1J7CA

Structure of the anabaena ferredoxin mutant e95k
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
b'ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEKDLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN I
publication title Structure-function relationships in Anabaena ferredoxin: correlations between X-ray crystal structures, reduction potentials, and rate constants of electron transfer to ferredoxin:NADP+ reductase for site-specific ferredoxin mutants.
pubmed doi rcsb
source organism Nostoc sp. pcc
molecule tags Electron transport
total genus 25
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1j7cA00
1N62A 1F0ZA 1J7AA 3FC4A 1FRDA 1L0VB 1UWMA 2WDVB 1KF6B 3AE2B 3LB8C 5H8YE 3HVZA 2CJNA 3BIID 1FIQA 3AE7B 3NRZA 2Y5CA 1KFYB 1OQQA 2PKOA 2W55A 1YQ4B 1RM6C 1RFKA 1FRRA 3SR6A 3VR9B 3PO0A 3CIRB 1TKEA 3P4RB 5EE0A 3LXFA 1XLOA 4WQMA 2N0SB 4N59A 2W3SA 1QOFA 1ZXIA 1SIJA 1JWBD 1GAQB 4KX6B 1QF6A 3AM9A 1L5PA 4JX1C 1A70A 4ITKA 4C80A 4USAA 2WQYB 1L6UA 4YSZB 1WGKA 4US9A 4YXDB 2QIEB 3VRBB 2BS4B 2PVOD 1PUTA 2W3RA 3AMZA 2MJDA 1PDXA 1VLBA 3DWGC 3KWLA 1JQ4A 4HRSA 1TKGA 4JWSC 3AEAB 4US8A 3AE4B 1NI3A 1ZOYB 1JROA 1OFFA 1N5WA 3VRAB 4YSXB 2H88B 1TYGB 3B9JA 1JALA 1WYGA 3HRDD 1ROEA 1N61A 2L83A 3AE6B 3DWMA 1DOIA 5AUKA 3W5VB 1E0ZA 1NENB 3HUIA 2M56B 2DBYA 3AEBB 3ZYYX 1OQRA 2BT6A 1VDVA 2G1EA 2Q5WD 1VJKA 1WWTA 2BS3B 1YQ3B 5MPOA 3P4PB 1E6EB 2DWQA 4FXCA 2AX5A 1E10A 1EWYC 1FFVA 1FO4A 3AB5A 2WU5B 1PFDA 1WXQA 2WU2B 1TJEA 5GXGB 2JX5A 4ZOHC 1XO3A 4IDIA 2PIAA 2JQRB 2L52A 2MH7A 2H89B 2WP9B 1TKYA 3AH7A 2EKIA 1I7HA 4ZHOA 1YJJA 1FXIA 2WDRB 3AEEB 3P4QB 2CU3A 1E9MA 1NVID 3SFDB 4C7ZA 1XLPA 1CJEA 4LTUA 4A9AA 1QOGA 1ZUD2 2HTME 1IUEA 2OHFA 3FAHA 3AEFB 4YSYB 4YTPB 1RYJA 2FBWB 3ABVB 1DGJA 5EE1A 5G5HA 1L6VA 2E3TA 1DOXA 1E7PB 1FFUA 1NYRA 2B76B 1ZP0B 4YTNB 1AYFA 1JWAD 1FM0D 2WLBA 3AE9B 2WDQB 3AEDB 1KRHA 1QOBA 2KAJA 1QT9A 3ETRA 1N5XA 3EUB2 5G5GA 1YJIA 4N58A 4P6VF 1J7CA 4YT0B 3AECB 3AE5B 5AUIA 2K5PA 2WS3B 3AV8A 1J7BA 4JWUC 5H92C 2BS2B 1XLQA 4YTMB 3CWIA 1T3QA 3NVZA 3SFEB 3AN1A 1FMAD 1GPXA 1CZPA 1JRPA 3NVWA 1QLBB 1N60A 3P1MA 1SB3C 1N63A 1V97A 3L4PA 1V8CA 3NVYA 3AE1B 3AE3B 2LEKA 3AE8B 3W5UB 3P63A 3AEGB 5EE9A 2M19A 1AWDA 3P4SB 4C7YA 1FXAA 3VR8B 2QJLA 3B2GA 1R7SA 1WRIA 2ACZB 4N6EB 5C2TB 1QOAA 2KMMA 3WCQA 1B9RA 1SF0A 1NYQA 1XLNA 3W9CB 1RWSA 2MJ3A 2MJEA 3NVVA 1NEKB 2W54A 3NS1A 4ZHPA 1DOYA 5EE3A 1JW9D 2K9XA 2K22A 3RPFC 3B2FA 4HROA 2CJOA 2PVGC 4WWMA 5C3JB
chains in the Genus database with same CATH superfamily
4R3DA 2ZEQA 2KJHB 2KFJA 4K1RB 2PLPA 1PYWD 2GLSA 4WAAA 4WJPA 5E6NA 4DXGA 4WQMA 2M8SA 4TUUA 1WE6A 2R2OA 3RNAC 4ITKA 1ZGUB 3H7PB 4US9A 1YOVB 1PUTA 4LNFA 2KZRA 3L54A 2BVCA 4JWSC 4LK0M 3OJ4B 2D3GA 4G11A 3BWUD 2VH2A 1NI3A 3ZDMC 2BWFA 2KQ4X 1RLFA 1WZ0A 2GBRA 2OOBB 4JGHB 1P9DU 3APFA 4BFRA 3FILB 1GOZA 1RAXA 2WXQA 3V62A 2QSDA 2WU5B 2WU2B 1ISNA 1HA5A 5GXGB 3ZW3A 3O65B 4IM0A 1WR1A 1IYFA 3P42A 4DK5A 1LFDA 4GU2A 1UH6A 1MHXA 2OHFA 3VXWA 1E5WA 2C7HA 3ABVB 1FFUA 2BYFA 1ZP0B 3Q3JA 4RGMA 4A6QA 2B3AA 3IXSA 3VHTC 3JW0X 1P0RA 1KLGD 4HXDA 1EF5A 4YTMB 2JYTA 3A4RA 2IJ0A 1M4VA 4KKIA 3PS6A 2JVCA 4AWJA 1KJTA 4DXAB 3NVYA 1I4GA 3AE1B 1V81A 1L0YB 2CHWA 4W9LA 2MA9B 4KGTA 5E6JA 1CMXB 5DPRA 2BWES 3NS1A 2GMIC 1MG4A 1JMLA 5E6OA 4KV2A 1N62A 4HPMB 3ECIA 4KGSA 4II3B 2MEKA 1KOTA 3NZUA 4PT5A 5LLIA 2KN4A 4BOSC 5HG2A 2INPE 4KX6B 3RUIB 4RNAA 2Z0DB 5T8IA 2N9LA 4QAYA 2GBKA 1LO5D 1V80A 4HK2A 2KDMA 5CX3A 2KKCA 4OZCA 3NZSA 1VZ8A 4P7IA 3R2IA 3I63C 2IGGA 1YQ3B 2LRWA 2UU7A 4RFBA 3RCZA 1FO4A 1ET9A 2L7RA 1TS5A 4IDIA 1I7HA 2CU3A 5BMHA 1E9MA 4W9JA 2AQ3B 4M00A 4N9F4 2J53A 2FNJB 5D3IB 1TZOA 3NY5A 2MBOA 5HFYA 1QILA 2JZPA 3RULA 4XE0A 2VZKD 3MJWA 2DZKA 3PZDA 2KDBA 1ZE3D 2K5PA 2WS3B 3AV8A 5H92C 2INCC 4A3PA 3NUHB 2L3ZA 1SSNA 4L23A 1V97A 1I4PA 4MEMA 1Q0WB 3I57A 3VR8B 4EEWA 4G50A 2IZVB 3TSSA 3MC0B 1WMHA 3PV1A 3Q2AC 3TEXA 2DLBA 4I6NB 2IBIB 3ZJTA 2K22A 1Z2MA 3RFZB 5J18A 2JU6X 5EDSA 1WJNA 3PLUA 3UIOB 4ZDVA 1D5ZC 1TBEA 1KF6B 2IY1B 4DHJD 2K8HA 2W9NA 2WXJA 4DHZB 1XLOA 4M8MA 1E7VA 2K8CA 3ZIMA 2LXAA 1V9JA 4HCPB 1YNTE 2O6VB 5BYRA 1ZKHA 3GZNI 4NZLB 2PVOD 1D3ZA 4MSQB 3Q3NC 3W2DA 2KYWA 4GDKA 1VRAB 3B9JA 2M0AA 4HPPA 3W1SC 3U2SC 4ICUA 3AEBB 3DVGY 1XXGA 1WI0A 5KHOA 5BMGA 2BS3B 2TSSA 2GBMA 5IP4D 3ZJVA 1NDDA 1FFVA 1UELA 2WXPA 1PFDA 2KC2A 4HVBA 2N7DA 4WWPA 4ZRPA 3BZDB 1XO3A 2JQRB 4MJSB 3VQIA 3VH3B 2CHZA 1C4PA 4YTPB 4GLSC 1AYFA 3T9LA 1Y56A 3DBSA 4IM2A 1WX7A 4GDLB 5IO9A 1FNUA 4YL8A 2JY6A 2J0MA 4RGNA 3Q8CA 3NVWA 3UIPB 1WZ3A 4NQKE 4HCNB 4ASWC 1KH0A 3DVGX 1WX8A 1GNUA 1RFAA 1QOAA 3QC8B 3BVGA 2ZJDA 5D6JB 3WA0A 3EFCA 2EKEC 1LQBA 1A5RA 1H4RA 1ESFA 2JUOA 2JRIB 1FRDA 1L0VB 1L0XB 4MACA 2LRUA 4ZYSA 2J4XA 3T8MA 1FRRA 1MVKA 3SR6A 2KWVB 5EE0A 3KLSX 2MBEA 3V6EB 5FR3A 1QOFA 1SIJA 3MHZA 1JWBD 3AM9A 3BVMA 3KUDB 4GN1A 2BS4B 3DCGA 4XX5A 1P98A 2N1VA 3AEAB 1WGGA 3GP7A 4XZ4A 4US8A 2DX5B 3KWVA 1F2RC 1YIWA 4MGIE 5C23A 1HTQA 3Q8BA 1OQRA 1S1QB 4URKA 5BYSA 3L08A 1MJDA 1TS3A 3ZRCA 2GBJA 3HM6X 5TR5A 4LLGM 4BBNF 1QZEA 4HKZE 4W9IA 1TKYA 2WXOA 3AH7A 1YJJA 2KQ7A 1J8CA 3CSTA 5TSSA 4A9AA 4ARIA 2MBQA 1WXAA 2HTME 2M1MA 4B95A 4G3XB 3K9OB 3ETRA 3IBEA 1J7CA 2LZ6A 1FCCC 2Y5PA 2HTHA 2KLCA 3IAM1 1T3QA 1IBXA 1P7EA 1WJ4A 1V8CA 3N1ZC 2ZW0A 4C00A 2WXGA 1SEBD 1ZW7A 4WIPA 5J2RA 2K6DB 3JSVB 2FCSA 1T5XD 1SE3A 4K7SA 1LXDA 4DWFA 2OJWA 3SU8X 1T0YA 2MWSB 2CJOA 1C9FA 5J17A 1XCQL 4KSKC 3NRZA 1KFYB 2W55A 3EC8A 3URYA 3PO0A 1ZDVA 3DHGC 4XYCA 3RT3B 1SJED 1E8XA 2KN5A 4C80A 4C56C 1L6UA 4BZAA 4JQWC 2QIEB 5L95C 4ANWA 3QIJA 1HEZE 4DQOC 2KQSA 2AL3A 1JROA 2MP2A 4HJGE 2RDGA 2K39A 3R66C 1VJKA 1FNWA 2XBBC 1Q10A 2DNFA 1UD7A 