1FRDA

Molecular structure of the oxidized, recombinant, heterocyst (2fe-2s) ferredoxin from anabaena 7120 determined to 1.7 angstroms resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
ASYQVRLINKKQDIDTTIEIDEETTILDGAEENGIELPFSCHSGSCSSCVGKVVEGEVDQSDQIFLDDEQMGKGFALLCVTYPRSNCTIKTHQEPYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HETEROCYST [2FE-2S] FERREDOXIN
publication title Molecular structure of the oxidized, recombinant, heterocyst [2Fe-2S] ferredoxin from Anabaena 7120 determined to 1.7-A resolution.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
total genus 29
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1993-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1frdA00
1KFYB 1V97A 4A9AA 1YQ3B 1IUEA 3NVYA 1JWAD 5C3JB 1L6VA 3AMZA 1VJKA 4N59A 1FM0D 3WCQA 4WQMA 3NVWA 1YJJA 1FRDA 2W3RA 3AECB 1FFVA 2JQRB 1XLPA 1E9MA 3PO0A 5G5GA 3AEGB 5AUKA 1L5PA 2KMMA 3P4PB 2WQYB 1DOYA 3ABVB 2L52A 2LEKA 2BT6A 2EKIA 1VDVA 4YTPB 3FC4A 3DWMA 4ZHPA 2W3SA 4YXDB 2WLBA 1XO3A 5C2TB 2PVGC 5H92C 3P63A 2WU2B 1TKEA 2L83A 1TKYA 1I7HA 2MJDA 1YJIA 1KF6B 1OFFA 3CWIA 2DBYA 3B2FA 4C80A 1VLBA 4YTMB 3KWLA 3EUB2 3NS1A 1UWMA 2WP9B 1OQQA 2QJLA 3CIRB 4C7YA 1GPXA 1NYRA 1RM6C 1CJEA 1R7SA 3VR9B 5G5HA 4KX6B 2DWQA 4IDIA 1QOAA 4N6EB 2MJ3A 3RPFC 3BIID 2MJEA 1QOBA 1QLBB 1SF0A 3AE2B 3HUIA 2B76B 1N5XA 3SFDB 4N58A 4ZHOA 2FBWB 2JX5A 1FO4A 1AYFA 2ACZB 1V8CA 1PDXA 3HVZA 1N62A 3W9CB 3AE4B 1DOIA 2AX5A 2PKOA 1JROA 4FXCA 4JWSC 1GAQB 3AE5B 3FAHA 1FXIA 3LB8C 5EE9A 2W55A 2CU3A 1T3QA 1WXQA 3SR6A 2N0SB 1QOFA 1E10A 3P1MA 1XLOA 2BS3B 1JWBD 1ZXIA 2WDVB 1RWSA 1FXAA 2HTME 1ROEA 3AN1A 3P4SB 5EE0A 1J7CA 1FIQA 1J7AA 3AE3B 1NI3A 2WDQB 5EE3A 2BS4B 2KAJA 3DWGC 2PVOD 1WGKA 3AEAB 3AEFB 3SFEB 1XLQA 3AE1B 3ZYYX 1DOXA 1JW9D 2Y5CA 1NVID 2WU5B 1E0ZA 2K9XA 1WWTA 1EWYC 2BS2B 1L6UA 3AV8A 2W54A 2M56B 4YSZB 3LXFA 2K22A 2PIAA 2QIEB 1FMAD 4WWMA 1N5WA 3AE8B 3AE6B 3AH7A 3HRDD 4ITKA 4JX1C 4YTNB 3W5UB 3P4QB 1AWDA 1A70A 1F0ZA 1TKGA 1WYGA 3AEDB 1NENB 2E3TA 4YT0B 1QF6A 1SB3C 4HRSA 1CZPA 1ZOYB 4C7ZA 1NYQA 1L0VB 2H89B 4US8A 2H88B 1FRRA 5AUIA 1JQ4A 1B9RA 3AB5A 3VRBB 1TYGB 1ZUD2 1J7BA 2K5PA 2G1EA 1DGJA 1FFUA 1PFDA 2Q5WD 2WS3B 5H8YE 3NRZA 3AE7B 1QT9A 4USAA 3AEEB 3AE9B 3ETRA 1WRIA 1OQRA 4US9A 1KRHA 3B2GA 3L4PA 4HROA 4YSYB 5MPOA 4YSXB 2M19A 3AM9A 3W5VB 1TJEA 2CJNA 4ZOHC 3AEBB 1PUTA 3NVVA 1N61A 5EE1A 3VR8B 1NEKB 3B9JA 3VRAB 4LTUA 2CJOA 1JALA 4P6VF 1N63A 1N60A 2MH7A 3P4RB 5GXGB 1E7PB 1RYJA 4JWUC 1JRPA 1RFKA 1XLNA 1YQ4B 1ZP0B 2WDRB 3NVZA 1SIJA 2OHFA 1E6EB 1QOGA
chains in the Genus database with same CATH superfamily
4MEMA 3VH3B 2UU7A 1UUPA 4GSWA 4KZCA 1VZ7A 3NVWA 1P3QU 4DHZB 2XNAC 1EUVB 2N9XA 2OOBB 3WAOA 2KO3A 1T0SC 4LCDE 2BYFA 2WLBA 3N1YC 3W1SA 3LDZE 4W9LA 1I7HA 4ASWC 3RN9C 2QSDA 4EUTA 2WP9B 1M94A 2DZKA 2ZJDA 3HHMA 1YX5B 2LMCA 2K6QA 1FCCC 2L0FA 2D11A 2O6VD 1F9JA 2B76B 1N5XA 4ZHOA 1MG8A 3A9JB 1HQRD 3R7QA 2KDEB 2CHZA 4FXCA 2KDBA 4JWSC 2Z8LA 2L8JA 3FAHA 3AU5A 1HTQA 1ZPSA 3SR6A 3PVLA 3VRAB 3NJTA 1RWSA 1VD2A 3DBHI 1IBXB 1SGHA 2NR2A 3UINB 3SFEB 2KD0A 2C7NB 3KLSX 2MLBA 3AULA 4KDIC 2B3AA 4PK1A 4RCOA 2R61A 3AE8B 2WXJA 1AWDA 1WX7A 1YD8U 2DZMA 2LJIA 4BZAA 4WURA 4REZA 1SEBD 3S2AA 2PPHA 4NAWB 1E8XA 1KJTA 4FHJA 1SIFA 3APFA 1PGAA 4USAA 2LI5A 4S17A 4US9A 3DCGA 5J2RA 1WI0A 2D5GA 3BYTB 3RFZB 1STEA 4MJSA 3BYYB 1Q1OA 3BK1A 3NVZA 4NAMA 3U30A 5BYRA 4CQNA 2WXGA 5AZHA 4GDLB 3L54A 2KXJA 1TY2A 4K7SA 1L5PA 2JY6A 1I4GA 2C60A 4WIPA 4LJOB 1WXMA 2JT4B 2A5UA 1F52A 1S3SG 4KSKC 3H1UA 4DXGA 2L76A 5D3DA 1EO6A 5T8IA 2WXFA 4IWPA 2DAFA 4MM3B 1IP9A 1HZ5A 2E6XA 2WDTB 3RZWC 4ZYSA 1VZ6A 3ZNID 3WAPA 4RH6A 2D3BA 1ET6A 1NBFC 2INNE 2YVCA 4C4VA 3ZKJC 2FUHB 2INCC 1ZXIA 1ROEA 4LNOA 1YJ1A 3ZXVA 4WQOB 3VHTC 3RULA 3ZDTA 2LHDA 2LRWA 4TMAB 2ZVNA 3ZRFA 2LGYA 4L1BA 1V5TA 1EWYC 1ZKHA 2XK5B 3QWZB 3AE6B 2BYVE 2KK8A 4BFRA 2XBBC 1WYGA 5G55A 2JVCA 3B08A 3HVDA 4F8CB 3AB5A 4LNIA 3VRBB 4B0MA 2GMIC 1WM2A 1J7BA 2JUOA 5CHVC 3AEEB 2KWVB 2WXPA 3MHSD 3NVVA 4XE0A 1TS2A 1TGZB 2XEWA 1L7YA 1QQRA 1N6ZA 1RFKA 4AS1A 4A55A 1SIJA 3DVNV 3QQ8B 1K53A 3AI5A 4GU2A 2KHWB 1HA5A 1TT5B 3T8MA 1PGXA 4W9HA 3IVFA 1CQVA 3DBRB 3A9JA 1P0RA 2WQYB 4WAFA 3PZ7A 2NBVB 2KQSA 4N9F4 3DWMA 2ASQA 2W3SA 4FULA 1XO3A 2WXKA 2QILA 2LGXA 5H92C 3M3JA 2MEKA 3N3KB 4DXFA 2QHOA 2J0MA 1IBXA 1UWMA 2LASA 3L08A 3Q2AC 2EMSA 2NMQA 4IUMB 1WX8A 2ZPYA 2D3GA 1D4BA 1AYFA 3APCA 3E56A 3AE4B 2V4IB 3HIZA 5DPRA 4GIVA 4NAWA 2N7DA 4XWTA 1JWBD 4EE2A 2HTME 4C56C 1BUIC 2ONQA 4BOSC 1NI3A 3BVZA 3AEFB 1SE2A 5BYSA 1V81A 1NVID 4BBNF 1D6EC 2ZEQA 2AQ1B 1HEZE 4W9FA 1E8WA 2K8CA 2GBNA 1PYWD 2LRUA 1PGBA 3WIMA 5JZEB 3V62A 3TUOA 3N1XC 4GDLA 4ZRKA 3LYYA 2KN5A 4KGRA 2BYEA 1ESFA 1DGJA 4IWQA 4ZDVA 3VUYA 3R2TA 2BWFA 5G2NA 5C23A 5MPOA 4MSQB 4BOZB 1YN3A 1RYJA 4HCPB 4MM3A 2BPSA 3VUXA 5IKCM 1LM8B 3BK2A 1T0RC 2PEAA 1FNVA 1TIFA 3EECA 2LHEA 3A9KB 2WNMA 3QIJA 5HKHA 1L0XB 3Q8AA 1HE8A 5J17A 2YEPF 4HEA1 1KM7A 2UWQA 3EHVA 1U4AA 2Z59B 1TZOA 1H8CA 1E7VA 3AE2B 2XK5A 4WH4A 1JWUD 2ZW0A 4AJWA 3T3NA 5EE9A 2MBEA 1WRDB 2Y5PA 5EE0A 3MHZA 3P42A 3TEWA 2BS4B 1TTNA 2DHZA 1WR1A 2JXTA 4HJGE 1TY0A 4DWFA 2BS2B 3DDCB 3NY5A 1F2RI 3HM3A 5BYQA 3DQVA 4P7IA 3MTNB 2GBRA 4IM2A 2KVZA 1P98A 3ALBA 4C7ZA 3PZDA 1WSPA 3Q3OC 4EFOA 3DBLB 2G1EA 2WS3B 2O2VB 4DK5A 1VCBA 5JHAA 3DPDA 5HI1A 4YSXB 3AM9A 2KOXA 3KUCB 2CJOA 2KJHB 2MQJA 2WXOA 1KLVA 2MBOA 4MGKE 3Q3FA 2IZVB 1C1YB 2OHFA 2JXXA 1RFAA 3DHIC 3DHHC 5HHDG 4DHJD 1YNTE 2IPKD 3H7SA 2X38A 2IY1B 2CHWA 4HPLB 2MCNB 4JL9A 1XLPA 4II3B 2JRHA 1GOZA 3N9YC 2LWPA 1CMXB 2L52A 2KC1A 5TSSA 3OAWA 3VH4B 2O6VB 4IWOA 4XC2A 1V5OA 3RNEC 2K3UA 2D2QA 4HKZE 2BB5A 3U2SC 2G45B 3CF6E 4W9KA 3RT3B 