1FXIA

Structure of the [2fe-2s] ferredoxin i from the blue-green alga aphanothece sacrum at 2.2 angstroms resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
96
structure length
96
Chain Sequence
b'ASYKVTLKTPDGDNVITVPDDEYILDVAEEEGLDLPYSCRAGACSTCAGKLVSGPAPDEDQSFLDDDQIQAGYILTCVAYPTGDCVIETHKEEALY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN I
publication title Structure of the [2Fe-2S] ferredoxin I from the blue-green alga Aphanothece sacrum at 2.2 A resolution.
pubmed doi rcsb
source organism Aphanothece sacrum
molecule tags Electron transfer (iron-sulfur protein)
total genus 14
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1990-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fxiA00
3W9CB 1GPXA 1L5PA 4N58A 3ABVB 2ACZB 1QOFA 1TKYA 3B2GA 3B2FA 1A70A 2WDQB 1GAQB 2AX5A 1J7AA 1R7SA 3AE2B 1WGKA 3AE6B 1EWYC 3EUB2 2E3TA 1OQRA 1JWBD 4JX1C 3AH7A 1PUTA 1FXIA 2W55A 4USAA 1NYRA 3AEBB 1E10A 2DWQA 1F0ZA 3AE7B 2KMMA 4FXCA 3W5VB 2CU3A 1IUEA 1NI3A 1QOAA 1B9RA 3PO0A 1PFDA 3P4PB 1QF6A 4ITKA 1FRDA 2WP9B 2G1EA 1ZXIA 1QLBB 2W54A 3NRZA 5EE3A 1JROA 1ZOYB 2L52A 4ZHOA 1RYJA 1XLNA 4A9AA 1NEKB 5GXGB 3P4QB 2EKIA 1NENB 1XLQA 1NYQA 1DGJA 1XLOA 3AEGB 1JQ4A 3P4SB 2M56B 1JRPA 1N5WA 3AEDB 4IDIA 2MH7A 2N0SB 5MPOA 4N6EB 1FMAD 3VRAB 3WCQA 5G5GA 4WWMA 3AN1A 1OFFA 3NVWA 4YSXB 4YXDB 2M19A 3HVZA 1FIQA 1KFYB 1ZUD2 5EE9A 2LEKA 3AE8B 2BS2B 3AE5B 3AB5A 3LXFA 2PVOD 5G5HA 3P4RB 1YQ3B 2WU5B 1WXQA 3NS1A 1J7BA 1L0VB 3ETRA 4JWSC 1QOBA 1VJKA 2JX5A 3AE4B 1L6UA 3AEEB 3B9JA 2QIEB 3NVZA 5AUIA 2WU2B 2Q5WD 4YTNB 1JALA 1RWSA 1AYFA 1SIJA 4US9A 3AE1B 1KF6B 3AEFB 4C7YA 4JWUC 2W3SA 1L6VA 3BIID 3KWLA 1ZP0B 4YT0B 2WDVB 1N61A 1TYGB 1AWDA 2H88B 3VRBB 2KAJA 1V8CA 3FC4A 2H89B 1J7CA 2Y5CA 4YTMB 1ROEA 1FRRA 1XO3A 1E9MA 1WRIA 3FAHA 4N59A 2WS3B 1DOXA 1N62A 4P6VF 3DWMA 1JW9D 1QT9A 3L4PA 1VLBA 1V97A 5H8YE 2BS3B 2MJ3A 3SR6A 3VR8B 3HRDD 1TJEA 2L83A 2W3RA 2QJLA 1FFVA 2CJNA 1NVID 2K9XA 2PIAA 3DWGC 4HROA 2HTME 5H92C 4ZHPA 1N5XA 3AM9A 1RFKA 3AEAB 1TKGA 2OHFA 1N60A 2K5PA 1E0ZA 2BT6A 1OQQA 2JQRB 2B76B 2PKOA 1YJIA 1RM6C 1I7HA 3AECB 1FXAA 1N63A 1VDVA 2MJEA 3HUIA 1QOGA 2DBYA 1TKEA 1CJEA 1SF0A 3SFDB 3ZYYX 1CZPA 4C80A 4US8A 3CIRB 1UWMA 5C3JB 4LTUA 4ZOHC 1DOYA 3VR9B 4HRSA 3SFEB 2BS4B 1PDXA 1FM0D 3AE3B 3AV8A 1E7PB 1E6EB 1T3QA 2CJOA 1WYGA 1XLPA 4KX6B 5EE1A 4C7ZA 1KRHA 5EE0A 2MJDA 3AE9B 4YSYB 2FBWB 1SB3C 4YTPB 4YSZB 1JWAD 1YJJA 3W5UB 3LB8C 2WDRB 3CWIA 1FFUA 2PVGC 2WLBA 2WQYB 3AMZA 1DOIA 5C2TB 1FO4A 3P1MA 2K22A 4WQMA 3NVVA 3NVYA 5AUKA 3P63A 1WWTA 1YQ4B 3RPFC
chains in the Genus database with same CATH superfamily
4DXAB 4L1BA 2IY1B 2LUEA 2AX5A 3DBLB 3VR9B 3ZYYX 3RCZA 2DYOA 4BKSD 4K81A 1QOAA 5EE3A 3U4EG 1WMHB 2NPTA 5GXGB 1D5ZC 2M0AA 1NYQA 2REXA 3EHVA 2L05A 5MPOA 2OJRA 3H7PB 2BWES 1Y56A 2DZJA 2DAFA 3T9LA 2NS5A 2JZZA 1M94A 4JIOU 3EFCA 4P1BC 2HE7A 4NY0A 5LXHA 4LK0M 1SJED 4JLCA 4RH6A 5D6JB 1F52A 4M01A 1AWDA 4JPSA 1EO6A 4WJOA 1FRRA 4LLGM 1Q0WB 3CMMB 4TMAB 3QJZA 5H8YE 1YQBA 2YVCA 1AW7A 4NJ6A 4RGTA 1RM6C 3QAQA 2IO3B 3L13A 1YN3A 2ZW1A 1C4AA 3GOEA 3ZXVA 5D7GA 2KDMA 2WXNA 1TY0A 2KNBA 2YEPF 5BYQA 4ZRJA 4KSKC 3GB1A 1SB3C 4XC2A 2J0JA 4GU2A 3TBLD 5J18A 3Q8AA 5E6PA 2Y5BB 3ABVB 2ACZB 3QQ8B 4W9GA 4W9KA 1K52A 3AEAB 2N7DA 4WWOA 1FNUA 3FILA 3AEBB 1IBXA 2CU3A 4ITKA 2IGDA 1QKZA 5IOIA 4FHJA 4ACFA 1XLOA 1KLVA 1E5WA 3WANA 3U7ZA 5G5GA 1XT9B 2KLGA 2MW5A 3APDA 3WA0A 1WR6E 2J0KA 2LXAA 4ARIA 4ZYNA 2BS2B 2WXFA 3C19A 4NZLB 3R2IA 2ZNVC 2IZVB 2QILA 3NOBA 2V3SA 2I2YA 3BYTB 3ZJTA 4YT0B 3DVNV 4J3OD 4IOIE 4F8CB 4HVBA 3L0WB 2BF8B 3ZNZB 1ZDVA 2JVCA 3U2SC 1N62A 3EC8A 1JW9D 2M0XA 1QT9A 3ZIMA 2KFJA 3ML8A 4IM0A 1YOVB 5DPRA 4OZCA 2QDFA 2WXOA 4HROA 1D3ZA 4MT5A 3KUCB 1F2RC 4P1CC 5AZGA 1FCLA 1QOGA 1TKEA 4MGIE 1CZPA 4LNNA 2MCNB 2KANA 1Q1OA 3WIMA 5JXVA 2LVOA 3AE3B 2NBVB 3OAWA 2PEAA 2SEBD 5I4DA 1RFAA 2HTHA 4JGHB 4WQMA 4AP4C 2WGSA 3ZGZA 1MHHE 3RPFC 3N32A 2LWPA 3ZO5B 3KLSX 1JWUD 2GBMA 2A4ZA 1SGHA 2L0FA 1I42A 5JHBA 1E8XA 1QF6A 1V2YA 2QCZA 2DAJA 2KDEB 4TKNA 1TT5B 2PJHA 3DBLI 4MGYE 4D2KA 1F2RI 4FJYA 2IY0B 2A5UA 3PHXB 2BYEA 4G0NB 4RGNA 4EOYA 3Q8FA 4ANWA 1WZ3A 5G2NA 1QOBA 2JX5A 3PLUA 4NJ7A 2Q5WD 3AE1B 4GOCA 1N61A 4NJCA 3W2DA 2RDBC 2Y5CA 3DWMA 2UWQA 3SR6A 2PPHA 2QJLA 2YEPB 4MM3A 2K9XA 1E8WA 2VZKD 2KD0A 3N3KB 4ARCA 2MBBB 1C76A 4E3CA 3ZDTA 1E0ZA 4RM8A 2ZCCA 3BVZA 3I9V1 2MBHA 4LNFA 3TUOA 2DBYA 3APFA 4L23A 2ONQA 2J0MA 4ZOHC 4E74A 2AQ1B 3GP7A 1PDXA 2AYOB 3RD2A 1UBQA 3R3MA 2WDRB 1FO4A 1DOIA 3SD5A 3NVYA 5BYRA 3K9OB 2JZ3B 1J7AA 1EU3A 5HHDG 1WGKA 3RI7C 1G6JA 2KACA 3T3NA 1JWBD 1ESFA 1FXIA 2LGDA 3H1UA 4XGAB 5HKHA 1FRDA 5L83A 3PLVA 1C78A 3Q2AC 3URYA 2RD0A 3P4QB 5FKAC 4CHKA 4II2B 1SE2A 3BY4B 2JSVX 3AEDB 1N5WA 1DYQA 4ICUA 3QIJA 2L8JA 1UWXA 1I4XA 2O6VB 2LZ6A 1ET9A 4NNJB 5D3DA 3AB5A 3LXFA 2MX2A 3UINB 1WJ6A 3NS1A 2BWFA 3EA6A 4FN2A 1P0RA 2GMIC 4KKIA 3APCA 4W9JA 4AQ7A 4MJSB 3MFGA 2KFKA 4PS3A 1RWSA 2L0TA 2IDYA 1HTQA 2KX0A 3AEFB 2HD5B 3V62A 3AU5A 2WDTB 4RNAA 3Q8BA 4LJPB 3SEBA 4ANVA 3M95A 1V8CA 1XQQA 2IJ0A 2V0GA 3VHTC 3ML9A 4W9EA 3IVFA 3VTUA 3FKYA 1WJUA 2BS3B 2XNAC 4LCDE 4A3OA 4BOSC 1WXMA 4OHJA 2LMCA 3M62B 1YJIA 3Q3FA 1E7VA 1FXAA 4ANXA 2XN9C 3DBSA 5DPTA 4R3DA 2BYFA 2N1WA 2JF5A 3CF6E 5TR5A 2DZKA 1V1OA 3QCAA 1VCBA 4XX5A 3C8YA 3LB8C 1FFUA 2K8BA 1QZEA 2LVQA 4KZCA 4ZYSA 4WURA 4FLHA 3UQAA 1WWTA 2UU7A 4AJWA 2BB5A 3P42A 3B2GA 3JYUA 4GGQA 4KKJA 1R7SA 1EWYC 3HIZA 1E10A 1F0ZA 1WGYA 3W5VB 2N1VA 4PT5A 2KKCA 3NZ3A 3UI3A 1H4RA 4PS7A 1ZOYB 2R2QA 2ZEQA 3ONSA 2IGHA 3L10B 3VVWB 1JQ4A 1KH0A 1GNUA 1FMAD 4NAWB 1Q5WB 2R61A 2N9EB 4C56C 3SHQA 5C1ZA 2KC1A 2C7NB 5G5HA 3Q3NC 1C77A 2NCNA 1WXSA 3VH4B 3GZNB 3TIXA 2QC8A 