3ZUNA

Pvhl54-213-elob-eloc complex_(2s,4r)-4-hydroxy-1-(2-(3-methylisoxazol- 5-yl)acetyl)-n-(4-nitrobenzyl)pyrrolidine-2-carboxamide bound
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
102
structure length
102
Chain Sequence
b'MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Elongin-B, Elongin-C, Von Hippel-Lindau Disease Tumor Suppressor Complex
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 20
structure length 102
sequence length 102
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zunA00
1J0GA 2LRWA 1WJ6A 2DAFA 3PHXB 2N9PC 2D2QA 2KK8A 4W9FA 4CHKA 2JF5A 3QCAA 5G55A 4AJWA 3TJPA 4MM3A 3UGBB 2V1YA 3W1SC 2M4NA 3EHVA 2BWFA 4IWPA 1WR1A 3QJZA 3NS8A 2Z59B 4NPNA 4IM3A 2GBRA 3T8MA 2M8SA 3C0RB 3OJ4B 4KSLC 2ZPYA 1EUVB 3N30A 2IO0B 3H7PB 2K6QA 3OLMD 3EECA 2IO1B 1F9JA 3DCGA 4BBNC 2L0TA 4BKSA 4DHJB 3H6NA 2QHOA 3VXWA 4KIKA 1RFAA 2AYOB 4I6LB 3L10B 4M8MA 2D3GA 3ZW3A 4F7ZA 3R66C 3DPDA 4KSKC 4PS8A 1NBFC 2DYOA 2FCNA 2JUOA 3IBEA 3KUDB 2KTRB 2KQSA 1GUAB 2R2OA 4IM0A 2ZNVC 5CTRC 4KVGB 2KDIA 4W9KA 2A4ZA 3PZDA 3QARA 4WWOA 2MW5A 1S3SG 2GBJA 3O65B 4WJQA 3VFKA 3M95A 4AOFA 1YIWA 3QWZB 2KTFA 2I1KA 4CO7A 3ZO5B 3NHEB 2MA9B 5L83A 2LGXA 1IPGA 1XD3B 4BKTA 4G11A 5AZHA 2MBOA 1T0YA 5J17A 2JZ3B 2NS5A 3MHSD 2LWPA 4JGHB 4MGIE 4EOYA 3TBLD 4ASWC 2IBIB 2C60A 2JVCA 1Y8RC 4EZLA 1WXMA 3AU5A 3PRMB 1OGWA 1J19A 3EFUA 1E8ZA 3IG3A 1Q1OA 3QHTA 3A4RA 4FHKA 3UQBA 2ZNVB 3PLVA 2DZIA 3WANA 1V49A 2AL6A 2FIFA 5CX3A 4ICUA 4HVBA 2RD0A 2XK5B 3A1QB 1BT0A 1WE7A 3KYDD 5JHBA 2K1FA 3T9LA 1EF5A 4ZYNA 2MBBB 3UINB 1SIFA 2NR2A 1WGHA 2CKHB 2XBBC 3N3KB 3PVLA 2BWES 1J8CA 1NDDA 1WGRA 2YVCA 2IY1B 4ANXA 2YLMA 5KHOA 2AL3A 2MX2A 1WMHA 2LVQA 3QAQA 4LJOB 2N1WA 1I35A 1X1MA 4W9CA 1GC7A 2IO3B 2WX1A 3ONSA 3L08A 4HDQA 4IC7B 2HD5B 4KDIC 3I3TB 4AJYB 1OEYA 1SE9A 3AU4A 4AWJA 4ANVA 2I1JA 2O2VB 2GBNA 1YX5B 3ML8A 3NY5A 4GB9A 4IWQA 1WJUA 1WJNA 4GDKB 3U30A 3ZRFA 3L54A 4ANWA 4NQKE 1UGMA 4MEMA 1G6JA 5FR6A 2CHXA 1EO6A 1OEYJ 3ZVVA 2REXA 4EFOA 2N9XA 3OAWA 4WAAA 1WZ0A 1AARA 1GC6A 3QX1A 3CSFA 1HE8A 2AEHA 2AWTA 4NJ7A 4DK5A 2N9EB 1ISNA 3WALA 3RYTA 4II2B 2BYFA 3GZNI 2N1VA 1UBQA 1LFDA 2OOBB 3L13A 3ZDTA 4FADA 4AP4C 1JRUA 4W9LA 3RZFA 4WJOA 4NAWB 3A9JB 2DZJA 4FJZA 2G3QB 4MGYE 3H7PA 2VRRB 2KMAA 4IG7B 3RT3B 3TCAA 3IVFA 1U4AA 1P9DU 2KFKB 2FCSA 3SDLC 3PHWB 2WDTB 4MELA 5D2MB 2DX5B 2CU1A 4GDLB 4HCPB 3A9KB 2KTRA 3DVGY 2KXJA 4PS3A 2MWSB 3K9PB 5CHVC 2LASA 4URKA 2C7HA 3QK0A 4I6NB 2C9WB 4EUTA 2KNBA 3KH0A 3W1SA 2LJ5A 2MBHA 3HM6X 5JHAA 4BFRA 2WWZA 4GXBA 4WWPA 4M0WB 2JY6A 3ENEA 2IZVB 2KLGA 4P7IA 3JW0X 2ZEQA 3HM3A 1Z5SB 2KFJA 2LGDA 3QIJA 4MDKE 2NVUI 3HIZA 1V6EA 3WAMA 3VH3B 2JRIB 3UIPB 3APFA 5GMVA 3MJWA 5JH5C 2DYBA 3LDZE 3ZIMA 3L16A 3X23A 2BYVE 2PE9A 2JRHA 2L3ZA 2LD9A 3S2AA 5LLIA 4DXAB 3V60A 2KO3A 1YJ1A 4W9EA 2CHZA 4HPMB 3BY4B 4N9F4 4W9HA 2XK5A 3A1QA 3RD2A 2CS4A 3UIOB 2HJ8A 3CMMB 4FHJA 4F1SA 5IA7A 1XQQA 4MJSB 4A20A 2DYMA 4YL8A 2PE6B 2Z0EB 3IFWB 1P3QU 5D7GA 5AEKB 3VTWA 2C7NB 2HTHA 3CSTA 2L8JA 3LJ3A 1L7YA 1WGGA 1WX9A 1WX8A 2LXCA 4HXDA 4W9DA 1KJTA 2CHWA 2ZVOA 3AI5A 5G2NA 3ZRCA 1H8CA 3SHQA 2FCQA 4NNJB 1WH3A 4ZRIA 3A4SC 4J6IA 2KLCA 2NPTB 3APDA 1WXVA 2PEAA 2O2VA 3DBRI 3H7SA 4LDTD 3QQ8B 3P2BA 2L76A 2DENB 2RPQA 2RSUA 3NOBA 4GDKA 1RAXA 2ZCBA 4BBNF 2MP2B 1GG3A 4ICVA 4B6WA 2JWZA 2J0KA 3L0WB 5DPRA 4FN2A 2L7RA 3JSVB 1R4NI 2ZCCA 3UF8A 3TL5A 3VTUA 5KHQA 2C7MB 3DBLI 4BOSC 2EMSA 3PREA 2UYZB 1YD8U 4LJPB 1P1AA 2GMIC 1Q0WB 3KUCB 3VUWA 4F8CB 1P0RA 4MH0E 2FCMA 3ECIA 2G4DB 2O6VD 3A9JA 3WAOA 1LXDA 4ZRJA 1C3TA 4NJ6A 3ZDMC 4PYZA 2RGFA 4FJVB 5LXHA 3VTVA 1WIAA 5TR5A 3DQVA 1V9JA 1M94A 2KFKA 3ZTCA 1SGHA 2LUEA 3Q3JA 3ZNHB 4GDLA 2B3AA 4EKUA 3TIXA 3A9KA 1V2YA 5AZGA 2V3SA 2K6DB 2KJHB 2GBMA 4FJYA 3ML9A 1KLVA 4KDLB 3WAPA 2LRUA 2MQJA 3AXCA 1E7UA 4K7SA 3NZUA 3JYUA 2FUHB 3PRPB 3DBHI 4B9KA 4DWFA 2JPHA 3Q3FA 4FLHA 1D3ZA 3M62B 4BVUC 4BKSD 2GBKA 4K1RB 2JXXA 2LVOA 1TGZB 2KANA 5DPTA 2MCNB 3VUXA 3EC8A 3M63B 4RMAA 2IY0B 4TUUA 2NBWB 3ALBA 3V6EB 2KC2A 3ZUNA 2M0XA 3SU8X 3HK0A 2BKFA 4GSWA 1WI0A 3H9DA 1K8RB 2FIDA 2KDBA 3JVZX 5J18A 1UZXB 4NY0A 1TBEA 2J7QB 2KDFB 1E5WA 2DAJA 4HLEA 3SD5A 4LCDE 2CR5A 1WF9A 1WM3A 2EMTA 4K81A 2LZ6A 2N4FA 1QZEA 5C1ZA 2KWUB 3N32A 4FA6A 2D11A 4MSQB 4EEWA 3RZWC 3ZNGC 1E90A 4MJSA 4EZJA 4TQ0A 1WRDB 2NCNA 2LI5A 4DDGD 1XT9B 3RUIB 5DPSA 1ZW7A 4XC2A 2N7EA 3R7RA 1WY8A 3RULA 4GIVA 2DZMA 4W9JA 1UELA 3MTNB 3V6CB 3GOEA 1KOTA 3R7QA 2G4SA 4I6PA 1EF1A 2NPTA 3H1UA 4XZ4A 4GOCA 1TZ1A 4ANUA 1E8YA 1V5TA 2BPSA 4HDOA 2LGYA 2J0JA 3K9OB 3ZLZA 3A33B 1L2NA 3PPAA 4KV2A 2MP2A 1IP9A 4GU2A 3TMPB 5EDSA 3BINA 2R2QA 3DBSA 2KQ7A 4LDTB 4TKNA 1P98A 4WJNA 2NBUA 4IW0A 2C5LC 3PS6A 2ZPNA 3VQIA 4K7WA 3JSVA 5DCNA 3U8ZA 5D94A 3WIMA 1GJZA 1RLFA 3DOWA 4X57B 1UH6A 5CHWA 3PSEB 3DVNV 1A5RA 5LXIB 1YX6B 1CMXB 1UD7A 2DZKA 2D07B 4IM2A 5IAAC 4KZCA 4B95A 1WM2A 3PLUA 2BF8B 2NBVB 3R3MA 5HKHA 1E7VA 2LXAA 4MGZE 1V86A 3ZKJC 4MGKE 4DHZB 1WGDA 4WWNA 1KM7A 2A5UA 4W9IA 3QC8B 4WJPA 1FXTB 2IO2B 2O6VB 4RM9A 2LVPA 4W9GA 3ZNID 2WYQA 1WXSA 4JQWC 4DHZE 3KVFB 3B0AA 4GN1A 2XEWA 4KZ0A 4FBJB 2KJRA 2M17A 4G50A 1S1QB 2KZRA 2BYEA 5CHFA 1V5OA 1WGYA 2K39A 2KX0A 4HPLB 2PPHA 3ZTDA 2N7DA 4JL9A 1UBIA 1V80A 2M1MA 4DDID 4TQ1A 2KVRA 2ZJDA 4EZKA 2FAZA 1Z2MA 4A3PA 2IYDB 4IWOA 4DHJD 2KOXA 2KC1A 3APCA 4MSMB 4JIOU 3RCZA 3CF6E 5E6OA 4E74A 5J2RA 1I42A 2RR9A 2MBEA 1PQSA 2JT4B 2KX3A 4NAWA 4M8NA 4KIKB 5D6JB 2G45B 4BKGA 5DPWA 5JZEB 5E6NA 2L05A 3DDCB 3PTFC 2K8CA 1OTRB 2JZZA 3HHMA 3NZSA 2EKEC 2DHZA 1Q5WB 2KWVB 3KUZA 2KN5A 3VHTC 4HK2A 4DBGA 3PT2B 2K8BA 3DVGX 1WYWB 2KD0A 3D32A 1WE6A 2W9NA 3V62A 4HWIB 3VDZA 1GNUA 1NI2A 1WFYA 1WR6E 4E3CA 4OVUA 4NQLB 4OVVA 2BKRB 3V61A 2OJRA 4PS7A 2ZZPB 2Z0DB 1ZKHA 2PJHA 2UWQA 3PV1A 4FULA 2MBQA 1TTNA 3U7DA 1H4RA 3W1YA 3KYCD 1VCBA 3WA0A 1LM8B 2MLBA 2GOWA 2L0FA 4GGQA 1RRBA 4PYUA 5E6PA 3VH4B 5L95C 3B08A 3M3JA 4II3B 1VD2A 1OQYA 3PGEA 4GMVA 3VAWA 1IYFA 4K7UA 2MRPA 4E71A 1WXAA 4RM8A 5AZFA 3UQAA 3PRZA 4IUMB 3VVWB 4G0NB 2KHWB 1E8XA 3KW5B 1E8WA 2WX0A 3L17A 1R4MI 4WQOB 1MG8A 2KWCA 2J0MA 4BOZB 1ZGUB 4HCNB 3B1LX 3DVNU 3VUYA 1WMHB 1WX7A 2L00B 2KDEB 4HJKA 4XX5A 4ZRKA 2D10A 1WZ3A 4TV3A 3X0WA 2KJ6A 5C23A 1C1YB 4CYEA 2Y5BB 1YQBA 2ZVNA 2MSED 2KKCA 3ZNZB 4JLCA 3AULA 3QA8A 4A3OA 2O6VA 2K25A 2FNJB 4G3XB 1LQBA 2K8HA 2V4LA 4AUQC 4ZDVA 1V81A 1WJ4A 5BO4B 2ASQA 3IHPC 2HE7A 2KMCA 3OJ3A 2BGFA
chains in the Genus database with same CATH superfamily
