3QX1A

Crystal structure of faf1 ubx domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
MEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FAS-associated factor 1
publication title Dissection of the interaction between FAF1 UBX and p97
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 25
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3qx1A00
4AOFA 4EZLA 4HWIB 3CSFA 1XT9B 2Z0DB 3A9JA 2L8JA 4W9IA 2EMSA 2V4LA 2ZPYA 2LGXA 1JRUA 2MW5A 3TCAA 2CKHB 3EECA 4X57B 2LXCA 3PREA 3Q3FA 4MELA 3L54A 2XK5B 4MGIE 5E6OA 3RUIB 4ASWC 1GJZA 4MH0E 4A3PA 4DDGD 4DHJB 1EO6A 3V6EB 4A20A 2MWSB 2UWQA 2GBJA 3RZWC 3APCA 2K8CA 1D3ZA 2O6VB 1IYFA 2KTFA 3Q3JA 2KKCA 2XK5A 5AZGA 3WANA 1E90A 1OEYJ 2BWES 2ZCCA 3DBLI 4CO7A 2KQ7A 2KZRA 3NHEB 3KUZA 4RMAA 1TZ1A 1WR1A 4FJYA 4HDQA 1J19A 4GOCA 2O6VA 4GIVA 1WXVA 1WMHA 2N7EA 2KMAA 2O6VD 4KDLB 5JZEB 1WXSA 3QWZB 3ZKJC 1TGZB 2C7HA 3RT3B 1WJNA 4II2B 1WZ3A 3ZO5B 2ZZPB 5DPTA 3ZLZA 3ZDTA 4B9KA 2PEAA 3QCAA 1WY8A 2PJHA 4NQLB 4OVUA 2IO1B 1WXMA 4KDIC 3V6CB 2G3QB 3EFUA 2A5UA 3V61A 2NPTB 2EKEC 3PRZA 2N4FA 4WWNA 4BFRA 4AP4C 2KHWB 4FJZA 3M95A 5J17A 2CHZA 3QX1A 1LFDA 4IWQA 2L76A 4JIOU 1WGYA 5DPSA 2KJHB 3KUDB 2BPSA 4LJOB 2DZIA 1GC6A 5CTRC 2C5LC 1KM7A 2C7NB 3CSTA 2FCMA 3VTWA 5CX3A 3PRMB 3VUXA 2N9XA 4FJVB 1GG3A 2ZPNA 1V9JA 2DZJA 3DCGA 2DENB 3BINA 3NS8A 4DBGA 3MTNB 3NOBA 4URKA 1C1YB 2CU1A 2KLGA 3APDA 4ICVA 2M1MA 4GDKB 1WJUA 2JF5A 3SU8X 3VVWB 3HHMA 1GUAB 3H7PB 4ANWA 1UBQA 3HIZA 4CHKA 2LGYA 3ZTDA 1RRBA 4WWPA 2KO3A 3PVLA 4M8MA 3JYUA 3DDCB 3ZNZB 1V81A 2RSUA 3VXWA 2JUOA 4WJOA 3PPAA 3IG3A 1GNUA 1Y8RC 4MJSA 3PTFC 3ZDMC 2ZNVC 2DYMA 2LRUA 2KTRB 4W9HA 3H6NA 3X0WA 3PSEB 3NZSA 4IM0A 1R4NI 4F1SA 4BOSC 2I1KA 2HD5B 5FR6A 2OJRA 4DK5A 2ZVNA 2EMTA 3ZRCA 2MQJA 1QZEA 2N7DA 2WYQA 2AEHA 2KDBA 5LLIA 3ML8A 2KTRA 1UZXB 4B95A 2KOXA 1WX8A 3VHTC 2KC2A 2D10A 4ZDVA 1C3TA 2KNBA 3PGEA 1WGGA 2BKFA 2MBHA 2K1FA 4TKNA 2MRPA 1ZW7A 1E8WA 4CYEA 2D3GA 1TBEA 1I35A 2LUEA 2PPHA 1WGRA 3MHSD 4LCDE 3UIPB 2B3AA 1T0YA 2HE7A 2M8SA 4IG7B 3V60A 2ZVOA 1CMXB 1WJ6A 1KJTA 3A9JB 1E5WA 2D07B 2KDFB 2C60A 2BYVE 3ZW3A 1LM8B 2R2QA 5JHAA 2RD0A 3UIOB 4HPLB 3VTVA 2DYBA 3DBRI 4F8CB 2KC1A 1EF1A 1WGHA 4WJQA 2BWFA 4BKSD 1V80A 3ZTCA 3SHQA 2JRIB 1Q0WB 1WR6E 4K7WA 3ENEA 1ISNA 4E71A 1P1AA 2NVUI 3JW0X 3R66C 4GB9A 2MCNB 1NI2A 2V1YA 1BT0A 3VUYA 2JWZA 4JGHB 3DVNU 4BBNF 2LVOA 2MP2A 2LJ5A 2N9EB 4ICUA 5D2MB 4ZRJA 1XD3B 2GBRA 3AXCA 3LDZE 1YJ1A 1AARA 4WAAA 2C7MB 3WAOA 4HLEA 4GMVA 2LASA 3PRPB 1WMHB 5TR5A 4NAWB 1RAXA 3DVGY 1WX7A 2MBBB 4EZJA 3KUCB 3WA0A 2DX5B 5D7GA 2NBVB 3O65B 3ONSA 3UF8A 2GBKA 3NZUA 4TV3A 1OQYA 1KOTA 3AULA 2NR2A 4NAWA 1V49A 4AUQC 3TBLD 3OJ3A 2LRWA 3IFWB 1WM2A 2G45B 3DPDA 2FIFA 2MBOA 4W9FA 2AL3A 2LVPA 4GDLA 3AI5A 2RR9A 4EEWA 3QA8A 1J8CA 3IBEA 4MSMB 4BKGA 2JVCA 4IM3A 1LQBA 3VDZA 4DXAB 3SDLC 3U7DA 4PS8A 3B0AA 5E6PA 2N1WA 4AJWA 2NS5A 2UYZB 4NJ7A 3EC8A 3LJ3A 4K81A 2NBWB 1J0GA 4HK2A 1IPGA 4G3XB 2N9PC 2FCNA 4I6LB 4I6PA 4OVVA 5CHFA 2BYEA 2FIDA 5C1ZA 2HJ8A 3JVZX 2LXAA 5KHOA 1X1MA 2G4DB 2YVCA 3DQVA 1TTNA 1E7VA 3GZNI 4G50A 4GGQA 4RM8A 1E8ZA 1WE7A 3RYTA 1OGWA 3IVFA 1OTRB 4HPMB 1WXAA 4TQ1A 4KZCA 4W9JA 4KZ0A 3A1QB 1WX9A 4IUMB 3CMMB 3N3KB 4MJSB 3V62A 2BF8B 1SIFA 1UELA 1YQBA 3KYCD 4NPNA 2XBBC 2K39A 5IAAC 2MBQA 3VH3B 2J0JA 4WJPA 1A5RA 1I42A 1YIWA 2CR5A 5IA7A 3K9OB 3PS6A 5L95C 2IBIB 2D11A 4EFOA 2JZZA 1S1QB 2GMIC 3A1QA 3PHWB 3ZNID 4K7SA 1EUVB 2FCQA 2IY1B 3QQ8B 4XX5A 4A3OA 3T9LA 2ZEQA 4EUTA 4DWFA 3A33B 3M3JA 1UBIA 3UINB 1G6JA 2DAJA 2LZ6A 1V2YA 3TL5A 3VUWA 4MEMA 4AJYB 1UGMA 1UD7A 3KW5B 5AEKB 5KHQA 3QHTA 3ALBA 4BVUC 4HCPB 4HXDA 2PE6B 2D2QA 2J0KA 2M17A 4I6NB 2XEWA 2MA9B 4YL8A 2KD0A 4NQKE 5LXIB 3PT2B 2K6DB 4DHZE 2DAFA 3D32A 4KSLC 2R2OA 2KDEB 3SD5A 1S3SG 3VAWA 1WM3A 3KH0A 3M63B 3UQBA 3KVFB 2DHZA 2BKRB 1HE8A 5DPRA 4TQ0A 3RULA 2L3ZA 3NY5A 1Z2MA 5D6JB 2KFKA 2YLMA 2CHWA 3DBSA 4JLCA 3A4SC 3HM3A 1ZKHA 2KMCA 2KQSA 3ZIMA 3L13A 2IZVB 3ECIA 4KIKB 4LDTB 2WDTB 3N30A 2LGDA 3W1YA 3ML9A 1P98A 2N1VA 2JY6A 4M8NA 2KWUB 1P9DU 2IO0B 2M0XA 2ZJDA 2RGFA 5G55A 4W9DA 1YD8U 1V5OA 1Z5SB 3ZUNA 4ANVA 3OLMD 5JHBA 4KIKA 4LDTD 2RPQA 3QJZA 4W9CA 3ZRFA 4BKSA 2MP2B 4MGYE 3B08A 4B6WA 1RLFA 3L17A 3WIMA 3L10B 4BKTA 3OAWA 2AWTA 3R3MA 2KWVB 2LWPA 3VH4B 1WFYA 3CF6E 1YX6B 2HTHA 4II3B 3TMPB 2NCNA 5J2RA 1K8RB 2LVQA 2KX0A 4XZ4A 3C0RB 2C9WB 3PV1A 3A9KB 4XC2A 3QARA 1WYWB 2REXA 3GOEA 1V5TA 4FHJA 2WX1A 4FA6A 3H9DA 5DPWA 4PYZA 4KSKC 1SGHA 4NY0A 3L0WB 4NNJB 3S2AA 3W1SC 2FAZA 2MBEA 3U30A 1SE9A 3A9KA 2QHOA 3I3TB 4GDLB 2L7RA 2IY0B 2Y5BB 2K8HA 3H7SA 4G0NB 2IO2B 2MSED 3A4RA 2J7QB 4ZRIA 4ANXA 4WQOB 2ZCBA 2ASQA 3PHXB 2VRRB 2PE9A 3H1UA 5E6NA 4IM2A 4NJ6A 2MLBA 4J6IA 4W9LA 5HKHA 1Q1OA 2GOWA 2GBMA 3RD2A 2KLCA 3APFA 3DVNV 1U4AA 5LXHA 1ZGUB 1OEYA 3RCZA 4BBNC 1UH6A 5G2NA 3L16A 3UGBB 2KK8A 1GC7A 2M4NA 1E7UA 3HM6X 4DHJD 4DDID 4AWJA 2KANA 4MGZE 1V86A 4RM9A 3DVGX 4W9KA 3WALA 2JXXA 1IP9A 4WJNA 4F7ZA 2K8BA 3AU4A 1EF5A 1WGDA 4HVBA 1F9JA 1E8YA 1NBFC 1WI0A 2L0FA 2L05A 3W1SA 2BGFA 3IHPC 2Z59B 4GXBA 4W9EA 3R7RA 2K25A 4GN1A 3TIXA 3VTUA 3BY4B 4MGKE 5CHVC 5J18A 4GSWA 3QIJA 4DHZB 4G11A 3T8MA 4FULA 2LI5A 4PS7A 1H4RA 1NDDA 5DCNA 3PLVA 4K1RB 4EZKA 1WE6A 1RFAA 2JT4B 2KDIA 4JL9A 2KX3A 4P7IA 2I1JA 2O2VB 2AL6A 4BOZB 2JZ3B 5AZHA 2JRHA 1E8XA 1L2NA 4FN2A 3WAPA 5L83A 2L0TA 4E3CA 1WRDB 2NPTA 1R4MI 4EOYA 5GMVA 5EDSA 4ZRKA 4ZYNA 4ANUA 2FCSA 3UQAA 4LJPB 1P0RA 1MG8A 2O2VA 2IYDB 4IWOA 1WJ4A 4PS3A 3JSVB 4MM3A 4W9GA 5AZFA 1WZ0A 1LXDA 4IW0A 3U8ZA 2DZKA 3B1LX 4IC7B 3QK0A 3N32A 2CS4A 1V6EA 3X23A 3TJPA 3RZFA 2WX0A 3P2BA 4IWPA 2KFKB 2OOBB 1YX5B 2NBUA 5BO4B 3JSVA 4GDKA 2J0MA 4FHKA 4M0WB 2DZMA 2FNJB 3H7PA 3DBHI 3DOWA 2KVRA 4MSQB 3OJ4B 1WH3A 1H8CA 2CHXA 2FUHB 4HCNB 2Z0EB 1WF9A 3VQIA 4EKUA 5JH5C 3KYDD 2W9NA 3AU5A 4FBJB 5D94A 2L00B 4GU2A 2JPHA 2G4SA 3M62B 3ZVVA 4KV2A 4K7UA 4N9F4 3L08A 2ZNVB 1VD2A 4E74A 2MX2A 4FLHA 1M94A 2K6QA 2KN5A 4HJKA 2KXJA 2V3SA 4MDKE 3VFKA 5C23A 2AYOB 4HDOA 1VCBA 2DYOA 1FXTB 4JQWC 2WWZA 5CHWA 4KVGB 3ZNGC 3K9PB 2A4ZA 4PYUA 3PZDA 1WIAA 2KJRA 4TUUA 3R7QA 3ZNHB 3PLUA 1Q5WB 3WAMA 3QC8B 1L7YA 2GBNA 3QAQA 4WWOA 1P3QU 1XQQA 2KWCA 1KLVA 3HK0A 3MJWA 2KFJA 2BYFA 4FADA 1PQSA 2KJ6A 2LD9A 3EHVA 2IO3B
chains in the Genus database with same CATH superfamily
