3PZ8A

Crystal structure of dvl1-dix(y17d) mutant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
82
structure length
82
Chain Sequence
b'DTKIIYHMDEEETPDLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Segment polarity protein dishevelled homolog DVL-1
publication title Molecular basis of WNT activation via the DIX-domain protein CCD1
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 12
structure length 82
sequence length 82
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.380 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3pz8A00
3PZ7A 3PZ8A 1WSPA 2D5GA 4WIPA
chains in the Genus database with same CATH superfamily
1L6UA 2W3RA 3W5VB 1AYFA 4RM8A 4EEWA 2INCC 3VUXA 2WX0A 4E74A 5CHWA 2OHFA 3VUYA 3K9PB 1VZ8A 2IDYA 2WXPA 1P3QU 3DBHB 4TQ0A 2I1JA 1MG8A 1LQBA 4I6PA 2KVZA 2NVUI 4PYUA 1YIWA 3EA6A 4OZAA 1ZXIA 3QQ8B 1STEA 2I1KA 5C1ZA 4PYZA 3PZ7A 3IBEA 2RMMA 1VJKA 1YJIA 1I4PA 4MGZE 3S2AA 2WLBA 5IO9A 4P1CC 1I42A 1B1ZA 2W9NA 3JSVA 4TSSA 1LM8B 4S0RA 2GBJA 1WGDA 3M62B 1OGWA 1UD7A 1YQ4B 4C4VA 2QILA 3DVGY 3Q3FA 1NI2A 4C00A 3W1YA 4I6LB 2BB5A 3NRZA 4LDTB 4XZ4A 4M0WA 2K25A 2J42A 2FNJB 2N0SB 1TKGA 2R61A 2MRPA 2K0PA 3DBHI 4J3OD 3SR6A 2WXJA 4W9EA 4HPMB 1FIQA 3RNAC 3KYDD 4ZYSA 2KWCA 4GDLA 3WAMA 3NVWA 1JMLA 3B2GA 4GIVA 4KIKB 3GE3C 4DHZB 2Y5PA 2YLMA 4FULA 4JIOU 4E3CA 2J52A 4ITKA 2HTME 4MELA 2DLBA 1M94A 1YNTE 3L17A 1XT9B 4G0NB 2I2YA 1FNVA 1SE2A 4G11A 5BO4B 4MGKE 2EELA 5HKHA 3A4SC 1TTNA 3EFUA 2LGXA 4LJPB 3WALA 2LI5A 1N6ZA 5CHFA 4WJNA 1Q0WB 1D4BA 1V49A 4XC2A 3MHSD 4GOCA 2PE6B 4GXBA 4MH0E 4KKJA 2YEPB 1PFDA 4BOZB 3R3MA 2V1YA 3V61A 4LNFA 4MJSA 2PPHA 3ZRCA 4A3PA 2EKIA 1UBIA 3QC8B 1NYRA 1EO6A 4MGIE 2FAZA 2LJ5A 3VHTC 2G9HD 4HKQA 5E6NA 4ARCA 1D6EC 2JYEA 3BY4B 2DZMA 3KUDB 1C3TA 1Y56A 1EUVB 3RCZA 1ROEA 3RD2A 4G3XB 2BKRB 2GMIC 2KWVB 4US9A 1WGHA 3DWGC 5IP4D 3IXSA 5E6OA 1L2NA 1TKYA 2XEWA 2C7NB 1D5XC 1RLFA 4L23A 1I4HA 2UWQA 3Q8EA 1P0RA 1YX6B 2J0KA 4OZBA 1EF1A 4FXCA 4KZCA 1XLPA 4N58A 4P7IA 4YSZB 2W54A 2AWTA 3L08A 4FN2A 2KO3A 2IPKD 3M3JA 3GE8C 2L8JA 3Q2AC 3CMMB 2L52A 2L3ZA 2RDBC 5BMHA 5H8YE 3BVGA 1TS4A 1WXVA 2D3BA 4MDKE 2BYVE 1HE8A 4F8CB 3ZJVA 3DVNV 5D94A 3ZQ4A 4RGNA 4HRSA 1YD8U 1KOTA 4OZCA 4BAXA 4IM2A 4HPLB 1QILA 3WA0A 2AYOB 1ZOYB 1VZ7A 4EZKA 1FRRA 1E10A 3AI5A 4IWQA 2M1MA 3CIRB 4NZLB 1SJED 4W9KA 2BPSA 1TYGB 2RDGA 5D3IB 4RF0A 2C7HA 1JQ4A 2ASQA 1ENFA 3VRBB 1CK1A 3VUWA 1FRDA 2FCMA 1MJDA 3PRPB 5DCNA 1SSNA 2M8SA 3L4PA 3SFEB 4L1BA 1T3QA 1NI3A 2FCQA 1GOZA 3OAWA 1MHHE 5GXGB 2CU3A 3HRDD 1KJTA 1WXMA 4B0EA 3AH7A 1V1PB 3BZDB 2LMCA 2BBCA 4X57B 4K81A 3PT2B 4TUUA 3B9JA 4DBGA 4TV3A 4K7SA 3WIMA 4DHZE 1HZ6A 4NQLB 5HG2A 3DBRB 1GG3A 2FIDA 4LK0M 2AX5A 3H7PA 1WGKA 1WY8A 5T8IA 3W2DA 1KLUD 3IHPC 4ANWA 1TGZB 2RPVA 1E90A 4BKGA 3DPDA 1JW9D 2WGSA 4BBNF 4LNKA 2BKFA 1OFFA 2BWFA 4ZRQA 2RPQA 1TZ1A 4A20A 3QWZB 2KQ4X 4RH6A 3BVMA 2PJHA 5EE1A 2D3AA 1E8YA 4ASWC 1WSPA 4YTPB 1R7SA 3L0WB 2E6XA 2BYTA 3DBRI 1TS3A 2V3SA 3EECA 1BMLC 2JQRB 3MP9A 3Q8FA 3QJZA 5J2RA 1N60A 3IG3A 1WM2A 5DPTA 1P9DU 2DYBA 3U7ZA 1EWCA 3VRAB 4DHJD 2PVGC 2WXLA 2ONQA 4FHJA 4NJ6A 3KUCB 4JL9A 1FXAA 3ZDTA 2IBIB 2KK8A 1E8ZA 1KFYB 4YTNB 3BK1A 2BGFA 1ZDXA 1TS5A 3Q6BA 5JXVA 2DYMA 4ZHOA 1RRBA 2N9KA 1AW7A 1PQSA 4W9HA 4D2KA 3AU5A 4ICUA 3Q8AA 2H89B 3KW5B 1UWXA 3GZNB 3MFGA 2NMQA 3NS1A 3A1QA 3I3TB 3OLMD 3NHEB 1JWAD 2REXA 1E7UA 3Q8BA 4ZRPA 4MACA 2LGIA 5G5GA 1WF9A 1WZ3A 4HJKA 2WS3B 2LHEA 3AE9B 4MM3A 3AXCA 4N6EB 1EF5A 2WNMA 1JRUA 3T3NA 4BBNC 4JWSC 3SD5A 3I57A 1ZW7A 3IVFA 3UI3A 4HCPB 1V8CA 2D11A 4FBJB 1F2RC 3SHQA 2V4IB 3GZNI 2N7JA 3LDZE 4G50A 1AWDA 2KMAA 2KWDA 1BXTA 4ANUA 1PYWD 2KNBA 3PRMB 4GSWA 2ZW0A 1K51A 1NYQA 2WXKA 3AEDB 4P16A 5BYSA 2OJWA 4A8XC 3EUB2 3D32A 4MSMB 1L0YB 2IGGA 2CS4A 4OVVA 4J6IA 3TMPB 2WYQA 4W9DA 3Q8CA 1CMXB 2CJNA 4F1SA 1YN4A 3EC8A 3ECIA 5D3DA 1WI0A 1V5OA 1S3SG 3Q3JA 3O65B 3V05A 1WR6E 2BW2A 2G1EA 3AEAB 2MBHA 1GJZA 2JU6X 2VZKB 2NBWB 3QCAA 3UGBB 4GLSC 2KZRA 1FO4A 1ZP0B 3CSFA 1Y8RC 1V97A 2DAJA 1VD2A 1X1MA 3HM6X 1WJUA 1GC7A 2QSDA 1P98A 5C2TB 1JWUD 4B0MA 2SAKA 2JVCA 1BT0A 2K6DB 4XWWA 3W1SA 2FCSA 5G55A 2GLSA 3KWVA 3Q14C 4RGOS 2AQ1B 1WGGA 3PZ8A 4KIKA 2JRIB 1Z2MA 4AUQC 1FM0D 4RFBA 2AQ3B 4CO7A 2KTRB 3DVNU 5FR3A 1JCKB 1QQRA 1VLBA 3U30A 2M19A 3I63C 5LNK1 2PEAA 1I4RA 2DWQA 4W9LA 2MX2A 1EM7A 1FXIA 3A33B 1AN8A 3RN9C 1T0YA 5DPWA 1FEHA 2B76B 1GB1A 2WXHA 1N5WA 4II3B 3SFDB 2G4DB 3PS6A 3RNGC 3WANA 4NJCA 1S1QB 3NZUA 3FILA 3GS2A 3P4QB 1WGYA 1KTKA 2L0TA 1FXTB 3FKYA 1E9MA 4AOFA 2C60A 4XDDA 4XDCA 1WM3A 2JYTA 2LRWA 1I7HA 3TUOA 1FPYA 1P7FA 3HVZA 3RYTA 3ZLZA 3V60A 4W9IA 3VQIA 2D10A 2L05A 2UYZB 4USAA 1DYQA 1L7YA 5BYRA 2KLGA 2J4XA 1KLVA 3AU4A 4K7WA 1QOFA 2G45B 5CHVC 3NVVA 3DBLB 1N62A 3AMZA 2IY0B 1LFDA 2X38A 1CZPA 4AQ7A 5HI1A 2INPE 2KDBA 3RUIB 3BVZA 4M01A 2N9XA 4YXDB 4EE2A 3CSTA 3R66C 3N9YC 2DYOA 5G5HA 2VZKD 1QZEA 3MJ5A 3DVGX 2O6VD 3GP7A 1C78A 3NOBA 2G4SA 2R2OA 4BKSA 1VZ6A 2C5LC 3QK0A 3R8BA 4GDKB 4KKIA 5AZFA 2KOXA 2KC2A 2LZ6A 1MPEA 4WAAA 4JWUC 3DBLI 2KXJA 5G2NA 1WH3A 1LO5D 1OEYJ 4FJZA 4ZRIA 3R2IA 2XK5B 1UGMA 2LUEA 4XYCA 5E6JA 