3AE3B

Crystal structure of porcine heart mitochondrial complex ii bound with 2-nitro-n-phenyl-benzamide
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Nitro-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 63
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae3B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae3B01
5H8YE 1T3QA 3AE9B 3DWMA 1WYGA 2Y5CA 1N5WA 1QF6A 1R7SA 4IDIA 3AE2B 2PVGC 2DWQA 2H88B 2MJ3A 1NVID 3ETRA 2MJEA 4WQMA 1KFYB 1JALA 4YSXB 1V97A 2WQYB 3AE3B 1E7PB 3P4QB 3CF4A 1CZPA 1L5PA 2HTME 2PIAA 3HVZA 1FO4A 1SB3C 4LTUA 3NVZA 1ZP0B 4HROA 3AE6B 3VR8B 1XLQA 3AEEB 3AH7A 3EUB2 2N0SB 3SR6A 2W55A 3AB5A 1PUTA 1JQ4A 1B9RA 3NS1A 1J7BA 1YJIA 5AUKA 3CIRB 3NRZA 1F0ZA 1RFKA 3BIID 4ITKA 3FC4A 4N59A 2G1EA 2QJLA 3B2GA 1PDXA 1L0VB 1ZXIA 3KWLA 1FIQA 1TKYA 2BT6A 3AV8A 1FXAA 1PFDA 4USAA 3WCQA 2B76B 4ZOHC 4A9AA 4ZHPA 1N60A 2WLBA 3DWGC 5AUIA 3ABVB 2WU5B 4JWUC 1H7WA 4US8A 1FXIA 1YQ3B 2OHFA 1AYFA 3B2FA 2WU2B 2H89B 3HUIA 1JRPA 4P6VF 1WRIA 2BS4B 1DGJA 3LB8C 1L6UA 3AMZA 5H92C 1JWBD 1GTEA 4C7YA 1WGKA 1GT8A 1GTHA 4YTMB 1NEKB 1KF6B 1DOIA 1NENB 1VJKA 2CJOA 4YT0B 1XLPA 3LXFA 1YQ4B 4JX1C 1N61A 4KX6B 2K9XA 2L83A 1FRRA 4YSYB 1N5XA 3AEAB 2PVOD 4ZHOA 3AECB 1N62A 1FM0D 2MH7A 5GXGB 2EKIA 1JWAD 3CWIA 1DOXA 1J7CA 3AE1B 1ROEA 1XO3A 5G5HA 2W3SA 3AE4B 3AE7B 2W54A 2L52A 3P63A 2JX5A 4YTPB 2CJNA 1JW9D 1CJEA 1NI3A 4N58A 1JROA 2M19A 1ZOYB 1RM6C 2AX5A 3FAHA 1H7XA 2MJDA 3P1MA 1E9MA 1OQQA 2K5PA 4FXCA 4C7ZA 3AE5B 5EE1A 1DOYA 5EE3A 1TKGA 2WP9B 1RYJA 2K22A 3AEFB 1TKEA 4N6EB 1TYGB 3AEGB 4C80A 1UWMA 2Q5WD 1OQRA 2KMMA 2FBWB 1TJEA 1FFVA 3AM9A 3VRAB 3L4PA 1FFUA 1E6EB 1GAQB 1VLBA 3VR9B 2W3RA 4HRSA 2BS2B 1ZUD2 1IUEA 1FMAD 2PKOA 1QOGA 3W9CB 3PO0A 1I7HA 3SFDB 3SFEB 1WXQA 2JQRB 5G5GA 1N63A 2M56B 1J7AA 1RWSA 2BS3B 1SIJA 3W5VB 1E10A 3AEBB 2KAJA 3P4PB 3HRDD 4JWSC 2WDQB 4YXDB 1QLBB 1A70A 1L6VA 3AE8B 2WDRB 1XLNA 4WWMA 1GPXA 3VRBB 1SF0A 2E3TA 1YJJA 1QT9A 1OFFA 2DBYA 3B9JA 2WS3B 2CU3A 1NYRA 5C2TB 3P4RB 2QIEB 3NVWA 3W5UB 5MPOA 1FRDA 3NVVA 1QOFA 1VDVA 1E0ZA 4YTNB 5C3JB 1WWTA 3P4SB 3AN1A 3ZYYX 5EE0A 5EE9A 1NYQA 2ACZB 4US9A 1EWYC 3RPFC 1AWDA 1KRHA 2LEKA 4YSZB 1V8CA 3NVYA 1QOBA 1QOAA 1XLOA 2WDVB 3AEDB
chains in the Genus database with same CATH superfamily
5H8YE 4DXFA 1T3QA 2UU7A 2WXPA 5DCNA 2BW2A 2ON8A 4P1CC 4KV2A 4B9KA 3NY5A 4ARIA 5I4DA 4II3B 2AL6A 3PLUA 2KO3A 1UH6A 4TSSA 5CHVC 3RNFC 1M94A 3VXWA 1LXDA 1X1MA 4ZHPA 1XF5L 3Q3JA 5J2RA 3DWGC 3H9DA 4JWUC 4KDLB 5TR5A 1FXIA 1OEYJ 3OJ3A 2NBWB 1FNUA 3PREA 1V86A 4A3PA 1PYWD 3DVNU 4RF0A 2MSED 4G50A 5T8IA 4YSYB 4E71A 3Q8EA 1CK1A 3AE7B 1U4AA 3O65B 2JPHA 2M19A 2AWTA 2MBOA 1KM7A 1FPYA 1N6ZA 1TKGA 1I35A 2KJHB 4O1NA 1E8WA 1HZ6A 4GDLB 3UF8A 3NS8A 3MHZA 2INCC 4DDID 3ZKJC 2X38A 4K7UA 1FNWA 2DHZA 3OAWA 3VFKA 1V5OA 2RDBC 2WXFA 1KLVA 5LNK1 3JVZX 4KZ0A 4FBJB 1F2RC 3QIJA 2WDRB 4MELA 2MBHA 4MGYE 4HLEA 3ZJUA 1WWTA 2INDC 2RPQA 2L1AA 1BXTA 3VHTC 4L23A 3V61A 2ZNVB 1QOBA 1QOAA 3N1XC 2WDVB 4DHJB 2PVGC 3E56A 1D6EC 5IO9A 1WX7A 2FAZA 2NVUI 1F9JA 3SR6A 2WWZA 3NS1A 1GUAB 4OVZA 2BPSA 2PEAA 2QJLA 4XZ4A 1FCCC 2KN4A 2WX1A 2D3BA 2M17A 2J42A 2KQSA 1C4CA 4P7IA 3WA0A 3A4SC 3R3MA 2AEHA 1L2NA 4K81A 4KGRA 1T0QC 3QCAA 1WJ6A 2K3UA 2FUG1 3LXFA 1YQ4B 4IWOA 1WYWB 1N5XA 5CHFA 1CMXB 2C9WB 1CQVA 5C23A 2BBCA 4FJVB 1I4PA 1TBEA 3DHHC 3OLMD 2N1VA 3P63A 2WXRA 3PRPB 1HEZE 3MP9A 3BINA 1YD8U 1B1ZA 4K1RB 4W9IA 3MJ5A 1E8XA 3AEFB 2VZKB 2FIDA 2KMAA 1OQRA 1FFUA 4CQNA 3C0RB 1EU3A 4AJYB 1XCTL 2KVZA 3SFDB 3SFEB 1QLBB 2NS5A 2EKEC 4JGHB 2PE9A 2YVCA 2CU3A 2N4FA 3W5UB 1Q0WB 2LASA 4WQOB 3AE9B 4LK0M 2JZPA 1R7SA 2WGSA 1WH3A 4KVGB 4DBGA 4LNFA 1WJ4A 1FCLA 4HKQA 4C4VB 5LXHA 1UF0A 2KJRA 4RNAA 4MJSB 4NQLB 2DZJA 3I9V1 4W9FA 3MJWA 1UGMA 4RGNA 3KWLA 2BT6A 3AV8A 4M0WB 2B76B 1VR9A 1N60A 2KHWB 1WX9A 2C7NB 1C3TA 3VUXA 4WWPA 4A3OA 1EUVB 2IY1B 3AU5A 1ISNA 1BUIC 4NZLB 1WE6A 1YX6B 2IGGA 5E6OA 1PQSA 1ZDVA 3NJTA 1NEKB 1VJKA 1N61A 4L1BA 1MG8A 2Y3AA 2PVOD 4RGMA 5GXGB 2KN5A 4CYEA 2DYOA 2ZZPB 1K51A 3QJZA 3H1UA 4XX5A 3RNEC 1PGAA 2AX5A 4C7ZA 2D07B 3EA6A 1TY0A 2N9EB 1TKEA 3L08A 1NI2A 3Q14C 2NPTB 2GBKA 1LGRA 2FBWB 1TJEA 4NPNA 1E6EB 1VLBA 2W3RA 3VR9B 1IUEA 5JH5C 1WSPA 4L2YA 1SE2A 1I7HA 4AS1A 2JQRB 5G5GA 1A5RA 2WYQA 1YX5B 1C79A 2RDHA 3P4PB 3IFWB 2ZW1A 1QILA 3T8MA 1XLNA 4KDIC 2MBQA 1SE4A 2INPE 4TKNA 3X23A 3KW5B 3ZQ4A 3RPFC 4YSZB 4N9F4 3A9KA 1IGDA 3NHEB 4HVBA 5BYSA 1WMHA 2O2VB 4CHKA 3W1SA 3ZXVA 2D3GA 4ASWC 3QARA 2IGDA 3HVZA 2RD0A 2NTTA 4LTUA 1SGHA 3ZDTA 2PW9A 1AN8A 3TUOA 3AEEB 2D10A 2W82A 4X57B 1Y56A 4ZDVA 4S0RA 3UINB 2RMMA 2KTFA 2IY0B 2BYEA 4DDGD 1DYQA 1L0VB 1ESFA 1KOTA 4LJOB 4PS7A 3DHIC 3N9YC 5AZGA 1EO6A 2WU2B 2BS4B 2XBBC 4HWIB 3Q3NC 2N9KA 2G4DB 1OQYA 4MDKE 1V6EA 4EUTA 5HFYA 3Q8FA 2K9XA 1J0GA 1NDDA 3GZNI 2WXLA 3TBLD 2M0AA 1J7CA 1MJDA 3ZVVA 1ROEA 4C00A 4A6QA 1YN5A 1L0XB 4RFBA 2N9XA 1ACCA 3T3OA 2TSSA 3TEWA 2D5GA 3VAWA 3VTWA 3BYYB 5TSSA 2FCNA 2BF8B 2IO3B 2ZW0A 3AM9A 3H7SA 4EOYA 2DENB 3M3JA 2BS2B 2BB6A 3EHVA 4R3DA 1I4RA 1J7AA 1RWSA 2WHIA 3UI3A 4B0MA 1GJZA 1RLFA 4BBNF 5HKHA 2LFIA 3K9OB 1V49A 3GOEA 5C2TB 3C8YA 3V60A 2KWVB 3AN1A 1EWCA 2V0GA 1WJUA 2MW5A 2ZEQA 2KDBA 4MM3B 2O6VA 3QAQA 5IOIA 2K39A 4B95A 2ICIA 1SE9A 4OVVA 4WWNA 3P4QB 2YLMA 2FCMA 3SHQA 4TQ1A 4ZYSA 4DHZB 3WAOA 3Q69A 2CU1A 2W9NA 1J7BA 2KNBA 3D32A 4NY0A 1MPEA 1ET6A 1KLGD 4W9GA 3ZW3A 3LYYA 3TEYA 5EDSA 3A1QB 4HPLB 4AUQC 4MGKE 2RSUA 5HI1A 1WRIA 4NAWB 2CHZA 4KSLC 2KX3A 2C7MB 4S17A 3QQ8B 1GTEA 1FNVA 3LJ3A 2MP2A 3W1YA 1D5ZC 4HJGE 4RH6A 2KANA 4F7ZA 2JZ3B 2J52A 1GNUA 2KDIA 2KLGA 3CWIA 2Z59B 2Z0EB 5BO4B 5BMHA 1P3QU 5G2NA 2AL3A 4GDLA 3ZUNA 1SJED 1F1HA 1WM3A 2X8XX 3RULA 2CHXA 2OJRA 1GAQB 