1SEBD 2VZKB 5FK9C 4YTMB 2Z0DB 3A9JA 1SE4A 2EMSA 1FEHA 2V4LA 2WDQB 2LGXA 3TCAA 1K51A 4A3PA 4DHJB 3AEAB 2UWQA 4REZA 3RZWC 3BIID 1D3ZA 2KKCA 1E90A 2BWES 3DBLI 2KQ7A 3KUZA 1SE2A 5JZEB 2O6VD 1WXSA 1RWSA 3ZKJC 2C7HA 3ZO5B 3ZLZA 4LTUA 4B9KA 4ZRQA 4NQLB 1WXMA 3V6CB 2G3QB 2EKEC 2N4FA 2KHWB 4FJZA 2CHZA 3QX1A 1LFDA 1XLPA 3VRAB 1NEKB 1MJDA 1UNSA 2OHFA 4DQOC 5CX3A 5JXVA 4FJVB 4TMAB 1L0VB 3BINA 3APDA 4ICVA 1WJUA 2JF5A 3SU8X 5BYQA 3H7PB 4ANWA 5IN7A 2K3UA 2QSDA 1RRBA 3RNFC 4OVZA 2KO3A 3PVLA 3Q3OC 3JYUA 3ZNZB 3J9CA 2MJEA 1Y8RC 2W82A 3PTFC 4M00A 3P63A 4W9HA 3RNGC 1YN4A 4F1SA 1VLBA 1T6BX 2W54A 3U2SC 2EMTA 4RGNA 1QZEA 3AE1B 4NZLB 1KF6B 4RGOS 1GB1A 2KTRA 1DOYA 2XN9C 1WX8A 2D10A 2BT6A 1ZW7A 3Q8BA 1FM0D 4CYEA 1I35A 2LFIA 1OFFA 2JYEA 3U52E 3MHSD 3TEXA 1C78A 2FE8A 2M8SA 1WGKA 1F52A 3AE2B 4IOIE 3A9JB 2D07B 2C60A 1CQVA 5JHAA 2DYBA 2PLPA 1FCLA 2J4XA 3BYTB 4WJQA 3GE3C 5EE1A 1Q0WB 4K7WA 2IJ0A 1JROA 4S0RA 2NVUI 1F77A 4J3OD 2W3RA 1BT0A 2JWZA 3VR9B 3DVNU 4WWMA 2GBRA 3LDZE 1TKEA 1YJ1A 4WAAA 2C7MB 3WAOA 3ZJUA 1RAXA 3DVGY 4B0MA 4EZJA 2WXKA 3KLSX 4KGTA 2GBKA 2JU6X 3TBLD 3IFWB 2G45B 1C77A 1RFKA 3DPDA 3GS2A 2MH7A 2K22A 4GDLA 2RR9A 2JVCA 4DXAB 3LXFA 3VDZA 3SDLC 4PS8A 3B0AA 4AJWA 3EUB2 2NS5A 2UYZB 3RFZB 4HK2A 1IPGA 1FMAD 3JVZX 2JZPA 2N9KA 4M02A 5KHOA 2G4DB 4G50A 3R8BA 2LUMA 3RYTA 3AEDB 1WXAA 4W9JA 3A1QB 1WX9A 4IUMB 3CMMB 1MHXA 2ACZB 3V62A 1YQBA 3AE8B 2J0JA 1A5RA 1I42A 4HJGE 5GXGB 2CR5A 2WXOA 3PHWB 5BYRA 4XX5A 2BB5A 2JWUA 2ZEQA 2E6XA 1N5XA 2I2YA 2LZ6A 3VUWA 1UGMA 1UD7A 3QHTA 2WXFA 2PE6B 2D2QA 2N7JA 5EE0A 1C76A 1T0SC 2PIAA 2XEWA 2L32A 4KSLC 2R2OA 3SD5A 1S3SG 4EE2A 2KWDA 3KVFB 2ICIA 2DHZA 1HE8A 4TQ0A 3SR6A 4JLCA 3HM3A 3C8YA 3L13A 2IZVB 3ECIA 2WDTB 2LGDA 1I7HA 1P98A 2N1VA 2ZJDA 5G55A 3OLMD 4OZCA 1KLGD 3P1MA 4BKSA 3WIMA 3AV8A 2AWTA 1WFYA 2WXRA 3BK1A 4II3B 3Q8EA 2DLBA 3AEGB 1TIFA 1WWTA 1V5TA 4RNAA 3N9YC 4FA6A 3AE6B 5DPWA 3AE9B 4PYZA 4NY0A 1YQ4B 3MC9A 3U30A 3A9KA 1C4AA 4GDLB 2L7RA 5D94A 2IO2B 4YTPB 1I4PA 3A4RA 4ANXA 2MLBA 2WXJA 1R4NB 4J6IA 1SJED 2GBMA 3RD2A 4CQNA 1OEYA 3Q6BA 5G2NA 3MC8A 3HM6X 2KANA 1V86A 4ARCA 2JXXA 4WJNA 2K8BA 3AU4A 4HVBA 1F9JA 1E8YA 1NBFC 4ZOHC 3R7RA 3QIJA 4JPSA 1BXTA 4PS7A 1H4RA 4K1RB 1SJHD 4LNFA 2KDIA 3DBRB 1VZ6A 1BMLC 2K9XA 5AUKA 2WU2B 1E8XA 3WAPA 1WRDB 2NPTA 1R4MI 1JMLA 5GMVA 4ZYNA 4XWTA 1MG8A 2WNMA 4IWOA 4RCOA 1WZ0A 2NTSA 2DZKA 2KT7A 1C79A 1QF6A 4IWPA 2OOBB 2NBUA 1KFYB 5BO4B 2M0AA 4GDKA 4M0WB 2FNJB 3DOWA 2LHDA 2ON8A 3TEZA 2CHXA 2Z0EB 1WF9A 4EKUA 1XLQA 4A6QA 4A9AA 1PGAA 3L4PA 3RI7C 1JWUD 2I38A 3L08A 3VFKA 2AYOB 4HKZE 2R61A 4YXDB 1FXTB 1N63A 3GZNB 4PYUA 3ZNHB 1JALA 3R7QA 2VH2A 4RF1A 2GLSA 2KACA 1YJJA 2WXIA 1P3QU 3HK0A 3MJWA 2KFJA 3MC0B 4HWIB 2YEPB 3RNBC 1JRUA 2MW5A 3EECA 4XDDA 4X57B 5E6OA 3Q3FA 4MELA 3NJTA 2XK5B 4MGIE 3RUIB 3HVZA 4MH0E 4L2YA 3V6EB 4A20A 1A70A 1FNVA 2O6VB 5HFYA 2MJ3A 2KZRA 1PGBA 2KDMA 4FJYA 3BYYB 1VJKA 1J19A 3IAM1 4WH4A 2KMMA 4GIVA 1WXVA 2G1EA 2KMAA 2XNAC 3MFGA 3RT3B 2D3AA 1WJNA 1WZ3A 2SAKA 5DPTA 2INNE 4H2AA 1WY8A 1KTKA 5D3IB 3EFUA 2NPTB 5J17A 4IWQA 5DPSA 2KJHB 4N58A 1XLNA 4LJOB 3PRMB 3ZJTA 2ZPNA 1YOVB 2DENB 4URKA 1KLUD 1C1YB 2KLGA 2GI9A 4GDKB 4A8XC 3HHMA 3V05A 1TKYA 1E6EB 3HIZA 4CHKA 1PYWD 4M8MA 1LGRA 4K3CA 1L4ZB 4WJOA 3PPAA 3TEYA 1GNUA 4JWUC 3ZDMC 2ZNVC 2DYMA 3H6NA 3NZSA 2HD5B 4ZRPA 2MQJA 2WYQA 5LLIA 1UZXB 4WURA 1TT5B 4ZDVA 1C3TA 2KNBA 3PGEA 1VR9A 2BKFA 2MBHA 4TKNA 1TBEA 1WGRA 1NYRA 4LCDE 2B3AA 2WU5B 2ZVOA 1D6EC 1WJ6A 1KJTA 3AECB 3DWGC 2BB6A 2JQRB 1E5WA 2KDFB 1T3QA 1LM8B 2RD0A 3UIOB 4HPLB 4F8CB 1ESFA 1EF1A 2Q5WD 2BWFA 4BKSD 2JRIB 5BMIA 2GRIA 1ISNA 1P1AA 3JW0X 4N59A 2INPE 4LNNA 1TS5A 2N9EB 4ICUA 5D2MB 1XD3B 1AARA 1F2RC 4GMVA 4NAWB 3EFCA 2DNFA 3AEBB 3KUCB 3I5JC 2WS3B 3WA0A 3W5UB 1D5XC 4D2KA 1XEEA 2NR2A 4AUQC 1MVKA 2LRWA 1FPYA 1WM2A 2AX5A 2KYWA 2MBOA 2AL3A 2OEDA 3QA8A 4BKGA 1FCCC 1J7AA 3U7DA 2N1WA 1YMHE 4NJ7A 4A55A 3LB8C 2N9PC 2FCNA 4I6PA 4OVVA 2BYEA 3EGRA 4LNKA 5C1ZA 5AUIA 4M01A 4OHJA 1WE7A 1OGWA 1IUEA 4MT5A 5D3DA 1ET9A 3PZ7A 1STEA 4ZYSA 4C7ZA 1QLBB 2MBQA 3VH3B 2E3TA 4NJCA 2G9HD 4WJPA 4XYCA 2QILA 2IBIB 2D11A 4EFOA 3A1QA 3ZNID 1EUVB 2IY1B 3VRBB 1G6JA 2DAJA 4MEMA 5KHQA 3ALBA 4HXDA 3AMZA 2WXPA 3DBLB 4I6NB 5T8IA 4YL8A 2KD0A 3W2DA 2J52A 1P7FA 2INDC 3PT2B 4DHZE 1WXQA 2YEPF 1WRIA 3M63B 3NVYA 5DPRA 3RULA 1ZP0B 2CHWA 1F2RI 2FBWB 3DBSA 1T5XD 4KIKB 2RPVA 3N30A 3AM9A 4FXCA 2PVOD 2KWUB 1P9DU 4WQMA 3OG5A 4AQ7A 1V5OA 3ZUNA 4ANVA 4LDTD 2RPQA 3FILA 3ZRFA 1RLFA 3L17A 3OAWA 3VH4B 3CF6E 1E9MA 3EA6A 1SIJA 3TMPB 4US8A 3DHHC 3P4QB 2KX0A 3C0RB 3PV1A 1WYWB 1DGJA 2REXA 1K50A 3GOEA 1HQRD 4NNJB 2FAZA 2Z8LA 1SE9A 2K8HA 3H7SA 2J7QB 4ZRIA 3PHXB 3H1UA 2PE9A 5LNK1 2PKOA 4IM2A 2CJOA 1F0ZA 4W9LA 1SF0A 2GOWA 1FRRA 5HHDG 2KLCA 3LYYA 5BMGA 3DVNV 1MI0A 3RCZA 1M4VA 2M19A 4K3BA 3UGBB 4DHJD 4MGZE 1JWBD 2L0FA 2L05A 2Z59B 2BTEA 4W9EA 3VTUA 4MGKE 2V4IB 5J18A 2WGSA 4GSWA 4DHZB 1FD6A 5C3JB 4G11A 3T8MA 2BQQA 2LI5A 1NDDA 2LEKA 4EZKA 1WE6A 2WXMA 1RFAA 2JT4B 4JL9A 2O2VB 4JE3B 5IKCM 4BOZB 1AN8A 1L2NA 4MM3B 2MJDA 5EDSA 2HDEA 4LJPB 2JYTA 3AE3B 1FXIA 3P4PB 1FIQA 4KKJA 3U8ZA 2EKIA 2L52A 4IC7B 3B1LX 3QK0A 1R7SA 1FNWA 3MJ5A 3RZFA 1B1ZA 2WX0A 1V1PB 3B2GA 4FHKA 3DBHI 2IGHA 1H8CA 5JH5C 4HCNB 2W9NA 3AU5A 4FBJB 1QILA 4M0WA 2J53A 3FILB 1LO5D 2RDGA 2MX2A 4FLHA 1XXGA 1M94A 3Q3MC 4UDUC 4XE0A 1JRPA 2K0PA 5C23A 1TZOA 2DYOA 1HTOA 2WXHA 5CHWA 4KVGB 2L83A 5IO9A 3TEWA 1QQRA 3PLUA 1Q5WB 3BWUD 2GB1A 2WP9B 2V9HA 1XQQA 1AWDA 4OZBA 2BYFA 2KJ6A 2LD9A 3EHVA 3TUOA 1ZUD2 4AOFA 1V8CA 1XT9B 2L8JA 2JSVX 2CKHB 1KH0A 2LXCA 3PREA 1GJZA 4BAXA 1HTQA 1EO6A 2WXNA 4LLGM 2K8CA 1ENFA 1IYFA 3Q3JA 3Q3NC 2XK5A 2VH1A 1OEYJ 2ZCCA 1N61A 2FUG1 4GOCA 2O6VA 4KDLB 1WMHA 1TKGA 1C4CA 2ZW0A 3QWZB 2ZZPB 2EELA 3RPFC 3P42A 2PJHA 1ACCA 2A5UA 3V61A 1EU4A 4AP4C 3HVDA 3P4SB 3KWVA 1IGDA 3KUDB 2BPSA 1GC6A 2C5LC 1YNTE 1GOZA 5IP4D 2C7NB 3VUXA 3VR8B 4A90A 4YWGG 1NVID 1GG3A 3CIRB 1YQ3B 2M1MA 1I4XA 2KAJA 1UBQA 4KX6B 3ZYYX 1E10A 3ZTDA 3DDCB 2SEBD 1V81A 2PMVA 2RSUA 3VXWA 2W55A 3H8HA 1JWSD 3X0WA 1L6UA 3PSEB 3DWMA 1D4BA 5FR6A 3AE4B 2OJRA 4DK5A 3ZRCA 2QC8A 2N7DA 2KDBA 4NAMA 3VHTC 1IBXB 3GP7A 1L5PA 2X38A 1ZOYB 1WGGA 1FFUA 5FR3A 1E8WA 2M56B 1TJEA 1VRAB 2D3GA 2PPHA 1J7BA 3UIPB 2BBCA 2HE7A 2N9LA 3ZQ4A 3V60A 1CMXB 3T3OA 2Y3AA 3FAHA 3KWLA 3ZW3A 1QOBA 1D5MC 1RYJA 3VTVA 3N1YC 2KC1A 1WGHA 3E9SA 1V80A 1HEZE 3SHQA 1R4MB 1WR6E 2QJLA 3ENEA 2IGGA 4E71A 1UGJA 2WHIA 1NI2A 4JGHB 4XDCA 4BBNF 2MP2A 2LJ5A 3AXCA 4HLEA 1N6ZA 2LASA 1WMHB 5TR5A 2AQ3B 4IKGA 1GPXA 3R2TA 1UWMA 3MHZA 5D7GA 2NBVB 4TV3A 3NZUA 1OQYA 4NAWA 1SB3C 2WXQA 2QIEB 3Q8AA 2MHJA 3WCQA 2W3SA 4W9FA 2LVPA 4EEWA 1FFVA 3IBEA 4IM3A 1LQBA 1K52A 3PO0A 5E6PA 1DYQA 3LJ3A 4K81A 1UUPA 1J0GA 3IT4B 2LHEA 5CHFA 4I6LB 1ET6A 2FIDA 2LXAA 1X1MA 3DQVA 1E7VA 4P1CC 2H89B 2DBYA 4RM8A 1PUTA 4YT0B 1E8ZA 3IVFA 4TQ1A 3AB5A 4KZCA 2WQYB 4KZ0A 2BW2A 1MHHE 3N3KB 2BF8B 3KYCD 4B0EA 2K39A 1L0XB 2D5GA 1YIWA 1JCKB 2D3BA 5IA7A 5L95C 2GMIC 1SE3A 1V1OA 3SFEB 3T9LA 4EUTA 3A33B 3M3JA 1EU3A 1V2YA 3TL5A 4AJYB 4ACFA 4PT5A 4BVUC 1EWYC 2M17A 1QT9A 3AEEB 3I63C 2K6DB 2DAFA 2BS3B 3D32A 3VAWA 1QKZA 3KH0A 2H88B 4OW0A 3B9JA 4YTNB 3UQBA 2BKRB 1TY0A 3NY5A 1I4HA 1Z2MA 3AEFB 5D6JB 2KFKA 4US9A 3A4SC 1ZKHA 3N1XC 2KMCA 2KQSA 4LDTB 3O13A 2NMQA 3W1YA 1IGCA 2AQ2B 2WXGA 4Q2JA 4AS1A 2JY6A 4KKIA 4M8NA 2IO0B 1OQRA 2RGFA 2WDVB 4W9DA 1Z5SB 4KIKA 4W9CA 1QOAA 2MP2B 4C00A 1UF0A 1MPEA 3L10B 4R3DA 4BKTA 4IDIA 2HTHA 5J2RA 1K8RB 1TYGB 2LVQA 4C4VA 3RNAC 4XC2A 1MG4A 2NTTA 3B2FA 1P7EA 2Y5CA 2WX1A 3H9DA 3S2AA 2HTME 2JX5A 1TS3A 3I3TB 4C56C 3E56A 2MSED 4USAA 4WQOB 2VRRB 4NJ6A 5HKHA 3U4EG 3NVZA 3APFA 5LXHA 1ZGUB 4BBNC 4P6VF 1UH6A 3IAS1 2KK8A 2M4NA 1E7UA 4AWJA 4W9KA 4RM9A 1EF5A 4RGMA 1WI0A 2BGFA 3IHPC 4HEA1 2KQ4X 4GXBA 1B9RA 4GN1A 4GLSC 3RN9C 3C19A 1VZ8A 3AE7B 3PLVA 2KX3A 1DOIA 4P7IA 1BUIC 2L0TA 2LGSA 4E3CA 4EOYA 4ZRKA 3W9CB 4ANUA 4TSSA 2O2VA 2IYDB 1E0ZA 4PS3A 1J7CA 3JSVB 4MM3A 4W9GA 5AZFA 2RDHA 4IW0A 2CS4A 3X23A 3TJPA 4DXGA 2KFKB 3PZ8A 1CK1A 3IXSA 2K5PA 1JWMD 4P16A 3ZXRA 2LJIA 2BYTA 1I4QA 2X8XX 1E7PB 3OJ4B 3VQIA 1V1PA 4KGRA 2L00B 2G4SA 2KN4A 3ZVVA 1GB4A 4KV2A 4N9F4 2JXTA 2ZNVB 1VD2A 4E74A 2K6QA 2KN5A 4HJKA 2KVZA 4MDKE 