3PZ8A

Crystal structure of dvl1-dix(y17d) mutant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
82
structure length
82
Chain Sequence
DTKIIYHMDEEETPDLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of WNT activation via the DIX-domain protein CCD1
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Segment polarity protein dishevelled homolog DVL-1
total genus 12
structure length 82
sequence length 82
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.380 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3pz8A00
2D5GA 3PZ8A 4WIPA 3PZ7A 1WSPA
chains in the Genus database with same CATH superfamily
2J52A 2IYDB 4YTNB 5J18A 1J7CA 3EFUA 1N6ZA 5IOIA 1ROEA 3DBHI 4ARIA 3AN1A 2B76B 2BB5A 2UWQA 3MHSD 2KLCA 2QHOA 3MFGA 2D10A 1IPGA 1WYGA 2KYWA 4L1BA 1XF5L 4DXFA 1YN3A 1EM7A 2KVRA 3IAS1 4MJSA 4P7IA 2AL3A 3Q3FA 4LJOB 3ZXRA 3KQ4A 2PJHA 1IGCA 1GG3A 1G6JA 2NBVB 1WGGA 3P42A 3H6NA 4B6WA 3VDZA 3P1MA 1UBIA 2NR2A 3PS6A 4LDTB 5HHDG 2FUHB 3MTNB 1ZDXA 3LDZE 1YQBA 2GMIC 4LNNA 1C4CA 2K39A 1WXSA 2WX0A 4W9KA 3ZNID 4LLGM 4WJOA 4XC2A 1BT0A 4GDKB 2QDFA 2KNBA 1MJDA 4G0NB 4RGOS 3QJZA 1JWMD 1PUTA 4L2YA 4C7YA 2J53A 2JRIB 3CIRB 4WIPA 4ANWA 4JE3B 5EE0A 2LWPA 3WALA 1M4VA 2NVUI 4AOFA 1CMXB 1KLGD 3A4SC 3IFWB 2M56B 1QOAA 1P98A 3RULA 4IWOA 4BBNC 4FJZA 3V3XA 1JROA 2KMAA 1XO3A 2JXTA 4I6NB 1SE2A 3I9V1 2O6VB 3AEAB 2LASA 4ICUA 2HJ1A 5LXIB 3RZFA 2LI5A 4RGNA 4DQOC 1FM0D 2RPVA 3BWUD 3DBRB 1HEZE 2LHEA 2XN9C 1GC6A 2KN4A 1UNSA 3HVZA 3PRPB 4E71A 2O6VD 1UBQA 2LGXA 2LGYA 2BYEA 1TS3A 1GUAB 2N1WA 1I4RA 1GB4A 3JYUA 2CKHB 3PZDA 1R4NB 2HJ8A 1LO5D 4P16A 3QWZB 1WXAA 4YWGG 5LXHA 5GMVA 3DVNV 2QCZA 4KZ0A 1Z5SB 3VRBB 5J2RA 4G50A 3RNCC 1XXGA 3W9CB 3R66C 4MH0E 2LGIA 2MP2B 4LNKA 1ZDVA 2I38A 3AEFB 3LYYA 1CJEA 2LJIA 1QILA 1IYFA 4RGTA 3VUYA 2MWSB 2WX1A 4RFBA 2JZPA 1Q0WB 3AE8B 3A4RA 3B1LX 2NBUA 4W9FA 4WURA 3B0AA 1P9DU 2FCQA 1HA5A 3OLMD 2KJHB 5AZGA 1WXMA 3NUHB 4K1RB 4XZ4A 3E9SA 2WLBA 1AWDA 4W9GA 1PGBA 2PMVA 3QIJA 3GOEA 4DHJD 3W1YA 3RZWC 5HFYA 3N1ZC 2KO3A 2JF5A 3FKYA 3VFKA 3UQBA 2KWCA 2ZNVB 3MHZA 4K3CA 2OJRA 1P1AA 3U52E 4PK1A 2K1FA 3M62B 1EO6A 2D07B 1U4AA 2O2VB 1YOVB 1I4PA 2N4FA 1L0VB 2J4XA 2AQ1B 4KX6B 1CZPA 2IY1B 2KQ7A 1UWXA 2FAZA 3RT3B 3RCZA 1KFYB 1F2RC 3DDCB 4PS8A 3L0WB 2N9XA 2IGGA 3RNGC 4AS1A 2G3QB 3SR6A 5EE3A 3SEBA 1V5TA 1EU3A 1BXTA 3ZQ4A 2XK5A 1E10A 2DBYA 3OG5A 3VR8B 2FUG1 3NVWA 2BF8B 5AEKB 1ZP0B 3QHTA 1P7EA 1UZXB 4NJCA 4HCNB 4ACFA 3CSTA 3U4EG 3QX1A 3A9JB 3BVGA 1Y8RC 5CTRC 3ZJUA 1D4BA 2WXRA 3ABVB 4M8MA 4PYZA 3VUWA 4ZRKA 4W9DA 1V86A 4WH4A 1LQBA 1GC7A 1ZPSA 4MACA 1V81A 1PGAA 1RYJA 4NAWB 1T0YA 3TSSA 4BKTA 3W5VB 3NHEB 4HRSA 4YL8A 2KJ6A 4ZHOA 1TS5A 2LZ6A 2KJRA 3RFZB 2JT4B 4B9KA 3PLUA 5FKAC 3PZ7A 1YD8U 2LEKA 3RYTA 1WGRA 2BYFA 3QA8A 4WJPA 2D11A 3PREA 3ZJVA 2K9XA 1YNTE 1L5PA 2XNAC 2W55A 4ZRQA 3TEWA 3ENEA 3VRAB 5CHVC 2L8JA 3ZNGC 2BYVE 2PE6B 3W1SC 1L6UA 4XDDA 4NQLB 3TEZA 3VXWA 2C60A 1D5ZC 2JU6X 5E6PA 2AEHA 3OJ4B 3P4SB 4AJWA 3ZVVA 4FBJB 2RSUA 1MG8A 4EZJA 3VUXA 2JYEA 2L83A 3H7PA 4M8NA 1ACCA 1HZ6A 2GBJA 1HQRD 1GNUA 2J0MA 2BKRB 3FAHA 4LNOA 3TBLD 4GXBA 1R4MI 1C79A 4KDLB 3AMZA 2LFIA 2O2VA 5C1ZA 1JWSD 1E9MA 2BPSA 2L32A 3DBSA 4ZRIA 3EUB2 4XWWA 3M3JA 4MSMB 1ET6A 3NZ3A 3N1XC 2OEDA 4B95A 4XX5A 3AB5A 4NJ6A 3R2IA 4REZA 3HRDD 4LJPB 3RD2A 3NOBA 1T6BX 2LRWA 2WXPA 2ZPYA 5D6JB 1WFYA 2MJ3A 4IKGA 3JW0X 1V6EA 3KLSX 3AV8A 2G9HD 2GOWA 4GDLB 2DYBA 2AX5A 3AECB 3B9JA 1QKZA 4YSYB 1PYWD 3KUZA 4ITKA 5L83A 1F9JA 1KH0A 2ZEQA 1WY8A 4KSKC 2IO0B 2ZCCA 4EUTA 3C8YA 4GMVA 4JWSC 2JWZA 2QMTA 4JGHB 2L1AA 2V9HA 1STEA 1YQ4B 3DWMA 1JWUD 2SEBD 3GZNB 4H2AA 2PTLA 4NQKE 2LUMA 2TSSA 3JSVB 4BFRA 2EMTA 1UWMA 3NG0A 1C76A 5JZEB 1MVKA 1ENFA 1VD2A 5HG2A 2DYMA 3KUCB 2CJNA 3NZUA 1C78A 2GBKA 3VQIA 4M0WA 2E3TA 2CU3A 4ASWC 2PVOD 5AZHA 3L4PA 4RM8A 1RLFA 3WAMA 3TL5A 2OHFA 3Q3MC 2DX5B 3GE3C 3QCAA 5G55A 4WJNA 2FCMA 4MM3B 1WXQA 2IGDA 1HTOA 1KF6B 5AUKA 2N1VA 1J8CA 2KD0A 1E8YA 3RNAC 2KANA 1F1HA 2QJLA 3VR9B 4MGIE 3ZNHB 1PGXA 2LJ5A 4YSXB 1WF9A 1WH3A 4US8A 4GDLA 3PTFC 2D2QA 3DHHC 2WU2B 3GE8C 4IM2A 1Z2MA 3ZW3A 2V3PA 5C23A 5L95C 2EELA 4MDKE 1YX5B 4IWQA 4HKZE 3N3KB 4IC7B 1FIQA 2KC1A 4N59A 4XYCA 2DYOA 1TTNA 3PGEA 3MC0B 3B2FA 1D5MC 1K50A 2M0AA 4MGKE 3MC9A 5BMHA 5JHBA 3AEBB 3JSVA 4OZBA 5HKHA 1KLUD 1NI2A 5D2MB 2M1MA 2Y5CA 5EE1A 2VH2A 2IDYA 4W9LA 3UIOB 3W1SA 1HZ5A 1OTRB 1Q5WB 1QLBB 4CQNA 2LD9A 4X57B 1WZ0A 2J42A 2W82A 1P7FA 1AW7A 1FXIA 2BQQA 2V4LA 4ZOHC 5MPOA 3QK0A 2ZW0A 3AE4B 3X23A 2RGFA 2ICIA 1WM3A 2K0PA 3H8HA 2KN5A 2MBQA 3IXSA 1CK1A 5KHOA 1EU4A 4MJSB 3MC8A 2ZNVC 4YTMB 3JVZX 2W9NA 4I6PA 4YXDB 1F77A 2INCC 3CMMB 2JUOA 4FLHA 4FHKA 3ECIA 3L08A 3LXFA 4IM0A 3S2AA 2C9WB 2AL6A 2PE9A 5DPWA 4BKGA 3DBLI 2RDHA 2DZKA 3C19A 1V49A 2HTHA 1E8XA 4JX1C 1B1ZA 4IUMB 1JWAD 5E6JA 4HROA 2NBWB 4FADA 3V6CB 5JXVA 3DVNU 2JX5A 1YN4A 1IP9A 1OQQA 1WGYA 2Z0EB 1WRIA 4ARCA 2NPTA 2ONQA 3DCGA 1XT9B 1RFKA 3I3TB 4HCPB 1WMHA 3GS2A 2KFJA 2KK8A 3MJ5A 2WDTB 3BYYB 1WX8A 4KKJA 3UGBB 1J7AA 3PRMB 1GJZA 2X38A 4HXDA 1E7VA 2NMQA 4M00A 4K3BA 3NJTA 1R4MB 1WIAA 4M01A 4HLEA 4OZCA 3C0RB 