1UGMA 2R61A 4IOIE 4W9CA 2DZMA 5DPTA 2KT7A 1WIAA 1WJ6A 1XF5L 4XWTA 3WAOA 2MP2B 3MJ5A 3PRMB 4W9DA 3VTWA 4RGTA 4TQ0A 1T0SC 2EMTA 2BB6A 3B1LX 4PYUA 2NPTA 2FCQA 3KW5B 1L4ZB 2M17A 1UBIA 3M62B 3ZNID 4FHJA 3AN1A 3L4PA 4IWPA 1UUPA 2RDBC 2FIFA 1D4BA 3DPDA 1FXAA 1PGAA 3RMKC 4B0MA 2V3NA 4W9KA 1WX9A 1NYQA 3RZWC 1XLNA 2NVUI 3HHMA 2L00B 2CJNA 4EE2A 3KUZA 2WDTB 2NMQA 1EWCA 4MELA 3CIRB 4HJKA 2AQ1B 2YLMA 3Q69A 2D2QA 1XCTL 5CHWA 3H7PA 2FUHB 3ZRFA 3C8YA 3DBLB 2MRPA 2MJDA 4P16A 1ZOYB 4X57B 5DCNA 1N61A 2D10A 1UNSA 3ZGZA 2KWUB 1K51A 2JF5A 3FILA 2GB1A 3AB5A 2WHIA 1WXQA 4MM3A 3RYTA 3PREA 4ZOHC 2MW5A 4M0WB 1WF9A 1JRUA 2DHZA 3U52E 2WWZA 1K53A 1IGCA 3IVFA 3R8BA 1L6VA 4PS7A 3EFUA 2WLBA 5DPSA 2Z59B 2IY0B 2KDEB 5JHAA 3DDCB 2L8JA 4MM3B 4IW0A 3JVZX 3MC8A 4EUTA 4XWWA 1IGDA 1FMAD 1SE9A 4DXFA 3L17A 4WAFA 4PS8A 2LGDA 4KDIC 4MDKE 3DHIC 1TS4A 3AXCA 4HWIB 1N6ZA 1WRIA 4ACFA 4W9GA 5C2TB 1VD2A 2MJEA 4K81A 3PPAA 4GOCA 3SEBA 2D5GA 4AP4C 2L0TA 4WWMA 2LMCA 3OWEB 2K8BA 4GSWA 2PMVA 3ENEA 2Y3AA 3NS8A 1RM6C 4EFOA 2KO3A 3L10B 1V1PB 2NTSA 4IG7B 4O1NA 2QCZA 2HJ1A 1E8ZA 1YQBA 2ONQA 2W3SA 2NBWB 1T6BX 2WX0A 4USAA 3RNCC 5HKHA 2KNBA 4XGAB 1GC7A 4EZLA 2WXRA 2I38A 3Q3FA 1NENB 2BW2A 1WSPA 4WH4A 2V9HA 2KX3A 2Q5WD 4MSMB 5D94A 2RSUA 1ZPSA 2NTTA 2RR9A 1EU3A 3M3JA 2KWCA 2L32A 2HDEA 1TJEA 1XQQA 2PIAA 2L52A 3UQAA 2CS4A 2LXCA 1FXIA 3DBRB 3AU4A 1WGYA 3Q3MC 1NBFC 3PHWB 3SDLC 2K1FA 4B6WA 2PEAA 3Q8EA 1HQRD 1P1AA 2FCNA 2JWZA 2MBBB 3C19A 2FCMA 3J9CA 1M94A 3HVDA 3U4EG 1XLQA 1E8WA 4JIOU 4LDTB 1F52A 2KXJA 3UINB 3ZQ4A 2KHWB 1YX6B 2WXMA 2G4SA 2YVCA 5JH5C 2QJLA 5FR6A 2D3AA 2OJRA 1C4CA 4GIVA 2UYZB 1E8YA 5EE3A 2ZVNA 1JW9D 1F2RI 3B2FA 4HROA 2O6VD 2PE9A 2MLBA 4BBNC 5H8YE 3I5JC 1GJZA 3EECA 1HZ6A 1EF1A 1OQQA 1MHHE 3VR9B 2LGIA 2SEBD 3V6CB 4L1BA 1EUVB 3PSEB 1F9JA 3PHXB 4XDDA 4FJYA 4OW0A 3I3TB 3PTFC 4JX1C 4OZAA 2O6VA 4A20A 2ZZPB 4BVUC 1V49A 3IFWB 3ZNGC 4KIKB 3W1SA 3ML9A 2HD5B 4FJVB 2V3SA 1SE4A 4CHKA 4OVVA 3HRDD 1ROEA 2Z0EB 3DWMA 3ZKJC 4JLCA 3ZYYX 2DBYA 1SJHD 1KM7A 3P4PB 4HPLB 4AS1A 1E10A 2MBHA 4A3OA 3E56A 4W9EA 2WP9B 4MJSA 3BYTB 3AEEB 2NBUA 3PRPB 2RD0A 3FAHA 2K25A 2FBWB 3A33B 2B76B 1XD3B 4D2KA 1QOBA 4UDUC 3UGBB 3H8HA 3U7DA 3TL5A 3TEYA 2V4IB 3N32A 4IM3A 4JWUC 4RF0A 4GDLA 3MFGA 4M8NA 1WXVA 3JYUA 3WALA 5LXIB 5AZHA 1FXTB 3AE8B 2KLGA 2MX2A 3AEGB 1MPEA 1C79A 1VZ7A 4TQ1A 1R4NI 5D2MB 3WIMA 4WJQA 3R3MA 3A1QB 1NEKB 4A8XC 2L05A 1FPYA 1HTOA 1QKZA 3L13A 3T3OA 4P1BC 3BIID 1C1YB 4LJPB 4EKUA 5JHBA 3VDZA 2EMSA 3QA8A 2DAFA 3CF6E 4FJZA 4GMVA 4XDCA 3LYYA 1L5PA 2WQYB 3BINA 5HHDG 3VRBB 3U8ZA 1S3SG 1WE7A 4WJOA 3ZXVA 4TV3A 4YSXB 1OQYA 2H88B 5AUKA 3DVNV 3QCAA 2I1JA 3HUIA 2LGSA 1HZ5A 1VDVA 2INNE 1ZDXA 4NJCA 2MHJA 3ZXRA 1EWYC 2C5LC 4RH6A 4E3CA 2KFKB 3VUWA 4WJNA 3LDZE 3PT2B 4P1CC 4C4VB 2MH7A 5BYQA 3SFDB 1KLUD 1CJEA 4JE3B 4S17A 3VTVA 3K9PB 2ZVOA 2ZW1A 2IO1B 4ZRKA 2XNAC 3IHPC 1QT9A 1WYWB 2M4NA 2FUG1 2KWDA 1SXTA 1YJIA 2QEJC 2C7NB 3NZ3A 2J52A 1WRDB 1V5OA 3P1MA 1MG8A 5CTRC 2JWUA 2PW9A 1J19A 2MCNB 4CYEA 3KVFB 4LCDE 4FN2A 4IWQA 1PQSA 4IKGA 3JSVA 1TS2A 3U7ZA 3DBLI 2V1YA 1TY0A 3NJTA 4MT5A 3LB8C 2N7JA 3HVZA 2ASQA 3VFKA 2O2VB 1FIQA 2M0XA 2Y5CA 2KMCA 2AL6A 4NAMA 2CU1A 4KDLB 3RNEC 3ZNZB 1L4DB 1WGHA 4YWGG 2CKHB 2WXLA 2RGFA 5FK9C 3VUYA 1I4RA 4L2YA 1WGKA 2NS5A 3EGRA 1ENFA 2KJ6A 1I4HA 1C4AA 2KTRB 2QDFA 3VRAB 2L76A 2V4LA 2DZIA 1H8CA 1KTKA 3APDA 1WWTA 5G2NA 2DWQA 2ZCCA 4FXCA 3QK0A 2LVPA 1Z5SB 2IGDA 2K6QA 1RRBA 3RD2A 1WGDA 3H6NA 3P4QB 3R7RA 2BF8B 3X0WA 2QMTA 2N7EA 1DOXA 1WGRA 1FM0D 4MH0E 3AE9B 1UF0A 2KAJA 4NAWB 3Q8FA 2LVQA 3OG5A 2KANA 1I4QA 2KMAA 5L83A 5BMIA 3DBHB 3AE3B 2INDC 1AARA 1PGBA 2I1KA 4KVGB 2QHOA 3GE8C 4OZBA 1V86A 4FULA 4OVUA 2ICIA 2W54A 1XEEA 1D5XC 3A9KB 1R4MB 2LGYA 1U4AA 4TMAB 3HK0A 3AMZA 4HEA1 1J7AA 3FC4A 1V1OA 2GOWA 4EZJA 2Z8LA 2N1WA 4FA6A 2KJRA 2PJHA 1YQ4B 3PZ8A 1I4XA 3PVLA 3ZJUA 3GOEA 1WXMA 2JXTA 4ZRIA 4CO7A 4JL9A 1QF6A 3I9V1 4IUMB 4EZKA 3R7QA 1OTRB 3QWZB 2W3RA 3DBRI 2QC8A 3BY4B 1K50A 3ZTDA 4MGZE 1GB1A 1Q1OA 1WXSA 1JALA 1IP9A 1P3QU 4II2B 4DHZE 3V61A 2G1EA 4J3OD 3GE3C 3L0WB 1E6EB 3DVNU 2REXA 2IO0B 2KX0A 3DOWA 3QARA 4KKJA 2RPVA 1SGHA 2EKIA 2D11A 1UWXA 4Q2JA 1XLPA 1B1ZA 4M0WA 1QOGA 2BBCA 4HDOA 2NBVB 4M01A 3TCAA 1NI2A 1KRHA 4NNJB 3AI5A 3TMPB 4TKNA 2HJ8A 2KD0A 4ZYNA 1N5XA 4RMAA 4N58A 2SAKA 4E71A 4F7ZA 4KZ0A 2ZCBA 3NVZA 2WXFA 3MP9A 4AUQC 1N60A 3ML8A 1N63A 3W5UB 4RF1A 3P63A 3OJ3A 3LJ3A 1EM7A 1R7SA 4AOFA 3IT6B 2ZPYA 3WCQA 2JZ3B 2X38A 3KUCB 2MQJA 4FLHA 2CHXA 1WJUA 2W82A 2XK5B 1GC6A 3Q6BA 1WFYA 1T0RC 1F0ZA 3AE2B 4LNKA 1BXTA 5JZEB 3N1YC 3N20C 1V1PA 1F1HA 4B0EA 2N0SB 4G0NB 2A4ZA 1JWSD 3BVZA 3DHHC 3ZO5B 4YXDB 3UI3A 3PZ7A 5C1ZA 5IN7A 3DWGC 1LGRA 1JQ4A 4WWNA 1TKGA 2D3BA 1WH3A 4AJYB 4FADA 2BB5A 1TYGB 3MC9A 3AE6B 1FNVA 1VR9A 1Y8RC 2L83A 2PPHA 5D7GA 3W5VB 1V2YA 4XC2A 4W9FA 1KLVA 2MSED 3P2BA 3C0RB 1YN5A 2EELA 1C77A 1C78A 1VZ6A 2IO3B 5JXVA 2H89B 2N9EB 4OHJA 4ZHOA 2WDRB 4RM9A 4BAXA 4BKGA 1NVID 4IWOA 3QAQA 4LDTD 1Q5WB 1ZUD2 1IUEA 3RNGC 1DGJA 4H2AA 2RPQA 5I4DA 3L16A 4LJOB 2ON8A 5CHFA 2BPSA 4F1SA 2KC1A 3AE5B 5AUIA 2BS2B 2K0PA 2JYEA 4GGQA 2N9XA 2YEPF 2M19A 1AWDA 3E9SA 3PLVA 3S2AA 3TJPA 4A90A 4K7WA 2V0GA 1ACCA 2BKRB 2KMMA 2N9PC 2D07B 4PS3A 3W9CB 1C3TA 2N4FA 1WM2A 3VH4B 3ZVVA 2J7QB 4ANVA 4EOYA 3M63B 5IKCM 4PYZA 1LM8B 2J0KA 1AW7A 2C7MB 2LHEA 1TKEA 1CQVA 3BK1A 1MFWA 2XN9C 3H9DA 2LGXA 3RZFA 3APCA 4LNNA 4KZCA 1JCKB 3M95A 5IOIA 3IT4B 1V5TA 3RNFC 2LVOA 4I6PA 5IA7A 1I42A 3D32A 1ZXHA 1CK1A 1PDXA 3KWLA 4B9KA 3DQVA 1OGWA 2NCNA 2VRRB 4KIKA 3V3XA 2GBNA 4REZA 3VTUA 1OFFA 2BGFA 2AEHA 1WYGA 1E90A 3U30A 1WR6E 4FBJB 2BT6A 3Q3OC 2KTFA 5MPOA 2WXIA 2JXXA 1BUIC 2JPHA 2WYQA 2DYOA 4NY0A 2R2QA 2JX5A 