5IO9A

X-ray structure of the n-terminal domain of human doublecortin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
98
structure length
98
Chain Sequence
MAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFDDVEYTKNVNPNWSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Neuronal migration protein doublecortin
publication title Crystal Structures of the Human Doublecortin C- and N-terminal Domains in Complex with Specific Antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 5io9A00
5IO9A 5IOIA 1MJDA 1MFWA 5IP4D 5IKCM 1MG4A 1UF0A 2BQQA 5IN7A 2DNFA
chains in the Genus database with same CATH superfamily
1WWTA 4FLHA 3VDZA 3Q3MC 1CMXB 2N0SB 2WXKA 1EU4A 5J2RA 1V81A 2ZCBA 1WXAA 2MH7A 3ML9A 2DZMA 4FN2A 2J7QB 1N62A 2LD9A 4M0WB 1NYQA 4E74A 1J7CA 1ZKHA 2NVUI 1V9JA 3IAS1 3JSVA 2PEAA 1QZEA 3WAOA 2Z8LA 3ZUNA 2GBMA 1WE7A 3NZ3A 3L0WB 1JWMD 1SGHA 2G4DB 4HWIB 5AZHA 5JH5C 1XXGA 1ZDVA 2MP2A 3A1QA 3NZSA 4I6PA 3BYTB 2NR2A 2CKHB 1I4RA 3ZJTA 2V3NA 3T3OA 2IY1B 3P4SB 2GBKA 3QA8A 2K39A 1YD8U 3UI3A 2D3BA 2YEPB 2ON8A 3AI5A 1YQ3B 5E6PA 3X23A 2BVCA 1WGKA 2KTRB 3P2BA 1YQ4B 3A9JB 4RM9A 3PT2B 1EM7A 1YIWA 2QIEB 2XNAC 5IOIA 1QOBA 1TJEA 3UIOB 1PQSA 4RGTA 2VZKB 4GMVA 4LDTD 4GDKB 4MGYE 2ZVOA 5C23A 4ANXA 1XLNA 1SF0A 2BW2A 3QARA 3SFEB 3EA6A 1ROEA 2KWVB 3HVDA 4GSWA 2IGHA 2M4NA 3H8HA 2NCNA 5EDSA 4IWQA 5I4DA 2WXOA 4IM2A 4IW0A 3JYUA 1KF6B 3A4RA 3FILB 3L08A 1C4CA 5CHVC 4REZA 5JHBA 1PDXA 3WCQA 1IUEA 4NJ6A 5L83A 1H4RA 1UELA 3BZDB 2GLSA 2N1WA 1PUTA 5DPSA 1TS2A 1FFUA 4LNNA 4AQ7A 2JZ3B 3ZNHB 2KDFB 5BYSA 1WXSA 2KN4A 3V62A 4BKSA 3NY5A 3AB5A 1C4PA 2K22A 2N1VA 4AJWA 4HCPB 1E7VA 1J7BA 4OVZA 5LXHA 1I4QA 4WWOA 1N6ZA 2A5UA 3NS1A 2MLBA 3PZ7A 1N61A 2VRRB 2LHEA 1WMHA 4C00A 2DZJA 3GP7A 2JYTA 2KN5A 4B95A 2V4LA 3DVGY 4LLGM 3DBLI 1WYGA 1WF9A 1BMLC 2ZPYA 1YN4A 3GZNB 1WE6A 3Q2AC 4ZRKA 1M94A 5MPOA 4YSXB 2GB1A 4IWPA 3KW5B 1V1OA 2HD5B 2JWUA 5D3IB 3VRBB 1UBIA 1OQQA 2BTEA 3Q8FA 2WS3B 3QJZA 1KJTA 3SEBA 2JY6A 2KXJA 2K25A 5HKHA 2CU3A 1PFDA 2CHZA 4JX1C 2QJLA 3BY4B 3ZVVA 4WJNA 2FAZA 2UWQA 3EFCA 1FM0D 1P0RA 2RDBC 2LMCA 3AXCA 1JQ4A 3MJWA 4ZOHC 1VR9A 2SEBD 3I5JC 2DHZA 2JVCA 2B3AA 2LI5A 1MJDA 3RT3B 5L95C 5AUKA 2O6VA 1FMAD 3EUB2 4ASWC 4YXDB 1X1MA 2L00B 3MHZA 2IDYA 4KDLB 4IKGA 3ZXRA 1P1AA 2GMIC 2BWES 1V1PA 4BKGA 1F1HA 2Q5WD 2L7RA 1QQRA 5H92C 3ZRCA 4RMAA 2ACZB 1QOGA 1Q10A 3FC4A 2O6VD 3DBRB 3GZNI 2MSED 3IHPC 3DCGA 2QCZA 1WJNA 2PJHA 3HK0A 4PYUA 2BKRB 1E8YA 2LGSA 2AL3A 2DX5B 2G45B 3ABVB 1WRIA 4AWJA 3QK0A 3Q14C 1SJED 3GE3C 3W9CB 4ZHPA 4HROA 2HTME 2PTLA 4PK1A 4HLEA 2O2VB 1YN5A 4IC7B 2R2QA 1YMHE 3DHIC 3UQAA 4M0WA 3RFZB 1L0VB 3DQVA 1WSPA 3L17A 2WHIA 2MBHA 3QCAA 2IJ0A 1R4MI 2UYZB 5HHDG 3BK2A 3Q8BA 1UNSA 3CSFA 1RWSA 1IYFA 4NJCA 1I35A 3VAWA 4ZRPA 3MP9A 3PREA 1XD3B 2DYBA 2XK5B 3Q3JA 5G5GA 4C4VB 1KLUD 2ZCCA 4ANUA 1E10A 2BKFA 2V1YA 4FULA 2KTRA 1EF5A 4XDCA 1ZUD2 4K1RB 3HVZA 4DHZE 4GDKA 3HM6X 2NBVB 2C7HA 2N9KA 4HJKA 3X0WA 1N63A 1FPYA 1U4AA 4NZLB 3UINB 1V6EA 4LJPB 2ZPNA 2J0KA 4HKZE 3OG5A 4OVVA 2KMMA 1ZGUB 3ZNZB 1VRAB 3RNFC 1SSNA 1QKZA 1YJIA 1WM3A 2PPHA 3ECIA 3RNBC 2V9HA 3MTNB 2MJDA 4W9KA 3Q3FA 3PO0A 5KHOA 1TZOA 5J18A 3VRAB 1UF0A 2MBOA 1S1QB 1FIQA 4A8XC 2QHOA 4L23A 3VUXA 4E71A 3IVFA 3RZFA 4FXCA 1FNWA 3DHHC 4CYEA 4W9LA 1HTQA 3VH3B 1T6BX 4II2B 2AWTA 3EGRA 3N1XC 4M02A 1XCTL 4ITKA 1QOAA 2JF5A 2BT6A 2XN9C 3EHVA 1SEBD 2LRUA 3UGBB 4J6IA 2AQ2B 3WANA 4XWWA 3BWUD 1V49A 2WWZA 3R8BA 1RYJA 4XX5A 3B1LX 1N5WA 2M8SA 4DDID 1KH0A 4BBNC 1M4VA 1I4XA 1Q0WB 3PRZA 2WNMA 3VTWA 1TY2A 1K52A 2XEWA 3AE4B 1ZXHA 2KQ4X 4ZDVA 4KGSA 4A20A 1WR1A 1OFFA 1UWMA 4YTPB 2BYEA 3BYYB 3AN1A 1VDVA 