1J7CA

Structure of the anabaena ferredoxin mutant e95k
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEKDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN I
publication title Structure-function relationships in Anabaena ferredoxin: correlations between X-ray crystal structures, reduction potentials, and rate constants of electron transfer to ferredoxin:NADP+ reductase for site-specific ferredoxin mutants.
pubmed doi rcsb
source organism Nostoc sp. pcc
total genus 25
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1j7cA00
3ETRA 1OQRA 3AE1B 3AEFB 2WDVB 4IDIA 4WWMA 1ZXIA 5AUKA 1VJKA 4FXCA 2MJDA 5EE0A 3VRBB 1T3QA 2W3RA 1L6VA 1DOIA 1NI3A 1PDXA 1YQ3B 2WLBA 1GAQB 3AE7B 2M19A 3AMZA 2PVGC 1JRPA 3FAHA 3ABVB 5H8YE 1WGKA 1DOYA 4C80A 1ZOYB 3SR6A 2H88B 2WQYB 2K9XA 1IUEA 5MPOA 1DGJA 1KF6B 1N63A 2K22A 3B9JA 1RM6C 3EUB2 3L4PA 2MJEA 3AE8B 3NS1A 4WQMA 1AYFA 4YTMB 1XLOA 2H89B 3AEBB 3NRZA 2CU3A 1E10A 3BIID 3NVZA 1GPXA 1FXIA 1XLNA 1VLBA 3HVZA 3RPFC 1OQQA 2MH7A 5C3JB 1XO3A 2AX5A 2QJLA 4JX1C 4YTNB 2CJNA 1QLBB 2WP9B 1JROA 4YSYB 2L52A 3AN1A 2EKIA 1SIJA 2PVOD 2QIEB 2WDRB 1N5WA 3B2GA 3HUIA 4US9A 4A9AA 1J7BA 1R7SA 1E9MA 2LEKA 3P4RB 5EE9A 2KMMA 1YQ4B 2JX5A 2G1EA 2WS3B 1ZP0B 3P1MA 4P6VF 5GXGB 4YSZB 1FO4A 1KRHA 4C7ZA 3VR9B 3ZYYX 1A70A 1JQ4A 1L0VB 3FC4A 1RFKA 2OHFA 1JALA 3NVVA 3NVWA 1ZUD2 1FXAA 3AV8A 1V97A 1FM0D 3P4SB 5EE1A 1F0ZA 1DOXA 1QOBA 3LB8C 1TKYA 1E7PB 1ROEA 4YTPB 3W9CB 2ACZB 4N6EB 1FFVA 3AE5B 1JWAD 1UWMA 2PIAA 3LXFA 4KX6B 1YJIA 3AECB 2FBWB 1NYQA 1WRIA 5G5GA 3AE3B 1TJEA 1QOGA 1FRDA 3P4QB 1KFYB 2L83A 4ZHPA 3B2FA 3AE4B 2KAJA 1B9RA 4HROA 1NYRA 1QOAA 1WWTA 2WDQB 2MJ3A 1SB3C 3SFEB 1RWSA 3P4PB 3CIRB 4HRSA 1QOFA 3AM9A 5EE3A 3AE6B 3VRAB 1YJJA 3AE9B 4N59A 1PFDA 1N5XA 2E3TA 2PKOA 2WU2B 3AEGB 4ITKA 4JWSC 4US8A 2K5PA 2W55A 1L5PA 3W5VB 1WYGA 4ZOHC 1JWBD 2DBYA 3P63A 2Y5CA 1J7AA 4N58A 1FFUA 3AH7A 1CJEA 3AEEB 1I7HA 1JW9D 1OFFA 1QT9A 5H92C 1VDVA 4YT0B 1EWYC 4ZHOA 1TYGB 2JQRB 1E6EB 1XLPA 5AUIA 1NVID 2N0SB 2BT6A 1WXQA 1AWDA 2DWQA 3NVYA 5G5HA 4YXDB 1J7CA 4LTUA 2HTME 3WCQA 3SFDB 2M56B 3AB5A 2BS3B 3CWIA 4YSXB 1NEKB 1L6UA 1SF0A 3AEDB 1CZPA 3AE2B 3HRDD 1QF6A 2BS4B 1N62A 3KWLA 1N61A 4USAA 5C2TB 1NENB 3W5UB 2CJOA 1TKGA 1RYJA 1V8CA 1FRRA 1N60A 3DWMA 1FIQA 4JWUC 1TKEA 3DWGC 2BS2B 2Q5WD 1FMAD 3PO0A 3VR8B 4C7YA 2W54A 3AEAB 2W3SA 2WU5B 1PUTA 1XLQA 2B76B 1E0ZA
chains in the Genus database with same CATH superfamily
4OVZA 2V3SA 3QK0A 3RFZB 3Q3OC 1L6VA 4ZRQA 3ABVB 2LXAA 4C4VB 3EC8A 2WQYB 3R7QA 3ZTDA 3S2AA 3EUB2 4P16A 1C1YB 2D3AA 1XD3B 3AEBB 5T8IA 3UF8A 4K7SA 4KZCA 2CHWA 2DHZA 4LJPB 1E8YA 3AU4A 2QHOA 1YD8U 2VH2A 3VFKA 1P1AA 5DPSA 4XX5A 2MCNB 2ZCCA 1JQ4A 2L76A 1FXAA 1J19A 2A5UA 2JT4B 2FIFA 1UUPA 3A4RA 2IY1B 4EZJA 2G9HD 1OGWA 2RPQA 1SJED 3WANA 1HZ6A 3P4PB 1C78A 3C8YA 3HM3A 4TUUA 3M63B 1NI2A 1YJJA 1MG4A 1N5XA 3RNFC 2N9LA 3W5VB 1FFUA 3AH7A 3DHGC 1C4AA 1TYGB 5IKCM 1T0SC 1WRDB 2JYTA 2BGFA 2DWQA 2ON8A 1C79A 5TR5A 2B3AA 4MM3A 4G11A 3FILB 3UIPB 1AN8A 4E3CA 1T6BX 4JWUC 3ZRCA 4NJ7A 1AARA 5AZFA 1WF9A 3AULA 2W3RA 1C9FA 1KLGD 1GAQB 4HK2A 3EECA 1BT0A 2NPTA 4XGAB 1KH0A 3NS1A 3PZDA 4RGOS 4CYEA 1WGHA 4KIKB 4LJOB 1XLNA 1I35A 1KM7A 2WDRB 2Z59B 2G3QB 3P1MA 4P6VF 4MH8A 4YSZB 1LO5D 4NJCA 4F8CB 1WM2A 3OAWA 5EE1A 1BMLC 2MLBA 3T9LA 1QOBA 2V3PA 3LB8C 1ROEA 3EFUA 2MSED 1T0RC 4I6LB 1FFVA 3AE5B 2PIAA 1YJIA 4BFRA 1LQBA 1C76A 5G5GA 1SSNA 2D11A 2QC8A 4W9IA 1IYFA 3AE4B 3KQ4A 4KKJA 1GOZA 1FEHA 1RAXA 4II3B 4HXDA 4EZLA 2ZEQA 2KDBA 4GN1A 2W55A 1HTOA 1WMHA 2Y5CA 3K9OB 1PGBA 1I4GA 3QIJA 4RF0A 1QT9A 3PZ8A 2JQRB 5AUIA 4AJYB 3V62A 4BKTA 4FADA 4YXDB 1V80A 4G50A 1WJ4A 3WCQA 2M56B 1XCQL 5J18A 1TS5A 4ARIA 3SU8X 4EZKA 4HCPB 2O6VB 2UU7A 3ZO5B 4RM9A 4N9F4 4B95A 2Y3AA 3RMKC 2DZMA 2HD5B 5GMVA 1ZXIA 1JWSD 2KMCA 4HPPA 3O13A 3T3NA 2R2QA 3OG5A 4IKGA 4JPSA 3Q2AC 2D5GA 3KYCD 3ZLZA 2WXHA 1GC6A 2MBBB 4JL9A 3DPDA 2IY0B 2Z8LA 1GPXA 1OQQA 2L52A 1IGDA 3EHVA 3DHHC 1EF5A 1VZ7A 4K1RB 1HQRD 2NMQA 1KRHA 4C7ZA 2K0PA 2JRHA 3NVWA 2MRPA 3VHTC 1F0ZA 3HIZA 2IO3B 3T8MA 3ZRFA 1GG3A 1K50A 4N6EB 2N7JA 1B1ZA 4BKSA 3NZSA 2PE9A 4WJNA 3BINA 1GB1A 2KJRA 2JWZA 2KTRB 1T5XD 1MVKA 2VH1A 4B0MA 1QOAA 1WWTA 5E6OA 1E8XA 3DBRB 1RWSA 3CIRB 3Q69A 1FCLA 3Q8CA 3ZTCA 4FLHA 2WU2B 4JWSC 5C23A 4OZCA 3IFWB 2CHXA 5E6NA 4RCOA 4IWPA 1ZPSA 3MHZA 5BYRA 2LGDA 1VDVA 2KLGA 2BYFA 2N4FA 3ENEA 1J7CA 3U30A 1L6UA 1E7VA 2J0KA 3V6EB 2QCZA 4FJYA 4RNAA 1GJZA 1MHXA 1OEYA 1QZEA 4C7YA 3TUOA 1L4DB 2SAKA 2KTFA 4RFBA 1C4PA 4REZA 2B76B 2MJ3A 1UF0A 4Q2JA 3U4EG 5CHWA 3W1SA 2G45B 2XBBC 3JVZX 3IBEA 1N63A 3B9JA 2PJHA 1P7FA 2D10A 3N3KB 4MM3B 4EOYA 3BIID 4M8NA 4A6QA 4KV2A 3NY5A 4W9FA 1XCTL 3PV1A 3AXCA 2QJLA 3ZJUA 1FNUA 2PVOD 3IG3A 2MBEA 4XWTA 3P4RB 2NTSA 1K53A 4JIOU 2KQ7A 4EUTA 3MP9A 3JSVA 2NCNA 2BWFA 3VTWA 1U4AA 3BZDB 3H7PA 1WSPA 3EGRA 4DXGA 2JZ3B 2WX0A 3H9DA 4KX6B 5D6JB 3PVLA 4FHKA 4XYCA 4ANUA 2IYDB 4ANWA 5LNK1 3ZKJC 2WXGA 4PYUA 1M4VA 1FNWA 4AS1A 3DBLI 2BB6A 2IBIB 2MHJA 1SE2A 4YL8A 4N59A 2C5LC 4ICVA 4HKZE 3VTVA 4EFOA 2CR5A 4L2YA 1JW9D 2AL3A 1LFDA 2Y5PA 2YVCA 2BWES 1JWMD 3BVZA 4W9GA 5I4DA 3IVFA 2PE6B 2ZZPB 1TBEA 1D4BA 3QC8B 2KK8A 1GNUA 3AEDB 4XE0A 3Q3NC 5BMIA 2JXXA 4MACA 3UQBA 2JRIB 2AWTA 2XK5A 1Q0WB 1N60A 2KWCA 4RM8A 1ET6A 1R4MB 1TTNA 3V60A 3ZXRA 4FBJB 5J2RA 1OQRA 3N20C 4AOFA 2WNMA 3DHIC 3JW0X 3CSFA 3KUDB 3C0RB 4BBNF 2WYQA 4YTMB 5HG2A 3A33B 3E9SA 1WJ6A 1VZ8A 3QARA 1TS2A 2LHDA 1HZ5A 2V3NA 4GIVA 3NZ3A 1SIJA 2WWZA 3TEXA 3N30A 2Y5BB 1G6JA 2I38A 1YQ4B 2JZPA 4DK5A 3Q6BA 1D5MC 4BKGA 3I3TB 1E7PB 2ASQA 2NVUI 3PHXB 4HKQA 1P7EA 3I5JC 4GU2A 3H7SA 4ZRIA 1FRDA 4ZRKA 2FIDA 3WAMA 3L54A 2WDQB 3PZ7A 4DQOC 