3AE3B

Crystal structure of porcine heart mitochondrial complex ii bound with 2-nitro-n-phenyl-benzamide
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Nitro-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 63
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae3B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae3B01
2WP9B 2N0SB 1H7WA 4HRSA 1N5WA 2KAJA 1JWAD 4IDIA 2OHFA 1L0VB 3AV8A 4YXDB 5G5GA 4A9AA 5MPOA 3AECB 3AH7A 3NVZA 1AWDA 3AE4B 3AE7B 3W9CB 2WU2B 1FFUA 1KF6B 1GTEA 2PKOA 3NVVA 5EE9A 3CF4A 5AUKA 1FXAA 1JRPA 3P4PB 1OQQA 1YJIA 4ITKA 4FXCA 2Y5CA 2CJNA 3CWIA 1DOYA 1XLNA 3VRBB 4YTMB 1AYFA 1TJEA 1QT9A 1PFDA 4C80A 1YJJA 2BS2B 1OQRA 2FBWB 1GTHA 1DOIA 1PDXA 4YTNB 1I7HA 3NS1A 2K9XA 2L83A 1QLBB 1NYRA 3ABVB 2JX5A 4YSYB 1FRRA 2K22A 2PIAA 3HVZA 1WXQA 3SR6A 3SFDB 2BT6A 2MJEA 4P6VF 3AE6B 1WRIA 3EUB2 4JWSC 2WDQB 3W5VB 1YQ3B 2K5PA 1L6VA 5H92C 1ROEA 1N63A 2DBYA 1GAQB 3AEDB 1RWSA 2MJ3A 3NRZA 2WU5B 1L5PA 3P63A 4HROA 5EE1A 3AE8B 1PUTA 1ZOYB 1R7SA 2LEKA 3KWLA 2Q5WD 3P1MA 2QJLA 3VR9B 3RPFC 4N59A 1N62A 1NENB 3DWGC 1FXIA 4LTUA 1TKYA 1E7PB 2KMMA 3AEFB 3SFEB 1N61A 1SF0A 1KRHA 2H88B 2EKIA 1A70A 2WDRB 2M19A 1DGJA 2QIEB 3P4QB 1TKGA 4KX6B 1WGKA 1VLBA 1KFYB 1FMAD 1SB3C 2PVGC 3B2GA 5EE0A 1GPXA 4N58A 4US9A 1JROA 1J7CA 2W3RA 2BS3B 1VJKA 2PVOD 1N5XA 3HRDD 2CU3A 3B9JA 2AX5A 2HTME 5EE3A 3DWMA 1NI3A 3AE1B 3AEGB 1XO3A 2L52A 1QOBA 1EWYC 1DOXA 5C2TB 1OFFA 4YSXB 1L6UA 2BS4B 1H7XA 1XLOA 1XLPA 3LXFA 3W5UB 1UWMA 1QOFA 1FIQA 4WQMA 1QOAA 2H89B 2CJOA 2JQRB 4ZHPA 1E0ZA 1FRDA 1J7BA 1WYGA 3AE5B 3BIID 5C3JB 1JQ4A 2G1EA 3ETRA 5H8YE 2ACZB 1XLQA 1VDVA 1RYJA 3VR8B 3AMZA 4USAA 3AN1A 2DWQA 4JWUC 2W54A 1E6EB 2E3TA 3VRAB 1NEKB 1E10A 2W55A 4C7YA 2WS3B 3HUIA 1NYQA 3PO0A 1QOGA 1CZPA 4C7ZA 1V97A 2MJDA 1ZP0B 4YT0B 1JALA 1SIJA 1ZUD2 3LB8C 4WWMA 1CJEA 1J7AA 4ZHOA 1QF6A 1ZXIA 3AEEB 5AUIA 1NVID 3P4RB 3AB5A 1YQ4B 1T3QA 4YSZB 3FAHA 5G5HA 1TYGB 4US8A 5GXGB 2M56B 1E9MA 1FO4A 3B2FA 3AE9B 1WWTA 1B9RA 1JWBD 1V8CA 2B76B 3NVWA 1GT8A 2W3SA 4YTPB 3AEAB 1FFVA 1RFKA 2MH7A 3L4PA 1JW9D 2WLBA 3NVYA 3P4SB 3AE3B 3ZYYX 1N60A 1FM0D 2WQYB 2WDVB 4JX1C 4N6EB 1F0ZA 4ZOHC 1TKEA 3AEBB 1IUEA 3FC4A 1RM6C 3WCQA 3AE2B 3CIRB 3AM9A
chains in the Genus database with same CATH superfamily
1SE4A 1JWAD 2FIDA 3WAMA 4EZKA 2N9EB 4G50A 4HEA1 1WFYA 3QJZA 3PSEB 3DBHB 3ONSA 2PKOA 1JRPA 1XLNA 4KIKB 1FCLA 1XF5L 3RNFC 1UGMA 1DOIA 2O6VB 2LMCA 4HPLB 3FILA 3NZ3A 3HVDA 3W1YA 3MC9A 2K8CA 2V4LA 4RGMA 4HROA 3PPAA 3RMKC 3Q3OC 2KVRA 3SD5A 4W9HA 4FHKA 2PPHA 3TCAA 1WZ3A 4QAYA 2ASQA 2N7EA 3KYCD 4REZA 4LDTB 4JQWC 2EKEC 1UWMA 3AE5B 4FBJB 3BIID 5CHWA 5C3JB 5E6PA 2ZW0A 4USAA 1V80A 4KZCA 2IPKD 3GP7A 1TS5A 2J42A 4LNKA 3QAQA 2PJHA 3C0RB 4S0RA 3AE9B 1P9DU 4B95A 3NVWA 2NTTA 3H8HA 1JWMD 1I4PA 4PYZA 2FIFA 5E6OA 5TR5A 5CHFA 2KDMA 1WR1A 5DPTA 3TBLD 1L0VB 1SGHA 4IWPA 2HJ8A 2KACA 1IP9A 1WM3A 4MM3B 2G4DB 3TJPA 3MHSD 3H6NA 1FXAA 4FJVB 3R8BA 2SAKA 3N9YC 1WZ0A 2BS2B 1QKZA 1WX8A 2L00B 1C79A 2Y5PA 4AS1A 3NHEB 4BBNC 4C56C 1F1HA 3Q8BA 1ZW7A 1WE6A 5D6JB 3AEDB 1RWSA 2XK5B 3N1XC 3QX1A 1WX7A 2LZ6A 4NY0A 3PZDA 1M94A 1NENB 3DWGC 1FXIA 1OQYA 1WIAA 1E7PB 4NPNA 1KRHA 2EKIA 1LFDA 3QHTA 1SB3C 4US9A 2W3RA 2KJ6A 2L52A 5GMVA 3NZSA 1EWYC 3GOEA 4FJZA 1GNUA 3R2IA 1E8XA 3T8MA 2R2QA 1I4XA 2FE8A 3AU4A 4GMVA 4L23A 1ZE3D 2V3PA 4F1SA 1E6EB 4WWOA 2BKFA 4FJYA 5I4DA 2Z0EB 4DXAB 1WSPA 4MM3A 4BAXA 2LXAA 2KOXA 4HJGE 2D07B 2DZKA 4M8MA 4XYCA 3ZJVA 2KN5A 1KM7A 2KDBA 3V60A 1F0ZA 1SE3A 5G5GA 2BGFA 2LGSA 2OJWA 2IDYA 2O2VA 2K1FA 5HFYA 3WAOA 2IGGA 2LFIA 2MX2A 2KZRA 3NVVA 3OG5A 2IYDB 4JLCA 1GTHA 1T0RC 3BK2A 3V61A 3A1QB 3Q8CA 1C4PA 2MJEA 2KKCA 3EUB2 3JYUA 1E90A 1TS4A 4DK5A 1L6VA 2EELA 3APDA 2JXXA 3PS6A 1GAQB 2BYFA 3U2SC 2GBKA 2XBBC 2LXCA 3EHVA 1FPYA 1R7SA 2GBMA 2FNJB 2M1MA 1C77A 3E56A 2KC2A 1VZ7A 2V9HA 2PVOD 2W9NA 2VH1A 4EFOA 5EE3A 1QOBA 5J17A 4BOZB 5AZHA 3CSTA 3WALA 2MP2A 3HUIA 4WIPA 3VVWB 2C7HA 2L8JA 1XCTL 1F2RC 1NVID 2GBRA 5HKHA 3AB5A 1T3QA 2L3ZA 2NMQA 5G5HA 1UNSA 1E9MA 1Y56A 2YEPB 2B76B 4OHJA 4HKQA 1RFKA 2MWSB 4B9KA 1FM0D 3ZTDA 1BUIC 1RM6C 4GU2A 4IUMB 3RZWC 2OOBB 3SU8X 1SE9A 3VH4B 5IP4D 1HE8A 5BMGA 1P1AA 5EE9A 2EMTA 2ZVNA 1E5WA 2DNFA 3VTVA 3H7PB 1AYFA 3P42A 2BQQA 1EUVB 3R7QA 1HXYD 3BVMA 3DQVA 3SR6A 1E8WA 3Q3FA 3Q8AA 4NJ6A 4HCPB 4NQLB 4A8XC 2MQJA 1XQQA 2FCMA 3P1MA 2QJLA 1K8RB 3RPFC 3BYYB 4II3B 1MHXA 2LD9A 5DPSA 1PGAA 3AXCA 1I4GA 1A70A 4KSLC 2PVGC 3I9V1 1WX9A 3VH3B 3B9JA 1ZDXA 3U30A 2I1JA 2DX5B 4P7IA 1WRDB 1OTRB 2VZKB 1ACCA 1K51A 1OFFA 3APCA 3U7ZA 4C80A 2BB6A 4ZYSA 2CJOA 4I6LB 3RN9C 1GB1A 3PLUA 1HTQA 4C7YA 3C19A 4NJ7A 2MJDA 4RF1A 4MACA 2J0KA 1QF6A 2MSED 1CJEA 4A3PA 4HXDA 3ZXVA 2M0AA 4ASWC 3R2TA 1I4RA 1ZGUB 1WWTA 1C9FA 1GT8A 2RMMA 4EZLA 3FKYA 2ICIA 2WDVB 3UQAA 3ML9A 5IKCM 3O13A 2CS4A 5FK9C 2KWVB 4CO7A 4YXDB 3IVFA 1HZ6A 1EWCA 3NUHB 1SXTA 4PK1A 2DYBA 1XXGA 3FILB 1YJIA 3P4PB 4URKA 2MRPA 2KX3A 3VRBB 2XN9C 3V6CB 3BYTB 3PLVA 4YTNB 3KQ4A 3J9CA 2J7QB 2JY6A 2A5UA 1WXQA 1FNWA 2JZ3B 2WXKA 1ROEA 3ZKJC 4LDTD 3NRZA 3SEBA 2GMIC 3NJTA 2ZCBA 4YL8A 2NTSA 1E7UA 4RGTA 1WI0A 1R4MI 2DAJA 3GB1A 3I3TB 4RF0A 3RNGC 3U4EG 1JRUA 1KLUD 5EE0A 1VR9A 1VLBA 1FMAD 2GBJA 5G55A 5CHVC 4HJKA 1VJKA 2PMVA 5T8IA 2LJ5A 3DWMA 4PT5A 4L1BA 5BMIA 1UBIA 2KHWB 2N7JA 1WXVA 2ZJDA 1I4QA 4HWIB 2J52A 1NEKB 2WX1A 4TV3A 5IO9A 1NYQA 2AQ2B 4WWMA 4M0WA 4RM8A 3ZO5B 2WGSA 4LNIA 1TYGB 4C4VB 1YX5B 2NS5A 3GZNB 1YD8U 4KKJA 3V3XA 3UINB 1V5TA 2I1KA 2INPE 3Q3JA 1IBXB 3VHTC 2MH7A 1N60A 4JX1C 1IGDA 3H9DA 4ZOHC 1KTKA 4ZYNA 1ZXHA 2BKRB 2HE7A 2PEAA 2KTRB 4JE3B 3DPDA 1N5WA 2M8SA 4BZAA 2BWES 1T5XD 2HDEA 4G3XB 2LI5A 3B0AA 2GB1A 3TEWA 5D94A 3IXSA 4YTMB 1F52A 3WAPA 