4MGZE 4W9DA 4C56C 2KX3A 4GXBA 1P7EA 3ZRFA 4WWNA 2JUOA 2XBBC 2NPTB 4RGMA 2WXMA 1F2RI 2MCNB 3AE1B 2J53A 5IKCM 1RRBA 4GOCA 3TEXA 4IM3A 1WXQA 1MFWA 2KT7A 2Y5CA 3U52E 4GGQA 3TSSA 2KMAA 1JW9D 3AEEB 3NVVA 1MG4A 3K9PB 4IG7B 2ZEQA 3U7DA 1ESFA 3NG0A 4GB9A 4KZ0A 3ZNGC 4KSLC 2KACA 3ZXVA 3M95A 3I3TB 1E7PB 1E5WA 2L0TA 4ZYSA 2DZKA 2G3QB 4HDQA 1E90A 3UF8A 5EE0A 3DVNU 2HDEA 4K7UA 2QILA 2EELA 2K3UA 4P7IA 1E6EB 1BXTA 2V4IB 2ZVNA 4KKIA 4L2YA 3NJTA 3C19A 3JW0X 2Z0EB 5AZGA 4LNOA 2JT4B 3R66C 1WYWB 4I6NB 1KOTA 3TIXA 2LGIA 4WAAA 2RR9A 1TYGB 5BMIA 2IGDA 2LWPA 1I42A 4A6QA 5DPRA 1VD2A 1XEEA 4P6VF 1G6JA 3VHTC 3ETRA 4FJYA 1UBQA 4G0NB 1Y56A 3NRZA 4JGHB 1JRPA 4WWMA 4NQKE 2N9LA 4TUUA 4NNJB 3AE9B 1BT0A 2GBRA 2BS3B 4XC2A 4B0MA 3P1MA 2PVOD 2B76B 3H6NA 3ZTDA 1MHHE 4ACFA 2KJ6A 5IN7A 1AWDA 4L1BA 1JWSD 3FAHA 1OEYA 1C4AA 4OVUA 1WR6E 2V3PA 3BIID 1FFVA 1EUVB 1ENFA 5BO4B 1T3QA 3NZUA 1WZ0A 4C4VA 1WM2A 5C1ZA 1WGYA 3VUWA 3ALBA 2WLBA 3PRPB 4BOZB 2J52A 2R2OA 3H7PB 4E3CA 3MJ5A 1KFYB 3DBLB 2GI9A 1Z5SB 3A33B 4TV3A 3DWGC 2WXFA 1DOXA 1LFDA 2KWDA 4G11A 3TL5A 2W3SA 3WAPA 1SXTA 3PRMB 1MHXA 2IO2B 2E3TA 3ZTCA 1T0RC 3P4QB 2IYDB 1AN8A 4D2KA 5FK9C 2W82A 5EE1A 2DYOA 1XCQL 4LNKA 1K51A 1JMLA 3LYYA 4MGKE 4ZRJA 2INNE 1GB4A 1XT9B 2BS4B 1FCLA 3W1SC 4YTMB 4NY0A 4KIKB 2BYVE 2L8JA 1WFYA 2KWUB 3RYTA 2JSVX 2DAJA 1V5TA 3PPAA 1EWYC 3J9CA 2JRIB 1WGRA 1FXTB 2M56B 4AOFA 1EO6A 1P9DU 1RLFA 2PLPA 4EZJA 2BYFA 4P16A 2VH2A 2J42A 3ZIMA 4WQOB 4JWUC 3IBEA 3GS2A 1L4DB 3W5VB 2LGXA 3DHGC 1JWAD 3L10B 1T5XD 2IGGA 3VQIA 4AJYB 1WGDA 4NQLB 3KUDB 2N7JA 3CIRB 4OHJA 1J7AA 2GOWA 3LJ3A 2M0XA 2LJIA 3TMPB 1B9RA 3HHMA 3QHTA 3TJPA 3ONSA 2RMMA 4HXDA 3BVGA 4ICVA 4IOIE 1GNUA 2PKOA 5D7GA 3VFKA 3WIMA 3IT4B 1QLBB 1HQRD 3AULA 2DNFA 4NAWB 4BKSD 4H2AA 2OEDA 1UZXB 4ANVA 3RUIB 2NS5A 4ICUA 1NDDA 2C5LC 4YSZB 1OQYA 3PGEA 4MM3B 4M8MA 1L2NA 4DWFA 3R2IA 4MELA 4JWSC 3N1YC 2DWQA 1L6UA 3AM9A 2K8HA 2FE8A 2ZZPB 4JE3B 2NBWB 3RNGC 2KFJA 2NPTA 1GG3A 2LGYA 4BZAA 1C76A 2KVRA 3AU5A 1XO3A 1V80A 2EKIA 3ZGZA 2J0JA 1WGGA 1UGMA 1NENB 3VUYA 1FO4A 2KMCA 3TEYA 2GBNA 4DHJB 4MT5A 2JU6X 4OZCA 1EWCA 1R4MB 2LJ5A 2KOXA 1B1ZA 4G50A 4P1CC 2DBYA 2IO3B 3W1SA 2LXAA 3TBLD 4ANWA 4P1BC 2KQSA 2FIFA 1ZDXA 1I4HA 3N1ZC 2Y5BB 4EE2A 4JQWC 4CQNA 1C78A 2DYMA 3NHEB 2ZNVB 5D2MB 2C7NB 2L76A 3DPDA 4W9FA 2WDRB 3QAQA 2FUG1 4HDOA 4EOYA 2LUMA 2DZIA 1C79A 1D5ZC 1KM7A 2MQJA 1TKGA 5G55A 2AQ1B 2PIAA 2WGSA 1QF6A 4JPSA 3AEAB 1CZPA 4NJ7A 1H8CA 2IPKD 4BFRA 4RH6A 2KNBA 4JIOU 2EMTA 2MW5A 2RSUA 2I2YA 4AS1A 1V2YA 2W54A 1FNUA 3NVYA 5JHAA 3PLVA 1ZP0B 3GB1A 1XQQA 2M0AA 3WA0A 5DPWA 1LXDA 5GXGB 2KHWB 4XWTA 3IFWB 3RPFC 1L0XB 2RGFA 2Z0DB 2G4SA 2V0GA 3M63B 3QX1A 3TCAA 3PS6A 3AE6B 2RPQA 4IM0A 1QT9A 2DAFA 4II3B 1E8XA 4WH4A 4A3PA 3HUIA 3A9KB 2MBQA 1AW7A 2KDBA 3JVZX 3SD5A 2JQRB 4G3XB 1Q5WB 2LVPA 4MH0E 4KKJA 1YX5B 2IZVB 3V61A 4HPPA 3H7PA 4ZYNA 1D3ZA 4EFOA 3ZLZA 4N59A 3ML8A 2KVZA 3ENEA 3R3MA 4YT0B 1K50A 1R4NB 2LFIA 4XGAB 5C3JB 3TEWA 2KJRA 2WDTB 3CMMB 4HPMB 1GAQB 1V5OA 4MDKE 4YSYB 2BQQA 2H88B 3A9JA 3EC8A 4FHJA 4FBJB 4KX6B 2JXXA 1T0QC 5FR6A 4NPNA 4FA6A 1HZ5A 3MC8A 1TY0A 1LQBA 4MEMA 3U4EG 3CF6E 2PE9A 4RF0A 4JLCA 3OWEB 1WY8A 1YQBA 2BF8B 3UQBA 4LDTB 4A55A 2FCQA 3APFA 3A1QB 1QILA 5KHQA 2CJOA 3VXWA 3PSEB 4XDDA 2L1AA 3BVMA 3FILA 1DOYA 2AL6A 3MC9A 3NS8A 1L7YA 2WX0A 2VZKD 3QWZB 2WU5B 3H7SA 1GUAB 2HTHA 2QMTA 1WX8A 5C2TB 2ZW0A 1TGZB 5DCNA 1I4PA 3MFGA 4C7ZA 2AEHA 2L52A 4TQ1A 4EUTA 2BB6A 3P63A 4MJSB 5J17A 1D5MC 4RFBA 3SR6A 4C80A 3V3XA 1VZ6A 5JZEB 4IUMB 1SE9A 1MI0A 2HJ1A 1I4GA 1HTOA 2K6DB 1C3TA 3AEBB 1Y8RC 3VH4B 3U8ZA 1WX7A 4XZ4A 1R4NI 2N9PC 2ZW1A 3MHSD 1WXMA 2GRIA 3AU4A 1SIJA 