1FRDA

Molecular structure of the oxidized, recombinant, heterocyst (2fe-2s) ferredoxin from anabaena 7120 determined to 1.7 angstroms resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
ASYQVRLINKKQDIDTTIEIDEETTILDGAEENGIELPFSCHSGSCSSCVGKVVEGEVDQSDQIFLDDEQMGKGFALLCVTYPRSNCTIKTHQEPYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords HETEROCYST [2FE-2S] FERREDOXIN
publication title Molecular structure of the oxidized, recombinant, heterocyst [2Fe-2S] ferredoxin from Anabaena 7120 determined to 1.7-A resolution.
pubmed doi rcsb
source organism Nostoc sp.
total genus 29
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1993-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1frdA00
5G5HA 1OQQA 1N5WA 2H88B 2WLBA 4JX1C 1SIJA 3AB5A 3AH7A 1E10A 2N0SB 4C80A 1XLNA 3NVZA 1QLBB 1A70A 1IUEA 3SFEB 1V8CA 5GXGB 1ROEA 1N61A 1WGKA 1E7PB 3AE4B 1SB3C 2BS3B 1CJEA 3VR9B 1TYGB 1OQRA 4YXDB 1FRRA 1DOXA 2MH7A 2DWQA 2WU5B 2WP9B 3AE9B 3AV8A 3KWLA 2PVGC 2OHFA 1NI3A 3P63A 4ZHOA 1VDVA 1DGJA 5EE0A 2B76B 1DOIA 1QOBA 1NYRA 1NENB 2W3SA 2WS3B 3AEBB 4ITKA 4FXCA 3P4PB 1QT9A 4WQMA 2MJEA 2W3RA 3AEGB 1ZP0B 3VRAB 3B9JA 2CJOA 5MPOA 1XLQA 2WU2B 3SFDB 1F0ZA 3AEAB 1J7AA 1QF6A 1RM6C 2MJDA 1NYQA 1L5PA 5AUIA 1RYJA 1N5XA 1XO3A 2L83A 1T3QA 3VR8B 1JALA 2E3TA 4N6EB 1KF6B 3BIID 1EWYC 3NVYA 4YTNB 4C7ZA 2KMMA 1N62A 4N58A 1FFUA 4ZOHC 1FIQA 1L6VA 2BS2B 3AE8B 3B2FA 3AECB 1FM0D 1YQ4B 5C2TB 3AE6B 1XLOA 1GAQB 1FXAA 5EE9A 1QOFA 2MJ3A 2K9XA 1N63A 3P4SB 3PO0A 3AEEB 1E9MA 1WYGA 2K5PA 3ETRA 1JROA 1L0VB 3AE7B 1XLPA 5H92C 5EE1A 3HUIA 2HTME 1L6UA 1JWBD 1PFDA 2JQRB 3RPFC 4HROA 1TKEA 2AX5A 1NVID 2K22A 3EUB2 3NVVA 4YT0B 1VJKA 1FO4A 3WCQA 4YTMB 1FMAD 4P6VF 3W5UB 4HRSA 3B2GA 3FC4A 3NS1A 4IDIA 1J7BA 1FRDA 3VRBB 3LB8C 3FAHA 1YQ3B 2PKOA 4JWUC 4USAA 1KFYB 1TJEA 4ZHPA 2Y5CA 4WWMA 4YTPB 1E6EB 1JWAD 1JW9D 1QOAA 1WXQA 2BT6A 2EKIA 5AUKA 5G5GA 3CIRB 1N60A 2H89B 4YSXB 1GPXA 3NVWA 1R7SA 3P4QB 2Q5WD 2M19A 1NEKB 3ABVB 4US9A 1PDXA 1RWSA 3P1MA 1YJJA 1V97A 3AE1B 2G1EA 4LTUA 2CU3A 5EE3A 2WDVB 3L4PA 2ACZB 4YSZB 3SR6A 3HRDD 1ZXIA 2W54A 1AYFA 1OFFA 2M56B 1UWMA 3AM9A 2WQYB 3HVZA 3W5VB 2WDQB 3CWIA 4JWSC 1FFVA 1TKGA 2FBWB 2WDRB 3AE3B 3AMZA 1I7HA 1CZPA 1AWDA 1SF0A 1TKYA 1ZUD2 3AE2B 3NRZA 4A9AA 2QIEB 1RFKA 1QOGA 2PIAA 2QJLA 3AEFB 3ZYYX 3LXFA 3AN1A 2W55A 3W9CB 2DBYA 4KX6B 1E0ZA 3P4RB 2CJNA 1KRHA 4C7YA 1WWTA 4YSYB 1J7CA 1WRIA 1YJIA 1JQ4A 1DOYA 3DWMA 1FXIA 2JX5A 4N59A 4US8A 3DWGC 3AE5B 1VLBA 2L52A 1ZOYB 2BS4B 2LEKA 1B9RA 2KAJA 1PUTA 3AEDB 5C3JB 1JRPA 5H8YE 2PVOD
chains in the Genus database with same CATH superfamily
4C4VB 4F8CB 2GB1A 2IJ0A 2WXNA 4DQOC 4HWIB 2KZRA 3WAPA 5HFYA 1WX7A 4TSSA 5J2RA 3AV8A 2KQSA 2KANA 2INCC 2J0JA 2RR9A 3ZO5B 1HZ6A 1YNTE 3NHEB 2MJEA 2A5UA 2ASQA 4IUMB 5MPOA 3RUIB 1ZGUB 3OLMD 4GOCA 4HKQA 4XC2A 2LHDA 2C60A 5C1ZA 1D6EC 2KWCA 3ZRFA 1FFUA 2HE7A 2O6VB 2DLBA 3DVNV 3W1SA 3B2FA 2KWUB 3CMMB 3DHHC 3TUOA 5EE9A 2WXGA 3A1QA 2G4DB 4E71A 1E9MA 2RMMA 2ZEQA 1UBQA 1BMLC 1IGCA 2WXLA 3IXSA 4NZLB 2XK5B 3ZTCA 2K8HA 3RPFC 3Q8CA 2AQ1B 3NVVA 3BVZA 4HDQA 3NG0A 3N9YC 1UGMA 4HPLB 3FAHA 2NR2A 1ACCA 3ZDMC 1VCBA 2MX2A 3RT3B 2KD0A 1PGAA 1PDXA 2IYDB 3AE1B 1HTQA 3BY4B 2VH1A 1SSNA 1RFAA 3HIZA 1ZXIA 1QZEA 1VRAB 1UWMA 1IPGA 1TKYA 1F9JA 4BBNC 2AL6A 3AN1A 4YWGG 4RGNA 3W9CB 1D5XC 4ZRIA 1UWXA 5IO9A 1DOYA 4MM3B 3PLVA 2JRIB 4HXDA 3CF6E 3GB1A 1WE6A 5HG2A 2WLBA 1DYQA 1WYWB 1E10A 1I35A 3UQBA 2JWUA 2BS3B 2CR5A 4JE3B 1V5OA 2BVCA 5BMHA 3QK0A 3KWLA 2PLPA 3DBRB 2KACA 3ML9A 1FCLA 1ET9A 4GIVA 5AEKB 4RM8A 3SFDB 5T8IA 4EEWA 2J0MA 4C7ZA 3PHXB 2C7NB 3HM3A 1L6VA 2G9HD 4P1BC 4I6NB 4BBNF 1F2RI 4XX5A 2I2YA 4XGAB 4A6QA 2BW2A 4KGSA 2EKEC 5FR3A 1V49A 3KVFB 3ZIMA 1K51A 1L7YA 2DZIA 2D3CA 2MW5A 5C23A 2X38A 4IWQA 4JWUC 1C4CA 1E6EB 2EKIA 3APFA 2WXPA 3A9JA 2GOWA 2WDVB 3L4PA 4YSZB 4C4VA 2NPTB 3SR6A 3ZNGC 2DYBA 1BT0A 3Q6BA 3AE3B 4NJ7A 4S0RA 3AEFB 4DDGD 2DBYA 1J7CA 1WRIA 3U7DA 1CQVA 1R4MI 3T8MA 3Q8FA 1B9RA 1ZOYB 1XCQL 5D2MB 3AU5A 1PUTA 3GZNI 2JZZA 1KLUD 1C78A 2Y5BB 1OQQA 2KDFB 1J8CA 2AYOB 1T5XD 1MJDA 4KDLB 1LO5D 1HA5A 1KLGD 1V81A 2FCQA 1CJEA 2O6VA 4HJGE 4IWPA 4AQ7A 3DBLI 3V61A 4J6IA 3AEBB 2L0TA 2BYVE 1YX5B 3HVDA 3PRZA 1F0ZA 2XK5A 1MG4A 2DNFA 2IDYA 4GN1A 2JZPA 2KMMA 2QCZA 3APDA 1ZDVA 1QQRA 1I4QA 2M17A 3AE8B 3PHWB 5C2TB 4ARCA 1XLOA 1FXAA 4A8XC 2MJ3A 2EMTA 2V1YA 3IG3A 3SEBA 2OJWA 1L0VB 5D3DA 4AS1A 4Q2JA 3RNAC 4AUQC 1D5ZC 5E6PA 2YEPF 2N9XA 2KTRB 4HRSA 5GMVA 3MJWA 4IDIA 1FRDA 1WGDA 1ENFA 2Y5CA 2ZVOA 1E5WA 4FBJB 3CIRB 2K25A 1R7SA 5CHVC 3ABVB 4B0EA 1PGXA 2N9PC 4MM3A 4PK1A 4WAFA 1KTKA 1C1YB 3HVZA 2WQYB 2CHWA 2IPKD 3RD2A 5CHWA 1ZUD2 2KWDA 4L23A 2LD9A 2V9HA 1P3QU 3IT6B 2W55A 5J17A 4K1RB 1WX9A 2CHXA 1YJIA 2JX5A 2J52A 2LEKA 3ZKJC 2KAJA 3J9CA 5C3JB 2JXTA 2PVOD 2H88B 3IFWB 4EOYA 3AH7A 3W1SC 1A70A 1IUEA 3QCAA 4EUTA 4PYUA 1KH0A 1LGRA 2GBRA 3X0WA 3ZJTA 1SGHA 2FAZA 3N32A 1QOBA 4GSWA 5D6JB 5LLIA 3VUWA 3Q3NC 3I5JC 1XQQA 2INDC 3T3NA 1KOTA 1OGWA 1RYJA 2LHEA 3U7ZA 2XN9C 4MSMB 4K3CA 1EWYC 3TL5A 4PT5A 4ZRKA 3ZRCA 3PGEA 4W9JA 3SHQA 2NVUI 2C9WB 5BMGA 3RZFA 2HJ8A 4QAYA 3ETRA 5TSSA 4BKGA 2LGDA 4KDIC 3ZVVA 4AOFA 2L32A 1IP9A 2LXAA 2INNE 1JRUA 4BKTA 4WIPA 2NPTA 4AP4C 2ONQA 3W5UB 4HJKA 2WWZA 1WGRA 3V62A 2DZJA 1XCTL 2N9LA 5JXVA 2O6VD 3KUCB 4FJZA 2R2OA 1D4BA 1N6ZA 1R4MB 3SDLC 2R2QA 3GZNB 3MC8A 1FCCC 4IM2A 2NBUA 2KJ6A 2WDQB 1SIFA 1I4RA 2PEAA 2MHJA 2KQ7A 1QOGA 2PIAA 1E90A 4MGIE 3DOWA 4JQWC 1WXAA 1E7VA 2KVRA 4GLSC 4BFRA 5HKHA 3PRMB 5H8YE 2BF8B 2FCSA 4E74A 2BB6A 4GDLB 4DK5A 2WGSA 3TSSA 5IKCM 3A9KB 4LJOB 2M4NA 2IBIB 4GXBA 1DOXA 4DXAB 1FRRA 2WU5B 2OHFA 3H6NA 2INPE 1WJ4A 3FILB 3CSFA 3L0WB 1WGHA 4WH4A 4TQ1A 3BK2A 