3ZUNA

Pvhl54-213-elob-eloc complex_(2s,4r)-4-hydroxy-1-(2-(3-methylisoxazol- 5-yl)acetyl)-n-(4-nitrobenzyl)pyrrolidine-2-carboxamide bound
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
102
structure length
102
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Elongin-B, Elongin-C, Von Hippel-Lindau Disease Tumor Suppressor Complex
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 20
structure length 102
sequence length 102
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zunA00
2KFKA 4EZKA 1KLVA 3IHPC 5DPRA 1E7UA 1UBIA 1WX8A 3NY5A 2DAJA 3NS8A 2IO3B 4F1SA 4IWPA 3QA8A 4KZ0A 2WYQA 4BVUC 3L16A 2ZCBA 2GBJA 3A1QA 2GOWA 3CSTA 5D7GA 1F9JA 5J2RA 3M63B 4GXBA 3R7RA 2KHWB 3VH3B 2BGFA 3ZDMC 4EFOA 1Y8RC 1IPGA 5JZEB 3W1SA 2NS5A 2LD9A 2DAFA 4MGZE 4B6WA 2L00B 3C0RB 2ZZPB 3VAWA 1RLFA 5BO4B 4K81A 4WWNA 4TQ1A 2ASQA 3VUXA 3A33B 3DOWA 2OOBB 2DENB 3H1UA 4A3OA 1IP9A 2KTRB 2ZNVB 1LXDA 2I1JA 3A9KB 2LRUA 2NCNA 4JGHB 3VTVA 2JWZA 2DYBA 2MA9B 2ZPNA 1WE6A 3WIMA 4HPLB 3M62B 1KOTA 3VXWA 2G3QB 4KSKC 3L10B 2RPQA 4X57B 4XZ4A 2GBMA 5KHOA 5TR5A 2BF8B 1H4RA 1WRDB 2HE7A 3ZLZA 1C3TA 1HE8A 4ZYNA 2RSUA 1E8XA 2MLBA 2LXAA 4TKNA 5AZHA 4BOSC 2KMAA 2LGXA 4FJZA 4DHZB 4W9KA 2LXCA 2XK5A 4LDTB 1GNUA 3JSVB 2JRHA 1D3ZA 3K9OB 2K25A 1R4MI 4F7ZA 4IM2A 1P98A 3B08A 2KX3A 4A20A 3NZUA 3BY4B 3IBEA 1OGWA 2KLGA 3DVNV 4II2B 3TCAA 3VUYA 3IG3A 4WAAA 4DXAB 4HCPB 1E5WA 2AWTA 3DPDA 3L17A 2XBBC 3TMPB 4CHKA 4NQKE 1WXMA 2HJ8A 1XD3B 2JT4B 4GN1A 2KN5A 1TZ1A 4WJNA 4NAWB 1WMHB 2L76A 4RM8A 1VCBA 2FAZA 2NBUA 4MGYE 1WM3A 1WGYA 1ZW7A 5EDSA 1WF9A 2CHXA 2KD0A 3TIXA 1OEYJ 3ZUNA 2CHWA 1WH3A 3H6NA 5AZGA 5JHAA 3CMMB 3HM6X 3NOBA 2KDEB 3VDZA 2L0FA 3APFA 1GC6A 1IYFA 4HPMB 1SE9A 4FADA 3ENEA 3IVFA 4IC7B 1Q0WB 3O65B 5AZFA 4DHJD 4AUQC 1XT9B 3N3KB 2REXA 2AL3A 1Z2MA 4WQOB 2ZJDA 3DQVA 4M8NA 3UIOB 3X23A 1V80A 3NZSA 4TQ0A 3PV1A 5G55A 4WJQA 2CR5A 1KJTA 3V6CB 3V62A 3WAOA 2BKRB 3Q3FA 4CYEA 2N9EB 4MJSB 1GC7A 4LJPB 2LGYA 3N30A 2B3AA 4KIKB 1LQBA 3KW5B 4A3PA 4DHZE 1WJUA 3PZDA 1ZKHA 4AOFA 1EO6A 2K39A 2EMSA 4W9DA 2KANA 3KVFB 2LASA 2KNBA 1UZXB 4NNJB 4OVVA 1UELA 2BYVE 5IA7A 3A9KA 3H7PA 2IY0B 2GBKA 2ZVOA 2IZVB 3PT2B 4WJOA 3VUWA 1J8CA 2JPHA 4W9GA 1FXTB 2L7RA 1UH6A 3TBLD 2XEWA 2MQJA 4TV3A 3SD5A 2PE9A 2KX0A 4FHJA 4AWJA 4BKGA 1J0GA 2A5UA 1M94A 2KJHB 4GMVA 3ZNID 1E8WA 5HKHA 5DPSA 2LI5A 2LZ6A 3DBLI 4FJYA 2NPTB 3X0WA 2D3GA 4URKA 4G0NB 5E6NA 2JRIB 2ZEQA 1L7YA 1MG8A 1ZGUB 1E8YA 3PS6A 3JSVA 3EECA 4MH0E 4MEMA 4MM3A 2LWPA 4RMAA 3UGBB 2M4NA 4ANVA 1OQYA 1I42A 5LXHA 4ZRKA 3UF8A 2KMCA 5CHFA 3DVGX 3PRPB 2K1FA 3JVZX 4EOYA 2CKHB 3QCAA 4GOCA 2IY1B 4MDKE 3SU8X 1OTRB 4EKUA 3DCGA 4W9JA 4ASWC 3VTWA 1E90A 3WALA 2RGFA 3ZTDA 4BKSA 4NAWA 1WMHA 3ZNGC 3UIPB 2IYDB 2N7DA 5DPTA 2YVCA 4M8MA 1YX5B 2HD5B 3T8MA 1WE7A 4JIOU 4K7WA 2L3ZA 1WJ6A 3DVNU 3A9JB 3KUZA 4HJKA 3HK0A 3L13A 1V86A 2BKFA 2V3SA 2C9WB 3AULA 1V81A 3N32A 4XC2A 2N1VA 1YQBA 3RYTA 1WXSA 2Z0EB 4PS7A 1RFAA 4TUUA 4WWPA 3KUDB 4J6IA 3ONSA 4WWOA 2KXJA 3WAPA 2LVPA 3VQIA 4I6PA 1E8ZA 2PEAA 4YL8A 4GGQA 4W9EA 4W9FA 2KO3A 4ICVA 2DYMA 1Q5WB 4FJVB 4I6NB 5DPWA 5G2NA 4FN2A 4E3CA 1UGMA 5C1ZA 4KIKA 1WZ0A 3R7QA 1V9JA 3UQAA 4E71A 5CTRC 3ZW3A 2NR2A 3RULA 2M0XA 1E7VA 2KDBA 3CSFA 2O2VA 2J0KA 4AJYB 4NQLB 3R66C 2AYOB 1V5TA 4IG7B 1SIFA 3D32A 2BPSA 2KWUB 4CO7A 1TTNA 1Z5SB 3PVLA 2MX2A 4BBNC 2W9NA 2VRRB 4DHJB 1KM7A 4PS8A 2KOXA 4IM0A 4BKTA 4GDLB 2PPHA 3LDZE 1TBEA 2KWCA 1WGDA 1R4NI 3RT3B 4M0WB 4G3XB 3PHWB 1WM2A 2DX5B 1WYWB 1TGZB 4HK2A 4HXDA 2BWFA 2FIFA 4LCDE 4B95A 4ZRIA 2PE6B 1V2YA 2NPTA 3VFKA 4DDID 2MBQA 3T9LA 2IO2B 1WY8A 3JW0X 4N9F4 4DK5A 3ZTCA 2KWVB 3A4SC 2DYOA 2O6VD 2IO0B 1J19A 1OEYA 3I3TB 3ZO5B 3TJPA 3WA0A 4LDTD 3EFUA 2L8JA 2KJ6A 2N7EA 3PTFC 5LLIA 3APCA 3VH4B 2DZMA 3M3JA 3ML8A 2KTFA 2C7HA 4FLHA 4IM3A 3EC8A 3QARA 1H8CA 3QIJA 4K1RB 3VHTC 3APDA 1ISNA 2GBNA 3ZRCA 1EF5A 2RD0A 2M17A 1S1QB 2KKCA 1EUVB 3A9JA 2KTRA 4GDKB 2NVUI 4XX5A 4DWFA 4HWIB 3WAMA 5CHWA 2FIDA 3OAWA 2C7MB 3L08A 3HHMA 2DHZA 4IUMB 3AU5A 2JXXA 2DZIA 4GIVA 3Q3JA 1GJZA 4KDLB 1WJ4A 1WJNA 3GZNI 2KZRA 4AJWA 3P2BA 1T0YA 2N1WA 3VTUA 3PREA 4JLCA 2G4DB 2A4ZA 2V4LA 3QK0A 3V6EB 4LJOB 2Y5BB 3ECIA 5GMVA 2UYZB 5LXIB 2KDFB 3DBRI 2Z59B 3MJWA 3GOEA 4IWQA 4GSWA 4DDGD 1I35A 2MP2B 2KFJA 3B0AA 5JH5C 2NBVB 2R2OA 3OLMD 4NJ6A 3U8ZA 2I1KA 3ZKJC 3QHTA 5D6JB 1P0RA 2G45B 2WX0A 1WGRA 2GBRA 1NBFC 1WXVA 3LJ3A 2KQ7A 3NHEB 2JZ3B 2IO1B 2FCSA 2FCMA 3UQBA 3HM3A 2KK8A 4WJPA 4GDLA 3W1SC 3BINA 2C5LC 3U30A 1QZEA 2KQSA 1K8RB 3W1YA 2BWES 1WGHA 3ALBA 4F8CB 1UBQA 1AARA 2CU1A 4HCNB 4W9IA 2DZJA 2K8CA 4KV2A 5CHVC 4PYUA 4BBNF 2KC2A 5D2MB 4B9KA 2K8BA 2V1YA 2BYFA 1LM8B 3K9PB 3ZNHB 4DBGA 3QAQA 2DZKA 3KYDD 3PLVA 2OJRA 2LGDA 3EHVA 2MBEA 3PRMB 1NI2A 2J0JA 3QC8B 1L2NA 3M95A 2KDIA 3OJ3A 1PQSA 5CX3A 4OVUA 2K8HA 3AXCA 2EMTA 2LRWA 3L0WB 2AL6A 1YD8U 2CHZA 2MW5A 4MJSA 3RD2A 4E74A 3H7PB 2WX1A 4NPNA 2FUHB 1BT0A 2J7QB 2BYEA 3UINB 1WZ3A 1GG3A 4KDIC 3SHQA 4FA6A 3HIZA 4PYZA 3DBHI 3RCZA 2KVRA 4GDKA 2D2QA 3RUIB 3PSEB 3DDCB 1WIAA 4I6LB 2WDTB 4AP4C 1WR1A 3MTNB 3ZRFA 3QWZB 2O6VB 1V49A 3AI5A 3AU4A 3B1LX 1WX7A 4ANXA 3DVGY 4IWOA 1S3SG 4KZCA 5J18A 2KFKB 1X1MA 1WX9A 3H7SA 2JY6A 2N9XA 4IW0A 4HLEA 2MCNB 2R2QA 3TL5A 3L54A 4MELA 1C1YB 2FNJB 3QJZA 4KSLC 2JVCA 2ZVNA 4MGKE 3RZWC 2Z0DB 2HTHA 4GU2A 4GB9A 4BOZB 3S2AA 5E6OA 4JL9A 2M8SA 1NDDA 4K7UA 1RRBA 4FBJB 2KJRA 1V6EA 4W9HA 3A1QB 2KLCA 2FCQA 4ANUA 3PHXB 2MP2A 2NBWB 1U4AA 2PJHA 4MGIE 2EKEC 3MHSD 2MWSB 3KUCB 3V61A 3JYUA 3A4RA 4ANWA 4MSMB 2D11A 3KH0A 4FHKA 4W9LA 1SGHA 4W9CA 3WANA 4HVBA 1P1AA 3V60A 1XQQA 4PS3A 2MBBB 3H9DA 3PGEA 4EEWA 1P9DU 2GMIC 3QX1A 4II3B 4RM9A 2MBHA 1YJ1A 2UWQA 2IBIB 2AEHA 3PPAA 3PLUA 2L05A 1EF1A 4KVGB 4NY0A 4P7IA 4BKSD 2MBOA 4G50A 1V5OA 2LVQA 4HDQA 1UD7A 4EZLA 3ZIMA 2MRPA 3DBSA 4ZDVA 2ZNVC 1VD2A 1CMXB 4JQWC 3R3MA 4EZJA 1RAXA 2C7NB 1GUAB 2N9PC 2WWZA 2ZPYA 3QQ8B 1WI0A 1WXAA 2LVOA 4G11A 3CF6E 4NJ7A 5L83A 2K6QA 2D10A 2XK5B 2LJ5A 1YX6B 3OJ4B 4K7SA 5D94A 4HDOA 1WR6E 2N4FA 1Q1OA 5IAAC 3ZDTA 3RZFA 5E6PA 1A5RA 5J17A 5DCNA 1G6JA 2K6DB 4ZRJA 2O2VB 5L95C 1WGGA 4EUTA 2J0MA 4FULA 3ML9A 2JF5A 1LFDA 2D07B 2FCNA 1YIWA 2JZZA 4BFRA 5FR6A 5C23A 3SDLC 3ZVVA 5AEKB 1JRUA 2YLMA 3KYCD 3U7DA 2JUOA 1WFYA 2L0TA 4MSQB 2C60A 2KC1A 2G4SA 2LUEA 2M1MA 2MSED 2RR9A 3IFWB 3VVWB 2CS4A 4ICUA 2O6VA 2ZCCA 3ZNZB 1P3QU 2QHOA 3PRZA 5JHBA 5KHQA
chains in the Genus database with same CATH superfamily
