3AE3B

Crystal structure of porcine heart mitochondrial complex ii bound with 2-nitro-n-phenyl-benzamide
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
b'PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Nitro-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 63
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae3B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae3B01
1QOBA 1DOIA 1QT9A 3NVVA 5EE0A 3NVZA 2PVOD 3W5UB 3AE9B 3VR8B 1E6EB 1NYRA 4ZHPA 2LEKA 1E10A 1F0ZA 1GTHA 3CF4A 3VR9B 1TKYA 1XLNA 4P6VF 1DOXA 4JWUC 3P4RB 1CZPA 3AE7B 2EKIA 1ZP0B 3NVWA 2M19A 3P1MA 4N59A 1QLBB 3AEGB 3P4PB 1A70A 1SIJA 5G5HA 1PDXA 2Q5WD 3DWMA 4JX1C 1E9MA 1FRRA 3AE2B 3AE8B 2BS4B 1YJIA 1ROEA 4YTMB 1YQ3B 2PKOA 3VRAB 1XLOA 1RYJA 2K5PA 2MJ3A 2QIEB 1KF6B 4YXDB 1JWBD 1OQQA 3AE4B 2FBWB 2PVGC 3AH7A 4KX6B 1IUEA 3AECB 4YT0B 1L0VB 1AYFA 3AEBB 1EWYC 1FXIA 1L6VA 1RWSA 1WGKA 3ABVB 1FMAD 2WQYB 1JRPA 2MJDA 3AMZA 4C7YA 1FM0D 2CJOA 3B9JA 5EE1A 3AEAB 3CWIA 2H89B 5C3JB 3NVYA 2WLBA 4WQMA 2W3SA 1QOFA 3L4PA 1OFFA 3B2GA 2MH7A 1JQ4A 1VDVA 5MPOA 2HTME 2B76B 3W9CB 5GXGB 2E3TA 1OQRA 2WDVB 1YJJA 4LTUA 1J7CA 1H7XA 1N62A 4C80A 1QF6A 2WS3B 4N6EB 4FXCA 5EE3A 1JW9D 1E7PB 2M56B 3VRBB 5G5GA 1NENB 1FXAA 5H92C 1NEKB 3EUB2 2WDRB 1J7BA 4YSXB 1SF0A 1R7SA 1N5XA 4IDIA 1RFKA 4WWMA 1GPXA 4YTPB 2K9XA 2CU3A 2W54A 3B2FA 3AEDB 3AEEB 2WDQB 3P4SB 1JWAD 2DBYA 2G1EA 1ZOYB 3AM9A 3HVZA 4US9A 2WP9B 1WXQA 2BT6A 1DOYA 4YTNB 1FRDA 1ZXIA 1B9RA 1GT8A 1I7HA 3LB8C 1QOAA 1QOGA 3ZYYX 3DWGC 4HRSA 1WYGA 4N58A 1AWDA 1N5WA 1XLPA 2DWQA 1GAQB 1NI3A 1V97A 1KFYB 5AUIA 4USAA 5EE9A 5AUKA 1FFVA 3AE6B 1JALA 1N63A 4C7ZA 2JX5A 4ITKA 1XO3A 2BS2B 2L52A 1CJEA 1WRIA 1RM6C 1VLBA 1ZUD2 2CJNA 2KAJA 3NRZA 2H88B 1PUTA 1V8CA 1TKEA 1PFDA 2KMMA 2MJEA 1GTEA 3KWLA 3PO0A 5C2TB 3P4QB 1J7AA 2Y5CA 4ZOHC 3SFEB 3W5VB 1KRHA 2N0SB 3HRDD 1DGJA 2AX5A 3AV8A 1YQ4B 1NYQA 1JROA 4JWSC 4HROA 1FFUA 2JQRB 2OHFA 3RPFC 3CIRB 3AE5B 1H7WA 3P63A 3SR6A 1VJKA 2WU2B 1NVID 2PIAA 3HUIA 3FAHA 1N61A 2L83A 1N60A 3LXFA 2W55A 3FC4A 3BIID 1SB3C 4ZHOA 3AB5A 4US8A 1WWTA 3AN1A 3AE3B 3AEFB 3ETRA 1TJEA 1TKGA 1XLQA 1E0ZA 2QJLA 2WU5B 3WCQA 1T3QA 1FO4A 1L6UA 2W3RA 4YSYB 1L5PA 1TYGB 4A9AA 1FIQA 3AE1B 2ACZB 1UWMA 2K22A 3NS1A 5H8YE 2BS3B 4YSZB 3SFDB
chains in the Genus database with same CATH superfamily
1QOBA 2AQ1B 4GB9A 5D3IB 3MHSD 4EEWA 2J0JA 4P6VF 1WE6A 3AE7B 2WXKA 3GE3C 3V62A 1ZKHA 1YQ3B 2AWTA 1OQQA 4YT0B 3GB1A 4X57B 2WXGA 2RSUA 2ZVOA 3I5JC 5D94A 3MP9A 2WLBA 4MGIE 1D3ZA 4BVUC 2NPTA 1JQ4A 1V1OA 2KOXA 1V1PA 2LUMA 3A9JB 2MWSB 2XK5B 1WYWB 4FXCA 2RPQA 1JW9D 1TT5B 1MJDA 1NENB 4BFRA 2L0FA 1SF0A 4G0NB 2KC2A 1E8XA 1HZ6A 2DBYA 3IG3A 2INPE 1P3QU 3A9KB 2IZVB 4KIKB 2N7DA 3ZNID 1N5WA 1S1QB 3R2IA 3KH0A 3WAMA 4GDKB 3I57A 1TKEA 3OAWA 2IO2B 3LJ3A 1SE2A 3HRDD 2GBMA 3RNBC 4LNNA 2A5UA 3O13A 2VZKD 2L83A 1N60A 4JPSA 3K9PB 1BT0A 1EF5A 1V49A 1EF1A 3AN1A 1WGGA 1TJEA 2IDYA 3W2DA 4MJSA 4ICVA 2KTRA 1L5PA 4LDTD 2ONQA 2KJ6A 3NVVA 5HFYA 3VR8B 2JPHA 1NDDA 3VR9B 1FXTB 4JWUC 1MG8A 4HDOA 3DBHB 1I4GA 4ANVA 4KKIA 5TR5A 4LK0M 2K8HA 1AYFA 4FJVB 3BVMA 3AEAB 2DX5B 2EELA 2CR5A 3IXSA 5I4DA 4REZA 2WS3B 4O1NA 1D6EC 1BMLC 1E7PB 4HJGE 4I6PA 1SE4A 3TEWA 3TIXA 3DPDA 1F52A 2W54A 1CQVA 2N1VA 4WAAA 1KLGD 4FHKA 3L10B 4NJ6A 3Q8EA 4HRSA 5IO9A 2Y5BB 5L83A 2M8SA 1B1ZA 5D7GA 3DBHI 1IBXA 1TIFA 3PZ7A 3JVZX 3PLVA 4IM2A 4GMVA 2MJEA 1XF5L 2LJIA 2QCZA 1LFDA 1YN5A 1V80A 5D6JB 1T0YA 2BYEA 1IPGA 3E9SA 1I42A 2BF8B 1VCBA 3MC8A 3V61A 4TSSA 1SJHD 3LXFA 2WXHA 5JHBA 3AULA 4GXBA 4DXGA 1Q1OA 2KJRA 1J8CA 2K0PA 3UGBB 2BWES 5DPSA 3WALA 5LNK1 4EOYA 1HTOA 1KTKA 3SFDB 2HD5B 2INDC 2LFIA 1Q0WB 2IBIB 2D07B 3DQVA 2GBRA 4B0MA 3AE9B 2LEKA 3P1MA 3PREA 2LHEA 2I1JA 1KF6B 1T0SC 3MHZA 1IUEA 2KNBA 1TY2A 3AEBB 2DZJA 4C7YA 3BYTB 3N3KB 2GBJA 4A6QA 4M00A 5JH5C 1ZE3D 4F7ZA 1VDVA 2GBNA 1ET6A 1WMHA 1H4RA 1J7CA 1YJ1A 1QF6A 3EFUA 3Q3OC 2M56B 2X38A 4M0WA 4RF1A 4BBNC 2YVCA 4NAWA 1WGHA 3WAOA 4JLCA 3ZNHB 3RNFC 2WDQB 5BYQA 2BYTA 1TTNA 3VXWA 3WAPA 2O2VA 2KT7A 2BT6A 1JMLA 2DYOA 2PJHA 1V2YA 2PW9A 3H9DA 1EU4A 3ZJTA 3QWZB 5AUIA 2C7MB 1FNVA 3TEXA 5BMIA 4WWOA 2NBVB 2CJNA 2DNFA 4HVBA 2KMMA 4IM3A 3ZJVA 4BOSC 2N0SB 2G3QB 3PRMB 2IY1B 3AV8A 4W9LA 2DAFA 2HTHA 3EFCA 1MG4A 1CMXB 1YX5B 2PE9A 2C7NB 3N1ZC 4Q2JA 4ZYNA 4M8MA 3UI3A 2CHWA 3FAHA 4RGMA 2L3ZA 2K8BA 4MM3A 3RZWC 2C60A 3SU8X 2QJLA 2KKCA 1XCTL 4HPPA 1TYGB 1I4QA 3DCGA 4H2AA 2MBOA 2WXRA 2CU1A 1JWUD 5CTRC 1I4PA 2N9PC 4EUTA 4WJPA 3KYCD 1GG3A 1CZPA 3QK0A 3A33B 1WIAA 3WANA 3KUZA 2R2OA 3E56A 2SEBD 4K7SA 2WXNA 1IP9A 4BZAA 4K81A 3QCAA 1JCKB 4A3OA 1FM0D 4WQMA 3RMKC 1ISNA 1P0RA 2LGIA 3S2AA 1WE7A 1F77A 1Y8RC 1AN8A 4N6EB 4DXAB 3VRBB 4ZRQA 1OGWA 2J4XA 1LM8B 3GP7A 2KHWB 1J7BA 2LGSA 4IDIA 3TEYA 5DPWA 4US9A 2K3UA 3TBLD 4YTNB 2O6VD 2ZVNA 4PS8A 4AOFA 3I3TB 5FK9C 3PHWB 2M4NA 3Q8FA 4ZYSA 4F1SA 4WJQA 1WX9A 1ZDVA 2BKFA 4DQOC 1N63A 1K51A 1XO3A 2NTTA 2OJRA 2KAJA 2FCMA 3NRZA 3RT3B 3RFZB 2K39A 1E8ZA 3PO0A 1G6JA 1L0YB 1YQ4B 2KMCA 2BKRB 5IKCM 2JU6X 1Z5SB 1WM2A 1C77A 1IGDA 2WHIA 4BKGA 1OEYJ 3M95A 2KFKA 1HE8A 3NOBA 3EECA 3HIZA 4YL8A 5LXIB 2DAJA 1A5RA 3N1YC 2YEPF 1DOIA 3NVZA 1MHXA 4ZRIA 3DHIC 4TQ0A 2KDBA 2R2QA 3JSVA 2M19A 1KH0A 1A70A 2ZPYA 3DWMA 1UELA 3CSFA 4HKZE 1U4AA 3AE2B 2UWQA 4YTMB 2D2QA 2FBWB 4ASWC 1V1PB 1M94A 3Q2AC 4XGAB 5EE1A 2KLGA 1NI2A 3MC9A 3JW0X 3R2TA 4B95A 2HTME 4JQWC 1OQRA 1EUVB 1J19A 2V4LA 4NNJB 5HHDG 2VRRB 4KVGB 5HG2A 2FCNA 4R3DA 2N9LA 5IAAC 2BTEA 2HJ1A 4UDUC 2N4FA 1KOTA 1FRDA 2DZKA 1F2RC 2KTFA 4NJCA 4NJ7A 2AYOB 2BS2B 1VLBA 4BKTA 3ML9A 4KZCA 5DPTA 2KXJA 3V60A 4LNIA 5CHFA 2QILA 4AJWA 1V86A 2LRUA 3VTVA 2L8JA 4K7UA 3PT2B 4GOCA 2C7HA 3MJWA 4NY0A 3AE3B 