5IO9A

X-ray structure of the n-terminal domain of human doublecortin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
98
structure length
98
Chain Sequence
MAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFDDVEYTKNVNPNWSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neuronal migration protein doublecortin
publication title Crystal Structures of the Human Doublecortin C- and N-terminal Domains in Complex with Specific Antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 22
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 5io9A00
1MG4A 5IOIA 2BQQA 1MJDA 2DNFA 5IN7A 1UF0A 5IO9A 5IP4D 5IKCM 1MFWA
chains in the Genus database with same CATH superfamily
1ACCA 2V4IB 1NYRA 1M4VA 4JL9A 2DYBA 3A9KB 1GG3A 2G9HD 1AYFA 2LEKA 2N4FA 4TKNA 2KHWB 1Y56A 1BUIC 2KDBA 3DBLB 3VUYA 3VR8B 2ZW1A 2KWDA 4O1NA 1JWUD 1OEYA 2WP9B 4C80A 1UD7A 4DHZB 1E7VA 3V05A 2SAKA 1A70A 3VR9B 1TS5A 5CTRC 3UQAA 2DZKA 2PE6B 3PRMB 1V6EA 2D07B 2QEJC 2Z0DB 1VZ8A 5J2RA 1K51A 1EWYC 3L13A 2KLGA 1HA5A 1C4CA 1WX8A 3KWVA 1UBQA 1SE9A 3MJWA 1JCKB 2ZCCA 3M95A 2MW5A 1X1MA 1HZ6A 1WM2A 2KWUB 2UYZB 2KOXA 2IGHA 5HKHA 1E0ZA 1ZUD2 1UWMA 3M63B 2G1EA 4I6NB 4G0NB 3RD2A 4FHKA 2W9NA 4W9GA 4A20A 2GOWA 4LNNA 3RNGC 4HROA 4FN2A 3ABVB 1FM0D 1JWMD 3EECA 2J42A 3QJZA 1F2RI 3M3JA 2KC2A 1RYJA 2KD0A 2K8BA 5AEKB 2IY0B 5DPSA 2LGIA 2IO0B 1TKGA 5D7GA 1N6ZA 2KANA 1N63A 4IOIE 3RUIB 4W9DA 1E7UA 3P2BA 5AZHA 4ZRJA 3OJ3A 3DCGA 1FPYA 2IDYA 1QILA 4USAA 1NDDA 4PS8A 1TZ1A 4FA6A 4AWJA 1WYWB 2AL3A 2BB5A 1YD8U 1TY2A 1WJ4A 2IY1B 2ZEQA 2AEHA 5T8IA 1F1HA 2I1KA 2A5UA 3H7PA 2AYOB 2QMTA 3Q8EA 1GJZA 1KH0A 4G50A 3S2AA 4XWTA 1TS3A 1JW9D 2JSVX 3DHIC 1P0RA 4ANUA 1GNUA 2KWVB 5HI1A 1VJKA 3ZO5B 2QHOA 1V81A 4RGOS 3KH0A 4A9AA 1LGRA 4GDKA 5J17A 2PEAA 3HIZA 1XO3A 1SEBD 3DBLI 1PUTA 4N59A 2KK8A 5AUKA 4KGSA 4BVUC 3GB1A 2MWSB 1WZ0A 4MM3A 4JX1C 3P4QB 3W5VB 1V5OA 4FHJA 2JRIB 2K39A 1QOGA 3D32A 2HDEA 3TEWA 2ZPYA 1B9RA 2L0FA 3PRZA 3H6NA 1I4PA 3WANA 3DVNV 2VH1A 3RZFA 2M1MA 3UGBB 2K0PA 4EE2A 1FFVA 5FK9C 1WXMA 3SHQA 5BMHA 1EU4A 3QC8B 2WGSA 4AUQC 1IPGA 4NNJB 1UUPA 1PGAA 1WGRA 2CS4A 1LFDA 5E6PA 1DGJA 1T0RC 4GLSC 4WURA 2JVCA 2GMIC 4ZRKA 1GC7A 1V49A 1NENB 1PGXA 1M94A 5CHWA 1DOYA 2WHIA 3I57A 2VZKD 2HJ8A 3DVNU 1WJ6A 4P7IA 2L00B 2Q5WD 1S1QB 2DAFA 4C7YA 4WWMA 1XLNA 1XLOA 1C77A 3C0RB 4WJQA 3AULA 3LDZE 2KN4A 2I2YA 2LWPA 5CHVC 2K8HA 1L4DB 2L32A 5LLIA 2BQQA 2INNE 2ON8A 1NYQA 1QT9A 2BT6A 2H88B 5H92C 4TQ1A 3ZUNA 2ZNVB 3QHTA 3X0WA 4I6LB 3IVFA 3LXFA 3N1ZC 1N62A 1OGWA 4KGTA 4MT5A 2W3SA 2SEBD 2AL6A 3HRDD 3AV8A 4IUMB 4ICVA 5MPOA 4P16A 2Y5BB 2BPSA 2MRPA 4D2KA 3Q8AA 1QOFA 1YJIA 4EZKA 1YJJA 2V4LA 3BYYB 3PSEB 5H8YE 2MBOA 3BY4B 1J7AA 2G45B 1SE4A 2N7EA 1N5WA 2MBHA 4BFRA 3NVVA 3M62B 4HJGE 3H7PB 2N9PC 3APCA 3PLVA 3TEXA 1SSNA 1E8YA 3PLUA 2DBYA 3NVZA 1KM7A 1E10A 4DXGA 1R4MB 3PZ7A 2N7DA 5BYQA 1FXIA 3W9CB 2LXCA 1I35A 5D3IB 1WGYA 2BYVE 2N9XA 3RN9C 3B1LX 1SIJA 3RI7C 4XWWA 2Y5PA 2RR9A 1H4RA 4W9EA 1H8CA 2BKFA 3X23A 5E6OA 1OTRB 3EGRA 3WIMA 2GBMA 2LGYA 2AQ1B 1QZEA 5IO9A 3O13A 2EKIA 1I4RA 3KQ4A 2L3ZA 3L4PA 2KXJA 1FNUA 2Y5CA 4ZDVA 3RMKC 4ITKA 2BBCA 2KNBA 2WLBA 4GGQA 1JWSD 2K1FA 4RGMA 1T3QA 1I4XA 3A9KA 4FLHA 4HRSA 1MHHE 2ZVOA 4PS3A 4J3OD 2LVQA 1IUEA 1WX9A 3HHMA 1OQYA 2AX5A 1MFWA 3PO0A 2CR5A 2LMCA 1YJ1A 4S0RA 3HK0A 2XBBC 1TBEA 3L54A 2JQRB 2WXPA 4GSWA 1CJEA 2WXNA 4RGNA 1KFYB 3A9JB 2PVOD 3JYUA 5JXVA 2PE9A 3Q3OC 3VRBB 1GC6A 2WU2B 2EELA 1WGDA 1BXTA 2MCNB 3VTWA 5E6NA 3AMZA 5IAAC 1RFKA 4YSXB 1WMHB 3PREA 2LVPA 2BS3B 3OG5A 1WXVA 4H2AA 1P7EA 3OLMD 1PDXA 4BOZB 3P4SB 3N30A 1HZ5A 3C19A 4MGKE 4ZRQA 3KW5B 1YQBA 2D10A 1YN3A 1D6EC 1CQVA 