3AE8B

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-isopropoxy-phenyl)-2-trifluoromethylbenzamide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Isopropoxy-phenyl)-2-trifluoromethylbenzamide
rcsb
total genus 54
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae8B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae8B01
3P4PB 3L4PA 1N63A 3WCQA 2WU2B 5G5GA 3W9CB 1TKYA 1XO3A 1YJIA 1WYGA 2PVGC 2K9XA 1GTHA 3AE5B 4YSYB 1VLBA 2K22A 5G5HA 1JROA 1XLPA 2AX5A 4P6VF 3ABVB 1E0ZA 2WU5B 4YSXB 2WLBA 3CWIA 3AM9A 2WS3B 3ZYYX 3VR9B 1J7BA 1L5PA 1PFDA 3NVWA 4US9A 1QF6A 3HVZA 3AE8B 1NVID 1JWAD 2W3RA 4N6EB 1A70A 1AWDA 4USAA 3AB5A 1NENB 3NVZA 2Q5WD 3AEBB 4WQMA 1DOIA 3AEDB 1GAQB 1IUEA 2WQYB 1DOXA 3AE6B 2KMMA 1RM6C 3AECB 3ETRA 1XLQA 1R7SA 1FIQA 1TKEA 1H7XA 5C2TB 3AE7B 1WGKA 5GXGB 1GT8A 2E3TA 1YQ3B 3AEAB 3AE2B 3AEEB 4YSZB 4YTMB 1H7WA 3AE3B 2M56B 1OFFA 2FBWB 2WDVB 1L0VB 1QOFA 3HUIA 1J7AA 3P63A 1QT9A 1RWSA 1TKGA 3W5UB 1DOYA 1OQQA 1N5XA 3VRAB 1TYGB 1N61A 1AYFA 3B9JA 4ITKA 4JX1C 4WWMA 3AMZA 1PDXA 4ZHOA 1E9MA 4ZHPA 1QOGA 2PVOD 1QLBB 1ZP0B 1XLOA 3P4SB 4ZOHC 1E7PB 1NEKB 1JW9D 1NYRA 1JALA 4A9AA 1SF0A 3RPFC 2KAJA 1N5WA 3VRBB 5H8YE 3FAHA 3SR6A 2MJEA 2EKIA 2BS3B 2L52A 2ACZB 1FXIA 1RFKA 3P4RB 1WRIA 1GTEA 1L6UA 1J7CA 1ZXIA 1CZPA 1FMAD 2CJOA 2H88B 2CU3A 2QIEB 3DWGC 5AUIA 3NS1A 1RYJA 5AUKA 1XLNA 1KRHA 2WP9B 1N62A 1T3QA 3B2GA 2JQRB 3EUB2 5MPOA 2W3SA 2BS4B 1OQRA 1V8CA 4HROA 2Y5CA 1FRDA 3VR8B 1VJKA 4US8A 3AEGB 3B2FA 4HRSA 1SIJA 3NVVA 2N0SB 1PUTA 4IDIA 3P1MA 2BS2B 1YQ4B 3AN1A 5EE9A 2LEKA 3CIRB 5EE3A 4C7ZA 1N60A 1ROEA 2HTME 1CJEA 1JWBD 1NI3A 3AE9B 3AEFB 3DWMA 3SFEB 2CJNA 1I7HA 5C3JB 2W55A 2QJLA 1V97A 3AH7A 1WXQA 1EWYC 2JX5A 1KF6B 4FXCA 1JRPA 2MJ3A 1UWMA 2H89B 4N59A 5EE0A 4N58A 3SFDB 4YXDB 2WDRB 4KX6B 2G1EA 5H92C 2BT6A 4JWSC 1F0ZA 1DGJA 3W5VB 1QOBA 2DWQA 4C7YA 1E10A 2WDQB 1GPXA 2DBYA 5EE1A 1B9RA 2PKOA 2PIAA 1ZOYB 3AV8A 3LB8C 3LXFA 4YTPB 3CF4A 4C80A 3AE1B 1L6VA 1ZUD2 3P4QB 2M19A 3KWLA 1YJJA 1TJEA 2K5PA 2MH7A 3PO0A 1FO4A 1VDVA 1NYQA 1FFVA 1FFUA 1QOAA 3NVYA 1JQ4A 1KFYB 3BIID 2W54A 1FXAA 3FC4A 2OHFA 4LTUA 4JWUC 1WWTA 2B76B 3AE4B 4YT0B 4YTNB 1FM0D 3HRDD 3NRZA 1E6EB 2L83A 1SB3C 1FRRA 2MJDA
chains in the Genus database with same CATH superfamily
3KLSX 4C4VB 3AULA 2I38A 3DBRI 5KHOA 2YLMA 3ZDTA 4BVUC 4OVVA 4IOIE 2L0TA 2MBOA 3CWIA 3GP7A 1PFDA 3U2SC 2GBMA 4WWNA 3Q3FA 3ML9A 1NVID 2DENB 4KKJA 1Y8RC 1QZEA 3AEBB 1XEEA 4AP4C 4MGIE 1GAQB 3W1SA 3AECB 2KC1A 1FIQA 3A1QA 1H7XA 1WM3A 3TL5A 3IVFA 3U30A 4O1NA 3DHIC 3U7DA 3Q3MC 3ZTCA 2WDVB 1Q5WB 1QT9A 2LRWA 4R3DA 4XWTA 4BKGA 4FA6A 3ML8A 3E56A 1OEYJ 2D3BA 1QLBB 2J0KA 4W9KA 2DAJA 2UU7A 3S2AA 1RFKA 3P4RB 1JRUA 1WMHA 4GSWA 2GBNA 3GE3C 1T0YA 3Q14C 1N62A 4NQKE 4EFOA 4L1BA 1LGRA 5TSSA 1L4ZB 2X8XX 3NZ3A 3A9KA 2BGFA 2PE9A 3GOEA 2DHZA 4HJKA 2J7QB 2CU1A 4MH0E 1C1YB 1J19A 1CJEA 1JWBD 3BY4B 3TEZA 3QIJA 3ZXRA 4ZDVA 3CF6E 3MJWA 1GOZA 4LK0M 2Y5PA 3I57A 4M01A 2MLBA 2OJWA 2R61A 2PPHA 2OHFA 1MHXA 1EU4A 4WJPA 3KUCB 4EEWA 4LNFA 2K6DB 1WH3A 2O6VD 2ZW1A 4ANWA 3KYDD 1CQVA 4M8NA 3AE5B 4ASWC 3B08A 4P6VF 2INCC 1E8ZA 2X38A 4HWIB 4M02A 2N7EA 2W9NA 2XK5A 3QARA 2NPTA 3ZJTA 3ZNHB 2KWCA 3IT6B 3A33B 1XLQA 2KXJA 1XCQL 1WM2A 2HD5B 4FADA 3WAOA 4KVGB 1ZW7A 1HTOA 4HVBA 3JVZX 1XLOA 1E7PB 1XD3B 1JWUD 4RCOA 1BT0A 2G4SA 5JZEB 1WGGA 4K3BA 2CU3A 4B9KA 1FMAD 4OVZA 3H8HA 4HCPB 2FUG1 4S0RA 1OQRA 4LJPB 2BB5A 1FRDA 2ZPNA 3H7PB 1WZ0A 2GMIC 1QQRA 1E8XA 1I4XA 2GB1A 3H7SA 5EE3A 3SEBA 4DK5A 2KMAA 2PJHA 3Q6BA 3IG3A 2IGHA 4MEMA 2JUOA 2XN9C 2KX3A 4MSMB 2GLSA 3LYYA 2WXQA 3I63C 1QKZA 2WDQB 3B1LX 1L4DB 2DBYA 1GPXA 1K51A 3V61A 3PREA 4NAWB 1TJEA 2KFKA 4MM3B 1FO4A 1I42A 1KFYB 3DOWA 4DHJB 2DYOA 3TEYA 3D32A 2CKHB 1N63A 1E6EB 2V4LA 3BVMA 3HIZA 3BYTB 2K9XA 1L0XB 5KHQA 4UDUC 1MHHE 2KK8A 4ARCA 2L0FA 2C60A 1XQQA 1UZXB 3DHGC 4KIKA 2DZIA 2R2OA 2KNBA 4F7ZA 1D6EC 3AE6B 2DNFA 1YN5A 3ZO5B 3R2IA 1SE3A 3AEAB 2BF8B 2FUHB 1WJ6A 3N3KB 1UF0A 4NJ7A 1BMLC 2QC8A 4HJGE 1D5MC 3VXWA 1C78A 3Q3JA 3QC8B 4WIPA 1WXVA 3FILB 2QEJC 2D10A 2BKFA 2QSDA 3VTWA 3AXCA 2ICIA 2K8HA 3LJ3A 2K0PA 3GZNB 4RGOS 4C4VA 3L13A 2MCNB 2KN4A 2Y3AA 1K8RB 2KDIA 4IKGA 4MACA 2J42A 4IDIA 5IOIA 3U52E 1WR1A 4TQ1A 3AE9B 1T5XD 2IBIB 4RNAA 4W9EA 2E6XA 1HXYD 1K52A 1V97A 1RRBA 4RFBA 4K81A 2K6QA 1WZ3A 3A9JB 3X0WA 2FCMA 2JF5A 5TR5A 2MRPA 2WDRB 2G1EA 3URYA 4DWFA 2L7RA 2J52A 1PYWD 2KQSA 4IG7B 2DWQA 3UF8A 1ZOYB 1L6VA 2FIFA 1HTQA 1AN8A 1L7YA 4DQOC 3KUDB 1NBFC 4A20A 2KKCA 2JT4B 3JW0X 2IYDB 3P4PB 3DBLB 2N7DA 4LDTD 1VLBA 2K22A 3APDA 2AX5A 1ZXHA 1T0RC 3AM9A 1V81A 3NVWA 2K39A 4P7IA 2LHEA 4KSKC 3TJPA 3UIPB 1YD8U 1F2RC 3WANA 4BFRA 4DBGA 3RCZA 3L17A 2CHXA 2KJHB 1YQ3B 4YTMB 2NBWB 3A9KB 2N7JA 3W5UB 2FCNA 4ITKA 1LO5D 4WJQA 2HJ1A 1PDXA 4K1RB 4C56C 1MI0A 3PSEB 4JIOU 1XCTL 1ENFA 1JALA 2WXLA 2WXFA 2KAJA 2MJEA 2EKIA 2PTLA 3H1UA 2L52A 2KVRA 1GG3A 2CR5A 4HPMB 2Z59B 2WP9B 2UWQA 2L76A 2JQRB 1YX6B 2IO3B 3ECIA 3VAWA 2ZCCA 3U4EG 2YEPB 3PZ7A 3ZW3A 3K9OB 1YQ4B 2BWES 4OZCA 4DXFA 3AEFB 1KOTA 5G2NA 3BZDB 3V62A 4PYUA 4N58A 4YXDB 5EDSA 3MHSD 1XT9B 4JWSC 5FKAC 1F0ZA 4JL9A 2KN5A 2XK5B 3RNBC 2PKOA 4IC7B 1MG4A 2V3SA 2IPKD 1C76A 1G6JA 1R4MI 2M19A 2MH7A 3NVYA 2PW9A 4XYCA 3IT4B 2RDBC 4JWUC 3DVNV 1NI2A 3RMKC 4HPPA 1F1HA 2WU2B 2BWFA 1MG8A 4PS3A 1Z5SB 1F9JA 4BZAA 1E7UA 2KYWA 2BYVE 3DVNU 3T8MA 2JWUA 1J8CA 4LLGM 1NENB 3NHEB 1Q10A 1V6EA 3H7PA 5HHDG 3CSFA 2WWZA 5HI1A 1E5WA 4DXGA 1VZ6A 1GT8A 3RD2A 4BBNC 3EECA 4IWOA 2M56B 4AS1A 3A4SC 3L08A 1J7AA 3DCGA 1HEZE 3Q69A 1D3ZA 3ZJUA 4AQ7A 3R8BA 2ZVOA 2ZNVC 2PVOD 1HQRD 1GC7A 1SF0A 2KFJA 4EUTA 3T3OA 4MM3A 3DWGC 5AEKB 3NS1A 4HKZE 1ESFA 3Q8CA 1LXDA 3A4RA 2LRUA 3R66C 