1UUPA 2WXPA 2ASQA 3BYYB 4MEMA 2J42A 4ZHPA 1F0ZA 4KGSA 3HK0A 4ZRKA 3JYUA 3M3JA 1I4XA 1ZP0B 2WWZA 1QLBB 3AEGB 4HJKA 3QJZA 4WJOA 1TGZB 2GI9A 4DHZE 2K5PA 3U4EG 3MC0B 2XEWA 2MW5A 2BPSA 3IT6B 1L4ZB 3T3OA 2HJ8A 2Y5PA 3BVGA 4BKSD 1XT9B 3P2BA 4C56C 1TZOA 2FCSA 1T0RC 3AEDB 2VZKB 2RPVA 1Q5WB 4WJNA 4WH4A 2LUEA 1IBXB 4DHJD 3R66C 3RULA 3Q14C 3SHQA 4EKUA 2X8XX 1PGBA 3R7QA 4LDTB 2DWQA 3DHGC 1WX7A 4GDLB 4ARIA 1TY0A 3NJTA 3TJPA 1XD3B 1YNTE 2BB6A 2JRHA 1WSPA 1L4DB 3W5VB 2RDGA 1E8YA 3U52E 1LXDA 5IP4D 4MELA 4L23A 1RFAA 4II2B 1K8RB 2JSVX 3BIID 4TUUA 1SB3C 4ZHOA 2WXQA 3CMMB 4C4VA 3L17A 2WU5B 3PS6A 1V9JA 4RMAA 2GRIA 4YSYB 1ZPSA 2J52A 4RNAA 2K22A 1TS5A 2WGSA 3ZDTA 2KFJA 2Z8LA 2KD0A 3W5UB 1WXMA 1HA5A 3ZLZA 1E8WA 3ALBA 2QDFA 4CO7A 1E9MA 3AE8B 1TS3A 4BKSA 4YXDB 2JYTA 3AMZA 3DVGY 2ZW1A 1GJZA 2MBBB 1P98A 2HE7A 1ET9A 4E3CA 1WM3A 3FILB 3NY5A 2MBHA 4URKA 2N7EA 3V6EB 4NAWB 4HDQA 1H7XA 2WNMA 4XE0A 4E71A 2KN5A 2V1YA 3ZNGC 3DBRB 2O2VB 2GMIC 3N20C 2WDRB 3Q3FA 2K9XA 2CU3A 3I9V1 2G1EA 3QA8A 3DOWA 4MACA 4PYZA 2K25A 4W9IA 4P16A 1GC6A 3ZYYX 2E6XA 2LVPA 3DWGC 4ICUA 3VTUA 3PRPB 1LO5D 3PTFC 3VHTC 3H7PA 2QHOA 2IJ0A 2L52A 3C19A 3KWLA 1YN3A 5C2TB 4W9HA 2KN4A 4HPLB 3OJ3A 2V0GA 3ZXVA 4FBJB 4HK2A 4MM3B 4MSQB 3AU5A 2PIAA 2WXFA 1HQRD 2NMQA 2W55A 4MH8A 4LCDE 3ML8A 3ETRA 3LDZE 3A4SC 4K3CA 1E5WA 1MHHE 5HKHA 3DBRI 3SEBA 2MRPA 1C1YB 4M01A 2N9KA 2JWUA 1FD6A 4JE3B 3Q8AA 5DCNA 5CX3A 2MBEA 3KW5B 4JIOU 4EZLA 2KLCA 1XCQL 2L00B 3VH3B 3VQIA 3A9JA 2FIDA 1P7EA 2QIEB 2XK5A 4JX1C 3DBLB 3ZO5B 1L0VB 5J2RA 2KX3A 3BK1A 2CJOA 4BBNF 3VDZA 1YQBA 3MJ5A 4DK5A 3X23A 2KDIA 1RRBA 2B76B 3OG5A 2JT4B 4AUQC 3A9KA 4KIKA 3W1YA 3VFKA 3DBSA 2D3GA 4FA6A 3ZUNA 5E6NA 5LXHA 4RF0A 2JXTA 3W1SC 2J53A 2XNAC 3Q3JA 3IT4B 2G45B 3LB8C 4S17A 1IYFA 1V97A 3APFA 2PEAA 4P1BC 5EE9A 3UIOB 2W82A 1V8CA 1P9DU 1GTEA 2LD9A 2GB1A 3DBLI 2KWVB 1PQSA 2KFKB 3L13A 3CIRB 1H7WA 1YD8U 2LRWA 3P63A 2WU2B 3SR6A 1QKZA 3DVGX 2LI5A 3FC4A 3AB5A 2N9EB 3LYYA 4PK1A 5CHWA 5AZGA 2NR2A 1SE3A 3TMPB 2ZNVC 4DDID 1FCLA 3JSVB 2C9WB 2BGFA 1WXAA 1WJ6A 5H8YE 3SD5A 1WJUA 3QIJA 3CF4A 3A4RA 1Q10A 3P4PB 5G5HA 1MI0A 1FRRA 4W9GA 4MT5A 2G9HD 1WJ4A 2JYEA 2MSED 2ZCBA 4A8XC 1L7YA 2PVGC 3AH7A 5BO4B 4XYCA 3VVWB 1E7VA 1FXIA 1EWYC 2KACA 1IGCA 2G4DB 4WURA 3APDA 3GE8C 5C3JB 4OW0A 1OEYA 2MH7A 2OJWA 2AQ2B 2M1MA 2TSSA 1FNWA 3PVLA 5GXGB 4JL9A 4C80A 3ZIMA 2JRIB 3PLUA 1RFKA 4QAYA 3B2FA 3W1SA 3URYA 4GGQA 3NHEB 2JXXA 2V3NA 1DOYA 1ZXIA 4A20A 2FCQA 1V81A 2NVUI 1QOAA 5AEKB 2BQQA 2D5GA 1QOGA 4W9JA 1XLPA 2Z0EB 2WX0A 3L54A 2RGFA 1PGAA 4MGZE 4USAA 1FFVA 3AE6B 1T6BX 2KZRA 2PE6B 1KLUD 1RM6C 4BOZB 2H88B 5IA7A 3ZW3A 2UYZB 4OVVA 4ZOHC 1KRHA 2KDFB 1STEA 4EZJA 2WXIA 3RPFC 2DHZA 2KQ7A 4AQ7A 1Z2MA 2K8CA 2M0AA 3I63C 1V6EA 2CHZA 4WWPA 1WWTA 4PS3A 2CKHB 2IYDB 2ICIA 4CHKA 1YMHE 3HM6X 1D4BA 2IO1B 1X1MA 2L05A 3U30A 2BS3B 3Q69A 3MFGA 1QT9A 1HEZE 1C4CA 3VAWA 3APCA 3KWVA 3NVWA 4ARCA 3HVDA 4K3BA 1WR6E 4CQNA 3RNGC 1ROEA 4J6IA 2DZMA 1L6VA 4MDKE 3TEZA 2MLBA 2JUOA 3VUXA 5BMHA 2YEPB 2WX1A 4W9DA 1FPYA 5FKAC 4C00A 4JGHB 1N6ZA 2D11A 3Q3MC 4HWIB 4WIPA 3PHXB 2INNE 4W9CA 3CSTA 2IO0B 1WJNA 2KX0A 2NPTB 2EMSA 2ZPNA 1SGHA 2MQJA 2N9XA 4B9KA 4WAFA 1UBIA 1WXQA 1H8CA 2IO3B 3KUCB 3Q3NC 2O6VA 3AU4A 2LGYA 2ON8A 3ENEA 4XDCA 2JWZA 2ZJDA 1NI3A 2AL3A 4C7ZA 3HM3A 4B0EA 3WIMA 3UQBA 1CJEA 1T0QC 1ZUD2 2IY0B 4AS1A 2OEDA 3M62B 2PLPA 1PYWD 2NCNA 3IFWB 1I4HA 3IHPC 3T3NA 1L0XB 2KVZA 2W9NA 3EHVA 1VZ7A 4C4VB 5J17A 1NVID 3DVNU 4US8A 3PSEB 2RR9A 2MX2A 1F1HA 2L1AA 2V9HA 3VUWA 1T3QA 4IWQA 2BBCA 4GN1A 2K6QA 3QARA 5JXVA 1OFFA 3AXCA 1WFYA 5JHAA 2CHXA 4TMAB 1E10A 1M4VA 1SIFA 4MJSB 5JZEB 4N59A 3UQAA 2KTRB 4GSWA 5C1ZA 4DHZB 4WWNA 1YJIA 3IAM1 2KQSA 4ACFA 4DHJB 3AE4B 2NS5A 4LNOA 4KX6B 1YJJA 1GB4A 1WGKA 3ABVB 1FMAD 2WQYB 3N1XC 3V6CB 2D3CA 2KANA 2UU7A 4PT5A 3ZGZA 4GLSC 3QC8B 1J0GA 1WXSA 2ZW0A 1VZ8A 3NZSA 3ZQ4A 1NEKB 4WWMA 1R4MB 5IN7A 4YTPB 2LXAA 3NS8A 3VTWA 2QEJC 1FNUA 3HVZA 4A3PA 4G3XB 3A1QA 2JZ3B 4MSMB 3H7PB 3OJ4B 3H8HA 1GT8A 2FUG1 4HXDA 1CK1A 2KDMA 4OHJA 2DENB 2R61A 4ITKA 2Z0DB 3J9CA 4KSKC 4IWPA 4RM9A 3VH4B 4A90A 1SEBD 4GIVA 3P4QB 1KJTA 1XQQA 3SFEB 4L2YA 1ENFA 1JROA 2DYBA 1T5XD 1TBEA 2JQRB 1Y56A 2PPHA 3HUIA 3KLSX 3ZJUA 1PGXA 2KJHB 2KMAA 5EDSA 1TKGA 5AZFA 3T8MA 4NQLB 2JZPA 5D2MB 2WDTB 1KLVA 3RNEC 1R4MI 4YSZB 2FNJB 5EE0A 2EMTA 2LZ6A 1E6EB 2N7JA 1NYRA 1GTHA 1L2NA 5J18A 1UF0A 2YLMA 3KQ4A 4XDDA 5AZHA 1XEEA 1SIJA 2Q5WD 2D10A 2BWFA 2FAZA 2PKOA 3VRAB 2MBQA 2MJ3A 2WXJA 3MTNB 4WQOB 1JRPA 1WF9A 4PS7A 2BYVE 3CWIA 2KC1A 4OVZA 2LVQA 2WXMA 3IBEA 3U7ZA 2WDVB 1VZ6A 1WH3A 1ZGUB 1C79A 2AEHA 2V3SA 5EE3A 2IGHA 3U2SC 2J0MA 4FJZA 3DHHC 5H92C 2V3PA 4RH6A 4IG7B 3U7DA 3AEEB 4W9EA 3P4SB 2DZIA 1WMHB 3ZNZB 4M8NA 2K6DB 1MFWA 3RN9C 1B9RA 2B3AA 4KKJA 5IOIA 4M0WB 1WGYA 1JRUA 4IM0A 1D5ZC 4ZRJA 1WRIA 4RCOA 2KYWA 4RM8A 2LJ5A 3UF8A 3BVZA 1BXTA 2XN9C 3O65B 3TL5A 3TCAA 1SSNA 4HKQA 2L7RA 1NYQA 4HROA 2BW2A 3KUDB 1UD7A 2LXCA 2V4IB 3QHTA 2G4SA 4HPMB 2BB5A 2J0KA 2LGDA 1EM7A 4BAXA 1L6UA 3EGRA 3ZTDA 1WY8A 2MCNB 2MP2A 4FHJA 2FIFA 3K9OB 4OZCA 2REXA 5BYSA 1HXYD 2DLBA 4AP4C 2KWUB 1GB1A 2NTSA 1I4RA 3NUHB 2BVCA 2JF5A 3PV1A 1XLOA 1E7UA 4JWSC 1TS2A 1FO4A 3H6NA 3PGEA 4A55A 1UZXB 3ONSA 3GOEA 1OTRB 4K1RB 5MPOA 2E3TA 4LTUA 3DVNV 1P7FA 1N62A 4KSLC 3V3XA 3PZDA 1S3SG 1SBBB 2WXLA 4NZLB 3L16A 3CF6E 4YSXB 1R7SA 1N5XA 1TZ1A 3PPAA 1D5XC 4GDLA 4MGKE 3AM9A 1K52A 4ZDVA 4I6NB 4LJPB 2WXOA 1AARA 4OVUA 1WYGA 3AI5A 4YWGG 2INCC 2AQ3B 5LLIA 1FEHA 4HCPB 1SXTA 2MA9B 4RGOS 3RUIB 3BK2A 4EZKA 4RGNA 1PFDA 2KO3A 3P42A 2ZCCA 5HI1A 5TSSA 1VR9A 4II3B 1QQRA 1DGJA 3D32A 4DBGA 4GDKA 1GC7A 1UNSA 4KZ0A 4IOIE 2ZNVB 4MGYE 3DDCB 3RI7C 2FUHB 4KDIC 4A9AA 5D3DA 4S0RA 