2Q5WD

The x-ray crystal structure of molybdopterin synthase from staphylococcus aureus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
MKVLYFAEIKDILQKAQEDIVLEQALTVQQFEDLLFERYPQINNKKFQVAVNEEFVQKSDFIQPNDTVALIPPVSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdopterin-converting factor subunit 2
publication title Crystal structure of a molybdopterin synthase-precursor Z complex: insight into its sulfur transfer mechanism and its role in molybdenum cofactor deficiency.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 19
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2007-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2q5wD00
1FMAD 2BS2B 3SR6A 2QJLA 3NVZA 1FFUA 1GAQB 2JQRB 4YXDB 3AE9B 1XLPA 2BT6A 3ZYYX 1QLBB 2DBYA 3AE4B 3AE8B 1YQ3B 1ZUD2 4IDIA 3W9CB 4C7YA 1CJEA 1NENB 3SFDB 3CIRB 1GPXA 2MJEA 1L0VB 1DGJA 4USAA 1N60A 2BS4B 1AWDA 2W55A 1TKGA 1JALA 2KAJA 2MJ3A 1QT9A 1RFKA 1WXQA 1NI3A 1UWMA 2PIAA 3AE7B 3B2FA 3FAHA 4KX6B 1VJKA 3B2GA 1V8CA 1JROA 4N58A 5H8YE 5GXGB 2WQYB 1NVID 1QOBA 1SB3C 1TYGB 2WDVB 1OQRA 4YTNB 2B76B 2HTME 5EE9A 1E0ZA 1PUTA 1WWTA 2WU2B 2K5PA 3AEEB 1R7SA 4HRSA 1TKEA 2H89B 1FO4A 3ABVB 1TJEA 1VLBA 3AE3B 1JW9D 1ZOYB 3NRZA 4C7ZA 5C2TB 1N63A 2LEKA 1N5WA 4ZHOA 1SF0A 5G5GA 1QOGA 3P63A 5H92C 2JX5A 3SFEB 1JQ4A 1OFFA 1L5PA 2WDRB 1KRHA 3AM9A 4A9AA 1FXAA 2CJOA 4US9A 3W5UB 4YT0B 2EKIA 1VDVA 2M56B 3CWIA 3AMZA 1QOFA 3NVVA 3ETRA 5EE3A 3AB5A 4HROA 4C80A 2CJNA 2WDQB 1NEKB 2L83A 1XLNA 2MH7A 3AECB 3AV8A 3HRDD 3HUIA 4JX1C 2G1EA 1WRIA 4LTUA 2OHFA 2H88B 3VRBB 4ZHPA 1NYRA 1E9MA 1N61A 3VR8B 1PDXA 2DWQA 1E7PB 2ACZB 1FIQA 2M19A 1DOIA 3AEDB 2WS3B 5AUIA 2W54A 2CU3A 1N62A 3AE5B 1I7HA 1KFYB 3AEAB 4P6VF 1AYFA 3FC4A 1RWSA 3DWGC 1EWYC 1JRPA 3BIID 5G5HA 1NYQA 1PFDA 3WCQA 4YSXB 4WWMA 1IUEA 2PKOA 4YSZB 3AE1B 1FRDA 3NS1A 1E10A 3AN1A 2Q5WD 2KMMA 4N6EB 3RPFC 4FXCA 1XLOA 1N5XA 3PO0A 1WYGA 3AE6B 2Y5CA 1QF6A 1YJJA 3VRAB 3KWLA 1FRRA 1ROEA 1FFVA 1E6EB 2QIEB 3P4PB 2W3RA 1DOXA 2K9XA 3VR9B 2FBWB 2WLBA 3W5VB 1A70A 1L6VA 4YTPB 1CZPA 1B9RA 1QOAA 1FXIA 1J7CA 1SIJA 1F0ZA 4N59A 1YJIA 4WQMA 5MPOA 1TKYA 4YSYB 1L6UA 3EUB2 1XO3A 4US8A 1KF6B 1OQQA 2AX5A 3DWMA 1WGKA 4JWUC 1DOYA 1ZP0B 1JWBD 5EE1A 3B9JA 2WU5B 5EE0A 3NVWA 1XLQA 3AEFB 3P4RB 4ZOHC 3AE2B 5AUKA 1T3QA 1V97A 1J7AA 2K22A 3NVYA 2N0SB 3HVZA 2BS3B 3AH7A 4ITKA 3P4QB 3P4SB 1FM0D 3AEBB 2L52A 1JWAD 3P1MA 4JWSC 4YTMB 1YQ4B 1J7BA 2E3TA 3L4PA 3AEGB 3LXFA 2W3SA 5C3JB 2MJDA 2WP9B 1RM6C 1RYJA 1ZXIA 2PVGC 3LB8C 2PVOD
chains in the Genus database with same CATH superfamily
5E6PA 1OEYJ 3H7SA 2JQRB 2ZCCA 3MJ5A 4RM8A 3AE4B 4CYEA 4JPSA 1L0VB 1ZDXA 1Q0WB 2JXTA 3Q6BA 2I1KA 4W9FA 5DPTA 2QILA 3GB1A 1V80A 1OQRA 2HTME 1WX7A 4HRSA 3U7DA 4BBNF 2RR9A 2JX5A 3V6EB 2K3UA 2MX2A 2LXAA 3HRDD 2WXJA 4IWOA 1K52A 4NY0A 5CTRC 2W54A 2KQ4X 3I3TB 2DENB 1C78A 2NTSA 4DQOC 4MJSB 2IPKD 4CQNA 3AN1A 2LI5A 5I4DA 2K39A 2K8HA 3VQIA 3W1SC 4AQ7A 3H7PB 3AE6B 1S3SG 1QF6A 1ROEA 1FFVA 1DOXA 2LGXA 2ON8A 2BBCA 1I4RA 5JHBA 4WQMA 1MG8A 4MGZE 4NJ6A 3TL5A 2RPQA 3KH0A 4FJZA 3B9JA 3KVFB 4DDID 2J0KA 2PE6B 1BMLC 5IAAC 1ZXHA 2E3TA 1WJ6A 3E9SA 5AZHA 2YVCA 1RYJA 1ZXIA 1ZW7A 3MC0B 4XGAB 2BTEA 2K6DB 1D5XC 4GU2A 5CHVC 2JU6X 2TSSA 1PGXA 1TIFA 1YOVB 1HZ5A 3VAWA 4L1BA 3DBRI 3W9CB 2BGFA 1MI0A 1F2RI 3S2AA 1GC6A 1TKGA 2KJ6A 3ZGZA 1WH3A 2WXRA 3B08A 2OEDA 2JY6A 4K3BA 2N9PC 1VRAB 1WGDA 2L1AA 2N9LA 2BYFA 3RULA 4A20A 2LMCA 2KXJA 4ZHOA 1SF0A 2AQ3B 5IO9A 3WA0A 2MHJA 2NPTA 2JZPA 4HROA 4C56C 2DAJA 1MG4A 1YN4A 2PEAA 3AU4A 1E9MA 2DZIA 3UF8A 1IBXA 4AP4C 2WS3B 2ASQA 1VZ8A 4DXGA 3SEBA 4W9KA 3BIID 2RPVA 2PTLA 2LVOA 2PKOA 2LXCA 3O13A 4FJYA 2SEBD 1ZDVA 4FXCA 1P7FA 1N5XA 3Q3MC 1IP9A 5G55A 5AEKB 1YJJA 2IGHA 2WXKA 2BF8B 2C7NB 1PQSA 3ZXRA 2WWZA 4YTPB 1V86A 1F0ZA 2V9HA 2W82A 4US8A 5KHOA 3ML9A 1D3ZA 4HK2A 2JZ3B 2L05A 3P4QB 3A9KB 4KKJA 4JWSC 4RM9A 2V3SA 5HG2A 2K25A 3AE9B 1E90A 4ICUA 4LNOA 1NENB 1C1YB 1ET6A 4K3CA 3RCZA 4BKSA 4PK1A 1V8CA 2K1FA 4N58A 5H8YE 2JYEA 2L32A 4YTNB 1GOZA 4FN2A 3BVZA 3VVWB 2FIDA 1MVKA 4H2AA 1MHHE 1ACCA 2DZKA 2WXMA 2MEKA 2X8XX 3P63A 2CJOA 3RYTA 1VD2A 4NPNA 3VUWA 2LRWA 4GDLA 3HM6X 4E71A 4AOFA 2WDQB 2V4IB 3AV8A 1ISNA 4JX1C 4LTUA 3M62B 4ZYSA 4HPMB 4RH6A 1HXYD 2C5LC 2FCSA 1PDXA 3ZW3A 3Q3NC 2M19A 2QSDA 4HCNB 3NY5A 1WGYA 4RNAA 4A8XC 1JMLA 3MTNB 3P42A 3DVNV 3ZRFA 4RGNA 3PHXB 1EWYC 2QDFA 4B9KA 2BKFA 4KGRA 1AW7A 1FRDA 3NS1A 1KOTA 4FHKA 2I2YA 1BUIC 3A4SC 2MWSB 1E5WA 3ZRCA 4NAMA 5IOIA 2Y5CA 2NTTA 4K7WA 3KWLA 2INDC 4K81A 1FRRA 2JRIB 1SGHA 3RMKC 2W3RA 3V6CB 4PS8A 4WJQA 1NI2A 4BKSD 3NZ3A 3A9JA 4IWPA 4K7SA 1GB4A 5CX3A 3HHMA 4KGSA 1CK1A 3R3MA 1WGRA 2DZJA 3R66C 4BAXA 2IYDB 2QHOA 1BXTA 4PS7A 3DHIC 2KFKA 1SJED 2O6VA 2QCZA 4II2B 4BKGA 2Z8LA 5IN7A 2HD5B 4YXDB 3UINB 4KSKC 1F2RC 4BFRA 4TKNA 4IDIA 1K8RB 1KLVA 5D7GA 1N60A 2IO0B 2MJ3A 1QT9A 1GG3A 4KX6B 3VH3B 1L0YB 3QC8B 2WQYB 2N7EA 1SB3C 3DQVA 3SHQA 3U52E 3RZFA 3RNGC 1YN3A 1FNVA 2G45B 5HI1A 2IZVB 1WMHA 5H92C 5GMVA 2XBBC 1HQRD 2Y3AA 4W9CA 2GBNA 3BVGA 5EE3A 4LNIA 1NEKB 4TSSA 3RFZB 2UWQA 2KDIA 4RCOA 3VTUA 2FUG1 3TEWA 1L4ZB 3TJPA 2DX5B 2BB5A 1T6BX 4FJVB 2BKRB 4FA6A 2WXHA 2ACZB 2G4DB 2YEPF 4Q2JA 1F77A 3RT3B 2KQSA 4EKUA 1YX6B 1NDDA 2C60A 1YNTE 1IUEA 4W9JA 4JE3B 1Q10A 3VFKA 2KDMA 5LXIB 4NJ7A 3AI5A 1LGRA 3RI7C 4EUTA 3TEXA 2GOWA 4W9HA 3BZDB 1L6VA 1B9RA 1EO6A 2HE7A 2YLMA 1RLFA 1WRDB 2D07B 4JWUC 1YD8U 3VUYA 2N4FA 5AUKA 1XLQA 4MH0E 1OQYA 2L76A 2REXA 4HLEA 1TTNA 2W9NA 1EU4A 3AEBB 2L52A 3P1MA 2CHWA 3ZKJC 3AEGB 1WF9A 1I4PA 3RD2A 3NG0A 3MJWA 4ZYNA 2PVOD 3EFUA 2G9HD 2NPTB 4CHKA 2BB6A 4BOSC 1FCLA 1C79A 1L7YA 3B2GA 1IBXB 3X23A 3WALA 4XWTA 5EE9A 2M0AA 4WH4A 4WJPA 2IO1B 4OZCA 4BOZB 