3AE8B

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-isopropoxy-phenyl)-2-trifluoromethylbenzamide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Isopropoxy-phenyl)-2-trifluoromethylbenzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 54
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae8B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae8B01
3FAHA 3FC4A 1NENB 2B76B 1A70A 1J7CA 1N5XA 2DWQA 1DGJA 3P4SB 1JRPA 1GAQB 1V8CA 1KRHA 3NS1A 3AE3B 1H7XA 3W9CB 1E10A 4US9A 5EE9A 1B9RA 1H7WA 2M56B 4N6EB 2FBWB 1AYFA 1ZP0B 3AE2B 1WRIA 3BIID 1DOYA 2K22A 1T3QA 3CWIA 1N61A 2K9XA 4JWUC 4A9AA 1JQ4A 2CJNA 2LEKA 1IUEA 1QF6A 2BS4B 2N0SB 2WDQB 1N62A 4N58A 1WGKA 4N59A 1FFVA 2MJDA 3CIRB 2KMMA 1FO4A 3AH7A 1KFYB 3AE5B 1EWYC 1AWDA 2MJ3A 2AX5A 4YSYB 1YJJA 4JWSC 1NYQA 3AEGB 3AE7B 1J7AA 1ROEA 1OQRA 2BT6A 1UWMA 3SFEB 1YQ4B 1XO3A 1L5PA 3AN1A 2L83A 1JALA 2PKOA 2WQYB 1L6VA 2QJLA 1DOXA 3VR9B 1QOFA 1TJEA 2MH7A 2WDRB 5AUKA 3NVWA 1OQQA 3NVZA 3AE1B 3P1MA 5EE3A 2E3TA 1RWSA 1L0VB 1QOBA 4ITKA 1FFUA 1PUTA 3L4PA 1V97A 1VJKA 2H88B 1OFFA 3AECB 1NVID 1RM6C 1SB3C 3NRZA 2BS2B 4HROA 1GTHA 2PIAA 2PVOD 1L6UA 4YSXB 2L52A 3WCQA 2M19A 3B2GA 3AB5A 1F0ZA 1TKGA 4JX1C 3W5VB 3AE4B 2DBYA 1JWBD 1ZUD2 2QIEB 2G1EA 2H89B 5C2TB 4C7ZA 4USAA 1RFKA 4C7YA 3NVVA 4LTUA 1NEKB 4FXCA 1JROA 3PO0A 1GT8A 2PVGC 3DWGC 3P4PB 3SFDB 1QLBB 5GXGB 1N5WA 1WYGA 1CZPA 3ETRA 3AEFB 3LXFA 2JX5A 1YQ3B 1JWAD 3P4RB 1XLQA 5MPOA 1QT9A 5EE0A 2CJOA 1VLBA 1XLOA 3LB8C 4ZOHC 4HRSA 4YXDB 1DOIA 1NYRA 1TKEA 3B2FA 3NVYA 4YSZB 3KWLA 4US8A 2WS3B 5H8YE 1E7PB 3ZYYX 1WWTA 1GTEA 4ZHOA 1CJEA 1JW9D 2HTME 3W5UB 3AV8A 4WWMA 4ZHPA 1PFDA 1QOGA 1J7BA 4YT0B 4C80A 3HRDD 2WDVB 2K5PA 1QOAA 2MJEA 3DWMA 5G5GA 1I7HA 2CU3A 2W3RA 3AEDB 2EKIA 3SR6A 2WU2B 5G5HA 3HVZA 1ZOYB 1FXAA 1FM0D 1NI3A 1PDXA 4P6VF 1FRDA 1XLPA 1ZXIA 1FXIA 5AUIA 4YTNB 4YTMB 3AEBB 3VRAB 4KX6B 1SIJA 3EUB2 1E0ZA 1GPXA 1E9MA 2W3SA 1RYJA 1N60A 1SF0A 2ACZB 1TKYA 2Q5WD 2WLBA 1YJIA 3VRBB 4IDIA 3AE9B 3CF4A 1TYGB 3AE8B 5EE1A 3AMZA 1FRRA 2KAJA 1R7SA 1VDVA 3HUIA 2WU5B 3ABVB 1XLNA 1FIQA 2W55A 3AEEB 3P4QB 3P63A 1KF6B 3B9JA 3AM9A 1N63A 2W54A 5H92C 4YTPB 3VR8B 3AEAB 4WQMA 1FMAD 5C3JB 2OHFA 2BS3B 3AE6B 1E6EB 1WXQA 2JQRB 2WP9B 3RPFC 2Y5CA
chains in the Genus database with same CATH superfamily
1OGWA 1HXYD 3P4SB 2K6QA 4NNJB 4US9A 3B1LX 2Y5PA 3I5JC 3BIID 1ZE3D 3KVFB 3CWIA 1R4MB 2KFKB 1AN8A 1IUEA 1S1QB 2NTSA 4MGKE 3QIJA 4FJZA 1FO4A 4WWOA 4XWWA 3AE7B 3SFEB 1ACCA 1L5PA 4NY0A 3N1XC 2MP2A 2BYVE 3L54A 3NVZA 2V3PA 4GDLA 4RFBA 1SSNA 3OJ3A 3DVNU 3E9SA 3T9LA 5G2NA 3IXSA 3AB5A 1WXVA 2WXNA 4EEWA 4JX1C 4C7ZA 1PGXA 3IHPC 2MHJA 3HHMA 2CHWA 4CQNA 2VRRB 1K53A 1SJED 4WH4A 4US8A 5H8YE 3CSTA 4HCNB 2D3CA 3BYTB 4GU2A 1GTEA 1B1ZA 1WJ4A 1OEYJ 1SJHD 4ZHPA 1PFDA 4EE2A 1IBXB 2R2QA 2IJ0A 2LRUA 4K7UA 4K7SA 1SF0A 2Q5WD 1E5WA 3RZFA 4W9FA 1VDVA 5FK9C 2ZEQA 2IGDA 2V3NA 1K8RB 1V81A 4KIKB 3FAHA 2RPQA 3GS2A 2J0JA 3A9KB 4AP4C 2FAZA 1V8CA 4K1RB 2LJ5A 2FBWB 2O2VB 1P0RA 4GXBA 2K3UA 2KZRA 1XCQL 2KYWA 1TS2A 2IO2B 1C76A 1E8ZA 3JSVA 3VVWB 2JWZA 5IP4D 1JALA 1TJEA 1UGMA 4G3XB 4S17A 1V6EA 2PW9A 1C4CA 2KXJA 2NCNA 3KW5B 4NJ6A 4LJPB 1TBEA 1OFFA 1PYWD 3N1YC 3O65B 1UGJA 2MRPA 1WGGA 1IGDA 2Y5BB 3Q3OC 3EA6A 2XK5B 3GZNI 2WNMA 2LWPA 2OOBB 4LNKA 1WXMA 4W9JA 3AXCA 3PSEB 1XLOA 3B2FA 1YX6B 2PJHA 2X38A 3EFCA 2HTME 3AV8A 1HTOA 1WM2A 4A90A 4MGZE 2WXMA 2FCQA 4EKUA 2KQ4X 4M8MA 4AS1A 1FRDA 1XLPA 2KT7A 4LK0M 3AEBB 3EUB2 4DK5A 3PZ7A 1E0ZA 2G4DB 1RYJA 4WIPA 3Q8BA 3TIXA 4PS7A 4JGHB 4ICUA 4P1CC 2KC2A 3AEEB 1WX9A 3N20C 5H92C 1FMAD 5KHOA 2OHFA 2WP9B 3MJWA 2LI5A 2L7RA 1ZDXA 1NDDA 3VTVA 3Q3JA 3Q3MC 3PRPB 1XEEA 1M4VA 2JXTA 1DOYA 5JH5C 1WRDB 4I6PA 4WJNA 1V1PA 1LM8B 1QKZA 2JWUA 3BVGA 4D2KA 2FCNA 3MTNB 1EWYC 2KK8A 3AEGB 1WMHA 2INNE 5CTRC 3RNCC 3B0AA 4EZKA 2FIFA 2C9WB 1TY2A 1DOXA 3TJPA 3GP7A 4XDDA 5CHWA 3AE1B 3UINB 2DX5B 5HG2A 2JZPA 3BINA 3H7SA 2PEAA 1WH3A 4MM3A 4LCDE 1Q5WB 4FJYA 2G4SA 3V62A 3FILB 2RPVA 3ZNID 2IO1B 5LNK1 1TKGA 2JYTA 3W5VB 1P7FA 1GOZA 3PLVA 4FADA 3N32A 3ZJTA 3IBEA 3IVFA 3AULA 4M8NA 3RNEC 3N30A 4RH6A 2ZVNA 1H4RA 1WYGA 2LVQA 4A3OA 1RFAA 4EOYA 3DVGY 2KTRA 3ZKJC 2HE7A 2LRWA 3ZJUA 1ZXHA 4N9F4 2K5PA 3ZJVA 3UGBB 1ZPSA 3RZWC 2ZZPB 3IT4B 4HCPB 1VR9A 2I1KA 2NPTA 2N9LA 4JLCA 3A4SC 2WWZA 2WLBA 4IG7B 2FCMA 3CF4A 5C1ZA 2BF8B 1YN3A 4LNNA 2K0PA 3UIOB 3VR8B 4PYZA 4WQMA 3M95A 1FCCC 1E90A 2K25A 1NENB 1N5XA 1JRPA 3ENEA 1IGCA 2M0AA 3AE3B 4II3B 2ON8A 3GE3C 4P7IA 3ECIA 4ZYNA 4L23A 2KHWB 5BMGA 4BOZB 4KVGB 2BTEA 2QILA 1XCTL 3U52E 3ZDTA 2JVCA 2WHIA 2XN9C 2KMMA 4JWSC 3A1QB 3WALA 1OQRA 1I4QA 1UWMA 1YN4A 2L83A 3O13A 3V6EB 1UUPA 2RMMA 1GJZA 4GIVA 3VR9B 3DCGA 2JRHA 3Q2AC 2C7NB 3NVWA 4A8XC 2IPKD 1C4PA 2JZZA 2DZMA 1VZ8A 4EUTA 1PUTA 1F77A 1HEZE 3L4PA 4KGRA 2WXPA 2N9KA 2IBIB 4ACFA 1JWUD 2BS2B 2WX0A 2J42A 1X1MA 2K8BA 2KDBA 1GTHA 3S2AA 5D94A 2KWUB 4PYUA 3DHGC 2JZ3B 4ZRJA 1SE2A 4FXCA 3QK0A 3RMKC 4ZYSA 4A6QA 1C4AA 2RD0A 2A4ZA 5EE0A 2LUEA 1MHHE 2BQQA 3ALBA 4RGNA 4NJCA 2NBUA 1Z2MA 2PTLA 4ZHOA 3HIZA 4C4VA 3VXWA 5DPWA 2N7EA 3W1SC 1FNUA 1WFYA 2WU2B 1SGHA 2XBBC 2ZVOA 4P6VF 4URKA 1MHXA 4CO7A 2KVRA 1SIJA 4B6WA 3DBRI 4KDLB 2V1YA 3URYA 4DDGD 2KFKA 4FULA 3U4EG 4IM0A 3QHTA 1WXQA 2LGYA 2B76B 1J8CA 1JMLA 3W9CB 5EE9A 2BKFA 2I2YA 3PHXB 5IO9A 1E8XA 2Z59B 1Q1OA 2KLCA 2CKHB 3WIMA 2BS4B 4RMAA 2GMIC 2CU1A 5J17A 3MP9A 1H8CA 1UNSA 5EDSA 4DXAB 4M01A 3V60A 2BT6A 2NPTB 5BMIA 2OJWA 1C9FA 3SDLC 2J52A 3DBLI 2AYOB 3ML9A 1OQQA 2IGGA 4WQOB 2IYDB 2WXKA 2VZKB 4KV2A 1VZ6A 3BVZA 1UH6A 1ZDVA 1XD3B 3IFWB 1SB3C 5IOIA 3HVDA 2YVCA 2J53A 1F0ZA 4G50A 1JCKB 1WXAA 2DAFA 2YEPF 4R3DA 1T5XD 1EWCA 3ZNGC 2DZJA 3OWEB 1XXGA 2DENB 1T0RC 