3AE3B

Crystal structure of porcine heart mitochondrial complex ii bound with 2-nitro-n-phenyl-benzamide
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Nitro-N-phenyl-benzamide
rcsb
total genus 63
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae3B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae3B01
1JW9D 2MJEA 3B9JA 4WQMA 3SFEB 1J7BA 1XO3A 1T3QA 3AE7B 3ZYYX 1AWDA 3AM9A 1SB3C 2AX5A 1E6EB 3AH7A 2LEKA 3BIID 1GPXA 3AE5B 1R7SA 4FXCA 2WS3B 1N5XA 1TKEA 1N62A 2DBYA 1E9MA 1FXIA 4US9A 3VRBB 1GAQB 1QOGA 3L4PA 1KF6B 3AEAB 3AEFB 5H8YE 1E7PB 2W3RA 1L0VB 1WXQA 3EUB2 3NVVA 3HUIA 2WDRB 2CU3A 1J7AA 1RWSA 2FBWB 1XLNA 2OHFA 2Y5CA 1PFDA 3B2FA 3DWGC 4N59A 4YSYB 3P4QB 2WDQB 1OFFA 3VRAB 1QOAA 3CF4A 1FMAD 3CWIA 3NVWA 2H88B 4JWSC 1JQ4A 1V97A 3AE8B 1QOBA 1QT9A 1DGJA 2Q5WD 2WLBA 4HRSA 1ZOYB 1ZP0B 1SF0A 1YJIA 3B2GA 1N5WA 3AV8A 2K5PA 3P1MA 5EE9A 3AE1B 4YT0B 1FM0D 2BS4B 2H89B 4ZHPA 3W5UB 3AEBB 3AE3B 3WCQA 1FFUA 2PKOA 4USAA 3AE2B 2WQYB 5C3JB 1NVID 1QOFA 2M19A 1XLOA 2MJ3A 1L6VA 3CIRB 2MJDA 1WGKA 5G5HA 5GXGB 1V8CA 1FO4A 1KFYB 1N63A 1YJJA 5MPOA 2WP9B 1L6UA 1NI3A 1F0ZA 2JX5A 2KMMA 1YQ3B 2BT6A 4US8A 3P4PB 2WU5B 2G1EA 4ITKA 4HROA 4N58A 2PVOD 3NVZA 3W5VB 3LB8C 2HTME 1J7CA 1DOXA 1ZUD2 2N0SB 1DOYA 1PUTA 2K9XA 1VDVA 2BS3B 1JALA 4C7ZA 1YQ4B 2MH7A 3AB5A 3LXFA 1XLQA 1ROEA 4KX6B 4YSZB 1WWTA 2W55A 1GTHA 1NENB 1N61A 1GT8A 2PIAA 4YSXB 3AMZA 4YTPB 3P63A 1QLBB 1WYGA 3ABVB 1L5PA 2W3SA 1PDXA 2L83A 3NRZA 3NS1A 2BS2B 2WU2B 1VLBA 3AECB 3AE9B 1QF6A 2PVGC 1EWYC 1FIQA 2B76B 5C2TB 1RFKA 1JRPA 1A70A 1FFVA 4C80A 1TJEA 5G5GA 2ACZB 2WDVB 3AE4B 3AEEB 2K22A 4YTNB 4A9AA 4ZHOA 2W54A 3NVYA 1TKGA 4JX1C 2JQRB 4C7YA 2CJOA 1FXAA 2QJLA 1RYJA 2M56B 1NEKB 3ETRA 1H7XA 4IDIA 1TKYA 1RM6C 1SIJA 1WRIA 1E0ZA 1I7HA 1B9RA 1UWMA 1IUEA 1JWAD 4LTUA 5EE0A 1OQQA 4P6VF 1VJKA 4ZOHC 3KWLA 1XLPA 3AN1A 2CJNA 1AYFA 3AE6B 2EKIA 1CJEA 3FAHA 1FRRA 1OQRA 4JWUC 5EE3A 1TYGB 5EE1A 2L52A 5AUIA 4WWMA 1JWBD 1KRHA 3AEDB 1DOIA 1H7WA 3VR8B 3SR6A 3PO0A 3P4SB 1FRDA 4N6EB 1NYQA 1ZXIA 2KAJA 1NYRA 3P4RB 1JROA 1E10A 5AUKA 3HVZA 2E3TA 4YTMB 3W9CB 3VR9B 4YXDB 2DWQA 3FC4A 5H92C 2QIEB 3RPFC 1GTEA 3SFDB 3AEGB 3HRDD 3DWMA 1CZPA 1N60A
chains in the Genus database with same CATH superfamily
1SIFA 2LD9A 3ZLZA 1WGRA 3M95A 5IKCM 3LJ3A 2IJ0A 1DYQA 3AH7A 4FXCA 4FLHA 3DVNU 1N62A 4YL8A 4AP4C 2VH2A 4M02A 1R4NI 2J4XA 3BZDB 2DX5B 1SE4A 3P4QB 4JWSC 3VXWA 4RGMA 2JXTA 1VZ8A 2PTLA 4ANVA 1SF0A 4EZLA 2KHWB 2L8JA 5HKHA 2LGIA 3RZFA 2JYEA 5E6JA 3RYTA 2L0TA 1L4ZB 4LNNA 3HM6X 1I4QA 5JZEB 2FE8A 4B0EA 2XEWA 1B1ZA 2L7RA 4ITKA 3L10B 1K51A 3RULA 4CHKA 1J7CA 3V61A 1DOYA 1V1PA 2EELA 4RM8A 2JY6A 2I1JA 4XWWA 2JXXA 1MG8A 2PMVA 2KYWA 4JQWC 2Y5PA 4MEMA 5BYRA 4TQ1A 2LFIA 2A5UA 1XXGA 1UNSA 4C80A 2QC8A 1Z5SB 3UF8A 3WA0A 1LO5D 3IVFA 1D5XC 1YX5B 4PS3A 5JXVA 3PRMB 3IHPC 1H4RA 1LGRA 4LTUA 1XCQL 3JSVA 1D3ZA 5IA7A 2LASA 3KYDD 3QQ8B 5KHOA 2PPHA 3UQBA 4N6EB 2KAJA 3P4RB 3RZWC 3Q69A 2NR2A 1LQBA 2MLBA 2J0MA 4IW0A 2IO2B 1M94A 1ZXHA 1J7BA 1K8RB 1T6BX 3IAS1 2AX5A 3A1QA 1GUAB 2IO0B 2WXPA 1V5OA 1P98A 2D5GA 3AEAB 3I3TB 3HIZA 3OJ3A 3Q3MC 2CU3A 3WALA 1V80A 5LXHA 2KWUB 2KC2A 4ZRPA 3VRAB 5L95C 3P42A 2HTHA 3N32A 2BYTA 4KVGB 2IGGA 1ZP0B 1N5WA 2KZRA 4WWOA 2WQYB 2R61A 4BKTA 1EU3A 2JU6X 1KOTA 2OJRA 1YQ3B 1WJUA 2JF5A 3Q14C 2KQ4X 1UELA 1UWXA 2QEJC 2LGYA 1V1PB 2PIAA 3DHHC 4A55A 2W3SA 3JYUA 2IYDB 1YNTE 2ZVNA 4WWPA 4HJKA 1A70A 4XDCA 1C78A 1LM8B 2MRPA 4GDLA 2CJOA 2KDMA 3NZSA 2MW5A 2WXMA 3Q6BA 2J7QB 4PT5A 1GOZA 2K1FA 2WXNA 3HVDA 3MP9A 2DHZA 2KMAA 2LWPA 4DDID 4K7UA 4IM0A 1I4RA 2DWQA 2QIEB 3SEBA 3C8YA 3PZ8A 2KT7A 1L0XB 1AWDA 4E74A 1L4DB 4OW0A 1D6EC 4KV2A 4BOZB 5DPRA 3L08A 2ZCCA 4C4VA 1WXAA 2Y5CA 3RMKC 2FBWB 1QKZA 2LUMA 3NVWA 1JQ4A 3EHVA 4RGOS 2IBIB 3DVNV 3Q3OC 2YEPF 4GDKA 1WMHB 4B95A 1YN4A 5IAAC 1L6VA 3HK0A 2HDEA 2N7DA 3PS6A 1I4PA 4XE0A 1SE3A 1PYWD 5CHFA 4S17A 2G4DB 1PUTA 1T0SC 3NG0A 1D5ZC 3BWUD 1GT8A 3ZO5B 2NVUI 2L83A 3NRZA 2K6DB 1QF6A 2B3AA 3BK2A 4X57B 2B76B 1R4MB 3MJ5A 1FFVA 2WDVB 2KKCA 3MHSD 2MHJA 4NAWA 4ZHOA 1C79A 3L16A 1V49A 3U52E 1AARA 4KIKA 4DK5A 3UIPB 4LNFA 4GDLB 4NZLB 2ZNVB 4W9FA 1JWAD 1P0RA 1WSPA 4KSKC 2M8SA 5CHVC 3RNEC 4TKNA 4I6NB 1FRRA 3N1YC 1JWBD 1DOIA 3P4SB 2RSUA 1HZ5A 3O13A 3D32A 2KX0A 3QIJA 3RFZB 2MSED 3Q8BA 2LEKA 1BUIC 3ZNHB 2NBUA 4ASWC 1WJ6A 4US9A 1XLNA 1ZDXA 2AQ1B 3IAM1 4PYUA 4RFBA 3ZTCA 2GBMA 4AS1A 3GE8C 5EE9A 3U7DA 4FHKA 4E3CA 2XBBC 3CIRB 2BYVE 1SEBD 4WJPA 5MPOA 4GDKB 1NBFC 2JX5A 1J19A 3N1ZC 2WX1A 3PRZA 2V9HA 3AU5A 3LB8C 2N0SB 2XK5A 4IC7B 4PS7A 4KKIA 1PGBA 3ZGZA 1GTHA 3B08A 4M0WB 4P16A 4RF0A 2V3NA 3ABVB 2KC1A 3S2AA 4M8MA 4S0RA 3AU4A 1QZEA 3HM3A 2KWDA 2WNMA 1FIQA 2L05A 2KN5A 2LGSA 1CMXB 4K81A 1C4PA 1TS4A 2WHIA 4W9KA 2PEAA 2BB6A 3PLUA 3N9YC 4HPMB 2I38A 1KM7A 4LJPB 1LFDA 1SIJA 1FD6A 3TSSA 4KIKB 2NTTA 1ENFA 2KDFB 3L0WB 3GS2A 2M4NA 4YTMB 2MX2A 2C60A 3ZJVA 4HPLB 1Z2MA 2KTFA 3X0WA 3H1UA 3A9JA 3PZDA 3B9JA 3ML9A 5CX3A 1TZ1A 2MEKA 1NDDA 2PJHA 2C7HA 4PS8A 2FCSA 5H8YE 4WH4A 3DWGC 3B2FA 2ONQA 4ZRKA 1SGHA 4BBNC 1V97A 4HDQA 3ZNZB 4HRSA 4MACA 3PLVA 2FCQA 2JT4B 2L76A 2NBWB 2WXIA 3AV8A 4KZCA 1FNUA 2V4IB 1K50A 4NQLB 3JVZX 4XWTA 4ZHPA 2ASQA 3W5UB 2G3QB 2PKOA 4TV3A 3VVWB 2N9EB 1C76A 1KFYB 1YJJA 3DVGX 4NY0A 4N58A 4TQ0A 4MSMB 1STEA 4IKGA 1PGXA 2REXA 3AI5A 2BB5A 1TY2A 4ACFA 1NENB 1WYGA 2G4SA 1SJHD 5IO9A 2N7JA 3APDA 5HG2A 3PRPB 2JWZA 2KFJA 4AJYB 2WXFA 3NVYA 1HZ6A 2JYTA 2D3BA 1RYJA 3B0AA 1UZXB 3TL5A 1WR1A 3SHQA 3WAPA 2R2OA 4GIVA 5IOIA 3M3JA 3OG5A 5EE1A 4HPPA 3VH4B 2YVCA 2DENB 2NS5A 2D2QA 2BW2A 3R8BA 2WDTB 2WXQA 3DDCB 3NS8A 2LZ6A 3QX1A 3SFEB 4IWQA 2LJIA 1EM7A 1V5TA 1JWUD 3A9JB 3HHMA 1E9MA 2KFKB 