2D2QA 3FILA 1JQ4A 2N9EB 5HHDG 2KK8A 4EZJA 3A4RA 1WXMA 2KC2A 3AECB 3HUIA 3AXCA 1I4XA 4RGMA 3L54A 3SDLC 4G11A 3A1QA 3O65B 3VTWA 1FPYA 3CF6E 1NYQA 5FR6A 4YSZB 4AUQC 3ALBA 1RRBA 4N6EB 3MHZA 5AZFA 3RPFC 3ONSA 1WE7A 5CHWA 1PGAA 1ZE3D 3I57A 3PTFC 2FBWB 3ZNZB 4OZBA 2QEJC 3APFA 2ZPNA 1XO3A 1WGKA 1T0RC 4RFBA 5EE1A 1XF5L 1S1QB 4ZOHC 2JF5A 2AQ1B 2K22A 3IG3A 3MHSD 2D10A 4S0RA 4MELA 3M3JA 1V9JA 1FEHA 2DZMA 1M4VA 3URYA 3SR6A 2BS2B 2CS4A 1B1ZA 3V61A 2FE8A 4GDLB 4GDKA 2SAKA 1V5OA 2BPSA 1PYWD 4ANUA 3AE7B 3B2FA 2BVCA 3E56A 5LNK1 1GC7A 1QOBA 1XEEA 1RFAA 5KHQA 3UQAA 1PUTA 1WGGA 2JYTA 3AE3B 3NRZA 1XCTL 3U2SC 2UYZB 1FXAA 1Q5WB 4US9A 4BZAA 2M56B 4IG7B 3EFCA 3RNEC 2ZNVB 1WRIA 2GLSA 4BVUC 2K8BA 3A9JB 1GJZA 2DYBA 4F7ZA 1OTRB 2JZZA 5HKHA 3AEAB 1RWSA 1Y56A 2JUOA 3JW0X 4O1NA 1I4QA 3K9PB 3L16A 1P7EA 4W9DA 3C0RB 3KUDB 4OVUA 1D6EC 4IW0A 1KLUD 1ET9A 4P1BC 2KFKB 3HK0A 3CSFA 3MC9A 3DBLB 2O6VB 1E6EB 2K9XA 3TBLD 2UU7A 3RN9C 3ECIA 2NR2A 1WE6A 4KVGB 2R2QA 1UGMA 2WGSA 4ZRQA 2KWVB 1AARA 4LLGM 1SXTA 2KYWA 1WZ3A 3BK1A 3M95A 3P4RB 3NZSA 4M0WA 4LJPB 1TS2A 4NNJB 2VZKD 2KDFB 1ENFA 3PSEB 1TGZB 3QWZB 2V0GA 1FMAD 1WMHB 1FFUA 2BT6A 3TEZA 3T9LA 2N1VA 4HDOA 4WQOB 5BMHA 4MGYE 2FCMA 3PLUA 3IFWB 4NZLB 2K8CA 2N9KA 4HJGE 3DVGX 2GB1A 3IT6B 1DYQA 1XXGA 2KO3A 1P98A 3ZJVA 2JWUA 4HXDA 2DAFA 2WDRB 4WJOA 4A9AA 3IAS1 1I35A 4C80A 1QOFA 1WIAA 1C4AA 2C9WB 3VHTC 3W1YA 2XEWA 1H8CA 1UZXB 3N20C 4KSLC 4DK5A 2ZPYA 3FC4A 5JHAA 3JSVA 2KD0A 2ZW0A 2R61A 3IBEA 3AE1B 2KWCA 4KV2A 2Q5WD 3QAQA 3TMPB 3L13A 4HJKA 1JRUA 2NBVB 4D2KA 1M94A 2VH1A 3VR9B 4WJNA 1JCKB 1WM3A 2RSUA 2EMTA 3LDZE 4WWNA 3WANA 3B0AA 3A33B 1DOYA 4GIVA 3SU8X 2WU5B 3QIJA 3N3KB 3GZNB 4TUUA 3PVLA 3P4SB 1FM0D 2MQJA 4GMVA 4HVBA 1YQ4B 3QJZA 2KC1A 3FILB 3LJ3A 2V3NA 2YEPB 3GE3C 3MP9A 3HM3A 2J7QB 3N1ZC 4USAA 4HKZE 3U8ZA 2XK5A 1D4BA 5IP4D 2MRPA 2E6XA 1TZ1A 4EZLA 1LM8B 3PZDA 4QAYA 3A1QB 2WU2B 3AEEB 1YQBA 2D11A 2LEKA 1QOGA 2RD0A 3J9CA 4URKA 3DHHC 4FLHA 4IWQA 5FR3A 1XT9B 1I42A 1VDVA 4A3PA 2KT7A 1V5TA 4EFOA 2D5GA 1NYRA 3AULA 3M63B 1N61A 2XN9C 3KYCD 1WX8A 1FIQA 1WR6E 3PREA 1TS3A 2JRHA 2CU3A 1SEBD 2MBBB 3WCQA 2LVPA 2LRUA 4WWMA 1D5MC 2OJWA 4TV3A 3KLSX 2KN5A 2KVZA 2BW2A 1R4MI 2J52A 5E6OA 3N9YC 3VRAB 3RNAC 3H6NA 3V05A 5TSSA 3W5VB 1R4NB 1KH0A 4C4VB 1Z2MA 5JXVA 1KF6B 2AX5A 3DPDA 4GDKB 1XCQL 1JWBD 1P0RA 3AE2B 3OG5A 4DWFA 4ITKA 2PJHA 3V60A 2B3AA 4JQWC 4ACFA 2K0PA 2RMMA 3RZWC 2PPHA 5C1ZA 3NVZA 2IJ0A 2AL3A 4MGIE 1C9FA 3PPAA 1QQRA 4DBGA 2VZKB 1DGJA 3OLMD 4LDTD 4LNNA 3ZTCA 4ZDVA 3ZDTA 2KDBA 1V2YA 1AN8A 4ZRIA 3PHWB 2M4NA 2B76B 1MPEA 4G50A 3U30A 4EE2A 4C7ZA 4ANWA 2PLPA 3PZ8A 4TMAB 2GRIA 1L5PA 1VZ6A 1WXAA 1KTKA 2AYOB 4XC2A 1YJ1A 3PLVA 1C4CA 3X0WA 4S17A 2H88B 2KX3A 2KACA 2BWFA 4FADA 1SE2A 4RGOS 4N9F4 3I9V1 2L0TA 4OZAA 2GI9A 4P16A 1PFDA 1TZOA 3D32A 2KTFA 4J6IA 5IA7A 1SBBB 1QZEA 4A3OA 3DBLI 3TSSA 5BYRA 4AWJA 4M0WB 1MFWA 2JPHA 3EHVA 4A6QA 2GBMA 1C3TA 4XWWA 3P2BA 3V3XA 5D3IB 2MSED 2NBWB 3U4EG 2Z0DB 4AS1A 3BYYB 1SIJA 5LXHA 4YSYB 4MEMA 2O6VD 3ZDMC 1Y8RC 2MA9B 1WI0A 4L23A 1T3QA 5EDSA 3DBRB 2KLCA 4PS3A 3VTVA 5E6JA 3AH7A 2IGGA 2XNAC 2LGIA 4ZRKA 3EC8A 5C3JB 3TEYA 1V6EA 2MJDA 4CO7A 3NZUA 5L83A 2BYEA 3W1SA 1T5XD 3CIRB 1Z5SB 2BS4B 2O2VA 4I6NB 1NI3A 3Q69A 3L0WB 3Q3FA 4W9GA 3OJ3A 2KX0A 1WJUA 1L0XB 4DHJD 4ASWC 2NCNA 1TKEA 1SJHD 3V62A 3C19A 3JSVB 5DPSA 1FXTB 1KRHA 5BYSA 3RUIB 4IC7B 3MFGA 4JLCA 4ARIA 1WR1A 3CSTA 3KYDD 2G1EA 3Q2AC 4EZKA 2LGYA 3HIZA 1CMXB 1UUPA 3UGBB 4L2YA 3BVMA 1FNUA 1UBQA 3TIXA 2X38A 3LYYA 5LLIA 3PS6A 3MC8A 2MLBA 4LK0M 2N7JA 1I4GA 1EF1A 4K1RB 2LFIA 4PT5A 3UIPB 4WAAA 2LD9A 2KJHB 2MCNB 2WLBA 1JWUD 4M00A 1GNUA 2EMSA 1YX5B 2J0MA 3L10B 4GLSC 4DXFA 2XK5B 2CR5A 4E3CA 3NVWA 1TBEA 4IM3A 5D94A 4LCDE 1V97A 1SE4A 3KUZA 4E74A 2Y5BB 4MSQB 1J7BA 1KJTA 2GBKA 4C00A 1IGCA 4J3OD 4M8NA 2QJLA 3NS8A 3PGEA 5D2MB 4MM3A 3L08A 3ZYYX 1QLBB 1CJEA 2QMTA 1JALA 2JSVX 3VUXA 2NBUA 2KHWB 1T0SC 2N7DA 4B95A 2INCC 3Q8FA 1L2NA 1E0ZA 2K5PA 2AEHA 3Q8EA 1FO4A 1WGHA 1PGBA 2H89B 4LDTB 2LJ5A 4C4VA 1OFFA 2V4LA 2CJNA 1YIWA 1EF5A 2Z0EB 1ZGUB 2JVCA 2IDYA 1GB1A 4ZHPA 1U4AA 3ZVVA 2HTHA 3ZO5B 4IM0A 1WY8A 5AUIA 2OOBB 5G2NA 3QK0A 3Q3OC 2G4SA 2DYOA 4OVZA 3TUOA 1VZ7A 3U7ZA 2J42A 4TQ0A 3IAM1 5FKAC 2J53A 2LZ6A 4ZRJA 3ZNGC 5DCNA 3PT2B 1FNWA 1OEYA 1MHXA 1UF0A 1A70A 1CZPA 3TCAA 3T3NA 2WXLA 4N59A 4GGQA 3H1UA 4DHZB 3EUB2 4DHZE 3Q14C 2AQ2B 1EUVB 4XYCA 2N1WA 3H9DA 2N0SB 1HTOA 1P9DU 2IO3B 3HVDA 3Q3JA 3QQ8B 4HKQA 2WDTB 1KLGD 3LXFA 4OVVA 2W3SA 3RNCC 3R8BA 4KIKA 4ICVA 1T0YA 3L17A 1XLPA 2DBYA 3AE8B 3ZXVA 3ZJTA 2ICIA 2DLBA 3SFDB 1TS4A 2KTRA 4KKIA 1WJNA 4FULA 4YWGG 3Q8CA 1VJKA 4NAWB 1JROA 2FNJB 5TR5A 4IM2A 3DBHB 1WXSA 1E8WA 2L8JA 4G3XB 2WYQA 1R7SA 3EGRA 1VLBA 3C8YA 1JW9D 1ZOYB 1HEZE 5G5GA 1EU3A 3SFEB 4HDQA 2BQQA 1C4PA 1XLNA 3EA6A 4DHJB 2JXXA 5DPWA 4FHJA 1FCCC 5C23A 2Z59B 2PE9A 4HCPB 2K6QA 2L00B 3PRMB 4M8MA 2A4ZA 2BYVE 2IBIB 1V1PA 1JRPA 1NBFC 2M0XA 2M8SA 1UBIA 2JT4B 4I6LB 2M17A 4OW0A 1XLOA 1WFYA 1HZ6A 2HJ1A 3DCGA 3N1YC 1ESFA 1WJ4A 4B0EA 1LO5D 2ZZPB 2QIEB 1E7VA 1UGJA 3N1XC 4NQLB 2NMQA 2KZRA 4ARCA 3ZTDA 2WXPA 4UDUC 2O2VB 3ZUNA 2KMCA 1A5RA 4XDCA 4NJCA 3W2DA 3ENEA 3ZQ4A 3NVYA 2BS3B 4PYUA 1OGWA 1N6ZA 3DVNU 4R3DA 1J19A 3SD5A 3L4PA 3QCAA 2C7HA 1HE8A 4XDDA 1RM6C 4XZ4A 2PVGC 4YL8A 3APCA 4P7IA 3APDA 2WXQA 2ONQA 2G3QB 5D3DA 5IKCM 2LGSA 3ML8A 1I4HA 3QHTA 1AWDA 2MP2B 2W55A 2KKCA 2HDEA 3NJTA 2WXIA 3FKYA 3PZ7A 3ZLZA 1TYGB 2WDVB 3UI3A 3ZJUA 1HA5A 3VH4B 3RNBC 1UELA 3AM9A 3ZIMA 2VH2A 3QARA 1UH6A 2MH7A 3CMMB 1LXDA 2LASA 3BY4B 4HPLB 1WXVA 2MW5A 4MSMB 1BT0A 5FK9C 2WXFA 4JGHB 4YSXB 3KWVA 3DDCB 2KWDA 1IYFA 3BINA 2KMMA 1UD7A 3GE8C 2LVQA 4ZRPA 2KLGA 4KGTA 3R7QA 4RMAA 4KDIC 