4W9GA 1SSNA 4JGHB 4ZRPA 4K7SA 4DHZE 1R4NB 2MX2A 3PRPB 4JQWC 4TUUA 3GZNI 2IDYA 4WAAA 2LGYA 4A8XC 1UH6A 1I7HA 3PTFC 1BUIC 3RULA 4RM9A 1T0SC 4CO7A 4RGNA 2CHZA 4C7YA 4M00A 1B9RA 4YTPB 2N1VA 1VZ7A 1V9JA 1STEA 3PO0A 2Z8LA 2RPVA 3U7ZA 5J2RA 1P3QU 2N4FA 4HEA1 4YTNB 1TS3A 1WYWB 1QILA 3FILA 2WXJA 2WX1A 3BINA 3W9CB 1ZGUB 2BVCA 1JROA 2JZPA 2KLCA 3ABVB 3UQAA 1SE4A 3WALA 3DBLI 2W3RA 4ANVA 4BOZB 5E6OA 2G3QB 1E8YA 1EF1A 1IP9A 1IUEA 1IBXA 4YL8A 3UIOB 4ICUA 1ZDVA 3PHWB 2KACA 1GC6A 3P63A 1DOYA 3EA6A 3VRAB 3A9JA 3APCA 3B9JA 2AWTA 2KD0A 4WAFA 5CHFA 4LJOB 4A9AA 3RPFC 2LJ5A 3FAHA 2HTHA 4BOSC 2QIEB 1I4GA 4KGRA 1XLNA 4ZYNA 5HKHA 2GBJA 4ZRIA 1LM8B 3PLUA 3ZUNA 1V8CA 4S17A 5IN7A 2LHDA 4C7ZA 3VVWB 4D2KA 5IO9A 1K50A 3QHTA 2VH1A 1V2YA 3IAS1 5D3DA 4N59A 5EE0A 1P7EA 4NQLB 1WGRA 2LZ6A 4W9CA 2MHJA 3WA0A 2FAZA 1UELA 3P4QB 3MFGA 3RUIB 4G0NB 2WGSA 2RDHA 3JSVB 2W54A 4JLCA 1RLFA 2N9KA 5CTRC 4DHJD 2M1MA 1WYGA 5G5HA 3RNCC 1E0ZA 1LFDA 2WU5B 1NDDA 4IWQA 5HG2A 1VD2A 3Q8EA 3MC9A 2A5UA 2N9LA 3RYTA 5D94A 3SD5A 4RF1A 1D5XC 3R7RA 4GB9A 4PT5A 3QAQA 2E3TA 4YSZB 3AE3B 4MSQB 2EMSA 2V3PA 2KQ4X 3TEWA 1V1PB 3B0AA 3APFA 2JRIB 2R2QA 3KVFB 3ZXVA 4DDID 2BYTA 1WXAA 2VZKB 1N5WA 3Q8BA 3VRBB 4OZBA 2RMMA 1WGHA 1E7VA 4ACFA 2CJOA 1WSPA 4IM2A 2C7HA 4JPSA 4HXDA 3VUXA 4NJ6A 2NCNA 4P1CC 1SIJA 4GU2A 2LGXA 1TS5A 2KTRA 1N60A 4NJCA 1SBBB 2JSVX 1H4RA 4RMAA 2I2YA 2KO3A 4PS7A 3Q2AC 3PHXB 3W5VB 1TZ1A 4KDIC 1E10A 2MEKA 4II2B 1J0GA 2LGDA 3LXFA 3N32A 4YT0B 4NPNA 1UGJA 4FHJA 1HE8A 4BKSA 1LQBA 2MJDA 3L0WB 3ZRCA 5G5GA 5BO4B 2PVGC 2NS5A 4DHZB 3RNEC 1RFAA 1J7BA 3J9CA 5CX3A 2Z0EB 2EMTA 2V4IB 4RGMA 3Q3NC 5BMIA 2RD0A 3ZNZB 3AEDB 3NOBA 5FK9C 3QK0A 3W1YA 1YX5B 3P42A 1WGKA 3TMPB 1VZ8A 4WQOB 2NBUA 3VUYA 4MELA 4EE2A 2HJ8A 1N5XA 4FJVB 1TYGB 1JWMD 2J53A 2J0MA 4RF0A 1NEKB 1NYRA 1V1OA 1AW7A 2C5LC 1ACCA 4F1SA 3N20C 4PYZA 2ACZB 4L2YA 2M8SA 1Q1OA 4TMAB 3X23A 3ZLZA 4E71A 1D5ZC 1GB4A 1UNSA 4A3PA 4NZLB 4EZJA 4CHKA 3PRMB 4ZRQA 1NI3A 2CJNA 3Q8AA 2DYMA 3AH7A 4CQNA 2JX5A 1GJZA 2VH2A 4W9IA 4WURA 4BAXA 3SFDB 5H92C 1WF9A 1DGJA 3QA8A 1VRAB 3V60A 4C80A 4OHJA 2AL6A 3AE1B 1Y56A 1ZUD2 3KWLA 1IBXB 2NBVB 1M4VA 2YVCA 2DZJA 2IO0B 1TY0A 4LTUA 2B76B 2KLGA 4LNOA 1E90A 2K8BA 3ZJVA 1SB3C 5JXVA 1XO3A 3H9DA 3KUZA 2O2VB 2JRHA 3UGBB 1SGHA 2WXOA 4B95A 1ET9A 3C0RB 1FNWA 3KW5B 4XGAB 4ANXA 2JPHA 1JWAD 2C7NB 4N6EB 1AWDA 4USAA 3VH4B 2LUMA 1MPEA 4FHKA 5AZFA 1ZDXA 4LNKA 2PE6B 1RM6C 1XXGA 4TKNA 2J4XA 3N1ZC 4II3B 3T3NA 1YQBA 4KZ0A 2LASA 1SEBD 2KDBA 1E8WA 2JZZA 2MA9B 4LCDE 4MH8A 5G55A 4W9HA 1EU3A 2ON8A 4ZHOA 3VUWA 1QOGA 2XNAC 3P4SB 3Q3OC 3SU8X 4BKSD 2FCQA 4OVUA 3JSVA 1RYJA 2W82A 3PVLA 2Y5CA 3TSSA 1XF5L 2BYFA 3DBRB 4XE0A 3DBSA 3OJ3A 4J3OD 2L8JA 2LMCA 3EGRA 4B0MA 2M4NA 4TV3A 2H89B 3DPDA 3N30A 4MT5A 2BT6A 3W1SC 1K53A 1F77A 4W9FA 3AV8A 1TT5B 4GXBA 3ALBA 1V1PA 1YJJA 3O13A 2BQQA 2G4DB 4GDLB 3ZGZA 2IO2B 1SJED 5I4DA 3AE4B 5AZGA 1S3SG 2ZCBA 1I35A 2IGDA 1WFYA 4FULA 3K9PB 1YJIA 2RGFA 1GTHA 1M94A 2JZ3B 4HKQA 1WGYA 3ZDMC 5JHAA 4P16A 2BTEA 3M62B 2K1FA 4URKA 1A70A 4W9JA 2TSSA 3IHPC 2WQYB 1WE6A 1DOXA 4GOCA 2ZNVB 3NG0A 3ENEA 2QHOA 1TKEA 2JY6A 5GMVA 5C2TB 4FJZA 1WRDB 3DQVA 3QJZA 3GS2A 1WIAA 2WXMA 1L0VB 1OGWA 3VH3B 1V49A 2KTRB 1C4PA 1U4AA 2YEPF 4XZ4A 3OAWA 3NUHB 1SXTA 1C77A 3RT3B 1KH0A 1DYQA 5H8YE 3SR6A 5BYSA 1V86A 3ZKJC 1T3QA 3M3JA 3I3TB 2BS4B 2INNE 3NY5A 2NTTA 1TGZB 2INPE 2AL3A 4G50A 1OEYA 2M0AA 2IJ0A 2KZRA 1FEHA 4MDKE 3AN1A 2RPQA 3UQBA 2BPSA 4GDKB 5BMGA 1PQSA 2V9HA 2C9WB 1A5RA 1KF6B 1YNTE 3HVDA 3LDZE 3MC0B 2KT7A 4N9F4 5LXIB 2D2QA 5D2MB 1UBQA 2K5PA 2ZPYA 3VDZA 2BBCA 5D6JB 1I4HA 3FC4A 1EM7A 4AUQC 3WIMA 2MBQA 3W2DA 1C9FA 2L32A 2IGGA 3ZYYX 1MVKA 1F2RI 2LXAA 5C1ZA 2QMTA 3EC8A 1V5OA 1DOIA 4DDGD 5J17A 1CK1A 3ETRA 1PGBA 2FE8A 1H8CA 1MJDA 2J0JA 3BVZA 4TQ0A 5JHBA 5BMHA 4WWOA 1N61A 4WWMA 1HA5A 3AMZA 3MHZA 1WX7A 1FNUA 2D3CA 4X57B 3RFZB 3PS6A 1KM7A 4ZOHC 2MSED 3DHHC 3IXSA 3V05A 4ANUA 3DDCB 1WRIA 2VZKD 3ZRFA 2RR9A 1IYFA 4KZCA 5DCNA 3I5JC 2JYTA 1FXTB 1V5TA 4FN2A 2O2VA 2DAFA 2QDFA 2DX5B 3NVVA 1WGDA 5EE9A 3JYUA 2IO1B 2PLPA 2WXKA 1P7FA 2DZKA 5FR3A 2GRIA 4NAMA 5C3JB 1P1AA 2QJLA 2MJ3A 2DLBA 3AU4A 2MP2B 3N1XC 1FCLA 3IFWB 3V3XA 2LVQA 4EZLA 1SIFA 4MGZE 3EFUA 2PIAA 3LB8C 2WX0A 2LVOA 1FNVA 4CYEA 3PZ8A 4W9DA 1UGMA 4FLHA 4FBJB 1EWCA 1EO6A 2BW2A 4IW0A 4W9LA 3L4PA 1V80A 3WCQA 4H2AA 2SAKA 4YSYB 5FR6A 2KC2A 4REZA 4YSXB 4MGYE 3E9SA 2D11A 3N9YC 2WS3B 1FD6A 4NY0A 2KJ6A 3NJTA 3MJ5A 5DPRA 4ARIA 3PGEA 2LXCA 2N1WA 5AZHA 1SE9A 1SE2A 3RNFC 1ISNA 1IGDA 4PK1A 1L2NA 2QILA 3SDLC 2PEAA 1R7SA 2OOBB 3AE7B 4WJNA 5GXGB 2XBBC 2LVPA 3AEEB 1UBIA 2MBEA 4I6NB 1WR6E 1RWSA 2C7MB 2L3ZA 3N1YC 2LGSA 3QCAA 1WJNA 4ZHPA 2OJRA 1ZP0B 1JWSD 1HZ6A 2K25A 5L83A 4HPLB 1YMHE 1FXIA 4GDLA 4EOYA 2H88B 3DBHB 1JMLA 1GB1A 1KRHA 4B6WA 4OZAA 1S1QB 3RI7C 3RN9C 1YJ1A 3ONSA 3OJ4B 2D3GA 2CHWA 4HROA 3HM6X 3B2FA 1KLUD 3CSTA 3KQ4A 5LNK1 1ZPSA 3C8YA 1TS4A 2HTME 3L54A 4IM0A 4MJSB 5E6PA 2HE7A 1FPYA 3CMMB 1JRPA 4C00A 1UWMA 5L95C 4J6IA 3IBEA 1WXSA 1BXTA 1QOBA 2IY1B 5BYQA 1WX9A 5HFYA 4HLEA 4K7WA 3RNGC 2AQ3B 1FM0D 1R4NI 4PS8A 3T9LA 2FIDA 1WX8A 4GN1A 5DPWA 3SHQA 3GE8C 3MTNB 3VR9B 1GNUA 1L5PA 3PT2B 1YOVB 4TSSA 1CMXB 3PRZA 1D4BA 2KJRA 1QF6A 2ZJDA 2L00B 4WQMA 1EUVB 1P0RA 1OTRB 4GDKA 3HK0A 3AE2B 4XC2A 3HUIA 4B0EA 2VRRB 2WXRA 3UI3A 1E9MA 4AOFA 4WWPA 3ZIMA 4EZKA 3HHMA 4OW0A 2BS3B 2KWUB 2MWSB 5E6NA 1CZPA 3L16A 1MFWA 1R4MB 1ET6A 4A3OA 2OEDA 2A4ZA 4EKUA 5MPOA 3PZDA 3TBLD 3VTUA 2G9HD 3ZNGC 1X1MA 2LFIA 2FNJB 2KDMA 3AEGB 2BB6A 1KLGD 3M95A 2WYQA 2IY0B 2BS2B 2K8CA 1IPGA 2NVUI 1N6ZA 3CIRB 2I1JA 3DWMA 4GIVA 5IA7A 1EWYC 2BKRB 4KGTA 4AJYB 4I6LB 2N9PC 2ZW0A 3DVGX 2Z0DB 2V3NA 2EELA 2NR2A 2WXHA 