1I4GA 4W9DA 2LHDA 3KVFB 2BQQA 3EUB2 3NVVA 1X1MA 3ZJTA 3QC8B 4YSYB 2VZKB 1KLUD 1MPEA 2MCNB 3B1LX 5CTRC 2QMTA 3V05A 1ZOYB 4GOCA 2LVPA 2I1KA 4WQOB 2DLBA 3DBSA 2BYFA 1IBXA 3AE2B 3L17A 4MDKE 2MJ3A 4WJNA 2M0AA 3RNCC 2V3PA 1CQVA 2DYMA 1XF5L 2ZEQA 4F1SA 3QHTA 2DNFA 2RD0A 2V1YA 3Q8AA 3PTFC 4R3DA 1TTNA 2D3CA 2UU7A 4EUTA 1N61A 5BYSA 3AMZA 4DDGD 3TIXA 1VLBA 3UGBB 4HCPB 4K3BA 1YN5A 2PVGC 3GZNI 4G50A 4EOYA 2LRUA 1TJEA 2LGXA 4YTNB 2LI5A 4DWFA 4LJOB 2KQSA 2JWUA 3H6NA 2QJLA 3ETRA 1NEKB 3UIOB 2A4ZA 1V81A 1VR9A 2GOWA 2Z59B 2Z8LA 4BAXA 3W1SC 2WXOA 2EKIA 1WJ4A 3Q3NC 4C56C 4LDTD 4MT5A 4DHZB 2IO1B 1FRDA 1WGHA 5AUKA 1OGWA 1L7YA 3GE3C 1TBEA 4NQKE 2D11A 2MJEA 1TY0A 1XO3A 3I5JC 1C1YB 4XX5A 3WAMA 3PREA 4F7ZA 1R7SA 1PQSA 3ONSA 2L0FA 4YWGG 1E7PB 2G45B 1QOAA 3CWIA 3QK0A 1ZDVA 2RDGA 4BKGA 3A4SC 4TUUA 2AEHA 2X8XX 3MHZA 1Q5WB 3N1XC 4I6PA 3QJZA 3TUOA 2MBOA 1I35A 1IP9A 1R4MI 1RAXA 2Z0EB 1WR6E 3U4EG 1I4HA 1IBXB 3V6EB 2PVOD 2KACA 2N9PC 1BT0A 3W5VB 2CHXA 4XYCA 1E90A 3UINB 3IFWB 3R7RA 4DQOC 4C7ZA 1UGJA 1F9JA 1WMHA 4HLEA 5JHBA 2W55A 2K0PA 4DXAB 4RM9A 1XD3B 3RNAC 3DQVA 1RFKA 2CR5A 1JRPA 2KDIA 2L3ZA 3AEEB 1TS3A 1L0YB 2FCNA 3OAWA 1IYFA 4P1CC 2DZIA 1WRIA 1ZPSA 3RD2A 1B9RA 4A6QA 1IUEA 1E7VA 3A9KB 4P6VF 4ANUA 3V60A 1C77A 3X23A 4WWMA 3FILA 1NI2A 3PT2B 4CO7A 3PO0A 4LDTB 1NYQA 1ZXIA 2CKHB 3JW0X 4EEWA 2D3GA 3ZNGC 1UBQA 1K52A 2N9XA 2OEDA 2FCMA 3SFDB 2JRHA 1E8WA 1H8CA 2MBQA 2G9HD 3TEWA 4IOIE 1E6EB 2LVQA 3OWEB 4LNIA 2GBRA 4M8NA 3APCA 2BKFA 2BKRB 5C1ZA 1WJNA 3GZNB 4JLCA 1J7AA 2ZCBA 5CHWA 5D7GA 2KLCA 2GBJA 1QOBA 1QT9A 2J0JA 3RUIB 1YJIA 3B2GA 4OZAA 3AE1B 1FM0D 2KLGA 1T0RC 2BTEA 4USAA 4RGNA 2BYEA 1QOFA 3PHXB 1XLOA 3NY5A 3NHEB 1V8CA 4WJQA 4W9JA 5C23A 3SDLC 5IP4D 1WE6A 2ZPYA 1L6UA 1MHXA 1NI3A 2KMMA 2VH1A 4US8A 4A8XC 4KDIC 1P7EA 2QSDA 3TEYA 1P7FA 5BO4B 2JRIB 2EMTA 2L32A 2N9KA 2V4LA 3LDZE 5L83A 4YSXB 1YJ1A 4J3OD 2WWZA 1QILA 2ICIA 3R7QA 3T3OA 1EWYC 4IWPA 4KZ0A 4AJWA 1OEYA 1VCBA 2ACZB 2K39A 4FJVB 4A9AA 5FK9C 3DBRB 4G0NB 3I57A 4M0WA 4HXDA 4ZDVA 1UWMA 3CF6E 3T3NA 1UBIA 1L2NA 2DYBA 1JMLA 1WIAA 3NZ3A 3PSEB 5T8IA 2W82A 4REZA 4C00A 5I4DA 4ZRIA 1NYRA 3FILB 3VR9B 2N1WA 2FIFA 3DWMA 1N60A 3NZUA 5TSSA 4ANWA 2M1MA 3AULA 3BIID 3AE5B 2AL6A 3EC8A 5KHQA 2IY0B 2DBYA 3V62A 3MC8A 1L0VB 2ZVOA 3O65B 4AOFA 1FMAD 5DPWA 4WAFA 1FCLA 2HD5B 1DGJA 4EZKA 3PVLA 1WM3A 4BFRA 4HDOA 3AEBB 2QHOA 1MI0A 4HKZE 1K53A 4A20A 2YLMA 2NPTB 1N63A 2KJRA 2WP9B 4PYZA 3P4PB 2G1EA 3DBLB 4AUQC 1GC7A 2INDC 1OEYJ 2N1VA 4ZYSA 1YQ4B 3AB5A 3LXFA 3DCGA 2LUEA 2HJ1A 3AECB 3VTUA 1SBBB 4HKQA 1S3SG 1TS5A 2D07B 1M4VA 1WYWB 5G5GA 3AE4B 2WXGA 1P3QU 2HE7A 4L23A 4C7YA 1LXDA 1SE2A 1T0QC 2VRRB 4RCOA 4IDIA 1E0ZA 2EMSA 5GMVA 1KJTA 4WWNA 1GB1A 4ZOHC 5D3DA 2WXKA 4K3CA 2JSVX 2JZZA 2CJNA 3AE6B 3VDZA 4B9KA 1OQRA 2MQJA 1SE9A 3ENEA 1WZ0A 5J17A 2X38A 1ESFA 3KUZA 4KKJA 4KSLC 3FC4A 1V2YA 1JRUA 3TEXA 1BMLC 5HFYA 1MG4A 1YD8U 3ZQ4A 3A33B 4B6WA 1FXIA 2KJHB 1WZ3A 1KF6B 3J9CA 2L1AA 1I42A 4GSWA 3GP7A 2V3SA 2KX3A 1RLFA 3RNFC 5D94A 1ACCA 2O6VA 5DPTA 4QAYA 4DHJB 2O6VD 2UYZB 2K5PA 2KFKA 3ALBA 1FEHA 5G5HA 1WX7A 4P1BC 2VZKD 4JE3B 1VD2A 3RNBC 2N4FA 3E56A 2HTME 3NJTA 4G3XB 2K9XA 3RNGC 2BS3B 4GGQA 1V86A 2ZPNA 1HQRD 1QLBB 3BYTB 2FUHB 2ZNVC 3AE9B 3EGRA 5HHDG 4AQ7A 1UD7A 1E7UA 2KMCA 3W2DA 2AL3A 2WYQA 2KXJA 4GMVA 2W54A 1Q1OA 2IZVB 4FJYA 3CSTA 3IT4B 1F2RI 1TKYA 3MC0B 3C0RB 4H2AA 2LXAA 2WXLA 3KWLA 2IO3B 2JUOA 3IXSA 1ZW7A 4DHZE 1T5XD 4W9GA 4A90A 1JWSD 4RGTA 1KLGD 5G55A 1IGDA 2LVOA 1WFYA 1WXVA 5D2MB 1C9FA 4IM2A 2LXCA 4XGAB 3Q2AC 4ZRJA 1XEEA 3R2TA 3ZJUA 2KDBA 4K1RB 4LLGM 4XZ4A 1MVKA 4MELA 1WE7A 3Q3FA 4RMAA 1N6ZA 4MH8A 1WGYA 2D10A 2KVZA 3M63B 5EDSA 3AEFB 1KLVA 2J42A 3HUIA 1HA5A 4II3B 4HVBA 2WDQB 4BVUC 2CHWA 1S1QB 2IDYA 4A3PA 3WANA 1C4AA 2K3UA 1BXTA 5JHAA 2C7MB 3VFKA 1E8XA 4DXGA 2BBCA 2O6VB 2BS4B 4DBGA 2O2VB 3AE3B 4ZYNA 1FFUA 2MJDA 1AN8A 2AQ2B 1WX8A 1WY8A 1EF5A 3VQIA 4WJOA 2AYOB 4NPNA 3T9LA 1WWTA 1V9JA 2RPQA 3W1YA 3VHTC 4IM3A 3MJWA 4XDDA 2W9NA 5C2TB 4BZAA 3WAOA 2PW9A 1WRDB 1VZ7A 4JX1C 4W9LA 3ZRFA 3KH0A 2JQRB 2RDHA 1PGAA 1FXAA 3PZ7A 4JGHB 1ISNA 2NCNA 4J6IA 1FNVA 1RM6C 3OLMD 1HTQA 2C5LC 1VRAB 4XC2A 4ARIA 3K9OB 2GMIC 1CJEA 5DCNA 1Q0WB 5LLIA 1H7WA 2KQ7A 3I63C 4O1NA 5E6PA 5JH5C 3MC9A 2E3TA 4GLSC 3H7PB 4OVUA 1GTEA 2KNBA 2ZW0A 1CZPA 1VZ6A 3A9KA 4A3OA 5BMIA 3OJ4B 3AM9A 2RDBC 2CHZA 2JZPA 3EECA 5BYQA 2GB1A 4MGIE 1IGCA 4CYEA 1N5XA 4NJ7A 3QARA 3QA8A 2K8CA 3DOWA 4KGSA 2QILA 1SXTA 1UH6A 2YEPB 1AW7A 4N59A 3ZUNA 3RN9C 2KO3A 4K7WA 3AE8B 3KUDB 1EF1A 2WLBA 3ZRCA 5BMGA 2BVCA 3ZDMC 3PV1A 1WGKA 2N9LA 1IPGA 4IG7B 3N30A 4MGZE 2WGSA 2MBEA 2WU5B 2KTRA 4HROA 3ZNID 1YN3A 2KJ6A 2GLSA 3DBRI 2CS4A 2MH7A 4KX6B 4L2YA 2TSSA 1EO6A 3CSFA 4LNOA 3ZVVA 3Q8CA 2LRWA 3RCZA 3UQAA 1PDXA 4FHJA 1JWMD 4HWIB 2KK8A 4FADA 5E6NA 4LNKA 5TR5A 3VUYA 4WIPA 3EA6A 3QWZB 1HE8A 3L54A 1GJZA 2KOXA 4WAAA 4FJZA 2J52A 1EUVB 2M56B 4MGKE 1KTKA 3VTVA 4PK1A 1Y56A 3NUHB 2CU1A 1ET9A 3URYA 5EE3A 1KRHA 1OTRB 3AEDB 1UF0A 3SR6A 4EE2A 4LCDE 3BY4B 5H92C 3VTWA 2MBBB 1ZE3D 4IUMB 2L00B 3AE7B 3DBHB 1SB3C 1WH3A 2DYOA 3PPAA 1GPXA 1TKEA 1C3TA 3R66C 1XT9B 3RT3B 4NJ6A 2WDRB 1RWSA 4G11A 4KGRA 3EFUA 1OFFA 1TIFA 1UUPA 3ZKJC 1F1HA 4ICUA 3DBLI 3KYCD 1P1AA 2XNAC 4URKA 3M62B 3P1MA 3IBEA 1TGZB 1C4CA 2C9WB 4MM3A 2MBHA 1WXMA 1WF9A 1R4NB 4K7SA 1GG3A 4N9F4 2K8BA 3PGEA 3K9PB 1WGGA 3DHIC 2IY1B 2KTRB 1VDVA 2GI9A 1XLQA 2ZZPB 2NPTA 2K25A 1A5RA 2RR9A 3JSVB 1XCTL 2MP2A 4ARCA 3U2SC 4DXFA 2OOBB 3GOEA 2K22A 4HCNB 4M01A 1TKGA 4JIOU 1WGDA 2J0KA 4OZBA 4TMAB 2UWQA 3VAWA 2DAFA 3KUCB 4BOSC 1TZOA 1U4AA 1F2RC 3KWVA 1Q10A 5D3IB 2NTSA 2V0GA 3FAHA 3MFGA 3A1QB 4RNAA 3VR8B 2KD0A 4AWJA 4HK2A 1JROA 2GBKA 3AEGB 