1V5TA 4CQNA 3TEYA 2FUHB 4EKUA 2N7EA 5FR6A 2L0TA 1LGRA 3RN9C 1SGHA 5BO4B 4CHKA 2FCMA 1J7AA 3MHSD 3TIXA 2WXPA 4DXFA 4PK1A 4JQWC 2ONQA 4RGNA 2I2YA 3U52E 4LDTB 4DHJD 3GZNI 2CS4A 1TT5B 3I63C 2BKRB 2G4SA 3I9V1 1N62A 4MJSB 2IGGA 1N61A 2ZW1A 1OQYA 3I57A 2K6DB 4RGMA 1ZE3D 2IJ0A 3APDA 2MX2A 3DOWA 2D3CA 3ZVVA 4IDIA 2ZW0A 1DOIA 1SJHD 1SBBB 4DDGD 4HJKA 5EDSA 2M19A 4GDKB 2GB1A 1H4RA 3QHTA 2KN4A 1TIFA 2K22A 1L4ZB 3Q8AA 1F52A 2GBRA 2LI5A 1N6ZA 1XLOA 4C00A 2H89B 4F1SA 2KWUB 3IXSA 1FXIA 5DPTA 1QLBB 4YSYB 2LASA 3DBHB 2AL6A 1WXSA 1V81A 5GXGB 4A3OA 1GC7A 3L16A 2AEHA 2XEWA 1YMHE 2D2QA 4BVUC 4GMVA 2LGSA 1V1PB 3W1SC 1FPYA 2KX0A 2LHEA 3PTFC 2INDC 1P3QU 3P4QB 4CO7A 1K51A 1CMXB 4HLEA 2LD9A 2YLMA 3AE6B 1MI0A 3VRAB 3KWVA 3APCA 3OLMD 2BYEA 2GRIA 2IO1B 4WH4A 4J3OD 2KDEB 1I7HA 5BYSA 1WM3A 2QSDA 1E6EB 2MEKA 1R4NB 4W9KA 4FHJA 3TJPA 3AB5A 2BS3B 2GBKA 4YSXB 1E90A 2FAZA 4OW0A 4NAWA 3W2DA 2OJWA 2L05A 3WAOA 3PO0A 1JWUD 4W9JA 2IGHA 1PUTA 2CKHB 2LGIA 4K3CA 5AUKA 4RF1A 2WHIA 4FXCA 3MJWA 4KGRA 1NI3A 3QWZB 3FAHA 2M17A 4C80A 2H88B 3ML8A 1T0YA 2BB5A 3N1YC 1L0XB 4HCNB 1IBXA 2Z0DB 1C4CA 3HVZA 1CQVA 2QMTA 2MP2A 5IOIA 4YTNB 2WP9B 4AP4C 1N5WA 4ANXA 4US9A 2NTTA 2BBCA 2LEKA 1Q5WB 4WWNA 3MC0B 2X38A 4GSWA 4NY0A 2OHFA 1I4HA 2DAJA 2BPSA 3UGBB 3W9CB 3PLUA 1HTQA 4W9CA 3N9YC 2FBWB 1Z5SB 1WRIA 3AE3B 3WA0A 3AU5A 2L83A 1KTKA 2L7RA 3KH0A 3VH3B 4MGZE 2INNE 3VDZA 4GB9A 1FCCC 4ANVA 3A9KA 2PTLA 1D3ZA 1WYGA 3V05A 1WY8A 3GS2A 1STEA 5DPWA 4TQ0A 2N0SB 3RNEC 3NVYA 1TY2A 3R8BA 2PPHA 1XF5L 2LMCA 3SFDB 5AEKB 2YEPB 3CF6E 1TZ1A 1VRAB 1L7YA 2CJOA 1ZGUB 4XDDA 3VTUA 4TMAB 3U2SC 1VZ6A 3RNCC 3A1QA 3RNBC 3RUIB 3R66C 2WXKA 3RZWC 3A9JB 1WR6E 2KWVB 2W9NA 4HJGE 4I6NB 3KW5B 2ICIA 4FULA 3AMZA 2LVPA 5D2MB 4E71A 1KF6B 4XC2A 3DCGA 2UYZB 2FE8A 3TEWA 2O6VD 3QCAA 2CJNA 2JSVX 4ZDVA 4MGIE 4M8MA 4MDKE 2KYWA 3AN1A 4M0WA 4NQKE 3UQAA 1TZOA 2KFKB 4W9HA 5D3DA 2KOXA 5KHOA 2MQJA 1ZP0B 4E74A 1QILA 2N1VA 2KX3A 3BY4B 4IG7B 5JH5C 3ZQ4A 2KKCA 3W1YA 1MPEA 4R3DA 3KLSX 2ZPYA 1QQRA 1WX8A 5D7GA 3SD5A 2J7QB 3QA8A 5AZGA 3PGEA 2KT7A 3NUHB 1XQQA 2WXJA 1SB3C 4NZLB 2WGSA 1FD6A 3ZXVA 5FKAC 2KN5A 2ZNVC 4KSKC 4IM0A 1EO6A 1XEEA 2DBYA 1AW7A 3U7ZA 1VCBA 4ZHOA 4MGKE 4LLGM 4B6WA 4RH6A 1UBIA 2IO2B 2KJ6A 4FN2A 4GDLA 4BBNC 2KNBA 1SE4A 2BS4B 3RD2A 1NBFC 1WI0A 3PS6A 4I6PA 1FIQA 5CHFA 4HWIB 3NZUA 2KJHB 4B0EA 3M95A 2M1MA 3AE1B 3M62B 2EKEC 1X1MA 3VRBB 1YN5A 4MSQB 1ACCA 4W9LA 4URKA 2K9XA 1M94A 3V6CB 3PRZA 3IHPC 1I4PA 2L8JA 2RDGA 2KQ4X 1UH6A 4ZRPA 3N32A 4P7IA 2MBQA 2DZKA 1FO4A 3VR9B 1L0VB 2DLBA 3FC4A 1RFKA 1JALA 3DDCB 2G4DB 4AUQC 4LNNA 3U7DA 2LGYA 3H1UA 2INCC 3NOBA 1XXGA 3GP7A 3AECB 3L13A 2D07B 3RT3B 2JY6A 1UNSA 2L1AA 3SEBA 4C4VA 3APFA 1NYRA 3MC8A 2X8XX 5EE3A 4TSSA 2LGXA 2CU1A 2PLPA 2HE7A 2NPTB 1V86A 3IT4B 4IWOA 1UBQA 1PFDA 1WX9A 1Z2MA 2C7HA 3R2IA 2YEPF 4MH0E 2LJ5A 3PREA 3MJ5A 1TS3A 1OEYJ 1WXAA 2LFIA 3C19A 4IM2A 2WX1A 3QX1A 1UGJA 1WXMA 3PRMB 4OZAA 1IP9A 1WJNA 3CWIA 1YIWA 3GB1A 1NEKB 2KZRA 2WXMA 2FUG1 3GE8C 1TKGA 1C3TA 3TCAA 4MT5A 3D32A 2BS2B 5AZHA 1FMAD 3VR8B 2J0MA 3OWEB 3AEEB 2JWUA 2J0JA 4LK0M 2OJRA 3ETRA 3K9PB 5CHVC 4WWOA 2AQ1B 5EE0A 2BTEA 3VUWA 3Q3FA 4M01A 1DOYA 4ARCA 2KANA 5LLIA 2VZKD 1R4MI 3MC9A 4ICUA 3VUXA 4PS3A 3H6NA 3DBLB 3OJ3A 3N1XC 3RPFC 2C9WB 2BF8B 4JX1C 1WMHB 1Y8RC 4WWPA 4ZRJA 1JROA 2EKIA 2DYMA 2J52A 4M02A 4RMAA 4IOIE 2BQQA 2KO3A 3Q3MC 1V5OA 1LXDA 4XDCA 3FILA 1ZUD2 5J17A 1DOXA 3NS8A 3R3MA 3X0WA 1VR9A 2N9KA 3B0AA 3P2BA 1NYQA 1WH3A 2N9PC 1TJEA 2N9EB 2BKFA 1OTRB 3ZJTA 3SFEB 1YX5B 1EWCA 1Y56A 4KIKA 2RGFA 4ITKA 3RULA 3VH4B 4WQOB 3ZGZA 1T0QC 4N58A 5H92C 1F77A 4MGYE 1WX7A 2LUMA 4GXBA 3B1LX 5G5HA 3EFCA 2HTME 2K8HA 4WIPA 4XWWA 3KWLA 3DQVA 1V8CA 3DWMA 2CHZA 1JRUA 1HE8A 1TKEA 2Q5WD 4F7ZA 2JPHA 2GI9A 2W54A 1PYWD 3Q8EA 2JU6X 2JVCA 1VJKA 1JMLA 3WAPA 1P98A 5L95C 2WLBA 2ZVOA 1ENFA 1JRPA 3PT2B 4PT5A 4EEWA 2LVQA 1WE6A 1IUEA 3KVFB 3L4PA 3NJTA 1AYFA 1YN4A 3HK0A 2N9XA 2KMAA 1E10A 2J4XA 3VXWA 4MSMB 4KDLB 3UINB 4JGHB 3NG0A 5C3JB 5LXHA 1XO3A 1YN3A 2KDIA 1YQBA 2N1WA 4DDID 4BZAA 1R7SA 1ZW7A 1SEBD 3ONSA 2KDFB 1A70A 1HA5A 4IM3A 3Q3JA 2O6VA 3GZNB 3NVVA 5IN7A 1FM0D 3M3JA 4J6IA 1K52A 1FXTB 4YTPB 2O2VA 1JWAD 2GLSA 4AQ7A 2IZVB 2INPE 1PQSA 3Q14C 1SIFA 4KKIA 2DENB 2I1JA 5FK9C 5C1ZA 3B2FA 4GLSC 2LRUA 1EM7A 3DVNU 3WIMA 3IAS1 4LNFA 1MHHE 5BYQA 3BVGA 2RDBC 4IWQA 3GOEA 3QQ8B 1ZDXA 3R7RA 1TY0A 4H2AA 4HVBA 3VUYA 4YT0B 5DCNA 2OEDA 1NVID 1WXQA 5LXIB 4TKNA 2XN9C 1L2NA 5G2NA 5C2TB 2PEAA 2D3BA 4MEMA 5CTRC 3JSVB 1R4NI 3L17A 1P9DU 3LJ3A 4X57B 4ZYSA 2K6QA 3H7PB 1TS4A 3VVWB 2KTRA 3ZDMC 3E56A 5DPRA 4LNIA 1DYQA 5HFYA 3CMMB 4WAAA 1WJUA 3SR6A 1S1QB 3PLVA 5MPOA 2WXRA 1V9JA 1RLFA 4GOCA 3L08A 3LYYA 2LJIA 2ZJDA 4ZYNA 1VLBA 1F1HA 5IAAC 3PRPB 1J8CA 2WDTB 2E6XA 3BYYB 3SHQA 2SEBD 1V2YA 1VD2A 3BWUD 1KLVA 3BVMA 2HJ8A 1D5XC 2V0GA 2BVCA 2NR2A 1F9JA 2LWPA 3ZYYX 4NAMA 1FNVA 2XNAC 2N7DA 2I1KA 2XK5B 1TKYA 1UGMA 1KLUD 1UWMA 4DBGA 2GBJA 1I4RA 2NBVB 1YOVB 3HVDA 4IUMB 4XZ4A 1KFYB 1J0GA 2WXIA 2Z0EB 4II2B 2FCQA 1P0RA 2HJ1A 3MTNB 2L32A 3AE9B 3N1ZC 3AEGB 3L10B 2K5PA 3TBLD 5KHQA 2BYTA 3PHWB 1CK1A 2K8BA 3MFGA 3ECIA 5BMGA 2LRWA 4TV3A 5IP4D 1ZKHA 4LTUA 1E8ZA 1Q10A 3J9CA 2KDMA 2K8CA 1CZPA 1QKZA 1UELA 3ZDTA 2JXTA 2KC1A 4OVVA 2ZVNA 5HHDG 3PPAA 5L83A 2PMVA 4FJZA 1SE9A 4OVUA 4C56C 1E8WA 2MJDA 1ZXHA 3IT6B 3AE7B 2HDEA 2M0AA 2KACA 4WQMA 5JXVA 3NRZA 2L0FA 4KGTA 4RGTA 4UDUC 3TMPB 2GBNA 1S3SG 3ZNZB 2QDFA 3NVZA 2OOBB 2WXNA 2JZZA 3EA6A 1MG8A 4FJVB 2K1FA 3QAQA 3U8ZA 2QIEB 3B2GA 3HUIA 5EE9A 2LZ6A 2KMMA 2FNJB 2G1EA 2WS3B 2REXA 2AQ3B 3HM6X 4PS8A 1WE7A 2PW9A 2RMMA 3AV8A 1V97A 4OZBA 2V1YA 3P4SB 4PYZA 2KD0A 2QILA 2L3ZA 4DWFA 2J42A 2IO0B 2JYEA 