3QX1A

Crystal structure of faf1 ubx domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
MEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FAS-associated factor 1
publication title Dissection of the interaction between FAF1 UBX and p97
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 25
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3qx1A00
3M63B 5FR6A 2NBUA 4KZCA 4WWPA 4IC7B 2KJRA 2W9NA 2LWPA 3QA8A 2WX1A 2K8CA 2RD0A 4OVUA 2L8JA 1IP9A 2LJ5A 1Q0WB 2G4DB 3ECIA 2DZKA 3PREA 3SU8X 1WX9A 3O65B 3AXCA 3ALBA 2G45B 2KHWB 2KKCA 2YVCA 3KYDD 4A3OA 3CMMB 2BWFA 2AWTA 2I1JA 4HDQA 2O2VB 3AU4A 4CO7A 3WALA 3ZTCA 2GBRA 1LQBA 1J19A 2WWZA 2MQJA 3U30A 5J17A 1PQSA 4ZRKA 1KOTA 2XK5A 3KUDB 5AZHA 1Q5WB 4ANVA 1E8ZA 4HLEA 1S1QB 3WIMA 2JUOA 2LASA 4KSKC 4TKNA 1GC6A 1OGWA 4RM9A 1P3QU 1V6EA 4M8NA 2KTFA 3VUWA 1WZ3A 4K7UA 3I3TB 2KDEB 2JF5A 4TQ1A 5KHOA 3VFKA 1V80A 2FAZA 4NNJB 3PLVA 4G3XB 2PE6B 3W1SA 2RGFA 1VCBA 2DHZA 2IY1B 3APDA 2JVCA 1JRUA 3ZRFA 4EOYA 3HM3A 2LUEA 3QAQA 4II2B 1YQBA 4W9FA 4ANUA 2C7HA 4EKUA 2GBKA 2L0TA 2KTRA 2DZJA 3WAMA 3JSVA 1ZGUB 2IO3B 3UF8A 4I6PA 5BO4B 2K6DB 3V62A 4NJ6A 1K8RB 3UQBA 1WE6A 2KX3A 4NPNA 4ZRJA 3A9KB 3UINB 1V2YA 4IM2A 3ZNID 1WM3A 1TZ1A 2JRIB 3ML9A 4GDKB 3VXWA 3WANA 1WXAA 3CSTA 1ISNA 3IG3A 2C5LC 3A33B 2J0KA 1KM7A 4NAWA 4GDLA 2R2QA 3R66C 1SIFA 5EDSA 2FCMA 1R4MI 4DWFA 2HD5B 4A3PA 2LRUA 1I42A 5CTRC 3V60A 2IO0B 3ZDTA 4F7ZA 2KJ6A 2FNJB 1L2NA 3R3MA 4PS3A 5AEKB 2C9WB 2QHOA 1WMHA 2JPHA 1V5TA 2ZNVB 4PS7A 2MBHA 4EZKA 4JGHB 1YIWA 4I6LB 3UIPB 5E6PA 2M1MA 1E8YA 5D2MB 4MJSB 3DBLI 4X57B 2L0FA 3SD5A 1V5OA 3H1UA 4ANXA 3KYCD 3DVGY 4W9EA 2L05A 1WX7A 5LXIB 3PLUA 3P2BA 2MLBA 3JYUA 4WJQA 4KIKA 5IA7A 4FHKA 2A5UA 4IM0A 4MSQB 3PRPB 3EHVA 1D3ZA 4TV3A 3N3KB 3AULA 3NOBA 4ZYNA 4LJPB 3QX1A 3DQVA 3HIZA 4DHZB 1RFAA 3QARA 1WXSA 3U7DA 4K1RB 2ZPNA 2LXAA 2G4SA 4AUQC 3GOEA 4W9CA 2ZCCA 3W1YA 3A9JA 2AYOB 2KC1A 4MELA 2DYMA 3IVFA 3RCZA 2CHZA 1UGMA 3IBEA 2DAFA 2PEAA 4FN2A 3AU5A 2NPTB 2V4LA 2LI5A 2FIFA 2ZNVC 4NY0A 1RRBA 4ANWA 4FBJB 2NBWB 3RYTA 3WAOA 3WA0A 3A4RA 2CS4A 2KMCA 1X1MA 1XD3B 2DAJA 3RUIB 4IUMB 4LCDE 3SHQA 3X0WA 3BINA 3TCAA 3N32A 4W9DA 1V9JA 2MBQA 1KJTA 2GBMA 1UH6A 2KQSA 4FADA 2K8HA 4DBGA 2BKRB 1YD8U 2GOWA 1WXVA 3VTVA 1V86A 2D07B 3RZFA 3QJZA 4XX5A 3GZNI 4N9F4 3IFWB 4I6NB 2JWZA 1J0GA 4WWNA 1LFDA 2D10A 2K6QA 3EECA 1YX5B 4ZRIA 2C7MB 1WJUA 2KC2A 5JH5C 2J0JA 2EMSA 2NR2A 1WE7A 3PT2B 4K7WA 1SGHA 3DBRI 2L76A 2XK5B 2N9PC 3PRMB 4W9LA 2LGXA 4JIOU 2K25A 3L16A 2BYEA 3QHTA 2REXA 1Q1OA 2ZZPB 3AI5A 3PTFC 4HCNB 1XQQA 4WJPA 2M8SA 2DX5B 4EFOA 4DK5A 3A1QA 1TBEA 1Y8RC 4FA6A 5J2RA 1WGDA 4BKSA 1UD7A 3DOWA 1WGHA 4HPLB 2K39A 4A20A 1OEYJ 3L54A 2M0XA 2BWES 3HHMA 1WI0A 4KDIC 2V1YA 4LDTD 4AJWA 1RAXA 5E6NA 1RLFA 2C7NB 4G11A 3QCAA 2N7EA 2IY0B 3HM6X 5LLIA 2EKEC 2MP2A 1UELA 2CKHB 4W9HA 4DDID 4EUTA 4GGQA 4LJOB 5TR5A 3VHTC 3JSVB 2ZVOA 3ZW3A 4IM3A 3APCA 2UYZB 2XBBC 1E8WA 1UZXB 1UBQA 4BFRA 4ZDVA 2DYBA 1Z5SB 3VTWA 2BYVE 5C1ZA 4B95A 2MBOA 1V81A 3KUCB 4RMAA 3X23A 2MRPA 1M94A 4MSMB 2EMTA 1LXDA 1KLVA 1E8XA 2LXCA 4CYEA 4II3B 3T9LA 1WZ0A 2KD0A 4NJ7A 2HTHA 2N4FA 4W9IA 4MGIE 2CHWA 2M17A 3W1SC 3DPDA 1LM8B 5E6OA 4BKGA 2L7RA 2YLMA 2Z59B 3MJWA 1U4AA 3SDLC 1WMHB 4DDGD 1YJ1A 3ZO5B 3L17A 3PVLA 5DCNA 3ZLZA 1TTNA 2L3ZA 2K1FA 1P0RA 3VVWB 1YX6B 2JY6A 2BGFA 4K7SA 3DDCB 1QZEA 5JZEB 2IYDB 2ASQA 4KVGB 2JZZA 3CSFA 3C0RB 5CHWA 3QC8B 2G3QB 4GXBA 4KIKB 3H9DA 4PS8A 4E74A 2A4ZA 1E5WA 4DHJD 4BBNC 2KQ7A 5DPSA 2ZEQA 1WR1A 4K81A 1WIAA 3ZDMC 1P98A 1VD2A 3L10B 2BKFA 3OLMD 4FJZA 4KDLB 4W9JA 1P9DU 3QQ8B 3B1LX 3DVNU 3QK0A 4KSLC 1OEYA 3A9JB 1SE9A 3TJPA 2KO3A 4FULA 1WFYA 1WXMA 1OTRB 2KFKA 4ICUA 1WGGA 2NVUI 1WF9A 2XEWA 4HXDA 4NQKE 3R7QA 4WJOA 4BKSD 5DPRA 3PS6A 4EZLA 2DZMA 1GC7A 3H7PB 4IWQA 2KX0A 4FLHA 4G50A 3TIXA 4BOSC 2J7QB 2GBJA 1L7YA 5KHQA 3V6EB 1HE8A 4WAAA 1Z2MA 2DYOA 3RZWC 4BVUC 2MSED 1E7UA 2KDFB 1ZKHA 3EFUA 3M62B 1WRDB 4AWJA 1EF5A 4TUUA 4EZJA 3NY5A 2MBBB 3DVGX 1MG8A 3Q3JA 3R7RA 1EF1A 1WR6E 2MBEA 3Q3FA 2FCNA 4FJYA 1G6JA 1EUVB 3ZNGC 3IHPC 3M3JA 2JRHA 3L0WB 4URKA 1UBIA 3PSEB 2NCNA 4JL9A 1A5RA 4AOFA 2NS5A 5CX3A 2O6VA 2LVQA 4DHJB 3DVNV 3QIJA 2PPHA 1H4RA 2LRWA 2R2OA 2MX2A 2ZPYA 3ZTDA 3CF6E 1IPGA 2ZCBA 3L13A 5IAAC 3TBLD 3ZVVA 3BY4B 3B0AA 4ASWC 2WDTB 3K9OB 4TQ0A 4HVBA 1E90A 1OQYA 4OVVA 3A4SC 2JZ3B 3A1QB 4HWIB 2KWVB 3OJ3A 3V61A 5D7GA 1GG3A 2KLCA 2DENB 4PYUA 1WM2A 2KFJA 4GU2A 4FHJA 4MDKE 3ZRCA 4BKTA 3VH3B 3PPAA 3LDZE 5HKHA 3M95A 2LVOA 2N1VA 3N30A 4JLCA 5L95C 2FCSA 4BOZB 2RSUA 5GMVA 2KN5A 2PJHA 1WX8A 2CHXA 2KJHB 1WGYA 2MWSB 5G55A 2MP2B 2LZ6A 2O2VA 4FJVB 2V3SA 2KWUB 1TGZB 3U8ZA 3ZNZB 3OJ4B 3ZKJC 3HK0A 4E71A 2KTRB 2IO2B 2KVRA 3ENEA 1WY8A 2FUHB 2OOBB 4B6WA 3WAPA 3UIOB 2LGYA 2L00B 1C3TA 4IG7B 1AARA 3TMPB 4GSWA 4KZ0A 2PE9A 1H8CA 4HCPB 1CMXB 1WH3A 2KOXA 2RR9A 5JHAA 2WX0A 2Z0EB 3VDZA 4MGZE 2D11A 2N7DA 4DHZE 3QWZB 4EEWA 1BT0A 2IBIB 3S2AA 4M8MA 4MGKE 4GIVA 4NAWB 4GDLB 5AZGA 4AP4C 2C60A 3V6CB 4BBNF 4MEMA 4WJNA 4IW0A 3RT3B 4G0NB 4ICVA 4W9KA 3KUZA 2KLGA 4HDOA 1GNUA 3NZUA 1WGRA 3APFA 4DXAB 2LVPA 1GUAB 3PV1A 4JQWC 3ML8A 3VTUA 3NHEB 4GOCA 3DCGA 3ZNHB 2ZVNA 2ZJDA 4HPMB 4GN1A 2D3GA 3KW5B 4NQLB 4GMVA 3T8MA 1J8CA 3A9KA 1I35A 5DPTA 2IZVB 2O6VD 2OJRA 4LDTB 4GB9A 2BF8B 1WJ6A 4GDKA 4F8CB 1WJ4A 3KH0A 1NDDA 4CHKA 2BYFA 2KWCA 2WYQA 2M4NA 2MCNB 2D2QA 4B9KA 2AL3A 3VH4B 2KDBA 3RD2A 2N1WA 3ZIMA 2RPQA 3H7SA 2KK8A 4XZ4A 4E3CA 2I1KA 3L08A 2Y5BB 3VUXA 2Z0DB 1V49A 2GMIC 2DZIA 2KANA 2KFKB 4W9GA 5D6JB 2NBVB 5G2NA 2N9EB 4HK2A 5D94A 2UWQA 3LJ3A 2VRRB 3JW0X 3EC8A 4PYZA 5AZFA 1EO6A 2AEHA 2J0MA 4MGYE 4HJKA 5L83A 3NS8A 1GJZA 3TL5A 4MH0E 3ZUNA 4MJSA 2MA9B 3PZDA 3VAWA 1P1AA 2KXJA 2B3AA 2JT4B 1NBFC 3JVZX 2KDIA 3D32A 1S3SG 1XT9B 3ONSA 4AJYB 4J6IA 2FIDA 4M0WB 4YL8A 2FCQA 3MTNB 5JHBA 4WQOB 5LXHA 3PRZA 2LGDA 3RULA 3OAWA 2CR5A 2KNBA 2KZRA 3DBHI 2IO1B 2BPSA 3NZSA 4IWOA 2MW5A 3VUYA 3MHSD 3DBSA 2K8BA 1NI2A 2LD9A 4WWOA 5DPWA 1ZW7A 3K9PB 4F1SA 4MM3A 1WYWB 2AL6A 2O6VB 3KVFB 3PGEA 5J18A 2JXXA 5CHVC 5CHFA 5C23A 3PHXB 1FXTB 4XC2A 3B08A 1C1YB 1F9JA 2GBNA 3H7PA 2NPTA 3H6NA 1T0YA 3UQAA 1WJNA 3UGBB 2CU1A 4P7IA 4IWPA 4KV2A 2KMAA 2N9XA 1E7VA 2HE7A 3PHWB 4RM8A 3VQIA 1IYFA 2HJ8A 1R4NI
chains in the Genus database with same CATH superfamily