3HRDD 4IWOA 2N7EA 3Q8EA 1T3QA 2DZKA 4WURA 3BK1A 4MGYE 5FR3A 2ZW1A 2WS3B 1QOGA 4HEA1 2WXHA 1WX9A 2ON8A 2C7NB 1Y8RC 4II2B 1FCCC 3DHGC 3WIMA 2INPE 4FBJB 2KANA 4CQNA 4M00A 1E5WA 2M17A 4NAMA 4GB9A 1CK1A 3VUXA 1GB4A 3WCQA 3BVZA 1E8YA 2BGFA 2HJ8A 3NOBA 4MM3B 2BT6A 3ZXVA 2JZ3B 3IG3A 2QCZA 3FKYA 1OQYA 2E6XA 2GRIA 3V6CB 3KW5B 4DHJD 2IGDA 1YX6B 1ROEA 1JCKB 4I6LB 5LNK1 1T0YA 3RI7C 4FULA 4JPSA 2LHEA 3CMMB 3BYYB 4KGTA 4OHJA 2MA9B 2RPVA 2DZJA 3R2IA 5FR6A 5AZHA 2MP2B 1V1OA 3QAQA 3PHWB 2IGHA 3TEZA 1I4XA 1I7HA 3ZTDA 1VJKA 2Y5BB 1XLPA 1AYFA 4JWUC 4BKSA 2D3AA 3TCAA 3ZXRA 2L52A 4W9IA 1V6EA 4BKSD 2IPKD 4LK0M 1XQQA 4C4VB 3W1SA 1RFAA 3W9CB 4FA6A 4YXDB 5LXIB 4GN1A 3TMPB 2JVCA 4W9EA 3SD5A 3LYYA 3ZW3A 4OVZA 2PE6B 1FXTB 2BWES 5DPSA 2FAZA 2Z0DB 4ICVA 2JPHA 3ML8A 3L4PA 1WXQA 3BINA 3MTNB 3UI3A 3CF4A 1WXSA 1RRBA 2I2YA 3L13A 4ANXA 2PLPA 3DVGY 4D2KA 2INCC 2RMMA 2KWVB 1ET6A 1HTOA 1YIWA 2LGDA 3TBLD 2WXRA 3V3XA 2FNJB 5BMHA 4E71A 1HEZE 5D6JB 5C3JB 1NVID 3R3MA 2M19A 1ZGUB 1G6JA 1FO4A 4MJSA 4MH0E 5J2RA 1DOXA 1GC6A 2KN4A 4NAWB 1JALA 3KQ4A 2O2VA 1J8CA 3DPDA 3GB1A 1MHHE 3VUWA 2K8HA 2BS2B 3NS1A 3IT6B 5IN7A 1WI0A 2LMCA 2SEBD 3ZDTA 3E9SA 1TS2A 3AXCA 4GU2A 3ZIMA 2NBVB 3QCAA 3KLSX 1SJED 1TT5B 4NJCA 1SSNA 4OZCA 1UGMA 1F52A 2AWTA 3H9DA 1OQQA 2WX0A 3VH3B 1ZKHA 2K6QA 4UDUC 4TSSA 1D5MC 2R2QA 2INNE 3N3KB 2KDEB 5E6OA 4RH6A 2FIDA 3A4RA 1J0GA 1D4BA 2BF8B 1EU4A 1JW9D 2EKEC 3Q8FA 3H7SA 4WQMA 1F77A 2DAJA 1FPYA 2FUG1 3ZYYX 5G2NA 2RGFA 2ZJDA 5AZFA 3VRBB 3P2BA 1GAQB 3I9V1 2GBNA 2W3RA 3H7PA 2OHFA 3TJPA 3ECIA 1PFDA 3C19A 2H88B 2PE9A 4RF1A 4FN2A 4KDLB 3U8ZA 2Q5WD 3N20C 2AQ3B 4EKUA 4ZRQA 2XK5B 4YT0B 4BBNF 2LJ5A 2H89B 2MWSB 5AEKB 4L1BA 3U7ZA 4MSQB 5GXGB 3SU8X 5J18A 1P9DU 2NMQA 3U30A 3BVGA 4F8CB 4W9HA 1F0ZA 2OJWA 3T8MA 4EFOA 3NVZA 2BWFA 1EWCA 4MJSB 4B0MA 5AZGA 1ZUD2 3BVMA 1QQRA 4P7IA 4YSZB 3P63A 4YTPB 4OVVA 1L5PA 4GXBA 2DZMA 2WU2B 4EZJA 3H8HA 4JL9A 3APFA 2KWCA 1WM2A 1E8ZA 2M0XA 4Q2JA 4W9CA 1GNUA 1YOVB 1MFWA 3EFCA 2Y3AA 5FKAC 1H7XA 2SAKA 4NNJB 3DBHI 5EE0A 3Q3JA 3AN1A 1HXYD 2BPSA 1TYGB 5AUIA 1KH0A 2XN9C 1MJDA 4HJGE 1YMHE 5HI1A 2QDFA 2WXJA 1YQBA 1E10A 3HVZA 2KVRA 1FNWA 3RPFC 2J53A
chains in the Genus database with same CATH topology
1ZE3D 5TSSA 3B9JA 3AE7B 1SB3C 2MEKA 2IJ0A 1DYQA 3AH7A 2DYOA 3BIID 1GPXA 3AE5B 4FXCA 1TKEA 1N62A 2DBYA 5H8YE 1L0VB 2J4XA 2WDRB 1RWSA 3BZDB 3DWGC 4KGRA 3B2FA 4WH4A 1SE4A 3P4QB 1OFFA 1UUPA 1FMAD 2ONQA 4JWSC 4RGMA 2JXTA 1VZ8A 2PTLA 1V97A 2XNAC 4WAFA 1FCLA 1DGJA 4HRSA 4MACA 1SF0A 2WXIA 3AV8A 3P1MA 1FNUA 2V4IB 1K50A 2LGIA 1C4CA 4XWTA 4ZHPA 3W5UB 3AEBB 2JYEA 1MI0A 2PKOA 4HKZE 1K53A 5E6JA 1L4ZB 1C76A 1KFYB 1N63A 1YJJA 1I4QA 2WP9B 2FE8A 4B0EA 3P4PB 2G1EA 1B1ZA 4ITKA 4N58A 4TQ0A 1K51A 1STEA 4IKGA 1J7CA 1PGXA 1DOYA 1V1PA 2EELA 4ZYSA 1VDVA 2BB5A 2GI9A 1YQ4B 3AB5A 3LXFA 1XLQA 1TY2A 4XWWA 1NENB 2PMVA 1WYGA 2Y5PA 1SJHD 3AECB 5BYRA 1SBBB 4HKQA 2N7JA 1XCTL 4TQ1A 2LFIA 1TS5A 4ARCA 1M4VA 1UNSA 1XXGA 3U2SC 5HG2A 4C80A 5G5GA 3AE4B 4DXFA 2K22A 2WXGA 2WXFA 3NVYA 1TKGA 4L23A 1LO5D 4C7YA 1HZ6A 4OZBA 1SE2A 4TMAB 2JYTA 1RYJA 4RCOA 1D5XC 4IDIA 5JXVA 1E0ZA 1TZOA 1F2RC 4LTUA 1GB1A 3KWVA 1Q10A 1XCQL 2WXKA 4ZOHC 5D3DA 5D3IB 2NTSA 2V0GA 2JSVX 2CJNA 3AE6B 3FAHA 3MFGA 1OQRA 5EE1A 4RNAA 2X38A 1ESFA 3VR8B 4KKJA 4N6EB 2KAJA 3P4RB 1JROA 2BW2A 3R8BA 2WXQA 3FC4A 3Q69A 3AEGB 3HRDD 3Q8EA 3TEXA 1BMLC 3SFEB 1J7BA 1ZXHA 1EM7A 2LJIA 5HFYA 1T3QA 1T6BX 3IAS1 4WURA 2AX5A 3BK1A 3ZQ4A 1JWUD 5FR3A 2ZW1A 2WS3B 2WXPA 1E9MA 1FXIA 1I4GA 1QOGA 2D5GA 1KF6B 3AEAB 2L1AA 2LHDA 2WXHA 3J9CA 4HEA1 3EUB2 3NVVA 3ZJTA 2ON8A 2CU3A 4YSYB 1FCCC 2VZKB 4ZRPA 3VRAB 3GP7A 3P42A 1KLUD 2INPE 1MPEA 1ACCA 2QMTA 3V05A 4CQNA 2BYTA 1ZOYB 2IGGA 1ZP0B 1N5WA 2DLBA 2K5PA 4NAMA 1CK1A 1GB4A 3WCQA 3BVZA 1IBXA 3AE2B 2WQYB 1FEHA 2MJ3A 2R61A 2M0AA 5G5HA 2V3PA 1CQVA 1EU3A 2JU6X 2DYMA 1XF5L 4MM3B 1YQ3B 2BT6A 2VZKD 4JE3B 2KQ4X 3E56A 3Q8AA 4R3DA 2HTME 2E6XA 2GRIA 2K9XA 1UWXA 2QEJC 2BS3B 2IGDA 1ROEA 1JCKB 1HQRD 1N61A 5LNK1 5BYSA 3AMZA 1V1PB 2PIAA 1QLBB 4A55A 4JPSA 2W3SA 3BYTB 1VLBA 2LHEA 1YNTE 3AE9B 3EGRA 1YN5A 2PVGC 5HHDG 4AQ7A 3BYYB 4KGTA 4OHJA 1A70A 3W2DA 4XDCA 1TJEA 2RPVA 1C78A 4YTNB 2W54A 3R2IA 2CJOA 2JWUA 2KDMA 2QJLA 3IT4B 3ETRA 1NEKB 1V1OA 1F2RI 2IGHA 1TKYA 3TEZA 3MC0B 1I4XA 1VR9A 1I7HA 2Z8LA 2WXMA 4PT5A 4H2AA 1VJKA 2WXOA 2WXLA 3KWLA 1XLPA 3IXSA 2EKIA 1AYFA 4JWUC 1GOZA 2WXNA 3HVDA 3MP9A 2L52A 1T5XD 4A90A 1JWSD 4MT5A 4RGTA 4C56C 2IPKD 4LK0M 1FRDA 1KLGD 3W1SA 5AUKA 1I4RA 1IGDA 3W9CB 4YXDB 2DWQA 2QIEB 3SEBA 1C9FA 3C8YA 3PZ8A 1XEEA 3R2TA 2MJEA 3ZJUA 4LLGM 3LYYA 1TY0A 1XO3A 1L0XB 1AWDA 1MVKA 4OVZA 1L4DB 4OW0A 1R7SA 1D6EC 4MH8A 3L4PA 3AEFB 4YWGG 1E7PB 1WXQA 2J42A 3HUIA 2Y5CA 2FBWB 1HA5A 1QKZA 2LUMA 3UI3A 1QOAA 2WDQB 3NVWA 3CWIA 3CF4A 1ZDVA 2RDGA 2IDYA 1JQ4A 1C4AA 2K3UA 1BXTA 2I2YA 2PLPA 4D2KA 3MHZA 4DXGA 4RGOS 2RMMA 1ET6A 2BBCA 2WXRA 2YEPF 2BS4B 3V3XA 5BMHA 3AE3B 1YN4A 1FFUA 1HEZE 5C3JB 1NVID 3TUOA 2M19A 2MJDA 1L6VA 1AN8A 2AQ2B 1FO4A 2HDEA 1I4PA 4XE0A 1SE3A 3U4EG 1I4HA 1IBXB 1PYWD 2PVOD 2KACA 3W5VB 3VQIA 1DOXA 1PUTA 2KN4A 4NAWB 4DQOC 1JALA 4C7ZA 1UGJA 3KQ4A 1WWTA 2W55A 1D5ZC 3BWUD 1GT8A 3GB1A 2K0PA 1MHHE 2L83A 3NRZA 3NS1A 2BS2B 4XDDA 3IT6B 1QF6A 2LMCA 2SEBD 3BK2A 2B76B 5C2TB 1RFKA 1JRPA 3MJ5A 1FFVA 3E9SA 2WDVB 2PW9A 3AEEB 1VZ7A 1TS3A 4ZHOA 1C79A 1L0YB 1TS2A 4JX1C 3U52E 2JQRB 2RDHA 1PGAA 1FXAA 3PZ7A 1FNVA 1RM6C 3KLSX 1WRIA 1ZPSA 1SJED 4NJCA 4GDLB 4NZLB 1B9RA 1SSNA 4OZCA 1VRAB 1IUEA 1JWAD 4A6QA 1OQQA 1WSPA 4P6VF 4ARIA 4UDUC 1CJEA 1C77A 1FRRA 4TSSA 4WWMA 3FILA 1JWBD 1D5MC 1DOIA 1H7WA 2INNE 3PO0A 3P4SB 4O1NA 1NYQA 1ZXIA 1HZ5A 2E3TA 3O13A 4GLSC 4RH6A 1K52A 3RFZB 2OEDA 