3PZ8A

Crystal structure of dvl1-dix(y17d) mutant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
82
structure length
82
Chain Sequence
DTKIIYHMDEEETPDLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Segment polarity protein dishevelled homolog DVL-1
publication title Molecular basis of WNT activation via the DIX-domain protein CCD1
rcsb
source organism Mus musculus
total genus 12
structure length 82
sequence length 82
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.380 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3pz8A00
1WSPA 3PZ7A 2D5GA 4WIPA 3PZ8A
chains in the Genus database with same CATH superfamily
2LVOA 2MJDA 5HFYA 2FAZA 1TZ1A 3H8HA 3V3XA 4NJ6A 2HJ1A 2AQ1B 2YEPB 5IA7A 2D3AA 3SD5A 4KV2A 1PGXA 2V4LA 1WRIA 2J7QB 2JUOA 4IM2A 4OVVA 4TUUA 3T9LA 5E6PA 2KJRA 4W9LA 4BAXA 1N6ZA 3RNBC 1E7PB 1SE9A 4F1SA 3ZNGC 2OEDA 1EU3A 3PLUA 3DVNV 3H9DA 5FK9C 2KMCA 2PE9A 2A4ZA 2LASA 4LNNA 1RFKA 2V9HA 3W1SA 1I4PA 1ISNA 1GB4A 1KLGD 2LJIA 1P7EA 5D94A 4GIVA 3WAMA 5CHVC 5G5HA 2BYFA 4ZRIA 4LCDE 1VRAB 1YN4A 1FPYA 4ICVA 3SFDB 3UF8A 1TZOA 3L13A 4DXFA 4ZOHC 1FXAA 5E6NA 1QOFA 2D2QA 4A6QA 2Z59B 1K52A 4O1NA 2K22A 1T5XD 2GOWA 1WZ0A 2MQJA 2MP2A 2NTTA 2H89B 2RSUA 3GOEA 1V6EA 1XLQA 2HDEA 1MVKA 3AM9A 2W3RA 2WXOA 1T6BX 5EE9A 5HG2A 2AL6A 4WH4A 1GC6A 3L16A 4HLEA 2J52A 3P4SB 2LGIA 5HHDG 4XDCA 3R2IA 1AN8A 1I4GA 2K6DB 3Q3OC 3SDLC 3VAWA 3S2AA 4MGYE 3CWIA 3Q2AC 2H88B 1TGZB 2V3PA 2WX1A 3ZRCA 1L0YB 3M63B 1F1HA 2NBVB 2FCMA 2QSDA 2AQ3B 4RM9A 3DBHI 1MFWA 3TUOA 1LM8B 3ZGZA 1GB1A 3UQAA 2ZZPB 3RZFA 1GC7A 3LYYA 1WX9A 1JWBD 3I5JC 4HXDA 2NPTA 4HEA1 1TKGA 1F52A 3DBSA 5I4DA 1WJ4A 3AB5A 4ITKA 3VTVA 4FA6A 4R3DA 1I35A 1NI2A 3PZ7A 3NZUA 3NUHB 1TS5A 1WE6A 4ACFA 2GMIC 2PVOD 2KQ7A 4XZ4A 4EE2A 2N9PC 1DGJA 2L32A 4K3CA 1MG8A 1NYQA 2KC1A 3VH4B 5AZFA 4WAFA 4W9KA 4YWGG 3WAPA 4Q2JA 4US8A 4TMAB 1LQBA 4WAAA 4II3B 1XQQA 2WXNA 1WXQA 1SXTA 1QT9A 1R4MI 4E71A 2DX5B 2B3AA 3ZQ4A 3ZJVA 3V62A 5LNK1 1AARA 4HCPB 4RGMA 3Q69A 4EEWA 1V5TA 4HDQA 2WS3B 1VDVA 3BYTB 3L10B 3VXWA 1OQRA 1NENB 3QHTA 2R2QA 3AMZA 3BY4B 2DNFA 3TEXA 1SSNA 3ZVVA 1BXTA 2N1VA 1WH3A 4I6LB 1E8XA 4A9AA 3Q8EA 3Q3JA 1JWAD 1HA5A 3ENEA 2CJOA 3DVGX 4FBJB 2PTLA 1UGMA 2N9LA 1R4NI 3AE3B 2KWVB 2JY6A 3ZKJC 2O6VA 4FHJA 3MHZA 5EDSA 1B1ZA 5BYRA 4TQ0A 3RYTA 4RF0A 2OJWA 3R8BA 1WXAA 2LUEA 3RN9C 3VFKA 4M8NA 5FR3A 4C80A 3AV8A 1D5ZC 3UINB 2K8HA 1YNTE 3VTWA 4EZJA 2DAFA 5JHBA 1OTRB 3DQVA 3EFUA 2YEPF 2OJRA 1EUVB 4JWSC 3NVWA 3M3JA 1VZ6A 3VH3B 2KLGA 2JT4B 1KM7A 1T0RC 1WJ6A 2J0KA 3CMMB 4A8XC 4F7ZA 1C4AA 2JZPA 2FCSA 4W9GA 2B76B 3U8ZA 2KDFB 4RH6A 1NBFC 2LRUA 2KMMA 4MDKE 1E8WA 1ET6A 5CX3A 2KOXA 2NBWB 2BVCA 2J4XA 5C2TB 4AP4C 4KIKA 4RMAA 4GDKB 4MSQB 5GMVA 2Y3AA 2D3GA 1FIQA 4I6NB 1SIFA 2IZVB 1TBEA 3IAM1 3R7RA 1WXMA 1WWTA 1RRBA 2CJNA 3KYDD 1FNUA 1FD6A 4URKA 2KO3A 1FO4A 2MBOA 2IGDA 2KJ6A 3WAOA 1PYWD 2KD0A 4S0RA 2HTME 4HPMB 1SE4A 2XK5A 3KVFB 1YMHE 1Z2MA 1EU4A 4F8CB 5AZHA 2WDTB 3W1YA 3ZXRA 2WX0A 5D7GA 2BWES 3U52E 1TKEA 4WWNA 1FFUA 4FJYA 3W5VB 3FILB 4P1BC 2C7NB 1Y8RC 4NAMA 3A33B 4YTNB 3LXFA 3NG0A 1WXSA 1WX7A 4ASWC 3PRZA 4DWFA 1VD2A 2JSVX 1E7UA 4LNKA 1KOTA 3UGBB 2QILA 1ZKHA 1MHXA 2BKRB 2BW2A 3HM3A 3A1QB 4K7WA 3L54A 2KVZA 3QIJA 4K3BA 4PT5A 4GOCA 3MHSD 4IC7B 5AUIA 4M02A 3P4PB 5G2NA 4ANWA 3E9SA 1V1OA 5C1ZA 3WANA 3R3MA 4KGTA 2ICIA 2HJ8A 3TEYA 4IUMB 2PEAA 2KHWB 1FCLA 4XDDA 3TIXA 2WDVB 5HI1A 4EFOA 2BT6A 2ZW1A 3AU5A 1H4RA 3Q3MC 2FIDA 4P16A 5C3JB 2V3NA 2BS4B 4KKIA 1FCCC 4YSYB 4HJGE 4MJSB 1CZPA 5H92C 2WXHA 4XX5A 1UWMA 1K8RB 2LXAA 2UU7A 2J0MA 2PW9A 1UZXB 3SFEB 4KSLC 2C60A 3H7PB 4QAYA 2MSED 2WYQA 2M8SA 4BKGA 2G4SA 1RM6C 2JWUA 3JYUA 1NVID 1P1AA 3RD2A 2E6XA 4BFRA 1IUEA 3CF6E 4HJKA 2TSSA 2INNE 2Z8LA 2IGHA 3Q8AA 2HD5B 3J9CA 4C7ZA 2DZKA 1V49A 2KQSA 1PGBA 4BKTA 3P42A 3QAQA 4IWQA 1KH0A 2J53A 2J42A 1WMHA 2W9NA 4MM3A 3APDA 3BK1A 3BWUD 4PK1A 3TBLD 3SEBA 3H1UA 1SE2A 1RWSA 1XLPA 1PQSA 2GLSA 1A70A 1ET9A 4RGOS 4AQ7A 1F2RI 2L1AA 1CJEA 4JX1C 2AQ2B 2REXA 4KZCA 1OGWA 3RNFC 1KLVA 3AE9B 2FUG1 2JZZA 3IAS1 2JU6X 1BMLC 2N1WA 1C4PA 3DHGC 5TSSA 2WXMA 1F0ZA 2Y5PA 1OQQA 3VUWA 4GGQA 2XBBC 2N9XA 3PLVA 2LJ5A 4W9CA 5J18A 4D2KA 3QARA 2IGGA 3PHXB 2ZNVB 1ZUD2 3I3TB 1EWYC 1RLFA 1QILA 1I7HA 4HKQA 2W3SA 3MTNB 1QOGA 3DBLI 3B2GA 4DHZE 1FM0D 4IW0A 1FRDA 2DENB 4IM0A 2RPVA 3HUIA 3TEZA 1GJZA 3DBRB 5GXGB 5HKHA 3Q8FA 3U30A 3PHWB 4PS7A 4BBNF 2N7DA 4NAWA 1GOZA 4HRSA 1A5RA 4M8MA 1B9RA 2MH7A 4YSZB 4ICUA 4LLGM 4HROA 4NZLB 4OZBA 2GB1A 1MPEA 3N1YC 2N7EA 2LHDA 4B9KA 1DYQA 3QJZA 2QEJC 1PUTA 5D6JB 3N1XC 1WR6E 1WR1A 2ZVOA 1ZDXA 2KWUB 1J0GA 4JL9A 1U4AA 4N6EB 5J17A 3DWGC 2RDGA 1SIJA 1HZ6A 1ZPSA 3JW0X 2MX2A 3A4SC 5D2MB 3WALA 1GUAB 1NEKB 1C77A 4IM3A 3O13A 2ZNVC 3ETRA 4KX6B 2KTRA 1TTNA 4AWJA 3ZDMC 5DPRA 4MH8A 2WDQB 4N9F4 3DVGY 5JZEB 3M95A 1L6VA 3QCAA 1V2YA 2CU1A 1WGHA 5E6JA 1E8YA 3JSVA 4P6VF 2LZ6A 2L7RA 2K3UA 1EF5A 2ONQA 3HIZA 1YN5A 3SR6A 3FAHA 3W5UB 3WCQA 4L23A 1L4DB 1RFAA 4BOSC 1UGJA 2ASQA 3R7QA 1J7BA 2FCQA 1C79A 3VUXA 3KYCD 1MHHE 2V4IB 3QQ8B 3EGRA 2WLBA 4W9HA 4ZRPA 3R66C 1V1PA 5IKCM 1S3SG 3LJ3A 1YQ4B 