1HZ5A 1TS4A 1Y56A 4C4VB 3RNEC 1C9FA 4JQWC 2WWZA 3ZNGC 2QCZA 2KJRA 4TUUA 1JWAD 3R2IA 3FC4A 3WAMA 1QOGA 3U7ZA 1L7YA 2KWCA 4PK1A 1PQSA 1D5ZC 4EZLA 3CSFA 2Y5PA 4LNOA 4LNIA 2PW9A 4W9IA 3ZXVA 2ZPYA 3Q69A 4RH6A 4ASWC 3L54A 5G5HA 2QEJC 2VZKD 5G5GA 4DDGD 2MWSB 2GBJA 5HI1A 3APCA 3ZGZA 4LK0M 2KTFA 1EM7A 1MFWA 5AZGA 3WANA 4CO7A 3NHEB 4RMAA 1TZ1A 1WR1A 3BK2A 1HXYD 1TY2A 1XLOA 4HDQA 1KRHA 2N7EA 3T3NA 3V3XA 2MEKA 4QAYA 1TGZB 5BYSA 1XF5L 4II2B 4RF0A 1JW9D 3ZDTA 2PEAA 3QCAA 4OVUA 2IO1B 4KDIC 1FNUA 3BVZA 3PRZA 1JQ4A 4WWNA 3N20C 4BFRA 3M95A 4C7YA 2L76A 4JIOU 1WGYA 2RDBC 5CTRC 3MP9A 2DZIA 1KM7A 3CSTA 2FCMA 3VTWA 2N9XA 1V9JA 2DZJA 3DCGA 3NS8A 4DBGA 3MTNB 3NOBA 2CU1A 4L1BA 2HJ1A 3VVWB 4KGSA 1GUAB 2BS4B 1UWXA 2LGYA 4WWPA 2JUOA 2N0SB 3IG3A 4MJSA 2BS2B 2LRUA 2KTRB 4OZAA 3FKYA 1QOFA 4IM0A 1R4NI 4BOSC 2PVGC 2I1KA 1FRDA 1CJEA 5FKAC 2ZVNA 2IDYA 2AEHA 2D3CA 3ML8A 4B95A 2KOXA 2UU7A 2KC2A 3Q14C 4HPPA 4ARIA 4P1BC 2K1FA 2MRPA 3OWEB 3AE5B 5H92C 2LUEA 1V97A 4IG7B 1T0YA 1IBXA 4YSZB 4DXFA 5C2TB 2BYVE 2QMTA 2R2QA 2QDFA 3DBRI 3NG0A 3BZDB 4YSXB 1VZ7A 3BVGA 3NZ3A 3ZTCA 5IOIA 3R66C 4RFBA 5TSSA 4JX1C 5E6JA 4GB9A 1T0RC 2MCNB 2OJWA 1YN3A 2V1YA 3VUYA 2LVOA 4C80A 4S17A 3Q8CA 4ZRJA 5HG2A 3GB1A 4HROA 3PRPB 1L0YB 1WX7A 2MBBB 5I4DA 4ZHPA 3Q2AC 1FO4A 2DX5B 3O65B 3ONSA 3UF8A 1WSPA 2WDRB 2ONQA 3DBHB 1KOTA 3AULA 1AYFA 4N6EB 1V49A 3HRDD 1ZXHA 3NUHB 3OJ3A 5BMHA 2FIFA 3URYA 1TS2A 2LGIA 3AI5A 1SSNA 1J8CA 4MSMB 3GE8C 1YN5A 5EE9A 3RMKC 4RGTA 3EC8A 1ZPSA 2NBWB 4G3XB 2HJ8A 1AW7A 2YVCA 1TTNA 1ZE3D 3GZNI 4MH8A 4O1NA 4GGQA 1OTRB 4HPMB 1K53A 4XWWA 4MJSB 2V3NA 1SIFA 1UELA 4NPNA 2XBBC 5IAAC 3I57A 2BVCA 3SFDB 3Q8FA 3K9OB 2CJNA 3PS6A 4BZAA 2JZZA 1S1QB 5H8YE 4K7SA 2FCQA 3QQ8B 4YSYB 4A3OA 1L6VA 4ZHOA 4DWFA 1UBIA 3UINB 1L4DB 1GAQB 1I4GA 3KW5B 5AEKB 3HUIA 3ABVB 4HCPB 2J0KA 2MA9B 4NQKE 5LXIB 1WYGA 4MACA 2KDEB 1OQQA 1WM3A 1N60A 1SBBB 1I4RA 2L3ZA 1T0QC 2YLMA 1XCQL 3ZIMA 1XO3A 3ML9A 2PTLA 2B76B 1EWCA 2M0XA 3DHGC 1YD8U 1SXTA 5JHBA 3QJZA 4MGYE 3B08A 4B6WA 3R3MA 1NYQA 2KWVB 2LWPA 1YJIA 1YX6B 3AN1A 2NCNA 4XZ4A 2C9WB 3ETRA 3A9KB 3QARA 2RMMA 1FXAA 4FHJA 2LMCA 1PDXA 4KSKC 1SGHA 3L0WB 1ZDXA 2V3PA 3W1SC 1N62A 4XGAB 3NVVA 2MBEA 1CZPA 2QHOA 2IY0B 2Y5BB 4G0NB 2ZCBA 2ASQA 5E6NA 1Q1OA 3KQ4A 3I9V1 1U4AA 2J42A 1RM6C 3L16A 1GC7A 4DDID 4WIPA 3WALA 3DVGX 1IP9A 4F7ZA 1WGDA 3W1SA 2K25A 3TIXA 3BY4B 2INCC 5CHVC 3TSSA 1XCTL 2WLBA 4FULA 3AH7A 3UI3A 3NS1A 1NENB 3ZJVA 5MPOA 5DCNA 1F1HA 1VDVA 2I1JA 4HKQA 3NRZA 3NVWA 2AL6A 2JZ3B 1ZDVA 1ROEA 5AZHA 2JRHA 4FN2A 5L83A 1N5WA 2FCSA 3UQAA 1P0RA 1PFDA 3DHIC 1WJ4A 1DOXA 4WAFA 1Q10A 1NI3A 1LXDA 2IGDA 2WXLA 3BVMA 1V6EA 3N32A 2DWQA 4L23A 3P2BA 3W5VB 1YX5B 2ZW1A 3IT6B 3JSVA 2J0MA 3N1ZC 2DZMA 3H7PA 2KVRA 4MSQB 1WH3A 2FUHB 3KYDD 1PGXA 1HZ6A 1C4PA 4GU2A 2JPHA 3M62B 3SEBA 2IPKD 4K7UA 4ITKA 2KXJA 2V3SA 4HDOA 4HRSA 1VCBA 5EE3A 3K9PB 2A4ZA 3PZDA 1WIAA 1HA5A 2V0GA 2TSSA 3CWIA 3QC8B 2AQ1B 2GBNA 3QAQA 4WWOA 4JWSC 2L1AA 3RNCC 1KLVA 3P4RB 2CU3A 1ZXIA 4FADA 2IO3B
chains in the Genus database with same CATH topology
4AOFA 4EZLA 4HWIB 3CSFA 1XT9B 2Z0DB 3A9JA 2L8JA 4W9IA 2EMSA 2V4LA 2ZPYA 2LGXA 1JRUA 2MW5A 3TCAA 2CKHB 3EECA 4X57B 2LXCA 3PREA 3Q3FA 4MELA 3L54A 2XK5B 4MGIE 5E6OA 3RUIB 4ASWC 1GJZA 4MH0E 4A3PA 4DDGD 4DHJB 1EO6A 3V6EB 4A20A 2MWSB 2UWQA 2GBJA 3RZWC 3APCA 2K8CA 1D3ZA 2O6VB 1IYFA 2KTFA 3Q3JA 2KKCA 2XK5A 5AZGA 3WANA 1E90A 1OEYJ 2BWES 2ZCCA 3DBLI 4CO7A 2KQ7A 2KZRA 3NHEB 3KUZA 4RMAA 1TZ1A 1WR1A 4FJYA 4HDQA 1J19A 4GOCA 2O6VA 4GIVA 1WXVA 1WMHA 2N7EA 2KMAA 2O6VD 4KDLB 5JZEB 1WXSA 3QWZB 3ZKJC 1TGZB 2C7HA 3RT3B 1WJNA 4II2B 1WZ3A 3ZO5B 2ZZPB 5DPTA 3ZLZA 3ZDTA 4B9KA 2PEAA 3QCAA 1WY8A 2PJHA 4NQLB 4OVUA 2IO1B 1WXMA 4KDIC 3V6CB 2G3QB 3EFUA 2A5UA 3V61A 2NPTB 2EKEC 3PRZA 2N4FA 4WWNA 4BFRA 4AP4C 2KHWB 4FJZA 3M95A 5J17A 2CHZA 3QX1A 1LFDA 4IWQA 2L76A 4JIOU 1WGYA 5DPSA 2KJHB 3KUDB 2BPSA 4LJOB 2DZIA 1GC6A 5CTRC 2C5LC 1KM7A 2C7NB 3CSTA 2FCMA 3VTWA 5CX3A 3PRMB 3VUXA 2N9XA 4FJVB 1GG3A 2ZPNA 1V9JA 2DZJA 3DCGA 2DENB 3BINA 3NS8A 4DBGA 3MTNB 3NOBA 4URKA 1C1YB 2CU1A 2KLGA 3APDA 4ICVA 2M1MA 4GDKB 1WJUA 2JF5A 3SU8X 3VVWB 3HHMA 1GUAB 3H7PB 4ANWA 1UBQA 3HIZA 4CHKA 2LGYA 3ZTDA 1RRBA 4WWPA 2KO3A 3PVLA 4M8MA 3JYUA 3DDCB 3ZNZB 1V81A 2RSUA 3VXWA 2JUOA 4WJOA 3PPAA 3IG3A 1GNUA 1Y8RC 4MJSA 3PTFC 3ZDMC 2ZNVC 2DYMA 2LRUA 2KTRB 4W9HA 3H6NA 3X0WA 3PSEB 3NZSA 4IM0A 1R4NI 4F1SA 4BOSC 2I1KA 2HD5B 5FR6A 2OJRA 4DK5A 2ZVNA 2EMTA 3ZRCA 2MQJA 1QZEA 2N7DA 2WYQA 2AEHA 2KDBA 5LLIA 3ML8A 2KTRA 1UZXB 4B95A 2KOXA 1WX8A 3VHTC 2KC2A 2D10A 4ZDVA 1C3TA 2KNBA 3PGEA 1WGGA 2BKFA 2MBHA 2K1FA 4TKNA 2MRPA 1ZW7A 1E8WA 4CYEA 2D3GA 1TBEA 1I35A 2LUEA 2PPHA 1WGRA 3MHSD 4LCDE 3UIPB 2B3AA 1T0YA 2HE7A 2M8SA 4IG7B 3V60A 2ZVOA 1CMXB 1WJ6A 1KJTA 3A9JB 1E5WA 2D07B 2KDFB 2C60A 2BYVE 3ZW3A 1LM8B 2R2QA 5JHAA 2RD0A 3UIOB 4HPLB 3VTVA 2DYBA 3DBRI 4F8CB 2KC1A 1EF1A 1WGHA 4WJQA 2BWFA 4BKSD 1V80A 3ZTCA 3SHQA 2JRIB 1Q0WB 1WR6E 4K7WA 3ENEA 1ISNA 4E71A 1P1AA 2NVUI 3JW0X 3R66C 4GB9A 2MCNB 1NI2A 2V1YA 1BT0A 3VUYA 2JWZA 4JGHB 3DVNU 4BBNF 2LVOA 2MP2A 2LJ5A 2N9EB 4ICUA 5D2MB 4ZRJA 1XD3B 2GBRA 3AXCA 3LDZE 1YJ1A 1AARA 4WAAA 2C7MB 3WAOA 4HLEA 4GMVA 2LASA 3PRPB 1WMHB 5TR5A 4NAWB 1RAXA 3DVGY 1WX7A 2MBBB 4EZJA 3KUCB 3WA0A 2DX5B 5D7GA 2NBVB 3O65B 3ONSA 3UF8A 2GBKA 3NZUA 4TV3A 1OQYA 1KOTA 3AULA 2NR2A 4NAWA 1V49A 4AUQC 3TBLD 3OJ3A 2LRWA 3IFWB 1WM2A 2G45B 3DPDA 2FIFA 2MBOA 4W9FA 2AL3A 2LVPA 4GDLA 3AI5A 2RR9A 4EEWA 3QA8A 1J8CA 3IBEA 4MSMB 4BKGA 2JVCA 4IM3A 1LQBA 3VDZA 4DXAB 3SDLC 3U7DA 4PS8A 3B0AA 5E6PA 2N1WA 4AJWA 2NS5A 2UYZB 4NJ7A 3EC8A 3LJ3A 4K81A 2NBWB 1J0GA 4HK2A 1IPGA 4G3XB 2N9PC 2FCNA 4I6LB 4I6PA 4OVVA 5CHFA 2BYEA 2FIDA 5C1ZA 2HJ8A 3JVZX 2LXAA 5KHOA 1X1MA 2G4DB 2YVCA 3DQVA 1TTNA 1E7VA 3GZNI 4G50A 4GGQA 4RM8A 1E8ZA 1WE7A 3RYTA 1OGWA 3IVFA 1OTRB 4HPMB 1WXAA 4TQ1A 4KZCA 4W9JA 4KZ0A 3A1QB 1WX9A 4IUMB 3CMMB 3N3KB 4MJSB 3V62A 2BF8B 1SIFA 1UELA 1YQBA 3KYCD 4NPNA 2XBBC 2K39A 5IAAC 2MBQA 3VH3B 2J0JA 4WJPA 1A5RA 1I42A 1YIWA 2CR5A 5IA7A 3K9OB 3PS6A 5L95C 2IBIB 2D11A 4EFOA 2JZZA 1S1QB 2GMIC 3A1QA 3PHWB 3ZNID 4K7SA 1EUVB 2FCQA 2IY1B 3QQ8B 4XX5A 4A3OA 3T9LA 2ZEQA 4EUTA 4DWFA 3A33B 3M3JA 1UBIA 3UINB 1G6JA 2DAJA 2LZ6A 1V2YA 3TL5A 3VUWA 4MEMA 4AJYB 1UGMA 1UD7A 3KW5B 5AEKB 5KHQA 3QHTA 3ALBA 4BVUC 4HCPB 4HXDA 2PE6B 2D2QA 2J0KA 2M17A 4I6NB 2XEWA 2MA9B 4YL8A 2KD0A 4NQKE 5LXIB 3PT2B 2K6DB 4DHZE 2DAFA 3D32A 4KSLC 2R2OA 2KDEB 3SD5A 1S3SG 3VAWA 1WM3A 3KH0A 3M63B 3UQBA 3KVFB 2DHZA 2BKRB 1HE8A 5DPRA 4TQ0A 3RULA 2L3ZA 3NY5A 1Z2MA 5D6JB 2KFKA 2YLMA 2CHWA 3DBSA 4JLCA 3A4SC 3HM3A 1ZKHA 2KMCA 2KQSA 3ZIMA 3L13A 2IZVB 3ECIA 4KIKB 4LDTB 2WDTB 3N30A 2LGDA 3W1YA 3ML9A 1P98A 2N1VA 2JY6A 4M8NA 2KWUB 1P9DU 2IO0B 2M0XA 2ZJDA 2RGFA 5G55A 4W9DA 1YD8U 1V5OA 1Z5SB 3ZUNA 4ANVA 3OLMD 5JHBA 4KIKA 4LDTD 2RPQA 3QJZA 4W9CA 3ZRFA 4BKSA 2MP2B 4MGYE 3B08A 4B6WA 1RLFA 3L17A 3WIMA 3L10B 4BKTA 3OAWA 2AWTA 3R3MA 2KWVB 2LWPA 3VH4B 1WFYA 3CF6E 1YX6B 2HTHA 4II3B 3TMPB 2NCNA 5J2RA 1K8RB 2LVQA 2KX0A 4XZ4A 3C0RB 2C9WB 3PV1A 3A9KB 4XC2A 3QARA 1WYWB 2REXA 3GOEA 1V5TA 4FHJA 2WX1A 4FA6A 3H9DA 5DPWA 4PYZA 4KSKC 1SGHA 4NY0A 3L0WB 4NNJB 3S2AA 3W1SC 2FAZA 2MBEA 3U30A 1SE9A 3A9KA 2QHOA 3I3TB 4GDLB 2L7RA 2IY0B 