2Q5WD

The x-ray crystal structure of molybdopterin synthase from staphylococcus aureus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
b'MKVLYFAEIKDILQKAQEDIVLEQALTVQQFEDLLFERYPQINNKKFQVAVNEEFVQKSDFIQPNDTVALIPPVSGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdopterin-converting factor subunit 2
publication title Crystal structure of a molybdopterin synthase-precursor Z complex: insight into its sulfur transfer mechanism and its role in molybdenum cofactor deficiency.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 19
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2007-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2q5wD00
2JQRB 2M19A 1R7SA 4ZHPA 1YQ4B 2G1EA 1FXIA 1NYQA 3FC4A 1L5PA 1SF0A 2N0SB 1QOAA 5MPOA 2MH7A 3AH7A 3FAHA 5GXGB 1KRHA 3AE1B 3HUIA 2KAJA 1QOGA 4YXDB 1NEKB 1KF6B 1FMAD 1VLBA 3AM9A 4A9AA 2DBYA 2Y5CA 1RYJA 1TJEA 2H89B 5EE3A 2CJOA 2MJ3A 2K22A 3DWMA 2JX5A 3NRZA 4N58A 4WWMA 1XLQA 2M56B 3AE4B 1JRPA 4YSZB 3W9CB 3SFDB 1E6EB 1E10A 5G5HA 1DGJA 1XLPA 3AE3B 1WXQA 1L0VB 2Q5WD 2W55A 1TYGB 1ROEA 2PVOD 2QJLA 4US9A 1FFVA 3AE2B 1B9RA 5AUKA 1OQQA 1QOFA 1NVID 1SIJA 2WU2B 1A70A 1RWSA 5C3JB 1FXAA 1NENB 1RFKA 4ITKA 1KFYB 3HRDD 2FBWB 4HROA 4USAA 4C7ZA 1QF6A 2PVGC 1N62A 1VDVA 3CWIA 2WP9B 3LB8C 5C2TB 1FM0D 3AN1A 1J7BA 2WU5B 4JWSC 3VRAB 3ZYYX 4ZHOA 1E0ZA 2WDRB 1JWBD 1DOXA 1XO3A 3WCQA 1RM6C 4P6VF 3VRBB 1L6VA 3AE8B 3AEAB 1WWTA 4C7YA 2WDVB 3HVZA 1ZOYB 5H92C 1FRDA 4WQMA 1N5XA 3P4QB 3EUB2 2EKIA 1TKEA 2BS4B 5EE0A 3NVZA 1GPXA 3RPFC 1UWMA 1JALA 2H88B 4LTUA 3VR9B 4N59A 1N60A 1PUTA 1T3QA 3W5UB 2BT6A 3P63A 1YJJA 1FFUA 1SB3C 2W3SA 1QLBB 1JQ4A 2WDQB 1L6UA 4IDIA 1FO4A 3PO0A 2CJNA 1IUEA 1E9MA 3AE9B 1N5WA 3P4PB 1FRRA 2PKOA 1WRIA 5G5GA 1YJIA 5H8YE 3SR6A 3LXFA 1V8CA 3BIID 3DWGC 1AYFA 1ZUD2 3NS1A 1F0ZA 4YT0B 1AWDA 4YTNB 1OQRA 1XLNA 1DOIA 1JW9D 1ZXIA 1JROA 2B76B 1XLOA 1PDXA 2LEKA 2E3TA 3AEGB 1QOBA 4KX6B 4HRSA 5EE9A 4C80A 1I7HA 1QT9A 1TKYA 3AEEB 3P4SB 2W54A 3P4RB 4YSYB 1DOYA 3ETRA 2HTME 2QIEB 1PFDA 3B9JA 1CJEA 1J7CA 3NVYA 3NVWA 3B2FA 3CIRB 3ABVB 1JWAD 1TKGA 2WLBA 3AEDB 4YTMB 2K9XA 1WYGA 3AECB 5AUIA 2L52A 2KMMA 3SFEB 2MJEA 3W5VB 2L83A 1EWYC 3AEFB 2BS3B 2OHFA 2AX5A 4JX1C 3VR8B 3AEBB 4ZOHC 3NVVA 4YSXB 2WQYB 1E7PB 2DWQA 1NI3A 3KWLA 1FIQA 1GAQB 3AE7B 1N61A 3AB5A 3AE6B 3P1MA 3L4PA 4N6EB 2WS3B 4JWUC 1YQ3B 2K5PA 3AMZA 5EE1A 2BS2B 1NYRA 2CU3A 2ACZB 1OFFA 1ZP0B 3B2GA 1N63A 4YTPB 2MJDA 1CZPA 1J7AA 1VJKA 2W3RA 2PIAA 3AE5B 1WGKA 4FXCA 1V97A 3AV8A 4US8A
chains in the Genus database with same CATH superfamily
1YQ4B 1L5PA 1SF0A 1UELA 5D3IB 3FAHA 3RNCC 3KYDD 4W9CA 4BAXA 3BWUD 2L0FA 1OTRB 2G45B 1X1MA 4IM3A 4DHZB 4HJKA 5IAAC 2PVOD 1ENFA 1KOTA 4KGSA 2GBJA 4FLHA 3EECA 4L2YA 4A6QA 1GB4A 2MEKA 1EWCA 1VCBA 3PPAA 5IOIA 4C4VB 1FRDA 2KVZA 2O6VD 3JYUA 4N59A 4LNIA 3W5UB 4TQ0A 4HVBA 2JWZA 3NG0A 1J8CA 2KN4A 2L7RA 3H7PA 1E8ZA 1PGBA 2INDC 1GNUA 2BW2A 1WJNA 3CSTA 3SD5A 2JSVX 2KTRA 2LZ6A 1SE9A 3PRMB 2VZKB 4C80A 5BMGA 3DBHB 4KVGB 3B9JA 1I4GA 4DHJD 3AULA 3VAWA 5JHAA 1GOZA 1T5XD 2LVPA 2DWQA 4E3CA 4AQ7A 1N61A 1WGDA 1YNTE 4PK1A 2JY6A 1WR6E 2NTSA 1BUIC 5HG2A 3Q2AC 4LNNA 2WXKA 3WAPA 3QQ8B 2M19A 3FC4A 5DPTA 1VZ6A 1XT9B 3A1QB 3V62A 4GXBA 4A55A 4OVZA 2KLCA 4G50A 2WWZA 1WX8A 3PLVA 3HHMA 2LGIA 1V80A 2Y5CA 1RYJA 2K22A 5BYSA 2KJRA 4A90A 3NS8A 3RYTA 3OG5A 2LJIA 2Q5WD 1SJHD 2N1WA 2NTTA 4A8XC 1QOFA 5C3JB 5JZEB 1XCTL 5BYQA 1SEBD 1KFYB 3A33B 2DX5B 1JWBD 3U2SC 1STEA 1HZ6A 2MQJA 1ZOYB 2W9NA 3RPFC 1JALA 4LTUA 4MT5A 1CK1A 2NMQA 2M17A 1GB1A 1JQ4A 1KM7A 3PO0A 2KWVB 3IAS1 2IO1B 2LI5A 3LXFA 3RNGC 2JYEA 1UGJA 3PHWB 3DBRB 2LXCA 2RPQA 1MHHE 1E5WA 1DOIA 3VFKA 2AQ1B 1EO6A 3TSSA 5HFYA 4HRSA 2DAFA 3NZUA 2NCNA 2BKRB 2KN5A 1EU3A 1MG4A 2QILA 1H8CA 4DXAB 5BMIA 5IP4D 4EZJA 4AS1A 1WYGA 2IYDB 4OVVA 3R66C 2L83A 4PS3A 3DVNV 3J9CA 4KDLB 2KO3A 2ZW0A 2J0MA 4KKIA 4N6EB 1NYRA 4M02A 3W1YA 3ZNID 3ZKJC 1R4NB 3DBSA 4LDTD 2L32A 3GP7A 4DQOC 3AE5B 1WGKA 2INNE 2D5GA 4EUTA 1NYQA 4DDGD 3U8ZA 4BKSA 3IVFA 2M1MA 3OJ3A 3PGEA 4W9KA 3W2DA 3TEYA 2TSSA 2L3ZA 4ZRKA 5D2MB 1AARA 3TBLD 2CS4A 2AEHA 2QJLA 4D2KA 5FKAC 4NNJB 2WU2B 4IM2A 1VD2A 2FNJB 1KLGD 4P7IA 3ZRFA 2LGDA 1QKZA 3DQVA 3WCQA 1I35A 1I4HA 3UINB 4B6WA 4HDOA 1V1PB 3VXWA 3L17A 4MJSB 4FHKA 2K25A 3RNBC 3KYCD 3ALBA 3DVGX 4NAMA 1HEZE 2MBQA 5G2NA 2HJ1A 3GZNI 2IGDA 4GN1A 3A9KA 3N1YC 1C77A 4XWWA 5IA7A 4S17A 2HE7A 2DLBA 2KDMA 3X0WA 5AEKB 1KLVA 1TBEA 2J4XA 3Q69A 1D5ZC 3SFEB 2LD9A 3AEFB 1P9DU 3Q3NC 4NQLB 3N32A 2QSDA 4M8MA 1V97A 2OEDA 4BBNC 1KH0A 1VZ8A 2LASA 3N9YC 3JVZX 2KD0A 5E6OA 4BKGA 2K6DB 4CQNA 2KAJA 1WM3A 1AN8A 4TQ1A 5EE3A 3OJ4B 2K8BA 3D32A 3NRZA 3Q3OC 1L0YB 2KX3A 2KACA 3RN9C 2VRRB 3H1UA 1T0QC 1TYGB 2DZKA 4US9A 4F8CB 1WMHB 2L8JA 1NVID 1L4ZB 3RNAC 1E8YA 3HRDD 1SGHA 4K3BA 2VH1A 4RCOA 1QILA 2V4IB 4XX5A 2C7MB 4K81A 1P7EA 3AE8B 3L0WB 2JF5A 2V3PA 4P16A 4GMVA 2BS4B 1GPXA 3JSVB 2CKHB 4M01A 4KSLC 1XEEA 1QLBB 4IDIA 1S1QB 1E9MA 3AE9B 1TT5B 1WX7A 3URYA 1AYFA 1OQRA 1C4PA 4B95A 3W1SC 1QT9A 5FR6A 3AU4A 3NJTA 1TKGA 4FJYA 2MBEA 4II3B 2RDGA 2N7DA 3DBLB 3VR8B 1R4NI 4MELA 1FIQA 2WYQA 4S0RA 2KDEB 4LLGM 5G55A 4YTPB 3KUZA 2FCQA 4M0WB 4KSKC 2ASQA 2RR9A 4F7ZA 2NBUA 1Z2MA 4OZAA 2J52A 3IBEA 4CYEA 3DDCB 1FEHA 3LYYA 4GDLB 1HTQA 3UIPB 3ZW3A 2MBBB 2M0XA 2C9WB 3NOBA 2RD0A 2XK5B 2H89B 2C60A 2J0JA 2WXQA 2CJOA 3VH3B 2YLMA 4ACFA 5J17A 4MEMA 1V81A 1NI2A 2M56B 5BO4B 1WGHA 4OW0A 1IBXB 1FNVA 2ZW1A 2D10A 3RULA 1Q5WB 3AE2B 1MFWA 3MHSD 1FXAA 3K9OB 4HROA 3KH0A 1WGGA 3T8MA 1E8XA 2RPVA 1DOXA 1RM6C 2WXOA 2BGFA 4WWOA 5EE0A 2JVCA 4M00A 2KC1A 1PUTA 2BBCA 2AL3A 4L23A 5FR3A 3LDZE 4HKZE 3U52E 3WANA 4IWOA 5AZGA 1HE8A 2E6XA 4XDDA 1TZOA 3UI3A 