2C7MB 3GP7A 2WXRA 2GBMA 1CMXB 2OEDA 4EE2A 1WI0A 5FR6A 2K8BA 2KTRA 3AI5A 3AECB 4K7UA 3HM6X 3U2SC 3KYCD 1GNUA 2K6QA 1IBXB 2MBOA 2M1MA 3WAMA 2IGDA 4FHJA 1EUVB 1PFDA 3E56A 1MPEA 1NVID 3EUB2 4YT0B 1VJKA 3UF8A 1J19A 4AJWA 1I4GA 1MHHE 3PSEB 1TGZB 4LCDE 2DX5B 2BGFA 1L4DB 1NEKB 3URYA 3N1ZC 1RWSA 3I63C 2V3NA 3ZXRA 2L7RA 4ZRQA 3ZDTA 3HRDD 1OFFA 2N7EA 2HD5B 3N30A 2D2QA 2HTHA 2REXA 3VTWA 2BB5A 2KLCA 3PS6A 4RGOS 3P4RB 2ZW0A 2D11A 4D2KA 3GOEA 3S2AA 2KO3A 5KHOA 2KYWA 3WANA 3K9PB 1N5WA 3IVFA 1EF5A 4C80A 2Y5PA 3JYUA 1V1PB 2WYQA 1RLFA 1E7PB 4BZAA 2KFJA 3KWVA 2Z59B 3DCGA 4YTMB 1NENB 4A3PA 2WXFA 4HVBA 2CJOA 3QIJA 2FNJB 2FIDA 2NBVB 3Q8BA 5AUIA 2G3QB 1A5RA 5JZEB 3NVYA 2LFIA 1T0SC 4TV3A 1FM0D 4HK2A 5G55A 1FEHA 3UIPB 2CKHB 4B95A 4ZYSA 1C9FA 3T3OA 1ZPSA 3AXCA 4DHZE 2NS5A 3Q14C 5IN7A 3Q3JA 3NZUA 1ZKHA 4ANXA 3DBHB 3LJ3A 4P6VF 4ICVA 3B2GA 3ZXVA 4B0MA 4IOIE 4FJYA 1EWCA 3H7PB 2JU6X 1C77A 4OW0A 3M62B 5G5GA 1MVKA 1GPXA 4NNJB 1ZW7A 3U8ZA 5I4DA 1MI0A 2ACZB 2LASA 4GDLA 4NQLB 3A9KA 4W9GA 2QIEB 1RFKA 1XXGA 4II3B 2KJRA 3AULA 2QDFA 2DYOA 4G3XB 4HPMB 3VUYA 3PVLA 5JH5C 3FILA 4TKNA 1JQ4A 2IO1B 3OJ4B 1SE2A 2J0KA 3NZ3A 1SIJA 1GC7A 1WF9A 2MLBA 3ZLZA 4EFOA 1GB1A 2WXJA 3QA8A 3NVZA 3Q3OC 3ZJVA 3KYDD 2XNAC 2MBHA 3JSVB 2MH7A 1LFDA 2PE6B 2PTLA 3DHIC 5CHFA 3VTVA 1HEZE 5J18A 5EE0A 2B76B 3DDCB 4L1BA 1IBXA 1WGGA 3KUDB 2KNBA 1TS4A 3Q69A 3AEAB 1QF6A 5CTRC 4RFBA 2D10A 1XO3A 2N1VA 1T3QA 2E3TA 3IAS1 4M00A 5D7GA 3M95A 1TZOA 2VRRB 3RMKC 1WJ6A 4ICUA 1JMLA 1U4AA 5DPTA 1SJED 1HZ5A 2ZPYA 4NJCA 5E6NA 1J0GA 5H92C 1IYFA 2PJHA 1WR1A 1OQYA 2TSSA 3W1YA 4IKGA 4M02A 3V05A 4HEA1 2ZNVB 4FLHA 2PPHA 3IT4B 3MP9A 3V60A 2QILA 3LB8C 1HXYD 2KWVB 2PKOA 3ENEA 4REZA 3ZJUA 4ZHPA 4OVUA 1SE9A 2IGHA 1RAXA 2WHIA 4MT5A 5LNK1 2M8SA 1TY2A 3OJ3A 2JYEA 2WX0A 4TUUA 3MC9A 4DDID 1L0XB 2M56B 1T6BX 3AM9A 4PYZA 2LRWA 1V1PA 4NQKE 1CZPA 3ZYYX 1F52A 5KHQA 1MFWA 4YSYB 2V4IB 3DWMA 1FXIA 1P9DU 3AE5B 4ANUA 4MH0E 2R61A 4RGTA 2MQJA 2ZCBA 3KUZA 4WJPA 2V4LA 1K8RB 3SD5A 1V8CA 4CYEA 1LQBA 1SB3C 4ZYNA 3EC8A 3ZUNA 3VTUA 3UIOB 4ITKA 3JW0X 3B9JA 4OVZA 2WU2B 1NYQA 2AWTA 3TEWA 3BINA 4W9EA 3P42A 4GU2A 4XWTA 2IGGA 3PZ8A 4YTNB 4XDDA 3WALA 1WMHB 3H7PA 2K9XA 1YIWA 2WXHA 3R7RA 2CHZA 2W82A 1WYGA 5G2NA 5L95C 1XLPA 4JL9A 1EU3A 1JWBD 3MFGA 4XZ4A 1TTNA 2AX5A 3EHVA 1B1ZA 1ZDXA 4B9KA 4ASWC 2ICIA 3GS2A 2KDBA 4M8MA 1P0RA 1TJEA 1NBFC 2K0PA 4ACFA 2LGYA 1F2RC 2Q5WD 4US9A 4PS7A 1PQSA 1WRDB 1YJJA 3MC0B 1WY8A 4HCPB 1TS2A 3W5VB 2RSUA 4ARIA 4CO7A 2BWES 4KSKC 3TEXA 3GE3C 1WIAA 2D5GA 2JSVX 3JSVA 1KRHA 4C7YA 4A3OA 4FA6A 1TS5A 3C8YA 2RD0A 3H8HA 1UZXB 2BYEA 3QAQA 3NJTA 2KC1A 1L4ZB 1I4XA 2KK8A 4RF1A 4OHJA 3VR9B 3SU8X 2WP9B 4IW0A 3QX1A 4UDUC 2N1WA 2ZVNA 3R8BA 2KX0A 2MJDA 2N7JA 2AQ3B 1HE8A 3H9DA 5AZHA 1N5XA 3VR8B 4EKUA 3QJZA 1JALA 3BIID 4C56C 1C3TA 2K1FA 3L10B 1QILA 3VVWB 4IM3A 4LNNA 4JLCA 4GMVA 1YN3A 3UINB 3PO0A 1SBBB 2BYFA 3I3TB 3R2IA 3AE7B 1Z2MA 2D3AA 4GDKB 2LGXA 3HUIA 3OAWA 1FNUA 5E6OA 3WCQA 4RMAA 1NDDA 5DPRA 2O2VB 4W9KA 3Q8EA 1XT9B 4KGRA 4USAA 1K52A 3T9LA 1Y8RC 3IHPC 2YLMA 5CX3A 4RGMA 3P4QB 3E9SA 4FULA 4JGHB 4M01A 2J42A 5HI1A 2KX3A 3NOBA 3CWIA 3ZW3A 2WDRB 1TKGA 2GMIC 3AMZA 4WJQA 3L13A 4FN2A 2JY6A 3KQ4A 4KVGB 1VZ6A 3HHMA 1F77A 1VLBA 2LJ5A 3NUHB 1GJZA 3R3MA 4S17A 4DHZB 2GLSA 3VXWA 4AJYB 4NAWB 4HCNB 2LI5A 4KKJA 2JT4B 2LVQA 1ZXHA 1Q1OA 4FHKA 1WMHA 2BPSA 3PZ7A 1E8ZA 2L8JA 1DGJA 2AL3A 4ZHOA 1T0YA 5JHAA 3DBLB 1OTRB 1V1OA 2ZCCA 2Z8LA 4WWOA 1KF6B 4B6WA 1Q0WB 1FXTB 3VQIA 4ZOHC 4WJNA 3PPAA 1KM7A 3JVZX 3M63B 1JWUD 2DYMA 4FADA 2DAFA 2WXIA 3PRPB 4LJPB 1XEEA 1YMHE 3B0AA 4XDCA 1V86A 1C76A 2L1AA 2A4ZA 3ZTDA 2N4FA 3MHZA 3WIMA 1SXTA 4G0NB 4OVVA 2FUG1 5BO4B 1JW9D 4EZKA 4K7SA 1MHXA 2Z0DB 1T0QC 3NS8A 2I1KA 1GUAB 5BMIA 4MACA 4RH6A 1SE3A 1V80A 3AE2B 1WSPA 3ML8A 2DZKA 1JWMD 4WWPA 2OOBB 2RDGA 1WXMA 2DZMA 2KXJA 2QEJC 3DWGC 2L52A 3AEDB 4NAMA 4BKSA 3TIXA 1V2YA 5IOIA 4JX1C 2JVCA 3DVGY 4W9IA 3RZWC 2I38A 3ZNZB 3VH4B 4I6LB 4DBGA 2BTEA 3PREA 1TYGB 3PZDA 2PVGC 4KV2A 4WAAA 2K8CA 2ZW1A 2JXXA 1M94A 3RNEC 1YJ1A 1C4AA 2C5LC 3MHSD 1F1HA 3GE8C 1XLQA 4GDKA 5LXHA 2EMSA 1J7AA 1K53A 4I6PA 3DVNU 4WURA 4KIKB 2VZKB 4NJ6A 5BYQA 2MP2B 2HJ1A 2O2VA 5HHDG 4N9F4 1ESFA 4W9LA 5D3IB 2WX1A 4LDTD 1GAQB 3ALBA 2N7DA 2L05A 4G50A 3P2BA 3P4SB 3FKYA 3BVMA 1ET6A 3VDZA 2RDBC 3QARA 1TS3A 3RN9C 1L6UA 4C00A 3DQVA 2K22A 4MSQB 2UU7A 2LVPA 3LYYA 3BZDB 3FC4A 2B3AA 1XD3B 3RFZB 1P7EA 2LGSA 2G4SA 1P1AA 1YQ3B 2LWPA 4ZDVA 1QOAA 1VD2A 1SEBD 3Q3MC 4ANVA 4KZCA 1UGJA 1AN8A 4LTUA 2CU3A 1GC6A 3NY5A 1TZ1A 5AZGA 4NAWA 3X23A 3K9OB 2FBWB 2MBBB 4PS3A 4A9AA 1V9JA 2QJLA 1UD7A 4M0WB 1WX8A 2MBQA 1L2NA 3RNFC 1E0ZA 3C19A 2D3GA 2RPQA 4URKA 2J7QB 2KFKB 4H2AA 1JRPA 2NMQA 2WXKA 2ZNVC 2MSED 1ISNA 3QWZB 1N61A 1WGKA 2MRPA 4A20A 3EECA 1AW7A 1BXTA 4MJSB 4W9FA 1LXDA 2BKFA 2DWQA 2JPHA 4HDOA 1IGDA 3NZSA 1NI3A 2BKRB 2Y3AA 2MCNB 2LZ6A 2JRHA 2W3SA 4W9CA 4MELA 2KDEB 3TCAA 3DPDA 1V5TA 5DCNA 2RDHA 5BYSA 2JUOA 4IC7B 2KOXA 1FNWA 1UH6A 3Q8AA 2GBJA 4J3OD 2KDMA 1WM3A 2QC8A 4P1CC 3TMPB 3VAWA 2WXMA 1QOFA 4X57B 2J53A 4GB9A 3WA0A 1UUPA 1UNSA 2JQRB 4KZ0A 3KW5B 1TKEA 2GI9A 1HTOA 2E6XA 4BKSD 2QHOA 1SJHD 1EM7A 4BOSC 4II2B 3PLUA 3ONSA 1P98A 3VRBB 1MG8A 4WWMA 3EGRA 4OZCA 5IA7A 4DWFA 5AUKA 4HKZE 5JHBA 4YSXB 1OEYJ 2IY0B 1LM8B 2Z0EB 1S1QB 1UELA 2W9NA 1GOZA 4MH8A 4JPSA 2MBEA 4A90A 4RF0A 3BK1A 4JWSC 4WJOA 3Q2AC 3U52E 4IWOA 1AWDA 1TIFA 2QMTA 1VZ7A 2ZPNA 1WJUA 4KSLC 2AQ2B 3IAM1 1NI2A 4US8A 4HPPA 2K39A 2NCNA 4NY0A 2LXCA 1E8XA 4KIKA 2LUEA 2N0SB 3SFEB 4WWNA 1ROEA 1VR9A 2MP2A 4IG7B 4YXDB 2M0XA 3AE9B 4MGYE 1PYWD 1H4RA 2L0FA 3OWEB 1V6EA 4LNKA 2WXQA 2W3RA 1ZP0B 3VRAB 1YN4A 2KDIA 2C7HA 1E8WA 3UI3A 4AWJA 5IAAC 4BOZB 4K81A 