1FXIA

Structure of the [2fe-2s] ferredoxin i from the blue-green alga aphanothece sacrum at 2.2 angstroms resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
96
structure length
96
Chain Sequence
ASYKVTLKTPDGDNVITVPDDEYILDVAEEEGLDLPYSCRAGACSTCAGKLVSGPAPDEDQSFLDDDQIQAGYILTCVAYPTGDCVIETHKEEALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the [2Fe-2S] ferredoxin I from the blue-green alga Aphanothece sacrum at 2.2 A resolution.
pubmed doi rcsb
source organism Aphanothece sacrum
molecule tags Electron transfer (iron-sulfur protein)
molecule keywords FERREDOXIN I
total genus 14
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1990-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fxiA00
1ZOYB 3VR9B 2K9XA 2KAJA 2CJNA 3AEAB 1YJJA 2E3TA 2PVGC 1NENB 2QIEB 3FAHA 1KF6B 3ETRA 3P4SB 1R7SA 2H88B 1AWDA 1F0ZA 1WYGA 4HROA 1QLBB 1TKYA 2H89B 3AN1A 1DOYA 2PKOA 1XLNA 1L6UA 4YT0B 1V97A 1JALA 1XLQA 1VDVA 1J7AA 2EKIA 1L6VA 2DWQA 4YXDB 3B2GA 1E6EB 4ZOHC 1QF6A 1JW9D 2WDVB 3EUB2 2WLBA 3AMZA 1OQRA 2KMMA 3P1MA 1ZUD2 1EWYC 2K22A 1GPXA 1RWSA 1TYGB 3DWMA 1DOIA 1JRPA 4HRSA 3NRZA 1J7BA 3P4RB 3AEGB 1JROA 1WXQA 3AE8B 1NEKB 2Q5WD 4P6VF 3BIID 3VRBB 4JX1C 4YSZB 5AUIA 1XO3A 1L0VB 2LEKA 3PO0A 5EE3A 1V8CA 1A70A 1QOFA 2WDRB 2G1EA 1QOAA 3AE1B 1RFKA 1FIQA 2M19A 3AE5B 3CWIA 1YJIA 3AECB 1DOXA 1KFYB 1YQ3B 1ZP0B 2JX5A 1FO4A 5EE1A 5C3JB 2JQRB 1OFFA 1XLOA 4IDIA 4ZHOA 2WU5B 3LB8C 3NVWA 4US9A 3RPFC 3SFDB 1FFVA 1FXAA 1QOGA 2M56B 3KWLA 3NVYA 3HVZA 1FM0D 1FXIA 5EE0A 3AEDB 2CU3A 5G5GA 1RYJA 4N6EB 3AH7A 3WCQA 1VJKA 4C7YA 1N62A 3W5UB 1XLPA 2K5PA 2WP9B 3AEEB 4FXCA 3HRDD 3AV8A 1B9RA 1PFDA 1RM6C 3AEFB 3P63A 4ITKA 1SB3C 5MPOA 5H8YE 2WS3B 3P4PB 2DBYA 1N5XA 1NYRA 2L52A 3B9JA 3AE4B 2MJ3A 4C80A 2MH7A 4KX6B 2W54A 4C7ZA 2Y5CA 1N61A 2MJDA 2W55A 1N63A 3AE9B 1OQQA 1UWMA 1TKEA 1JWAD 5GXGB 2WU2B 4YSYB 4YSXB 1IUEA 1JQ4A 2MJEA 1SF0A 1I7HA 4YTMB 2WQYB 1PDXA 1E7PB 2BS4B 3HUIA 3NVZA 1E0ZA 1CJEA 1JWBD 1GAQB 1PUTA 3NVVA 1ROEA 2N0SB 1WGKA 1QOBA 1J7CA 1E9MA 3FC4A 4JWUC 1L5PA 4YTNB 4A9AA 3L4PA 2BS2B 4LTUA 1TKGA 3LXFA 2ACZB 2WDQB 2AX5A 3AEBB 3SR6A 1N60A 1WRIA 1FRDA 1TJEA 1ZXIA 2CJOA 2L83A 1NYQA 3W9CB 3B2FA 1CZPA 1SIJA 1VLBA 5EE9A 3AE2B 2BT6A 3AE7B 1DGJA 1FMAD 2OHFA 4N58A 3NS1A 3W5VB 5G5HA 3ZYYX 4WQMA 1QT9A 3DWGC 5AUKA 5C2TB 2FBWB 1YQ4B 2PVOD 1FRRA 3CIRB 1NVID 4USAA 1E10A 1FFUA 3AE6B 5H92C 3AM9A 2QJLA 3VRAB 2W3SA 3P4QB 3VR8B 2B76B 4N59A 1N5WA 2BS3B 4ZHPA 4JWSC 4YTPB 4US8A 2PIAA 1NI3A 3AE3B 2W3RA 3AB5A 1WWTA 1T3QA 1KRHA 4WWMA 1AYFA 2HTME 3ABVB 3SFEB
chains in the Genus database with same CATH superfamily
3AU5A 2CJNA 2PVGC 3DBLI 4WJPA 2IYDB 2GBNA 1WGRA 1XQQA 4B0MA 2AQ3B 4ZOHC 3NOBA 1K50A 4G3XB 2HJ8A 1B1ZA 3DWMA 2HJ1A 1SIFA 5FR3A 3AEGB 2ZNVC 4NAMA 4XC2A 4NJ6A 5EE3A 1XXGA 3AE1B 2G1EA 2EMTA 3Q8FA 2V0GA 3GZNI 3NJTA 3N3KB 2VRRB 4K81A 3ONSA 1YX5B 1PGXA 4ITKA 4B9KA 3UI3A 5MPOA 2G4SA 3X23A 3NHEB 1WJUA 4FHKA 1KTKA 5GXGB 4A90A 4II3B 2K6QA 2DZMA 5DPRA 1I7HA 2K39A 1E0ZA 3HIZA 2IDYA 3VUWA 4N58A 2WYQA 2AL3A 2FCSA 4D2KA 2K6DB 2LGYA 1C9FA 2FBWB 2PVOD 4G11A 4K7WA 2MW5A 3WAOA 3QHTA 2WXMA 3P4QB 4RFBA 4RGNA 2Z0DB 2G9HD 2V3NA 5DPTA 2CKHB 1WWTA 4RNAA 4WWMA 4G50A 3V60A 2K9XA 4URKA 3ETRA 3L10B 1AWDA 3TIXA 2KO3A 1WMHA 4WJOA 1AARA 3PV1A 1PGBA 2GI9A 4PS8A 4KKJA 3EECA 3KVFB 2LHDA 4HK2A 1GPXA 2I38A 1JRPA 1GUAB 1NEKB 3RNCC 4IWPA 2BQQA 3I57A 2JXXA 1YJIA 4C56C 1DOXA 1YQ3B 1HA5A 2IGDA 2BVCA 3KWLA 2ZVOA 2GOWA 2FCQA 3Q3JA 2K8HA 1V2YA 2AQ2B 1BUIC 3AI5A 3LYYA 3HRDD 1RAXA 4LJOB 5HFYA 1ZDXA 4ZRKA 2DAJA 1WX8A 5D3DA 1YD8U 3U7ZA 3BVGA 3IFWB 3P2BA 2ON8A 2KDFB 2QDFA 3APCA 2Y5CA 2D07B 2NTSA 2M17A 2KWVB 2ZPYA 3HHMA 2ICIA 1PDXA 3BYTB 4N9F4 3BY4B 1HQRD 3Q3MC 3Q69A 2L83A 3B2FA 1SIJA 4RF0A 1VLBA 1SE4A 3NZSA 4WURA 3E9SA 3ZUNA 1NI2A 2O6VB 2V4IB 1PGAA 5BYQA 3Q2AC 4GXBA 3DWGC 3MC0B 2IO0B 1ET6A 3JVZX 4FADA 4W9GA 2GBMA 3VUYA 1FCCC 1AW7A 2KJHB 3QAQA 3WALA 2YEPF 2EMSA 5IAAC 5LXIB 4DQOC 2ZPNA 1RLFA 1V5TA 1NBFC 2LD9A 2PE6B 2RDGA 1UGJA 1MJDA 3W1SA 4LNFA 2J42A 2KWCA 3H1UA 2W9NA 3M63B 3EA6A 4LNNA 3V61A 2WDVB 3H7PB 2WXGA 1TYGB 1J7BA 2ZW0A 5JXVA 2LJ5A 4RF1A 1UNSA 2RSUA 1T5XD 3OJ3A 3ML9A 2A4ZA 4PS3A 4ZHOA 2D2QA 2JWZA 2N4FA 1L4DB 4US9A 3E56A 4HJKA 2IGGA 5G5GA 4HPMB 2IO2B 4AOFA 3LJ3A 1MFWA 2MCNB 3GP7A 2WGSA 3ZO5B 2KWUB 4W9LA 4BKTA 4FJYA 4HPLB 2N9KA 4BKSA 1UD7A 2BBCA 1SF0A 4L1BA 4ICVA 3C19A 1D5XC 2C7MB 2E6XA 2D3CA 1E9MA 2WDQB 1JCKB 1TS2A 3JSVA 2KMAA 4LJPB 1TS4A 1L0YB 2D3AA 3W5VB 2K3UA 5G5HA 4HKZE 1PQSA 1E10A 1YQ4B 3URYA 4OVUA 4USAA 3AE6B 2WXPA 3V62A 4PK1A 3IHPC 3T3OA 1WH3A 5JH5C 4NZLB 3U52E 2LJIA 2ZJDA 3VR9B 2L32A 2E3TA 4FHJA 5E6JA 4FJZA 1V1OA 4X57B 2BWFA 1ACCA 1KM7A 2KJ6A 4BKGA 2LGDA 4MGYE 4KGRA 1V97A 2EKIA 3X0WA 3WAMA 1YNTE 2K25A 3V6CB 2LHEA 3N1YC 3VDZA 1CK1A 3JW0X 4TSSA 4MJSB 1ZE3D 2INCC 4P1CC 2XK5A 3JYUA 1WM3A 1A5RA 4OW0A 4MSMB 2X8XX 4JE3B 3JSVB 1FXTB 1XEEA 1QQRA 2WU5B 3LB8C 3RPFC 1IP9A 4F8CB 3R7RA 3PPAA 3ZTDA 3NVYA 2M56B 3HVZA 1FM0D 4ASWC 2FE8A 1B9RA 1V80A 1UBQA 2KTFA 4A55A 1LQBA 2JWUA 1R4NB 2MJ3A 2KTRA 2CHXA 2DAFA 4MSQB 3UIOB 2LMCA 4DHJD 5HKHA 1WGKA 1V5OA 1L7YA 1Z5SB 3SR6A 2AX5A 4US8A 3ZRCA 4G0NB 1M94A 3W9CB 3WANA 3UQAA 1I4XA 4IC7B 1Y56A 5G55A 3NZ3A 2QILA 1TY2A 1WGHA 1S1QB 1IGDA 2AEHA 2PLPA 4IWQA 4ZHPA 4GU2A 1C76A 1Q5WB 1V1PB 2KDMA 4IG7B 1LXDA 3GZNB 1KF6B 1WE7A 2H88B 2OJWA 1WXAA 1TS3A 2PKOA 4GN1A 3A4RA 1EU4A 2GBKA 1RFAA 1VRAB 2Y5PA 4BZAA 1ESFA 2QHOA 2V3SA 3PGEA 4DHZE 2KC1A 3H9DA 1ZPSA 4RCOA 3A4SC 1SXTA 5AUIA 4WAFA 1L0VB 2VH2A 2J0MA 3AECB 1KFYB 3VXWA 2QEJC 1TS5A 1YJ1A 2Z0EB 2ZVNA 2RR9A 2JY6A 4TKNA 5KHOA 1GJZA 4NY0A 5CHWA 3MJ5A 4AJWA 2FCNA 2DBYA 3MTNB 3L0WB 1TT5B 2JF5A 