4QAYA 1J8CA 1FD6A 4XE0A 1GB1A 1R7SA 2Y5PA 3HM3A 3WALA 4A90A 1UD7A 4LCDE 2LUEA 4GN1A 3B2GA 1ET9A 1WGHA 2D5GA 4WJPA 3L54A 3VR8B 4IWOA 2L83A 2KDMA 5TR5A 4HK2A 1HA5A 1WMHB 2KYWA 4ARCA 4GDLB 1V97A 1AARA 2IBIB 4N58A 3IG3A 2YVCA 1OGWA 4PS8A 2BYTA 4A3OA 2H89B 5HFYA 4MGIE 2YLMA 2WXIA 4EZKA 4Q2JA 3EFUA 1HEZE 3QIJA 3V05A 4TQ0A 3VVWB 4ARIA 3URYA 3I9V1 1YJ1A 1WH3A 2QC8A 3U7ZA 5D94A 4BOSC 4HEA1 1K8RB 3Q69A 2FIDA 3P4RB 3PZ8A 1I7HA 1ZOYB 3LB8C 2JXTA 1VLBA 3MC0B 2JRHA 2NBUA 3PHXB 5IP4D 4ZHOA 1RM6C 3PTFC 1F52A 1E8ZA 1TS3A 1WJ4A 3EECA 1F2RC 3NVWA 3S2AA 2WXNA 2WP9B 3DVNV 1NBFC 1SBBB 3R7RA 1TZ1A 1N5XA 1F0ZA 2N9EB 2PMVA 3AE7B 2MBBB 3AE8B 4RNAA 2O6VB 1OQRA 2KANA 4FHKA 4C7YA 3PV1A 3AV8A 1WRDB 2C7MB 2D3CA 1Z2MA 2FUHB 2O2VA 3H9DA 2KZRA 1YNTE 3V6EB 3A4SC 2C60A 1DGJA 3A9KA 2RPVA 2BPSA 1C1YB 3SU8X 2N4FA 4JL9A 4KZCA 1KLVA 1V1PB 1YOVB 2N7DA 4CO7A 5GMVA 4W9EA 2I1KA 1TS5A 3VTUA 1TBEA 2KFKB 2KD0A 3QQ8B 1RAXA 4LJOB 5AZFA 2MX2A 2AYOB 1PGXA 3SHQA 1N60A 2PE6B 2FBWB 3DBSA 1F9JA 2XK5A 4PYZA 4DXFA 2D3GA 3N32A 3W1YA 4USAA 3VR9B 4ZRQA 3RMKC 1IBXB 3APCA 3DVGX 1ZXIA 2ONQA 4WQMA 3E56A 4DDGD 2W9NA 5EE3A 2KWCA 1UWXA 2KO3A 5TSSA 4WURA 5BYQA 2OHFA 3L4PA 5IAAC 1GPXA 3HRDD 2KDIA 4FJZA 4RGNA 1WZ3A 1C77A 1EF1A 3R7QA 2OJWA 3RNCC 2LVOA 2HJ8A 3ZDTA 4TMAB 1VZ7A 2CS4A 2EKEC 5CHWA 3ZDMC 3CSTA 2BB5A 4WJOA 1XF5L 1K53A 3APDA 1FRRA 4YTNB 3KQ4A 1S3SG 2R61A 3V60A 2ICIA 2WQYB 1NVID 2D10A 4RM8A 2N9XA 3KWVA 1LGRA 2LHDA 3RCZA 2C9WB 1KTKA 3ZKJC 1KLGD 4YL8A 1E8WA 4K7SA 4FJVB 3I57A 1YX6B 3U30A 4OZAA 2L0FA 4MJSA 2N7EA 3Q3NC 2AQ3B 1LO5D 3NVZA 4MH8A 2RDGA 1PGAA 2K8CA 2L3ZA 1GJZA 1Q1OA 2DLBA 1E0ZA 5IA7A 1A5RA 1TTNA 2L05A 5LNK1 1PYWD 3BVZA 1WJUA 1SE4A 2D07B 2G9HD 4CHKA 3DBHB 2D3AA 3IAM1 1XLPA 4LTUA 1TS4A 2LRWA 1FCCC 1L0YB 2Y3AA 5E6OA 1L5PA 2WXHA 2BWFA 1HXYD 3RZWC 3ZJVA 3PLUA 3AEDB 4WJQA 1FEHA 4HKQA 4F1SA 1VCBA 2LASA 2KTFA 1HZ6A 5CX3A 2DENB 2LEKA 1JCKB 4WIPA 5H8YE 4B0EA 3LXFA 3C0RB 2BS2B 3ZJUA 1ET6A 4FADA 3AE2B 1MVKA 4K7WA 4GDLA 1J0GA 2YEPF 3AMZA 1D6EC 5JXVA 2WXGA 3KH0A 3V6CB 4UDUC 2QDFA 1GC7A 1E7UA 3SFDB 4KDIC 2INDC 2FCSA 4KSKC 1SJHD 2UU7A 2IO1B 3N3KB 2BBCA 4K3BA 3WAMA 2KX0A 3O13A 4S17A 3P42A 3RULA 1ZE3D 1YJJA 2KJHB 5G5HA 3GOEA 1LM8B 2KKCA 2K0PA 3KYDD 4ZRIA 4KGRA 5IO9A 3W5UB 2INPE 3T9LA 1SB3C 2HE7A 3AE5B 2KQ7A 1FRDA 4PS7A 4W9IA 3RN9C 3QC8B 3DBHI 4M8NA 1IP9A 3OAWA 2MJ3A 5BMHA 4M00A 3D32A 1UUPA 1VJKA 3Q6BA 4US9A 1ZW7A 4R3DA 3KVFB 3PHWB 1EU3A 3CWIA 2CR5A 3RD2A 3AECB 2INCC 4RCOA 5DPTA 2OOBB 4US8A 3IXSA 3U2SC 4DQOC 2JX5A 3IT6B 4HRSA 1MG8A 2KDEB 3FKYA 4HPLB 1XLOA 1D4BA 1WI0A 2WU2B 2MRPA 3N9YC 1V8CA 4BKTA 2KFKA 3L16A 1TT5B 4F7ZA 4KVGB 2KK8A 3AE3B 1E9MA 1IGDA 1JALA 4A9AA 1JRUA 3I63C 5LLIA 4B6WA 1JROA 2D11A 2K1FA 1CJEA 2V3SA 4EEWA 4N6EB 3B9JA 1V86A 4PS3A 3KYCD 1CQVA 5HG2A 1P3QU 1IBXA 2JYEA 2ASQA 3T3NA 2G1EA 2WDVB 1J19A 1JWBD 5AEKB 2LZ6A 4I6LB 3RNEC 1TKEA 1WIAA 3N30A 3BK1A 1TKYA 4LNFA 4M01A 2NTTA 5BYRA 3ZNID 2X38A 2W3RA 4DXGA 3ZW3A 4X57B 2E6XA 3AEFB 2KLGA 2MWSB 3Q3OC 2I38A 2LVQA 4DHZB 3JSVB 5FKAC 4N9F4 4W9HA 4K81A 1L4ZB 1P98A 3ZYYX 2D2QA 1NYRA 3RNAC 2KLCA 1C9FA 5AUIA 2MJEA 3PVLA 4WWPA 2NTSA 4S0RA 2MBEA 2CJNA 4EKUA 1IGCA 4HVBA 3BINA 2MP2B 4KIKA 4O1NA 4W9JA 3H1UA 4MSMB 1TIFA 2KC1A 1DOIA 2J0MA 3T8MA 2VH1A 4WAFA 1XLQA 1HE8A 3AEGB 1T0YA 2JWZA 2ZNVC 2IY0B 2BGFA 2LXCA 2JPHA 2MEKA 5T8IA 1ISNA 3OLMD 4IDIA 1WX9A 3DBRI 3KUZA 5E6NA 2CHXA 3DWMA 1UGJA 4HCNB 3Q8AA 1IPGA 5D6JB 4BBNF 4HJGE 2FCMA 2X8XX 5G2NA 2IO0B 3KWLA 4KGTA 2WXRA 2K8BA 3M3JA 1D5XC 4W9CA 2L32A 5EE9A 1GOZA 1WXVA 4URKA 2M19A 2WX1A 5D3DA 3R2TA 4BAXA 5CHFA 2QSDA 4J3OD 2MHJA 4MACA 3AH7A 2M17A 3B0AA 1OEYJ 1NI2A 