1V1PB 1ZDXA 1EWCA 2D3BA 4KVGB 1FRRA 2D11A 1AW7A 1ET6A 2K25A 3FKYA 3AEEB 3BVMA 3TSSA 1ZKHA 3DPDA 2LGXA 3DHHC 2N9EB 1LXDA 5HG2A 3R3MA 2RDBC 2M56B 5G2NA 2L76A 3WA0A 2RD0A 2CJOA 1R4MI 2LRUA 3AXCA 3NZ3A 3ZRCA 1B1ZA 2LASA 1XXGA 1ZW7A 3EFCA 5D94A 2G3QB 5CX3A 4WWOA 1SJED 4K1RB 3DVGX 2NBVB 1C4PA 3VHTC 4DXAB 2KX0A 3P4RB 4JLCA 4EZLA 1MI0A 4EFOA 1KF6B 1RWSA 1UGMA 1TT5B 3J9CA 2UWQA 2WX1A 1ZOYB 4FJZA 4KKIA 1L7YA 4OHJA 1HXYD 3ZTCA 3URYA 2K22A 2CU3A 2OJRA 3VDZA 1WRIA 2MLBA 4B9KA 5JHBA 3HUIA 2JZPA 2LJ5A 2BTEA 5IP4D 1FRDA 3TEZA 4II2B 1R7SA 3MTNB 4OZBA 3MC9A 4E74A 2LFIA 4HJKA 4RMAA 3ZW3A 1E8ZA 3AH7A 1K52A 1PGBA 5EE1A 3ZNZB 4AP4C 1YN4A 1L6UA 3APFA 3GS2A 2CU1A 3I3TB 2LUEA 2L0TA 4KKJA 2MBEA 2O6VD 2QCZA 1QQRA 3AE5B 4KIKA 1VZ6A 2KQ7A 4GN1A 2YVCA 2KAJA 4K3BA 1C78A 2FUG1 3RNAC 4OVZA 2DENB 3AB5A 3UIOB 2DWQA 2JXXA 4IWPA 4HKQA 2L05A 2RDGA 4F8CB 4GDLB 1FCLA 3BYTB 1FXAA 3UF8A 2IGDA 4MH8A 4CQNA 1XCQL 2WDRB 2KDMA 3V62A 3VAWA 2MHJA 3KVFB 2V3NA 2LI5A 2N0SB 3DWMA 2C60A 2BKRB 1C79A 3ENEA 1E7PB 3R8BA 1ENFA 4BBNC 1OFFA 3VUXA 3NS1A 4K3CA 1UWXA 2XN9C 4FXCA 2DZIA 1DOXA 2K9XA 2JZZA 3ZKJC 1J19A 4EUTA 3RNFC 2K6DB 2C9WB 3AU4A 5L83A 4KV2A 4XC2A 1T0QC 4ZYNA 3B2FA 3LB8C 2GBKA 4II3B 3TL5A 3ZXRA 2NVUI 3U52E 4DHZE 4DHJB 3RCZA 1FEHA 2GI9A 4K7SA 1SBBB 4NY0A 2FE8A 3FAHA 4RF0A 1MG4A 3ZNID 2NTTA 1JQ4A 4MGZE 3H7SA 3V6CB 3GE3C 1V97A 1WIAA 5FKAC 3Q8FA 4HDQA 5G5HA 4L23A 3APDA 1OQRA 4KGRA 5EE3A 4Q2JA 3L16A 4XX5A 4W9FA 2WXMA 4A3OA 4BBNF 1S3SG 4ANVA 3K9PB 1OQQA 2WXHA 5JH5C 2K3UA 3CIRB 4JWUC 5HHDG 2C7MB 3NHEB 1XD3B 2IBIB 1T5XD 4NQLB 4TQ0A 3AM9A 1C76A 2LD9A 1JWBD 4P1BC 2FCMA 2JU6X 4MEMA 3WAOA 4HVBA 2AQ3B 3Q3MC 1MVKA 1U4AA 3MC8A 4B0MA 2KX3A 1ZXIA 2FAZA 2H89B 3A33B 1N61A 2LVOA 2MBBB 1SGHA 4RNAA 3L0WB 4JPSA 2LZ6A 3P42A 1I4GA 2NPTA 3SDLC 4MH0E 3U30A 3QK0A 4MJSA 2WDTB 4REZA 3AEAB 2LHEA 2DZJA 2BWES 1WZ3A 4NZLB 1L0VB 1T0SC 2RPVA 3DBSA 3L08A 5JHAA 4KIKB 3IT4B 4GXBA 1F9JA 5E6JA 1Y8RC 2O2VB 5LXHA 1WJUA 1TS2A 3BK1A 4M02A 4I6PA 3VUWA 3ECIA 3JVZX 5G55A 4LJOB 5DPTA 4OVUA 3NUHB 4K81A 4S17A 1A5RA 3V61A 2QC8A 4PS7A 3N1XC 2JX5A 3GOEA 3I5JC 2KC1A 2BW2A 4IKGA 2L1AA 2LUMA 2PMVA 4JGHB 3T3OA 3A9JA 4M0WA 4NAWB 3UQBA 1E8WA 3H1UA 3CWIA 1MG8A 1I7HA 1FFUA 2DYMA 2DZMA 4W9HA 4ZHPA 1WMHA 1WE7A 2M0AA 1EO6A 1HE8A 3PVLA 2CHZA 1RAXA 4ICUA 5LXIB 1KRHA 4NAMA 4KZ0A 1V1PA 3MJ5A 2MP2A 1GB1A 2WYQA 3MHZA 2FIFA 1ZP0B 5BO4B 3CSFA 3VTVA 1JROA 2WDVB 1V2YA 3PRPB 3Q8BA 3DOWA 2N1VA 2A4ZA 2NCNA 2JWZA 1WXQA 4M8NA 3ZQ4A 2AWTA 1P9DU 4DXFA 4PT5A 5BMIA 1IBXA 3AEGB 4IG7B 2LXAA 4XGAB 2CHWA 3WAMA 4DK5A 5D6JB 2KMCA 2X8XX 2WXOA 1PFDA 4KDIC 4CYEA 2Z8LA 1WR6E 1YNTE 1HTOA 2GLSA 3NS8A 4PYUA 4ASWC 1QOAA 2KMAA 4L2YA 1KLGD 1YOVB 3Q69A 3IFWB 5BMGA 2MA9B 3PS6A 1WJNA 4LCDE 4WAFA 3JW0X 1ZGUB 1AN8A 1AARA 1C9FA 4LTUA 3SR6A 1P3QU 4XYCA 1KOTA 2WX0A 3AEFB 3SU8X 3A4RA 1WH3A 2BGFA 3NOBA 5DPRA 1V9JA 2MJEA 5FR3A 3P4PB 2KJ6A 3K9OB 3EHVA 3WAPA 3QA8A 4US9A 3ZDMC 3PV1A 1L0YB 1UZXB 4IDIA 4FBJB 3N20C 4BKGA 2NPTB 1YX6B 2J0JA 1D5MC 3Q2AC 4MJSB 4WQOB 4C4VB 3BVGA 4MDKE 4YWGG 2M17A 4YT0B 3VH4B 3RNCC 5IKCM 2VZKB 2PJHA 4RM8A 2NR2A 1FNVA 2GBJA 3FILB 2KKCA 4ZOHC 3EFUA 4M00A 3ZTDA 2AQ2B 2RDHA 2L8JA 1ZPSA 4M01A 2FNJB 3JSVA 4GDLA 3BIID 2XK5B 5JZEB 2WDQB 3TJPA 3A4SC 3R7QA 4L1BA 4NJ7A 2WXRA 4DQOC 3CSTA 3E9SA 1WFYA 2KFKB 3AEBB 3NY5A 1LO5D 2JT4B 1WSPA 2EMSA 3ZXVA 4F7ZA 3HVZA 3AE4B 3OWEB 4JWSC 2KQ4X 4LJPB 1K53A 2IYDB 4M0WB 5GMVA 1F77A 2BYFA 3QIJA 2WS3B 3O65B 2X38A 2HJ1A 4EKUA 5C23A 3A1QA 5GXGB 4US8A 4E71A 2G4SA 2RSUA 2WU5B 3SD5A 4FADA 2C7NB 2QSDA 3ML9A 3HVDA 2MP2B 4DDID 1N5XA 1F52A 3N3KB 2GBNA 3RZWC 1G6JA 2LJIA 4WAAA 2D3AA 1IYFA 2INDC 3VTUA 