3QX1A

Crystal structure of faf1 ubx domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
MEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords FAS-associated factor 1
publication title Dissection of the interaction between FAF1 UBX and p97
rcsb
source organism Homo sapiens
total genus 25
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3qx1A00
2BF8B 3DVGX 2JXXA 4HPLB 5G55A 2O2VA 3DVGY 3WAOA 4BKSD 1XD3B 2OOBB 1MG8A 1KJTA 3OLMD 4ZYNA 2AL6A 2Z59B 3D32A 3PLVA 5E6PA 4HXDA 4RMAA 3QK0A 5CHVC 3BINA 4HWIB 3KUCB 2ZPYA 4N9F4 3PV1A 1V2YA 4OVUA 1M94A 2LVPA 3L0WB 2O6VD 2DYOA 1P1AA 4LCDE 5D94A 2EKEC 4AWJA 3UF8A 3RUIB 2KDFB 2DX5B 1XQQA 2NVUI 4KVGB 4MH0E 1YD8U 3RZWC 4EFOA 2FCNA 2YLMA 1WMHA 3VTUA 5DPWA 3QQ8B 2KC1A 4PYZA 3R66C 2GBMA 3PVLA 1GUAB 3QX1A 2BKRB 2GBJA 1C3TA 2M1MA 2KQSA 2PPHA 3H7PB 4FADA 2JRIB 3OJ4B 2EMSA 2PE6B 4GDLB 4DXAB 2NS5A 3ZRFA 1V5TA 2V1YA 3ECIA 4IM0A 2WX1A 1WJUA 4NPNA 2WYQA 2MCNB 1UZXB 2G3QB 3S2AA 1WH3A 3VXWA 2M4NA 3PRPB 4TV3A 4TQ0A 4HDQA 3ZNHB 1V86A 5J17A 4FLHA 3ZTCA 1TZ1A 3VQIA 2MRPA 3B1LX 3EC8A 4GDKA 2N4FA 2G4DB 3WAMA 3KW5B 2IO1B 2KVRA 4GU2A 5DPTA 4NJ6A 3ZDMC 2LGXA 4GN1A 2CKHB 1WGYA 2JRHA 3QHTA 2LD9A 2MP2B 1WM3A 2LJ5A 3OAWA 4BBNF 4WWNA 3I3TB 4M8NA 3C0RB 2KWVB 3L17A 2KTFA 3UGBB 1WX8A 2VRRB 5FR6A 5C1ZA 3U30A 1GG3A 2A5UA 1WM2A 2OJRA 2BKFA 2FIFA 2UYZB 1Z5SB 2Y5BB 4I6PA 3U7DA 4ANUA 3QC8B 3AU5A 3RCZA 2KLCA 3X0WA 3A9KA 1YQBA 3UIPB 3UQBA 5L95C 4FHJA 2XK5B 3H6NA 4MEMA 3T8MA 4B95A 4KIKB 3CF6E 3JW0X 2C7MB 3CSFA 3M62B 4MGKE 4ZRIA 2MQJA 1OGWA 3JYUA 4W9LA 4HCNB 2KKCA 3PS6A 3VAWA 3B0AA 2M0XA 3ZUNA 2JVCA 1R4MI 3M63B 2NR2A 2C7NB 2R2OA 3QIJA 4BKTA 4BKSA 1S1QB 2KFKB 3SHQA 1T0YA 4CYEA 1L2NA 3LDZE 2MX2A 3PZDA 4W9CA 2ZZPB 3DPDA 1WXMA 4X57B 1OEYJ 4ICVA 3L54A 2NPTA 3A9JB 3P2BA 2RD0A 3UINB 2NBVB 5TR5A 2LI5A 2ASQA 2LZ6A 4G11A 2HJ8A 1WR1A 4K81A 2WWZA 3ZW3A 4TUUA 3KYCD 1ZW7A 2ZNVB 3L16A 2L0FA 3APCA 3RD2A 2GBRA 3U8ZA 2J0KA 4HVBA 3JVZX 3V6EB 4DHZB 4W9GA 1GNUA 4GOCA 3DBHI 2KDIA 2ZCBA 3N3KB 1SIFA 1RLFA 3PHWB 2V4LA 2MBOA 3AXCA 3TL5A 2Z0EB 3TMPB 3PTFC 2DENB 4W9EA 4B6WA 2NBUA 4WQOB 4IWOA 3N30A 2L7RA 1WGHA 1AARA 2IO3B 2K8HA 4MSQB 2LXAA 1ZKHA 3H9DA 4LDTB 3PRZA 4M8MA 1I35A 1YX6B 1WZ3A 2DYBA 4FJVB 1J19A 1WXAA 2JWZA 2KWUB 3HK0A 1U4AA 1WGRA 2A4ZA 4CO7A 3BY4B 2JY6A 1WGDA 3H7SA 4WJQA 3WANA 3Q3JA 4WJPA 3ZNZB 1FXTB 4AJYB 5E6OA 5IAAC 3ZIMA 1P0RA 2MBHA 1WXSA 3PREA 1EUVB 1E7UA 3TCAA 1F9JA 4FHKA 1WX7A 4XC2A 4AUQC 2ZVOA 1TGZB 3W1SA 3APDA 2IO2B 3PRMB 2MSED 3DOWA 3VH3B 3DVNV 2K25A 1UBIA 2PEAA 3V6CB 2GBKA 2MBEA 4K7UA 4ANWA 1K8RB 2BYVE 1WY8A 2MBBB 2KFJA 2D11A 2K8BA 2KXJA 3M3JA 4EZJA 1WGGA 5GMVA 1WE7A 3ZNGC 2LRUA 1WJNA 2N7DA 3KYDD 3K9OB 5D6JB 1RFAA 3VTVA 5LXIB 2BYFA 2D10A 4ZRJA 5BO4B 3EECA 2XEWA 3ZTDA 4LJPB 4BFRA 4HK2A 4EUTA 2CHZA 2ZVNA 3EFUA 3PHXB 4BVUC 2C7HA 5DCNA 4FBJB 2FIDA 3DBSA 2D3GA 1IPGA 5D2MB 2YVCA 3PT2B 4IWPA 3QJZA 5CX3A 4CHKA 4DBGA 4DHZE 3A4SC 5DPSA 3EHVA 4HCPB 4BBNC 2WX0A 3ZLZA 1C1YB 1WMHB 4G50A 3KH0A 4RM8A 2JZ3B 3HIZA 4NJ7A 3IFWB 5J18A 4XZ4A 5HKHA 2KWCA 5E6NA 2KD0A 2LRWA 4DDID 3A1QB 3WAPA 4W9DA 2J0MA 1WYWB 2C5LC 1UH6A 4MELA 4ZDVA 3DVNU 4E71A 2LUEA 2KX3A 4IG7B 3R3MA 2K1FA 2KTRA 4E3CA 1V49A 2KMAA 3PPAA 1LQBA 2RGFA 4HPMB 4HLEA 4GDKB 3VUXA 2M17A 2JT4B 2L8JA 3PLUA 1GJZA 2K8CA 5CTRC 4DK5A 1V80A 2BWES 2BWFA 4AP4C 4ANVA 4URKA 2KQ7A 2KJHB 4B9KA 1IP9A 3JSVA 1YX5B 1P3QU 2HTHA 3VUWA 4IWQA 3QWZB 3CMMB 2LGYA 4ANXA 1GC6A 2KK8A 2L05A 2ZNVC 1HE8A 4FA6A 1E8XA 4MSMB 2V3SA 3IG3A 4G0NB 4KZ0A 3WA0A 4KSKC 4K7SA 4LJOB 3VTWA 1E5WA 4PS8A 5AZGA 1VCBA 3A9KB 3WIMA 4KDLB 3CSTA 2DZIA 2M8SA 4NAWA 3M95A 2JUOA 3TJPA 1D3ZA 3SU8X 1BT0A 2KMCA 1J0GA 3L10B 2O6VA 2EMTA 2GBNA 4I6NB 3VFKA 3KVFB 1R4NI 2KDEB 2C60A 1EF5A 4A3PA 2JPHA 1WRDB 1WX9A 3B08A 4K1RB 3R7QA 2KO3A 3ZVVA 2B3AA 3ZDTA 3UIOB 2KJ6A 2CR5A 3IVFA 3SD5A 1Q0WB 2DHZA 3ALBA 4F8CB 2N9PC 2D2QA 2FNJB 2NPTB 2KHWB 3ZRCA 1CMXB 2IO0B 3V61A 2WDTB 3NS8A 4GMVA 2BGFA 5LXHA 2DAJA 2N1WA 4JQWC 1WF9A 1LM8B 1WJ4A 1XT9B 2DZMA 2G4SA 2KDBA 4F7ZA 2R2QA 4J6IA 4K7WA 3AI5A 3TIXA 5AZHA 1UBQA 2ZPNA 3DCGA 4ZRKA 2IY0B 3TBLD 5CHWA 4MJSA 1S3SG 1NI2A 4MDKE 4EZKA 1E90A 3V60A 5JHBA 3N32A 1WI0A 4PS7A 1X1MA 3DBRI 1JRUA 1GC7A 1EF1A 2ZJDA 4EZLA 3VUYA 2GOWA 4KSLC 4IUMB 2ZEQA 1WR6E 3Q3FA 1WIAA 2N1VA 5D7GA 3H1UA 1OQYA 2CHWA 2L0TA 5J2RA 1V5OA 4GXBA 5LLIA 2Z0DB 2FCQA 2UWQA 2O2VB 4IW0A 2KZRA 4W9IA 2RPQA 3NZUA 1Z2MA 3ZO5B 5JH5C 2LVQA 3ZNID 1UGMA 2NBWB 3QA8A 1E8ZA 3DQVA 1Q5WB 2IZVB 1A5RA 1H8CA 3ZKJC 2HD5B 3H7PA 4IM3A 3W1YA 4GDLA 2AEHA 2K39A 2N7EA 2KOXA 2BYEA 1E7VA 2AWTA 2MWSB 1E8WA 4YL8A 2DZJA 1ZGUB 1V9JA 4WAAA 4WWPA 1YJ1A 1EO6A 2IY1B 2N9EB 3MTNB 3OJ3A 3QAQA 4DHJB 4DWFA 2DAFA 4BOSC 4EOYA 4NY0A 2QHOA 2L3ZA 1YIWA 2I1JA 1P98A 3SDLC 4LDTD 2KJRA 1UELA 4JLCA 4MGZE 2C9WB 1KLVA 3IHPC 2JF5A 4FJYA 1NBFC 1RRBA 4WJOA 1PQSA 2J7QB 4WJNA 1WXVA 5IA7A 1TTNA 3A1QA 4IM2A 4BKGA 2MP2A 1QZEA 1TBEA 2XBBC 5JZEB 3O65B 3HHMA 4GSWA 1V6EA 4W9FA 4AJWA 4FN2A 4MM3A 2MA9B 3UQAA 1J8CA 2G45B 2LGDA 3ONSA 2LXCA 3PSEB 3NHEB 4OVVA 2W9NA 4TQ1A 3WALA 4FJZA 1SGHA 1V81A 3VVWB 3KUDB 4NQLB 3L08A 2JZZA 4TKNA 1Q1OA 4W9HA 2XK5A 1KOTA 1RAXA 4KIKA 3L13A 4WWOA 2KANA 2KN5A 1WJ6A 2RR9A 4W9JA 3LJ3A 4PYUA 1L7YA 3V62A 4A3OA 2LWPA 3RYTA 3GZNI 2MW5A 1OEYA 2KNBA 2KTRB 3APFA 2AYOB 2LASA 3DDCB 1IYFA 4HDOA 3IBEA 4MGIE 2RSUA 1NDDA 3NY5A 5AZFA 4W9KA 2CHXA 2KFKA 3DBLI 1OTRB 4HJKA 4GIVA 2FUHB 4XX5A 2PE9A 1Y8RC 4AOFA 4MGYE 4BOZB 1I42A 2MBQA 4DHJD 5KHQA 4JIOU 2LVOA 3A9JA 4II3B 3JSVB 4NNJB 2ZCCA 4A20A 2REXA 3PGEA 3A4RA 1WFYA 1SE9A 3ML8A 1ISNA 4JL9A 3VHTC 1P9DU 3AU4A 2BPSA 3AULA 2GMIC 3HM3A 3NZSA 5KHOA 2FCMA 4M0WB 3R7RA 5G2NA 2L76A 2L00B 3MHSD 2N9XA 2FAZA 4ICUA 4PS3A 2FCSA 3GOEA 4NAWB 1WZ0A 3RZFA 4ASWC 2D07B 2O6VB 2IYDB 2HE7A 4GB9A 4EEWA 2KLGA 5DPRA 4P7IA 3X23A 5CHFA 4EKUA 2KC2A 2CS4A 3QARA 4GGQA 1VD2A 2J0JA 3A33B 1LFDA 3ENEA 2NCNA 3RT3B 3QCAA 3VDZA 3ML9A 3KUZA 4KZCA 4JGHB 3K9PB 2K6DB 1LXDA 2K6QA 3HM6X 1E8YA 5C23A 3T9LA 4F1SA 4KDIC 2DYMA 5EDSA 2CU1A 3W1SC 2MLBA 5AEKB 5JHAA 2I1KA 4DDGD 4I6LB 3MJWA 3RULA 2KX0A 2PJHA 4NQKE 4RM9A 2AL3A 5L83A 3VH4B 1KM7A 4IC7B 1G6JA 4KV2A 1WE6A 4E74A 4FULA 4G3XB 3NOBA 4MJSB 1UD7A 2DZKA 2IBIB 4II2B 1H4RA
chains in the Genus database with same CATH superfamily
