3ZUNA

Pvhl54-213-elob-eloc complex_(2s,4r)-4-hydroxy-1-(2-(3-methylisoxazol- 5-yl)acetyl)-n-(4-nitrobenzyl)pyrrolidine-2-carboxamide bound
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
102
structure length
102
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Elongin-B, Elongin-C, Von Hippel-Lindau Disease Tumor Suppressor Complex
rcsb
source organism Homo sapiens
total genus 20
structure length 102
sequence length 102
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zunA00
1C1YB 3DBHI 2IBIB 2I1JA 2FCMA 3UIOB 3QA8A 2MRPA 2MLBA 4NY0A 4I6NB 2NS5A 4GDKB 1MG8A 1KJTA 1WH3A 3IHPC 2KJRA 4DK5A 2LRUA 4II2B 5C1ZA 4AUQC 3QWZB 4BKTA 4ZYNA 4K7WA 1YX6B 4YL8A 3OJ3A 5KHOA 3VUYA 4I6LB 2PE6B 4K81A 2IO2B 5CHFA 2MX2A 5D7GA 2IY0B 3CF6E 2ZJDA 3GOEA 3PS6A 4IWOA 3D32A 4IWPA 2MSED 2K25A 3AU5A 3CMMB 3WAMA 1UZXB 5L95C 3RULA 4AWJA 2BKRB 1BT0A 1TGZB 2KFJA 4DDGD 3X23A 3JVZX 2JT4B 4HDOA 4GB9A 5CHVC 3V62A 3WAOA 2G4DB 4W9EA 2KNBA 2D3GA 3PLUA 5BO4B 4NJ7A 4IC7B 1U4AA 3W1YA 3QARA 2EMTA 2DENB 3CSTA 2KWCA 4JL9A 4MJSA 4DDID 2C60A 3PLVA 2RSUA 3DVGX 3MTNB 3QQ8B 4IUMB 4WWPA 4A3PA 4CHKA 1GC7A 4EZJA 1OQYA 4MDKE 1Q5WB 3RD2A 4E71A 3JSVB 4W9DA 4FHKA 1S1QB 1D3ZA 4WJQA 2LWPA 4EOYA 2RPQA 4W9IA 2KMAA 4IM2A 2A5UA 2ZVOA 2CHWA 3L13A 3WAPA 4FJVB 1WIAA 3ZNHB 3RT3B 1HE8A 4HK2A 5E6NA 4W9JA 4EFOA 3NZUA 1GNUA 2BGFA 3PPAA 2CKHB 1V2YA 1NDDA 1RFAA 3LJ3A 3ECIA 1IP9A 2CHZA 3AI5A 1NBFC 3HIZA 3PHWB 2C9WB 4W9CA 1WGRA 2JF5A 1A5RA 4TQ1A 1WI0A 3A9JA 2KLGA 4MGZE 4A3OA 1RAXA 2ZNVC 4X57B 2K8BA 2ZCCA 4B95A 1KOTA 3VTWA 5J2RA 3APCA 4PS7A 3WIMA 4DWFA 2FIDA 3O65B 2MWSB 2FUHB 2G4SA 1LFDA 4MH0E 4XX5A 2NPTA 4HPLB 2JZ3B 2N4FA 4J6IA 3VTUA 2DZJA 2LJ5A 1C3TA 2NVUI 5JHBA 3UIPB 1ZW7A 2OOBB 2OJRA 1E5WA 3AU4A 3DPDA 4P7IA 4LJOB 4MJSB 2V4LA 3PRPB 4JQWC 3M62B 2L05A 1R4MI 1TZ1A 2N9PC 5TR5A 3DCGA 3AXCA 3PT2B 4MGIE 4DHZB 3A4RA 1EO6A 2GOWA 2ZPNA 4IM3A 2PJHA 2AL6A 3PV1A 2D10A 1OGWA 3TBLD 3V6EB 2L0FA 3CSFA 1UBQA 4MSMB 3RCZA 1WXMA 2MBOA 4K1RB 4BKSD 4FN2A 1WJ6A 5LLIA 1ISNA 4F7ZA 1M94A 3A4SC 4KSLC 4CO7A 2N7EA 3S2AA 3TJPA 2UWQA 4HLEA 4RMAA 3ZVVA 3A9KA 1TTNA 4FHJA 1H4RA 1RRBA 1Q0WB 1WX9A 2NBWB 1WM3A 3EECA 1ZGUB 2CS4A 1WXVA 4WJOA 4B9KA 1E7UA 4G3XB 2N9XA 4JLCA 2Y5BB 4KZCA 3DBLI 1SGHA 4WJNA 1EF1A 3A9JB 3KH0A 2L8JA 4JIOU 1P9DU 2DZKA 2HJ8A 1WE7A 2K6DB 2W9NA 3ZNZB 4HPMB 1WJUA 5IA7A 2J0JA 3L16A 3PGEA 4GU2A 1WFYA 2L0TA 2KANA 2NBVB 4NAWA 2MQJA 3WA0A 4E74A 4F1SA 1UH6A 2HD5B 3JYUA 4KDIC 4EKUA 4M8MA 1WGYA 5AEKB 4W9KA 1LQBA 1R4NI 3ML8A 1WRDB 4G50A 4NQLB 1E7VA 1I35A 4ZDVA 1RLFA 3K9OB 2ASQA 2QHOA 3VH4B 3QHTA 3P2BA 2CU1A 2IYDB 4HXDA 3AULA 1YJ1A 3MJWA 5HKHA 3PRZA 4IG7B 2K8HA 2YVCA 1H8CA 3K9PB 5G55A 2MCNB 1V5TA 2KOXA 3HM3A 2IY1B 3V61A 1YX5B 4A20A 2KTRB 4TV3A 3ONSA 4ICVA 3UGBB 1G6JA 2N1VA 4NQKE 5EDSA 2A4ZA 2KD0A 2IO3B 1F9JA 3L54A 3ZNGC 1E8ZA 3PVLA 3N3KB 5AZGA 3APDA 2LI5A 3QC8B 5G2NA 1WGHA 3DBSA 1GC6A 4WJPA 2M4NA 3SHQA 2BF8B 4DXAB 2NBUA 1WXAA 1J0GA 1FXTB 1P1AA 2R2QA 2AEHA 2LD9A 2M8SA 1P3QU 5DPWA 2MBHA 3QAQA 2MP2A 4PS8A 4LDTB 3U30A 1AARA 2GBRA 4AJYB 5KHQA 3N30A 1GJZA 2L00B 4WQOB 4ANVA 2G45B 3TCAA 3B1LX 2M1MA 2RD0A 4AJWA 1WGDA 3IVFA 2LVPA 1P0RA 2LUEA 4LDTD 3EFUA 2BPSA 3HHMA 1YD8U 3UQAA 1KLVA 2DHZA 2KFKA 2LGYA 2LRWA 1PQSA 3PRMB 5DPTA 4ZRJA 2KDIA 1Z2MA 4M0WB 3UF8A 4DHZE 4CYEA 2B3AA 2MW5A 1WXSA 1UGMA 2FCNA 2LGXA 4PYUA 5CHWA 4TUUA 5E6PA 2WX1A 2KDBA 2PE9A 2XBBC 4N9F4 3ZTCA 2HE7A 4ASWC 4NJ6A 1WM2A 2PEAA 1OEYJ 2M17A 4W9FA 1GG3A 2LVOA 2O6VA 1VCBA 4GSWA 5J18A 3IG3A 1KM7A 2LXCA 3LDZE 2Z59B 2DZMA 1Y8RC 2KX3A 2KWVB 2XK5A 5LXIB 2I1KA 3ZW3A 4HDQA 4EUTA 2LASA 2DAJA 4AP4C 3L17A 3OAWA 5JZEB 1LXDA 2ZEQA 1V6EA 2JZZA 1E8WA 1WMHA 3N32A 4FLHA 3T8MA 4EZKA 1VD2A 1UELA 1IPGA 3VDZA 1V80A 3WALA 2DX5B 4OVVA 3R7RA 2BKFA 4ANUA 4BOSC 3PHXB 4HJKA 2L76A 2KDFB 4DBGA 4G0NB 2KC1A 4FADA 2JXXA 1E8YA 4IW0A 2FNJB 3M63B 2DYMA 1WJNA 3H7PA 4AOFA 2N1WA 4KVGB 4GDKA 5LXHA 5C23A 3BINA 4ANXA 2KFKB 2EMSA 4ZRIA 2KJHB 1WF9A 1TBEA 5D2MB 3PTFC 3U7DA 3KUDB 3KW5B 5GMVA 3NZSA 3GZNI 3RZFA 3RYTA 3KUZA 3IBEA 1WY8A 3KYDD 3VVWB 2FCQA 2HTHA 2JY6A 4MM3A 3VTVA 5D6JB 1WR6E 4HCPB 3VHTC 1OEYA 2IO0B 2KJ6A 2KQ7A 3PREA 3RUIB 5JHAA 4GN1A 4F8CB 2BWES 2K8CA 2K6QA 2O6VB 5L83A 1Q1OA 3NOBA 3V6CB 3V60A 4RM8A 2K39A 2BYFA 3H7SA 4GXBA 4E3CA 3ZRFA 2NPTB 1XQQA 4MGKE 3PSEB 2EKEC 2LVQA 2O6VD 4PS3A 2C7NB 2DZIA 3U8ZA 3DBRI 4RM9A 2ZZPB 4II3B 4DHJB 1YIWA 1UD7A 2FCSA 3QCAA 2C7MB 3EC8A 2KQSA 2V3SA 4TKNA 3VAWA 1V49A 3BY4B 4GOCA 2BYEA 2R2OA 1K8RB 3DOWA 4DHJD 2J0MA 2CHXA 2AYOB 2D2QA 2ZCBA 1J19A 1QZEA 2KVRA 3B0AA 3DVNV 3ZLZA 3I3TB 1J8CA 2WDTB 3Q3FA 1WR1A 1V81A 4MEMA 4GMVA 3ZUNA 1IYFA 4GGQA 1WYWB 4KV2A 3H7PB 2GBNA 4BBNF 1YQBA 1E90A 3A9KB 2KMCA 1LM8B 4XC2A 3T9LA 1GUAB 1XT9B 2C5LC 5DCNA 2AL3A 2MBQA 1T0YA 2C7HA 2LZ6A 4W9LA 1WZ0A 3PZDA 3TIXA 4BVUC 4LCDE 5D94A 2VRRB 3APFA 2NCNA 4KSKC 2MA9B 3VH3B 3H1UA 2MBBB 1CMXB 4MSQB 2D11A 4LJPB 4BFRA 5AZFA 3NS8A 1X1MA 3A33B 3X0WA 2IZVB 3DQVA 2JVCA 3A1QA 3R7QA 3VFKA 3HK0A 4NAWB 2GBKA 1JRUA 3H9DA 3M3JA 3SDLC 2MBEA 3NY5A 2JRIB 4IWQA 4KDLB 3ZRCA 3QK0A 2IO1B 2RGFA 3IFWB 2JUOA 4HWIB 3TMPB 4HVBA 2G3QB 3ALBA 5J17A 2O2VA 2RR9A 3KUCB 2KTFA 2XEWA 4JGHB 1WX7A 4ANWA 2KK8A 3VUWA 2JPHA 3ZKJC 3HM6X 4BKSA 2FIFA 1V86A 2ZVNA 2M0XA 5CX3A 5AZHA 1V9JA 4NNJB 3ZO5B 3ZDMC 3W1SA 2KDEB 2KKCA 2FAZA 4FULA 5FR6A 4G11A 3W1SC 4EEWA 4OVUA 4WWNA 2N9EB 3OJ4B 2KZRA 1EF5A 2LGDA 4W9HA 3RZWC 2BYVE 2REXA 2KWUB 2Z0EB 2LXAA 5DPRA 1L2NA 2WWZA 3EHVA 5DPSA 4NPNA 2KC2A 4GDLA 2L7RA 3QJZA 3TL5A 2UYZB 3M95A 1V5OA 3NHEB 4GIVA 4K7SA 4PYZA 2DYBA 3ML9A 1SE9A 2DYOA 4KIKA 4FBJB 1SIFA 3KVFB 2ZPYA 3A1QB 2DAFA 5IAAC 2MP2B 1WE6A 2GBJA 3ZDTA 4K7UA 3DVGY 1P98A 4MELA 4WAAA 1S3SG 2JWZA 1UBIA 2L3ZA 2NR2A 3H6NA 3L10B 2GBMA 1XD3B 4BBNC 4BKGA 1E8XA 1WGGA 2KHWB 2Z0DB 3C0RB 3R3MA 2J7QB 4I6PA 2O2VB 3VUXA 1NI2A 3ZNID 2KX0A 3L0WB 3QIJA 3VXWA 4URKA 2KLCA 3SD5A 3WANA 3UINB 3L08A 4B6WA 2JRHA 4FA6A 2YLMA 2J0KA 5E6OA 4KZ0A 3SU8X 3ZTDA 4ZRKA 1OTRB 1EUVB 2BWFA 3DVNU 2KN5A 2KTRA 1I42A 4TQ0A 3QX1A 3KYCD 2CR5A 2WX0A 5CTRC 3ENEA 3Q3JA 4FJYA 2GMIC 4HCNB 3ZIMA 1WZ3A 4WWOA 4M8NA 2AWTA 2ZNVB 3JW0X 3DDCB 2XK5B 3MHSD 1L7YA 2PPHA 2D07B 2N7DA 1Z5SB 4FJZA 4XZ4A 3UQBA 4GDLB 4EZLA 4BOZB 1ZKHA 1WMHB 2V1YA 4W9GA 2WYQA 2K1FA 3OLMD 1WJ4A 4IM0A 4KIKB 3VQIA 3R66C 1WX8A 5JH5C 2KXJA 3B08A 2KO3A 4ICUA 4MGYE 3JSVA
chains in the Genus database with same CATH superfamily