1SXTA 4R3DA 1WWTA 3AN1A 4M0WA 4EZKA 1KLVA 2J52A 3HVZA 3AV8A 1GOZA 2DAJA 1ZDXA 1XO3A 4F1SA 3QA8A 2JYEA 2GOWA 5D7GA 4GXBA 3R7RA 3ZYYX 1CK1A 2DAFA 2L00B 2ZZPB 1L0XB 3VAWA 1FXIA 4WWNA 3DOWA 3H1UA 2OOBB 2DENB 1IP9A 3AE7B 2ZNVB 1LXDA 4XE0A 4A55A 4LLGM 1LGRA 5HHDG 3VTVA 1I4RA 2CJNA 4HPLB 3M62B 3ZJTA 1KOTA 3L10B 2RPQA 4XZ4A 2GBMA 5TR5A 1WRDB 2FE8A 1C3TA 1HE8A 4ZYNA 4LNOA 3BVGA 4K3BA 2BQQA 5IP4D 1D3ZA 2K25A 4RF0A 3C8YA 3BY4B 4II2B 3DVNV 4HKZE 3TCAA 3VUYA 1E5WA 4NQKE 1WXMA 1XD3B 2L76A 3BWUD 1T0QC 1WM3A 3ZUNA 2CHWA 5AZGA 3CMMB 3HM6X 5BYRA 2RDBC 4MH8A 1IYFA 4A90A 1FCCC 1EWYC 5AZFA 1FNVA 1XT9B 5EE1A 2AL3A 4LNIA 1R7SA 2ZJDA 4M8NA 3UIOB 1V80A 3NZSA 3PV1A 2QEJC 2J42A 4WJQA 2CR5A 4RGMA 3V62A 2BKRB 2N9EB 1M4VA 3N30A 2B3AA 1EO6A 1PDXA 1QOGA 1QLBB 3KVFB 4NNJB 3A9KA 1TKGA 2KVZA 1C77A 2JPHA 4W9GA 4AWJA 2KJHB 5H8YE 3ZNID 1E8WA 2LZ6A 1AWDA 5E6NA 2ZEQA 1I4XA 3AB5A 1ZGUB 4RMAA 4MM3A 2LWPA 1OQYA 5EE3A 1NEKB 4ZRKA 3UF8A 4FXCA 1ZXHA 2CKHB 4GOCA 3DCGA 4W9JA 1E90A 2RGFA 4L23A 1WMHA 3UIPB 3PO0A 5DPTA 1E9MA 2CJOA 2WHIA 1WE7A 3GZNB 3A9JB 1V86A 2C9WB 1V81A 4XC2A 1SE2A 2N1VA 5D3IB 3DBRB 4J6IA 4WWOA 3TUOA 1N61A 4HROA 4OZAA 1XXGA 4W9FA 4ICVA 1VRAB 5TSSA 2LGSA 4FJVB 5G2NA 2WLBA 4KIKA 4P6VF 1WZ0A 1HTQA 2I38A 5CTRC 4RGOS 3RULA 2KDBA 3CSFA 3ZQ4A 4AJYB 4NQLB 4IG7B 1SIFA 2BPSA 2INNE 2KWUB 4CO7A 1TTNA 2VRRB 3P4SB 4PS8A 4BKTA 4GDLB 1SJHD 2PPHA 3URYA 1XLOA 3O13A 4JX1C 4G3XB 4M0WB 3TEXA 3VFKA 2NPTA 1HEZE 2V3PA 2IO2B 1WY8A 1J7AA 4N9F4 4OZCA 4REZA 2AQ1B 2DYOA 1WGKA 2IDYA 3ZO5B 1C78A 2AQ2B 3CIRB 2BTEA 2KYWA 2Y5CA 4YXDB 2RPVA 3M3JA 3ML8A 2KTFA 2C7HA 3E9SA 1JRPA 4K1RB 1QOFA 3DHIC 3ZRCA 2RD0A 2KKCA 1EUVB 4GDKB 2NVUI 3AE6B 2FIDA 1ET9A 2WGSA 3TEWA 4YT0B 1DOIA 1GJZA 2LUMA 1WJ4A 1D5MC 1D5ZC 2KZRA 3I63C 2KN4A 3AEDB 2N1WA 3VTUA 1DOXA 3PREA 2A4ZA 2WXMA 2Y5BB 2BVCA 1HXYD 3GS2A 1P7EA 3GOEA 3BYYB 1I35A 2KFJA 5E6JA 5JH5C 2NBVB 3U8ZA 2I1KA 4IDIA 1P0RA 1WGRA 2GBRA 2IJ0A 2JZ3B 4N59A 3Q8EA 3HM3A 1WSPA 4WJPA 2VH1A 3BINA 3ETRA 1QOBA 2BWES 3ALBA 2CU1A 1HZ5A 1T0RC 1PYWD 2DZJA 3Q8BA 4B9KA 2V1YA 4WQMA 3QAQA 3AECB 3EHVA 1L2NA 1XCTL 1PQSA 4MJSA 3RD2A 3NG0A 4NPNA 2FUHB 2XN9C 2BYEA 4PK1A 5AUIA 1GG3A 2D2QA 3PSEB 3DDCB 4PT5A 1WR1A 2BT6A 1TYGB 1V49A 3AE8B 1NVID 1S3SG 1L5PA 1KLGD 5IO9A 1F2RC 1FXAA 4HLEA 1GAQB 4JE3B 1ACCA 2R2QA 4MM3B 2MCNB 3TL5A 3L54A 3Q8CA 2KMMA 4HRSA 3HUIA 2M8SA 4B0EA 3BK1A 2KJRA 3TSSA 3KWLA 4W9HA 4M02A 4ANUA 3PHXB 2NBWB 5LNK1 4MGIE 4C7YA 1PGAA 1BMLC 4ZHPA 3A4RA 2WNMA 1SSNA 3IAS1 3V60A 2MBBB 4DXFA 2UWQA 2IBIB 1F2RI 3DWMA 4NY0A 1CJEA 4BKSD 1R4MB 1NENB 3ZIMA 2WXOA 4EZJA 2N9PC 2N7JA 1WI0A 5L83A 2K6QA 4L2YA 4NAMA 3OJ4B 4K7SA 1WR6E 3RZFA 4C56C 5E6PA 1A5RA 1UF0A 1P7FA 2K6DB 3DHHC 1WGGA 2J0MA 2L52A 5BMHA 1SEBD 1YJIA 3T3OA 2Y5PA 1JRUA 2YLMA 3NS1A 2L0TA 2M1MA 1JWBD 2O6VA 3ZNZB 2N0SB 1V97A 5DPRA 4BZAA 2EKIA 3NUHB 2NMQA 2QC8A 4IWPA 1J7CA 5C2TB 3A1QA 1WYGA 5J2RA 1F9JA 3M63B 3ZDMC 1YOVB 1QF6A 5JZEB 2NS5A 4OHJA 2LD9A 4MGZE 1E6EB 3C0RB 1RLFA 5MPOA 4TQ1A 3AE9B 3VUXA 2WQYB 4CQNA 1IGDA 2I1JA 4D2KA 4JGHB 2NCNA 2DYBA 2MA9B 1K50A 3VXWA 2XNAC 1RWSA 1KTKA 3CWIA 4X57B 5KHOA 1UWMA 2RSUA 1E8XA 2H89B 2MLBA 2VH2A 3AE4B 2LXAA 4TKNA 4XWWA 1TT5B 1YJJA 3MC0B 1KFYB 1FCLA 1GNUA 4K3CA 2JRHA 2AX5A 3B08A 3IBEA 1OGWA 2KLGA 3IG3A 3E56A 4WAAA 3DPDA 2GRIA 2KN5A 4NAWB 4RM8A 1VCBA 2FAZA 4MGYE 5C3JB 1WF9A 2CHXA 2ONQA 3R8BA 2KDEB 2WDQB 2BS2B 3N1ZC 1GC6A 1SE9A 3ENEA 3IVFA 3O65B 2PIAA 3AEAB 3DQVA 2WU5B 3FAHA 2YEPB 1I7HA 4N6EB 3WAOA 3Q3FA 4MJSB 2L83A 1LQBA 5EE0A 4NZLB 2MHJA 2DBYA 4AOFA 2DNFA 2K39A 3Q6BA 2KANA 2LASA 2KNBA 2IY0B 1JCKB 2ZVOA 3PT2B 1UH6A 2JSVX 2PE9A 5FR3A 4BKGA 1J0GA 1M94A 2MJDA 5HKHA 4MACA 4FJYA 3JSVA 3EECA 4MEMA 4RH6A 3JVZX 4DXGA 1AW7A 4LTUA 2IY1B 1ZP0B 3RNGC 1JWUD 1MJDA 2PVGC 1YX5B 2L32A 2HD5B 2HDEA 2LJIA 4JIOU 1T0SC 2W82A 3AULA 2V3NA 1XLPA 1WXSA 2QDFA 3KUDB 1C76A 3ONSA 1K53A 3WAPA 3RN9C 3SR6A 1E8ZA 3P4RB 4GGQA 4W9EA 1Q5WB 1QKZA 4RFBA 3N9YC 4E71A 1STEA 2MJ3A 3ZW3A 2M0XA 1E7VA 1B1ZA 1Y56A 2J0KA 1RYJA 2W3RA 2AYOB 1V5TA 3D32A 4RGTA 3AE2B 1Z5SB 2KOXA 3LDZE 1WGDA 4ARCA 2J53A 1L0YB 3PHWB 2DX5B 1TGZB 2PE6B 1V2YA 1JMLA 2HTME 3JW0X 3BIID 4DK5A 2KWVB 2PTLA 1OEYA 4WWMA 4NJCA 2HJ1A 4LDTD 2PW9A 2KJ6A 2BB6A 3APCA 3VH4B 1Q10A 2RMMA 1E7PB 3APDA 2GBNA 2ON8A 2KTRA 4XX5A 4IKGA 4DWFA 2M0AA 2WXFA 3OAWA 3EGRA 2C7MB 1F52A 3L08A 3HHMA 3I57A 1JW9D 2JXXA 3AU5A 1SF0A 4GIVA 3Q3JA 1K51A 2X8XX 3MJ5A 1TJEA 3GZNI 1SE3A 3P2BA 3ZGZA 2FUG1 4JLCA 2V4LA 3QK0A 5JXVA 4LJOB 2OJWA 2KDFB 2LHDA 3DBRI 2JXTA 2PKOA 4IOIE 2VZKD 4IWQA 4P1CC 5IKCM 2R2OA 3OLMD 1T6BX 2R61A 5D6JB 1I4PA 4DQOC 1WXVA 2WXGA 2KQ7A 3NHEB 1EU4A 2KK8A 2QMTA 5HI1A 1ZDVA 1QZEA 1YN4A 1K8RB 4YSYB 3W1YA 1L0VB 4F8CB 4JWSC 4LK0M 5CHVC 5D2MB 1WRIA 2K8BA 4DBGA 3ZNHB 3NRZA 3FILB 3KYDD 3PLVA 2OJRA 2LGDA 4M00A 3T3NA 1NI2A 2ACZB 2KQ4X 2KDMA 2G9HD 5CX3A 2K8HA 4L1BA 1XLQA 3L0WB 2LRWA 2IGDA 1YD8U 2MW5A 4E74A 3NVVA 2J7QB 1RFKA 3Q2AC 4FA6A 3HIZA 3DBHI 3J9CA 1I4QA 1VZ8A 1SB3C 4AP4C 3AI5A 1WX7A 5HG2A 1PFDA 2G1EA 3DVGY 4IWOA 4ANXA 2BS4B 4S17A 3H7SA 1UNSA 4IW0A 3QJZA 2JVCA 2UU7A 1N5WA 1SE4A 2HTHA 4BOZB 3NVYA 4JL9A 1NDDA 4K7UA 4US8A 1V6EA 2MP2A 1U4AA 2EKEC 3MHSD 4LNKA 2WS3B 3DBHB 4ANWA 4FHKA 1XQQA 2BYTA 1UUPA 5GXGB 1P9DU 4P1BC 2GMIC 1FRDA 3QX1A 1IBXA 4II3B 4RM9A 4ZHOA 1YJ1A 2AEHA 3PPAA 1FPYA 4KVGB 1L6UA 2MBOA 4HDQA 2MRPA 3DBSA 1GB4A 2WXIA 3BYTB 3R3MA 3NVZA 1WXAA 3L4PA 2D10A 2DWQA 1Q1OA 3ZDTA 5DCNA 1G6JA 3RPFC 3B2FA 4YTMB 1LFDA 2FCNA 2WXQA 3IT4B 3P1MA 1FFUA 3ZJUA 2WXKA 2G4SA 2MSED 2RR9A 1FM0D 1TZOA 2CS4A 2ZCCA 5FK9C 1SBBB 3PZ7A 1JROA 3UI3A 3R2IA 3FKYA 2KFKA 3FC4A 1UBIA 1WX8A 4KZ0A 4BVUC 4AS1A 1HA5A 2PVOD 2ZCBA 1FNUA 4YWGG 4EFOA 2KHWB 4A6QA 1Y8RC 3W1SA 3NJTA 2LEKA 4B6WA 2D3CA 1EU3A 4C7ZA 5BO4B 1VR9A 4KKIA 3A33B 4A3OA 1D4BA 2KTRB 1C79A 3A9KB 1VJKA 3V3XA 2JWZA 2ZPNA 3WIMA 1NI3A 1YN3A 2BF8B 2HE7A 3ZLZA 3I5JC 1ZUD2 3ZXVA 1ESFA 3RNEC 2W55A 5AZHA 4BOSC 3N20C 2KMAA 1L6VA 4DHZB 4WH4A 1YQ4B 2XK5A 2NTSA 4LDTB 2QJLA 5IN7A 2BBCA 4F7ZA 1R4MI 4IM2A 2KX3A 3NZUA 1C4CA 4DXAB 3AEGB 4HCPB 2AWTA 3L17A 2JQRB 2XBBC 1D5XC 3TMPB 2HJ8A 4BAXA 1WMHB 1XEEA 2NBUA 2K3UA 3ZXRA 4AQ7A 5EDSA 1WH3A 3MC8A 3NOBA 2L0FA 5BYSA 3APFA 4HPMB 3DHGC 4IC7B 1Q0WB 4AUQC 2MJEA 3N3KB 2REXA 1Z2MA 3EUB2 4WQOB 3AEFB 3X23A 4YSXB 2VZKB 2N9KA 3I9V1 5G55A 4CYEA 5BMGA 1YNTE 4HPPA 4LJPB 4KIKB 4A3PA 5HFYA 1R4NB 4DHZE 1WJUA 3PZDA 3EA6A 4W9DA 1UZXB 5IA7A 4OVVA 1UELA 3H7PA 2GBKA 3VR8B 2M56B 1FXTB 2L7RA 2XEWA 4TV3A 4FHJA 2KX0A 4YSZB 2WDRB 2A5UA 4GMVA 1LO5D 2LI5A 4URKA 2NPTB 3U4EG 2D3GA 4C00A 1L7YA 3RFZB 1MG8A 1E8YA 3UGBB 1TS3A 1I42A 4XYCA 5LXHA 2KMCA 4WURA 5CHFA 3DVGX 2KWDA 4EOYA 2LMCA 3QCAA 4S0RA 3SU8X 4EKUA 2IGHA 1V1PA 3ZTDA 4BKSA 3ZNGC 4ZRPA 2BB5A 3GE8C 2YVCA 3Q14C 4XDCA 4K7WA 3DVNU 4HJKA 4OW0A 2MEKA 2BKFA 1I4HA 4PS7A 1RFAA 2IGGA 2KXJA 1RM6C 3VQIA 4I6PA 4TSSA 2DYMA 2WP9B 5G5HA 5DPWA 4FN2A 2ZW0A 3UQAA 1IUEA 2NR2A 2GB1A 2O2VA 4BBNC 2MX2A 1TIFA 4MT5A 3KWVA 4DHJB 1KM7A 4IM0A 4XDDA 1TBEA 4H2AA 2PLPA 3RT3B 2WDVB 1WYWB 4B95A 4ZRIA 3MFGA 3T9LA 3LYYA 1IGCA 4KGRA 2LHEA 3ZTCA 2I2YA 2IO0B 3RNCC 1ZOYB 3IT6B 1PGXA 3GE3C 1I4GA 3OG5A 1QQRA 2L8JA 4GLSC 3PTFC 4HEA1 2Q5WD 2DZMA 1YMHE 2OHFA 4FLHA 4IM3A 1UWXA 2WU2B 3QIJA 2JX5A 3VHTC 2V9HA 1EF5A 2M17A 1S1QB 3A9JA 1TS2A 1FIQA 4HWIB 3WAMA 5CHWA 4RGNA 1UGJA 2DHZA 4IUMB 2DZIA 3AH7A 2GLSA 1MHXA 1N6ZA 4AJWA 1V1OA 2JYTA 2G4DB 2X38A 3V6EB 2INPE 2UYZB 3HVDA 1C9FA 3RI7C 3MJWA 1TKEA 4DDGD 4NJ6A 4WAFA 3ZKJC 3C19A 3QHTA 2WX0A 2RDGA 1NBFC 2FCMA 2ICIA 3AE1B 4GDLA 3VR9B 1CZPA 2Z8LA 3NZ3A 1BUIC 1WGHA 1UBQA 1AARA 4W9IA 2K8CA 4KV2A 1C4AA 2KC2A 4ZYSA 3TEZA 3K9PB 3ZJVA 2LGIA 2K0PA 2PMVA 1OQRA 4ZOHC 2J0JA 3Q8FA 3M95A 2KDIA 2V0GA 3BVMA 2EMTA 3VRAB 2AL6A 3PZ8A 3H7PB 2WX1A 1N5XA 3UINB 1WZ3A 1GB1A 2OEDA 3RCZA 3SFEB 4GDKA 2L1AA 2BW2A 1KRHA 4I6LB 3MTNB 3ZRFA 2O6VB 5BMIA 5J18A 1X1MA 1WX9A 2N9XA 3N1XC 4MELA 4KSLC 2FNJB 2ZVNA 4MGKE 2Z0DB 1VZ7A 1AN8A 3S2AA 4Q2JA 1RRBA 3A1QB 2PJHA 1V1PB 2MWSB 1MI0A 3KUCB 1C4PA 3JYUA 2GI9A 4MSMB 3H8HA 1FRRA 4W9CA 4HVBA 1P1AA 5H92C 5IOIA 2WXPA 4PS3A 3PGEA 3W9CB 1ET6A 2Y3AA 