2Y5BB 2K8HA 3H7SA 4G0NB 2IO2B 2MSED 3A4RA 2J7QB 4ZRIA 4ANXA 4WQOB 2ZCBA 2ASQA 3PHXB 2VRRB 2PE9A 3H1UA 5E6NA 4IM2A 4NJ6A 2MLBA 4J6IA 4W9LA 5HKHA 1Q1OA 2GOWA 2GBMA 3RD2A 2KLCA 3APFA 3DVNV 1U4AA 5LXHA 1ZGUB 1OEYA 3RCZA 4BBNC 1UH6A 5G2NA 3L16A 3UGBB 2KK8A 1GC7A 2M4NA 1E7UA 3HM6X 4DHJD 4DDID 4AWJA 2KANA 4MGZE 1V86A 4RM9A 3DVGX 4W9KA 3WALA 2JXXA 1IP9A 4WJNA 4F7ZA 2K8BA 3AU4A 1EF5A 1WGDA 4HVBA 1F9JA 1E8YA 1NBFC 1WI0A 2L0FA 2L05A 3W1SA 2BGFA 3IHPC 2Z59B 4GXBA 4W9EA 3R7RA 2K25A 4GN1A 3TIXA 3VTUA 3BY4B 4MGKE 5CHVC 5J18A 4GSWA 3QIJA 4DHZB 4G11A 3T8MA 4FULA 2LI5A 4PS7A 1H4RA 1NDDA 5DCNA 3PLVA 4K1RB 4EZKA 1WE6A 1RFAA 2JT4B 2KDIA 4JL9A 2KX3A 4P7IA 2I1JA 2O2VB 2AL6A 4BOZB 2JZ3B 5AZHA 2JRHA 1E8XA 1L2NA 4FN2A 3WAPA 5L83A 2L0TA 4E3CA 1WRDB 2NPTA 1R4MI 4EOYA 5GMVA 5EDSA 4ZRKA 4ZYNA 4ANUA 2FCSA 3UQAA 4LJPB 1P0RA 1MG8A 2O2VA 2IYDB 4IWOA 1WJ4A 4PS3A 3JSVB 4MM3A 4W9GA 5AZFA 1WZ0A 1LXDA 4IW0A 3U8ZA 2DZKA 3B1LX 4IC7B 3QK0A 3N32A 2CS4A 1V6EA 3X23A 3TJPA 3RZFA 2WX0A 3P2BA 4IWPA 2KFKB 2OOBB 1YX5B 2NBUA 5BO4B 3JSVA 4GDKA 2J0MA 4FHKA 4M0WB 2DZMA 2FNJB 3H7PA 3DBHI 3DOWA 2KVRA 4MSQB 3OJ4B 1WH3A 1H8CA 2CHXA 2FUHB 4HCNB 2Z0EB 1WF9A 3VQIA 4EKUA 5JH5C 3KYDD 2W9NA 3AU5A 4FBJB 5D94A 2L00B 4GU2A 2JPHA 2G4SA 3M62B 3ZVVA 4KV2A 4K7UA 4N9F4 3L08A 2ZNVB 1VD2A 4E74A 2MX2A 4FLHA 1M94A 2K6QA 2KN5A 4HJKA 2KXJA 2V3SA 4MDKE 3VFKA 5C23A 2AYOB 4HDOA 1VCBA 2DYOA 1FXTB 4JQWC 2WWZA 5CHWA 4KVGB 3ZNGC 3K9PB 2A4ZA 4PYUA 3PZDA 1WIAA 2KJRA 4TUUA 3R7QA 3ZNHB 3PLUA 1Q5WB 3WAMA 3QC8B 1L7YA 2GBNA 3QAQA 4WWOA 1P3QU 1XQQA 2KWCA 1KLVA 3HK0A 3MJWA 2KFJA 2BYFA 4FADA 1PQSA 2KJ6A 2LD9A 3EHVA 2IO3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AOF A;  4EZL A;  4HWI B;  3CSF A;  1XT9 B;  2Z0D B;  3A9J A;  2L8J A;  4W9I A;  2EMS A;  2V4L A;  2ZPY A;  2LGX A;  1JRU A;  2MW5 A;  3TCA A;  2CKH B;  3EEC A;  4X57 B;  2LXC A;  3PRE A;  3Q3F A;  4MEL A;  3L54 A;  2XK5 B;  4MGI E;  5E6O A;  3RUI B;  4ASW C;  1GJZ A;  4MH0 E;  4A3P A;  4DDG D;  4DHJ B;  1EO6 A;  3V6E B;  4A20 A;  2MWS B;  2UWQ A;  2GBJ A;  3RZW C;  3APC A;  2K8C A;  1D3Z A;  2O6V B;  1IYF A;  2KTF A;  3Q3J A;  2KKC A;  2XK5 A;  5AZG A;  3WAN A;  1E90 A;  1OEY J;  2BWE S;  2ZCC A;  3DBL I;  4CO7 A;  2KQ7 A;  2KZR A;  3NHE B;  3KUZ A;  4RMA A;  1TZ1 A;  1WR1 A;  4FJY A;  4HDQ A;  1J19 A;  4GOC A;  2O6V A;  4GIV A;  1WXV A;  1WMH A;  2N7E A;  2KMA A;  2O6V D;  4KDL B;  5JZE B;  1WXS A;  3QWZ B;  3ZKJ C;  1TGZ B;  2C7H A;  3RT3 B;  1WJN A;  4II2 B;  1WZ3 A;  3ZO5 B;  2ZZP B;  5DPT A;  3ZLZ A;  3ZDT A;  4B9K A;  2PEA A;  3QCA A;  1WY8 A;  2PJH A;  4NQL B;  4OVU A;  2IO1 B;  1WXM A;  4KDI C;  3V6C B;  2G3Q B;  3EFU A;  2A5U A;  3V61 A;  2NPT B;  2EKE C;  3PRZ A;  2N4F A;  4WWN A;  4BFR A;  4AP4 C;  2KHW B;  4FJZ A;  3M95 A;  5J17 A;  2CHZ A;  3QX1 A;  1LFD A;  4IWQ A;  2L76 A;  4JIO U;  1WGY A;  5DPS A;  2KJH B;  3KUD B;  2BPS A;  4LJO B;  2DZI A;  1GC6 A;  5CTR C;  2C5L C;  1KM7 A;  2C7N B;  3CST A;  2FCM A;  3VTW A;  5CX3 A;  3PRM B;  3VUX A;  2N9X A;  4FJV B;  1GG3 A;  2ZPN A;  1V9J A;  2DZJ A;  3DCG A;  2DEN B;  3BIN A;  3NS8 A;  4DBG A;  3MTN B;  3NOB A;  4URK A;  1C1Y B;  2CU1 A;  2KLG A;  3APD A;  4ICV A;  2M1M A;  4GDK B;  1WJU A;  2JF5 A;  3SU8 X;  3VVW B;  3HHM A;  1GUA B;  3H7P B;  4ANW A;  1UBQ A;  3HIZ A;  4CHK A;  2LGY A;  3ZTD A;  1RRB A;  4WWP A;  2KO3 A;  3PVL A;  4M8M A;  3JYU A;  3DDC B;  3ZNZ B;  1V81 A;  2RSU A;  3VXW A;  2JUO A;  4WJO A;  3PPA A;  3IG3 A;  1GNU A;  1Y8R C;  4MJS A;  3PTF C;  3ZDM C;  2ZNV C;  2DYM A;  2LRU A;  2KTR B;  4W9H A;  3H6N A;  3X0W A;  3PSE B;  3NZS A;  4IM0 A;  1R4N I;  4F1S A;  4BOS C;  2I1K A;  2HD5 B;  5FR6 A;  2OJR A;  4DK5 A;  2ZVN A;  2EMT A;  3ZRC A;  2MQJ A;  1QZE A;  2N7D A;  2WYQ A;  2AEH A;  2KDB A;  5LLI A;  3ML8 A;  2KTR A;  1UZX B;  4B95 A;  2KOX A;  1WX8 A;  3VHT C;  2KC2 A;  2D10 A;  4ZDV A;  1C3T A;  2KNB A;  3PGE A;  1WGG A;  2BKF A;  2MBH A;  2K1F A;  4TKN A;  2MRP A;  1ZW7 A;  1E8W A;  4CYE A;  2D3G A;  1TBE A;  1I35 A;  2LUE A;  2PPH A;  1WGR A;  3MHS D;  4LCD E;  3UIP B;  2B3A A;  1T0Y A;  2HE7 A;  2M8S A;  4IG7 B;  3V60 A;  2ZVO A;  1CMX B;  1WJ6 A;  1KJT A;  3A9J B;  1E5W A;  2D07 B;  2KDF B;  2C60 A;  2BYV E;  3ZW3 A;  1LM8 B;  2R2Q A;  5JHA A;  2RD0 A;  3UIO B;  4HPL B;  3VTV A;  2DYB A;  3DBR I;  4F8C B;  2KC1 A;  1EF1 A;  1WGH A;  4WJQ A;  2BWF A;  4BKS D;  1V80 A;  3ZTC A;  3SHQ A;  2JRI B;  1Q0W B;  1WR6 E;  4K7W A;  3ENE A;  1ISN A;  4E71 A;  1P1A A;  2NVU I;  3JW0 X;  3R66 C;  4GB9 A;  2MCN B;  1NI2 A;  2V1Y A;  1BT0 A;  3VUY A;  2JWZ A;  4JGH B;  3DVN U;  4BBN F;  2LVO A;  2MP2 A;  2LJ5 A;  2N9E B;  4ICU A;  5D2M B;  4ZRJ A;  1XD3 B;  2GBR A;  3AXC A;  3LDZ E;  1YJ1 A;  1AAR A;  4WAA A;  2C7M B;  3WAO A;  4HLE A;  4GMV A;  2LAS A;  3PRP B;  1WMH B;  5TR5 A;  4NAW B;  1RAX A;  3DVG Y;  1WX7 A;  2MBB B;  4EZJ A;  3KUC B;  3WA0 A;  2DX5 B;  5D7G A;  2NBV B;  3O65 B;  3ONS A;  3UF8 A;  2GBK A;  3NZU A;  4TV3 A;  1OQY A;  1KOT A;  3AUL A;  2NR2 A;  4NAW A;  1V49 A;  4AUQ C;  3TBL D;  3OJ3 A;  2LRW A;  3IFW B;  1WM2 A;  2G45 B;  3DPD A;  2FIF A;  2MBO A;  4W9F A;  2AL3 A;  2LVP A;  4GDL A;  3AI5 A;  2RR9 A;  4EEW A;  3QA8 A;  1J8C A;  3IBE A;  4MSM B;  4BKG A;  2JVC A;  4IM3 A;  1LQB A;  3VDZ A;  4DXA B;  3SDL C;  3U7D A;  4PS8 A;  3B0A A;  5E6P A;  2N1W A;  4AJW A;  2NS5 A;  2UYZ B;  4NJ7 A;  3EC8 A;  3LJ3 A;  4K81 A;  2NBW B;  1J0G A;  4HK2 A;  1IPG A;  4G3X B;  2N9P C;  2FCN A;  4I6L B;  4I6P A;  4OVV A;  5CHF A;  2BYE A;  2FID A;  5C1Z A;  2HJ8 A;  3JVZ X;  2LXA A;  5KHO A;  1X1M A;  2G4D B;  2YVC A;  3DQV A;  1TTN A;  1E7V A;  3GZN I;  4G50 A;  4GGQ A;  4RM8 A;  1E8Z A;  1WE7 A;  3RYT A;  1OGW A;  3IVF A;  1OTR B;  4HPM B;  1WXA A;  4TQ1 A;  4KZC A;  4W9J A;  4KZ0 A;  3A1Q B;  1WX9 A;  4IUM B;  3CMM B;  3N3K B;  4MJS B;  3V62 A;  2BF8 B;  1SIF A;  1UEL A;  1YQB A;  3KYC D;  4NPN A;  2XBB C;  2K39 A;  5IAA C;  2MBQ A;  3VH3 B;  2J0J A;  4WJP A;  1A5R A;  1I42 A;  1YIW A;  2CR5 A;  5IA7 A;  3K9O B;  3PS6 A;  5L95 C;  2IBI B;  2D11 A;  4EFO A;  2JZZ A;  1S1Q B;  2GMI C;  3A1Q A;  3PHW B;  3ZNI D;  4K7S A;  1EUV B;  2FCQ A;  2IY1 B;  3QQ8 B;  4XX5 A;  4A3O A;  3T9L A;  2ZEQ A;  4EUT A;  4DWF A;  3A33 B;  3M3J A;  1UBI A;  3UIN B;  1G6J A;  2DAJ A;  2LZ6 A;  1V2Y A;  3TL5 A;  3VUW A;  4MEM A;  4AJY B;  1UGM A;  1UD7 A;  3KW5 B;  5AEK B;  5KHQ A;  3QHT A;  3ALB A;  4BVU C;  4HCP B;  4HXD A;  2PE6 B;  2D2Q A;  2J0K A;  2M17 A;  4I6N B;  2XEW A;  2MA9 B;  4YL8 A;  2KD0 A;  4NQK E;  5LXI B;  3PT2 B;  2K6D B;  4DHZ E;  2DAF A;  3D32 A;  4KSL C;  2R2O A;  2KDE B;  3SD5 A;  1S3S G;  3VAW A;  1WM3 A;  3KH0 A;  3M63 B;  3UQB A;  3KVF B;  2DHZ A;  2BKR B;  1HE8 A;  5DPR A;  4TQ0 A;  3RUL A;  2L3Z A;  3NY5 A;  1Z2M A;  5D6J B;  2KFK A;  2YLM A;  2CHW A;  3DBS A;  4JLC A;  3A4S C;  3HM3 A;  1ZKH A;  2KMC A;  2KQS A;  3ZIM A;  3L13 A;  2IZV B;  3ECI A;  4KIK B;  4LDT B;  2WDT B;  3N30 A;  2LGD A;  3W1Y A;  3ML9 A;  1P98 A;  2N1V A;  2JY6 A;  4M8N A;  2KWU B;  1P9D U;  2IO0 B;  2M0X A;  2ZJD A;  2RGF A;  5G55 