2KAJA 1V1OA 4LNKA 1PGAA 4KDIC 1Q1OA 1UWXA 2GOWA 4WAFA 2RD0A 3CSTA 2LVOA 3RYTA 4K3BA 5IA7A 4NQLB 3V61A 1CJEA 3OJ4B 1OFFA 2O2VB 1XLPA 2ZNVB 2R61A 3AI5A 1SF0A 3HRDD 1QF6A 3P42A 1NENB 4KSLC 3IAM1 2NS5A 3W5UB 2KC2A 1FRRA 2KHWB 1SE3A 2JUOA 1WZ3A 2EMSA 1PGXA 2DAFA 2K3UA 2WU5B 4KGSA 1XLQA 2WDVB 3DBRI 5E6PA 4G0NB 1T3QA 1E5WA 3PSEB 4A20A 2K25A 1WGKA 4AJWA 1WYWB 1ZOYB 2A4ZA 3URYA 2RSUA 5IO9A 1RM6C 3L0WB 3AE8B 3Q8BA 3X23A 3ZJVA 5BMHA 2BYVE 2RR9A 1IPGA 3RI7C 4BOSC 3UI3A 1KJTA 4HDQA 4KVGB 3DVGY 2M0XA 1D6EC 1YX6B 2MW5A 4MJSA 4NPNA 4EE2A 5E6JA 3Q8FA 2WXOA 2JF5A 3JYUA 4NAWB 2C7NB 1A5RA 1JCKB 3LXFA 3ML9A 1YJ1A 4ZHPA 4GDKA 3GE3C 1D5ZC 5JZEB 4A55A 2KFJA 5TSSA 1C77A 1GB4A 5FR3A 3DVGX 2MWSB 3AM9A 2IPKD 4S0RA 1WGDA 2KVZA 4JLCA 3ZNGC 1IBXB 4L1BA 3BK1A 1F2RI 2WXQA 1KOTA 1NDDA 1WXVA 2DYBA 2IGDA 2MP2B 2GBMA 3VQIA 1EF1A 4YWGG 4IW0A 3ZW3A 1MJDA 1EU3A 2DZIA 4WJPA 4USAA 4LCDE 2IDYA 4D2KA 2BW2A 1V1PA 3BYTB 1L0YB 4A8XC 3DBSA 1H8CA 4DHZE 5G55A 3BK2A 2J53A 2M4NA 3H8HA 2PVGC 4B9KA 2L00B 4HPMB 4TQ1A 2KLCA 4G3XB 1F2RC 2KQSA 2MJEA 4W9EA 1HEZE 1BUIC 2DZJA 3T3OA 2CU3A 1I42A 3A9KB 3RCZA 4A90A 4HEA1 3VAWA 1WGRA 1J7BA 4K81A 1E9MA 3UIOB 3ZUNA 1WR1A 1SXTA 1ZDVA 2V4IB 2NBWB 5D94A 4PS7A 2DYOA 4ASWC 2ACZB 2RDHA 3DVNV 5JHAA 3A1QB 1IGCA 3TSSA 3WALA 2W82A 2AQ2B 1QOGA 4DXAB 2WXLA 2C7MB 1LM8B 4OHJA 1B9RA 4HROA 2C60A 4P1CC 3B08A 2ZCBA 1E7UA 2VZKB 1QOFA 1WIAA 1TGZB 3SDLC 5JHBA 2E3TA 4US8A 2PKOA 3KUZA 4ACFA 3O65B 4BOZB 4JE3B 1WZ0A 4QAYA 2RPVA 1AWDA 1UD7A 4M0WB 4DHZB 3ALBA 1I4XA 3ZNHB 2MBOA 2HTHA 3A4SC 3ZNID 3TL5A 4P1BC 4O1NA 2R2OA 3DWGC 4WURA 2KVRA 1ISNA 2LUEA 3AEFB 4WWMA 2D3GA 1PDXA 1YQ3B 1GUAB 1BXTA 2DX5B 3FKYA 5H8YE 1RRBA 2FCNA 2WXFA 2AYOB 1DGJA 1EU4A 2K39A 3KUCB 2UWQA 4HPLB 2DNFA 2V9HA 3R2TA 4BAXA 5HKHA 2EELA 2MH7A 2AX5A 1V6EA 4NJ6A 4BKSD 5D3IB 3HHMA 4A9AA 4LDTD 2MA9B 3RNGC 2JX5A 4MELA 1XT9B 4GDLB 4IC7B 5CX3A 4LNOA 2EMTA 5HI1A 1WGYA 1ESFA 3A9JA 2LXCA 1YNTE 4DHJB 3V3XA 2GMIC 1K8RB 2MBHA 1EUVB 4K7UA 4HRSA 3QJZA 1MFWA 1WGGA 2TSSA 3RZFA 4AWJA 3KYDD 2VRRB 4K7WA 4W9DA 1L5PA 4A3PA 4ZOHC 1JWBD 3ZIMA 3P63A 2KXJA 2M8SA 3DBHI 2QEJC 4L23A 4HDOA 1EWYC 4WJQA 2KWDA 2KFKA 2BT6A 1ET9A 1WFYA 1V49A 2ZPNA 4M00A 2NBUA 3RNAC 4FA6A 1UZXB 3AE2B 4GGQA 4KZ0A 1HXYD 1RYJA 3NHEB 3TEZA 2V4LA 3LDZE 4S17A 4NNJB 1I4QA 4WJOA 2FCSA 3AEAB 2W3SA 1RFAA 1E0ZA
chains in the Genus database with same CATH topology
4OVZA 1OQRA 3AE1B 4C56C 3VRBB 2MJDA 2WNMA 1YN5A 1ZXHA 3RFZB 3IT6B 1L6VA 3AE7B 1ACCA 4ZRQA 2HDEA 3ABVB 2M0AA 2K9XA 2WQYB 2KACA 4WQMA 3EUB2 4YTMB 5HG2A 4P16A 5JXVA 5T8IA 3AEBB 3E9SA 3NRZA 4KGTA 4RGTA 4UDUC 1VZ8A 3NVZA 1I4PA 2WXNA 2RDGA 2KQ4X 1TS2A 2LHDA 3EA6A 1HZ5A 2V3NA 4ZRPA 3NZ3A 1SIJA 2QIEB 3TEXA 3B2GA 3HUIA 2I38A 5EE9A 2KMMA 1YQ4B 2WS3B 2G1EA 1FO4A 2AQ3B 3VR9B 1JQ4A 1L0VB 2DLBA 2PW9A 3FC4A 2RMMA 1RFKA 1JALA 2JZPA 1FXAA 3AV8A 1V97A 4OZBA 3P4SB 1D5MC 1UUPA 1E7PB 2G9HD 4HKQA 1P7EA 1XXGA 3GP7A 1SJED 3AECB 2QILA 1FRDA 2J42A 1UNSA 2JYEA 2L1AA 3SEBA 2KAJA 1V1OA 1NYRA 2WDQB 3PZ7A 4DQOC 1HZ6A 3P4PB 4CQNA 1PGAA 3TEYA 1C78A 1UWXA 3C8YA 4WAFA 4TSSA 5EE3A 2PLPA 3IT4B 1YJJA 1PFDA 1N5XA 3R2IA 2N9LA 2YEPF 3W5VB 1J7AA 1FFUA 3AH7A 1CJEA 2WXPA 4DXFA 1OFFA 3MJ5A 1C4AA 1TS3A 1TYGB 2LFIA 2ONQA 4RGNA 2I2YA 3U52E 1XLPA 2JYTA 1UGJA 2DWQA 4OZAA 2ON8A 1C79A 2R61A 3CWIA 3GB1A 1NEKB 1SF0A 3HRDD 3I9V1 1QF6A 1N62A 2WXMA 2IGGA 1N61A 2ZW1A 2FUG1 3P42A 1NENB 3I57A 3IAM1 3W5UB 1TKGA 4RGMA 1FRRA 3FILB 4MT5A 1AN8A 1SE3A 1T6BX 4JWUC 2BS2B 1FMAD 3VR8B 1PGXA 2K3UA 1ZE3D 2IJ0A 3OWEB 2WU5B 3AEEB 4KGSA 2JWUA 1XLQA 4LK0M 3ETRA 2WDVB 4IDIA 2AQ1B 5EE0A 2BTEA 2ZW0A 1T3QA 2W3RA 1C9FA 1DOIA 1KLGD 1SBBB 1SJHD 1GAQB 2M19A 4GDKB 2GB1A 1WGKA 1DOYA 4ARCA 1ZOYB 2KN4A 3URYA 2VZKD 2K22A 1L4ZB 1KH0A 3NS1A 1RM6C 3Q8AA 4RGOS 3AE8B 3Q8BA 1XLOA 2H89B 3ZJVA 3IXSA 5BMHA 1FXIA 1XLNA 3RPFC 4JX1C 3UI3A 1QLBB 1JROA 4YSYB 2EKIA 2DYMA 2WDRB 2J52A 1D6EC 3P1MA 4P6VF 5GXGB 4MH8A 4IOIE 4YSZB 1LO5D 4NJCA 4EE2A 5E6JA 3Q8FA 4XDCA 3FILA 2WXOA 1ZUD2 5EE1A 1BMLC 1DOXA 1YMHE 1QOBA 2V3PA 3LB8C 1ROEA 4NAWB 1FFVA 1V1PB 3AE5B 1JCKB 1VR9A 2PIAA 2LHEA 2N9KA 1YJIA 3LXFA 1NYQA 1C76A 5G5GA 1SSNA 1TJEA 3P4QB 4ZHPA 1K51A 1D5ZC 3AE4B 3KQ4A 4A55A 4KKJA 3ZJTA 1GOZA 5TSSA 1FEHA 1C77A 3SFEB 5FR3A 1GB4A 3AM9A 3AE6B 2IPKD 1MI0A 1EWCA 3VRAB 1Y56A 3KWVA 4ITKA 1IBXB 2GRIA 4WH4A 4L1BA 2W55A 4J3OD 3BK1A 3ZGZA 2Y5CA 1F2RI 2WXQA 4N58A 1PGBA 1I4GA 1I7HA 5BYSA 4RF0A 1QT9A 5H92C 2IGDA 2QSDA 3PZ8A 1F77A 2JQRB 1E6EB 2MEKA 5AUIA 3VQIA 2LUMA 4YWGG 5G5HA 4YXDB 2HTME 3WCQA 2M56B 3AB5A 2BS3B 4YSXB 1EU3A 4WIPA 4XWWA 1XCQL 1TS5A 3KWLA 4OW0A 4USAA 4ARIA 1V8CA 2IDYA 3DWMA 3W2DA 4D2KA 2BW2A 1V1PA 3BYTB 1TKEA 2Q5WD 3PO0A 1JWUD 1L0YB 2GI9A 2IGHA 2W54A 4A8XC 2Y3AA 1PYWD 3Q8EA 2JU6X 1PUTA 2LGIA 5AUKA 4RF1A 1ZXIA 3BK2A 1JWSD 1VJKA 2J53A 1JMLA 4FXCA 3H8HA 4KGRA 1NI3A 2WLBA 3O13A 3T3NA 2PVGC 1ENFA 1JRPA 3FAHA 4TQ1A 4PT5A 4IKGA 4JPSA 4C80A 2H88B 1IUEA 2BB5A 1F2RC 3L4PA 2MJEA 1L0XB 1AYFA 1YN4A 2D5GA 1IBXA 1HEZE 1BUIC 2WXHA 2CU3A 3T3OA 1E10A 2J4XA 1C4CA 2Z8LA 1GPXA 3HVZA 1CQVA 2QMTA 1OQQA 4A90A 5C3JB 1XO3A 4HEA1 1YN3A 4YTNB 2WP9B 2L52A 1N5WA 4US9A 2NTTA 1J7BA 1IGDA 1R7SA 2BBCA 1E9MA 2LEKA 1VZ7A 1SEBD 1HQRD 2NMQA 3MC0B 1KRHA 4C7ZA 2K0PA 1A70A 1HA5A 1SXTA 1ZDVA 2X38A 2V4IB 2OHFA 3NVVA 3NVWA 1I4HA 1FM0D 2DYOA 1F0ZA 1K52A 1K50A 4YTPB 3W9CB 2ACZB 4N6EB 1JWAD 2N7JA 2RDHA 3N9YC 4AQ7A 1B1ZA 1IGCA 2INPE 2FBWB 3TSSA 1WRIA 2W82A 2AQ2B 3AE3B 1QOGA 4KKIA 2WXLA 5FK9C 2L83A 1GB1A 3B2FA 1KTKA 4OHJA 1T5XD 1MVKA 4GLSC 1B9RA 4B0MA 4HROA 1QOAA 1WWTA 1EM7A 1RWSA 2INNE 3CIRB 2VZKB 3IAS1 1QOFA 3Q69A 3Q8CA 1MHHE 1FCLA 5BYQA 3BVGA 1FCCC 1ZDXA 2E3TA 