3RD2A 1NBFC 4NAMA 4KV2A 4DDGD 3BY4B 1WXVA 2ZEQA 4MH0E 1YN4A 3B1LX 2PTLA 2I38A 1PDXA 4W9KA 3BINA 4D2KA 3FILA 2GLSA 1WGDA 3C8YA 3ZRCA 3L0WB 3X0WA 4L1BA 1D5MC 2MHJA 2QSDA 3WA0A 1RWSA 1ZXHA 2JVCA 2QMTA 2D3AA 3IVFA 3OLMD 2MJDA 3PRZA 2LGXA 2RMMA 4P1CC 2H89B 2W3SA 1XXGA 3B2GA 2ZZPB 1MVKA 2WYQA 5KHQA 5G5GA 1FXAA 1DYQA 1LQBA 1WR1A 1WZ0A 1P1AA 2KK8A 2C5LC 2L76A 3ECIA 2O6VB 1WRDB 3Q6BA 4RFBA 1WX8A 1JWAD 3FKYA 5CHVC 3RZFA 2SAKA 1WGRA 3GS2A 1ESFA 1ZDXA 1K53A 1GAQB 1KFYB 3H1UA 1C4AA 4OZBA 3R7RA 5AUKA 1JALA 4FULA 1R4NB 2NBUA 1PUTA 2DYMA 1KM7A 1UGJA 2J7QB 3ZRFA 1C9FA 3L08A 1FFUA 2L0TA 2D3BA 3AE5B 4B6WA 5G55A 2XBBC 2OOBB 3ZDMC 1MPEA 1QILA 4HLEA 5KHOA 3RCZA 3AEFB 3RNCC 3NG0A 5T8IA 4NPNA 1VRAB 4ANWA 2BYFA 3AE1B 2ACZB 1V5TA 4HEA1 5E6OA 3NS1A 2M17A 4W9FA 3N30A 3NZ3A 2PVOD 3V05A 5BYRA 1XLNA 3ZKJC 3P4RB 1ACCA 4E74A 1C3TA 2M0XA 5G2NA 1LGRA 2BS4B 2CS4A 1OQYA 3ZXRA 1RYJA 3C0RB 2JZZA 3AECB 1R4NI 2GBKA 1WZ3A 4F8CB 4FJYA 5DPRA 1E90A 3B9JA 2K1FA 5FR6A 3NVYA 1QOFA 1C4PA 3L4PA 1F9JA 2KDEB 1JWSD 4IKGA 3W9CB 4XX5A 4TKNA 2KVRA 3GZNB 1TS4A 3IAS1 2AL6A 1EWCA 1RAXA 1SJED 2NBWB 1UH6A 3A1QB 3EUB2 3SDLC 1GPXA 1EO6A 1GUAB 2PMVA 3B0AA 4AJYB 1HTQA 1JWMD 1YX6B 5BMGA 2LVOA 4M02A 3T9LA 4IW0A 2KWDA 1UGMA 4IUMB 3R3MA 1C78A 1AWDA 3QQ8B 1GNUA 3UIPB 2LASA 4LLGM 2JX5A 2LWPA 4DXFA 3B08A 5GMVA 1C76A 2N1WA 5C23A 4ANUA 1J7AA 2Y5CA 2IGDA 1SE9A 2EKEC 1I35A 2OHFA 4I6LB 1VJKA 4LNFA 4G50A 4CYEA 2I2YA 3GZNI 1BUIC 4J3OD 3RYTA 3EC8A 1E0ZA 4IWOA 3HHMA 1RLFA 1FIQA 5E6PA 4XWWA 2Z59B 4TV3A 4HCNB 4GU2A 4TQ1A 4EFOA 1YIWA 4OZAA 1AW7A 3EA6A 3BZDB 4P7IA 3UINB 2Y3AA 2A4ZA 1DOXA 1TKYA 2MEKA 4G11A 2EKIA 4RGTA 3M63B 3N9YC 3Q8CA 3N32A 1UWXA 1FCCC 4LJOB 4AWJA 1ZW7A 1VD2A 1JWBD 3WCQA 4FLHA 3QX1A 4KGTA 2GOWA 4EE2A 4LNKA 1F2RI 3RNAC 3ZTCA 5L95C 1WI0A 1K50A 2VH1A 3Q8BA 3KYDD 5FR3A 2LHDA 2QC8A 2LMCA 2RD0A 2FE8A 3TUOA 3VUYA 1V5OA 2KQ4X 3ZVVA 4N9F4 4K7WA 2L32A 1ZOYB 1GOZA 2WP9B 3KVFB 4XZ4A 1I7HA 4NQKE 3R8BA 2JY6A 4PYUA 4N58A 4ZRPA 1EU3A 2HDEA 1HZ5A 4DWFA 2RDHA 3TSSA 4IC7B 3U8ZA 4XC2A 2IGGA 3QAQA 3H7SA 4KDLB 2AX5A 1QZEA 3PZ8A 4ANXA 2KWCA 3BWUD 1N61A 1YOVB 2IPKD 3OWEB 5E6JA 1UBQA 4KGRA 4XWTA 2MP2B 1XLQA 2RDBC 4FADA 3NZUA 2W3RA 4FN2A 2VH2A 1UWMA 2I1KA
chains in the Genus database with same CATH topology
1QOBA 2AQ1B 1DOIA 4OZCA 5D3IB 3NVZA 1MHXA 5BYSA 4TQ0A 1HXYD 3CF4A 4P6VF 3AE7B 2M19A 1Q10A 2DLBA 2WXKA 1KH0A 3P4PB 1GB1A 1A70A 2NTSA 1I4RA 5G5HA 3DWMA 1MI0A 4HKZE 1FRRA 3AE2B 3NUHB 4YTMB 1YQ3B 4MT5A 2G9HD 1XLOA 2JYEA 4JWSC 1OQQA 3AH7A 1TS2A 2PVGC 4A8XC 2FBWB 1FXIA 4YT0B 1EWYC 3GB1A 1FO4A 2KACA 1IGCA 4A55A 2WXGA 4WURA 1V1PB 5EE1A 5C3JB 3MP9A 2WLBA 4OW0A 2MH7A 1JQ4A 1V1OA 2AQ2B 3R2TA 5MPOA 2HTME 2TSSA 1FNWA 5GXGB 2E3TA 1OQRA 4LTUA 1P7FA 1V1PA 1N62A 2LUMA 4C80A 3V3XA 4FXCA 5HHDG 1JW9D 1SBBB 1NENB 2WXLA 4NZLB 5HG2A 4R3DA 4YSXB 1SF0A 1R7SA 1N5XA 2N9LA 1RFKA 1D5XC 3B2FA 2BTEA 2DBYA 1HZ6A 3W1SA 3AM9A 1K52A 3URYA 4UDUC 2INPE 2V3NA 1DOYA 1FRDA 1ZXIA 2WXOA 1QOAA 2D5GA 1QOGA 1WYGA 1N5WA 1XLPA 1F2RC 4YWGG 2AQ3B 3R2IA 1PGAA 4USAA 1FFVA 3AE6B 1FEHA 1T6BX 4NJCA 1SXTA 2BS2B 1KLUD 1VLBA 1RM6C 4GDKB 3I57A 2H88B 4RGOS 3BK2A 1TKEA 4RGNA 1PFDA 3P42A 5HI1A 4ZOHC 5TSSA 1SE2A 1KRHA 3HRDD 1VR9A 1QQRA 1DGJA 1STEA 2QILA 2WXIA 3RPFC 1UNSA 3O13A 2VZKD 4AQ7A 4IOIE 2L83A 1N60A 2M0AA 4JPSA 1WWTA 3AN1A 3AE3B 1UUPA 1TJEA 2IDYA 2ICIA 2WXPA 3W2DA 1YMHE 1L5PA 4A9AA 1D4BA 5D3DA 2ONQA 2BS3B 3BYYB 3Q69A 3MFGA 1QT9A 1HEZE 3NVVA 5HFYA 4NAMA 2J42A 1C4CA 3VR8B 4ZHPA 1F0ZA 4KGSA 3VR9B 1YN4A 4JWUC 1I4XA 1ZP0B 3KWVA 3NVWA 1QLBB 3AEGB 1I4GA 4ARCA 3HVDA 4KKIA 2PTLA 2I38A 1PDXA 4D2KA 3FILA 4CQNA 4LK0M 2GI9A 3C8YA 1ROEA 2K5PA 4L1BA 1D5MC 2QSDA 1L6VA 1AYFA 3U4EG 1RWSA 1ZXHA 2QMTA 3TEZA 2MJDA 3BVMA 2RMMA 3AEAB 2H89B 2EELA 3MC0B 2W3SA 5BMHA 1XXGA 3IT6B 3B2GA 2YEPB 1L4ZB 3T3OA 5FKAC 3IXSA 1MVKA 5I4DA 4REZA 2WS3B 2Y5PA 4O1NA 1D6EC 1BMLC 1E7PB 4HJGE 4WIPA 2INNE 5G5GA 1SE4A 3TEWA 1FXAA 1DYQA 3BVGA 4C56C 1TZOA 4RFBA 2W54A 2VZKB 3AEDB 1CQVA 2RPVA 1JWAD 4WAFA 4WH4A 1KLGD 1WXQA 1IBXB 2SAKA 3GS2A 3Q8EA 1PGBA 1ESFA 2ON8A 4HRSA 1ZDXA 1B1ZA 4XDCA 1K53A 2DWQA 1GAQB 1NI3A 5D7GA 1KFYB 1IBXA 1C4AA 4OZBA 4GDLB 5AUKA 1JALA 4C7ZA 4ARIA 1TY0A 4B0EA 3PZ7A 1CJEA 1ZUD2 4AS1A 1YNTE 2OEDA 2PLPA 1PUTA 1PYWD 2DYMA 2MJEA 2BB6A 1UGJA 1XF5L 1I4HA 2LJIA 1WSPA 3T3NA 1L4DB 3W5VB 1YN5A 2RDGA 3U52E 1L0XB 1C9FA 3E9SA 1VZ7A 1FFUA 3AE5B 1NVID 4L23A 4TSSA 1SJHD 3LXFA 1MPEA 2WXHA 1QILA 2JSVX 3BIID 1SB3C 4ZHOA 2WXQA 4US8A 3AEFB 4DXGA 2L1AA 5T8IA 1VRAB 2WU5B 2K0PA 1T3QA 2GRIA 4YSYB 1ZPSA 2J52A 2BBCA 3AE1B 2ACZB 4RNAA 4HEA1 2K22A 1TS5A 5LNK1 3NS1A 5JXVA 1OFFA 1KTKA 3SFDB 2LFIA 3NZ3A 2PVOD 2Z8LA 3V05A 3AE9B 4TMAB 5BYRA 3W5UB 1M4VA 2LEKA 4B0MA 1E10A 1XLNA 1HA5A 3P4RB 3P1MA 1ACCA 4N59A 2LHEA 1E9MA 3AE8B 2BS4B 1YJIA 3IAM1 1TS3A 1RYJA 1KF6B 4YXDB 3AE4B 3MHZA 4KX6B 1IUEA 3AECB 1YJJA 1TY2A 1GB4A 3AEBB 2JYTA 3AMZA 1WGKA 2ZW1A 3ABVB 1FMAD 2WQYB 3BYTB 4C7YA 3B9JA 3NVYA 1ET9A 1QOFA 1C4PA 3L4PA 4A6QA 1ZE3D 3FILB 1JWSD 4PT5A 1VDVA 4IKGA 3ZGZA 4GLSC 3W9CB 1ET6A 1TS4A 4NAWB 1J7CA 1H7XA 3IAS1 2WNMA 4XE0A 1QF6A 2ZW0A 1EWCA 2M56B 1SJED 2X38A 4M0WA 1VZ8A 4RF1A 3ZQ4A 1NEKB 3EUB2 2WDRB 4WWMA 1GPXA 2PMVA 4YTPB 1JWMD 2CU3A 2K9XA 3I9V1 5BMGA 2G1EA 2QEJC 2WDQB 5BYQA 2BYTA 1FNUA 4MACA 3HVZA 2BT6A 2KWDA 1JMLA 2DYOA 3H8HA 1GT8A 2FUG1 4P16A 2PW9A 1CK1A 3ZYYX 2E6XA 3DWGC 1C78A 1EU4A 1AWDA 3ZJTA 1LO5D 5AUIA 2KDMA 4OHJA 4LLGM 1FNVA 2IJ0A 2JX5A 2R61A 4ITKA 2L52A 3TEXA 4DXFA 5BMIA 1C76A 2CJNA 3J9CA 2KMMA 3KWLA 1YN3A 1SEBD 4A90A 5C2TB 3P4QB 3ZJVA 1J7AA 2Y5CA 3SFEB 2IGDA 2N0SB 2KN4A 4L2YA 2V0GA 3AV8A 1ENFA 1JROA 2OHFA 1T5XD 2JQRB 4MM3B 1VJKA 1Y56A 4Q2JA 