2LXCA 5HI1A 5AZHA 2FCMA 1C79A 3U52E 1PYWD 2ZJDA 4I6NB 3C0RB 4K3BA 1TZ1A 3CSFA 1WIAA 2LGSA 3ZRCA 4OZBA 1X1MA 2WS3B 1VR9A 3DHHC 4KDIC 4TQ0A 3RFZB 4I6PA 1HZ5A 1OQYA 2CJNA 2GI9A 3KVFB 2KTRA 3HK0A 2QHOA 1TKGA 1V1PA 4C4VA 1ISNA 1UNSA 3JW0X 2CHXA 2BT6A 1VDVA 2K6DB 2KVRA 5BMIA 2LFIA 4W9FA 2LD9A 2CJOA 1WFYA 1L0XB 4XWWA 5CHFA 4C7ZA 2JXXA 2ASQA 2ZPNA 3CWIA 4DHJD 1WH3A 1GC6A 3Q14C 3I5JC 2I38A 3B2FA 4KGRA 4MGKE 4YSZB 2EKEC 2ZNVB 3AH7A 4HKQA 3RULA 1MG4A 4IWOA 4FBJB 3ALBA 2G1EA 1QLBB 4PK1A 1OTRB 1HEZE 1L7YA 2L00B 4XWTA 4ZRIA 4A9AA 2EKIA 3W1SA 4B9KA 2DNFA 3A9JB 5BYSA 2PE6B 4MEMA 2M56B 2D3BA 1T0QC 1P9DU 2MH7A 4KV2A 4N6EB 4BOZB 1E8YA 3UIPB 2IYDB 2RGFA 3H7SA 2V3NA 2CHZA 1D5MC 3AE8B 1P98A 3NUHB 2X8XX 1WMHA 3IT6B 1WXQA 2C9WB 3IAS1 3B08A 3EGRA 1EM7A 2IO2B 4M00A 4MDKE 1L6UA 1YIWA 3H7PA 1GC7A 4US9A 3P2BA 1TS4A 2ON8A 5JZEB 3GS2A 3ZNHB 4HKZE 2K3UA 1XO3A 4FJVB 3VQIA 3PHWB 1GUAB 4GB9A 3V6EB 2KT7A 1S3SG 4NAMA 1TJEA 2N7EA 4FA6A 1M4VA 2BYTA 2G3QB 3BWUD 1GJZA 1L4ZB 3X0WA 1CJEA 5CHWA 4GDKB 3A9KB 4Q2JA 5C3JB 4LNKA 1KJTA 1OEYJ 3AV8A 1E7PB 3VFKA 1LXDA 1FNVA 1UGJA 2DZIA 5EE1A 4CYEA 3QWZB 1IP9A 4NPNA 3PS6A 4P16A 1T0RC 5BMGA 2K22A 3RNGC 4A8XC 3MC0B 3LYYA 3NZSA 1YQ4B 1T0YA 3VUWA 3HM3A 1GPXA 2ICIA 2FCNA 3AE2B 5D2MB 1C3TA 2E6XA 3PRPB 1WGGA 4TUUA 4XE0A 2E3TA 4WJNA 1JRUA 1LM8B 2DWQA 4EKUA 3V6CB 3PO0A 2ZVOA 1IGCA 3W1YA 1F9JA 1WGHA 1LQBA 4OVVA 1NEKB 2RR9A 4BZAA 1YN5A 1JWSD 2OOBB 2B3AA 3P4SB 1JWMD 1C9FA 3EECA 2BBCA 2O2VB 3IG3A 1KLUD 1ACCA 4XDCA 2KDFB 5EE9A 1UH6A 4NQKE 3N1ZC 1SIFA 2G4DB 2WU5B 2MHJA 4KGTA 2CR5A 1WYWB 3PTFC 1XF5L 3NVZA 3TMPB 3VAWA 2BKRB 3VUYA 3RZFA 1AYFA 2MSED 4C7YA 4JWUC 3VUXA 1TYGB 4MH0E 4M0WB 4I6LB 3RUIB 5G55A 3Q3JA 4N59A 4LDTD 1MPEA 4DBGA 1I4QA 3GZNI 4W9IA 1P3QU 3UIOB 3VR8B 1MG8A 2L83A 3KW5B 2PIAA 1T6BX 4ZDVA 3JVZX 1WJ4A 3PZ7A 4BKGA 1N5XA 2INCC 1R4MB 2M1MA 2RPVA 2MJEA 4HXDA 4ASWC 2INDC 1HQRD 1L0YB 4LNIA 3A4RA 1WX7A 5IO9A 2JWZA 3TEYA 1HXYD 3PGEA 5KHQA 1Q10A 2KTFA 2JWUA 4EFOA 1JWAD 4PYZA 1U4AA 1ZGUB 1KLGD 3LDZE 4KDLB 1VRAB 3IT4B 2AQ2B 3W9CB 2MBQA 4HJKA 1H8CA 4USAA 3AE7B 4FXCA 3TEXA 3V05A 1JCKB 2N4FA 1DGJA 4WIPA 2KWDA 1IPGA 1WXVA 1SJHD 1WE6A 2M19A 3HVZA 3BK1A 2N9XA 3ZNGC 3PPAA 1J0GA 1IYFA 4RF1A 4JWSC 4A20A 5LXIB 3AEEB 4QAYA 1V80A 1P7FA 2PE9A 1WE7A 3SU8X 2ZW0A 2V4LA 4NQLB 3KWLA 3BIID 3ZXRA 2XK5B 1ZP0B 4C00A 1D4BA 3FC4A 4X57B 4KIKB 1E9MA 2LGXA 1V9JA 1VZ6A 2M17A 1YJ1A 4YWGG 2DZMA 3BVGA 1EF5A 2KX3A 1HZ6A 2NTTA 5E6NA 3MJ5A 3PSEB 2K5PA 2GLSA 4RCOA 2KK8A 1N63A 3RNBC 1V5TA 4G11A 1GB4A 2I1KA 5JHAA 3PZDA 4RGMA 4DXGA 1XCQL 5AZFA 1WYGA 3QA8A 4CQNA 4WAAA 3RNAC 3T8MA 3DVGX 1MJDA 1K8RB 3AE9B 3JSVB 4AS1A 2WQYB 2JPHA 5FK9C 5L95C 3MC8A 3OJ4B 5E6OA 3SDLC 4BKTA 1P1AA 2K39A 1B1ZA 2BTEA 3IAM1 2PMVA 5IP4D 2HJ1A 3BVMA 2LRUA 3V3XA 1NDDA 3A1QB 1ZXIA 3NRZA 2D3AA 2KO3A 4HEA1 2LRWA 2N0SB 2KC2A 4IW0A 2KDBA 1OFFA 3NVWA 4IM3A 1KM7A 2V4IB 2MA9B 1E8ZA 4IWPA 2LEKA 4OVZA 2KN5A 3MHSD 1YQ3B 4RM9A 5EDSA 4M8MA 2WXIA 4WH4A 1VJKA 3KYDD 1WGDA 4XYCA 2WU2B 5FR6A 2D3GA 2O6VA 2LHDA 4ZRPA 2KXJA 1OGWA 1WM3A 4WJPA 4BFRA 2H89B 2WXPA 2JYEA 4GXBA 2IGGA 4DWFA 3MTNB 2KDIA 4MJSA 3RNCC 1WZ0A 3UGBB 2RPQA 3IXSA 3Q3MC 1UBIA 4EE2A 4XZ4A 4HLEA 5CX3A 4S0RA 4EEWA 1V5OA 2K1FA 2PTLA 3R66C 2NVUI 1R4NB 2MWSB 2DYMA 2NBWB 2MP2B 4II3B 4GDLB 3SFEB 2TSSA 3IBEA 4KX6B 2MLBA 1YX5B 3ZRFA 2JZPA 1R4MI 3W5UB 3BYYB 1SE4A 3P1MA 2J53A 3O13A 4ZHPA 2FIDA 4N58A 4PS8A 3B0AA 4G3XB 3EUB2 2Z8LA 4JX1C 1KOTA 1LO5D 2FNJB 1D6EC 2DX5B 2HJ8A 1WR1A 1RYJA 4KGSA 4JQWC 1VZ7A 1PGXA 1HA5A 3DHGC 4IDIA 2JT4B 3L16A 3ZQ4A 1SSNA 4RFBA 4RF0A 3AN1A 4TQ1A 3OG5A 4B6WA 1KFYB 1ZUD2 1UELA 3B1LX 1TZOA 2KWUB 2FAZA 2IO1B 3R8BA 2JU6X 2WXLA 3PZ8A 5AUIA 1YD8U 3OLMD 1FPYA 4DHZE 4NAWA 3RYTA 3H9DA 1WGRA 1C4PA 1RLFA 1Z5SB 1J7CA 3FAHA 2FCQA 2FE8A 2LASA 1UZXB 3KWVA 4S17A 4K1RB 2VZKB 3O65B 4XDDA 4US8A 3MHZA 4IUMB 5IN7A 1YX6B 1TGZB 2D3CA 4IM2A 5T8IA 1T3QA 1KRHA 2PLPA 5CTRC 5EE0A 2UYZB 2MJDA 3DHIC 1F1HA 1YJJA 1TS3A 3BK2A 1K51A 1J19A 2PVGC 4TV3A 4IC7B 3VTWA 5J17A 4HJGE 3HHMA 3AE6B 2AQ3B 3VRBB 2K8CA 2KJRA 1PQSA 2N9KA 1IUEA 2NR2A 3M63B 2WP9B 3ZTDA 2KLCA 1MI0A 1GOZA 1XLNA 1T5XD 4O1NA 4ZRKA 2BPSA 2KTRB 4URKA 2BQQA 2FUHB 1I4RA 5DPSA 2GBJA 1E90A 3Q8CA 3VXWA 3VRAB 3PREA 2JY6A 4W9DA 2RMMA 3MC9A 1NBFC 3A4SC 2HDEA 2C7MB 4P7IA 4KSLC 4FJZA 3L17A 1F77A 1HE8A 3A9JA 2LGIA 4M8NA 2Y5PA 2RDHA 4M02A 3TEWA 3LJ3A 2KQSA 3KUZA 3E9SA 1FXTB 3TSSA 4A3PA 1C4CA 4AWJA 1V97A 4HWIB 4A90A 3AM9A 3KUDB 3MJWA 2V1YA 1N60A 2GOWA 4HDOA 2GRIA 3SFDB 3CIRB 3RMKC 3WALA 2AEHA 1ZKHA 3DVGY 3U8ZA 2DHZA 2DYBA 1PGBA 2JRIB 3DDCB 1XLPA 4DQOC 2D07B 2WYQA 1N6ZA 2KYWA 4K7UA 5DPWA 1WY8A 4W9LA 2GB1A 2X38A 4DDGD 2KWCA 2N9LA 4GDKA 5AUKA 2NPTB 3A9KA 2BYVE 1L5PA 1R4NI 4B0EA 1GAQB 2C5LC 4WQOB 1FEHA 4IG7B 3UF8A 3KYCD 4ZHOA 1WM2A 1NENB 1CK1A 3KQ4A 4BBNF 1NI2A 4IKGA 4AOFA 3N1YC 3T3OA 2KMAA 4UDUC 2WHIA 1V6EA 1S1QB 2WXKA 4MGZE 4E71A 3HVDA 3QARA 2QSDA 5GMVA 1FIQA 3DQVA 1TS2A 3I3TB 1J7BA 3WAOA 4YTNB 2O2VA 4HCNB 3IHPC 2CHWA 4ICVA 2MRPA 1GG3A 3HM6X 1STEA 2BKFA 2N9PC 4LNOA 3R7RA 2MBEA 2WXGA 2WXRA 4YTMB 1WRIA 5JH5C 4DK5A 4J6IA 4K7WA 2WX0A 2GBRA 2KQ4X 3PRZA 4L2YA 4JL9A 4IWQA 2W3RA 4TSSA 1NVID 2NMQA 1YMHE 3TJPA 2ZZPB 1EF1A 4WJQA 2VH1A 1VD2A 4M0WA 2FIFA 4C80A 1XXGA 1P7EA 3RNFC 2J42A 2YLMA 4KZ0A 4WWNA 2C60A 3FILB 1XCTL 1E6EB 3DBRB 2LGYA 1IBXB 3OJ3A 3QHTA 1GB1A 2W9NA 1C1YB 3R7QA 3AULA 4YTPB 1WX8A 3AMZA 2CU1A 1BMLC 2D10A 2NTSA 1WXAA 4DHJB 1QOFA 3RZWC 2MEKA 2QEJC 2WDQB 3ZVVA 1K50A 2KVZA 1CMXB 2JYTA 3ZNID 4N9F4 1EUVB 3I57A 1AN8A 3BZDB 4KVGB 5AEKB 4B95A 2JRHA 2O6VD 2C7HA 2FCSA 5D94A 1SE9A 1MFWA 5LNK1 1OEYA 2CKHB 2M8SA 4GN1A 1TTNA 3Q3OC 4BKSA 3AE5B 3W1SC 3I63C 1L0VB 3ETRA 1ZE3D 