2PKOA 1YIWA 3VH4B 5JHBA 4FJZA 5LXIB 4DXAB 1T6BX 3VUWA 3R7QA 3AEBB 1MFWA 3ML8A 1QQRA 3H7PB 1WZ3A 2Z8LA 2K25A 4JQWC 5MPOA 3NVWA 2JF5A 1KJTA 1Z2MA 4G0NB 2NCNA 1IBXA 3P4SB 3UGBB 5IKCM 1P1AA 1T0RC 1WE7A 1C78A 3A9JB 3M63B 3JYUA 3KUCB 2XNAC 4DXGA 2Y5CA 4GMVA 1QF6A 1ZXHA 4IDIA 2MEKA 2UYZB 3DOWA 2BKRB 2KX0A 2AYOB 3U7DA 2LGYA 2ZPNA 1RRBA 3AE6B 2CKHB 2VRRB 3B08A 2PLPA 4RGOS 2WXJA 2HD5B 3MC0B 5D94A 4EEWA 1UELA 2G1EA 2V9HA 3JW0X 1C4PA 4MH8A 4USAA 4A9AA 4AWJA 1BMLC 3L54A 1WY8A 4TV3A 2L3ZA 4YT0B 2O6VD 4RF1A 4JE3B 5L83A 2KFJA 1L4ZB 5IA7A 3PV1A 2A4ZA 5G5HA 3DQVA 4LLGM 4YTPB 4RMAA 3V62A 1NI3A 2SAKA 1E9MA 1OQQA 1RYJA 5FR3A 4GDKA 2PTLA 5FKAC 2JWUA 3VRAB 1IPGA 2WNMA 4B0EA 4WWOA 2QMTA 3ZTCA 3K9PB 1Z5SB 3WIMA 1LM8B 3U8ZA 2E6XA 3TJPA 2DBYA 2ZPYA 2JWZA 1YN3A 3NVVA 2J7QB 1QOFA 4A55A 3GE8C 3R66C 3FKYA 5CTRC 3NZ3A 4HK2A 4NJ7A 4J3OD 5KHQA 2HE7A 4MH0E 3AE2B 3N3KB 2IPKD 4RM8A 2KC2A 1L5PA 1VZ7A 2LRUA 3NVZA 4W9KA 1ZP0B 1YNTE 3KQ4A 3VH3B 4BKSA 4ANUA 1WM2A 1Q10A 2UWQA 1TKYA 1SJHD 3WCQA 1UNSA 3NG0A 3BVZA 3TIXA 1T0SC 1GG3A 1WF9A 1RAXA 2OJWA 3SD5A 1JRPA 2WXIA 2GBNA 3Q8BA 5E6PA 3S2AA 1K8RB 3SU8X 4TMAB 3IG3A 3DBLB 3SDLC 2N7DA 4IOIE 1WGYA 2PPHA 1FRRA 3RNBC 4G3XB 1MI0A 1RFAA 4KIKA 4LNIA 1TS3A 1V81A 3DBLI 2W54A 2QSDA 3PGEA 2MJDA 4H2AA 3RNGC 2JU6X 2QC8A 2K22A 3ZNGC 4N6EB 2REXA 4BZAA 1P0RA 2KMCA 4GSWA 3BK1A 3KLSX 1J8CA 3L13A 4M01A 1WI0A 3NOBA 3KVFB 4NJ6A 3AULA 4NNJB 1JRUA 3GB1A 2C60A 3VRBB 1SF0A 4ACFA 1QT9A 3B9JA 4XDCA 1E0ZA 3VQIA 5DPWA 2ZCBA 2M4NA 1NYQA 1WX8A 3PVLA 1R4MB 2WXOA 3PZ8A 4EZLA 4BOZB 3DPDA 3DWMA 2JT4B 2VH2A 3B1LX 4MSQB 2KVRA 1KFYB 4JPSA 2XK5A 1V97A 2GOWA 2BTEA 1R4MI 3L10B 2KWCA 1IGCA 4BAXA 3EC8A 4LNKA 4ZRQA 4HKZE 2KLCA 1L7YA 1P7FA 4KKJA 3L17A 1B9RA 2KC1A 3NRZA 3UIOB 1RFKA 4N59A 2JYTA 3R7RA 4W9CA 1PDXA 2LJIA 3DBHI 3V6EB 1L0YB 3DBRI 4HEA1 2H89B 2EELA 4P6VF 4DQOC 2K8BA 4LDTB 1DOIA 2RPVA 4LCDE 2FUHB 4M8MA 1TY2A 1VZ8A 1ZPSA 4EKUA 2CS4A 4FA6A 2L83A 1UUPA 2ONQA 2DYBA 5CX3A 1YN4A 4C56C 2NBVB 3BWUD 2K0PA 3VTVA 2L52A 2JX5A 2RR9A 3MTNB 3IXSA 2GB1A 2K8CA 4BKSD 4FADA 1FD6A 4IM0A 1HA5A 1C4AA 2LJ5A 3L4PA 4KGSA 4WJNA 4MGIE 1WXQA 4ICVA 4OHJA 4AQ7A 1TS2A 1GPXA 1Y8RC 1OFFA 1J19A 1NYRA 1UZXB 2C5LC 3DHGC 2HJ8A 4DK5A 4YTNB 5EE9A 3DCGA 4HXDA 3U2SC 4GB9A 2ZVNA 3JSVA 1LQBA 3BY4B 2MX2A 3RZFA 1GB4A 1VRAB 1NVID 2D11A 3N32A 3DVNV 5E6NA 1CZPA 1FO4A 4W9JA 1EF5A 4UDUC 1FXTB 4PYZA 3AH7A 3EUB2 4XYCA 1D5XC 5AUKA 3FC4A 2I1KA 1C77A 3DVGY 3HM6X 3IAM1 3RN9C 1FXAA 1IP9A 2KZRA 3ABVB 1BT0A 1YQ3B 1AYFA 2JSVX 2LI5A 4GGQA 3A33B 4IM2A 3V05A 2MBBB 2LWPA 3U30A 1GT8A 4YWGG 1TIFA 3RD2A 3AI5A 2N7JA 1YJ1A 1D5MC 3AECB 1P9DU 1FM0D 3MC8A 1JWAD 4HDQA 1V1PA 3P42A 4IWPA 3W2DA 1KTKA 3E9SA 1JROA 5BYQA 2KTRA 1RM6C 2IO2B 1HTQA 1E7UA 4BFRA 2FE8A 3GZNB 2HDEA 1GC7A 4E74A 3PZ7A 1TZOA 3IVFA 3PPAA 1FMAD 3HM3A 3OWEB 5J17A 1P98A 1VZ6A 3QWZB 2LGSA 1LFDA 2KAJA 4JWSC 4FHKA 4GLSC 1UD7A 3SEBA 3T9LA 3ZYYX 2LEKA 3NZUA 1P7EA 1WR6E 1WIAA 2YEPF 3MFGA 3CSFA 2J0KA 4JLCA 4PT5A 4XE0A 3QC8B 2IO1B 1VD2A 2L0TA 3T3NA 4I6NB 1C1YB 4NQKE 3DBSA 2KACA 4IKGA 1F52A 2BYVE 1I4HA 3ECIA 3N1ZC 1PGXA 1WR1A 2KFKA 1TS5A 3GS2A 2IO0B 1AW7A 3QX1A 4ANVA 2V3SA 5FR6A 3VUYA 4C7YA 3MC9A 3GP7A 4GN1A 2I38A 1GOZA 1UBIA 1YMHE 2CJOA 1XLPA 2BYTA 2KDFB 2OOBB 3LDZE 4IM3A 1V9JA 2DZKA 3CMMB 1ZDXA 2LXAA 3BYTB 3HHMA 1C9FA 1IYFA 1ZOYB 2IYDB 2K5PA 2WP9B 1TYGB 2DX5B 1WGRA 4EZJA 2KMMA 3RCZA 1Q1OA 2GRIA 3N1YC 4BBNC 3W9CB 3I3TB 2BS3B 3O13A 2DLBA 1QKZA 1A70A 3KYCD 2PMVA 1WMHB 1GC6A 2WS3B 3ZJTA 2QEJC 4OVUA 1WXMA 2KK8A 5IP4D 1R4NI 2V4IB 3ZNHB 3TSSA 3FILB 5HHDG 1XLOA 1H4RA 2L8JA 1WYGA 4LNOA 1N5WA 4A90A 3L16A 2FNJB 4FN2A 3AE3B 2HTME 2MRPA 3ALBA 3Q3MC 1EM7A 2M8SA 3L0WB 3PS6A 3X0WA 4ZRPA 5KHOA 3V6CB 1F0ZA 2FCQA 2KQ7A 3B2GA 3TL5A 5J18A 3Q3OC 2WU5B 4RGTA 2HTHA 4EFOA 2V4LA 2LHDA 2LHEA 1I42A 3PT2B 4WJQA 1UWXA 1D4BA 3C19A 2V3NA 3AXCA 4ARCA 4KX6B 3MHSD 1SEBD 1WGHA 3AEAB 4AJWA 1N62A 1DOXA 1XO3A 4HCNB 4PYUA 4BOSC 2Z0DB 3P2BA 4F8CB 2BVCA 2KJ6A 2LUEA 2JXTA 3ZNID 2JRHA 4WH4A 2L0FA 2IZVB 1S3SG 4GOCA 5BMIA 3EFCA 1QOGA 1UBQA 1V5TA 2DNFA 3ZIMA 4GU2A 1XCQL 2J53A 4WJOA 4J6IA 4W9EA 5L95C 2O6VB 2LXCA 2V3PA 1HE8A 2VH1A 2INNE 1K50A 4ICUA 5D3IB 2LMCA 4KGTA 1V80A 2GBMA 3IT6B 1V8CA 3NVYA 3WAMA 2G9HD 1H8CA 2NTSA 4REZA 2N1WA 1M4VA 2DYMA 1SBBB 3V3XA 3APDA 2DWQA 1TGZB 2MJEA 3CSTA 2BGFA 1JALA 1TS4A 4W9LA 4XWTA 1E7PB 3CF4A 4M02A 2MLBA 4XC2A 1SXTA 4GXBA 2N0SB 2W55A 5JXVA 2BKFA 3VVWB 2MP2B 3W1SC 2GBRA 3TCAA 1OGWA 3EGRA 1ZKHA 5AUIA 2ZJDA 4IG7B 5BYRA 2K8HA 4MGZE 3URYA 1I4GA 1H7WA 3N30A 4W9HA 4C4VA 4M8NA 3ML9A 3R2IA 3LB8C 3AMZA 3HVDA 1WZ0A 2G3QB 1JWBD 2MCNB 4MJSA 3ZRCA 4LJPB 4URKA 4M0WA 2N9PC 4WIPA 1ZW7A 3TEXA 4A20A 3UQAA 4ZRIA 2JRIB 4XWWA 2W3SA 2D2QA 1E8ZA 2JZZA 3I63C 3FAHA 3AE5B 4DHJD 3RFZB 1EF1A 3M62B 2AQ3B 2QHOA 2K6DB 4PS8A 1UWMA 2KDEB 3H6NA 1FFVA 1OEYA 3AU4A 4TUUA 4P16A 2BYFA 1IBXB 3RT3B 2I1JA 5DPSA 1E10A 1N63A 1F77A 2IGHA 2I2YA 3HRDD 1TT5B 2KT7A 1JMLA 2NPTA 2PE6B 4OZAA 3P4RB 2QIEB 4I6LB 4ZRJA 2JXXA 4W9DA 3IHPC 2ACZB 2L7RA 1AWDA 2GLSA 2M1MA 2C7HA 5IAAC 1XT9B 2AQ2B 4QAYA 3TEZA 2OEDA 4XGAB 2WQYB 1SE3A 2WXMA 2GMIC 1ET9A 3I57A 4WAFA 3VR8B 2KYWA 3AB5A 1OTRB 1YJIA 1QZEA 2O2VA 4LNNA 4WJPA 3VTUA 1NBFC 2VZKD 3CF6E 2WXNA 4ANWA 4HDOA 1DGJA 3DDCB 3RNCC 2D3AA 1C76A 1WXSA 4HPPA 1KF6B 4AP4C 1I4XA 2L05A 3DBHB 4A8XC 3H8HA 4GDKB 3DBRB 2QILA 1T5XD 2MH7A 5FK9C 4Q2JA 3U4EG 3AE1B 1SIFA 4HCPB 1JW9D 2NBUA 2Y5BB 5IN7A 4FXCA 3Q2AC 4MEMA 5EE3A 3PZDA 5DPRA 3AEGB 2Q5WD 4D2KA 2LGIA 3QA8A 3BVGA 1TTNA 4LDTD 5G55A 1SIJA 2CHWA 2EMSA 2WDTB 1L6VA 4FULA 4WWMA 2K6QA 2ZVOA 1YJJA 4DWFA 1E7VA 2LGXA 2WXKA 4G11A 2D3CA 2FIFA 3ZXRA 1HXYD 3QK0A 1T0YA 1KRHA 3PRMB 