4J6IA 2C9WB 4KGRA 4ICVA 4DBGA 3A9JA 1RYJA 2KVRA 2DENB 3H1UA 4A55A 4MGKE 2JRHA 2UWQA 2GI9A 3EUB2 4K3BA 4P6VF 5G5GA 1K8RB 4YT0B 4WQOB 3ZLZA 1P7FA 1D6EC 1IPGA 1JRPA 2XEWA 3W1YA 4ANUA 3RN9C 4C7YA 3A9JB 2LFIA 3N30A 2QILA 4HLEA 3QX1A 1T0QC 2JSVX 2VZKB 1WMHB 4N6EB 3GS2A 4TSSA 4M02A 2DAJA 3Q14C 3A1QA 1RWSA 1DOYA 3B08A 1FD6A 4AJWA 3T3NA 3TIXA 2AQ2B 2WDVB 4K7UA 5IAAC 2PKOA 3QJZA 4RCOA 1RFKA 5FKAC 3WANA 2LUMA 3BK2A 4DDGD 1OEYJ 2BQQA 3IG3A 2LJ5A 4N59A 2KDIA 1OEYA 1TT5B 4YSZB 3ONSA 5DPWA 4DHJB 1WY8A 1VLBA 4ZRJA 3R2TA 2D3CA 4GDKB 1N5WA 4NJ7A 3RI7C 1BMLC 1YN3A 2X8XX 1AN8A 5AZFA 4PK1A 2K3UA 2KFKA 3HM3A 3DBHI 4C4VA 2DYMA 2WX1A 3UQBA 1UZXB 1QQRA 4LTUA 2KACA 2NR2A 4OVZA 3TUOA 4KSLC 2AWTA 3O13A 1R4MI 2DYBA 2WXNA 2DZJA 1E7UA 1J7BA 3CWIA 3CSFA 3A4SC 2BKFA 1GPXA 2ZPNA 1EU4A 1CZPA 3IAS1 1QLBB 2VH1A 1HXYD 1X1MA 2LEKA 2L0FA 3B2GA 1TTNA 1TZ1A 4ZRQA 1B9RA 2OEDA 1SF0A 4BKTA 3VAWA 2MJ3A 4ZHPA 2PE6B 4HKQA 2KVZA 1YD8U 2N9KA 1SIFA 2Y5BB 4CQNA 3NHEB 1YMHE 2GRIA 3VUXA 1UWMA 3NOBA 4WURA 2G3QB 3KQ4A 1YN4A 2O2VA 2BTEA 2WXHA 3AU5A 1YJ1A 3P4RB 3LXFA 2KK8A 2WGSA 3AULA 4E74A 3FKYA 1UGJA 3Q8AA 1FCLA 3MTNB 2IGHA 1ZXIA 3V60A 3ZNHB 2JT4B 4GXBA 2LASA 1GB4A 1L2NA 2ZNVB 4RGOS 1DYQA 4AQ7A 2LI5A 2ZNVC 4NJ6A 4MH8A 2KTRA 3MHSD 1BT0A 1DOIA 2HE7A 1E0ZA 2FIDA 2WNMA 2JZZA 4I6LB 2C60A 3CMMB 5KHQA 4HDQA 4BKSD 2J42A 1WM3A 1GG3A 2G45B 1HE8A 2LWPA 3GZNB 2E6XA 2PTLA 3ZDTA 2AYOB 1FEHA 1V6EA 2IO2B 2E3TA 1E7PB 1NYRA 1ET6A 4BKSA 3VVWB 4LNIA 2WDQB 3AEDB 3X23A 3ZUNA 3NG0A 4S0RA 2G4DB 3HIZA 4MGYE 4NAWA 3AECB 1GUAB 2RDHA 1TGZB 3RNBC 3SFEB 1IBXB 2BYEA 1YX5B 3ALBA 1SE2A 1SB3C 2J0JA 4NQLB 3V05A 5EE9A 3P4SB 2WXKA 2ACZB 5D3DA 5CHVC 1R4NB 3SD5A 3TEZA 3NVVA 3KYDD 2K9XA 4GB9A 3A9KA 1TY2A 3N3KB 3TEWA 5E6PA 1STEA 3WAMA 3ZTCA 3N9YC 3AE7B 2KOXA 3TBLD 5LNK1 3H7SA 1UBQA 2LHDA 2BYTA 1VCBA 1JWMD 1GAQB 2IYDB 1A70A 3KYCD 4BOZB 5HI1A 2LUEA 2RMMA 1L7YA 1SBBB 4W9HA 3QQ8B 4ANXA 4IC7B 4HRSA 1TIFA 2YEPB 3AE4B 2FE8A 2IPKD 1EO6A 3KH0A 4K3CA 2M56B 5LXHA 2IDYA 1F77A 2AX5A 2CR5A 1PGXA 4FHKA 3OLMD 3SHQA 4WWOA 3EHVA 4F8CB 1XT9B 5AZGA 4ARCA 4C7ZA 3OAWA 2LJIA 4LNOA 2V3PA 3N1XC 3AEFB 4YSYB 5EE1A 4JPSA 3B0AA 5G5HA 2LD9A 1C76A 3UF8A 4YTNB 1JWAD 3GB1A 2NPTB 2KDFB 1I35A 1MI0A 4DDID 5GMVA 4NPNA 3PRZA 1G6JA 3WAPA 1J0GA 5AEKB 1JWUD 1D5MC 2I2YA 3EA6A 2L1AA 2A5UA 3QHTA 4RM8A 5BO4B 5G55A 2FAZA 1K52A 2BYVE 3BYYB 3RPFC 2G9HD 2XK5A 2PVGC 3PGEA 5C3JB
chains in the Genus database with same CATH topology
4R3DA 1C9FA 3T3OA 1XCQL 3BIID 3NRZA 1AW7A 1KFYB 2W55A 2PLPA 3URYA 1PYWD 3PO0A 1ZDVA 2LHEA 1TKEA 1CQVA 3BK1A 4DXGA 2XN9C 4WQMA 1SJED 1JCKB 3IT4B 4XDCA 3LYYA 1L5PA 4ITKA 4C56C 4C80A 2WQYB 1L6UA 4US9A 5HHDG 2QIEB 3VRBB 1PUTA 1ZXHA 1HEZE 4DQOC 1CK1A 1PDXA 3KWLA 4JWSC 4LK0M 3V3XA 3BWUD 1NI3A 4REZA 1JROA 1OFFA 4YSXB 2H88B 1WYGA 4HJGE 5AUKA 2KQ4X 2RDGA 3HUIA 1HZ5A 2BT6A 1VDVA 1VJKA 2INNE 1FNWA 1ZDXA 4NJCA 5MPOA 1Q10A 2WXIA 3FILB 1BUIC 1GOZA 1EWYC 2DYOA 2WXQA 4RH6A 2R61A 4IOIE 2QSDA 2WU5B 2WU2B 1HA5A 5GXGB 2JX5A 2MH7A 1XF5L 3P42A 4KGRA 4XWTA 5BYQA 3SFDB 1KLUD 1CJEA 4JE3B 1MHXA 2OHFA 1RYJA 3ABVB 3MJ5A 2ZW1A 1FFUA 4RGTA 4TQ0A 1ZP0B 4A55A 4RGMA 2XNAC 4A6QA 2BB6A 1QT9A 2FUG1 2KWDA 3IXSA 1L4ZB 2GI9A 3EUB2 1SXTA 1YJIA 2QEJC 4P6VF 4YT0B 5G5GA 1KLGD 3NZ3A 2J52A 4YTMB 2JYTA 2IJ0A 3AN1A 1D6EC 1M4VA 1P7FA 4KKIA 1JRPA 3P1MA 3L4PA 3NVYA 1I4GA 2JWUA 3AE1B 1L0YB 2PW9A 1UUPA 4C7YA 1D4BA 1FXAA 2LFIA 2QILA 4KGTA 1PGAA 2JSVX 2VZKB 4N6EB 5E6JA 3GS2A 4B0MA 4TSSA 2V3NA 1NYQA 4IKGA 1XLNA 1RWSA 1DOYA 3NS1A 1TS2A 3U7ZA 1TY0A 1FD6A 1JMLA 3T3NA 1N62A 2AQ2B 4MT5A 2WDVB 3LB8C 2N7JA 3HVZA 4KGSA 2CJNA 4EE2A 1FIQA 2Y5CA 2MEKA 2NMQA 2PKOA 4RCOA 4NAMA 1RFKA 5FKAC 1EWCA 2LUMA 3BK2A 3CIRB 4PT5A 1L4DB 2AQ1B 2KN4A 3Q69A 4YWGG 4N59A 1XCTL 5HG2A 2INPE 2WXLA 4KX6B 5FK9C 1I4RA 4L2YA 4RNAA 5T8IA 4YSZB 1WGKA 3EGRA 1ENFA 2N9LA 3C8YA 2MJDA 1VLBA 4P16A 3R2TA 1I4HA 1LO5D 1C4AA 1ZOYB 4GDKB 2KDMA 3VRAB 1N5WA 1KTKA 1N61A 4OZCA 1VZ8A 1BMLC 3R2IA 1YN3A 1AN8A 2IGGA 1UNSA 1WWTA 3ZGZA 1YQ3B 1K51A 2DWQA 4FXCA 3FILA 2GB1A 4RFBA 1FO4A 2K3UA 1ET9A 3AB5A 1WXQA 2IGDA 1TS5A 4ZOHC 4IDIA 2DYMA 1I7HA 3P4QB 2CU3A 5BMHA 1E9MA 2AQ3B 1QQRA 4LTUA 3U52E 1K53A 2J53A 2QMTA 2KACA 1IGCA 1DOXA 5D3IB 3R8BA 1TZOA 1L6VA 5HFYA 2WLBA 1FM0D 1QILA 2JZPA 3AE9B 4OVZA 3TUOA 2KAJA 4XE0A 2VZKD 3O13A 4NAWB 3Q8FA 2WXNA 1ZE3D 2K5PA 2WS3B 3AV8A 1J7BA 4MM3B 5H92C 3CWIA 4XWWA 1I4QA 1IGDA 1FMAD 3NUHB 3IAS1 1EU4A 1CZPA 1GPXA 4DXFA 1QLBB 1SSNA 1HXYD 4L23A 4WAFA 5BMIA 1V97A 1I4PA 3AE3B 2LEKA 3I57A 1TS4A 3VR8B 3B2GA 3TSSA 1PGBA 1WRIA 3MC0B 4ZRQA 5C2TB 3TEXA 1B9RA 2OEDA 1SF0A 2DLBA 4OZBA 2ICIA 2MJ3A 2MJEA 4ZHPA 2W54A 1XEEA 1D5XC 3ZJTA 2K22A 3SEBA 4HKQA 2D5GA 3RFZB 4CQNA 2N9KA 2JU6X 4TMAB 3AMZA 2GRIA 1YMHE 2LMCA 4WWMA 4HEA1 3OWEB 1J7AA 1D5ZC 1V1OA 3FC4A 1UWMA 1KF6B 2PMVA 2Z8LA 4WURA 2Y3AA 3KQ4A 1YN4A 2BTEA 2WXHA 1YQ4B 1RM6C 3PZ8A 1V1PB 2NTSA 1I4XA 4O1NA 3P4RB 3ZJUA 3LXFA 2WXJA 2JXTA 1XLOA 1UGJA 3Q8AA 1FCLA 2ONQA 2W3SA 2IGHA 1ZXIA 1QF6A 3I9V1 1T6BX 4USAA 1YNTE 5BYRA 1GB4A 4RGOS 4NZLB 2PVOD 2W3RA 1DYQA 4AQ7A 3W2DA 1K50A 1GB1A 2WXRA 4MH8A 2I38A 1VRAB 3B9JA 1JALA 2M0AA 1DOIA 1E0ZA 3U2SC 2WNMA 1NENB 2BW2A 3AEBB 1WSPA 4WH4A 1XXGA 2G1EA 2Q5WD 4J3OD 2BS3B 5BMGA 2TSSA 1ZPSA 1E6EB 3ZJVA 2NTTA 1FFVA 1EU3A 2J42A 2WXPA 2L32A 1PFDA 2HDEA 1TJEA 4ZRPA 3BZDB 1XO3A 2PIAA 4KKJA 2JQRB 2L52A 2RPVA 2EKIA 2E6XA 1FXIA 3VQIA 1UWXA 4Q2JA 1XLPA 1B1ZA 2PTLA 4M0WA 1QOGA 1FEHA 2BBCA 1C4PA 4YTPB 4GLSC 2E3TA 1E7PB 1NYRA 1ET6A 1AYFA 2WDQB 3AEDB 1KRHA 3Q8EA 1HQRD 1Y56A 1N5XA 3J9CA 3HVDA 4N58A 2SAKA 3AECB 3U4EG 2RDHA 4GDLB 1XLQA 1FNUA 3NVZA 3SFEB 1IBXB 4RGNA 2WXFA 3Q8CA 3MP9A 3NVWA 1N60A 