5TR5A 2GBRA 2ZW0A 3PRMB 3I57A 1C76A 1WGKA 3C8YA 1TY0A 3GE8C 1IPGA 2NCNA 1KLUD 2WXGA 5DPTA 2W54A 3DPDA 1ZDVA 2KYWA 4ANUA 4OVZA 4XWWA 1YJ1A 1ZGUB 3JVZX 3X23A 1WYGA 3HVDA 2JVCA 2O2VB 4DDID 1E7VA 2KDEB 4WJNA 1E5WA 1DOXA 1HE8A 2C9WB 3DVNU 3A4RA 2EELA 4LNOA 4MH0E 1TT5B 2RD0A 3AE2B 2FIFA 2IYDB 4N59A 4HK2A 2KJHB 3AEDB 4MGIE 3PSEB 5BMIA 4JPSA 2AL3A 3QA8A 3V6CB 3A9KA 3IXSA 4GDLA 3KWVA 2ZCBA 1V80A 4M0WA 3ONSA 2KK8A 1C4CA 5CHWA 3VR8B 4PYUA 3HHMA 2JZ3B 4C56C 5CHFA 3AE4B 3I63C 1HTOA 4WWMA 3P1MA 1I4XA 3EHVA 3ZUNA 4WJQA 2K8BA 2NMQA 4JWUC 2X38A 4XWTA 1EM7A 2IPKD 2D3BA 2I38A 3DCGA 4YTPB 2QCZA 2K8CA 1ZE3D 4P1CC 2KWCA 5DPWA 5FKAC 4KKJA 4W9DA 1UH6A 1PGAA 2C7HA 4YT0B 2BF8B 3AI5A 4FULA 2GBJA 2LI5A 4NJ7A 2NS5A 3H7SA 2JXTA 2WXQA 3EECA 4A20A 4JE3B 1ACCA 3MC9A 5C23A 2CS4A 4JLCA 5IN7A 2DZIA 4HCNB 4B0EA 2JWZA 3V05A 3PTFC 3W2DA 3AEBB 4AOFA 1FFVA 3ALBA 2C7MB 2Z0EB 3B9JA 2CU3A 2KC2A 5JH5C 4EKUA 1SJHD 3V6EB 1QOAA 2IY1B 3KLSX 1D6EC 1E10A 3RNEC 1TJEA 2KN5A 2EKEC 4C4VA 3PV1A 2KANA 1Q5WB 1V86A 1KJTA 3NZ3A 4ANVA 4DHZB 3NZSA 1IYFA 1HEZE 4ZDVA 2KLCA 3L0WB 2A5UA 1V9JA 4FXCA 2MP2B 2LGYA 2D07B 1FEHA 1STEA 1YX6B 4UDUC 1YX5B 2LFIA 1P9DU 1CMXB 2L52A 1D4BA 4FN2A 2W82A 2BYTA 4OW0A 2PIAA 3DOWA 2VRRB 3C0RB 3DBHB 3AH7A 4ZHOA 1F9JA 1L0VB 3BVGA 1OEYJ 3N1ZC 4IKGA 2D10A 2D11A 2IO0B 4G11A 4ANXA 3OLMD 5MPOA 2VZKB 4IG7B 3W1SC 3I9V1 3AE8B 1JALA 4ZYSA 2RMMA 1WRDB 3APCA 3DHHC 1QZEA 1QF6A 3M62B 2KAJA 4KZ0A 4IWOA 2QHOA 2KFKA 1L2NA 3KWLA 2VH1A 2V3SA 1LGRA 2MBBB 2O6VD 3RFZB 3B2FA 4XC2A 2PVGC 3GZNI 3WIMA 1HTQA 3VDZA 3NVVA 1HQRD 4CQNA 5EE0A 4EOYA 4ZRJA 4YSXB 3L4PA 2Q5WD 2BPSA 2WXPA 4LJPB 2MCNB 5KHOA 4IWPA 2IY0B 1R4MB 1WSPA 1EO6A 5EE3A 3VHTC 4BBNC 2NPTB 1JROA 4A90A 2M4NA 3MC0B 3AE6B 4ZRKA 1WY8A 2GRIA 3N30A 3RULA 1XLOA 4XE0A 4BZAA 4LDTD 4ZHPA 2MBEA 3BYYB 1C9FA 4JGHB 3TSSA 4LTUA 3IT6B 3AU4A 2KKCA 1QQRA 1R4NB 2QJLA 1YIWA 4ARCA 2IO2B 1UWXA 3IG3A 3NJTA 1LO5D 5LXHA 2MBHA 1Q1OA 1T0QC 1WF9A 1UNSA 3PZDA 1Q10A 2KZRA 3DDCB 2ON8A 2AYOB 1RAXA 5D3DA 2MRPA 2NR2A 2FCNA 2BYEA 2R2OA 2CHZA 1FRRA 1ENFA 5EE1A 4OZAA 4MEMA 1VJKA 3VTUA 2I2YA 3ML8A 2KX3A 3HK0A 4GMVA 2JXXA 3AE1B 2DYMA 4M00A 2K1FA 4YXDB 4GLSC 2BWFA 3VR9B 4DXAB 2BBCA 3EC8A 2O6VB 3AECB 1ZP0B 2N7JA 4W9FA 2L05A 5G5GA 2CHWA 2RDBC 2DLBA 2QIEB 3IT4B 3EA6A 1E9MA 3T8MA 2GBMA 3ZTCA 3OWEB 4S17A 2DYBA 1QLBB 3NRZA 1L4ZB 1QOBA 2K6QA 2K39A 2KVRA 1E8ZA 2MJEA 2KQ4X 3CSTA 1OFFA 1KRHA 3ABVB 1D3ZA 2M19A 2XEWA 3AE5B 2KN4A 2M1MA 1M4VA 1BT0A 1F77A 5L83A 2LGSA 3CIRB 4LDTB 3FKYA 4KGRA 1J8CA 3GE3C 2PKOA 1N5WA 2ZCCA 2M56B 3T3NA 4WURA 1N63A 3PT2B 3KH0A 1P0RA 1TS4A 1WFYA 1V8CA 4AJWA 1JMLA 3UQBA 1P3QU 1Y56A 2PJHA 2WXIA 3EFCA 3Q8BA 4MSMB 3RNAC 2X8XX 4CHKA 1E90A 1N61A 1TS3A 3UI3A 3BVZA 3AE7B 1YD8U 2INDC 1NDDA 1I4QA 1D5XC 1FXTB 2KMAA 2BS2B 1KTKA 2QDFA 1IBXB 3OG5A 1AWDA 2LVQA 4US9A 1XD3B 1FNWA 4G0NB 1WJNA 2LD9A 2FBWB 3NS1A 2XK5B 3BK2A 1I4HA 4RM8A 4HDOA 2BTEA 2WWZA 3SU8X 3V60A 2V1YA 5JHAA 2WHIA 1M94A 1IGCA 1NYRA 1ZOYB 1VR9A 4M01A 4NPNA 1WI0A 4W9JA 1YJIA 1C78A 2Y5CA 1EF1A 4REZA 2J0JA 4G50A 2QC8A 2XNAC 3OAWA 4NY0A 2K25A 3ZO5B 2MWSB 1BUIC 3ZLZA 1TS2A 2QMTA 3EUB2 2LRWA 2MJ3A 2OOBB 1KFYB 2DWQA 5BYSA 5BMHA 2K0PA 4MGZE 4KDIC 4PS8A 4LK0M 3ZJUA 1XLNA 4HWIB 2PLPA 2BYVE 2GBNA 4A3PA 4KDLB 1XO3A 1SJED 3PPAA 3RNGC 4YL8A 4FADA 3RZWC 1JCKB 1VZ7A 4CYEA 2M0AA 3Q3NC 2I1KA 2DHZA 4BKSD 2L76A 5T8IA 3RT3B 1YOVB 3OJ3A 4KVGB 4ZYNA 2XN9C 3HM6X 1UF0A 2L3ZA 1DOYA 1XT9B 4KGSA 5G55A 1WE7A 5BO4B 4I6PA 1AW7A 1C3TA 2WXJA 5DCNA 1TY2A 3X0WA 1L5PA 1OQYA 2KACA 3RUIB 3PRPB 3A9JB 1MG4A 1J7AA 4AJYB 4AS1A 2G45B 2JYTA 4NQLB 1N60A 2JF5A 1J7CA 2AX5A 2BB5A 1GNUA 2GI9A 4RCOA 2NTSA 3LB8C 1WGDA 3AEAB 4HPPA 3PVLA 3APFA 3MFGA 2ACZB 1MI0A 1XF5L 3NHEB 2WXFA 1WMHB 2K9XA 1SGHA 4GDKA 3Q8CA 4MM3B 2JPHA 2LGDA 5J2RA 2M17A 2L00B 3HRDD 2L8JA 1SBBB 1JW9D 1WIAA 2IDYA 4PYZA 5D3IB 4MACA 4IDIA 3PGEA 1E6EB 2CHXA 4HVBA 2G4DB 3DBLB 2MW5A 3K9PB 3P63A 4N58A 3TL5A 4TV3A 2WU5B 4AUQC 3U2SC 2N9EB 4JQWC 4BVUC 2N0SB 1WM2A 5AEKB 2CR5A 2WGSA 3MJ5A 3AULA 1LXDA 2LGXA 1JRPA 1HZ5A 2YVCA 3NS8A 4GSWA 2AWTA 2IO3B 2BS3B 1T0SC 2DAJA 1F2RC 4II2B 2OHFA 2L83A 2UWQA 5BMGA 2KFJA 1X1MA 4B95A 3N32A 4GU2A 1HXYD 1CQVA 2FUHB 1JWUD 2G1EA 1D5MC 1L6UA 1N5XA 3FILA 2LMCA 4WWPA 4TQ1A 1V97A 4MGKE 1LFDA 3N9YC 1OEYA 1S1QB 1SB3C 2LHEA 4L2YA 1T0YA 2WQYB 3RI7C 2I1JA 3MP9A 1L7YA 2VZKD 4ZRQA 4NAWB 3Q14C 4GN1A 3ZXVA 2D5GA 3BZDB 4H2AA 1ZXIA 4DHJD 2DZJA 2MBQA 4EZLA 2AEHA 1YQ3B 4A55A 3A1QA 2IO1B 1J19A 2BQQA 1YN3A 1YQBA 3IBEA 1XEEA 1WGGA 4WWOA 4TKNA 5IO9A 3U7ZA 1IGDA 1AYFA 2Z0DB 3N20C 3PREA 3TMPB 3ZJTA 4CO7A 4LNFA 3RNCC 4RFBA 1K50A 2SEBD 1MJDA 1XCTL 2Y5BB 1VZ8A 3KUDB 1H8CA 5FR6A 4J3OD 1WYWB 1EWCA 3OJ4B 2R61A 3IVFA 1UUPA 1UELA 2MEKA 3GP7A 5AUKA 3QX1A 2SAKA 4WJPA 2KTRB 1WGYA 3PS6A 2PMVA 4NJCA 1YJJA 4WJOA 4ARIA 1L0XB 4MJSA 1WZ3A 3BIID 3HVZA 4RGTA 3Q3FA 3NY5A 3H7PA 2DYOA 2EMSA 3ZNHB 3JSVB 3GS2A 3U7DA 1JRUA 1K51A 2LXCA 2WXLA 1E0ZA 2K5PA 4DK5A 2N9KA 3BVMA 3E56A 3QK0A 5LXIB 1VLBA 3P4QB 2ZVNA 1ROEA 2GBKA 5BYQA 5KHQA 3IFWB 2UYZB 3IHPC 4LNIA 3MC8A 3ZW3A 2WXKA 1DOIA 2JX5A 1V1PB 2DBYA 4OHJA 