4HPLB 1M4VA 2JXXA 3DVGY 4BKSD 1XD3B 2OOBB 1MG8A 1KJTA 4ZYNA 2AL6A 2Z59B 1N61A 4HXDA 3J9CA 3QK0A 4FXCA 4HWIB 4N9F4 3PV1A 1FD6A 2LVPA 3L0WB 1KRHA 1P1AA 4AWJA 3AEFB 2DX5B 2NVUI 1MI0A 2KC1A 2KMMA 4A9AA 2VZKB 1GUAB 1VLBA 3P4QB 2W55A 3H7PB 4DXAB 3BWUD 3ZRFA 1V5TA 3ECIA 2WX1A 4NPNA 2MCNB 3VXWA 2G3QB 1WH3A 2V0GA 3AE4B 1JWUD 1SF0A 3EC8A 3I9V1 4GDKA 4KKJA 2N4FA 2BT6A 3WAMA 3CWIA 3AEAB 4YSXB 1RFKA 3ZDMC 2LGXA 1WYGA 3DBRB 3E9SA 2KTFA 3UGBB 2H89B 1WX8A 2MJDA 5C1ZA 1XO3A 2BKFA 1Z5SB 4I6PA 3AU5A 4FHJA 3H6NA 3T8MA 2OHFA 3EA6A 3JW0X 4GLSC 4D2KA 3M62B 4ZRIA 4BAXA 3JYUA 1DOYA 1BUIC 2BS4B 3PS6A 3B0AA 2C7NB 2INDC 4BKTA 3T3OA 4W9CA 2ZZPB 1WXMA 3T3NA 3A9JB 3UINB 2RD0A 1SBBB 3I63C 4ZOHC 2HJ8A 1WR1A 4K81A 2WWZA 2ZNVB 4RGNA 2L0FA 3RD2A 3U8ZA 2J0KA 1MG4A 3N1ZC 3NZ3A 5EE1A 3U2SC 2ZCBA 3N3KB 4RF1A 2WXOA 3EFCA 3Q3OC 3TL5A 4W9EA 5EE0A 1AYFA 4WQOB 3RNBC 4IWOA 2L7RA 1WGHA 1EU3A 4C00A 4LDTB 1YX6B 2X8XX 1WXAA 1JROA 2EELA 3NVWA 3WANA 1FXTB 4AJYB 1P0RA 1FIQA 4A90A 3TCAA 1F9JA 4OW0A 1XCTL 3W1SA 2L1AA 3ZYYX 2WHIA 3V6CB 2MBEA 3N9YC 5C3JB 3ZJUA 2MBBB 3MHZA 2D11A 2PVGC 3M3JA 1WGGA 3AE2B 5D6JB 3VTVA 4ZRJA 2KAJA 3EECA 1L4DB 2WS3B 3Q14C 3ZTDA 3Q2AC 1TT5B 4P1CC 4S17A 5DCNA 2FIDA 3PT2B 4IWPA 4CHKA 3QJZA 5CX3A 1WXQA 4DBGA 3EHVA 2WX0A 1ACCA 2KYWA 1KH0A 4G50A 4RM8A 1GAQB 3IFWB 3FILB 2KD0A 3A1QB 1JW9D 3URYA 3AE3B 2C5LC 1BXTA 2OJWA 3R3MA 2ON8A 4E3CA 1V49A 4UDUC 3PPAA 2RGFA 4HPMB 4REZA 4HLEA 4GDKB 1TS2A 2JT4B 1I7HA 3TEXA 4XDCA 2BQQA 2BWFA 4HEA1 1L6VA 2HTHA 3P63A 4C80A 3QWZB 3ZJVA 3U4EG 2ZNVC 4YTNB 1E8XA 1NI3A 2INCC 2V3SA 2KDMA 2DNFA 3ZGZA 3WA0A 4JPSA 4K7SA 4LNOA 3VTWA 1VCBA 1XF5L 4NAWA 2JUOA 4US9A 1AW7A 1FCCC 5FR3A 1WRDB 1YN3A 3B08A 4K1RB 1UWXA 3W5UB 4RGMA 1IGCA 1FMAD 2D2QA 1CMXB 3OG5A 4HKQA 2BGFA 1WWTA 1I4RA 1LM8B 2NMQA 4K7WA 2AQ1B 2PKOA 3BVMA 2ZPNA 3O13A 4ZRKA 2IY0B 5CHWA 2INNE 4MDKE 3V60A 4PS7A 3P4RB 2AQ2B 1X1MA 3DBRI 4EZLA 4JWUC 2GOWA 2DWQA 4KSLC 3KWLA 3FAHA 3Q3FA 1V1OA 2N1VA 2ACZB 3H1UA 1V5OA 3ABVB 4GXBA 1V8CA 1R4MB 3ZJTA 4W9IA 2RPQA 1Z2MA 1QLBB 1UGMA 2NBWB 3QA8A 2HD5B 2JU6X 1OFFA 1VR9A 2AEHA 2AWTA 5EE9A 1E8WA 2N9EB 2IY1B 3AE9B 2DAFA 2QHOA 1HXYD 2I1JA 1P98A 2N0SB 1T5XD 1NYRA 3H8HA 4MGZE 3SR6A 1YJJA 1ET9A 3IHPC 2JF5A 4FJYA 4OZCA 4LTUA 1PUTA 5JZEB 1CZPA 4GSWA 1V6EA 2KT7A 4W9FA 4AJWA 1UF0A 2G45B 4NAMA 3ONSA 3PSEB 3MC0B 3NHEB 4OVVA 1V81A 1MVKA 1I4XA 3L08A 2JZZA 4TKNA 2XK5A 2FBWB 3HVDA 1PGAA 4PYUA 4W9JA 1L7YA 1ZUD2 4A3OA 3P4SB 5LNK1 2W3SA 1JWMD 2MW5A 2RDHA 2KNBA 1IYFA 3IBEA 3NY5A 2CHXA 5E6JA 2FUHB 4XX5A 4MGYE 2MBQA 2LVOA 2M56B 3A4RA 1SE9A 3BVZA 3HVZA 1XLQA 3VHTC 1P9DU 3AU4A 2BPSA 1FNUA 3IAM1 3R7RA 1D4BA 2FAZA 2WP9B 2FCSA 4NAWB 1WZ0A 3RZFA 2D07B 1D5MC 3I5JC 4GB9A 2JSVX 4EEWA 4OHJA 1K53A 1KLUD 4ZRQA 2CS4A 4GGQA 5MPOA 3KLSX 2NCNA 2BBCA 3ML9A 4JGHB 1C4AA 1FNWA 2TSSA 5C23A 4F1SA 2D3BA 2CU1A 3W1SC 3RFZB 2MLBA 2I1KA 1PYWD 1GOZA 4RM9A 2AL3A 1T0SC 1KM7A 1WE6A 2FE8A 4FULA 2BB6A 1N6ZA 5CHVC 2K0PA 3WAOA 5E6PA 1EWCA 2WU2B 2QC8A 2ZPYA 2QILA 1M94A 2DYOA 4LCDE 3UF8A 3MFGA 3RUIB 1C9FA 3GP7A 4MH0E 3RZWC 2JYTA 1RYJA 1WMHA 3VTUA 1F2RC 2WXFA 2BKRB 2KQSA 2PPHA 1I4PA 2NS5A 4IM0A 3S2AA 2WYQA 4F8CB 4TQ0A 2M4NA 4TV3A 3ZTCA 2VH2A 2RPVA 3R2IA 2WXMA 4ZYSA 4GU2A 1E9MA 5DPTA 3QHTA 4L23A 4BBNF 2LJ5A 2W54A 2KWVB 1ESFA 1PGXA 2L32A 3U30A 2A5UA 2FIFA 2DLBA 4ANUA 4MH8A 3RCZA 5L95C 2XK5B 4B95A 1EWYC 3CF6E 2NTTA 3CSFA 2K22A 4MGKE 1N62A 4W9LA 4HCNB 1XLPA 3VAWA 2M0XA 3ZUNA 1R4MI 2NR2A 3SHQA 4CYEA 3VR8B 2K3UA 1OEYJ 3P2BA 2NPTA 1DOIA 5TR5A 5BYRA 4ARCA 2ASQA 3Q8FA 2BYTA 3AE7B 3ZW3A 1ZW7A 3EGRA 4HVBA 3JVZX 4DHZB 1ET6A 1GNUA 4RGTA 2KDIA 3PHWB 1RLFA 2MBOA 1YOVB 4YSZB 5IP4D 4LNIA 4C4VA 3AEGB 3N30A 1AARA 3AE8B 2IO3B 1MJDA 3H9DA 1I35A 5HI1A 2DYBA 4FJVB 3DHGC 4KGTA 2K9XA 2KWUB 1AN8A 2JY6A 1GB4A 1F2RI 1C78A 5E6OA 5IAAC 4C56C 1EUVB 4FHKA 1FRDA 3APDA 4WWMA 3DOWA 1XLNA 2K25A 2JX5A 1J7AA 4KGSA 4K7UA 4ANWA 2BYVE 4ZHPA 2KFJA 2K8BA 3P1MA 1TKGA 1WE7A 3ZNGC 3VR9B 1WJNA 3KYDD 2GB1A 1A70A 2D10A 1R7SA 4BFRA 3NVVA 4EUTA 2ZVNA 1EM7A 2WU5B 2SAKA 1PFDA 1VZ7A 1IPGA 2YVCA 3AE6B 3A4SC 2BTEA 2QDFA 1WMHB 4DXFA 3KH0A 3HIZA 4TMAB 2KWCA 1SE3A 3WAPA 4MELA 1L0YB 1SEBD 4IG7B 2KTRA 5IO9A 2KMAA 1LQBA 1JCKB 3IT6B 2K8CA 5CTRC 4DK5A 5EE3A 4B9KA 3JSVA 4KKIA 3CMMB 3IT4B 4ANXA 1HA5A 2KK8A 5D3IB 2VZKD 1ZE3D 3IG3A 4ACFA 4LNKA 4M0WA 2EKIA 1E5WA 1T6BX 3Q8EA 5TSSA 3NRZA 3C19A 2DZIA 1D3ZA 2PLPA 3SU8X 2K5PA 3L10B 2O6VA 2BB5A 4I6NB 1SE4A 3NVZA 2JPHA 1WX9A 2B3AA 2UU7A 3B2GA 2CR5A 3IVFA 3SD5A 2WXPA 3ALBA 2N9PC 2FNJB 2NPTB 2KHWB 3ZRCA 3V61A 2WXRA 2WDTB 2QCZA 3NS8A 2DAJA 2N1WA 2CJOA 1WF9A 4WH4A 3LB8C 1BMLC 2DZMA 2KDBA 1MPEA 2X38A 5G5GA 5AZHA 5AUIA 3TEYA 1UBQA 3Q8AA 3TBLD 1QKZA 4EZKA 5JHBA 3N32A 1UUPA 1GC7A 4C4VB 1EF1A 3BZDB 1V97A 2ZEQA 5FKAC 1VDVA 2XNAC 3RMKC 3BK1A 1QOFA 2UWQA 2KZRA 1TS3A 4RFBA 3NZUA 4A55A 2LVQA 1TY2A 2R61A 3DQVA 4CQNA 2IZVB 4GDLA 2K39A 1E7VA 2MWSB 1MFWA 2DZJA 1ZGUB 4WAAA 2ZW0A 1FFVA 2N9KA 5C2TB 1YN4A 4AQ7A 2FUG1 5AUKA 4LDTD 2KJRA 1UELA 3RNGC 3NVYA 3KQ4A 1RRBA 1PQSA 4WJNA 1TBEA 2JWUA 1FFUA 2H88B 4MM3A 1T3QA 3WALA 2Y5CA 4AS1A 1HZ5A 4KIKA 3IAS1 3L13A 2KN5A 2RR9A 3BYTB 1B9RA 2KTRB 2AYOB 2LASA 5G5HA 3R2TA 3UI3A 1NDDA 5AZFA 4W9KA 2KFKA 1OTRB 4HJKA 1LGRA 4ARIA 3Q3MC 4YTMB 4AOFA 1TS4A 1I42A 2LJIA 5KHQA 4II3B 3JSVB 2ZCCA 2REXA 4JWSC 1WFYA 2HJ1A 1VRAB 4JL9A 3AULA 3DWGC 2GMIC 5KHOA 4M0WB 2L76A 2D3AA 3MHSD 2QJLA 1ZP0B 1WRIA 3GOEA 3W2DA 4ASWC 5D3DA 2O6VB 3TEZA 2HE7A 4P7IA 3X23A 5CHFA 3LYYA 1DOXA 2LFIA 2J0JA 3VRAB 4O1NA 1LFDA 4N59A 2WDQB 3ENEA 2RDGA 5HHDG 2ICIA 3T9LA 3K9PB 1E8YA 1Y56A 1ROEA 3GE3C 5AEKB 1MHHE 4XE0A 3MJWA 1JWAD 1N63A 2KX0A 5BMIA 1G6JA 2OEDA 4G3XB 3NOBA 4JX1C 1D5ZC 2IBIB 4MSQB 1QOAA 5G55A 2WXKA 2O2VA 1TS5A 2AQ3B 3AEEB 1GPXA 3OLMD 2LGSA 4RMAA 1XEEA 2ONQA 4OVUA 2O6VD 2HDEA 5D94A 2WXNA 1I4GA 1F1HA 4EFOA 4KVGB 2FCNA 2YLMA 1F52A 4PYZA 1YMHE 1TKEA 3PVLA 4DXGA 3QX1A 1IBXA 2M1MA 1JALA 1QQRA 2JRIB 3OJ4B 2EMSA 2Z8LA 4GDLB 3B2FA 1WJUA 3Q8BA 3RNCC 3ZNHB 1V86A 5J17A 1TZ1A 2MRPA 3B1LX 2G4DB 1HTOA 3KW5B 3ZXVA 2KVRA 3SFEB 4NJ6A 4YSYB 4OVZA 2I38A 4WWNA 4LK0M 4M8NA 3C0RB 4MM3B 3L17A 4MT5A 1ZDVA 5FR6A 1GG3A 1WM2A 2AX5A 2OJRA 1IUEA 3U7DA 3UIPB 3UQBA 3PO0A 4KIKB 2INPE 1VJKA 4IKGA 2WXHA 2IGGA 2JVCA 1V1PA 4NJCA 5IN7A 4BKSA 2KFKB 2Q5WD 3LDZE 2ZW1A 4DQOC 4K3CA 3DPDA 3AECB 1YJIA 3FKYA 4X57B 4ICVA 2JZPA 1D6EC 1YNTE 1JWSD 2NBVB 2B76B 2PMVA 4P6VF 1QT9A 4XGAB 1OQRA 2PW9A 2PTLA 1NVID 5HFYA 3APCA 2E3TA 1SE2A 3Q6BA 2V4LA 4OZBA 3AXCA 3TMPB 2DENB 2NBUA 3W5VB 2LUMA 2K8HA 2LXAA 1UNSA 3PRZA 1WZ3A 2JWZA 3HK0A 3GS2A 1WGRA 4WJQA 3H7SA 3Q3JA 3NS1A 5GXGB 3DBLB 2MBHA 1TKYA 1WX7A 2D3CA 2ZVOA 1YQ3B 4N6EB 1F0ZA 2MSED 1FXAA 3DVNV 1UBIA 2GBKA 1WGKA 3DHHC 2WXIA 3L4PA 2CJNA 1FO4A 3PZ7A 1XXGA 5GMVA 2N7DA 2VH1A 3K9OB 4LNFA 5LXIB 2BYFA 3RPFC 5BO4B 2XN9C 3Q3NC 2XEWA 4HK2A 3EFUA 4BVUC 3BVGA 4IOIE 3TEWA 2D3GA 1TYGB 5DPSA 4HCPB 4BBNC 3ZLZA 1C1YB 3BIID 1E10A 1TIFA 4NJ7A 4XWTA 5J18A 1IBXB 1Q10A 4JE3B 4DDID 3AEDB 4W9DA 1WYWB 1P7FA 1KTKA 3DVNU 2LUEA 3FC4A 1L6UA 1OQQA 3VUXA 2LHDA 2L8JA 4L1BA 3AE5B 3PLUA 1V80A 2BWES 4URKA 4AP4C 4ANVA 4B0MA 2KJHB 1P3QU 1CQVA 2LGYA 1GC6A 1FEHA 3U52E 4MSMB 4G0NB 4KSKC 5BMHA 2J4XA 4PS8A 5AZGA 2M8SA 3AM9A 2J42A 3TJPA 1BT0A 2KMCA 1J0GA 2EMTA 3VFKA 3KVFB 2KDEB 2C60A 1EF5A 1VZ8A 5FK9C 4HKZE 1V1PB 4A6QA 3ZVVA 3ZDTA 2KJ6A 4YT0B 3AB5A 3AEBB 2LMCA 2DHZA 2WXJA 4K3BA 5T8IA 4BZAA 1DGJA 1QOGA 4JQWC 2V9HA 4RH6A 1XT9B 2G1EA 3V05A 4F7ZA 2R2QA 4J6IA 3AI5A 2J53A 4MJSA 1WI0A 1K51A 2JYEA 1K52A 2ZJDA 3ZQ4A 1L5PA 1AWDA 1WR6E 1XLOA 3P42A 1WIAA 5D7GA 1STEA 2CHWA 5J2RA 3RNAC 3TSSA 2FCQA 1F77A 5BMGA 2BS3B 3ZO5B 1N60A 1Q5WB 4LLGM 1A5RA 1H8CA 3W1YA 4QAYA 3PZ8A 3I57A 5BYQA 2BS2B 4YL8A 1V9JA 4WWPA 1EO6A 3MTNB 1FXIA 4NY0A 2L3ZA 1YIWA 4KX6B 1NBFC 4WJOA 2J7QB 2MJEA 3FILA 1WXVA 3DBHB 3A1QA 4BKGA 2MP2A 1QZEA 3O65B 4P16A 1RWSA 3UQAA 4HPPA 1J8CA 5IKCM 2LXCA 2W9NA 3NJTA 4FJZA 1Q1OA 4M02A 1E6EB 1KOTA 1RAXA 2WNMA 4WWOA 2KANA 1WJ6A 1JMLA 1D5XC 3V62A 2LWPA 3DDCB 2WXQA 4HDOA 2MH7A 4S0RA 3DBLI 5H8YE 4GIVA 4HJGE 3Q8CA 1Y8RC 3AH7A 2YEPB 2WXGA 4JIOU 4NNJB 2WDRB 1I4QA 4M00A 4A20A 3ML8A 1ISNA 2FCMA 1TZOA 2WQYB 4HRSA 2L00B 2N9XA 1DYQA 3ETRA 1RM6C 4N58A 1N5XA 3MP9A 