3ALBA 2LHDA 3BK2A 4BKSD 1TKYA 3DBRI 2WYQA 3B08A 3L54A 1S1QB 2CHXA 1MI0A 3FILB 2KTFA 3BIID 2C7MB 1YN5A 1N5XA 4BOZB 5AUIA 3UINB 1LM8B 4OZAA 4BKSA 4EZLA 2Y3AA 4MGYE 4OHJA 1R7SA 2NCNA 4RCOA 4G11A 1SJED 1I35A 2KQSA 4KKIA 5C2TB 2KC2A 4RM9A 2JXXA 1LGRA 2PEAA 1WSPA 3N1YC 2INNE 2N9KA 5FR3A 4B0MA 2WXMA 4R3DA 1WE7A 4P1BC 2JYTA 2LGSA 3Q3JA 5JH5C 5J17A 2CJOA 1NYQA 4A3OA 2OJWA 4A8XC 3K9PB 1QT9A 3R7RA 4ZYSA 2MLBA 1AN8A 2ON8A 3PLVA 2SAKA 1V9JA 3T3OA 3AE1B 3ZO5B 3Q8CA 2WQYB 3RUIB 4HJGE 3EHVA 1YQ3B 5DPRA 4NAMA 2PKOA 4N6EB 1HE8A 1XEEA 4NNJB 1F52A 4LNFA 2OOBB 2NTTA 5D3DA 1SF0A 3FC4A 2BS3B 1T0SC 2LUEA 4GU2A 4S17A 2ZZPB 2DZMA 1LFDA 4PYUA 2KDBA 4PS7A 2QIEB 2MBHA 5E6OA 2WU5B 1E90A 5LLIA 3U8ZA 2BW2A 3V6EB 2BWES 3ZTCA 1TJEA 1MHHE 1PFDA 4MH8A 3GZNI 4BZAA 1V1PA 2KKCA 4DXAB 2IZVB 4WWPA 4JIOU 2Z0DB 3A1QB 3VVWB 2K5PA 3BY4B 4KIKB 2YEPB 5EE9A 4JWUC 2DNFA 2LRUA 2V1YA 2YEPF 3Q8BA 3DBLB 4RF0A 1VR9A 1BUIC 4HPMB 3IHPC 2BBCA 4DDGD 4RNAA 3IG3A 4RMAA 2KDEB 2NPTB 3APCA 2DZJA 2Q5WD 2M17A 2LMCA 5IO9A 4OVVA 5IP4D 5TR5A 2WXIA 2KMMA 4GLSC 1VZ8A 4NPNA 3CWIA 3Q8FA 2WXLA 2KTRA 3ZGZA 2I2YA 2KMCA 1FRDA 1SJHD 4G3XB 4E74A 1L4DB 1XCQL 1V80A 3PRZA 1SIJA 3NVYA 1GAQB 2LVOA 5C3JB 1N63A 3KWLA 4IDIA 4HKQA 4WJQA 3IT6B 4F7ZA 3TJPA 2KXJA 2CHWA 2WP9B 3AI5A 1TBEA 2CR5A 1JALA 3WAPA 1QF6A 4TUUA 3NVVA 2IJ0A 4CYEA 4A20A 4FA6A 3EFCA 1J19A 3ZDMC 2PVGC 4A90A 1TY0A 2H88B 4K7UA 3IBEA 2L52A 1OFFA 4II3B 2A4ZA 4OW0A 2IY0B 4W9JA 2DENB 3R2TA 2GI9A 5T8IA 4K81A 1WGKA 4F8CB 2GBRA 2KDMA 3APFA 2K3UA 2KVZA 2KAJA 3Q8AA 3MJWA 1T3QA 3URYA 3PHWB 2KX3A 4ZRJA 1QQRA 4W9HA 3Q3NC 4US9A 5D7GA 5FK9C 1D5XC 3VH4B 3DVGY 4LDTD 4DXGA 1SB3C 4WQMA 4MELA 1FCLA 4BBNF 1E7UA 3V05A 4A3PA 4WAAA 4LK0M 4LTUA 1TKEA 3RNBC 2KWVB 1TZ1A 3OJ3A 4TQ1A 2B3AA 1SGHA 2W3RA 2KACA 4CHKA 2BT6A 2GLSA 3Q3OC 1EWYC 2LVQA 1L4ZB 3AH7A 3BYTB 1IUEA 1C77A 3AEDB 1MPEA 2LXAA 3AU4A 2VH1A 3NS1A 3PZ8A 1B9RA 5BYRA 1VLBA 2WXFA 2DAFA 1TS2A 2KWDA 2KOXA 4KV2A 2MHJA 4NAWA 3P2BA 1T0QC 4JPSA 3W2DA 2DHZA 5CHFA 4N58A 3X0WA 2KWUB 1WGDA 1TKGA 1FXAA 3H9DA 4HWIB 4YSZB 4KGRA 3PVLA 1HXYD 1RM6C 2D3CA 2MBBB 3ZDTA 4MSQB 3WANA 2AYOB 3AE7B 2WXGA 3U7ZA 2G4SA 4USAA 4HK2A 4WWMA 5TSSA 3UQAA 4EKUA 3WAOA 1KJTA 2IPKD 3ZJTA 2O6VA 3KYDD 1WYWB 2KX0A 4GGQA 1SEBD 2FCNA 1V97A 2JVCA 3HM3A 4HDOA 3VH3B 2GB1A 2INPE 3ML8A 4EE2A 2EMSA 3NZSA 3BK1A 2HE7A 1E0ZA 4DK5A 5G5GA 2PIAA 4MT5A 3HM6X 4P1CC 1HTQA 4DWFA 1UGMA 1K51A 2DZIA 4KSLC 5LNK1 2WXKA 1ZXIA 2L3ZA 2K6QA 2Y5PA 1N62A 5BYQA 1UUPA 1KOTA 4I6LB 3A9KA 3V62A 2D5GA 1J7BA 2GRIA 3N30A 2MH7A 1E5WA 3U7DA 1QZEA 2ACZB 2MRPA 4PS3A 4L23A 2WXHA 3EA6A 1FNVA 2E6XA 2ZJDA 2MA9B 1X1MA 2IBIB 1R4NI 1FNUA 2PPHA 3UI3A 2WDVB 1ZXHA 2K25A 2LXCA 2HDEA 2MEKA 4DBGA 1FPYA 2XEWA 3PO0A 3E56A 2G45B 4A9AA 2DWQA 2L0FA 2REXA 1ZGUB 2X8XX 2ZVOA 3I57A 1RWSA 1A5RA 3NRZA 2IGHA 5AZFA 2RD0A 1ISNA 4DHJB 2M4NA 2J7QB 1UD7A 3RMKC 3TUOA 1Y56A 4C56C 2Z8LA 1FD6A 2N7DA 1SE3A 1XCTL 3GB1A 2WDRB 1OQYA 4K7SA 1LXDA 3KUDB 1JMLA 2KHWB 3KYCD 3VAWA 2VRRB 2BWFA 3WCQA 3ZNZB 2WHIA 2JWUA 2C7NB 1WWTA 4CO7A 1FFUA 1FCCC 1DOIA 4NZLB 1DYQA 4W9IA 4EEWA 1JWBD 2FNJB 4GDKA 3AEGB 2J0KA 3ZKJC 3M63B 5G2NA 2UU7A 4YTPB 3UIPB 3EGRA 1C9FA 1C4AA 1SSNA 3B2GA 3O13A 1I7HA 2QC8A 3ZYYX 1DOXA 3KH0A 3EC8A 1K8RB 2V4IB 4WQOB 4S0RA 1TIFA 1KTKA 4WWOA 4GIVA 3PPAA 2JY6A 3A33B 1SBBB 3AE3B 4NY0A 3P63A 2IO2B 1RAXA 2K8CA 2HD5B 2BB6A 1JCKB 3T9LA 3WA0A 1V2YA 4TKNA 1EWCA 2M8SA 4ZRPA 2RR9A 3DPDA 1EF5A 4II2B 3VTWA 2RDGA 1NBFC 1H8CA 4OVZA 4DHZB 5D3IB 3SU8X 1TT5B 1I4QA 2MSED 5E6NA 4ZDVA 1V1PB 2AQ3B 2Y5BB 2INDC 4TMAB 2CHZA 2PLPA 4N9F4 1YJ1A 4JL9A 3BVZA 2L05A 1VRAB 3SFEB 4BVUC 4ICVA 2V3NA 2KDFB 3PV1A 2RMMA 5D94A 2AWTA 3KWVA 1EF1A 3DHIC 4IW0A 3NVZA 4EZKA 1IBXA 1GPXA 4B0EA 3BVMA 2WDQB 3U2SC 5HI1A 4JQWC 1OEYJ 3LB8C 1L0YB 3N32A 4RGMA 3P4PB 1FMAD 2ZPNA 5EDSA 1WXVA 4J3OD 4IM3A 3L10B 1F2RI 2WXJA 1UGJA 1KLVA 1E7PB 2MBOA 1WM2A 2MP2A 1M94A 2IO3B 2K6DB 1XD3B 4XWTA 3IVFA 1C3TA 3EECA 1YJIA 4Q2JA 3Q8EA 4AWJA 1WZ3A 1N61A 2R61A 3AE9B 1QOBA 2C7HA 3NY5A 5CHWA 1FEHA 1K52A 1XLPA 4F1SA 2MW5A 4OVUA 2N9EB 2BKFA 3IT4B 3AXCA 1J0GA 1T5XD 1C4PA 2I1KA 3FILA 4RH6A 4W9CA 2EKIA 3T8MA 4ZYNA 1WMHB 1BMLC 2W3SA 4M02A 5IN7A 5BMGA 5CX3A 1AARA 2JSVX 3ONSA 2AQ2B 2R2OA 2L7RA 2BS2B 4AUQC 3AE6B 3VTVA 1L2NA 2MCNB 2ZCBA 3RNEC 1XLQA 1FO4A 2H89B 3VHTC 1JRPA 3DVGX 3P4QB 3PSEB 4D2KA 1D3ZA 3I63C 3N9YC 1L6VA 2L76A 1N5WA 2QSDA 2D3AA 4ANUA 4NJ7A 4C4VB 3O65B 2LGDA 4MEMA 3LJ3A 2M19A 1EUVB 5KHQA 1WJNA 4XE0A 1WJ6A 1RRBA 3HK0A 3DWGC 4GB9A 4FXCA 3WIMA 1TYGB 3M95A 2BTEA 4TQ0A 1MFWA 4KZCA 3Q69A 3RI7C 2BVCA 3RN9C 3KVFB 3PT2B 1XLOA 2DAJA 2MX2A 3DQVA 1N60A 2N0SB 1JQ4A 4HDQA 3BZDB 1XLNA 2V3SA 2XBBC 1OGWA 4URKA 2CS4A 1CQVA 1VCBA 3AE5B 1YX6B 3L16A 1TS4A 3SDLC 2BGFA 3OWEB 3ZRCA 2WS3B 2G1EA 2A5UA 3DOWA 1WR6E 3HUIA 1ESFA 2YVCA 3QQ8B 2RDBC 4HPLB 2VZKD 3AE2B 4AQ7A 2FE8A 3A9JA 2JPHA 2MQJA 3L17A 3AULA 1NENB 4GOCA 3QAQA 2LVPA 3HIZA 1SE9A 2WXQA 1GOZA 2BS4B 5BO4B 3RNFC 1SIFA 1WR1A 3AU5A 3RPFC 1NDDA 1TZOA 1ZOYB 4AP4C 5DPSA 3TEXA 4GN1A 1V8CA 1T0RC 4KGTA 4EFOA 4IG7B 1WX9A 2BYTA 3TCAA 2WWZA 1E8ZA 1TY2A 2FBWB 