3ZTCA

Pvhl54-213-elob-eloc complex _ (2s,4r)-n-((1,1'-biphenyl)-4-ylmethyl)- 4-hydroxy-1-(2-(3-methylisoxazol-5-yl)acetyl)pyrrolidine-2- carboxamide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
103
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADTFEALCIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 21
structure length 103
sequence length 104
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ztcA00
3PVLA 4MDKE 2PJHA 4KV2A 4WJQA 3H7PB 4DWFA 4ZRIA 2CU1A 5GMVA 2K6DB 3VH4B 4BKGA 3VH3B 1AARA 2XEWA 3WAPA 1IYFA 1ZW7A 2IO2B 4MGZE 3WA0A 1GUAB 1P0RA 5J18A 3TMPB 1WR1A 2KVRA 3WALA 5EDSA 4MGIE 2KDBA 2KJHB 2WYQA 1UH6A 2GOWA 2AYOB 3EECA 1X1MA 3A9JA 3VFKA 5D2MB 4IM0A 4FJVB 1EF1A 3KYCD 4NY0A 5CTRC 4A20A 4EKUA 2M4NA 2NVUI 5DPRA 3DOWA 5CHWA 2KC2A 4BVUC 3A9KB 3T8MA 3QAQA 3APFA 1E8YA 2BF8B 1WJUA 3RUIB 4DHZE 1LM8B 3PRMB 2I1JA 4KZ0A 1Q1OA 2O2VB 2NBUA 2C7MB 1D3ZA 5KHOA 1LXDA 2L3ZA 1P9DU 1TTNA 3UGBB 3ZNZB 3VTWA 2FCMA 3MTNB 2J0KA 3IHPC 3IBEA 3ZRCA 1WH3A 1BT0A 3QQ8B 3A4RA 3DCGA 3HIZA 2L00B 5CX3A 5D94A 3RYTA 2G45B 5CHFA 3QK0A 3W1SA 2V1YA 4W9EA 2MP2B 4IM3A 4G50A 5AZGA 3R7RA 2IY0B 1V6EA 1EUVB 2GBKA 2IYDB 2MRPA 4ZDVA 3DQVA 2NPTB 1VCBA 2ZCBA 4RM8A 4KSKC 2FCNA 3PLUA 2EMSA 3B08A 2LVQA 3L10B 4F7ZA 3PS6A 4J6IA 2MBOA 3NS8A 4ZRKA 3WIMA 1GNUA 3AU5A 3NY5A 4MM3A 1LFDA 4WWNA 4GDLA 1WGHA 2MW5A 3VUWA 2NCNA 3HK0A 4FJZA 1WX7A 2D07B 1Z5SB 3ECIA 4FULA 4FA6A 2KHWB 3VUXA 2MBEA 3WANA 4OVVA 4WJPA 2JRIB 3M95A 1C3TA 4MEMA 2I1KA 2ZNVB 1NI2A 4PS8A 3L13A 3JW0X 2IO1B 4DHZB 2O6VB 1V80A 1J19A 1S1QB 1EO6A 3R7QA 3B0AA 3CF6E 4K7WA 4KVGB 1SE9A 4W9IA 1WM3A 2JF5A 2KDFB 4GIVA 3B1LX 4ANUA 3TL5A 2J7QB 2N9EB 1WGDA 2M8SA 3A1QA 3PV1A 3QHTA 3ZO5B 2A4ZA 4IM2A 5G2NA 1JRUA 2L76A 3BY4B 2J0JA 4PS3A 4DBGA 1ZKHA 3TBLD 1WMHA 1WJNA 2JT4B 2PE9A 2N9XA 4FHJA 2FNJB 2KOXA 2M17A 3C0RB 3QJZA 4MH0E 2KLCA 3ZIMA 4JIOU 2KWVB 1V49A 2L8JA 3A33B 4W9CA 1V5TA 3N32A 4GOCA 2KJRA 1YX5B 3CMMB 4E74A 2JVCA 3W1SC 2N4FA 3HM6X 1UZXB 3H9DA 2MBQA 5JHAA 3QCAA 4WQOB 4G11A 3ZRFA 1I42A 1E5WA 4FJYA 5C23A 3D32A 3DDCB 1NDDA 4GXBA 3W1YA 5JZEB 3CSTA 1E8ZA 2N1WA 4E71A 2JY6A 5HKHA 3QC8B 3DVNU 1WE7A 1E7UA 4GDKB 3VUYA 1P98A 4KDLB 4LJPB 4EZLA 4URKA 1V9JA 4A3PA 1OTRB 4HJKA 4PYUA 3A9KA 3SHQA 3OLMD 3DBLI 3KUZA 3NZSA 3UF8A 4DHJB 2O2VA 4IG7B 4NNJB 4MSMB 2LI5A 1J0GA 2EMTA 4ZYNA 3ZDTA 2LGYA 1UBQA 3TIXA 4PS7A 3AU4A 3RZFA 1RFAA 1TBEA 1WX8A 1OGWA 2LRUA 3ZKJC 1J8CA 2MP2A 1R4NI 2OOBB 4FHKA 4IWOA 1V5OA 1WZ3A 3L08A 1FXTB 3WAMA 2NPTA 1GJZA 3ZNGC 2DZJA 3L17A 3DPDA 2Z59B 4K7UA 3GZNI 2O6VD 4ANVA 4W9JA 1T0YA 4K7SA 4ANXA 2IY1B 2JZ3B 2LGDA 3R3MA 2FIDA 4DXAB 2MBHA 1Q5WB 2V3SA 4BFRA 1WX9A 2QHOA 3H6NA 3KUDB 5J17A 2JPHA 1C1YB 2MLBA 2GMIC 2KTFA 2KD0A 3L54A 1Z2MA 4NQLB 2ZEQA 3N30A 5L83A 2M1MA 3SDLC 2LUEA 3PPAA 4GN1A 4G0NB 4XX5A 4M0WB 1OEYA 1YIWA 4I6LB 4MELA 3HM3A 2LGXA 3ZTCA 5JH5C 2HTHA 2K6QA 5CHVC 2DYOA 2UWQA 1E8WA 4I6PA 4K1RB 5D7GA 2C9WB 4HPLB 2O6VA 5G55A 4IC7B 4NAWB 5KHQA 2D10A 5DPWA 3SU8X 2L05A 3DVGX 2G4SA 2KFKB 1YJ1A 3ZNHB 2KC1A 1RLFA 1WXVA 4W9DA 5DPTA 3JVZX 2KMAA 3EFUA 3KW5B 2ZPNA 1G6JA 2XK5B 4FLHA 1XQQA 4TQ0A 1P3QU 4YL8A 3X23A 2ZCCA 1WFYA 2GBJA 3IG3A 3PTFC 3P2BA 3HHMA 2HE7A 3QARA 4WAAA 2KLGA 3TJPA 3V61A 4HDQA 2BKFA 1RAXA 2KWCA 5AZFA 2PEAA 2KN5A 1EF5A 2JWZA 1XT9B 3L16A 4BOZB 2RR9A 4GB9A 2BKRB 2M0XA 4P7IA 