3PLUA 3U52E 1EF1A 1TS5A 4G50A 1FFVA 1V5OA 2LVQA 1UD7A 4EZLA 4JQWC 1CMXB 2JZPA 1RAXA 2WXHA 1GUAB 2WWZA 4USAA 2LVOA 4NJ7A 3CF6E 3Q69A 3W5VB 1NYRA 1YQ3B 4HKQA 1YX6B 5IAAC 5D94A 4HDOA 1L4DB 4P16A 5J17A 2INCC 3P42A 1NYQA 1ZPSA 4EE2A 2O2VB 4EUTA 2JF5A 2D07B 2JZZA 2TSSA 1YIWA 4BFRA 5C23A 5AEKB 1ZXIA 3KYCD 2JUOA 4MSQB 2C60A 2KC1A 2LUEA 1F77A 3VVWB 2LFIA 4ICUA 5JHBA 3AMZA 2SAKA 4ZRQA 1HTOA 3IAM1 3MC9A 3IHPC 1MG4A 3P63A 1E7UA 3NY5A 3Q3NC 3AEBB 3NS8A 1ROEA 2IO3B 2WYQA 3L16A 2D5GA 3HRDD 4XWTA 2GBJA 3CSTA 4LNFA 3VH3B 4LNNA 2BGFA 1N62A 1TY0A 1IPGA 3Q8AA 2WXNA 4QAYA 4K81A 4OVZA 4KKJA 2M19A 1TKYA 2ASQA 4C4VA 2W54A 4ARIA 2LRUA 4B0MA 2KT7A 5FKAC 1WE6A 3BK2A 1QT9A 2G3QB 4KSKC 1DGJA 1N63A 2RDHA 1H4RA 3DWGC 2LGXA 4FJZA 3Q3OC 4JWUC 4W9KA 2LXCA 3JSVB 3K9OB 1P98A 1J7BA 4A20A 4TMAB 4WIPA 1KH0A 4CHKA 4GN1A 4WJNA 2JT4B 1TZ1A 2H88B 1JWAD 1OFFA 2V4IB 4YTPB 1SIJA 1WGYA 1ZW7A 2KD0A 3TIXA 1OEYJ 3H6NA 5JHAA 3VDZA 4A8XC 3ABVB 4FADA 4ITKA 1VZ6A 4KX6B 1V8CA 4DHJD 4TQ0A 3B9JA 1KJTA 3V6CB 2J4XA 3MHZA 1GC7A 4YTNB 1FD6A 2LGYA 3KW5B 1L4ZB 1XLNA 1JWSD 1ZKHA 2EMSA 2BYVE 2WXLA 3B2GA 2IZVB 1MFWA 4WJOA 3VUWA 1J8CA 3LXFA 3TBLD 2D3AA 2MQJA 3SD5A 1JALA 5DPSA 1N60A 3DBLI 3X0WA 4G0NB 1QOAA 2JRIB 3PS6A 4MH0E 4ANVA 2M4NA 1KLUD 3PRPB 2K1FA 3R2TA 4MDKE 1OTRB 4ASWC 3VTWA 1PGBA 2BS3B 3WALA 1ENFA 1HZ6A 1YN5A 4NAWA 2IPKD 2IYDB 2N7DA 2QIEB 2EELA 4M8MA 3T8MA 2L3ZA 1WJ6A 3KUZA 3HK0A 3L13A 2V3SA 3DBLB 3AEEB 3MP9A 3U7ZA 3N32A 1YQBA 3RYTA 2Z0EB 4TUUA 4WWPA 2ZW1A 2LVPA 3WCQA 3BVZA 2PEAA 4YL8A 2KO3A 2FBWB 4J3OD 3P4QB 4I6NB 4E3CA 1UGMA 5C1ZA 1JQ4A 1JWMD 3R7QA 1V9JA 1BXTA 3GP7A 3AM9A 1TS4A 1SJED 3R66C 3PVLA 1DOYA 1XCQL 2W9NA 3RNAC 2KWCA 1R4NI 1WM2A 4HK2A 5BYQA 4HXDA 2BWFA 2FIFA 4LCDE 2INDC 4DDID 2MBQA 1DYQA 3A4SC 2O6VD 1FNWA 1J19A 3I3TB 3AE3B 1VLBA 1T5XD 1FMAD 3TJPA 3WA0A 3EFUA 2N7EA 4KGTA 3GB1A 5LLIA 1FO4A 4C4VB 3EC8A 4OZBA 3QARA 1H8CA 4KGSA 1ISNA 1TY2A 4M01A 1MPEA 2QCZA 3SEBA 4KDLB 4N58A 3NVWA 1WJNA 2KAJA 5T8IA 1T0YA 2K22A 1XF5L 2YEPF 3RMKC 5EE9A 3U2SC 3ECIA 5GMVA 5LXIB 2Z59B 4GSWA 2KACA 3VRBB 1E10A 2MP2B 3B0AA 2G45B 3LJ3A 2IO1B 1KF6B 2FCSA 4C80A 3UQBA 1HQRD 1EM7A 1IBXB 2SEBD 3W1SC 2C5LC 3U30A 2KQSA 4O1NA 1AYFA 4HCNB 2W3SA 1VDVA 1A70A 4PYUA 4BBNF 2WXRA 3RNFC 2BYFA 1LM8B 1EWCA 2DZKA 3N1YC 2MH7A 1F1HA 2MBEA 3PRMB 3QC8B 3OJ3A 1F0ZA 4OVUA 3AXCA 2WXJA 3EFCA 2CHZA 3W5UB 3KLSX 1BT0A 2E3TA 4KDIC 3SHQA 2QSDA 1QILA 4PYZA 3W2DA 3P4PB 2KVRA 3RUIB 1D6EC 1WIAA 2WDTB 3IXSA 3QWZB 2D3BA 3AU4A 3B1LX 2CU3A 4KZCA 1WXQA 2KFKB 2JY6A 1C1YB 5D3DA 3RZWC 2NTTA 4GU2A 1CQVA 4GB9A 5E6OA 4FBJB 5G5GA 2KLCA 2FCQA 3RNBC 3SFDB 4HJGE 3V61A 2D11A 2DLBA 3LB8C 2E6XA 3AE5B 3KH0A 1K52A 2AQ3B 1SGHA 4W9LA 3WANA 4UDUC 3H9DA 1PUTA 4EEWA 4XGAB 2MBHA 2B76B 4RCOA 4JPSA 5I4DA 1E0ZA 2L05A 1B9RA 1FEHA 4P7IA 3V05A 1OQQA 1ZE3D 4ACFA 2K9XA 3OWEB 4ZDVA 2K5PA 2ZNVC 1VD2A 2C7NB 3QQ8B 2ZPYA 4G11A 3BZDB 3FILA 1T3QA 2XK5B 4RNAA 5AUKA 2LJ5A 4A9AA 3Q3MC 2N4FA 4US9A 4ZRJA 5L95C 1MVKA 3KQ4A 4FULA 3ML9A 5FR6A 2JU6X 3SDLC 3ZVVA 3U7DA 4RF1A 1WFYA 2QILA 1GPXA 3IFWB 3TEYA 1P3QU 2JWUA 2QHOA 2N9LA 3PRZA 5KHQA 1MHHE
chains in the Genus database with same CATH topology
2KFKA 4EZKA 1KLVA 3IHPC 5DPRA 1E7UA 1UBIA 1WX8A 3NY5A 2DAJA 3NS8A 2IO3B 4F1SA 4IWPA 3QA8A 4KZ0A 2WYQA 4BVUC 3L16A 2ZCBA 2GBJA 3A1QA 2GOWA 3CSTA 5D7GA 1F9JA 5J2RA 3M63B 4GXBA 3R7RA 2KHWB 3VH3B 2BGFA 3ZDMC 4EFOA 1Y8RC 1IPGA 5JZEB 3W1SA 2NS5A 2LD9A 2DAFA 4MGZE 4B6WA 2L00B 3C0RB 2ZZPB 3VAWA 1RLFA 5BO4B 4K81A 4WWNA 4TQ1A 2ASQA 3VUXA 3A33B 3DOWA 2OOBB 2DENB 3H1UA 4A3OA 1IP9A 2KTRB 2ZNVB 1LXDA 2I1JA 3A9KB 2LRUA 2NCNA 4JGHB 3VTVA 2JWZA 2DYBA 2MA9B 2ZPNA 1WE6A 3WIMA 4HPLB 3M62B 1KOTA 3VXWA 2G3QB 4KSKC 3L10B 2RPQA 4X57B 4XZ4A 2GBMA 5KHOA 5TR5A 2BF8B 1H4RA 1WRDB 2HE7A 3ZLZA 1C3TA 1HE8A 4ZYNA 2RSUA 1E8XA 2MLBA 2LXAA 4TKNA 5AZHA 4BOSC 2KMAA 2LGXA 4FJZA 4DHZB 4W9KA 2LXCA 2XK5A 4LDTB 1GNUA 3JSVB 2JRHA 1D3ZA 3K9OB 2K25A 1R4MI 4F7ZA 4IM2A 1P98A 3B08A 2KX3A 4A20A 3NZUA 3BY4B 3IBEA 1OGWA 2KLGA 3DVNV 4II2B 3TCAA 3VUYA 3IG3A 4WAAA 4DXAB 4HCPB 1E5WA 2AWTA 3DPDA 3L17A 2XBBC 3TMPB 4CHKA 4NQKE 1WXMA 2HJ8A 1XD3B 2JT4B 4GN1A 2KN5A 1TZ1A 4WJNA 4NAWB 1WMHB 2L76A 4RM8A 1VCBA 2FAZA 2NBUA 4MGYE 1WM3A 1WGYA 1ZW7A 5EDSA 1WF9A 2CHXA 2KD0A 3TIXA 1OEYJ 3ZUNA 2CHWA 1WH3A 3H6NA 5AZGA 5JHAA 3CMMB 3HM6X 3NOBA 2KDEB 3VDZA 2L0FA 3APFA 1GC6A 1IYFA 4HPMB 1SE9A 4FADA 3ENEA 3IVFA 4IC7B 1Q0WB 3O65B 5AZFA 4DHJD 4AUQC 1XT9B 3N3KB 2REXA 2AL3A 1Z2MA 4WQOB 2ZJDA 3DQVA 4M8NA 3UIOB 3X23A 1V80A 3NZSA 4TQ0A 3PV1A 5G55A 4WJQA 2CR5A 1KJTA 3V6CB 3V62A 3WAOA 2BKRB 3Q3FA 4CYEA 2N9EB 4MJSB 1GC7A 4LJPB 2LGYA 3N30A 2B3AA 4KIKB 1LQBA 3KW5B 4A3PA 4DHZE 1WJUA 3PZDA 1ZKHA 4AOFA 1EO6A 2K39A 2EMSA 4W9DA 2KANA 3KVFB 2LASA 2KNBA 1UZXB 4NNJB 4OVVA 1UELA 2BYVE 5IA7A 3A9KA 3H7PA 2IY0B 2GBKA 2ZVOA 2IZVB 3PT2B 4WJOA 3VUWA 1J8CA 2JPHA 4W9GA 1FXTB 2L7RA 1UH6A 3TBLD 2XEWA 2MQJA 4TV3A 3SD5A 2PE9A 2KX0A 4FHJA 4AWJA 4BKGA 1J0GA 2A5UA 1M94A 2KJHB 4GMVA 3ZNID 1E8WA 5HKHA 5DPSA 2LI5A 2LZ6A 3DBLI 4FJYA 2NPTB 3X0WA 2D3GA 4URKA 4G0NB 5E6NA 2JRIB 2ZEQA 1L7YA 1MG8A 1ZGUB 1E8YA 3PS6A 3JSVA 3EECA 4MH0E 4MEMA 4MM3A 2LWPA 4RMAA 3UGBB 2M4NA 4ANVA 1OQYA 1I42A 5LXHA 4ZRKA 3UF8A 2KMCA 5CHFA 3DVGX 3PRPB 2K1FA 3JVZX 4EOYA 2CKHB 3QCAA 4GOCA 2IY1B 4MDKE 3SU8X 1OTRB 4EKUA 3DCGA 4W9JA 4ASWC 3VTWA 1E90A 3WALA 2RGFA 3ZTDA 4BKSA 4NAWA 1WMHA 3ZNGC 3UIPB 2IYDB 2N7DA 5DPTA 2YVCA 4M8MA 1YX5B 2HD5B 3T8MA 1WE7A 4JIOU 4K7WA 2L3ZA 1WJ6A 3DVNU 3A9JB 3KUZA 4HJKA 3HK0A 3L13A 1V86A 2BKFA 2V3SA 2C9WB 3AULA 1V81A 3N32A 4XC2A 2N1VA 1YQBA 3RYTA 1WXSA 2Z0EB 4PS7A 1RFAA 4TUUA 4WWPA 3KUDB 4J6IA 3ONSA 4WWOA 2KXJA 3WAPA 2LVPA 3VQIA 4I6PA 1E8ZA 2PEAA 4YL8A 4GGQA 4W9EA 4W9FA 2KO3A 4ICVA 2DYMA 1Q5WB 4FJVB 4I6NB 5DPWA 5G2NA 4FN2A 4E3CA 1UGMA 5C1ZA 4KIKA 1WZ0A 3R7QA 1V9JA 3UQAA 4E71A 5CTRC 3ZW3A 2NR2A 3RULA 2M0XA 1E7VA 2KDBA 3CSFA 2O2VA 2J0KA 4AJYB 4NQLB 3R66C 2AYOB 1V5TA 4IG7B 1SIFA 3D32A 2BPSA 2KWUB 4CO7A 1TTNA 1Z5SB 3PVLA 2MX2A 4BBNC 2W9NA 2VRRB 4DHJB 1KM7A 4PS8A 2KOXA 4IM0A 4BKTA 4GDLB 2PPHA 3LDZE 1TBEA 2KWCA 1WGDA 1R4NI 3RT3B 4M0WB 4G3XB 3PHWB 1WM2A 2DX5B 1WYWB 1TGZB 4HK2A 4HXDA 2BWFA 2FIFA 4LCDE 4B95A 4ZRIA 2PE6B 1V2YA 2NPTA 3VFKA 4DDID 2MBQA 3T9LA 2IO2B 1WY8A 3JW0X 4N9F4 4DK5A 3ZTCA 2KWVB 3A4SC 2DYOA 2O6VD 2IO0B 1J19A 1OEYA 3I3TB 3ZO5B 3TJPA 3WA0A 4LDTD 3EFUA 2L8JA 2KJ6A 2N7EA 3PTFC 5LLIA 3APCA 3VH4B 2DZMA 3M3JA 3ML8A 2KTFA 2C7HA 4FLHA 4IM3A 3EC8A 3QARA 1H8CA 3QIJA 4K1RB 3VHTC 3APDA 1ISNA 2GBNA 3ZRCA 1EF5A 2RD0A 2M17A 1S1QB 2KKCA 1EUVB 3A9JA 2KTRA 4GDKB 2NVUI 4XX5A 4DWFA 4HWIB 3WAMA 5CHWA 2FIDA 3OAWA 2C7MB 3L08A 3HHMA 2DHZA 4IUMB 3AU5A 2JXXA 2DZIA 4GIVA 3Q3JA 1GJZA 4KDLB 1WJ4A 1WJNA 3GZNI 2KZRA 4AJWA 3P2BA 1T0YA 2N1WA 3VTUA 3PREA 4JLCA 2G4DB 2A4ZA 2V4LA 3QK0A 3V6EB 4LJOB 2Y5BB 3ECIA 5GMVA 2UYZB 5LXIB 2KDFB 3DBRI 2Z59B 3MJWA 3GOEA 4IWQA 4GSWA 4DDGD 1I35A 2MP2B 2KFJA 3B0AA 5JH5C 2NBVB 2R2OA 3OLMD 4NJ6A 3U8ZA 2I1KA 3ZKJC 3QHTA 5D6JB 1P0RA 2G45B 2WX0A 1WGRA 2GBRA 1NBFC 1WXVA 3LJ3A 2KQ7A 3NHEB 2JZ3B 2IO1B 2FCSA 2FCMA 3UQBA 3HM3A 2KK8A 4WJPA 4GDLA 3W1SC 3BINA 2C5LC 3U30A 1QZEA 2KQSA 1K8RB 3W1YA 2BWES 1WGHA 3ALBA 4F8CB 1UBQA 1AARA 2CU1A 4HCNB 4W9IA 2DZJA 2K8CA 4KV2A 5CHVC 4PYUA 