1C1YB 1YN4A 3UIOB 3PZ8A 2MLBA 2OHFA 4USAA 3Q8FA 1K53A 2KJRA 2WXPA 4II2B 4P6VF 5C1ZA 4AUQC 3QWZB 3NJTA 2AQ3B 4K7WA 1MHHE 2CU3A 4K81A 2EELA 4KKJA 5D7GA 5H92C 3CF6E 1YMHE 3GOEA 3D32A 1KTKA 2K25A 3WAMA 1BT0A 4GB9A 5CHVC 5HHDG 4W9EA 4N59A 4IC7B 2IJ0A 3QARA 2EMTA 1TY2A 4MJSA 1NI3A 1FFVA 4DDID 5BYQA 3PLVA 2RSUA 3MTNB 1R7SA 1Q5WB 3RD2A 1D3ZA 4OZAA 2A5UA 2JQRB 4HRSA 3ZNHB 4UDUC 5E6NA 1YN3A 1E6EB 1E7PB 3NZUA 1GNUA 3PPAA 2CKHB 4M00A 1NDDA 1FEHA 3ECIA 3P4RB 3PHWB 2BQQA 1A5RA 1K52A 4TQ1A 4A3OA 1AN8A 1I4XA 2ZCCA 4B95A 5J2RA 2PVGC 3APCA 4PS7A 3ZXVA 1C79A 2H89B 3IT6B 2NPTA 4HPLB 2JZ3B 4S0RA 2DZJA 3NG0A 2IGGA 1ZW7A 2MJEA 1E5WA 3AU4A 3DPDA 4P7IA 3Q8BA 4MJSB 2PLPA 2L05A 1R4MI 5TR5A 3A4RA 3AB5A 2GOWA 3PV1A 2HJ1A 3TBLD 3V6EB 1UBQA 1ROEA 1QLBB 1PDXA 5LLIA 1GB1A 3DBRB 1ISNA 4KSLC 1C77A 3TJPA 1SEBD 2LHDA 4YTPB 3AEBB 2NBWB 1WM3A 2CS4A 1WXVA 4XDDA 1E7UA 2KDMA 3MP9A 1SGHA 1EF1A 4XGAB 2HJ8A 1JMLA 4RGMA 4HPMB 1WJUA 1J7AA 5FK9C 5IA7A 4GU2A 1YN5A 2NBVB 4NAWA 5FKAC 3WA0A 3JYUA 5TSSA 4KDIC 4BZAA 4M8MA 1FCLA 2IGHA 1K50A 1I35A 3AE7B 3K9OB 3WCQA 3Q8AA 1JW9D 1B1ZA 4HXDA 3MJWA 3PRZA 2K8HA 3LXFA 3C19A 2V4IB 3AEGB 2MCNB 2WDRB 1L6VA 3P42A 4J3OD 4ICVA 2N1VA 1TS2A 2A4ZA 2BVCA 2WU2B 1VZ7A 2LI5A 3QC8B 2QSDA 2VZKB 3NVYA 4A6QA 1FD6A 3DBSA 1GC6A 1DOXA 2BF8B 4DXAB 1FNVA 5DPWA 2R2QA 2AEHA 2LD9A 1P3QU 3MHZA 4RNAA 1DGJA 4PS8A 4LDTB 3N30A 2L00B 3AECB 1SE4A 3B1LX 2RD0A 1WGDA 3EFUA 2BPSA 3NRZA 1PQSA 1KH0A 1I4RA 3PRMB 3TEWA 2KDIA 3B9JA 2B3AA 2WGSA 1UGMA 1ZXHA 3KWLA 4LK0M 1L4DB 3KWVA 2WX1A 2KDBA 4ASWC 3VR9B 1GG3A 1VCBA 4GSWA 1R4MB 2LXCA 3UI3A 2Z59B 4B0EA 1ZOYB 4KGSA 2I1KA 4EUTA 2UU7A 2LASA 3L17A 5JZEB 2AQ1B 2ZEQA 1TKGA 2JZZA 3N32A 1E8WA 3NVWA 4REZA 4JWSC 2DX5B 4TSSA 5LNK1 3R7RA 2L76A 4DBGA 2KC1A 1WYGA 5EE0A 1FPYA 4OW0A 2WXQA 2XN9C 2N1WA 3PZ7A 3BINA 4ANXA 1STEA 3KUDB 3RZFA 3IBEA 3KYDD 1E9MA 4US9A 2KJ6A 4F8CB 2E3TA 5L83A 3NOBA 3AE5B 3H7SA 5FR3A 5GXGB 4E3CA 1J7CA 4PT5A 2LVQA 2O6VD 1QT9A 2C7NB 4RM9A 2ZZPB 4HKZE 4RGNA 4JPSA 1TKEA 4GOCA 2BYEA 2JX5A 2J0MA 1D5XC 3DVNV 1RFKA 2AYOB 1QZEA 4MACA 1WR1A 3Q3NC 5G5HA 2GBNA 3A9KB 1GUAB 2C5LC 5DCNA 2AL3A 2MBQA 3TEYA 1WZ0A 3PZDA 3ABVB 3TIXA 2QEJC 5EE1A 4NAMA 2KAJA 1TS4A 1PGAA 2D11A 1MI0A 3DQVA 2JVCA 3VFKA 3HK0A 3SDLC 2MBEA 3ZRCA 1P7EA 1RWSA 3BWUD 3IFWB 4HWIB 3TMPB 2KTFA 4JGHB 1WX7A 4ANWA 3T3NA 1I4HA 2JPHA 2HTME 4BKSA 1EU4A 2FIFA 5CX3A 2M0XA 4C80A 1V9JA 4NNJB 3AV8A 2KDEB 1ZP0B 4IOIE 2KKCA 2FAZA 3PO0A 5BMIA 3I9V1 1WRIA 4RGTA 4OVUA 1C4PA 1EF5A 2X8XX 2BYVE 1TS3A 2LXAA 4C7YA 1VR9A 3QJZA 1BMLC 2AQ2B 1V5OA 3NHEB 4K7SA 4PYZA 2DYBA 1SE9A 2WS3B 1I7HA 2DAFA 4ZRQA 2JXTA 4YTNB 2JYTA 4MH8A 4MELA 4WAAA 1S3SG 1UBIA 2L3ZA 1WGGA 2KMMA 3Q14C 4I6PA 5IP4D 2W3RA 4URKA 3WANA 2EKIA 3FAHA 3L08A 4B6WA 2J0KA 1XXGA 1MFWA 1SJHD 1MVKA 4ZRKA 1OTRB 1SBBB 1R4NB 4HEA1 5IKCM 1FXAA 3CWIA 4FXCA 2ON8A 2CR5A 1CZPA 3FILA 1YQ3B 3N1YC 4N6EB 2WXIA 2AWTA 4XZ4A 1I4PA 4EZLA 1T0RC 3Q3OC 1WMHB 3AE8B 4BOZB 1J7BA 2QILA 3OLMD 1WX8A 1HA5A 3BVMA 2KO3A 4ICUA 3GE8C 1L6UA 3RNGC 3JSVA 2W82A 2IBIB 2I1JA 1SE3A 4GDKB 1WH3A 4XYCA 3MC9A 3CIRB 3NZ3A 1YX6B 3OJ3A 3VUYA 2BB5A 2MX2A 2YEPB 4IKGA 2IY0B 3PS6A 3CMMB 4A90A 5L95C 2KYWA 4DDGD 3X23A 3FILB 4HDOA 3V62A 3WAOA 2G4DB 2LMCA 3DHIC 2KNBA 5BO4B 1U4AA 4LTUA 4BAXA 1C78A 3W1YA 1E0ZA 1YJIA 1HEZE 4WWPA 4CHKA 5AUIA 2N0SB 1OQYA 3JSVB 3DHHC 4N58A 4W9DA 2BB6A 4EOYA 4P1CC 3SEBA 1D6EC 4ZHOA 2CHWA 1XF5L 3L13A 1OFFA 3WAPA 4FJVB 3LYYA 2WDQB 3IXSA 3AE2B 1ZDXA 2R61A 3R2TA 1IP9A 2CHZA 3AI5A 1NBFC 1WGRA 3TEZA 3LB8C 2W54A 3A9JA 2KLGA 4X57B 1TYGB 3P1MA 3VTWA 2FIDA 2PTLA 4MH0E 4J6IA 3VTUA 2LJ5A 2NVUI 5JHBA 2OOBB 3PRPB 3AXCA 3PT2B 2PJHA 1RM6C 4RFBA 4MSMB 1FO4A 3RCZA 4FN2A 1YJJA 2D3CA 2UWQA 4HLEA 2BT6A 3Q69A 1T3QA 4FHJA 1WX9A 1Q0WB 2PMVA 3EECA 1ZGUB 2WQYB 2QDFA 1V1OA 4WJOA 4RH6A 4G3XB 2N9XA 4JLCA 3DBLI 1D4BA 4WJNA 3A9JB 2RPVA 2DZKA 3Q6BA 3ZNZB 3E9SA 2JWUA 2ZW1A 2Z8LA 4F1SA 3IT4B 1LO5D 1QQRA 2HD5B 1SJED 2M0AA 4HJGE 1WGYA 4W9KA 2QIEB 4WQMA 2FBWB 1JALA 3VH4B 2RDBC 2L83A 1MG4A 3P2BA 1XLPA 2WXRA 3AULA 2J52A 5G55A 1V5TA 2IY1B 3V61A 1V1PA 3UGBB 5EDSA 1UF0A 1IGCA 1WXQA 1T6BX 5AZGA 4JE3B 1SE2A 4K3CA 5BYSA 3Q3MC 1XLNA 2M4NA 4LNKA 2NBUA 1J0GA 4RF1A 2VZKD 1QF6A 2MP2A 4AJYB 3U30A 1AARA 5C3JB 1L0YB 4ANVA 3TCAA 3C8YA 4C4VA 4LDTD 3UQAA 1KLVA 4DXGA 4PYUA 2LGXA 4TUUA 3VRAB 1JCKB 2PE9A 1WM2A 4RGOS 2M17A 2LVOA 5J18A 3IG3A 3LDZE 1V97A 3R8BA 2DZMA 2E6XA 3ZW3A 3MC8A 2DNFA 1EWCA 1N63A 1UELA 1IPGA 1FM0D 4OVVA 3Q8CA 4BOSC 5D3DA 4FADA 4G0NB 3RNFC 1E8YA 4IW0A 2SAKA 2FNJB 4P16A 4C4VB 3T3OA 2EMSA 4ZRIA 1FCCC 3NZSA 1TT5B 3GE3C 1WY8A 2Q5WD 2JY6A 2VH1A 4MM3A 2Y5PA 3VTVA 2J4XA 3VHTC 3PREA 3RUIB 2BWES 2LHEA 1SF0A 4RM8A 4GXBA 1JWAD 3ZRFA 2NPTB 1XQQA 4ITKA 3V3XA 1E10A 4PS3A 2DZIA 4II3B 4DHJB 3TEXA 2I2YA 3QCAA 2V3SA 3VAWA 3DWGC 1JWUD 5BYRA 1J8CA 4KV2A 1WYWB 1E90A 1LM8B 3T9LA 1HXYD 1UUPA 2C7HA 2LZ6A 3TSSA 1XO3A 4LCDE 2G9HD 2VRRB 1XLOA 2MA9B 3IAM1 3VH3B 5HFYA 2MBBB 1CMXB 1F77A 2K3UA 5AZFA 3NS8A 3A33B 1KRHA 3R7QA 4NAWB 2GBKA 2JRIB 1DOIA 1TKYA 4YTMB 4H2AA 4ZYSA 1EM7A 2JUOA 2G3QB 3KUCB 3RI7C 3ZKJC 3HM6X 4OHJA 1I4GA 1XCTL 5AZHA 2PKOA 3ZJUA 3ZDMC 4S17A 2K5PA 4FULA 4G11A 2INPE 3OJ4B 1QILA 2KZRA 4W9HA 1FRRA 2REXA 2K9XA 2WWZA 5I4DA 2KC2A 4GDLA 1ESFA 2UYZB 1YOVB 1JRPA 4KIKA 3KVFB 2BS4B 1KLUD 3ZDTA 3HRDD 1E8XA 2KHWB 4AS1A 2I38A 3L0WB 1XEEA 2WXLA 2KLCA 3SD5A 3SR6A 3UINB 1IBXA 2YLMA 1XLQA 3ZTDA 5G5GA 4LLGM 3DVNU 2KTRA 4A55A 2FE8A 4FJYA 2L1AA 4WWOA 2LFIA 2ZNVB 3DDCB 2D07B 2N7DA 1Z5SB 2WXHA 4GDLB 1ZKHA 2V1YA 4W9GA 5IO9A 3ETRA 5IN7A 4IM0A 4KIKB 3R66C 3RNEC 1JROA 2VH2A 1UWXA 3BZDB 3DWMA 1GPXA 2FCMA 3QA8A 2WXMA 3RNBC 4NY0A 2NS5A 1MG8A 1WSPA 1KJTA 2LRUA 1SB3C 1TY0A 4BKTA 1VLBA 3ZGZA 2IPKD 4HPPA 2IO2B 5CHFA 5JXVA 3AN1A 1QOGA 2MSED 1ET6A 1UZXB 2G1EA 3RULA 4AWJA 2V0GA 3JVZX 2JT4B 4NJCA 1F0ZA 5EE3A 2D3GA 3Q2AC 4NJ7A 3AE1B 3J9CA 4M01A 4IUMB 3QQ8B 4A3PA 2GLSA 4FHKA 2LWPA 2RPQA 4W9IA 4IM2A 4D2KA 4P1BC 1WIAA 3VR8B 3RT3B 1HE8A 1PYWD 4HK2A 3HUIA 4W9JA 4EFOA 1ACCA 1V2YA 1NENB 4YXDB 3HIZA 2C9WB 3OWEB 1RAXA 1FNWA 2BS3B 3WIMA 2MWSB 2H88B 2FUHB 1LFDA 5HI1A 4XX5A 1C3TA 2N4FA 3UIPB 4KGTA 4ZRPA 5BMGA 1JWMD 3O13A 2V4LA 1FIQA 4JQWC 3M62B 1TZ1A 2N9PC 3DCGA 1UGJA 4MGIE 5T8IA 3AH7A 3I63C 1EO6A 2ZPNA 3W5VB 2RMMA 3V05A 1OGWA 2L0FA 3CSFA 1MHXA 2MBOA 3SFEB 1WJ6A 4XDCA 1M94A 3A4SC 4OZBA 4CO7A 3S2AA 1FFUA 4RMAA 1OQRA 1JWBD 3ZVVA 3Q8EA 4ARIA 4B9KA 4KZCA 1PGBA 2Y5BB 1JWSD 2Y3AA 4WAFA 3KH0A 2L8JA 2W9NA 1WE7A 2K6DB 3EUB2 2V9HA 2J0JA 3L16A 1WFYA 2SEBD 2L0TA 2MEKA 2KANA 2BYTA 4E74A 4O1NA 5AEKB 3RFZB 1LQBA 3HVDA 3ML8A 1WRDB 4NQLB 1E7VA 3ZJVA 4ZDVA 1RLFA 4DQOC 3N9YC 3QHTA 4A8XC 2BBCA 2CU1A 2IYDB 5HKHA 1YJ1A 4M0WA 4IG7B 2YVCA 1H8CA 2AX5A 3K9PB 1HQRD 2NTTA 2KOXA 3URYA 4TV3A 3ONSA 3P4PB 3OG5A 4QAYA 3P4QB 2KD0A 2IO3B 1F9JA 3L54A 1C4AA 3PVLA 3N3KB 1SSNA 2CJNA 4LNFA 3P4SB 5G2NA 3BYTB 1N62A 2BW2A 4WJPA 3NS1A 1FXTB 1UWMA 2GRIA 2M8SA 2MBHA 1BUIC 1QOBA 2KN4A 2GBRA 1AYFA 3P63A 2QJLA 4KGRA 4L23A 2HDEA 3IVFA 3I5JC 2LVPA 2JSVX 3HHMA 1YD8U 3BIID 2KFKA 2LRWA 1F52A 4ZRJA 4M0WB 4DHZE 4CYEA 2MW5A 1WXSA 2FCNA 5CHWA 2RDHA 5E6PA 1CQVA 5HG2A 4YSZB 3ZTCA 4NJ6A 3EFCA 1L0XB 4EE2A 2BTEA 4W9FA 3GB1A 2WXFA 3U2SC 3W9CB 1KM7A 1HTQA 2INDC 2KWVB 4NZLB 2XK5A 4B0MA 2QMTA 1LXDA 3T8MA 1V6EA 4EZKA 2QC8A 3VDZA 2OJWA 4RCOA 2JXXA 1MPEA 3M63B 2DYMA 2GI9A 4ZHPA 1IGDA 4KKIA 2W3SA 4KVGB 5LXHA 5AUKA 2L32A 2KFKB 1UNSA 1TBEA 1VJKA 3N1ZC 4MT5A 3KW5B 5GMVA 3RYTA 2HTHA 1HTOA 2FUG1 1DOYA 3I57A 5D6JB 1WR6E 2TSSA 2WNMA 4HCPB 2KQ7A 4DXFA 5JHAA 2K8CA 1FNUA 3V6CB 3V60A 2K39A 2BYFA 4PK1A 4MGKE 4YWGG 2IDYA 3PSEB 5EE9A 2EKEC 3U8ZA 3DBRI 2N9LA 1F2RI 1YIWA 1UD7A 2FCSA 3EGRA 2KQSA 1FRDA 1L4ZB 4TKNA 3BY4B 4OVZA 3DOWA 4DHJD 2D2QA 2ZCBA 1CK1A 1J19A 2KVRA 3ZLZA 3I3TB 1C76A 2WDTB 2NTSA 1N60A 4US8A 4BBNF 4XC2A 2KMCA 1RYJA 3ZQ4A 4JX1C 4W9LA 4BVUC 1ENFA 2RDGA 5D94A 3APFA 3H1UA 4LJPB 4BFRA 1X1MA 1SXTA 2IZVB 2BS2B 3AMZA 2OEDA 3H9DA 3M3JA 3R2IA 4IWQA 3QK0A 4WWMA 4HVBA 3B2FA 5J17A 1HZ6A 2KK8A 3VUWA 2ZVNA 2ONQA 2V3NA 3ZO5B 3W1SA 1V1PB 2INCC 1N6ZA 5FR6A 2WXOA 3HVZA 3W1SC 4EEWA 2WU5B 