3M63B 3B2FA 4IC7B 2KJRA 2LWPA 1STEA 4C00A 2WX1A 4OVUA 3RNFC 2K22A 2HDEA 1XXGA 3UI3A 2IDYA 3O65B 2J42A 2G45B 3HVZA 2YVCA 4TMAB 2AWTA 2BVCA 4IOIE 3AU4A 3W2DA 4MT5A 1R4MB 2VZKD 1Q5WB 1E8ZA 1HTOA 1S1QB 3WIMA 3SR6A 1WRIA 1V6EA 3AE4B 3I3TB 2RPVA 3VFKA 2I2YA 2FAZA 3W1SA 1LO5D 1VCBA 1XEEA 2DHZA 4XWTA 4W9FA 2KTRA 1SIJA 1HZ6A 4I6PA 3BWUD 1HZ5A 1ROEA 1RWSA 1HXYD 2WS3B 1TZ1A 1L6VA 1WXAA 2D5GA 2WLBA 2C5LC 2JQRB 3A33B 4NAWA 4A3PA 1ACCA 4N6EB 1QQRA 4KKIA 1XCTL 2C9WB 2JZPA 2QHOA 2JPHA 1DGJA 2MBHA 2KWDA 3R2TA 2G9HD 3SD5A 4W9EA 3GE3C 4FHKA 4IM0A 3NOBA 4ZYNA 3DQVA 1MI0A 3QARA 1WXSA 4K1RB 2ZPNA 2G4SA 2DLBA 2ZCCA 3A9JA 1GOZA 4MELA 3IVFA 2CHZA 1UGMA 3IBEA 2V4LA 2JU6X 1B1ZA 2WDRB 4FBJB 2WXQA 3MFGA 2KMCA 1XD3B 3AEEB 1LGRA 3KLSX 5MPOA 4LCDE 3X0WA 4W9DA 2KQSA 4FADA 2K8HA 1JRPA 3GZNI 2INCC 4N9F4 2I38A 1LFDA 2K6QA 3PZ7A 4S0RA 1NI3A 2J0JA 2BS3B 3PT2B 1VDVA 3PRMB 2QC8A 4YTPB 2ZZPB 3PTFC 4HCNB 1XQQA 3AE2B 4DK5A 1Y8RC 1L4DB 3P4SB 3EGRA 2PW9A 4N58A 3VRBB 2HTME 1MHXA 1K52A 1OFFA 2N7EA 3RN9C 5LLIA 4DDID 4EUTA 3RFZB 2ZVOA 3ZW3A 4KKJA 1Q10A 1N63A 2XBBC 1Z5SB 4IDIA 2BYVE 1B9RA 1V81A 4RMAA 2LFIA 3X23A 2MRPA 1M94A 3GP7A 1E7PB 1LXDA 4CYEA 3Q8AA 3T9LA 3GS2A 2HTHA 3KWLA 4MGIE 3W1SC 3NZ3A 2FBWB 2YLMA 2Z59B 2VZKB 3MJWA 3AE1B 1SJHD 3U52E 1SF0A 1TS4A 1XLOA 1TY0A 1P0RA 1YX6B 2BGFA 1F2RC 3U4EG 4GXBA 3BVMA 2PLPA 3KQ4A 2KQ7A 3KWVA 4K3BA 4K81A 2VH2A 4R3DA 4RNAA 1I4HA 3ZDMC 1VD2A 3OLMD 2BKFA 4KDLB 1ZDVA 3DVNU 3A9JB 2Q5WD 1WFYA 5HG2A 1OTRB 2NVUI 2XEWA 4WJOA 1TKEA 3PS6A 4EZLA 4P1CC 4A8XC 3TIXA 2GBJA 5KHQA 2X38A 2CU3A 2DYOA 1E7UA 2KDFB 4LLGM 4LNKA 1ZKHA 4Q2JA 3P4RB 4EZJA 2EKIA 1ZPSA 1L4ZB 1GB4A 3M3JA 1FIQA 2WDQB 3L0WB 4HEA1 3PSEB 2M56B 2NS5A 2O6VA 1V8CA 3DVNV 3QIJA 2LRWA 2ZPYA 1F77A 1IPGA 1TT5B 1PYWD 3BY4B 4ASWC 2WDTB 3K9OB 1SJED 2IGDA 5D7GA 1GG3A 1TS2A 2DENB 4PYUA 3ZRCA 2J4XA 1CQVA 3VH3B 3LDZE 4MACA 1KTKA 1SE4A 4JLCA 2CJNA 2FCSA 5GXGB 2AQ1B 5GMVA 2CHXA 1WGYA 2MWSB 4WQMA 2WXGA 2KWUB 1TGZB 2UU7A 3OJ4B 4E71A 2W55A 3ENEA 4B6WA 5T8IA 4YWGG 3UIOB 3SFDB 4IG7B 1AARA 3TMPB 2KAJA 1DOXA 1SXTA 1H8CA 3PZ8A 1DOIA 3DBLB 4MGZE 2D11A 2ICIA 2N7DA 4BBNF 4WJNA 4ICVA 2KLGA 2QEJC 5BYQA 1N5WA 3N9YC 3EFCA 2LVPA 4JQWC 3R2IA 3OWEB 3AEFB 4GN1A 1UGJA 3T8MA 3TSSA 2V0GA 5D3DA 4KX6B 3MHZA 1EU3A 1WJ4A 2WYQA 2M4NA 2D2QA 1JWBD 1C79A 4XZ4A 4E3CA 2Y5BB 2Z0DB 2IGHA 2DZIA 4HJGE 5D6JB 2NBVB 1MPEA 3NRZA 2AEHA 4XYCA 2BB5A 3P63A 1GJZA 4A9AA 3TL5A 2ONQA 1UF0A 4MJSA 4ZHPA 2B3AA 2GLSA 2KDIA 3U2SC 1FNVA 3B9JA 3J9CA 4AJYB 3AE5B 3PRZA 3RULA 2CR5A 3CIRB 2FE8A 2IO1B 4NJCA 2KT7A 3NZSA 3MHSD 3DBSA 3K9PB 4MM3A 5J18A 2O6VB 3KVFB 4H2AA 2JXXA 3B08A 3BK1A 1C1YB 1F9JA 3V3XA 2GBNA 3ZQ4A 4P7IA 2KMAA 2N9XA 1E7VA 2HE7A 3DHIC 4KGTA 1PFDA 2NBUA 4KZCA 1RM6C 4L2YA 3EUB2 1IP9A 4A55A 1FCCC 2LJ5A 3AXCA 1XCQL 2KHWB 2W3RA 3KYDD 4LNNA 1NENB 2WXJA 3Q8BA 3FKYA 1YQ3B 1LQBA 4JWSC 1ZP0B 3U30A 2XK5A 2JUOA 2CJOA 2RDBC 3URYA 4RM9A 4DXFA 1V1OA 2KTFA 1WZ3A 4TQ1A 2KDEB 2JF5A 2WGSA 1V80A 4US9A 2X8XX 4G3XB 2RGFA 2IY1B 1AW7A 1JRUA 2LUEA 2KACA 3WAMA 3SFEB 2IO3B 3UF8A 4WURA 1WE6A 3UQBA 4ZRJA 1UNSA 3WANA 1YJJA 4XDDA 1ISNA 2J0KA 1KM7A 2RDHA 2R2QA 3R66C 1E9MA 1R4MI 2HD5B 2NTSA 1I42A 5CTRC 3V60A 2IO0B 2FNJB 4NZLB 4HKQA 1JWUD 4WWMA 2JSVX 4JGHB 4I6LB 2N7JA 3UIPB 4HKZE 2M1MA 4MJSB 4ANXA 3KYCD 3DVGY 2L52A 4M01A 3AECB 5BMIA 4KIKA 4MSQB 1D3ZA 1ZDXA 3QX1A 3FILA 1D5XC 3GOEA 4MM3B 4W9CA 3Q8FA 1OQRA 2DYMA 2INNE 4TSSA 3ZXRA 4FN2A 2PEAA 4ZRPA 4ANWA 2NBWB 3WCQA 3WA0A 3LYYA 3SHQA 1KJTA 1UH6A 4DBGA 2GOWA 1YD8U 1WXVA 1V86A 3RZFA 4I6NB 3T3NA 2JWZA 1J0GA 4WWNA 2D10A 3FC4A 1YX5B 1N5XA 2C7MB 1WE7A 1SGHA 1E10A 2XK5B 1K53A 4JIOU 3L16A 1PGAA 2BYEA 3QHTA 1Q1OA 1HQRD 1FEHA 4EFOA 1TBEA 1RYJA 4BKSA 5BYSA 4MH8A 4JWUC 2K39A 4A20A 3HHMA 2V1YA 1RAXA 1RLFA 4G11A 3HM6X 2MP2A 1UELA 2B76B 2CKHB 4FXCA 4W9HA 4GLSC 4M00A 3APCA 4BFRA 1FMAD 2V9HA 1YOVB 4C7YA 2EMTA 1KLVA 4LK0M 4NJ7A 3Q3NC 4BZAA 2MJDA 4BKGA 3MC0B 5EE0A 4LTUA 4PK1A 3ZO5B 3L17A 3NVYA 5DCNA 3AEDB 3VVWB 2JY6A 3I9V1 2WXOA 2IYDB 3BVGA 1C4AA 2ASQA 2JZZA 5G5GA 5CHWA 4E74A 2G3QB 4KIKB 4BBNC 1FFUA 3AE7B 2G1EA 1PUTA 1QKZA 2NTTA 3FILB 1I4XA 1KRHA 4FULA 1WXMA 2KFKA 2KQ4X 4B0EA 2H88B 2K5PA 1GC7A 2JYEA 3MJ5A 2KX0A 4BOSC 4G50A 4KGRA 3V6EB 1EWYC 1Z2MA 3RMKC 4BVUC 2MSED 3M62B 5EE1A 4K3CA 2MBBB 2V3PA 3DVGX 3Q3JA 4QAYA 1WR6E 2MBEA 3W5UB 4M0WA 1G6JA 2K0PA 4DXGA 4URKA 1UBIA 4ARIA 2D3BA 3FAHA 2J53A 1VJKA 3P4PB 4AOFA 1WWTA 3Q14C 4DHJB 1GB1A 2R2OA 2LHEA 2GI9A 2MX2A 1TIFA 2BS2B 3I63C 1WGKA 3DWMA 2INDC 1TS5A 1SSNA 2MJEA 1FXIA 3LB8C 3A4SC 2JZ3B 4P16A 2JXTA 1OQQA 1WM2A 1FXAA 4FHJA 1YQ4B 1YN5A 2WXFA 3AN1A 2MEKA 4HROA 3BZDB 1WX8A 5G55A 2MP2B 2O2VA 5TSSA 3ZNZB 2BS4B 2KTRB 2IO2B 1TS3A 2W82A 3TUOA 1VZ8A 3ABVB 1EWCA 4AQ7A 1CMXB 2HJ1A 1F1HA 1WH3A 1C4CA 2RR9A 2WX0A 3DHHC 3VDZA 1BT0A 1R7SA 4M8MA 4MGKE 4ACFA 4NAWB 4AP4C 3V6CB 3RT3B 4IW0A 4IKGA 3NVZA 1AWDA 2ACZB 1T0QC 1WGRA 3APFA 3N1ZC 4DXAB 1FO4A 3ZNHB 3VTUA 3ML8A 3NHEB 1SE3A 2D3GA 2N9LA 1C9FA 3ZJTA 2O6VD 2OJRA 4L23A 4REZA 1WJ6A 4F8CB 3KH0A 3NVWA 4CHKA 2BYFA 2MCNB 4B9KA 2AL3A 3VH4B 2KDBA 3H7SA 2I1KA 3VUXA 3AE6B 4C80A 3RNCC 2GMIC 2L83A 2KFKB 5G2NA 2N9EB 5D94A 2UWQA 5E6JA 4PYZA 1EO6A 5L83A 3GZNB 4YTMB 1CK1A 3V05A 2DNFA 2JT4B 1NBFC 3JVZX 1BMLC 1S3SG 1XT9B 4RFBA 2AX5A 4J6IA 4M0WB 4YL8A 5LXHA 2WXIA 2BPSA 4IWOA 2MW5A 2K8BA 1NI2A 2LD9A 1Y56A 1WYGA 1WYWB 5CHVC 5C23A 1FXTB 3AM9A 3H7PA 1V1PA 3UQAA 1WJNA 3UGBB 2CU1A 4KV2A 1HEZE 3PHWB 1D5MC 2QSDA 3VQIA 4A90A 1R4NI 5FR6A 4WWPA 4XDCA 4YTNB 5BYRA 1PDXA 2BYTA 3QA8A 2K8CA 2RD0A 2YEPF 2L8JA 3ECIA 1Q0WB 2G4DB 2DZKA 3SU8X 5C2TB 2RDGA 1KH0A 4WIPA 3CMMB 2O2VB 4L1BA 3P42A 3WALA 3ZTCA 1HA5A 1J19A 3NG0A 2WWZA 2MQJA 3MP9A 1KOTA 1PQSA 1C4PA 3KUDB 2KYWA 5D3IB 4KSKC 4TKNA 1OGWA 4M8NA 2BT6A 5KHOA 4NNJB 2LGSA 3PLVA 3APDA 2V4IB 1XLQA 3ZRFA 3QAQA 1YQBA 2LEKA 4ANUA 3TEWA 2C7HA 1SB3C 4EKUA 2AQ2B 3JSVA 4A6QA 4NPNA 3ZNID 4IM2A 3TEZA 1WM3A 3VXWA 3CSTA 3IG3A 2JYTA 4GDLA 1J7CA 5EDSA 3GB1A 3RI7C 1C77A 2FCMA 3AEAB 1KLGD 4F7ZA 3IT6B 5AEKB 3IAM1 1P7FA 5H8YE 1WMHA 1V5TA 1MHHE 1TKYA 4EZKA 3Q3OC 1KF6B 5D2MB 1ESFA 1E8YA 4X57B 2SEBD 1MVKA 2L0FA 1ZUD2 1V5OA 3IXSA 2Y5PA 3E56A 1E0ZA 3P2BA 1T3QA 2MLBA 3JYUA 4RGOS 4WJQA 3ZGZA 5IA7A 2MH7A 2A5UA 3PRPB 3EHVA 4TV3A 3N3KB 3AULA 3HIZA 4DHZB 1RFAA 2BTEA 4AUQC 2AYOB 4S17A 2GRIA 1HTQA 1QT9A 3ZYYX 2DAFA 4OVZA 1V1PB 3AU5A 2XN9C 2WXKA 2ZW0A 2FIFA 1C76A 3RYTA 3WAOA 1ET6A 3A4RA 3RUIB 1I4RA 3N32A 1V9JA 2MBQA 3N20C 2PVGC 2GBMA 2JX5A 2MJ3A 1V97A 3QJZA 4XX5A 2LJIA 2LMCA 3VR8B 1WJUA 1BUIC 2NR2A 1F0ZA 4K7WA 3DBRI 2PTLA 4W9LA 3AEGB 2LGXA 5EE3A 2K25A 2PKOA 3AI5A 2DX5B 2AQ3B 3A1QA 1NVID 4FA6A 1WGDA 2DWQA 2WU2B 3DOWA 1WGHA 4HPLB 1OEYJ 2BWES 1WI0A 4XE0A 2E6XA 4YSXB 5E6NA 2C7NB 2WXRA 2IY0B 2M0AA 2KDMA 2EKEC 5TR5A 4LJOB 5FKAC 3JSVB 2PVOD 2UYZB 1UZXB 1UBQA 2SAKA 2DYBA 1AN8A 2L32A 4B95A 2BB6A 1MJDA 2D3CA 2JWUA 4M02A 3TEYA 1YNTE 1E8XA 2LXCA 4RGTA 4II3B 1WZ0A 2KD0A 5EE9A 1ENFA 2J52A 2N4FA 4W9IA 3Q2AC 3DPDA 2L7RA 1T0RC 3I57A 1JMLA 1QLBB 1KLUD 1TZOA 4ZOHC 3SDLC 1WMHB 1YJ1A 3PVLA 3ZLZA 1TTNA 5IKCM 2K1FA 4WH4A 5JZEB 1J7AA 4KVGB 1PGBA 1D5ZC 4DHJD 1I7HA 2K9XA 1C78A 1P98A 4W9JA 3QQ8B 3QK0A 3OG5A 2KO3A 1WF9A 4HXDA 4NQKE 4BKSD 2N0SB 5DPRA 3MC8A 4FLHA 5C3JB 2J7QB 3VRAB 2QIEB 3RZWC 2EELA 3EFUA 1WRDB 3SEBA 1EF5A 4TUUA 4KGSA 1VR9A 1EF1A 5LNK1 3Q3FA 1I4PA 3IHPC 1N60A 2JRHA 1ZE3D 4ZRQA 1A5RA 4US8A 5CX3A 1UWXA 2OJWA 1FRDA 1CJEA 1H4RA 1NEKB 2L1AA 3ZTDA 3CF6E 3TBLD 2LUMA 3L13A 1GAQB 2IPKD 3B0AA 4HVBA 2BW2A 4OVVA 3A1QB 2KWVB 3Q8CA 3BIID 2ZW1A 4BKTA 4LNFA 3M95A 5L95C 4AS1A 1ZXHA 3Q3MC 4BOZB 2RSUA 2KN5A 1WSPA 1NYQA 2LGIA 2LZ6A 3BYTB 4FJVB 2V3SA 3ZXVA 3ZKJC 3HK0A 3MC9A 1WY8A 2FUHB 2IGGA 2OOBB 3WAPA 2NMQA 1QOBA 2LGYA 2L00B 3IAS1 1C3TA 4GSWA 4KZ0A 1M4VA 5JHAA 4DHZE 1L6UA 3QWZB 2IBIB 5FK9C 3S2AA 4O1NA 4GIVA 5AZGA 1QOFA 4MEMA 1FRRA 4G0NB 3KUZA 1GPXA 4HDOA 4NAMA 1GNUA 3NZUA 2WHIA 3C19A 3PV1A 3DBHB 4GOCA 2ZVNA 2ZJDA 4NQLB 1J8CA 3A9KA 2H89B 3NVVA 2IZVB 4OW0A 1EM7A 5DPTA 5AUKA 2BF8B 4GDKA 1NDDA 1T6BX 2WXLA 3ZIMA 2RPQA 2KK8A 3HVDA 1V49A 3AE8B 4HK2A 3LJ3A 2QMTA 1F2RI 2J0MA 4MGYE 4HJKA 2BQQA 3NS8A 4PT5A 1MFWA 4MH0E 1QOAA 3ZUNA 1N62A 5AUIA 3R8BA 2MA9B 3PZDA 3VAWA 1P1AA 