2LJIA 3UQBA 5BYQA 2KNBA 4RF0A 3NUHB 3NHEB 2MBEA 1FD6A 1FXIA 4MM3B 2I38A 2LGDA 2LHDA 4GOCA 5MPOA 2C7MB 1L6UA 2CHXA 3PRPB 2QC8A 2LWPA 5EE0A 1P3QU 1WM2A 4ANXA 3HVZA 2KANA 2IY1B 1JWAD 4XE0A 2AL6A 2CKHB 5CHFA 4IKGA 2RDHA 3LB8C 4GSWA 2CHZA 2WNMA 4ANVA 4KZ0A 1YQ3B 1STEA 2MJEA 3K9OB 2V3PA 4MDKE 2KAJA 1TT5B 1E8ZA 1NVID 2INNE 2WX0A 4B0MA 1C77A 1WWTA 1WSPA 2ZVOA 3Q8BA 2CU1A 2LHEA 1TY2A 1N5WA 4HEA1 5L95C 3BWUD 4YT0B 2LUEA 2WXGA 2EKIA 3CWIA 3AMZA 4M02A 5JH5C 4TQ1A 4GXBA 3N32A 4BKTA 2NS5A 4WIPA 4MT5A 3VRBB 3WIMA 3IVFA 2D3BA 2MBHA 2ZVNA 1E7PB 1DOIA 2WXNA 2KN4A 2FCNA 1KFYB 2KQ7A 2EELA 2VRRB 4LNKA 3DVGY 4F8CB 2AWTA 2FAZA 1XD3B 1V49A 2FCQA 2RGFA 2KDEB 4NAWA 5T8IA 2IY0B 2L7RA 4DDGD 4MH8A 2ZCBA 3GS2A 1TY0A 3WAOA 4RGTA 2KMAA 4KIKB 1JWSD 5E6NA 3DBSA 1OQQA 1Q1OA 2KTRB 2INPE 4MJSA 3I5JC 3GOEA 4A55A 3KUCB 4MGKE 4XX5A 3H7PA 4WURA 1J0GA 4YTMB 1H4RA 1JWMD 2D3CA 3I63C 2WXOA 2D3AA 2WP9B 4BBNC 3QA8A 4II3B 2Y5PA 1J8CA 2L3ZA 2L0FA 1ZUD2 2RDBC 4C7YA 1GPXA 1SE9A 3DBHI 1YMHE 2PIAA 1WXQA 2FUHB 1K51A 3EECA 3N30A 1CQVA 5AZGA 3GP7A 1QKZA 1X1MA 3ABVB 4W9IA 1XQQA 3IHPC 1V1PB 5BMGA 5C2TB 5DPRA 3ZNID 3H8HA 2PMVA 2ZW1A 3JVZX 3W5UB 3WAPA 3T3OA 3KW5B 3R7RA 3AB5A 2DNFA 2GBJA 4I6PA 2OHFA 1EM7A 1C76A 3PV1A 2KWUB 1KM7A 4REZA 1G6JA 2KVRA 2J0JA 3AEDB 4RF1A 1N62A 1WX9A 1AYFA 1GUAB 3R2IA 2KFJA 3VXWA 1EWCA 3UIOB 4IUMB 3PO0A 3BYTB 4WWPA 2MP2A 4W9EA 1SSNA 1VCBA 1MJDA 5BMIA 2WX1A 1J7CA 4EEWA 4W9LA 2ZEQA 4KZCA 3DWMA 3Q8AA 3OJ4B 1ZP0B 2V1YA 4NQKE 2A5UA 2DYMA 3AEFB 1LFDA 5D6JB 4M01A 4JIOU 1E7UA 2OJRA 2BWES 4LJOB 2EKEC 4B6WA 1HTQA 1GAQB 4DXAB 4X57B 2DHZA 3GZNI 2R2OA 1YN5A 4OHJA 1RFKA 1LQBA 1UWMA 3FAHA 2N9XA 2KOXA 1RAXA 5GXGB 4HWIB 1V81A 3A9KA 4KDLB 5J18A 2FIFA 4GB9A 4AJWA 2ZJDA 4LNFA 1WZ0A 1TJEA 3BK2A 1N63A 2NVUI 2D3GA 4WWOA 3ZNHB 1IPGA 3NVVA 3DHGC 3ETRA 1ZPSA 2GBRA 2L83A 1K53A 1P1AA 2GMIC 5BO4B 3JYUA 2J4XA 3VR8B 2DWQA 3IXSA 4HPPA 4JL9A 1QILA 1R4MB 3VDZA 3NOBA 4EOYA 4A90A 3RNFC 2ZNVC 3T8MA 2I1JA 2KJRA 3AE5B 1D5ZC 1I7HA 4AJYB 5HFYA 4P6VF 1SIFA 3DWGC 4G0NB 5G5HA 5J2RA 1TS5A 5J17A 1V1OA 1IGDA 1K50A 3OAWA 1E10A 3PRZA 1T0QC 3AU5A 4GN1A 4MACA 1UWXA 1WYGA 2MBOA 4PYZA 1WYWB 2LUMA 2MBQA 1L4DB 2HJ8A 3KQ4A 3P4PB 1ZKHA 3R2TA 1F52A 3DOWA 1QOAA 3QX1A 1YJIA 1VR9A 1TKYA 1UNSA 1SE3A 2JWZA 2WHIA 4K7UA 4IOIE 3OWEB 1J7AA 1F9JA 2BYTA 2M1MA 1E8YA 3IT4B 1F1HA 4F1SA 1R4NI 3WAMA 1E8XA 4FBJB 3B1LX 2RDGA 4WAFA 4P1CC 5JZEB 2PW9A 2IO2B 2IGDA
chains in the Genus database with same CATH topology
2WXQA 3NVZA 2ONQA 2IJ0A 2JQRB 2G9HD 5D3DA 3MJ5A 1C9FA 3AE4B 2BB6A 1QQRA 1I4HA 4JPSA 1L0VB 2VZKB 1ZDXA 1DGJA 1FCLA 1AWDA 2JXTA 2W55A 1C79A 2HDEA 3B2GA 1IBXB 1AN8A 2WXIA 3PZ7A 2QILA 3GB1A 1TYGB 2WDVB 1OQRA 2B76B 2HTME 4XWTA 3UI3A 5EE9A 1MPEA 2M0AA 4HRSA 3ZJUA 4WH4A 4EE2A 4C7ZA 2PLPA 1HA5A 3PZ8A 4TMAB 2GRIA 4OZCA 2JX5A 3FILA 1JQ4A 3AM9A 1L5PA 5HHDG 1VZ6A 2K3UA 1KTKA 3HRDD 2MH7A 1C4CA 2WXJA 3AECB 3HUIA 2H88B 1I4XA 2KACA 4RGMA 1SE2A 5FK9C 2WXFA 1K52A 4RGOS 2W54A 3I9V1 2KQ4X 4OZAA 2GI9A 4P16A 4YSXB 3KWVA 1NYQA 1C78A 1PFDA 1TZOA 2NTSA 4DQOC 4YSZB 2IPKD 4CQNA 2KWDA 1SBBB 3AN1A 2KMMA 3TSSA 5I4DA 5BYRA 4N6EB 3MHZA 3RPFC 3VQIA 4A6QA 4AQ7A 4ZRPA 3AE6B 1QF6A 4KGTA 4XWWA 3V3XA 1PGAA 5D3IB 1ZE3D 1ROEA 1FFVA 1DOXA 2LJIA 3I57A 5BYQA 4RF0A 2ON8A 3NUHB 3U4EG 2FBWB 4AS1A 2BBCA 3BYYB 4OZBA 1FD6A 1I4RA 1FXIA 4MM3B 1SIJA 2I38A 2LHDA 2QEJC 4WQMA 5MPOA 4YSYB 1L6UA 1XO3A 1WGKA 4RFBA 5EE1A 1XF5L 3B9JA 5EE0A 4L23A 4ZOHC 2AQ1B 1T3QA 2K22A 5E6JA 3HVZA 3AH7A 2IGGA 2XNAC 2PW9A 1JWAD 4XE0A 2LGIA 1BMLC 1ZXHA 2E3TA 5C3JB 3TEYA 1FEHA 3E9SA 2MJDA 4IKGA 2RDHA 1RYJA 1ZXIA 3MC0B 3LB8C 2BTEA 1M4VA 3URYA 3SR6A 2BS2B 1B1ZA 1D5XC 3W1SA 1T5XD 2FE8A 2JU6X 2TSSA 2WNMA 1PGXA 1HZ5A 4GDLB 1YQ3B 1STEA 4L1BA 3W9CB 3CIRB 2MJEA 1MI0A 1F2RI 2SAKA 2BS4B 1TKGA 1PYWD 2V3PA 2KAJA 3AE7B 3B2FA 3E56A 3ZGZA 1NI3A 2WXRA 5LNK1 3Q69A 2OEDA 1NVID 1QOBA 1XEEA 1VRAB 2INNE 4B0MA 2L1AA 2N9LA 1C77A 1PUTA 1WWTA 1L0XB 1WSPA 1TKEA 1SJHD 3Q8BA 2JYTA 3AE3B 3NRZA 2LMCA 2LHEA 1TY2A 1N5WA 4ZHOA 1SF0A 2AQ3B 4HEA1 1XCTL 3U2SC 1KRHA 5BYSA 1FXAA 4US9A 2JZPA 3BWUD 4YT0B 2WXGA 2EKIA 3MFGA 2M56B 3CWIA 3AMZA 4ARIA 4HROA 4C56C 4TQ1A 2G1EA 1WRIA 4WIPA 4MT5A 3VRBB 1YN4A 1E9MA 1IBXA 1UUPA 4L2YA 1E7PB 1DOIA 3BVMA 1FNUA 2WXNA 2WS3B 2KN4A 1VZ8A 4DXGA 3SEBA 1KFYB 3AEAB 1RWSA 1Y56A 2X38A 3BIID 2RPVA 2PTLA 2EELA 4O1NA 2PKOA 1I4QA 3LYYA 3O13A 1P7EA 2SEBD 1ZDVA 4LK0M 2N7JA 4FXCA 1I4GA 1P7FA 1N5XA 1D6EC 2LFIA 1KLUD 4PT5A 1ET9A 1YJJA 2IGHA 1E6EB 5T8IA 2K9XA 2WXKA 4MH8A 3GS2A 1TY0A 4RGTA 2WLBA 1JWUD 4YTPB 1JWSD 1F0ZA 2W82A 4ZRQA 4US8A 1OQQA 4GLSC 4LLGM 4DXFA 2INPE 1SXTA 3NVWA 3BK1A 3P4RB 4A55A 1V97A 4M0WA 1SE4A 1TS2A 3P4QB 4WURA 4KKJA 4JWSC 4YTMB 1JWMD 1J7BA 2VZKD 1ENFA 2WXOA 2WP9B 1IGCA 4J3OD 2V0GA 1FMAD 2Y5PA 2QJLA 5HG2A 1FFUA 3AE9B 2BT6A 3ZYYX 1QLBB 3TEZA 1ZUD2 1GPXA 4C7YA 1CJEA 1NENB 1ET6A 2QMTA 1JALA 5BMHA 1YMHE 2JSVX 2PIAA 1WXQA 4NZLB 1V8CA 4N58A 1K51A 5H8YE 2JYEA 2N9KA 4HJGE 2L32A 1CQVA 4YTNB 1GOZA 3Q8FA 3GP7A 1E0ZA 2GB1A 1QKZA 3IT6B 3BVZA 2K5PA 3Q8EA 1MVKA 2H89B 1PGBA 1FO4A 4H2AA 3ABVB 1DYQA 1MHHE 1V1PB 1ACCA 1XXGA 5BMGA 5C2TB 3ZJVA 3H8HA 2PMVA 2WXMA 2JWUA 2MEKA 2ZW1A 3P63A 1OFFA 2WDRB 4A9AA 2CJOA 3W5UB 3IAS1 4C80A 3T3OA 1QOFA 1C4AA 3AB5A 2CJNA 2WDQB 2V4IB 3AV8A 4JX1C 4LTUA 4ZYSA 2IDYA 2OHFA 1GB1A 4RH6A 1EM7A 1HXYD 4ZHPA 1PDXA 1C76A 4REZA 2M19A 2QSDA 3AEDB 4RNAA 4RF1A 5AUIA 4A8XC 1N62A 1JMLA 3P42A 1AYFA 3FC4A 4RGNA 1EWYC 2ZW0A 2R61A 3R2IA 2DYOA 4KGRA 1AW7A 3AE1B 1FRDA 3NS1A 1VZ7A 4OVZA 3TUOA 2Q5WD 2I2YA 1EWCA 3U7ZA 2J42A 1BUIC 4TQ0A 3PO0A 3BYTB 4NAMA 3IAM1 2Y5CA 2NTTA 5FKAC 2J53A 3KWLA 1FRRA 2W3RA 1SSNA 4D2KA 3NZ3A 3VR9B 1FNWA 