1WF9A 2CKHB 1QOBA 3PGEA 3ZJTA 1NVID 2BVCA 2HE7A 3QARA 1TJEA 1MHXA 1KLVA 1VDVA 4ZHOA 1IBXB 4JQWC 3EA6A 4BKSA 3MP9A 4PK1A 3U4EG 4AOFA 2DHZA 1YQ3B 3B08A 2IGGA 2WQYB 3V6EB 1XCTL 2D3GA 1MPEA 3ML8A 1CMXB 1V5TA 2WNMA 5IA7A 2BB6A 3ZJUA 2I38A 1NI2A 4RH6A 5AUIA 2NMQA 3IAM1 2DAJA 2N7JA 1EF1A 2N9LA 4ACFA 3ZIMA 3DBHB 1NBFC 1SF0A 4B6WA 4CHKA 4OW0A 4M8MA 1GB4A 4P1CC 1OEYJ 3TCAA 1TKEA 2NS5A 2KVRA 4IWQA 1L0XB 4K7UA 4BAXA 2R2OA 1XEEA 1Z2MA 2B76B 1KTKA 4MSMB 4WWNA 2KTFA 1Q5WB 2RPQA 2FIDA 4HK2A 4G11A 4YL8A 1L6VA 1EM7A 3I63C 2UU7A 4MELA 2WXGA 2XEWA 2KDEB 3GP7A 3ZYYX 2KT7A 4W9KA 3U7DA 3BVZA 2KDFB 2KQSA 3W5UB 1YN5A 2MQJA 3U7ZA 1GPXA 2BS4B 1PYWD 2ZJDA 2OHFA 2ZCBA 4AJWA 3ZDTA 1ZE3D 1XF5L 2O2VA 4NJ6A 3QWZB 1RFAA 1TYGB 4HCPB 1UGJA 3TBLD 3KLSX 2KTRB 3JSVB 2WXKA 2JRHA 3PTFC 4WJNA 2E6XA 2ZZPB 3MHSD 4GIVA 3Q14C 1L4ZB 5KHQA 4KSKC 2BYEA 2JWUA 4FJVB 1WR1A 1F2RC 4F1SA 1IGDA 3ZRFA 2K5PA 2PIAA 4G3XB 2GRIA 2FBWB 2KWCA 5KHOA 4YTPB 2MH7A 1WGKA 3E56A 2KZRA 4NAWA 4LDTB 2Z59B 4CO7A 1STEA 3SFEB 4X57B 4EEWA 3H9DA 3A1QB 4JIOU 1E9MA 1HEZE 1V8CA 1ROEA 2JY6A 1TY0A 2MSED 1XT9B 1TZOA 5D3DA 4AS1A 1L5PA 2GB1A 3Q6BA 2KMMA 3ETRA 2DLBA 3UI3A 2G4DB 4YXDB 1MJDA 1EF5A 2NBWB 2ACZB 4R3DA 3HM6X 3R66C 3QX1A 1ISNA 3LYYA 4IW0A 4GMVA 4PYZA 4N9F4 4IM2A 3U2SC 2V0GA 1JALA 4RFBA 3OJ4B 2JYEA 1CZPA 1D3ZA 2D2QA 1TTNA 3DBHI 1P1AA 4HKZE 2DNFA 3P63A 2Z0EB 3AE1B 1FD6A 2PPHA 1T0YA 3W1YA 3T3NA 2YEPB 4LNKA 1VR9A 4J6IA 1FMAD 3W2DA 2D5GA 5LNK1 3NVYA 2IJ0A 2BWFA 1YX5B 2QDFA 2W55A 3R7RA 4URKA 2ZW0A 3IAS1 3ZNHB 2CHXA 3KUZA 4WWPA 1PQSA 3DDCB 4ZRIA 2O6VB 3IBEA 3L17A 2ZPNA 4BOSC 1Z5SB 1CK1A 2CJNA 2IO2B 4WQMA 1P7FA 3QCAA 3OAWA 1XQQA 4LLGM 4P6VF 2INPE 2KFJA 3PZ8A 4XDDA 3W1SC 4A3PA 4LNIA 3BZDB 2WXFA 3VQIA 2IO3B 3ALBA 1L2NA 2C7HA 3ZVVA 3TEYA 3N1YC 4OZAA 1WE6A 1C1YB 4ZYSA 3N9YC 1SXTA 4N6EB 2INCC 2YLMA 3AE8B 2J52A 2HTME 3NG0A 3U8ZA 1Q10A 4TV3A 4C4VA 5IOIA 1KLUD 1QLBB 4NJCA 4LNFA 1WWTA 1FXTB 3FC4A 3ZJVA 4WJPA 3IXSA 4HCNB 1VLBA 3FILA 4MGYE 1HTQA 1E8XA 4KSLC 3WALA 3SEBA 1VD2A 4W9CA 4YTMB 3DWGC 1UBIA 1WY8A 3AN1A 4HPPA 4IC7B 1C3TA 4B0EA 1R4NB 1N60A 1J7CA 3RNEC 2XK5A 2WXLA 4C00A 4W9LA 2I1JA 2J53A 2LRWA 1LM8B 2ASQA 3RYTA 1VZ7A 2KFKA 1SB3C 2KN5A 5C3JB 2JF5A 3TIXA 4YTNB 3R2TA 3NVWA 2FCNA 3VVWB 2PTLA 1JWAD 1Q1OA 2K6QA 1K50A 3PT2B 2J4XA 3DBRB 2KJRA 1EUVB 2XNAC 1V1OA 4EOYA 5EE0A 1ESFA 3DHGC 2JUOA 4OZCA 2WXQA 4RM9A 4TUUA 5DPWA 2QIEB 2IPKD 2Y3AA 3AU5A 2YEPF 1JRUA 1SIFA 5AZFA 4AJYB 1F0ZA 1UELA 5CHFA 1BT0A 3AEDB 2BF8B 3AE9B 2D3CA 2QILA 4MSQB 2V3SA 1IP9A 3PZDA 2DX5B 3Q3JA 3WCQA 3MC0B 2IO1B 4HXDA 1SJHD 3RULA 4HLEA 1WXAA 4DWFA 1WI0A 3T9LA 3VRAB 1WGGA 3QQ8B 2C5LC 3EUB2 1I4HA 2OOBB 3GZNB 1D4BA 2J0MA 1ET9A 5EDSA 2V1YA 3HM3A 4B95A 3B0AA 5DCNA 2HTHA 1NI3A 2M4NA 3AECB 2N1WA 4LK0M 2LGSA 4HPLB 1FIQA 1T6BX 5TR5A 4BKTA 1WM3A 4C56C 2OEDA 1I4QA 5EE9A 1I42A 4GOCA 3KYDD 5D2MB 4ANXA 4ZRPA 3NRZA 3B2GA 4C7ZA 2BYTA 2MEKA 4KX6B 3LJ3A 2HD5B 2BS2B 3RT3B 1Q0WB 1EU3A 2E3TA 1E5WA 2R2QA 5TSSA 4YSZB 1R4NI 3VXWA 2ZNVC 2WXJA 3T8MA 1GAQB 3ZGZA 2GBRA 3AE3B 1YIWA 3IT6B 1JRPA 4KDLB 4GDKB 4E3CA 2K8CA 2RMMA 3NZUA 4QAYA 2M19A 4KZCA 2DYOA 5IN7A 5BYSA 3DBRI 2B3AA 1SE3A 5FR6A 3Q3FA 4ARCA 1D5ZC 2VRRB 3B9JA 4NPNA 3TUOA 3KWLA 3C8YA 4LNOA 4MM3B 3PHXB 4N58A 2JZ3B 4XDCA 1XLPA 3KUDB 4YSYB 4JE3B 2KTRA 1IGCA 1UH6A 2KJHB 1QF6A 1HQRD 3KUCB 4A8XC 2REXA 2KACA 1TKYA 3PHWB 2JXTA 3CMMB 5AZGA 2W82A 5HFYA 5BYRA 3RNBC 2JYTA 2WXIA 1BMLC 1RRBA 2TSSA 2FCQA 2ZVNA 4FJYA 4TSSA 4WIPA 3UIPB 1RLFA 2KLCA 3BWUD 4ANWA 2NBUA 3R2IA 4HDOA 2N9KA 1QKZA 1XLQA 4IWOA 1WRDB 3I9V1 1WGHA 3UINB 2PVGC 4NQKE 4RCOA 4RGTA 2J7QB 1J7BA 4HPMB 4A90A 1J0GA 3GZNI 4MACA 1TIFA 