5CHVC 2AYOB 3QX1A 4L23A 3O65B 2EKEC 1NYQA 4HDQA 1JQ4A 2O6VB 1WWTA 1KTKA 2N9XA 5EE1A 2LUEA 3P2BA 1TKYA 2KWVB 3KYCD 4K3CA 5E6JA 2D07B 1KJTA 1T0QC 3H6NA 3PLVA 1L0YB 5JH5C 2LJIA 3HVZA 2LWPA 3AB5A 3NVZA 4RM8A 2Q5WD 1C4AA 4XX5A 2FCSA 4M0WA 2AEHA 1ZE3D 4MGKE 3ZNID 2LGIA 1AYFA 2MP2A 2CS4A 2XEWA 3TCAA 2ONQA 1L6UA 1F52A 2KTFA 3FKYA 4F8CB 3BVGA 5J18A 2SEBD 3EFCA 2WXNA 4Q2JA 3B2GA 4LNIA 1YIWA 5T8IA 3MC8A 3VR8B 1VR9A 3DBHI 2GI9A 1C4CA 4GLSC 1IGCA 1OQYA 2N0SB 1WY8A 3NZSA 1PUTA 2V1YA 3P1MA 3A1QB 2G45B 4WJOA 2AQ2B 4KSLC 2W55A 1UUPA 2WNMA 4E3CA 4ZRJA 4KKIA 1UWXA 3BWUD 2WHIA 1GUAB 4IWPA 4AJWA 4G3XB 1FFUA 1QOAA 1WMHB 1YN4A 3TIXA 1I4PA 2L05A 2AQ1B 4ZYSA 3AI5A 1I4RA 1FRRA 4I6PA 2IZVB 2RDGA 3PPAA 2WLBA 3R2TA 1TS2A 2MBBB 1EF5A 5D7GA 3UINB 2KDEB 4XDDA 3C19A 4M8MA 4BKTA 1SJHD 2GBKA 2KMMA 4A6QA 4HK2A 3NS8A 4AWJA 1T6BX 2DYBA 4YWGG 3BK1A 1H7WA 1I4QA 4KV2A 1OFFA 2D5GA 2DZMA 2M17A 2MBHA 4MJSA 4XWWA 3I9V1 3VTVA 3BK2A 1OQQA 3NZUA 2D3AA 4JX1C 4G11A 3VHTC 5CHWA 2KANA 3V6EB 2PMVA 2NTSA 5BYRA 1ZXIA 1TZOA 2JXXA 1GTEA 5AUIA 5AUKA 2B3AA 3TEXA 2W3SA 2WXIA 4A55A 2NPTB 5C23A 4US8A 1PGAA 4QAYA 4ICVA 4HRSA 2GOWA 2WXGA 2JXTA 2HDEA 3L10B 2QCZA 2LI5A 1YN3A 3GB1A 3ZQ4A 1C3TA 4FXCA 3MP9A 4IM3A 4K7UA 3VQIA 3WAPA 1C79A 4HDOA 2UYZB 2V0GA 4GGQA 3ZTDA 1TTNA 3CF4A 1P9DU 3WAMA 4BBNF 5LLIA 2LD9A 4DXAB 2KWDA 1WE7A 4IUMB 2K3UA 4NNJB 1FXAA 4LDTB 4P1BC 3NRZA 2WXPA 2RSUA 2L83A 2JWZA 3U8ZA 2INDC 2ZZPB 1XLPA 1Z2MA 2MW5A 4E74A 5IAAC 2MQJA 3V6CB 2JU6X 4US9A 4FJYA 2KX0A 3AE8B 1ZKHA 2KMCA 3ZVVA 3DVGY 2BYEA 4NAWA 3OWEB 5IKCM 5DPTA 1AARA 3TUOA 3Q8FA 5LXHA 2FBWB 1HZ5A 1QOFA 2ASQA 2M0XA 1TKGA 2KFKB 2NMQA 3R3MA 1KLVA 1B1ZA 4RH6A 5IP4D 3PV1A 4HCNB 2L1AA 3RZWC 4JE3B 2KDFB 2KOXA 1JW9D 1FCCC 4A90A 2ZEQA 4ZRKA 2REXA 3RNAC 4KGSA 3QQ8B 1J7CA 2O6VA 3OG5A 2ZVNA 1WJ4A 3EHVA 3EUB2 2KHWB 3HM3A 3AU5A 4RGTA 1TBEA 4WH4A 1TY2A 1Q0WB 2N9EB 4KIKB 1VJKA 3M63B 3VFKA 2WDTB 2KQ7A 3RZFA 1PGXA 1TIFA 2LEKA 3IAM1 1ROEA 4XDCA 5D3IB 1WXMA 1JCKB 3KH0A 3SFEB 3OLMD 2KVZA 3KWVA 4LNNA 1WXQA 1UD7A 2JVCA 4KX6B 4KDLB 1VCBA 2Y5BB 4GMVA 1RAXA 1P98A 2JYEA 2I1KA 4M0WB 1VDVA 1FFVA 3QWZB 1WJUA 3BIID 3R7QA 3BYYB 3HRDD 5DPSA 2GBRA 1WI0A
chains in the Genus database with same CATH topology
3KLSX 2WU2B 2I38A 5JXVA 1XO3A 4IOIE 2WXOA 3CWIA 3GP7A 1ET9A 3VR9B 1L5PA 1PFDA 3U2SC 1FNWA 4TSSA 1D4BA 2JWUA 1QF6A 1NVID 1JWAD 4N6EB 1AWDA 4KKJA 4USAA 4LLGM 1NENB 2LUMA 1MPEA 1Q10A 3AEBB 1XEEA 4WQMA 5HHDG 1ZDXA 1GAQB 1RM6C 1XXGA 3AECB 5HI1A 2J4XA 3W1SA 1FIQA 4DXGA 1H7XA 1VZ6A 1GT8A 3T3NA 4O1NA 3AE2B 2M56B 4AS1A 2WDVB 3HUIA 1SEBD 4B0EA 1J7AA 3Q69A 1HEZE 1QT9A 3ZJUA 2WXRA 4MH8A 4R3DA 4XWTA 4AQ7A 3UI3A 3R8BA 3E56A 1EU3A 2ON8A 4ZHOA 1E9MA 1QOGA 2PVOD 1QLBB 2XNAC 3P4SB 1HQRD 1SF0A 3T3OA 4OW0A 2BS3B 1RFKA 3P4RB 1CZPA 3DWGC 3NS1A 1RYJA 1ET6A 2W82A 4HKZE 1ESFA 3Q8CA 2OEDA 1N62A 5MPOA 4L1BA 5TSSA 1SSNA 1L4ZB 2G9HD 4ZRPA 3NZ3A 2Y5CA 2LFIA 2KDMA 3TSSA 3AEGB 2BB6A 1XF5L 1KLGD 4XE0A 2BS2B 3CIRB 2IDYA 1CJEA 1JWBD 4A8XC 4J3OD 3DWMA 3TEZA 1I7HA 2LMCA 3EGRA 1EWYC 4B0MA 4KGTA 1BUIC 2H89B 1GOZA 4MT5A 2BT6A 2ZW0A 1K53A 4RGNA 1F77A 4LK0M 4C7YA 2Y5PA 1B9RA 3I57A 2V3NA 3AV8A 2EELA 4YTPB 2WXHA 1VZ7A 1STEA 3PO0A 1V1PA 1YJJA 3O13A 4L23A 2Z8LA 4GDLB 1NYQA 1JQ4A 2RPVA 3U7ZA 2R61A 3ZGZA 1SJED 5I4DA 2OHFA 1MHXA 1EU4A 1WWTA 3AE4B 4HEA1 4YTNB 1KTKA 1TS3A 1QILA 5EE1A 3FILA 2ZW1A 2WXJA 1CQVA 2IGDA 3W9CB 1TKYA 1YJIA 1GTHA 3AE5B 4HKQA 1JROA 4P6VF 2JZPA 5E6JA 3ABVB 2X38A 1SE4A 4P16A 2BTEA 1L0YB 2LJIA 3HVZA 2W3RA 1A70A 2TSSA 3AB5A 3NVZA 3ZJTA 2Q5WD 1C4AA 1IBXA 1IUEA 2WQYB 1DOXA 4M0WA 1ZDVA 3IT6B 1XLQA 1TKEA 1ZE3D 5C2TB 2KACA 3GS2A 1XCQL 2WXMA 3P63A 1L0VB 1DOYA 3EA6A 2LGIA 3VRAB 3B9JA 1AYFA 1C4PA 4WAFA 2YEPF 1XLOA 3NUHB 1E7PB 1SXTA 1C77A 4A9AA 3RPFC 1KH0A 2ONQA 1JWUD 1DYQA 4RCOA 5H8YE 3FAHA 3SR6A 2CU3A 1L6UA 2QIEB 1FMAD 3BVGA 5BYSA 1I4GA 4KGRA 2SEBD 4OVZA 3H8HA 2WXNA 1XLNA 4Q2JA 1T3QA 2FUG1 3B2GA 2BS4B 1OQRA 2INNE 5T8IA 2NTTA 1V8CA 2INPE 2BB5A 1FRDA 3VR8B 1VR9A 2M0AA 2GI9A 1C4CA 4GLSC 2IJ0A 1IGCA 1QQRA 2N0SB 1FEHA 1PUTA 1I4XA 2GB1A 3P1MA 2LHDA 3AN1A 5EE3A 3SEBA 4C7ZA 4GDKB 5BMGA 2AQ2B 4D2KA 2W55A 1K50A 1UUPA 1KF6B 2WNMA 3IAS1 5D3DA 1YNTE 4KKIA 2IGHA 4N59A 5EE0A 3HVDA 1P7EA 2XN9C 3MC0B 1UWXA 3LYYA 2WXQA 1QKZA 2WDQB 1GPXA 1L4DB 2DBYA 3BWUD 1K51A 4NAWB 3P4QB 1TJEA 2K5PA 3MFGA 4MM3B 1FO4A 2BBCA 2RDHA 1FFUA 1QOAA 1I4HA 1KFYB 1YN4A 1I4PA 2W54A 3FC4A 1EM7A 2DYOA 3TEYA 2AQ1B 2N9KA 4ZYSA 1N63A 1I4RA 1E6EB 1FRRA 3W2DA 3BVMA 1WYGA 3BYTB 2K9XA 1C9FA 1L0XB 5G5HA 2L32A 2IGGA 4UDUC 2RDGA 1MHHE 1E0ZA 4ARCA 2WU5B 2WLBA 5HG2A 3R2TA 1TS2A 3ZYYX 1MVKA 3Q8EA 5D7GA 1F2RI 2QMTA 4XDDA 2N9LA 1DOIA 1D6EC 3AE6B 1SJHD 2KMMA 1CK1A 4A6QA 3ETRA 1PGBA 2FE8A 4RF1A 1D5XC 1YN5A 1T6BX 4PT5A 4YWGG 3BK1A 3R2IA 2E3TA 1SE3A 3AEAB 3BVZA 4YSZB 1H7WA 3AE3B 1I4QA 4TQ0A 1OFFA 2D5GA 4XWWA 2V3PA 2KQ4X 3I9V1 3TEWA 1V1PB 5BMHA 3BK2A 1OQQA 4JX1C 1N61A 4WWMA 1HA5A 3AMZA 3MHZA 1BMLC 4HJGE 1FNUA 1D5MC 1C78A 3RFZB 4WIPA 4ZOHC 2BYTA 3FILB 2QEJC 2PMVA 2VZKB 3IXSA 2NTSA 1N5WA 3Q8BA 3VRBB 2QSDA 4OZBA 2RMMA 5BYRA 3V05A 1WRIA 1ZXIA 1TZOA 2VZKD 1GTEA 5AUIA 2CJOA 1WSPA 5AUKA 2ICIA 3TEXA 2W3SA 2WXIA 4JPSA 4A55A 2K0PA 4RGOS 2JYTA 4US8A 1PGAA 2KN4A 2Y3AA 4IKGA 4HRSA 1SIJA 3NVVA 4MACA 2J42A 4IDIA 1TS5A 2WXGA 2JXTA 3U52E 2HDEA 5EE9A 1YN3A 1N60A 3GB1A 4TQ1A 2PLPA 2WXKA 4NJCA 1P7FA 3AE9B 1SBBB 5FR3A 1T5XD 2GRIA 4NAMA 4RNAA 2JSVX 2E6XA 1HXYD 3ZQ4A 1K52A 5C3JB 2QJLA 1V97A 4RFBA 2I2YA 4FXCA 2MJ3A 2DLBA 3MP9A 2WDRB 2G1EA 3URYA 1FCLA 2J52A 1PYWD 3V3XA 1C79A 3VQIA 3W5VB 2DWQA 1E10A 2V0GA 2MEKA 2PIAA 1ZOYB 3LB8C 3LXFA 3CF4A 1L6VA 1AN8A 4DQOC 2KWDA 1FNVA 2K3UA 1FXAA 