5L95C 1RRBA 2OEDA 4NAWA 3JSVB 1I42A 2BT6A 1YQ3B 2KX0A 2V4IB 4FADA 4G0NB 4OVVA 4EUTA 1L0XB 4DXFA 3AULA 3L13A 4ANXA 1A5RA 3H7PA 1C3TA 4C00A 4MGKE 3PT2B 2H88B 3I63C 3DVNU 4KIKA 3L17A 3BVGA 2WYQA 3RULA 1MHHE 1XLPA 1H7XA 3Q3NC 4M0WB 3KYDD 1QOAA 2H89B 3ZNID 4BFRA 1J7BA 2JZPA 1WMHA 3IAS1 3HHMA 3PZ7A 3VR8B 4H2AA 3JSVA 4KGTA 4K7SA 4GOCA 3RUIB 3VRAB 2WXOA 3UI3A 2W55A 1P7EA 3PO0A 1C4CA 1V1OA 4BVUC 4EKUA 4PYUA 3DHHC 3AEEB 2IO0B 3VUYA 4GSWA 1AARA 4IM2A 2M56B 1FO4A 3SDLC 1B9RA 4DHJD 1K53A 1WJUA 2INNE 1WGGA 2IO2B 3WANA 2JXTA 3ZYYX 2N7DA 1TKEA 3FC4A 1WJNA 3ZRFA 2MW5A 3LDZE 2WP9B 5BO4B 3AV8A 3RD2A 3AH7A 2LVQA 1AWDA 4OZAA 2NCNA 3RT3B 3L0WB 2G9HD 3IAM1 5KHOA 3L16A 2I38A 1K52A 2KNBA 4W9JA 5AUKA 3GE8C 3QK0A 2KLGA 2N4FA 2JUOA 2GI9A 1LO5D 4P16A 2BB5A 2D3AA 3BK1A 2DLBA 1UZXB 2PIAA 1NYRA 1FRRA 2DYOA 1CK1A 4JWSC 2UWQA 4GLSC 2N9KA 3E9SA 2Y3AA 2MLBA 4E3CA 4DDGD 4RCOA 2LGYA 3PRZA 1V81A 1FXTB 3R66C 1IGCA 4N58A 1MVKA 4XGAB 5DCNA 2CU3A 4RGOS 2JT4B 3KUZA 4MJSA 1BT0A 2FUHB 4KV2A 3KWVA 4YSXB 4P1CC 4IKGA 2TSSA 4W9EA 1DYQA 2NBWB 2G1EA 5H8YE 5EDSA 4LNOA 1VCBA 3M3JA 1JWSD 2WX0A 1N6ZA 2DENB 2MBOA 3AU5A 3TMPB 1H8CA 1BXTA 2NVUI 3ALBA 4RM9A 4ZRKA 3N1ZC 1YNTE 1EU4A 2JYEA 2WWZA 3DVNV 4PS8A 1SE2A 4GB9A 3ZJTA 5J18A 4HKZE 2V0GA 4XDCA 4HRSA 1VZ6A 3DVGY 1GC6A 4MSMB 3AE4B 1PQSA 3EFUA 3PRMB 3EECA 5HHDG 1WM2A 1OQQA 3KUCB 2MHJA 4FXCA 2JF5A 4ICUA 1PFDA 1YJJA 2KFKB 2NBUA 1WY8A 2JX5A 1Z2MA 2UU7A 4GGQA 4KKIA 4BKSA 5IOIA 2O6VD 4O1NA 2VZKD 2MJ3A 4TMAB 2Z59B 3HM6X 5HI1A 3RNCC 3RNEC 4E74A 2BTEA 4S17A 1TKYA 3VAWA 3B2GA 3C8YA 1YN4A 1J7CA 2LHEA 1KLGD 2RDBC 1RAXA 3AE1B 5BYRA 2Z8LA 2AQ3B 2QMTA 4JL9A 4RH6A 1XLOA 4WQMA 4ZHPA 2KJRA 1ET9A 2O2VB 2DWQA 2C7NB 3ZNHB 3DHIC 1TIFA 1STEA 3CMMB 1D3ZA 1NBFC 3ZGZA 2YVCA 3GE3C 1JALA 3TEXA 1FNVA 2PLPA 4KDIC 4AOFA 1J7AA 1P98A 1ZXIA 1V6EA 2GLSA 5FR3A 1GB4A 4US8A 3I57A 3NY5A 3Q6BA 2BW2A 4K3BA 3VFKA 4LNNA 1V8CA 4MH8A 3W1SC 1KOTA 4FULA 3CSFA 3AE3B 4TQ0A 3R7RA 1CMXB 2KXJA 1IPGA 4XWWA 4IOIE 4ZRJA 1WMHB 2G45B 5IA7A 2X8XX 1YJ1A 4MH0E 1SIFA 1FFUA 5C23A 1KF6B 2C60A 1SEBD 3HIZA 2KMCA 4PS7A 1SJHD 2CJNA 2KMAA 2LUMA 1X1MA 1QT9A 1WGYA 3N1YC 2KLCA 3MFGA 3BY4B 3BVZA 2GRIA 2C9WB 4P6VF 3GS2A 2J53A 1OEYA 1GC7A 4GDLB 2D5GA 1TS2A 2MEKA 2CHWA 2N9PC 1WJ4A 1ZOYB 1QZEA 2LEKA 3OJ3A 3BZDB 4KDLB 3UIPB 3QC8B 1N62A 1Q0WB 1LGRA 5LXIB 1L0YB 4B0MA 2R61A 1TGZB 1N61A 4K81A 4GDKA 4F7ZA 2IO1B 5KHQA 1YX6B 1GPXA 1ZPSA 3IG3A 1N5XA 3N20C 2HTME 1NI3A 2WNMA 3R3MA 3UF8A 3KUDB 3TEZA 3PV1A 1QOFA 2XNAC 1WF9A 3PHXB 1ENFA 2W54A 2E6XA 4DXGA 1P0RA 3B1LX 2MBHA 5AZFA 4C7ZA 4ARCA 2ZZPB 4K3CA 3D32A 1SJED 2WXNA 4DHZB 4I6NB 4YSZB 1KJTA 2GOWA 3FAHA 4DDID 5JHBA 5LXHA 1KH0A 2AQ1B 1ET6A 2JRIB 2KWUB 4MT5A 4CQNA 3TL5A 1FFVA 2J0JA 1H4RA 2K8HA 3P4SB 5FR6A 1WGDA 3PTFC 2N0SB 2KAJA 1K50A 3N30A 1F2RI 4GN1A 1V1PA 2IZVB 3QQ8B 4MGYE 1DOYA 4WJQA 2YLMA 2WXGA 2CKHB 4I6PA 3ENEA 1PDXA 1TY2A 4CYEA 3ZJUA 4ARIA 3EC8A 3W5VB 4TQ1A 1BMLC 3VUWA 2BYVE 1N63A 2DBYA 4RMAA 4XDDA 2L05A 1WYWB 2D3GA 4WQOB 1C4AA 2IY1B 1YIWA 3VR9B 4XC2A 2KVZA 2JYTA 2RPVA 4NNJB 1V5OA 2DZMA 1UBQA 5IN7A 2N9LA 2LVPA 2QILA 1WGKA 3U8ZA 2AX5A 1J19A 2NPTA 1ZKHA 1DOXA 2L32A 3A9KB 2IJ0A 3IT6B 2L7RA 3H1UA 1I35A 3RNAC 2HJ1A 5D3DA 4A6QA 3QCAA 3K9PB 4AQ7A 4XX5A 1PGBA 1C76A 1YQBA 4HVBA 2WHIA 1EF5A 4ZRPA 3LB8C 1ZUD2 3IFWB 3X0WA 3IT4B 3DDCB 1MG4A 4IWOA 2KWDA 1HEZE 3A9JB 4P1BC 4J6IA 5DPWA 4ANUA 1QILA 2NR2A 3L4PA 3V6EB 2LJIA 1UD7A 1LXDA 1EU3A 1LQBA 4IDIA 3N32A 1EO6A 3AECB 1WR6E 4OZBA 1VRAB 2JPHA 2G3QB 3NS8A 2KQSA 4TSSA 1UH6A 3MHZA 2QSDA 3B08A 2D3BA 3NS1A 2JWZA 3MP9A 1F9JA 2K9XA 1QQRA 3U7DA 3OJ4B 4W9IA 2WDTB 5BYSA 3TSSA 2IBIB 3GZNI 1D6EC 3TUOA 2WXMA 5JZEB 4L2YA 1TZOA 2INCC 2WXRA 5JHAA 4WAAA 1S3SG 4W9GA 3UIOB 4TKNA 3T3OA 1SF0A 3QIJA 2IY0B 2KDFB 3A33B 3A9KA 3M62B 1DGJA 3P4QB 2M4NA 3BINA 4C4VA 1JROA 3PRPB 1KLVA 4LJOB 3AI5A 1T0QC 1MG8A 3HRDD 1WGHA 4GDLA 3Q3MC 5FKAC 4WAFA 4NQKE 3MTNB 1V2YA 3A9JA 3LXFA 2PW9A 1FIQA 1E0ZA 3S2AA 4A55A 1IBXA 2MA9B 1RYJA 2QDFA 3AN1A 3W1SA 4JWUC 4JGHB 1AW7A 3LYYA 2GBNA 3DBLB 1ESFA 1R4MB 1RLFA 4ZHOA 1MPEA 1T6BX 3MC8A 2ZNVB 2K39A 2KN4A 1MFWA 5G2NA 3DOWA 4RGNA 3CF6E 2AYOB 2ZW1A 4AJWA 2UYZB 1E7VA 2QC8A 2R2OA 2WLBA 3HK0A 1E8YA 3AE2B 4BKSD 1XT9B 4ANWA 5CX3A 3ZDMC 4AWJA 5MPOA 3RCZA 2G4SA 1P7FA 3ZDTA 3AE7B 4KZ0A 4HK2A 3PVLA 4GIVA 3PREA 3L08A 4IWQA 3ZNZB 4F8CB 4FHJA 3RYTA 3HVZA 2LUEA 1Y8RC 2KQ7A 2V1YA 3VQIA 5H92C 3DHGC 1LM8B 2BPSA 4HCNB 1R4NB 2WU5B 1L5PA 2KD0A 2BYTA 1IYFA 4MELA 3P63A 4W9KA 3KWLA 5E6JA 2C7MB 4N59A 1MJDA 4GXBA 4AP4C 2ZPYA 1P3QU 5BMHA 2PTLA 4YWGG 2KQ4X 4MSQB 3H7SA 3DVGX 1VZ8A 2KWCA 3TEYA 1WJ6A 2IGHA 5C2TB 1L6UA 1V49A 2PE6B 4MGZE 1V9JA 4OW0A 1M4VA 3K9OB 2LGXA 4XWTA 4XE0A 2ACZB 1XLQA 2JSVX 2IO3B 3BWUD 3AMZA 2E3TA 3I5JC 4IG7B 4LK0M 3KH0A 3T9LA 1GOZA 1WE7A 1PYWD 3P4RB 1TS3A 2RGFA 5HG2A 2BF8B 3V05A 2KTFA 2LWPA 2BYEA 1R4NI 4EE2A 4OZCA 5DPRA 4MJSB 2WXQA 4BKTA 4W9LA 3ZQ4A 2D3CA 2BBCA 3WCQA 3AM9A 4IM3A 2WXJA 3A4RA 3VDZA 2OHFA 5BYQA 2ON8A 4RNAA 3W9CB 5AEKB 2KO3A 1GJZA 2DZJA 3CF4A 3APFA 1GUAB 3DBSA 1YOVB 4K7UA 4HPMB 4DHZE 4A90A 1JWUD 2EMSA 4FLHA 1J0GA 3PHWB 4YSYB 3L10B 4ZRIA 1FEHA 2KK8A 3EFCA 1WRIA 3URYA 1B1ZA 1OEYJ 5LLIA 3RFZB 1PUTA 2INDC 3KLSX 1D5ZC 4B0EA 4BOSC 2LGIA 3MJWA 4FN2A 3AEFB 1JMLA 1S1QB 3DBLI 3WIMA 2N9XA 2JZZA 4X57B 2WXHA 4JIOU 1WXAA 2LVOA 4HLEA 3VUXA 3AEGB 3PGEA 2LRUA 2NBVB 2N1WA 2OJRA 1WXMA 3KW5B 2D11A 1YN3A 3ML8A 4BKGA 2L0FA 2JQRB 1FRDA 5AZGA 3VTUA 1JQ4A 3ETRA 2CHZA 2VH2A 4IW0A 3OAWA 4M02A 4WJNA 4EEWA 3ZTCA 4DBGA 2RPQA 4W9DA 2X38A 2KFKA 2C5LC 1WH3A 4B6WA 3RI7C 5D3IB 3PZ8A 2QEJC 3Q69A 4UDUC 4M00A 4LCDE 2KANA 3NZUA 4MGIE 3ZW3A 3AEBB 3CIRB 2A4ZA 1H7WA 4LLGM 