1SE2A 1SB3C 1N63A 3ZQ4A 3V05A 3W5UB 1KH0A 3P63A 4RF1A 2WXMA 5EE9A 3P4SB 2WXKA 2QJLA 1EM7A 1R7SA 3IT6B 2ACZB 5D3DA 1QOAA 3WCQA 1C4CA 2X38A 3TEZA 3NVVA 3BVGA 5EE3A 1JW9D 2K9XA 1TY2A 1F2RI 3B2FA 1ESFA 2W82A 3TEWA 1STEA 4HROA 1F0ZA 1FRDA 1L0VB 5H8YE 3AE2B 1HZ6A 1L0XB 1BXTA 4MACA 3N9YC 3AE7B 4ZYSA 2J4XA 1OQQA 1MHHE 3VR9B 2LGIA 1FRRA 1MVKA 3SR6A 5LNK1 2SEBD 1V1PA 2LHDA 4L1BA 5EE0A 3KLSX 4B0EA 2N0SB 2BYTA 4XDDA 1JWMD 1QOFA 5FR3A 1JWSD 1SIJA 3MHZA 1JWBD 1GAQB 4OW0A 3BVZA 3AM9A 4JX1C 1A70A 3BVMA 5HI1A 4YXDB 4OZAA 2RMMA 3PZ7A 3UI3A 2BS4B 1SBBB 3DWGC 1JQ4A 4HRSA 1TKGA 3AEAB 2YEPB 3W1SA 3GP7A 4US8A 3AE4B 2BB5A 3KWVA 1SE4A 1TYGB 2FE8A 2IPKD 3HRDD 1F2RC 1FNVA 1ROEA 1VR9A 2L83A 3AE6B 3DWMA 5D7GA 3W5VB 3ZYYX 2M56B 2DBYA 3Q8BA 1OQRA 1SJHD 2IDYA 1YN5A 2EELA 3P4PB 1F77A 4AS1A 1C77A 2AX5A 5BYSA 1E10A 1C78A 1VZ6A 1PGXA 1TS3A 3E56A 4LLGM 4HKZE 2WP9B 5JXVA 2H89B 1TKYA 2WXOA 3AH7A 4OHJA 4ZHOA 3BYTB 1YJJA 3AEEB 2WDRB 4ARCA 1NVID 4C7ZA 5TSSA 2LJIA 4A9AA 4ARIA 2V3PA 1ZUD2 2HTME 1IUEA 3FAHA 3AEFB 4YSYB 2FBWB 5EE1A 1DGJA 4JPSA 5G5HA 4H2AA 1C76A 5I4DA 2B76B 4YTNB 4D2KA 1JWAD 3GB1A 1QOBA 3ETRA 4UDUC 3H8HA 2ON8A 3TEYA 1J7CA 2V4IB 3AE5B 1FCCC 5AUIA 2Y5PA 3IAM1 4JWUC 4RF0A 2BS2B 1MI0A 1T3QA 3MFGA 1IBXA 2K0PA 1P7EA 2JYEA 1JWUD 1V8CA 1D5MC 3AE8B 2YEPF 3AEGB 1MPEA 3EA6A 2M19A 1AWDA 2L1AA 3E9SA 2I2YA 1C79A 1VZ7A 2ZW0A 4TQ1A 4A90A 2V0GA 2WXGA 1ACCA 1SEBD 4WIPA 2KMMA 3W9CB 1NEKB 4A8XC 1K52A 3BYYB 1T5XD 3RPFC 1SE3A 2G9HD 2CJOA 2PVGC 1QKZA 5C3JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N62 A;  1F0Z A;  1J7A A;  3FC4 A;  1FRD A;  1L0V B;  1UWM A;  2WDV B;  1KF6 B;  3AE2 B;  3LB8 C;  5H8Y E;  3HVZ A;  2CJN A;  3BII D;  1FIQ A;  3AE7 B;  3NRZ A;  2Y5C A;  1KFY B;  1OQQ A;  2PKO A;  2W55 A;  1YQ4 B;  1RM6 C;  1RFK A;  1FRR A;  3SR6 A;  3VR9 B;  3PO0 A;  3CIR B;  1TKE A;  3P4R B;  5EE0 A;  3LXF A;  1XLO A;  4WQM A;  2N0S B;  4N59 A;  2W3S A;  1QOF A;  1ZXI A;  1SIJ A;  1JWB D;  1GAQ B;  4KX6 B;  1QF6 A;  3AM9 A;  1L5P A;  4JX1 C;  1A70 A;  4ITK A;  4C80 A;  4USA A;  2WQY B;  1L6U A;  4YSZ B;  1WGK A;  4US9 A;  4YXD B;  2QIE B;  3VRB B;  2BS4 B;  2PVO D;  1PUT A;  2W3R A;  3AMZ A;  2MJD A;  1PDX A;  1VLB A;  3DWG C;  3KWL A;  1JQ4 A;  4HRS A;  1TKG A;  4JWS C;  3AEA B;  4US8 A;  3AE4 B;  1NI3 A;  1ZOY B;  1JRO A;  1OFF A;  1N5W A;  3VRA B;  4YSX B;  2H88 B;  1TYG B;  3B9J A;  1JAL A;  1WYG A;  3HRD D;  1ROE A;  1N61 A;  2L83 A;  3AE6 B;  3DWM A;  1DOI A;  5AUK A;  3W5V B;  1E0Z A;  1NEN B;  3HUI A;  2M56 B;  2DBY A;  3AEB B;  3ZYY X;  1OQR A;  2BT6 A;  1VDV A;  2G1E A;  2Q5W D;  1VJK A;  1WWT A;  2BS3 B;  1YQ3 B;  5MPO A;  3P4P B;  1E6E B;  2DWQ A;  4FXC A;  2AX5 A;  1E10 A;  1EWY C;  1FFV A;  1FO4 A;  3AB5 A;  2WU5 B;  1PFD A;  1WXQ A;  2WU2 B;  1TJE A;  5GXG B;  2JX5 A;  4ZOH C;  1XO3 A;  4IDI A;  2PIA A;  2JQR B;  2L52 A;  2MH7 A;  2H89 B;  2WP9 B;  1TKY A;  3AH7 A;  2EKI A;  1I7H A;  4ZHO A;  1YJJ A;  1FXI A;  2WDR B;  3AEE B;  3P4Q B;  2CU3 A;  1E9M A;  1NVI D;  3SFD B;  4C7Z A;  1XLP A;  1CJE A;  4LTU A;  4A9A A;  1QOG A;  1ZUD 2;  2HTM E;  1IUE A;  2OHF A;  3FAH A;  3AEF B;  4YSY B;  4YTP B;  1RYJ A;  2FBW B;  3ABV B;  1DGJ A;  5EE1 A;  5G5H A;  1L6V A;  2E3T A;  1DOX A;  1E7P B;  1FFU A;  1NYR A;  2B76 B;  1ZP0 B;  4YTN B;  1AYF A;  1JWA D;  1FM0 D;  2WLB A;  3AE9 B;  2WDQ B;  3AED B;  1KRH A;  1QOB A;  2KAJ A;  1QT9 A;  3ETR A;  1N5X A;  3EUB 2;  5G5G A;  1YJI A;  4N58 A;  4P6V F;  1J7C A;  4YT0 B;  3AEC B;  3AE5 B;  5AUI A;  2K5P A;  2WS3 B;  3AV8 A;  1J7B A;  4JWU C;  5H92 C;  2BS2 B;  1XLQ A;  4YTM B;  3CWI A;  1T3Q A;  3NVZ A;  3SFE B;  3AN1 A;  1FMA D;  1GPX A;  1CZP A;  1JRP A;  3NVW A;  1QLB B;  1N60 A;  3P1M A;  1SB3 C;  1N63 A;  1V97 A;  3L4P A;  1V8C A;  3NVY A;  3AE1 B;  3AE3 B;  2LEK A;  3AE8 B;  3W5U B;  3P63 A;  3AEG B;  5EE9 A;  2M19 A;  1AWD A;  3P4S B;  4C7Y A;  1FXA A;  3VR8 B;  2QJL A;  3B2G A;  1R7S A;  1WRI A;  2ACZ B;  4N6E B;  5C2T B;  1QOA A;  2KMM A;  3WCQ A;  1B9R A;  1SF0 A;  1NYQ A;  1XLN A;  3W9C B;  1RWS A;  2MJ3 A;  2MJE A;  3NVV A;  1NEK B;  2W54 A;  3NS1 A;  4ZHP A;  1DOY A;  5EE3 A;  1JW9 D;  2K9X A;  2K22 A;  3RPF C;  3B2F A;  4HRO A;  2CJO A;  2PVG C;  4WWM A;  5C3J B; 
#chains in the Genus database with same CATH topology
 4R3D A;  2ZEQ A;  2KJH B;  2KFJ A;  4K1R B;  2PLP A;  1PYW D;  2GLS A;  4WAA A;  4WJP A;  5E6N A;  4DXG A;  4WQM A;  2M8S A;  4TUU A;  1WE6 A;  2R2O A;  3RNA C;  4ITK A;  1ZGU B;  3H7P B;  4US9 A;  1YOV B;  1PUT A;  4LNF A;  2KZR A;  3L54 A;  2BVC A;  4JWS C;  4LK0 M;  3OJ4 B;  2D3G A;  4G11 A;  3BWU D;  2VH2 A;  1NI3 A;  3ZDM C;  2BWF A;  2KQ4 X;  1RLF A;  1WZ0 A;  2GBR A;  2OOB B;  4JGH B;  1P9D U;  3APF A;  4BFR A;  3FIL B;  1GOZ A;  1RAX A;  2WXQ A;  3V62 A;  2QSD A;  2WU5 B;  2WU2 B;  1ISN A;  1HA5 A;  5GXG B;  3ZW3 A;  3O65 B;  4IM0 A;  1WR1 A;  1IYF A;  3P42 A;  4DK5 A;  1LFD A;  4GU2 A;  1UH6 A;  1MHX A;  2OHF A;  3VXW A;  1E5W A;  2C7H A;  3ABV B;  1FFU A;  2BYF A;  1ZP0 B;  3Q3J A;  4RGM A;  4A6Q A;  2B3A A;  3IXS A;  3VHT C;  3JW0 X;  1P0R A;  1KLG D;  4HXD A;  1EF5 A;  4YTM B;  2JYT A;  3A4R A;  2IJ0 A;  1M4V A;  4KKI A;  3PS6 A;  2JVC A;  4AWJ A;  1KJT A;  4DXA B;  3NVY A;  1I4G A;  3AE1 B;  1V81 A;  1L0Y B;  2CHW A;  4W9L A;  2MA9 B;  4KGT A;  5E6J A;  1CMX B;  5DPR A;  2BWE S;  3NS1 A;  2GMI C;  1MG4 A;  1JML A;  5E6O A;  4KV2 A;  1N62 A;  4HPM B;  3ECI A;  4KGS A;  4II3 B;  2MEK A;  1KOT A;  3NZU A;  4PT5 A;  5LLI A;  2KN4 A;  4BOS C;  5HG2 A;  2INP E;  4KX6 B;  3RUI B;  4RNA A;  2Z0D