2QJLA 4HWIB 2MJ3A 3IHPC 2L83A 4WJOA 4GU2A 3ZLZA 3KYCD 4MGIE 4W9JA 1RM6C 2W3RA 4DDGD 4BZAA 1FO4A 1SE2A 3EC8A 3N32A 3ONSA 1DYQA 1TGZB 3AE6B 3W1SA 1WX7A 2RGFA 1VRAB 3V3XA 3P1MA 5L95C 4K7WA 1JMLA 2EKEC 2V3PA 1TS4A 2L7RA 3AI5A 3NZSA 5G5GA 4W9IA 1E6EB 3RPFC 3SFDB 3BINA 2ICIA 2KO3A 3ZNGC 4IM3A 1LQBA 2M8SA 2IZVB 4XZ4A 5J18A 1V80A 4LDTD 1AWDA 2L52A 2KDIA 2W54A 4XE0A 2MX2A 5C1ZA 2KYWA 2JPHA 2KVZA 3PPAA 3IG3A 4WH4A 5C2TB 1NEKB 3GE8C 1KJTA 3QAQA 4GB9A 2O6VA 4A6QA 1J8CA 3VFKA 2LGDA 2PKOA 3DVGY 1GUAB 1UNSA 2FCSA 2PW9A 2VH2A 4DHJD 4EZJA 1C4AA 3MFGA 1E90A 1V86A 4DBGA 2WWZA 4UDUC 4AQ7A 1WYGA 3L10B 1VCBA 2V9HA 4BKSD 1UF0A 3NJTA 1K8RB 2MBQA 1DOIA 5I4DA 3DQVA 2OJWA 2EMTA 4HEA1 2J0KA 4TMAB 2FUHB 1GOZA 4FULA 3AE7B 3BK2A 1FNWA 1YQ4B 3V60A 1D5XC 3Q3NC 4ARIA 3Q8CA 3CF6E 2ONQA 2LHDA 2NTSA 1P98A 2R61A 2MJDA 1FCCC 3AE2B 4RF1A 1ZDVA 1YMHE 4IM0A 4OVVA 1ZXHA 2PLPA 2M0XA 4A55A 1WXSA 3VH3B 3RFZB 3H8HA 3TMPB
chains in the Genus database with same CATH topology
1MG4A 5IOIA 2BQQA 1MJDA 2DNFA 5IN7A 1UF0A 5IO9A 5IP4D 5IKCM 1MFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG4 A;  5IOI A;  2BQQ A;  1MJD A;  2DNF A;  5IN7 A;  1UF0 A;  5IO9 A;  5IP4 D;  5IKC M;  1MFW A; 
#chains in the Genus database with same CATH topology
 1ACC A;  2V4I B;  1NYR A;  1M4V A;  4JL9 A;  2DYB A;  3A9K B;  1GG3 A;  2G9H D;  1AYF A;  2LEK A;  2N4F A;  4TKN A;  2KHW B;  1Y56 A;  1BUI C;  2KDB A;  3DBL B;  3VUY A;  3VR8 B;  2ZW1 A;  2KWD A;  4O1N A;  1JWU D;  1OEY A;  2WP9 B;  4C80 A;  1UD7 A;  4DHZ B;  1E7V A;  3V05 A;  2SAK A;  1A70 A;  3VR9 B;  1TS5 A;  5CTR C;  3UQA A;  2DZK A;  2PE6 B;  3PRM B;  1V6E A;  2D07 B;  2QEJ C;  2Z0D B;  1VZ8 A;  5J2R A;  1K51 A;  1EWY C;  3L13 A;  2KLG A;  1HA5 A;  1C4C A;  1WX8 A;  3KWV A;  1UBQ A;  1SE9 A;  3MJW A;  1JCK B;  2ZCC A;  3M95 A;  2MW5 A;  1X1M A;  1HZ6 A;  1WM2 A;  2KWU B;  2UYZ B;  2KOX A;  2IGH A;  5HKH A;  1E0Z A;  1ZUD 2;  1UWM A;  3M63 B;  2G1E A;  4I6N B;  4G0N B;  3RD2 A;  4FHK A;  2W9N A;  4W9G A;  4A20 A;  2GOW A;  4LNN A;  3RNG C;  4HRO A;  4FN2 A;  3ABV B;  1FM0 D;  1JWM D;  3EEC A;  2J42 A;  3QJZ A;  1F2R I;  3M3J A;  2KC2 A;  1RYJ A;  2KD0 A;  2K8B A;  5AEK B;  2IY0 B;  5DPS A;  2LGI A;  2IO0 B;  1TKG A;  5D7G A;  1N6Z A;  2KAN A;  1N63 A;  4IOI E;  3RUI B;  4W9D A;  1E7U A;  3P2B A;  5AZH A;  4ZRJ A;  3OJ3 A;  3DCG A;  1FPY A;  2IDY A;  1QIL A;  4USA A;  1NDD A;  4PS8 A;  1TZ1 A;  4FA6 A;  4AWJ A;  1WYW B;  2AL3 A;  2BB5 A;  1YD8 U;  1TY2 A;  1WJ4 A;  2IY1 B;  2ZEQ A;  2AEH A;  5T8I A;  1F1H A;  2I1K A;  2A5U A;  3H7P A;  2AYO B;  2QMT A;  3Q8E A;  1GJZ A;  1KH0 A;  4G50 A;  3S2A A;  4XWT A;  1TS3 A;  1JW9 D;  2JSV X;  3DHI C;  1P0R A;  4ANU A;  1GNU A;  2KWV B;  5HI1 A;  1VJK A;  3ZO5 B;  2QHO A;  1V81 A;  4RGO S;  3KH0 A;  4A9A A;  1LGR A;  4GDK A;  5J17 A;  2PEA A;  3HIZ A;  1XO3 A;  1SEB D;  3DBL I;  1PUT A;  4N59 A;  2KK8 A;  5AUK A;  4KGS A;  4BVU C;  3GB1 A;  2MWS B;  1WZ0 A;  4MM3 A;  4JX1 C;  3P4Q B;  3W5V B;  1V5O A;  4FHJ A;  2JRI B;  2K39 A;  1QOG A;  3D32 A;  2HDE A;  3TEW A;  2ZPY A;  1B9R A;  2L0F A;  3PRZ A;  3H6N A;  1I4P A;  3WAN A;  3DVN V;  2VH1 A;  3RZF A;  2M1M A;  3UGB B;  2K0P A;  4EE2 A;  1FFV A;  5FK9 C;  1WXM A;  3SHQ A;  5BMH A;  1EU4 A;  3QC8 B;  2WGS A;  4AUQ C;  1IPG A;  4NNJ B;  1UUP A;  1PGA A;  1WGR A;  2CS4 A;  1LFD A;  5E6P A;  1DGJ A;  1T0R C;  4GLS C;  4WUR A;  2JVC A;  2GMI C;  4ZRK A;  1GC7 A;  1V49 A;  1NEN B;  1PGX A;  1M94 A;  5CHW A;  1DOY A;  2WHI A;  3I57 A;  2VZK D;  2HJ8 A;  3DVN U;  1WJ6 A;  4P7I A;  2L00 B;  2Q5W D;  1S1Q B;  