2PIAA 3UI3A 2WXFA 3FAHA 3HUIA 1HQRD 2NMQA 4RGMA 3KLSX 2I2YA 3ZJUA 1PGXA 2W55A 4MH8A 1BUIC 4J3OD 3ETRA 1TKGA 1MHHE 1E0ZA 2QJLA 1XCTL 3SEBA 2JZPA 1TYGB 1I4QA 1FIQA 4H2AA 4XWWA 2N9KA 4YSZB 4TQ1A 2WXRA 1JWUD 4OZAA 2JWUA 1FD6A 1AW7A 5EE0A 3EA6A 3BZDB 4JE3B 1E6EB 2N7JA 2Y3AA 1NYRA 3Q8AA 1I4PA 1GTHA 1DOXA 1TKYA 2MEKA 1CZPA 2EKIA 3KQ4A 4XDDA 4RGTA 1XEEA 3N9YC 3Q8CA 1SIJA 1UWXA 2Q5WD 1FCCC 1XCQL 3VQIA 3E56A 2SEBD 2PKOA 3VRAB 2WXNA 1P7EA 2MJ3A 2QIEB 2WXJA 4JX1C 1JWBD 3WCQA 1L0VB 4KGTA 1JRPA 1JCKB 3BK1A 1FM0D 2CJOA 3CWIA 4EE2A 4WQMA 4OVZA 1F2RI 3MJ5A 2WXMA 2LGIA 3U7ZA 2B76B 2WDVB 1K50A 1VZ6A 3Q8BA 5FR3A 1F77A 2LHDA 1AN8A 2LMCA 1C79A 4N6EB 5EE3A 2IGHA 3U2SC 2FE8A 3VRBB 3TUOA 4ZRQA 2KQ4X 5H92C 2J4XA 3GP7A 1J7BA 2V3PA 4IDIA 4RH6A 3TEYA 4RF0A 3AEEB 3P4SB 2L32A 4US9A 1ZOYB 1GOZA 2JXTA 2K3UA 2WP9B 4YTNB 2J53A 2XNAC 1B9RA 3IT4B 4KKJA 1I7HA 3LB8C 5FK9C 3R8BA 4ZYSA 3Q8FA 4N58A 4ZRPA 1EU3A 1V97A 2HDEA 1D5ZC 1ZDVA 1HZ5A 4DQOC 5EE9A 1N63A 1K51A 2RDHA 1XO3A 3TSSA 2NTTA 2W82A 1WRIA 2KAJA 3NRZA 4RCOA 2IGGA 1V8CA 3RFZB 1GTEA 3PO0A 2GB1A 3BVZA 1BXTA 2XN9C 2AX5A 1L0YB 1YQ4B 1SSNA 4HKQA 1NYQA 4HROA 2BW2A 3CIRB 1H7WA 3P63A 3PZ8A 3SR6A 2WU2B 1QKZA 2JU6X 1C77A 3BWUD 1N61A 2IPKD 3OWEB 1IGDA 3FC4A 2V4IB 5E6JA 3AB5A 4KGRA 4XWTA 3LYYA 1XLQA 2BB5A 1EM7A 1L6UA 1SE3A 2W3RA 3EGRA 1UWMA 1FCLA 5H8YE 2YEPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QOB A;  1DOI A;  1QT9 A;  3NVV A;  5EE0 A;  3NVZ A;  2PVO D;  3W5U B;  3AE9 B;  3VR8 B;  1E6E B;  1NYR A;  4ZHP A;  2LEK A;  1E10 A;  1F0Z A;  1GTH A;  3CF4 A;  3VR9 B;  1TKY A;  1XLN A;  4P6V F;  1DOX A;  4JWU C;  3P4R B;  1CZP A;  3AE7 B;  2EKI A;  1ZP0 B;  3NVW A;  2M19 A;  3P1M A;  4N59 A;  1QLB B;  3AEG B;  3P4P B;  1A70 A;  1SIJ A;  5G5H A;  1PDX A;  2Q5W D;  3DWM A;  4JX1 C;  1E9M A;  1FRR A;  3AE2 B;  3AE8 B;  2BS4 B;  1YJI A;  1ROE A;  4YTM B;  1YQ3 B;  2PKO A;  3VRA B;  1XLO A;  1RYJ A;  2K5P A;  2MJ3 A;  2QIE B;  1KF6 B;  4YXD B;  1JWB D;  1OQQ A;  3AE4 B;  2FBW B;  2PVG C;  3AH7 A;  4KX6 B;  1IUE A;  3AEC B;  4YT0 B;  1L0V B;  1AYF A;  3AEB B;  1EWY C;  1FXI A;  1L6V A;  1RWS A;  1WGK A;  3ABV B;  1FMA D;  2WQY B;  1JRP A;  2MJD A;  3AMZ A;  4C7Y A;  1FM0 D;  2CJO A;  3B9J A;  5EE1 A;  3AEA B;  3CWI A;  2H89 B;  5C3J B;  3NVY A;  2WLB A;  4WQM A;  2W3S A;  1QOF A;  3L4P A;  1OFF A;  3B2G A;  2MH7 A;  1JQ4 A;  1VDV A;  5MPO A;  2HTM E;  2B76 B;  3W9C B;  5GXG B;  2E3T A;  1OQR A;  2WDV B;  1YJJ A;  4LTU A;  1J7C A;  1H7X A;  1N62 A;  4C80 A;  1QF6 A;  2WS3 B;  4N6E B;  4FXC A;  5EE3 A;  1JW9 D;  1E7P B;  2M56 B;  3VRB B;  5G5G A;  1NEN B;  1FXA A;  5H92 C;  1NEK B;  3EUB 2;  2WDR B;  1J7B A;  4YSX B;  1SF0 A;  1R7S A;  1N5X A;  4IDI A;  1RFK A;  4WWM A;  1GPX A;  4YTP B;  2K9X A;  2CU3 A;  2W54 A;  3B2F A;  3AED B;  3AEE B;  2WDQ B;  3P4S B;  1JWA D;  2DBY A;  2G1E A;  1ZOY B;  3AM9 A;  3HVZ A;  4US9 A;  2WP9 B;  1WXQ A;  2BT6 A;  1DOY A;  4YTN B;  1FRD A;  1ZXI A;  1B9R A;  1GT8 A;  1I7H A;  3LB8 C;  1QOA A;  1QOG A;  3ZYY X;  3DWG C;  4HRS A;  1WYG A;  4N58 A;  1AWD A;  1N5W A;  1XLP A;  2DWQ A;  1GAQ B;  1NI3 A;  1V97 A;  1KFY B;  5AUI A;  4USA A;  5EE9 A;  5AUK A;  1FFV A;  3AE6 B;  1JAL A;  1N63 A;  4C7Z A;  2JX5 A;  4ITK A;  1XO3 A;  2BS2 B;  2L52 A;  1CJE A;  1WRI A;  1RM6 C;  1VLB A;  1ZUD 2;  2CJN A;  2KAJ A;  3NRZ A;  2H88 B;  1PUT A;  1V8C A;  1TKE A;  1PFD A;  2KMM A;  2MJE A;  1GTE A;  3KWL A;  3PO0 A;  5C2T B;  3P4Q B;  1J7A A;  2Y5C A;  4ZOH C;  3SFE B;  3W5V B;  1KRH A;  2N0S B;  3HRD D;  1DGJ A;  2AX5 A;  3AV8 A;  1YQ4 B;  1NYQ A;  1JRO A;  4JWS C;  4HRO A;  1FFU A;  2JQR B;  2OHF A;  3RPF C;  3CIR B;  3AE5 B;  1H7W A;  3P63 A;  3SR6 A;  1VJK A;  2WU2 B;  1NVI D;  2PIA A;  3HUI A;  3FAH A;  1N61 A;  2L83 A;  1N60 A;  3LXF A;  2W55 A;  3FC4 A;  3BII D;  1SB3 C;  4ZHO A;  3AB5 A;  4US8 A;  1WWT A;  3AN1 A;  3AE3 B;  3AEF B;  3ETR A;  1TJE A;  1TKG A;  1XLQ A;  1E0Z A;  2QJL A;  2WU5 B;  3WCQ A;  1T3Q A;  1FO4 A;  1L6U A;  2W3R A;  4YSY B;  1L5P A;  1TYG B;  4A9A A;  1FIQ A;  3AE1 B;  2ACZ B;  1UWM A;  2K22 A;  3NS1 A;  5H8Y E;  2BS3 B;  4YSZ B;  3SFD B; 
#chains in the Genus database with same CATH topology
 1QOB A;  2AQ1 B;  4GB9 A;  5D3I B;  3MHS D;  4EEW A;  2J0J A;  4P6V F;  1WE6 A;  3AE7 B;  2WXK A;  3GE3 C;  3V62 A;  1ZKH A;  1YQ3 B;  2AWT A;  1OQQ A;  4YT0 B;  3GB1 A;  4X57 B;  2WXG A;  2RSU A;  2ZVO A;  3I5J C;  5D94 A;  3MP9 A;  2WLB A;  4MGI E;  1D3Z A;  4BVU C;  2NPT A;  1JQ4 A;  1V1O A;  2KOX A;  1V1P A;  2LUM A;  3A9J B;  2MWS B;  2XK5 B;  1WYW B;  4FXC A;  2RPQ A;  1JW9 D;  1TT5 B;  1MJD A;  1NEN B;  4BFR A;  2L0F A;  1SF0 A;  4G0N B;  2KC2 A;  1E8X A;  1HZ6 A;  2DBY A;  3IG3 A;  2INP E;  1P3Q U;  3A9K B;  2IZV B;  4KIK B;  2N7D A;  3ZNI D;  1N5W A;  1S1Q B;  3R2I A;  3KH0 A;  3WAM A;  4GDK B;  3I57 A;  1TKE A;  3OAW A;  2IO2 B;  3LJ3 A;  1SE2 A;  3HRD D;  2GBM A;  3RNB C;  4LNN A;  2A5U A;  3O13 A;  2VZK D;  2L83 A;  1N60 A;  4JPS A;  3K9P B;  1BT0 A;  1EF5 A;  1V49 A;  1EF1 A;  3AN1 A;  1WGG A;  1TJE A;  2IDY A;  3W2D A;  4MJS A;  4ICV A;  2KTR A;  1L5P A;  4LDT D;  2ONQ A;  2KJ6 A;  3NVV A;  5HFY A;  3VR8 B;  2JPH A;  1NDD A;  3VR9 B;  1FXT B;  4JWU C;  1MG8 A;  4HDO A;  3DBH B;  1I4G A;  4ANV A;  4KKI A;  5TR5 A;  4LK0 M;  2K8H A;  1AYF A;  4FJV B;  3BVM A;  3AEA B;  2DX5 B;  2EEL A;  2CR5 A;  3IXS A;  5I4D A;  4REZ A;  2WS3 B;  4O1N A;  1D6E C;  1BML C;  1E7P B;  4HJG E;  4I6P A;  1SE4 A;  3TEW A;  3TIX A;  3DPD A;  1F52 A;  2W54 A;  1CQV A;  2N1V A;  4WAA A;  1KLG D;  4FHK A;  