3PZ8A

Crystal structure of dvl1-dix(y17d) mutant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
82
structure length
82
Chain Sequence
DTKIIYHMDEEETPDLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Segment polarity protein dishevelled homolog DVL-1
publication title Molecular basis of WNT activation via the DIX-domain protein CCD1
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 12
structure length 82
sequence length 82
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.380 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3pz8A00
3PZ7A 2D5GA 3PZ8A 1WSPA 4WIPA
chains in the Genus database with same CATH superfamily
4A9AA 4ZRQA 4FJYA 1SE3A 1OTRB 1NI3A 1WFYA 5TR5A 3GE8C 4FULA 1VZ7A 3CWIA 5FKAC 4M8MA 1YJIA 4GDKA 4II2B 2VZKD 4RNAA 4JWSC 2BB5A 4M00A 4AJWA 3S2AA 2NTSA 2V0GA 4MACA 3BVMA 5D3IB 4WURA 2R2OA 1GB1A 1SE4A 3OLMD 4ICVA 2C9WB 4RCOA 1WXQA 4RGOS 1S1QB 4XZ4A 4HPPA 3PLUA 4K7UA 1Z2MA 4TMAB 3B2FA 3CIRB 4P1CC 2K6DB 1SE2A 1F2RI 1NEKB 3Q8CA 5G55A 2CJNA 2LASA 3E56A 4JWUC 1UGJA 2SAKA 4WJOA 2N7EA 2IGGA 2YEPB 1WRDB 2KMMA 4DBGA 3CSTA 2C5LC 4US9A 4WJPA 4L2YA 3UIPB 2KOXA 3ETRA 4MH0E 4YTMB 1JWSD 2K8HA 2BYEA 3GZNB 3R7QA 2ZPNA 4LNKA 1DOIA 2KC2A 3KUCB 4RF0A 2A4ZA 3PREA 4IG7B 4J3OD 4NY0A 1N6ZA 2DAJA 3BK1A 3DBRB 1JROA 4XC2A 5CX3A 2NBVB 1WYWB 2LGDA 3A9KA 3RNAC 1VD2A 1ZPSA 3KWVA 4YT0B 1U4AA 3B9JA 2FIFA 5J2RA 4KX6B 1L4ZB 3DVNU 1WWTA 3ML9A 2HE7A 2KDFB 2O6VD 3Q3FA 5LXIB 1SEBD 1TTNA 1EUVB 5IO9A 3LB8C 1EF1A 1UF0A 2BYTA 3IAM1 1SJED 4KKIA 2KN4A 1V6EA 1WMHA 4KKJA 3O13A 5C2TB 1KH0A 2KQSA 5IA7A 2IJ0A 5EE0A 1I4XA 3V61A 3AE9B 2JUOA 2NMQA 4TQ0A 3ZRFA 2IY0B 3DBLB 4G3XB 2BT6A 1IYFA 4FLHA 3DOWA 4TV3A 2L8JA 2QHOA 4EOYA 2FIDA 2X38A 2FCQA 1VJKA 2MLBA 2O2VA 1XLOA 1Q10A 1UBIA 4EUTA 1HZ5A 1C76A 2MEKA 1D3ZA 1UWXA 2EMSA 2QJLA 1A70A 3ZYYX 3BINA 1QF6A 1JW9D 1PGXA 2LXAA 3VH4B 1M94A 1TBEA 4WIPA 1SSNA 4N59A 3WAOA 4WH4A 5H92C 1FFUA 3P4RB 3KYCD 4L1BA 2BTEA 2LI5A 1T0SC 1V1PB 2D3AA 1QOBA 3ZRCA 3ZDMC 4I6LB 4K3BA 4XDDA 2LGSA 3Q8BA 5G5GA 2WS3B 4RM8A 2JRIB 4LK0M 3N1YC 1SF0A 5E6NA 2IDYA 1N5WA 1DYQA 5T8IA 2RSUA 3SDLC 1K52A 4K1RB 4DXGA 1WRIA 1I4RA 3P4QB 2Q5WD 4WWNA 2L3ZA 4TQ1A 2QMTA 1JWUD 1P9DU 2WHIA 3ZJTA 2IPKD 3VHTC 1C4AA 2IO3B 1UUPA 3BWUD 2MX2A 3AEEB 5CTRC 3NVVA 2L83A 2ZVNA 4BKGA 3L17A 5LXHA 1FM0D 3K9OB 1IGCA 4USAA 1VZ6A 2IYDB 3TMPB 3AU5A 1PFDA 3JYUA 3WCQA 2WXQA 2QEJC 2K1FA 2LFIA 4DHJB 2ICIA 3ZKJC 3AU4A 4KIKB 4F1SA 3R66C 1QILA 3L13A 3UQBA 4URKA 2K25A 3AE1B 4LNOA 3ZTDA 1L5PA 5HG2A 2G4SA 2ZW0A 1CZPA 3NHEB 3IAS1 1V2YA 2M56B 2B3AA 1L6VA 2JZZA 3VUWA 2FUG1 2YVCA 3R2IA 1FRRA 3DHIC 3IHPC 3HIZA 2WXLA 2M17A 2KANA 3I57A 4FJZA 3GE3C 1HZ6A 2HDEA 2C60A 2KQ7A 3BY4B 4LLGM 3DBHB 3L16A 1FXAA 3BYTB 4LNNA 3APCA 2WP9B 2E3TA 3ZIMA 4A20A 3UF8A 3A1QB 2KJ6A 2J0JA 2AL6A 1K50A 1TS5A 5C23A 1JCKB 4US8A 4C4VA 2LHDA 1RLFA 3Q6BA 1KLUD 2RR9A 2HJ8A 4C00A 2KLGA 3E9SA 3IT6B 1ZDVA 3V62A 3ZXVA 2LRWA 2KDBA 3P1MA 4BKSA 2KXJA 4OZAA 1BMLC 4HVBA 5GXGB 5KHQA 3Q8EA 3X0WA 2WNMA 4HPMB 2MP2B 3H7PA 1IGDA 3W1SC 1NENB 3GB1A 3NY5A 5G2NA 1EWYC 3EHVA 1ET6A 5HFYA 4DDGD 2VZKB 4ZHOA 3MTNB 4RM9A 1OFFA 1AW7A 3OWEB 2KT7A 3U30A 2ZCBA 1YX5B 1WR1A 3RPFC 1R4NB 2N9XA 3QQ8B 2WXGA 3KUZA 2DWQA 1OEYA 1E6EB 2CR5A 2GRIA 1HE8A 2L76A 3CF6E 3IT4B 2INPE 3TSSA 1J7CA 2Y3AA 2JT4B 3TEWA 4RMAA 1Y8RC 2G3QB 2LVOA 4IWOA 3B1LX 3I9V1 2BKRB 3HVDA 2E6XA 2KJHB 1TS3A 4XWTA 4W9JA 3MC9A 1XCTL 4NAWA 2RMMA 2EMTA 1EWCA 1C4PA 2BBCA 2AQ2B 2WDVB 2C7NB 2FCSA 4OZCA 3VDZA 4YSZB 4C56C 2K5PA 4PK1A 1F1HA 1BXTA 1VDVA 2QILA 3ML8A 1I42A 1BUIC 1SB3C 2KVRA 2G1EA 1UH6A 4EEWA 5BYSA 2N7DA 2KHWB 4K7SA 1WI0A 1YQ3B 2MA9B 2GBNA 5BMIA 3BK2A 4A3OA 2MBQA 5HHDG 1WGRA 3BIID 3M62B 2D3GA 4YTPB 3MJ5A 4KZ0A 3OJ4B 1IBXB 3W9CB 3APDA 2PE9A 1I4QA 2KWUB 2L1AA 3LDZE 2FBWB 1E7PB 2X8XX 5DPTA 2LGIA 3JVZX 2WQYB 1GC7A 3QCAA 2O6VA 3A4RA 3ZJUA 1EO6A 2Z59B 2KMAA 3DQVA 2KNBA 2KX3A 1V9JA 4HK2A 1JQ4A 4B95A 4JPSA 3V6EB 4HJKA 1ZUD2 3HK0A 3RNBC 5FR6A 1XO3A 2KQ4X 2JYEA 2KFKB 3QHTA 4M0WB 3UINB 3URYA 4JGHB 2K6QA 2LMCA 2XEWA 3A4SC 3HHMA 2L05A 1XQQA 5AUKA 1AN8A 1YMHE 4YSXB 3N20C 1XLPA 3Q3NC 2L00B 2AQ1B 1YN4A 4HDQA 4HJGE 4HRSA 4ZYSA 1JRPA 2BB6A 1E5WA 4OW0A 2DENB 1J7AA 4RGNA 3Q3OC 1S3SG 5FK9C 3IFWB 4BKSD 4MJSA 4GXBA 3BYYB 3W1SA 3ZGZA 1ZOYB 1WIAA 2N9KA 1P7FA 1XEEA 3MHSD 3M3JA 4FBJB 1PGAA 1LFDA 1PUTA 3TCAA 3VUXA 2TSSA 2N1VA 2J42A 1PQSA 3ZVVA 4GDLA 1N60A 3B2GA 1CK1A 4FJVB 3I3TB 5JZEB 3ECIA 1QOAA 3O65B 4GDKB 3W2DA 2CHZA 3PGEA 3DVGY 2J0KA 3QAQA 4OZBA 4S17A 4IWPA 4N6EB 2DX5B 5EDSA 4ZRPA 4S0RA 2N4FA 3VRAB 1R7SA 5BMGA 2JZPA 4KSKC 1GJZA 3AE3B 4JL9A 2BWFA 4XWWA 4PS8A 1HQRD 2L52A 4II3B 2IO0B 3FKYA 4HXDA 3L08A 1GB4A 1KTKA 1FRDA 1ZDXA 1QOGA 2DYOA 3NVYA 3LYYA 1D6EC 3QX1A 1JWAD 5AEKB 1ZW7A 3WA0A 2N7JA 2NPTA 2KYWA 2A5UA 4RF1A 3KYDD 3R8BA 2GMIC 2KWVB 3M95A 2W54A 4KGTA 4EFOA 3K9PB 4W9HA 3RNGC 1T3QA 4NZLB 4TKNA 3RZFA 1WXAA 3RUIB 2FCNA 4TUUA 2M1MA 5J17A 4A3PA 2FNJB 3R2TA 3EECA 1I4PA 1VLBA 4E74A 4OVVA 4IM3A 3R7RA 1MHHE 1Y56A 1E0ZA 2KO3A 3A9KB 3RNFC 3SFEB 2CHXA 4KGRA 2G45B 3T9LA 2ON8A 2MBEA 2C7MB 3V3XA 3NRZA 