2KXJA 2W54A 4USAA 2BBCA 3D32A 4RF1A 5HHDG 3RNAC 1KFYB 1YMHE 2FCQA 5JHBA 2LGDA 3OAWA 3VUYA 5DPWA 4WWOA 1ZW7A 3BYYB 4F1SA 2AL6A 4XC2A 1VZ7A 2D3AA 4EE2A 2NPTA 4ARCA 1E6EB 2Y5CA 2HJ8A 3RNBC 1IYFA 3H8HA 2W9NA 5I4DA 2QILA 4JE3B 2WXPA 4XWWA 3PREA 1WX9A 1FPYA 3ALBA 2RMMA 2KKCA 4A3OA 2BWFA 3Q8EA 4XGAB 4HDQA 2I1JA 4JX1C 1SEBD 1T0SC 4CO7A 1FNWA 2GBRA 1L0XB 4RF0A 5J17A 4HRSA 4ZRKA 2MHJA 5AZHA 4ANVA 4HLEA 2LASA 1GC6A 1P3QU 3VUWA 4K7UA 2R61A 3IT4B 2PE6B 3HUIA 2JVCA 3L4PA 3Q6BA 4YT0B 4EOYA 3HM3A 4II2B 1L0VB 4OZBA 4B0MA 3AB5A 2GBKA 2L0TA 1IGCA 3W9CB 4P1BC 1BXTA 2DZJA 1QF6A 4OZCA 1UUPA 1D6EC 1ZGUB 5BO4B 2K6DB 3V62A 4NJ6A 1K8RB 2KX3A 1NYRA 2INPE 3A9KB 3UINB 1V2YA 1N6ZA 2JRIB 3ML9A 4GDKB 1VRAB 2PMVA 1SIFA 4DWFA 1QOGA 2LRUA 1JALA 1EU4A 3ZDTA 2KJ6A 3I5JC 1L2NA 3R3MA 3VR9B 4PS3A 4RGNA 2ZNVB 4PS7A 1YIWA 2ON8A 4D2KA 3T3OA 5E6PA 1IGDA 3BVZA 3DBLI 3N1YC 3H1UA 3U7ZA 1FFVA 2L05A 1WX7A 5LXIB 2FUG1 3PLUA 4BAXA 1YJIA 1VLBA 3NS1A 1FCLA 3AMZA 4LJPB 3U7DA 2LXAA 3W1YA 2KC1A 1N61A 1XO3A 1RFKA 3RCZA 3AE9B 2NPTB 2LI5A 2ZNVC 4NY0A 1RRBA 2CS4A 1X1MA 4WAFA 5H92C 2DAJA 4IUMB 2KMMA 3BINA 3TCAA 4ZYSA 5IP4D 2BKRB 3VTVA 1FM0D 1D4BA 2D07B 3AH7A 3IFWB 1ET9A 3EECA 1K51A 4ZRIA 4YSZB 2KC2A 1A70A 5JH5C 4C4VA 2EMSA 3AV8A 2L76A 1UWMA 2N9PC 3ZJVA 2E3TA 4JPSA 1TJEA 2QCZA 2REXA 3PO0A 4WJPA 2M8SA 5BMHA 5J2RA 1UD7A 1IBXA 3L54A 2M0XA 3P1MA 4KDIC 4LDTD 2W3SA 4AJWA 3QCAA 1JW9D 4GGQA 3VHTC 4IM3A 1ZOYB 1E8WA 1K50A 3ZJUA 4ZDVA 3VTWA 5C1ZA 2MBOA 3EA6A 3KUCB 3P4QB 1DYQA 4MSMB 1CZPA 1P7EA 2K3UA 3BK2A 2XNAC 2CHWA 1WXQA 2M17A 1LM8B 5E6OA 2OHFA 3CWIA 4UDUC 1U4AA 2Y3AA 4N59A 4OZAA 1AYFA 4DDGD 2L3ZA 1FD6A 1XLPA 4K7SA 3DDCB 1QZEA 4C56C 2LHDA 3CSFA 3NJTA 3C0RB 3E9SA 3QC8B 3DWGC 3H9DA 4PS8A 2A4ZA 1E5WA 3N1XC 5DPSA 2ZEQA 1WR1A 1WIAA 5IN7A 1SBBB 1R4NB 4FJZA 2PIAA 3L10B 5IO9A 4RH6A 1P9DU 3B1LX 2QJLA 4KSLC 1OEYA 1SE9A 3TJPA 2WXMA 3GE8C 4ICUA 1YN4A 1WGGA 3R7QA 1TKGA 3B2GA 2DBYA 3O13A 2DZMA 3H7PB 4IWQA 1T5XD 1L7YA 1HE8A 4WAAA 2TSSA 4AWJA 3ETRA 4LNOA 3NY5A 3R7RA 5JXVA 1MG8A 1IUEA 2WXHA 4C7ZA 4YXDB 5IOIA 3NUHB 4ITKA 2FCNA 4FJYA 1EUVB 3ZNGC 2WNMA 2VH1A 1DOYA 2NCNA 4JL9A 1F52A 2LVQA 2PPHA 1VZ6A 4CQNA 4C4VB 4HPPA 3AEBB 5IAAC 2ZCBA 3ZVVA 1ZXIA 4TQ0A 1E90A 1OQYA 1TY2A 4HWIB 4RCOA 3OJ3A 3V61A 2KLCA 1SE2A 2KFJA 4MDKE 4GU2A 1IBXB 3PPAA 5HKHA 2LVOA 2N1VA 4J3OD 3N30A 2IJ0A 2Z8LA 4ZHOA 2WQYB 2PJHA 2KJHB 2WXNA 3U8ZA 5HI1A 2KVRA 3HRDD 1JWSD 2OEDA 2PE9A 3RNEC 2KVZA 4HCPB 4RGMA 1FNUA 3DHGC 2KOXA 3Q69A 2Z0EB 4LNIA 4EEWA 4GDLB 2C60A 1TYGB 1XLNA 2N9KA 4W9KA 2WP9B 1JCKB 3RPFC 3AE3B 1GUAB 4OHJA 1MG4A 1YN3A 3DCGA 4HPMB 2M19A 1L0YB 3KW5B 4GMVA 1JROA 1I4GA 1I35A 4YSYB 1I4QA 4LDTB 4GB9A 1J7BA 2KWCA 1L5PA 3RD2A 2N1WA 5G5HA 3L08A 1JWAD 5HFYA 2KANA 4W9GA 3LXFA 1JWMD 2VRRB 3JW0X 3EC8A 5AZFA 5FR3A 1QILA 4P6VF 1JQ4A 1XF5L 4DQOC 2KN4A 2WDVB 2GB1A 3DBRB 3ONSA 5BMGA 2FIDA 3MTNB 4WQOB 2KNBA 2KZRA 3DBHI 3C8YA 1PGXA 2V3NA 3PGEA 5CHFA 3PHXB 2WU5B 3H6NA 3TEXA 1T0YA 3W5VB 4IWPA 3RNGC 2QDFA 4RM8A 2YEPB
chains in the Genus database with same CATH topology
3M63B 5FR6A 2NBUA 4KZCA 4WWPA 4IC7B 2KJRA 2W9NA 2LWPA 3QA8A 2WX1A 2K8CA 2RD0A 4OVUA 2L8JA 1IP9A 2LJ5A 1Q0WB 2G4DB 3ECIA 2DZKA 3PREA 3SU8X 1WX9A 3O65B 3AXCA 3ALBA 2G45B 2KHWB 2KKCA 2YVCA 3KYDD 4A3OA 3CMMB 2BWFA 2AWTA 2I1JA 4HDQA 2O2VB 3AU4A 4CO7A 3WALA 3ZTCA 2GBRA 1LQBA 1J19A 2WWZA 2MQJA 3U30A 5J17A 1PQSA 4ZRKA 1KOTA 2XK5A 3KUDB 5AZHA 1Q5WB 4ANVA 1E8ZA 4HLEA 1S1QB 3WIMA 2JUOA 2LASA 4KSKC 4TKNA 1GC6A 1OGWA 4RM9A 1P3QU 1V6EA 4M8NA 2KTFA 3VUWA 1WZ3A 4K7UA 3I3TB 2KDEB 2JF5A 4TQ1A 5KHOA 3VFKA 1V80A 2FAZA 4NNJB 3PLVA 4G3XB 2PE6B 3W1SA 2RGFA 1VCBA 2DHZA 2IY1B 3APDA 2JVCA 1JRUA 3ZRFA 4EOYA 3HM3A 2LUEA 3QAQA 4II2B 1YQBA 4W9FA 4ANUA 2C7HA 4EKUA 2GBKA 2L0TA 2KTRA 2DZJA 3WAMA 3JSVA 1ZGUB 2IO3B 3UF8A 4I6PA 5BO4B 2K6DB 3V62A 4NJ6A 1K8RB 3UQBA 1WE6A 2KX3A 4NPNA 4ZRJA 3A9KB 3UINB 1V2YA 4IM2A 3ZNID 1WM3A 1TZ1A 2JRIB 3ML9A 4GDKB 3VXWA 3WANA 1WXAA 3CSTA 1ISNA 3IG3A 2C5LC 3A33B 2J0KA 1KM7A 4NAWA 4GDLA 2R2QA 3R66C 1SIFA 5EDSA 2FCMA 1R4MI 4DWFA 2HD5B 4A3PA 2LRUA 1I42A 5CTRC 3V60A 2IO0B 3ZDTA 4F7ZA 2KJ6A 2FNJB 1L2NA 3R3MA 4PS3A 5AEKB 2C9WB 2QHOA 1WMHA 2JPHA 1V5TA 2ZNVB 4PS7A 2MBHA 4EZKA 4JGHB 1YIWA 4I6LB 3UIPB 5E6PA 2M1MA 1E8YA 5D2MB 4MJSB 3DBLI 4X57B 2L0FA 3SD5A 1V5OA 3H1UA 4ANXA 3KYCD 3DVGY 4W9EA 2L05A 1WX7A 5LXIB 3PLUA 3P2BA 2MLBA 3JYUA 4WJQA 4KIKA 5IA7A 4FHKA 2A5UA 4IM0A 4MSQB 3PRPB 3EHVA 1D3ZA 4TV3A 3N3KB 3AULA 3NOBA 4ZYNA 4LJPB 3QX1A 3DQVA 3HIZA 4DHZB 1RFAA 3QARA 1WXSA 3U7DA 4K1RB 2ZPNA 2LXAA 2G4SA 4AUQC 3GOEA 4W9CA 2ZCCA 3W1YA 3A9JA 2AYOB 2KC1A 4MELA 2DYMA 3IVFA 3RCZA 2CHZA 1UGMA 3IBEA 2DAFA 2PEAA 4FN2A 3AU5A 2NPTB 2V4LA 2LI5A 2FIFA 2ZNVC 4NY0A 1RRBA 4ANWA 4FBJB 2NBWB 3RYTA 3WAOA 3WA0A 3A4RA 2CS4A 2KMCA 1X1MA 1XD3B 2DAJA 3RUIB 4IUMB 4LCDE 3SHQA 3X0WA 3BINA 3TCAA 3N32A 4W9DA 1V9JA 2MBQA 1KJTA 2GBMA 1UH6A 2KQSA 4FADA 2K8HA 4DBGA 2BKRB 1YD8U 2GOWA 1WXVA 3VTVA 1V86A 2D07B 3RZFA 3QJZA 4XX5A 3GZNI 4N9F4 3IFWB 4I6NB 2JWZA 1J0GA 4WWNA 1LFDA 2D10A 2K6QA 3EECA 1YX5B 4ZRIA 2C7MB 1WJUA 2KC2A 5JH5C 2J0JA 2EMSA 2NR2A 1WE7A 3PT2B 4K7WA 1SGHA 3DBRI 2L76A 2XK5B 2N9PC 3PRMB 4W9LA 2LGXA 4JIOU 2K25A 3L16A 2BYEA 3QHTA 2REXA 1Q1OA 2ZZPB 3AI5A 3PTFC 4HCNB 1XQQA 4WJPA 2M8SA 2DX5B 4EFOA 4DK5A 3A1QA 1TBEA 1Y8RC 4FA6A 5J2RA 1WGDA 4BKSA 1UD7A 3DOWA 1WGHA 4HPLB 2K39A 4A20A 1OEYJ 3L54A 2M0XA 2BWES 3HHMA 1WI0A 4KDIC 2V1YA 4LDTD 4AJWA 1RAXA 5E6NA 1RLFA 2C7NB 4G11A 3QCAA 2N7EA 2IY0B 3HM6X 5LLIA 2EKEC 2MP2A 1UELA 2CKHB 4W9HA 4DDID 4EUTA 4GGQA 4LJOB 5TR5A 3VHTC 3JSVB 2ZVOA 3ZW3A 4IM3A 3APCA 2UYZB 2XBBC 1E8WA 1UZXB 1UBQA 4BFRA 4ZDVA 2DYBA 1Z5SB 3VTWA 2BYVE 5C1ZA 4B95A 2MBOA 1V81A 3KUCB 4RMAA 3X23A 2MRPA 1M94A 4MSMB 2EMTA 1LXDA 1KLVA 1E8XA 2LXCA 4CYEA 4II3B 3T9LA 1WZ0A 2KD0A 4NJ7A 2HTHA 2N4FA 4W9IA 4MGIE 2CHWA 2M17A 3W1SC 3DPDA 1LM8B 5E6OA 4BKGA 2L7RA 2YLMA 2Z59B 3MJWA 1U4AA 3SDLC 1WMHB 4DDGD 1YJ1A 3ZO5B 3L17A 3PVLA 5DCNA 3ZLZA 1TTNA 2L3ZA 2K1FA 1P0RA 3VVWB 1YX6B 2JY6A 2BGFA 4K7SA 3DDCB 1QZEA 5JZEB 2IYDB 2ASQA 4KVGB 2JZZA 3CSFA 3C0RB 5CHWA 3QC8B 2G3QB 4GXBA 4KIKB 3H9DA 4PS8A 4E74A 2A4ZA 1E5WA 4DHJD 4BBNC 2KQ7A 5DPSA 2ZEQA 1WR1A 4K81A 1WIAA 3ZDMC 1P98A 1VD2A 3L10B 2BKFA 3OLMD 4FJZA 4KDLB 4W9JA 1P9DU 3QQ8B 3B1LX 3DVNU 3QK0A 4KSLC 1OEYA 3A9JB 1SE9A 3TJPA 2KO3A 4FULA 1WFYA 1WXMA 1OTRB 2KFKA 4ICUA 1WGGA 2NVUI 1WF9A 2XEWA 4HXDA 4NQKE 3R7QA 4WJOA 4BKSD 5DPRA 3PS6A 4EZLA 2DZMA 1GC7A 3H7PB 4IWQA 2KX0A 4FLHA 4G50A 3TIXA 4BOSC 2J7QB 2GBJA 1L7YA 5KHQA 3V6EB 1HE8A 4WAAA 1Z2MA 2DYOA 3RZWC 4BVUC 2MSED 1E7UA 2KDFB 1ZKHA 3EFUA 3M62B 1WRDB 4AWJA 1EF5A 4TUUA 4EZJA 3NY5A 2MBBB 3DVGX 1MG8A 3Q3JA 3R7RA 1EF1A 1WR6E 2MBEA 3Q3FA 2FCNA 4FJYA 1G6JA 1EUVB 3ZNGC 3IHPC 3M3JA 2JRHA 3L0WB 4URKA 1UBIA 3PSEB 2NCNA 4JL9A 1A5RA 4AOFA 2NS5A 5CX3A 2O6VA 2LVQA 4DHJB 3DVNV 3QIJA 2PPHA 1H4RA 2LRWA 2R2OA 2MX2A 2ZPYA 3ZTDA 3CF6E 1IPGA 2ZCBA 3L13A 5IAAC 3TBLD 3ZVVA 3BY4B 3B0AA 4ASWC 2WDTB 3K9OB 4TQ0A 4HVBA 1E90A 1OQYA 4OVVA 3A4SC 2JZ3B 3A1QB 4HWIB 2KWVB 3OJ3A 3V61A 5D7GA 1GG3A 2KLCA 2DENB 4PYUA 1WM2A 2KFJA 4GU2A 4FHJA 4MDKE 3ZRCA 4BKTA 3VH3B 3PPAA 3LDZE 5HKHA 3M95A 2LVOA 2N1VA 3N30A 4JLCA 5L95C 2FCSA 4BOZB 2RSUA 5GMVA 2KN5A 2PJHA 