1TY0A 2WU2B 2PKOA 4JWSC 4US8A 2PTLA 4H2AA 4OZCA 1WYGA 3V05A 4RCOA 1ZPSA 3MHZA 3GS2A 5BYRA 1STEA 1VDVA 4YT0B 4JE3B 4TQ0A 2OEDA 2RPVA 1NVID 2N0SB 1WXQA 1AWDA 1TY2A 3NVYA 1J7CA 3R8BA 1I4XA 1XF5L 2LMCA 3SFDB 2XN9C 2YEPB 1L6UA 1VRAB 5C2TB 2CJOA 4XDDA 4O1NA 4RNAA 4TMAB 3U2SC 1VZ6A 3DWGC 1MHXA 4WURA 4C7YA 3TUOA 4ZYSA 1L4DB 2SAKA 2WXKA 1TS4A 4RFBA 1C4PA 4REZA 2B76B 2MJ3A 3AEFB 4WWMA 4HJGE 3E56A 4Q2JA 2ICIA 1PDXA 1YQ3B 3U4EG 1BXTA 1DYQA 5HFYA 3AMZA 5H8YE 3W1SA 2WXFA 3SR6A 5MPOA 2WXRA 1DGJA 1EU4A 1KF6B 1N63A 3B9JA 1P7FA 4MM3B 2FE8A 3TEWA 3LYYA 3BIID 3R2TA 4A6QA 2LJIA 1VLBA 1XCTL 2EELA 2MH7A 2QJLA 2AX5A 3ZJUA 2CJNA 2JSVX 1FNUA 2E6XA 3BYYB 2SEBD 3AN1A 2PVOD 4M0WA 5D3IB 4A9AA 3BWUD 4XWTA 1TZOA 3BVMA 3P4RB 2NTSA 5D3DA 1K53A 2JX5A 1ZP0B 1D5XC 1QILA 3MP9A 2V0GA 3ZYYX 4GDLB 4NAMA 1FNVA 2XNAC 5HI1A 1TKYA 3BZDB 1WSPA 3ZQ4A 3EGRA 4DXGA 1ESFA 1KLUD 1UWMA 1MPEA 1I4RA 4KX6B 4R3DA 3KLSX 1QQRA 3HVDA 5D7GA 1KFYB 1YNTE 5LNK1 3NUHB 2WXGA 2WXIA 2WXJA 3V3XA 1M4VA 1FNWA 4AS1A 1SB3C 4NZLB 1FD6A 4HRSA 2BB6A 2TSSA 1SE2A 5FKAC 2L32A 3AE9B 4N59A 3AEGB 4HKZE 1XEEA 2K5PA 1L5PA 4ZOHC 2BYTA 1JWBD 2DBYA 3P63A 1AW7A 4L2YA 1CK1A 3U7ZA 1JW9D 2QEJC 4L23A 3MFGA 1EWYC 5BMGA 4ZHOA 2Y5PA 2KWDA 2BT6A 1ET9A 4LLGM 1JWMD 3BVZA 4RH6A 5I4DA 4LTUA 1Q10A 1D4BA 1SE4A 3J9CA 2KDMA 3AEDB 4XE0A 1CZPA 3AE2B 1QKZA 5BMIA 2BS4B 4MACA 1HXYD 2JXTA 1RYJA 3TEZA 1N60A 5HHDG 1FIQA 1ET6A 2PMVA 1I4QA 4B0EA 3AEAB 2W3SA 1E0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ETR A;  1OQR A;  3AE1 B;  3AEF B;  2WDV B;  4IDI A;  4WWM A;  1ZXI A;  5AUK A;  1VJK A;  4FXC A;  2MJD A;  5EE0 A;  3VRB B;  1T3Q A;  2W3R A;  1L6V A;  1DOI A;  1NI3 A;  1PDX A;  1YQ3 B;  2WLB A;  1GAQ B;  3AE7 B;  2M19 A;  3AMZ A;  2PVG C;  1JRP A;  3FAH A;  3ABV B;  5H8Y E;  1WGK A;  1DOY A;  4C80 A;  1ZOY B;  3SR6 A;  2H88 B;  2WQY B;  2K9X A;  1IUE A;  5MPO A;  1DGJ A;  1KF6 B;  1N63 A;  2K22 A;  3B9J A;  1RM6 C;  3EUB 2;  3L4P A;  2MJE A;  3AE8 B;  3NS1 A;  4WQM A;  1AYF A;  4YTM B;  1XLO A;  2H89 B;  3AEB B;  3NRZ A;  2CU3 A;  1E10 A;  3BII D;  3NVZ A;  1GPX A;  1FXI A;  1XLN A;  1VLB A;  3HVZ A;  3RPF C;  1OQQ A;  2MH7 A;  5C3J B;  1XO3 A;  2AX5 A;  2QJL A;  4JX1 C;  4YTN B;  2CJN A;  1QLB B;  2WP9 B;  1JRO A;  4YSY B;  2L52 A;  3AN1 A;  2EKI A;  1SIJ A;  2PVO D;  2QIE B;  2WDR B;  1N5W A;  3B2G A;  3HUI A;  4US9 A;  4A9A A;  1J7B A;  1R7S A;  1E9M A;  2LEK A;  3P4R B;  5EE9 A;  2KMM A;  1YQ4 B;  2JX5 A;  2G1E A;  2WS3 B;  1ZP0 B;  3P1M A;  4P6V F;  5GXG B;  4YSZ B;  1FO4 A;  1KRH A;  4C7Z A;  3VR9 B;  3ZYY X;  1A70 A;  1JQ4 A;  1L0V B;  3FC4 A;  1RFK A;  2OHF A;  1JAL A;  3NVV A;  3NVW A;  1ZUD 2;  1FXA A;  3AV8 A;  1V97 A;  1FM0 D;  3P4S B;  5EE1 A;  1F0Z A;  1DOX A;  1QOB A;  3LB8 C;  1TKY A;  1E7P B;  1ROE A;  4YTP B;  3W9C B;  2ACZ B;  4N6E B;  1FFV A;  3AE5 B;  1JWA D;  1UWM A;  2PIA A;  3LXF A;  4KX6 B;  1YJI A;  3AEC B;  2FBW B;  1NYQ A;  1WRI A;  5G5G A;  3AE3 B;  1TJE A;  1QOG A;  1FRD A;  3P4Q B;  1KFY B;  2L83 A;  4ZHP A;  3B2F A;  3AE4 B;  2KAJ A;  1B9R A;  4HRO A;  1NYR A;  1QOA A;  1WWT A;  2WDQ B;  2MJ3 A;  1SB3 C;  3SFE B;  1RWS A;  3P4P B;  3CIR B;  4HRS A;  1QOF A;  3AM9 A;  5EE3 A;  3AE6 B;  3VRA B;  1YJJ A;  3AE9 B;  4N59 A;  1PFD A;  1N5X A;  2E3T A;  2PKO A;  2WU2 B;  3AEG B;  4ITK A;  4JWS C;  4US8 A;  2K5P A;  2W55 A;  1L5P A;  3W5V B;  1WYG A;  4ZOH C;  1JWB D;  2DBY A;  3P63 A;  2Y5C A;  1J7A A;  4N58 A;  1FFU A;  3AH7 A;  1CJE A;  3AEE B;  1I7H A;  1JW9 D;  1OFF A;  1QT9 A;  5H92 C;  1VDV A;  4YT0 B;  1EWY C;  4ZHO A;  1TYG B;  2JQR B;  1E6E B;  1XLP A;  5AUI A;  1NVI D;  2N0S B;  2BT6 A;  1WXQ A;  1AWD A;  2DWQ A;  3NVY A;  5G5H A;  4YXD B;  1J7C A;  4LTU A;  2HTM E;  3WCQ A;  3SFD B;  2M56 B;  3AB5 A;  2BS3 B;  3CWI A;  4YSX B;  1NEK B;  1L6U A;  1SF0 A;  3AED B;  1CZP A;  3AE2 B;  3HRD D;  1QF6 A;  2BS4 B;  1N62 A;  3KWL A;  1N61 A;  4USA A;  5C2T B;  1NEN B;  3W5U B;  2CJO A;  1TKG A;  1RYJ A;  1V8C A;  1FRR A;  1N60 A;  3DWM A;  1FIQ A;  4JWU C;  1TKE A;  3DWG C;  2BS2 B;  2Q5W D;  1FMA D;  3PO0 A;  3VR8 B;  4C7Y A;  2W54 A;  3AEA B;  2W3S A;  2WU5 B;  1PUT A;  1XLQ A;  2B76 B;  1E0Z A; 
#chains in the Genus database with same CATH topology
 4OVZ A;  2V3S A;  3QK0 A;  3RFZ B;  3Q3O C;  1L6V A;  4ZRQ A;  3ABV B;  2LXA A;  4C4V B;  3EC8 A;  2WQY B;  3R7Q A;  3ZTD A;  3S2A A;  3EUB 2;  4P16 A;  1C1Y B;  2D3A A;  1XD3 B;  3AEB B;  5T8I A;  3UF8 A;  4K7S A;  4KZC A;  2CHW A;  2DHZ A;  4LJP B;  1E8Y A;  3AU4 A;  2QHO A;  1YD8 U;  2VH2 A;  3VFK A;  1P1A A;  5DPS A;  4XX5 A;  2MCN B;  2ZCC A;  1JQ4 A;  2L76 A;  1FXA A;  1J19 A;  2A5U A;  2JT4 B;  2FIF A;  1UUP A;  3A4R A;  2IY1 B;  4EZJ A;  2G9H D;  1OGW A;  2RPQ A;  1SJE D;  3WAN A;  1HZ6 A;  3P4P B;  1C78 A;  3C8Y A;  3HM3 A;  4TUU A;  3M63 B;  1NI2 A;  1YJJ A;  1MG4 A;  1N5X A;  3RNF C;  2N9L A;  3W5V B;  1FFU A;  3AH7 A;  3DHG C;  1C4A A;  1TYG B;  5IKC M;  1T0S C;  1WRD B;  2JYT A;  2BGF A;  2DWQ A;  2ON8 A;  1C79 A;  5TR5 A;  2B3A A;  4MM3 A;  4G11 A;  3FIL B;  3UIP B;  1AN8 A;  4E3C A;  1T6B X;  4JWU C;  3ZRC A;  4NJ7 A;  1AAR A;  5AZF A;  1WF9 A;  3AUL A;  2W3R A;  1C9F A;  1KLG D;  1GAQ B;  4HK2 A;  3EEC A;  1BT0 A;  2NPT A;  4XGA B;  1KH0 A;  3NS1 A;  3PZD A;  4RGO S;  4CYE A;  1WGH A;  4KIK B;  4LJO B;  1XLN A;  1I35 A;  1KM7 A;  2WDR B;  2Z59 B;  2G3Q B;  3P1M A;  4P6V F;  4MH8 A;  4YSZ B;  1LO5 D;  4NJC A;  4F8C B;  1WM2 A;  3OAW A;  5EE1 A;  1BML C;  2MLB A;  3T9L A;  1QOB A;  2V3P A;  3LB8 C;  1ROE A;  3EFU A;  2MSE D;  1T0R