4NAWA 1MPEA 2CU1A 3E9SA 4MM3A 1T0SC 3KUCB 1RFAA 3DOWA 3Q8EA 4DXAB 4B9KA 2AX5A 3M62B 2PVGC 2SAKA 3W2DA 1KRHA 3KLSX 1F77A 2Z59B 3LDZE 1ACCA 2ZJDA 4AP4C 2M1MA 1FXAA 4GIVA 3C8YA 2JZZA 3DDCB 1FXIA 2QEJC 1QOFA 2GBJA 3PZDA 1ZPSA 3RI7C 2I1JA 5LXIB 4GLSC 3HIZA 2W55A 2KAJA 4W9GA 4TSSA 1PGBA 1SIFA 2TSSA 2K9XA 3TUOA 3K9OB 2REXA 4F8CB 4DK5A 3B08A 3VTVA 3OJ3A 4XYCA 2JZPA 1WJ6A 2EMSA 4DHJD 5E6JA 4EZLA 1AYFA 1NEKB 2LGDA 4LNIA 4YWGG 3NOBA 4OW0A 4OZBA 1YN3A 2NMQA 2OJRA 4DBGA 1SE2A 4RGOS 1JWUD 2CHWA 3OJ4B 1A70A 3P4PB 1RFKA 2WYQA 4BVUC 1OTRB 5CTRC 4KV2A 2WDQB 2MA9B 4LK0M 1GC6A 1NI3A 4TKNA 1P7FA 2J4XA 2KC2A 3Q8CA 3N20C 1SE3A 1FNVA 4GU2A 2K6QA 2RDHA 3SDLC 2A4ZA 3B2FA 3TEZA 2K5PA 2FNJB 1BUIC 2RD0A 2WXJA 2PW9A 3ZQ4A 3ZO5B 5HI1A 3O65B 1CK1A 1L6VA 2WXPA 4MSQB 4NAMA 2FCNA 3L13A 3NUHB 3UIPB 5FR3A 4K3CA 5BMGA 4RF1A 4PT5A 1DYQA 4AUQC 3GE8C 1STEA 1VZ8A 1UH6A 2WXQA 2WXLA
chains in the Genus database with same CATH topology
5IO9A 5IOIA 1MJDA 1MFWA 5IP4D 5IKCM 1MG4A 1UF0A 2BQQA 5IN7A 2DNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IO9 A;  5IOI A;  1MJD A;  1MFW A;  5IP4 D;  5IKC M;  1MG4 A;  1UF0 A;  2BQQ A;  5IN7 A;  2DNF A; 
#chains in the Genus database with same CATH topology
 1WWT A;  4FLH A;  3VDZ A;  3Q3M C;  1CMX B;  2N0S B;  2WXK A;  1EU4 A;  5J2R A;  1V81 A;  2ZCB A;  1WXA A;  2MH7 A;  3ML9 A;  2DZM A;  4FN2 A;  2J7Q B;  1N62 A;  2LD9 A;  4M0W B;  1NYQ A;  4E74 A;  1J7C A;  1ZKH A;  2NVU I;  1V9J A;  3IAS 1;  3JSV A;  2PEA A;  1QZE A;  3WAO A;  2Z8L A;  3ZUN A;  2GBM A;  1WE7 A;  3NZ3 A;  3L0W B;  1JWM D;  1SGH A;  2G4D B;  4HWI B;  5AZH A;  5JH5 C;  1XXG A;  1ZDV A;  2MP2 A;  3A1Q A;  3NZS A;  4I6P A;  3BYT B;  2NR2 A;  2CKH B;  1I4R A;  3ZJT A;  2V3N A;  3T3O A;  2IY1 B;  3P4S B;  2GBK A;  3QA8 A;  2K39 A;  1YD8 U;  3UI3 A;  2D3B A;  2YEP B;  2ON8 A;  3AI5 A;  1YQ3 B;  5E6P A;  3X23 A;  2BVC A;  1WGK A;  2KTR B;  3P2B A;  1YQ4 B;  3A9J B;  4RM9 A;  3PT2 B;  1EM7 A;  1YIW A;  2QIE B;  2XNA C;  5IOI A;  1QOB A;  1TJE A;  3UIO B;  1PQS A;  4RGT A;  2VZK B;  4GMV A;  4LDT D;  4GDK B;  4MGY E;  2ZVO A;  5C23 A;  4ANX A;  1XLN A;  1SF0 A;  2BW2 A;  3QAR A;  3SFE B;  3EA6 A;  1ROE A;  2KWV B;  3HVD A;  4GSW A;  2IGH A;  2M4N A;  3H8H A;  2NCN A;  5EDS A;  4IWQ A;  5I4D A;  2WXO A;  4IM2 A;  4IW0 A;  3JYU A;  1KF6 B;  3A4R A;  3FIL B;  3L08 A;  1C4C A;  5CHV C;  4REZ A;  5JHB A;  1PDX A;  3WCQ A;  1IUE A;  4NJ6 A;  5L83 A;  1H4R A;  1UEL A;  3BZD B;  2GLS A;  2N1W A;  1PUT A;  5DPS A;  1TS2 A;  1FFU A;  4LNN A;  4AQ7 A;  2JZ3 B;  3ZNH B;  2KDF B;  5BYS A;  1WXS A;  2KN4 A;  3V62 A;  4BKS A;  3NY5 A;  3AB5 A;  1C4P A;  2K22 A;  2N1V A;  4AJW A;  4HCP B;  1E7V A;  1J7B A;  4OVZ A;  5LXH A;  1I4Q A;  4WWO A;  1N6Z A;  2A5U A;  3NS1 A;  2MLB A;  3PZ7 A;  1N61 A;  2VRR B;  2LHE A;  1WMH A;  4C00 A;  2DZJ A;  3GP7 A;  2JYT A;  2KN5 A;  4B95 A;  2V4L A;  3DVG Y;  4LLG M;  3DBL I;  1WYG A;  1WF9 A;  1BML C;  2ZPY A;  1YN4 A;  3GZN B;  1WE6 A;  3Q2A C;  4ZRK A;  1M94 A;  5MPO A;  4YSX B;  2GB1 A;  4IWP A;  3KW5 B;  1V1O A;  2HD5 B;  2JWU A;  5D3I B;  3VRB B;  1UBI A;  1OQQ A;  2BTE A;  3Q8F A;  2WS3 B;  3QJZ A;  1KJT A;  3SEB A;  2JY6 A;  2KXJ A;  2K25 A;  5HKH A;  2CU3 A;  1PFD A;  2CHZ A;  4JX1 C;  2QJL A;  3BY4 B;  3ZVV A;  4WJN A;  2FAZ A;  2UWQ A;  3EFC A;  1FM0 D;  1P0R A;  2RDB C;  2LMC A;  3AXC A;  1JQ4 A;  3MJW A;  4ZOH C;  1VR9 A;  2SEB D;  3I5J C;  2DHZ A;  2JVC A;  2B3A A;  2LI5 A;  1MJD A;  3RT3 B;  5L95 C;  5AUK A;  2O6V A;  1FMA D;  3EUB 2;  4ASW C;  4YXD B;  1X1M A;  2L00 B;  3MHZ A;  