2DZMA 3B08A 2HTHA 3GB1A 4E3CA 3VRBB 3UIPB 1Q0WB 1TKYA 3P2BA 4WIPA 4MT5A 1N62A 2MHJA 4K1RB 4DHJB 4MELA 4JIOU 2PPHA 3PZ8A 2WDRB 2KDMA 1WXVA 1TIFA 3AEEB 4FHKA 4FJZA 2KT7A 2JRHA 3BINA 4C7YA 1NI3A 3B1LX 4NQKE 2EMTA 4DBGA 3D32A 2JYEA 3KUZA 5AZGA 3FC4A 2VH2A 4K81A 2IBIB 1PFDA 3KUCB 3L08A 4BOZB 3B0AA 3ZTDA 3DWMA 2KDIA 1IBXA 4KSKC 3U4EG 1WM3A 4J6IA 2C5LC 4PS3A 3A9KB 1TYGB 4GDLB 3TJPA 3AN1A 4W9IA 4M0WB 1UD7A 3UIOB 3TEWA 3N3KB 2RR9A 2FE8A 1JWSD 4DQOC 3ZDTA 3WA0A 3C19A 3VVWB 3ZIMA 3ZRFA 3NVYA 1P7FA 3DHIC 2D3CA 2INCC 3V61A 4B0MA 4C00A 3RCZA 3ZNID 3H6NA 2V0GA 4E74A 4X57B 2WXRA 1WGRA 2PE6B 4IOIE 3KW5B 3R2TA 5IAAC 3Q6BA 1SE3A 4L1BA 1XCQL 2G9HD 2KXJA 1IP9A 2WP9B 4GXBA 2NVUI 4NNJB 4RGNA 1Z5SB 3LDZE 2WU2B 2KWDA 1KF6B 1RYJA 2KNBA 3NVZA 2G3QB 3DBRI 1JWMD 4XYCA 4EZKA 4FLHA 2FNJB 1C1YB 3RPFC 3CSFA 3PO0A 3QC8B 5E6OA 4RF1A 4WQMA 4K7SA 1GPXA 1CK1A 4G3XB 2MA9B 4FJVB 2MLBA 2BGFA 3ECIA 1FMAD 1T3QA 1ZXHA 4HKZE 3AEGB 3MJWA 4W9EA 3VUYA 4C4VB 2ZEQA 2BKFA 2KTFA 4YTMB 5CTRC 1XXGA 1FNVA 5DPSA 4TSSA 4LJOB 2L0FA 1PDXA 4DDGD 2LUMA 3A9JA 1P98A 3P4RB 1WX8A 1ZW7A 3ML9A 2EKIA 3AXCA 4K7UA 1V5OA 4HPLB 3T3OA 2ZPYA 5H8YE 2ZJDA 2JRIB 2ZPNA 4XGAB 1JQ4A 2LWPA 2E3TA 3ZYYX 1K53A 1GAQB 2RGFA 3AEFB 3O65B 2LEKA 2W55A 4OZCA 3TCAA 1I42A 1GG3A 5L95C 3VQIA 3GZNB 1V81A 1QKZA 5IP4D 4USAA 4DXGA 4P7IA 3URYA 2N4FA 1R7SA 1UBIA 2IJ0A 4A3OA 2INPE 2YLMA 4KIKB 1SF0A 3VRAB 5LLIA 5IOIA 2JQRB 1ESFA 2L0TA 1UBQA 2RPQA 1SEBD 2RDHA 3NOBA 4WQOB 3ZNZB 2O2VA 3SHQA 2LVPA 4EUTA 2KDBA 1FXIA 3RMKC 3L17A 2KFKB 2KX0A 3K9OB 2NBUA 2CKHB 3W9CB 1G6JA 5JXVA 4GB9A 1I4RA 4BKSA 4RNAA 4B6WA 2BB6A 4OVUA 1VCBA 2HE7A 2WNMA 3KQ4A 1WJUA 2M0XA 3QWZB
chains in the Genus database with same CATH topology
2MJDA 5HFYA 1HEZE 4PT5A 3H8HA 3HRDD 5AUIA 3V3XA 3P4PB 1SBBB 1JW9D 2IDYA 5D3IB 4MACA 3E9SA 4FXCA 4IDIA 1V1OA 2AQ1B 2YEPB 1FEHA 1E6EB 1STEA 4UDUC 4KGTA 2LFIA 2ICIA 3P63A 3TEYA 1PGXA 4N58A 1WRIA 2L52A 1D4BA 2WU5B 2W82A 3U2SC 1FCLA 2BYTA 4XDDA 4OW0A 2PIAA 2WDVB 5HI1A 4ZHOA 2BT6A 3AH7A 2N0SB 3MJ5A 2ZW1A 1L0VB 3BVGA 1JRPA 1HZ5A 4IKGA 2BS3B 4P16A 5C3JB 2V3NA 2BS4B 4KKIA 1FCCC 1F2RC 4YSYB 4HJGE 5MPOA 2OHFA 1CZPA 2L83A 2VZKB 2WXHA 5H92C 5BMGA 1UWMA 2PW9A 3I9V1 3SFEB 1E7PB 3AE8B 1JALA 4ZYSA 2RMMA 2OEDA 1EU3A 1HXYD 1CQVA 1QF6A 1JWUD 2G1EA 5FK9C 2KAJA 1D5MC 1L6UA 1RM6C 1RFKA 1N5XA 3FILA 3W1SA 1I4PA 2JWUA 2LMCA 1NVID 1GB4A 1KLGD 2E6XA 3KWLA 2LJIA 4TQ1A 1V97A 1P7EA 1IUEA 3N9YC 1SB3C 2LHEA 2TSSA 4L2YA 2INNE 2Z8LA 2WQYB 2IGHA 3Q8AA 5G5HA 3MP9A 3RFZB 3B2FA 3J9CA 2PVGC 4C7ZA 3NVVA 2VZKD 1VRAB 1HQRD 1PGBA 4ZRQA 1YN4A 4NAWB 4CQNA 5EE0A 3P42A 2D5GA 3BZDB 4YSXB 3L4PA 2Q5WD 4H2AA 1ZXIA 1KH0A 2WXPA 3SFDB 2J53A 1YQ3B 2J42A 4A55A 1WSPA 1TZOA 5EE3A 4DXFA 4ZOHC 1FXAA 3BK1A 3BWUD 3SEBA 1QOFA 1YN3A 4A6QA 1SE2A 1RWSA 1XEEA 1XLPA 1JROA 3U7ZA 4A90A 1K52A 4O1NA 1A70A 1ET9A 1IGDA 2K22A 4RGOS 1AYFA 1F2RI 1T5XD 4AQ7A 2L1AA 3MC0B 3ZJTA 1CJEA 4JX1C 2AQ2B 4RFBA 3AE6B 1K50A 2SEBD 2NTTA 2H89B 2GRIA 1XCTL 1VZ8A 1XLOA 1XLQA 4XE0A 4J3OD 2HDEA 4ZHPA 1MVKA 1EWCA 2W3RA 2FUG1 3AE9B 3AM9A 3IAS1 2JU6X 2WXOA 1T6BX 3BYYB 1C9FA 1BMLC 2R61A 3TSSA 1UUPA 4LTUA 5EE9A 1C4PA 2MEKA 3IT6B 3GP7A 5AUKA 5HG2A 4WH4A 5TSSA 2QJLA 1QQRA 2SAKA 2WXMA 1F0ZA 2J52A 2Y5PA 4ARCA 1OQQA 2PMVA 4NJCA 3P4SB 1YJJA 2LGIA 5HHDG 4ARIA 4XDCA 1L0XB 3R2IA 1UWXA 1AN8A 1I4GA 4D2KA 2IGGA 3BIID 1LO5D 1ZUD2 3HVZA 4RGTA 1EWYC 1QILA 1I7HA 2DYOA 4HKQA 1UNSA 2W3SA 3GS2A 3CWIA 2H88B 1K51A 1Q10A 2WXLA 1E0ZA 2K5PA 1QOGA 2N9KA 2ON8A 3BVMA 3E56A 3B2GA 2V3PA 1VLBA 3P4QB 1FM0D 5D3DA 1ROEA 1FRDA 2RPVA 3HUIA 5BYQA 1L0YB 3TEZA 1FRRA 5GXGB 1ENFA 3Q8FA 2QSDA 2AQ3B 5EE1A 4OZAA 3TUOA 1VJKA 2WXKA 1GOZA 2I2YA 1DOIA 2JX5A 3ZGZA 4HRSA 1GB1A 1V1PB 3AE1B 2DYMA 1B9RA 2MH7A 4YXDB 4GLSC 3VR9B 4YSZB 2BBCA 2DBYA 3AECB 1ZP0B 4OHJA 4LLGM 2N7JA 4HROA 4NZLB 3LYYA 5G5GA 1JWBD 2DLBA 3GB1A 4OZBA 2GB1A 1MPEA 4HEA1 3VRBB 1TKGA 2LHDA 1TKYA 4WIPA 4MT5A 1N62A 5I4DA 2QIEB 3IT4B 1DYQA 2QEJC 3AB5A 4ITKA 3EA6A 1PUTA 1E9MA 3PZ8A 2WDRB 2KDMA 4R3DA 1ZDXA 3OWEB 1QLBB 3PZ7A 3NRZA 3NUHB 1L4ZB 1TS5A 4N6EB 1QOBA 3AEEB 3DWGC 4EE2A 2PVOD 1DGJA 2L32A 2RDGA 1SIJA 2MJEA 1NYQA 2KQ4X 4C7YA 1HZ6A 1ZPSA 1NI3A 4WAFA 1OFFA 1KRHA 3ABVB 2M19A 3AE5B 2JYEA 1NEKB 2KN4A 1C77A 1M4VA 3FC4A 3ETRA 3O13A 4YWGG 1F77A 4Q2JA 4KX6B 4US8A 4TMAB 1PFDA 3CIRB 2WXNA 4MH8A 1WXQA 1SXTA 1QT9A 2WDQB 4KGRA 3ZQ4A 3ZJVA 3DWMA 2PKOA 1N5WA 5LNK1 1IBXA 1L6VA 4RGMA 3Q69A 2M56B 3T3NA 4WURA 1N63A 5E6JA 3U4EG 1TS4A 1V8CA 2WS3B 1VDVA 3BYTB 4P6VF 1OQRA 2K3UA 1JMLA 1NENB 2ONQA 4GDLB 1TYGB 3AMZA 1YN5A 3SR6A 3FAHA 1Y56A 3AN1A 2WXIA 3TEXA 3W5UB 3WCQA 1SSNA 4L23A 1L4DB 3TEWA 1BXTA 3Q8BA 1UGJA 2FE8A 1JWSD 1J7BA 4DQOC 1C79A 4A9AA 3Q8EA 1JWAD 1HA5A 1MHHE 3NVYA 2CJOA 2V4IB 1P7FA 2PTLA 1N61A 1TS3A 3EGRA 3UI3A 2WLBA 2N9LA 3AE7B 3BVZA 4ZRPA 4B0MA 3AE3B 1V1PA 2V0GA 1I4QA 1D5XC 1YQ4B 2BS2B 2WXRA 2ZW0A 3I57A 3MHZA 1C76A 1KTKA 1B1ZA 1WGKA 5BYRA 4IOIE 3C8YA 3R2TA 1IBXB 4TQ0A 1TY0A 4RF0A 1SE3A 1AWDA 4L1BA 3R8BA 1XCQL 2G9HD 4US9A 1FNWA 2WP9B 5FR3A 1KLUD 4C80A 2FBWB 2WXGA 3AV8A 1D5ZC 4RGNA 3NS1A 3BK2A 2WU2B 