4DDID 4EUTA 2JVCA 1IYFA 1WMHB 4IM2A 4KIKB 1WIAA 1ZXIA 3ZNHB 4NQKE 1TBEA 2BT6A 4CHKA 5BMHA 1IBXA 5HHDG 2WHIA 2W3SA 4BOZB 1STEA 1MI0A 4ZRPA 2RD0A 2MQJA 2Z8LA 2WXRA 4M0WA 2O6VA 2KAJA 1KLGD 2LVPA 4ZYSA 3R66C 2KJRA 3DBLB 3C0RB 1F0ZA 4RGTA 1D6EC 2JXTA 1KH0A 3P42A 5D6JB 4DWFA 1GG3A 2FNJB 1P9DU 4NPNA 5CX3A 3AU4A 2AL6A 2D5GA 2LEKA 3PO0A 1TZOA 2C7NB 4B0EA 1YMHE 1FD6A 3DHHC 5HG2A 5CHFA 1WX7A 1P1AA 3N1ZC 2XBBC 3ZLZA 3NVWA 3W1SC 3OJ4B 4OZCA 1LO5D 3MHSD 4N6EB 5C1ZA 3RYTA 3ZTCA 4FXCA 1TIFA 4GB9A 4KV2A 2LUEA 2MWSB 3BVMA 2KHWB 2M0AA 2R61A 3BINA 4I6NB 1KOTA 3B1LX 1JWAD 2KVZA 3APFA 1UWXA 1JWBD 4GDKA 2N7JA 1YOVB 5BMGA 2INPE 1JRUA 2MP2A 2BS2B 3EC8A 1N60A 2O6VD 3RNFC 2MHJA 1NYQA 1EWCA 2MLBA 2KYWA 1Z2MA 3DBHI 3DVGX 4FLHA 4LDTD 1LGRA 4MJSA 2UWQA 2VZKD 3CIRB 1WZ3A 1I42A 3NY5A 2LGXA 3MFGA 1I4PA 2FAZA 1V9JA 3CSFA 1F1HA 1AYFA 2LXAA 2LUMA 2NCNA 3AEAB 2IO3B 4W9DA 1ZXHA 2QIEB 3N9YC 2L0TA 3UF8A 5D7GA 2X38A 4WWPA 1ENFA 5D2MB 3MC9A 3GE8C 1TY0A 1T0RC 5J18A 2KTRB 3ENEA 3W1YA 1E8ZA 1C4PA 2BWES 2Q5WD 1WZ0A 5DCNA 1K53A 5FKAC 2GLSA 3AE5B 1MG8A 1SJED 2ONQA 1OFFA 1XLOA 4EZKA 2JRIB 3PVLA 4C7YA 1XLPA 4LNKA 1SE3A 2QCZA 1DYQA 3M62B 3P4PB 2L52A 1NYRA 1UGMA 1Y8RC 1V1PA 4C4VB 1OEYA 4C7ZA 3DDCB 2WXJA 4YSXB 3MHZA 1IUEA 2WXOA 3N32A 4KGSA 1WF9A 3HM3A 1SSNA 4XGAB 4HPPA 2KWDA 2NS5A 2KVRA 2KN5A 2ZCBA 2NR2A 3AEBB 5DPWA 4ANUA 3AXCA 1FRDA 4ARCA 2CJOA 1HZ5A 5EE9A 3N30A 3TSSA 3NS1A 4L2YA 3ZYYX 3M3JA 3R8BA 4EE2A 1K52A 1E5WA 3M95A 1P3QU 1V81A 1F9JA 3T8MA 3UINB 1UUPA 3RULA 4EZLA 1WGDA 4EZJA 4S0RA 4O1NA 4CYEA 1VZ8A 4JQWC 3AN1A 2V1YA 1YN3A 1D3ZA 2KOXA 1VDVA 1MHHE 1J7AA 2DZJA 2KDEB 3ZNGC 3AMZA 1OQRA 3GE3C 5G2NA 1ZUD2 4RH6A 4A20A 4BKSD 2KT7A 4IOIE 4M8MA 2V9HA 3A33B 3RNEC 1WE6A 3QK0A 4YSZB 1C4AA 2I2YA 4JWSC 1QOAA 1RFKA 3OG5A 3MP9A 3C8YA 2KANA 5EE1A 3B0AA 1L0XB 1IPGA 1RRBA 4NAWB 1FFVA 2KX3A 5LLIA 1C79A 4BBNF 5DPSA 3TMPB 3AEEB 2KD0A 2W82A 2J0KA 2V4LA 2EKEC 2N1VA 1D5MC 4PT5A 2J7QB 2TSSA 2W54A 4GSWA 1N61A 1UWMA 2KMCA 2JZ3B 4KVGB 4MEMA 3V05A 1GC7A 1VZ7A 1XCTL 3L4PA 2PJHA 1P7EA 4XDDA 3UQBA 2PEAA 1MG4A 4B95A 4W9HA 1JWUD 2WXLA 4GOCA 4KIKA 3QQ8B 3VR8B 5IA7A 5FK9C 3UGBB 1XT9B 2WXNA 4FBJB 2MBBB 3CF6E 4TQ0A 5IN7A 3Q3OC 2CR5A 2V3PA 3D32A 1P98A 3IBEA 3ZDTA 3FAHA 2HTHA 5IP4D 2R2OA 3A9KA 3N20C 4YL8A 1XLQA 3V3XA 2A5UA 3R3MA 3ECIA 4ZYNA 1KLUD 1TTNA 3KUCB 1J19A 3LDZE 4HRSA 3RNBC 1E7VA 4DXGA 3ML8A 4I6PA 3ZGZA 1KJTA 1D5ZC 3KH0A 3U8ZA 3BK2A 1FO4A 5KHQA 2WDTB 5C3JB 1H4RA 4KGTA 2AYOB 2KN4A 2MBQA 2FIFA 3AEDB 2WP9B 2LZ6A 1EF1A 5FR6A 3Q8EA 1SE2A 4ANXA 4RM8A 3B9JA 2GBJA 3AE4B 3QIJA 2G4DB 4WWNA 4C80A 2GBRA 2BTEA 1ZDVA 2WU2B 1WGYA 3HUIA 1GAQB 4KDIC 1ROEA 4IUMB 2LASA 5JHBA 3BK1A 1WYWB 2ACZB 2OJRA 4MT5A 2DENB 4MH8A 4C00A 3AE7B 1FMAD 1WJ4A 1V86A 4W9EA 1HTQA 3O13A 1FFUA 3FKYA 3PZ7A 2QJLA 2YLMA 4KSKC 2JZZA 5I4DA 4YTPB 3AE3B 2LWPA 2HTME 1F52A 2M0XA 1YJJA 2L76A 2DX5B 2L05A 3ZKJC 1QILA 3I3TB 3EHVA 2NVUI 2ZZPB 1J0GA 4KZ0A 3PRPB 3Q8BA 4F1SA 2BW2A 4AWJA 4YXDB 5IOIA 2MBHA 2KDIA 3U30A 2KFKB 4XWTA 5E6OA 3ZQ4A 4REZA 1OEYJ 4RGMA 2RGFA 3FILA 5IO9A 1I4GA 1XO3A 3VH4B 2BYTA 3ZJUA 4NNJB 2LI5A 4J3OD 1WGGA 2ZEQA 2MP2B 4GDKB 2LXCA 2WXQA 1E8YA 1OQYA 3PTFC 4OVZA 4BVUC 2CHWA 3KQ4A 4GLSC 1GB1A 2L7RA 1EU3A 1P7FA 3U2SC 1PFDA 4E74A 2VH1A 2IGHA 5H8YE 4K1RB 2IZVB 2DHZA 4NQLB 4KX6B 2W55A 4HXDA 1OQQA 4OZAA 3U7DA 3PS6A 1CJEA 1WI0A 2BB5A 4M8NA 3FC4A 2UYZB 1LM8B 3A9JB 3VHTC 2ZNVB 4K7UA 3QJZA 2LFIA 4WQOB 4HCPB 3RN9C 4ZDVA 5AZHA 2KQ7A 4PYZA 1C3TA 1GNUA 4K7SA 2M1MA 4HDOA 3AM9A 5H92C 1ZW7A 5BO4B 3SEBA 1FNUA 3DHIC 2XK5B 1GB4A 4K3CA 3RUIB 1P0RA 2C5LC 2N1WA 2W3RA 3AB5A 3DPDA 4A9AA 2INNE 4RMAA 3NUHB 3I5JC 4ZRQA 4GGQA 1NENB 1R7SA 4HROA 1QLBB 2MSED 1GOZA 4S17A 4RGOS 1L6UA 4DHZB 5D94A 3R7QA 2L00B 3P1MA 4EEWA 1WJNA 2KDBA 1BMLC 3DVNU 1DOIA 1HZ6A 1FPYA 2KK8A 4P7IA 1C4CA 1XCQL 4XDCA 3VQIA 2NBWB 3MC8A 1K51A 2LRUA 2HDEA 1ZP0B 2HE7A 1Q10A 4IDIA 3IAM1 4P1BC 5GMVA 2RMMA 3SFDB 5EE0A 3Q8CA 4LNOA 1R4MI 2PTLA 4W9FA 1VJKA 3KUDB 2L3ZA 2K5PA 4IM3A 4A6QA 2NBVB 4II2B 1OGWA 3BZDB 2WS3B 2ZW1A 1C78A 4HCNB 4AJYB 2IJ0A 3OAWA 4NAWA 2J52A 5TSSA 2GB1A 1D4BA 1H8CA 2MX2A 3A9KB 3L13A 4KDLB 3VUXA 1MHXA 3DOWA 3IG3A 4PS7A 2C60A 1PUTA 3NVVA 4LNIA 1L5PA 3GS2A 3LXFA 4A3OA 1WRIA 4WWOA 1AN8A 1JWMD 3MJWA 5BMIA 4IWOA 2BB6A 4XX5A 1KLVA 1HTOA 2RDBC 2XNAC 4WQMA 5AUKA 3ZXVA 4OZBA 3KYCD 1WR6E 2B76B 4N59A 3PZ8A 1IGCA 1EF5A 2PIAA 2DYMA 4XYCA 4EKUA 3APDA 5LNK1 2K8BA 3NS8A 1ZOYB 1VCBA 2WXKA 3U4EG 4R3DA 1WYGA 3TL5A 3J9CA 1WXSA 4AP4C 2BF8B 1SBBB 2M4NA 4CO7A 1L6VA 3B2GA 3EFUA 3RFZB 2NTTA 3HM6X 3VAWA 3H6NA 3AULA 1EWYC 2K22A 2CHZA 1M4VA 3ZW3A 2OOBB 1QZEA 2R2QA 2D3GA 4P6VF 3BIID 3I9V1 1XD3B 4JX1C 2G3QB 3H7SA 2INDC 2K0PA 4DDGD 3L54A 3GB1A 1EUVB 2FCMA 2JQRB 4HWIB 1FXAA 3TEZA 1FXIA 1ZKHA 2CU3A 2MEKA 3WCQA 4TV3A 4IKGA 2IPKD 4MM3A 1RM6C 3AEFB 1WSPA 3P63A 4KKIA 1K8RB 2JU6X 2YVCA 2MH7A 3NG0A 1UH6A 3TJPA 3KW5B 4M0WB 4TQ1A 1Q0WB 1Q1OA 2J0JA 4YTMB 5AEKB 4DBGA 1E7PB 1L2NA 2DLBA 2N0SB 4A8XC 4JWUC 3A1QB 4LLGM 4M00A 1TKGA 2KNBA 4HJGE 1TJEA 1I4RA 5T8IA 3ZNID 4XE0A 2M8SA 5CHVC 3PREA 1FEHA 2WX1A 2OEDA 3Q3NC 4HVBA 5BYSA 1BT0A 5L95C 1EM7A 1SJHD 2MRPA 2WX0A 4TMAB 3VTUA 1NI3A 2KLGA 2KZRA 4E71A 4BFRA 4WH4A 1E8WA 3H7PA 4GDLA 2DYOA 3P4SB 1ISNA 1FNWA 1X1MA 1OTRB 1TKYA 4WJNA 2NBUA 1XLNA 1ZGUB 2ZCCA 3VTWA 2JZPA 1VR9A 2DWQA 2O2VB 3UIPB 1JW9D 3K9PB 5J2RA 4F7ZA 2WLBA 2KLCA 2KMMA 1WXVA 1V49A 1YN5A 2LGSA 2CS4A 4QAYA 1JROA 2IY1B 5BYRA 3VVWB 4ZRJA 1J8CA 2LGIA 3A9JA 3I63C 2KFKA 1I35A 2KX0A 1T0QC 2JX5A 1SGHA 3DBRI 1C1YB 1I4QA 1WX9A 3Q6BA 3R2IA 3T3NA 4EOYA 3DVGY 4W9JA 2JUOA 3OWEB 2LVOA 3DBSA 4FN2A 1QOGA 4FA6A 4HLEA 3O65B 1UF0A 3WAPA 1JMLA 2IBIB 4KZCA 4W9IA 3L16A 3DBRB 