1SXTA 3ETRA 3AEFB 5CX3A 5L95C 1IBXA 1JWAD 1OQYA 1SEBD 4KKJA 1D5MC 5KHQA 3PRZA 2KMAA 5DPSA 1EUVB 4DHJB 4LDTB 5DCNA 2W3RA 2LGXA 3L17A 1NI2A 4KIKA 3A4RA 3A9KA 1TYGB 1R7SA 2G45B 2O2VA 3P63A 3ZO5B 1LO5D 4TSSA 3CF6E 5D7GA 4CYEA 2RR9A 4M0WB 4I6LB 1GNUA 1UD7A 3EECA 4FJVB 4RF1A 3FKYA 4N6EB 2M8SA 4W9EA 1ZP0B 1T3QA 4A9AA 1ESFA 3PZ8A 1WGKA 4C4VB 2G3QB 2KDMA 4X57B 1JRUA 1KTKA 4YSYB 1YJJA 3R7RA 4K81A 3BY4B 2Z0DB 2PKOA 2KX0A 4KGTA 2XK5A 1L0VB 1P7EA 4EZLA 1Z5SB 3CSFA 1WZ3A 2CHZA 1C78A 1TZ1A 1D4BA 3WAPA 3I9V1 2PIAA 2KQ7A 3TL5A 5AZGA 2L0FA 1WE6A 1YJ1A 3H9DA 3VQIA 3MHZA 2WXFA 1KOTA 1FEHA 4WJQA 4USAA 1GT8A 2E6XA 2JPHA 2QMTA 3PZDA 4MGIE 1D6EC 2ASQA 3P4PB 3BWUD 1WZ0A 3NUHB 2IZVB 2YLMA 3ZW3A 1MG8A 1V80A 4YXDB 3L08A 3KWLA 3QA8A 4RM9A 1WGHA 4LNIA 3W1YA 2KDEB 3DWMA 3UF8A 2WGSA 3TEXA 2ZCCA 4W9DA 3M63B 1NBFC 3QQ8B 1GC6A 1ZXIA 1RLFA 4YTMB 1HZ6A 4W9CA 4KX6B 1E9MA 1WR1A 2C7HA 2RDGA 1OTRB 1GUAB 4MJSB 3ZNZB 2BYEA 3TEZA 3OG5A 2JXXA 4NZLB 2K9XA 4P1BC 2D10A 1GAQB 1E10A 2GI9A 3ZRCA 2WXHA 2BB5A 3C8YA 2MW5A 1N61A 4HEA1 4HJGE 1WGYA 4TQ1A 1MVKA 3JW0X 2LFIA 3CIRB 2EELA 1QQRA 5IA7A 4M00A 2BGFA 1J7AA 3FILA 3LDZE 3KH0A 1YN5A 2VZKD 1BT0A 2D11A 1V97A 1L0XB 2LVOA 3RI7C 1L4ZB 2DNFA 3U7ZA 2PVOD 2JY6A 3WA0A 1UBIA 2MQJA 2DBYA 4ZRKA 5LXIB 4W9GA 1E7UA 4XZ4A 3TUOA 4BBNC 3NVVA 5HHDG 4JE3B 4E3CA 2KTFA 1QLBB 4ZDVA 1EO6A 3I57A 5LXHA 3H8HA 4HRSA 1TKEA 3NZSA 1R4NB 4DHJD 4LDTD 2RGFA 2QCZA 4DWFA 4YT0B 1DYQA 3AEDB 4BOSC 3QJZA 4J6IA 1FXIA 2ZPNA 3PVLA 1GPXA 1V9JA 1N60A 4FLHA 1FD6A 2KANA 1I42A 2KAJA 4M02A 2FUHB 3ABVB 4ANXA 3ML8A 4HWIB 4JIOU 4E74A 3L10B 1IP9A 2WXQA 2AQ2B 5CHFA 3RPFC 2Y5CA 2V3SA 3L16A 3Q69A 4Q2JA 3A1QA 2ICIA 3T3NA 3ZUNA 3PS6A 2HDEA 3R3MA 2MSED 3VUYA 4ZRPA 1T0SC 2KOXA 3DVGX 1N62A 2QSDA 3DVNV 1WI0A 2KJ6A 1T0QC 2V4IB 3AE5B 1K50A 1Y56A 3DPDA 2AX5A 2D3AA 2LXCA 2D3GA 1GB1A 4HJKA 3RNGC 5BMHA 3QARA 3R8BA 4F7ZA 1R4MI 2AL6A 2YEPB 1VJKA 3HK0A 5D2MB 4PT5A 3ZNHB 1SE4A 4G11A 2I1JA 2LGSA 1D5ZC 4YSXB 3N1ZC 4HK2A 2N7JA 1JWBD 1ZUD2 1Q0WB 1YNTE 2W9NA 4OVVA 1BMLC 4MH0E 1RFKA 1KLGD 2R2OA 2VH2A 1YIWA 3N3KB 2DZIA 5GXGB 2KJHB 3PRMB 2CJOA 4XC2A 3UI3A 3KQ4A 2NVUI 3KYCD 4RCOA 1WF9A 4II2B 3EHVA 3DBHI 4RF0A 4S0RA 2NS5A 3LYYA 4IM3A 3ZXVA 4GGQA 2AQ3B 3A33B 4L2YA 3N9YC 5HFYA 4YTNB 3NHEB 2NTTA 2PLPA 3SEBA 3V61A 2WU5B 3RUIB 1AW7A 1JWMD 2BPSA 3AI5A 3DBSA 2LASA 2BYTA 2LZ6A 2N1WA 2LHDA 2M56B 1AYFA 1JQ4A 1QF6A 2WDQB 4K7WA 1I4RA 3JVZX 3VUXA 2WQYB 2QJLA 1TIFA 1I4XA 4IUMB 4DHZB 1WGRA 1RWSA 4HPMB 2KACA 2L1AA 4PS3A 2DZKA 1YOVB 1NVID 2KX3A 4HROA 3B2GA 2KKCA 1HTQA 4ICVA 1UBQA 4P16A 2M4NA 2H89B 1C1YB 4HDOA 5D3DA 4I6NB 4IM2A 1YQBA 3APFA 3KWVA 3QWZB 3TCAA 4YL8A 3R66C 3Q6BA 3SHQA 3EC8A 3ZXRA 2L76A 3NS8A 1C3TA 3KYDD 4HVBA 3HRDD 5G5GA 4FA6A 5G5HA 2J4XA 2IDYA 1EU3A 3IAS1 5FR3A 1SIFA 3TBLD 5AUIA 4HKZE 5JHAA 2MCNB 2LVPA 4M0WA 1FRRA 2WXIA 3ZDMC 4NAMA 4A3PA 2X8XX 5TR5A 3AU5A 1Y8RC 2GLSA 5JHBA 3NG0A 3NS1A 3NZ3A 4FHJA 2MX2A 2JT4B 3UQBA 1CMXB 3P42A 4JQWC 4LNFA 2LEKA 3PLUA 4ZRQA 4DHZE 2N0SB 4DXGA 1KLUD 1TY0A 2AL3A 4IKGA 1AWDA 2IGHA 2B3AA 5BYSA 2ZNVC 1NYQA 1ROEA 1XO3A 3MC9A 5AUKA 2ZJDA 3VUWA 1FFUA 4BBNF 2MBHA 5BO4B 2UU7A 4WAAA 5AEKB 1BUIC 4DDID 1ET6A 3Q8CA 1K52A 3RNAC 3APCA 4ARCA 3X23A 1WR6E 1U4AA 3IT6B 5JXVA 3KLSX 4HPLB 4B0EA 2K8CA 1CZPA 1KM7A 2OEDA 1TS3A 3LXFA 3CMMB 1YQ3B 1XLQA 5MPOA 2SAKA 1Q10A 2BWES 3K9PB 1JW9D 3W5UB 1VCBA 1E7VA 3Q8EA 4MJSA 3U30A 4EZJA 1TS4A 2KLGA 4PS8A 4KDIC 2K6DB 2I38A 2WDTB 2LXAA 1L7YA 3H1UA 2M1MA 4MT5A 3P4QB 1LFDA 3AM9A 4YTPB 3AEAB 3OAWA 2JQRB 3W2DA 2OJRA 3RNBC 2IY1B 4QAYA 3OLMD 3Q8AA 3APDA 3PHWB 2IO3B 1ISNA 1I4PA 5HKHA 2O6VB 2KN5A 2R61A 3PV1A 2NMQA 1L2NA 3VH3B 1YMHE 2CJNA 3BVMA 4N58A 2HJ8A 2MLBA 1G6JA 2K8HA 1GB4A 2GBMA 2FUG1 4GDKB 3MJ5A 1YQ4B 2WDRB 4RGOS 3GZNB 2GB1A 1FNVA 4ITKA 3QX1A 2INPE 4H2AA 2GRIA 3BZDB 2KWDA 1F52A 3L13A 1VD2A 3NRZA 3H6NA 3RYTA 3TSSA 1J0GA 2GOWA 3ZRFA 2JU6X 3VAWA 2JUOA 3V6CB 3A9JA 3EGRA 4W9HA 2M17A 4HDQA 4UDUC 1EF5A 2PVGC 3DWGC 1TZOA 1J19A 2KFJA 3E56A 4KZ0A 3P4RB 1IYFA 1QT9A 1VLBA 2RSUA 1DOIA 4DBGA 2JYEA 2BB6A 3PGEA 2ZW0A 1VRAB 4NPNA 4WWMA 4C80A 2MJEA 4HXDA 5DPRA 2EKIA 1F1HA 1PDXA 3UQAA 3BYYB 3VRAB 2N1VA 2KJRA 1STEA 2WYQA 4JPSA 2KDIA 4LLGM 3EFUA 2EMSA 4JL9A 2D3BA 3SU8X 5GMVA 5J2RA 3DHIC 2DWQA 1DGJA 2AWTA 1H7WA 4NQKE 2FCSA 4K3CA 2K22A 2BWFA 4OHJA 3Q14C 2J0KA 2QDFA 3MC8A 1WJ6A 2C60A 1GC7A 5TSSA 1EM7A 1ENFA 4B95A 3GE8C 4W9LA 2MJ3A 1EF1A 1HQRD 2J0MA 5E6JA 2MH7A 1SE3A 2Y3AA 3DBHB 4NQLB 5I4DA 1MJDA 1OEYA 3QCAA 5IN7A 1F2RI 3GOEA 2N9XA 2QIEB 2G1EA 5C2TB 2KDFB 2INDC 4YWGG 4CHKA 5IAAC 1NEKB 1JROA 2K39A 3U2SC 1D3ZA 4MSQB 1P9DU 4AOFA 4DXFA 2L8JA 3LB8C 3ONSA 4ZOHC 1NYRA 3NVYA 4BKSD 2KN4A 2IY0B 1QZEA 1TS5A 2FIDA 2QEJC 3M62B 3NZUA 2GBRA 2N9EB 3C0RB 2PPHA 4ANVA 4BZAA 1UZXB 2V9HA 4FBJB 3RULA 2LGIA 4ZRIA 5JZEB 1NI3A 4F8CB 5BYQA 3NOBA 4IDIA 1HE8A 1GG3A 1CK1A 1SE9A 3A9JB 1FIQA 2W55A 3LJ3A 2XEWA 4FN2A 3R2IA 1K51A 4IWQA 2HJ1A 3FC4A 5CHVC 3H7PA 2O6VD 2AQ1B 2M0XA 3OJ4B 2BBCA 4XX5A 1B9RA 2D07B 2LGDA 4KGSA 3VHTC 2GBJA 1E8YA 2QHOA 3GB1A 1TGZB 1L4DB 1T6BX 1FFVA 1ET9A 1MPEA 2W82A 3KUZA 2CHXA 2KD0A 1WX8A 2V0GA 3RNFC 3AN1A 2ZW1A 4TV3A 3RFZB 3RCZA 1PGBA 1WIAA 2K1FA 2MA9B 2H88B 4FHKA 3AECB 1PQSA 1RM6C 3ZGZA 4MEMA 1FCLA 2A5UA 4RGTA 3NY5A 2V4LA 1YX5B 4OZCA 2M19A 1RAXA 2MP2B 4A20A 3T3OA 4GDLB 2PMVA 4BFRA 2G9HD 4C7YA 1UWXA 3L0WB 3PO0A 4MELA 1YD8U 4HLEA 1C77A 2RDHA 4TMAB 1N5WA 3TEWA 3JYUA 2BYFA 4K3BA 4O1NA 5C23A 3ZLZA 1LQBA 1I4HA 4L1BA 3BK2A 1WXSA 2NBVB 2IO0B 1V5TA 1MG4A 2JRIB 4WWPA 2C5LC 2KO3A 3DBRB 3I3TB 1WWTA 2BKRB 2KMCA 1ZW7A 2KNBA 4HKQA 1QOAA 2KVZA 2LUMA 4TQ0A 1L0YB 1WE7A 3VTUA 3M3JA 1FXAA 1T0YA 2RDBC 2HTHA 3PTFC 5AZFA 2LD9A 