3OWEB 1A5RA 5LLIA 4GMVA 3QK0A 1JALA 2KZRA 1K53A 1SBBB 4OZAA 3L08A 3ENEA 4HCPB 4GSWA 4W9CA 2L32A 3BINA 5HG2A 3L4PA 2KHWB 3V61A 2ZPYA 3DVNU 3DWGC 2HTME 5H92C 2N7JA 3DBHI 2D2QA 3R2TA 3N1XC 3PT2B 4HK2A 2XK5A 1V86A 5IKCM 1TBEA 2WWZA 4KIKA 1SF0A 1UWMA 4H2AA 5J2RA 1Y8RC 2WXQA 2BS4B 1XD3B 2WXHA 1CQVA 1QILA 2KN4A 2V3PA 2K8HA 1WSPA 3ZLZA 4B0MA 4MSMB 3A33B 4HDQA 3WAPA 3P63A 4YSXB 2CS4A 1I4GA 1QQRA 3AI5A 1TKYA 2L76A 1A70A 2V9HA 2GBNA 1OQRA 2G45B 4F7ZA 2KMMA 3N30A 1NI3A 2LVPA 3DOWA 1PFDA 1TS5A 3P4PB 1TY2A 3JSVA 1JROA 2I1JA 2WXMA 3DPDA 2IPKD 4OVUA 1JRPA 2AL6A 4WWMA 3NG0A 3K9PB 2RSUA 2K6QA 3A1QA 1FNWA 4G50A 5BO4B 3ZW3A 2IO0B 4BVUC 5DCNA 2JXTA 3U7DA 1D5XC 2QIEB 1AARA 1FCCC 4AJYB 4MM3B 2LJIA 3M3JA 1SIJA 1WI0A 2JUOA 5TSSA 3NJTA 2AL3A 3S2AA 2GBKA 3ZJVA 1WF9A 2BGFA 2FUG1 1ROEA 3WAMA 1ET6A 3AU4A 5CHVC 1HTOA 2DLBA 1BUIC 4LDTB 1FFVA 4WAFA 4HPLB 3GE8C 1TIFA 4A6QA 2WXJA 1OQQA 1UD7A 2B76B 1JMLA 3EFUA 1J8CA 1WJNA 2ZVNA 3N20C 3CSTA 4GLSC 2VH2A 2SAKA 2NBUA 3ZKJC 1V81A 3IFWB 3ECIA 2L3ZA 1MHXA 1ENFA 1BT0A 5C2TB 5C23A 2RDGA 2EMSA 4HPMB 2MP2A 4GDLA 1SEBD 4P6VF 1B9RA 1DOXA 2W55A 1NYRA 3DBRI 4K3CA 2LJ5A 2Z0EB 2L7RA 4FHKA 3DCGA 2W54A 5IAAC 2BB6A 2L52A 1L4DB 4K7SA 1ZDXA 2INPE 3Q8EA 3AXCA 1XLQA 2K25A 2W82A 1E7UA 5IA7A 2J7QB 1L2NA 2M4NA 2KFKB 3MP9A 1I4PA 3ZJUA 3D32A 3J9CA 4ZRQA 1UF0A 1XEEA 1SE3A 2PVOD 3P4RB 4YL8A 4MSQB 5FR3A 2KJ6A 2G4SA 1ZPSA 3H8HA 3AE4B 2OEDA 1WX9A 2EELA 4EUTA 2WX1A 4OW0A 1LGRA 3VTVA 1FD6A 1KF6B 4RMAA 1YN4A 2WDVB 2H88B 4FULA 2J52A 1KTKA 2LUMA 1T0SC 1WRDB 2EMTA 1UGMA 2KQ7A 1ZW7A 3NY5A 1IGDA 2MJ3A 4BBNC 3HRDD 3U30A 1I4HA 2BW2A 2OHFA 5HFYA 2JQRB 3AECB 3TEZA 3HUIA 2VRRB 4ANUA 1LFDA 4LTUA 2BVCA 4HRSA 2PW9A 3Q69A 2ZCBA 5E6JA 5BMHA 4F1SA 1FM0D 1Z2MA 4WWPA 1RRBA 4YSYB 2FBWB 1PGAA 1SXTA 3PVLA 2WLBA 4FADA 2KJHB 3VH3B 3NVVA 2KMCA 1I35A 2LHEA 2J4XA 1YNTE 1PUTA 2OJWA 4HPPA 2D11A 1RAXA 4DDID 2DENB 5D3IB 4MH8A 4EZKA 5KHOA 3AEGB 2WNMA 4BAXA 4RGOS 3TL5A 4AUQC 3NS8A 2K0PA 2KWVB 3PRMB 4W9HA 4YXDB 3VDZA 4PYUA 4REZA 4CO7A 2G9HD 2MBOA 4GIVA 2IBIB 2XEWA 4DHZB 2L1AA 3V60A 3KH0A 1EU4A 1BXTA 2D5GA 1VZ8A 2QMTA 2W3SA 1V1PB 1L6VA 2XBBC 4C4VB 3L54A 2INNE 3Q6BA 2KAJA 2LI5A 3TCAA 1MVKA 1V49A 2KOXA 3ZDMC 3NHEB 1VLBA 3H6NA 3E56A 2MQJA 3QC8B 4MACA 1UUPA 2Z59B 1RFKA 3RT3B 4EZJA 2PKOA 1I7HA 3WCQA 3DBHB 3RNEC 1EWCA 1DOYA 3ZTCA 3QX1A 4A55A 4EZLA 3PV1A 2R2OA 3X23A 3NZUA 3UQBA 4DXFA 4LJOB 3RN9C 1ZXHA 2Z0DB 3GE3C 4MELA 2AWTA 4JE3B 3ZUNA 3N9YC 3B9JA 2Y3AA
chains in the Genus database with same CATH topology
3P42A 4L1BA 1B1ZA 1QOFA 3B2GA 4KKJA 2BTEA 2MEKA 2QEJC 3IAM1 2WDQB 2AX5A 1K50A 1R7SA 2PMVA 1EWYC 3VR9B 3ZYYX 1E10A 2JYTA 1F0ZA 3W5VB 4PT5A 3BVMA 2DYOA 1QOAA 3I57A 3NZ3A 3V3XA 1AN8A 3UI3A 3BZDB 5EE3A 1ZXIA 3NRZA 1ZOYB 3U4EG 2IGHA 5GXGB 1D5ZC 2M0AA 4HEA1 1NYQA 1JQ4A 1KH0A 2N0SB 5MPOA 1FMAD 4NAWB 1OFFA 1Y56A 5LNK1 2R61A 3NVWA 2V4IB 4C56C 4OVZA 2LEKA 3AE5B 5G5HA 1YQ3B 1C77A 1L0VB 3ETRA 2WXIA 4LK0M 1ZE3D 4WH4A 1SJED 1VJKA 3OWEB 5HI1A 2WU2B 4RH6A 1JALA 2LHDA 1C79A 4ZRPA 1PYWD 3U52E 1K53A 1SBBB 4OZAA 1AWDA 4JPSA 2H89B 2WXPA 1FRRA 4OZBA 2JYEA 2L32A 4LLGM 2WS3B 1VR9A 4TQ0A 2IGGA 3RFZB 5HG2A 3L4PA 4TMAB 1HZ5A 5H8YE 1AW7A 2CJNA 3DWGC 3IXSA 2GI9A 2HTME 5H92C 2N7JA 1TKGA 3R2TA 4EE2A 1V1PA 4RGTA 1UNSA 2BT6A 1RM6C 1VDVA 2PTLA 1SF0A 1UWMA 1YN3A 5BMIA 4H2AA 2ZW1A 1C4AA 2DYMA 2LFIA 2WXQA 4GDLB 2BS4B 5D7GA 2TSSA 3SFEB 2KDMA 2WXHA 2WXNA 2KN4A 1CQVA 1QILA 1TY0A 2YEPF 2CJOA 2V3PA 1L0XB 5BYQA 1WSPA 4XWWA 4KX6B 4C7ZA 2JZPA 3GB1A 1SB3C 4B0MA 3W5UB 3BYYB 3CWIA 1SE4A 3P1MA 2J53A 3O13A 3P63A 4YSXB 4ZHPA 1I4GA 1QQRA 2I38A 3Q8AA 4N58A 3ABVB 2ACZB 1TKYA 1K52A 3B2FA 1A70A 3AEAB 4KGRA 1FNUA 3EUB2 3FILA 2Z8LA 4YSZB 1OQRA 4JX1C 3AH7A 3AEBB 1LO5D 4HKQA 1IBXA 2KMMA 2CU3A 1D6EC 1NI3A 1PFDA 1TS5A 3P4PB 4ITKA 1TY2A 2G1EA 1QLBB 2IGDA 1JROA 1HEZE 2WXMA 1RYJA 1QKZA 4XWTA 4A9AA 4KGSA 2EKIA 3W1SA 1VZ7A 2IPKD 1XLOA 1PGXA 1HA5A 5BYSA 2M56B 1JRPA 4IDIA 3ZQ4A 1SSNA 2MH7A 3U7ZA 4N6EB 4RFBA 4RF0A 5G5GA 4WWMA 3AN1A 4TQ1A 2V3NA 4ARIA 1FNWA 1KFYB 1ZUD2 1D5MC 3AE8B 2NTSA 2BS2B 3NUHB 2WXFA 2JXTA 3IT6B 1TZOA 1WXQA 3IAS1 3EGRA 1EM7A 3R8BA 4NZLB 3R2IA 1D5XC 2JU6X 2WXLA 3PZ8A 5AUIA 1L6UA 2QILA 2QIEB 1FCCC 4MM3B 2LJIA 2I2YA 1SIJA 3BYTB 4US9A 3ZJTA 1TS4A 1C4PA 5TSSA 4YT0B 4J3OD 2ON8A 4IOIE 3ZJVA 3GS2A 4HKZE 1J7CA 2FUG1 2K3UA 1ROEA 1XO3A 1ZDVA 3VQIA 3FAHA 1ET6A 3U2SC 1N62A 1JW9D 1QT9A 2FE8A 4NAMA 4OZCA 2DLBA 1BUIC 3KWVA 1TJEA 1FFVA 2WXOA 4HROA 1M4VA 4WAFA 2BYTA 4MT5A 4A6QA 2WXJA 1OQQA 1F2RC 2B76B 1L4ZB 3BWUD 2VZKB 1JMLA 1FCLA 1QOGA 4XDDA 1TKEA 1CJEA 4US8A 3MHZA 1CZPA 4GDKB 4Q2JA 5C3JB 4GLSC 5JXVA 3AE3B 5T8IA 3AV8A 1E7PB 1T3QA 2SAKA 1FNVA 1UGJA 5EE1A 1KRHA 2PLPA 5EE0A 2MJDA 1MHXA 1ENFA 1YJJA 1TS3A 3BK2A 1K51A 2SEBD 4P16A 5I4DA 2PVGC 5C2TB 5BMGA 4WQMA 2K22A 4A8XC 2RDGA 3MC0B 3LYYA 3ZGZA 1YQ4B 1MHHE 3RPFC 1GPXA 4HJGE 3KLSX 2ICIA 1JWUD 1SEBD 3AE2B 3AE6B 4P6VF 1B9RA 2E6XA 1DOXA 2AQ3B 3VRBB 4XE0A 2E3TA 2W55A 1NYRA 2DWQA 2N9KA 1IUEA 3PO0A 1QF6A 1IGCA 2WP9B 2W54A 2BB6A 2L52A 1L4DB 1MI0A 1GOZA 1XLNA 1T5XD 1ZDXA 1NEKB 4O1NA 1YN5A 1JWSD 2INPE 3Q8EA 1XLQA 2W82A 3P4SB 1JWMD 1C9FA 1I4RA 3Q8CA 2BBCA 3MP9A 1I4PA 3VRAB 2RMMA 4D2KA 3ZJUA 2HDEA 1F2RI 3J9CA 1KLUD 4ZRQA 1ACCA 1XEEA 4XDCA 5EE9A 1SE3A 4RGNA 2PVOD 3P4RB 2WU5B 3Q8FA 1F77A 4KGTA 5FR3A 3N9YC 1QOBA 1ZPSA 2LGIA 3H8HA 2JX5A 1XF5L 3AE4B 3NVZA 2Y5PA 2OEDA 2EELA 2Q5WD 4OW0A 1AYFA 3AE1B 2RDHA 1FD6A 1KF6B 4C7YA 4JWUC 3TEWA 1YN4A 2WDVB 1N61A 1TYGB 2H88B 4NJCA 3W2DA 3E9SA 2Y5CA 2J52A 3TSSA 1C4CA 1KTKA 4N59A 2LUMA 1MPEA 3DWMA 1V97A 1I4QA 1IGDA 2MJ3A 3SR6A 3VR8B 3HRDD 2L83A 2QJLA 2YEPB 4A90A 2PIAA 1T6BX 2K9XA 3PZ7A 2VZKD 1N5XA 