1WXAA 3VTVA 3EGRA 3ZKJC 3AEEB 2E3TA 2PIAA 1MI0A 1XCQL 2LHDA 2MCNB 3QAQA 1T6BX 3PTFC 4FHKA 4ARIA 4HXDA 1WE7A 2GBMA 3RNCC 3ZTCA 1J19A 2KVRA 2PTLA 2DZJA 3APCA 3M95A 4RNAA 3L13A 2BYFA 3ONSA 4GN1A 1TY2A 1MHXA 2MP2B 3ZXRA 4LJOB 1OTRB 1R4NB 2A4ZA 4HCNB 4YSYB 3PHWB 1T0RC 1TS2A 2LASA 2BTEA 1E0ZA 4GB9A 4C7ZA 1GB4A 3TEZA 2O2VB 2J0MA 3TEYA 3AE2B 1F52A 2PKOA 3C8YA 4IUMB 1DGJA 1FMAD 2J53A 5TSSA 5I4DA 3AB5A 3ZYYX 4MGYE 2JXXA 4H2AA 1JALA 4L2YA 4K3BA 3PRZA 3AECB 4NAWA 4GMVA 2L83A 2Q5WD 3OG5A 4DHJB 3T9LA 4YSXB 3H8HA 1WX7A 2GOWA 3A9JB 2JSVX 2L7RA 2FIFA 1DOIA 2IYDB 2LGYA 4LCDE 4AJYB 3DQVA 3NS8A 3P42A 1NVID 5C3JB 2WDTB 2ZNVC 4M8NA 4WURA 1L6VA 2KYWA 2NS5A 3PLUA 1UZXB 3HUIA 2N9PC 2AL3A 3NVZA 1FFVA 3VAWA 3ZNID 2CKHB 2N9EB 3ZGZA 4ZRKA 2XN9C 3UQBA 3VR8B 1L4DB 1L0XB 2M0XA 1DOYA 1E8WA 3P4RB 3NZ3A 4RF1A 5IN7A 4IC7B 2BS3B 2BS2B 1P7EA 2SEBD 2ZVOA 5AZHA 2NPTA 2ZZPB 1IGCA 1K50A 4OVZA 1HTOA 4P6VF 1KF6B 5L95C 1E5WA 4XWTA 4LNOA 2BYEA 4W9JA 3QA8A 1IP9A 2JXTA 3BIID 1FNUA 4WAFA 2MBEA 3RPFC 1ZGUB 1WE6A 3ZJUA 3PGEA 4NPNA 1H8CA 2QHOA 3BYTB 1WYGA 2PLPA 1ZXHA 2N7DA 2XNAC 1T0QC 1XF5L 4WJQA 3E56A 4RCOA 3P2BA 4HVBA 1IBXB 2KN5A 3PO0A 4FA6A 4LNIA 2FUHB 1AARA 1WJ6A 2LVPA 2WDRB 4WWPA 2W55A 1UUPA 2LRUA 1WR1A 5J17A 1QKZA 3ZNHB 4KZ0A 2D3GA 5TR5A 1HXYD 5BMGA 2QIEB 1XLNA 2KDFB 2PVOD 5D7GA 1C77A 3IAS1 3BK2A 4II2B 1EU3A 1YMHE 3RFZB 1L0VB 1JRPA 2JZPA 3X0WA 2V4LA 1C9FA 1WMHB 2ZPNA 2D3CA 1UWMA 1ET6A 2Z0DB 3FC4A 5HHDG 5D2MB 4KGTA 1I4XA 4M8MA 4IOIE 4HEA1 2MW5A 1Z5SB 3AN1A 3KQ4A 2H88B 3PSEB 1SJHD 3TEXA 1V1OA 4NNJB 1ET9A 2I38A 4HROA 5EDSA 4DDID 2V9HA 2L32A 1SBBB 2K9XA 2DAFA 3URYA 1ESFA 2MJEA 2BS4B 2MQJA 1TJEA 4HWIB 4C7YA 1U4AA 2GB1A 2WXRA 1NBFC 3CWIA 1HZ5A 4IW0A 4C56C 1C76A 2KX3A 2WP9B 2PW9A 3A9KB 2JWZA 3PLVA 3N1YC 3UIOB 3DDCB 3BWUD 4WJPA 1RAXA 5JZEB 1FNWA 1J8CA 3VFKA 1HEZE 3IFWB 2JWUA 2QC8A 3AE4B 1RFAA 2MJ3A 3H7PB 2V3PA 1TIFA 1RM6C 2MBQA 2J0JA 1T5XD 1SXTA 4EFOA 3HHMA 2K8CA 1GUAB 3MC9A 4JX1C 2KTRA 1VCBA 2INDC 2CHZA 2JPHA 2LFIA 2K8HA 3LB8C 1XD3B 2DBYA 1ZKHA 3DHHC 3PZDA 4OHJA 2CJOA 1WXSA 1XEEA 1E7PB 2TSSA 3N1XC 2RR9A 2WX1A 2Z0EB 3RZWC 1SIJA 2GBNA 4IWPA 1V6EA 2J7QB 3DWMA 2DZIA 2K8BA 2K1FA 3NJTA 4B95A 4US8A 4CHKA 1SE4A 1F2RI 3N30A 3A4RA 1UELA 1C1YB 1IYFA 4ZOHC 2LGDA 5EE3A 1QOGA 3MC8A 1LXDA 2Y5BB 5C23A 1KRHA 3C19A 2JZZA 3PVLA 5AUKA 1C4CA 3TL5A 4KGRA 2WQYB 3N3KB 4N9F4 1RFKA 2Z59B 4W9CA 3ZXVA 3RI7C 3R7RA 2BWES 2O6VB 2XBBC 3TEWA 2GRIA 3DBSA 3RMKC 1TZOA 3Q3OC 3SEBA 1CJEA 2JZ3B 2ZEQA 1I4GA 3B08A 4AWJA 5FK9C 2BT6A 2K22A 5AZGA 1PGBA 4TKNA 2LXCA 2BVCA 1T0SC 2KFKB 1LGRA 3HIZA 2ICIA 2FCNA 2M4NA 3N32A 1L4ZB 2LXAA 3P4SB 1XLOA 4RMAA 2NCNA 1WX9A 1WJ4A 3EFCA 3RNFC 1J7AA 4A6QA 3AULA 3ZW3A 1QF6A 4HKZE 1J7CA 1GPXA 1WWTA 3NVYA 4IKGA 2IY1B 2VH1A 3SU8X 1UF0A 3E9SA 2ZCBA 3JW0X 3VXWA 3WCQA 2ACZB 4JGHB 1V9JA 4BFRA 3TJPA 4NQKE 2DNFA 4WJOA 4M00A 1G6JA 1JWBD 4NJ7A 3HVDA 3AEBB 4K3CA 2MHJA 4GDKA 1OEYA 3ZNGC 3ZIMA 2KMCA 2KJ6A 1RYJA 5D6JB 1IGDA 4A55A 4MH8A 2NTTA 3QIJA 2IGHA 1WFYA 4KDIC 2QCZA 1YX5B 3OJ3A 4NY0A 1QLBB 1RWSA 3DHIC 4MSQB 1WRIA 3TIXA 2XK5A 3VR9B 4IG7B 1YOVB 4BVUC 1Q1OA 2JUOA 3O13A 1Q5WB 1PUTA 1WJNA 3QHTA 4AS1A 2MLBA 1N61A 3L16A 3AM9A 3U52E 2HDEA 2MH7A 5LXHA 1YN3A 1J0GA 2KTFA 3APDA 4JPSA 2YEPF 3UIPB 4ZDVA 2QMTA 3AE7B 3V3XA 4ANVA 4JLCA 4ACFA 2WWZA 2LEKA 4PS3A 5CTRC 2MP2A 2ZVNA 1FCCC 4HPPA 2X8XX 4ZYNA 1A5RA 5IAAC 3UQAA 2PMVA 4RM9A 3I9V1 2MBBB 2QEJC 1IPGA 4IM0A 1C79A 3NZSA 2O2VA 1F77A 2IO1B 1WYWB 5DPRA 2L1AA 2WHIA 4IDIA 4S17A 2ZJDA 3H6NA 3RT3B 1MFWA 2LVQA 5J18A 4WQMA 2LWPA 4EUTA 3IT6B 2JT4B 3NY5A 1P1AA 2KDEB 1SIFA 3RULA 1ZDVA 4DDGD 2W82A 3JYUA 5FR6A 3A9JA 3B0AA 1E7VA 5EE0A 4OW0A 3LJ3A 4HK2A 2LGSA 3PHXB 3W1SC 3ZVVA 4W9FA 3W5UB 4ZRJA 1CQVA 3WAPA 1KH0A 5BMIA 1TT5B 2KT7A 2WXNA 1OQYA 1KM7A 1WXQA 2UU7A 3RNBC 5JH5C 1XCTL 2V3NA 3H1UA 2KACA 3AE6B 3DCGA 3BYYB 3V6EB 3L54A 3GOEA 2MWSB 3U7DA 2KANA 3H9DA 5IA7A 4BZAA 1V2YA 2L76A 3FILB 3ZO5B 3W9CB 5JHBA 4A9AA 2BF8B 2RDHA 1BUIC 2DZKA 3JSVB 2KC1A 4KX6B 1YQBA 3IT4B 1V1PA 2QJLA 2VRRB 1ZPSA 1A70A 4C4VB 3VDZA 1YN5A 4WWOA 1R4MB 2KFJA 1K53A 3HM3A 2BB6A 4M0WB 1GAQB 3CF6E 3K9OB 3PREA 1C4PA 1IBXA 4ICVA 1ISNA 2WXIA 1N63A 4GDLB 2ZNVB 3I5JC 4WQOB 2WDVB 2EMTA 1GC6A 4EOYA 2LUMA 4DXAB 1I35A 3MC0B 3AE3B 3ML9A 1F9JA 3N20C 1TY0A 4PK1A 4DXFA 3R7QA 1I4QA 1NDDA 1R4NI 3P4PB 4M02A 3SDLC 2L00B 4IM3A 1M4VA 1R4MI 1VDVA 3TSSA 4WWNA 1WIAA 1JROA 1WMHA 1V86A 3AEFB 1KLGD 1UBQA 4RGTA 5DPSA 1SGHA 4LDTD 3VVWB 5CX3A 3DOWA 1SF0A 2W3SA 3Q3MC 2KJHB 3Q69A 4URKA 5L83A 4A90A 4MJSB 2ZW1A 1WRDB 1V81A 2DENB 3WAOA 1H4RA 2V0GA 2ZPYA 4LNNA 4O1NA 1B9RA 4P1BC 3RNEC 2N4FA 4LTUA 2WU2B 3ZUNA 2EMSA 2DHZA 3LYYA 4K7UA 2K5PA 2GI9A 2ZCCA 2D2QA 2MEKA 4ZHPA 4REZA 4DQOC 2A5UA 3PV1A 2EKEC 5KHQA 3ZNZB 1YQ3B 4QAYA 3ABVB 1YJJA 1XQQA 2HJ1A 3FAHA 2N9LA 2L0FA 4LLGM 1V80A 1XO3A 2KDMA 3NG0A 1WX8A 1SB3C 2MA9B 1UNSA 2RSUA 3LXFA 2K39A 3UF8A 1N5XA 2Z8LA 3U8ZA 2WXMA 2FUG1 1V5TA 3T8MA 1MG4A 5AUIA 3A9KA 1PGXA 2KKCA 3DHGC 4PS8A 2KMMA 2CR5A 4WWMA 2M56B 4EZJA 2KN4A 1QT9A 1SE9A 2M0AA 2N1VA 2M17A 1K8RB 1TBEA 3BINA 3B2FA 2GBKA 3V6CB 4HLEA 