4E71A 4AWJA 2LJIA 1WJUA 3VRBB 3AE9B 1SBBB 4KSKC 4BVUC 2MBEA 2DHZA 3VDZA 2N7DA 1N63A 1P98A 4F1SA 4B0MA 4IWOA 5C3JB 1E6EB 3MC0B 1XT9B 4W9IA 4WURA 2J7QB 4IOIE 1KRHA 5E6PA 1AARA 3DBLB 4OVUA 1RRBA 3WAMA 4IC7B 3BK1A 2KQSA 3QAQA 1P1AA 3ZTCA 2NBWB 2L0TA 1I4GA 1WX7A 2LHEA 1KFYB 2PE9A 1XF5L 4C56C 2WXLA 4IW0A 1M94A 2DYBA 3W1SA 5DPTA 2L3ZA 3P1MA 4GLSC 1I35A 3T8MA 2DYMA 1V86A 4WJPA 3JSVB 4ASWC 4A55A 2N9PC 2L32A 4EFOA 2UWQA 3H7PB 1WJNA 4LTUA 2Z0EB 2GBNA 4GN1A 1P3QU 4BKSA 2KWVB 5HI1A 4AJYB 3VH4B 1WY8A 4GMVA 2BVCA 3V05A 1MI0A 5E6OA 4OW0A 1E7PB 4MDKE 3DQVA 1CJEA 3WANA 2XNAC 1WYWB 2MEKA 2WDVB 2BW2A 3DHHC 4LJOB 4WAFA 2CU3A 3Q3FA 3SR6A 1XQQA 1LXDA 3DOWA 1YJIA 1R4NI 4KKIA 2CR5A 4MSMB 3HUIA 1FXTB 2O6VA 1XLNA 3WAOA 3B9JA 2W54A 5FR6A 1IPGA 4OVZA 1F9JA 1A70A 1J7CA 3R2TA 1ZKHA 3Q3NC 4GDKA 1H7XA 2NR2A 1TTNA 2MBBB 3DDCB 3ZVVA 3C19A 3AE2B 1WRIA 4JWUC 4XYCA 2Z8LA 3Q8FA 4N59A 1WM3A 2MJDA 2INCC 3RD2A 5LLIA 1PGAA 1LGRA 4B9KA 1L6VA 1QOFA 2L05A 1MFWA 1QOBA 5AZHA 5D6JB 3RN9C 3TEYA 1V1PB 2ZPYA 4REZA 1N6ZA 3R7QA 4J3OD 5G55A 1HA5A 1KJTA 4XDCA 4AUQC 1WMHB 1V49A 3WCQA 1QILA 2SEBD 2AEHA 2WXOA 4OZAA 1JWSD 4AQ7A 1UF0A 1F2RC 3U7DA 3B08A 1TT5B 4WWNA 5BYRA 4NAWA 1V5OA 5FKAC 3IG3A 3SFDB 4MM3B 2KWCA 4HPPA 4GSWA 4NJ7A 2JX5A 1FPYA 2KC1A 4YSZB 3K9OB 3PT2B 2JSVX 4LNOA 3ZYYX 2MBQA 1V1OA 1KH0A 1J7BA 4MACA 1HZ5A 1WSPA 2MWSB 4ANUA 1I7HA 5L83A 3SD5A 2TSSA 3HVZA 3V3XA 1FM0D 2KTRB 4PK1A 2EKEC 2VH1A 3D32A 1VZ7A 3KUCB 2ACZB 3AE8B 3AMZA 2ZNVB 3I63C 3ZQ4A 4RM8A 4XWTA 3QC8B 3P2BA 2EMTA 5IKCM 2DLBA 2DYOA 2BS3B 3AE6B 4GB9A 4TUUA 2HD5B 3PREA 2JF5A 2REXA 1D5XC 1FNWA 5T8IA 4MH8A 2DAJA 2ZCBA 4RGMA 2ONQA 1UELA 5E6NA 1EU4A 4ANWA 1BXTA 2WXRA 4TKNA 3AH7A 3J9CA 3AU4A 4W9KA 1V2YA 5D3IB 3UIPB 4BAXA 5EE3A 2WXJA 2E3TA 3KUDB 4RNAA 4IWPA 2PE6B 2QC8A 4AJWA 2MBOA 3MFGA 4ARIA 1L6UA 2L52A 3VFKA 3AE4B 2WX1A 4GOCA 1C79A 2N4FA 3X0WA 2CS4A 5J18A 4C00A 2D2QA 3IAM1 2L00B 4OZBA 1E8WA 2FNJB 2FE8A 1A5RA 1CQVA 4BKGA 3HM6X 3ZIMA 1WGDA 2UYZB 3VTWA 3ZTDA 3TMPB 2WS3B 1S3SG 4G0NB 4DQOC 1QOGA 3PPAA 4XGAB 3MHSD 3U8ZA 1ZOYB 2D5GA 4WJOA 4KZCA 3NJTA 3HM3A 2W3SA 1TKYA 5EE1A 2LMCA 1KLVA 2C7MB 4XE0A 4BKTA 1KF6B 2WXGA 4KSLC 3RT3B 1ZGUB 4NAWB 2GBKA 4MGYE
chains in the Genus database with same CATH topology
3FC4A 2B76B 1HXYD 2AQ1B 3P4SB 2BBCA 2LHDA 1JMLA 3W9CB 4US9A 5EE9A 1B9RA 2I2YA 4KGSA 2M56B 1AYFA 2Y5PA 3BIID 1ZE3D 3GB1A 3CWIA 1AN8A 1QF6A 1L4DB 1IUEA 1JQ4A 2BS4B 2WDQB 1T6BX 1FFVA 2NTSA 3MP9A 1ET9A 1MPEA 1FO4A 2W82A 1UNSA 4XWWA 1I4RA 3AE7B 2BT6A 2V0GA 3SFEB 1ACCA 5BMIA 1L5PA 3AN1A 2WQYB 1C9FA 2QJLA 2ZW1A 2J52A 1OQQA 3NVZA 1I4XA 2V3PA 1RWSA 4RFBA 2IGGA 3RFZB 1PGBA 1SSNA 2KACA 2WXKA 2L1AA 2VZKB 2H88B 1VZ6A 3BVZA 3AECB 1NVID 1ZDVA 3E9SA 1RM6C 1SB3C 3ZGZA 1FCLA 4HROA 3HVDA 4RGTA 2J53A 4OZCA 3IXSA 2M19A 3B2GA 3AB5A 1F0ZA 2WXNA 1JCKB 4JX1C 2YEPF 4R3DA 3T3OA 1T5XD 4P16A 4GDLB 2PMVA 1EWCA 2H89B 4C7ZA 5D3DA 2G9HD 4C7YA 1UWXA 1PGXA 3PO0A 3OWEB 1C77A 4CQNA 2RDHA 1XXGA 1N5WA 4TMAB 3TEWA 1K53A 1SXTA 3ETRA 3AEFB 4O1NA 1IBXA 1JWAD 3KWVA 1SEBD 1I4HA 4L1BA 4KKJA 3BK2A 1SJED 4WH4A 1D5MC 4US8A 5H8YE 3BYTB 1WWTA 1GTEA 1B1ZA 1SJHD 4ZHPA 1PFDA 3HRDD 4HKQA 1QOAA 5G5GA 2LUMA 4TQ0A 2W3RA 4EE2A 1L0YB 1IBXB 5G5HA 2J4XA 2IDYA 2IJ0A 1EU3A 1FXAA 3IAS1 5FR3A 5AUIA 4HKZE 2LJIA 1SF0A 2Q5WD 3VRBB 4M0WA 3AE9B 1TYGB 1SBBB 1FRRA 1R7SA 1VDVA 2WXIA 4NAMA 3P63A 1LO5D 5FK9C 4TSSA 1N63A 4B0MA 2IGDA 5C3JB 2V3NA 1E6EB 3MC0B 3FAHA 3GS2A 4WURA 4IOIE 3NS1A 1V8CA 3NZ3A 5D7GA 1KRHA 4RF1A 4N6EB 2FBWB 3P42A 1ZP0B 3BK1A 1T3QA 4A9AA 2LEKA 4ZRQA 2K3UA 2N0SB 1ESFA 3PZ8A 1I4GA 1XCQL 1WGKA 4DXGA 2LHEA 1KLUD 1TY0A 2KDMA 1KFYB 4IKGA 1TS2A 1AWDA 1KTKA 2IGHA 4YSYB 1XF5L 1YJJA 1C76A 2WXLA 1NYQA 4C56C 5BYSA 1ROEA 1XO3A 2PKOA 1JALA 3W1SA 1TJEA 5AUKA 3P1MA 2PW9A 4KGTA 1L0VB 1P7EA 4GLSC 1C4CA 1FFUA 1C78A 1BUIC 1OFFA 2DYMA 1D4BA 1PYWD 1UGJA 3I9V1 2PIAA 1ET6A 3Q8CA 1K52A 4A55A 1IGDA 4ARCA 2L32A 3VQIA 3MHZA 3EA6A 2WXFA 1FEHA 3IT6B 4USAA 2WNMA 4LTUA 5JXVA 1GT8A 2E6XA 2QMTA 3KLSX 4B0EA 1D6EC 5HI1A 3P4PB 3BWUD 3NUHB 1CZPA 2OEDA 1TS3A 3LXFA 1YQ3B 1XLQA 5MPOA 2SAKA 1Q10A 3V05A 1MI0A 1XLOA 4YXDB 3B2FA 3KWLA 4OW0A 1E7PB 2X38A 1CJEA 1JW9D 2HTME 2XNAC 3W5UB 3AV8A 3Q8EA 4A90A 2MEKA 2WDVB 2BW2A 2WXMA 3DWMA 4WAFA 2KQ4X 2CU3A 3TEXA 3SR6A 1TS4A 4AS1A 1FRDA 1XLPA 1ZXIA 4LK0M 4YTMB 3AEBB 1HZ6A 4KX6B 3EUB2 2I38A 3PZ7A 1E0ZA 1E9MA 1RYJA 2RDGA 4WIPA 3Q8BA 1YJIA 4KKIA 3HUIA 1XLNA 4MT5A 3AEEB 3P4QB 3B9JA 3TEZA 3AM9A 5H92C 2W54A 4YTPB 3AEAB 1FMAD 2OHFA 4NZLB 4OVZA 2JQRB 2K9XA 2WP9B 3W2DA 1ZDXA 1A70A 1J7CA 3R2TA 1GAQB 3Q8AA 1E10A 2GI9A 1H7XA 2WXHA 1I4PA 2BB5A 3AE2B 1WRIA 2R61A 3C8YA 2NMQA 1XEEA 1M4VA 2JXTA 4JWUC 1DOYA 1N61A 4HEA1 4HJGE 1YMHE 2CJNA 2Z8LA 3Q8FA 4TQ1A 3BVMA 1V1PA 4N58A 4N59A 1MVKA 1QKZA 2LFIA 2JWUA 2MJDA 3CIRB 3BVGA 4D2KA 2EELA 1EWYC 1QQRA 1GB4A 3AEGB 2FUG1 2INNE 1J7AA 1PGAA 3FILA 3MJ5A 4GDKB 1YQ4B 1DOXA 1TY2A 1L6VA 1YN5A 1QOFA 2VZKD 3GP7A 4XDDA 2WDRB 3AE1B 4RGOS 1QOBA 2GB1A 1FNVA 4ITKA 2INPE 5HG2A 2JZPA 3TEYA 1V1PB 1V97A 4H2AA 2GRIA 4REZA 1L0XB 3BZDB 2KWDA 1L4ZB 4J3OD 1HA5A 3NRZA 4XDCA 3U7ZA 2PVOD 3FILB 2RPVA 3WCQA 3TSSA 5LNK1 1QILA 2SEBD 1TKGA 2JYTA 2WXOA 3W5VB 2DBYA 4OZAA 1JWSD 2JU6X 1P7FA 1GOZA 4AQ7A 1F2RC 3EGRA 3ZJTA 3TUOA 3NVVA 5HHDG 4UDUC 5BYRA 4JE3B 2PVGC 4RH6A 3DWGC 5FKAC 1TZOA 3SFDB 1QLBB 4MM3B 1WYGA 2JX5A 3E56A 3P4RB 3I57A 1QT9A 3H8HA 1VLBA 4HRSA 1DOIA 1TKEA 4YSZB 2JSVX 2JYEA 2BB6A 3ZYYX 3ZJUA 2ZW0A 1VRAB 1ZXHA 1V1OA 4WWMA 1KH0A 1J7BA 4YT0B 4C80A 4MACA 2K5PA 1HZ5A 1WSPA 2MJEA 3ZJVA 1ZPSA 1I7HA 3IT4B 1DYQA 3AEDB 2EKIA 1VR9A 2TSSA 3HVZA 3V3XA 1FM0D 1PDXA 3BYYB 1FXIA 2N9LA 3VRAB 1VZ7A 1GPXA 1N60A 1FD6A 