2KLGA 5DPRA 2WXLA 4EKUA 2GRIA 2KC2A 1VD2A 2RDBC 1MHXA 4USAA 3RT3B 4C7YA 2MEKA 3VDZA 3KUZA 4BOSC 2K6DB 1LXDA 2K6QA 3HM6X 4KDIC 3GB1A 2KQ4X 2BVCA 1YQ4B 5JHAA 1C4PA 3ZXRA 2PVOD 3N1XC 1HZ6A 3IXSA 1XCQL 2E6XA 5L83A 4IC7B 4KV2A 5H92C 4E74A 4MJSB 1QF6A 1UD7A 3SFDB 4II2B 1H4RA 4IDIA 2BF8B 1SB3C 3DVGX 1C79A 1PDXA 3D32A 1L0VB 3PLVA 3AN1A 3BINA 3KUCB 1V2YA 3NG0A 2MHJA 4ITKA 3MC9A 1SXTA 2EKEC 3C8YA 1R4NB 2KACA 2KDFB 2KWDA 1XQQA 1YD8U 3KWVA 5DPWA 3QQ8B 3R66C 2GBMA 1C3TA 2GBJA 4FADA 2PE6B 1KFYB 2V1YA 1UZXB 3PRPB 2HTME 4HDQA 4FLHA 3VQIA 1FRRA 3GE8C 2IO1B 2GLSA 3CIRB 2QMTA 4GN1A 2CKHB 1WGYA 2JRHA 2LD9A 2MP2B 1WM3A 3OAWA 2YEPF 3I3TB 1ENFA 1P7EA 4M01A 2VRRB 1YN5A 4R3DA 2Y5PA 4YWGG 2UYZB 2Y5BB 3QC8B 2PIAA 2KLCA 3X0WA 3A9KA 1YQBA 1B1ZA 4MEMA 4L2YA 2V4IB 2C7MB 2QIEB 2IGHA 1ZXHA 1OGWA 2MQJA 2KKCA 1PGBA 3RNFC 3M63B 2R2OA 3TUOA 1E7PB 3QIJA 1S1QB 1T0YA 1L2NA 2D5GA 2MX2A 1CJEA 2KVZA 3PZDA 1KLGD 3MC8A 2GI9A 4WURA 3L54A 4B0EA 1K50A 3V3XA 1CK1A 2LI5A 1I4HA 2LZ6A 4G11A 4TUUA 3KYCD 2N9LA 3L16A 2GBRA 1ZDXA 3V6EB 4W9GA 3HRDD 4GOCA 3DBHI 1SIFA 5JXVA 4XDDA 2Z0EB 3R8BA 3PTFC 4YTPB 4B6WA 1E0ZA 3U7ZA 1L0XB 2IDYA 1ZKHA 2SEBD 4M8MA 4ZRPA 1ZOYB 5IOIA 3N1YC 1J19A 1U4AA 3GZNB 2A4ZA 4CO7A 3BY4B 4C7ZA 1WGDA 2L83A 4WJPA 3ZNZB 3ZIMA 3N20C 3Q69A 1WXSA 3RI7C 3PREA 1E7UA 4XC2A 4AUQC 2G9HD 1TGZB 2IGDA 2IO2B 3PRMB 3VH3B 3NUHB 2PEAA 2KN4A 1QILA 1K8RB 1C76A 1HEZE 1WY8A 1T0RC 2KXJA 3RNEC 4EZJA 1VZ6A 1TY0A 2LRUA 4WQMA 1RFAA 4LJPB 2W82A 1UGJA 2CHZA 3PHXB 4RNAA 1QOBA 2C7HA 4FBJB 3DBSA 1WSPA 5D2MB 3BK2A 4DHZE 2MJ3A 2JQRB 1T0QC 2JZ3B 2BW2A 3VRBB 4XZ4A 1NYQA 3MJ5A 3B9JA 2QEJC 5HKHA 3AMZA 5E6NA 2LRWA 1JWBD 2CU3A 5HG2A 2J0MA 1UH6A 4ZDVA 4E71A 1HTQA 2KX3A 5BYSA 1C77A 2K1FA 1C4CA 2RMMA 2DBYA 2M17A 1GJZA 1IGDA 2NTSA 2KQ7A 1IP9A 3VUWA 1YX5B 4IWQA 4RGOS 2L05A 4J3OD 1HE8A 4FA6A 4KZ0A 4LJOB 2I2YA 1FM0D 3A9KB 3WIMA 4KDLB 3CSTA 3M95A 4PT5A 1FNVA 2GBNA 4RCOA 2LGIA 1R4NI 1KF6B 1EU4A 4A3PA 4KGRA 1N5WA 3R7QA 2KO3A 2WLBA 3UIOB 3P4PB 1Q0WB 1FCLA 3BYYB 4MACA 5I4DA 2IO0B 4GMVA 5LXHA 1SSNA 1WJ4A 2G4SA 4H2AA 3TIXA 1UWMA 3DCGA 4P1BC 1S3SG 1NI2A 4HROA 4XWWA 1E90A 4YXDB 1GB1A 1JRUA 3VUYA 4IUMB 4EE2A 1NEKB 1OQYA 2L0TA 2V3PA 5LLIA 2Z0DB 1TJEA 1J7BA 3AV8A 2O2VB 2WDVB 4IW0A 2M0AA 5JH5C 3ZNID 1E8ZA 3ZKJC 3H7PA 4IM3A 4LNNA 4PK1A 2N7EA 2KOXA 2BYEA 3OJ3A 1YJ1A 2IJ0A 4DHJB 3QAQA 4TSSA 4DWFA 4EOYA 3RN9C 3SDLC 1JQ4A 4JLCA 3DHIC 2C9WB 1KLVA 3AE1B 2N7JA 2W3RA 4WIPA 3EUB2 5IA7A 1TTNA 1SJHD 4IM2A 4A8XC 2XBBC 2LEKA 3HHMA 3LXFA 4FN2A 3HUIA 2MA9B 2LGDA 4TQ1A 3W9CB 1SGHA 2M19A 3VVWB 3KUDB 4NQLB 4W9HA 3WCQA 1FPYA 1SJED 3LJ3A 2J52A 1J7CA 3E56A 3RYTA 3GZNI 3APFA 1OEYA 1HQRD 4MGIE 2RSUA 2LHEA 3SEBA 1NENB 2PE9A 4BOZB 2V3NA 4DHJD 2WGSA 4WAFA 3A9JA 3PGEA 4RF0A 4ZHOA 2Y3AA 4NZLB 1ZXIA 2QSDA 3HM3A 3NZSA 2JXTA 1L4ZB 2L52A 5G2NA 4ICUA 4PS3A 4XYCA 4Q2JA 2IYDB 4US8A 3DWMA 4OZAA 2IPKD 3QARA 3A33B 1SIJA 3QCAA 4KZCA 2DYMA 5EDSA 1JRPA 4DDGD 4I6LB 3RULA 3OWEB 2PJHA 4NQKE 1LO5D 1ZPSA 3VH4B 2DZKA
chains in the Genus database with same CATH topology
2BF8B 3DVGX 2JXXA 4HPLB 5G55A 2O2VA 3DVGY 3WAOA 4BKSD 1XD3B 2OOBB 1MG8A 1KJTA 3OLMD 4ZYNA 2AL6A 2Z59B 3D32A 3PLVA 5E6PA 4HXDA 4RMAA 3QK0A 5CHVC 3BINA 4HWIB 3KUCB 2ZPYA 4N9F4 3PV1A 1V2YA 4OVUA 1M94A 2LVPA 3L0WB 2O6VD 2DYOA 1P1AA 4LCDE 5D94A 2EKEC 4AWJA 3UF8A 3RUIB 2KDFB 2DX5B 1XQQA 2NVUI 4KVGB 4MH0E 1YD8U 3RZWC 4EFOA 2FCNA 2YLMA 1WMHA 3VTUA 5DPWA 3QQ8B 2KC1A 4PYZA 3R66C 2GBMA 3PVLA 1GUAB 3QX1A 2BKRB 2GBJA 1C3TA 2M1MA 2KQSA 2PPHA 3H7PB 4FADA 2JRIB 3OJ4B 2EMSA 2PE6B 4GDLB 4DXAB 2NS5A 3ZRFA 1V5TA 2V1YA 3ECIA 4IM0A 2WX1A 1WJUA 4NPNA 2WYQA 2MCNB 1UZXB 2G3QB 3S2AA 1WH3A 3VXWA 2M4NA 3PRPB 4TV3A 4TQ0A 4HDQA 3ZNHB 1V86A 5J17A 4FLHA 3ZTCA 1TZ1A 3VQIA 2MRPA 3B1LX 3EC8A 4GDKA 2N4FA 2G4DB 3WAMA 3KW5B 2IO1B 2KVRA 4GU2A 5DPTA 4NJ6A 3ZDMC 2LGXA 4GN1A 2CKHB 1WGYA 2JRHA 3QHTA 2LD9A 2MP2B 1WM3A 2LJ5A 3OAWA 4BBNF 4WWNA 3I3TB 4M8NA 3C0RB 2KWVB 3L17A 2KTFA 3UGBB 1WX8A 2VRRB 5FR6A 5C1ZA 3U30A 1GG3A 2A5UA 1WM2A 2OJRA 2BKFA 2FIFA 2UYZB 1Z5SB 2Y5BB 4I6PA 3U7DA 4ANUA 3QC8B 3AU5A 3RCZA 2KLCA 3X0WA 3A9KA 1YQBA 3UIPB 3UQBA 5L95C 4FHJA 2XK5B 3H6NA 4MEMA 3T8MA 4B95A 4KIKB 3CF6E 3JW0X 2C7MB 3CSFA 3M62B 4MGKE 4ZRIA 2MQJA 1OGWA 3JYUA 4W9LA 4HCNB 2KKCA 3PS6A 3VAWA 3B0AA 2M0XA 3ZUNA 2JVCA 1R4MI 3M63B 2NR2A 2C7NB 2R2OA 3QIJA 4BKTA 4BKSA 1S1QB 2KFKB 3SHQA 1T0YA 4CYEA 1L2NA 3LDZE 2MX2A 3PZDA 4W9CA 2ZZPB 3DPDA 1WXMA 4X57B 1OEYJ 4ICVA 3L54A 2NPTA 3A9JB 3P2BA 2RD0A 3UINB 2NBVB 5TR5A 2LI5A 2ASQA 2LZ6A 4G11A 2HJ8A 1WR1A 4K81A 2WWZA 3ZW3A 4TUUA 3KYCD 1ZW7A 2ZNVB 3L16A 2L0FA 3APCA 3RD2A 2GBRA 3U8ZA 2J0KA 4HVBA 3JVZX 3V6EB 4DHZB 4W9GA 1GNUA 4GOCA 3DBHI 2KDIA 2ZCBA 3N3KB 1SIFA 1RLFA 3PHWB 2V4LA 2MBOA 3AXCA 3TL5A 2Z0EB 3TMPB 3PTFC 2DENB 4W9EA 4B6WA 2NBUA 4WQOB 4IWOA 3N30A 2L7RA 1WGHA 1AARA 2IO3B 2K8HA 4MSQB 2LXAA 1ZKHA 3H9DA 4LDTB 3PRZA 4M8MA 1I35A 1YX6B 1WZ3A 2DYBA 4FJVB 1J19A 1WXAA 2JWZA 2KWUB 3HK0A 1U4AA 1WGRA 2A4ZA 4CO7A 3BY4B 2JY6A 1WGDA 3H7SA 4WJQA 3WANA 3Q3JA 4WJPA 3ZNZB 1FXTB 4AJYB 5E6OA 5IAAC 3ZIMA 1P0RA 2MBHA 1WXSA 3PREA 1EUVB 1E7UA 3TCAA 1F9JA 4FHKA 1WX7A 4XC2A 4AUQC 2ZVOA 1TGZB 3W1SA 3APDA 2IO2B 3PRMB 2MSED 3DOWA 3VH3B 3DVNV 2K25A 1UBIA 2PEAA 3V6CB 2GBKA 2MBEA 4K7UA 4ANWA 1K8RB 2BYVE 1WY8A 2MBBB 2KFJA 2D11A 2K8BA 2KXJA 3M3JA 4EZJA 1WGGA 5GMVA 1WE7A 3ZNGC 2LRUA 1WJNA 2N7DA 3KYDD 3K9OB 5D6JB 1RFAA 3VTVA 5LXIB 2BYFA 2D10A 4ZRJA 5BO4B 3EECA 2XEWA 3ZTDA 4LJPB 4BFRA 4HK2A 4EUTA 2CHZA 2ZVNA 3EFUA 3PHXB 4BVUC 2C7HA 5DCNA 4FBJB 2FIDA 3DBSA 2D3GA 1IPGA 5D2MB 2YVCA 3PT2B 4IWPA 3QJZA 5CX3A 4CHKA 4DBGA 4DHZE 3A4SC 5DPSA 3EHVA 4HCPB 4BBNC 2WX0A 3ZLZA 1C1YB 1WMHB 4G50A 3KH0A 4RM8A 2JZ3B 3HIZA 4NJ7A 3IFWB 5J18A 4XZ4A 5HKHA 2KWCA 5E6NA 2KD0A 2LRWA 4DDID 3A1QB 3WAPA 4W9DA 2J0MA 1WYWB 2C5LC 1UH6A 4MELA 4ZDVA 3DVNU 4E71A 2LUEA 2KX3A 4IG7B 3R3MA 2K1FA 2KTRA 4E3CA 1V49A 2KMAA 3PPAA 1LQBA 2RGFA 4HPMB 4HLEA 4GDKB 3VUXA 2M17A 2JT4B 2L8JA 3PLUA 1GJZA 2K8CA 5CTRC 4DK5A 1V80A 2BWES 2BWFA 4AP4C 4ANVA 4URKA 2KQ7A 2KJHB 4B9KA 1IP9A 3JSVA 1YX5B 1P3QU 2HTHA 3VUWA 4IWQA 3QWZB 3CMMB 2LGYA 4ANXA 1GC6A 2KK8A 2L05A 2ZNVC 1HE8A 4FA6A 1E8XA 4MSMB 2V3SA 3IG3A 4G0NB 4KZ0A 3WA0A 4KSKC 4K7SA 4LJOB 3VTWA 1E5WA 4PS8A 5AZGA 1VCBA 3A9KB 3WIMA 4KDLB 3CSTA 2DZIA 2M8SA 4NAWA 3M95A 2JUOA 3TJPA 1D3ZA 3SU8X 1BT0A 2KMCA 1J0GA 3L10B 2O6VA 2EMTA 2GBNA 4I6NB 3VFKA 3KVFB 1R4NI 2KDEB 2C60A 1EF5A 4A3PA 2JPHA 1WRDB 1WX9A 3B08A 4K1RB 3R7QA 2KO3A 3ZVVA 2B3AA 3ZDTA 3UIOB 2KJ6A 2CR5A 3IVFA 3SD5A 1Q0WB 2DHZA 3ALBA 4F8CB 2N9PC 2D2QA 2FNJB 2NPTB 2KHWB 3ZRCA 1CMXB 2IO0B 3V61A 2WDTB 3NS8A 4GMVA 2BGFA 5LXHA 2DAJA 2N1WA 4JQWC 1WF9A 1LM8B 1WJ4A 1XT9B 2DZMA 2G4SA 2KDBA 4F7ZA 2R2QA 4J6IA 4K7WA 3AI5A 3TIXA 5AZHA 1UBQA 2ZPNA 3DCGA 4ZRKA 2IY0B 3TBLD 5CHWA 4MJSA 1S3SG 1NI2A 4MDKE 4EZKA 1E90A 3V60A 5JHBA 3N32A 1WI0A 4PS7A 1X1MA 3DBRI 1JRUA 1GC7A 1EF1A 2ZJDA 4EZLA 3VUYA 2GOWA 4KSLC 4IUMB 2ZEQA 1WR6E 3Q3FA 1WIAA 2N1VA 5D7GA 3H1UA 1OQYA 2CHWA 2L0TA 5J2RA 1V5OA 4GXBA 5LLIA 2Z0DB 2FCQA 2UWQA 2O2VB 4IW0A 2KZRA 4W9IA 2RPQA 3NZUA 1Z2MA 3ZO5B 5JH5C 2LVQA 3ZNID 1UGMA 2NBWB 3QA8A 1E8ZA 3DQVA 1Q5WB 2IZVB 1A5RA 1H8CA 3ZKJC 2HD5B 3H7PA 4IM3A 3W1YA 4GDLA 2AEHA 2K39A 