3AM9A 4ARCA 1I4HA 2BW2A 2OHFA 5HFYA 1C76A 1N60A 2RPVA 1E0ZA 2JQRB 3I9V1 3BVZA 3AECB 2GRIA 3TUOA 2MJEA 3TEZA 3HUIA 2DBYA 1HQRD 3SFDB 3CIRB 4L23A 2ONQA 4LTUA 4ZOHC 1L0YB 2AQ1B 2PW9A 3GP7A 3Q69A 4HRSA 5E6JA 1PDXA 5BMHA 1PGBA 1FM0D 3TEYA 1XLPA 1HXYD 4DQOC 1Q10A 2JWUA 4YSYB 2FBWB 1PGAA 1SXTA 1JWAD 2WDRB 2GB1A 2WLBA 2X38A 1KLGD 1DOIA 1FO4A 2N9LA 3NVVA 3NVYA 5AUKA 1VRAB 3IT4B 2AQ2B 5BYRA 3W9CB 1L5PA 2LHEA 4B0EA 1GAQB 2J4XA 1J7AA 1EU3A 1YNTE 1WGKA 5HHDG 2KACA 3T3NA 1JWBD 4USAA 1ESFA 1FXIA 1PUTA 3AE7B 4FXCA 1FEHA 3TEXA 3V05A 1FRDA 1JCKB 4ZHOA 1C78A 3URYA 5D3IB 3P4QB 5FKAC 1NENB 4MH8A 1CK1A 1SE2A 3KQ4A 1DGJA 3AEGB 2WNMA 2JSVX 3AEDB 4RGOS 1N5WA 4IKGA 4WIPA 1DYQA 2KWDA 3T3OA 4UDUC 2K0PA 1SJHD 1UWXA 2WXKA 1I4XA 3HVDA 4YXDB 2QSDA 1ET9A 2M19A 3HVZA 4REZA 2G9HD 1FIQA 3BK1A 5D3DA 3AB5A 3LXFA 1TS2A 2L1AA 3NS1A 1J7BA 3EA6A 4RF1A 4JWSC 4KKIA 1EU4A 4AQ7A 3AEEB 3MFGA 1BXTA 1P7FA 4YTNB 1RWSA 2IDYA 2ZW0A 2D5GA 3AEFB 1VZ8A 2QMTA 2W3SA 1STEA 1L6VA 1V1PB 3BIID 3KWLA 4RNAA 3Q8BA 1ZP0B 3SEBA 2INNE 1D4BA 2KAJA 1V8CA 2WXRA 2WXGA 3FC4A 4YTMB 2IJ0A 1E9MA 1MVKA 1WRIA 2V0GA 1VZ6A 4YWGG 3BVGA 1VLBA 3E56A 2KQ4X 2XNAC 2BS3B 1HZ6A 4L2YA 2NTTA 4MACA 2W3RA 4TSSA 1UUPA 1NVID 2NMQA 1YMHE 3MJ5A 1RFKA 4OHJA 2K5PA 2LMCA 2PKOA 4RCOA 1YJIA 1I7HA 1FXAA 1N63A 4M0WA 3WCQA 4C80A 1XXGA 1P7EA 2XN9C 1EWCA 2J42A 1GB4A 4R3DA 1DOYA 4RGMA 3FILB 4DXGA 4A55A 1XCTL 1XCQL 1E6EB 1V1OA 1WYGA 4CQNA 1IBXB 4DXFA 1GB1A 1ZXHA 3AE9B 4YTPB 3C8YA 3LB8C 4AS1A 1FFUA 3AMZA 2WQYB 5FK9C 4ZYSA 1BMLC 4JE3B 4WURA 1WWTA 3B9JA 2Y3AA 2BB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W9C B;  1GPX A;  1L5P A;  4N58 A;  3ABV B;  2ACZ B;  1QOF A;  1TKY A;  3B2G A;  3B2F A;  1A70 A;  2WDQ B;  1GAQ B;  2AX5 A;  1J7A A;  1R7S A;  3AE2 B;  1WGK A;  3AE6 B;  1EWY C;  3EUB 2;  2E3T A;  1OQR A;  1JWB D;  4JX1 C;  3AH7 A;  1PUT A;  1FXI A;  2W55 A;  4USA A;  1NYR A;  3AEB B;  1E10 A;  2DWQ A;  1F0Z A;  3AE7 B;  2KMM A;  4FXC A;  3W5V B;  2CU3 A;  1IUE A;  1NI3 A;  1QOA A;  1B9R A;  3PO0 A;  1PFD A;  3P4P B;  1QF6 A;  4ITK A;  1FRD A;  2WP9 B;  2G1E A;  1ZXI A;  1QLB B;  2W54 A;  3NRZ A;  5EE3 A;  1JRO A;  1ZOY B;  2L52 A;  4ZHO A;  1RYJ A;  1XLN A;  4A9A A;  1NEK B;  5GXG B;  3P4Q B;  2EKI A;  1NEN B;  1XLQ A;  1NYQ A;  1DGJ A;  1XLO A;  3AEG B;  1JQ4 A;  3P4S B;  2M56 B;  1JRP A;  1N5W A;  3AED B;  4IDI A;  2MH7 A;  2N0S B;  5MPO A;  4N6E B;  1FMA D;  3VRA B;  3WCQ A;  5G5G A;  4WWM A;  3AN1 A;  1OFF A;  3NVW A;  4YSX B;  4YXD B;  2M19 A;  3HVZ A;  1FIQ A;  1KFY B;  1ZUD 2;  5EE9 A;  2LEK A;  3AE8 B;  2BS2 B;  3AE5 B;  3AB5 A;  3LXF A;  2PVO D;  5G5H A;  3P4R B;  1YQ3 B;  2WU5 B;  1WXQ A;  3NS1 A;  1J7B A;  1L0V B;  3ETR A;  4JWS C;  1QOB A;  1VJK A;  2JX5 A;  3AE4 B;  1L6U A;  3AEE B;  3B9J A;  2QIE B;  3NVZ A;  5AUI A;  2WU2 B;  2Q5W D;  4YTN B;  1JAL A;  1RWS A;  1AYF A;  1SIJ A;  4US9 A;  3AE1 B;  1KF6 B;  3AEF B;  4C7Y A;  4JWU C;  2W3S A;  1L6V A;  3BII D;  3KWL A;  1ZP0 B;  4YT0 B;  2WDV B;  1N61 A;  1TYG B;  1AWD A;  2H88 B;  3VRB B;  2KAJ A;  1V8C A;  3FC4 A;  2H89 B;  1J7C A;  2Y5C A;  4YTM B;  1ROE A;  1FRR A;  1XO3 A;  1E9M A;  1WRI A;  3FAH A;  4N59 A;  2WS3 B;  1DOX A;  1N62 A;  4P6V F;  3DWM A;  1JW9 D;  1QT9 A;  3L4P A;  1VLB A;  1V97 A;  5H8Y E;  2BS3 B;  2MJ3 A;  3SR6 A;  3VR8 B;  3HRD D;  1TJE A;  2L83 A;  2W3R A;  2QJL A;  1FFV A;  2CJN A;  1NVI D;  2K9X A;  2PIA A;  3DWG C;  4HRO A;  2HTM E;  5H92 C;  4ZHP A;  1N5X A;  3AM9 A;  1RFK A;  3AEA B;  1TKG A;  2OHF A;  1N60 A;  2K5P A;  1E0Z A;  2BT6 A;  1OQQ A;  2JQR B;  2B76 B;  2PKO A;  1YJI A;  1RM6 C;  1I7H A;  3AEC B;  1FXA A;  1N63 A;  1VDV A;  2MJE A;  3HUI A;  1QOG A;  2DBY A;  1TKE A;  1CJE A;  1SF0 A;  3SFD B;  3ZYY X;  1CZP A;  4C80 A;  4US8 A;  3CIR B;  1UWM A;  5C3J B;  4LTU A;  4ZOH C;  1DOY A;  3VR9 B;  4HRS A;  3SFE B;  2BS4 B;  1PDX A;  1FM0 D;  3AE3 B;  3AV8 A;  1E7P B;  1E6E B;  1T3Q A;  2CJO A;  1WYG A;  1XLP A;  4KX6 B;  5EE1 A;  4C7Z A;  1KRH A;  5EE0 A;  2MJD A;  3AE9 B;  4YSY B;  2FBW B;  1SB3 C;  4YTP B;  4YSZ B;  1JWA D;  1YJJ A;  3W5U B;  3LB8 C;  2WDR B;  3CWI A;  1FFU A;  2PVG C;  2WLB A;  2WQY B;  3AMZ A;  1DOI A;  5C2T B;  1FO4 A;  3P1M A;  2K22 A;  4WQM A;  3NVV A;  3NVY A;  5AUK A;  3P63 A;  1WWT A;  1YQ4 B;  3RPF C; 
#chains in the Genus database with same CATH topology
 4DXA B;  4L1B A;  2IY1 B;  2LUE A;  2AX5 A;  3DBL B;  3VR9 B;  3ZYY X;  3RCZ A;  2DYO A;  4BKS D;  4K81 A;  1QOA A;  5EE3 A;  3U4E G;  1WMH B;  2NPT A;  5GXG B;  1D5Z C;  2M0A A;  1NYQ A;  2REX A;  3EHV A;  2L05 A;  5MPO A;  2OJR A;  3H7P B;  2BWE S;  1Y56 A;  2DZJ A;  2DAF A;  3T9L A;  2NS5 A;  2JZZ A;  1M94 A;  4JIO U;  3EFC A;  4P1B C;  2HE7 A;  4NY0 A;  5LXH A;  4LK0 M;  1SJE D;  4JLC A;  4RH6 A;  5D6J B;  1F52 A;  4M01 A;  1AWD A;  4JPS A;  1EO6 A;  4WJO A;  1FRR A;  4LLG M;  1Q0W B;  3CMM B;  4TMA B;  3QJZ A;  5H8Y E;  1YQB A;  2YVC A;  1AW7 A;  4NJ6 A;  4RGT A;  1RM6 C;  3QAQ A;  2IO3 B;  3L13 A;  1YN3 A;  2ZW1 A;  1C4A A;  3GOE A;  3ZXV A;  5D7G A;  2KDM A;  2WXN A;  1TY0 A;  2KNB A;  2YEP F;  5BYQ A;  4ZRJ A;  4KSK C;  3GB1 A;  1SB3 C;  4XC2 A;  2J0J A;  4GU2 A;  3TBL D;  5J18 A;  3Q8A A;  5E6P A;  2Y5B B;  3ABV B;  2ACZ B;  3QQ8 B;  4W9G A;  4W9K A;  1K52 A;  3AEA B;  2N7D A;  4WWO A;  1FNU A;  3FIL A;  3AEB B;  1IBX A;  2CU3 A;  4ITK A;  2IGD A;  1QKZ A;  5IOI A;  4FHJ A;  4ACF A;  1XLO A;  1KLV A;  1E5W A;  3WAN A;  3U7Z A;  5G5G A;  1XT9 B;  2KLG A;  2MW5 A;  3APD A;  3WA0 A;  1WR6 E;  2J0K A;  2LXA A;  4ARI A;  4ZYN A;  2BS2 B;  2WXF A;  3C19 A;  