3AE8B

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-isopropoxy-phenyl)-2-trifluoromethylbenzamide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
239
structure length
239
Chain Sequence
b'PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Isopropoxy-phenyl)-2-trifluoromethylbenzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 54
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae8B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae8B01
1GAQB 1KFYB 2WQYB 2K9XA 1OFFA 2N0SB 4LTUA 3SR6A 2CJNA 1QOBA 2W54A 3AE5B 1TYGB 1E0ZA 3W5UB 3AE7B 1FXIA 2H89B 1SB3C 3AB5A 2WDQB 2L83A 3B2FA 3KWLA 3WCQA 1CJEA 1PDXA 2H88B 1ZXIA 1A70A 1GTHA 2WU2B 3AN1A 3AEDB 1N60A 3VRAB 5C3JB 3NVYA 1E10A 1TJEA 3CWIA 4YT0B 1WXQA 1JALA 3NVVA 3CF4A 5EE0A 1IUEA 3ABVB 1RM6C 1QOAA 2G1EA 2PVGC 3HVZA 3B9JA 1JWAD 3AEAB 1VJKA 1VDVA 4US9A 4N58A 1I7HA 1QT9A 1JWBD 5AUKA 5H92C 1H7XA 1FMAD 2FBWB 3FAHA 4YSXB 3B2GA 3RPFC 4C7ZA 1RFKA 3ETRA 2B76B 2BS4B 2WDVB 3AEFB 2LEKA 3AE2B 4KX6B 1L6VA 3DWMA 4FXCA 5EE9A 1DOXA 1ZOYB 3NVWA 4WQMA 1TKYA 1V97A 2CU3A 2BS3B 1AWDA 2DWQA 1XO3A 1YJJA 5G5GA 4A9AA 2M56B 5MPOA 1UWMA 1GTEA 1YQ3B 3AECB 2K5PA 1N61A 4ZHOA 5GXGB 1NENB 4YSYB 1JW9D 3W5VB 1DOYA 2HTME 1EWYC 3P4PB 1YQ4B 1JROA 2JQRB 4N6EB 1WGKA 4YTNB 4YTPB 5G5HA 1ZUD2 2MJEA 1FFVA 2QJLA 2MJ3A 2AX5A 4ITKA 1XLNA 3EUB2 1OQQA 1L5PA 1JQ4A 3VR9B 1NVID 1R7SA 1XLPA 2OHFA 4YXDB 1E6EB 1H7WA 2Q5WD 1NI3A 3SFEB 4HROA 1FO4A 3AEEB 2PVOD 4WWMA 1KRHA 2MH7A 1XLOA 3NS1A 5H8YE 1KF6B 2WS3B 1RYJA 1QF6A 1DOIA 1ZP0B 3SFDB 3AE9B 2WU5B 1FRRA 1WYGA 3AV8A 1B9RA 1RWSA 1WRIA 1J7BA 2K22A 2QIEB 4N59A 4ZOHC 1J7CA 4ZHPA 3NVZA 1SF0A 2WP9B 4US8A 1QOGA 1L0VB 1SIJA 4JWUC 5C2TB 1L6UA 1T3QA 1CZPA 3AE1B 1N5WA 1PFDA 3P4RB 2M19A 4C80A 2WDRB 3PO0A 4JWSC 1FFUA 2WLBA 1FRDA 1FXAA 2KAJA 2MJDA 4HRSA 2EKIA 4JX1C 3P1MA 4C7YA 2BT6A 4YSZB 2KMMA 3NRZA 3AMZA 1JRPA 1N5XA 2E3TA 2W3RA 1E7PB 1DGJA 1TKEA 3AE4B 3AM9A 5AUIA 3P4QB 1N63A 3AE8B 1ROEA 1TKGA 2BS2B 3AEBB 3AEGB 3CIRB 1AYFA 3FC4A 5EE1A 3W9CB 2L52A 3HUIA 3HRDD 4P6VF 1OQRA 3VRBB 1E9MA 3VR8B 2DBYA 3LXFA 1QLBB 1N62A 3DWGC 4IDIA 1F0ZA 2ACZB 3AE3B 1NYRA 1NYQA 1FM0D 2PIAA 1QOFA 1YJIA 3L4PA 3AE6B 5EE3A 2Y5CA 1GT8A 1NEKB 2CJOA 2W55A 2PKOA 1FIQA 1XLQA 1V8CA 2JX5A 2W3SA 3AH7A 3ZYYX 1VLBA 1PUTA 1WWTA 3BIID 1J7AA 4USAA 1GPXA 3P63A 3P4SB 3LB8C 4YTMB
chains in the Genus database with same CATH superfamily
3B0AA 4H2AA 3UI3A 2PLPA 1Q5WB 2IDYA 2XN9C 2EMSA 1EO6A 3N30A 2BYEA 3SDLC 5D6JB 3A33B 4R3DA 1FPYA 2JSVX 3KWVA 4OVZA 1DYQA 1TT5B 3RPFC 3Q8EA 1E7VA 4WJNA 2KD0A 3BVZA 2WXIA 3AI5A 2DAJA 4GDKB 4DK5A 4EFOA 1CK1A 1ZOYB 4HJKA 1XO3A 2SEBD 4BBNC 1UWMA 3C0RB 5G55A 2J52A 1P7FA 1L4DB 3TUOA 2V4LA 1Z5SB 5JZEB 1C3TA 1FEHA 4MH0E 2MCNB 3TCAA 3VTUA 2AX5A 2M1MA 4ITKA 2PVOD 4WWMA 5J17A 2RSUA 1XLOA 2JZZA 5C23A 3WALA 2FUHB 2WGSA 1J7BA 1ET9A 4MSQB 4F8CB 3DBRB 5DPWA 3HHMA 3LJ3A 2M19A 4C80A 4MGYE 1OEYJ 4P1CC 3Q14C 3QQ8B 4A6QA 2JWUA 1ZKHA 2LRUA 2KHWB 2KMMA 1GC6A 1WR1A 2EKEC 2ZCBA 2BB6A 1TKGA 4REZA 1ROEA 3AEBB 2FCSA 1TS3A 2V3SA 1OQRA 3VRBB 1D4BA 3L54A 1N62A 4FHJA 5BYRA 5D7GA 4RM8A 3HVDA 3QAQA 2DZMA 2VH2A 4HWIB 2LGSA 2N7DA 3RNFC 1VLBA 1TGZB 3ZNZB 1J7AA 1WXAA 2KVRA 2YEPB 4HEA1 3H1UA 4YTMB 1GAQB 2JF5A 2KFKB 4LTUA 3IBEA 4UDUC 3WCQA 1PDXA 2H88B 3QC8B 5C3JB 2MP2B 1UD7A 3NJTA 4RGOS 4GDLB 2IO2B 2N9PC 3Q69A 3ZVVA 1CMXB 2D3AA 4MELA 2LGIA 4NPNA 1FMAD 5FR3A 3CMMB 2WWZA 3R8BA 1XQQA 1S1QB 3AU4A 3APCA 3ZTCA 3MC8A 1MFWA 4BOSC 3AE2B 3T8MA 4A8XC 2MRPA 4AWJA 1OEYA 4W9FA 4HPMB 4EZKA 4IG7B 2K8CA 1KLVA 4BAXA 3PRZA 5HHDG 2EELA 2D3CA 3P4PB 2I1JA 2N9EB 3DHIC 5CX3A 1TZOA 2QJLA 3ECIA 4K3CA 3NS1A 4LNFA 2KFJA 2VRRB 2WXRA 2ZVOA 1PGAA 2KQ4X 1J7CA 2L3ZA 3VDZA 2LGYA 1WR6E 4MGKE 2OEDA 2QILA 1CZPA 3DVNV 1V5TA 2KDEB 4GDLA 2BYTA 2CKHB 2MJDA 1MG8A 2EKIA 4A3OA 2L32A 1X1MA 2RPVA 1JRPA 2ZCCA 2HJ8A 3L08A 3AU5A 2WXKA 3I3TB 5AUIA 2DZIA 3R3MA 2RD0A 4ZRJA 4EE2A 3IFWB 3GE3C 1YJ1A 1GT8A 4FADA 2X8XX 2UU7A 2WQYB 1QOBA 3RYTA 1UGMA 3H7PB 3AB5A 1WZ3A 3ZW3A 1A70A 1GTHA 2V3PA 2DYBA 4KGSA 5D94A 4ZRKA 2HE7A 2G1EA 1R4NI 1FNUA 2C7MB 4KGTA 4XWWA 3V62A 4MSMB 2FUG1 1L0YB 2MX2A 4TMAB 3W1SC 3R2IA 2LEKA 3DVGX 3APDA 1SXTA 1LGRA 3PREA 2CU3A 2JWZA 3DBLB 2BS3B 1NDDA 4ZYNA 4MJSB 3ZKJC 1D6EC 1C1YB 3P2BA 2JZPA 1EWYC 1YD8U 4GU2A 1XLPA 2Q5WD 3TEZA 1P1AA 2XBBC 2J0MA 2LASA 2GMIC 5H8YE 2D10A 2M4NA 1RYJA 4G3XB 3VUWA 4RGNA 1QKZA 4AJWA 1L0VB 2FCQA 2LVPA 4HKZE 2OJWA 3APFA 1WE7A 4L23A 5FKAC 4NJ6A 1I4HA 1TS2A 3P1MA 3U8ZA 1RFAA 4BOZB 4GIVA 3AM9A 4TSSA 3VAWA 4EUTA 3IAM1 2IBIB 1J8CA 1K52A 2LJIA 3WANA 2MLBA 3QA8A 2O2VB 1I4QA 2QHOA 1YN4A 2MHJA 2KJ6A 2KYWA 3OJ3A 4EEWA 4PK1A 1WXMA 2R2OA 1PQSA 3ZYYX 1PUTA 4LLGM 4USAA 2D3BA 3NZ3A 2YVCA 4IKGA 1YX6B 2JYEA 4DXGA 2ZW1A 1XCQL 2JRIB 1D3ZA 3DBRI 2G45B 2PJHA 2FAZA 3ZUNA 2JRHA 3U7DA 4BFRA 3PLVA 2LJ5A 1VJKA 1VDVA 1YMHE 3QARA 3ZJVA 4NAMA 2KC1A 4MH8A 3ZDMC 5BYSA 4JPSA 3BVGA 3JVZX 4L1BA 1UH6A 1WJ4A 2KT7A 2PEAA 1L6VA 3DOWA 1D5XC 5EDSA 3LDZE 1V97A 3N1ZC 4W9JA 5CTRC 1ZPSA 2O6VB 2O2VA 1HTOA 2K5PA 4YSYB 1F9JA 3PZ7A 4ARCA 2D3GA 1C9FA 1FD6A 1R7SA 1P9DU 3U52E 2LVOA 1SBBB 4XWTA 4ANUA 4JIOU 4WJOA 3NVZA 3UQBA 1OGWA 4JWUC 4WIPA 4XGAB 3PVLA 2CHXA 4KSKC 4PYUA 5IKCM 3TJPA 3HIZA 2W9NA 4HK2A 2FNJB 4JX1C 4S17A 3W2DA 3IVFA 4JQWC 3HM6X 2PW9A 2GBKA 4FHKA 3V6EB 2JY6A 3HUIA 4DXAB 3T3NA 4OZAA 4IW0A 3C19A 3AE3B 3QHTA 2PIAA 1WGYA 4KIKB 2Y5CA 3KW5B 3O13A 1C76A 4OW0A 3P4SB 4B6WA 1PYWD 3SR6A 4E3CA 2M0XA 1WGGA 2K6DB 5IN7A 1NBFC 1F52A 3KLSX 1KLUD 1Q10A 3U7ZA 3UQAA 4RGMA 1IBXB 4ZRIA 4FA6A 4RCOA 3GS2A 1WM2A 4YT0B 2O6VD 3CWIA 2KTFA 2RDBC 1MG4A 2DYMA 1IGCA 4FJZA 1JWBD 4HVBA 3BYYB 3Q8BA 4W9DA 3Q8FA 4C7ZA 3RFZB 3L17A 1P3QU 