2LRWA 3U2SC 2N9PC 2D2QA 2FBWB 3Q8FA 4MM3A 1VJKA 1D6EC 1L4DB 3EHVA 3QJZA 4IM3A 2VH2A 3T8MA 4KGSA 2M8SA 3OJ4B 1DOYA 3N30A 2K6QA 2V3PA 2CJNA 3AE6B 3ZGZA 3H6NA 2QHOA 1RFAA 4M8MA 4C4VA 2D3GA 1MG4A 4OVZA 3DPDA 1Q10A 1YOVB 1QF6A 1QLBB 2R2OA 3TSSA 4KVGB 2MJEA 5LNK1 4AOFA 3W9CB 3QWZB 2KTFA 2LMCA 4M02A 1N61A 1R7SA 2WDVB 5J17A 2NS5A 4JGHB 4MGIE 3TBLD 2JVCA 1IGCA 4EZLA 3RNAC 1WXMA 3AU5A 4KGTA 1TJEA 1MVKA 3O13A 4A6QA 1PYWD 4A9AA 1RFKA 3PLVA 1IUEA 1LO5D 4US9A 3WANA 5CX3A 4HVBA 4IOIE 2BB6A 2BT6A 3KYDD 1SIFA 2NR2A 1WGHA 3P4RB 3PVLA 1YN5A 1NDDA 1MHXA 3L4PA 2AL3A 2MX2A 2LVQA 4YSXB 1I35A 1X1MA 1E7PB 4W9CA 1TZOA 4HDQA 4KDIC 1SE9A 3AU4A 1TS3A 2I1JA 5IP4D 1YX5B 1WJUA 1WJNA 3U30A 4ANWA 1I4PA 4MEMA 1EO6A 1OEYJ 1ZPSA 2REXA 4WAAA 1KTKA 2WXMA 1T0RC 1OFFA 3BYTB 2ON8A 2DZJA 4M01A 2G3QB 2KMAA 3RT3B 4HEA1 1P9DU 3SDLC 4OW0A 5FKAC 1YJJA 2KXJA 3B2GA 4HPPA 4I6NB 2C9WB 4EUTA 4A8XC 1ZOYB 1I4XA 3ZXVA 4M0WB 1A70A 2INDC 4WH4A 3ENEA 3IAM1 1F2RC 1J7AA 2JRIB 5BYRA 3UIPB 5JH5C 2JXTA 4ARIA 4DXAB 1ET9A 4HKQA 1TT5B 4ZHPA 1ROEA 4W9HA 3UIOB 3CMMB 4F1SA 4MJSB 2PE6B 1XEEA 1ZE3D 2C7NB 3CSTA 1L7YA 2QILA 1N63A 1WX8A 4W9DA 3AI5A 4OHJA 4L23A 4ZRIA 1WH3A 3A4SC 4J6IA 4NZLB 1YN3A 1WXVA 2PEAA 1MFWA 1BUIC 2DENB 4BBNF 2L7RA 4JPSA 4ZYSA 1FFVA 1CZPA 2BS2B 1CK1A 2C7MB 3DBLI 1FMAD 2UYZB 4RF0A 1JRPA 3KUCB 3VUWA 1LXDA 4XYCA 4NJ6A 2BS3B 1QOAA 2RGFA 2Y5PA 3VTVA 1WIAA 3TEYA 1DOXA 1M94A 3GE8C 5D3IB 5I4DA 2V3SA 2MHJA 1CJEA 1K52A 1PUTA 2K6DB 1DOIA 3WAPA 2MQJA 4K7SA 3NZUA 1K51A 1TIFA 3PRPB 1F52A 1EWYC 1PGBA 2OHFA 2JPHA 4H2AA 1L0XB 4BVUC 4BKSD 1ET6A 4M0WA 1TGZB 1E6EB 5BMGA 3SEBA 1V8CA 3H9DA 2IGDA 3P63A 2QJLA 4NY0A 2DAJA 4HLEA 2J53A 5BMIA 4A55A 5C1ZA 1ZDXA 2D11A 3RZWC 2MEKA 3ZNGC 3AEDB 5H8YE 4MJSA 1XT9B 4JWUC 1SE4A 1XXGA 2EELA 4OZBA 3V6CB 3GOEA 3RNFC 1KOTA 3R7QA 4I6PA 3VRBB 3H1UA 1TZ1A 1V5TA 4WAFA 3A33B 5FK9C 1L2NA 1E9MA 1IP9A 3TMPB 4HRSA 3DBSA 2KQ7A 3BK1A 4LDTB 4TKNA 1P98A 2BYTA 3VQIA 2ZPNA 3U8ZA 1BXTA 4WQMA 1P7FA 3ZJUA 3DVNV 3FAHA 2WS3B 1UD7A 4KZCA 5HKHA 2LXAA 4WWMA 2K0PA 5D3DA 1KM7A 4W9IA 5C2TB 3QC8B 4RM9A 2LVPA 3ZNID 2WYQA 1WXSA 2PVGC 2GI9A 4YT0B 3B0AA 4FBJB 1HZ6A 4AS1A 2KZRA 2BYEA 5CHFA 1YJIA 1D5MC 4HPLB 4JL9A 4DDID 2KVRA 4EZKA 2D5GA 4MSMB 3C19A 3Q69A 2YEPF 1XF5L 4CQNA 1PQSA 4KIKB 2G45B 5DPWA 2L52A 5JZEB 3URYA 1L6UA 2IJ0A 1OTRB 3VHTC 3PT2B 4DXFA 3DVGX 4YXDB 3N9YC 1WR6E 3V61A 2WXOA 1ZKHA 4FULA 3W1YA 1H4RA 3EA6A 2GOWA 3M3JA 3VAWA 4GMVA 1IYFA 4E71A 4C56C 3UQAA 3PRZA 4P1CC 4IUMB 4JX1C 4XWTA 2NTTA 1E8XA 2INCC 1YN4A 3KW5B 3J9CA 2J0MA 1VR9A 3MHZA 2LEKA 4HJKA 2KDEB 2D10A 4UDUC 2KJ6A 1UWMA 4CYEA 2FUG1 1AW7A 3UI3A 1YQBA 2PW9A 1FXAA 2KKCA 3TEXA 3AULA 5HFYA 4S17A 2B76B 1SF0A 4AUQC 2JYTA 4ZDVA 1V81A 5BO4B 1XLQA 2ASQA 1FCLA 4AP4C 3IAS1 2WQYB 1J0GA 1WJ6A 4W9FA 2KK8A 4CHKA 2JF5A 3TJPA 1VZ7A 3R2TA 3UGBB 2J42A 4IWPA 4NPNA 1N6ZA 4C80A 2QDFA 2IO0B 3OLMD 4DHJB 2IO1B 2L0TA 3I57A 4KIKA 4F7ZA 1QKZA 3R66C 1HTQA 3KUDB 1GUAB 2A4ZA 2GBJA 1KLGD 3VFKA 3M95A 2PKOA 1M4VA 1WXQA 2WXFA 2PMVA 2MA9B 1IPGA 1XD3B 1VLBA 3GZNB 4G11A 5AZHA 2JZ3B 2LWPA 1QILA 4EOYA 5IOIA 2KWDA 3N20C 1OGWA 3EFUA 1RWSA 1E8ZA 1Q1OA 1FNVA 2V9HA 3A4RA 2DZIA 1FO4A 2RD0A 1WE7A 1HZ5A 5JHBA 2K1FA 3T9LA 1EF5A 1N60A 1VDVA 3OWEB 3MP9A 2VZKD 1WGRA 2YLMA 2AX5A 2RMMA 2N1WA 5HI1A 5EE3A 2WX1A 3ONSA 4P1BC 2HD5B 4EE2A 4ANVA 2O2VB 3NY5A 3ML8A 4NQKE 3ZVVA 1KFYB 2RDHA 3AH7A 2H89B 1GC6A 3NS1A 2I2YA 3AE4B 3CSFA 1HE8A 3P42A 2AWTA 1KH0A 2N9EB 4KKIA 1OQRA 2BYFA 4ZOHC 2NTSA 2V3NA 3L13A 1JRUA 3RZFA 4WJOA 4NAWB 4FJZA 2JWUA 2VRRB 2X38A 3TCAA 3IVFA 4XWWA 1U4AA 3RN9C 3PHWB 2WDTB 1DGJA 1SE2A 2DX5B 3DBRB 3AEBB 3DVGY 2LASA 2RDBC 1KF6B 3ZYYX 1HA5A 1SEBD 3GB1A 1R4NB 2MBHA 2R61A 3HM6X 5JHAA 4BFRA 4GXBA 2LFIA 2IZVB 2KLGA 1K50A 4C7YA 2HJ1A 3P4PB 1PGXA 1Z5SB 3QIJA 4MDKE 1IBXB 1V6EA 3WAMA 3L16A 2V4IB 3B9JA 3X23A 2LGSA 2J52A 2PE9A 2L3ZA 3S2AA 4TSSA 1TKYA 1YJ1A 4W9EA 4TMAB 2MH7A 2CHZA 1TY2A 2JX5A 2CS4A 2DYMA 2Z0EB 1P3QU 1L0VB 2OJWA 4DQOC 2L8JA 4KX6B 5JXVA 1KJTA 4RH6A 3RNGC 4J3OD 2FCQA 5FR3A 1OQQA 3EUB2 2KLCA 3APDA 2O2VA 3KWVA 1NENB 2ZCBA 4B6WA 4L2YA 3NUHB 2JWZA 4YSYB 2J0KA 3L0WB 4FN2A 2WXPA 4XDCA 3UF8A 3TL5A 5KHQA 1JROA 1JWMD 1TS2A 3RFZB 4P16A 4BOSC 3PREA 2N9LA 4B0MA 3MFGA 3R2IA 4XGAB 1WSPA 2DNFA 1Q0WB 1P0RA 1L4ZB 1J7CA 2G4DB 2PLPA 4ZRJA 3ZDMC 4PYZA 4FJVB 4HKZE 1YQ3B 2G9HD 3ZTCA 3LXFA 3HUIA 1WGKA 3TIXA 1UUPA 4PT5A 5AZGA 5AUKA 4FJYA 3ML9A 1C78A 3AXCA 1E7UA 2SEBD 2FUHB 1D3ZA 4A90A 1JWUD 1F2RI 3VUXA 5C3JB 2IY0B 2NBWB 2KC2A 3ZUNA 3SU8X 1GAQB 1IBXA 2N9KA 4RGMA 3JVZX 5J18A 2J7QB 2N0SB 3SD5A 1WM3A 2WXGA 4K81A 4L1BA 1I4HA 2BBCA 2LZ6A 2N4FA 2KWUB 2PTLA 3DWGC 1D5XC 4TQ0A 2LI5A 1F1HA 1ZW7A 1ZUD2 2N7EA 1WY8A 1SB3C 2DZMA 1UELA 3MTNB 3AN1A 4XZ4A 2IGGA 5E6JA 3RMKC 2J0JA 5TSSA 4KV2A 3BINA 4O1NA 4IW0A 3PS6A 2MJ3A 3P1MA 2H88B 3DHHC 5LXIB 2D07B 4JE3B 4US8A 5EE1A 1WRIA 2WLBA 1FEHA 4MGZE 3ZKJC 4MGKE 1XO3A 1I4RA 3DHGC 4WWNA 2MJDA 1TY0A 1E0ZA 2M0AA 1FIQA 2K5PA 3AEAB 1S1QB 2K39A 3GS2A 2PPHA 4AQ7A 1PDXA 4LNIA 1V80A 4TQ1A 1Z2MA 4A3PA 4IWOA 2M19A 1YNTE 2KOXA 2M56B 5J2RA 2V0GA 1I42A 4YTNB 2JT4B 2KX3A 4M8NA 1YQ4B 1N62A 1D5ZC 3DDCB 3PTFC 3FC4A 3HHMA 2EKEC 4LNFA 3KUZA 4DBGA 3BIID 2KMMA 3D32A 4JWSC 3V62A 1NI2A 1WFYA 1SXTA 4NQLB 1UNSA 3AB5A 1XLOA 2ZZPB 2Z0DB 2MBQA 3U7DA 3KYCD 1LM8B 5EE9A 2L0FA 1RRBA 3VH4B 1YMHE 3B08A 4IDIA 1WXAA 4RM8A 4RF1A 5BYQA 3Q2AC 1BMLC 1ENFA 3OG5A 4XDDA 4BOZB 3AEGB 3B1LX 3VUYA 1WMHB 2L00B 1WZ3A 3X0WA 4HJGE 1FNUA 2X8XX 2W3SA 3ZNZB 4JLCA 3EFCA 1JCKB 3Q8EA 4K3CA 2FNJB 4G3XB 4RGNA 2K8HA 4QAYA 2V4LA 1WJ4A 3E56A 2W82A 3IHPC 2HE7A 4PS3A 3PHXB 1N5XA 3QCAA 4AJWA 3W1SC 2BWFA 2CU3A 1WR1A 1TS5A 2DLBA 2KDMA 4KSLC 2ZPYA 3E9SA 4BKSA 1F9JA 4BZAA 3RNEC 2AYOB 3L10B 2WXRA 2UU7A 3ZW3A 1V97A 2RPVA 4PS8A 2WU2B 1NBFC 3IBEA 2KTRB 1I4GA 4IM0A 2ZNVC 5CTRC 4W9KA 3PZDA 3AECB 1S3SG 3N1ZC 1L6VA 1YIWA 4IKGA 4D2KA 2LJIA 2INPE 5HG2A 2I1KA 1PGAA 3ZO5B 5L83A 2Y3AA 4RFBA 4C00A 2MBOA 1T0YA 3MHSD 1AWDA 3Q8CA 4N58A 3AEEB 1QOGA 1UF0A 4LNOA 4RNAA 3KLSX 3IG3A 3I9V1 2ZNVB 2ACZB 1V49A 1XCQL 2AL6A 3I63C 1T6BX 4ICUA 2XK5B 3A1QB 1NVID 4LTUA 2MBBB 1J8CA 3N3KB 3AMZA 2Y5CA 2BWES 2YVCA 2IY1B 4ANXA 1MPEA 3AM9A 5KHOA 2I38A 1WMHA 4MT5A 2IO3B 3L08A 2LUMA 4DXGA 4IC7B 3V05A 3LYYA 1FRDA 3ZRFA 3L54A 3MC9A 2CHXA 1FCCC 1XLPA 1AARA 4LLGM 3QX1A 3CIRB 2AEHA 1J7BA 3RNBC 3FKYA 1T3QA 4ZRQA 4DK5A 3NJTA 4II2B 3GZNI 2N1VA 1LFDA 2KACA 3ZDTA 2WXJA 4MGYE 2KFKB 2FCSA 3NVVA 1SE3A 4GDLB 2CU1A 4HCPB 5D2MB 3A9KB 2KTRA 2MWSB 4URKA 2C7HA 2RDGA 2KNBA 3KH0A 3W1SA 2QC8A 2LJ5A 2WWZA 4WWPA 4P7IA 3NVWA 4MH8A 2JYEA 2ZEQA 4NAMA 3HIZA 3Q8AA 3HRDD 5GMVA 3MJWA 2E6XA 2BYVE 3I5JC 1V1OA 5T8IA 2LD9A 5LLIA 1K53A 3BY4B 4N9F4 3RD2A 2XK5A 3A1QA 3U4EG 2HJ8A 1ACCA 5IA7A 4A20A 1TS4A 2QSDA 1SIJA 5D7GA 5AEKB 3VTWA 2HTHA 2LXCA 4HXDA 2JQRB 2VH1A 3DBHB 2CHWA 1QT9A 2VZKB 2ZVOA 3SHQA 3LB8C 2GRIA 3RNCC 2NPTB 3DBRI 3H7SA 3QQ8B 3P2BA 5BYSA 1RAXA 4N59A 5DPRA 3JSVB 1R4NI 2ZCCA 2JSVX 1VZ6A 1F77A 2GMIC 1SSNA 3Q6BA 2FCMA 2O6VD 1C3TA 5LXHA 5TR5A 3DQVA 1I7HA 1T5XD 2KFKA 3AE1B 2LUEA 3Q3JA 4GDLA 2B3AA 1NI3A 4EKUA 3A9KA 3BWUD 2KJHB 2L32A 2LRUA 3JYUA 4B9KA 4DWFA 3NG0A 2EKIA 3M62B 1HTOA 4K1RB 3EC8A 4TUUA 3V6EB 2M0XA 3NZ3A 3HK0A 4GSWA 5IKCM 1E10A 1K8RB 2KDBA 3BK2A 3AE5B 1UZXB 1TBEA 1E5WA 3W2DA 4LCDE 2CR5A 1WF9A 2PIAA 1QZEA 3AE8B 3N1XC 4FA6A 1WWTA 4MSQB 4WIPA 4EEWA 1E90A 4EZJA 2NCNA 4DDGD 1C4AA 3RUIB 5DPSA 4XC2A 3RULA 1VZ8A 4GIVA 2G4SA 1EF1A 2NPTA 2L83A 4ANUA 2LGYA 3K9OB 1RYJA 3Q3NC 2E3TA 3NRZA 2NBUA 5G5GA 2C5LC 2QMTA 2LGIA 3JSVA 5DCNA 5D94A 3WIMA 3PO0A 4X57B 1UH6A 3PSEB 2DZKA 1CMXB 4IM2A 5H92C 1KLUD 3PLUA 3R3MA 1JWBD 4C7ZA 1UGJA 1NYRA 1V86A 4RGTA 1WGDA 3AE7B 2WXLA 2A5UA 1V1PB 3ZQ4A 1FXTB 2IO2B 4W9GA 4JQWC 4DHZE 3TUOA 4GN1A 4YSZB 2KJRA 2M17A 1QOBA 1WGYA 3KQ4A 2KX0A 1RM6C 4OZAA 2M1MA 2CJOA 2ZJDA 1R4MB 2FAZA 2IYDB 2KC1A 4JIOU 4YTMB 3CF6E 5E6OA 4NAWA 5D6JB 1HEZE 2BVCA 3GE3C 3TEWA 2W54A 2K8CA 2JZZA 1L0YB 2WXQA 2KWVB 4HK2A 2K8BA 1WYWB 2KD0A 4WURA 2W9NA 1GOZA 5IN7A 1ZDVA 3VDZA 2BKRB 2OJRA 4ITKA 2PJHA 3PV1A 1JWSD 2WDRB 1VCBA 3AE9B 4GGQA 4PYUA 2Q5WD 