2OOBB 3X23A 1IUEA 4UDUC 4NAWB 5HFYA 1JWSD 1C4AA 2JX5A 4FJVB 4BKTA 4R3DA 2GBRA 3KWLA 2B3AA 2DX5B 4AP4C 4KSLC 2AL6A 2VH2A 1TKEA 4XGAB 5E6PA 1Q10A 2FE8A 2KDIA 3AE5B 4KVGB 2WXFA 2LJIA 1HA5A 4BOSC 4IWOA 1K52A 4EZLA 1F0ZA 1EU4A 5GMVA 2IZVB 1SE3A 1D3ZA 5H92C 2IO3B 1GNUA 5FKAC 4E71A 3ALBA 1E6EB 1FD6A 4I6NB 1J7BA 2ON8A 1YJ1A 3ZDMC 3B1LX 2CU1A 3V62A 4YWGG 2WDQB 5JHAA 4A3OA 5IKCM 4YTMB 2KAJA 2KQ7A 3RZFA 1VR9A 4KDLB 2NPTB 3ML8A 1ACCA 1PDXA 3OWEB 3PPAA 2N1WA 3GB1A 1ZUD2 2G3QB 1FCLA 2O6VA 4FADA 4AJWA 4TQ1A 2RD0A 2C7MB 3AE1B 4BKSD 3TBLD 2IO0B 1HQRD 4F7ZA 4N59A 3U2SC 1WGRA 4KGSA 3C0RB 2OEDA 1PGAA 3OJ4B 3KLSX 4CYEA 2KLCA 2WXGA 2HE7A 2KFKA 1MVKA 5MPOA 3IAM1 4Q2JA 3VTWA 2YVCA 4DWFA 5AEKB 4EKUA 1VRAB 4KV2A 3H7SA 2KJRA 2INNE 3TCAA 4RGMA 4DXGA 2KX0A 2Y5CA 4DK5A 3N1ZC 1HTQA 5KHOA 1UGJA 4TMAB 4GU2A 1NENB 1XXGA 3J9CA 3VTUA 1SEBD 4B6WA 2WU5B 2D5GA 4GGQA 4KSKC 2HD5B 2CHXA 4HJGE 1NEKB 3APFA 3KUZA 2MBOA 3M63B 4B9KA 3AV8A 4NAMA 3HK0A 4K1RB 1ZE3D 1QOBA 2NBUA 2NBVB 3ENEA 2JF5A 2KHWB 3MJWA 3UINB 4FLHA 2PE9A 1EWYC 3KH0A 2Y3AA 3EHVA 3AE8B 3VH3B 5EE9A 4YL8A 2WXQA 3R2TA 3AEGB 1OQRA 3KVFB 4WH4A 2IJ0A 4YT0B 4JQWC 4C80A 2MJDA 2HTHA 3ETRA 3ZRFA 2FBWB 2IO2B 1D5ZC 2C9WB 4PS7A 3ZJTA 3U4EG 2KQSA 3P63A 3ZTDA 2MSED 1E8XA 2AQ2B 2JRHA 3T3OA 3P1MA 5LLIA 3KYCD 2LD9A 4W9GA 2BQQA 2AEHA 2K3UA 4XX5A 3JVZX 4XE0A 2QDFA 1F1HA 4PT5A 2JY6A 1XLQA 3QX1A 4HDOA 2LVOA 4WIPA 5LXIB 3A1QB 2NR2A 5BYQA 2HJ8A 3MTNB 4MT5A 1DOXA 2D07B 2KWUB 4MEMA 1UH6A 2IGDA 4HDQA 4MM3B 1L5PA 2CHWA 1OQQA 3QARA 2NTSA 5IOIA 3NUHB 3MHZA 1D5MC 4FJYA 3L10B 1QOAA 2K6QA 2WXOA 1WZ0A 2RGFA 4CQNA 4OVUA 2OJRA 4ANXA 1FFUA 2R2QA 3Q3NC 2KD0A 1JWMD 4JE3B 3VH4B 2N7EA
chains in the Genus database with same CATH topology
1L6UA 2W3RA 4N6EB 2XNAC 3W9CB 3W5VB 1XF5L 4A9AA 3E56A 1AYFA 4RCOA 2WNMA 1IBXB 2OHFA 2RDHA 1BUIC 3PO0A 3T3NA 4JWSC 3I57A 1VZ8A 4KX6B 2IDYA 2WXPA 2WDRB 3IT4B 1V1PA 2QJLA 1ZPSA 2W55A 1A70A 4TQ0A 1UUPA 1YN5A 3UI3A 1V8CA 1QKZA 3EA6A 4OZAA 1ZXIA 1F2RC 1HXYD 1STEA 5BMGA 2V4IB 2QIEB 2N7JA 3PZ7A 1K53A 1XLNA 2BB6A 2RMMA 2PVOD 1GAQB 5D7GA 1AWDA 1VJKA 1YJIA 1I4PA 2KWDA 1C77A 1BXTA 3IAS1 3BK2A 2WLBA 1C4PA 1EU3A 1YMHE 3RFZB 1L0VB 1PYWD 1B1ZA 1IBXA 1JRPA 2JZPA 2WXIA 2ZW0A 4TSSA 1K51A 1NYQA 2WXKA 3AEDB 1N63A 1C9FA 4GDLB 4P16A 5BYSA 2WDVB 4A8XC 3EUB2 1YQ4B 1L0YB 1UWMA 2IGGA 2QILA 1ET6A 2LUMA 3MC0B 2BB5A 3FC4A 3AE3B 3NRZA 5HHDG 3Q8CA 4KGTA 2CJNA 1I4XA 1TY0A 4M0WA 1YN4A 2J42A 4DXFA 2N0SB 1I4QA 1TKGA 2R61A 3P4PB 4IOIE 2K0PA 5D3DA 4J3OD 3SR6A 4HEA1 2WXJA 1M4VA 1VDVA 3TSSA 3V05A 3AN1A 3KQ4A 1JROA 2BW2A 2G1EA 2H88B 3AEAB 1FIQA 4ZYSA 2JU6X 1SJHD 2VZKB 3NVWA 1JMLA 3TEXA 3B2GA 1V1OA 3AEFB 1ET9A 1KLGD 2I38A 4HROA 4RGTA 4GLSC 2Y5PA 1FO4A 2J52A 1ZP0B 2L32A 4ITKA 1V97A 1SF0A 2HTME 2W3SA 1SBBB 2K9XA 3Q69A 2DLBA 1YNTE 4A90A 3URYA 2QSDA 1ESFA 2MJEA 2BS4B 2I2YA 5C2TB 1FNVA 1TJEA 1JWUD 2ZW1A 1SE2A 4B0MA 2SAKA 2EELA 4C7YA 4XWWA 2V0GA 3W1SA 4O1NA 3KWVA 4RGOS 1B9RA 2AQ1B 2GB1A 2WXRA 1D4BA 3PZ8A 4LTUA 2WU2B 3CWIA 1HZ5A 4C56C 1C76A 3LYYA 2WP9B 1FM0D 2K5PA 2GI9A 4RFBA 2PW9A 2AQ3B 4KKJA 2MEKA 2YEPB 5FR3A 1PFDA 4ZHPA 4REZA 1JCKB 4DQOC 1QQRA 1VLBA 1YQ3B 2M19A 5LNK1 3ABVB 1YJJA 1I4RA 2EKIA 3BWUD 3FAHA 2N9LA 2DWQA 1FNWA 4LLGM 1HEZE 1NYRA 1XO3A 2JWUA 2KDMA 3AE4B 1EM7A 1FXIA 2MJ3A 1AN8A 2G9HD 1SB3C 2V3PA 4HKQA 1UNSA 1RM6C 4ARCA 3LXFA 2JYEA 1D6EC 1T5XD 1SXTA 1N5XA 2Z8LA 2WXMA 2FUG1 1Y56A 4JX1C 2LFIA 3LB8C 5AUIA 1ROEA 1FEHA 1PGXA 2B76B 2DBYA 4OHJA 2CJOA 1GB1A 2WXHA 1XEEA 4US9A 1N5WA 3DWGC 1E7PB 2KMMA 2TSSA 4WWMA 3SFDB 2M56B 2KN4A 4NJCA 1QT9A 3IXSA 2M0AA 1TKYA 1D5XC 3FILA 3GS2A 4L23A 1SIJA 3P4QB 3B2FA 1I4HA 1KTKA 3Q8EA 1IUEA 1E9MA 3DWMA 4UDUC 4NAWB 5HFYA 4XDDA 4US8A 1JWSD 4OZBA 4XDCA 1SE4A 1C4AA 1F2RI 2JX5A 2JYTA 1I7HA 4R3DA 4FXCA 1XLPA 3TUOA 3KWLA 4ZOHC 5EE3A 4N58A 4YSZB 1QOGA 2W54A 1P7FA 2IPKD 1KRHA 2L52A 3HVZA 5AUKA 1TKEA 1C4CA 5BMHA 4KGRA 5H8YE 2WQYB 1TS4A 3BVGA 1Q10A 2FE8A 1RFKA 3AE5B 3VQIA 4USAA 2WXFA 2LJIA 1DYQA 1HA5A 5BYRA 1K52A 3ZJVA 1F0ZA 1EU4A 2J4XA 1SE3A 3ZQ4A 5H92C 1QOFA 4RGNA 4HRSA 4OZCA 3TEWA 3NVVA 5FKAC 1N62A 2GRIA 3AMZA 1QILA 1FD6A 1E6EB 1TZOA 3SEBA 1CJEA 1J7BA 1ZOYB 1VZ7A 2ON8A 1FRRA 1E10A 1I4GA 2X38A 4YWGG 2WDQB 1CZPA 4AQ7A 3CIRB 4YTMB 5FK9C 4NZLB 2KAJA 1VR9A 2BT6A 5HI1A 2INPE 2K22A 1PGBA 1SJED 3BVZA 1TYGB 1ACCA 1PDXA 3OWEB 4YXDB 2RDGA 4EE2A 3GB1A 5D3IB 1ZUD2 4RF0A 2ICIA 3N9YC 2DYOA 5G5HA 1JQ4A 2VZKD 3MJ5A 1FCLA 1L4ZB 1ENFA 3GP7A 3VRBB 3P4SB 1C78A 1XLOA 4TQ1A 1CK1A 3AE1B 1VZ6A 1HQRD 4N59A 3R8BA 4GDKB 3U2SC 4KKIA 1FRDA 1J7AA 4A6QA 4KGSA 1QF6A 1MPEA 4HKZE 4JWUC 2OEDA 1PGAA 1J7CA 3KLSX 1GPXA 1SSNA 1WWTA 2WXGA 3NVYA 3L4PA 3SFEB 1LO5D 1T3QA 4IKGA 1MVKA 1NI3A 5MPOA 1GOZA 3E9SA 3IAM1 3WCQA 1MHHE 2ACZB 3R2IA 4Q2JA 5GXGB 2CU3A 3HRDD 5E6JA 1VRAB 4B0EA 1JWBD 3EGRA 3HVDA 3AH7A 3AEBB 1V1PB 3AEEB 2E3TA 2INNE 2PIAA 3BZDB 1MI0A 1XCQL 2BBCA 2LMCA 2LHDA 1T6BX 4RGMA 4DXGA 2Y5CA 1RYJA 4ARIA 1IGDA 4A55A 4MH8A 2NTTA 3B9JA 2IGHA 2PTLA 1UGJA 4TMAB 1HZ6A 5HG2A 1QLBB 1RWSA 1NENB 1XXGA 1WRIA 3J9CA 4LK0M 4RNAA 3VR9B 1SEBD 2AX5A 1WGKA 2WU5B 2D5GA 5T8IA 