4HDOA 4K1RB 4AJYB 2CHXA 4MDKE 3M95A 2WU2B 1GTEA 2D2QA 4ITKA 3CWIA 4ANVA 1PGXA 1TJEA 4MEMA 1XD3B 1OQRA 2FUG1 2FBWB 4LJPB 1QLBB 3ABVB 4Q2JA 3SFDB 3NOBA 5CTRC 2WDQB 4WH4A 3Q8EA 1L7YA 1HTOA 3U52E 4EZJA 1J8CA 2PE9A 3AE8B 2J4XA 2K6QA 4K7WA 4DHJB 3UQBA 2JWUA 4LTUA 2KMMA 1HA5A 2DYMA 4KGRA 2W82A 2MBEA 2RD0A 1Z5SB 2K25A 4R3DA 1T0YA 2YEPF 2LHDA 4ZRQA 1D4BA 2M0XA 2K6DB 2KT7A 1EF1A 2ZPNA 2V3SA 2K0PA 2FCQA 2RDHA 1Q1OA 5IAAC 4A3OA 3KVFB 4DWFA 1MI0A 4G11A 1YQ4B 3JW0X 3B2FA 4WWNA 2JRHA 2W3SA 1UGJA 3RNBC 3AEAB 2QHOA 2REXA 5E6NA 3TIXA 2WQYB 2ZVOA 3OWEB 1Q10A 3N3KB 3X23A 1HZ5A 4DQOC 4A9AA 2KYWA 3NVZA 2ZNVC 1F77A 4XZ4A 4NAWB 4M8NA 3ZUNA 2VRRB 4WJOA 5J2RA 3ECIA 3NG0A 3VXWA 4HPPA 2HD5B 3A4SC 2CR5A 3QWZB 4M01A 3MC0B 1V86A 2I2YA 1D5XC 1XEEA 3EA6A 2KDEB 3ZIMA 4HDQA 4KVGB 4N9F4 5EE1A 4KGSA 1UF0A 3IHPC 2LGDA 2J0MA 3JVZX 4EOYA 3SFEB 1GG3A 4ZDVA 2QIEB 1TKGA 4KX6B 2CU1A 1KFYB 1HQRD 2BS3B 2Z0DB 3RZFA 1V1PB 5JH5C 2MBQA 1XO3A 2KDIA 4JPSA 2JU6X 2BVCA 2BS4B 2K8BA 2WXPA 1L4ZB 1VD2A 2DZIA 1U4AA 4A20A 1VDVA 3V62A 4NAMA 3DBRB 4II2B 1AN8A 1E10A 4NZLB 3ZNGC 3Q8FA 2XK5A 1V97A 3P2BA 3WA0A 1XCQL 2BWFA 2AWTA 3HM3A 2B3AA 3L54A 2M17A 1SBBB 1G6JA 5D7GA 4WURA 4W9FA 1Q5WB 2MP2B 1L2NA 2LRWA 2ONQA 3ZRCA 1NDDA 1TZ1A 1JW9D 3NVYA 4PS3A 4N6EB 1TBEA 2D10A 2WXFA 1IUEA 4FA6A 4NJCA 1T0SC 1CQVA 3EGRA 2AL6A 5D2MB 4TUUA 1FNUA 2FCSA 3IBEA 5C1ZA 3DBHI 2MCNB 1UELA 3SHQA 2Y5CA 2QCZA 1ISNA 1ZDVA 1WXSA 1YN5A 1I7HA 2WXIA 4IC7B 1YMHE 2L83A 1OGWA 2AL3A 2K22A 3O65B 1C1YB 3AE6B 2RR9A 3MJ5A 3UGBB 2JVCA 2K5PA 3ZLZA 1L4DB 3OLMD 3LJ3A 2DHZA 4J3OD 2NPTB 3ZXRA 3T3NA 2ZCCA 2KC1A 4OVZA 4D2KA 2K3UA 3Q14C 2Q5WD 2KFJA 2V3NA 4RFBA 2L0TA 3DBRI 2RDGA 2DAFA 2KJHB 2N1VA 2WDRB 2M19A 5L83A 4WJPA 2O6VA 4WWPA 4W9CA 2ZEQA 1UUPA 2RSUA 3DCGA 5TSSA 2HTHA 1TT5B 1I4HA 5JXVA 2AEHA 2KTRA 2XEWA 4IM0A 4BBNF 4AUQC 5LNK1 3VTWA 1SSNA 2IGDA 3QARA 2FAZA 3W5UB 1NI2A 1WYGA 3Q2AC 2LASA 1FCCC 4E71A 2Y5BB 1RFAA 1C78A 4GDKB 2WS3B 2MBBB 1QOGA 1CZPA 4LNFA 4ACFA 1ZP0B 4YT0B 2SEBD 1SIJA 1EM7A 1TY0A 4CHKA 5AUIA 1E8ZA 2WXLA 3QA8A 2FCNA 5GXGB 1TTNA 3W2DA 1JCKB 1D5MC 3A1QA 1JWBD 3ZVVA 4YTPB 2L1AA 4OVUA 1UWXA 4KSKC 1WGRA 2L76A 3M63B 1FD6A 4ICVA
chains in the Genus database with same CATH topology
2WXJA 4IOIE 4MACA 1SE4A 3O13A 1JWAD 5FK9C 2OHFA 5BYQA 4YXDB 2ON8A 1HZ6A 1EWCA 4RNAA 3NUHB 4HEA1 3W9CB 1SXTA 1FFUA 1KF6B 2PKOA 1SEBD 3CF4A 1XXGA 3FILB 1JRPA 1YJIA 3P4PB 1SJHD 2CJNA 1XLNA 3VRBB 2LUMA 2XN9C 1QT9A 4A90A 1FCLA 1XF5L 1JWUD 3BYTB 1DOIA 4YTNB 3MFGA 3KQ4A 3J9CA 4YSYB 3BVZA 1FEHA 2GRIA 1WXQA 1FNWA 2LMCA 4P6VF 3GS2A 1WRIA 3URYA 1B1ZA 2J53A 3FILA 2WXKA 4GDLB 1ROEA 2D5GA 1TS2A 2MEKA 3NZ3A 3HVDA 3NRZA 3RFZB 3SEBA 4RGMA 4HROA 1PUTA 1ZOYB 2LEKA 2NTSA 3BZDB 1N62A 4RGTA 3KLSX 1D5ZC 4B0EA 1L0YB 2LGIA 4B0MA 2R61A 3AEFB 1JMLA 1N61A 3GB1A 4RF0A 3U4EG 1KLUD 5EE0A 1VR9A 1VLBA 1FMAD 2WXHA 1GPXA 1ZPSA 1VJKA 1N5XA 2PMVA 5T8IA 2HTME 4REZA 3DWMA 1NI3A 3AEGB 2WNMA 4PT5A 4L1BA 5BMIA 1UWMA 1QOFA 1YN3A 3TEZA 2XNAC 2JQRB 3TEXA 1FRDA 3AE5B 3BIID 5C3JB 1JQ4A 3ETRA 2ZW0A 4USAA 2N7JA 1ENFA 1I4QA 2W54A 2E6XA 4DXGA 2J52A 2IPKD 1NEKB 3GP7A 1NYQA 4C7ZA 2AQ2B 4ARCA 4WWMA 4M0WA 1SJED 1TS5A 2J42A 2WXNA 2X38A 4YSZB 3FAHA 1TYGB 3AE9B 1KH0A 4KKJA 3V3XA 5D3IB 2AQ1B 1ET6A 3PZ8A 4MT5A 3NVWA 2QEJC 4CQNA 2NTTA 3Q69A 2INPE 1FFVA 1IBXB 2MH7A 4UDUC 3H8HA 3P4SB 1JWMD 1N60A 1I4PA 4JX1C 1IGDA 4ZOHC 3AEBB 1KTKA 2KDMA 1ZXHA 3CIRB 2N0SB 1H7WA 4JE3B 4LLGM 1N5WA 2KAJA 1L0VB 2KACA 1T5XD 4MM3B 1K50A 2HDEA 2WU2B 1GTEA 1F2RI 1V1PA 2GB1A 1FXAA 4ITKA 3R8BA 3TEWA 1DOYA 3CWIA 2SAKA 1PGXA 3IXSA 4YTMB 1TJEA 3N9YC 2WXGA 2BS2B 1OQRA 2FUG1 2FBWB 1QKZA 1PDXA 1TY2A 2OEDA 1C79A 2Y5PA 3ZJUA 1QLBB 3ABVB 4AS1A 4ARIA 4C56C 4Q2JA 3SFDB 2BT6A 2WDQB 3W5VB 4TQ1A 1YQ3B 4WH4A 3Q8BA 1BMLC 3Q8EA 2V4IB 3U52E 1N63A 2DBYA 3AEDB 1RWSA 4XDDA 1L0XB 3AE8B 2J4XA 1C4AA 4DXFA 3VR9B 2JYTA 2RPVA 1NENB 3DWGC 2JWUA 1FXIA 4LTUA 2KMMA 1E7PB 1HA5A 1KRHA 2H88B 2DYMA 2EKIA 2N9LA 4KGRA 2QILA 1WGKA 2W82A 1SB3C 4US9A 2W3RA 1QF6A 4R3DA 2AX5A 3BVGA 2L52A 2LHDA 2YEPF 1EWYC 4ZRQA 1DOXA 1D4BA 3R2IA 2L32A 1MHHE 1XLPA 1H7XA 1I4XA 1QOAA 2H89B 1J7BA 2IJ0A 3IT6B 2FE8A 2JZPA 4L23A 3IAS1 3PZ7A 1ZE3D 3VR8B 2V3PA 4H2AA 4KGTA 1E6EB 5D3DA 4A6QA 3VRAB 2WXOA 3UI3A 2K0PA 2W55A 4AQ7A 5I4DA 2RDHA 1P7EA 3PO0A 1PGBA 1C76A 1C4CA 1V1OA 4ZRPA 1WSPA 1ZUD2 3LB8C 3IT4B 3AEEB 4HJGE 1MI0A 1YQ4B 2KWDA 2M56B 1FO4A 3B2FA 1HEZE 1B9RA 3ZJVA 1K53A 2W3SA 1UGJA 3AEAB 2INNE 1QILA 2JXTA 3L4PA 3ZYYX 2WQYB 1F0ZA 1SE3A 1TKEA 3OWEB 3FC4A 2LJIA 1Q10A 2WP9B 1EU3A 5G5GA 1HZ5A 4DQOC 4IDIA 3AV8A 4A9AA 2IDYA 3AECB 3AH7A 3NVZA 1AWDA 5HFYA 4OZAA 2IGGA 4OZBA 1F77A 1VRAB 4NAWB 2LFIA 2G9HD 3IAM1 3NVVA 2I38A 1K52A 4TSSA 5AUKA 3MHZA 2GI9A 2QSDA 1LO5D 4P16A 2BB5A 1GTHA 3NS1A 3BK1A 3MP9A 3BK2A 2DLBA 2K9XA 2PIAA 1NYRA 1FRRA 1QQRA 2DYOA 1CK1A 1C4PA 2MJEA 3MC0B 3Q8CA 4JWSC 3EUB2 2I2YA 1TS4A 1L6VA 4GLSC 2EELA 2N9KA 3E9SA 2Y3AA 5BYSA 1GAQB 1D5XC 1XEEA 3TSSA 3EA6A 3U2SC 4RCOA 1D6EC 3TUOA 5EE1A 2WXMA 4KGSA 1R7SA 4L2YA 1TZOA 2WXRA 3T3OA 1IGCA 3SFEB 1SF0A 1C77A 3E56A 1DGJA 2QIEB 3P4QB 1TKGA 4KX6B 1KFYB 4N58A 1JROA 1MVKA 1VZ7A 1HQRD 2BS3B 2PVOD 3HRDD 2CU3A 1V1PB 5EE3A 4RGOS 5FKAC 1XO3A 4WAFA 4JPSA 1QOBA 2JU6X 3KWVA 4YSXB 2BS4B 3LXFA 2PW9A 4IKGA 1FIQA 2WXPA 1E0ZA 1L4ZB 2TSSA 1DYQA 2G1EA 5H8YE 4A55A 1IBXA 1VDVA 1RYJA 3AN1A 3W1SA 4NAMA 4JWUC 1AW7A 3LYYA 1AN8A 1E10A 4NZLB 3HUIA 1JWSD 3Q8FA 4WIPA 1V97A 1ESFA 4ZHOA 1MPEA 1T6BX 1XCQL 1XCTL 1F2RC 1NVID 3AB5A 2KN4A 1T3QA 2NMQA 5G5HA 1BXTA 1UNSA 1E9MA 1SBBB 1Y56A 2YEPB 5D7GA 4RGNA 4WURA 2ZW1A 2B76B 2ONQA 4OHJA 1YNTE 4HKQA 1EU4A 1RFKA 2JYEA 1JW9D 2WLBA 3NVYA 1SE2A 1FM0D 4N6EB 3ZJTA 