1VD2A 2IDYA 1WYGA 3N1YC 2MRPA 1ZXIA 4K7UA 5AZFA 1N5WA 1QQRA 1HXYD 3KWLA 2AQ3B 4G0NB 2KHWB 2FE8A 1EM7A 1E8WA 2WX0A 4WQOB 1MG8A 3SR6A 2KWCA 3AE2B 3ABVB 1ZGUB 4HCNB 5IO9A 3DVNU 1WX7A 4XX5A 4ZRKA 1C1YB 4LK0M 2KVZA 2ZVNA 2MSED 1V1PA 2WU5B 3T3OA 3QA8A 4A3OA 1LQBA 3PZ8A 5BMHA 3OJ3A 2BGFA 3B2FA 1NEKB 2DAFA 5G55A 2V1YA 2HTME 4N6EB 2M4NA 1TKEA 3NS8A 2Z59B 3P4QB 1JMLA 2GBRA 2W3RA 3SFEB 3AEFB 1PFDA 3RI7C 3U7ZA 3C0RB 1EUVB 3H7PB 4M00A 3EECA 3DCGA 4BBNC 1XLNA 1ZP0B 3VXWA 4I6LB 3GP7A 4KSKC 1FFUA 2DYOA 2FCNA 2JUOA 2WXHA 2KQSA 1Y56A 2KDIA 4ACFA 3QARA 4WWOA 4GLSC 2MW5A 3O65B 4WJQA 3DWMA 1MI0A 4CO7A 3VRAB 1JWAD 3NHEB 2LGXA 1FD6A 4BKTA 3W5VB 4ASWC 2IBIB 1TYGB 2C60A 1Y8RC 3PRMB 1J19A 3QHTA 4FHKA 3UQBA 2D3BA 1MJDA 2FIFA 1BT0A 4ZYNA 3UINB 2XBBC 2CKHB 1IGDA 3BZDB 2QEJC 3QAQA 3MJ5A 4LJOB 1GC7A 3HVDA 2IPKD 4AJYB 3I3TB 1OEYA 4USAA 4ARCA 4AWJA 2GBNA 4GB9A 4IWQA 2W55A 4GDKB 3FILB 1ESFA 1UGMA 1G6JA 5FR6A 1VRAB 4EFOA 2N9XA 3OAWA 1WZ0A 4KGRA 3ZJVA 2ZW1A 1T0SC 4NJ7A 1ISNA 3ETRA 3WALA 3RYTA 2OOBB 1UBQA 5MPOA 4FADA 5G5HA 4W9LA 3A9JB 3ZXRA 3H7PA 3EGRA 4IG7B 3BVMA 4BAXA 2K3UA 2K22A 3SFDB 2JZPA 4MELA 2K9XA 1JW9D 3K9PB 5CHVC 3QK0A 1MHHE 1GB1A 3VR8B 2WXNA 3HVZA 1GB4A 1GPXA 2D3CA 2KT7A 2JY6A 3DBLB 3JW0X 3BVGA 3HM3A 2KFJA 2LGDA 2NVUI 3VH3B 3APFA 2DYBA 3LDZE 3ZIMA 1QOFA 3NVYA 2JRHA 2KQ4X 3NVZA 3TEZA 3V60A 2KO3A 4HPMB 4RGOS 1C76A 4FHJA 1XQQA 4YL8A 2PVOD 3IFWB 4XE0A 3V3XA 3WCQA 3LJ3A 1WGGA 1WX9A 5G2NA 1H8CA 4PK1A 3ZRCA 4NNJB 3MC0B 2GLSA 1C9FA 1I4QA 4LDTD 1FPYA 2L76A 2RPQA 2RSUA 3NOBA 4GDKA 1EU3A 3FILA 4OZCA 2MP2B 1GG3A 2IGHA 4ICVA 3Q14C 1D4BA 4YTPB 3VTUA 2YEPB 2EMSA 2LHDA 3AE3B 1YD8U 1TKGA 1P1AA 4LJPB 5HHDG 1B1ZA 2XNAC 4F8CB 2SAKA 4MH0E 1F0ZA 3ECIA 1C79A 2OEDA 3A9JA 3WAOA 1V9JA 1SGHA 3ZNHB 1UWXA 1V2YA 2GBMA 1KLVA 4KDLB 1STEA 1JALA 3VR9B 3DBHI 4FLHA 3Q3FA 1FXIA 3IT6B 2GBKA 2JXXA 2D3AA 2LVOA 2KANA 5DPTA 2MCNB 4RMAA 3M63B 4LNKA 4HROA 3ALBA 2BKFA 1WI0A 2FIDA 2KDFB 4ZHOA 3Q3MC 4Q2JA 2EMTA 3T3NA 2WGSA 3IT4B 3N32A 2ONQA 1SJED 2KAJA 1WRDB 2Z8LA 3BYYB 1JQ4A 3R7RA 2J4XA 4W9JA 3C8YA 2NMQA 1T0QC 4GOCA 1E8YA 1AYFA 2BPSA 3PZ7A 2ICIA 4HDOA 1HQRD 3ZLZA 3H8HA 3PPAA 2BB5A 2MP2A 3ZJTA 1C4CA 4GU2A 5EDSA 2XN9C 2R2QA 5GXGB 2G1EA 4WJNA 4K7WA 3R8BA 1GJZA 1RLFA 3DOWA 5CHWA 3P4SB 1XCTL 4B0EA 1A5RA 2JU6X 1YX6B 5IAAC 4B95A 1WM2A 2BF8B 1C77A 2NBVB 1E7VA 1FM0D 3Q3OC 4DHZB 3Q8BA 1B9RA 3IXSA 4WJPA 2O6VB 5EE0A 2WP9B 3KVFB 2XEWA 4KZ0A 2AQ1B 4G50A 1DYQA 1V5OA 1EU4A 3ZTDA 2INNE 2N7DA 4MM3B 1UBIA 2BW2A 4K3BA 4P6VF 2TSSA 2LHEA 4DHJD 1AN8A 3APCA 3RCZA 4E74A 1SJHD 2QCZA 1SBBB 1LGRA 2MBEA 2RR9A 4BKGA 1ZXHA 2GB1A 4FXCA 4C4VB 5E6NA 1L5PA 1EWCA 2L05A 1NYQA 2WXKA 4RCOA 3NZSA 4ZRPA 2HDEA 2DHZA 1Q5WB 2KN5A 2WXIA 4S0RA 1WE6A 4HWIB 2WDQB 1GNUA 4LNNA 4E3CA 2BQQA 4OVUA 4OVVA 4MACA 3MC8A 2BTEA 4PS7A 2UWQA 4KKJA 1TTNA 2N7JA 3WA0A 2MLBA 2QIEB 4NJCA 3W5UB 4R3DA 5E6PA 5L95C 2L1AA 4REZA 2ZW0A 4II3B 1OQYA 3PGEA 2BS4B 2KYWA 1FRRA 3VVWB 1P7EA 3RPFC 3DHIC 2WNMA 1FNWA 1C4PA 2AQ2B 3L17A 1R4MI 2KN4A 1CQVA 3CWIA 5AUIA 4TV3A 2DBYA 3BVZA 5C23A 1KRHA 2Y5BB 3AV8A 3U52E 2WHIA 4YWGG 2O6VA 2K25A 2DWQA 2KMCA
chains in the Genus database with same CATH topology
1J0GA 2LRWA 1WJ6A 2DAFA 3PHXB 2N9PC 2D2QA 2KK8A 4W9FA 4CHKA 2JF5A 3QCAA 5G55A 4AJWA 3TJPA 4MM3A 3UGBB 2V1YA 3W1SC 2M4NA 3EHVA 2BWFA 4IWPA 1WR1A 3QJZA 3NS8A 2Z59B 4NPNA 4IM3A 2GBRA 3T8MA 2M8SA 3C0RB 3OJ4B 4KSLC 2ZPYA 1EUVB 3N30A 2IO0B 3H7PB 2K6QA 3OLMD 3EECA 2IO1B 1F9JA 3DCGA 4BBNC 2L0TA 4BKSA 4DHJB 3H6NA 2QHOA 3VXWA 4KIKA 1RFAA 2AYOB 4I6LB 3L10B 4M8MA 2D3GA 3ZW3A 4F7ZA 3R66C 3DPDA 4KSKC 4PS8A 1NBFC 2DYOA 2FCNA 2JUOA 3IBEA 3KUDB 2KTRB 2KQSA 1GUAB 2R2OA 4IM0A 2ZNVC 5CTRC 4KVGB 2KDIA 4W9KA 2A4ZA 3PZDA 3QARA 4WWOA 2MW5A 1S3SG 2GBJA 3O65B 4WJQA 3VFKA 3M95A 4AOFA 1YIWA 3QWZB 2KTFA 2I1KA 4CO7A 3ZO5B 3NHEB 2MA9B 5L83A 2LGXA 1IPGA 1XD3B 4BKTA 4G11A 5AZHA 2MBOA 1T0YA 5J17A 2JZ3B 2NS5A 3MHSD 2LWPA 4JGHB 4MGIE 4EOYA 3TBLD 4ASWC 2IBIB 2C60A 2JVCA 1Y8RC 4EZLA 1WXMA 3AU5A 3PRMB 1OGWA 1J19A 3EFUA 1E8ZA 3IG3A 1Q1OA 3QHTA 3A4RA 4FHKA 3UQBA 2ZNVB 3PLVA 2DZIA 3WANA 1V49A 2AL6A 2FIFA 5CX3A 4ICUA 4HVBA 2RD0A 2XK5B 3A1QB 1BT0A 1WE7A 3KYDD 5JHBA 2K1FA 3T9LA 1EF5A 4ZYNA 2MBBB 3UINB 1SIFA 2NR2A 1WGHA 2CKHB 2XBBC 3N3KB 3PVLA 2BWES 1J8CA 1NDDA 1WGRA 2YVCA 2IY1B 4ANXA 2YLMA 5KHOA 2AL3A 2MX2A 1WMHA 2LVQA 3QAQA 4LJOB 2N1WA 1I35A 1X1MA 4W9CA 1GC7A 2IO3B 2WX1A 3ONSA 3L08A 4HDQA 4IC7B 2HD5B 4KDIC 3I3TB 4AJYB 1OEYA 1SE9A 3AU4A 4AWJA 4ANVA 2I1JA 2O2VB 2GBNA 1YX5B 3ML8A 3NY5A 4GB9A 4IWQA 1WJUA 1WJNA 4GDKB 3U30A 3ZRFA 3L54A 4ANWA 4NQKE 1UGMA 4MEMA 1G6JA 5FR6A 2CHXA 1EO6A 1OEYJ 3ZVVA 2REXA 4EFOA 2N9XA 3OAWA 4WAAA 1WZ0A 1AARA 1GC6A 3QX1A 3CSFA 1HE8A 2AEHA 2AWTA 4NJ7A 4DK5A 2N9EB 1ISNA 3WALA 3RYTA 4II2B 2BYFA 3GZNI 2N1VA 1UBQA 1LFDA 2OOBB 3L13A 3ZDTA 4FADA 4AP4C 1JRUA 4W9LA 3RZFA 4WJOA 4NAWB 3A9JB 2DZJA 4FJZA 2G3QB 4MGYE 3H7PA 2VRRB 2KMAA 4IG7B 3RT3B 3TCAA 3IVFA 1U4AA 1P9DU 2KFKB 2FCSA 3SDLC 3PHWB 2WDTB 4MELA 5D2MB 2DX5B 2CU1A 4GDLB 4HCPB 3A9KB 2KTRA 3DVGY 2KXJA 4PS3A 2MWSB 3K9PB 5CHVC 2LASA 4URKA 2C7HA 3QK0A 4I6NB 2C9WB 4EUTA 2KNBA 3KH0A 3W1SA 2LJ5A 2MBHA 3HM6X 5JHAA 4BFRA 2WWZA 4GXBA 4WWPA 4M0WB 2JY6A 3ENEA 2IZVB 2KLGA 4P7IA 3JW0X 2ZEQA 3HM3A 1Z5SB 2KFJA 2LGDA 3QIJA 4MDKE 2NVUI 3HIZA 1V6EA 3WAMA 3VH3B 2JRIB 3UIPB 3APFA 5GMVA 3MJWA 5JH5C 2DYBA 3LDZE 3ZIMA 3L16A 3X23A 2BYVE 2PE9A 2JRHA 2L3ZA 2LD9A 3S2AA 5LLIA 4DXAB 3V60A 2KO3A 1YJ1A 4W9EA 2CHZA 4HPMB 3BY4B 4N9F4 4W9HA 2XK5A 3A1QA 3RD2A 2CS4A 3UIOB 2HJ8A 3CMMB 4FHJA 4F1SA 5IA7A 1XQQA 4MJSB 4A20A 2DYMA 4YL8A 2PE6B 2Z0EB 3IFWB 1P3QU 5D7GA 5AEKB 3VTWA 2C7NB 2HTHA 3CSTA 2L8JA 3LJ3A 1L7YA 1WGGA 1WX9A 1WX8A 2LXCA 4HXDA 4W9DA 1KJTA 2CHWA 2ZVOA 3AI5A 5G2NA 3ZRCA 1H8CA 3SHQA 2FCQA 4NNJB 1WH3A 4ZRIA 3A4SC 4J6IA 2KLCA 2NPTB 3APDA 1WXVA 2PEAA 2O2VA 3DBRI 3H7SA 4LDTD 3QQ8B 3P2BA 2L76A 2DENB 2RPQA 2RSUA 3NOBA 4GDKA 1RAXA 2ZCBA 4BBNF 2MP2B 1GG3A 4ICVA 4B6WA 2JWZA 2J0KA 3L0WB 5DPRA 4FN2A 2L7RA 3JSVB 1R4NI 2ZCCA 3UF8A 3TL5A 3VTUA 5KHQA 2C7MB 3DBLI 4BOSC 2EMSA 3PREA 2UYZB 1YD8U 4LJPB 1P1AA 2GMIC 1Q0WB 3KUCB 3VUWA 4F8CB 1P0RA 4MH0E 2FCMA 3ECIA 2G4DB 2O6VD 3A9JA 3WAOA 1LXDA 4ZRJA 1C3TA 4NJ6A 3ZDMC 4PYZA 2RGFA 4FJVB 5LXHA 3VTVA 1WIAA 5TR5A 3DQVA 1V9JA 1M94A 2KFKA 3ZTCA 1SGHA 2LUEA 3Q3JA 3ZNHB 4GDLA 2B3AA 4EKUA 3TIXA 3A9KA 1V2YA 5AZGA 2V3SA 2K6DB 2KJHB 2GBMA 4FJYA 3ML9A 1KLVA 4KDLB 3WAPA 2LRUA 2MQJA 3AXCA 1E7UA 4K7SA 3NZUA 3JYUA 2FUHB 3PRPB 3DBHI 4B9KA 4DWFA 2JPHA 3Q3FA 4FLHA 1D3ZA 3M62B 4BVUC 4BKSD 2GBKA 4K1RB 2JXXA 2LVOA 1TGZB 2KANA 5DPTA 2MCNB 3VUXA 3EC8A 3M63B 4RMAA 2IY0B 4TUUA 2NBWB 3ALBA 3V6EB 2KC2A 3ZUNA 2M0XA 3SU8X 3HK0A 2BKFA 4GSWA 1WI0A 3H9DA 1K8RB 2FIDA 2KDBA 3JVZX 5J18A 1UZXB 4NY0A 1TBEA 2J7QB 2KDFB 1E5WA 2DAJA 4HLEA 3SD5A 4LCDE 2CR5A 1WF9A 1WM3A 2EMTA 4K81A 2LZ6A 2N4FA 1QZEA 5C1ZA 2KWUB 3N32A 4FA6A 2D11A 4MSQB 4EEWA 3RZWC 3ZNGC 1E90A 4MJSA 4EZJA 4TQ0A 1WRDB 2NCNA 2LI5A 4DDGD 1XT9B 3RUIB 5DPSA 1ZW7A 4XC2A 2N7EA 3R7RA 1WY8A 3RULA 4GIVA 2DZMA 4W9JA 1UELA 3MTNB 3V6CB 3GOEA 1KOTA 3R7QA 2G4SA 4I6PA 1EF1A 2NPTA 3H1UA 4XZ4A 4GOCA 1TZ1A 4ANUA 1E8YA 1V5TA 2BPSA 4HDOA 2LGYA 2J0JA 3K9OB 3ZLZA 3A33B 1L2NA 3PPAA 4KV2A 2MP2A 1IP9A 4GU2A 3TMPB 5EDSA 