1TY2A 1MHXA 3W2DA 4HJGE 1NEKB 3O13A 1PUTA 1KLUD 4YSYB 4AS1A 1TS2A 1N61A 3AV8A 2BTEA 1E0ZA 4NAMA 1ZE3D 3AM9A 2RPVA 3U52E 2HDEA 2MH7A 1QOBA 4C7ZA 1GB4A 1YN3A 3TEZA 1JW9D 4JPSA 2YEPF 3TEYA 3AE2B 2PKOA 3C8YA 1DGJA 1FMAD 1OFFA 2J53A 2QMTA 3AE7B 3V3XA 5TSSA 5I4DA 3AB5A 1EWYC 4ZRQA 2Y3AA 3ZYYX 2LEKA 4H2AA 3AE8B 1JALA 4L2YA 5EE9A 2KQ4X 2WXQA 3BVMA 3R2TA 4RH6A 1FCCC 3AECB 3AEGB 1OQRA 5EE1A 2L83A 4WH4A 2IJ0A 1WSPA 2Q5WD 4YT0B 4YTPB 1R7SA 2PMVA 2E6XA 4YSXB 2BYTA 3H8HA 3I9V1 1TS3A 2QEJC 4C80A 1C79A 2MJDA 3ETRA 2FBWB 2JSVX 1D5ZC 1DOIA 1F77A 3ZJTA 1BMLC 2JQRB 3U4EG 3P63A 3MP9A 3Q8FA 2L1AA 4IDIA 3P42A 2AQ2B 1N60A 3T3OA 1NVID 5C3JB 4WQMA 4WURA 1L6VA 3P1MA 3HUIA 3NVZA 3U7ZA 1FFVA 1EWCA 2K3UA 3IT6B 3VRAB 2PVGC 4XE0A 3ZGZA 2WXLA 2ONQA 4PT5A 2XN9C 1ZDVA 1XLQA 3VR8B 4WIPA 2W82A 1FXAA 1L4DB 1L0XB 5BYQA 1KFYB 4YTNB 1DOYA 3BK1A 3P4RB 1ZDXA 5EE0A 1TS5A 3NZ3A 4RF1A 5JXVA 4OW0A 4MT5A 1DOXA 2DYMA 2BS3B 4ZHOA 2BS2B 2IGDA 3W5UB 1P7EA 1CQVA 4MM3B 1L5PA 2N9KA 2SEBD 1AW7A 1OQQA 4D2KA 1IGCA 1K50A 1KH0A 2NTSA 4OVZA 5BMIA 4P6VF 3NUHB 3MHZA 3Q8AA 1KF6B 2WXNA 2H89B 1WXQA 4XWTA 1D5MC 1UWXA 1XCTL 2V3NA 3MFGA 2NMQA 1QOAA 2KACA 2JXTA 2WXOA 3AE6B 3NS1A 3BIID 4CQNA 1FNUA 3BYYB 1JWAD 3Q8BA 4WAFA 3RPFC 4ZRPA 4MACA 2LGIA 5G5GA 3ZJUA 1FFUA 2WS3B 2LHEA 3AE9B 3BYTB 1WYGA 2PLPA 1ZXHA 1JWMD 4JE3B 3FILB 4L1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZ7 A;  3PZ8 A;  1WSP A;  2D5G A;  4WIP A; 
#chains in the Genus database with same CATH topology
 1L6U A;  2W3R A;  3W5V B;  1AYF A;  4RM8 A;  4EEW A;  2INC C;  3VUX A;  2WX0 A;  4E74 A;  5CHW A;  2OHF A;  3VUY A;  3K9P B;  1VZ8 A;  2IDY A;  2WXP A;  1P3Q U;  3DBH B;  4TQ0 A;  2I1J A;  1MG8 A;  1LQB A;  4I6P A;  2KVZ A;  2NVU I;  4PYU A;  1YIW A;  3EA6 A;  4OZA A;  1ZXI A;  3QQ8 B;  1STE A;  2I1K A;  5C1Z A;  4PYZ A;  3PZ7 A;  3IBE A;  2RMM A;  1VJK A;  1YJI A;  1I4P A;  4MGZ E;  3S2A A;  2WLB A;  5IO9 A;  4P1C C;  1I42 A;  1B1Z A;  2W9N A;  3JSV A;  4TSS A;  1LM8 B;  4S0R A;  2GBJ A;  1WGD A;  3M62 B;  1OGW A;  1UD7 A;  1YQ4 B;  4C4V A;  2QIL A;  3DVG Y;  3Q3F A;  1NI2 A;  4C00 A;  3W1Y A;  4I6L B;  2BB5 A;  3NRZ A;  4LDT B;  4XZ4 A;  4M0W A;  2K25 A;  2J42 A;  2FNJ B;  2N0S B;  1TKG A;  2R61 A;  2MRP A;  2K0P A;  3DBH I;  4J3O D;  3SR6 A;  2WXJ A;  4W9E A;  4HPM B;  1FIQ A;  3RNA C;  3KYD D;  4ZYS A;  2KWC A;  4GDL A;  3WAM A;  3NVW A;  1JML A;  3B2G A;  4GIV A;  4KIK B;  3GE3 C;  4DHZ B;  2Y5P A;  2YLM A;  4FUL A;  4JIO U;  4E3C A;  2J52 A;  4ITK A;  2HTM E;  4MEL A;  2DLB A;  1M94 A;  1YNT E;  3L17 A;  1XT9 B;  4G0N B;  2I2Y A;  1FNV A;  1SE2 A;  4G11 A;  5BO4 B;  4MGK E;  2EEL A;  5HKH A;  3A4S C;  1TTN A;  3EFU A;  2LGX A;  4LJP B;  3WAL A;  2LI5 A;  1N6Z A;  5CHF A;  4WJN A;  1Q0W B;  1D4B A;  1V49 A;  4XC2 A;  3MHS D;  4GOC A;  2PE6 B;  4GXB A;  4MH0 E;  4KKJ A;  2YEP B;  1PFD A;  4BOZ B;  3R3M A;  2V1Y A;  3V61 A;  4LNF A;  4MJS A;  2PPH A;  3ZRC A;  4A3P A;  2EKI A;  1UBI A;  3QC8 B;  1NYR A;  1EO6 A;  4MGI E;  2FAZ A;  2LJ5 A;  3VHT C;  2G9H D;  4HKQ A;  5E6N A;  4ARC A;  1D6E C;  2JYE A;  3BY4 B;  2DZM A;  3KUD B;  1C3T A;  1Y56 A;  1EUV B;  3RCZ A;  1ROE A;  3RD2 A;  4G3X B;  2BKR B;  2GMI C;  2KWV B;  4US9 A;  1WGH A;  3DWG C;  5IP4 D;  3IXS A;  5E6O A;  1L2N A;  1TKY A;  2XEW A;  2C7N B;  1D5X C;  1RLF A;  4L23 A;  1I4H A;  2UWQ A;  3Q8E A;  1P0R A;  1YX6 B;  2J0K A;  4OZB A;  1EF1 A;  4FXC A;  4KZC A;  1XLP A;  4N58 A;  4P7I A;  4YSZ B;  2W54 A;  2AWT A;  3L08 A;  4FN2 A;  2KO3 A;  2IPK D;  3M3J A;  3GE8 C;  2L8J A;  3Q2A C;  3CMM B;  2L52 A;  2L3Z A;  2RDB C;  5BMH A;  5H8Y E;  3BVG A;  1TS4 A;  1WXV A;  2D3B A;  4MDK E;  2BYV E;  1HE8 A;  4F8C B;  3ZJV A;  3DVN V;  5D94 A;  3ZQ4 A;  4RGN A;  4HRS A;  1YD8 U;  1KOT A;  4OZC A;  4BAX A;  4IM2 A;  4HPL B;  1QIL A;  3WA0 A;  2AYO B;  1ZOY B;  1VZ7 A;  4EZK A;  1FRR A;  1E10 A;  3AI5 A;  4IWQ A;  2M1M A;  3CIR B;  4NZL B;  1SJE D;  4W9K A;  2BPS A;  1TYG B;  2RDG A;  5D3I B;  4RF0 A;  2C7H A;  1JQ4 A;  2ASQ A;  1ENF A;  3VRB B;  1CK1 A;  3VUW A;  1FRD A;  2FCM A;  1MJD A;  3PRP B;  5DCN A;  1SSN A;  2M8S A;  3L4P A;  3SFE B;  4L1B A;  1T3Q A;  1NI3 A;  2FCQ A;  1GOZ A;  3OAW A;  1MHH E;  5GXG B;  2CU3 A;  3HRD D;  1KJT A;  1WXM A;  4B0E A;  3AH7 A;  1V1P B;  3BZD B;  2LMC A;  2BBC A;  4X57 B;  4K81 A;  3PT2 B;  4TUU A;  3B9J A;  4DBG A;  4TV3 A;  4K7S A;  3WIM A;  4DHZ E;  1HZ6 A;  4NQL B;  5HG2 A;  3DBR B;  1GG3 A;  2FID A;  4LK0 M;  2AX5 A;  3H7P A;  1WGK A;  1WY8 A;  5T8I A;  3W2D A;  1KLU D;  3IHP C;  4ANW A;  1TGZ B;  2RPV A;  1E90 A;  4BKG A;  3DPD A;  1JW9 D;  2WGS A;  4BBN F;  4LNK A;  2BKF A;  1OFF A;  2BWF A;  4ZRQ A;  2RPQ A;  1TZ1 A;  4A20 A;  3QWZ B;  2KQ4 X;  4RH6 A;  3BVM A;  2PJH A;  5EE1 A;  2D3A A;  1E8Y A;  4ASW C;  1WSP A;  4YTP B;  1R7S A;  3L0W B;  2E6X A;  2BYT A;  3DBR I;  1TS3 A;  2V3S A;  3EEC A;  1BML C;  2JQR B;  3MP9 A;  3Q8F A;  3QJZ A;  5J2R A;  1N60 A;  3IG3 A;  1WM2 A;  5DPT A;  1P9D U;  2DYB A;  3U7Z A;  