3L10 B;  4NJ6 A;  3Q8E A;  4HRS A;  5IO9 A;  2Y5B B;  5L83 A;  2M8S A;  1B1Z A;  5D7G A;  3DBH I;  1IBX A;  1TIF A;  3PZ7 A;  3JVZ X;  3PLV A;  4IM2 A;  4GMV A;  2MJE A;  1XF5 L;  2LJI A;  2QCZ A;  1LFD A;  1YN5 A;  1V80 A;  5D6J B;  1T0Y A;  2BYE A;  1IPG A;  3E9S A;  1I42 A;  2BF8 B;  1VCB A;  3MC8 A;  3V61 A;  4TSS A;  1SJH D;  3LXF A;  2WXH A;  5JHB A;  3AUL A;  4GXB A;  4DXG A;  1Q1O A;  2KJR A;  1J8C A;  2K0P A;  3UGB B;  2BWE S;  5DPS A;  3WAL A;  5LNK 1;  4EOY A;  1HTO A;  1KTK A;  3SFD B;  2HD5 B;  2IND C;  2LFI A;  1Q0W B;  2IBI B;  2D07 B;  3DQV A;  2GBR A;  4B0M A;  3AE9 B;  2LEK A;  3P1M A;  3PRE A;  2LHE A;  2I1J A;  1KF6 B;  1T0S C;  3MHZ A;  1IUE A;  2KNB A;  1TY2 A;  3AEB B;  2DZJ A;  4C7Y A;  3BYT B;  3N3K B;  2GBJ A;  4A6Q A;  4M00 A;  5JH5 C;  1ZE3 D;  4F7Z A;  1VDV A;  2GBN A;  1ET6 A;  1WMH A;  1H4R A;  1J7C A;  1YJ1 A;  1QF6 A;  3EFU A;  3Q3O C;  2M56 B;  2X38 A;  4M0W A;  4RF1 A;  4BBN C;  2YVC A;  4NAW A;  1WGH A;  3WAO A;  4JLC A;  3ZNH B;  3RNF C;  2WDQ B;  5BYQ A;  2BYT A;  1TTN A;  3VXW A;  3WAP A;  2O2V A;  2KT7 A;  2BT6 A;  1JML A;  2DYO A;  2PJH A;  1V2Y A;  2PW9 A;  3H9D A;  1EU4 A;  3ZJT A;  3QWZ B;  5AUI A;  2C7M B;  1FNV A;  3TEX A;  5BMI A;  4WWO A;  2NBV B;  2CJN A;  2DNF A;  4HVB A;  2KMM A;  4IM3 A;  3ZJV A;  4BOS C;  2N0S B;  2G3Q B;  3PRM B;  2IY1 B;  3AV8 A;  4W9L A;  2DAF A;  2HTH A;  3EFC A;  1MG4 A;  1CMX B;  1YX5 B;  2PE9 A;  2C7N B;  3N1Z C;  4Q2J A;  4ZYN A;  4M8M A;  3UI3 A;  2CHW A;  3FAH A;  4RGM A;  2L3Z A;  2K8B A;  4MM3 A;  3RZW C;  2C60 A;  3SU8 X;  2QJL A;  2KKC A;  1XCT L;  4HPP A;  1TYG B;  1I4Q A;  3DCG A;  4H2A A;  2MBO A;  2WXR A;  2CU1 A;  1JWU D;  5CTR C;  1I4P A;  2N9P C;  4EUT A;  4WJP A;  3KYC D;  1GG3 A;  1CZP A;  3QK0 A;  3A33 B;  1WIA A;  3WAN A;  3KUZ A;  2R2O A;  3E56 A;  2SEB D;  4K7S A;  2WXN A;  1IP9 A;  4BZA A;  4K81 A;  3QCA A;  1JCK B;  4A3O A;  1FM0 D;  4WQM A;  3RMK C;  1ISN A;  1P0R A;  2LGI A;  3S2A A;  1WE7 A;  1F77 A;  1Y8R C;  1AN8 A;  4N6E B;  4DXA B;  3VRB B;  4ZRQ A;  1OGW A;  2J4X A;  1LM8 B;  3GP7 A;  2KHW B;  1J7B A;  2LGS A;  4IDI A;  3TEY A;  5DPW A;  4US9 A;  2K3U A;  3TBL D;  4YTN B;  2O6V D;  2ZVN A;  4PS8 A;  4AOF A;  3I3T B;  5FK9 C;  3PHW B;  2M4N A;  3Q8F A;  4ZYS A;  4F1S A;  4WJQ A;  1WX9 A;  1ZDV A;  2BKF A;  4DQO C;  1N63 A;  1K51 A;  1XO3 A;  2NTT A;  2OJR A;  2KAJ A;  2FCM A;  3NRZ A;  3RT3 B;  3RFZ B;  2K39 A;  1E8Z A;  3PO0 A;  1G6J A;  1L0Y B;  1YQ4 B;  2KMC A;  2BKR B;  5IKC M;  2JU6 X;  1Z5S B;  1WM2 A;  1C77 A;  1IGD A;  2WHI A;  4BKG A;  1OEY J;  3M95 A;  2KFK A;  1HE8 A;  3NOB A;  3EEC A;  3HIZ A;  4YL8 A;  5LXI B;  2DAJ A;  1A5R A;  3N1Y C;  2YEP F;  1DOI A;  3NVZ A;  1MHX A;  4ZRI A;  3DHI C;  4TQ0 A;  2KDB A;  2R2Q A;  3JSV A;  2M19 A;  1KH0 A;  1A70 A;  2ZPY A;  3DWM A;  1UEL A;  3CSF A;  4HKZ E;  1U4A A;  3AE2 B;  2UWQ A;  4YTM B;  2D2Q A;  2FBW B;  4ASW C;  1V1P B;  1M94 A;  3Q2A C;  4XGA B;  5EE1 A;  2KLG A;  1NI2 A;  3MC9 A;  3JW0 X;  3R2T A;  4B95 A;  2HTM E;  4JQW C;  1OQR A;  1EUV B;  1J19 A;  2V4L A;  4NNJ B;  5HHD G;  2VRR B;  4KVG B;  5HG2 A;  2FCN A;  4R3D A;  2N9L A;  5IAA C;  2BTE A;  2HJ1 A;  4UDU C;  2N4F A;  1KOT A;  1FRD A;  2DZK A;  1F2R C;  2KTF A;  4NJC A;  4NJ7 A;  2AYO B;  2BS2 B;  1VLB A;  4BKT A;  3ML9 A;  4KZC A;  5DPT A;  2KXJ A;  3V60 A;  4LNI A;  5CHF A;  2QIL A;  4AJW A;  1V86 A;  2LRU A;  3VTV A;  2L8J A;  4K7U A;  3PT2 B;  4GOC A;  2C7H A;  3MJW A;  4NY0 A;  3AE3 B;  1UUP A;  2WXP A;  2ASQ A;  3BYY B;  4MEM A;  2J42 A;  4ZHP A;  1F0Z A;  4KGS A;  3HK0 A;  4ZRK A;  3JYU A;  3M3J A;  1I4X A;  1ZP0 B;  2WWZ A;  1QLB B;  3AEG B;  4HJK A;  3QJZ A;  4WJO A;  1TGZ B;  2GI9 A;  4DHZ E;  2K5P A;  3U4E G;  3MC0 B;  2XEW A;  2MW5 A;  2BPS A;  3IT6 B;  1L4Z B;  3T3O A;  2HJ8 A;  2Y5P A;  3BVG A;  4BKS D;  1XT9 B;  3P2B A;  4C56 C;  1TZO A;  2FCS A;  1T0R C;  3AED B;  2VZK B;  2RPV A;  1Q5W B;  4WJN A;  4WH4 A;  2LUE A;  1IBX B;  4DHJ D;  3R66 C;  3RUL A;  3Q14 C;  3SHQ A;  4EKU A;  2X8X X;  1PGB A;  3R7Q A;  4LDT B;  2DWQ A;  3DHG C;  1WX7 A;  4GDL B;  4ARI A;  1TY0 A;  3NJT A;  3TJP A;  1XD3 B;  1YNT E;  2BB6 A;  2JRH A;  1WSP A;  1L4D B;  3W5V B;  2RDG A;  1E8Y A;  3U52 E;  1LXD A;  5IP4 D;  4MEL A;  4L23 A;  1RFA A;  4II2 B;  1K8R B;  2JSV X;  3BII D;  4TUU A;  1SB3 C;  4ZHO A;  2WXQ A;  3CMM B;  4C4V A;  3L17 A;  2WU5 B;  3PS6 A;  1V9J A;  4RMA A;  2GRI A;  4YSY B;  1ZPS A;  2J52 A;  4RNA A;  2K22 A;  1TS5 A;  2WGS A;  3ZDT A;  2KFJ A;  2Z8L A;  2KD0 A;  3W5U B;  1WXM A;  1HA5 A;  3ZLZ A;  1E8W A;  3ALB A;  2QDF A;  4CO7 A;  1E9M A;  3AE8 B;  1TS3 A;  4BKS A;  4YXD B;  2JYT A;  3AMZ A;  3DVG Y;  2ZW1 A;  1GJZ A;  2MBB B;  1P98 A;  2HE7 A;  1ET9 A;  4E3C A;  1WM3 A;  3FIL B;  3NY5 A;  2MBH A;  4URK A;  2N7E A;  3V6E B;  4NAW B;  4HDQ A;  1H7X A;  2WNM A;  4XE0 A;  4E71 A;  2KN5 A;  2V1Y A;  3ZNG C;  3DBR B;  2O2V B;  2GMI C;  3N20 C;  2WDR B;  3Q3F A;  2K9X A;  2CU3 A;  3I9V 1;  2G1E A;  3QA8 A;  3DOW A;  4MAC A;  4PYZ A;  2K25 A;  4W9I A;  4P16 A;  1GC6 A;  3ZYY X;  2E6X A;  2LVP A;  3DWG C;  4ICU A;  3VTU A;  3PRP B;  1LO5 D;  3PTF C;  3VHT C;  3H7P A;  2QHO A;  2IJ0 A;  2L52 A;  3C19 A;  3KWL A;  1YN3 A;  5C2T B;  4W9H A;  2KN4 A;  4HPL B;  3OJ3 A;  2V0G A;  3ZXV A;  4FBJ B;  4HK2 A;  4MM3 B;  4MSQ B;  3AU5 A;  2PIA A;  2WXF A;  1HQR D;  2NMQ A;  2W55 A;  4MH8 A;  4LCD E;  3ML8 A;  3ETR A;  3LDZ E;  3A4S C;  4K3C A;  1E5W A;  1MHH E;  5HKH A;  3DBR I;  3SEB A;  2MRP A;  1C1Y B;  4M01 A;  2N9K