C;  4I6L B;  1FFV A;  3AE5 B;  2PIA A;  1YJI A;  4BFR A;  1LQB A;  1C76 A;  5G5G A;  1SSN A;  2D11 A;  2QC8 A;  4W9I A;  1IYF A;  3AE4 B;  3KQ4 A;  4KKJ A;  1GOZ A;  1FEH A;  1RAX A;  4II3 B;  4HXD A;  4EZL A;  2ZEQ A;  2KDB A;  4GN1 A;  2W55 A;  1HTO A;  1WMH A;  2Y5C A;  3K9O B;  1PGB A;  1I4G A;  3QIJ A;  4RF0 A;  1QT9 A;  3PZ8 A;  2JQR B;  5AUI A;  4AJY B;  3V62 A;  4BKT A;  4FAD A;  4YXD B;  1V80 A;  4G50 A;  1WJ4 A;  3WCQ A;  2M56 B;  1XCQ L;  5J18 A;  1TS5 A;  4ARI A;  3SU8 X;  4EZK A;  4HCP B;  2O6V B;  2UU7 A;  3ZO5 B;  4RM9 A;  4N9F 4;  4B95 A;  2Y3A A;  3RMK C;  2DZM A;  2HD5 B;  5GMV A;  1ZXI A;  1JWS D;  2KMC A;  4HPP A;  3O13 A;  3T3N A;  2R2Q A;  3OG5 A;  4IKG A;  4JPS A;  3Q2A C;  2D5G A;  3KYC D;  3ZLZ A;  2WXH A;  1GC6 A;  2MBB B;  4JL9 A;  3DPD A;  2IY0 B;  2Z8L A;  1GPX A;  1OQQ A;  2L52 A;  1IGD A;  3EHV A;  3DHH C;  1EF5 A;  1VZ7 A;  4K1R B;  1HQR D;  2NMQ A;  1KRH A;  4C7Z A;  2K0P A;  2JRH A;  3NVW A;  2MRP A;  3VHT C;  1F0Z A;  3HIZ A;  2IO3 B;  3T8M A;  3ZRF A;  1GG3 A;  1K50 A;  4N6E B;  2N7J A;  1B1Z A;  4BKS A;  3NZS A;  2PE9 A;  4WJN A;  3BIN A;  1GB1 A;  2KJR A;  2JWZ A;  2KTR B;  1T5X D;  1MVK A;  2VH1 A;  4B0M A;  1QOA A;  1WWT A;  5E6O A;  1E8X A;  3DBR B;  1RWS A;  3CIR B;  3Q69 A;  1FCL A;  3Q8C A;  3ZTC A;  4FLH A;  2WU2 B;  4JWS C;  5C23 A;  4OZC A;  3IFW B;  2CHX A;  5E6N A;  4RCO A;  4IWP A;  1ZPS A;  3MHZ A;  5BYR A;  2LGD A;  1VDV A;  2KLG A;  2BYF A;  2N4F A;  3ENE A;  1J7C A;  3U30 A;  1L6U A;  1E7V A;  2J0K A;  3V6E B;  2QCZ A;  4FJY A;  4RNA A;  1GJZ A;  1MHX A;  1OEY A;  1QZE A;  4C7Y A;  3TUO A;  1L4D B;  2SAK A;  2KTF A;  4RFB A;  1C4P A;  4REZ A;  2B76 B;  2MJ3 A;  1UF0 A;  4Q2J A;  3U4E G;  5CHW A;  3W1S A;  2G45 B;  2XBB C;  3JVZ X;  3IBE A;  1N63 A;  3B9J A;  2PJH A;  1P7F A;  2D10 A;  3N3K B;  4MM3 B;  4EOY A;  3BII D;  4M8N A;  4A6Q A;  4KV2 A;  3NY5 A;  4W9F A;  1XCT L;  3PV1 A;  3AXC A;  2QJL A;  3ZJU A;  1FNU A;  2PVO D;  3IG3 A;  2MBE A;  4XWT A;  3P4R B;  2NTS A;  1K53 A;  4JIO U;  2KQ7 A;  4EUT A;  3MP9 A;  3JSV A;  2NCN A;  2BWF A;  3VTW A;  1U4A A;  3BZD B;  3H7P A;  1WSP A;  3EGR A;  4DXG A;  2JZ3 B;  2WX0 A;  3H9D A;  4KX6 B;  5D6J B;  3PVL A;  4FHK A;  4XYC A;  4ANU A;  2IYD B;  4ANW A;  5LNK 1;  3ZKJ C;  2WXG A;  4PYU A;  1M4V A;  1FNW A;  4AS1 A;  3DBL I;  2BB6 A;  2IBI B;  2MHJ A;  1SE2 A;  4YL8 A;  4N59 A;  2C5L C;  4ICV A;  4HKZ E;  3VTV A;  4EFO A;  2CR5 A;  4L2Y A;  1JW9 D;  2AL3 A;  1LFD A;  2Y5P A;  2YVC A;  2BWE S;  1JWM D;  3BVZ A;  4W9G A;  5I4D A;  3IVF A;  2PE6 B;  2ZZP B;  1TBE A;  1D4B A;  3QC8 B;  2KK8 A;  1GNU A;  3AED B;  4XE0 A;  3Q3N C;  5BMI A;  2JXX A;  4MAC A;  3UQB A;  2JRI B;  2AWT A;  2XK5 A;  1Q0W B;  1N60 A;  2KWC A;  4RM8 A;  1ET6 A;  1R4M B;  1TTN A;  3V60 A;  3ZXR A;  4FBJ B;  5J2R A;  1OQR A;  3N20 C;  4AOF A;  2WNM A;  3DHI C;  3JW0 X;  3CSF A;  3KUD B;  3C0R B;  4BBN F;  2WYQ A;  4YTM B;  5HG2 A;  3A33 B;  3E9S A;  1WJ6 A;  1VZ8 A;  3QAR A;  1TS2 A;  2LHD A;  1HZ5 A;  2V3N A;  4GIV A;  3NZ3 A;  1SIJ A;  2WWZ A;  3TEX A;  3N30 A;  2Y5B B;  1G6J A;  2I38 A;  1YQ4 B;  2JZP A;  4DK5 A;  3Q6B A;  1D5M C;  4BKG A;  3I3T B;  1E7P B;  2ASQ A;  2NVU I;  3PHX B;  4HKQ A;  1P7E A;  3I5J C;  4GU2 A;  3H7S A;  4ZRI A;  1FRD A;  4ZRK A;  2FID A;  3WAM A;  3L54 A;  2WDQ B;  3PZ7 A;  4DQO C;  1V5T A;  4CQN A;  3TEY A;  2FUH B;  4EKU A;  2N7E A;  5FR6 A;  2L0T A;  1LGR A;  3RN9 C;  1SGH A;  5BO4 B;  4CHK A;  2FCM A;  1J7A A;  3MHS D;  3TIX A;  2WXP A;  4DXF A;  4PK1 A;  4JQW C;  2ONQ A;  4RGN A;  2I2Y A;  3U52 E;  4LDT B;  4DHJ D;  3GZN I;  2CS4 A;  1TT5 B;  3I63 C;  2BKR B;  2G4S A;  3I9V 1;  1N62 A;  4MJS B;  2IGG A;  1N61 A;  2ZW1 A;  1OQY A;  3I57 A;  2K6D B;  4RGM A;  1ZE3 D;  2IJ0 A;  3APD A;  2MX2 A;  3DOW A;  2D3C A;  3ZVV A;  4IDI A;  2ZW0 A;  1DOI A;  1SJH D;  1SBB B;  4DDG D;  4HJK A;  5EDS A;  2M19 A;  4GDK B;  2GB1 A;  1H4R A;  3QHT A;  2KN4 A;  1TIF A;  2K22 A;  1L4Z B;  3Q8A A;  1F52 A;  2GBR A;  2LI5 A;  1N6Z A;  1XLO A;  4C00 A;  2H89 B;  4F1S A;  2KWU B;  3IXS A;  1FXI A;  5DPT A;  1QLB B;  4YSY B;  2LAS A;  3DBH B;  2AL6 A;  1WXS A;  1V81 A;  5GXG B;  4A3O A;  1GC7 A;  3L16 A;  2AEH A;  2XEW A;  1YMH E;  2D2Q A;  4BVU C;  4GMV A;  2LGS A;  1V1P B;  3W1S C;  1FPY A;  2KX0 A;  2LHE A;  3PTF C;  2IND C;  1P3Q U;  3P4Q B;  4CO7 A;  1K51 A;  1CMX B;  4HLE A;  2LD9 A;  2YLM A;  3AE6 B;  1MI0 A;  3VRA B;  3KWV A;  3APC A;  3OLM D;  2BYE A;  2GRI A;  2IO1 B;  4WH4 A;  4J3O D;  2KDE B;  1I7H A;  5BYS A;  1WM3 A;  2QSD A;  1E6E B;  2MEK A;  1R4N B;  4W9K A;  4FHJ A;  3TJP A;  3AB5 A;  2BS3 B;  2GBK A;  4YSX B;  1E90 A;  2FAZ A;  4OW0 A;  4NAW A;  3W2D A;  2OJW A;  2L05 A;  3WAO A;  3PO0 A;  1JWU D;  4W9J A;  2IGH A;  1PUT A;  2CKH B;  2LGI A;  4K3C A;  5AUK A;  4RF1 A;  2WHI A;  4FXC A;  3MJW A;  4KGR A;  1NI3 A;  3QWZ B;  3FAH A;  2M17 A;  4C80 A;  2H88 B;  3ML8 A;  1T0Y A;  2BB5 A;  3N1Y C;  1L0X B;  4HCN B;  1IBX A;  2Z0D B;  1C4C A;  3HVZ A;  1CQV A;  2QMT A;  2MP2 A;  5IOI A;  4YTN B;  2WP9 B;  4AP4 C;  1N5W A;  4ANX A;  4US9 A;  2NTT A;  2BBC A;  2LEK A;  1Q5W B;  4WWN A;  3MC0 B;  2X38 A;  4GSW A;  4NY0 A;  2OHF A;  1I4H A;  2DAJ A;  2BPS A;  3UGB B;  3W9C B;  3PLU A;  1HTQ A;  4W9C A;  3N9Y C;  2FBW B;  1Z5S B;  1WRI A;  3AE3 B;  3WA0 A;  3AU5 A;  2L83 A;  1KTK A;  2L7R A;  3KH0 A;  3VH3 B;  4MGZ E;  2INN E;  3VDZ A;  4GB9 A;  1FCC C;  4ANV A;  3A9K A;  2PTL A;  1D3Z A;  1WYG A;  3V05 A;  1WY8 A;  3GS2 A;  1STE A;  5DPW