2KWDA 1I4HA 1KF6B 1RYJA 1ZDVA 2W54A 1YNTE 4OVZA 2BTEA 4XWWA 3NVZA 1JWMD 2YEPF 3RPFC 1WYGA 3HVDA 1IGCA 1NYRA 1ZOYB 4JWSC 1VR9A 3NVWA 3PO0A 1VZ6A 1YJIA 4RF1A 4WQMA 1DOXA 1C78A 4A8XC 1GPXA 2Y5CA 1CK1A 2EELA 4REZA 3AE2B 1C4AA 2JZPA 4N59A 2B76B 2XNAC 4RH6A 3AEDB 1FMAD 1T3QA 2KMMA 5BMIA 4JPSA 1BUIC 1ZXHA 4HKZE 3AEGB 1ET6A 1TS2A 2QMTA 3IXSA 3EUB2 3KWVA 2J4XA 2MJ3A 4M0WA 5C2TB 4YTMB 1KFYB 2DWQA 5BYSA 1C4CA 5BMHA 2K0PA 4GDKB 3VR8B 4LK0M 1XXGA 3ZJUA 2Y3AA 1FNVA 1XLNA 4TSSA 1FIQA 2PLPA 4C56C 3AE4B 1XO3A 4WWMA 1PDXA 1SJED 3P1MA 2LUMA 1I4XA 3P4RB 2EKIA 3IAM1 3T3OA 5H8YE 1WWTA 1JCKB 1VZ7A 4MM3B 2M0AA 1JQ4A 2NMQA 4JWUC 2X38A 4XWTA 2CJNA 2E3TA 1EM7A 2IPKD 3ZYYX 1FNUA 1K53A 2I38A 5T8IA 1GAQB 4YTPB 1FD6A 3AEFB 2LEKA 2W55A 1FO4A 4OZCA 1ZE3D 3VQIA 2XN9C 1QKZA 2IGDA 1PYWD 4USAA 4DXGA 1DOYA 2HTME 3URYA 4KGSA 5FKAC 1R7SA 2IJ0A 4KKJA 1SE4A 2INPE 1YMHE 1AW7A 1EU4A 2WXJA 1PGAA 1TY2A 1SF0A 3VRAB 1L5PA 2JQRB 1ESFA 4YT0B 2KACA 5D7GA 1SEBD 2RDHA 3U52E 2JXTA 1J7AA 1TKEA 2WXQA 4AS1A 4JE3B 1ACCA 2JYTA 4B0EA 1FFUA 1FXIA 3V05A 3W5VB 3FILB 3W2DA 1N60A 3AEBB 1FFVA 4NAMA 1J7CA 4YTNB 3B9JA 2AX5A 2BB5A 2CU3A 3LXFA 2GI9A 4RCOA 1SJHD 3W9CB 2NTSA 1QOAA 2JSVX 3LB8C 3AEAB 5JXVA 1I4RA 3KLSX 1D6EC 3MFGA 2QILA 1E10A 2ACZB 1TJEA 4RNAA 1MI0A 2BB6A 1XF5L 1MHXA 2WXFA 2BW2A 2WNMA 3KQ4A 3NZ3A 2K9XA 3Q8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WSP A;  3PZ7 A;  2D5G A;  4WIP A;  3PZ8 A; 
#chains in the Genus database with same CATH topology
 2LVO A;  2MJD A;  5HFY A;  2FAZ A;  1TZ1 A;  3H8H A;  3V3X A;  4NJ6 A;  2HJ1 A;  2AQ1 B;  2YEP B;  5IA7 A;  2D3A A;  3SD5 A;  4KV2 A;  1PGX A;  2V4L A;  1WRI A;  2J7Q B;  2JUO A;  4IM2 A;  4OVV A;  4TUU A;  3T9L A;  5E6P A;  2KJR A;  4W9L A;  4BAX A;  1N6Z A;  3RNB C;  1E7P B;  1SE9 A;  4F1S A;  3ZNG C;  2OED A;  1EU3 A;  3PLU A;  3DVN V;  3H9D A;  5FK9 C;  2KMC A;  2PE9 A;  2A4Z A;  2LAS A;  4LNN A;  1RFK A;  2V9H A;  3W1S A;  1I4P A;  1ISN A;  1GB4 A;  1KLG D;  2LJI A;  1P7E A;  5D94 A;  4GIV A;  3WAM A;  5CHV C;  5G5H A;  2BYF A;  4ZRI A;  4LCD E;  1VRA B;  1YN4 A;  1FPY A;  4ICV A;  3SFD B;  3UF8 A;  1TZO A;  3L13 A;  4DXF A;  4ZOH C;  1FXA A;  5E6N A;  1QOF A;  2D2Q A;  4A6Q A;  2Z59 B;  1K52 A;  4O1N A;  2K22 A;  1T5X D;  2GOW A;  1WZ0 A;  2MQJ A;  2MP2 A;  2NTT A;  2H89 B;  2RSU A;  3GOE A;  1V6E A;  1XLQ A;  2HDE A;  1MVK A;  3AM9 A;  2W3R A;  2WXO A;  1T6B X;  5EE9 A;  5HG2 A;  2AL6 A;  4WH4 A;  1GC6 A;  3L16 A;  4HLE A;  2J52 A;  3P4S B;  2LGI A;  5HHD G;  4XDC A;  3R2I A;  1AN8 A;  1I4G A;  2K6D B;  3Q3O C;  3SDL C;  3VAW A;  3S2A A;  4MGY E;  3CWI A;  3Q2A C;  2H88 B;  1TGZ B;  2V3P A;  2WX1 A;  3ZRC A;  1L0Y B;  3M63 B;  1F1H A;  2NBV B;  2FCM A;  2QSD A;  2AQ3 B;  4RM9 A;  3DBH I;  1MFW A;  3TUO A;  1LM8 B;  3ZGZ A;  1GB1 A;  3UQA A;  2ZZP B;  3RZF A;  1GC7 A;  3LYY A;  1WX9 A;  1JWB D;  3I5J C;  4HXD A;  2NPT A;  4HEA 1;  1TKG A;  1F52 A;  3DBS A;  5I4D A;  1WJ4 A;  3AB5 A;  4ITK A;  3VTV A;  4FA6 A;  4R3D A;  1I35 A;  1NI2 A;  3PZ7 A;  3NZU A;  3NUH B;  1TS5 A;  1WE6 A;  4ACF A;  2GMI C;  2PVO D;  2KQ7 A;  4XZ4 A;  4EE2 A;  2N9P C;  1DGJ A;  2L32 A;  4K3C A;  1MG8 A;  1NYQ A;  2KC1 A;  3VH4 B;  5AZF A;  4WAF A;  4W9K A;  4YWG G;  3WAP A;  4Q2J A;  4US8 A;  4TMA B;  1LQB A;  4WAA A;  4II3 B;  1XQQ A;  2WXN A;  1WXQ A;  1SXT A;  1QT9 A;  1R4M I;  4E71 A;  2DX5 B;  2B3A A;  3ZQ4 A;  3ZJV A;  3V62 A;  5LNK 1;  1AAR A;  4HCP B;  4RGM A;  3Q69 A;  4EEW A;  1V5T A;  4HDQ A;  2WS3 B;  1VDV A;  3BYT B;  3L10 B;  3VXW A;  1OQR A;  1NEN B;  3QHT A;  2R2Q A;  3AMZ A;  3BY4 B;  2DNF A;  3TEX A;  1SSN A;  3ZVV A;  1BXT A;  2N1V A;  1WH3 A;  4I6L B;  1E8X A;  4A9A A;  3Q8E A;  3Q3J A;  1JWA D;  1HA5 A;  3ENE A;  2CJO A;  3DVG X;  4FBJ B;  2PTL A;  1UGM A;  2N9L A;  1R4N I;  3AE3 B;  2KWV B;  2JY6 A;  3ZKJ C;  2O6V A;  4FHJ A;  3MHZ A;  5EDS A;  1B1Z A;  5BYR A;  4TQ0 A;  3RYT A;  4RF0 A;  2OJW A;  3R8B A;  1WXA A;  2LUE A;  3RN9 C;  3VFK A;  4M8N A;  5FR3 A;  4C80 A;  3AV8 A;  1D5Z C;  3UIN B;  2K8H A;  1YNT E;  3VTW A;  4EZJ A;  2DAF A;  5JHB A;  1OTR B;  3DQV A;  3EFU A;  2YEP F;  2OJR A;  1EUV B;  4JWS C;  3NVW A;  3M3J A;  1VZ6 A;  3VH3 B;  2KLG A;  2JT4 B;  1KM7 A;  1T0R C;  1WJ6 A;  2J0K A;  3CMM B;  4A8X C;  4F7Z A;  1C4A A;  2JZP A;  2FCS A;  4W9G A;  2B76 B;  3U8Z A;  2KDF B;  4RH6 A;  1NBF C;  2LRU A;  2KMM A;  4MDK E;  1E8W A;  1ET6 A;  5CX3 A;  2KOX A;  2NBW B;  2BVC A;  2J4X A;  5C2T B;  4AP4 C;  4KIK A;  4RMA A;  4GDK B;  4MSQ B;  5GMV A;  2Y3A A;  2D3G A;  1FIQ A;  4I6N B;  1SIF A;  2IZV B;  1TBE A;  3IAM 1;  3R7R A;  1WXM A;  1WWT A;  1RRB A;  2CJN A;  3KYD D;  1FNU A;  1FD6 A;  4URK A;  2KO3 A;  1FO4 A;  2MBO A;  2IGD A;  2KJ6 A;  3WAO A;  1PYW D;  2KD0 A;  4S0R A;  2HTM E;  4HPM B;  1SE4 A;  2XK5 A;  3KVF B;  1YMH E;  1Z2M A;  1EU4 A;  4F8C B;  5AZH A;  2WDT B;  3W1Y A;  3ZXR A;  2WX0 A;  5D7G A;  2BWE S;  3U52 E;  1TKE A;  4WWN A;  1FFU A;  4FJY A;  3W5V B;  3FIL B;  4P1B C;  2C7N B;  1Y8R