1JCKB 1MHXA 5BMIA 1A70A 1CZPA 3T3NA 1GB4A 2WXLA 1J7CA 4N59A 4KGSA 3EUB2 3DWMA 3Q8AA 1CK1A 1DOYA 1ZP0B 2AQ2B 2WU5B 2DYMA 3AEFB 1BXTA 2N0SB 3P4SB 4HKQA 1FM0D 3HVDA 1KLGD 1SJED 1YQ4B 3LXFA 2W3SA 3R8BA 2Z8LA 3FILB 1GAQB 4YXDB 2V3NA 2YEPB 1XLPA 1F2RC 2DBYA 3AE8B 3MP9A 4IDIA 2ICIA 3ZJTA 2DLBA 3SFDB 1TS4A 1YN5A 4USAA 4HKZE 4KKIA 4OHJA 1N60A 5D7GA 4YWGG 1D4BA 2MJ3A 1QT9A 1RFKA 1UWMA 3FAHA 3Q8CA 4KX6B 1VJKA 4NAWB 1JROA 2E6XA 1L0YB 5GXGB 2WQYB 1SB3C 3U52E 2WU2B 3AEEB 1R7SA 3EGRA 1TJEA 1VLBA 3C8YA 1JW9D 1ZOYB 3BK2A 1YN3A 1FNVA 1N63A 1HEZE 5HI1A 2LEKA 5G5GA 1QOGA 3J9CA 1EU3A 5H92C 3SFEB 5FR3A 1HQRD 2Y3AA 1VDVA 3NVVA 3BVGA 3ETRA 5EE3A 1C4PA 1ZPSA 1NEKB 2L83A 1XLNA 3EA6A 1K53A 4TSSA 3RFZB 4RCOA 2D5GA 2FUG1 3TEWA 1L4ZB 1NYRA 1FCCC 2BB5A 1T6BX 2J4XA 1N61A 2XN9C 3VR8B 2DWQA 3IXSA 2WXHA 1QILA 2ACZB 1FIQA 2YEPF 4Q2JA 1TS3A 4A90A 2CU3A 3AE5B 1F77A 1D5ZC 1I7HA 1SEBD 5HFYA 4P6VF 3DWGC 3WCQA 1V1PA 1JRPA 5G5HA 1TS5A 1YNTE 1IUEA 1D5MC 1V1OA 4WWMA 1IGDA 1K50A 4JE3B 1E10A 1Q10A 3KLSX 2KDMA 4OW0A 1XLOA 4MACA 2BW2A 1UWXA 1WYGA 1HZ6A 2J52A 1ESFA 3N9YC 4B0EA 3VRAB 1LO5D 2LUMA 1L4DB 3KQ4A 3P4PB 2QIEB 3TEXA 1UGJA 3V05A 5TSSA 3R2TA 3W5VB 3BZDB 1L6VA 2NMQA 1KH0A 1QOAA 1B9RA 1YJIA 5JXVA 1VR9A 1TKYA 1KF6B 2AX5A 1UNSA 1SE3A 4ARCA 4JWUC 4GDKB 2WXPA 1XCQL 1JWBD 4UDUC 4IOIE 3OWEB 5AUKA 1XLQA 3AE2B 4XDCA 1J7AA 4NJCA 3W2DA 2BYTA 3ZQ4A 3NVYA 3IT4B 2BS3B 4ITKA 1EU4A 3AEBB 4R3DA 2L52A 3P1MA 2RDGA 3L4PA 4WAFA 3AEGB 4XDDA 1RM6C 1I4PA 2K0PA 2PVGC 2RMMA 2IGDA 2PVOD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FMA D;  2BS2 B;  3SR6 A;  2QJL A;  3NVZ A;  1FFU A;  1GAQ B;  2JQR B;  4YXD B;  3AE9 B;  1XLP A;  2BT6 A;  3ZYY X;  1QLB B;  2DBY A;  3AE4 B;  3AE8 B;  1YQ3 B;  1ZUD 2;  4IDI A;  3W9C B;  4C7Y A;  1CJE A;  1NEN B;  3SFD B;  3CIR B;  1GPX A;  2MJE A;  1L0V B;  1DGJ A;  4USA A;  1N60 A;  2BS4 B;  1AWD A;  2W55 A;  1TKG A;  1JAL A;  2KAJ A;  2MJ3 A;  1QT9 A;  1RFK A;  1WXQ A;  1NI3 A;  1UWM A;  2PIA A;  3AE7 B;  3B2F A;  3FAH A;  4KX6 B;  1VJK A;  3B2G A;  1V8C A;  1JRO A;  4N58 A;  5H8Y E;  5GXG B;  2WQY B;  1NVI D;  1QOB A;  1SB3 C;  1TYG B;  2WDV B;  1OQR A;  4YTN B;  2B76 B;  2HTM E;  5EE9 A;  1E0Z A;  1PUT A;  1WWT A;  2WU2 B;  2K5P A;  3AEE B;  1R7S A;  4HRS A;  1TKE A;  2H89 B;  1FO4 A;  3ABV B;  1TJE A;  1VLB A;  3AE3 B;  1JW9 D;  1ZOY B;  3NRZ A;  4C7Z A;  5C2T B;  1N63 A;  2LEK A;  1N5W A;  4ZHO A;  1SF0 A;  5G5G A;  1QOG A;  3P63 A;  5H92 C;  2JX5 A;  3SFE B;  1JQ4 A;  1OFF A;  1L5P A;  2WDR B;  1KRH A;  3AM9 A;  4A9A A;  1FXA A;  2CJO A;  4US9 A;  3W5U B;  4YT0 B;  2EKI A;  1VDV A;  2M56 B;  3CWI A;  3AMZ A;  1QOF A;  3NVV A;  3ETR A;  5EE3 A;  3AB5 A;  4HRO A;  4C80 A;  2CJN A;  2WDQ B;  1NEK B;  2L83 A;  1XLN A;  2MH7 A;  3AEC B;  3AV8 A;  3HRD D;  3HUI A;  4JX1 C;  2G1E A;  1WRI A;  4LTU A;  2OHF A;  2H88 B;  3VRB B;  4ZHP A;  1NYR A;  1E9M A;  1N61 A;  3VR8 B;  1PDX A;  2DWQ A;  1E7P B;  2ACZ B;  1FIQ A;  2M19 A;  1DOI A;  3AED B;  2WS3 B;  5AUI A;  2W54 A;  2CU3 A;  1N62 A;  3AE5 B;  1I7H A;  1KFY B;  3AEA B;  4P6V F;  1AYF A;  3FC4 A;  1RWS A;  3DWG C;  1EWY C;  1JRP A;  3BII D;  5G5H A;  1NYQ A;  1PFD A;  3WCQ A;  4YSX B;  4WWM A;  1IUE A;  2PKO A;  4YSZ B;  3AE1 B;  1FRD A;  3NS1 A;  1E10 A;  3AN1 A;  2Q5W D;  2KMM A;  4N6E B;  3RPF C;  4FXC A;  1XLO A;  1N5X A;  3PO0 A;  1WYG A;  3AE6 B;  2Y5C A;  1QF6 A;  1YJJ A;  3VRA B;  3KWL A;  1FRR A;  1ROE A;  1FFV A;  1E6E B;  2QIE B;  3P4P B;  2W3R A;  1DOX A;  2K9X A;  3VR9 B;  2FBW B;  2WLB A;  3W5V B;  1A70 A;  1L6V A;  4YTP B;  1CZP A;  1B9R A;  1QOA A;  1FXI A;  1J7C A;  1SIJ A;  1F0Z A;  4N59 A;  1YJI A;  4WQM A;  5MPO A;  1TKY A;  4YSY B;  1L6U A;  3EUB 2;  1XO3 A;  4US8 A;  1KF6 B;  1OQQ A;  2AX5 A;  3DWM A;  1WGK A;  4JWU C;  1DOY A;  1ZP0 B;  1JWB D;  5EE1 A;  3B9J A;  2WU5 B;  5EE0 A;  3NVW A;  1XLQ A;  3AEF B;  3P4R B;  4ZOH C;  3AE2 B;  5AUK A;  1T3Q A;  1V97 A;  1J7A A;  2K22 A;  3NVY A;  2N0S B;  3HVZ A;  2BS3 B;  3AH7 A;  4ITK A;  3P4Q B;  3P4S B;  1FM0 D;  3AEB B;  2L52 A;  1JWA D;  3P1M A;  4JWS C;  4YTM B;  1YQ4 B;  1J7B A;  2E3T A;  3L4P A;  3AEG B;  3LXF A;  2W3S A;  5C3J B;  2MJD A;  2WP9 B;  1RM6 C;  1RYJ A;  1ZXI A;  2PVG C;  3LB8 C;  2PVO D; 
#chains in the Genus database with same CATH topology
 5E6P A;  1OEY J;  3H7S A;  2JQR B;  2ZCC A;  3MJ5 A;  4RM8 A;  3AE4 B;  4CYE A;  4JPS A;  1L0V B;  1ZDX A;  1Q0W B;  2JXT A;  3Q6B A;  2I1K A;  4W9F A;  5DPT A;  2QIL A;  3GB1 A;  1V80 A;  1OQR A;  2HTM E;  1WX7 A;  4HRS A;  3U7D A;  4BBN F;  2RR9 A;  2JX5 A;  3V6E B;  2K3U A;  2MX2 A;  2LXA A;  3HRD D;  2WXJ A;  4IWO A;  1K52 A;  4NY0 A;  5CTR C;  2W54 A;  2KQ4 X;  3I3T B;  2DEN B;  1C78 A;  2NTS A;  4DQO C;  4MJS B;  2IPK D;  4CQN A;  3AN1 A;  2LI5 A;  5I4D A;  2K39 A;  2K8H A;  3VQI A;  3W1S C;  4AQ7 A;  3H7P B;  3AE6 B;  1S3S G;  1QF6 A;  1ROE A;  1FFV A;  1DOX A;  2LGX A;  2ON8 A;  2BBC A;  1I4R A;  5JHB A;  4WQM A;  1MG8 A;  4MGZ E;  4NJ6 A;  3TL5 A;  2RPQ A;  3KH0 A;  4FJZ A;  3B9J A;  3KVF B;  4DDI D;  2J0K A;  2PE6 B;  1BML C;  5IAA C;  1ZXH A;  2E3T A;  1WJ6 A;  3E9S A;  5AZH A;  2YVC A;  1RYJ A;  1ZXI A;  1ZW7 A;  3MC0 B;  4XGA B;  2BTE A;  2K6D B;  1D5X C;  4GU2 A;  5CHV C;  2JU6 X;  2TSS A;  1PGX A;  1TIF A;  1YOV B;  1HZ5 A;  3VAW A;  4L1B A;  3DBR I;  3W9C B;  2BGF A;  1MI0 A;  1F2R I;  3S2A A;  1GC6 A;  1TKG A;  2KJ6 A;  3ZGZ A;  1WH3 A;  2WXR A;  3B08 A;  2OED A;  2JY6 A;  4K3B A;  2N9P C;  1VRA B;  1WGD A;  2L1A A;  2N9L A;  2BYF A;  3RUL A;  4A20 A;  2LMC A;  2KXJ A;  4ZHO