A;  4TQ0 A;  2N0S B;  3RNE C;  3NVY A;  1TY2 A;  3R8B A;  2PPH A;  1XF5 L;  2LMC A;  3SFD B;  5AEK B;  2YEP B;  3CF6 E;  1TZ1 A;  1VRA B;  1L7Y A;  2CJO A;  1ZGU B;  4XDD A;  3VTU A;  4TMA B;  3U2S C;  1VZ6 A;  3RNC C;  3A1Q A;  3RNB C;  3RUI B;  3R66 C;  2WXK A;  3RZW C;  3A9J B;  1WR6 E;  2KWV B;  2W9N A;  4HJG E;  4I6N B;  3KW5 B;  2ICI A;  4FUL A;  3AMZ A;  2LVP A;  5D2M B;  4E71 A;  1KF6 B;  4XC2 A;  3DCG A;  2UYZ B;  2FE8 A;  3TEW A;  2O6V D;  3QCA A;  2CJN A;  2JSV X;  4ZDV A;  4MGI E;  4M8M A;  4MDK E;  2KYW A;  3AN1 A;  4M0W A;  4NQK E;  3UQA A;  1TZO A;  2KFK B;  4W9H A;  5D3D A;  2KOX A;  5KHO A;  2MQJ A;  1ZP0 B;  4E74 A;  1QIL A;  2N1V A;  2KX3 A;  3BY4 B;  4IG7 B;  5JH5 C;  3ZQ4 A;  2KKC A;  3W1Y A;  1MPE A;  4R3D A;  3KLS X;  2ZPY A;  1QQR A;  1WX8 A;  5D7G A;  3SD5 A;  2J7Q B;  3QA8 A;  5AZG A;  3PGE A;  2KT7 A;  3NUH B;  1XQQ A;  2WXJ A;  1SB3 C;  4NZL B;  2WGS A;  1FD6 A;  3ZXV A;  5FKA C;  2KN5 A;  2ZNV C;  4KSK C;  4IM0 A;  1EO6 A;  1XEE A;  2DBY A;  1AW7 A;  3U7Z A;  1VCB A;  4ZHO A;  4MGK E;  4LLG M;  4B6W A;  4RH6 A;  1UBI A;  2IO2 B;  2KJ6 A;  4FN2 A;  4GDL A;  4BBN C;  2KNB A;  1SE4 A;  2BS4 B;  3RD2 A;  1NBF C;  1WI0 A;  3PS6 A;  4I6P A;  1FIQ A;  5CHF A;  4HWI B;  3NZU A;  2KJH B;  4B0E A;  3M95 A;  2M1M A;  3AE1 B;  3M62 B;  2EKE C;  1X1M A;  3VRB B;  1YN5 A;  4MSQ B;  1ACC A;  4W9L A;  4URK A;  2K9X A;  1M94 A;  3V6C B;  3PRZ A;  3IHP C;  1I4P A;  2L8J A;  2RDG A;  2KQ4 X;  1UH6 A;  4ZRP A;  3N32 A;  4P7I A;  2MBQ A;  2DZK A;  1FO4 A;  3VR9 B;  1L0V B;  2DLB A;  3FC4 A;  1RFK A;  1JAL A;  3DDC B;  2G4D B;  4AUQ C;  4LNN A;  3U7D A;  2LGY A;  3H1U A;  2INC C;  3NOB A;  1XXG A;  3GP7 A;  3AEC B;  3L13 A;  2D07 B;  3RT3 B;  2JY6 A;  1UNS A;  2L1A A;  3SEB A;  4C4V A;  3APF A;  1NYR A;  3MC8 A;  2X8X X;  5EE3 A;  4TSS A;  2LGX A;  2CU1 A;  2PLP A;  2HE7 A;  2NPT B;  1V86 A;  3IT4 B;  4IWO A;  1UBQ A;  1PFD A;  1WX9 A;  1Z2M A;  2C7H A;  3R2I A;  2YEP F;  4MH0 E;  2LJ5 A;  3PRE A;  3MJ5 A;  1TS3 A;  1OEY J;  1WXA A;  2LFI A;  3C19 A;  4IM2 A;  2WX1 A;  3QX1 A;  1UGJ A;  1WXM A;  3PRM B;  4OZA A;  1IP9 A;  1WJN A;  3CWI A;  1YIW A;  3GB1 A;  1NEK B;  2KZR A;  2WXM A;  2FUG 1;  3GE8 C;  1TKG A;  1C3T A;  3TCA A;  4MT5 A;  3D32 A;  2BS2 B;  5AZH A;  1FMA D;  3VR8 B;  2J0M A;  3OWE B;  3AEE B;  2JWU A;  2J0J A;  4LK0 M;  2OJR A;  3ETR A;  3K9P B;  5CHV C;  4WWO A;  2AQ1 B;  5EE0 A;  2BTE A;  3VUW A;  3Q3F A;  4M01 A;  1DOY A;  4ARC A;  2KAN A;  5LLI A;  2VZK D;  1R4M I;  3MC9 A;  4ICU A;  3VUX A;  4PS3 A;  3H6N A;  3DBL B;  3OJ3 A;  3N1X C;  3RPF C;  2C9W B;  2BF8 B;  4JX1 C;  1WMH B;  1Y8R C;  4WWP A;  4ZRJ A;  1JRO A;  2EKI A;  2DYM A;  2J52 A;  4M02 A;  4RMA A;  4IOI E;  2BQQ A;  2KO3 A;  3Q3M C;  1V5O A;  1LXD A;  4XDC A;  3FIL A;  1ZUD 2;  5J17 A;  1DOX A;  3NS8 A;  3R3M A;  3X0W A;  1VR9 A;  2N9K A;  3B0A A;  3P2B A;  1NYQ A;  1WH3 A;  2N9P C;  1TJE A;  2N9E B;  2BKF A;  1OTR B;  3ZJT A;  3SFE B;  1YX5 B;  1EWC A;  1Y56 A;  4KIK A;  2RGF A;  4ITK A;  3RUL A;  3VH4 B;  4WQO B;  3ZGZ A;  1T0Q C;  4N58 A;  5H92 C;  1F77 A;  4MGY E;  1WX7 A;  2LUM A;  4GXB A;  3B1L X;  5G5H A;  3EFC A;  2HTM E;  2K8H A;  4WIP A;  4XWW A;  3KWL A;  3DQV A;  1V8C A;  3DWM A;  2CHZ A;  1JRU A;  1HE8 A;  1TKE A;  2Q5W D;  4F7Z A;  2JPH A;  2GI9 A;  2W54 A;  1PYW D;  3Q8E A;  2JU6 X;  2JVC A;  1VJK A;  1JML A;  3WAP A;  1P98 A;  5L95 C;  2WLB A;  2ZVO A;  1ENF A;  1JRP A;  3PT2 B;  4PT5 A;  4EEW A;  2LVQ A;  1WE6 A;  1IUE A;  3KVF B;  3L4P A;  3NJT A;  1AYF A;  1YN4 A;  3HK0 A;  2N9X A;  2KMA A;  1E10 A;  2J4X A;  3VXW A;  4MSM B;  4KDL B;  3UIN B;  4JGH B;  3NG0 A;  5C3J B;  5LXH A;  1XO3 A;  1YN3 A;  2KDI A;  1YQB A;  2N1W A;  4DDI D;  4BZA A;  1R7S A;  1ZW7 A;  1SEB D;  3ONS A;  2KDF B;  1A70 A;  1HA5 A;  4IM3 A;  3Q3J A;  2O6V A;  3GZN B;  3NVV A;  5IN7 A;  1FM0 D;  3M3J A;  4J6I A;  1K52 A;  1FXT B;  4YTP B;  2O2V A;  1JWA D;  2GLS A;  4AQ7 A;  2IZV B;  2INP E;  1PQS A;  3Q14 C;  1SIF A;  4KKI A;  2DEN B;  2I1J A;  5FK9 C;  5C1Z A;  3B2F A;  4GLS C;  2LRU A;  1EM7 A;  3DVN U;  3WIM A;  3IAS 1;  4LNF A;  1MHH E;  5BYQ A;  3BVG A;  2RDB C;  4IWQ A;  3GOE A;  3QQ8 B;  1ZDX A;  3R7R A;  1TY0 A;  4H2A A;  4HVB A;  3VUY A;  4YT0 B;  5DCN A;  2OED A;  1NVI D;  1WXQ A;  5LXI B;  4TKN A;  2XN9 C;  1L2N A;  5G2N A;  5C2T B;  2PEA A;  2D3B A;  4MEM A;  5CTR C;  3JSV B;  1R4N I;  3L17 A;  1P9D U;  3LJ3 A;  4X57 B;  4ZYS A;  2K6Q A;  3H7P B;  1TS4 A;  3VVW B;  2KTR A;  3ZDM C;  3E56 A;  5DPR A;  4LNI A;  1DYQ A;  5HFY A;  3CMM B;  4WAA A;  1WJU A;  3SR6 A;  1S1Q B;  3PLV A;  5MPO A;  2WXR A;  1V9J A;  1RLF A;  4GOC A;  3L08 A;  3LYY A;  2LJI A;  2ZJD A;  4ZYN A;  1VLB A;  1F1H A;  5IAA C;  3PRP B;  1J8C A;  2WDT B;  2E6X A;  3BYY B;  3SHQ A;  2SEB D;  1V2Y A;  1VD2 A;  3BWU D;  1KLV A;  3BVM A;  2HJ8 A;  1D5X C;  2V0G A;  2BVC A;  2NR2 A;  1F9J A;  2LWP A;  3ZYY X;  4NAM A;  1FNV A;  2XNA C;  2N7D A;  2I1K A;  2XK5 B;  1TKY A;  1UGM A;  1KLU D;  1UWM A;  4DBG A;  2GBJ A;  1I4R A;  2NBV B;  1YOV B;  3HVD A;  4IUM B;  4XZ4 A;  1KFY B;  1J0G A;  2WXI A;  2Z0E B;  4II2 B;  2FCQ A;  1P0R A;  2HJ1 A;  3MTN B;  2L32 A;  3AE9 B;  3N1Z C;  3AEG B;  3L10 B;  2K5P A;  3TBL D;  5KHQ A;  2BYT A;  3PHW B;  1CK1 A;  2K8B A;  3MFG A;  3ECI A;  5BMG A;  2LRW A;  4TV3 A;  5IP4 D;  1ZKH A;  4LTU A;  1E8Z A;  1Q10 A;  3J9C A;  2KDM A;  2K8C A;  1CZP A;  1QKZ A;  1UEL A;  3ZDT A;  2JXT A;  2KC1 A;  4OVV A;  2ZVN A;  5HHD G;  3PPA A;  5L83 A;  