1KLUD 2KDMA 2EMTA 4RM9A 2H88B 2MJ3A 2ZNVC 3KUZA 1GB1A 1WFYA 1XD3B 1JWUD 5D2MB 4OZBA 3ONSA 1EU4A 1XLQA 1PUTA 2R2OA 2MQJA 3CIRB 4MM3A 3BIID 4HPMB 1ZXIA 2N9LA 1JWMD 1MVKA 4KIKB 3B2FA 2KOXA 4K3BA 1JWSD 3OJ4B 1AARA 5HG2A 2XN9C 4MT5A 3TMPB 1GTHA 2BWFA 2JUOA 3ZTDA 4DHZE 3ZNZB 3RMKC 2KWUB 1XQQA 4ZRKA 4BKTA 3A1QA 4NJCA 2R61A 1G6JA 2DAJA 3UQBA 4NAWA 1WXAA 1L4DB 2R2QA 2YEPB 2WXHA 4KKIA 4ANXA 3KH0A 1JCKB 3N20C 1FEHA 4OW0A 4IUMB 5EE1A 2KQ4X 2J0MA 4NAMA 3IBEA 2V1YA 3R8BA 1ZUD2 2LRWA 1WGDA 2WX0A 3Q8AA 1ZE3D 5JHAA 4FHJA 3WALA 3WAPA 4B6WA 3PHXB 3Q6BA 4YXDB 3PHWB 4BKGA 2XK5B 2LUMA 5D6JB 3FILA 1ZGUB 2BWES 2IBIB 1WRDB 3OG5A 4OZCA 4CO7A 3DVGX 3ZRFA 4IC7B 1EWYC 1V1OA 1ENFA 4XDDA 2K1FA 3VDZA 3KYDD 3KUDB 3H7PA 2QDFA 4EE2A 4EZKA 4WQMA 3IT4B 4I6PA 2DZMA 1HTOA 2HJ1A 4HROA 4K7SA 1VCBA 1WXVA 2DZIA 1V2YA 3R2TA 3ZGZA 1JQ4A 1E5WA 3A9JA 4WAAA 1K53A 4ITKA 3BK2A 1PFDA 2SEBD 2WLBA 4KSKC 4II2B 2MA9B 2BB5A 2JVCA 2PJHA 5JZEB 5CHWA 2JYEA 4M00A 2GBJA 3RNAC 4AOFA 4YTMB 2L32A 2NR2A 2ASQA 2WXQA 5D7GA 4PS3A 3RUIB 2MBEA 4ZHOA 3RYTA 1WJNA 4IWQA 3EFUA 1XEEA 2IDYA 1CJEA 4N58A 4P1BC 3IAS1 1H7XA 3P1MA 2LD9A 5C1ZA 1DOYA 1HQRD 2MHJA 2L00B 3KWVA 1TZ1A 2Y5PA 3U7ZA 4FLHA 5E6JA 3PO0A 3Q3FA 4K7WA 2FCSA 2N7EA 3PRZA 2M56B 1PGBA 3I5JC 2KXJA 3JSVB 2WDQB 2WXGA 2RGFA 3AE8B 1SSNA 3ZDMC 2E3TA 4MSMB 2KD0A 3A4RA 2LVOA 5AEKB 2GI9A 3NUHB 1S1QB 1VDVA 1I4QA 2KWDA 4YL8A 4TQ0A 2KKCA 1K52A 2G45B 3AEDB 3APCA 2J4XA 3J9CA 3ETRA 3A9KB 3APFA 5LLIA 4YSXB 2MWSB 4K3CA 2PIAA 3Q8CA 1R4NB 1SB3C 1YQBA 3GE3C 3EECA 5DPTA 4F1SA 1STEA 3HIZA 4FJYA 3ZJVA 3U52E 2RDGA 1HZ5A 1FIQA 3PTFC 1D3ZA 4JIOU 4ZOHC 1UGJA 5BMGA 2NMQA 4KZCA 3ZO5B 2IJ0A 3WANA 4BVUC 4US8A 1E90A 1XXGA 3RI7C 2OHFA 3NZSA 1V1PB 3HUIA 2AQ1B 3RZWC 1L6UA 5H92C 3BVMA 3BZDB 1Q5WB 1WGKA 2KTRB 5D3DA 4ZYNA 1LO5D 1NENB 4GIVA 4JX1C 1MHXA 2M0XA 1MG4A 2LVPA 1WGGA 4RCOA 2EKIA 2J0JA 2G4SA 3AE4B 3HK0A 2CJNA 3PLVA 3ZLZA 1F2RI 4WURA 2DAFA 5AZHA 4PK1A 2QCZA 4JL9A 2A5UA 4MACA 4C80A 2B3AA 1KH0A 5AZFA 3QHTA 4E3CA 2LZ6A 4HRSA 1YOVB 2BQQA 3PSEB 2CR5A 2JY6A 5GMVA 3UIPB 2XEWA 3W5VB 2LVQA 2ZCCA 3B0AA 3M95A 4HJKA 2LGDA 1FRDA 5C3JB 1E8YA 1MHHE 5EE0A 4US9A 4IW0A 2L76A 3ENEA 2KFKB
chains in the Genus database with same CATH topology
5H8YE 4DXFA 1T3QA 4MM3B 2WXPA 1GB4A 2AQ2B 2BW2A 1VRAB 1NVID 2ICIA 2ON8A 3TEZA 2OEDA 2WQYB 1CZPA 1SE3A 3P4QB 4ARIA 1FO4A 2WXMA 1ET9A 3I57A 4WAFA 5I4DA 4UDUC 4TQ1A 4ZYSA 3VR8B 3AH7A 3EUB2 3Q69A 3AB5A 4TSSA 1D5XC 1J7BA 1YJIA 5AUKA 1MPEA 1ET6A 3FC4A 1KLGD 1C77A 3IAM1 4ZHPA 1FXAA 1XF5L 2VZKD 3LYYA 2WXNA 3TEYA 3DWGC 3ABVB 4JWUC 1FXIA 1YQ3B 1AYFA 2JSVX 5HI1A 1WRIA 4NAWB 1DGJA 1FNUA 3V05A 1GTEA 1FNVA 1C76A 1GT8A 4YWGG 1D5ZC 1PYWD 4HJGE 4RH6A 1KF6B 4RF0A 1I4XA 4A8XC 2N7JA 5T8IA 3H8HA 4GDKB 4YSYB 1D5MC 2J52A 2QILA 3AECB 1T5XD 1FM0D 2MH7A 5FK9C 4Q2JA 1JWAD 3CWIA 3Q8EA 1CK1A 3U4EG 3AE1B 1V1PA 3P42A 3AE7B 5BMHA 3W2DA 1JW9D 1KTKA 3E9SA 1JROA 2M19A 5BYQA 1RM6C 4FXCA 1SJED 5EE3A 1TKGA 2FE8A 2HDEA 3AEGB 4O1NA 3PZ7A 1HZ6A 1TZOA 4GDLB 2Q5WD 3MHZA 4D2KA 2LGIA 2X38A 3BVGA 1FNWA 1GAQB 2PKOA 1FMAD 3OWEB 1T6BX 2WXFA 1VZ6A 1SIJA 5LNK1 3AEBB 2KAJA 4JWSC 1F2RC 1L6VA 1QQRA 2WDRB 4WWMA 2Z8LA 1YJJA 4GLSC 5MPOA 3NVWA 2WXKA 3SEBA 1IBXA 3ZJUA 1WWTA 3ZYYX 3P4SB 2L1AA 1BXTA 1HXYD 1KRHA 2LEKA 4L23A 1QOBA 1P7EA 1QOAA 1KLUD 1C78A 2WDVB 4DXGA 2KDMA 2XNAC 2YEPF 2Y5CA 3MFGA 1QF6A 1ZXHA 4IDIA 2PVGC 3E56A 2H88B 2MJ3A 4PT5A 1D6EC 2MEKA 4XE0A 1GB1A 3T3NA 1JWUD 4OZBA 2KACA 4IKGA 1EU4A 3AE6B 1XLQA 1I4HA 3SR6A 1PUTA 1PGXA 2PLPA 4RGOS 1TS5A 3NS1A 2WXJA 3MC0B 3CIRB 3BIID 4OVZA 2G1EA 2QJLA 1ZXIA 1FCCC 1C4PA 4MH8A 4USAA 4A9AA 2KN4A 1BMLC 2J42A 2N9LA 1JWMD 1MVKA 1C4CA 3GS2A 3B2FA 1AW7A 1JWSD 5HG2A 4C7YA 2XN9C 4KGRA 3GP7A 4MT5A 1GTHA 2I38A 1GOZA 2K3UA 1YMHE 2CJOA 4YT0B 1XLPA 2FUG1 1YQ4B 3LXFA 2BYTA 4RF1A 4JE3B 1N5XA 4NJCA 2R61A 1L4ZB 1CQVA 2BBCA 1I4PA 5G5HA 1ZDXA 3P63A 4LLGM 2WXRA 1L4DB 4YTPB 1NI3A 1HEZE 2YEPB 3BYTB 2WXHA 4KKIA 1C9FA 2SAKA 1ZOYB 3MP9A 1JCKB 1E9MA 1B1ZA 1OQQA 1FEHA 2K5PA 4OW0A 5EE1A 3MJ5A 2WP9B 1RYJA 2KQ4X 3AEFB 5FR3A 2VZKB 1TYGB 1OQRA 2KMMA 2PTLA 4NAMA 5FKAC 2JWUA 3VRAB 1FFUA 4CQNA 2WNMA 4B0EA 1EU3A 3R8BA 1ZUD2 2GRIA 3Q8AA 3W9CB 1XCTL 1ZE3D 2QMTA 3SFDB 3SFEB 2BS3B 3O13A 2DLBA 4YXDB 1QKZA 1QLBB 1A70A 2PMVA 2E6XA 2DBYA 2WS3B 2CU3A 2LUMA 3ZJTA 1YN3A 2QEJC 3W5UB 3FILA 3NVVA 4OZCA 1QOFA 4A55A 3NZ3A 2V4IB 1EWYC 1V1OA 3TSSA 3FILB 1ENFA 5HHDG 4XDDA 1XLOA 3AE9B 4J3OD 1WYGA 4LK0M 1N5WA 2JZPA 4EE2A 1R7SA 3AE2B 4A90A 4WQMA 3IT4B 2IPKD 3AE3B 1L5PA 1VZ7A 2HTME 1FCLA 3NVZA 4HKQA 1ZP0B 4HROA 1EM7A 1YNTE 3R2TA 3ZGZA 3KQ4A 1JQ4A 4ZRPA 4RNAA 1K53A 1F0ZA 3I9V1 4ITKA 1Q10A 3BK2A 3B2GA 4RGNA 3KWLA 1TKYA 2BT6A 1SJHD 3AV8A 1PFDA 3WCQA 2SEBD 2B76B 1UNSA 1VR9A 1N60A 2WLBA 3BVZA 2WU5B 4RGTA 2LHDA 2BB5A 2LHEA 1JRPA 2WXIA 1BUIC 4NZLB 3Q8BA 2IGGA 2JYEA 1UWXA 4YTMB 1ZDVA 2L32A 4TMAB 1NEKB 2WXQA 4IOIE 5D7GA 1D4BA 1VJKA 2V3NA 1N61A 4KX6B 4L1BA 4ARCA 1FRRA 1SEBD 2Y3AA 3AEAB 2PVOD 4ZHOA 4RGMA 1N62A 5GXGB 1MI0A 1DOXA 1TS3A 1XO3A 2DYOA 2W54A 1XEEA 2IDYA 1K51A 2QSDA 1CJEA 4N58A 1PGAA 3IAS1 2AX5A 4C7ZA 1H7XA 2MJDA 3P1MA 4H2AA 3EA6A 2JU6X 1TY0A 1DOYA 1HQRD 2K22A 2JXTA 1TKEA 4N6EB 4WH4A 2FBWB 1TJEA 3KWVA 2Y5PA 1E6EB 1VLBA 2W3RA 3VR9B 3BK1A 5BMIA 3KLSX 3U7ZA 1IUEA 5E6JA 1WSPA 1QOGA 4L2YA 3PO0A 1SE2A 1XCQL 1I7HA 4AS1A 2JQRB 5G5GA 2M56B 1PGBA 2J53A 1C79A 2RDHA 3P4PB 2WDQB 2WXGA 2ZW1A 1QILA 3AE8B 1SSNA 1XLNA 3GB1A 3VRBB 1SF0A 2E3TA 2V3PA 2INNE 1QT9A 3B9JA 1K50A 4XDCA 5D3IB 2GI9A 1SE4A 2INPE 3NUHB 2LMCA 1VDVA 1I4QA 4KGTA 2KWDA 1E0ZA 3VQIA 4TQ0A 1NYQA 3ZQ4A 3RPFC 1K52A 2WXOA 3PZ8A 3IT6B 4YSZB 1V8CA 3NVYA 2G9HD 1IGDA 2NTSA 3AEDB 4REZA 1M4VA 