3AE8B

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-isopropoxy-phenyl)-2-trifluoromethylbenzamide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Isopropoxy-phenyl)-2-trifluoromethylbenzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 54
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae8B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae8B01
2K5PA 1AWDA 3AE4B 4US9A 2H89B 3AEBB 4KX6B 3P63A 3P4QB 1N60A 3AB5A 3FC4A 1ZP0B 4N58A 5EE9A 1L0VB 2CJOA 1E0ZA 1PDXA 5H92C 1VJKA 4YSXB 3ETRA 2QJLA 3W5UB 1DOXA 1KF6B 4A9AA 1GPXA 5C3JB 2WU2B 3AEDB 2MJ3A 1WWTA 4YTPB 3AV8A 2N0SB 3CWIA 2B76B 2M56B 2K22A 4JWSC 1L6VA 2PVGC 1WGKA 2CU3A 2EKIA 4C80A 1FXAA 1B9RA 2MH7A 1ZOYB 1JALA 1QT9A 2PIAA 5G5GA 2BS2B 3AE7B 3AE9B 3P4RB 4YXDB 2L83A 2Y5CA 1FFUA 1TKEA 3NVVA 1DOYA 2W54A 3AEFB 1FFVA 1PFDA 3B2FA 3NVYA 1H7XA 1E7PB 3LB8C 4JWUC 1CJEA 1RWSA 4YSZB 2AX5A 1FIQA 1RM6C 5AUIA 1YQ4B 5C2TB 3W5VB 1XO3A 1NENB 1XLQA 1JWAD 1TYGB 1V8CA 1WYGA 1ZXIA 2E3TA 2BS4B 2WS3B 1DGJA 1NI3A 1NEKB 1PUTA 1QOAA 3P4PB 3VRBB 1SB3C 2ACZB 1SIJA 2W55A 3KWLA 2WDRB 2M19A 5GXGB 1A70A 1NYQA 3L4PA 5EE3A 3NRZA 3AMZA 3CIRB 1RYJA 4LTUA 2FBWB 1VLBA 2QIEB 4USAA 3RPFC 3EUB2 2BS3B 2MJDA 5G5HA 1QOFA 3P1MA 1E10A 4ITKA 1XLPA 1FM0D 1VDVA 1YJIA 1YJJA 5MPOA 3CF4A 1AYFA 1I7HA 3B9JA 3DWMA 1F0ZA 1R7SA 3AE5B 4ZOHC 4N6EB 2WLBA 1TJEA 3B2GA 2LEKA 2PVOD 3VR9B 4US8A 1IUEA 3SR6A 1YQ3B 1FO4A 1QF6A 1OFFA 1NVID 2WDQB 4YTNB 2WDVB 1TKGA 2PKOA 2WP9B 1FMAD 3PO0A 3AN1A 3NVZA 1ROEA 1JWBD 2DWQA 3ZYYX 1GTHA 1UWMA 2KMMA 4P6VF 4ZHPA 3AE6B 1T3QA 2W3RA 1L5PA 3AM9A 2CJNA 1V97A 4FXCA 3AECB 2WU5B 5EE0A 4YTMB 1FRDA 3NVWA 1QOBA 4C7ZA 1J7CA 1NYRA 4YSYB 1DOIA 1L6UA 2OHFA 1E6EB 2W3SA 5EE1A 1GT8A 2JX5A 3HRDD 1FXIA 3SFDB 1N5WA 1WRIA 1H7WA 3AEEB 3W9CB 3AE1B 2BT6A 3VR8B 4HRSA 1FRRA 2MJEA 4JX1C 4YT0B 1KFYB 1EWYC 1JROA 5H8YE 3FAHA 2HTME 4IDIA 1OQQA 2JQRB 3NS1A 1QOGA 3AE3B 1GTEA 1WXQA 2K9XA 4WQMA 3ABVB 1XLOA 1ZUD2 3BIID 1N63A 5AUKA 1RFKA 1N62A 1KRHA 1XLNA 1N5XA 3P4SB 2G1EA 3AH7A 1TKYA 1E9MA 2DBYA 4HROA 4WWMA 4ZHOA 1N61A 3WCQA 1QLBB 1SF0A 2L52A 3DWGC 3AEAB 3HVZA 2WQYB 3VRAB 1OQRA 3AEGB 1J7BA 1JRPA 3HUIA 3AE2B 3SFEB 3AE8B 1GAQB 2Q5WD 3LXFA 2H88B 2KAJA 4N59A 1JW9D 4C7YA 1JQ4A 1J7AA 1CZPA
chains in the Genus database with same CATH superfamily
5E6PA 4WURA 1TBEA 2D3AA 3I9V1 2AWTA 2KQ7A 3FC4A 3Q69A 4HXDA 2DAJA 4DXGA 1ZW7A 2MQJA 1B9RA 1E8XA 3JW0X 1ZKHA 1K50A 1AW7A 5D6JB 2C5LC 1T0QC 5IP4D 2E3TA 3TJPA 2WS3B 3BVMA 4HKQA 4URKA 3KWLA 2ACZB 2V4LA 2KZRA 3IG3A 2BWES 1V1PB 1IYFA 1YJ1A 3P1MA 3U7ZA 3BY4B 3MHSD 1AYFA 2V0GA 3WANA 4IC7B 2IZVB 2K6QA 4US8A 3URYA 2YEPF 4W9IA 3ZNGC 3U7DA 3U30A 1I4PA 2D2QA 2ZCBA 3BZDB 4RMAA 2OOBB 4GU2A 5CTRC 5BMGA 2FE8A 4MELA 3EFCA 4FHJA 4A20A 5FK9C 1L4ZB 1FXIA 2MW5A 3SFDB 3R7QA 3VVWB 3SEBA 2BKFA 5HG2A 4KZCA 4K81A 1D5ZC 3EA6A 1OQQA 2K0PA 1XF5L 2CR5A 4W9KA 2KDEB 1FEHA 1OGWA 1EU3A 1N62A 4OHJA 5BMIA 2K39A 3DPDA 1PQSA 3N30A 4GDLA 4N59A 3PLUA 4W9LA 2HJ1A 2WX1A 2X38A 2Z0DB 4ANWA 4KX6B 3KH0A 1WGYA 4N58A 2J7QB 1H8CA 1I4GA 5C3JB 4DHJB 2KDMA 5CX3A 2M56B 1IPGA 2EKIA 4K3BA 4ZRJA 2BB5A 2MH7A 2N7EA 3HHMA 3W1YA 2ONQA 3MJ5A 2IDYA 2M17A 3N1XC 3MJWA 2UYZB 4NAMA 4XZ4A 2M19A 3L13A 4G0NB 2FBWB 1GB1A 2JPHA 1VZ7A 1XLPA 2ZPNA 1YJIA 3DWMA 2WHIA 4ZOHC 1MHHE 2WNMA 2ZW0A 3V60A 5D7GA 4OZAA 4ANUA 3ZW3A 1OEYJ 2N9PC 2O2VA 2BYTA 3LYYA 2DWQA 3RZWC 3OJ4B 3Q8EA 4JIOU 3TBLD 3AE6B 3DHGC 3W2DA 1DOIA 2W3SA 2JX5A 2ICIA 3T3NA 2JXTA 2DZIA 1L0XB 4W9CA 2KVZA 3C8YA 3L10B 4OVVA 3MTNB 1LXDA 1XT9B 1Z2MA 1KRHA 3DHHC 1GB4A 2DBYA 1WX7A 3ZGZA 2MBBB 2GLSA 2CHZA 3W1SC 2AEHA 3AEAB 3H8HA 3HUIA 3LXFA 1WJNA 2Z0EB 4HPPA 1J7AA 1VD2A 1I4HA 3ZTDA 1XXGA 2ZNVC 2H89B 1WI0A 4BBNF 4DXFA 1QZEA 3VDZA 4TMAB 3GOEA 4GLSC 2O6VA 2CHXA 3IAS1 4C00A 2K22A 3JVZX 1E8ZA 1HA5A 3GE8C 3DHIC 2KVRA 4YXDB 2L83A 3WA0A 1M4VA 2KQSA 1DOYA 4ACFA 2I1KA 4NY0A 2KC2A 1L4DB 1JWAD 1EM7A 2Z59B 3P4PB 4F1SA 3M62B 4K3CA 3RUIB 2GB1A 4PS7A 2NS5A 3O13A 4EEWA 2FIDA 3AE5B 2OJRA 1CK1A 1R4MI 2PVOD 1S1QB 2IPKD 2LD9A 2NBWB 2WDVB 2PKOA 2PLPA 4KIKB 1ROEA 1E5WA 3KWVA 3DBRI 4EZLA 2J0MA 4YTMB 1QOBA 4C7ZA 3H1UA 4J6IA 4BFRA 2WX0A 2IJ0A 2GRIA 5EDSA 4MT5A 3QAQA 5J2RA 1Y56A 3Q8AA 1D5MC 3NUHB 3QIJA 1GTEA 4II2B 4WAFA 3EECA 1WM3A 2G1EA 3DBSA 4HROA 3VXWA 2RD0A 3WCQA 2I38A 1VR9A 4MH0E 2ZJDA 1L0YB 3BVGA 3PHXB 2WXIA 1E0ZA 2OJWA 3BK1A 3RNEC 2MJ3A 4RF0A 3T3OA 4JWSC 3H7SA 4ICVA 3H6NA 4TQ1A 3QC8B 1XCTL 2YEPB 3R3MA 4RCOA 2DZJA 1H4RA 2OEDA 2RSUA 2D11A 3HVDA 3U4EG 1RWSA 2B3AA 1LQBA 1RM6C 5AUIA 2FCQA 3L16A 1V81A 2MEKA 3IVFA 3ECIA 3ZIMA 2PPHA 2DAFA 3QX1A 4QAYA 1OTRB 3ONSA 1QILA 4MJSB 1VLBA 3BWUD 2R2QA 1VZ6A 3MC8A 4MGKE 2M8SA 2M1MA 2GBJA 3B9JA 4AUQC 3DBRB 4DHJD 5JZEB 4BOZB 1WSPA 4FBJB 1NI2A 2JYEA 3ZUNA 4AQ7A 2BYVE 1E7VA 1YX5B 2FCSA 1WM2A 3ZYYX 2IGHA 3A9KB 2MBQA 1WX8A 4PYZA 2LGYA 4Q2JA 1N5WA 2INCC 4M01A 1H7WA 4LLGM 4ZDVA 3AEEB 1MG4A 4GB9A 4JGHB 2IO1B 3UIPB 4YT0B 1ET9A 1UELA 2XK5B 4P7IA 2GBRA 4K7SA 1TY2A 2NBUA 2KN5A 4JLCA 3VH4B 2VZKB 1WZ3A 3PT2B 1EWCA 2N9XA 2O6VD 2J4XA 3A9KA 1WXVA 2WWZA 5BO4B 4M0WA 4NJCA 1SF0A 3ALBA 3PVLA 2KWUB 1OQYA 1I35A 3AEGB 3AE8B 4ANVA 1V2YA 2K5PA 3AU4A 4LNIA 1TY0A 2V1YA 3TL5A 3FILB 1V1OA 3NZ3A 3ZNZB 4KKJA 4BZAA 4WJNA 2HE7A 1GPXA 2WU2B 3GE3C 4IUMB 4YTPB 4FJYA 2KC1A 1CMXB 4AJYB 2IGDA 1QT9A 1FCLA 4WWPA 1LM8B 2DYOA 2JYTA 2W54A 2WXGA 3LB8C 4JWUC 4IWOA 1ENFA 4EOYA 2KFJA 1TGZB 1FIQA 1TYGB 1P7EA 2MBOA 1NI3A 1KTKA 3RCZA 2KYWA 2WXNA 1WMHA 2QEJC 1KLVA 2QIEB 3HM3A 3UI3A 2G45B 4HK2A 2WXOA 3VFKA 1WXMA 4MH8A 4ZRKA 1I4QA 1QF6A 3IXSA 3IT6B 4DXAB 3QJZA 2KO3A 1E8WA 1FMAD 2FUHB 4W9JA 1GTHA 3GZNI 3HK0A 2AYOB 1F2RI 1WJ6A 5BYSA 1FD6A 3EC8A 3TEYA 2RGFA 4E3CA 