3PZ8A 4YT0B 3NRZA 2WXPA 1UGJA 1EWCA 2L83A 2BW2A 2MJDA 3P4PB 3L4PA 3WCQA 4H2AA 2SAKA 5G5GA 2PVGC 4YSYB 1VLBA 2K22A 1XLPA 2AX5A 1ZXHA 4REZA 4YSXB 3E9SA 3AM9A 3N9YC 2WS3B 1FD6A 1J7BA 3NVWA 2JU6X 4US9A 3MJ5A 3J9CA 2LHEA 4ARIA 3AE8B 2V4IB 4RGMA 5BMIA 1F2RC 1SE2A 3AEDB 1IGDA 3OWEB 2QILA 5FK9C 1R7SA 3P42A 3TUOA 1WGKA 3Q8FA 3AE7B 1VZ8A 5GXGB 1YQ3B 3AEEB 4YTMB 2N7JA 2FBWB 1HZ5A 1QOFA 1RWSA 1TKGA 2NMQA 3W5UB 4EE2A 1N5XA 4ITKA 1TYGB 1B1ZA 1JWMD 2J53A 4RH6A 1LO5D 1PDXA 4C56C 1MI0A 1XCTL 2L1AA 4ZHPA 4RF0A 1ZP0B 4JE3B 1NEKB 1JWSD 1ENFA 1JALA 1JW9D 1NYRA 2WXLA 2WXFA 1FCCC 4A90A 1HZ6A 1V1OA 2KAJA 1AW7A 1ACCA 2MJEA 2EKIA 2PTLA 1YMHE 2L52A 2ACZB 1FXIA 4KGSA 1J7CA 4L2YA 2H88B 1JMLA 1GB1A 1KRHA 2WP9B 2JQRB 3EUB2 4OZAA 4TMAB 4RGTA 4WH4A 1TY2A 4HROA 1VJKA 1GB4A 1D5ZC 3U4EG 3B2FA 1UNSA 2YEPB 3PZ7A 4NZLB 1KLUD 5LNK1 3KQ4A 1ZPSA 1YQ4B 1PGXA 4OZCA 3C8YA 2LEKA 3IAM1 1TS4A 1ROEA 2HTME 4XDCA 5D3IB 4ZRQA 1NI3A 4DXFA 3AEFB 1JCKB 3SFEB 2CJNA 3Q8AA 2DYMA 3AH7A 3KWVA 4CQNA 1WXQA 2JX5A 3BZDB 1JRPA 1UWMA 4WURA 4N58A 3SFDB 4YXDB 4KX6B 5H92C 4JWSC 5FKAC 1F0ZA 1DGJA 1BXTA 1QOBA 1VRAB 5BYQA 2PKOA 4C80A 4OHJA 5HFYA 3AE1B 1Y56A 2IPKD 1C76A 1ZUD2 3KWLA 2M19A 1IBXB 2JYEA 2MH7A 1VDVA 1M4VA 1FFVA 3NVYA 3BIID 2PW9A 3IT4B 1TY0A 4LTUA 4JWUC 2B76B 2AQ3B 1FM0D 3BYYB 3HRDD 3ZJVA 1SB3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4P B;  3L4P A;  1N63 A;  3WCQ A;  2WU2 B;  5G5G A;  3W9C B;  1TKY A;  1XO3 A;  1YJI A;  1WYG A;  2PVG C;  2K9X A;  1GTH A;  3AE5 B;  4YSY B;  1VLB A;  2K22 A;  5G5H A;  1JRO A;  1XLP A;  2AX5 A;  4P6V F;  3ABV B;  1E0Z A;  2WU5 B;  4YSX B;  2WLB A;  3CWI A;  3AM9 A;  2WS3 B;  3ZYY X;  3VR9 B;  1J7B A;  1L5P A;  1PFD A;  3NVW A;  4US9 A;  1QF6 A;  3HVZ A;  3AE8 B;  1NVI D;  1JWA D;  2W3R A;  4N6E B;  1A70 A;  1AWD A;  4USA A;  3AB5 A;  1NEN B;  3NVZ A;  2Q5W D;  3AEB B;  4WQM A;  1DOI A;  3AED B;  1GAQ B;  1IUE A;  2WQY B;  1DOX A;  3AE6 B;  2KMM A;  1RM6 C;  3AEC B;  3ETR A;  1XLQ A;  1R7S A;  1FIQ A;  1TKE A;  1H7X A;  5C2T B;  3AE7 B;  1WGK A;  5GXG B;  1GT8 A;  2E3T A;  1YQ3 B;  3AEA B;  3AE2 B;  3AEE B;  4YSZ B;  4YTM B;  1H7W A;  3AE3 B;  2M56 B;  1OFF A;  2FBW B;  2WDV B;  1L0V B;  1QOF A;  3HUI A;  1J7A A;  3P63 A;  1QT9 A;  1RWS A;  1TKG A;  3W5U B;  1DOY A;  1OQQ A;  1N5X A;  3VRA B;  1TYG B;  1N61 A;  1AYF A;  3B9J A;  4ITK A;  4JX1 C;  4WWM A;  3AMZ A;  1PDX A;  4ZHO A;  1E9M A;  4ZHP A;  1QOG A;  2PVO D;  1QLB B;  1ZP0 B;  1XLO A;  3P4S B;  4ZOH C;  1E7P B;  1NEK B;  1JW9 D;  1NYR A;  1JAL A;  4A9A A;  1SF0 A;  3RPF C;  2KAJ A;  1N5W A;  3VRB B;  5H8Y E;  3FAH A;  3SR6 A;  2MJE A;  2EKI A;  2BS3 B;  2L52 A;  2ACZ B;  1FXI A;  1RFK A;  3P4R B;  1WRI A;  1GTE A;  1L6U A;  1J7C A;  1ZXI A;  1CZP A;  1FMA D;  2CJO A;  2H88 B;  2CU3 A;  2QIE B;  3DWG C;  5AUI A;  3NS1 A;  1RYJ A;  5AUK A;  1XLN A;  1KRH A;  2WP9 B;  1N62 A;  1T3Q A;  3B2G A;  2JQR B;  3EUB 2;  5MPO A;  2W3S A;  2BS4 B;  1OQR A;  1V8C A;  4HRO A;  2Y5C A;  1FRD A;  3VR8 B;  1VJK A;  4US8 A;  3AEG B;  3B2F A;  4HRS A;  1SIJ A;  3NVV A;  2N0S B;  1PUT A;  4IDI A;  3P1M A;  2BS2 B;  1YQ4 B;  3AN1 A;  5EE9 A;  2LEK A;  3CIR B;  5EE3 A;  4C7Z A;  1N60 A;  1ROE A;  2HTM E;  1CJE A;  1JWB D;  1NI3 A;  3AE9 B;  3AEF B;  3DWM A;  3SFE B;  2CJN A;  1I7H A;  5C3J B;  2W55 A;  2QJL A;  1V97 A;  3AH7 A;  1WXQ A;  1EWY C;  2JX5 A;  1KF6 B;  4FXC A;  1JRP A;  2MJ3 A;  1UWM A;  2H89 B;  4N59 A;  5EE0 A;  4N58 A;  3SFD B;  4YXD B;  2WDR B;  4KX6 B;  2G1E A;  5H92 C;  2BT6 A;  4JWS C;  1F0Z A;  1DGJ A;  3W5V B;  1QOB A;  2DWQ A;  4C7Y A;  1E10 A;  2WDQ B;  1GPX A;  2DBY A;  5EE1 A;  1B9R A;  2PKO A;  2PIA A;  1ZOY B;  3AV8 A;  3LB8 C;  3LXF A;  4YTP B;  3CF4 A;  4C80 A;  3AE1 B;  1L6V A;  1ZUD 2;  3P4Q B;  2M19 A;  3KWL A;  1YJJ A;  1TJE A;  2K5P A;  2MH7 A;  3PO0 A;  1FO4 A;  1VDV A;  1NYQ A;  1FFV A;  1FFU A;  1QOA A;  3NVY A;  1JQ4 A;  1KFY B;  3BII D;  2W54 A;  1FXA A;  3FC4 A;  2OHF A;  4LTU A;  4JWU C;  1WWT A;  2B76 B;  3AE4 B;  4YT0 B;  4YTN B;  1FM0 D;  3HRD D;  3NRZ A;  1E6E B;  2L83 A;  1SB3 C;  1FRR A;  2MJD A; 
#chains in the Genus database with same CATH topology
 3KLS X;  4C4V B;  3AUL A;  2I38 A;  3DBR I;  5KHO A;  2YLM A;  3ZDT A;  4BVU C;  4OVV A;  4IOI E;  2L0T A;  2MBO A;  3CWI A;  3GP7 A;  1PFD A;  3U2S C;  2GBM A;  4WWN A;  3Q3F A;  3ML9 A;  1NVI D;  2DEN B;  4KKJ A;  1Y8R C;  1QZE A;  3AEB B;  1XEE A;  4AP4 C;  4MGI E;  1GAQ B;  3W1S A;  3AEC B;  2KC1 A;  1FIQ A;  3A1Q A;  1H7X A;  1WM3 A;  3TL5 A;  3IVF A;  3U30 A;  4O1N A;  3DHI C;  3U7D A;  3Q3M C;  3ZTC A;  2WDV B;  1Q5W B;  1QT9 A;  2LRW A;  4R3D A;  4XWT A;  4BKG A;  4FA6 A;  3ML8 A;  3E56 A;  1OEY J;  2D3B A;  1QLB B;  2J0K A;  4W9K A;  2DAJ A;  2UU7 A;  3S2A A;  1RFK A;  3P4R B;  1JRU A;  1WMH A;  4GSW A;  2GBN A;  3GE3 C;  1T0Y A;  3Q14 C;  1N62 A;  4NQK E;  4EFO A;  4L1B A;  1LGR A;  5TSS A;  1L4Z B;  2X8X X;  3NZ3 A;  3A9K A;  2BGF A;  2PE9 A;  3GOE A;  2DHZ A;  4HJK A;  2J7Q B;  2CU1 A;  4MH0 E;  1C1Y B;  1J19 A;  1CJE A;  1JWB D;  3BY4 B;  3TEZ A;  3QIJ A;  3ZXR A;  4ZDV A;  3CF6 E;  3MJW A;  1GOZ A;  4LK0 M;  2Y5P A;  3I57 A;  4M01 A;  2MLB A;  2OJW A;  2R61 A;  2PPH A;  2OHF A;  1MHX A;  1EU4 A;  4WJP A;  3KUC B;  4EEW A;  4LNF A;  2K6D B;  1WH3 A;  2O6V D;  2ZW1 A;  4ANW A;  3KYD D;  1CQV A;  4M8N A;  3AE5 B;  4ASW C;  3B08 A;  4P6V F;  2INC C;  1E8Z A;  2X38 A;  4HWI B;  4M02 A;  2N7E A;  2W9N A;  2XK5 A;  3QAR A;  2NPT A;  3ZJT A;  3ZNH B;  2KWC A;  3IT6 B;  3A33 B;  1XLQ A;  2KXJ A;  1XCQ L;  1WM2 A;  