2I2YA 5JH5C 3T3OA 1PDXA 4IC7B 5D6JB 3WAMA 2JT4B 3NVYA 1RFAA 1SE4A 5AUIA 4LNFA 2JZ3B 2BS3B 4WAAA 2VZKD 2AX5A 3EA6A 3AEBB 1FNWA 3X23A 3L4PA 1R4MI 4RGMA 1WJ4A 4XDCA 4B0EA 1KTKA 3A4RA 1RAXA 2G4DB 3TUOA 2O6VA 4EZLA 2Y5PA 1T0RC 1DYQA 3IT4B 1SJED 3UQAA 1Y56A 2WXMA 1RLFA 4REZA 1QOGA 4R3DA 1UBQA 4MGKE 4RH6A 1V86A 3WA0A 2KDIA 2BWFA 3GE8C 2JYTA 4YSZB 2ZCCA 3SDLC 2PW9A 2KJ6A 2K3UA 1WJ6A 4DK5A 2W82A 2BB6A 1A70A 4HPLB 1WR1A 2DZIA 3VTVA 1JWUD 3NHEB 2I38A 5D94A 3EGRA 2ONQA 1C1YB 3B0AA 1XCQL 4ZHOA 2WDRB 2LUMA 5E6JA 1XF5L 4WQMA 3MJ5A 5CHVC 4KDIC 3ZVVA 2KKCA 3V3XA 2WX0A 3VTUA 3P4PB 2V0GA 2N9PC 2HJ8A 2BYEA 1SXTA 3L13A 4DDID 2JPHA 3I9V1 2REXA 3PLUA 1F52A 1J19A 3ZXRA 1WI0A 4WJPA 2Z8LA 3SHQA 2KZRA 1YN3A 1GC7A 2KMMA 1N6ZA 2MX2A 4WURA 4FJZA 1EF5A 5L95C 2Y5BB 2WXHA 4MJSA 3AXCA 4AJYB 2D2QA 1YQ3B 2FUHB 2ZNVB 2KJHB 1ET6A 2KMAA 1OFFA 4J3OD 4PYUA 1CZPA 4W9GA 4WWNA 3GE3C 2K0PA 1MPEA 2ZVOA 5DPSA 3RT3B 1QOAA 4ARCA 2K1FA 1Y8RC 4EZKA 4J6IA 1KF6B 1C76A 4A9AA 1E90A 4WWMA 1V5OA 2O2VA 4NAWB 2WXNA 4XZ4A 1XLPA 2DHZA 3AE3B 1TS5A 2A4ZA 4I6PA 3ONSA 1RWSA 1NENB 1RFKA 2WHIA 4ZDVA 3PZ8A 1LQBA 2CU1A 2WU5B 1IGCA 3ZLZA 3A9JA 3VRBB 2IGHA 2RSUA 1OGWA 4IM0A 1V2YA 4NJCA 1UWMA 3TL5A 2M0AA 2SAKA 3KVFB 1K53A 4WJNA 2GBKA 2ZPNA 1AW7A 3RCZA 4IWQA 3ZJTA 1NBFC 1JCKB 2JWUA 4TKNA 1TGZB 1WRIA 3HK0A 1XQQA 4H2AA 4GSWA 3NS1A 2YEPF 1I4QA 4IW0A 5T8IA 1OEYJ 1UD7A 1ZGUB 2WXGA 4PS7A 4MM3B 1TKYA 3ML9A 1DOYA 2HTME 5LXIB 3DOWA 2CR5A 4K7SA 3AEDB 2XN9C 3O13A 1C3TA 4G0NB 2V1YA 4O1NA 1GAQB 1WSPA 3N1ZC 3CSFA 3P1MA 1FPYA 1PGXA 3AMZA 4I6NB 4A3PA 1JWMD 3MC8A 1KJTA 4KZ0A 2N1VA 1JMLA 3MJWA 1D5MC 5MPOA 1K52A 4EKUA 3HUIA 4MSMB 3U4EG 3V6EB 1VLBA 1P1AA 4FULA 3ZNGC 3TEXA 2KWUB 2AQ3B 2JRHA 2K8HA 1K8RB 4GU2A 1WXQA 2HD5B 3H7SA 3M63B 2FBWB 4PT5A 2PVGC 2OJRA 1K50A 1VDVA 2JXTA 4I6LB 4GOCA 3HM6X 2G4SA 3EHVA 1XO3A 1TZ1A 3EC8A 1WWTA 4HPMB 2Y3AA 1D5XC 1TKEA 2PPHA 3VQIA 1E8WA 1EM7A 4GDLA 4YL8A 2WXJA 2MHJA 4K7UA 1YJIA 2I1JA 4FN2A 3L10B 3BVGA 3U7ZA 1CMXB 1C4CA 3B08A 4WJQA 3Q8EA 3BVMA 2KYWA 2B76B 3EFUA 4RNAA 4KX6B 1L7YA 4KGRA 3E9SA 4RM9A 2QCZA 3ETRA 4PS8A 4WAFA 2KFJA 2SEBD 1J7CA 1FNUA 2DZMA 3B2FA 3H7PB 2K9XA 1F1HA 4BVUC 3O65B 3BVZA 4GDKB 1WGRA 3DBHI 1D6EC 1EU4A 2KWCA 3AB5A 2AQ2B 2EMTA 2G9HD 3RUIB 2XEWA 1TTNA 2HTHA 1YMHE 2KT7A 3FILA 5LXHA 4HWIB 2N7JA 4G11A 2N0SB 3U7DA 2R61A 2FAZA 3AH7A 1KRHA 1NEKB 2WX1A 2DBYA 1TJEA 4AP4C 1WY8A 2V9HA 2ZVNA 1NDDA 1DGJA 2UU7A 1FCCC 2DNFA 3GOEA 3BZDB 1SIJA 2PMVA 4P1BC 1M94A 1UZXB 4MACA 1F2RC 4K3CA 1LGRA 4P6VF 2IJ0A 4C7YA 2N4FA 1WX9A 1UNSA 3EUB2 2GRIA 3M62B 1E7UA 3W1SA 3QARA 3VR9B 2JU6X 2KMCA 1HQRD 2YEPB 4DWFA 3NY5A 2W3SA 4HKQA 4B9KA 2D11A 2L0TA 4Q2JA 2ZEQA 2IO3B 1F0ZA 3PV1A 4IG7B 4XE0A 2MRPA 3RNEC 4IOIE 1ET9A 2FIFA 4DXFA 2WNMA 1FXTB 4WJOA 1QOBA 1IYFA 3GB1A 4LNOA 2DYOA 1JWAD 3DBRI 2WXRA 2FUG1 1VZ7A 4LJPB 4ZOHC 1WXSA 3NVVA 2KQ7A 2L1AA 4JQWC 3IT6B 5EE1A 1J7AA 2LUEA 2PIAA 3AV8A 4US8A 2JQRB 1ACCA 1HZ5A 3PHXB 3IXSA 3P2BA 4ICUA 1EUVB 3ZTDA 1D3ZA 2PE9A 3H9DA 1UGMA 3AM9A 4C4VA 4FADA 4HPPA 1I4RA 2ZCBA 4GGQA 2PEAA 1A5RA 1V6EA 5E6PA 2C7HA 1IPGA 1WH3A 4MH8A 3N20C 1P3QU 2MLBA 3DVNU 3HVDA 3M3JA 4QAYA 2WXLA 1SE3A 3AN1A 2V3SA 1E0ZA 3L54A 1L6VA 4HDQA 2M8SA 5H92C 1N5XA 3P4QB 2X8XX 2LMCA 1S3SG 1ZE3D 4BKTA 4JGHB 4RM8A 3VUXA 2GLSA 2NBVB 1L0XB 2G3QB 1F9JA 1C78A 1FO4A 1L6UA 2KFKB 3DHIC 1V8CA 2MA9B 1ZUD2 1UBIA 4KV2A 1ZDVA 1T6BX 2ZJDA 1JROA 2HDEA 2NPTB 1I7HA 2LVOA 4YSYB 1TS4A 2BKFA 4W9FA 4OVUA 1PFDA 3VTWA 2DYMA 2RDHA 1EF1A 3Q6BA 2FCNA 3IFWB 4NJ7A 2VH2A 1WRDB 4MGZE 2BYTA 3AECB 3A1QA 3W5VB 1TS3A 2LWPA 2LGXA 3EFCA 4KGTA 3T3NA 3JW0X 3A9KB 2WQYB 3RI7C 4MSQB 2KNBA 4MGYE 2ZNVC 4W9LA 2BS2B 1K51A 2WXPA 1F77A 5C23A 2IO0B 2QDFA 2KTFA 3TCAA 3ZJUA 2GBRA 1UF0A 1LFDA 1QQRA 1V1OA 3C8YA 1XLQA 1J0GA 2MW5A 1JRPA 3MFGA 1E6EB 2EMSA 5DCNA 2W55A 1U4AA 2Z59B 3V61A 1UWXA 1OQQA 1XD3B 3H8HA 4USAA 1QF6A 5BMHA 4KIKB 3ZNZB 2WP9B 3LB8C 5C2TB 3ZYYX 1ZKHA 4ANVA 2FCSA 4FA6A 3I5JC 3VVWB 2M4NA 4BFRA 4MGIE 3HVZA 1RRBA 1BXTA 4AOFA 3I57A 2WXIA 2DENB 2IY0B 4LJOB 3APDA 3KLSX 4RGOS 4OHJA 3Q8AA 1HA5A 2J7QB 3Q14C 5HKHA 2CHWA 3BIID 4NY0A 3TJPA 4JE3B 3ZQ4A 3WIMA 2CHZA 3MP9A 2UYZB 4WQOB 1XLOA 2LRWA 3MC9A 2D3AA 3B1LX 3V60A 3NZSA 2PE6B 5CX3A 2MBHA 5J18A 3QAQA 3GS2A 4AUQC 1T0SC 3ABVB 3R2IA 4YTMB 3APCA 2N9XA 3IG3A 2OHFA 5IN7A 2RMMA 3V6CB 4YSXB 1NI3A 2DZJA 3AE7B 3ZNHB 2NR2A 3ZGZA 1N63A 2BYFA 2KDFB 2ICIA 3E56A 3DBLI 2GBNA 3R7QA 4OZCA 2JUOA 2WXFA 1L2NA 3VUWA 3VHTC 2GBMA 1V1PA 1ZDXA 2MJ3A 2JX5A 1YIWA 1Q0WB 5L83A 1WFYA 1OQYA 1SE2A 2B3AA 4HK2A 3SFDB 3QC8B 5G5HA 4ICVA 1L0VB 2R2OA 3H6NA 4C7ZA 4GDKA 2KLGA 4WIPA 5AZFA 4LNKA 1SSNA 3AEAB 4XWTA 2OOBB 3GZNB 1VRAB 3ENEA 2MP2B 3QX1A 1N60A 3T9LA 4N9F4 4CHKA 3IHPC 3FKYA 2Z0EB 3APFA 2WDTB 4ASWC 3BY4B 1FFUA 1F2RI 1YN5A 2WDQB 4GIVA 2D3BA 3K9PB 2BF8B 1T0YA 4W9EA 2FE8A 4PYZA 2KHWB 1P0RA 1L4DB 2YVCA 3AEGB 4HLEA 3WAOA 1PYWD 3L16A 3NUHB 2W54A 4NJ6A 1YD8U 3KW5B 2PTLA 1WIAA 3OAWA 1WXMA 3CIRB 1PGAA 3MC0B 3RNFC 1ZPSA 2L76A 2K8CA 4EOYA 3ZIMA 2QEJC 4WWPA 1V5TA 3RZFA 2CHXA 1ZW7A 4JPSA 3BK1A 2EKEC 4C56C 2K5PA 1TY2A 2CU3A 4ANXA 4XGAB 3U30A 4NQKE 5CHFA 2W3RA 5JHBA 3BYYB 3QA8A 1WMHA 4BOSC 2PLPA 2MSED 4ZHPA 2RGFA 2IDYA 1I4XA 3S2AA 4IUMB 4ZRJA 3PTFC 2KK8A 1MHXA 2Z0DB 2BWES 2J0KA 4WH4A 3OWEB 5IO9A 4CO7A 2AWTA 2BB5A 3JSVA 3ZDMC 4TV3A 2FIDA 4EE2A 5C1ZA 1ROEA 3R8BA 2O6VB 5CTRC 5AUKA 1WXVA 4LK0M 1HTOA 3C19A 3Q3FA 4II2B 2LHDA 2BQQA 3RD2A 5IKCM 4ANUA 1YX6B 3TEWA 3I3TB 2WDVB 1GG3A 4YWGG 3ZXVA 4FBJB 4G3XB 3VH4B 2MBOA 2KC2A 2BT6A 3P63A 1YJJA 2MWSB 1I42A 3PSEB 4AJWA 2CJNA 3VUYA 4DHJB 3SR6A 2BTEA 1JW9D 1ZXIA 5I4DA 3ZDTA 2R2QA 4OZBA 3P4RB 5BYRA 4M0WA 5TR5A 2QIEB 1WF9A 2XNAC 4RGTA 3QWZB 