5MPOA 2GB1A 3BYYB 4WWNA 2LGDA 3RZWC 1F2RC 2WXKA 3AE4B 5DPRA 1QOAA 3EHVA 4LNIA 1TJEA 1AWDA 2D5GA 4YSXB 3H8HA 4ARCA 3ML9A 2QCZA 4FBJB 1VDVA 1SIFA 4KX6B 2ZPYA 5IOIA 5IAAC 2MP2B 1WE6A 2LGSA 4K7UA 1IUEA 3DVGY 4CQNA 3SFDB 2X38A 4C56C 2NR2A 3H6NA 2M19A 4BKGA 1VRAB 3DBLB 1I4QA 2J7QB 2INNE 4A9AA 2LJIA 3VUXA 4WH4A 3W5UB 2KX0A 2KT7A 3MFGA 2JZPA 1ZPSA 5E6OA 4KZ0A 3SU8X 1P7FA 2MHJA 2PW9A 2KN5A 5H8YE 1M4VA 3ENEA 4HCNB 3ZIMA 1WZ3A 4M8NA 1L7YA 2PPHA 2W55A 4FJZA 3UQBA 2K1FA 1WJ4A 5JH5C 3ZXRA 2KXJA 4MGYE 3BVZA 3DBHI 1HZ5A 2MRPA 4I6NB 3IHPC 4DK5A 1SIJA 3GP7A 4ZYNA 4YL8A 1V8CA 5KHOA 2K0PA 2LGIA 4I6LB 2PE6B 4MM3B 2ZJDA 4IWOA 4XE0A 4IWPA 3AU5A 2BKRB 2KFJA 1TGZB 2IGDA 1WGKA 3PLUA 1B9RA 1TZOA 1LGRA 3ZYYX 2DENB 2XNAC 3CSTA 2KWCA 4RF0A 1ZE3D 4JL9A 2C60A 4C7ZA 3DVGX 4LNOA 4L1BA 1GC7A 4EZJA 4MDKE 4E71A 3W2DA 2L52A 1S1QB 4WJQA 2K22A 2KMAA 2ZVOA 1C9FA 4HROA 1Y56A 4JWUC 1AW7A 1KLGD 3TUOA 2BGFA 5C2TB 1RFAA 3LJ3A 3AEDB 4W9CA 3NUHB 2JF5A 1ZUD2 1WI0A 3B2GA 4TMAB 2M56B 4MGZE 2ZNVC 2K8BA 1KOTA 1NEKB 4IDIA 4DWFA 3O65B 2G4SA 1ET9A 2KQ4X 1ZXIA 2OJRA 1FMAD 4LJOB 4C00A 4DHZB 4WIPA 4IM3A 3RMKC 2AL6A 2D10A 2JYEA 3RN9C 2PIAA 1WXMA 2CJOA 4K1RB 4BKSD 4F7ZA 4LNNA 2N7EA 3BK1A 3A9KA 1TTNA 3MJ5A 1H4RA 1RRBA 1QOFA 1PGXA 1JQ4A 1ZDVA 2ZW0A 3BVGA 2KACA 1YQ4B 3DBHB 4JIOU 1P9DU 2WXJA 3U52E 3E56A 3PGEA 1WWTA 1GAQB 2MQJA 1UH6A 2ICIA 4EKUA 3RPFC 1R4NI 2PVOD 3AM9A 4G50A 2ASQA 2QHOA 2LEKA 1VZ6A 1T0QC 3KLSX 1IBXB 2JU6X 3HM3A 3N20C 1YX5B 3GS2A 4A20A 2KTRB 1G6JA 4NQKE 3BK2A 3FC4A 5BMHA 4HKQA 3ZNGC 4Q2JA 2D3AA 1E8ZA 1MJDA 3APDA 4OZCA 1WGHA 2N7JA 2V3PA 5E6JA 3SHQA 1WXAA 1P1AA 2WLBA 3QAQA 1D5MC 3AE3B 1GJZA 5KHQA 1NYRA 1NVID 4WQOB 2Y5CA 2G45B 3IAS1 2M1MA 3NVVA 4AJWA 3RNAC 1P0RA 2LUEA 2DHZA 2LGYA 5DPTA 3UF8A 1Z2MA 1PUTA 2XBBC 4N9F4 2HE7A 2N9KA 2PEAA 1OEYJ 2O6VA 1CJEA 1VZ8A 4YSYB 1Y8RC 1BXTA 2KX3A 5LXIB 3N1XC 4HDQA 2J42A 2DAJA 4AP4C 3OAWA 1KFYB 4FLHA 1WMHA 1T5XD 3NVZA 1VD2A 3WALA 1V80A 2BKFA 4ANUA 1GOZA 3PHXB 4HJKA 2KDFB 1D5ZC 4ACFA 2DBYA 2LUMA 1YNTE 1WJNA 3H7PA 4AOFA 4XWTA 2WP9B 4GDKA 5C23A 2KJHB 1WF9A 5D2MB 3PTFC 3MC0B 3U7DA 3AE6B 3GZNI 3KUZA 3VVWB 2FCQA 2WHIA 1OEYA 2IO0B 4GN1A 2K6QA 2O6VB 1KF6B 1Q1OA 4AQ7A 2WDVB 4ZOHC 1GB4A 1N5XA 1N5WA 3ZJTA 2J53A 2C7MB 3EC8A 1T0SC 1Q10A 1V49A 2R2OA 1K8RB 2CHXA 2ACZB 3B0AA 2KVZA 1L5PA 1FXIA 1XCQL 3Q3FA 1V81A 4MEMA 4GMVA 3ZUNA 1IYFA 4GGQA 3H7PB 1K51A 3L4PA 1YQBA 1NYQA 1XT9B 1T0YA 1EWYC 2NCNA 4KSKC 4XWWA 4MSQB 1TIFA 3AE9B 3X0WA 3FKYA 3A1QA 2YEPF 4YT0B 1JRUA 2D3BA 3NY5A 4K3BA 4KDLB 2IO1B 4WURA 2RGFA 3ALBA 2O2VA 2RR9A 2XEWA 2MJDA 1F1HA 3KQ4A 3DHGC 3AEAB 1V86A 1PFDA 1L0VB 1QKZA 4R3DA 2B76B 1OQQA 3AEEB 2N9EB 1N61A 2KWUB 2Z0EB 1L2NA 5DPSA 4NPNA 4L2YA 4GLSC 2L7RA 3TL5A 3M95A 4GIVA 2DYOA 3U7ZA 3A1QB 5D3IB 2GBJA 1P98A 2JWZA 3L10B 3GZNB 2GBMA 1XD3B 4BBNC 2Z0DB 3C0RB 3R3MA 2O2VB 2WXGA 1NI2A 3VRBB 3ZNID 2KWDA 3QIJA 3VXWA 2WXNA 3U4EG 2JRHA 4FA6A 4M02A 2MH7A 2DWQA 1EU3A 1TS5A 1EUVB 2MJ3A 2BWFA 1I42A 4TQ0A 3QX1A 3KYCD 2WX0A 5CTRC 3Q3JA 2GMIC 3JW0X 2XK5B 2NMQA 3MHSD 2DLBA 2WYQA 3EA6A 1DYQA 3VQIA 3RNCC 3AEFB 1C4CA 1A70A 3B08A
chains in the Genus database with same CATH topology
1C1YB 3DBHI 2IBIB 2I1JA 2FCMA 3UIOB 3QA8A 2MRPA 2MLBA 4NY0A 4I6NB 2NS5A 4GDKB 1MG8A 1KJTA 1WH3A 3IHPC 2KJRA 4DK5A 2LRUA 4II2B 5C1ZA 4AUQC 3QWZB 4BKTA 4ZYNA 4K7WA 1YX6B 4YL8A 3OJ3A 5KHOA 3VUYA 4I6LB 2PE6B 4K81A 2IO2B 5CHFA 2MX2A 5D7GA 2IY0B 3CF6E 2ZJDA 3GOEA 3PS6A 4IWOA 3D32A 4IWPA 2MSED 2K25A 3AU5A 3CMMB 3WAMA 1UZXB 5L95C 3RULA 4AWJA 2BKRB 1BT0A 1TGZB 2KFJA 4DDGD 3X23A 3JVZX 2JT4B 4HDOA 4GB9A 5CHVC 3V62A 3WAOA 2G4DB 4W9EA 2KNBA 2D3GA 3PLUA 5BO4B 4NJ7A 4IC7B 1U4AA 3W1YA 3QARA 2EMTA 2DENB 3CSTA 2KWCA 4JL9A 4MJSA 4DDID 2C60A 3PLVA 2RSUA 3DVGX 3MTNB 3QQ8B 4IUMB 4WWPA 4A3PA 4CHKA 1GC7A 4EZJA 1OQYA 4MDKE 1Q5WB 3RD2A 4E71A 3JSVB 4W9DA 4FHKA 1S1QB 1D3ZA 4WJQA 2LWPA 4EOYA 2RPQA 4W9IA 2KMAA 4IM2A 2A5UA 2ZVOA 2CHWA 3L13A 3WAPA 4FJVB 1WIAA 3ZNHB 3RT3B 1HE8A 4HK2A 5E6NA 4W9JA 4EFOA 3NZUA 1GNUA 2BGFA 3PPAA 2CKHB 1V2YA 1NDDA 1RFAA 3LJ3A 3ECIA 1IP9A 2CHZA 3AI5A 1NBFC 3HIZA 3PHWB 2C9WB 4W9CA 1WGRA 2JF5A 1A5RA 4TQ1A 1WI0A 3A9JA 2KLGA 4MGZE 4A3OA 1RAXA 2ZNVC 4X57B 2K8BA 2ZCCA 4B95A 1KOTA 3VTWA 5J2RA 3APCA 4PS7A 3WIMA 4DWFA 2FIDA 3O65B 2MWSB 2FUHB 2G4SA 1LFDA 4MH0E 4XX5A 2NPTA 4HPLB 2JZ3B 2N4FA 4J6IA 3VTUA 2DZJA 2LJ5A 1C3TA 2NVUI 5JHBA 3UIPB 1ZW7A 2OOBB 2OJRA 1E5WA 3AU4A 3DPDA 4P7IA 4LJOB 4MJSB 2V4LA 3PRPB 4JQWC 3M62B 2L05A 1R4MI 1TZ1A 2N9PC 5TR5A 3DCGA 3AXCA 3PT2B 4MGIE 4DHZB 3A4RA 1EO6A 2GOWA 2ZPNA 4IM3A 2PJHA 2AL6A 3PV1A 2D10A 1OGWA 3TBLD 3V6EB 2L0FA 3CSFA 1UBQA 4MSMB 3RCZA 1WXMA 2MBOA 4K1RB 4BKSD 4FN2A 1WJ6A 5LLIA 1ISNA 4F7ZA 1M94A 3A4SC 4KSLC 4CO7A 2N7EA 3S2AA 3TJPA 2UWQA 4HLEA 4RMAA 3ZVVA 3A9KA 1TTNA 4FHJA 1H4RA 1RRBA 1Q0WB 1WX9A 2NBWB 1WM3A 3EECA 1ZGUB 2CS4A 1WXVA 4WJOA 4B9KA 1E7UA 4G3XB 2N9XA 4JLCA 2Y5BB 4KZCA 3DBLI 1SGHA 4WJNA 1EF1A 3A9JB 3KH0A 2L8JA 4JIOU 1P9DU 2DZKA 2HJ8A 1WE7A 2K6DB 2W9NA 3ZNZB 4HPMB 1WJUA 5IA7A 2J0JA 3L16A 3PGEA 4GU2A 1WFYA 2L0TA 2KANA 2NBVB 4NAWA 2MQJA 3WA0A 4E74A 4F1SA 1UH6A 2HD5B 3JYUA 4KDIC 4EKUA 4M8MA 1WGYA 5AEKB 4W9KA 1LQBA 1R4NI 3ML8A 1WRDB 4G50A 4NQLB 1E7VA 1I35A 4ZDVA 1RLFA 3K9OB 2ASQA 2QHOA 3VH4B 3QHTA 3P2BA 2CU1A 2IYDB 4HXDA 3AULA 1YJ1A 3MJWA 5HKHA 3PRZA 4IG7B 2K8HA 2YVCA 1H8CA 3K9PB 5G55A 2MCNB 1V5TA 2KOXA 3HM3A 2IY1B 3V61A 1YX5B 4A20A 2KTRB 4TV3A 3ONSA 4ICVA 3UGBB 1G6JA 2N1VA 4NQKE 5EDSA 2A4ZA 2KD0A 2IO3B 1F9JA 3L54A 3ZNGC 1E8ZA 3PVLA 3N3KB 5AZGA 3APDA 2LI5A 3QC8B 5G2NA 1WGHA 3DBSA 1GC6A 4WJPA 2M4NA 3SHQA 2BF8B 4DXAB 2NBUA 1WXAA 1J0GA 1FXTB 1P1AA 2R2QA 2AEHA 2LD9A 2M8SA 1P3QU 5DPWA 2MBHA 3QAQA 2MP2A 4PS8A 4LDTB 3U30A 1AARA 2GBRA 4AJYB 5KHQA 3N30A 1GJZA 2L00B 4WQOB 4ANVA 2G45B 3TCAA 3B1LX 2M1MA 2RD0A 4AJWA 1WGDA 3IVFA 2LVPA 1P0RA 2LUEA 4LDTD 3EFUA 2BPSA 3HHMA 1YD8U 3UQAA 1KLVA 2DHZA 2KFKA 2LGYA 2LRWA 1PQSA 3PRMB 5DPTA 4ZRJA 2KDIA 1Z2MA 4M0WB 3UF8A 4DHZE 4CYEA 2B3AA 2MW5A 1WXSA 1UGMA 2FCNA 2LGXA 4PYUA 5CHWA 4TUUA 5E6PA 2WX1A 2KDBA 2PE9A 2XBBC 4N9F4 3ZTCA 2HE7A 4ASWC 4NJ6A 1WM2A 2PEAA 1OEYJ 2M17A 4W9FA 1GG3A 2LVOA 2O6VA 1VCBA 4GSWA 5J18A 3IG3A 1KM7A 2LXCA 3LDZE 2Z59B 2DZMA 1Y8RC 2KX3A 2KWVB 2XK5A 5LXIB 2I1KA 3ZW3A 4HDQA 4EUTA 2LASA 2DAJA 4AP4C 3L17A 3OAWA 5JZEB 1LXDA 2ZEQA 1V6EA 2JZZA 1E8WA 1WMHA 3N32A 4FLHA 3T8MA 4EZKA 1VD2A 1UELA 1IPGA 3VDZA 1V80A 3WALA 2DX5B 4OVVA 3R7RA 2BKFA 4ANUA 4BOSC 3PHXB 4HJKA 2L76A 2KDFB 4DBGA 4G0NB 2KC1A 4FADA 2JXXA 1E8YA 4IW0A 2FNJB 3M63B 2DYMA 1WJNA 3H7PA 4AOFA 2N1WA 4KVGB 4GDKA 5LXHA 5C23A 3BINA 4ANXA 2KFKB 2EMSA 4ZRIA 2KJHB 1WF9A 1TBEA 5D2MB 3PTFC 3U7DA 3KUDB 3KW5B 5GMVA 3NZSA 3GZNI 3RZFA 3RYTA 3KUZA 3IBEA 1WY8A 3KYDD 3VVWB 2FCQA 2HTHA 2JY6A 4MM3A 3VTVA 5D6JB 1WR6E 4HCPB 3VHTC 1OEYA 2IO0B 2KJ6A 2KQ7A 3PREA 3RUIB 5JHAA 4GN1A 4F8CB 2BWES 2K8CA 2K6QA 2O6VB 5L83A 1Q1OA 3NOBA 3V6CB 3V60A 4RM8A 2K39A 2BYFA 3H7SA 4GXBA 4E3CA 3ZRFA 2NPTB 1XQQA 4MGKE 3PSEB 2EKEC 2LVQA 2O6VD 4PS3A 2C7NB 2DZIA 3U8ZA 3DBRI 4RM9A 2ZZPB 4II3B 4DHJB 1YIWA 1UD7A 2FCSA 3QCAA 2C7MB 3EC8A 2KQSA 2V3SA 4TKNA 3VAWA 1V49A 3BY4B 4GOCA 2BYEA 2R2OA 1K8RB 3DOWA 4DHJD 2J0MA 2CHXA 2AYOB 2D2QA 2ZCBA 1J19A 1QZEA 2KVRA 3B0AA 3DVNV 3ZLZA 3I3TB 1J8CA 