENF A;  2FUG 1;  1JML A;  4TMA B;  2MEK A;  1STE A;  3BII D;  3UI3 A;  3WCQ A;  2R61 A;  5FKA C;  3NVY A;  2WXF A;  1C78 A;  1TY0 A;  1GAQ B;  1TS2 A;  1DOI A;  3VRA B;  1MHX A;  1ZXH A;  2JQR B;  4YSZ B;  4YXD B;  4Q2J A;  4N59 A;  4KX6 B;  4ZOH C;  1FCC C;  2AQ1 B;  2NTS A;  4GLS C;  1WRI A;  4HEA 1;  4N58 A;  4B0M A;  1N63 A;  1NEK B;  4IKG A;  1C4C A;  1ESF A;  3Q69 A;  1I4P A;  1L0X B;  4A9A A;  2JWU A;  4DXG A;  2KDM A;  4YTP B;  2ICI A;  1FXI A;  1ZDV A;  2OHF A;  2IDY A;  4KGS A;  2DYO A;  4RF1 A;  1VDV A;  2AQ3 B;  3SR6 A;  2HDE A;  2G1E A;  2ZW0 A;  1FRD A;  2E3T A;  3J9C A;  3BWU D;  4MM3 B;  1J7A A;  1E9M A;  2B76 B;  4YTN B;  4MH8 A;  5H92 C;  1TJE A;  3EA6 A;  4RGT A;  3NVW A;  4HKZ E;  1KF6 B;  4RGM A;  2QIE B;  1FCL A;  1JQ4 A;  1EU4 A;  2J42 A;  3Q8E A;  2GRI A;  4IOI E;  4PT5 A;  1N60 A;  1XLQ A;  1ACC A;  4YT0 B;  1I4X A;  3IAM 1;  1FEH A;  1PFD A;  1QKZ A;  1SSN A;  1F2R I;  2SAK A;  2BS3 B;  5H8Y E;  3W9C B;  4WIP A;  1KLG D;  1I4R A;  4YSX B;  4JE3 B;  1PDX A;  1V97 A;  3AE2 B;  1FNV A;  1L0Y B;  2VZK D;  5EE3 A;  2Z8L A;  3P42 A;  1SEB D;  1QOA A;  1SF0 A;  5I4D A;  4RH6 A;  1AYF A;  1H7X A;  1WYG A;  2MH7 A;  4JX1 C;  1BUI C;  2NMQ A;  4YTM B;  3AEA B;  1I4G A;  1KLU D;  3FIL A;  4HKQ A;  2KWD A;  4GDK B;  5EE9 A;  3TEX A;  1R7S A;  2BBC A;  4YWG G;  4USA A;  1BXT A;  3AE4 B;  2DLB A;  4RGN A;  2WDR B;  2KN4 A;  3P4S B;  2VZK B;  1N62 A;  4RF0 A;  4C56 C;  1YJJ A;  2V3N A;  3VRB B;  2QIL A;  2DBY A;  2V0G A;  2MJD A;  2SEB D;  1IUE A;  3ZQ4 A;  2ACZ B;  3RFZ B;  2N7J A;  1OQQ A;  3RPF C;  4MT5 A;  4WH4 A;  2PKO A;  3AEF B;  1QF6 A;  1KFY B;  2LHE A;  2DWQ A;  2INP E;  1TKG A;  3URY A;  1RFK A;  2PTL A;  4TQ1 A;  4WUR A;  5JXV A;  3GP7 A;  1WGK A;  1FNU A;  1N5X A;  2M56 B;  3R8B A;  1D5Z C;  3CF4 A;  2QMT A;  2IGD A;  3SFD B;  1FXA A;  1JWB D;  3CWI A;  1JAL A;  1LO5 D;  2LHD A;  3LB8 C;  1QIL A;  1N5W A;  4OZA A;  3ZGZ A;  1E0Z A;  1JCK B;  2QEJ C;  2YEP B;  3BYT B;  4LLG M;  1N61 A;  3NS1 A;  1KRH A;  3U52 E;  2IGH A;  1VRA B;  3AEG B;  2JX5 A;  4C7Y A;  1NEN B;  1JWM D;  1UNS A;  2CU3 A;  2I38 A;  2JYE A;  4TSS A;  1F2R C;  3AE3 B;  2DYM A;  2LFI A;  1VLB A;  4H2A A;  4P16 A;  1SE4 A;  1DOX A;  1NYQ A;  1UWM A;  2QJL A;  1XLP A;  2JSV X;  1DOY A;  3KLS X;  3FAH A;  1PYW D;  5GXG B;  4US9 A;  2N0S B;  5BMG A;  3Q8C A;  2IJ0 A;  2WXJ A;  3U7Z A;  4A55 A;  2K22 A;  4MAC A;  1ROE A;  1ZXI A;  4A6Q A;  3IAS 1;  4WQM A;  4L1B A;  2X38 A;  1GT8 A;  3CIR B;  3U2S C;  3B2G A;  1C4A A;  3MFG A;  3GS2 A;  5EE1 A;  5HHD G;  3ZYY X;  1ET6 A;  1FMA D;  2JZP A;  4JWS C;  1ZUD 2;  3P4P B;  4GDL B;  4HRS A;  3SEB A;  1EU3 A;  4RNA A;  1YQ3 B;  1SIJ A;  4ZHO A;  1TYG B;  3P1M A;  2WQY B;  1KH0 A;  4CQN A;  2WXG A;  1K51 A;  3AN1 A;  2WXK A;  5EE0 A;  5AUI A;  2JXT A;  4C7Z A;  2BTE A;  3W1S A;  4RGO S;  2YEP F;  2L52 A;  2JYT A;  3AED B;  1V1P B;  4TQ0 A;  2N9K A;  3EUB 2;  1YQ4 B;  2L1A A;  2H88 B;  3AE7 B;  3P4Q B;  1YNT E;  3EGR A;  3BK1 A;  2EKI A;  2WNM A;  5HG2 A;  2I2Y A;  2ONQ A;  5D3D A;  3BVG A;  1PGA A;  3AE6 B;  1JWU D;  3NUH B;  3NVV A;  3HUI A;  1AW7 A;  3ZJT A;  1ET9 A;  1PGB A;  4A90 A;  4US8 A;  1FIQ A;  1CZP A;  1HA5 A;  2PLP A;  1TY2 A;  3R2I A;  3ZJV A;  2H89 B;  2XNA C;  5FR3 A;  2BS2 B;  1C9F A;  2CJO A;  4HRO A;  1XO3 A;  4OZC A;  1SJH D;  1XCQ L;  2Y5C A;  4XWW A;  1B1Z A;  1XEE A;  3NZ3 A;  4KGT A;  2LEK A;  1J7C A;  2D5G A;  1YN5 A;  1GTH A;  3TEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...