3VTUA 1TGZB 5TR5A 2PE6B 3NHEB 2KQSA 1M94A 1H4RA 1U4AA 2K25A 3LJ3A 5BO4B 2LXAA 3RZWC 1KOTA 3PT2B 4DDID 4DHJD 2V4LA 2R2OA 1CMXB 3ZVVA 1WI0A 3TCAA 4MGYE 2YVCA 2ASQA 2DAJA 2KXJA 4AJYB 2NR2A 2LWPA 2KDIA 3DBSA 5C1ZA 1UGMA 4MSQB 4ZRJA 3OAWA 3ZLZA 3K9PB 5FR6A 3ML9A 4GU2A 4JLCA 1L7YA 3SD5A 3Q3FA 4XZ4A 4B95A 3BINA 1WGRA 2CHWA 4GDKA 2RD0A 2AL3A 1I35A 2MSED 3PLVA 5LLIA 1OQYA 3OJ3A 2HJ8A 4KIKB 4OVUA 1K8RB 3LDZE 4F8CB 4BOSC 2Z0DB 2J0MA 3U30A 5E6NA 2R2QA 1KJTA 3APCA 1Y8RC 2DHZA 4EZKA 2BGFA 3JSVB 2BPSA 2ZJDA 3VHTC 4G3XB 4HVBA 2KMCA 2Z0EB 3PSEB 2N9PC 3KYDD 1WJ6A 2KDEB 2W9NA 2YLMA 2MCNB 4AP4C 1E90A 4HLEA 3DBHI 1IP9A 3M62B 2XBBC 2G3QB 1A5RA 1NBFC 1WXSA 4WWOA 2KX3A 2N7EA 5AEKB 4EOYA 2FIFA 2L0TA 1UBIA 1H8CA 1KM7A 2LXCA 2VRRB 2RSUA 3T9LA 4AJWA 1P1AA 1TZ1A 2NS5A 1IPGA 2REXA 5L95C 2DX5B 2WX0A 4CO7A 1UELA 1WXMA 3KUCB 2IZVB 3VTVA 4M8NA 3CSFA 2BWFA 2CS4A 2CHZA 3AI5A 1V2YA 2IBIB 2UYZB 3MJWA 2DENB 2GBNA 4IUMB 4TUUA 2LVOA 2WX1A 1OEYJ 4EFOA 4ICUA 3PHXB 3N3KB 3UINB 5E6PA 3PRZA 4MGKE 2BYEA 3QIJA 3AXCA 4IWPA 4HPMB 5J2RA 3DBRI 2KNBA 1WXAA 5AZHA 2JRHA 1Q0WB 4F1SA 3OJ4B 4AOFA 2D11A 3PGEA 1UD7A 3RD2A 1LQBA 4LDTB 2B3AA 1MG8A 2EKEC 3M63B 4N9F4 2DZMA 3ZNID 1VD2A 4JGHB 3VXWA 2D2QA 1GC6A 2FAZA 1E8XA 3VVWB 1E7VA 5E6OA 2BYFA 3H7SA 3UIPB 4NAWA 5LXIB 4TQ1A 1L2NA 3WAOA 2K39A 3Q3JA 2MQJA 2DZKA 2NBVB 1V86A 1WY8A 1WZ0A 2KTRB 4XC2A 2KFKA 1WGGA 4RM9A 2MBBB 4TKNA 5D6JB 3NOBA 4WJOA 2AEHA 3V60A 2FCQA 4DDGD 4A3OA 1QZEA 2C7HA 2JUOA 2XK5A 4HK2A 3DVNV 3IFWB 2KQ7A 1ZGUB 2KJ6A 2LVPA 3UQAA 4BBNF 4IWQA 5IA7A 1WRDB 3I3TB 2WWZA 4GSWA 4HDOA 4KSLC 4FBJB 2FCSA 3A9JB 3L0WB 4W9LA 2LJ5A 1S3SG 2K8CA 2IO0B 3H1UA 3A4SC 3QWZB 3RT3B 3EHVA 4GMVA 2PPHA 2DYBA 4W9FA 2K8BA 2KKCA 1SIFA 4HCPB 3ZW3A 4HWIB 2C7NB 3K9OB 3PHWB 4LCDE 1WYWB 4FN2A 5DPSA 4JQWC 2C60A 2IO3B 4II2B 2CKHB 5DCNA 4ASWC 4FADA 1WGYA 2DZIA 3ML8A 2LASA 3APDA 3QX1A 5LXHA 3QA8A 2BWES 1WR6E 4HXDA 4KDIC 4NJ6A 3KVFB 1GG3A 3ZUNA 3EC8A 4KIKA 1WIAA 1RRBA 2KX0A 2RPQA 4II3B 2NBWB 4I6NB 1GC7A 3DVGY 3ONSA 4LJOB 4W9KA 2FUHB 2K1FA 3JSVA 1WE6A 3ENEA 1WJ4A 4DK5A 2D3GA 4X57B 4B6WA 2CHXA 2KK8A 2GBMA 3UIOB 2ZVOA 3VQIA 4PYZA 4BKTA 1YQBA 4CYEA 4WJNA 2DAFA 2LZ6A 4GDLB 2C5LC 2L7RA 2MA9B 2MWSB 2ZPYA 3O65B 4LDTD 3PRPB 4HCNB 3U8ZA 4BKSD 1F9JA 2HD5B 2DYMA 1HE8A 4K81A 4B9KA 2MX2A 3VAWA 3NZUA 4NQKE 2ZNVC 3M3JA 4GGQA 2N1VA 1KLVA 3UQBA 3V6EB 4RMAA 1YD8U 4ICVA 3ZTDA 5JHBA 2ZZPB 2JZZA 2K8HA 2RGFA 2WDTB 3KH0A 1YX6B 1PQSA 4AWJA 4EEWA 3A1QB 3ALBA 3RCZA 2L0FA 2AL6A 2JXXA 3RULA 3ZDMC 4AUQC 2AWTA 1WF9A 4EUTA 2CR5A 4MJSA 1ISNA 4NJ7A 3AULA 5IAAC 3S2AA 3R66C 4IW0A 1WMHB 3PZDA 3H7PA 1XD3B 4M8MA 4E3CA 4WWPA 2A5UA 3VDZA 4BKSA 4ANWA 1SGHA 2Y5BB 3U7DA 4CHKA 2LRWA 2GBRA 3V6CB 3IVFA 3PREA 2ZVNA 2LD9A 2KWUB 2OJRA 4W9HA 4W9GA 1WM2A 2KZRA 2KFJA 3GOEA 4KZCA 3X0WA 2N7DA 3JYUA 2G4DB 3MHSD 4JL9A 1R4MI 1V81A 2KTRA 2KANA 2KO3A 3V62A 4MJSB 4TV3A 4NPNA 4EZJA 4BBNC 2BYVE
chains in the Genus database with same CATH superfamily