2N7EA 2KOXA 2BYEA 1E7VA 2AWTA 2MWSB 1E8WA 4YL8A 2DZJA 1ZGUB 1V9JA 4WAAA 4WWPA 1YJ1A 1EO6A 2IY1B 2N9EB 3MTNB 3OJ3A 3QAQA 4DHJB 4DWFA 2DAFA 4BOSC 4EOYA 4NY0A 2QHOA 2L3ZA 1YIWA 2I1JA 1P98A 3SDLC 4LDTD 2KJRA 1UELA 4JLCA 4MGZE 2C9WB 1KLVA 3IHPC 2JF5A 4FJYA 1NBFC 1RRBA 4WJOA 1PQSA 2J7QB 4WJNA 1WXVA 5IA7A 1TTNA 3A1QA 4IM2A 4BKGA 2MP2A 1QZEA 1TBEA 2XBBC 5JZEB 3O65B 3HHMA 4GSWA 1V6EA 4W9FA 4AJWA 4FN2A 4MM3A 2MA9B 3UQAA 1J8CA 2G45B 2LGDA 3ONSA 2LXCA 3PSEB 3NHEB 4OVVA 2W9NA 4TQ1A 3WALA 4FJZA 1SGHA 1V81A 3VVWB 3KUDB 4NQLB 3L08A 2JZZA 4TKNA 1Q1OA 4W9HA 2XK5A 1KOTA 1RAXA 4KIKA 3L13A 4WWOA 2KANA 2KN5A 1WJ6A 2RR9A 4W9JA 3LJ3A 4PYUA 1L7YA 3V62A 4A3OA 2LWPA 3RYTA 3GZNI 2MW5A 1OEYA 2KNBA 2KTRB 3APFA 2AYOB 2LASA 3DDCB 1IYFA 4HDOA 3IBEA 4MGIE 2RSUA 1NDDA 3NY5A 5AZFA 4W9KA 2CHXA 2KFKA 3DBLI 1OTRB 4HJKA 4GIVA 2FUHB 4XX5A 2PE9A 1Y8RC 4AOFA 4MGYE 4BOZB 1I42A 2MBQA 4DHJD 5KHQA 4JIOU 2LVOA 3A9JA 4II3B 3JSVB 4NNJB 2ZCCA 4A20A 2REXA 3PGEA 3A4RA 1WFYA 1SE9A 3ML8A 1ISNA 4JL9A 3VHTC 1P9DU 3AU4A 2BPSA 3AULA 2GMIC 3HM3A 3NZSA 5KHOA 2FCMA 4M0WB 3R7RA 5G2NA 2L76A 2L00B 3MHSD 2N9XA 2FAZA 4ICUA 4PS3A 2FCSA 3GOEA 4NAWB 1WZ0A 3RZFA 4ASWC 2D07B 2O6VB 2IYDB 2HE7A 4GB9A 4EEWA 2KLGA 5DPRA 4P7IA 3X23A 5CHFA 4EKUA 2KC2A 2CS4A 3QARA 4GGQA 1VD2A 2J0JA 3A33B 1LFDA 3ENEA 2NCNA 3RT3B 3QCAA 3VDZA 3ML9A 3KUZA 4KZCA 4JGHB 3K9PB 2K6DB 1LXDA 2K6QA 3HM6X 1E8YA 5C23A 3T9LA 4F1SA 4KDIC 2DYMA 5EDSA 2CU1A 3W1SC 2MLBA 5AEKB 5JHAA 2I1KA 4DDGD 4I6LB 3MJWA 3RULA 2KX0A 2PJHA 4NQKE 4RM9A 2AL3A 5L83A 3VH4B 1KM7A 4IC7B 1G6JA 4KV2A 1WE6A 4E74A 4FULA 4G3XB 3NOBA 4MJSB 1UD7A 2DZKA 2IBIB 4II2B 1H4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BF8 B;  3DVG X;  2JXX A;  4HPL B;  5G55 A;  2O2V A;  3DVG Y;  3WAO A;  4BKS D;  1XD3 B;  2OOB B;  1MG8 A;  1KJT A;  3OLM D;  4ZYN A;  2AL6 A;  2Z59 B;  3D32 A;  3PLV A;  5E6P A;  4HXD A;  4RMA A;  3QK0 A;  5CHV C;  3BIN A;  4HWI B;  3KUC B;  2ZPY A;  4N9F 4;  3PV1 A;  1V2Y A;  4OVU A;  1M94 A;  2LVP A;  3L0W B;  2O6V D;  2DYO A;  1P1A A;  4LCD E;  5D94 A;  2EKE C;  4AWJ A;  3UF8 A;  3RUI B;  2KDF B;  2DX5 B;  1XQQ A;  2NVU I;  4KVG B;  4MH0 E;  1YD8 U;  3RZW C;  4EFO A;  2FCN A;  2YLM A;  1WMH A;  3VTU A;  5DPW A;  3QQ8 B;  2KC1 A;  4PYZ A;  3R66 C;  2GBM A;  3PVL A;  1GUA B;  3QX1 A;  2BKR B;  2GBJ A;  1C3T A;  2M1M A;  2KQS A;  2PPH A;  3H7P B;  4FAD A;  2JRI B;  3OJ4 B;  2EMS A;  2PE6 B;  4GDL B;  4DXA B;  2NS5 A;  3ZRF A;  1V5T A;  2V1Y A;  3ECI A;  4IM0 A;  2WX1 A;  1WJU A;  4NPN A;  2WYQ A;  2MCN B;  1UZX B;  2G3Q B;  3S2A A;  1WH3 A;  3VXW A;  2M4N A;  3PRP B;  4TV3 A;  4TQ0 A;  4HDQ A;  3ZNH B;  1V86 A;  5J17 A;  4FLH A;  3ZTC A;  1TZ1 A;  3VQI A;  2MRP A;  3B1L X;  3EC8 A;  4GDK A;  2N4F A;  2G4D B;  3WAM A;  3KW5 B;  2IO1 B;  2KVR A;  4GU2 A;  5DPT A;  4NJ6 A;  3ZDM C;  2LGX A;  4GN1 A;  2CKH B;  1WGY A;  2JRH A;  3QHT A;  2LD9 A;  2MP2 B;  1WM3 A;  2LJ5 A;  3OAW A;  4BBN F;  4WWN A;  3I3T B;  4M8N A;  3C0R B;  2KWV B;  3L17 A;  2KTF A;  3UGB B;  1WX8 A;  2VRR B;  5FR6 A;  5C1Z A;  3U30 A;  1GG3 A;  2A5U A;  1WM2 A;  2OJR A;  2BKF A;  2FIF A;  2UYZ B;  1Z5S B;  2Y5B B;  4I6P A;  3U7D A;  4ANU A;  3QC8 B;  3AU5 A;  3RCZ A;  2KLC A;  3X0W A;  3A9K A;  1YQB A;  3UIP B;  3UQB A;  5L95 C;  4FHJ A;  2XK5 B;  3H6N A;  4MEM A;  3T8M A;  4B95 A;  4KIK B;  3CF6 E;  3JW0 X;  2C7M B;  3CSF A;  3M62 B;  4MGK E;  4ZRI A;  2MQJ A;  1OGW A;  3JYU A;  4W9L A;  4HCN B;  2KKC A;  3PS6 A;  3VAW A;  3B0A A;  2M0X A;  3ZUN A;  2JVC A;  1R4M I;  3M63 B;  2NR2 A;  2C7N B;  2R2O A;  3QIJ A;  4BKT A;  4BKS A;  1S1Q B;  2KFK B;  3SHQ A;  1T0Y A;  4CYE A;  1L2N A;  3LDZ E;  2MX2 A;  3PZD A;  4W9C A;  2ZZP B;  3DPD A;  1WXM A;  4X57 B;  1OEY J;  4ICV A;  3L54 A;  2NPT A;  3A9J B;  3P2B A;  2RD0 A;  3UIN B;  2NBV B;  5TR5 A;  2LI5 A;  2ASQ A;  2LZ6 A;  4G11 A;  2HJ8 A;  1WR1 A;  4K81 A;  2WWZ A;  3ZW3 A;  4TUU A;  3KYC D;  1ZW7 A;  2ZNV B;  3L16 A;  2L0F A;  3APC A;  3RD2 A;  2GBR A;  3U8Z A;  2J0K A;  4HVB A;  3JVZ X;  3V6E B;  4DHZ B;  4W9G A;  1GNU A;  4GOC A;  3DBH I;  2KDI A;  2ZCB A;  3N3K B;  1SIF A;  1RLF A;  3PHW B;  2V4L A;  2MBO A;  3AXC A;  3TL5 A;  2Z0E B;  3TMP B;  3PTF C;  2DEN B;  4W9E A;  4B6W A;  2NBU A;  4WQO B;  4IWO A;  3N30 A;  2L7R A;  1WGH A;  1AAR A;  2IO3 B;  2K8H A;  4MSQ B;  2LXA A;  1ZKH A;  3H9D A;  4LDT B;  3PRZ A;  4M8M A;  1I35 A;  1YX6 B;  1WZ3 A;  2DYB A;  4FJV B;  1J19 A;  1WXA A;  2JWZ A;  2KWU B;  3HK0 A;  1U4A A;  1WGR A;  2A4Z A;  4CO7 A;  3BY4 B;  2JY6 A;  1WGD A;  3H7S A;  4WJQ A;  3WAN A;  3Q3J A;  4WJP A;  3ZNZ B;  1FXT B;  4AJY B;  5E6O A;  5IAA C;  3ZIM A;  1P0R A;  2MBH A;  1WXS A;  3PRE A;  1EUV B;  1E7U A;  3TCA A;  1F9J A;  4FHK A;  1WX7 A;  4XC2 A;  4AUQ C;  2ZVO A;  1TGZ B;  3W1S A;  3APD A;  2IO2 B;  3PRM B;  2MSE D;  3DOW A;  3VH3 B;  3DVN V;  2K25 A;  1UBI A;  2PEA A;  3V6C B;  2GBK A;  2MBE A;  4K7U A;  4ANW A;  1K8R B;  2BYV E;  1WY8 A;  2MBB B;  2KFJ A;  2D11 A;  2K8B A;  2KXJ A;  3M3J A;  4EZJ A;  1WGG A;  5GMV A;  1WE7 A;  3ZNG C;  2LRU A;  1WJN A;  2N7D A;  3KYD D;  3K9O B;  5D6J B;  1RFA A;  3VTV A;  5LXI B;  2BYF A;  2D10 A;  4ZRJ A;  5BO4 B;  3EEC A;  2XEW A;  3ZTD A;  4LJP B;  4BFR A;  4HK2 A;  4EUT A;  2CHZ A;  2ZVN A;  3EFU A;  3PHX B;  4BVU C;  2C7H A;  5DCN A;  4FBJ B;  2FID A;  3DBS A;  2D3G A;  1IPG A;  5D2M B;  2YVC A;  3PT2 B;  4IWP A;  3QJZ A;  5CX3 A;  4CHK A;  4DBG A;  4DHZ E;  3A4S C;  5DPS A;  3EHV A;  4HCP B;  4BBN C;  2WX0 A;  3ZLZ A;  1C1Y B;  1WMH B;  4G50 A;  3KH0 A;  4RM8 A;  2JZ3 B;  3HIZ A;  4NJ7 A;  3IFW B;  5J18 A;  4XZ4 A;  5HKH A;  2KWC A;  5E6N A;  2KD0 A;  2LRW A;  4DDI D;  3A1Q B;  3WAP A;  4W9D A;  2J0M A;  1WYW B;  2C5L C;  1UH6 A;  4MEL A;  4ZDV A;  3DVN U;  4E71 A;  2LUE A;  2KX3 A;  4IG7 B;  3R3M A;  2K1F A;  2KTR A;  4E3C A;  1V49 A;  2KMA A;  3PPA A;  1LQB A;  2RGF A;  4HPM B;  4HLE A;  4GDK B;  3VUX A;  2M17 A;  2JT4 B;  2L8J A;  3PLU A;  1GJZ A;  2K8C A;  5CTR C;  4DK5 A;  1V80 A;  2BWE S;  2BWF A;  4AP4 C;  4ANV A;  4URK A;  2KQ7 A;  2KJH B;  4B9K A;  1IP9 A;  3JSV A;  1YX5 B;  1P3Q U;  2HTH A;  3VUW A;  4IWQ A;  3QWZ B;  3CMM B;  2LGY A;  4ANX A;  1GC6 A;  2KK8 A;  2L05 A;  2ZNV C;  1HE8 A;  4FA6 A;  1E8X A;  4MSM B;  2V3S A;  3IG3 A;  4G0N B;  4KZ0 A;  3WA0 A;  4KSK C;  4K7S A;  4LJO B;  3VTW A;  1E5W A;  4PS8 A;  5AZG A;  1VCB A;  3A9K B;  3WIM A;  4KDL B;  3CST A;  2DZI A;  2M8S A;  4NAW A;  3M95 A;  2JUO A;  3TJP A;  1D3Z A;  3SU8 X;  1BT0 A;  2KMC A;  1J0G A;  3L10 B;  2O6V A;  2EMT A;  2GBN A;  4I6N B;  3VFK A;  3KVF B;  1R4N I;  2KDE B;  2C60 A;  1EF5 A;  4A3P A;  2JPH A;  1WRD B;  1WX9 A;  3B08 A;  4K1R B;  3R7Q A;  2KO3 A;  3ZVV A;  2B3A A;  3ZDT A;  3UIO B;  2KJ6 A;  2CR5 A;  3IVF A;  3SD5 A;  1Q0W B;  2DHZ A;  3ALB A;  4F8C B;  2N9P C;  2D2Q A;  2FNJ B;  2NPT B;  2KHW B;  3ZRC A;  1CMX B;  2IO0 B;  3V61 A;  2WDT B;  3NS8 A;  4GMV A;  2BGF A;  5LXH A;  2DAJ A;  2N1W A;  4JQW C;  1WF9 A;  1LM8 B;  1WJ4 A;  1XT9 B;  2DZM A;  2G4S A;  2KDB A;  4F7Z A;  2R2Q A;  4J6I A;  4K7W A;  3AI5 A;  3TIX