A;  1SF0 A;  2AQ3 B;  5IO9 A;  3WA0 A;  2MHJ A;  2NPT A;  2JZP A;  4HRO A;  4C56 C;  2DAJ A;  1MG4 A;  1YN4 A;  2PEA A;  3AU4 A;  1E9M A;  2DZI A;  3UF8 A;  1IBX A;  4AP4 C;  2WS3 B;  2ASQ A;  1VZ8 A;  4DXG A;  3SEB A;  4W9K A;  3BII D;  2RPV A;  2PTL A;  2LVO A;  2PKO A;  2LXC A;  3O13 A;  4FJY A;  2SEB D;  1ZDV A;  4FXC A;  1P7F A;  1N5X A;  3Q3M C;  1IP9 A;  5G55 A;  5AEK B;  1YJJ A;  2IGH A;  2WXK A;  2BF8 B;  2C7N B;  1PQS A;  3ZXR A;  2WWZ A;  4YTP B;  1V86 A;  1F0Z A;  2V9H A;  2W82 A;  4US8 A;  5KHO A;  3ML9 A;  1D3Z A;  4HK2 A;  2JZ3 B;  2L05 A;  3P4Q B;  3A9K B;  4KKJ A;  4JWS C;  4RM9 A;  2V3S A;  5HG2 A;  2K25 A;  3AE9 B;  1E90 A;  4ICU A;  4LNO A;  1NEN B;  1C1Y B;  1ET6 A;  4K3C A;  3RCZ A;  4BKS A;  4PK1 A;  1V8C A;  2K1F A;  4N58 A;  5H8Y E;  2JYE A;  2L32 A;  4YTN B;  1GOZ A;  4FN2 A;  3BVZ A;  3VVW B;  2FID A;  1MVK A;  4H2A A;  1MHH E;  1ACC A;  2DZK A;  2WXM A;  2MEK A;  2X8X X;  3P63 A;  2CJO A;  3RYT A;  1VD2 A;  4NPN A;  3VUW A;  2LRW A;  4GDL A;  3HM6 X;  4E71 A;  4AOF A;  2WDQ B;  2V4I B;  3AV8 A;  1ISN A;  4JX1 C;  4LTU A;  3M62 B;  4ZYS A;  4HPM B;  4RH6 A;  1HXY D;  2C5L C;  2FCS A;  1PDX A;  3ZW3 A;  3Q3N C;  2M19 A;  2QSD A;  4HCN B;  3NY5 A;  1WGY A;  4RNA A;  4A8X C;  1JML A;  3MTN B;  3P42 A;  3DVN V;  3ZRF A;  4RGN A;  3PHX B;  1EWY C;  2QDF A;  4B9K A;  2BKF A;  4KGR A;  1AW7 A;  1FRD A;  3NS1 A;  1KOT A;  4FHK A;  2I2Y A;  1BUI C;  3A4S C;  2MWS B;  1E5W A;  3ZRC A;  4NAM A;  5IOI A;  2Y5C A;  2NTT A;  4K7W A;  3KWL A;  2IND C;  4K81 A;  1FRR A;  2JRI B;  1SGH A;  3RMK C;  2W3R A;  3V6C B;  4PS8 A;  4WJQ A;  1NI2 A;  4BKS D;  3NZ3 A;  3A9J A;  4IWP A;  4K7S A;  1GB4 A;  5CX3 A;  3HHM A;  4KGS A;  1CK1 A;  3R3M A;  1WGR A;  2DZJ A;  3R66 C;  4BAX A;  2IYD B;  2QHO A;  1BXT A;  4PS7 A;  3DHI C;  2KFK A;  1SJE D;  2O6V A;  2QCZ A;  4II2 B;  4BKG A;  2Z8L A;  5IN7 A;  2HD5 B;  4YXD B;  3UIN B;  4KSK C;  1F2R C;  4BFR A;  4TKN A;  4IDI A;  1K8R B;  1KLV A;  5D7G A;  1N60 A;  2IO0 B;  2MJ3 A;  1QT9 A;  1GG3 A;  4KX6 B;  3VH3 B;  1L0Y B;  3QC8 B;  2WQY B;  2N7E A;  1SB3 C;  3DQV A;  3SHQ A;  3U52 E;  3RZF A;  3RNG C;  1YN3 A;  1FNV A;  2G45 B;  5HI1 A;  2IZV B;  1WMH A;  5H92 C;  5GMV A;  2XBB C;  1HQR D;  2Y3A A;  4W9C A;  2GBN A;  3BVG A;  5EE3 A;  4LNI A;  1NEK B;  4TSS A;  3RFZ B;  2UWQ A;  2KDI A;  4RCO A;  3VTU A;  2FUG 1;  3TEW A;  1L4Z B;  3TJP A;  2DX5 B;  2BB5 A;  1T6B X;  4FJV B;  2BKR B;  4FA6 A;  2WXH A;  2ACZ B;  2G4D B;  2YEP F;  4Q2J A;  1F77 A;  3RT3 B;  2KQS A;  4EKU A;  1YX6 B;  1NDD A;  2C60 A;  1YNT E;  1IUE A;  4W9J A;  4JE3 B;  1Q10 A;  3VFK A;  2KDM A;  5LXI B;  4NJ7 A;  3AI5 A;  1LGR A;  3RI7 C;  4EUT A;  3TEX A;  2GOW A;  4W9H A;  3BZD B;  1L6V A;  1B9R A;  1EO6 A;  2HE7 A;  2YLM A;  1RLF A;  1WRD B;  2D07 B;  4JWU C;  1YD8 U;  3VUY A;  2N4F A;  5AUK A;  1XLQ A;  4MH0 E;  1OQY A;  2L76 A;  2REX A;  4HLE A;  1TTN A;  2W9N A;  1EU4 A;  3AEB B;  2L52 A;  3P1M A;  2CHW A;  3ZKJ C;  3AEG B;  1WF9 A;  1I4P A;  3RD2 A;  3NG0 A;  3MJW A;  4ZYN A;  2PVO D;  3EFU A;  2G9H D;  2NPT B;  4CHK A;  2BB6 A;  4BOS C;  1FCL A;  1C79 A;  1L7Y A;  3B2G A;  1IBX B;  3X23 A;  3WAL A;  4XWT A;  5EE9 A;  2M0A A;  4WH4 A;  4WJP A;  2IO1 B;  4OZC A;  4BOZ B;  2D2Q A;  3FIL A;  1JQ4 A;  2N9E B;  5HHD G;  2KK8 A;  4EZJ A;  3A4R A;  1WXM A;  2KC2 A;  3AEC B;  3HUI A;  3AXC A;  1I4X A;  4RGM A;  3L54 A;  3SDL C;  4G11 A;  3A1Q A;  3O65 B;  3VTW A;  1FPY A;  3CF6 E;  1NYQ A;  5FR6 A;  4YSZ B;  4AUQ C;  3ALB A;  1RRB A;  4N6E B;  3MHZ A;  5AZF A;  3RPF C;  3ONS A;  1WE7 A;  5CHW A;  1PGA A;  1ZE3 D;  3I57 A;  3PTF C;  2FBW B;  3ZNZ B;  4OZB A;  2QEJ C;  3APF A;  2ZPN A;  1XO3 A;  1WGK A;  1T0R C;  4RFB A;  5EE1 A;  1XF5 L;  1S1Q B;  4ZOH C;  2JF5 A;  2AQ1 B;  2K22 A;  3IG3 A;  3MHS D;  2D10 A;  4S0R A;  4MEL A;  3M3J A;  1V9J A;  1FEH A;  2DZM A;  1M4V A;  3URY A;  3SR6 A;  2BS2 B;  2CS4 A;  1B1Z A;  3V61 A;  2FE8 A;  4GDL B;  4GDK A;  2SAK A;  1V5O A;  2BPS A;  1PYW D;  4ANU A;  3AE7 B;  3B2F A;  2BVC A;  3E56 A;  5LNK 1;  1GC7 A;  1QOB A;  1XEE A;  1RFA A;  5KHQ A;  3UQA A;  1PUT A;  1WGG A;  2JYT A;  3AE3 B;  3NRZ A;  1XCT L;  3U2S C;  2UYZ B;  1FXA A;  1Q5W B;  4US9 A;  4BZA A;  2M56 B;  4IG7 B;  3EFC A;  3RNE C;  2ZNV B;  1WRI A;  2GLS A;  4BVU C;  2K8B A;  3A9J B;  1GJZ A;  2DYB A;  4F7Z A;  1OTR B;  2JZZ A;  5HKH A;  3AEA B;  1RWS A;  1Y56 A;  2JUO A;  3JW0 X;  4O1N A;  1I4Q A;  3K9P B;  3L16 A;  1P7E A;  4W9D A;  3C0R B;  3KUD B;  4OVU A;  1D6E C;  4IW0 A;  1KLU D;  1ET9 A;  4P1B C;  2KFK B;  3HK0 A;  3CSF A;  3MC9 A;  3DBL B;  2O6V B;  1E6E B;  2K9X A;  3TBL D;  2UU7 A;  3RN9 C;  3ECI A;  2NR2 A;  1WE6 A;  4KVG B;  2R2Q A;  1UGM A;  2WGS A;  4ZRQ A;  2KWV B;  1AAR A;  4LLG M;  1SXT A;  2KYW A;  1WZ3 A;  3BK1 A;  3M95 A;  3P4R B;  3NZS A;  4M0W A;  4LJP B;  1TS2 A;  4NNJ B;  2VZK D;  2KDF B;  1ENF A;  3PSE B;  1TGZ B;  3QWZ B;  2V0G A;  1FMA D;  1WMH B;  1FFU A;  2BT6 A;  3TEZ A;  3T9L A;  2N1V A;  4HDO A;  4WQO B;  5BMH A;  4MGY E;  2FCM A;  3PLU A;  3IFW B;  4NZL B;  2K8C A;  2N9K A;  4HJG E;  3DVG X;  2GB1 A;  3IT6 B;  1DYQ A;  1XXG A;  2KO3 A;  1P98 A;  3ZJV A;  2JWU A;  4HXD A;  2DAF A;  2WDR B;  4WJO A;  4A9A A;  3IAS 1;  1I35 A;  4C80 A;  1QOF A;  1WIA A;  1C4A A;  2C9W B;  3VHT C;  3W1Y A;  2XEW A;  1H8C A;  1UZX B;  3N20 C;  4KSL C;  4DK5 A;  2ZPY A;  3FC4 A;  5JHA A;  3JSV A;  2KD0 A;  2ZW0 A;  2R61 A;  3IBE A;  3AE1 B;  2KWC A;  4KV2 A;  2Q5W D;  3QAQ A;  3TMP B;  3L13 A;  4HJK A;  1JRU A;  