5T8IA 5J17A 3CSFA 3C0RB 1WRIA 2ZVOA 1F1HA 4RFBA 3VR8B 4PK1A 5HI1A 2KWCA 1WRDB 4FA6A 3MC0B 3A4SC 2KANA 3K9OB 4JL9A 4LK0M 4CO7A 4NJ7A 4MEMA 2BW2A 2W82A 2WQYB 4C7YA 2H88B 4A3OA 1V5TA 1UZXB 2BPSA 3L17A 1UF0A 3AB5A 2QDFA 2AQ2B 1UUPA 3DOWA 2HD5B 1KLGD 3H9DA 2PE6B 2WYQA 4LJOB 2I1JA 2UU7A 2KLGA 2Y5CA 3PZDA 3OJ3A 2DENB 2KJHB 1TKEA 1L2NA 2I2YA 2X8XX 1YN5A 4KVGB 2INNE 3V6CB 4YSZB 1FXTB 5IO9A 1HTQA 1NENB 2KNBA 1GC7A 3W5UB 1HXYD 2LJIA 3B08A 1HEZE 3NRZA 3LJ3A 4PT5A 2G3QB 2N9LA 1I4RA 5MPOA 4LNOA 4HDOA 1HTOA 4A55A 1WJ4A 4WAAA 3VH3B 2TSSA 1XD3B 2LXAA 3ML8A 2LJ5A 3DBHI 3NVZA 2FUG1 4ZHPA 2W3RA 3WAOA 2DNFA 2WU5B 2NBVB 3WALA 3SD5A 2OHFA 4RGOS 4WQOB 4BKTA 1MHXA 2BT6A 1VZ8A 3AU5A 3A9JA 4AP4C 3CMMB 3EHVA 1YX6B 2L1AA 3FAHA 2GI9A 3D32A 4DK5A 3IT4B 2K9XA 4B9KA 4HCPB 1KLUD 1P9DU 4RF1A 3KW5B 1UGJA 3ZKJC 1ZDXA 5IN7A 3B0AA 2PEAA 4RNAA 5IKCM 4IM2A 2MCNB 1Z5SB 5EE9A 4K7UA 2G4DB 2JUOA 3U8ZA 2R61A 3RNCC 3Q3OC 1WWTA 3AV8A 1YNTE 2QHOA 3QWZB 4GDKA 3TEWA 2JRHA 2PIAA 5G5GA 3AE9B 1WE7A 3GP7A 1WF9A 3ML9A 4CYEA 2LI5A 2FIFA 2PTLA 1CQVA 2JWUA 3PLVA 3ZJVA 2K8BA 1EUVB 5DPTA 4WJQA 1SJHD 4W9HA 3ZRCA 3CIRB 3ZO5B 1K8RB 2LGDA 3A33B 3EFUA 1GG3A 1WMHB 1RAXA 3QK0A 1VDVA 1F52A 3DDCB 3DBLB 3N9YC 2QC8A 1ZXHA 1VCBA 2KN4A 4LNNA 1WH3A 4OVUA 2WDQB 4HEA1 4XGAB 5L95C 2LXCA 3PO0A 3APCA 4BKSA 1V97A 5HKHA 4BKSD 5EE0A 5KHOA 1J0GA 1D4BA 1J7CA 2MHJA 2KWVB 5FKAC 2ZPYA 2LVPA 4KIKA 2RDHA 3T9LA 2BYEA 4W9EA 2BF8B 1T0SC 2GMIC 3M63B 2JVCA 2M4NA 4IKGA 2D3BA 4CHKA 3IAM1 4AOFA 3KYCD 1D3ZA 1RFKA 2LGIA 5DCNA 4WWMA 1C9FA 3DWGC 3ENEA 4FJZA 4NQLB 1J7BA 4IM0A 1GAQB 2XK5A 1QKZA 1HZ6A 2L32A 3AEBB 2BB6A 2VH2A 2FAZA 3KUDB 1FCCC 1HQRD 3BINA 1SIFA 3KYDD 4EZJA 4DWFA 1BUIC 1WGKA 1KH0A 3GS2A 2ZW1A 1Q5WB 5FR3A 1MI0A 4XC2A 4KGSA 3EGRA 1E7UA 2KWDA 1C4PA 3V3XA 2N7DA 3Q8CA 2L8JA 4P16A 1D5XC 1A70A 3L4PA 3APFA 2DYBA 5D2MB 1E8YA 2KDBA 4M02A 2BS3B 1XQQA 1WYWB 2GBMA 2WXMA 3ZVVA 2PMVA 3Q3MC 3SR6A 3Q3NC 3JSVA 3I3TB 1FO4A 3RT3B 2CU1A 3NS8A 4PS3A 1E90A 2V4IB 4DDGD 3R66C 3MC9A 2GOWA 2AL6A 2KMMA 3AM9A 1T3QA 5IA7A 1AARA 2C7MB 3S2AA 3UF8A 1SEBD 1V80A 4G11A 3N32A 1FRRA 3UIOB 2LHEA 5H8YE 3ZDTA 3RN9C 1STEA 2JSVX 2ON8A 2DHZA 3V6EB 1HE8A 2CS4A 2JZZA 2WXLA 1TKYA 1E9MA 4LNFA 1ESFA 2K8HA 2ZZPB 2N1VA 3PREA 1TZOA 4KKIA 2BVCA 4L23A 2LFIA 1N60A 4GDLB 3QHTA 4WH4A 2E6XA 1C78A 2N7JA 2B76B 1MFWA 1PYWD 2K8CA 5E6OA 4D2KA 4S17A 3PZ8A 4OVZA 1T6BX 2KKCA 1TIFA 1CJEA 2XBBC 4XWWA 4DQOC 2JXXA 3N1ZC 1VRAB 2J53A 2KACA 1ZPSA 3SHQA 1YN3A 2LGXA 1NYQA 3ZNHB 3VUYA 4HCNB 1P1AA 1F9JA 2BYFA 2WXHA 3Q14C 1C4AA 1FNUA 3VHTC 3TSSA 2KT7A 2V3PA 3OAWA 4CQNA 3N1YC 1WXSA 3RNFC 3I63C 5JHBA 4RM9A 3M95A 4M00A 1YQ3B 1KM7A 1OFFA 1NVID 3PSEB 1SE2A 1L5PA 3AECB 3Q6BA 1K51A 2WXKA 4GXBA 2VRRB 1L6UA 1SBBB 2KFKB 4KSLC 2BGFA 4MM3B 4MACA 3U2SC 1XCQL 5BYQA 1WGHA 2J52A 1KFYB 1JROA 4MJSA 4PYUA 3GB1A 2QCZA 5LLIA 3DBLI 4HJKA 1A5RA 5AUKA 2KOXA 3PZ7A 1PGBA 4ARIA 4HJGE 1UD7A 4ZHOA 4TSSA 1FNWA 2J42A 3HVZA 2LVOA 3K9PB 2XN9C 3PHWB 1AWDA 1SJED 4WWNA 1Y8RC 4HVBA 2O2VB 2KQ4X 3WIMA 3BYTB 1PGAA 4EE2A 2N0SB 2EMSA 5AEKB 2ZVNA 4MGIE 3KLSX 1EF5A 2JT4B 2WDTB 4EKUA 3NVVA 2AQ3B 3RNGC 5BMHA 5L83A 4KDIC 1ZXIA 2A4ZA 2W55A 2MA9B 2LRWA 3PS6A 1SE3A 3AMZA 4A6QA 2KJ6A 2RDGA 2NMQA 1TS3A 2K25A 4ITKA 1F0ZA 2ASQA 1N6ZA 3UQAA 3X23A 2AL3A 1WR6E 4YTNB 3BK2A 4XDCA 2WP9B 4WJOA 1JWBD 4KV2A 2KTRB 4B6WA 3WAPA 2JZPA 1NYRA 2MP2B 4LDTD 2J0KA 5AZGA 1GOZA 1UBIA 2EMTA 4XWTA 1B1ZA 2C7HA 4XDDA 2K1FA 1MVKA 4X57B 3RI7C 3T8MA 3BYYB 3PV1A 4KSKC 3ABVB 2MRPA 1ZUD2 4UDUC 3ZDMC 4NAWB 2BQQA 4IOIE 1QLBB 4REZA 2Q5WD 4MDKE 5C1ZA 1V8CA 1ZDVA 3AE4B 4US9A 1SE4A 1F77A 3P63A 3FKYA 3C19A 5CHFA 3R2TA 3ZTCA 1VJKA 2WXRA 4A9AA 5CHWA 4IWQA 4EFOA 2QMTA 3AULA 3OWEB 4M8MA 1ZOYB 4TUUA 5BYRA 3AE7B 3NOBA 1ACCA 2W9NA 4BBNC 4B0EA 3NVYA 1J19A 3RULA 1P98A 4FULA 3W5VB 4R3DA 1XLQA 1DGJA 3MP9A 4TV3A 1J8CA 5EE3A 1UWXA 2RR9A 3Q3JA 2LZ6A 2PJHA 4W9DA 1EO6A 1YQBA 4A8XC 2PW9A 4GOCA 2A5UA 3VR9B 2C60A 3R2IA 2AQ1B 3PRZA 1JMLA 3APDA 5HHDG 1C4CA 2FCNA 3I5JC 2ZNVB 4ZRQA 4M0WB 1I42A 4HPMB 2JY6A 1JWSD 2G4SA 4YSYB 2N1WA 1E6EB 3N20C 2REXA 2IO3B 2KX0A 4JE3B 1PGXA 4JX1C 3JSVB 3QA8A 2M0AA 2GBKA 4WJPA 1OEYA 2L05A 1GC6A 4BVUC 2D10A 1WXAA 4NNJB 4AS1A 4YWGG 4BOSC 3VRAB 1OQRA 1JRPA 3AE2B 5CHVC 1R4NB 4ZYSA 3SDLC 1P7FA 2NPTB 4TKNA 2RDBC 4DHZE 1V5OA 1C79A 4EZKA 1Q1OA 1WIAA 4GSWA 1RRBA 1FXAA 3P4RB 3DVGX 2WGSA 3AEFB 2KK8A 1IP9A 5D3IB 2N4FA 3NY5A 2IYDB 3VUXA 4ANXA 1UH6A 2HTME 2LUMA 4N9F4 1ISNA 1IBXA 1SIJA 4HPLB 2RPVA 4I6LB 3UQBA 1RYJA 3NZUA 1UBQA 4USAA 2NTSA 3IBEA 5G5HA 3OG5A 4C56C 1K52A 2HTHA 2JWZA 1YJJA 3V62A 5LXHA 2LHDA 3QARA 2LEKA 2BWFA 5IAAC 2ZCCA 4KDLB 1BXTA 4LCDE 2Y3AA 1WR1A 4A90A 2JU6X 4P6VF 4FXCA 4L2YA 3R8BA 2MBHA 1FRDA 3NHEB 3NVWA 3TEZA 5EE1A 5E6JA 4OZCA 2KD0A 5JHAA 2DYMA 4RGNA 4NQKE 1U4AA 5HFYA 3PGEA 2KDFB 2O6VB 2WXJA 3A9JB 4B95A 3DVNU 3QCAA 3NS1A 4K1RB 2MBEA 2HJ8A 1XLOA 1V86A 3RNAC 3J9CA 1N5XA 3IHPC 3AH7A 3MFGA 4G50A 1N61A 2IY1B 4MM3A 3VTWA 5JXVA 4HKZE 1LFDA 3R7RA 1IGCA 4NPNA 4KZ0A 4II3B 1GUAB 2KAJA 1CZPA 1RFAA 2D5GA 3P4QB 1L0VB 2CJOA 4YSXB 2KLCA 2QJLA 1GNUA 2SEBD 4F8CB 3AEDB 2JZ3B 2MWSB 4NAWA 3CWIA 1C77A 3ZRFA 5DPRA 5D94A 4GN1A 1L6VA 2PVGC 2YVCA 1LO5D 4HDQA 2L00B 3ZJUA 4DBGA 1FFVA 3Q2AC 1H7XA 4DHZB 1UNSA 4W9FA 2NTTA 4F7ZA 4P1CC 1SE9A 2K3UA 1LGRA 3I57A 4WIPA 2DLBA 5G55A 5DPWA 2KMCA 2PE9A 4ARCA 2KMAA 1R4NI 1M94A 3L54A 2NCNA 3RPFC 3EUB2 1QOFA 4I6PA 1E10A 1L7YA 2KHWB 1I7HA 3TUOA 4YL8A 3B2GA 4IW0A 3M3JA 1ZGUB 2WXQA 2MX2A 4W9GA 3WAMA 5AZHA 2HDEA 1TKGA 2XNAC 4BKGA 3RNBC 1JWUD 3VTUA 4O1NA 3V61A 4AWJA 1NDDA 1T5XD 3NJTA 3AE1B 2L7RA 4HRSA 3Q8FA 4K7WA 1FPYA 1EWYC 2KJRA 4XE0A 3Q8BA 5DPSA 3HIZA 4FLHA 3BIID 4ZRPA 