5E6NA 1YQBA 1V9JA 4RGNA 2DYBA 4AWJA 4TMAB 2OJWA 2C7NB 4K1RB 4ZYSA 4JX1C 1GUAB 3R7RA 2LJ5A 2GOWA 4DXGA 1P7FA 2XK5A 1E7PB 1H4RA 3KWLA 3QIJA 3AE6B 2KVRA 2KOXA 4IKGA 1LO5D 1FD6A 3N1XC 3P42A 1IBXA 4ZRPA 3B2GA 2MJDA 3PT2B 3QJZA 2NBWB 2KFKA 2KX0A 3Q3MC 2JXXA 3RZWC 1UUPA 3DHHC 2MH7A 2ON8A 3Q8FA 3A4SC 3M95A 2KTRB 1GJZA 4BBNF 2NPTA 3N30A 4ARIA 3C0RB 3TIXA 3CMMB 3W9CB 3LJ3A 1Z5SB 1QZEA 1JWSD 3CF6E 2ZZPB 4K7WA 3TMPB 1MG8A 1YOVB 2LGSA 5FK9C 2WGSA 2A5UA 5AZHA 4ITKA 4L1BA 2BVCA 1N62A 3CWIA 2JRIB 2ZPYA 3VRAB 1WZ3A 4F1SA 3DVGY 3NVZA 1CQVA 2N9KA 2O2VB 5TSSA 4X57B 3PZDA 1TY0A 2NS5A 1SB3C 4W9DA 5JXVA 4BKSD 1IUEA 2L05A 1FRRA 3MTNB 3DWGC 3KQ4A 4EFOA 3A9JB 1ESFA 5HI1A 3ZTCA 3TEZA 1XLNA 4MDKE 1WXAA 1YX5B 5J2RA 1R4MB 4HXDA 3AU5A 3ZRCA 4TSSA 3N3KB 1YJ1A 1V49A 1YN4A 4LDTB 1BMLC 2PJHA 4KIKA 2L52A 1UH6A 4W9HA 3WALA 4RFBA 3ZJVA 4E74A 4LCDE 3PVLA 1Q10A 2WS3B 3PRPB 4DBGA 4JLCA 4BOZB 2K39A 1WJUA 1C9FA 2IZVB 2NVUI 3AE1B 5D3DA 4RF0A 5D7GA 4YXDB 3DCGA 3MHZA 2N9LA 5DPRA 4JIOU 5LNK1 1SBBB 1Q1OA 1BT0A 3DWMA 1WYWB 3PZ7A 2V4LA 1I4PA 4KKJA 3QK0A 2AL6A 3ECIA 2IY1B 1FFVA 4XC2A 2KQ4X 1B9RA 5CHWA 3SU8X 5KHQA 5KHOA 1MJDA 1WE7A 4ZRQA 1D4BA 2KANA 1FM0D 4JWSC 4JL9A 5HHDG 4HCNB 2EKIA 4A20A 2H88B 3IAM1 3HIZA 4EEWA 1T3QA 1TS2A 1JRUA 2IO2B 1WGYA 3L08A 1TIFA 2LRUA 4RMAA 3KUCB 3NZ3A 2KQSA 1N5WA 2LXAA 2PKOA 5G5GA 1MVKA 2INPE 3DHGC 3UF8A 2BYVE 2RDBC 3V05A 4YTNB 4M8NA 4P1CC 5EE9A 4W9JA 1PQSA 2GI9A 2V3NA 2DAJA 1CJEA 2K6QA 5EDSA 2KWDA 1WE6A 2IGGA 2WLBA 3PRZA 1LXDA 2D3GA 2MJEA 4B0MA 3BK2A 1EWYC 2L00B 2UWQA 3AI5A 1IGDA 1P98A 3BYTB 3SEBA 3RFZB 4FHJA 1LM8B 2J53A 4JWUC 2MP2A 4ZRIA 2ACZB 4NAWA 1ZP0B 3R3MA 1M4VA 3ZUNA 2GB1A 2J42A 1R7SA 2AYOB 1FXIA 2G1EA 1MI0A 3BINA 2MCNB 3Q8CA 4KZCA 4ZYNA 5GXGB 4ANWA 1HXYD 1FMAD 4XYCA 2FCMA 4C00A 1ZXHA 4N58A 4HJGE 3AE4B 2C5LC 2QC8A 2N9EB 3PS6A 1E10A 2I1KA 1OEYA 4URKA 4DHZE 3I63C 2LFIA 3FILB 1FCLA 3DPDA 2N7EA 2D07B 4UDUC 1B1ZA 3UQBA 4HEA1 1J7BA 1XXGA 2INCC 2KDBA 2QHOA 1ISNA 3Q8BA 1GC6A 2XBBC 4HCPB 2LVQA 2IPKD 3ML8A 4BZAA 4MM3A 4E71A 1WZ0A 3PREA 3QHTA 3QCAA 4NZLB 4W9IA 4NPNA 4MH0E 2KXJA 4FJVB 3UGBB 2IBIB 4IWPA 2LHEA 1WM2A 1IP9A 2JZPA 5H8YE 5LLIA 3RMKC 4A3OA 5GMVA 2X38A 4YT0B 1AWDA 2E3TA 2LEKA 1SIFA 3P4SB 3AEEB 1VR9A 3KWVA 3Q3JA 4GB9A 1E7VA 2BPSA 3NVWA 2JZZA 2EELA 1G6JA 2LGYA 4RF1A 3UIOB 3VDZA 1KLUD 1C79A 2QMTA 4GLSC 2D3CA 1C4AA 3OLMD 5DPWA 3KUDB 1VJKA 3HM3A 3R2TA 4TUUA 3ZO5B 2GMIC 4FXCA
chains in the Genus database with same CATH topology
4ZHPA 1YQ4B 2N7JA 1L5PA 2IDYA 1I4XA 1SF0A 1FEHA 2N0SB 3LYYA 4GDLB 2R61A 5D3IB 3AH7A 3FAHA 1KRHA 1NEKB 2DBYA 3BWUD 1MHXA 1TJEA 2H89B 2WXQA 2CJOA 4WH4A 3OWEB 2M56B 2BB5A 4OW0A 1IBXB 1FNVA 2ZW1A 1DGJA 4EE2A 1FCCC 1ROEA 1ENFA 2PVOD 3BZDB 3R8BA 3AE2B 4KGSA 1SIJA 5AUKA 2PMVA 1FXAA 4LK0M 4HROA 4L2YA 4A6QA 1GB4A 2MEKA 2LHDA 1EWCA 4MACA 1F2RC 2RPVA 3TEWA 1DOXA 1RM6C 4P6VF 2WXOA 2IJ0A 4C7YA 2WDVB 1FRDA 4YWGG 1UNSA 3EUB2 2GRIA 5EE0A 3W1SA 3VR9B 4N59A 2JU6X 1HQRD 1PUTA 2YEPB 3W5UB 4TQ0A 2BT6A 2BBCA 3P63A 1YJJA 4L23A 2KN4A 5FR3A 2W3SA 4HKQA 1PGBA 4HKZE 2CJNA 4Q2JA 3U52E 2BW2A 3SR6A 2E6XA 4XDDA 1TZOA 3UI3A 2I2YA 1F0ZA 2JSVX 4XE0A 2BTEA 4IOIE 1ET9A 4DXFA 1JW9D 1ZXIA 2VZKB 2WNMA 3T3OA 1PDXA 5I4DA 4C80A 5BMGA 1QOBA 4OZBA 3P4RB 5BYRA 4M0WA 2QIEB 3B9JA 1I4GA 2XNAC 3NVYA 4RGTA 3GB1A 2DYOA 1JWAD 1SE4A 5AUIA 4RGNA 1GOZA 2WXRA 1T5XD 2BS3B 2FUG1 4TMAB 1VZ7A 2VZKD 2AX5A 4JX1C 4ZYSA 3EA6A 3AEBB 4ZOHC 3NVVA 1P7FA 4DXGA 1E7PB 1FNWA 2DWQA 3KWLA 4AQ7A 1N61A 3AE6B 2L1AA 3L4PA 4IKGA 4RGMA 4XDCA 1LO5D 3IT6B 1FD6A 5EE1A 1YNTE 3P42A 4B0EA 1IBXA 4ZRPA 1KTKA 2NTSA 1BUIC 3B2GA 5HG2A 2MJDA 1J7AA 2WXKA 2PIAA 3TUOA 3AV8A 2Y5PA 4US8A 2JQRB 1ACCA 2M19A 1HZ5A 3FC4A 1DYQA 3IXSA 3IT4B 1UUPA 1VZ6A 1SJED 1Y56A 2MH7A 2WXMA 4A55A 4REZA 4OVZA 2ON8A 1QOGA 4R3DA 3Q8FA 3AM9A 4RH6A 2LGIA 2Y5CA 1RYJA 2K22A 1I4RA 5BYSA 4A90A 4ARIA 2JYTA 4YSZB 3W9CB 1JWSD 2PW9A 2LJIA 2Q5WD 1SJHD 2K3UA 2NTTA 4A8XC 5FK9C 1QOFA 2W82A 4MH8A 2BB6A 5C3JB 1A70A 1XCTL 5BYQA 1SEBD 3HVDA 1KFYB 1JWUD 4ITKA 2I38A 4L1BA 1N62A 3EGRA 3CWIA 2WXLA 2ONQA 1SE3A 3VRAB 3AN1A 1XCQL 4ZHOA 1E0ZA 2WDRB 1JWBD 2LUMA 3U2SC 1STEA 5E6JA 1L6VA 1HZ6A 1XF5L 1ZOYB 5H92C 4WQMA 1N5XA 3P4QB 2LMCA 3NVZA 1CQVA 1ZE3D 1JALA 3RPFC 4LTUA 3MJ5A 2N9KA 4MT5A 5TSSA 1CK1A 2NMQA 1TY0A 1L0XB 1SB3C 5JXVA 1GB1A 1C78A 1FO4A 1L6UA 3V3XA 1JQ4A 3PO0A 1IUEA 3IAS1 3P4PB 2V0GA 1FRRA 3LXFA 1V8CA 3DWGC 3KQ4A 1SXTA 2JYEA 1ZUD2 1UGJA 1ZDVA 1ESFA 5HI1A 1T6BX 3I9V1 1XLNA 1MHHE 3TEZA 1DOIA 1JROA 2AQ1B 3TSSA 5HFYA 4HRSA 2HDEA 1I7HA 4YSYB 1TS4A 1EU3A 1PFDA 2Z8LA 4TSSA 2DYMA 2QILA 2RDHA 1YN4A 5BMIA 4AS1A 2BYTA 1WYGA 1BMLC 1YN3A 3AECB 2L52A 2KMMA 4WURA 3W5VB 2L83A 1TS3A 3J9CA 4KGTA 4RFBA 3ZJVA 3T3NA 2WQYB 2ZW0A 2WXHA 4KKIA 1Q10A 4N6EB 2WS3B 1YQ3B 2BS2B 1NYRA 1K51A 1ET6A 2WXPA 1F77A 1OFFA 4J3OD 1CZPA 2L32A 3GP7A 4DQOC 3AE5B 1WGKA 2INNE 2K0PA 1MPEA 3ZJUA 2D5GA 1NYQA 1C9FA 1QOAA 4ARCA 3AE1B 5D3DA 4RF0A 5D7GA 4YXDB 1QQRA 1KF6B 1C76A 3MHZA 1V1OA 2N9LA 4A9AA 5LNK1 1SBBB 3C8YA 3DWMA 3W2DA 4WWMA 3TEYA 1XLQA 3PZ7A 1JRPA 2TSSA 1I4PA 3MFGA 4NAWB 4KKJA 1E6EB 2WXNA 1XLPA 3AE3B 1TS5A 2W55A 2QJLA 4D2KA 1FFVA 1B9RA 2KQ4X 5FKAC 1OQQA 1UWXA 2WU2B 1RWSA 1NENB 1RFKA 3H8HA 4USAA 1QF6A 1KLGD 5BMHA 4ZRQA 3PZ8A 1D4BA 2WP9B 3LB8C 5C2TB 1FM0D 4JWSC 2WU5B 3ZYYX 5HHDG 1IGCA 1QKZA 3WCQA 1I4HA 3VRBB 2IGHA 1V1PB 3HVZA 1BXTA 2EKIA 4NJCA 1UWMA 2H88B 3IAM1 2M0AA 2SAKA 1K53A 3I57A 1T3QA 1TS2A 2WXIA 3KLSX 4RGOS 4OHJA 3Q8AA 1AW7A 4NAMA 1HEZE 1HA5A 3NZ3A 3ZJTA 1N5WA 1JCKB 2JWUA 2PKOA 5G5GA 1WRIA 1MVKA 3BIID 2IGDA 2INPE 4H2AA 3NS1A 1C77A 4JE3B 4XWWA 2YEPF 3ZQ4A 1I4QA 3V05A 4YTNB 3MP9A 5T8IA 1XLOA 5EE9A 2WXGA 