2WXFA 4HKZE 1BUIC 1IUEA 1RM6C 3AE2B 4NJCA 2V0GA 4XDCA 4HRSA 1CQVA 1VZ6A 3EGRA 1FNUA 5MPOA 1P7FA 3AE4B 3AE7B 5BMGA 5HHDG 5EE9A 1OQQA 4FXCA 2Y5CA 1AYFA 1PFDA 1YJJA 3P42A 1ZDVA 1YN5A 1I7HA 2WXIA 1YMHE 1HXYD 2L83A 2JX5A 3HVZA 2K22A 3BVMA 4KKIA 3SR6A 3AE6B 3MJ5A 3VQIA 4O1NA 5H92C 2K5PA 1L4DB 2VZKD 3Q8AA 2MJ3A 4J3OD 2WU5B 1L5PA 3T3NA 4TMAB 2BYTA 4A8XC 4OVZA 3P63A 5HI1A 4D2KA 2K3UA 3KWLA 2Q5WD 3P1MA 5E6JA 2QJLA 2BTEA 3RPFC 4N59A 3BYYB 1MHXA 2V3NA 4RFBA 1TKYA 1PGAA 2RDGA 1I4GA 1A70A 2WDRB 2M19A 1FD6A 5BMHA 2PTLA 4YWGG 2PVGC 3I9V1 3B2GA 3C8YA 1UUPA 2KQ4X 1YN4A 1J7CA 2LHEA 5TSSA 1KLGD 1I4HA 5JXVA 3B9JA 1ZDXA 3AE1B 1VZ8A 2VZKB 2Z8LA 2AQ3B 2QMTA 5BYRA 4RH6A 1ACCA 3TEYA 1K51A 2IGHA 5LNK1 5C2TB 1OFFA 1SSNA 3U7ZA 1L6UA 1XLOA 2IGDA 4C80A 3W5UB 2BB6A 4WQMA 4ZYSA 2CJOA 4OW0A 4ZHPA 1WYGA 1M4VA 1ET9A 1FCCC 4XWTA 2ACZB 1XLQA 2JSVX 4XE0A 3BWUD 3AMZA 1GB1A 2DWQA 2E3TA 1C78A 4GDKB 1STEA 4C7YA 2WS3B 4LK0M 3ZGZA 1QOGA 1CZPA 2MJDA 4RF1A 1ZP0B 4YT0B 1JALA 1FNVA 1SIJA 2PLPA 2SEBD 1CJEA 1J7AA 1EM7A 1GOZA 1TY0A 1ZXIA 5AUIA 1PYWD 2M0AA 2WXLA 3P4RB 1TS3A 5HG2A 5FR3A 1GB4A 3R2TA 4US8A 3I57A 5GXGB 3V05A 1I4RA 2BW2A 3W2DA 1JCKB 1WWTA 1D5MC 1JWBD 1V8CA 4MH8A 1C9FA 4EE2A 1GT8A 4YTPB 2L1AA 2RMMA 4OZCA 2WXQA 1UWXA 3AE3B 2ICIA 2WDVB 3ZQ4A 4TQ0A 2BBCA 3WCQA 3AM9A 4XWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WP9 B;  2N0S B;  1H7W A;  4HRS A;  1N5W A;  2KAJ A;  1JWA D;  4IDI A;  2OHF A;  1L0V B;  3AV8 A;  4YXD B;  5G5G A;  4A9A A;  5MPO A;  3AEC B;  3AH7 A;  3NVZ A;  1AWD A;  3AE4 B;  3AE7 B;  3W9C B;  2WU2 B;  1FFU A;  1KF6 B;  1GTE A;  2PKO A;  3NVV A;  5EE9 A;  3CF4 A;  5AUK A;  1FXA A;  1JRP A;  3P4P B;  1OQQ A;  1YJI A;  4ITK A;  4FXC A;  2Y5C A;  2CJN A;  3CWI A;  1DOY A;  1XLN A;  3VRB B;  4YTM B;  1AYF A;  1TJE A;  1QT9 A;  1PFD A;  4C80 A;  1YJJ A;  2BS2 B;  1OQR A;  2FBW B;  1GTH A;  1DOI A;  1PDX A;  4YTN B;  1I7H A;  3NS1 A;  2K9X A;  2L83 A;  1QLB B;  1NYR A;  3ABV B;  2JX5 A;  4YSY B;  1FRR A;  2K22 A;  2PIA A;  3HVZ A;  1WXQ A;  3SR6 A;  3SFD B;  2BT6 A;  2MJE A;  4P6V F;  3AE6 B;  1WRI A;  3EUB 2;  4JWS C;  2WDQ B;  3W5V B;  1YQ3 B;  2K5P A;  1L6V A;  5H92 C;  1ROE A;  1N63 A;  2DBY A;  1GAQ B;  3AED B;  1RWS A;  2MJ3 A;  3NRZ A;  2WU5 B;  1L5P A;  3P63 A;  4HRO A;  5EE1 A;  3AE8 B;  1PUT A;  1ZOY B;  1R7S A;  2LEK A;  3KWL A;  2Q5W D;  3P1M A;  2QJL A;  3VR9 B;  3RPF C;  4N59 A;  1N62 A;  1NEN B;  3DWG C;  1FXI A;  4LTU A;  1TKY A;  1E7P B;  2KMM A;  3AEF B;  3SFE B;  1N61 A;  1SF0 A;  1KRH A;  2H88 B;  2EKI A;  1A70 A;  2WDR B;  2M19 A;  1DGJ A;  2QIE B;  3P4Q B;  1TKG A;  4KX6 B;  1WGK A;  1VLB A;  1KFY B;  1FMA D;  1SB3 C;  2PVG C;  3B2G A;  5EE0 A;  1GPX A;  4N58 A;  4US9 A;  1JRO A;  1J7C A;  2W3R A;  2BS3 B;  1VJK A;  2PVO D;  1N5X A;  3HRD D;  2CU3 A;  3B9J A;  2AX5 A;  2HTM E;  5EE3 A;  3DWM A;  1NI3 A;  3AE1 B;  3AEG B;  1XO3 A;  2L52 A;  1QOB A;  1EWY C;  1DOX A;  5C2T B;  1OFF A;  4YSX B;  1L6U A;  2BS4 B;  1H7X A;  1XLO A;  1XLP A;  3LXF A;  3W5U B;  1UWM A;  1QOF A;  1FIQ A;  4WQM A;  1QOA A;  2H89 B;  2CJO A;  2JQR B;  4ZHP A;  1E0Z A;  1FRD A;  1J7B A;  1WYG A;  3AE5 B;  3BII D;  5C3J B;  1JQ4 A;  2G1E A;  3ETR A;  5H8Y E;  2ACZ B;  1XLQ A;  1VDV A;  1RYJ A;  3VR8 B;  3AMZ A;  4USA A;  3AN1 A;  2DWQ A;  4JWU C;  2W54 A;  1E6E B;  2E3T A;  3VRA B;  1NEK B;  1E10 A;  2W55 A;  4C7Y A;  2WS3 B;  3HUI A;  1NYQ A;  3PO0 A;  1QOG A;  1CZP A;  4C7Z A;  1V97 A;  2MJD A;  1ZP0 B;  4YT0 B;  1JAL A;  1SIJ A;  1ZUD 2;  3LB8 C;  4WWM A;  1CJE A;  1J7A A;  4ZHO A;  1QF6 A;  1ZXI A;  3AEE B;  5AUI A;  1NVI D;  3P4R B;  3AB5 A;  1YQ4 B;  1T3Q A;  4YSZ B;  3FAH A;  5G5H A;  1TYG B;  4US8 A;  5GXG B;  2M56 B;  1E9M A;  1FO4 A;  3B2F A;  3AE9 B;  1WWT A;  1B9R A;  1JWB D;  1V8C A;  2B76 B;  3NVW A;  1GT8 A;  2W3S A;  4YTP B;  3AEA B;  1FFV A;  1RFK A;  2MH7 A;  3L4P A;  1JW9 D;  2WLB A;  3NVY A;  3P4S B;  3AE3 B;  3ZYY X;  1N60 A;  1FM0 D;  2WQY B;  2WDV B;  4JX1 C;  4N6E B;  1F0Z A;  4ZOH C;  1TKE A;  3AEB B;  1IUE A;  3FC4 A;  1RM6 C;  3WCQ A;  3AE2 B;  3CIR B;  3AM9 A; 
#chains in the Genus database with same CATH topology
 1SE4 A;  1JWA D;  2FID A;  3WAM A;  4EZK A;  2N9E B;  4G50 A;  4HEA 1;  1WFY A;  3QJZ A;  3PSE B;  3DBH B;  3ONS A;  2PKO A;  1JRP A;  1XLN A;  4KIK B;  1FCL A;  1XF5 L;  3RNF C;  1UGM A;  1DOI A;  2O6V B;  2LMC A;  4HPL B;  3FIL A;  3NZ3 A;  3HVD A;  3W1Y A;  3MC9 A;  2K8C A;  2V4L A;  4RGM A;  4HRO A;  3PPA A;  3RMK C;  3Q3O C;  2KVR A;  3SD5 A;  4W9H A;  4FHK A;  2PPH A;  3TCA A;  1WZ3 A;  4QAY A;  2ASQ A;  2N7E A;  3KYC D;  4REZ A;  4LDT B;  4JQW C;  2EKE C;  1UWM A;  3AE5 B;  4FBJ B;  3BII D;  5CHW A;  5C3J B;  5E6P A;  2ZW0 A;  4USA A;  1V80 A;  4KZC A;  2IPK D;  3GP7 A;  1TS5 A;  2J42 A;  4LNK A;  3QAQ A;  2PJH A;  3C0R B;  4S0R A;  3AE9 B;  1P9D U;  4B95 A;  3NVW A;  2NTT A;  3H8H A;  1JWM D;  1I4P A;  4PYZ A;  2FIF A;  5E6O A;  5TR5 A;  5CHF A;  2KDM A;  1WR1 A;  5DPT A;  3TBL D;  1L0V B;  1SGH A;  4IWP A;  2HJ8 A;  2KAC A;  1IP9 A;  1WM3 A;  4MM3 B;  2G4D B;  3TJP A;  3MHS D;  3H6N A;  1FXA A;  4FJV B;  3R8B A;  2SAK A;  3N9Y C;  1WZ0 A;  2BS2 B;  1QKZ A;  1WX8 A;  2L00 B;  1C79 A;  2Y5P A;  4AS1 A;  3NHE B;  4BBN C;  4C56 C;  1F1H A;  3Q8B A;  1ZW7 A;  1WE6 A;  5D6J B;  3AED B;  1RWS A;  2XK5 B;  3N1X C;  3QX1 A;  1WX7 A;  2LZ6 A;  4NY0 A;  3PZD A;  1M94 A;  1NEN B;  3DWG C;  1FXI A;  1OQY A;  1WIA A;  1E7P B;  4NPN A;  1KRH A;  2EKI A;  1LFD A;  3QHT A;  1SB3 C;  4US9 A;  2W3R A;  2KJ6 A;  2L52 A;  5GMV A;  3NZS A;  1EWY C;  3GOE A;  4FJZ A;  1GNU A;  3R2I A;  1E8X A;  3T8M A;  2R2Q A;  1I4X A;  2FE8 A;  3AU4 A;  4GMV A;  4L23 A;  1ZE3 D;  2V3P A;  4F1S A;  1E6E B;  4WWO A;  2BKF A;  4FJY A;  5I4D A;  2Z0E B;  4DXA B;  1WSP A;  4MM3 A;  4BAX A;  2LXA A;  2KOX A;  4HJG E;  2D07 B;  2DZK A;  4M8M A;  4XYC A;  3ZJV A;  2KN5 A;  1KM7 A;  2KDB A;  3V60 A;  1F0Z A;  1SE3 A;  5G5G A;  2BGF A;  2LGS A;  2OJW A;  2IDY A;  2O2V A;  2K1F A;  5HFY A;  3WAO A;  2IGG A;  2LFI A;  2MX2 A;  2KZR A;  3NVV A;  3OG5 A;  2IYD B;  4JLC A;  1GTH A;  1T0R C;  3BK2 A;  3V61 A;  3A1Q B;  3Q8C A;  1C4P A;  2MJE A;  2KKC A;  3EUB 2;  3JYU A;  1E90 A;  1TS4 A;  4DK5 A;  1L6V A;  2EEL A;  3APD A;  2JXX A;  3PS6 A;  1GAQ B;  2BYF A;  3U2S C;  2GBK A;  2XBB C;  2LXC A;  3EHV A;  1FPY A;  1R7S A;  2GBM A;  2FNJ B;  2M1M A;  1C77 A;  3E56 A;  2KC2 A;  1VZ7 A;  2V9H A;  2PVO D;  2W9N A;  2VH1 A;  4EFO A;  5EE3 A;  1QOB A;  5J17 A;  4BOZ B;  5AZH A;  3CST A;  3WAL A;  2MP2 A;  3HUI A;  4WIP A;  3VVW B;  2C7H A;  2L8J A;  1XCT L;  1F2R C;  1NVI D;  2GBR A;  5HKH A;  3AB5 A;  1T3Q A;  2L3Z A;  2NMQ A;  5G5H A;  1UNS A;  1E9M A;  1Y56 A;  2YEP B;  2B76 B;  4OHJ A;  4HKQ A;  1RFK A;  2MWS B;  4B9K A;  1FM0 D;  3ZTD A;  1BUI C;  1RM6 C;  4GU2 A;  4IUM B;  3RZW C;  2OOB B;  3SU8 X;  1SE9 A;  3VH4 B;  5IP4 D;  1HE8 A;  5BMG A;  1P1A A;  5EE9 A;  2EMT A;  2ZVN A;  1E5W A;  2DNF A;  3VTV A;  3H7P B;  1AYF A;  3P42 A;  2BQQ A;  1EUV B;  3R7Q A;  1HXY D;  3BVM A;  3DQV A;  3SR6 A;  1E8W A;  3Q3F A;  3Q8A A;  4NJ6 A;  4HCP B;  4NQL B;  4A8X C;  2MQJ A;  1XQQ A;  2FCM A;  3P1M A;  2QJL A;  1K8R B;  3RPF C;  3BYY B;  4II3 B;  1MHX A;  2LD9 A;  5DPS A;  1PGA A;  3AXC A;  1I4G A;  1A70 A;  4KSL C;  2PVG C;  3I9V 1;  1WX9 A;  3VH3 B;  3B9J A;  1ZDX A;  3U30 A;  2I1J A;  2DX5 B;  4P7I A;  1WRD B;  1OTR B;  2VZK B;  1ACC A;  1K51 A;  1OFF A;  3APC A;  3U7Z A;  4C80 A;  2BB6 A;  4ZYS A;  2CJO A;  4I6L B;  3RN9 C;  1GB1 A;  3PLU A;  1HTQ A;  4C7Y A;  3C19 A;  4NJ7 A;  2MJD A;  4RF1 A;  4MAC A;  2J0K A;  1QF6 A;  2MSE D;  1CJE A;  4A3P A;  4HXD A;  3ZXV A;  2M0A A;  4ASW C;  3R2T A;  1I4R A;  1ZGU B;  1WWT A;  1C9F A;  1GT8 A;  2RMM A;  4EZL A;  3FKY A;  2ICI A;  2WDV B;  3UQA A;  3ML9 A;  5IKC M;  3O13 A;  2CS4 A;  5FK9 C;  2KWV B;  4CO7 A;  4YXD B;  3IVF A;  1HZ6 A;  1EWC A;  3NUH B;  1SXT A;  4PK1 A;  2DYB A;  1XXG A;  3FIL B;  1YJI A;  3P4P B;  4URK A;  2MRP A;  2KX3 A;  3VRB B;  2XN9 C;  3V6C B;  3BYT B;  3PLV A;  4YTN B;  3KQ4 A;  3J9C A;  2J7Q B;  2JY6 A;  2A5U A;  1WXQ A;  1FNW A;  2JZ3 B;  2WXK A;  1ROE A;  3ZKJ C;  4LDT D;  3NRZ A;  3SEB A;  2GMI C;  3NJT A;  2ZCB A;  4YL8 A;  2NTS A;  1E7U A;  4RGT A;  1WI0 A;  1R4M I;  2DAJ A;  3GB1 A;  3I3T B;  4RF0 A;  3RNG C;  3U4E G;  1JRU A;  1KLU D;  5EE0 A;  1VR9 A;  1VLB A;  1FMA D;  2GBJ A;  5G55 A;  5CHV C;  4HJK A;  1VJK A;  2PMV A;  5T8I A;  2LJ5 A;  3DWM A;  4PT5 A;  4L1B A;  5BMI A;  1UBI A;  2KHW B;  2N7J A;  1WXV A;  2ZJD A;  1I4Q A;  4HWI B;  2J52 A;  1NEK B;  2WX1 A;  4TV3 A;  5IO9 A;  1NYQ A;  2AQ2 B;  4WWM A;  4M0W A;  4RM8 A;  3ZO5 B;  2WGS A;  4LNI A;  1TYG B;  4C4V B;  1YX5 B;  2NS5 A;  3GZN B;  1YD8 U;  4KKJ A;  3V3X A;  3UIN B;  1V5T A;  2I1K A;  2INP E;  3Q3J A;  1IBX B;  3VHT C;  2MH7 A;  1N60 A;  4JX1 C;  1IGD A;  3H9D A;  4ZOH C;  1KTK A;  4ZYN A;  1ZXH A;  2BKR B;  2HE7 A;  2PEA A;  2KTR B;  4JE3 B;  3DPD A;  1N5W A;  2M8S A;  4BZA A;  2BWE S;  1T5X D;  2HDE A;  4G3X B;  2LI5 A;  3B0A A;  2GB1 A;  3TEW A;  5D94 A;  3IXS A;  4YTM B;  1F52 A;  3WAP A;  5L95 C;  1RRB A;  2OED A;  4NAW A;  3JSV B;  1I42 A;  2BT6 A;  1YQ3 B;  2KX0 A;  2V4I B;  4FAD A;  4G0N B;  4OVV A;  4EUT A;  1L0X B;  4DXF A;  3AUL A;  3L13 A;  4ANX A;  1A5R A;  3H7P A;  1C3T A;  4C00 A;  4MGK E;  3PT2 B;  2H88 B;  3I63 C;  3DVN U;  4KIK A;  3L17 A;  3BVG A;  2WYQ A;  3RUL A;  1MHH E;  1XLP A;  1H7X A;  3Q3N C;  4M0W B;  3KYD D;  1QOA A;  2H89 B;  3ZNI D;  4BFR A;  1J7B A;  2JZP A;  1WMH A;  3IAS 1;  3HHM A;  3PZ7 A;  3VR8 B;  4H2A A;  3JSV A;  4KGT A;  4K7S A;  4GOC A;  3RUI B;  3VRA B;  2WXO A;  3UI3 A;  2W55 A;  1P7E A;  3PO0 A;  1C4C A;  1V1O A;  4BVU C;  4EKU A;  4PYU A;  3DHH C;  3AEE B;  2IO0 B;  3VUY A;  4GSW A;  1AAR A;  4IM2 A;  2M56 B;  1FO4 A;  3SDL C;  1B9R A;  4DHJ D;  1K53 A;  1WJU A;  2INN E;  1WGG A;  2IO2 B;  3WAN A;  2JXT A;  3ZYY X;  2N7D A;  1TKE A;  3FC4 A;  1WJN A;  3ZRF A;  2MW5 A;  3LDZ E;  2WP9 B;  5BO4 B;  3AV8 A;  3RD2 A;  3AH7 A;  2LVQ A;  1AWD A;  4OZA A;  2NCN A;  3RT3 B;  3L0W B;  2G9H D;  3IAM 1;  5KHO A;  3L16 A;  2I38 A;  1K52 A;  2KNB A;  4W9J A;  5AUK A;  3GE8 C;  3QK0 A;  2KLG A;  2N4F A;  2JUO A;  2GI9 A;  1LO5 D;  4P16 A;  2BB5 A;  2D3A A;  3BK1 A;  2DLB A;  1UZX B;  2PIA A;  1NYR A;  1FRR A;  2DYO A;  1CK1 A;  4JWS C;  2UWQ A;  4GLS C;  2N9K A;  3E9S A;  2Y3A A;  2MLB A;  4E3C A;  4DDG D;  4RCO A;  2LGY A;  3PRZ A;  1V81 A;  1FXT B;  3R66 C;  1IGC A;  4N58 A;  1MVK A;  4XGA B;  5DCN A;  2CU3 A;  4RGO S;  2JT4 B;  3KUZ A;  4MJS A;  1BT0 A;  2FUH B;  4KV2 A;  3KWV A;  4YSX B;  4P1C C;  4IKG A;  2TSS A;  4W9E A;  1DYQ A;  2NBW B;  2G1E A;  5H8Y E;  5EDS A;  4LNO A;  1VCB A;  3M3J A;  1JWS D;  2WX0 A;  1N6Z A;  2DEN B;  2MBO A;  3AU5 A;  3TMP B;  1H8C A;  1BXT A;  2NVU I;  3ALB A;  4RM9 A;  4ZRK A;  3N1Z C;  1YNT E;  1EU4 A;  2JYE A;  2WWZ A;  3DVN V;  4PS8 A;  1SE2 A;  4GB9 A;  3ZJT A;  5J18 A;  4HKZ E;  2V0G A;  4XDC A;  4HRS A;  1VZ6 A;  3DVG Y;  1GC6 A;  4MSM B;  3AE4 B;  1PQS A;  3EFU A;  3PRM B;  3EEC A;  