2PMV A;  4FJZ A;  1SE9 A;  4OVU A;  4C56 C;  1E8W A;  2MJD A;  1ZXH A;  3IT6 B;  3AE7 B;  2HDE A;  2M0A A;  2KAC A;  4WQM A;  5JXV A;  3NRZ A;  2L0F A;  4KGT A;  4RGT A;  4UDU C;  3TMP B;  2GBN A;  1S3S G;  3ZNZ B;  2QDF A;  3NVZ A;  2OOB B;  2WXN A;  2JZZ A;  3EA6 A;  1MG8 A;  4FJV B;  2K1F A;  3QAQ A;  3U8Z A;  2QIE B;  3B2G A;  3HUI A;  5EE9 A;  2LZ6 A;  2KMM A;  2FNJ B;  2G1E A;  2WS3 B;  2REX A;  2AQ3 B;  3HM6 X;  4PS8 A;  1WE7 A;  2PW9 A;  2RMM A;  3AV8 A;  1V97 A;  4OZB A;  2V1Y A;  3P4S B;  4PYZ A;  2KD0 A;  2QIL A;  2L3Z A;  4DWF A;  2J42 A;  2IO0 B;  2JYE A;  2KAJ A;  1V1O A;  4LNK A;  1PGA A;  4KDI C;  1Q1O A;  1UWX A;  2GOW A;  4WAF A;  2RD0 A;  3CST A;  2LVO A;  3RYT A;  4K3B A;  5IA7 A;  4NQL B;  3V61 A;  1CJE A;  3OJ4 B;  1OFF A;  2O2V B;  1XLP A;  2ZNV B;  2R61 A;  3AI5 A;  1SF0 A;  3HRD D;  1QF6 A;  3P42 A;  1NEN B;  4KSL C;  3IAM 1;  2NS5 A;  3W5U B;  2KC2 A;  1FRR A;  2KHW B;  1SE3 A;  2JUO A;  1WZ3 A;  2EMS A;  1PGX A;  2DAF A;  2K3U A;  2WU5 B;  4KGS A;  1XLQ A;  2WDV B;  3DBR I;  5E6P A;  4G0N B;  1T3Q A;  1E5W A;  3PSE B;  4A20 A;  2K25 A;  1WGK A;  4AJW A;  1WYW B;  1ZOY B;  2A4Z A;  3URY A;  2RSU A;  5IO9 A;  1RM6 C;  3L0W B;  3AE8 B;  3Q8B A;  3X23 A;  3ZJV A;  5BMH A;  2BYV E;  2RR9 A;  1IPG A;  3RI7 C;  4BOS C;  3UI3 A;  1KJT A;  4HDQ A;  4KVG B;  3DVG Y;  2M0X A;  1D6E C;  1YX6 B;  2MW5 A;  4MJS A;  4NPN A;  4EE2 A;  5E6J A;  3Q8F A;  2WXO A;  2JF5 A;  3JYU A;  4NAW B;  2C7N B;  1A5R A;  1JCK B;  3LXF A;  3ML9 A;  1YJ1 A;  4ZHP A;  4GDK A;  3GE3 C;  1D5Z C;  5JZE B;  4A55 A;  2KFJ A;  5TSS A;  1C77 A;  1GB4 A;  5FR3 A;  3DVG X;  2MWS B;  3AM9 A;  2IPK D;  4S0R A;  1WGD A;  2KVZ A;  4JLC A;  3ZNG C;  1IBX B;  4L1B A;  3BK1 A;  1F2R I;  2WXQ A;  1KOT A;  1NDD A;  1WXV A;  2DYB A;  2IGD A;  2MP2 B;  2GBM A;  3VQI A;  1EF1 A;  4YWG G;  4IW0 A;  3ZW3 A;  1MJD A;  1EU3 A;  2DZI A;  4WJP A;  4USA A;  4LCD E;  2IDY A;  4D2K A;  2BW2 A;  1V1P A;  3BYT B;  1L0Y B;  4A8X C;  3DBS A;  1H8C A;  4DHZ E;  5G55 A;  3BK2 A;  2J53 A;  2M4N A;  3H8H A;  2PVG C;  4B9K A;  2L00 B;  4HPM B;  4TQ1 A;  2KLC A;  4G3X B;  1F2R C;  2KQS A;  2MJE A;  4W9E A;  1HEZ E;  1BUI C;  2DZJ A;  3T3O A;  2CU3 A;  1I42 A;  3A9K B;  3RCZ A;  4A90 A;  4HEA 1;  3VAW A;  1WGR A;  1J7B A;  4K81 A;  1E9M A;  3UIO B;  3ZUN A;  1WR1 A;  1SXT A;  1ZDV A;  2V4I B;  2NBW B;  5D94 A;  4PS7 A;  2DYO A;  4ASW C;  2ACZ B;  2RDH A;  3DVN V;  5JHA A;  3A1Q B;  1IGC A;  3TSS A;  3WAL A;  2W82 A;  2AQ2 B;  1QOG A;  4DXA B;  2WXL A;  2C7M B;  1LM8 B;  4OHJ A;  1B9R A;  4HRO A;  2C60 A;  4P1C C;  3B08 A;  2ZCB A;  1E7U A;  2VZK B;  1QOF A;  1WIA A;  1TGZ B;  3SDL C;  5JHB A;  2E3T A;  4US8 A;  2PKO A;  3KUZ A;  4ACF A;  3O65 B;  4BOZ B;  4JE3 B;  1WZ0 A;  4QAY A;  2RPV A;  1AWD A;  1UD7 A;  4M0W B;  4DHZ B;  3ALB A;  1I4X A;  3ZNH B;  2MBO A;  2HTH A;  3A4S C;  3ZNI D;  3TL5 A;  4P1B C;  4O1N A;  2R2O A;  3DWG C;  4WUR A;  2KVR A;  1ISN A;  2LUE A;  3AEF B;  4WWM A;  2D3G A;  1PDX A;  1YQ3 B;  1GUA B;  1BXT A;  2DX5 B;  3FKY A;  5H8Y E;  1RRB A;  2FCN A;  2WXF A;  2AYO B;  1DGJ A;  1EU4 A;  2K39 A;  3KUC B;  2UWQ A;  4HPL B;  2DNF A;  2V9H A;  3R2T A;  4BAX A;  5HKH A;  2EEL A;  2MH7 A;  2AX5 A;  1V6E A;  4NJ6 A;  4BKS D;  5D3I B;  3HHM A;  4A9A A;  4LDT D;  2MA9 B;  3RNG C;  2JX5 A;  4MEL A;  1XT9 B;  4GDL B;  4IC7 B;  5CX3 A;  4LNO A;  2EMT A;  5HI1 A;  1WGY A;  1ESF A;  3A9J A;  2LXC A;  1YNT E;  4DHJ B;  3V3X A;  2GMI C;  1K8R B;  2MBH A;  1EUV B;  4K7U A;  4HRS A;  3QJZ A;  1MFW A;  1WGG A;  2TSS A;  3RZF A;  4AWJ A;  3KYD D;  2VRR B;  4K7W A;  4W9D A;  1L5P A;  4A3P A;  4ZOH C;  1JWB D;  3ZIM A;  3P63 A;  2KXJ A;  2M8S A;  3DBH I;  2QEJ C;  4L23 A;  4HDO A;  1EWY C;  4WJQ A;  2KWD A;  2KFK A;  2BT6 A;  1ET9 A;  1WFY A;  1V49 A;  2ZPN A;  4M00 A;  2NBU A;  3RNA C;  4FA6 A;  1UZX B;  3AE2 B;  4GGQ A;  4KZ0 A;  1HXY D;  1RYJ A;  3NHE B;  3TEZ A;  2V4L A;  3LDZ E;  4S17 A;  4NNJ B;  1I4Q A;  4WJO A;  2FCS A;  3AEA B;  2W3S A;  1RFA A;  1E0Z A; 
#chains in the Genus database with same CATH homology
 4OVZ A;  1OQR A;  3AE1 B;  4C56 C;  3VRB B;  2MJD A;  2WNM A;  1YN5 A;  1ZXH A;  3RFZ B;  3IT6 B;  1L6V A;  3AE7 B;  1ACC A;  4ZRQ A;  2HDE A;  3ABV B;  2M0A A;  2K9X A;  2WQY B;  2KAC A;  4WQM A;  3EUB 2;  4YTM B;  5HG2 A;  4P16 A;  5JXV A;  5T8I A;  3AEB B;  3E9S A;  3NRZ A;  4KGT A;  4RGT A;  4UDU C;  1VZ8 A;  3NVZ A;  1I4P A;  2WXN A;  2RDG A;  2KQ4 X;  1TS2 A;  2LHD A;  3EA6 A;  1HZ5 A;  2V3N A;  4ZRP A;  3NZ3 A;  1SIJ A;  2QIE B;  3TEX A;  3B2G A;  3HUI A;  2I38 A;  5EE9 A;  2KMM A;  1YQ4 B;  2WS3 B;  2G1E A;  1FO4 A;  2AQ3 B;  3VR9 B;  1JQ4 A;  1L0V B;  2DLB A;  2PW9 A;  3FC4 A;  2RMM A;  1RFK A;  1JAL A;  2JZP A;  1FXA A;  3AV8 A;  1V97 A;  4OZB A;  3P4S B;  1D5M C;  1UUP A;  1E7P B;  2G9H D;  4HKQ A;  1P7E A;  1XXG A;  3GP7 A;  1SJE D;  3AEC B;  2QIL A;  1FRD A;  2J42 A;  1UNS A;  2JYE A;  2L1A A;  3SEB A;  2KAJ A;  1V1O A;  1NYR A;  2WDQ B;  3PZ7 A;  4DQO C;  1HZ6 A;  3P4P B;  4CQN A;  1PGA A;  3TEY A;  1C78 A;  1UWX A;  3C8Y A;  4WAF A;  4TSS A;  5EE3 A;  2PLP A;  3IT4 B;  1YJJ A;  1PFD A;  1N5X A;  3R2I A;  2N9L A;  2YEP F;  3W5V B;  1J7A A;  1FFU A;  3AH7 A;  1CJE A;  2WXP A;  4DXF A;  1OFF A;  3MJ5 A;  1C4A A;  1TS3 A;  1TYG B;  2LFI A;  2ONQ A;  4RGN A;  2I2Y A;  3U52 E;  1XLP A;  2JYT A;  1UGJ A;  2DWQ A;  4OZA A;  2ON8 A;  1C79 A;  2R61 A;  3CWI A;  3GB1 A;  1NEK B;  1SF0 A;  3HRD D;  3I9V 1;  1QF6 A;  1N62 A;  2WXM A;  2IGG A;  1N61 A;  