4MM3B 1TKYA 2GI9A 1DOYA 2DLBA 2HTME 2KDMA 2V3NA 1CJEA 3GS2A 2KWDA 2IGGA 3ABVB 2WLBA 3AEDB 3R2IA 2XN9C 3O13A 4YTMB 2J4XA 3Q69A 1D5ZC 3SFEB 2MJEA 4B0MA 3BK2A 1EWYC 3AEFB 2OHFA 2RMMA 4YSXB 1IGDA 3BYTB 4O1NA 3SEBA 1NI3A 3RFZB 1GAQB 1WSPA 3AE7B 3P1MA 3ZGZA 2J53A 1PGXA 3AMZA 4JWUC 2ACZB 1ZP0B 2QSDA 1N63A 1JWMD 1M4VA 2ICIA 2GB1A 1V97A 2OEDA 2J42A 3E56A 1R7SA 2G1EA 1FXIA 1JMLA 1KH0A 1D5MC 1VZ8A 1MI0A 5MPOA 1K52A 3N9YC 3Q8CA 4CQNA 5GXGB 4OZCA 3HUIA 2KAJA 3U4EG 1HXYD 1VLBA 1FMAD 2WXFA 1AN8A 4TQ1A 3TEXA 5EE3A 1V1PA 1ZDXA 2MJ3A 1ZXHA 2AQ3B 2JX5A 3NRZA 4N58A 1L0YB 4HJGE 2KACA 3AE4B 1SE2A 3SFDB 1E10A 5G5HA 1WXQA 1L0VB 1TYGB 4US9A 2LFIA 3FILB 1NVID 1L4ZB 1FCLA 3HRDD 2FBWB 4PT5A 4C7ZA 4UDUC 2PVGC 4RCOA 1B1ZA 1QILA 1K50A 1VDVA 2JXTA 2V4IB 4HEA1 4WIPA 1J7BA 1XXGA 1SSNA 1XO3A 1P7EA 3AE8B 3AEAB 1WWTA 4XWTA 2Y3AA 2V3PA 3Q8BA 4P16A 1D5XC 2IPKD 1TKEA 2BS4B 1GPXA 1VRAB 1N60A 4NZLB 3VQIA 1FFUA 1F2RI 1XEEA 1YN5A 1QLBB 1EM7A 2WDQB 4IDIA 2LHEA 2WXJA 1E9MA 2JZPA 3AE9B 5H8YE 1YJIA 2FE8A 3BVGA 3U7ZA 3URYA 1C4CA 1AYFA 2X38A 4YT0B 1AWDA 3Q8EA 1L4DB 1OQRA 3BVMA 2E3TA 2LEKA 3AEGB 2B76B 1C4PA 1PYWD 4RNAA 4KX6B 3NUHB 4KGRA 3E9SA 1QT9A 3AEEB 3P4SB 2W54A 1VR9A 3ETRA 4WAFA 2PTLA 2SEBD 3KWVA 1J7CA 3NVWA 1FNUA 3B2FA 3CIRB 1PGAA 3MC0B 1TKGA 2K9XA 2EELA 1ZPSA 2RDGA 4RF1A 2QEJC 3BVZA 4GDKB 1KLUD 1C79A 2QMTA 3VR8B 4JPSA 1D6EC 3BK1A 1EU4A 1FIQA 4GLSC 3AB5A 2AQ2B 4C56C 1C4AA 2K5PA 1TY2A 2G9HD 4LLGM 2CU3A 4YTPB 1VJKA 1YMHE 2W3RA 3R2TA 3BYYB 4FXCA 3FILA 4OZAA 2J52A 2PLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQR B;  2M19 A;  1R7S A;  4ZHP A;  1YQ4 B;  2G1E A;  1FXI A;  1NYQ A;  3FC4 A;  1L5P A;  1SF0 A;  2N0S B;  1QOA A;  5MPO A;  2MH7 A;  3AH7 A;  3FAH A;  5GXG B;  1KRH A;  3AE1 B;  3HUI A;  2KAJ A;  1QOG A;  4YXD B;  1NEK B;  1KF6 B;  1FMA D;  1VLB A;  3AM9 A;  4A9A A;  2DBY A;  2Y5C A;  1RYJ A;  1TJE A;  2H89 B;  5EE3 A;  2CJO A;  2MJ3 A;  2K22 A;  3DWM A;  2JX5 A;  3NRZ A;  4N58 A;  4WWM A;  1XLQ A;  2M56 B;  3AE4 B;  1JRP A;  4YSZ B;  3W9C B;  3SFD B;  1E6E B;  1E10 A;  5G5H A;  1DGJ A;  1XLP A;  3AE3 B;  1WXQ A;  1L0V B;  2Q5W D;  2W55 A;  1TYG B;  1ROE A;  2PVO D;  2QJL A;  4US9 A;  1FFV A;  3AE2 B;  1B9R A;  5AUK A;  1OQQ A;  1QOF A;  1NVI D;  1SIJ A;  2WU2 B;  1A70 A;  1RWS A;  5C3J B;  1FXA A;  1NEN B;  1RFK A;  4ITK A;  1KFY B;  3HRD D;  2FBW B;  4HRO A;  4USA A;  4C7Z A;  1QF6 A;  2PVG C;  1N62 A;  1VDV A;  3CWI A;  2WP9 B;  3LB8 C;  5C2T B;  1FM0 D;  3AN1 A;  1J7B A;  2WU5 B;  4JWS C;  3VRA B;  3ZYY X;  4ZHO A;  1E0Z A;  2WDR B;  1JWB D;  1DOX A;  1XO3 A;  3WCQ A;  1RM6 C;  4P6V F;  3VRB B;  1L6V A;  3AE8 B;  3AEA B;  1WWT A;  4C7Y A;  2WDV B;  3HVZ A;  1ZOY B;  5H92 C;  1FRD A;  4WQM A;  1N5X A;  3P4Q B;  3EUB 2;  2EKI A;  1TKE A;  2BS4 B;  5EE0 A;  3NVZ A;  1GPX A;  3RPF C;  1UWM A;  1JAL A;  2H88 B;  4LTU A;  3VR9 B;  4N59 A;  1N60 A;  1PUT A;  1T3Q A;  3W5U B;  2BT6 A;  3P63 A;  1YJJ A;  1FFU A;  1SB3 C;  2W3S A;  1QLB B;  1JQ4 A;  2WDQ B;  1L6U A;  4IDI A;  1FO4 A;  3PO0 A;  2CJN A;  1IUE A;  1E9M A;  3AE9 B;  1N5W A;  3P4P B;  1FRR A;  2PKO A;  1WRI A;  5G5G A;  1YJI A;  5H8Y E;  3SR6 A;  3LXF A;  1V8C A;  3BII D;  3DWG C;  1AYF A;  1ZUD 2;  3NS1 A;  1F0Z A;  4YT0 B;  1AWD A;  4YTN B;  1OQR A;  1XLN A;  1DOI A;  1JW9 D;  1ZXI A;  1JRO A;  2B76 B;  1XLO A;  1PDX A;  2LEK A;  2E3T A;  3AEG B;  1QOB A;  4KX6 B;  4HRS A;  5EE9 A;  4C80 A;  1I7H A;  1QT9 A;  1TKY A;  3AEE B;  3P4S B;  2W54 A;  3P4R B;  4YSY B;  1DOY A;  3ETR A;  2HTM E;  2QIE B;  1PFD A;  3B9J A;  1CJE A;  1J7C A;  3NVY A;  3NVW A;  3B2F A;  3CIR B;  3ABV B;  1JWA D;  1TKG A;  2WLB A;  3AED B;  4YTM B;  2K9X A;  1WYG A;  3AEC B;  5AUI A;  2L52 A;  2KMM A;  3SFE B;  2MJE A;  3W5V B;  2L83 A;  1EWY C;  3AEF B;  2BS3 B;  2OHF A;  2AX5 A;  4JX1 C;  3VR8 B;  3AEB B;  4ZOH C;  3NVV A;  4YSX B;  2WQY B;  1E7P B;  2DWQ A;  1NI3 A;  3KWL A;  1FIQ A;  1GAQ B;  3AE7 B;  1N61 A;  3AB5 A;  3AE6 B;  3P1M A;  3L4P A;  4N6E B;  2WS3 B;  4JWU C;  1YQ3 B;  2K5P A;  3AMZ A;  5EE1 A;  2BS2 B;  1NYR A;  2CU3 A;  2ACZ B;  1OFF A;  1ZP0 B;  3B2G A;  1N63 A;  4YTP B;  2MJD A;  1CZP A;  1J7A A;  1VJK A;  2W3R A;  2PIA A;  3AE5 B;  1WGK A;  4FXC A;  1V97 A;  3AV8 A;  4US8 A; 
#chains in the Genus database with same CATH topology
 1YQ4 B;  1L5P A;  1SF0 A;  1UEL A;  5D3I B;  3FAH A;  3RNC C;  3KYD D;  4W9C A;  4BAX A;  3BWU D;  2L0F A;  1OTR B;  2G45 B;  1X1M A;  4IM3 A;  4DHZ B;  4HJK A;  5IAA C;  2PVO D;  1ENF A;  1KOT A;  4KGS A;  2GBJ A;  4FLH A;  3EEC A;  4L2Y A;  4A6Q A;  1GB4 A;  2MEK A;  1EWC A;  1VCB A;  3PPA A;  5IOI A;  4C4V B;  1FRD A;  2KVZ A;  2O6V D;  3JYU A;  4N59 A;  4LNI A;  3W5U B;  4TQ0 A;  4HVB A;  2JWZ A;  3NG0 A;  1J8C A;  2KN4 A;  2L7R A;  3H7P A;  1E8Z A;  1PGB A;  2IND C;  1GNU A;  2BW2 A;  1WJN A;  3CST A;  3SD5 A;  2JSV X;  2KTR A;  2LZ6 A;  1SE9 A;  3PRM B;  2VZK B;  4C80 A;  5BMG A;  3DBH B;  4KVG B;  3B9J A;  1I4G A;  4DHJ D;  3AUL A;  3VAW A;  5JHA A;  1GOZ A;  1T5X D;  2LVP A;  2DWQ A;  4E3C A;  4AQ7 A;  1N61 A;  1WGD A;  1YNT E;  4PK1 A;  2JY6 A;  1WR6 E;  2NTS A;  1BUI C;  5HG2 A;  3Q2A C;  4LNN A;  2WXK A;  3WAP A;  3QQ8 B;  2M19 A;  3FC4 A;  5DPT A;  1VZ6 A;  1XT9 B;  3A1Q B;  3V62 A;  4GXB A;  4A55 A;  4OVZ A;  2KLC A;  4G50 A;  2WWZ A;  1WX8 A;  3PLV A;  3HHM A;  2LGI A;  1V80 A;  2Y5C A;  1RYJ A;  2K22 A;  5BYS A;  2KJR A;  4A90 A;  3NS8 A;  3RYT A;  3OG5 A;  2LJI A;  2Q5W D;  1SJH D;  2N1W A;  2NTT A;  4A8X C;  1QOF A;  5C3J B;  5JZE B;  1XCT L;  5BYQ A;  1SEB D;  1KFY B;  3A33 