5FK9C 2CU1A 4M00A 1ZW7A 2BB5A 5J18A 1WR1A 4XDDA 2KDBA 3I5JC 2KJHB 1LO5D 1UH6A 1I4HA 2KAJA 3VFKA 4IM0A 4FJVB 1EF1A 4A20A 3NUHB 4C7YA 5CHWA 2KC2A 3RUIB 4DHZE 1LM8B 2I1JA 3GE8C 1Q1OA 2C7MB 5KHOA 1LXDA 3MTNB 1BT0A 1AYFA 5CX3A 4HROA 5EE3A 3QK0A 2V1YA 2FBWB 1V6EA 2GBKA 3LYYA 4ZDVA 2NPTB 1VCBA 1TZOA 2ZCBA 4P1CC 4BZAA 2IJ0A 4KSKC 2WDQB 3PLUA 4ZRQA 1VDVA 1KTKA 1F2RC 1GNUA 4ZRPA 3AU5A 3GS2A 1FRDA 3AEFB 1K51A 4MM3A 1LFDA 2MW5A 1WX7A 2D07B 4FULA 2KHWB 3EUB2 3N1ZC 1C3TA 3ZXRA 4BAXA 2WP9B 3L13A 2LHDA 2O6VB 1V80A 1TKYA 1EO6A 2BQQA 1WM3A 3PV1A 1ROEA 1J7AA 3ZO5B 2J0JA 1TS3A 1STEA 2KOXA 3Q8CA 1FMAD 1GB1A 2L8JA 1CQVA 1V5TA 2BS3B 2M0AA 4OZCA 3HM6X 5EE0A 3H9DA 1OQRA 3W9CB 5T8IA 1I42A 3FILA 2JQRB 3P4RB 1QOGA 3W1YA 2QJLA 4C56C 3CSTA 4A9AA 4E71A 5JXVA 3QC8B 2N0SB 1N61A 3VR9B 2BBCA 3C19A 4PYUA 2BB6A 1JALA 2QDFA 4NNJB 1J0GA 3U4EG 2WXRA 3AE8B 3ZDTA 1EU3A 1OGWA 4AQ7A 1YQ4B 1JWMD 1E9MA 4IWOA 4DXFA 1JWUD 3DHHC 3L17A 4K7UA 4ANVA 3FKYA 1V8CA 1F1HA 1ENFA 2WNMA 3W2DA 2JZ3B 3R3MA 1C4CA 2FIDA 3Q8BA 1YQ3B 2GI9A 2MBHA 5J17A 1C1YB 2PVGC 4HKZE 2MHJA 1GPXA 1Z2MA 4NQLB 2ZEQA 3RNBC 4RF0A 5IN7A 1OEYA 3ZTCA 1I7HA 2OEDA 5CHVC 2UWQA 5D7GA 1KLUD 4HPLB 2IGGA 4ARCA 2D10A 2AQ1B 3SU8X 2G4SA 4KKJA 1YJ1A 3Q2AC 2KC1A 4ITKA 3KW5B 1G6JA 2HJ1A 4TQ0A 3DWGC 2ZCCA 3IG3A 3P2BA 2KLGA 1RAXA 2KWCA 3B2FA 1PDXA 1EF5A 2JWZA 3L16A 1NEKB 3OG5A 3P4SB 2KQSA 1M94A 1H4RA 3LJ3A 1I4GA 3MJ5A 4H2AA 1KOTA 3AMZA 3AE5B 4KGTA 4DHJD 2R2OA 4MT5A 1XLNA 4MGYE 3SFEB 2ASQA 2RPVA 5FR3A 1UGMA 4MSQB 3ZLZA 5FR6A 4B95A 3BINA 2AL3A 1I35A 3PLVA 1C79A 2HJ8A 4OVUA 2I2YA 1K8RB 4J3OD 2R2QA 1KJTA 1Y8RC 2DHZA 2BGFA 3JSVB 4A90A 4AP4C 4HLEA 3DBHI 2G3QB 3TUOA 3N1YC 3E9SA 1UBIA 1H8CA 3RNFC 4AJWA 2RSUA 2VZKD 2REXA 5L95C 5BYQA 2DX5B 2Y3AA 1UELA 3VTVA 4M8NA 1SF0A 1TKEA 1V2YA 2UYZB 4JE3B 2DENB 4NAMA 4TUUA 1YJIA 1VLBA 1OEYJ 4DXGA 3UINB 2ZW1A 4O1NA 4AOFA 1HEZE 3ZNID 1GC6A 1E7VA 2WHIA 2NBVB 1V86A 2KFKA 1WGGA 3NOBA 5MPOA 1YJJA 1KLGD 2AEHA 3V60A 2C7HA 2JUOA 2VH1A 5HI1A 4PT5A 5IKCM 1XO3A 2KQ7A 1SE3A 5IA7A 1WRDB 1XLQA 4KSLC 2CJOA 3R8BA 3GE3C 2K8CA 3H1UA 2PMVA 4OHJA 3RT3B 3AE7B 1I4PA 1RWSA 1EWYC 4YTPB 4II2B 4JWSC 5DCNA 3ML8A 2DZIA 2LASA 1C76A 3QX1A 4USAA 3EC8A 1WIAA 2KX0A 3AEDB 3GB1A 4I6NB 1FFUA 1GC7A 2INDC 1WJ4A 2WDVB 2G9HD 4IOIE 4MM3B 4R3DA 4WJNA 2LZ6A 2L7RA 2ZPYA 3U8ZA 4HCNB 4BKSD 2J53A 1HE8A 4K81A 2MX2A 2MJ3A 3PZ8A 3NZUA 4NQKE 3M3JA 5FKAC 2N1VA 3UQBA 3ZTDA 4WH4A 2X38A 2K8HA 3U2SC 1PGBA 3KH0A 1PQSA 1VR9A 2LFIA 1WYGA 3R66C 3GP7A 1D6EC 4TMAB 4E3CA 4BKSA 1SGHA 2V4IB 3U7DA 1F52A 2ZVNA 2JYEA 4W9HA 1WM2A 3JYUA 2G4DB 4JL9A 4OVZA 2K5PA 1R4MI 2MJEA 4NPNA 4BBNC 1FRRA 4S0RA 3PVLA 2PJHA 1V1OA 4KV2A 3H7PB 4WJQA 4DWFA 2K6DB 3VH4B 4B0MA 3FILB 1AARA 1IYFA 4MGZE 3WA0A 1HTQA 2KVRA 5EDSA 2WGSA 1EM7A 2GOWA 3EECA 1X1MA 3A9JA 1WRIA 2K22A 4NY0A 5CTRC 2NVUI 3DOWA 3MC9A 1D3ZA 1P9DU 3ZNZB 2KVZA 2J0KA 3IHPC 3T3NA 3IBEA 3QQ8B 2L00B 4FXCA 3RYTA 2G45B 3W1SA 4XYCA 1FCLA 4G50A 2IY0B 1EUVB 2IYDB 2NMQA 4RM8A 2AX5A 2FCNA 3RNGC 4LNIA 1MFWA 4F7ZA 2MBOA 1HXYD 1L0YB 3BK2A 4WWNA 1WGHA 2NCNA 3ZJTA 1SXTA 1D5MC 1Z5SB 4LNFA 3ECIA 4FA6A 2JRIB 3M95A 5D3IB 4MEMA 5H8YE 2ZNVB 3NRZA 1L5PA 2IO1B 5LNK1 5EE1A 1L0XB 2PIAA 3R7QA 4LNNA 3AM9A 4W9IA 2JF5A 2H88B 4IM2A 2L76A 4C00A 3R2TA 1WMHA 2Q5WD 2QSDA 2FNJB 3C0RB 4LTUA 4MH0E 3Q3OC 2KWVB 3TEWA 1XXGA 2PLPA 3CMMB 2WU5B 4RGMA 3W1SC 1QOBA 1UZXB 5C3JB 5JHAA 2JX5A 1SB3C 1ZOYB 1XCQL 4ZHPA 3AH7A 4N59A 3D32A 1NYRA 1FFVA 2N1WA 5G5GA 5HKHA 2HTME 3NVZA 1P98A 4KDLB 1V9JA 4HJKA 4YSYB 1WWTA 2YEPB 3DBLI 4DHJB 2O2VA 2SEBD 4IG7B 3PZ7A 4MSMB 1FNWA 4ZYNA 3W5VB 2LGYA 4PS7A 1JCKB 1RFAA 1TBEA 1YN5A 5TSSA 1ET9A 2LRUA 2MP2A 1R4NI 2OOBB 2W82A 2MH7A 2NTSA 3L08A 2INNE 