2UYZB 2ZW0A 1V6EA 1T0SC 1QQRA 1ENFA 3N3KB 1FCLA 4A3PA 4NJ7A 2A4ZA 2KX3A 2L0TA 2KO3A 1DOYA 1SE2A 1ACCA 2N9KA 4IC7B 4KIKA 1D5MC 3PV1A 1L5PA 4M0WB 5JXVA 4LCDE 4EOYA 4FJVB 5HFYA 3SFDB 4ANVA 2LMCA 4MACA 2CHWA 2Z59B 4GLSC 1SIFA 5D3DA 3IG3A 1IBXA 2K6QA 1SJHD 1SEBD 2JT4B 2WDRB 2JVCA 3RUIB 2DNFA 3DVNU 3ALBA 1K51A 3AMZA 1VZ6A 3M62B 1GG3A 2KLGA 2ZPYA 2G4SA 3AEGB 3DBLI 3BZDB 5EE1A 2HD5B 3JSVB 3VXWA 4KSLC 3T3OA 3SEBA 2GBNA 1R4MB 1TS5A 1QOFA 3L4PA 3VHTC 3AE6B 2PKOA 3AH7A 2MQJA 1C79A 3ZQ4A 1I35A 3AXCA 3K9PB 2ZPNA 3X23A 2I2YA 2MEKA 1OQYA 3N20C 2XNAC 3PLUA 1Z2MA 3KUZA 1FXIA 2KJHB 1F77A 2VZKD 3ZIMA 5EE0A 3JW0X 5LLIA 4KZCA 1HXYD 4US9A 2NPTA 4AJYB 4XE0A 4URKA 2DZKA 4HKQA 3B2GA 2LVQA 1RFKA 1VD2A 1XXGA 3BK1A 2B76B 2L7RA 2XK5B 2NMQA 2KWUB 4EZJA 4K1RB 4BKSA 3JSVA 4K81A 1XT9B 1YQ3B 3JYUA 4LK0M 1NENB 1V9JA 1YN5A 1VCBA 3A9JA 5DPSA 3DHHC 3VVWB 2OHFA 3W1YA 4L2YA 4E74A 4DHJB 1KTKA 3I63C 3FILB 1B9RA 5J18A 2WXPA 1HE8A 1RWSA 2IY0B 2QMTA 1RAXA 1HA5A 2C60A 3K9OB 4US8A 3RZWC 3RN9C 4WWNA 1YIWA 1WGRA 3NG0A 3OJ4B 1VRAB 2JXTA 5DPTA 1FFUA 2J7QB 2M17A 1UWXA 4P7IA 3RD2A 3NRZA 2AL3A 2K0PA 1TBEA 1C4CA 1QZEA 2KWVB 4P1BC 2XK5A 4F1SA 3HRDD 1RRBA 1E9MA 2DBYA 4XX5A 3ZGZA 3DBHB 1FIQA 5LXIB 3DHGC 2KLCA 4AOFA 1LFDA 2K9XA 1OFFA 3A9KA 2FE8A 3I5JC 3HM3A 4NQKE 3UGBB 1JMLA 3KWLA 2L76A 1UF0A 1WJ6A 1GC7A 3FILA 3CSTA 3LYYA 3T9LA 1WXQA 4PS3A 4IWQA 1EM7A 3ZDTA 3MC9A 2JUOA 3UIOB 2N7JA 4CYEA 4YSXB 1VR9A 2L00B 4HDOA 1V80A 2KANA 1TY0A 2WXOA 1WSPA 3AEFB 2WXFA 1DOXA 2Z0EB 1WZ0A 4C4VA 1K50A 2KQSA 3DCGA 1F2RC 1YJJA 4KV2A 4I6LB 1FXTB 2ZZPB 2MWSB 4JE3B 1NI2A 2JQRB 3RT3B 4YTNB 2MJEA 2G9HD 3CSFA 4F7ZA 2WXMA 1FO4A 2OJRA 1D5ZC 1V81A 3HK0A 1ZP0B 4NY0A 3ZNGC 2N7EA 3Q3JA 1GJZA 4O1NA 1UELA 1N6ZA 3RI7C 2WLBA 2C5LC 2R61A 4GSWA 4TQ1A 5BYQA 1VZ7A 1T0YA 2L52A 4HPPA 4A90A 3R66C 4RF0A 4J3OD 5CHWA 1AW7A 2CJOA 2W55A 2JX5A 2PE9A 1H4RA 2LGDA 5LNK1 3TIXA 1PGXA 1U4AA 4NJCA 1TYGB 1MPEA 2BYFA 2H89B 5CHFA 5G2NA 3SHQA 3DDCB 4DHZB 3GP7A 3ABVB 3IT4B 1HZ6A 3HVZA 3AEAB 5E6JA 1I7HA 4P16A 2K8BA 3WAMA 3FAHA 2KMCA 4FLHA 4DBGA 1E8YA 2BKRB 4W9GA 1C4AA 2WDTB 2WHIA 1G6JA 1TKYA 4OZCA 5DPRA 1R4MI 3H7SA 3QJZA 2WXGA 5G5GA 5MPOA 4A9AA 5GXGB 1FCCC 3IT6B 3W5VB 2RPQA 2L1AA 5G5HA 3PO0A 4WQOB 1MVKA 4KVGB 3SFEB 1WMHB 2DAFA 1ET6A 4EKUA 1E8XA 5DCNA 3AE9B 1V1PB 2WP9B 1SGHA 1T5XD 1TTNA 5BMGA 1T0RC 3KH0A 4MGIE 2V3NA 2IO0B 5FK9C 2MBQA 4A20A 3RMKC 3L13A 3NUHB 4S0RA 3BYTB 4P6VF 2V4IB 3LXFA 1ZGUB 3PZ8A 1NYQA 2Z0DB 5EE3A 4MT5A 1XLQA 4XYCA 1P7EA 4RGTA 3R7RA 2Y5PA 1JRUA 4ANWA 3U4EG 1UBQA 4RNAA 4WAAA 2CJNA 2W54A 4M00A 3M3JA 3W5UB 1WMHA 2L83A 4TQ0A 5HKHA 2N4FA 4IM3A 4I6NB 2CU1A 4LNNA 3RNCC 1JALA 3NVVA 1V1PA 1MHHE 3B9JA 1JWAD 4ACFA 4IWOA 4N58A 3Q3FA 4HLEA 2DYOA 2GLSA 5L95C 2LXCA 2WDVB 3H9DA 1I4XA 3QX1A 2ZVNA 3ZXVA 3DBHI 1VZ8A 1GTEA 3A4SC 3H8HA 4GXBA 1HTQA 3Q3MC 5J2RA 4N6EB 1WGKA 1ZUD2 4FJYA 4B95A 1E6EB 4M02A 4QAYA 1P0RA 2DHZA 4D2KA 1YX5B 4HPLB 1ZDXA 2D11A 1V5OA 2WU5B 2FIFA 4N59A 1L4ZB 1I42A 3DBSA 1QOGA 4M8NA 1SIJA 5C2TB 2INDC 4AUQC 1MI0A 2XEWA 3UF8A 3UINB 2BW2A 2LHDA 5C1ZA 2RGFA 2ICIA 1KJTA 1XCTL 2BPSA 3ML9A 4WURA 4RF1A 4JLCA 4YWGG 1GUAB 3M95A 1MJDA 3IHPC 4GB9A 1QLBB 1KM7A 3DWGC 4YL8A 1NYRA 1WRDB 3OG5A 3M63B 2PE6B 1S3SG 2LRWA 3VTWA 1WI0A 1TZ1A 1WM3A 2D5GA 1EUVB 1HQRD 2YEPF 2QCZA 3NOBA 4NAWA 2KN4A 3B2FA 3RCZA 2ON8A 3NVYA 5TSSA 2N9LA 2KWCA 3CF4A 3WIMA 3RNGC 1WGHA 1SE3A 2HTHA 2INNE 2LZ6A 2WXJA 2E6XA 1H7XA 3Q3OC 2FBWB 2AEHA 3RNAC 2BWES 2BS4B 1WXSA 4XDCA 2J53A 5EE9A 2FIDA 3VQIA 2N9XA 2RR9A 3NVWA 3BWUD 2WYQA 4II2B 4KGRA 1JW9D 1WE6A 3PTFC 3ZJTA 5D2MB 1ZXHA 1JQ4A 3MC0B 2W3RA 4DXFA 2WXQA 4GN1A 3AEEB 4W9HA 1KRHA 1LXDA 2VH1A 2PPHA 1IP9A 4OZBA 1WYGA 3PS6A 3AV8A 1WRIA 2QIEB 4AS1A 2KKCA 4HCNB 3DVGY 2L05A 4BBNF 5E6NA 1N5WA 3NS8A 3QWZB 4HRSA 4WWOA 2BT6A 4K3BA 2NBVB 1YOVB 2CHZA 1E7PB 3R2TA 2JYTA 2AQ2B 2TSSA 4GGQA 5KHQA 3W9CB 4W9IA 5IOIA 2KDBA 2LI5A 4HDQA 1UNSA 2QC8A 1YJIA 4LNOA 1V49A 2A5UA 1HEZE 3E56A 1CQVA 3RULA 2K8HA 2NPTB 5JHBA 3C8YA 1GPXA 2QSDA 4X57B 4ANXA 5AZGA 1KFYB 3BK2A 2KMAA 3AE5B 1F2RI 1E0ZA 4IUMB 3VUXA 3MJWA 1Q1OA 1RLFA 5HG2A 2GRIA 1CJEA 2AQ1B 1GNUA 1N60A 1M94A 2AQ3B 1RM6C 3A9JB 3N1XC 1C78A 1YQBA 4W9KA 1JWUD 2CS4A 3GE8C 2AWTA 3DWMA 3ONSA 2IO1B 2NS5A 2FCNA 2I38A 4N9F4 4NZLB 1YQ4B 1FFVA 3IAS1 4II3B 1UBIA 2IY1B 2WX0A 1WXVA 1NI3A 1LO5D 4K7SA 3PT2B 2IGDA 3KYCD 1MHXA 1XD3B 3KVFB 2BYVE 3DPDA 4GMVA 4RM9A 2BVCA 1TIFA 1FRDA 2KAJA 2EMTA 3A9KB 4IM0A 3ZNHB 5IA7A 3U30A 2NCNA 4AQ7A 2QEJC 1N63A 4HXDA 3PRPB 3N1YC 4BKSD 1XF5L 3I9V1 2GBJA 2DZJA 2BTEA 2X38A 1AARA 5FR6A 5KHOA 3ZRFA 1ZE3D 4B0MA 3NZUA 4ICUA 2MW5A 2KOXA 3VH3B 3MTNB 1Q0WB 3VTVA 1WIAA 4C4VB 4MM3A 3AN1A 2NR2A 2KQ7A 2LUMA 1L2NA 1IUEA 2KDFB 2OOBB 2LFIA 2CR5A 4WJPA 3TEWA 4PT5A 1P98A 2R2QA 2IGGA 4W9LA 5CHVC 1WJUA 1BXTA 2GBRA 1WGDA 2BB5A 4ZDVA 2BKFA 2GOWA 2L0FA 1V1OA 1AWDA 5T8IA 3RZFA 4J6IA 3PHWB 4NQLB 1WYWB 3L10B 4YXDB 1PGBA 2ZNVC 3ZLZA 5D3IB 1SSNA 1J0GA 2K3UA 3V3XA 4DHJD 4KZ0A 1FRRA 4FN2A 4GDKA 1SF0A 1SJED 4NNJB 4JL9A 3EA6A 4AP4C 2KACA 5GMVA 5AEKB 2INCC 2DLBA 1F1HA 1J19A 2E3TA 2N1WA 2W82A 1TKEA 5LXHA 1OTRB 2BS2B 3FC4A 2KZRA 3GZNB 2WXHA 1BUIC 3MP9A 2JU6X 3L0WB 2ASQA 2KXJA 3LB8C 2GB1A 1WH3A 1T6BX 4XC2A 3Q3NC 3PRMB 3AE7B 1EU4A 3N32A 3TL5A 2BGFA 3WA0A 1LQBA 2WU2B 2MA9B 1Y56A 1E10A 1B1ZA 1TJEA 1BMLC 3OWEB 1WFYA 3U2SC 4TV3A 4Q2JA 2MBBB 4BKGA 2KFKA 5JHAA 3ZTDA 3MHZA 2DENB 2B3AA 2V9HA 2JZ3B 1E8WA 3N9YC 2AYOB 4TUUA 3PPAA 2MP2A 2IYDB 3SU8X 1JROA 4YTPB 3PGEA 1XLNA 1EWCA 5I4DA 3ZNID 1KF6B 2WS3B 1JWSD 5AZHA 3L16A 3TBLD 4OVVA 4K7UA 5BMIA 1STEA 2HDEA 4B9KA 1LM8B 1PFDA 1GOZA 4C7YA 1FXAA 2ZNVB 4W9EA 4YSZB 3A4RA 1DGJA 3NZSA 3IXSA 3SD5A 3PHXB 3EGRA 3OLMD 3P4QB 4KKIA 