2HD5 B;  4FAD A;  3WAO A;  4KVG B;  1ZW7 A;  1HTO A;  4HVB A;  3JVZ X;  1XLO A;  1E7P B;  1XD3 B;  1JWU D;  4RCO A;  1BT0 A;  2G4S A;  5JZE B;  1WGG A;  4K3B A;  2CU3 A;  4B9K A;  1FMA D;  4OVZ A;  3H8H A;  4HCP B;  2FUG 1;  4S0R A;  1OQR A;  4LJP B;  2BB5 A;  1FRD A;  2ZPN A;  3H7P B;  1WZ0 A;  2GMI C;  1QQR A;  1E8X A;  1I4X A;  2GB1 A;  3H7S A;  5EE3 A;  3SEB A;  4DK5 A;  2KMA A;  2PJH A;  3Q6B A;  3IG3 A;  2IGH A;  4MEM A;  2JUO A;  2XN9 C;  2KX3 A;  4MSM B;  2GLS A;  3LYY A;  2WXQ A;  3I63 C;  1QKZ A;  2WDQ B;  3B1L X;  1L4D B;  2DBY A;  1GPX A;  1K51 A;  3V61 A;  3PRE A;  4NAW B;  1TJE A;  2KFK A;  4MM3 B;  1FO4 A;  1I42 A;  1KFY B;  3DOW A;  4DHJ B;  2DYO A;  3TEY A;  3D32 A;  2CKH B;  1N63 A;  1E6E B;  2V4L A;  3BVM A;  3HIZ A;  3BYT B;  2K9X A;  1L0X B;  5KHQ A;  4UDU C;  1MHH E;  2KK8 A;  4ARC A;  2L0F A;  2C60 A;  1XQQ A;  1UZX B;  3DHG C;  4KIK A;  2DZI A;  2R2O A;  2KNB A;  4F7Z A;  1D6E C;  3AE6 B;  2DNF A;  1YN5 A;  3ZO5 B;  3R2I A;  1SE3 A;  3AEA B;  2BF8 B;  2FUH B;  1WJ6 A;  3N3K B;  1UF0 A;  4NJ7 A;  1BML C;  2QC8 A;  4HJG E;  1D5M C;  3VXW A;  1C78 A;  3Q3J A;  3QC8 B;  4WIP A;  1WXV A;  3FIL B;  2QEJ C;  2D10 A;  2BKF A;  2QSD A;  3VTW A;  3AXC A;  2ICI A;  2K8H A;  3LJ3 A;  2K0P A;  3GZN B;  4RGO S;  4C4V A;  3L13 A;  2MCN B;  2KN4 A;  2Y3A A;  1K8R B;  2KDI A;  4IKG A;  4MAC A;  2J42 A;  4IDI A;  5IOI A;  3U52 E;  1WR1 A;  4TQ1 A;  3AE9 B;  1T5X D;  2IBI B;  4RNA A;  4W9E A;  2E6X A;  1HXY D;  1K52 A;  1V97 A;  1RRB A;  4RFB A;  4K81 A;  2K6Q A;  1WZ3 A;  3A9J B;  3X0W A;  2FCM A;  2JF5 A;  5TR5 A;  2MRP A;  2WDR B;  2G1E A;  3URY A;  4DWF A;  2L7R A;  2J52 A;  1PYW D;  2KQS A;  4IG7 B;  2DWQ A;  3UF8 A;  1ZOY B;  1L6V A;  2FIF A;  1HTQ A;  1AN8 A;  1L7Y A;  4DQO C;  3KUD B;  1NBF C;  4A20 A;  2KKC A;  2JT4 B;  3JW0 X;  2IYD B;  3P4P B;  3DBL B;  2N7D A;  4LDT D;  1VLB A;  2K22 A;  3APD A;  2AX5 A;  1ZXH A;  1T0R C;  3AM9 A;  1V81 A;  3NVW A;  2K39 A;  4P7I A;  2LHE A;  4KSK C;  3TJP A;  3UIP B;  1YD8 U;  1F2R C;  3WAN A;  4BFR A;  4DBG A;  3RCZ A;  3L17 A;  2CHX A;  2KJH B;  1YQ3 B;  4YTM B;  2NBW B;  3A9K B;  2N7J A;  3W5U B;  2FCN A;  4ITK A;  1LO5 D;  4WJQ A;  2HJ1 A;  1PDX A;  4K1R B;  4C56 C;  1MI0 A;  3PSE B;  4JIO U;  1XCT L;  1ENF A;  1JAL A;  2WXL A;  2WXF A;  2KAJ A;  2MJE A;  2EKI A;  2PTL A;  3H1U A;  2L52 A;  2KVR A;  1GG3 A;  2CR5 A;  4HPM B;  2Z59 B;  2WP9 B;  2UWQ A;  2L76 A;  2JQR B;  1YX6 B;  2IO3 B;  3ECI A;  3VAW A;  2ZCC A;  3U4E G;  2YEP B;  3PZ7 A;  3ZW3 A;  3K9O B;  1YQ4 B;  2BWE S;  4OZC A;  4DXF A;  3AEF B;  1KOT A;  5G2N A;  3BZD B;  3V62 A;  4PYU A;  4N58 A;  4YXD B;  5EDS A;  3MHS D;  1XT9 B;  4JWS C;  5FKA C;  1F0Z A;  4JL9 A;  2KN5 A;  2XK5 B;  3RNB C;  2PKO A;  4IC7 B;  1MG4 A;  2V3S A;  2IPK D;  1C76 A;  1G6J A;  1R4M I;  2M19 A;  2MH7 A;  3NVY A;  2PW9 A;  4XYC A;  3IT4 B;  2RDB C;  4JWU C;  3DVN V;  1NI2 A;  3RMK C;  4HPP A;  1F1H A;  2WU2 B;  2BWF A;  1MG8 A;  4PS3 A;  1Z5S B;  1F9J A;  4BZA A;  1E7U A;  2KYW A;  2BYV E;  3DVN U;  3T8M A;  2JWU A;  1J8C A;  4LLG M;  1NEN B;  3NHE B;  1Q10 A;  1V6E A;  3H7P A;  5HHD G;  3CSF A;  2WWZ A;  5HI1 A;  1E5W A;  4DXG A;  1VZ6 A;  1GT8 A;  3RD2 A;  4BBN C;  3EEC A;  4IWO A;  2M56 B;  4AS1 A;  3A4S C;  3L08 A;  1J7A A;  3DCG A;  1HEZ E;  3Q69 A;  1D3Z A;  3ZJU A;  4AQ7 A;  3R8B A;  2ZVO A;  2ZNV C;  2PVO D;  1HQR D;  1GC7 A;  1SF0 A;  2KFJ A;  4EUT A;  3T3O A;  4MM3 A;  3DWG C;  5AEK B;  3NS1 A;  4HKZ E;  1ESF A;  3Q8C A;  1LXD A;  3A4R A;  2LRU A;  3R66 C;  4W9G A;  1SSN A;  4JGH B;  4ZRP A;  4K7S A;  4DHZ E;  1R4N B;  2MX2 A;  3PRP B;  4JQW C;  4TUU A;  3GZN I;  2IDY A;  4WAA A;  2LGY A;  4A8X C;  1UH6 A;  1I7H A;  3PTF C;  1BUI C;  3RUL A;  4RM9 A;  1T0S C;  4CO7 A;  4RGN A;  2CHZ A;  4C7Y A;  4M00 A;  1B9R A;  4YTP B;  2N1V A;  1VZ7 A;  1V9J A;  1STE A;  3PO0 A;  2Z8L A;  2RPV A;  3U7Z A;  5J2R A;  1P3Q U;  2N4F A;  4HEA 1;  4YTN B;  1TS3 A;  1WYW B;  1QIL A;  3FIL A;  2WXJ A;  2WX1 A;  3BIN A;  3W9C B;  1ZGU B;  2BVC A;  1JRO A;  2JZP A;  2KLC A;  3ABV B;  3UQA A;  1SE4 A;  3WAL A;  3DBL I;  2W3R A;  4ANV A;  4BOZ B;  5E6O A;  2G3Q B;  1E8Y A;  1EF1 A;  1IP9 A;  1IUE A;  1IBX A;  4YL8 A;  3UIO B;  4ICU A;  1ZDV A;  3PHW B;  2KAC A;  1GC6 A;  3P63 A;  1DOY A;  3EA6 A;  3VRA B;  3A9J A;  3APC A;  3B9J A;  2AWT A;  2KD0 A;  4WAF A;  5CHF A;  4LJO B;  4A9A A;  3RPF C;  2LJ5 A;  3FAH A;  2HTH A;  4BOS C;  2QIE B;  1I4G A;  4KGR A;  1XLN A;  4ZYN A;  5HKH A;  2GBJ A;  4ZRI A;  1LM8 B;  3PLU A;  3ZUN A;  1V8C A;  4S17 A;  5IN7 A;  2LHD A;  4C7Z A;  3VVW B;  4D2K A;  5IO9 A;  1K50 A;  3QHT A;  2VH1 A;  1V2Y A;  3IAS 1;  5D3D A;  4N59 A;  5EE0 A;  1P7E A;  4NQL B;  1WGR A;  2LZ6 A;  4W9C A;  2MHJ A;  3WA0 A;  2FAZ A;  1UEL A;  3P4Q B;  3MFG A;  3RUI B;  4G0N B;  2WGS A;  2RDH A;  3JSV B;  2W54 A;  4JLC A;  1RLF A;  2N9K A;  5CTR C;  4DHJ D;  2M1M A;  1WYG A;  5G5H A;  3RNC C;  1E0Z A;  1LFD A;  2WU5 B;  1NDD A;  4IWQ A;  5HG2 A;  1VD2 A;  3Q8E A;  3MC9 A;  2A5U A;  2N9L A;  3RYT A;  5D94 A;  3SD5 A;  4RF1 A;  1D5X C;  3R7R A;  4GB9 A;  4PT5 A;  3QAQ A;  2E3T A;  4YSZ B;  3AE3 B;  4MSQ B;  2EMS A;  2V3P A;  2KQ4 X;  3TEW A;  1V1P B;  3B0A A;  3APF A;  2JRI B;  2R2Q A;  3KVF B;  3ZXV A;  4DDI D;  2BYT A;  1WXA A;  2VZK B;  1N5W A;  3Q8B A;  3VRB B;  4OZB A;  2RMM A;  1WGH A;  1E7V A;  4ACF A;  2CJO A;  1WSP A;  4IM2 A;  2C7H A;  4JPS A;  4HXD A;  3VUX A;  4NJ6 A;  2NCN A;  4P1C C;  1SIJ A;  4GU2 A;  2LGX A;  1TS5 A;  2KTR A;  1N60 