1FXIA

Structure of the [2fe-2s] ferredoxin i from the blue-green alga aphanothece sacrum at 2.2 angstroms resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
96
structure length
96
Chain Sequence
ASYKVTLKTPDGDNVITVPDDEYILDVAEEEGLDLPYSCRAGACSTCAGKLVSGPAPDEDQSFLDDDQIQAGYILTCVAYPTGDCVIETHKEEALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transfer (iron-sulfur protein)
molecule keywords FERREDOXIN I
publication title Structure of the [2Fe-2S] ferredoxin I from the blue-green alga Aphanothece sacrum at 2.2 A resolution.
pubmed doi rcsb
source organism Aphanothece sacrum
total genus 14
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1990-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fxiA00
1FRDA 3AECB 3NVVA 4WWMA 2ACZB 1N61A 1YQ3B 3RPFC 1DOXA 2HTME 1N62A 1KRHA 4YSZB 2L52A 2WDVB 2WU2B 5AUKA 1DOIA 5AUIA 2KMMA 1CJEA 1FFVA 2G1EA 1WRIA 2CJOA 1L6UA 2BS4B 2WS3B 3DWMA 2JQRB 3AV8A 1TYGB 1V8CA 1JWAD 2MJEA 1N5XA 3AE9B 1L0VB 3EUB2 1N60A 1J7AA 1JALA 3KWLA 4HROA 3AB5A 4N59A 4YSXB 1NENB 2QIEB 3HRDD 1PUTA 1FRRA 1QOGA 3AEFB 4US9A 5EE1A 5GXGB 4WQMA 1DOYA 4ITKA 2M56B 2EKIA 5H8YE 4C7ZA 2QJLA 3VR8B 1JROA 1KF6B 3ABVB 1FXAA 1QOAA 4LTUA 1N5WA 2W55A 4JX1C 1NI3A 3NRZA 1RYJA 1AWDA 1VJKA 4KX6B 1YJJA 4JWSC 2K22A 3VRBB 1ROEA 1JQ4A 3SFDB 2BT6A 3NVWA 2BS2B 1ZXIA 1FFUA 2DBYA 1L6VA 4USAA 3AEDB 3P4RB 2DWQA 1FXIA 5G5HA 2CJNA 1WWTA 2W3RA 3AE2B 3AEAB 1F0ZA 1R7SA 2JX5A 2Q5WD 3ETRA 3L4PA 1UWMA 3AN1A 1TKYA 3NVYA 3W5UB 5C3JB 1SF0A 1TJEA 4YTNB 3P4QB 5EE9A 1SIJA 2B76B 1OQQA 3DWGC 2W3SA 3AE6B 2KAJA 3AH7A 2AX5A 2PKOA 3B2GA 1ZOYB 3FAHA 2WQYB 3PO0A 4ZOHC 3W9CB 3WCQA 4ZHPA 2N0SB 1B9RA 3AE3B 1QF6A 3AE4B 1IUEA 2PVGC 3P1MA 3P4PB 1NVID 4YTPB 1E7PB 1PDXA 2PIAA 1GAQB 1FO4A 1DGJA 1WYGA 1QOBA 5H92C 2W54A 5C2TB 5MPOA 1N63A 1CZPA 1TKEA 4N58A 4HRSA 4YSYB 1XLQA 1E9MA 3AE5B 1E6EB 3B9JA 3FC4A 4YT0B 1RM6C 2WP9B 1T3QA 1WXQA 2WLBA 2WDQB 1L5PA 3CWIA 3P63A 3LB8C 3AE8B 1I7HA 3HVZA 1PFDA 1NEKB 1VLBA 1V97A 3AE1B 1NYQA 5G5GA 4YTMB 2MH7A 1JRPA 1JWBD 1GPXA 2WU5B 1FM0D 3AE7B 3SFEB 1KFYB 1ZP0B 3BIID 2CU3A 1EWYC 1ZUD2 1XLOA 1A70A 4C80A 5EE0A 2WDRB 1QOFA 2Y5CA 3SR6A 2OHFA 2M19A 2PVOD 1TKGA 1XO3A 1FIQA 1YJIA 3NVZA 4P6VF 3AEBB 4ZHOA 3AEGB 1JW9D 1WGKA 1AYFA 1XLPA 4N6EB 4IDIA 1OFFA 2H89B 4C7YA 1J7BA 2E3TA 1XLNA 3LXFA 4US8A 3W5VB 1NYRA 2FBWB 4FXCA 3CIRB 1J7CA 2MJ3A 2K9XA 1E0ZA 1FMAD 1OQRA 4JWUC 2MJDA 3VRAB 4A9AA 1YQ4B 3P4SB 3AM9A 1RWSA 1VDVA 1E10A 2LEKA 2L83A 3ZYYX 3B2FA 2H88B 5EE3A 1RFKA 4YXDB 3AMZA 3VR9B 3AEEB 3HUIA 3NS1A 2BS3B 1QT9A 2K5PA 1QLBB 1SB3C
chains in the Genus database with same CATH superfamily
3RT3B 2HTME 5AUKA 3TEZA 2N9XA 3T9LA 1YX6B 3QK0A 4D2KA 2XN9C 4KIKA 1C79A 1GNUA 4KKJA 1QOGA 2JU6X 2EKIA 3BVGA 3BY4B 1FXAA 3BK1A 3J9CA 1C3TA 1RYJA 1YJJA 2X38A 2JZZA 1FFUA 2BKFA 3SHQA 3N1YC 1I4HA 1WMHA 1D4BA 1TJEA 3S2AA 3P4QB 1LFDA 2SEBD 1E7UA 4ZHPA 1IUEA 4PK1A 4DXAB 2L0TA 1Q10A 1FO4A 4II3B 1TKEA 4PYZA 3RZFA 4HRSA 1SSNA 3M3JA 1AN8A 4MDKE 2JXTA 3ENEA 3HVZA 4JIOU 1WE6A 4EZJA 3AE7B 2JF5A 2A5UA 3HVDA 3Q3JA 1LM8B 2LFIA 1MHHE 1WX8A 2K6DB 1FIQA 1WXAA 3AEBB 1XQQA 3AEGB 3M63B 3MJWA 1HZ6A 4LK0M 4OZAA 3SU8X 5D7GA 2K8HA 1BXTA 2K9XA 3JSVB 5C23A 1YQ4B 3R2TA 3UF8A 4TUUA 2FCQA 3NS1A 4MM3B 1P0RA 1QT9A 3DHHC 1DOXA 2BWFA 4RFBA 3PRZA 3ZRFA 4LCDE 2KMMA 5D3IB 1JMLA 3B1LX 3KWLA 2QSDA 1MG4A 2WGSA 1CK1A 3EA6A 2K8CA 2WXNA 4KIKB 1TY0A 2QJLA 2L7RA 3PRMB 4FJYA 2W55A 3RI7C 4OVUA 1MVKA 3JW0X 1GG3A 4LNFA 4WJQA 1EM7A 4EFOA 1F2RI 2BS2B 3I5JC 1I4XA 1FXIA 2OEDA 1R7SA 4FADA 3A9KB 4ASWC 1WMHB 3ZNGC 1GC6A 3UINB 1YIWA 2WWZA 3FAHA 1HZ5A 2KKCA 2YLMA 3AE3B 3AE4B 3QQ8B 1OGWA 1SJED 5IP4D 4FLHA 4BKSA 4S17A 2INDC 1WX7A 4M01A 1IBXB 4YT0B 2WP9B 1T3QA 3UQBA 2KYWA 1NEKB 3LDZE 2Z0DB 3Q8FA 1MG8A 4YTMB 5DCNA 3DPDA 1JWUD 1SE4A 2L05A 3DBLB 4WWNA 4C56C 2V0GA 3MHZA 1XO3A 2KQ7A 4DHJB 3W1SC 4N6EB 2QDFA 5BMHA 3BYYB 2BGFA 2MW5A 1J7BA 2N1VA 2GOWA 2KDEB 1YMHE 3P42A 1WY8A 2INNE 2RDHA 3MTNB 2KDMA 3ZIMA 4BBNC 2V3PA 4R3DA 1KH0A 3VTVA 3AEEB 3HUIA 4BKGA 1WX9A 1QLBB 2L52A 3RPFC 2ACZB 4ICUA 4LDTB 2M4NA 4CO7A 2BWES 2WXMA 4CHKA 5AUIA 1WJUA 4WH4A 5D3DA 4B0EA 4JQWC 2LRWA 4WAFA 4YSXB 2BVCA 3HRDD 5GXGB 4P7IA 4C7ZA 2IGDA 4KV2A 3DOWA 3VR8B 1S1QB 2J7QB 2DENB 2FCMA 2IJ0A 1AWDA 2XK5B 4B9KA 1FPYA 2UYZB 1WGRA 2CS4A 2GBNA 2CJNA 2XBBC 4KSKC 2O6VD 1S3SG 1FNWA 1I4GA 2Z59B 3ZXVA 2BB6A 1XEEA 4HCPB 1YNTE 4BZAA 1E7PB 2JVCA 3GE3C 3AI5A 4HPPA 4RGNA 4ICVA 3A9JA 4MH0E 2QMTA 1TIFA 1TS4A 2C7HA 3RZWC 2BYVE 1WJ6A 3FILB 1WH3A 1Z2MA 2V3NA 2JT4B 2KX0A 2RDBC 3KWVA 4A3PA 3ZNZB 2CU3A 4IWPA 1BMLC 4JLCA 1KLGD 2DNFA 1TKGA 5J18A 3NVZA 4M02A 1K8RB 4C00A 2KWUB 1XLPA 4WWPA 2DHZA 2UWQA 4BOSC 3ZO5B 1K50A 1V5OA 2G4DB 4MJSB 1NYRA 4WJNA 3CIRB 2KO3A 3EFUA 1J7CA 2CHZA 2FCNA 2WX0A 4KGTA 2D3CA 1Z5SB 3UQAA 2BPSA 3P4SB 1K52A 5E6NA 2L83A 4HK2A 2Y3AA 2AQ1B 5LLIA 4P16A 1UNSA 3N1ZC 1WM2A 2XNAC 3SDLC 3TEXA 4ANXA 3NUHB 4JGHB 4NQKE 3L17A 1MI0A 3QWZB 2DYBA 4Q2JA 5E6PA 1BUIC 3RFZB 3V05A 3DBSA 1J8CA 1FRRA 2K8BA 5EDSA 2MA9B 1KF6B 4OZBA 4DDID 3TCAA 4JE3B 1GJZA 1F1HA 1JQ4A 5D6JB 1YN5A 1L6VA 4GMVA 1GOZA 1L0XB 2QEJC 3PLUA 2UU7A 1XF5L 1WFYA 4II2B 3U2SC 3ML8A 2WXFA 3IG3A 4TMAB 4NJ7A 3K9PB 1GC7A 4PS3A 4P1CC 2J0KA 3Q8BA 3WAMA 4REZA 4AQ7A 3DHGC 4FULA 2FCSA 3B08A 4H2AA 2FIDA 2W9NA 2ZZPB 2L3ZA 3Q3MC 4DWFA 3ZNID 5E6JA 1EO6A 1R4MB 2WXLA 1E9MA 5DPWA 4GLSC 3FC4A 4MGIE 1JCKB 4DHZB 3LB8C 3Q3NC 4GN1A 5DPRA 3PT2B 1F77A 1GPXA 4W9KA 1XLOA 2J53A 1FNUA 4NPNA 5JH5C 3C8YA 3IBEA 1T0YA 2GRIA 3HM6X 1WXMA 4C7YA 1L0YB 4PYUA 2FE8A 3APFA 3URYA 1C4CA 5IOIA 3VDZA 3M62B 2LWPA 3NOBA 1H4RA 2LHDA 4PS8A 2H88B 1EUVB 3VTUA 2QC8A 1XXGA 1TT5B 1WJNA 2IY0B 4RH6A 4WIPA 2D10A 1AW7A 