2PW9A 4N6EB 2JF5A 4LDTB 3WAOA 5FK9C 1FIQA 1CK1A 2M0AA 3AE6B 2GRIA 2LUMA 2RGFA 3LDZE 3N20C 3RNCC 3AEEB 3BVGA 2DAJA 1FD6A 2X8XX 1FO4A 1FMAD 4NPNA 4EZLA 3L54A 3TEZA 2KJHB 4W9DA 2IZVB 3V6EB 1WGYA 2D3BA 2NTSA 3NS1A 3I57A 4DXGA 1J7BA 2KMCA 4M0WA 2GBKA 4DHJB 2BT6A 1GG3A 3M3JA 2MEKA 5DPSA 1H8CA 2WNMA 2BWFA 2KFKA 3U4EG 3R7QA 2DHZA 4ZRPA 3QQ8B 1X1MA 1WXVA 3C0RB 2VH2A 4MJSA 1JCKB 1WJNA 2I1JA 4KX6B 3RNGC 1KLVA 1I4PA 3DBSA 1EF1A 2IY1B 3TBLD 2WDTB 3ZQ4A 1XLNA 3D32A 3AE4B 3BWUD 3O13A 3ZGZA 3H7SA 5LXIB 3N1XC 3W2DA 1DOIA 4FXCA 1QT9A 4LLGM 5TR5A 2V3SA 2CS4A 3AU4A 3QC8B 1L5PA 4LK0M 2L83A 1JWSD 2KTFA 1WE7A 4P7IA 3V3XA 2JWZA 1N62A 2G45B 3BYYB 3L16A 2KN5A 2K6DB 1YQ4B 4RNAA 1WM2A 1E7UA 4ZRJA 3UGBB 4MGZE 3A4RA 1WZ3A 2BBCA 3I9V1 1TT5B 3H1UA 2YEPB 3ZNHB 3R2TA 1WZ0A 1I42A 3Q3FA 2ZJDA 1RRBA 4F1SA 1E8YA 3MJ5A 2VZKD 4JIOU 2J4XA 2SEBD 4KKIA 1JWAD 3PV1A 1N60A 1C4PA 2V3PA 3NVWA 2RPVA 4FJVB 4XWWA 4KGTA 4L2YA 5L83A 3R66C 2G1EA 1T0RC 1EU4A 4XE0A 5EE3A 2KVZA 2LVOA 2W54A 3MTNB 3RYTA 2EELA 1Y56A 1I7HA 1ZE3D 1D3ZA 1SF0A 2N9KA 1XF5L 4GGQA 1UBIA 3RULA 2CJNA 2D07B 3TJPA 3KH0A 4MDKE 3O65B 2BS4B 4MGKE 1M4VA 1WH3A 4K3BA 3HK0A 2N9EB 5AZFA 1VZ8A 5GXGB 1TBEA 1S3SG 3VHTC 4A55A 3DVGX 4TQ0A 1HQRD 4BAXA 3P63A 5D94A 4E3CA 1NYRA 1TY0A 2AEHA 2WS3B 4WQMA 1R4NI 1WR6E 3AEGB 3EFUA 1OEYA 3N3KB 2LRUA 1YD8U 2HDEA 2K3UA 3B08A 2KHWB 4N58A 1WXSA 4IM0A 3EFCA 3VH3B 2FUHB 4O1NA 1YOVB 1YX6B 2XBBC 4TMAB 4F7ZA 2SAKA 2JYTA 1N63A 2K5PA 1C79A 2YVCA 3DBHI 2BYTA 2ZZPB 5EE1A 1Q5WB 2HTME 4HROA 5BYRA 3N1YC 4G11A 3QHTA 2GBNA 4LNFA 2OJRA 2PMVA 2CU1A 4YTPB 3A1QB 1K50A 4CQNA 2M19A 1PGBA 2KC2A 4K7WA 3VFKA 1AYFA 1YQBA 5DPWA 2WXOA 4PS8A 2PE9A 1QKZA 2KN4A 4N59A 1STEA 1YN5A 4YL8A 4HLEA 1Z5SB 2LMCA 2BQQA 5G5HA 4DXFA 2QSDA 3AB5A 3L08A 2IO2B 1QLBB 1L0YB 2NBWB 4MEMA 4OZAA 1OQRA 2NTTA 4CHKA 4LNOA 1VDVA 2L76A 3P4PB 2UYZB 5IP4D 3RNBC 4BVUC 3OG5A 3PT2B 2L3ZA 1RM6C 2LJIA 3BYTB 3V6CB 3EA6A 3CSTA 3L17A 2ON8A 1BUIC 2KKCA 3PTFC 4OZBA 2JZ3B 4EZJA 2BS2B 3DBRI 5FKAC 3A4SC 4RM9A 1I4HA 4WQOB 5EDSA 1UF0A 1FPYA 1AARA 3TEYA 1FNVA 1JROA 4RCOA 1SE4A 2XEWA 1WFYA 3ZNID 2KT7A 3APCA 1KJTA 2FCMA 4M8NA 4ANWA 4LNIA 1G6JA 1P7FA 1GB4A 1KFYB 3U30A 2MA9B 4P16A 5E6JA 1WXQA 2V0GA 2H89B 1EO6A 4R3DA 2LGIA 2FIFA 2IO3B 3VUXA 3P1MA 1V97A 3A33B 4W9HA 2KMAA 2FE8A 2FCNA 2L00B 1FFVA 2MWSB 2KLGA 3NRZA 2UWQA 3ECIA 2IO0B 3LXFA 1D5MC 3RCZA 3IBEA 3UQAA 3RI7C 1WWTA 3B1LX 1Q10A 4XYCA 3DHGC 3A9JB 1R4NB 4DHJD 2KQ4X 2DENB 3KLSX
chains in the Genus database with same CATH topology
2GB1A 2BB6A 1L4ZB 1I4XA 4GDLB 2N0SB 3TSSA 3SFEB 2IJ0A 2WXNA 4RF1A 4DQOC 1ROEA 1VR9A 5HFYA 4OHJA 4YXDB 3VR9B 1DOXA 1FRRA 2WU5B 3AE9B 3AV8A 2WP9B 4TSSA 1PYWD 2OHFA 2INPE 3FILB 3OWEB 1HZ6A 1YNTE 2WXQA 2MJEA 2W3RA 4UDUC 1ZP0B 3VRAB 4WH4A 1YN4A 5MPOA 4TQ1A 3BK2A 3R8BA 3GP7A 3UI3A 2MJDA 2WXRA 2N7JA 2AQ3B 2OEDA 4HKQA 4EE2A 2LHDA 1N5XA 3VR8B 2PW9A 1JALA 4N6EB 3BIID 4C56C 1D6EC 1FFUA 5FK9C 1FIQA 2DLBA 3W1SA 1CK1A 2M0AA 3B2FA 3AECB 3AE6B 2GRIA 1QILA 3TUOA 5EE9A 2WXGA 3U2SC 2LUMA 1YN3A 3PO0A 1IBXB 3AEEB 1E9MA 2RMMA 1SBBB 3R2IA 3AE7B 1BMLC 1IGCA 3BVGA 2WXLA 3IXSA 2IGDA 4GDKB 3HUIA 4NZLB 1FD6A 1FNUA 1PFDA 3RPFC 3E56A 3Q8CA 1MPEA 1NVID 3EUB2 2AQ1B 3NVVA 3BVZA 4YT0B 1VJKA 1FO4A 3WCQA 1FMAD 3TEZA 1I4GA 3Q8EA 1MHHE 3N9YC 2NTSA 3NS1A 3I57A 4DXGA 1J7BA 3FAHA 4KGRA 4USAA 1ACCA 1K52A 4M0WA 2BT6A 4RGMA 2MEKA 1L4DB 3P4QB 1NEKB 1PGAA 3E9SA 1PDXA 3URYA 1RWSA 2WNMA 3AE1B 2V3NA 3U4EG 4ZRQA 2J42A 5HI1A 1SSNA 3HRDD 1ZXIA 1OFFA 1VRAB 1UWMA 4ZRPA 3CWIA 2WDRB 1TKGA 3AMZA 1TKYA 1JCKB 3AN1A 2BB5A 4YWGG 4RGNA 4RGOS 1D5XC 4KX6B 3W9CB 3P4RB 2ZW0A 1UWXA 3KQ4A 1VZ6A 1DOYA 4D2KA 1I4PA 1F77A 1VLBA 3NUHB 4MM3B 3GB1A 1N5WA 3ZQ4A 5HG2A 2WLBA 1DYQA 4NAWB 1E10A 4C80A 2Y5PA 1XLNA 1V1PB 4KKJA 2JWUA 1E7PB 1ZXHA 3AE4B 3BWUD 2BS3B 3O13A 3ZGZA 4JE3B 5BMHA 3KWVA 3KWLA 3PZ7A 2PLPA 1DGJA 2KACA 3W2DA 4ZHOA 1DOIA 4YTMB 1NENB 1FCLA 4FXCA 1QT9A 4LLGM 1ET9A 2WXFA 2CJOA 1V1OA 3SFDB 5T8IA 3Q8BA 1L5PA 4LK0M 5AUIA 2Z8LA 2L83A 1JWSD 3V3XA 1KF6B 3NVYA 4C7ZA 3VQIA 1N62A 4ZOHC 2LFIA 1L6VA 3BYYB 1FM0D 1YQ4B 2G9HD 1JWUD 4RNAA 1FEHA 2DYMA 4ZYSA 1C9FA 3T3OA 1ZPSA 1F2RI 2WXIA 2I2YA 4A6QA 2BBCA 3I9V1 2BW2A 4KGSA 2YEPB 1XEEA 1YMHE 5FR3A 3R2TA 4XDCA 1C76A 2L1AA 4P6VF 1K51A 3MHZA 3B2GA 2X38A 1SXTA 3MJ5A 2VZKD 2J4XA 4JWUC 4B0MA 4IOIE 2SEBD 4KKIA 1EWCA 1C4CA 2FUG1 1E6EB 2JU6X 1JWAD 1JW9D 1C77A 4OW0A 2EKIA 5G5GA 1MHXA 1C4PA 1MVKA 1N60A 2V3PA 3NVWA 2RPVA 1GPXA 4XWWA 4KGTA 4L2YA 2WXPA 5I4DA 2G1EA 1EU4A 4XE0A 5EE3A 1MI0A 2WDVB 3L4PA 2ACZB 4YSZB 3SR6A 2W54A 2EELA 5BMIA 3AE3B 4MACA 1Y56A 4RH6A 1SE3A 1I7HA 1ZE3D 1SF0A 3AE2B 1WSPA 2QIEB 1RFKA 1XXGA 2N9KA 1XF5L 3AEFB 1JWMD 2RDGA 2DBYA 2CJNA 2DYOA 1J7CA 1WRIA 1CQVA 3FILA 1JQ4A 2QEJC 3DWGC 3Q8FA 2L52A 1B9RA 1ZOYB 2BS4B 1XCQL 1SE2A 1PUTA 3AEDB 1M4VA 1KLUD 1C78A 4NAMA 1OQQA 3NZ3A 4JX1C 1SIJA 1T5XD 1GB1A 2WXJA 2I38A 3NVZA 1LO5D 1HA5A 5H8YE 1VZ8A 3ZJVA 5GXGB 1KLGD 2XNAC 4A55A 2BTEA 1CJEA 4TQ0A 1TYGB 1HQRD 2MH7A 4HJGE 3P63A 2PVGC 4AQ7A 2PTLA 2ZW1A 1HEZE 5EE0A 2B76B 3AEBB 1NYRA 1TY0A 2WS3B 4WQMA 4L1BA 1IBXA 3AEGB 1C4AA 1TS4A 3HVDA 1XLQA 3Q69A 1F0ZA 3AEAB 1J7AA 1QF6A 1K53A 4WURA 2IDYA 4RFBA 2VZKB 2HDEA 1XO3A 1T3QA 2K3UA 2E3TA 3IAS1 5BYQA 2JZPA 2KMMA 5D7GA 4N58A 1ZDVA 1QQRA 5HHDG 1I4QA 1ESFA 1TZOA 3AE8B 4O1NA 5D3IB 4TMAB 5C2TB 4ARCA 1JMLA 1XLOA 1GAQB 1FXAA 4A8XC 2MJ3A 2SAKA 2JYTA 1N63A 1SJED 3P4SB 1HZ5A 3SEBA 4NJCA 2K5PA 3BVMA 1ET6A 1C79A 2BYTA 5H92C 1L0VB 5EE1A 1TS3A 5D3DA 2HTME 1L6UA 4AS1A 4HROA 2TSSA 2K22A 4Q2JA 5BYRA 4IKGA 3LYYA 3V05A 1D5ZC 2YEPF 4HEA1 3BZDB 4HRSA 3FC4A 3IT4B 3RFZB 3MP9A 1P7EA 4IDIA 1FRDA 2QILA 3LB8C 1HXYD 1YQ3B 2PKOA 1ENFA 2PMVA 