2WDTB 3Q3FA 1WR1A 1V81A 4MEMA 4GMVA 3ZUNA 1IYFA 4GGQA 1WYWB 4KV2A 3H7PB 2GBNA 4BBNF 1YQBA 1E90A 3A9KB 2KMCA 1LM8B 4XC2A 3T9LA 1GUAB 1XT9B 2C5LC 5DCNA 2AL3A 2MBQA 1T0YA 2C7HA 2LZ6A 4W9LA 1WZ0A 3PZDA 3TIXA 4BVUC 4LCDE 5D94A 2VRRB 3APFA 2NCNA 4KSKC 2MA9B 3VH3B 3H1UA 2MBBB 1CMXB 4MSQB 2D11A 4LJPB 4BFRA 5AZFA 3NS8A 1X1MA 3A33B 3X0WA 2IZVB 3DQVA 2JVCA 3A1QA 3R7QA 3VFKA 3HK0A 4NAWB 2GBKA 1JRUA 3H9DA 3M3JA 3SDLC 2MBEA 3NY5A 2JRIB 4IWQA 4KDLB 3ZRCA 3QK0A 2IO1B 2RGFA 3IFWB 2JUOA 4HWIB 3TMPB 4HVBA 2G3QB 3ALBA 5J17A 2O2VA 2RR9A 3KUCB 2KTFA 2XEWA 4JGHB 1WX7A 4ANWA 2KK8A 3VUWA 2JPHA 3ZKJC 3HM6X 4BKSA 2FIFA 1V86A 2ZVNA 2M0XA 5CX3A 5AZHA 1V9JA 4NNJB 3ZO5B 3ZDMC 3W1SA 2KDEB 2KKCA 2FAZA 4FULA 5FR6A 4G11A 3W1SC 4EEWA 4OVUA 4WWNA 2N9EB 3OJ4B 2KZRA 1EF5A 2LGDA 4W9HA 3RZWC 2BYVE 2REXA 2KWUB 2Z0EB 2LXAA 5DPRA 1L2NA 2WWZA 3EHVA 5DPSA 4NPNA 2KC2A 4GDLA 2L7RA 3QJZA 3TL5A 2UYZB 3M95A 1V5OA 3NHEB 4GIVA 4K7SA 4PYZA 2DYBA 3ML9A 1SE9A 2DYOA 4KIKA 4FBJB 1SIFA 3KVFB 2ZPYA 3A1QB 2DAFA 5IAAC 2MP2B 1WE6A 2GBJA 3ZDTA 4K7UA 3DVGY 1P98A 4MELA 4WAAA 1S3SG 2JWZA 1UBIA 2L3ZA 2NR2A 3H6NA 3L10B 2GBMA 1XD3B 4BBNC 4BKGA 1E8XA 1WGGA 2KHWB 2Z0DB 3C0RB 3R3MA 2J7QB 4I6PA 2O2VB 3VUXA 1NI2A 3ZNID 2KX0A 3L0WB 3QIJA 3VXWA 4URKA 2KLCA 3SD5A 3WANA 3UINB 3L08A 4B6WA 2JRHA 4FA6A 2YLMA 2J0KA 5E6OA 4KZ0A 3SU8X 3ZTDA 4ZRKA 1OTRB 1EUVB 2BWFA 3DVNU 2KN5A 2KTRA 1I42A 4TQ0A 3QX1A 3KYCD 2CR5A 2WX0A 5CTRC 3ENEA 3Q3JA 4FJYA 2GMIC 4HCNB 3ZIMA 1WZ3A 4WWOA 4M8NA 2AWTA 2ZNVB 3JW0X 3DDCB 2XK5B 3MHSD 1L7YA 2PPHA 2D07B 2N7DA 1Z5SB 4FJZA 4XZ4A 3UQBA 4GDLB 4EZLA 4BOZB 1ZKHA 1WMHB 2V1YA 4W9GA 2WYQA 2K1FA 3OLMD 1WJ4A 4IM0A 4KIKB 3VQIA 3R66C 1WX8A 5JH5C 2KXJA 3B08A 2KO3A 4ICUA 4MGYE 3JSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C1Y B;  3DBH I;  2IBI B;  2I1J A;  2FCM A;  3UIO B;  3QA8 A;  2MRP A;  2MLB A;  4NY0 A;  4I6N B;  2NS5 A;  4GDK B;  1MG8 A;  1KJT A;  1WH3 A;  3IHP C;  2KJR A;  4DK5 A;  2LRU A;  4II2 B;  5C1Z A;  4AUQ C;  3QWZ B;  4BKT A;  4ZYN A;  4K7W A;  1YX6 B;  4YL8 A;  3OJ3 A;  5KHO A;  3VUY A;  4I6L B;  2PE6 B;  4K81 A;  2IO2 B;  5CHF A;  2MX2 A;  5D7G A;  2IY0 B;  3CF6 E;  2ZJD A;  3GOE A;  3PS6 A;  4IWO A;  3D32 A;  4IWP A;  2MSE D;  2K25 A;  3AU5 A;  3CMM B;  3WAM A;  1UZX B;  5L95 C;  3RUL A;  4AWJ A;  2BKR B;  1BT0 A;  1TGZ B;  2KFJ A;  4DDG D;  3X23 A;  3JVZ X;  2JT4 B;  4HDO A;  4GB9 A;  5CHV C;  3V62 A;  3WAO A;  2G4D B;  4W9E A;  2KNB A;  2D3G A;  3PLU A;  5BO4 B;  4NJ7 A;  4IC7 B;  1U4A A;  3W1Y A;  3QAR A;  2EMT A;  2DEN B;  3CST A;  2KWC A;  4JL9 A;  4MJS A;  4DDI D;  2C60 A;  3PLV A;  2RSU A;  3DVG X;  3MTN B;  3QQ8 B;  4IUM B;  4WWP A;  4A3P A;  4CHK A;  1GC7 A;  4EZJ A;  1OQY A;  4MDK E;  1Q5W B;  3RD2 A;  4E71 A;  3JSV B;  4W9D A;  4FHK A;  1S1Q B;  1D3Z A;  4WJQ A;  2LWP A;  4EOY A;  2RPQ A;  4W9I A;  2KMA A;  4IM2 A;  2A5U A;  2ZVO A;  2CHW A;  3L13 A;  3WAP A;  4FJV B;  1WIA A;  3ZNH B;  3RT3 B;  1HE8 A;  4HK2 A;  5E6N A;  4W9J A;  4EFO A;  3NZU A;  1GNU A;  2BGF A;  3PPA A;  2CKH B;  1V2Y A;  1NDD A;  1RFA A;  3LJ3 A;  3ECI A;  1IP9 A;  2CHZ A;  3AI5 A;  1NBF C;  3HIZ A;  3PHW B;  2C9W B;  4W9C A;  1WGR A;  2JF5 A;  1A5R A;  4TQ1 A;  1WI0 A;  3A9J A;  2KLG A;  4MGZ E;  4A3O A;  1RAX A;  2ZNV C;  4X57 B;  2K8B A;  2ZCC A;  4B95 A;  1KOT A;  3VTW A;  5J2R A;  3APC A;  4PS7 A;  3WIM A;  4DWF A;  2FID A;  3O65 B;  2MWS B;  2FUH B;  2G4S A;  1LFD A;  4MH0 E;  4XX5 A;  2NPT A;  4HPL B;  2JZ3 B;  2N4F A;  4J6I A;  3VTU A;  2DZJ A;  2LJ5 A;  1C3T A;  2NVU I;  5JHB A;  3UIP B;  1ZW7 A;  2OOB B;  2OJR A;  1E5W A;  3AU4 A;  3DPD A;  4P7I A;  4LJO B;  4MJS B;  2V4L A;  3PRP B;  4JQW C;  3M62 B;  2L05 A;  1R4M I;  1TZ1 A;  2N9P C;  5TR5 A;  3DCG A;  3AXC A;  3PT2 B;  4MGI E;  4DHZ B;  3A4R A;  1EO6 A;  2GOW A;  2ZPN A;  4IM3 A;  2PJH A;  2AL6 A;  3PV1 A;  2D10 A;  1OGW A;  3TBL D;  3V6E B;  2L0F A;  3CSF A;  1UBQ A;  4MSM B;  3RCZ A;  1WXM A;  2MBO A;  4K1R B;  4BKS D;  4FN2 A;  1WJ6 A;  5LLI A;  1ISN A;  4F7Z A;  1M94 A;  3A4S C;  4KSL C;  4CO7 A;  2N7E A;  3S2A A;  3TJP A;  2UWQ A;  4HLE A;  4RMA A;  3ZVV A;  3A9K A;  1TTN A;  4FHJ A;  1H4R A;  1RRB A;  1Q0W B;  1WX9 A;  2NBW B;  1WM3 A;  3EEC A;  1ZGU B;  2CS4 A;  1WXV A;  4WJO A;  4B9K A;  1E7U A;  4G3X B;  2N9X A;  4JLC A;  2Y5B B;  4KZC A;  3DBL I;  1SGH A;  4WJN A;  1EF1 A;  3A9J B;  3KH0 A;  2L8J A;  4JIO U;  1P9D U;  2DZK A;  2HJ8 A;  1WE7 A;  2K6D B;  2W9N A;  3ZNZ B;  4HPM B;  1WJU A;  5IA7 A;  2J0J A;  3L16 A;  3PGE A;  4GU2 A;  1WFY A;  2L0T A;  2KAN A;  2NBV B;  4NAW A;  2MQJ A;  3WA0 A;  4E74 A;  4F1S A;  1UH6 A;  2HD5 B;  3JYU A;  4KDI C;  4EKU A;  4M8M A;  1WGY A;  5AEK B;  4W9K A;  1LQB A;  1R4N I;  3ML8 A;  1WRD B;  4G50 A;  4NQL B;  1E7V A;  1I35 A;  4ZDV A;  1RLF A;  3K9O B;  2ASQ A;  2QHO A;  3VH4 B;  3QHT A;  3P2B A;  2CU1 A;  2IYD B;  4HXD A;  3AUL A;  1YJ1 A;  3MJW A;  5HKH A;  3PRZ A;  4IG7 B;  2K8H A;  2YVC A;  1H8C A;  3K9P B;  5G55 A;  2MCN B;  1V5T A;  2KOX A;  3HM3 A;  2IY1 B;  3V61 A;  1YX5 B;  4A20 A;  2KTR B;  4TV3 A;  3ONS A;  4ICV A;  3UGB B;  1G6J A;  2N1V A;  4NQK E;  5EDS A;  2A4Z A;  2KD0 A;  2IO3 B;  1F9J A;  3L54 A;  3ZNG C;  1E8Z A;  3PVL A;  3N3K B;  5AZG A;  3APD A;  2LI5 A;  3QC8 B;  5G2N A;  1WGH A;  3DBS A;  1GC6 A;  4WJP A;  2M4N A;  3SHQ A;  2BF8 B;  4DXA B;  2NBU A;  1WXA A;  1J0G A;  1FXT B;  1P1A A;  2R2Q A;  2AEH A;  2LD9 A;  2M8S A;  1P3Q U;  5DPW A;  2MBH A;  3QAQ A;  2MP2 A;  4PS8 A;  4LDT B;  3U30 A;  1AAR A;  2GBR A;  4AJY B;  5KHQ A;  3N30 A;  1GJZ A;  2L00 B;  4WQO B;  4ANV A;  2G45 B;  3TCA A;  3B1L X;  2M1M A;  2RD0 A;  4AJW A;  1WGD A;  3IVF A;  2LVP A;  1P0R A;  2LUE A;  4LDT D;  3EFU A;  2BPS A;  3HHM A;  1YD8 U;  3UQA A;  1KLV A;  2DHZ A;  2KFK A;  2LGY A;  2LRW A;  1PQS A;  3PRM B;  5DPT A;  4ZRJ A;  2KDI A;  1Z2M A;  4M0W B;  3UF8 A;  4DHZ E;  4CYE A;  2B3A A;  2MW5 A;  1WXS A;  1UGM A;  2FCN A;  2LGX A;  4PYU A;  5CHW A;  4TUU A;  5E6P A;  2WX1 A;  2KDB A;  2PE9 A;  2XBB C;  4N9F 4;  3ZTC A;  2HE7 A;  4ASW C;  4NJ6 A;  1WM2 A;  2PEA A;  1OEY J;  2M17 A;  4W9F A;  1GG3 A;  2LVO A;  2O6V A;  1VCB A;  4GSW A;  5J18 A;  3IG3 A;  1KM7 A;  2LXC A;  3LDZ E;  2Z59 B;  2DZM A;  1Y8R C;  2KX3 A;  2KWV B;  2XK5 A;  5LXI B;  2I1K A;  3ZW3 A;  4HDQ A;  4EUT A;  2LAS A;  2DAJ A;  4AP4 C;  3L17 A;  3OAW A;  5JZE B;  1LXD A;  2ZEQ A;  1V6E A;  2JZZ A;  1E8W A;  1WMH A;  3N32 A;  4FLH A;  3T8M A;  4EZK A;  1VD2 A;  1UEL A;  1IPG A;  3VDZ A;  1V80 A;  3WAL A;  2DX5 B;  4OVV A;  3R7R A;  2BKF A;  4ANU A;  4BOS C;  3PHX B;  4HJK A;  2L76 A;  2KDF B;  4DBG A;  4G0N B;  2KC1 A;  4FAD A;  2JXX A;  1E8Y A;  4IW0 A;  2FNJ B;  3M63 B;  2DYM A;  1WJN A;  3H7P A;  4AOF A;  2N1W A;  4KVG B;  4GDK A;  5LXH A;  5C23 A;  3BIN A;  4ANX A;  2KFK B;  2EMS A;  4ZRI A;  2KJH B;  1WF9 A;  1TBE A;  5D2M B;  3PTF C;  3U7D A;  3KUD B;  3KW5 B;  5GMV A;  3NZS A;  3GZN I;  3RZF A;  3RYT A;  3KUZ A;  3IBE A;  1WY8 A;  3KYD D;  3VVW B;  2FCQ A;  2HTH A;  2JY6 A;  4MM3 A;  3VTV A;  5D6J B;  1WR6 E;  4HCP B;  3VHT C;  1OEY A;  2IO0 B;  2KJ6 A;  