2MJEA 1PQSA 4FHJA 3TMPB 3GP7A 2DLBA 4DHZE 2Z59B 3SHQA 1PDXA 4C80A 2RPQA 2WNMA 3H7SA 1F0ZA 2QEJC 3AM9A 1UF0A 1TGZB 2G4DB 3A1QA 1NYRA 1OEYA 1NEKB 1KRHA 1NI3A 3ZIMA 4BAXA 1P0RA 5I4DA 4FN2A 2FCSA 4W9EA 3ZUNA 2KT7A 4LNIA 5IA7A 3QC8B 1ZW7A 3ETRA 1WJUA 4HJKA 4C7ZA 2L0TA 3UF8A 1JRUA 4ZHPA 3DBHB 4C4VA 3PHXB 1Q10A 1WGHA 1V1OA 5G5HA 3DHGC 4KGSA 1WI0A 2NTSA 1ZE3D 3Q6BA 2N9PC 1VJKA 1FXTB 1VZ7A 2WGSA 2N7EA 5DPTA 4FULA 2GBMA 2D3GA 4IOIE 3T3NA 2KFKA 2NS5A 4O1NA 3VTUA 5BYSA 3CSFA 4A6QA 1XQQA 2FIDA 4IWPA 4ANVA 3IAM1 5H92C 1S3SG 2M0XA 4TSSA 2YLMA 2K8HA 3I5JC 1A70A 4WWNA 1ZKHA 2ZVNA 4E3CA 3U30A 5DCNA 1WE6A 5GXGB 1DGJA 1IBXB 3APDA 5IAAC 3TEYA 1KM7A 2JZZA 4MGZE 3CF6E 1DOYA 1VZ6A 1I4XA 3W5UB 1P3QU 1ET9A 3AEEB 3KW5B 2N7JA 1SXTA 1WJ4A 3Q2AC 1MG4A 4YT0B 2CU1A 2QILA 4K7WA 4KVGB 2N9LA 4ANXA 4M0WB 3SFDB 2WXOA 2PW9A 4FJVB 2XK5B 2IO1B 2JQRB 4A55A 1I4GA 1QOGA 4RF1A 3ZLZA 1V5OA 1FNWA 4MM3A 3V60A 3ZRFA 1YMHE 1JW9D 1IGDA 2EKEC 3MP9A 5FR6A 1GB1A 4TV3A 4J6IA 1K53A 1SE4A 2ASQA 1UH6A 1YJJA 2JRHA 4LCDE 1E6EB 3SD5A 1OQRA 2JZ3B 1I4HA 2VZKB 2KFKB 3BINA 3K9OB 3OAWA 1QOFA 1YIWA 3P4RB 2J0JA 4BOSC 2KZRA 4EOYA 1D6EC 1FRRA 3A9KB 4XGAB 3N20C 4GSWA 3D32A 4HEA1 4C00A 2R2QA 1AYFA 4KIKA 4AJYB 2HTME 4HVBA 1E8WA 1UELA 1VDVA 1RFAA 2K22A 3TIXA 5JHAA 1L0XB 2FIFA 2W54A 1ZUD2 2K8BA 1H4RA 2ZW1A 2KDIA 2UYZB 4QAYA 5H8YE 2MJDA 5BMIA 2KQ4X 1FFVA 2MBEA 1I42A 3NS8A 3ZTDA 3ZXVA 4HPPA 4PT5A 1NVID 1L7YA 2C5LC 4WAFA 2KTRB 1Q1OA 4UDUC 2GBNA 4DDID 1C1YB 3L13A 4FJYA 3V61A 3HVDA 5IKCM 1WX7A 3Q14C 4P6VF 2L00B 4JLCA 3R7QA 1MHXA 2I1JA 3H1UA 3R8BA 2WXNA 3QARA 2V0GA 2D3BA 3H7PB 3ML9A 1WRDB 3J9CA 3HHMA 3R3MA 4KDIC 4XDCA 2KLGA
chains in the Genus database with same CATH topology
2OEDA 2J52A 3Q8FA 1FEHA 1K52A 1XLPA 4YTNB 2WXLA 3AB5A 4REZA 3R2IA 3ZGZA 2I2YA 1J7CA 3HRDD 1FRDA 1SJHD 1ROEA 1T6BX 2WXPA 1L4DB 3IT4B 1XCQL 1T5XD 1C4PA 2MJ3A 1SIJA 3NVYA 3FILA 1GAQB 3AN1A 4RH6A 4IKGA 1N63A 2B76B 3KLSX 5C3JB 3KWLA 2BB5A 3AV8A 4IDIA 2G9HD 2EKIA 3MFGA 4GDLB 4HKQA 2AX5A 3AECB 3B9JA 1WYGA 3IT6B 4L1BA 1BMLC 1XF5L 2W3SA 1QKZA 2WP9B 5BMGA 1JALA 4YSYB 1PYWD 1QF6A 4DXFA 1YN3A 2JSVX 3NVVA 2IJ0A 1EM7A 2AQ2B 3IAS1 4ITKA 2BS2B 1KH0A 3AE6B 2PVGC 4A90A 1XLQA 1FO4A 1TY0A 2H88B 2H89B 1JRPA 2L52A 3C8YA 3P4QB 4D2KA 1OFFA 3KQ4A 4JWSC 3N9YC 1L6VA 2QMTA 1IGCA 1N5WA 2L1AA 2QSDA 1STEA 4OW0A 1YQ4B 3DWMA 3P42A 3R2TA 1JWUD 2GI9A 5T8IA 2SEBD 3P1MA 2M19A 4H2AA 2PTLA 1WGKA 2LUMA 2TSSA 4XE0A 5HHDG 2KDMA 3DWGC 2K3UA 1UWMA 1ZDXA 2KAJA 3Q8AA 4FXCA 1T3QA 1C76A 3URYA 1MVKA 1TYGB 1ENFA 2BTEA 5HG2A 1C4CA 1QQRA 4TQ0A 2DYMA 3Q69A 4US9A 5D7GA 2CJNA 5FK9C 4LLGM 1C78A 3VQIA 4M0WA 1D5XC 2E3TA 1XLOA 2CU3A 4GDKB 1SB3C 4DXGA 2PVOD 4WQMA 3L4PA 1FCLA 1N60A 4RGOS 2N0SB 3V05A 1JWMD 1PUTA 4L2YA 4C7YA 1JQ4A 2J53A 4LK0M 3BZDB 4LTUA 2OHFA 3CIRB 1TKEA 1XLNA 4WIPA 4JE3B 4MM3B 4TQ1A 1WXQA 5EE0A 2IGDA 1KF6B 5AUKA 1M4VA 2W3RA 2KACA 2BT6A 1KLGD 1CQVA 2M56B 1QOAA 1EWYC 3AE5B 1L4ZB 3AH7A 2QJLA 3BYTB 3VR9B 1IUEA 1C77A 3AEDB 1MPEA 1TS4A 1PGXA 4YSXB 3NS1A 3V3XA 3PZ8A 1JROA 1XO3A 3OWEB 2JXTA 4US8A 1SE2A 2G1EA 2WS3B 5BYRA 1B9RA 3HUIA 3I9V1 1VLBA 2WXFA 1ESFA 1TS2A 3AEAB 2WU2B 2KWDA 4JPSA 3W2DA 4RGNA 2VZKD 4DQOC 3AE2B 4N58A 1FM0D 2V3PA 1TKGA 1FXAA 2RPVA 4AQ7A 3BWUD 4YSZB 2FE8A 2EELA 4KGRA 1HEZE 2LHEA 2XN9C 1HXYD 1RM6C 2KN4A 1UNSA 3HVZA 4HKZE 1NENB 1FIQA 1TS3A 4N59A 3AE7B 2WXGA 2DYOA 1I4RA 3U7ZA 4USAA 3MC0B 1GB4A 2WXQA 4WWMA 5TSSA 1GOZA 1LO5D 2BS4B 4P16A 3B2FA 4YWGG 3RPFC 1D5MC 1K50A 2IPKD 2M0AA 3ZJTA 5BMHA 1TZOA 1ZOYB 1SEBD 3AEBB 4OZBA 1V97A 3TEXA 1KLUD 5EE1A 2Y5CA 1V8CA 3VRBB 2IDYA 4KGTA 2GB1A 2INPE 1XXGA 2BYTA 4EE2A 3W9CB 3W1SA 1HZ5A 1QLBB 1TY2A 4CQNA 2FBWB 3BK1A 2LGIA 2MJEA 1E0ZA 1ZDVA 5G5GA 2I38A 2PIAA 4MT5A 3GP7A 2DLBA 3AEFB 3LYYA 1CJEA 2J42A 2LJIA 2W82A 1QILA 1K51A 1P7FA 1AW7A 1FXIA 5LNK1 2WXKA 4RGTA 1ZXIA 4ZOHC 5MPOA 4RFBA 1PDXA 2Y5PA 2ZW0A 2JZPA 4C80A 1N62A 2WNMA 5BYQA 1F0ZA 2QEJC 3AE8B 1UUPA 3AE4B 3AM9A 4WURA 2ICIA 2K0PA 3H8HA 3IXSA 1CK1A 1HA5A 2D5GA 1NYRA 1J7BA 1EU4A 2GRIA 2MH7A 4YTMB 1NEKB 1KRHA 1NI3A 2ACZB 4L23A 5I4DA 4YXDB 1F77A 2WXHA 3EA6A 1FNVA 2E6XA 3NUHB 3ETRA 1FNUA 3UI3A 4C7ZA 2WDVB 1ZXHA 3LXFA 3E9SA 4ZHPA 2HDEA 2MEKA 2WLBA 1AWDA 3PO0A 1PGBA 2PMVA 3E56A 1Q10A 2RDHA 4A9AA 2DWQA 1V1OA 5G5HA 5HFYA 4KGSA 4JX1C 2NTSA 1B1ZA 1JWAD 1ZE3D 5E6JA 4HROA 3I57A 1VJKA 3MHZA 5JXVA 1VZ7A 1RWSA 4ARIA 3NRZA 2JX5A 3U52E 2IGHA 1YN4A 1OQQA 1WRIA 4IOIE 3T3NA 4ARCA 4O1NA 1I4PA 3TUOA 1L0VB 2J4XA 2ONQA 1Y56A 4C56C 5BYSA 2Z8LA 1RFKA 4A6QA 2AQ1B 1FD6A 4KX6B 1CZPA 1SE3A 3IAM1 3GS2A 1UWXA 1XCTL 3GB1A 3MJ5A 3BYYB 2WDRB 4KKJA 1J7AA 2X38A 1KFYB 5H92C 2NMQA 1JMLA 1F2RC 4XDCA 2IGGA 4AS1A 4TSSA 3WCQA 2JWUA 1A70A 1WWTA 1FFUA 4OZCA 1FCCC 3SR6A 1DOIA 5EE3A 4NZLB 1DYQA 2LHDA 3SEBA 3BK2A 1TKYA 1EU3A 5GXGB 1JWBD 1IBXB 1DGJA 1MI0A 3FILB 3TEYA 1BXTA 3BIID 3ZQ4A 3AEGB 1E10A 1YN5A 2DBYA 3VR8B 2FUG1 3NVWA 1N5XA 5AUIA 1DOYA 1ZP0B 4YTPB 1P7EA 3EGRA 4OZAA 4NJCA 1VZ6A 2Y3AA 4OHJA 1I4XA 3W5UB 1C9FA 1C4AA 1R7SA 1ET9A 3AEEB 1SSNA 4RCOA 3U4EG 1SJED 3B2GA 2N7JA 4KKIA 1SXTA 5C2TB 3O13A 1I7HA 3ZYYX 1DOXA 