3DWMA 2J4XA 5BYSA 2DYMA 3J9CA 1SBBB 3V3XA 2DWQA 3ETRA 2MJEA 3W1SA 1KFYB 4JPSA 1JALA 1TS4A 4YSXB 4XWTA 1V97A 2BTEA 1E7PB 3CF4A 2IGDA 2PIAA 3HVZA 3Q8CA 1SB3C 2NTTA 4LTUA 1IGCA 1SXTA 4ZRQA 4HKZE 2PW9A 1AN8A 3TUOA 3AEEB 2N0SB 2W82A 1Y56A 1P7FA 2W55A 5JXVA 1STEA 4KKJA 1B9RA 2RMMA 3NRZA 3ZJVA 1RFKA 3U52E 2RDGA 2JYTA 4N59A 1PDXA 1DYQA 1L0VB 1ESFA 1HZ5A 1FIQA 3EGRA 4ZOHC 5AUIA 5BYRA 1UGJA 5BMGA 2NMQA 1I4GA 1H7WA 2IJ0A 2LJIA 3N9YC 3URYA 4US8A 1XXGA 2OHFA 1L0YB 2WU2B 1V1PB 2H89B 2AQ1B 2EELA 3HUIA 4HEA1 3R2IA 2BS4B 3LB8C 4P6VF 1L6UA 3AMZA 3HVDA 5H92C 4DQOC 3BVMA 1JWBD 3BZDB 2N9KA 1WGKA 5D3DA 1LO5D 1DOIA 2RPVA 1NENB 5HFYA 1TY2A 1VZ8A 1ZPSA 1MHXA 2K9XA 3Q8FA 4JX1C 4M0WA 2L83A 4WIPA 1UUPA 2ONQA 3TEXA 4RCOA 2EKIA 1YN4A 2WXLA 4XWWA 2M0AA 4C56C 1J7CA 3BWUD 2K0PA 1ROEA 2W3SA 3AE4B 2L52A 2JX5A 2CJNA 4A6QA 1YN5A 1L0XB 4RFBA 3FAHA 1F2RI 3IXSA 2GB1A 4WURA 3AE5B 1ACCA 3T3OA 2TSSA 3RFZB 1FD6A 3TEWA 2AQ3B 2D5GA 4MACA 4C80A 1KH0A 1UWMA 3BYYB 5TSSA 1FFVA 1HA5A 1C4AA 2ZW0A 3AM9A 3L4PA 4P16A 1IBXB 4HRSA 4KGSA 2BS2B 2BB6A 1WXQA 4R3DA 1I4RA 4OHJA 1N63A 1F77A 1J7AA 1RWSA 2IGHA 3W5VB 3UI3A 4AQ7A 1E10A 2I2YA 3HRDD 1TS2A 4B0MA 1JMLA 1GPXA 2LFIA 1OFFA 4OZAA 1NYRA 5C2TB 3P4RB 2QIEB 3C8YA 1FRDA 4YTNB 5C3JB 1MHHE 3AN1A 5EE0A 5EE9A 1EWCA 2ACZB 4US9A 2V0GA 1AWDA 3U2SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H8Y E;  1T3Q A;  3AE9 B;  3DWM A;  1WYG A;  2Y5C A;  1N5W A;  1QF6 A;  1R7S A;  4IDI A;  3AE2 B;  2PVG C;  2DWQ A;  2H88 B;  2MJ3 A;  1NVI D;  3ETR A;  2MJE A;  4WQM A;  1KFY B;  1JAL A;  4YSX B;  1V97 A;  2WQY B;  3AE3 B;  1E7P B;  3P4Q B;  3CF4 A;  1CZP A;  1L5P A;  2HTM E;  2PIA A;  3HVZ A;  1FO4 A;  1SB3 C;  4LTU A;  3NVZ A;  1ZP0 B;  4HRO A;  3AE6 B;  3VR8 B;  1XLQ A;  3AEE B;  3AH7 A;  3EUB 2;  2N0S B;  3SR6 A;  2W55 A;  3AB5 A;  1PUT A;  1JQ4 A;  1B9R A;  3NS1 A;  1J7B A;  1YJI A;  5AUK A;  3CIR B;  3NRZ A;  1F0Z A;  1RFK A;  3BII D;  4ITK A;  3FC4 A;  4N59 A;  2G1E A;  2QJL A;  3B2G A;  1PDX A;  1L0V B;  1ZXI A;  3KWL A;  1FIQ A;  1TKY A;  2BT6 A;  3AV8 A;  1FXA A;  1PFD A;  4USA A;  3WCQ A;  2B76 B;  4ZOH C;  4A9A A;  4ZHP A;  1N60 A;  2WLB A;  3DWG C;  5AUI A;  3ABV B;  2WU5 B;  4JWU C;  1H7W A;  4US8 A;  1FXI A;  1YQ3 B;  2OHF A;  1AYF A;  3B2F A;  2WU2 B;  2H89 B;  3HUI A;  1JRP A;  4P6V F;  1WRI A;  2BS4 B;  1DGJ A;  3LB8 C;  1L6U A;  3AMZ A;  5H92 C;  1JWB D;  1GTE A;  4C7Y A;  1WGK A;  1GT8 A;  1GTH A;  4YTM B;  1NEK B;  1KF6 B;  1DOI A;  1NEN B;  1VJK A;  2CJO A;  4YT0 B;  1XLP A;  3LXF A;  1YQ4 B;  4JX1 C;  1N61 A;  4KX6 B;  2K9X A;  2L83 A;  1FRR A;  4YSY B;  1N5X A;  3AEA B;  2PVO D;  4ZHO A;  3AEC B;  1N62 A;  1FM0 D;  2MH7 A;  5GXG B;  2EKI A;  1JWA D;  3CWI A;  1DOX A;  1J7C A;  3AE1 B;  1ROE A;  1XO3 A;  5G5H A;  2W3S A;  3AE4 B;  3AE7 B;  2W54 A;  2L52 A;  3P63 A;  2JX5 A;  4YTP B;  2CJN A;  1JW9 D;  1CJE A;  1NI3 A;  4N58 A;  1JRO A;  2M19 A;  1ZOY B;  1RM6 C;  2AX5 A;  3FAH A;  1H7X A;  2MJD A;  3P1M A;  1E9M A;  1OQQ A;  2K5P A;  4FXC A;  4C7Z A;  3AE5 B;  5EE1 A;  1DOY A;  5EE3 A;  1TKG A;  2WP9 B;  1RYJ A;  2K22 A;  3AEF B;  1TKE A;  4N6E B;  1TYG B;  3AEG B;  4C80 A;  1UWM A;  2Q5W D;  1OQR A;  2KMM A;  2FBW B;  1TJE A;  1FFV A;  3AM9 A;  3VRA B;  3L4P A;  1FFU A;  1E6E B;  1GAQ B;  1VLB A;  3VR9 B;  2W3R A;  4HRS A;  2BS2 B;  1ZUD 2;  1IUE A;  1FMA D;  2PKO A;  1QOG A;  3W9C B;  3PO0 A;  1I7H A;  3SFD B;  3SFE B;  1WXQ A;  2JQR B;  5G5G A;  1N63 A;  2M56 B;  1J7A A;  1RWS A;  2BS3 B;  1SIJ A;  3W5V B;  1E10 A;  3AEB B;  2KAJ A;  3P4P B;  3HRD D;  4JWS C;  2WDQ B;  4YXD B;  1QLB B;  1A70 A;  1L6V A;  3AE8 B;  2WDR B;  1XLN A;  4WWM A;  1GPX A;  3VRB B;  1SF0 A;  2E3T A;  1YJJ A;  1QT9 A;  1OFF A;  2DBY A;  3B9J A;  2WS3 B;  2CU3 A;  1NYR A;  5C2T B;  3P4R B;  2QIE B;  3NVW A;  3W5U B;  5MPO A;  1FRD A;  3NVV A;  1QOF A;  1VDV A;  1E0Z A;  4YTN B;  5C3J B;  1WWT A;  3P4S B;  3AN1 A;  3ZYY X;  5EE0 A;  5EE9 A;  1NYQ A;  2ACZ B;  4US9 A;  1EWY C;  3RPF C;  1AWD A;  1KRH A;  2LEK A;  4YSZ B;  1V8C A;  3NVY A;  1QOB A;  1QOA A;  1XLO A;  2WDV B;  3AED B; 
#chains in the Genus database with same CATH topology
 5H8Y E;  4DXF A;  1T3Q A;  2UU7 A;  2WXP A;  5DCN A;  2BW2 A;  2ON8 A;  4P1C C;  4KV2 A;  4B9K A;  3NY5 A;  4ARI A;  5I4D A;  4II3 B;  2AL6 A;  3PLU A;  2KO3 A;  1UH6 A;  4TSS A;  5CHV C;  3RNF C;  1M94 A;  3VXW A;  1LXD A;  1X1M A;  4ZHP A;  1XF5 L;  3Q3J A;  5J2R A;  3DWG C;  3H9D A;  4JWU C;  4KDL B;  5TR5 A;  1FXI A;  1OEY J;  3OJ3 A;  2NBW B;  1FNU A;  3PRE A;  1V86 A;  4A3P A;  1PYW D;  3DVN U;  4RF0 A;  2MSE D;  4G50 A;  5T8I A;  4YSY B;  4E71 A;  3Q8E A;  1CK1 A;  3AE7 B;  1U4A A;  3O65 B;  2JPH A;  2M19 A;  2AWT A;  2MBO A;  1KM7 A;  1FPY A;  1N6Z A;  1TKG A;  1I35 A;  2KJH B;  4O1N A;  1E8W A;  1HZ6 A;  4GDL B;  3UF8 A;  3NS8 A;  3MHZ A;  2INC C;  4DDI D;  3ZKJ C;  2X38 A;  4K7U A;  1FNW A;  2DHZ A;  3OAW A;  3VFK A;  1V5O A;  2RDB C;  2WXF A;  1KLV A;  5LNK 1;  3JVZ X;  4KZ0 A;  4FBJ B;  1F2R C;  3QIJ A;  2WDR B;  4MEL A;  2MBH A;  4MGY E;  4HLE A;  3ZJU A;  1WWT A;  2IND C;  2RPQ A;  2L1A A;  1BXT A;  3VHT C;  4L23 A;  3V61 A;  2ZNV B;  1QOB A;  1QOA A;  3N1X C;  2WDV B;  4DHJ B;  2PVG C;  3E56 A;  1D6E C;  5IO9 A;  1WX7 A;  2FAZ A;  2NVU I;  1F9J A;  3SR6 A;  2WWZ A;  3NS1 A;  1GUA B;  4OVZ A;  2BPS A;  2PEA A;  2QJL A;  4XZ4 A;  1FCC C;  2KN4 A;  2WX1 A;  2D3B A;  2M17 A;  2J42 A;  2KQS A;  1C4C A;  4P7I A;  3WA0 A;  3A4S C;  3R3M A;  2AEH A;  1L2N A;  4K81 A;  4KGR A;  1T0Q C;  3QCA A;  1WJ6 A;  2K3U A;  