1UD7A 4HJKA 1T0YA 3ZUNA 1WF9A 2RSUA 4XGAB 1QKZA 3BIID 1FEHA 2ACZB 2BQQA 1QZEA 3MC8A 2V3PA 3TEYA 3R66C 4TQ0A 5IO9A 1UBQA 3P4SB 4EZKA 5LXHA 5EE3A 5AZFA 2L05A 2DYBA 2KANA 4CYEA 1S1QB 2LVPA 1I42A 2D3AA 3KUZA 4Q2JA 1Q10A 2C7HA 2MA9B 3AXCA 2K25A 3APDA 4HXDA 4TV3A 3ZJVA 3PT2B 1BMLC 2LFIA 2LGDA 1XCQL 5DCNA 2NCNA 1FFUA 3ZLZA 4FBJB 3IHPC 1P9DU 4AQ7A 5EDSA 3SEBA 4JPSA 1I4PA 2NPTB 2V1YA 4OVUA 5EE1A 1JALA 4P6VF 3RCZA 4A6QA 5GXGB 5TR5A 2D3CA 1ET9A 5IOIA 3NZ3A 3TL5A 5JHBA 1V97A 3KYCD 1VRAB 2KACA 2C7MB 1Z5SB 3IAM1 5G5GA 5AUKA 2DYOA 3M63B 4ACFA 1WXAA 3ABVB 1E5WA 4LDTD 1SBBB 4LNFA 2AL6A 3A4RA 3ZVVA 3NOBA 3RNCC 1WJUA 1ZW7A 2DBYA 5FKAC 1P1AA 2BGFA 4NJ7A 3FILB 4IM3A 1WR6E 1E7UA 2V9HA 3OLMD 2BTEA 5JH5C 3RPFC 3W2DA 3ZNHB 2MSED 2V3NA 1QLBB 3GZNB 1RLFA 4RF1A 5E6OA 1C4PA 4TKNA 2FNJB 3ML9A 4K81A 2QCZA 2VRRB 2KJRA 2IGHA 4J3OD 2LVOA 2QEJC 2O2VA 3WALA 4W9GA 4RM9A 5DPTA 3ZNGC 1T5XD 1DYQA 2FCSA 3V61A 3ECIA 2A4ZA 4IOIE 3LXFA 2LVQA 4PT5A 1QF6A 1SB3C 4MGYE 5E6JA 3PZ8A 1WJ6A 2KNBA 1B9RA 5L83A 1IYFA 4O1NA 4TSSA 3X0WA 3EFUA 1JCKB 5KHQA 3EGRA 3NRZA 2I38A 2O6VA 3ETRA 4XZ4A 1V1PB 1UELA 3C8YA 4YSYB 2ZNVC 4XX5A 1E90A 4DBGA 1VR9A 1SSNA 3B9JA 1WXVA 2KFKB 1N60A 2KWUB 4I6NB 4G0NB 2JRIB 1MVKA 2KLCA 3QX1A 3I63C 4G11A 4OZBA 2Y3AA 4P16A 2AL3A 2D07B 3AEGB 1XT9B 2FAZA 2BT6A 3ENEA 1WJ4A 4GOCA 2PVGC 3Q8EA 2LGIA 4MH8A 4GDKB 1VLBA 5BMGA 3NS1A 5D6JB 2KFJA 4RGOS 3ZDMC 2Y5BB 1WXSA 3Q14C 3ZNZB 4N6EB 3X23A 3ZXRA 4N58A 1OQYA 1YX6B 2JX5A 1TS3A 1EF1A 2KVRA 4NJCA 3W9CB 1D5MC 4OW0A 1JROA 4KKIA 3CSFA 2ZPNA 3AE5B 4IM0A 5GMVA 3P1MA 1FXAA 1FIQA 2KLGA 4F1SA 2MX2A 2NPTA 4OHJA 1KH0A 4EZLA 4W9DA 1K50A 2M56B 4FJZA 3MFGA 5L95C 5HG2A 2KMCA 3VTUA 3GE8C 2EKEC 2KDFB 1JWMD 1ZUD2 4JIOU 1R4NB 4JQWC 2Q5WD 1PFDA 4K7UA 3MJ5A 2ZNVB 2FCMA 2NS5A 3I3TB 3JW0X 1PQSA 1D3ZA 3Q3MC 3PLUA 1V86A 4XYCA 1UWXA 4NZLB 3FILA 1XLNA 1C9FA 2FUG1 1QOGA 5JXVA 4A9AA 1MHXA 1A5RA 2RMMA 1UZXB 4NJ6A 1GUAB 3DVGY 1YOVB 3TSSA 1SJHD 2KMMA 3MC0B 2KTRB 3O65B 4JLCA 3ZQ4A 1MHHE 1ZXHA 2ICIA 2WU2B 1TS5A 4RF0A 5LXIB 1L4DB 1YJIA 1KF6B 1ZGUB 3TMPB 4A20A 4RFBA 2DLBA 1MPEA 3SDLC 4KZ0A 4M02A 3ZGZA 3TBLD 3KQ4A 2WWZA 2L00B 3UQBA 2N0SB 1D5XC 2SEBD 4B0EA 2BS3B 3ZO5B 1EM7A 2BYTA 4M01A 1GJZA 1WGHA 5LNK1 4GB9A 1V1PA 1XCTL 4PS3A 1LXDA 2BW2A 2JWUA 2KFKA 4I6LB 3RYTA 1SE9A 4WWMA 3HRDD 1EU3A 4JX1C 3W5UB 1P7FA 1T0QC 3P4QB 2RPQA 4DQOC 1XXGA 2J53A 2WXQA 1UH6A 2FCQA 2ZCCA 4HDOA 4M8MA 4DHJB 1YQBA 1OEYJ 4LLGM 3L13A 5KHOA 3AE9B 3C0RB 4QAYA 4OVZA 3N20C 2V0GA 3ML8A 4GDKA 3VR8B 1RAXA 1TS4A 1N63A 2KJ6A 2PW9A 2PLPA 2MH7A 4HDQA 1YQ4B 4RNAA 1R4MB 3ZTDA 2V4LA 4W9IA 1WJNA 4GMVA 2RPVA 4ANUA 3L17A 3QARA 3QAQA 5CHFA 3DBHB 4A90A 3Q69A 2LXCA 1WGYA 2K6DB 1FXTB 4YTMB 3WAMA 5E6PA 3JVZX 2QJLA 2KDMA 1GPXA 1TZ1A 1CJEA 1R7SA 2NVUI 1AN8A 3VVWB 4A3OA 1FPYA 4IDIA 1QOAA 3C19A 3EC8A 4ZYNA 2K39A 2IDYA 1FXIA 3NS8A 1NDDA 3TCAA 3VXWA 2WDVB 3RZFA 5BMHA 1J7AA 2HDEA 3IFWB 2WDQB 3HM6X 4OZCA 3AE1B 4KIKB 1LGRA 3I5JC 4KSLC 2CU1A 3A33B 1C3TA 1I4XA 4K7WA 2BF8B 3RNBC 1K51A 3WANA 1TKGA 3L10B 3MP9A 1CZPA 4TUUA 3PRZA 3W1YA 4FHKA 3V60A 3UI3A 1TYGB 4NPNA 2C5LC 1UF0A 2J4XA 3P2BA 4M0WB 2WGSA 3SHQA 2KTRA 2ZVOA 3PREA 4F7ZA 2M17A 3U7ZA 4BKGA 1Q0WB 3ZRCA 1YIWA 1WMHB 2JYEA 1AARA 2K1FA 3R3MA 2PE6B 4WAAA 3T9LA 1YQ3B 4XDCA 1GC6A 1YJJA 3UGBB 3GS2A 4AJYB 3KVFB 4G3XB 1UGJA 1XD3B 1OEYA 3RNGC 4A3PA 4YTPB 4ZHPA 1TKEA 2L83A 4PS8A 5IP4D 3SD5A 1OQQA 3N32A 2KQ7A 4M8NA 2QMTA 1ZDVA 1MFWA 3M95A 1SF0A 5BMIA 3KW5B 1I4QA 2LUEA 1K52A 1V80A 1V8CA 2N1WA 2WXHA 2AX5A 3LB8C 4EKUA 1T3QA 3DVNU 3CSTA 3RNFC 1TBEA 2JPHA 1NI2A 4ZRIA 2IY0B 4RGMA 4WJNA 4LJPB 4ICVA 1BT0A 3BWUD 2Y5CA 4BKSD 1E0ZA 2D10A 3U4EG 3PSEB 2K22A 2QIEB 1MI0A 3AH7A 4KVGB 1HTOA 4CHKA 2ZW1A 4YT0B 2L3ZA 2MBQA 1WGGA 1WGDA 1FRRA 2TSSA 3R2IA 4NQLB 3QCAA 5H8YE 4EZJA 2KX0A 4HK2A 1OQRA 1DOXA 2WX1A 1Z2MA 4NNJB 2CJNA 4ZOHC 3H6NA 1R4NI 2KN4A 3I9V1 2N9LA 4URKA 3P4RB 1X1MA 1C77A 1KOTA 1JRPA 3EA6A 3Q3NC 4AOFA 2ZZPB 3Q8BA 5FR6A 2G9HD 1JWAD 1L6VA 3WCQA 2IBIB 3A9KA 1FM0D 4N59A 5D2MB 2MW5A 2J0JA 2VZKD 1LO5D 3URYA 1IGCA 1GB1A 3Q3JA 3R8BA 5CHWA 2LEKA 2GOWA 3D32A 3BINA 3L16A 4MDKE 3P63A 1FNUA 2IGGA 2N7JA 3MC9A 4KV2A 2CHXA 2M4NA 3KWLA 5CTRC 3PLVA 2VH1A 1NYRA 1RM6C 4KIKA 3PV1A 3SU8X 1F2RC 5IA7A 4W9JA 1WZ3A 1QOBA 3HUIA 3NHEB 2JZ3B 2I1JA 4D2KA 3VTVA 1PDXA 1N62A 3QHTA 2WXRA 3UIOB 2IO1B 4KGSA 1L4ZB 2QC8A 3DBRI 5DPWA 1EU4A 1XEEA 3VQIA 4BVUC 4US8A 1AW7A 4MSMB 4E74A 2ZCBA 4RMAA 2JZZA 2J0KA 4LNKA 4IG7B 4M0WA 2SAKA 3MJWA 4BKTA 3TEZA 2PE9A 1UNSA 4MELA 3V05A 1JW9D 2IO0B 2KWDA 2HTHA 4HPPA 3AV8A 1GG3A 2PIAA 2OEDA 1OTRB 2Z0DB 2LGSA 1WMHA 4L23A 2E3TA 1YMHE 3K9OB 2CS4A 2DX5B 2H88B 1CK1A 3H7PB 4DHZE 3UQAA 2K5PA 3VTWA 4KGTA 2MHJA 3AE7B 3L0WB 1C4AA 2AEHA 2NTSA 3BVMA 4MH0E 4ANVA 1GNUA 4X57B 2BVCA 2IO2B 2IO3B 3QJZA 2G4DB 3QA8A 3QK0A 2OJWA 4AUQC 4C00A 2L32A 5C1ZA 1VJKA 3VFKA 2IYDB 3U52E 3AECB 4BAXA 3OJ3A 1JWSD 3V3XA 2FE8A 1WM3A 5I4DA 5LLIA 4H2AA 1R4MI 5AZGA 2DYMA 1G6JA 4KKJA 3FC4A 4EEWA 3PPAA 1FD6A 4WWOA 3PHWB 2WX0A 4PYUA 2JZPA 4C80A 3OJ4B 4R3DA 3GP7A 2EELA 3N30A 4E3CA 2LZ6A 4MT5A 3CIRB 5D3IB 3VR9B 2MBBB 4UDUC 1XQQA 1Y8RC 1KTKA 4IC7B 3NZSA 3ZTCA 2LJ5A 4P1CC 1GAQB 2JSVX 3IG3A 3ZIMA 3U7DA 3ZJUA 2NBWB 2W55A 2EMTA 1QOFA 1E10A 5DPSA 4GN1A 3NUHB 2KTFA 3TIXA 1V49A 2KAJA 3DWGC 2FCNA 1GB4A 3LJ3A 3PTFC 2WU5B 3H8HA 5FR3A 4L2YA 5E6NA 2X8XX 4S0RA 4ZRPA 1BXTA 4LNNA 3TJPA 1V1OA 1WE6A 3N1ZC 2HE7A 3AEDB 1J0GA 4HRSA 2MRPA 2H89B 1ACCA 1C4CA 2ON8A 5AUIA 1JQ4A 3HK0A 1FCLA 3IXSA 2GRIA 1B1ZA 4CO7A 1QT9A 4MGIE 1H4RA 2INDC 3VUWA 4ARIA 1E8ZA 2M19A 1TJEA 4FJVB 4JE3B 4JWUC 4IKGA 4IW0A 2N7EA 4PYZA 2K0PA 3V6EB 1SE4A 3IAS1 2KQ4X 3PRMB 1IUEA 2V3SA 2GBJA 4WQMA 1FRDA 3BVGA 1FFVA 