2DZJA 5D3DA 3GZNI 4YT0B 4W9JA 1D4BA 1L6VA 2V3SA 3H6NA 2FUG1 2JPHA 1ZUD2 4RGOS 2KTFA 2KD0A 3L54A 3N30A 5L83A 3SDLC 2VZKB 3H8HA 1E0ZA 1F0ZA 1T5XD 4XX5A 1YIWA 4I6LB 4MELA 5JH5C 3HM3A 2LGXA 5G55A 4HPPA 4IC7B 1PGXA 3BVMA 1MHXA 2L05A 3DVGX 2KFKB 3ZNHB 1RLFA 1WXVA 3JVZX 3EFUA 4GLSC 1XQQA 1P3QU 3X23A 1WFYA 1C4PA 3PTFC 2HE7A 3TJPA 4HDQA 3Q8EA 2KN5A 1QILA 1A70A 2M0XA 3IT6B 2GB1A 3NHEB 5BO4B 3RZWC 5BMIA 3PT2B 1CMXB 3Q3NC 3ZVVA 1N62A 1WI0A 3DBHB 2YVCA 1J7CA 3AE4B 4AJYB 2LWPA 3DBSA 2L83A 3K9PB 3ZJVA 4JLCA 1L7YA 3SD5A 3Q3FA 4XZ4A 4K3CA 1WGRA 4GDKA 1FO4A 3LDZE 2INPE 2BPSA 4G3XB 3PSEB 1SE4A 1TJEA 2XBBC 2KX3A 2BS4B 4EOYA 2WU2B 4AS1A 2G1EA 1TZ1A 3URYA 2IZVB 2CS4A 3P42A 2GBNA 2WXPA 3KQ4A 2LVOA 3MC8A 2BYTA 3QIJA 1N6ZA 2JWUA 5J2RA 3V05A 2KNBA 1WXAA 2JRHA 3OJ4B 2D11A 3PGEA 1UD7A 3RD2A 4KKIA 1MG8A 3M63B 4ZOHC 4M0WA 2D2QA 3VVWB 5E6OA 5BMGA 2BYFA 1E10A 3FAHA 3I9V1 3CIRB 3WAOA 4N58A 2MQJA 2DZKA 5AUIA 1WY8A 4RM9A 4TKNA 4WJOA 4DDGD 3DVNV 3RFZB 2WS3B 1ZGUB 1P7EA 4BBNF 2PVOD 3I3TB 1B9RA 2W3RA 1WSPA 4XE0A 1FD6A 3A9JB 4IDIA 2QMTA 2LJ5A 1DYQA 1ESFA 1TS2A 2IO0B 2FE8A 2WXJA 4W9FA 2PPHA 2DYBA 4HCPB 4A6QA 4HWIB 2LGSA 1MHHE 4KGSA 5DPSA 4JQWC 2IO3B 4LK0M 4YWGG 1J7BA 2IGHA 1IGDA 1RYJA 5LXHA 2D3BA 4HXDA 3KWLA 1GG3A 4KIKA 1RRBA 1ZXIA 1FPYA 2L1AA 4W9KA 1WE6A 2D3GA 1VZ7A 2WLBA 4TSSA 1K50A 2GBMA 1WGKA 2ZVOA 4BKTA 2C5LC 3UI3A 2MA9B 2MWSB 4LDTD 3O65B 3IXSA 4ACFA 4B9KA 1E6EB 2N9LA 2ZNVC 4US8A 4UDUC 4ICVA 2ZZPB 2RGFA 2WDTB 1TT5B 3DBRB 1ZP0B 4XGAB 2IPKD 1ET6A 1ZE3D 4AWJA 4EEWA 4WQMA 3ALBA 2L0FA 2AL6A 4AUQC 2JZPA 3B9JA 2KQ4X 1ISNA 4NJ7A 3Q3MC 2D3AA 2LUMA 1WMHB 3PZDA 1XD3B 2A5UA 3VDZA 4RFBA 3VR8B 1TS5A 4CHKA 2I38A 1KRHA 3V6CB 2BW2A 1T6BX 5C2TB 3Q69A 2RDGA 4KZCA 2W54A 1UF0A 3BZDB 4EZJA 4MJSB 4TV3A 4L23A 3DWMA 2BYVE 4RH6A 3U7ZA 5GMVA 4BKGA 3WAPA 3TEXA 2IO2B 1P0RA 1HZ5A 4RGTA 1WXQA 2KYWA 3WALA 4MGIE 3AN1A 4S17A 4EKUA 2M4NA 4BVUC 3QAQA 3APFA 2BF8B 3PRMB 2BVCA 1QF6A 1SEBD 2O2VB 2NBUA 3U52E 1QT9A 1N5WA 5HHDG 3Q8FA 1TTNA 3UGBB 3BVZA 3VTWA 3I57A 1WH3A 3DCGA 5D94A 5CHFA 1UUPA 4W9EA 2MP2B 4IM3A 4ZYSA 3R7RA 1YOVB 3DQVA 2AQ3B 2V3NA 1V97A 3HVDA 2EMSA 3EA6A 3NJTA 3L10B 4J6IA 3C8YA 3VUWA 3HK0A 3TSSA 4FJZA 1BMLC 1C4AA 3CWIA 3VUXA 1JW9D 4C4VA 4Q2JA 2I1KA 4PS8A 1UGJA 3JW0X 2DBYA 4DHZB 1YN3A 1J19A 1QLBB 1Q10A 1D5XC 1VRAB 3CF6E 2N9KA 1SE9A 3B1LX 3TL5A 2J7QB 1M4VA 3IT4B 1AWDA 2DWQA 3QHTA 3Q6BA 4PS3A 1ZPSA 1WJNA 2PE9A 2N9XA 4FHJA 3QJZA 2KLCA 3DHGC 4JIOU 3A33B 3SEBA 1R7SA 3N32A 1VZ8A 1YN4A 2JVCA 5I4DA 1N60A 4IKGA 1VJKA 3QCAA 2LMCA 4G11A 3ZRFA 2JSVX 2LJIA 3DDCB 1NDDA 3NVWA 4GXBA 2HDEA 2ON8A 1E8ZA 1R4NB 3DVNU 4GDKB 1E7UA 3VUYA 4LJPB 4EZLA 1FIQA 4URKA 4A3PA 3A9KA 3SHQA 3OLMD 1UWXA 4XDCA 3NZSA 3AE1B 1E7PB 2JU6X 4KX6B 3TIXA 3RZFA 1K52A 1V1PA 1GOZA 3ZKJC 1C78A 4FHKA 3ABVB 1FXTB 1NENB 3WAMA 1GJZA 3RPFC 3ZNGC 3DPDA 4ANXA 4A8XC 2LGDA 4RF1A 4DXAB 3Q14C 1Q5WB 4BFRA 2QHOA 3KUDB 2PTLA 2MLBA 4YTMB 2GMIC 4JX1C 1T0SC 4XWWA 2LUEA 3L4PA 1DOIA 4M0WB 2HTHA 2K6QA 1E8WA 2C9WB 3TEYA 3T3OA 4MACA 2ACZB 4REZA 3DHIC 1OFFA 2BT6A 5KHQA 2QEJC 2WXMA 5DPWA 3RNEC 1F2RI 5DPTA 1FXIA 1NYQA 3MC0B 2B76B 2WXNA 1PYWD 3HHMA 4WAAA 3V61A 3R2IA 4RCOA 5AZFA 2DNFA 2PEAA 1JQ4A 4BOZB 2RR9A 4GB9A 2BKRB 3MP9A 3VTUA 3WCQA 1TGZB 5TR5A 2PE6B 2WXOA 4DDID 1ZXHA 2V4LA 1UWMA 3VRBB 2DAJA 2KXJA 1QOFA 2KDIA 1DGJA 1JWBD 