4BBNF 2KC2A 5D2MB 4B9KA 2K8BA 2V1YA 2BYFA 1LM8B 3K9PB 3ZNHB 4DBGA 3QAQA 2DZKA 3KYDD 3PLVA 2OJRA 2LGDA 3EHVA 2MBEA 3PRMB 1NI2A 2J0JA 3QC8B 1L2NA 3M95A 2KDIA 3OJ3A 1PQSA 5CX3A 4OVUA 2K8HA 3AXCA 2EMTA 2LRWA 3L0WB 2AL6A 1YD8U 2CHZA 2MW5A 4MJSA 3RD2A 4E74A 3H7PB 2WX1A 4NPNA 2FUHB 1BT0A 2J7QB 2BYEA 3UINB 1WZ3A 1GG3A 4KDIC 3SHQA 4FA6A 3HIZA 4PYZA 3DBHI 3RCZA 2KVRA 4GDKA 2D2QA 3RUIB 3PSEB 3DDCB 1WIAA 4I6LB 2WDTB 4AP4C 1WR1A 3MTNB 3ZRFA 3QWZB 2O6VB 1V49A 3AI5A 3AU4A 3B1LX 1WX7A 4ANXA 3DVGY 4IWOA 1S3SG 4KZCA 5J18A 2KFKB 1X1MA 1WX9A 3H7SA 2JY6A 2N9XA 4IW0A 4HLEA 2MCNB 2R2QA 3TL5A 3L54A 4MELA 1C1YB 2FNJB 3QJZA 4KSLC 2JVCA 2ZVNA 4MGKE 3RZWC 2Z0DB 2HTHA 4GU2A 4GB9A 4BOZB 3S2AA 5E6OA 4JL9A 2M8SA 1NDDA 4K7UA 1RRBA 4FBJB 2KJRA 1V6EA 4W9HA 3A1QB 2KLCA 2FCQA 4ANUA 3PHXB 2MP2A 2NBWB 1U4AA 2PJHA 4MGIE 2EKEC 3MHSD 2MWSB 3KUCB 3V61A 3JYUA 3A4RA 4ANWA 4MSMB 2D11A 3KH0A 4FHKA 4W9LA 1SGHA 4W9CA 3WANA 4HVBA 1P1AA 3V60A 1XQQA 4PS3A 2MBBB 3H9DA 3PGEA 4EEWA 1P9DU 2GMIC 3QX1A 4II3B 4RM9A 2MBHA 1YJ1A 2UWQA 2IBIB 2AEHA 3PPAA 3PLUA 2L05A 1EF1A 4KVGB 4NY0A 4P7IA 4BKSD 2MBOA 4G50A 1V5OA 2LVQA 4HDQA 1UD7A 4EZLA 3ZIMA 2MRPA 3DBSA 4ZDVA 2ZNVC 1VD2A 1CMXB 4JQWC 3R3MA 4EZJA 1RAXA 2C7NB 1GUAB 2N9PC 2WWZA 2ZPYA 3QQ8B 1WI0A 1WXAA 2LVOA 4G11A 3CF6E 4NJ7A 5L83A 2K6QA 2D10A 2XK5B 2LJ5A 1YX6B 3OJ4B 4K7SA 5D94A 4HDOA 1WR6E 2N4FA 1Q1OA 5IAAC 3ZDTA 3RZFA 5E6PA 1A5RA 5J17A 5DCNA 1G6JA 2K6DB 4ZRJA 2O2VB 5L95C 1WGGA 4EUTA 2J0MA 4FULA 3ML9A 2JF5A 1LFDA 2D07B 2FCNA 1YIWA 2JZZA 4BFRA 5FR6A 5C23A 3SDLC 3ZVVA 5AEKB 1JRUA 2YLMA 3KYCD 3U7DA 2JUOA 1WFYA 2L0TA 4MSQB 2C60A 2KC1A 2G4SA 2LUEA 2M1MA 2MSED 2RR9A 3IFWB 3VVWB 2CS4A 4ICUA 2O6VA 2ZCCA 3ZNZB 1P3QU 2QHOA 3PRZA 5JHBA 5KHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KFK A;  4EZK A;  1KLV A;  3IHP C;  5DPR A;  1E7U A;  1UBI A;  1WX8 A;  3NY5 A;  2DAJ A;  3NS8 A;  2IO3 B;  4F1S A;  4IWP A;  3QA8 A;  4KZ0 A;  2WYQ A;  4BVU C;  3L16 A;  2ZCB A;  2GBJ A;  3A1Q A;  2GOW A;  3CST A;  5D7G A;  1F9J A;  5J2R A;  3M63 B;  4GXB A;  3R7R A;  2KHW B;  3VH3 B;  2BGF A;  3ZDM C;  4EFO A;  1Y8R C;  1IPG A;  5JZE B;  3W1S A;  2NS5 A;  2LD9 A;  2DAF A;  4MGZ E;  4B6W A;  2L00 B;  3C0R B;  2ZZP B;  3VAW A;  1RLF A;  5BO4 B;  4K81 A;  4WWN A;  4TQ1 A;  2ASQ A;  3VUX A;  3A33 B;  3DOW A;  2OOB B;  2DEN B;  3H1U A;  4A3O A;  1IP9 A;  2KTR B;  2ZNV B;  1LXD A;  2I1J A;  3A9K B;  2LRU A;  2NCN A;  4JGH B;  3VTV A;  2JWZ A;  2DYB A;  2MA9 B;  2ZPN A;  1WE6 A;  3WIM A;  4HPL B;  3M62 B;  1KOT A;  3VXW A;  2G3Q B;  4KSK C;  3L10 B;  2RPQ A;  4X57 B;  4XZ4 A;  2GBM A;  5KHO A;  5TR5 A;  2BF8 B;  1H4R A;  1WRD B;  2HE7 A;  3ZLZ A;  1C3T A;  1HE8 A;  4ZYN A;  2RSU A;  1E8X A;  2MLB A;  2LXA A;  4TKN A;  5AZH A;  4BOS C;  2KMA A;  2LGX A;  4FJZ A;  4DHZ B;  4W9K A;  2LXC A;  2XK5 A;  4LDT B;  1GNU A;  3JSV B;  2JRH A;  1D3Z A;  3K9O B;  2K25 A;  1R4M I;  4F7Z A;  4IM2 A;  1P98 A;  3B08 A;  2KX3 A;  4A20 A;  3NZU A;  3BY4 B;  3IBE A;  1OGW A;  2KLG A;  3DVN V;  4II2 B;  3TCA A;  3VUY A;  3IG3 A;  4WAA A;  4DXA B;  4HCP B;  1E5W A;  2AWT A;  3DPD A;  3L17 A;  2XBB C;  3TMP B;  4CHK A;  4NQK E;  1WXM A;  2HJ8 A;  1XD3 B;  2JT4 B;  4GN1 A;  2KN5 A;  1TZ1 A;  4WJN A;  4NAW B;  1WMH B;  2L76 A;  4RM8 A;  1VCB A;  2FAZ A;  2NBU A;  4MGY E;  1WM3 A;  1WGY A;  1ZW7 A;  5EDS A;  1WF9 A;  2CHX A;  2KD0 A;  3TIX A;  1OEY J;  3ZUN A;  2CHW A;  1WH3 A;  3H6N A;  5AZG A;  5JHA A;  3CMM B;  3HM6 X;  3NOB A;  2KDE B;  3VDZ A;  2L0F A;  3APF A;  1GC6 A;  1IYF A;  4HPM B;  1SE9 A;  4FAD A;  3ENE A;  3IVF A;  4IC7 B;  1Q0W B;  3O65 B;  5AZF A;  4DHJ D;  4AUQ C;  1XT9 B;  3N3K B;  2REX A;  2AL3 A;  1Z2M A;  4WQO B;  2ZJD A;  3DQV A;  4M8N A;  3UIO B;  3X23 A;  1V80 A;  3NZS A;  4TQ0 A;  3PV1 A;  5G55 A;  4WJQ A;  2CR5 A;  1KJT A;  3V6C B;  3V62 A;  3WAO A;  2BKR B;  3Q3F A;  4CYE A;  2N9E B;  4MJS B;  1GC7 A;  4LJP B;  2LGY A;  3N30 A;  2B3A A;  4KIK B;  1LQB A;  3KW5 B;  4A3P A;  4DHZ E;  1WJU A;  3PZD A;  1ZKH A;  4AOF A;  1EO6 A;  2K39 A;  2EMS A;  4W9D A;  2KAN A;  3KVF B;  2LAS A;  2KNB A;  1UZX B;  4NNJ B;  4OVV A;  1UEL A;  2BYV E;  5IA7 A;  3A9K A;  3H7P A;  2IY0 B;  2GBK A;  2ZVO A;  2IZV B;  3PT2 B;  4WJO A;  3VUW A;  1J8C A;  2JPH A;  4W9G A;  1FXT B;  2L7R A;  1UH6 A;  3TBL D;  2XEW A;  2MQJ A;  4TV3 A;  3SD5 A;  2PE9 A;  2KX0 A;  4FHJ A;  4AWJ A;  4BKG A;  1J0G A;  2A5U A;  1M94 A;  2KJH B;  4GMV A;  3ZNI D;  1E8W A;  5HKH A;  5DPS A;  2LI5 A;  2LZ6 A;  3DBL I;  4FJY A;  2NPT B;  3X0W A;  2D3G A;  4URK A;  4G0N B;  5E6N A;  2JRI B;  2ZEQ A;  1L7Y A;  1MG8 A;  1ZGU B;  1E8Y A;  3PS6 A;  3JSV A;  3EEC A;  4MH0 E;  4MEM A;  4MM3 A;  2LWP A;  4RMA A;  3UGB B;  2M4N A;  4ANV A;  1OQY A;  1I42 A;  5LXH A;  4ZRK A;  3UF8 A;  2KMC A;  5CHF A;  3DVG X;  3PRP B;  2K1F A;  3JVZ X;  4EOY A;  2CKH B;  3QCA A;  4GOC A;  2IY1 B;  4MDK E;  3SU8 X;  1OTR B;  4EKU A;  3DCG A;  4W9J A;  4ASW C;  3VTW A;  1E90 A;  3WAL A;  2RGF A;  3ZTD A;  4BKS A;  4NAW A;  1WMH A;  3ZNG C;  3UIP B;  2IYD B;  2N7D A;  5DPT A;  2YVC A;  4M8M A;  1YX5 B;  2HD5 B;  3T8M A;  1WE7 A;  4JIO U;  4K7W A;  2L3Z A;  1WJ6 A;  3DVN U;  3A9J B;  3KUZ A;  4HJK A;  3HK0 A;  3L13 A;  1V86 A;  2BKF A;  2V3S A;  2C9W B;  3AUL A;  1V81 A;  3N32 A;  4XC2 A;  2N1V A;  1YQB A;  3RYT A;  1WXS A;  2Z0E B;  4PS7 A;  1RFA A;  4TUU A;  4WWP A;  3KUD B;  4J6I A;  3ONS A;  4WWO A;  2KXJ A;  3WAP A;  2LVP A;  3VQI A;  4I6P A;  1E8Z A;  2PEA A;  4YL8 A;  4GGQ A;  4W9E A;  4W9F A;  2KO3 A;  4ICV A;  2DYM A;  1Q5W B;  4FJV B;  4I6N B;  5DPW A;  5G2N A;  4FN2 A;  4E3C A;  1UGM A;  5C1Z A;  4KIK A;  1WZ0 A;  3R7Q A;  1V9J A;  3UQA A;  4E71 A;  5CTR C;  3ZW3 A;  2NR2 A;  3RUL A;  2M0X A;  1E7V A;  2KDB A;  3CSF A;  2O2V A;  2J0K A;  4AJY B;  4NQL B;  3R66 C;  2AYO B;  1V5T A;  4IG7 B;  1SIF A;  3D32 A;  2BPS A;  2KWU B;  4CO7 A;  1TTN A;  1Z5S B;  3PVL A;  2MX2 A;  4BBN C;  2W9N A;  2VRR B;  4DHJ B;  1KM7 A;  4PS8 A;  2KOX A;  4IM0 A;  4BKT A;  4GDL B;  2PPH A;  3LDZ E;  1TBE A;  2KWC A;  1WGD A;  1R4N I;  3RT3 B;  4M0W B;  4G3X B;  3PHW B;  1WM2 A;  2DX5 B;  1WYW B;  1TGZ B;  4HK2 A;  4HXD A;  2BWF A;  2FIF A;  4LCD E;  4B95 A;  4ZRI A;  2PE6 B;  1V2Y A;  2NPT A;  3VFK A;  4DDI D;  2MBQ A;  3T9L A;  2IO2 B;  1WY8 A;  3JW0 X;  4N9F 4;  4DK5 A;  3ZTC A;  2KWV B;  3A4S C;  2DYO A;  2O6V D;  2IO0 B;  1J19 A;  1OEY A;  3I3T B;  3ZO5 B;  3TJP A;  3WA0 A;  4LDT D;  3EFU A;  2L8J A;  2KJ6 A;  2N7E A;  3PTF C;  5LLI A;  3APC A;  3VH4 B;  2DZM A;  3M3J A;  3ML8 A;  2KTF A;  2C7H A;  4FLH A;  4IM3 A;  3EC8 A;  3QAR A;  1H8C A;  3QIJ A;  4K1R B;  3VHT C;  3APD A;  1ISN A;  2GBN A;  3ZRC A;  1EF5 A;  2RD0 A;  2M17 A;  1S1Q B;  2KKC A;  1EUV B;  3A9J A;  2KTR A;  4GDK B;  2NVU I;  4XX5 A;  4DWF A;  4HWI B;  3WAM A;  5CHW A;  2FID A;  3OAW A;  2C7M B;  3L08 A;  3HHM A;  2DHZ A;  4IUM B;  3AU5 A;  2JXX A;  2DZI A;  4GIV A;  3Q3J A;  1GJZ A;  4KDL B;  1WJ4 A;  1WJN A;  3GZN I;  2KZR A;  4AJW A;  3P2B A;  1T0Y A;  2N1W A;  3VTU A;  3PRE A;  4JLC A;  2G4D B;  2A4Z A;  2V4L A;  3QK0 A;  3V6E B;  4LJO B;  