2JQRB 3PHXB 3PO0A 3P4PB 1ZDXA 3DBLI 2PJHA 4K3CA 3DOWA 3Q8FA 1F1HA 3EUB2 1SE3A 4W9CA 5CX3A 2LD9A 2RR9A 1RRBA 2PTLA 2N9EB 4KX6B 4EOYA 5BO4B 3SFDB 2L7RA 3KYDD 1YN4A 2BWES 3OG5A 1WYWB 1WXQA 2NBUA 3E9SA 3H7PA 3GOEA 4WJPA 5G5HA 4BBNC 2WHIA 4OVVA 1J7CA 3GB1A 2BKFA 2J7QB 2PVOD 1WGKA 2MWSB 3AEAB 1UBIA 3J9CA 2K9XA 1KLGD 3UIPB 2DAJA 1HXYD 2J52A 2HJ1A 2M1MA 4GXBA 3BZDB 1L0VB 3IBEA 2FIDA 2G4SA 3KH0A 1WY8A 2R2OA 2R2QA 4E71A 2LUMA 4HROA 3RNAC 4WWPA 1N61A 4LTUA 2MP2B 4HCNB 2IGDA 4KDLB 2M0XA 1MJDA 1JRUA 2N9KA 2IJ0A 2KDIA 5C3JB 2W3RA 4GLSC 1WZ0A 3PS6A 2HD5B 1DOYA 1WIAA 4FN2A 2EKIA 2KC2A 4ICUA 2GBKA 3RD2A 4ANXA 2KYWA 3IT6B 2MJDA 2WYQA 4RGNA 1EWCA 1MG4A 2VH2A 1YN5A 2Z0EB 2UYZB 2WXMA 2I1KA 4WWNA 3GE3C 2DWQA 4AP4C 2MJ3A 1Y56A 3KWVA 2AYOB 2LXAA 2C9WB 1FO4A 3H9DA 3HVZA 2KX3A 2PKOA 4WJQA 2RDGA 2GBMA 2PMVA 2CU3A 2N9PC 3T3OA 2JYTA 1XLOA 3AN1A 3W1SC 2KT7A 4J6IA 2JWZA 4G50A 1XLQA 4II2B 3ZYYX 4MGZE 2WXIA 2YLMA 1L6UA 4YSZB 3K9PB 1EF5A 2DZJA 3VAWA 1N5WA 1C78A 4YTNB 3ZJTA 3NG0A 2M0AA 2M8SA 1NENB 2J42A 3GZNI 2AWTA 2KKCA 1NYQA 3WA0A 4K1RB 4YL8A 3B1LX 3IT4B 2RDBC 1WH3A 2KMAA 3JYUA 4A8XC 3JSVB 4MACA 3A1QB 1VZ8A 4B6WA 4OZAA 1WRIA 3CMMB 2VZKB 4FADA 2BKRB 2INPE 3AEBB 1PUTA 2N4FA 2GI9A 3ONSA 1QILA 2K8HA 4NQKE 1F77A 1ZP0B 2JF5A 2DNFA 1KFYB 5FK9C 3NZUA 3NVYA 1L2NA 1WGRA 3KUDB 1E9MA 4ARCA 5D7GA 2OJRA 2YEPB 4LK0M 5J18A 1LQBA 4DDID 5IAAC 4AWJA 1L0YB 4FLHA 3V6CB 3M62B 3CWIA 4LDTB 1C79A 2RDHA 4C7YA 4RM8A 5AEKB 5HFYA 3B0AA 4JGHB 2L1AA 2MJEA 1E8YA 2FBWB 3O13A 1IGDA 4FJYA 1DOIA 2QDFA 1WE7A 3DHGC 4I6PA 4YWGG 4WJOA 3DBSA 1KLUD 3AE3B 1UGMA 3OWEB 2BBCA 4M00A 1ENFA 2DZIA 3RI7C 1SXTA 2REXA 2HJ8A 2DENB 1I35A 2MP2A 1FMAD 1IPGA 4ITKA 1A70A 2I2YA 1I4RA 4TQ1A 1ZOYB 4DDGD 2FIFA 1D5ZC 3BY4B 2K8BA 4ZRJA 4GGQA 2CKHB 3RMKC 1KRHA 3L4PA 4HLEA 3W5VB 4FA6A 1NEKB 4HWIB 4RGTA 4B95A 2GB1A 2NTTA 1E7PB 3AU4A 3ZW3A 3QC8B 3UF8A 2L0TA 1I4HA 1E6EB 4XWWA 5IN7A 2GLSA 3AMZA 3U8ZA 3TEXA 2KZRA 2KWCA 3Q8CA 4BKSA 1K8RB 3PRPB 1VDVA 3DVGX 1OGWA 4YXDB 5C2TB 1WFYA 1GC7A 4DXAB 4HPMB 1TKYA 1OFFA 3B2FA 1C76A 4MJSB 1J19A 3RUIB 2RD0A 1V6EA 3VDZA 4HKQA 1Q5WB 2AQ3B 2W9NA 2BB6A 4K3BA 4HVBA 3A4SC 1J8CA 2WXLA 1JMLA 1V9JA 2AQ2B 1P7EA 2N1VA 2RGFA 3FKYA 2MBHA 1ISNA 4B9KA 3JSVA 3A1QA 2CR5A 1WWTA 2W54A 1XF5L 4P1BC 1SJED 1FNWA 1ZE3D 1V2YA 1F0ZA 4C4VB 1T6BX 4PS7A 4NY0A 4XDDA 3R7RA 2G3QB 2W82A 3PGEA 1WX9A 2XN9C 3B2GA 5D94A 2WXNA 4ANWA 4W9EA 4ZRQA 1M4VA 1LFDA 2WDRB 3I57A 2JU6X 3Q6BA 3EFCA 1HZ6A
chains in the Genus database with same CATH topology
1YNTE 2KQ4X 1IUEA 1UUPA 2IPKD 1VZ7A 4WQMA 2X38A 3NVWA 1FRDA 3BVGA 1FFVA 2JQRB 2XNAC 1XLPA 3PO0A 2RPVA 1GOZA 3N9YC 3P4PB 2L52A 1ZDXA 5TSSA 4A90A 3Q69A 2WLBA 2K3UA 3W1SA 4HKZE 1I7HA 2BB5A 3Q8FA 2QSDA 4YTMB 3EUB2 3U2SC 1SE3A 2WP9B 2QJLA 2KDMA 1GPXA 2LMCA 1CJEA 2PTLA 1R7SA 1AN8A 1FCCC 4KX6B 4IDIA 1QOAA 1QKZA 3BIID 1FEHA 2B76B 1N5XA 3SFDB 4ZHOA 2ACZB 1HQRD 4FXCA 2V3PA 4JWSC 2IDYA 2Z8LA 1YN4A 3FAHA 1FXIA 1ZPSA 3TEYA 1WXQA 3SR6A 3E9SA 4TQ0A 3VRAB 5G5HA 2WDVB 1RWSA 5BMHA 3P4SB 1J7CA 3GB1A 1J7AA 2HDEA 1IBXB 2WDQB 5EE3A 2PVOD 1WGKA 3AEAB 4OZCA 3SFEB 3AE1B 3J9CA 3KLSX 2K9XA 1KLGD 1I4XA 4RCOA 1K51A 2R61A 3AE8B 1HXYD 4Q2JA 2J52A 1Q10A 2WXJA 1AWDA 1TKGA 3MP9A 2LJIA 3BZDB 1CZPA 4WURA 4REZA 1SEBD 1L0VB 3ZJVA 4NAWB 3UI3A 1BMLC 2LFIA 1TYGB 1XCQL 1FFUA 2J4XA 1PGAA 4AQ7A 4USAA 2LUMA 4US9A 4HROA 3SEBA 4JPSA 1I4PA 5EE1A 3U7ZA 2D5GA 1N61A 3BYTB 4LTUA 1JALA 4P6VF 3RFZB 4A6QA 1STEA 5GXGB 3BYYB 2IGDA 1ET9A 3BK1A 3NVZA 3NZ3A 4NAMA 5BYRA 4CQNA 2JYEA 2N9KA 2WXGA 2IJ0A 1V97A 1VRAB 1YQ3B 4GDLB 4XDCA 5C3JB 2KACA 1TY2A 1YJJA 2W3RA 4GLSC 3GS2A 3IAM1 5AUKA 5G5GA 1L5PA 4WIPA 1I4GA 2DYOA 1DOYA 1UGJA 3ABVB 2EKIA 4YTPB 4ZHPA 1SBBB 4DXGA 3IT6B 1TKEA 2L83A 2MJDA 4RGNA 2DBYA 1EWCA 5FKAC 5D3DA 1OQQA 1YN5A 5T8IA 2WXFA 3FILB 4MM3B 2WXMA 1HZ5A 2E6XA 2BTEA 2DWQA 2QMTA 1ZDVA 2MJ3A 1Y56A 3RPFC 3W2DA 4ZYSA 1VZ6A 1SF0A 1QLBB 2V3NA 3KWVA 5BMIA 1I4QA 1FO4A 4RF1A 1C4PA 1K52A 1V8CA 4RH6A 3HVZA 2WXHA 2AX5A 2PKOA 2IGHA 1ET6A 2RDGA 2INNE 3LB8C 2PMVA 2CU3A 1T3QA 3T3OA 2JYTA 1XLOA 4J3OD 1ZXIA 3AN1A 1ROEA 4RGMA 2QEJC 1XLQA 3BWUD 3ZYYX 1T5XD 1DYQA 2LHDA 2Y5CA 1E0ZA 4TMAB 2WXIA 4L1BA 3U4EG 1EWYC 1L6UA 4IOIE 4YSZB 3LXFA 2K22A 2QIEB 1MI0A 1N5WA 3AE6B 3AH7A 1C78A 4YTNB 3ZJTA 4PT5A 2M0AA 1WYGA 1NENB 2ZW1A 2J42A 4YT0B 1QF6A 1SB3C 5E6JA 3HVDA 1NYQA 3PZ8A 1FRRA 1B9RA 3AB5A 3VRBB 4B0MA 2TSSA 3R2IA 3IT4B 1J7BA 4A8XC 4O1NA 4TSSA 4MACA 1JCKB 5H8YE 3EGRA 3NRZA 2I38A 1VZ8A 3AEEB 3ETRA 4OZAA 1WRIA 1OQRA 1V1PB 3C8YA 4YSYB 1DOXA 2VZKB 2WXPA 2INPE 2CJNA 4ZOHC 1VR9A 3AEBB 1PUTA 1SSNA 2KN4A 3NVVA 3I9V1 3B9JA 2GI9A 4XE0A 1QILA 1TS2A 2N9LA 1N60A 1QQRA 3P4RB 1C77A 1F77A 1JRPA 1RFKA 3EA6A 1ZP0B 3Q8BA 4AS1A 4A55A 2G9HD 1MVKA 1SIJA 1KFYB 1K53A 5FK9C 3NVYA 1JWAD 1HA5A 1L6VA 4N59A 3WCQA 1FM0D 4OZBA 2Y3AA 4P16A 1PGXA 2VZKD 1LO5D 1E9MA 4ARCA 3AEGB 5D7GA 1CQVA 2YEPB 3URYA 1IGCA 2WQYB 4LK0M 1GB1A 4WAFA 3R8BA 2LEKA 3PZ7A 2BT6A 3DWMA 2W3SA 1XO3A 2WXKA 2PVGC 2QILA 3Q8EA 3P63A 1FNUA 1L0YB 2LGIA 4MH8A 5H92C 2MEKA 2IGGA 4GDKB 4DXFA 3CWIA 2N7JA 1VLBA 5BMGA 3KWLA 1C79A 1UWMA 3NS1A 1IBXA 2RDHA 4RGOS 4C7YA 1NYRA 1RM6C 5HFYA 1F2RC 2NMQA 2L1AA 4N6EB 2MJEA 1QOBA 3HUIA 1D4BA 4N58A 2FBWB 2JX5A 1AYFA 1TS3A 3O13A 3E56A 1IGDA 1PDXA 4D2KA 1N62A 4NJCA 3W9CB 1D5MC 4OW0A 3AE4B 1DOIA 1JROA 2WXRA 4KKIA 2V4IB 3AE5B 4KGSA 1L4ZB 3P1MA 1EU4A 1XEEA 4YWGG 4XWTA 1JWBD 3VQIA 4EE2A 2HTME 1FXAA 1AW7A 1KLUD 4C56C 4US8A 1FIQA 3AE3B 1BUIC 2ONQA 3OWEB 1NI3A 2BBCA 4M0WA 3BVZA 1ENFA 2SAKA 3AEFB 1SE2A 3V05A 1UNSA 3TEZA 5BYSA 1JW9D 1NVID 2KWDA 1SXTA 1D6EC 4OHJA 1KH0A 2AQ1B 1HEZE 1K50A 3AV8A 2M56B 2PIAA 2OEDA 1FMAD 4ITKA 3MFGA 1PYWD 