2ACZB 2WLBA 3CF4A 1STEA 3AE8B 1YN3A 3AMZA 2KAJA 4JPSA 3ABVB 3ZQ4A 4LLGM 2K0PA 4XWTA 3VR8B 4WQMA 2DLBA 2DYOA 2WXQA 2BS3B 3AE6B 1FCCC 2AQ2B 3RPFC 2Y5CA 1NENB 1N5XA 2DWQA 1DGJA 1JRPA 3Q69A 1IGCA 4Q2JA 1D5XC 2ICIA 3AE3B 2M0AA 3T3NA 1FNWA 2HDEA 2ON8A 1H7WA 5T8IA 4MH8A 4RGMA 4L23A 5BMGA 2ONQA 2K22A 4ZRPA 4OHJA 2BTEA 2QILA 1XCTL 1EU4A 3U52E 1N62A 2QSDA 2XN9C 5TSSA 1BXTA 2KMMA 2WXRA 1EM7A 1ENFA 3AH7A 3J9CA 2V4IB 3AE5B 1K50A 1Y56A 2MJ3A 2AX5A 4JWSC 1HQRD 1OQRA 1I4QA 1UWMA 1GB1A 5BMHA 1YN4A 2L83A 3O13A 1UUPA 5E6JA 2RMMA 3VR9B 2MH7A 1SE3A 2Y3AA 3NVWA 5D3IB 4A8XC 5EE3A 2WXJA 2E3TA 2IPKD 1C4PA 4RNAA 1VZ8A 1PUTA 1F77A 3R8BA 1HEZE 5I4DA 3L4PA 4KGRA 2WXPA 2N9KA 1VJKA 2YEPB 1JWUD 4PT5A 1SE4A 1F2RI 2BS2B 2J42A 3MFGA 1D5ZC 4ARIA 1GTHA 1L6UA 4YSXB 2L52A 3AE4B 2N7JA 1JWBD 1ZUD2 2QIEB 1YNTE 1C79A 2G1EA 5C2TB 1BMLC 1RFKA 1KLGD 4YWGG 1NEKB 1SE2A 1JROA 3IAM1 4FXCA 4OZBA 3U2SC 2FE8A 5GXGB 4ZYSA 4A6QA 1CQVA 1C4AA 4DXFA 5EE0A 2CJOA 3LB8C 4ZOHC 1MHHE 1NYRA 3NVYA 3UI3A 2WS3B 3KQ4A 4RGNA 2KN4A 4NJCA 4RCOA 1TS5A 2PTLA 4ZHOA 2QEJC 4DQOC 1QOGA 4RF0A 1FNUA 3LYYA 2WU2B 1ZOYB 2D5GA 2LGIA 1NI3A 2AQ3B 4P6VF 4L2YA 3N9YC 5HFYA 1MHXA 4YTNB 1SIJA 5BYQA 2NTTA 2W3SA 1TKYA 2PLPA 4IDIA 3SEBA 5EE1A 1CK1A 2LMCA 4XE0A 3URYA 2WU5B 1FIQA 2W55A 1KF6B 1AW7A 2WXGA 1JWMD 3U4EG 3R2IA 1K51A 4NAWB 2BYTA 1WXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAH A;  3FC4 A;  1NEN B;  2B76 B;  1A70 A;  1J7C A;  1N5X A;  2DWQ A;  1DGJ A;  3P4S B;  1JRP A;  1GAQ B;  1V8C A;  1KRH A;  3NS1 A;  3AE3 B;  1H7X A;  3W9C B;  1E10 A;  4US9 A;  5EE9 A;  1B9R A;  1H7W A;  2M56 B;  4N6E B;  2FBW B;  1AYF A;  1ZP0 B;  3AE2 B;  1WRI A;  3BII D;  1DOY A;  2K22 A;  1T3Q A;  3CWI A;  1N61 A;  2K9X A;  4JWU C;  4A9A A;  1JQ4 A;  2CJN A;  2LEK A;  1IUE A;  1QF6 A;  2BS4 B;  2N0S B;  2WDQ B;  1N62 A;  4N58 A;  1WGK A;  4N59 A;  1FFV A;  2MJD A;  3CIR B;  2KMM A;  1FO4 A;  3AH7 A;  1KFY B;  3AE5 B;  1EWY C;  1AWD A;  2MJ3 A;  2AX5 A;  4YSY B;  1YJJ A;  4JWS C;  1NYQ A;  3AEG B;  3AE7 B;  1J7A A;  1ROE A;  1OQR A;  2BT6 A;  1UWM A;  3SFE B;  1YQ4 B;  1XO3 A;  1L5P A;  3AN1 A;  2L83 A;  1JAL A;  2PKO A;  2WQY B;  1L6V A;  2QJL A;  1DOX A;  3VR9 B;  1QOF A;  1TJE A;  2MH7 A;  2WDR B;  5AUK A;  3NVW A;  1OQQ A;  3NVZ A;  3AE1 B;  3P1M A;  5EE3 A;  2E3T A;  1RWS A;  1L0V B;  1QOB A;  4ITK A;  1FFU A;  1PUT A;  3L4P A;  1V97 A;  1VJK A;  2H88 B;  1OFF A;  3AEC B;  1NVI D;  1RM6 C;  1SB3 C;  3NRZ A;  2BS2 B;  4HRO A;  1GTH A;  2PIA A;  2PVO D;  1L6U A;  4YSX B;  2L52 A;  3WCQ A;  2M19 A;  3B2G A;  3AB5 A;  1F0Z A;  1TKG A;  4JX1 C;  3W5V B;  3AE4 B;  2DBY A;  1JWB D;  1ZUD 2;  2QIE B;  2G1E A;  2H89 B;  5C2T B;  4C7Z A;  4USA A;  1RFK A;  4C7Y A;  3NVV A;  4LTU A;  1NEK B;  4FXC A;  1JRO A;  3PO0 A;  1GT8 A;  2PVG C;  3DWG C;  3P4P B;  3SFD B;  1QLB B;  5GXG B;  1N5W A;  1WYG A;  1CZP A;  3ETR A;  3AEF B;  3LXF A;  2JX5 A;  1YQ3 B;  1JWA D;  3P4R B;  1XLQ A;  5MPO A;  1QT9 A;  5EE0 A;  2CJO A;  1VLB A;  1XLO A;  3LB8 C;  4ZOH C;  4HRS A;  4YXD B;  1DOI A;  1NYR A;  1TKE A;  3B2F A;  3NVY A;  4YSZ B;  3KWL A;  4US8 A;  2WS3 B;  5H8Y E;  1E7P B;  3ZYY X;  1WWT A;  1GTE A;  4ZHO A;  1CJE A;  1JW9 D;  2HTM E;  3W5U B;  3AV8 A;  4WWM A;  4ZHP A;  1PFD A;  1QOG A;  1J7B A;  4YT0 B;  4C80 A;  3HRD D;  2WDV B;  2K5P A;  1QOA A;  2MJE A;  3DWM A;  5G5G A;  1I7H A;  2CU3 A;  2W3R A;  3AED B;  2EKI A;  3SR6 A;  2WU2 B;  5G5H A;  3HVZ A;  1ZOY B;  1FXA A;  1FM0 D;  1NI3 A;  1PDX A;  4P6V F;  1FRD A;  1XLP A;  1ZXI A;  1FXI A;  5AUI A;  4YTN B;  4YTM B;  3AEB B;  3VRA B;  4KX6 B;  1SIJ A;  3EUB 2;  1E0Z A;  1GPX A;  1E9M A;  2W3S A;  1RYJ A;  1N60 A;  1SF0 A;  2ACZ B;  1TKY A;  2Q5W D;  2WLB A;  1YJI A;  3VRB B;  4IDI A;  3AE9 B;  3CF4 A;  1TYG B;  3AE8 B;  5EE1 A;  3AMZ A;  1FRR A;  2KAJ A;  1R7S A;  1VDV A;  3HUI A;  2WU5 B;  3ABV B;  1XLN A;  1FIQ A;  2W55 A;  3AEE B;  3P4Q B;  3P63 A;  1KF6 B;  3B9J A;  3AM9 A;  1N63 A;  2W54 A;  5H92 C;  4YTP B;  3VR8 B;  3AEA B;  4WQM A;  1FMA D;  5C3J B;  2OHF A;  2BS3 B;  3AE6 B;  1E6E B;  1WXQ A;  2JQR B;  2WP9 B;  3RPF C;  2Y5C A; 
#chains in the Genus database with same CATH topology
 1OGW A;  1HXY D;  3P4S B;  2K6Q A;  4NNJ B;  4US9 A;  3B1L X;  2Y5P A;  3I5J C;  3BII D;  1ZE3 D;  3KVF B;  3CWI A;  1R4M B;  2KFK B;  1AN8 A;  1IUE A;  1S1Q B;  2NTS A;  4MGK E;  3QIJ A;  4FJZ A;  1FO4 A;  4WWO A;  4XWW A;  3AE7 B;  3SFE B;  1ACC A;  1L5P A;  4NY0 A;  3N1X C;  2MP2 A;  2BYV E;  3L54 A;  3NVZ A;  2V3P A;  4GDL A;  4RFB A;  1SSN A;  3OJ3 A;  3DVN U;  3E9S A;  3T9L A;  5G2N A;  3IXS A;  3AB5 A;  1WXV A;  2WXN A;  4EEW A;  4JX1 C;  4C7Z A;  1PGX A;  3IHP C;  2MHJ A;  3HHM A;  2CHW A;  4CQN A;  2VRR B;  1K53 A;  1SJE D;  4WH4 A;  4US8 A;  5H8Y E;  3CST A;  4HCN B;  2D3C A;  3BYT B;  4GU2 A;  1GTE A;  1B1Z A;  1WJ4 A;  1OEY J;  1SJH D;  4ZHP A;  1PFD A;  4EE2 A;  1IBX B;  2R2Q A;  2IJ0 A;  2LRU A;  4K7U A;  4K7S A;  1SF0 A;  2Q5W D;  1E5W A;  3RZF A;  4W9F A;  1VDV A;  5FK9 C;  2ZEQ A;  2IGD A;  2V3N A;  1K8R B;  1V81 A;  4KIK B;  3FAH A;  2RPQ A;  3GS2 A;  2J0J A;  3A9K B;  4AP4 C;  2FAZ A;  1V8C A;  4K1R B;  2LJ5 A;  2FBW B;  2O2V B;  1P0R A;  4GXB A;  2K3U A;  2KZR A;  1XCQ L;  2KYW A;  1TS2 A;  2IO2 B;  1C76 A;  1E8Z A;  3JSV A;  3VVW B;  2JWZ A;  5IP4 D;  1JAL A;  1TJE A;  1UGM A;  4G3X B;  4S17 A;  1V6E A;  2PW9 A;  1C4C A;  2KXJ A;  2NCN A;  3KW5 B;  4NJ6 A;  4LJP B;  1TBE A;  1OFF A;  1PYW D;  3N1Y C;  3O65 B;  1UGJ A;  2MRP A;  1WGG A;  1IGD A;  2Y5B B;  3Q3O C;  3EA6 A;  2XK5 B;  3GZN