1WXVA 1PYWD 1WE6A 3VQIA 1GG3A 2DLBA 5E6JA 4R3DA 2KJRA 2V1YA 1AWDA 4FADA 3C19A 3QA8A 3NS1A 2ZW1A 1FEHA 1WJ6A 1WMHB 2BQQA 1N63A 3B0AA 2LJ5A 5BO4B 1L0VB 3N3KB 4N58A 4ZOHC 1WXMA 3P42A 3X23A 1D4BA 1I7HA 5EE3A 4YXDB 3JSVA 5L83A 2DYBA 3BZDB 4F8CB 2MRPA 3U7ZA 4HKQA 4FA6A 2O2VB 3FILA 2AEHA 1X1MA 2CU3A 2IO1B 1WM2A 4MGZE 4P6VF 3ZNGC 4L23A 2INNE 3ZO5B 5E6PA 2PEAA 5D2MB 2L7RA 1F52A 2EKIA 4GLSC 2JXXA 4MH8A 2PE6B 1MVKA 1NVID 3SFDB 2WXOA 1N61A 5DPWA 3KVFB 4LJOB 2BW2A 4WAFA 3ONSA 2BS4B 5IOIA 4LCDE 5AUIA 4W9KA 1KM7A 1E9MA 1Q1OA 3EUB2 1I4HA 1KLGD 5IKCM 1AARA 4GSWA 3DCGA 1PDXA 2MW5A 3VTVA 1TS4A 1UGMA 1SIJA 3DWGC 2RGFA 4ZRJA 3VTWA 3DBSA 3EFCA 2XK5A 5BYQA 1L6UA 2FUHB 3T8MA 2V4IB 4K7WA 4E3CA 1YIWA 1XT9B 5CHWA 1L0XB 2ZEQA 4IUMB 2NS5A 2VH1A 3AE8B 3W1YA 3VUYA 3PZ7A 2LVQA 3AMZA 3NJTA 1V5OA 4B0MA 1ZP0B 4E71A 3OAWA 1EF5A 3NZSA 1PGBA 2FE8A 3Q14C 3ZJVA 2XN9C 2GOWA 1E8XA 2WXKA 4M02A 2I1KA 2EKEC 1YN3A 3TIXA 2J53A 2CS4A 2ZZPB 4WWMA 5HI1A 1GAQB 2ACZB 1SIFA 3QARA 5IP4D 2KN5A 3PO0A 1ACCA 3ZNZB 1ENFA 3EGRA 1ZE3D 2WXJA 4W9GA 3RFZB 4LJPB 3TEYA 2RD0A 3UIOB 3BVZA 1FFVA 4NJ7A 1CMXB 4C7ZA 3PS6A 3PPAA 4PYZA 2DZIA 2GBRA 3J9CA 3TUOA 4FHKA 1WX8A 1YNTE 1AYFA 5LLIA 4DHZE 1RM6C 3I63C 3AXCA 4XE0A 5D3DA 1EU4A 2JWUA 3WANA 2BF8B 3W5VB 2K0PA 2LHEA 3AE2B 4HKZE 4XDCA 3TBLD 4W9CA 1TZ1A 4BZAA 1E7VA 4REZA 2KDEB 1IP9A 1UD7A 2LRUA 4MM3A 1L4DB 3N32A 4RH6A 1TJEA 3PVLA 3VFKA 2MCNB 1NI2A 1XCQL 1E8WA 4YWGG 2KDMA 1KFYB 4IW0A 3CMMB 2HTHA 1YJ1A 2LXCA 2KFJA 4C4VB 2KDIA 4FXCA 1TIFA 2LUMA 2LJIA 4MELA 4ITKA 2LGXA 2IZVB 1WGGA 2LZ6A 3C8YA 1KRHA 2EELA 3RI7C 1WGDA 2R61A 2K8BA 3EC8A 2UU7A 1FNVA 3WALA 1ROEA 2HD5B 4BKTA 2KACA 1D5ZC 2KC1A 4DHZB 1E8YA 2K39A 4AWJA 1YD8U 1KF6B 3H7PB 2BVCA 2IO2B 3AEFB 1WR6E 1WH3A 4IOIE 3N1XC 2K3UA 1D5MC 3Q3JA 4MGIE 4IM2A 4GIVA 3H7SA 4N9F4 5BMHA 3AH7A 1QZEA 2JX5A 1WYGA 3DBRI 2JQRB 3T3NA 2ONQA 4ANXA 2YEPF 5AZGA 4A55A 1WSPA 1KOTA 4CHKA 2CU1A 1DOYA 2KX0A 1V80A 3RCZA 2PW9A 3MJWA 2INCC 3PT2B 2NCNA 1QT9A 1TT5B 4ARCA 5DPRA 3ZDTA 1JRUA 1HTQA 2ZJDA 1YQ4B 2PPHA 4KVGB 2VH2A 4C7YA 3QC8B 4LTUA 4NAWB 3H9DA 2WWZA 3CSFA 2KTRA 3SD5A 2INDC 1C79A 2Y5CA 3RYTA 4NAMA 1KLVA 4CO7A 2M19A 5JHBA 3DBLI 1T0QC 1FO4A 3AEAB 4BAXA 4AJYB 5IAAC 1FCLA 2KMCA 4NJ6A 1P7EA 1GPXA 4PT5A 4B0EA 4C80A 2CJOA 5AZHA 2GI9A 3AN1A 4WQMA 4DHJD 4PS7A 5DCNA 1FCCC 2BGFA 4NPNA 1VCBA 2QSDA 5I4DA 4P16A 2NR2A 1IPGA 2M0AA 1NDDA 1EU3A 2MBBB 4HLEA 4MGKE 1MG4A 2REXA 5DPSA 1V86A 3ZNHB 2K9XA 4AUQC 1ESFA 2O6VB 3A9JA 3HRDD 2H89B 3PRZA 1QQRA 3AI5A 5C1ZA 2N0SB 1E10A 1HXYD 1HA5A 2LEKA 1TY0A 4ASWC 3NVWA 1UBQA 4EKUA 1P98A 2JVCA 3PHWB 4KV2A 2G9HD 2WXNA 3SEBA 1FXIA 2M0XA 2W3SA 3MP9A 1XD3B 4KSLC 4X57B 1FNUA 5D94A 4QAYA 1P3QU 3AE6B 5JH5C 4BBNF 1DGJA 3L54A 3RT3B 2KWCA 4FHJA 3NS8A 5JXVA 2UWQA 2H88B 2MBOA 5EE9A 3IVFA 4AQ7A 4WQOB 4YTNB 1WE7A 2KZRA 2PVGC 1FPYA 1TY2A 4YL8A 1L0YB 2SEBD 2DZKA 5D6JB 1I4GA 3DVGX 2QCZA 4DWFA 4HWIB 1C3TA 5IN7A 1N5XA 4MJSB 4LNFA 3VVWB 1ZGUB 4B9KA 1FNWA 2PVOD 4BOSC 1D5XC 3VTUA 2VRRB 2MWSB 2DZMA 2FAZA 4BBNC 1QKZA 4GDLB 1H8CA 3ALBA 1XLNA 3QWZB 2WXRA 2WX0A 2WU5B 1LM8B 2AX5A 3N9YC 4WAAA 2GB1A 1JALA 3KQ4A 4D2KA 2J4XA 2BS3B 2W3RA 2MSED 4NQKE 3VR8B 3ABVB 4AP4C 5BYRA 4I6PA 5KHOA 1V49A 4IC7B 2WDRB 1LO5D 4PS3A 3FC4A 4DQOC 5L95C 2NBWB 1WY8A 3U8ZA 1VRAB 1JMLA 2RPQA 2L0TA 4CQNA 3BVGA 2NTTA 2V4LA 5MPOA 4XYCA 4B6WA 3HUIA 1T0YA 3QK0A 2FCMA 2J52A 3PZDA 2B76B 4GGQA 2PIAA 2LWPA 1WZ3A 3WIMA 2NBUA 4BOZB 2NPTB 1STEA 3QIJA 3DBHI 3RNEC 2D5GA 1MI0A 2NVUI 2WXPA 3NZUA 4IWQA 2V9HA 2CKHB 2WDQB 2V3PA 3V05A 1C77A 2ASQA 1SGHA 4WJQA 2YLMA 2GLSA 1V8CA 2IY1B 2D11A 2WDTB 4W9FA 1V97A 2ZVOA 5H8YE 3N1ZC 2KK8A 2K22A 2CHWA 4O1NA 2MHJA 1ZXIA 4DDID 3NOBA 3AE4B 1SBBB 3DDCB 3ENEA 4KDIC 3AB5A 1SE9A 1HEZE 2KAJA 3U7DA 3ZUNA 1QLBB 1JWBD 1ET9A 1RYJA 2ZNVB 3SU8X 4ACFA 3OJ3A 3PRPB 2M4NA 3ZLZA 1TKEA 2IBIB 1F2RC 2RDHA 2Z8LA 5EE1A 3WAMA 2QIEB 2XBBC 3NG0A 1GC6A 1OQYA 1XXGA 3U2SC 2JXTA 1OGWA 2W55A 3P2BA 2QDFA 1E90A 2WU2B 1R4NI 1JWMD 1V81A 3RZWC 1SJHD 2AWTA 5CHVC 4LNIA 3ZTCA 5HKHA 1TKGA 4KZCA 4WWOA 2N9PC 1R4MI 1WJNA 3HM3A 2WYQA 3RN9C 3ZQ4A 4GB9A 1ZKHA 5CHFA 3JSVB 1RFAA 1BT0A 1Q5WB 2JWZA 4Q2JA 2J7QB 2KD0A 2L0FA 4W9EA 2M8SA 3SHQA 1E7UA 1TS2A 3FILB 4P1BC 2BKFA 3LJ3A 2DNFA 4LDTD 3D32A 4JQWC 2RDGA 1MJDA 4EZJA 2L32A 3EA6A 1CJEA 3AECB 1F0ZA 1QOFA 3EFUA 5GMVA 1TZOA 3L10B 2MH7A 5J18A 3PHXB 2WGSA 3MFGA 1YOVB 4BFRA 2RPVA 1V1PA 1YX6B 4ZRKA 3VR9B 3AEDB 4G50A 2LD9A 2AYOB 3L0WB 2MJEA 3PV1A 3TEZA 3AEGB 4KGSA 2MJDA 2PKOA 5E6OA 1FXTB 1CQVA 3WAPA 3H1UA 3RNCC 4TSSA 4G0NB 3MHZA 5TSSA 4HPLB 3A33B 2R2QA 2XK5B 4UDUC 2N9EB 4MT5A 1MFWA 2D2QA 3H6NA 2GBJA 2V3SA 2I38A 4ARIA 1FD6A 5D7GA 3Q8FA 4GU2A 4K81A 1M4VA 4ZYNA 2WXFA 2W9NA 3IG3A 2D3BA 4IM0A 4XX5A 1J7BA 4AS1A 1WJUA 1UWMA 2KVZA 4J6IA 3PRMB 4WJNA 4MEMA 4BVUC 3DWMA 4A6QA 4HEA1 1L2NA 1DOXA 2UYZB 4P7IA 2PTLA 2KKCA 4A8XC 3Q3MC 4ANUA 2BS2B 2J0MA 1E8ZA 3PLVA 1J19A 2IGHA 1XLQA 2C7HA 2N1WA 4JIOU 1NYQA 1K51A 1FIQA 1OQQA 2GBKA 3MC0B 2DYMA 1HTOA 4IKGA 4KIKA 4W9DA 1LXDA 4ZHPA 1TKYA 4JE3B 3PSEB 4G11A 5FR3A 4JX1C 2BYVE 1C78A 2Y5PA 2KLCA 1B1ZA 2OJWA 3TJPA 