2KQ7 A;  3PRE A;  3RUI B;  5JHA A;  4GN1 A;  4F8C B;  2BWE S;  2K8C A;  2K6Q A;  2O6V B;  5L83 A;  1Q1O A;  3NOB A;  3V6C B;  3V60 A;  4RM8 A;  2K39 A;  2BYF A;  3H7S A;  4GXB A;  4E3C A;  3ZRF A;  2NPT B;  1XQQ A;  4MGK E;  3PSE B;  2EKE C;  2LVQ A;  2O6V D;  4PS3 A;  2C7N B;  2DZI A;  3U8Z A;  3DBR I;  4RM9 A;  2ZZP B;  4II3 B;  4DHJ B;  1YIW A;  1UD7 A;  2FCS A;  3QCA A;  2C7M B;  3EC8 A;  2KQS A;  2V3S A;  4TKN A;  3VAW A;  1V49 A;  3BY4 B;  4GOC A;  2BYE A;  2R2O A;  1K8R B;  3DOW A;  4DHJ D;  2J0M A;  2CHX A;  2AYO B;  2D2Q A;  2ZCB A;  1J19 A;  1QZE A;  2KVR A;  3B0A A;  3DVN V;  3ZLZ A;  3I3T B;  1J8C A;  2WDT B;  3Q3F A;  1WR1 A;  1V81 A;  4MEM A;  4GMV A;  3ZUN A;  1IYF A;  4GGQ A;  1WYW B;  4KV2 A;  3H7P B;  2GBN A;  4BBN F;  1YQB A;  1E90 A;  3A9K B;  2KMC A;  1LM8 B;  4XC2 A;  3T9L A;  1GUA B;  1XT9 B;  2C5L C;  5DCN A;  2AL3 A;  2MBQ A;  1T0Y A;  2C7H A;  2LZ6 A;  4W9L A;  1WZ0 A;  3PZD A;  3TIX A;  4BVU C;  4LCD E;  5D94 A;  2VRR B;  3APF A;  2NCN A;  4KSK C;  2MA9 B;  3VH3 B;  3H1U A;  2MBB B;  1CMX B;  4MSQ B;  2D11 A;  4LJP B;  4BFR A;  5AZF A;  3NS8 A;  1X1M A;  3A33 B;  3X0W A;  2IZV B;  3DQV A;  2JVC A;  3A1Q A;  3R7Q A;  3VFK A;  3HK0 A;  4NAW B;  2GBK A;  1JRU A;  3H9D A;  3M3J A;  3SDL C;  2MBE A;  3NY5 A;  2JRI B;  4IWQ A;  4KDL B;  3ZRC A;  3QK0 A;  2IO1 B;  2RGF A;  3IFW B;  2JUO A;  4HWI B;  3TMP B;  4HVB A;  2G3Q B;  3ALB A;  5J17 A;  2O2V A;  2RR9 A;  3KUC B;  2KTF A;  2XEW A;  4JGH B;  1WX7 A;  4ANW A;  2KK8 A;  3VUW A;  2JPH A;  3ZKJ C;  3HM6 X;  4BKS A;  2FIF A;  1V86 A;  2ZVN A;  2M0X A;  5CX3 A;  5AZH A;  1V9J A;  4NNJ B;  3ZO5 B;  3ZDM C;  3W1S A;  2KDE B;  2KKC A;  2FAZ A;  4FUL A;  5FR6 A;  4G11 A;  3W1S C;  4EEW A;  4OVU A;  4WWN A;  2N9E B;  3OJ4 B;  2KZR A;  1EF5 A;  2LGD A;  4W9H A;  3RZW C;  2BYV E;  2REX A;  2KWU B;  2Z0E B;  2LXA A;  5DPR A;  1L2N A;  2WWZ A;  3EHV A;  5DPS A;  4NPN A;  2KC2 A;  4GDL A;  2L7R A;  3QJZ A;  3TL5 A;  2UYZ B;  3M95 A;  1V5O A;  3NHE B;  4GIV A;  4K7S A;  4PYZ A;  2DYB A;  3ML9 A;  1SE9 A;  2DYO A;  4KIK A;  4FBJ B;  1SIF A;  3KVF B;  2ZPY A;  3A1Q B;  2DAF A;  5IAA C;  2MP2 B;  1WE6 A;  2GBJ A;  3ZDT A;  4K7U A;  3DVG Y;  1P98 A;  4MEL A;  4WAA A;  1S3S G;  2JWZ A;  1UBI A;  2L3Z A;  2NR2 A;  3H6N A;  3L10 B;  2GBM A;  1XD3 B;  4BBN C;  4BKG A;  1E8X A;  1WGG A;  2KHW B;  2Z0D B;  3C0R B;  3R3M A;  2J7Q B;  4I6P A;  2O2V B;  3VUX A;  1NI2 A;  3ZNI D;  2KX0 A;  3L0W B;  3QIJ A;  3VXW A;  4URK A;  2KLC A;  3SD5 A;  3WAN A;  3UIN B;  3L08 A;  4B6W A;  2JRH A;  4FA6 A;  2YLM A;  2J0K A;  5E6O A;  4KZ0 A;  3SU8 X;  3ZTD A;  4ZRK A;  1OTR B;  1EUV B;  2BWF A;  3DVN U;  2KN5 A;  2KTR A;  1I42 A;  4TQ0 A;  3QX1 A;  3KYC D;  2CR5 A;  2WX0 A;  5CTR C;  3ENE A;  3Q3J A;  4FJY A;  2GMI C;  4HCN B;  3ZIM A;  1WZ3 A;  4WWO A;  4M8N A;  2AWT A;  2ZNV B;  3JW0 X;  3DDC B;  2XK5 B;  3MHS D;  1L7Y A;  2PPH A;  2D07 B;  2N7D A;  1Z5S B;  4FJZ A;  4XZ4 A;  3UQB A;  4GDL B;  4EZL A;  4BOZ B;  1ZKH A;  1WMH B;  2V1Y A;  4W9G A;  2WYQ A;  2K1F A;  3OLM D;  1WJ4 A;  4IM0 A;  4KIK B;  3VQI A;  3R66 C;  1WX8 A;  5JH5 C;  2KXJ A;  3B08 A;  2KO3 A;  4ICU A;  4MGY E;  3JSV A; 
#chains in the Genus database with same CATH topology
 1C1Y B;  1YN4 A;  3UIO B;  3PZ8 A;  2MLB A;  2OHF A;  4USA A;  3Q8F A;  1K53 A;  2KJR A;  2WXP A;  4II2 B;  4P6V F;  5C1Z A;  4AUQ C;  3QWZ B;  3NJT A;  2AQ3 B;  4K7W A;  1MHH E;  2CU3 A;  4K81 A;  2EEL A;  4KKJ A;  5D7G A;  5H92 C;  3CF6 E;  1YMH E;  3GOE A;  3D32 A;  1KTK A;  2K25 A;  3WAM A;  1BT0 A;  4GB9 A;  5CHV C;  5HHD G;  4W9E A;  4N59 A;  4IC7 B;  2IJ0 A;  3QAR A;  2EMT A;  1TY2 A;  4MJS A;  1NI3 A;  1FFV A;  4DDI D;  5BYQ A;  3PLV A;  2RSU A;  3MTN B;  1R7S A;  1Q5W B;  3RD2 A;  1D3Z A;  4OZA A;  2A5U A;  2JQR B;  4HRS A;  3ZNH B;  4UDU C;  5E6N A;  1YN3 A;  1E6E B;  1E7P B;  3NZU A;  1GNU A;  3PPA A;  2CKH B;  4M00 A;  1NDD A;  1FEH A;  3ECI A;  3P4R B;  3PHW B;  2BQQ A;  1A5R A;  1K52 A;  4TQ1 A;  4A3O A;  1AN8 A;  1I4X A;  2ZCC A;  4B95 A;  5J2R A;  2PVG C;  3APC A;  4PS7 A;  3ZXV A;  1C79 A;  2H89 B;  3IT6 B;  2NPT A;  4HPL B;  2JZ3 B;  4S0R A;  2DZJ A;  3NG0 A;  2IGG A;  1ZW7 A;  2MJE A;  1E5W A;  3AU4 A;  3DPD A;  4P7I A;  3Q8B A;  4MJS B;  2PLP A;  2L05 A;  1R4M I;  5TR5 A;  3A4R A;  3AB5 A;  2GOW A;  3PV1 A;  2HJ1 A;  3TBL D;  3V6E B;  1UBQ A;  1ROE A;  1QLB B;  1PDX A;  5LLI A;  1GB1 A;  3DBR B;  1ISN A;  4KSL C;  1C77 A;  3TJP A;  1SEB D;  2LHD A;  4YTP B;  3AEB B;  2NBW B;  1WM3 A;  2CS4 A;  1WXV A;  4XDD A;  1E7U A;  2KDM A;  3MP9 A;  1SGH A;  1EF1 A;  4XGA B;  2HJ8 A;  1JML A;  4RGM A;  4HPM B;  1WJU A;  1J7A A;  5FK9 C;  5IA7 A;  4GU2 A;  1YN5 A;  2NBV B;  4NAW A;  5FKA C;  3WA0 A;  3JYU A;  5TSS A;  4KDI C;  4BZA A;  4M8M A;  1FCL A;  2IGH A;  1K50 A;  1I35 A;  3AE7 B;  3K9O B;  3WCQ A;  3Q8A A;  1JW9 D;  1B1Z A;  4HXD A;  3MJW A;  3PRZ A;  2K8H A;  3LXF A;  3C19 A;  2V4I B;  3AEG B;  2MCN B;  2WDR B;  1L6V A;  3P42 A;  4J3O D;  4ICV A;  2N1V A;  1TS2 A;  2A4Z A;  2BVC A;  2WU2 B;  1VZ7 A;  2LI5 A;  3QC8 B;  2QSD A;  2VZK B;  3NVY A;  4A6Q A;  1FD6 A;  3DBS A;  1GC6 A;  1DOX A;  2BF8 B;  4DXA B;  1FNV A;  5DPW A;  2R2Q A;  2AEH A;  2LD9 A;  1P3Q U;  3MHZ A;  4RNA A;  1DGJ A;  4PS8 A;  4LDT B;  3N30 A;  2L00 B;  3AEC B;  1SE4 A;  3B1L X;  2RD0 A;  1WGD A;  3EFU A;  2BPS A;  3NRZ A;  1PQS A;  1KH0 A;  1I4R A;  3PRM B;  3TEW A;  2KDI A;  3B9J A;  2B3A A;  2WGS A;  1UGM A;  1ZXH A;  3KWL A;  4LK0 M;  1L4D B;  3KWV A;  2WX1 A;  2KDB A;  4ASW C;  3VR9 B;  1GG3 A;  1VCB A;  4GSW A;  1R4M B;  2LXC A;  3UI3 A;  2Z59 B;  4B0E A;  1ZOY B;  4KGS A;  2I1K A;  4EUT A;  2UU7 A;  2LAS A;  3L17 A;  5JZE B;  2AQ1 B;  2ZEQ A;  1TKG A;  2JZZ A;  3N32 A;  1E8W A;  3NVW A;  4REZ A;  4JWS C;  2DX5 B;  4TSS A;  5LNK 1;  3R7R A;  2L76 A;  4DBG A;  2KC1 A;  1WYG A;  5EE0 A;  1FPY A;  4OW0 A;  2WXQ A;  2XN9 C;  2N1W A;  3PZ7 A;  3BIN A;  4ANX A;  1STE A;  3KUD B;  3RZF A;  3IBE A;  3KYD D;  1E9M A;  4US9 A;  2KJ6 A;  4F8C B;  2E3T A;  5L83 A;  3NOB A;  3AE5 B;  3H7S A;  5FR3 A;  5GXG B;  4E3C A;  1J7C A;  4PT5 A;  2LVQ A;  2O6V D;  1QT9 A;  2C7N B;  4RM9 A;  2ZZP B;  4HKZ E;  4RGN A;  4JPS A;  1TKE A;  4GOC A;  2BYE A;  2JX5 A;  2J0M A;  1D5X C;  3DVN V;  1RFK A;  2AYO B;  1QZE A;  4MAC A;  1WR1 A;  3Q3N C;  5G5H A;  2GBN A;  3A9K B;  1GUA B;  2C5L C;  5DCN A;  2AL3 A;  2MBQ A;  3TEY A;  1WZ0 A;  3PZD A;  3ABV B;  3TIX A;  2QEJ C;  5EE1 A;  4NAM A;  2KAJ A;  1TS4 A;  1PGA A;  2D11 A;  1MI0 A;  3DQV A;  2JVC A;  3VFK A;  3HK0 A;  3SDL C;  2MBE A;  3ZRC A;  1P7E A;  1RWS A;  3BWU D;  3IFW B;  4HWI B;  3TMP B;  2KTF A;  4JGH B;  1WX7 A;  4ANW A;  3T3N A;  1I4H A;  2JPH A;  2HTM E;  4BKS A;  1EU4 A;  2FIF A;  5CX3 A;  2M0X A;  4C80 A;  1V9J A;  4NNJ B;  3AV8 A;  2KDE B;  1ZP0 B;  4IOI E;  2KKC A;  2FAZ A;  3PO0 A;  5BMI A;  3I9V 1;  1WRI A;  4RGT A;  4OVU A;  1C4P A;  1EF5 A;  2X8X X;  2BYV E;  1TS3 A;  2LXA A;  4C7Y A;  1VR9 A;  3QJZ A;  1BML C;  2AQ2 B;  1V5O A;  3NHE B;  4K7S A;  4PYZ A;  2DYB A;  1SE9 A;  