5HG2A 1A70A 2I2YA 1PGBA 1I4RA 4L23A 2E3TA 4TQ1A 3TUOA 1YMHE 1ZOYB 3LYYA 4KGRA 2H88B 1CK1A 1ESFA 1JWMD 1D5ZC 1ZUD2 2K5PA 1DGJA 1PFDA 2Q5WD 4KGTA 3MJ5A 3AE7B 1C4AA 3R2TA 1KRHA 3L4PA 5MPOA 2NTSA 3BVMA 3W5VB 1NEKB 4RGTA 1YN3A 2GB1A 2NTTA 1E7PB 1RYJA 1UWXA 4NZLB 3FILA 1XLNA 1C9FA 2FUG1 1I4HA 1E6EB 4XWWA 1QOGA 2L32A 5JXVA 4A9AA 1MHXA 3BK2A 2RMMA 3AMZA 1VJKA 1FNVA 3U52E 3AECB 2LHEA 1JWSD 3V3XA 3TEXA 3TSSA 1SJHD 2FE8A 2WNMA 2KMMA 3Q8CA 5I4DA 4H2AA 3MC0B 2DYMA 1L0XB 3Q8AA 1VDVA 4KKJA 3FC4A 4YXDB 1FD6A 3ZQ4A 1MHHE 1ZXHA 5C2TB 2ICIA 2WU2B 1TS5A 2JZPA 4RF0A 1L4DB 1TKYA 1YJIA 1KF6B 1OFFA 4R3DA 3B2FA 4C80A 2YEPF 1C76A 3GP7A 4HEA1 2EELA 4MT5A 3CIRB 4RFBA 4HKQA 2DLBA 5D3IB 3VR9B 1MPEA 1TZOA 4UDUC 2AQ3B 3AE2B 2BB6A 4WH4A 1KTKA 1JWUD 2ZW0A 3ZGZA 2WXLA 1GAQB 1JMLA 2JSVX 3T3NA 3ZJUA 3KQ4A 5EE9A 2W55A 2AQ2B 2N0SB 1QOFA 1E10A 1D5XC 1P7EA 2SEBD 4B0EA 2BS3B 3NUHB 2Y5PA 5EE0A 1EM7A 3MHZA 2BYTA 3P42A 3TEWA 2BS4B 2KAJA 3DWGC 5LNK1 1V1PA 2JXTA 1GB4A 1XCTL 4HJGE 2WU5B 3H8HA 5FR3A 4L2YA 1WWTA 2BW2A 2JWUA 1TY0A 2BS2B 2W54A 1XF5L 1F2RI 1SJED 4ZRPA 1BXTA 4WWMA 5BYQA 3HRDD 1EU3A 4JX1C 3W5UB 1FNWA 1P7FA 1V1OA 1ZE3D 3P4QB 4DQOC 1F0ZA 1XXGA 2J53A 3AEDB 2WXQA 4HRSA 4C7ZA 1T6BX 2H89B 1WSPA 1ACCA 1C4CA 2ON8A 5AUIA 1JQ4A 4XDDA 1FCLA 2W82A 3IXSA 2G1EA 2WS3B 2GRIA 1B1ZA 1QT9A 4LLGM 3AE9B 3IAS1 2XN9C 5HI1A 3B2GA 4OVZA 4ARIA 2WXNA 2M19A 3AM9A 4YSXB 2V0GA 1TJEA 3VR8B 4ZRQA 1M4VA 2CJOA 1TS4A 1N63A 2PW9A 2PLPA 2WXOA 4JE3B 2MH7A 4JWUC 1YQ4B 2WDRB 4IKGA 3I57A 4RNAA 2JU6X 2K0PA 2OHFA 1SE4A 1HZ6A 5HHDG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFY B;  1V97 A;  4A9A A;  1YQ3 B;  1IUE A;  3NVY A;  1JWA D;  5C3J B;  1L6V A;  3AMZ A;  1VJK A;  4N59 A;  1FM0 D;  3WCQ A;  4WQM A;  3NVW A;  1YJJ A;  1FRD A;  2W3R A;  3AEC B;  1FFV A;  2JQR B;  1XLP A;  1E9M A;  3PO0 A;  5G5G A;  3AEG B;  5AUK A;  1L5P A;  2KMM A;  3P4P B;  2WQY B;  1DOY A;  3ABV B;  2L52 A;  2LEK A;  2BT6 A;  2EKI A;  1VDV A;  4YTP B;  3FC4 A;  3DWM A;  4ZHP A;  2W3S A;  4YXD B;  2WLB A;  1XO3 A;  5C2T B;  2PVG C;  5H92 C;  3P63 A;  2WU2 B;  1TKE A;  2L83 A;  1TKY A;  1I7H A;  2MJD A;  1YJI A;  1KF6 B;  1OFF A;  3CWI A;  2DBY A;  3B2F A;  4C80 A;  1VLB A;  4YTM B;  3KWL A;  3EUB 2;  3NS1 A;  1UWM A;  2WP9 B;  1OQQ A;  2QJL A;  3CIR B;  4C7Y A;  1GPX A;  1NYR A;  1RM6 C;  1CJE A;  1R7S A;  3VR9 B;  5G5H A;  4KX6 B;  2DWQ A;  4IDI A;  1QOA A;  4N6E B;  2MJ3 A;  3RPF C;  3BII D;  2MJE A;  1QOB A;  1QLB B;  1SF0 A;  3AE2 B;  3HUI A;  2B76 B;  1N5X A;  3SFD B;  4N58 A;  4ZHO A;  2FBW B;  2JX5 A;  1FO4 A;  1AYF A;  2ACZ B;  1V8C A;  1PDX A;  3HVZ A;  1N62 A;  3W9C B;  3AE4 B;  1DOI A;  2AX5 A;  2PKO A;  1JRO A;  4FXC A;  4JWS C;  1GAQ B;  3AE5 B;  3FAH A;  1FXI A;  3LB8 C;  5EE9 A;  2W55 A;  2CU3 A;  1T3Q A;  1WXQ A;  3SR6 A;  2N0S B;  1QOF A;  1E10 A;  3P1M A;  1XLO A;  2BS3 B;  1JWB D;  1ZXI A;  2WDV B;  1RWS A;  1FXA A;  2HTM E;  1ROE A;  3AN1 A;  3P4S B;  5EE0 A;  1J7C A;  1FIQ A;  1J7A A;  3AE3 B;  1NI3 A;  2WDQ B;  5EE3 A;  2BS4 B;  2KAJ A;  3DWG C;  2PVO D;  1WGK A;  3AEA B;  3AEF B;  3SFE B;  1XLQ A;  3AE1 B;  3ZYY X;  1DOX A;  1JW9 D;  2Y5C A;  1NVI D;  2WU5 B;  1E0Z A;  2K9X A;  1WWT A;  1EWY C;  2BS2 B;  1L6U A;  3AV8 A;  2W54 A;  2M56 B;  4YSZ B;  3LXF A;  2K22 A;  2PIA A;  2QIE B;  1FMA D;  4WWM A;  1N5W A;  3AE8 B;  3AE6 B;  3AH7 A;  3HRD D;  4ITK A;  4JX1 C;  4YTN B;  3W5U B;  3P4Q B;  1AWD A;  1A70 A;  1F0Z A;  1TKG A;  1WYG A;  3AED B;  1NEN B;  2E3T A;  4YT0 B;  1QF6 A;  1SB3 C;  4HRS A;  1CZP A;  1ZOY B;  4C7Z A;  1NYQ A;  1L0V B;  2H89 B;  4US8 A;  2H88 B;  1FRR A;  5AUI A;  1JQ4 A;  1B9R A;  3AB5 A;  3VRB B;  1TYG B;  1ZUD 2;  1J7B A;  2K5P A;  2G1E A;  1DGJ A;  1FFU A;  1PFD A;  2Q5W D;  2WS3 B;  5H8Y E;  3NRZ A;  3AE7 B;  1QT9 A;  4USA A;  3AEE B;  3AE9 B;  3ETR A;  1WRI A;  1OQR A;  4US9 A;  1KRH A;  3B2G A;  3L4P A;  4HRO A;  4YSY B;  5MPO A;  4YSX B;  2M19 A;  3AM9 A;  3W5V B;  1TJE A;  2CJN A;  4ZOH C;  3AEB B;  1PUT A;  3NVV A;  1N61 A;  5EE1 A;  3VR8 B;  1NEK B;  3B9J A;  3VRA B;  4LTU A;  2CJO A;  1JAL A;  4P6V F;  1N63 A;  1N60 A;  2MH7 A;  3P4R B;  5GXG B;  1E7P B;  1RYJ A;  4JWU C;  1JRP A;  1RFK A;  1XLN A;  1YQ4 B;  1ZP0 B;  2WDR B;  3NVZ A;  1SIJ A;  2OHF A;  1E6E B;  1QOG A; 
#chains in the Genus database with same CATH topology
 4MEM A;  3VH3 B;  2UU7 A;  1UUP A;  4GSW A;  4KZC A;  1VZ7 A;  3NVW A;  1P3Q U;  4DHZ B;  2XNA C;  1EUV B;  2N9X A;  2OOB B;  3WAO A;  2KO3 A;  1T0S C;  4LCD E;  2BYF A;  2WLB A;  3N1Y C;  3W1S A;  3LDZ E;  4W9L A;  1I7H A;  4ASW C;  3RN9 C;  2QSD A;  4EUT A;  2WP9 B;  1M94 A;  2DZK A;  2ZJD A;  3HHM A;  1YX5 B;  2LMC A;  2K6Q A;  1FCC C;  2L0F A;  2D11 A;  2O6V D;  1F9J A;  2B76 B;  1N5X A;  4ZHO A;  1MG8 A;  3A9J B;  1HQR D;  3R7Q A;  2KDE B;  2CHZ A;  4FXC A;  2KDB A;  4JWS C;  2Z8L A;  2L8J A;  3FAH A;  3AU5 A;  1HTQ A;  1ZPS A;  3SR6 A;  3PVL A;  3VRA B;  3NJT A;  1RWS A;  1VD2 A;  3DBH I;  1IBX B;  1SGH A;  2NR2 A;  3UIN B;  3SFE B;  2KD0 A;  2C7N B;  3KLS X;  2MLB A;  3AUL A;  4KDI C;  2B3A A;  4PK1 A;  4RCO A;  2R61 A;  3AE8 B;  2WXJ A;  1AWD A;  1WX7 A;  1YD8 U;  2DZM A;  2LJI A;  4BZA A;  4WUR A;  4REZ A;  1SEB D;  3S2A A;  2PPH A;  4NAW B;  1E8X A;  1KJT A;  4FHJ A;  1SIF A;  3APF A;  1PGA A;  4USA A;  2LI5 A;  4S17 A;  4US9 A;  3DCG A;  5J2R A;  1WI0 A;  2D5G A;  3BYT B;  3RFZ B;  1STE A;  4MJS A;  3BYY B;  1Q1O A;  3BK1 A;  3NVZ A;  4NAM A;  3U30 A;  5BYR A;  4CQN A;  2WXG A;  5AZH A;  4GDL B;  3L54 A;  2KXJ A;  1TY2 A;  4K7S A;  1L5P A;  2JY6 A;  1I4G