3AE8B 4ZYSA 3CIRB 2Y5BB 2J4XA 2M0AA 2BQQA 4ASWC 1YN3A 3Q2AC 3KYDD 2ZJDA 3KUDB 2D07B 3BY4B 4G50A 3V05A 5BO4B 4LNIA 4RFBA 4BZAA 2BBCA 1WX7A 4PYZA 4A55A 2N0SB 4ZRPA 2LD9A 3GB1A 3QCAA 2G3QB 2KWDA 1HZ5A 3AEDB 4OHJA 3VRAB 2J0KA 2MBOA 3BVMA 3R7QA 5IAAC 4DQOC 3OAWA 4JGHB 3P42A 2YLMA 3BINA 1Y8RC 3S2AA 5H92C 4DDGD 2NTSA 4ZRQA 3EFCA 4ARIA 1TY2A 3RNBC 3EC8A 1M4VA 3H7PA 3EHVA 2NTTA 1FNWA 2DWQA 1AN8A 2M56B 2C9WB 2C7HA 4HCPB 4RH6A 4ZHOA 3ZRCA 4CQNA 2HTME 3UIPB 1ZW7A 4LJPB 1C77A 1ESFA 4M01A 2MJ3A 4LJOB 3QIJA 1ZDVA 1OQQA 2GBMA 3VR9B 1L7YA 2IJ0A 3A1QB 4HROA 1SE4A 4E71A 2IPKD 2MBEA 1K8RB 1SE9A 3H6NA 1DOIA 2RMMA 3ML8A 2WXLA 4C00A 4ZOHC 5HI1A 2HJ1A 3EECA 1L6UA 2JXXA 4LNKA 4MJSA 3AE1B 3V61A 2BWFA 5E6PA 2SAKA 1ISNA 4TKNA 3WAPA 4G11A 2LXAA 2K1FA 4EZLA 1C4PA 4NAWB 1IGDA 2WX1A 3B08A 2IO3B 5L83A 2M8SA 4CO7A 2LGXA 3Q8AA 3VR8B 3FKYA 4KDLB 1JWMD 2KX0A 3ENEA 3Q6BA 4GOCA 3NHEB 4G0NB 1WWTA 2KDIA 3D32A 2NVUI 3P63A 3J9CA 2KVZA 1IYFA 1UGJA 3Q8CA 4WJQA 1I4GA 2KDMA 2BF8B 3A1QA 1GB1A 1A5RA 3X0WA 5IP4D 4IOIE 4BVUC 2JPHA 2J0JA 1EU3A 2AL6A 2Z8LA 2KTRB 2D2QA 1QT9A 2KNBA 2LHEA 3V60A 2GI9A 3ETRA 4KX6B 3TEYA 3GZNI 4PS8A 4WQMA 3E9SA 2INPE 3PSEB 4DDID 3MJ5A 1L0XB 1N61A 3RNEC 2WXNA 4PS7A 2IGHA 2N1VA 1QILA 2IZVB 3EUB2 1NVID 2Y3AA 1H7WA 3KUCB 1QF6A 3ZJUA 2REXA 2NBWB 3CF6E 4ZHPA 3VFKA 4IM2A 3MHSD 3PZDA 4ICVA 2KC2A 2O6VA 3QK0A 1UZXB 3P4RB 4JWSC 2QDFA 4MDKE 3W1SA 1N5XA 2KN5A 2KTRA 1KH0A 4LDTB 3AE4B 2MSED 3URYA 2FCMA 4WWPA 3WAOA 5JH5C 4WH4A 2WNMA 4KKJA 4M8MA 1F0ZA 4IDIA 4W9CA 2ACZB 1WJNA 1FM0D 3TEXA 1EF1A 4RMAA 4MGZE 1NEKB 4BKTA 1V8CA 3EFUA 3BIID 2K25A 1KLGD 1BT0A 3I57A 3KQ4A 1GB4A 1I4PA 2PMVA 5IO9A 1SB3C 2L8JA 2WDQB 4FBJB 1ZXIA 1EF5A 2ONQA 5TR5A 2VZKB 4I6PA 2RDGA 1H8CA 2I1KA 1WX9A 1QOAA 2PVGC 3B1LX 1IPGA 1FNVA 5AUKA 1I4RA 3NY5A 2ZEQA 2V0GA 1WX8A 1E7UA 4FXCA 4DHZE 3V6CB 4XZ4A 1V2YA 1TS4A 2J42A 3AECB 2V1YA 2LWPA 1T0QC 1KOTA 1WF9A 4IWPA 2NBUA 4LDTD 2LUEA 2MH7A 3DQVA 3VH4B 4CHKA 2C7NB 2K22A 1YNTE 2PTLA 4OVUA 1T3QA 1E8ZA 2RDHA 4WAFA 5AZFA 3O65B 2MBHA 4KDIC 1R4NB 3ZXRA 3GOEA 4MEMA 4FULA 4C56C 1WY8A 4DWFA 3VUYA 3TMPB 3TSSA 4M0WA 1XEEA 2UWQA 1E90A 5E6OA 4MM3B 4K7WA 1AYFA 1E5WA 1JCKB 4HJGE 4XDDA 2DX5B 3ZO5B 2KK8A 2KJRA 1K53A 2W3SA 3MFGA 5BMHA 4B0EA 1V86A 2G4DB 3AULA 2K39A 1UUPA
chains in the Genus database with same CATH topology
4RNAA 1PYWD 4H2AA 3SR6A 3UI3A 2CJNA 2PLPA 2W54A 2IDYA 1T6BX 2XN9C 3W5UB 3AE7B 1EU4A 3KLSX 1KLUD 2L83A 1Q10A 3U7ZA 4TQ0A 4RGMA 1IBXB 2WU2B 1Y56A 4RCOA 1E10A 1B1ZA 1TJEA 3GS2A 1BMLC 3CWIA 4YT0B 3OWEB 1JALA 3NVVA 1V1PA 3U2SC 1MHHE 2DYMA 3B9JA 1JWAD 4R3DA 1IGCA 2JSVX 3KWVA 4N58A 4OVZA 1JWBD 1DYQA 4Q2JA 3BYYB 3Q8BA 3Q8FA 3RPFC 4C7ZA 3RFZB 2DYOA 3Q8EA 3BVZA 2WXIA 3MHZA 2WDVB 2ZW0A 4GDKB 1CK1A 1ZOYB 1I4XA 1QQRA 1ENFA 3N9YC 1FCLA 1XO3A 2SEBD 1UWMA 1VZ8A 1GTEA 2J52A 1P7FA 3H8HA 1L4DB 3TUOA 1DOYA 1SE2A 1ACCA 2N9KA 1FEHA 1JROA 4N6EB 1WGKA 4YTPB 1D5MC 1ZUD2 2AX5A 4ITKA 1XLNA 1L5PA 1E6EB 1EWCA 5JXVA 2PVOD 4WWMA 5I4DA 1XLOA 4D2KA 1KF6B 2WS3B 1ZDXA 1JWSD 5HFYA 3SFDB 2LMCA 2WU5B 4MACA 4GLSC 1J7BA 4N59A 1L4ZB 5D3DA 5BMIA 1ET9A 1IBXA 1STEA 1QOGA 1SIJA 5C2TB 1SJHD 2HDEA 1MI0A 1SEBD 1PFDA 2M19A 4C80A 2WDRB 2BW2A 1GOZA 2LHDA 4C7YA 1FXAA 2ICIA 4A6QA 2JWUA 4YSZB 2KMMA 1K51A 1XCTL 3AMZA 4WURA 1VZ6A 1DGJA 4RF1A 3IXSA 3EGRA 3P4QB 2BB6A 4KKIA 4YWGG 1TKGA 3AE8B 1ROEA 4REZA 3AEBB 4ZYSA 3AEGB 3CIRB 1TS3A 2J4XA 3BZDB 5EE1A 2M0AA 1OQRA 3T3OA 3SEBA 3VRBB 1YN3A 1D4BA 1QLBB 1N62A 1TS5A 3DWGC 5BYRA 5D7GA 1NYRA 3V05A 3HVDA 1QOFA 3L4PA 3AE6B 4RFBA 2BBCA 2PKOA 3AH7A 1VLBA 1C79A 3ZQ4A 1J7AA 2YEPB 4HEA1 4A55A 2I2YA 4YTMB 1GAQB 2MEKA 4LTUA 2N0SB 4ZRPA 2XNAC 3GB1A 2D5GA 1HQRD 2YEPF 1FXIA 2KN4A 4UDUC 3B2FA 2KWDA 1HZ5A 3WCQA 1PDXA 2ON8A 2H88B 3NVYA 5TSSA 3AEDB 1F77A 3VRAB 5C3JB 2N9LA 4OHJA 3BVMA 2VZKD 4RGOS 4GDLB 5EE0A 3CF4A 1HXYD 3Q69A 4DQOC 1SE3A 4US9A 2LGIA 2INNE 3P42A 2WXJA 2E6XA 4XE0A 5H92C 1H7XA 4HKQA 1FMAD 2NTSA 2FBWB 5FR3A 3B2GA 4ZRQA 1RFKA 4ARIA 1TY2A 3R8BA 1XXGA 3BK1A 2B76B 2BS4B 1M4VA 2NMQA 4XDCA 3AE2B 2J53A 5EE9A 4A8XC 3VQIA 3NVWA 2NTTA 1FNWA 2DWQA 3BWUD 1AN8A 2M56B 1YQ3B 4KGRA 4LK0M 4RH6A 4ZHOA 1NENB 1JW9D 4CQNA 2HTME 5HHDG 2EELA 3P4PB 1YN5A 3ZJTA 1C77A 1ESFA 1TZOA 2QJLA 2MJ3A 1JQ4A 1ZXHA 1ZDVA 1OQQA 3MC0B 3VR9B 2IJ0A 2W3RA 2WXQA 2OHFA 4HROA 4DXFA 1SE4A 3AEEB 4L2YA 2IPKD 1KRHA 3NS1A 1KTKA 4OZBA 1DOIA 2WXRA 3FILB 1WYGA 2RMMA 1B9RA 3AV8A 2WXPA 2WXLA 1RWSA 1WRIA 2QIEB 4AS1A 1PGAA 4ZOHC 2KQ4X 1J7CA 2QMTA 1HA5A 5HI1A 4US8A 1L6UA 2OEDA 2QILA 1CZPA 3AE1B 1N5WA 1VRAB 2JXTA 1FFUA 2SAKA 2BYTA 2MJDA 4HRSA 2EKIA 1UWXA 2BT6A 2L32A 3NRZA 2RPVA 1JRPA 1E7PB 3R2TA 2K0PA 2WXKA 5AUIA 1C4PA 1C4CA 1IGDA 2JYTA 4NAWB 2AQ2B 2TSSA 3W9CB 4EE2A 3HRDD 3Q8AA 1E9MA 3VR8B 2DBYA 1JWMD 1UNSA 3ZGZA 1YJIA 1HEZE 1GT8A 3E56A 1CQVA 1FIQA 1WWTA 3C8YA 1GPXA 2QSDA 3P63A 3J9CA 1UGJA 3Q8CA 1KFYB 2WQYB 2K9XA 1OFFA 3BK2A 1QOBA 1I4GA 3AE5B 1F2RI 2FE8A 2KDMA 1E0ZA 1GB1A 3AB5A 1JMLA 5HG2A 3KWLA 2GRIA 1CJEA 2AQ1B 1A70A 1GTHA 1N60A 2V3PA 3FILA 4KGSA 4IOIE 3LYYA 2AQ3B 1WXQA 1EU3A 1RM6C 2G1EA 1EM7A 1FNUA 1C78A 4KGTA 4XWWA 2Z8LA 1QT9A 2N7JA 2FUG1 1JWUD 1L0YB 4YSXB 1VR9A 4TMAB 2LHEA 1TY0A 2GI9A 2WXOA 3ETRA 3R2IA 1WSPA 3AEFB 2LEKA 2WXFA 4KX6B 3DWMA 3TEYA 1DOXA 4WQMA 3E9SA 1SXTA 2CU3A 2INPE 2BS3B 1K50A 3MJ5A 1F2RC 1YJJA 1L0XB 1N61A 1D6EC 2I38A 2WXNA 2JZPA 4NZLB 1EWYC 4JE3B 1YQ4B 2JQRB 2IGHA 4YTNB 1QILA 2MJEA 1FFVA 3IAS1 2G9HD 3EUB2 1XLPA 1NVID 2WXMA 2Q5WD 2Y3AA 1FO4A 1H7WA 3TEZA 1NI3A 1LO5D 1D5ZC 5H8YE 2IGDA 1RYJA 1QF6A 1ZP0B 3ZJUA 4ZHPA 4RGNA 1QKZA 1MHXA 4O1NA 1L0VB 4HKZE 3P4RB 4L23A 4JWSC 2WLBA 5FKAC 1FRDA 2KAJA 1I4HA 1TS2A 3P1MA 3W1SA 2R61A 1N5XA 1KH0A 3AE4B 