1YN5A 1KJTA 4GOCA 1MG8A 4A90A 2BWES 4GN1A 1VZ8A 5JHAA 2D10A 1RWSA 4ZRIA 4DXFA 1Q0WB 3UQAA 3JW0X 2RDBC 2Y5BB 1WJ4A 4ANVA 4H2AA 1OQRA 1NBFC 3ZNID 1OEYJ 3P63A 1WX9A 2WXHA 2WXMA 4IDIA 1RAXA 2PLPA 4RFBA 3A1QA 4JLCA 2QC8A 2V3NA 1WGYA 4MM3B 1F77A 4DXAB 3APFA 1ZXHA 2JYTA 1I35A 3P4PB 3NUHB 4KDLB 3FAHA 2DZJA 4EE2A 2MBHA 3DHHC 1TYGB 2WXIA 2MJ3A 1FMAD 2AL3A 1WZ0A 2LGYA 3I5JC 3AM9A 3HM6X 4MDKE 3TEXA 1J0GA 4HCPB 1V1OA 1ISNA 2LVPA 3PTFC 1LQBA 3W5UB 3UI3A 4DK5A 2ZCCA 2Z0DB 4WWPA 4F7ZA 2PMVA 1G6JA 2MP2A 4ANWA 3U4EG 4ZDVA 1WGKA 2HTME 1UZXB 2HJ1A 1IUEA 1NYRA 3AEBB 1T6BX 4PYUA 3GZNI 2DHZA 3LXFA 2DBYA 4M01A 3VH3B 1GOZA 3IBEA 4NQLB 1B9RA 4GMVA 4CYEA 3GOEA 3DPDA 3QJZA 1L7YA 4W9IA 2LUEA 1J8CA 2BYFA 4FN2A 4M8NA 4OVUA 3SR6A 2WLBA 2W82A 1K53A 1P0RA 1EM7A 2OEDA 4I6NB 2I1JA 2KTFA 3OG5A 1F9JA 4OVZA 1WF9A 4MSMB 2JF5A 1N62A 2N9LA 4YSYB 2OOBB 2D07B 3RD2A 1GNUA 3AE5B 3DHGC 2OJRA 1R4MB 1T0RC 2JU6X 3KUDB 1K8RB 1TGZB 3H8HA 2Z0EB 1P1AA 2K8CA 3VRBB 4EZLA 4RGMA 3T3OA 3B08A 2KWDA 2KTRB 4MSQB 2OHFA 3Q69A 5AZFA 3MC8A 4AOFA 4EZKA 3IXSA 2PJHA 3R3MA 1MPEA 2JRHA 1SXTA 3V6CB 1RFKA 1IBXA 3M63B 3AULA 3VXWA 3GS2A 3AE7B 3L4PA 3VAWA 3Q2AC 3DVNV 1WGHA 3Q8AA 2XNAC 3U52E 3GP7A 2GBMA 2AQ3B 3UGBB 2ZPYA 2WX1A 2MQJA 1A5RA 1UNSA 2I2YA 3A9JB 4MGYE 2D3CA 3KLSX 3AV8A 4HROA 3RMKC 1Z5SB 3KW5B 3PZ8A 3N30A 4W9LA 3NZ3A 2JSVX 3ZW3A 3NVZA 3KWLA 2IGDA 2KFKA 3V60A 4M0WA 2ZNVC 1UELA 5G5HA 4XGAB 3P4SB 4ICUA 2JY6A 4RGTA 2BPSA 3RULA 1C1YB 2G4DB 4OHJA 4K3CA 1C9FA 1LGRA 2JPHA 1WM3A 4HCNB 1C4CA 2DAFA 2JZ3B 5C3JB 3ZXRA 1YQBA 1V5TA 4HDOA 1GUAB 1VR9A 1T5XD 4NJCA 5LNK1 1RRBA 1YJJA 1MHXA 3C0RB 1WX7A 1WXSA 1H4RA 4NNJB 3TL5A 4LDTB 3HVZA 3KH0A 1XF5L
chains in the Genus database with same CATH topology
2WXJA 4A9AA 4ZRQA 3RFZB 2QIEB 3TEYA 1SE3A 3I9V1 3BVZA 3U2SC 1XXGA 1FFVA 2JXTA 1NI3A 2W55A 3HVDA 2E6XA 1VZ7A 2WU2B 4C7ZA 3CWIA 5FKAC 1JWMD 1TS3A 1SJHD 3J9CA 3TUOA 1YJIA 4XWTA 1XCTL 1YNTE 1AYFA 2RMMA 1TKGA 2VZKD 1RM6C 4RNAA 1EWCA 4JWSC 1C4PA 2BBCA 2BB5A 4XE0A 2AQ2B 2NTSA 5D3DA 3ZQ4A 1EU4A 2WDVB 2JWUA 2V0GA 4OZCA 4YSZB 4MACA 4C56C 2K5PA 3BVMA 5D3IB 3W5VB 4WURA 1BXTA 1GB1A 2K0PA 1SE4A 2LHEA 3AE2B 4HKZE 4Q2JA 1VDVA 2QILA 4XDCA 1BUIC 1SB3C 2G1EA 4RCOA 1TS2A 1WXQA 4RGOS 3FILB 5BYSA 2RDGA 4REZA 1YQ3B 4TMAB 2L32A 5BMIA 3B2FA 3BK2A 3CIRB 3EA6A 1CJEA 3AECB 5HHDG 3BIID 1F0ZA 1SE2A 4YTPB 3MJ5A 1L4DB 1QOFA 3W9CB 1F2RI 4RH6A 1NEKB 1TJEA 1TZOA 3Q8CA 1IBXB 1I4QA 2MH7A 2CJNA 3E56A 4JWUC 1UGJA 2L1AA 2FBWB 1XCQL 2SAKA 3MFGA 1E7PB 4YWGG 2KDMA 2LGIA 1KFYB 2WQYB 2IGGA 2RPVA 2YEPB 1V1PA 3VR9B 2KMMA 4FXCA 3AEDB 4US9A 3ZJUA 2LUMA 4L2YA 2LJIA 4ITKA 2MJEA 3TEZA 3AEGB 3ETRA 4KGSA 4YTMB 2MJDA 1JWSD 2PKOA 1JQ4A 3C8YA 4JPSA 1CQVA 1KRHA 2EELA 1DOIA 1ZUD2 2R61A 4RF0A 4TSSA 1FNVA 1ROEA 3MHZA 5TSSA 2KACA 1D5ZC 4J3OD 1XO3A 2KQ4X 3BK1A 2JYEA 4UDUC 1JROA 1KF6B 4MT5A 3AEFB 3URYA 2LMCA 5AUKA 4IOIE 2I38A 4ARIA 1AN8A 1FD6A 5D7GA 3Q8FA 1YMHE 2K3UA 4YSXB 1XLPA 1D5MC 2AQ1B 1YN4A 1M4VA 1ZPSA 3KWVA 4YT0B 2WXFA 3B9JA 4HJGE 4HRSA 4KX6B 4ZYSA 1JRPA 2BB6A 1L4ZB 1J7BA 5BMHA 3AH7A 2JX5A 1WWTA 1WYGA 4AS1A 4OW0A 2JQRB 1UWMA 3T3NA 2ONQA 1J7AA 3DWMA 4A6QA 2YEPF 4HEA1 4RGNA 1DOXA 5FK9C 4A55A 1SEBD 1WSPA 2PTLA 3BYYB 3LB8C 3W1SA 4A8XC 3ZGZA 1ZOYB 2BS2B 1DOYA 2N9KA 2IGHA 1P7FA 1XLQA 1XEEA 2BYTA 3IAM1 1NYQA 2PW9A 1K51A 1FIQA 1OQQA 1PGAA 1SJED 4KKIA 2KN4A 1PUTA 3MC0B 4KKJA 2DYMA 4IKGA 2TSSA 1QT9A 3O13A 5C2TB 1KH0A 4ZHPA 1TKYA 2J42A 4ARCA 2IJ0A 1N60A 3B2GA 4JE3B 1CK1A 5EE0A 1I4XA 3AE9B 5FR3A 4JX1C 2NMQA 4TQ0A 1C78A 1YQ4B 2Y5PA 1B1ZA 1QOAA 4GDKB 3W2DA 2BT6A 1YN5A 4C7YA 4LTUA 4NAWB 4A90A 4OZBA 1VZ8A 4N6EB 1C79A 4ZRPA 2X38A 2Y5CA 1VJKA 1RWSA 3VRAB 4NAMA 1R7SA 5BMGA 2JZPA 1XLOA 1Q10A 3AE3B 4DXFA 2M19A 4XWWA 1HZ5A 1HQRD 1FO4A 2L52A 3AEAB 4H2AA 1OQRA 1C76A 2MEKA 1FCLA 1UWXA 3P63A 2QJLA 1P7EA 1A70A 2WXMA 2WXHA 3ZYYX 1GPXA 4PT5A 4IDIA 4B0EA 1QF6A 2PLPA 4C80A 2CJOA 4RFBA 1GB4A 2GI9A 2V3NA 3AN1A 1KTKA 1JW9D 1F77A 1FRDA 4MM3B 4WQMA 1PGXA 1ZDXA 1FCCC 1QOGA 1ZXHA 2QSDA 2JYTA 4WIPA 2DYOA 3NVYA 3LYYA 5I4DA 1SSNA 4N59A 3P4PB 1D6EC 4P16A 3NUHB 1JWAD 2M0AA 4WH4A 3FAHA 1EU3A 1FFUA 5H92C 4EE2A 3P4RB 2N7JA 4L1BA 2BTEA 1TYGB 4RF1A 2WXIA 2MJ3A 1V1PB 3R8BA 1QOBA 1FMAD 2K9XA 1ESFA 3AM9A 3TEXA 2W54A 4KGTA 3HRDD 2H89B 1V1OA 1T3QA 3W5UB 4NZLB 1QQRA 3UI3A 4XDDA 2N0SB 1E10A 3Q8BA 1HXYD 1HA5A 5G5GA 2LEKA 2WS3B 2PMVA 1TY0A 4LK0M 3NVWA 3U4EG 1WGKA 2HTME 1IUEA 1NYRA 3AEBB 1T6BX 1SF0A 2G9HD 1N5WA 2IDYA 1DYQA 1FXIA 2WXNA 3SEBA 5T8IA 2W3SA 3MP9A 3R2TA 1FNUA 3LXFA 1I4PA 2DBYA 1VLBA 1MHHE 1K52A 1GOZA 1Y56A 1E0ZA 3AE6B 4DXGA 1WRIA 1B9RA 1I4RA 3P4QB 2Q5WD 1DGJA 3SFEB 4TQ1A 2QMTA 1JWUD 5JXVA 3ZJTA 2IPKD 4KGRA 2H88B 1C4AA 5EE9A 4AQ7A 2ON8A 4YTNB 1UUPA 3BWUD 3V3XA 3NRZA 1PYWD 2PVGC 3SR6A 3VQIA 2WLBA 1TY2A 2DLBA 2W82A 5E6JA 1K53A 1EM7A 3AEEB 2OEDA 4R3DA 1L0YB 2SEBD 2L83A 3NVVA 1I4GA 1FM0D 1AWDA 1IGCA 4USAA 1VZ6A 1N5XA 4OVZA 1N62A 1PFDA 2N9LA 4YSYB 3NS1A 2ZW1A 1FEHA 1FNWA 2PVOD 3WCQA 2WXQA 1D5XC 2QEJC 3AE5B 2LFIA 2ICIA 1N63A 1QKZA 2JU6X 4GDLB 1QILA 3H8HA 1L0VB 1XLNA 4N58A 3AE1B 4ZOHC 3P42A 2WXRA 1D4BA 