A;  2JWU A;  1FD6 A;  4JE3 B;  3Q8A A;  5DCN A;  5CX3 A;  2MBE A;  3KW5 B;  4JIO U;  4EZL A;  2KLC A;  1XCQ L;  2L00 B;  3VH3 B;  3VQI A;  3A9J A;  2FID A;  1P7E A;  2QIE B;  2XK5 A;  4JX1 C;  3DBL B;  3ZO5 B;  1L0V B;  5J2R A;  2KX3 A;  3BK1 A;  2CJO A;  4BBN F;  3VDZ A;  1YQB A;  3MJ5 A;  4DK5 A;  3X23 A;  2KDI A;  1RRB A;  2B76 B;  3OG5 A;  2JT4 B;  4AUQ C;  3A9K A;  4KIK A;  3W1Y A;  3VFK A;  3DBS A;  2D3G A;  4FA6 A;  3ZUN A;  5E6N A;  5LXH A;  4RF0 A;  2JXT A;  3W1S C;  2J53 A;  2XNA C;  3Q3J A;  3IT4 B;  2G45 B;  3LB8 C;  4S17 A;  1IYF A;  1V97 A;  3APF A;  2PEA A;  4P1B C;  5EE9 A;  3UIO B;  2W82 A;  1V8C A;  1P9D U;  1GTE A;  2LD9 A;  2GB1 A;  3DBL I;  2KWV B;  1PQS A;  2KFK B;  3L13 A;  3CIR B;  1H7W A;  1YD8 U;  2LRW A;  3P63 A;  2WU2 B;  3SR6 A;  1QKZ A;  3DVG X;  2LI5 A;  3FC4 A;  3AB5 A;  2N9E B;  3LYY A;  4PK1 A;  5CHW A;  5AZG A;  2NR2 A;  1SE3 A;  3TMP B;  2ZNV C;  4DDI D;  1FCL A;  3JSV B;  2C9W B;  2BGF A;  1WXA A;  1WJ6 A;  5H8Y E;  3SD5 A;  1WJU A;  3QIJ A;  3CF4 A;  3A4R A;  1Q10 A;  3P4P B;  5G5H A;  1MI0 A;  1FRR A;  4W9G A;  4MT5 A;  2G9H D;  1WJ4 A;  2JYE A;  2MSE D;  2ZCB A;  4A8X C;  1L7Y A;  2PVG C;  3AH7 A;  5BO4 B;  4XYC A;  3VVW B;  1E7V A;  1FXI A;  1EWY C;  2KAC A;  1IGC A;  2G4D B;  4WUR A;  3APD A;  3GE8 C;  5C3J B;  4OW0 A;  1OEY A;  2MH7 A;  2OJW A;  2AQ2 B;  2M1M A;  2TSS A;  1FNW A;  3PVL A;  5GXG B;  4JL9 A;  4C80 A;  3ZIM A;  2JRI B;  3PLU A;  1RFK A;  4QAY A;  3B2F A;  3W1S A;  3URY A;  4GGQ A;  3NHE B;  2JXX A;  2V3N A;  1DOY A;  1ZXI A;  4A20 A;  2FCQ A;  1V81 A;  2NVU I;  1QOA A;  5AEK B;  2BQQ A;  2D5G A;  1QOG A;  4W9J A;  1XLP A;  2Z0E B;  2WX0 A;  3L54 A;  2RGF A;  1PGA A;  4MGZ E;  4USA A;  1FFV A;  3AE6 B;  1T6B X;  2KZR A;  2PE6 B;  1KLU D;  1RM6 C;  4BOZ B;  2H88 B;  5IA7 A;  3ZW3 A;  2UYZ B;  4OVV A;  4ZOH C;  1KRH A;  2KDF B;  1STE A;  4EZJ A;  2WXI A;  3RPF C;  2DHZ A;  2KQ7 A;  4AQ7 A;  1Z2M A;  2K8C A;  2M0A A;  3I63 C;  1V6E A;  2CHZ A;  4WWP A;  1WWT A;  4PS3 A;  2CKH B;  2IYD B;  2ICI A;  4CHK A;  1YMH E;  3HM6 X;  1D4B A;  2IO1 B;  1X1M A;  2L05 A;  3U30 A;  2BS3 B;  3Q69 A;  3MFG A;  1QT9 A;  1HEZ E;  1C4C A;  3VAW A;  3APC A;  3KWV A;  3NVW A;  4ARC A;  3HVD A;  4K3B A;  1WR6 E;  4CQN A;  3RNG C;  1ROE A;  4J6I A;  2DZM A;  1L6V A;  4MDK E;  3TEZ A;  2MLB A;  2JUO A;  3VUX A;  5BMH A;  2YEP B;  2WX1 A;  4W9D A;  1FPY A;  5FKA C;  4C00 A;  4JGH B;  1N6Z A;  2D11 A;  3Q3M C;  4HWI B;  4WIP A;  3PHX B;  2INN E;  4W9C A;  3CST A;  2IO0 B;  1WJN A;  2KX0 A;  2NPT B;  2EMS A;  2ZPN A;  1SGH A;  2MQJ A;  2N9X A;  4B9K A;  4WAF A;  1UBI A;  1WXQ A;  1H8C A;  2IO3 B;  3KUC B;  3Q3N C;  2O6V A;  3AU4 A;  2LGY A;  2ON8 A;  3ENE A;  4XDC A;  2JWZ A;  2ZJD A;  1NI3 A;  2AL3 A;  4C7Z A;  3HM3 A;  4B0E A;  3WIM A;  3UQB A;  1CJE A;  1T0Q C;  1ZUD 2;  2IY0 B;  4AS1 A;  2OED A;  3M62 B;  2PLP A;  1PYW D;  2NCN A;  3IFW B;  1I4H A;  3IHP C;  3T3N A;  1L0X B;  2KVZ A;  2W9N A;  3EHV A;  1VZ7 A;  4C4V B;  5J17 A;  1NVI D;  3DVN U;  4US8 A;  3PSE B;  2RR9 A;  2MX2 A;  1F1H A;  2L1A A;  2V9H A;  3VUW A;  1T3Q A;  4IWQ A;  2BBC A;  4GN1 A;  2K6Q A;  3QAR A;  5JXV A;  1OFF A;  3AXC A;  1WFY A;  5JHA A;  2CHX A;  4TMA B;  1E10 A;  1M4V A;  1SIF A;  4MJS B;  5JZE B;  4N59 A;  3UQA A;  2KTR B;  4GSW A;  5C1Z A;  4DHZ B;  4WWN A;  1YJI A;  3IAM 1;  2KQS A;  4ACF A;  4DHJ B;  3AE4 B;  2NS5 A;  4LNO A;  4KX6 B;  1YJJ A;  1GB4 A;  1WGK A;  3ABV B;  1FMA D;  2WQY B;  3N1X C;  3V6C B;  2D3C A;  2KAN A;  2UU7 A;  4PT5 A;  3ZGZ A;  4GLS C;  3QC8 B;  1J0G A;  1WXS A;  2ZW0 A;  1VZ8 A;  3NZS A;  3ZQ4 A;  1NEK B;  4WWM A;  1R4M B;  5IN7 A;  4YTP B;  2LXA A;  3NS8 A;  3VTW A;  2QEJ C;  1FNU A;  3HVZ A;  4A3P A;  4G3X B;  3A1Q A;  2JZ3 B;  4MSM B;  3H7P B;  3OJ4 B;  3H8H A;  1GT8 A;  2FUG 1;  4HXD A;  1CK1 A;  2KDM A;  4OHJ A;  2DEN B;  2R61 A;  4ITK A;  2Z0D B;  3J9C A;  4KSK C;  4IWP A;  4RM9 A;  3VH4 B;  4A90 A;  1SEB D;  4GIV A;  3P4Q B;  1KJT A;  1XQQ A;  3SFE B;  4L2Y A;  1ENF A;  1JRO A;  2DYB A;  1T5X D;  1TBE A;  2JQR B;  1Y56 A;  2PPH A;  3HUI A;  3KLS X;  3ZJU A;  1PGX A;  2KJH B;  2KMA A;  5EDS A;  1TKG A;  5AZF A;  3T8M A;  4NQL B;  2JZP A;  5D2M B;  2WDT B;  1KLV A;  3RNE C;  1R4M I;  4YSZ B;  2FNJ B;  5EE0 A;  2EMT A;  2LZ6 A;  1E6E B;  2N7J A;  1NYR A;  1GTH A;  1L2N A;  5J18 A;  1UF0 A;  2YLM A;  3KQ4 A;  4XDD A;  5AZH A;  1XEE A;  1SIJ A;  2Q5W D;  2D10 A;  2BWF A;  2FAZ A;  2PKO A;  3VRA B;  2MBQ A;  2MJ3 A;  2WXJ A;  3MTN B;  4WQO B;  1JRP A;  1WF9 A;  4PS7 A;  2BYV E;  3CWI A;  2KC1 A;  4OVZ A;  2LVQ A;  2WXM A;  3IBE A;  3U7Z A;  2WDV B;  1VZ6 A;  1WH3 A;  1ZGU B;  1C79 A;  2AEH A;  2V3S A;  5EE3 A;  2IGH A;  3U2S C;  2J0M A;  4FJZ A;  3DHH C;  5H92 C;  2V3P A;  4RH6 A;  4IG7 B;  3U7D A;  3AEE B;  4W9E A;  3P4S B;  2DZI A;  1WMH B;  3ZNZ B;  4M8N A;  2K6D B;  1MFW A;  3RN9 C;  1B9R A;  2B3A A;  4KKJ A;  5IOI A;  4M0W B;  1WGY A;  1JRU A;  4IM0 A;  1D5Z C;  4ZRJ A;  1WRI A;  4RCO A;  2KYW A;  4RM8 A;  2LJ5 A;  3UF8 A;  3BVZ A;  1BXT A;  2XN9 C;  3O65 B;  3TL5 A;  3TCA A;  1SSN A;  4HKQ A;  2L7R A;  1NYQ A;  4HRO A;  2BW2 A;  3KUD B;  1UD7 A;  2LXC A;  2V4I B;  3QHT A;  2G4S A;  4HPM B;  2BB5 A;  2J0K A;  2LGD A;  1EM7 A;  4BAX A;  1L6U A;  3EGR A;  3ZTD A;  1WY8 A;  2MCN B;  2MP2 A;  4FHJ A;  2FIF A;  3K9O B;  4OZC A;  2REX A;  5BYS A;  1HXY D;  2DLB A;  4AP4 C;  2KWU B;  1GB1 A;  2NTS A;  1I4R A;  3NUH B;  2BVC A;  2JF5 A;  3PV1 A;  1XLO A;  1E7U A;  4JWS C;  1TS2 A;  1FO4 A;  3H6N A;  