B;  5T8I A;  2N9L A;  4QAY A;  2GBK A;  1LO5 D;  1V80 A;  4HK2 A;  2KDM A;  5CX3 A;  2KKC A;  4OZC A;  3NZS A;  1VZ8 A;  4P7I A;  3R2I A;  3I63 C;  2IGG A;  1YQ3 B;  2LRW A;  2UU7 A;  4RFB A;  3RCZ A;  1FO4 A;  1ET9 A;  2L7R A;  1TS5 A;  4IDI A;  1I7H A;  2CU3 A;  5BMH A;  1E9M A;  4W9J A;  2AQ3 B;  4M00 A;  4N9F 4;  2J53 A;  2FNJ B;  5D3I B;  1TZO A;  3NY5 A;  2MBO A;  5HFY A;  1QIL A;  2JZP A;  3RUL A;  4XE0 A;  2VZK D;  3MJW A;  2DZK A;  3PZD A;  2KDB A;  1ZE3 D;  2K5P A;  2WS3 B;  3AV8 A;  5H92 C;  2INC C;  4A3P A;  3NUH B;  2L3Z A;  1SSN A;  4L23 A;  1V97 A;  1I4P A;  4MEM A;  1Q0W B;  3I57 A;  3VR8 B;  4EEW A;  4G50 A;  2IZV B;  3TSS A;  3MC0 B;  1WMH A;  3PV1 A;  3Q2A C;  3TEX A;  2DLB A;  4I6N B;  2IBI B;  3ZJT A;  2K22 A;  1Z2M A;  3RFZ B;  5J18 A;  2JU6 X;  5EDS A;  1WJN A;  3PLU A;  3UIO B;  4ZDV A;  1D5Z C;  1TBE A;  1KF6 B;  2IY1 B;  4DHJ D;  2K8H A;  2W9N A;  2WXJ A;  4DHZ B;  1XLO A;  4M8M A;  1E7V A;  2K8C A;  3ZIM A;  2LXA A;  1V9J A;  4HCP B;  1YNT E;  2O6V B;  5BYR A;  1ZKH A;  3GZN I;  4NZL B;  2PVO D;  1D3Z A;  4MSQ B;  3Q3N C;  3W2D A;  2KYW A;  4GDK A;  1VRA B;  3B9J A;  2M0A A;  4HPP A;  3W1S C;  3U2S C;  4ICU A;  3AEB B;  3DVG Y;  1XXG A;  1WI0 A;  5KHO A;  5BMG A;  2BS3 B;  2TSS A;  2GBM A;  5IP4 D;  3ZJV A;  1NDD A;  1FFV A;  1UEL A;  2WXP A;  1PFD A;  2KC2 A;  4HVB A;  2N7D A;  4WWP A;  4ZRP A;  3BZD B;  1XO3 A;  2JQR B;  4MJS B;  3VQI A;  3VH3 B;  2CHZ A;  1C4P A;  4YTP B;  4GLS C;  1AYF A;  3T9L A;  1Y56 A;  3DBS A;  4IM2 A;  1WX7 A;  4GDL B;  5IO9 A;  1FNU A;  4YL8 A;  2JY6 A;  2J0M A;  4RGN A;  3Q8C A;  3NVW A;  3UIP B;  1WZ3 A;  4NQK E;  4HCN B;  4ASW C;  1KH0 A;  3DVG X;  1WX8 A;  1GNU A;  1RFA A;  1QOA A;  3QC8 B;  3BVG A;  2ZJD A;  5D6J B;  3WA0 A;  3EFC A;  2EKE C;  1LQB A;  1A5R A;  1H4R A;  1ESF A;  2JUO A;  2JRI B;  1FRD A;  1L0V B;  1L0X B;  4MAC A;  2LRU A;  4ZYS A;  2J4X A;  3T8M A;  1FRR A;  1MVK A;  3SR6 A;  2KWV B;  5EE0 A;  3KLS X;  2MBE A;  3V6E B;  5FR3 A;  1QOF A;  1SIJ A;  3MHZ A;  1JWB D;  3AM9 A;  3BVM A;  3KUD B;  4GN1 A;  2BS4 B;  3DCG A;  4XX5 A;  1P98 A;  2N1V A;  3AEA B;  1WGG A;  3GP7 A;  4XZ4 A;  4US8 A;  2DX5 B;  3KWV A;  1F2R C;  1YIW A;  4MGI E;  5C23 A;  1HTQ A;  3Q8B A;  1OQR A;  1S1Q B;  4URK A;  5BYS A;  3L08 A;  1MJD A;  1TS3 A;  3ZRC A;  2GBJ A;  3HM6 X;  5TR5 A;  4LLG M;  4BBN F;  1QZE A;  4HKZ E;  4W9I A;  1TKY A;  2WXO A;  3AH7 A;  1YJJ A;  2KQ7 A;  1J8C A;  3CST A;  5TSS A;  4A9A A;  4ARI A;  2MBQ A;  1WXA A;  2HTM E;  2M1M A;  4B95 A;  4G3X B;  3K9O B;  3ETR A;  3IBE A;  1J7C A;  2LZ6 A;  1FCC C;  2Y5P A;  2HTH A;  2KLC A;  3IAM 1;  1T3Q A;  1IBX A;  1P7E A;  1WJ4 A;  1V8C A;  3N1Z C;  2ZW0 A;  4C00 A;  2WXG A;  1SEB D;  1ZW7 A;  4WIP A;  5J2R A;  2K6D B;  3JSV B;  2FCS A;  1T5X D;  1SE3 A;  4K7S A;  1LXD A;  4DWF A;  2OJW A;  3SU8 X;  1T0Y A;  2MWS B;  2CJO A;  1C9F A;  5J17 A;  1XCQ L;  4KSK C;  3NRZ A;  1KFY B;  2W55 A;  3EC8 A;  3URY A;  3PO0 A;  1ZDV A;  3DHG C;  4XYC A;  3RT3 B;  1SJE D;  1E8X A;  2KN5 A;  4C80 A;  4C56 C;  1L6U A;  4BZA A;  4JQW C;  2QIE B;  5L95 C;  4ANW A;  3QIJ A;  1HEZ E;  4DQO C;  2KQS A;  2AL3 A;  1JRO A;  2MP2 A;  4HJG E;  2RDG A;  2K39 A;  3R66 C;  1VJK A;  1FNW A;  2XBB C;  1Q10 A;  2DNF A;  1UD7 A;  1UGM A;  2R61 A;  4IOI E;  4W9C A;  2DZM A;  5DPT A;  2KT7 A;  1WIA A;  1WJ6 A;  1XF5 L;  4XWT A;  3WAO A;  2MP2 B;  3MJ5 A;  3PRM B;  4W9D A;  3VTW A;  4RGT A;  4TQ0 A;  1T0S C;  2EMT A;  2BB6 A;  3B1L X;  4PYU A;  2NPT A;  2FCQ A;  3KW5 B;  1L4Z B;  2M17 A;  1UBI A;  3M62 B;  3ZNI D;  4FHJ A;  3AN1 A;  3L4P A;  4IWP A;  1UUP A;  2RDB C;  2FIF A;  1D4B A;  3DPD A;  1FXA A;  1PGA A;  3RMK C;  4B0M A;  2V3N A;  4W9K A;  1WX9 A;  1NYQ A;  3RZW C;  1XLN A;  2NVU I;  3HHM A;  2L00 B;  2CJN A;  4EE2 A;  3KUZ A;  2WDT B;  2NMQ A;  1EWC A;  4MEL A;  3CIR B;  4HJK A;  2AQ1 B;  2YLM A;  3Q69 A;  2D2Q A;  1XCT L;  5CHW A;  3H7P A;  2FUH B;  3ZRF A;  3C8Y A;  3DBL B;  2MRP A;  2MJD A;  4P16 A;  1ZOY B;  4X57 B;  5DCN A;  1N61 A;  2D10 A;  1UNS A;  3ZGZ A;  2KWU B;  1K51 A;  2JF5 A;  3FIL A;  2GB1 A;  3AB5 A;  2WHI A;  1WXQ A;  4MM3 A;  3RYT A;  3PRE A;  4ZOH C;  2MW5 A;  4M0W B;  1WF9 A;  1JRU A;  2DHZ A;  3U52 E;  2WWZ A;  1K53 A;  1IGC A;  3IVF A;  3R8B A;  1L6V A;  4PS7 A;  3EFU A;  2WLB A;  5DPS A;  2Z59 B;  2IY0 B;  2KDE B;  5JHA A;  3DDC B;  2L8J A;  4MM3 B;  4IW0 A;  3JVZ X;  3MC8 A;  4EUT A;  4XWW A;  1IGD A;  1FMA D;  1SE9 A;  4DXF A;  3L17 A;  4WAF A;  4PS8 A;  2LGD A;  4KDI C;  4MDK E;  3DHI C;  1TS4 A;  3AXC A;  4HWI B;  1N6Z A;  1WRI A;  4ACF A;  4W9G A;  5C2T B;  1VD2 A;  2MJE A;  4K81 A;  3PPA A;  4GOC A;  3SEB A;  2D5G A;  4AP4 C;  2L0T A;  4WWM A;  2LMC A;  3OWE B;  2K8B A;  4GSW A;  2PMV A;  3ENE A;  2Y3A A;  3NS8 A;  1RM6 C;  4EFO A;  2KO3 A;  3L10 B;  1V1P B;  2NTS A;  4IG7 B;  4O1N A;  2QCZ A;  2HJ1 A;  1E8Z A;  1YQB A;  2ONQ A;  2W3S A;  2NBW B;  1T6B X;  2WX0 A;  4USA A;  3RNC C;  5HKH A;  2KNB A;  4XGA B;  1GC7 A;  4EZL A;  2WXR A;  2I38 A;  3Q3F A;  1NEN B;  2BW2 A;  1WSP A;  4WH4 A;  2V9H A;  2KX3 A;  2Q5W D;  4MSM B;  5D94 A;  2RSU A;  1ZPS A;  2NTT A;  2RR9 A;  1EU3 A;  3M3J A;  2KWC A;  2L32 A;  2HDE A;  1TJE A;  1XQQ A;  2PIA A;  2L52 A;  3UQA A;  2CS4 A;  2LXC A;  1FXI A;  3DBR B;  3AU4 A;  1WGY A;  3Q3M C;  1NBF C;  3PHW B;  3SDL C;  2K1F A;  4B6W A;  2PEA A;  3Q8E A;  1HQR D;  1P1A A;  2FCN A;  2JWZ A;  2MBB B;  3C19 A;  2FCM A;  3J9C A;  1M94 A;  3HVD A;  3U4E G;  1XLQ A;  1E8W A;  4JIO U;  4LDT B;  1F52 