4YT0B 2QILA 3BVGA 2V4IB 3ZJUA 1WSPA 2N9LA 1D4BA 2WXRA 1KTKA 2INNE 2N9KA 3ABVB 3SFDB 5FR3A 2WXOA 2PW9A 4B0MA 2WXMA 4R3DA 1SBBB 3AE3B 2JQRB 4A55A 3P63A 2JYTA 1I4GA 1QOGA 4RF1A 4WH4A 2CJOA 1ZPSA 4MACA 1PGAA 1FNWA 1RYJA 1NYQA 2BB6A 4NAWB 1YMHE 1JW9D 1JCKB 1IGDA 3TSSA 3MP9A 1GB1A 4A8XC 3W5VB 1QT9A 4ZYSA 1AN8A 2ON8A 4HRSA 1EWCA 1K53A 1SE4A 2SAKA 3T3OA 3AE1B 4ZRPA 1YJJA 3Q8CA 2WQYB 1E6EB 4ZHOA 2RDGA 4HJGE 1OQRA 4OVZA 1TS5A 3RFZB 1I4HA 2VZKB 1YQ3B 5D3IB 3PZ7A 2PKOA 4NAMA 5FKAC 1QOFA 2LEKA 4N6EB 3P4RB 1I4QA 1XEEA 3ZJVA 2K9XA 1YNTE 1L5PA 1V1PB 2XNAC 2W55A 1D6EC 1FRRA 2AQ3B 2NTTA 4ZRQA 5D3DA 4TMAB 3TEWA 1SF0A 2PLPA 3FC4A 2BS3B 3VRAB 4HEA1 1AYFA 3BVZA 1L6UA 1VRAB 3SFEB 2V3NA 2HTME 4XDDA 1VDVA 2RMMA 3TEZA 2QIEB 3KWVA 2K22A 2WU5B 3NVZA 1L0XB 1D5ZC 2W54A 2JU6X 1IBXA 1ZUD2 2BW2A 3P4SB 2ZW1A 1GPXA 4B0EA 3BVMA 2WDQB 5H8YE 2MJDA 5BMIA 1TJEA 1MHHE 5HI1A 3U2SC 1PFDA 4MH8A 2KQ4X 3LB8C 1L0YB 1FFVA 2JYEA 1V1PA 2L83A 4RGMA 3P4PB 4PT5A 1NVID 1FMAD 1ACCA 4J3OD 1HZ6A 2K5PA 1F2RI 1HQRD 2WXJA 2YEPB 4WAFA 1UGJA 5EE9A 4JWUC 4UDUC 1E7PB 3FAHA 3Q8BA 2YEPF 4RF0A 1VR9A 1BUIC 3HVDA 2BBCA 1C79A 4RNAA 3AMZA 2LFIA 4XWTA 4P6VF 1JWSD 1YJIA 4Q2JA 1E9MA 2Q5WD 1MHXA 2LMCA 2L32A 3Q8EA 3R8BA 2WXNA 2WXIA 2V0GA 2KMMA 1N61A 3EUB2 3J9CA 2R61A 4GLSC 4XWWA 3AE9B 1VZ8A 1QOBA 1ET6A 3NZ3A 3CWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5G A;  3PZ8 A;  4WIP A;  3PZ7 A;  1WSP A; 
#chains in the Genus database with same CATH topology
 2J52 A;  2IYD B;  4YTN B;  5J18 A;  1J7C A;  3EFU A;  1N6Z A;  5IOI A;  1ROE A;  3DBH I;  4ARI A;  3AN1 A;  2B76 B;  2BB5 A;  2UWQ A;  3MHS D;  2KLC A;  2QHO A;  3MFG A;  2D10 A;  1IPG A;  1WYG A;  2KYW A;  4L1B A;  1XF5 L;  4DXF A;  1YN3 A;  1EM7 A;  2KVR A;  3IAS 1;  4MJS A;  4P7I A;  2AL3 A;  3Q3F A;  4LJO B;  3ZXR A;  3KQ4 A;  2PJH A;  1IGC A;  1GG3 A;  1G6J A;  2NBV B;  1WGG A;  3P42 A;  3H6N A;  4B6W A;  3VDZ A;  3P1M A;  1UBI A;  2NR2 A;  3PS6 A;  4LDT B;  5HHD G;  2FUH B;  3MTN B;  1ZDX A;  3LDZ E;  1YQB A;  2GMI C;  4LNN A;  1C4C A;  2K39 A;  1WXS A;  2WX0 A;  4W9K A;  3ZNI D;  4LLG M;  4WJO A;  4XC2 A;  1BT0 A;  4GDK B;  2QDF A;  2KNB A;  1MJD A;  4G0N B;  4RGO S;  3QJZ A;  1JWM D;  1PUT A;  4L2Y A;  4C7Y A;  2J53 A;  2JRI B;  3CIR B;  4WIP A;  4ANW A;  4JE3 B;  5EE0 A;  2LWP A;  3WAL A;  1M4V A;  2NVU I;  4AOF A;  1CMX B;  1KLG D;  3A4S C;  3IFW B;  2M56 B;  1QOA A;  1P98 A;  3RUL A;  4IWO A;  4BBN C;  4FJZ A;  3V3X A;  1JRO A;  2KMA A;  1XO3 A;  2JXT A;  4I6N B;  1SE2 A;  3I9V 1;  2O6V B;  3AEA B;  2LAS A;  4ICU A;  2HJ1 A;  5LXI B;  3RZF A;  2LI5 A;  4RGN A;  4DQO C;  1FM0 D;  2RPV A;  3BWU D;  3DBR B;  1HEZ E;  2LHE A;  2XN9 C;  1GC6 A;  2KN4 A;  1UNS A;  3HVZ A;  3PRP B;  4E71 A;  2O6V D;  1UBQ A;  2LGX A;  2LGY A;  2BYE A;  1TS3 A;  1GUA B;  2N1W A;  1I4R A;  1GB4 A;  3JYU A;  2CKH B;  3PZD A;  1R4N B;  2HJ8 A;  1LO5 D;  4P16 A;  3QWZ B;  1WXA A;  4YWG G;  5LXH A;  5GMV A;  3DVN V;  2QCZ A;  4KZ0 A;  1Z5S B;  3VRB B;  5J2R A;  4G50 A;  3RNC C;  1XXG A;  3W9C B;  3R66 C;  4MH0 E;  2LGI A;  2MP2 B;  4LNK A;  1ZDV A;  2I38 A;  3AEF B;  3LYY A;  1CJE A;  2LJI A;  1QIL A;  1IYF A;  4RGT A;  3VUY A;  2MWS B;  2WX1 A;  4RFB A;  2JZP A;  1Q0W B;  3AE8 B;  3A4R A;  3B1L X;  2NBU A;  4W9F A;  4WUR A;  3B0A A;  1P9D U;  2FCQ A;  1HA5 A;  3OLM D;  2KJH B;  5AZG A;  1WXM A;  3NUH B;  4K1R B;  4XZ4 A;  3E9S A;  2WLB A;  1AWD A;  4W9G A;  1PGB A;  2PMV A;  3QIJ A;  3GOE A;  4DHJ D;  3W1Y A;  3RZW C;  5HFY A;  3N1Z C;  2KO3 A;  2JF5 A;  3FKY A;  3VFK A;  3UQB A;  2KWC A;  2ZNV B;  3MHZ A;  4K3C A;  2OJR A;  1P1A A;  3U52 E;  4PK1 A;  2K1F A;  3M62 B;  1EO6 A;  2D07 B;  1U4A A;  2O2V B;  1YOV B;  1I4P A;  2N4F A;  1L0V B;  2J4X A;  2AQ1 B;  4KX6 B;  1CZP A;  2IY1 B;  2KQ7 A;  1UWX A;  2FAZ A;  3RT3 B;  3RCZ A;  1KFY B;  1F2R C;  3DDC B;  4PS8 A;  3L0W B;  2N9X A;  2IGG A;  3RNG C;  4AS1 A;  2G3Q B;  3SR6 A;  5EE3 A;  3SEB A;  1V5T A;  1EU3 A;  1BXT A;  3ZQ4 A;  2XK5 A;  1E10 A;  2DBY A;  3OG5 A;  3VR8 B;  2FUG 1;  3NVW A;  2BF8 B;  5AEK B;  1ZP0 B;  3QHT A;  1P7E A;  1UZX B;  4NJC A;  4HCN B;  4ACF A;  3CST A;  3U4E G;  3QX1 A;  3A9J B;  3BVG A;  1Y8R C;  5CTR C;  3ZJU A;  1D4B A;  2WXR A;  3ABV B;  4M8M A;  4PYZ A;  3VUW A;  4ZRK A;  4W9D A;  1V86 A;  4WH4 A;  1LQB A;  1GC7 A;  1ZPS A;  4MAC A;  1V81 A;  1PGA A;  1RYJ A;  4NAW B;  1T0Y A;  3TSS A;  4BKT A;  3W5V B;  3NHE B;  4HRS A;  4YL8 A;  2KJ6 A;  4ZHO A;  1TS5 A;  2LZ6 A;  2KJR A;  3RFZ B;  2JT4 B;  4B9K A;  3PLU A;  5FKA C;  3PZ7 A;  1YD8 U;  2LEK A;  3RYT A;  1WGR A;  2BYF A;  3QA8 A;  4WJP A;  2D11 A;  3PRE A;  3ZJV A;  2K9X A;  1YNT E;  1L5P A;  2XNA C;  2W55 A;  4ZRQ A;  3TEW A;  3ENE A;  3VRA B;  5CHV C;  2L8J A;  3ZNG C;  2BYV E;  2PE6 B;  3W1S C;  1L6U A;  4XDD A;  4NQL B;  3TEZ A;  3VXW A;  2C60 A;  1D5Z C;  2JU6 X;  5E6P A;  2AEH A;  3OJ4 B;  3P4S B;  4AJW A;  3ZVV A;  4FBJ B;  2RSU A;  1MG8 A;  4EZJ A;  3VUX A;  2JYE A;  2L83 A;  3H7P A;  4M8N A;  1ACC