2L1AA 2B3AA 1YIWA 4MGZE 1SB3C 2NPTB 3N1XC 1E90A 3L17A 3GOEA 3PSEB 3RD2A 3L08A 5AZFA 3SD5A 1N63A 2RDHA 1T0YA 3ZJTA 2L0FA 3NVZA 5JHAA 4DHJB 4MH0E 4FULA 2KQ4X 1QOBA 2QSDA 4TUUA 1T6BX 2L8JA 1CZPA 3AE2B 1FNVA 1JWSD 3TBLD 3BVZA 4WAAA 2G45B 2KC2A 3SDLC 2BPSA 5AZGA 4LCDE 4M02A 4AQ7A 3RZFA 5E6NA 1G6JA 3DCGA 5HI1A 3QWZB 4GMVA 4WIPA 2SAKA 2KXJA 1I4HA 3EFCA 2N9EB 2H89B 1HEZE 4BAXA 2IO1B 5D3IB 1YX6B 3RI7C 1JALA 3VH3B 2QMTA 1E6EB 3NZUA 2JRHA 3K9OB 1HE8A 3PRMB 4L23A 3ZRFA 1F77A 4DXFA 1RWSA 2WWZA 3VRBB 1T0SC 4M01A 1E8XA 1R4NI 3W2DA 1V8CA 1A70A 2N7EA 2WDRB 3H8HA 4JGHB 1FIQA 1MVKA 4JPSA 2N9LA 2Z59B 4ARIA 4LDTB 3RNAC 3ZJVA 3PHWB 4XZ4A 2D11A 5LXHA 3T9LA 5CTRC 4OHJA 1RYJA 2DZKA 1SE9A 2QC8A 2LRWA 3AV8A 2BYVE 2RPQA 1N6ZA 3TEXA 2D10A 4B6WA 4RM9A 3BYYB 2MA9B 4UDUC 2BKRB 2K1FA 2PW9A 3ALBA 2GMIC 4I6LB 4IM0A 3ZIMA 2GRIA 3CMMB 4KSLC 2KACA 3RT3B 2UU7A 1NDDA 1ET9A 5C2TB 1FRRA 1NVID 4FJVB 2EELA 1TGZB 1SEBD 1YQBA 2YEPB 5L83A 3KUZA 3SFEB 4HDQA 2JYTA 1F2RI 4H2AA 4IW0A 1DOYA 3DVNV 4JL9A 2IY0B 2WXIA 4YT0B 3PRZA 4W9KA 1QF6A 2C7HA 3Q8AA 3V6EB 3EUB2 4MACA 2REXA 2KKCA 2K8CA 4BBNC 4ZRIA 1IBXB 4J6IA 2HD5B 1FCLA 3KYDD 2BYFA 4K3BA 3QARA 3AE8B 4OVVA 3ZVVA 3BWUD 4NJ7A 2BGFA 3S2AA 4ANWA 1CQVA 1QOFA 1UZXB 2SEBD 1VD2A 4AUQC 2MBEA 1C77A 2JT4B 1R4MB 3IXSA 1WR1A 3Q14C 3TUOA 4A3PA 1N62A 2DNFA 2J4XA 1L4ZB 1UBIA 4HKQA 3PLUA 3OLMD 4JIOU 2I1KA 2WXHA 3IT6B 4WJQA 2FUG1 2MJDA 3AE9B 3HVDA 1TKEA 1VZ6A 3RNGC 4DXAB 1JQ4A 2MJEA 2WQYB 2BS4B 3EGRA 3PT2B 4MM3B 2VZKB 3RCZA 2O2VA 1CMXB 3PLVA 1J7CA 3KLSX 4YTNB 3VFKA 5JZEB 2N7DA 5J17A 3SHQA 2FIDA 2XN9C 3DHGC 4MGIE 3ZXRA 3FILB 5IKCM 1GC6A 3CSTA 2PE9A 5C23A 1N5WA 1EO6A 2I1JA 1LFDA 2FUHB 4E3CA 3QA8A 1KRHA 2D3BA 3ABVB 2WNMA 4HEA1 3IT4B 1WY8A 5E6PA 2DZIA 5EDSA 4ANVA 4NJCA 3VTVA 4YWGG 1F2RC 2LVQA 4GIVA 2NMQA 4MGKE 3TCAA 1WM2A 1MPEA 4LK0M 2PPHA 1U4AA 3WIMA 3RZWC 4XWWA 4ACFA 1WFYA 4DK5A 3DBHB 5TR5A 3NRZA 3P4RB 1WXQA 2BKFA 1XF5L 3IVFA 1WXMA 2PMVA 3HK0A 1QKZA 1UELA 3PZDA 2JSVX 3TEYA 2M19A 2C9WB 3CWIA 3A1QA 4CQNA 3DQVA 3IAS1 3TEWA 3RMKC 1WRDB 2XEWA 3PHXB 3AH7A 3W5UB 3KWVA 2J53A 4MDKE 2WXFA 3ZNZB 1TZ1A 2BYEA 1N5XA 1WJ6A 3QX1A 1V6EA 3QC8B 2CU1A 1E7UA 1HXYD 4YSYB 2N9XA 2KFJA 4EFOA 4GDLB 3B08A 2DYBA 4PYUA 2KQSA 2NPTA 1PYWD 4Q2JA 4W9CA 2JYEA 2AWTA 2N9PC 4LTUA 2MBOA 3WA0A 4ICUA 1BXTA 1S3SG 2Y5BB 4MELA 3SU8X 1DGJA 4JLCA 2OHFA 1YN4A 2ASQA 2Y3AA 1QT9A 4BOSC 2AQ1B 3VRAB 2RPVA 2BS3B 3Q3FA 3R2TA 4P16A 3ZDMC 1T3QA 2JPHA 4C4VA 3QCAA 4AS1A
chains in the Genus database with same CATH topology
4WH4A 2V3PA 1V1PB 2CJNA 2KDMA 2PVGC 2DYOA 3FAHA 1KF6B 3P4SB 1FNWA 2H88B 1TKYA 1TS3A 2PKOA 1XLNA 4B0MA 1EU4A 2AQ3B 2JZPA 1XLQA 3V3XA 1VR9A 2DWQA 4ZOHC 1JW9D 1VRAB 2Y5PA 2WLBA 1KLUD 1ESFA 1K50A 2KMMA 1YN5A 1B1ZA 3DWMA 4HRSA 1ZPSA 5FR3A 3AEGB 4DXGA 1JROA 5BYRA 4RCOA 4NAMA 3ZGZA 1SXTA 5AUIA 4WAFA 1L0VB 5EE3A 2LGIA 1XXGA 1D5ZC 3AE1B 2G1EA 3AECB 1KFYB 2JX5A 2QEJC 3BK2A 1FO4A 1TS5A 1I4QA 3Q8FA 5C3JB 3R2IA 4KGTA 3T3NA 2V0GA 2KN4A 3OWEB 1QOGA 3AEDB 1JMLA 2WP9B 3MJ5A 1PGXA 2L1AA 4ITKA 1SB3C 3UI3A 5MPOA 3Q8EA 1SE2A 2DBYA 3B9JA 3AE4B 4C80A 1KTKA 2BTEA 1ZDVA 1N63A 2RDHA 5GXGB 4A90A 2WU2B 1I7HA 3ZJTA 3HUIA 3NVZA 1E0ZA 1GAQB 1ROEA 2KQ4X 1QOBA 2QSDA 3BK1A 2ACZB 1T6BX 1ZXIA 4MT5A 4MH8A 1CZPA 2IDYA 3AE2B 2BT6A 3AE7B 1FMAD 1FNVA 4N58A 1JWSD 3BVZA 5BMHA 4D2KA 1IBXA 1C9FA 2FBWB 2PVOD 3O13A 5HHDG 1FFUA 3PZ7A 2QJLA 2WXMA 2W3SA 3P4QB 4RFBA 5I4DA 4RGNA 4YTPB 1STEA 1MI0A 2G9HD 4ZRPA 2V3NA 3AE3B 2Z8LA 4AQ7A 1WWTA 2WXRA 4RNAA 4WWMA 2HTME 4M0WA 2K9XA 1KLGD 2KAJA 5HI1A 4ZYSA 1YJJA 4WIPA 2SAKA 3ETRA 1QILA 1AWDA 1I4HA 1F0ZA 2H89B 1HEZE 4RGTA 5D3IB 1D6EC 2JXTA 1JALA 1KH0A 2BW2A 2QMTA 3Q8BA 4YXDB 1PGBA 2GI9A 1E6EB 3P42A 4KKJA 4XWTA 4L23A 1F77A 4DXFA 2LHDA 3ZQ4A 1GPXA 1RWSA 4REZA 2I38A 1JRPA 4RGMA 1NEKB 3FILA 3VRBB 1I4GA 3W2DA 1XO3A 2D5GA 2LEKA 2BYTA 3PO0A 3ZJUA 1V8CA 4J3OD 1A70A 2WDRB 3H8HA 1FIQA 1MVKA 1TZOA 2N9LA 1YJIA 3I57A 4GDKB 1YQ3B 4JPSA 4B0EA 4C56C 1DOXA 1YMHE 1FD6A 4ARIA 5HG2A 2WXQA 1HA5A 3ZJVA 2IGDA 3NVWA 3KWLA 4OZCA 4OVZA 1LO5D 4OHJA 1RYJA 4N6EB 2AQ2B 3KQ4A 1BUIC 4GLSC 1GB1A 1EU3A 4FXCA 1P7FA 3HRDD 3LYYA 3U2SC 3AV8A 5HFYA 1ZDXA 1PFDA 5D3DA 2IGHA 5H8YE 3BVMA 3U7ZA 3BVGA 2M0AA 2ON8A 3TEXA 2R61A 4KX6B 3BYYB 2Y5CA 2W55A 2NTSA 1OQQA 4OZAA 4UDUC 1JWAD 2ICIA 2PW9A 1PDXA 1CJEA 1UWXA 1JWBD 3BYTB 2BB5A 2N7JA 5BMGA 2INPE 1HQRD 3FC4A 2BS2B 3Q69A 1N60A 2L83A 1NYQA 2GRIA 3B2FA 2LFIA 1EWCA 1SIJA 1VLBA 4RF0A 2KACA 1SE4A 4WURA 3E9SA 1ET9A 2V4IB 1PGAA 5BYQA 3DWGC 5C2TB 2VZKD 3CIRB 1FRRA 1NVID 5H92C 3AM9A 3MC0B 3SEBA 1FNUA 3MFGA 1GB4A 1I4PA 1ET6A 2EELA 1SEBD 2W3RA 3AB5A 1FCCC 1AW7A 1AYFA 2YEPF 2YEPB 2INNE 4A9AA 3NUHB 3SFEB 2LUMA 4DQOC 3AEAB 4ZRQA 1ZXHA 1NENB 2QIEB 3N9YC 1R7SA 2JYTA 4HROA 1QLBB 1F2RI 1UGJA 2RDGA 1GOZA 4H2AA 1DOYA 5D7GA 2X38A 4RGOS 3W1SA 1L6UA 2WXIA 4YT0B 1ENFA 2J42A 1QF6A 1TY0A 3EA6A 3Q8AA 2WDVB 3EUB2 4MACA 2WXGA 3P1MA 1IBXB 1BMLC 1TYGB 1FCLA 1DOIA 1C4PA 1HZ6A 1J7BA 2ZW0A 5JXVA 1C4CA 1XCQL 3AE8B 4XDCA 3VQIA 2Q5WD 4RF1A 1UNSA 1K51A 3BWUD 2HDEA 1K53A 5FKAC 1CQVA 1QOFA 3AE5B 1T5XD 1ZP0B 1SJED 1Q10A 2ONQA 1OFFA 1XLOA 2SEBD 3IAM1 4IDIA 4ZHOA 1L4DB 4US9A 1C77A 3E56A 2RMMA 3IXSA 3SFDB 5EE0A 2IGGA 3Q8CA 5G5GA 2PTLA 3TUOA 1VJKA 4C7YA 1N62A 1XLPA 2K5PA 4A6QA 1SE3A 3GP7A 2J4XA 3BZDB 1DYQA 2WS3B 1L4ZB 3P4PB 2L52A 4HKQA 1NYRA 2ZW1A 1C78A 2N9KA 2IJ0A 2WXHA 1V1PA 2J52A 3IT6B 2FUG1 5TSSA 4C7ZA 2WXJA 2MJDA 3AE9B 3HVDA 1TKEA 4YSXB 1VZ6A 2GB1A 3MHZA 1IUEA 2WXOA 2MJEA 2BBCA 1SF0A 4L1BA 1D4BA 4KGSA 1JQ4A 2WQYB 2BS4B 3EGRA 4MM3B 1D5XC 1MHXA 2E6XA 2VZKB 1PUTA 3NVVA 1SSNA 1E9MA 1J7CA 3KLSX 4YTNB 1L5PA 2KWDA 3GS2A 3LXFA 2WDQB 3AEBB 1WRIA 4ARCA 1FRDA 