A;  4NJC A;  1SBB B;  2JSV X;  1H4R A;  4RMA A;  2I2Y A;  2KO3 A;  4PS7 A;  3Q2A C;  3PHX B;  3W5V B;  1TZ1 A;  4KDI C;  1E10 A;  2MEK A;  4II2 B;  1J0G A;  2LGD A;  3LXF A;  3N32 A;  4YT0 B;  4NPN A;  1UGJ A;  4FHJ A;  1HE8 A;  4BKS A;  1LQB A;  2MJD A;  3L0W B;  3ZRC A;  5G5G A;  5BO4 B;  2PVG C;  2NS5 A;  4DHZ B;  3RNE C;  1RFA A;  1J7B A;  3J9C A;  5CX3 A;  2Z0E B;  2EMT A;  2V4I B;  4RGM A;  3Q3N C;  5BMI A;  2RD0 A;  3ZNZ B;  3AED B;  3NOB A;  5FK9 C;  3QK0 A;  3W1Y A;  1YX5 B;  3P42 A;  1WGK A;  3TMP B;  1VZ8 A;  4WQO B;  2NBU A;  3VUY A;  4MEL A;  4EE2 A;  2HJ8 A;  1N5X A;  4FJV B;  1TYG B;  1JWM D;  2J53 A;  2J0M A;  4RF0 A;  1NEK B;  1NYR A;  1V1O A;  1AW7 A;  2C5L C;  1ACC A;  4F1S A;  3N20 C;  4PYZ A;  2ACZ B;  4L2Y A;  2M8S A;  1Q1O A;  4TMA B;  3X23 A;  3ZLZ A;  4E71 A;  1D5Z C;  1GB4 A;  1UNS A;  4A3P A;  4NZL B;  4EZJ A;  4CHK A;  3PRM B;  4ZRQ A;  1NI3 A;  2CJN A;  3Q8A A;  2DYM A;  3AH7 A;  4CQN A;  2JX5 A;  1GJZ A;  2VH2 A;  4W9I A;  4WUR A;  4BAX A;  3SFD B;  5H92 C;  1WF9 A;  1DGJ A;  3QA8 A;  1VRA B;  3V60 A;  4C80 A;  4OHJ A;  2AL6 A;  3AE1 B;  1Y56 A;  1ZUD 2;  3KWL A;  1IBX B;  2NBV B;  1M4V A;  2YVC A;  2DZJ A;  2IO0 B;  1TY0 A;  4LTU A;  2B76 B;  2KLG A;  4LNO A;  1E90 A;  2K8B A;  3ZJV A;  1SB3 C;  5JXV A;  1XO3 A;  3H9D A;  3KUZ A;  2O2V B;  2JRH A;  3UGB B;  1SGH A;  2WXO A;  4B95 A;  1ET9 A;  3C0R B;  1FNW A;  3KW5 B;  4XGA B;  4ANX A;  2JPH A;  1JWA D;  2C7N B;  4N6E B;  1AWD A;  4USA A;  3VH4 B;  2LUM A;  1MPE A;  4FHK A;  5AZF A;  1ZDX A;  4LNK A;  2PE6 B;  1RM6 C;  1XXG A;  4TKN A;  2J4X A;  3N1Z C;  4II3 B;  3T3N A;  1YQB A;  4KZ0 A;  2LAS A;  1SEB D;  2KDB A;  1E8W A;  2JZZ A;  2MA9 B;  4LCD E;  4MH8 A;  5G55 A;  4W9H A;  1EU3 A;  2ON8 A;  4ZHO A;  3VUW A;  1QOG A;  2XNA C;  3P4S B;  3Q3O C;  3SU8 X;  4BKS D;  2FCQ A;  4OVU A;  3JSV A;  1RYJ A;  2W82 A;  3PVL A;  2Y5C A;  3TSS A;  1XF5 L;  2BYF A;  3DBR B;  4XE0 A;  3DBS A;  3OJ3 A;  4J3O D;  2L8J A;  2LMC A;  3EGR A;  4B0M A;  2M4N A;  4TV3 A;  2H89 B;  3DPD A;  3N30 A;  4MT5 A;  2BT6 A;  3W1S C;  1K53 A;  1F77 A;  4W9F A;  3AV8 A;  1TT5 B;  4GXB A;  3ALB A;  1V1P A;  1YJJ A;  3O13 A;  2BQQ A;  2G4D B;  4GDL B;  3ZGZ A;  2IO2 B;  1SJE D;  5I4D A;  3AE4 B;  5AZG A;  1S3S G;  2ZCB A;  1I35 A;  2IGD A;  1WFY A;  4FUL A;  3K9P B;  1YJI A;  2RGF A;  1GTH A;  1M94 A;  2JZ3 B;  4HKQ A;  1WGY A;  3ZDM C;  5JHA A;  4P16 A;  2BTE A;  3M62 B;  2K1F A;  4URK A;  1A70 A;  4W9J A;  2TSS A;  3IHP C;  2WQY B;  1WE6 A;  1DOX A;  4GOC A;  2ZNV B;  3NG0 A;  3ENE A;  2QHO A;  1TKE A;  2JY6 A;  5GMV A;  5C2T B;  4FJZ A;  1WRD B;  3DQV A;  3QJZ A;  3GS2 A;  1WIA A;  2WXM A;  1L0V B;  1OGW A;  3VH3 B;  1V49 A;  2KTR B;  1C4P A;  1U4A A;  2YEP F;  4XZ4 A;  3OAW A;  3NUH B;  1SXT A;  1C77 A;  3RT3 B;  1KH0 A;  1DYQ A;  5H8Y E;  3SR6 A;  5BYS A;  1V86 A;  3ZKJ C;  1T3Q A;  3M3J A;  3I3T B;  2BS4 B;  2INN E;  3NY5 A;  2NTT A;  1TGZ B;  2INP E;  2AL3 A;  4G50 A;  1OEY A;  2M0A A;  2IJ0 A;  2KZR A;  1FEH A;  4MDK E;  3AN1 A;  2RPQ A;  3UQB A;  2BPS A;  4GDK B;  5BMG A;  1PQS A;  2V9H A;  2C9W B;  1A5R A;  1KF6 B;  1YNT E;  3HVD A;  3LDZ E;  3MC0 B;  2KT7 A;  4N9F 4;  5LXI B;  2D2Q A;  5D2M B;  1UBQ A;  2K5P A;  2ZPY A;  3VDZ A;  2BBC A;  5D6J B;  1I4H A;  3FC4 A;  1EM7 A;  4AUQ C;  3WIM A;  2MBQ A;  3W2D A;  1C9F A;  2L32 A;  2IGG A;  3ZYY X;  1MVK A;  1F2R I;  2LXA A;  5C1Z A;  2QMT A;  3EC8 A;  1V5O A;  1DOI A;  4DDG D;  5J17 A;  1CK1 A;  3ETR A;  1PGB A;  2FE8 A;  1H8C A;  1MJD A;  2J0J A;  3BVZ A;  4TQ0 A;  5JHB A;  5BMH A;  4WWO A;  1N61 A;  4WWM A;  1HA5 A;  3AMZ A;  3MHZ A;  1WX7 A;  1FNU A;  2D3C A;  4X57 B;  3RFZ B;  3PS6 A;  1KM7 A;  4ZOH C;  2MSE D;  3DHH C;  3IXS A;  3V05 A;  4ANU A;  3DDC B;  1WRI A;  2VZK D;  3ZRF A;  2RR9 A;  1IYF A;  4KZC A;  5DCN A;  3I5J C;  2JYT A;  1FXT B;  1V5T A;  4FN2 A;  2O2V A;  2DAF A;  2QDF A;  2DX5 B;  3NVV A;  1WGD A;  5EE9 A;  3JYU A;  2IO1 B;  2PLP A;  2WXK A;  1P7F A;  2DZK A;  5FR3 A;  2GRI A;  4NAM A;  5C3J B;  1P1A A;  2QJL A;  2MJ3 A;  2DLB A;  3AU4 A;  2MP2 B;  3N1X C;  1FCL A;  3IFW B;  3V3X A;  2LVQ A;  4EZL A;  1SIF A;  4MGZ E;  3EFU A;  2PIA A;  3LB8 C;  2WX0 A;  2LVO A;  1FNV A;  4CYE A;  3PZ8 A;  4W9D A;  1UGM A;  4FLH A;  4FBJ B;  1EWC A;  1EO6 A;  2BW2 A;  4IW0 A;  4W9L A;  3L4P A;  1V80 A;  3WCQ A;  4H2A A;  2SAK A;  4YSY B;  5FR6 A;  2KC2 A;  4REZ A;  4YSX B;  4MGY E;  3E9S A;  2D11 A;  3N9Y C;  2WS3 B;  1FD6 A;  4NY0 A;  2KJ6 A;  3NJT A;  3MJ5 A;  5DPR A;  4ARI A;  3PGE A;  2LXC A;  2N1W A;  5AZH A;  1SE9 A;  1SE2 A;  3RNF C;  1ISN A;  1IGD A;  4PK1 A;  1L2N A;  2QIL A;  3SDL C;  2PEA A;  1R7S A;  2OOB B;  3AE7 B;  4WJN A;  5GXG B;  2XBB C;  2LVP A;  3AEE B;  1UBI A;  2MBE A;  4I6N B;  1WR6 E;  1RWS A;  2C7M B;  2L3Z A;  3N1Y C;  2LGS A;  3QCA A;  1WJN A;  4ZHP A;  2OJR A;  1ZP0 B;  1JWS D;  1HZ6 A;  2K25 A;  5L83 A;  4HPL B;  1YMH E;  1FXI A;  4GDL A;  4EOY A;  2H88 B;  3DBH B;  1JML A;  1GB1 A;  1KRH A;  4B6W A;  4OZA A;  1S1Q B;  3RI7 C;  3RN9 C;  1YJ1 A;  3ONS A;  3OJ4 B;  2D3G A;  2CHW A;  4HRO A;  3HM6 X;  3B2F A;  1KLU D;  3CST A;  3KQ4 A;  5LNK 1;  1ZPS A;  3C8Y A;  1TS4 A;  2HTM E;  3L54 A;  4IM0 A;  4MJS B;  5E6P A;  2HE7 A;  1FPY A;  3CMM B;  1JRP A;  4C00 A;  1UWM A;  5L95 C;  4J6I A;  3IBE A;  1WXS A;  1BXT A;  1QOB A;  2IY1 B;  5BYQ A;  1WX9 A;  5HFY A;  4HLE A;  4K7W A;  3RNG C;  2AQ3 B;  1FM0 D;  1R4N I;  4PS8 A;  3T9L A;  2FID A;  1WX8 A;  4GN1 A;  5DPW A;  3SHQ A;  3GE8 C;  3MTN B;  3VR9 