A;  2KXJ A;  3UIN B;  3ZQ4 A;  2KHW B;  1YX6 B;  2WXM A;  2G4S A;  2YVC A;  5JH5 C;  2QJL A;  5FR6 A;  2D3A A;  2OJR A;  1C4C A;  4GIV A;  2UYZ B;  1E8Y A;  5EE3 A;  2ZVN A;  1JW9 D;  1F2R I;  3B2F A;  4HRO A;  2O6V D;  2PE9 A;  2MLB A;  4BBN C;  5H8Y E;  3I5J C;  1GJZ A;  3EEC A;  1HZ6 A;  1EF1 A;  1OQQ A;  1MHH E;  3VR9 B;  2LGI A;  2SEB D;  3V6C B;  4L1B A;  1EUV B;  3PSE B;  1F9J A;  3PHX B;  4XDD A;  4FJY A;  4OW0 A;  3I3T B;  3PTF C;  4JX1 C;  4OZA A;  2O6V A;  4A20 A;  2ZZP B;  4BVU C;  1V49 A;  3IFW B;  3ZNG C;  4KIK B;  3W1S A;  3ML9 A;  2HD5 B;  4FJV B;  2V3S A;  1SE4 A;  4CHK A;  4OVV A;  3HRD D;  1ROE A;  2Z0E B;  3DWM A;  3ZKJ C;  4JLC A;  3ZYY X;  2DBY A;  1SJH D;  1KM7 A;  3P4P B;  4HPL B;  4AS1 A;  1E10 A;  2MBH A;  4A3O A;  3E56 A;  4W9E A;  2WP9 B;  4MJS A;  3BYT B;  3AEE B;  2NBU A;  3PRP B;  2RD0 A;  3FAH A;  2K25 A;  2FBW B;  3A33 B;  2B76 B;  1XD3 B;  4D2K A;  1QOB A;  4UDU C;  3UGB B;  3H8H A;  3U7D A;  3TL5 A;  3TEY A;  2V4I B;  3N32 A;  4IM3 A;  4JWU C;  4RF0 A;  4GDL A;  3MFG A;  4M8N A;  1WXV A;  3JYU A;  3WAL A;  5LXI B;  5AZH A;  1FXT B;  3AE8 B;  2KLG A;  2MX2 A;  3AEG B;  1MPE A;  1C79 A;  1VZ7 A;  4TQ1 A;  1R4N I;  5D2M B;  3WIM A;  4WJQ A;  3R3M A;  3A1Q B;  1NEK B;  4A8X C;  2L05 A;  1FPY A;  1HTO A;  1QKZ A;  3L13 A;  3T3O A;  4P1B C;  3BII D;  1C1Y B;  4LJP B;  4EKU A;  5JHB A;  3VDZ A;  2EMS A;  3QA8 A;  2DAF A;  3CF6 E;  4FJZ A;  4GMV A;  4XDC A;  3LYY A;  1L5P A;  2WQY B;  3BIN A;  5HHD G;  3VRB B;  3U8Z A;  1S3S G;  1WE7 A;  4WJO A;  3ZXV A;  4TV3 A;  4YSX B;  1OQY A;  2H88 B;  5AUK A;  3DVN V;  3QCA A;  2I1J A;  3HUI A;  2LGS A;  1HZ5 A;  1VDV A;  2INN E;  1ZDX A;  4NJC A;  2MHJ A;  3ZXR A;  1EWY C;  2C5L C;  4RH6 A;  4E3C A;  2KFK B;  3VUW A;  4WJN A;  3LDZ E;  3PT2 B;  4P1C C;  4C4V B;  2MH7 A;  5BYQ A;  3SFD B;  1KLU D;  1CJE A;  4JE3 B;  4S17 A;  3VTV A;  3K9P B;  2ZVO A;  2ZW1 A;  2IO1 B;  4ZRK A;  2XNA C;  3IHP C;  1QT9 A;  1WYW B;  2M4N A;  2FUG 1;  2KWD A;  1SXT A;  1YJI A;  2QEJ C;  2C7N B;  3NZ3 A;  2J52 A;  1WRD B;  1V5O A;  3P1M A;  1MG8 A;  5CTR C;  2JWU A;  2PW9 A;  1J19 A;  2MCN B;  4CYE A;  3KVF B;  4LCD E;  4FN2 A;  4IWQ A;  1PQS A;  4IKG A;  3JSV A;  1TS2 A;  3U7Z A;  3DBL I;  2V1Y A;  1TY0 A;  3NJT A;  4MT5 A;  3LB8 C;  2N7J A;  3HVZ A;  2ASQ A;  3VFK A;  2O2V B;  1FIQ A;  2M0X A;  2Y5C A;  2KMC A;  2AL6 A;  4NAM A;  2CU1 A;  4KDL B;  3RNE C;  3ZNZ B;  1L4D B;  1WGH A;  4YWG G;  2CKH B;  2WXL A;  2RGF A;  5FK9 C;  3VUY A;  1I4R A;  4L2Y A;  1WGK A;  2NS5 A;  3EGR A;  1ENF A;  2KJ6 A;  1I4H A;  1C4A A;  2KTR B;  2QDF A;  3VRA B;  2L76 A;  2V4L A;  2DZI A;  1H8C A;  1KTK A;  3APD A;  1WWT A;  5G2N A;  2DWQ A;  2ZCC A;  4FXC A;  3QK0 A;  2LVP A;  1Z5S B;  2IGD A;  2K6Q A;  1RRB A;  3RD2 A;  1WGD A;  3H6N A;  3P4Q B;  3R7R A;  2BF8 B;  3X0W A;  2QMT A;  2N7E A;  1DOX A;  1WGR A;  1FM0 D;  4MH0 E;  3AE9 B;  1UF0 A;  2KAJ A;  4NAW B;  3Q8F A;  2LVQ A;  3OG5 A;  2KAN A;  1I4Q A;  2KMA A;  5L83 A;  5BMI A;  3DBH B;  3AE3 B;  2IND C;  1AAR A;  1PGB A;  2I1K A;  4KVG B;  2QHO A;  3GE8 C;  4OZB A;  1V86 A;  4FUL A;  4OVU A;  2ICI A;  2W54 A;  1XEE A;  1D5X C;  3A9K B;  1R4M B;  2LGY A;  1U4A A;  4TMA B;  3HK0 A;  3AMZ A;  4HEA 1;  1J7A A;  3FC4 A;  1V1O A;  2GOW A;  4EZJ A;  2Z8L A;  2N1W A;  4FA6 A;  2KJR A;  2PJH A;  1YQ4 B;  3PZ8 A;  1I4X A;  3PVL A;  3ZJU A;  3GOE A;  1WXM A;  2JXT A;  4ZRI A;  4CO7 A;  4JL9 A;  1QF6 A;  3I9V 1;  4IUM B;  4EZK A;  3R7Q A;  1OTR B;  3QWZ B;  2W3R A;  3DBR I;  2QC8 A;  3BY4 B;  1K50 A;  3ZTD A;  4MGZ E;  1GB1 A;  1Q1O A;  1WXS A;  1JAL A;  1IP9 A;  1P3Q U;  4II2 B;  4DHZ E;  3V61 A;  2G1E A;  4J3O D;  3GE3 C;  3L0W B;  1E6E B;  3DVN U;  2REX A;  2IO0 B;  2KX0 A;  3DOW A;  3QAR A;  4KKJ A;  2RPV A;  1SGH A;  2EKI A;  2D11 A;  1UWX A;  4Q2J A;  1XLP A;  1B1Z A;  4M0W A;  1QOG A;  2BBC A;  4HDO A;  2NBV B;  4M01 A;  3TCA A;  1NI2 A;  1KRH A;  4NNJ B;  3AI5 A;  3TMP B;  4TKN A;  2HJ8 A;  2KD0 A;  4ZYN A;  1N5X A;  4RMA A;  4N58 A;  2SAK A;  4E71 A;  4F7Z A;  4KZ0 A;  2ZCB A;  3NVZ A;  2WXF A;  3MP9 A;  4AUQ C;  1N60 A;  3ML8 A;  1N63 A;  3W5U B;  4RF1 A;  3P63 A;  3OJ3 A;  3LJ3 A;  1EM7 A;  1R7S A;  4AOF A;  3IT6 B;  2ZPY A;  3WCQ A;  2JZ3 B;  2X38 A;  3KUC B;  2MQJ A;  4FLH A;  2CHX A;  1WJU A;  2W82 A;  2XK5 B;  1GC6 A;  3Q6B A;  1WFY A;  1T0R C;  1F0Z A;  3AE2 B;  4LNK A;  1BXT A;  5JZE B;  3N1Y C;  3N20 C;  1V1P A;  1F1H A;  4B0E A;  2N0S B;  4G0N B;  2A4Z A;  1JWS D;  3BVZ A;  3DHH C;  3ZO5 B;  4YXD B;  3UI3 A;  3PZ7 A;  5C1Z A;  5IN7 A;  3DWG C;  1LGR A;  1JQ4 A;  4WWN A;  1TKG A;  2D3B A;  1WH3 A;  4AJY B;  4FAD A;  2BB5 A;  1TYG B;  3MC9 A;  3AE6 B;  1FNV A;  1VR9 A;  1Y8R C;  2L83 A;  2PPH A;  5D7G A;  3W5V B;  1V2Y A;  4XC2 A;  4W9F A;  1KLV A;  2MSE D;  3P2B A;  3C0R B;  1YN5 A;  2EEL A;  1C77 A;  1C78 A;  1VZ6 A;  2IO3 B;  5JXV A;  2H89 B;  2N9E B;  4OHJ A;  4ZHO A;  2WDR B;  4RM9 A;  4BAX A;  4BKG A;  1NVI D;  4IWO A;  3QAQ A;  4LDT D;  1Q5W B;  1ZUD 2;  1IUE A;  3RNG C;  1DGJ A;  4H2A A;  2RPQ A;  5I4D A;  3L16 A;  4LJO B;  2ON8 A;  5CHF A;  2BPS A;  4F1S A;  2KC1 A;  3AE5 B;  5AUI A;  2BS2 B;  2K0P A;  2JYE A;  4GGQ A;  2N9X A;  2YEP F;  2M19 A;  1AWD A;  3E9S A;  3PLV A;  3S2A A;  3TJP A;  4A90 A;  4K7W A;  2V0G A;  1ACC A;  2BKR B;  2KMM A;  2N9P C;  2D07 B;  4PS3 A;  3W9C B;  1C3T A;  2N4F A;  1WM2 A;  3VH4 B;  3ZVV A;  2J7Q B;  4ANV A;  4EOY A;  3M63 B;  5IKC M;  4PYZ A;  1LM8 B;  2J0K A;  1AW7 A;  2C7M B;  2LHE A;  1TKE A;  1CQV