2IDY A;  4KDL B;  4IKG A;  3ZXR A;  1P1A A;  2GMI C;  2BWE S;  1V1P A;  4BKG A;  1F1H A;  2Q5W D;  2L7R A;  1QQR A;  5H92 C;  3ZRC A;  4RMA A;  2ACZ B;  1QOG A;  1Q10 A;  3FC4 A;  2O6V D;  3DBR B;  3GZN I;  2MSE D;  3IHP C;  3DCG A;  2QCZ A;  1WJN A;  2PJH A;  3HK0 A;  4PYU A;  2BKR B;  1E8Y A;  2LGS A;  2AL3 A;  2DX5 B;  2G45 B;  3ABV B;  1WRI A;  4AWJ A;  3QK0 A;  3Q14 C;  1SJE D;  3GE3 C;  3W9C B;  4ZHP A;  4HRO A;  2HTM E;  2PTL A;  4PK1 A;  4HLE A;  2O2V B;  1YN5 A;  4IC7 B;  2R2Q A;  1YMH E;  3DHI C;  3UQA A;  4M0W A;  3RFZ B;  1L0V B;  3DQV A;  1WSP A;  3L17 A;  2WHI A;  2MBH A;  3QCA A;  2IJ0 A;  1R4M I;  2UYZ B;  5HHD G;  3BK2 A;  3Q8B A;  1UNS A;  3CSF A;  1RWS A;  1IYF A;  4NJC A;  1I35 A;  3VAW A;  4ZRP A;  3MP9 A;  3PRE A;  1XD3 B;  2DYB A;  2XK5 B;  3Q3J A;  5G5G A;  4C4V B;  1KLU D;  2ZCC A;  4ANU A;  1E10 A;  2BKF A;  2V1Y A;  4FUL A;  2KTR A;  1EF5 A;  4XDC A;  1ZUD 2;  4K1R B;  3HVZ A;  4DHZ E;  4GDK A;  3HM6 X;  2NBV B;  2C7H A;  2N9K A;  4HJK A;  3X0W A;  1N63 A;  1FPY A;  1U4A A;  4NZL B;  3UIN B;  1V6E A;  4LJP B;  2ZPN A;  2J0K A;  4HKZ E;  3OG5 A;  4OVV A;  2KMM A;  1ZGU B;  3ZNZ B;  1VRA B;  3RNF C;  1SSN A;  1QKZ A;  1YJI A;  1WM3 A;  2PPH A;  3ECI A;  3RNB C;  2V9H A;  3MTN B;  2MJD A;  4W9K A;  3Q3F A;  3PO0 A;  5KHO A;  1TZO A;  5J18 A;  3VRA B;  1UF0 A;  2MBO A;  1S1Q B;  1FIQ A;  4A8X C;  2QHO A;  4L23 A;  3VUX A;  4E71 A;  3IVF A;  3RZF A;  4FXC A;  1FNW A;  3DHH C;  4CYE A;  4W9L A;  1HTQ A;  3VH3 B;  1T6B X;  4II2 B;  2AWT A;  3EGR A;  3N1X C;  4M02 A;  1XCT L;  4ITK A;  1QOA A;  2JF5 A;  2BT6 A;  2XN9 C;  3EHV A;  1SEB D;  2LRU A;  3UGB B;  4J6I A;  2AQ2 B;  3WAN A;  4XWW A;  3BWU D;  1V49 A;  2WWZ A;  3R8B A;  1RYJ A;  4XX5 A;  3B1L X;  1N5W A;  2M8S A;  4DDI D;  1KH0 A;  4BBN C;  1M4V A;  1I4X A;  1Q0W B;  3PRZ A;  2WNM A;  3VTW A;  1TY2 A;  1K52 A;  2XEW A;  3AE4 B;  1ZXH A;  2KQ4 X;  4ZDV A;  4KGS A;  4A20 A;  1WR1 A;  1OFF A;  1UWM A;  4YTP B;  2BYE A;  3BYY B;  3AN1 A;  1VDV A;  4MGZ E;  4W9D A;  4C56 C;  2KX3 A;  4GXB A;  1P7E A;  3ZRF A;  4WWN A;  2JUO A;  2XBB C;  2NPT B;  4RGM A;  2WXM A;  1F2R I;  2MCN B;  3AE1 B;  2J53 A;  5IKC M;  1RRB A;  4GOC A;  3TEX A;  4IM3 A;  1WXQ A;  1MFW A;  2KT7 A;  2Y5C A;  3U52 E;  4GGQ A;  3TSS A;  2KMA A;  1JW9 D;  3AEE B;  3NVV A;  1MG4 A;  3K9P B;  4IG7 B;  2ZEQ A;  3U7D A;  1ESF A;  3NG0 A;  4GB9 A;  4KZ0 A;  3ZNG C;  4KSL C;  2KAC A;  3ZXV A;  3M95 A;  3I3T B;  1E7P B;  1E5W A;  2L0T A;  4ZYS A;  2DZK A;  2G3Q B;  4HDQ A;  1E90 A;  3UF8 A;  5EE0 A;  3DVN U;  2HDE A;  4K7U A;  2QIL A;  2EEL A;  2K3U A;  4P7I A;  1E6E B;  1BXT A;  2V4I B;  2ZVN A;  4KKI A;  4L2Y A;  3NJT A;  3C19 A;  3JW0 X;  2Z0E B;  5AZG A;  4LNO A;  2JT4 B;  3R66 C;  1WYW B;  4I6N B;  1KOT A;  3TIX A;  2LGI A;  4WAA A;  2RR9 A;  1TYG B;  5BMI A;  2IGD A;  2LWP A;  1I42 A;  4A6Q A;  5DPR A;  1VD2 A;  1XEE A;  4P6V F;  1G6J A;  3VHT C;  3ETR A;  4FJY A;  1UBQ A;  4G0N B;  1Y56 A;  3NRZ A;  4JGH B;  1JRP A;  4WWM A;  4NQK E;  2N9L A;  4TUU A;  4NNJ B;  3AE9 B;  1BT0 A;  2GBR A;  2BS3 B;  4XC2 A;  4B0M A;  3P1M A;  2PVO D;  2B76 B;  3H6N A;  3ZTD A;  1MHH E;  4ACF A;  2KJ6 A;  5IN7 A;  1AWD A;  4L1B A;  1JWS D;  3FAH A;  1OEY A;  1C4A A;  4OVU A;  1WR6 E;  2V3P A;  3BII D;  1FFV A;  1EUV B;  1ENF A;  5BO4 B;  1T3Q A;  3NZU A;  1WZ0 A;  4C4V A;  1WM2 A;  5C1Z A;  1WGY A;  3VUW A;  3ALB A;  2WLB A;  3PRP B;  4BOZ B;  2J52 A;  2R2O A;  3H7P B;  4E3C A;  3MJ5 A;  1KFY B;  3DBL B;  2GI9 A;  1Z5S B;  3A33 B;  4TV3 A;  3DWG C;  2WXF