A;  2C60 A;  4WIP A;  4LJO B;  1WXM A;  2JT4 B;  2A5U A;  1F52 A;  1S3S G;  4KSK C;  3H1U A;  4DXG A;  2L76 A;  5D3D A;  1EO6 A;  5T8I A;  2WXF A;  4IWP A;  2DAF A;  4MM3 B;  1IP9 A;  1HZ5 A;  2E6X A;  2WDT B;  3RZW C;  4ZYS A;  1VZ6 A;  3ZNI D;  3WAP A;  4RH6 A;  2D3B A;  1ET6 A;  1NBF C;  2INN E;  2YVC A;  4C4V A;  3ZKJ C;  2FUH B;  2INC C;  1ZXI A;  1ROE A;  4LNO A;  1YJ1 A;  3ZXV A;  4WQO B;  3VHT C;  3RUL A;  3ZDT A;  2LHD A;  2LRW A;  4TMA B;  2ZVN A;  3ZRF A;  2LGY A;  4L1B A;  1V5T A;  1EWY C;  1ZKH A;  2XK5 B;  3QWZ B;  3AE6 B;  2BYV E;  2KK8 A;  4BFR A;  2XBB C;  1WYG A;  5G55 A;  2JVC A;  3B08 A;  3HVD A;  4F8C B;  3AB5 A;  4LNI A;  3VRB B;  4B0M A;  2GMI C;  1WM2 A;  1J7B A;  2JUO A;  5CHV C;  3AEE B;  2KWV B;  2WXP A;  3MHS D;  3NVV A;  4XE0 A;  1TS2 A;  1TGZ B;  2XEW A;  1L7Y A;  1QQR A;  1N6Z A;  1RFK A;  4AS1 A;  4A55 A;  1SIJ A;  3DVN V;  3QQ8 B;  1K53 A;  3AI5 A;  4GU2 A;  2KHW B;  1HA5 A;  1TT5 B;  3T8M A;  1PGX A;  4W9H A;  3IVF A;  1CQV A;  3DBR B;  3A9J A;  1P0R A;  2WQY B;  4WAF A;  3PZ7 A;  2NBV B;  2KQS A;  4N9F 4;  3DWM A;  2ASQ A;  2W3S A;  4FUL A;  1XO3 A;  2WXK A;  2QIL A;  2LGX A;  5H92 C;  3M3J A;  2MEK A;  3N3K B;  4DXF A;  2QHO A;  2J0M A;  1IBX A;  1UWM A;  2LAS A;  3L08 A;  3Q2A C;  2EMS A;  2NMQ A;  4IUM B;  1WX8 A;  2ZPY A;  2D3G A;  1D4B A;  1AYF A;  3APC A;  3E56 A;  3AE4 B;  2V4I B;  3HIZ A;  5DPR A;  4GIV A;  4NAW A;  2N7D A;  4XWT A;  1JWB D;  4EE2 A;  2HTM E;  4C56 C;  1BUI C;  2ONQ A;  4BOS C;  1NI3 A;  3BVZ A;  3AEF B;  1SE2 A;  5BYS A;  1V81 A;  1NVI D;  4BBN F;  1D6E C;  2ZEQ A;  2AQ1 B;  1HEZ E;  4W9F A;  1E8W A;  2K8C A;  2GBN A;  1PYW D;  2LRU A;  1PGB A;  3WIM A;  5JZE B;  3V62 A;  3TUO A;  3N1X C;  4GDL A;  4ZRK A;  3LYY A;  2KN5 A;  4KGR A;  2BYE A;  1ESF A;  1DGJ A;  4IWQ A;  4ZDV A;  3VUY A;  3R2T A;  2BWF A;  5G2N A;  5C23 A;  5MPO A;  4MSQ B;  4BOZ B;  1YN3 A;  1RYJ A;  4HCP B;  4MM3 A;  2BPS A;  3VUX A;  5IKC M;  1LM8 B;  3BK2 A;  1T0R C;  2PEA A;  1FNV A;  1TIF A;  3EEC A;  2LHE A;  3A9K B;  2WNM A;  3QIJ A;  5HKH A;  1L0X B;  3Q8A A;  1HE8 A;  5J17 A;  2YEP F;  4HEA 1;  1KM7 A;  2UWQ A;  3EHV A;  1U4A A;  2Z59 B;  1TZO A;  1H8C A;  1E7V A;  3AE2 B;  2XK5 A;  4WH4 A;  1JWU D;  2ZW0 A;  4AJW A;  3T3N A;  5EE9 A;  2MBE A;  1WRD B;  2Y5P A;  5EE0 A;  3MHZ A;  3P42 A;  3TEW A;  2BS4 B;  1TTN A;  2DHZ A;  1WR1 A;  2JXT A;  4HJG E;  1TY0 A;  4DWF A;  2BS2 B;  3DDC B;  3NY5 A;  1F2R I;  3HM3 A;  5BYQ A;  3DQV A;  4P7I A;  3MTN B;  2GBR A;  4IM2 A;  2KVZ A;  1P98 A;  3ALB A;  4C7Z A;  3PZD A;  1WSP A;  3Q3O C;  4EFO A;  3DBL B;  2G1E A;  2WS3 B;  2O2V B;  4DK5 A;  1VCB A;  5JHA A;  3DPD A;  5HI1 A;  4YSX B;  3AM9 A;  2KOX A;  3KUC B;  2CJO A;  2KJH B;  2MQJ A;  2WXO A;  1KLV A;  2MBO A;  4MGK E;  3Q3F A;  2IZV B;  1C1Y B;  2OHF A;  2JXX A;  1RFA A;  3DHI C;  3DHH C;  5HHD G;  4DHJ D;  1YNT E;  2IPK D;  3H7S A;  2X38 A;  2IY1 B;  2CHW A;  4HPL B;  2MCN B;  4JL9 A;  1XLP A;  4II3 B;  2JRH A;  1GOZ A;  3N9Y C;  2LWP A;  1CMX B;  2L52 A;  2KC1 A;  5TSS A;  3OAW A;  3VH4 B;  2O6V B;  4IWO A;  4XC2 A;  1V5O A;  3RNE C;  2K3U A;  2D2Q A;  4HKZ E;  2BB5 A;  3U2S C;  2G45 B;  3CF6 E;  4W9K A;  3RT3 B;  1UD7 A;  4HJK A;  1T0Y A;  3ZUN A;  1WF9 A;  2RSU A;  4XGA B;  1QKZ A;  3BII D;  1FEH A;  2ACZ B;  2BQQ A;  1QZE A;  3MC8 A;  2V3P A;  3TEY A;  3R66 C;  4TQ0 A;  5IO9 A;  1UBQ A;  3P4S B;  4EZK A;  5LXH A;  5EE3 A;  5AZF A;  2L05 A;  2DYB A;  2KAN A;  4CYE A;  1S1Q B;  2LVP A;  1I42 A;  2D3A A;  3KUZ A;  4Q2J A;  1Q10 A;  2C7H A;  2MA9 B;  3AXC A;  2K25 A;  3APD A;  4HXD A;  4TV3 A;  3ZJV A;  3PT2 B;  1BML C;  2LFI A;  2LGD A;  1XCQ L;  5DCN A;  2NCN A;  1FFU A;  3ZLZ A;  4FBJ B;  3IHP C;  1P9D U;  4AQ7 A;  5EDS A;  3SEB A;  4JPS A;  1I4P A;  2NPT B;  2V1Y A;  4OVU A;  5EE1 A;  1JAL A;  4P6V F;  3RCZ A;  4A6Q A;  5GXG B;  5TR5 A;  2D3C A;  1ET9 A;  5IOI A;  3NZ3 A;  3TL5 A;  5JHB A;  1V97 A;  3KYC D;  1VRA B;  2KAC A;  2C7M B;  1Z5S B;  3IAM 1;  5G5G A;  5AUK A;  2DYO A;  3M63 B;  4ACF A;  1WXA A;  3ABV B;  1E5W A;  4LDT D;  1SBB B;  4LNF A;  2AL6 A;  3A4R A;  3ZVV A;  3NOB A;  3RNC C;  1WJU A;  1ZW7 A;  2DBY A;  5FKA C;  1P1A A;  2BGF A;  4NJ7 A;  3FIL B;  4IM3 A;  1WR6 E;  1E7U A;  2V9H A;  3OLM D;  2BTE A;  5JH5 C;  3RPF C;  3W2D A;  3ZNH B;  2MSE D;  2V3N A;  1QLB B;  3GZN B;  1RLF A;  4RF1 A;  5E6O A;  1C4P A;  4TKN A;  2FNJ B;  3ML9 A;  4K81 A;  2QCZ A;  2VRR B;  2KJR A;  2IGH A;  4J3O D;  2LVO A;  2QEJ C;  2O2V A;  3WAL A;  4W9G A;  4RM9 A;  5DPT A;  3ZNG C;  1T5X D;  1DYQ A;  2FCS A;  3V61 A;  3ECI A;  2A4Z A;  4IOI E;  3LXF A;  2LVQ A;  4PT5 A;  1QF6 A;  1SB3 C;  4MGY E;  5E6J A;  3PZ8 A;  1WJ6 A;  2KNB A;  1B9R A;  5L83 A;  1IYF A;  4O1N A;  4TSS A;  3X0W A;  3EFU A;  1JCK B;  5KHQ A;  3EGR A;  3NRZ A;  2I38 A;  2O6V A;  3ETR A;  4XZ4 A;  1V1P B;  1UEL A;  3C8Y A;  4YSY B;  2ZNV C;  4XX5 A;  1E90 A;  4DBG A;  1VR9 A;  1SSN A;  3B9J A;  1WXV A;  2KFK B;  1N60 A;  2KWU B;  4I6N B;  4G0N B;  2JRI B;  1MVK A;  2KLC A;  3QX1 A;  3I63 C;  4G11 A;  4OZB A;  2Y3A A;  4P16 A;  2AL3 A;  2D07 B;  3AEG B;  1XT9 B;  2FAZ A;  2BT6 A;  3ENE A;  1WJ4 A;  4GOC A;  2PVG C;  3Q8E A;  2LGI A;  4MH8 A;  4GDK B;  1VLB A;  5BMG A;  3NS1 A;  5D6J B;  2KFJ A;  4RGO S;  3ZDM C;  2Y5B B;  1WXS A;  3Q14 C;  3ZNZ B;  4N6E B;  3X23 A;  3ZXR A;  4N58 A;  1OQY A;  1YX6 B;  2JX5 A;  1TS3 A;  1EF1 A;  2KVR A;  4NJC A;  3W9C B;  1D5M C;  4OW0 A;  1JRO A;  4KKI A;  3CSF A;  2ZPN A;  3AE5 B;  4IM0 A;  5GMV A;  3P1M A;  1FXA A;  