2FUG 1;  3LXF A;  1YQ4 B;  4IWO A;  1WYW B;  1N5X A;  5CHF A;  1CMX B;  2C9W B;  1CQV A;  5C23 A;  2BBC A;  4FJV B;  1I4P A;  1TBE A;  3DHH C;  3OLM D;  2N1V A;  3P63 A;  2WXR A;  3PRP B;  1HEZ E;  3MP9 A;  3BIN A;  1YD8 U;  1B1Z A;  4K1R B;  4W9I A;  3MJ5 A;  1E8X A;  3AEF B;  2VZK B;  2FID A;  2KMA A;  1OQR A;  1FFU A;  4CQN A;  3C0R B;  1EU3 A;  4AJY B;  1XCT L;  2KVZ A;  3SFD B;  3SFE B;  1QLB B;  2NS5 A;  2EKE C;  4JGH B;  2PE9 A;  2YVC A;  2CU3 A;  2N4F A;  3W5U B;  1Q0W B;  2LAS A;  4WQO B;  3AE9 B;  4LK0 M;  2JZP A;  1R7S A;  2WGS A;  1WH3 A;  4KVG B;  4DBG A;  4LNF A;  1WJ4 A;  1FCL A;  4HKQ A;  4C4V B;  5LXH A;  1UF0 A;  2KJR A;  4RNA A;  4MJS B;  4NQL B;  2DZJ A;  3I9V 1;  4W9F A;  3MJW A;  1UGM A;  4RGN A;  3KWL A;  2BT6 A;  3AV8 A;  4M0W B;  2B76 B;  1VR9 A;  1N60 A;  2KHW B;  1WX9 A;  2C7N B;  1C3T A;  3VUX A;  4WWP A;  4A3O A;  1EUV B;  2IY1 B;  3AU5 A;  1ISN A;  1BUI C;  4NZL B;  1WE6 A;  1YX6 B;  2IGG A;  5E6O A;  1PQS A;  1ZDV A;  3NJT A;  1NEK B;  1VJK A;  1N61 A;  4L1B A;  1MG8 A;  2Y3A A;  2PVO D;  4RGM A;  5GXG B;  2KN5 A;  4CYE A;  2DYO A;  2ZZP B;  1K51 A;  3QJZ A;  3H1U A;  4XX5 A;  3RNE C;  1PGA A;  2AX5 A;  4C7Z A;  2D07 B;  3EA6 A;  1TY0 A;  2N9E B;  1TKE A;  3L08 A;  1NI2 A;  3Q14 C;  2NPT B;  2GBK A;  1LGR A;  2FBW B;  1TJE A;  4NPN A;  1E6E B;  1VLB A;  2W3R A;  3VR9 B;  1IUE A;  5JH5 C;  1WSP A;  4L2Y A;  1SE2 A;  1I7H A;  4AS1 A;  2JQR B;  5G5G A;  1A5R A;  2WYQ A;  1YX5 B;  1C79 A;  2RDH A;  3P4P B;  3IFW B;  2ZW1 A;  1QIL A;  3T8M A;  1XLN A;  4KDI C;  2MBQ A;  1SE4 A;  2INP E;  4TKN A;  3X23 A;  3KW5 B;  3ZQ4 A;  3RPF C;  4YSZ B;  4N9F 4;  3A9K A;  1IGD A;  3NHE B;  4HVB A;  5BYS A;  1WMH A;  2O2V B;  4CHK A;  3W1S A;  3ZXV A;  2D3G A;  4ASW C;  3QAR A;  2IGD A;  3HVZ A;  2RD0 A;  2NTT A;  4LTU A;  1SGH A;  3ZDT A;  2PW9 A;  1AN8 A;  3TUO A;  3AEE B;  2D10 A;  2W82 A;  4X57 B;  1Y56 A;  4ZDV A;  4S0R A;  3UIN B;  2RMM A;  2KTF A;  2IY0 B;  2BYE A;  4DDG D;  1DYQ A;  1L0V B;  1ESF A;  1KOT A;  4LJO B;  4PS7 A;  3DHI C;  3N9Y C;  5AZG A;  1EO6 A;  2WU2 B;  2BS4 B;  2XBB C;  4HWI B;  3Q3N C;  2N9K A;  2G4D B;  1OQY A;  4MDK E;  1V6E A;  4EUT A;  5HFY A;  3Q8F A;  2K9X A;  1J0G A;  1NDD A;  3GZN I;  2WXL A;  3TBL D;  2M0A A;  1J7C A;  1MJD A;  3ZVV A;  1ROE A;  4C00 A;  4A6Q A;  1YN5 A;  1L0X B;  4RFB A;  2N9X A;  1ACC A;  3T3O A;  2TSS A;  3TEW A;  2D5G A;  3VAW A;  3VTW A;  3BYY B;  5TSS A;  2FCN A;  2BF8 B;  2IO3 B;  2ZW0 A;  3AM9 A;  3H7S A;  4EOY A;  2DEN B;  3M3J A;  2BS2 B;  2BB6 A;  3EHV A;  4R3D A;  1I4R A;  1J7A A;  1RWS A;  2WHI A;  3UI3 A;  4B0M A;  1GJZ A;  1RLF A;  4BBN F;  5HKH A;  2LFI A;  3K9O B;  1V49 A;  3GOE A;  5C2T B;  3C8Y A;  3V60 A;  2KWV B;  3AN1 A;  1EWC A;  2V0G A;  1WJU A;  2MW5 A;  2ZEQ A;  2KDB A;  4MM3 B;  2O6V A;  3QAQ A;  5IOI A;  2K39 A;  4B95 A;  2ICI A;  1SE9 A;  4OVV A;  4WWN A;  3P4Q B;  2YLM A;  2FCM A;  3SHQ A;  4TQ1 A;  4ZYS A;  4DHZ B;  3WAO A;  3Q69 A;  2CU1 A;  2W9N A;  1J7B A;  2KNB A;  3D32 A;  4NY0 A;  1MPE A;  1ET6 A;  1KLG D;  4W9G A;  3ZW3 A;  3LYY A;  3TEY A;  5EDS A;  3A1Q B;  4HPL B;  4AUQ C;  4MGK E;  2RSU A;  5HI1 A;  1WRI A;  4NAW B;  2CHZ A;  4KSL C;  2KX3 A;  2C7M B;  4S17 A;  3QQ8 B;  1GTE A;  1FNV A;  3LJ3 A;  2MP2 A;  3W1Y A;  1D5Z C;  4HJG E;  4RH6 A;  2KAN A;  4F7Z A;  2JZ3 B;  2J52 A;  1GNU A;  2KDI A;  2KLG A;  3CWI A;  2Z59 B;  2Z0E B;  5BO4 B;  5BMH A;  1P3Q U;  5G2N A;  2AL3 A;  4GDL A;  3ZUN A;  1SJE D;  1F1H A;  1WM3 A;  2X8X X;  3RUL A;  2CHX A;  2OJR A;  1GAQ B;  2PKO A;  1YIW A;  3VH4 B;  5JHB A;  4FJZ A;  5LXI B;  4DXA B;  1T6B X;  3VUW A;  3R7Q A;  3AEB B;  1MFW A;  3ML8 A;  1QQR A;  3H7P B;  1WZ3 A;  2Z8L A;  2K25 A;  4JQW C;  5MPO A;  3NVW A;  2JF5 A;  1KJT A;  1Z2M A;  4G0N B;  2NCN A;  1IBX A;  3P4S B;  3UGB B;  5IKC M;  1P1A A;  1T0R C;  1WE7 A;  1C78 A;  3A9J B;  3M63 B;  3JYU A;  3KUC B;  2XNA C;  4DXG A;  2Y5C A;  4GMV A;  1QF6 A;  1ZXH A;  4IDI A;  2MEK A;  2UYZ B;  3DOW A;  2BKR B;  2KX0 A;  2AYO B;  3U7D A;  2LGY A;  2ZPN A;  1RRB A;  3AE6 B;  2CKH B;  2VRR B;  3B08 A;  2PLP A;  4RGO S;  2WXJ A;  2HD5 B;  3MC0 B;  5D94 A;  4EEW A;  1UEL A;  2G1E A;  2V9H A;  3JW0 X;  1C4P A;  4MH8 A;  4USA A;  4A9A A;  4AWJ A;  1BML C;  3L54 A;  1WY8 A;  4TV3 A;  2L3Z A;  4YT0 B;  2O6V D;  4RF1 A;  4JE3 B;  5L83 A;  2KFJ A;  1L4Z B;  5IA7 A;  3PV1 A;  2A4Z A;  5G5H A;  3DQV A;  4LLG M;  4YTP B;  4RMA A;  3V62 A;  1NI3 A;  2SAK A;  1E9M A;  1OQQ A;  1RYJ A;  5FR3 A;  4GDK A;  2PTL A;  5FKA C;  2JWU A;  3VRA B;  1IPG A;  2WNM A;  4B0E A;  4WWO A;  2QMT A;  3ZTC A;  3K9P B;  1Z5S B;  3WIM A;  1LM8 B;  3U8Z A;  2E6X A;  3TJP A;  2DBY A;  2ZPY A;  2JWZ A;  1YN3 A;  3NVV A;  2J7Q B;  1QOF A;  4A55 A;  3GE8 C;  3R66 C;  3FKY A;  5CTR C;  3NZ3 A;  4HK2 A;  4NJ7 A;  4J3O D;  5KHQ A;  2HE7 A;  4MH0 E;  3AE2 B;  3N3K B;  2IPK D;  4RM8 A;  2KC2 A;  1L5P A;  1VZ7 A;  2LRU A;  3NVZ A;  4W9K A;  1ZP0 B;  1YNT E;  3KQ4 A;  3VH3 B;  4BKS A;  4ANU A;  1WM2 A;  1Q10 A;  2UWQ A;  1TKY A;  1SJH D;  3WCQ A;  1UNS A;  3NG0 A;  3BVZ A;  3TIX A;  1T0S C;  1GG3 A;  1WF9 A;  1RAX A;  2OJW A;  3SD5 A;  1JRP A;  2WXI A;  2GBN A;  3Q8B A;  5E6P A;  3S2A A;  1K8R B;  3SU8 X;  4TMA B;  3IG3 A;  3DBL B;  3SDL C;  2N7D A;  4IOI E;  1WGY A;  2PPH A;  1FRR A;  3RNB C;  4G3X B;  1MI0 A;  1RFA A;  4KIK A;  4LNI A;  1TS3 A;  1V81 A;  3DBL I;  2W54 A;  2QSD A;  3PGE A;  2MJD A;  4H2A A;  3RNG C;  2JU6 X;  2QC8 A;  2K22 A;  3ZNG C;  4N6E B;  2REX A;  4BZA A;  1P0R A;  