1I7HA 1L5PA 5HG2A 2ZW0A 1CZPA 5EE3A 3IAS1 4YXDB 2WU5B 3VRBB 3N9YC 2AX5A 4RGMA 2M56B 3T3OA 3BZDB 2GB1A 1JALA 3KQ4A 1L6VA 4D2KA 2J4XA 2KWDA 2FUG1 2BS3B 3U7ZA 2W3RA 4HKQA 2OHFA 3Q69A 3R2IA 1FRRA 3IXSA 3VR8B 3ABVB 3FILA 2CU3A 5BYRA 2WXLA 4P6VF 4L23A 1MPEA 2INNE 2WDRB 3I57A 1HZ6A 2HDEA 1LO5D 3FC4A 4DQOC 1SXTA 3TEWA 2EKIA 4GLSC 4LLGM 4MH8A 1RFKA 1IBXA 1FXAA 3BYTB 1VRAB 2WP9B 3GS2A 1JMLA 1MVKA 2E3TA 3AE7B 1NVID 3SFDB 2WXOA 1N61A 3L4PA 4CQNA 3BVGA 2NTTA 5MPOA 2BW2A 3HUIA 1K50A 2J52A 4WAFA 2B76B 1TS5A 1JCKB 2PIAA 4US8A 2BS4B 5AUIA 1E9MA 3Q8AA 2LHDA 2XNAC 3EUB2 3GP7A 3U52E 1STEA 1I4HA 2AQ3B 1KLGD 1KLUD 1UNSA 2I2YA 3E9SA 3IT6B 1ZDVA 2D5GA 1MI0A 3P1MA 2WXPA 1PDXA 3KLSX 3AV8A 4HROA 4OZAA 2WDQB 1BMLC 1TS4A 3PZ8A 2V3PA 1SIJA 1C77A 2JSVX 3NZ3A 3DWGC 3V05A 5GXGB 3NVZA 3Q8EA 3KWLA 1V8CA 2IGDA 2WNMA 5BYQA 1IGDA 1L6UA 4M0WA 1NENB 2V4IB 5G5HA 1V97A 5H8YE 3P4SB 2K22A 3GB1A 1EWYC 4O1NA 1L0XB 4RGTA 1ZXIA 4OHJA 3AE8B 1C9FA 3AE4B 1ET6A 5HFYA 3PZ7A 1C4CA 3AMZA 5C3JB 1SBBB 4B0MA 1ZP0B 2VZKB 4ZHOA 1PGBA 2FE8A 3AB5A 1OFFA 1AW7A 3OWEB 3ZJVA 1HEZE 2KAJA 2XN9C 2WXKA 1VR9A 1T5XD 4NJCA 5LNK1 1QLBB 1JWBD 1ET9A 3RPFC 1YJJA 1MHXA 1RYJA 2WXGA 1YN3A 2DWQA 2J53A 4WWMA 1E6EB 2GRIA 5HI1A 1GAQB 1TKEA 2ACZB 1F2RC 3IT4B 2INPE 3TSSA 3PO0A 2RDHA 1ACCA 1XF5L 2Z8LA 1ENFA 3HVZA 1J7CA 3EGRA 2Y3AA 1ZE3D 5EE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZ7 A;  2D5G A;  3PZ8 A;  1WSP A;  4WIP A; 
#chains in the Genus database with same CATH topology
 4A9A A;  4ZRQ A;  4FJY A;  1SE3 A;  1OTR B;  1NI3 A;  1WFY A;  5TR5 A;  3GE8 C;  4FUL A;  1VZ7 A;  3CWI A;  5FKA C;  4M8M A;  1YJI A;  4GDK A;  4II2 B;  2VZK D;  4RNA A;  4JWS C;  2BB5 A;  4M00 A;  4AJW A;  3S2A A;  2NTS A;  2V0G A;  4MAC A;  3BVM A;  5D3I B;  4WUR A;  2R2O A;  1GB1 A;  1SE4 A;  3OLM D;  4ICV A;  2C9W B;  4RCO A;  1WXQ A;  4RGO S;  1S1Q B;  4XZ4 A;  4HPP A;  3PLU A;  4K7U A;  1Z2M A;  4TMA B;  3B2F A;  3CIR B;  4P1C C;  2K6D B;  1SE2 A;  1F2R I;  1NEK B;  3Q8C A;  5G55 A;  2CJN A;  2LAS A;  3E56 A;  4JWU C;  1UGJ A;  2SAK A;  4WJO A;  2N7E A;  2IGG A;  2YEP B;  1WRD B;  2KMM A;  4DBG A;  3CST A;  2C5L C;  4US9 A;  4WJP A;  4L2Y A;  3UIP B;  2KOX A;  3ETR A;  4MH0 E;  4YTM B;  1JWS D;  2K8H A;  2BYE A;  3GZN B;  3R7Q A;  2ZPN A;  4LNK A;  1DOI A;  2KC2 A;  3KUC B;  4RF0 A;  2A4Z A;  3PRE A;  4IG7 B;  4J3O D;  4NY0 A;  1N6Z A;  2DAJ A;  3BK1 A;  3DBR B;  1JRO A;  4XC2 A;  5CX3 A;  2NBV B;  1WYW B;  2LGD A;  3A9K A;  3RNA C;  1VD2 A;  1ZPS A;  3KWV A;  4YT0 B;  1U4A A;  3B9J A;  2FIF A;  5J2R A;  4KX6 B;  1L4Z B;  3DVN U;  1WWT A;  3ML9 A;  2HE7 A;  2KDF B;  2O6V D;  3Q3F A;  5LXI B;  1SEB D;  1TTN A;  1EUV B;  5IO9 A;  3LB8 C;  1EF1 A;  1UF0 A;  2BYT A;  3IAM 1;  1SJE D;  4KKI A;  2KN4 A;  1V6E A;  1WMH A;  4KKJ A;  3O13 A;  5C2T B;  1KH0 A;  2KQS A;  5IA7 A;  2IJ0 A;  5EE0 A;  1I4X A;  3V61 A;  3AE9 B;  2JUO A;  2NMQ A;  4TQ0 A;  3ZRF A;  2IY0 B;  3DBL B;  4G3X B;  2BT6 A;  1IYF A;  4FLH A;  3DOW A;  4TV3 A;  2L8J A;  2QHO A;  4EOY A;  2FID A;  2X38 A;  2FCQ A;  1VJK A;  2MLB A;  2O2V A;  1XLO A;  1Q10 A;  1UBI A;  4EUT A;  1HZ5 A;  1C76 A;  2MEK A;  1D3Z A;  1UWX A;  2EMS A;  2QJL A;  1A70 A;  3ZYY X;  3BIN A;  1QF6 A;  1JW9 D;  1PGX A;  2LXA A;  3VH4 B;  1M94 A;  1TBE A;  4WIP A;  1SSN A;  4N59 A;  3WAO A;  4WH4 A;  5H92 C;  1FFU A;  3P4R B;  3KYC D;  4L1B A;  2BTE A;  2LI5 A;  1T0S C;  1V1P B;  2D3A A;  1QOB A;  3ZRC A;  3ZDM C;  4I6L B;  4K3B A;  4XDD A;  2LGS A;  3Q8B A;  5G5G A;  2WS3 B;  4RM8 A;  2JRI B;  4LK0 M;  3N1Y C;  1SF0 A;  5E6N A;  2IDY A;  1N5W A;  1DYQ A;  5T8I A;  2RSU A;  3SDL C;  1K52 A;  4K1R B;  4DXG A;  1WRI A;  1I4R A;  3P4Q B;  2Q5W D;  4WWN A;  2L3Z A;  4TQ1 A;  2QMT A;  1JWU D;  1P9D U;  2WHI A;  3ZJT A;  2IPK D;  3VHT C;  1C4A A;  2IO3 B;  1UUP A;  3BWU D;  2MX2 A;  3AEE B;  5CTR C;  3NVV A;  2L83 A;  2ZVN A;  4BKG A;  3L17 A;  5LXH A;  1FM0 D;  3K9O B;  1IGC A;  4USA A;  1VZ6 A;  2IYD B;  3TMP B;  3AU5 A;  1PFD A;  3JYU A;  3WCQ A;  2WXQ A;  2QEJ C;  2K1F A;  2LFI A;  4DHJ B;  2ICI A;  3ZKJ C;  3AU4 A;  4KIK B;  4F1S A;  3R66 C;  1QIL A;  3L13 A;  3UQB A;  4URK A;  2K25 A;  3AE1 B;  4LNO A;  3ZTD A;  1L5P A;  5HG2 A;  2G4S A;  2ZW0 A;  1CZP A;  3NHE B;  3IAS 1;  1V2Y A;  2M56 B;  2B3A A;  1L6V A;  2JZZ A;  3VUW A;  2FUG 1;  2YVC A;  3R2I A;  1FRR A;  3DHI C;  3IHP C;  3HIZ A;  2WXL A;  2M17 A;  2KAN A;  3I57 A;  4FJZ A;  3GE3 C;  1HZ6 A;  2HDE A;  2C60 A;  2KQ7 A;  3BY4 B;  4LLG M;  3DBH B;  3L16 A;  1FXA A;  3BYT B;  4LNN A;  3APC A;  2WP9 B;  2E3T A;  3ZIM A;  4A20 A;  3UF8 A;  3A1Q B;  2KJ6 A;  2J0J A;  2AL6 A;  1K50 A;  1TS5 A;  5C23 A;  1JCK B;  4US8 A;  4C4V A;  2LHD A;  1RLF A;  3Q6B A;  1KLU D;  2RR9 A;  2HJ8 A;  4C00 A;  2KLG A;  3E9S A;  3IT6 B;  1ZDV A;  3V62 A;  3ZXV A;  2LRW A;  2KDB A;  3P1M A;  4BKS A;  2KXJ A;  4OZA A;  1BML C;  4HVB A;  5GXG B;  5KHQ A;  3Q8E A;  3X0W A;  2WNM A;  4HPM B;  2MP2 B;  3H7P A;  1IGD A;  3W1S C;  1NEN B;  3GB1 A;  