3AM9A 4TSSA 4AQ7A 3IAM1 2QEJC 4TQ1A 5BYQA 1N63A 3URYA 1K52A 2LJIA 1VZ7A 2L52A 4WH4A 1XF5L 4A90A 1I4QA 2WNMA 4KKJA 1YN4A 3I9V1 1F0ZA 4IDIA 2ACZB 1FM0D 4RF0A 3TEXA 2BTEA 4J3OD 2X38A 1AW7A 1NEKB 2CJOA 2W55A 1V8CA 2JX5A 3ZYYX 1ZE3D 1PUTA 3BIID 4LLGM 4USAA 3NZ3A 4IKGA 4B0MA 1KLGD 5LNK1 2JYEA 3I57A 4DXGA 3KQ4A 2ZW1A 1XCQL 1PGXA 1GB4A 4NJCA 1TYGB 1MPEA 1I4PA 2H89B 2PMVA 1SB3C 2WDQB 1ZXIA 3AN1A 2ONQA 2VZKB 2LUMA 2RDGA 3GP7A 1IUEA 3ABVB 1QOAA 3IT4B 1HZ6A 2PVGC 2LFIA 3HVZA 1FNVA 3AEAB 1VJKA 1VDVA 5E6JA 1YMHE 3TEWA 1I7HA 3ZJVA 5AUKA 4P16A 1I4RA 4NAMA 4PT5A 3FAHA 2IGGA 4MH8A 5BYSA 4JPSA 3BVGA 1BXTA 4L1BA 2V0GA 2BB5A 1C4AA 1L6VA 4FXCA 1D5XC 1TKYA 1V1OA 4OZCA 1V97A 1AWDA 2WXGA 1ZPSA 5T8IA 5G5GA 1TS4A 5MPOA 4A9AA 2J42A 3AECB 2K5PA 5GXGB 1FCCC 3IT6B 4YSYB 3W5VB 2L1AA 3PZ7A 4ARCA 5G5HA 1C9FA 1FD6A 1R7SA 3PO0A 4YXDB 3U52E 1MVKA 1PGBA 1SBBB 3SFEB 1ET6A 4XWTA 5D3IB 1SSNA 2MH7A 2K3UA 3V3XA 3AE9B 1FRRA 2K22A 1YNTE 3NVZA 1V1PB 1SF0A 1SJED 2PTLA 2WP9B 4JWUC 4WIPA 1T3QA 1T5XD 5BMGA 2RDHA 4WAFA 3EA6A 2KACA 3W2DA 4JX1C 2DLBA 4C56C 2E3TA 2V3NA 2PW9A 2W82A 3TSSA 1TKEA 4M0WA 1XEEA 5FK9C 2BS2B 3NUHB 4MM3B 1AYFA 3FC4A 1JCKB 3BYTB 3HUIA 4HJGE 4P6VF 4XDDA 2WXHA 3T3NA 4OZAA 2V4IB 3LXFA 1BUIC 3AE3B 3MP9A 2JU6X 3PZ8A 1NYQA 2PIAA 5EE3A 4MT5A 2Y5CA 1K53A 1XLQA 2W3SA 3MFGA 3O13A 1C76A 1P7EA 4OW0A 5BMHA 4B0EA 3P4SB 3LB8C 4RGTA 2GB1A 2Y5PA 3U4EG 1UUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GAQ B;  1KFY B;  2WQY B;  2K9X A;  1OFF A;  2N0S B;  4LTU A;  3SR6 A;  2CJN A;  1QOB A;  2W54 A;  3AE5 B;  1TYG B;  1E0Z A;  3W5U B;  3AE7 B;  1FXI A;  2H89 B;  1SB3 C;  3AB5 A;  2WDQ B;  2L83 A;  3B2F A;  3KWL A;  3WCQ A;  1CJE A;  1PDX A;  2H88 B;  1ZXI A;  1A70 A;  1GTH A;  2WU2 B;  3AN1 A;  3AED B;  1N60 A;  3VRA B;  5C3J B;  3NVY A;  1E10 A;  1TJE A;  3CWI A;  4YT0 B;  1WXQ A;  1JAL A;  3NVV A;  3CF4 A;  5EE0 A;  1IUE A;  3ABV B;  1RM6 C;  1QOA A;  2G1E A;  2PVG C;  3HVZ A;  3B9J A;  1JWA D;  3AEA B;  1VJK A;  1VDV A;  4US9 A;  4N58 A;  1I7H A;  1QT9 A;  1JWB D;  5AUK A;  5H92 C;  1H7X A;  1FMA D;  2FBW B;  3FAH A;  4YSX B;  3B2G A;  3RPF C;  4C7Z A;  1RFK A;  3ETR A;  2B76 B;  2BS4 B;  2WDV B;  3AEF B;  2LEK A;  3AE2 B;  4KX6 B;  1L6V A;  3DWM A;  4FXC A;  5EE9 A;  1DOX A;  1ZOY B;  3NVW A;  4WQM A;  1TKY A;  1V97 A;  2CU3 A;  2BS3 B;  1AWD A;  2DWQ A;  1XO3 A;  1YJJ A;  5G5G A;  4A9A A;  2M56 B;  5MPO A;  1UWM A;  1GTE A;  1YQ3 B;  3AEC B;  2K5P A;  1N61 A;  4ZHO A;  5GXG B;  1NEN B;  4YSY B;  1JW9 D;  3W5V B;  1DOY A;  2HTM E;  1EWY C;  3P4P B;  1YQ4 B;  1JRO A;  2JQR B;  4N6E B;  1WGK A;  4YTN B;  4YTP B;  5G5H A;  1ZUD 2;  2MJE A;  1FFV A;  2QJL A;  2MJ3 A;  2AX5 A;  4ITK A;  1XLN A;  3EUB 2;  1OQQ A;  1L5P A;  1JQ4 A;  3VR9 B;  1NVI D;  1R7S A;  1XLP A;  2OHF A;  4YXD B;  1E6E B;  1H7W A;  2Q5W D;  1NI3 A;  3SFE B;  4HRO A;  1FO4 A;  3AEE B;  2PVO D;  4WWM A;  1KRH A;  2MH7 A;  1XLO A;  3NS1 A;  5H8Y E;  1KF6 B;  2WS3 B;  1RYJ A;  1QF6 A;  1DOI A;  1ZP0 B;  3SFD B;  3AE9 B;  2WU5 B;  1FRR A;  1WYG A;  3AV8 A;  1B9R A;  1RWS A;  1WRI A;  1J7B A;  2K22 A;  2QIE B;  4N59 A;  4ZOH C;  1J7C A;  4ZHP A;  3NVZ A;  1SF0 A;  2WP9 B;  4US8 A;  1QOG A;  1L0V B;  1SIJ A;  4JWU C;  5C2T B;  1L6U A;  1T3Q A;  1CZP A;  3AE1 B;  1N5W A;  1PFD A;  3P4R B;  2M19 A;  4C80 A;  2WDR B;  3PO0 A;  4JWS C;  1FFU A;  2WLB A;  1FRD A;  1FXA A;  2KAJ A;  2MJD A;  4HRS A;  2EKI A;  4JX1 C;  3P1M A;  4C7Y A;  2BT6 A;  4YSZ B;  2KMM A;  3NRZ A;  3AMZ A;  1JRP A;  1N5X A;  2E3T A;  2W3R A;  1E7P B;  1DGJ A;  1TKE A;  3AE4 B;  3AM9 A;  5AUI A;  3P4Q B;  1N63 A;  3AE8 B;  1ROE A;  1TKG A;  2BS2 B;  3AEB B;  3AEG B;  3CIR B;  1AYF A;  3FC4 A;  5EE1 A;  3W9C B;  2L52 A;  3HUI A;  3HRD D;  4P6V F;  1OQR A;  3VRB B;  1E9M A;  3VR8 B;  2DBY A;  3LXF A;  1QLB B;  1N62 A;  3DWG C;  4IDI A;  1F0Z A;  2ACZ B;  3AE3 B;  1NYR A;  1NYQ A;  1FM0 D;  2PIA A;  1QOF A;  1YJI A;  3L4P A;  3AE6 B;  5EE3 A;  2Y5C A;  1GT8 A;  1NEK B;  2CJO A;  2W55 A;  2PKO A;  1FIQ A;  1XLQ A;  1V8C A;  2JX5 A;  2W3S A;  3AH7 A;  3ZYY X;  1VLB A;  1PUT A;  1WWT A;  3BII D;  1J7A A;  4USA A;  1GPX A;  3P63 A;  3P4S B;  3LB8 C;  4YTM B; 
#chains in the Genus database with same CATH topology
 3B0A A;  4H2A A;  3UI3 A;  2PLP A;  1Q5W B;  2IDY A;  2XN9 C;  2EMS A;  1EO6 A;  3N30 A;  2BYE A;  3SDL C;  5D6J B;  3A33 B;  4R3D A;  1FPY A;  2JSV X;  3KWV A;  4OVZ A;  1DYQ A;  1TT5 B;  3RPF C;  3Q8E A;  1E7V A;  4WJN A;  2KD0 A;  3BVZ A;  2WXI A;  3AI5 A;  2DAJ A;  4GDK B;  4DK5 A;  4EFO A;  1CK1 A;  1ZOY B;  4HJK A;  1XO3 A;  2SEB D;  4BBN C;  1UWM A;  3C0R B;  5G55 A;  2J52 A;  1P7F A;  1L4D B;  3TUO A;  2V4L A;  1Z5S B;  5JZE B;  1C3T A;  1FEH A;  4MH0 E;  2MCN B;  3TCA A;  3VTU A;  2AX5 A;  2M1M A;  4ITK A;  2PVO D;  4WWM A;  5J17 A;  2RSU A;  1XLO A;  2JZZ A;  5C23 A;  3WAL A;  2FUH B;  2WGS A;  1J7B A;  1ET9 A;  4MSQ B;  4F8C B;  3DBR B;  5DPW A;  3HHM A;  3LJ3 A;  2M19 A;  4C80 A;  4MGY E;  1OEY J;  4P1C C;  3Q14 C;  3QQ8 B;  4A6Q A;  2JWU A;  1ZKH A;  2LRU A;  2KHW B;  2KMM A;  1GC6 A;  1WR1 A;  2EKE C;  2ZCB A;  2BB6 A;  1TKG A;  4REZ A;  1ROE A;  3AEB B;  2FCS A;  1TS3 A;  2V3S A;  1OQR A;  3VRB B;  1D4B A;  3L54 A;  1N62 A;  4FHJ A;  5BYR A;  5D7G A;  4RM8 A;  3HVD A;  3QAQ A;  2DZM A;  2VH2 A;  4HWI B;  2LGS A;  2N7D A;  3RNF C;  1VLB A;  1TGZ B;  3ZNZ B;  1J7A A;  1WXA A;  2KVR A;  2YEP B;  4HEA 1;  3H1U A;  4YTM B;  1GAQ B;  2JF5 A;  2KFK B;  4LTU A;  3IBE A;  4UDU C;  3WCQ A;  1PDX A;  2H88 B;  3QC8 B;  5C3J B;  2MP2 B;  1UD7 A;  3NJT A;  