1D4BA 1GTEA 3SFDB 1EU4A 2ZW0A 1VZ6A 1CZPA 1JW9D 3Q8FA 5BMIA 2G9HD 4WQMA 1F77A 3Q8BA 3TEWA 2FUG1 3ZYYX 3AM9A 4IOIE 1E6EB 2LEKA 2JZPA 3OWEB 5BYQA 1BUIC 2GB1A 1IGCA 1N5XA 4US9A 3VRBB 1GAQB 3I9V1 2W3RA 4KGSA 2QILA 1SXTA 2YEPB 1J7AA 2OHFA 1XLNA 1AW7A 4N59A 1PFDA 1ZDXA 2H88B 2AQ1B 5D7GA 3IAM1 4RF1A 3AE8B 4RFBA 1QOBA 1QT9A 2WLBA 2Q5WD 4AS1A 2AQ3B 5BMGA 1YJIA 3B2GA 4ZRQA 4OZAA 5EE9A 3AE1B 4YT0B 1FM0D 2H89B 2BTEA 4L1BA 4USAA 4RGNA 3U7ZA 1QOFA 1XLOA 5GXGB 3CIRB 1WGKA 2N9LA 1SEBD 1V8CA 5MPOA 4GDKB 2NMQA 3BVGA 1L6UA 1MHXA 1NI3A 1F0ZA 2JX5A 2KMMA 4US8A 4A8XC 2WU5B 4HROA 1YN3A 1P7EA 2QSDA 3NVZA 1EWCA 3TEYA 4B0MA 3LB8C 1P7FA 1ZUD2 2N0SB 4KKIA 3BVMA 1QQRA 1PGBA 2MH7A 4KX6B 2L32A 2N9KA 4YSZB 4L2YA 3ZGZA 1GTHA 4YSXB 3P63A 4YTPB 2TSSA 4J3OD 4P16A 2V3NA 4RF0A 3ABVB 1L5PA 1QILA 3Q8CA 1PDXA 2ICIA 2WU2B 3H8HA 1JWMD 3T3OA 2KWDA 1EWYC 2WNMA 1FIQA 4WIPA 3EA6A 1C4PA 1TS4A 2ACZB 2BB6A 4A9AA 4Q2JA 5FK9C 3N9YC 2Y3AA 2J52A 2I38A 3I57A 2M56B 4M0WA 5FKAC 1H7XA 1KTKA 1SIJA 2SAKA 1FD6A 1Y56A 3TSSA 1UWMA 5EE0A 3NUHB 3T3NA 1ET9A 2NTTA 3AN1A 1ENFA 1HXYD 3URYA 5EE3A 1TYGB 1JMLA 5AUIA 3NZ3A 5T8IA 1KH0A 1KRHA 2W82A 2XN9C 3AEDB 4REZA 5I4DA 4HJGE 1YMHE 5HI1A 3SR6A 3GS2A 2WXJA 4EE2A 1NYRA 1E10A 3HVZA 4YTMB 3FILB 3VR9B 3ZJVA 1FNWA 5H92C 3RPFC 3DWMA 2J53A 1N60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JW9 D;  2MJE A;  3B9J A;  4WQM A;  3SFE B;  1J7B A;  1XO3 A;  1T3Q A;  3AE7 B;  3ZYY X;  1AWD A;  3AM9 A;  1SB3 C;  2AX5 A;  1E6E B;  3AH7 A;  2LEK A;  3BII D;  1GPX A;  3AE5 B;  1R7S A;  4FXC A;  2WS3 B;  1N5X A;  1TKE A;  1N62 A;  2DBY A;  1E9M A;  1FXI A;  4US9 A;  3VRB B;  1GAQ B;  1QOG A;  3L4P A;  1KF6 B;  3AEA B;  3AEF B;  5H8Y E;  1E7P B;  2W3R A;  1L0V B;  1WXQ A;  3EUB 2;  3NVV A;  3HUI A;  2WDR B;  2CU3 A;  1J7A A;  1RWS A;  2FBW B;  1XLN A;  2OHF A;  2Y5C A;  1PFD A;  3B2F A;  3DWG C;  4N59 A;  4YSY B;  3P4Q B;  2WDQ B;  1OFF A;  3VRA B;  1QOA A;  3CF4 A;  1FMA D;  3CWI A;  3NVW A;  2H88 B;  4JWS C;  1JQ4 A;  1V97 A;  3AE8 B;  1QOB A;  1QT9 A;  1DGJ A;  2Q5W D;  2WLB A;  4HRS A;  1ZOY B;  1ZP0 B;  1SF0 A;  1YJI A;  3B2G A;  1N5W A;  3AV8 A;  2K5P A;  3P1M A;  5EE9 A;  3AE1 B;  4YT0 B;  1FM0 D;  2BS4 B;  2H89 B;  4ZHP A;  3W5U B;  3AEB B;  3AE3 B;  3WCQ A;  1FFU A;  2PKO A;  4USA A;  3AE2 B;  2WQY B;  5C3J B;  1NVI D;  1QOF A;  2M19 A;  1XLO A;  2MJ3 A;  1L6V A;  3CIR B;  2MJD A;  1WGK A;  5G5H A;  5GXG B;  1V8C A;  1FO4 A;  1KFY B;  1N63 A;  1YJJ A;  5MPO A;  2WP9 B;  1L6U A;  1NI3 A;  1F0Z A;  2JX5 A;  2KMM A;  1YQ3 B;  2BT6 A;  4US8 A;  3P4P B;  2WU5 B;  2G1E A;  4ITK A;  4HRO A;  4N58 A;  2PVO D;  3NVZ A;  3W5V B;  3LB8 C;  2HTM E;  1J7C A;  1DOX A;  1ZUD 2;  2N0S B;  1DOY A;  1PUT A;  2K9X A;  1VDV A;  2BS3 B;  1JAL A;  4C7Z A;  1YQ4 B;  2MH7 A;  3AB5 A;  3LXF A;  1XLQ A;  1ROE A;  4KX6 B;  4YSZ B;  1WWT A;  2W55 A;  1GTH A;  1NEN B;  1N61 A;  1GT8 A;  2PIA A;  4YSX B;  3AMZ A;  4YTP B;  3P63 A;  1QLB B;  1WYG A;  3ABV B;  1L5P A;  2W3S A;  1PDX A;  2L83 A;  3NRZ A;  3NS1 A;  2BS2 B;  2WU2 B;  1VLB A;  3AEC B;  3AE9 B;  1QF6 A;  2PVG C;  1EWY C;  1FIQ A;  2B76 B;  5C2T B;  1RFK A;  1JRP A;  1A70 A;  1FFV A;  4C80 A;  1TJE A;  5G5G A;  2ACZ B;  2WDV B;  3AE4 B;  3AEE B;  2K22 A;  4YTN B;  4A9A A;  4ZHO A;  2W54 A;  3NVY A;  1TKG A;  4JX1 C;  2JQR B;  4C7Y A;  2CJO A;  1FXA A;  2QJL A;  1RYJ A;  2M56 B;  1NEK B;  3ETR A;  1H7X A;  4IDI A;  1TKY A;  1RM6 C;  1SIJ A;  1WRI A;  1E0Z A;  1I7H A;  1B9R A;  1UWM A;  1IUE A;  1JWA D;  4LTU A;  5EE0 A;  1OQQ A;  4P6V F;  1VJK A;  4ZOH C;  3KWL A;  1XLP A;  3AN1 A;  2CJN A;  1AYF A;  3AE6 B;  2EKI A;  1CJE A;  3FAH A;  1FRR A;  1OQR A;  4JWU C;  5EE3 A;  1TYG B;  5EE1 A;  2L52 A;  5AUI A;  4WWM A;  1JWB D;  1KRH A;  3AED B;  1DOI A;  1H7W A;  3VR8 B;  3SR6 A;  3PO0 A;  3P4S B;  1FRD A;  4N6E B;  1NYQ A;  1ZXI A;  2KAJ A;  1NYR A;  3P4R B;  1JRO A;  1E10 A;  5AUK A;  3HVZ A;  2E3T A;  4YTM B;  3W9C B;  3VR9 B;  4YXD B;  2DWQ A;  3FC4 A;  5H92 C;  2QIE B;  3RPF C;  1GTE A;  3SFD B;  3AEG B;  3HRD D;  3DWM A;  1CZP A;  1N60 A; 
#chains in the Genus database with same CATH topology
 1SIF A;  2LD9 A;  3ZLZ A;  1WGR A;  3M95 A;  5IKC M;  3LJ3 A;  2IJ0 A;  1DYQ A;  3AH7 A;  4FXC A;  4FLH A;  3DVN U;  1N62 A;  4YL8 A;  4AP4 C;  2VH2 A;  4M02 A;  1R4N I;  2J4X A;  3BZD B;  2DX5 B;  1SE4 A;  3P4Q B;  4JWS C;  3VXW A;  4RGM A;  2JXT A;  1VZ8 A;  2PTL A;  4ANV A;  1SF0 A;  4EZL A;  2KHW B;  2L8J A;  5HKH A;  2LGI A;  3RZF A;  2JYE A;  5E6J A;  3RYT A;  2L0T A;  1L4Z B;  4LNN A;  3HM6 X;  1I4Q A;  5JZE B;  2FE8 A;  4B0E A;  2XEW A;  1B1Z A;  2L7R A;  4ITK A;  3L10 B;  1K51 A;  3RUL A;  4CHK A;  1J7C A;  3V61 A;  1DOY A;  1V1P A;  2EEL A;  4RM8 A;  2JY6 A;  2I1J A;  4XWW A;  2JXX A;  1MG8 A;  2PMV A;  2KYW A;  4JQW C;  2Y5P A;  4MEM A;  5BYR A;  4TQ1 A;  2LFI A;  2A5U A;  1XXG A;  1UNS A;  4C80 A;  2QC8 A;  1Z5S B;  3UF8 A;  3WA0 A;  1LO5 D;  3IVF A;  1D5X C;  1YX5 B;  4PS3 A;  5JXV A;  3PRM B;  3IHP C;  1H4R A;  1LGR A;  4LTU A;  1XCQ L;  3JSV A;  1D3Z A;  5IA7 A;  2LAS A;  3KYD D;  3QQ8 B;  5KHO A;  2PPH A;  3UQB A;  4N6E B;  2KAJ A;  3P4R B;  3RZW C;  3Q69 A;  2NR2 A;  1LQB A;  2MLB A;  2J0M A;  4IW0 A;  2IO2 B;  1M94 A;  1ZXH A;  1J7B A;  1K8R B;  1T6B X;  3IAS 1;  2AX5 A;  3A1Q A;  1GUA B;  2IO0 B;  2WXP A;  1V5O A;  1P98 A;  2D5G A;  3AEA B;  3I3T B;  3HIZ A;  3OJ3 A;  3Q3M C;  2CU3 A;  3WAL A;  1V80 A;  5LXH A;  2KWU B;  2KC2 A;  4ZRP A;  3VRA B;  5L95 C;  3P42 A;  2HTH A;  3N32 A;  2BYT A;  4KVG B;  2IGG A;  