2DAF A;  4C7Y A;  4WWM A;  1XLN A;  1XLO A;  1C77 A;  3C0R B;  4WJQ A;  3AUL A;  3LDZ E;  2KN4 A;  2I2Y A;  2LWP A;  5CHV C;  2K8H A;  1L4D B;  2L32 A;  5LLI A;  2BQQ A;  2INN E;  2ON8 A;  1NYQ A;  1QT9 A;  2BT6 A;  2H88 B;  5H92 C;  4TQ1 A;  3ZUN A;  2ZNV B;  3QHT A;  3X0W A;  4I6L B;  3IVF A;  3LXF A;  3N1Z C;  1N62 A;  1OGW A;  4KGT A;  4MT5 A;  2W3S A;  2SEB D;  2AL6 A;  3HRD D;  3AV8 A;  4IUM B;  4ICV A;  5MPO A;  4P16 A;  2Y5B B;  2BPS A;  2MRP A;  4D2K A;  3Q8A A;  1QOF A;  1YJI A;  4EZK A;  1YJJ A;  2V4L A;  3BYY B;  3PSE B;  5H8Y E;  2MBO A;  3BY4 B;  1J7A A;  2G45 B;  1SE4 A;  2N7E A;  1N5W A;  2MBH A;  4BFR A;  3NVV A;  3M62 B;  4HJG E;  3H7P B;  2N9P C;  3APC A;  3PLV A;  3TEX A;  1SSN A;  1E8Y A;  3PLU A;  2DBY A;  3NVZ A;  1KM7 A;  1E10 A;  4DXG A;  1R4M B;  3PZ7 A;  2N7D A;  5BYQ A;  1FXI A;  3W9C B;  2LXC A;  1I35 A;  5D3I B;  1WGY A;  2BYV E;  2N9X A;  3RN9 C;  3B1L X;  1SIJ A;  3RI7 C;  4XWW A;  2Y5P A;  2RR9 A;  1H4R A;  4W9E A;  1H8C A;  2BKF A;  3X23 A;  5E6O A;  1OTR B;  3EGR A;  3WIM A;  2GBM A;  2LGY A;  2AQ1 B;  1QZE A;  5IO9 A;  3O13 A;  2EKI A;  1I4R A;  3KQ4 A;  2L3Z A;  3L4P A;  2KXJ A;  1FNU A;  2Y5C A;  4ZDV A;  3RMK C;  4ITK A;  2BBC A;  2KNB A;  2WLB A;  4GGQ A;  1JWS D;  2K1F A;  4RGM A;  1T3Q A;  1I4X A;  3A9K A;  4FLH A;  4HRS A;  1MHH E;  2ZVO A;  4PS3 A;  4J3O D;  2LVQ A;  1IUE A;  1WX9 A;  3HHM A;  1OQY A;  2AX5 A;  1MFW A;  3PO0 A;  2CR5 A;  2LMC A;  1YJ1 A;  4S0R A;  3HK0 A;  2XBB C;  1TBE A;  3L54 A;  2JQR B;  2WXP A;  4GSW A;  1CJE A;  2WXN A;  4RGN A;  1KFY B;  3A9J B;  2PVO D;  3JYU A;  5JXV A;  2PE9 A;  3Q3O C;  3VRB B;  1GC6 A;  2WU2 B;  2EEL A;  1WGD A;  1BXT A;  2MCN B;  3VTW A;  5E6N A;  3AMZ A;  5IAA C;  1RFK A;  4YSX B;  1WMH B;  3PRE A;  2LVP A;  2BS3 B;  3OG5 A;  1WXV A;  4H2A A;  1P7E A;  3OLM D;  1PDX A;  4BOZ B;  3P4S B;  3N30 A;  1HZ5 A;  3C19 A;  4MGK E;  4ZRQ A;  3KW5 B;  1YQB A;  2D10 A;  1YN3 A;  1D6E C;  1CQV A;  1V1P B;  1ZDX A;  1EWC A;  2D3B A;  4KVG B;  1FRR A;  2D11 A;  1AW7 A;  1ET6 A;  2K25 A;  3FKY A;  3AEE B;  3BVM A;  3TSS A;  1ZKH A;  3DPD A;  2LGX A;  3DHH C;  2N9E B;  1LXD A;  5HG2 A;  3R3M A;  2RDB C;  2M56 B;  5G2N A;  2L76 A;  3WA0 A;  2RD0 A;  2CJO A;  1R4M I;  2LRU A;  3AXC A;  3NZ3 A;  3ZRC A;  1B1Z A;  2LAS A;  1XXG A;  1ZW7 A;  3EFC A;  5D94 A;  2G3Q B;  5CX3 A;  4WWO A;  1SJE D;  4K1R B;  3DVG X;  2NBV B;  1C4P A;  3VHT C;  4DXA B;  2KX0 A;  3P4R B;  4JLC A;  4EZL A;  1MI0 A;  4EFO A;  1KF6 B;  1RWS A;  1UGM A;  1TT5 B;  3J9C A;  2UWQ A;  2WX1 A;  1ZOY B;  4FJZ A;  4KKI A;  1L7Y A;  4OHJ A;  1HXY D;  3ZTC A;  3URY A;  2K22 A;  2CU3 A;  2OJR A;  3VDZ A;  1WRI A;  2MLB A;  4B9K A;  5JHB A;  3HUI A;  2JZP A;  2LJ5 A;  2BTE A;  5IP4 D;  1FRD A;  3TEZ A;  4II2 B;  1R7S A;  3MTN B;  4OZB A;  3MC9 A;  4E74 A;  2LFI A;  4HJK A;  4RMA A;  3ZW3 A;  1E8Z A;  3AH7 A;  1K52 A;  1PGB A;  5EE1 A;  3ZNZ B;  4AP4 C;  1YN4 A;  1L6U A;  3APF A;  3GS2 A;  2CU1 A;  3I3T B;  2LUE A;  2L0T A;  4KKJ A;  2MBE A;  2O6V D;  2QCZ A;  1QQR A;  3AE5 B;  4KIK A;  1VZ6 A;  2KQ7 A;  4GN1 A;  2YVC A;  2KAJ A;  4K3B A;  1C78 A;  2FUG 1;  3RNA C;  4OVZ A;  2DEN B;  3AB5 A;  3UIO B;  2DWQ A;  2JXX A;  4IWP A;  4HKQ A;  2L05 A;  2RDG A;  4F8C B;  4GDL B;  1FCL A;  3BYT B;  1FXA A;  3UF8 A;  2IGD A;  4MH8 A;  4CQN A;  1XCQ L;  2WDR B;  2KDM A;  3V62 A;  3VAW A;  2MHJ A;  3KVF B;  2V3N A;  2LI5 A;  2N0S B;  3DWM A;  2C60 A;  2BKR B;  1C79 A;  3ENE A;  1E7P B;  3R8B A;  1ENF A;  4BBN C;  1OFF A;  3VUX A;  3NS1 A;  4K3C A;  1UWX A;  