1XLNA 2IO2B 3HM6X 1JCKB 3L08A 2VZKD 2C7NB 3E9SA 4IM3A 2GBNA 2DZKA 3PRMB 3RMKC 5I4DA 2N9EB 4ICUA 1PDXA 3LDZE 3ETRA 1DOXA 1Q10A 3P42A 4A3PA 3W1SA 2NVUI 3JYUA 2BKRB 2WXFA 2YLMA 2LUEA 5IOIA 1YIWA 3ZLZA 2BS2B 3BVZA 2RMMA 1FFUA 1XEEA 5JH5C 2QILA 3CF6E 3KVFB 2AX5A 1YQ4B 1MG8A 1TS5A 1WYGA 2EELA 2V9HA 2BS4B 1NEKB 1SB3C 3VRBB 3ZNID 4KGTA 3L0WB 5J18A 3KUZA 3A1QB 2L0FA 1KOTA 4DDID 2MJDA 1V1PA 2IGGA 4B0MA 2IBIB 4H2AA 1R7SA 2MSED 4RGMA 4N6EB 2KFKA 2WLBA 2BTEA 3U52E 3ZJTA 2INPE 4MGZE 3TCAA 1D6EC 2LVQA 3DVNV 2LWPA 2L0TA 3ZQ4A 1T0RC 4IG7B 3AN1A 1BT0A 2LASA 3AI5A 3AXCA 2CJNA 4MGYE 4S0RA 1MPEA 1SGHA 3ZXRA 3W9CB 1GJZA 2LGSA 2MJEA 3A4RA 2DX5B 3TMPB 2IY0B 1FNVA 4IDIA 5TSSA 2JQRB 3PRPB 1P0RA 2D3CA 2BBCA 4WWOA 4OZBA 1EF1A 2L3ZA 2INDC 3PTFC 1WY8A 1TS2A 2L52A 2EKEC 4KGRA 1WGRA 4ZYNA 3V05A 2VH1A 2KTRA 2J0JA 3RD2A 1ZP0B 1X1MA 2MP2A 1YD8U 3VTVA 2Z8LA 5H92C 2L76A 1ET6A 4MSQB 1K53A 3O65B 2CU3A 1WE6A 4IWPA 1TS4A 4E74A 1JALA 3E56A 2NPTA 1YOVB 2JF5A 3DQVA 3UINB 1PFDA 1XO3A 4FHKA 2IO0B 1HZ5A 4JQWC 1QOAA 1TTNA 1I4XA 2WDRB 1JWMD 4LTUA 2FCMA 5E6NA 2Y5BB 1P3QU 1MJDA 1YN4A 3VUWA 2ZEQA 1TJEA 2D3GA 3IFWB 4LDTB 1C3TA 4E71A 2M0XA 2CHWA 4ASWC 4L1BA 2NR2A 3KQ4A 3DVGY 3DCGA 1YMHE 3RFZB 4GMVA 4FN2A 4HWIB 3H7PB 2RPQA 3RYTA 2V3SA 3X0WA 1G6JA 4OW0A 4MSMB 1GT8A 1WGGA 3HRDD 4GIVA 1R4MB 1UGMA 1S3SG 5C23A 4C4VB 2QSDA 2CKHB 1T0YA 3A1QA 4LJPB 4TQ0A 3UGBB 4FJVB 1QOGA 1WXQA 1WZ0A 5LNK1 2KTFA 1N63A 2XEWA 1KJTA 1RLFA 2Y5PA 3Q3FA 1JQ4A 1TT5B 1JW9D 3FILA 1EU4A 4LNKA 4HLEA 4ZRIA 3NG0A 5TR5A 4RGTA 2V3NA 4PS8A 1JRUA 1KF6B 4EUTA 2FNJB 4NZLB 1WFYA 1C76A 4P1BC 2LMCA 1C1YB 5LXIB 4C80A 4RH6A 1SXTA 2KDIA 1BMLC 2JRIB 3PPAA 4GDKB 3ZXVA 4G3XB 3B2FA 4BAXA 2KX3A 1E7PB 2C9WB 2KXJA 1WX9A 5C2TB 3GZNB 3H7PA 4GGQA 1NBFC 4M8NA 1PUTA 3N3KB 1QQRA 5AZFA 1IBXB 3TIXA 5GXGB 5GMVA 1IGDA 2K6DB 2UWQA 3OLMD 1FM0D 3B1LX 3RZFA 4FADA 3CF4A 2DZMA 2D07B 5D3DA 1ZE3D 1F2RC 2SAKA 5G2NA 1IUEA 3VAWA 3SU8X 3DBHB 1WGDA 4I6NB 1V49A 1TZ1A 2R2OA 3CSTA 1UWMA 2G9HD 5FR6A 2MLBA 4RM8A 3KUCB 1V6EA 2N9KA 4JPSA 1AN8A 1Q0WB 4C4VA 3MHZA 1DYQA 3AE3B 2WXPA 1SSNA 4WQMA 3TEXA 4AJWA 4XX5A 4XYCA 4J3OD 3QQ8B 3P4SB 1V9JA 3P2BA 1WJUA 3NZSA 2LRUA 3VQIA 3SFEB 5KHQA 4NJ6A
chains in the Genus database with same CATH topology
2K5PA 1TY0A 2LFIA 3FILB 1V1OA 3NZ3A 4WURA 2D5GA 3P4QB 3I9V1 4KKJA 1N60A 3FC4A 4GDLB 1L0VB 2CJOA 3Q69A 4YSXB 4WH4A 2QJLA 2SEBD 2E6XA 1GPXA 2WU2B 3AEDB 1C78A 2N7JA 3CWIA 1C77A 4YTPB 2B76B 4DXGA 1PYWD 1L6VA 2PVGC 1B9RA 2IGDA 1QT9A 1FCLA 1LO5D 4D2KA 2DYOA 2JYTA 3ZJUA 2W54A 3PZ8A 1K50A 4OVZA 1FFVA 1T6BX 2WXGA 1H7XA 1UNSA 3LB8C 1AW7A 1CJEA 1ENFA 2NTTA 4JWUC 1FIQA 2K3UA 4XWWA 4DQOC 2E3TA 1TYGB 1P7EA 1VRAB 3I57A 4WIPA 2WS3B 1NI3A 2DLBA 2J53A 3BVMA 2KACA 4HKQA 1ZPSA 3KWLA 2ACZB 1KTKA 4ARCA 1YN3A 1NYQA 2WXNA 2QEJC 1V1PB 2QIEB 3RPFC 3EUB2 3UI3A 1QOFA 2WXHA 3P1MA 1E10A 3U7ZA 1C4AA 2WXOA 1AYFA 1I7HA 2V0GA 1FNUA 3TSSA 2V3PA 4CQNA 3TUOA 3B2GA 4US8A 3URYA 4MH8A 2YEPF 2WXQA 1I4QA 1YQ3B 1QF6A 1I4PA 1OFFA 1NVID 3IT6B 3IXSA 2HDEA 1TKGA 2XNAC 1SE2A 1FMAD 3BZDB 5BMGA 2FE8A 1GTHA 1JWUD 4O1NA 1L5PA 3AECB 1F2RI 1K51A 2WXKA 5BYSA 1FD6A 5FK9C 3TEYA 1L6UA 5T8IA 1SBBB 1L4ZB 1FXIA 3SFDB 1WRIA 1T5XD 4MACA 4MM3B 3AE1B 4RFBA 3VR8B 3SEBA 3U2SC 1XCQL 4HRSA 5BYQA 5HI1A 3Q8FA 2J52A 1KFYB 1EWYC 4XE0A 3Q8BA 1JROA 3MC0B 5HG2A 3GB1A 1D5ZC 3EA6A 1OQQA 2K0PA 1XF5L 3BIID 4LK0M 4ZRPA 1FEHA 5AUKA 1EU3A 1N62A 1XLNA 3PZ7A 4OHJA 1PGBA 4ARIA 5BMIA 4HJGE 2BW2A 4ZHOA 2W82A 4TSSA 1FNWA 2J42A 1JCKB 2WQYB 3HVZA 4C7YA 2VZKD 2XN9C 2H88B 4N59A 1AWDA 2X38A 1SJED 3E9SA 4KX6B 5I4DA 3AB5A 4N58A 2KQ4X 2AQ2B 1PDXA 1DOXA 3ETRA 1I4GA 1Q10A 1UUPA 3BYTB 3P42A 5C3JB 1PGAA 2KDMA 4EE2A 1KLGD 3W1SA 2N0SB 2M56B 2WXFA 2EKIA 2BB5A 2MH7A 3KLSX 2BS2B 3BVZA 2Y5CA 2RMMA 1FFUA 1XEEA 1TKEA 3NVVA 2QILA 2ONQA 2I2YA 3MJ5A 2AQ3B 1YN5A 5BMHA 2IDYA 2AX5A 2INNE 4YSZB 1YQ4B 1TS5A 1NENB 1WYGA 2EELA 4NAMA 1ZXIA 3W5UB 2BS4B 2W55A 1NEKB 1HXYD 3VRBB 1SB3C 4KGTA 2M19A 2LJIA 1SE3A 1HEZE 3NRZA 3AMZA 4A6QA 2RDGA 2FBWB 4PT5A 1GB1A 2MJDA 2N9LA 2NMQA 1TS3A 1V1PA 1VZ7A 4ITKA 1I4RA 1XLPA 2IGGA 4B0MA 1YJIA 5MPOA 1F0ZA 3DWMA 4H2AA 1R7SA 4RGMA 4ZOHC 4N6EB 2WLBA 2BTEA 3U52E 1MHHE 2WNMA 3ZJTA 4A55A 2INPE 1D6EC 2ZW0A 3ZQ4A 5D7GA 4OZAA 4YTNB 3BK2A 2TSSA 4XDCA 2WP9B 2BYTA 3AN1A 3NVZA 3LYYA 1JWBD 2DWQA 2FUG1 3Q8EA 4ZHPA 3AE6B 2W3RA 2CJNA 2WU5B 2JZPA 2OHFA 1NYRA 1DOIA 2W3SA 4RGOS 3W2DA 1MPEA 2ICIA 2JX5A 2JXTA 3T3NA 1MHXA 3W9CB 1L0XB 2BT6A 1VZ8A 1GOZA 2MJEA 4XWTA 3C8YA 1B1ZA 2L1AA 3FAHA 1FNVA 4IDIA 4XDDA 2GI9A 5TSSA 2JQRB 1MVKA 3IT4B 2K9XA 3BYYB 3ABVB 1ZUD2 2BBCA 4UDUC 1KLUD 4RF1A 1KRHA 1UGJA 1ZDXA 4NAWB 4OZBA 1GB4A 2DBYA 4IOIE 4RNAA 1QLBB 3ZGZA 1TS2A 2L52A 3AEAB 4REZA 3H8HA 3HUIA 3LXFA 4KGRA 2Q5WD 1J7AA 1V8CA 1ZDVA 3V05A 3AE4B 1I4HA 4US9A 1SE4A 1XXGA 1F77A 2H89B 3P63A 4DXFA 1ZP0B 5EE9A 3R2TA 2Z8LA 4TMAB 4GLSC 5H92C 1VJKA 2R61A 2WXRA 4A9AA 1ET6A 1WWTA 3AV8A 1YNTE 2QMTA 3IAS1 1K53A 2K22A 3OWEB 2CU3A 3TEWA 1HA5A 1TS4A 1ZOYB 1JALA 2PIAA 5G5GA 3E56A 5BYRA 3AE7B 3AE9B 2L83A 4YXDB 3GP7A 1M4VA 1ACCA 1DOYA 4B0EA 1PFDA 3NVYA 1L4DB 2PTLA 3W5VB 1CQVA 1XO3A 4R3DA 1XLQA 1JWAD 1HZ5A 2JWUA 3ZJVA 1QOAA 1DGJA 1EM7A 3P4PB 1I4XA 2WDRB 1SJHD 3MP9A 1JWMD 5EE3A 3CIRB 4LTUA 1UWXA 2GB1A 3O13A 1VDVA 1YN4A 3N9YC 3AE5B 4A8XC 1CK1A 1TJEA 1ZXHA 2PW9A 2PVOD 3VR9B 3R2IA 2KN4A 2AQ1B 2IPKD 4L1BA 1JMLA 3KQ4A 5HHDG 2WDQB 2WDVB 4HEA1 1C4CA 2PKOA 2PLPA 1YMHE 3RFZB 3PO0A 1ROEA 3KWVA 4ZRQA 1V97A 5EE0A 1D4BA 4YTMB 1QOBA 4C7ZA 1J7CA 1JWSD 4YSYB 5FKAC 1E6EB 4OW0A 1GT8A 3HRDD 2IJ0A 2RDHA 4JE3B 1PGXA 2GRIA 4JX1C 4MT5A 2QSDA 2M0AA 1Y56A 3Q8AA 4TQ0A 1D5MC 3NUHB 4IKGA 1QOGA 1WXQA 1GTEA 5LNK1 