B;  1GNU A;  1L5P A;  3PT2 B;  1YOV B;  4TSS A;  1CMX B;  3PRZ A;  1D4B A;  2KJR A;  1QF6 A;  2ZJD A;  2L00 B;  4WQM A;  1EUV B;  1P0R A;  1OTR B;  4GDK A;  3HK0 A;  3AE2 B;  4XC2 A;  3HUI A;  4B0E A;  2VRR B;  2WXR A;  3UI3 A;  1E9M A;  4AOF A;  4WWP A;  3ZIM A;  4EZK A;  3HHM A;  4OW0 A;  2BS3 B;  2KWU B;  2MWS B;  5E6N A;  1CZP A;  3L16 A;  1MFW A;  1R4M B;  1ET6 A;  4A3O A;  2OED A;  2A4Z A;  4EKU A;  5MPO A;  3PZD A;  3TBL D;  3VTU A;  2G9H D;  3ZNG C;  1X1M A;  2LFI A;  2FNJ B;  2KDM A;  3AEG B;  2BB6 A;  1KLG D;  3M95 A;  2WYQ A;  2IY0 B;  2BS2 B;  2K8C A;  1IPG A;  2NVU I;  1N6Z A;  3CIR B;  2I1J A;  3DWM A;  4GIV A;  5IA7 A;  1EWY C;  2BKR B;  4KGT A;  4AJY B;  4I6L B;  2N9P C;  2ZW0 A;  3DVG X;  2Z0D B;  2V3N A;  2EEL A;  2NR2 A;  2WXH A;  5CHV C;  2AYO B;  3QX1 A;  4L23 A;  3O65 B;  2EKE C;  1NYQ A;  4HDQ A;  1JQ4 A;  2O6V B;  1WWT A;  1KTK A;  2N9X A;  5EE1 A;  2LUE A;  3P2B A;  1TKY A;  2KWV B;  3KYC D;  4K3C A;  5E6J A;  2D07 B;  1KJT A;  1T0Q C;  3H6N A;  3PLV A;  1L0Y B;  5JH5 C;  2LJI A;  3HVZ A;  2LWP A;  3AB5 A;  3NVZ A;  4RM8 A;  2Q5W D;  1C4A A;  4XX5 A;  2FCS A;  4M0W A;  2AEH A;  1ZE3 D;  4MGK E;  3ZNI D;  2LGI A;  1AYF A;  2MP2 A;  2CS4 A;  2XEW A;  3TCA A;  2ONQ A;  1L6U A;  1F52 A;  2KTF A;  3FKY A;  4F8C B;  3BVG A;  5J18 A;  2SEB D;  3EFC A;  2WXN A;  4Q2J A;  3B2G A;  4LNI A;  1YIW A;  5T8I A;  3MC8 A;  3VR8 B;  1VR9 A;  3DBH I;  2GI9 A;  1C4C A;  4GLS C;  1IGC A;  1OQY A;  2N0S B;  1WY8 A;  3NZS A;  1PUT A;  2V1Y A;  3P1M A;  3A1Q B;  2G45 B;  4WJO A;  2AQ2 B;  4KSL C;  2W55 A;  1UUP A;  2WNM A;  4E3C A;  4ZRJ A;  4KKI A;  1UWX A;  3BWU D;  2WHI A;  1GUA B;  4IWP A;  4AJW A;  4G3X B;  1FFU A;  1QOA A;  1WMH B;  1YN4 A;  3TIX A;  1I4P A;  2L05 A;  2AQ1 B;  4ZYS A;  3AI5 A;  1I4R A;  1FRR A;  4I6P A;  2IZV B;  2RDG A;  3PPA A;  2WLB A;  3R2T A;  1TS2 A;  2MBB B;  1EF5 A;  5D7G A;  3UIN B;  2KDE B;  4XDD A;  3C19 A;  4M8M A;  4BKT A;  1SJH D;  2GBK A;  2KMM A;  4A6Q A;  4HK2 A;  3NS8 A;  4AWJ A;  1T6B X;  2DYB A;  4YWG G;  3BK1 A;  1H7W A;  1I4Q A;  4KV2 A;  1OFF A;  2D5G A;  2DZM A;  2M17 A;  2MBH A;  4MJS A;  4XWW A;  3I9V 1;  3VTV A;  3BK2 A;  1OQQ A;  3NZU A;  2D3A A;  4JX1 C;  4G11 A;  3VHT C;  5CHW A;  2KAN A;  3V6E B;  2PMV A;  2NTS A;  5BYR A;  1ZXI A;  1TZO A;  2JXX A;  1GTE A;  5AUI A;  5AUK A;  2B3A A;  3TEX A;  2W3S A;  2WXI A;  4A55 A;  2NPT B;  5C23 A;  4US8 A;  1PGA A;  4QAY A;  4ICV A;  4HRS A;  2GOW A;  2WXG A;  2JXT A;  2HDE A;  3L10 B;  2QCZ A;  2LI5 A;  1YN3 A;  3GB1 A;  3ZQ4 A;  1C3T A;  4FXC A;  3MP9 A;  4IM3 A;  4K7U A;  3VQI A;  3WAP A;  1C79 A;  4HDO A;  2UYZ B;  2V0G A;  4GGQ A;  3ZTD A;  1TTN A;  3CF4 A;  1P9D U;  3WAM A;  4BBN F;  5LLI A;  2LD9 A;  4DXA B;  2KWD A;  1WE7 A;  4IUM B;  2K3U A;  4NNJ B;  1FXA A;  4LDT B;  4P1B C;  3NRZ A;  2WXP A;  2RSU A;  2L83 A;  2JWZ A;  3U8Z A;  2IND C;  2ZZP B;  1XLP A;  1Z2M A;  2MW5 A;  4E74 A;  5IAA C;  2MQJ A;  3V6C B;  2JU6 X;  4US9 A;  4FJY A;  2KX0 A;  3AE8 B;  1ZKH A;  2KMC A;  3ZVV A;  3DVG Y;  2BYE A;  4NAW A;  3OWE B;  5IKC M;  5DPT A;  1AAR A;  3TUO A;  3Q8F A;  5LXH A;  2FBW B;  1HZ5 A;  1QOF A;  2ASQ A;  2M0X A;  1TKG A;  2KFK B;  2NMQ A;  3R3M A;  1KLV A;  1B1Z A;  4RH6 A;  5IP4 D;  3PV1 A;  4HCN B;  2L1A A;  3RZW C;  4JE3 B;  2KDF B;  2KOX A;  1JW9 D;  1FCC C;  4A90 A;  2ZEQ A;  4ZRK A;  2REX A;  3RNA C;  4KGS A;  3QQ8 B;  1J7C A;  2O6V A;  3OG5 A;  2ZVN A;  1WJ4 A;  3EHV A;  3EUB 2;  2KHW B;  3HM3 A;  3AU5 A;  4RGT A;  1TBE A;  4WH4 A;  1TY2 A;  1Q0W B;  2N9E B;  4KIK B;  1VJK A;  3M63 B;  3VFK A;  2WDT B;  2KQ7 A;  3RZF A;  1PGX A;  1TIF A;  2LEK A;  3IAM 1;  1ROE A;  4XDC A;  5D3I B;  1WXM A;  1JCK B;  3KH0 A;  3SFE B;  3OLM D;  2KVZ A;  3KWV A;  4LNN A;  1WXQ A;  1UD7 A;  2JVC A;  4KX6 B;  4KDL B;  1VCB A;  2Y5B B;  4GMV A;  1RAX A;  1P98 A;  2JYE A;  2I1K A;  4M0W B;  1VDV A;  1FFV A;  3QWZ B;  1WJU A;  3BII D;  3R7Q A;  3BYY B;  3HRD D;  5DPS A;  2GBR A;  1WI0 A; 
#chains in the Genus database with same CATH homology
 3KLS X;  2WU2 B;  2I38 A;  5JXV A;  1XO3 A;  4IOI E;  2WXO A;  3CWI A;  3GP7 A;  1ET9 A;  3VR9 B;  1L5P A;  1PFD A;  3U2S C;  1FNW A;  4TSS A;  1D4B A;  2JWU A;  1QF6 A;  1NVI D;  1JWA D;  4N6E B;  1AWD A;  4KKJ A;  4USA A;  4LLG M;  1NEN B;  2LUM A;  1MPE A;  1Q10 A;  3AEB B;  1XEE A;  4WQM A;  5HHD G;  1ZDX A;  1GAQ B;  1RM6 C;  1XXG A;  3AEC B;  5HI1 A;  2J4X A;  3W1S A;  1FIQ A;  4DXG A;  1H7X A;  1VZ6 A;  1GT8 A;  3T3N A;  4O1N A;  3AE2 B;  2M56 B;  4AS1 A;  2WDV B;  3HUI A;  1SEB D;  4B0E A;  1J7A A;  3Q69 A;  1HEZ E;  1QT9 A;  3ZJU A;  2WXR A;  4MH8 A;  4R3D A;  4XWT A;  4AQ7 A;  3UI3 A;  3R8B A;  3E56 A;  1EU3 A;  2ON8 A;  4ZHO A;  1E9M A;  1QOG A;  2PVO D;  1QLB B;  2XNA C;  3P4S B;  1HQR D;  1SF0 A;  3T3O A;  4OW0 A;  2BS3 B;  1RFK A;  3P4R B;  1CZP A;  3DWG C;  3NS1 A;  1RYJ A;  1ET6 A;  2W82 A;  4HKZ E;  1ESF A;  3Q8C A;  2OED A;  1N62 A;  5MPO A;  4L1B A;  5TSS A;  1SSN A;  1L4Z B;  2G9H D;  4ZRP A;  3NZ3 A;  2Y5C A;  2LFI A;  2KDM A;  3TSS A;  3AEG B;  2BB6 A;  1XF5 L;  1KLG D;  4XE0 A;  2BS2 B;  3CIR B;  2IDY A;  1CJE A;  1JWB D;  4A8X C;  4J3O D;  3DWM A;  3TEZ A;  1I7H A;  2LMC A;  3EGR A;  1EWY C;  4B0M A;  4KGT A;  1BUI C;  2H89 B;  1GOZ A;  4MT5 A;  2BT6 A;  2ZW0 A;  1K53 A;  4RGN A;  1F77 A;  4LK0 M;  4C7Y A;  2Y5P A;  1B9R A;  3I57 A;  2V3N A;  3AV8 A;  2EEL A;  4YTP B;  2WXH A;  1VZ7 A;  1STE A;  3PO0 A;  1V1P A;  1YJJ A;  3O13 A;  4L23 A;  2Z8L A;  4GDL B;  1NYQ A;  1JQ4 A;  