1JCKB 1TS2A 2CJOA 1AN8A 1HZ5A 1JWMD 5EE9A 5BMIA 2BB6A 2XN9C 1TS4A 1L0YB 3TSSA 3NS1A 4L2YA 3W5VB 2K3UA 5G5HA 3ZYYX 2XNAC 4WQMA 3FILB 4HKZE 3R8BA 5AUKA 4EE2A 1E10A 1YQ4B 1K52A 3URYA 4USAA 4OZBA 3AE6B 2WXPA 2B76B 4N59A 1N5WA 3PZ8A 1IGCA 3T3OA 2PIAA 2DYMA 5LNK1 1KRHA 4NZLB 3ABVB 3U52E 2LJIA 2WNMA 1ZOYB 3VR9B 2WXKA 4HEA1 2L32A 3IT4B 1UUPA 2E3TA 5E6JA 3U4EG 1V1OA 4R3DA 1ACCA 4O1NA 1WYGA 4NJCA 3J9CA 1VZ8A 3AN1A 1F2RC 4YWGG 1SBBB 1YN3A 2NMQA 4KGRA 1V97A 1MPEA 1MHHE 1J7AA 2EKIA 1L6VA 1VDVA 3B2GA 3RFZB 2NTTA 1YNTE 4LK0M 3AMZA 1OQRA 2LHEA 4XWWA 1ZUD2 1EWYC 2K22A 4RH6A 1CK1A 4TSSA 1M4VA 4IOIE 1ZE3D 3NRZA 3P4RB 1WXQA 1XF5L 4P6VF 3BIID 3I9V1 4JX1C 4YSZB 1C4AA 2PMVA 1QKZA 2I2YA 2JSVX 3TEYA 4JWSC 1QOAA 2K0PA 1RFKA 4OW0A 2M19A 3CWIA 3MP9A 3C8YA 4JE3B 5EE1A 3GB1A 4CQNA 2JQRB 1XEEA 1L0XB 3IAS1 1QQRA 2WU5B 3LB8C 3RPFC 3TEWA 4NAWB 1FFVA 1FXAA 2M56B 3NVYA 3TEZA 3HVZA 1FM0D 1FXIA 2CU3A 1C79A 2MEKA 3WCQA 3AH7A 3W5UB 3AEEB 3KWVA 4IKGA 2J53A 2FE8A 2WXFA 2IPKD 1B9RA 2W82A 1RM6C 3AEFB 1WSPA 3P63A 4KKIA 4A55A 1N5XA 1D5MC 2JWUA 2MJ3A 4PT5A 2JU6X 2MH7A 2TSSA 2W54A 1N61A 1UWMA 4TQ1A 1HXYD 4YSYB 4GDLB 2LMCA 4YTMB 1E7PB 1PYWD 2DLBA 4Q2JA 2N0SB 1WGKA 4A8XC 3V05A 4JWUC 1VZ7A 1XCTL 3L4PA 2JYEA 4LLGM 4LTUA 1TKGA 3SR6A 2AX5A 4US8A 4HJGE 1BXTA 1TJEA 1I4RA 5T8IA 3W9CB 1I4XA 1Y56A 4XE0A 1P7EA 4XDDA 1DGJA 2OHFA 3NZ3A 2QILA 1TY2A 1YN4A 2Y3AA 1QT9A 1FEHA 2OEDA 1JWUD 2WXLA 1IGDA 5BYSA 2AQ1B 3VRAB 2PLPA 2RPVA 1EM7A 1SJHD 3VR8B 5FK9C 2BS3B 2WXNA 4ZHPA 4TMAB 1NI3A 3R2TA 4P16A 1T3QA 4TQ0A 1C76A 4AS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZOY B;  3VR9 B;  2K9X A;  2KAJ A;  2CJN A;  3AEA B;  1YJJ A;  2E3T A;  2PVG C;  1NEN B;  2QIE B;  3FAH A;  1KF6 B;  3ETR A;  3P4S B;  1R7S A;  2H88 B;  1AWD A;  1F0Z A;  1WYG A;  4HRO A;  1QLB B;  1TKY A;  2H89 B;  3AN1 A;  1DOY A;  2PKO A;  1XLN A;  1L6U A;  4YT0 B;  1V97 A;  1JAL A;  1XLQ A;  1VDV A;  1J7A A;  2EKI A;  1L6V A;  2DWQ A;  4YXD B;  3B2G A;  1E6E B;  4ZOH C;  1QF6 A;  1JW9 D;  2WDV B;  3EUB 2;  2WLB A;  3AMZ A;  1OQR A;  2KMM A;  3P1M A;  1ZUD 2;  1EWY C;  2K22 A;  1GPX A;  1RWS A;  1TYG B;  3DWM A;  1DOI A;  1JRP A;  4HRS A;  3NRZ A;  1J7B A;  3P4R B;  3AEG B;  1JRO A;  1WXQ A;  3AE8 B;  1NEK B;  2Q5W D;  4P6V F;  3BII D;  3VRB B;  4JX1 C;  4YSZ B;  5AUI A;  1XO3 A;  1L0V B;  2LEK A;  3PO0 A;  5EE3 A;  1V8C A;  1A70 A;  1QOF A;  2WDR B;  2G1E A;  1QOA A;  3AE1 B;  1RFK A;  1FIQ A;  2M19 A;  3AE5 B;  3CWI A;  1YJI A;  3AEC B;  1DOX A;  1KFY B;  1YQ3 B;  1ZP0 B;  2JX5 A;  1FO4 A;  5EE1 A;  5C3J B;  2JQR B;  1OFF A;  1XLO A;  4IDI A;  4ZHO A;  2WU5 B;  3LB8 C;  3NVW A;  4US9 A;  3RPF C;  3SFD B;  1FFV A;  1FXA A;  1QOG A;  2M56 B;  3KWL A;  3NVY A;  3HVZ A;  1FM0 D;  1FXI A;  5EE0 A;  3AED B;  2CU3 A;  5G5G A;  1RYJ A;  4N6E B;  3AH7 A;  3WCQ A;  1VJK A;  4C7Y A;  1N62 A;  3W5U B;  1XLP A;  2K5P A;  2WP9 B;  3AEE B;  4FXC A;  3HRD D;  3AV8 A;  1B9R A;  1PFD A;  1RM6 C;  3AEF B;  3P63 A;  4ITK A;  1SB3 C;  5MPO A;  5H8Y E;  2WS3 B;  3P4P B;  2DBY A;  1N5X A;  1NYR A;  2L52 A;  3B9J A;  3AE4 B;  2MJ3 A;  4C80 A;  2MH7 A;  4KX6 B;  2W54 A;  4C7Z A;  2Y5C A;  1N61 A;  2MJD A;  2W55 A;  1N63 A;  3AE9 B;  1OQQ A;  1UWM A;  1TKE A;  1JWA D;  5GXG B;  2WU2 B;  4YSY B;  4YSX B;  1IUE A;  1JQ4 A;  2MJE A;  1SF0 A;  1I7H A;  4YTM B;  2WQY B;  1PDX A;  1E7P B;  2BS4 B;  3HUI A;  3NVZ A;  1E0Z A;  1CJE A;  1JWB D;  1GAQ B;  1PUT A;  3NVV A;  1ROE A;  2N0S B;  1WGK A;  1QOB A;  1J7C A;  1E9M A;  3FC4 A;  4JWU C;  1L5P A;  4YTN B;  4A9A A;  3L4P A;  2BS2 B;  4LTU A;  1TKG A;  3LXF A;  2ACZ B;  2WDQ B;  2AX5 A;  3AEB B;  3SR6 A;  1N60 A;  1WRI A;  1FRD A;  1TJE A;  1ZXI A;  2CJO A;  2L83 A;  1NYQ A;  3W9C B;  3B2F A;  1CZP A;  1SIJ A;  1VLB A;  5EE9 A;  3AE2 B;  2BT6 A;  3AE7 B;  1DGJ A;  1FMA D;  2OHF A;  4N58 A;  3NS1 A;  3W5V B;  5G5H A;  3ZYY X;  4WQM A;  1QT9 A;  3DWG C;  5AUK A;  5C2T B;  2FBW B;  1YQ4 B;  2PVO D;  1FRR A;  3CIR B;  1NVI D;  4USA A;  1E10 A;  1FFU A;  3AE6 B;  5H92 C;  3AM9 A;  2QJL A;  3VRA B;  2W3S A;  3P4Q B;  3VR8 B;  2B76 B;  4N59 A;  1N5W A;  2BS3 B;  4ZHP A;  4JWS C;  4YTP B;  4US8 A;  2PIA A;  1NI3 A;  3AE3 B;  2W3R A;  3AB5 A;  1WWT A;  1T3Q A;  1KRH A;  4WWM A;  1AYF A;  2HTM E;  3ABV B;  3SFE B; 
#chains in the Genus database with same CATH topology
 3AU5 A;  2CJN A;  2PVG C;  3DBL I;  4WJP A;  2IYD B;  2GBN A;  1WGR A;  1XQQ A;  4B0M A;  2AQ3 B;  4ZOH C;  3NOB A;  1K50 A;  4G3X B;  2HJ8 A;  1B1Z A;  3DWM A;  2HJ1 A;  1SIF A;  5FR3 A;  3AEG B;  2ZNV C;  4NAM A;  4XC2 A;  4NJ6 A;  5EE3 A;  1XXG A;  3AE1 B;  2G1E A;  2EMT A;  3Q8F A;  2V0G A;  3GZN I;  3NJT A;  3N3K B;  2VRR B;  4K81 A;  3ONS A;  1YX5 B;  1PGX A;  4ITK A;  4B9K A;  3UI3 A;  5MPO A;  2G4S A;  3X23 A;  3NHE B;  1WJU A;  4FHK A;  1KTK A;  5GXG B;  4A90 A;  4II3 B;  2K6Q A;  2DZM A;  5DPR A;  1I7H A;  2K39 A;  1E0Z A;  3HIZ A;  2IDY A;  3VUW A;  4N58 A;  2WYQ A;  2AL3 A;  2FCS A;  4D2K A;  2K6D B;  2LGY A;  1C9F A;  2FBW B;  2PVO D;  4G11 A;  4K7W A;  2MW5 A;  3WAO A;  3QHT A;  2WXM A;  3P4Q B;  4RFB A;  4RGN A;  2Z0D B;  2G9H D;  2V3N A;  5DPT A;  2CKH B;  1WWT A;  4RNA A;  4WWM A;  4G50 A;  3V60 A;  2K9X A;  4URK A;  3ETR A;  3L10 B;  1AWD A;  3TIX A;  2KO3 A;  1WMH A;  4WJO A;  1AAR A;  3PV1 A;  1PGB A;  2GI9 A;  4PS8 A;  4KKJ A;  3EEC A;  3KVF B;  2LHD A;  4HK2 A;  1GPX A;  2I38 A;  1JRP A;  1GUA B;  1NEK B;  3RNC C;  4IWP A;  2BQQ A;  3I57 A;  2JXX A;  1YJI A;  4C56 C;  1DOX A;  1YQ3 B;  1HA5 A;  2IGD A;  2BVC A;  3KWL A;  2ZVO A;  2GOW A;  2FCQ A;  3Q3J A;  2K8H A;  1V2Y A;  2AQ2 B;  1BUI C;  3AI5 A;  3LYY A;  3HRD D;  1RAX A;  4LJO B;  5HFY A;  1ZDX A;  4ZRK A;  2DAJ A;  1WX8 A;  5D3D A;  1YD8 U;  3U7Z A;  3BVG A;  3IFW B;  3P2B A;  2ON8 A;  2KDF B;  2QDF A;  3APC A;  2Y5C A;  2D07 B;  2NTS A;  2M17 A;  2KWV B;  2ZPY A;  3HHM A;  2ICI A;  1PDX A;  3BYT B;  4N9F 4;  3BY4 B;  1HQR D;  3Q3M C;  3Q69 A;  2L83 A;  3B2F A;  1SIJ A;  4RF0 A;  1VLB A;  1SE4 A;  3NZS A;  4WUR A;  3E9S A;  3ZUN A;  1NI2 A;  2O6V B;  2V4I B;  1PGA A;  5BYQ A;  3Q2A C;  4GXB A;  3DWG C;  3MC0 B;  2IO0 B;  1ET6 A;  3JVZ X;  4FAD A;  4W9G A;  2GBM A;  3VUY A;  1FCC C;  1AW7 A;  2KJH B;  3QAQ A;  3WAL A;  2YEP F;  2EMS A;  5IAA C;  5LXI B;  4DQO C;  2ZPN A;  1RLF A;  1V5T A;  1NBF C;  2LD9 A;  2PE6 B;  2RDG A;  1UGJ A;  1MJD A;  3W1S A;  4LNF A;  2J42 A;  2KWC A;  3H1U A;  2W9N A;  3M63 B;  3EA6 A;  4LNN A;  3V61 A;  2WDV B;  3H7P B;  2WXG A;  1TYG B;  1J7B A;  2ZW0 A;  5JXV A;  2LJ5 A;  4RF1 A;  1UNS A;  2RSU A;  1T5X D;  3OJ3 A;  3ML9 A;  2A4Z A;  4PS3 A;  4ZHO A;  2D2Q A;  2JWZ A;  2N4F A;  1L4D B;  4US9 A;  3E56 A;  4HJK A;  2IGG A;  5G5G A;  4HPM B;  2IO2 B;  4AOF A;  3LJ3 A;  1MFW A;  2MCN B;  3GP7 A;  2WGS A;  3ZO5 B;  2KWU B;  4W9L A;  4BKT A;  4FJY A;  4HPL B;  2N9K A;  4BKS A;  1UD7 A;  2BBC A;  1SF0 A;  4L1B A;  4ICV A;  3C19 A;  1D5X C;  2C7M B;  2E6X A;  2D3C A;  1E9M A;  2WDQ B;  1JCK B;  1TS2 A;  3JSV A;  2KMA A;  4LJP B;  1TS4 A;  1L0Y B;  2D3A A;  3W5V B;  2K3U A;  5G5H A;  4HKZ E;  1PQS A;  1E10 A;  1YQ4 B;  3URY A;  4OVU A;  4USA A;  3AE6 B;  2WXP A;  3V62 A;  4PK1 A;  3IHP C;  3T3O A;  1WH3 A;  5JH5 C;  4NZL B;  3U52 E;  2LJI A;  2ZJD A;  3VR9 B;  2L32 A;  2E3T A;  4FHJ A;  5E6J A;  4FJZ A;  1V1O A;  4X57 B;  2BWF A;  1ACC A;  1KM7 A;  2KJ6 A;  4BKG A;  2LGD A;  4MGY E;  4KGR A;  1V97 A;  2EKI A;  3X0W A;  3WAM A;  1YNT E;  2K25 A;  3V6C B;  2LHE A;  3N1Y C;  3VDZ A;  1CK1 A;  3JW0 X;  4TSS A;  4MJS B;  1ZE3 D;  2INC C;  4P1C C;  2XK5 A;  3JYU A;  1WM3 A;  1A5R A;  4OW0 A;  4MSM B;  2X8X X;  4JE3 B;  3JSV B;  1FXT B;  1XEE A;  1QQR A;  2WU5 B;  3LB8 C;  3RPF C;  1IP9 A;  4F8C B;  3R7R A;  3PPA A;  3ZTD A;  3NVY A;  2M56 B;  3HVZ A;  1FM0 D;  4ASW C;  2FE8 A;  1B9R A;  1V80 A;  1UBQ A;  2KTF A;  4A55 A;  1LQB A;  2JWU A;  1R4N B;  2MJ3 A;  2KTR A;  2CHX A;  2DAF A;  4MSQ B;  3UIO B;  2LMC A;  4DHJ D;  5HKH A;  1WGK A;  1V5O A;  1L7Y A;  1Z5S B;  3SR6 A;  2AX5 A;  4US8 A;  3ZRC A;  4G0N B;  1M94 A;  3W9C B;  3WAN A;  3UQA A;  1I4X A;  4IC7 B;  1Y56 A;  5G55 A;  3NZ3 A;  2QIL A;  1TY2 A;  1WGH A;  1S1Q B;  1IGD A;  2AEH A;  2PLP A;  4IWQ A;  4ZHP A;  4GU2 A;  1C76 A;  1Q5W B;  1V1P B;  2KDM A;  4IG7 B;  1LXD A;  3GZN B;  1KF6 B;  1WE7 A;  2H88 B;  2OJW A;  1WXA A;  1TS3 A;  2PKO A;  4GN1 A;  3A4R A;  1EU4 A;  2GBK A;  1RFA A;  1VRA B;  2Y5P A;  4BZA A;  1ESF A;  2QHO A;  2V3S A;  3PGE A;  4DHZ E;  2KC1 A;  3H9D A;  1ZPS A;  4RCO A;  3A4S C;  1SXT A;  5AUI A;  4WAF A;  1L0V B;  2VH2 A;  2J0M A;  3AEC B;  1KFY B;  3VXW A;  2QEJ C;  1TS5 A;  1YJ1 A;  2Z0E B;  2ZVN A;  2RR9 A;  2JY6 A;  4TKN A;  5KHO A;  1GJZ A;  4NY0 A;  5CHW A;  3MJ5 A;  4AJW A;  2FCN A;  2DBY A;  3MTN B;  3L0W B;  1TT5 B;  2JF5 A;  4DDI D;  4EUT A;  2JVC A;  1IYF A;  1WMH B;  4IM2 A;  4KIK B;  1WIA A;  1ZXI A;  3ZNH B;  4NQK E;  1TBE A;  2BT6 A;  4CHK A;  5BMH A;  1IBX A;  5HHD G;  2WHI A;  2W3S A;  4BOZ B;  1STE A;  1MI0 A;  4ZRP A;  2RD0 A;  2MQJ A;  2Z8L A;  2WXR A;  4M0W A;  2O6V A;  2KAJ A;  1KLG D;  2LVP A;  4ZYS A;  3R66 C;  2KJR A;  3DBL B;  3C0R B;  1F0Z A;  4RGT A;  1D6E C;  2JXT A;  1KH0 A;  3P42 A;  5D6J B;  4DWF A;  1GG3 A;  2FNJ B;  1P9D U;  4NPN A;  5CX3 A;  3AU4 A;  2AL6 A;  2D5G A;  2LEK A;  3PO0 A;  1TZO A;  2C7N B;  4B0E A;  1YMH E;  1FD6 A;  3DHH C;  5HG2 A;  5CHF A;  1WX7 A;  1P1A A;  3N1Z C;  2XBB C;  3ZLZ A;  3NVW A;  3W1S C;  3OJ4 B;  4OZC A;  1LO5 D;  3MHS D;  4N6E B;  5C1Z A;  3RYT A;  3ZTC A;  4FXC A;  1TIF A;  4GB9 A;  4KV2 A;  2LUE A;  2MWS B;  3BVM A;  2KHW B;  2M0A A;  2R61 A;  3BIN A;  4I6N B;  1KOT A;  3B1L X;  1JWA D;  2KVZ A;  3APF A;  1UWX A;  1JWB D;  4GDK A;  2N7J A;  1YOV B;  5BMG A;  2INP E;  1JRU A;  2MP2 A;  2BS2 B;  3EC8 A;  1N60 A;  2O6V D;  3RNF C;  2MHJ A;  1NYQ A;  1EWC A;  2MLB A;  2KYW A;  1Z2M A;  3DBH I;  3DVG X;  4FLH A;  4LDT D;  1LGR A;  4MJS A;  2UWQ A;  2VZK D;  3CIR B;  1WZ3 A;  1I42 A;  3NY5 A;  2LGX A;  3MFG A;  1I4P A;  2FAZ A;  1V9J A;  3CSF A;  1F1H A;  1AYF A;  2LXA A;  2LUM A;  2NCN A;  3AEA B;  2IO3 B;  4W9D A;  1ZXH A;  2QIE B;  3N9Y C;  2L0T A;  3UF8 A;  5D7G A;  2X38 A;  4WWP A;  1ENF A;  5D2M B;  3MC9 A;  3GE8 C;  1TY0 A;  1T0R C;  5J18 A;  2KTR B;  3ENE A;  3W1Y A;  1E8Z A;  1C4P A;  2BWE S;  2Q5W D;  1WZ0 A;  5DCN A;  1K53 A;  5FKA C;  2GLS A;  3AE5 B;  1MG8 A;  1SJE D;  2ONQ A;  1OFF A;  1XLO A;  4EZK A;  2JRI B;  3PVL A;  4C7Y A;  1XLP A;  4LNK A;  1SE3 A;  2QCZ A;  1DYQ A;  3M62 B;  3P4P B;  2L52 A;  1NYR A;  1UGM A;  1Y8R C;  1V1P A;  4C4V B;  1OEY A;  4C7Z A;  3DDC B;  2WXJ A;  4YSX B;  3MHZ A;  1IUE A;  2WXO A;  3N32 A;  4KGS A;  1WF9 A;  3HM3 A;  1SSN A;  4XGA B;  4HPP A;  2KWD A;  2NS5 A;  2KVR A;  2KN5 A;  2ZCB A;  2NR2 A;  3AEB B;  5DPW A;  4ANU A;  3AXC A;  1FRD A;  4ARC A;  2CJO A;  1HZ5 A;  5EE9 A;  3N30 A;  3TSS A;  3NS1 A;  4L2Y A;  3ZYY X;  3M3J A;  3R8B A;  4EE2 A;  1K52 A;  1E5W A;  3M95 A;  1P3Q U;  1V81 A;  1F9J A;  3T8M A;  3UIN B;  1UUP A;  3RUL A;  4EZL A;  1WGD A;  4EZJ A;  4S0R A;  4O1N A;  4CYE A;  1VZ8 A;  4JQW C;  3AN1 A;  2V1Y