1WX8A 2CHXA 2KJHB 1WGYA 2MWSB 5G55A 2MP2B 2LZ6A 2O2VA 4FJVB 2V3SA 2KWUB 1TGZB 3U8ZA 3ZNZB 3OJ4B 3ZKJC 3HK0A 4E71A 2KTRB 2IO2B 2KVRA 3ENEA 1WY8A 2FUHB 2OOBB 4B6WA 3WAPA 3UIOB 2LGYA 2L00B 1C3TA 4IG7B 1AARA 3TMPB 4GSWA 4KZ0A 2PE9A 1H8CA 4HCPB 1CMXB 1WH3A 2KOXA 2RR9A 5JHAA 2WX0A 2Z0EB 3VDZA 4MGZE 2D11A 2N7DA 4DHZE 3QWZB 4EEWA 1BT0A 2IBIB 3S2AA 4M8MA 4MGKE 4GIVA 4NAWB 4GDLB 5AZGA 4AP4C 2C60A 3V6CB 4BBNF 4MEMA 4WJNA 4IW0A 3RT3B 4G0NB 4ICVA 4W9KA 3KUZA 2KLGA 4HDOA 1GNUA 3NZUA 1WGRA 3APFA 4DXAB 2LVPA 1GUAB 3PV1A 4JQWC 3ML8A 3VTUA 3NHEB 4GOCA 3DCGA 3ZNHB 2ZVNA 2ZJDA 4HPMB 4GN1A 2D3GA 3KW5B 4NQLB 4GMVA 3T8MA 1J8CA 3A9KA 1I35A 5DPTA 2IZVB 2O6VD 2OJRA 4LDTB 4GB9A 2BF8B 1WJ6A 4GDKA 4F8CB 1WJ4A 3KH0A 1NDDA 4CHKA 2BYFA 2KWCA 2WYQA 2M4NA 2MCNB 2D2QA 4B9KA 2AL3A 3VH4B 2KDBA 3RD2A 2N1WA 3ZIMA 2RPQA 3H7SA 2KK8A 4XZ4A 4E3CA 2I1KA 3L08A 2Y5BB 3VUXA 2Z0DB 1V49A 2GMIC 2DZIA 2KANA 2KFKB 4W9GA 5D6JB 2NBVB 5G2NA 2N9EB 4HK2A 5D94A 2UWQA 3LJ3A 2VRRB 3JW0X 3EC8A 4PYZA 5AZFA 1EO6A 2AEHA 2J0MA 4MGYE 4HJKA 5L83A 3NS8A 1GJZA 3TL5A 4MH0E 3ZUNA 4MJSA 2MA9B 3PZDA 3VAWA 1P1AA 2KXJA 2B3AA 2JT4B 1NBFC 3JVZX 2KDIA 3D32A 1S3SG 1XT9B 3ONSA 4AJYB 4J6IA 2FIDA 4M0WB 4YL8A 2FCQA 3MTNB 5JHBA 4WQOB 5LXHA 3PRZA 2LGDA 3RULA 3OAWA 2CR5A 2KNBA 2KZRA 3DBHI 2IO1B 2BPSA 3NZSA 4IWOA 2MW5A 3VUYA 3MHSD 3DBSA 2K8BA 1NI2A 2LD9A 4WWOA 5DPWA 1ZW7A 3K9PB 4F1SA 4MM3A 1WYWB 2AL6A 2O6VB 3KVFB 3PGEA 5J18A 2JXXA 5CHVC 5CHFA 5C23A 3PHXB 1FXTB 4XC2A 3B08A 1C1YB 1F9JA 2GBNA 3H7PA 2NPTA 3H6NA 1T0YA 3UQAA 1WJNA 3UGBB 2CU1A 4P7IA 4IWPA 4KV2A 2KMAA 2N9XA 1E7VA 2HE7A 3PHWB 4RM8A 3VQIA 1IYFA 2HJ8A 1R4NI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M63 B;  5FR6 A;  2NBU A;  4KZC A;  4WWP A;  4IC7 B;  2KJR A;  2W9N A;  2LWP A;  3QA8 A;  2WX1 A;  2K8C A;  2RD0 A;  4OVU A;  2L8J A;  1IP9 A;  2LJ5 A;  1Q0W B;  2G4D B;  3ECI A;  2DZK A;  3PRE A;  3SU8 X;  1WX9 A;  3O65 B;  3AXC A;  3ALB A;  2G45 B;  2KHW B;  2KKC A;  2YVC A;  3KYD D;  4A3O A;  3CMM B;  2BWF A;  2AWT A;  2I1J A;  4HDQ A;  2O2V B;  3AU4 A;  4CO7 A;  3WAL A;  3ZTC A;  2GBR A;  1LQB A;  1J19 A;  2WWZ A;  2MQJ A;  3U30 A;  5J17 A;  1PQS A;  4ZRK A;  1KOT A;  2XK5 A;  3KUD B;  5AZH A;  1Q5W B;  4ANV A;  1E8Z A;  4HLE A;  1S1Q B;  3WIM A;  2JUO A;  2LAS A;  4KSK C;  4TKN A;  1GC6 A;  1OGW A;  4RM9 A;  1P3Q U;  1V6E A;  4M8N A;  2KTF A;  3VUW A;  1WZ3 A;  4K7U A;  3I3T B;  2KDE B;  2JF5 A;  4TQ1 A;  5KHO A;  3VFK A;  1V80 A;  2FAZ A;  4NNJ B;  3PLV A;  4G3X B;  2PE6 B;  3W1S A;  2RGF A;  1VCB A;  2DHZ A;  2IY1 B;  3APD A;  2JVC A;  1JRU A;  3ZRF A;  4EOY A;  3HM3 A;  2LUE A;  3QAQ A;  4II2 B;  1YQB A;  4W9F A;  4ANU A;  2C7H A;  4EKU A;  2GBK A;  2L0T A;  2KTR A;  2DZJ A;  3WAM A;  3JSV A;  1ZGU B;  2IO3 B;  3UF8 A;  4I6P A;  5BO4 B;  2K6D B;  3V62 A;  4NJ6 A;  1K8R B;  3UQB A;  1WE6 A;  2KX3 A;  4NPN A;  4ZRJ A;  3A9K B;  3UIN B;  1V2Y A;  4IM2 A;  3ZNI D;  1WM3 A;  1TZ1 A;  2JRI B;  3ML9 A;  4GDK B;  3VXW A;  3WAN A;  1WXA A;  3CST A;  1ISN A;  3IG3 A;  2C5L C;  3A33 B;  2J0K A;  1KM7 A;  4NAW A;  4GDL A;  2R2Q A;  3R66 C;  1SIF A;  5EDS A;  2FCM A;  1R4M I;  4DWF A;  2HD5 B;  4A3P A;  2LRU A;  1I42 A;  5CTR C;  3V60 A;  2IO0 B;  3ZDT A;  4F7Z A;  2KJ6 A;  2FNJ B;  1L2N A;  3R3M A;  4PS3 A;  5AEK B;  2C9W B;  2QHO A;  1WMH A;  2JPH A;  1V5T A;  2ZNV B;  4PS7 A;  2MBH A;  4EZK A;  4JGH B;  1YIW A;  4I6L B;  3UIP B;  5E6P A;  2M1M A;  1E8Y A;  5D2M B;  4MJS B;  3DBL I;  4X57 B;  2L0F A;  3SD5 A;  1V5O A;  3H1U A;  4ANX A;  3KYC D;  3DVG Y;  4W9E A;  2L05 A;  1WX7 A;  5LXI B;  3PLU A;  3P2B A;  2MLB A;  3JYU A;  4WJQ A;  4KIK A;  5IA7 A;  4FHK A;  2A5U A;  4IM0 A;  4MSQ B;  3PRP B;  3EHV A;  1D3Z A;  4TV3 A;  3N3K B;  3AUL A;  3NOB A;  4ZYN A;  4LJP B;  3QX1 A;  3DQV A;  3HIZ A;  4DHZ B;  1RFA A;  3QAR A;  1WXS A;  3U7D A;  4K1R B;  2ZPN A;  2LXA A;  2G4S A;  4AUQ C;  3GOE A;  4W9C A;  2ZCC A;  3W1Y A;  3A9J A;  2AYO B;  2KC1 A;  4MEL A;  2DYM A;  3IVF A;  3RCZ A;  2CHZ A;  1UGM A;  3IBE A;  2DAF A;  2PEA A;  4FN2 A;  3AU5 A;  2NPT B;  2V4L A;  2LI5 A;  2FIF A;  2ZNV C;  4NY0 A;  1RRB A;  4ANW A;  4FBJ B;  2NBW B;  3RYT A;  3WAO A;  3WA0 A;  3A4R A;  2CS4 A;  2KMC A;  1X1M A;  1XD3 B;  2DAJ A;  3RUI B;  4IUM B;  4LCD E;  3SHQ A;  3X0W A;  3BIN A;  3TCA A;  3N32 A;  4W9D A;  1V9J A;  2MBQ A;  1KJT A;  2GBM A;  1UH6 A;  2KQS A;  4FAD A;  2K8H A;  4DBG A;  2BKR B;  1YD8 U;  2GOW A;  1WXV A;  3VTV A;  1V86 A;  2D07 B;  3RZF A;  3QJZ A;  4XX5 A;  3GZN I;  4N9F 4;  3IFW B;  4I6N B;  2JWZ A;  1J0G A;  4WWN A;  1LFD A;  2D10 A;  2K6Q A;  3EEC A;  1YX5 B;  4ZRI A;  2C7M B;  1WJU A;  2KC2 A;  5JH5 C;  2J0J A;  2EMS A;  2NR2 A;  1WE7 A;  3PT2 B;  4K7W A;  1SGH A;  3DBR I;  2L76 A;  2XK5 B;  2N9P C;  3PRM B;  4W9L A;  2LGX A;  4JIO U;  2K25 A;  3L16 A;  2BYE A;  3QHT A;  2REX A;  1Q1O A;  2ZZP B;  3AI5 A;  3PTF C;  4HCN B;  1XQQ A;  4WJP A;  2M8S A;  2DX5 B;  4EFO A;  4DK5 A;  3A1Q A;  1TBE A;  1Y8R C;  4FA6 A;  5J2R A;  1WGD A;  4BKS A;  1UD7 A;  3DOW A;  1WGH A;  4HPL B;  2K39 A;  4A20 A;  1OEY J;  3L54 A;  2M0X A;  2BWE S;  3HHM A;  1WI0 A;  4KDI C;  2V1Y A;  4LDT D;  4AJW A;  1RAX A;  5E6N A;  1RLF A;  2C7N B;  4G11 A;  3QCA A;  2N7E A;  2IY0 B;  3HM6 X;  5LLI A;  2EKE C;  2MP2 A;  1UEL A;  2CKH B;  4W9H A;  4DDI D;  4EUT A;  4GGQ A;  4LJO B;  5TR5 A;  3VHT C;  3JSV B;  2ZVO A;  3ZW3 A;  4IM3 A;  3APC A;  2UYZ B;  2XBB C;  1E8W A;  1UZX B;  1UBQ A;  4BFR A;  4ZDV A;  2DYB A;  1Z5S B;  3VTW A;  2BYV E;  5C1Z A;  4B95 A;  2MBO A;  1V81 A;  3KUC B;  4RMA A;  3X23 A;  2MRP A;  1M94 A;  4MSM B;  2EMT A;  1LXD A;  1KLV A;  1E8X A;  2LXC A;  4CYE A;  4II3 B;  3T9L A;  1WZ0 A;  2KD0 A;  4NJ7 A;  2HTH A;  2N4F A;  4W9I A;  4MGI E;  2CHW A;  2M17 A;  3W1S C;  3DPD A;  1LM8 B;  5E6O A;  4BKG A;  2L7R A;  2YLM A;  2Z59 B;  3MJW A;  1U4A A;  3SDL C;  1WMH B;  4DDG D;  1YJ1 A;  3ZO5 B;  3L17 A;  3PVL A;  5DCN A;  3ZLZ A;  1TTN A;  2L3Z A;  2K1F A;  1P0R A;  3VVW B;  1YX6 B;  2JY6 A;  2BGF A;  4K7S A;  3DDC B;  1QZE A;  5JZE B;  2IYD B;  2ASQ A;  4KVG B;  2JZZ A;  3CSF A;  3C0R B;  5CHW A;  3QC8 B;  2G3Q B;  4GXB A;  4KIK B;  3H9D A;  4PS8 A;  4E74 A;  2A4Z A;  1E5W A;  4DHJ D;  4BBN C;  2KQ7 A;  5DPS A;  2ZEQ A;  1WR1 A;  4K81 A;  1WIA A;  3ZDM C;  1P98 A;  1VD2 A;  3L10 B;  2BKF A;  3OLM D;  4FJZ A;  4KDL B;  4W9J A;  1P9D U;  3QQ8 B;  3B1L X;  3DVN U;  3QK0 A;  4KSL C;  1OEY A;  3A9J B;  1SE9 A;  3TJP A;  2KO3 A;  4FUL A;  1WFY A;  1WXM A;  1OTR B;  2KFK A;  4ICU A;  1WGG A;  2NVU I;  1WF9 A;  2XEW A;  4HXD A;  4NQK E;  3R7Q A;  4WJO A;  4BKS D;  5DPR A;  3PS6 A;  4EZL A;  2DZM A;  1GC7 A;  3H7P B;  4IWQ A;  2KX0 A;  4FLH A;  4G50 A;  3TIX A;  4BOS C;  2J7Q B;  2GBJ A;  1L7Y A;  5KHQ A;  3V6E B;  1HE8 A;  4WAA A;  1Z2M A;  2DYO A;  3RZW C;  4BVU C;  2MSE D;  1E7U A;  2KDF B;  1ZKH A;  3EFU A;  3M62 B;  1WRD B;  4AWJ A;  1EF5 A;  4TUU A;  4EZJ A;  3NY5 A;  2MBB B;  3DVG X;  1MG8 A;  3Q3J A;  3R7R A;  1EF1 A;  1WR6 E;  2MBE A;  3Q3F A;  2FCN A;  4FJY A;  1G6J A;  1EUV B;  3ZNG C;  3IHP C;  3M3J A;  2JRH A;  3L0W B;  4URK A;  1UBI A;  3PSE B;  2NCN A;  4JL9 A;  1A5R A;  4AOF A;  2NS5 A;  5CX3 A;  2O6V A;  2LVQ A;  4DHJ B;  3DVN V;  3QIJ A;  2PPH A;  1H4R A;  2LRW A;  2R2O A;  2MX2 A;  2ZPY A;  3ZTD A;  3CF6 E;  1IPG A;  2ZCB A;  3L13 A;  5IAA C;  3TBL D;  3ZVV A;  3BY4 B;  3B0A A;  4ASW C;  2WDT B;  3K9O B;  4TQ0 A;  4HVB A;  1E90 A;  1OQY A;  4OVV A;  3A4S C;  2JZ3 B;  3A1Q B;  4HWI B;  2KWV B;  3OJ3 A;  3V61 A;  5D7G A;  1GG3 A;  2KLC A;  2DEN B;  4PYU A;  1WM2 A;  2KFJ A;  4GU2 A;  4FHJ A;  4MDK E;  3ZRC A;  4BKT A;  3VH3 B;  3PPA A;  3LDZ E;  5HKH A;  3M95 A;  2LVO A;  2N1V A;  3N30 A;  4JLC A;  5L95 C;  2FCS A;  4BOZ B;  2RSU A;  5GMV A;  2KN5 A;  2PJH A;  1WX8 A;  2CHX A;  2KJH B;  1WGY A;  2MWS B;  5G55 A;  2MP2 B;  2LZ6 A;  2O2V A;  4FJV B;  2V3S A;  2KWU B;  1TGZ B;  3U8Z A;  3ZNZ B;  3OJ4 B;  3ZKJ C;  3HK0 A;  4E71 A;  2KTR B;  2IO2 B;  2KVR A;  3ENE A;  1WY8 A;  2FUH B;  2OOB B;  4B6W A;  3WAP A;  3UIO B;  2LGY A;  2L00 B;  1C3T A;  4IG7 B;  1AAR A;  3TMP B;  4GSW A;  4KZ0 A;  2PE9 A;  1H8C A;  4HCP B;  1CMX B;  1WH3 A;  2KOX A;  2RR9 A;  5JHA A;  2WX0 A;  2Z0E B;  3VDZ A;  4MGZ E;  2D11 A;  2N7D A;  4DHZ E;  3QWZ B;  4EEW A;  1BT0 A;  2IBI B;  3S2A A;  4M8M A;  4MGK E;  4GIV A;  4NAW B;  4GDL B;  5AZG A;  4AP4 C;  2C60 A;  3V6C B;  4BBN F;  4MEM A;  4WJN A;  4IW0 A;  3RT3 B;  4G0N B;  4ICV A;  4W9K A;  3KUZ A;  2KLG A;  4HDO A;  1GNU A;  3NZU A;  1WGR A;  3APF A;  4DXA B;  2LVP A;  1GUA B;  3PV1 A;  4JQW C;  3ML8 A;  3VTU A;  3NHE B;  4GOC A;  3DCG A;  3ZNH B;  2ZVN A;  2ZJD A;  4HPM B;  4GN1 A;  2D3G A;  3KW5 B;  4NQL B;  4GMV A;  3T8M A;  1J8C A;  3A9K A;  1I35 A;  5DPT A;  2IZV B;  2O6V D;  2OJR A;  4LDT B;  4GB9 A;  2BF8 B;  1WJ6 A;  4GDK A;  4F8C B;  1WJ4 A;  3KH0 A;  1NDD A;  4CHK A;  2BYF A;  2KWC A;  2WYQ A;  2M4N A;  2MCN B;  2D2Q A;  4B9K A;  2AL3 A;  3VH4 B;  2KDB A;  3RD2 A;  2N1W A;  3ZIM A;  2RPQ A;  3H7S A;  2KK8 A;  4XZ4 A;  4E3C A;  2I1K A;  3L08 A;  2Y5B B;  3VUX A;  2Z0D B;  1V49 A;  2GMI C;  2DZI A;  2KAN A;  2KFK B;  4W9G A;  5D6J B;  2NBV B;  5G2N A;  2N9E B;  4HK2 A;  5D94 A;  2UWQ A;  3LJ3 A;  2VRR B;  3JW0 X;  3EC8 A;  4PYZ A;  5AZF A;  1EO6 A;  2AEH A;  2J0M A;  4MGY E;  4HJK A;  5L83 A;  3NS8 A;  1GJZ A;  3TL5 A;  4MH0 E;  3ZUN A;  4MJS A;  2MA9 B;  3PZD A;  3VAW A;  1P1A A;  2KXJ A;  2B3A A;  2JT4 B;  1NBF C;  3JVZ X;  2KDI A;  3D32 A;  1S3S G;  1XT9 B;  3ONS A;  4AJY B;  4J6I A;  2FID A;  4M0W B;  4YL8 A;  2FCQ A;  3MTN B;  5JHB A;  4WQO B;  5LXH A;  3PRZ A;  2LGD A;  3RUL A;  3OAW A;  2CR5 A;  2KNB A;  2KZR A;  3DBH I;  2IO1 B;  2BPS A;  3NZS A;  4IWO A;  2MW5 A;  3VUY A;  3MHS D;  3DBS A;  2K8B A;  1NI2 A;  2LD9 A;  4WWO A;  5DPW A;  1ZW7 A;  3K9P B;  4F1S A;  4MM3 A;  1WYW B;  2AL6 A;  2O6V B;  3KVF B;  3PGE A;  5J18 A;  2JXX A;  5CHV C;  5CHF A;  5C23 A;  3PHX B;  1FXT B;  4XC2 A;  3B08 A;  1C1Y B;  1F9J A;  2GBN A;  3H7P A;  2NPT A;  3H6N A;  1T0Y A;  3UQA A;  1WJN A;  3UGB B;  2CU1 A;  4P7I A;  4IWP A;  4KV2 A;  2KMA A;  2N9X A;  1E7V A;  2HE7 A;  3PHW B;  4RM8 A;  3VQI A;  1IYF A;  2HJ8 A;  1R4N I; 
#chains in the Genus database with same CATH topology
 3M63 B;  3B2F A;  4IC7 B;  2KJR A;  2LWP A;  1STE A;  4C00 A;  2WX1 A;  4OVU A;  3RNF C;  2K22 A;  2HDE A;  1XXG A;  3UI3 A;  2IDY A;  3O65 B;  2J42 A;  2G45 B;  3HVZ A;  2YVC A;  4TMA B;  2AWT A;  2BVC A;  4IOI E;  3AU4 A;  3W2D A;  4MT5 A;  1R4M B;  2VZK D;  1Q5W B;  1E8Z A;  1HTO A;  1S1Q B;  3WIM A;  3SR6 A;  1WRI A;  1V6E A;  3AE4 B;  3I3T B;  2RPV A;  3VFK A;  2I2Y A;  2FAZ A;  3W1S A;  1LO5 D;  1VCB A;  1XEE A;  2DHZ A;  4XWT A;  4W9F A;  2KTR A;  1SIJ A;  1HZ6 A;  4I6P A;  3BWU D;  1HZ5 A;  1ROE A;  1RWS A;  1HXY D;  2WS3 B;  1TZ1 A;  1L6V A;  1WXA A;  2D5G A;  2WLB A;  2C5L C;  2JQR B;  3A33 B;  4NAW A;  4A3P A;  1ACC A;  4N6E B;  1QQR A;  4KKI A;  1XCT L;  2C9W B;  2JZP A;  2QHO A;  2JPH A;  1DGJ A;  2MBH A;  2KWD A;  3R2T A;  2G9H D;  3SD5 A;  4W9E A;  3GE3 C;  4FHK A;  4IM0 A;  3NOB A;  4ZYN A;  3DQV A;  1MI0 A;  3QAR A;  1WXS A;  4K1R B;  2ZPN A;  2G4S A;  2DLB A;  2ZCC A;  3A9J A;  1GOZ A;  4MEL A;  3IVF A;  2CHZ A;  1UGM A;  3IBE A;  2V4L A;  2JU6 X;  1B1Z A;  2WDR B;  4FBJ B;  2WXQ A;  3MFG A;  2KMC A;  1XD3 B;  3AEE B;  1LGR A;  3KLS X;  5MPO A;  4LCD E;  3X0W A;  4W9D A;  2KQS A;  4FAD A;  2K8H A;  1JRP A;  3GZN I;  2INC C;  4N9F 4;  2I38 A;  1LFD A;  2K6Q A;  3PZ7 A;  4S0R A;  1NI3 A;  2J0J A;  2BS3 B;  3PT2 B;  1VDV A;  3PRM B;  2QC8 A;  4YTP B;  2ZZP B;  3PTF C;  4HCN B;  1XQQ A;  3AE2 B;  4DK5 A;  1Y8R C;  1L4D B;  3P4S B;  3EGR A;  2PW9 A;  4N58 A;  3VRB B;  2HTM E;  1MHX A;  1K52 A;  1OFF A;  2N7E A;  3RN9 C;  5LLI A;  4DDI D;  4EUT A;  3RFZ B;  2ZVO A;  3ZW3 A;  4KKJ A;  1Q10 A;  1N63 A;  2XBB C;  1Z5S B;  4IDI A;  2BYV E;  1B9R A;  1V81 A;  4RMA A;  2LFI A;  3X23 A;  2MRP A;  1M94 A;  3GP7 A;  1E7P B;  1LXD A;  4CYE A;  3Q8A A;  3T9L A;  3GS2 A;  2HTH A;  3KWL A;  4MGI E;  3W1S C;  3NZ3 A;  2FBW B;  2YLM A;  2Z59 B;  2VZK B;  3MJW A;  3AE1 B;  1SJH D;  3U52 E;  1SF0 A;  1TS4 A;  1XLO A;  1TY0 A;  1P0R A;  1YX6 B;  2BGF A;  1F2R C;  3U4E G;  4GXB A;  3BVM A;  2PLP A;  3KQ4 A;  2KQ7 A;  3KWV A;  4K3B A;  4K81 A;  2VH2 A;  4R3D A;  4RNA A;  1I4H A;  3ZDM C;  1VD2 A;  3OLM D;  2BKF A;  4KDL B;  1ZDV A;  3DVN U;  3A9J B;  2Q5W D;  1WFY A;  5HG2 A;  1OTR B;  2NVU I;  2XEW A;  4WJO A;  1TKE A;  3PS6 A;  4EZL A;  4P1C C;  4A8X C;  3TIX A;  2GBJ A;  5KHQ A;  2X38 A;  2CU3 A;  2DYO A;  1E7U A;  2KDF B;  4LLG M;  4LNK A;  1ZKH A;  4Q2J A;  3P4R B;  4EZJ A;  2EKI A;  1ZPS A;  1L4Z B;  1GB4 A;  3M3J A;  1FIQ A;  2WDQ B;  3L0W B;  4HEA 1;  3PSE B;  2M56 B;  2NS5 A;  2O6V A;  1V8C A;  3DVN V;  3QIJ A;  2LRW A;  2ZPY A;  1F77 A;  1IPG A;  1TT5 B;  1PYW D;  3BY4 B;  4ASW C;  2WDT B;  3K9O B;  1SJE D;  2IGD A;  5D7G A;  1GG3 A;  1TS2 A;  2DEN B;  4PYU A;  3ZRC A;  2J4X A;  1CQV A;  3VH3 B;  3LDZ E;  4MAC A;  1KTK A;  1SE4 A;  4JLC A;  2CJN A;  2FCS A;  5GXG B;  2AQ1 B;  5GMV A;  2CHX A;  1WGY A;  2MWS B;  4WQM A;  2WXG A;  2KWU B;  1TGZ B;  2UU7 A;  3OJ4 B;  4E71 A;  2W55 A;  3ENE A;  4B6W A;  5T8I A;  4YWG G;  3UIO B;  3SFD B;  4IG7 B;  1AAR A;  3TMP B;  2KAJ A;  1DOX A;  1SXT A;  1H8C A;  3PZ8 A;  1DOI A;  3DBL B;  4MGZ E;  2D11 A;  2ICI A;  2N7D A;  4BBN F;  4WJN A;  4ICV A;  2KLG A;  2QEJ C;  5BYQ A;  1N5W A;  3N9Y C;  3EFC A;  2LVP A;  4JQW C;  3R2I A;  3OWE B;  3AEF B;  4GN1 A;  1UGJ A;  3T8M A;  3TSS A;  2V0G A;  5D3D A;  4KX6 B;  3MHZ A;  1EU3 A;  1WJ4 A;  2WYQ A;  2M4N A;  2D2Q A;  1JWB D;  1C79 A;  4XZ4 A;  4E3C A;  2Y5B B;  2Z0D B;  2IGH A;  2DZI A;  4HJG E;  5D6J B;  2NBV B;  1MPE A;  3NRZ A;  2AEH A;  4XYC A;  2BB5 A;  3P63 A;  1GJZ A;  4A9A A;  3TL5 A;  2ONQ A;  1UF0 A;  4MJS A;  4ZHP A;  2B3A A;  2GLS A;  2KDI A;  3U2S C;  1FNV A;  3B9J A;  3J9C A;  4AJY B;  3AE5 B;  3PRZ A;  3RUL A;  2CR5 A;  3CIR B;  2FE8 A;  2IO1 B;  4NJC A;  2KT7 A;  3NZS A;  3MHS D;  3DBS A;  3K9P B;  4MM3 A;  5J18 A;  2O6V B;  3KVF B;  4H2A A;  2JXX A;  3B08 