3BINA 2R2QA 3DBSA 2KQ7A 4LDTB 4TKNA 1P98A 4WJNA 2NBUA 4IW0A 2C5LC 3PS6A 2ZPNA 3VQIA 4K7WA 3JSVA 5DCNA 3U8ZA 5D94A 3WIMA 1GJZA 1RLFA 3DOWA 4X57B 1UH6A 5CHWA 3PSEB 3DVNV 1A5RA 5LXIB 1YX6B 1CMXB 1UD7A 2DZKA 2D07B 4IM2A 5IAAC 4KZCA 4B95A 1WM2A 3PLUA 2BF8B 2NBVB 3R3MA 5HKHA 1E7VA 2LXAA 4MGZE 1V86A 3ZKJC 4MGKE 4DHZB 1WGDA 4WWNA 1KM7A 2A5UA 4W9IA 3QC8B 4WJPA 1FXTB 2IO2B 2O6VB 4RM9A 2LVPA 4W9GA 3ZNID 2WYQA 1WXSA 4JQWC 4DHZE 3KVFB 3B0AA 4GN1A 2XEWA 4KZ0A 4FBJB 2KJRA 2M17A 4G50A 1S1QB 2KZRA 2BYEA 5CHFA 1V5OA 1WGYA 2K39A 2KX0A 4HPLB 2PPHA 3ZTDA 2N7DA 4JL9A 1UBIA 1V80A 2M1MA 4DDID 4TQ1A 2KVRA 2ZJDA 4EZKA 2FAZA 1Z2MA 4A3PA 2IYDB 4IWOA 4DHJD 2KOXA 2KC1A 3APCA 4MSMB 4JIOU 3RCZA 3CF6E 5E6OA 4E74A 5J2RA 1I42A 2RR9A 2MBEA 1PQSA 2JT4B 2KX3A 4NAWA 4M8NA 4KIKB 5D6JB 2G45B 4BKGA 5DPWA 5JZEB 5E6NA 2L05A 3DDCB 3PTFC 2K8CA 1OTRB 2JZZA 3HHMA 3NZSA 2EKEC 2DHZA 1Q5WB 2KWVB 3KUZA 2KN5A 3VHTC 4HK2A 4DBGA 3PT2B 2K8BA 3DVGX 1WYWB 2KD0A 3D32A 1WE6A 2W9NA 3V62A 4HWIB 3VDZA 1GNUA 1NI2A 1WFYA 1WR6E 4E3CA 4OVUA 4NQLB 4OVVA 2BKRB 3V61A 2OJRA 4PS7A 2ZZPB 2Z0DB 1ZKHA 2PJHA 2UWQA 3PV1A 4FULA 2MBQA 1TTNA 3U7DA 1H4RA 3W1YA 3KYCD 1VCBA 3WA0A 1LM8B 2MLBA 2GOWA 2L0FA 4GGQA 1RRBA 4PYUA 5E6PA 3VH4B 5L95C 3B08A 3M3JA 4II3B 1VD2A 1OQYA 3PGEA 4GMVA 3VAWA 1IYFA 4K7UA 2MRPA 4E71A 1WXAA 4RM8A 5AZFA 3UQAA 3PRZA 4IUMB 3VVWB 4G0NB 2KHWB 1E8XA 3KW5B 1E8WA 2WX0A 3L17A 1R4MI 4WQOB 1MG8A 2KWCA 2J0MA 4BOZB 1ZGUB 4HCNB 3B1LX 3DVNU 3VUYA 1WMHB 1WX7A 2L00B 2KDEB 4HJKA 4XX5A 4ZRKA 2D10A 1WZ3A 4TV3A 3X0WA 2KJ6A 5C23A 1C1YB 4CYEA 2Y5BB 1YQBA 2ZVNA 2MSED 2KKCA 3ZNZB 4JLCA 3AULA 3QA8A 4A3OA 2O6VA 2K25A 2FNJB 4G3XB 1LQBA 2K8HA 2V4LA 4AUQC 4ZDVA 1V81A 1WJ4A 5BO4B 2ASQA 3IHPC 2HE7A 2KMCA 3OJ3A 2BGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J0G A;  2LRW A;  1WJ6 A;  2DAF A;  3PHX B;  2N9P C;  2D2Q A;  2KK8 A;  4W9F A;  4CHK A;  2JF5 A;  3QCA A;  5G55 A;  4AJW A;  3TJP A;  4MM3 A;  3UGB B;  2V1Y A;  3W1S C;  2M4N A;  3EHV A;  2BWF A;  4IWP A;  1WR1 A;  3QJZ A;  3NS8 A;  2Z59 B;  4NPN A;  4IM3 A;  2GBR A;  3T8M A;  2M8S A;  3C0R B;  3OJ4 B;  4KSL C;  2ZPY A;  1EUV B;  3N30 A;  2IO0 B;  3H7P B;  2K6Q A;  3OLM D;  3EEC A;  2IO1 B;  1F9J A;  3DCG A;  4BBN C;  2L0T A;  4BKS A;  4DHJ B;  3H6N A;  2QHO A;  3VXW A;  4KIK A;  1RFA A;  2AYO B;  4I6L B;  3L10 B;  4M8M A;  2D3G A;  3ZW3 A;  4F7Z A;  3R66 C;  3DPD A;  4KSK C;  4PS8 A;  1NBF C;  2DYO A;  2FCN A;  2JUO A;  3IBE A;  3KUD B;  2KTR B;  2KQS A;  1GUA B;  2R2O A;  4IM0 A;  2ZNV C;  5CTR C;  4KVG B;  2KDI A;  4W9K A;  2A4Z A;  3PZD A;  3QAR A;  4WWO A;  2MW5 A;  1S3S G;  2GBJ A;  3O65 B;  4WJQ A;  3VFK A;  3M95 A;  4AOF A;  1YIW A;  3QWZ B;  2KTF A;  2I1K A;  4CO7 A;  3ZO5 B;  3NHE B;  2MA9 B;  5L83 A;  2LGX A;  1IPG A;  1XD3 B;  4BKT A;  4G11 A;  5AZH A;  2MBO A;  1T0Y A;  5J17 A;  2JZ3 B;  2NS5 A;  3MHS D;  2LWP A;  4JGH B;  4MGI E;  4EOY A;  3TBL D;  4ASW C;  2IBI B;  2C60 A;  2JVC A;  1Y8R C;  4EZL A;  1WXM A;  3AU5 A;  3PRM B;  1OGW A;  1J19 A;  3EFU A;  1E8Z A;  3IG3 A;  1Q1O A;  3QHT A;  3A4R A;  4FHK A;  3UQB A;  2ZNV B;  3PLV A;  2DZI A;  3WAN A;  1V49 A;  2AL6 A;  2FIF A;  5CX3 A;  4ICU A;  4HVB A;  2RD0 A;  2XK5 B;  3A1Q B;  1BT0 A;  1WE7 A;  3KYD D;  5JHB A;  2K1F A;  3T9L A;  1EF5 A;  4ZYN A;  2MBB B;  3UIN B;  1SIF A;  2NR2 A;  1WGH A;  2CKH B;  2XBB C;  3N3K B;  3PVL A;  2BWE S;  1J8C A;  1NDD A;  1WGR A;  2YVC A;  2IY1 B;  4ANX A;  2YLM A;  5KHO A;  2AL3 A;  2MX2 A;  1WMH A;  2LVQ A;  3QAQ A;  4LJO B;  2N1W A;  1I35 A;  1X1M A;  4W9C A;  1GC7 A;  2IO3 B;  2WX1 A;  3ONS A;  3L08 A;  4HDQ A;  4IC7 B;  2HD5 B;  4KDI C;  3I3T B;  4AJY B;  1OEY A;  1SE9 A;  3AU4 A;  4AWJ A;  4ANV A;  2I1J A;  2O2V B;  2GBN A;  1YX5 B;  3ML8 A;  3NY5 A;  4GB9 A;  4IWQ A;  1WJU A;  1WJN A;  4GDK B;  3U30 A;  3ZRF A;  3L54 A;  4ANW A;  4NQK E;  1UGM A;  4MEM A;  1G6J A;  5FR6 A;  2CHX A;  1EO6 A;  1OEY J;  3ZVV A;  2REX A;  4EFO A;  2N9X A;  3OAW A;  4WAA A;  1WZ0 A;  1AAR A;  1GC6 A;  3QX1 A;  3CSF A;  1HE8 A;  2AEH A;  2AWT A;  4NJ7 A;  4DK5 A;  2N9E B;  1ISN A;  3WAL A;  3RYT A;  4II2 B;  2BYF A;  3GZN I;  2N1V A;  1UBQ A;  1LFD A;  2OOB B;  3L13 A;  3ZDT A;  4FAD A;  4AP4 C;  1JRU A;  4W9L A;  3RZF A;  4WJO A;  4NAW B;  3A9J B;  2DZJ A;  4FJZ A;  2G3Q B;  4MGY E;  3H7P A;  2VRR B;  2KMA A;  4IG7 B;  3RT3 B;  3TCA A;  3IVF A;  1U4A A;  1P9D U;  2KFK B;  2FCS A;  3SDL C;  3PHW B;  2WDT B;  4MEL A;  5D2M B;  2DX5 B;  2CU1 A;  4GDL B;  4HCP B;  3A9K B;  2KTR A;  3DVG Y;  2KXJ A;  4PS3 A;  2MWS B;  3K9P B;  5CHV C;  2LAS A;  4URK A;  2C7H A;  3QK0 A;  4I6N B;  2C9W B;  4EUT A;  2KNB A;  3KH0 A;  3W1S A;  2LJ5 A;  2MBH A;  3HM6 X;  5JHA A;  4BFR A;  2WWZ A;  4GXB A;  4WWP A;  4M0W B;  2JY6 A;  3ENE A;  2IZV B;  2KLG A;  4P7I A;  3JW0 X;  2ZEQ A;  3HM3 A;  1Z5S B;  2KFJ A;  2LGD A;  3QIJ A;  4MDK E;  2NVU I;  3HIZ A;  1V6E A;  3WAM A;  3VH3 B;  2JRI B;  3UIP B;  3APF A;  5GMV A;  3MJW A;  5JH5 C;  2DYB A;  3LDZ E;  3ZIM A;  3L16 A;  3X23 A;  2BYV E;  2PE9 A;  2JRH A;  2L3Z A;  2LD9 A;  3S2A A;  5LLI A;  4DXA B;  3V60 A;  2KO3 A;  1YJ1 A;  4W9E A;  2CHZ A;  4HPM B;  3BY4 B;  4N9F 4;  4W9H A;  2XK5 A;  3A1Q A;  3RD2 A;  2CS4 A;  3UIO B;  2HJ8 A;  3CMM B;  4FHJ A;  4F1S A;  5IA7 A;  1XQQ A;  4MJS B;  4A20 A;  2DYM A;  4YL8 A;  2PE6 B;  2Z0E B;  3IFW B;  1P3Q U;  5D7G A;  5AEK B;  3VTW A;  2C7N B;  2HTH A;  3CST A;  2L8J A;  3LJ3 A;  1L7Y A;  1WGG A;  1WX9 A;  1WX8 A;  2LXC A;  4HXD A;  4W9D A;  1KJT A;  2CHW A;  2ZVO A;  3AI5 A;  5G2N A;  3ZRC A;  1H8C A;  3SHQ A;  2FCQ A;  4NNJ B;  1WH3 A;  4ZRI A;  3A4S C;  4J6I A;  2KLC A;  2NPT B;  3APD A;  1WXV A;  2PEA A;  2O2V A;  3DBR I;  3H7S A;  4LDT D;  3QQ8 B;  3P2B A;  2L76 A;  2DEN B;  2RPQ A;  2RSU A;  3NOB A;  4GDK A;  1RAX A;  2ZCB A;  4BBN F;  2MP2 B;  1GG3 A;  4ICV A;  4B6W A;  2JWZ A;  2J0K A;  3L0W B;  5DPR A;  4FN2 A;  2L7R A;  3JSV B;  1R4N I;  2ZCC A;  3UF8 A;  3TL5 A;  3VTU A;  5KHQ A;  2C7M B;  3DBL I;  4BOS C;  2EMS A;  3PRE A;  2UYZ B;  1YD8 U;  4LJP B;  1P1A A;  2GMI C;  1Q0W B;  3KUC B;  3VUW A;  4F8C B;  1P0R A;  4MH0 E;  2FCM A;  3ECI A;  2G4D B;  2O6V D;  3A9J A;  3WAO A;  1LXD A;  4ZRJ A;  1C3T A;  4NJ6 A;  3ZDM C;  4PYZ A;  2RGF A;  4FJV B;  5LXH A;  3VTV A;  1WIA A;  5TR5 A;  3DQV A;  1V9J A;  1M94 A;  2KFK A;  3ZTC A;  1SGH A;  2LUE A;  3Q3J A;  3ZNH B;  4GDL A;  2B3A A;  4EKU A;  3TIX A;  3A9K A;  1V2Y A;  5AZG A;  2V3S A;  2K6D B;  2KJH B;  2GBM A;  4FJY A;  3ML9 A;  1KLV A;  4KDL B;  3WAP A;  2LRU A;  2MQJ A;  3AXC A;  1E7U A;  4K7S A;  3NZU A;  3JYU A;  2FUH B;  3PRP B;  3DBH I;  4B9K A;  4DWF A;  2JPH A;  3Q3F A;  4FLH A;  1D3Z A;  3M62 B;  4BVU C;  4BKS D;  2GBK A;  4K1R B;  2JXX A;  2LVO A;  1TGZ B;  2KAN A;  5DPT A;  2MCN B;  3VUX A;  3EC8 A;  3M63 B;  4RMA A;  2IY0 B;  4TUU A;  2NBW B;  3ALB A;  3V6E B;  2KC2 A;  3ZUN A;  2M0X A;  3SU8 X;  3HK0 A;  2BKF A;  4GSW A;  1WI0 A;  3H9D A;  1K8R B;  2FID A;  2KDB A;  3JVZ X;  5J18 A;  1UZX B;  4NY0 A;  1TBE A;  2J7Q B;  2KDF B;  1E5W A;  2DAJ A;  4HLE A;  3SD5 A;  4LCD E;  2CR5 A;  1WF9 A;  