I;  2WNM A;  2LWP A;  2OOB B;  4LNK A;  1WXM A;  4W9J A;  3AXC A;  3PSE B;  1XLO A;  3B2F A;  1YX6 B;  2PJH A;  2X38 A;  3EFC A;  2HTM E;  3AV8 A;  1HTO A;  1WM2 A;  4A90 A;  4MGZ E;  2WXM A;  2FCQ A;  4EKU A;  2KQ4 X;  4M8M A;  4AS1 A;  1FRD A;  1XLP A;  2KT7 A;  4LK0 M;  3AEB B;  3EUB 2;  4DK5 A;  3PZ7 A;  1E0Z A;  2G4D B;  1RYJ A;  4WIP A;  3Q8B A;  3TIX A;  4PS7 A;  4JGH B;  4ICU A;  4P1C C;  2KC2 A;  3AEE B;  1WX9 A;  3N20 C;  5H92 C;  1FMA D;  5KHO A;  2OHF A;  2WP9 B;  3MJW A;  2LI5 A;  2L7R A;  1ZDX A;  1NDD A;  3VTV A;  3Q3J A;  3Q3M C;  3PRP B;  1XEE A;  1M4V A;  2JXT A;  1DOY A;  5JH5 C;  1WRD B;  4I6P A;  4WJN A;  1V1P A;  1LM8 B;  1QKZ A;  2JWU A;  3BVG A;  4D2K A;  2FCN A;  3MTN B;  1EWY C;  2KK8 A;  3AEG B;  1WMH A;  2INN E;  5CTR C;  3RNC C;  3B0A A;  4EZK A;  2FIF A;  2C9W B;  1TY2 A;  1DOX A;  3TJP A;  3GP7 A;  4XDD A;  5CHW A;  3AE1 B;  3UIN B;  2DX5 B;  5HG2 A;  2JZP A;  3BIN A;  3H7S A;  2PEA A;  1WH3 A;  4MM3 A;  4LCD E;  1Q5W B;  4FJY A;  2G4S A;  3V62 A;  3FIL B;  2RPV A;  3ZNI D;  2IO1 B;  5LNK 1;  1TKG A;  2JYT A;  3W5V B;  1P7F A;  1GOZ A;  3PLV A;  4FAD A;  3N32 A;  3ZJT A;  3IBE A;  3IVF A;  3AUL A;  4M8N A;  3RNE C;  3N30 A;  4RH6 A;  2ZVN A;  1H4R A;  1WYG A;  2LVQ A;  4A3O A;  1RFA A;  4EOY A;  3DVG Y;  2KTR A;  3ZKJ C;  2HE7 A;  2LRW A;  3ZJU A;  1ZXH A;  4N9F 4;  2K5P A;  3ZJV A;  3UGB B;  1ZPS A;  3RZW C;  2ZZP B;  3IT4 B;  4HCP B;  1VR9 A;  2I1K A;  2NPT A;  2N9L A;  4JLC A;  3A4S C;  2WWZ A;  2WLB A;  4IG7 B;  2FCM A;  3CF4 A;  5C1Z A;  2BF8 B;  1YN3 A;  4LNN A;  2K0P A;  3UIO B;  3VR8 B;  4PYZ A;  4WQM A;  3M95 A;  1FCC C;  1E90 A;  2K25 A;  1NEN B;  1N5X A;  1JRP A;  3ENE A;  1IGC A;  2M0A A;  3AE3 B;  4II3 B;  2ON8 A;  3GE3 C;  4P7I A;  3ECI A;  4ZYN A;  4L23 A;  2KHW B;  5BMG A;  4BOZ B;  4KVG B;  2BTE A;  2QIL A;  1XCT L;  3U52 E;  3ZDT A;  2JVC A;  2WHI A;  2XN9 C;  2KMM A;  4JWS C;  3A1Q B;  3WAL A;  1OQR A;  1I4Q A;  1UWM A;  1YN4 A;  2L83 A;  3O13 A;  3V6E B;  1UUP A;  2RMM A;  1GJZ A;  4GIV A;  3VR9 B;  3DCG A;  2JRH A;  3Q2A C;  2C7N B;  3NVW A;  4A8X C;  2IPK D;  1C4P A;  2JZZ A;  2DZM A;  1VZ8 A;  4EUT A;  1PUT A;  1F77 A;  1HEZ E;  3L4P A;  4KGR A;  2WXP A;  2N9K A;  2IBI B;  4ACF A;  1JWU D;  2BS2 B;  2WX0 A;  2J42 A;  1X1M A;  2K8B A;  2KDB A;  1GTH A;  3S2A A;  5D94 A;  2KWU B;  4PYU A;  3DHG C;  2JZ3 B;  4ZRJ A;  1SE2 A;  4FXC A;  3QK0 A;  3RMK C;  4ZYS A;  4A6Q A;  1C4A A;  2RD0 A;  2A4Z A;  5EE0 A;  2LUE A;  1MHH E;  2BQQ A;  3ALB A;  4RGN A;  4NJC A;  2NBU A;  1Z2M A;  2PTL A;  4ZHO A;  3HIZ A;  4C4V A;  3VXW A;  5DPW A;  2N7E A;  3W1S C;  1FNU A;  1WFY A;  2WU2 B;  1SGH A;  2XBB C;  2ZVO A;  4P6V F;  4URK A;  1MHX A;  4CO7 A;  2KVR A;  1SIJ A;  4B6W A;  3DBR I;  4KDL B;  2V1Y A;  3URY A;  4DDG D;  2KFK A;  4FUL A;  3U4E G;  4IM0 A;  3QHT A;  1WXQ A;  2LGY A;  2B76 B;  1J8C A;  1JML A;  3W9C B;  5EE9 A;  2BKF A;  2I2Y A;  3PHX B;  5IO9 A;  1E8X A;  2Z59 B;  1Q1O A;  2KLC A;  2CKH B;  3WIM A;  2BS4 B;  4RMA A;  2GMI C;  2CU1 A;  5J17 A;  3MP9 A;  1H8C A;  1UNS A;  5EDS A;  4DXA B;  4M01 A;  3V60 A;  2BT6 A;  2NPT B;  5BMI A;  2OJW A;  1C9F A;  3SDL C;  2J52 A;  3DBL I;  2AYO B;  3ML9 A;  1OQQ A;  2IGG A;  4WQO B;  2IYD B;  2WXK A;  2VZK B;  4KV2 A;  1VZ6 A;  3BVZ A;  1UH6 A;  1ZDV A;  1XD3 B;  3IFW B;  1SB3 C;  5IOI A;  3HVD A;  2YVC A;  2J53 A;  1F0Z A;  4G50 A;  1JCK B;  1WXA A;  2DAF A;  2YEP F;  4R3D A;  1T5X D;  1EWC A;  3ZNG C;  2DZJ A;  3OWE B;  1XXG A;  2DEN B;  1T0R C;  1SXT A;  3ETR A;  3AEF B;  5CX3 A;  5L95 C;  1IBX A;  1JWA D;  1OQY A;  1SEB D;  4KKJ A;  1D5M C;  5KHQ A;  3PRZ A;  2KMA A;  5DPS A;  1EUV B;  4DHJ B;  4LDT B;  5DCN A;  2W3R A;  2LGX A;  3L17 A;  1NI2 A;  4KIK A;  3A4R A;  3A9K A;  1TYG B;  1R7S A;  2G45 B;  2O2V A;  3P63 A;  3ZO5 B;  1LO5 D;  4TSS A;  3CF6 E;  5D7G A;  4CYE A;  2RR9 A;  4M0W B;  4I6L B;  1GNU A;  1UD7 A;  3EEC A;  4FJV B;  4RF1 A;  3FKY A;  4N6E B;  2M8S A;  4W9E A;  1ZP0 B;  1T3Q A;  4A9A A;  1ESF A;  3PZ8 A;  1WGK A;  4C4V B;  2G3Q B;  2KDM A;  4X57 B;  1JRU A;  1KTK A;  4YSY B;  1YJJ A;  3R7R A;  4K81 A;  3BY4 B;  2Z0D B;  2PKO A;  2KX0 A;  4KGT A;  2XK5 A;  1L0V B;  1P7E A;  4EZL A;  1Z5S B;  3CSF A;  1WZ3 A;  2CHZ A;  1C78 A;  1TZ1 A;  1D4B A;  3WAP A;  3I9V 1;  2PIA A;  2KQ7 A;  3TL5 A;  5AZG A;  2L0F A;  1WE6 A;  1YJ1 A;  3H9D A;  3VQI A;  3MHZ A;  2WXF A;  1KOT A;  1FEH A;  4WJQ A;  4USA A;  1GT8 A;  2E6X A;  2JPH A;  2QMT A;  3PZD A;  4MGI E;  1D6E C;  2ASQ A;  3P4P B;  3BWU D;  1WZ0 A;  3NUH B;  2IZV B;  2YLM A;  3ZW3 A;  1MG8 A;  1V80 A;  4YXD B;  3L08 A;  3KWL A;  3QA8 A;  4RM9 A;  1WGH A;  4LNI A;  3W1Y A;  2KDE B;  3DWM A;  3UF8 A;  2WGS A;  3TEX A;  2ZCC A;  4W9D A;  3M63 B;  1NBF C;  3QQ8 B;  1GC6 A;  1ZXI A;  1RLF A;  4YTM B;  1HZ6 A;  4W9C A;  4KX6 B;  1E9M A;  1WR1 A;  2C7H A;  2RDG A;  1OTR B;  1GUA B;  4MJS B;  3ZNZ B;  2BYE A;  3TEZ A;  3OG5 A;  2JXX A;  4NZL B;  2K9X A;  4P1B C;  2D10 A;  1GAQ B;  1E10 A;  2GI9 A;  3ZRC A;  2WXH A;  2BB5 A;  3C8Y A;  2MW5 A;  1N61 A;  4HEA 1;  4HJG E;  1WGY A;  4TQ1 A;  1MVK A;  3JW0 X;  2LFI A;  3CIR B;  2EEL A;  1QQR A;  5IA7 A;  4M00 A;  2BGF A;  1J7A A;  3FIL A;  3LDZ E;  3KH0 A;  1YN5 A;  2VZK D;  1BT0 A;  2D11 A;  1V97 A;  1L0X B;  2LVO A;  3RI7 C;  1L4Z B;  2DNF A;  3U7Z A;  2PVO D;  2JY6 A;  3WA0 A;  1UBI A;  2MQJ A;  2DBY A;  4ZRK A;  5LXI B;  4W9G A;  1E7U A;  4XZ4 A;  3TUO A;  4BBN C;  3NVV A;  5HHD G;  4JE3 B;  4E3C A;  2KTF A;  1QLB B;  4ZDV A;  1EO6 A;  3I57 