4REZA 3ZJUA 4ZHPA 2Y5CA 4YTPB 1QOAA 1K50A 3CIRB 4CQNA 2IGHA 1R7SA 2M19A 3ABVB 4MT5A 4B0EA 1PGBA 5LNK1 1PGXA 1TY2A 1SEBD 1UGJA 2JYEA 1AN8A 4LTUA 2CU3A 4WAFA 1L0XB 1AYFA 1KTKA 2M56B 3HVZA 1T6BX 2WQYB 3AM9A 2FBWB 2IPKD 1V1PA 1CZPA 1ZUD2 2KWDA 2WXOA 4A9AA 2QJLA 4L23A 3ZYYX 3IT6B 2W55A 1E0ZA 4YSYB 1YJIA 2V4IB 1QKZA 2KN4A 1FXIA 1STEA 1YN5A 2J52A 2JX5A 3DWMA 4N59A 3AE5B 2LEKA 2LMCA 2KAJA 2R61A 3J9CA 1JRPA 2JXTA 4H2AA 5C3JB 4RGTA 2PVOD 5G5HA 2NMQA 2WXKA 2H88B 4DXFA 2QSDA 3AB5A 3AH7A 1QLBB 1A70A 1IUEA 1L0YB 1V8CA 1N61A 1WGKA 1KH0A 1SB3C 1AW7A 1BXTA 4OZAA 1OQRA 2NTTA 2DWQA 1IGDA 1NI3A 3ZJTA 2Y3AA 1VDVA 1QOBA 2W3SA 4ITKA 3P4PB 3B9JA 4OVZA 2WU2B 1RM6C 2LJIA 1NYQA 3BYTB 3TEWA 3T3NA 3EA6A 2RDHA 5BYSA 3P42A 1RYJA 2ON8A 4XWTA 1BUIC 1FNWA 2LHEA 2XN9C 3U7ZA 2IGGA 3PZ8A 3Q8AA 4J3OD 2KDMA 1EWYC 4YTNB 4OZBA 4PT5A 4XDDA 2BS2B 5FKAC 1I4HA 2WXMA 1QOFA 5BMGA 2K9XA 2J53A 2WXHA 2W82A 1WYGA 3ETRA 5TSSA 3TEYA 1FNVA 1JROA 4RCOA 1SE4A 1XLPA 1UUPA 1UNSA 2L32A 1EU3A 1JWBD 2JQRB 2INNE 3MFGA 1TKEA 2AX5A 2GI9A 4WIPA 2E6XA 1B1ZA 2ONQA 1ZDXA 3W5UB 1SJHD 1EM7A 2ICIA 3GS2A 3VRBB 1P7FA 1GB4A 1KFYB 1TJEA 4WWMA 1XCTL 3EGRA 4OZCA 2N9LA 4P16A 5E6JA 1WXQA 5JXVA 2K0PA 2V0GA 5AUKA 4HKZE 2H89B 4YSXB 4R3DA 1F2RC 2LGIA 2Q5WD 1D4BA 4US9A 3P1MA 1YJJA 1V97A 3MC0B 2FE8A 1GOZA 4MH8A 1FCCC 4JPSA 1TS2A 3W5VB 2WDQB 4A90A 4RF0A 3BK1A 4JWSC 1FFVA 1I4RA 4ARIA 3U52E 1AWDA 3NRZA 2QMTA 1VZ7A 1QOGA 2PIAA 3TEXA 2D5GA 1D5MC 2JSVX 3LXFA 1KRHA 4C7YA 2AQ2B 1WWTA 1TS5A 3C8YA 1Q10A 3IAM1 3H8HA 4US8A 4GLSC 2KQ4X 3KLSX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G5H A;  1OQQ A;  1N5W A;  2H88 B;  2WLB A;  4JX1 C;  1SIJ A;  3AB5 A;  3AH7 A;  1E10 A;  2N0S B;  4C80 A;  1XLN A;  3NVZ A;  1QLB B;  1A70 A;  1IUE A;  3SFE B;  1V8C A;  5GXG B;  1ROE A;  1N61 A;  1WGK A;  1E7P B;  3AE4 B;  1SB3 C;  2BS3 B;  1CJE A;  3VR9 B;  1TYG B;  1OQR A;  4YXD B;  1FRR A;  1DOX A;  2MH7 A;  2DWQ A;  2WU5 B;  2WP9 B;  3AE9 B;  3AV8 A;  3KWL A;  2PVG C;  2OHF A;  1NI3 A;  3P63 A;  4ZHO A;  1VDV A;  1DGJ A;  5EE0 A;  2B76 B;  1DOI A;  1QOB A;  1NYR A;  1NEN B;  2W3S A;  2WS3 B;  3AEB B;  4ITK A;  4FXC A;  3P4P B;  1QT9 A;  4WQM A;  2MJE A;  2W3R A;  3AEG B;  1ZP0 B;  3VRA B;  3B9J A;  2CJO A;  5MPO A;  1XLQ A;  2WU2 B;  3SFD B;  1F0Z A;  3AEA B;  1J7A A;  1QF6 A;  1RM6 C;  2MJD A;  1NYQ A;  1L5P A;  5AUI A;  1RYJ A;  1N5X A;  1XO3 A;  2L83 A;  1T3Q A;  3VR8 B;  1JAL A;  2E3T A;  4N6E B;  1KF6 B;  3BII D;  1EWY C;  3NVY A;  4YTN B;  4C7Z A;  2KMM A;  1N62 A;  4N58 A;  1FFU A;  4ZOH C;  1FIQ A;  1L6V A;  2BS2 B;  3AE8 B;  3B2F A;  3AEC B;  1FM0 D;  1YQ4 B;  5C2T B;  3AE6 B;  1XLO A;  1GAQ B;  1FXA A;  5EE9 A;  1QOF A;  2MJ3 A;  2K9X A;  1N63 A;  3P4S B;  3PO0 A;  3AEE B;  1E9M A;  1WYG A;  2K5P A;  3ETR A;  1JRO A;  1L0V B;  3AE7 B;  1XLP A;  5H92 C;  5EE1 A;  3HUI A;  2HTM E;  1L6U A;  1JWB D;  1PFD A;  2JQR B;  3RPF C;  4HRO A;  1TKE A;  2AX5 A;  1NVI D;  2K22 A;  3EUB 2;  3NVV A;  4YT0 B;  1VJK A;  1FO4 A;  3WCQ A;  4YTM B;  1FMA D;  4P6V F;  3W5U B;  4HRS A;  3B2G A;  3FC4 A;  3NS1 A;  4IDI A;  1J7B A;  1FRD A;  3VRB B;  3LB8 C;  3FAH A;  1YQ3 B;  2PKO A;  4JWU C;  4USA A;  1KFY B;  1TJE A;  4ZHP A;  2Y5C A;  4WWM A;  4YTP B;  1E6E B;  1JWA D;  1JW9 D;  1QOA A;  1WXQ A;  2BT6 A;  2EKI A;  5AUK A;  5G5G A;  3CIR B;  1N60 A;  2H89 B;  4YSX B;  1GPX A;  3NVW A;  1R7S A;  3P4Q B;  2Q5W D;  2M19 A;  1NEK B;  3ABV B;  4US9 A;  1PDX A;  1RWS A;  3P1M A;  1YJJ A;  1V97 A;  3AE1 B;  2G1E A;  4LTU A;  2CU3 A;  5EE3 A;  2WDV B;  3L4P A;  2ACZ B;  4YSZ B;  3SR6 A;  3HRD D;  1ZXI A;  2W54 A;  1AYF A;  1OFF A;  2M56 B;  1UWM A;  3AM9 A;  2WQY B;  3HVZ A;  3W5V B;  2WDQ B;  3CWI A;  4JWS C;  1FFV A;  1TKG A;  2FBW B;  2WDR B;  3AE3 B;  3AMZ A;  1I7H A;  1CZP A;  1AWD A;  1SF0 A;  1TKY A;  1ZUD 2;  3AE2 B;  3NRZ A;  4A9A A;  2QIE B;  1RFK A;  1QOG A;  2PIA A;  2QJL A;  3AEF B;  3ZYY X;  3LXF A;  3AN1 A;  2W55 A;  3W9C B;  2DBY A;  4KX6 B;  1E0Z A;  3P4R B;  2CJN A;  1KRH A;  4C7Y A;  1WWT A;  4YSY B;  1J7C A;  1WRI A;  1YJI A;  1JQ4 A;  1DOY A;  3DWM A;  1FXI A;  2JX5 A;  4N59 A;  4US8 A;  3DWG C;  3AE5 B;  1VLB A;  2L52 A;  1ZOY B;  2BS4 B;  2LEK A;  1B9R A;  2KAJ A;  1PUT A;  3AED B;  5C3J B;  1JRP A;  5H8Y E;  2PVO D; 
#chains in the Genus database with same CATH topology
 4C4V B;  4F8C B;  2GB1 A;  2IJ0 A;  2WXN A;  4DQO C;  4HWI B;  2KZR A;  3WAP A;  5HFY A;  1WX7 A;  4TSS A;  5J2R A;  3AV8 A;  2KQS A;  2KAN A;  2INC C;  2J0J A;  2RR9 A;  3ZO5 B;  1HZ6 A;  1YNT E;  3NHE B;  2MJE A;  2A5U A;  2ASQ A;  4IUM B;  5MPO A;  3RUI B;  1ZGU B;  3OLM D;  4GOC A;  4HKQ A;  4XC2 A;  2LHD A;  2C60 A;  5C1Z A;  1D6E C;  2KWC A;  3ZRF A;  1FFU A;  2HE7 A;  2O6V B;  2DLB A;  3DVN V;  3W1S A;  3B2F A;  2KWU B;  3CMM B;  3DHH C;  3TUO A;  5EE9 A;  2WXG A;  3A1Q A;  2G4D B;  4E71 A;  1E9M A;  2RMM A;  2ZEQ A;  1UBQ A;  1BML C;  1IGC A;  2WXL A;  3IXS A;  4NZL B;  2XK5 B;  3ZTC A;  2K8H A;  3RPF C;  3Q8C A;  2AQ1 B;  3NVV A;  3BVZ A;  4HDQ A;  3NG0 A;  3N9Y C;  1UGM A;  4HPL B;  3FAH A;  2NR2 A;  1ACC A;  3ZDM C;  1VCB A;  2MX2 A;  3RT3 B;  2KD0 A;  1PGA A;  1PDX A;  2IYD B;  3AE1 B;  1HTQ A;  3BY4 B;  2VH1 A;  1SSN A;  1RFA A;  3HIZ A;  1ZXI A;  1QZE A;  1VRA B;  1UWM A;  1IPG A;  1TKY A;  1F9J A;  4BBN C;  2AL6 A;  3AN1 A;  4YWG G;  4RGN A;  3W9C B;  1D5X C;  4ZRI A;  1UWX A;  5IO9 A;  1DOY A;  4MM3 B;  3PLV A;  2JRI B;  4HXD A;  3CF6 E;  3GB1 A;  1WE6 A;  5HG2 A;  2WLB A;  1DYQ A;  1WYW B;  1E10 A;  1I35 A;  3UQB A;  2JWU A;  2BS3 B;  2CR5 A;  4JE3 B;  