1EWC A;  3VRA B;  4DHJ D;  2PVG C;  2WXL A;  2ONQ A;  4FHJ A;  4NJ6 A;  3KUC B;  4JL9 A;  1FXA A;  3ZDT A;  2IBI B;  2KK8 A;  1E8Z A;  1KFY B;  4YTN B;  3BK1 A;  2BGF A;  1ZDX A;  1TS5 A;  3Q6B A;  5JXV A;  2DYM A;  4ZHO A;  1RRB A;  2N9K A;  1AW7 A;  1PQS A;  4W9H A;  4D2K A;  3AU5 A;  4ICU A;  3Q8A A;  2H89 B;  3KW5 B;  1UWX A;  3GZN B;  3MFG A;  2NMQ A;  3NS1 A;  3A1Q A;  3I3T B;  3OLM D;  3NHE B;  1JWA D;  2REX A;  1E7U A;  3Q8B A;  4ZRP A;  4MAC A;  2LGI A;  5G5G A;  1WF9 A;  1WZ3 A;  4HJK A;  2WS3 B;  2LHE A;  3AE9 B;  4MM3 A;  3AXC A;  4N6E B;  1EF5 A;  2WNM A;  1JRU A;  3T3N A;  4BBN C;  4JWS C;  3SD5 A;  3I57 A;  1ZW7 A;  3IVF A;  3UI3 A;  4HCP B;  1V8C A;  2D11 A;  4FBJ B;  1F2R C;  3SHQ A;  2V4I B;  3GZN I;  2N7J A;  3LDZ E;  4G50 A;  1AWD A;  2KMA A;  2KWD A;  1BXT A;  4ANU A;  1PYW D;  2KNB A;  3PRM B;  4GSW A;  2ZW0 A;  1K51 A;  1NYQ A;  2WXK A;  3AED B;  4P16 A;  5BYS A;  2OJW A;  4A8X C;  3EUB 2;  3D32 A;  4MSM B;  1L0Y B;  2IGG A;  2CS4 A;  4OVV A;  4J6I A;  3TMP B;  2WYQ A;  4W9D A;  3Q8C A;  1CMX B;  2CJN A;  4F1S A;  1YN4 A;  3EC8 A;  3ECI A;  5D3D A;  1WI0 A;  1V5O A;  1S3S G;  3Q3J A;  3O65 B;  3V05 A;  1WR6 E;  2BW2 A;  2G1E A;  3AEA B;  2MBH A;  1GJZ A;  2JU6 X;  2VZK B;  2NBW B;  3QCA A;  3UGB B;  4GLS C;  2KZR A;  1FO4 A;  1ZP0 B;  3CSF A;  1Y8R C;  1V97 A;  2DAJ A;  1VD2 A;  1X1M A;  3HM6 X;  1WJU A;  1GC7 A;  2QSD A;  1P98 A;  5C2T B;  1JWU D;  4B0M A;  2SAK A;  2JVC A;  1BT0 A;  2K6D B;  4XWW A;  3W1S A;  2FCS A;  5G55 A;  2GLS A;  3KWV A;  3Q14 C;  4RGO S;  2AQ1 B;  1WGG A;  3PZ8 A;  4KIK A;  2JRI B;  1Z2M A;  4AUQ C;  1FM0 D;  4RFB A;  2AQ3 B;  4CO7 A;  2KTR B;  3DVN U;  5FR3 A;  1JCK B;  1QQR A;  1VLB A;  3U30 A;  2M19 A;  3I63 C;  5LNK 1;  2PEA A;  1I4R A;  2DWQ A;  4W9L A;  2MX2 A;  1EM7 A;  1FXI A;  3A33 B;  1AN8 A;  3RN9 C;  1T0Y A;  5DPW A;  1FEH A;  2B76 B;  1GB1 A;  2WXH A;  1N5W A;  4II3 B;  3SFD B;  2G4D B;  3PS6 A;  3RNG C;  3WAN A;  4NJC A;  1S1Q B;  3NZU A;  3FIL A;  3GS2 A;  3P4Q B;  1WGY A;  1KTK A;  2L0T A;  1FXT B;  3FKY A;  1E9M A;  4AOF A;  2C60 A;  4XDD A;  4XDC A;  1WM3 A;  2JYT A;  2LRW A;  1I7H A;  3TUO A;  1FPY A;  1P7F A;  3HVZ A;  3RYT A;  3ZLZ A;  3V60 A;  4W9I A;  3VQI A;  2D10 A;  2L05 A;  2UYZ B;  4USA A;  1DYQ A;  1L7Y A;  5BYR A;  2KLG A;  2J4X A;  1KLV A;  3AU4 A;  4K7W A;  1QOF A;  2G45 B;  5CHV C;  3NVV A;  3DBL B;  1N62 A;  3AMZ A;  2IY0 B;  1LFD A;  2X38 A;  1CZP A;  4AQ7 A;  5HI1 A;  2INP E;  2KDB A;  3RUI B;  3BVZ A;  4M01 A;  2N9X A;  4YXD B;  4EE2 A;  3CST A;  3R66 C;  3N9Y C;  2DYO A;  5G5H A;  2VZK D;  1QZE A;  3MJ5 A;  3DVG X;  2O6V D;  3GP7 A;  1C78 A;  3NOB A;  2G4S A;  2R2O A;  4BKS A;  1VZ6 A;  2C5L C;  3QK0 A;  3R8B A;  4GDK B;  4KKI A;  5AZF A;  2KOX A;  2KC2 A;  2LZ6 A;  1MPE A;  4WAA A;  4JWU C;  3DBL I;  2KXJ A;  5G2N A;  1WH3 A;  1LO5 D;  1OEY J;  4FJZ A;  4ZRI A;  3R2I A;  2XK5 B;  1UGM A;  2LUE A;  4XYC A;  5E6J A;  1WXA A;  3VTV A;  3EGR A;  3ZKJ C;  3AEE B;  2E3T A;  2PIA A;  1MI0 A;  1XCQ L;  2LHD A;  2MCN B;  3QAQ A;  1T6B X;  3PTF C;  4FHK A;  4ARI A;  4HXD A;  1WE7 A;  2GBM A;  3RNC C;  3ZTC A;  1J19 A;  2KVR A;  2PTL A;  2DZJ A;  3APC A;  3M95 A;  4RNA A;  3L13 A;  2BYF A;  3ONS A;  4GN1 A;  1TY2 A;  1MHX A;  2MP2 B;  3ZXR A;  4LJO B;  1OTR B;  1R4N B;  2A4Z A;  4HCN B;  4YSY B;  3PHW B;  1T0R C;  1TS2 A;  2LAS A;  2BTE A;  1E0Z A;  4GB9 A;  4C7Z A;  1GB4 A;  3TEZ A;  2O2V B;  2J0M A;  3TEY A;  3AE2 B;  1F52 A;  2PKO A;  3C8Y A;  4IUM B;  1DGJ A;  1FMA D;  2J53 A;  5TSS A;  5I4D A;  3AB5 A;  3ZYY X;  4MGY E;  2JXX A;  4H2A A;  1JAL A;  4L2Y A;  4K3B A;  3PRZ A;  3AEC B;  4NAW A;  4GMV A;  2L83 A;  2Q5W D;  3OG5 A;  4DHJ B;  3T9L A;  4YSX B;  3H8H A;  1WX7 A;  2GOW A;  3A9J B;  2JSV X;  2L7R A;  2FIF A;  1DOI A;  2IYD B;  2LGY A;  4LCD E;  4AJY B;  3DQV A;  3NS8 A;  3P42 A;  1NVI D;  5C3J B;  2WDT B;  2ZNV C;  4M8N A;  4WUR A;  1L6V A;  2KYW A;  2NS5 A;  3PLU A;  1UZX B;  3HUI A;  2N9P C;  2AL3 A;  3NVZ A;  1FFV A;  3VAW A;  3ZNI D;  2CKH B;  2N9E B;  3ZGZ A;  4ZRK A;  2XN9 C;  3UQB A;  3VR8 B;  1L4D B;  1L0X B;  2M0X A;  1DOY A;  1E8W A;  3P4R B;  3NZ3 A;  4RF1 A;  5IN7 A;  4IC7 B;  2BS3 B;  2BS2 B;  1P7E A;  2SEB D;  2ZVO A;  5AZH A;  2NPT A;  2ZZP B;  1IGC A;  1K50 A;  4OVZ A;  1HTO A;  4P6V F;  1KF6 B;  5L95 C;  1E5W A;  4XWT A;  4LNO A;  2BYE A;  4W9J A;  3QA8 A;  1IP9 A;  2JXT A;  3BII D;  1FNU A;  4WAF A;  2MBE A;  3RPF C;  1ZGU B;  1WE6 A;  3ZJU A;  3PGE A;  4NPN A;  1H8C A;  2QHO A;  3BYT B;  1WYG A;  2PLP A;  1ZXH A;  2N7D A;  2XNA C;  1T0Q C;  1XF5 L;  4WJQ A;  3E56 A;  4RCO A;  3P2B A;  4HVB A;  1IBX B;  2KN5 A;  3PO0 A;  4FA6 A;  4LNI A;  2FUH B;  1AAR A;  1WJ6 A;  2LVP A;  2WDR B;  4WWP A;  2W55 A;  1UUP A;  2LRU A;  1WR1 A;  5J17 A;  1QKZ A;  3ZNH B;  4KZ0 A;  2D3G A;  5TR5 A;  1HXY D;  5BMG A;  2QIE B;  1XLN A;  2KDF B;  2PVO D;  5D7G A;  1C77 A;  3IAS 1;  3BK2 A;  4II2 B;  1EU3 A;  1YMH E;  3RFZ B;  1L0V B;  1JRP A;  2JZP A;  3X0W A;  2V4L A;  1C9F A;  1WMH B;  2ZPN A;  2D3C A;  1UWM A;  1ET6 A;  2Z0D B;  3FC4 A;  5HHD G;  5D2M B;  4KGT A;  1I4X A;  4M8M A;  4IOI E;  4HEA 1;  2MW5 A;  1Z5S B;  3AN1 A;  3KQ4 A;  2H88 B;  3PSE B;  1SJH D;  3TEX A;  1V1O A;  4NNJ B;  1ET9 A;  2I38 A;  4HRO A;  5EDS A;  4DDI D;  2V9H A;  2L32 A;  1SBB B;  2K9X A;  2DAF A;  3URY A;  1ESF A;  2MJE A;  2BS4 B;  2MQJ A;  1TJE A;  4HWI B;  4C7Y A;  1U4A A;  2GB1 A;  2WXR A;  1NBF C;  3CWI A;  1HZ5 A;  4IW0 A;  4C56 C;  1C76 A;  2KX3 A;  2WP9 B;  2PW9 A;  3A9K B;  2JWZ A;  3PLV A;  3N1Y C;  3UIO B;  3DDC B;  3BWU D;  4WJP A;  1RAX A;  5JZE B;  1FNW A;  1J8C A;  3VFK A;  1HEZ E;  3IFW B;  2JWU A;  2QC8 A;  3AE4 B;  1RFA A;  2MJ3 A;  3H7P B;  2V3P A;  1TIF A;  1RM6 C;  2MBQ A;  2J0J A;  1T5X D;  1SXT A;  4EFO A;  3HHM A;  2K8C A;  1GUA B;  3MC9 A;  4JX1 C;  2KTR A;  1VCB A;  2IND C;  2CHZ A;  2JPH A;  2LFI A;  2K8H A;  3LB8 C;  1XD3 B;  2DBY A;  1ZKH A;  3DHH C;  3PZD A;  4OHJ A;  2CJO A;  1WXS A;  1XEE A;  1E7P B;  2TSS A;  3N1X C;  2RR9 A;  2WX1 A;  2Z0E B;  3RZW C;  1SIJ A;  2GBN A;  4IWP A;  1V6E A;  2J7Q B;  3DWM A;  2DZI A;  2K8B A;  2K1F A;  3NJT A;  4B95 A;  4US8 A;  4CHK A;  1SE4 A;  1F2R I;  3N30 A;  3A4R A;  1UEL A;  1C1Y B;  1IYF A;  4ZOH C;  2LGD A;  5EE3 A;  1QOG A;  3MC8 A;  1LXD A;  2Y5B B;  5C23 A;  1KRH A;  3C19 A;  2JZZ A;  3PVL A;  5AUK A;  1C4C A;  3TL5 A;  4KGR A;  2WQY B;  3N3K B;  4N9F 4;  1RFK A;  2Z59 B;  4W9C A;  3ZXV A;  3RI7 C;  3R7R A;  2BWE S;  2O6V B;  2XBB C;  3TEW A;  2GRI A;  3DBS A;  3RMK C;  1TZO A;  3Q3O C;  3SEB A;  1CJE A;  2JZ3 B;  2ZEQ A;  1I4G A;  3B08 A;  4AWJ A;  5FK9 C;  2BT6 A;  2K22 A;  5AZG A;  1PGB A;  4TKN A;  2LXC A;  2BVC A;  1T0S C;  2KFK B;  1LGR A;  3HIZ A;  2ICI A;  2FCN A;  2M4N A;  3N32 A;  1L4Z B;  2LXA A;  3P4S B;  1XLO A;  4RMA A;  2NCN A;  1WX9 A;  1WJ4 A;  3EFC A;  3RNF C;  1J7A A;  4A6Q A;  3AUL A;  3ZW3 A;  1QF6 A;  4HKZ E;  1J7C A;  1GPX A;  1WWT A;  3NVY A;  4IKG A;  2IY1 B;  2VH1 A;  3SU8 X;  1UF0 A;  3E9S A;  2ZCB A;  3JW0 X;  3VXW A;  3WCQ A;  2ACZ B;  4JGH B;  1V9J A;  4BFR A;  3TJP A;  4NQK E;  2DNF A;  4WJO A;  4M00 A;  1G6J A;  1JWB D;  4NJ7 A;  3HVD A;  3AEB B;  4K3C A;  2MHJ A;  4GDK A;  1OEY A;  3ZNG C;  3ZIM A;  2KMC A;  2KJ6 A;  1RYJ A;  5D6J B;  1IGD A;  4A55 A;  4MH8 A;  2NTT A;  3QIJ A;  2IGH A;  1WFY A;  4KDI C;  2QCZ A;  1YX5 B;  3OJ3 A;  4NY0 A;  1QLB B;  1RWS A;  3DHI C;  4MSQ B;  1WRI A;  3TIX A;  2XK5 A;  3VR9 B;  4IG7 B;  1YOV B;  4BVU C;  1Q1O A;  2JUO A;  3O13 A;  1Q5W B;  1PUT A;  1WJN A;  3QHT A;  4AS1 A;  2MLB A;  1N61 A;  3L16 A;  3AM9 A;  3U52 E;  2HDE A;  2MH7 A;  5LXH A;  1YN3 A;  1J0G A;  2KTF A;  3APD A;  4JPS A;  2YEP F;  3UIP B;  4ZDV A;  2QMT A;  3AE7 B;  3V3X A;  4ANV A;  4JLC A;  4ACF A;  2WWZ A;  2LEK A;  4PS3 A;  5CTR C;  2MP2 A;  2ZVN A;  1FCC C;  4HPP A;  2X8X X;  4ZYN A;  1A5R A;  5IAA C;  3UQA A;  2PMV A;  4RM9 A;  3I9V 1;  2MBB B;  2QEJ C;  1IPG A;  4IM0 A;  1C79 A;  3NZS A;  2O2V A;  1F77 A;  2IO1 B;  1WYW B;  5DPR A;  2L1A A;  2WHI A;  4IDI A;  4S17 A;  2ZJD A;  3H6N A;  3RT3 B;  1MFW A;  2LVQ A;  5J18 A;  4WQM A;  2LWP A;  4EUT A;  3IT6 B;  2JT4 B;  3NY5 A;  1P1A A;  2KDE B;  1SIF A;  3RUL A;  1ZDV A;  4DDG D;  2W82 A;  3JYU A;  5FR6 A;  3A9J A;  3B0A A;  1E7V A;  5EE0 A;  4OW0 A;  3LJ3 A;  4HK2 A;  2LGS A;  3PHX B;  3W1S C;  3ZVV A;  4W9F A;  3W5U B;  4ZRJ A;  1CQV A;  3WAP A;  1KH0 A;  5BMI A;  1TT5 B;  2KT7 A;  2WXN A;  1OQY A;  1KM7 A;  1WXQ A;  2UU7 A;  3RNB C;  5JH5 C;  1XCT L;  2V3N A;  3H1U A;  2KAC A;  3AE6 B;  3DCG A;  3BYY B;  3V6E B;  3L54 A;  3GOE A;  2MWS B;  3U7D A;  2KAN A;  3H9D A;  5IA7 A;  4BZA A;  1V2Y A;  2L76 A;  3FIL B;  3ZO5 B;  3W9C B;  5JHB A;  4A9A A;  2BF8 B;  2RDH A;  1BUI C;  2DZK A;  3JSV B;  2KC1 A;  4KX6 B;  1YQB A;  3IT4 B;  1V1P A;  2QJL A;  2VRR B;  1ZPS A;  1A70 A;  4C4V B;  3VDZ A;  1YN5 A;  4WWO A;  1R4M B;  2KFJ A;  1K53 A;  3HM3 A;  2BB6 A;  4M0W B;  1GAQ B;  3CF6 E;  3K9O B;  3PRE A;  1C4P A;  1IBX A;  4ICV A;  1ISN A;  2WXI A;  1N63 A;  4GDL B;  2ZNV B;  3I5J C;  4WQO B;  2WDV B;  2EMT A;  1GC6 A;  4EOY A;  2LUM A;  4DXA B;  1I35 A;  3MC0 B;  3AE3 B;  3ML9 A;  1F9J A;  3N20 C;  1TY0 A;  4PK1 A;  4DXF A;  3R7Q A;  1I4Q A;  1NDD A;  1R4N I;  3P4P B;  4M02 A;  3SDL C;  2L00 B;  4IM3 A;  1M4V A;  1R4M I;  1VDV A;  3TSS A;  4WWN A;  1WIA A;  1JRO A;  1WMH A;  1V86 A;  3AEF B;  1KLG D;  1UBQ A;  4RGT A;  5DPS A;  1SGH A;  4LDT D;  3VVW B;  5CX3 A;  3DOW A;  1SF0 A;  2W3S A;  3Q3M C;  2KJH B;  3Q69 A;  4URK A;  5L83 A;  4A90 A;  4MJS B;  2ZW1 A;  1WRD B;  1V81 A;  2DEN B;  3WAO A;  1H4R A;  2V0G A;  2ZPY A;  4LNN A;  4O1N A;  1B9R A;  4P1B C;  3RNE C;  2N4F A;  4LTU A;  2WU2 B;  3ZUN A;  2EMS A;  2DHZ A;  3LYY A;  4K7U A;  2K5P A;  2GI9 A;  2ZCC A;  2D2Q A;  2MEK A;  4ZHP A;  4REZ A;  4DQO C;  2A5U A;  3PV1 A;  2EKE C;  5KHQ A;  3ZNZ B;  1YQ3 B;  4QAY A;  3ABV B;  1YJJ A;  