A;  5LXH A;  3H8H A;  4HRS A;  1TKE A;  3NZS A;  1R4N B;  4DHJ D;  4LDT D;  2RGF A;  2QCZ A;  4DWF A;  4YT0 B;  1DYQ A;  3AED B;  4BOS C;  3QJZ A;  4J6I A;  1FXI A;  2ZPN A;  3PVL A;  1GPX A;  1V9J A;  1N60 A;  4FLH A;  1FD6 A;  2KAN A;  1I42 A;  2KAJ A;  4M02 A;  2FUH B;  3ABV B;  4ANX A;  3ML8 A;  4HWI B;  4JIO U;  4E74 A;  3L10 B;  1IP9 A;  2WXQ A;  2AQ2 B;  5CHF A;  3RPF C;  2Y5C A;  2V3S A;  3L16 A;  3Q69 A;  4Q2J A;  3A1Q A;  2ICI A;  3T3N A;  3ZUN A;  3PS6 A;  2HDE A;  3R3M A;  2MSE D;  3VUY A;  4ZRP A;  1T0S C;  2KOX A;  3DVG X;  1N62 A;  2QSD A;  3DVN V;  1WI0 A;  2KJ6 A;  1T0Q C;  2V4I B;  3AE5 B;  1K50 A;  1Y56 A;  3DPD A;  2AX5 A;  2D3A A;  2LXC A;  2D3G A;  1GB1 A;  4HJK A;  3RNG C;  5BMH A;  3QAR A;  3R8B A;  4F7Z A;  1R4M I;  2AL6 A;  2YEP B;  1VJK A;  3HK0 A;  5D2M B;  4PT5 A;  3ZNH B;  1SE4 A;  4G11 A;  2I1J A;  2LGS A;  1D5Z C;  4YSX B;  3N1Z C;  4HK2 A;  2N7J A;  1JWB D;  1ZUD 2;  1Q0W B;  1YNT E;  2W9N A;  4OVV A;  1BML C;  4MH0 E;  1RFK A;  1KLG D;  2R2O A;  2VH2 A;  1YIW A;  3N3K B;  2DZI A;  5GXG B;  2KJH B;  3PRM B;  2CJO A;  4XC2 A;  3UI3 A;  3KQ4 A;  2NVU I;  3KYC D;  4RCO A;  1WF9 A;  4II2 B;  3EHV A;  3DBH I;  4RF0 A;  4S0R A;  2NS5 A;  3LYY A;  4IM3 A;  3ZXV A;  4GGQ A;  2AQ3 B;  3A33 B;  4L2Y A;  3N9Y C;  5HFY A;  4YTN B;  3NHE B;  2NTT A;  2PLP A;  3SEB A;  3V61 A;  2WU5 B;  3RUI B;  1AW7 A;  1JWM D;  2BPS A;  3AI5 A;  3DBS A;  2LAS A;  2BYT A;  2LZ6 A;  2N1W A;  2LHD A;  2M56 B;  1AYF A;  1JQ4 A;  1QF6 A;  2WDQ B;  4K7W A;  1I4R A;  3JVZ X;  3VUX A;  2WQY B;  2QJL A;  1TIF A;  1I4X A;  4IUM B;  4DHZ B;  1WGR A;  1RWS A;  4HPM B;  2KAC A;  2L1A A;  4PS3 A;  2DZK A;  1YOV B;  1NVI D;  2KX3 A;  4HRO A;  3B2G A;  2KKC A;  1HTQ A;  4ICV A;  1UBQ A;  4P16 A;  2M4N A;  2H89 B;  1C1Y B;  4HDO A;  5D3D A;  4I6N B;  4IM2 A;  1YQB A;  3APF A;  3KWV A;  3QWZ B;  3TCA A;  4YL8 A;  3R66 C;  3Q6B A;  3SHQ A;  3EC8 A;  3ZXR A;  2L76 A;  3NS8 A;  1C3T A;  3KYD D;  4HVB A;  3HRD D;  5G5G A;  4FA6 A;  5G5H A;  2J4X A;  2IDY A;  1EU3 A;  3IAS 1;  5FR3 A;  1SIF A;  3TBL D;  5AUI A;  4HKZ E;  5JHA A;  2MCN B;  2LVP A;  4M0W A;  1FRR A;  2WXI A;  3ZDM C;  4NAM A;  4A3P A;  2X8X X;  5TR5 A;  3AU5 A;  1Y8R C;  2GLS A;  5JHB A;  3NG0 A;  3NS1 A;  3NZ3 A;  4FHJ A;  2MX2 A;  2JT4 B;  3UQB A;  1CMX B;  3P42 A;  4JQW C;  4LNF A;  2LEK A;  3PLU A;  4ZRQ A;  4DHZ E;  2N0S B;  4DXG A;  1KLU D;  1TY0 A;  2AL3 A;  4IKG A;  1AWD A;  2IGH A;  2B3A A;  5BYS A;  2ZNV C;  1NYQ A;  1ROE A;  1XO3 A;  3MC9 A;  5AUK A;  2ZJD A;  3VUW A;  1FFU A;  4BBN F;  2MBH A;  5BO4 B;  2UU7 A;  4WAA A;  5AEK B;  1BUI C;  4DDI D;  1ET6 A;  3Q8C A;  1K52 A;  3RNA C;  3APC A;  4ARC A;  3X23 A;  1WR6 E;  1U4A A;  3IT6 B;  5JXV A;  3KLS X;  4HPL B;  4B0E A;  2K8C A;  1CZP A;  1KM7 A;  2OED A;  1TS3 A;  3LXF A;  3CMM B;  1YQ3 B;  1XLQ A;  5MPO A;  2SAK A;  1Q10 A;  2BWE S;  3K9P B;  1JW9 D;  3W5U B;  1VCB A;  1E7V A;  3Q8E A;  4MJS A;  3U30 A;  4EZJ A;  1TS4 A;  2KLG A;  4PS8 A;  4KDI C;  2K6D B;  2I38 A;  2WDT B;  2LXA A;  1L7Y A;  3H1U A;  2M1M A;  4MT5 A;  3P4Q B;  1LFD A;  3AM9 A;  4YTP B;  3AEA B;  3OAW A;  2JQR B;  3W2D A;  2OJR A;  3RNB C;  2IY1 B;  4QAY A;  3OLM D;  3Q8A A;  3APD A;  3PHW B;  2IO3 B;  1ISN A;  1I4P A;  5HKH A;  2O6V B;  2KN5 A;  2R61 A;  3PV1 A;  2NMQ A;  1L2N A;  3VH3 B;  1YMH E;  2CJN A;  3BVM A;  4N58 A;  2HJ8 A;  2MLB A;  1G6J A;  2K8H A;  1GB4 A;  2GBM A;  2FUG 1;  4GDK B;  3MJ5 A;  1YQ4 B;  2WDR B;  4RGO S;  3GZN B;  2GB1 A;  1FNV A;  4ITK A;  3QX1 A;  2INP E;  4H2A A;  2GRI A;  3BZD B;  2KWD A;  1F52 A;  3L13 A;  1VD2 A;  3NRZ A;  3H6N A;  3RYT A;  3TSS A;  1J0G A;  2GOW A;  3ZRF A;  2JU6 X;  3VAW A;  2JUO A;  3V6C B;  3A9J A;  3EGR A;  4W9H A;  2M17 A;  4HDQ A;  4UDU C;  1EF5 A;  2PVG C;  3DWG C;  1TZO A;  1J19 A;  2KFJ A;  3E56 A;  4KZ0 A;  3P4R B;  1IYF A;  1QT9 A;  1VLB A;  2RSU A;  1DOI A;  4DBG A;  2JYE A;  2BB6 A;  3PGE A;  2ZW0 A;  1VRA B;  4NPN A;  4WWM A;  4C80 A;  2MJE A;  4HXD A;  5DPR A;  2EKI A;  1F1H A;  1PDX A;  3UQA A;  3BYY B;  3VRA B;  2N1V A;  2KJR A;  1STE A;  2WYQ A;  4JPS A;  2KDI A;  4LLG M;  3EFU A;  2EMS A;  4JL9 A;  2D3B A;  3SU8 X;  5GMV A;  5J2R A;  3DHI C;  2DWQ A;  1DGJ A;  2AWT A;  1H7W A;  4NQK E;  2FCS A;  4K3C A;  2K22 A;  2BWF A;  4OHJ A;  3Q14 C;  2J0K A;  2QDF A;  3MC8 A;  1WJ6 A;  2C60 A;  1GC7 A;  5TSS A;  1EM7 A;  1ENF A;  4B95 A;  3GE8 C;  4W9L A;  2MJ3 A;  1EF1 A;  1HQR D;  2J0M A;  5E6J A;  2MH7 A;  1SE3 A;  2Y3A A;  3DBH B;  4NQL B;  5I4D A;  1MJD A;  1OEY A;  3QCA A;  5IN7 A;  1F2R I;  3GOE A;  2N9X A;  2QIE B;  2G1E A;  5C2T B;  2KDF B;  2IND C;  4YWG G;  4CHK A;  5IAA C;  1NEK B;  1JRO A;  2K39 A;  3U2S C;  1D3Z A;  4MSQ B;  1P9D U;  4AOF A;  4DXF A;  2L8J A;  3LB8 C;  3ONS A;  4ZOH C;  1NYR A;  3NVY A;  4BKS D;  2KN4 A;  2IY0 B;  1QZE A;  1TS5 A;  2FID A;  2QEJ C;  3M62 B;  3NZU A;  2GBR A;  2N9E B;  3C0R B;  2PPH A;  4ANV A;  4BZA A;  1UZX B;  2V9H A;  4FBJ B;  3RUL A;  2LGI A;  4ZRI A;  5JZE B;  1NI3 A;  4F8C B;  5BYQ A;  3NOB A;  4IDI A;  1HE8 A;  1GG3 A;  1CK1 A;  1SE9 A;  3A9J B;  1FIQ A;  2W55 A;  3LJ3 A;  2XEW A;  4FN2 A;  3R2I A;  1K51 A;  4IWQ A;  2HJ1 A;  3FC4 A;  5CHV C;  3H7P A;  2O6V D;  2AQ1 B;  2M0X A;  3OJ4 B;  2BBC A;  4XX5 A;  1B9R A;  2D07 B;  2LGD A;  4KGS A;  3VHT C;  2GBJ A;  1E8Y A;  2QHO A;  3GB1 A;  1TGZ B;  1L4D B;  1T6B X;  1FFV A;  1ET9 A;  1MPE A;  2W82 A;  3KUZ A;  2CHX A;  2KD0 A;  1WX8 A;  2V0G A;  3RNF C;  3AN1 A;  2ZW1 A;  4TV3 A;  3RFZ B;  3RCZ A;  1PGB A;  1WIA A;  2K1F A;  2MA9 B;  2H88 B;  4FHK A;  3AEC B;  1PQS A;  1RM6 C;  3ZGZ A;  4MEM A;  1FCL A;  2A5U A;  4RGT A;  3NY5 A;  2V4L A;  1YX5 B;  4OZC A;  2M19 A;  1RAX A;  2MP2 B;  4A20 A;  3T3O A;  4GDL B;  2PMV A;  4BFR A;  2G9H D;  4C7Y A;  1UWX A;  3L0W B;  3PO0 A;  4MEL A;  1YD8 U;  4HLE A;  1C77 A;  2RDH A;  4TMA B;  1N5W A;  3TEW A;  3JYU A;  2BYF A;  4K3B A;  4O1N A;  5C23 A;  3ZLZ A;  1LQB A;  1I4H A;  4L1B A;  3BK2 A;  1WXS A;  2NBV B;  2IO0 B;  1V5T A;  1MG4 A;  2JRI B;  4WWP A;  2C5L C;  2KO3 A;  3DBR B;  3I3T B;  1WWT A;  2BKR B;  2KMC A;  1ZW7 A;  2KNB A;  4HKQ A;  1QOA A;  2KVZ A;  2LUM A;  4TQ0 A;  1L0Y B;  1WE7 A;  3VTU A;  3M3J A;  1FXA A;  1T0Y A;  2RDB C;  2HTH A;  3PTF C;  5AZF A;  2LD9 A;  4E71 A;  4AWJ A;  2LJI A;  1WJU A;  3VRB B;  3AE9 B;  1SBB B;  4KSK C;  4BVU C;  2MBE A;  2DHZ A;  3VDZ A;  2N7D A;  1N63 A;  1P98 A;  4F1S A;  4B0M A;  4IWO A;  5C3J B;  1E6E B;  3MC0 B;  1XT9 B;  4W9I A;  4WUR A;  2J7Q B;  4IOI E;  1KRH A;  5E6P A;  1AAR A;  3DBL B;  4OVU A;  1RRB A;  3WAM A;  4IC7 B;  3BK1 A;  2KQS A;  3QAQ A;  1P1A A;  3ZTC A;  2NBW B;  2L0T A;  1I4G A;  1WX7 A;  2LHE A;  1KFY B;  2PE9 A;  1XF5 L;  4C56 C;  2WXL A;  4IW0 A;  1M94 A;  2DYB A;  3W1S A;  5DPT A;  2L3Z A;  3P1M A;  4GLS C;  1I35 A;  3T8M A;  2DYM A;  1V86 A;  4WJP A;  3JSV B;  4ASW C;  4A55 A;  2N9P C;  2L32 A;  4EFO A;  2UWQ A;  3H7P B;  1WJN A;  4LTU A;  2Z0E B;  2GBN A;  4GN1 A;  1P3Q U;  4BKS A;  2KWV B;  5HI1 A;  4AJY B;  3VH4 B;  1WY8 A;  4GMV A;  2BVC A;  3V05 A;  1MI0 A;  5E6O A;  4OW0 A;  1E7P B;  4MDK E;  3DQV A;  1CJE A;  3WAN A;  2XNA C;  1WYW B;  2MEK A;  2WDV B;  2BW2 A;  3DHH C;  4LJO B;  4WAF A;  2CU3 A;  3Q3F A;  3SR6 A;  1XQQ A;  1LXD A;  3DOW A;  1YJI A;  1R4N I;  4KKI A;  2CR5 A;  4MSM B;  3HUI A;  1FXT B;  2O6V A;  1XLN A;  3WAO A;  3B9J A;  2W54 A;  5FR6 A;  1IPG A;  4OVZ A;  1F9J A;  1A70 A;  1J7C A;  3R2T A;  1ZKH A;  3Q3N C;  4GDK A;  1H7X A;  2NR2 A;  1TTN A;  2MBB B;  3DDC B;  3ZVV A;  3C19 A;  3AE2 B;  1WRI A;  4JWU C;  4XYC A;  2Z8L A;  3Q8F A;  4N59 A;  1WM3 A;  2MJD A;  2INC C;  3RD2 A;  5LLI A;  1PGA A;  1LGR A;  4B9K A;  1L6V A;  1QOF A;  2L05 A;  1MFW A;  1QOB A;  5AZH A;  5D6J B;  3RN9 C;  3TEY A;  1V1P B;  2ZPY A;  4REZ A;  1N6Z A;  3R7Q A;  4J3O D;  5G55 A;  1HA5 A;  1KJT A;  4XDC A;  4AUQ C;  1WMH B;  1V49 A;  3WCQ A;  1QIL A;  2SEB D;  2AEH A;  2WXO A;  4OZA A;  1JWS D;  4AQ7 A;  1UF0 A;  1F2R C;  3U7D A;  3B08 A;  1TT5 B;  4WWN A;  5BYR A;  4NAW A;  1V5O A;  5FKA C;  3IG3 A;  3SFD B;  4MM3 B;  2KWC A;  4HPP A;  4GSW A;  4NJ7 A;  2JX5 A;  1FPY A;  2KC1 A;  4YSZ B;  3K9O B;  3PT2 B;  2JSV X;  4LNO A;  3ZYY X;  2MBQ A;  1V1O A;  1KH0 A;  1J7B A;  4MAC A;  1HZ5 A;  1WSP A;  2MWS B;  4ANU A;  1I7H A;  5L83 A;  3SD5 A;  2TSS A;  3HVZ A;  3V3X A;  1FM0 D;  2KTR B;  4PK1 A;  2EKE C;  2VH1 A;  3D32 A;  1VZ7 A;  3KUC B;  2ACZ B;  3AE8 B;  3AMZ A;  2ZNV B;  3I63 C;  3ZQ4 A;  4RM8 A;  4XWT A;  3QC8 B;  3P2B A;  2EMT A;  5IKC M;  2DLB A;  2DYO A;  2BS3 B;  3AE6 B;  4GB9 A;  4TUU A;  2HD5 B;  3PRE A;  2JF5 A;  2REX A;  1D5X C;  1FNW A;  5T8I A;  4MH8 A;  2DAJ A;  2ZCB A;  4RGM A;  2ONQ A;  1UEL A;  5E6N A;  1EU4 A;  4ANW A;  1BXT A;  2WXR A;  4TKN A;  3AH7 A;  3J9C A;  3AU4 A;  4W9K A;  1V2Y A;  5D3I B;  3UIP B;  4BAX A;  5EE3 A;  2WXJ A;  2E3T A;  3KUD B;  4RNA A;  4IWP A;  2PE6 B;  2QC8 A;  4AJW A;  2MBO A;  3MFG A;  4ARI A;  1L6U A;  2L52 A;  3VFK A;  3AE4 B;  2WX1 A;  4GOC A;  1C79 A;  2N4F A;  3X0W A;  2CS4 A;  5J18 A;  4C00 A;  2D2Q A;  3IAM 1;  2L00 B;  4OZB A;  1E8W A;  2FNJ B;  2FE8 A;  1A5R A;  1CQV A;  4BKG A;  3HM6 X;  3ZIM A;  1WGD A;  2UYZ B;  3VTW A;  3ZTD A;  3TMP B;  2WS3 B;  1S3S G;  4G0N B;  4DQO C;  1QOG A;  3PPA A;  4XGA B;  3MHS D;  3U8Z A;  1ZOY B;  2D5G A;  4WJO A;  4KZC A;  3NJT A;  3HM3 A;  2W3S A;  1TKY A;  5EE1 A;  2LMC A;  1KLV A;  2C7M B;  4XE0 A;  4BKT A;  1KF6 B;  2WXG A;  4KSL C;  3RT3 B;  1ZGU B;  4NAW B;  2GBK A;  4MGY E; 
#chains in the Genus database with same CATH homology
 3FC4 A;  2B76 B;  1HXY D;  2AQ1 B;  3P4S B;  2BBC A;  2LHD A;  1JML A;  3W9C B;  4US9 A;  5EE9 A;  1B9R A;  2I2Y A;  4KGS A;  2M56 B;  1AYF A;  2Y5P A;  3BII D;  1ZE3 D;  3GB1 A;  3CWI A;  1AN8 A;  1QF6 A;  1L4D B;  1IUE A;  1JQ4 A;  2BS4 B;  2WDQ B;  1T6B X;  1FFV A;  2NTS A;  3MP9 A;  1ET9 A;  1MPE A;  1FO4 A;  2W82 A;  1UNS A;  4XWW A;  1I4R A;  3AE7 B;  2BT6 A;  2V0G A;  3SFE B;  1ACC A;  5BMI A;  1L5P A;  3AN1 A;  2WQY B;  1C9F A;  2QJL A;  2ZW1 A;  2J52 A;  1OQQ A;  3NVZ A;  1I4X A;  2V3P A;  1RWS A;  4RFB A;  2IGG A;  3RFZ B;  1PGB A;  1SSN A;  2KAC A;  2WXK A;  2L1A A;  2VZK B;  2H88 B;  1VZ6 A;  3BVZ A;  3AEC B;  1NVI D;  1ZDV A;  3E9S A;  1RM6 C;  1SB3 C;  3ZGZ A;  1FCL A;  4HRO A;  3HVD A;  4RGT A;  2J53 A;  4OZC A;  3IXS A;  2M19 A;  3B2G A;  3AB5 A;  1F0Z A;  2WXN A;  1JCK B;  4JX1 C;  2YEP F;  4R3D A;  3T3O A;  1T5X D;  4P16 A;  4GDL B;  2PMV A;  1EWC A;  2H89 B;  4C7Z A;  5D3D A;  2G9H D;  4C7Y A;  1UWX A;  1PGX A;  3PO0 A;  3OWE B;  1C77 A;  4CQN A;  2RDH A;  1XXG A;  1N5W A;  4TMA B;  3TEW A;  1K53 A;  1SXT A;  3ETR A;  3AEF B;  4O1N A;  1IBX A;  1JWA D;  3KWV A;  1SEB D;  1I4H A;  4L1B A;  4KKJ A;  3BK2 A;  1SJE D;  4WH4 A;  1D5M C;  4US8 A;  5H8Y E;  3BYT B;  1WWT A;  1GTE A;  1B1Z A;  1SJH D;  4ZHP A;  1PFD A;  3HRD D;  4HKQ A;  1QOA A;  5G5G A;  2LUM A;  4TQ0 A;  2W3R A;  4EE2 A;  1L0Y B;  1IBX B;  5G5H A;  2J4X A;  2IDY A;  2IJ0 A;  1EU3 A;  1FXA A;  3IAS 1;  5FR3 A;  5AUI