1WM3 A;  2EMT A;  4K81 A;  2LZ6 A;  2N4F A;  1QZE A;  5C1Z A;  2KWU B;  3N32 A;  4FA6 A;  2D11 A;  4MSQ B;  4EEW A;  3RZW C;  3ZNG C;  1E90 A;  4MJS A;  4EZJ A;  4TQ0 A;  1WRD B;  2NCN A;  2LI5 A;  4DDG D;  1XT9 B;  3RUI B;  5DPS A;  1ZW7 A;  4XC2 A;  2N7E A;  3R7R A;  1WY8 A;  3RUL A;  4GIV A;  2DZM A;  4W9J A;  1UEL A;  3MTN B;  3V6C B;  3GOE A;  1KOT A;  3R7Q A;  2G4S A;  4I6P A;  1EF1 A;  2NPT A;  3H1U A;  4XZ4 A;  4GOC A;  1TZ1 A;  4ANU A;  1E8Y A;  1V5T A;  2BPS A;  4HDO A;  2LGY A;  2J0J A;  3K9O B;  3ZLZ A;  3A33 B;  1L2N A;  3PPA A;  4KV2 A;  2MP2 A;  1IP9 A;  4GU2 A;  3TMP B;  5EDS A;  3BIN A;  2R2Q A;  3DBS A;  2KQ7 A;  4LDT B;  4TKN A;  1P98 A;  4WJN A;  2NBU A;  4IW0 A;  2C5L C;  3PS6 A;  2ZPN A;  3VQI A;  4K7W A;  3JSV A;  5DCN A;  3U8Z A;  5D94 A;  3WIM A;  1GJZ A;  1RLF A;  3DOW A;  4X57 B;  1UH6 A;  5CHW A;  3PSE B;  3DVN V;  1A5R A;  5LXI B;  1YX6 B;  1CMX B;  1UD7 A;  2DZK A;  2D07 B;  4IM2 A;  5IAA C;  4KZC A;  4B95 A;  1WM2 A;  3PLU A;  2BF8 B;  2NBV B;  3R3M A;  5HKH A;  1E7V A;  2LXA A;  4MGZ E;  1V86 A;  3ZKJ C;  4MGK E;  4DHZ B;  1WGD A;  4WWN A;  1KM7 A;  2A5U A;  4W9I A;  3QC8 B;  4WJP A;  1FXT B;  2IO2 B;  2O6V B;  4RM9 A;  2LVP A;  4W9G A;  3ZNI D;  2WYQ A;  1WXS A;  4JQW C;  4DHZ E;  3KVF B;  3B0A A;  4GN1 A;  2XEW A;  4KZ0 A;  4FBJ B;  2KJR A;  2M17 A;  4G50 A;  1S1Q B;  2KZR A;  2BYE A;  5CHF A;  1V5O A;  1WGY A;  2K39 A;  2KX0 A;  4HPL B;  2PPH A;  3ZTD A;  2N7D A;  4JL9 A;  1UBI A;  1V80 A;  2M1M A;  4DDI D;  4TQ1 A;  2KVR A;  2ZJD A;  4EZK A;  2FAZ A;  1Z2M A;  4A3P A;  2IYD B;  4IWO A;  4DHJ D;  2KOX A;  2KC1 A;  3APC A;  4MSM B;  4JIO U;  3RCZ A;  3CF6 E;  5E6O A;  4E74 A;  5J2R A;  1I42 A;  2RR9 A;  2MBE A;  1PQS A;  2JT4 B;  2KX3 A;  4NAW A;  4M8N A;  4KIK B;  5D6J B;  2G45 B;  4BKG A;  5DPW A;  5JZE B;  5E6N A;  2L05 A;  3DDC B;  3PTF C;  2K8C A;  1OTR B;  2JZZ A;  3HHM A;  3NZS A;  2EKE C;  2DHZ A;  1Q5W B;  2KWV B;  3KUZ A;  2KN5 A;  3VHT C;  4HK2 A;  4DBG A;  3PT2 B;  2K8B A;  3DVG X;  1WYW B;  2KD0 A;  3D32 A;  1WE6 A;  2W9N A;  3V62 A;  4HWI B;  3VDZ A;  1GNU A;  1NI2 A;  1WFY A;  1WR6 E;  4E3C A;  4OVU A;  4NQL B;  4OVV A;  2BKR B;  3V61 A;  2OJR A;  4PS7 A;  2ZZP B;  2Z0D B;  1ZKH A;  2PJH A;  2UWQ A;  3PV1 A;  4FUL A;  2MBQ A;  1TTN A;  3U7D A;  1H4R A;  3W1Y A;  3KYC D;  1VCB A;  3WA0 A;  1LM8 B;  2MLB A;  2GOW A;  2L0F A;  4GGQ A;  1RRB A;  4PYU A;  5E6P A;  3VH4 B;  5L95 C;  3B08 A;  3M3J A;  4II3 B;  1VD2 A;  1OQY A;  3PGE A;  4GMV A;  3VAW A;  1IYF A;  4K7U A;  2MRP A;  4E71 A;  1WXA A;  4RM8 A;  5AZF A;  3UQA A;  3PRZ A;  4IUM B;  3VVW B;  4G0N B;  2KHW B;  1E8X A;  3KW5 B;  1E8W A;  2WX0 A;  3L17 A;  1R4M I;  4WQO B;  1MG8 A;  2KWC A;  2J0M A;  4BOZ B;  1ZGU B;  4HCN B;  3B1L X;  3DVN U;  3VUY A;  1WMH B;  1WX7 A;  2L00 B;  2KDE B;  4HJK A;  4XX5 A;  4ZRK A;  2D10 A;  1WZ3 A;  4TV3 A;  3X0W A;  2KJ6 A;  5C23 A;  1C1Y B;  4CYE A;  2Y5B B;  1YQB A;  2ZVN A;  2MSE D;  2KKC A;  3ZNZ B;  4JLC A;  3AUL A;  3QA8 A;  4A3O A;  2O6V A;  2K25 A;  2FNJ B;  4G3X B;  1LQB A;  2K8H A;  2V4L A;  4AUQ C;  4ZDV A;  1V81 A;  1WJ4 A;  5BO4 B;  2ASQ A;  3IHP C;  2HE7 A;  2KMC A;  3OJ3 A;  2BGF A; 
#chains in the Genus database with same CATH topology
 2LRW A;  3U2S C;  2N9P C;  2D2Q A;  2FBW B;  3Q8F A;  4MM3 A;  1VJK A;  1D6E C;  1L4D B;  3EHV A;  3QJZ A;  4IM3 A;  2VH2 A;  3T8M A;  4KGS A;  2M8S A;  3OJ4 B;  1DOY A;  3N30 A;  2K6Q A;  2V3P A;  2CJN A;  3AE6 B;  3ZGZ A;  3H6N A;  2QHO A;  1RFA A;  4M8M A;  4C4V A;  2D3G A;  1MG4 A;  4OVZ A;  3DPD A;  1Q10 A;  1YOV B;  1QF6 A;  1QLB B;  2R2O A;  3TSS A;  4KVG B;  2MJE A;  5LNK 1;  4AOF A;  3W9C B;  3QWZ B;  2KTF A;  2LMC A;  4M02 A;  1N61 A;  1R7S A;  2WDV B;  5J17 A;  2NS5 A;  4JGH B;  4MGI E;  3TBL D;  2JVC A;  1IGC A;  4EZL A;  3RNA C;  1WXM A;  3AU5 A;  4KGT A;  1TJE A;  1MVK A;  3O13 A;  4A6Q A;  1PYW D;  4A9A A;  1RFK A;  3PLV A;  1IUE A;  1LO5 D;  4US9 A;  3WAN A;  5CX3 A;  4HVB A;  4IOI E;  2BB6 A;  2BT6 A;  3KYD D;  1SIF A;  2NR2 A;  1WGH A;  3P4R B;  3PVL A;  1YN5 A;  1NDD A;  1MHX A;  3L4P A;  2AL3 A;  2MX2 A;  2LVQ A;  4YSX B;  1I35 A;  1X1M A;  1E7P B;  4W9C A;  1TZO A;  4HDQ A;  4KDI C;  1SE9 A;  3AU4 A;  1TS3 A;  2I1J A;  5IP4 D;  1YX5 B;  1WJU A;  1WJN A;  3U30 A;  4ANW A;  1I4P A;  4MEM A;  1EO6 A;  1OEY J;  1ZPS A;  2REX A;  4WAA A;  1KTK A;  2WXM A;  1T0R C;  1OFF A;  3BYT B;  2ON8 A;  2DZJ A;  4M01 A;  2G3Q B;  2KMA A;  3RT3 B;  4HEA 1;  1P9D U;  3SDL C;  4OW0 A;  5FKA C;  1YJJ A;  2KXJ A;  3B2G A;  4HPP A;  4I6N B;  2C9W B;  4EUT A;  4A8X C;  1ZOY B;  1I4X A;  3ZXV A;  4M0W B;  1A70 A;  2IND C;  4WH4 A;  3ENE A;  3IAM 1;  1F2R C;  1J7A A;  2JRI B;  5BYR A;  3UIP B;  5JH5 C;  2JXT A;  4ARI A;  4DXA B;  1ET9 A;  4HKQ A;  1TT5 B;  4ZHP A;  1ROE A;  4W9H A;  3UIO B;  3CMM B;  4F1S A;  4MJS B;  2PE6 B;  1XEE A;  1ZE3 D;  2C7N B;  3CST A;  1L7Y A;  2QIL A;  1N63 A;  1WX8 A;  4W9D A;  3AI5 A;  4OHJ A;  4L23 A;  4ZRI A;  1WH3 A;  3A4S C;  4J6I A;  4NZL B;  1YN3 A;  1WXV A;  2PEA A;  1MFW A;  1BUI C;  2DEN B;  4BBN F;  2L7R A;  4JPS A;  4ZYS A;  1FFV A;  1CZP A;  2BS2 B;  1CK1 A;  2C7M B;  3DBL I;  1FMA D;  2UYZ B;  4RF0 A;  1JRP A;  3KUC B;  3VUW A;  1LXD A;  4XYC A;  4NJ6 A;  2BS3 B;  1QOA A;  2RGF A;  2Y5P A;  3VTV A;  1WIA A;  3TEY A;  1DOX A;  1M94 A;  3GE8 C;  5D3I B;  5I4D A;  2V3S A;  2MHJ A;  1CJE A;  1K52 A;  1PUT A;  2K6D B;  1DOI A;  3WAP A;  2MQJ A;  4K7S A;  3NZU A;  1K51 A;  1TIF A;  3PRP B;  1F52 A;  1EWY C;  1PGB A;  2OHF A;  2JPH A;  4H2A A;  1L0X B;  4BVU C;  4BKS D;  1ET6 A;  4M0W A;  1TGZ B;  1E6E B;  5BMG A;  3SEB A;  1V8C A;  3H9D A;  2IGD A;  3P63 A;  2QJL A;  4NY0 A;  2DAJ A;  4HLE A;  2J53 A;  5BMI A;  4A55 A;  5C1Z A;  1ZDX A;  2D11 A;  3RZW C;  2MEK A;  3ZNG C;  3AED B;  5H8Y E;  4MJS A;  1XT9 B;  4JWU C;  1SE4 A;  1XXG A;  2EEL A;  4OZB A;  3V6C B;  3GOE A;  3RNF C;  1KOT A;  3R7Q A;  4I6P A;  3VRB B;  3H1U A;  1TZ1 A;  1V5T A;  4WAF A;  3A33 B;  5FK9 C;  1L2N A;  1E9M A;  1IP9 A;  3TMP B;  4HRS A;  3DBS A;  2KQ7 A;  3BK1 A;  4LDT B;  4TKN A;  1P98 A;  2BYT A;  3VQI A;  2ZPN A;  3U8Z A;  1BXT A;  4WQM A;  1P7F A;  3ZJU A;  3DVN V;  3FAH A;  2WS3 B;  1UD7 A;  4KZC A;  5HKH A;  2LXA A;  4WWM A;  2K0P A;  5D3D A;  1KM7 A;  4W9I A;  5C2T B;  3QC8 B;  4RM9 A;  2LVP A;  3ZNI D;  2WYQ A;  1WXS A;  2PVG C;  2GI9 A;  4YT0 B;  3B0A A;  4FBJ B;  1HZ6 A;  4AS1 A;  2KZR A;  2BYE A;  5CHF A;  1YJI A;  1D5M C;  4HPL B;  4JL9 A;  4DDI D;  2KVR A;  4EZK A;  2D5G A;  4MSM B;  3C19 A;  3Q69 A;  2YEP F;  1XF5 L;  4CQN A;  1PQS A;  4KIK B;  2G45 B;  5DPW A;  2L52 A;  5JZE B;  3URY A;  1L6U A;  2IJ0 A;  1OTR B;  3VHT C;  3PT2 B;  4DXF A;  3DVG X;  4YXD B;  3N9Y C;  1WR6 E;  3V61 A;  2WXO A;  1ZKH A;  4FUL A;  3W1Y A;  1H4R A;  3EA6 A;  2GOW A;  3M3J A;  3VAW A;  4GMV A;  1IYF A;  4E71 A;  4C56 C;  3UQA A;  3PRZ A;  4P1C C;  4IUM B;  4JX1 C;  4XWT A;  2NTT A;  1E8X A;  2INC C;  1YN4 A;  3KW5 B;  3J9C A;  2J0M A;  1VR9 A;  3MHZ A;  2LEK A;  4HJK A;  2KDE B;  2D10 A;  4UDU C;  