2WS3 B;  1I7H A;  2DAF A;  4ZRQ A;  2JXT A;  4YTN B;  2JYT A;  4MH8 A;  4MEL A;  4WAA A;  1S3S G;  1UBI A;  2L3Z A;  1WGG A;  2KMM A;  3Q14 C;  4I6P A;  5IP4 D;  2W3R A;  4URK A;  3WAN A;  2EKI A;  3FAH A;  3L08 A;  4B6W A;  2J0K A;  1XXG A;  1MFW A;  1SJH D;  1MVK A;  4ZRK A;  1OTR B;  1SBB B;  1R4N B;  4HEA 1;  5IKC M;  1FXA A;  3CWI A;  4FXC A;  2ON8 A;  2CR5 A;  1CZP A;  3FIL A;  1YQ3 B;  3N1Y C;  4N6E B;  2WXI A;  2AWT A;  4XZ4 A;  1I4P A;  4EZL A;  1T0R C;  3Q3O C;  1WMH B;  3AE8 B;  4BOZ B;  1J7B A;  2QIL A;  3OLM D;  1WX8 A;  1HA5 A;  3BVM A;  2KO3 A;  4ICU A;  3GE8 C;  1L6U A;  3RNG C;  3JSV A;  2W82 A;  2IBI B;  2I1J A;  1SE3 A;  4GDK B;  1WH3 A;  4XYC A;  3MC9 A;  3CIR B;  3NZ3 A;  1YX6 B;  3OJ3 A;  3VUY A;  2BB5 A;  2MX2 A;  2YEP B;  4IKG A;  2IY0 B;  3PS6 A;  3CMM B;  4A90 A;  5L95 C;  2KYW A;  4DDG D;  3X23 A;  3FIL B;  4HDO A;  3V62 A;  3WAO A;  2G4D B;  2LMC A;  3DHI C;  2KNB A;  5BO4 B;  1U4A A;  4LTU A;  4BAX A;  1C78 A;  3W1Y A;  1E0Z A;  1YJI A;  1HEZ E;  4WWP A;  4CHK A;  5AUI A;  2N0S B;  1OQY A;  3JSV B;  3DHH C;  4N58 A;  4W9D A;  2BB6 A;  4EOY A;  4P1C C;  3SEB A;  1D6E C;  4ZHO A;  2CHW A;  1XF5 L;  3L13 A;  1OFF A;  3WAP A;  4FJV B;  3LYY A;  2WDQ B;  3IXS A;  3AE2 B;  1ZDX A;  2R61 A;  3R2T A;  1IP9 A;  2CHZ A;  3AI5 A;  1NBF C;  1WGR A;  3TEZ A;  3LB8 C;  2W54 A;  3A9J A;  2KLG A;  4X57 B;  1TYG B;  3P1M A;  3VTW A;  2FID A;  2PTL A;  4MH0 E;  4J6I A;  3VTU A;  2LJ5 A;  2NVU I;  5JHB A;  2OOB B;  3PRP B;  3AXC A;  3PT2 B;  2PJH A;  1RM6 C;  4RFB A;  4MSM B;  1FO4 A;  3RCZ A;  4FN2 A;  1YJJ A;  2D3C A;  2UWQ A;  4HLE A;  2BT6 A;  3Q69 A;  1T3Q A;  4FHJ A;  1WX9 A;  1Q0W B;  2PMV A;  3EEC A;  1ZGU B;  2WQY B;  2QDF A;  1V1O A;  4WJO A;  4RH6 A;  4G3X B;  2N9X A;  4JLC A;  3DBL I;  1D4B A;  4WJN A;  3A9J B;  2RPV A;  2DZK A;  3Q6B A;  3ZNZ B;  3E9S A;  2JWU A;  2ZW1 A;  2Z8L A;  4F1S A;  3IT4 B;  1LO5 D;  1QQR A;  2HD5 B;  1SJE D;  2M0A A;  4HJG E;  1WGY A;  4W9K A;  2QIE B;  4WQM A;  2FBW B;  1JAL A;  3VH4 B;  2RDB C;  2L83 A;  1MG4 A;  3P2B A;  1XLP A;  2WXR A;  3AUL A;  2J52 A;  5G55 A;  1V5T A;  2IY1 B;  3V61 A;  1V1P A;  3UGB B;  5EDS A;  1UF0 A;  1IGC A;  1WXQ A;  1T6B X;  5AZG A;  4JE3 B;  1SE2 A;  4K3C A;  5BYS A;  3Q3M C;  1XLN A;  2M4N A;  4LNK A;  2NBU A;  1J0G A;  4RF1 A;  2VZK D;  1QF6 A;  2MP2 A;  4AJY B;  3U30 A;  1AAR A;  5C3J B;  1L0Y B;  4ANV A;  3TCA A;  3C8Y A;  4C4V A;  4LDT D;  3UQA A;  1KLV A;  4DXG A;  4PYU A;  2LGX A;  4TUU A;  3VRA B;  1JCK B;  2PE9 A;  1WM2 A;  4RGO S;  2M17 A;  2LVO A;  5J18 A;  3IG3 A;  3LDZ E;  1V97 A;  3R8B A;  2DZM A;  2E6X A;  3ZW3 A;  3MC8 A;  2DNF A;  1EWC A;  1N63 A;  1UEL A;  1IPG A;  1FM0 D;  4OVV A;  3Q8C A;  4BOS C;  5D3D A;  4FAD A;  4G0N B;  3RNF C;  1E8Y A;  4IW0 A;  2SAK A;  2FNJ B;  4P16 A;  4C4V B;  3T3O A;  2EMS A;  4ZRI A;  1FCC C;  3NZS A;  1TT5 B;  3GE3 C;  1WY8 A;  2Q5W D;  2JY6 A;  2VH1 A;  4MM3 A;  2Y5P A;  3VTV A;  2J4X A;  3VHT C;  3PRE A;  3RUI B;  2BWE S;  2LHE A;  1SF0 A;  4RM8 A;  4GXB A;  1JWA D;  3ZRF A;  2NPT B;  1XQQ A;  4ITK A;  3V3X A;  1E10 A;  4PS3 A;  2DZI A;  4II3 B;  4DHJ B;  3TEX A;  2I2Y A;  3QCA A;  2V3S A;  3VAW A;  3DWG C;  1JWU D;  5BYR A;  1J8C A;  4KV2 A;  1WYW B;  1E90 A;  1LM8 B;  3T9L A;  1HXY D;  1UUP A;  2C7H A;  2LZ6 A;  3TSS A;  1XO3 A;  4LCD E;  2G9H D;  2VRR B;  1XLO A;  2MA9 B;  3IAM 1;  3VH3 B;  5HFY A;  2MBB B;  1CMX B;  1F77 A;  2K3U A;  5AZF A;  3NS8 A;  3A33 B;  1KRH A;  3R7Q A;  4NAW B;  2GBK A;  2JRI B;  1DOI A;  1TKY A;  4YTM B;  4H2A A;  4ZYS A;  1EM7 A;  2JUO A;  2G3Q B;  3KUC B;  3RI7 C;  3ZKJ C;  3HM6 X;  4OHJ A;  1I4G A;  1XCT L;  5AZH A;  2PKO A;  3ZJU A;  3ZDM C;  4S17 A;  2K5P A;  4FUL A;  4G11 A;  2INP E;  3OJ4 B;  1QIL A;  2KZR A;  4W9H A;  1FRR A;  2REX A;  2K9X A;  2WWZ A;  5I4D A;  2KC2 A;  4GDL A;  1ESF A;  2UYZ B;  1YOV B;  1JRP A;  4KIK A;  3KVF B;  2BS4 B;  1KLU D;  3ZDT A;  3HRD D;  1E8X A;  2KHW B;  4AS1 A;  2I38 A;  3L0W B;  1XEE A;  2WXL A;  2KLC A;  3SD5 A;  3SR6 A;  3UIN B;  1IBX A;  2YLM A;  1XLQ A;  3ZTD A;  5G5G A;  4LLG M;  3DVN U;  2KTR A;  4A55 A;  2FE8 A;  4FJY A;  2L1A A;  4WWO A;  2LFI A;  2ZNV B;  3DDC B;  2D07 B;  2N7D A;  1Z5S B;  2WXH A;  4GDL B;  1ZKH A;  2V1Y A;  4W9G A;  5IO9 A;  3ETR A;  5IN7 A;  4IM0 A;  4KIK B;  3R66 C;  3RNE C;  1JRO A;  2VH2 A;  1UWX A;  3BZD B;  3DWM A;  1GPX A;  2FCM A;  3QA8 A;  2WXM A;  3RNB C;  4NY0 A;  2NS5 A;  1MG8 A;  1WSP A;  1KJT A;  2LRU A;  1SB3 C;  1TY0 A;  4BKT A;  1VLB A;  3ZGZ A;  2IPK D;  4HPP A;  2IO2 B;  5CHF A;  5JXV A;  3AN1 A;  1QOG A;  2MSE D;  1ET6 A;  1UZX B;  2G1E A;  3RUL A;  4AWJ A;  2V0G A;  3JVZ X;  2JT4 B;  4NJC A;  1F0Z A;  5EE3 A;  2D3G A;  3Q2A C;  4NJ7 A;  3AE1 B;  3J9C A;  4M01 A;  4IUM B;  3QQ8 B;  4A3P A;  2GLS A;  4FHK A;  2LWP A;  2RPQ A;  4W9I A;  4IM2 A;  4D2K A;  4P1B C;  1WIA A;  3VR8 B;  3RT3 B;  1HE8 A;  1PYW D;  4HK2 A;  3HUI A;  4W9J A;  4EFO A;  1ACC A;  1V2Y A;  1NEN B;  4YXD B;  3HIZ A;  2C9W B;  3OWE B;  1RAX A;  1FNW A;  2BS3 B;  3WIM A;  2MWS B;  2H88 B;  2FUH B;  1LFD A;  5HI1 A;  4XX5 A;  1C3T A;  2N4F A;  3UIP B;  4KGT A;  4ZRP A;  5BMG A;  1JWM D;  3O13 A;  2V4L A;  1FIQ A;  4JQW C;  3M62 B;  1TZ1 A;  2N9P C;  3DCG A;  1UGJ A;  4MGI E;  5T8I A;  3AH7 A;  3I63 C;  1EO6 A;  2ZPN A;  3W5V B;  2RMM A;  3V05 A;  1OGW A;  2L0F A;  3CSF A;  1MHX A;  2MBO A;  3SFE B;  1WJ6 A;  4XDC A;  1M94 A;  3A4S C;  4OZB A;  4CO7 A;  3S2A A;  1FFU A;  4RMA A;  1OQR A;  1JWB D;  3ZVV A;  3Q8E A;  4ARI A;  4B9K A;  4KZC A;  1PGB A;  2Y5B B;  1JWS D;  2Y3A A;  4WAF A;  3KH0 A;  2L8J A;  2W9N A;  1WE7 A;  2K6D B;  3EUB 2;  2V9H A;  2J0J A;  3L16 A;  1WFY A;  2SEB D;  2L0T A;  2MEK A;  2KAN A;  2BYT A;  4E74 A;  4O1N A;  5AEK B;  3RFZ B;  1LQB A;  3HVD A;  3ML8 A;  1WRD B;  4NQL B;  1E7V A;  3ZJV A;  4ZDV A;  1RLF A;  4DQO C;  3N9Y C;  3QHT A;  4A8X C;  2BBC A;  2CU1 A;  2IYD B;  5HKH A;  1YJ1 A;  4M0W A;  4IG7 B;  2YVC A;  1H8C A;  2AX5 A;  3K9P B;  1HQR D;  2NTT A;  2KOX A;  3URY A;  4TV3 A;  3ONS A;  3P4P B;  3OG5 A;  4QAY A;  3P4Q B;  2KD0 A;  2IO3 B;  1F9J A;  3L54 A;  1C4A A;  3PVL A;  3N3K B;  1SSN A;  2CJN A;  4LNF A;  3P4S B;  5G2N A;  3BYT B;  1N62 A;  2BW2 A;  4WJP A;  3NS1 A;  1FXT B;  1UWM A;  2GRI A;  2M8S A;  2MBH A;  1BUI C;  1QOB A;  2KN4 A;  2GBR A;  1AYF A;  3P63 A;  2QJL A;  4KGR A;  4L23 A;  2HDE A;  3IVF A;  3I5J C;  2LVP A;  2JSV X;  3HHM A;  1YD8 U;  3BII D;  2KFK A;  2LRW A;  1F52 A;  4ZRJ A;  4M0W B;  4DHZ E;  4CYE A;  2MW5 A;  1WXS A;  2FCN A;  5CHW A;  2RDH A;  5E6P A;  1CQV A;  5HG2 A;  4YSZ B;  3ZTC A;  4NJ6 A;  3EFC A;  1L0X B;  4EE2 A;  2BTE A;  4W9F A;  3GB1 A;  2WXF A;  3U2S C;  3W9C B;  1KM7 A;  1HTQ A;  2IND C;  2KWV B;  4NZL B;  2XK5 A;  4B0M A;  2QMT A;  1LXD A;  3T8M A;  1V6E A;  4EZK A;  2QC8 A;  3VDZ A;  2OJW A;  4RCO A;  2JXX A;  1MPE A;  3M63 B;  2DYM A;  2GI9 A;  4ZHP A;  1IGD A;  4KKI A;  2W3S A;  4KVG B;  5LXH A;  5AUK A;  2L32 A;  2KFK B;  1UNS A;  1TBE A;  1VJK A;  3N1Z C;  4MT5 A;  3KW5 B;  5GMV A;  