4NZL B;  3R2I A;  2ZNV C;  2IZV B;  2QIL A;  3NOB A;  2V3S A;  2I2Y A;  3BYT B;  3ZJT A;  4YT0 B;  3DVN V;  4J3O D;  4IOI E;  4F8C B;  4HVB A;  3L0W B;  2BF8 B;  3ZNZ B;  1ZDV A;  2JVC A;  3U2S C;  1N62 A;  3EC8 A;  1JW9 D;  2M0X A;  1QT9 A;  3ZIM A;  2KFJ A;  3ML8 A;  4IM0 A;  1YOV B;  5DPR A;  4OZC A;  2QDF A;  2WXO A;  4HRO A;  1D3Z A;  4MT5 A;  3KUC B;  1F2R C;  4P1C C;  5AZG A;  1FCL A;  1QOG A;  1TKE A;  4MGI E;  1CZP A;  4LNN A;  2MCN B;  2KAN A;  1Q1O A;  3WIM A;  5JXV A;  2LVO A;  3AE3 B;  2NBV B;  3OAW A;  2PEA A;  2SEB D;  5I4D A;  1RFA A;  2HTH A;  4JGH B;  4WQM A;  4AP4 C;  2WGS A;  3ZGZ A;  1MHH E;  3RPF C;  3N32 A;  2LWP A;  3ZO5 B;  3KLS X;  1JWU D;  2GBM A;  2A4Z A;  1SGH A;  2L0F A;  1I42 A;  5JHB A;  1E8X A;  1QF6 A;  1V2Y A;  2QCZ A;  2DAJ A;  2KDE B;  4TKN A;  1TT5 B;  2PJH A;  3DBL I;  4MGY E;  4D2K A;  1F2R I;  4FJY A;  2IY0 B;  2A5U A;  3PHX B;  2BYE A;  4G0N B;  4RGN A;  4EOY A;  3Q8F A;  4ANW A;  1WZ3 A;  5G2N A;  1QOB A;  2JX5 A;  3PLU A;  4NJ7 A;  2Q5W D;  3AE1 B;  4GOC A;  1N61 A;  4NJC A;  3W2D A;  2RDB C;  2Y5C A;  3DWM A;  2UWQ A;  3SR6 A;  2PPH A;  2QJL A;  2YEP B;  4MM3 A;  2K9X A;  1E8W A;  2VZK D;  2KD0 A;  3N3K B;  4ARC A;  2MBB B;  1C76 A;  4E3C A;  3ZDT A;  1E0Z A;  4RM8 A;  2ZCC A;  3BVZ A;  3I9V 1;  2MBH A;  4LNF A;  3TUO A;  2DBY A;  3APF A;  4L23 A;  2ONQ A;  2J0M A;  4ZOH C;  4E74 A;  2AQ1 B;  3GP7 A;  1PDX A;  2AYO B;  3RD2 A;  1UBQ A;  3R3M A;  2WDR B;  1FO4 A;  1DOI A;  3SD5 A;  3NVY A;  5BYR A;  3K9O B;  2JZ3 B;  1J7A A;  1EU3 A;  5HHD G;  1WGK A;  3RI7 C;  1G6J A;  2KAC A;  3T3N A;  1JWB D;  1ESF A;  1FXI A;  2LGD A;  3H1U A;  4XGA B;  5HKH A;  1FRD A;  5L83 A;  3PLV A;  1C78 A;  3Q2A C;  3URY A;  2RD0 A;  3P4Q B;  5FKA C;  4CHK A;  4II2 B;  1SE2 A;  3BY4 B;  2JSV X;  3AED B;  1N5W A;  1DYQ A;  4ICU A;  3QIJ A;  2L8J A;  1UWX A;  1I4X A;  2O6V B;  2LZ6 A;  1ET9 A;  4NNJ B;  5D3D A;  3AB5 A;  3LXF A;  2MX2 A;  3UIN B;  1WJ6 A;  3NS1 A;  2BWF A;  3EA6 A;  4FN2 A;  1P0R A;  2GMI C;  4KKI A;  3APC A;  4W9J A;  4AQ7 A;  4MJS B;  3MFG A;  2KFK A;  4PS3 A;  1RWS A;  2L0T A;  2IDY A;  1HTQ A;  2KX0 A;  3AEF B;  2HD5 B;  3V62 A;  3AU5 A;  2WDT B;  4RNA A;  3Q8B A;  4LJP B;  3SEB A;  4ANV A;  3M95 A;  1V8C A;  1XQQ A;  2IJ0 A;  2V0G A;  3VHT C;  3ML9 A;  4W9E A;  3IVF A;  3VTU A;  3FKY A;  1WJU A;  2BS3 B;  2XNA C;  4LCD E;  4A3O A;  4BOS C;  1WXM A;  4OHJ A;  2LMC A;  3M62 B;  1YJI A;  3Q3F A;  1E7V A;  1FXA A;  4ANX A;  2XN9 C;  3DBS A;  5DPT A;  4R3D A;  2BYF A;  2N1W A;  2JF5 A;  3CF6 E;  5TR5 A;  2DZK A;  1V1O A;  3QCA A;  1VCB A;  4XX5 A;  3C8Y A;  3LB8 C;  1FFU A;  2K8B A;  1QZE A;  2LVQ A;  4KZC A;  4ZYS A;  4WUR A;  4FLH A;  3UQA A;  1WWT A;  2UU7 A;  4AJW A;  2BB5 A;  3P42 A;  3B2G A;  3JYU A;  4GGQ A;  4KKJ A;  1R7S A;  1EWY C;  3HIZ A;  1E10 A;  1F0Z A;  1WGY A;  3W5V B;  2N1V A;  4PT5 A;  2KKC A;  3NZ3 A;  3UI3 A;  1H4R A;  4PS7 A;  1ZOY B;  2R2Q A;  2ZEQ A;  3ONS A;  2IGH A;  3L10 B;  3VVW B;  1JQ4 A;  1KH0 A;  1GNU A;  1FMA D;  4NAW B;  1Q5W B;  2R61 A;  2N9E B;  4C56 C;  3SHQ A;  5C1Z A;  2KC1 A;  2C7N B;  5G5H A;  3Q3N C;  1C77 A;  2NCN A;  1WXS A;  3VH4 B;  3GZN B;  3TIX A;  2QC8 A;  2LXC A;  5HI1 A;  5AZH A;  2FCM A;  1C79 A;  3U52 E;  1PYW D;  2ZJD A;  4I6N B;  3C0R B;  4K3B A;  1TZ1 A;  3CSF A;  1WIA A;  2LGS A;  3ZRC A;  4OZB A;  1X1M A;  2WS3 B;  1VR9 A;  3DHH C;  4KDI C;  4TQ0 A;  3RFZ B;  4I6P A;  1HZ5 A;  1OQY A;  2CJN A;  2GI9 A;  3KVF B;  2KTR A;  3HK0 A;  2QHO A;  1TKG A;  1V1P A;  4C4V A;  1ISN A;  1UNS A;  3JW0 X;  2CHX A;  2BT6 A;  1VDV A;  2K6D B;  2KVR A;  5BMI A;  2LFI A;  4W9F A;  2LD9 A;  2CJO A;  1WFY A;  1L0X B;  4XWW A;  5CHF A;  4C7Z A;  2JXX A;  2ASQ A;  2ZPN A;  3CWI A;  4DHJ D;  1WH3 A;  1GC6 A;  3Q14 C;  3I5J C;  2I38 A;  3B2F A;  4KGR A;  4MGK E;  4YSZ B;  2EKE C;  2ZNV B;  3AH7 A;  4HKQ A;  3RUL A;  1MG4 A;  4IWO A;  4FBJ B;  3ALB A;  2G1E A;  1QLB B;  4PK1 A;  1OTR B;  1HEZ E;  1L7Y A;  2L00 B;  4XWT A;  4ZRI A;  4A9A A;  2EKI A;  3W1S A;  4B9K A;  2DNF A;  3A9J B;  5BYS A;  2PE6 B;  4MEM A;  2M56 B;  2D3B A;  1T0Q C;  1P9D U;  2MH7 A;  4KV2 A;  4N6E B;  4BOZ B;  1E8Y A;  3UIP B;  2IYD B;  2RGF A;  3H7S A;  2V3N A;  2CHZ A;  1D5M C;  3AE8 B;  1P98 A;  3NUH B;  2X8X X;  1WMH A;  3IT6 B;  1WXQ A;  2C9W B;  3IAS 1;  3B08 A;  3EGR A;  1EM7 A;  2IO2 B;  4M00 A;  4MDK E;  1L6U A;  1YIW A;  3H7P A;  1GC7 A;  4US9 A;  3P2B A;  1TS4 A;  2ON8 A;  5JZE B;  3GS2 A;  3ZNH B;  4HKZ E;  2K3U A;  1XO3 A;  4FJV B;  3VQI A;  3PHW B;  1GUA B;  4GB9 A;  3V6E B;  2KT7 A;  1S3S G;  4NAM A;  1TJE A;  2N7E A;  4FA6 A;  1M4V A;  2BYT A;  2G3Q B;  3BWU D;  1GJZ A;  1L4Z B;  3X0W A;  1CJE A;  5CHW A;  4GDK B;  3A9K B;  4Q2J A;  5C3J B;  4LNK A;  1KJT A;  1OEY J;  3AV8 A;  1E7P B;  3VFK A;  1LXD A;  1FNV A;  1UGJ A;  2DZI A;  5EE1 A;  4CYE A;  3QWZ B;  1IP9 A;  4NPN A;  3PS6 A;  4P16 A;  1T0R C;  5BMG A;  2K22 A;  3RNG C;  4A8X C;  3MC0 B;  3LYY A;  3NZS A;  1YQ4 B;  1T0Y A;  3VUW A;  3HM3 A;  1GPX A;  2ICI A;  2FCN A;  3AE2 B;  5D2M B;  1C3T A;  2E6X A;  3PRP B;  1WGG A;  4TUU A;  4XE0 A;  2E3T A;  4WJN A;  1JRU A;  1LM8 B;  2DWQ A;  4EKU A;  3V6C B;  3PO0 A;  2ZVO A;  1IGC A;  3W1Y A;  1F9J A;  1WGH A;  1LQB A;  4OVV A;  1NEK B;  2RR9 A;  4BZA A;  1YN5 A;  1JWS D;  2OOB B;  2B3A A;  3P4S B;  1JWM D;  1C9F A;  3EEC A;  2BBC A;  2O2V B;  3IG3 A;  1KLU D;  1ACC A;  4XDC A;  2KDF B;  5EE9 A;  1UH6 A;  4NQK E;  3N1Z C;  1SIF A;  2G4D B;  2WU5 B;  2MHJ A;  4KGT A;  2CR5 A;  1WYW B;  3PTF