1XQQ A;  2HJ1 A;  3FAH A;  2N9L A;  2L0F A;  4LLG M;  1V80 A;  1XO3 A;  2KDM A;  3NG0 A;  1WX8 A;  1SB3 C;  2MA9 B;  1UNS A;  2RSU A;  3LXF A;  2K39 A;  3UF8 A;  1N5X A;  2Z8L A;  3U8Z A;  2WXM A;  2FUG 1;  1V5T A;  3T8M A;  1MG4 A;  5AUI A;  3A9K A;  1PGX A;  2KKC A;  3DHG C;  4PS8 A;  2KMM A;  2CR5 A;  4WWM A;  2M56 B;  4EZJ A;  2KN4 A;  1QT9 A;  1SE9 A;  2M0A A;  2N1V A;  2M17 A;  1K8R B;  1TBE A;  3BIN A;  3B2F A;  2GBK A;  3V6C B;  4HLE A;  2OOB B;  3X23 A;  1IUE A;  4UDU C;  4NAW B;  5HFY A;  1JWS D;  1C4A A;  2JX5 A;  4FJV B;  4BKT A;  4R3D A;  2GBR A;  3KWL A;  2B3A A;  2DX5 B;  4AP4 C;  4KSL C;  2AL6 A;  2VH2 A;  1TKE A;  4XGA B;  5E6P A;  1Q10 A;  2FE8 A;  2KDI A;  3AE5 B;  4KVG B;  2WXF A;  2LJI A;  1HA5 A;  4BOS C;  4IWO A;  1K52 A;  4EZL A;  1F0Z A;  1EU4 A;  5GMV A;  2IZV B;  1SE3 A;  1D3Z A;  5H92 C;  2IO3 B;  1GNU A;  5FKA C;  4E71 A;  3ALB A;  1E6E B;  1FD6 A;  4I6N B;  1J7B A;  2ON8 A;  1YJ1 A;  3ZDM C;  3B1L X;  2CU1 A;  3V62 A;  4YWG G;  2WDQ B;  5JHA A;  4A3O A;  5IKC M;  4YTM B;  2KAJ A;  2KQ7 A;  3RZF A;  1VR9 A;  4KDL B;  2NPT B;  3ML8 A;  1ACC A;  1PDX A;  3OWE B;  3PPA A;  2N1W A;  3GB1 A;  1ZUD 2;  2G3Q B;  1FCL A;  2O6V A;  4FAD A;  4AJW A;  4TQ1 A;  2RD0 A;  2C7M B;  3AE1 B;  4BKS D;  3TBL D;  2IO0 B;  1HQR D;  4F7Z A;  4N59 A;  3U2S C;  1WGR A;  4KGS A;  3C0R B;  2OED A;  1PGA A;  3OJ4 B;  3KLS X;  4CYE A;  2KLC A;  2WXG A;  2HE7 A;  2KFK A;  1MVK A;  5MPO A;  3IAM 1;  4Q2J A;  3VTW A;  2YVC A;  4DWF A;  5AEK B;  4EKU A;  1VRA B;  4KV2 A;  3H7S A;  2KJR A;  2INN E;  3TCA A;  4RGM A;  4DXG A;  2KX0 A;  2Y5C A;  4DK5 A;  3N1Z C;  1HTQ A;  5KHO A;  1UGJ A;  4TMA B;  4GU2 A;  1NEN B;  1XXG A;  3J9C A;  3VTU A;  1SEB D;  4B6W A;  2WU5 B;  2D5G A;  4GGQ A;  4KSK C;  2HD5 B;  2CHX A;  4HJG E;  1NEK B;  3APF A;  3KUZ A;  2MBO A;  3M63 B;  4B9K A;  3AV8 A;  4NAM A;  3HK0 A;  4K1R B;  1ZE3 D;  1QOB A;  2NBU A;  2NBV B;  3ENE A;  2JF5 A;  2KHW B;  3MJW A;  3UIN B;  4FLH A;  2PE9 A;  1EWY C;  3KH0 A;  2Y3A A;  3EHV A;  3AE8 B;  3VH3 B;  5EE9 A;  4YL8 A;  2WXQ A;  3R2T A;  3AEG B;  1OQR A;  3KVF B;  4WH4 A;  2IJ0 A;  4YT0 B;  4JQW C;  4C80 A;  2MJD A;  2HTH A;  3ETR A;  3ZRF A;  2FBW B;  2IO2 B;  1D5Z C;  2C9W B;  4PS7 A;  3ZJT A;  3U4E G;  2KQS A;  3P63 A;  3ZTD A;  2MSE D;  1E8X A;  2AQ2 B;  2JRH A;  3T3O A;  3P1M A;  5LLI A;  3KYC D;  2LD9 A;  4W9G A;  2BQQ A;  2AEH A;  2K3U A;  4XX5 A;  3JVZ X;  4XE0 A;  2QDF A;  1F1H A;  4PT5 A;  2JY6 A;  1XLQ A;  3QX1 A;  4HDO A;  2LVO A;  4WIP A;  5LXI B;  3A1Q B;  2NR2 A;  5BYQ A;  2HJ8 A;  3MTN B;  4MT5 A;  1DOX A;  2D07 B;  2KWU B;  4MEM A;  1UH6 A;  2IGD A;  4HDQ A;  4MM3 B;  1L5P A;  2CHW A;  1OQQ A;  3QAR A;  2NTS A;  5IOI A;  3NUH B;  3MHZ A;  1D5M C;  4FJY A;  3L10 B;  1QOA A;  2K6Q A;  2WXO A;  1WZ0 A;  2RGF A;  4CQN A;  4OVU A;  2OJR A;  4ANX A;  1FFU A;  2R2Q A;  3Q3N C;  2KD0 A;  1JWM D;  4JE3 B;  3VH4 B;  2N7E A; 
#chains in the Genus database with same CATH homology
 1L6U A;  2W3R A;  4N6E B;  2XNA C;  3W9C B;  3W5V B;  1XF5 L;  4A9A A;  3E56 A;  1AYF A;  4RCO A;  2WNM A;  1IBX B;  2OHF A;  2RDH A;  1BUI C;  3PO0 A;  3T3N A;  4JWS C;  3I57 A;  1VZ8 A;  4KX6 B;  2IDY A;  2WXP A;  2WDR B;  3IT4 B;  1V1P A;  2QJL A;  1ZPS A;  2W55 A;  1A70 A;  4TQ0 A;  1UUP A;  1YN5 A;  3UI3 A;  1V8C A;  1QKZ A;  3EA6 A;  4OZA A;  1ZXI A;  1F2R C;  1HXY D;  1STE A;  5BMG A;  2V4I B;  2QIE B;  2N7J A;  3PZ7 A;  1K53 A;  1XLN A;  2BB6 A;  2RMM A;  2PVO D;  1GAQ B;  5D7G A;  1AWD A;  1VJK A;  1YJI A;  1I4P A;  2KWD A;  1C77 A;  1BXT A;  3IAS 1;  3BK2 A;  2WLB A;  1C4P A;  1EU3 A;  1YMH E;  3RFZ B;  1L0V B;  1PYW D;  1B1Z A;  1IBX A;  1JRP A;  2JZP A;  2WXI A;  2ZW0 A;  4TSS A;  1K51 A;  1NYQ A;  2WXK A;  3AED B;  1N63 A;  1C9F A;  4GDL B;  4P16 A;  5BYS A;  2WDV B;  4A8X C;  3EUB 2;  1YQ4 B;  1L0Y B;  1UWM A;  2IGG A;  2QIL A;  1ET6 A;  2LUM A;  3MC0 B;  2BB5 A;  3FC4 A;  3AE3 B;  3NRZ A;  5HHD G;  3Q8C A;  4KGT A;  2CJN A;  1I4X A;  1TY0 A;  4M0W A;  1YN4 A;  2J42 A;  4DXF A;  2N0S B;  1I4Q A;  1TKG A;  2R61 A;  3P4P B;  4IOI E;  2K0P A;  5D3D A;  4J3O D;  3SR6 A;  4HEA 1;  2WXJ A;  1M4V A;  1VDV A;  3TSS A;  3V05 A;  3AN1 A;  3KQ4 A;  1JRO A;  2BW2 A;  2G1E A;  2H88 B;  3AEA B;  1FIQ A;  4ZYS A;  2JU6 X;  1SJH D;  2VZK B;  3NVW A;  1JML A;  3TEX A;  3B2G A;  1V1O A;  3AEF B;  1ET9 A;  1KLG D;  2I38 A;  4HRO A;  4RGT A;  4GLS C;  2Y5P A;  1FO4 A;  2J52 A;  1ZP0 B;  2L32 A;  4ITK A;  1V97 A;  1SF0 A;  2HTM E;  2W3S A;  1SBB B;  2K9X A;  3Q69 A;  2DLB A;  1YNT E;  4A90 A;  3URY A;  2QSD A;  1ESF A;  2MJE A;  2BS4 B;  2I2Y A;  5C2T B;  1FNV A;  1TJE A;  1JWU D;  2ZW1 A;  1SE2 A;  4B0M A;  2SAK A;  2EEL A;  4C7Y A;  4XWW A;  2V0G A;  3W1S A;  4O1N A;  3KWV A;  4RGO S;  1B9R A;  2AQ1 B;  2GB1 A;  2WXR A;  1D4B A;  3PZ8 A;  4LTU A;  2WU2 B;  3CWI A;  1HZ5 A;  4C56 C;  1C76 A;  3LYY A;  2WP9 B;  1FM0 D;  2K5P A;  2GI9 A;  4RFB A;  2PW9 A;  2AQ3 B;  4KKJ A;  