1ZP0 B;  1N5W A;  2KZR A;  4WWO A;  2WQY B;  2R61 A;  4BKT A;  1EU3 A;  2JU6 X;  1KOT A;  2OJR A;  1YQ3 B;  1WJU A;  2JF5 A;  3Q14 C;  2KQ4 X;  1UEL A;  1UWX A;  2QEJ C;  2LGY A;  1V1P B;  2PIA A;  3DHH C;  4A55 A;  2W3S A;  3JYU A;  2IYD B;  1YNT E;  2ZVN A;  4WWP A;  4HJK A;  1A70 A;  4XDC A;  1C78 A;  1LM8 B;  2MRP A;  4GDL A;  2CJO A;  2KDM A;  3NZS A;  2MW5 A;  2WXM A;  3Q6B A;  2J7Q B;  4PT5 A;  1GOZ A;  2K1F A;  2WXN A;  3HVD A;  3MP9 A;  2DHZ A;  2KMA A;  2LWP A;  4DDI D;  4K7U A;  4IM0 A;  1I4R A;  2DWQ A;  2QIE B;  3SEB A;  3C8Y A;  3PZ8 A;  2KT7 A;  1L0X B;  1AWD A;  4E74 A;  1L4D B;  4OW0 A;  1D6E C;  4KV2 A;  4BOZ B;  5DPR A;  3L08 A;  2ZCC A;  4C4V A;  1WXA A;  2Y5C A;  3RMK C;  2FBW B;  1QKZ A;  2LUM A;  3NVW A;  1JQ4 A;  3EHV A;  4RGO S;  2IBI B;  3DVN V;  3Q3O C;  2YEP F;  4GDK A;  1WMH B;  4B95 A;  1YN4 A;  5IAA C;  1L6V A;  3HK0 A;  2HDE A;  2N7D A;  3PS6 A;  1I4P A;  4XE0 A;  1SE3 A;  1PYW D;  5CHF A;  4S17 A;  2G4D B;  1PUT A;  1T0S C;  3NG0 A;  1D5Z C;  3BWU D;  1GT8 A;  3ZO5 B;  2NVU I;  2L83 A;  3NRZ A;  2K6D B;  1QF6 A;  2B3A A;  3BK2 A;  4X57 B;  2B76 B;  1R4M B;  3MJ5 A;  1FFV A;  2WDV B;  2KKC A;  3MHS D;  2MHJ A;  4NAW A;  4ZHO A;  1C79 A;  3L16 A;  1V49 A;  3U52 E;  1AAR A;  4KIK A;  4DK5 A;  3UIP B;  4LNF A;  4GDL B;  4NZL B;  2ZNV B;  4W9F A;  1JWA D;  1P0R A;  1WSP A;  4KSK C;  2M8S A;  5CHV C;  3RNE C;  4TKN A;  4I6N B;  1FRR A;  3N1Y C;  1JWB D;  1DOI A;  3P4S B;  2RSU A;  1HZ5 A;  3O13 A;  3D32 A;  2KX0 A;  3QIJ A;  3RFZ B;  2MSE D;  3Q8B A;  2LEK A;  1BUI C;  3ZNH B;  2NBU A;  4ASW C;  1WJ6 A;  4US9 A;  1XLN A;  1ZDX A;  2AQ1 B;  3IAM 1;  4PYU A;  4RFB A;  3ZTC A;  2GBM A;  4AS1 A;  3GE8 C;  5EE9 A;  3U7D A;  4FHK A;  4E3C A;  2XBB C;  3CIR B;  2BYV E;  1SEB D;  4WJP A;  5MPO A;  4GDK B;  1NBF C;  2JX5 A;  1J19 A;  3N1Z C;  2WX1 A;  3PRZ A;  2V9H A;  3AU5 A;  3LB8 C;  2N0S B;  2XK5 A;  4IC7 B;  4PS7 A;  4KKI A;  1PGB A;  3ZGZ A;  1GTH A;  3B08 A;  4M0W B;  4P16 A;  4RF0 A;  2V3N A;  3ABV B;  2KC1 A;  3S2A A;  4M8M A;  4S0R A;  3AU4 A;  1QZE A;  3HM3 A;  2KWD A;  2WNM A;  1FIQ A;  2L05 A;  2KN5 A;  2LGS A;  1CMX B;  4K81 A;  1C4P A;  1TS4 A;  2WHI A;  4W9K A;  2PEA A;  2BB6 A;  3PLU A;  3N9Y C;  4HPM B;  2I38 A;  1KM7 A;  4LJP B;  1LFD A;  1SIJ A;  1FD6 A;  3TSS A;  4KIK B;  2NTT A;  1ENF A;  2KDF B;  3L0W B;  3GS2 A;  2M4N A;  4YTM B;  2MX2 A;  2C60 A;  3ZJV A;  4HPL B;  1Z2M A;  2KTF A;  3X0W A;  3H1U A;  3A9J A;  3PZD A;  3B9J A;  3ML9 A;  5CX3 A;  1TZ1 A;  2MEK A;  1NDD A;  2PJH A;  2C7H A;  4PS8 A;  2FCS A;  5H8Y E;  4WH4 A;  3DWG C;  3B2F A;  2ONQ A;  4ZRK A;  1SGH A;  4BBN C;  1V97 A;  4HDQ A;  3ZNZ B;  4HRS A;  4MAC A;  3PLV A;  2FCQ A;  2JT4 B;  2L76 A;  2NBW B;  2WXI A;  3AV8 A;  4KZC A;  1FNU A;  2V4I B;  1K50 A;  4NQL B;  3JVZ X;  4XWT A;  4ZHP A;  2ASQ A;  3W5U B;  2G3Q B;  2PKO A;  4TV3 A;  3VVW B;  2N9E B;  1C76 A;  1KFY B;  1YJJ A;  3DVG X;  4NY0 A;  4N58 A;  4TQ0 A;  4MSM B;  1STE A;  4IKG A;  1PGX A;  2REX A;  3AI5 A;  2BB5 A;  1TY2 A;  4ACF A;  1NEN B;  1WYG A;  2G4S A;  1SJH D;  5IO9 A;  2N7J A;  3APD A;  5HG2 A;  3PRP B;  2JWZ A;  2KFJ A;  4AJY B;  2WXF A;  3NVY A;  1HZ6 A;  2JYT A;  2D3B A;  1RYJ A;  3B0A A;  1UZX B;  3TL5 A;  1WR1 A;  3SHQ A;  3WAP A;  2R2O A;  4GIV A;  5IOI A;  3M3J A;  3OG5 A;  5EE1 A;  4HPP A;  3VH4 B;  2YVC A;  2DEN B;  2NS5 A;  2D2Q A;  2BW2 A;  3R8B A;  2WDT B;  2WXQ A;  3DDC B;  3NS8 A;  2LZ6 A;  3QX1 A;  3SFE B;  4IWQ A;  2LJI A;  1EM7 A;  1V5T A;  1JWU D;  3A9J B;  3HHM A;  1E9M A;  2KFK B;  1I4G A;  4W9D A;  2LHD A;  3KVF B;  2BQQ A;  3EUB 2;  3NVV A;  1X1M A;  3ZJT A;  3QC8 B;  4YSY B;  2VZK B;  1KLU D;  1MPE A;  2MCN B;  3B1L X;  5CTR C;  2QMT A;  3V05 A;  1ZOY B;  4GOC A;  2LVP A;  2I1K A;  4WQO B;  2DLB A;  3DBS A;  2BYF A;  1IBX A;  3AE2 B;  3L17 A;  4MDK E;  2MJ3 A;  4WJN A;  2M0A A;  3RNC C;  2V3P A;  1CQV A;  2DYM A;  1XF5 L;  2ZEQ A;  4F1S A;  3QHT A;  2DNF A;  2RD0 A;  2V1Y A;  3Q8A A;  3PTF C;  4R3D A;  1TTN A;  2D3C A;  2UU7 A;  4EUT A;  1N61 A;  5BYS A;  3AMZ A;  4DDG D;  3TIX A;  1VLB A;  3UGB B;  4HCP B;  4K3B A;  1YN5 A;  2PVG C;  3GZN I;  4G50 A;  4EOY A;  2LRU A;  1TJE A;  2LGX A;  4YTN B;  2LI5 A;  4DWF A;  4LJO B;  2KQS A;  2JWU A;  3H6N A;  2QJL A;  3ETR A;  1NEK B;  3UIO B;  2A4Z A;  1V81 A;  1VR9 A;  2GOW A;  2Z59 B;  2Z8L A;  4BAX A;  3W1S C;  2WXO A;  2EKI A;  1WJ4 A;  3Q3N C;  4C56 C;  4LDT D;  4MT5 A;  4DHZ B;  2IO1 B;  1FRD A;  1WGH A;  5AUK A;  1OGW A;  1L7Y A;  3GE3 C;  1TBE A;  4NQK E;  2D11 A;  2MJE A;  1TY0 A;  1XO3 A;  3I5J C;  1C1Y B;  4XX5 A;  3WAM A;  3PRE A;  4F7Z A;  1R7S A;  1PQS A;  3ONS A;  2L0F A;  4YWG G;  1E7P B;  2G45 B;  1QOA A;  3CWI A;  3QK0 A;  1ZDV A;  2RDG A;  4BKG A;  3A4S C;  4TUU A;  2AEH A;  2X8X X;  3MHZ A;  1Q5W B;  3N1X C;  4I6P A;  3QJZ A;  3TUO A;  2MBO A;  1I35 A;  1IP9 A;  1R4M I;  1RAX A;  2Z0E B;  1WR6 E;  3U4E G;  1I4H A;  1IBX B;  3V6E B;  2PVO D;  2KAC A;  2N9P C;  1BT0 A;  3W5V B;  2CHX A;  4XYC A;  1E90 A;  3UIN B;  3IFW B;  3R7R A;  4DQO C;  4C7Z A;  1UGJ A;  1F9J A;  1WMH A;  4HLE A;  5JHB A;  2W55 A;  2K0P A;  4DXA B;  4RM9 A;  1XD3 B;  3RNA C;  3DQV A;  1RFK A;  2CR5 A;  1JRP A;  2KDI A;  2L3Z A;  3AEE B;  1TS3 A;  1L0Y B;  2FCN A;  3OAW A;  1IYF A;  4P1C C;  2DZI A;  1WRI A;  1ZPS A;  3RD2 A;  1B9R A;  4A6Q A;  1IUE A;  1E7V A;  3A9K B;  4P6V F;  4ANU A;  3V60 A;  1C77 A;  3X23 A;  4WWM A;  3FIL A;  1NI2 A;  3PT2 B;  4CO7 A;  3PO0 A;  4LDT B;  1NYQ A;  1ZXI A;  2CKH