2XN9 C;  4FXC A;  2DZI A;  1DOX A;  2K9X A;  2JZZ A;  3ZKJ C;  1J19 A;  4EUT A;  3RNF C;  2K6D B;  2C9W B;  3AU4 A;  5L83 A;  4KV2 A;  4XC2 A;  1T0Q C;  4ZYN A;  3B2F A;  3LB8 C;  2GBK A;  4II3 B;  3TL5 A;  3ZXR A;  2NVU I;  3U52 E;  4DHZ E;  4DHJ B;  3RCZ A;  1FEH A;  2GI9 A;  4K7S A;  1SBB B;  4NY0 A;  2FE8 A;  3FAH A;  4RF0 A;  1MG4 A;  3ZNI D;  2NTT A;  1JQ4 A;  4MGZ E;  3H7S A;  3V6C B;  3GE3 C;  1V97 A;  1WIA A;  5FKA C;  3Q8F A;  4HDQ A;  5G5H A;  4L23 A;  3APD A;  1OQR A;  4KGR A;  5EE3 A;  4Q2J A;  3L16 A;  4XX5 A;  4W9F A;  2WXM A;  4A3O A;  4BBN F;  1S3S G;  4ANV A;  3K9P B;  1OQQ A;  2WXH A;  5JH5 C;  2K3U A;  3CIR B;  4JWU C;  5HHD G;  2C7M B;  3NHE B;  1XD3 B;  2IBI B;  1T5X D;  4NQL B;  4TQ0 A;  3AM9 A;  1C76 A;  2LD9 A;  1JWB D;  4P1B C;  2FCM A;  2JU6 X;  4MEM A;  3WAO A;  4HVB A;  2AQ3 B;  3Q3M C;  1MVK A;  1U4A A;  3MC8 A;  4B0M A;  2KX3 A;  1ZXI A;  2FAZ A;  2H89 B;  3A33 B;  1N61 A;  2LVO A;  2MBB B;  1SGH A;  4RNA A;  3L0W B;  4JPS A;  2LZ6 A;  3P42 A;  1I4G A;  2NPT A;  3SDL C;  4MH0 E;  3U30 A;  3QK0 A;  4MJS A;  2WDT B;  4REZ A;  3AEA B;  2LHE A;  2DZJ A;  2BWE S;  1WZ3 A;  4NZL B;  1L0V B;  1T0S C;  2RPV A;  3DBS A;  3L08 A;  5JHA A;  4KIK B;  3IT4 B;  4GXB A;  1F9J A;  5E6J A;  1Y8R C;  2O2V B;  5LXH A;  1WJU A;  1TS2 A;  3BK1 A;  4M02 A;  4I6P A;  3VUW A;  3ECI A;  3JVZ X;  5G55 A;  4LJO B;  5DPT A;  4OVU A;  3NUH B;  4K81 A;  4S17 A;  1A5R A;  3V61 A;  2QC8 A;  4PS7 A;  3N1X C;  2JX5 A;  3GOE A;  3I5J C;  2KC1 A;  2BW2 A;  4IKG A;  2L1A A;  2LUM A;  2PMV A;  4JGH B;  3T3O A;  3A9J A;  4M0W A;  4NAW B;  3UQB A;  1E8W A;  3H1U A;  3CWI A;  1MG8 A;  1I7H A;  1FFU A;  2DYM A;  2DZM A;  4W9H A;  4ZHP A;  1WMH A;  1WE7 A;  2M0A A;  1EO6 A;  1HE8 A;  3PVL A;  2CHZ A;  1RAX A;  4ICU A;  5LXI B;  1KRH A;  4NAM A;  4KZ0 A;  1V1P A;  3MJ5 A;  2MP2 A;  1GB1 A;  2WYQ A;  3MHZ A;  2FIF A;  1ZP0 B;  5BO4 B;  3CSF A;  3VTV A;  1JRO A;  2WDV B;  1V2Y A;  3PRP B;  3Q8B A;  3DOW A;  2N1V A;  2A4Z A;  2NCN A;  2JWZ A;  1WXQ A;  4M8N A;  3ZQ4 A;  2AWT A;  1P9D U;  4DXF A;  4PT5 A;  5BMI A;  1IBX A;  3AEG B;  4IG7 B;  2LXA A;  4XGA B;  2CHW A;  3WAM A;  4DK5 A;  5D6J B;  2KMC A;  2X8X X;  2WXO A;  1PFD A;  4KDI C;  4CYE A;  2Z8L A;  1WR6 E;  1YNT E;  1HTO A;  2GLS A;  3NS8 A;  4PYU A;  4ASW C;  1QOA A;  2KMA A;  4L2Y A;  1KLG D;  1YOV B;  3Q69 A;  3IFW B;  5BMG A;  2MA9 B;  3PS6 A;  1WJN A;  4LCD E;  4WAF A;  3JW0 X;  1ZGU B;  1AN8 A;  1AAR A;  1C9F A;  4LTU A;  3SR6 A;  1P3Q U;  4XYC A;  1KOT A;  2WX0 A;  3AEF B;  3SU8 X;  3A4R A;  1WH3 A;  2BGF A;  3NOB A;  5DPR A;  1V9J A;  2MJE A;  5FR3 A;  3P4P B;  2KJ6 A;  3K9O B;  3EHV A;  3WAP A;  3QA8 A;  4US9 A;  3ZDM C;  3PV1 A;  1L0Y B;  1UZX B;  4IDI A;  4FBJ B;  3N20 C;  4BKG A;  2NPT B;  1YX6 B;  2J0J A;  1D5M C;  3Q2A C;  4MJS B;  4WQO B;  4C4V B;  3BVG A;  4MDK E;  4YWG G;  2M17 A;  4YT0 B;  3VH4 B;  3RNC C;  5IKC M;  2VZK B;  2PJH A;  4RM8 A;  2NR2 A;  1FNV A;  2GBJ A;  3FIL B;  2KKC A;  4ZOH C;  3EFU A;  4M00 A;  3ZTD A;  2AQ2 B;  2RDH A;  2L8J A;  1ZPS A;  4M01 A;  2FNJ B;  3JSV A;  4GDL A;  3BII D;  2XK5 B;  5JZE B;  2WDQ B;  3TJP A;  3A4S C;  3R7Q A;  4L1B A;  4NJ7 A;  2WXR A;  4DQO C;  3CST A;  3E9S A;  1WFY A;  2KFK B;  3AEB B;  3NY5 A;  1LO5 D;  2JT4 B;  1WSP A;  2EMS A;  3ZXV A;  4F7Z A;  3HVZ A;  3AE4 B;  3OWE B;  4JWS C;  2KQ4 X;  4LJP B;  1K53 A;  2IYD B;  4M0W B;  5GMV A;  1F77 A;  2BYF A;  3QIJ A;  2WS3 B;  3O65 B;  2X38 A;  2HJ1 A;  4EKU A;  5C23 A;  3A1Q A;  5GXG B;  4US8 A;  4E71 A;  2G4S A;  2RSU A;  2WU5 