A;  1YN3 A;  1D3Z A;  2KOX A;  1VDV A;  1MHH E;  1J7A A;  2DZJ A;  2KDE B;  3ZNG C;  3AMZ A;  1OQR A;  3GE3 C;  5G2N A;  1ZUD 2;  4RH6 A;  4A20 A;  4BKS D;  2KT7 A;  4IOI E;  4M8M A;  2V9H A;  3A33 B;  3RNE C;  1WE6 A;  3QK0 A;  4YSZ B;  1C4A A;  2I2Y A;  4JWS C;  1QOA A;  1RFK A;  3OG5 A;  3MP9 A;  3C8Y A;  2KAN A;  5EE1 A;  3B0A A;  1L0X B;  1IPG A;  1RRB A;  4NAW B;  1FFV A;  2KX3 A;  5LLI A;  1C79 A;  4BBN F;  5DPS A;  3TMP B;  3AEE B;  2KD0 A;  2W82 A;  2J0K A;  2V4L A;  2EKE C;  2N1V A;  1D5M C;  4PT5 A;  2J7Q B;  2TSS A;  2W54 A;  4GSW A;  1N61 A;  1UWM A;  2KMC A;  2JZ3 B;  4KVG B;  4MEM A;  3V05 A;  1GC7 A;  1VZ7 A;  1XCT L;  3L4P A;  2PJH A;  1P7E A;  4XDD A;  3UQB A;  2PEA A;  1MG4 A;  4B95 A;  4W9H A;  1JWU D;  2WXL A;  4GOC A;  4KIK A;  3QQ8 B;  3VR8 B;  5IA7 A;  5FK9 C;  3UGB B;  1XT9 B;  2WXN A;  4FBJ B;  2MBB B;  3CF6 E;  4TQ0 A;  5IN7 A;  3Q3O C;  2CR5 A;  2V3P A;  3D32 A;  1P98 A;  3IBE A;  3ZDT A;  3FAH A;  2HTH A;  5IP4 D;  2R2O A;  3A9K A;  3N20 C;  4YL8 A;  1XLQ A;  3V3X A;  2A5U A;  3R3M A;  3ECI A;  4ZYN A;  1KLU D;  1TTN A;  3KUC B;  1J19 A;  3LDZ E;  4HRS A;  3RNB C;  1E7V A;  4DXG A;  3ML8 A;  4I6P A;  3ZGZ A;  1KJT A;  1D5Z C;  3KH0 A;  3U8Z A;  3BK2 A;  1FO4 A;  5KHQ A;  2WDT B;  5C3J B;  1H4R A;  4KGT A;  2AYO B;  2KN4 A;  2MBQ A;  2FIF A;  3AED B;  2WP9 B;  2LZ6 A;  1EF1 A;  5FR6 A;  3Q8E A;  1SE2 A;  4ANX A;  4RM8 A;  3B9J A;  2GBJ A;  3AE4 B;  3QIJ A;  2G4D B;  4WWN A;  4C80 A;  2GBR A;  2BTE A;  1ZDV A;  2WU2 B;  1WGY A;  3HUI A;  1GAQ B;  4KDI C;  1ROE A;  4IUM B;  2LAS A;  5JHB A;  3BK1 A;  1WYW B;  2ACZ B;  2OJR A;  4MT5 A;  2DEN B;  4MH8 A;  4C00 A;  3AE7 B;  1FMA D;  1WJ4 A;  1V86 A;  4W9E A;  1HTQ A;  3O13 A;  1FFU A;  3FKY A;  3PZ7 A;  2QJL A;  2YLM A;  4KSK C;  2JZZ A;  5I4D A;  4YTP B;  3AE3 B;  2LWP A;  2HTM E;  1F52 A;  2M0X A;  1YJJ A;  2L76 A;  2DX5 B;  2L05 A;  3ZKJ C;  1QIL A;  3I3T B;  3EHV A;  2NVU I;  2ZZP B;  1J0G A;  4KZ0 A;  3PRP B;  3Q8B A;  4F1S A;  2BW2 A;  4AWJ A;  4YXD B;  5IOI A;  2MBH A;  2KDI A;  3U30 A;  2KFK B;  4XWT A;  5E6O A;  3ZQ4 A;  4REZ A;  1OEY J;  4RGM A;  2RGF A;  3FIL A;  5IO9 A;  1I4G A;  1XO3 A;  3VH4 B;  2BYT A;  3ZJU A;  4NNJ B;  2LI5 A;  4J3O D;  1WGG A;  2ZEQ A;  2MP2 B;  4GDK B;  2LXC A;  2WXQ A;  1E8Y A;  1OQY A;  3PTF C;  4OVZ A;  4BVU C;  2CHW A;  3KQ4 A;  4GLS C;  1GB1 A;  2L7R A;  1EU3 A;  1P7F A;  3U2S C;  1PFD A;  4E74 A;  2VH1 A;  2IGH A;  5H8Y E;  4K1R B;  2IZV B;  2DHZ A;  4NQL B;  4KX6 B;  2W55 A;  4HXD A;  1OQQ A;  4OZA A;  3U7D A;  3PS6 A;  1CJE A;  1WI0 A;  2BB5 A;  4M8N A;  3FC4 A;  2UYZ B;  1LM8 B;  3A9J B;  3VHT C;  2ZNV B;  4K7U A;  3QJZ A;  2LFI A;  4WQO B;  4HCP B;  3RN9 C;  4ZDV A;  5AZH A;  2KQ7 A;  4PYZ A;  1C3T A;  1GNU A;  4K7S A;  2M1M A;  4HDO A;  3AM9 A;  5H92 C;  1ZW7 A;  5BO4 B;  3SEB A;  1FNU A;  3DHI C;  2XK5 B;  1GB4 A;  4K3C A;  3RUI B;  1P0R A;  2C5L C;  2N1W A;  2W3R A;  3AB5 A;  3DPD A;  4A9A A;  2INN E;  4RMA A;  3NUH B;  3I5J C;  4ZRQ A;  4GGQ A;  1NEN B;  1R7S A;  4HRO A;  1QLB B;  2MSE D;  1GOZ A;  4S17 A;  4RGO S;  1L6U A;  4DHZ B;  5D94 A;  3R7Q A;  2L00 B;  3P1M A;  4EEW A;  1WJN A;  2KDB A;  1BML C;  3DVN U;  1DOI A;  1HZ6 A;  1FPY A;  2KK8 A;  4P7I A;  1C4C A;  1XCQ L;  4XDC A;  3VQI A;  2NBW B;  3MC8 A;  1K51 A;  2LRU A;  2HDE A;  1ZP0 B;  2HE7 A;  1Q10 A;  4IDI A;  3IAM 1;  4P1B C;  5GMV A;  2RMM A;  3SFD B;  5EE0 A;  3Q8C A;  4LNO A;  1R4M I;  2PTL A;  4W9F A;  1VJK A;  3KUD B;  2L3Z A;  2K5P A;  4IM3 A;  4A6Q A;  2NBV B;  4II2 B;  1OGW A;  3BZD B;  2WS3 B;  2ZW1 A;  1C78 A;  4HCN B;  4AJY B;  2IJ0 A;  3OAW A;  4NAW A;  2J52 A;  5TSS A;  2GB1 A;  1D4B A;  1H8C A;  2MX2 A;  3A9K B;  3L13 A;  4KDL B;  3VUX A;  1MHX A;  3DOW A;  3IG3 A;  4PS7 A;  2C60 A;  1PUT A;  3NVV A;  4LNI A;  1L5P A;  3GS2 A;  3LXF A;  4A3O A;  1WRI A;  4WWO A;  1AN8 A;  1JWM D;  3MJW A;  5BMI A;  4IWO A;  2BB6 A;  4XX5 A;  1KLV A;  1HTO A;  2RDB C;  2XNA C;  4WQM A;  5AUK A;  3ZXV A;  4OZB A;  3KYC D;  1WR6 E;  2B76 B;  4N59 A;  3PZ8 A;  1IGC A;  1EF5 A;  2PIA A;  2DYM A;  4XYC A;  4EKU A;  3APD A;  5LNK 1;  2K8B A;  3NS8 A;  1ZOY B;  1VCB A;  2WXK A;  3U4E G;  4R3D A;  1WYG A;  3TL5 A;  3J9C A;  1WXS A;  4AP4 C;  2BF8 B;  1SBB B;  2M4N A;  4CO7 A;  1L6V A;  3B2G A;  3EFU A;  3RFZ B;  2NTT A;  3HM6 X;  3VAW A;  3H6N A;  3AUL A;  1EWY C;  2K22 A;  2CHZ A;  1M4V A;  3ZW3 A;  2OOB B;  1QZE A;  2R2Q A;  2D3G A;  4P6V F;  3BII D;  3I9V 1;  1XD3 B;  4JX1 C;  2G3Q B;  3H7S A;  2IND C;  2K0P A;  4DDG D;  3L54 A;  3GB1 A;  1EUV B;  2FCM A;  2JQR B;  4HWI B;  1FXA A;  3TEZ A;  1FXI A;  1ZKH A;  2CU3 A;  2MEK A;  3WCQ A;  4TV3 A;  4IKG A;  2IPK D;  4MM3 A;  1RM6 C;  3AEF B;  1WSP A;  3P63 A;  4KKI A;  1K8R B;  2JU6 X;  2YVC A;  2MH7 A;  3NG0 A;  1UH6 A;  3TJP A;  3KW5 B;  4M0W B;  4TQ1 A;  1Q0W B;  1Q1O A;  2J0J A;  4YTM B;  5AEK B;  4DBG A;  1E7P B;  1L2N A;  2DLB A;  2N0S B;  4A8X C;  4JWU C;  3A1Q B;  4LLG M;  4M00 A;  1TKG A;  2KNB A;  4HJG E;  1TJE A;  1I4R A;  5T8I A;  3ZNI D;  4XE0 A;  2M8S A;  5CHV C;  3PRE A;  1FEH A;  2WX1 A;  2OED A;  3Q3N C;  4HVB A;  5BYS A;  1BT0 A;  5L95 C;  1EM7 A;  1SJH D;  2MRP A;  2WX0 A;  4TMA B;  3VTU A;  1NI3 A;  2KLG A;  2KZR A;  4E71 A;  4BFR A;  4WH4 A;  1E8W A;  3H7P A;  4GDL A;  2DYO A;  3P4S B;  1ISN A;  1FNW A;  1X1M A;  1OTR B;  1TKY A;  4WJN A;  2NBU A;  1XLN A;  1ZGU B;  2ZCC A;  3VTW A;  2JZP A;  1VR9 A;  2DWQ A;  2O2V B;  3UIP B;  1JW9 D;  3K9P B;  5J2R A;  4F7Z A;  2WLB A;  2KLC A;  2KMM A;  1WXV