2KJ6 A;  1UWM A;  4CYE A;  2FUG 1;  1AW7 A;  3UI3 A;  1YQB A;  2PW9 A;  1FXA A;  2KKC A;  3TEX A;  3AUL A;  5HFY A;  4S17 A;  2B76 B;  1SF0 A;  4AUQ C;  2JYT A;  4ZDV A;  1V81 A;  5BO4 B;  1XLQ A;  2ASQ A;  1FCL A;  4AP4 C;  3IAS 1;  2WQY B;  1J0G A;  1WJ6 A;  4W9F A;  2KK8 A;  4CHK A;  2JF5 A;  3TJP A;  1VZ7 A;  3R2T A;  3UGB B;  2J42 A;  4IWP A;  4NPN A;  1N6Z A;  4C80 A;  2QDF A;  2IO0 B;  3OLM D;  4DHJ B;  2IO1 B;  2L0T A;  3I57 A;  4KIK A;  4F7Z A;  1QKZ A;  3R66 C;  1HTQ A;  3KUD B;  1GUA B;  2A4Z A;  2GBJ A;  1KLG D;  3VFK A;  3M95 A;  2PKO A;  1M4V A;  1WXQ A;  2WXF A;  2PMV A;  2MA9 B;  1IPG A;  1XD3 B;  1VLB A;  3GZN B;  4G11 A;  5AZH A;  2JZ3 B;  2LWP A;  1QIL A;  4EOY A;  5IOI A;  2KWD A;  3N20 C;  1OGW A;  3EFU A;  1RWS A;  1E8Z A;  1Q1O A;  1FNV A;  2V9H A;  3A4R A;  2DZI A;  1FO4 A;  2RD0 A;  1WE7 A;  1HZ5 A;  5JHB A;  2K1F A;  3T9L A;  1EF5 A;  1N60 A;  1VDV A;  3OWE B;  3MP9 A;  2VZK D;  1WGR A;  2YLM A;  2AX5 A;  2RMM A;  2N1W A;  5HI1 A;  5EE3 A;  2WX1 A;  3ONS A;  4P1B C;  2HD5 B;  4EE2 A;  4ANV A;  2O2V B;  3NY5 A;  3ML8 A;  4NQK E;  3ZVV A;  1KFY B;  2RDH A;  3AH7 A;  2H89 B;  1GC6 A;  3NS1 A;  2I2Y A;  3AE4 B;  3CSF A;  1HE8 A;  3P42 A;  2AWT A;  1KH0 A;  2N9E B;  4KKI A;  1OQR A;  2BYF A;  4ZOH C;  2NTS A;  2V3N A;  3L13 A;  1JRU A;  3RZF A;  4WJO A;  4NAW B;  4FJZ A;  2JWU A;  2VRR B;  2X38 A;  3TCA A;  3IVF A;  4XWW A;  1U4A A;  3RN9 C;  3PHW B;  2WDT B;  1DGJ A;  1SE2 A;  2DX5 B;  3DBR B;  3AEB B;  3DVG Y;  2LAS A;  2RDB C;  1KF6 B;  3ZYY X;  1HA5 A;  1SEB D;  3GB1 A;  1R4N B;  2MBH A;  2R61 A;  3HM6 X;  5JHA A;  4BFR A;  4GXB A;  2LFI A;  2IZV B;  2KLG A;  1K50 A;  4C7Y A;  2HJ1 A;  3P4P B;  1PGX A;  1Z5S B;  3QIJ A;  4MDK E;  1IBX B;  1V6E A;  3WAM A;  3L16 A;  2V4I B;  3B9J A;  3X23 A;  2LGS A;  2J52 A;  2PE9 A;  2L3Z A;  3S2A A;  4TSS A;  1TKY A;  1YJ1 A;  4W9E A;  4TMA B;  2MH7 A;  2CHZ A;  1TY2 A;  2JX5 A;  2CS4 A;  2DYM A;  2Z0E B;  1P3Q U;  1L0V B;  2OJW A;  4DQO C;  2L8J A;  4KX6 B;  5JXV A;  1KJT A;  4RH6 A;  3RNG C;  4J3O D;  2FCQ A;  5FR3 A;  1OQQ A;  3EUB 2;  2KLC A;  3APD A;  2O2V A;  3KWV A;  1NEN B;  2ZCB A;  4B6W A;  4L2Y A;  3NUH B;  2JWZ A;  4YSY B;  2J0K A;  3L0W B;  4FN2 A;  2WXP A;  4XDC A;  3UF8 A;  3TL5 A;  5KHQ A;  1JRO A;  1JWM D;  1TS2 A;  3RFZ B;  4P16 A;  4BOS C;  3PRE A;  2N9L A;  4B0M A;  3MFG A;  3R2I A;  4XGA B;  1WSP A;  2DNF A;  1Q0W B;  1P0R A;  1L4Z B;  1J7C A;  2G4D B;  2PLP A;  4ZRJ A;  3ZDM C;  4PYZ A;  4FJV B;  4HKZ E;  1YQ3 B;  2G9H D;  3ZTC A;  3LXF A;  3HUI A;  1WGK A;  3TIX A;  1UUP A;  4PT5 A;  5AZG A;  5AUK A;  4FJY A;  3ML9 A;  1C78 A;  3AXC A;  1E7U A;  2SEB D;  2FUH B;  1D3Z A;  4A90 A;  1JWU D;  1F2R I;  3VUX A;  5C3J B;  2IY0 B;  2NBW B;  2KC2 A;  3ZUN A;  3SU8 X;  1GAQ B;  1IBX A;  2N9K A;  4RGM A;  3JVZ X;  5J18 A;  2J7Q B;  2N0S B;  3SD5 A;  1WM3 A;  2WXG A;  4K81 A;  4L1B A;  1I4H A;  2BBC A;  2LZ6 A;  2N4F A;  2KWU B;  2PTL A;  3DWG C;  1D5X C;  4TQ0 A;  2LI5 A;  1F1H A;  1ZW7 A;  1ZUD 2;  2N7E A;  1WY8 A;  1SB3 C;  2DZM A;  1UEL A;  3MTN B;  3AN1 A;  4XZ4 A;  2IGG A;  5E6J A;  3RMK C;  2J0J A;  5TSS A;  4KV2 A;  3BIN A;  4O1N A;  4IW0 A;  3PS6 A;  2MJ3 A;  3P1M A;  2H88 B;  3DHH C;  5LXI B;  2D07 B;  4JE3 B;  4US8 A;  5EE1 A;  1WRI A;  2WLB A;  1FEH A;  4MGZ E;  3ZKJ C;  4MGK E;  1XO3 A;  1I4R A;  3DHG C;  4WWN A;  2MJD A;  1TY0 A;  1E0Z A;  2M0A A;  1FIQ A;  2K5P A;  3AEA B;  1S1Q B;  2K39 A;  3GS2 A;  2PPH A;  4AQ7 A;  1PDX A;  4LNI A;  1V80 A;  4TQ1 A;  1Z2M A;  4A3P A;  4IWO A;  2M19 A;  1YNT E;  2KOX A;  2M56 B;  5J2R A;  2V0G A;  1I42 A;  4YTN B;  2JT4 B;  2KX3 A;  4M8N A;  1YQ4 B;  1N62 A;  1D5Z C;  3DDC B;  3PTF C;  3FC4 A;  3HHM A;  2EKE C;  4LNF A;  3KUZ A;  4DBG A;  3BII D;  2KMM A;  3D32 A;  4JWS C;  3V62 A;  1NI2 A;  1WFY A;  1SXT A;  4NQL B;  1UNS A;  3AB5 A;  1XLO A;  2ZZP B;  2Z0D B;  2MBQ A;  3U7D A;  3KYC D;  1LM8 B;  5EE9 A;  2L0F A;  1RRB A;  3VH4 B;  1YMH E;  3B08 A;  4IDI A;  1WXA A;  4RM8 A;  4RF1 A;  5BYQ A;  3Q2A C;  1BML C;  1ENF A;  3OG5 A;  4XDD A;  4BOZ B;  3AEG B;  3B1L X;  3VUY A;  1WMH B;  2L00 B;  1WZ3 A;  3X0W A;  4HJG E;  1FNU A;  2X8X X;  2W3S A;  3ZNZ B;  4JLC A;  3EFC A;  1JCK B;  3Q8E A;  4K3C A;  2FNJ B;  4G3X B;  4RGN A;  2K8H A;  4QAY A;  2V4L A;  1WJ4 A;  3E56 A;  2W82 A;  3IHP C;  2HE7 A;  4PS3 A;  3PHX B;  1N5X A;  3QCA A;  4AJW A;  3W1S C;  2BWF A;  2CU3 A;  1WR1 A;  1TS5 A;  2DLB A;  2KDM A;  4KSL C;  2ZPY A;  3E9S A;  4BKS A;  1F9J A;  4BZA A;  3RNE C;  2AYO B;  3L10 B;  2WXR A;  2UU7 A;  3ZW3 A;  1V97 A;  2RPV A;  4PS8 A;  2WU2 B;  1NBF C;  3IBE A;  2KTR B;  1I4G A;  4IM0 A;  2ZNV C;  5CTR C;  4W9K A;  3PZD A;  3AEC B;  1S3S G;  3N1Z C;  1L6V A;  1YIW A;  4IKG A;  4D2K A;  2LJI A;  2INP E;  5HG2 A;  2I1K A;  1PGA A;  3ZO5 B;  5L83 A;  2Y3A A;  4RFB A;  4C00 A;  2MBO A;  1T0Y A;  3MHS D;  1AWD A;  3Q8C A;  4N58 A;  3AEE B;  1QOG A;  1UF0 A;  4LNO A;  4RNA A;  3KLS X;  3IG3 A;  3I9V 1;  2ZNV B;  2ACZ B;  1V49 A;  1XCQ L;  2AL6 A;  3I63 C;  1T6B X;  4ICU A;  2XK5 B;  3A1Q B;  1NVI D;  4LTU A;  2MBB B;  1J8C A;  3N3K B;  3AMZ A;  2Y5C A;  2BWE S;  2YVC A;  2IY1 B;  4ANX A;  1MPE A;  3AM9 A;  5KHO A;  2I38 A;  1WMH A;  4MT5 A;  2IO3 B;  3L08 A;  2LUM A;  4DXG A;  4IC7 B;  3V05 A;  3LYY A;  1FRD A;  3ZRF A;  3L54 A;  3MC9 A;  2CHX A;  1FCC C;  1XLP A;  1AAR A;  4LLG M;  3QX1 A;  3CIR B;  2AEH A;  1J7B A;  3RNB C;  3FKY A;  1T3Q A;  4ZRQ A;  4DK5 A;  3NJT A;  4II2 B;  3GZN I;  2N1V A;  1LFD A;  2KAC A;  3ZDT A;  2WXJ A;  4MGY E;  2KFK B;  2FCS A;  3NVV A;  1SE3 A;  4GDL B;  2CU1 A;  4HCP B;  5D2M B;  3A9K B;  2KTR A;  2MWS B;  4URK A;  2C7H A;  2RDG A;  2KNB A;  3KH0 A;  3W1S A;  2QC8 A;  2LJ5 A;  2WWZ A;  4WWP A;  4P7I A;  3NVW A;  4MH8 A;  2JYE A;  2ZEQ A;  4NAM A;  3HIZ A;  3Q8A A;  3HRD D;  5GMV A;  3MJW A;  2E6X A;  2BYV E;  3I5J C;  1V1O A;  5T8I A;  2LD9 A;  5LLI A;  1K53 A;  3BY4 B;  4N9F 4;  3RD2 A;  2XK5 A;  3A1Q A;  3U4E G;  2HJ8 A;  1ACC A;  5IA7 A;  4A20 A;  1TS4 A;  2QSD A;  1SIJ A;  5D7G A;  5AEK B;  3VTW A;  2HTH A;  2LXC A;  4HXD A;  2JQR B;  2VH1 A;  3DBH B;  2CHW A;  1QT9 A;  2VZK B;  2ZVO A;  3SHQ A;  3LB8 C;  2GRI A;  3RNC C;  2NPT B;  3DBR I;  3H7S A;  3QQ8 B;  3P2B A;  5BYS A;  1RAX A;  4N59 A;  5DPR A;  3JSV B;  1R4N I;  2ZCC A;  2JSV X;  1VZ6 A;  1F77 A;  2GMI C;  1SSN A;  3Q6B A;  2FCM A;  2O6V D;  1C3T A;  5LXH A;  5TR5 A;  3DQV A;  1I7H A;  1T5X D;  2KFK A;  3AE1 B;  2LUE A;  3Q3J A;  4GDL A;  2B3A A;  1NI3 A;  4EKU A;  3A9K A;  3BWU D;  2KJH B;  2L32 A;  2LRU A;  3JYU A;  4B9K A;  4DWF A;  3NG0 A;  2EKI A;  3M62 B;  1HTO A;  4K1R B;  3EC8 A;  4TUU A;  3V6E B;  2M0X A;  3NZ3 A;  3HK0 A;  4GSW A;  5IKC M;  1E10 A;  1K8R B;  2KDB A;  3BK2 A;  3AE5 B;  1UZX B;  1TBE A;  1E5W A;  3W2D A;  4LCD E;  2CR5 A;  1WF9 A;  2PIA A;  1QZE A;  3AE8 B;  3N1X C;  4FA6 A;  1WWT A;  4MSQ B;  4WIP A;  4EEW A;  1E90 A;  4EZJ A;  2NCN A;  4DDG D;  1C4A A;  3RUI B;  5DPS A;  4XC2 A;  3RUL A;  1VZ8 A;  4GIV A;  2G4S A;  1EF1 A;  2NPT A;  2L83 A;  