B;  3SD5 A;  4FAD A;  2C7N B;  2QSD A;  3ML9 A;  3HVD A;  2MP2 B;  4DDI D;  1N5X A;  1F52 A;  3N3K B;  2GBN A;  3RZW C;  1G6J A;  2LJI A;  4WAA A;  2D3A A;  1IYF A;  2IND C;  3VTU A;  1WF9 A;  2CKH B;  1QOB A;  3PGE A;  3ZJT A;  1NVI D;  2BVC A;  2HE7 A;  3QAR A;  1TJE A;  1MHX A;  1KLV A;  1VDV A;  4ZHO A;  1IBX B;  4JQW C;  3EA6 A;  4BKS A;  3MP9 A;  4PK1 A;  3U4E G;  4AOF A;  2DHZ A;  1YQ3 B;  3B08 A;  2IGG A;  2WQY B;  3V6E B;  1XCT L;  2D3G A;  1MPE A;  3ML8 A;  1CMX B;  1V5T A;  2WNM A;  5IA7 A;  2BB6 A;  3ZJU A;  2I38 A;  1NI2 A;  4RH6 A;  5AUI A;  2NMQ A;  3IAM 1;  2DAJ A;  2N7J A;  1EF1 A;  2N9L A;  4ACF A;  3ZIM A;  3DBH B;  1NBF C;  1SF0 A;  4B6W A;  4CHK A;  4OW0 A;  4M8M A;  1GB4 A;  4P1C C;  1OEY J;  3TCA A;  1TKE A;  2NS5 A;  2KVR A;  4IWQ A;  1L0X B;  4K7U A;  4BAX A;  2R2O A;  1XEE A;  1Z2M A;  2B76 B;  1KTK A;  4MSM B;  4WWN A;  2KTF A;  1Q5W B;  2RPQ A;  2FID A;  4HK2 A;  4G11 A;  4YL8 A;  1L6V A;  1EM7 A;  3I63 C;  2UU7 A;  4MEL A;  2WXG A;  2XEW A;  2KDE B;  3GP7 A;  3ZYY X;  2KT7 A;  4W9K A;  3U7D A;  3BVZ A;  2KDF B;  2KQS A;  3W5U B;  1YN5 A;  2MQJ A;  3U7Z A;  1GPX A;  2BS4 B;  1PYW D;  2ZJD A;  2OHF A;  2ZCB A;  4AJW A;  3ZDT A;  1ZE3 D;  1XF5 L;  2O2V A;  4NJ6 A;  3QWZ B;  1RFA A;  1TYG B;  4HCP B;  1UGJ A;  3TBL D;  3KLS X;  2KTR B;  3JSV B;  2WXK A;  2JRH A;  3PTF C;  4WJN A;  2E6X A;  2ZZP B;  3MHS D;  4GIV A;  3Q14 C;  1L4Z B;  5KHQ A;  4KSK C;  2BYE A;  2JWU A;  4FJV B;  1WR1 A;  1F2R C;  4F1S A;  1IGD A;  3ZRF A;  2K5P A;  2PIA A;  4G3X B;  2GRI A;  2FBW B;  2KWC A;  5KHO A;  4YTP B;  2MH7 A;  1WGK A;  3E56 A;  2KZR A;  4NAW A;  4LDT B;  2Z59 B;  4CO7 A;  1STE A;  3SFE B;  4X57 B;  4EEW A;  3H9D A;  3A1Q B;  4JIO U;  1E9M A;  1HEZ E;  1V8C A;  1ROE A;  2JY6 A;  1TY0 A;  2MSE D;  1XT9 B;  1TZO A;  5D3D A;  4AS1 A;  1L5P A;  2GB1 A;  3Q6B A;  2KMM A;  3ETR A;  2DLB A;  3UI3 A;  2G4D B;  4YXD B;  1MJD A;  1EF5 A;  2NBW B;  2ACZ B;  4R3D A;  3HM6 X;  3R66 C;  3QX1 A;  1ISN A;  3LYY A;  4IW0 A;  4GMV A;  4PYZ A;  4N9F 4;  4IM2 A;  3U2S C;  2V0G A;  1JAL A;  4RFB A;  3OJ4 B;  2JYE A;  1CZP A;  1D3Z A;  2D2Q A;  1TTN A;  3DBH I;  1P1A A;  4HKZ E;  2DNF A;  3P63 A;  2Z0E B;  3AE1 B;  1FD6 A;  2PPH A;  1T0Y A;  3W1Y A;  3T3N A;  2YEP B;  4LNK A;  1VR9 A;  4J6I A;  1FMA D;  3W2D A;  2D5G A;  5LNK 1;  3NVY A;  2IJ0 A;  2BWF A;  1YX5 B;  2QDF A;  2W55 A;  3R7R A;  4URK A;  2ZW0 A;  3IAS 1;  3ZNH B;  2CHX A;  3KUZ A;  4WWP A;  1PQS A;  3DDC B;  4ZRI A;  2O6V B;  3IBE A;  3L17 A;  2ZPN A;  4BOS C;  1Z5S B;  1CK1 A;  2CJN A;  2IO2 B;  4WQM A;  1P7F A;  3QCA A;  3OAW A;  1XQQ A;  4LLG M;  4P6V F;  2INP E;  2KFJ A;  3PZ8 A;  4XDD A;  3W1S C;  4A3P A;  4LNI A;  3BZD B;  2WXF A;  3VQI A;  2IO3 B;  3ALB A;  1L2N A;  2C7H A;  3ZVV A;  3TEY A;  3N1Y C;  4OZA A;  1WE6 A;  1C1Y B;  4ZYS A;  3N9Y C;  1SXT A;  4N6E B;  2INC C;  2YLM A;  3AE8 B;  2J52 A;  2HTM E;  3NG0 A;  3U8Z A;  1Q10 A;  4TV3 A;  4C4V A;  5IOI A;  1KLU D;  1QLB B;  4NJC A;  4LNF A;  1WWT A;  1FXT B;  3FC4 A;  3ZJV A;  4WJP A;  3IXS A;  4HCN B;  1VLB A;  3FIL A;  4MGY E;  1HTQ A;  1E8X A;  4KSL C;  3WAL A;  3SEB A;  1VD2 A;  4W9C A;  4YTM B;  3DWG C;  1UBI A;  1WY8 A;  3AN1 A;  4HPP A;  4IC7 B;  1C3T A;  4B0E A;  1R4N B;  1N60 A;  1J7C A;  3RNE C;  2XK5 A;  2WXL A;  4C00 A;  4W9L A;  2I1J A;  2J53 A;  2LRW A;  1LM8 B;  2ASQ A;  3RYT A;  1VZ7 A;  2KFK A;  1SB3 C;  2KN5 A;  5C3J B;  2JF5 A;  3TIX A;  4YTN B;  3R2T A;  3NVW A;  2FCN A;  3VVW B;  2PTL A;  1JWA D;  1Q1O A;  2K6Q A;  1K50 A;  3PT2 B;  2J4X