2VH2A 2ICIA 4ZRJA 1CZPA 1PFDA 4GU2A 2BTEA 1SE2A 3BK1A 3HVZA 2MSED 2TSSA 2WXFA 4KIKB 4F8CB 2J0MA 2JYTA 2L32A 3U30A 2ZJDA 3VHTC 2N9PC 3KYDD 1WJ6A 2W9NA 1NVID 1A5RA 1NBFC 2FIFA 3E56A 2LXCA 2VRRB 1IPGA 4OZBA 2KDMA 4CO7A 3KUCB 1CJEA 1EWCA 2BWFA 2CHZA 5IOIA 1TY0A 3MJWA 3RI7C 3NVVA 3HRDD 1IGCA 3PHXB 1P7FA 4MGKE 3OWEB 4HPMB 3TEZA 1FXAA 5AZHA 4F1SA 1RM6C 2WXLA 5BMHA 2IGDA 4N6EB 1Y56A 4M02A 4LDTB 2B3AA 2RMMA 4N9F4 5G5HA 3I63C 1EU4A 1MJDA 1VD2A 3VXWA 2IDYA 2FAZA 1MG4A 3H7SA 3UIPB 4NAWA 1UNSA 2QILA 4TQ1A 5D6JB 2FCQA 2J52A 4A3OA 2XK5A 4HK2A 2SAKA 3IFWB 3IAS1 2KJ6A 1B1ZA 3N20C 4GSWA 3ZQ4A 4HJGE 4W9LA 2E3TA 3AE3B 2KT7A 5IP4D 1XEEA 4GMVA 2K8BA 2KKCA 2C7NB 2ZW0A 2C60A 1HTOA 4ASWC 5EE9A 2YEPF 3APDA 1HZ6A 4NJ6A 4KDIC 1WR6E 1HQRD 3ZUNA 3RN9C 2RPQA 3N1XC 2RDHA 1IBXA 4C7ZA 2K1FA 2XN9C 3BIID 3ENEA 4DK5A 4XWTA 4X57B 4B6WA 2CHXA 1L6UA 2KK8A 3PO0A 3UIOB 4YTNB 4PYZA 3V3XA 1YQBA 3AB5A 2V3PA 1F9JA 1SIJA 2HD5B 2JXTA 2EELA 4C4VB 3VAWA 3B2GA 3LXFA 1KLVA 1N63A 3V6EB 4RMAA 1YD8U 2JZZA 2GLSA 2D5GA 4EUTA 2AWTA 3ETRA 3AULA 4P1BC 4MH8A 1TYGB 3H7PA 1PUTA 4WWPA 4RNAA 4ANWA 1FCCC 2J4XA 2LRWA 1ZDXA 3MFGA 2OJRA 4W9GA 1BUIC 2KZRA 2KFJA 3GOEA 2N7DA 3O13A 3AEAB 2WXKA 2QCZA 3MHSD 3V62A 2KANA 2KTRA 2KO3A 2OJWA 2AQ2B 1TY2A 4MDKE 3P4QB 4ZRIA 5GXGB 3VH3B 2XEWA 1GUAB 3TMPB 2L52A 4KGRA 2R61A 2WYQA 2AYOB 5D2MB 3KYCD 2MEKA 2OHFA 5DPRA 3A9KB 3T8MA 3P1MA 1E8YA 1WJUA 4KZ0A 5IO9A 2L3ZA 1ZDVA 2WQYB 2FCMA 3ZRCA 1V1PB 3A4RA 3HIZA 1I4XA 5AZGA 1NI3A 4HKQA 3HUIA 2MRPA 4A55A 2K0PA 1FEHA 1YMHE 4LLGM 3AECB 3B08A 2LVQA 3Q8AA 1TS4A 3PS6A 4OW0A 3NS8A 2KACA 4ZRKA 3WIMA 2WXQA 2EKIA 3NY5A 1C77A 3ZJUA 4GDLA 5HFYA 1IUEA 3P4PB 2MBEA 3WANA 4OVVA 4WJPA 1NI2A 4YXDB 2MJDA 1S1QB 3NG0A 3AEBB 4NJCA 3B0AA 4K7WA 4KVGB 1D5ZC 2KDFB 4ANUA 1QOAA 4GIVA 1FNUA 2N9EB 1WGDA 2M8SA 3A1QA 3BYTB 2J42A 2A4ZA 5G2NA 1JRUA 3BY4B 4DBGA 1ZKHA 3TBLD 4OZAA 2JT4B 2M17A 2WXHA 2Y5PA 3ZIMA 1V49A 1GAQB 4W9CA 4GOCA 3W5UB 2M56B 2KJRA 1YX5B 1R4MB 4E74A 4EE2A 2N4FA 1L4ZB 1KFYB 5BYSA 4NZLB 2MBQA 1QQRA 4WQOB 3NS1A 1E5WA 4FJYA 1L0VB 5C23A 1PGAA 2WXIA 5JZEB 2JY6A 1WE7A 4LNKA 1TKGA 1OTRB 5HG2A 1VZ6A 2X8XX 2K3UA 1BXTA 3KUZA 3UF8A 1GB4A 2LI5A 2M19A 2EMTA 1UBQA 4L1BA 3AU4A 2PW9A 1WX8A 1FNVA 1HA5A 1J8CA 5BYRA 2V9HA 1V5OA 1WZ3A 4JPSA 2NPTA 2Z59B 2O6VD 1T0YA 4K7SA 2IY1B 3AE2B 3AEGB 1WX9A 1ACCA 1KH0A 1MPEA 1DOXA 3MHZA 1SBBB 2M1MA 4YSXB 1CK1A 3PPAA 1KF6B 4GN1A 4G0NB 2WXGA 3BYYB 2DYOA 4I6PA 4K1RB 2O6VA 4NAWB 1SJED 4D2KA 4WURA 2DLBA 1JWSD 1T3QA 4US9A 4W9DA 5H92C 1I4RA 2XNAC 2KMAA 2ZPNA 2XK5B 2H89B 4FLHA 4YL8A 2LEKA 2GBJA 3QARA 1LGRA 4M01A 2BKFA 4PK1A 1XF5L 1XT9B 2WDRB 4JWUC 1T0QC 2LGIA 4P7IA 1JWAD 1U4AA 2K25A 2LXAA 3LB8C 4L2YA 5E6JA 3RNCC 3AE9B 3N9YC 3BVGA 3KWVA 3ZGZA 2N7JA 3TCAA 3AE6B 4WAFA 2NR2A 4RGNA 5C1ZA 3OAWA 3ML9A 2CHWA 4CQNA 2RD0A 5LLIA 1OQYA 1FM0D 3OJ3A 3DBLB 4BOSC 2Z0DB 5E6NA 1IBXB 3APCA 4EZKA 3RNAC 1JRPA 4HVBA 3EGRA 2KMCA 2Z0EB 4WWMA 2MCNB 2KDEB 2YLMA 1E90A 1IP9A 3M62B 1YNTE 4WWOA 1WXSA 2N7EA 5AEKB 2L0TA 1KM7A 3T9LA 1P1AA 2NS5A 2WX0A 3GZNB 1WXMA 1N5XA 2Z8LA 3CSFA 4ARIA 3AI5A 2IBIB 5AUKA 4IUMB 3KLSX 2WX1A 4EFOA 2LHEA 4ICUA 3J9CA 3N3KB 3SFDB 5E6PA 3PRZA 2BYEA 3AXCA 4IWPA 3DBRI 4C80A 1OQQA 1Q0WB 3EFCA 1LQBA 3FC4A 1L4DB 1TIFA 3BWUD 2EKEC 1T0RC 2DZMA 4JGHB 2W55A 1E8XA 4YSZB 3AV8A 3IAM1 2KMMA 5LXIB 4DQOC 1L2NA 