A;  4W9D A;  1YD8 U;  1V5O A;  1Z5S B;  3ZUN A;  4ANV A;  3OLM D;  5JHB A;  4KIK A;  4LDT D;  2RPQ A;  3QJZ A;  4W9C A;  3ZRF A;  4BKS A;  2MP2 B;  4MGY E;  3B08 A;  4B6W A;  1RLF A;  3L17 A;  3WIM A;  3L10 B;  4BKT A;  3OAW A;  2AWT A;  3R3M A;  2KWV B;  2LWP A;  3VH4 B;  1WFY A;  3CF6 E;  1YX6 B;  2HTH A;  4II3 B;  3TMP B;  2NCN A;  5J2R A;  1K8R B;  2LVQ A;  2KX0 A;  4XZ4 A;  3C0R B;  2C9W B;  3PV1 A;  3A9K B;  4XC2 A;  3QAR A;  1WYW B;  2REX A;  3GOE A;  1V5T A;  4FHJ A;  2WX1 A;  4FA6 A;  3H9D A;  5DPW A;  4PYZ A;  4KSK C;  1SGH A;  4NY0 A;  3L0W B;  4NNJ B;  3S2A A;  3W1S C;  2FAZ A;  2MBE A;  3U30 A;  1SE9 A;  3A9K A;  2QHO A;  3I3T B;  4GDL B;  2L7R A;  2IY0 B;  2Y5B B;  2K8H A;  3H7S A;  4G0N B;  2IO2 B;  2MSE D;  3A4R A;  2J7Q B;  4ZRI A;  4ANX A;  4WQO B;  2ZCB A;  2ASQ A;  3PHX B;  2VRR B;  2PE9 A;  3H1U A;  5E6N A;  4IM2 A;  4NJ6 A;  2MLB A;  4J6I A;  4W9L A;  5HKH A;  1Q1O A;  2GOW A;  2GBM A;  3RD2 A;  2KLC A;  3APF A;  3DVN V;  1U4A A;  5LXH A;  1ZGU B;  1OEY A;  3RCZ A;  4BBN C;  1UH6 A;  5G2N A;  3L16 A;  3UGB B;  2KK8 A;  1GC7 A;  2M4N A;  1E7U A;  3HM6 X;  4DHJ D;  4DDI D;  4AWJ A;  2KAN A;  4MGZ E;  1V86 A;  4RM9 A;  3DVG X;  4W9K A;  3WAL A;  2JXX A;  1IP9 A;  4WJN A;  4F7Z A;  2K8B A;  3AU4 A;  1EF5 A;  1WGD A;  4HVB A;  1F9J A;  1E8Y A;  1NBF C;  1WI0 A;  2L0F A;  2L05 A;  3W1S A;  2BGF A;  3IHP C;  2Z59 B;  4GXB A;  4W9E A;  3R7R A;  2K25 A;  4GN1 A;  3TIX A;  3VTU A;  3BY4 B;  4MGK E;  5CHV C;  5J18 A;  4GSW A;  3QIJ A;  4DHZ B;  4G11 A;  3T8M A;  4FUL A;  2LI5 A;  4PS7 A;  1H4R A;  1NDD A;  5DCN A;  3PLV A;  4K1R B;  4EZK A;  1WE6 A;  1RFA A;  2JT4 B;  2KDI A;  4JL9 A;  2KX3 A;  4P7I A;  2I1J A;  2O2V B;  2AL6 A;  4BOZ B;  2JZ3 B;  5AZH A;  2JRH A;  1E8X A;  1L2N A;  4FN2 A;  3WAP A;  5L83 A;  2L0T A;  4E3C A;  1WRD B;  2NPT A;  1R4M I;  4EOY A;  5GMV A;  5EDS A;  4ZRK A;  4ZYN A;  4ANU A;  2FCS A;  3UQA A;  4LJP B;  1P0R A;  1MG8 A;  2O2V A;  2IYD B;  4IWO A;  1WJ4 A;  4PS3 A;  3JSV B;  4MM3 A;  4W9G A;  5AZF A;  1WZ0 A;  1LXD A;  4IW0 A;  3U8Z A;  2DZK A;  3B1L X;  4IC7 B;  3QK0 A;  3N32 A;  2CS4 A;  1V6E A;  3X23 A;  3TJP A;  3RZF A;  2WX0 A;  3P2B A;  4IWP A;  2KFK B;  2OOB B;  1YX5 B;  2NBU A;  5BO4 B;  3JSV A;  4GDK A;  2J0M A;  4FHK A;  4M0W B;  2DZM A;  2FNJ B;  3H7P A;  3DBH I;  3DOW A;  2KVR A;  4MSQ B;  3OJ4 B;  1WH3 A;  1H8C A;  2CHX A;  2FUH B;  4HCN B;  2Z0E B;  1WF9 A;  3VQI A;  4EKU A;  5JH5 C;  3KYD D;  2W9N A;  3AU5 A;  4FBJ B;  5D94 A;  2L00 B;  4GU2 A;  2JPH A;  2G4S A;  3M62 B;  3ZVV A;  4KV2 A;  4K7U A;  4N9F 4;  3L08 A;  2ZNV B;  1VD2 A;  4E74 A;  2MX2 A;  4FLH A;  1M94 A;  2K6Q A;  2KN5 A;  4HJK A;  2KXJ A;  2V3S A;  4MDK E;  3VFK A;  5C23 A;  2AYO B;  4HDO A;  1VCB A;  2DYO A;  1FXT B;  4JQW C;  2WWZ A;  5CHW A;  4KVG B;  3ZNG C;  3K9P B;  2A4Z A;  4PYU A;  3PZD A;  1WIA A;  2KJR A;  4TUU A;  3R7Q A;  3ZNH B;  3PLU A;  1Q5W B;  3WAM A;  3QC8 B;  1L7Y A;  2GBN A;  3QAQ A;  4WWO A;  1P3Q U;  1XQQ A;  2KWC A;  1KLV A;  3HK0 A;  3MJW A;  2KFJ A;  2BYF A;  4FAD A;  1PQS A;  2KJ6 A;  2LD9 A;  3EHV A;  2IO3 B; 
#chains in the Genus database with same CATH topology
 1SEB D;  2VZK B;  5FK9 C;  4YTM B;  2Z0D B;  3A9J A;  1SE4 A;  2EMS A;  1FEH A;  2V4L A;  2WDQ B;  2LGX A;  3TCA A;  1K51 A;  4A3P A;  4DHJ B;  3AEA B;  2UWQ A;  4REZ A;  3RZW C;  3BII D;  1D3Z A;  2KKC A;  1E90 A;  2BWE S;  3DBL I;  2KQ7 A;  3KUZ A;  1SE2 A;  5JZE B;  2O6V D;  1WXS A;  1RWS A;  3ZKJ C;  2C7H A;  3ZO5 B;  3ZLZ A;  4LTU A;  4B9K A;  4ZRQ A;  4NQL B;  1WXM A;  3V6C B;  2G3Q B;  2EKE C;  2N4F A;  2KHW B;  4FJZ A;  2CHZ A;  3QX1 A;  1LFD A;  1XLP A;  3VRA B;  1NEK B;  1MJD A;  1UNS A;  2OHF A;  4DQO C;  5CX3 A;  5JXV A;  4FJV B;  4TMA B;  1L0V B;  3BIN A;  3APD A;  4ICV A;  1WJU A;  2JF5 A;  3SU8 X;  5BYQ A;  3H7P B;  4ANW A;  5IN7 A;  2K3U A;  2QSD A;  1RRB A;  3RNF C;  4OVZ A;  2KO3 A;  3PVL A;  3Q3O C;  3JYU A;  3ZNZ B;  3J9C A;  2MJE A;  1Y8R C;  2W82 A;  3PTF C;  4M00 A;  3P63 A;  4W9H A;  3RNG C;  1YN4 A;  4F1S A;  1VLB A;  1T6B X;  2W54 A;  3U2S C;  2EMT A;  4RGN A;  1QZE A;  3AE1 B;  4NZL B;  1KF6 B;  4RGO S;  1GB1 A;  2KTR A;  1DOY A;  2XN9 C;  1WX8 A;  2D10 A;  2BT6 A;  1ZW7 A;  3Q8B A;  1FM0 D;  4CYE A;  1I35 A;  2LFI A;  1OFF A;  2JYE A;  3U52 E;  3MHS D;  3TEX A;  1C78 A;  2FE8 A;  2M8S A;  1WGK A;  1F52 A;  3AE2 B;  4IOI E;  3A9J B;  2D07 B;  2C60 A;  1CQV A;  5JHA A;  2DYB A;  2PLP A;  1FCL A;  2J4X A;  3BYT B;  4WJQ A;  3GE3 C;  5EE1 A;  1Q0W B;  4K7W A;  2IJ0 A;  1JRO A;  4S0R A;  2NVU I;  1F77 A;  4J3O D;  2W3R A;  1BT0 A;  2JWZ A;  3VR9 B;  3DVN U;  4WWM A;  2GBR A;  3LDZ E;  1TKE A;  1YJ1 A;  4WAA A;  2C7M B;  3WAO A;  3ZJU A;  1RAX A;  3DVG Y;  4B0M A;  4EZJ A;  2WXK A;  3KLS X;  4KGT A;  2GBK A;  2JU6 X;  3TBL D;  3IFW B;  2G45 B;  1C77 A;  1RFK A;  3DPD A;  3GS2 A;  2MH7 A;  2K22 A;  4GDL A;  2RR9 A;  2JVC A;  4DXA B;  3LXF A;  3VDZ A;  3SDL C;  4PS8 A;  3B0A A;  4AJW A;  3EUB 2;  2NS5 A;  2UYZ B;  3RFZ B;  4HK2 A;  1IPG A;  1FMA D;  3JVZ X;  2JZP A;  2N9K A;  4M02 A;  5KHO A;  2G4D B;  4G50 A;  3R8B A;  2LUM A;  3RYT A;  3AED B;  1WXA A;  4W9J A;  3A1Q B;  1WX9 A;  4IUM B;  3CMM B;  1MHX A;  2ACZ B;  3V62 A;  1YQB A;  3AE8 B;  2J0J A;  1A5R A;  1I42 A;  4HJG E;  5GXG B;  2CR5 A;  2WXO A;  3PHW B;  5BYR A;  4XX5 A;  2BB5 A;  2JWU A;  2ZEQ A;  2E6X A;  1N5X A;  2I2Y A;  2LZ6 A;  3VUW A;  1UGM A;  1UD7 A;  3QHT A;  2WXF A;  2PE6 B;  2D2Q A;  2N7J A;  5EE0 A;  1C76 A;  1T0S C;  2PIA A;  2XEW A;  2L32 A;  4KSL C;  2R2O A;  3SD5 A;  1S3S G;  4EE2 A;  2KWD A;  3KVF B;  2ICI A;  2DHZ A;  1HE8 A;  4TQ0 A;  3SR6 A;  4JLC A;  3HM3 A;  3C8Y A;  3L13 A;  2IZV B;  3ECI A;  2WDT B;  2LGD A;  1I7H A;  1P98 A;  2N1V A;  2ZJD A;  5G55 A;  3OLM D;  4OZC A;  1KLG D;  3P1M A;  4BKS A;  3WIM A;  3AV8 A;  2AWT A;  1WFY A;  2WXR A;  3BK1 A;  4II3 B;  3Q8E A;  2DLB A;  3AEG B;  1TIF A;  1WWT A;  1V5T A;  4RNA A;  3N9Y C;  4FA6 A;  3AE6 B;  5DPW A;  3AE9 B;  4PYZ A;  4NY0 A;  1YQ4 B;  3MC9 A;  3U30 A;  3A9K A;  1C4A A;  4GDL B;  2L7R A;  5D94 A;  2IO2 B;  4YTP B;  1I4P A;  3A4R A;  4ANX A;  2MLB A;  2WXJ A;  1R4N B;  4J6I A;  1SJE D;  2GBM A;  3RD2 A;  4CQN A;  1OEY A;  3Q6B A;  5G2N A;  3MC8 A;  3HM6 X;  2KAN A;  1V86 A;  4ARC A;  2JXX A;  4WJN A;  2K8B A;  3AU4 A;  4HVB A;  1F9J A;  1E8Y A;  1NBF C;  4ZOH C;  3R7R A;  3QIJ A;  4JPS A;  1BXT A;  4PS7 A;  1H4R A;  4K1R B;  1SJH D;  4LNF A;  2KDI A;  3DBR B;  1VZ6 A;  1BML C;  2K9X A;  5AUK A;  2WU2 B;  1E8X A;  3WAP A;  1WRD B;  2NPT A;  1R4M I;  1JML A;  5GMV A;  4ZYN A;  4XWT A;  1MG8 A;  2WNM A;  4IWO A;  4RCO A;  1WZ0 A;  2NTS A;  2DZK A;  2KT7 A;  1C79 A;  1QF6 A;  4IWP A;  2OOB B;  2NBU A;  1KFY B;  5BO4 B;  2M0A A;  4GDK A;  4M0W B;  2FNJ B;  3DOW A;  2LHD A;  2ON8 A;  3TEZ A;  2CHX A;  2Z0E B;  1WF9 A;  4EKU A;  1XLQ A;  4A6Q A;  4A9A A;  1PGA A;  3L4P A;  3RI7 C;  1JWU D;  2I38 A;  3L08 A;  3VFK A;  2AYO B;  4HKZ E;  2R61 A;  4YXD B;  1FXT B;  1N63 A;  3GZN B;  4PYU A;  3ZNH B;  1JAL