A;  5AZH A;  1UBQ A;  2ZPN A;  3DCG A;  4ZRK A;  2IY0 B;  3TBL D;  5CHW A;  4MJS A;  1S3S G;  1NI2 A;  4MDK E;  4EZK A;  1E90 A;  3V60 A;  5JHB A;  3N32 A;  1WI0 A;  4PS7 A;  1X1M A;  3DBR I;  1JRU A;  1GC7 A;  1EF1 A;  2ZJD A;  4EZL A;  3VUY A;  2GOW A;  4KSL C;  4IUM B;  2ZEQ A;  1WR6 E;  3Q3F A;  1WIA A;  2N1V A;  5D7G A;  3H1U A;  1OQY A;  2CHW A;  2L0T A;  5J2R A;  1V5O A;  4GXB A;  5LLI A;  2Z0D B;  2FCQ A;  2UWQ A;  2O2V B;  4IW0 A;  2KZR A;  4W9I A;  2RPQ A;  3NZU A;  1Z2M A;  3ZO5 B;  5JH5 C;  2LVQ A;  3ZNI D;  1UGM A;  2NBW B;  3QA8 A;  1E8Z A;  3DQV A;  1Q5W B;  2IZV B;  1A5R A;  1H8C A;  3ZKJ C;  2HD5 B;  3H7P A;  4IM3 A;  3W1Y A;  4GDL A;  2AEH A;  2K39 A;  2N7E A;  2KOX A;  2BYE A;  1E7V A;  2AWT A;  2MWS B;  1E8W A;  4YL8 A;  2DZJ A;  1ZGU B;  1V9J A;  4WAA A;  4WWP A;  1YJ1 A;  1EO6 A;  2IY1 B;  2N9E B;  3MTN B;  3OJ3 A;  3QAQ A;  4DHJ B;  4DWF A;  2DAF A;  4BOS C;  4EOY A;  4NY0 A;  2QHO A;  2L3Z A;  1YIW A;  2I1J A;  1P98 A;  3SDL C;  4LDT D;  2KJR A;  1UEL A;  4JLC A;  4MGZ E;  2C9W B;  1KLV A;  3IHP C;  2JF5 A;  4FJY A;  1NBF C;  1RRB A;  4WJO A;  1PQS A;  2J7Q B;  4WJN A;  1WXV A;  5IA7 A;  1TTN A;  3A1Q A;  4IM2 A;  4BKG A;  2MP2 A;  1QZE A;  1TBE A;  2XBB C;  5JZE B;  3O65 B;  3HHM A;  4GSW A;  1V6E A;  4W9F A;  4AJW A;  4FN2 A;  4MM3 A;  2MA9 B;  3UQA A;  1J8C A;  2G45 B;  2LGD A;  3ONS A;  2LXC A;  3PSE B;  3NHE B;  4OVV A;  2W9N A;  4TQ1 A;  3WAL A;  4FJZ A;  1SGH A;  1V81 A;  3VVW B;  3KUD B;  4NQL B;  3L08 A;  2JZZ A;  4TKN A;  1Q1O A;  4W9H A;  2XK5 A;  1KOT A;  1RAX A;  4KIK A;  3L13 A;  4WWO A;  2KAN A;  2KN5 A;  1WJ6 A;  2RR9 A;  4W9J A;  3LJ3 A;  4PYU A;  1L7Y A;  3V62 A;  4A3O A;  2LWP A;  3RYT A;  3GZN I;  2MW5 A;  1OEY A;  2KNB A;  2KTR B;  3APF A;  2AYO B;  2LAS A;  3DDC B;  1IYF A;  4HDO A;  3IBE A;  4MGI E;  2RSU A;  1NDD A;  3NY5 A;  5AZF A;  4W9K A;  2CHX A;  2KFK A;  3DBL I;  1OTR B;  4HJK A;  4GIV A;  2FUH B;  4XX5 A;  2PE9 A;  1Y8R C;  4AOF A;  4MGY E;  4BOZ B;  1I42 A;  2MBQ A;  4DHJ D;  5KHQ A;  4JIO U;  2LVO A;  3A9J A;  4II3 B;  3JSV B;  4NNJ B;  2ZCC A;  4A20 A;  2REX A;  3PGE A;  3A4R A;  1WFY A;  1SE9 A;  3ML8 A;  1ISN A;  4JL9 A;  3VHT C;  1P9D U;  3AU4 A;  2BPS A;  3AUL A;  2GMI C;  3HM3 A;  3NZS A;  5KHO A;  2FCM A;  4M0W B;  3R7R A;  5G2N A;  2L76 A;  2L00 B;  3MHS D;  2N9X A;  2FAZ A;  4ICU A;  4PS3 A;  2FCS A;  3GOE A;  4NAW B;  1WZ0 A;  3RZF A;  4ASW C;  2D07 B;  2O6V B;  2IYD B;  2HE7 A;  4GB9 A;  4EEW A;  2KLG A;  5DPR A;  4P7I A;  3X23 A;  5CHF A;  4EKU A;  2KC2 A;  2CS4 A;  3QAR A;  4GGQ A;  1VD2 A;  2J0J A;  3A33 B;  1LFD A;  3ENE A;  2NCN A;  3RT3 B;  3QCA A;  3VDZ A;  3ML9 A;  3KUZ A;  4KZC A;  4JGH B;  3K9P B;  2K6D B;  1LXD A;  2K6Q A;  3HM6 X;  1E8Y A;  5C23 A;  3T9L A;  4F1S A;  4KDI C;  2DYM A;  5EDS A;  2CU1 A;  3W1S C;  2MLB A;  5AEK B;  5JHA A;  2I1K A;  4DDG D;  4I6L B;  3MJW A;  3RUL A;  2KX0 A;  2PJH A;  4NQK E;  4RM9 A;  2AL3 A;  5L83 A;  3VH4 B;  1KM7 A;  4IC7 B;  1G6J A;  4KV2 A;  1WE6 A;  4E74 A;  4FUL A;  4G3X B;  3NOB A;  4MJS B;  1UD7 A;  2DZK A;  2IBI B;  4II2 B;  1H4R A; 
#chains in the Genus database with same CATH topology
 4HPL B;  1M4V A;  2JXX A;  3DVG Y;  4BKS D;  1XD3 B;  2OOB B;  1MG8 A;  1KJT A;  4ZYN A;  2AL6 A;  2Z59 B;  1N61 A;  4HXD A;  3J9C A;  3QK0 A;  4FXC A;  4HWI B;  4N9F 4;  3PV1 A;  1FD6 A;  2LVP A;  3L0W B;  1KRH A;  1P1A A;  4AWJ A;  3AEF B;  2DX5 B;  2NVU I;  1MI0 A;  2KC1 A;  2KMM A;  4A9A A;  2VZK B;  1GUA B;  1VLB A;  3P4Q B;  2W55 A;  3H7P B;  4DXA B;  3BWU D;  3ZRF A;  1V5T A;  3ECI A;  2WX1 A;  4NPN A;  2MCN B;  3VXW A;  2G3Q B;  1WH3 A;  2V0G A;  3AE4 B;  1JWU D;  1SF0 A;  3EC8 A;  3I9V 1;  4GDK A;  4KKJ A;  2N4F A;  2BT6 A;  3WAM A;  3CWI A;  3AEA B;  4YSX B;  1RFK A;  3ZDM C;  2LGX A;  1WYG A;  3DBR B;  3E9S A;  2KTF A;  3UGB B;  2H89 B;  1WX8 A;  2MJD A;  5C1Z A;  1XO3 A;  2BKF A;  1Z5S B;  4I6P A;  3AU5 A;  4FHJ A;  3H6N A;  3T8M A;  2OHF A;  3EA6 A;  3JW0 X;  4GLS C;  4D2K A;  3M62 B;  4ZRI A;  4BAX A;  3JYU A;  1DOY A;  1BUI C;  2BS4 B;  3PS6 A;  3B0A A;  2C7N B;  2IND C;  4BKT A;  3T3O A;  4W9C A;  2ZZP B;  1WXM A;  3T3N A;  3A9J B;  3UIN B;  2RD0 A;  1SBB B;  3I63 C;  4ZOH C;  2HJ8 A;  1WR1 A;  4K81 A;  2WWZ A;  2ZNV B;  4RGN A;  2L0F A;  3RD2 A;  3U8Z A;  2J0K A;  1MG4 A;  3N1Z C;  3NZ3 A;  5EE1 A;  3U2S C;  2ZCB A;  3N3K B;  4RF1 A;  2WXO A;  3EFC A;  3Q3O C;  3TL5 A;  4W9E A;  5EE0 A;  1AYF A;  4WQO B;  3RNB C;  4IWO A;  2L7R A;  1WGH A;  1EU3 A;  4C00 A;  4LDT B;  1YX6 B;  2X8X X;  1WXA A;  1JRO A;  2EEL A;  3NVW A;  3WAN A;  1FXT B;  4AJY B;  1P0R A;  1FIQ A;  4A90 A;  3TCA A;  1F9J A;  4OW0 A;  1XCT L;  3W1S A;  2L1A A;  3ZYY X;  2WHI A;  3V6C B;  2MBE A;  3N9Y C;  5C3J B;  3ZJU A;  2MBB B;  3MHZ A;  2D11 A;  2PVG C;  3M3J A;  1WGG A;  3AE2 B;  5D6J B;  3VTV A;  4ZRJ A;  2KAJ A;  3EEC A;  1L4D B;  2WS3 B;  3Q14 C;  3ZTD A;  3Q2A C;  1TT5 B;  4P1C C;  4S17 A;  5DCN A;  2FID A;  3PT2 B;  4IWP A;  4CHK A;  3QJZ A;  5CX3 A;  1WXQ A;  4DBG A;  3EHV A;  2WX0 A;  1ACC A;  2KYW A;  1KH0 A;  4G50 A;  4RM8 A;  1GAQ B;  3IFW B;  3FIL B;  2KD0 A;  3A1Q B;  1JW9 D;  3URY A;  3AE3 B;  2C5L C;  1BXT A;  2OJW A;  3R3M A;  2ON8 A;  4E3C A;  1V49 A;  4UDU C;  3PPA A;  2RGF A;  4HPM B;  4REZ A;  4HLE A;  4GDK B;  1TS2 A;  2JT4 B;  1I7H A;  3TEX A;  4XDC A;  2BQQ A;  2BWF A;  4HEA 1;  1L6V A;  2HTH A;  3P63 A;  4C80 A;  3QWZ B;  3ZJV A;  3U4E G;  2ZNV C;  4YTN B;  1E8X A;  1NI3 A;  2INC C;  2V3S A;  2KDM A;  2DNF A;  3ZGZ A;  3WA0 A;  4JPS A;  4K7S A;  4LNO A;  3VTW A;  1VCB A;  1XF5 L;  4NAW A;  2JUO A;  4US9 A;  1AW7 A;  1FCC C;  5FR3 A;  1WRD B;  1YN3 A;  3B08 A;  4K1R B;  1UWX A;  3W5U B;  4RGM A;  1IGC A;  1FMA D;  2D2Q A;  1CMX B;  3OG5 A;  4HKQ A;  2BGF A;  1WWT A;  1I4R A;  1LM8 B;  2NMQ A;  4K7W A;  2AQ1 B;  2PKO A;  3BVM A;  2ZPN A;  3O13 A;  4ZRK A;  2IY0 B;  5CHW A;  2INN E;  4MDK E;  3V60 A;  4PS7 A;  3P4R B;  2AQ2 B;  1X1M A;  3DBR I;  4EZL A;  4JWU C;  2GOW A;  2DWQ A;  4KSL C;  3KWL A;  3FAH A;  3Q3F A;  1V1O A;  2N1V A;  2ACZ B;  3H1U A;  1V5O A;  3ABV B;  4GXB A;  1V8C A;  1R4M B;  3ZJT A;  4W9I A;  2RPQ A;  1Z2M A;  1QLB B;  1UGM A;  2NBW B;  3QA8 A;  2HD5 B;  2JU6 X;  1OFF A;  1VR9 A;  2AEH A;  2AWT A;  5EE9 A;  1E8W A;  2N9E B;  2IY1 B;  3AE9 B;  2DAF A;  2QHO A;  1HXY D;  2I1J A;  1P98 A;  2N0S B;  1T5X D;  1NYR A;  3H8H A;  4MGZ E;  3SR6 A;  1YJJ A;  1ET9 A;  3IHP C;  2JF5 A;  4FJY A;  4OZC A;  4LTU A;  1PUT A;  5JZE B;  1CZP A;  4GSW A;  1V6E A;  2KT7 A;  4W9F A;  4AJW A;  1UF0 A;  2G45 B;  4NAM A;  3ONS A;  3PSE B;  3MC0 B;  3NHE B;  4OVV A;  1V81 A;  1MVK A;  1I4X A;  3L08 A;  2JZZ A;  4TKN A;  2XK5 A;  2FBW B;  3HVD A;  1PGA A;  4PYU A;  4W9J A;  1L7Y A;  1ZUD 2;  4A3O A;  3P4S B;  5LNK 1;  2W3S A;  1JWM D;  2MW5 A;  2RDH A;  2KNB A;  1IYF A;  3IBE A;  3NY5 A;  2CHX A;  5E6J A;  2FUH B;  4XX5 A;  4MGY E;  2MBQ A;  2LVO A;  2M56 B;  3A4R A;  1SE9 A;  3BVZ A;  3HVZ A;  1XLQ A;  3VHT C;  1P9D U;  3AU4 A;  2BPS A;  1FNU A;  3IAM 