B;  2DX5 B;  1JWB D;  3U2S C;  1STE A;  1HZ6 A;  2MQJ A;  1ZOY B;  2W9N A;  3RPF C;  1JAL A;  4LTU A;  4MT5 A;  1CK1 A;  2NMQ A;  2M17 A;  1GB1 A;  1JQ4 A;  1KM7 A;  3PO0 A;  2KWV B;  3IAS 1;  2IO1 B;  2LI5 A;  3LXF A;  3RNG C;  2JYE A;  1UGJ A;  3PHW B;  3DBR B;  2LXC A;  2RPQ A;  1MHH E;  1E5W A;  1DOI A;  3VFK A;  2AQ1 B;  1EO6 A;  3TSS A;  5HFY A;  4HRS A;  2DAF A;  3NZU A;  2NCN A;  2BKR B;  2KN5 A;  1EU3 A;  1MG4 A;  2QIL A;  1H8C A;  4DXA B;  5BMI A;  5IP4 D;  4EZJ A;  4AS1 A;  1WYG A;  2IYD B;  4OVV A;  3R66 C;  2L83 A;  4PS3 A;  3DVN V;  3J9C A;  4KDL B;  2KO3 A;  2ZW0 A;  2J0M A;  4KKI A;  4N6E B;  1NYR A;  4M02 A;  3W1Y A;  3ZNI D;  3ZKJ C;  1R4N B;  3DBS A;  4LDT D;  2L32 A;  3GP7 A;  4DQO C;  3AE5 B;  1WGK A;  2INN E;  2D5G A;  4EUT A;  1NYQ A;  4DDG D;  3U8Z A;  4BKS A;  3IVF A;  2M1M A;  3OJ3 A;  3PGE A;  4W9K A;  3W2D A;  3TEY A;  2TSS A;  2L3Z A;  4ZRK A;  5D2M B;  1AAR A;  3TBL D;  2CS4 A;  2AEH A;  2QJL A;  4D2K A;  5FKA C;  4NNJ B;  2WU2 B;  4IM2 A;  1VD2 A;  2FNJ B;  1KLG D;  4P7I A;  3ZRF A;  2LGD A;  1QKZ A;  3DQV A;  3WCQ A;  1I35 A;  1I4H A;  3UIN B;  4B6W A;  4HDO A;  1V1P B;  3VXW A;  3L17 A;  4MJS B;  4FHK A;  2K25 A;  3RNB C;  3KYC D;  3ALB A;  3DVG X;  4NAM A;  1HEZ E;  2MBQ A;  5G2N A;  2HJ1 A;  3GZN I;  2IGD A;  4GN1 A;  3A9K A;  3N1Y C;  1C77 A;  4XWW A;  5IA7 A;  4S17 A;  2HE7 A;  2DLB A;  2KDM A;  3X0W A;  5AEK B;  1KLV A;  1TBE A;  2J4X A;  3Q69 A;  1D5Z C;  3SFE B;  2LD9 A;  3AEF B;  1P9D U;  3Q3N C;  4NQL B;  3N32 A;  2QSD A;  4M8M A;  1V97 A;  2OED A;  4BBN C;  1KH0 A;  1VZ8 A;  2LAS A;  3N9Y C;  3JVZ X;  2KD0 A;  5E6O A;  4BKG A;  2K6D B;  4CQN A;  2KAJ A;  1WM3 A;  1AN8 A;  4TQ1 A;  5EE3 A;  3OJ4 B;  2K8B A;  3D32 A;  3NRZ A;  3Q3O C;  1L0Y B;  2KX3 A;  2KAC A;  3RN9 C;  2VRR B;  3H1U A;  1T0Q C;  1TYG B;  2DZK A;  4US9 A;  4F8C B;  1WMH B;  2L8J A;  1NVI D;  1L4Z B;  3RNA C;  1E8Y A;  3HRD D;  1SGH A;  4K3B A;  2VH1 A;  4RCO A;  1QIL A;  2V4I B;  4XX5 A;  2C7M B;  4K81 A;  1P7E A;  3AE8 B;  3L0W B;  2JF5 A;  2V3P A;  4P16 A;  4GMV A;  2BS4 B;  1GPX A;  3JSV B;  2CKH B;  4M01 A;  4KSL C;  1XEE A;  1QLB B;  4IDI A;  1S1Q B;  1E9M A;  3AE9 B;  1TT5 B;  1WX7 A;  3URY A;  1AYF A;  1OQR A;  1C4P A;  4B95 A;  3W1S C;  1QT9 A;  5FR6 A;  3AU4 A;  3NJT A;  1TKG A;  4FJY A;  2MBE A;  4II3 B;  2RDG A;  2N7D A;  3DBL B;  3VR8 B;  1R4N I;  4MEL A;  1FIQ A;  2WYQ A;  4S0R A;  2KDE B;  4LLG M;  5G55 A;  4YTP B;  3KUZ A;  2FCQ A;  4M0W B;  4KSK C;  2ASQ A;  2RR9 A;  4F7Z A;  2NBU A;  1Z2M A;  4OZA A;  2J52 A;  3IBE A;  4CYE A;  3DDC B;  1FEH A;  3LYY A;  4GDL B;  1HTQ A;  3UIP B;  3ZW3 A;  2MBB B;  2M0X A;  2C9W B;  3NOB A;  2RD0 A;  2XK5 B;  2H89 B;  2C60 A;  2J0J A;  2WXQ A;  2CJO A;  3VH3 B;  2YLM A;  4ACF A;  5J17 A;  4MEM A;  1V81 A;  1NI2 A;  2M56 B;  5BO4 B;  1WGH A;  4OW0 A;  1IBX B;  1FNV A;  2ZW1 A;  2D10 A;  3RUL A;  1Q5W B;  3AE2 B;  1MFW A;  3MHS D;  1FXA A;  3K9O B;  4HRO A;  3KH0 A;  1WGG A;  3T8M A;  1E8X A;  2RPV A;  1DOX A;  1RM6 C;  2WXO A;  2BGF A;  4WWO A;  5EE0 A;  2JVC A;  4M00 A;  2KC1 A;  1PUT A;  2BBC A;  2AL3 A;  4L23 A;  5FR3 A;  3LDZ E;  4HKZ E;  3U52 E;  3WAN A;  4IWO A;  5AZG A;  1HE8 A;  2E6X A;  4XDD A;  1TZO A;  3UI3 A;  2I2Y A;  5JH5 C;  3T3O A;  1PDX A;  4IC7 B;  5D6J B;  3WAM A;  2JT4 B;  3NVY A;  1RFA A;  1SE4 A;  5AUI A;  4LNF A;  2JZ3 B;  2BS3 B;  4WAA A;  2VZK D;  2AX5 A;  3EA6 A;  3AEB B;  1FNW A;  3X23 A;  3L4P A;  1R4M I;  4RGM A;  1WJ4 A;  4XDC A;  4B0E A;  1KTK A;  3A4R A;  1RAX A;  2G4D B;  3TUO A;  2O6V A;  4EZL A;  2Y5P A;  1T0R C;  1DYQ A;  3IT4 B;  1SJE D;  3UQA A;  1Y56 A;  2WXM A;  1RLF A;  4REZ A;  1QOG A;  4R3D A;  1UBQ A;  4MGK E;  4RH6 A;  1V86 A;  3WA0 A;  2KDI A;  2BWF A;  3GE8 C;  2JYT A;  4YSZ B;  2ZCC A;  3SDL C;  2PW9 A;  2KJ6 A;  2K3U A;  1WJ6 A;  4DK5 A;  2W82 A;  2BB6 A;  1A70 A;  4HPL B;  1WR1 A;  2DZI A;  3VTV A;  1JWU D;  3NHE B;  2I38 A;  5D94 A;  3EGR A;  2ONQ A;  1C1Y B;  3B0A A;  1XCQ L;  4ZHO A;  2WDR B;  2LUM A;  5E6J A;  1XF5 L;  4WQM A;  3MJ5 A;  5CHV C;  4KDI C;  3ZVV A;  2KKC A;  3V3X A;  2WX0 A;  3VTU A;  3P4P B;  2V0G A;  2N9P C;  2HJ8 A;  2BYE A;  1SXT A;  3L13 A;  4DDI D;  2JPH A;  3I9V 1;  2REX A;  3PLU A;  1F52 A;  1J19 A;  3ZXR A;  1WI0 A;  4WJP A;  2Z8L A;  3SHQ A;  2KZR A;  1YN3 A;  1GC7 A;  2KMM A;  1N6Z A;  2MX2 A;  4WUR A;  4FJZ A;  1EF5 A;  5L95 C;  2Y5B B;  2WXH A;  4MJS A;  3AXC A;  4AJY B;  2D2Q A;  1YQ3 B;  2FUH B;  2ZNV B;  2KJH B;  1ET6 A;  2KMA A;  1OFF A;  4J3O D;  4PYU A;  1CZP A;  4W9G A;  4WWN A;  3GE3 C;  2K0P A;  1MPE A;  2ZVO A;  5DPS A;  3RT3 B;  1QOA A;  4ARC A;  2K1F A;  1Y8R C;  4EZK A;  4J6I A;  1KF6 B;  1C76 A;  4A9A A;  1E90 A;  4WWM A;  1V5O A;  2O2V A;  4NAW B;  2WXN A;  4XZ4 A;  1XLP A;  2DHZ A;  3AE3 B;  1TS5 A;  2A4Z A;  4I6P A;  3ONS A;  1RWS A;  1NEN B;  1RFK A;  2WHI A;  4ZDV A;  3PZ8 A;  1LQB A;  2CU1 A;  2WU5 B;  1IGC A;  3ZLZ A;  3A9J A;  3VRB B;  2IGH A;  2RSU A;  1OGW A;  4IM0 A;  1V2Y A;  4NJC A;  1UWM A;  3TL5 A;  2M0A A;  2SAK A;  3KVF B;  1K53 A;  4WJN A;  2GBK A;  2ZPN A;  1AW7 A;  3RCZ A;  4IWQ A;  3ZJT A;  1NBF C;  1JCK B;  2JWU A;  4TKN A;  1TGZ B;  1WRI A;  3HK0 A;  1XQQ A;  4H2A A;  4GSW A;  3NS1 A;  2YEP F;  1I4Q A;  4IW0 A;  5T8I A;  1OEY J;  1UD7 A;  1ZGU B;  2WXG A;  4PS7 A;  4MM3 B;  1TKY A;  3ML9 A;  1DOY A;  2HTM E;  5LXI B;  3DOW A;  2CR5 A;  4K7S A;  3AED B;  2XN9 C;  3O13 A;  1C3T A;  4G0N B;  2V1Y A;  4O1N A;  1GAQ B;  1WSP A;  3N1Z C;  3CSF A;  3P1M A;  1FPY