3UI3A 1Q0WB 1WXSA 4YL8A 1CJEA 1VRAB 2MBOA 2FAZA 1HXYD 1VZ6A 2BKRB 2KOXA 2MJEA 3H1UA 2AYOB 1FCLA 2KD0A 1C1YB 3AB5A 3R3MA 4PS7A 1P7FA 1QZEA 1ZGUB 1UELA 3N1XC 4HJGE 4BOZB 1TS5A 1SE3A 4AP4C 3JVZX 2AQ2B 5DPTA 3AEAB 5BYQA 3R7QA 2ON8A 2WHIA 1V6EA 1OQQA 2LJ5A 1B9RA 4MT5A 3DVNU 1GAQB 2WXOA 1QOBA 5HG2A 2R2QA 5JHAA 4PT5A 2J42A 5FR3A 3Q69A 2AL3A 4IC7B 2X8XX 1RM6C 2BTEA 2WDQB 3EHVA 3TEWA 2PTLA 4RMAA 1VLBA 5G5GA 2KJHB 2NR2A 1JRPA 3BZDB 4ZRIA 2WXIA 4QAYA 1PGXA 3T8MA 4GB9A 2OHFA 2ZW0A 2WXQA 2KWCA 2PW9A 2QILA 4G11A 2MBQA 1WGKA 1AYFA 2AEHA 4ANUA 2C7MB 3V61A 5KHQA 3CMMB 2IGHA 4NAMA 3QAQA 2LASA 3IT4B 4JPSA 1E0ZA 2L0FA 2LD9A 2E6XA 2MJDA 4CYEA 3R8BA 1TTNA 2RPQA 2WXPA 4FHKA 2KWVB 2L76A 1T6BX 2PJHA 4DBGA 2KMCA 2PPHA 3RCZA 2GB1A 2MCNB 3PHXB 1SIFA 2WU2B 2YVCA 2WX1A 2ASQA 4GDLA 2G1EA 2C5LC 2KHWB 3GS2A 1V8CA 3C19A 4US9A 2RPVA 3ALBA 4GDKA 5J17A 1VZ8A 1JROA 3PREA 1QOAA 1N5WA 2MX2A 1IGDA 2V9HA 2Z8LA 3PZDA 3MFGA 1ROEA 1V1PB 1ZXIA 1K53A 4DHZE 1HQRD 1SJHD 3NVYA 1SF0A 3TMPB 4KGRA 3PLVA 3C0RB 2PKOA 1UWXA 3MP9A 1M94A 3KVFB 3P4PB 1F52A 4ZYSA 4M00A 5H92C 2W54A 2D11A 3L08A 3NY5A 2WLBA 2JUOA 1T5XD 3A4SC 3VVWB 2HE7A 1PFDA 1KJTA 3BWUD 1NI2A 3ZRCA 2KZRA 1B1ZA 1Y8RC 3P2BA 2MLBA 4K7WA 2KNBA 2KXJA 1T0QC 1YX5B 2E3TA 4HVBA 4FXCA 3AULA 1IPGA 2MHJA 1JRUA 1OQRA 2C60A 4FA6A 2J4XA 2K0PA 2REXA 3X23A 3NG0A 2GBMA 2HJ8A 3W1YA 2BS3B 4MGKE 3AECB 3VHTC 3HHMA 4HCNB 1T0SC 1DOIA 1FFVA 2CJOA 4IM2A 2BS4B 3KLSX 1TYGB 4ZYNA 2N4FA 4ARIA 1NENB 4BAXA 4WQMA 4ITKA 2J52A 3V6EB 2BW2A 2VH2A 2D07B 3I3TB 4GDKB 1VJKA 1KLVA 1GUAB 1FD6A 1I35A 3SEBA 3AEDB 2RSUA 4BFRA 1ZDVA 2Q5WD 2VZKD 5IA7A 2L32A 4K7UA 1N6ZA 3RYTA 3O65B 3DWGC 2MQJA 1WF9A 3AH7A 2IZVB 1WGGA 3W9CB 1E8ZA 2GBRA 2LMCA 2BYTA 1QF6A 4G3XB 1NVID 3ZLZA 3SD5A 1A5RA 2ONQA 4A90A 2M1MA 1I4RA 2V4IB 2N7EA 1V80A 2ICIA 2NMQA 2V1YA 4YSYB 1XT9B 3AE5B 4TQ1A 3AU4A 1ZKHA 2LGSA 1WM3A 4AUQC 3GZNI 2M17A 5CX3A 1C76A 2ZCBA 1WIAA 1OQYA 2WU5B 1ZP0B 2WXHA 3D32A 3IHPC 4TKNA 2N9PC 3U30A 4US8A 4L1BA 4FJVB 3PVLA 1R4NI 3QJZA 1E10A 3PZ8A 2BQQA 2O2VA 2QCZA 2IPKD 3NVVA 4IUMB 5CTRC 1V9JA 4YSZB 3L54A 4W9LA 4XE0A 1L6UA 2N1WA 2JQRB 1JWSD 2LXAA 3N20C 2LXCA 3PSEB 3Q8EA 1J0GA 2HD5B 2NBUA 4AWJA 1UBIA 1PUTA 2LZ6A 3NRZA 2GLSA 2YEPB 4KVGB 4FBJB 2BT6A 1PGAA 3FKYA 3VUXA 2AWTA 3VH4B 4A55A 1F0ZA 3AN1A 4O1NA 1G6JA 4W9HA 3U4EG 2B76B 2LI5A 3V62A 3PTFC 4RCOA 5LXIB 1D5ZC 2G45B 2I2YA 4LNKA 2PIAA 3ZJTA 3ZQ4A 2M0XA 1N63A 1L2NA 1RRBA 1GB1A 1XLQA 2JZ3B 3UGBB 2DYMA 1WXQA 4AJYB 2V3SA 4TV3A 2RMMA 3T3OA 3Q3FA 1V97A 1CQVA 1JWBD 4LNNA 2N7DA 4ZRJA 1UUPA 1QOFA 4NZLB 3KUZA 3V3XA 2CKHB 1C4AA 2JWZA 4WWOA 2Z0EB 3WA0A 4IM0A 3DHIC 3LXFA 4RM9A 4IKGA 3KUCB 4HEA1 1WR6E 2NPTA 1FCCC 3BYTB 3EGRA 2GI9A 1EWCA 4WURA 4B95A 3TBLD 4B0MA 2FUG1 4BBNF 3ZJVA 2KLGA 2KC1A 2KVRA 3DBRI 3RULA 1AARA 2WNMA 2I38A 3L10B 2WS3B 4AJWA 1Q1OA 2DZIA 1E8XA 3O13A 2M56B 1YJ1A 4EEWA 2LGIA 2G9HD 2BF8B 1WGHA 3ZGZA 3Q6BA 3DBHI 3QX1A 2ZNVC 1VZ7A 3ZUNA 1TKYA 3E56A 1XCTL 4NNJB 5KHOA 3MC8A 4W9DA 4JL9A 1NBFC 3B2GA 2KQSA 4ANWA 1PDXA 2NVUI 2ZPNA 3OJ3A 4ANVA 4ARCA 1STEA 3I63C 2GBKA 4RM8A 1ZW7A 1XCQL 3NS8A 2N9LA 3RNGC 3RNBC 4EKUA 2KTRA 5BYRA 1H8CA 2PE6B 2KK8A 2ZPYA 3P63A 4MH8A 2IO3B 4I6LB 2INPE 2LVPA 2DZKA 1E7VA 1ZUD2 1C4PA 4DXGA 4C80A 3KYDD 1KOTA 2IGGA 1VD2A 5AEKB 1LXDA 1ACCA 3MC9A 3RMKC 2D2QA 3VTWA 4HJKA 4KGSA 3A9JB 3RNEC 3VFKA 3PRPB 3VQIA 2INCC 3DVGX 3GE8C 2VRRB 2WXJA 3N30A 2R61A 5EE3A 1FNVA 4XDDA 2JYTA 4DXFA 3SFDB 1FRDA 4WWMA 2LJIA 2R2OA 1SGHA 1KRHA 5AZFA 2BYEA 2O6VA 1WRIA 1ESFA 3ZW3A 3TEYA 2JYEA 2ZEQA 1I4QA 3I9V1 4WJPA 4N59A 4RGTA 4XDCA 4IG7B 4MACA 3A4RA 3PZ7A 2DAFA 1D3ZA 1HTOA 1ISNA 2LUEA 5BMIA 4C4VA 3DCGA 2WXKA 5G5HA 2W3RA 1WWTA 3GP7A 3ETRA 3H9DA 1IGCA 2CR5A 2W3SA 2KAJA 2C9WB 2MEKA 4NJCA 4BVUC 1ZOYB 2J0JA 2N0SB 2IO0B 4AS1A 3ZJUA 2DAJA 1WXVA 1WYGA 2JRHA 1K51A 4XYCA 1ZDXA 5L95C 1I42A 1EU3A 1RAXA 1MPEA 3OJ4B 2JWUA 1JWMD 2SAKA 1KM7A 1TZ1A 2V4LA 3E9SA 1LQBA 4DQOC 1NYQA 4KZ0A 1C9FA 3SFEB 2IBIB 1UBQA 3CF6E 5EE0A 3U7DA 2M19A 1L7YA 4GGQA 1DYQA 1ET9A 4ZHOA 3HIZA 4S0RA 3Q8AA 1CMXB 2LGDA 4A20A 3MC0B 4RNAA 1E8WA 3EECA 2KFJA 4G50A 2DX5B 2LGYA 3I57A 3EFCA 4RF0A 5AZGA 3WIMA 4DHJD 1ZPSA 4I6NB 1WZ3A 2K5PA 4A6QA 1PYWD 5G55A 4A3OA 3AV8A 1SE2A 2O6VB 1VCBA 1J7AA 1WR1A 4W9CA 2KWDA 4UDUC 1HA5A 1TZOA 2JSVX 3ABVB 4F1SA 3NZUA 4JX1C 2CU1A 3DQVA 1EF1A 4LDTD 4LLGM 4JWSC 3VRBB 2HDEA 2KFKA 4G0NB 4C4VB 1TY2A 1EU4A 3DBLI 2K39A 1C77A 1MJDA 1Y56A 3WCQA 3VH3B 2MBHA 3N32A 1P1AA 3R66C 4MSMB 1P9DU 1DGJA 3TJPA 4OHJA 2LUMA 4LJPB 3H8HA 4NY0A 4CQNA 1MHXA 3M95A 3CSFA 1TBEA 3CSTA 4EE2A 3H6NA 1L5PA 2IDYA 3DDCB 2DLBA 2BBCA 1UGMA 3AE1B 3BVZA 3PGEA 4M8MA 1SEBD 3KYCD 2WDRB 1F2RC 4MGYE 4W9IA 3LJ3A 3EC8A 4BKSD 4HKQA 3X0WA 4K3BA 1OTRB 2MJ3A 2W82A 2VH1A 1IP9A 1P98A 1RWSA 5CHVC 4GOCA 4XX5A 2QHOA 2NBVB 3AMZA 3NZ3A 1V81A 4M0WA 3MHSD 1SXTA 2K3UA 1YD8U 3A9KA 1UGJA 1HE8A 2NTSA 3B0AA 3WAPA 3WANA 1D5MC 3ZTCA 2HTHA 3U7ZA 3PHWB 5HFYA 2RDGA 2RGFA 3QC8B 4KX6B 1HTQA 1IBXA 3BINA 3P4RB 4ZRQA 1ET6A 5MPOA 1KTKA 4W9JA 5CHWA 2KDBA 2KFKB 3QHTA 4X57B 4GDLB 4EOYA 1WSPA 5D2MB 2FIFA 1TGZB 4F7ZA 2ZNVB 4OVZA 4YTPB 3TL5A 4N9F4 1P7EA 2M0AA 1ENFA 4F8CB 1YN3A 1SE9A 3ZDMC 1E6EB 4RGOS 1UD7A 3AE8B 4LNIA 2ZVNA 2J0MA 2IO1B 2D5GA 2M8SA 1E90A 4K7SA 2KANA 3H7SA 1WE7A 2Y5CA 1OEYA 2OJWA 1ZXHA 2D3GA 4P6VF 2RR9A 3MJ5A 4IOIE 2H89B 2WYQA 2KJ6A 1V5TA 2LVOA 1WJ4A 3OWEB 3KUDB 4HXDA 4JWUC 3ZDTA 2DZJA 2K6QA 2ZVOA 3AM9A 1V86A 1M4VA 4KSLC 4XWTA 3R7RA 3HK0A 1D6EC 3U52E 2XK5A 2JY6A 4M8NA 4YXDB 1EF5A 5DPSA 2BYFA 3PS6A 3ECIA 2D3AA 2HJ1A 4M0WB 2A4ZA 3QA8A 1I4PA 3ONSA 2KQ4X 2LRUA 2LVQA 3EUB2 3AE9B 1L0VB 1JALA 5JXVA 3N3KB 1DOYA 4HDQA 3H7PA 1R4MI 2G4SA 1KLUD 3PV1A 3QIJA 4GXBA 