1FIQ A;  2KLG A;  4F1S A;  2MX2 A;  2NPT A;  4OHJ A;  1KH0 A;  4EZL A;  4W9D A;  1K50 A;  2M56 B;  4FJZ A;  3MFG A;  5L95 C;  5HG2 A;  2KMC A;  3VTU A;  3GE8 C;  2EKE C;  2KDF B;  1JWM D;  1ZUD 2;  4JIO U;  1R4N B;  4JQW C;  2Q5W D;  1PFD A;  4K7U A;  3MJ5 A;  2ZNV B;  2FCM A;  2NS5 A;  3I3T B;  3JW0 X;  1PQS A;  1D3Z A;  3Q3M C;  3PLU A;  1V86 A;  4XYC A;  1UWX A;  4NZL B;  3FIL A;  1XLN A;  1C9F A;  2FUG 1;  1QOG A;  5JXV A;  4A9A A;  1MHX A;  1A5R A;  2RMM A;  1UZX B;  4NJ6 A;  1GUA B;  3DVG Y;  1YOV B;  3TSS A;  1SJH D;  2KMM A;  3MC0 B;  2KTR B;  3O65 B;  4JLC A;  3ZQ4 A;  1MHH E;  1ZXH A;  2ICI A;  2WU2 B;  1TS5 A;  4RF0 A;  5LXI B;  1L4D B;  1YJI A;  1KF6 B;  1ZGU B;  3TMP B;  4A20 A;  4RFB A;  2DLB A;  1MPE A;  3SDL C;  4KZ0 A;  4M02 A;  3ZGZ A;  3TBL D;  3KQ4 A;  2WWZ A;  2L00 B;  3UQB A;  2N0S B;  1D5X C;  2SEB D;  4B0E A;  2BS3 B;  3ZO5 B;  1EM7 A;  2BYT A;  4M01 A;  1GJZ A;  1WGH A;  5LNK 1;  4GB9 A;  1V1P A;  1XCT L;  4PS3 A;  1LXD A;  2BW2 A;  2JWU A;  2KFK A;  4I6L B;  3RYT A;  1SE9 A;  4WWM A;  3HRD D;  1EU3 A;  4JX1 C;  3W5U B;  1P7F A;  1T0Q C;  3P4Q B;  2RPQ A;  4DQO C;  1XXG A;  2J53 A;  2WXQ A;  1UH6 A;  2FCQ A;  2ZCC A;  4HDO A;  4M8M A;  4DHJ B;  1YQB A;  1OEY J;  4LLG M;  3L13 A;  5KHO A;  3AE9 B;  3C0R B;  4QAY A;  4OVZ A;  3N20 C;  2V0G A;  3ML8 A;  4GDK A;  3VR8 B;  1RAX A;  1TS4 A;  1N63 A;  2KJ6 A;  2PW9 A;  2PLP A;  2MH7 A;  4HDQ A;  1YQ4 B;  4RNA A;  1R4M B;  3ZTD A;  2V4L A;  4W9I A;  1WJN A;  4GMV A;  2RPV A;  4ANU A;  3L17 A;  3QAR A;  3QAQ A;  5CHF A;  3DBH B;  4A90 A;  3Q69 A;  2LXC A;  1WGY A;  2K6D B;  1FXT B;  4YTM B;  3WAM A;  5E6P A;  3JVZ X;  2QJL A;  2KDM A;  1GPX A;  1TZ1 A;  1CJE A;  1R7S A;  2NVU I;  1AN8 A;  3VVW B;  4A3O A;  1FPY A;  4IDI A;  1QOA A;  3C19 A;  3EC8 A;  4ZYN A;  2K39 A;  2IDY A;  1FXI A;  3NS8 A;  1NDD A;  3TCA A;  3VXW A;  2WDV B;  3RZF A;  5BMH A;  1J7A A;  2HDE A;  3IFW B;  2WDQ B;  3HM6 X;  4OZC A;  3AE1 B;  4KIK B;  1LGR A;  3I5J C;  4KSL C;  2CU1 A;  3A33 B;  1C3T A;  1I4X A;  4K7W A;  2BF8 B;  3RNB C;  1K51 A;  3WAN A;  1TKG A;  3L10 B;  3MP9 A;  1CZP A;  4TUU A;  3PRZ A;  3W1Y A;  4FHK A;  3V60 A;  3UI3 A;  1TYG B;  4NPN A;  2C5L C;  1UF0 A;  2J4X A;  3P2B A;  4M0W B;  2WGS A;  3SHQ A;  2KTR A;  2ZVO A;  3PRE A;  4F7Z A;  2M17 A;  3U7Z A;  4BKG A;  1Q0W B;  3ZRC A;  1YIW A;  1WMH B;  2JYE A;  1AAR A;  2K1F A;  3R3M A;  2PE6 B;  4WAA A;  3T9L A;  1YQ3 B;  4XDC A;  1GC6 A;  1YJJ A;  3UGB B;  3GS2 A;  4AJY B;  3KVF B;  4G3X B;  1UGJ A;  1XD3 B;  1OEY A;  3RNG C;  4A3P A;  4YTP B;  4ZHP A;  1TKE A;  2L83 A;  4PS8 A;  5IP4 D;  3SD5 A;  1OQQ A;  3N32 A;  2KQ7 A;  4M8N A;  2QMT A;  1ZDV A;  1MFW A;  3M95 A;  1SF0 A;  5BMI A;  3KW5 B;  1I4Q A;  2LUE A;  1K52 A;  1V80 A;  1V8C A;  2N1W A;  2WXH A;  2AX5 A;  3LB8 C;  4EKU A;  1T3Q A;  3DVN U;  3CST A;  3RNF C;  1TBE A;  2JPH A;  1NI2 A;  4ZRI A;  2IY0 B;  4RGM A;  4WJN A;  4LJP B;  4ICV A;  1BT0 A;  3BWU D;  2Y5C A;  4BKS D;  1E0Z A;  2D10 A;  3U4E G;  3PSE B;  2K22 A;  2QIE B;  1MI0 A;  3AH7 A;  4KVG B;  1HTO A;  4CHK A;  2ZW1 A;  4YT0 B;  2L3Z A;  2MBQ A;  1WGG A;  1WGD A;  1FRR A;  2TSS A;  3R2I A;  4NQL B;  3QCA A;  5H8Y E;  4EZJ A;  2KX0 A;  4HK2 A;  1OQR A;  1DOX A;  2WX1 A;  1Z2M A;  4NNJ B;  2CJN A;  4ZOH C;  3H6N A;  1R4N I;  2KN4 A;  3I9V 1;  2N9L A;  4URK A;  3P4R B;  1X1M A;  1C77 A;  1KOT A;  1JRP A;  3EA6 A;  3Q3N C;  4AOF A;  2ZZP B;  3Q8B A;  5FR6 A;  2G9H D;  1JWA D;  1L6V A;  3WCQ A;  2IBI B;  3A9K A;  1FM0 D;  4N59 A;  5D2M B;  2MW5 A;  2J0J A;  2VZK D;  1LO5 D;  3URY A;  1IGC A;  1GB1 A;  3Q3J A;  3R8B A;  5CHW A;  2LEK A;  2GOW A;  3D32 A;  3BIN A;  3L16 A;  4MDK E;  3P63 A;  1FNU A;  2IGG A;  2N7J A;  3MC9 A;  4KV2 A;  2CHX A;  2M4N A;  3KWL A;  5CTR C;  3PLV A;  2VH1 A;  1NYR A;  1RM6 C;  4KIK A;  3PV1 A;  3SU8 X;  1F2R C;  5IA7 A;  4W9J A;  1WZ3 A;  1QOB A;  3HUI A;  3NHE B;  2JZ3 B;  2I1J A;  4D2K A;  3VTV A;  1PDX A;  1N62 A;  3QHT A;  2WXR A;  3UIO B;  2IO1 B;  4KGS A;  1L4Z B;  2QC8 A;  3DBR I;  5DPW A;  1EU4 A;  1XEE A;  3VQI A;  4BVU C;  4US8 A;  1AW7 A;  4MSM B;  4E74 A;  2ZCB A;  4RMA A;  2JZZ A;  2J0K A;  4LNK A;  4IG7 B;  4M0W A;  2SAK A;  3MJW A;  4BKT A;  3TEZ A;  2PE9 A;  1UNS A;  4MEL A;  3V05 A;  1JW9 D;  2IO0 B;  2KWD A;  2HTH A;  4HPP A;  3AV8 A;  1GG3 A;  2PIA A;  2OED A;  1OTR B;  2Z0D B;  2LGS A;  1WMH A;  4L23 A;  2E3T A;  1YMH E;  3K9O B;  2CS4 A;  2DX5 B;  2H88 B;  1CK1 A;  3H7P B;  4DHZ E;  3UQA A;  2K5P A;  3VTW A;  4KGT A;  2MHJ A;  3AE7 B;  3L0W B;  1C4A A;  2AEH A;  2NTS A;  3BVM A;  4MH0 E;  4ANV A;  1GNU A;  4X57 B;  2BVC A;  2IO2 B;  2IO3 B;  3QJZ A;  2G4D B;  3QA8 A;  3QK0 A;  2OJW A;  4AUQ C;  4C00 A;  2L32 A;  5C1Z A;  1VJK A;  3VFK A;  2IYD B;  3U52 E;  3AEC B;  4BAX A;  3OJ3 A;  1JWS D;  3V3X A;  2FE8 A;  1WM3 A;  5I4D A;  5LLI A;  4H2A A;  1R4M I;  5AZG A;  2DYM A;  1G6J A;  4KKJ A;  3FC4 A;  4EEW A;  3PPA A;  1FD6 A;  4WWO A;  3PHW B;  2WX0 A;  4PYU A;  2JZP A;  4C80 A;  3OJ4 B;  4R3D A;  3GP7 A;  2EEL A;  3N30 A;  4E3C A;  2LZ6 A;  4MT5 A;  3CIR B;  5D3I B;  3VR9 B;  2MBB B;  4UDU C;  1XQQ A;  1Y8R C;  1KTK A;  4IC7 B;  3NZS A;  3ZTC A;  2LJ5 A;  4P1C C;  1GAQ B;  2JSV X;  3IG3 A;  3ZIM A;  3U7D A;  3ZJU A;  2NBW B;  2W55 A;  2EMT A;  1QOF A;  1E10 A;  5DPS A;  4GN1 A;  3NUH B;  2KTF A;  3TIX A;  1V49 A;  2KAJ A;  3DWG C;  2FCN A;  1GB4 A;  3LJ3 A;  3PTF C;  2WU5 B;  3H8H A;  5FR3 A;  4L2Y A;  5E6N A;  2X8X X;  4S0R A;  4ZRP A;  1BXT A;  4LNN A;  3TJP A;  1V1O A;  