1V5O A;  2BVC A;  5BMH A;  3QK0 A;  3KWL A;  2PLP A;  3DBR B;  2KAC A;  3ML9 A;  1FCL A;  1ET9 A;  4GIV A;  5AEK B;  4RM8 A;  3SFD B;  5T8I A;  4EEW A;  2J0M A;  4C7Z A;  3PHX B;  2C7N B;  3HM3 A;  1L6V A;  2G9H D;  4P1B C;  4I6N B;  4BBN F;  1F2R I;  4XX5 A;  2I2Y A;  4XGA B;  4A6Q A;  2BW2 A;  4KGS A;  2EKE C;  5FR3 A;  1V49 A;  3KVF B;  3ZIM A;  1K51 A;  1L7Y A;  2DZI A;  2D3C A;  2MW5 A;  5C23 A;  2X38 A;  4IWQ A;  4JWU C;  1C4C A;  1E6E B;  2EKI A;  3APF A;  2WXP A;  3A9J A;  2GOW A;  2WDV B;  3L4P A;  4YSZ B;  4C4V A;  2NPT B;  3SR6 A;  3ZNG C;  2DYB A;  1BT0 A;  3Q6B A;  3AE3 B;  4NJ7 A;  4S0R A;  3AEF B;  4DDG D;  2DBY A;  1J7C A;  1WRI A;  3U7D A;  1CQV A;  1R4M I;  3T8M A;  3Q8F A;  1B9R A;  1ZOY B;  1XCQ L;  5D2M B;  3AU5 A;  1PUT A;  3GZN I;  2JZZ A;  1KLU D;  1C78 A;  2Y5B B;  1OQQ A;  2KDF B;  1J8C A;  2AYO B;  1T5X D;  1MJD A;  4KDL B;  1LO5 D;  1HA5 A;  1KLG D;  1V81 A;  2FCQ A;  1CJE A;  2O6V A;  4HJG E;  4IWP A;  4AQ7 A;  3DBL I;  3V61 A;  4J6I A;  3AEB B;  2L0T A;  2BYV E;  1YX5 B;  3HVD A;  3PRZ A;  1F0Z A;  2XK5 A;  1MG4 A;  2DNF A;  2IDY A;  4GN1 A;  2JZP A;  2KMM A;  2QCZ A;  3APD A;  1ZDV A;  1QQR A;  1I4Q A;  2M17 A;  3AE8 B;  3PHW B;  5C2T B;  4ARC A;  1XLO A;  1FXA A;  4A8X C;  2MJ3 A;  2EMT A;  2V1Y A;  3IG3 A;  3SEB A;  2OJW A;  1L0V B;  5D3D A;  4AS1 A;  4Q2J A;  3RNA C;  4AUQ C;  1D5Z C;  5E6P A;  2YEP F;  2N9X A;  2KTR B;  4HRS A;  5GMV A;  3MJW A;  4IDI A;  1FRD A;  1WGD A;  1ENF A;  2Y5C A;  2ZVO A;  1E5W A;  4FBJ B;  3CIR B;  2K25 A;  1R7S A;  5CHV C;  3ABV B;  4B0E A;  1PGX A;  2N9P C;  4MM3 A;  4PK1 A;  4WAF A;  1KTK A;  1C1Y B;  3HVZ A;  2WQY B;  2CHW A;  2IPK D;  3RD2 A;  5CHW A;  1ZUD 2;  2KWD A;  4L23 A;  2LD9 A;  2V9H A;  1P3Q U;  3IT6 B;  2W55 A;  5J17 A;  4K1R B;  1WX9 A;  2CHX A;  1YJI A;  2JX5 A;  2J52 A;  2LEK A;  3ZKJ C;  2KAJ A;  3J9C A;  5C3J B;  2JXT A;  2PVO D;  2H88 B;  3IFW B;  4EOY A;  3AH7 A;  3W1S C;  1A70 A;  1IUE A;  3QCA A;  4EUT A;  4PYU A;  1KH0 A;  1LGR A;  2GBR A;  3X0W A;  3ZJT A;  1SGH A;  2FAZ A;  3N32 A;  1QOB A;  4GSW A;  5D6J B;  5LLI A;  3VUW A;  3Q3N C;  3I5J C;  1XQQ A;  2IND C;  3T3N A;  1KOT A;  1OGW A;  1RYJ A;  2LHE A;  3U7Z A;  2XN9 C;  4MSM B;  4K3C A;  1EWY C;  3TL5 A;  4PT5 A;  4ZRK A;  3ZRC A;  3PGE A;  4W9J A;  3SHQ A;  2NVU I;  2C9W B;  5BMG A;  3RZF A;  2HJ8 A;  4QAY A;  3ETR A;  5TSS A;  4BKG A;  2LGD A;  4KDI C;  3ZVV A;  4AOF A;  2L32 A;  1IP9 A;  2LXA A;  2INN E;  1JRU A;  4BKT A;  4WIP A;  2NPT A;  4AP4 C;  2ONQ A;  3W5U B;  4HJK A;  2WWZ A;  1WGR A;  3V62 A;  2DZJ A;  1XCT L;  2N9L A;  5JXV A;  2O6V D;  3KUC B;  4FJZ A;  2R2O A;  1D4B A;  1N6Z A;  1R4M B;  3SDL C;  2R2Q A;  3GZN B;  3MC8 A;  1FCC C;  4IM2 A;  2NBU A;  2KJ6 A;  2WDQ B;  1SIF A;  1I4R A;  2PEA A;  2MHJ A;  2KQ7 A;  1QOG A;  2PIA A;  1E90 A;  4MGI E;  3DOW A;  4JQW C;  1WXA A;  1E7V A;  2KVR A;  4GLS C;  4BFR A;  5HKH A;  3PRM B;  5H8Y E;  2BF8 B;  2FCS A;  4E74 A;  2BB6 A;  4GDL B;  4DK5 A;  2WGS A;  3TSS A;  5IKC M;  3A9K B;  4LJO B;  2M4N A;  2IBI B;  4GXB A;  1DOX A;  4DXA B;  1FRR A;  2WU5 B;  2OHF A;  3H6N A;  2INP E;  1WJ4 A;  3FIL B;  3CSF A;  3L0W B;  1WGH A;  4WH4 A;  4TQ1 A;  3BK2 A;  2C7M B;  3GP7 A;  2WXR A;  2GBM A;  1CMX B;  2OED A;  4EE2 A;  1WI0 A;  5FR6 A;  2K8B A;  2KTR A;  3AI5 A;  3AEC B;  4K7U A;  3HM6 X;  3U2S C;  3KYC D;  1GNU A;  2K6Q A;  1IBX B;  2MBO A;  2M1M A;  3WAM A;  2IGD A;  4FHJ A;  1EUV B;  1PFD A;  3E56 A;  1MPE A;  1NVI D;  3EUB 2;  4YT0 B;  1VJK A;  3UF8 A;  1J19 A;  4AJW A;  1I4G A;  1MHH E;  3PSE B;  1TGZ B;  4LCD E;  2DX5 B;  2BGF A;  1L4D B;  1NEK B;  3URY A;  3N1Z C;  1RWS A;  3I63 C;  2V3N A;  3ZXR A;  2L7R A;  4ZRQ A;  3ZDT A;  3HRD D;  1OFF A;  2N7E A;  2HD5 B;  3N30 A;  2D2Q A;  2HTH A;  2REX A;  3VTW A;  2BB5 A;  2KLC A;  3PS6 A;  4RGO S;  3P4R B;  2ZW0 A;  2D11 A;  4D2K A;  3GOE A;  3S2A A;  2KO3 A;  5KHO A;  2KYW A;  3WAN A;  3K9P B;  1N5W A;  3IVF A;  1EF5 A;  4C80 A;  2Y5P A;  3JYU A;  1V1P B;  2WYQ A;  1RLF A;  1E7P B;  4BZA A;  2KFJ A;  3KWV A;  2Z59 B;  3DCG A;  4YTM B;  1NEN B;  4A3P A;  2WXF A;  4HVB A;  2CJO A;  3QIJ A;  2FNJ B;  2FID A;  2NBV B;  3Q8B A;  5AUI A;  2G3Q B;  1A5R A;  5JZE B;  3NVY A;  2LFI A;  1T0S C;  4TV3 A;  1FM0 D;  4HK2 A;  5G55 A;  1FEH A;  3UIP B;  2CKH B;  4B95 A;  4ZYS A;  1C9F A;  3T3O A;  1ZPS A;  3AXC A;  4DHZ E;  2NS5 A;  3Q14 C;  5IN7 A;  3Q3J A;  3NZU A;  1ZKH A;  4ANX A;  3DBH B;  3LJ3 A;  4P6V F;  4ICV A;  3B2G A;  3ZXV A;  4B0M A;  4IOI E;  4FJY A;  1EWC A;  3H7P B;  2JU6 X;  1C77 A;  4OW0 A;  3M62 B;  5G5G A;  1MVK A;  1GPX A;  4NNJ B;  1ZW7 A;  3U8Z A;  5I4D A;  1MI0 A;  2ACZ B;  2LAS A;  4GDL A;  4NQL B;  3A9K A;  4W9G A;  2QIE B;  1RFK A;  1XXG A;  4II3 B;  2KJR A;  3AUL A;  2QDF A;  2DYO A;  4G3X B;  4HPM B;  3VUY A;  3PVL A;  5JH5 C;  3FIL A;  4TKN A;  1JQ4 A;  2IO1 B;  3OJ4 B;  1SE2 A;  2J0K A;  3NZ3 A;  1SIJ A;  1GC7 A;  1WF9 A;  2MLB A;  3ZLZ A;  4EFO A;  1GB1 A;  2WXJ A;  3QA8 A;  3NVZ A;  3Q3O C;  3ZJV A;  3KYD D;  2XNA C;  2MBH A;  3JSV B;  2MH7 A;  1LFD A;  2PE6 B;  2PTL A;  3DHI C;  5CHF A;  3VTV A;  1HEZ E;  5J18 A;  5EE0 A;  2B76 B;  3DDC B;  4L1B A;  1IBX A;  1WGG A;  3KUD B;  2KNB A;  1TS4 A;  3Q69 A;  3AEA B;  1QF6 A;  5CTR C;  4RFB A;  2D10 A;  1XO3 A;  2N1V A;  1T3Q A;  2E3T A;  3IAS 1;  4M00 A;  5D7G A;  3M95 A;  1TZO A;  2VRR B;  3RMK C;  1WJ6 A;  4ICU A;  1JML A;  1U4A A;  5DPT A;  1SJE D;  1HZ5 A;  2ZPY A;  4NJC A;  5E6N A;  1J0G A;  5H92 C;  1IYF A;  2PJH A;  1WR1 A;  