1N63A 4WAFA 3IAM1 4AS1A 1RFKA 4YWGG 2LGIA 2G1EA 4WWMA 2Y5PA 4HROA 1C9FA 3WCQA 2I38A 3DWGC 1VR9A 3VRAB 1OQRA 1J7BA 1JRPA 3AE2B 1GAQB 1JQ4A 1JW9D 3FILA 1QKZA 1EU4A 4ZYSA 1HZ6A 1L0YB 2L32A 3BVGA 3AEBB 4RGTA 2V3NA 2BB6A 1P7FA 2WXIA 1E0ZA 3BK1A 1KF6B 1FCCC 1HQRD 1C79A 2MJ3A 4NZLB 1C76A 4RF0A 3T3OA 2LMCA 4JWSC 1BUIC 4C80A 1WGKA 4RH6A 1FXAA 1SXTA 1KH0A 3GS2A 4TQ1A 3P4RB 1BMLC 2ZW1A 1XCTL 2YEPB 4GDKB 5FR3A 1MI0A 4RCOA 3AEFB 2OEDA 4KGSA 3B2FA 3EGRA 1E7PB 3HVDA 3U4EG 1RWSA 5D3IB 1RM6C 2KWDA 5AUIA 5C2TB 1C4PA 3V3XA 2MEKA 3Q8CA 2HTME 2LUMA 1PUTA 1IBXA 1SIJA 4P16A 1QQRA 1IBXB 2RPVA 1D5XC 5GXGB 1A70A 3L4PA 1QILA 1RYJA 1VLBA 4USAA 3BWUD 2BS3B 1IGDA 1VZ6A 2NTSA 5G5HA 4C56C 1K52A 1FM0D 1YJJA 3CF4A 3B9JA 2LHDA 5D3DA 1ZE3D 1F2RC 2LEKA 2WXMA 2SAKA 2PMVA 1WSPA 1IUEA 3SR6A 2JYEA 4AQ7A 1FO4A 1BXTA 2V4IB 2Y3AA 3ZYYX 4A90A 1UWMA 2G9HD 2JU6X 2KMMA 3AM9A 1T3QA 4P6VF 2IGHA 4FXCA 4L2YA 3R8BA 1FRDA 3NVWA 3TEZA 5EE1A 5E6JA 4OZCA 4Q2JA 2DYMA 1N5WA 4RGNA 1H7WA 4LLGM 1SEBD 3AEEB 2N9KA 4JPSA 5HFYA 1FRRA 4YT0B 1AN8A 1ET9A 2LHEA 2WXJA 5H8YE 1TY2A 3MHZA 3NS1A 1DYQA 3AE3B 1STEA 1SSNA 2JSVX 2ON8A 2WXPA 4WQMA 3TEXA 1XLOA 2VZKB 1EWCA 3J9CA 2J4XA 4J3OD 1N5XA 3P4SB 2WXLA 4M0WA 3AH7A 1TKYA 1E9MA 3MFGA 1N61A 4NJCA 5JXVA 1SF0A 4HKZE 1IGCA 1ESFA 3VQIA 3AEGB 1TZOA 3SFEB 4KKIA 3AE8B 2KAJA 1CZPA 4L23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5P A;  1AWD A;  3AE4 B;  4US9 A;  2H89 B;  3AEB B;  4KX6 B;  3P63 A;  3P4Q B;  1N60 A;  3AB5 A;  3FC4 A;  1ZP0 B;  4N58 A;  5EE9 A;  1L0V B;  2CJO A;  1E0Z A;  1PDX A;  5H92 C;  1VJK A;  4YSX B;  3ETR A;  2QJL A;  3W5U B;  1DOX A;  1KF6 B;  4A9A A;  1GPX A;  5C3J B;  2WU2 B;  3AED B;  2MJ3 A;  1WWT A;  4YTP B;  3AV8 A;  2N0S B;  3CWI A;  2B76 B;  2M56 B;  2K22 A;  4JWS C;  1L6V A;  2PVG C;  1WGK A;  2CU3 A;  2EKI A;  4C80 A;  1FXA A;  1B9R A;  2MH7 A;  1ZOY B;  1JAL A;  1QT9 A;  2PIA A;  5G5G A;  2BS2 B;  3AE7 B;  3AE9 B;  3P4R B;  4YXD B;  2L83 A;  2Y5C A;  1FFU A;  1TKE A;  3NVV A;  1DOY A;  2W54 A;  3AEF B;  1FFV A;  1PFD A;  3B2F A;  3NVY A;  1H7X A;  1E7P B;  3LB8 C;  4JWU C;  1CJE A;  1RWS A;  4YSZ B;  2AX5 A;  1FIQ A;  1RM6 C;  5AUI A;  1YQ4 B;  5C2T B;  3W5V B;  1XO3 A;  1NEN B;  1XLQ A;  1JWA D;  1TYG B;  1V8C A;  1WYG A;  1ZXI A;  2E3T A;  2BS4 B;  2WS3 B;  1DGJ A;  1NI3 A;  1NEK B;  1PUT A;  1QOA A;  3P4P B;  3VRB B;  1SB3 C;  2ACZ B;  1SIJ A;  2W55 A;  3KWL A;  2WDR B;  2M19 A;  5GXG B;  1A70 A;  1NYQ A;  3L4P A;  5EE3 A;  3NRZ A;  3AMZ A;  3CIR B;  1RYJ A;  4LTU A;  2FBW B;  1VLB A;  2QIE B;  4USA A;  3RPF C;  3EUB 2;  2BS3 B;  2MJD A;  5G5H A;  1QOF A;  3P1M A;  1E10 A;  4ITK A;  1XLP A;  1FM0 D;  1VDV A;  1YJI A;  1YJJ A;  5MPO A;  3CF4 A;  1AYF A;  1I7H A;  3B9J A;  3DWM A;  1F0Z A;  1R7S A;  3AE5 B;  4ZOH C;  4N6E B;  2WLB A;  1TJE A;  3B2G A;  2LEK A;  2PVO D;  3VR9 B;  4US8 A;  1IUE A;  3SR6 A;  1YQ3 B;  1FO4 A;  1QF6 A;  1OFF A;  1NVI D;  2WDQ B;  4YTN B;  2WDV B;  1TKG A;  2PKO A;  2WP9 B;  1FMA D;  3PO0 A;  3AN1 A;  3NVZ A;  1ROE A;  1JWB D;  2DWQ A;  3ZYY X;  1GTH A;  1UWM A;  2KMM A;  4P6V F;  4ZHP A;  3AE6 B;  1T3Q A;  2W3R A;  1L5P A;  3AM9 A;  2CJN A;  1V97 A;  4FXC A;  3AEC B;  2WU5 B;  5EE0 A;  4YTM B;  1FRD A;  3NVW A;  1QOB A;  4C7Z A;  1J7C A;  1NYR A;  4YSY B;  1DOI A;  1L6U A;  2OHF A;  1E6E B;  2W3S A;  5EE1 A;  1GT8 A;  2JX5 A;  3HRD D;  1FXI A;  3SFD B;  1N5W A;  1WRI A;  1H7W A;  3AEE B;  3W9C B;  3AE1 B;  2BT6 A;  3VR8 B;  4HRS A;  1FRR A;  2MJE A;  4JX1 C;  4YT0 B;  1KFY B;  1EWY C;  1JRO A;  5H8Y E;  3FAH A;  2HTM E;  4IDI A;  1OQQ A;  2JQR B;  3NS1 A;  1QOG A;  3AE3 B;  1GTE A;  1WXQ A;  2K9X A;  4WQM A;  3ABV B;  1XLO A;  1ZUD 2;  3BII D;  1N63 A;  5AUK A;  1RFK A;  1N62 A;  1KRH A;  1XLN A;  1N5X A;  3P4S B;  2G1E A;  3AH7 A;  1TKY A;  1E9M A;  2DBY A;  4HRO A;  4WWM A;  4ZHO A;  1N61 A;  3WCQ A;  1QLB B;  1SF0 A;  2L52 A;  3DWG C;  3AEA B;  3HVZ A;  2WQY B;  3VRA B;  1OQR A;  3AEG B;  1J7B A;  1JRP A;  3HUI A;  3AE2 B;  3SFE B;  3AE8 B;  1GAQ B;  2Q5W D;  3LXF A;  2H88 B;  2KAJ A;  4N59 A;  1JW9 D;  4C7Y A;  1JQ4 A;  1J7A A;  1CZP A; 
#chains in the Genus database with same CATH topology
 5E6P A;  4WUR A;  1TBE A;  2D3A A;  3I9V 1;  2AWT A;  2KQ7 A;  3FC4 A;  3Q69 A;  4HXD A;  2DAJ A;  4DXG A;  1ZW7 A;  2MQJ A;  1B9R A;  1E8X A;  3JW0 X;  1ZKH A;  1K50 A;  1AW7 A;  5D6J B;  2C5L C;  1T0Q C;  5IP4 D;  2E3T A;  3TJP A;  2WS3 B;  3BVM A;  4HKQ A;  4URK A;  3KWL A;  2ACZ B;  2V4L A;  2KZR A;  3IG3 A;  2BWE S;  1V1P B;  1IYF A;  1YJ1 A;  3P1M A;  3U7Z A;  3BY4 B;  3MHS D;  1AYF A;  2V0G A;  3WAN A;  4IC7 B;  2IZV B;  2K6Q A;  4US8 A;  3URY A;  2YEP F;  4W9I A;  3ZNG C;  3U7D A;  3U30 A;  1I4P A;  2D2Q A;  2ZCB A;  3BZD B;  4RMA A;  2OOB B;  4GU2 A;  5CTR C;  5BMG A;  2FE8 A;  4MEL A;  3EFC A;  4FHJ A;  4A20 A;  5FK9 C;  1L4Z B;  1FXI A;  2MW5 A;  3SFD B;  3R7Q A;  3VVW B;  3SEB A;  2BKF A;  5HG2 A;  4KZC A;  4K81 A;  1D5Z C;  3EA6 A;  1OQQ A;  2K0P A;  1XF5 L;  2CR5 A;  4W9K A;  2KDE B;  1FEH A;  1OGW A;  1EU3 A;  1N62 A;  4OHJ A;  5BMI A;  2K39 A;  3DPD A;  1PQS A;  3N30 A;  4GDL A;  4N59 A;  3PLU A;  4W9L A;  2HJ1 A;  2WX1 A;  2X38 A;  2Z0D B;  4ANW A;  4KX6 B;  3KH0 A;  1WGY A;  4N58 A;  2J7Q B;  1H8C A;  1I4G A;  5C3J B;  4DHJ B;  2KDM A;  5CX3 A;  2M56 B;  1IPG A;  2EKI A;  4K3B A;  4ZRJ A;  2BB5 A;  2MH7 A;  2N7E A;  3HHM A;  3W1Y A;  2ONQ A;  3MJ5 A;  2IDY A;  2M17 A;  3N1X C;  3MJW A;  2UYZ B;  4NAM A;  4XZ4 A;  2M19 A;  3L13 A;  4G0N B;  2FBW B;  1GB1 A;  2JPH A;  1VZ7 A;  1XLP A;  2ZPN