5HHD G;  1WM2 A;  1OQQ A;  3KUC B;  2MHJ A;  4FXC A;  2JF5 A;  4ICU A;  1PFD A;  1YJJ A;  2KFK B;  2NBU A;  1WY8 A;  2JX5 A;  1Z2M A;  2UU7 A;  4GGQ A;  4KKI A;  4BKS A;  5IOI A;  2O6V D;  4O1N A;  2VZK D;  2MJ3 A;  4TMA B;  2Z59 B;  3HM6 X;  5HI1 A;  3RNC C;  3RNE C;  4E74 A;  2BTE A;  4S17 A;  1TKY A;  3VAW A;  3B2G A;  3C8Y A;  1YN4 A;  1J7C A;  2LHE A;  1KLG D;  2RDB C;  1RAX A;  3AE1 B;  5BYR A;  2Z8L A;  2AQ3 B;  2QMT A;  4JL9 A;  4RH6 A;  1XLO A;  4WQM A;  4ZHP A;  2KJR A;  1ET9 A;  2O2V B;  2DWQ A;  2C7N B;  3ZNH B;  3DHI C;  1TIF A;  1STE A;  3CMM B;  1D3Z A;  1NBF C;  3ZGZ A;  2YVC A;  3GE3 C;  1JAL A;  3TEX A;  1FNV A;  2PLP A;  4KDI C;  4AOF A;  1J7A A;  1P98 A;  1ZXI A;  1V6E A;  2GLS A;  5FR3 A;  1GB4 A;  4US8 A;  3I57 A;  3NY5 A;  3Q6B A;  2BW2 A;  4K3B A;  3VFK A;  4LNN A;  1V8C A;  4MH8 A;  3W1S C;  1KOT A;  4FUL A;  3CSF A;  3AE3 B;  4TQ0 A;  3R7R A;  1CMX B;  2KXJ A;  1IPG A;  4XWW A;  4IOI E;  4ZRJ A;  1WMH B;  2G45 B;  5IA7 A;  2X8X X;  1YJ1 A;  4MH0 E;  1SIF A;  1FFU A;  5C23 A;  1KF6 B;  2C60 A;  1SEB D;  3HIZ A;  2KMC A;  4PS7 A;  1SJH D;  2CJN A;  2KMA A;  2LUM A;  1X1M A;  1QT9 A;  1WGY A;  3N1Y C;  2KLC A;  3MFG A;  3BY4 B;  3BVZ A;  2GRI A;  2C9W B;  4P6V F;  3GS2 A;  2J53 A;  1OEY A;  1GC7 A;  4GDL B;  2D5G A;  1TS2 A;  2MEK A;  2CHW A;  2N9P C;  1WJ4 A;  1ZOY B;  1QZE A;  2LEK A;  3OJ3 A;  3BZD B;  4KDL B;  3UIP B;  3QC8 B;  1N62 A;  1Q0W B;  1LGR A;  5LXI B;  1L0Y B;  4B0M A;  2R61 A;  1TGZ B;  1N61 A;  4K81 A;  4GDK A;  4F7Z A;  2IO1 B;  5KHQ A;  1YX6 B;  1GPX A;  1ZPS A;  3IG3 A;  1N5X A;  3N20 C;  2HTM E;  1NI3 A;  2WNM A;  3R3M A;  3UF8 A;  3KUD B;  3TEZ A;  3PV1 A;  1QOF A;  2XNA C;  1WF9 A;  3PHX B;  1ENF A;  2W54 A;  2E6X A;  4DXG A;  1P0R A;  3B1L X;  2MBH A;  5AZF A;  4C7Z A;  4ARC A;  2ZZP B;  4K3C A;  3D32 A;  1SJE D;  2WXN A;  4DHZ B;  4I6N B;  4YSZ B;  1KJT A;  2GOW A;  3FAH A;  4DDI D;  5JHB A;  5LXH A;  1KH0 A;  2AQ1 B;  1ET6 A;  2JRI B;  2KWU B;  4MT5 A;  4CQN A;  3TL5 A;  1FFV A;  2J0J A;  1H4R A;  2K8H A;  3P4S B;  5FR6 A;  1WGD A;  3PTF C;  2N0S B;  2KAJ A;  1K50 A;  3N30 A;  1F2R I;  4GN1 A;  1V1P A;  2IZV B;  3QQ8 B;  4MGY E;  1DOY A;  4WJQ A;  2YLM A;  2WXG A;  2CKH B;  4I6P A;  3ENE A;  1PDX A;  1TY2 A;  4CYE A;  3ZJU A;  4ARI A;  3EC8 A;  3W5V B;  4TQ1 A;  1BML C;  3VUW A;  2BYV E;  1N63 A;  2DBY A;  4RMA A;  4XDD A;  2L05 A;  1WYW B;  2D3G A;  4WQO B;  1C4A A;  2IY1 B;  1YIW A;  3VR9 B;  4XC2 A;  2KVZ A;  2JYT A;  2RPV A;  4NNJ B;  1V5O A;  2DZM A;  1UBQ A;  5IN7 A;  2N9L A;  2LVP A;  2QIL A;  1WGK A;  3U8Z A;  2AX5 A;  1J19 A;  2NPT A;  1ZKH A;  1DOX A;  2L32 A;  3A9K B;  2IJ0 A;  3IT6 B;  2L7R A;  3H1U A;  1I35 A;  3RNA C;  2HJ1 A;  5D3D A;  4A6Q A;  3QCA A;  3K9P B;  4AQ7 A;  4XX5 A;  1PGB A;  1C76 A;  1YQB A;  4HVB A;  2WHI A;  1EF5 A;  4ZRP A;  3LB8 C;  1ZUD 2;  3IFW B;  3X0W A;  3IT4 B;  3DDC B;  1MG4 A;  4IWO A;  2KWD A;  1HEZ E;  3A9J B;  4P1B C;  4J6I A;  5DPW A;  4ANU A;  1QIL A;  2NR2 A;  3L4P A;  3V6E B;  2LJI A;  1UD7 A;  1LXD A;  1EU3 A;  1LQB A;  4IDI A;  3N32 A;  1EO6 A;  3AEC B;  1WR6 E;  4OZB A;  1VRA B;  2JPH A;  2G3Q B;  3NS8 A;  2KQS A;  4TSS A;  1UH6 A;  3MHZ A;  2QSD A;  3B08 A;  2D3B A;  3NS1 A;  2JWZ A;  3MP9 A;  1F9J A;  2K9X A;  1QQR A;  3U7D A;  3OJ4 B;  4W9I A;  2WDT B;  5BYS A;  3TSS A;  2IBI B;  3GZN I;  1D6E C;  3TUO A;  2WXM A;  5JZE B;  4L2Y A;  1TZO A;  2INC C;  2WXR A;  5JHA A;  4WAA A;  1S3S G;  4W9G A;  3UIO B;  4TKN A;  3T3O A;  1SF0 A;  3QIJ A;  2IY0 B;  2KDF B;  3A33 B;  3A9K A;  3M62 B;  1DGJ A;  3P4Q B;  2M4N A;  3BIN A;  4C4V A;  1JRO A;  3PRP B;  1KLV A;  4LJO B;  3AI5 A;  1T0Q C;  1MG8 A;  3HRD D;  1WGH A;  4GDL A;  3Q3M C;  5FKA C;  4WAF A;  4NQK E;  3MTN B;  1V2Y A;  3A9J A;  3LXF A;  2PW9 A;  1FIQ A;  1E0Z A;  3S2A A;  4A55 A;  1IBX A;  2MA9 B;  1RYJ A;  2QDF A;  3AN1 A;  3W1S A;  4JWU C;  4JGH B;  1AW7 A;  3LYY A;  2GBN A;  3DBL B;  1ESF A;  1R4M B;  1RLF A;  4ZHO A;  1MPE A;  1T6B X;  3MC8 A;  2ZNV B;  2K39 A;  2KN4 A;  1MFW A;  5G2N A;  3DOW A;  4RGN A;  3CF6 E;  2AYO B;  2ZW1 A;  4AJW A;  2UYZ B;  1E7V A;  2QC8 A;  2R2O A;  2WLB A;  3HK0 A;  1E8Y A;  3AE2 B;  4BKS D;  1XT9 B;  4ANW A;  5CX3 A;  3ZDM C;  4AWJ A;  5MPO A;  3RCZ A;  2G4S A;  1P7F A;  3ZDT A;  3AE7 B;  4KZ0 A;  4HK2 A;  3PVL A;  4GIV A;  3PRE A;  3L08 A;  4IWQ A;  3ZNZ B;  4F8C B;  4FHJ A;  3RYT A;  3HVZ A;  2LUE A;  1Y8R C;  2KQ7 A;  2V1Y A;  3VQI A;  5H92 C;  3DHG C;  1LM8 B;  2BPS A;  4HCN B;  1R4N B;  2WU5 B;  1L5P A;  2KD0 A;  2BYT A;  1IYF A;  4MEL A;  3P63 A;  4W9K A;  3KWL A;  5E6J A;  2C7M B;  4N59 A;  1MJD A;  4GXB A;  4AP4 C;  2ZPY A;  1P3Q U;  5BMH A;  2PTL A;  4YWG G;  2KQ4 X;  4MSQ B;  3H7S A;  3DVG X;  1VZ8 A;  2KWC A;  3TEY A;  1WJ6 A;  2IGH A;  5C2T B;  1L6U A;  1V49 A;  2PE6 B;  4MGZ E;  1V9J A;  4OW0 A;  1M4V A;  3K9O B;  2LGX A;  4XWT A;  4XE0 A;  2ACZ B;  1XLQ A;  2JSV X;  2IO3 B;  3BWU D;  3AMZ A;  2E3T A;  3I5J C;  4IG7 B;  4LK0 M;  3KH0 A;  3T9L A;  1GOZ A;  1WE7 A;  1PYW D;  3P4R B;  1TS3 A;  2RGF A;  5HG2 A;  2BF8 B;  3V05 A;  2KTF A;  2LWP A;  2BYE A;  1R4N I;  4EE2 A;  4OZC A;  5DPR A;  4MJS B;  2WXQ A;  4BKT A;  4W9L A;  3ZQ4 A;  2D3C A;  2BBC A;  3WCQ A;  3AM9 A;  4IM3 A;  2WXJ A;  3A4R A;  3VDZ A;  2OHF A;  5BYQ A;  2ON8 A;  4RNA A;  3W9C B;  5AEK B;  2KO3 A;  1GJZ A;  2DZJ A;  3CF4 A;  3APF A;  1GUA B;  3DBS A;  1YOV B;  4K7U A;  4HPM B;  4DHZ E;  4A90 A;  1JWU D;  2EMS A;  4FLH A;  1J0G A;  3PHW B;  4YSY B;  3L10 B;  4ZRI