1OQY A;  2TSS A;  3W1Y A;  4IKG A;  4M02 A;  3V05 A;  4HEA 1;  2ZNV B;  4FLH A;  2PPH A;  3IT4 B;  3MP9 A;  3V60 A;  2QIL A;  3LB8 C;  1HXY D;  2KWV B;  2PKO A;  3ENE A;  4REZ A;  3ZJU A;  4ZHP A;  4OVU A;  1SE9 A;  2IGH A;  1RAX A;  2WHI A;  4MT5 A;  5LNK 1;  2M8S A;  1TY2 A;  3OJ3 A;  2JYE A;  2WX0 A;  4TUU A;  3MC9 A;  4DDI D;  1L0X B;  2M56 B;  1T6B X;  3AM9 A;  4PYZ A;  2LRW A;  1V1P A;  4NQK E;  1CZP A;  3ZYY X;  1F52 A;  5KHQ A;  1MFW A;  4YSY B;  2V4I B;  3DWM A;  1FXI A;  1P9D U;  3AE5 B;  4ANU A;  4MH0 E;  2R61 A;  4RGT A;  2MQJ A;  2ZCB A;  3KUZ A;  4WJP A;  2V4L A;  1K8R B;  3SD5 A;  1V8C A;  4CYE A;  1LQB A;  1SB3 C;  4ZYN A;  3EC8 A;  3ZUN A;  3VTU A;  3UIO B;  4ITK A;  3JW0 X;  3B9J A;  4OVZ A;  2WU2 B;  1NYQ A;  2AWT A;  3TEW A;  3BIN A;  4W9E A;  3P42 A;  4GU2 A;  4XWT A;  2IGG A;  3PZ8 A;  4YTN B;  4XDD A;  3WAL A;  1WMH B;  3H7P A;  2K9X A;  1YIW A;  2WXH A;  3R7R A;  2CHZ A;  2W82 A;  1WYG A;  5G2N A;  5L95 C;  1XLP A;  4JL9 A;  1EU3 A;  1JWB D;  3MFG A;  4XZ4 A;  1TTN A;  2AX5 A;  3EHV A;  1B1Z A;  1ZDX A;  4B9K A;  4ASW C;  2ICI A;  3GS2 A;  2KDB A;  4M8M A;  1P0R A;  1TJE A;  1NBF C;  2K0P A;  4ACF A;  2LGY A;  1F2R C;  2Q5W D;  4US9 A;  4PS7 A;  1PQS A;  1WRD B;  1YJJ A;  3MC0 B;  1WY8 A;  4HCP B;  1TS2 A;  3W5V B;  2RSU A;  4ARI A;  4CO7 A;  2BWE S;  4KSK C;  3TEX A;  3GE3 C;  1WIA A;  2D5G A;  2JSV X;  3JSV A;  1KRH A;  4C7Y A;  4A3O A;  4FA6 A;  1TS5 A;  3C8Y A;  2RD0 A;  3H8H A;  1UZX B;  2BYE A;  3QAQ A;  3NJT A;  2KC1 A;  1L4Z B;  1I4X A;  2KK8 A;  4RF1 A;  4OHJ A;  3VR9 B;  3SU8 X;  2WP9 B;  4IW0 A;  3QX1 A;  4UDU C;  2N1W A;  2ZVN A;  3R8B A;  2KX0 A;  2MJD A;  2N7J A;  2AQ3 B;  1HE8 A;  3H9D A;  5AZH A;  1N5X A;  3VR8 B;  4EKU A;  3QJZ A;  1JAL A;  3BII D;  4C56 C;  1C3T A;  2K1F A;  3L10 B;  1QIL A;  3VVW B;  4IM3 A;  4LNN A;  4JLC A;  4GMV A;  1YN3 A;  3UIN B;  3PO0 A;  1SBB B;  2BYF A;  3I3T B;  3R2I A;  3AE7 B;  1Z2M A;  2D3A A;  4GDK B;  2LGX A;  3HUI A;  3OAW A;  1FNU A;  5E6O A;  3WCQ A;  4RMA A;  1NDD A;  5DPR A;  2O2V B;  4W9K A;  3Q8E A;  1XT9 B;  4KGR A;  4USA A;  1K52 A;  3T9L A;  1Y8R C;  3IHP C;  2YLM A;  5CX3 A;  4RGM A;  3P4Q B;  3E9S A;  4FUL A;  4JGH B;  4M01 A;  2J42 A;  5HI1 A;  2KX3 A;  3NOB A;  3CWI A;  3ZW3 A;  2WDR B;  1TKG A;  2GMI C;  3AMZ A;  4WJQ A;  3L13 A;  4FN2 A;  2JY6 A;  3KQ4 A;  4KVG B;  1VZ6 A;  3HHM A;  1F77 A;  1VLB A;  2LJ5 A;  3NUH B;  1GJZ A;  3R3M A;  4S17 A;  4DHZ B;  2GLS A;  3VXW A;  4AJY B;  4NAW B;  4HCN B;  2LI5 A;  4KKJ A;  2JT4 B;  2LVQ A;  1ZXH A;  1Q1O A;  4FHK A;  1WMH A;  2BPS A;  3PZ7 A;  1E8Z A;  2L8J A;  1DGJ A;  2AL3 A;  4ZHO A;  1T0Y A;  5JHA A;  3DBL B;  1OTR B;  1V1O A;  2ZCC A;  2Z8L A;  4WWO A;  1KF6 B;  4B6W A;  1Q0W B;  1FXT B;  3VQI A;  4ZOH C;  4WJN A;  3PPA A;  1KM7 A;  3JVZ X;  3M63 B;  1JWU D;  2DYM A;  4FAD A;  2DAF A;  2WXI A;  3PRP B;  4LJP B;  1XEE A;  1YMH E;  3B0A A;  4XDC A;  1V86 A;  1C76 A;  2L1A A;  2A4Z A;  3ZTD A;  2N4F A;  3MHZ A;  3WIM A;  1SXT A;  4G0N B;  4OVV A;  2FUG 1;  5BO4 B;  1JW9 D;  4EZK A;  4K7S A;  1MHX A;  2Z0D B;  1T0Q C;  3NS8 A;  2I1K A;  1GUA B;  5BMI A;  4MAC A;  4RH6 A;  1SE3 A;  1V80 A;  3AE2 B;  1WSP A;  3ML8 A;  2DZK A;  1JWM D;  4WWP A;  2OOB B;  2RDG A;  1WXM A;  2DZM A;  2KXJ A;  2QEJ C;  3DWG C;  2L52 A;  3AED B;  4NAM A;  4BKS A;  3TIX A;  1V2Y A;  5IOI A;  4JX1 C;  2JVC A;  3DVG Y;  4W9I A;  3RZW C;  2I38 A;  3ZNZ B;  3VH4 B;  4I6L B;  4DBG A;  2BTE A;  3PRE A;  1TYG B;  3PZD A;  2PVG C;  4KV2 A;  4WAA A;  2K8C A;  2ZW1 A;  2JXX A;  1M94 A;  3RNE C;  1YJ1 A;  1C4A A;  2C5L C;  3MHS D;  1F1H A;  3GE8 C;  1XLQ A;  4GDK A;  5LXH A;  2EMS A;  1J7A A;  1K53 A;  4I6P A;  3DVN U;  4WUR A;  4KIK B;  2VZK B;  4NJ6 A;  5BYQ A;  2MP2 B;  2HJ1 A;  2O2V A;  5HHD G;  4N9F 4;  1ESF A;  4W9L A;  5D3I B;  2WX1 A;  4LDT D;  1GAQ B;  3ALB A;  2N7D A;  2L05 A;  4G50 A;  3P2B A;  3P4S B;  3FKY A;  3BVM A;  1ET6 A;  3VDZ A;  2RDB C;  3QAR A;  1TS3 A;  3RN9 C;  1L6U A;  4C00 A;  3DQV A;  2K22 A;  4MSQ B;  2UU7 A;  2LVP A;  3LYY A;  3BZD B;  3FC4 A;  2B3A A;  1XD3 B;  3RFZ B;  1P7E A;  2LGS A;  2G4S A;  1P1A A;  1YQ3 B;  2LWP A;  4ZDV A;  1QOA A;  1VD2 A;  1SEB D;  3Q3M C;  4ANV A;  4KZC A;  1UGJ A;  1AN8 A;  4LTU A;  2CU3 A;  1GC6 A;  3NY5 A;  1TZ1 A;  5AZG A;  4NAW A;  3X23 A;  3K9O B;  2FBW B;  2MBB B;  4PS3 A;  4A9A A;  1V9J A;  2QJL A;  1UD7 A;  4M0W B;  1WX8 A;  2MBQ A;  1L2N A;  3RNF C;  1E0Z A;  3C19 A;  2D3G A;  2RPQ A;  4URK A;  2J7Q B;  2KFK B;  4H2A A;  1JRP A;  2NMQ A;  2WXK A;  2ZNV C;  2MSE D;  1ISN A;  3QWZ B;  1N61 A;  1WGK A;  2MRP A;  4A20 A;  3EEC A;  1AW7 A;  1BXT A;  4MJS B;  4W9F A;  1LXD A;  2BKF A;  2DWQ A;  2JPH A;  4HDO A;  1IGD A;  3NZS A;  1NI3 A;  2BKR B;  2Y3A A;  2MCN B;  2LZ6 A;  2JRH A;  2W3S A;  4W9C A;  4MEL A;  2KDE B;  3TCA A;  3DPD A;  1V5T A;  5DCN A;  2RDH A;  5BYS A;  2JUO A;  4IC7 B;  2KOX A;  1FNW A;  1UH6 A;  3Q8A A;  2GBJ A;  4J3O D;  2KDM A;  1WM3 A;  2QC8 A;  4P1C C;  3TMP B;  3VAW A;  2WXM A;  1QOF A;  4X57 B;  2J53 A;  4GB9 A;  3WA0 A;  1UUP A;  1UNS A;  2JQR B;  4KZ0 A;  3KW5 B;  1TKE A;  2GI9 A;  1HTO A;  2E6X A;  4BKS D;  2QHO A;  1SJH D;  1EM7 A;  4BOS C;  4II2 B;  3PLU A;  3ONS A;  1P98 A;  3VRB B;  1MG8 A;  4WWM A;  3EGR A;  4OZC A;  5IA7 A;  4DWF A;  5AUK A;  4HKZ E;  5JHB A;  4YSX B;  1OEY J;  2IY0 B;  1LM8 B;  2Z0E B;  1S1Q B;  1UEL A;  2W9N A;  1GOZ A;  4MH8 A;  4JPS A;  2MBE A;  4A90 A;  4RF0 A;  3BK1 A;  4JWS C;  4WJO A;  3Q2A C;  3U52 E;  4IWO A;  1AWD A;  