A;  1DOX A;  1LFD A;  2KWD A;  4G11 A;  3TL5 A;  2W3S A;  3WAP A;  1SXT A;  3PRM B;  1MHX A;  2IO2 B;  2E3T A;  3ZTC A;  1T0R C;  3P4Q B;  2IYD B;  1AN8 A;  4D2K A;  5FK9 C;  2W82 A;  5EE1 A;  2DYO A;  1XCQ L;  4LNK A;  1K51 A;  1JML A;  3LYY A;  4MGK E;  4ZRJ A;  2INN E;  1GB4 A;  1XT9 B;  2BS4 B;  1FCL A;  3W1S C;  4YTM B;  4NY0 A;  4KIK B;  2BYV E;  2L8J A;  1WFY A;  2KWU B;  3RYT A;  2JSV X;  2DAJ A;  1V5T A;  3PPA A;  1EWY C;  3J9C A;  2JRI B;  1WGR A;  1FXT B;  2M56 B;  4AOF A;  1EO6 A;  1P9D U;  1RLF A;  2PLP A;  4EZJ A;  2BYF A;  4P16 A;  2VH2 A;  2J42 A;  3ZIM A;  4WQO B;  4JWU C;  3IBE A;  3GS2 A;  1L4D B;  3W5V B;  2LGX A;  3DHG C;  1JWA D;  3L10 B;  1T5X D;  2IGG A;  3VQI A;  4AJY B;  1WGD A;  4NQL B;  3KUD B;  2N7J A;  3CIR B;  4OHJ A;  1J7A A;  2GOW A;  3LJ3 A;  2M0X A;  2LJI A;  3TMP B;  1B9R A;  3HHM A;  3QHT A;  3TJP A;  3ONS A;  2RMM A;  4HXD A;  3BVG A;  4ICV A;  4IOI E;  1GNU A;  2PKO A;  5D7G A;  3VFK A;  3WIM A;  3IT4 B;  1QLB B;  1HQR D;  3AUL A;  2DNF A;  4NAW B;  4BKS D;  4H2A A;  2OED A;  1UZX B;  4ANV A;  3RUI B;  2NS5 A;  4ICU A;  1NDD A;  2C5L C;  4YSZ B;  1OQY A;  3PGE A;  4MM3 B;  4M8M A;  1L2N A;  4DWF A;  3R2I A;  4MEL A;  4JWS C;  3N1Y C;  2DWQ A;  1L6U A;  3AM9 A;  2K8H A;  2FE8 A;  2ZZP B;  4JE3 B;  2NBW B;  3RNG C;  2KFJ A;  2NPT A;  1GG3 A;  2LGY A;  4BZA A;  1C76 A;  2KVR A;  3AU5 A;  1XO3 A;  1V80 A;  2EKI A;  3ZGZ A;  2J0J A;  1WGG A;  1UGM A;  1NEN B;  3VUY A;  1FO4 A;  2KMC A;  3TEY A;  2GBN A;  4DHJ B;  4MT5 A;  2JU6 X;  4OZC A;  1EWC A;  1R4M B;  2LJ5 A;  2KOX A;  1B1Z A;  4G50 A;  4P1C C;  2DBY A;  2IO3 B;  3W1S A;  2LXA A;  3TBL D;  4ANW A;  4P1B C;  2KQS A;  2FIF A;  1ZDX A;  1I4H A;  3N1Z C;  2Y5B B;  4EE2 A;  4JQW C;  4CQN A;  1C78 A;  2DYM A;  3NHE B;  2ZNV B;  5D2M B;  2C7N B;  2L76 A;  3DPD A;  4W9F A;  2WDR B;  3QAQ A;  2FUG 1;  4HDO A;  4EOY A;  2LUM A;  2DZI A;  1C79 A;  1D5Z C;  1KM7 A;  2MQJ A;  1TKG A;  5G55 A;  2AQ1 B;  2PIA A;  2WGS A;  1QF6 A;  4JPS A;  3AEA B;  1CZP A;  4NJ7 A;  1H8C A;  2IPK D;  4BFR A;  4RH6 A;  2KNB A;  4JIO U;  2EMT A;  2MW5 A;  2RSU A;  2I2Y A;  4AS1 A;  1V2Y A;  2W54 A;  1FNU A;  3NVY A;  5JHA A;  3PLV A;  1ZP0 B;  3GB1 A;  1XQQ A;  2M0A A;  3WA0 A;  5DPW A;  1LXD A;  5GXG B;  2KHW B;  4XWT A;  3IFW B;  3RPF C;  1L0X B;  2RGF A;  2Z0D B;  2G4S A;  2V0G A;  3M63 B;  3QX1 A;  3TCA A;  3PS6 A;  3AE6 B;  2RPQ A;  4IM0 A;  1QT9 A;  2DAF A;  4II3 B;  1E8X A;  4WH4 A;  4A3P A;  3HUI A;  3A9K B;  2MBQ A;  1AW7 A;  2KDB A;  3JVZ X;  3SD5 A;  2JQR B;  4G3X B;  1Q5W B;  2LVP A;  4MH0 E;  4KKJ A;  1YX5 B;  2IZV B;  3V61 A;  4HPP A;  3H7P A;  4ZYN A;  1D3Z A;  4EFO A;  3ZLZ A;  4N59 A;  3ML8 A;  2KVZ A;  3ENE A;  3R3M A;  4YT0 B;  1K50 A;  1R4N B;  2LFI A;  4XGA B;  5C3J B;  3TEW A;  2KJR A;  2WDT B;  3CMM B;  4HPM B;  1GAQ B;  1V5O A;  4MDK E;  4YSY B;  2BQQ A;  2H88 B;  3A9J A;  3EC8 A;  4FHJ A;  4FBJ B;  4KX6 B;  2JXX A;  1T0Q C;  5FR6 A;  4NPN A;  4FA6 A;  1HZ5 A;  3MC8 A;  1TY0 A;  1LQB A;  4MEM A;  3U4E G;  3CF6 E;  2PE9 A;  4RF0 A;  4JLC A;  3OWE B;  1WY8 A;  1YQB A;  2BF8 B;  3UQB A;  4LDT B;  4A55 A;  2FCQ A;  3APF A;  3A1Q B;  1QIL A;  5KHQ A;  2CJO A;  3VXW A;  3PSE B;  4XDD A;  2L1A A;  3BVM A;  3FIL A;  1DOY A;  2AL6 A;  3MC9 A;  3NS8 A;  1L7Y A;  2WX0 A;  2VZK D;  3QWZ B;  2WU5 B;  3H7S A;  1GUA B;  2HTH A;  2QMT A;  1WX8 A;  5C2T B;  2ZW0 A;  1TGZ B;  5DCN A;  1I4P A;  3MFG A;  4C7Z A;  2AEH A;  2L52 A;  4TQ1 A;  4EUT A;  2BB6 A;  3P63 A;  4MJS B;  5J17 A;  1D5M C;  4RFB A;  3SR6 A;  