A;  4HKZ E;  2LJI A;  1SF0 A;  2Q5W D;  3VRB B;  4M0W A;  3AE9 B;  1TYG B;  1SBB B;  1FRR A;  1R7S A;  1VDV A;  2WXI A;  4NAM A;  3P63 A;  1LO5 D;  5FK9 C;  4TSS A;  1N63 A;  4B0M A;  2IGD A;  5C3J B;  2V3N A;  1E6E B;  3MC0 B;  3FAH A;  3GS2 A;  4WUR A;  4IOI E;  3NS1 A;  1V8C A;  3NZ3 A;  5D7G A;  1KRH A;  4RF1 A;  4N6E B;  2FBW B;  3P42 A;  1ZP0 B;  3BK1 A;  1T3Q A;  4A9A A;  2LEK A;  4ZRQ A;  2K3U A;  2N0S B;  1ESF A;  3PZ8 A;  1I4G A;  1XCQ L;  1WGK A;  4DXG A;  2LHE A;  1KLU D;  1TY0 A;  2KDM A;  1KFY B;  4IKG A;  1TS2 A;  1AWD A;  1KTK A;  2IGH A;  4YSY B;  1XF5 L;  1YJJ A;  1C76 A;  2WXL A;  1NYQ A;  4C56 C;  5BYS A;  1ROE A;  1XO3 A;  2PKO A;  1JAL A;  3W1S A;  1TJE A;  5AUK A;  3P1M A;  2PW9 A;  4KGT A;  1L0V B;  1P7E A;  4GLS C;  1C4C A;  1FFU A;  1C78 A;  1BUI C;  1OFF A;  2DYM A;  1D4B A;  1PYW D;  1UGJ A;  3I9V 1;  2PIA A;  1ET6 A;  3Q8C A;  1K52 A;  4A55 A;  1IGD A;  4ARC A;  2L32 A;  3VQI A;  3MHZ A;  3EA6 A;  2WXF A;  1FEH A;  3IT6 B;  4USA A;  2WNM A;  4LTU A;  5JXV A;  1GT8 A;  2E6X A;  2QMT A;  3KLS X;  4B0E A;  1D6E C;  5HI1 A;  3P4P B;  3BWU D;  3NUH B;  1CZP A;  2OED A;  1TS3 A;  3LXF A;  1YQ3 B;  1XLQ A;  5MPO A;  2SAK A;  1Q10 A;  3V05 A;  1MI0 A;  1XLO A;  4YXD B;  3B2F A;  3KWL A;  4OW0 A;  1E7P B;  2X38 A;  1CJE A;  1JW9 D;  2HTM E;  2XNA C;  3W5U B;  3AV8 A;  3Q8E A;  4A90 A;  2MEK A;  2WDV B;  2BW2 A;  2WXM A;  3DWM A;  4WAF A;  2KQ4 X;  2CU3 A;  3TEX A;  3SR6 A;  1TS4 A;  4AS1 A;  1FRD A;  1XLP A;  1ZXI A;  4LK0 M;  4YTM B;  3AEB B;  1HZ6 A;  4KX6 B;  3EUB 2;  2I38 A;  3PZ7 A;  1E0Z A;  1E9M A;  1RYJ A;  2RDG A;  4WIP A;  3Q8B A;  1YJI A;  4KKI A;  3HUI A;  1XLN A;  4MT5 A;  3AEE B;  3P4Q B;  3B9J A;  3TEZ A;  3AM9 A;  5H92 C;  2W54 A;  4YTP B;  3AEA B;  1FMA D;  2OHF A;  4NZL B;  4OVZ A;  2JQR B;  2K9X A;  2WP9 B;  3W2D A;  1ZDX A;  1A70 A;  1J7C A;  3R2T A;  1GAQ B;  3Q8A A;  1E10 A;  2GI9 A;  1H7X A;  2WXH A;  1I4P A;  2BB5 A;  3AE2 B;  1WRI A;  2R61 A;  3C8Y A;  2NMQ A;  1XEE A;  1M4V A;  2JXT A;  4JWU C;  1DOY A;  1N61 A;  4HEA 1;  4HJG E;  1YMH E;  2CJN A;  2Z8L A;  3Q8F A;  4TQ1 A;  3BVM A;  1V1P A;  4N58 A;  4N59 A;  1MVK A;  1QKZ A;  2LFI A;  2JWU A;  2MJD A;  3CIR B;  3BVG A;  4D2K A;  2EEL A;  1EWY C;  1QQR A;  1GB4 A;  3AEG B;  2FUG 1;  2INN E;  1J7A A;  1PGA A;  3FIL A;  3MJ5 A;  4GDK B;  1YQ4 B;  1DOX A;  1TY2 A;  1L6V A;  1YN5 A;  1QOF A;  2VZK D;  3GP7 A;  4XDD A;  2WDR B;  3AE1 B;  4RGO S;  1QOB A;  2GB1 A;  1FNV A;  4ITK A;  2INP E;  5HG2 A;  2JZP A;  3TEY A;  1V1P B;  1V97 A;  4H2A A;  2GRI A;  4REZ A;  1L0X B;  3BZD B;  2KWD A;  1L4Z B;  4J3O D;  1HA5 A;  3NRZ A;  4XDC A;  3U7Z A;  2PVO D;  3FIL B;  2RPV A;  3WCQ A;  3TSS A;  5LNK 1;  1QIL A;  2SEB D;  1TKG A;  2JYT A;  2WXO A;  3W5V B;  2DBY A;  4OZA A;  1JWS D;  2JU6 X;  1P7F A;  1GOZ A;  4AQ7 A;  1F2R C;  3EGR A;  3ZJT A;  3TUO A;  3NVV A;  5HHD G;  4UDU C;  5BYR A;  4JE3 B;  2PVG C;  4RH6 A;  3DWG C;  5FKA C;  1TZO A;  3SFD B;  1QLB B;  4MM3 B;  1WYG A;  2JX5 A;  3E56 A;  3P4R B;  3I57 A;  1QT9 A;  3H8H A;  1VLB A;  4HRS A;  1DOI A;  1TKE A;  4YSZ B;  2JSV X;  2JYE A;  2BB6 A;  3ZYY X;  3ZJU A;  2ZW0 A;  1VRA B;  1ZXH A;  1V1O A;  4WWM A;  1KH0 A;  1J7B A;  4YT0 B;  4C80 A;  4MAC A;  2K5P A;  1HZ5 A;  1WSP A;  2MJE A;  3ZJV A;  1ZPS A;  1I7H A;  3IT4 B;  1DYQ A;  3AED B;  2EKI A;  1VR9 A;  2TSS A;  3HVZ A;  3V3X A;  1FM0 D;  1PDX A;  3BYY B;  1FXI A;  2N9L A;  3VRA B;  1VZ7 A;  1GPX A;  1N60 A;  1FD6 A;  2ACZ B;  2WLB A;  3CF4 A;  1STE A;  3AE8 B;  1YN3 A;  3AMZ A;  2KAJ A;  4JPS A;  3ABV B;  3ZQ4 A;  4LLG M;  2K0P A;  4XWT A;  3VR8 B;  4WQM A;  2DLB A;  2DYO A;  2WXQ A;  2BS3 B;  3AE6 B;  1FCC C;  2AQ2 B;  3RPF C;  2Y5C A;  1NEN B;  1N5X A;  2DWQ A;  1DGJ A;  1JRP A;  3Q69 A;  1IGC A;  4Q2J A;  1D5X C;  2ICI A;  3AE3 B;  2M0A A;  3T3N A;  1FNW A;  2HDE A;  2ON8 A;  1H7W A;  5T8I A;  4MH8 A;  4RGM A;  4L23 A;  5BMG A;  2ONQ A;  2K22 A;  4ZRP A;  4OHJ A;  2BTE A;  2QIL A;  1XCT L;  1EU4 A;  3U52 E;  1N62 A;  2QSD A;  2XN9 C;  5TSS A;  1BXT A;  2KMM A;  2WXR A;  1EM7 A;  1ENF A;  3AH7 A;  3J9C A;  2V4I B;  3AE5 B;  1K50 A;  1Y56 A;  2MJ3 A;  2AX5 A;  4JWS C;  1HQR D;  1OQR A;  1I4Q A;  1UWM A;  1GB1 A;  5BMH A;  1YN4 A;  2L83 A;  3O13 A;  1UUP A;  5E6J A;  2RMM A;  3VR9 B;  2MH7 A;  1SE3 A;  2Y3A A;  3NVW A;  5D3I B;  4A8X C;  5EE3 A;  2WXJ A;  2E3T A;  2IPK D;  1C4P A;  4RNA A;  1VZ8 A;  1PUT A;  1F77 A;  3R8B A;  1HEZ E;  5I4D A;  3L4P A;  4KGR A;  2WXP A;  2N9K A;  1VJK A;  2YEP B;  1JWU D;  4PT5 A;  1SE4 A;  1F2R I;  2BS2 B;  2J42 A;  3MFG A;  1D5Z C;  4ARI A;  1GTH A;  1L6U A;  4YSX B;  2L52 A;  3AE4 B;  2N7J A;  1JWB D;  1ZUD 2;  2QIE B;  1YNT E;  1C79 A;  2G1E A;  5C2T B;  1BML C;  1RFK A;  1KLG D;  4YWG G;  1NEK B;  1SE2 A;  1JRO A;  3IAM 1;  4FXC A;  4OZB A;  3U2S C;  2FE8 A;  5GXG B;  4ZYS A;  4A6Q A;  1CQV A;  1C4A A;  4DXF A;  5EE0 A;  2CJO A;  3LB8 C;  4ZOH C;  1MHH E;  1NYR A;  3NVY A;  3UI3 A;  2WS3 B;  3KQ4 A;  4RGN A;  2KN4 A;  4NJC A;  4RCO A;  1TS5 A;  2PTL A;  4ZHO A;  2QEJ C;  4DQO C;  1QOG A;  4RF0 A;  1FNU A;  3LYY A;  2WU2 B;  1ZOY B;  2D5G A;  2LGI A;  1NI3 A;  2AQ3 B;  4P6V F;  4L2Y A;  3N9Y C;  5HFY A;  1MHX A;  4YTN B;  1SIJ A;  5BYQ A;  2NTT A;  2W3S A;  1TKY A;  2PLP A;  4IDI A;  3SEB A;  5EE1 A;  1CK1 A;  2LMC A;  4XE0 A;  3URY A;  2WU5 B;  1FIQ A;  2W55 A;  1KF6 B;  1AW7 A;  2WXG A;  1JWM D;  3U4E G;  3R2I A;  1K51 A;  4NAW B;  2BYT A;  1WXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...