A;  1FEH A;  2KK8 A;  3EFC A;  1WRI A;  3URY A;  1B1Z A;  1OEY J;  5LLI A;  3RFZ B;  1PUT A;  2IND C;  3KLS X;  1D5Z C;  4B0E A;  4BOS C;  2LGI A;  3MJW A;  4FN2 A;  3AEF B;  1JML A;  1S1Q B;  3DBL I;  3WIM A;  2N9X A;  2JZZ A;  4X57 B;  2WXH A;  4JIO U;  1WXA A;  2LVO A;  4HLE A;  3VUX A;  3AEG B;  3PGE A;  2LRU A;  2NBV B;  2N1W A;  2OJR A;  1WXM A;  3KW5 B;  2D11 A;  1YN3 A;  3ML8 A;  4BKG A;  2L0F A;  2JQR B;  1FRD A;  5AZG A;  3VTU A;  1JQ4 A;  3ETR A;  2CHZ A;  2VH2 A;  4IW0 A;  3OAW A;  4M02 A;  4WJN A;  4EEW A;  3ZTC A;  4DBG A;  2RPQ A;  4W9D A;  2X38 A;  2KFK A;  2C5L C;  1WH3 A;  4B6W A;  3RI7 C;  5D3I B;  3PZ8 A;  2QEJ C;  3Q69 A;  4UDU C;  4M00 A;  4LCD E;  2KAN A;  3NZU A;  4MGI E;  3ZW3 A;  3AEB B;  3CIR B;  2A4Z A;  1H7W A;  4LLG M;  4HDO A;  4K1R B;  4AJY B;  2CHX A;  4MDK E;  3M95 A;  2WU2 B;  1GTE A;  2D2Q A;  4ITK A;  3CWI A;  4ANV A;  1PGX A;  1TJE A;  4MEM A;  1XD3 B;  1OQR A;  2FUG 1;  2FBW B;  4LJP B;  1QLB B;  3ABV B;  4Q2J A;  3SFD B;  3NOB A;  5CTR C;  2WDQ B;  4WH4 A;  3Q8E A;  1L7Y A;  1HTO A;  3U52 E;  4EZJ A;  1J8C A;  2PE9 A;  3AE8 B;  2J4X A;  2K6Q A;  4K7W A;  4DHJ B;  3UQB A;  2JWU A;  4LTU A;  2KMM A;  1HA5 A;  2DYM A;  4KGR A;  2W82 A;  2MBE A;  2RD0 A;  1Z5S B;  2K25 A;  4R3D A;  1T0Y A;  2YEP F;  2LHD A;  4ZRQ A;  1D4B A;  2M0X A;  2K6D B;  2KT7 A;  1EF1 A;  2ZPN A;  2V3S A;  2K0P A;  2FCQ A;  2RDH A;  1Q1O A;  5IAA C;  4A3O A;  3KVF B;  4DWF A;  1MI0 A;  4G11 A;  1YQ4 B;  3JW0 X;  3B2F A;  4WWN A;  2JRH A;  2W3S A;  1UGJ A;  3RNB C;  3AEA B;  2QHO A;  2REX A;  5E6N A;  3TIX A;  2WQY B;  2ZVO A;  3OWE B;  1Q10 A;  3N3K B;  3X23 A;  1HZ5 A;  4DQO C;  4A9A A;  2KYW A;  3NVZ A;  2ZNV C;  1F77 A;  4XZ4 A;  4NAW B;  4M8N A;  3ZUN A;  2VRR B;  4WJO A;  5J2R A;  3ECI A;  3NG0 A;  3VXW A;  4HPP A;  2HD5 B;  3A4S C;  2CR5 A;  3QWZ B;  4M01 A;  3MC0 B;  1V86 A;  2I2Y A;  1D5X C;  1XEE A;  3EA6 A;  2KDE B;  3ZIM A;  4HDQ A;  4KVG B;  4N9F 4;  5EE1 A;  4KGS A;  1UF0 A;  3IHP C;  2LGD A;  2J0M A;  3JVZ X;  4EOY A;  3SFE B;  1GG3 A;  4ZDV A;  2QIE B;  1TKG A;  4KX6 B;  2CU1 A;  1KFY B;  1HQR D;  2BS3 B;  2Z0D B;  3RZF A;  1V1P B;  5JH5 C;  2MBQ A;  1XO3 A;  2KDI A;  4JPS A;  2JU6 X;  2BVC A;  2BS4 B;  2K8B A;  2WXP A;  1L4Z B;  1VD2 A;  2DZI A;  1U4A A;  4A20 A;  1VDV A;  3V62 A;  4NAM A;  3DBR B;  4II2 B;  1AN8 A;  1E10 A;  4NZL B;  3ZNG C;  3Q8F A;  2XK5 A;  1V97 A;  3P2B A;  3WA0 A;  1XCQ L;  2BWF A;  2AWT A;  3HM3 A;  2B3A A;  3L54 A;  2M17 A;  1SBB B;  1G6J A;  5D7G A;  4WUR A;  4W9F A;  1Q5W B;  2MP2 B;  1L2N A;  2LRW A;  2ONQ A;  3ZRC A;  1NDD A;  1TZ1 A;  1JW9 D;  3NVY A;  4PS3 A;  4N6E B;  1TBE A;  2D10 A;  2WXF A;  1IUE A;  4FA6 A;  4NJC A;  1T0S C;  1CQV A;  3EGR A;  2AL6 A;  5D2M B;  4TUU A;  1FNU A;  2FCS A;  3IBE A;  5C1Z A;  3DBH I;  2MCN B;  1UEL A;  3SHQ A;  2Y5C A;  2QCZ A;  1ISN A;  1ZDV A;  1WXS A;  1YN5 A;  1I7H A;  2WXI A;  4IC7 B;  1YMH E;  2L83 A;  1OGW A;  2AL3 A;  2K22 A;  3O65 B;  1C1Y B;  3AE6 B;  2RR9 A;  3MJ5 A;  3UGB B;  2JVC A;  2K5P A;  3ZLZ A;  1L4D B;  3OLM D;  3LJ3 A;  2DHZ A;  4J3O D;  2NPT B;  3ZXR A;  3T3N A;  2ZCC A;  2KC1 A;  4OVZ A;  4D2K A;  2K3U A;  3Q14 C;  2Q5W D;  2KFJ A;  2V3N A;  4RFB A;  2L0T A;  3DBR I;  2RDG A;  2DAF A;  2KJH B;  2N1V A;  2WDR B;  2M19 A;  5L83 A;  4WJP A;  2O6V A;  4WWP A;  4W9C A;  2ZEQ A;  1UUP A;  2RSU A;  3DCG A;  5TSS A;  2HTH A;  1TT5 B;  1I4H A;  5JXV A;  2AEH A;  2KTR A;  2XEW A;  4IM0 A;  4BBN F;  4AUQ C;  5LNK 1;  3VTW A;  1SSN A;  2IGD A;  3QAR A;  2FAZ A;  3W5U B;  1NI2 A;  1WYG A;  3Q2A C;  2LAS A;  1FCC C;  4E71 A;  2Y5B B;  1RFA A;  1C78 A;  4GDK B;  2WS3 B;  2MBB B;  1QOG A;  1CZP A;  4LNF A;  4ACF A;  1ZP0 B;  4YT0 B;  2SEB D;  1SIJ A;  1EM7 A;  1TY0 A;  4CHK A;  5AUI A;  1E8Z A;  2WXL A;  3QA8 A;  2FCN A;  5GXG B;  1TTN A;  3W2D A;  1JCK B;  1D5M C;  3A1Q A;  1JWB D;  3ZVV A;  4YTP B;  2L1A A;  4OVU A;  1UWX A;  4KSK C;  1WGR A;  2L76 A;  3M63 B;  1FD6 A;  4ICV A; 
#chains in the Genus database with same CATH homology
 2WXJ A;  4IOI E;  4MAC A;  1SE4 A;  3O13 A;  1JWA D;  5FK9 C;  2OHF A;  5BYQ A;  4YXD B;  2ON8 A;  1HZ6 A;  1EWC A;  4RNA A;  3NUH B;  4HEA 1;  3W9C B;  1SXT A;  1FFU A;  1KF6 B;  2PKO A;  1SEB D;  3CF4 A;  1XXG A;  3FIL B;  1JRP A;  1YJI A;  3P4P B;  1SJH D;  2CJN A;  1XLN A;  3VRB B;  2LUM A;  2XN9 C;  1QT9 A;  4A90 A;  1FCL A;  1XF5 L;  1JWU D;  3BYT B;  1DOI A;  4YTN B;  3MFG A;  3KQ4 A;  3J9C A;  4YSY B;  3BVZ A;  1FEH A;  2GRI A;  1WXQ A;  1FNW A;  2LMC A;  4P6V F;  3GS2 A;  1WRI A;  3URY A;  1B1Z A;  2J53 A;  3FIL A;  2WXK A;  4GDL B;  1ROE A;  2D5G A;  1TS2 A;  2MEK A;  3NZ3 A;  3HVD A;  3NRZ A;  3RFZ B;  3SEB A;  4RGM A;  4HRO A;  1PUT A;  1ZOY B;  2LEK A;  2NTS A;  3BZD B;  1N62 A;  4RGT A;  3KLS X;  1D5Z C;  4B0E A;  1L0Y B;  2LGI A;  4B0M A;  2R61 A;  3AEF B;  1JML A;  1N61 A;  3GB1 A;  4RF0 A;  3U4E G;  1KLU D;  5EE0 A;  1VR9 A;  1VLB A;  1FMA D;  2WXH A;  1GPX A;  1ZPS A;  1VJK A;  1N5X A;  2PMV A;  5T8I A;  2HTM E;  4REZ A;  3DWM A;  1NI3 A;  3AEG B;  2WNM A;  4PT5 A;  4L1B A;  5BMI A;  1UWM A;  1QOF A;  1YN3 A;  3TEZ A;  2XNA C;  2JQR B;  3TEX A;  1FRD A;  3AE5 B;  3BII D;  5C3J B;  1JQ4 A;  3ETR A;  2ZW0 A;  4USA A;  2N7J A;  1ENF A;  1I4Q A;  2W54 A;  2E6X A;  4DXG A;  2J52 A;  2IPK D;  1NEK B;  3GP7 A;  1NYQ A;  4C7Z A;  2AQ2 B;  4ARC A;  4WWM A;  4M0W A;  1SJE D;  1TS5 A;  2J42 A;  2WXN A;  2X38 A;  4YSZ B;  3FAH A;  1TYG B;  3AE9 B;  1KH0 A;  4KKJ A;  3V3X A;  5D3I B;  2AQ1 B;  