4RGO S;  4GDL B;  2IO2 B;  2N9P C;  3Q69 A;  3ZVV A;  1CMX B;  2D3A A;  4MEL A;  2LGI A;  4NPN A;  1FMA D;  5FR3 A;  3CMM B;  2WWZ A;  3R8B A;  1XQQ A;  1S1Q B;  3AU4 A;  3APC A;  3ZTC A;  3MC8 A;  1MFW A;  4BOS C;  3AE2 B;  3T8M A;  4A8X C;  2MRP A;  4AWJ A;  1OEY A;  4W9F A;  4HPM B;  4EZK A;  4IG7 B;  2K8C A;  1KLV A;  4BAX A;  3PRZ A;  5HHD G;  2EEL A;  2D3C A;  3P4P B;  2I1J A;  2N9E B;  3DHI C;  5CX3 A;  1TZO A;  2QJL A;  3ECI A;  4K3C A;  3NS1 A;  4LNF A;  2KFJ A;  2VRR B;  2WXR A;  2ZVO A;  1PGA A;  2KQ4 X;  1J7C A;  2L3Z A;  3VDZ A;  2LGY A;  1WR6 E;  4MGK E;  2OED A;  2QIL A;  1CZP A;  3DVN V;  1V5T A;  2KDE B;  4GDL A;  2BYT A;  2CKH B;  2MJD A;  1MG8 A;  2EKI A;  4A3O A;  2L32 A;  1X1M A;  2RPV A;  1JRP A;  2ZCC A;  2HJ8 A;  3L08 A;  3AU5 A;  2WXK A;  3I3T B;  5AUI A;  2DZI A;  3R3M A;  2RD0 A;  4ZRJ A;  4EE2 A;  3IFW B;  3GE3 C;  1YJ1 A;  1GT8 A;  4FAD A;  2X8X X;  2UU7 A;  2WQY B;  1QOB A;  3RYT A;  1UGM A;  3H7P B;  3AB5 A;  1WZ3 A;  3ZW3 A;  1A70 A;  1GTH A;  2V3P A;  2DYB A;  4KGS A;  5D94 A;  4ZRK A;  2HE7 A;  2G1E A;  1R4N I;  1FNU A;  2C7M B;  4KGT A;  4XWW A;  3V62 A;  4MSM B;  2FUG 1;  1L0Y B;  2MX2 A;  4TMA B;  3W1S C;  3R2I A;  2LEK A;  3DVG X;  3APD A;  1SXT A;  1LGR A;  3PRE A;  2CU3 A;  2JWZ A;  3DBL B;  2BS3 B;  1NDD A;  4ZYN A;  4MJS B;  3ZKJ C;  1D6E C;  1C1Y B;  3P2B A;  2JZP A;  1EWY C;  1YD8 U;  4GU2 A;  1XLP A;  2Q5W D;  3TEZ A;  1P1A A;  2XBB C;  2J0M A;  2LAS A;  2GMI C;  5H8Y E;  2D10 A;  2M4N A;  1RYJ A;  4G3X B;  3VUW A;  4RGN A;  1QKZ A;  4AJW A;  1L0V B;  2FCQ A;  2LVP A;  4HKZ E;  2OJW A;  3APF A;  1WE7 A;  4L23 A;  5FKA C;  4NJ6 A;  1I4H A;  1TS2 A;  3P1M A;  3U8Z A;  1RFA A;  4BOZ B;  4GIV A;  3AM9 A;  4TSS A;  3VAW A;  4EUT A;  3IAM 1;  2IBI B;  1J8C A;  1K52 A;  2LJI A;  3WAN A;  2MLB A;  3QA8 A;  2O2V B;  1I4Q A;  2QHO A;  1YN4 A;  2MHJ A;  2KJ6 A;  2KYW A;  3OJ3 A;  4EEW A;  4PK1 A;  1WXM A;  2R2O A;  1PQS A;  3ZYY X;  1PUT A;  4LLG M;  4USA A;  2D3B A;  3NZ3 A;  2YVC A;  4IKG A;  1YX6 B;  2JYE A;  4DXG A;  2ZW1 A;  1XCQ L;  2JRI B;  1D3Z A;  3DBR I;  2G45 B;  2PJH A;  2FAZ A;  3ZUN A;  2JRH A;  3U7D A;  4BFR A;  3PLV A;  2LJ5 A;  1VJK A;  1VDV A;  1YMH E;  3QAR A;  3ZJV A;  4NAM A;  2KC1 A;  4MH8 A;  3ZDM C;  5BYS A;  4JPS A;  3BVG A;  3JVZ X;  4L1B A;  1UH6 A;  1WJ4 A;  2KT7 A;  2PEA A;  1L6V A;  3DOW A;  1D5X C;  5EDS A;  3LDZ E;  1V97 A;  3N1Z C;  4W9J A;  5CTR C;  1ZPS A;  2O6V B;  2O2V A;  1HTO A;  2K5P A;  4YSY B;  1F9J A;  3PZ7 A;  4ARC A;  2D3G A;  1C9F A;  1FD6 A;  1R7S A;  1P9D U;  3U52 E;  2LVO A;  1SBB B;  4XWT A;  4ANU A;  4JIO U;  4WJO A;  3NVZ A;  3UQB A;  1OGW A;  4JWU C;  4WIP A;  4XGA B;  3PVL A;  2CHX A;  4KSK C;  4PYU A;  5IKC M;  3TJP A;  3HIZ A;  2W9N A;  4HK2 A;  2FNJ B;  4JX1 C;  4S17 A;  3W2D A;  3IVF A;  4JQW C;  3HM6 X;  2PW9 A;  2GBK A;  4FHK A;  3V6E B;  2JY6 A;  3HUI A;  4DXA B;  3T3N A;  4OZA A;  4IW0 A;  3C19 A;  3AE3 B;  3QHT A;  2PIA A;  1WGY A;  4KIK B;  2Y5C A;  3KW5 B;  3O13 A;  1C76 A;  4OW0 A;  3P4S B;  4B6W A;  1PYW D;  3SR6 A;  4E3C A;  2M0X A;  1WGG A;  2K6D B;  5IN7 A;  1NBF C;  1F52 A;  3KLS X;  1KLU D;  1Q10 A;  3U7Z A;  3UQA A;  4RGM A;  1IBX B;  4ZRI A;  4FA6 A;  4RCO A;  3GS2 A;  1WM2 A;  4YT0 B;  2O6V D;  3CWI A;  2KTF A;  2RDB C;  1MG4 A;  2DYM A;  1IGC A;  4FJZ A;  1JWB D;  4HVB A;  3BYY B;  3Q8B A;  4W9D A;  3Q8F A;  4C7Z A;  3RFZ B;  3L17 A;  1P3Q U;  2UYZ B;  2ZW0 A;  1V6E A;  1T0S C;  1QQR A;  1ENF A;  3N3K B;  1FCL A;  4A3P A;  4NJ7 A;  2A4Z A;  2KX3 A;  2L0T A;  2KO3 A;  1DOY A;  1SE2 A;  1ACC A;  2N9K A;  4IC7 B;  4KIK A;  1D5M C;  3PV1 A;  1L5P A;  4M0W B;  5JXV A;  4LCD E;  4EOY A;  4FJV B;  5HFY A;  3SFD B;  4ANV A;  2LMC A;  4MAC A;  2CHW A;  2Z59 B;  4GLS C;  1SIF A;  5D3D A;  3IG3 A;  1IBX A;  2K6Q A;  1SJH D;  1SEB D;  2JT4 B;  2WDR B;  2JVC A;  3RUI B;  2DNF A;  3DVN U;  3ALB A;  1K51 A;  3AMZ A;  1VZ6 A;  3M62 B;  1GG3 A;  2KLG A;  2ZPY A;  2G4S A;  3AEG B;  3DBL I;  3BZD B;  5EE1 A;  2HD5 B;  3JSV B;  3VXW A;  4KSL C;  3T3O A;  3SEB A;  2GBN A;  1R4M B;  1TS5 A;  1QOF A;  3L4P A;  3VHT C;  3AE6 B;  2PKO A;  3AH7 A;  2MQJ A;  1C79 A;  3ZQ4 A;  1I35 A;  3AXC A;  3K9P B;  2ZPN A;  3X23 A;  2I2Y A;  2MEK A;  1OQY A;  3N20 C;  2XNA C;  3PLU A;  1Z2M A;  3KUZ A;  1FXI A;  2KJH B;  1F77 A;  2VZK D;  3ZIM A;  5EE0 A;  3JW0 X;  5LLI A;  4KZC A;  1HXY D;  4US9 A;  2NPT A;  4AJY B;  4XE0 A;  4URK A;  2DZK A;  4HKQ A;  3B2G A;  2LVQ A;  1RFK A;  1VD2 A;  1XXG A;  3BK1 A;  2B76 B;  2L7R A;  2XK5 B;  2NMQ A;  2KWU B;  4EZJ A;  4K1R B;  4BKS A;  3JSV A;  4K81 A;  1XT9 B;  1YQ3 B;  3JYU A;  4LK0 M;  1NEN B;  1V9J A;  1YN5 A;  1VCB A;  3A9J A;  5DPS A;  3DHH C;  3VVW B;  2OHF A;  3W1Y A;  4L2Y A;  4E74 A;  4DHJ B;  1KTK A;  3I63 C;  3FIL B;  1B9R A;  5J18 A;  2WXP A;  1HE8 A;  1RWS A;  2IY0 B;  2QMT A;  1RAX A;  1HA5 A;  2C60 A;  3K9O B;  4US8 A;  3RZW C;  3RN9 C;  4WWN A;  1YIW A;  1WGR A;  3NG0 A;  3OJ4 B;  1VRA B;  2JXT A;  5DPT A;  1FFU A;  2J7Q B;  2M17 A;  1UWX A;  4P7I A;  3RD2 A;  3NRZ A;  2AL3 A;  2K0P A;  1TBE A;  1C4C A;  1QZE A;  2KWV B;  4P1B C;  2XK5 A;  4F1S A;  3HRD D;  1RRB A;  1E9M A;  2DBY A;  4XX5 A;  3ZGZ A;  3DBH B;  1FIQ A;  5LXI B;  3DHG C;  2KLC A;  4AOF A;  1LFD A;  2K9X A;  1OFF A;  3A9K A;  2FE8 A;  3I5J C;  3HM3 A;  4NQK E;  3UGB B;  1JML A;  3KWL A;  2L76 A;  1UF0 A;  1WJ6 A;  1GC7 A;  3FIL A;  3CST A;  3LYY A;  3T9L A;  1WXQ A;  4PS3 A;  4IWQ A;  1EM7 A;  3ZDT A;  3MC9 A;  2JUO A;  3UIO B;  2N7J A;  4CYE A;  4YSX