A;  3BK1 A;  1MFW A;  2XN9 C;  3H9D A;  2LGX A;  3RZF A;  3APC A;  4LNN A;  4KZC A;  1JCK B;  3M95 A;  5IOI A;  3IT4 B;  1V5T A;  3RNF C;  2LVO A;  4I6P A;  5IA7 A;  1I42 A;  3D32 A;  1ZXH A;  1CK1 A;  1PDX A;  3KWL A;  4B9K A;  3DQV A;  1OGW A;  2NCN A;  2VRR B;  4KIK A;  3V3X A;  2GBN A;  4REZ A;  3VTU A;  1OFF A;  2BGF A;  2AEH A;  1WYG A;  1E90 A;  3U30 A;  1WR6 E;  4FBJ B;  2BT6 A;  3Q3O C;  2KTF A;  5MPO A;  2WXI A;  2JXX A;  1BUI C;  2JPH A;  2WYQ A;  2DYO A;  4NY0 A;  2R2Q A;  2JX5 A;  4J6I A;  2C9W B;  4KGR A;  4ICV A;  4DBG A;  3A9J A;  1RYJ A;  2KVR A;  2DEN B;  3H1U A;  4A55 A;  4MGK E;  2JRH A;  2UWQ A;  2GI9 A;  3EUB 2;  4K3B A;  4P6V F;  5G5G A;  1K8R B;  4YT0 B;  4WQO B;  3ZLZ A;  1P7F A;  1D6E C;  1IPG A;  1JRP A;  2XEW A;  3W1Y A;  4ANU A;  3RN9 C;  4C7Y A;  3A9J B;  2LFI A;  3N30 A;  2QIL A;  4HLE A;  3QX1 A;  1T0Q C;  2JSV X;  2VZK B;  1WMH B;  4N6E B;  3GS2 A;  4TSS A;  4M02 A;  2DAJ A;  3Q14 C;  3A1Q A;  1RWS A;  1DOY A;  3B08 A;  1FD6 A;  4AJW A;  3T3N A;  3TIX A;  2AQ2 B;  2WDV B;  4K7U A;  5IAA C;  2PKO A;  3QJZ A;  4RCO A;  1RFK A;  5FKA C;  3WAN A;  2LUM A;  3BK2 A;  4DDG D;  1OEY J;  2BQQ A;  3IG3 A;  2LJ5 A;  4N59 A;  2KDI A;  1OEY A;  1TT5 B;  4YSZ B;  3ONS A;  5DPW A;  4DHJ B;  1WY8 A;  1VLB A;  4ZRJ A;  3R2T A;  2D3C A;  4GDK B;  1N5W A;  4NJ7 A;  3RI7 C;  1BML C;  1YN3 A;  2X8X X;  1AN8 A;  5AZF A;  4PK1 A;  2K3U A;  2KFK A;  3HM3 A;  3DBH I;  4C4V A;  2DYM A;  2WX1 A;  3UQB A;  1UZX B;  1QQR A;  4LTU A;  2KAC A;  2NR2 A;  4OVZ A;  3TUO A;  4KSL C;  2AWT A;  3O13 A;  1R4M I;  2DYB A;  2WXN A;  2DZJ A;  1E7U A;  1J7B A;  3CWI A;  3CSF A;  3A4S C;  2BKF A;  1GPX A;  2ZPN A;  1EU4 A;  1CZP A;  3IAS 1;  1QLB B;  2VH1 A;  1HXY D;  1X1M A;  2LEK A;  2L0F A;  3B2G A;  1TTN A;  1TZ1 A;  4ZRQ A;  1B9R A;  2OED A;  1SF0 A;  4BKT A;  3VAW A;  2MJ3 A;  4ZHP A;  2PE6 B;  4HKQ A;  2KVZ A;  1YD8 U;  2N9K A;  1SIF A;  2Y5B B;  4CQN A;  3NHE B;  1YMH E;  2GRI A;  3VUX A;  1UWM A;  3NOB A;  4WUR A;  2G3Q B;  3KQ4 A;  1YN4 A;  2O2V A;  2BTE A;  2WXH A;  3AU5 A;  1YJ1 A;  3P4R B;  3LXF A;  2KK8 A;  2WGS A;  3AUL A;  4E74 A;  3FKY A;  1UGJ A;  3Q8A A;  1FCL A;  3MTN B;  2IGH A;  1ZXI A;  3V60 A;  3ZNH B;  2JT4 B;  4GXB A;  2LAS A;  1GB4 A;  1L2N A;  2ZNV B;  4RGO S;  1DYQ A;  4AQ7 A;  2LI5 A;  2ZNV C;  4NJ6 A;  4MH8 A;  2KTR A;  3MHS D;  1BT0 A;  1DOI A;  2HE7 A;  1E0Z A;  2FID A;  2WNM A;  2JZZ A;  4I6L B;  2C60 A;  3CMM B;  5KHQ A;  4HDQ A;  4BKS D;  2J42 A;  1WM3 A;  1GG3 A;  2G45 B;  1HE8 A;  2LWP A;  3GZN B;  2E6X A;  2PTL A;  3ZDT A;  2AYO B;  1FEH A;  1V6E A;  2IO2 B;  2E3T A;  1E7P B;  1NYR A;  1ET6 A;  4BKS A;  3VVW B;  4LNI A;  2WDQ B;  3AED B;  3X23 A;  3ZUN A;  3NG0 A;  4S0R A;  2G4D B;  3HIZ A;  4MGY E;  4NAW A;  3AEC B;  1GUA B;  2RDH A;  1TGZ B;  3RNB C;  3SFE B;  1IBX B;  2BYE A;  1YX5 B;  3ALB A;  1SE2 A;  1SB3 C;  2J0J A;  4NQL B;  3V05 A;  5EE9 A;  3P4S B;  2WXK A;  2ACZ B;  5D3D A;  5CHV C;  1R4N B;  3SD5 A;  3TEZ A;  3NVV A;  3KYD D;  2K9X A;  4GB9 A;  3A9K A;  1TY2 A;  3N3K B;  3TEW A;  5E6P A;  1STE A;  3WAM A;  3ZTC A;  3N9Y C;  3AE7 B;  2KOX A;  3TBL D;  5LNK 1;  3H7S A;  1UBQ A;  2LHD A;  2BYT A;  1VCB A;  1JWM D;  1GAQ B;  2IYD B;  1A70 A;  3KYC D;  4BOZ B;  5HI1 A;  2LUE A;  2RMM A;  1L7Y A;  1SBB B;  4W9H A;  3QQ8 B;  4ANX A;  4IC7 B;  4HRS A;  1TIF A;  2YEP B;  3AE4 B;  2FE8 A;  2IPK D;  1EO6 A;  3KH0 A;  4K3C A;  2M56 B;  5LXH A;  2IDY A;  1F77 A;  2AX5 A;  2CR5 A;  1PGX A;  4FHK A;  3OLM D;  3SHQ A;  4WWO A;  3EHV A;  4F8C B;  1XT9 B;  5AZG A;  4ARC A;  4C7Z A;  3OAW A;  2LJI A;  4LNO A;  2V3P A;  3N1X C;  3AEF B;  4YSY B;  5EE1 A;  4JPS A;  3B0A A;  5G5H A;  2LD9 A;  1C76 A;  3UF8 A;  4YTN B;  1JWA D;  3GB1 A;  2NPT B;  2KDF B;  1I35 A;  1MI0 A;  4DDI D;  5GMV A;  4NPN A;  3PRZ A;  1G6J A;  3WAP A;  1J0G A;  5AEK B;  1JWU D;  1D5M C;  2I2Y A;  3EA6 A;  2L1A A;  2A5U A;  3QHT A;  4RM8 A;  5BO4 B;  5G55 A;  2FAZ A;  1K52 A;  2BYV E;  3BYY B;  3RPF C;  2G9H D;  2XK5 A;  2PVG C;  3PGE A;  5C3J B; 
#chains in the Genus database with same CATH homology
 4R3D A;  1C9F A;  3T3O A;  1XCQ L;  3BII D;  3NRZ A;  1AW7 A;  1KFY B;  2W55 A;  2PLP A;  3URY A;  1PYW D;  3PO0 A;  1ZDV A;  2LHE A;  1TKE A;  1CQV A;  3BK1 A;  4DXG A;  2XN9 C;  4WQM A;  1SJE D;  1JCK B;  3IT4 B;  4XDC A;  3LYY A;  1L5P A;  4ITK A;  4C56 C;  4C80 A;  2WQY B;  1L6U A;  4US9 A;  5HHD G;  2QIE B;  3VRB B;  1PUT A;  1ZXH A;  1HEZ E;  4DQO C;  1CK1 A;  1PDX A;  3KWL A;  4JWS C;  4LK0 M;  3V3X A;  3BWU D;  1NI3 A;  4REZ A;  1JRO A;  1OFF A;  4YSX B;  2H88 B;  1WYG A;  4HJG E;  5AUK A;  2KQ4 X;  2RDG A;  3HUI A;  1HZ5 A;  2BT6 A;  1VDV A;  1VJK A;  2INN E;  1FNW A;  1ZDX A;  4NJC A;  5MPO A;  1Q10 A;  2WXI A;  3FIL B;  1BUI C;  1GOZ A;  1EWY C;  2DYO A;  2WXQ A;  4RH6 A;  2R61 A;  4IOI E;  2QSD A;  2WU5 B;  2WU2 B;  1HA5 A;  5GXG B;  2JX5 A;  2MH7 A;  1XF5 L;  3P42 A;  4KGR A;  4XWT A;  5BYQ A;  3SFD B;  1KLU D;  1CJE A;  4JE3 B;  1MHX A;  2OHF A;  1RYJ A;  3ABV B;  3MJ5 A;  2ZW1 A;  1FFU A;  4RGT A;  4TQ0 A;  1ZP0 B;  4A55 A;  4RGM A;  2XNA C;  4A6Q A;  2BB6 A;  1QT9 A;  2FUG 1;  2KWD A;  3IXS A;  1L4Z B;  2GI9 A;  3EUB 2;  1SXT A;  1YJI A;  2QEJ C;  4P6V F;  4YT0 B;  5G5G A;  1KLG D;  3NZ3 A;  2J52 A;  4YTM B;  2JYT A;  2IJ0 A;  3AN1 A;  1D6E C;  1M4V A;  1P7F A;  4KKI A;  1JRP A;  3P1M A;  3L4P A;  3NVY A;  1I4G A;  2JWU A;  3AE1 B;  1L0Y B;  2PW9 A;  1UUP A;  4C7Y A;  1D4B A;  1FXA A;  2LFI A;  2QIL A;  4KGT A;  1PGA A;  2JSV