3NY5 A;  5G2N A;  1EWY C;  3EHV A;  1ET6 A;  5HFY A;  4DDG D;  2VZK B;  4ZHO A;  3MTN B;  4RM9 A;  1OFF A;  1AW7 A;  3OWE B;  2KT7 A;  3U30 A;  2ZCB A;  1YX5 B;  1WR1 A;  3RPF C;  1R4N B;  2N9X A;  3QQ8 B;  2WXG A;  3KUZ A;  2DWQ A;  1OEY A;  1E6E B;  2CR5 A;  2GRI A;  1HE8 A;  2L76 A;  3CF6 E;  3IT4 B;  2INP E;  3TSS A;  1J7C A;  2Y3A A;  2JT4 B;  3TEW A;  4RMA A;  1Y8R C;  2G3Q B;  2LVO A;  4IWO A;  3B1L X;  3I9V 1;  2BKR B;  3HVD A;  2E6X A;  2KJH B;  1TS3 A;  4XWT A;  4W9J A;  3MC9 A;  1XCT L;  4NAW A;  2RMM A;  2EMT A;  1EWC A;  1C4P A;  2BBC A;  2AQ2 B;  2WDV B;  2C7N B;  2FCS A;  4OZC A;  3VDZ A;  4YSZ B;  4C56 C;  2K5P A;  4PK1 A;  1F1H A;  1BXT A;  1VDV A;  2QIL A;  3ML8 A;  1I42 A;  1BUI C;  1SB3 C;  2KVR A;  2G1E A;  1UH6 A;  4EEW A;  5BYS A;  2N7D A;  2KHW B;  4K7S A;  1WI0 A;  1YQ3 B;  2MA9 B;  2GBN A;  5BMI A;  3BK2 A;  4A3O A;  2MBQ A;  5HHD G;  1WGR A;  3BII D;  3M62 B;  2D3G A;  4YTP B;  3MJ5 A;  4KZ0 A;  3OJ4 B;  1IBX B;  3W9C B;  3APD A;  2PE9 A;  1I4Q A;  2KWU B;  2L1A A;  3LDZ E;  2FBW B;  1E7P B;  2X8X X;  5DPT A;  2LGI A;  3JVZ X;  2WQY B;  1GC7 A;  3QCA A;  2O6V A;  3A4R A;  3ZJU A;  1EO6 A;  2Z59 B;  2KMA A;  3DQV A;  2KNB A;  2KX3 A;  1V9J A;  4HK2 A;  1JQ4 A;  4B95 A;  4JPS A;  3V6E B;  4HJK A;  1ZUD 2;  3HK0 A;  3RNB C;  5FR6 A;  1XO3 A;  2KQ4 X;  2JYE A;  2KFK B;  3QHT A;  4M0W B;  3UIN B;  3URY A;  4JGH B;  2K6Q A;  2LMC A;  2XEW A;  3A4S C;  3HHM A;  2L05 A;  1XQQ A;  5AUK A;  1AN8 A;  1YMH E;  4YSX B;  3N20 C;  1XLP A;  3Q3N C;  2L00 B;  2AQ1 B;  1YN4 A;  4HDQ A;  4HJG E;  4HRS A;  4ZYS A;  1JRP A;  2BB6 A;  1E5W A;  4OW0 A;  2DEN B;  1J7A A;  4RGN A;  3Q3O C;  1S3S G;  5FK9 C;  3IFW B;  4BKS D;  4MJS A;  4GXB A;  3BYY B;  3W1S A;  3ZGZ A;  1ZOY B;  1WIA A;  2N9K A;  1P7F A;  1XEE A;  3MHS D;  3M3J A;  4FBJ B;  1PGA A;  1LFD A;  1PUT A;  3TCA A;  3VUX A;  2TSS A;  2N1V A;  2J42 A;  1PQS A;  3ZVV A;  4GDL A;  1N60 A;  3B2G A;  1CK1 A;  4FJV B;  3I3T B;  5JZE B;  3ECI A;  1QOA A;  3O65 B;  4GDK B;  3W2D A;  2CHZ A;  3PGE A;  3DVG Y;  2J0K A;  3QAQ A;  4OZB A;  4S17 A;  4IWP A;  4N6E B;  2DX5 B;  5EDS A;  4ZRP A;  4S0R A;  2N4F A;  3VRA B;  1R7S A;  5BMG A;  2JZP A;  4KSK C;  1GJZ A;  3AE3 B;  4JL9 A;  2BWF A;  4XWW A;  4PS8 A;  1HQR D;  2L52 A;  4II3 B;  2IO0 B;  3FKY A;  4HXD A;  3L08 A;  1GB4 A;  1KTK A;  1FRD A;  1ZDX A;  1QOG A;  2DYO A;  3NVY A;  3LYY A;  1D6E C;  3QX1 A;  1JWA D;  5AEK B;  1ZW7 A;  3WA0 A;  2N7J A;  2NPT A;  2KYW A;  2A5U A;  4RF1 A;  3KYD D;  3R8B A;  2GMI C;  2KWV B;  3M95 A;  2W54 A;  4KGT A;  4EFO A;  3K9P B;  4W9H A;  3RNG C;  1T3Q A;  4NZL B;  4TKN A;  3RZF A;  1WXA A;  3RUI B;  2FCN A;  4TUU A;  2M1M A;  5J17 A;  4A3P A;  2FNJ B;  3R2T A;  3EEC A;  1I4P A;  1VLB A;  4E74 A;  4OVV A;  4IM3 A;  3R7R A;  1MHH E;  1Y56 A;  1E0Z A;  2KO3 A;  3A9K B;  3RNF C;  3SFE B;  2CHX A;  4KGR A;  2G45 B;  3T9L A;  2ON8 A;  2MBE A;  2C7M B;  3V3X A;  3NRZ A;  1WXV A;  1PYW D;  1WE6 A;  3VQI A;  1GG3 A;  2DLB A;  5E6J A;  4R3D A;  2KJR A;  2V1Y A;  1AWD A;  4FAD A;  3C19 A;  3QA8 A;  3NS1 A;  2ZW1 A;  1FEH A;  1WJ6 A;  1WMH B;  2BQQ A;  1N63 A;  3B0A A;  2LJ5 A;  5BO4 B;  1L0V B;  3N3K B;  4N58 A;  4ZOH C;  1WXM A;  3P42 A;  3X23 A;  1D4B A;  1I7H A;  5EE3 A;  4YXD B;  3JSV A;  5L83 A;  2DYB A;  3BZD B;  4F8C B;  2MRP A;  3U7Z A;  4HKQ A;  4FA6 A;  2O2V B;  3FIL A;  2AEH A;  1X1M A;  2CU3 A;  2IO1 B;  1WM2 A;  4MGZ E;  4P6V F;  3ZNG C;  4L23 A;  2INN E;  3ZO5 B;  5E6P A;  2PEA A;  5D2M B;  2L7R A;  1F52 A;  2EKI A;  4GLS C;  2JXX A;  4MH8 A;  2PE6 B;  1MVK A;  1NVI D;  3SFD B;  2WXO A;  1N61 A;  5DPW A;  3KVF B;  4LJO B;  2BW2 A;  4WAF A;  3ONS A;  2BS4 B;  5IOI A;  4LCD E;  5AUI A;  4W9K A;  1KM7 A;  1E9M A;  1Q1O A;  3EUB 2;  1I4H A;  1KLG D;  5IKC M;  1AAR A;  4GSW A;  3DCG A;  1PDX A;  2MW5 A;  3VTV A;  1TS4 A;  1UGM A;  1SIJ A;  3DWG C;  2RGF A;  4ZRJ A;  3VTW A;  3DBS A;  3EFC A;  2XK5 A;  5BYQ A;  1L6U A;  2FUH B;  3T8M A;  2V4I B;  4K7W A;  4E3C A;  1YIW A;  1XT9 B;  5CHW A;  1L0X B;  2ZEQ A;  4IUM B;  2NS5 A;  2VH1 A;  3AE8 B;  3W1Y A;  3VUY A;  3PZ7 A;  2LVQ A;  3AMZ A;  3NJT A;  1V5O A;  4B0M A;  1ZP0 B;  4E71 A;  3OAW A;  1EF5 A;  3NZS A;  1PGB A;  2FE8 A;  3Q14 C;  3ZJV A;  2XN9 C;  2GOW A;  1E8X A;  2WXK A;  4M02 A;  2I1K A;  2EKE C;  1YN3 A;  3TIX A;  2J53 A;  2CS4 A;  2ZZP B;  4WWM A;  5HI1 A;  1GAQ B;  2ACZ B;  1SIF A;  3QAR A;  5IP4 D;  2KN5 A;  3PO0 A;  1ACC A;  3ZNZ B;  1ENF A;  3EGR A;  1ZE3 D;  2WXJ A;  4W9G A;  3RFZ B;  4LJP B;  3TEY A;  2RD0 A;  3UIO B;  3BVZ A;  1FFV A;  4NJ7 A;  1CMX B;  4C7Z A;  3PS6 A;  3PPA A;  4PYZ A;  2DZI A;  2GBR A;  3J9C A;  3TUO A;  4FHK A;  1WX8 A;  1YNT E;  1AYF A;  5LLI A;  4DHZ E;  1RM6 C;  3I63 C;  3AXC A;  4XE0 A;  5D3D A;  1EU4 A;  2JWU A;  3WAN A;  2BF8 B;  3W5V B;  2K0P A;  2LHE A;  3AE2 B;  4HKZ E;  4XDC A;  3TBL D;  4W9C A;  1TZ1 A;  4BZA A;  1E7V A;  4REZ A;  2KDE B;  1IP9 A;  1UD7 A;  2LRU A;  4MM3 