A;  3DBR B;  2KJR A;  1EUV B;  2XNA C;  1V1O A;  4EOY A;  5EE0 A;  1ESF A;  3DHG C;  2JUO A;  4OZC A;  2WXQ A;  4RM9 A;  4TUU A;  5DPW A;  2QIE B;  2IPK D;  2Y3A A;  3AU5 A;  2YEP F;  1JRU A;  1SIF A;  5AZF A;  4AJY B;  1F0Z A;  1UEL A;  5CHF A;  1BT0 A;  3AED B;  2BF8 B;  3AE9 B;  2D3C A;  2QIL A;  4MSQ B;  2V3S A;  1IP9 A;  3PZD A;  2DX5 B;  3Q3J A;  3WCQ A;  3MC0 B;  2IO1 B;  4HXD A;  1SJH D;  3RUL A;  4HLE A;  1WXA A;  4DWF A;  1WI0 A;  3T9L A;  3VRA B;  1WGG A;  3QQ8 B;  2C5L C;  3EUB 2;  1I4H A;  2OOB B;  3GZN B;  1D4B A;  2J0M A;  1ET9 A;  5EDS A;  2V1Y A;  3HM3 A;  4B95 A;  3B0A A;  5DCN A;  2HTH A;  1NI3 A;  2M4N A;  3AEC B;  2N1W A;  4LK0 M;  2LGS A;  4HPL B;  1FIQ A;  1T6B X;  5TR5 A;  4BKT A;  1WM3 A;  4C56 C;  2OED A;  1I4Q A;  5EE9 A;  1I42 A;  4GOC A;  3KYD D;  5D2M B;  4ANX A;  4ZRP A;  3NRZ A;  3B2G A;  4C7Z A;  2BYT A;  2MEK A;  4KX6 B;  3LJ3 A;  2HD5 B;  2BS2 B;  3RT3 B;  1Q0W B;  1EU3 A;  2E3T A;  1E5W A;  2R2Q A;  5TSS A;  4YSZ B;  1R4N I;  3VXW A;  2ZNV C;  2WXJ A;  3T8M A;  1GAQ B;  3ZGZ A;  2GBR A;  3AE3 B;  1YIW A;  3IT6 B;  1JRP A;  4KDL B;  4GDK B;  4E3C A;  2K8C A;  2RMM A;  3NZU A;  4QAY A;  2M19 A;  4KZC A;  2DYO A;  5IN7 A;  5BYS A;  3DBR I;  2B3A A;  1SE3 A;  5FR6 A;  3Q3F A;  4ARC A;  1D5Z C;  2VRR B;  3B9J A;  4NPN A;  3TUO A;  3KWL A;  3C8Y A;  4LNO A;  4MM3 B;  3PHX B;  4N58 A;  2JZ3 B;  4XDC A;  1XLP A;  3KUD B;  4YSY B;  4JE3 B;  2KTR A;  1IGC A;  1UH6 A;  2KJH B;  1QF6 A;  1HQR D;  3KUC B;  4A8X C;  2REX A;  2KAC A;  1TKY A;  3PHW B;  2JXT A;  3CMM B;  5AZG A;  2W82 A;  5HFY A;  5BYR A;  3RNB C;  2JYT A;  2WXI A;  1BML C;  1RRB A;  2TSS A;  2FCQ A;  2ZVN A;  4FJY A;  4TSS A;  4WIP A;  3UIP B;  1RLF A;  2KLC A;  3BWU D;  4ANW A;  2NBU A;  3R2I A;  4HDO A;  2N9K A;  1QKZ A;  1XLQ A;  4IWO A;  1WRD B;  3I9V 1;  1WGH A;  3UIN B;  2PVG C;  4NQK E;  4RCO A;  4RGT A;  2J7Q B;  1J7B A;  4HPM B;  4A90 A;  1J0G A;  3GZN I;  4MAC A;  1TIF A;  2QJL A;  4HWI B;  2MJ3 A;  3IHP C;  2L83 A;  4WJO A;  4GU2 A;  3ZLZ A;  3KYC D;  4MGI E;  4W9J A;  1RM6 C;  2W3R A;  4DDG D;  4BZA A;  1FO4 A;  1SE2 A;  3EC8 A;  3N32 A;  3ONS A;  1DYQ A;  1TGZ B;  3AE6 B;  3W1S A;  1WX7 A;  2RGF A;  1VRA B;  3V3X A;  3P1M A;  5L95 C;  4K7W A;  1JML A;  2EKE C;  2V3P A;  1TS4 A;  2L7R A;  3AI5 A;  3NZS A;  5G5G A;  4W9I A;  1E6E B;  3RPF C;  3SFD B;  3BIN A;  2ICI A;  2KO3 A;  3ZNG C;  4IM3 A;  1LQB A;  2M8S A;  2IZV B;  4XZ4 A;  5J18 A;  1V80 A;  4LDT D;  1AWD A;  2L52 A;  2KDI A;  2W54 A;  4XE0 A;  2MX2 A;  5C1Z A;  2KYW A;  2JPH A;  2KVZ A;  3PPA A;  3IG3 A;  4WH4 A;  5C2T B;  1NEK B;  3GE8 C;  1KJT A;  3QAQ A;  4GB9 A;  2O6V A;  4A6Q A;  1J8C A;  3VFK A;  2LGD A;  2PKO A;  3DVG Y;  1GUA B;  1UNS A;  2FCS A;  2PW9 A;  2VH2 A;  4DHJ D;  4EZJ A;  1C4A A;  3MFG A;  1E90 A;  1V86 A;  4DBG A;  2WWZ A;  4UDU C;  4AQ7 A;  1WYG A;  3L10 B;  1VCB A;  2V9H A;  4BKS D;  1UF0 A;  3NJT A;  1K8R B;  2MBQ A;  1DOI A;  5I4D A;  3DQV A;  2OJW A;  2EMT A;  4HEA 1;  2J0K A;  4TMA B;  2FUH B;  1GOZ A;  4FUL A;  3AE7 B;  3BK2 A;  1FNW A;  1YQ4 B;  3V60 A;  1D5X C;  3Q3N C;  4ARI A;  3Q8C A;  3CF6 E;  2ONQ A;  2LHD A;  2NTS A;  1P98 A;  2R61 A;  2MJD A;  1FCC C;  3AE2 B;  4RF1 A;  1ZDV A;  1YMH E;  4IM0 A;  4OVV A;  1ZXH A;  2PLP A;  2M0X A;  4A55 A;  1WXS A;  3VH3 B;  3RFZ B;  3H8H A;  3TMP B; 
#chains in the Genus database with same CATH homology
 1MG4 A;  5IOI A;  2BQQ A;  1MJD A;  2DNF A;  5IN7 A;  1UF0 A;  5IO9 A;  5IP4 D;  5IKC M;  1MFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...