A;  1YJI A;  3DWM A;  2WHI A;  4ZOH C;  1MHH E;  2WNM A;  2ZW0 A;  3V60 A;  5D7G A;  4OZA A;  4ANU A;  3ZW3 A;  1OEY J;  2N9P C;  2O2V A;  2BYT A;  3LYY A;  2DWQ A;  3RZW C;  3OJ4 B;  3Q8E A;  4JIO U;  3TBL D;  3AE6 B;  3DHG C;  3W2D A;  1DOI A;  2W3S A;  2JX5 A;  2ICI A;  3T3N A;  2JXT A;  2DZI A;  1L0X B;  4W9C A;  2KVZ A;  3C8Y A;  3L10 B;  4OVV A;  3MTN B;  1LXD A;  1XT9 B;  1Z2M A;  1KRH A;  3DHH C;  1GB4 A;  2DBY A;  1WX7 A;  3ZGZ A;  2MBB B;  2GLS A;  2CHZ A;  3W1S C;  2AEH A;  3AEA B;  3H8H A;  3HUI A;  3LXF A;  1WJN A;  2Z0E B;  4HPP A;  1J7A A;  1VD2 A;  1I4H A;  3ZTD A;  1XXG A;  2ZNV C;  2H89 B;  1WI0 A;  4BBN F;  4DXF A;  1QZE A;  3VDZ A;  4TMA B;  3GOE A;  4GLS C;  2O6V A;  2CHX A;  3IAS 1;  4C00 A;  2K22 A;  3JVZ X;  1E8Z A;  1HA5 A;  3GE8 C;  3DHI C;  2KVR A;  4YXD B;  2L83 A;  3WA0 A;  1M4V A;  2KQS A;  1DOY A;  4ACF A;  2I1K A;  4NY0 A;  2KC2 A;  1L4D B;  1JWA D;  1EM7 A;  2Z59 B;  3P4P B;  4F1S A;  3M62 B;  4K3C A;  3RUI B;  2GB1 A;  4PS7 A;  2NS5 A;  3O13 A;  4EEW A;  2FID A;  3AE5 B;  2OJR A;  1CK1 A;  1R4M I;  2PVO D;  1S1Q B;  2IPK D;  2LD9 A;  2NBW B;  2WDV B;  2PKO A;  2PLP A;  4KIK B;  1ROE A;  1E5W A;  3KWV A;  3DBR I;  4EZL A;  2J0M A;  4YTM B;  1QOB A;  4C7Z A;  3H1U A;  4J6I A;  4BFR A;  2WX0 A;  2IJ0 A;  2GRI A;  5EDS A;  4MT5 A;  3QAQ A;  5J2R A;  1Y56 A;  3Q8A A;  1D5M C;  3NUH B;  3QIJ A;  1GTE A;  4II2 B;  4WAF A;  3EEC A;  1WM3 A;  2G1E A;  3DBS A;  4HRO A;  3VXW A;  2RD0 A;  3WCQ A;  2I38 A;  1VR9 A;  4MH0 E;  2ZJD A;  1L0Y B;  3BVG A;  3PHX B;  2WXI A;  1E0Z A;  2OJW A;  3BK1 A;  3RNE C;  2MJ3 A;  4RF0 A;  3T3O A;  4JWS C;  3H7S A;  4ICV A;  3H6N A;  4TQ1 A;  3QC8 B;  1XCT L;  2YEP B;  3R3M A;  4RCO A;  2DZJ A;  1H4R A;  2OED A;  2RSU A;  2D11 A;  3HVD A;  3U4E G;  1RWS A;  2B3A A;  1LQB A;  1RM6 C;  5AUI A;  2FCQ A;  3L16 A;  1V81 A;  2MEK A;  3IVF A;  3ECI A;  3ZIM A;  2PPH A;  2DAF A;  3QX1 A;  4QAY A;  1OTR B;  3ONS A;  1QIL A;  4MJS B;  1VLB A;  3BWU D;  2R2Q A;  1VZ6 A;  3MC8 A;  4MGK E;  2M8S A;  2M1M A;  2GBJ A;  3B9J A;  4AUQ C;  3DBR B;  4DHJ D;  5JZE B;  4BOZ B;  1WSP A;  4FBJ B;  1NI2 A;  2JYE A;  3ZUN A;  4AQ7 A;  2BYV E;  1E7V A;  1YX5 B;  2FCS A;  1WM2 A;  3ZYY X;  2IGH A;  3A9K B;  2MBQ A;  1WX8 A;  4PYZ A;  2LGY A;  4Q2J A;  1N5W A;  2INC C;  4M01 A;  1H7W A;  4LLG M;  4ZDV A;  3AEE B;  1MG4 A;  4GB9 A;  4JGH B;  2IO1 B;  3UIP B;  4YT0 B;  1ET9 A;  1UEL A;  2XK5 B;  4P7I A;  2GBR A;  4K7S A;  1TY2 A;  2NBU A;  2KN5 A;  4JLC A;  3VH4 B;  2VZK B;  1WZ3 A;  3PT2 B;  1EWC A;  2N9X A;  2O6V D;  2J4X A;  3A9K A;  1WXV A;  2WWZ A;  5BO4 B;  4M0W A;  4NJC A;  1SF0 A;  3ALB A;  3PVL A;  2KWU B;  1OQY A;  1I35 A;  3AEG B;  3AE8 B;  4ANV A;  1V2Y A;  2K5P A;  3AU4 A;  4LNI A;  1TY0 A;  2V1Y A;  3TL5 A;  3FIL B;  1V1O A;  3NZ3 A;  3ZNZ B;  4KKJ A;  4BZA A;  4WJN A;  2HE7 A;  1GPX A;  2WU2 B;  3GE3 C;  4IUM B;  4YTP B;  4FJY A;  2KC1 A;  1CMX B;  4AJY B;  2IGD A;  1QT9 A;  1FCL A;  4WWP A;  1LM8 B;  2DYO A;  2JYT A;  2W54 A;  2WXG A;  3LB8 C;  4JWU C;  4IWO A;  1ENF A;  4EOY A;  2KFJ A;  1TGZ B;  1FIQ A;  1TYG B;  1P7E A;  2MBO A;  1NI3 A;  1KTK A;  3RCZ A;  2KYW A;  2WXN A;  1WMH A;  2QEJ C;  1KLV A;  2QIE B;  3HM3 A;  3UI3 A;  2G45 B;  4HK2 A;  2WXO A;  3VFK A;  1WXM A;  4MH8 A;  4ZRK A;  1I4Q A;  1QF6 A;  3IXS A;  3IT6 B;  4DXA B;  3QJZ A;  2KO3 A;  1E8W A;  1FMA D;  2FUH B;  4W9J A;  1GTH A;  3GZN I;  3HK0 A;  2AYO B;  1F2R I;  1WJ6 A;  5BYS A;  1FD6 A;  3EC8 A;  3TEY A;  2RGF A;  4E3C A;  5T8I A;  5J17 A;  3CSF A;  3C0R B;  1WRI A;  2ZVO A;  1F1H A;  4RFB A;  3VR8 B;  4PK1 A;  5HI1 A;  2KWC A;  1WRD B;  4FA6 A;  3MC0 B;  3A4S C;  2KAN A;  3K9O B;  4JL9 A;  4LK0 M;  4CO7 A;  4NJ7 A;  4MEM A;  2BW2 A;  2W82 A;  2WQY B;  4C7Y A;  2H88 B;  4A3O A;  1V5T A;  1UZX B;  2BPS A;  3L17 A;  1UF0 A;  3AB5 A;  2QDF A;  2AQ2 B;  1UUP A;  3DOW A;  2HD5 B;  1KLG D;  3H9D A;  2PE6 B;  2WYQ A;  4LJO B;  2I1J A;  2UU7 A;  2KLG A;  2Y5C A;  3PZD A;  3OJ3 A;  2DEN B;  2KJH B;  1TKE A;  1L2N A;  2I2Y A;  2X8X X;  1YN5 A;  4KVG B;  2INN E;  3V6C B;  4YSZ B;  1FXT B;  5IO9 A;  1HTQ A;  1NEN B;  2KNB A;  1GC7 A;  3W5U B;  1HXY D;  2LJI A;  3B08 A;  1HEZ E;  3NRZ A;  3LJ3 A;  4PT5 A;  2G3Q B;  2N9L A;  1I4R A;  5MPO A;  4LNO A;  4HDO A;  1HTO A;  4A55 A;  1WJ4 A;  4WAA A;  3VH3 B;  2TSS A;  1XD3 B;  2LXA A;  3ML8 A;  2LJ5 A;  3DBH I;  3NVZ A;  2FUG 1;  4ZHP A;  2W3R A;  3WAO A;  2DNF A;  2WU5 B;  2NBV B;  3WAL A;  3SD5 A;  2OHF A;  4RGO S;  4WQO B;  4BKT A;  1MHX A;  2BT6 A;  1VZ8 A;  3AU5 A;  3A9J A;  4AP4 C;  3CMM B;  3EHV A;  1YX6 B;  2L1A A;  3FAH A;  2GI9 A;  3D32 A;  4DK5 A;  3IT4 B;  2K9X A;  4B9K A;  4HCP B;  1KLU D;  1P9D U;  4RF1 A;  3KW5 B;  1UGJ A;  3ZKJ C;  1ZDX A;  5IN7 A;  3B0A A;  2PEA A;  4RNA A;  5IKC M;  4IM2 A;  2MCN B;  1Z5S B;  5EE9 A;  4K7U A;  2G4D B;  2JUO A;  3U8Z A;  2R61 A;  3RNC C;  3Q3O C;  1WWT A;  3AV8 A;  1YNT E;  2QHO A;  3QWZ B;  4GDK A;  3TEW A;  2JRH A;  2PIA A;  5G5G A;  3AE9 B;  1WE7 A;  3GP7 A;  1WF9 A;  3ML9 A;  4CYE A;  2LI5 A;  2FIF A;  2PTL A;  1CQV A;  2JWU A;  3PLV A;  3ZJV A;  2K8B A;  1EUV B;  5DPT A;  4WJQ A;  1SJH D;  4W9H A;  3ZRC A;  3CIR B;  3ZO5 B;  1K8R B;  2LGD A;  3A33 B;  3EFU A;  1GG3 A;  1WMH B;  1RAX A;  3QK0 A;  1VDV A;  1F52 A;  3DDC B;  3DBL B;  3N9Y C;  2QC8 A;  1ZXH A;  1VCB A;  2KN4 A;  4LNN A;  1WH3 A;  4OVU A;  2WDQ B;  4HEA 1;  4XGA B;  5L95 C;  2LXC A;  3PO0 A;  3APC A;  4BKS A;  1V97 A;  5HKH A;  4BKS D;  5EE0 A;  5KHO A;  1J0G A;  1D4B