2KMC A;  4GSW A;  3BK1 A;  3KLS X;  1J8C A;  3L13 A;  4M01 A;  1WI0 A;  3NOB A;  3KVF B;  4NJ6 A;  3AUL A;  4NNJ B;  1JRU A;  3GB1 A;  2C60 A;  3VRB B;  1SF0 A;  4ACF A;  1QT9 A;  3B9J A;  4XDC A;  1E0Z A;  3VQI A;  5DPW A;  2ZCB A;  2M4N A;  1NYQ A;  1WX8 A;  3PVL A;  1R4M B;  2WXO A;  3PZ8 A;  4EZL A;  4BOZ B;  3DPD A;  3DWM A;  2JT4 B;  2VH2 A;  3B1L X;  4MSQ B;  2KVR A;  1KFY B;  4JPS A;  2XK5 A;  1V97 A;  2GOW A;  2BTE A;  1R4M I;  3L10 B;  2KWC A;  1IGC A;  4BAX A;  3EC8 A;  4LNK A;  4ZRQ A;  4HKZ E;  2KLC A;  1L7Y A;  1P7F A;  4KKJ A;  3L17 A;  1B9R A;  2KC1 A;  3NRZ A;  3UIO B;  1RFK A;  4N59 A;  2JYT A;  3R7R A;  4W9C A;  1PDX A;  2LJI A;  3DBH I;  3V6E B;  1L0Y B;  3DBR I;  4HEA 1;  2H89 B;  2EEL A;  4P6V F;  4DQO C;  2K8B A;  4LDT B;  1DOI A;  2RPV A;  4LCD E;  2FUH B;  4M8M A;  1TY2 A;  1VZ8 A;  1ZPS A;  4EKU A;  2CS4 A;  4FA6 A;  2L83 A;  1UUP A;  2ONQ A;  2DYB A;  5CX3 A;  1YN4 A;  4C56 C;  2NBV B;  3BWU D;  2K0P A;  3VTV A;  2L52 A;  2JX5 A;  2RR9 A;  3MTN B;  3IXS A;  2GB1 A;  2K8C A;  4BKS D;  4FAD A;  1FD6 A;  4IM0 A;  1HA5 A;  1C4A A;  2LJ5 A;  3L4P A;  4KGS A;  4WJN A;  4MGI E;  1WXQ A;  4ICV A;  4OHJ A;  4AQ7 A;  1TS2 A;  1GPX A;  1Y8R C;  1OFF A;  1J19 A;  1NYR A;  1UZX B;  2C5L C;  3DHG C;  2HJ8 A;  4DK5 A;  4YTN B;  5EE9 A;  3DCG A;  4HXD A;  3U2S C;  4GB9 A;  2ZVN A;  3JSV A;  1LQB A;  3BY4 B;  2MX2 A;  3RZF A;  1GB4 A;  1VRA B;  1NVI D;  2D11 A;  3N32 A;  3DVN V;  5E6N A;  1CZP A;  1FO4 A;  4W9J A;  1EF5 A;  4UDU C;  1FXT B;  4PYZ A;  3AH7 A;  3EUB 2;  4XYC A;  1D5X C;  5AUK A;  3FC4 A;  2I1K A;  1C77 A;  3DVG Y;  3HM6 X;  3IAM 1;  3RN9 C;  1FXA A;  1IP9 A;  2KZR A;  3ABV B;  1BT0 A;  1YQ3 B;  1AYF A;  2JSV X;  2LI5 A;  4GGQ A;  3A33 B;  4IM2 A;  3V05 A;  2MBB B;  2LWP A;  3U30 A;  1GT8 A;  4YWG G;  1TIF A;  3RD2 A;  3AI5 A;  2N7J A;  1YJ1 A;  1D5M C;  3AEC B;  1P9D U;  1FM0 D;  3MC8 A;  1JWA D;  4HDQ A;  1V1P A;  3P42 A;  4IWP A;  3W2D A;  1KTK A;  3E9S A;  1JRO A;  5BYQ A;  2KTR A;  1RM6 C;  2IO2 B;  1HTQ A;  1E7U A;  4BFR A;  2FE8 A;  3GZN B;  2HDE A;  1GC7 A;  4E74 A;  3PZ7 A;  1TZO A;  3IVF A;  3PPA A;  1FMA D;  3HM3 A;  3OWE B;  5J17 A;  1P98 A;  1VZ6 A;  3QWZ B;  2LGS A;  1LFD A;  2KAJ A;  4JWS C;  4FHK A;  4GLS C;  1UD7 A;  3SEB A;  3T9L A;  3ZYY X;  2LEK A;  3NZU A;  1P7E A;  1WR6 E;  1WIA A;  2YEP F;  3MFG A;  3CSF A;  2J0K A;  4JLC A;  4PT5 A;  4XE0 A;  3QC8 B;  2IO1 B;  1VD2 A;  2L0T A;  3T3N A;  4I6N B;  1C1Y B;  4NQK E;  3DBS A;  2KAC A;  4IKG A;  1F52 A;  2BYV E;  1I4H A;  3ECI A;  3N1Z C;  1PGX A;  1WR1 A;  2KFK A;  1TS5 A;  3GS2 A;  2IO0 B;  1AW7 A;  3QX1 A;  4ANV A;  2V3S A;  5FR6 A;  3VUY A;  4C7Y A;  3MC9 A;  3GP7 A;  4GN1 A;  2I38 A;  1GOZ A;  1UBI A;  1YMH E;  2CJO A;  1XLP A;  2BYT A;  2KDF B;  2OOB B;  3LDZ E;  4IM3 A;  1V9J A;  2DZK A;  3CMM B;  1ZDX A;  2LXA A;  3BYT B;  3HHM A;  1C9F A;  1IYF A;  1ZOY B;  2IYD B;  2K5P A;  2WP9 B;  1TYG B;  2DX5 B;  1WGR A;  4EZJ A;  2KMM A;  3RCZ A;  1Q1O A;  2GRI A;  3N1Y C;  4BBN C;  3W9C B;  3I3T B;  2BS3 B;  3O13 A;  2DLB A;  1QKZ A;  1A70 A;  3KYC D;  2PMV A;  1WMH B;  1GC6 A;  2WS3 B;  3ZJT A;  2QEJ C;  4OVU A;  1WXM A;  2KK8 A;  5IP4 D;  1R4N I;  2V4I B;  3ZNH B;  3TSS A;  3FIL B;  5HHD G;  1XLO A;  1H4R A;  2L8J A;  1WYG A;  4LNO A;  1N5W A;  4A90 A;  3L16 A;  2FNJ B;  4FN2 A;  3AE3 B;  2HTM E;  2MRP A;  3ALB A;  3Q3M C;  1EM7 A;  2M8S A;  3L0W B;  3PS6 A;  3X0W A;  4ZRP A;  5KHO A;  3V6C B;  1F0Z A;  2FCQ A;  2KQ7 A;  3B2G A;  3TL5 A;  5J18 A;  3Q3O C;  2WU5 B;  4RGT A;  2HTH A;  4EFO A;  2V4L A;  2LHD A;  2LHE A;  1I42 A;  3PT2 B;  4WJQ A;  1UWX A;  1D4B A;  3C19 A;  2V3N A;  3AXC A;  4ARC A;  4KX6 B;  3MHS D;  1SEB D;  1WGH A;  3AEA B;  4AJW A;  1N62 A;  1DOX A;  1XO3 A;  4HCN B;  4PYU A;  4BOS C;  2Z0D B;  3P2B A;  4F8C B;  2BVC A;  2KJ6 A;  2LUE A;  2JXT A;  3ZNI D;  2JRH A;  4WH4 A;  2L0F A;  2IZV B;  1S3S G;  4GOC A;  5BMI A;  3EFC A;  1QOG A;  1UBQ A;  1V5T A;  2DNF A;  3ZIM A;  4GU2 A;  1XCQ L;  2J53 A;  4WJO A;  4J6I A;  4W9E A;  5L95 C;  2O6V B;  2LXC A;  2V3P A;  1HE8 A;  2VH1 A;  2INN E;  1K50 A;  4ICU A;  5D3I B;  2LMC A;  4KGT A;  1V80 A;  2GBM A;  3IT6 B;  1V8C A;  3NVY A;  3WAM A;  2G9H D;  1H8C A;  2NTS A;  4REZ A;  2N1W A;  1M4V A;  2DYM A;  1SBB B;  3V3X A;  3APD A;  2DWQ A;  1TGZ B;  2MJE A;  3CST A;  2BGF A;  1JAL A;  1TS4 A;  4W9L A;  4XWT A;  1E7P B;  3CF4 A;  4M02 A;  2MLB A;  4XC2 A;  1SXT A;  4GXB A;  2N0S B;  2W55 A;  5JXV A;  2BKF A;  3VVW B;  2MP2 B;  3W1S C;  2GBR A;  3TCA A;  1OGW A;  3EGR A;  1ZKH A;  5AUI A;  2ZJD A;  4IG7 B;  5BYR A;  2K8H A;  4MGZ E;  3URY A;  1I4G A;  1H7W A;  3N30 A;  4W9H A;  4C4V A;  4M8N A;  3ML9 A;  3R2I A;  3LB8 C;  3AMZ A;  3HVD A;  1WZ0 A;  2G3Q B;  1JWB D;  2MCN B;  4MJS A;  3ZRC A;  4LJP B;  4URK A;  4M0W A;  2N9P C;  4WIP A;  1ZW7 A;  3TEX A;  4A20 A;  3UQA A;  4ZRI A;  2JRI B;  4XWW A;  2W3S A;  2D2Q A;  1E8Z A;  2JZZ A;  3I63 C;  3FAH A;  3AE5 B;  4DHJ D;  3RFZ B;  1EF1 A;  3M62 B;  2AQ3 B;  2QHO A;  2K6D B;  4PS8 A;  1UWM A;  2KDE B;  3H6N A;  1FFV A;  1OEY A;  3AU4 A;  4TUU A;  4P16 A;  2BYF A;  1IBX B;  3RT3 B;  2I1J A;  5DPS A;  1E10 A;  1N63 A;  1F77 A;  2IGH A;  2I2Y A;  3HRD D;  1TT5 B;  2KT7 A;  1JML A;  2NPT A;  2PE6 B;  4OZA A;  3P4R B;  2QIE B;  4I6L B;  4ZRJ A;  2JXX A;  4W9D A;  3IHP C;  2ACZ B;  2L7R A;  1AWD A;  2GLS A;  2M1M A;  2C7H A;  5IAA C;  1XT9 B;  2AQ2 B;  4QAY A;  3TEZ A;  2OED A;  4XGA B;  2WQY B;  1SE3 A;  2WXM A;  2GMI C;  1ET9 A;  3I57 