2RPV A;  3U7Z A;  2R61 A;  3ZGZ A;  1SJE D;  5I4D A;  2OHF A;  1MHX A;  1EU4 A;  1WWT A;  3AE4 B;  4HEA 1;  4YTN B;  1KTK A;  1TS3 A;  1QIL A;  5EE1 A;  3FIL A;  2ZW1 A;  2WXJ A;  1CQV A;  2IGD A;  3W9C B;  1TKY A;  1YJI A;  1GTH A;  3AE5 B;  4HKQ A;  1JRO A;  4P6V F;  2JZP A;  5E6J A;  3ABV B;  2X38 A;  1SE4 A;  4P16 A;  2BTE A;  1L0Y B;  2LJI A;  3HVZ A;  2W3R A;  1A70 A;  2TSS A;  3AB5 A;  3NVZ A;  3ZJT A;  2Q5W D;  1C4A A;  1IBX A;  1IUE A;  2WQY B;  1DOX A;  4M0W A;  1ZDV A;  3IT6 B;  1XLQ A;  1TKE A;  1ZE3 D;  5C2T B;  2KAC A;  3GS2 A;  1XCQ L;  2WXM A;  3P63 A;  1L0V B;  1DOY A;  3EA6 A;  2LGI A;  3VRA B;  3B9J A;  1AYF A;  1C4P A;  4WAF A;  2YEP F;  1XLO A;  3NUH B;  1E7P B;  1SXT A;  1C77 A;  4A9A A;  3RPF C;  1KH0 A;  2ONQ A;  1JWU D;  1DYQ A;  4RCO A;  5H8Y E;  3FAH A;  3SR6 A;  2CU3 A;  1L6U A;  2QIE B;  1FMA D;  3BVG A;  5BYS A;  1I4G A;  4KGR A;  2SEB D;  4OVZ A;  3H8H A;  2WXN A;  1XLN A;  4Q2J A;  1T3Q A;  2FUG 1;  3B2G A;  2BS4 B;  1OQR A;  2INN E;  5T8I A;  2NTT A;  1V8C A;  2INP E;  2BB5 A;  1FRD A;  3VR8 B;  1VR9 A;  2M0A A;  2GI9 A;  1C4C A;  4GLS C;  2IJ0 A;  1IGC A;  1QQR A;  2N0S B;  1FEH A;  1PUT A;  1I4X A;  2GB1 A;  3P1M A;  2LHD A;  3AN1 A;  5EE3 A;  3SEB A;  4C7Z A;  4GDK B;  5BMG A;  2AQ2 B;  4D2K A;  2W55 A;  1K50 A;  1UUP A;  1KF6 B;  2WNM A;  3IAS 1;  5D3D A;  1YNT E;  4KKI A;  2IGH A;  4N59 A;  5EE0 A;  3HVD A;  1P7E A;  2XN9 C;  3MC0 B;  1UWX A;  3LYY A;  2WXQ A;  1QKZ A;  2WDQ B;  1GPX A;  1L4D B;  2DBY A;  3BWU D;  1K51 A;  4NAW B;  3P4Q B;  1TJE A;  2K5P A;  3MFG A;  4MM3 B;  1FO4 A;  2BBC A;  2RDH A;  1FFU A;  1QOA A;  1I4H A;  1KFY B;  1YN4 A;  1I4P A;  2W54 A;  3FC4 A;  1EM7 A;  2DYO A;  3TEY A;  2AQ1 B;  2N9K A;  4ZYS A;  1N63 A;  1I4R A;  1E6E B;  1FRR A;  3W2D A;  3BVM A;  1WYG A;  3BYT B;  2K9X A;  1C9F A;  1L0X B;  5G5H A;  2L32 A;  2IGG A;  4UDU C;  2RDG A;  1MHH E;  1E0Z A;  4ARC A;  2WU5 B;  2WLB A;  5HG2 A;  3R2T A;  1TS2 A;  3ZYY X;  1MVK A;  3Q8E A;  5D7G A;  1F2R I;  2QMT A;  4XDD A;  2N9L A;  1DOI A;  1D6E C;  3AE6 B;  1SJH D;  2KMM A;  1CK1 A;  4A6Q A;  3ETR A;  1PGB A;  2FE8 A;  4RF1 A;  1D5X C;  1YN5 A;  1T6B X;  4PT5 A;  4YWG G;  3BK1 A;  3R2I A;  2E3T A;  1SE3 A;  3AEA B;  3BVZ A;  4YSZ B;  1H7W A;  3AE3 B;  1I4Q A;  4TQ0 A;  1OFF A;  2D5G A;  4XWW A;  2V3P A;  2KQ4 X;  3I9V 1;  3TEW A;  1V1P B;  5BMH A;  3BK2 A;  1OQQ A;  4JX1 C;  1N61 A;  4WWM A;  1HA5 A;  3AMZ A;  3MHZ A;  1BML C;  4HJG E;  1FNU A;  1D5M C;  1C78 A;  3RFZ B;  4WIP A;  4ZOH C;  2BYT A;  3FIL B;  2QEJ C;  2PMV A;  2VZK B;  3IXS A;  2NTS A;  1N5W A;  3Q8B A;  3VRB B;  2QSD A;  4OZB A;  2RMM A;  5BYR A;  3V05 A;  1WRI A;  1ZXI A;  1TZO A;  2VZK D;  1GTE A;  5AUI A;  2CJO A;  1WSP A;  5AUK A;  2ICI A;  3TEX A;  2W3S A;  2WXI A;  4JPS A;  4A55 A;  2K0P A;  4RGO S;  2JYT A;  4US8 A;  1PGA A;  2KN4 A;  2Y3A A;  4IKG A;  4HRS A;  1SIJ A;  3NVV A;  4MAC A;  2J42 A;  4IDI A;  1TS5 A;  2WXG A;  2JXT A;  3U52 E;  2HDE A;  5EE9 A;  1YN3 A;  1N60 A;  3GB1 A;  4TQ1 A;  2PLP A;  2WXK A;  4NJC A;  1P7F A;  3AE9 B;  1SBB B;  5FR3 A;  1T5X D;  2GRI A;  4NAM A;  4RNA A;  2JSV X;  2E6X A;  1HXY D;  3ZQ4 A;  1K52 A;  5C3J B;  2QJL A;  1V97 A;  4RFB A;  2I2Y A;  4FXC A;  2MJ3 A;  2DLB A;  3MP9 A;  2WDR B;  2G1E A;  3URY A;  1FCL A;  2J52 A;  1PYW D;  3V3X A;  1C79 A;  3VQI A;  3W5V B;  2DWQ A;  1E10 A;  2V0G A;  2MEK A;  2PIA A;  1ZOY B;  3LB8 C;  3LXF A;  3CF4 A;  1L6V A;  1AN8 A;  4DQO C;  2KWD A;  1FNV A;  2K3U A;  1FXA A;  3PZ8 A;  4YT0 B;  3NRZ A;  2WXP A;  1UGJ A;  1EWC A;  2L83 A;  2BW2 A;  2MJD A;  3P4P B;  3L4P A;  3WCQ A;  4H2A A;  2SAK A;  5G5G A;  2PVG C;  4YSY B;  1VLB A;  2K22 A;  1XLP A;  2AX5 A;  1ZXH A;  4REZ A;  4YSX B;  3E9S A;  3AM9 A;  3N9Y C;  2WS3 B;  1FD6 A;  1J7B A;  3NVW A;  2JU6 X;  4US9 A;  3MJ5 A;  3J9C A;  2LHE A;  4ARI A;  3AE8 B;  2V4I B;  4RGM A;  5BMI A;  1F2R C;  1SE2 A;  3AED B;  1IGD A;  3OWE B;  2QIL A;  5FK9 C;  1R7S A;  3P42 A;  3TUO A;  1WGK A;  3Q8F A;  3AE7 B;  1VZ8 A;  5GXG B;  1YQ3 B;  3AEE B;  4YTM B;  2N7J A;  2FBW B;  1HZ5 A;  1QOF A;  1RWS A;  1TKG A;  2NMQ A;  3W5U B;  4EE2 A;  1N5X A;  4ITK A;  1TYG B;  1B1Z A;  1JWM D;  2J53 A;  4RH6 A;  1LO5 D;  1PDX A;  4C56 C;  1MI0 A;  1XCT L;  2L1A A;  4ZHP A;  4RF0 A;  1ZP0 B;  4JE3 B;  1NEK B;  1JWS D;  1ENF A;  1JAL A;  1JW9 D;  1NYR A;  2WXL A;  2WXF A;  1FCC C;  4A90 A;  1HZ6 A;  1V1O A;  2KAJ A;  1AW7 A;  1ACC A;  2MJE A;  2EKI A;  2PTL A;  1YMH E;  2L52 A;  2ACZ B;  1FXI A;  4KGS A;  1J7C A;  4L2Y A;  2H88 B;  1JML A;  1GB1 A;  1KRH A;  2WP9 B;  2JQR B;  3EUB 2;  4OZA A;  4TMA B;  4RGT A;  4WH4 A;  1TY2 A;  4HRO A;  1VJK A;  1GB4 A;  1D5Z C;  3U4E G;  3B2F A;  1UNS A;  2YEP B;  3PZ7 A;  4NZL B;  1KLU D;  5LNK 1;  3KQ4 A;  1ZPS A;  1YQ4 B;  1PGX A;  4OZC A;  3C8Y A;  2LEK A;  3IAM 1;  1TS4 A;  1ROE A;  2HTM E;  4XDC A;  5D3I B;  4ZRQ A;  1NI3 A;  4DXF A;  3AEF B;  1JCK B;  3SFE B;  2CJN A;  3Q8A A;  2DYM A;  3AH7 A;  3KWV A;  4CQN A;  1WXQ A;  2JX5 A;  3BZD B;  1JRP A;  1UWM A;  4WUR A;  4N58 A;  3SFD B;  4YXD B;  4KX6 B;  5H92 C;  4JWS C;  5FKA C;  1F0Z A;  1DGJ A;  1BXT A;  1QOB A;  1VRA B;  5BYQ A;  2PKO A;  4C80 A;  4OHJ A;  5HFY A;  3AE1 B;  1Y56 A;  2IPK D;  1C76 A;  1ZUD 2;  3KWL A;  2M19 A;  1IBX B;  2JYE A;  2MH7 A;  1VDV A;  1M4V A;  1FFV A;  3NVY A;  3BII D;  2PW9 A;  3IT4 B;  1TY0 A;  4LTU A;  4JWU C;  2B76 B;  2AQ3 B;  1FM0 D;  3BYY B;  3HRD D;  3ZJV A;  1SB3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...