A;  1V49 A;  1YN5 A;  2LGS A;  2CS4 A;  4QAY A;  1JRO A;  2IY1 B;  5BYR A;  3VVW B;  4ZRJ A;  1J8C A;  2LGI A;  3A9J A;  3I63 C;  2KFK A;  1I35 A;  2KX0 A;  1T0Q C;  2JX5 A;  1SGH A;  3DBR I;  1C1Y B;  1I4Q A;  1WX9 A;  3Q6B A;  3R2I A;  3T3N A;  4EOY A;  3DVG Y;  4W9J A;  2JUO A;  3OWE B;  2LVO A;  3DBS A;  4FN2 A;  1QOG A;  4FA6 A;  4HLE A;  3O65 B;  1UF0 A;  3WAP A;  1JML A;  2IBI B;  4KZC A;  4W9I A;  3L16 A;  3DBR B;  2L1A A;  2B3A A;  1YIW A;  4MGZ E;  1SB3 C;  2NPT B;  3N1X C;  1E90 A;  3L17 A;  3GOE A;  3PSE B;  3RD2 A;  3L08 A;  5AZF A;  3SD5 A;  1N63 A;  2RDH A;  1T0Y A;  3ZJT A;  2L0F A;  3NVZ A;  5JHA A;  4DHJ B;  4MH0 E;  4FUL A;  2KQ4 X;  1QOB A;  2QSD A;  4TUU A;  1T6B X;  2L8J A;  1CZP A;  3AE2 B;  1FNV A;  1JWS D;  3TBL D;  3BVZ A;  4WAA A;  2G45 B;  2KC2 A;  3SDL C;  2BPS A;  5AZG A;  4LCD E;  4M02 A;  4AQ7 A;  3RZF A;  5E6N A;  1G6J A;  3DCG A;  5HI1 A;  3QWZ B;  4GMV A;  4WIP A;  2SAK A;  2KXJ A;  1I4H A;  3EFC A;  2N9E B;  2H89 B;  1HEZ E;  4BAX A;  2IO1 B;  5D3I B;  1YX6 B;  3RI7 C;  1JAL A;  3VH3 B;  2QMT A;  1E6E B;  3NZU A;  2JRH A;  3K9O B;  1HE8 A;  3PRM B;  4L23 A;  3ZRF A;  1F77 A;  4DXF A;  1RWS A;  2WWZ A;  3VRB B;  1T0S C;  4M01 A;  1E8X A;  1R4N I;  3W2D A;  1V8C A;  1A70 A;  2N7E A;  2WDR B;  3H8H A;  4JGH B;  1FIQ A;  1MVK A;  4JPS A;  2N9L A;  2Z59 B;  4ARI A;  4LDT B;  3RNA C;  3ZJV A;  3PHW B;  4XZ4 A;  2D11 A;  5LXH A;  3T9L A;  5CTR C;  4OHJ A;  1RYJ A;  2DZK A;  1SE9 A;  2QC8 A;  2LRW A;  3AV8 A;  2BYV E;  2RPQ A;  1N6Z A;  3TEX A;  2D10 A;  4B6W A;  4RM9 A;  3BYY B;  2MA9 B;  4UDU C;  2BKR B;  2K1F A;  2PW9 A;  3ALB A;  2GMI C;  4I6L B;  4IM0 A;  3ZIM A;  2GRI A;  3CMM B;  4KSL C;  2KAC A;  3RT3 B;  2UU7 A;  1NDD A;  1ET9 A;  5C2T B;  1FRR A;  1NVI D;  4FJV B;  2EEL A;  1TGZ B;  1SEB D;  1YQB A;  2YEP B;  5L83 A;  3KUZ A;  3SFE B;  4HDQ A;  2JYT A;  1F2R I;  4H2A A;  4IW0 A;  1DOY A;  3DVN V;  4JL9 A;  2IY0 B;  2WXI A;  4YT0 B;  3PRZ A;  4W9K A;  1QF6 A;  2C7H A;  3Q8A A;  3V6E B;  3EUB 2;  4MAC A;  2REX A;  2KKC A;  2K8C A;  4BBN C;  4ZRI A;  1IBX B;  4J6I A;  2HD5 B;  1FCL A;  3KYD D;  2BYF A;  4K3B A;  3QAR A;  3AE8 B;  4OVV A;  3ZVV A;  3BWU D;  4NJ7 A;  2BGF A;  3S2A A;  4ANW A;  1CQV A;  1QOF A;  1UZX B;  2SEB D;  1VD2 A;  4AUQ C;  2MBE A;  1C77 A;  2JT4 B;  1R4M B;  3IXS A;  1WR1 A;  3Q14 C;  3TUO A;  4A3P A;  1N62 A;  2DNF A;  2J4X A;  1L4Z B;  1UBI A;  4HKQ A;  3PLU A;  3OLM D;  4JIO U;  2I1K A;  2WXH A;  3IT6 B;  4WJQ A;  2FUG 1;  2MJD A;  3AE9 B;  3HVD A;  1TKE A;  1VZ6 A;  3RNG C;  4DXA B;  1JQ4 A;  2MJE A;  2WQY B;  2BS4 B;  3EGR A;  3PT2 B;  4MM3 B;  2VZK B;  3RCZ A;  2O2V A;  1CMX B;  3PLV A;  1J7C A;  3KLS X;  4YTN B;  3VFK A;  5JZE B;  2N7D A;  5J17 A;  3SHQ A;  2FID A;  2XN9 C;  3DHG C;  4MGI E;  3ZXR A;  3FIL B;  5IKC M;  1GC6 A;  3CST A;  2PE9 A;  5C23 A;  1N5W A;  1EO6 A;  2I1J A;  1LFD A;  2FUH B;  4E3C A;  3QA8 A;  1KRH A;  2D3B A;  3ABV B;  2WNM A;  4HEA 1;  3IT4 B;  1WY8 A;  5E6P A;  2DZI A;  5EDS A;  4ANV A;  4NJC A;  3VTV A;  4YWG G;  1F2R C;  2LVQ A;  4GIV A;  2NMQ A;  4MGK E;  3TCA A;  1WM2 A;  1MPE A;  4LK0 M;  2PPH A;  1U4A A;  3WIM A;  3RZW C;  4XWW A;  4ACF A;  1WFY A;  4DK5 A;  3DBH B;  5TR5 A;  3NRZ A;  3P4R B;  1WXQ A;  2BKF A;  1XF5 L;  3IVF A;  1WXM A;  2PMV A;  3HK0 A;  1QKZ A;  1UEL A;  3PZD A;  2JSV X;  3TEY A;  2M19 A;  2C9W B;  3CWI A;  3A1Q A;  4CQN A;  3DQV A;  3IAS 1;  3TEW A;  3RMK C;  1WRD B;  2XEW A;  3PHX B;  3AH7 A;  3W5U B;  3KWV A;  2J53 A;  4MDK E;  2WXF A;  3ZNZ B;  1TZ1 A;  2BYE A;  1N5X A;  1WJ6 A;  3QX1 A;  1V6E A;  3QC8 B;  2CU1 A;  1E7U A;  1HXY D;  4YSY B;  2N9X A;  2KFJ A;  4EFO A;  4GDL B;  3B08 A;  2DYB A;  4PYU A;  2KQS A;  2NPT A;  1PYW D;  4Q2J A;  4W9C A;  2JYE A;  2AWT A;  2N9P C;  4LTU A;  2MBO A;  3WA0 A;  4ICU A;  1BXT A;  1S3S G;  2Y5B B;  4MEL A;  3SU8 X;  1DGJ A;  4JLC A;  2OHF A;  1YN4 A;  2ASQ A;  2Y3A A;  1QT9 A;  4BOS C;  2AQ1 B;  3VRA B;  2RPV A;  2BS3 B;  3Q3F A;  3R2T A;  4P16 A;  3ZDM C;  1T3Q A;  2JPH A;  4C4V A;  3QCA A;  4AS1 A; 
#chains in the Genus database with same CATH homology
 4WH4 A;  2V3P A;  1V1P B;  2CJN A;  2KDM A;  2PVG C;  2DYO A;  3FAH A;  1KF6 B;  3P4S B;  1FNW A;  2H88 B;  1TKY A;  1TS3 A;  2PKO A;  1XLN A;  4B0M A;  1EU4 A;  2AQ3 B;  2JZP A;  1XLQ A;  3V3X A;  1VR9 A;  2DWQ A;  4ZOH C;  1JW9 D;  1VRA B;  2Y5P A;  2WLB A;  1KLU D;  1ESF A;  1K50 A;  2KMM A;  1YN5 A;  1B1Z A;  3DWM A;  4HRS A;  1ZPS A;  5FR3 A;  3AEG B;  4DXG A;  1JRO A;  5BYR A;  4RCO A;  4NAM A;  3ZGZ A;  1SXT A;  5AUI A;  4WAF A;  1L0V B;  5EE3 A;  2LGI A;  1XXG A;  1D5Z C;  3AE1 B;  2G1E A;  3AEC B;  1KFY B;  2JX5 A;  2QEJ C;  3BK2 A;  1FO4 A;  1TS5 A;  1I4Q A;  3Q8F A;  5C3J B;  3R2I A;  4KGT A;  3T3N A;  2V0G A;  2KN4 A;  3OWE B;  1QOG A;  3AED B;  1JML A;  2WP9 B;  3MJ5 A;  1PGX A;  2L1A A;  4ITK A;  1SB3 C;  3UI3 A;  5MPO A;  3Q8E A;  1SE2 A;  2DBY A;  3B9J A;  3AE4 B;  4C80 A;  1KTK A;  2BTE A;  1ZDV A;  1N63 A;  2RDH A;  5GXG B;  4A90 A;  2WU2 B;  1I7H A;  3ZJT A;  3HUI A;  3NVZ A;  1E0Z A;  1GAQ B;  1ROE A;  2KQ4 X;  1QOB A;  2QSD A;  3BK1 A;  2ACZ B;  1T6B X;  1ZXI A;  4MT5 A;  4MH8 A;  1CZP A;  2IDY A;  3AE2 B;  2BT6 A;  3AE7 B;  1FMA D;  1FNV A;  4N58 A;  1JWS D;  3BVZ A;  5BMH A;  4D2K A;  1IBX A;  1C9F A;  2FBW B;  2PVO D;  3O13 A;  5HHD G;  1FFU A;  3PZ7 A;  2QJL A;  2WXM A;  2W3S A;  3P4Q B;  4RFB A;  5I4D A;  4RGN A;  4YTP B;  1STE A;  1MI0 A;  2G9H D;  4ZRP A;  2V3N A;  3AE3 B;  2Z8L A;  4AQ7 A;  1WWT A;  2WXR