X;  2VZK B;  4N6E B;  5E6J A;  3GS2 A;  4B0M A;  4TSS A;  2V3N A;  1NYQ A;  4IKG A;  1XLN A;  1RWS A;  1DOY A;  3NS1 A;  1TS2 A;  3U7Z A;  1TY0 A;  1FD6 A;  1JML A;  3T3N A;  1N62 A;  2AQ2 B;  4MT5 A;  2WDV B;  3LB8 C;  2N7J A;  3HVZ A;  4KGS A;  2CJN A;  4EE2 A;  1FIQ A;  2Y5C A;  2MEK A;  2NMQ A;  2PKO A;  4RCO A;  4NAM A;  1RFK A;  5FKA C;  1EWC A;  2LUM A;  3BK2 A;  3CIR B;  4PT5 A;  1L4D B;  2AQ1 B;  2KN4 A;  3Q69 A;  4YWG G;  4N59 A;  1XCT L;  5HG2 A;  2INP E;  2WXL A;  4KX6 B;  5FK9 C;  1I4R A;  4L2Y A;  4RNA A;  5T8I A;  4YSZ B;  1WGK A;  3EGR A;  1ENF A;  2N9L A;  3C8Y A;  2MJD A;  1VLB A;  4P16 A;  3R2T A;  1I4H A;  1LO5 D;  1C4A A;  1ZOY B;  4GDK B;  2KDM A;  3VRA B;  1N5W A;  1KTK A;  1N61 A;  4OZC A;  1VZ8 A;  1BML C;  3R2I A;  1YN3 A;  1AN8 A;  2IGG A;  1UNS A;  1WWT A;  3ZGZ A;  1YQ3 B;  1K51 A;  2DWQ A;  4FXC A;  3FIL A;  2GB1 A;  4RFB A;  1FO4 A;  2K3U A;  1ET9 A;  3AB5 A;  1WXQ A;  2IGD A;  1TS5 A;  4ZOH C;  4IDI A;  2DYM A;  1I7H A;  3P4Q B;  2CU3 A;  5BMH A;  1E9M A;  2AQ3 B;  1QQR A;  4LTU A;  3U52 E;  1K53 A;  2J53 A;  2QMT A;  2KAC A;  1IGC A;  1DOX A;  5D3I B;  3R8B A;  1TZO A;  1L6V A;  5HFY A;  2WLB A;  1FM0 D;  1QIL A;  2JZP A;  3AE9 B;  4OVZ A;  3TUO A;  2KAJ A;  4XE0 A;  2VZK D;  3O13 A;  4NAW B;  3Q8F A;  2WXN A;  1ZE3 D;  2K5P A;  2WS3 B;  3AV8 A;  1J7B A;  4MM3 B;  5H92 C;  3CWI A;  4XWW A;  1I4Q A;  1IGD A;  1FMA D;  3NUH B;  3IAS 1;  1EU4 A;  1CZP A;  1GPX A;  4DXF A;  1QLB B;  1SSN A;  1HXY D;  4L23 A;  4WAF A;  5BMI A;  1V97 A;  1I4P A;  3AE3 B;  2LEK A;  3I57 A;  1TS4 A;  3VR8 B;  3B2G A;  3TSS A;  1PGB A;  1WRI A;  3MC0 B;  4ZRQ A;  5C2T B;  3TEX A;  1B9R A;  2OED A;  1SF0 A;  2DLB A;  4OZB A;  2ICI A;  2MJ3 A;  2MJE A;  4ZHP A;  2W54 A;  1XEE A;  1D5X C;  3ZJT A;  2K22 A;  3SEB A;  4HKQ A;  2D5G A;  3RFZ B;  4CQN A;  2N9K A;  2JU6 X;  4TMA B;  3AMZ A;  2GRI A;  1YMH E;  2LMC A;  4WWM A;  4HEA 1;  3OWE B;  1J7A A;  1D5Z C;  1V1O A;  3FC4 A;  1UWM A;  1KF6 B;  2PMV A;  2Z8L A;  4WUR A;  2Y3A A;  3KQ4 A;  1YN4 A;  2BTE A;  2WXH A;  1YQ4 B;  1RM6 C;  3PZ8 A;  1V1P B;  2NTS A;  1I4X A;  4O1N A;  3P4R B;  3ZJU A;  3LXF A;  2WXJ A;  2JXT A;  1XLO A;  1UGJ A;  3Q8A A;  1FCL A;  2ONQ A;  2W3S A;  2IGH A;  1ZXI A;  1QF6 A;  3I9V 1;  1T6B X;  4USA A;  1YNT E;  5BYR A;  1GB4 A;  4RGO S;  4NZL B;  2PVO D;  2W3R A;  1DYQ A;  4AQ7 A;  3W2D A;  1K50 A;  1GB1 A;  2WXR A;  4MH8 A;  2I38 A;  1VRA B;  3B9J A;  1JAL A;  2M0A A;  1DOI A;  1E0Z A;  3U2S C;  2WNM A;  1NEN B;  2BW2 A;  3AEB B;  1WSP A;  4WH4 A;  1XXG A;  2G1E A;  2Q5W D;  4J3O D;  2BS3 B;  5BMG A;  2TSS A;  1ZPS A;  1E6E B;  3ZJV A;  2NTT A;  1FFV A;  1EU3 A;  2J42 A;  2WXP A;  2L32 A;  1PFD A;  2HDE A;  1TJE A;  4ZRP A;  3BZD B;  1XO3 A;  2PIA A;  4KKJ A;  2JQR B;  2L52 A;  2RPV A;  2EKI A;  2E6X A;  1FXI A;  3VQI A;  1UWX A;  4Q2J A;  1XLP A;  1B1Z A;  2PTL A;  4M0W A;  1QOG A;  1FEH A;  2BBC A;  1C4P A;  4YTP B;  4GLS C;  2E3T A;  1E7P B;  1NYR A;  1ET6 A;  1AYF A;  2WDQ B;  3AED B;  1KRH A;  3Q8E A;  1HQR D;  1Y56 A;  1N5X A;  3J9C A;  3HVD A;  4N58 A;  2SAK A;  3AEC B;  3U4E G;  2RDH A;  4GDL B;  1XLQ A;  1FNU A;  3NVZ A;  3SFE B;  1IBX B;  4RGN A;  2WXF A;  3Q8C A;  3MP9 A;  3NVW A;  1N60 A;  1SE2 A;  1SB3 C;  1N63 A;  3ZQ4 A;  3V05 A;  3W5U B;  1KH0 A;  3P63 A;  4RF1 A;  2WXM A;  5EE9 A;  3P4S B;  2WXK A;  2QJL A;  1EM7 A;  1R7S A;  3IT6 B;  2ACZ B;  5D3D A;  1QOA A;  3WCQ A;  1C4C A;  2X38 A;  3TEZ A;  3NVV A;  3BVG A;  5EE3 A;  1JW9 D;  2K9X A;  1TY2 A;  1F2R I;  3B2F A;  1ESF A;  2W82 A;  3TEW A;  1STE A;  4HRO A;  1F0Z A;  1FRD A;  1L0V B;  5H8Y E;  3AE2 B;  1HZ6 A;  1L0X B;  1BXT A;  4MAC A;  3N9Y C;  3AE7 B;  4ZYS A;  2J4X A;  1OQQ A;  1MHH E;  3VR9 B;  2LGI A;  1FRR A;  1MVK A;  3SR6 A;  5LNK 1;  2SEB D;  1V1P A;  2LHD A;  4L1B A;  5EE0 A;  3KLS X;  4B0E A;  2N0S B;  2BYT A;  4XDD A;  1JWM D;  1QOF A;  5FR3 A;  1JWS D;  1SIJ A;  3MHZ A;  1JWB D;  1GAQ B;  4OW0 A;  3BVZ A;  3AM9 A;  4JX1 C;  1A70 A;  3BVM A;  5HI1 A;  4YXD B;  4OZA A;  2RMM A;  3PZ7 A;  3UI3 A;  2BS4 B;  1SBB B;  3DWG C;  1JQ4 A;  4HRS A;  1TKG A;  3AEA B;  2YEP B;  3W1S A;  3GP7 A;  4US8 A;  3AE4 B;  2BB5 A;  3KWV A;  1SE4 A;  1TYG B;  2FE8 A;  2IPK D;  3HRD D;  1F2R C;  1FNV A;  1ROE A;  1VR9 A;  2L83 A;  3AE6 B;  3DWM A;  5D7G A;  3W5V B;  3ZYY X;  2M56 B;  2DBY A;  3Q8B A;  1OQR A;  1SJH D;  2IDY A;  1YN5 A;  2EEL A;  3P4P B;  1F77 A;  4AS1 A;  1C77 A;  2AX5 A;  5BYS A;  1E10 A;  1C78 A;  1VZ6 A;  1PGX A;  1TS3 A;  3E56 A;  4LLG M;  4HKZ E;  2WP9 B;  5JXV A;  2H89 B;  1TKY A;  2WXO A;  3AH7 A;  4OHJ A;  4ZHO A;  3BYT B;  1YJJ A;  3AEE B;  2WDR B;  4ARC A;  1NVI D;  4C7Z A;  5TSS A;  2LJI A;  4A9A A;  4ARI A;  2V3P A;  1ZUD 2;  2HTM E;  1IUE A;  3FAH A;  3AEF B;  4YSY B;  2FBW B;  5EE1 A;  1DGJ A;  4JPS A;  5G5H A;  4H2A A;  1C76 A;  5I4D A;  2B76 B;  4YTN B;  4D2K A;  1JWA D;  3GB1 A;  1QOB A;  3ETR A;  4UDU C;  3H8H A;  2ON8 A;  3TEY A;  1J7C A;  2V4I B;  3AE5 B;  1FCC C;  5AUI A;  2Y5P A;  3IAM 1;  4JWU C;  4RF0 A;  2BS2 B;  1MI0 A;  1T3Q A;  3MFG A;  1IBX A;  2K0P A;  1P7E A;  2JYE A;  1JWU D;  1V8C A;  1D5M C;  3AE8 B;  2YEP F;  3AEG B;  1MPE A;  3EA6 A;  2M19 A;  1AWD A;  2L1A A;  3E9S A;  2I2Y A;  1C79 A;  1VZ7 A;  2ZW0 A;  4TQ1 A;  4A90 A;  2V0G A;  2WXG A;  1ACC A;  1SEB D;  4WIP A;  2KMM A;  3W9C B;  1NEK B;  4A8X C;  1K52 A;  3BYY B;  1T5X D;  3RPF C;  1SE3 A;  2G9H D;  2CJO A;  2PVG C;  1QKZ A;  5C3J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...