4ANU A;  2LGY A;  3K9O B;  1RYJ A;  3Q3N C;  2E3T A;  3NRZ A;  2NBU A;  5G5G A;  2C5L C;  2QMT A;  2LGI A;  3JSV A;  5DCN A;  5D94 A;  3WIM A;  3PO0 A;  4X57 B;  1UH6 A;  3PSE B;  2DZK A;  1CMX B;  4IM2 A;  5H92 C;  1KLU D;  3PLU A;  3R3M A;  1JWB D;  4C7Z A;  1UGJ A;  1NYR A;  1V86 A;  4RGT A;  1WGD A;  3AE7 B;  2WXL A;  2A5U A;  1V1P B;  3ZQ4 A;  1FXT B;  2IO2 B;  4W9G A;  4JQW C;  4DHZ E;  3TUO A;  4GN1 A;  4YSZ B;  2KJR A;  2M17 A;  1QOB A;  1WGY A;  3KQ4 A;  2KX0 A;  1RM6 C;  4OZA A;  2M1M A;  2CJO A;  2ZJD A;  1R4M B;  2FAZ A;  2IYD B;  2KC1 A;  4JIO U;  4YTM B;  3CF6 E;  5E6O A;  4NAW A;  5D6J B;  1HEZ E;  2BVC A;  3GE3 C;  3TEW A;  2W54 A;  2K8C A;  2JZZ A;  1L0Y B;  2WXQ A;  2KWV B;  4HK2 A;  2K8B A;  1WYW B;  2KD0 A;  4WUR A;  2W9N A;  1GOZ A;  5IN7 A;  1ZDV A;  3VDZ A;  2BKR B;  2OJR A;  4ITK A;  2PJH A;  3PV1 A;  1JWS D;  2WDR B;  1VCB A;  3AE9 B;  4GGQ A;  4PYU A;  2Q5W D;  1VD2 A;  2IDY A;  1WYG A;  3N1Y C;  2MRP A;  1ZXI A;  4K7U A;  5AZF A;  1N5W A;  1QQR A;  1HXY D;  3KWL A;  2AQ3 B;  4G0N B;  2KHW B;  2FE8 A;  1EM7 A;  1E8W A;  2WX0 A;  4WQO B;  1MG8 A;  3SR6 A;  2KWC A;  3AE2 B;  3ABV B;  1ZGU B;  4HCN B;  5IO9 A;  3DVN U;  1WX7 A;  4XX5 A;  4ZRK A;  1C1Y B;  4LK0 M;  2KVZ A;  2ZVN A;  2MSE D;  1V1P A;  2WU5 B;  3T3O A;  3QA8 A;  4A3O A;  1LQB A;  3PZ8 A;  5BMH A;  3OJ3 A;  2BGF A;  3B2F A;  1NEK B;  2DAF A;  5G55 A;  2V1Y A;  2HTM E;  4N6E B;  2M4N A;  1TKE A;  3NS8 A;  2Z59 B;  3P4Q B;  1JML A;  2GBR A;  2W3R A;  3SFE B;  3AEF B;  1PFD A;  3RI7 C;  3U7Z A;  3C0R B;  1EUV B;  3H7P B;  4M00 A;  3EEC A;  3DCG A;  4BBN C;  1XLN A;  1ZP0 B;  3VXW A;  4I6L B;  3GP7 A;  4KSK C;  1FFU A;  2DYO A;  2FCN A;  2JUO A;  2WXH A;  2KQS A;  1Y56 A;  2KDI A;  4ACF A;  3QAR A;  4WWO A;  4GLS C;  2MW5 A;  3O65 B;  4WJQ A;  3DWM A;  1MI0 A;  4CO7 A;  3VRA B;  1JWA D;  3NHE B;  2LGX A;  1FD6 A;  4BKT A;  3W5V B;  4ASW C;  2IBI B;  1TYG B;  2C60 A;  1Y8R C;  3PRM B;  1J19 A;  3QHT A;  4FHK A;  3UQB A;  2D3B A;  1MJD A;  2FIF A;  1BT0 A;  4ZYN A;  3UIN B;  2XBB C;  2CKH B;  1IGD A;  3BZD B;  2QEJ C;  3QAQ A;  3MJ5 A;  4LJO B;  1GC7 A;  3HVD A;  2IPK D;  4AJY B;  3I3T B;  1OEY A;  4USA A;  4ARC A;  4AWJ A;  2GBN A;  4GB9 A;  4IWQ A;  2W55 A;  4GDK B;  3FIL B;  1ESF A;  1UGM A;  1G6J A;  5FR6 A;  1VRA B;  4EFO A;  2N9X A;  3OAW A;  1WZ0 A;  4KGR A;  3ZJV A;  2ZW1 A;  1T0S C;  4NJ7 A;  1ISN A;  3ETR A;  3WAL A;  3RYT A;  2OOB B;  1UBQ A;  5MPO A;  4FAD A;  5G5H A;  4W9L A;  3A9J B;  3ZXR A;  3H7P A;  3EGR A;  4IG7 B;  3BVM A;  4BAX A;  2K3U A;  2K22 A;  3SFD B;  2JZP A;  4MEL A;  2K9X A;  1JW9 D;  3K9P B;  5CHV C;  3QK0 A;  1MHH E;  1GB1 A;  3VR8 B;  2WXN A;  3HVZ A;  1GB4 A;  1GPX A;  2D3C A;  2KT7 A;  2JY6 A;  3DBL B;  3JW0 X;  3BVG A;  3HM3 A;  2KFJ A;  2LGD A;  2NVU I;  3VH3 B;  3APF A;  2DYB A;  3LDZ E;  3ZIM A;  1QOF A;  3NVY A;  2JRH A;  2KQ4 X;  3NVZ A;  3TEZ A;  3V60 A;  2KO3 A;  4HPM B;  4RGO S;  1C76 A;  4FHJ A;  1XQQ A;  4YL8 A;  2PVO D;  3IFW B;  4XE0 A;  3V3X A;  3WCQ A;  3LJ3 A;  1WGG A;  1WX9 A;  5G2N A;  1H8C A;  4PK1 A;  3ZRC A;  4NNJ B;  3MC0 B;  2GLS A;  1C9F A;  1I4Q A;  4LDT D;  1FPY A;  2L76 A;  2RPQ A;  2RSU A;  3NOB A;  4GDK A;  1EU3 A;  3FIL A;  4OZC A;  2MP2 B;  1GG3 A;  2IGH A;  4ICV A;  3Q14 C;  1D4B A;  4YTP B;  3VTU A;  2YEP B;  2EMS A;  2LHD A;  3AE3 B;  1YD8 U;  1TKG A;  1P1A A;  4LJP B;  5HHD G;  1B1Z A;  2XNA C;  4F8C B;  2SAK A;  4MH0 E;  1F0Z A;  3ECI A;  1C79 A;  2OED A;  3A9J A;  3WAO A;  1V9J A;  1SGH A;  3ZNH B;  1UWX A;  1V2Y A;  2GBM A;  1KLV A;  4KDL B;  1STE A;  1JAL A;  3VR9 B;  3DBH I;  4FLH A;  3Q3F A;  1FXI A;  3IT6 B;  2GBK A;  2JXX A;  2D3A A;  2LVO A;  2KAN A;  5DPT A;  2MCN B;  4RMA A;  3M63 B;  4LNK A;  4HRO A;  3ALB A;  2BKF A;  1WI0 A;  2FID A;  2KDF B;  4ZHO A;  3Q3M C;  4Q2J A;  2EMT A;  3T3N A;  2WGS A;  3IT4 B;  3N32 A;  2ONQ A;  1SJE D;  2KAJ A;  1WRD B;  2Z8L A;  3BYY B;  1JQ4 A;  3R7R A;  2J4X A;  4W9J A;  3C8Y A;  2NMQ A;  1T0Q C;  4GOC A;  1E8Y A;  1AYF A;  2BPS A;  3PZ7 A;  2ICI A;  4HDO A;  1HQR D;  3ZLZ A;  3H8H A;  3PPA A;  2BB5 A;  2MP2 A;  3ZJT A;  1C4C A;  4GU2 A;  5EDS A;  2XN9 C;  2R2Q A;  5GXG B;  2G1E A;  4WJN A;  4K7W A;  3R8B A;  1GJZ A;  1RLF A;  3DOW A;  5CHW A;  3P4S B;  1XCT L;  4B0E A;  1A5R A;  2JU6 X;  1YX6 B;  5IAA C;  4B95 A;  1WM2 A;  2BF8 B;  1C77 A;  2NBV B;  1E7V A;  1FM0 D;  3Q3O C;  4DHZ B;  3Q8B A;  1B9R A;  3IXS A;  4WJP A;  2O6V B;  5EE0 A;  2WP9 B;  3KVF B;  2XEW A;  4KZ0 A;  2AQ1 B;  4G50 A;  1DYQ A;  1V5O A;  1EU4 A;  3ZTD A;  2INN E;  2N7D A;  4MM3 B;  1UBI A;  2BW2 A;  4K3B A;  4P6V F;  2TSS A;  2LHE A;  4DHJ D;  1AN8 A;  3APC A;  3RCZ A;  4E74 A;  1SJH D;  2QCZ A;  1SBB B;  1LGR A;  2MBE A;  2RR9 A;  4BKG A;  1ZXH A;  2GB1 A;  4FXC A;  4C4V B;  5E6N A;  1L5P A;  1EWC A;  2L05 A;  1NYQ A;  2WXK A;  4RCO A;  3NZS A;  4ZRP A;  2HDE A;  2DHZ A;  1Q5W B;  2KN5 A;  2WXI A;  4S0R A;  1WE6 A;  4HWI B;  2WDQ B;  1GNU A;  4LNN A;  4E3C A;  2BQQ A;  4OVU A;  4OVV A;  4MAC A;  3MC8 A;  2BTE A;  4PS7 A;  2UWQ A;  4KKJ A;  1TTN A;  2N7J A;  3WA0 A;  2MLB A;  2QIE B;  4NJC A;  3W5U B;  4R3D A;  5E6P A;  5L95 C;  2L1A A;  4REZ A;  2ZW0 A;  4II3 B;  1OQY A;  3PGE A;  2BS4 B;  2KYW A;  1FRR A;  3VVW B;  1P7E A;  3RPF C;  3DHI C;  2WNM A;  1FNW A;  1C4P A;  2AQ2 B;  3L17 A;  1R4M I;  2KN4 A;  1CQV A;  3CWI A;  5AUI A;  4TV3 A;  2DBY A;  3BVZ A;  5C23 A;  1KRH A;  2Y5B B;  3AV8 A;  3U52 E;  2WHI A;  4YWG G;  2O6V A;  2K25 A;  2DWQ A;  2KMC A; 
#chains in the Genus database with same CATH homology
 1J0G A;  2LRW A;  1WJ6 A;  2DAF A;  3PHX B;  2N9P C;  2D2Q A;  2KK8 A;  4W9F A;  4CHK A;  2JF5 A;  3QCA A;  5G55 A;  4AJW A;  3TJP A;  4MM3 A;  3UGB B;  2V1Y A;  3W1S C;  2M4N A;  3EHV A;  2BWF A;  4IWP A;  1WR1 A;  3QJZ A;  3NS8 A;  2Z59 B;  4NPN A;  4IM3 A;  2GBR A;  3T8M A;  2M8S A;  3C0R B;  3OJ4 B;  4KSL C;  2ZPY A;  1EUV B;  3N30 A;  2IO0 B;  3H7P B;  2K6Q A;  3OLM D;  3EEC A;  2IO1 B;  1F9J A;  3DCG A;  4BBN C;  2L0T A;  4BKS A;  4DHJ B;  3H6N A;  2QHO A;  3VXW A;  4KIK A;  1RFA A;  2AYO B;  4I6L B;  3L10 B;  4M8M A;  2D3G A;  3ZW3 A;  4F7Z A;  3R66 C;  3DPD A;  4KSK C;  4PS8 A;  1NBF C;  2DYO A;  2FCN A;  2JUO A;  3IBE A;  3KUD B;  2KTR B;  2KQS A;  1GUA B;  2R2O A;  4IM0 A;  2ZNV C;  5CTR C;  4KVG B;  2KDI A;  4W9K A;  2A4Z A;  3PZD A;  3QAR A;  4WWO A;  2MW5 A;  1S3S G;  2GBJ A;  3O65 B;  4WJQ A;  3VFK A;  3M95 A;  4AOF A;  1YIW A;  3QWZ B;  2KTF A;  2I1K A;  4CO7 A;  3ZO5 B;  3NHE B;  2MA9 B;  5L83 A;  2LGX A;  1IPG A;  1XD3 B;  4BKT A;  4G11 A;  5AZH A;  2MBO A;  1T0Y A;  5J17 A;  2JZ3 B;  2NS5 A;  3MHS D;  2LWP A;  4JGH B;  4MGI E;  4EOY A;  3TBL D;  4ASW C;  2IBI B;  2C60 A;  2JVC A;  1Y8R C;  4EZL A;  1WXM A;  3AU5 A;  3PRM B;  1OGW A;  1J19 A;  3EFU A;  1E8Z A;  3IG3 A;  1Q1O A;  3QHT A;  3A4R A;  4FHK A;  3UQB A;  2ZNV B;  3PLV A;  2DZI A;  3WAN A;  1V49 A;  2AL6 A;  2FIF A;  5CX3 A;  4ICU A;  4HVB A;  2RD0 A;  2XK5 B;  3A1Q B;  1BT0 A;  1WE7 A;  3KYD D;  5JHB A;  2K1F A;  3T9L A;  1EF5 A;  4ZYN