A;  1PGX A;  3AMZ A;  4I6N B;  4A3P A;  1JWM D;  3MC8 A;  1KJT A;  4KZ0 A;  2N1V A;  1JML A;  3MJW A;  1D5M C;  5MPO A;  1K52 A;  4EKU A;  3HUI A;  4MSM B;  3U4E G;  3V6E B;  1VLB A;  1P1A A;  4FUL A;  3ZNG C;  3TEX A;  2KWU B;  2AQ3 B;  2JRH A;  2K8H A;  1K8R B;  4GU2 A;  1WXQ A;  2HD5 B;  3H7S A;  3M63 B;  2FBW B;  4PT5 A;  2PVG C;  2OJR A;  1K50 A;  1VDV A;  2JXT A;  4I6L B;  4GOC A;  3HM6 X;  2G4S A;  3EHV A;  1XO3 A;  1TZ1 A;  3EC8 A;  1WWT A;  4HPM B;  2Y3A A;  1D5X C;  1TKE A;  2PPH A;  3VQI A;  1E8W A;  1EM7 A;  4GDL A;  4YL8 A;  2WXJ A;  2MHJ A;  4K7U A;  1YJI A;  2I1J A;  4FN2 A;  3L10 B;  3BVG A;  3U7Z A;  1CMX B;  1C4C A;  3B08 A;  4WJQ A;  3Q8E A;  3BVM A;  2KYW A;  2B76 B;  3EFU A;  4RNA A;  4KX6 B;  1L7Y A;  4KGR A;  3E9S A;  4RM9 A;  2QCZ A;  3ETR A;  4PS8 A;  4WAF A;  2KFJ A;  2SEB D;  1J7C A;  1FNU A;  2DZM A;  3B2F A;  3H7P B;  2K9X A;  1F1H A;  4BVU C;  3O65 B;  3BVZ A;  4GDK B;  1WGR A;  3DBH I;  1D6E C;  1EU4 A;  2KWC A;  3AB5 A;  2AQ2 B;  2EMT A;  2G9H D;  3RUI B;  2XEW A;  1TTN A;  2HTH A;  1YMH E;  2KT7 A;  3FIL A;  5LXH A;  4HWI B;  2N7J A;  4G11 A;  2N0S B;  3U7D A;  2R61 A;  2FAZ A;  3AH7 A;  1KRH A;  1NEK B;  2WX1 A;  2DBY A;  1TJE A;  4AP4 C;  1WY8 A;  2V9H A;  2ZVN A;  1NDD A;  1DGJ A;  2UU7 A;  1FCC C;  2DNF A;  3GOE A;  3BZD B;  1SIJ A;  2PMV A;  4P1B C;  1M94 A;  1UZX B;  4MAC A;  1F2R C;  4K3C A;  1LGR A;  4P6V F;  2IJ0 A;  4C7Y A;  2N4F A;  1WX9 A;  1UNS A;  3EUB 2;  2GRI A;  3M62 B;  1E7U A;  3W1S A;  3QAR A;  3VR9 B;  2JU6 X;  2KMC A;  1HQR D;  2YEP B;  4DWF A;  3NY5 A;  2W3S A;  4HKQ A;  4B9K A;  2D11 A;  2L0T A;  4Q2J A;  2ZEQ A;  2IO3 B;  1F0Z A;  3PV1 A;  4IG7 B;  4XE0 A;  2MRP A;  3RNE C;  4IOI E;  1ET9 A;  2FIF A;  4DXF A;  2WNM A;  1FXT B;  4WJO A;  1QOB A;  1IYF A;  3GB1 A;  4LNO A;  2DYO A;  1JWA D;  3DBR I;  2WXR A;  2FUG 1;  1VZ7 A;  4LJP B;  4ZOH C;  1WXS A;  3NVV A;  2KQ7 A;  2L1A A;  4JQW C;  3IT6 B;  5EE1 A;  1J7A A;  2LUE A;  2PIA A;  3AV8 A;  4US8 A;  2JQR B;  1ACC A;  1HZ5 A;  3PHX B;  3IXS A;  3P2B A;  4ICU A;  1EUV B;  3ZTD A;  1D3Z A;  2PE9 A;  3H9D A;  1UGM A;  3AM9 A;  4C4V A;  4FAD A;  4HPP A;  1I4R A;  2ZCB A;  4GGQ A;  2PEA A;  1A5R A;  1V6E A;  5E6P A;  2C7H A;  1IPG A;  1WH3 A;  4MH8 A;  3N20 C;  1P3Q U;  2MLB A;  3DVN U;  3HVD A;  3M3J A;  4QAY A;  2WXL A;  1SE3 A;  3AN1 A;  2V3S A;  1E0Z A;  3L54 A;  1L6V A;  4HDQ A;  2M8S A;  5H92 C;  1N5X A;  3P4Q B;  2X8X X;  2LMC A;  1S3S G;  1ZE3 D;  4BKT A;  4JGH B;  4RM8 A;  3VUX A;  2GLS A;  2NBV B;  1L0X B;  2G3Q B;  1F9J A;  1C78 A;  1FO4 A;  1L6U A;  2KFK B;  3DHI C;  1V8C A;  2MA9 B;  1ZUD 2;  1UBI A;  4KV2 A;  1ZDV A;  1T6B X;  2ZJD A;  1JRO A;  2HDE A;  2NPT B;  1I7H A;  2LVO A;  4YSY B;  1TS4 A;  2BKF A;  4W9F A;  4OVU A;  1PFD A;  3VTW A;  2DYM A;  2RDH A;  1EF1 A;  3Q6B A;  2FCN A;  3IFW B;  4NJ7 A;  2VH2 A;  1WRD B;  4MGZ E;  2BYT A;  3AEC B;  3A1Q A;  3W5V B;  1TS3 A;  2LWP A;  2LGX A;  3EFC A;  4KGT A;  3T3N A;  3JW0 X;  3A9K B;  2WQY B;  3RI7 C;  4MSQ B;  2KNB A;  4MGY E;  2ZNV C;  4W9L A;  2BS2 B;  1K51 A;  2WXP A;  1F77 A;  5C23 A;  2IO0 B;  2QDF A;  2KTF A;  3TCA A;  3ZJU A;  2GBR A;  1UF0 A;  1LFD A;  1QQR A;  1V1O A;  3C8Y A;  1XLQ A;  1J0G A;  2MW5 A;  1JRP A;  3MFG A;  1E6E B;  2EMS A;  5DCN A;  2W55 A;  1U4A A;  2Z59 B;  3V61 A;  1UWX A;  1OQQ A;  1XD3 B;  3H8H A;  4USA A;  1QF6 A;  5BMH A;  4KIK B;  3ZNZ B;  2WP9 B;  3LB8 C;  5C2T B;  3ZYY X;  1ZKH A;  4ANV A;  2FCS A;  4FA6 A;  3I5J C;  3VVW B;  2M4N A;  4BFR A;  4MGI E;  3HVZ A;  1RRB A;  1BXT A;  4AOF A;  3I57 A;  2WXI A;  2DEN B;  2IY0 B;  4LJO B;  3APD A;  3KLS X;  4RGO S;  4OHJ A;  3Q8A A;  1HA5 A;  2J7Q B;  3Q14 C;  5HKH A;  2CHW A;  3BII D;  4NY0 A;  3TJP A;  4JE3 B;  3ZQ4 A;  3WIM A;  2CHZ A;  3MP9 A;  2UYZ B;  4WQO B;  1XLO A;  2LRW A;  3MC9 A;  2D3A A;  3B1L X;  3V60 A;  3NZS A;  2PE6 B;  5CX3 A;  2MBH A;  5J18 A;  3QAQ A;  3GS2 A;  4AUQ C;  1T0S C;  3ABV B;  3R2I A;  4YTM B;  3APC A;  2N9X A;  3IG3 A;  2OHF A;  5IN7 A;  2RMM A;  3V6C B;  4YSX B;  1NI3 A;  2DZJ A;  3AE7 B;  3ZNH B;  2NR2 A;  3ZGZ A;  1N63 A;  2BYF A;  2KDF B;  2ICI A;  3E56 A;  3DBL I;  2GBN A;  3R7Q A;  4OZC A;  2JUO A;  2WXF A;  1L2N A;  3VUW A;  3VHT C;  2GBM A;  1V1P A;  1ZDX A;  2MJ3 A;  2JX5 A;  1YIW A;  1Q0W B;  5L83 A;  1WFY A;  1OQY A;  1SE2 A;  2B3A A;  4HK2 A;  3SFD B;  3QC8 B;  5G5H A;  4ICV A;  1L0V B;  2R2O A;  3H6N A;  4C7Z A;  4GDK A;  2KLG A;  4WIP A;  5AZF A;  4LNK A;  1SSN A;  3AEA B;  4XWT A;  2OOB B;  3GZN B;  1VRA B;  3ENE A;  2MP2 B;  3QX1 A;  1N60 A;  3T9L A;  4N9F 4;  4CHK A;  3IHP C;  3FKY A;  2Z0E B;  3APF A;  2WDT B;  4ASW C;  3BY4 B;  1FFU A;  1F2R I;  1YN5 A;  2WDQ B;  4GIV A;  2D3B A;  3K9P B;  2BF8 B;  1T0Y A;  4W9E A;  2FE8 A;  4PYZ A;  2KHW B;  1P0R A;  1L4D B;  2YVC A;  3AEG B;  4HLE A;  3WAO A;  1PYW D;  3L16 A;  3NUH B;  2W54 A;  4NJ6 A;  1YD8 U;  3KW5 B;  2PTL A;  1WIA A;  3OAW A;  1WXM A;  3CIR B;  1PGA A;  3MC0 B;  3RNF C;  1ZPS A;  2L76 A;  2K8C A;  4EOY A;  3ZIM A;  2QEJ C;  4WWP A;  1V5T A;  3RZF A;  2CHX A;  1ZW7 A;  4JPS A;  3BK1 A;  2EKE C;  4C56 C;  2K5P A;  1TY2 A;  2CU3 A;  4ANX A;  4XGA B;  3U30 A;  4NQK E;  5CHF A;  2W3R A;  5JHB A;  3BYY B;  3QA8 A;  1WMH A;  4BOS C;  2PLP A;  2MSE D;  4ZHP A;  2RGF A;  2IDY A;  1I4X A;  3S2A A;  4IUM B;  4ZRJ A;  3PTF C;  2KK8 A;  1MHX A;  2Z0D B;  2BWE S;  2J0K A;  4WH4 A;  3OWE B;  5IO9 A;  4CO7 A;  2AWT A;  2BB5 A;  3JSV A;  3ZDM C;  4TV3 A;  2FID A;  4EE2 A;  5C1Z A;  1ROE A;  3R8B A;  