A;  4RNA A;  4WWM A;  2HTM E;  4M0W A;  2K9X A;  1KLG D;  2KAJ A;  5HI1 A;  4ZYS A;  1YJJ A;  4WIP A;  2SAK A;  3ETR A;  1QIL A;  1AWD A;  1I4H A;  1F0Z A;  2H89 B;  1HEZ E;  4RGT A;  5D3I B;  1D6E C;  2JXT A;  1JAL A;  1KH0 A;  2BW2 A;  2QMT A;  3Q8B A;  4YXD B;  1PGB A;  2GI9 A;  1E6E B;  3P42 A;  4KKJ A;  4XWT A;  4L23 A;  1F77 A;  4DXF A;  2LHD A;  3ZQ4 A;  1GPX A;  1RWS A;  4REZ A;  2I38 A;  1JRP A;  4RGM A;  1NEK B;  3FIL A;  3VRB B;  1I4G A;  3W2D A;  1XO3 A;  2D5G A;  2LEK A;  2BYT A;  3PO0 A;  3ZJU A;  1V8C A;  4J3O D;  1A70 A;  2WDR B;  3H8H A;  1FIQ A;  1MVK A;  1TZO A;  2N9L A;  1YJI A;  3I57 A;  4GDK B;  1YQ3 B;  4JPS A;  4B0E A;  4C56 C;  1DOX A;  1YMH E;  1FD6 A;  4ARI A;  5HG2 A;  2WXQ A;  1HA5 A;  3ZJV A;  2IGD A;  3NVW A;  3KWL A;  4OZC A;  4OVZ A;  1LO5 D;  4OHJ A;  1RYJ A;  4N6E B;  2AQ2 B;  3KQ4 A;  1BUI C;  4GLS C;  1GB1 A;  1EU3 A;  4FXC A;  1P7F A;  3HRD D;  3LYY A;  3U2S C;  3AV8 A;  5HFY A;  1ZDX A;  1PFD A;  5D3D A;  2IGH A;  5H8Y E;  3BVM A;  3U7Z A;  3BVG A;  2M0A A;  2ON8 A;  3TEX A;  2R61 A;  4KX6 B;  3BYY B;  2Y5C A;  2W55 A;  2NTS A;  1OQQ A;  4OZA A;  4UDU C;  1JWA D;  2ICI A;  2PW9 A;  1PDX A;  1CJE A;  1UWX A;  1JWB D;  3BYT B;  2BB5 A;  2N7J A;  5BMG A;  2INP E;  1HQR D;  3FC4 A;  2BS2 B;  3Q69 A;  1N60 A;  2L83 A;  1NYQ A;  2GRI A;  3B2F A;  2LFI A;  1EWC A;  1SIJ A;  1VLB A;  4RF0 A;  2KAC A;  1SE4 A;  4WUR A;  3E9S A;  1ET9 A;  2V4I B;  1PGA A;  5BYQ A;  3DWG C;  5C2T B;  2VZK D;  3CIR B;  1FRR A;  1NVI D;  5H92 C;  3AM9 A;  3MC0 B;  3SEB A;  1FNU A;  3MFG A;  1GB4 A;  1I4P A;  1ET6 A;  2EEL A;  1SEB D;  2W3R A;  3AB5 A;  1FCC C;  1AW7 A;  1AYF A;  2YEP F;  2YEP B;  2INN E;  4A9A A;  3NUH B;  3SFE B;  2LUM A;  4DQO C;  3AEA B;  4ZRQ A;  1ZXH A;  1NEN B;  2QIE B;  3N9Y C;  1R7S A;  2JYT A;  4HRO A;  1QLB B;  1F2R I;  1UGJ A;  2RDG A;  1GOZ A;  4H2A A;  1DOY A;  5D7G A;  2X38 A;  4RGO S;  3W1S A;  1L6U A;  2WXI A;  4YT0 B;  1ENF A;  2J42 A;  1QF6 A;  1TY0 A;  3EA6 A;  3Q8A A;  2WDV B;  3EUB 2;  4MAC A;  2WXG A;  3P1M A;  1IBX B;  1BML C;  1TYG B;  1FCL A;  1DOI A;  1C4P A;  1HZ6 A;  1J7B A;  2ZW0 A;  5JXV A;  1C4C A;  1XCQ L;  3AE8 B;  4XDC A;  3VQI A;  2Q5W D;  4RF1 A;  1UNS A;  1K51 A;  3BWU D;  2HDE A;  1K53 A;  5FKA C;  1CQV A;  1QOF A;  3AE5 B;  1T5X D;  1ZP0 B;  1SJE D;  1Q10 A;  2ONQ A;  1OFF A;  1XLO A;  2SEB D;  3IAM 1;  4IDI A;  4ZHO A;  1L4D B;  4US9 A;  1C77 A;  3E56 A;  2RMM A;  3IXS A;  3SFD B;  5EE0 A;  2IGG A;  3Q8C A;  5G5G A;  2PTL A;  3TUO A;  1VJK A;  4C7Y A;  1N62 A;  1XLP A;  2K5P A;  4A6Q A;  1SE3 A;  3GP7 A;  2J4X A;  3BZD B;  1DYQ A;  2WS3 B;  1L4Z B;  3P4P B;  2L52 A;  4HKQ A;  1NYR A;  2ZW1 A;  1C78 A;  2N9K A;  2IJ0 A;  2WXH A;  1V1P A;  2J52 A;  3IT6 B;  2FUG 1;  5TSS A;  4C7Z A;  2WXJ A;  2MJD A;  3AE9 B;  3HVD A;  1TKE A;  4YSX B;  1VZ6 A;  2GB1 A;  3MHZ A;  1IUE A;  2WXO A;  2MJE A;  2BBC A;  1SF0 A;  4L1B A;  1D4B A;  4KGS A;  1JQ4 A;  2WQY B;  2BS4 B;  3EGR A;  4MM3 B;  1D5X C;  1MHX A;  2E6X A;  2VZK B;  1PUT A;  3NVV A;  1SSN A;  1E9M A;  1J7C A;  3KLS X;  4YTN B;  1L5P A;  2KWD A;  3GS2 A;  3LXF A;  2WDQ B;  3AEB B;  1WRI A;  4ARC A;  1FRD A;  1JCK B;  1TS2 A;  2CJO A;  1AN8 A;  1HZ5 A;  1JWM D;  5EE9 A;  5BMI A;  2BB6 A;  2XN9 C;  1TS4 A;  1L0Y B;  3TSS A;  3NS1 A;  4L2Y A;  3W5V B;  2K3U A;  5G5H A;  3ZYY X;  2XNA C;  4WQM A;  3FIL B;  4HKZ E;  3R8B A;  5AUK A;  4EE2 A;  1E10 A;  1YQ4 B;  1K52 A;  3URY A;  4USA A;  4OZB A;  3AE6 B;  2WXP A;  2B76 B;  4N59 A;  1N5W A;  3PZ8 A;  1IGC A;  3T3O A;  2PIA A;  2DYM A;  5LNK 1;  1KRH A;  4NZL B;  3ABV B;  3U52 E;  2LJI A;  2WNM A;  1ZOY B;  3VR9 B;  2WXK A;  4HEA 1;  2L32 A;  3IT4 B;  1UUP A;  2E3T A;  5E6J A;  3U4E G;  1V1O A;  4R3D A;  1ACC A;  4O1N A;  1WYG A;  4NJC A;  3J9C A;  1VZ8 A;  3AN1 A;  1F2R C;  4YWG G;  1SBB B;  1YN3 A;  2NMQ A;  4KGR A;  1V97 A;  1MPE A;  1MHH E;  1J7A A;  2EKI A;  1L6V A;  1VDV A;  3B2G A;  3RFZ B;  2NTT A;  1YNT E;  4LK0 M;  3AMZ A;  1OQR A;  2LHE A;  4XWW A;  1ZUD 2;  1EWY C;  2K22 A;  4RH6 A;  1CK1 A;  4TSS A;  1M4V A;  4IOI E;  1ZE3 D;  3NRZ A;  3P4R B;  1WXQ A;  1XF5 L;  4P6V F;  3BII D;  3I9V 1;  4JX1 C;  4YSZ B;  1C4A A;  2PMV A;  1QKZ A;  2I2Y A;  2JSV X;  3TEY A;  4JWS C;  1QOA A;  2K0P A;  1RFK A;  4OW0 A;  2M19 A;  3CWI A;  3MP9 A;  3C8Y A;  4JE3 B;  5EE1 A;  3GB1 A;  4CQN A;  2JQR B;  1XEE A;  1L0X B;  3IAS 1;  1QQR A;  2WU5 B;  3LB8 C;  3RPF C;  3TEW A;  4NAW B;  1FFV A;  1FXA A;  2M56 B;  3NVY A;  3TEZ A;  3HVZ A;  1FM0 D;  1FXI A;  2CU3 A;  1C79 A;  2MEK A;  3WCQ A;  3AH7 A;  3W5U B;  3AEE B;  3KWV A;  4IKG A;  2J53 A;  2FE8 A;  2WXF A;  2IPK D;  1B9R A;  2W82 A;  1RM6 C;  3AEF B;  1WSP A;  3P63 A;  4KKI A;  4A55 A;  1N5X A;  1D5M C;  2JWU A;  2MJ3 A;  4PT5 A;  2JU6 X;  2MH7 A;  2TSS A;  2W54 A;  1N61 A;  1UWM A;  4TQ1 A;  1HXY D;  4YSY B;  4GDL B;  2LMC A;  4YTM B;  1E7P B;  1PYW D;  2DLB A;  4Q2J A;  2N0S B;  1WGK A;  4A8X C;  3V05 A;  4JWU C;  1VZ7 A;  1XCT L;  3L4P A;  2JYE A;  4LLG M;  4LTU A;  1TKG A;  3SR6 A;  2AX5 A;  4US8 A;  4HJG E;  1BXT A;  1TJE A;  1I4R A;  5T8I A;  3W9C B;  1I4X A;  1Y56 A;  4XE0 A;  1P7E A;  4XDD A;  1DGJ A;  2OHF A;  3NZ3 A;  2QIL A;  1TY2 A;  1YN4 A;  2Y3A A;  1QT9 A;  1FEH A;  2OED A;  1JWU D;  2WXL A;  1IGD A;  5BYS A;  2AQ1 B;  3VRA B;  2PLP A;  2RPV A;  1EM7 A;  1SJH D;  3VR8 B;  5FK9 C;  2BS3 B;  2WXN A;  4ZHP A;  4TMA B;  1NI3 A;  3R2T A;  4P16 A;  1T3Q A;  4TQ0 A;  1C76 A;  4AS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...