C;  4NAM A;  3A33 B;  4YTN B;  3LXF A;  3NG0 A;  1WXS A;  1WX7 A;  4ASW C;  3PRZ A;  4DWF A;  1VD2 A;  2JSV X;  1E7U A;  4LNK A;  1KOT A;  3UGB B;  2QIL A;  1ZKH A;  1MHX A;  2BKR B;  2BW2 A;  3HM3 A;  3A1Q B;  4K7W A;  3L54 A;  2KVZ A;  3QIJ A;  4K3B A;  4PT5 A;  4GOC A;  3MHS D;  4IC7 B;  5AUI A;  4M02 A;  3P4P B;  5G2N A;  4ANW A;  3E9S A;  1V1O A;  5C1Z A;  3WAN A;  3R3M A;  4KGT A;  2ICI A;  2HJ8 A;  3TEY A;  4IUM B;  2PEA A;  2KHW B;  1FCL A;  4XDD A;  3TIX A;  2WDV B;  5HI1 A;  4EFO A;  2BT6 A;  2ZW1 A;  3AU5 A;  1H4R A;  3Q3M C;  2FID A;  4P16 A;  5C3J B;  2V3N A;  2BS4 B;  4KKI A;  1FCC C;  4YSY B;  4HJG E;  4MJS B;  1CZP A;  5H92 C;  2WXH A;  4XX5 A;  1UWM A;  1K8R B;  2LXA A;  2UU7 A;  2J0M A;  2PW9 A;  1UZX B;  3SFE B;  4KSL C;  2C60 A;  3H7P B;  4QAY A;  2MSE D;  2WYQ A;  2M8S A;  4BKG A;  2G4S A;  1RM6 C;  2JWU A;  3JYU A;  1NVI D;  1P1A A;  3RD2 A;  2E6X A;  4BFR A;  1IUE A;  3CF6 E;  4HJK A;  2TSS A;  2INN E;  2Z8L A;  2IGH A;  3Q8A A;  2HD5 B;  3J9C A;  4C7Z A;  2DZK A;  1V49 A;  2KQS A;  1PGB A;  4BKT A;  3P42 A;  3QAQ A;  4IWQ A;  1KH0 A;  2J53 A;  2J42 A;  1WMH A;  2W9N A;  4MM3 A;  3APD A;  3BK1 A;  3BWU D;  4PK1 A;  3TBL D;  3SEB A;  3H1U A;  1SE2 A;  1RWS A;  1XLP A;  1PQS A;  2GLS A;  1A70 A;  1ET9 A;  4RGO S;  4AQ7 A;  1F2R I;  2L1A A;  1CJE A;  4JX1 C;  2AQ2 B;  2REX A;  4KZC A;  1OGW A;  3RNF C;  1KLV A;  3AE9 B;  2FUG 1;  2JZZ A;  3IAS 1;  2JU6 X;  1BML C;  2N1W A;  1C4P A;  3DHG C;  5TSS A;  2WXM A;  1F0Z A;  2Y5P A;  1OQQ A;  3VUW A;  4GGQ A;  2XBB C;  2N9X A;  3PLV A;  2LJ5 A;  4W9C A;  5J18 A;  4D2K A;  3QAR A;  2IGG A;  3PHX B;  2ZNV B;  1ZUD 2;  3I3T B;  1EWY C;  1RLF A;  1QIL A;  1I7H A;  4HKQ A;  2W3S A;  3MTN B;  1QOG A;  3DBL I;  3B2G A;  4DHZ E;  1FM0 D;  4IW0 A;  1FRD A;  2DEN B;  4IM0 A;  2RPV A;  3HUI A;  3TEZ A;  1GJZ A;  3DBR B;  5GXG B;  5HKH A;  3Q8F A;  3U30 A;  3PHW B;  4PS7 A;  4BBN F;  2N7D A;  4NAW A;  1GOZ A;  4HRS A;  1A5R A;  4M8M A;  1B9R A;  2MH7 A;  4YSZ B;  4ICU A;  4LLG M;  4HRO A;  4NZL B;  4OZB A;  2GB1 A;  1MPE A;  3N1Y C;  2N7E A;  2LHD A;  4B9K A;  1DYQ A;  3QJZ A;  2QEJ C;  1PUT A;  5D6J B;  3N1X C;  1WR6 E;  1WR1 A;  2ZVO A;  1ZDX A;  2KWU B;  1J0G A;  4JL9 A;  1U4A A;  4N6E B;  5J17 A;  3DWG C;  2RDG A;  1SIJ A;  1HZ6 A;  1ZPS A;  3JW0 X;  2MX2 A;  3A4S C;  5D2M B;  3WAL A;  1GUA B;  1NEK B;  1C77 A;  4IM3 A;  3O13 A;  2ZNV C;  3ETR A;  4KX6 B;  2KTR A;  1TTN A;  4AWJ A;  3ZDM C;  5DPR A;  4MH8 A;  2WDQ B;  4N9F 4;  3DVG Y;  5JZE B;  3M95 A;  1L6V A;  3QCA A;  1V2Y A;  2CU1 A;  1WGH A;  5E6J A;  1E8Y A;  3JSV A;  4P6V F;  2LZ6 A;  2L7R A;  2K3U A;  1EF5 A;  2ONQ A;  3HIZ A;  1YN5 A;  3SR6 A;  3FAH A;  3W5U B;  3WCQ A;  4L23 A;  1L4D B;  1RFA A;  4BOS C;  1UGJ A;  2ASQ A;  3R7Q A;  1J7B A;  2FCQ A;  1C79 A;  3VUX A;  3KYC D;  1MHH E;  2V4I B;  3QQ8 B;  3EGR A;  2WLB A;  4W9H A;  4ZRP A;  3R66 C;  1V1P A;  5IKC M;  1S3S G;  3LJ3 A;  1YQ4 B;  5TR5 A;  2GBR A;  2ZW0 A;  3PRM B;  3I57 A;  1C76 A;  1WGK A;  3C8Y A;  1TY0 A;  3GE8 C;  1IPG A;  2NCN A;  1KLU D;  2WXG A;  5DPT A;  2W54 A;  3DPD A;  1ZDV A;  2KYW A;  4ANU A;  4OVZ A;  4XWW A;  1YJ1 A;  1ZGU B;  3JVZ X;  3X23 A;  1WYG A;  3HVD A;  2JVC A;  2O2V B;  4DDI D;  1E7V A;  2KDE B;  4WJN A;  1E5W A;  1DOX A;  1HE8 A;  2C9W B;  3DVN U;  3A4R A;  2EEL A;  4LNO A;  4MH0 E;  1TT5 B;  2RD0 A;  3AE2 B;  2FIF A;  2IYD B;  4N59 A;  4HK2 A;  2KJH B;  3AED B;  4MGI E;  3PSE B;  5BMI A;  4JPS A;  2AL3 A;  3QA8 A;  3V6C B;  3A9K A;  3IXS A;  4GDL A;  3KWV A;  2ZCB A;  1V80 A;  4M0W A;  3ONS A;  2KK8 A;  1C4C A;  5CHW A;  3VR8 B;  4PYU A;  3HHM A;  2JZ3 B;  4C56 C;  5CHF A;  3AE4 B;  3I63 C;  1HTO A;  4WWM A;  3P1M A;  1I4X A;  3EHV A;  3ZUN A;  4WJQ A;  2K8B A;  2NMQ A;  4JWU C;  2X38 A;  4XWT A;  1EM7 A;  2IPK D;  2D3B A;  2I38 A;  3DCG A;  4YTP B;  2QCZ A;  2K8C A;  1ZE3 D;  4P1C C;  2KWC A;  5DPW A;  5FKA C;  4KKJ A;  4W9D A;  1UH6 A;  1PGA A;  2C7H A;  4YT0 B;  2BF8 B;  3AI5 A;  4FUL A;  2GBJ A;  2LI5 A;  4NJ7 A;  2NS5 A;  3H7S A;  2JXT A;  2WXQ A;  3EEC A;  4A20 A;  4JE3 B;  1ACC A;  3MC9 A;  5C23 A;  2CS4 A;  4JLC A;  5IN7 A;  2DZI A;  4HCN B;  4B0E A;  2JWZ A;  3V05 A;  3PTF C;  3W2D A;  3AEB B;  4AOF A;  1FFV A;  3ALB A;  2C7M B;  2Z0E B;  3B9J A;  2CU3 A;  2KC2 A;  5JH5 C;  4EKU A;  1SJH D;  3V6E B;  1QOA A;  2IY1 B;  3KLS X;  1D6E C;  1E10 A;  3RNE C;  1TJE A;  2KN5 A;  2EKE C;  4C4V A;  3PV1 A;  2KAN A;  1Q5W B;  1V86 A;  1KJT A;  3NZ3 A;  4ANV A;  4DHZ B;  3NZS A;  1IYF A;  1HEZ E;  4ZDV A;  2KLC A;  3L0W B;  2A5U A;  1V9J A;  4FXC A;  2MP2 B;  2LGY A;  2D07 B;  1FEH A;  1STE A;  1YX6 B;  4UDU C;  1YX5 B;  2LFI A;  1P9D U;  1CMX B;  2L52 A;  1D4B A;  4FN2 A;  2W82 A;  2BYT A;  4OW0 A;  2PIA A;  3DOW A;  2VRR B;  3C0R B;  3DBH B;  3AH7 A;  4ZHO A;  1F9J A;  1L0V B;  3BVG A;  1OEY J;  3N1Z C;  4IKG A;  2D10 A;  2D11 A;  2IO0 B;  4G11 A;  4ANX A;  3OLM D;  5MPO A;  2VZK B;  4IG7 B;  3W1S C;  