2NBV B;  4D2K A;  1M94 A;  2VH1 A;  3VR9 B;  4WJN A;  1JCK B;  1WM3 A;  2RSU A;  2EMT A;  3LDZ E;  4WWN A;  3WAN A;  3B0A A;  3A33 B;  1DOY A;  4GIV A;  3SU8 X;  2WU5 B;  3QIJ A;  3N3K B;  3GZN B;  4TUU A;  3PVL A;  3P4S B;  1FM0 D;  2MQJ A;  4GMV A;  4HVB A;  1YQ4 B;  3QJZ A;  2KC1 A;  3FIL B;  3LJ3 A;  2V3N A;  2YEP B;  3GE3 C;  3MP9 A;  3HM3 A;  2J7Q B;  3N1Z C;  4USA A;  4HKZ E;  3U8Z A;  2XK5 A;  1D4B A;  5IP4 D;  2MRP A;  2E6X A;  1TZ1 A;  4EZL A;  1LM8 B;  3PZD A;  4QAY A;  3A1Q B;  2WU2 B;  3AEE B;  1YQB A;  2D11 A;  2LEK A;  1QOG A;  2RD0 A;  3J9C A;  4URK A;  3DHH C;  4FLH A;  4IWQ A;  5FR3 A;  1XT9 B;  1I42 A;  1VDV A;  4A3P A;  2KT7 A;  1V5T A;  4EFO A;  2D5G A;  1NYR A;  3AUL A;  3M63 B;  1N61 A;  2XN9 C;  3KYC D;  1WX8 A;  1FIQ A;  1WR6 E;  3PRE A;  1TS3 A;  2JRH A;  2CU3 A;  1SEB D;  2MBB B;  3WCQ A;  2LVP A;  2LRU A;  4WWM A;  1D5M C;  2OJW A;  4TV3 A;  3KLS X;  2KN5 A;  2KVZ A;  2BW2 A;  1R4M I;  2J52 A;  5E6O A;  3N9Y C;  3VRA B;  3RNA C;  3H6N A;  3V05 A;  5TSS A;  3W5V B;  1R4N B;  1KH0 A;  4C4V B;  1Z2M A;  5JXV A;  1KF6 B;  2AX5 A;  3DPD A;  4GDK B;  1XCQ L;  1JWB D;  1P0R A;  3AE2 B;  3OG5 A;  4DWF A;  4ITK A;  2PJH A;  3V60 A;  2B3A A;  4JQW C;  4ACF A;  2K0P A;  2RMM A;  3RZW C;  2PPH A;  5C1Z A;  3NVZ A;  2IJ0 A;  2AL3 A;  4MGI E;  1C9F A;  3PPA A;  1QQR A;  4DBG A;  2VZK B;  1DGJ A;  3OLM D;  4LDT D;  4LNN A;  3ZTC A;  4ZDV A;  3ZDT A;  2KDB A;  1V2Y A;  1AN8 A;  4ZRI A;  3PHW B;  2M4N A;  2B76 B;  1MPE A;  4G50 A;  3U30 A;  4EE2 A;  4C7Z A;  4ANW A;  2PLP A;  3PZ8 A;  4TMA B;  2GRI A;  1L5P A;  1VZ6 A;  1WXA A;  1KTK A;  2AYO B;  4XC2 A;  1YJ1 A;  3PLV A;  1C4C A;  3X0W A;  4S17 A;  2H88 B;  2KX3 A;  2KAC A;  2BWF A;  4FAD A;  1SE2 A;  4RGO S;  4N9F 4;  3I9V 1;  2L0T A;  4OZA A;  2GI9 A;  4P16 A;  1PFD A;  1TZO A;  3D32 A;  2KTF A;  4J6I A;  5IA7 A;  1SBB B;  1QZE A;  4A3O A;  3DBL I;  3TSS A;  5BYR A;  4AWJ A;  4M0W B;  1MFW A;  2JPH A;  3EHV A;  4A6Q A;  2GBM A;  1C3T A;  4XWW A;  3P2B A;  3V3X A;  5D3I B;  2MSE D;  2NBW B;  3U4E G;  2Z0D B;  4AS1 A;  3BYY B;  1SIJ A;  5LXH A;  4YSY B;  4MEM A;  2O6V D;  3ZDM C;  1Y8R C;  2MA9 B;  1WI0 A;  4L23 A;  1T3Q A;  5EDS A;  3DBR B;  2KLC A;  4PS3 A;  3VTV A;  5E6J A;  3AH7 A;  2IGG A;  2XNA C;  2LGI A;  4ZRK A;  3EC8 A;  5C3J B;  3TEY A;  1V6E A;  2MJD A;  4CO7 A;  3NZU A;  5L83 A;  2BYE A;  3W1S A;  1T5X D;  3CIR B;  1Z5S B;  2BS4 B;  2O2V A;  4I6N B;  1NI3 A;  3Q69 A;  3L0W B;  3Q3F A;  4W9G A;  3OJ3 A;  2KX0 A;  1WJU A;  1L0X B;  4DHJ D;  4ASW C;  2NCN A;  1TKE A;  1SJH D;  3V62 A;  3C19 A;  3JSV B;  5DPS A;  1FXT B;  1KRH A;  5BYS A;  3RUI B;  4IC7 B;  3MFG A;  4JLC A;  4ARI A;  1WR1 A;  3CST A;  3KYD D;  2G1E A;  3Q2A C;  4EZK A;  2LGY A;  3HIZ A;  1CMX B;  1UUP A;  3UGB B;  4L2Y A;  3BVM A;  1FNU A;  1UBQ A;  3TIX A;  2X38 A;  3LYY A;  5LLI A;  3PS6 A;  3MC8 A;  2MLB A;  4LK0 M;  2N7J A;  1I4G A;  1EF1 A;  4K1R B;  2LFI A;  4PT5 A;  3UIP B;  4WAA A;  2LD9 A;  2KJH B;  2MCN B;  2WLB A;  1JWU D;  4M00 A;  1GNU A;  2EMS A;  1YX5 B;  2J0M A;  3L10 B;  4GLS C;  4DXF A;  2XK5 B;  2CR5 A;  4E3C A;  3NVW A;  1TBE A;  4IM3 A;  5D94 A;  4LCD E;  1V97 A;  1SE4 A;  3KUZ A;  4E74 A;  2Y5B B;  4MSQ B;  1J7B A;  1KJT A;  2GBK A;  4C00 A;  1IGC A;  4J3O D;  4M8N A;  2QJL A;  3NS8 A;  3PGE A;  5D2M B;  4MM3 A;  3L08 A;  3ZYY X;  1QLB B;  1CJE A;  2QMT A;  1JAL A;  2JSV X;  3VUX A;  2NBU A;  2KHW B;  1T0S C;  2N7D A;  4B95 A;  2INC C;  3Q8F A;  1L2N A;  1E0Z A;  2K5P A;  2AEH A;  3Q8E A;  1FO4 A;  1WGH A;  1PGB A;  2H89 B;  4LDT B;  2LJ5 A;  4C4V A;  1OFF A;  2V4L A;  2CJN A;  1YIW A;  1EF5 A;  2Z0E B;  1ZGU B;  2JVC A;  2IDY A;  1GB1 A;  4ZHP A;  1U4A A;  3ZVV A;  2HTH A;  3ZO5 B;  4IM0 A;  1WY8 A;  5AUI A;  2OOB B;  5G2N A;  3QK0 A;  3Q3O C;  2G4S A;  2DYO A;  4OVZ A;  3TUO A;  1VZ7 A;  3U7Z A;  2J42 A;  4TQ0 A;  3IAM 1;  5FKA C;  2J53 A;  2LZ6 A;  4ZRJ A;  3ZNG C;  5DCN A;  3PT2 B;  1FNW A;  1OEY A;  1MHX A;  1UF0 A;  1A70 A;  1CZP A;  3TCA A;  3T3N A;  2WXL A;  4N59 A;  4GGQ A;  3H1U A;  4DHZ B;  3EUB 2;  4DHZ E;  3Q14 C;  2AQ2 B;  1EUV B;  4XYC A;  2N1W A;  3H9D A;  2N0S B;  1HTO A;  1P9D U;  2IO3 B;  3HVD A;  3Q3J A;  3QQ8 B;  4HKQ A;  2WDT B;  1KLG D;  3LXF A;  4OVV A;  2W3S A;  3RNC C;  3R8B A;  4KIK A;  4ICV A;  1T0Y A;  3L17 A;  1XLP A;  2DBY A;  3AE8 B;  3ZXV A;  3ZJT A;  2ICI A;  2DLB A;  3SFD B;  1TS4 A;  2KTR A;  4KKI A;  1WJN A;  4FUL A;  4YWG G;  3Q8C A;  1VJK A;  4NAW B;  1JRO A;  2FNJ B;  5TR5 A;  4IM2 A;  3DBH B;  1WXS A;  1E8W A;  2L8J A;  4G3X B;  2WYQ A;  1R7S A;  3EGR A;  1VLB A;  3C8Y A;  1JW9 D;  1ZOY B;  1HEZ E;  5G5G A;  1EU3 A;  3SFE B;  4HDQ A;  2BQQ A;  1C4P A;  1XLN A;  3EA6 A;  4DHJ B;  2JXX A;  5DPW A;  4FHJ A;  1FCC C;  5C23 A;  2Z59 B;  2PE9 A;  4HCP B;  2K6Q A;  2L00 B;  3PRM B;  4M8M A;  2A4Z A;  2BYV E;  2IBI B;  1V1P A;  1JRP A;  1NBF C;  2M0X A;  2M8S A;  1UBI A;  2JT4 B;  4I6L B;  2M17 A;  4OW0 A;  1XLO A;  1WFY A;  1HZ6 A;  2HJ1 A;  3DCG A;  3N1Y C;  1ESF A;  1WJ4 A;  4B0E A;  1LO5 D;  2ZZP B;  2QIE B;  1E7V A;  1UGJ A;  3N1X C;  4NQL B;  2NMQ A;  2KZR A;  4ARC A;  3ZTD A;  2WXP A;  4UDU C;  2O2V B;  3ZUN A;  2KMC A;  1A5R A;  4XDC A;  4NJC A;  3W2D A;  3ENE A;  3ZQ4 A;  3NVY A;  2BS3 B;  4PYU A;  1OGW A;  1N6Z A;  3DVN U;  4R3D A;  1J19 A;  3SD5 A;  3L4P A;  3QCA A;  2C7H A;  1HE8 A;  4XDD A;  1RM6 C;  4XZ4 A;  2PVG C;  4YL8 A;  3APC A;  4P7I A;  3APD A;  2WXQ A;  2ONQ A;  2G3Q B;  5D3D A;  5IKC M;  2LGS A;  3ML8 A;  1I4H A;  