3PGE A;  4A55 A;  1UZX B;  3ONS A;  3GOE A;  1OTR B;  4K1R B;  5MPO A;  2E3T A;  4LTU A;  3DVN V;  1P7F A;  1N62 A;  4KSL C;  3V3X A;  3PZD A;  1S3S G;  1SBB B;  2WXL A;  4NZL B;  3L16 A;  3CF6 E;  4YSX B;  1R7S A;  1N5X A;  1TZ1 A;  3PPA A;  1D5X C;  4GDL A;  4MGK E;  3AM9 A;  1K52 A;  4ZDV A;  4I6N B;  4LJP B;  2WXO A;  1AAR A;  4OVU A;  1WYG A;  3AI5 A;  4YWG G;  2INC C;  2AQ3 B;  5LLI A;  1FEH A;  4HCP B;  1SXT A;  2MA9 B;  4RGO S;  3RUI B;  3BK2 A;  4EZK A;  4RGN A;  1PFD A;  2KO3 A;  3P42 A;  2ZCC A;  5HI1 A;  5TSS A;  1VR9 A;  4II3 B;  1QQR A;  1DGJ A;  3D32 A;  4DBG A;  4GDK A;  1GC7 A;  1UNS A;  4KZ0 A;  4IOI E;  2ZNV B;  4MGY E;  3DDC B;  3RI7 C;  2FUH B;  4KDI C;  4A9A A;  5D3D A;  4S0R A;  3RD2 A;  1NBF C;  4NAM A;  4KV2 A;  4DDG D;  3BY4 B;  1WXV A;  2ZEQ A;  4MH0 E;  1YN4 A;  3B1L X;  2PTL A;  2I38 A;  1PDX A;  4W9K A;  3BIN A;  4D2K A;  3FIL A;  2GLS A;  1WGD A;  3C8Y A;  3ZRC A;  3L0W B;  3X0W A;  4L1B A;  1D5M C;  2MHJ A;  2QSD A;  3WA0 A;  1RWS A;  1ZXH A;  2JVC A;  2QMT A;  2D3A A;  3IVF A;  3OLM D;  2MJD A;  3PRZ A;  2LGX A;  2RMM A;  4P1C C;  2H89 B;  2W3S A;  1XXG A;  3B2G A;  2ZZP B;  1MVK A;  2WYQ A;  5KHQ A;  5G5G A;  1FXA A;  1DYQ A;  1LQB A;  1WR1 A;  1WZ0 A;  1P1A A;  2KK8 A;  2C5L C;  2L76 A;  3ECI A;  2O6V B;  1WRD B;  3Q6B A;  4RFB A;  1WX8 A;  1JWA D;  3FKY A;  5CHV C;  3RZF A;  2SAK A;  1WGR A;  3GS2 A;  1ESF A;  1ZDX A;  1K53 A;  1GAQ B;  1KFY B;  3H1U A;  1C4A A;  4OZB A;  3R7R A;  5AUK A;  1JAL A;  4FUL A;  1R4N B;  2NBU A;  1PUT A;  2DYM A;  1KM7 A;  1UGJ A;  2J7Q B;  3ZRF A;  1C9F A;  3L08 A;  1FFU A;  2L0T A;  2D3B A;  3AE5 B;  4B6W A;  5G55 A;  2XBB C;  2OOB B;  3ZDM C;  1MPE A;  1QIL A;  4HLE A;  5KHO A;  3RCZ A;  3AEF B;  3RNC C;  3NG0 A;  5T8I A;  4NPN A;  1VRA B;  4ANW A;  2BYF A;  3AE1 B;  2ACZ B;  1V5T A;  4HEA 1;  5E6O A;  3NS1 A;  2M17 A;  4W9F A;  3N30 A;  3NZ3 A;  2PVO D;  3V05 A;  5BYR A;  1XLN A;  3ZKJ C;  3P4R B;  1ACC A;  4E74 A;  1C3T A;  2M0X A;  5G2N A;  1LGR A;  2BS4 B;  2CS4 A;  1OQY A;  3ZXR A;  1RYJ A;  3C0R B;  2JZZ A;  3AEC B;  1R4N I;  2GBK A;  1WZ3 A;  4F8C B;  4FJY A;  5DPR A;  1E90 A;  3B9J A;  2K1F A;  5FR6 A;  3NVY A;  1QOF A;  1C4P A;  3L4P A;  1F9J A;  2KDE B;  1JWS D;  4IKG A;  3W9C B;  4XX5 A;  4TKN A;  2KVR A;  3GZN B;  1TS4 A;  3IAS 1;  2AL6 A;  1EWC A;  1RAX A;  1SJE D;  2NBW B;  1UH6 A;  3A1Q B;  3EUB 2;  3SDL C;  1GPX A;  1EO6 A;  1GUA B;  2PMV A;  3B0A A;  4AJY B;  1HTQ A;  1JWM D;  1YX6 B;  5BMG A;  2LVO A;  4M02 A;  3T9L A;  4IW0 A;  2KWD A;  1UGM A;  4IUM B;  3R3M A;  1C78 A;  1AWD A;  3QQ8 B;  1GNU A;  3UIP B;  2LAS A;  4LLG M;  2JX5 A;  2LWP A;  4DXF A;  3B08 A;  5GMV A;  1C76 A;  2N1W A;  5C23 A;  4ANU A;  1J7A A;  2Y5C A;  2IGD A;  1SE9 A;  2EKE C;  1I35 A;  2OHF A;  4I6L B;  1VJK A;  4LNF A;  4G50 A;  4CYE A;  2I2Y A;  3GZN I;  1BUI C;  4J3O D;  3RYT A;  3EC8 A;  1E0Z A;  4IWO A;  3HHM A;  1RLF A;  1FIQ A;  5E6P A;  4XWW A;  2Z59 B;  4TV3 A;  4HCN B;  4GU2 A;  4TQ1 A;  4EFO A;  1YIW A;  4OZA A;  1AW7 A;  3EA6 A;  3BZD B;  4P7I A;  3UIN B;  2Y3A A;  2A4Z A;  1DOX A;  1TKY A;  2MEK A;  4G11 A;  2EKI A;  4RGT A;  3M63 B;  3N9Y C;  3Q8C A;  3N32 A;  1UWX A;  1FCC C;  4LJO B;  4AWJ A;  1ZW7 A;  1VD2 A;  1JWB D;  3WCQ A;  4FLH A;  3QX1 A;  4KGT A;  2GOW A;  4EE2 A;  4LNK A;  1F2R I;  3RNA C;  3ZTC A;  5L95 C;  1WI0 A;  1K50 A;  2VH1 A;  3Q8B A;  3KYD D;  5FR3 A;  2LHD A;  2QC8 A;  2LMC A;  2RD0 A;  2FE8 A;  3TUO A;  3VUY A;  1V5O A;  2KQ4 X;  3ZVV A;  4N9F 4;  4K7W A;  2L32 A;  1ZOY B;  1GOZ A;  2WP9 B;  3KVF B;  4XZ4 A;  1I7H A;  4NQK E;  3R8B A;  2JY6 A;  4PYU A;  4N58 A;  4ZRP A;  1EU3 A;  2HDE A;  1HZ5 A;  4DWF A;  2RDH A;  3TSS A;  4IC7 B;  3U8Z A;  4XC2 A;  2IGG A;  3QAQ A;  3H7S A;  4KDL B;  2AX5 A;  1QZE A;  3PZ8 A;  4ANX A;  2KWC A;  3BWU D;  1N61 A;  1YOV B;  2IPK D;  3OWE B;  5E6J A;  1UBQ A;  4KGR A;  4XWT A;  2MP2 B;  1XLQ A;  2RDB C;  4FAD A;  3NZU A;  2W3R A;  4FN2 A;  2VH2 A;  1UWM A;  2I1K A; 
#chains in the Genus database with same CATH homology
 1QOB A;  2AQ1 B;  1DOI A;  4OZC A;  5D3I B;  3NVZ A;  1MHX A;  5BYS A;  4TQ0 A;  1HXY D;  3CF4 A;  4P6V F;  3AE7 B;  2M19 A;  1Q10 A;  2DLB A;  2WXK A;  1KH0 A;  3P4P B;  1GB1 A;  1A70 A;  2NTS A;  1I4R A;  5G5H A;  3DWM A;  1MI0 A;  4HKZ E;  1FRR A;  3AE2 B;  3NUH B;  4YTM B;  1YQ3 B;  4MT5 A;  2G9H D;  1XLO A;  2JYE A;  4JWS C;  1OQQ A;  3AH7 A;  1TS2 A;  2PVG C;  4A8X C;  2FBW B;  1FXI A;  4YT0 B;  1EWY C;  3GB1 A;  1FO4 A;  2KAC A;  1IGC A;  4A55 A;  2WXG A;  4WUR A;  1V1P B;  5EE1 A;  5C3J B;  3MP9 A;  2WLB A;  4OW0 A;  2MH7 A;  1JQ4 A;  1V1O A;  2AQ2 B;  3R2T A;  5MPO A;  2HTM E;  2TSS A;  1FNW A;  5GXG B;  2E3T A;  1OQR A;  4LTU A;  1P7F A;  1V1P A;  1N62 A;  2LUM A;  4C80 A;  3V3X A;  4FXC A;  5HHD G;  1JW9 D;  1SBB B;  1NEN B;  2WXL A;  4NZL B;  5HG2 A;  4R3D A;  4YSX B;  1SF0 A;  1R7S A;  1N5X A;  2N9L A;  1RFK A;  1D5X C;  3B2F A;  2BTE A;  2DBY A;  1HZ6 A;  3W1S A;  3AM9 A;  1K52 A;  3URY A;  4UDU C;  2INP E;  2V3N A;  1DOY A;  1FRD A;  1ZXI A;  2WXO A;  1QOA A;  2D5G A;  1QOG A;  1WYG A;  1N5W A;  1XLP A;  1F2R C;  4YWG G;  2AQ3 B;  3R2I A;  1PGA A;  4USA A;  1FFV A;  3AE6 B;  1FEH A;  1T6B X;  4NJC A;  1SXT A;  2BS2 B;  1KLU D;  1VLB A;  1RM6 C;  4GDK B;  3I57 A;  2H88 B;  4RGO S;  3BK2 A;  1TKE A;  4RGN A;  1PFD A;  3P42 A;  5HI1 A;  4ZOH C;  5TSS A;  1SE2 A;  1KRH A;  3HRD D;  1VR9 A;  1QQR A;  1DGJ A;  1STE A;  2QIL A;  2WXI A;  3RPF C;  1UNS A;  3O13 A;  2VZK D;  4AQ7 A;  4IOI E;  2L83 A;  1N60 A;  2M0A A;  4JPS A;  1WWT A;  3AN1 A;  3AE3 B;  1UUP A;  1TJE A;  2IDY A;  2ICI A;  2WXP A;  3W2D A;  1YMH E;  1L5P A;  4A9A A;  1D4B A;  5D3D A;  2ONQ A;  2BS3 B;  3BYY B;  3Q69 A;  3MFG A;  1QT9 A;  1HEZ E;  3NVV A;  5HFY A;  4NAM A;  2J42 A;  1C4C A;  3VR8 B;  4ZHP A;  1F0Z A;  4KGS A;  3VR9 B;  1YN4 A;  4JWU C;  1I4X A;  1ZP0 B;  3KWV A;  3NVW A;  1QLB B;  3AEG B;  1I4G A;  4ARC A;  3HVD A;  4KKI A;  2PTL A;  2I38 A;  1PDX A;  4D2K A;  3FIL A;  4CQN A;  4LK0 M;  2GI9 A;  3C8Y A;  1ROE A;  2K5P A;  4L1B A;  1D5M C;  2QSD A;  1L6V A;  1AYF A;  3U4E G;  1RWS A;  1ZXH A;  2QMT A;  3TEZ A;  2MJD A;  3BVM A;  2RMM A;  3AEA B;  2H89 B;  2EEL A;  3MC0 B;  2W3S A;  5BMH A;  1XXG A;  3IT6 B;  3B2G A;  2YEP B;  1L4Z B;  3T3O A;  5FKA C;  3IXS A;  1MVK A;  5I4D A;  4REZ A;  2WS3 B;  2Y5P A;  4O1N A;  1D6E C;  1BML C;  1E7P B;  4HJG E;  4WIP A;  2INN E;  5G5G A;  1SE4 A;  3TEW A;  1FXA A;  1DYQ A;  3BVG A;  4C56 C;  1TZO A;  4RFB A;  2W54 A;  2VZK B;  3AED B;  1CQV A;  2RPV A;  1JWA D;  4WAF A;  4WH4 A;  1KLG D;  1WXQ A;  1IBX B;  2SAK A;  3GS2 A;  3Q8E A;  1PGB A;  1ESF A;  2ON8 A;  4HRS A;  1ZDX A;  1B1Z A;  4XDC A;  1K53 A;  2DWQ A;  1GAQ B;  1NI3 A;  5D7G A;  1KFY B;  1IBX A;  1C4A A;  4OZB A;  4GDL B;  5AUK A;  1JAL A;  4C7Z A;  4ARI A;  1TY0 A;  4B0E A;  3PZ7 A;  1CJE A;  1ZUD 2;  4AS1 A;  1YNT E;  2OED A;  2PLP A;  1PUT A;  1PYW D;  2DYM A;  2MJE A;  2BB6 A;  1UGJ A;  1XF5 L;  1I4H A;  2LJI A;  1WSP A;  3T3N A;  1L4D B;  3W5V B;  1YN5 A;  2RDG A;  3U52 E;  1L0X B;  1C9F A;  3E9S A;  1VZ7 A;  1FFU A;  3AE5 B;  1NVI D;  4L23 A;  4TSS A;  1SJH D;  3LXF A;  1MPE A;  2WXH A;  1QIL A;  2JSV X;  3BII D;  1SB3 C;  4ZHO A;  2WXQ A;  4US8 A;  3AEF B;  4DXG A;  2L1A A;  5T8I A;  1VRA B;  2WU5 B;  2K0P A;  1T3Q A;  2GRI A;  4YSY B;  1ZPS A;  2J52 A;  2BBC A;  3AE1 B;  2ACZ B;  4RNA A;  4HEA 1;  2K22 A;  1TS5 A;  5LNK 1;  3NS1 A;  5JXV A;  1OFF A;  1KTK A;  3SFD B;  2LFI A;  3NZ3 A;  2PVO D;  2Z8L A;  3V05 A;  3AE9 B;  4TMA B;  5BYR A;  3W5U B;  1M4V A;  2LEK A;  4B0M A;  1E10 A;  1XLN A;  1HA5 A;  3P4R B;  3P1M A;  1ACC A;  4N59 A;  2LHE A;  1E9M A;  3AE8 B;  2BS4 B;  1YJI A;  3IAM 1;  1TS3 A;  1RYJ A;  1KF6 B;  4YXD B;  3AE4 B;  3MHZ A;  4KX6 B;  1IUE A;  3AEC B;  1YJJ A;  1TY2 A;  1GB4 A;  3AEB B;  2JYT A;  3AMZ A;  1WGK A;  2ZW1 A;  3ABV B;  1FMA D;  2WQY B;  3BYT B;  4C7Y A;  3B9J A;  3NVY A;  1ET9 A;  1QOF A;  1C4P A;  3L4P A;  4A6Q A;  1ZE3 D;  3FIL B;  1JWS D;  4PT5 A;  1VDV A;  4IKG A;  3ZGZ A;  4GLS C;  3W9C B;  1ET6 A;  1TS4 A;  4NAW B;  1J7C A;  1H7X A;  3IAS 1;  2WNM A;  4XE0 A;  1QF6 A;  2ZW0 A;  1EWC A;  2M56 B;  1SJE D;  2X38 A;  4M0W A;  1VZ8 A;  4RF1 A;  3ZQ4 A;  1NEK B;  3EUB 2;  2WDR B;  4WWM A;  1GPX A;  2PMV A;  4YTP B;  1JWM D;  2CU3 A;  2K9X A;  3I9V 1;  5BMG A;  2G1E A;  2QEJ C;  2WDQ B;  5BYQ A;  2BYT A;  1FNU A;  4MAC A;  3HVZ A;  2BT6 A;  2KWD A;  1JML A;  2DYO A;  3H8H A;  1GT8 A;  2FUG 1;  4P16 A;  2PW9 A;  1CK1 A;  3ZYY X;  2E6X A;  3DWG C;  1C78 A;  1EU4 A;  1AWD A;  3ZJT A;  1LO5 D;  5AUI A;  2KDM A;  4OHJ A;  4LLG M;  1FNV A;  2IJ0 A;  2JX5 A;  2R61 A;  4ITK A;  2L52 A;  3TEX A;  4DXF A;  5BMI A;  1C76 A;  2CJN A;  3J9C A;  2KMM A;  3KWL A;  1YN3 A;  1SEB D;  4A90 A;  5C2T B;  3P4Q B;  3ZJV A;  1J7A A;  2Y5C A;  3SFE B;  2IGD A;  2N0S B;  2KN4 A;  4L2Y A;  2V0G A;  3AV8 A;  1ENF A;  1JRO A;  2OHF A;  1T5X D;  2JQR B;  4MM3 B;  1VJK A;  1Y56 A;  4Q2J A;  2PIA A;  3UI3 A;  2WXF A;  3FAH A;  3HUI A;  1HQR D;  2NMQ A;  4RGM A;  3KLS X;  2I2Y A;  3ZJU A;  1PGX A;  2W55 A;  4MH8 A;  1BUI C;  4J3O D;  3ETR A;  1TKG A;  1MHH E;  1E0Z A;  2QJL A;  1XCT L;  3SEB A;  2JZP A;  1TYG B;  1I4Q A;  1FIQ A;  4H2A A;  4XWW A;  2N9K A;  4YSZ B;  4TQ1 A;  2WXR A;  1JWU D;  4OZA A;  2JWU A;  1FD6 A;  1AW7 A;  5EE0 A;  3EA6 A;  3BZD B;  4JE3 B;  1E6E B;  2N7J A;  2Y3A A;  1NYR A;  3Q8A A;  1I4P A;  1GTH A;  1DOX A;  1TKY A;  2MEK A;  1CZP A;  2EKI A;  3KQ4 A;  4XDD A;  4RGT A;  1XEE A;  3N9Y C;  3Q8C A;  1SIJ A;  1UWX A;  2Q5W D;  1FCC C;  1XCQ L;  3VQI A;  3E56 A;  2SEB D;  2PKO A;  3VRA B;  2WXN A;  1P7E A;  2MJ3 A;  2QIE B;  2WXJ A;  4JX1 C;  1JWB D;  3WCQ A;  1L0V B;  4KGT A;  1JRP A;  1JCK B;  3BK1 A;  1FM0 D;  2CJO A;  3CWI A;  4EE2 A;  4WQM A;  4OVZ A;  1F2R I;  3MJ5 A;  2WXM A;  2LGI A;  3U7Z A;  2B76 B;  2WDV B;  1K50 A;  1VZ6 A;  3Q8B A;  5FR3 A;  1F77 A;  2LHD A;  1AN8 A;  2LMC A;  1C79 A;  4N6E B;  5EE3 A;  2IGH A;  3U2S C;  2FE8 A;  3VRB B;  3TUO A;  4ZRQ A;  2KQ4 X;  5H92 C;  2J4X A;  3GP7 A;  1J7B A;  2V3P A;  4IDI A;  4RH6 A;  3TEY A;  4RF0 A;  3AEE B;  3P4S B;  2L32 A;  4US9 A;  1ZOY B;  1GOZ A;  2JXT A;  2K3U A;  2WP9 B;  4YTN B;  2J53 A;  2XNA C;  1B9R A;  3IT4 B;  4KKJ A;  1I7H A;  3LB8 C;  5FK9 C;  3R8B A;  4ZYS A;  3Q8F A;  4N58 A;  4ZRP A;  1EU3 A;  1V97 A;  2HDE A;  1D5Z C;  1ZDV A;  1HZ5 A;  4DQO C;  5EE9 A;  1N63 A;  1K51 A;  2RDH A;  1XO3 A;  3TSS A;  2NTT A;  2W82 A;  1WRI A;  2KAJ A;  3NRZ A;  4RCO A;  2IGG A;  1V8C A;  3RFZ B;  1GTE A;  3PO0 A;  2GB1 A;  3BVZ A;  1BXT A;  2XN9 C;  2AX5 A;  1L0Y B;  1YQ4 B;  1SSN A;  4HKQ A;  1NYQ A;  4HRO A;  2BW2 A;  3CIR B;  1H7W A;  3P63 A;  3PZ8 A;  3SR6 A;  2WU2 B;  1QKZ A;  2JU6 X;  1C77 A;  3BWU D;  1N61 A;  2IPK D;  3OWE B;  1IGD A;  3FC4 A;  2V4I B;  5E6J A;  3AB5 A;  4KGR A;  4XWT A;  3LYY A;  1XLQ A;  2BB5 A;  1EM7 A;  1L6U A;  1SE3 A;  2W3R A;  3EGR A;  1UWM A;  1FCL A;  5H8Y E;  2YEP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...