B;  1VR9 A;  2L00 B;  4HDO A;  1V80 A;  2KAN A;  1TY0 A;  2WXO A;  1WSP A;  3AEF B;  2WXF A;  1DOX A;  2Z0E B;  1WZ0 A;  4C4V A;  1K50 A;  2KQS A;  3DCG A;  1F2R C;  1YJJ A;  4KV2 A;  4I6L B;  1FXT B;  2ZZP B;  2MWS B;  4JE3 B;  1NI2 A;  2JQR B;  3RT3 B;  4YTN B;  2MJE A;  2G9H D;  3CSF A;  4F7Z A;  2WXM A;  1FO4 A;  2OJR A;  1D5Z C;  1V81 A;  3HK0 A;  1ZP0 B;  4NY0 A;  3ZNG C;  2N7E A;  3Q3J A;  1GJZ A;  4O1N A;  1UEL A;  1N6Z A;  3RI7 C;  2WLB A;  2C5L C;  2R61 A;  4GSW A;  4TQ1 A;  5BYQ A;  1VZ7 A;  1T0Y A;  2L52 A;  4HPP A;  4A90 A;  3R66 C;  4RF0 A;  4J3O D;  5CHW A;  1AW7 A;  2CJO A;  2W55 A;  2JX5 A;  2PE9 A;  1H4R A;  2LGD A;  5LNK 1;  3TIX A;  1PGX A;  1U4A A;  4NJC A;  1TYG B;  1MPE A;  2BYF A;  2H89 B;  5CHF A;  5G2N A;  3SHQ A;  3DDC B;  4DHZ B;  3GP7 A;  3ABV B;  3IT4 B;  1HZ6 A;  3HVZ A;  3AEA B;  5E6J A;  1I7H A;  4P16 A;  2K8B A;  3WAM A;  3FAH A;  2KMC A;  4FLH A;  4DBG A;  1E8Y A;  2BKR B;  4W9G A;  1C4A A;  2WDT B;  2WHI A;  1G6J A;  1TKY A;  4OZC A;  5DPR A;  1R4M I;  3H7S A;  3QJZ A;  2WXG A;  5G5G A;  5MPO A;  4A9A A;  5GXG B;  1FCC C;  3IT6 B;  3W5V B;  2RPQ A;  2L1A A;  5G5H A;  3PO0 A;  4WQO B;  1MVK A;  4KVG B;  3SFE B;  1WMH B;  2DAF A;  1ET6 A;  4EKU A;  1E8X A;  5DCN A;  3AE9 B;  1V1P B;  2WP9 B;  1SGH A;  1T5X D;  1TTN A;  5BMG A;  1T0R C;  3KH0 A;  4MGI E;  2V3N A;  2IO0 B;  5FK9 C;  2MBQ A;  4A20 A;  3RMK C;  3L13 A;  3NUH B;  4S0R A;  3BYT B;  4P6V F;  2V4I B;  3LXF A;  1ZGU B;  3PZ8 A;  1NYQ A;  2Z0D B;  5EE3 A;  4MT5 A;  1XLQ A;  4XYC A;  1P7E A;  4RGT A;  3R7R A;  2Y5P A;  1JRU A;  4ANW A;  3U4E G;  1UBQ A;  4RNA A;  4WAA A;  2CJN A;  2W54 A;  4M00 A;  3M3J A;  3W5U B;  1WMH A;  2L83 A;  4TQ0 A;  5HKH A;  2N4F A;  4IM3 A;  4I6N B;  2CU1 A;  4LNN A;  3RNC C;  1JAL A;  3NVV A;  1V1P A;  1MHH E;  3B9J A;  1JWA D;  4ACF A;  4IWO A;  4N58 A;  3Q3F A;  4HLE A;  2DYO A;  2GLS A;  5L95 C;  2LXC A;  2WDV B;  3H9D A;  1I4X A;  3QX1 A;  2ZVN A;  3ZXV A;  3DBH I;  1VZ8 A;  1GTE A;  3A4S C;  3H8H A;  4GXB A;  1HTQ A;  3Q3M C;  5J2R A;  4N6E B;  1WGK A;  1ZUD 2;  4FJY A;  4B95 A;  1E6E B;  4M02 A;  4QAY A;  1P0R A;  2DHZ A;  4D2K A;  1YX5 B;  4HPL B;  1ZDX A;  2D11 A;  1V5O A;  2WU5 B;  2FIF A;  4N59 A;  1L4Z B;  1I42 A;  3DBS A;  1QOG A;  4M8N A;  1SIJ A;  5C2T B;  2IND C;  4AUQ C;  1MI0 A;  2XEW A;  3UF8 A;  3UIN B;  2BW2 A;  2LHD A;  5C1Z A;  2RGF A;  2ICI A;  1KJT A;  1XCT L;  2BPS A;  3ML9 A;  4WUR A;  4RF1 A;  4JLC A;  4YWG G;  1GUA B;  3M95 A;  1MJD A;  3IHP C;  4GB9 A;  1QLB B;  1KM7 A;  3DWG C;  4YL8 A;  1NYR A;  1WRD B;  3OG5 A;  3M63 B;  2PE6 B;  1S3S G;  2LRW A;  3VTW A;  1WI0 A;  1TZ1 A;  1WM3 A;  2D5G A;  1EUV B;  1HQR D;  2YEP F;  2QCZ A;  3NOB A;  4NAW A;  2KN4 A;  3B2F A;  3RCZ A;  2ON8 A;  3NVY A;  5TSS A;  2N9L A;  2KWC A;  3CF4 A;  3WIM A;  3RNG C;  1WGH A;  1SE3 A;  2HTH A;  2INN E;  2LZ6 A;  2WXJ A;  2E6X A;  1H7X A;  3Q3O C;  2FBW B;  2AEH A;  3RNA C;  2BWE S;  2BS4 B;  1WXS A;  4XDC A;  2J53 A;  5EE9 A;  2FID A;  3VQI A;  2N9X A;  2RR9 A;  3NVW A;  3BWU D;  2WYQ A;  4II2 B;  4KGR A;  1JW9 D;  1WE6 A;  3PTF C;  3ZJT A;  5D2M B;  1ZXH A;  1JQ4 A;  3MC0 B;  2W3R A;  4DXF A;  2WXQ A;  4GN1 A;  3AEE B;  4W9H A;  1KRH A;  1LXD A;  2VH1 A;  2PPH A;  1IP9 A;  4OZB A;  1WYG A;  3PS6 A;  3AV8 A;  1WRI A;  2QIE B;  4AS1 A;  2KKC A;  4HCN B;  3DVG Y;  2L05 A;  4BBN F;  5E6N A;  1N5W A;  3NS8 A;  3QWZ B;  4HRS A;  4WWO A;  2BT6 A;  4K3B A;  2NBV B;  1YOV B;  2CHZ A;  1E7P B;  3R2T A;  2JYT A;  2AQ2 B;  2TSS A;  4GGQ A;  5KHQ A;  3W9C B;  4W9I A;  5IOI A;  2KDB A;  2LI5 A;  4HDQ A;  1UNS A;  2QC8 A;  1YJI A;  4LNO A;  1V49 A;  2A5U A;  1HEZ E;  3E56 A;  1CQV A;  3RUL A;  2K8H A;  2NPT B;  5JHB A;  3C8Y A;  1GPX A;  2QSD A;  4X57 B;  4ANX A;  5AZG A;  1KFY B;  3BK2 A;  2KMA A;  3AE5 B;  1F2R I;  1E0Z A;  4IUM B;  3VUX A;  3MJW A;  1Q1O A;  1RLF A;  5HG2 A;  2GRI A;  1CJE A;  2AQ1 B;  1GNU A;  1N60 A;  1M94 A;  2AQ3 B;  1RM6 C;  3A9J B;  3N1X C;  1C78 A;  1YQB A;  4W9K A;  1JWU D;  2CS4 A;  3GE8 C;  2AWT A;  3DWM A;  3ONS A;  2IO1 B;  2NS5 A;  2FCN A;  2I38 A;  4N9F 4;  4NZL B;  1YQ4 B;  1FFV A;  3IAS 1;  4II3 B;  1UBI A;  2IY1 B;  2WX0 A;  1WXV A;  1NI3 A;  1LO5 D;  4K7S A;  3PT2 B;  2IGD A;  3KYC D;  1MHX A;  1XD3 B;  3KVF B;  2BYV E;  3DPD A;  4GMV A;  4RM9 A;  2BVC A;  1TIF A;  1FRD A;  2KAJ A;  2EMT A;  3A9K B;  4IM0 A;  3ZNH B;  5IA7 A;  3U30 A;  2NCN A;  4AQ7 A;  2QEJ C;  1N63 A;  4HXD A;  3PRP B;  3N1Y C;  4BKS D;  1XF5 L;  3I9V 1;  2GBJ A;  2DZJ A;  2BTE A;  2X38 A;  1AAR A;  5FR6 A;  5KHO A;  3ZRF A;  1ZE3 D;  4B0M A;  3NZU A;  4ICU A;  2MW5 A;  2KOX A;  3VH3 B;  3MTN B;  1Q0W B;  3VTV A;  1WIA A;  4C4V B;  4MM3 A;  3AN1 A;  2NR2 A;  2KQ7 A;  2LUM A;  1L2N A;  1IUE A;  2KDF B;  2OOB B;  2LFI A;  2CR5 A;  4WJP A;  3TEW A;  4PT5 A;  1P98 A;  2R2Q A;  2IGG A;  4W9L A;  5CHV C;  1WJU A;  1BXT A;  2GBR A;  1WGD A;  2BB5 A;  4ZDV A;  2BKF A;  2GOW A;  2L0F A;  1V1O A;  1AWD A;  5T8I A;  3RZF A;  4J6I A;  3PHW B;  4NQL B;  1WYW B;  3L10 B;  4YXD B;  1PGB A;  2ZNV C;  3ZLZ A;  5D3I B;  1SSN A;  1J0G A;  2K3U A;  3V3X A;  4DHJ D;  4KZ0 A;  1FRR A;  4FN2 A;  4GDK A;  1SF0 A;  1SJE D;  4NNJ B;  4JL9 A;  3EA6 A;  4AP4 C;  2KAC A;  5GMV A;  5AEK B;  2INC C;  2DLB A;  1F1H A;  1J19 A;  2E3T A;  2N1W A;  2W82 A;  1TKE A;  5LXH A;  1OTR B;  2BS2 B;  3FC4 A;  2KZR A;  3GZN B;  2WXH A;  1BUI C;  3MP9 A;  2JU6 X;  3L0W B;  2ASQ A;  2KXJ A;  3LB8 C;  2GB1 A;  1WH3 A;  1T6B X;  4XC2 A;  3Q3N C;  3PRM B;  3AE7 B;  1EU4 