2MEK A;  2YEP B;  5FR3 A;  1PFD A;  4ZHP A;  4REZ A;  1JCK B;  4DQO C;  1QQR A;  1VLB A;  1YQ3 B;  2M19 A;  5LNK 1;  3ABV B;  1YJJ A;  1I4R A;  2EKI A;  3BWU D;  3FAH A;  2N9L A;  2DWQ A;  1FNW A;  4LLG M;  1HEZ E;  1NYR A;  1XO3 A;  2JWU A;  2KDM A;  3AE4 B;  1EM7 A;  1FXI A;  2MJ3 A;  1AN8 A;  2G9H D;  1SB3 C;  2V3P A;  4HKQ A;  1UNS A;  1RM6 C;  4ARC A;  3LXF A;  2JYE A;  1D6E C;  1T5X D;  1SXT A;  1N5X A;  2Z8L A;  2WXM A;  2FUG 1;  1Y56 A;  4JX1 C;  2LFI A;  3LB8 C;  5AUI A;  1ROE A;  1FEH A;  1PGX A;  2B76 B;  2DBY A;  4OHJ A;  2CJO A;  1GB1 A;  2WXH A;  1XEE A;  4US9 A;  1N5W A;  3DWG C;  1E7P B;  2KMM A;  2TSS A;  4WWM A;  3SFD B;  2M56 B;  2KN4 A;  4NJC A;  1QT9 A;  3IXS A;  2M0A A;  1TKY A;  1D5X C;  3FIL A;  3GS2 A;  4L23 A;  1SIJ A;  3P4Q B;  3B2F A;  1I4H A;  1KTK A;  3Q8E A;  1IUE A;  1E9M A;  3DWM A;  4UDU C;  4NAW B;  5HFY A;  4XDD A;  4US8 A;  1JWS D;  4OZB A;  4XDC A;  1SE4 A;  1C4A A;  1F2R I;  2JX5 A;  2JYT A;  1I7H A;  4R3D A;  4FXC A;  1XLP A;  3TUO A;  3KWL A;  4ZOH C;  5EE3 A;  4N58 A;  4YSZ B;  1QOG A;  2W54 A;  1P7F A;  2IPK D;  1KRH A;  2L52 A;  3HVZ A;  5AUK A;  1TKE A;  1C4C A;  5BMH A;  4KGR A;  5H8Y E;  2WQY B;  1TS4 A;  3BVG A;  1Q10 A;  2FE8 A;  1RFK A;  3AE5 B;  3VQI A;  4USA A;  2WXF A;  2LJI A;  1DYQ A;  1HA5 A;  5BYR A;  1K52 A;  3ZJV A;  1F0Z A;  1EU4 A;  2J4X A;  1SE3 A;  3ZQ4 A;  5H92 C;  1QOF A;  4RGN A;  4HRS A;  4OZC A;  3TEW A;  3NVV A;  5FKA C;  1N62 A;  2GRI A;  3AMZ A;  1QIL A;  1FD6 A;  1E6E B;  1TZO A;  3SEB A;  1CJE A;  1J7B A;  1ZOY B;  1VZ7 A;  2ON8 A;  1FRR A;  1E10 A;  1I4G A;  2X38 A;  4YWG G;  2WDQ B;  1CZP A;  4AQ7 A;  3CIR B;  4YTM B;  5FK9 C;  4NZL B;  2KAJ A;  1VR9 A;  2BT6 A;  5HI1 A;  2INP E;  2K22 A;  1PGB A;  1SJE D;  3BVZ A;  1TYG B;  1ACC A;  1PDX A;  3OWE B;  4YXD B;  2RDG A;  4EE2 A;  3GB1 A;  5D3I B;  1ZUD 2;  4RF0 A;  2ICI A;  3N9Y C;  2DYO A;  5G5H A;  1JQ4 A;  2VZK D;  3MJ5 A;  1FCL A;  1L4Z B;  1ENF A;  3GP7 A;  3VRB B;  3P4S B;  1C78 A;  1XLO A;  4TQ1 A;  1CK1 A;  3AE1 B;  1VZ6 A;  1HQR D;  4N59 A;  3R8B A;  4GDK B;  3U2S C;  4KKI A;  1FRD A;  1J7A A;  4A6Q A;  4KGS A;  1QF6 A;  1MPE A;  4HKZ E;  4JWU C;  2OED A;  1PGA A;  1J7C A;  3KLS X;  1GPX A;  1SSN A;  1WWT A;  2WXG A;  3NVY A;  3L4P A;  3SFE B;  1LO5 D;  1T3Q A;  4IKG A;  1MVK A;  1NI3 A;  5MPO A;  1GOZ A;  3E9S A;  3IAM 1;  3WCQ A;  1MHH E;  2ACZ B;  3R2I A;  4Q2J A;  5GXG B;  2CU3 A;  3HRD D;  5E6J A;  1VRA B;  4B0E A;  1JWB D;  3EGR A;  3HVD A;  3AH7 A;  3AEB B;  1V1P B;  3AEE B;  2E3T A;  2INN E;  2PIA A;  3BZD B;  1MI0 A;  1XCQ L;  2BBC A;  2LMC A;  2LHD A;  1T6B X;  4RGM A;  4DXG A;  2Y5C A;  1RYJ A;  4ARI A;  1IGD A;  4A55 A;  4MH8 A;  2NTT A;  3B9J A;  2IGH A;  2PTL A;  1UGJ A;  4TMA B;  1HZ6 A;  5HG2 A;  1QLB B;  1RWS A;  1NEN B;  1XXG A;  1WRI A;  3J9C A;  4LK0 M;  4RNA A;  3VR9 B;  1SEB D;  2AX5 A;  1WGK A;  2WU5 B;  2D5G A;  5T8I A;  1TY2 A;  1MHX A;  3W2D A;  4HJG E;  1NEK B;  3O13 A;  1PUT A;  1KLU D;  4YSY B;  4AS1 A;  1TS2 A;  1N61 A;  3AV8 A;  2BTE A;  1E0Z A;  4NAM A;  1ZE3 D;  3AM9 A;  2RPV A;  3U52 E;  2HDE A;  2MH7 A;  1QOB A;  4C7Z A;  1GB4 A;  1YN3 A;  3TEZ A;  1JW9 D;  4JPS A;  2YEP F;  3TEY A;  3AE2 B;  2PKO A;  3C8Y A;  1DGJ A;  1FMA D;  1OFF A;  2J53 A;  2QMT A;  3AE7 B;  3V3X A;  5TSS A;  5I4D A;  3AB5 A;  1EWY C;  4ZRQ A;  2Y3A A;  3ZYY X;  2LEK A;  4H2A A;  3AE8 B;  1JAL A;  4L2Y A;  5EE9 A;  2KQ4 X;  2WXQ A;  3BVM A;  3R2T A;  4RH6 A;  1FCC C;  3AEC B;  3AEG B;  1OQR A;  5EE1 A;  2L83 A;  4WH4 A;  2IJ0 A;  1WSP A;  2Q5W D;  4YT0 B;  4YTP B;  1R7S A;  2PMV A;  2E6X A;  4YSX B;  2BYT A;  3H8H A;  3I9V 1;  1TS3 A;  2QEJ C;  4C80 A;  1C79 A;  2MJD A;  3ETR A;  2FBW B;  2JSV X;  1D5Z C;  1DOI A;  1F77 A;  3ZJT A;  1BML C;  2JQR B;  3U4E G;  3P63 A;  3MP9 A;  3Q8F A;  2L1A A;  4IDI A;  3P42 A;  2AQ2 B;  1N60 A;  3T3O A;  1NVI D;  5C3J B;  4WQM A;  4WUR A;  1L6V A;  3P1M A;  3HUI A;  3NVZ A;  3U7Z A;  1FFV A;  1EWC A;  2K3U A;  3IT6 B;  3VRA B;  2PVG C;  4XE0 A;  3ZGZ A;  2WXL A;  2ONQ A;  4PT5 A;  2XN9 C;  1ZDV A;  1XLQ A;  3VR8 B;  4WIP A;  2W82 A;  1FXA A;  1L4D B;  1L0X B;  5BYQ A;  1KFY B;  4YTN B;  1DOY A;  3BK1 A;  3P4R B;  1ZDX A;  5EE0 A;  1TS5 A;  3NZ3 A;  4RF1 A;  5JXV A;  4OW0 A;  4MT5 A;  1DOX A;  2DYM A;  2BS3 B;  4ZHO A;  2BS2 B;  2IGD A;  3W5U B;  1P7E A;  1CQV A;  4MM3 B;  1L5P A;  2N9K A;  2SEB D;  1AW7 A;  1OQQ A;  4D2K A;  1IGC A;  1K50 A;  1KH0 A;  2NTS A;  4OVZ A;  5BMI A;  4P6V F;  3NUH B;  3MHZ A;  3Q8A A;  1KF6 B;  2WXN A;  2H89 B;  1WXQ A;  4XWT A;  1D5M C;  1UWX A;  1XCT L;  2V3N A;  3MFG A;  2NMQ A;  1QOA A;  2KAC A;  2JXT A;  2WXO A;  3AE6 B;  3NS1 A;  3BII D;  4CQN A;  1FNU A;  3BYY B;  1JWA D;  3Q8B A;  4WAF A;  3RPF C;  4ZRP A;  4MAC A;  2LGI A;  5G5G A;  3ZJU A;  1FFU A;  2WS3 B;  2LHE A;  3AE9 B;  3BYT B;  1WYG A;  2PLP A;  1ZXH A;  1JWM D;  4JE3 B;  3FIL B;  4L1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...