4LTUA 5LNK1 2AQ3B 3W2DA 2L1AA 4EZLA 3FILA 4L2YA 3RNCC 1X1MA 3V6CB 3AE2B 2MSED 1UWMA 4NAWA 4URKA 5C3JB 1WGYA 4YTNB 1V2YA 1VR9A 5EE9A 3APCA 1WI0A 4K3CA 5LXHA 2PVGC 1OEYJ 4FJZA 3VUWA 1UF0A 4OW0A 4MJSA 1T0RC 4HDOA 5BYSA 3B9JA 3OG5A 4K1RB 3AU5A 5HI1A 2Y5BB 5TR5A 4HLEA 4EUTA 2MP2A 3QARA 1UH6A 4W9GA 4BKTA 4FHJA 1E5WA 1KFYB 2IYDB 1WRDB 2GBJA 3RD2A 1U4AA 1FXTB 4IM3A 1V1OA 1LO5D 4J3OD 2PEAA 2L00B 4P1BC 1XLNA 3NHEB 4YWGG 3RN9C 1ZE3D 2FBWB 4NQLB 1UZXB 4A9AA 1TS2A 2B3AA 4OVVA 2KDIA 2IY1B 3IFWB 4DDGD 3T3NA 1N61A 4RGMA 2OJRA 3JYUA 3BK2A 2AL6A 3V60A 2Y5PA 3ZNHB 4ACFA 2QIEB 5IN7A 1V49A 2KTFA 2PMVA 2WXGA 2ZW1A 4MELA 4IWOA 3H7PB 2OOBB 4KKIA 3IAS1 1RLFA 4LNOA 1NI3A 4E74A 3PPAA 2K22A 3NVWA 2O2VB 2DBYA 2XEWA 3AXCA 5I4DA 2JX5A 3L4PA 2ZCCA 2GMIC 4NAWB 5JZEB 3AE6B 4W9FA 3APDA 3IT6B 1GB4A 4XGAB 4I6PA 1WYWB 1L4DB 1IYFA 1HEZE 3IAM1 3N9YC 3UIPB 3ZVVA 3Q14C 4GU2A 4XC2A 1I7HA 2EMTA 3NZSA 3KW5B 5IAAC 3Q2AC 2MP2B 5D94A 1EWYC 3VAWA 3GB1A 5FR6A 3RNFC 2I1JA 2IO2B 2PVOD 2L8JA 3QCAA 4IDIA 5L83A 5T8IA 3W5VB 1SBBB 3HM3A 2ZJDA 2RD0A 3KQ4A 3ML9A 2N7JA 4HWIB 4ZRPA 2DYOA 5E6OA 2KX3A 1VDVA 2N9EB 4ZDVA 1RFKA 3A1QA 4HKZE 1C78A 3VR9B 3U8ZA 2EMSA 3GZNB 3BVMA 1SB3C 1N62A 4XZ4A 3TUOA 4GIVA 2WDVB 4KDLB 1NDDA 4A8XC 2BB5A 2KC2A 3DWMA 1J19A 3NJTA 2VZKB 1JWAD 4HROA 3GOEA 1QQRA 4KDIC 2NPTB 2CHWA 1MFWA 5J2RA 1R4NB 2LGXA 4USAA 1XD3B 2KJRA 5FKAC 3TIXA 2MWSB 2JPHA 4IWQA 1SIJA 4RF1A 2AX5A 2KACA 3PO0A 5FK9C 4MSQB 2N9KA 4OZCA 3L13A 4MGZE 4NJ6A 5HHDG 4J6IA 2C7NB 1WGDA 2MBBB 5C2TB 4N58A 5BMGA 4E71A 1YN4A 3VUYA 5AZHA 4MEMA 2NBWB 2KLCA 3A33B 2JZPA 2PE9A 3LYYA 3L0WB 3DVGY 5JHBA 3CWIA 3KH0A 3W1SA 3RNAC 2MH7A 1FM0D 2K25A 1A70A 2WXRA 4XWWA 4KZCA 4AOFA 5C1ZA 3WAOA 4EZKA 1RFAA 1BT0A 4TSSA 1LGRA 3VRAB 2KTRB 2NTTA 3ZYYX 2KVZA 3WALA 4HPMB 1YOVB 3VXWA 3ZKJC 5BO4B 1V1PA 3IVFA 3A1QB 5GMVA 4WJOA 1YQ3B 1WZ0A 2KT7A 4WQOB 2CHXA 1N5XA 2K1FA 1N60A 4L23A 3Q8CA 5G2NA 5EE1A 3AEFB 3UIOB 1PGBA 5H8YE 1P3QU 1PQSA 3IXSA 1QILA 2JRIB 2WDTB 2KMAA 5IKCM 3K9OB 2FUHB 3Q3OC 2DWQA 2D3BA 5IO9A 1QKZA 3W5UB 1F9JA 2G3QB 4GSWA 5CHFA 3DBRB 4ZRKA 4ZOHC 2WQYB 2MRPA 2YEPF 3P1MA 3ZTDA 4IW0A 2KN5A 1TS3A 4FN2A 5TSSA 3ZXRA 2LHEA 4E3CA 1CZPA 1YQBA 4W9EA 2PLPA 3R2IA 2NS5A 4B6WA 3RUIB 2FNJB 2MBEA 3OLMD 1Q5WB 3TSSA 3DVNV 2DZMA 3DBHB 4WAAA 3BIID 1D5XC 2EKEC 5HKHA 3L16A 2NCNA 3SR6A 4LJOB 3OAWA 1YJIA 2KN4A 1E8YA 1JW9D 1OFFA 4K81A 3JSVA 4DK5A 1FEHA 1FMAD 2KDFB 2I1KA 2LEKA 3B2FA 4TQ0A 4MM3A 2EELA 1L4ZB 2JXXA 2TSSA 4HPLB
chains in the Genus database with same CATH topology
2FUG1 3ZJVA 2HTME 4RH6A 4WIPA 1AW7A 3UI3A 5AUKA 3TEZA 1CJEA 1VRAB 1I4PA 2WNMA 2I38A 1HXYD 2WS3B 2KQ4X 4D2KA 1VZ6A 2MJEA 3EUB2 3AE9B 1L0VB 1FCLA 1JALA 2XN9C 3AB5A 1C79A 5JXVA 4KKJA 1DOYA 1QOGA 3O13A 2JU6X 2EKIA 2M56B 3BVGA 1KLUD 1P7FA 1FXAA 3BK1A 3J9CA 4LTUA 4HJGE 2LGIA 5LNK1 1RYJA 2G9HD 2AQ3B 3W2DA 1TS5A 1SE3A 1YJJA 2L1AA 2X38A 3FILA 2AQ2B 1FFUA 4L2YA 3ZGZA 1VZ7A 3AE2B 1I4HA 3AEAB 5BYQA 1UWMA 1TKYA 3E56A 1XCTL 5C3JB 2ON8A 1TJEA 4YTNB 3P4QB 1D4BA 1VR9A 5EE9A 1OQQA 2SEBD 3B2GA 1B9RA 4ZHPA 4MT5A 1IUEA 2PVGC 1PDXA 1Q10A 1GAQB 4ARCA 1STEA 1FO4A 2WXOA 1QOBA 4OW0A 5HG2A 1TKEA 4HRSA 5BYSA 4PT5A 1SSNA 2J42A 1XCQL 1AN8A 2N9LA 3Q69A 5FR3A 3B9JA 1RM6C 5HI1A 5BYRA 2BTEA 2WDQB 2JXTA 3P63A 4MH8A 3HVZA 3TEWA 2INPE 2PTLA 1VLBA 5G5GA 1JRPA 3AE7B 3BZDB 1KFYB 3HVDA 1ZUD2 2WXIA 2LFIA 1C4PA 1MHHE 4DXGA 4C80A 1PGXA 2OHFA 2ZW0A 2IGGA 1V1OA 1LO5D 1FIQA 2WXQA 2PW9A 2QILA 3AEBB 1ACCA 4J3OD 3AEGB 1WGKA 1AYFA 1HZ6A 1XLNA 4LK0M 4OZAA 4YWGG 2IGHA 1ZE3D 2FBWB 4KGSA 4NAMA 5D7GA 3VQIA 1BXTA 3IT4B 4JPSA 1E0ZA 2K9XA 2E6XA 2MJDA 3R8BA 4A9AA 1YQ4B 1TS2A 2WXPA 3R2TA 2WXJA 2R61A 5EE3A 1FNVA 1T6BX 4XDDA 2JYTA 3T3NA 3NS1A 4MM3B 4DXFA 2GB1A 1QT9A 3SFDB 1FRDA 4WWMA 1N61A 1DOXA 2LJIA 4RFBA 1KRHA 4RGMA 2WU2B 3BK2A 2KMMA 2G1EA 1WRIA 5D3IB 1ESFA 1JMLA 3GS2A 3TEYA 1V8CA 2Y5PA 2JYEA 3KWLA 1I4QA 2QSDA 3I9V1 1CK1A 4N59A 4RGTA 4XDCA 2QIEB 3EA6A 4US9A 4MACA 2RPVA 2WXNA 1VZ8A 1TY0A 2PMVA 2QJLA 2WXGA 2ZW1A 3PZ7A 1JROA 1QOAA 4KKIA 3IAS1 1N5WA 2W55A 1NI3A 1MVKA 1IGDA 2Z8LA 3MFGA 2K22A 1ROEA 1EM7A 3NVWA 1F2RI 2BS2B 1V1PB 1ZXIA 2DBYA 1K53A 5BMIA 5I4DA 1HQRD 1I4XA 1FXIA 2WXKA 1SJHD 1WWTA 2W3RA 5G5HA 3GP7A 2OEDA 1R7SA 2JX5A 3ETRA 3L4PA 3NVYA 1IGCA 1SF0A 4KGRA 4NAWB 2W3SA 3AE6B 2KAJA 4NJCA 2MEKA 2PKOA 1UWXA 1ZOYB 3FAHA 1HZ5A 3MP9A 2N0SB 3AE3B 3AE4B 3P4PB 4AS1A 4ZYSA 3IT6B 3ZJUA 1GB4A 1SJED 1WYGA 5H92C 1K51A 2W54A 1ZDXA 1L4DB 1EU3A 1MPEA 1HEZE 3IAM1 3N9YC 2JWUA 1JWMD 1IBXB 2SAKA 4YT0B 2WP9B 1T3QA 2WLBA 1T5XD 1I7HA 3E9SA 1PFDA 4DQOC 1NEKB 3BWUD 1NYQA 3Q8FA 4YTMB 1JWUD 1C9FA 3SFEB 1B1ZA 1SE4A 1EWYC 3GB1A 5EE0A 4C56C 2V0GA 2M19A 3MHZA 2PVOD 1XO3A 1DYQA 1ET9A 4ZHOA 3Q8AA 4N6EB 5BMHA 3BYYB 4IDIA 1J7BA 2E3TA 3MC0B 4RNAA 4FXCA 5T8IA 3W5VB 1SBBB 3KQ4A 2N7JA 4ZRPA 1OQRA 2DYOA 1YMHE 3P42A 2J4XA 2INNE 3I57A 2RDHA 1VDVA 2K0PA 4RF0A 2KDMA 1RFKA 2V3PA 4HKZE 4R3DA 1KH0A 1C78A 3VR9B 3AEEB 3HUIA 1ZPSA 2BS3B 3BVMA 2K5PA 1QLBB 1SB3C 2L52A 3AECB 3RPFC 2ACZB 4A6QA 1PYWD 1N62A 3TUOA 4A8XC 2WDVB 2WXMA 1DOIA 2BB5A 5AUIA 1FFVA 2CJOA 2BS4B 3DWMA 4WH4A 3KLSX 3AV8A 1TYGB 1SE2A 2VZKB 5D3DA 1JWAD 4B0EA 4HROA 1J7AA 1QQRA 4ARIA 4WAFA 4YSXB 1NENB 3HRDD 5GXGB 2KWDA 4WQMA 4ITKA 2J52A 4C7ZA 2IGDA 4UDUC 2BW2A 3VR8B 1HA5A 1TZOA 2JSVX 3ABVB 4GDKB 4JX1C 2IJ0A 1AWDA 1VJKA 4LLGM 4JWSC 3VRBB 2HDEA 1FD6A 3SEBA 4USAA 3AEDB 5FKAC 2CJNA 1ZDVA 2Q5WD 2VZKD 2L32A 1TY2A 1FNWA 1EU4A 1SIJA 1C77A 1I4GA 3DWGC 3AH7A 2BB6A 4RF1A 1Y56A 2AX5A 2KACA 1XEEA 3W9CB 3WCQA 3PO0A 5FK9C 2LMCA 2BYTA 1QF6A 1NVID 1E7PB 2ONQA 2N9KA 4A90A 4OZCA 1I4RA 5HHDG 1DGJA 2V4IB 5C2TB 4RGNA 4OHJA 2LUMA 4N58A 5BMGA 2ICIA 2NMQA 2QMTA 1YN4A 4YSYB 1TS4A 3H8HA 3AE5B 2JZPA 4CQNA 1MHXA 3FILB 3LYYA 4TQ1A 4EE2A 1L5PA 2IDYA 3CWIA 3W1SA 2V3NA 2DLBA 1C76A 2BBCA 3AE1B 3BVZA 2MH7A 3KWVA 2WU5B 1FM0D 1ZP0B 1SEBD 2CU3A 2WXHA 1A70A 2WDRB 1BMLC 2WXRA 1KLGD 4XWWA 1TKGA 1F2RC 3NVZA 1XLPA 4HKQA 4US8A 1K50A 1NYRA 3CIRB 4L1BA 4TSSA 1J7CA 2MJ3A 2W82A 4KGTA 3VRAB 3P4SB 1K52A 1RWSA 1E10A 2L83A 2NTTA 3ZYYX 3PZ8A 2Y3AA 3AMZA 3NZ3A 1V1PA 2AQ1B 4P16A 1UNSA 4M0WA 2IPKD 2XNAC 3TEXA 3NVVA 1YQ3B 3NUHB 4YSZB 1SXTA 2K3UA 1UGJA 2NTSA 1MI0A 4XE0A 1L6UA 4Q2JA 1D5MC 1JWSD 2JQRB 1BUIC 1N5XA 3RFZB 1N60A 3Q8EA 3V05A 4L23A 3Q8CA 5EE1A 1PUTA 1FRRA 3AEFB 1PGBA 5H8YE 3U7ZA 1KF6B 5HFYA 4OZBA 3IXSA 1QILA 3NRZA 2RDGA 2YEPB 4JE3B 4KX6B 1JQ4A 2BT6A 1IBXA 1YN5A 1L6VA 1PGAA 3P4RB 2DWQA 4ZRQA 1ET6A 1GOZA 1L0XB 2QEJC 4A55A 1F0ZA 1QKZA 5MPOA 1KTKA 1XF5L 3W5UB 3AN1A 4O1NA 3U2SC 3U4EG 2B76B 4GDLB 1WSPA 2WXFA 4TMAB 4RCOA 4ZOHC 2WQYB 3Q8BA 2YEPF 1D5ZC 4REZA 3P1MA 4AQ7A 2I2YA 4OVZA 4YTPB 1TS3A 2PIAA 5TSSA 3ZJTA 4H2AA 3ZQ4A 1N63A 2LHEA 1P7EA 1CZPA 5E6JA 2M0AA 1ENFA 2PLPA 3R2IA 1YN3A 1XLQA 1GB1A 2WXLA 2DYMA 1E9MA 1E6EB 4GLSC 3FC4A 1WXQA 4RGOS 1JCKB 3LB8C 2RMMA 3AE8B 3T3OA 3TSSA 1V97A 1CQVA 1F77A 2D5GA 1GPXA 1JWBD 3BIID 1XLOA 1UUPA 1D5XC 2J53A 3SR6A 1QOFA 1FNUA 2Y5CA 4NZLB 3C8YA 1ZXHA 3V3XA 1YJIA 2KN4A 1C4AA 4P6VF 1JW9D 2GRIA 3MJ5A 4IOIE 1OFFA 2H89B 4C7YA 1L0YB 3LXFA 2FE8A 4IKGA 3URYA 1C4CA 4HEA1 1FEHA 3OWEB 1FMAD 4JWUC 1FCCC 3BYTB 3AM9A 2LHDA 1M4VA 3EGRA 2LEKA 4XWTA 2GI9A 3B2FA 2H88B 1D6EC 3U52E 4TQ0A 2EELA 4YXDB 1EWCA 1L4ZB 2TSSA 1XXGA 4WURA 1YNTE 4B0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FRD A;  3AEC B;  3NVV A;  4WWM A;  2ACZ B;  1N61 A;  1YQ3 B;  3RPF C;  1DOX A;  2HTM E;  1N62 A;  1KRH A;  4YSZ B;  2L52 A;  2WDV B;  2WU2 B;  5AUK A;  1DOI A;  5AUI A;  2KMM A;  1CJE A;  1FFV A;  2G1E A;  1WRI A;  2CJO A;  1L6U A;  2BS4 B;  2WS3 B;  3DWM A;  2JQR B;  3AV8 A;  1TYG B;  1V8C A;  1JWA D;  2MJE A;  1N5X A;  3AE9 B;  1L0V B;  3EUB 2;  1N60 A;  1J7A A;  1JAL A;  3KWL A;  4HRO A;  3AB5 A;  4N59 A;  4YSX B;  1NEN B;  2QIE B;  3HRD D;  1PUT A;  1FRR A;  1QOG A;  3AEF B;  4US9 A;  5EE1 A;  5GXG B;  4WQM A;  1DOY A;  4ITK A;  2M56 B;  2EKI A;  5H8Y E;  4C7Z A;  2QJL A;  3VR8 B;  1JRO A;  1KF6 B;  3ABV B;  1FXA A;  1QOA A;  4LTU A;  1N5W A;  2W55 A;  4JX1 C;  1NI3 A;  3NRZ A;  1RYJ A;  1AWD A;  1VJK A;  4KX6 B;  1YJJ A;  4JWS C;  2K22 A;  3VRB B;  1ROE A;  1JQ4 A;  3SFD B;  2BT6 A;  3NVW A;  2BS2 B;  1ZXI A;  1FFU A;  2DBY A;  1L6V A;  4USA A;  3AED B;  3P4R B;  2DWQ A;  1FXI A;  5G5H A;  2CJN A;  1WWT A;  2W3R A;  3AE2 B;  3AEA B;  1F0Z A;  1R7S A;  2JX5 A;  2Q5W D;  3ETR A;  3L4P A;  1UWM A;  3AN1 A;  1TKY A;  3NVY A;  3W5U B;  5C3J B;  1SF0 A;  1TJE A;  4YTN B;  3P4Q B;  5EE9 A;  1SIJ A;  2B76 B;  1OQQ A;  3DWG C;  2W3S A;  3AE6 B;  2KAJ A;  3AH7 A;  2AX5 A;  2PKO A;  3B2G A;  1ZOY B;  3FAH A;  2WQY B;  3PO0 A;  4ZOH C;  3W9C B;  3WCQ A;  4ZHP A;  2N0S B;  1B9R A;  3AE3 B;  1QF6 A;  3AE4 B;  1IUE A;  2PVG C;  3P1M A;  3P4P B;  1NVI D;  4YTP B;  1E7P B;  1PDX A;  2PIA A;  1GAQ B;  1FO4 A;  1DGJ A;  1WYG A;  1QOB A;  5H92 C;  2W54 A;  5C2T B;  5MPO A;  1N63 A;  1CZP A;  1TKE A;  4N58 A;  4HRS A;  4YSY B;  1XLQ A;  1E9M A;  3AE5 B;  1E6E B;  3B9J A;  3FC4 A;  4YT0 B;  1RM6 C;  2WP9 B;  1T3Q A;  1WXQ A;  2WLB A;  2WDQ B;  1L5P A;  3CWI A;  3P63 A;  3LB8 C;  3AE8 B;  1I7H A;  3HVZ A;  1PFD A;  1NEK B;  1VLB A;  1V97 A;  3AE1 B;  1NYQ A;  5G5G A;  4YTM B;  2MH7 A;  1JRP A;  1JWB D;  1GPX A;  2WU5 B;  1FM0 D;  3AE7 B;  3SFE B;  1KFY B;  1ZP0 B;  3BII D;  2CU3 A;  1EWY C;  1ZUD 2;  1XLO A;  1A70 A;  4C80 A;  5EE0 A;  2WDR B;  1QOF A;  2Y5C A;  3SR6 A;  2OHF A;  2M19 A;  2PVO D;  1TKG A;  1XO3 A;  1FIQ A;  1YJI A;  3NVZ A;  4P6V F;  3AEB B;  4ZHO A;  3AEG B;  1JW9 D;  1WGK A;  1AYF A;  1XLP A;  4N6E B;  4IDI A;  1OFF A;  2H89 B;  4C7Y A;  1J7B A;  2E3T A;  1XLN A;  3LXF A;  4US8 A;  3W5V B;  1NYR A;  2FBW B;  4FXC A;  3CIR B;  1J7C A;  2MJ3 A;  2K9X A;  1E0Z A;  1FMA D;  1OQR A;  4JWU C;  2MJD A;  3VRA B;  4A9A A;  1YQ4 B;  3P4S B;  3AM9 A;  1RWS A;  1VDV A;  1E10 A;  2LEK A;  2L83 A;  3ZYY X;  3B2F A;  2H88 B;  5EE3 A;  1RFK A;  4YXD B;  3AMZ A;  3VR9 B;  3AEE B;  3HUI A;  3NS1 A;  2BS3 B;  1QT9 A;  2K5P A;  1QLB B;  1SB3 C; 
#chains in the Genus database with same CATH topology
 3RT3 B;  2HTM E;  5AUK A;  3TEZ A;  2N9X A;  3T9L A;  1YX6 B;  3QK0 A;  4D2K A;  2XN9 C;  4KIK A;  1C79 A;  1GNU A;  4KKJ A;  1QOG A;  2JU6 X;  2EKI A;  3BVG A;  3BY4 B;  1FXA A;  3BK1 A;  3J9C A;  1C3T A;  1RYJ A;  1YJJ A;  2X38 A;  2JZZ A;  1FFU A;  2BKF A;  3SHQ A;  3N1Y C;  1I4H A;  1WMH A;  1D4B A;  1TJE A;  3S2A A;  3P4Q B;  1LFD A;  2SEB D;  1E7U A;  4ZHP A;  1IUE A;  4PK1 A;  4DXA B;  2L0T A;  1Q10 A;  1FO4 A;  4II3 B;  1TKE A;  4PYZ A;  3RZF A;  4HRS A;  1SSN A;  3M3J A;  1AN8 A;  4MDK E;  2JXT A;  3ENE A;  3HVZ A;  4JIO U;  1WE6 A;  4EZJ A;  3AE7 B;  2JF5 A;  2A5U A;  3HVD A;  3Q3J A;  1LM8 B;  2LFI A;  1MHH E;  1WX8 A;  2K6D B;  1FIQ A;  1WXA A;  3AEB B;  1XQQ A;  3AEG B;  3M63 B;  3MJW A;  1HZ6 A;  4LK0 M;  4OZA A;  3SU8 X;  5D7G A;  2K8H A;  1BXT A;  2K9X A;  3JSV B;  5C23 A;  1YQ4 B;  3R2T A;  3UF8 A;  4TUU A;  2FCQ A;  3NS1 A;  4MM3 B;  1P0R A;  1QT9 A;  3DHH C;  1DOX A;  2BWF A;  4RFB A;  3PRZ A;  3ZRF A;  4LCD E;  2KMM A;  5D3I B;  1JML A;  3B1L X;  3KWL A;  2QSD A;  1MG4 A;  2WGS A;  1CK1 A;  3EA6 A;  2K8C A;  2WXN A;  4KIK B;  1TY0 A;  2QJL A;  2L7R A;  3PRM B;  4FJY A;  2W55 A;  3RI7 C;  4OVU A;  1MVK A;  3JW0 X;  1GG3 A;  4LNF A;  4WJQ A;  