4C80 A;  3V3X A;  1VZ6 A;  5JZE B;  4IUM B;  1SE9 A;  1MI0 A;  2HJ1 A;  1I4G A;  1HTO A;  2K6D B;  1C3T A;  3AEB B;  1Y8R C;  3VH4 B;  3U8Z A;  1WX7 A;  4XZ4 A;  1R4N I;  2N9P C;  2ZW1 A;  3MHS D;  1WXM A;  2GRI A;  3AU4 A;  1SIJ A;  4QAY A;  1J8C A;  1FD6 A;  4XE0 A;  1GB1 A;  1R7S A;  2Y5P A;  3HM3 A;  3WAL A;  4A90 A;  1UD7 A;  4LCD E;  2LUE A;  4GN1 A;  3B2G A;  1ET9 A;  1WGH A;  2D5G A;  4WJP A;  3L54 A;  3VR8 B;  4IWO A;  2L83 A;  2KDM A;  5TR5 A;  4HK2 A;  1HA5 A;  1WMH B;  2KYW A;  4ARC A;  4GDL B;  1V97 A;  1AAR A;  2IBI B;  4N58 A;  3IG3 A;  2YVC A;  1OGW A;  4PS8 A;  2BYT A;  4A3O A;  2H89 B;  5HFY A;  4MGI E;  2YLM A;  2WXI A;  4EZK A;  4Q2J A;  3EFU A;  1HEZ E;  3QIJ A;  3V05 A;  4TQ0 A;  3VVW B;  4ARI A;  3URY A;  3I9V 1;  1YJ1 A;  1WH3 A;  2QC8 A;  3U7Z A;  5D94 A;  4BOS C;  4HEA 1;  1K8R B;  3Q69 A;  2FID A;  3P4R B;  3PZ8 A;  1I7H A;  1ZOY B;  3LB8 C;  2JXT A;  1VLB A;  3MC0 B;  2JRH A;  2NBU A;  3PHX B;  5IP4 D;  4ZHO A;  1RM6 C;  3PTF C;  1F52 A;  1E8Z A;  1TS3 A;  1WJ4 A;  3EEC A;  1F2R C;  3NVW A;  3S2A A;  2WXN A;  2WP9 B;  3DVN V;  1NBF C;  1SBB B;  3R7R A;  1TZ1 A;  1N5X A;  1F0Z A;  2N9E B;  2PMV A;  3AE7 B;  2MBB B;  3AE8 B;  4RNA A;  2O6V B;  1OQR A;  2KAN A;  4FHK A;  4C7Y A;  3PV1 A;  3AV8 A;  1WRD B;  2C7M B;  2D3C A;  1Z2M A;  2FUH B;  2O2V A;  3H9D A;  2KZR A;  1YNT E;  3V6E B;  3A4S C;  2C60 A;  1DGJ A;  3A9K A;  2RPV A;  2BPS A;  1C1Y B;  3SU8 X;  2N4F A;  4JL9 A;  4KZC A;  1KLV A;  1V1P B;  1YOV B;  2N7D A;  4CO7 A;  5GMV A;  4W9E A;  2I1K A;  1TS5 A;  3VTU A;  1TBE A;  2KFK B;  2KD0 A;  3QQ8 B;  1RAX A;  4LJO B;  5AZF A;  2MX2 A;  2AYO B;  1PGX A;  3SHQ A;  1N60 A;  2PE6 B;  2FBW B;  3DBS A;  1F9J A;  2XK5 A;  4PYZ A;  4DXF A;  2D3G A;  3N32 A;  3W1Y A;  4USA A;  3VR9 B;  4ZRQ A;  3RMK C;  1IBX B;  3APC A;  3DVG X;  1ZXI A;  2ONQ A;  4WQM A;  3E56 A;  4DDG D;  2W9N A;  5EE3 A;  2KWC A;  1UWX A;  2KO3 A;  5TSS A;  4WUR A;  5BYQ A;  2OHF A;  3L4P A;  5IAA C;  1GPX A;  3HRD D;  2KDI A;  4FJZ A;  4RGN A;  1WZ3 A;  1C77 A;  1EF1 A;  3R7Q A;  2OJW A;  3RNC C;  2LVO A;  2HJ8 A;  3ZDT A;  4TMA B;  1VZ7 A;  2CS4 A;  2EKE C;  5CHW A;  3ZDM C;  3CST A;  2BB5 A;  4WJO A;  1XF5 L;  1K53 A;  3APD A;  1FRR A;  4YTN B;  3KQ4 A;  1S3S G;  2R61 A;  3V60 A;  2ICI A;  2WQY B;  1NVI D;  2D10 A;  4RM8 A;  2N9X A;  3KWV A;  1LGR A;  2LHD A;  3RCZ A;  2C9W B;  1KTK A;  3ZKJ C;  1KLG D;  4YL8 A;  1E8W A;  4K7S A;  4FJV B;  3I57 A;  1YX6 B;  3U30 A;  4OZA A;  2L0F A;  4MJS A;  2N7E A;  3Q3N C;  2AQ3 B;  1LO5 D;  3NVZ A;  4MH8 A;  2RDG A;  1PGA A;  2K8C A;  2L3Z A;  1GJZ A;  1Q1O A;  2DLB A;  1E0Z A;  5IA7 A;  1A5R A;  1TTN A;  2L05 A;  5LNK 1;  1PYW D;  3BVZ A;  1WJU A;  1SE4 A;  2D07 B;  2G9H D;  4CHK A;  3DBH B;  2D3A A;  3IAM 1;  1XLP A;  4LTU A;  1TS4 A;  2LRW A;  1FCC C;  1L0Y B;  2Y3A A;  5E6O A;  1L5P A;  2WXH A;  2BWF A;  1HXY D;  3RZW C;  3ZJV A;  3PLU A;  3AED B;  4WJQ A;  1FEH A;  4HKQ A;  4F1S A;  1VCB A;  2LAS A;  2KTF A;  1HZ6 A;  5CX3 A;  2DEN B;  2LEK A;  1JCK B;  4WIP A;  5H8Y E;  4B0E A;  3LXF A;  3C0R B;  2BS2 B;  3ZJU A;  1ET6 A;  4FAD A;  3AE2 B;  1MVK A;  4K7W A;  4GDL A;  1J0G A;  2YEP F;  3AMZ A;  1D6E C;  5JXV A;  2WXG A;  3KH0 A;  3V6C B;  4UDU C;  2QDF A;  1GC7 A;  1E7U A;  3SFD B;  4KDI C;  2IND C;  2FCS A;  4KSK C;  1SJH D;  2UU7 A;  2IO1 B;  3N3K B;  2BBC A;  4K3B A;  3WAM A;  2KX0 A;  3O13 A;  4S17 A;  3P42 A;  3RUL A;  1ZE3 D;  1YJJ A;  2KJH B;  5G5H A;  3GOE A;  1LM8 B;  2KKC A;  2K0P A;  3KYD D;  4ZRI A;  4KGR A;  5IO9 A;  