C;  1XF5 L;  3NVZ A;  3TMP B;  3VAW A;  2BKR B;  3VUY A;  3RZF A;  1AYF A;  2MSE D;  4C7Y A;  4JWU C;  3VUX A;  1TYG B;  4MH0 E;  4M0W B;  4I6L B;  3RUI B;  5G55 A;  3Q3J A;  4N59 A;  4LDT D;  1MPE A;  4DBG A;  1I4Q A;  3GZN I;  4W9I A;  1P3Q U;  3UIO B;  3VR8 B;  1MG8 A;  2L83 A;  3KW5 B;  2PIA A;  1T6B X;  4ZDV A;  3JVZ X;  1WJ4 A;  3PZ7 A;  4BKG A;  1N5X A;  2INC C;  1R4M B;  2M1M A;  2RPV A;  2MJE A;  4HXD A;  4ASW C;  2IND C;  1HQR D;  1L0Y B;  4LNI A;  3A4R A;  1WX7 A;  5IO9 A;  2JWZ A;  3TEY A;  1HXY D;  3PGE A;  5KHQ A;  1Q10 A;  2KTF A;  2JWU A;  4EFO A;  1JWA D;  4PYZ A;  1U4A A;  1ZGU B;  1KLG D;  3LDZ E;  4KDL B;  1VRA B;  3IT4 B;  2AQ2 B;  3W9C B;  2MBQ A;  4HJK A;  1H8C A;  4USA A;  3AE7 B;  4FXC A;  3TEX A;  3V05 A;  1JCK B;  2N4F A;  1DGJ A;  4WIP A;  2KWD A;  1IPG A;  1WXV A;  1SJH D;  1WE6 A;  2M19 A;  3HVZ A;  3BK1 A;  2N9X A;  3ZNG C;  3PPA A;  1J0G A;  1IYF A;  4RF1 A;  4JWS C;  4A20 A;  5LXI B;  3AEE B;  4QAY A;  1V80 A;  1P7F A;  2PE9 A;  1WE7 A;  3SU8 X;  2ZW0 A;  2V4L A;  4NQL B;  3KWL A;  3BII D;  3ZXR A;  2XK5 B;  1ZP0 B;  4C00 A;  1D4B A;  3FC4 A;  4X57 B;  4KIK B;  1E9M A;  2LGX A;  1V9J A;  1VZ6 A;  2M17 A;  1YJ1 A;  4YWG G;  2DZM A;  3BVG A;  1EF5 A;  2KX3 A;  1HZ6 A;  2NTT A;  5E6N A;  3MJ5 A;  3PSE B;  2K5P A;  2GLS A;  4RCO A;  2KK8 A;  1N63 A;  3RNB C;  1V5T A;  4G11 A;  1GB4 A;  2I1K A;  5JHA A;  3PZD A;  4RGM A;  4DXG A;  1XCQ L;  5AZF A;  1WYG A;  3QA8 A;  4CQN A;  4WAA A;  3RNA C;  3T8M A;  3DVG X;  1MJD A;  1K8R B;  3AE9 B;  3JSV B;  4AS1 A;  2WQY B;  2JPH A;  5FK9 C;  5L95 C;  3MC8 A;  3OJ4 B;  5E6O A;  3SDL C;  4BKT A;  1P1A A;  2K39 A;  1B1Z A;  2BTE A;  3IAM 1;  2PMV A;  5IP4 D;  2HJ1 A;  3BVM A;  2LRU A;  3V3X A;  1NDD A;  3A1Q B;  1ZXI A;  3NRZ A;  2D3A A;  2KO3 A;  4HEA 1;  2LRW A;  2N0S B;  2KC2 A;  4IW0 A;  2KDB A;  1OFF A;  3NVW A;  4IM3 A;  1KM7 A;  2V4I B;  2MA9 B;  1E8Z A;  4IWP A;  2LEK A;  4OVZ A;  2KN5 A;  3MHS D;  1YQ3 B;  4RM9 A;  5EDS A;  4M8M A;  2WXI A;  4WH4 A;  1VJK A;  3KYD D;  1WGD A;  4XYC A;  2WU2 B;  5FR6 A;  2D3G A;  2O6V A;  2LHD A;  4ZRP A;  2KXJ A;  1OGW A;  1WM3 A;  4WJP A;  4BFR A;  2H89 B;  2WXP A;  2JYE A;  4GXB A;  2IGG A;  4DWF A;  3MTN B;  2KDI A;  4MJS A;  3RNC C;  1WZ0 A;  3UGB B;  2RPQ A;  3IXS A;  3Q3M C;  1UBI A;  4EE2 A;  4XZ4 A;  4HLE A;  5CX3 A;  4S0R A;  4EEW A;  1V5O A;  2K1F A;  2PTL A;  3R66 C;  2NVU I;  1R4N B;  2MWS B;  2DYM A;  2NBW B;  2MP2 B;  4II3 B;  4GDL B;  3SFE B;  2TSS A;  3IBE A;  4KX6 B;  2MLB A;  1YX5 B;  3ZRF A;  2JZP A;  1R4M I;  3W5U B;  3BYY B;  1SE4 A;  3P1M A;  2J53 A;  3O13 A;  4ZHP A;  2FID A;  4N58 A;  4PS8 A;  3B0A A;  4G3X B;  3EUB 2;  2Z8L A;  4JX1 C;  1KOT A;  1LO5 D;  2FNJ B;  1D6E C;  2DX5 B;  2HJ8 A;  1WR1 A;  1RYJ A;  4KGS A;  4JQW C;  1VZ7 A;  1PGX A;  1HA5 A;  3DHG C;  4IDI A;  2JT4 B;  3L16 A;  3ZQ4 A;  1SSN A;  4RFB A;  4RF0 A;  3AN1 A;  4TQ1 A;  3OG5 A;  4B6W A;  1KFY B;  1ZUD 2;  1UEL A;  3B1L X;  1TZO A;  2KWU B;  2FAZ A;  2IO1 B;  3R8B A;  2JU6 X;  2WXL A;  3PZ8 A;  5AUI A;  1YD8 U;  3OLM D;  1FPY A;  4DHZ E;  4NAW A;  3RYT A;  3H9D A;  1WGR A;  1C4P A;  1RLF A;  1Z5S B;  1J7C A;  3FAH A;  2FCQ A;  2FE8 A;  2LAS A;  1UZX B;  3KWV A;  4S17 A;  4K1R B;  2VZK B;  3O65 B;  4XDD A;  4US8 A;  3MHZ A;  4IUM B;  5IN7 A;  1YX6 B;  1TGZ B;  2D3C A;  4IM2 A;  5T8I A;  1T3Q A;  1KRH A;  2PLP A;  5CTR C;  5EE0 A;  2UYZ B;  2MJD A;  3DHI C;  1F1H A;  1YJJ A;  1TS3 A;  3BK2 A;  1K51 A;  1J19 A;  2PVG C;  4TV3 A;  4IC7 B;  3VTW A;  5J17 A;  4HJG E;  3HHM A;  3AE6 B;  2AQ3 B;  3VRB B;  2K8C A;  2KJR A;  1PQS A;  2N9K A;  1IUE A;  2NR2 A;  3M63 B;  2WP9 B;  3ZTD A;  2KLC A;  1MI0 A;  1GOZ A;  1XLN A;  1T5X D;  4O1N A;  4ZRK A;  2BPS A;  2KTR B;  4URK A;  2BQQ A;  2FUH B;  1I4R A;  5DPS A;  2GBJ A;  1E90 A;  3Q8C A;  3VXW A;  3VRA B;  3PRE A;  2JY6 A;  4W9D A;  2RMM A;  3MC9 A;  1NBF C;  3A4S C;  2HDE A;  2C7M B;  4P7I A;  4KSL C;  4FJZ A;  3L17 A;  1F77 A;  1HE8 A;  3A9J A;  2LGI A;  4M8N A;  2Y5P A;  2RDH A;  4M02 A;  3TEW A;  3LJ3 A;  2KQS A;  3KUZ A;  3E9S A;  1FXT B;  3TSS A;  4A3P A;  1C4C A;  4AWJ A;  1V97 A;  4HWI B;  4A90 A;  3AM9 A;  3KUD B;  3MJW A;  2V1Y A;  1N60 A;  2GOW A;  4HDO A;  2GRI A;  3SFD B;  3CIR B;  3RMK C;  3WAL A;  2AEH A;  1ZKH A;  3DVG Y;  3U8Z A;  2DHZ A;  2DYB A;  1PGB A;  2JRI B;  3DDC B;  1XLP A;  4DQO C;  2D07 B;  2WYQ A;  1N6Z A;  2KYW A;  4K7U A;  5DPW A;  1WY8 A;  4W9L A;  2GB1 A;  2X38 A;  4DDG D;  2KWC A;  2N9L A;  4GDK A;  5AUK A;  2NPT B;  3A9K A;  2BYV E;  1L5P A;  1R4N I;  4B0E A;  1GAQ B;  2C5L C;  4WQO B;  1FEH A;  4IG7 B;  3UF8 A;  3KYC D;  4ZHO A;  1WM2 A;  1NEN B;  1CK1 A;  3KQ4 A;  4BBN F;  1NI2 A;  4IKG A;  4AOF A;  3N1Y C;  3T3O A;  2KMA A;  4UDU C;  2WHI A;  1V6E A;  1S1Q B;  2WXK A;  4MGZ E;  4E71 A;  3HVD A;  3QAR A;  2QSD A;  5GMV A;  1FIQ A;  3DQV A;  1TS2 A;  3I3T B;  1J7B A;  3WAO A;  4YTN B;  2O2V A;  4HCN B;  3IHP C;  2CHW A;  4ICV A;  2MRP A;  1GG3 A;  3HM6 X;  1STE A;  2BKF A;  2N9P C;  4LNO A;  3R7R A;  2MBE A;  2WXG A;  2WXR A;  4YTM B;  1WRI A;  5JH5 C;  4DK5 A;  4J6I A;  4K7W A;  2WX0 A;  2GBR A;  2KQ4 X;  3PRZ A;  4L2Y A;  4JL9 A;  4IWQ A;  2W3R A;  4TSS A;  1NVI D;  2NMQ A;  1YMH E;  3TJP A;  2ZZP B;  1EF1 A;  4WJQ A;  2VH1 A;  1VD2 A;  4M0W A;  2FIF A;  4C80 A;  1XXG A;  1P7E A;  3RNF C;  2J42 A;  2YLM A;  4KZ0 A;  4WWN A;  2C60 A;  3FIL B;  1XCT L;  1E6E B;  3DBR B;  2LGY A;  1IBX B;  3OJ3 A;  3QHT A;  1GB1 A;  2W9N A;  1C1Y B;  3R7Q A;  3AUL A;  4YTP B;  1WX8 