3I9V 1;  3AE8 B;  1JAL A;  4ZYS A;  2RMM A;  1WRD B;  3APC A;  3DHH C;  1QZE A;  1QF6 A;  3M62 B;  2KAJ A;  4KZ0 A;  4IWO A;  2QHO A;  2KFK A;  1L2N A;  3KWL A;  2VH1 A;  2V3S A;  1LGR A;  2MBB B;  2O6V D;  3RFZ B;  3B2F A;  4XC2 A;  2PVG C;  3GZN I;  3WIM A;  1HTQ A;  3VDZ A;  3NVV A;  1HQR D;  4CQN A;  5EE0 A;  4EOY A;  4ZRJ A;  4YSX B;  3L4P A;  2Q5W D;  2BPS A;  2WXP A;  4LJP B;  2MCN B;  5KHO A;  4IWP A;  2IY0 B;  1R4M B;  1WSP A;  1EO6 A;  5EE3 A;  3VHT C;  4BBN C;  2NPT B;  1JRO A;  4A90 A;  2M4N A;  3MC0 B;  3AE6 B;  4ZRK A;  1WY8 A;  2GRI A;  3N30 A;  3RUL A;  1XLO A;  4XE0 A;  4BZA A;  4LDT D;  4ZHP A;  2MBE A;  3BYY B;  1C9F A;  4JGH B;  3TSS A;  4LTU A;  3IT6 B;  3AU4 A;  2KKC A;  1QQR A;  1R4N B;  2QJL A;  1YIW A;  4ARC A;  2IO2 B;  1UWX A;  3IG3 A;  3NJT A;  1LO5 D;  5LXH A;  2MBH A;  1Q1O A;  1T0Q C;  1WF9 A;  1UNS A;  3PZD A;  1Q10 A;  2KZR A;  3DDC B;  2ON8 A;  2AYO B;  1RAX A;  5D3D A;  2MRP A;  2NR2 A;  2FCN A;  2BYE A;  2R2O A;  2CHZ A;  1FRR A;  1ENF A;  5EE1 A;  4OZA A;  4MEM A;  1VJK A;  3VTU A;  2I2Y A;  3ML8 A;  2KX3 A;  3HK0 A;  4GMV A;  2JXX A;  3AE1 B;  2DYM A;  4M00 A;  2K1F A;  4YXD B;  4GLS C;  2BWF A;  3VR9 B;  4DXA B;  2BBC A;  3EC8 A;  2O6V B;  3AEC B;  1ZP0 B;  2N7J A;  4W9F A;  2L05 A;  5G5G A;  2CHW A;  2RDB C;  2DLB A;  2QIE B;  3IT4 B;  3EA6 A;  1E9M A;  3T8M A;  2GBM A;  3ZTC A;  3OWE B;  4S17 A;  2DYB A;  1QLB B;  3NRZ A;  1L4Z B;  1QOB A;  2K6Q A;  2K39 A;  2KVR A;  1E8Z A;  2MJE A;  2KQ4 X;  3CST A;  1OFF A;  1KRH A;  3ABV B;  1D3Z A;  2M19 A;  2XEW A;  3AE5 B;  2KN4 A;  2M1M A;  1M4V A;  1BT0 A;  1F77 A;  5L83 A;  2LGS A;  3CIR B;  4LDT B;  3FKY A;  4KGR A;  1J8C A;  3GE3 C;  2PKO A;  1N5W A;  2ZCC A;  2M56 B;  3T3N A;  4WUR A;  1N63 A;  3PT2 B;  3KH0 A;  1P0R A;  1TS4 A;  1WFY A;  1V8C A;  4AJW A;  1JML A;  3UQB A;  1P3Q U;  1Y56 A;  2PJH A;  2WXI A;  3EFC A;  3Q8B A;  4MSM B;  3RNA C;  2X8X X;  4CHK A;  1E90 A;  1N61 A;  1TS3 A;  3UI3 A;  3BVZ A;  3AE7 B;  1YD8 U;  2IND C;  1NDD A;  1I4Q A;  1D5X C;  1FXT B;  2KMA A;  2BS2 B;  1KTK A;  2QDF A;  1IBX B;  3OG5 A;  1AWD A;  2LVQ A;  4US9 A;  1XD3 B;  1FNW A;  4G0N B;  1WJN A;  2LD9 A;  2FBW B;  3NS1 A;  2XK5 B;  3BK2 A;  1I4H A;  4RM8 A;  4HDO A;  2BTE A;  2WWZ A;  3SU8 X;  3V60 A;  2V1Y A;  5JHA A;  2WHI A;  1M94 A;  1IGC A;  1NYR A;  1ZOY B;  1VR9 A;  4M01 A;  4NPN A;  1WI0 A;  4W9J A;  1YJI A;  1C78 A;  2Y5C A;  1EF1 A;  4REZ A;  2J0J A;  4G50 A;  2QC8 A;  2XNA C;  3OAW A;  4NY0 A;  2K25 A;  3ZO5 B;  2MWS B;  1BUI C;  3ZLZ A;  1TS2 A;  2QMT A;  3EUB 2;  2LRW A;  2MJ3 A;  2OOB B;  1KFY B;  2DWQ A;  5BYS A;  5BMH A;  2K0P A;  4MGZ E;  4KDI C;  4PS8 A;  4LK0 M;  3ZJU A;  1XLN A;  4HWI B;  2PLP A;  2BYV E;  2GBN A;  4A3P A;  4KDL B;  1XO3 A;  1SJE D;  3PPA A;  3RNG C;  4YL8 A;  4FAD A;  3RZW C;  1JCK B;  1VZ7 A;  4CYE A;  2M0A A;  3Q3N C;  2I1K A;  2DHZ A;  4BKS D;  2L76 A;  5T8I A;  3RT3 B;  1YOV B;  3OJ3 A;  4KVG B;  4ZYN A;  2XN9 C;  3HM6 X;  1UF0 A;  2L3Z A;  1DOY A;  1XT9 B;  4KGS A;  5G55 A;  1WE7 A;  5BO4 B;  4I6P A;  1AW7 A;  1C3T A;  2WXJ A;  5DCN A;  1TY2 A;  3X0W A;  1L5P A;  1OQY A;  2KAC A;  3RUI B;  3PRP B;  3A9J B;  1MG4 A;  1J7A A;  4AJY B;  4AS1 A;  2G45 B;  2JYT A;  4NQL B;  1N60 A;  2JF5 A;  1J7C A;  2AX5 A;  2BB5 A;  1GNU A;  2GI9 A;  4RCO A;  2NTS A;  3LB8 C;  1WGD A;  3AEA B;  4HPP A;  3PVL A;  3APF A;  3MFG A;  2ACZ B;  1MI0 A;  1XF5 L;  3NHE B;  2WXF A;  1WMH B;  2K9X A;  1SGH A;  4GDK A;  3Q8C A;  4MM3 B;  2JPH A;  2LGD A;  5J2R A;  2M17 A;  2L00 B;  3HRD D;  2L8J A;  1SBB B;  1JW9 D;  1WIA A;  2IDY A;  4PYZ A;  5D3I B;  4MAC A;  4IDI A;  3PGE A;  1E6E B;  2CHX A;  4HVB A;  2G4D B;  3DBL B;  2MW5 A;  3K9P B;  3P63 A;  4N58 A;  3TL5 A;  4TV3 A;  2WU5 B;  4AUQ C;  3U2S C;  2N9E B;  4JQW C;  4BVU C;  2N0S B;  1WM2 A;  5AEK B;  2CR5 A;  2WGS A;  3MJ5 A;  3AUL A;  1LXD A;  2LGX A;  1JRP A;  1HZ5 A;  2YVC A;  3NS8 A;  4GSW A;  2AWT A;  2IO3 B;  2BS3 B;  1T0S C;  2DAJ A;  1F2R C;  4II2 B;  2OHF A;  2L83 A;  2UWQ A;  5BMG A;  2KFJ A;  1X1M A;  4B95 A;  3N32 A;  4GU2 A;  1HXY D;  1CQV A;  2FUH B;  1JWU D;  2G1E A;  1D5M C;  1L6U A;  1N5X A;  3FIL A;  2LMC A;  4WWP A;  4TQ1 A;  1V97 A;  4MGK E;  1LFD A;  3N9Y C;  1OEY A;  1S1Q B;  1SB3 C;  2LHE A;  4L2Y A;  1T0Y A;  2WQY B;  3RI7 C;  2I1J A;  3MP9 A;  1L7Y A;  2VZK D;  4ZRQ A;  4NAW B;  3Q14 C;  4GN1 A;  3ZXV A;  2D5G A;  3BZD B;  4H2A A;  1ZXI A;  4DHJ D;  2DZJ A;  2MBQ A;  4EZL A;  2AEH A;  1YQ3 B;  4A55 A;  3A1Q A;  2IO1 B;  1J19 A;  2BQQ A;  1YN3 A;  1YQB A;  3IBE A;  1XEE A;  1WGG A;  4WWO A;  4TKN A;  5IO9 A;  3U7Z A;  1IGD A;  1AYF A;  2Z0D B;  3N20 C;  3PRE A;  3TMP B;  3ZJT A;  4CO7 A;  4LNF A;  3RNC C;  4RFB A;  1K50 A;  2SEB D;  1MJD A;  1XCT L;  2Y5B B;  1VZ8 A;  3KUD B;  1H8C A;  5FR6 A;  4J3O D;  1WYW B;  1EWC A;  3OJ4 B;  2R61 A;  3IVF A;  1UUP A;  1UEL A;  2MEK A;  3GP7 A;  5AUK A;  3QX1 A;  2SAK A;  4WJP A;  2KTR B;  1WGY A;  