1WE6 A;  3N1Z C;  2HE7 A;  3AED B;  1J0G A;  4HRS A;  2MRP A;  2H89 B;  1ACC A;  1C4C A;  2ON8 A;  5AUI A;  1JQ4 A;  3HK0 A;  1FCL A;  3IXS A;  2GRI A;  1B1Z A;  4CO7 A;  1QT9 A;  4MGI E;  1H4R A;  2IND C;  3VUW A;  4ARI A;  1E8Z A;  2M19 A;  1TJE A;  4FJV B;  4JE3 B;  4JWU C;  4IKG A;  4IW0 A;  2N7E A;  4PYZ A;  2K0P A;  3V6E B;  1SE4 A;  3IAS 1;  2KQ4 X;  3PRM B;  1IUE A;  2V3S A;  2GBJ A;  4WQM A;  1FRD A;  3BVG A;  1FFV A;  2JQR B;  3PHX B;  3PO0 A;  3P4P B;  1ZDX A;  3DBL I;  2PJH A;  4K3C A;  3DOW A;  3Q8F A;  1F1H A;  3EUB 2;  1SE3 A;  4W9C A;  5CX3 A;  2LD9 A;  2RR9 A;  1RRB A;  2PTL A;  2N9E B;  4KX6 B;  4EOY A;  5BO4 B;  3SFD B;  2L7R A;  3KYD D;  1YN4 A;  2BWE S;  3OG5 A;  1WYW B;  1WXQ A;  2NBU A;  3E9S A;  3H7P A;  3GOE A;  4WJP A;  5G5H A;  4BBN C;  2WHI A;  4OVV A;  1J7C A;  3GB1 A;  2BKF A;  2J7Q B;  2PVO D;  1WGK A;  2MWS B;  3AEA B;  1UBI A;  3J9C A;  2K9X A;  1KLG D;  3UIP B;  2DAJ A;  1HXY D;  2J52 A;  2HJ1 A;  2M1M A;  4GXB A;  3BZD B;  1L0V B;  3IBE A;  2FID A;  2G4S A;  3KH0 A;  1WY8 A;  2R2O A;  2R2Q A;  4E71 A;  2LUM A;  4HRO A;  3RNA C;  4WWP A;  1N61 A;  4LTU A;  2MP2 B;  4HCN B;  2IGD A;  4KDL B;  2M0X A;  1MJD A;  1JRU A;  2N9K A;  2IJ0 A;  2KDI A;  5C3J B;  2W3R A;  4GLS C;  1WZ0 A;  3PS6 A;  2HD5 B;  1DOY A;  1WIA A;  4FN2 A;  2EKI A;  2KC2 A;  4ICU A;  2GBK A;  3RD2 A;  4ANX A;  2KYW A;  3IT6 B;  2MJD A;  2WYQ A;  4RGN A;  1EWC A;  1MG4 A;  2VH2 A;  1YN5 A;  2Z0E B;  2UYZ B;  2WXM A;  2I1K A;  4WWN A;  3GE3 C;  2DWQ A;  4AP4 C;  2MJ3 A;  1Y56 A;  3KWV A;  2AYO B;  2LXA A;  2C9W B;  1FO4 A;  3H9D A;  3HVZ A;  2KX3 A;  2PKO A;  4WJQ A;  2RDG A;  2GBM A;  2PMV A;  2CU3 A;  2N9P C;  3T3O A;  2JYT A;  1XLO A;  3AN1 A;  3W1S C;  2KT7 A;  4J6I A;  2JWZ A;  4G50 A;  1XLQ A;  4II2 B;  3ZYY X;  4MGZ E;  2WXI A;  2YLM A;  1L6U A;  4YSZ B;  3K9P B;  1EF5 A;  2DZJ A;  3VAW A;  1N5W A;  1C78 A;  4YTN B;  3ZJT A;  3NG0 A;  2M0A A;  2M8S A;  1NEN B;  2J42 A;  3GZN I;  2AWT A;  2KKC A;  1NYQ A;  3WA0 A;  4K1R B;  4YL8 A;  3B1L X;  3IT4 B;  2RDB C;  1WH3 A;  2KMA A;  3JYU A;  4A8X C;  3JSV B;  4MAC A;  3A1Q B;  1VZ8 A;  4B6W A;  4OZA A;  1WRI A;  3CMM B;  2VZK B;  4FAD A;  2BKR B;  2INP E;  3AEB B;  1PUT A;  2N4F A;  2GI9 A;  3ONS A;  1QIL A;  2K8H A;  4NQK E;  1F77 A;  1ZP0 B;  2JF5 A;  2DNF A;  1KFY B;  5FK9 C;  3NZU A;  3NVY A;  1L2N A;  1WGR A;  3KUD B;  1E9M A;  4ARC A;  5D7G A;  2OJR A;  2YEP B;  4LK0 M;  5J18 A;  1LQB A;  4DDI D;  5IAA C;  4AWJ A;  1L0Y B;  4FLH A;  3V6C B;  3M62 B;  3CWI A;  4LDT B;  1C79 A;  2RDH A;  4C7Y A;  4RM8 A;  5AEK B;  5HFY A;  3B0A A;  4JGH B;  2L1A A;  2MJE A;  1E8Y A;  2FBW B;  3O13 A;  1IGD A;  4FJY A;  1DOI A;  2QDF A;  1WE7 A;  3DHG C;  4I6P A;  4YWG G;  4WJO A;  3DBS A;  1KLU D;  3AE3 B;  1UGM A;  3OWE B;  2BBC A;  4M00 A;  1ENF A;  2DZI A;  3RI7 C;  1SXT A;  2REX A;  2HJ8 A;  2DEN B;  1I35 A;  2MP2 A;  1FMA D;  1IPG A;  4ITK A;  1A70 A;  2I2Y A;  1I4R A;  4TQ1 A;  1ZOY B;  4DDG D;  2FIF A;  1D5Z C;  3BY4 B;  2K8B A;  4ZRJ A;  4GGQ A;  2CKH B;  3RMK C;  1KRH A;  3L4P A;  4HLE A;  3W5V B;  4FA6 A;  1NEK B;  4HWI B;  4RGT A;  4B95 A;  2GB1 A;  2NTT A;  1E7P B;  3AU4 A;  3ZW3 A;  3QC8 B;  3UF8 A;  2L0T A;  1I4H A;  1E6E B;  4XWW A;  5IN7 A;  2GLS A;  3AMZ A;  3U8Z A;  3TEX A;  2KZR A;  2KWC A;  3Q8C A;  4BKS A;  1K8R B;  3PRP B;  1VDV A;  3DVG X;  1OGW A;  4YXD B;  5C2T B;  1WFY A;  1GC7 A;  4DXA B;  4HPM B;  1TKY A;  1OFF A;  3B2F A;  1C76 A;  4MJS B;  1J19 A;  3RUI B;  2RD0 A;  1V6E A;  3VDZ A;  4HKQ A;  1Q5W B;  2AQ3 B;  2W9N A;  2BB6 A;  4K3B A;  4HVB A;  3A4S C;  1J8C A;  2WXL A;  1JML A;  1V9J A;  2AQ2 B;  1P7E A;  2N1V A;  2RGF A;  3FKY A;  2MBH A;  1ISN A;  4B9K A;  3JSV A;  3A1Q A;  2CR5 A;  1WWT A;  2W54 A;  1XF5 L;  4P1B C;  1SJE D;  1FNW A;  1ZE3 D;  1V2Y A;  1F0Z A;  4C4V B;  1T6B X;  4PS7 A;  4NY0 A;  4XDD A;  3R7R A;  2G3Q B;  2W82 A;  3PGE A;  1WX9 A;  2XN9 C;  3B2G A;  5D94 A;  2WXN A;  4ANW A;  4W9E A;  4ZRQ A;  1M4V A;  1LFD A;  2WDR B;  3I57 A;  2JU6 X;  3Q6B A;  3EFC A;  1HZ6 A; 
#chains in the Genus database with same CATH homology
 1YNT E;  2KQ4 X;  1IUE A;  1UUP A;  2IPK D;  1VZ7 A;  4WQM A;  2X38 A;  3NVW A;  1FRD A;  3BVG A;  1FFV A;  2JQR B;  2XNA C;  1XLP A;  3PO0 A;  2RPV A;  1GOZ A;  3N9Y C;  3P4P B;  2L52 A;  1ZDX A;  5TSS A;  4A90 A;  3Q69 A;  2WLB A;  2K3U A;  3W1S A;  4HKZ E;  1I7H A;  2BB5 A;  3Q8F A;  2QSD A;  4YTM B;  3EUB 2;  3U2S C;  1SE3 A;  2WP9 B;  2QJL A;  2KDM A;  1GPX A;  2LMC A;  1CJE A;  2PTL A;  1R7S A;  1AN8 A;  1FCC C;  4KX6 B;  4IDI A;  1QOA A;  1QKZ A;  3BII D;  1FEH A;  2B76 B;  1N5X A;  3SFD B;  4ZHO A;  2ACZ B;  1HQR D;  4FXC A;  2V3P A;  4JWS C;  2IDY A;  2Z8L A;  1YN4 A;  3FAH A;  1FXI A;  1ZPS A;  3TEY A;  1WXQ A;  3SR6 A;  3E9S A;  4TQ0 A;  3VRA B;  5G5H A;  2WDV B;  1RWS A;  5BMH A;  3P4S B;  1J7C A;  3GB1 A;  1J7A A;  2HDE A;  1IBX B;  2WDQ B;  5EE3 A;  2PVO D;  1WGK A;  3AEA B;  4OZC A;  3SFE B;  3AE1 B;  3J9C A;  3KLS X;  2K9X A;  1KLG D;  1I4X A;  4RCO A;  1K51 A;  2R61 A;  3AE8 B;  1HXY D;  4Q2J A;  2J52 A;  1Q10 A;  2WXJ A;  1AWD A;  1TKG A;  3MP9 A;  2LJI A;  3BZD B;  1CZP A;  4WUR A;  4REZ A;  1SEB D;  1L0V B;  3ZJV A;  4NAW B;  3UI3 A;  1BML C;  2LFI A;  1TYG B;  1XCQ L;  1FFU A;  2J4X A;  1PGA A;  4AQ7 A;  4USA A;  2LUM A;  4US9 A;  4HRO A;  3SEB A;  4JPS A;  1I4P A;  5EE1 A;  3U7Z A;  2D5G A;  1N61 A;  3BYT B;  4LTU A;  1JAL A;  4P6V F;  3RFZ B;  4A6Q A;  1STE A;  5GXG B;  3BYY B;  2IGD A;  1ET9 A;  3BK1 A;  3NVZ A;  