A;  3AMZ A;  2CU1 A;  1BML C;  2D10 A;  2NTS A;  1WXA A;  4DHJ B;  1QOF A;  3RZW C;  2MEK A;  2QEJ C;  2WDQ B;  3ZVV A;  1K50 A;  2KVZ A;  1CMX B;  2JYT A;  3ZNI D;  4N9F 4;  1EUV B;  3I57 A;  1AN8 A;  3BZD B;  4KVG B;  5AEK B;  4B95 A;  2JRH A;  2O6V D;  2C7H A;  2FCS A;  5D94 A;  1SE9 A;  1MFW A;  5LNK 1;  1OEY A;  2CKH B;  2M8S A;  4GN1 A;  1TTN A;  3Q3O C;  4BKS A;  3AE5 B;  3W1S C;  3I63 C;  1L0V B;  3ETR A;  1ZE3 D;  3OWE B;  1A5R A;  5LLI A;  4GMV A;  3QK0 A;  1JAL A;  2KZR A;  1K53 A;  1SBB B;  4OZA A;  3L08 A;  3ENE A;  4HCP B;  4GSW A;  4W9C A;  2L32 A;  3BIN A;  5HG2 A;  3L4P A;  2KHW B;  3V61 A;  2ZPY A;  3DVN U;  3DWG C;  2HTM E;  5H92 C;  2N7J A;  3DBH I;  2D2Q A;  3R2T A;  3N1X C;  3PT2 B;  4HK2 A;  2XK5 A;  1V86 A;  5IKC M;  1TBE A;  2WWZ A;  4KIK A;  1SF0 A;  1UWM A;  4H2A A;  5J2R A;  1Y8R C;  2WXQ A;  2BS4 B;  1XD3 B;  2WXH A;  1CQV A;  1QIL A;  2KN4 A;  2V3P A;  2K8H A;  1WSP A;  3ZLZ A;  4B0M A;  4MSM B;  3A33 B;  4HDQ A;  3WAP A;  3P63 A;  4YSX B;  2CS4 A;  1I4G A;  1QQR A;  3AI5 A;  1TKY A;  2L76 A;  1A70 A;  2V9H A;  2GBN A;  1OQR A;  2G45 B;  4F7Z A;  2KMM A;  3N30 A;  1NI3 A;  2LVP A;  3DOW A;  1PFD A;  1TS5 A;  3P4P B;  1TY2 A;  3JSV A;  1JRO A;  2I1J A;  2WXM A;  3DPD A;  2IPK D;  4OVU A;  1JRP A;  2AL6 A;  4WWM A;  3NG0 A;  3K9P B;  2RSU A;  2K6Q A;  3A1Q A;  1FNW A;  4G50 A;  5BO4 B;  3ZW3 A;  2IO0 B;  4BVU C;  5DCN A;  2JXT A;  3U7D A;  1D5X C;  2QIE B;  1AAR A;  1FCC C;  4AJY B;  4MM3 B;  2LJI A;  3M3J A;  1SIJ A;  1WI0 A;  2JUO A;  5TSS A;  3NJT A;  2AL3 A;  3S2A A;  2GBK A;  3ZJV A;  1WF9 A;  2BGF A;  2FUG 1;  1ROE A;  3WAM A;  1ET6 A;  3AU4 A;  5CHV C;  1HTO A;  2DLB A;  1BUI C;  4LDT B;  1FFV A;  4WAF A;  4HPL B;  3GE8 C;  1TIF A;  4A6Q A;  2WXJ A;  1OQQ A;  1UD7 A;  2B76 B;  1JML A;  3EFU A;  1J8C A;  1WJN A;  2ZVN A;  3N20 C;  3CST A;  4GLS C;  2VH2 A;  2SAK A;  2NBU A;  3ZKJ C;  1V81 A;  3IFW B;  3ECI A;  2L3Z A;  1MHX A;  1ENF A;  1BT0 A;  5C2T B;  5C23 A;  2RDG A;  2EMS A;  4HPM B;  2MP2 A;  4GDL A;  1SEB D;  4P6V F;  1B9R A;  1DOX A;  2W55 A;  1NYR A;  3DBR I;  4K3C A;  2LJ5 A;  2Z0E B;  2L7R A;  4FHK A;  3DCG A;  2W54 A;  5IAA C;  2BB6 A;  2L52 A;  1L4D B;  4K7S A;  1ZDX A;  2INP E;  3Q8E A;  3AXC A;  1XLQ A;  2K25 A;  2W82 A;  1E7U A;  5IA7 A;  2J7Q B;  1L2N A;  2M4N A;  2KFK B;  3MP9 A;  1I4P A;  3ZJU A;  3D32 A;  3J9C A;  4ZRQ A;  1UF0 A;  1XEE A;  1SE3 A;  2PVO D;  3P4R B;  4YL8 A;  4MSQ B;  5FR3 A;  2KJ6 A;  2G4S A;  1ZPS A;  3H8H A;  3AE4 B;  2OED A;  1WX9 A;  2EEL A;  4EUT A;  2WX1 A;  4OW0 A;  1LGR A;  3VTV A;  1FD6 A;  1KF6 B;  4RMA A;  1YN4 A;  2WDV B;  2H88 B;  4FUL A;  2J52 A;  1KTK A;  2LUM A;  1T0S C;  1WRD B;  2EMT A;  1UGM A;  2KQ7 A;  1ZW7 A;  3NY5 A;  1IGD A;  2MJ3 A;  4BBN C;  3HRD D;  3U30 A;  1I4H A;  2BW2 A;  2OHF A;  5HFY A;  2JQR B;  3AEC B;  3TEZ A;  3HUI A;  2VRR B;  4ANU A;  1LFD A;  4LTU A;  2BVC A;  4HRS A;  2PW9 A;  3Q69 A;  2ZCB A;  5E6J A;  5BMH A;  4F1S A;  1FM0 D;  1Z2M A;  4WWP A;  1RRB A;  4YSY B;  2FBW B;  1PGA A;  1SXT A;  3PVL A;  2WLB A;  4FAD A;  2KJH B;  3VH3 B;  3NVV A;  2KMC A;  1I35 A;  2LHE A;  2J4X A;  1YNT E;  1PUT A;  2OJW A;  4HPP A;  2D11 A;  1RAX A;  4DDI D;  2DEN B;  5D3I B;  4MH8 A;  4EZK A;  5KHO A;  3AEG B;  2WNM A;  4BAX A;  4RGO S;  3TL5 A;  4AUQ C;  3NS8 A;  2K0P A;  2KWV B;  3PRM B;  4W9H A;  4YXD B;  3VDZ A;  4PYU A;  4REZ A;  4CO7 A;  2G9H D;  2MBO A;  4GIV A;  2IBI B;  2XEW A;  4DHZ B;  2L1A A;  3V60 A;  3KH0 A;  1EU4 A;  1BXT A;  2D5G A;  1VZ8 A;  2QMT A;  2W3S A;  1V1P B;  1L6V A;  2XBB C;  4C4V B;  3L54 A;  2INN E;  3Q6B A;  2KAJ A;  2LI5 A;  3TCA A;  1MVK A;  1V49 A;  2KOX A;  3ZDM C;  3NHE B;  1VLB A;  3H6N A;  3E56 A;  2MQJ A;  3QC8 B;  4MAC A;  1UUP A;  2Z59 B;  1RFK A;  3RT3 B;  4EZJ A;  2PKO A;  1I7H A;  3WCQ A;  3DBH B;  3RNE C;  1EWC A;  1DOY A;  3ZTC A;  3QX1 A;  4A55 A;  4EZL A;  3PV1 A;  2R2O A;  3X23 A;  3NZU A;  3UQB A;  4DXF A;  4LJO B;  3RN9 C;  1ZXH A;  2Z0D B;  3GE3 C;  4MEL A;  2AWT A;  4JE3 B;  3ZUN A;  3N9Y C;  3B9J A;  2Y3A A; 
#chains in the Genus database with same CATH homology
 3P42 A;  4L1B A;  1B1Z A;  1QOF A;  3B2G A;  4KKJ A;  2BTE A;  2MEK A;  2QEJ C;  3IAM 1;  2WDQ B;  2AX5 A;  1K50 A;  1R7S A;  2PMV A;  1EWY C;  3VR9 B;  3ZYY X;  1E10 A;  2JYT A;  1F0Z A;  3W5V B;  4PT5 A;  3BVM A;  2DYO A;  1QOA A;  3I57 A;  3NZ3 A;  3V3X A;  1AN8 A;  3UI3 A;  3BZD B;  5EE3 A;  1ZXI A;  3NRZ A;  1ZOY B;  3U4E G;  2IGH A;  5GXG B;  1D5Z C;  2M0A A;  4HEA 1;  1NYQ A;  1JQ4 A;  1KH0 A;  2N0S B;  5MPO A;  1FMA D;  4NAW B;  1OFF A;  1Y56 A;  5LNK 1;  2R61 A;  3NVW A;  2V4I B;  4C56 C;  4OVZ A;  2LEK A;  3AE5 B;  5G5H A;  1YQ3 B;  1C77 A;  1L0V B;  3ETR A;  2WXI A;  4LK0 M;  1ZE3 D;  4WH4 A;  1SJE D;  1VJK A;  3OWE B;  5HI1 A;  2WU2 B;  4RH6 A;  1JAL A;  2LHD A;  1C79 A;  4ZRP A;  1PYW D;  3U52 E;  1K53 A;  1SBB B;  4OZA A;  1AWD A;  4JPS A;  2H89 B;  2WXP A;  1FRR A;  4OZB A;  2JYE A;  2L32 A;  4LLG M;  2WS3 B;  1VR9 A;  4TQ0 A;  2IGG A;  3RFZ B;  5HG2 A;  3L4P A;  4TMA B;  1HZ5 A;  5H8Y E;  1AW7 A;  2CJN A;  3DWG C;  3IXS A;  2GI9 A;  2HTM E;  5H92 C;  2N7J A;  1TKG A;  3R2T A;  4EE2 A;  1V1P A;  4RGT A;  1UNS A;  2BT6 A;  1RM6 C;  1VDV A;  2PTL A;  1SF0 A;  1UWM A;  1YN3 A;  5BMI A;  4H2A A;  2ZW1 A;  1C4A A;  2DYM A;  2LFI A;  2WXQ A;  4GDL B;  2BS4 B;  5D7G A;  2TSS A;  3SFE B;  2KDM A;  2WXH A;  2WXN A;  2KN4 A;  1CQV A;  1QIL A;  1TY0 A;  2YEP F;  2CJO A;  2V3P A;  1L0X B;  5BYQ A;  1WSP A;  4XWW A;  4KX6 B;  4C7Z