A;  1J7C A;  2MHJ A;  2KWV B;  5FKA C;  2ZPY A;  2LVP A;  4KIK A;  2RDH A;  3T9L A;  2BYE A;  4W9E A;  2BF8 B;  1T0S C;  2GMI C;  3M63 B;  2JVC A;  2M4N A;  4IKG A;  2D3B A;  4CHK A;  3IAM 1;  4AOF A;  3KYC D;  1D3Z A;  1RFK A;  2LGI A;  5DCN A;  4WWM A;  1C9F A;  3DWG C;  3ENE A;  4FJZ A;  4NQL B;  1J7B A;  4IM0 A;  1GAQ B;  2XK5 A;  1QKZ A;  1HZ6 A;  2L32 A;  3AEB B;  2BB6 A;  2VH2 A;  2FAZ A;  3KUD B;  1FCC C;  1HQR D;  3BIN A;  1SIF A;  3KYD D;  4EZJ A;  4DWF A;  1BUI C;  1WGK A;  1KH0 A;  3GS2 A;  2ZW1 A;  1Q5W B;  5FR3 A;  1MI0 A;  4XC2 A;  4KGS A;  3EGR A;  1E7U A;  2KWD A;  1C4P A;  3V3X A;  2N7D A;  3Q8C A;  2L8J A;  4P16 A;  1D5X C;  1A70 A;  3L4P A;  3APF A;  2DYB A;  5D2M B;  1E8Y A;  2KDB A;  4M02 A;  2BS3 B;  1XQQ A;  1WYW B;  2GBM A;  2WXM A;  3ZVV A;  2PMV A;  3Q3M C;  3SR6 A;  3Q3N C;  3JSV A;  3I3T B;  1FO4 A;  3RT3 B;  2CU1 A;  3NS8 A;  4PS3 A;  1E90 A;  2V4I B;  4DDG D;  3R66 C;  3MC9 A;  2GOW A;  2AL6 A;  2KMM A;  3AM9 A;  1T3Q A;  5IA7 A;  1AAR A;  2C7M B;  3S2A A;  3UF8 A;  1SEB D;  1V80 A;  4G11 A;  3N32 A;  1FRR A;  3UIO B;  2LHE A;  5H8Y E;  3ZDT A;  3RN9 C;  1STE A;  2JSV X;  2ON8 A;  2DHZ A;  3V6E B;  1HE8 A;  2CS4 A;  2JZZ A;  2WXL A;  1TKY A;  1E9M A;  4LNF A;  1ESF A;  2K8H A;  2ZZP B;  2N1V A;  3PRE A;  1TZO A;  4KKI A;  2BVC A;  4L23 A;  2LFI A;  1N60 A;  4GDL B;  3QHT A;  4WH4 A;  2E6X A;  1C78 A;  2N7J A;  2B76 B;  1MFW A;  1PYW D;  2K8C A;  5E6O A;  4D2K A;  4S17 A;  3PZ8 A;  4OVZ A;  1T6B X;  2KKC A;  1TIF A;  1CJE A;  2XBB C;  4XWW A;  4DQO C;  2JXX A;  3N1Z C;  1VRA B;  2J53 A;  2KAC A;  1ZPS A;  3SHQ A;  1YN3 A;  2LGX A;  1NYQ A;  3ZNH B;  3VUY A;  4HCN B;  1P1A A;  1F9J A;  2BYF A;  2WXH A;  3Q14 C;  1C4A A;  1FNU A;  3VHT C;  3TSS A;  2KT7 A;  2V3P A;  3OAW A;  4CQN A;  3N1Y C;  1WXS A;  3RNF C;  3I63 C;  5JHB A;  4RM9 A;  3M95 A;  4M00 A;  1YQ3 B;  1KM7 A;  1OFF A;  1NVI D;  3PSE B;  1SE2 A;  1L5P A;  3AEC B;  3Q6B A;  1K51 A;  2WXK A;  4GXB A;  2VRR B;  1L6U A;  1SBB B;  2KFK B;  4KSL C;  2BGF A;  4MM3 B;  4MAC A;  3U2S C;  1XCQ L;  5BYQ A;  1WGH A;  2J52 A;  1KFY B;  1JRO A;  4MJS A;  4PYU A;  3GB1 A;  2QCZ A;  5LLI A;  3DBL I;  4HJK A;  1A5R A;  5AUK A;  2KOX A;  3PZ7 A;  1PGB A;  4ARI A;  4HJG E;  1UD7 A;  4ZHO A;  4TSS A;  1FNW A;  2J42 A;  3HVZ A;  2LVO A;  3K9P B;  2XN9 C;  3PHW B;  1AWD A;  1SJE D;  4WWN A;  1Y8R C;  4HVB A;  2O2V B;  2KQ4 X;  3WIM A;  3BYT B;  1PGA A;  4EE2 A;  2N0S B;  2EMS A;  5AEK B;  2ZVN A;  4MGI E;  3KLS X;  1EF5 A;  2JT4 B;  2WDT B;  4EKU A;  3NVV A;  2AQ3 B;  3RNG C;  5BMH A;  5L83 A;  4KDI C;  1ZXI A;  2A4Z A;  2W55 A;  2MA9 B;  2LRW A;  3PS6 A;  1SE3 A;  3AMZ A;  4A6Q A;  2KJ6 A;  2RDG A;  2NMQ A;  1TS3 A;  2K25 A;  4ITK A;  1F0Z A;  2ASQ A;  1N6Z A;  3UQA A;  3X23 A;  2AL3 A;  1WR6 E;  4YTN B;  3BK2 A;  4XDC A;  2WP9 B;  4WJO A;  1JWB D;  4KV2 A;  2KTR B;  4B6W A;  3WAP A;  2JZP A;  1NYR A;  2MP2 B;  4LDT D;  2J0K A;  5AZG A;  1GOZ A;  1UBI A;  2EMT A;  4XWT A;  1B1Z A;  2C7H A;  4XDD A;  2K1F A;  1MVK A;  4X57 B;  3RI7 C;  3T8M A;  3BYY B;  3PV1 A;  4KSK C;  3ABV B;  2MRP A;  1ZUD 2;  4UDU C;  3ZDM C;  4NAW B;  2BQQ A;  4IOI E;  1QLB B;  4REZ A;  2Q5W D;  4MDK E;  5C1Z A;  1V8C A;  1ZDV A;  3AE4 B;  4US9 A;  1SE4 A;  1F77 A;  3P63 A;  3FKY A;  3C19 A;  5CHF A;  3R2T A;  3ZTC A;  1VJK A;  2WXR A;  4A9A A;  5CHW A;  4IWQ A;  4EFO A;  2QMT A;  3AUL A;  3OWE B;  4M8M A;  1ZOY B;  4TUU A;  5BYR A;  3AE7 B;  3NOB A;  1ACC A;  2W9N A;  4BBN C;  4B0E A;  3NVY A;  1J19 A;  3RUL A;  1P98 A;  4FUL A;  3W5V B;  4R3D A;  1XLQ A;  1DGJ A;  3MP9 A;  4TV3 A;  1J8C A;  5EE3 A;  1UWX A;  2RR9 A;  3Q3J A;  2LZ6 A;  2PJH A;  4W9D A;  1EO6 A;  1YQB A;  4A8X C;  2PW9 A;  4GOC A;  2A5U A;  3VR9 B;  2C60 A;  3R2I A;  2AQ1 B;  3PRZ A;  1JML A;  3APD A;  5HHD G;  1C4C A;  2FCN A;  3I5J C;  2ZNV B;  4ZRQ A;  4M0W B;  1I42 A;  4HPM B;  2JY6 A;  1JWS D;  2G4S A;  4YSY B;  2N1W A;  1E6E B;  3N20 C;  2REX A;  2IO3 B;  2KX0 A;  4JE3 B;  1PGX A;  4JX1 C;  3JSV B;  3QA8 A;  2M0A A;  2GBK A;  4WJP A;  1OEY A;  2L05 A;  1GC6 A;  4BVU C;  2D10 A;  1WXA A;  4NNJ B;  4AS1 A;  4YWG G;  4BOS C;  3VRA B;  1OQR A;  1JRP A;  3AE2 B;  5CHV C;  1R4N B;  4ZYS A;  3SDL C;  1P7F A;  2NPT B;  4TKN A;  2RDB C;  4DHZ E;  1V5O A;  1C79 A;  4EZK A;  1Q1O A;  1WIA A;  4GSW A;  1RRB A;  1FXA A;  3P4R B;  3DVG X;  2WGS A;  3AEF B;  2KK8 A;  1IP9 A;  5D3I B;  2N4F A;  3NY5 A;  2IYD B;  3VUX A;  4ANX A;  1UH6 A;  2HTM E;  2LUM A;  4N9F 4;  1ISN A;  1IBX A;  1SIJ A;  4HPL B;  2RPV A;  4I6L B;  3UQB A;  1RYJ A;  3NZU A;  1UBQ A;  4USA A;  2NTS A;  3IBE A;  5G5H A;  3OG5 A;  4C56 C;  1K52 A;  2HTH A;  2JWZ A;  1YJJ A;  3V62 A;  5LXH A;  2LHD A;  3QAR A;  2LEK A;  2BWF A;  5IAA C;  2ZCC A;  4KDL B;  1BXT A;  4LCD E;  2Y3A A;  1WR1 A;  4A90 A;  2JU6 X;  4P6V F;  4FXC A;  4L2Y A;  3R8B A;  2MBH A;  1FRD A;  3NHE B;  3NVW A;  3TEZ A;  5EE1 A;  5E6J A;  4OZC A;  2KD0 A;  5JHA A;  2DYM A;  4RGN A;  4NQK E;  1U4A A;  5HFY A;  3PGE A;  2KDF B;  2O6V B;  2WXJ A;  3A9J B;  4B95 A;  3DVN U;  3QCA A;  3NS1 A;  4K1R B;  2MBE A;  2HJ8 A;  1XLO A;  1V86 A;  3RNA C;  3J9C A;  1N5X A;  3IHP C;  3AH7 A;  3MFG A;  4G50 A;  1N61 A;  2IY1 B;  4MM3 A;  3VTW A;  5JXV A;  4HKZ E;  1LFD A;  3R7R A;  1IGC A;  4NPN A;  4KZ0 A;  4II3 B;  1GUA B;  2KAJ A;  1CZP A;  1RFA A;  2D5G A;  3P4Q B;  1L0V B;  2CJO A;  4YSX B;  2KLC A;  2QJL A;  1GNU A;  2SEB D;  4F8C B;  3AED B;  2JZ3 B;  2MWS B;  4NAW A;  3CWI A;  1C77 A;  3ZRF A;  5DPR A;  5D94 A;  4GN1 A;  1L6V A;  2PVG C;  2YVC A;  1LO5 D;  4HDQ A;  2L00 B;  3ZJU A;  4DBG A;  1FFV A;  3Q2A C;  1H7X A;  4DHZ B;  1UNS A;  4W9F A;  2NTT A;  4F7Z A;  4P1C C;  1SE9 A;  2K3U A;  1LGR A;  3I57 A;  4WIP A;  2DLB A;  5G55 A;  5DPW A;  2KMC A;  2PE9 A;  4ARC A;  2KMA A;  1R4N I;  1M94 A;  3L54 A;  2NCN A;  3RPF C;  3EUB 2;  1QOF A;  4I6P A;  1E10 A;  1L7Y A;  2KHW B;  1I7H A;  3TUO A;  4YL8 A;  3B2G A;  4IW0 A;  3M3J A;  1ZGU B;  2WXQ A;  2MX2 A;  4W9G A;  3WAM A;  5AZH A;  2HDE A;  1TKG A;  2XNA C;  4BKG A;  3RNB C;  1JWU D;  3VTU A;  4O1N A;  3V61 A;  4AWJ A;  1NDD A;  1T5X D;  3NJT A;  3AE1 B;  2L7R A;  4HRS A;  3Q8F A;  4K7W A;  1FPY A;  1EWY C;  2KJR A;  4XE0 A;  3Q8B A;  5DPS A;  3HIZ A;  4FLH A;  3BII D;  4ZRP A;  1XLN A;  2IO2 B;  3HM6 X;  1JCK B;  3L08 A;  2VZK D;  2C7N B;  3E9S A;  4IM3 A;  2GBN A;  2DZK A;  3PRM B;  3RMK C;  5I4D A;  2N9E B;  4ICU A;  1PDX A;  3LDZ E;  3ETR A;  1DOX A;  1Q10 A;  3P42 A;  4A3P A;  3W1S A;  2NVU I;  3JYU A;  2BKR B;  2WXF A;  2YLM A;  2LUE A;  5IOI A;  1YIW A;  3ZLZ A;  2BS2 B;  3BVZ A;  2RMM A;  1FFU A;  1XEE A;  5JH5 C;  2QIL A;  3CF6 E;  3KVF B;  2AX5 A;  1YQ4 B;  1MG8 A;  1TS5 A;  1WYG A;  2EEL A;  2V9H A;  2BS4 B;  1NEK B;  1SB3 C;  3VRB B;  3ZNI D;  4KGT A;  3L0W B;  5J18 A;  3KUZ A;  3A1Q B;  2L0F A;  1KOT A;  4DDI D;  2MJD A;  1V1P A;  2IGG A;  4B0M A;  2IBI B;  4H2A A;  1R7S A;  2MSE D;  4RGM A;  4N6E B;  2KFK A;  2WLB A;  2BTE A;  3U52 E;  3ZJT A;  2INP E;  4MGZ E;  3TCA A;  1D6E C;  2LVQ A;  3DVN V;  2LWP A;  2L0T A;  3ZQ4 A;  1T0R C;  4IG7 B;  3AN1 A;  1BT0 A;  2LAS A;  3AI5 A;  3AXC A;  2CJN A;  4MGY E;  4S0R A;  1MPE A;  1SGH A;  3ZXR A;  3W9C B;  1GJZ A;  2LGS A;  2MJE A;  3A4R A;  2DX5 B;  3TMP B;  2IY0 B;  1FNV A;  4IDI A;  5TSS A;  2JQR B;  3PRP B;  1P0R A;  2D3C A;  2BBC A;  4WWO A;  4OZB A;  1EF1 A;  2L3Z A;  2IND C;  3PTF C;  1WY8 A;  1TS2 A;  2L52 A;  2EKE C;  4KGR A;  1WGR A;  4ZYN A;  3V05 A;  2VH1 A;  2KTR A;  2J0J A;  3RD2 A;  1ZP0 B;  1X1M A;  2MP2 A;  1YD8 U;  3VTV A;  2Z8L A;  5H92 C;  2L76 A;  1ET6 A;  4MSQ B;  1K53 A;  3O65 B;  2CU3 A;  1WE6 A;  4IWP A;  1TS4 A;  4E74 A;  1JAL A;  3E56 A;  2NPT A;  1YOV B;  2JF5 A;  3DQV A;  3UIN B;  1PFD A;  1XO3 A;  4FHK A;  2IO0 B;  1HZ5 A;  4JQW C;  1QOA A;  1TTN A;  1I4X A;  2WDR B;  1JWM D;  4LTU A;  2FCM A;  5E6N A;  2Y5B B;  1P3Q U;  1MJD A;  1YN4 A;  3VUW A;  2ZEQ A;  1TJE A;  2D3G A;  3IFW B;  4LDT B;  1C3T A;  4E71 A;  2M0X A;  2CHW A;  4ASW C;  4L1B A;  2NR2 A;  3KQ4 A;  3DVG Y;  3DCG A;  1YMH E;  3RFZ B;  4GMV A;  4FN2 A;  4HWI B;  3H7P B;  2RPQ A;  3RYT A;  2V3S A;  3X0W A;  1G6J A;  4OW0 A;  4MSM B;  1GT8 A;  1WGG A;  3HRD D;  4GIV A;  1R4M B;  1UGM A;  1S3S G;  5C23 A;  4C4V B;  2QSD A;  2CKH B;  1T0Y A;  3A1Q A;  4LJP B;  4TQ0 A;  3UGB B;  4FJV B;  1QOG A;  1WXQ A;  1WZ0 A;  5LNK 1;  2KTF A;  1N63 A;  2XEW A;  1KJT A;  1RLF A;  2Y5P A;  3Q3F A;  1JQ4 A;  1TT5 B;  1JW9 D;  3FIL A;  1EU4 A;  4LNK A;  4HLE A;  4ZRI A;  3NG0 A;  5TR5 A;  4RGT A;  2V3N A;  4PS8 A;  1JRU A;  1KF6 B;  4EUT A;  2FNJ B;  4NZL B;  1WFY A;  1C76 A;  4P1B C;  2LMC A;  1C1Y B;  5LXI B;  4C80 A;  4RH6 A;  1SXT A;  2KDI A;  1BML C;  2JRI B;  3PPA A;  4GDK B;  3ZXV A;  4G3X B;  3B2F A;  4BAX A;  2KX3 A;  1E7P B;  2C9W B;  2KXJ A;  1WX9 A;  5C2T B;  3GZN B;  3H7P A;  4GGQ A;  1NBF C;  4M8N A;  1PUT A;  3N3K B;  1QQR A;  5AZF A;  1IBX B;  3TIX A;  5GXG B;  5GMV A;  1IGD A;  2K6D B;  2UWQ A;  3OLM D;  1FM0 D;  3B1L X;  3RZF A;  4FAD A;  3CF4 A;  2DZM A;  2D07 B;  5D3D A;  1ZE3 D;  1F2R C;  2SAK A;  5G2N A;  1IUE A;  3VAW A;  3SU8 X;  3DBH B;  1WGD A;  4I6N B;  1V49 A;  1TZ1 A;  2R2O A;  3CST A;  1UWM A;  2G9H D;  5FR6 A;  2MLB A;  4RM8 A;  3KUC B;  1V6E A;  2N9K A;  4JPS A;  1AN8 A;  1Q0W B;  4C4V A;  3MHZ A;  1DYQ A;  3AE3 B;  2WXP A;  1SSN A;  4WQM A;  3TEX A;  4AJW A;  4XX5 A;  4XYC A;  4J3O D;  3QQ8 B;  3P4S B;  1V9J A;  3P2B A;  1WJU A;  3NZS A;  2LRU A;  3VQI A;  3SFE B;  5KHQ A;  4NJ6 A; 
#chains in the Genus database with same CATH homology
 2K5P A;  1TY0 A;  2LFI A;  3FIL B;  1V1O A;  3NZ3 A;  4WUR A;  2D5G A;  3P4Q B;  3I9V 1;  4KKJ A;  1N60 A;  3FC4 A;  4GDL B;  1L0V B;  2CJO A;  3Q69 A;  4YSX B;  4WH4 A;  2QJL A;  2SEB D;  2E6X A;  1GPX A;  2WU2 B;  3AED B;  1C78 A;  2N7J A;  3CWI A;  1C77 A;  4YTP B;  2B76 B;  4DXG A;  1PYW D;  1L6V A;  2PVG C;  1B9R A;  2IGD A;  1QT9 A;  1FCL A;  1LO5 D;  4D2K A;  2DYO A;  2JYT A;  3ZJU A;  2W54 A;  3PZ8 A;  1K50 A;  4OVZ A;  1FFV A;  1T6B X;  2WXG A;  1H7X A;  1UNS A;  3LB8 C;  1AW7 A;  1CJE A;  1ENF A;  2NTT A;  4JWU C;  1FIQ A;  2K3U A;  4XWW A;  4DQO C;  2E3T A;  1TYG B;  1P7E A;  1VRA B;  3I57 A;  4WIP A;  2WS3 B;  1NI3 A;  2DLB A;  2J53 A;  3BVM A;  2KAC A;  4HKQ A;  1ZPS A;  3KWL A;  2ACZ B;  1KTK A;  4ARC A;  1YN3 A;  1NYQ A;  2WXN A;  2QEJ C;  1V1P B;  2QIE B;  3RPF C;  3EUB 2;  3UI3 A;  1QOF A;  2WXH A;  3P1M A;  1E10 A;  3U7Z A;  1C4A A;  2WXO A;  1AYF A;  1I7H A;  2V0G A;  1FNU A;  3TSS A;  2V3P A;  4CQN A;  3TUO A;  3B2G A;  4US8 A;  3URY A;  4MH8 A;  2YEP F;  2WXQ A;  1I4Q A;  1YQ3 B;  1QF6 A;  1I4P A;  1OFF A;  1NVI D;  3IT6 B;  3IXS A;  2HDE A;  1TKG A;  2XNA C;  1SE2 A;  1FMA D;  3BZD B;  5BMG A;  2FE8 A;  1GTH A;  1JWU D;  4O1N A;  1L5P A;  3AEC B;  1F2R I;  1K51 A;  2WXK A;  5BYS A;  1FD6 A;  5FK9 C;  3TEY A;  1L6U A;  5T8I A;  1SBB B;  1L4Z B;  1FXI A;  3SFD B;  1WRI A;  1T5X D;  4MAC A;  4MM3 B;  3AE1 B;  4RFB A;  3VR8 B;  3SEB A;  3U2S C;  1XCQ L;  4HRS A;  5BYQ A;  5HI1 