B;  3JW0 X;  4EEW A;  2D3G A;  3ZNG C;  1UBQ A;  1K52 A;  2N9X A;  2OED A;  2FCM A;  3SFD B;  2JRH A;  1E8W A;  1H8C A;  2MBQ A;  2G9H D;  3TEW A;  4IOI E;  1E6E B;  2LVQ A;  3OWE B;  4LNI A;  2GBR A;  4M8N A;  3APC A;  2BKF A;  2BKR B;  5C1Z A;  1WJN A;  3GZN B;  4JLC A;  1J7A A;  2ZCB A;  5CHW A;  5D7G A;  2KLC A;  2GBJ A;  1QOB A;  1QT9 A;  2J0J A;  3RUI B;  1YJI A;  3B2G A;  4OZA A;  3AE1 B;  1FM0 D;  2KLG A;  1T0R C;  2BTE A;  4USA A;  4RGN A;  2BYE A;  1QOF A;  3PHX B;  1XLO A;  3NY5 A;  3NHE B;  1V8C A;  4WJQ A;  4W9J A;  5C23 A;  3SDL C;  5IP4 D;  1WE6 A;  2ZPY A;  1L6U A;  1MHX A;  1NI3 A;  2KMM A;  2VH1 A;  4US8 A;  4A8X C;  4KDI C;  1P7E A;  2QSD A;  3TEY A;  1P7F A;  5BO4 B;  2JRI B;  2EMT A;  2L32 A;  2N9K A;  2V4L A;  3LDZ E;  5L83 A;  4YSX B;  1YJ1 A;  4J3O D;  2WWZ A;  1QIL A;  2ICI A;  3R7Q A;  3T3O A;  1EWY C;  4IWP A;  4KZ0 A;  4AJW A;  1OEY A;  1VCB A;  2ACZ B;  2K39 A;  4FJV B;  4A9A A;  5FK9 C;  3DBR B;  4G0N B;  3I57 A;  4M0W A;  4HXD A;  4ZDV A;  1UWM A;  3CF6 E;  3T3N A;  1UBI A;  1L2N A;  2DYB A;  1JML A;  1WIA A;  3NZ3 A;  3PSE B;  5T8I A;  2W82 A;  4REZ A;  4C00 A;  5I4D A;  4ZRI A;  1NYR A;  3FIL B;  3VR9 B;  2N1W A;  2FIF A;  3DWM A;  1N60 A;  3NZU A;  5TSS A;  4ANW A;  2M1M A;  3AUL A;  3BII D;  3AE5 B;  2AL6 A;  3EC8 A;  5KHQ A;  2IY0 B;  2DBY A;  3V62 A;  3MC8 A;  1L0V B;  2ZVO A;  3O65 B;  4AOF A;  1FMA D;  5DPW A;  4WAF A;  1FCL A;  2HD5 B;  1DGJ A;  4EZK A;  3PVL A;  1WM3 A;  4BFR A;  4HDO A;  3AEB B;  2QHO A;  1MI0 A;  4HKZ E;  1K53 A;  4A20 A;  2YLM A;  2NPT B;  1N63 A;  2KJR A;  2WP9 B;  4PYZ A;  3P4P B;  2G1E A;  3DBL B;  4AUQ C;  1GC7 A;  2IND C;  1OEY J;  2N1V A;  4ZYS A;  1YQ4 B;  3AB5 A;  3LXF A;  3DCG A;  2LUE A;  2HJ1 A;  3AEC B;  3VTU A;  1SBB B;  4HKQ A;  1S3S G;  1TS5 A;  2D07 B;  1M4V A;  1WYW B;  5G5G A;  3AE4 B;  2WXG A;  1P3Q U;  2HE7 A;  4L23 A;  4C7Y A;  1LXD A;  1SE2 A;  1T0Q C;  2VRR B;  4RCO A;  4IDI A;  1E0Z A;  2EMS A;  5GMV A;  1KJT A;  4WWN A;  1GB1 A;  4ZOH C;  5D3D A;  2WXK A;  4K3C A;  2JSV X;  2JZZ A;  2CJN A;  3AE6 B;  3VDZ A;  4B9K A;  1OQR A;  2MQJ A;  1SE9 A;  3ENE A;  1WZ0 A;  5J17 A;  2X38 A;  1ESF A;  3KUZ A;  4KKJ A;  4KSL C;  3FC4 A;  1V2Y A;  1JRU A;  3TEX A;  1BML C;  5HFY A;  1MG4 A;  1YD8 U;  3ZQ4 A;  3A33 B;  4B6W A;  1FXI A;  2KJH B;  1WZ3 A;  1KF6 B;  3J9C A;  2L1A A;  1I42 A;  4GSW A;  3GP7 A;  2V3S A;  2KX3 A;  1RLF A;  3RNF C;  5D94 A;  1ACC A;  2O6V A;  5DPT A;  4QAY A;  4DHJ B;  2O6V D;  2UYZ B;  2K5P A;  2KFK A;  3ALB A;  1FEH A;  5G5H A;  1WX7 A;  4P1B C;  2VZK D;  4JE3 B;  1VD2 A;  3RNB C;  2N4F A;  3E56 A;  2HTM E;  3NJT A;  4G3X B;  2K9X A;  3RNG C;  2BS3 B;  4GGQ A;  1V86 A;  2ZPN A;  1HQR D;  1QLB B;  3BYT B;  2FUH B;  2ZNV C;  3AE9 B;  3EGR A;  5HHD G;  4AQ7 A;  1UD7 A;  1E7U A;  2KMC A;  3W2D A;  2AL3 A;  2WYQ A;  2KXJ A;  4GMV A;  2W54 A;  1Q1O A;  2IZV B;  4FJY A;  3CST A;  3IT4 B;  1F2R I;  1TKY A;  3MC0 B;  3C0R B;  4H2A A;  2LXA A;  2WXL A;  3KWL A;  2IO3 B;  2JUO A;  3IXS A;  1ZW7 A;  4DHZ E;  1T5X D;  4W9G A;  4A90 A;  1JWS D;  4RGT A;  1KLG D;  5G55 A;  1IGD A;  2LVO A;  1WFY A;  1WXV A;  5D2M B;  1C9F A;  4IM2 A;  2LXC A;  4XGA B;  3Q2A C;  4ZRJ A;  1XEE A;  3R2T A;  3ZJU A;  2KDB A;  4K1R B;  4LLG M;  4XZ4 A;  1MVK A;  4MEL A;  1WE7 A;  3Q3F A;  4RMA A;  1N6Z A;  4MH8 A;  1WGY A;  2D10 A;  2KVZ A;  3M63 B;  5EDS A;  3AEF B;  1KLV A;  2J42 A;  3HUI A;  1HA5 A;  4II3 B;  4HVB A;  2WDQ B;  4BVU C;  2CHW A;  1S1Q B;  2IDY A;  4A3P A;  3WAN A;  1C4A A;  2K3U A;  1BXT A;  5JHA A;  2C7M B;  3VFK A;  1E8X A;  4DXG A;  2BBC A;  2O6V B;  2BS4 B;  4DBG A;  2O2V B;  3AE3 B;  4ZYN A;  1FFU A;  2MJD A;  1AN8 A;  2AQ2 B;  1WX8 A;  1WY8 A;  1EF5 A;  3VQI A;  4WJO A;  2AYO B;  4NPN A;  3T9L A;  1WWT A;  1V9J A;  2RPQ A;  3W1Y A;  3VHT C;  4IM3 A;  3MJW A;  4XDD A;  2W9N A;  5C2T B;  4BZA A;  3WAO A;  2PW9 A;  1WRD B;  1VZ7 A;  4JX1 C;  4W9L A;  3ZRF A;  3KH0 A;  2JQR B;  2RDH A;  1PGA A;  1FXA A;  3PZ7 A;  4JGH B;  1ISN A;  2NCN A;  4J6I A;  1FNV A;  1RM6 C;  3OLM D;  1HTQ A;  2C5L C;  1VRA B;  4XC2 A;  4ARI A;  3K9O B;  2GMI C;  1CJE A;  5DCN A;  1Q0W B;  5LLI A;  1H7W A;  2KQ7 A;  3I63 C;  4O1N A;  5E6P A;  5JH5 C;  3MC9 A;  2E3T A;  4GLS C;  3H7P B;  4OVU A;  1GTE A;  2KNB A;  2ZW0 A;  1CZP A;  1VZ6 A;  3A9K A;  4A3O A;  5BMI A;  3OJ4 B;  3AM9 A;  2RDB C;  2CHZ A;  2JZP A;  3EEC A;  5BYQ A;  2GB1 A;  4MGI E;  1IGC A;  4CYE A;  1N5X A;  4NJ7 A;  3QAR A;  3QA8 A;  2K8C A;  3DOW A;  4KGS A;  2QIL A;  1SXT A;  1UH6 A;  2YEP B;  1AW7 A;  4N59 A;  3ZUN A;  3RN9 C;  2KO3 A;  4K7W A;  3AE8 B;  3KUD B;  1EF1 A;  2WLB A;  3ZRC A;  5BMG A;  2BVC A;  3ZDM C;  3PV1 A;  1WGK A;  2N9L A;  1IPG A;  4IG7 B;  3N30 A;  4MGZ E;  2WGS A;  2MBE A;  2WU5 B;  2KTR A;  4HRO A;  3ZNI D;  1YN3 A;  2KJ6 A;  2GLS A;  3DBR I;  2CS4 A;  2MH7 A;  4KX6 B;  4L2Y A;  2TSS A;  1EO6 A;  3CSF A;  4LNO A;  3ZVV A;  3Q8C A;  2LRW A;  3RCZ A;  3UQA A;  1PDX A;  4FHJ A;  1JWM D;  4HWI B;  2KK8 A;  4FAD A;  5E6N A;  4LNK A;  5TR5 A;  3VUY A;  4WIP A;  3EA6 A;  3QWZ B;  1HE8 A;  3L54 A;  1GJZ A;  2KOX A;  4WAA A;  4FJZ A;  2J52 A;  1EUV B;  2M56 B;  4MGK E;  1KTK A;  3VTV A;  4PK1 A;  1Y56 A;  3NUH B;  2CU1 A;  1ET9 A;  3URY A;  5EE3 A;  1KRH A;  1OTR B;  3AED B;  1UF0 A;  3SR6 A;  4EE2 A;  4LCD E;  3BY4 B;  5H92 C;  3VTW A;  2MBB B;  1ZE3 D;  4IUM B;  2L00 B;  3AE7 B;  3DBH B;  1SB3 C;  1WH3 A;  2DYO A;  3PPA A;  1GPX A;  1TKE A;  1C3T A;  3R66 C;  1XT9 B;  3RT3 B;  4NJ6 A;  