1EM7 A;  4EFO A;  1F2R I;  2BS2 B;  3I5J C;  1I4X A;  1FXI A;  2OED A;  1R7S A;  4FAD A;  3A9K B;  4ASW C;  1WMH B;  3ZNG C;  1GC6 A;  3UIN B;  1YIW A;  2WWZ A;  3FAH A;  1HZ5 A;  2KKC A;  2YLM A;  3AE3 B;  3AE4 B;  3QQ8 B;  1OGW A;  1SJE D;  5IP4 D;  4FLH A;  4BKS A;  4S17 A;  2IND C;  1WX7 A;  4M01 A;  1IBX B;  4YT0 B;  2WP9 B;  1T3Q A;  3UQB A;  2KYW A;  1NEK B;  3LDZ E;  2Z0D B;  3Q8F A;  1MG8 A;  4YTM B;  5DCN A;  3DPD A;  1JWU D;  1SE4 A;  2L05 A;  3DBL B;  4WWN A;  4C56 C;  2V0G A;  3MHZ A;  1XO3 A;  2KQ7 A;  4DHJ B;  3W1S C;  4N6E B;  2QDF A;  5BMH A;  3BYY B;  2BGF A;  2MW5 A;  1J7B A;  2N1V A;  2GOW A;  2KDE B;  1YMH E;  3P42 A;  1WY8 A;  2INN E;  2RDH A;  3MTN B;  2KDM A;  3ZIM A;  4BBN C;  2V3P A;  4R3D A;  1KH0 A;  3VTV A;  3AEE B;  3HUI A;  4BKG A;  1WX9 A;  1QLB B;  2L52 A;  3RPF C;  2ACZ B;  4ICU A;  4LDT B;  2M4N A;  4CO7 A;  2BWE S;  2WXM A;  4CHK A;  5AUI A;  1WJU A;  4WH4 A;  5D3D A;  4B0E A;  4JQW C;  2LRW A;  4WAF A;  4YSX B;  2BVC A;  3HRD D;  5GXG B;  4P7I A;  4C7Z A;  2IGD A;  4KV2 A;  3DOW A;  3VR8 B;  1S1Q B;  2J7Q B;  2DEN B;  2FCM A;  2IJ0 A;  1AWD A;  2XK5 B;  4B9K A;  1FPY A;  2UYZ B;  1WGR A;  2CS4 A;  2GBN A;  2CJN A;  2XBB C;  4KSK C;  2O6V D;  1S3S G;  1FNW A;  1I4G A;  2Z59 B;  3ZXV A;  2BB6 A;  1XEE A;  4HCP B;  1YNT E;  4BZA A;  1E7P B;  2JVC A;  3GE3 C;  3AI5 A;  4HPP A;  4RGN A;  4ICV A;  3A9J A;  4MH0 E;  2QMT A;  1TIF A;  1TS4 A;  2C7H A;  3RZW C;  2BYV E;  1WJ6 A;  3FIL B;  1WH3 A;  1Z2M A;  2V3N A;  2JT4 B;  2KX0 A;  2RDB C;  3KWV A;  4A3P A;  3ZNZ B;  2CU3 A;  4IWP A;  1BML C;  4JLC A;  1KLG D;  2DNF A;  1TKG A;  5J18 A;  3NVZ A;  4M02 A;  1K8R B;  4C00 A;  2KWU B;  1XLP A;  4WWP A;  2DHZ A;  2UWQ A;  4BOS C;  3ZO5 B;  1K50 A;  1V5O A;  2G4D B;  4MJS B;  1NYR A;  4WJN A;  3CIR B;  2KO3 A;  3EFU A;  1J7C A;  2CHZ A;  2FCN A;  2WX0 A;  4KGT A;  2D3C A;  1Z5S B;  3UQA A;  2BPS A;  3P4S B;  1K52 A;  5E6N A;  2L83 A;  4HK2 A;  2Y3A A;  2AQ1 B;  5LLI A;  4P16 A;  1UNS A;  3N1Z C;  1WM2 A;  2XNA C;  3SDL C;  3TEX A;  4ANX A;  3NUH B;  4JGH B;  4NQK E;  3L17 A;  1MI0 A;  3QWZ B;  2DYB A;  4Q2J A;  5E6P A;  1BUI C;  3RFZ B;  3V05 A;  3DBS A;  1J8C A;  1FRR A;  2K8B A;  5EDS A;  2MA9 B;  1KF6 B;  4OZB A;  4DDI D;  3TCA A;  4JE3 B;  1GJZ A;  1F1H A;  1JQ4 A;  5D6J B;  1YN5 A;  1L6V A;  4GMV A;  1GOZ A;  1L0X B;  2QEJ C;  3PLU A;  2UU7 A;  1XF5 L;  1WFY A;  4II2 B;  3U2S C;  3ML8 A;  2WXF A;  3IG3 A;  4TMA B;  4NJ7 A;  3K9P B;  1GC7 A;  4PS3 A;  4P1C C;  2J0K A;  3Q8B A;  3WAM A;  4REZ A;  4AQ7 A;  3DHG C;  4FUL A;  2FCS A;  3B08 A;  4H2A A;  2FID A;  2W9N A;  2ZZP B;  2L3Z A;  3Q3M C;  4DWF A;  3ZNI D;  5E6J A;  1EO6 A;  1R4M B;  2WXL A;  1E9M A;  5DPW A;  4GLS C;  3FC4 A;  4MGI E;  1JCK B;  4DHZ B;  3LB8 C;  3Q3N C;  4GN1 A;  5DPR A;  3PT2 B;  1F77 A;  1GPX A;  4W9K A;  1XLO A;  2J53 A;  1FNU A;  4NPN A;  5JH5 C;  3C8Y A;  3IBE A;  1T0Y A;  2GRI A;  3HM6 X;  1WXM A;  4C7Y A;  1L0Y B;  4PYU A;  2FE8 A;  3APF A;  3URY A;  1C4C A;  5IOI A;  3VDZ A;  3M62 B;  2LWP A;  3NOB A;  1H4R A;  2LHD A;  4PS8 A;  2H88 B;  1EUV B;  3VTU A;  2QC8 A;  1XXG A;  1TT5 B;  1WJN A;  2IY0 B;  4RH6 A;  4WIP A;  2D10 A;  1AW7 A;  3UI3 A;  1Q0W B;  1WXS A;  4YL8 A;  1CJE A;  1VRA B;  2MBO A;  2FAZ A;  1HXY D;  1VZ6 A;  2BKR B;  2KOX A;  2MJE A;  3H1U A;  2AYO B;  1FCL A;  2KD0 A;  1C1Y B;  3AB5 A;  3R3M A;  4PS7 A;  1P7F A;  1QZE A;  1ZGU B;  1UEL A;  3N1X C;  4HJG E;  4BOZ B;  1TS5 A;  1SE3 A;  4AP4 C;  3JVZ X;  2AQ2 B;  5DPT A;  3AEA B;  5BYQ A;  3R7Q A;  2ON8 A;  2WHI A;  1V6E A;  1OQQ A;  2LJ5 A;  1B9R A;  4MT5 A;  3DVN U;  1GAQ B;  2WXO A;  1QOB A;  5HG2 A;  2R2Q A;  5JHA A;  4PT5 A;  2J42 A;  5FR3 A;  3Q69 A;  2AL3 A;  4IC7 B;  2X8X X;  1RM6 C;  2BTE A;  2WDQ B;  3EHV A;  3TEW A;  2PTL A;  4RMA A;  1VLB A;  5G5G A;  2KJH B;  2NR2 A;  1JRP A;  3BZD B;  4ZRI A;  2WXI A;  4QAY A;  1PGX A;  3T8M A;  4GB9 A;  2OHF A;  2ZW0 A;  2WXQ A;  2KWC A;  2PW9 A;  2QIL A;  4G11 A;  2MBQ A;  1WGK A;  1AYF A;  2AEH A;  4ANU A;  2C7M B;  3V61 A;  5KHQ A;  3CMM B;  2IGH A;  4NAM A;  3QAQ A;  2LAS A;  3IT4 B;  4JPS A;  1E0Z A;  2L0F A;  2LD9 A;  2E6X A;  2MJD A;  4CYE A;  3R8B A;  1TTN A;  2RPQ A;  2WXP A;  4FHK A;  2KWV B;  2L76 A;  1T6B X;  2PJH A;  4DBG A;  2KMC A;  2PPH A;  3RCZ A;  2GB1 A;  2MCN B;  3PHX B;  1SIF A;  2WU2 B;  2YVC A;  2WX1 A;  2ASQ A;  4GDL A;  2G1E A;  2C5L C;  2KHW B;  3GS2 A;  1V8C A;  3C19 A;  4US9 A;  2RPV A;  3ALB A;  4GDK A;  5J17 A;  1VZ8 A;  1JRO A;  3PRE A;  1QOA A;  1N5W A;  2MX2 A;  1IGD A;  2V9H A;  2Z8L A;  3PZD A;  3MFG A;  1ROE A;  1V1P B;  1ZXI A;  1K53 A;  4DHZ E;  1HQR D;  1SJH D;  3NVY A;  1SF0 A;  3TMP B;  4KGR A;  3PLV A;  3C0R B;  2PKO A;  1UWX A;  3MP9 A;  1M94 A;  3KVF B;  3P4P B;  1F52 A;  4ZYS A;  4M00 A;  5H92 C;  2W54 A;  2D11 A;  3L08 A;  3NY5 A;  2WLB A;  2JUO A;  1T5X D;  3A4S C;  3VVW B;  2HE7 A;  1PFD A;  1KJT A;  3BWU D;  1NI2 A;  3ZRC A;  2KZR A;  1B1Z A;  1Y8R C;  3P2B A;  2MLB A;  4K7W A;  2KNB A;  2KXJ A;  1T0Q C;  1YX5 B;  2E3T A;  4HVB A;  4FXC A;  3AUL A;  1IPG A;  2MHJ A;  1JRU A;  1OQR A;  2C60 A;  4FA6 A;  2J4X A;  2K0P A;  2REX A;  3X23 A;  3NG0 A;  2GBM A;  2HJ8 A;  3W1Y A;  2BS3 B;  4MGK E;  3AEC B;  3VHT C;  3HHM A;  4HCN B;  1T0S C;  1DOI A;  1FFV A;  2CJO A;  4IM2 A;  2BS4 B;  3KLS X;  1TYG B;  4ZYN A;  2N4F A;  4ARI A;  1NEN B;  4BAX A;  4WQM A;  4ITK A;  2J52 A;  3V6E B;  2BW2 A;  2VH2 A;  2D07 B;  3I3T B;  4GDK B;  1VJK A;  1KLV A;  1GUA B;  1FD6 A;  1I35 A;  3SEB A;  