2Y5B B;  3ECI A;  5GMV A;  2UYZ B;  5LXI B;  2KDF B;  3DBR I;  2Z59 B;  3MJW A;  3GOE A;  4IWQ A;  4GSW A;  4DDG D;  1I35 A;  2MP2 B;  2KFJ A;  3B0A A;  5JH5 C;  2NBV B;  2R2O A;  3OLM D;  4NJ6 A;  3U8Z A;  2I1K A;  3ZKJ C;  3QHT A;  5D6J B;  1P0R A;  2G45 B;  2WX0 A;  1WGR A;  2GBR A;  1NBF C;  1WXV A;  3LJ3 A;  2KQ7 A;  3NHE B;  2JZ3 B;  2IO1 B;  2FCS A;  2FCM A;  3UQB A;  3HM3 A;  2KK8 A;  4WJP A;  4GDL A;  3W1S C;  3BIN A;  2C5L C;  3U30 A;  1QZE A;  2KQS A;  1K8R B;  3W1Y A;  2BWE S;  1WGH A;  3ALB A;  4F8C B;  1UBQ A;  1AAR A;  2CU1 A;  4HCN B;  4W9I A;  2DZJ A;  2K8C A;  4KV2 A;  5CHV C;  4PYU A;  4BBN F;  2KC2 A;  5D2M B;  4B9K A;  2K8B A;  2V1Y A;  2BYF A;  1LM8 B;  3K9P B;  3ZNH B;  4DBG A;  3QAQ A;  2DZK A;  3KYD D;  3PLV A;  2OJR A;  2LGD A;  3EHV A;  2MBE A;  3PRM B;  1NI2 A;  2J0J A;  3QC8 B;  1L2N A;  3M95 A;  2KDI A;  3OJ3 A;  1PQS A;  5CX3 A;  4OVU A;  2K8H A;  3AXC A;  2EMT A;  2LRW A;  3L0W B;  2AL6 A;  1YD8 U;  2CHZ A;  2MW5 A;  4MJS A;  3RD2 A;  4E74 A;  3H7P B;  2WX1 A;  4NPN A;  2FUH B;  1BT0 A;  2J7Q B;  2BYE A;  3UIN B;  1WZ3 A;  1GG3 A;  4KDI C;  3SHQ A;  4FA6 A;  3HIZ A;  4PYZ A;  3DBH I;  3RCZ A;  2KVR A;  4GDK A;  2D2Q A;  3RUI B;  3PSE B;  3DDC B;  1WIA A;  4I6L B;  2WDT B;  4AP4 C;  1WR1 A;  3MTN B;  3ZRF A;  3QWZ B;  2O6V B;  1V49 A;  3AI5 A;  3AU4 A;  3B1L X;  1WX7 A;  4ANX A;  3DVG Y;  4IWO A;  1S3S G;  4KZC A;  5J18 A;  2KFK B;  1X1M A;  1WX9 A;  3H7S A;  2JY6 A;  2N9X A;  4IW0 A;  4HLE A;  2MCN B;  2R2Q A;  3TL5 A;  3L54 A;  4MEL A;  1C1Y B;  2FNJ B;  3QJZ A;  4KSL C;  2JVC A;  2ZVN A;  4MGK E;  3RZW C;  2Z0D B;  2HTH A;  4GU2 A;  4GB9 A;  4BOZ B;  3S2A A;  5E6O A;  4JL9 A;  2M8S A;  1NDD A;  4K7U A;  1RRB A;  4FBJ B;  2KJR A;  1V6E A;  4W9H A;  3A1Q B;  2KLC A;  2FCQ A;  4ANU A;  3PHX B;  2MP2 A;  2NBW B;  1U4A A;  2PJH A;  4MGI E;  2EKE C;  3MHS D;  2MWS B;  3KUC B;  3V61 A;  3JYU A;  3A4R A;  4ANW A;  4MSM B;  2D11 A;  3KH0 A;  4FHK A;  4W9L A;  1SGH A;  4W9C A;  3WAN A;  4HVB A;  1P1A A;  3V60 A;  1XQQ A;  4PS3 A;  2MBB B;  3H9D A;  3PGE A;  4EEW A;  1P9D U;  2GMI C;  3QX1 A;  4II3 B;  4RM9 A;  2MBH A;  1YJ1 A;  2UWQ A;  2IBI B;  2AEH A;  3PPA A;  3PLU A;  2L05 A;  1EF1 A;  4KVG B;  4NY0 A;  4P7I A;  4BKS D;  2MBO A;  4G50 A;  1V5O A;  2LVQ A;  4HDQ A;  1UD7 A;  4EZL A;  3ZIM A;  2MRP A;  3DBS A;  4ZDV A;  2ZNV C;  1VD2 A;  1CMX B;  4JQW C;  3R3M A;  4EZJ A;  1RAX A;  2C7N B;  1GUA B;  2N9P C;  2WWZ A;  2ZPY A;  3QQ8 B;  1WI0 A;  1WXA A;  2LVO A;  4G11 A;  3CF6 E;  4NJ7 A;  5L83 A;  2K6Q A;  2D10 A;  2XK5 B;  2LJ5 A;  1YX6 B;  3OJ4 B;  4K7S A;  5D94 A;  4HDO A;  1WR6 E;  2N4F A;  1Q1O A;  5IAA C;  3ZDT A;  3RZF A;  5E6P A;  1A5R A;  5J17 A;  5DCN A;  1G6J A;  2K6D B;  4ZRJ A;  2O2V B;  5L95 C;  1WGG A;  4EUT A;  2J0M A;  4FUL A;  3ML9 A;  2JF5 A;  1LFD A;  2D07 B;  2FCN A;  1YIW A;  2JZZ A;  4BFR A;  5FR6 A;  5C23 A;  3SDL C;  3ZVV A;  5AEK B;  1JRU A;  2YLM A;  3KYC D;  3U7D A;  2JUO A;  1WFY A;  2L0T A;  4MSQ B;  2C60 A;  2KC1 A;  2G4S A;  2LUE A;  2M1M A;  2MSE D;  2RR9 A;  3IFW B;  3VVW B;  2CS4 A;  4ICU A;  2O6V A;  2ZCC A;  3ZNZ B;  1P3Q U;  2QHO A;  3PRZ A;  5JHB A;  5KHQ A; 
#chains in the Genus database with same CATH topology
 1SXT A;  4R3D A;  1WWT A;  3AN1 A;  4M0W A;  4EZK A;  1KLV A;  2J52 A;  3HVZ A;  3AV8 A;  1GOZ A;  2DAJ A;  1ZDX A;  1XO3 A;  4F1S A;  3QA8 A;  2JYE A;  2GOW A;  5D7G A;  4GXB A;  3R7R A;  3ZYY X;  1CK1 A;  2DAF A;  2L00 B;  2ZZP B;  1L0X B;  3VAW A;  1FXI A;  4WWN A;  3DOW A;  3H1U A;  2OOB B;  2DEN B;  1IP9 A;  3AE7 B;  2ZNV B;  1LXD A;  4XE0 A;  4A55 A;  4LLG M;  1LGR A;  5HHD G;  3VTV A;  1I4R A;  2CJN A;  4HPL B;  3M62 B;  3ZJT A;  1KOT A;  3L10 B;  2RPQ A;  4XZ4 A;  2GBM A;  5TR5 A;  1WRD B;  2FE8 A;  1C3T A;  1HE8 A;  4ZYN A;  4LNO A;  3BVG A;  4K3B A;  2BQQ A;  5IP4 D;  1D3Z A;  2K25 A;  4RF0 A;  3C8Y A;  3BY4 B;  4II2 B;  3DVN V;  4HKZ E;  3TCA A;  3VUY A;  1E5W A;  4NQK E;  1WXM A;  1XD3 B;  2L76 A;  3BWU D;  1T0Q C;  1WM3 A;  3ZUN A;  2CHW A;  5AZG A;  3CMM B;  3HM6 X;  5BYR A;  2RDB C;  4MH8 A;  1IYF A;  4A90 A;  1FCC C;  1EWY C;  5AZF A;  1FNV A;  1XT9 B;  5EE1 A;  2AL3 A;  4LNI A;  1R7S A;  2ZJD A;  4M8N A;  3UIO B;  1V80 A;  3NZS A;  3PV1 A;  2QEJ C;  2J42 A;  4WJQ A;  2CR5 A;  4RGM A;  3V62 A;  2BKR B;  2N9E B;  1M4V A;  3N30 A;  2B3A A;  1EO6 A;  1PDX A;  1QOG A;  1QLB B;  3KVF B;  4NNJ B;  3A9K A;  1TKG A;  2KVZ A;  1C77 A;  2JPH A;  4W9G A;  4AWJ A;  2KJH B;  5H8Y E;  3ZNI D;  1E8W A;  2LZ6 A;  1AWD A;  5E6N A;  2ZEQ A;  1I4X A;  3AB5 A;  1ZGU B;  4RMA A;  4MM3 A;  2LWP A;  1OQY A;  5EE3 A;  1NEK B;  4ZRK A;  3UF8 A;  4FXC A;  1ZXH A;  2CKH B;  4GOC A;  3DCG A;  4W9J A;  1E90 A;  2RGF A;  4L23 A;  1WMH A;  3UIP B;  3PO0 A;  5DPT A;  1E9M A;  2CJO A;  2WHI A;  1WE7 A;  3GZN B;  3A9J B;  1V86 A;  2C9W B;  1V81 A;  4XC2 A;  1SE2 A;  2N1V A;  5D3I B;  3DBR B;  4J6I A;  4WWO A;  3TUO A;  1N61 A;  4HRO A;  4OZA A;  1XXG A;  4W9F A;  4ICV A;  1VRA B;  5TSS A;  2LGS A;  4FJV B;  5G2N A;  2WLB A;  4KIK A;  4P6V F;  1WZ0 A;  1HTQ A;  2I38 A;  5CTR C;  4RGO S;  3RUL A;  2KDB A;  3CSF A;  3ZQ4 A;  4AJY B;  4NQL B;  4IG7 B;  1SIF A;  2BPS A;  2INN E;  2KWU B;  4CO7 A;  1TTN A;  2VRR B;  3P4S B;  4PS8 A;  4BKT A;  4GDL B;  1SJH D;  2PPH A;  3URY A;  1XLO A;  3O13 A;  4JX1 C;  4G3X B;  4M0W B;  3TEX A;  3VFK A;  2NPT A;  1HEZ E;  2V3P A;  2IO2 B;  1WY8 A;  1J7A A;  4N9F 4;  4OZC A;  4REZ A;  2AQ1 B;  2DYO A;  1WGK A;  2IDY A;  3ZO5 B;  1C78 A;  2AQ2 B;  3CIR B;  2BTE A;  2KYW A;  2Y5C A;  4YXD B;  2RPV A;  3M3J A;  3ML8 A;  2KTF A;  2C7H A;  3E9S A;  1JRP A;  4K1R B;  1QOF A;  3DHI C;  3ZRC A;  2RD0 A;  2KKC A;  1EUV B;  4GDK B;  2NVU I;  3AE6 B;  2FID A;  1ET9 A;  2WGS A;  3TEW A;  4YT0 B;  1DOI A;  1GJZ A;  2LUM A;  1WJ4 A;  1D5M C;  1D5Z C;  2KZR A;  3I63 C;  2KN4 A;  3AED B;  2N1W A;  3VTU A;  1DOX A;  3PRE A;  2A4Z A;  2WXM A;  2Y5B B;  2BVC A;  1HXY D;  3GS2 A;  1P7E A;  3GOE A;  3BYY B;  1I35 A;  2KFJ A;  5E6J A;  5JH5 C;  2NBV B;  3U8Z A;  2I1K A;  4IDI A;  1P0R A;  1WGR A;  2GBR A;  2IJ0 A;  2JZ3 B;  4N59 A;  3Q8E A;  3HM3 A;  1WSP A;  4WJP A;  2VH1 A;  3BIN A;  3ETR A;  1QOB A;  2BWE S;  3ALB A;  2CU1 A;  1HZ5 A;  1T0R C;  1PYW D;  2DZJ A;  3Q8B A;  4B9K A;  2V1Y A;  4WQM A;  3QAQ A;  3AEC B;  3EHV A;  1L2N A;  1XCT L;  1PQS A;  4MJS A;  3RD2 A;  3NG0 A;  4NPN A;  2FUH B;  2XN9 C;  2BYE A;  4PK1 A;  5AUI A;  1GG3 A;  2D2Q A;  3PSE B;  3DDC B;  4PT5 A;  1WR1 A;  2BT6 A;  1TYG B;  1V49 A;  3AE8 B;  1NVI D;  1S3S G;  1L5P A;  1KLG D;  5IO9 A;  1F2R C;  1FXA A;  4HLE A;  1GAQ B;  4JE3 B;  1ACC A;  2R2Q A;  4MM3 B;  2MCN B;  3TL5 A;  3L54 A;  3Q8C A;  2KMM A;  4HRS A;  3HUI A;  2M8S A;  4B0E A;  3BK1 A;  2KJR A;  3TSS A;  3KWL A;  4W9H A;  4M02 A;  4ANU A;  3PHX B;  2NBW B;  5LNK 1;  4MGI E;  4C7Y A;  1PGA A;  1BML C;  4ZHP A;  3A4R A;  2WNM A;  1SSN A;  3IAS 1;  3V60 A;  2MBB B;  4DXF A;  2UWQ A;  2IBI B;  1F2R I;  3DWM A;  4NY0 A;  1CJE A;  4BKS D;  1R4M B;  1NEN B;  3ZIM A;  2WXO A;  4EZJ A;  2N9P C;  2N7J A;  1WI0 A;  5L83 A;  2K6Q A;  4L2Y A;  4NAM A;  3OJ4 B;  4K7S A;  1WR6 E;  3RZF A;  4C56 C;  5E6P A;  1A5R A;  1UF0 A;  1P7F A;  2K6D B;  3DHH C;  1WGG A;  2J0M A;  2L52 A;  5BMH A;  1SEB D;  1YJI A;  3T3O A;  2Y5P A;  1JRU A;  2YLM A;  3NS1 A;  2L0T A;  2M1M A;  1JWB D;  2O6V A;  3ZNZ B;  2N0S B;  1V97 A;  5DPR A;  4BZA A;  2EKI A;  3NUH B;  2NMQ A;  2QC8 A;  4IWP A;  1J7C A;  5C2T B;  3A1Q A;  1WYG A;  5J2R A;  1F9J A;  3M63 B;  3ZDM C;  1YOV B;  1QF6 A;  5JZE B;  2NS5 A;  4OHJ A;  2LD9 A;  4MGZ E;  1E6E B;  3C0R B;  1RLF A;  5MPO A;  4TQ1 A;  3AE9 B;  3VUX A;  2WQY B;  4CQN A;  1IGD A;  2I1J A;  4D2K A;  4JGH B;  2NCN A;  2DYB A;  2MA9 B;  1K50 A;  3VXW A;  2XNA C;  1RWS A;  1KTK A;  3CWI A;  4X57 B;  5KHO A;  1UWM A;  2RSU A;  1E8X A;  2H89 B;  2MLB A;  2VH2 A;  3AE4 B;  2LXA A;  4TKN A;  4XWW A;  1TT5 B;  1YJJ A;  3MC0 B;  1KFY B;  1FCL A;  1GNU A;  4K3C A;  2JRH A;  2AX5 A;  3B08 A;  3IBE A;  1OGW A;  2KLG A;  3IG3 A;  3E56 A;  4WAA A;  3DPD A;  2GRI A;  2KN5 A;  4NAW B;  4RM8 A;  1VCB A;  2FAZ A;  4MGY E;  5C3J B;  1WF9 A;  2CHX A;  2ONQ A;  3R8B A;  2KDE B;  2WDQ B;  2BS2 B;  3N1Z C;  1GC6 A;  1SE9 A;  3ENE A;  3IVF A;  3O65 B;  2PIA A;  3AEA B;  3DQV A;  2WU5 B;  3FAH A;  2YEP B;  1I7H A;  4N6E B;  3WAO A;  3Q3F A;  4MJS B;  2L83 A;  1LQB A;  5EE0 A;  4NZL B;  2MHJ A;  2DBY A;  4AOF A;  2DNF A;  2K39 A;  3Q6B A;  2KAN A;  2LAS A;  2KNB A;  2IY0 B;  1JCK B;  2ZVO A;  3PT2 B;  1UH6 A;  2JSV X;  2PE9 A;  5FR3 A;  4BKG A;  1J0G A;  1M94 A;  2MJD A;  5HKH A;  4MAC A;  4FJY A;  3JSV A;  3EEC A;  4MEM A;  4RH6 A;  3JVZ X;  4DXG A;  1AW7 A;  4LTU A;  2IY1 B;  1ZP0 B;  3RNG C;  1JWU D;  1MJD A;  2PVG C;  1YX5 B;  2L32 A;  2HD5 B;  2HDE A;  2LJI A;  4JIO U;  1T0S C;  2W82 A;  3AUL A;  2V3N A;  1XLP A;  1WXS A;  2QDF A;  3KUD B;  1C76 A;  3ONS A;  1K53 A;  3WAP A;  3RN9 C;  3SR6 A;  1E8Z A;  3P4R B;  4GGQ A;  4W9E A;  1Q5W B;  1QKZ A;  4RFB A;  3N9Y C;  4E71 A;  1STE A;  2MJ3 A;  3ZW3 A;  2M0X A;  1E7V A;  1B1Z A;  1Y56 A;  2J0K A;  1RYJ A;  2W3R A;  2AYO B;  1V5T A;  3D32 A;  4RGT A;  3AE2 B;  1Z5S B;  2KOX A;  3LDZ E;  1WGD A;  4ARC A;  2J53 A;  1L0Y B;  3PHW B;  2DX5 B;  1TGZ B;  2PE6 B;  1V2Y A;  1JML A;  2HTM E;  3JW0 X;  3BII D;  4DK5 A;  2KWV B;  2PTL A;  1OEY A;  4WWM A;  4NJC A;  2HJ1 A;  4LDT D;  2PW9 A;  2KJ6 A;  2BB6 A;  3APC A;  3VH4 B;  1Q10 A;  2RMM A;  1E7P B;  3APD A;  2GBN A;  2ON8 A;  2KTR A;  4XX5 A;  4IKG A;  4DWF A;  2M0A A;  2WXF A;  3OAW A;  3EGR A;  2C7M B;  1F52 A;  3L08 A;  3HHM A;  3I57 A;  1JW9 D;  2JXX A;  3AU5 A;  1SF0 A;  4GIV A;  3Q3J A;  1K51 A;  2X8X X;  3MJ5 A;  1TJE A;  3GZN I;  1SE3 A;  3P2B A;  3ZGZ A;  2FUG 1;  4JLC A;  2V4L A;  3QK0 A;  5JXV A;  4LJO B;  2OJW A;  2KDF B;  2LHD A;  3DBR I;  2JXT A;  2PKO A;  4IOI E;  2VZK D;  4IWQ A;  4P1C C;  5IKC M;  2R2O A;  3OLM D;  1T6B X;  2R61 A;  5D6J B;  1I4P A;  4DQO C;  1WXV A;  2WXG A;  2KQ7 A;  3NHE B;  1EU4 A;  2KK8 A;  2QMT A;  5HI1 A;  1ZDV A;  1QZE A;  1YN4 A;  1K8R B;  4YSY B;  3W1Y A;  1L0V B;  4F8C B;  4JWS C;  4LK0 M;  5CHV C;  5D2M B;  1WRI A;  2K8B A;  4DBG A;  3ZNH B;  3NRZ A;  3FIL B;  3KYD D;  3PLV A;  2OJR A;  2LGD A;  4M00 A;  3T3N A;  1NI2 A;  2ACZ B;  2KQ4 X;  2KDM A;  2G9H D;  5CX3 A;  2K8H A;  4L1B A;  1XLQ A;  3L0W B;  2LRW A;  2IGD A;  1YD8 U;  2MW5 A;  4E74 A;  3NVV A;  2J7Q B;  1RFK A;  3Q2A C;  4FA6 A;  3HIZ A;  3DBH I;  3J9C A;  1I4Q A;  1VZ8 A;  1SB3 C;  4AP4 C;  3AI5 A;  1WX7 A;  5HG2 A;  1PFD A;  2G1E A;  3DVG Y;  4IWO A;  4ANX A;  2BS4 B;  4S17 A;  3H7S A;  1UNS A;  4IW0 A;  3QJZ A;  2JVC A;  2UU7 A;  1N5W A;  1SE4 A;  2HTH A;  4BOZ B;  3NVY A;  4JL9 A;  1NDD A;  4K7U A;  4US8 A;  1V6E A;  2MP2 A;  1U4A A;  2EKE C;  3MHS D;  4LNK A;  2WS3 B;  3DBH B;  4ANW A;  4FHK A;  1XQQ A;  2BYT A;  1UUP A;  5GXG B;  1P9D U;  4P1B C;  2GMI C;  1FRD A;  3QX1 A;  1IBX A;  4II3 B;  4RM9 A;  4ZHO A;  1YJ1 A;  2AEH A;  3PPA A;  1FPY A;  4KVG B;  1L6U A;  2MBO A;  4HDQ A;  2MRP A;  3DBS A;  1GB4 A;  2WXI A;  3BYT B;  3R3M A;  3NVZ A;  1WXA A;  3L4P A;  2D10 A;  2DWQ A;  1Q1O A;  3ZDT A;  5DCN A;  1G6J A;  3RPF C;  3B2F A;  4YTM B;  1LFD A;  2FCN A;  2WXQ A;  3IT4 B;  3P1M A;  1FFU A;  3ZJU A;  2WXK A;  2G4S A;  2MSE D;  2RR9 A;  1FM0 D;  1TZO A;  2CS4 A;  2ZCC A;  5FK9 C;  1SBB B;  3PZ7 A;  1JRO A;  3UI3 A;  3R2I A;  3FKY A;  2KFK A;  3FC4 A;  1UBI A;  1WX8 A;  4KZ0 A;  4BVU C;  4AS1 A;  1HA5 A;  2PVO D;  2ZCB A;  1FNU A;  4YWG G;  4EFO A;  2KHW B;  4A6Q A;  1Y8R C;  3W1S A;  3NJT A;  2LEK A;  4B6W A;  2D3C A;  1EU3 A;  4C7Z A;  5BO4 B;  1VR9 A;  4KKI A;  3A33 B;  4A3O A;  1D4B A;  2KTR B;  1C79 A;  3A9K B;  1VJK A;  3V3X A;  2JWZ A;  2ZPN A;  3WIM A;  1NI3 A;  1YN3 A;  2BF8 B;  2HE7 A;  3ZLZ A;  3I5J C;  1ZUD 2;  3ZXV A;  1ESF A;  3RNE C;  2W55 A;  5AZH A;  4BOS C;  3N20 C;  2KMA A;  1L6V A;  4DHZ B;  4WH4 A;  1YQ4 B;  2XK5 A;  2NTS A;  4LDT B;  2QJL A;  5IN7 A;  2BBC A;  4F7Z A;  1R4M I;  4IM2 A;  2KX3 A;  3NZU A;  1C4C A;  4DXA B;  3AEG B;  4HCP B;  2AWT A;  3L17 A;  2JQR B;  2XBB C;  1D5X C;  3TMP B;  2HJ8 A;  4BAX A;  1WMH B;  1XEE A;  2NBU A;  2K3U A;  3ZXR A;  4AQ7 A;  5EDS A;  1WH3 A;  3MC8 A;  3NOB A;  2L0F A;  5BYS A;  3APF A;  4HPM B;  3DHG C;  4IC7 B;  1Q0W B;  4AUQ C;  2MJE A;  3N3K B;  2REX A;  1Z2M A;  3EUB 2;  4WQO B;  3AEF B;  3X23 A;  4YSX B;  2VZK B;  2N9K A;  3I9V 1;  5G55 A;  4CYE A;  5BMG A;  1YNT E;  4HPP A;  4LJP B;  4KIK B;  4A3P A;  5HFY A;  1R4N B;  4DHZ E;  1WJU A;  3PZD A;  3EA6 A;  4W9D A;  1UZX B;  5IA7 A;  4OVV A;  1UEL A;  3H7P A;  2GBK A;  3VR8 B;  2M56 B;  1FXT B;  2L7R A;  2XEW A;  4TV3 A;  4FHJ A;  2KX0 A;  4YSZ B;  2WDR B;  2A5U A;  4GMV A;  1LO5 D;  2LI5 A;  4URK A;  2NPT B;  3U4E G;  2D3G A;  4C00 A;  1L7Y A;  3RFZ B;  1MG8 A;  1E8Y A;  3UGB B;  1TS3 A;  1I42 A;  4XYC A;  5LXH A;  2KMC A;  4WUR A;  5CHF A;  3DVG X;  2KWD A;  4EOY A;  2LMC A;  3QCA A;  4S0R A;  3SU8 X;  4EKU A;  2IGH A;  1V1P A;  3ZTD A;  4BKS A;  3ZNG C;  4ZRP A;  2BB5 A;  3GE8 C;  2YVC A;  3Q14 C;  4XDC A;  4K7W A;  3DVN U;  4HJK A;  4OW0 A;  2MEK A;  2BKF A;  1I4H A;  4PS7 A;  1RFA A;  2IGG A;  2KXJ A;  1RM6 C;  3VQI A;  4I6P A;  4TSS A;  2DYM A;  2WP9 B;  5G5H A;  5DPW A;  4FN2 A;  2ZW0 A;  3UQA A;  1IUE A;  2NR2 A;  2GB1 A;  2O2V A;  4BBN C;  2MX2 A;  1TIF A;  4MT5 A;  3KWV A;  4DHJ B;  1KM7 A;  4IM0 A;  4XDD A;  1TBE A;  4H2A A;  2PLP A;  3RT3 B;  2WDV B;  1WYW B;  4B95 A;  4ZRI A;  3MFG A;  3T9L A;  3LYY A;  1IGC A;  4KGR A;  2LHE A;  3ZTC A;  2I2Y A;  2IO0 B;  3RNC C;  1ZOY B;  3IT6 B;  1PGX A;  3GE3 C;  1I4G A;  3OG5 A;  1QQR A;  2L8J A;  4GLS C;  3PTF C;  4HEA 1;  2Q5W D;  2DZM A;  1YMH E;  2OHF A;  4FLH A;  4IM3 A;  1UWX A;  2WU2 B;  3QIJ A;  2JX5 A;  3VHT C;  2V9H A;  1EF5 A;  2M17 A;  1S1Q B;  3A9J A;  1TS2 A;  1FIQ A;  4HWI B;  3WAM A;  5CHW A;  4RGN A;  1UGJ A;  2DHZ A;  4IUM B;  2DZI A;  3AH7 A;  2GLS A;  1MHX A;  1N6Z A;  4AJW A;  1V1O A;  2JYT A;  2G4D B;  2X38 A;  3V6E B;  2INP E;  2UYZ B;  3HVD A;  1C9F A;  3RI7 C;  3MJW A;  1TKE A;  4DDG