A;  1L4D B;  3N32 A;  4RH6 A;  1TJE A;  3PVL A;  3VFK A;  2MCN B;  1NI2 A;  1XCQ L;  1E8W A;  4YWG G;  2KDM A;  1KFY B;  4IW0 A;  3CMM B;  2HTH A;  1YJ1 A;  2LXC A;  2KFJ A;  4C4V B;  2KDI A;  4FXC A;  1TIF A;  2LUM A;  2LJI A;  4MEL A;  4ITK A;  2LGX A;  2IZV B;  1WGG A;  2LZ6 A;  3C8Y A;  1KRH A;  2EEL A;  3RI7 C;  1WGD A;  2R61 A;  2K8B A;  3EC8 A;  2UU7 A;  1FNV A;  3WAL A;  1ROE A;  2HD5 B;  4BKT A;  2KAC A;  1D5Z C;  2KC1 A;  4DHZ B;  1E8Y A;  2K39 A;  4AWJ A;  1YD8 U;  1KF6 B;  3H7P B;  2BVC A;  2IO2 B;  3AEF B;  1WR6 E;  1WH3 A;  4IOI E;  3N1X C;  2K3U A;  1D5M C;  3Q3J A;  4MGI E;  4IM2 A;  4GIV A;  3H7S A;  4N9F 4;  5BMH A;  3AH7 A;  1QZE A;  2JX5 A;  1WYG A;  3DBR I;  2JQR B;  3T3N A;  2ONQ A;  4ANX A;  2YEP F;  5AZG A;  4A55 A;  1WSP A;  1KOT A;  4CHK A;  2CU1 A;  1DOY A;  2KX0 A;  1V80 A;  3RCZ A;  2PW9 A;  3MJW A;  2INC C;  3PT2 B;  2NCN A;  1QT9 A;  1TT5 B;  4ARC A;  5DPR A;  3ZDT A;  1JRU A;  1HTQ A;  2ZJD A;  1YQ4 B;  2PPH A;  4KVG B;  2VH2 A;  4C7Y A;  3QC8 B;  4LTU A;  4NAW B;  3H9D A;  2WWZ A;  3CSF A;  2KTR A;  3SD5 A;  2IND C;  1C79 A;  2Y5C A;  3RYT A;  4NAM A;  1KLV A;  4CO7 A;  2M19 A;  5JHB A;  3DBL I;  1T0Q C;  1FO4 A;  3AEA B;  4BAX A;  4AJY B;  5IAA C;  1FCL A;  2KMC A;  4NJ6 A;  1P7E A;  1GPX A;  4PT5 A;  4B0E A;  4C80 A;  2CJO A;  5AZH A;  2GI9 A;  3AN1 A;  4WQM A;  4DHJ D;  4PS7 A;  5DCN A;  1FCC C;  2BGF A;  4NPN A;  1VCB A;  2QSD A;  5I4D A;  4P16 A;  2NR2 A;  1IPG A;  2M0A A;  1NDD A;  1EU3 A;  2MBB B;  4HLE A;  4MGK E;  1MG4 A;  2REX A;  5DPS A;  1V86 A;  3ZNH B;  2K9X A;  4AUQ C;  1ESF A;  2O6V B;  3A9J A;  3HRD D;  2H89 B;  3PRZ A;  1QQR A;  3AI5 A;  5C1Z A;  2N0S B;  1E10 A;  1HXY D;  1HA5 A;  2LEK A;  1TY0 A;  4ASW C;  3NVW A;  1UBQ A;  4EKU A;  1P98 A;  2JVC A;  3PHW B;  4KV2 A;  2G9H D;  2WXN A;  3SEB A;  1FXI A;  2M0X A;  2W3S A;  3MP9 A;  1XD3 B;  4KSL C;  4X57 B;  1FNU A;  5D94 A;  4QAY A;  1P3Q U;  3AE6 B;  5JH5 C;  4BBN F;  1DGJ A;  3L54 A;  3RT3 B;  2KWC A;  4FHJ A;  3NS8 A;  5JXV A;  2UWQ A;  2H88 B;  2MBO A;  5EE9 A;  3IVF A;  4AQ7 A;  4WQO B;  4YTN B;  1WE7 A;  2KZR A;  2PVG C;  1FPY A;  1TY2 A;  4YL8 A;  1L0Y B;  2SEB D;  2DZK A;  5D6J B;  1I4G A;  3DVG X;  2QCZ A;  4DWF A;  4HWI B;  1C3T A;  5IN7 A;  1N5X A;  4MJS B;  4LNF A;  3VVW B;  1ZGU B;  4B9K A;  1FNW A;  2PVO D;  4BOS C;  1D5X C;  3VTU A;  2VRR B;  2MWS B;  2DZM A;  2FAZ A;  4BBN C;  1QKZ A;  4GDL B;  1H8C A;  3ALB A;  1XLN A;  3QWZ B;  2WXR A;  2WX0 A;  2WU5 B;  1LM8 B;  2AX5 A;  3N9Y C;  4WAA A;  2GB1 A;  1JAL A;  3KQ4 A;  4D2K A;  2J4X A;  2BS3 B;  2W3R A;  2MSE D;  4NQK E;  3VR8 B;  3ABV B;  4AP4 C;  5BYR A;  4I6P A;  5KHO A;  1V49 A;  4IC7 B;  2WDR B;  1LO5 D;  4PS3 A;  3FC4 A;  4DQO C;  5L95 C;  2NBW B;  1WY8 A;  3U8Z A;  1VRA B;  1JML A;  2RPQ A;  2L0T A;  4CQN A;  3BVG A;  2NTT A;  2V4L A;  5MPO A;  4XYC A;  4B6W A;  3HUI A;  1T0Y A;  3QK0 A;  2FCM A;  2J52 A;  3PZD A;  2B76 B;  4GGQ A;  2PIA A;  2LWP A;  1WZ3 A;  3WIM A;  2NBU A;  4BOZ B;  2NPT B;  1STE A;  3QIJ A;  3DBH I;  3RNE C;  2D5G A;  1MI0 A;  2NVU I;  2WXP A;  3NZU A;  4IWQ A;  2V9H A;  2CKH B;  2WDQ B;  2V3P A;  3V05 A;  1C77 A;  2ASQ A;  1SGH A;  4WJQ A;  2YLM A;  2GLS A;  1V8C A;  2IY1 B;  2D11 A;  2WDT B;  4W9F A;  1V97 A;  2ZVO A;  5H8Y E;  3N1Z C;  2KK8 A;  2K22 A;  2CHW A;  4O1N A;  2MHJ A;  1ZXI A;  4DDI D;  3NOB A;  3AE4 B;  1SBB B;  3DDC B;  3ENE A;  4KDI C;  3AB5 A;  1SE9 A;  1HEZ E;  2KAJ A;  3U7D A;  3ZUN A;  1QLB B;  1JWB D;  1ET9 A;  1RYJ A;  2ZNV B;  3SU8 X;  4ACF A;  3OJ3 A;  3PRP B;  2M4N A;  3ZLZ A;  1TKE A;  2IBI B;  1F2R C;  2RDH A;  2Z8L A;  5EE1 A;  3WAM A;  2QIE B;  2XBB C;  3NG0 A;  1GC6 A;  1OQY A;  1XXG A;  3U2S C;  2JXT A;  1OGW A;  2W55 A;  3P2B A;  2QDF A;  1E90 A;  2WU2 B;  1R4N I;  1JWM D;  1V81 A;  3RZW C;  1SJH D;  2AWT A;  5CHV C;  4LNI A;  3ZTC A;  5HKH A;  1TKG A;  4KZC A;  4WWO A;  2N9P C;  1R4M I;  1WJN A;  3HM3 A;  2WYQ A;  3RN9 C;  3ZQ4 A;  4GB9 A;  1ZKH A;  5CHF A;  3JSV B;  1RFA A;  1BT0 A;  1Q5W B;  2JWZ A;  4Q2J A;  2J7Q B;  2KD0 A;  2L0F A;  4W9E A;  2M8S A;  3SHQ A;  1E7U A;  1TS2 A;  3FIL B;  4P1B C;  2BKF A;  3LJ3 A;  2DNF A;  4LDT D;  3D32 A;  4JQW C;  2RDG A;  1MJD A;  4EZJ A;  2L32 A;  3EA6 A;  1CJE A;  3AEC B;  1F0Z A;  1QOF A;  3EFU A;  5GMV A;  1TZO A;  3L10 B;  2MH7 A;  5J18 A;  3PHX B;  2WGS A;  3MFG A;  1YOV B;  4BFR A;  2RPV A;  1V1P A;  1YX6 B;  4ZRK A;  3VR9 B;  3AED B;  4G50 A;  2LD9 A;  2AYO B;  3L0W B;  2MJE A;  3PV1 A;  3TEZ A;  3AEG B;  4KGS A;  2MJD A;  2PKO A;  5E6O A;  1FXT B;  1CQV A;  3WAP A;  3H1U A;  3RNC C;  4TSS A;  4G0N B;  3MHZ A;  5TSS A;  4HPL B;  3A33 B;  2R2Q A;  2XK5 B;  4UDU C;  2N9E B;  4MT5 A;  1MFW A;  2D2Q A;  3H6N A;  2GBJ A;  2V3S A;  2I38 A;  4ARI A;  1FD6 A;  5D7G A;  3Q8F A;  4GU2 A;  4K81 A;  1M4V A;  4ZYN A;  2WXF A;  2W9N A;  3IG3 A;  2D3B A;  4IM0 A;  4XX5 A;  1J7B A;  4AS1 A;  1WJU A;  1UWM A;  2KVZ A;  4J6I A;  3PRM B;  4WJN A;  