A;  3R7Q A;  2VH2 A;  4RF1 A;  2GLS A;  2KAC A;  1YJJ A;  2WXI A;  1P3Q U;  3HK0 A;  3MJW A;  2KFJ A;  3MC0 B;  4HWI B;  2YEP B;  3RNB C;  1JRU A;  2MW5 A;  3EEC A;  4XDD A;  4X57 B;  5E6O A;  3Q3F A;  4MEL A;  3NJT A;  2XK5 B;  4MGI E;  3RUI B;  3HVZ A;  4MH0 E;  4L2Y A;  3V6E B;  4A20 A;  1A70 A;  1FNV A;  2O6V B;  5HFY A;  2MJ3 A;  2KZR A;  1PGB A;  2KDM A;  4FJY A;  3BYY B;  1VJK A;  1J19 A;  3IAM 1;  4WH4 A;  2KMM A;  4GIV A;  1WXV A;  2G1E A;  2KMA A;  2XNA C;  3MFG A;  3RT3 B;  2D3A A;  1WJN A;  1WZ3 A;  2SAK A;  5DPT A;  2INN E;  4H2A A;  1WY8 A;  1KTK A;  5D3I B;  3EFU A;  2NPT B;  5J17 A;  4IWQ A;  5DPS A;  2KJH B;  4N58 A;  1XLN A;  4LJO B;  3PRM B;  3ZJT A;  2ZPN A;  1YOV B;  2DEN B;  4URK A;  1KLU D;  1C1Y B;  2KLG A;  2GI9 A;  4GDK B;  4A8X C;  3HHM A;  3V05 A;  1TKY A;  1E6E B;  3HIZ A;  4CHK A;  1PYW D;  4M8M A;  1LGR A;  4K3C A;  1L4Z B;  4WJO A;  3PPA A;  3TEY A;  1GNU A;  4JWU C;  3ZDM C;  2ZNV C;  2DYM A;  3H6N A;  3NZS A;  2HD5 B;  4ZRP A;  2MQJ A;  2WYQ A;  5LLI A;  1UZX B;  4WUR A;  1TT5 B;  4ZDV A;  1C3T A;  2KNB A;  3PGE A;  1VR9 A;  2BKF A;  2MBH A;  4TKN A;  1TBE A;  1WGR A;  1NYR A;  4LCD E;  2B3A A;  2WU5 B;  2ZVO A;  1D6E C;  1WJ6 A;  1KJT A;  3AEC B;  3DWG C;  2BB6 A;  2JQR B;  1E5W A;  2KDF B;  1T3Q A;  1LM8 B;  2RD0 A;  3UIO B;  4HPL B;  4F8C B;  1ESF A;  1EF1 A;  2Q5W D;  2BWF A;  4BKS D;  2JRI B;  5BMI A;  2GRI A;  1ISN A;  1P1A A;  3JW0 X;  4N59 A;  2INP E;  4LNN A;  1TS5 A;  2N9E B;  4ICU A;  5D2M B;  1XD3 B;  1AAR A;  1F2R C;  4GMV A;  4NAW B;  3EFC A;  2DNF A;  3AEB B;  3KUC B;  3I5J C;  2WS3 B;  3WA0 A;  3W5U B;  1D5X C;  4D2K A;  1XEE A;  2NR2 A;  4AUQ C;  1MVK A;  2LRW A;  1FPY A;  1WM2 A;  2AX5 A;  2KYW A;  2MBO A;  2AL3 A;  2OED A;  3QA8 A;  4BKG A;  1FCC C;  1J7A A;  3U7D A;  2N1W A;  1YMH E;  4NJ7 A;  4A55 A;  3LB8 C;  2N9P C;  2FCN A;  4I6P A;  4OVV A;  2BYE A;  3EGR A;  4LNK A;  5C1Z A;  5AUI A;  4M01 A;  4OHJ A;  1WE7 A;  1OGW A;  1IUE A;  4MT5 A;  5D3D A;  1ET9 A;  3PZ7 A;  1STE A;  4ZYS A;  4C7Z A;  1QLB B;  2MBQ A;  3VH3 B;  2E3T A;  4NJC A;  2G9H D;  4WJP A;  4XYC A;  2QIL A;  2IBI B;  2D11 A;  4EFO A;  3A1Q A;  3ZNI D;  1EUV B;  2IY1 B;  3VRB B;  1G6J A;  2DAJ A;  4MEM A;  5KHQ A;  3ALB A;  4HXD A;  3AMZ A;  2WXP A;  3DBL B;  4I6N B;  5T8I A;  4YL8 A;  2KD0 A;  3W2D A;  2J52 A;  1P7F A;  2IND C;  3PT2 B;  4DHZ E;  1WXQ A;  2YEP F;  1WRI A;  3M63 B;  3NVY A;  5DPR A;  3RUL A;  1ZP0 B;  2CHW A;  1F2R I;  2FBW B;  3DBS A;  1T5X D;  4KIK B;  2RPV A;  3N30 A;  3AM9 A;  4FXC A;  2PVO D;  2KWU B;  1P9D U;  4WQM A;  3OG5 A;  4AQ7 A;  1V5O A;  3ZUN A;  4ANV A;  4LDT D;  2RPQ A;  3FIL A;  3ZRF A;  1RLF A;  3L17 A;  3OAW A;  3VH4 B;  3CF6 E;  1E9M A;  3EA6 A;  1SIJ A;  3TMP B;  4US8 A;  3DHH C;  3P4Q B;  2KX0 A;  3C0R B;  3PV1 A;  1WYW B;  1DGJ A;  2REX A;  1K50 A;  3GOE A;  1HQR D;  4NNJ B;  2FAZ A;  2Z8L A;  1SE9 A;  2K8H A;  3H7S A;  2J7Q B;  4ZRI A;  3PHX B;  3H1U A;  2PE9 A;  5LNK 1;  2PKO A;  4IM2 A;  2CJO A;  1F0Z A;  4W9L A;  1SF0 A;  2GOW A;  1FRR A;  5HHD G;  2KLC A;  3LYY A;  5BMG A;  3DVN V;  1MI0 A;  3RCZ A;  1M4V A;  2M19 A;  4K3B A;  3UGB B;  4DHJ D;  4MGZ E;  1JWB D;  2L0F A;  2L05 A;  2Z59 B;  2BTE A;  4W9E A;  3VTU A;  4MGK E;  2V4I B;  5J18 A;  2WGS A;  4GSW A;  4DHZ B;  1FD6 A;  5C3J B;  4G11 A;  3T8M A;  2BQQ A;  2LI5 A;  1NDD A;  2LEK A;  4EZK A;  1WE6 A;  2WXM A;  1RFA A;  2JT4 B;  4JL9 A;  2O2V B;  4JE3 B;  5IKC M;  4BOZ B;  1AN8 A;  1L2N A;  4MM3 B;  2MJD A;  5EDS A;  2HDE A;  4LJP B;  2JYT A;  3AE3 B;  1FXI A;  3P4P B;  1FIQ A;  4KKJ A;  3U8Z A;  2EKI A;  2L52 A;  4IC7 B;  3B1L X;  3QK0 A;  1R7S A;  1FNW A;  3MJ5 A;  3RZF A;  1B1Z A;  2WX0 A;  1V1P B;  3B2G A;  4FHK A;  3DBH I;  2IGH A;  1H8C A;  5JH5 C;  4HCN B;  2W9N A;  3AU5 A;  4FBJ B;  1QIL A;  4M0W A;  2J53 A;  3FIL B;  1LO5 D;  2RDG A;  2MX2 A;  4FLH A;  1XXG A;  1M94 A;  3Q3M C;  4UDU C;  4XE0 A;  1JRP A;  2K0P A;  5C23 A;  1TZO A;  2DYO A;  1HTO A;  2WXH A;  5CHW A;  4KVG B;  2L83 A;  5IO9 A;  3TEW A;  1QQR A;  3PLU A;  1Q5W B;  3BWU D;  2GB1 A;  2WP9 B;  2V9H A;  1XQQ A;  1AWD A;  4OZB A;  2BYF A;  2KJ6 A;  2LD9 A;  3EHV A;  3TUO A;  1ZUD 2;  4AOF A;  1V8C A;  1XT9 B;  2L8J A;  2JSV X;  2CKH B;  1KH0 A;  2LXC A;  3PRE A;  1GJZ A;  4BAX A;  1HTQ A;  1EO6 A;  2WXN A;  4LLG M;  2K8C A;  1ENF A;  1IYF A;  3Q3J A;  3Q3N C;  2XK5 A;  2VH1 A;  1OEY J;  2ZCC A;  1N61 A;  2FUG 1;  4GOC A;  2O6V A;  4KDL B;  1WMH A;  1TKG A;  1C4C A;  2ZW0 A;  3QWZ B;  2ZZP B;  2EEL A;  3RPF C;  3P42 A;  2PJH A;  1ACC A;  2A5U A;  3V61 A;  1EU4 A;  4AP4 C;  3HVD A;  3P4S B;  3KWV A;  1IGD A;  3KUD B;  2BPS A;  1GC6 A;  2C5L C;  1YNT E;  1GOZ A;  5IP4 D;  2C7N B;  3VUX A;  3VR8 B;  4A90 A;  4YWG G;  1NVI D;  1GG3 A;  3CIR B;  1YQ3 B;  2M1M A;  1I4X A;  2KAJ A;  1UBQ A;  4KX6 B;  3ZYY X;  1E10 A;  3ZTD A;  3DDC B;  2SEB D;  1V81 A;  2PMV A;  2RSU A;  3VXW A;  2W55 A;  3H8H A;  1JWS D;  3X0W A;  1L6U A;  3PSE B;  3DWM A;  1D4B A;  5FR6 A;  3AE4 B;  2OJR A;  4DK5 A;  3ZRC A;  2QC8 A;  2N7D A;  2KDB A;  4NAM A;  3VHT C;  1IBX B;  3GP7 A;  1L5P A;  2X38 A;  1ZOY B;  1WGG A;  1FFU A;  5FR3 A;  1E8W A;  2M56 B;  1TJE A;  1VRA B;  2D3G A;  2PPH A;  1J7B A;  3UIP B;  2BBC A;  2HE7 A;  2N9L A;  3ZQ4 A;  3V60 A;  1CMX B;  3T3O A;  2Y3A A;  3FAH A;  3KWL A;  3ZW3 A;  1QOB A;  1D5M C;  1RYJ A;  3VTV A;  3N1Y C;  2KC1 A;  1WGH A;  3E9S A;  1V80 A;  1HEZ E;  3SHQ A;  1R4M B;  1WR6 E;  2QJL A;  3ENE A;  2IGG A;  4E71 A;  1UGJ A;  2WHI A;  1NI2 A;  4JGH B;  4XDC A;  4BBN F;  2MP2 A;  2LJ5 A;  3AXC A;  4HLE A;  1N6Z A;  2LAS A;  1WMH B;  5TR5 A;  2AQ3 B;  4IKG A;  1GPX A;  3R2T A;  1UWM A;  3MHZ A;  5D7G A;  2NBV B;  4TV3 A;  3NZU A;  1OQY A;  4NAW A;  1SB3 C;  2WXQ A;  2QIE B;  3Q8A A;  2MHJ A;  3WCQ A;  2W3S A;  4W9F A;  2LVP A;  4EEW A;  1FFV A;  3IBE A;  4IM3 A;  1LQB A;  1K52 A;  3PO0 A;  5E6P A;  1DYQ A;  3LJ3 A;  4K81 A;  1UUP A;  1J0G A;  3IT4 B;  2LHE A;  5CHF A;  4I6L B;  1ET6 A;  2FID A;  2LXA A;  1X1M A;  3DQV A;  1E7V A;  4P1C C;  2H89 B;  2DBY A;  4RM8 A;  1PUT A;  4YT0 B;  1E8Z A;  3IVF A;  4TQ1 A;  3AB5 A;  4KZC A;  2WQY B;  4KZ0 A;  2BW2 A;  1MHH E;  3N3K B;  2BF8 B;  3KYC D;  4B0E A;  2K39 A;  1L0X B;  2D5G A;  1YIW A;  1JCK B;  2D3B A;  5IA7 A;  5L95 C;  2GMI C;  1SE3 A;  1V1O A;  3SFE B;  3T9L A;  4EUT A;  3A33 B;  3M3J A;  1EU3 A;  1V2Y A;  3TL5 A;  4AJY B;  4ACF A;  4PT5 A;  4BVU C;  1EWY C;  2M17 A;  1QT9 A;  3AEE B;  3I63 C;  2K6D B;  2DAF A;  2BS3 B;  3D32 A;  3VAW A;  1QKZ A;  3KH0 A;  2H88 B;  4OW0 A;  3B9J A;  4YTN B;  3UQB A;  2BKR B;  1TY0 A;  3NY5 A;  1I4H A;  1Z2M A;  3AEF B;  5D6J B;  2KFK A;  4US9 A;  3A4S C;  1ZKH A;  3N1X C;  2KMC A;  2KQS A;  4LDT B;  3O13 A;  2NMQ A;  3W1Y A;  1IGC A;  2AQ2 B;  2WXG A;  4Q2J A;  4AS1 A;  2JY6 A;  4KKI A;  4M8N A;  2IO0 B;  1OQR A;  2RGF A;  2WDV B;  4W9D A;  1Z5S B;  4KIK A;  4W9C A;  1QOA A;  2MP2 B;  4C00 A;  1UF0 A;  1MPE A;  3L10 B;  4R3D A;  4BKT A;  4IDI A;  2HTH A;  5J2R A;  1K8R B;  1TYG B;  2LVQ A;  4C4V A;  3RNA C;  4XC2 A;  1MG4 A;  2NTT A;  3B2F A;  1P7E A;  2Y5C A;  2WX1 A;  3H9D A;  3S2A A;  2HTM E;  2JX5 A;  1TS3 A;  3I3T B;  4C56 C;  3E56 A;  2MSE D;  4USA A;  4WQO B;  2VRR B;  4NJ6 A;  5HKH A;  3U4E G;  3NVZ A;  3APF A;  5LXH A;  1ZGU B;  4BBN C;  4P6V F;  1UH6 A;  3IAS 1;  2KK8 A;  2M4N A;  1E7U A;  4AWJ A;  4W9K A;  4RM9 A;  1EF5 A;  4RGM A;  1WI0 A;  2BGF A;  3IHP C;  4HEA 1;  2KQ4 X;  4GXB A;  1B9R A;  4GN1 A;  4GLS C;  3RN9 C;  3C19 A;  1VZ8 A;  3AE7 B;  3PLV A;  2KX3 A;  1DOI A;  4P7I A;  1BUI C;  2L0T A;  2LGS A;  4E3C A;  4EOY A;  4ZRK A;  3W9C B;  4ANU A;  4TSS A;  2O2V A;  2IYD B;  1E0Z A;  4PS3 A;  1J7C A;  3JSV B;  4MM3 A;  4W9G A;  5AZF A;  2RDH A;  4IW0 A;  2CS4 A;  3X23 A;  3TJP A;  4DXG A;  2KFK B;  3PZ8 A;  1CK1 A;  3IXS A;  2K5P A;  1JWM D;  4P16 A;  3ZXR A;  2LJI A;  2BYT A;  1I4Q A;  2X8X X;  1E7P B;  3OJ4 B;  3VQI A;  1V1P A;  4KGR A;  2L00 B;  2G4S A;  2KN4 A;  3ZVV A;  1GB4 A;  4KV2 A;  4N9F 4;  2JXT A;  2ZNV B;  1VD2 A;  4E74 A;  2K6Q A;  2KN5 A;  4HJK A;  2KVZ A;  4MDK E;  1HZ5 A;  1TS4 A;  1Y56 A;  4C4V B;  3RNE C;  1C9F A;  4JQW C;  2WWZ A;  3ZNG C;  2QCZ A;  2KJR A;  4TUU A;  1JWA D;  3R2I A;  3FC4 A;  3WAM A;  1QOG A;  3U7Z A;  1L7Y A;  2KWC A;  4PK1 A;  1PQS A;  1D5Z C;  4EZL A;  3CSF A;  2Y5P A;  4LNO A;  4LNI A;  2PW9 A;  4W9I A;  3ZXV A;  2ZPY A;  3Q69 A;  4RH6 A;  4ASW C;  3L54 A;  5G5H A;  2QEJ C;  2VZK D;  5G5G A;  4DDG D;  2MWS B;  2GBJ A;  5HI1 A;  3APC A;  3ZGZ A;  4LK0 M;  2KTF A;  1EM7 A;  1MFW A;  5AZG A;  3WAN A;  4CO7 A;  3NHE B;  4RMA A;  1TZ1 A;  1WR1 A;  3BK2 A;  1HXY D;  1TY2 A;  1XLO A;  4HDQ A;  1KRH A;  2N7E A;  3T3N A;  3V3X A;  2MEK A;  4QAY A;  1TGZ B;  5BYS A;  1XF5 L;  4II2 B;  4RF0 A;  1JW9 D;  3ZDT A;  2PEA A;  3QCA A;  4OVU A;  2IO1 B;  4KDI C;  1FNU A;  3BVZ A;  3PRZ A;  1JQ4 A;  4WWN A;  3N20 C;  4BFR A;  3M95 A;  4C7Y A;  2L76 A;  4JIO U;  1WGY A;  2RDB C;  5CTR C;  3MP9 A;  2DZI A;  1KM7 A;  3CST A;  2FCM A;  3VTW A;  2N9X A;  1V9J A;  2DZJ A;  3DCG A;  3NS8 A;  4DBG A;  3MTN B;  3NOB A;  2CU1 A;  4L1B A;  2HJ1 A;  3VVW B;  4KGS A;  1GUA B;  2BS4 B;  1UWX A;  2LGY A;  4WWP A;  2JUO A;  2N0S B;  3IG3 A;  4MJS A;  2BS2 B;  2LRU A;  2KTR B;  4OZA A;  3FKY A;  1QOF A;  4IM0 A;  1R4N I;  4BOS C;  2PVG C;  2I1K A;  1FRD A;  1CJE A;  5FKA C;  2ZVN A;  2IDY A;  2AEH A;  2D3C A;  3ML8 A;  4B95 A;  2KOX A;  2UU7 A;  2KC2 A;  3Q14 C;  4HPP A;  4ARI A;  4P1B C;  2K1F A;  2MRP A;  3OWE B;  3AE5 B;  5H92 C;  2LUE A;  1V97 A;  4IG7 B;  1T0Y A;  1IBX A;  4YSZ B;  4DXF A;  5C2T B;  2BYV E;  2QMT A;  2R2Q A;  2QDF A;  3DBR I;  3NG0 A;  3BZD B;  4YSX B;  1VZ7 A;  3BVG A;  3NZ3 A;  3ZTC A;  5IOI A;  3R66 C;  4RFB A;  5TSS A;  4JX1 C;  5E6J A;  4GB9 A;  1T0R C;  2MCN B;  2OJW A;  1YN3 A;  2V1Y A;  3VUY A;  2LVO A;  4C80 A;  4S17 A;  3Q8C A;  4ZRJ A;  5HG2 A;  3GB1 A;  4HRO A;  3PRP B;  1L0Y B;  1WX7 A;  2MBB B;  5I4D A;  4ZHP A;  3Q2A C;  1FO4 A;  2DX5 B;  3O65 B;  3ONS A;  3UF8 A;  1WSP A;  2WDR B;  2ONQ A;  3DBH B;  1KOT A;  3AUL A;  1AYF A;  4N6E B;  1V49 A;  3HRD D;  1ZXH A;  3NUH B;  3OJ3 A;  5BMH A;  2FIF A;  3URY A;  1TS2 A;  2LGI A;  3AI5 A;  1SSN A;  1J8C A;  4MSM B;  3GE8 C;  1YN5 A;  5EE9 A;  3RMK C;  4RGT A;  3EC8 A;  1ZPS A;  2NBW B;  4G3X B;  2HJ8 A;  1AW7 A;  2YVC A;  1TTN A;  1ZE3 D;  3GZN I;  4MH8 A;  4O1N A;  4GGQ A;  1OTR B;  4HPM B;  1K53 A;  4XWW A;  4MJS B;  2V3N A;  1SIF A;  1UEL A;  4NPN A;  2XBB C;  5IAA C;  3I57 A;  2BVC A;  3SFD B;  3Q8F A;  3K9O B;  2CJN A;  3PS6 A;  4BZA A;  2JZZ A;  1S1Q B;  5H8Y E;  4K7S A;  2FCQ A;  3QQ8 B;  4YSY B;  4A3O A;  1L6V A;  4ZHO A;  4DWF A;  1UBI A;  3UIN B;  1L4D B;  1GAQ B;  1I4G A;  3KW5 B;  5AEK B;  3HUI A;  3ABV B;  4HCP B;  2J0K A;  2MA9 B;  4NQK E;  5LXI B;  1WYG A;  4MAC A;  2KDE B;  1OQQ A;  1WM3 A;  1N60 A;  1SBB B;  1I4R A;  2L3Z A;  1T0Q C;  2YLM A;  1XCQ L;  3ZIM A;  1XO3 A;  3ML9 A;  2PTL A;  2B76 B;  1EWC A;  2M0X A;  3DHG C;  1YD8 U;  1SXT A;  5JHB A;  3QJZ A;  4MGY E;  3B08 A;  4B6W A;  3R3M A;  1NYQ A;  2KWV B;  2LWP A;  1YJI A;  1YX6 B;  3AN1 A;  2NCN A;  4XZ4 A;  2C9W B;  3ETR A;  3A9K B;  3QAR A;  2RMM A;  1FXA A;  4FHJ A;  2LMC A;  1PDX A;  4KSK C;  1SGH A;  3L0W B;  1ZDX A;  2V3P A;  3W1S C;  1N62 A;  4XGA B;  3NVV A;  2MBE A;  1CZP A;  2QHO A;  2IY0 B;  2Y5B B;  4G0N B;  2ZCB A;  2ASQ A;  5E6N A;  1Q1O A;  3KQ4 A;  3I9V 1;  1U4A A;  2J42 A;  1RM6 C;  3L16 A;  1GC7 A;  4DDI D;  4WIP A;  3WAL A;  3DVG X;  1IP9 A;  4F7Z A;  1WGD A;  3W1S A;  2K25 A;  3TIX A;  3BY4 B;  2INC C;  5CHV C;  3TSS A;  1XCT L;  2WLB A;  4FUL A;  3AH7 A;  3UI3 A;  3NS1 A;  1NEN B;  3ZJV A;  5MPO A;  5DCN A;  1F1H A;  1VDV A;  2I1J A;  4HKQ A;  3NRZ A;  3NVW A;  2AL6 A;  2JZ3 B;  1ZDV A;  1ROE A;  5AZH A;  2JRH A;  4FN2 A;  5L83 A;  1N5W A;  2FCS A;  3UQA A;  1P0R A;  1PFD A;  3DHI C;  1WJ4 A;  1DOX A;  4WAF A;  1Q10 A;  1NI3 A;  1LXD A;  2IGD A;  2WXL A;  3BVM A;  1V6E A;  3N32 A;  2DWQ A;  4L23 A;  3P2B A;  3W5V B;  1YX5 B;  2ZW1 A;  3IT6 B;  3JSV A;  2J0M A;  3N1Z C;  2DZM A;  3H7P A;  2KVR A;  4MSQ B;  1WH3 A;  2FUH B;  3KYD D;  1PGX A;  1HZ6 A;  1C4P A;  4GU2 A;  2JPH A;  3M62 B;  3SEB A;  2IPK D;  4K7U A;  4ITK A;  2KXJ A;  2V3S A;  4HDO A;  4HRS A;  1VCB A;  5EE3 A;  3K9P B;  2A4Z A;  3PZD A;  1WIA A;  1HA5 A;  2V0G A;  2TSS A;  3CWI A;  3QC8 B;  2AQ1 B;  2GBN A;  3QAQ A;  4WWO A;  4JWS C;  2L1A A;  3RNC C;  1KLV A;  3P4R B;  2CU3 A;  1ZXI A;  4FAD A;  2IO3 B; 
#chains in the Genus database with same CATH homology
 4AOF A;  4EZL A;  4HWI B;  3CSF A;  1XT9 B;  2Z0D B;  3A9J A;  2L8J A;  4W9I A;  2EMS A;  2V4L A;  2ZPY A;  2LGX A;  1JRU A;  2MW5 A;  3TCA A;  2CKH B;  3EEC A;  4X57 B;  2LXC A;  3PRE A;  3Q3F A;  4MEL A;  3L54 A;  2XK5 B;  4MGI E;  5E6O A;  3RUI B;  4ASW C;  1GJZ A;  4MH0 E;  4A3P A;  4DDG D;  4DHJ B;  1EO6 A;  3V6E B;  4A20 A;  2MWS B;  2UWQ A;  2GBJ A;  3RZW C;  3APC A;  2K8C A;  1D3Z A;  2O6V B;  1IYF A;  2KTF A;  3Q3J A;  2KKC A;  2XK5 A;  5AZG A;  3WAN A;  1E90 A;  1OEY J;  2BWE S;  2ZCC A;  3DBL I;  4CO7 A;  2KQ7 A;  2KZR A;  3NHE B;  3KUZ A;  4RMA A;  1TZ1 A;  1WR1 A;  4FJY A;  4HDQ A;  1J19 A;  4GOC A;  2O6V A;  4GIV A;  1WXV A;  1WMH A;  2N7E A;  2KMA A;  2O6V D;  4KDL B;  5JZE B;  1WXS A;  3QWZ B;  3ZKJ C;  1TGZ B;  2C7H A;  3RT3 B;  1WJN A;  4II2 B;  1WZ3 A;  3ZO5 B;  2ZZP B;  5DPT A;  3ZLZ A;  3ZDT A;  4B9K A;  2PEA A;  3QCA A;  1WY8 A;  2PJH A;  4NQL B;  4OVU A;  2IO1 B;  1WXM A;  4KDI C;  3V6C B;  2G3Q B;  3EFU A;  2A5U A;  3V61 A;  2NPT B;  2EKE C;  3PRZ A;  2N4F A;  4WWN A;  4BFR A;  4AP4 C;  2KHW B;  4FJZ A;  3M95 A;  5J17 A;  2CHZ A;  3QX1 A;  1LFD A;  4IWQ A;  2L76 A;  4JIO U;  1WGY A;  5DPS A;  2KJH B;  3KUD B;  2BPS A;  4LJO B;  2DZI A;  1GC6 A;  5CTR C;  2C5L C;  1KM7 A;  2C7N B;  3CST A;  2FCM A;  3VTW A;  5CX3 A;  3PRM B;  3VUX A;  2N9X A;  4FJV B;  1GG3 A;  2ZPN A;  1V9J A;  2DZJ A;  3DCG A;  2DEN B;  3BIN A;  3NS8 A;  4DBG A;  3MTN B;  3NOB A;  4URK A;  1C1Y B;  2CU1 A;  2KLG A;  3APD A;  4ICV A;  2M1M