A;  4WAF A;  3VR8 B;  2KYW A;  3AB5 A;  1OTR B;  1YJI A;  1QZE A;  2O2V A;  4LNN A;  4WJP A;  3VTU A;  1NBF C;  2VZK D;  3CF6 E;  2WXN A;  4ANW A;  4HDO A;  1DGJ A;  3DDC B;  3RNC C;  2D3A A;  1C76 A;  1WXS A;  4HPP A;  1KF6 B;  4AP4 C;  1I4X A;  2L05 A;  3DBH B;  4A8X C;  3H8H A;  4GDK B;  3DBR B;  2QIL A;  1T5X D;  2MH7 A;  5FK9 C;  4Q2J A;  3U4E G;  3AE1 B;  1SIF A;  4HCP B;  1JW9 D;  2NBU A;  2Y5B B;  5IN7 A;  4FXC A;  3Q2A C;  4MEM A;  5EE3 A;  3PZD A;  5DPR A;  3AEG B;  2Q5W D;  4D2K A;  2LGI A;  3QA8 A;  3BVG A;  1TTN A;  4LDT D;  5G55 A;  1SIJ A;  2CHW A;  2EMS A;  2WDT B;  1L6V A;  4FUL A;  4WWM A;  2K6Q A;  2ZVO A;  1YJJ A;  4DWF A;  1E7V A;  2LGX A;  2WXK A;  4G11 A;  2D3C A;  2FIF A;  3ZXR A;  1HXY D;  3QK0 A;  1T0Y A;  1KRH A;  3PRM B;  1KLU D;  2KDM A;  2EMT A;  4RM9 A;  2H88 B;  2MJ3 A;  2ZNV C;  3KUZ A;  1GB1 A;  1WFY A;  1XD3 B;  1JWU D;  5D2M B;  4OZB A;  3ONS A;  1EU4 A;  1XLQ A;  1PUT A;  2R2O A;  2MQJ A;  3CIR B;  4MM3 A;  3BII D;  4HPM B;  1ZXI A;  2N9L A;  1JWM D;  1MVK A;  4KIK B;  3B2F A;  2KOX A;  4K3B A;  1JWS D;  3OJ4 B;  1AAR A;  5HG2 A;  2XN9 C;  4MT5 A;  3TMP B;  1GTH A;  2BWF A;  2JUO A;  3ZTD A;  4DHZ E;  3ZNZ B;  3RMK C;  2KWU B;  1XQQ A;  4ZRK A;  4BKT A;  3A1Q A;  4NJC A;  2R61 A;  1G6J A;  2DAJ A;  3UQB A;  4NAW A;  1WXA A;  1L4D B;  2R2Q A;  2YEP B;  2WXH A;  4KKI A;  4ANX A;  3KH0 A;  1JCK B;  3N20 C;  1FEH A;  4OW0 A;  4IUM B;  5EE1 A;  2KQ4 X;  2J0M A;  4NAM A;  3IBE A;  2V1Y A;  3R8B A;  1ZUD 2;  2LRW A;  1WGD A;  2WX0 A;  3Q8A A;  1ZE3 D;  5JHA A;  4FHJ A;  3WAL A;  3WAP A;  4B6W A;  3PHX B;  3Q6B A;  4YXD B;  3PHW B;  4BKG A;  2XK5 B;  2LUM A;  5D6J B;  3FIL A;  1ZGU B;  2BWE S;  2IBI B;  1WRD B;  3OG5 A;  4OZC A;  4CO7 A;  3DVG X;  3ZRF A;  4IC7 B;  1EWY C;  1V1O A;  1ENF A;  4XDD A;  2K1F A;  3VDZ A;  3KYD D;  3KUD B;  3H7P A;  2QDF A;  4EE2 A;  4EZK A;  4WQM A;  3IT4 B;  4I6P A;  2DZM A;  1HTO A;  2HJ1 A;  4HRO A;  4K7S A;  1VCB A;  1WXV A;  2DZI A;  1V2Y A;  3R2T A;  3ZGZ A;  1JQ4 A;  1E5W A;  3A9J A;  4WAA A;  1K53 A;  4ITK A;  3BK2 A;  1PFD A;  2SEB D;  2WLB A;  4KSK C;  4II2 B;  2MA9 B;  2BB5 A;  2JVC A;  2PJH A;  5JZE B;  5CHW A;  2JYE A;  4M00 A;  2GBJ A;  3RNA C;  4AOF A;  4YTM B;  2L32 A;  2NR2 A;  2ASQ A;  2WXQ A;  5D7G A;  4PS3 A;  3RUI B;  2MBE A;  4ZHO A;  3RYT A;  1WJN A;  4IWQ A;  3EFU A;  1XEE A;  2IDY A;  1CJE A;  4N58 A;  4P1B C;  3IAS 1;  1H7X A;  3P1M A;  2LD9 A;  5C1Z A;  1DOY A;  1HQR D;  2MHJ A;  2L00 B;  3KWV A;  1TZ1 A;  2Y5P A;  3U7Z A;  4FLH A;  5E6J A;  3PO0 A;  3Q3F A;  4K7W A;  2FCS A;  2N7E A;  3PRZ A;  2M56 B;  1PGB A;  3I5J C;  2KXJ A;  3JSV B;  2WDQ B;  2WXG A;  2RGF A;  3AE8 B;  1SSN A;  3ZDM C;  2E3T A;  4MSM B;  2KD0 A;  3A4R A;  2LVO A;  5AEK B;  2GI9 A;  3NUH B;  1S1Q B;  1VDV A;  1I4Q A;  2KWD A;  4YL8 A;  4TQ0 A;  2KKC A;  1K52 A;  2G45 B;  3AED B;  3APC A;  2J4X A;  3J9C A;  3ETR A;  3A9K B;  3APF A;  5LLI A;  4YSX B;  2MWS B;  4K3C A;  2PIA A;  3Q8C A;  1R4N B;  1SB3 C;  1YQB A;  3GE3 C;  3EEC A;  5DPT A;  4F1S A;  1STE A;  3HIZ A;  4FJY A;  3ZJV A;  3U52 E;  2RDG A;  1HZ5 A;  1FIQ A;  3PTF C;  1D3Z A;  4JIO U;  4ZOH C;  1UGJ A;  5BMG A;  2NMQ A;  4KZC A;  3ZO5 B;  2IJ0 A;  3WAN A;  4BVU C;  4US8 A;  1E90 A;  1XXG A;  3RI7 C;  2OHF A;  3NZS A;  1V1P B;  3HUI A;  2AQ1 B;  3RZW C;  1L6U A;  5H92 C;  3BVM A;  3BZD B;  1Q5W B;  1WGK A;  2KTR B;  5D3D A;  4ZYN A;  1LO5 D;  1NEN B;  4GIV A;  4JX1 C;  1MHX A;  2M0X A;  1MG4 A;  2LVP A;  1WGG A;  4RCO A;  2EKI A;  2J0J A;  2G4S A;  3AE4 B;  3HK0 A;  2CJN A;  3PLV A;  3ZLZ A;  1F2R I;  4WUR A;  2DAF A;  5AZH A;  4PK1 A;  2QCZ A;  4JL9 A;  2A5U A;  4MAC A;  4C80 A;  2B3A A;  1KH0 A;  5AZF A;  3QHT A;  4E3C A;  2LZ6 A;  4HRS A;  1YOV B;  2BQQ A;  3PSE B;  2CR5 A;  2JY6 A;  5GMV A;  3UIP B;  2XEW A;  3W5V B;  2LVQ A;  2ZCC A;  3B0A A;  3M95 A;  4HJK A;  2LGD A;  1FRD A;  5C3J B;  1E8Y A;  1MHH E;  5EE0 A;  4US9 A;  4IW0 A;  2L76 A;  3ENE A;  2KFK B; 
#chains in the Genus database with same CATH homology
 5H8Y E;  4DXF A;  1T3Q A;  4MM3 B;  2WXP A;  1GB4 A;  2AQ2 B;  2BW2 A;  1VRA B;  1NVI D;  2ICI A;  2ON8 A;  3TEZ A;  2OED A;  2WQY B;  1CZP A;  1SE3 A;  3P4Q B;  4ARI A;  1FO4 A;  2WXM A;  1ET9 A;  3I57 A;  4WAF A;  5I4D A;  4UDU C;  4TQ1 A;  4ZYS A;  3VR8 B;  3AH7 A;  3EUB 2;  3Q69 A;  3AB5 A;  4TSS A;  1D5X C;  1J7B A;  1YJI A;  5AUK A;  1MPE A;  1ET6 A;  3FC4 A;  1KLG D;  1C77 A;  3IAM 1;  4ZHP A;  1FXA A;  1XF5 L;  2VZK D;  3LYY A;  2WXN A;  3TEY A;  3DWG C;  3ABV B;  4JWU C;  1FXI A;  1YQ3 B;  1AYF A;  2JSV X;  5HI1 A;  1WRI A;  4NAW B;  1DGJ A;  1FNU A;  3V05 A;  1GTE A;  1FNV A;  1C76 A;  1GT8 A;  4YWG G;  1D5Z C;  1PYW D;  4HJG E;  4RH6 A;  1KF6 B;  4RF0 A;  1I4X A;  4A8X C;  2N7J A;  5T8I A;  3H8H A;  4GDK B;  4YSY B;  1D5M C;  2J52 A;  2QIL A;  3AEC B;  1T5X D;  1FM0 D;  2MH7 A;  5FK9 C;  4Q2J A;  1JWA D;  3CWI A;  3Q8E A;  1CK1 A;  3U4E G;  3AE1 B;  1V1P A;  3P42 A;  3AE7 B;  5BMH A;  3W2D A;  1JW9 D;  1KTK A;  3E9S A;  1JRO A;  2M19 A;  5BYQ A;  1RM6 C;  4FXC A;  1SJE D;  5EE3 A;  1TKG A;  2FE8 A;  2HDE A;  3AEG B;  4O1N A;  3PZ7 A;  1HZ6 A;  1TZO A;  4GDL B;  2Q5W D;  3MHZ A;  4D2K A;  2LGI A;  2X38 A;  3BVG A;  1FNW A;  1GAQ B;  2PKO A;  1FMA D;  3OWE B;  1T6B X;  2WXF A;  1VZ6 A;  1SIJ A;  5LNK 1;  3AEB B;  2KAJ A;  4JWS C;  1F2R C;  1L6V A;  1QQR A;  2WDR B;  4WWM A;  2Z8L A;  1YJJ A;  4GLS C;  5MPO A;  3NVW A;  2WXK A;  3SEB A;  1IBX A;  3ZJU A;  1WWT A;  3ZYY X;  3P4S B;  2L1A A;  