3NZ3 A;  4NAM A;  5BYR A;  4CQN A;  2JYE A;  2N9K A;  2WXG A;  2IJ0 A;  1V97 A;  1VRA B;  1YQ3 B;  4GDL B;  4XDC A;  5C3J B;  2KAC A;  1TY2 A;  1YJJ A;  2W3R A;  4GLS C;  3GS2 A;  3IAM 1;  5AUK A;  5G5G A;  1L5P A;  4WIP A;  1I4G A;  2DYO A;  1DOY A;  1UGJ A;  3ABV B;  2EKI A;  4YTP B;  4ZHP A;  1SBB B;  4DXG A;  3IT6 B;  1TKE A;  2L83 A;  2MJD A;  4RGN A;  2DBY A;  1EWC A;  5FKA C;  5D3D A;  1OQQ A;  1YN5 A;  5T8I A;  2WXF A;  3FIL B;  4MM3 B;  2WXM A;  1HZ5 A;  2E6X A;  2BTE A;  2DWQ A;  2QMT A;  1ZDV A;  2MJ3 A;  1Y56 A;  3RPF C;  3W2D A;  4ZYS A;  1VZ6 A;  1SF0 A;  1QLB B;  2V3N A;  3KWV A;  5BMI A;  1I4Q A;  1FO4 A;  4RF1 A;  1C4P A;  1K52 A;  1V8C A;  4RH6 A;  3HVZ A;  2WXH A;  2AX5 A;  2PKO A;  2IGH A;  1ET6 A;  2RDG A;  2INN E;  3LB8 C;  2PMV A;  2CU3 A;  1T3Q A;  3T3O A;  2JYT A;  1XLO A;  4J3O D;  1ZXI A;  3AN1 A;  1ROE A;  4RGM A;  2QEJ C;  1XLQ A;  3BWU D;  3ZYY X;  1T5X D;  1DYQ A;  2LHD A;  2Y5C A;  1E0Z A;  4TMA B;  2WXI A;  4L1B A;  3U4E G;  1EWY C;  1L6U A;  4IOI E;  4YSZ B;  3LXF A;  2K22 A;  2QIE B;  1MI0 A;  1N5W A;  3AE6 B;  3AH7 A;  1C78 A;  4YTN B;  3ZJT A;  4PT5 A;  2M0A A;  1WYG A;  1NEN B;  2ZW1 A;  2J42 A;  4YT0 B;  1QF6 A;  1SB3 C;  5E6J A;  3HVD A;  1NYQ A;  3PZ8 A;  1FRR A;  1B9R A;  3AB5 A;  3VRB B;  4B0M A;  2TSS A;  3R2I A;  3IT4 B;  1J7B A;  4A8X C;  4O1N A;  4TSS A;  4MAC A;  1JCK B;  5H8Y E;  3EGR A;  3NRZ A;  2I38 A;  1VZ8 A;  3AEE B;  3ETR A;  4OZA A;  1WRI A;  1OQR A;  1V1P B;  3C8Y A;  4YSY B;  1DOX A;  2VZK B;  2WXP A;  2INP E;  2CJN A;  4ZOH C;  1VR9 A;  3AEB B;  1PUT A;  1SSN A;  2KN4 A;  3NVV A;  3I9V 1;  3B9J A;  2GI9 A;  4XE0 A;  1QIL A;  1TS2 A;  2N9L A;  1N60 A;  1QQR A;  3P4R B;  1C77 A;  1F77 A;  1JRP A;  1RFK A;  3EA6 A;  1ZP0 B;  3Q8B A;  4AS1 A;  4A55 A;  2G9H D;  1MVK A;  1SIJ A;  1KFY B;  1K53 A;  5FK9 C;  3NVY A;  1JWA D;  1HA5 A;  1L6V A;  4N59 A;  3WCQ A;  1FM0 D;  4OZB A;  2Y3A A;  4P16 A;  1PGX A;  2VZK D;  1LO5 D;  1E9M A;  4ARC A;  3AEG B;  5D7G A;  1CQV A;  2YEP B;  3URY A;  1IGC A;  2WQY B;  4LK0 M;  1GB1 A;  4WAF A;  3R8B A;  2LEK A;  3PZ7 A;  2BT6 A;  3DWM A;  2W3S A;  1XO3 A;  2WXK A;  2PVG C;  2QIL A;  3Q8E A;  3P63 A;  1FNU A;  1L0Y B;  2LGI A;  4MH8 A;  5H92 C;  2MEK A;  2IGG A;  4GDK B;  4DXF A;  3CWI A;  2N7J A;  1VLB A;  5BMG A;  3KWL A;  1C79 A;  1UWM A;  3NS1 A;  1IBX A;  2RDH A;  4RGO S;  4C7Y A;  1NYR A;  1RM6 C;  5HFY A;  1F2R C;  2NMQ A;  2L1A A;  4N6E B;  2MJE A;  1QOB A;  3HUI A;  1D4B A;  4N58 A;  2FBW B;  2JX5 A;  1AYF A;  1TS3 A;  3O13 A;  3E56 A;  1IGD A;  1PDX A;  4D2K A;  1N62 A;  4NJC A;  3W9C B;  1D5M C;  4OW0 A;  3AE4 B;  1DOI A;  1JRO A;  2WXR A;  4KKI A;  2V4I B;  3AE5 B;  4KGS A;  1L4Z B;  3P1M A;  1EU4 A;  1XEE A;  4YWG G;  4XWT A;  1JWB D;  3VQI A;  4EE2 A;  2HTM E;  1FXA A;  1AW7 A;  1KLU D;  4C56 C;  4US8 A;  1FIQ A;  3AE3 B;  1BUI C;  2ONQ A;  3OWE B;  1NI3 A;  2BBC A;  4M0W A;  3BVZ A;  1ENF A;  2SAK A;  3AEF B;  1SE2 A;  3V05 A;  1UNS A;  3TEZ A;  5BYS A;  1JW9 D;  1NVI D;  2KWD A;  1SXT A;  1D6E C;  4OHJ A;  1KH0 A;  2AQ1 B;  1HEZ E;  1K50 A;  3AV8 A;  2M56 B;  2PIA A;  2OED A;  1FMA D;  4ITK A;  3MFG A;  1PYW D;  5HG2 A;  1A70 A;  2I2Y A;  1PGB A;  1I4R A;  4L23 A;  2E3T A;  4TQ1 A;  3TUO A;  1YMH E;  1ZOY B;  3LYY A;  4KGR A;  2H88 B;  1CK1 A;  1ESF A;  1JWM D;  1D5Z C;  1ZUD 2;  2K5P A;  1DGJ A;  1PFD A;  2Q5W D;  4KGT A;  3MJ5 A;  3AE7 B;  1C4A A;  3R2T A;  1KRH A;  3L4P A;  5MPO A;  2NTS A;  3BVM A;  3W5V B;  1NEK B;  4RGT A;  1YN3 A;  2GB1 A;  2NTT A;  1E7P B;  1RYJ A;  1UWX A;  4NZL B;  3FIL A;  1XLN A;  1C9F A;  2FUG 1;  1I4H A;  1E6E B;  4XWW A;  1QOG A;  2L32 A;  5JXV A;  4A9A A;  1MHX A;  3BK2 A;  2RMM A;  3AMZ A;  1VJK A;  1FNV A;  3U52 E;  3AEC B;  2LHE A;  1JWS D;  3V3X A;  3TEX A;  3TSS A;  1SJH D;  2FE8 A;  2WNM A;  2KMM A;  3Q8C A;  5I4D A;  4H2A A;  3MC0 B;  2DYM A;  1L0X B;  3Q8A A;  1VDV A;  4KKJ A;  3FC4 A;  4YXD B;  1FD6 A;  3ZQ4 A;  1MHH E;  1ZXH A;  5C2T B;  2ICI A;  2WU2 B;  1TS5 A;  2JZP A;  4RF0 A;  1L4D B;  1TKY A;  1YJI A;  1KF6 B;  1OFF A;  4R3D A;  3B2F A;  4C80 A;  2YEP F;  1C76 A;  3GP7 A;  4HEA 1;  2EEL A;  4MT5 A;  3CIR B;  4RFB A;  4HKQ A;  2DLB A;  5D3I B;  3VR9 B;  1MPE A;  1TZO A;  4UDU C;  2AQ3 B;  3AE2 B;  2BB6 A;  4WH4 A;  1KTK A;  1JWU D;  2ZW0 A;  3ZGZ A;  2WXL A;  1GAQ B;  1JML A;  2JSV X;  3T3N A;  3ZJU A;  3KQ4 A;  5EE9 A;  2W55 A;  2AQ2 B;  2N0S B;  1QOF A;  1E10 A;  1D5X C;  1P7E A;  2SEB D;  4B0E A;  2BS3 B;  3NUH B;  2Y5P A;  5EE0 A;  1EM7 A;  3MHZ A;  2BYT A;  3P42 A;  3TEW A;  2BS4 B;  2KAJ A;  3DWG C;  5LNK 1;  1V1P A;  2JXT A;  1GB4 A;  1XCT L;  4HJG E;  2WU5 B;  3H8H A;  5FR3 A;  4L2Y A;  1WWT A;  2BW2 A;  2JWU A;  1TY0 A;  2BS2 B;  2W54 A;  1XF5 L;  1F2R I;  1SJE D;  4ZRP A;  1BXT A;  4WWM A;  5BYQ A;  3HRD D;  1EU3 A;  4JX1 C;  3W5U B;  1FNW A;  1P7F A;  1V1O A;  1ZE3 D;  3P4Q B;  4DQO C;  1F0Z A;  1XXG A;  2J53 A;  3AED B;  2WXQ A;  4HRS A;  4C7Z A;  1T6B X;  2H89 B;  1WSP A;  1ACC A;  1C4C A;  2ON8 A;  5AUI A;  1JQ4 A;  4XDD A;  1FCL A;  2W82 A;  3IXS A;  2G1E A;  2WS3 B;  2GRI A;  1B1Z A;  1QT9 A;  4LLG M;  3AE9 B;  3IAS 1;  2XN9 C;  5HI1 A;  3B2G A;  4OVZ A;  4ARI A;  2WXN A;  2M19 A;  3AM9 A;  4YSX B;  2V0G A;  1TJE A;  3VR8 B;  4ZRQ A;  1M4V A;  2CJO A;  1TS4 A;  1N63 A;  2PW9 A;  2PLP A;  2WXO A;  4JE3 B;  2MH7 A;  4JWU C;  1YQ4 B;  2WDR B;  4IKG A;  3I57 A;  4RNA A;  2JU6 X;  2K0P A;  2OHF A;  1SE4 A;  1HZ6 A;  5HHD G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...