4MEM A;  4BVU C;  3DWM A;  4A6Q A;  4HEA 1;  1L2N A;  1DOX A;  2UYZ B;  4P7I A;  2PTL A;  2KKC A;  4A8X C;  3Q3M C;  4ANU A;  2BS2 B;  2J0M A;  1E8Z A;  3PLV A;  1J19 A;  2IGH A;  1XLQ A;  2C7H A;  2N1W A;  4JIO U;  1NYQ A;  1K51 A;  1FIQ A;  1OQQ A;  2GBK A;  3MC0 B;  2DYM A;  1HTO A;  4IKG A;  4KIK A;  4W9D A;  1LXD A;  4ZHP A;  1TKY A;  4JE3 B;  3PSE B;  4G11 A;  5FR3 A;  4JX1 C;  2BYV E;  1C78 A;  2Y5P A;  2KLC A;  1B1Z A;  2OJW A;  3TJP A;  1YN5 A;  1KJT A;  4GOC A;  1MG8 A;  4A90 A;  2BWE S;  4GN1 A;  1VZ8 A;  5JHA A;  2D10 A;  1RWS A;  4ZRI A;  4DXF A;  1Q0W B;  3UQA A;  3JW0 X;  2RDB C;  2Y5B B;  1WJ4 A;  4ANV A;  4H2A A;  1OQR A;  1NBF C;  3ZNI D;  1OEY J;  3P63 A;  1WX9 A;  2WXH A;  2WXM A;  4IDI A;  1RAX A;  2PLP A;  4RFB A;  3A1Q A;  4JLC A;  2QC8 A;  2V3N A;  1WGY A;  4MM3 B;  1F77 A;  4DXA B;  3APF A;  1ZXH A;  2JYT A;  1I35 A;  3P4P B;  3NUH B;  4KDL B;  3FAH A;  2DZJ A;  4EE2 A;  2MBH A;  3DHH C;  1TYG B;  2WXI A;  2MJ3 A;  1FMA D;  2AL3 A;  1WZ0 A;  2LGY A;  3I5J C;  3AM9 A;  3HM6 X;  4MDK E;  3TEX A;  1J0G A;  4HCP B;  1V1O A;  1ISN A;  2LVP A;  3PTF C;  1LQB A;  3W5U B;  3UI3 A;  4DK5 A;  2ZCC A;  2Z0D B;  4WWP A;  4F7Z A;  2PMV A;  1G6J A;  2MP2 A;  4ANW A;  3U4E G;  4ZDV A;  1WGK A;  2HTM E;  1UZX B;  2HJ1 A;  1IUE A;  1NYR A;  3AEB B;  1T6B X;  4PYU A;  3GZN I;  2DHZ A;  3LXF A;  2DBY A;  4M01 A;  3VH3 B;  1GOZ A;  3IBE A;  4NQL B;  1B9R A;  4GMV A;  4CYE A;  3GOE A;  3DPD A;  3QJZ A;  1L7Y A;  4W9I A;  2LUE A;  1J8C A;  2BYF A;  4FN2 A;  4M8N A;  4OVU A;  3SR6 A;  2WLB A;  2W82 A;  1K53 A;  1P0R A;  1EM7 A;  2OED A;  4I6N B;  2I1J A;  2KTF A;  3OG5 A;  1F9J A;  4OVZ A;  1WF9 A;  4MSM B;  2JF5 A;  1N62 A;  2N9L A;  4YSY B;  2OOB B;  2D07 B;  3RD2 A;  1GNU A;  3AE5 B;  3DHG C;  2OJR A;  1R4M B;  1T0R C;  2JU6 X;  3KUD B;  1K8R B;  1TGZ B;  3H8H A;  2Z0E B;  1P1A A;  2K8C A;  3VRB B;  4EZL A;  4RGM A;  3T3O A;  3B08 A;  2KWD A;  2KTR B;  4MSQ B;  2OHF A;  3Q69 A;  5AZF A;  3MC8 A;  4AOF A;  4EZK A;  3IXS A;  2PJH A;  3R3M A;  1MPE A;  2JRH A;  1SXT A;  3V6C B;  1RFK A;  1IBX A;  3M63 B;  3AUL A;  3VXW A;  3GS2 A;  3AE7 B;  3L4P A;  3VAW A;  3Q2A C;  3DVN V;  1WGH A;  3Q8A A;  2XNA C;  3U52 E;  3GP7 A;  2GBM A;  2AQ3 B;  3UGB B;  2ZPY A;  2WX1 A;  2MQJ A;  1A5R A;  1UNS A;  2I2Y A;  3A9J B;  4MGY E;  2D3C A;  3KLS X;  3AV8 A;  4HRO A;  3RMK C;  1Z5S B;  3KW5 B;  3PZ8 A;  3N30 A;  4W9L A;  3NZ3 A;  2JSV X;  3ZW3 A;  3NVZ A;  3KWL A;  2IGD A;  2KFK A;  3V60 A;  4M0W A;  2ZNV C;  1UEL A;  5G5H A;  4XGA B;  3P4S B;  4ICU A;  2JY6 A;  4RGT A;  2BPS A;  3RUL A;  1C1Y B;  2G4D B;  4OHJ A;  4K3C A;  1C9F A;  1LGR A;  2JPH A;  1WM3 A;  4HCN B;  1C4C A;  2DAF A;  2JZ3 B;  5C3J B;  3ZXR A;  1YQB A;  1V5T A;  4HDO A;  1GUA B;  1VR9 A;  1T5X D;  4NJC A;  5LNK 1;  1RRB A;  1YJJ A;  1MHX A;  3C0R B;  1WX7 A;  1WXS A;  1H4R A;  4NNJ B;  3TL5 A;  4LDT B;  3HVZ A;  3KH0 A;  1XF5 L; 
#chains in the Genus database with same CATH homology
 2WXJ A;  4A9A A;  4ZRQ A;  3RFZ B;  2QIE B;  3TEY A;  1SE3 A;  3I9V 1;  3BVZ A;  3U2S C;  1XXG A;  1FFV A;  2JXT A;  1NI3 A;  2W55 A;  3HVD A;  2E6X A;  1VZ7 A;  2WU2 B;  4C7Z A;  3CWI A;  5FKA C;  1JWM D;  1TS3 A;  1SJH D;  3J9C A;  3TUO A;  1YJI A;  4XWT A;  1XCT L;  1YNT E;  1AYF A;  2RMM A;  1TKG A;  2VZK D;  1RM6 C;  4RNA A;  1EWC A;  4JWS C;  1C4P A;  2BBC A;  2BB5 A;  4XE0 A;  2AQ2 B;  2NTS A;  5D3D A;  3ZQ4 A;  1EU4 A;  2WDV B;  2JWU A;  2V0G A;  4OZC A;  4YSZ B;  4MAC A;  4C56 C;  2K5P A;  3BVM A;  5D3I B;  3W5V B;  4WUR A;  1BXT A;  1GB1 A;  2K0P A;  1SE4 A;  2LHE A;  3AE2 B;  4HKZ E;  4Q2J A;  1VDV A;  2QIL A;  4XDC A;  1BUI C;  1SB3 C;  2G1E A;  4RCO A;  1TS2 A;  1WXQ A;  4RGO S;  3FIL B;  5BYS A;  2RDG A;  4REZ A;  1YQ3 B;  4TMA B;  2L32 A;  5BMI A;  3B2F A;  3BK2 A;  3CIR B;  3EA6 A;  1CJE A;  3AEC B;  5HHD G;  3BII D;  1F0Z A;  1SE2 A;  4YTP B;  3MJ5 A;  1L4D B;  1QOF A;  3W9C B;  1F2R I;  4RH6 A;  1NEK B;  1TJE A;  1TZO A;  3Q8C A;  1IBX B;  1I4Q A;  2MH7 A;  2CJN A;  3E56 A;  4JWU C;  1UGJ A;  2L1A A;  2FBW B;  1XCQ L;  2SAK A;  3MFG A;  1E7P B;  4YWG G;  2KDM A;  2LGI A;  1KFY B;  2WQY B;  2IGG A;  2RPV A;  2YEP B;  1V1P A;  3VR9 B;  2KMM A;  4FXC A;  3AED B;  4US9 A;  3ZJU A;  2LUM A;  4L2Y A;  2LJI A;  4ITK A;  2MJE A;  3TEZ A;  3AEG B;  3ETR A;  4KGS A;  4YTM B;  2MJD A;  1JWS D;  2PKO A;  1JQ4 A;  3C8Y A;  4JPS A;  1CQV A;  1KRH A;  2EEL A;  1DOI A;  1ZUD 2;  2R61 A;  4RF0 A;  4TSS A;  1FNV A;  1ROE A;  3MHZ A;  5TSS A;  2KAC A;  1D5Z C;  4J3O D;  1XO3 A;  2KQ4 X;  3BK1 A;  2JYE A;  4UDU C;  1JRO A;  1KF6 B;  4MT5 A;  3AEF B;  3URY A;  2LMC A;  5AUK A;  4IOI E;  2I38 A;  4ARI A;  1AN8 A;  1FD6 A;  5D7G A;  3Q8F A;  1YMH E;  2K3U A;  4YSX B;  1XLP A;  1D5M C;  2AQ1 B;  1YN4 A;  1M4V A;  1ZPS A;  3KWV A;  4YT0 B;  2WXF A;  3B9J A;  4HJG E;  4HRS A;  4KX6 B;  4ZYS A;  1JRP A;  2BB6 A;  1L4Z B;  1J7B A;  5BMH A;  3AH7 A;  2JX5 A;  1WWT A;  1WYG A;  