1BXT A;  1HXY D;  1KRH A;  2LEK A;  4L23 A;  1QOB A;  1P7E A;  1QOA A;  1KLU D;  1C78 A;  2WDV B;  4DXG A;  2KDM A;  2XNA C;  2YEP F;  2Y5C A;  3MFG A;  1QF6 A;  1ZXH A;  4IDI A;  2PVG C;  3E56 A;  2H88 B;  2MJ3 A;  4PT5 A;  1D6E C;  2MEK A;  4XE0 A;  1GB1 A;  3T3N A;  1JWU D;  4OZB A;  2KAC A;  4IKG A;  1EU4 A;  3AE6 B;  1XLQ A;  1I4H A;  3SR6 A;  1PUT A;  1PGX A;  2PLP A;  4RGO S;  1TS5 A;  3NS1 A;  2WXJ A;  3MC0 B;  3CIR B;  3BII D;  4OVZ A;  2G1E A;  2QJL A;  1ZXI A;  1FCC C;  1C4P A;  4MH8 A;  4USA A;  4A9A A;  2KN4 A;  1BML C;  2J42 A;  2N9L A;  1JWM D;  1MVK A;  1C4C A;  3GS2 A;  3B2F A;  1AW7 A;  1JWS D;  5HG2 A;  4C7Y A;  2XN9 C;  4KGR A;  3GP7 A;  4MT5 A;  1GTH A;  2I38 A;  1GOZ A;  2K3U A;  1YMH E;  2CJO A;  4YT0 B;  1XLP A;  2FUG 1;  1YQ4 B;  3LXF A;  2BYT A;  4RF1 A;  4JE3 B;  1N5X A;  4NJC A;  2R61 A;  1L4Z B;  1CQV A;  2BBC A;  1I4P A;  5G5H A;  1ZDX A;  3P63 A;  4LLG M;  2WXR A;  1L4D B;  4YTP B;  1NI3 A;  1HEZ E;  2YEP B;  3BYT B;  2WXH A;  4KKI A;  1C9F A;  2SAK A;  1ZOY B;  3MP9 A;  1JCK B;  1E9M A;  1B1Z A;  1OQQ A;  1FEH A;  2K5P A;  4OW0 A;  5EE1 A;  3MJ5 A;  2WP9 B;  1RYJ A;  2KQ4 X;  3AEF B;  5FR3 A;  2VZK B;  1TYG B;  1OQR A;  2KMM A;  2PTL A;  4NAM A;  5FKA C;  2JWU A;  3VRA B;  1FFU A;  4CQN A;  2WNM A;  4B0E A;  1EU3 A;  3R8B A;  1ZUD 2;  2GRI A;  3Q8A A;  3W9C B;  1XCT L;  1ZE3 D;  2QMT A;  3SFD B;  3SFE B;  2BS3 B;  3O13 A;  2DLB A;  4YXD B;  1QKZ A;  1QLB B;  1A70 A;  2PMV A;  2E6X A;  2DBY A;  2WS3 B;  2CU3 A;  2LUM A;  3ZJT A;  1YN3 A;  2QEJ C;  3W5U B;  3FIL A;  3NVV A;  4OZC A;  1QOF A;  4A55 A;  3NZ3 A;  2V4I B;  1EWY C;  1V1O A;  3TSS A;  3FIL B;  1ENF A;  5HHD G;  4XDD A;  1XLO A;  3AE9 B;  4J3O D;  1WYG A;  4LK0 M;  1N5W A;  2JZP A;  4EE2 A;  1R7S A;  3AE2 B;  4A90 A;  4WQM A;  3IT4 B;  2IPK D;  3AE3 B;  1L5P A;  1VZ7 A;  2HTM E;  1FCL A;  3NVZ A;  4HKQ A;  1ZP0 B;  4HRO A;  1EM7 A;  1YNT E;  3R2T A;  3ZGZ A;  3KQ4 A;  1JQ4 A;  4ZRP A;  4RNA A;  1K53 A;  1F0Z A;  3I9V 1;  4ITK A;  1Q10 A;  3BK2 A;  3B2G A;  4RGN A;  3KWL A;  1TKY A;  2BT6 A;  1SJH D;  3AV8 A;  1PFD A;  3WCQ A;  2SEB D;  2B76 B;  1UNS A;  1VR9 A;  1N60 A;  2WLB A;  3BVZ A;  2WU5 B;  4RGT A;  2LHD A;  2BB5 A;  2LHE A;  1JRP A;  2WXI A;  1BUI C;  4NZL B;  3Q8B A;  2IGG A;  2JYE A;  1UWX A;  4YTM B;  1ZDV A;  2L32 A;  4TMA B;  1NEK B;  2WXQ A;  4IOI E;  5D7G A;  1D4B A;  1VJK A;  2V3N A;  1N61 A;  4KX6 B;  4L1B A;  4ARC A;  1FRR A;  1SEB D;  2Y3A A;  3AEA B;  2PVO D;  4ZHO A;  4RGM A;  1N62 A;  5GXG B;  1MI0 A;  1DOX A;  1TS3 A;  1XO3 A;  2DYO A;  2W54 A;  1XEE A;  2IDY A;  1K51 A;  2QSD A;  1CJE A;  4N58 A;  1PGA A;  3IAS 1;  2AX5 A;  4C7Z A;  1H7X A;  2MJD A;  3P1M A;  4H2A A;  3EA6 A;  2JU6 X;  1TY0 A;  1DOY A;  1HQR D;  2K22 A;  2JXT A;  1TKE A;  4N6E B;  4WH4 A;  2FBW B;  1TJE A;  3KWV A;  2Y5P A;  1E6E B;  1VLB A;  2W3R A;  3VR9 B;  3BK1 A;  5BMI A;  3KLS X;  3U7Z A;  1IUE A;  5E6J A;  1WSP A;  1QOG A;  4L2Y A;  3PO0 A;  1SE2 A;  1XCQ L;  1I7H A;  4AS1 A;  2JQR B;  5G5G A;  2M56 B;  1PGB A;  2J53 A;  1C79 A;  2RDH A;  3P4P B;  2WDQ B;  2WXG A;  2ZW1 A;  1QIL A;  3AE8 B;  1SSN A;  1XLN A;  3GB1 A;  3VRB B;  1SF0 A;  2E3T A;  2V3P A;  2INN E;  1QT9 A;  3B9J A;  1K50 A;  4XDC A;  5D3I B;  2GI9 A;  1SE4 A;  2INP E;  3NUH B;  2LMC A;  1VDV A;  1I4Q A;  4KGT A;  2KWD A;  1E0Z A;  3VQI A;  4TQ0 A;  1NYQ A;  3ZQ4 A;  3RPF C;  1K52 A;  2WXO A;  3PZ8 A;  3IT6 B;  4YSZ B;  1V8C A;  3NVY A;  2G9H D;  1IGD A;  2NTS A;  3AED B;  4REZ A;  1M4V A;  3DWM A;  2J4X A;  5BYS A;  2DYM A;  3J9C A;  1SBB B;  3V3X A;  2DWQ A;  3ETR A;  2MJE A;  3W1S A;  1KFY B;  4JPS A;  1JAL A;  1TS4 A;  4YSX B;  4XWT A;  1V97 A;  2BTE A;  1E7P B;  3CF4 A;  2IGD A;  2PIA A;  3HVZ A;  3Q8C A;  1SB3 C;  2NTT A;  4LTU A;  1IGC A;  1SXT A;  4ZRQ A;  4HKZ E;  2PW9 A;  1AN8 A;  3TUO A;  3AEE B;  2N0S B;  2W82 A;  1Y56 A;  1P7F A;  2W55 A;  5JXV A;  1STE A;  4KKJ A;  1B9R A;  2RMM A;  3NRZ A;  3ZJV A;  1RFK A;  3U52 E;  2RDG A;  2JYT A;  4N59 A;  1PDX A;  1DYQ A;  1L0V B;  1ESF A;  1HZ5 A;  1FIQ A;  3EGR A;  4ZOH C;  5AUI A;  5BYR A;  1UGJ A;  5BMG A;  2NMQ A;  1I4G A;  1H7W A;  2IJ0 A;  2LJI A;  3N9Y C;  3URY A;  4US8 A;  1XXG A;  2OHF A;  1L0Y B;  2WU2 B;  1V1P B;  2H89 B;  2AQ1 B;  2EEL A;  3HUI A;  4HEA 1;  3R2I A;  2BS4 B;  3LB8 C;  4P6V F;  1L6U A;  3AMZ A;  3HVD A;  5H92 C;  4DQO C;  3BVM A;  1JWB D;  3BZD B;  2N9K A;  1WGK A;  5D3D A;  1LO5 D;  1DOI A;  2RPV A;  1NEN B;  5HFY A;  1TY2 A;  1VZ8 A;  1ZPS A;  1MHX A;  2K9X A;  3Q8F A;  4JX1 C;  4M0W A;  2L83 A;  4WIP A;  1UUP A;  2ONQ A;  3TEX A;  4RCO A;  2EKI A;  1YN4 A;  2WXL A;  4XWW A;  2M0A A;  4C56 C;  1J7C A;  3BWU D;  2K0P A;  1ROE A;  2W3S A;  3AE4 B;  2L52 A;  2JX5 A;  2CJN A;  4A6Q A;  1YN5 A;  1L0X B;  4RFB A;  3FAH A;  1F2R I;  3IXS A;  2GB1 A;  4WUR A;  3AE5 B;  1ACC A;  3T3O A;  2TSS A;  3RFZ B;  1FD6 A;  3TEW A;  2AQ3 B;  2D5G A;  4MAC A;  4C80 A;  1KH0 A;  1UWM A;  3BYY B;  5TSS A;  1FFV A;  1HA5 A;  1C4A A;  2ZW0 A;  3AM9 A;  3L4P A;  4P16 A;  1IBX B;  4HRS A;  4KGS A;  2BS2 B;  2BB6 A;  1WXQ A;  4R3D A;  1I4R A;  4OHJ A;  1N63 A;  1F77 A;  1J7A A;  1RWS A;  2IGH A;  3W5V B;  3UI3 A;  4AQ7 A;  1E10 A;  2I2Y A;  3HRD D;  1TS2 A;  4B0M A;  1JML A;  1GPX A;  2LFI A;  1OFF A;  4OZA A;  1NYR A;  5C2T B;  3P4R B;  2QIE B;  3C8Y A;  1FRD A;  4YTN B;  5C3J B;  1MHH E;  3AN1 A;  5EE0 A;  5EE9 A;  1EWC A;  2ACZ B;  4US9 A;  2V0G A;  1AWD A;  3U2S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...