A;  1HZ6 A;  2GBJ A;  1HQR D;  1GNU A;  2J0M A;  2BKR B;  3FAH A;  4LNO A;  3TBL D;  4GXB A;  1R4M I;  1C79 A;  4KDL B;  3AMZ A;  2LFI A;  2O2V A;  5C1Z A;  1JWS D;  1E9M A;  2BPS A;  2L32 A;  3DBS A;  4ZRI A;  3EUB 2;  4XWW A;  3M3J A;  4MSM B;  1ET6 A;  3NZ3 A;  3N1X C;  2OED A;  4B95 A;  4XX5 A;  3AB5 A;  4NJ6 A;  3R2I A;  4REZ A;  3HRD D;  4LJP B;  3RD2 A;  3NOB A;  1T6B X;  2LRW A;  2WXP A;  2ZPY A;  5D6J B;  1WFY A;  2MJ3 A;  4IKG A;  3JW0 X;  1V6E A;  3KLS X;  3AV8 A;  2G9H D;  2GOW A;  4GDL B;  2DYB A;  2AX5 A;  3AEC B;  3B9J A;  1QKZ A;  4YSY B;  1PYW D;  3KUZ A;  4ITK A;  5L83 A;  1F9J A;  1KH0 A;  2ZEQ A;  1WY8 A;  4KSK C;  2IO0 B;  2ZCC A;  4EUT A;  3C8Y A;  4GMV A;  4JWS C;  2JWZ A;  2QMT A;  4JGH B;  2L1A A;  2V9H A;  1STE A;  1YQ4 B;  3DWM A;  1JWU D;  2SEB D;  3GZN B;  4H2A A;  2PTL A;  4NQK E;  2LUM A;  2TSS A;  3JSV B;  4BFR A;  2EMT A;  1UWM A;  3NG0 A;  1C76 A;  5JZE B;  1MVK A;  1ENF A;  1VD2 A;  5HG2 A;  2DYM A;  3KUC B;  2CJN A;  3NZU A;  1C78 A;  2GBK A;  3VQI A;  4M0W A;  2E3T A;  2CU3 A;  4ASW C;  2PVO D;  5AZH A;  3L4P A;  4RM8 A;  1RLF A;  3WAM A;  3TL5 A;  2OHF A;  3Q3M C;  2DX5 B;  3GE3 C;  3QCA A;  5G55 A;  4WJN A;  2FCM A;  4MM3 B;  1WXQ A;  2IGD A;  1HTO A;  1KF6 B;  5AUK A;  2N1V A;  1J8C A;  2KD0 A;  1E8Y A;  3RNA C;  2KAN A;  1F1H A;  2QJL A;  3VR9 B;  4MGI E;  3ZNH B;  1PGX A;  2LJ5 A;  4YSX B;  1WF9 A;  1WH3 A;  4US8 A;  4GDL A;  3PTF C;  2D2Q A;  3DHH C;  2WU2 B;  3GE8 C;  4IM2 A;  1Z2M A;  3ZW3 A;  2V3P A;  5C23 A;  5L95 C;  2EEL A;  4MDK E;  1YX5 B;  4IWQ A;  4HKZ E;  3N3K B;  4IC7 B;  1FIQ A;  2KC1 A;  4N59 A;  4XYC A;  2DYO A;  1TTN A;  3PGE A;  3MC0 B;  3B2F A;  1D5M C;  1K50 A;  2M0A A;  4MGK E;  3MC9 A;  5BMH A;  5JHB A;  3AEB B;  3JSV A;  4OZB A;  5HKH A;  1KLU D;  1NI2 A;  5D2M B;  2M1M A;  2Y5C A;  5EE1 A;  2VH2 A;  2IDY A;  4W9L A;  3UIO B;  3W1S A;  1HZ5 A;  1OTR B;  1Q5W B;  1QLB B;  4CQN A;  2LD9 A;  4X57 B;  1WZ0 A;  2J42 A;  2W82 A;  1P7F A;  1AW7 A;  1FXI A;  2BQQ A;  2V4L A;  4ZOH C;  5MPO A;  3QK0 A;  2ZW0 A;  3AE4 B;  3X23 A;  2RGF A;  2ICI A;  1WM3 A;  2K0P A;  3H8H A;  2KN5 A;  2MBQ A;  3IXS A;  1CK1 A;  5KHO A;  1EU4 A;  4MJS B;  3MC8 A;  2ZNV C;  4YTM B;  3JVZ X;  2W9N A;  4I6P A;  4YXD B;  1F77 A;  2INC C;  3CMM B;  2JUO A;  4FLH A;  4FHK A;  3ECI A;  3L08 A;  3LXF A;  4IM0 A;  3S2A A;  2C9W B;  2AL6 A;  2PE9 A;  5DPW A;  4BKG A;  3DBL I;  2RDH A;  2DZK A;  3C19 A;  1V49 A;  2HTH A;  1E8X A;  4JX1 C;  1B1Z A;  4IUM B;  1JWA D;  5E6J A;  4HRO A;  2NBW B;  4FAD A;  3V6C B;  5JXV A;  3DVN U;  2JX5 A;  1YN4 A;  1IP9 A;  1OQQ A;  1WGY A;  2Z0E B;  1WRI A;  4ARC A;  2NPT A;  2ONQ A;  3DCG A;  1XT9 B;  1RFK A;  3I3T B;  4HCP B;  1WMH A;  3GS2 A;  2KFJ A;  2KK8 A;  3MJ5 A;  2WDT B;  3BYY B;  1WX8 A;  4KKJ A;  3UGB B;  1J7A A;  3PRM B;  1GJZ A;  2X38 A;  4HXD A;  1E7V A;  2NMQ A;  4M00 A;  4K3B A;  3NJT A;  1R4M B;  1WIA A;  4M01 A;  4HLE A;  4OZC A;  3C0R B;  3ALB A;  2LHD A;  3BK2 A;  4BKS D;  1TKY A;  3DBR I;  2WYQ A;  3B08 A;  3L54 A;  1S1Q B;  2CHX A;  1MI0 A;  3FIL B;  2KTF A;  3BII D;  2C7M B;  1YN5 A;  1N5X A;  4BOZ B;  5AUI A;  3UIN B;  1LM8 B;  4OZA A;  4BKS A;  4EZL A;  2Y3A A;  4MGY E;  4OHJ A;  1R7S A;  2NCN A;  4RCO A;  4G11 A;  1SJE D;  1I35 A;  2KQS A;  4KKI A;  5C2T B;  2KC2 A;  4RM9 A;  2JXX A;  1LGR A;  2PEA A;  1WSP A;  3N1Y C;  2INN E;  2N9K A;  5FR3 A;  4B0M A;  2WXM A;  4R3D A;  1WE7 A;  4P1B C;  2JYT A;  2LGS A;  3Q3J A;  5JH5 C;  5J17 A;  2CJO A;  1NYQ A;  4A3O A;  2OJW A;  4A8X C;  3K9P B;  1QT9 A;  3R7R A;  4ZYS A;  2MLB A;  1AN8 A;  2ON8 A;  3PLV A;  2SAK A;  1V9J A;  3T3O A;  3AE1 B;  3ZO5 B;  3Q8C A;  2WQY B;  3RUI B;  4HJG E;  3EHV A;  1YQ3 B;  5DPR A;  4NAM A;  2PKO A;  4N6E B;  1HE8 A;  1XEE A;  4NNJ B;  1F52 A;  4LNF A;  2OOB B;  2NTT A;  5D3D A;  1SF0 A;  3FC4 A;  2BS3 B;  1T0S C;  2LUE A;  4GU2 A;  4S17 A;  2ZZP B;  2DZM A;  1LFD A;  4PYU A;  2KDB A;  4PS7 A;  2QIE B;  2MBH A;  5E6O A;  2WU5 B;  1E90 A;  5LLI A;  3U8Z A;  2BW2 A;  3V6E B;  2BWE S;  3ZTC A;  1TJE A;  1MHH E;  1PFD A;  4MH8 A;  3GZN I;  4BZA A;  1V1P A;  2KKC A;  4DXA B;  2IZV B;  4WWP A;  4JIO U;  2Z0D B;  3A1Q B;  3VVW B;  2K5P A;  3BY4 B;  4KIK B;  2YEP B;  5EE9 A;  4JWU C;  2DNF A;  2LRU A;  2V1Y A;  2YEP F;  3Q8B A;  3DBL B;  4RF0 A;  1VR9 A;  1BUI C;  4HPM B;  3IHP C;  2BBC A;  4DDG D;  4RNA A;  3IG3 A;  4RMA A;  2KDE B;  2NPT B;  3APC A;  2DZJ A;  2Q5W D;  2M17 A;  2LMC A;  5IO9 A;  4OVV A;  5IP4 D;  5TR5 A;  2WXI A;  2KMM A;  4GLS C;  1VZ8 A;  4NPN A;  3CWI A;  3Q8F A;  2WXL A;  2KTR A;  3ZGZ A;  2I2Y A;  2KMC A;  1FRD A;  1SJH D;  4G3X B;  4E74 A;  1L4D B;  1XCQ L;  1V80 A;  3PRZ A;  1SIJ A;  3NVY A;  1GAQ B;  2LVO A;  5C3J B;  1N63 A;  3KWL A;  4IDI A;  4HKQ A;  4WJQ A;  3IT6 B;  4F7Z A;  3TJP A;  2KXJ A;  2CHW A;  2WP9 B;  3AI5 A;  1TBE A;  2CR5 A;  1JAL A;  3WAP A;  1QF6 A;  4TUU A;  3NVV A;  2IJ0 A;  4CYE A;  4A20 A;  4FA6 A;  3EFC