A;  2JZP A;  3GB1 A;  1SB3 C;  4B0M A;  3W5U B;  3BYY B;  3CWI A;  1SE4 A;  3P1M A;  2J53 A;  3O13 A;  3P63 A;  4YSX B;  4ZHP A;  1I4G A;  1QQR A;  2I38 A;  3Q8A A;  4N58 A;  3ABV B;  2ACZ B;  1TKY A;  1K52 A;  3B2F A;  1A70 A;  3AEA B;  4KGR A;  1FNU A;  3EUB 2;  3FIL A;  2Z8L A;  4YSZ B;  1OQR A;  4JX1 C;  3AH7 A;  3AEB B;  1LO5 D;  4HKQ A;  1IBX A;  2KMM A;  2CU3 A;  1D6E C;  1NI3 A;  1PFD A;  1TS5 A;  3P4P B;  4ITK A;  1TY2 A;  2G1E A;  1QLB B;  2IGD A;  1JRO A;  1HEZ E;  2WXM A;  1RYJ A;  1QKZ A;  4XWT A;  4A9A A;  4KGS A;  2EKI A;  3W1S A;  1VZ7 A;  2IPK D;  1XLO A;  1PGX A;  1HA5 A;  5BYS A;  2M56 B;  1JRP A;  4IDI A;  3ZQ4 A;  1SSN A;  2MH7 A;  3U7Z A;  4N6E B;  4RFB A;  4RF0 A;  5G5G A;  4WWM A;  3AN1 A;  4TQ1 A;  2V3N A;  4ARI A;  1FNW A;  1KFY B;  1ZUD 2;  1D5M C;  3AE8 B;  2NTS A;  2BS2 B;  3NUH B;  2WXF A;  2JXT A;  3IT6 B;  1TZO A;  1WXQ A;  3IAS 1;  3EGR A;  1EM7 A;  3R8B A;  4NZL B;  3R2I A;  1D5X C;  2JU6 X;  2WXL A;  3PZ8 A;  5AUI A;  1L6U A;  2QIL A;  2QIE B;  1FCC C;  4MM3 B;  2LJI A;  2I2Y A;  1SIJ A;  3BYT B;  4US9 A;  3ZJT A;  1TS4 A;  1C4P A;  5TSS A;  4YT0 B;  4J3O D;  2ON8 A;  4IOI E;  3ZJV A;  3GS2 A;  4HKZ E;  1J7C A;  2FUG 1;  2K3U A;  1ROE A;  1XO3 A;  1ZDV A;  3VQI A;  3FAH A;  1ET6 A;  3U2S C;  1N62 A;  1JW9 D;  1QT9 A;  2FE8 A;  4NAM A;  4OZC A;  2DLB A;  1BUI C;  3KWV A;  1TJE A;  1FFV A;  2WXO A;  4HRO A;  1M4V A;  4WAF A;  2BYT A;  4MT5 A;  4A6Q A;  2WXJ A;  1OQQ A;  1F2R C;  2B76 B;  1L4Z B;  3BWU D;  2VZK B;  1JML A;  1FCL A;  1QOG A;  4XDD A;  1TKE A;  1CJE A;  4US8 A;  3MHZ A;  1CZP A;  4GDK B;  4Q2J A;  5C3J B;  4GLS C;  5JXV A;  3AE3 B;  5T8I A;  3AV8 A;  1E7P B;  1T3Q A;  2SAK A;  1FNV A;  1UGJ A;  5EE1 A;  1KRH A;  2PLP A;  5EE0 A;  2MJD A;  1MHX A;  1ENF A;  1YJJ A;  1TS3 A;  3BK2 A;  1K51 A;  2SEB D;  4P16 A;  5I4D A;  2PVG C;  5C2T B;  5BMG A;  4WQM A;  2K22 A;  4A8X C;  2RDG A;  3MC0 B;  3LYY A;  3ZGZ A;  1YQ4 B;  1MHH E;  3RPF C;  1GPX A;  4HJG E;  3KLS X;  2ICI A;  1JWU D;  1SEB D;  3AE2 B;  3AE6 B;  4P6V F;  1B9R A;  2E6X A;  1DOX A;  2AQ3 B;  3VRB B;  4XE0 A;  2E3T A;  2W55 A;  1NYR A;  2DWQ A;  2N9K A;  1IUE A;  3PO0 A;  1QF6 A;  1IGC A;  2WP9 B;  2W54 A;  2BB6 A;  2L52 A;  1L4D B;  1MI0 A;  1GOZ A;  1XLN A;  1T5X D;  1ZDX A;  1NEK B;  4O1N A;  1YN5 A;  1JWS D;  2INP E;  3Q8E A;  1XLQ A;  2W82 A;  3P4S B;  1JWM D;  1C9F A;  1I4R A;  3Q8C A;  2BBC A;  3MP9 A;  1I4P A;  3VRA B;  2RMM A;  4D2K A;  3ZJU A;  2HDE A;  1F2R I;  3J9C A;  1KLU D;  4ZRQ A;  1ACC A;  1XEE A;  4XDC A;  5EE9 A;  1SE3 A;  4RGN A;  2PVO D;  3P4R B;  2WU5 B;  3Q8F A;  1F77 A;  4KGT A;  5FR3 A;  3N9Y C;  1QOB A;  1ZPS A;  2LGI A;  3H8H A;  2JX5 A;  1XF5 L;  3AE4 B;  3NVZ A;  2Y5P A;  2OED A;  2EEL A;  2Q5W D;  4OW0 A;  1AYF A;  3AE1 B;  2RDH A;  1FD6 A;  1KF6 B;  4C7Y A;  4JWU C;  3TEW A;  1YN4 A;  2WDV B;  1N61 A;  1TYG B;  2H88 B;  4NJC A;  3W2D A;  3E9S A;  2Y5C A;  2J52 A;  3TSS A;  1C4C A;  1KTK A;  4N59 A;  2LUM A;  1MPE A;  3DWM A;  1V97 A;  1I4Q A;  1IGD A;  2MJ3 A;  3SR6 A;  3VR8 B;  3HRD D;  2L83 A;  2QJL A;  2YEP B;  4A90 A;  2PIA A;  1T6B X;  2K9X A;  3PZ7 A;  2VZK D;  1N5X A;  3AM9 A;  4ARC A;  1I4H A;  2BW2 A;  2OHF A;  5HFY A;  1C76 A;  1N60 A;  2RPV A;  1E0Z A;  2JQR B;  3I9V 1;  3BVZ A;  3AEC B;  2GRI A;  3TUO A;  2MJE A;  3TEZ A;  3HUI A;  2DBY A;  1HQR D;  3SFD B;  3CIR B;  4L23 A;  2ONQ A;  4LTU A;  4ZOH C;  1L0Y B;  2AQ1 B;  2PW9 A;  3GP7 A;  3Q69 A;  4HRS A;  5E6J A;  1PDX A;  5BMH A;  1PGB A;  1FM0 D;  3TEY A;  1XLP A;  1HXY D;  4DQO C;  1Q10 A;  2JWU A;  4YSY B;  2FBW B;  1PGA A;  1SXT A;  1JWA D;  2WDR B;  2GB1 A;  2WLB A;  2X38 A;  1KLG D;  1DOI A;  1FO4 A;  2N9L A;  3NVV A;  3NVY A;  5AUK A;  1VRA B;  3IT4 B;  2AQ2 B;  5BYR A;  3W9C B;  1L5P A;  2LHE A;  4B0E A;  1GAQ B;  2J4X A;  1J7A A;  1EU3 A;  1YNT E;  1WGK A;  5HHD G;  2KAC A;  3T3N A;  1JWB D;  4USA A;  1ESF A;  1FXI A;  1PUT A;  3AE7 B;  4FXC A;  1FEH A;  3TEX A;  3V05 A;  1FRD A;  1JCK B;  4ZHO A;  1C78 A;  3URY A;  5D3I B;  3P4Q B;  5FKA C;  1NEN B;  4MH8 A;  1CK1 A;  1SE2 A;  3KQ4 A;  1DGJ A;  3AEG B;  2WNM A;  2JSV X;  3AED B;  4RGO S;  1N5W A;  4IKG A;  4WIP A;  1DYQ A;  2KWD A;  3T3O A;  4UDU C;  2K0P A;  1SJH D;  1UWX A;  2WXK A;  1I4X A;  3HVD A;  4YXD B;  2QSD A;  1ET9 A;  2M19 A;  3HVZ A;  4REZ A;  2G9H D;  1FIQ A;  3BK1 A;  5D3D A;  3AB5 A;  3LXF A;  1TS2 A;  2L1A A;  3NS1 A;  1J7B A;  3EA6 A;  4RF1 A;  4JWS C;  4KKI A;  1EU4 A;  4AQ7 A;  3AEE B;  3MFG A;  1BXT A;  1P7F A;  4YTN B;  1RWS A;  2IDY A;  2ZW0 A;  2D5G A;  3AEF B;  1VZ8 A;  2QMT A;  2W3S A;  1STE A;  1L6V A;  1V1P B;  3BII D;  3KWL A;  4RNA A;  3Q8B A;  1ZP0 B;  3SEB A;  2INN E;  1D4B A;  2KAJ A;  1V8C A;  2WXR A;  2WXG A;  3FC4 A;  4YTM B;  2IJ0 A;  1E9M A;  1MVK A;  1WRI A;  2V0G A;  1VZ6 A;  4YWG G;  3BVG A;  1VLB A;  3E56 A;  2KQ4 X;  2XNA C;  2BS3 B;  1HZ6 A;  4L2Y A;  2NTT A;  4MAC A;  2W3R A;  4TSS A;  1UUP A;  1NVI D;  2NMQ A;  1YMH E;  3MJ5 A;  1RFK A;  4OHJ A;  2K5P A;  2LMC A;  2PKO A;  4RCO A;  1YJI A;  1I7H A;  1FXA A;  1N63 A;  4M0W A;  3WCQ A;  4C80 A;  1XXG A;  1P7E A;  2XN9 C;  1EWC A;  2J42 A;  1GB4 A;  4R3D A;  1DOY A;  4RGM A;  3FIL B;  4DXG A;  4A55 A;  1XCT L;  1XCQ L;  1E6E B;  1V1O A;  1WYG A;  4CQN A;  1IBX B;  4DXF A;  1GB1 A;  1ZXH A;  3AE9 B;  4YTP B;  3C8Y A;  3LB8 C;  4AS1 A;  1FFU A;  3AMZ A;  2WQY B;  5FK9 C;  4ZYS A;  1BML C;  4JE3 B;  4WUR A;  1WWT A;  3B9J A;  2Y3A A;  2BB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...