3PS6 A;  2PMV A;  4NJC A;  1YJJ A;  4WJO A;  4ARI A;  1L0X B;  4MJS A;  1WZ3 A;  3BII D;  3HVZ A;  4RGT A;  3Q3F A;  3NY5 A;  3H7P A;  2DYO A;  2EMS A;  3ZNH B;  3JSV B;  3GS2 A;  3U7D A;  1JRU A;  1K51 A;  2LXC A;  2WXL A;  1E0Z A;  2K5P A;  4DK5 A;  2N9K A;  3BVM A;  3E56 A;  3QK0 A;  5LXI B;  1VLB A;  3P4Q B;  2ZVN A;  1ROE A;  2GBK A;  5BYQ A;  5KHQ A;  3IFW B;  2UYZ B;  3IHP C;  4LNI A;  3MC8 A;  3ZW3 A;  2WXK A;  1DOI A;  2JX5 A;  1V1P B;  2DBY A;  4OHJ A;  2DZM A;  3B08 A;  2HTH A;  3GB1 A;  4E3C A;  3VRB B;  3UIP B;  1Q0W B;  1TKY A;  3P2B A;  4WIP A;  4MT5 A;  1N62 A;  2MHJ A;  4K1R B;  4DHJ B;  4MEL A;  4JIO U;  2PPH A;  3PZ8 A;  2WDR B;  2KDM A;  1WXV A;  1TIF A;  3AEE B;  4FHK A;  4FJZ A;  2KT7 A;  2JRH A;  3BIN A;  4C7Y A;  1NI3 A;  3B1L X;  4NQK E;  2EMT A;  4DBG A;  3D32 A;  2JYE A;  3KUZ A;  5AZG A;  3FC4 A;  2VH2 A;  4K81 A;  2IBI B;  1PFD A;  3KUC B;  3L08 A;  4BOZ B;  3B0A A;  3ZTD A;  3DWM A;  2KDI A;  1IBX A;  4KSK C;  3U4E G;  1WM3 A;  4J6I A;  2C5L C;  4PS3 A;  3A9K B;  1TYG B;  4GDL B;  3TJP A;  3AN1 A;  4W9I A;  4M0W B;  1UD7 A;  3UIO B;  3TEW A;  3N3K B;  2RR9 A;  2FE8 A;  1JWS D;  4DQO C;  3ZDT A;  3WA0 A;  3C19 A;  3VVW B;  3ZIM A;  3ZRF A;  3NVY A;  1P7F A;  3DHI C;  2D3C A;  2INC C;  3V61 A;  4B0M A;  4C00 A;  3RCZ A;  3ZNI D;  3H6N A;  2V0G A;  4E74 A;  4X57 B;  2WXR A;  1WGR A;  2PE6 B;  4IOI E;  3KW5 B;  3R2T A;  5IAA C;  3Q6B A;  1SE3 A;  4L1B A;  1XCQ L;  2G9H D;  2KXJ A;  1IP9 A;  2WP9 B;  4GXB A;  2NVU I;  4NNJ B;  4RGN A;  1Z5S B;  3LDZ E;  2WU2 B;  2KWD A;  1KF6 B;  1RYJ A;  2KNB A;  3NVZ A;  2G3Q B;  3DBR I;  1JWM D;  4XYC A;  4EZK A;  4FLH A;  2FNJ B;  1C1Y B;  3RPF C;  3CSF A;  3PO0 A;  3QC8 B;  5E6O A;  4RF1 A;  4WQM A;  4K7S A;  1GPX A;  1CK1 A;  4G3X B;  2MA9 B;  4FJV B;  2MLB A;  2BGF A;  3ECI A;  1FMA D;  1T3Q A;  1ZXH A;  4HKZ E;  3AEG B;  3MJW A;  4W9E A;  3VUY A;  4C4V B;  2ZEQ A;  2BKF A;  2KTF A;  4YTM B;  5CTR C;  1XXG A;  1FNV A;  5DPS A;  4TSS A;  4LJO B;  2L0F A;  1PDX A;  4DDG D;  2LUM A;  3A9J A;  1P98 A;  3P4R B;  1WX8 A;  1ZW7 A;  3ML9 A;  2EKI A;  3AXC A;  4K7U A;  1V5O A;  4HPL B;  3T3O A;  2ZPY A;  5H8Y E;  2ZJD A;  2JRI B;  2ZPN A;  4XGA B;  1JQ4 A;  2LWP A;  2E3T A;  3ZYY X;  1K53 A;  1GAQ B;  2RGF A;  3AEF B;  3O65 B;  2LEK A;  2W55 A;  4OZC A;  3TCA A;  1I42 A;  1GG3 A;  5L95 C;  3VQI A;  3GZN B;  1V81 A;  1QKZ A;  5IP4 D;  4USA A;  4DXG A;  4P7I A;  3URY A;  2N4F A;  1R7S A;  1UBI A;  2IJ0 A;  4A3O A;  2INP E;  2YLM A;  4KIK B;  1SF0 A;  3VRA B;  5LLI A;  5IOI A;  2JQR B;  1ESF A;  2L0T A;  1UBQ A;  2RPQ A;  1SEB D;  2RDH A;  3NOB A;  4WQO B;  3ZNZ B;  2O2V A;  3SHQ A;  2LVP A;  4EUT A;  2KDB A;  1FXI A;  3RMK C;  3L17 A;  2KFK B;  2KX0 A;  3K9O B;  2NBU A;  2CKH B;  3W9C B;  1G6J A;  5JXV A;  4GB9 A;  1I4R A;  4BKS A;  4RNA A;  4B6W A;  2BB6 A;  4OVU A;  1VCB A;  2HE7 A;  2WNM A;  3KQ4 A;  1WJU A;  2M0X A;  3QWZ B; 
#chains in the Genus database with same CATH homology
 2MJD A;  5HFY A;  1HEZ E;  4PT5 A;  3H8H A;  3HRD D;  5AUI A;  3V3X A;  3P4P B;  1SBB B;  1JW9 D;  2IDY A;  5D3I B;  4MAC A;  3E9S A;  4FXC A;  4IDI A;  1V1O A;  2AQ1 B;  2YEP B;  1FEH A;  1E6E B;  1STE A;  4UDU C;  4KGT A;  2LFI A;  2ICI A;  3P63 A;  3TEY A;  1PGX A;  4N58 A;  1WRI A;  2L52 A;  1D4B A;  2WU5 B;  2W82 A;  3U2S C;  1FCL A;  2BYT A;  4XDD A;  4OW0 A;  2PIA A;  2WDV B;  5HI1 A;  4ZHO A;  2BT6 A;  3AH7 A;  2N0S B;  3MJ5 A;  2ZW1 A;  1L0V B;  3BVG A;  1JRP A;  1HZ5 A;  4IKG A;  2BS3 B;  4P16 A;  5C3J B;  2V3N A;  2BS4 B;  4KKI A;  1FCC C;  1F2R C;  4YSY B;  4HJG E;  5MPO A;  2OHF A;  1CZP A;  2L83 A;  2VZK B;  2WXH A;  5H92 C;  5BMG A;  1UWM A;  2PW9 A;  3I9V 1;  3SFE B;  1E7P B;  3AE8 B;  1JAL A;  4ZYS A;  2RMM A;  2OED A;  1EU3 A;  1HXY D;  1CQV A;  1QF6 A;  1JWU D;  2G1E A;  5FK9 C;  2KAJ A;  1D5M C;  1L6U A;  1RM6 C;  1RFK A;  1N5X A;  3FIL A;  3W1S A;  1I4P A;  2JWU A;  2LMC A;  1NVI D;  1GB4 A;  1KLG D;  2E6X A;  3KWL A;  2LJI A;  4TQ1 A;  1V97 A;  1P7E A;  1IUE A;  3N9Y C;  1SB3 C;  2LHE A;  2TSS A;  4L2Y A;  2INN E;  2Z8L A;  2WQY B;  2IGH A;  3Q8A A;  5G5H A;  3MP9 A;  3RFZ B;  3B2F A;  3J9C A;  2PVG C;  4C7Z A;  3NVV A;  2VZK D;  1VRA B;  1HQR D;  1PGB A;  4ZRQ A;  1YN4 A;  4NAW B;  4CQN A;  5EE0 A;  3P42 A;  2D5G A;  3BZD B;  4YSX B;  3L4P A;  2Q5W D;  4H2A A;  1ZXI A;  1KH0 A;  2WXP A;  3SFD B;  2J53 A;  1YQ3 B;  2J42 A;  4A55 A;  1WSP A;  1TZO A;  5EE3 A;  4DXF A;  4ZOH C;  1FXA A;  3BK1 A;  3BWU D;  3SEB A;  1QOF A;  1YN3 A;  4A6Q A;  1SE2 A;  1RWS A;  1XEE A;  1XLP A;  1JRO A;  3U7Z A;  4A90 A;  1K52 A;  4O1N A;  1A70 A;  1ET9 A;  1IGD A;  2K22 A;  4RGO S;  1AYF A;  1F2R I;  1T5X D;  4AQ7 A;  2L1A A;  3MC0 B;  3ZJT A;  1CJE A;  4JX1 C;  2AQ2 B;  4RFB A;  3AE6 B;  1K50 A;  2SEB D;  2NTT A;  2H89 B;  2GRI A;  1XCT L;  1VZ8 A;  1XLO A;  1XLQ A;  4XE0 A;  4J3O D;  2HDE A;  4ZHP A;  1MVK A;  1EWC A;  2W3R A;  2FUG 1;  3AE9 B;  3AM9 A;  3IAS 1;  