A;  3BK1 A;  1C1Y B;  1F9J A;  3V3X A;  2GBN A;  3ZQ4 A;  4P7I A;  2KMA A;  2N9X A;  1E7V A;  2HE7 A;  3DHI C;  4KGT A;  1PFD A;  2NBU A;  4KZC A;  1RM6 C;  4L2Y A;  3EUB 2;  1IP9 A;  4A55 A;  1FCC C;  2LJ5 A;  3AXC A;  1XCQ L;  2KHW B;  2W3R A;  3KYD D;  4LNN A;  1NEN B;  2WXJ A;  3Q8B A;  3FKY A;  1YQ3 B;  1LQB A;  4JWS C;  1ZP0 B;  3U30 A;  2XK5 A;  2JUO A;  2CJO A;  2RDB C;  3URY A;  4RM9 A;  4DXF A;  1V1O A;  2KTF A;  1WZ3 A;  4TQ1 A;  2KDE B;  2JF5 A;  2WGS A;  1V80 A;  4US9 A;  2X8X X;  4G3X B;  2RGF A;  2IY1 B;  1AW7 A;  1JRU A;  2LUE A;  2KAC A;  3WAM A;  3SFE B;  2IO3 B;  3UF8 A;  4WUR A;  1WE6 A;  3UQB A;  4ZRJ A;  1UNS A;  3WAN A;  1YJJ A;  4XDD A;  1ISN A;  2J0K A;  1KM7 A;  2RDH A;  2R2Q A;  3R66 C;  1E9M A;  1R4M I;  2HD5 B;  2NTS A;  1I42 A;  5CTR C;  3V60 A;  2IO0 B;  2FNJ B;  4NZL B;  4HKQ A;  1JWU D;  4WWM A;  2JSV X;  4JGH B;  4I6L B;  2N7J A;  3UIP B;  4HKZ E;  2M1M A;  4MJS B;  4ANX A;  3KYC D;  3DVG Y;  2L52 A;  4M01 A;  3AEC B;  5BMI A;  4KIK A;  4MSQ B;  1D3Z A;  1ZDX A;  3QX1 A;  3FIL A;  1D5X C;  3GOE A;  4MM3 B;  4W9C A;  3Q8F A;  1OQR A;  2DYM A;  2INN E;  4TSS A;  3ZXR A;  4FN2 A;  2PEA A;  4ZRP A;  4ANW A;  2NBW B;  3WCQ A;  3WA0 A;  3LYY A;  3SHQ A;  1KJT A;  1UH6 A;  4DBG A;  2GOW A;  1YD8 U;  1WXV A;  1V86 A;  3RZF A;  4I6N B;  3T3N A;  2JWZ A;  1J0G A;  4WWN A;  2D10 A;  3FC4 A;  1YX5 B;  1N5X A;  2C7M B;  1WE7 A;  1SGH A;  1E10 A;  2XK5 B;  1K53 A;  4JIO U;  3L16 A;  1PGA A;  2BYE A;  3QHT A;  1Q1O A;  1HQR D;  1FEH A;  4EFO A;  1TBE A;  1RYJ A;  4BKS A;  5BYS A;  4MH8 A;  4JWU C;  2K39 A;  4A20 A;  3HHM A;  2V1Y A;  1RAX A;  1RLF A;  4G11 A;  3HM6 X;  2MP2 A;  1UEL A;  2B76 B;  2CKH B;  4FXC A;  4W9H A;  4GLS C;  4M00 A;  3APC A;  4BFR A;  1FMA D;  2V9H A;  1YOV B;  4C7Y A;  2EMT A;  1KLV A;  4LK0 M;  4NJ7 A;  3Q3N C;  4BZA A;  2MJD A;  4BKG A;  3MC0 B;  5EE0 A;  4LTU A;  4PK1 A;  3ZO5 B;  3L17 A;  3NVY A;  5DCN A;  3AED B;  3VVW B;  2JY6 A;  3I9V 1;  2WXO A;  2IYD B;  3BVG A;  1C4A A;  2ASQ A;  2JZZ A;  5G5G A;  5CHW A;  4E74 A;  2G3Q B;  4KIK B;  4BBN C;  1FFU A;  3AE7 B;  2G1E A;  1PUT A;  1QKZ A;  2NTT A;  3FIL B;  1I4X A;  1KRH A;  4FUL A;  1WXM A;  2KFK A;  2KQ4 X;  4B0E A;  2H88 B;  2K5P A;  1GC7 A;  2JYE A;  3MJ5 A;  2KX0 A;  4BOS C;  4G50 A;  4KGR A;  3V6E B;  1EWY C;  1Z2M A;  3RMK C;  4BVU C;  2MSE D;  3M62 B;  5EE1 A;  4K3C A;  2MBB B;  2V3P A;  3DVG X;  3Q3J A;  4QAY A;  1WR6 E;  2MBE A;  3W5U B;  4M0W A;  1G6J A;  2K0P A;  4DXG A;  4URK A;  1UBI A;  4ARI A;  2D3B A;  3FAH A;  2J53 A;  1VJK A;  3P4P B;  4AOF A;  1WWT A;  3Q14 C;  4DHJ B;  1GB1 A;  2R2O A;  2LHE A;  2GI9 A;  2MX2 A;  1TIF A;  2BS2 B;  3I63 C;  1WGK A;  3DWM A;  2IND C;  1TS5 A;  1SSN A;  2MJE A;  1FXI A;  3LB8 C;  3A4S C;  2JZ3 B;  4P16 A;  2JXT A;  1OQQ A;  1WM2 A;  1FXA A;  4FHJ A;  1YQ4 B;  1YN5 A;  2WXF A;  3AN1 A;  2MEK A;  4HRO A;  3BZD B;  1WX8 A;  5G55 A;  2MP2 B;  2O2V A;  5TSS A;  3ZNZ B;  2BS4 B;  2KTR B;  2IO2 B;  1TS3 A;  2W82 A;  3TUO A;  1VZ8 A;  3ABV B;  1EWC A;  4AQ7 A;  1CMX B;  2HJ1 A;  1F1H A;  1WH3 A;  1C4C A;  2RR9 A;  2WX0 A;  3DHH C;  3VDZ A;  1BT0 A;  1R7S A;  4M8M A;  4MGK E;  4ACF A;  4NAW B;  4AP4 C;  3V6C B;  3RT3 B;  4IW0 A;  4IKG A;  3NVZ A;  1AWD A;  2ACZ B;  1T0Q C;  1WGR A;  3APF A;  3N1Z C;  4DXA B;  1FO4 A;  3ZNH B;  3VTU A;  3ML8 A;  3NHE B;  1SE3 A;  2D3G A;  2N9L A;  1C9F A;  3ZJT A;  2O6V D;  2OJR A;  4L23 A;  4REZ A;  1WJ6 A;  4F8C B;  3KH0 A;  3NVW A;  4CHK A;  2BYF A;  2MCN B;  4B9K A;  2AL3 A;  3VH4 B;  2KDB A;  3H7S A;  2I1K A;  3VUX A;  3AE6 B;  4C80 A;  3RNC C;  2GMI C;  2L83 A;  2KFK B;  5G2N A;  2N9E B;  5D94 A;  2UWQ A;  5E6J A;  4PYZ A;  1EO6 A;  5L83 A;  3GZN B;  4YTM B;  1CK1 A;  3V05 A;  2DNF A;  2JT4 B;  1NBF C;  3JVZ X;  1BML C;  1S3S G;  1XT9 B;  4RFB A;  2AX5 A;  4J6I A;  4M0W B;  4YL8 A;  5LXH A;  2WXI A;  2BPS A;  4IWO A;  2MW5 A;  2K8B A;  1NI2 A;  2LD9 A;  1Y56 A;  1WYG A;  1WYW B;  5CHV C;  5C23 A;  1FXT B;  3AM9 A;  3H7P A;  1V1P A;  3UQA A;  1WJN A;  3UGB B;  2CU1 A;  4KV2 A;  1HEZ E;  3PHW B;  1D5M C;  2QSD A;  3VQI A;  4A90 A;  1R4N I;  5FR6 A;  4WWP A;  4XDC A;  4YTN B;  5BYR A;  1PDX A;  2BYT A;  3QA8 A;  2K8C A;  2RD0 A;  2YEP F;  2L8J A;  3ECI A;  1Q0W B;  2G4D B;  2DZK A;  3SU8 X;  5C2T B;  2RDG A;  1KH0 A;  4WIP A;  3CMM B;  2O2V B;  4L1B A;  3P42 A;  3WAL A;  3ZTC A;  1HA5 A;  1J19 A;  3NG0 A;  2WWZ A;  2MQJ A;  3MP9 A;  1KOT A;  1PQS A;  1C4P A;  3KUD B;  2KYW A;  5D3I B;  4KSK C;  4TKN A;  1OGW A;  4M8N A;  2BT6 A;  5KHO A;  4NNJ B;  2LGS A;  3PLV A;  3APD A;  2V4I B;  1XLQ A;  3ZRF A;  3QAQ A;  1YQB A;  2LEK A;  4ANU A;  3TEW A;  2C7H A;  1SB3 C;  4EKU A;  2AQ2 B;  3JSV A;  4A6Q A;  4NPN A;  3ZNI D;  4IM2 A;  3TEZ A;  1WM3 A;  3VXW A;  3CST A;  3IG3 A;  2JYT A;  4GDL A;  1J7C A;  5EDS A;  3GB1 A;  3RI7 C;  1C77 A;  2FCM A;  3AEA B;  1KLG D;  4F7Z A;  3IT6 B;  5AEK B;  3IAM 1;  1P7F A;  5H8Y E;  1WMH A;  1V5T A;  1MHH E;  1TKY A;  4EZK A;  3Q3O C;  1KF6 B;  5D2M B;  1ESF A;  1E8Y A;  4X57 B;  2SEB D;  1MVK A;  2L0F A;  1ZUD 2;  1V5O A;  3IXS A;  2Y5P A;  3E56 A;  1E0Z A;  3P2B A;  1T3Q A;  2MLB A;  3JYU A;  4RGO S;  4WJQ A;  3ZGZ A;  5IA7 A;  2MH7 A;  2A5U A;  3PRP B;  3EHV A;  4TV3 A;  3N3K B;  3AUL A;  3HIZ A;  4DHZ B;  1RFA A;  2BTE A;  4AUQ C;  2AYO B;  4S17 A;  2GRI A;  1HTQ A;  1QT9 A;  3ZYY X;  2DAF A;  4OVZ A;  1V1P B;  3AU5 A;  2XN9 C;  2WXK A;  2ZW0 A;  2FIF A;  1C76 A;  3RYT A;  3WAO A;  1ET6 A;  3A4R A;  3RUI B;  1I4R A;  3N32 A;  1V9J A;  2MBQ A;  3N20 C;  2PVG C;  2GBM A;  2JX5 A;  2MJ3 A;  1V97 A;  3QJZ A;  4XX5 A;  2LJI A;  2LMC A;  3VR8 B;  1WJU A;  1BUI C;  2NR2 A;  1F0Z A;  4K7W A;  3DBR I;  2PTL A;  4W9L A;  3AEG B;  2LGX A;  5EE3 A;  2K25 A;  2PKO A;  3AI5 A;  2DX5 B;  2AQ3 B;  3A1Q A;  1NVI D;  4FA6 A;  1WGD A;  2DWQ A;  2WU2 B;  3DOW A;  1WGH A;  4HPL B;  1OEY J;  2BWE S;  1WI0 A;  4XE0 A;  2E6X A;  4YSX B;  5E6N A;  2C7N B;  2WXR A;  2IY0 B;  2M0A A;  2KDM A;  2EKE C;  5TR5 A;  4LJO B;  5FKA C;  3JSV B;  2PVO D;  2UYZ B;  1UZX B;  1UBQ A;  2SAK A;  2DYB A;  1AN8 A;  2L32 A;  4B95 A;  2BB6 A;  1MJD A;  2D3C A;  2JWU A;  4M02 A;  3TEY A;  1YNT E;  1E8X A;  2LXC A;  4RGT A;  4II3 B;  1WZ0 A;  2KD0 A;  5EE9 A;  1ENF A;  2J52 A;  2N4F A;  4W9I A;  3Q2A C;  3DPD A;  2L7R A;  1T0R C;  3I57 A;  1JML A;  1QLB B;  1KLU D;  1TZO A;  4ZOH C;  3SDL C;  1WMH B;  1YJ1 A;  3PVL A;  3ZLZ A;  1TTN A;  5IKC M;  2K1F A;  4WH4 A;  5JZE B;  1J7A A;  4KVG B;  1PGB A;  1D5Z C;  4DHJ D;  1I7H A;  2K9X A;  1C78 A;  1P98 A;  4W9J A;  3QQ8 B;  3QK0 A;  3OG5 A;  2KO3 A;  1WF9 A;  4HXD A;  4NQK E;  4BKS D;  2N0S B;  5DPR A;  3MC8 A;  4FLH A;  5C3J B;  2J7Q B;  3VRA B;  2QIE B;  3RZW C;  2EEL A;  3EFU A;  1WRD B;  3SEB A;  1EF5 A;  4TUU A;  4KGS A;  1VR9 A;  1EF1 A;  5LNK 1;  3Q3F A;  1I4P A;  3IHP C;  1N60 A;  2JRH A;  1ZE3 D;  4ZRQ A;  1A5R A;  4US8 A;  5CX3 A;  1UWX A;  2OJW A;  1FRD A;  1CJE A;  1H4R A;  1NEK B;  2L1A A;  3ZTD A;  3CF6 E;  3TBL D;  2LUM A;  3L13 A;  1GAQ B;  2IPK D;  3B0A A;  4HVB A;  2BW2 A;  4OVV A;  3A1Q B;  2KWV B;  3Q8C A;  3BII D;  2ZW1 A;  4BKT A;  4LNF A;  3M95 A;  5L95 C;  4AS1 A;  1ZXH A;  3Q3M C;  4BOZ B;  2RSU A;  2KN5 A;  1WSP A;  1NYQ A;  2LGI A;  2LZ6 A;  3BYT B;  4FJV B;  2V3S A;  3ZXV A;  3ZKJ C;  3HK0 A;  3MC9 A;  1WY8 A;  2FUH B;  2IGG A;  2OOB B;  3WAP A;  2NMQ A;  1QOB A;  2LGY A;  2L00 B;  3IAS 1;  1C3T A;  4GSW A;  4KZ0 A;  1M4V A;  5JHA A;  4DHZ E;  1L6U A;  3QWZ B;  2IBI B;  5FK9 C;  3S2A A;  4O1N A;  4GIV A;  5AZG A;  1QOF A;  4MEM A;  1FRR A;  4G0N B;  3KUZ A;  1GPX A;  4HDO A;  4NAM A;  1GNU A;  3NZU A;  2WHI A;  3C19 A;  3PV1 A;  3DBH B;  4GOC A;  2ZVN A;  2ZJD A;  4NQL B;  1J8C A;  3A9K A;  2H89 B;  3NVV A;  2IZV B;  4OW0 A;  1EM7 A;  5DPT A;  5AUK A;  2BF8 B;  4GDK A;  1NDD A;  1T6B X;  2WXL A;  3ZIM A;  2RPQ A;  2KK8 A;  3HVD A;  1V49 A;  3AE8 B;  4HK2 A;  3LJ3 A;  2QMT A;  1F2R I;  2J0M A;  4MGY E;  4HJK A;  2BQQ A;  3NS8 A;  4PT5 A;  1MFW A;  4MH0 E;  1QOA A;  3ZUN A;  1N62 A;  5AUI A;  3R8B A;  2MA9 B;  3PZD A;  3VAW A;  1P1A A;  2KXJ A;  2W54 A;  4USA A;  2BBC A;  3D32 A;  4RF1 A;  5HHD G;  3RNA C;  1KFY B;  1YMH E;  2FCQ A;  5JHB A;  2LGD A;  3OAW A;  3VUY A;  5DPW A;  4WWO A;  1ZW7 A;  3BYY B;  4F1S A;  2AL6 A;  4XC2 A;  1VZ7 A;  2D3A A;  4EE2 A;  2NPT A;  4ARC A;  1E6E B;  2Y5C A;  2HJ8 A;  3RNB C;  1IYF A;  3H8H A;  2W9N A;  5I4D A;  2QIL A;  4JE3 B;  2WXP A;  4XWW A;  3PRE A;  1WX9 A;  1FPY A;  3ALB A;  2RMM A;  2KKC A;  4A3O A;  2BWF A;  3Q8E A;  4XGA B;  4HDQ A;  2I1J A;  4JX1 C;  1SEB D;  1T0S C;  4CO7 A;  1FNW A;  2GBR A;  1L0X B;  4RF0 A;  5J17 A;  4HRS A;  4ZRK A;  2MHJ A;  5AZH A;  4ANV A;  4HLE A;  2LAS A;  1GC6 A;  1P3Q U;  3VUW A;  4K7U A;  2R61 A;  3IT4 B;  2PE6 B;  3HUI A;  2JVC A;  3L4P A;  3Q6B A;  4YT0 B;  4EOY A;  3HM3 A;  4II2 B;  1L0V B;  4OZB A;  4B0M A;  3AB5 A;  2GBK A;  2L0T A;  1IGC A;  3W9C B;  4P1B C;  1BXT A;  2DZJ A;  1QF6 A;  4OZC A;  1UUP A;  1D6E C;  1ZGU B;  5BO4 B;  2K6D B;  3V62 A;  4NJ6 A;  1K8R B;  2KX3 A;  1NYR A;  2INP E;  3A9K B;  3UIN B;  1V2Y A;  1N6Z A;  2JRI B;  3ML9 A;  4GDK B;  1VRA B;  2PMV A;  1SIF A;  4DWF A;  1QOG A;  2LRU A;  1JAL A;  1EU4 A;  3ZDT A;  2KJ6 A;  3I5J C;  1L2N A;  3R3M A;  3VR9 B;  4PS3 A;  4RGN A;  2ZNV B;  4PS7 A;  1YIW A;  2ON8 A;  4D2K A;  3T3O A;  5E6P A;  1IGD A;  3BVZ A;  3DBL I;  3N1Y C;  3H1U A;  3U7Z A;  1FFV A;  2L05 A;  1WX7 A;  5LXI B;  2FUG 1;  3PLU A;  4BAX A;  1YJI A;  1VLB A;  3NS1 A;  1FCL A;  3AMZ A;  4LJP B;  3U7D A;  2LXA A;  3W1Y A;  2KC1 A;  1N61 A;  1XO3 A;  1RFK A;  3RCZ A;  3AE9 B;  2NPT B;  2LI5 A;  2ZNV C;  4NY0 A;  1RRB A;  2CS4 A;  1X1M A;  4WAF A;  5H92 C;  2DAJ A;  4IUM B;  2KMM A;  3BIN A;  3TCA A;  4ZYS A;  5IP4 D;  2BKR B;  3VTV A;  1FM0 D;  1D4B A;  2D07 B;  3AH7 A;  3IFW B;  1ET9 A;  3EEC A;  1K51 A;  4ZRI A;  4YSZ B;  2KC2 A;  1A70 A;  5JH5 C;  4C4V A;  2EMS A;  3AV8 A;  2L76 A;  1UWM A;  2N9P C;  3ZJV A;  2E3T A;  4JPS A;  1TJE A;  2QCZ A;  2REX A;  3PO0 A;  4WJP A;  2M8S A;  5BMH A;  5J2R A;  1UD7 A;  1IBX A;  3L54 A;  2M0X A;  3P1M A;  4KDI C;  4LDT D;  2W3S A;  4AJW A;  3QCA A;  1JW9 D;  4GGQ A;  3VHT C;  4IM3 A;  1ZOY B;  1E8W A;  1K50 A;  3ZJU A;  4ZDV A;  3VTW A;  5C1Z A;  2MBO A;  3EA6 A;  3KUC B;  3P4Q B;  1DYQ A;  4MSM B;  1CZP A;  1P7E A;  2K3U A;  3BK2 A;  2XNA C;  2CHW A;  1WXQ A;  2M17 A;  1LM8 B;  5E6O A;  2OHF A;  3CWI A;  4UDU C;  1U4A A;  2Y3A A;  4N59 A;  4OZA A;  1AYF A;  4DDG D;  2L3Z A;  1FD6 A;  1XLP A;  4K7S A;  3DDC B;  1QZE A;  4C56 C;  2LHD A;  3CSF A;  3NJT A;  3C0R B;  3E9S A;  3QC8 B;  3DWG C;  3H9D A;  4PS8 A;  2A4Z A;  1E5W A;  3N1X C;  5DPS A;  2ZEQ A;  1WR1 A;  1WIA A;  5IN7 A;  1SBB B;  1R4N B;  4FJZ A;  2PIA A;  3L10 B;  5IO9 A;  4RH6 A;  1P9D U;  3B1L X;  2QJL A;  4KSL C;  1OEY A;  1SE9 A;  3TJP A;  2WXM A;  3GE8 C;  4ICU A;  1YN4 A;  1WGG A;  3R7Q A;  1TKG A;  3B2G A;  2DBY A;  3O13 A;  2DZM A;  3H7P B;  4IWQ A;  1T5X D;  1L7Y A;  1HE8 A;  4WAA A;  2TSS A;  4AWJ A;  3ETR A;  4LNO A;  3NY5 A;  3R7R A;  5JXV A;  1MG8 A;  1IUE A;  2WXH A;  4C7Z A;  4YXD B;  5IOI A;  3NUH B;  4ITK A;  2FCN A;  4FJY A;  1EUV B;  3ZNG C;  2WNM A;  2VH1 A;  1DOY A;  2NCN A;  4JL9 A;  1F52 A;  2LVQ A;  2PPH A;  1VZ6 A;  4CQN A;  4C4V B;  4HPP A;  3AEB B;  5IAA C;  2ZCB A;  3ZVV A;  1ZXI A;  4TQ0 A;  1E90 A;  1OQY A;  1TY2 A;  4HWI B;  4RCO A;  3OJ3 A;  3V61 A;  2KLC A;  1SE2 A;  2KFJ A;  4MDK E;  4GU2 A;  1IBX B;  3PPA A;  5HKH A;  2LVO A;  2N1V A;  4J3O D;  3N30 A;  2IJ0 A;  2Z8L A;  4ZHO A;  2WQY B;  2PJH A;  2KJH B;  2WXN A;  3U8Z A;  5HI1 A;  2KVR A;  3HRD D;  1JWS D;  2OED A;  2PE9 A;  3RNE C;  2KVZ A;  4HCP B;  4RGM A;  1FNU A;  3DHG C;  2KOX A;  3Q69 A;  2Z0E B;  4LNI A;  4EEW A;  4GDL B;  2C60 A;  1TYG B;  1XLN A;  2N9K A;  4W9K A;  2WP9 B;  1JCK B;  3RPF C;  3AE3 B;  1GUA B;  4OHJ A;  1MG4 A;  1YN3 A;  3DCG A;  4HPM B;  2M19 A;  1L0Y B;  3KW5 B;  4GMV A;  1JRO A;  1I4G A;  1I35 A;  4YSY B;  1I4Q A;  4LDT B;  4GB9 A;  1J7B A;  2KWC A;  1L5P A;  3RD2 A;  2N1W A;  5G5H A;  3L08 A;  1JWA D;  5HFY A;  2KAN A;  4W9G A;  3LXF A;  1JWM D;  2VRR B;  3JW0 X;  3EC8 A;  5AZF A;  5FR3 A;  1QIL A;  4P6V F;  1JQ4 A;  1XF5 L;  4DQO C;  2KN4 A;  2WDV B;  2GB1 A;  3DBR B;  3ONS A;  5BMG A;  2FID A;  3MTN B;  4WQO B;  2KNB A;  2KZR A;  3DBH I;  3C8Y A;  1PGX A;  2V3N A;  3PGE A;  5CHF A;  3PHX B;  2WU5 B;  3H6N A;  3TEX A;  1T0Y A;  3W5V B;  4IWP A;  3RNG C;  2QDF A;  4RM8 A;  2YEP B; 
#chains in the Genus database with same CATH homology
 3M63 B;  5FR6 A;  2NBU A;  4KZC A;  4WWP A;  4IC7 B;  2KJR A;  2W9N A;  2LWP A;  3QA8 A;  2WX1 A;  2K8C A;  2RD0 A;  4OVU A;  2L8J A;  1IP9 A;  2LJ5 A;  1Q0W B;  2G4D B;  3ECI A;  2DZK A;  3PRE A;  3SU8 X;  1WX9 A;  3O65 B;  3AXC A;  3ALB A;  2G45 B;  2KHW B;  2KKC A;  2YVC A;  3KYD D;  4A3O A;  3CMM B;  2BWF A;  2AWT A;  2I1J A;  4HDQ A;  2O2V B;  3AU4 A;  4CO7 A;  3WAL A;  3ZTC A;  2GBR A;  1LQB A;  1J19 A;  2WWZ A;  2MQJ A;  3U30 A;  5J17 A;  1PQS A;  4ZRK A;  1KOT A;  2XK5 A;  3KUD B;  5AZH A;  1Q5W B;  4ANV A;  1E8Z A;  4HLE A;  1S1Q B;  3WIM A;  2JUO A;  2LAS A;  4KSK C;  4TKN A;  1GC6 A;  1OGW A;  4RM9 A;  1P3Q U;  1V6E A;  4M8N A;  2KTF A;  3VUW A;  1WZ3 A;  4K7U A;  3I3T B;  2KDE B;  2JF5 A;  4TQ1 A;  5KHO A;  3VFK A;  1V80 A;  2FAZ A;  4NNJ B;  3PLV A;  4G3X B;  2PE6 B;  3W1S A;  2RGF A;  1VCB A;  2DHZ A;  2IY1 B;  3APD A;  2JVC A;  1JRU A;  3ZRF A;  4EOY A;  3HM3 A;  2LUE A;  3QAQ A;  4II2 B;  1YQB A;  4W9F A;  4ANU A;  2C7H A;  4EKU A;  2GBK A;  2L0T A;  2KTR A;  2DZJ A;  3WAM A;  3JSV A;  1ZGU B;  2IO3 B;  3UF8 A;  4I6P A;  5BO4 B;  2K6D B;  3V62 A;  4NJ6 A;  1K8R B;  3UQB A;  1WE6 A;  2KX3 A;  4NPN A;  4ZRJ A;  3A9K B;  3UIN B;  1V2Y A;  4IM2 A;  3ZNI D;  1WM3 A;  1TZ1 A;  2JRI B;  3ML9 A;  4GDK B;  3VXW A;  3WAN A;  1WXA A;  3CST A;  1ISN A;  3IG3 A;  2C5L C;  3A33 B;  2J0K A;  1KM7 A;  4NAW A;  4GDL A;  2R2Q A;  3R66 C;  1SIF A;  5EDS A;  2FCM A;  1R4M I;  4DWF A;  2HD5 B;  4A3P A;  2LRU A;  1I42 A;  5CTR C;  3V60 