D;  4NJ6 A;  4WAF A;  3ZKJ C;  3C19 A;  3QHT A;  2WX0 A;  2RDG A;  1NBF C;  2FCM A;  2ICI A;  3AE1 B;  4GDL A;  3VR9 B;  1CZP A;  2Z8L A;  3NZ3 A;  1BUI C;  1WGH A;  1UBQ A;  1AAR A;  4W9I A;  2K8C A;  4KV2 A;  1C4A A;  2KC2 A;  4ZYS A;  3TEZ A;  3K9P B;  3ZJV A;  2LGI A;  2K0P A;  2PMV A;  1OQR A;  4ZOH C;  2J0J A;  3Q8F A;  3M95 A;  2KDI A;  2V0G A;  3BVM A;  2EMT A;  3VRA B;  2AL6 A;  3PZ8 A;  3H7P B;  2WX1 A;  1N5X A;  3UIN B;  1WZ3 A;  1GB1 A;  2OED A;  3RCZ A;  3SFE B;  4GDK A;  2L1A A;  2BW2 A;  1KRH A;  4I6L B;  3MTN B;  3ZRF A;  2O6V B;  5BMI A;  5J18 A;  1X1M A;  1WX9 A;  2N9X A;  3N1X C;  4MEL A;  4KSL C;  2FNJ B;  2ZVN A;  4MGK E;  2Z0D B;  1VZ7 A;  1AN8 A;  3S2A A;  4Q2J A;  1RRB A;  3A1Q B;  2PJH A;  1V1P B;  2MWS B;  1MI0 A;  3KUC B;  1C4P A;  3JYU A;  2GI9 A;  4MSM B;  3H8H A;  1FRR A;  4W9C A;  4HVB A;  1P1A A;  5H92 C;  5IOI A;  2WXP A;  4PS3 A;  3PGE A;  3W9C B;  1ET6 A;  2Y3A A;  3PLU A;  3U52 E;  1EF1 A;  1TS5 A;  4G50 A;  1FFV A;  1V5O A;  2LVQ A;  1UD7 A;  4EZL A;  4JQW C;  1CMX B;  2JZP A;  1RAX A;  2WXH A;  1GUA B;  2WWZ A;  4USA A;  2LVO A;  4NJ7 A;  3CF6 E;  3Q69 A;  3W5V B;  1NYR A;  1YQ3 B;  4HKQ A;  1YX6 B;  5IAA C;  5D94 A;  4HDO A;  1L4D B;  4P16 A;  5J17 A;  2INC C;  3P42 A;  1NYQ A;  1ZPS A;  4EE2 A;  2O2V B;  4EUT A;  2JF5 A;  2D07 B;  2JZZ A;  2TSS A;  1YIW A;  4BFR A;  5C23 A;  5AEK B;  1ZXI A;  3KYC D;  2JUO A;  4MSQ B;  2C60 A;  2KC1 A;  2LUE A;  1F77 A;  3VVW B;  2LFI A;  4ICU A;  5JHB A;  3AMZ A;  2SAK A;  4ZRQ A;  1HTO A;  3IAM 1;  3MC9 A;  3IHP C;  1MG4 A;  3P63 A;  1E7U A;  3NY5 A;  3Q3N C;  3AEB B;  3NS8 A;  1ROE A;  2IO3 B;  2WYQ A;  3L16 A;  2D5G A;  3HRD D;  4XWT A;  2GBJ A;  3CST A;  4LNF A;  3VH3 B;  4LNN A;  2BGF A;  1N62 A;  1TY0 A;  1IPG A;  3Q8A A;  2WXN A;  4QAY A;  4K81 A;  4OVZ A;  4KKJ A;  2M19 A;  1TKY A;  2ASQ A;  4C4V A;  2W54 A;  4ARI A;  2LRU A;  4B0M A;  2KT7 A;  5FKA C;  1WE6 A;  3BK2 A;  1QT9 A;  2G3Q B;  4KSK C;  1DGJ A;  1N63 A;  2RDH A;  1H4R A;  3DWG C;  2LGX A;  4FJZ A;  3Q3O C;  4JWU C;  4W9K A;  2LXC A;  3JSV B;  3K9O B;  1P98 A;  1J7B A;  4A20 A;  4TMA B;  4WIP A;  1KH0 A;  4CHK A;  4GN1 A;  4WJN A;  2JT4 B;  1TZ1 A;  2H88 B;  1JWA D;  1OFF A;  2V4I B;  4YTP B;  1SIJ A;  1WGY A;  1ZW7 A;  2KD0 A;  3TIX A;  1OEY J;  3H6N A;  5JHA A;  3VDZ A;  4A8X C;  3ABV B;  4FAD A;  4ITK A;  1VZ6 A;  4KX6 B;  1V8C A;  4DHJ D;  4TQ0 A;  3B9J A;  1KJT A;  3V6C B;  2J4X A;  3MHZ A;  1GC7 A;  4YTN B;  1FD6 A;  2LGY A;  3KW5 B;  1L4Z B;  1XLN A;  1JWS D;  1ZKH A;  2EMS A;  2BYV E;  2WXL A;  3B2G A;  2IZV B;  1MFW A;  4WJO A;  3VUW A;  1J8C A;  3LXF A;  3TBL D;  2D3A A;  2MQJ A;  3SD5 A;  1JAL A;  5DPS A;  1N60 A;  3DBL I;  3X0W A;  4G0N B;  1QOA A;  2JRI B;  3PS6 A;  4MH0 E;  4ANV A;  2M4N A;  1KLU D;  3PRP B;  2K1F A;  3R2T A;  4MDK E;  1OTR B;  4ASW C;  3VTW A;  1PGB A;  2BS3 B;  3WAL A;  1ENF A;  1HZ6 A;  1YN5 A;  4NAW A;  2IPK D;  2IYD B;  2N7D A;  2QIE B;  2EEL A;  4M8M A;  3T8M A;  2L3Z A;  1WJ6 A;  3KUZ A;  3HK0 A;  3L13 A;  2V3S A;  3DBL B;  3AEE B;  3MP9 A;  3U7Z A;  3N32 A;  1YQB A;  3RYT A;  2Z0E B;  4TUU A;  4WWP A;  2ZW1 A;  2LVP A;  3WCQ A;  3BVZ A;  2PEA A;  4YL8 A;  2KO3 A;  2FBW B;  4J3O D;  3P4Q B;  4I6N B;  4E3C A;  1UGM A;  5C1Z A;  1JQ4 A;  1JWM D;  3R7Q A;  1V9J A;  1BXT A;  3GP7 A;  3AM9 A;  1TS4 A;  1SJE D;  3R66 C;  3PVL A;  1DOY A;  1XCQ L;  2W9N A;  3RNA C;  2KWC A;  1R4N I;  1WM2 A;  4HK2 A;  5BYQ A;  4HXD A;  2BWF A;  2FIF A;  4LCD E;  2IND C;  4DDI D;  2MBQ A;  1DYQ A;  3A4S C;  2O6V D;  1FNW A;  1J19 A;  3I3T B;  3AE3 B;  1VLB A;  1T5X D;  1FMA D;  3TJP A;  3WA0 A;  3EFU A;  2N7E A;  4KGT A;  3GB1 A;  5LLI A;  1FO4 A;  4C4V B;  3EC8 A;  4OZB A;  3QAR A;  1H8C A;  4KGS A;  1ISN A;  1TY2 A;  4M01 A;  1MPE A;  2QCZ A;  3SEB A;  4KDL B;  4N58 A;  3NVW A;  1WJN A;  2KAJ A;  5T8I A;  1T0Y A;  2K22 A;  1XF5 L;  2YEP F;  3RMK C;  5EE9 A;  3U2S C;  3ECI A;  5GMV A;  5LXI B;  2Z59 B;  4GSW A;  2KAC A;  3VRB B;  1E10 A;  2MP2 B;  3B0A A;  2G45 B;  3LJ3 A;  2IO1 B;  1KF6 B;  2FCS A;  4C80 A;  3UQB A;  1HQR D;  1EM7 A;  1IBX B;  2SEB D;  3W1S C;  2C5L C;  3U30 A;  2KQS A;  4O1N A;  1AYF A;  4HCN B;  2W3S A;  1VDV A;  1A70 A;  4PYU A;  4BBN F;  2WXR A;  3RNF C;  2BYF A;  1LM8 B;  1EWC A;  2DZK A;  3N1Y C;  2MH7 A;  1F1H A;  2MBE A;  3PRM B;  3QC8 B;  3OJ3 A;  1F0Z A;  4OVU A;  3AXC A;  2WXJ A;  3EFC A;  2CHZ A;  3W5U B;  3KLS X;  1BT0 A;  2E3T A;  4KDI C;  3SHQ A;  2QSD A;  1QIL A;  4PYZ A;  3W2D A;  3P4P B;  2KVR A;  3RUI B;  1D6E C;  1WIA A;  2WDT B;  3IXS A;  3QWZ B;  2D3B A;  3AU4 A;  3B1L X;  2CU3 A;  4KZC A;  1WXQ A;  2KFK B;  2JY6 A;  1C1Y B;  5D3D A;  3RZW C;  2NTT A;  4GU2 A;  1CQV A;  4GB9 A;  5E6O A;  4FBJ B;  5G5G A;  2KLC A;  2FCQ A;  3RNB C;  3SFD B;  4HJG E;  3V61 A;  2D11 A;  2DLB A;  3LB8 C;  2E6X A;  3AE5 B;  3KH0 A;  1K52 A;  2AQ3 B;  1SGH A;  4W9L A;  3WAN A;  4UDU C;  3H9D A;  1PUT A;  4EEW A;  4XGA B;  2MBH A;  2B76 B;  4RCO A;  4JPS A;  5I4D A;  1E0Z A;  2L05 A;  1B9R A;  1FEH A;  4P7I A;  3V05 A;  1OQQ A;  1ZE3 D;  4ACF A;  2K9X A;  3OWE B;  4ZDV A;  2K5P A;  2ZNV C;  1VD2 A;  2C7N B;  3QQ8 B;  2ZPY A;  4G11 A;  3BZD B;  3FIL A;  1T3Q A;  2XK5 B;  4RNA A;  5AUK A;  2LJ5 A;  4A9A A;  3Q3M C;  2N4F A;  4US9 A;  4ZRJ A;  5L95 C;  1MVK A;  3KQ4 A;  4FUL A;  3ML9 A;  5FR6 A;  2JU6 X;  3SDL C;  3ZVV A;  3U7D A;  4RF1 A;  1WFY A;  2QIL A;  1GPX A;  3IFW B;  3TEY A;  1P3Q U;  2JWU A;  2QHO A;  2N9L A;  3PRZ A;  5KHQ A;  1MHH E; 
#chains in the Genus database with same CATH homology
 2KFK A;  4EZK A;  1KLV A;  3IHP C;  5DPR A;  1E7U A;  1UBI A;  1WX8 A;  3NY5 A;  2DAJ A;  3NS8 A;  2IO3 B;  4F1S A;  4IWP A;  3QA8 A;  4KZ0 A;  2WYQ A;  4BVU C;  3L16 A;  2ZCB A;  2GBJ A;  3A1Q A;  2GOW A;  3CST A;  5D7G A;  1F9J A;  5J2R A;  3M63 B;  4GXB A;  3R7R A;  2KHW B;  3VH3 B;  2BGF A;  3ZDM C;  4EFO A;  1Y8R C;  1IPG A;  5JZE B;  3W1S A;  2NS5 A;  2LD9 A;  2DAF A;  4MGZ E;  4B6W A;  2L00 B;  3C0R B;  2ZZP B;  3VAW A;  1RLF A;  5BO4 B;  4K81 A;  4WWN A;  4TQ1 A;  2ASQ A;  3VUX A;  3A33 B;  3DOW A;  2OOB B;  2DEN B;  3H1U A;  4A3O A;  1IP9 A;  2KTR B;  2ZNV B;  1LXD A;  2I1J A;  3A9K B;  2LRU A;  2NCN A;  4JGH B;  3VTV A;  2JWZ A;  2DYB A;  2MA9 B;  2ZPN A;  1WE6 A;  3WIM A;  4HPL B;  3M62 B;  1KOT A;  3VXW A;  2G3Q B;  4KSK C;  3L10 B;  2RPQ A;  4X57 B;  4XZ4 A;  2GBM A;  5KHO A;  5TR5 A;  2BF8 B;  1H4R A;  1WRD B;  2HE7 A;  3ZLZ A;  1C3T A;  1HE8 A;  4ZYN A;  2RSU A;  1E8X A;  2MLB A;  2LXA A;  4TKN A;  5AZH A;  4BOS C;  2KMA A;  2LGX A;  4FJZ A;  4DHZ B;  4W9K A;  2LXC A;  2XK5 A;  4LDT B;  1GNU A;  3JSV B;  2JRH A;  1D3Z A;  3K9O B;  2K25 A;  1R4M I;  4F7Z A;  4IM2 A;  1P98 A;  3B08 A;  2KX3 A;  4A20 A;  3NZU A;  3BY4 B;  3IBE A;  1OGW A;  2KLG A;  3DVN V;  4II2 B;  3TCA A;  3VUY A;  3IG3 A;  4WAA A;  4DXA B;  4HCP B;  1E5W A;  2AWT A;  3DPD A;  3L17 A;  2XBB C;  3TMP B;  4CHK A;  4NQK E;  1WXM A;  2HJ8 A;  1XD3 B;  2JT4 B;  4GN1 A;  2KN5 A;  1TZ1 A;  4WJN A;  4NAW B;  1WMH B;  2L76 A;  4RM8 A;  1VCB