1TIF A;  2QMT A;  1VZ7 A;  2ZPN A;  1WJU A;  4KSL C;  2AQ2 B;  3IAM 1;  1NI2 A;  4US8 A;  4HPP A;  2K39 A;  2NCN A;  4NY0 A;  2LXC A;  1E8X A;  4KIK A;  2LUE A;  2N0S B;  3SFE B;  4WWN A;  1ROE A;  1VR9 A;  2MP2 A;  4IG7 B;  4YXD B;  2M0X A;  3AE9 B;  4MGY E;  1PYW D;  1H4R A;  2L0F A;  3OWE B;  1V6E A;  4LNK A;  2WXQ A;  2W3R A;  1ZP0 B;  3VRA B;  1YN4 A;  2KDI A;  2C7H A;  1E8W A;  3UI3 A;  4AWJ A;  5IAA C;  4BOZ B;  4K81 A;  2PW9 A;  4N6E B;  2JF5 A;  4LDT B;  3WAO A;  5FK9 C;  1FIQ A;  1CK1 A;  2M0A A;  3AE6 B;  2GRI A;  2LUM A;  2RGF A;  3LDZ E;  3N20 C;  3RNC C;  3AEE B;  3BVG A;  2DAJ A;  1FD6 A;  2X8X X;  1FO4 A;  1FMA D;  4NPN A;  4EZL A;  3L54 A;  3TEZ A;  2KJH B;  4W9D A;  2IZV B;  3V6E B;  1WGY A;  2D3B A;  2NTS A;  3NS1 A;  3I57 A;  4DXG A;  1J7B A;  2KMC A;  4M0W A;  2GBK A;  4DHJ B;  2BT6 A;  1GG3 A;  3M3J A;  2MEK A;  5DPS A;  1H8C A;  2WNM A;  2BWF A;  2KFK A;  3U4E G;  3R7Q A;  2DHZ A;  4ZRP A;  3QQ8 B;  1X1M A;  1WXV A;  3C0R B;  2VH2 A;  4MJS A;  1JCK B;  1WJN A;  2I1J A;  4KX6 B;  3RNG C;  1KLV A;  1I4P A;  3DBS A;  1EF1 A;  2IY1 B;  3TBL D;  2WDT B;  3ZQ4 A;  1XLN A;  3D32 A;  3AE4 B;  3BWU D;  3O13 A;  3ZGZ A;  3H7S A;  5LXI B;  3N1X C;  3W2D A;  1DOI A;  4FXC A;  1QT9 A;  4LLG M;  5TR5 A;  2V3S A;  2CS4 A;  3AU4 A;  3QC8 B;  1L5P A;  4LK0 M;  2L83 A;  1JWS D;  2KTF A;  1WE7 A;  4P7I A;  3V3X A;  2JWZ A;  1N62 A;  2G45 B;  3BYY B;  3L16 A;  2KN5 A;  2K6D B;  1YQ4 B;  4RNA A;  1WM2 A;  1E7U A;  4ZRJ A;  3UGB B;  4MGZ E;  3A4R A;  1WZ3 A;  2BBC A;  3I9V 1;  1TT5 B;  3H1U A;  2YEP B;  3ZNH B;  3R2T A;  1WZ0 A;  1I42 A;  3Q3F A;  2ZJD A;  1RRB A;  4F1S A;  1E8Y A;  3MJ5 A;  2VZK D;  4JIO U;  2J4X A;  2SEB D;  4KKI A;  1JWA D;  3PV1 A;  1N60 A;  1C4P A;  2V3P A;  3NVW A;  2RPV A;  4FJV B;  4XWW A;  4KGT A;  4L2Y A;  5L83 A;  3R66 C;  2G1E A;  1T0R C;  1EU4 A;  4XE0 A;  5EE3 A;  2KVZ A;  2LVO A;  2W54 A;  3MTN B;  3RYT A;  2EEL A;  1Y56 A;  1I7H A;  1ZE3 D;  1D3Z A;  1SF0 A;  2N9K A;  1XF5 L;  4GGQ A;  1UBI A;  3RUL A;  2CJN A;  2D07 B;  3TJP A;  3KH0 A;  4MDK E;  3O65 B;  2BS4 B;  4MGK E;  1M4V A;  1WH3 A;  4K3B A;  3HK0 A;  2N9E B;  5AZF A;  1VZ8 A;  5GXG B;  1TBE A;  1S3S G;  3VHT C;  4A55 A;  3DVG X;  4TQ0 A;  1HQR D;  4BAX A;  3P63 A;  5D94 A;  4E3C A;  1NYR A;  1TY0 A;  2AEH A;  2WS3 B;  4WQM A;  1R4N I;  1WR6 E;  3AEG B;  3EFU A;  1OEY A;  3N3K B;  2LRU A;  1YD8 U;  2HDE A;  2K3U A;  3B08 A;  2KHW B;  4N58 A;  1WXS A;  4IM0 A;  3EFC A;  3VH3 B;  2FUH B;  4O1N A;  1YOV B;  1YX6 B;  2XBB C;  4TMA B;  4F7Z A;  2SAK A;  2JYT A;  1N63 A;  2K5P A;  1C79 A;  2YVC A;  3DBH I;  2BYT A;  2ZZP B;  5EE1 A;  1Q5W B;  2HTM E;  4HRO A;  5BYR A;  3N1Y C;  4G11 A;  3QHT A;  2GBN A;  4LNF A;  2OJR A;  2PMV A;  2CU1 A;  4YTP B;  3A1Q B;  1K50 A;  4CQN A;  2M19 A;  1PGB A;  2KC2 A;  4K7W A;  3VFK A;  1AYF A;  1YQB A;  5DPW A;  2WXO A;  4PS8 A;  2PE9 A;  1QKZ A;  2KN4 A;  4N59 A;  1STE A;  1YN5 A;  4YL8 A;  4HLE A;  1Z5S B;  2LMC A;  2BQQ A;  5G5H A;  4DXF A;  2QSD A;  3AB5 A;  3L08 A;  2IO2 B;  1QLB B;  1L0Y B;  2NBW B;  4MEM A;  4OZA A;  1OQR A;  2NTT A;  4CHK A;  4LNO A;  1VDV A;  2L76 A;  3P4P B;  2UYZ B;  5IP4 D;  3RNB C;  4BVU C;  3OG5 A;  3PT2 B;  2L3Z A;  1RM6 C;  2LJI A;  3BYT B;  3V6C B;  3EA6 A;  3CST A;  3L17 A;  2ON8 A;  1BUI C;  2KKC A;  3PTF C;  4OZB A;  2JZ3 B;  4EZJ A;  2BS2 B;  3DBR I;  5FKA C;  3A4S C;  4RM9 A;  1I4H A;  4WQO B;  5EDS A;  1UF0 A;  1FPY A;  1AAR A;  3TEY A;  1FNV A;  1JRO A;  4RCO A;  1SE4 A;  2XEW A;  1WFY A;  3ZNI D;  2KT7 A;  3APC A;  1KJT A;  2FCM A;  4M8N A;  4ANW A;  4LNI A;  1G6J A;  1P7F A;  1GB4 A;  1KFY B;  3U30 A;  2MA9 B;  4P16 A;  5E6J A;  1WXQ A;  2V0G A;  2H89 B;  1EO6 A;  4R3D A;  2LGI A;  2FIF A;  2IO3 B;  3VUX A;  3P1M A;  1V97 A;  3A33 B;  4W9H A;  2KMA A;  2FE8 A;  2FCN A;  2L00 B;  1FFV A;  2MWS B;  2KLG A;  3NRZ A;  2UWQ A;  3ECI A;  2IO0 B;  3LXF A;  1D5M C;  3RCZ A;  3IBE A;  3UQA A;  3RI7 C;  1WWT A;  3B1L X;  1Q10 A;  4XYC A;  3DHG C;  3A9J B;  1R4N B;  4DHJ D;  2KQ4 X;  2DEN B;  3KLS X; 
#chains in the Genus database with same CATH homology
 2GB1 A;  2BB6 A;  1L4Z B;  1I4X A;  4GDL B;  2N0S B;  3TSS A;  3SFE B;  2IJ0 A;  2WXN A;  4RF1 A;  4DQO C;  1ROE A;  1VR9 A;  5HFY A;  4OHJ A;  4YXD B;  3VR9 B;  1DOX A;  1FRR A;  2WU5 B;  3AE9 B;  3AV8 A;  2WP9 B;  4TSS A;  1PYW D;  2OHF A;  2INP E;  3FIL B;  3OWE B;  1HZ6 A;  1YNT E;  2WXQ A;  2MJE A;  2W3R A;  4UDU C;  1ZP0 B;  3VRA B;  4WH4 A;  1YN4 A;  5MPO A;  4TQ1 A;  3BK2 A;  3R8B A;  3GP7 A;  3UI3 A;  2MJD A;  2WXR A;  2N7J A;  2AQ3 B;  2OED A;  4HKQ A;  4EE2 A;  2LHD A;  1N5X A;  3VR8 B;  2PW9 A;  1JAL A;  4N6E B;  3BII D;  4C56 C;  1D6E C;  1FFU A;  5FK9 C;  1FIQ A;  2DLB A;  3W1S A;  1CK1 A;  2M0A A;  3B2F A;  3AEC B;  3AE6 B;  2GRI A;  1QIL A;  3TUO A;  5EE9 A;  2WXG A;  3U2S C;  2LUM A;  1YN3 A;  3PO0 A;  1IBX B;  3AEE B;  1E9M A;  2RMM A;  1SBB B;  3R2I A;  3AE7 B;  1BML C;  1IGC A;  3BVG A;  2WXL A;  3IXS A;  2IGD A;  4GDK B;  3HUI A;  4NZL B;  1FD6 A;  1FNU A;  1PFD A;  3RPF C;  3E56 A;  3Q8C A;  1MPE A;  1NVI D;  3EUB 2;  2AQ1 B;  3NVV A;  3BVZ A;  4YT0 B;  1VJK A;  1FO4 A;  3WCQ A;  1FMA D;  3TEZ A;  1I4G A;  3Q8E A;  1MHH E;  3N9Y C;  2NTS A;  3NS1 A;  3I57 A;  4DXG A;  1J7B A;  3FAH A;  4KGR A;  4USA A;  1ACC A;  1K52 A;  4M0W A;  2BT6 A;  4RGM A;  2MEK A;  1L4D B;  3P4Q B;  1NEK B;  1PGA A;  3E9S A;  1PDX A;  3URY A;  1RWS A;  2WNM A;  3AE1 B;  2V3N A;  3U4E G;  4ZRQ A;  2J42 A;  5HI1 A;  1SSN A;  3HRD D;  1ZXI A;  