2WDR B;  1RWS A;  4G11 A;  4KGR A;  3EFU A;  1OFF A;  1TIF A;  1UUP A;  3ZKJ C;  1F1H A;  4ICU A;  3DBL I;  3KYC D;  1P1A A;  2XNA C;  4URK A;  3M62 B;  3P1M A;  3IBE A;  1TGZ B;  1C4C A;  2C9W B;  4MM3 A;  2MBH A;  1WXM A;  1WF9 A;  1R4N B;  4K7S A;  1GG3 A;  4N9F 4;  2K8B A;  3PGE A;  3K9P B;  1WGG A;  3DHI C;  2IY1 B;  2KTR B;  1VDV A;  2GI9 A;  1XLQ A;  2ZZP B;  2NPT A;  2K25 A;  1A5R A;  2RR9 A;  3JSV B;  1XCT L;  2MP2 A;  4ARC A;  3U2S C;  4DXF A;  2OOB B;  3GOE A;  2K22 A;  4HCN B;  4M01 A;  1TKG A;  4JIO U;  1WGD A;  2J0K A;  4OZB A;  4TMA B;  2UWQ A;  3VAW A;  2DAF A;  3KUC B;  4BOS C;  1TZO A;  1U4A A;  1F2R C;  3KWV A;  1Q10 A;  5D3I B;  2NTS A;  2V0G A;  3FAH A;  3MFG A;  3A1Q B;  4RNA A;  3VR8 B;  2KD0 A;  4AWJ A;  4HK2 A;  1JRO A;  2GBK A;  3AEG B;  3HRD D;  4IWO A;  2N7E A;  3Q8E A;  1T3Q A;  2DZK A;  4WUR A;  3BK1 A;  4MGY E;  5FR3 A;  2ZW1 A;  2WS3 B;  1QOG A;  4HEA 1;  2WXH A;  1WX9 A;  2ON8 A;  2C7N B;  1Y8R C;  4II2 B;  1FCC C;  3DHG C;  3WIM A;  2INP E;  4FBJ B;  2KAN A;  4CQN A;  4M00 A;  1E5W A;  2M17 A;  4NAM A;  4GB9 A;  1CK1 A;  3VUX A;  1GB4 A;  3WCQ A;  3BVZ A;  1E8Y A;  2BGF A;  2HJ8 A;  3NOB A;  4MM3 B;  2BT6 A;  3ZXV A;  2JZ3 B;  3IG3 A;  2QCZ A;  3FKY A;  1OQY A;  2E6X A;  2GRI A;  3V6C B;  3KW5 B;  4DHJ D;  2IGD A;  1YX6 B;  1ROE A;  1JCK B;  4I6L B;  5LNK 1;  1T0Y A;  3RI7 C;  4FUL A;  4JPS A;  2LHE A;  3CMM B;  3BYY B;  4KGT A;  4OHJ A;  2MA9 B;  2RPV A;  2DZJ A;  3R2I A;  5FR6 A;  5AZH A;  2MP2 B;  1V1O A;  3QAQ A;  3PHW B;  2IGH A;  3TEZ A;  1I4X A;  1I7H A;  3ZTD A;  1VJK A;  2Y5B B;  1XLP A;  1AYF A;  4JWU C;  4BKS A;  2D3A A;  3TCA A;  3ZXR A;  2L52 A;  4W9I A;  1V6E A;  4BKS D;  2IPK D;  4LK0 M;  1XQQ A;  4C4V B;  3W1S A;  1RFA A;  3W9C B;  4FA6 A;  4YXD B;  5LXI B;  4GN1 A;  3TMP B;  2JVC A;  4W9E A;  3SD5 A;  3LYY A;  3ZW3 A;  4OVZ A;  2PE6 B;  1FXT B;  2BWE S;  5DPS A;  2FAZ A;  2Z0D B;  4ICV A;  2JPH A;  3ML8 A;  3L4P A;  1WXQ A;  3BIN A;  3MTN B;  3UI3 A;  3CF4 A;  1WXS A;  1RRB A;  2I2Y A;  3L13 A;  4ANX A;  2PLP A;  3DVG Y;  4D2K A;  2INC C;  2RMM A;  2KWV B;  1ET6 A;  1HTO A;  1YIW A;  2LGD A;  3TBL D;  2WXR A;  3V3X A;  2FNJ B;  5BMH A;  4E71 A;  1HEZ E;  5D6J B;  5C3J B;  1NVI D;  3R3M A;  2M19 A;  1ZGU B;  1G6J A;  1FO4 A;  4MJS A;  4MH0 E;  5J2R A;  1DOX A;  1GC6 A;  2KN4 A;  4NAW B;  1JAL A;  3KQ4 A;  2O2V A;  1J8C A;  3DPD A;  3GB1 A;  1MHH E;  3VUW A;  2K8H A;  2BS2 B;  3NS1 A;  3IT6 B;  5IN7 A;  1WI0 A;  2LMC A;  2SEB D;  3ZDT A;  3E9S A;  1TS2 A;  3AXC A;  4GU2 A;  3ZIM A;  2NBV B;  3QCA A;  3KLS X;  1SJE D;  1TT5 B;  4NJC A;  1SSN A;  4OZC A;  1UGM A;  1F52 A;  2AWT A;  3H9D A;  1OQQ A;  2WX0 A;  3VH3 B;  1ZKH A;  2K6Q A;  4UDU C;  4TSS A;  1D5M C;  2R2Q A;  2INN E;  3N3K B;  2KDE B;  5E6O A;  4RH6 A;  2FID A;  3A4R A;  1J0G A;  1D4B A;  2BF8 B;  1EU4 A;  1JW9 D;  2EKE C;  3Q8F A;  3H7S A;  4WQM A;  1F77 A;  2DAJ A;  1FPY A;  2FUG 1;  3ZYY X;  5G2N A;  2RGF A;  2ZJD A;  5AZF A;  3VRB B;  3P2B A;  1GAQ B;  3I9V 1;  2GBN A;  2W3R A;  3H7P A;  2OHF A;  3TJP A;  3ECI A;  1PFD A;  3C19 A;  2H88 B;  2PE9 A;  4RF1 A;  4FN2 A;  4KDL B;  3U8Z A;  2Q5W D;  3N20 C;  2AQ3 B;  4EKU A;  4ZRQ A;  2XK5 B;  4YT0 B;  4BBN F;  2LJ5 A;  2H89 B;  2MWS B;  5AEK B;  4L1B A;  3U7Z A;  4MSQ B;  5GXG B;  3SU8 X;  5J18 A;  1P9D U;  2NMQ A;  3U30 A;  3BVG A;  4F8C B;  4W9H A;  1F0Z A;  2OJW A;  3T8M A;  4EFO A;  3NVZ A;  2BWF A;  1EWC A;  4MJS B;  4B0M A;  5AZG A;  1ZUD 2;  3BVM A;  1QQR A;  4P7I A;  4YSZ B;  3P63 A;  4YTP B;  4OVV A;  1L5P A;  4GXB A;  2DZM A;  2WU2 B;  4EZJ A;  3H8H A;  4JL9 A;  3APF A;  2KWC A;  1WM2 A;  1E8Z A;  2M0X A;  4Q2J A;  4W9C A;  1GNU A;  1YOV B;  1MFW A;  3EFC A;  2Y3A A;  5FKA C;  1H7X A;  2SAK A;  4NNJ B;  3DBH I;  5EE0 A;  3Q3J A;  3AN1 A;  1HXY D;  2BPS A;  1TYG B;  5AUI A;  1KH0 A;  2XN9 C;  1MJD A;  4HJG E;  1YMH E;  5HI1 A;  2QDF A;  2WXJ A;  1YQB A;  1E10 A;  3HVZ A;  2KVR A;  1FNW A;  3RPF C;  2J53 A; 
#chains in the Genus database with same CATH homology
 1ZE3 D;  5TSS A;  3B9J A;  3AE7 B;  1SB3 C;  2MEK A;  2IJ0 A;  1DYQ A;  3AH7 A;  2DYO A;  3BII D;  1GPX A;  3AE5 B;  4FXC A;  1TKE A;  1N62 A;  2DBY A;  5H8Y E;  1L0V B;  2J4X A;  2WDR B;  1RWS A;  3BZD B;  3DWG C;  4KGR A;  3B2F A;  4WH4 A;  1SE4 A;  3P4Q B;  1OFF A;  1UUP A;  1FMA D;  2ONQ A;  4JWS C;  4RGM A;  2JXT A;  1VZ8 A;  2PTL A;  1V97 A;  2XNA C;  4WAF A;  1FCL A;  1DGJ A;  4HRS A;  4MAC A;  1SF0 A;  2WXI A;  3AV8 A;  3P1M A;  1FNU A;  2V4I B;  1K50 A;  2LGI A;  1C4C A;  4XWT A;  4ZHP A;  3W5U B;  3AEB B;  2JYE A;  1MI0 A;  2PKO A;  4HKZ E;  1K53 A;  5E6J A;  1L4Z B;  1C76 A;  1KFY B;  1N63 A;  1YJJ A;  1I4Q A;  2WP9 B;  2FE8 A;  4B0E A;  3P4P B;  2G1E A;  1B1Z A;  4ITK A;  4N58 A;  4TQ0 A;  1K51 A;  1STE A;  4IKG A;  1J7C A;  1PGX A;  1DOY A;  1V1P A;  2EEL A;  4ZYS A;  1VDV A;  2BB5 A;  2GI9 A;  1YQ4 B;  3AB5 A;  3LXF A;  1XLQ A;  1TY2 A;  4XWW A;  1NEN B;  2PMV A;  1WYG A;  2Y5P A;  1SJH D;  3AEC B;  5BYR A;  1SBB B;  4HKQ A;  2N7J A;  1XCT L;  4TQ1 A;  2LFI A;  1TS5 A;  4ARC A;  1M4V A;  1UNS A;  1XXG A;  3U2S C;  5HG2 A;  4C80 A;  5G5G A;  3AE4 B;  4DXF A;  2K22 A;  2WXG A;  2WXF A;  3NVY A;  1TKG A;  4L23 A;  1LO5 D;  4C7Y A;  1HZ6 A;  4OZB A;  1SE2 A;  4TMA B;  2JYT A;  1RYJ A;  4RCO A;  1D5X C;  4IDI A;  5JXV A;  1E0Z A;  1TZO A;  1F2R C;  4LTU A;  1GB1 A;  3KWV A;  1Q10 A;  1XCQ L;  2WXK A;  4ZOH C;  5D3D A;  5D3I B;  2NTS A;  2V0G A;  2JSV X;  2CJN A;  3AE6 B;  3FAH A;  3MFG A;  