1;  3R7R A;  1D4B A;  2FAZ A;  2WP9 B;  2FCS A;  4NAW B;  1WZ0 A;  3RZF A;  2D07 B;  1D5M C;  3I5J C;  4GB9 A;  2JSV X;  4EEW A;  4OHJ A;  1K53 A;  1KLU D;  4ZRQ A;  2CS4 A;  4GGQ A;  5MPO A;  3KLS X;  2NCN A;  2BBC A;  3ML9 A;  4JGH B;  1C4A A;  1FNW A;  2TSS A;  5C23 A;  4F1S A;  2D3B A;  2CU1 A;  3W1S C;  3RFZ B;  2MLB A;  2I1K A;  1PYW D;  1GOZ A;  4RM9 A;  2AL3 A;  1T0S C;  1KM7 A;  1WE6 A;  2FE8 A;  4FUL A;  2BB6 A;  1N6Z A;  5CHV C;  2K0P A;  3WAO A;  5E6P A;  1EWC A;  2WU2 B;  2QC8 A;  2ZPY A;  2QIL A;  1M94 A;  2DYO A;  4LCD E;  3UF8 A;  3MFG A;  3RUI B;  1C9F A;  3GP7 A;  4MH0 E;  3RZW C;  2JYT A;  1RYJ A;  1WMH A;  3VTU A;  1F2R C;  2WXF A;  2BKR B;  2KQS A;  2PPH A;  1I4P A;  2NS5 A;  4IM0 A;  3S2A A;  2WYQ A;  4F8C B;  4TQ0 A;  2M4N A;  4TV3 A;  3ZTC A;  2VH2 A;  2RPV A;  3R2I A;  2WXM A;  4ZYS A;  4GU2 A;  1E9M A;  5DPT A;  3QHT A;  4L23 A;  4BBN F;  2LJ5 A;  2W54 A;  2KWV B;  1ESF A;  1PGX A;  2L32 A;  3U30 A;  2A5U A;  2FIF A;  2DLB A;  4ANU A;  4MH8 A;  3RCZ A;  5L95 C;  2XK5 B;  4B95 A;  1EWY C;  3CF6 E;  2NTT A;  3CSF A;  2K22 A;  4MGK E;  1N62 A;  4W9L A;  4HCN B;  1XLP A;  3VAW A;  2M0X A;  3ZUN A;  1R4M I;  2NR2 A;  3SHQ A;  4CYE A;  3VR8 B;  2K3U A;  1OEY J;  3P2B A;  2NPT A;  1DOI A;  5TR5 A;  5BYR A;  4ARC A;  2ASQ A;  3Q8F A;  2BYT A;  3AE7 B;  3ZW3 A;  1ZW7 A;  3EGR A;  4HVB A;  3JVZ X;  4DHZ B;  1ET6 A;  1GNU A;  4RGT A;  2KDI A;  3PHW B;  1RLF A;  2MBO A;  1YOV B;  4YSZ B;  5IP4 D;  4LNI A;  4C4V A;  3AEG B;  3N30 A;  1AAR A;  3AE8 B;  2IO3 B;  1MJD A;  3H9D A;  1I35 A;  5HI1 A;  2DYB A;  4FJV B;  3DHG C;  4KGT A;  2K9X A;  2KWU B;  1AN8 A;  2JY6 A;  1GB4 A;  1F2R I;  1C78 A;  5E6O A;  5IAA C;  4C56 C;  1EUV B;  4FHK A;  1FRD A;  3APD A;  4WWM A;  3DOW A;  1XLN A;  2K25 A;  2JX5 A;  1J7A A;  4KGS A;  4K7U A;  4ANW A;  2BYV E;  4ZHP A;  2KFJ A;  2K8B A;  3P1M A;  1TKG A;  1WE7 A;  3ZNG C;  3VR9 B;  1WJN A;  3KYD D;  2GB1 A;  1A70 A;  2D10 A;  1R7S A;  4BFR A;  3NVV A;  4EUT A;  2ZVN A;  1EM7 A;  2WU5 B;  2SAK A;  1PFD A;  1VZ7 A;  1IPG A;  2YVC A;  3AE6 B;  3A4S C;  2BTE A;  2QDF A;  1WMH B;  4DXF A;  3KH0 A;  3HIZ A;  4TMA B;  2KWC A;  1SE3 A;  3WAP A;  4MEL A;  1L0Y B;  1SEB D;  4IG7 B;  2KTR A;  5IO9 A;  2KMA A;  1LQB A;  1JCK B;  3IT6 B;  2K8C A;  5CTR C;  4DK5 A;  5EE3 A;  4B9K A;  3JSV A;  4KKI A;  3CMM B;  3IT4 B;  4ANX A;  1HA5 A;  2KK8 A;  5D3I B;  2VZK D;  1ZE3 D;  3IG3 A;  4ACF A;  4LNK A;  4M0W A;  2EKI A;  1E5W A;  1T6B X;  3Q8E A;  5TSS A;  3NRZ A;  3C19 A;  2DZI A;  1D3Z A;  2PLP A;  3SU8 X;  2K5P A;  3L10 B;  2O6V A;  2BB5 A;  4I6N B;  1SE4 A;  3NVZ A;  2JPH A;  1WX9 A;  2B3A A;  2UU7 A;  3B2G A;  2CR5 A;  3IVF A;  3SD5 A;  2WXP A;  3ALB A;  2N9P C;  2FNJ B;  2NPT B;  2KHW B;  3ZRC A;  3V61 A;  2WXR A;  2WDT B;  2QCZ A;  3NS8 A;  2DAJ A;  2N1W A;  2CJO A;  1WF9 A;  4WH4 A;  3LB8 C;  1BML C;  2DZM A;  2KDB A;  1MPE A;  2X38 A;  5G5G A;  5AZH A;  5AUI A;  3TEY A;  1UBQ A;  3Q8A A;  3TBL D;  1QKZ A;  4EZK A;  5JHB A;  3N32 A;  1UUP A;  1GC7 A;  4C4V B;  1EF1 A;  3BZD B;  1V97 A;  2ZEQ A;  5FKA C;  1VDV A;  2XNA C;  3RMK C;  3BK1 A;  1QOF A;  2UWQ A;  2KZR A;  1TS3 A;  4RFB A;  3NZU A;  4A55 A;  2LVQ A;  1TY2 A;  2R61 A;  3DQV A;  4CQN A;  2IZV B;  4GDL A;  2K39 A;  1E7V A;  2MWS B;  1MFW A;  2DZJ A;  1ZGU B;  4WAA A;  2ZW0 A;  1FFV A;  2N9K A;  5C2T B;  1YN4 A;  4AQ7 A;  2FUG 1;  5AUK A;  4LDT D;  2KJR A;  1UEL A;  3RNG C;  3NVY A;  3KQ4 A;  1RRB A;  1PQS A;  4WJN A;  1TBE A;  2JWU A;  1FFU A;  2H88 B;  4MM3 A;  1T3Q A;  3WAL A;  2Y5C A;  4AS1 A;  1HZ5 A;  4KIK A;  3IAS 1;  3L13 A;  2KN5 A;  2RR9 A;  3BYT B;  1B9R A;  2KTR B;  2AYO B;  2LAS A;  5G5H A;  3R2T A;  3UI3 A;  1NDD A;  5AZF A;  4W9K A;  2KFK A;  1OTR B;  4HJK A;  1LGR A;  4ARI A;  3Q3M C;  4YTM B;  4AOF A;  1TS4 A;  1I42 A;  2LJI A;  5KHQ A;  4II3 B;  3JSV B;  2ZCC A;  2REX A;  4JWS C;  1WFY A;  2HJ1 A;  1VRA B;  4JL9 A;  3AUL A;  3DWG C;  2GMI C;  5KHO A;  4M0W B;  2L76 A;  2D3A A;  3MHS D;  2QJL A;  1ZP0 B;  1WRI A;  3GOE A;  3W2D A;  4ASW C;  5D3D A;  2O6V B;  3TEZ A;  2HE7 A;  4P7I A;  3X23 A;  5CHF A;  3LYY A;  1DOX A;  2LFI A;  2J0J A;  3VRA B;  4O1N A;  1LFD A;  4N59 A;  2WDQ B;  3ENE A;  2RDG A;  5HHD G;  2ICI A;  3T9L A;  3K9P B;  1E8Y A;  1Y56 A;  1ROE A;  3GE3 C;  5AEK B;  1MHH E;  4XE0 A;  3MJW A;  1JWA D;  1N63 A;  2KX0 A;  5BMI A;  1G6J A;  2OED A;  4G3X B;  3NOB A;  4JX1 C;  1D5Z C;  2IBI B;  4MSQ B;  1QOA A;  5G55 A;  2WXK A;  2O2V A;  1TS5 A;  2AQ3 B;  3AEE B;  1GPX A;  3OLM D;  2LGS A;  4RMA A;  1XEE A;  2ONQ A;  4OVU A;  2O6V D;  2HDE A;  5D94 A;  2WXN A;  1I4G A;  1F1H A;  4EFO A;  4KVG B;  2FCN A;  2YLM A;  1F52 A;  4PYZ A;  1YMH E;  1TKE A;  3PVL A;  4DXG A;  3QX1 A;  1IBX A;  2M1M A;  1JAL A;  1QQR A;  2JRI B;  3OJ4 B;  2EMS A;  2Z8L A;  4GDL B;  3B2F A;  1WJU A;  3Q8B A;  3RNC C;  3ZNH B;  1V86 A;  5J17 A;  1TZ1 A;  2MRP A;  3B1L X;  2G4D B;  1HTO A;  3KW5 B;  3ZXV A;  2KVR A;  3SFE B;  4NJ6 A;  4YSY B;  4OVZ A;  2I38 A;  4WWN A;  4LK0 M;  4M8N A;  3C0R B;  4MM3 B;  3L17 A;  4MT5 A;  1ZDV A;  5FR6 A;  1GG3 A;  1WM2 A;  2AX5 A;  2OJR A;  1IUE A;  3U7D A;  3UIP B;  3UQB A;  3PO0 A;  4KIK B;  2INP E;  1VJK A;  4IKG A;  2WXH A;  2IGG A;  2JVC A;  1V1P A;  4NJC A;  5IN7 A;  4BKS A;  2KFK B;  2Q5W D;  3LDZ E;  2ZW1 A;  4DQO C;  4K3C A;  3DPD A;  3AEC B;  1YJI A;  3FKY A;  4X57 B;  4ICV A;  2JZP A;  1D6E C;  1YNT E;  1JWS D;  2NBV B;  2B76 B;  2PMV A;  4P6V F;  1QT9 A;  4XGA B;  1OQR A;  2PW9 A;  2PTL A;  1NVI D;  5HFY A;  3APC A;  2E3T A;  1SE2 A;  3Q6B A;  2V4L A;  4OZB A;  3AXC A;  3TMP B;  2DEN B;  2NBU A;  3W5V B;  2LUM A;  2K8H A;  2LXA A;  1UNS A;  3PRZ A;  1WZ3 A;  2JWZ A;  3HK0 A;  3GS2 A;  1WGR A;  4WJQ A;  3H7S A;  3Q3J A;  3NS1 A;  5GXG B;  3DBL B;  2MBH A;  1TKY A;  1WX7 A;  2D3C A;  2ZVO A;  1YQ3 B;  4N6E B;  1F0Z A;  2MSE D;  1FXA A;  3DVN V;  1UBI A;  2GBK A;  1WGK A;  3DHH C;  2WXI A;  3L4P A;  2CJN A;  1FO4 A;  3PZ7 A;  1XXG A;  5GMV A;  2N7D A;  2VH1 A;  3K9O B;  4LNF A;  5LXI B;  2BYF A;  3RPF C;  5BO4 B;  2XN9 C;  3Q3N C;  2XEW A;  4HK2 A;  3EFU A;  4BVU C;  3BVG A;  4IOI E;  3TEW A;  2D3G A;  1TYG B;  5DPS A;  4HCP B;  4BBN C;  3ZLZ A;  1C1Y B;  3BII D;  1E10 A;  1TIF A;  4NJ7 A;  4XWT A;  5J18 A;  1IBX B;  1Q10 A;  4JE3 B;  4DDI D;  3AED B;  4W9D A;  1WYW B;  1P7F A;  1KTK A;  3DVN U;  2LUE A;  3FC4 A;  1L6U A;  1OQQ A;  3VUX A;  2LHD A;  2L8J A;  4L1B A;  3AE5 B;  3PLU A;  1V80 A;  2BWE S;  4URK A;  4AP4 C;  4ANV A;  4B0M A;  2KJH B;  1P3Q U;  1CQV A;  2LGY A;  1GC6 A;  1FEH A;  3U52 E;  4MSM B;  4G0N B;  4KSK C;  5BMH A;  2J4X A;  4PS8 A;  5AZG A;  2M8S A;  3AM9 A;  2J42 A;  3TJP A;  1BT0 A;  2KMC A;  1J0G A;  2EMT A;  3VFK A;  3KVF B;  2KDE B;  2C60 A;  1EF5 A;  1VZ8 A;  5FK9 C;  4HKZ E;  1V1P B;  4A6Q A;  3ZVV A;  3ZDT A;  2KJ6 A;  4YT0 B;  3AB5 A;  3AEB B;  2LMC A;  2DHZ A;  2WXJ A;  4K3B A;  5T8I A;  4BZA A;  1DGJ A;  1QOG A;  4JQW C;  2V9H A;  4RH6 A;  1XT9 B;  2G1E A;  3V05 A;  4F7Z A;  2R2Q A;  4J6I A;  3AI5 