3AED B;  2RSU A;  4BFR A;  1ZDV A;  2Q5W D;  2VZK D;  5IA7 A;  2L32 A;  4K7U A;  1N6Z A;  3RYT A;  3O65 B;  3DWG C;  2MQJ A;  1WF9 A;  3AH7 A;  2IZV B;  1WGG A;  3W9C B;  1E8Z A;  2GBR A;  2LMC A;  2BYT A;  1QF6 A;  4G3X B;  1NVI D;  3ZLZ A;  3SD5 A;  1A5R A;  2ONQ A;  4A90 A;  2M1M A;  1I4R A;  2V4I B;  2N7E A;  1V80 A;  2ICI A;  2NMQ A;  2V1Y A;  4YSY B;  1XT9 B;  3AE5 B;  4TQ1 A;  3AU4 A;  1ZKH A;  2LGS A;  1WM3 A;  4AUQ C;  3GZN I;  2M17 A;  5CX3 A;  1C76 A;  2ZCB A;  1WIA A;  1OQY A;  2WU5 B;  1ZP0 B;  2WXH A;  3D32 A;  3IHP C;  4TKN A;  2N9P C;  3U30 A;  4US8 A;  4L1B A;  4FJV B;  3PVL A;  1R4N I;  3QJZ A;  1E10 A;  3PZ8 A;  2BQQ A;  2O2V A;  2QCZ A;  2IPK D;  3NVV A;  4IUM B;  5CTR C;  1V9J A;  4YSZ B;  3L54 A;  4W9L A;  4XE0 A;  1L6U A;  2N1W A;  2JQR B;  1JWS D;  2LXA A;  3N20 C;  2LXC A;  3PSE B;  3Q8E A;  1J0G A;  2HD5 B;  2NBU A;  4AWJ A;  1UBI A;  1PUT A;  2LZ6 A;  3NRZ A;  2GLS A;  2YEP B;  4KVG B;  4FBJ B;  2BT6 A;  1PGA A;  3FKY A;  3VUX A;  2AWT A;  3VH4 B;  4A55 A;  1F0Z A;  3AN1 A;  4O1N A;  1G6J A;  4W9H A;  3U4E G;  2B76 B;  2LI5 A;  3V62 A;  3PTF C;  4RCO A;  5LXI B;  1D5Z C;  2G45 B;  2I2Y A;  4LNK A;  2PIA A;  3ZJT A;  3ZQ4 A;  2M0X A;  1N63 A;  1L2N A;  1RRB A;  1GB1 A;  1XLQ A;  2JZ3 B;  3UGB B;  2DYM A;  1WXQ A;  4AJY B;  2V3S A;  4TV3 A;  2RMM A;  3T3O A;  3Q3F A;  1V97 A;  1CQV A;  1JWB D;  4LNN A;  2N7D A;  4ZRJ A;  1UUP A;  1QOF A;  4NZL B;  3KUZ A;  3V3X A;  2CKH B;  1C4A A;  2JWZ A;  4WWO A;  2Z0E B;  3WA0 A;  4IM0 A;  3DHI C;  3LXF A;  4RM9 A;  4IKG A;  3KUC B;  4HEA 1;  1WR6 E;  2NPT A;  1FCC C;  3BYT B;  3EGR A;  2GI9 A;  1EWC A;  4WUR A;  4B95 A;  3TBL D;  4B0M A;  2FUG 1;  4BBN F;  3ZJV A;  2KLG A;  2KC1 A;  2KVR A;  3DBR I;  3RUL A;  1AAR A;  2WNM A;  2I38 A;  3L10 B;  2WS3 B;  4AJW A;  1Q1O A;  2DZI A;  1E8X A;  3O13 A;  2M56 B;  1YJ1 A;  4EEW A;  2LGI A;  2G9H D;  2BF8 B;  1WGH A;  3ZGZ A;  3Q6B A;  3DBH I;  3QX1 A;  2ZNV C;  1VZ7 A;  3ZUN A;  1TKY A;  3E56 A;  1XCT L;  4NNJ B;  5KHO A;  3MC8 A;  4W9D A;  4JL9 A;  1NBF C;  3B2G A;  2KQS A;  4ANW A;  1PDX A;  2NVU I;  2ZPN A;  3OJ3 A;  4ANV A;  4ARC A;  1STE A;  3I63 C;  2GBK A;  4RM8 A;  1ZW7 A;  1XCQ L;  3NS8 A;  2N9L A;  3RNG C;  3RNB C;  4EKU A;  2KTR A;  5BYR A;  1H8C A;  2PE6 B;  2KK8 A;  2ZPY A;  3P63 A;  4MH8 A;  2IO3 B;  4I6L B;  2INP E;  2LVP A;  2DZK A;  1E7V A;  1ZUD 2;  1C4P A;  4DXG A;  4C80 A;  3KYD D;  1KOT A;  2IGG A;  1VD2 A;  5AEK B;  1LXD A;  1ACC A;  3MC9 A;  3RMK C;  2D2Q A;  3VTW A;  4HJK A;  4KGS A;  3A9J B;  3RNE C;  3VFK A;  3PRP B;  3VQI A;  2INC C;  3DVG X;  3GE8 C;  2VRR B;  2WXJ A;  3N30 A;  2R61 A;  5EE3 A;  1FNV A;  4XDD A;  2JYT A;  4DXF A;  3SFD B;  1FRD A;  4WWM A;  2LJI A;  2R2O A;  1SGH A;  1KRH A;  5AZF A;  2BYE A;  2O6V A;  1WRI A;  1ESF A;  3ZW3 A;  3TEY A;  2JYE A;  2ZEQ A;  1I4Q A;  3I9V 1;  4WJP A;  4N59 A;  4RGT A;  4XDC A;  4IG7 B;  4MAC A;  3A4R A;  3PZ7 A;  2DAF A;  1D3Z A;  1HTO A;  1ISN A;  2LUE A;  5BMI A;  4C4V A;  3DCG A;  2WXK A;  5G5H A;  2W3R A;  1WWT A;  3GP7 A;  3ETR A;  3H9D A;  1IGC A;  2CR5 A;  2W3S A;  2KAJ A;  2C9W B;  2MEK A;  4NJC A;  4BVU C;  1ZOY B;  2J0J A;  2N0S B;  2IO0 B;  4AS1 A;  3ZJU A;  2DAJ A;  1WXV A;  1WYG A;  2JRH A;  1K51 A;  4XYC A;  1ZDX A;  5L95 C;  1I42 A;  1EU3 A;  1RAX A;  1MPE A;  3OJ4 B;  2JWU A;  1JWM D;  2SAK A;  1KM7 A;  1TZ1 A;  2V4L A;  3E9S A;  1LQB A;  4DQO C;  1NYQ A;  4KZ0 A;  1C9F A;  3SFE B;  2IBI B;  1UBQ A;  3CF6 E;  5EE0 A;  3U7D A;  2M19 A;  1L7Y A;  4GGQ A;  1DYQ A;  1ET9 A;  4ZHO A;  3HIZ A;  4S0R A;  3Q8A A;  1CMX B;  2LGD A;  4A20 A;  3MC0 B;  4RNA A;  1E8W A;  3EEC A;  2KFJ A;  4G50 A;  2DX5 B;  2LGY A;  3I57 A;  3EFC A;  4RF0 A;  5AZG A;  3WIM A;  4DHJ D;  1ZPS A;  4I6N B;  1WZ3 A;  2K5P A;  4A6Q A;  1PYW D;  5G55 A;  4A3O A;  3AV8 A;  1SE2 A;  2O6V B;  1VCB A;  1J7A A;  1WR1 A;  4W9C A;  2KWD A;  4UDU C;  1HA5 A;  1TZO A;  2JSV X;  3ABV B;  4F1S A;  3NZU A;  4JX1 C;  2CU1 A;  3DQV A;  1EF1 A;  4LDT D;  4LLG M;  4JWS C;  3VRB B;  2HDE A;  2KFK A;  4G0N B;  4C4V B;  1TY2 A;  1EU4 A;  3DBL I;  2K39 A;  1C77 A;  1MJD A;  1Y56 A;  3WCQ A;  3VH3 B;  2MBH A;  3N32 A;  1P1A A;  3R66 C;  4MSM B;  1P9D U;  1DGJ A;  3TJP A;  4OHJ A;  2LUM A;  4LJP B;  3H8H A;  4NY0 A;  4CQN A;  1MHX A;  3M95 A;  3CSF A;  1TBE A;  3CST A;  4EE2 A;  3H6N A;  1L5P A;  2IDY A;  3DDC B;  2DLB A;  2BBC A;  1UGM A;  3AE1 B;  3BVZ A;  3PGE A;  4M8M A;  1SEB D;  3KYC D;  2WDR B;  1F2R C;  4MGY E;  4W9I A;  3LJ3 A;  3EC8 A;  4BKS D;  4HKQ A;  3X0W A;  4K3B A;  1OTR B;  2MJ3 A;  2W82 A;  2VH1 A;  1IP9 A;  1P98 A;  1RWS A;  5CHV C;  4GOC A;  4XX5 A;  2QHO A;  2NBV B;  3AMZ A;  3NZ3 A;  1V81 A;  4M0W A;  3MHS D;  1SXT A;  2K3U A;  1YD8 U;  3A9K A;  1UGJ A;  1HE8 A;  2NTS A;  3B0A A;  3WAP A;  3WAN A;  1D5M C;  3ZTC A;  2HTH A;  3U7Z A;  3PHW B;  5HFY A;  2RDG A;  2RGF A;  3QC8 B;  4KX6 B;  1HTQ A;  1IBX A;  3BIN A;  3P4R B;  4ZRQ A;  1ET6 A;  5MPO A;  1KTK A;  4W9J A;  5CHW A;  2KDB A;  2KFK B;  3QHT A;  4X57 B;  4GDL B;  4EOY A;  1WSP A;  5D2M B;  2FIF A;  1TGZ B;  4F7Z A;  2ZNV B;  4OVZ A;  4YTP B;  3TL5 A;  4N9F 4;  1P7E A;  2M0A A;  1ENF A;  4F8C B;  1YN3 A;  1SE9 A;  3ZDM C;  1E6E B;  4RGO S;  1UD7 A;  3AE8 B;  4LNI A;  2ZVN A;  2J0M A;  2IO1 B;  2D5G A;  2M8S A;  1E90 A;  4K7S A;  2KAN A;  3H7S A;  1WE7 A;  2Y5C A;  1OEY A;  2OJW A;  1ZXH A;  2D3G A;  4P6V F;  2RR9 A;  3MJ5 A;  4IOI E;  2H89 B;  2WYQ A;  2KJ6 A;  1V5T A;  2LVO A;  1WJ4 A;  3OWE B;  3KUD B;  4HXD A;  4JWU C;  3ZDT