4AS1 A;  4OW0 A;  2JQR B;  1UWM A;  3T3N A;  2ONQ A;  1J7A A;  3DWM A;  4A6Q A;  2YEP F;  4HEA 1;  4RGN A;  1DOX A;  5FK9 C;  4A55 A;  1SEB D;  1WSP A;  2PTL A;  3BYY B;  3LB8 C;  3W1S A;  4A8X C;  3ZGZ A;  1ZOY B;  2BS2 B;  1DOY A;  2N9K A;  2IGH A;  1P7F A;  1XLQ A;  1XEE A;  2BYT A;  3IAM 1;  1NYQ A;  2PW9 A;  1K51 A;  1FIQ A;  1OQQ A;  1PGA A;  1SJE D;  4KKI A;  2KN4 A;  1PUT A;  3MC0 B;  4KKJ A;  2DYM A;  4IKG A;  2TSS A;  1QT9 A;  3O13 A;  5C2T B;  1KH0 A;  4ZHP A;  1TKY A;  2J42 A;  4ARC A;  2IJ0 A;  1N60 A;  3B2G A;  4JE3 B;  1CK1 A;  5EE0 A;  1I4X A;  3AE9 B;  5FR3 A;  4JX1 C;  2NMQ A;  4TQ0 A;  1C78 A;  1YQ4 B;  2Y5P A;  1B1Z A;  1QOA A;  4GDK B;  3W2D A;  2BT6 A;  1YN5 A;  4C7Y A;  4LTU A;  4NAW B;  4A90 A;  4OZB A;  1VZ8 A;  4N6E B;  1C79 A;  4ZRP A;  2X38 A;  2Y5C A;  1VJK A;  1RWS A;  3VRA B;  4NAM A;  1R7S A;  5BMG A;  2JZP A;  1XLO A;  1Q10 A;  3AE3 B;  4DXF A;  2M19 A;  4XWW A;  1HZ5 A;  1HQR D;  1FO4 A;  2L52 A;  3AEA B;  4H2A A;  1OQR A;  1C76 A;  2MEK A;  1FCL A;  1UWX A;  3P63 A;  2QJL A;  1P7E A;  1A70 A;  2WXM A;  2WXH A;  3ZYY X;  1GPX A;  4PT5 A;  4IDI A;  4B0E A;  1QF6 A;  2PLP A;  4C80 A;  2CJO A;  4RFB A;  1GB4 A;  2GI9 A;  2V3N A;  3AN1 A;  1KTK A;  1JW9 D;  1F77 A;  1FRD A;  4MM3 B;  4WQM A;  1PGX A;  1ZDX A;  1FCC C;  1QOG A;  1ZXH A;  2QSD A;  2JYT A;  4WIP A;  2DYO A;  3NVY A;  3LYY A;  5I4D A;  1SSN A;  4N59 A;  3P4P B;  1D6E C;  4P16 A;  3NUH B;  1JWA D;  2M0A A;  4WH4 A;  3FAH A;  1EU3 A;  1FFU A;  5H92 C;  4EE2 A;  3P4R B;  2N7J A;  4L1B A;  2BTE A;  1TYG B;  4RF1 A;  2WXI A;  2MJ3 A;  1V1P B;  3R8B A;  1QOB A;  1FMA D;  2K9X A;  1ESF A;  3AM9 A;  3TEX A;  2W54 A;  4KGT A;  3HRD D;  2H89 B;  1V1O A;  1T3Q A;  3W5U B;  4NZL B;  1QQR A;  3UI3 A;  4XDD A;  2N0S B;  1E10 A;  3Q8B A;  1HXY D;  1HA5 A;  5G5G A;  2LEK A;  2WS3 B;  2PMV A;  1TY0 A;  4LK0 M;  3NVW A;  3U4E G;  1WGK A;  2HTM E;  1IUE A;  1NYR A;  3AEB B;  1T6B X;  1SF0 A;  2G9H D;  1N5W A;  2IDY A;  1DYQ A;  1FXI A;  2WXN A;  3SEB A;  5T8I A;  2W3S A;  3MP9 A;  3R2T A;  1FNU A;  3LXF A;  1I4P A;  2DBY A;  1VLB A;  1MHH E;  1K52 A;  1GOZ A;  1Y56 A;  1E0Z A;  3AE6 B;  4DXG A;  1WRI A;  1B9R A;  1I4R A;  3P4Q B;  2Q5W D;  1DGJ A;  3SFE B;  4TQ1 A;  2QMT A;  1JWU D;  5JXV A;  3ZJT A;  2IPK D;  4KGR A;  2H88 B;  1C4A A;  5EE9 A;  4AQ7 A;  2ON8 A;  4YTN B;  1UUP A;  3BWU D;  3V3X A;  3NRZ A;  1PYW D;  2PVG C;  3SR6 A;  3VQI A;  2WLB A;  1TY2 A;  2DLB A;  2W82 A;  5E6J A;  1K53 A;  1EM7 A;  3AEE B;  2OED A;  4R3D A;  1L0Y B;  2SEB D;  2L83 A;  3NVV A;  1I4G A;  1FM0 D;  1AWD A;  1IGC A;  4USA A;  1VZ6 A;  1N5X A;  4OVZ A;  1N62 A;  1PFD A;  2N9L A;  4YSY B;  3NS1 A;  2ZW1 A;  1FEH A;  1FNW A;  2PVO D;  3WCQ A;  2WXQ A;  1D5X C;  2QEJ C;  3AE5 B;  2LFI A;  2ICI A;  1N63 A;  1QKZ A;  2JU6 X;  4GDL B;  1QIL A;  3H8H A;  1L0V B;  1XLN A;  4N58 A;  3AE1 B;  4ZOH C;  3P42 A;  2WXR A;  1D4B A;  1I7H A;  1L5P A;  5HG2 A;  2ZW0 A;  1CZP A;  5EE3 A;  3IAS 1;  4YXD B;  2WU5 B;  3VRB B;  3N9Y C;  2AX5 A;  4RGM A;  2M56 B;  3T3O A;  3BZD B;  2GB1 A;  1JAL A;  3KQ4 A;  1L6V A;  4D2K A;  2J4X A;  2KWD A;  2FUG 1;  2BS3 B;  3U7Z A;  2W3R A;  4HKQ A;  2OHF A;  3Q69 A;  3R2I A;  1FRR A;  3IXS A;  3VR8 B;  3ABV B;  3FIL A;  2CU3 A;  5BYR A;  2WXL A;  4P6V F;  4L23 A;  1MPE A;  2INN E;  2WDR B;  3I57 A;  1HZ6 A;  2HDE A;  1LO5 D;  3FC4 A;  4DQO C;  1SXT A;  3TEW A;  2EKI A;  4GLS C;  4LLG M;  4MH8 A;  1RFK A;  1IBX A;  1FXA A;  3BYT B;  1VRA B;  2WP9 B;  3GS2 A;  1JML A;  1MVK A;  2E3T A;  3AE7 B;  1NVI D;  3SFD B;  2WXO A;  1N61 A;  3L4P A;  4CQN A;  3BVG A;  2NTT A;  5MPO A;  2BW2 A;  3HUI A;  1K50 A;  2J52 A;  4WAF A;  2B76 B;  1TS5 A;  1JCK B;  2PIA A;  4US8 A;  2BS4 B;  5AUI A;  1E9M A;  3Q8A A;  2LHD A;  2XNA C;  3EUB 2;  3GP7 A;  3U52 E;  1STE A;  1I4H A;  2AQ3 B;  1KLG D;  1KLU D;  1UNS A;  2I2Y A;  3E9S A;  3IT6 B;  1ZDV A;  2D5G A;  1MI0 A;  3P1M A;  2WXP A;  1PDX A;  3KLS X;  3AV8 A;  4HRO A;  4OZA A;  2WDQ B;  1BML C;  1TS4 A;  3PZ8 A;  2V3P A;  1SIJ A;  1C77 A;  2JSV X;  3NZ3 A;  3DWG C;  3V05 A;  5GXG B;  3NVZ A;  3Q8E A;  3KWL A;  1V8C A;  2IGD A;  2WNM A;  5BYQ A;  1IGD A;  1L6U A;  4M0W A;  1NEN B;  2V4I B;  5G5H A;  1V97 A;  5H8Y E;  3P4S B;  2K22 A;  3GB1 A;  1EWY C;  4O1N A;  1L0X B;  4RGT A;  1ZXI A;  4OHJ A;  3AE8 B;  1C9F A;  3AE4 B;  1ET6 A;  5HFY A;  3PZ7 A;  1C4C A;  3AMZ A;  5C3J B;  1SBB B;  4B0M A;  1ZP0 B;  2VZK B;  4ZHO A;  1PGB A;  2FE8 A;  3AB5 A;  1OFF A;  1AW7 A;  3OWE B;  3ZJV A;  1HEZ E;  2KAJ A;  2XN9 C;  2WXK A;  1VR9 A;  1T5X D;  4NJC A;  5LNK 1;  1QLB B;  1JWB D;  1ET9 A;  3RPF C;  1YJJ A;  1MHX A;  1RYJ A;  2WXG A;  1YN3 A;  2DWQ A;  2J53 A;  4WWM A;  1E6E B;  2GRI A;  5HI1 A;  1GAQ B;  1TKE A;  2ACZ B;  1F2R C;  3IT4 B;  2INP E;  3TSS A;  3PO0 A;  2RDH A;  1ACC A;  1XF5 L;  2Z8L A;  1ENF A;  3HVZ A;  1J7C A;  3EGR A;  2Y3A A;  1ZE3 D;  5EE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...