A;  1J19 A;  3ZDM C;  2PVG C;  4A90 A;  1TY0 A;  2H88 B;  4K7U A;  3IBE A;  2L52 A;  1OFF A;  4II3 B;  2A4Z A;  4OW0 A;  2IY0 B;  4W9J A;  2DEN B;  3R2T A;  2GI9 A;  5T8I A;  4K81 A;  1WGK A;  4F8C B;  2GBR A;  2KDM A;  3APF A;  2K3U A;  2KVZ A;  2KAJ A;  3Q8A A;  3MJW A;  1T3Q A;  3URY A;  3PHW B;  2KX3 A;  4ZRJ A;  1QQR A;  4W9H A;  3Q3N C;  4US9 A;  5D7G A;  5FK9 C;  1D5X C;  3VH4 B;  3DVG Y;  4LDT D;  4DXG A;  1SB3 C;  4WQM A;  4MEL A;  1FCL A;  4BBN F;  1E7U A;  3V05 A;  4A3P A;  4WAA A;  4LK0 M;  4LTU A;  1TKE A;  3RNB C;  2KWV B;  1TZ1 A;  3OJ3 A;  4TQ1 A;  2B3A A;  1SGH A;  2W3R A;  2KAC A;  4CHK A;  2BT6 A;  2GLS A;  3Q3O C;  1EWY C;  2LVQ A;  1L4Z B;  3AH7 A;  3BYT B;  1IUE A;  1C77 A;  3AED B;  1MPE A;  2LXA A;  3AU4 A;  2VH1 A;  3NS1 A;  3PZ8 A;  1B9R A;  5BYR A;  1VLB A;  2WXF A;  2DAF A;  1TS2 A;  2KWD A;  2KOX A;  4KV2 A;  2MHJ A;  4NAW A;  3P2B A;  1T0Q C;  4JPS A;  3W2D A;  2DHZ A;  5CHF A;  4N58 A;  3X0W A;  2KWU B;  1WGD A;  1TKG A;  1FXA A;  3H9D A;  4HWI B;  4YSZ B;  4KGR A;  3PVL A;  1HXY D;  1RM6 C;  2D3C A;  2MBB B;  3ZDT A;  4MSQ B;  3WAN A;  2AYO B;  3AE7 B;  2WXG A;  3U7Z A;  2G4S A;  4USA A;  4HK2 A;  4WWM A;  5TSS A;  3UQA A;  4EKU A;  3WAO A;  1KJT A;  2IPK D;  3ZJT A;  2O6V A;  3KYD D;  1WYW B;  2KX0 A;  4GGQ A;  1SEB D;  2FCN A;  1V97 A;  2JVC A;  3HM3 A;  4HDO A;  3VH3 B;  2GB1 A;  2INP E;  3ML8 A;  4EE2 A;  2EMS A;  3NZS A;  3BK1 A;  2HE7 A;  1E0Z A;  4DK5 A;  5G5G A;  2PIA A;  4MT5 A;  3HM6 X;  4P1C C;  1HTQ A;  4DWF A;  1UGM A;  1K51 A;  2DZI A;  4KSL C;  5LNK 1;  2WXK A;  1ZXI A;  2L3Z A;  2K6Q A;  2Y5P A;  1N62 A;  5BYQ A;  1UUP A;  1KOT A;  4I6L B;  3A9K A;  3V62 A;  2D5G A;  1J7B A;  2GRI A;  3N30 A;  2MH7 A;  1E5W A;  3U7D A;  1QZE A;  2ACZ B;  2MRP A;  4PS3 A;  4L23 A;  2WXH A;  3EA6 A;  1FNV A;  2E6X A;  2ZJD A;  2MA9 B;  1X1M A;  2IBI B;  1R4N I;  1FNU A;  2PPH A;  3UI3 A;  2WDV B;  1ZXH A;  2K25 A;  2LXC A;  2HDE A;  2MEK A;  4DBG A;  1FPY A;  2XEW A;  3PO0 A;  3E56 A;  2G45 B;  4A9A A;  2DWQ A;  2L0F A;  2REX A;  1ZGU B;  2X8X X;  2ZVO A;  3I57 A;  1RWS A;  1A5R A;  3NRZ A;  2IGH A;  5AZF A;  2RD0 A;  1ISN A;  4DHJ B;  2M4N A;  2J7Q B;  1UD7 A;  3RMK C;  3TUO A;  1Y56 A;  4C56 C;  2Z8L A;  1FD6 A;  2N7D A;  1SE3 A;  1XCT L;  3GB1 A;  2WDR B;  1OQY A;  4K7S A;  1LXD A;  3KUD B;  1JML A;  2KHW B;  3KYC D;  3VAW A;  2VRR B;  2BWF A;  3WCQ A;  3ZNZ B;  2WHI A;  2JWU A;  2C7N B;  1WWT A;  4CO7 A;  1FFU A;  1FCC C;  1DOI A;  4NZL B;  1DYQ A;  4W9I A;  4EEW A;  1JWB D;  2FNJ B;  4GDK A;  3AEG B;  2J0K A;  3ZKJ C;  3M63 B;  5G2N A;  2UU7 A;  4YTP B;  3UIP B;  3EGR A;  1C9F A;  1C4A A;  1SSN A;  3B2G A;  3O13 A;  1I7H A;  2QC8 A;  3ZYY X;  1DOX A;  3KH0 A;  3EC8 A;  1K8R B;  2V4I B;  4WQO B;  4S0R A;  1TIF A;  1KTK A;  4WWO A;  4GIV A;  3PPA A;  2JY6 A;  3A33 B;  1SBB B;  3AE3 B;  4NY0 A;  3P63 A;  2IO2 B;  1RAX A;  2K8C A;  2HD5 B;  2BB6 A;  1JCK B;  3T9L A;  3WA0 A;  1V2Y A;  4TKN A;  1EWC A;  2M8S A;  4ZRP A;  2RR9 A;  3DPD A;  1EF5 A;  4II2 B;  3VTW A;  2RDG A;  1NBF C;  1H8C A;  4OVZ A;  4DHZ B;  5D3I B;  3SU8 X;  1TT5 B;  1I4Q A;  2MSE D;  5E6N A;  4ZDV A;  1V1P B;  2AQ3 B;  2Y5B B;  2IND C;  4TMA B;  2CHZ A;  2PLP A;  4N9F 4;  1YJ1 A;  4JL9 A;  3BVZ A;  2L05 A;  1VRA B;  3SFE B;  4BVU C;  4ICV A;  2V3N A;  2KDF B;  3PV1 A;  2RMM A;  5D94 A;  2AWT A;  3KWV A;  1EF1 A;  3DHI C;  4IW0 A;  3NVZ A;  4EZK A;  1IBX A;  1GPX A;  4B0E A;  3BVM A;  2WDQ B;  3U2S C;  5HI1 A;  4JQW C;  1OEY J;  3LB8 C;  1L0Y B;  3N32 A;  4RGM A;  3P4P B;  1FMA D;  2ZPN A;  5EDS A;  1WXV A;  4J3O D;  4IM3 A;  3L10 B;  1F2R I;  2WXJ A;  1UGJ A;  1KLV A;  1E7P B;  2MBO A;  1WM2 A;  2MP2 A;  1M94 A;  2IO3 B;  2K6D B;  1XD3 B;  4XWT A;  3IVF A;  1C3T A;  3EEC A;  1YJI A;  4Q2J A;  3Q8E A;  4AWJ A;  1WZ3 A;  1N61 A;  2R61 A;  3AE9 B;  1QOB A;  2C7H A;  3NY5 A;  5CHW A;  1FEH A;  1K52 A;  1XLP A;  4F1S A;  2MW5 A;  4OVU A;  2N9E B;  2BKF A;  3IT4 B;  3AXC A;  1J0G A;  1T5X D;  1C4P A;  2I1K A;  3FIL A;  4RH6 A;  4W9C A;  2EKI A;  3T8M A;  4ZYN A;  1WMH B;  1BML C;  2W3S A;  4M02 A;  5IN7 A;  5BMG A;  5CX3 A;  1AAR A;  2JSV X;  3ONS A;  2AQ2 B;  2R2O A;  2L7R A;  2BS2 B;  4AUQ C;  3AE6 B;  3VTV A;  1L2N A;  2MCN B;  2ZCB A;  3RNE C;  1XLQ A;  1FO4 A;  2H89 B;  3VHT C;  1JRP A;  3DVG X;  3P4Q B;  3PSE B;  4D2K A;  1D3Z A;  3I63 C;  3N9Y C;  1L6V A;  2L76 A;  1N5W A;  2QSD A;  2D3A A;  4ANU A;  4NJ7 A;  4C4V B;  3O65 B;  2LGD A;  4MEM A;  3LJ3 A;  2M19 A;  1EUV B;  5KHQ A;  1WJN A;  4XE0 A;  1WJ6 A;  1RRB A;  3HK0 A;  3DWG C;  4GB9 A;  4FXC A;  3WIM A;  1TYG B;  3M95 A;  2BTE A;  4TQ0 A;  1MFW A;  4KZC A;  3Q69 A;  3RI7 C;  2BVC A;  3RN9 C;  3KVF B;  3PT2 B;  1XLO A;  2DAJ A;  2MX2 A;  3DQV A;  1N60 A;  2N0S B;  1JQ4 A;  4HDQ A;  3BZD B;  1XLN A;  2V3S A;  2XBB C;  1OGW A;  4URK A;  2CS4 A;  1CQV A;  1VCB A;  3AE5 B;  1YX6 B;  3L16 A;  1TS4 A;  3SDL C;  2BGF A;  3OWE B;  3ZRC A;  2WS3 B;  2G1E