3RYT A;  2HTH A;  1HTO A;  2FUG 1;  1DOY A;  3I57 A;  5D6J B;  1WR6 E;  2TSS A;  2WNM A;  4HCP B;  2KQ7 A;  4DXF A;  5JHA A;  2K8C A;  1FNU A;  3V6C B;  3V60 A;  2K39 A;  2BYF A;  4PK1 A;  4MGK E;  4YWG G;  2IDY A;  3PSE B;  5EE9 A;  2EKE C;  3U8Z A;  3DBR I;  2N9L A;  1F2R I;  1YIW A;  1UD7 A;  2FCS A;  3EGR A;  2KQS A;  1FRD A;  1L4Z B;  4TKN A;  3BY4 B;  4OVZ A;  3DOW A;  4DHJ D;  2D2Q A;  2ZCB A;  1CK1 A;  1J19 A;  2KVR A;  3ZLZ A;  3I3T B;  1C76 A;  2WDT B;  2NTS A;  1N60 A;  4US8 A;  4BBN F;  4XC2 A;  2KMC A;  1RYJ A;  3ZQ4 A;  4JX1 C;  4W9L A;  4BVU C;  1ENF A;  2RDG A;  5D94 A;  3APF A;  3H1U A;  4LJP B;  4BFR A;  1X1M A;  1SXT A;  2IZV B;  2BS2 B;  3AMZ A;  2OED A;  3H9D A;  3M3J A;  3R2I A;  4IWQ A;  3QK0 A;  4WWM A;  4HVB A;  3B2F A;  5J17 A;  1HZ6 A;  2KK8 A;  3VUW A;  2ZVN A;  2ONQ A;  2V3N A;  3ZO5 B;  3W1S A;  1V1P B;  2INC C;  1N6Z A;  5FR6 A;  2WXO A;  3HVZ A;  3W1S C;  4EEW A;  2WU5 B;  5MPO A;  2GB1 A;  3BYY B;  4WWN A;  2LGD A;  3RZW C;  1F2R C;  2WXK A;  3AE4 B;  5DPR A;  1QOA A;  3EHV A;  4LNI A;  1TJE A;  1AWD A;  2D5G A;  4YSX B;  3H8H A;  4ARC A;  3ML9 A;  2QCZ A;  4FBJ B;  1VDV A;  1SIF A;  4KX6 B;  2ZPY A;  5IOI A;  5IAA C;  2MP2 B;  1WE6 A;  2LGS A;  4K7U A;  1IUE A;  3DVG Y;  4CQN A;  3SFD B;  2X38 A;  4C56 C;  2NR2 A;  3H6N A;  2M19 A;  4BKG A;  1VRA B;  3DBL B;  1I4Q A;  2J7Q B;  2INN E;  4A9A A;  2LJI A;  3VUX A;  4WH4 A;  3W5U B;  2KX0 A;  2KT7 A;  3MFG A;  2JZP A;  1ZPS A;  5E6O A;  4KZ0 A;  3SU8 X;  1P7F A;  2MHJ A;  2PW9 A;  2KN5 A;  5H8Y E;  1M4V A;  3ENE A;  4HCN B;  3ZIM A;  1WZ3 A;  4M8N A;  1L7Y A;  2PPH A;  2W55 A;  4FJZ A;  3UQB A;  2K1F A;  1WJ4 A;  5JH5 C;  3ZXR A;  2KXJ A;  4MGY E;  3BVZ A;  3DBH I;  1HZ5 A;  2MRP A;  4I6N B;  3IHP C;  4DK5 A;  1SIJ A;  3GP7 A;  4ZYN A;  4YL8 A;  1V8C A;  5KHO A;  2K0P A;  2LGI A;  4I6L B;  2PE6 B;  4MM3 B;  2ZJD A;  4IWO A;  4XE0 A;  4IWP A;  3AU5 A;  2BKR B;  2KFJ A;  1TGZ B;  2IGD A;  1WGK A;  3PLU A;  1B9R A;  1TZO A;  1LGR A;  3ZYY X;  2DEN B;  2XNA C;  3CST A;  2KWC A;  4RF0 A;  1ZE3 D;  4JL9 A;  2C60 A;  4C7Z A;  3DVG X;  4LNO A;  4L1B A;  1GC7 A;  4EZJ A;  4MDK E;  4E71 A;  3W2D A;  2L52 A;  1S1Q B;  4WJQ A;  2K22 A;  2KMA A;  2ZVO A;  1C9F A;  4HRO A;  1Y56 A;  4JWU C;  1AW7 A;  1KLG D;  3TUO A;  2BGF A;  5C2T B;  1RFA A;  3LJ3 A;  3AED B;  4W9C A;  3NUH B;  2JF5 A;  1ZUD 2;  1WI0 A;  3B2G A;  4TMA B;  2M56 B;  4MGZ E;  2ZNV C;  2K8B A;  1KOT A;  1NEK B;  4IDI A;  4DWF A;  3O65 B;  2G4S A;  1ET9 A;  2KQ4 X;  1ZXI A;  2OJR A;  1FMA D;  4LJO B;  4C00 A;  4DHZ B;  4WIP A;  4IM3 A;  3RMK C;  2AL6 A;  2D10 A;  2JYE A;  3RN9 C;  2PIA A;  1WXM A;  2CJO A;  4K1R B;  4BKS D;  4F7Z A;  4LNN A;  2N7E A;  3BK1 A;  3A9K A;  1TTN A;  3MJ5 A;  1H4R A;  1RRB A;  1QOF A;  1PGX A;  1JQ4 A;  1ZDV A;  2ZW0 A;  3BVG A;  2KAC A;  1YQ4 B;  3DBH B;  4JIO U;  1P9D U;  2WXJ A;  3U52 E;  3E56 A;  3PGE A;  1WWT A;  1GAQ B;  2MQJ A;  1UH6 A;  2ICI A;  4EKU A;  3RPF C;  1R4N I;  2PVO D;  3AM9 A;  4G50 A;  2ASQ A;  2QHO A;  2LEK A;  1VZ6 A;  1T0Q C;  3KLS X;  1IBX B;  2JU6 X;  3HM3 A;  3N20 C;  1YX5 B;  3GS2 A;  4A20 A;  2KTR B;  1G6J A;  4NQK E;  3BK2 A;  3FC4 A;  5BMH A;  4HKQ A;  3ZNG C;  4Q2J A;  2D3A A;  1E8Z A;  1MJD A;  3APD A;  4OZC A;  1WGH A;  2N7J A;  2V3P A;  5E6J A;  3SHQ A;  1WXA A;  1P1A A;  2WLB A;  3QAQ A;  1D5M C;  3AE3 B;  1GJZ A;  5KHQ A;  1NYR A;  1NVI D;  4WQO B;  2Y5C A;  2G45 B;  3IAS 1;  2M1M A;  3NVV A;  4AJW A;  3RNA C;  1P0R A;  2LUE A;  2DHZ A;  2LGY A;  5DPT A;  3UF8 A;  1Z2M A;  1PUT A;  2XBB C;  4N9F 4;  2HE7 A;  2N9K A;  2PEA A;  1OEY J;  2O6V A;  1CJE A;  1VZ8 A;  4YSY B;  1Y8R C;  1BXT A;  2KX3 A;  5LXI B;  3N1X C;  4HDQ A;  2J42 A;  2DAJ A;  4AP4 C;  3OAW A;  1KFY B;  4FLH A;  1WMH A;  1T5X D;  3NVZ A;  1VD2 A;  3WAL A;  1V80 A;  2BKF A;  4ANU A;  1GOZ A;  3PHX B;  4HJK A;  2KDF B;  1D5Z C;  4ACF A;  2DBY A;  2LUM A;  1YNT E;  1WJN A;  3H7P A;  4AOF A;  4XWT A;  2WP9 B;  4GDK A;  5C23 A;  2KJH B;  1WF9 A;  5D2M B;  3PTF C;  3MC0 B;  3U7D A;  3AE6 B;  3GZN I;  3KUZ A;  3VVW B;  2FCQ A;  2WHI A;  1OEY A;  2IO0 B;  4GN1 A;  2K6Q A;  2O6V B;  1KF6 B;  1Q1O A;  4AQ7 A;  2WDV B;  4ZOH C;  1GB4 A;  1N5X A;  1N5W A;  3ZJT A;  2J53 A;  2C7M B;  3EC8 A;  1T0S C;  1Q10 A;  1V49 A;  2R2O A;  1K8R B;  2CHX A;  2ACZ B;  3B0A A;  2KVZ A;  1L5P A;  1FXI A;  1XCQ L;  3Q3F A;  1V81 A;  4MEM A;  4GMV A;  3ZUN A;  1IYF A;  4GGQ A;  3H7P B;  1K51 A;  3L4P A;  1YQB A;  1NYQ A;  1XT9 B;  1T0Y A;  1EWY C;  2NCN A;  4KSK C;  4XWW A;  4MSQ B;  1TIF A;  3AE9 B;  3X0W A;  3FKY A;  3A1Q A;  2YEP F;  4YT0 B;  1JRU A;  2D3B A;  3NY5 A;  4K3B A;  4KDL B;  2IO1 B;  4WUR A;  2RGF A;  3ALB A;  2O2V A;  2RR9 A;  2XEW A;  2MJD A;  1F1H A;  3KQ4 A;  3DHG C;  3AEA B;  1V86 A;  1PFD A;  1L0V B;  1QKZ A;  4R3D A;  2B76 B;  1OQQ A;  3AEE B;  2N9E B;  1N61 A;  2KWU B;  2Z0E B;  1L2N A;  5DPS A;  4NPN A;  4L2Y A;  4GLS C;  2L7R A;  3TL5 A;  3M95 A;  4GIV A;  2DYO A;  3U7Z A;  3A1Q B;  5D3I B;  2GBJ A;  1P98 A;  2JWZ A;  3L10 B;  3GZN B;  2GBM A;  1XD3 B;  4BBN C;  2Z0D B;  3C0R B;  3R3M A;  2O2V B;  2WXG A;  1NI2 A;  3VRB B;  3ZNI D;  2KWD A;  3QIJ A;  3VXW A;  2WXN A;  3U4E G;  2JRH A;  4FA6 A;  4M02 A;  2MH7 A;  2DWQ A;  1EU3 A;  1TS5 A;  1EUV B;  2MJ3 A;  2BWF A;  1I42 A;  4TQ0 A;  3QX1 A;  3KYC D;  2WX0 A;  5CTR C;  3Q3J A;  2GMI C;  3JW0 X;  2XK5 B;  2NMQ A;  3MHS D;  2DLB A;  2WYQ A;  3EA6 A;  1DYQ A;  3VQI A;  3RNC C;  3AEF B;  1C4C A;  1A70 A;  3B08 A; 
#chains in the Genus database with same CATH homology
 1C1Y B;  3DBH I;  2IBI B;  2I1J A;  2FCM A;  3UIO B;  3QA8 A;  2MRP A;  2MLB A;  4NY0 A;  4I6N B;  2NS5 A;  4GDK B;  1MG8 A;  1KJT A;  1WH3 A;  3IHP C;  2KJR A;  4DK5 A;  2LRU A;  4II2 B;  5C1Z A;  4AUQ C;  3QWZ B;  4BKT A;  4ZYN A;  4K7W A;  1YX6 B;  4YL8 A;  3OJ3 A;  5KHO A;  3VUY A;  4I6L B;  2PE6 B;  4K81 A;  2IO2 B;  5CHF A;  2MX2 A;  5D7G A;  2IY0 B;  3CF6 E;  2ZJD A;  3GOE A;  3PS6 A;  4IWO A;  3D32 A;  4IWP A;  2MSE D;  2K25 A;  3AU5 A;  3CMM B;  3WAM A;  1UZX B;  5L95 C;  3RUL A;  4AWJ A;  2BKR B;  1BT0 A;  1TGZ B;  2KFJ A;  4DDG D;  3X23 A;  3JVZ X;  2JT4 B;  4HDO A;  4GB9 A;  5CHV C;  3V62 A;  3WAO A;  2G4D B;  4W9E A;  2KNB A;  2D3G A;  3PLU A;  5BO4 B;  4NJ7 A;  4IC7 B;  1U4A A;  3W1Y A;  3QAR A;  2EMT A;  2DEN B;  3CST A;  2KWC A;  4JL9 A;  4MJS A;  4DDI D;  2C60 A;  3PLV A;  2RSU A;  3DVG X;  3MTN B;  3QQ8 B;  4IUM B;  4WWP A;  4A3P A;  4CHK A;  1GC7 A;  4EZJ A;  1OQY A;  4MDK E;  1Q5W B;  3RD2 A;  4E71 A;  3JSV B;  4W9D A;  4FHK A;  1S1Q B;  1D3Z A;  4WJQ A;  2LWP A;  4EOY A;  2RPQ A;  4W9I A;  2KMA A;  4IM2 A;  2A5U A;  2ZVO A;  2CHW A;  3L13 A;  3WAP A;  4FJV B;  1WIA A;  3ZNH B;  3RT3 B;  1HE8 A;  4HK2 A;  5E6N A;  4W9J A;  4EFO A;  3NZU A;  1GNU A;  2BGF A;  3PPA A;  2CKH B;  1V2Y A;  1NDD A;  1RFA A;  3LJ3 A;  3ECI A;  1IP9 A;  2CHZ A;  3AI5 A;  1NBF C;  3HIZ A;  3PHW B;  2C9W B;  4W9C A;  1WGR A;  2JF5 A;  1A5R A;  4TQ1 A;  1WI0 A;  3A9J A;  2KLG A;  4MGZ E;  4A3O A;  1RAX A;  2ZNV C;  4X57 