A;  2IO0 B;  3ZDT A;  4F7Z A;  2KJ6 A;  2FNJ B;  1L2N A;  3R3M A;  4PS3 A;  5AEK B;  2C9W B;  2QHO A;  1WMH A;  2JPH A;  1V5T A;  2ZNV B;  4PS7 A;  2MBH A;  4EZK A;  4JGH B;  1YIW A;  4I6L B;  3UIP B;  5E6P A;  2M1M A;  1E8Y A;  5D2M B;  4MJS B;  3DBL I;  4X57 B;  2L0F A;  3SD5 A;  1V5O A;  3H1U A;  4ANX A;  3KYC D;  3DVG Y;  4W9E A;  2L05 A;  1WX7 A;  5LXI B;  3PLU A;  3P2B A;  2MLB A;  3JYU A;  4WJQ A;  4KIK A;  5IA7 A;  4FHK A;  2A5U A;  4IM0 A;  4MSQ B;  3PRP B;  3EHV A;  1D3Z A;  4TV3 A;  3N3K B;  3AUL A;  3NOB A;  4ZYN A;  4LJP B;  3QX1 A;  3DQV A;  3HIZ A;  4DHZ B;  1RFA A;  3QAR A;  1WXS A;  3U7D A;  4K1R B;  2ZPN A;  2LXA A;  2G4S A;  4AUQ C;  3GOE A;  4W9C A;  2ZCC A;  3W1Y A;  3A9J A;  2AYO B;  2KC1 A;  4MEL A;  2DYM A;  3IVF A;  3RCZ A;  2CHZ A;  1UGM A;  3IBE A;  2DAF A;  2PEA A;  4FN2 A;  3AU5 A;  2NPT B;  2V4L A;  2LI5 A;  2FIF A;  2ZNV C;  4NY0 A;  1RRB A;  4ANW A;  4FBJ B;  2NBW B;  3RYT A;  3WAO A;  3WA0 A;  3A4R A;  2CS4 A;  2KMC A;  1X1M A;  1XD3 B;  2DAJ A;  3RUI B;  4IUM B;  4LCD E;  3SHQ A;  3X0W A;  3BIN A;  3TCA A;  3N32 A;  4W9D A;  1V9J A;  2MBQ A;  1KJT A;  2GBM A;  1UH6 A;  2KQS A;  4FAD A;  2K8H A;  4DBG A;  2BKR B;  1YD8 U;  2GOW A;  1WXV A;  3VTV A;  1V86 A;  2D07 B;  3RZF A;  3QJZ A;  4XX5 A;  3GZN I;  4N9F 4;  3IFW B;  4I6N B;  2JWZ A;  1J0G A;  4WWN A;  1LFD A;  2D10 A;  2K6Q A;  3EEC A;  1YX5 B;  4ZRI A;  2C7M B;  1WJU A;  2KC2 A;  5JH5 C;  2J0J A;  2EMS A;  2NR2 A;  1WE7 A;  3PT2 B;  4K7W A;  1SGH A;  3DBR I;  2L76 A;  2XK5 B;  2N9P C;  3PRM B;  4W9L A;  2LGX A;  4JIO U;  2K25 A;  3L16 A;  2BYE A;  3QHT A;  2REX A;  1Q1O A;  2ZZP B;  3AI5 A;  3PTF C;  4HCN B;  1XQQ A;  4WJP A;  2M8S A;  2DX5 B;  4EFO A;  4DK5 A;  3A1Q A;  1TBE A;  1Y8R C;  4FA6 A;  5J2R A;  1WGD A;  4BKS A;  1UD7 A;  3DOW A;  1WGH A;  4HPL B;  2K39 A;  4A20 A;  1OEY J;  3L54 A;  2M0X A;  2BWE S;  3HHM A;  1WI0 A;  4KDI C;  2V1Y A;  4LDT D;  4AJW A;  1RAX A;  5E6N A;  1RLF A;  2C7N B;  4G11 A;  3QCA A;  2N7E A;  2IY0 B;  3HM6 X;  5LLI A;  2EKE C;  2MP2 A;  1UEL A;  2CKH B;  4W9H A;  4DDI D;  4EUT A;  4GGQ A;  4LJO B;  5TR5 A;  3VHT C;  3JSV B;  2ZVO A;  3ZW3 A;  4IM3 A;  3APC A;  2UYZ B;  2XBB C;  1E8W A;  1UZX B;  1UBQ A;  4BFR A;  4ZDV A;  2DYB A;  1Z5S B;  3VTW A;  2BYV E;  5C1Z A;  4B95 A;  2MBO A;  1V81 A;  3KUC B;  4RMA A;  3X23 A;  2MRP A;  1M94 A;  4MSM B;  2EMT A;  1LXD A;  1KLV A;  1E8X A;  2LXC A;  4CYE A;  4II3 B;  3T9L A;  1WZ0 A;  2KD0 A;  4NJ7 A;  2HTH A;  2N4F A;  4W9I A;  4MGI E;  2CHW A;  2M17 A;  3W1S C;  3DPD A;  1LM8 B;  5E6O A;  4BKG A;  2L7R A;  2YLM A;  2Z59 B;  3MJW A;  1U4A A;  3SDL C;  1WMH B;  4DDG D;  1YJ1 A;  3ZO5 B;  3L17 A;  3PVL A;  5DCN A;  3ZLZ A;  1TTN A;  2L3Z A;  2K1F A;  1P0R A;  3VVW B;  1YX6 B;  2JY6 A;  2BGF A;  4K7S A;  3DDC B;  1QZE A;  5JZE B;  2IYD B;  2ASQ A;  4KVG B;  2JZZ A;  3CSF A;  3C0R B;  5CHW A;  3QC8 B;  2G3Q B;  4GXB A;  4KIK B;  3H9D A;  4PS8 A;  4E74 A;  2A4Z A;  1E5W A;  4DHJ D;  4BBN C;  2KQ7 A;  5DPS A;  2ZEQ A;  1WR1 A;  4K81 A;  1WIA A;  3ZDM C;  1P98 A;  1VD2 A;  3L10 B;  2BKF A;  3OLM D;  4FJZ A;  4KDL B;  4W9J A;  1P9D U;  3QQ8 B;  3B1L X;  3DVN U;  3QK0 A;  4KSL C;  1OEY A;  3A9J B;  1SE9 A;  3TJP A;  2KO3 A;  4FUL A;  1WFY A;  1WXM A;  1OTR B;  2KFK A;  4ICU A;  1WGG A;  2NVU I;  1WF9 A;  2XEW A;  4HXD A;  4NQK E;  3R7Q A;  4WJO A;  4BKS D;  5DPR A;  3PS6 A;  4EZL A;  2DZM A;  1GC7 A;  3H7P B;  4IWQ A;  2KX0 A;  4FLH A;  4G50 A;  3TIX A;  4BOS C;  2J7Q B;  2GBJ A;  1L7Y A;  5KHQ A;  3V6E B;  1HE8 A;  4WAA A;  1Z2M A;  2DYO A;  3RZW C;  4BVU C;  2MSE D;  1E7U A;  2KDF B;  1ZKH A;  3EFU A;  3M62 B;  1WRD B;  4AWJ A;  1EF5 A;  4TUU A;  4EZJ A;  3NY5 A;  2MBB B;  3DVG X;  1MG8 A;  3Q3J A;  3R7R A;  1EF1 A;  1WR6 E;  2MBE A;  3Q3F A;  2FCN A;  4FJY A;  1G6J A;  1EUV B;  3ZNG C;  3IHP C;  3M3J A;  2JRH A;  3L0W B;  4URK A;  1UBI A;  3PSE B;  2NCN A;  4JL9 A;  1A5R A;  4AOF A;  2NS5 A;  5CX3 A;  2O6V A;  2LVQ A;  4DHJ B;  3DVN V;  3QIJ A;  2PPH A;  1H4R A;  2LRW A;  2R2O A;  2MX2 A;  2ZPY A;  3ZTD A;  3CF6 E;  1IPG A;  2ZCB A;  3L13 A;  5IAA C;  3TBL D;  3ZVV A;  3BY4 B;  3B0A A;  4ASW C;  2WDT B;  3K9O B;  4TQ0 A;  4HVB A;  1E90 A;  1OQY A;  4OVV A;  3A4S C;  2JZ3 B;  3A1Q B;  4HWI B;  2KWV B;  3OJ3 A;  3V61 A;  5D7G A;  1GG3 A;  2KLC A;  2DEN B;  4PYU A;  1WM2 A;  2KFJ A;  4GU2 A;  4FHJ A;  4MDK E;  3ZRC A;  4BKT A;  3VH3 B;  3PPA A;  3LDZ E;  5HKH A;  3M95 A;  2LVO A;  2N1V A;  3N30 A;  4JLC A;  5L95 C;  2FCS A;  4BOZ B;  2RSU A;  5GMV A;  2KN5 A;  2PJH A;  1WX8 A;  2CHX A;  2KJH B;  1WGY A;  2MWS B;  5G55 A;  2MP2 B;  2LZ6 A;  2O2V A;  4FJV B;  2V3S A;  2KWU B;  1TGZ B;  3U8Z A;  3ZNZ B;  3OJ4 B;  3ZKJ C;  3HK0 A;  4E71 A;  2KTR B;  2IO2 B;  2KVR A;  3ENE A;  1WY8 A;  2FUH B;  2OOB B;  4B6W A;  3WAP A;  3UIO B;  2LGY A;  2L00 B;  1C3T A;  4IG7 B;  1AAR A;  3TMP B;  4GSW A;  4KZ0 A;  2PE9 A;  1H8C A;  4HCP B;  1CMX B;  1WH3 A;  2KOX A;  2RR9 A;  5JHA A;  2WX0 A;  2Z0E B;  3VDZ A;  4MGZ E;  2D11 A;  2N7D A;  4DHZ E;  3QWZ B;  4EEW A;  1BT0 A;  2IBI B;  3S2A A;  4M8M A;  4MGK E;  4GIV A;  4NAW B;  4GDL B;  5AZG A;  4AP4 C;  2C60 A;  3V6C B;  4BBN F;  4MEM A;  4WJN A;  4IW0 A;  3RT3 B;  4G0N B;  4ICV A;  4W9K A;  3KUZ A;  2KLG A;  4HDO A;  1GNU A;  3NZU A;  1WGR A;  3APF A;  4DXA B;  2LVP A;  1GUA B;  3PV1 A;  4JQW C;  3ML8 A;  3VTU A;  3NHE B;  4GOC A;  3DCG A;  3ZNH B;  2ZVN A;  2ZJD A;  4HPM B;  4GN1 A;  2D3G A;  3KW5 B;  4NQL B;  4GMV A;  3T8M A;  1J8C A;  3A9K A;  1I35 A;  5DPT A;  2IZV B;  2O6V D;  2OJR A;  4LDT B;  4GB9 A;  2BF8 B;  1WJ6 A;  4GDK A;  4F8C B;  1WJ4 A;  3KH0 A;  1NDD A;  4CHK A;  2BYF A;  2KWC A;  2WYQ A;  2M4N A;  2MCN B;  2D2Q A;  4B9K A;  2AL3 A;  3VH4 B;  2KDB A;  3RD2 A;  2N1W A;  3ZIM A;  2RPQ A;  3H7S A;  2KK8 A;  4XZ4 A;  4E3C A;  2I1K A;  3L08 A;  2Y5B B;  3VUX A;  2Z0D B;  1V49 A;  2GMI C;  2DZI A;  2KAN A;  2KFK B;  4W9G A;  5D6J B;  2NBV B;  5G2N A;  2N9E B;  4HK2 A;  5D94 A;  2UWQ A;  3LJ3 A;  2VRR B;  3JW0 X;  3EC8 A;  4PYZ A;  5AZF A;  1EO6 A;  2AEH A;  2J0M A;  4MGY E;  4HJK A;  5L83 A;  3NS8 A;  1GJZ A;  3TL5 A;  4MH0 E;  3ZUN A;  4MJS A;  2MA9 B;  3PZD A;  3VAW A;  1P1A A;  2KXJ A;  2B3A A;  2JT4 B;  1NBF C;  3JVZ X;  2KDI A;  3D32 A;  1S3S G;  1XT9 B;  3ONS A;  4AJY B;  4J6I A;  2FID A;  4M0W B;  4YL8 A;  2FCQ A;  3MTN B;  5JHB A;  4WQO B;  5LXH A;  3PRZ A;  2LGD A;  3RUL A;  3OAW A;  2CR5 A;  2KNB A;  2KZR A;  3DBH I;  2IO1 B;  2BPS A;  3NZS A;  4IWO A;  2MW5 A;  3VUY A;  3MHS D;  3DBS A;  2K8B A;  1NI2 A;  2LD9 A;  4WWO A;  5DPW A;  1ZW7 A;  3K9P B;  4F1S A;  4MM3 A;  1WYW B;  2AL6 A;  2O6V B;  3KVF B;  3PGE A;  5J18 A;  2JXX A;  5CHV C;  5CHF A;  5C23 A;  3PHX B;  1FXT B;  4XC2 A;  3B08 A;  1C1Y B;  1F9J A;  2GBN A;  3H7P A;  2NPT A;  3H6N A;  1T0Y A;  3UQA A;  1WJN A;  3UGB B;  2CU1 A;  4P7I A;  4IWP A;  4KV2 A;  2KMA A;  2N9X A;  1E7V A;  2HE7 A;  3PHW B;  4RM8 A;  3VQI A;  1IYF A;  2HJ8 A;  1R4N I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...