2ZW1 A;  2FUG 1;  3P42 A;  1NEN B;  3I57 A;  3IAM 1;  3W5U B;  1TKG A;  4RGM A;  1FRR A;  3FIL B;  4MT5 A;  1AN8 A;  1SE3 A;  1T6B X;  4JWU C;  2BS2 B;  1FMA D;  3VR8 B;  1PGX A;  2K3U A;  1ZE3 D;  2IJ0 A;  3OWE B;  2WU5 B;  3AEE B;  4KGS A;  2JWU A;  1XLQ A;  4LK0 M;  3ETR A;  2WDV B;  4IDI A;  2AQ1 B;  5EE0 A;  2BTE A;  2ZW0 A;  1T3Q A;  2W3R A;  1C9F A;  1DOI A;  1KLG D;  1SBB B;  1SJH D;  1GAQ B;  2M19 A;  4GDK B;  2GB1 A;  1WGK A;  1DOY A;  4ARC A;  1ZOY B;  2KN4 A;  3URY A;  2VZK D;  2K22 A;  1L4Z B;  1KH0 A;  3NS1 A;  1RM6 C;  3Q8A A;  4RGO S;  3AE8 B;  3Q8B A;  1XLO A;  2H89 B;  3ZJV A;  3IXS A;  5BMH A;  1FXI A;  1XLN A;  3RPF C;  4JX1 C;  3UI3 A;  1QLB B;  1JRO A;  4YSY B;  2EKI A;  2DYM A;  2WDR B;  2J52 A;  1D6E C;  3P1M A;  4P6V F;  5GXG B;  4MH8 A;  4IOI E;  4YSZ B;  1LO5 D;  4NJC A;  4EE2 A;  5E6J A;  3Q8F A;  4XDC A;  3FIL A;  2WXO A;  1ZUD 2;  5EE1 A;  1BML C;  1DOX A;  1YMH E;  1QOB A;  2V3P A;  3LB8 C;  1ROE A;  4NAW B;  1FFV A;  1V1P B;  3AE5 B;  1JCK B;  1VR9 A;  2PIA A;  2LHE A;  2N9K A;  1YJI A;  3LXF A;  1NYQ A;  1C76 A;  5G5G A;  1SSN A;  1TJE A;  3P4Q B;  4ZHP A;  1K51 A;  1D5Z C;  3AE4 B;  3KQ4 A;  4A55 A;  4KKJ A;  3ZJT A;  1GOZ A;  5TSS A;  1FEH A;  1C77 A;  3SFE B;  5FR3 A;  1GB4 A;  3AM9 A;  3AE6 B;  2IPK D;  1MI0 A;  1EWC A;  3VRA B;  1Y56 A;  3KWV A;  4ITK A;  1IBX B;  2GRI A;  4WH4 A;  4L1B A;  2W55 A;  4J3O D;  3BK1 A;  3ZGZ A;  2Y5C A;  1F2R I;  2WXQ A;  4N58 A;  1PGB A;  1I4G A;  1I7H A;  5BYS A;  4RF0 A;  1QT9 A;  5H92 C;  2IGD A;  2QSD A;  3PZ8 A;  1F77 A;  2JQR B;  1E6E B;  2MEK A;  5AUI A;  3VQI A;  2LUM A;  4YWG G;  5G5H A;  4YXD B;  2HTM E;  3WCQ A;  2M56 B;  3AB5 A;  2BS3 B;  4YSX B;  1EU3 A;  4WIP A;  4XWW A;  1XCQ L;  1TS5 A;  3KWL A;  4OW0 A;  4USA A;  4ARI A;  1V8C A;  2IDY A;  3DWM A;  3W2D A;  4D2K A;  2BW2 A;  1V1P A;  3BYT B;  1TKE A;  2Q5W D;  3PO0 A;  1JWU D;  1L0Y B;  2GI9 A;  2IGH A;  2W54 A;  4A8X C;  2Y3A A;  1PYW D;  3Q8E A;  2JU6 X;  1PUT A;  2LGI A;  5AUK A;  4RF1 A;  1ZXI A;  3BK2 A;  1JWS D;  1VJK A;  2J53 A;  1JML A;  4FXC A;  3H8H A;  4KGR A;  1NI3 A;  2WLB A;  3O13 A;  3T3N A;  2PVG C;  1ENF A;  1JRP A;  3FAH A;  4TQ1 A;  4PT5 A;  4IKG A;  4JPS A;  4C80 A;  2H88 B;  1IUE A;  2BB5 A;  1F2R C;  3L4P A;  2MJE A;  1L0X B;  1AYF A;  1YN4 A;  2D5G A;  1IBX A;  1HEZ E;  1BUI C;  2WXH A;  2CU3 A;  3T3O A;  1E10 A;  2J4X A;  1C4C A;  2Z8L A;  1GPX A;  3HVZ A;  1CQV A;  2QMT A;  1OQQ A;  4A90 A;  5C3J B;  1XO3 A;  4HEA 1;  1YN3 A;  4YTN B;  2WP9 B;  2L52 A;  1N5W A;  4US9 A;  2NTT A;  1J7B A;  1IGD A;  1R7S A;  2BBC A;  1E9M A;  2LEK A;  1VZ7 A;  1SEB D;  1HQR D;  2NMQ A;  3MC0 B;  1KRH A;  4C7Z A;  2K0P A;  1A70 A;  1HA5 A;  1SXT A;  1ZDV A;  2X38 A;  2V4I B;  2OHF A;  3NVV A;  3NVW A;  1I4H A;  1FM0 D;  2DYO A;  1F0Z A;  1K52 A;  1K50 A;  4YTP B;  3W9C B;  2ACZ B;  4N6E B;  1JWA D;  2N7J A;  2RDH A;  3N9Y C;  4AQ7 A;  1B1Z A;  1IGC A;  2INP E;  2FBW B;  3TSS A;  1WRI A;  2W82 A;  2AQ2 B;  3AE3 B;  1QOG A;  4KKI A;  2WXL A;  5FK9 C;  2L83 A;  1GB1 A;  3B2F A;  1KTK A;  4OHJ A;  1T5X D;  1MVK A;  4GLS C;  1B9R A;  4B0M A;  4HRO A;  1QOA A;  1WWT A;  1EM7 A;  1RWS A;  2INN E;  3CIR B;  2VZK B;  3IAS 1;  1QOF A;  3Q69 A;  3Q8C A;  1MHH E;  1FCL A;  5BYQ A;  3BVG A;  1FCC C;  1ZDX A;  2E3T A;  1TY0 A;  2WU2 B;  2PKO A;  4JWS C;  4US8 A;  2PTL A;  4H2A A;  4OZC A;  1WYG A;  3V05 A;  4RCO A;  1ZPS A;  3MHZ A;  3GS2 A;  5BYR A;  1STE A;  1VDV A;  4YT0 B;  4JE3 B;  4TQ0 A;  2OED A;  2RPV A;  1NVI D;  2N0S B;  1WXQ A;  1AWD A;  1TY2 A;  3NVY A;  1J7C A;  3R8B A;  1I4X A;  1XF5 L;  2LMC A;  3SFD B;  2XN9 C;  2YEP B;  1L6U A;  1VRA B;  5C2T B;  2CJO A;  4XDD A;  4O1N A;  4RNA A;  4TMA B;  3U2S C;  1VZ6 A;  3DWG C;  1MHX A;  4WUR A;  4C7Y A;  3TUO A;  4ZYS A;  1L4D B;  2SAK A;  2WXK A;  1TS4 A;  4RFB A;  1C4P A;  4REZ A;  2B76 B;  2MJ3 A;  3AEF B;  4WWM A;  4HJG E;  3E56 A;  4Q2J A;  2ICI A;  1PDX A;  1YQ3 B;  3U4E G;  1BXT A;  1DYQ A;  5HFY A;  3AMZ A;  5H8Y E;  3W1S A;  2WXF A;  3SR6 A;  5MPO A;  2WXR A;  1DGJ A;  1EU4 A;  1KF6 B;  1N63 A;  3B9J A;  1P7F A;  4MM3 B;  2FE8 A;  3TEW A;  3LYY A;  3BII D;  3R2T A;  4A6Q A;  2LJI A;  1VLB A;  1XCT L;  2EEL A;  2MH7 A;  2QJL A;  2AX5 A;  3ZJU A;  2CJN A;  2JSV X;  1FNU A;  2E6X A;  3BYY B;  2SEB D;  3AN1 A;  2PVO D;  4M0W A;  5D3I B;  4A9A A;  3BWU D;  4XWT A;  1TZO A;  3BVM A;  3P4R B;  2NTS A;  5D3D A;  1K53 A;  2JX5 A;  1ZP0 B;  1D5X C;  1QIL A;  3MP9 A;  2V0G A;  3ZYY X;  4GDL B;  4NAM A;  1FNV A;  2XNA C;  5HI1 A;  1TKY A;  3BZD B;  1WSP A;  3ZQ4 A;  3EGR A;  4DXG A;  1ESF A;  1KLU D;  1UWM A;  1MPE A;  1I4R A;  4KX6 B;  4R3D A;  3KLS X;  1QQR A;  3HVD A;  5D7G A;  1KFY B;  1YNT E;  5LNK 1;  3NUH B;  2WXG A;  2WXI A;  2WXJ A;  3V3X A;  1M4V A;  1FNW A;  4AS1 A;  1SB3 C;  4NZL B;  1FD6 A;  4HRS A;  2BB6 A;  2TSS A;  1SE2 A;  5FKA C;  2L32 A;  3AE9 B;  4N59 A;  3AEG B;  4HKZ E;  1XEE A;  2K5P A;  1L5P A;  4ZOH C;  2BYT A;  1JWB D;  2DBY A;  3P63 A;  1AW7 A;  4L2Y A;  1CK1 A;  3U7Z A;  1JW9 D;  2QEJ C;  4L23 A;  3MFG A;  1EWY C;  5BMG A;  4ZHO A;  2Y5P A;  2KWD A;  2BT6 A;  1ET9 A;  4LLG M;  1JWM D;  3BVZ A;  4RH6 A;  5I4D A;  4LTU A;  1Q10 A;  1D4B A;  1SE4 A;  3J9C A;  2KDM A;  3AED B;  4XE0 A;  1CZP A;  3AE2 B;  1QKZ A;  5BMI A;  2BS4 B;  4MAC A;  1HXY D;  2JXT A;  1RYJ A;  3TEZ A;  1N60 A;  5HHD G;  1FIQ A;  1ET6 A;  2PMV A;  1I4Q A;  4B0E A;  3AEA B;  2W3S A;  1E0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...