A;  2A5U A;  3DOW A;  1WR6 E;  3HUI A;  1ESF A;  2YVC A;  3QQ8 B;  2RDB C;  4HPL B;  2VZK D;  3AE2 B;  4AQ7 A;  2FE8 A;  3A9J A;  2JPH A;  2MQJ A;  3L17 A;  3AUL A;  1NEN B;  4GOC A;  3QAQ A;  2LVP A;  3HIZ A;  1SE9 A;  2WXQ A;  1GOZ A;  2BS4 B;  5BO4 B;  3RNF C;  1SIF A;  1WR1 A;  3AU5 A;  3RPF C;  1NDD A;  1TZO A;  1ZOY B;  4AP4 C;  5DPS A;  3TEX A;  4GN1 A;  1V8C A;  1T0R C;  4KGT A;  4EFO A;  4IG7 B;  1WX9 A;  2BYT A;  3TCA A;  2WWZ A;  1E8Z A;  1TY2 A;  2FBW B;  2MJE A;  1PQS A;  4FHJ A;  3TMP B;  3GP7 A;  2DLB A;  4DHZ E;  2Z59 B;  3SHQ A;  1PDX A;  4C80 A;  2RPQ A;  2WNM A;  3H7S A;  1F0Z A;  2QEJ C;  3AM9 A;  1UF0 A;  1TGZ B;  2G4D B;  3A1Q A;  1NYR A;  1OEY A;  1NEK B;  1KRH A;  1NI3 A;  3ZIM A;  4BAX A;  1P0R A;  5I4D A;  4FN2 A;  2FCS A;  4W9E A;  3ZUN A;  2KT7 A;  4LNI A;  5IA7 A;  3QC8 B;  1ZW7 A;  3ETR A;  1WJU A;  4HJK A;  4C7Z A;  2L0T A;  3UF8 A;  1JRU A;  4ZHP A;  3DBH B;  4C4V A;  3PHX B;  1Q10 A;  1WGH A;  1V1O A;  5G5H A;  3DHG C;  4KGS A;  1WI0 A;  2NTS A;  1ZE3 D;  3Q6B A;  2N9P C;  1VJK A;  1FXT B;  1VZ7 A;  2WGS A;  2N7E A;  5DPT A;  4FUL A;  2GBM A;  2D3G A;  4IOI E;  3T3N A;  2KFK A;  2NS5 A;  4O1N A;  3VTU A;  5BYS A;  3CSF A;  4A6Q A;  1XQQ A;  2FID A;  4IWP A;  4ANV A;  3IAM 1;  5H92 C;  1S3S G;  2M0X A;  4TSS A;  2YLM A;  2K8H A;  3I5J C;  1A70 A;  4WWN A;  1ZKH A;  2ZVN A;  4E3C A;  3U30 A;  5DCN A;  1WE6 A;  5GXG B;  1DGJ A;  1IBX B;  3APD A;  5IAA C;  3TEY A;  1KM7 A;  2JZZ A;  4MGZ E;  3CF6 E;  1DOY A;  1VZ6 A;  1I4X A;  3W5U B;  1P3Q U;  1ET9 A;  3AEE B;  3KW5 B;  2N7J A;  1SXT A;  1WJ4 A;  3Q2A C;  1MG4 A;  4YT0 B;  2CU1 A;  2QIL A;  4K7W A;  4KVG B;  2N9L A;  4ANX A;  4M0W B;  3SFD B;  2WXO A;  2PW9 A;  4FJV B;  2XK5 B;  2IO1 B;  2JQR B;  4A55 A;  1I4G A;  1QOG A;  4RF1 A;  3ZLZ A;  1V5O A;  1FNW A;  4MM3 A;  3V60 A;  3ZRF A;  1YMH E;  1JW9 D;  1IGD A;  2EKE C;  3MP9 A;  5FR6 A;  1GB1 A;  4TV3 A;  4J6I A;  1K53 A;  1SE4 A;  2ASQ A;  1UH6 A;  1YJJ A;  2JRH A;  4LCD E;  1E6E B;  3SD5 A;  1OQR A;  2JZ3 B;  1I4H A;  2VZK B;  2KFK B;  3BIN A;  3K9O B;  3OAW A;  1QOF A;  1YIW A;  3P4R B;  2J0J A;  4BOS C;  2KZR A;  4EOY A;  1D6E C;  1FRR A;  3A9K B;  4XGA B;  3N20 C;  4GSW A;  3D32 A;  4HEA 1;  4C00 A;  2R2Q A;  1AYF A;  4KIK A;  4AJY B;  2HTM E;  4HVB A;  1E8W A;  1UEL A;  1VDV A;  1RFA A;  2K22 A;  3TIX A;  5JHA A;  1L0X B;  2FIF A;  2W54 A;  1ZUD 2;  2K8B A;  1H4R A;  2ZW1 A;  2KDI A;  2UYZ B;  4QAY A;  5H8Y E;  2MJD A;  5BMI A;  2KQ4 X;  1FFV A;  2MBE A;  1I42 A;  3NS8 A;  3ZTD A;  3ZXV A;  4HPP A;  4PT5 A;  1NVI D;  1L7Y A;  2C5L C;  4WAF A;  2KTR B;  1Q1O A;  4UDU C;  2GBN A;  4DDI D;  1C1Y B;  3L13 A;  4FJY A;  3V61 A;  3HVD A;  5IKC M;  1WX7 A;  3Q14 C;  4P6V F;  2L00 B;  4JLC A;  3R7Q A;  1MHX A;  2I1J A;  3H1U A;  3R8B A;  2WXN A;  3QAR A;  2V0G A;  2D3B A;  3H7P B;  3ML9 A;  1WRD B;  3J9C A;  3HHM A;  3R3M A;  4KDI C;  4XDC A;  2KLG A; 
#chains in the Genus database with same CATH homology
 2OED A;  2J52 A;  3Q8F A;  1FEH A;  1K52 A;  1XLP A;  4YTN B;  2WXL A;  3AB5 A;  4REZ A;  3R2I A;  3ZGZ A;  2I2Y A;  1J7C A;  3HRD D;  1FRD A;  1SJH D;  1ROE A;  1T6B X;  2WXP A;  1L4D B;  3IT4 B;  1XCQ L;  1T5X D;  1C4P A;  2MJ3 A;  1SIJ A;  3NVY A;  3FIL A;  1GAQ B;  3AN1 A;  4RH6 A;  4IKG A;  1N63 A;  2B76 B;  3KLS X;  5C3J B;  3KWL A;  2BB5 A;  3AV8 A;  4IDI A;  2G9H D;  2EKI A;  3MFG A;  4GDL B;  4HKQ A;  2AX5 A;  3AEC B;  3B9J A;  1WYG A;  3IT6 B;  4L1B A;  1BML C;  1XF5 L;  2W3S A;  1QKZ A;  2WP9 B;  5BMG A;  1JAL A;  4YSY B;  1PYW D;  1QF6 A;  4DXF A;  1YN3 A;  2JSV X;  3NVV A;  2IJ0 A;  1EM7 A;  2AQ2 B;  3IAS 1;  4ITK A;  2BS2 B;  1KH0 A;  3AE6 B;  2PVG C;  4A90 A;  1XLQ A;  1FO4 A;  1TY0 A;  2H88 B;  2H89 B;  1JRP A;  2L52 A;  3C8Y A;  3P4Q B;  4D2K A;  1OFF A;  3KQ4 A;  4JWS C;  3N9Y C;  1L6V A;  2QMT A;  1IGC A;  1N5W A;  2L1A A;  2QSD A;  1STE A;  4OW0 A;  1YQ4 B;  3DWM A;  3P42 A;  3R2T A;  1JWU D;  2GI9 A;  5T8I A;  2SEB D;  3P1M A;  2M19 A;  4H2A A;  2PTL A;  1WGK A;  2LUM A;  2TSS A;  4XE0 A;  5HHD G;  2KDM A;  3DWG C;  2K3U A;  1UWM A;  1ZDX A;  2KAJ A;  3Q8A A;  4FXC A;  1T3Q A;  1C76 A;  3URY A;  1MVK A;  1TYG B;  1ENF A;  2BTE A;  5HG2 A;  1C4C A;  1QQR A;  4TQ0 A;  2DYM A;  3Q69 A;  4US9 A;  5D7G A;  2CJN A;  5FK9 C;  4LLG M;  1C78 A;  3VQI A;  4M0W A;  1D5X C;  2E3T A;  1XLO A;  2CU3 A;  4GDK B;  1SB3 C;  4DXG A;  2PVO D;  4WQM A;  3L4P A;  1FCL A;  1N60 A;  4RGO S;  2N0S B;  3V05 A;  1JWM D;  1PUT A;  4L2Y A;  4C7Y A;  1JQ4 A;  2J53 A;  4LK0 M;  3BZD B;  4LTU A;  2OHF A;  3CIR B;  1TKE A;  1XLN A;  4WIP A;  4JE3 B;  4MM3 B;  4TQ1 A;  1WXQ A;  5EE0 A;  2IGD A;  1KF6 B;  5AUK A;  1M4V A;  2W3R A;  2KAC A;  2BT6 A;  1KLG D;  1CQV A;  2M56 B;  1QOA A;  1EWY C;  3AE5 B;  1L4Z B;  3AH7 A;  2QJL A;  3BYT B;  3VR9 B;  1IUE A;  1C77 A;  3AED B;  1MPE A;  1TS4 A;  1PGX A;  4YSX B;  3NS1 A;  3V3X A;  3PZ8 A;  1JRO A;  1XO3 A;  3OWE B;  2JXT A;  4US8 A;  1SE2 