A;  2J53 A;  4MJS A;  1WI0 A;  1K51 A;  2JYE A;  1K52 A;  2ZJD A;  3ZQ4 A;  1L5P A;  1AWD A;  1WR6 E;  1XLO A;  3P42 A;  1WIA A;  5D7G A;  1STE A;  2CHW A;  5J2R A;  3RNA C;  3TSS A;  2FCQ A;  1F77 A;  5BMG A;  2BS3 B;  3ZO5 B;  1N60 A;  1Q5W B;  4LLG M;  1A5R A;  1H8C A;  3W1Y A;  4QAY A;  3PZ8 A;  3I57 A;  5BYQ A;  2BS2 B;  4YL8 A;  1V9J A;  4WWP A;  1EO6 A;  3MTN B;  1FXI A;  4NY0 A;  2L3Z A;  1YIW A;  4KX6 B;  1NBF C;  4WJO A;  2J7Q B;  2MJE A;  3FIL A;  1WXV A;  3DBH B;  3A1Q A;  4BKG A;  2MP2 A;  1QZE A;  3O65 B;  4P16 A;  1RWS A;  3UQA A;  4HPP A;  1J8C A;  5IKC M;  2LXC A;  2W9N A;  3NJT A;  4FJZ A;  1Q1O A;  4M02 A;  1E6E B;  1KOT A;  1RAX A;  2WNM A;  4WWO A;  2KAN A;  1WJ6 A;  1JML A;  1D5X C;  3V62 A;  2LWP A;  3DDC B;  2WXQ A;  4HDO A;  2MH7 A;  4S0R A;  3DBL I;  5H8Y E;  4GIV A;  4HJG E;  3Q8C A;  1Y8R C;  3AH7 A;  2YEP B;  2WXG A;  4JIO U;  4NNJ B;  2WDR B;  1I4Q A;  4M00 A;  4A20 A;  3ML8 A;  1ISN A;  2FCM A;  1TZO A;  2WQY B;  4HRS A;  2L00 B;  2N9X A;  1DYQ A;  3ETR A;  1RM6 C;  4N58 A;  1N5X A;  3MP9 A;  2KLG A;  5DPR A;  2WXL A;  4EKU A;  2GRI A;  2KC2 A;  1VD2 A;  2RDB C;  1MHX A;  4USA A;  3RT3 B;  4C7Y A;  2MEK A;  3VDZ A;  3KUZ A;  4BOS C;  2K6D B;  1LXD A;  2K6Q A;  3HM6 X;  4KDI C;  3GB1 A;  2KQ4 X;  2BVC A;  1YQ4 B;  5JHA A;  1C4P A;  3ZXR A;  2PVO D;  3N1X C;  1HZ6 A;  3IXS A;  1XCQ L;  2E6X A;  5L83 A;  4IC7 B;  4KV2 A;  5H92 C;  4E74 A;  4MJS B;  1QF6 A;  1UD7 A;  3SFD B;  4II2 B;  1H4R A;  4IDI A;  2BF8 B;  1SB3 C;  3DVG X;  1C79 A;  1PDX A;  3D32 A;  1L0V B;  3PLV A;  3AN1 A;  3BIN A;  3KUC B;  1V2Y A;  3NG0 A;  2MHJ A;  4ITK A;  3MC9 A;  1SXT A;  2EKE C;  3C8Y A;  1R4N B;  2KAC A;  2KDF B;  2KWD A;  1XQQ A;  1YD8 U;  3KWV A;  5DPW A;  3QQ8 B;  3R66 C;  2GBM A;  1C3T A;  2GBJ A;  4FAD A;  2PE6 B;  1KFY B;  2V1Y A;  1UZX B;  3PRP B;  2HTM E;  4HDQ A;  4FLH A;  3VQI A;  1FRR A;  3GE8 C;  2IO1 B;  2GLS A;  3CIR B;  2QMT A;  4GN1 A;  2CKH B;  1WGY A;  2JRH A;  2LD9 A;  2MP2 B;  1WM3 A;  3OAW A;  2YEP F;  3I3T B;  1ENF A;  1P7E A;  4M01 A;  2VRR B;  1YN5 A;  4R3D A;  2Y5P A;  4YWG G;  2UYZ B;  2Y5B B;  3QC8 B;  2PIA A;  2KLC A;  3X0W A;  3A9K A;  1YQB A;  1B1Z A;  4MEM A;  4L2Y A;  2V4I B;  2C7M B;  2QIE B;  2IGH A;  1ZXH A;  1OGW A;  2MQJ A;  2KKC A;  1PGB A;  3RNF C;  3M63 B;  2R2O A;  3TUO A;  1E7P B;  3QIJ A;  1S1Q B;  1T0Y A;  1L2N A;  2D5G A;  2MX2 A;  1CJE A;  2KVZ A;  3PZD A;  1KLG D;  3MC8 A;  2GI9 A;  4WUR A;  3L54 A;  4B0E A;  1K50 A;  3V3X A;  1CK1 A;  2LI5 A;  1I4H A;  2LZ6 A;  4G11 A;  4TUU A;  3KYC D;  2N9L A;  3L16 A;  2GBR A;  1ZDX A;  3V6E B;  4W9G A;  3HRD D;  4GOC A;  3DBH I;  1SIF A;  5JXV A;  4XDD A;  2Z0E B;  3R8B A;  3PTF C;  4YTP B;  4B6W A;  1E0Z A;  3U7Z A;  1L0X B;  2IDY A;  1ZKH A;  2SEB D;  4M8M A;  4ZRP A;  1ZOY B;  5IOI A;  3N1Y C;  1J19 A;  1U4A A;  3GZN B;  2A4Z A;  4CO7 A;  3BY4 B;  4C7Z A;  1WGD A;  2L83 A;  4WJP A;  3ZNZ B;  3ZIM A;  3N20 C;  3Q69 A;  1WXS A;  3RI7 C;  3PRE A;  1E7U A;  4XC2 A;  4AUQ C;  2G9H D;  1TGZ B;  2IGD A;  2IO2 B;  3PRM B;  3VH3 B;  3NUH B;  2PEA A;  2KN4 A;  1QIL A;  1K8R B;  1C76 A;  1HEZ E;  1WY8 A;  1T0R C;  2KXJ A;  3RNE C;  4EZJ A;  1VZ6 A;  1TY0 A;  2LRU A;  4WQM A;  1RFA A;  4LJP B;  2W82 A;  1UGJ A;  2CHZ A;  3PHX B;  4RNA A;  1QOB A;  2C7H A;  4FBJ B;  3DBS A;  1WSP A;  5D2M B;  3BK2 A;  4DHZ E;  2MJ3 A;  2JQR B;  1T0Q C;  2JZ3 B;  2BW2 A;  3VRB B;  4XZ4 A;  1NYQ A;  3MJ5 A;  3B9J A;  2QEJ C;  5HKH A;  3AMZ A;  5E6N A;  2LRW A;  1JWB D;  2CU3 A;  5HG2 A;  2J0M A;  1UH6 A;  4ZDV A;  4E71 A;  1HTQ A;  2KX3 A;  5BYS A;  1C77 A;  2K1F A;  1C4C A;  2RMM A;  2DBY A;  2M17 A;  1GJZ A;  1IGD A;  2NTS A;  2KQ7 A;  1IP9 A;  3VUW A;  1YX5 B;  4IWQ A;  4RGO S;  2L05 A;  4J3O D;  1HE8 A;  4FA6 A;  4KZ0 A;  4LJO B;  2I2Y A;  1FM0 D;  3A9K B;  3WIM A;  4KDL B;  3CST A;  3M95 A;  4PT5 A;  1FNV A;  2GBN A;  4RCO A;  2LGI A;  1R4N I;  1KF6 B;  1EU4 A;  4A3P A;  4KGR A;  1N5W A;  3R7Q A;  2KO3 A;  2WLB A;  3UIO B;  3P4P B;  1Q0W B;  1FCL A;  3BYY B;  4MAC A;  5I4D A;  2IO0 B;  4GMV A;  5LXH A;  1SSN A;  1WJ4 A;  2G4S A;  4H2A A;  3TIX A;  1UWM A;  3DCG A;  4P1B C;  1S3S G;  1NI2 A;  4HRO A;  4XWW A;  1E90 A;  4YXD B;  1GB1 A;  1JRU A;  3VUY A;  4IUM B;  4EE2 A;  1NEK B;  1OQY A;  2L0T A;  2V3P A;  5LLI A;  2Z0D B;  1TJE A;  1J7B A;  3AV8 A;  2O2V B;  2WDV B;  4IW0 A;  2M0A A;  5JH5 C;  3ZNI D;  1E8Z A;  3ZKJ C;  3H7P A;  4IM3 A;  4LNN A;  4PK1 A;  2N7E A;  2KOX A;  2BYE A;  3OJ3 A;  1YJ1 A;  2IJ0 A;  4DHJ B;  3QAQ A;  4TSS A;  4DWF A;  4EOY A;  3RN9 C;  3SDL C;  1JQ4 A;  4JLC A;  3DHI C;  2C9W B;  1KLV A;  3AE1 B;  2N7J A;  2W3R A;  4WIP A;  3EUB 2;  5IA7 A;  1TTN A;  1SJH D;  4IM2 A;  4A8X C;  2XBB C;  2LEK A;  3HHM A;  3LXF A;  4FN2 A;  3HUI A;  2MA9 B;  2LGD A;  4TQ1 A;  3W9C B;  1SGH A;  2M19 A;  3VVW B;  3KUD B;  4NQL B;  4W9H A;  3WCQ A;  1FPY A;  1SJE D;  3LJ3 A;  2J52 A;  1J7C A;  3E56 A;  3RYT A;  3GZN I;  3APF A;  1OEY A;  1HQR D;  4MGI E;  2RSU A;  2LHE A;  3SEB A;  1NEN B;  2PE9 A;  4BOZ B;  2V3N A;  4DHJ D;  2WGS A;  4WAF A;  3A9J A;  3PGE A;  4RF0 A;  4ZHO A;  2Y3A A;  4NZL B;  1ZXI A;  2QSD A;  3HM3 A;  3NZS A;  2JXT A;  1L4Z B;  2L52 A;  5G2N A;  4ICU A;  4PS3 A;  4XYC A;  4Q2J A;  2IYD B;  4US8 A;  3DWM A;  4OZA A;  2IPK D;  3QAR A;  3A33 B;  1SIJ A;  3QCA A;  4KZC A;  2DYM A;  5EDS A;  1JRP A;  4DDG D;  4I6L B;  3RUL A;  3OWE B;  2PJH A;  4NQK E;  1LO5 D;  1ZPS A;  3VH4 B;  2DZK A; 
#chains in the Genus database with same CATH homology
 2BF8 B;  3DVG X;  2JXX A;  4HPL B;  5G55 A;  2O2V A;  3DVG Y;  3WAO A;  4BKS D;  1XD3 B;  2OOB B;  1MG8 A;  1KJT A;  3OLM D;  4ZYN A;  2AL6 A;  2Z59 B;  3D32 A;  3PLV A;  5E6P A;  4HXD A;  4RMA A;  3QK0 A;  5CHV C;  3BIN A;  4HWI B;  3KUC B;  2ZPY A;  4N9F 4;  3PV1 A;  1V2Y A;  4OVU A;  1M94 A;  2LVP A;  3L0W B;  2O6V D;  2DYO A;  1P1A A;  4LCD E;  5D94 A;  2EKE C;  4AWJ A;  3UF8 A;  3RUI B;  2KDF B;  2DX5 B;  1XQQ A;  2NVU I;  4KVG B;  4MH0 E;  1YD8 U;  3RZW C;  4EFO A;  2FCN A;  2YLM A;  1WMH A;  3VTU A;  5DPW A;  3QQ8 B;  2KC1 A;  4PYZ A;  3R66 C;  2GBM A;  3PVL A;  1GUA B;  3QX1 A;  2BKR B;  2GBJ A;  1C3T A;  2M1M A;  2KQS A;  2PPH A;  3H7P B;  4FAD A;  2JRI B;  3OJ4 B;  2EMS A;  2PE6 B;  4GDL B;  4DXA B;  2NS5 A;  3ZRF A;  1V5T A;  2V1Y A;  3ECI A;  4IM0 A;  2WX1 A;  1WJU A;  4NPN A;  2WYQ A;  2MCN B;  1UZX B;  2G3Q B;  3S2A A;  1WH3 A;  3VXW A;  2M4N A;  3PRP B;  4TV3 A;  4TQ0 A;  4HDQ A;  3ZNH B;  1V86 A;  5J17 A;  4FLH A;  3ZTC A;  1TZ1 A;  3VQI A;  2MRP A;  3B1L X;  3EC8 A;  4GDK A;  2N4F A;  2G4D B;  3WAM A;  3KW5 B;  2IO1 B;  2KVR A;  4GU2 A;  5DPT A;  4NJ6 A;  3ZDM C;  2LGX A;  4GN1 A;  2CKH B;  1WGY A;  2JRH A;  3QHT A;  2LD9 A;  2MP2 B;  1WM3 A;  2LJ5 A;  3OAW A;  4BBN F;  4WWN A;  3I3T B;  4M8N A;  3C0R B;  2KWV B;  3L17 A;  2KTF A;  3UGB B;  1WX8 A;  2VRR B;  5FR6 A;  5C1Z A;  3U30 A;  1GG3 A;  2A5U A;  1WM2 A;  2OJR A;  2BKF A;  2FIF A;  2UYZ B;  1Z5S B;  2Y5B B;  4I6P A;  3U7D A;  4ANU A;  3QC8 B;  3AU5 A;  3RCZ A;  2KLC A;  3X0W A;  3A9K A;  1YQB A;  3UIP B;  3UQB A;  5L95 C;  4FHJ A;  2XK5 B;  3H6N A;  4MEM A;  3T8M A;  4B95 A;  4KIK B;  3CF6 E;  3JW0 X;  2C7M B;  3CSF A;  3M62 B;  4MGK E;  4ZRI A;  2MQJ A;  1OGW A;  3JYU A;  4W9L A;  4HCN B;  2KKC A;  3PS6 A;  3VAW A;  3B0A A;  2M0X A;  3ZUN A;  2JVC A;  1R4M I;  3M63 B;  2NR2 A;  2C7N B;  2R2O A;  3QIJ A;  4BKT A;  4BKS A;  1S1Q B;  2KFK B;  3SHQ A;  1T0Y A;  4CYE A;  1L2N A;  3LDZ E;  2MX2 A;  3PZD A;  4W9C A;  2ZZP B;  3DPD A;  1WXM A;  4X57 B;  1OEY J;  4ICV A;  3L54 A;  2NPT A;  3A9J B;  3P2B A;  2RD0 A;  3UIN B;  2NBV B;  5TR5 A;  2LI5 A;  2ASQ A;  2LZ6 A;  4G11 A;  2HJ8 A;  1WR1 A;  4K81 A;  2WWZ A;  3ZW3 A;  4TUU A;  3KYC D;  1ZW7 A;  2ZNV B;  3L16 A;  2L0F A;  3APC A;  3RD2 A;  2GBR A;  3U8Z A;  2J0K A;  4HVB A;  3JVZ X;  3V6E B;  4DHZ B;  4W9G A;  1GNU A;  4GOC A;  3DBH I;  2KDI A;  2ZCB A;  3N3K B;  1SIF A;  1RLF A;  3PHW B;  2V4L A;  2MBO A;  3AXC A;  3TL5 A;  2Z0E B;  3TMP B;  3PTF C;  2DEN B;  4W9E A;  4B6W A;  2NBU A;  4WQO B;  4IWO A;  3N30 A;  2L7R A;  1WGH A;  1AAR A;  2IO3 B;  2K8H A;  4MSQ B;  2LXA A;  1ZKH A;  3H9D A;  4LDT B;  3PRZ A;  4M8M A;  1I35 A;  1YX6 B;  1WZ3 A;  2DYB A;  4FJV B;  1J19 A;  1WXA A;  2JWZ A;  2KWU B;  3HK0 A;  1U4A A;  1WGR A;  2A4Z A;  4CO7 A;  3BY4 B;  2JY6 A;  1WGD A;  3H7S A;  4WJQ A;  3WAN A;  3Q3J A;  4WJP A;  3ZNZ B;  1FXT B;  4AJY B;  5E6O A;  5IAA C;  3ZIM A;  1P0R A;  2MBH A;  1WXS A;  3PRE A;  1EUV B;  1E7U A;  3TCA A;  1F9J A;  4FHK A;  1WX7 A;  4XC2 A;  4AUQ C;  2ZVO A;  1TGZ B;  3W1S A;  3APD A;  2IO2 B;  3PRM B;  2MSE D;  3DOW A;  3VH3 B;  3DVN V;  2K25 A;  1UBI A;  2PEA A;  3V6C B;  2GBK A;  2MBE A;  4K7U A;  4ANW A;  1K8R B;  2BYV E;  1WY8 A;  2MBB B;  2KFJ A;  2D11 A;  2K8B A;  2KXJ A;  3M3J A;  4EZJ A;  1WGG A;  5GMV A;  1WE7 A;  3ZNG C;  2LRU A;  1WJN A;  2N7D A;  3KYD D;  3K9O B;  5D6J B;  1RFA A;  3VTV A;  5LXI B;  2BYF A;  2D10 A;  4ZRJ A;  5BO4 B;  3EEC A;  2XEW A;  3ZTD A;  4LJP B;  4BFR A;  4HK2 A;  4EUT A;  2CHZ A;  2ZVN A;  3EFU A;  3PHX B;  4BVU C;  2C7H A;  5DCN A;  4FBJ B;  2FID A;  3DBS A;  2D3G A;  1IPG A;  5D2M B;  2YVC A;  3PT2 B;  4IWP A;  3QJZ A;  5CX3 A;  4CHK A;  4DBG A;  4DHZ E;  3A4S C;  5DPS A;  3EHV A;  4HCP B;  4BBN C;  2WX0 A;  3ZLZ A;  1C1Y B;  1WMH B;  4G50 A;  3KH0 A;  4RM8 A;  2JZ3 B;  3HIZ A;  4NJ7 A;  3IFW B;  5J18 A;  4XZ4 A;  5HKH A;  2KWC A;  5E6N A;  2KD0 A;  2LRW A;  4DDI D;  3A1Q B;  3WAP A;  4W9D A;  2J0M A;  1WYW B;  2C5L C;  1UH6 A;  4MEL A;  4ZDV A;  3DVN U;  4E71 A;  2LUE A;  2KX3 A;  4IG7 B;  3R3M A;  2K1F A;  2KTR A;  4E3C A;  1V49 A;  2KMA A;  3PPA A;  1LQB A;  2RGF A;  4HPM B;  4HLE A;  4GDK B;  3VUX A;  2M17 A;  2JT4 B;  2L8J A;  3PLU A;  1GJZ A;  2K8C A;  5CTR C;  4DK5 A;  1V80 A;  2BWE S;  2BWF A;  4AP4 C;  4ANV A;  4URK A;  2KQ7 A;  2KJH B;  4B9K A;  1IP9 A;  3JSV A;  1YX5 B;  1P3Q U;  2HTH A;  3VUW A;  4IWQ A;  3QWZ B;  3CMM B;  2LGY A;  4ANX A;  1GC6 A;  2KK8 A;  2L05 A;  2ZNV C;  1HE8 A;  4FA6 A;  1E8X A;  4MSM B;  2V3S A;  3IG3 A;  4G0N B;  4KZ0 A;  3WA0 A;  4KSK C;  4K7S A;  4LJO B;  3VTW A;  1E5W A;  4PS8 A;  5AZG A;  1VCB A;  3A9K B;  3WIM A;  4KDL B;  3CST A;  2DZI A;  2M8S A;  4NAW A;  3M95 A;  2JUO A;  3TJP A;  1D3Z A;  3SU8 X;  1BT0 A;  2KMC A;  1J0G A;  3L10 B;  2O6V A;  2EMT A;  2GBN A;  4I6N B;  3VFK A;  3KVF B;  1R4N I;  2KDE B;  2C60 A;  1EF5 A;  4A3P A;  2JPH A;  1WRD B;  1WX9 A;  3B08 A;  4K1R B;  3R7Q A;  2KO3 A;  3ZVV A;  2B3A A;  3ZDT A;  3UIO B;  2KJ6 A;  2CR5 A;  3IVF A;  3SD5 A;  1Q0W B;  2DHZ A;  3ALB A;  4F8C B;  2N9P C;  2D2Q A;  2FNJ B;  2NPT B;  2KHW B;  3ZRC A;  1CMX B;  2IO0 B;  3V61 A;  2WDT B;  3NS8 A;  4GMV A;  2BGF A;  5LXH A;  2DAJ A;  2N1W A;  4JQW C;  1WF9 A;  1LM8 B;  1WJ4 A;  1XT9 B;  2DZM A;  2G4S A;  2KDB A;  4F7Z A;  2R2Q A;  4J6I A;  4K7W A;  3AI5 A;  3TIX A;  5AZH A;  1UBQ A;  2ZPN A;  3DCG A;  4ZRK A;  2IY0 B;  3TBL D;  5CHW A;  4MJS A;  1S3S G;  1NI2 A;  4MDK E;  4EZK A;  1E90 A;  3V60 A;  5JHB A;  3N32 A;  1WI0 A;  4PS7 A;  1X1M A;  3DBR I;  1JRU A;  1GC7 A;  1EF1 A;  2ZJD A;  4EZL A;  3VUY A;  2GOW A;  4KSL C;  4IUM B;  2ZEQ A;  1WR6 E;  3Q3F A;  1WIA A;  2N1V A;  5D7G A;  3H1U A;  1OQY A;  2CHW A;  2L0T A;  5J2R A;  1V5O A;  4GXB A;  5LLI A;  2Z0D B;  2FCQ A;  2UWQ A;  2O2V B;  4IW0 A;  2KZR A;  4W9I A;  2RPQ A;  3NZU A;  1Z2M A;  3ZO5 B;  5JH5 C;  2LVQ A;  3ZNI D;  1UGM A;  2NBW B;  3QA8 A;  1E8Z A;  3DQV A;  1Q5W B;  2IZV B;  1A5R A;  1H8C A;  3ZKJ C;  2HD5 B;  3H7P A;  4IM3 A;  3W1Y A;  4GDL A;  2AEH A;  2K39 A;  2N7E A;  2KOX A;  2BYE A;  1E7V A;  2AWT A;  2MWS B;  1E8W A;  4YL8 A;  2DZJ A;  1ZGU B;  1V9J A;  4WAA A;  4WWP A;  1YJ1 A;  1EO6 A;  2IY1 B;  2N9E B;  3MTN B;  3OJ3 A;  3QAQ A;  4DHJ B;  4DWF A;  2DAF A;  4BOS C;  4EOY A;  4NY0 A;  2QHO A;  2L3Z A;  1YIW A;  2I1J A;  1P98 A;  3SDL C;  4LDT D;  2KJR A;  1UEL A;  4JLC A;  4MGZ E;  2C9W B;  1KLV A;  3IHP C;  2JF5 A;  4FJY A;  1NBF C;  1RRB A;  4WJO A;  1PQS A;  2J7Q B;  4WJN A;  1WXV A;  5IA7 A;  1TTN A;  3A1Q A;  4IM2 A;  4BKG A;  2MP2 A;  1QZE A;  1TBE A;  2XBB C;  5JZE B;  3O65 B;  3HHM A;  4GSW A;  1V6E A;  4W9F A;  4AJW A;  4FN2 A;  4MM3 A;  2MA9 B;  3UQA A;  1J8C A;  2G45 B;  2LGD A;  3ONS A;  2LXC A;  3PSE B;  3NHE B;  4OVV A;  2W9N A;  4TQ1 A;  3WAL A;  4FJZ A;  1SGH A;  1V81 A;  3VVW B;  3KUD B;  4NQL B;  3L08 A;  2JZZ A;  4TKN A;  1Q1O A;  4W9H A;  2XK5 A;  1KOT A;  1RAX A;  4KIK A;  3L13 A;  4WWO A;  2KAN A;  2KN5 A;  1WJ6 A;  2RR9 A;  4W9J A;  3LJ3 A;  4PYU A;  1L7Y A;  3V62 A;  4A3O A;  2LWP A;  3RYT A;  3GZN I;  2MW5 A;  1OEY A;  2KNB A;  2KTR B;  3APF A;  2AYO B;  2LAS A;  3DDC B;  1IYF A;  4HDO A;  3IBE A;  4MGI E;  2RSU A;  1NDD A;  3NY5 A;  5AZF A;  4W9K A;  2CHX A;  2KFK A;  3DBL I;  1OTR B;  4HJK A;  4GIV A;  2FUH B;  4XX5 A;  2PE9 A;  1Y8R C;  4AOF A;  4MGY E;  4BOZ B;  1I42 A;  2MBQ A;  4DHJ D;  5KHQ A;  4JIO U;  2LVO A;  3A9J A;  4II3 B;  3JSV B;  4NNJ B;  2ZCC A;  4A20 A;  2REX A;  3PGE A;  3A4R A;  1WFY A;  1SE9 A;  3ML8 A;  1ISN A;  4JL9 A;  3VHT C;  1P9D U;  3AU4 A;  2BPS A;  3AUL A;  2GMI C;  3HM3 A;  3NZS A;  5KHO A;  2FCM A;  4M0W B;  3R7R A;  5G2N A;  2L76 A;  2L00 B;  3MHS D;  2N9X A;  2FAZ A;  4ICU A;  4PS3 A;  2FCS A;  3GOE A;  4NAW B;  1WZ0 A;  3RZF A;  4ASW C;  2D07 B;  2O6V B;  2IYD B;  2HE7 A;  4GB9 A;  4EEW A;  2KLG A;  5DPR A;  4P7I A;  3X23 A;  5CHF A;  4EKU A;  2KC2 A;  2CS4 A;  3QAR A;  4GGQ A;  1VD2 A;  2J0J A;  3A33 B;  1LFD A;  3ENE A;  2NCN A;  3RT3 B;  3QCA A;  3VDZ A;  3ML9 A;  3KUZ A;  4KZC A;  4JGH B;  3K9P B;  2K6D B;  1LXD A;  2K6Q A;  3HM6 X;  1E8Y A;  5C23 A;  3T9L A;  4F1S A;  4KDI C;  2DYM A;  5EDS A;  2CU1 A;  3W1S C;  2MLB A;  5AEK B;  5JHA A;  2I1K A;  4DDG D;  4I6L B;  3MJW A;  3RUL A;  2KX0 A;  2PJH A;  4NQK E;  4RM9 A;  2AL3 A;  5L83 A;  3VH4 B;  1KM7 A;  4IC7 B;  1G6J A;  4KV2 A;  1WE6 A;  4E74 A;  4FUL A;  4G3X B;  3NOB A;  4MJS B;  1UD7 A;  2DZK A;  2IBI B;  4II2 B;  1H4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...