A;  2DZJ A;  2K6Q A;  2ZVO A;  3AM9 A;  1V86 A;  1M4V A;  4KSL C;  4XWT A;  3R7R A;  3HK0 A;  1D6E C;  3U52 E;  2XK5 A;  2JY6 A;  4M8N A;  4YXD B;  1EF5 A;  5DPS A;  2BYF A;  3PS6 A;  3ECI A;  2D3A A;  2HJ1 A;  4M0W B;  2A4Z A;  3QA8 A;  1I4P A;  3ONS A;  2KQ4 X;  2LRU A;  2LVQ A;  3EUB 2;  3AE9 B;  1L0V B;  1JAL A;  5JXV A;  3N3K B;  1DOY A;  4HDQ A;  3H7P A;  1R4M I;  2G4S A;  1KLU D;  3PV1 A;  3QIJ A;  4GXB A;  4LTU A;  5LNK 1;  2AQ3 B;  3W2D A;  2L1A A;  4EZL A;  3FIL A;  4L2Y A;  3RNC C;  1X1M A;  3V6C B;  3AE2 B;  2MSE D;  1UWM A;  4NAW A;  4URK A;  5C3J B;  1WGY A;  4YTN B;  1V2Y A;  1VR9 A;  5EE9 A;  3APC A;  1WI0 A;  4K3C A;  5LXH A;  2PVG C;  1OEY J;  4FJZ A;  3VUW A;  1UF0 A;  4OW0 A;  4MJS A;  1T0R C;  4HDO A;  5BYS A;  3B9J A;  3OG5 A;  4K1R B;  3AU5 A;  5HI1 A;  2Y5B B;  5TR5 A;  4HLE A;  4EUT A;  2MP2 A;  3QAR A;  1UH6 A;  4W9G A;  4BKT A;  4FHJ A;  1E5W A;  1KFY B;  2IYD B;  1WRD B;  2GBJ A;  3RD2 A;  1U4A A;  1FXT B;  4IM3 A;  1V1O A;  1LO5 D;  4J3O D;  2PEA A;  2L00 B;  4P1B C;  1XLN A;  3NHE B;  4YWG G;  3RN9 C;  1ZE3 D;  2FBW B;  4NQL B;  1UZX B;  4A9A A;  1TS2 A;  2B3A A;  4OVV A;  2KDI A;  2IY1 B;  3IFW B;  4DDG D;  3T3N A;  1N61 A;  4RGM A;  2OJR A;  3JYU A;  3BK2 A;  2AL6 A;  3V60 A;  2Y5P A;  3ZNH B;  4ACF A;  2QIE B;  5IN7 A;  1V49 A;  2KTF A;  2PMV A;  2WXG A;  2ZW1 A;  4MEL A;  4IWO A;  3H7P B;  2OOB B;  4KKI A;  3IAS 1;  1RLF A;  4LNO A;  1NI3 A;  4E74 A;  3PPA A;  2K22 A;  3NVW A;  2O2V B;  2DBY A;  2XEW A;  3AXC A;  5I4D A;  2JX5 A;  3L4P A;  2ZCC A;  2GMI C;  4NAW B;  5JZE B;  3AE6 B;  4W9F A;  3APD A;  3IT6 B;  1GB4 A;  4XGA B;  4I6P A;  1WYW B;  1L4D B;  1IYF A;  1HEZ E;  3IAM 1;  3N9Y C;  3UIP B;  3ZVV A;  3Q14 C;  4GU2 A;  4XC2 A;  1I7H A;  2EMT A;  3NZS A;  3KW5 B;  5IAA C;  3Q2A C;  2MP2 B;  5D94 A;  1EWY C;  3VAW A;  3GB1 A;  5FR6 A;  3RNF C;  2I1J A;  2IO2 B;  2PVO D;  2L8J A;  3QCA A;  4IDI A;  5L83 A;  5T8I A;  3W5V B;  1SBB B;  3HM3 A;  2ZJD A;  2RD0 A;  3KQ4 A;  3ML9 A;  2N7J A;  4HWI B;  4ZRP A;  2DYO A;  5E6O A;  2KX3 A;  1VDV A;  2N9E B;  4ZDV A;  1RFK A;  3A1Q A;  4HKZ E;  1C78 A;  3VR9 B;  3U8Z A;  2EMS A;  3GZN B;  3BVM A;  1SB3 C;  1N62 A;  4XZ4 A;  3TUO A;  4GIV A;  2WDV B;  4KDL B;  1NDD A;  4A8X C;  2BB5 A;  2KC2 A;  3DWM A;  1J19 A;  3NJT A;  2VZK B;  1JWA D;  4HRO A;  3GOE A;  1QQR A;  4KDI C;  2NPT B;  2CHW A;  1MFW A;  5J2R A;  1R4N B;  2LGX A;  4USA A;  1XD3 B;  2KJR A;  5FKA C;  3TIX A;  2MWS B;  2JPH A;  4IWQ A;  1SIJ A;  4RF1 A;  2AX5 A;  2KAC A;  3PO0 A;  5FK9 C;  4MSQ B;  2N9K A;  4OZC A;  3L13 A;  4MGZ E;  4NJ6 A;  5HHD G;  4J6I A;  2C7N B;  1WGD A;  2MBB B;  5C2T B;  4N58 A;  5BMG A;  4E71 A;  1YN4 A;  3VUY A;  5AZH A;  4MEM A;  2NBW B;  2KLC A;  3A33 B;  2JZP A;  2PE9 A;  3LYY A;  3L0W B;  3DVG Y;  5JHB A;  3CWI A;  3KH0 A;  3W1S A;  3RNA C;  2MH7 A;  1FM0 D;  2K25 A;  1A70 A;  2WXR A;  4XWW A;  4KZC A;  4AOF A;  5C1Z A;  3WAO A;  4EZK A;  1RFA A;  1BT0 A;  4TSS A;  1LGR A;  3VRA B;  2KTR B;  2NTT A;  3ZYY X;  2KVZ A;  3WAL A;  4HPM B;  1YOV B;  3VXW A;  3ZKJ C;  5BO4 B;  1V1P A;  3IVF A;  3A1Q B;  5GMV A;  4WJO A;  1YQ3 B;  1WZ0 A;  2KT7 A;  4WQO B;  2CHX A;  1N5X A;  2K1F A;  1N60 A;  4L23 A;  3Q8C A;  5G2N A;  5EE1 A;  3AEF B;  3UIO B;  1PGB A;  5H8Y E;  1P3Q U;  1PQS A;  3IXS A;  1QIL A;  2JRI B;  2WDT B;  2KMA A;  5IKC M;  3K9O B;  2FUH B;  3Q3O C;  2DWQ A;  2D3B A;  5IO9 A;  1QKZ A;  3W5U B;  1F9J A;  2G3Q B;  4GSW A;  5CHF A;  3DBR B;  4ZRK A;  4ZOH C;  2WQY B;  2MRP A;  2YEP F;  3P1M A;  3ZTD A;  4IW0 A;  2KN5 A;  1TS3 A;  4FN2 A;  5TSS A;  3ZXR A;  2LHE A;  4E3C A;  1CZP A;  1YQB A;  4W9E A;  2PLP A;  3R2I A;  2NS5 A;  4B6W A;  3RUI B;  2FNJ B;  2MBE A;  3OLM D;  1Q5W B;  3TSS A;  3DVN V;  2DZM A;  3DBH B;  4WAA A;  3BII D;  1D5X C;  2EKE C;  5HKH A;  3L16 A;  2NCN A;  3SR6 A;  4LJO B;  3OAW A;  1YJI A;  2KN4 A;  1E8Y A;  1JW9 D;  1OFF A;  4K81 A;  3JSV A;  4DK5 A;  1FEH A;  1FMA D;  2KDF B;  2I1K A;  2LEK A;  3B2F A;  4TQ0 A;  4MM3 A;  2EEL A;  1L4Z B;  2JXX A;  2TSS A;  4HPL B; 
#chains in the Genus database with same CATH homology
 2FUG 1;  3ZJV A;  2HTM E;  4RH6 A;  4WIP A;  1AW7 A;  3UI3 A;  5AUK A;  3TEZ A;  1CJE A;  1VRA B;  1I4P A;  2WNM A;  2I38 A;  1HXY D;  2WS3 B;  2KQ4 X;  4D2K A;  1VZ6 A;  2MJE A;  3EUB 2;  3AE9 B;  1L0V B;  1FCL A;  1JAL A;  2XN9 C;  3AB5 A;  1C79 A;  5JXV A;  4KKJ A;  1DOY A;  1QOG A;  3O13 A;  2JU6 X;  2EKI A;  2M56 B;  3BVG A;  1KLU D;  1P7F A;  1FXA A;  3BK1 A;  3J9C A;  4LTU A;  4HJG E;  2LGI A;  5LNK 1;  1RYJ A;  2G9H D;  2AQ3 B;  3W2D A;  1TS5 A;  1SE3 A;  1YJJ A;  2L1A A;  2X38 A;  3FIL A;  2AQ2 B;  1FFU A;  4L2Y A;  3ZGZ A;  1VZ7 A;  3AE2 B;  1I4H A;  3AEA B;  5BYQ A;  1UWM A;  1TKY A;  3E56 A;  1XCT L;  5C3J B;  2ON8 A;  1TJE A;  4YTN B;  3P4Q B;  1D4B A;  1VR9 A;  5EE9 A;  1OQQ A;  2SEB D;  3B2G A;  1B9R A;  4ZHP A;  4MT5 A;  1IUE A;  2PVG C;  1PDX A;  1Q10 A;  1GAQ B;  4ARC A;  1STE A;  1FO4 A;  2WXO A;  1QOB A;  4OW0 A;  5HG2 A;  1TKE A;  4HRS A;  5BYS A;  4PT5 A;  1SSN A;  2J42 A;  1XCQ L;  1AN8 A;  2N9L A;  3Q69 A;  5FR3 A;  3B9J A;  1RM6 C;  5HI1 A;  5BYR A;  2BTE A;  2WDQ B;  2JXT A;  3P63 A;  4MH8 A;  3HVZ A;  3TEW A;  2INP E;  2PTL A;  1VLB A;  5G5G A;  1JRP A;  3AE7 B;  3BZD B;  1KFY B;  3HVD A;  1ZUD 2;  2WXI A;  2LFI A;  1C4P A;  1MHH E;  4DXG A;  4C80 A;  1PGX A;  2OHF A;  2ZW0 A;  2IGG A;  1V1O A;  1LO5 D;  1FIQ A;  2WXQ A;  2PW9 A;  2QIL A;  3AEB B;  1ACC A;  4J3O D;  3AEG B;  1WGK A;  1AYF A;  1HZ6 A;  1XLN