A;  2MBB B;  3UIN B;  1SIF A;  2NR2 A;  1WGH A;  2CKH B;  2XBB C;  3N3K B;  3PVL A;  2BWE S;  1J8C A;  1NDD A;  1WGR A;  2YVC A;  2IY1 B;  4ANX A;  2YLM A;  5KHO A;  2AL3 A;  2MX2 A;  1WMH A;  2LVQ A;  3QAQ A;  4LJO B;  2N1W A;  1I35 A;  1X1M A;  4W9C A;  1GC7 A;  2IO3 B;  2WX1 A;  3ONS A;  3L08 A;  4HDQ A;  4IC7 B;  2HD5 B;  4KDI C;  3I3T B;  4AJY B;  1OEY A;  1SE9 A;  3AU4 A;  4AWJ A;  4ANV A;  2I1J A;  2O2V B;  2GBN A;  1YX5 B;  3ML8 A;  3NY5 A;  4GB9 A;  4IWQ A;  1WJU A;  1WJN A;  4GDK B;  3U30 A;  3ZRF A;  3L54 A;  4ANW A;  4NQK E;  1UGM A;  4MEM A;  1G6J A;  5FR6 A;  2CHX A;  1EO6 A;  1OEY J;  3ZVV A;  2REX A;  4EFO A;  2N9X A;  3OAW A;  4WAA A;  1WZ0 A;  1AAR A;  1GC6 A;  3QX1 A;  3CSF A;  1HE8 A;  2AEH A;  2AWT A;  4NJ7 A;  4DK5 A;  2N9E B;  1ISN A;  3WAL A;  3RYT A;  4II2 B;  2BYF A;  3GZN I;  2N1V A;  1UBQ A;  1LFD A;  2OOB B;  3L13 A;  3ZDT A;  4FAD A;  4AP4 C;  1JRU A;  4W9L A;  3RZF A;  4WJO A;  4NAW B;  3A9J B;  2DZJ A;  4FJZ A;  2G3Q B;  4MGY E;  3H7P A;  2VRR B;  2KMA A;  4IG7 B;  3RT3 B;  3TCA A;  3IVF A;  1U4A A;  1P9D U;  2KFK B;  2FCS A;  3SDL C;  3PHW B;  2WDT B;  4MEL A;  5D2M B;  2DX5 B;  2CU1 A;  4GDL B;  4HCP B;  3A9K B;  2KTR A;  3DVG Y;  2KXJ A;  4PS3 A;  2MWS B;  3K9P B;  5CHV C;  2LAS A;  4URK A;  2C7H A;  3QK0 A;  4I6N B;  2C9W B;  4EUT A;  2KNB A;  3KH0 A;  3W1S A;  2LJ5 A;  2MBH A;  3HM6 X;  5JHA A;  4BFR A;  2WWZ A;  4GXB A;  4WWP A;  4M0W B;  2JY6 A;  3ENE A;  2IZV B;  2KLG A;  4P7I A;  3JW0 X;  2ZEQ A;  3HM3 A;  1Z5S B;  2KFJ A;  2LGD A;  3QIJ A;  4MDK E;  2NVU I;  3HIZ A;  1V6E A;  3WAM A;  3VH3 B;  2JRI B;  3UIP B;  3APF A;  5GMV A;  3MJW A;  5JH5 C;  2DYB A;  3LDZ E;  3ZIM A;  3L16 A;  3X23 A;  2BYV E;  2PE9 A;  2JRH A;  2L3Z A;  2LD9 A;  3S2A A;  5LLI A;  4DXA B;  3V60 A;  2KO3 A;  1YJ1 A;  4W9E A;  2CHZ A;  4HPM B;  3BY4 B;  4N9F 4;  4W9H A;  2XK5 A;  3A1Q A;  3RD2 A;  2CS4 A;  3UIO B;  2HJ8 A;  3CMM B;  4FHJ A;  4F1S A;  5IA7 A;  1XQQ A;  4MJS B;  4A20 A;  2DYM A;  4YL8 A;  2PE6 B;  2Z0E B;  3IFW B;  1P3Q U;  5D7G A;  5AEK B;  3VTW A;  2C7N B;  2HTH A;  3CST A;  2L8J A;  3LJ3 A;  1L7Y A;  1WGG A;  1WX9 A;  1WX8 A;  2LXC A;  4HXD A;  4W9D A;  1KJT A;  2CHW A;  2ZVO A;  3AI5 A;  5G2N A;  3ZRC A;  1H8C A;  3SHQ A;  2FCQ A;  4NNJ B;  1WH3 A;  4ZRI A;  3A4S C;  4J6I A;  2KLC A;  2NPT B;  3APD A;  1WXV A;  2PEA A;  2O2V A;  3DBR I;  3H7S A;  4LDT D;  3QQ8 B;  3P2B A;  2L76 A;  2DEN B;  2RPQ A;  2RSU A;  3NOB A;  4GDK A;  1RAX A;  2ZCB A;  4BBN F;  2MP2 B;  1GG3 A;  4ICV A;  4B6W A;  2JWZ A;  2J0K A;  3L0W B;  5DPR A;  4FN2 A;  2L7R A;  3JSV B;  1R4N I;  2ZCC A;  3UF8 A;  3TL5 A;  3VTU A;  5KHQ A;  2C7M B;  3DBL I;  4BOS C;  2EMS A;  3PRE A;  2UYZ B;  1YD8 U;  4LJP B;  1P1A A;  2GMI C;  1Q0W B;  3KUC B;  3VUW A;  4F8C B;  1P0R A;  4MH0 E;  2FCM A;  3ECI A;  2G4D B;  2O6V D;  3A9J A;  3WAO A;  1LXD A;  4ZRJ A;  1C3T A;  4NJ6 A;  3ZDM C;  4PYZ A;  2RGF A;  4FJV B;  5LXH A;  3VTV A;  1WIA A;  5TR5 A;  3DQV A;  1V9J A;  1M94 A;  2KFK A;  3ZTC A;  1SGH A;  2LUE A;  3Q3J A;  3ZNH B;  4GDL A;  2B3A A;  4EKU A;  3TIX A;  3A9K A;  1V2Y A;  5AZG A;  2V3S A;  2K6D B;  2KJH B;  2GBM A;  4FJY A;  3ML9 A;  1KLV A;  4KDL B;  3WAP A;  2LRU A;  2MQJ A;  3AXC A;  1E7U A;  4K7S A;  3NZU A;  3JYU A;  2FUH B;  3PRP B;  3DBH I;  4B9K A;  4DWF A;  2JPH A;  3Q3F A;  4FLH A;  1D3Z A;  3M62 B;  4BVU C;  4BKS D;  2GBK A;  4K1R B;  2JXX A;  2LVO A;  1TGZ B;  2KAN A;  5DPT A;  2MCN B;  3VUX A;  3EC8 A;  3M63 B;  4RMA A;  2IY0 B;  4TUU A;  2NBW B;  3ALB A;  3V6E B;  2KC2 A;  3ZUN A;  2M0X A;  3SU8 X;  3HK0 A;  2BKF A;  4GSW A;  1WI0 A;  3H9D A;  1K8R B;  2FID A;  2KDB A;  3JVZ X;  5J18 A;  1UZX B;  4NY0 A;  1TBE A;  2J7Q B;  2KDF B;  1E5W A;  2DAJ A;  4HLE A;  3SD5 A;  4LCD E;  2CR5 A;  1WF9 A;  1WM3 A;  2EMT A;  4K81 A;  2LZ6 A;  2N4F A;  1QZE A;  5C1Z A;  2KWU B;  3N32 A;  4FA6 A;  2D11 A;  4MSQ B;  4EEW A;  3RZW C;  3ZNG C;  1E90 A;  4MJS A;  4EZJ A;  4TQ0 A;  1WRD B;  2NCN A;  2LI5 A;  4DDG D;  1XT9 B;  3RUI B;  5DPS A;  1ZW7 A;  4XC2 A;  2N7E A;  3R7R A;  1WY8 A;  3RUL A;  4GIV A;  2DZM A;  4W9J A;  1UEL A;  3MTN B;  3V6C B;  3GOE A;  1KOT A;  3R7Q A;  2G4S A;  4I6P A;  1EF1 A;  2NPT A;  3H1U A;  4XZ4 A;  4GOC A;  1TZ1 A;  4ANU A;  1E8Y A;  1V5T A;  2BPS A;  4HDO A;  2LGY A;  2J0J A;  3K9O B;  3ZLZ A;  3A33 B;  1L2N A;  3PPA A;  4KV2 A;  2MP2 A;  1IP9 A;  4GU2 A;  3TMP B;  5EDS A;  3BIN A;  2R2Q A;  3DBS A;  2KQ7 A;  4LDT B;  4TKN A;  1P98 A;  4WJN A;  2NBU A;  4IW0 A;  2C5L C;  3PS6 A;  2ZPN A;  3VQI A;  4K7W A;  3JSV A;  5DCN A;  3U8Z A;  5D94 A;  3WIM A;  1GJZ A;  1RLF A;  3DOW A;  4X57 B;  1UH6 A;  5CHW A;  3PSE B;  3DVN V;  1A5R A;  5LXI B;  1YX6 B;  1CMX B;  1UD7 A;  2DZK A;  2D07 B;  4IM2 A;  5IAA C;  4KZC A;  4B95 A;  1WM2 A;  3PLU A;  2BF8 B;  2NBV B;  3R3M A;  5HKH A;  1E7V A;  2LXA A;  4MGZ E;  1V86 A;  3ZKJ C;  4MGK E;  4DHZ B;  1WGD A;  4WWN A;  1KM7 A;  2A5U A;  4W9I A;  3QC8 B;  4WJP A;  1FXT B;  2IO2 B;  2O6V B;  4RM9 A;  2LVP A;  4W9G A;  3ZNI D;  2WYQ A;  1WXS A;  4JQW C;  4DHZ E;  3KVF B;  3B0A A;  4GN1 A;  2XEW A;  4KZ0 A;  4FBJ B;  2KJR A;  2M17 A;  4G50 A;  1S1Q B;  2KZR A;  2BYE A;  5CHF A;  1V5O A;  1WGY A;  2K39 A;  2KX0 A;  4HPL B;  2PPH A;  3ZTD A;  2N7D A;  4JL9 A;  1UBI A;  1V80 A;  2M1M A;  4DDI D;  4TQ1 A;  2KVR A;  2ZJD A;  4EZK A;  2FAZ A;  1Z2M A;  4A3P A;  2IYD B;  4IWO A;  4DHJ D;  2KOX A;  2KC1 A;  3APC A;  4MSM B;  4JIO U;  3RCZ A;  3CF6 E;  5E6O A;  4E74 A;  5J2R A;  1I42 A;  2RR9 A;  2MBE A;  1PQS A;  2JT4 B;  2KX3 A;  4NAW A;  4M8N A;  4KIK B;  5D6J B;  2G45 B;  4BKG A;  5DPW A;  5JZE B;  5E6N A;  2L05 A;  3DDC B;  3PTF C;  2K8C A;  1OTR B;  2JZZ A;  3HHM A;  3NZS A;  2EKE C;  2DHZ A;  1Q5W B;  2KWV B;  3KUZ A;  2KN5 A;  3VHT C;  4HK2 A;  4DBG A;  3PT2 B;  2K8B A;  3DVG X;  1WYW B;  2KD0 A;  3D32 A;  1WE6 A;  2W9N A;  3V62 A;  4HWI B;  3VDZ A;  1GNU A;  1NI2 A;  1WFY A;  1WR6 E;  4E3C A;  4OVU A;  4NQL B;  4OVV A;  2BKR B;  3V61 A;  2OJR A;  4PS7 A;  2ZZP B;  2Z0D B;  1ZKH A;  2PJH A;  2UWQ A;  3PV1 A;  4FUL A;  2MBQ A;  1TTN A;  3U7D A;  1H4R A;  3W1Y A;  3KYC D;  1VCB A;  3WA0 A;  1LM8 B;  2MLB A;  2GOW A;  2L0F A;  4GGQ A;  1RRB A;  4PYU A;  5E6P A;  3VH4 B;  5L95 C;  3B08 A;  3M3J A;  4II3 B;  1VD2 A;  1OQY A;  3PGE A;  4GMV A;  3VAW A;  1IYF A;  4K7U A;  2MRP A;  4E71 A;  1WXA A;  4RM8 A;  5AZF A;  3UQA A;  3PRZ A;  4IUM B;  3VVW B;  4G0N B;  2KHW B;  1E8X A;  3KW5 B;  1E8W A;  2WX0 A;  3L17 A;  1R4M I;  4WQO B;  1MG8 A;  2KWC A;  2J0M A;  4BOZ B;  1ZGU B;  4HCN B;  3B1L X;  3DVN U;  3VUY A;  1WMH B;  1WX7 A;  2L00 B;  2KDE B;  4HJK A;  4XX5 A;  4ZRK A;  2D10 A;  1WZ3 A;  4TV3 A;  3X0W A;  2KJ6 A;  5C23 A;  1C1Y B;  4CYE A;  2Y5B B;  1YQB A;  2ZVN A;  2MSE D;  2KKC A;  3ZNZ B;  4JLC A;  3AUL A;  3QA8 A;  4A3O A;  2O6V A;  2K25 A;  2FNJ B;  4G3X B;  1LQB A;  2K8H A;  2V4L A;  4AUQ C;  4ZDV A;  1V81 A;  1WJ4 A;  5BO4 B;  2ASQ A;  3IHP C;  2HE7 A;  2KMC A;  3OJ3 A;  2BGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...