1OFF A;  1VRA B;  1UWM A;  4ZRP A;  3CWI A;  2WDR B;  1TKG A;  3AMZ A;  1TKY A;  1JCK B;  3AN1 A;  2BB5 A;  4YWG G;  4RGN A;  4RGO S;  1D5X C;  4KX6 B;  3W9C B;  3P4R B;  2ZW0 A;  1UWX A;  3KQ4 A;  1VZ6 A;  1DOY A;  4D2K A;  1I4P A;  1F77 A;  1VLB A;  3NUH B;  4MM3 B;  3GB1 A;  1N5W A;  3ZQ4 A;  5HG2 A;  2WLB A;  1DYQ A;  4NAW B;  1E10 A;  4C80 A;  2Y5P A;  1XLN A;  1V1P B;  4KKJ A;  2JWU A;  1E7P B;  1ZXH A;  3AE4 B;  3BWU D;  2BS3 B;  3O13 A;  3ZGZ A;  4JE3 B;  5BMH A;  3KWV A;  3KWL A;  3PZ7 A;  2PLP A;  1DGJ A;  2KAC A;  3W2D A;  4ZHO A;  1DOI A;  4YTM B;  1NEN B;  1FCL A;  4FXC A;  1QT9 A;  4LLG M;  1ET9 A;  2WXF A;  2CJO A;  1V1O A;  3SFD B;  5T8I A;  3Q8B A;  1L5P A;  4LK0 M;  5AUI A;  2Z8L A;  2L83 A;  1JWS D;  3V3X A;  1KF6 B;  3NVY A;  4C7Z A;  3VQI A;  1N62 A;  4ZOH C;  2LFI A;  1L6V A;  3BYY B;  1FM0 D;  1YQ4 B;  2G9H D;  1JWU D;  4RNA A;  1FEH A;  2DYM A;  4ZYS A;  1C9F A;  3T3O A;  1ZPS A;  1F2R I;  2WXI A;  2I2Y A;  4A6Q A;  2BBC A;  3I9V 1;  2BW2 A;  4KGS A;  2YEP B;  1XEE A;  1YMH E;  5FR3 A;  3R2T A;  4XDC A;  1C76 A;  2L1A A;  4P6V F;  1K51 A;  3MHZ A;  3B2G A;  2X38 A;  1SXT A;  3MJ5 A;  2VZK D;  2J4X A;  4JWU C;  4B0M A;  4IOI E;  2SEB D;  4KKI A;  1EWC A;  1C4C A;  2FUG 1;  1E6E B;  2JU6 X;  1JWA D;  1JW9 D;  1C77 A;  4OW0 A;  2EKI A;  5G5G A;  1MHX A;  1C4P A;  1MVK A;  1N60 A;  2V3P A;  3NVW A;  2RPV A;  1GPX A;  4XWW A;  4KGT A;  4L2Y A;  2WXP A;  5I4D A;  2G1E A;  1EU4 A;  4XE0 A;  5EE3 A;  1MI0 A;  2WDV B;  3L4P A;  2ACZ B;  4YSZ B;  3SR6 A;  2W54 A;  2EEL A;  5BMI A;  3AE3 B;  4MAC A;  1Y56 A;  4RH6 A;  1SE3 A;  1I7H A;  1ZE3 D;  1SF0 A;  3AE2 B;  1WSP A;  2QIE B;  1RFK A;  1XXG A;  2N9K A;  1XF5 L;  3AEF B;  1JWM D;  2RDG A;  2DBY A;  2CJN A;  2DYO A;  1J7C A;  1WRI A;  1CQV A;  3FIL A;  1JQ4 A;  2QEJ C;  3DWG C;  3Q8F A;  2L52 A;  1B9R A;  1ZOY B;  2BS4 B;  1XCQ L;  1SE2 A;  1PUT A;  3AED B;  1M4V A;  1KLU D;  1C78 A;  4NAM A;  1OQQ A;  3NZ3 A;  4JX1 C;  1SIJ A;  1T5X D;  1GB1 A;  2WXJ A;  2I38 A;  3NVZ A;  1LO5 D;  1HA5 A;  5H8Y E;  1VZ8 A;  3ZJV A;  5GXG B;  1KLG D;  2XNA C;  4A55 A;  2BTE A;  1CJE A;  4TQ0 A;  1TYG B;  1HQR D;  2MH7 A;  4HJG E;  3P63 A;  2PVG C;  4AQ7 A;  2PTL A;  2ZW1 A;  1HEZ E;  5EE0 A;  2B76 B;  3AEB B;  1NYR A;  1TY0 A;  2WS3 B;  4WQM A;  4L1B A;  1IBX A;  3AEG B;  1C4A A;  1TS4 A;  3HVD A;  1XLQ A;  3Q69 A;  1F0Z A;  3AEA B;  1J7A A;  1QF6 A;  1K53 A;  4WUR A;  2IDY A;  4RFB A;  2VZK B;  2HDE A;  1XO3 A;  1T3Q A;  2K3U A;  2E3T A;  3IAS 1;  5BYQ A;  2JZP A;  2KMM A;  5D7G A;  4N58 A;  1ZDV A;  1QQR A;  5HHD G;  1I4Q A;  1ESF A;  1TZO A;  3AE8 B;  4O1N A;  5D3I B;  4TMA B;  5C2T B;  4ARC A;  1JML A;  1XLO A;  1GAQ B;  1FXA A;  4A8X C;  2MJ3 A;  2SAK A;  2JYT A;  1N63 A;  1SJE D;  3P4S B;  1HZ5 A;  3SEB A;  4NJC A;  2K5P A;  3BVM A;  1ET6 A;  1C79 A;  2BYT A;  5H92 C;  1L0V B;  5EE1 A;  1TS3 A;  5D3D A;  2HTM E;  1L6U A;  4AS1 A;  4HRO A;  2TSS A;  2K22 A;  4Q2J A;  5BYR A;  4IKG A;  3LYY A;  3V05 A;  1D5Z C;  2YEP F;  4HEA 1;  3BZD B;  4HRS A;  3FC4 A;  3IT4 B;  3RFZ B;  3MP9 A;  1P7E A;  4IDI A;  1FRD A;  2QIL A;  3LB8 C;  1HXY D;  1YQ3 B;  2PKO A;  1ENF A;  2PMV A;  4REZ A;  3ZJU A;  4ZHP A;  2Y5C A;  4YTP B;  1QOA A;  1K50 A;  3CIR B;  4CQN A;  2IGH A;  1R7S A;  2M19 A;  3ABV B;  4MT5 A;  4B0E A;  1PGB A;  5LNK 1;  1PGX A;  1TY2 A;  1SEB D;  1UGJ A;  2JYE A;  1AN8 A;  4LTU A;  2CU3 A;  4WAF A;  1L0X B;  1AYF A;  1KTK A;  2M56 B;  3HVZ A;  1T6B X;  2WQY B;  3AM9 A;  2FBW B;  2IPK D;  1V1P A;  1CZP A;  1ZUD 2;  2KWD A;  2WXO A;  4A9A A;  2QJL A;  4L23 A;  3ZYY X;  3IT6 B;  2W55 A;  1E0Z A;  4YSY B;  1YJI A;  2V4I B;  1QKZ A;  2KN4 A;  1FXI A;  1STE A;  1YN5 A;  2J52 A;  2JX5 A;  3DWM A;  4N59 A;  3AE5 B;  2LEK A;  2LMC A;  2KAJ A;  2R61 A;  3J9C A;  1JRP A;  2JXT A;  4H2A A;  5C3J B;  4RGT A;  2PVO D;  5G5H A;  2NMQ A;  2WXK A;  2H88 B;  4DXF A;  2QSD A;  3AB5 A;  3AH7 A;  1QLB B;  1A70 A;  1IUE A;  1L0Y B;  1V8C A;  1N61 A;  1WGK A;  1KH0 A;  1SB3 C;  1AW7 A;  1BXT A;  4OZA A;  1OQR A;  2NTT A;  2DWQ A;  1IGD A;  1NI3 A;  3ZJT A;  2Y3A A;  1VDV A;  1QOB A;  2W3S A;  4ITK A;  3P4P B;  3B9J A;  4OVZ A;  2WU2 B;  1RM6 C;  2LJI A;  1NYQ A;  3BYT B;  3TEW A;  3T3N A;  3EA6 A;  2RDH A;  5BYS A;  3P42 A;  1RYJ A;  2ON8 A;  4XWT A;  1BUI C;  1FNW A;  2LHE A;  2XN9 C;  3U7Z A;  2IGG A;  3PZ8 A;  3Q8A A;  4J3O D;  2KDM A;  1EWY C;  4YTN B;  4OZB A;  4PT5 A;  4XDD A;  2BS2 B;  5FKA C;  1I4H A;  2WXM A;  1QOF A;  5BMG A;  2K9X A;  2J53 A;  2WXH A;  2W82 A;  1WYG A;  3ETR A;  5TSS A;  3TEY A;  1FNV A;  1JRO A;  4RCO A;  1SE4 A;  1XLP A;  1UUP A;  1UNS A;  2L32 A;  1EU3 A;  1JWB D;  2JQR B;  2INN E;  3MFG A;  1TKE A;  2AX5 A;  2GI9 A;  4WIP A;  2E6X A;  1B1Z A;  2ONQ A;  1ZDX A;  3W5U B;  1SJH D;  1EM7 A;  2ICI A;  3GS2 A;  3VRB B;  1P7F A;  1GB4 A;  1KFY B;  1TJE A;  4WWM A;  1XCT L;  3EGR A;  4OZC A;  2N9L A;  4P16 A;  5E6J A;  1WXQ A;  5JXV A;  2K0P A;  2V0G A;  5AUK A;  4HKZ E;  2H89 B;  4YSX B;  4R3D A;  1F2R C;  2LGI A;  2Q5W D;  1D4B A;  4US9 A;  3P1M A;  1YJJ A;  1V97 A;  3MC0 B;  2FE8 A;  1GOZ A;  4MH8 A;  1FCC C;  4JPS A;  1TS2 A;  3W5V B;  2WDQ B;  4A90 A;  4RF0 A;  3BK1 A;  4JWS C;  1FFV A;  1I4R A;  4ARI A;  3U52 E;  1AWD A;  3NRZ A;  2QMT A;  1VZ7 A;  1QOG A;  2PIA A;  3TEX A;  2D5G A;  1D5M C;  2JSV X;  3LXF A;  1KRH A;  4C7Y A;  2AQ2 B;  1WWT A;  1TS5 A;  3C8Y A;  1Q10 A;  3IAM 1;  3H8H A;  4US8 A;  4GLS C;  2KQ4 X;  3KLS X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...