A;  2FAZ A;  2NBU A;  4MGY E;  1WM3 A;  1WGY A;  1ZW7 A;  5EDS A;  1WF9 A;  2CHX A;  2KD0 A;  3TIX A;  1OEY J;  3ZUN A;  2CHW A;  1WH3 A;  3H6N A;  5AZG A;  5JHA A;  3CMM B;  3HM6 X;  3NOB A;  2KDE B;  3VDZ A;  2L0F A;  3APF A;  1GC6 A;  1IYF A;  4HPM B;  1SE9 A;  4FAD A;  3ENE A;  3IVF A;  4IC7 B;  1Q0W B;  3O65 B;  5AZF A;  4DHJ D;  4AUQ C;  1XT9 B;  3N3K B;  2REX A;  2AL3 A;  1Z2M A;  4WQO B;  2ZJD A;  3DQV A;  4M8N A;  3UIO B;  3X23 A;  1V80 A;  3NZS A;  4TQ0 A;  3PV1 A;  5G55 A;  4WJQ A;  2CR5 A;  1KJT A;  3V6C B;  3V62 A;  3WAO A;  2BKR B;  3Q3F A;  4CYE A;  2N9E B;  4MJS B;  1GC7 A;  4LJP B;  2LGY A;  3N30 A;  2B3A A;  4KIK B;  1LQB A;  3KW5 B;  4A3P A;  4DHZ E;  1WJU A;  3PZD A;  1ZKH A;  4AOF A;  1EO6 A;  2K39 A;  2EMS A;  4W9D A;  2KAN A;  3KVF B;  2LAS A;  2KNB A;  1UZX B;  4NNJ B;  4OVV A;  1UEL A;  2BYV E;  5IA7 A;  3A9K A;  3H7P A;  2IY0 B;  2GBK A;  2ZVO A;  2IZV B;  3PT2 B;  4WJO A;  3VUW A;  1J8C A;  2JPH A;  4W9G A;  1FXT B;  2L7R A;  1UH6 A;  3TBL D;  2XEW A;  2MQJ A;  4TV3 A;  3SD5 A;  2PE9 A;  2KX0 A;  4FHJ A;  4AWJ A;  4BKG A;  1J0G A;  2A5U A;  1M94 A;  2KJH B;  4GMV A;  3ZNI D;  1E8W A;  5HKH A;  5DPS A;  2LI5 A;  2LZ6 A;  3DBL I;  4FJY A;  2NPT B;  3X0W A;  2D3G A;  4URK A;  4G0N B;  5E6N A;  2JRI B;  2ZEQ A;  1L7Y A;  1MG8 A;  1ZGU B;  1E8Y A;  3PS6 A;  3JSV A;  3EEC A;  4MH0 E;  4MEM A;  4MM3 A;  2LWP A;  4RMA A;  3UGB B;  2M4N A;  4ANV A;  1OQY A;  1I42 A;  5LXH A;  4ZRK A;  3UF8 A;  2KMC A;  5CHF A;  3DVG X;  3PRP B;  2K1F A;  3JVZ X;  4EOY A;  2CKH B;  3QCA A;  4GOC A;  2IY1 B;  4MDK E;  3SU8 X;  1OTR B;  4EKU A;  3DCG A;  4W9J A;  4ASW C;  3VTW A;  1E90 A;  3WAL A;  2RGF A;  3ZTD A;  4BKS A;  4NAW A;  1WMH A;  3ZNG C;  3UIP B;  2IYD B;  2N7D A;  5DPT A;  2YVC A;  4M8M A;  1YX5 B;  2HD5 B;  3T8M A;  1WE7 A;  4JIO U;  4K7W A;  2L3Z A;  1WJ6 A;  3DVN U;  3A9J B;  3KUZ A;  4HJK A;  3HK0 A;  3L13 A;  1V86 A;  2BKF A;  2V3S A;  2C9W B;  3AUL A;  1V81 A;  3N32 A;  4XC2 A;  2N1V A;  1YQB A;  3RYT A;  1WXS A;  2Z0E B;  4PS7 A;  1RFA A;  4TUU A;  4WWP A;  3KUD B;  4J6I A;  3ONS A;  4WWO A;  2KXJ A;  3WAP A;  2LVP A;  3VQI A;  4I6P A;  1E8Z A;  2PEA A;  4YL8 A;  4GGQ A;  4W9E A;  4W9F A;  2KO3 A;  4ICV A;  2DYM A;  1Q5W B;  4FJV B;  4I6N B;  5DPW A;  5G2N A;  4FN2 A;  4E3C A;  1UGM A;  5C1Z A;  4KIK A;  1WZ0 A;  3R7Q A;  1V9J A;  3UQA A;  4E71 A;  5CTR C;  3ZW3 A;  2NR2 A;  3RUL A;  2M0X A;  1E7V A;  2KDB A;  3CSF A;  2O2V A;  2J0K A;  4AJY B;  4NQL B;  3R66 C;  2AYO B;  1V5T A;  4IG7 B;  1SIF A;  3D32 A;  2BPS A;  2KWU B;  4CO7 A;  1TTN A;  1Z5S B;  3PVL A;  2MX2 A;  4BBN C;  2W9N A;  2VRR B;  4DHJ B;  1KM7 A;  4PS8 A;  2KOX A;  4IM0 A;  4BKT A;  4GDL B;  2PPH A;  3LDZ E;  1TBE A;  2KWC A;  1WGD A;  1R4N I;  3RT3 B;  4M0W B;  4G3X B;  3PHW B;  1WM2 A;  2DX5 B;  1WYW B;  1TGZ B;  4HK2 A;  4HXD A;  2BWF A;  2FIF A;  4LCD E;  4B95 A;  4ZRI A;  2PE6 B;  1V2Y A;  2NPT A;  3VFK A;  4DDI D;  2MBQ A;  3T9L A;  2IO2 B;  1WY8 A;  3JW0 X;  4N9F 4;  4DK5 A;  3ZTC A;  2KWV B;  3A4S C;  2DYO A;  2O6V D;  2IO0 B;  1J19 A;  1OEY A;  3I3T B;  3ZO5 B;  3TJP A;  3WA0 A;  4LDT D;  3EFU A;  2L8J A;  2KJ6 A;  2N7E A;  3PTF C;  5LLI A;  3APC A;  3VH4 B;  2DZM A;  3M3J A;  3ML8 A;  2KTF A;  2C7H A;  4FLH A;  4IM3 A;  3EC8 A;  3QAR A;  1H8C A;  3QIJ A;  4K1R B;  3VHT C;  3APD A;  1ISN A;  2GBN A;  3ZRC A;  1EF5 A;  2RD0 A;  2M17 A;  1S1Q B;  2KKC A;  1EUV B;  3A9J A;  2KTR A;  4GDK B;  2NVU I;  4XX5 A;  4DWF A;  4HWI B;  3WAM A;  5CHW A;  2FID A;  3OAW A;  2C7M B;  3L08 A;  3HHM A;  2DHZ A;  4IUM B;  3AU5 A;  2JXX A;  2DZI A;  4GIV A;  3Q3J A;  1GJZ A;  4KDL B;  1WJ4 A;  1WJN A;  3GZN I;  2KZR A;  4AJW A;  3P2B A;  1T0Y A;  2N1W A;  3VTU A;  3PRE A;  4JLC A;  2G4D B;  2A4Z A;  2V4L A;  3QK0 A;  3V6E B;  4LJO B;  2Y5B B;  3ECI A;  5GMV A;  2UYZ B;  5LXI B;  2KDF B;  3DBR I;  2Z59 B;  3MJW A;  3GOE A;  4IWQ A;  4GSW A;  4DDG D;  1I35 A;  2MP2 B;  2KFJ A;  3B0A A;  5JH5 C;  2NBV B;  2R2O A;  3OLM D;  4NJ6 A;  3U8Z A;  2I1K A;  3ZKJ C;  3QHT A;  5D6J B;  1P0R A;  2G45 B;  2WX0 A;  1WGR A;  2GBR A;  1NBF C;  1WXV A;  3LJ3 A;  2KQ7 A;  3NHE B;  2JZ3 B;  2IO1 B;  2FCS A;  2FCM A;  3UQB A;  3HM3 A;  2KK8 A;  4WJP A;  4GDL A;  3W1S C;  3BIN A;  2C5L C;  3U30 A;  1QZE A;  2KQS A;  1K8R B;  3W1Y A;  2BWE S;  1WGH A;  3ALB A;  4F8C B;  1UBQ A;  1AAR A;  2CU1 A;  4HCN B;  4W9I A;  2DZJ A;  2K8C A;  4KV2 A;  5CHV C;  4PYU A;  4BBN F;  2KC2 A;  5D2M B;  4B9K A;  2K8B A;  2V1Y A;  2BYF A;  1LM8 B;  3K9P B;  3ZNH B;  4DBG A;  3QAQ A;  2DZK A;  3KYD D;  3PLV A;  2OJR A;  2LGD A;  3EHV A;  2MBE A;  3PRM B;  1NI2 A;  2J0J A;  3QC8 B;  1L2N A;  3M95 A;  2KDI A;  3OJ3 A;  1PQS A;  5CX3 A;  4OVU A;  2K8H A;  3AXC A;  2EMT A;  2LRW A;  3L0W B;  2AL6 A;  1YD8 U;  2CHZ A;  2MW5 A;  4MJS A;  3RD2 A;  4E74 A;  3H7P B;  2WX1 A;  4NPN A;  2FUH B;  1BT0 A;  2J7Q B;  2BYE A;  3UIN B;  1WZ3 A;  1GG3 A;  4KDI C;  3SHQ A;  4FA6 A;  3HIZ A;  4PYZ A;  3DBH I;  3RCZ A;  2KVR A;  4GDK A;  2D2Q A;  3RUI B;  3PSE B;  3DDC B;  1WIA A;  4I6L B;  2WDT B;  4AP4 C;  1WR1 A;  3MTN B;  3ZRF A;  3QWZ B;  2O6V B;  1V49 A;  3AI5 A;  3AU4 A;  3B1L X;  1WX7 A;  4ANX A;  3DVG Y;  4IWO A;  1S3S G;  4KZC A;  5J18 A;  2KFK B;  1X1M A;  1WX9 A;  3H7S A;  2JY6 A;  2N9X A;  4IW0 A;  4HLE A;  2MCN B;  2R2Q A;  3TL5 A;  3L54 A;  4MEL A;  1C1Y B;  2FNJ B;  3QJZ A;  4KSL C;  2JVC A;  2ZVN A;  4MGK E;  3RZW C;  2Z0D B;  2HTH A;  4GU2 A;  4GB9 A;  4BOZ B;  3S2A A;  5E6O A;  4JL9 A;  2M8S A;  1NDD A;  4K7U A;  1RRB A;  4FBJ B;  2KJR A;  1V6E A;  4W9H A;  3A1Q B;  2KLC A;  2FCQ A;  4ANU A;  3PHX B;  2MP2 A;  2NBW B;  1U4A A;  2PJH A;  4MGI E;  2EKE C;  3MHS D;  2MWS B;  3KUC B;  3V61 A;  3JYU A;  3A4R A;  4ANW A;  4MSM B;  2D11 A;  3KH0 A;  4FHK A;  4W9L A;  1SGH A;  4W9C A;  3WAN A;  4HVB A;  1P1A A;  3V60 A;  1XQQ A;  4PS3 A;  2MBB B;  3H9D A;  3PGE A;  4EEW A;  1P9D U;  2GMI C;  3QX1 A;  4II3 B;  4RM9 A;  2MBH A;  1YJ1 A;  2UWQ A;  2IBI B;  2AEH A;  3PPA A;  3PLU A;  2L05 A;  1EF1 A;  4KVG B;  4NY0 A;  4P7I A;  4BKS D;  2MBO A;  4G50 A;  1V5O A;  2LVQ A;  4HDQ A;  1UD7 A;  4EZL A;  3ZIM A;  2MRP A;  3DBS A;  4ZDV A;  2ZNV C;  1VD2 A;  1CMX B;  4JQW C;  3R3M A;  4EZJ A;  1RAX A;  2C7N B;  1GUA B;  2N9P C;  2WWZ A;  2ZPY A;  3QQ8 B;  1WI0 A;  1WXA A;  2LVO A;  4G11 A;  3CF6 E;  4NJ7 A;  5L83 A;  2K6Q A;  2D10 A;  2XK5 B;  2LJ5 A;  1YX6 B;  3OJ4 B;  4K7S A;  5D94 A;  4HDO A;  1WR6 E;  2N4F A;  1Q1O A;  5IAA C;  3ZDT A;  3RZF A;  5E6P A;  1A5R A;  5J17 A;  5DCN A;  1G6J A;  2K6D B;  4ZRJ A;  2O2V B;  5L95 C;  1WGG A;  4EUT A;  2J0M A;  4FUL A;  3ML9 A;  2JF5 A;  1LFD A;  2D07 B;  2FCN A;  1YIW A;  2JZZ A;  4BFR A;  5FR6 A;  5C23 A;  3SDL C;  3ZVV A;  5AEK B;  1JRU A;  2YLM A;  3KYC D;  3U7D A;  2JUO A;  1WFY A;  2L0T A;  4MSQ B;  2C60 A;  2KC1 A;  2G4S A;  2LUE A;  2M1M A;  2MSE D;  2RR9 A;  3IFW B;  3VVW B;  2CS4 A;  4ICU A;  2O6V A;  2ZCC A;  3ZNZ B;  1P3Q U;  2QHO A;  3PRZ A;  5JHB A;  5KHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...