3W5U B;  2INP E;  3T9L A;  1SB3 C;  2HE7 A;  3AE5 B;  2KQ7 A;  1FRD A;  4PS7 A;  4W9I A;  3RN9 C;  3QC8 B;  3DBH I;  4M8N A;  1IP9 A;  3OAW A;  2MJ3 A;  5BMH A;  4M00 A;  3D32 A;  1UUP A;  1VJK A;  3Q6B A;  4US9 A;  1ZW7 A;  4R3D A;  3KVF B;  3PHW B;  1EU3 A;  3CWI A;  2CR5 A;  3RD2 A;  3AEC B;  2INC C;  4RCO A;  5DPT A;  2OOB B;  4US8 A;  3IXS A;  3U2S C;  4DQO C;  2JX5 A;  3IT6 B;  4HRS A;  1MG8 A;  2KDE B;  3FKY A;  4HPL B;  1XLO A;  1D4B A;  1WI0 A;  2WU2 B;  2MRP A;  3N9Y C;  1V8C A;  4BKT A;  2KFK A;  3L16 A;  1TT5 B;  4F7Z A;  4KVG B;  2KK8 A;  3AE3 B;  1E9M A;  1IGD A;  1JAL A;  4A9A A;  1JRU A;  3I63 C;  5LLI A;  4B6W A;  1JRO A;  2D11 A;  2K1F A;  1CJE A;  2V3S A;  4EEW A;  4N6E B;  3B9J A;  1V86 A;  4PS3 A;  3KYC D;  1CQV A;  5HG2 A;  1P3Q U;  1IBX A;  2JYE A;  2ASQ A;  3T3N A;  2G1E A;  2WDV B;  1J19 A;  1JWB D;  5AEK B;  2LZ6 A;  4I6L B;  3RNE C;  1TKE A;  1WIA A;  3N30 A;  3BK1 A;  1TKY A;  4LNF A;  4M01 A;  2NTT A;  5BYR A;  3ZNI D;  2X38 A;  2W3R A;  4DXG A;  3ZW3 A;  4X57 B;  2E6X A;  3AEF B;  2KLG A;  2MWS B;  3Q3O C;  2I38 A;  2LVQ A;  4DHZ B;  3JSV B;  5FKA C;  4N9F 4;  4W9H A;  4K81 A;  1L4Z B;  1P98 A;  3ZYY X;  2D2Q A;  1NYR A;  3RNA C;  2KLC A;  1C9F A;  5AUI A;  2MJE A;  3PVL A;  4WWP A;  2NTS A;  4S0R A;  2MBE A;  2CJN A;  4EKU A;  1IGC A;  4HVB A;  3BIN A;  2MP2 B;  4KIK A;  4O1N A;  4W9J A;  3H1U A;  4MSM B;  1TIF A;  2KC1 A;  1DOI A;  2J0M A;  3T8M A;  2VH1 A;  4WAF A;  1XLQ A;  1HE8 A;  3AEG B;  1T0Y A;  2JWZ A;  2ZNV C;  2IY0 B;  2BGF A;  2LXC A;  2JPH A;  2MEK A;  5T8I A;  1ISN A;  3OLM D;  4IDI A;  1WX9 A;  3DBR I;  3KUZ A;  5E6N A;  2CHX A;  3DWM A;  1UGJ A;  4HCN B;  3Q8A A;  1IPG A;  5D6J B;  4BBN F;  4HJG E;  2FCM A;  2X8X X;  5G2N A;  2IO0 B;  3KWL A;  4KGT A;  2WXR A;  2K8B A;  3M3J A;  1D5X C;  4W9C A;  2L32 A;  5EE9 A;  1GOZ A;  1WXV A;  4URK A;  2M19 A;  2WX1 A;  5D3D A;  3R2T A;  4BAX A;  5CHF A;  2QSD A;  4J3O D;  2MHJ A;  4MAC A;  3AH7 A;  2M17 A;  3B0A A;  1OEY J;  1NI2 A;  4NAW A;  1MPE A;  2CU1 A;  3E9S A;  4MM3 A;  1T0S C;  3KUC B;  1RFA A;  3DOW A;  3Q8E A;  4DXA B;  4B9K A;  2AX5 A;  3M62 B;  2PVG C;  2SAK A;  3W2D A;  1KRH A;  3KLS X;  1F77 A;  2Z59 B;  3LDZ E;  1ACC A;  2ZJD A;  4AP4 C;  2M1M A;  1FXA A;  4GIV A;  3C8Y A;  2JZZ A;  3DDC B;  1FXI A;  2QEJ C;  1QOF A;  2GBJ A;  3PZD A;  1ZPS A;  3RI7 C;  2I1J A;  5LXI B;  4GLS C;  3HIZ A;  2W55 A;  2KAJ A;  4W9G A;  4TSS A;  1PGB A;  1SIF A;  2TSS A;  2K9X A;  3TUO A;  3K9O B;  2REX A;  4F8C B;  4DK5 A;  3B08 A;  3VTV A;  3OJ3 A;  4XYC A;  2JZP A;  1WJ6 A;  2EMS A;  4DHJ D;  5E6J A;  4EZL A;  1AYF A;  1NEK B;  2LGD A;  4LNI A;  4YWG G;  3NOB A;  4OW0 A;  4OZB A;  1YN3 A;  2NMQ A;  2OJR A;  4DBG A;  1SE2 A;  4RGO S;  1JWU D;  2CHW A;  3OJ4 B;  1A70 A;  3P4P B;  1RFK A;  2WYQ A;  4BVU C;  1OTR B;  5CTR C;  4KV2 A;  2WDQ B;  2MA9 B;  4LK0 M;  1GC6 A;  1NI3 A;  4TKN A;  1P7F A;  2J4X A;  2KC2 A;  3Q8C A;  3N20 C;  1SE3 A;  1FNV A;  4GU2 A;  2K6Q A;  2RDH A;  3SDL C;  2A4Z A;  3B2F A;  3TEZ A;  2K5P A;  2FNJ B;  1BUI C;  2RD0 A;  2WXJ A;  2PW9 A;  3ZQ4 A;  3ZO5 B;  5HI1 A;  3O65 B;  1CK1 A;  1L6V A;  2WXP A;  4MSQ B;  4NAM A;  2FCN A;  3L13 A;  3NUH B;  3UIP B;  5FR3 A;  4K3C A;  5BMG A;  4RF1 A;  4PT5 A;  1DYQ A;  4AUQ C;  3GE8 C;  1STE A;  1VZ8 A;  1UH6 A;  2WXQ A;  2WXL A; 
#chains in the Genus database with same CATH homology
 5IO9 A;  5IOI A;  1MJD A;  1MFW A;  5IP4 D;  5IKC M;  1MG4 A;  1UF0 A;  2BQQ A;  5IN7 A;  2DNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...