1OQR A;  5EE1 A;  4RNA A;  2X38 A;  1ESF A;  3VR8 B;  4KKJ A;  4N6E B;  2KAJ A;  3P4R B;  1JRO A;  2BW2 A;  3R8B A;  2WXQ A;  3FC4 A;  3Q69 A;  3AEG B;  3HRD D;  3Q8E A;  3TEX A;  1BML C;  3SFE B;  1J7B A;  1ZXH A;  1EM7 A;  2LJI A;  5HFY A;  1T3Q A;  1T6B X;  3IAS 1;  4WUR A;  2AX5 A;  3BK1 A;  3ZQ4 A;  1JWU D;  5FR3 A;  2ZW1 A;  2WS3 B;  2WXP A;  1E9M A;  1FXI A;  1I4G A;  1QOG A;  2D5G A;  1KF6 B;  3AEA B;  2L1A A;  2LHD A;  2WXH A;  3J9C A;  4HEA 1;  3EUB 2;  3NVV A;  3ZJT A;  2ON8 A;  2CU3 A;  4YSY B;  1FCC C;  2VZK B;  4ZRP A;  3VRA B;  3GP7 A;  3P42 A;  1KLU D;  2INP E;  1MPE A;  1ACC A;  2QMT A;  3V05 A;  4CQN A;  2BYT A;  1ZOY B;  2IGG A;  1ZP0 B;  1N5W A;  2DLB A;  2K5P A;  4NAM A;  1CK1 A;  1GB4 A;  3WCQ A;  3BVZ A;  1IBX A;  3AE2 B;  2WQY B;  1FEH A;  2MJ3 A;  2R61 A;  2M0A A;  5G5H A;  2V3P A;  1CQV A;  1EU3 A;  2JU6 X;  2DYM A;  1XF5 L;  4MM3 B;  1YQ3 B;  2BT6 A;  2VZK D;  4JE3 B;  2KQ4 X;  3E56 A;  3Q8A A;  4R3D A;  2HTM E;  2E6X A;  2GRI A;  2K9X A;  1UWX A;  2QEJ C;  2BS3 B;  2IGD A;  1ROE A;  1JCK B;  1HQR D;  1N61 A;  5LNK 1;  5BYS A;  3AMZ A;  1V1P B;  2PIA A;  1QLB B;  4A55 A;  4JPS A;  2W3S A;  3BYT B;  1VLB A;  2LHE A;  1YNT E;  3AE9 B;  3EGR A;  1YN5 A;  2PVG C;  5HHD G;  4AQ7 A;  3BYY B;  4KGT A;  4OHJ A;  1A70 A;  3W2D A;  4XDC A;  1TJE A;  2RPV A;  1C78 A;  4YTN B;  2W54 A;  3R2I A;  2CJO A;  2JWU A;  2KDM A;  2QJL A;  3IT4 B;  3ETR A;  1NEK B;  1V1O A;  1F2R I;  2IGH A;  1TKY A;  3TEZ A;  3MC0 B;  1I4X A;  1VR9 A;  1I7H A;  2Z8L A;  2WXM A;  4PT5 A;  4H2A A;  1VJK A;  2WXO A;  2WXL A;  3KWL A;  1XLP A;  3IXS A;  2EKI A;  1AYF A;  4JWU C;  1GOZ A;  2WXN A;  3HVD A;  3MP9 A;  2L52 A;  1T5X D;  4A90 A;  1JWS D;  4MT5 A;  4RGT A;  4C56 C;  2IPK D;  4LK0 M;  1FRD A;  1KLG D;  3W1S A;  5AUK A;  1I4R A;  1IGD A;  3W9C B;  4YXD B;  2DWQ A;  2QIE B;  3SEB A;  1C9F A;  3C8Y A;  3PZ8 A;  1XEE A;  3R2T A;  2MJE A;  3ZJU A;  4LLG M;  3LYY A;  1TY0 A;  1XO3 A;  1L0X B;  1AWD A;  1MVK A;  4OVZ A;  1L4D B;  4OW0 A;  1R7S A;  1D6E C;  4MH8 A;  3L4P A;  3AEF B;  4YWG G;  1E7P B;  1WXQ A;  2J42 A;  3HUI A;  2Y5C A;  2FBW B;  1HA5 A;  1QKZ A;  2LUM A;  3UI3 A;  1QOA A;  2WDQ B;  3NVW A;  3CWI A;  3CF4 A;  1ZDV A;  2RDG A;  2IDY A;  1JQ4 A;  1C4A A;  2K3U A;  1BXT A;  2I2Y A;  2PLP A;  4D2K A;  3MHZ A;  4DXG A;  4RGO S;  2RMM A;  1ET6 A;  2BBC A;  2WXR A;  2YEP F;  2BS4 B;  3V3X A;  5BMH A;  3AE3 B;  1YN4 A;  1FFU A;  1HEZ E;  5C3J B;  1NVI D;  3TUO A;  2M19 A;  2MJD A;  1L6V A;  1AN8 A;  2AQ2 B;  1FO4 A;  2HDE A;  1I4P A;  4XE0 A;  1SE3 A;  3U4E G;  1I4H A;  1IBX B;  1PYW D;  2PVO D;  2KAC A;  3W5V B;  3VQI A;  1DOX A;  1PUT A;  2KN4 A;  4NAW B;  4DQO C;  1JAL A;  4C7Z A;  1UGJ A;  3KQ4 A;  1WWT A;  2W55 A;  1D5Z C;  3BWU D;  1GT8 A;  3GB1 A;  2K0P A;  1MHH E;  2L83 A;  3NRZ A;  3NS1 A;  2BS2 B;  4XDD A;  3IT6 B;  1QF6 A;  2LMC A;  2SEB D;  3BK2 A;  2B76 B;  5C2T B;  1RFK A;  1JRP A;  3MJ5 A;  1FFV A;  3E9S A;  2WDV B;  2PW9 A;  3AEE B;  1VZ7 A;  1TS3 A;  4ZHO A;  1C79 A;  1L0Y B;  1TS2 A;  4JX1 C;  3U52 E;  2JQR B;  2RDH A;  1PGA A;  1FXA A;  3PZ7 A;  1FNV A;  1RM6 C;  3KLS X;  1WRI A;  1ZPS A;  1SJE D;  4NJC A;  4GDL B;  4NZL B;  1B9R A;  1SSN A;  4OZC A;  1VRA B;  1IUE A;  1JWA D;  4A6Q A;  1OQQ A;  1WSP A;  4P6V F;  4ARI A;  4UDU C;  1CJE A;  1C77 A;  1FRR A;  4TSS A;  4WWM A;  3FIL A;  1JWB D;  1D5M C;  1DOI A;  1H7W A;  2INN E;  3PO0 A;  3P4S B;  4O1N A;  1NYQ A;  1ZXI A;  1HZ5 A;  2E3T A;  3O13 A;  4GLS C;  4RH6 A;  1K52 A;  3RFZ B;  2OED A;  1D4B A;  1GTE A;  3SFD B;  1EU4 A;  2ZW0 A;  1VZ6 A;  1CZP A;  1JW9 D;  3Q8F A;  5BMI A;  2G9H D;  4WQM A;  1F77 A;  3Q8B A;  3TEW A;  2FUG 1;  3ZYY X;  3AM9 A;  4IOI E;  1E6E B;  2LEK A;  2JZP A;  3OWE B;  5BYQ A;  1BUI C;  2GB1 A;  1IGC A;  1N5X A;  4US9 A;  3VRB B;  1GAQ B;  3I9V 1;  2W3R A;  4KGS A;  2QIL A;  1SXT A;  2YEP B;  1J7A A;  2OHF A;  1XLN A;  1AW7 A;  4N59 A;  1PFD A;  1ZDX A;  2H88 B;  2AQ1 B;  5D7G A;  3IAM 1;  4RF1 A;  3AE8 B;  4RFB A;  1QOB A;  1QT9 A;  2WLB A;  2Q5W D;  4AS1 A;  2AQ3 B;  5BMG A;  1YJI A;  3B2G A;  4ZRQ A;  4OZA A;  5EE9 A;  3AE1 B;  4YT0 B;  1FM0 D;  2H89 B;  2BTE A;  4L1B A;  4USA A;  4RGN A;  3U7Z A;  1QOF A;  1XLO A;  5GXG B;  3CIR B;  1WGK A;  2N9L A;  1SEB D;  1V8C A;  5MPO A;  4GDK B;  2NMQ A;  3BVG A;  1L6U A;  1MHX A;  1NI3 A;  1F0Z A;  2JX5 A;  2KMM A;  4US8 A;  4A8X C;  2WU5 B;  4HRO A;  1YN3 A;  1P7E A;  2QSD A;  3NVZ A;  1EWC A;  3TEY A;  4B0M A;  3LB8 C;  1P7F A;  1ZUD 2;  2N0S B;  4KKI A;  3BVM A;  1QQR A;  1PGB A;  2MH7 A;  4KX6 B;  2L32 A;  2N9K A;  4YSZ B;  4L2Y A;  3ZGZ A;  1GTH A;  4YSX B;  3P63 A;  4YTP B;  2TSS A;  4J3O D;  4P16 A;  2V3N A;  4RF0 A;  3ABV B;  1L5P A;  1QIL A;  3Q8C A;  1PDX A;  2ICI A;  2WU2 B;  3H8H A;  1JWM D;  3T3O A;  2KWD A;  1EWY C;  2WNM A;  1FIQ A;  4WIP A;  3EA6 A;  1C4P A;  1TS4 A;  2ACZ B;  2BB6 A;  4A9A A;  4Q2J A;  5FK9 C;  3N9Y C;  2Y3A A;  2J52 A;  2I38 A;  3I57 A;  2M56 B;  4M0W A;  5FKA C;  1H7X A;  1KTK A;  1SIJ A;  2SAK A;  1FD6 A;  1Y56 A;  3TSS A;  1UWM A;  5EE0 A;  3NUH B;  3T3N A;  1ET9 A;  2NTT A;  3AN1 A;  1ENF A;  1HXY D;  3URY A;  5EE3 A;  1TYG B;  1JML A;  5AUI A;  3NZ3 A;  5T8I A;  1KH0 A;  1KRH A;  2W82 A;  2XN9 C;  3AED B;  4REZ A;  5I4D A;  4HJG E;  1YMH E;  5HI1 A;  3SR6 A;  3GS2 A;  2WXJ A;  4EE2 A;  1NYR A;  1E10 A;  3HVZ A;  4YTM B;  3FIL B;  3VR9 B;  3ZJV A;  1FNW A;  5H92 C;  3RPF C;  3DWM A;  2J53 A;  1N60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...