2O6V B;  5CTR C;  5AUK A;  1WXV A;  4LK0 M;  1HTO A;  3C19 A;  3Q3F A;  4II2 B;  2LHD A;  2BQQ A;  3RD2 A;  5IKC M;  4ANU A;  1YX6 B;  3TEW A;  3I3T B;  2WDV B;  1GG3 A;  4YWG G;  3ZXV A;  4FBJ B;  4G3X B;  3VH4 B;  2MBO A;  2KC2 A;  2BT6 A;  3P63 A;  1YJJ A;  2MWS B;  1I42 A;  3PSE B;  4AJW A;  2CJN A;  3VUY A;  4DHJ B;  3SR6 A;  2BTE A;  1JW9 D;  1ZXI A;  5I4D A;  3ZDT A;  2R2Q A;  4OZB A;  3P4R B;  5BYR A;  4M0W A;  5TR5 A;  2QIE B;  1WF9 A;  2XNA C;  4RGT A;  3QWZ B;  5E6N A;  1YQB A;  1V9J A;  4RGN A;  2DYB A;  4AWJ A;  4TMA B;  2OJW A;  2C7N B;  4K1R B;  4ZYS A;  4JX1 C;  1GUA B;  3R7R A;  2LJ5 A;  2GOW A;  4DXG A;  1P7F A;  2XK5 A;  1E7P B;  1H4R A;  3KWL A;  3QIJ A;  3AE6 B;  2KVR A;  2KOX A;  4IKG A;  1LO5 D;  1FD6 A;  3N1X C;  3P42 A;  1IBX A;  4ZRP A;  3B2G A;  2MJD A;  3PT2 B;  3QJZ A;  2NBW B;  2KFK A;  2KX0 A;  3Q3M C;  2JXX A;  3RZW C;  1UUP A;  3DHH C;  2MH7 A;  2ON8 A;  3Q8F A;  3A4S C;  3M95 A;  2KTR B;  1GJZ A;  4BBN F;  2NPT A;  3N30 A;  4ARI A;  3C0R B;  3TIX A;  3CMM B;  3W9C B;  3LJ3 A;  1Z5S B;  1QZE A;  1JWS D;  3CF6 E;  2ZZP B;  4K7W A;  3TMP B;  1MG8 A;  1YOV B;  2LGS A;  5FK9 C;  2WGS A;  2A5U A;  5AZH A;  4ITK A;  4L1B A;  2BVC A;  1N62 A;  3CWI A;  2JRI B;  2ZPY A;  3VRA B;  1WZ3 A;  4F1S A;  3DVG Y;  3NVZ A;  1CQV A;  2N9K A;  2O2V B;  5TSS A;  4X57 B;  3PZD A;  1TY0 A;  2NS5 A;  1SB3 C;  4W9D A;  5JXV A;  4BKS D;  1IUE A;  2L05 A;  1FRR A;  3MTN B;  3DWG C;  3KQ4 A;  4EFO A;  3A9J B;  1ESF A;  5HI1 A;  3ZTC A;  3TEZ A;  1XLN A;  4MDK E;  1WXA A;  1YX5 B;  5J2R A;  1R4M B;  4HXD A;  3AU5 A;  3ZRC A;  4TSS A;  3N3K B;  1YJ1 A;  1V49 A;  1YN4 A;  4LDT B;  1BML C;  2PJH A;  4KIK A;  2L52 A;  1UH6 A;  4W9H A;  3WAL A;  4RFB A;  3ZJV A;  4E74 A;  4LCD E;  3PVL A;  1Q10 A;  2WS3 B;  3PRP B;  4DBG A;  4JLC A;  4BOZ B;  2K39 A;  1WJU A;  1C9F A;  2IZV B;  2NVU I;  3AE1 B;  5D3D A;  4RF0 A;  5D7G A;  4YXD B;  3DCG A;  3MHZ A;  2N9L A;  5DPR A;  4JIO U;  5LNK 1;  1SBB B;  1Q1O A;  1BT0 A;  3DWM A;  1WYW B;  3PZ7 A;  2V4L A;  1I4P A;  4KKJ A;  3QK0 A;  2AL6 A;  3ECI A;  2IY1 B;  1FFV A;  4XC2 A;  2KQ4 X;  1B9R A;  5CHW A;  3SU8 X;  5KHQ A;  5KHO A;  1MJD A;  1WE7 A;  4ZRQ A;  1D4B A;  2KAN A;  1FM0 D;  4JWS C;  4JL9 A;  5HHD G;  4HCN B;  2EKI A;  4A20 A;  2H88 B;  3IAM 1;  3HIZ A;  4EEW A;  1T3Q A;  1TS2 A;  1JRU A;  2IO2 B;  1WGY A;  3L08 A;  1TIF A;  2LRU A;  4RMA A;  3KUC B;  3NZ3 A;  2KQS A;  1N5W A;  2LXA A;  2PKO A;  5G5G A;  1MVK A;  2INP E;  3DHG C;  3UF8 A;  2BYV E;  2RDB C;  3V05 A;  4YTN B;  4M8N A;  4P1C C;  5EE9 A;  4W9J A;  1PQS A;  2GI9 A;  2V3N A;  2DAJ A;  1CJE A;  2K6Q A;  5EDS A;  2KWD A;  1WE6 A;  2IGG A;  2WLB A;  3PRZ A;  1LXD A;  2D3G A;  2MJE A;  4B0M A;  3BK2 A;  1EWY C;  2L00 B;  2UWQ A;  3AI5 A;  1IGD A;  1P98 A;  3BYT B;  3SEB A;  3RFZ B;  4FHJ A;  1LM8 B;  2J53 A;  4JWU C;  2MP2 A;  4ZRI A;  2ACZ B;  4NAW A;  1ZP0 B;  3R3M A;  1M4V A;  3ZUN A;  2GB1 A;  2J42 A;  1R7S A;  2AYO B;  1FXI A;  2G1E A;  1MI0 A;  3BIN A;  2MCN B;  3Q8C A;  4KZC A;  4ZYN A;  5GXG B;  4ANW A;  1HXY D;  1FMA D;  4XYC A;  2FCM A;  4C00 A;  1ZXH A;  4N58 A;  4HJG E;  3AE4 B;  2C5L C;  2QC8 A;  2N9E B;  3PS6 A;  1E10 A;  2I1K A;  1OEY A;  4URK A;  4DHZ E;  3I63 C;  2LFI A;  3FIL B;  1FCL A;  3DPD A;  2N7E A;  2D07 B;  4UDU C;  1B1Z A;  3UQB A;  4HEA 1;  1J7B A;  1XXG A;  2INC C;  2KDB A;  2QHO A;  1ISN A;  3Q8B A;  1GC6 A;  2XBB C;  4HCP B;  2LVQ A;  2IPK D;  3ML8 A;  4BZA A;  4MM3 A;  4E71 A;  1WZ0 A;  3PRE A;  3QHT A;  3QCA A;  4NZL B;  4W9I A;  4NPN A;  4MH0 E;  2KXJ A;  4FJV B;  3UGB B;  2IBI B;  4IWP A;  2LHE A;  1WM2 A;  1IP9 A;  2JZP A;  5H8Y E;  5LLI A;  3RMK C;  4A3O A;  5GMV A;  2X38 A;  4YT0 B;  1AWD A;  2E3T A;  2LEK A;  1SIF A;  3P4S B;  3AEE B;  1VR9 A;  3KWV A;  3Q3J A;  4GB9 A;  1E7V A;  2BPS A;  3NVW A;  2JZZ A;  2EEL A;  1G6J A;  2LGY A;  4RF1 A;  3UIO B;  3VDZ A;  1KLU D;  1C79 A;  2QMT A;  4GLS C;  2D3C A;  1C4A A;  3OLM D;  5DPW A;  3KUD B;  1VJK A;  3HM3 A;  3R2T A;  4TUU A;  3ZO5 B;  2GMI C;  4FXC A; 
#chains in the Genus database with same CATH homology
 4ZHP A;  1YQ4 B;  2N7J A;  1L5P A;  2IDY A;  1I4X A;  1SF0 A;  1FEH A;  2N0S B;  3LYY A;  4GDL B;  2R61 A;  5D3I B;  3AH7 A;  3FAH A;  1KRH A;  1NEK B;  2DBY A;  3BWU D;  1MHX A;  1TJE A;  2H89 B;  2WXQ A;  2CJO A;  4WH4 A;  3OWE B;  2M56 B;  2BB5 A;  4OW0 A;  1IBX B;  1FNV A;  2ZW1 A;  1DGJ A;  4EE2 A;  1FCC C;  1ROE A;  1ENF A;  2PVO D;  3BZD B;  3R8B A;  3AE2 B;  4KGS A;  1SIJ A;  5AUK A;  2PMV A;  1FXA A;  4LK0 M;  4HRO A;  4L2Y A;  4A6Q A;  1GB4 A;  2MEK A;  2LHD A;  1EWC A;  4MAC A;  1F2R C;  2RPV A;  3TEW A;  1DOX A;  1RM6 C;  4P6V F;  2WXO A;  2IJ0 A;  4C7Y A;  2WDV B;  1FRD A;  4YWG G;  1UNS A;  3EUB 2;  2GRI A;  5EE0 A;  3W1S A;  3VR9 B;  4N59 A;  2JU6 X;  1HQR D;  1PUT A;  2YEP B;  3W5U B;  4TQ0 A;  2BT6 A;  2BBC A;  3P63 A;  1YJJ A;  4L23 A;  2KN4 A;  5FR3 A;  2W3S A;  4HKQ A;  1PGB A;  4HKZ E;  2CJN A;  4Q2J A;  3U52 E;  2BW2 A;  3SR6 A;  2E6X A;  4XDD A;  1TZO A;  3UI3 A;  2I2Y A;  1F0Z A;  2JSV X;  4XE0 A;  2BTE A;  4IOI E;  1ET9 A;  4DXF A;  1JW9 D;  1ZXI A;  2VZK B;  2WNM A;  3T3O A;  1PDX A;  5I4D A;  4C80 A;  5BMG A;  1QOB A;  4OZB A;  3P4R B;  5BYR A;  4M0W A;  2QIE B;  3B9J A;  1I4G A;  2XNA C;  3NVY A;  4RGT A;  3GB1 A;  2DYO A;  1JWA D;  1SE4 A;  5AUI A;  4RGN A;  1GOZ A;  2WXR A;  1T5X D;  2BS3 B;  2FUG 1;  4TMA B;  1VZ7 A;  2VZK D;  2AX5 A;  4JX1 C;  4ZYS A;  3EA6 A;  3AEB B;  4ZOH C;  3NVV A;  1P7F A;  4DXG A;  