1ET6 A;  3PZ8 A;  4MT5 A;  3NVW A;  2QEJ C;  4CQN A;  2NTT A;  3Q69 A;  2INP E;  1FFV A;  1IBX B;  2MH7 A;  4UDU C;  3H8H A;  3P4S B;  1JWM D;  1N60 A;  1I4P A;  4JX1 C;  1IGD A;  4ZOH C;  3AEB B;  1KTK A;  2KDM A;  1ZXH A;  3CIR B;  2N0S B;  1H7W A;  4JE3 B;  4LLG M;  1N5W A;  2KAJ A;  1L0V B;  2KAC A;  1T5X D;  4MM3 B;  1K50 A;  2HDE A;  2WU2 B;  1GTE A;  1F2R I;  1V1P A;  2GB1 A;  1FXA A;  4ITK A;  3R8B A;  3TEW A;  1DOY A;  3CWI A;  2SAK A;  1PGX A;  3IXS A;  4YTM B;  1TJE A;  3N9Y C;  2WXG A;  2BS2 B;  1OQR A;  2FUG 1;  2FBW B;  1QKZ A;  1PDX A;  1TY2 A;  2OED A;  1C79 A;  2Y5P A;  3ZJU A;  1QLB B;  3ABV B;  4AS1 A;  4ARI A;  4C56 C;  4Q2J A;  3SFD B;  2BT6 A;  2WDQ B;  3W5V B;  4TQ1 A;  1YQ3 B;  4WH4 A;  3Q8B A;  1BML C;  3Q8E A;  2V4I B;  3U52 E;  1N63 A;  2DBY A;  3AED B;  1RWS A;  4XDD A;  1L0X B;  3AE8 B;  2J4X A;  1C4A A;  4DXF A;  3VR9 B;  2JYT A;  2RPV A;  1NEN B;  3DWG C;  2JWU A;  1FXI A;  4LTU A;  2KMM A;  1E7P B;  1HA5 A;  1KRH A;  2H88 B;  2DYM A;  2EKI A;  2N9L A;  4KGR A;  2QIL A;  1WGK A;  2W82 A;  1SB3 C;  4US9 A;  2W3R A;  1QF6 A;  4R3D A;  2AX5 A;  3BVG A;  2L52 A;  2LHD A;  2YEP F;  1EWY C;  4ZRQ A;  1DOX A;  1D4B A;  3R2I A;  2L32 A;  1MHH E;  1XLP A;  1H7X A;  1I4X A;  1QOA A;  2H89 B;  1J7B A;  2IJ0 A;  3IT6 B;  2FE8 A;  2JZP A;  4L23 A;  3IAS 1;  3PZ7 A;  1ZE3 D;  3VR8 B;  2V3P A;  4H2A A;  4KGT A;  1E6E B;  5D3D A;  4A6Q A;  3VRA B;  2WXO A;  3UI3 A;  2K0P A;  2W55 A;  4AQ7 A;  5I4D A;  2RDH A;  1P7E A;  3PO0 A;  1PGB A;  1C76 A;  1C4C A;  1V1O A;  4ZRP A;  1WSP A;  1ZUD 2;  3LB8 C;  3IT4 B;  3AEE B;  4HJG E;  1MI0 A;  1YQ4 B;  2KWD A;  2M56 B;  1FO4 A;  3B2F A;  1HEZ E;  1B9R A;  3ZJV A;  1K53 A;  2W3S A;  1UGJ A;  3AEA B;  2INN E;  1QIL A;  2JXT A;  3L4P A;  3ZYY X;  2WQY B;  1F0Z A;  1SE3 A;  1TKE A;  3OWE B;  3FC4 A;  2LJI A;  1Q10 A;  2WP9 B;  1EU3 A;  5G5G A;  1HZ5 A;  4DQO C;  4IDI A;  3AV8 A;  4A9A A;  2IDY A;  3AEC B;  3AH7 A;  3NVZ A;  1AWD A;  5HFY A;  4OZA A;  2IGG A;  4OZB A;  1F77 A;  1VRA B;  4NAW B;  2LFI A;  2G9H D;  3IAM 1;  3NVV A;  2I38 A;  1K52 A;  4TSS A;  5AUK A;  3MHZ A;  2GI9 A;  2QSD A;  1LO5 D;  4P16 A;  2BB5 A;  1GTH A;  3NS1 A;  3BK1 A;  3MP9 A;  3BK2 A;  2DLB A;  2K9X A;  2PIA A;  1NYR A;  1FRR A;  1QQR A;  2DYO A;  1CK1 A;  1C4P A;  2MJE A;  3MC0 B;  3Q8C A;  4JWS C;  3EUB 2;  2I2Y A;  1TS4 A;  1L6V A;  4GLS C;  2EEL A;  2N9K A;  3E9S A;  2Y3A A;  5BYS A;  1GAQ B;  1D5X C;  1XEE A;  3TSS A;  3EA6 A;  3U2S C;  4RCO A;  1D6E C;  3TUO A;  5EE1 A;  2WXM A;  4KGS A;  1R7S A;  4L2Y A;  1TZO A;  2WXR A;  3T3O A;  1IGC A;  3SFE B;  1SF0 A;  1C77 A;  3E56 A;  1DGJ A;  2QIE B;  3P4Q B;  1TKG A;  4KX6 B;  1KFY B;  4N58 A;  1JRO A;  1MVK A;  1VZ7 A;  1HQR D;  2BS3 B;  2PVO D;  3HRD D;  2CU3 A;  1V1P B;  5EE3 A;  4RGO S;  5FKA C;  1XO3 A;  4WAF A;  4JPS A;  1QOB A;  2JU6 X;  3KWV A;  4YSX B;  2BS4 B;  3LXF A;  2PW9 A;  4IKG A;  1FIQ A;  2WXP A;  1E0Z A;  1L4Z B;  2TSS A;  1DYQ A;  2G1E A;  5H8Y E;  4A55 A;  1IBX A;  1VDV A;  1RYJ A;  3AN1 A;  3W1S A;  4NAM A;  4JWU C;  1AW7 A;  3LYY A;  1AN8 A;  1E10 A;  4NZL B;  3HUI A;  1JWS D;  3Q8F A;  4WIP A;  1V97 A;  1ESF A;  4ZHO A;  1MPE A;  1T6B X;  1XCQ L;  1XCT L;  1F2R C;  1NVI D;  3AB5 A;  2KN4 A;  1T3Q A;  2NMQ A;  5G5H A;  1BXT A;  1UNS A;  1E9M A;  1SBB B;  1Y56 A;  2YEP B;  5D7G A;  4RGN A;  4WUR A;  2ZW1 A;  2B76 B;  2ONQ A;  4OHJ A;  1YNT E;  4HKQ A;  1EU4 A;  1RFK A;  2JYE A;  1JW9 D;  2WLB A;  3NVY A;  1SE2 A;  1FM0 D;  4N6E B;  3ZJT A;  2WXF A;  4HKZ E;  1BUI C;  1IUE A;  1RM6 C;  3AE2 B;  4NJC A;  2V0G A;  4XDC A;  4HRS A;  1CQV A;  1VZ6 A;  3EGR A;  1FNU A;  5MPO A;  1P7F A;  3AE4 B;  3AE7 B;  5BMG A;  5HHD G;  5EE9 A;  1OQQ A;  4FXC A;  2Y5C A;  1AYF A;  1PFD A;  1YJJ A;  3P42 A;  1ZDV A;  1YN5 A;  1I7H A;  2WXI A;  1YMH E;  1HXY D;  2L83 A;  2JX5 A;  3HVZ A;  2K22 A;  3BVM A;  4KKI A;  3SR6 A;  3AE6 B;  3MJ5 A;  3VQI A;  4O1N A;  5H92 C;  2K5P A;  1L4D B;  2VZK D;  3Q8A A;  2MJ3 A;  4J3O D;  2WU5 B;  1L5P A;  3T3N A;  4TMA B;  2BYT A;  4A8X C;  4OVZ A;  3P63 A;  5HI1 A;  4D2K A;  2K3U A;  3KWL A;  2Q5W D;  3P1M A;  5E6J A;  2QJL A;  2BTE A;  3RPF C;  4N59 A;  3BYY B;  1MHX A;  2V3N A;  4RFB A;  1TKY A;  1PGA A;  2RDG A;  1I4G A;  1A70 A;  2WDR B;  2M19 A;  1FD6 A;  5BMH A;  2PTL A;  4YWG G;  2PVG C;  3I9V 1;  3B2G A;  3C8Y A;  1UUP A;  2KQ4 X;  1YN4 A;  1J7C A;  2LHE A;  5TSS A;  1KLG D;  1I4H A;  5JXV A;  3B9J A;  1ZDX A;  3AE1 B;  1VZ8 A;  2VZK B;  2Z8L A;  2AQ3 B;  2QMT A;  5BYR A;  4RH6 A;  1ACC A;  3TEY A;  1K51 A;  2IGH A;  5LNK 1;  5C2T B;  1OFF A;  1SSN A;  3U7Z A;  1L6U A;  1XLO A;  2IGD A;  4C80 A;  3W5U B;  2BB6 A;  4WQM A;  4ZYS A;  2CJO A;  4OW0 A;  4ZHP A;  1WYG A;  1M4V A;  1ET9 A;  1FCC C;  4XWT A;  2ACZ B;  1XLQ A;  2JSV X;  4XE0 A;  3BWU D;  3AMZ A;  1GB1 A;  2DWQ A;  2E3T A;  1C78 A;  4GDK B;  1STE A;  4C7Y A;  2WS3 B;  4LK0 M;  3ZGZ A;  1QOG A;  1CZP A;  2MJD A;  4RF1 A;  1ZP0 B;  4YT0 B;  1JAL A;  1FNV A;  1SIJ A;  2PLP A;  2SEB D;  1CJE A;  1J7A A;  1EM7 A;  1GOZ A;  1TY0 A;  1ZXI A;  5AUI A;  1PYW D;  2M0A A;  2WXL A;  3P4R B;  1TS3 A;  5HG2 A;  5FR3 A;  1GB4 A;  3R2T A;  4US8 A;  3I57 A;  5GXG B;  3V05 A;  1I4R A;  2BW2 A;  3W2D A;  1JCK B;  1WWT A;  1D5M C;  1JWB D;  1V8C A;  4MH8 A;  1C9F A;  4EE2 A;  1GT8 A;  4YTP B;  2L1A A;  2RMM A;  4OZC A;  2WXQ A;  1UWX A;  3AE3 B;  2ICI A;  2WDV B;  3ZQ4 A;  4TQ0 A;  2BBC A;  3WCQ A;  3AM9 A;  4XWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...