A;  3Q8F A;  2J52 A;  1KFY B;  1EWY C;  4XE0 A;  3Q8B A;  1JRO A;  3MC0 B;  5HG2 A;  3GB1 A;  1D5Z C;  3EA6 A;  1OQQ A;  2K0P A;  1XF5 L;  3BII D;  4LK0 M;  4ZRP A;  1FEH A;  5AUK A;  1EU3 A;  1N62 A;  1XLN A;  3PZ7 A;  4OHJ A;  1PGB A;  4ARI A;  5BMI A;  4HJG E;  2BW2 A;  4ZHO A;  2W82 A;  4TSS A;  1FNW A;  2J42 A;  1JCK B;  2WQY B;  3HVZ A;  4C7Y A;  2VZK D;  2XN9 C;  2H88 B;  4N59 A;  1AWD A;  2X38 A;  1SJE D;  3E9S A;  4KX6 B;  5I4D A;  3AB5 A;  4N58 A;  2KQ4 X;  2AQ2 B;  1PDX A;  1DOX A;  3ETR A;  1I4G A;  1Q10 A;  1UUP A;  3BYT B;  3P42 A;  5C3J B;  1PGA A;  2KDM A;  4EE2 A;  1KLG D;  3W1S A;  2N0S B;  2M56 B;  2WXF A;  2EKI A;  2BB5 A;  2MH7 A;  3KLS X;  2BS2 B;  3BVZ A;  2Y5C A;  2RMM A;  1FFU A;  1XEE A;  1TKE A;  3NVV A;  2QIL A;  2ONQ A;  2I2Y A;  3MJ5 A;  2AQ3 B;  1YN5 A;  5BMH A;  2IDY A;  2AX5 A;  2INN E;  4YSZ B;  1YQ4 B;  1TS5 A;  1NEN B;  1WYG A;  2EEL A;  4NAM A;  1ZXI A;  3W5U B;  2BS4 B;  2W55 A;  1NEK B;  1HXY D;  3VRB B;  1SB3 C;  4KGT A;  2M19 A;  2LJI A;  1SE3 A;  1HEZ E;  3NRZ A;  3AMZ A;  4A6Q A;  2RDG A;  2FBW B;  4PT5 A;  1GB1 A;  2MJD A;  2N9L A;  2NMQ A;  1TS3 A;  1V1P A;  1VZ7 A;  4ITK A;  1I4R A;  1XLP A;  2IGG A;  4B0M A;  1YJI A;  5MPO A;  1F0Z A;  3DWM A;  4H2A A;  1R7S A;  4RGM A;  4ZOH C;  4N6E B;  2WLB A;  2BTE A;  3U52 E;  1MHH E;  2WNM A;  3ZJT A;  4A55 A;  2INP E;  1D6E C;  2ZW0 A;  3ZQ4 A;  5D7G A;  4OZA A;  4YTN B;  3BK2 A;  2TSS A;  4XDC A;  2WP9 B;  2BYT A;  3AN1 A;  3NVZ A;  3LYY A;  1JWB D;  2DWQ A;  2FUG 1;  3Q8E A;  4ZHP A;  3AE6 B;  2W3R A;  2CJN A;  2WU5 B;  2JZP A;  2OHF A;  1NYR A;  1DOI A;  2W3S A;  4RGO S;  3W2D A;  1MPE A;  2ICI A;  2JX5 A;  2JXT A;  3T3N A;  1MHX A;  3W9C B;  1L0X B;  2BT6 A;  1VZ8 A;  1GOZ A;  2MJE A;  4XWT A;  3C8Y A;  1B1Z A;  2L1A A;  3FAH A;  1FNV A;  4IDI A;  4XDD A;  2GI9 A;  5TSS A;  2JQR B;  1MVK A;  3IT4 B;  2K9X A;  3BYY B;  3ABV B;  1ZUD 2;  2BBC A;  4UDU C;  1KLU D;  4RF1 A;  1KRH A;  1UGJ A;  1ZDX A;  4NAW B;  4OZB A;  1GB4 A;  2DBY A;  4IOI E;  4RNA A;  1QLB B;  3ZGZ A;  1TS2 A;  2L52 A;  3AEA B;  4REZ A;  3H8H A;  3HUI A;  3LXF A;  4KGR A;  2Q5W D;  1J7A A;  1V8C A;  1ZDV A;  3V05 A;  3AE4 B;  1I4H A;  4US9 A;  1SE4 A;  1XXG A;  1F77 A;  2H89 B;  3P63 A;  4DXF A;  1ZP0 B;  5EE9 A;  3R2T A;  2Z8L A;  4TMA B;  4GLS C;  5H92 C;  1VJK A;  2R61 A;  2WXR A;  4A9A A;  1ET6 A;  1WWT A;  3AV8 A;  1YNT E;  2QMT A;  3IAS 1;  1K53 A;  2K22 A;  3OWE B;  2CU3 A;  3TEW A;  1HA5 A;  1TS4 A;  1ZOY B;  1JAL A;  2PIA A;  5G5G A;  3E56 A;  5BYR A;  3AE7 B;  3AE9 B;  2L83 A;  4YXD B;  3GP7 A;  1M4V A;  1ACC A;  1DOY A;  4B0E A;  1PFD A;  3NVY A;  1L4D B;  2PTL A;  3W5V B;  1CQV A;  1XO3 A;  4R3D A;  1XLQ A;  1JWA D;  1HZ5 A;  2JWU A;  3ZJV A;  1QOA A;  1DGJ A;  1EM7 A;  3P4P B;  1I4X A;  2WDR B;  1SJH D;  3MP9 A;  1JWM D;  5EE3 A;  3CIR B;  4LTU A;  1UWX A;  2GB1 A;  3O13 A;  1VDV A;  1YN4 A;  3N9Y C;  3AE5 B;  4A8X C;  1CK1 A;  1TJE A;  1ZXH A;  2PW9 A;  2PVO D;  3VR9 B;  3R2I A;  2KN4 A;  2AQ1 B;  2IPK D;  4L1B A;  1JML A;  3KQ4 A;  5HHD G;  2WDQ B;  2WDV B;  4HEA 1;  1C4C A;  2PKO A;  2PLP A;  1YMH E;  3RFZ B;  3PO0 A;  1ROE A;  3KWV A;  4ZRQ A;  1V97 A;  5EE0 A;  1D4B A;  4YTM B;  1QOB A;  4C7Z A;  1J7C A;  1JWS D;  4YSY B;  5FKA C;  1E6E B;  4OW0 A;  1GT8 A;  3HRD D;  2IJ0 A;  2RDH A;  4JE3 B;  1PGX A;  2GRI A;  4JX1 C;  4MT5 A;  2QSD A;  2M0A A;  1Y56 A;  3Q8A A;  4TQ0 A;  1D5M C;  3NUH B;  4IKG A;  1QOG A;  1WXQ A;  1GTE A;  5LNK 1;  1N63 A;  4WAF A;  3IAM 1;  4AS1 A;  1RFK A;  4YWG G;  2LGI A;  2G1E A;  4WWM A;  2Y5P A;  4HRO A;  1C9F A;  3WCQ A;  2I38 A;  3DWG C;  1VR9 A;  3VRA B;  1OQR A;  1J7B A;  1JRP A;  3AE2 B;  1GAQ B;  1JQ4 A;  1JW9 D;  3FIL A;  1QKZ A;  1EU4 A;  4ZYS A;  1HZ6 A;  1L0Y B;  2L32 A;  3BVG A;  3AEB B;  4RGT A;  2V3N A;  2BB6 A;  1P7F A;  2WXI A;  1E0Z A;  3BK1 A;  1KF6 B;  1FCC C;  1HQR D;  1C79 A;  2MJ3 A;  4NZL B;  1C76 A;  4RF0 A;  3T3O A;  2LMC A;  4JWS C;  1BUI C;  4C80 A;  1WGK A;  4RH6 A;  1FXA A;  1SXT A;  1KH0 A;  3GS2 A;  4TQ1 A;  3P4R B;  1BML C;  2ZW1 A;  1XCT L;  2YEP B;  4GDK B;  5FR3 A;  1MI0 A;  4RCO A;  3AEF B;  2OED A;  4KGS A;  3B2F A;  3EGR A;  1E7P B;  3HVD A;  3U4E G;  1RWS A;  5D3I B;  1RM6 C;  2KWD A;  5AUI A;  5C2T B;  1C4P A;  3V3X A;  2MEK A;  3Q8C A;  2HTM E;  2LUM A;  1PUT A;  1IBX A;  1SIJ A;  4P16 A;  1QQR A;  1IBX B;  2RPV A;  1D5X C;  5GXG B;  1A70 A;  3L4P A;  1QIL A;  1RYJ A;  1VLB A;  4USA A;  3BWU D;  2BS3 B;  1IGD A;  1VZ6 A;  2NTS A;  5G5H A;  4C56 C;  1K52 A;  1FM0 D;  1YJJ A;  3CF4 A;  3B9J A;  2LHD A;  5D3D A;  1ZE3 D;  1F2R C;  2LEK A;  2WXM A;  2SAK A;  2PMV A;  1WSP A;  1IUE A;  3SR6 A;  2JYE A;  4AQ7 A;  1FO4 A;  1BXT A;  2V4I B;  2Y3A A;  3ZYY X;  4A90 A;  1UWM A;  2G9H D;  2JU6 X;  2KMM A;  3AM9 A;  1T3Q A;  4P6V F;  2IGH A;  4FXC A;  4L2Y A;  3R8B A;  1FRD A;  3NVW A;  3TEZ A;  5EE1 A;  5E6J A;  4OZC A;  4Q2J A;  2DYM A;  1N5W A;  4RGN A;  1H7W A;  4LLG M;  1SEB D;  3AEE B;  2N9K A;  4JPS A;  5HFY A;  1FRR A;  4YT0 B;  1AN8 A;  1ET9 A;  2LHE A;  2WXJ A;  5H8Y E;  1TY2 A;  3MHZ A;  3NS1 A;  1DYQ A;  3AE3 B;  1STE A;  1SSN A;  2JSV X;  2ON8 A;  2WXP A;  4WQM A;  3TEX A;  1XLO A;  2VZK B;  1EWC A;  3J9C A;  2J4X A;  4J3O D;  1N5X A;  3P4S B;  2WXL A;  4M0W A;  3AH7 A;  1TKY A;  1E9M A;  3MFG A;  1N61 A;  4NJC A;  5JXV A;  1SF0 A;  4HKZ E;  1IGC A;  1ESF A;  3VQI A;  3AEG B;  1TZO A;  3SFE B;  4KKI A;  3AE8 B;  2KAJ A;  1CZP A;  4L23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...