A;  2G1E A;  2WS3 B;  5BYR A;  1B9R A;  3HUI A;  3I9V 1;  1VLB A;  2WXF A;  1ESF A;  1TS2 A;  3AEA B;  2WU2 B;  2KWD A;  4JPS A;  3W2D A;  4RGN A;  2VZK D;  4DQO C;  3AE2 B;  4N58 A;  1FM0 D;  2V3P A;  1TKG A;  1FXA A;  2RPV A;  4AQ7 A;  3BWU D;  4YSZ B;  2FE8 A;  2EEL A;  4KGR A;  1HEZ E;  2LHE A;  2XN9 C;  1HXY D;  1RM6 C;  2KN4 A;  1UNS A;  3HVZ A;  4HKZ E;  1NEN B;  1FIQ A;  1TS3 A;  4N59 A;  3AE7 B;  2WXG A;  2DYO A;  1I4R A;  3U7Z A;  4USA A;  3MC0 B;  1GB4 A;  2WXQ A;  4WWM A;  5TSS A;  1GOZ A;  1LO5 D;  2BS4 B;  4P16 A;  3B2F A;  4YWG G;  3RPF C;  1D5M C;  1K50 A;  2IPK D;  2M0A A;  3ZJT A;  5BMH A;  1TZO A;  1ZOY B;  1SEB D;  3AEB B;  4OZB A;  1V97 A;  3TEX A;  1KLU D;  5EE1 A;  2Y5C A;  1V8C A;  3VRB B;  2IDY A;  4KGT A;  2GB1 A;  2INP E;  1XXG A;  2BYT A;  4EE2 A;  3W9C B;  3W1S A;  1HZ5 A;  1QLB B;  1TY2 A;  4CQN A;  2FBW B;  3BK1 A;  2LGI A;  2MJE A;  1E0Z A;  1ZDV A;  5G5G A;  2I38 A;  2PIA A;  4MT5 A;  3GP7 A;  2DLB A;  3AEF B;  3LYY A;  1CJE A;  2J42 A;  2LJI A;  2W82 A;  1QIL A;  1K51 A;  1P7F A;  1AW7 A;  1FXI A;  5LNK 1;  2WXK A;  4RGT A;  1ZXI A;  4ZOH C;  5MPO A;  4RFB A;  1PDX A;  2Y5P A;  2ZW0 A;  2JZP A;  4C80 A;  1N62 A;  2WNM A;  5BYQ A;  1F0Z A;  2QEJ C;  3AE8 B;  1UUP A;  3AE4 B;  3AM9 A;  4WUR A;  2ICI A;  2K0P A;  3H8H A;  3IXS A;  1CK1 A;  1HA5 A;  2D5G A;  1NYR A;  1J7B A;  1EU4 A;  2GRI A;  2MH7 A;  4YTM B;  1NEK B;  1KRH A;  1NI3 A;  2ACZ B;  4L23 A;  5I4D A;  4YXD B;  1F77 A;  2WXH A;  3EA6 A;  1FNV A;  2E6X A;  3NUH B;  3ETR A;  1FNU A;  3UI3 A;  4C7Z A;  2WDV B;  1ZXH A;  3LXF A;  3E9S A;  4ZHP A;  2HDE A;  2MEK A;  2WLB A;  1AWD A;  3PO0 A;  1PGB A;  2PMV A;  3E56 A;  1Q10 A;  2RDH A;  4A9A A;  2DWQ A;  1V1O A;  5G5H A;  5HFY A;  4KGS A;  4JX1 C;  2NTS A;  1B1Z A;  1JWA D;  1ZE3 D;  5E6J A;  4HRO A;  3I57 A;  1VJK A;  3MHZ A;  5JXV A;  1VZ7 A;  1RWS A;  4ARI A;  3NRZ A;  2JX5 A;  3U52 E;  2IGH A;  1YN4 A;  1OQQ A;  1WRI A;  4IOI E;  3T3N A;  4ARC A;  4O1N A;  1I4P A;  3TUO A;  1L0V B;  2J4X A;  2ONQ A;  1Y56 A;  4C56 C;  5BYS A;  2Z8L A;  1RFK A;  4A6Q A;  2AQ1 B;  1FD6 A;  4KX6 B;  1CZP A;  1SE3 A;  3IAM 1;  3GS2 A;  1UWX A;  1XCT L;  3GB1 A;  3MJ5 A;  3BYY B;  2WDR B;  4KKJ A;  1J7A A;  2X38 A;  1KFY B;  5H92 C;  2NMQ A;  1JML A;  1F2R C;  4XDC A;  2IGG A;  4AS1 A;  4TSS A;  3WCQ A;  2JWU A;  1A70 A;  1WWT A;  1FFU A;  4OZC A;  1FCC C;  3SR6 A;  1DOI A;  5EE3 A;  4NZL B;  1DYQ A;  2LHD A;  3SEB A;  3BK2 A;  1TKY A;  1EU3 A;  5GXG B;  1JWB D;  1IBX B;  1DGJ A;  1MI0 A;  3FIL B;  3TEY A;  1BXT A;  3BII D;  3ZQ4 A;  3AEG B;  1E10 A;  1YN5 A;  2DBY A;  3VR8 B;  2FUG 1;  3NVW A;  1N5X A;  5AUI A;  1DOY A;  1ZP0 B;  4YTP B;  1P7E A;  3EGR A;  4OZA A;  4NJC A;  1VZ6 A;  2Y3A A;  4OHJ A;  1I4X A;  3W5U B;  1C9F A;  1C4A A;  1R7S A;  1ET9 A;  3AEE B;  1SSN A;  4RCO A;  3U4E G;  1SJE D;  3B2G A;  2N7J A;  4KKI A;  1SXT A;  5C2T B;  3O13 A;  1I7H A;  3ZYY X;  1DOX A;  4YT0 B;  2QIL A;  3BVG A;  2V4I B;  3ZJU A;  1WSP A;  2N9L A;  1D4B A;  2WXR A;  1KTK A;  2INN E;  2N9K A;  3ABV B;  3SFD B;  5FR3 A;  2WXO A;  2PW9 A;  4B0M A;  2WXM A;  4R3D A;  1SBB B;  3AE3 B;  2JQR B;  4A55 A;  3P63 A;  2JYT A;  1I4G A;  1QOG A;  4RF1 A;  4WH4 A;  2CJO A;  1ZPS A;  4MAC A;  1PGA A;  1FNW A;  1RYJ A;  1NYQ A;  2BB6 A;  4NAW B;  1YMH E;  1JW9 D;  1JCK B;  1IGD A;  3TSS A;  3MP9 A;  1GB1 A;  4A8X C;  3W5V B;  1QT9 A;  4ZYS A;  1AN8 A;  2ON8 A;  4HRS A;  1EWC A;  1K53 A;  1SE4 A;  2SAK A;  3T3O A;  3AE1 B;  4ZRP A;  1YJJ A;  3Q8C A;  2WQY B;  1E6E B;  4ZHO A;  2RDG A;  4HJG E;  1OQR A;  4OVZ A;  1TS5 A;  3RFZ B;  1I4H A;  2VZK B;  1YQ3 B;  5D3I B;  3PZ7 A;  2PKO A;  4NAM A;  5FKA C;  1QOF A;  2LEK A;  4N6E B;  3P4R B;  1I4Q A;  1XEE A;  3ZJV A;  2K9X A;  1YNT E;  1L5P A;  1V1P B;  2XNA C;  2W55 A;  1D6E C;  1FRR A;  2AQ3 B;  2NTT A;  4ZRQ A;  5D3D A;  4TMA B;  3TEW A;  1SF0 A;  2PLP A;  3FC4 A;  2BS3 B;  3VRA B;  4HEA 1;  1AYF A;  3BVZ A;  1L6U A;  1VRA B;  3SFE B;  2V3N A;  2HTM E;  4XDD A;  1VDV A;  2RMM A;  3TEZ A;  2QIE B;  3KWV A;  2K22 A;  2WU5 B;  3NVZ A;  1L0X B;  1D5Z C;  2W54 A;  2JU6 X;  1IBX A;  1ZUD 2;  2BW2 A;  3P4S B;  2ZW1 A;  1GPX A;  4B0E A;  3BVM A;  2WDQ B;  5H8Y E;  2MJD A;  5BMI A;  1TJE A;  1MHH E;  5HI1 A;  3U2S C;  1PFD A;  4MH8 A;  2KQ4 X;  3LB8 C;  1L0Y B;  1FFV A;  2JYE A;  1V1P A;  2L83 A;  4RGM A;  3P4P B;  4PT5 A;  1NVI D;  1FMA D;  1ACC A;  4J3O D;  1HZ6 A;  2K5P A;  1F2R I;  1HQR D;  2WXJ A;  2YEP B;  4WAF A;  1UGJ A;  5EE9 A;  4JWU C;  4UDU C;  1E7P B;  3FAH A;  3Q8B A;  2YEP F;  4RF0 A;  1VR9 A;  1BUI C;  3HVD A;  2BBC A;  1C79 A;  4RNA A;  3AMZ A;  2LFI A;  4XWT A;  4P6V F;  1JWS D;  1YJI A;  4Q2J A;  1E9M A;  2Q5W D;  1MHX A;  2LMC A;  2L32 A;  3Q8E A;  3R8B A;  2WXN A;  2WXI A;  2V0G A;  2KMM A;  1N61 A;  3EUB 2;  3J9C A;  2R61 A;  4GLS C;  4XWW A;  3AE9 B;  1VZ8 A;  1QOB A;  1ET6 A;  3NZ3 A;  3CWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...