3QHT A;  1AWD A;  2MP2 B;  2W55 A;  2KKC A;  2HDE A;  3NJT A;  2WXI A;  3FKY A;  3PZ7 A;  3ZLZ A;  1TYG B;  2WDV B;  3UI3 A;  3ZJU A;  1HA5 A;  3VH4 B;  3RNB C;  1UEL A;  3AM9 A;  3ZIM A;  2VH2 A;  3QAR A;  1UH6 A;  2MH7 A;  3CMM B;  1LXD A;  2LAS A;  3BY4 B;  4HPL B;  1WXV A;  2MW5 A;  4MSM B;  1BT0 A;  5FK9 C;  2WXF A;  4JGH B;  4YSX B;  3KWV A;  3DDC B;  2KWD A;  1IYF A;  3BIN A;  2KMM A;  1UD7 A;  3GE8 C;  2LVQ A;  4ZRP A;  2KLG A;  4KGT A;  3R7Q A;  4RMA A;  4KDI C;  2LJI A;  3UQB A;  5BYQ A;  2KNB A;  4RF0 A;  3NUH B;  3NHE B;  2MBE A;  1FD6 A;  1FXI A;  4MM3 B;  2I38 A;  2LGD A;  2LHD A;  4GOC A;  5MPO A;  2C7M B;  1L6U A;  2CHX A;  3PRP B;  2QC8 A;  2LWP A;  5EE0 A;  1P3Q U;  1WM2 A;  4ANX A;  3HVZ A;  2KAN A;  2IY1 B;  1JWA D;  4XE0 A;  2AL6 A;  2CKH B;  5CHF A;  4IKG A;  2RDH A;  3LB8 C;  4GSW A;  2CHZ A;  2WNM A;  4ANV A;  4KZ0 A;  1YQ3 B;  1STE A;  2MJE A;  3K9O B;  2V3P A;  4MDK E;  2KAJ A;  1TT5 B;  1E8Z A;  1NVI D;  2INN E;  2WX0 A;  4B0M A;  1C77 A;  1WWT A;  1WSP A;  2ZVO A;  3Q8B A;  2CU1 A;  2LHE A;  1TY2 A;  1N5W A;  4HEA 1;  5L95 C;  3BWU D;  4YT0 B;  2LUE A;  2WXG A;  2EKI A;  3CWI A;  3AMZ A;  4M02 A;  5JH5 C;  4TQ1 A;  4GXB A;  3N32 A;  4BKT A;  2NS5 A;  4WIP A;  4MT5 A;  3VRB B;  3WIM A;  3IVF A;  2D3B A;  2MBH A;  2ZVN A;  1E7P B;  1DOI A;  2WXN A;  2KN4 A;  2FCN A;  1KFY B;  2KQ7 A;  2EEL A;  2VRR B;  4LNK A;  3DVG Y;  4F8C B;  2AWT A;  2FAZ A;  1XD3 B;  1V49 A;  2FCQ A;  2RGF A;  2KDE B;  4NAW A;  5T8I A;  2IY0 B;  2L7R A;  4DDG D;  4MH8 A;  2ZCB A;  3GS2 A;  1TY0 A;  3WAO A;  4RGT A;  2KMA A;  4KIK B;  1JWS D;  5E6N A;  3DBS A;  1OQQ A;  1Q1O A;  2KTR B;  2INP E;  4MJS A;  3I5J C;  3GOE A;  4A55 A;  3KUC B;  4MGK E;  4XX5 A;  3H7P A;  4WUR A;  1J0G A;  4YTM B;  1H4R A;  1JWM D;  2D3C A;  3I63 C;  2WXO A;  2D3A A;  2WP9 B;  4BBN C;  3QA8 A;  4II3 B;  2Y5P A;  1J8C A;  2L3Z A;  2L0F A;  1ZUD 2;  2RDB C;  4C7Y A;  1GPX A;  1SE9 A;  3DBH I;  1YMH E;  2PIA A;  1WXQ A;  2FUH B;  1K51 A;  3EEC A;  3N30 A;  1CQV A;  5AZG A;  3GP7 A;  1QKZ A;  1X1M A;  3ABV B;  4W9I A;  1XQQ A;  3IHP C;  1V1P B;  5BMG A;  5C2T B;  5DPR A;  3ZNI D;  3H8H A;  2PMV A;  2ZW1 A;  3JVZ X;  3W5U B;  3WAP A;  3T3O A;  3KW5 B;  3R7R A;  3AB5 A;  2DNF A;  2GBJ A;  4I6P A;  2OHF A;  1EM7 A;  1C76 A;  3PV1 A;  2KWU B;  1KM7 A;  4REZ A;  1G6J A;  2KVR A;  2J0J A;  3AED B;  4RF1 A;  1N62 A;  1WX9 A;  1AYF A;  1GUA B;  3R2I A;  2KFJ A;  3VXW A;  1EWC A;  3UIO B;  4IUM B;  3PO0 A;  3BYT B;  4WWP A;  2MP2 A;  4W9E A;  1SSN A;  1VCB A;  1MJD A;  5BMI A;  2WX1 A;  1J7C A;  4EEW A;  4W9L A;  2ZEQ A;  4KZC A;  3DWM A;  3Q8A A;  3OJ4 B;  1ZP0 B;  2V1Y A;  4NQK E;  2A5U A;  2DYM A;  3AEF B;  1LFD A;  5D6J B;  4M01 A;  4JIO U;  1E7U A;  2OJR A;  2BWE S;  4LJO B;  2EKE C;  4B6W A;  1HTQ A;  1GAQ B;  4DXA B;  4X57 B;  2DHZ A;  3GZN I;  2R2O A;  1YN5 A;  4OHJ A;  1RFK A;  1LQB A;  1UWM A;  3FAH A;  2N9X A;  2KOX A;  1RAX A;  5GXG B;  4HWI B;  1V81 A;  3A9K A;  4KDL B;  5J18 A;  2FIF A;  4GB9 A;  4AJW A;  2ZJD A;  4LNF A;  1WZ0 A;  1TJE A;  3BK2 A;  1N63 A;  2NVU I;  2D3G A;  4WWO A;  3ZNH B;  1IPG A;  3NVV A;  3DHG C;  3ETR A;  1ZPS A;  2GBR A;  2L83 A;  1K53 A;  1P1A A;  2GMI C;  5BO4 B;  3JYU A;  2J4X A;  3VR8 B;  2DWQ A;  3IXS A;  4HPP A;  4JL9 A;  1QIL A;  1R4M B;  3VDZ A;  3NOB A;  4EOY A;  4A90 A;  3RNF C;  2ZNV C;  3T8M A;  2I1J A;  2KJR A;  3AE5 B;  1D5Z C;  1I7H A;  4AJY B;  5HFY A;  4P6V F;  1SIF A;  3DWG C;  4G0N B;  5G5H A;  5J2R A;  1TS5 A;  5J17 A;  1V1O A;  1IGD A;  1K50 A;  3OAW A;  1E10 A;  3PRZ A;  1T0Q C;  3AU5 A;  4GN1 A;  4MAC A;  1UWX A;  1WYG A;  2MBO A;  4PYZ A;  1WYW B;  2LUM A;  2MBQ A;  1L4D B;  2HJ8 A;  3KQ4 A;  3P4P B;  1ZKH A;  3R2T A;  1F52 A;  3DOW A;  1QOA A;  3QX1 A;  1YJI A;  1VR9 A;  1TKY A;  1UNS A;  1SE3 A;  2JWZ A;  2WHI A;  4K7U A;  4IOI E;  3OWE B;  1J7A A;  1F9J A;  2BYT A;  2M1M A;  1E8Y A;  3IT4 B;  1F1H A;  4F1S A;  1R4N I;  3WAM A;  1E8X A;  4FBJ B;  3B1L X;  2RDG A;  4WAF A;  4P1C C;  5JZE B;  2PW9 A;  2IO2 B;  2IGD A; 
#chains in the Genus database with same CATH homology
 2WXQ A;  3NVZ A;  2ONQ A;  2IJ0 A;  2JQR B;  2G9H D;  5D3D A;  3MJ5 A;  1C9F A;  3AE4 B;  2BB6 A;  1QQR A;  1I4H A;  4JPS A;  1L0V B;  2VZK B;  1ZDX A;  1DGJ A;  1FCL A;  1AWD A;  2JXT A;  2W55 A;  1C79 A;  2HDE A;  3B2G A;  1IBX B;  1AN8 A;  2WXI A;  3PZ7 A;  2QIL A;  3GB1 A;  1TYG B;  2WDV B;  1OQR A;  2B76 B;  2HTM E;  4XWT A;  3UI3 A;  5EE9 A;  1MPE A;  2M0A A;  4HRS A;  3ZJU A;  4WH4 A;  4EE2 A;  4C7Z A;  2PLP A;  1HA5 A;  3PZ8 A;  4TMA B;  2GRI A;  4OZC A;  2JX5 A;  3FIL A;  1JQ4 A;  3AM9 A;  1L5P A;  5HHD G;  1VZ6 A;  2K3U A;  1KTK A;  3HRD D;  2MH7 A;  1C4C A;  2WXJ A;  3AEC B;  3HUI A;  2H88 B;  1I4X A;  2KAC A;  4RGM A;  1SE2 A;  5FK9 C;  2WXF A;  1K52 A;  4RGO S;  2W54 A;  3I9V 1;  2KQ4 X;  4OZA A;  2GI9 A;  4P16 A;  4YSX B;  3KWV A;  1NYQ A;  1C78 A;  1PFD A;  1TZO A;  2NTS A;  4DQO C;  4YSZ B;  2IPK D;  4CQN A;  2KWD A;  1SBB B;  3AN1 A;  2KMM A;  3TSS A;  5I4D A;  5BYR A;  4N6E B;  3MHZ A;  3RPF C;  3VQI A;  4A6Q A;  4AQ7 A;  4ZRP A;  3AE6 B;  1QF6 A;  4KGT A;  4XWW A;  3V3X A;  1PGA A;  5D3I B;  1ZE3 D;  1ROE A;  1FFV A;  1DOX A;  2LJI A;  3I57 A;  5BYQ A;  4RF0 A;  2ON8 A;  3NUH B;  3U4E G;  2FBW B;  4AS1 A;  2BBC A;  3BYY B;  4OZB A;  1FD6 A;  1I4R A;  1FXI A;  4MM3 B;  1SIJ A;  2I38 A;  2LHD A;  2QEJ C;  4WQM A;  5MPO A;  4YSY B;  1L6U A;  1XO3 A;  1WGK A;  4RFB A;  5EE1 A;  1XF5 L;  3B9J A;  5EE0 A;  4L23 A;  4ZOH C;  2AQ1 