A;  3N32 A;  3TL5 A;  2BGF A;  3WA0 A;  1LQB A;  2WU2 B;  2MA9 B;  1Y56 A;  1E10 A;  1B1Z A;  1TJE A;  1BML C;  3OWE B;  1WFY A;  3U2S C;  4TV3 A;  4Q2J A;  2MBB B;  4BKG A;  2KFK A;  5JHA A;  3ZTD A;  3MHZ A;  2DEN B;  2B3A A;  2V9H A;  2JZ3 B;  1E8W A;  3N9Y C;  2AYO B;  4TUU A;  3PPA A;  2MP2 A;  2IYD B;  3SU8 X;  1JRO A;  4YTP B;  3PGE A;  1XLN A;  1EWC A;  5I4D A;  3ZNI D;  1KF6 B;  2WS3 B;  1JWS D;  5AZH A;  3L16 A;  3TBL D;  4OVV A;  4K7U A;  5BMI A;  1STE A;  2HDE A;  4B9K A;  1LM8 B;  1PFD A;  1GOZ A;  4C7Y A;  1FXA A;  2ZNV B;  4W9E A;  4YSZ B;  3A4R A;  1DGJ A;  3NZS A;  3IXS A;  3SD5 A;  3PHX B;  3EGR A;  3OLM D;  3P4Q B;  4KKI A;  3AE8 B;  4ZYS A;  3CIR B;  2Y5B B;  2J4X A;  2M0A A;  2BQQ A;  4ASW C;  1YN3 A;  3Q2A C;  3KYD D;  2ZJD A;  3KUD B;  2D07 B;  3BY4 B;  4G50 A;  3V05 A;  5BO4 B;  4LNI A;  4RFB A;  4BZA A;  2BBC A;  1WX7 A;  4PYZ A;  4A55 A;  2N0S B;  4ZRP A;  2LD9 A;  3GB1 A;  3QCA A;  2G3Q B;  2KWD A;  1HZ5 A;  3AED B;  4OHJ A;  3VRA B;  2J0K A;  2MBO A;  3BVM A;  3R7Q A;  5IAA C;  4DQO C;  3OAW A;  4JGH B;  3P42 A;  2YLM A;  3BIN A;  1Y8R C;  3S2A A;  5H92 C;  4DDG D;  2NTS A;  4ZRQ A;  3EFC A;  4ARI A;  1TY2 A;  3RNB C;  3EC8 A;  1M4V A;  3H7P A;  3EHV A;  2NTT A;  1FNW A;  2DWQ A;  1AN8 A;  2M56 B;  2C9W B;  2C7H A;  4HCP B;  4RH6 A;  4ZHO A;  3ZRC A;  4CQN A;  2HTM E;  3UIP B;  1ZW7 A;  4LJP B;  1C77 A;  1ESF A;  4M01 A;  2MJ3 A;  4LJO B;  3QIJ A;  1ZDV A;  1OQQ A;  2GBM A;  3VR9 B;  1L7Y A;  2IJ0 A;  3A1Q B;  4HRO A;  1SE4 A;  4E71 A;  2IPK D;  2MBE A;  1K8R B;  1SE9 A;  3H6N A;  1DOI A;  2RMM A;  3ML8 A;  2WXL A;  4C00 A;  4ZOH C;  5HI1 A;  2HJ1 A;  3EEC A;  1L6U A;  2JXX A;  4LNK A;  4MJS A;  3AE1 B;  3V61 A;  2BWF A;  5E6P A;  2SAK A;  1ISN A;  4TKN A;  3WAP A;  4G11 A;  2LXA A;  2K1F A;  4EZL A;  1C4P A;  4NAW B;  1IGD A;  2WX1 A;  3B08 A;  2IO3 B;  5L83 A;  2M8S A;  4CO7 A;  2LGX A;  3Q8A A;  3VR8 B;  3FKY A;  4KDL B;  1JWM D;  2KX0 A;  3ENE A;  3Q6B A;  4GOC A;  3NHE B;  4G0N B;  1WWT A;  2KDI A;  3D32 A;  2NVU I;  3P63 A;  3J9C A;  2KVZ A;  1IYF A;  1UGJ A;  3Q8C A;  4WJQ A;  1I4G A;  2KDM A;  2BF8 B;  3A1Q A;  1GB1 A;  1A5R A;  3X0W A;  5IP4 D;  4IOI E;  4BVU C;  2JPH A;  2J0J A;  1EU3 A;  2AL6 A;  2Z8L A;  2KTR B;  2D2Q A;  1QT9 A;  2KNB A;  2LHE A;  3V60 A;  2GI9 A;  3ETR A;  4KX6 B;  3TEY A;  3GZN I;  4PS8 A;  4WQM A;  3E9S A;  2INP E;  3PSE B;  4DDI D;  3MJ5 A;  1L0X B;  1N61 A;  3RNE C;  2WXN A;  4PS7 A;  2IGH A;  2N1V A;  1QIL A;  2IZV B;  3EUB 2;  1NVI D;  2Y3A A;  1H7W A;  3KUC B;  1QF6 A;  3ZJU A;  2REX A;  2NBW B;  3CF6 E;  4ZHP A;  3VFK A;  4IM2 A;  3MHS D;  3PZD A;  4ICV A;  2KC2 A;  2O6V A;  3QK0 A;  1UZX B;  3P4R B;  4JWS C;  2QDF A;  4MDK E;  3W1S A;  1N5X A;  2KN5 A;  2KTR A;  1KH0 A;  4LDT B;  3AE4 B;  2MSE D;  3URY A;  2FCM A;  4WWP A;  3WAO A;  5JH5 C;  4WH4 A;  2WNM A;  4KKJ A;  4M8M A;  1F0Z A;  4IDI A;  4W9C A;  2ACZ B;  1WJN A;  1FM0 D;  3TEX A;  1EF1 A;  4RMA A;  4MGZ E;  1NEK B;  4BKT A;  1V8C A;  3EFU A;  3BII D;  2K25 A;  1KLG D;  1BT0 A;  3I57 A;  3KQ4 A;  1GB4 A;  1I4P A;  2PMV A;  5IO9 A;  1SB3 C;  2L8J A;  2WDQ B;  4FBJ B;  1ZXI A;  1EF5 A;  2ONQ A;  5TR5 A;  2VZK B;  4I6P A;  2RDG A;  1H8C A;  2I1K A;  1WX9 A;  1QOA A;  2PVG C;  3B1L X;  1IPG A;  1FNV A;  5AUK A;  1I4R A;  3NY5 A;  2ZEQ A;  2V0G A;  1WX8 A;  1E7U A;  4FXC A;  4DHZ E;  3V6C B;  4XZ4 A;  1V2Y A;  1TS4 A;  2J42 A;  3AEC B;  2V1Y A;  2LWP A;  1T0Q C;  1KOT A;  1WF9 A;  4IWP A;  2NBU A;  4LDT D;  2LUE A;  2MH7 A;  3DQV A;  3VH4 B;  4CHK A;  2C7N B;  2K22 A;  1YNT E;  2PTL A;  4OVU A;  1T3Q A;  1E8Z A;  2RDH A;  4WAF A;  5AZF A;  3O65 B;  2MBH A;  4KDI C;  1R4N B;  3ZXR A;  3GOE A;  4MEM A;  4FUL A;  4C56 C;  1WY8 A;  4DWF A;  3VUY A;  3TMP B;  3TSS A;  4M0W A;  1XEE A;  2UWQ A;  1E90 A;  5E6O A;  4MM3 B;  4K7W A;  1AYF A;  1E5W A;  1JCK B;  4HJG E;  4XDD A;  2DX5 B;  3ZO5 B;  2KK8 A;  2KJR A;  1K53 A;  2W3S A;  3MFG A;  5BMH A;  4B0E A;  1V86 A;  2G4D B;  3AUL A;  2K39 A;  1UUP A; 
#chains in the Genus database with same CATH homology
 4RNA A;  1PYW D;  4H2A A;  3SR6 A;  3UI3 A;  2CJN A;  2PLP A;  2W54 A;  2IDY A;  1T6B X;  2XN9 C;  3W5U B;  3AE7 B;  1EU4 A;  3KLS X;  1KLU D;  2L83 A;  1Q10 A;  3U7Z A;  4TQ0 A;  4RGM A;  1IBX B;  2WU2 B;  1Y56 A;  4RCO A;  1E10 A;  1B1Z A;  1TJE A;  3GS2 A;  1BML C;  3CWI A;  4YT0 B;  3OWE B;  1JAL A;  3NVV A;  1V1P A;  3U2S C;  1MHH E;  2DYM A;  3B9J A;  1JWA D;  4R3D A;  1IGC A;  2JSV X;  3KWV A;  4N58 A;  4OVZ A;  1JWB D;  1DYQ A;  4Q2J A;  3BYY B;  3Q8B A;  3Q8F A;  3RPF C;  4C7Z A;  3RFZ B;  2DYO A;  3Q8E A;  3BVZ A;  2WXI A;  3MHZ A;  2WDV B;  2ZW0 A;  4GDK B;  1CK1 A;  1ZOY B;  1I4X A;  1QQR A;  1ENF A;  3N9Y C;  1FCL A;  1XO3 A;  2SEB D;  1UWM A;  1VZ8 A;  1GTE A;  2J52 A;  1P7F A;  3H8H A;  1L4D B;  3TUO A;  1DOY A;  1SE2 A;  1ACC A;  2N9K A;  1FEH A;  1JRO A;  4N6E B;  1WGK A;  4YTP B;  1D5M C;  1ZUD 2;  2AX5 A;  4ITK A;  1XLN A;  1L5P A;  1E6E B;  1EWC A;  5JXV A;  2PVO D;  4WWM A;  5I4D A;  1XLO A;  4D2K A;  1KF6 B;  2WS3 B;  1ZDX A;  1JWS D;  5HFY A;  3SFD B;  2LMC A;  2WU5 B;  4MAC A;  4GLS C;  1J7B A;  4N59 A;  1L4Z B;  5D3D A;  5BMI A;  1ET9 A;  1IBX A;  1STE A;  1QOG A;  1SIJ A;  5C2T B;  1SJH D;  2HDE A;  1MI0 A;  1SEB D;  1PFD A;  2M19 A;  4C80 A;  2WDR B;  2BW2 A;  1GOZ A;  2LHD A;  4C7Y A;  1FXA A;  2ICI A;  4A6Q A;  2JWU A;  4YSZ B;  2KMM A;  1K51 A;  1XCT L;  3AMZ A;  4WUR A;  1VZ6 A;  1DGJ A;  4RF1 A;  3IXS A;  3EGR A;  3P4Q B;  2BB6 A;  4KKI A;  4YWG G;  