B;  2K8B A;  2ZCC A;  4B95 A;  1KOT A;  3VTW A;  5J2R A;  3APC A;  4PS7 A;  3WIM A;  4DWF A;  2FID A;  3O65 B;  2MWS B;  2FUH B;  2G4S A;  1LFD A;  4MH0 E;  4XX5 A;  2NPT A;  4HPL B;  2JZ3 B;  2N4F A;  4J6I A;  3VTU A;  2DZJ A;  2LJ5 A;  1C3T A;  2NVU I;  5JHB A;  3UIP B;  1ZW7 A;  2OOB B;  2OJR A;  1E5W A;  3AU4 A;  3DPD A;  4P7I A;  4LJO B;  4MJS B;  2V4L A;  3PRP B;  4JQW C;  3M62 B;  2L05 A;  1R4M I;  1TZ1 A;  2N9P C;  5TR5 A;  3DCG A;  3AXC A;  3PT2 B;  4MGI E;  4DHZ B;  3A4R A;  1EO6 A;  2GOW A;  2ZPN A;  4IM3 A;  2PJH A;  2AL6 A;  3PV1 A;  2D10 A;  1OGW A;  3TBL D;  3V6E B;  2L0F A;  3CSF A;  1UBQ A;  4MSM B;  3RCZ A;  1WXM A;  2MBO A;  4K1R B;  4BKS D;  4FN2 A;  1WJ6 A;  5LLI A;  1ISN A;  4F7Z A;  1M94 A;  3A4S C;  4KSL C;  4CO7 A;  2N7E A;  3S2A A;  3TJP A;  2UWQ A;  4HLE A;  4RMA A;  3ZVV A;  3A9K A;  1TTN A;  4FHJ A;  1H4R A;  1RRB A;  1Q0W B;  1WX9 A;  2NBW B;  1WM3 A;  3EEC A;  1ZGU B;  2CS4 A;  1WXV A;  4WJO A;  4B9K A;  1E7U A;  4G3X B;  2N9X A;  4JLC A;  2Y5B B;  4KZC A;  3DBL I;  1SGH A;  4WJN A;  1EF1 A;  3A9J B;  3KH0 A;  2L8J A;  4JIO U;  1P9D U;  2DZK A;  2HJ8 A;  1WE7 A;  2K6D B;  2W9N A;  3ZNZ B;  4HPM B;  1WJU A;  5IA7 A;  2J0J A;  3L16 A;  3PGE A;  4GU2 A;  1WFY A;  2L0T A;  2KAN A;  2NBV B;  4NAW A;  2MQJ A;  3WA0 A;  4E74 A;  4F1S A;  1UH6 A;  2HD5 B;  3JYU A;  4KDI C;  4EKU A;  4M8M A;  1WGY A;  5AEK B;  4W9K A;  1LQB A;  1R4N I;  3ML8 A;  1WRD B;  4G50 A;  4NQL B;  1E7V A;  1I35 A;  4ZDV A;  1RLF A;  3K9O B;  2ASQ A;  2QHO A;  3VH4 B;  3QHT A;  3P2B A;  2CU1 A;  2IYD B;  4HXD A;  3AUL A;  1YJ1 A;  3MJW A;  5HKH A;  3PRZ A;  4IG7 B;  2K8H A;  2YVC A;  1H8C A;  3K9P B;  5G55 A;  2MCN B;  1V5T A;  2KOX A;  3HM3 A;  2IY1 B;  3V61 A;  1YX5 B;  4A20 A;  2KTR B;  4TV3 A;  3ONS A;  4ICV A;  3UGB B;  1G6J A;  2N1V A;  4NQK E;  5EDS A;  2A4Z A;  2KD0 A;  2IO3 B;  1F9J A;  3L54 A;  3ZNG C;  1E8Z A;  3PVL A;  3N3K B;  5AZG A;  3APD A;  2LI5 A;  3QC8 B;  5G2N A;  1WGH A;  3DBS A;  1GC6 A;  4WJP A;  2M4N A;  3SHQ A;  2BF8 B;  4DXA B;  2NBU A;  1WXA A;  1J0G A;  1FXT B;  1P1A A;  2R2Q A;  2AEH A;  2LD9 A;  2M8S A;  1P3Q U;  5DPW A;  2MBH A;  3QAQ A;  2MP2 A;  4PS8 A;  4LDT B;  3U30 A;  1AAR A;  2GBR A;  4AJY B;  5KHQ A;  3N30 A;  1GJZ A;  2L00 B;  4WQO B;  4ANV A;  2G45 B;  3TCA A;  3B1L X;  2M1M A;  2RD0 A;  4AJW A;  1WGD A;  3IVF A;  2LVP A;  1P0R A;  2LUE A;  4LDT D;  3EFU A;  2BPS A;  3HHM A;  1YD8 U;  3UQA A;  1KLV A;  2DHZ A;  2KFK A;  2LGY A;  2LRW A;  1PQS A;  3PRM B;  5DPT A;  4ZRJ A;  2KDI A;  1Z2M A;  4M0W B;  3UF8 A;  4DHZ E;  4CYE A;  2B3A A;  2MW5 A;  1WXS A;  1UGM A;  2FCN A;  2LGX A;  4PYU A;  5CHW A;  4TUU A;  5E6P A;  2WX1 A;  2KDB A;  2PE9 A;  2XBB C;  4N9F 4;  3ZTC A;  2HE7 A;  4ASW C;  4NJ6 A;  1WM2 A;  2PEA A;  1OEY J;  2M17 A;  4W9F A;  1GG3 A;  2LVO A;  2O6V A;  1VCB A;  4GSW A;  5J18 A;  3IG3 A;  1KM7 A;  2LXC A;  3LDZ E;  2Z59 B;  2DZM A;  1Y8R C;  2KX3 A;  2KWV B;  2XK5 A;  5LXI B;  2I1K A;  3ZW3 A;  4HDQ A;  4EUT A;  2LAS A;  2DAJ A;  4AP4 C;  3L17 A;  3OAW A;  5JZE B;  1LXD A;  2ZEQ A;  1V6E A;  2JZZ A;  1E8W A;  1WMH A;  3N32 A;  4FLH A;  3T8M A;  4EZK A;  1VD2 A;  1UEL A;  1IPG A;  3VDZ A;  1V80 A;  3WAL A;  2DX5 B;  4OVV A;  3R7R A;  2BKF A;  4ANU A;  4BOS C;  3PHX B;  4HJK A;  2L76 A;  2KDF B;  4DBG A;  4G0N B;  2KC1 A;  4FAD A;  2JXX A;  1E8Y A;  4IW0 A;  2FNJ B;  3M63 B;  2DYM A;  1WJN A;  3H7P A;  4AOF A;  2N1W A;  4KVG B;  4GDK A;  5LXH A;  5C23 A;  3BIN A;  4ANX A;  2KFK B;  2EMS A;  4ZRI A;  2KJH B;  1WF9 A;  1TBE A;  5D2M B;  3PTF C;  3U7D A;  3KUD B;  3KW5 B;  5GMV A;  3NZS A;  3GZN I;  3RZF A;  3RYT A;  3KUZ A;  3IBE A;  1WY8 A;  3KYD D;  3VVW B;  2FCQ A;  2HTH A;  2JY6 A;  4MM3 A;  3VTV A;  5D6J B;  1WR6 E;  4HCP B;  3VHT C;  1OEY A;  2IO0 B;  2KJ6 A;  2KQ7 A;  3PRE A;  3RUI B;  5JHA A;  4GN1 A;  4F8C B;  2BWE S;  2K8C A;  2K6Q A;  2O6V B;  5L83 A;  1Q1O A;  3NOB A;  3V6C B;  3V60 A;  4RM8 A;  2K39 A;  2BYF A;  3H7S A;  4GXB A;  4E3C A;  3ZRF A;  2NPT B;  1XQQ A;  4MGK E;  3PSE B;  2EKE C;  2LVQ A;  2O6V D;  4PS3 A;  2C7N B;  2DZI A;  3U8Z A;  3DBR I;  4RM9 A;  2ZZP B;  4II3 B;  4DHJ B;  1YIW A;  1UD7 A;  2FCS A;  3QCA A;  2C7M B;  3EC8 A;  2KQS A;  2V3S A;  4TKN A;  3VAW A;  1V49 A;  3BY4 B;  4GOC A;  2BYE A;  2R2O A;  1K8R B;  3DOW A;  4DHJ D;  2J0M A;  2CHX A;  2AYO B;  2D2Q A;  2ZCB A;  1J19 A;  1QZE A;  2KVR A;  3B0A A;  3DVN V;  3ZLZ A;  3I3T B;  1J8C A;  2WDT B;  3Q3F A;  1WR1 A;  1V81 A;  4MEM A;  4GMV A;  3ZUN A;  1IYF A;  4GGQ A;  1WYW B;  4KV2 A;  3H7P B;  2GBN A;  4BBN F;  1YQB A;  1E90 A;  3A9K B;  2KMC A;  1LM8 B;  4XC2 A;  3T9L A;  1GUA B;  1XT9 B;  2C5L C;  5DCN A;  2AL3 A;  2MBQ A;  1T0Y A;  2C7H A;  2LZ6 A;  4W9L A;  1WZ0 A;  3PZD A;  3TIX A;  4BVU C;  4LCD E;  5D94 A;  2VRR B;  3APF A;  2NCN A;  4KSK C;  2MA9 B;  3VH3 B;  3H1U A;  2MBB B;  1CMX B;  4MSQ B;  2D11 A;  4LJP B;  4BFR A;  5AZF A;  3NS8 A;  1X1M A;  3A33 B;  3X0W A;  2IZV B;  3DQV A;  2JVC A;  3A1Q A;  3R7Q A;  3VFK A;  3HK0 A;  4NAW B;  2GBK A;  1JRU A;  3H9D A;  3M3J A;  3SDL C;  2MBE A;  3NY5 A;  2JRI B;  4IWQ A;  4KDL B;  3ZRC A;  3QK0 A;  2IO1 B;  2RGF A;  3IFW B;  2JUO A;  4HWI B;  3TMP B;  4HVB A;  2G3Q B;  3ALB A;  5J17 A;  2O2V A;  2RR9 A;  3KUC B;  2KTF A;  2XEW A;  4JGH B;  1WX7 A;  4ANW A;  2KK8 A;  3VUW A;  2JPH A;  3ZKJ C;  3HM6 X;  4BKS A;  2FIF A;  1V86 A;  2ZVN A;  2M0X A;  5CX3 A;  5AZH A;  1V9J A;  4NNJ B;  3ZO5 B;  3ZDM C;  3W1S A;  2KDE B;  2KKC A;  2FAZ A;  4FUL A;  5FR6 A;  4G11 A;  3W1S C;  4EEW A;  4OVU A;  4WWN A;  2N9E B;  3OJ4 B;  2KZR A;  1EF5 A;  2LGD A;  4W9H A;  3RZW C;  2BYV E;  2REX A;  2KWU B;  2Z0E B;  2LXA A;  5DPR A;  1L2N A;  2WWZ A;  3EHV A;  5DPS A;  4NPN A;  2KC2 A;  4GDL A;  2L7R A;  3QJZ A;  3TL5 A;  2UYZ B;  3M95 A;  1V5O A;  3NHE B;  4GIV A;  4K7S A;  4PYZ A;  2DYB A;  3ML9 A;  1SE9 A;  2DYO A;  4KIK A;  4FBJ B;  1SIF A;  3KVF B;  2ZPY A;  3A1Q B;  2DAF A;  5IAA C;  2MP2 B;  1WE6 A;  2GBJ A;  3ZDT A;  4K7U A;  3DVG Y;  1P98 A;  4MEL A;  4WAA A;  1S3S G;  2JWZ A;  1UBI A;  2L3Z A;  2NR2 A;  3H6N A;  3L10 B;  2GBM A;  1XD3 B;  4BBN C;  4BKG A;  1E8X A;  1WGG A;  2KHW B;  2Z0D B;  3C0R B;  3R3M A;  2J7Q B;  4I6P A;  2O2V B;  3VUX A;  1NI2 A;  3ZNI D;  2KX0 A;  3L0W B;  3QIJ A;  3VXW A;  4URK A;  2KLC A;  3SD5 A;  3WAN A;  3UIN B;  3L08 A;  4B6W A;  2JRH A;  4FA6 A;  2YLM A;  2J0K A;  5E6O A;  4KZ0 A;  3SU8 X;  3ZTD A;  4ZRK A;  1OTR B;  1EUV B;  2BWF A;  3DVN U;  2KN5 A;  2KTR A;  1I42 A;  4TQ0 A;  3QX1 A;  3KYC D;  2CR5 A;  2WX0 A;  5CTR C;  3ENE A;  3Q3J A;  4FJY A;  2GMI C;  4HCN B;  3ZIM A;  1WZ3 A;  4WWO A;  4M8N A;  2AWT A;  2ZNV B;  3JW0 X;  3DDC B;  2XK5 B;  3MHS D;  1L7Y A;  2PPH A;  2D07 B;  2N7D A;  1Z5S B;  4FJZ A;  4XZ4 A;  3UQB A;  4GDL B;  4EZL A;  4BOZ B;  1ZKH A;  1WMH B;  2V1Y A;  4W9G A;  2WYQ A;  2K1F A;  3OLM D;  1WJ4 A;  4IM0 A;  4KIK B;  3VQI A;  3R66 C;  1WX8 A;  5JH5 C;  2KXJ A;  3B08 A;  2KO3 A;  4ICU A;  4MGY E;  3JSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...