B;  1T3Q A;  2K22 A;  5E6J A;  3HVZ A;  3AH7 A;  2IGG A;  2XNA C;  2PW9 A;  1JWA D;  4XE0 A;  2LGI A;  1BML C;  1ZXH A;  2E3T A;  5C3J B;  3TEY A;  1FEH A;  3E9S A;  2MJD A;  4IKG A;  2RDH A;  1RYJ A;  1ZXI A;  3MC0 B;  3LB8 C;  2BTE A;  1M4V A;  3URY A;  3SR6 A;  2BS2 B;  1B1Z A;  1D5X C;  3W1S A;  1T5X D;  2FE8 A;  2JU6 X;  2TSS A;  2WNM A;  1PGX A;  1HZ5 A;  4GDL B;  1YQ3 B;  1STE A;  4L1B A;  3W9C B;  3CIR B;  2MJE A;  1MI0 A;  1F2R I;  2SAK A;  2BS4 B;  1TKG A;  1PYW D;  2V3P A;  2KAJ A;  3AE7 B;  3B2F A;  3E56 A;  3ZGZ A;  1NI3 A;  2WXR A;  5LNK 1;  3Q69 A;  2OED A;  1NVI D;  1QOB A;  1XEE A;  1VRA B;  2INN E;  4B0M A;  2L1A A;  2N9L A;  1C77 A;  1PUT A;  1WWT A;  1L0X B;  1WSP A;  1TKE A;  1SJH D;  3Q8B A;  2JYT A;  3AE3 B;  3NRZ A;  2LMC A;  2LHE A;  1TY2 A;  1N5W A;  4ZHO A;  1SF0 A;  2AQ3 B;  4HEA 1;  1XCT L;  3U2S C;  1KRH A;  5BYS A;  1FXA A;  4US9 A;  2JZP A;  3BWU D;  4YT0 B;  2WXG A;  2EKI A;  3MFG A;  2M56 B;  3CWI A;  3AMZ A;  4ARI A;  4HRO A;  4C56 C;  4TQ1 A;  2G1E A;  1WRI A;  4WIP A;  4MT5 A;  3VRB B;  1YN4 A;  1E9M A;  1IBX A;  1UUP A;  4L2Y A;  1E7P B;  1DOI A;  3BVM A;  1FNU A;  2WXN A;  2WS3 B;  2KN4 A;  1VZ8 A;  4DXG A;  3SEB A;  1KFY B;  3AEA B;  1RWS A;  1Y56 A;  2X38 A;  3BII D;  2RPV A;  2PTL A;  2EEL A;  4O1N A;  2PKO A;  1I4Q A;  3LYY A;  3O13 A;  1P7E A;  2SEB D;  1ZDV A;  4LK0 M;  2N7J A;  4FXC A;  1I4G A;  1P7F A;  1N5X A;  1D6E C;  2LFI A;  1KLU D;  4PT5 A;  1ET9 A;  1YJJ A;  2IGH A;  1E6E B;  5T8I A;  2K9X A;  2WXK A;  4MH8 A;  3GS2 A;  1TY0 A;  4RGT A;  2WLB A;  1JWU D;  4YTP B;  1JWS D;  1F0Z A;  2W82 A;  4ZRQ A;  4US8 A;  1OQQ A;  4GLS C;  4LLG M;  4DXF A;  2INP E;  1SXT A;  3NVW A;  3BK1 A;  3P4R B;  4A55 A;  1V97 A;  4M0W A;  1SE4 A;  1TS2 A;  3P4Q B;  4WUR A;  4KKJ A;  4JWS C;  4YTM B;  1JWM D;  1J7B A;  2VZK D;  1ENF A;  2WXO A;  2WP9 B;  1IGC A;  4J3O D;  2V0G A;  1FMA D;  2Y5P A;  2QJL A;  5HG2 A;  1FFU A;  3AE9 B;  2BT6 A;  3ZYY X;  1QLB B;  3TEZ A;  1ZUD 2;  1GPX A;  4C7Y A;  1CJE A;  1NEN B;  1ET6 A;  2QMT A;  1JAL A;  5BMH A;  1YMH E;  2JSV X;  2PIA A;  1WXQ A;  4NZL B;  1V8C A;  4N58 A;  1K51 A;  5H8Y E;  2JYE A;  2N9K A;  4HJG E;  2L32 A;  1CQV A;  4YTN B;  1GOZ A;  3Q8F A;  3GP7 A;  1E0Z A;  2GB1 A;  1QKZ A;  3IT6 B;  3BVZ A;  2K5P A;  3Q8E A;  1MVK A;  2H89 B;  1PGB A;  1FO4 A;  4H2A A;  3ABV B;  1DYQ A;  1MHH E;  1V1P B;  1ACC A;  1XXG A;  5BMG A;  5C2T B;  3ZJV A;  3H8H A;  2PMV A;  2WXM A;  2JWU A;  2MEK A;  2ZW1 A;  3P63 A;  1OFF A;  2WDR B;  4A9A A;  2CJO A;  3W5U B;  3IAS 1;  4C80 A;  3T3O A;  1QOF A;  1C4A A;  3AB5 A;  2CJN A;  2WDQ B;  2V4I B;  3AV8 A;  4JX1 C;  4LTU A;  4ZYS A;  2IDY A;  2OHF A;  1GB1 A;  4RH6 A;  1EM7 A;  1HXY D;  4ZHP A;  1PDX A;  1C76 A;  4REZ A;  2M19 A;  2QSD A;  3AED B;  4RNA A;  4RF1 A;  5AUI A;  4A8X C;  1N62 A;  1JML A;  3P42 A;  1AYF A;  3FC4 A;  4RGN A;  1EWY C;  2ZW0 A;  2R61 A;  3R2I A;  2DYO A;  4KGR A;  1AW7 A;  3AE1 B;  1FRD A;  3NS1 A;  1VZ7 A;  4OVZ A;  3TUO A;  2Q5W D;  2I2Y A;  1EWC A;  3U7Z A;  2J42 A;  1BUI C;  4TQ0 A;  3PO0 A;  3BYT B;  4NAM A;  3IAM 1;  2Y5C A;  2NTT A;  5FKA C;  2J53 A;  3KWL A;  1FRR A;  2W3R A;  1SSN A;  4D2K A;  3NZ3 A;  3VR9 B;  1FNW A;  1JCK B;  1MHX A;  5BMI A;  1A70 A;  1CZP A;  3T3N A;  1GB4 A;  2WXL A;  1J7C A;  4N59 A;  4KGS A;  3EUB 2;  3DWM A;  3Q8A A;  1CK1 A;  1DOY A;  1ZP0 B;  2AQ2 B;  2WU5 B;  2DYM A;  3AEF B;  1BXT A;  2N0S B;  3P4S B;  4HKQ A;  1FM0 D;  3HVD A;  1KLG D;  1SJE D;  1YQ4 B;  3LXF A;  2W3S A;  3R8B A;  2Z8L A;  3FIL B;  1GAQ B;  4YXD B;  2V3N A;  2YEP B;  1XLP A;  1F2R C;  2DBY A;  3AE8 B;  3MP9 A;  4IDI A;  2ICI A;  3ZJT A;  2DLB A;  3SFD B;  1TS4 A;  1YN5 A;  4USA A;  4HKZ E;  4KKI A;  4OHJ A;  1N60 A;  5D7G A;  4YWG G;  1D4B A;  2MJ3 A;  1QT9 A;  1RFK A;  1UWM A;  3FAH A;  3Q8C A;  4KX6 B;  1VJK A;  4NAW B;  1JRO A;  2E6X A;  1L0Y B;  5GXG B;  2WQY B;  1SB3 C;  3U52 E;  2WU2 B;  3AEE B;  1R7S A;  3EGR A;  1TJE A;  1VLB A;  3C8Y A;  1JW9 D;  1ZOY B;  3BK2 A;  1YN3 A;  1FNV A;  1N63 A;  1HEZ E;  5HI1 A;  2LEK A;  5G5G A;  1QOG A;  3J9C A;  1EU3 A;  5H92 C;  3SFE B;  5FR3 A;  1HQR D;  2Y3A A;  1VDV A;  3NVV A;  3BVG A;  3ETR A;  5EE3 A;  1C4P A;  1ZPS A;  1NEK B;  2L83 A;  1XLN A;  3EA6 A;  1K53 A;  4TSS A;  3RFZ B;  4RCO A;  2D5G A;  2FUG 1;  3TEW A;  1L4Z B;  1NYR A;  1FCC C;  2BB5 A;  1T6B X;  2J4X A;  1N61 A;  2XN9 C;  3VR8 B;  2DWQ A;  3IXS A;  2WXH A;  1QIL A;  2ACZ B;  1FIQ A;  2YEP F;  4Q2J A;  1TS3 A;  4A90 A;  2CU3 A;  3AE5 B;  1F77 A;  1D5Z C;  1I7H A;  1SEB D;  5HFY A;  4P6V F;  3DWG C;  3WCQ A;  1V1P A;  1JRP A;  5G5H A;  1TS5 A;  1YNT E;  1IUE A;  1D5M C;  1V1O A;  4WWM A;  1IGD A;  1K50 A;  4JE3 B;  1E10 A;  1Q10 A;  3KLS X;  2KDM A;  4OW0 A;  1XLO A;  4MAC A;  2BW2 A;  1UWX A;  1WYG A;  1HZ6 A;  2J52 A;  1ESF A;  3N9Y C;  4B0E A;  3VRA B;  1LO5 D;  2LUM A;  1L4D B;  3KQ4 A;  3P4P B;  2QIE B;  3TEX A;  1UGJ A;  3V05 A;  5TSS A;  3R2T A;  3W5V B;  3BZD B;  1L6V A;  2NMQ A;  1KH0 A;  1QOA A;  1B9R A;  1YJI A;  5JXV A;  1VR9 A;  1TKY A;  1KF6 B;  2AX5 A;  1UNS A;  1SE3 A;  4ARC A;  4JWU C;  4GDK B;  2WXP A;  1XCQ L;  1JWB D;  4UDU C;  4IOI E;  3OWE B;  5AUK A;  1XLQ A;  3AE2 B;  4XDC A;  1J7A A;  4NJC A;  3W2D A;  2BYT A;  3ZQ4 A;  3NVY A;  3IT4 B;  2BS3 B;  4ITK A;  1EU4 A;  3AEB B;  4R3D A;  2L52 A;  3P1M A;  2RDG A;  3L4P A;  4WAF A;  3AEG B;  4XDD A;  1RM6 C;  1I4P A;  2K0P A;  2PVG C;  2RMM A;  2IGD A;  2PVO D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...