1E7P B;  1FNW A;  2DWQ A;  3KWL A;  4AQ7 A;  1N61 A;  3AE6 B;  2L1A A;  3L4P A;  4IKG A;  4RGM A;  4XDC A;  1LO5 D;  3IT6 B;  1FD6 A;  5EE1 A;  1YNT E;  3P42 A;  4B0E A;  1IBX A;  4ZRP A;  1KTK A;  2NTS A;  1BUI C;  3B2G A;  5HG2 A;  2MJD A;  1J7A A;  2WXK A;  2PIA A;  3TUO A;  3AV8 A;  2Y5P A;  4US8 A;  2JQR B;  1ACC A;  2M19 A;  1HZ5 A;  3FC4 A;  1DYQ A;  3IXS A;  3IT4 B;  1UUP A;  1VZ6 A;  1SJE D;  1Y56 A;  2MH7 A;  2WXM A;  4A55 A;  4REZ A;  4OVZ A;  2ON8 A;  1QOG A;  4R3D A;  3Q8F A;  3AM9 A;  4RH6 A;  2LGI A;  2Y5C A;  1RYJ A;  2K22 A;  1I4R A;  5BYS A;  4A90 A;  4ARI A;  2JYT A;  4YSZ B;  3W9C B;  1JWS D;  2PW9 A;  2LJI A;  2Q5W D;  1SJH D;  2K3U A;  2NTT A;  4A8X C;  5FK9 C;  1QOF A;  2W82 A;  4MH8 A;  2BB6 A;  5C3J B;  1A70 A;  1XCT L;  5BYQ A;  1SEB D;  3HVD A;  1KFY B;  1JWU D;  4ITK A;  2I38 A;  4L1B A;  1N62 A;  3EGR A;  3CWI A;  2WXL A;  2ONQ A;  1SE3 A;  3VRA B;  3AN1 A;  1XCQ L;  4ZHO A;  1E0Z A;  2WDR B;  1JWB D;  2LUM A;  3U2S C;  1STE A;  5E6J A;  1L6V A;  1HZ6 A;  1XF5 L;  1ZOY B;  5H92 C;  4WQM A;  1N5X A;  3P4Q B;  2LMC A;  3NVZ A;  1CQV A;  1ZE3 D;  1JAL A;  3RPF C;  4LTU A;  3MJ5 A;  2N9K A;  4MT5 A;  5TSS A;  1CK1 A;  2NMQ A;  1TY0 A;  1L0X B;  1SB3 C;  5JXV A;  1GB1 A;  1C78 A;  1FO4 A;  1L6U A;  3V3X A;  1JQ4 A;  3PO0 A;  1IUE A;  3IAS 1;  3P4P B;  2V0G A;  1FRR A;  3LXF A;  1V8C A;  3DWG C;  3KQ4 A;  1SXT A;  2JYE A;  1ZUD 2;  1UGJ A;  1ZDV A;  1ESF A;  5HI1 A;  1T6B X;  3I9V 1;  1XLN A;  1MHH E;  3TEZ A;  1DOI A;  1JRO A;  2AQ1 B;  3TSS A;  5HFY A;  4HRS A;  2HDE A;  1I7H A;  4YSY B;  1TS4 A;  1EU3 A;  1PFD A;  2Z8L A;  4TSS A;  2DYM A;  2QIL A;  2RDH A;  1YN4 A;  5BMI A;  4AS1 A;  2BYT A;  1WYG A;  1BML C;  1YN3 A;  3AEC B;  2L52 A;  2KMM A;  4WUR A;  3W5V B;  2L83 A;  1TS3 A;  3J9C A;  4KGT A;  4RFB A;  3ZJV A;  3T3N A;  2WQY B;  2ZW0 A;  2WXH A;  4KKI A;  1Q10 A;  4N6E B;  2WS3 B;  1YQ3 B;  2BS2 B;  1NYR A;  1K51 A;  1ET6 A;  2WXP A;  1F77 A;  1OFF A;  4J3O D;  1CZP A;  2L32 A;  3GP7 A;  4DQO C;  3AE5 B;  1WGK A;  2INN E;  2K0P A;  1MPE A;  3ZJU A;  2D5G A;  1NYQ A;  1C9F A;  1QOA A;  4ARC A;  3AE1 B;  5D3D A;  4RF0 A;  5D7G A;  4YXD B;  1QQR A;  1KF6 B;  1C76 A;  3MHZ A;  1V1O A;  2N9L A;  4A9A A;  5LNK 1;  1SBB B;  3C8Y A;  3DWM A;  3W2D A;  4WWM A;  3TEY A;  1XLQ A;  3PZ7 A;  1JRP A;  2TSS A;  1I4P A;  3MFG A;  4NAW B;  4KKJ A;  1E6E B;  2WXN A;  1XLP A;  3AE3 B;  1TS5 A;  2W55 A;  2QJL A;  4D2K A;  1FFV A;  1B9R A;  2KQ4 X;  5FKA C;  1OQQ A;  1UWX A;  2WU2 B;  1RWS A;  1NEN B;  1RFK A;  3H8H A;  4USA A;  1QF6 A;  1KLG D;  5BMH A;  4ZRQ A;  3PZ8 A;  1D4B A;  2WP9 B;  3LB8 C;  5C2T B;  1FM0 D;  4JWS C;  2WU5 B;  3ZYY X;  5HHD G;  1IGC A;  1QKZ A;  3WCQ A;  1I4H A;  3VRB B;  2IGH A;  1V1P B;  3HVZ A;  1BXT A;  2EKI A;  4NJC A;  1UWM A;  2H88 B;  3IAM 1;  2M0A A;  2SAK A;  1K53 A;  3I57 A;  1T3Q A;  1TS2 A;  2WXI A;  3KLS X;  4RGO S;  4OHJ A;  3Q8A A;  1AW7 A;  4NAM A;  1HEZ E;  1HA5 A;  3NZ3 A;  3ZJT A;  1N5W A;  1JCK B;  2JWU A;  2PKO A;  5G5G A;  1WRI A;  1MVK A;  3BII D;  2IGD A;  2INP E;  4H2A A;  3NS1 A;  1C77 A;  4JE3 B;  4XWW A;  2YEP F;  3ZQ4 A;  1I4Q A;  3V05 A;  4YTN B;  3MP9 A;  5T8I A;  1XLO A;  5EE9 A;  2WXG A;  4MM3 B;  1TKY A;  2GI9 A;  1DOY A;  2DLB A;  2HTM E;  2KDM A;  2V3N A;  1CJE A;  3GS2 A;  2KWD A;  2IGG A;  3ABV B;  2WLB A;  3AED B;  3R2I A;  2XN9 C;  3O13 A;  4YTM B;  2J4X A;  3Q69 A;  1D5Z C;  3SFE B;  2MJE A;  4B0M A;  3BK2 A;  1EWY C;  3AEF B;  2OHF A;  2RMM A;  4YSX B;  1IGD A;  3BYT B;  4O1N A;  3SEB A;  1NI3 A;  3RFZ B;  1GAQ B;  1WSP A;  3AE7 B;  3P1M A;  3ZGZ A;  2J53 A;  1PGX A;  3AMZ A;  4JWU C;  2ACZ B;  1ZP0 B;  2QSD A;  1N63 A;  1JWM D;  1M4V A;  2ICI A;  2GB1 A;  1V97 A;  2OED A;  2J42 A;  3E56 A;  1R7S A;  2G1E A;  1FXI A;  1JML A;  1KH0 A;  1D5M C;  1VZ8 A;  1MI0 A;  5MPO A;  1K52 A;  3N9Y C;  3Q8C A;  4CQN A;  5GXG B;  4OZC A;  3HUI A;  2KAJ A;  3U4E G;  1HXY D;  1VLB A;  1FMA D;  2WXF A;  1AN8 A;  4TQ1 A;  3TEX A;  5EE3 A;  1V1P A;  1ZDX A;  2MJ3 A;  1ZXH A;  2AQ3 B;  2JX5 A;  3NRZ A;  4N58 A;  1L0Y B;  4HJG E;  2KAC A;  3AE4 B;  1SE2 A;  3SFD B;  1E10 A;  5G5H A;  1WXQ A;  1L0V B;  1TYG B;  4US9 A;  2LFI A;  3FIL B;  1NVI D;  1L4Z B;  1FCL A;  3HRD D;  2FBW B;  4PT5 A;  4C7Z A;  4UDU C;  2PVG C;  4RCO A;  1B1Z A;  1QIL A;  1K50 A;  1VDV A;  2JXT A;  2V4I B;  4HEA 1;  4WIP A;  1J7B A;  1XXG A;  1SSN A;  1XO3 A;  1P7E A;  3AE8 B;  3AEA B;  1WWT A;  4XWT A;  2Y3A A;  2V3P A;  3Q8B A;  4P16 A;  1D5X C;  2IPK D;  1TKE A;  2BS4 B;  1GPX A;  1VRA B;  1N60 A;  4NZL B;  3VQI A;  1FFU A;  1F2R I;  1XEE A;  1YN5 A;  1QLB B;  1EM7 A;  2WDQ B;  4IDI A;  2LHE A;  2WXJ A;  1E9M A;  2JZP A;  3AE9 B;  5H8Y E;  1YJI A;  2FE8 A;  3BVG A;  3U7Z A;  3URY A;  1C4C A;  1AYF A;  2X38 A;  4YT0 B;  1AWD A;  3Q8E A;  1L4D B;  1OQR A;  3BVM A;  2E3T A;  2LEK A;  3AEG B;  2B76 B;  1C4P A;  1PYW D;  4RNA A;  4KX6 B;  3NUH B;  4KGR A;  3E9S A;  1QT9 A;  3AEE B;  3P4S B;  2W54 A;  1VR9 A;  3ETR A;  4WAF A;  2PTL A;  2SEB D;  3KWV A;  1J7C A;  3NVW A;  1FNU A;  3B2F A;  3CIR B;  1PGA A;  3MC0 B;  1TKG A;  2K9X A;  2EEL A;  1ZPS A;  2RDG A;  4RF1 A;  2QEJ C;  3BVZ A;  4GDK B;  1KLU D;  1C79 A;  2QMT A;  3VR8 B;  4JPS A;  1D6E C;  3BK1 A;  1EU4 A;  1FIQ A;  4GLS C;  3AB5 A;  2AQ2 B;  4C56 C;  1C4A A;  2K5P A;  1TY2 A;  2G9H D;  4LLG M;  2CU3 A;  4YTP B;  1VJK A;  1YMH E;  2W3R A;  3R2T A;  3BYY B;  4FXC A;  3FIL A;  4OZA A;  2J52 A;  2PLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...