A;  4LK0 M;  4OZA A;  4YWG G;  2IGH A;  1ZE3 D;  2FBW B;  4KGS A;  4NAM A;  5D7G A;  3VQI A;  1BXT A;  3IT4 B;  4JPS A;  1E0Z A;  2K9X A;  2E6X A;  2MJD A;  3R8B A;  4A9A A;  1YQ4 B;  1TS2 A;  2WXP A;  3R2T A;  2WXJ A;  2R61 A;  5EE3 A;  1FNV A;  1T6B X;  4XDD A;  2JYT A;  3T3N A;  3NS1 A;  4MM3 B;  4DXF A;  2GB1 A;  1QT9 A;  3SFD B;  1FRD A;  4WWM A;  1N61 A;  1DOX A;  2LJI A;  4RFB A;  1KRH A;  4RGM A;  2WU2 B;  3BK2 A;  2KMM A;  2G1E A;  1WRI A;  5D3I B;  1ESF A;  1JML A;  3GS2 A;  3TEY A;  1V8C A;  2Y5P A;  2JYE A;  3KWL A;  1I4Q A;  2QSD A;  3I9V 1;  1CK1 A;  4N59 A;  4RGT A;  4XDC A;  2QIE B;  3EA6 A;  4US9 A;  4MAC A;  2RPV A;  2WXN A;  1VZ8 A;  1TY0 A;  2PMV A;  2QJL A;  2WXG A;  2ZW1 A;  3PZ7 A;  1JRO A;  1QOA A;  4KKI A;  3IAS 1;  1N5W A;  2W55 A;  1NI3 A;  1MVK A;  1IGD A;  2Z8L A;  3MFG A;  2K22 A;  1ROE A;  1EM7 A;  3NVW A;  1F2R I;  2BS2 B;  1V1P B;  1ZXI A;  2DBY A;  1K53 A;  5BMI A;  5I4D A;  1HQR D;  1I4X A;  1FXI A;  2WXK A;  1SJH D;  1WWT A;  2W3R A;  5G5H A;  3GP7 A;  2OED A;  1R7S A;  2JX5 A;  3ETR A;  3L4P A;  3NVY A;  1IGC A;  1SF0 A;  4KGR A;  4NAW B;  2W3S A;  3AE6 B;  2KAJ A;  4NJC A;  2MEK A;  2PKO A;  1UWX A;  1ZOY B;  3FAH A;  1HZ5 A;  3MP9 A;  2N0S B;  3AE3 B;  3AE4 B;  3P4P B;  4AS1 A;  4ZYS A;  3IT6 B;  3ZJU A;  1GB4 A;  1SJE D;  1WYG A;  5H92 C;  1K51 A;  2W54 A;  1ZDX A;  1L4D B;  1EU3 A;  1MPE A;  1HEZ E;  3IAM 1;  3N9Y C;  2JWU A;  1JWM D;  1IBX B;  2SAK A;  4YT0 B;  2WP9 B;  1T3Q A;  2WLB A;  1T5X D;  1I7H A;  3E9S A;  1PFD A;  4DQO C;  1NEK B;  3BWU D;  1NYQ A;  3Q8F A;  4YTM B;  1JWU D;  1C9F A;  3SFE B;  1B1Z A;  1SE4 A;  1EWY C;  3GB1 A;  5EE0 A;  4C56 C;  2V0G A;  2M19 A;  3MHZ A;  2PVO D;  1XO3 A;  1DYQ A;  1ET9 A;  4ZHO A;  3Q8A A;  4N6E B;  5BMH A;  3BYY B;  4IDI A;  1J7B A;  2E3T A;  3MC0 B;  4RNA A;  4FXC A;  5T8I A;  3W5V B;  1SBB B;  3KQ4 A;  2N7J A;  4ZRP A;  1OQR A;  2DYO A;  1YMH E;  3P42 A;  2J4X A;  2INN E;  3I57 A;  2RDH A;  1VDV A;  2K0P A;  4RF0 A;  2KDM A;  1RFK A;  2V3P A;  4HKZ E;  4R3D A;  1KH0 A;  1C78 A;  3VR9 B;  3AEE B;  3HUI A;  1ZPS A;  2BS3 B;  3BVM A;  2K5P A;  1QLB B;  1SB3 C;  2L52 A;  3AEC B;  3RPF C;  2ACZ B;  4A6Q A;  1PYW D;  1N62 A;  3TUO A;  4A8X C;  2WDV B;  2WXM A;  1DOI A;  2BB5 A;  5AUI A;  1FFV A;  2CJO A;  2BS4 B;  3DWM A;  4WH4 A;  3KLS X;  3AV8 A;  1TYG B;  1SE2 A;  2VZK B;  5D3D A;  1JWA D;  4B0E A;  4HRO A;  1J7A A;  1QQR A;  4ARI A;  4WAF A;  4YSX B;  1NEN B;  3HRD D;  5GXG B;  2KWD A;  4WQM A;  4ITK A;  2J52 A;  4C7Z A;  2IGD A;  4UDU C;  2BW2 A;  3VR8 B;  1HA5 A;  1TZO A;  2JSV X;  3ABV B;  4GDK B;  4JX1 C;  2IJ0 A;  1AWD A;  1VJK A;  4LLG M;  4JWS C;  3VRB B;  2HDE A;  1FD6 A;  3SEB A;  4USA A;  3AED B;  5FKA C;  2CJN A;  1ZDV A;  2Q5W D;  2VZK D;  2L32 A;  1TY2 A;  1FNW A;  1EU4 A;  1SIJ A;  1C77 A;  1I4G A;  3DWG C;  3AH7 A;  2BB6 A;  4RF1 A;  1Y56 A;  2AX5 A;  2KAC A;  1XEE A;  3W9C B;  3WCQ A;  3PO0 A;  5FK9 C;  2LMC A;  2BYT A;  1QF6 A;  1NVI D;  1E7P B;  2ONQ A;  2N9K A;  4A90 A;  4OZC A;  1I4R A;  5HHD G;  1DGJ A;  2V4I B;  5C2T B;  4RGN A;  4OHJ A;  2LUM A;  4N58 A;  5BMG A;  2ICI A;  2NMQ A;  2QMT A;  1YN4 A;  4YSY B;  1TS4 A;  3H8H A;  3AE5 B;  2JZP A;  4CQN A;  1MHX A;  3FIL B;  3LYY A;  4TQ1 A;  4EE2 A;  1L5P A;  2IDY A;  3CWI A;  3W1S A;  2V3N A;  2DLB A;  1C76 A;  2BBC A;  3AE1 B;  3BVZ A;  2MH7 A;  3KWV A;  2WU5 B;  1FM0 D;  1ZP0 B;  1SEB D;  2CU3 A;  2WXH A;  1A70 A;  2WDR B;  1BML C;  2WXR A;  1KLG D;  4XWW A;  1TKG A;  1F2R C;  3NVZ A;  1XLP A;  4HKQ A;  4US8 A;  1K50 A;  1NYR A;  3CIR B;  4L1B A;  4TSS A;  1J7C A;  2MJ3 A;  2W82 A;  4KGT A;  3VRA B;  3P4S B;  1K52 A;  1RWS A;  1E10 A;  2L83 A;  2NTT A;  3ZYY X;  3PZ8 A;  2Y3A A;  3AMZ A;  3NZ3 A;  1V1P A;  2AQ1 B;  4P16 A;  1UNS A;  4M0W A;  2IPK D;  2XNA C;  3TEX A;  3NVV A;  1YQ3 B;  3NUH B;  4YSZ B;  1SXT A;  2K3U A;  1UGJ A;  2NTS A;  1MI0 A;  4XE0 A;  1L6U A;  4Q2J A;  1D5M C;  1JWS D;  2JQR B;  1BUI C;  1N5X A;  3RFZ B;  1N60 A;  3Q8E A;  3V05 A;  4L23 A;  3Q8C A;  5EE1 A;  1PUT A;  1FRR A;  3AEF B;  1PGB A;  5H8Y E;  3U7Z A;  1KF6 B;  5HFY A;  4OZB A;  3IXS A;  1QIL A;  3NRZ A;  2RDG A;  2YEP B;  4JE3 B;  4KX6 B;  1JQ4 A;  2BT6 A;  1IBX A;  1YN5 A;  1L6V A;  1PGA A;  3P4R B;  2DWQ A;  4ZRQ A;  1ET6 A;  1GOZ A;  1L0X B;  2QEJ C;  4A55 A;  1F0Z A;  1QKZ A;  5MPO A;  1KTK A;  1XF5 L;  3W5U B;  3AN1 A;  4O1N A;  3U2S C;  3U4E G;  2B76 B;  4GDL B;  1WSP A;  2WXF A;  4TMA B;  4RCO A;  4ZOH C;  2WQY B;  3Q8B A;  2YEP F;  1D5Z C;  4REZ A;  3P1M A;  4AQ7 A;  2I2Y A;  4OVZ A;  4YTP B;  1TS3 A;  2PIA A;  5TSS A;  3ZJT A;  4H2A A;  3ZQ4 A;  1N63 A;  2LHE A;  1P7E A;  1CZP A;  5E6J A;  2M0A A;  1ENF A;  2PLP A;  3R2I A;  1YN3 A;  1XLQ A;  1GB1 A;  2WXL A;  2DYM A;  1E9M A;  1E6E B;  4GLS C;  3FC4 A;  1WXQ A;  4RGO S;  1JCK B;  3LB8 C;  2RMM A;  3AE8 B;  3T3O A;  3TSS A;  1V97 A;  1CQV A;  1F77 A;  2D5G A;  1GPX A;  1JWB D;  3BII D;  1XLO A;  1UUP A;  1D5X C;  2J53 A;  3SR6 A;  1QOF A;  1FNU A;  2Y5C A;  4NZL B;  3C8Y A;  1ZXH A;  3V3X A;  1YJI A;  2KN4 A;  1C4A A;  4P6V F;  1JW9 D;  2GRI A;  3MJ5 A;  4IOI E;  1OFF A;  2H89 B;  4C7Y A;  1L0Y B;  3LXF A;  2FE8 A;  4IKG A;  3URY A;  1C4C A;  4HEA 1;  1FEH A;  3OWE B;  1FMA D;  4JWU C;  1FCC C;  3BYT B;  3AM9 A;  2LHD A;  1M4V A;  3EGR A;  2LEK A;  4XWT A;  2GI9 A;  3B2F A;  2H88 B;  1D6E C;  3U52 E;  4TQ0 A;  2EEL A;  4YXD B;  1EWC A;  1L4Z B;  2TSS A;  1XXG A;  4WUR A;  1YNT E;  4B0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...