A;  4GDK B;  1WJU A;  2JF5 A;  3SU8 X;  3VVW B;  3HHM A;  1GUA B;  3H7P B;  4ANW A;  1UBQ A;  3HIZ A;  4CHK A;  2LGY A;  3ZTD A;  1RRB A;  4WWP A;  2KO3 A;  3PVL A;  4M8M A;  3JYU A;  3DDC B;  3ZNZ B;  1V81 A;  2RSU A;  3VXW A;  2JUO A;  4WJO A;  3PPA A;  3IG3 A;  1GNU A;  1Y8R C;  4MJS A;  3PTF C;  3ZDM C;  2ZNV C;  2DYM A;  2LRU A;  2KTR B;  4W9H A;  3H6N A;  3X0W A;  3PSE B;  3NZS A;  4IM0 A;  1R4N I;  4F1S A;  4BOS C;  2I1K A;  2HD5 B;  5FR6 A;  2OJR A;  4DK5 A;  2ZVN A;  2EMT A;  3ZRC A;  2MQJ A;  1QZE A;  2N7D A;  2WYQ A;  2AEH A;  2KDB A;  5LLI A;  3ML8 A;  2KTR A;  1UZX B;  4B95 A;  2KOX A;  1WX8 A;  3VHT C;  2KC2 A;  2D10 A;  4ZDV A;  1C3T A;  2KNB A;  3PGE A;  1WGG A;  2BKF A;  2MBH A;  2K1F A;  4TKN A;  2MRP A;  1ZW7 A;  1E8W A;  4CYE A;  2D3G A;  1TBE A;  1I35 A;  2LUE A;  2PPH A;  1WGR A;  3MHS D;  4LCD E;  3UIP B;  2B3A A;  1T0Y A;  2HE7 A;  2M8S A;  4IG7 B;  3V60 A;  2ZVO A;  1CMX B;  1WJ6 A;  1KJT A;  3A9J B;  1E5W A;  2D07 B;  2KDF B;  2C60 A;  2BYV E;  3ZW3 A;  1LM8 B;  2R2Q A;  5JHA A;  2RD0 A;  3UIO B;  4HPL B;  3VTV A;  2DYB A;  3DBR I;  4F8C B;  2KC1 A;  1EF1 A;  1WGH A;  4WJQ A;  2BWF A;  4BKS D;  1V80 A;  3ZTC A;  3SHQ A;  2JRI B;  1Q0W B;  1WR6 E;  4K7W A;  3ENE A;  1ISN A;  4E71 A;  1P1A A;  2NVU I;  3JW0 X;  3R66 C;  4GB9 A;  2MCN B;  1NI2 A;  2V1Y A;  1BT0 A;  3VUY A;  2JWZ A;  4JGH B;  3DVN U;  4BBN F;  2LVO A;  2MP2 A;  2LJ5 A;  2N9E B;  4ICU A;  5D2M B;  4ZRJ A;  1XD3 B;  2GBR A;  3AXC A;  3LDZ E;  1YJ1 A;  1AAR A;  4WAA A;  2C7M B;  3WAO A;  4HLE A;  4GMV A;  2LAS A;  3PRP B;  1WMH B;  5TR5 A;  4NAW B;  1RAX A;  3DVG Y;  1WX7 A;  2MBB B;  4EZJ A;  3KUC B;  3WA0 A;  2DX5 B;  5D7G A;  2NBV B;  3O65 B;  3ONS A;  3UF8 A;  2GBK A;  3NZU A;  4TV3 A;  1OQY A;  1KOT A;  3AUL A;  2NR2 A;  4NAW A;  1V49 A;  4AUQ C;  3TBL D;  3OJ3 A;  2LRW A;  3IFW B;  1WM2 A;  2G45 B;  3DPD A;  2FIF A;  2MBO A;  4W9F A;  2AL3 A;  2LVP A;  4GDL A;  3AI5 A;  2RR9 A;  4EEW A;  3QA8 A;  1J8C A;  3IBE A;  4MSM B;  4BKG A;  2JVC A;  4IM3 A;  1LQB A;  3VDZ A;  4DXA B;  3SDL C;  3U7D A;  4PS8 A;  3B0A A;  5E6P A;  2N1W A;  4AJW A;  2NS5 A;  2UYZ B;  4NJ7 A;  3EC8 A;  3LJ3 A;  4K81 A;  2NBW B;  1J0G A;  4HK2 A;  1IPG A;  4G3X B;  2N9P C;  2FCN A;  4I6L B;  4I6P A;  4OVV A;  5CHF A;  2BYE A;  2FID A;  5C1Z A;  2HJ8 A;  3JVZ X;  2LXA A;  5KHO A;  1X1M A;  2G4D B;  2YVC A;  3DQV A;  1TTN A;  1E7V A;  3GZN I;  4G50 A;  4GGQ A;  4RM8 A;  1E8Z A;  1WE7 A;  3RYT A;  1OGW A;  3IVF A;  1OTR B;  4HPM B;  1WXA A;  4TQ1 A;  4KZC A;  4W9J A;  4KZ0 A;  3A1Q B;  1WX9 A;  4IUM B;  3CMM B;  3N3K B;  4MJS B;  3V62 A;  2BF8 B;  1SIF A;  1UEL A;  1YQB A;  3KYC D;  4NPN A;  2XBB C;  2K39 A;  5IAA C;  2MBQ A;  3VH3 B;  2J0J A;  4WJP A;  1A5R A;  1I42 A;  1YIW A;  2CR5 A;  5IA7 A;  3K9O B;  3PS6 A;  5L95 C;  2IBI B;  2D11 A;  4EFO A;  2JZZ A;  1S1Q B;  2GMI C;  3A1Q A;  3PHW B;  3ZNI D;  4K7S A;  1EUV B;  2FCQ A;  2IY1 B;  3QQ8 B;  4XX5 A;  4A3O A;  3T9L A;  2ZEQ A;  4EUT A;  4DWF A;  3A33 B;  3M3J A;  1UBI A;  3UIN B;  1G6J A;  2DAJ A;  2LZ6 A;  1V2Y A;  3TL5 A;  3VUW A;  4MEM A;  4AJY B;  1UGM A;  1UD7 A;  3KW5 B;  5AEK B;  5KHQ A;  3QHT A;  3ALB A;  4BVU C;  4HCP B;  4HXD A;  2PE6 B;  2D2Q A;  2J0K A;  2M17 A;  4I6N B;  2XEW A;  2MA9 B;  4YL8 A;  2KD0 A;  4NQK E;  5LXI B;  3PT2 B;  2K6D B;  4DHZ E;  2DAF A;  3D32 A;  4KSL C;  2R2O A;  2KDE B;  3SD5 A;  1S3S G;  3VAW A;  1WM3 A;  3KH0 A;  3M63 B;  3UQB A;  3KVF B;  2DHZ A;  2BKR B;  1HE8 A;  5DPR A;  4TQ0 A;  3RUL A;  2L3Z A;  3NY5 A;  1Z2M A;  5D6J B;  2KFK A;  2YLM A;  2CHW A;  3DBS A;  4JLC A;  3A4S C;  3HM3 A;  1ZKH A;  2KMC A;  2KQS A;  3ZIM A;  3L13 A;  2IZV B;  3ECI A;  4KIK B;  4LDT B;  2WDT B;  3N30 A;  2LGD A;  3W1Y A;  3ML9 A;  1P98 A;  2N1V A;  2JY6 A;  4M8N A;  2KWU B;  1P9D U;  2IO0 B;  2M0X A;  2ZJD A;  2RGF A;  5G55 A;  4W9D A;  1YD8 U;  1V5O A;  1Z5S B;  3ZUN A;  4ANV A;  3OLM D;  5JHB A;  4KIK A;  4LDT D;  2RPQ A;  3QJZ A;  4W9C A;  3ZRF A;  4BKS A;  2MP2 B;  4MGY E;  3B08 A;  4B6W A;  1RLF A;  3L17 A;  3WIM A;  3L10 B;  4BKT A;  3OAW A;  2AWT A;  3R3M A;  2KWV B;  2LWP A;  3VH4 B;  1WFY A;  3CF6 E;  1YX6 B;  2HTH A;  4II3 B;  3TMP B;  2NCN A;  5J2R A;  1K8R B;  2LVQ A;  2KX0 A;  4XZ4 A;  3C0R B;  2C9W B;  3PV1 A;  3A9K B;  4XC2 A;  3QAR A;  1WYW B;  2REX A;  3GOE A;  1V5T A;  4FHJ A;  2WX1 A;  4FA6 A;  3H9D A;  5DPW A;  4PYZ A;  4KSK C;  1SGH A;  4NY0 A;  3L0W B;  4NNJ B;  3S2A A;  3W1S C;  2FAZ A;  2MBE A;  3U30 A;  1SE9 A;  3A9K A;  2QHO A;  3I3T B;  4GDL B;  2L7R A;  2IY0 B;  2Y5B B;  2K8H A;  3H7S A;  4G0N B;  2IO2 B;  2MSE D;  3A4R A;  2J7Q B;  4ZRI A;  4ANX A;  4WQO B;  2ZCB A;  2ASQ A;  3PHX B;  2VRR B;  2PE9 A;  3H1U A;  5E6N A;  4IM2 A;  4NJ6 A;  2MLB A;  4J6I A;  4W9L A;  5HKH A;  1Q1O A;  2GOW A;  2GBM A;  3RD2 A;  2KLC A;  3APF A;  3DVN V;  1U4A A;  5LXH A;  1ZGU B;  1OEY A;  3RCZ A;  4BBN C;  1UH6 A;  5G2N A;  3L16 A;  3UGB B;  2KK8 A;  1GC7 A;  2M4N A;  1E7U A;  3HM6 X;  4DHJ D;  4DDI D;  4AWJ A;  2KAN A;  4MGZ E;  1V86 A;  4RM9 A;  3DVG X;  4W9K A;  3WAL A;  2JXX A;  1IP9 A;  4WJN A;  4F7Z A;  2K8B A;  3AU4 A;  1EF5 A;  1WGD A;  4HVB A;  1F9J A;  1E8Y A;  1NBF C;  1WI0 A;  2L0F A;  2L05 A;  3W1S A;  2BGF A;  3IHP C;  2Z59 B;  4GXB A;  4W9E A;  3R7R A;  2K25 A;  4GN1 A;  3TIX A;  3VTU A;  3BY4 B;  4MGK E;  5CHV C;  5J18 A;  4GSW A;  3QIJ A;  4DHZ B;  4G11 A;  3T8M A;  4FUL A;  2LI5 A;  4PS7 A;  1H4R A;  1NDD A;  5DCN A;  3PLV A;  4K1R B;  4EZK A;  1WE6 A;  1RFA A;  2JT4 B;  2KDI A;  4JL9 A;  2KX3 A;  4P7I A;  2I1J A;  2O2V B;  2AL6 A;  4BOZ B;  2JZ3 B;  5AZH A;  2JRH A;  1E8X A;  1L2N A;  4FN2 A;  3WAP A;  5L83 A;  2L0T A;  4E3C A;  1WRD B;  2NPT A;  1R4M I;  4EOY A;  5GMV A;  5EDS A;  4ZRK A;  4ZYN A;  4ANU A;  2FCS A;  3UQA A;  4LJP B;  1P0R A;  1MG8 A;  2O2V A;  2IYD B;  4IWO A;  1WJ4 A;  4PS3 A;  3JSV B;  4MM3 A;  4W9G A;  5AZF A;  1WZ0 A;  1LXD A;  4IW0 A;  3U8Z A;  2DZK A;  3B1L X;  4IC7 B;  3QK0 A;  3N32 A;  2CS4 A;  1V6E A;  3X23 A;  3TJP A;  3RZF A;  2WX0 A;  3P2B A;  4IWP A;  2KFK B;  2OOB B;  1YX5 B;  2NBU A;  5BO4 B;  3JSV A;  4GDK A;  2J0M A;  4FHK A;  4M0W B;  2DZM A;  2FNJ B;  3H7P A;  3DBH I;  3DOW A;  2KVR A;  4MSQ B;  3OJ4 B;  1WH3 A;  1H8C A;  2CHX A;  2FUH B;  4HCN B;  2Z0E B;  1WF9 A;  3VQI A;  4EKU A;  5JH5 C;  3KYD D;  2W9N A;  3AU5 A;  4FBJ B;  5D94 A;  2L00 B;  4GU2 A;  2JPH A;  2G4S A;  3M62 B;  3ZVV A;  4KV2 A;  4K7U A;  4N9F 4;  3L08 A;  2ZNV B;  1VD2 A;  4E74 A;  2MX2 A;  4FLH A;  1M94 A;  2K6Q A;  2KN5 A;  4HJK A;  2KXJ A;  2V3S A;  4MDK E;  3VFK A;  5C23 A;  2AYO B;  4HDO A;  1VCB A;  2DYO A;  1FXT B;  4JQW C;  2WWZ A;  5CHW A;  4KVG B;  3ZNG C;  3K9P B;  2A4Z A;  4PYU A;  3PZD A;  1WIA A;  2KJR A;  4TUU A;  3R7Q A;  3ZNH B;  3PLU A;  1Q5W B;  3WAM A;  3QC8 B;  1L7Y A;  2GBN A;  3QAQ A;  4WWO A;  1P3Q U;  1XQQ A;  2KWC A;  1KLV A;  3HK0 A;  3MJW A;  2KFJ A;  2BYF A;  4FAD A;  1PQS A;  2KJ6 A;  2LD9 A;  3EHV A;  2IO3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...