2JU6 X;  2WXO A;  1T6B X;  3BYY B;  1C9F A;  1BML C;  2R61 A;  3TSS A;  1UUP A;  4LTU A;  5EE9 A;  1C4P A;  2MEK A;  3IT6 B;  3GP7 A;  5AUK A;  5HG2 A;  4WH4 A;  5TSS A;  2QJL A;  1QQR A;  2SAK A;  2WXM A;  1F0Z A;  2J52 A;  2Y5P A;  4ARC A;  1OQQ A;  2PMV A;  4NJC A;  3P4S B;  1YJJ A;  2LGI A;  5HHD G;  4ARI A;  4XDC A;  1L0X B;  3R2I A;  1UWX A;  1AN8 A;  1I4G A;  4D2K A;  2IGG A;  3BII D;  1LO5 D;  1ZUD 2;  3HVZ A;  4RGT A;  1EWY C;  1QIL A;  1I7H A;  2DYO A;  4HKQ A;  1UNS A;  2W3S A;  3GS2 A;  3CWI A;  2H88 B;  1K51 A;  1Q10 A;  2WXL A;  1E0Z A;  2K5P A;  1QOG A;  2N9K A;  2ON8 A;  3BVM A;  3E56 A;  3B2G A;  2V3P A;  1VLB A;  3P4Q B;  1FM0 D;  5D3D A;  1ROE A;  1FRD A;  2RPV A;  3HUI A;  5BYQ A;  1L0Y B;  3TEZ A;  1FRR A;  5GXG B;  1ENF A;  3Q8F A;  2QSD A;  2AQ3 B;  5EE1 A;  4OZA A;  3TUO A;  1VJK A;  2WXK A;  1GOZ A;  2I2Y A;  1DOI A;  2JX5 A;  3ZGZ A;  4HRS A;  1GB1 A;  1V1P B;  3AE1 B;  2DYM A;  1B9R A;  2MH7 A;  4YXD B;  4GLS C;  3VR9 B;  4YSZ B;  2BBC A;  2DBY A;  3AEC B;  1ZP0 B;  4OHJ A;  4LLG M;  2N7J A;  4HRO A;  4NZL B;  3LYY A;  5G5G A;  1JWB D;  2DLB A;  3GB1 A;  4OZB A;  2GB1 A;  1MPE A;  4HEA 1;  3VRB B;  1TKG A;  2LHD A;  1TKY A;  4WIP A;  4MT5 A;  1N62 A;  5I4D A;  2QIE B;  3IT4 B;  1DYQ A;  2QEJ C;  3AB5 A;  4ITK A;  3EA6 A;  1PUT A;  1E9M A;  3PZ8 A;  2WDR B;  2KDM A;  4R3D A;  1ZDX A;  3OWE B;  1QLB B;  3PZ7 A;  3NRZ A;  3NUH B;  1L4Z B;  1TS5 A;  4N6E B;  1QOB A;  3AEE B;  3DWG C;  4EE2 A;  2PVO D;  1DGJ A;  2L32 A;  2RDG A;  1SIJ A;  2MJE A;  1NYQ A;  2KQ4 X;  4C7Y A;  1HZ6 A;  1ZPS A;  1NI3 A;  4WAF A;  1OFF A;  1KRH A;  3ABV B;  2M19 A;  3AE5 B;  2JYE A;  1NEK B;  2KN4 A;  1C77 A;  1M4V A;  3FC4 A;  3ETR A;  3O13 A;  4YWG G;  1F77 A;  4Q2J A;  4KX6 B;  4US8 A;  4TMA B;  1PFD A;  3CIR B;  2WXN A;  4MH8 A;  1WXQ A;  1SXT A;  1QT9 A;  2WDQ B;  4KGR A;  3ZQ4 A;  3ZJV A;  3DWM A;  2PKO A;  1N5W A;  5LNK 1;  1IBX A;  1L6V A;  4RGM A;  3Q69 A;  2M56 B;  3T3N A;  4WUR A;  1N63 A;  5E6J A;  3U4E G;  1TS4 A;  1V8C A;  2WS3 B;  1VDV A;  3BYT B;  4P6V F;  1OQR A;  2K3U A;  1JML A;  1NEN B;  2ONQ A;  4GDL B;  1TYG B;  3AMZ A;  1YN5 A;  3SR6 A;  3FAH A;  1Y56 A;  3AN1 A;  2WXI A;  3TEX A;  3W5U B;  3WCQ A;  1SSN A;  4L23 A;  1L4D B;  3TEW A;  1BXT A;  3Q8B A;  1UGJ A;  2FE8 A;  1JWS D;  1J7B A;  4DQO C;  1C79 A;  4A9A A;  3Q8E A;  1JWA D;  1HA5 A;  1MHH E;  3NVY A;  2CJO A;  2V4I B;  1P7F A;  2PTL A;  1N61 A;  1TS3 A;  3EGR A;  3UI3 A;  2WLB A;  2N9L A;  3AE7 B;  3BVZ A;  4ZRP A;  4B0M A;  3AE3 B;  1V1P A;  2V0G A;  1I4Q A;  1D5X C;  1YQ4 B;  2BS2 B;  2WXR A;  2ZW0 A;  3I57 A;  3MHZ A;  1C76 A;  1KTK A;  1B1Z A;  1WGK A;  5BYR A;  4IOI E;  3C8Y A;  3R2T A;  1IBX B;  4TQ0 A;  1TY0 A;  4RF0 A;  1SE3 A;  1AWD A;  4L1B A;  3R8B A;  1XCQ L;  2G9H D;  4US9 A;  1FNW A;  2WP9 B;  5FR3 A;  1KLU D;  4C80 A;  2FBW B;  2WXG A;  3AV8 A;  1D5Z C;  4RGN A;  3NS1 A;  3BK2 A;  2WU2 B;  2KWD A;  1I4H A;  1KF6 B;  1RYJ A;  1ZDV A;  2W54 A;  1YNT E;  4OVZ A;  2BTE A;  4XWW A;  3NVZ A;  1JWM D;  2YEP F;  3RPF C;  1WYG A;  3HVD A;  1IGC A;  1NYR A;  1ZOY B;  4JWS C;  1VR9 A;  3NVW A;  3PO0 A;  1VZ6 A;  1YJI A;  4RF1 A;  4WQM A;  1DOX A;  1C78 A;  4A8X C;  1GPX A;  2Y5C A;  1CK1 A;  2EEL A;  4REZ A;  3AE2 B;  1C4A A;  2JZP A;  4N59 A;  2B76 B;  2XNA C;  4RH6 A;  3AED B;  1FMA D;  1T3Q A;  2KMM A;  5BMI A;  4JPS A;  1BUI C;  1ZXH A;  4HKZ E;  3AEG B;  1ET6 A;  1TS2 A;  2QMT A;  3IXS A;  3EUB 2;  3KWV A;  2J4X A;  2MJ3 A;  4M0W A;  5C2T B;  4YTM B;  1KFY B;  2DWQ A;  5BYS A;  1C4C A;  5BMH A;  2K0P A;  4GDK B;  3VR8 B;  4LK0 M;  1XXG A;  3ZJU A;  2Y3A A;  1FNV A;  1XLN A;  4TSS A;  1FIQ A;  2PLP A;  4C56 C;  3AE4 B;  1XO3 A;  4WWM A;  1PDX A;  1SJE D;  3P1M A;  2LUM A;  1I4X A;  3P4R B;  2EKI A;  3IAM 1;  3T3O A;  5H8Y E;  1WWT A;  1JCK B;  1VZ7 A;  4MM3 B;  2M0A A;  1JQ4 A;  2NMQ A;  4JWU C;  2X38 A;  4XWT A;  2CJN A;  2E3T A;  1EM7 A;  2IPK D;  3ZYY X;  1FNU A;  1K53 A;  2I38 A;  5T8I A;  1GAQ B;  4YTP B;  1FD6 A;  3AEF B;  2LEK A;  2W55 A;  1FO4 A;  4OZC A;  1ZE3 D;  3VQI A;  2XN9 C;  1QKZ A;  2IGD A;  1PYW D;  4USA A;  4DXG A;  1DOY A;  2HTM E;  3URY A;  4KGS A;  5FKA C;  1R7S A;  2IJ0 A;  4KKJ A;  1SE4 A;  2INP E;  1YMH E;  1AW7 A;  1EU4 A;  2WXJ A;  1PGA A;  1TY2 A;  1SF0 A;  3VRA B;  1L5P A;  2JQR B;  1ESF A;  4YT0 B;  2KAC A;  5D7G A;  1SEB D;  2RDH A;  3U52 E;  2JXT A;  1J7A A;  1TKE A;  2WXQ A;  4AS1 A;  4JE3 B;  1ACC A;  2JYT A;  4B0E A;  1FFU A;  1FXI A;  3V05 A;  3W5V B;  3FIL B;  3W2D A;  1N60 A;  3AEB B;  1FFV A;  4NAM A;  1J7C A;  4YTN B;  3B9J A;  2AX5 A;  2BB5 A;  2CU3 A;  3LXF A;  2GI9 A;  4RCO A;  1SJH D;  3W9C B;  2NTS A;  1QOA A;  2JSV X;  3LB8 C;  3AEA B;  5JXV A;  1I4R A;  3KLS X;  1D6E C;  3MFG A;  2QIL A;  1E10 A;  2ACZ B;  1TJE A;  4RNA A;  1MI0 A;  2BB6 A;  1XF5 L;  1MHX A;  2WXF A;  2BW2 A;  2WNM A;  3KQ4 A;  3NZ3 A;  2K9X A;  3Q8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...