1TKG A;  3AE8 B;  1ROE A;  4REZ A;  3AEB B;  4ZYS A;  3AEG B;  3CIR B;  1TS3 A;  2J4X A;  3BZD B;  5EE1 A;  2M0A A;  1OQR A;  3T3O A;  3SEB A;  3VRB B;  1YN3 A;  1D4B A;  1QLB B;  1N62 A;  1TS5 A;  3DWG C;  5BYR A;  5D7G A;  1NYR A;  3V05 A;  3HVD A;  1QOF A;  3L4P A;  3AE6 B;  4RFB A;  2BBC A;  2PKO A;  3AH7 A;  1VLB A;  1C79 A;  3ZQ4 A;  1J7A A;  2YEP B;  4HEA 1;  4A55 A;  2I2Y A;  4YTM B;  1GAQ B;  2MEK A;  4LTU A;  2N0S B;  4ZRP A;  2XNA C;  3GB1 A;  2D5G A;  1HQR D;  2YEP F;  1FXI A;  2KN4 A;  4UDU C;  3B2F A;  2KWD A;  1HZ5 A;  3WCQ A;  1PDX A;  2ON8 A;  2H88 B;  3NVY A;  5TSS A;  3AED B;  1F77 A;  3VRA B;  5C3J B;  2N9L A;  4OHJ A;  3BVM A;  2VZK D;  4RGO S;  4GDL B;  5EE0 A;  3CF4 A;  1HXY D;  3Q69 A;  4DQO C;  1SE3 A;  4US9 A;  2LGI A;  2INN E;  3P42 A;  2WXJ A;  2E6X A;  4XE0 A;  5H92 C;  1H7X A;  4HKQ A;  1FMA D;  2NTS A;  2FBW B;  5FR3 A;  3B2G A;  4ZRQ A;  1RFK A;  4ARI A;  1TY2 A;  3R8B A;  1XXG A;  3BK1 A;  2B76 B;  2BS4 B;  1M4V A;  2NMQ A;  4XDC A;  3AE2 B;  2J53 A;  5EE9 A;  4A8X C;  3VQI A;  3NVW A;  2NTT A;  1FNW A;  2DWQ A;  3BWU D;  1AN8 A;  2M56 B;  1YQ3 B;  4KGR A;  4LK0 M;  4RH6 A;  4ZHO A;  1NEN B;  1JW9 D;  4CQN A;  2HTM E;  5HHD G;  2EEL A;  3P4P B;  1YN5 A;  3ZJT A;  1C77 A;  1ESF A;  1TZO A;  2QJL A;  2MJ3 A;  1JQ4 A;  1ZXH A;  1ZDV A;  1OQQ A;  3MC0 B;  3VR9 B;  2IJ0 A;  2W3R A;  2WXQ A;  2OHF A;  4HRO A;  4DXF A;  1SE4 A;  3AEE B;  4L2Y A;  2IPK D;  1KRH A;  3NS1 A;  1KTK A;  4OZB A;  1DOI A;  2WXR A;  3FIL B;  1WYG A;  2RMM A;  1B9R A;  3AV8 A;  2WXP A;  2WXL A;  1RWS A;  1WRI A;  2QIE B;  4AS1 A;  1PGA A;  4ZOH C;  2KQ4 X;  1J7C A;  2QMT A;  1HA5 A;  5HI1 A;  4US8 A;  1L6U A;  2OED A;  2QIL A;  1CZP A;  3AE1 B;  1N5W A;  1VRA B;  2JXT A;  1FFU A;  2SAK A;  2BYT A;  2MJD A;  4HRS A;  2EKI A;  1UWX A;  2BT6 A;  2L32 A;  3NRZ A;  2RPV A;  1JRP A;  1E7P B;  3R2T A;  2K0P A;  2WXK A;  5AUI A;  1C4P A;  1C4C A;  1IGD A;  2JYT A;  4NAW B;  2AQ2 B;  2TSS A;  3W9C B;  4EE2 A;  3HRD D;  3Q8A A;  1E9M A;  3VR8 B;  2DBY A;  1JWM D;  1UNS A;  3ZGZ A;  1YJI A;  1HEZ E;  1GT8 A;  3E56 A;  1CQV A;  1FIQ A;  1WWT A;  3C8Y A;  1GPX A;  2QSD A;  3P63 A;  3J9C A;  1UGJ A;  3Q8C A;  1KFY B;  2WQY B;  2K9X A;  1OFF A;  3BK2 A;  1QOB A;  1I4G A;  3AE5 B;  1F2R I;  2FE8 A;  2KDM A;  1E0Z A;  1GB1 A;  3AB5 A;  1JML A;  5HG2 A;  3KWL A;  2GRI A;  1CJE A;  2AQ1 B;  1A70 A;  1GTH A;  1N60 A;  2V3P A;  3FIL A;  4KGS A;  4IOI E;  3LYY A;  2AQ3 B;  1WXQ A;  1EU3 A;  1RM6 C;  2G1E A;  1EM7 A;  1FNU A;  1C78 A;  4KGT A;  4XWW A;  2Z8L A;  1QT9 A;  2N7J A;  2FUG 1;  1JWU D;  1L0Y B;  4YSX B;  1VR9 A;  4TMA B;  2LHE A;  1TY0 A;  2GI9 A;  2WXO A;  3ETR A;  3R2I A;  1WSP A;  3AEF B;  2LEK A;  2WXF A;  4KX6 B;  3DWM A;  3TEY A;  1DOX A;  4WQM A;  3E9S A;  1SXT A;  2CU3 A;  2INP E;  2BS3 B;  1K50 A;  3MJ5 A;  1F2R C;  1YJJ A;  1L0X B;  1N61 A;  1D6E C;  2I38 A;  2WXN A;  2JZP A;  4NZL B;  1EWY C;  4JE3 B;  1YQ4 B;  2JQR B;  2IGH A;  4YTN B;  1QIL A;  2MJE A;  1FFV A;  3IAS 1;  2G9H D;  3EUB 2;  1XLP A;  1NVI D;  2WXM A;  2Q5W D;  2Y3A A;  1FO4 A;  1H7W A;  3TEZ A;  1NI3 A;  1LO5 D;  1D5Z C;  5H8Y E;  2IGD A;  1RYJ A;  1QF6 A;  1ZP0 B;  3ZJU A;  4ZHP A;  4RGN A;  1QKZ A;  1MHX A;  4O1N A;  1L0V B;  4HKZ E;  3P4R B;  4L23 A;  4JWS C;  2WLB A;  5FKA C;  1FRD A;  2KAJ A;  1I4H A;  1TS2 A;  3P1M A;  3W1S A;  2R61 A;  1N5X A;  1KH0 A;  3AE4 B;  3AM9 A;  4TSS A;  4AQ7 A;  3IAM 1;  2QEJ C;  4TQ1 A;  5BYQ A;  1N63 A;  3URY A;  1K52 A;  2LJI A;  1VZ7 A;  2L52 A;  4WH4 A;  1XF5 L;  4A90 A;  1I4Q A;  2WNM A;  4KKJ A;  1YN4 A;  3I9V 1;  1F0Z A;  4IDI A;  2ACZ B;  1FM0 D;  4RF0 A;  3TEX A;  2BTE A;  4J3O D;  2X38 A;  1AW7 A;  1NEK B;  2CJO A;  2W55 A;  1V8C A;  2JX5 A;  3ZYY X;  1ZE3 D;  1PUT A;  3BII D;  4LLG M;  4USA A;  3NZ3 A;  4IKG A;  4B0M A;  1KLG D;  5LNK 1;  2JYE A;  3I57 A;  4DXG A;  3KQ4 A;  2ZW1 A;  1XCQ L;  1PGX A;  1GB4 A;  4NJC A;  1TYG B;  1MPE A;  1I4P A;  2H89 B;  2PMV A;  1SB3 C;  2WDQ B;  1ZXI A;  3AN1 A;  2ONQ A;  2VZK B;  2LUM A;  2RDG A;  3GP7 A;  1IUE A;  3ABV B;  1QOA A;  3IT4 B;  1HZ6 A;  2PVG C;  2LFI A;  3HVZ A;  1FNV A;  3AEA B;  1VJK A;  1VDV A;  5E6J A;  1YMH E;  3TEW A;  1I7H A;  3ZJV A;  5AUK A;  4P16 A;  1I4R A;  4NAM A;  4PT5 A;  3FAH A;  2IGG A;  4MH8 A;  5BYS A;  4JPS A;  3BVG A;  1BXT A;  4L1B A;  2V0G A;  2BB5 A;  1C4A A;  1L6V A;  4FXC A;  1D5X C;  1TKY A;  1V1O A;  4OZC A;  1V97 A;  1AWD A;  2WXG A;  1ZPS A;  5T8I A;  5G5G A;  1TS4 A;  5MPO A;  4A9A A;  2J42 A;  3AEC B;  2K5P A;  5GXG B;  1FCC C;  3IT6 B;  4YSY B;  3W5V B;  2L1A A;  3PZ7 A;  4ARC A;  5G5H A;  1C9F A;  1FD6 A;  1R7S A;  3PO0 A;  4YXD B;  3U52 E;  1MVK A;  1PGB A;  1SBB B;  3SFE B;  1ET6 A;  4XWT A;  5D3I B;  1SSN A;  2MH7 A;  2K3U A;  3V3X A;  3AE9 B;  1FRR A;  2K22 A;  1YNT E;  3NVZ A;  1V1P B;  1SF0 A;  1SJE D;  2PTL A;  2WP9 B;  4JWU C;  4WIP A;  1T3Q A;  1T5X D;  5BMG A;  2RDH A;  4WAF A;  3EA6 A;  2KAC A;  3W2D A;  4JX1 C;  2DLB A;  4C56 C;  2E3T A;  2V3N A;  2PW9 A;  2W82 A;  3TSS A;  1TKE A;  4M0W A;  1XEE A;  5FK9 C;  2BS2 B;  3NUH B;  4MM3 B;  1AYF A;  3FC4 A;  1JCK B;  3BYT B;  3HUI A;  4HJG E;  4P6V F;  4XDD A;  2WXH A;  3T3N A;  4OZA A;  2V4I B;  3LXF A;  1BUI C;  3AE3 B;  3MP9 A;  2JU6 X;  3PZ8 A;  1NYQ A;  2PIA A;  5EE3 A;  4MT5 A;  2Y5C A;  1K53 A;  1XLQ A;  2W3S A;  3MFG A;  3O13 A;  1C76 A;  1P7E A;  4OW0 A;  5BMH A;  4B0E A;  3P4S B;  3LB8 C;  4RGT A;  2GB1 A;  2Y5P A;  3U4E G;  1UUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...