2K39A 3Q3JA 2BS2B 1WZ0A 2KTRB 4XC2A 1K53A 2MBBB 2QIEB 1C9FA 4HEA1 4HRSA 1QZEA 3ZXVA 1SSNA 3SR6A 1I4QA 1SJHD 2CJNA 2NTTA 2LVPA 3UQAA 4IWQA 3P63A 2WWZA 4HDOA 1JROA 3ZYYX 4FBJB 2FCSA 3L0WB 3NVYA 1S3SG 2Y5CA 2CU3A 4P6VF 3A4SC 4LNOA 2UU7A 3QWZB 3EHVA 3ZW3A 1SIFA 2QC8A 3K9OB 3PHWB 4LCDE 1WYWB 4FN2A 1QKZA 4K3BA 2CKHB 4FADA 2GRIA 1WGYA 4WIPA 1MI0A 3QA8A 2BWES 3KVFB 3RMKC 1MVKA 4II3B 2K9XA 2NBWB 3DVGY 3ONSA 4LJOB 2FUHB 3JSVA 1DOYA 2PKOA 3VRAB 4P16A 3VQIA 4CYEA 2DAFA 4GDLB 2ONQA 1AW7A 3PRPB 2DYMA 2INCC 1F77A 4QAYA 4GGQA 2KWDA 4B0EA 2W3SA 5JHBA 1JMLA 3AEEB 1YX6B 2D3CA 1XLOA 3A1QB 3RCZA 3RULA 3ZDMC 2JXXA 1WF9A 2RDBC 2CR5A 4MJSA 5IAAC 3S2AA 3NZ3A 2E6XA 4ZHOA 4IW0A 4M8MA 2Y5BB 2KN4A 2GBRA 3IVFA 3PREA 2LD9A 2KWUB 1RFKA 3X0WA 1AN8A 1XCTL 1V81A 2V0GA 1XLPA
chains in the Genus database with same CATH topology
3PVLA 4MDKE 2PJHA 4KV2A 4WJQA 3H7PB 4DWFA 4ZRIA 2CU1A 5GMVA 2K6DB 3VH4B 4BKGA 3VH3B 1AARA 2XEWA 3WAPA 1IYFA 1ZW7A 2IO2B 4MGZE 3WA0A 1GUAB 1P0RA 5J18A 3TMPB 1WR1A 2KVRA 3WALA 5EDSA 4MGIE 2KDBA 2KJHB 2WYQA 1UH6A 2GOWA 2AYOB 3EECA 1X1MA 3A9JA 3VFKA 5D2MB 4IM0A 4FJVB 1EF1A 3KYCD 4NY0A 5CTRC 4A20A 4EKUA 2M4NA 2NVUI 5DPRA 3DOWA 5CHWA 2KC2A 4BVUC 3A9KB 3T8MA 3QAQA 3APFA 1E8YA 2BF8B 1WJUA 3RUIB 4DHZE 1LM8B 3PRMB 2I1JA 4KZ0A 1Q1OA 2O2VB 2NBUA 2C7MB 1D3ZA 5KHOA 1LXDA 2L3ZA 1P9DU 1TTNA 3UGBB 3ZNZB 3VTWA 2FCMA 3MTNB 2J0KA 3IHPC 3IBEA 3ZRCA 1WH3A 1BT0A 3QQ8B 3A4RA 3DCGA 3HIZA 2L00B 5CX3A 5D94A 3RYTA 2G45B 5CHFA 3QK0A 3W1SA 2V1YA 4W9EA 2MP2B 4IM3A 4G50A 5AZGA 3R7RA 2IY0B 1V6EA 1EUVB 2GBKA 2IYDB 2MRPA 4ZDVA 3DQVA 2NPTB 1VCBA 2ZCBA 4RM8A 4KSKC 2FCNA 3PLUA 2EMSA 3B08A 2LVQA 3L10B 4F7ZA 3PS6A 4J6IA 2MBOA 3NS8A 4ZRKA 3WIMA 1GNUA 3AU5A 3NY5A 4MM3A 1LFDA 4WWNA 4GDLA 1WGHA 2MW5A 3VUWA 2NCNA 3HK0A 4FJZA 1WX7A 2D07B 1Z5SB 3ECIA 4FULA 4FA6A 2KHWB 3VUXA 2MBEA 3WANA 4OVVA 4WJPA 2JRIB 3M95A 1C3TA 4MEMA 2I1KA 2ZNVB 1NI2A 4PS8A 3L13A 3JW0X 2IO1B 4DHZB 2O6VB 1V80A 1J19A 1S1QB 1EO6A 3R7QA 3B0AA 3CF6E 4K7WA 4KVGB 1SE9A 4W9IA 1WM3A 2JF5A 2KDFB 4GIVA 3B1LX 4ANUA 3TL5A 2J7QB 2N9EB 1WGDA 2M8SA 3A1QA 3PV1A 3QHTA 3ZO5B 2A4ZA 4IM2A 5G2NA 1JRUA 2L76A 3BY4B 2J0JA 4PS3A 4DBGA 1ZKHA 3TBLD 1WMHA 1WJNA 2JT4B 2PE9A 2N9XA 4FHJA 2FNJB 2KOXA 2M17A 3C0RB 3QJZA 4MH0E 2KLCA 3ZIMA 4JIOU 2KWVB 1V49A 2L8JA 3A33B 4W9CA 1V5TA 3N32A 4GOCA 2KJRA 1YX5B 3CMMB 4E74A 2JVCA 3W1SC 2N4FA 3HM6X 1UZXB 3H9DA 2MBQA 5JHAA 3QCAA 4WQOB 4G11A 3ZRFA 1I42A 1E5WA 4FJYA 5C23A 3D32A 3DDCB 1NDDA 4GXBA 3W1YA 5JZEB 3CSTA 1E8ZA 2N1WA 4E71A 2JY6A 5HKHA 3QC8B 3DVNU 1WE7A 1E7UA 4GDKB 3VUYA 1P98A 4KDLB 4LJPB 4EZLA 4URKA 1V9JA 4A3PA 1OTRB 4HJKA 4PYUA 3A9KA 3SHQA 3OLMD 3DBLI 3KUZA 3NZSA 3UF8A 4DHJB 2O2VA 4IG7B 4NNJB 4MSMB 2LI5A 1J0GA 2EMTA 4ZYNA 3ZDTA 2LGYA 1UBQA 3TIXA 4PS7A 3AU4A 3RZFA 1RFAA 1TBEA 1WX8A 1OGWA 2LRUA 3ZKJC 1J8CA 2MP2A 1R4NI 2OOBB 4FHKA 4IWOA 1V5OA 1WZ3A 3L08A 1FXTB 3WAMA 2NPTA 1GJZA 3ZNGC 2DZJA 3L17A 3DPDA 2Z59B 4K7UA 3GZNI 2O6VD 4ANVA 4W9JA 1T0YA 4K7SA 4ANXA 2IY1B 2JZ3B 2LGDA 3R3MA 2FIDA 4DXAB 2MBHA 1Q5WB 2V3SA 4BFRA 1WX9A 2QHOA 3H6NA 3KUDB 5J17A 2JPHA 1C1YB 2MLBA 2GMIC 2KTFA 2KD0A 3L54A 1Z2MA 4NQLB 2ZEQA 3N30A 5L83A 2M1MA 3SDLC 2LUEA 3PPAA 4GN1A 4G0NB 4XX5A 4M0WB 1OEYA 1YIWA 4I6LB 4MELA 3HM3A 2LGXA 3ZTCA 5JH5C 2HTHA 2K6QA 5CHVC 2DYOA 2UWQA 1E8WA 4I6PA 4K1RB 5D7GA 2C9WB 4HPLB 2O6VA 5G55A 4IC7B 4NAWB 5KHQA 2D10A 5DPWA 3SU8X 2L05A 3DVGX 2G4SA 2KFKB 1YJ1A 3ZNHB 2KC1A 1RLFA 1WXVA 4W9DA 5DPTA 3JVZX 2KMAA 3EFUA 3KW5B 2ZPNA 1G6JA 2XK5B 4FLHA 1XQQA 4TQ0A 1P3QU 4YL8A 3X23A 2ZCCA 1WFYA 2GBJA 3IG3A 3PTFC 3P2BA 3HHMA 2HE7A 3QARA 4WAAA 2KLGA 3TJPA 3V61A 4HDQA 2BKFA 1RAXA 2KWCA 5AZFA 2PEAA 2KN5A 1EF5A 2JWZA 1XT9B 3L16A 4BOZB 2RR9A 4GB9A 2BKRB 2M0XA 4P7IA 3VTUA 1TGZB 5TR5A 2PE6B 3NHEB 2KQSA 1M94A 1H4RA 1U4AA 2K25A 3LJ3A 5BO4B 2LXAA 3RZWC 1KOTA 3PT2B 4DDID 4DHJD 2V4LA 2R2OA 1CMXB 3ZVVA 1WI0A 3TCAA 4MGYE 2YVCA 2ASQA 2DAJA 2KXJA 4AJYB 2NR2A 2LWPA 2KDIA 3DBSA 5C1ZA 1UGMA 4MSQB 4ZRJA 3OAWA 3ZLZA 3K9PB 5FR6A 3ML9A 4GU2A 4JLCA 1L7YA 3SD5A 3Q3FA 4XZ4A 4B95A 3BINA 1WGRA 2CHWA 4GDKA 2RD0A 2AL3A 1I35A 2MSED 3PLVA 5LLIA 1OQYA 3OJ3A 2HJ8A 4KIKB 4OVUA 1K8RB 3LDZE 4F8CB 4BOSC 2Z0DB 2J0MA 3U30A 5E6NA 2R2QA 1KJTA 3APCA 1Y8RC 2DHZA 4EZKA 2BGFA 3JSVB 2BPSA 2ZJDA 3VHTC 4G3XB 4HVBA 2KMCA 2Z0EB 3PSEB 2N9PC 3KYDD 1WJ6A 2KDEB 2W9NA 2YLMA 2MCNB 4AP4C 1E90A 4HLEA 3DBHI 1IP9A 3M62B 2XBBC 2G3QB 1A5RA 1NBFC 1WXSA 4WWOA 2KX3A 2N7EA 5AEKB 4EOYA 2FIFA 2L0TA 1UBIA 1H8CA 1KM7A 2LXCA 2VRRB 2RSUA 3T9LA 4AJWA 1P1AA 1TZ1A 2NS5A 1IPGA 2REXA 5L95C 2DX5B 2WX0A 4CO7A 1UELA 1WXMA 3KUCB 2IZVB 3VTVA 4M8NA 3CSFA 2BWFA 2CS4A 2CHZA 3AI5A 1V2YA 2IBIB 2UYZB 3MJWA 2DENB 2GBNA 4IUMB 4TUUA 2LVOA 2WX1A 1OEYJ 4EFOA 4ICUA 3PHXB 3N3KB 3UINB 5E6PA 3PRZA 4MGKE 2BYEA 3QIJA 3AXCA 4IWPA 4HPMB 5J2RA 3DBRI 2KNBA 1WXAA 5AZHA 2JRHA 1Q0WB 4F1SA 3OJ4B 4AOFA 2D11A 3PGEA 1UD7A 3RD2A 1LQBA 4LDTB 2B3AA 1MG8A 2EKEC 3M63B 4N9F4 2DZMA 3ZNID 1VD2A 4JGHB 3VXWA 2D2QA 1GC6A 2FAZA 1E8XA 3VVWB 1E7VA 5E6OA 2BYFA 3H7SA 3UIPB 4NAWA 5LXIB 4TQ1A 1L2NA 3WAOA 2K39A 3Q3JA 2MQJA 2DZKA 2NBVB 1V86A 1WY8A 1WZ0A 2KTRB 4XC2A 2KFKA 1WGGA 4RM9A 2MBBB 4TKNA 5D6JB 3NOBA 4WJOA 2AEHA 3V60A 2FCQA 4DDGD 4A3OA 1QZEA 2C7HA 2JUOA 2XK5A 4HK2A 3DVNV 3IFWB 2KQ7A 1ZGUB 2KJ6A 2LVPA 3UQAA 4BBNF 4IWQA 5IA7A 1WRDB 3I3TB 2WWZA 4GSWA 4HDOA 4KSLC 4FBJB 2FCSA 3A9JB 3L0WB 4W9LA 2LJ5A 1S3SG 2K8CA 2IO0B 3H1UA 3A4SC 3QWZB 3RT3B 3EHVA 4GMVA 2PPHA 2DYBA 4W9FA 2K8BA 2KKCA 1SIFA 4HCPB 3ZW3A 4HWIB 2C7NB 3K9OB 3PHWB 4LCDE 1WYWB 4FN2A 5DPSA 4JQWC 2C60A 2IO3B 4II2B 2CKHB 5DCNA 4ASWC 4FADA 1WGYA 2DZIA 3ML8A 2LASA 3APDA 3QX1A 5LXHA 3QA8A 2BWES 1WR6E 4HXDA 4KDIC 4NJ6A 3KVFB 1GG3A 3ZUNA 3EC8A 4KIKA 1WIAA 1RRBA 2KX0A 2RPQA 4II3B 2NBWB 4I6NB 1GC7A 3DVGY 3ONSA 4LJOB 4W9KA 2FUHB 2K1FA 3JSVA 1WE6A 3ENEA 1WJ4A 4DK5A 2D3GA 4X57B 4B6WA 2CHXA 2KK8A 2GBMA 3UIOB 2ZVOA 3VQIA 4PYZA 4BKTA 1YQBA 4CYEA 4WJNA 2DAFA 2LZ6A 4GDLB 2C5LC 2L7RA 2MA9B 2MWSB 2ZPYA 3O65B 4LDTD 3PRPB 4HCNB 3U8ZA 4BKSD 1F9JA 2HD5B 2DYMA 1HE8A 4K81A 4B9KA 2MX2A 3VAWA 3NZUA 4NQKE 2ZNVC 3M3JA 4GGQA 2N1VA 1KLVA 3UQBA 3V6EB 4RMAA 1YD8U 4ICVA 3ZTDA 5JHBA 2ZZPB 2JZZA 2K8HA 2RGFA 2WDTB 3KH0A 1YX6B 1PQSA 4AWJA 4EEWA 3A1QB 3ALBA 3RCZA 2L0FA 2AL6A 2JXXA 3RULA 3ZDMC 4AUQC 2AWTA 1WF9A 4EUTA 2CR5A 4MJSA 1ISNA 4NJ7A 3AULA 5IAAC 3S2AA 3R66C 4IW0A 1WMHB 3PZDA 3H7PA 1XD3B 4M8MA 4E3CA 4WWPA 2A5UA 3VDZA 4BKSA 4ANWA 1SGHA 2Y5BB 3U7DA 4CHKA 2LRWA 2GBRA 3V6CB 3IVFA 3PREA 2ZVNA 2LD9A 2KWUB 2OJRA 4W9HA 4W9GA 1WM2A 2KZRA 2KFJA 3GOEA 4KZCA 3X0WA 2N7DA 3JYUA 2G4DB 3MHSD 4JL9A 1R4MI 1V81A 2KTRA 2KANA 2KO3A 3V62A 4MJSB 4TV3A 4NPNA 4EZJA 4BBNC 2BYVE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVL A;  4MDK E;  2PJH A;  4KV2 A;  4WJQ A;  3H7P B;  4DWF A;  4ZRI A;  2CU1 A;  5GMV A;  2K6D B;  3VH4 B;  4BKG A;  3VH3 B;  1AAR A;  2XEW A;  3WAP A;  1IYF A;  1ZW7 A;  2IO2 B;  4MGZ E;  3WA0 A;  1GUA B;  1P0R A;  5J18 A;  3TMP B;  1WR1 A;  2KVR A;  3WAL A;  5EDS A;  4MGI E;  2KDB A;  2KJH B;  2WYQ A;  1UH6 A;  2GOW A;  2AYO B;  3EEC A;  1X1M A;  3A9J A;  3VFK A;  5D2M B;  4IM0 A;  4FJV B;  1EF1 A;  3KYC D;  4NY0 A;  5CTR C;  4A20 A;  4EKU A;  2M4N A;  2NVU I;  5DPR A;  3DOW A;  5CHW A;  2KC2 A;  4BVU C;  3A9K B;  3T8M A;  3QAQ A;  3APF A;  1E8Y A;  2BF8 B;  1WJU A;  3RUI B;  4DHZ E;  1LM8 B;  3PRM B;  2I1J A;  4KZ0 A;  1Q1O A;  2O2V B;  2NBU A;  2C7M B;  1D3Z A;  5KHO A;  1LXD A;  2L3Z A;  1P9D U;  1TTN A;  3UGB B;  3ZNZ B;  3VTW A;  2FCM A;  3MTN B;  2J0K A;  3IHP C;  3IBE A;  3ZRC A;  1WH3 A;  1BT0 A;  3QQ8 B;  3A4R A;  3DCG A;  3HIZ A;  2L00 B;  5CX3 A;  5D94 A;  3RYT A;  2G45 B;  5CHF A;  3QK0 A;  3W1S A;  2V1Y A;  4W9E A;  2MP2 B;  4IM3 A;  4G50 A;  5AZG A;  3R7R A;  2IY0 B;  1V6E A;  1EUV B;  2GBK A;  2IYD B;  2MRP A;  4ZDV A;  3DQV A;  2NPT B;  1VCB A;  2ZCB A;  4RM8 A;  4KSK C;  2FCN A;  3PLU A;  2EMS A;  3B08 A;  2LVQ A;  3L10 B;  4F7Z A;  3PS6 A;  4J6I A;  2MBO A;  3NS8 A;  4ZRK A;  3WIM A;  1GNU A;  3AU5 A;  3NY5 A;  4MM3 A;  1LFD A;  4WWN A;  4GDL A;  1WGH A;  2MW5 A;  3VUW A;  2NCN A;  3HK0 A;  4FJZ A;  1WX7 A;  2D07 B;  1Z5S B;  3ECI A;  4FUL A;  4FA6 A;  2KHW B;  3VUX A;  2MBE A;  3WAN A;  4OVV A;  4WJP A;  2JRI B;  3M95 A;  1C3T A;  4MEM A;  2I1K A;  2ZNV B;  1NI2 A;  4PS8 A;  3L13 A;  3JW0 X;  2IO1 B;  4DHZ B;  2O6V B;  1V80 A;  1J19 A;  1S1Q B;  1EO6 A;  3R7Q A;  3B0A A;  3CF6 E;  4K7W A;  4KVG B;  1SE9 A;  4W9I A;  1WM3 A;  2JF5 A;  2KDF B;  4GIV A;  3B1L X;  4ANU A;  3TL5 A;  2J7Q B;  2N9E B;  1WGD A;  2M8S A;  3A1Q A;  3PV1 A;  3QHT A;  3ZO5 B;  2A4Z A;  4IM2 A;  5G2N A;  1JRU A;  2L76 A;  3BY4 B;  2J0J A;  4PS3 A;  4DBG A;  1ZKH A;  3TBL D;  1WMH A;  1WJN A;  2JT4 B;  2PE9 A;  2N9X A;  4FHJ A;  2FNJ B;  2KOX A;  2M17 A;  3C0R B;  3QJZ A;  4MH0 E;  2KLC A;  3ZIM A;  4JIO U;  2KWV B;  1V49 A;  2L8J A;  3A33 B;  4W9C A;  1V5T A;  3N32 A;  4GOC A;  2KJR A;  1YX5 B;  3CMM B;  4E74 A;  2JVC A;  3W1S C;  2N4F A;  3HM6 X;  1UZX B;  3H9D A;  2MBQ A;  5JHA A;  3QCA A;  4WQO B;  4G11 A;  3ZRF A;  1I42 A;  1E5W A;  4FJY A;  5C23 A;  3D32 A;  3DDC B;  1NDD A;  4GXB A;  3W1Y A;  5JZE B;  3CST A;  1E8Z A;  2N1W A;  4E71 A;  2JY6 A;  5HKH A;  3QC8 B;  3DVN U;  1WE7 A;  1E7U A;  4GDK B;  3VUY A;  1P98 A;  4KDL B;  4LJP B;  4EZL A;  4URK A;  1V9J A;  4A3P A;  1OTR B;  4HJK A;  4PYU A;  3A9K A;  3SHQ A;  3OLM D;  3DBL I;  3KUZ A;  3NZS A;  3UF8 A;  4DHJ B;  2O2V A;  4IG7 B;  4NNJ B;  4MSM B;  2LI5 A;  1J0G A;  2EMT A;  4ZYN A;  3ZDT A;  2LGY A;  1UBQ A;  3TIX A;  4PS7 A;  3AU4 A;  3RZF A;  1RFA A;  1TBE A;  1WX8 A;  1OGW A;  2LRU A;  3ZKJ C;  1J8C A;  2MP2 A;  1R4N I;  2OOB B;  4FHK A;  4IWO A;  1V5O A;  1WZ3 A;  3L08 A;  1FXT B;  3WAM A;  2NPT A;  1GJZ A;  3ZNG C;  2DZJ A;  3L17 A;  3DPD A;  2Z59 B;  4K7U A;  3GZN I;  2O6V D;  4ANV A;  4W9J A;  1T0Y A;  4K7S A;  4ANX A;  2IY1 B;  2JZ3 B;  2LGD A;  3R3M A;  2FID A;  4DXA B;  2MBH A;  1Q5W B;  2V3S A;  4BFR A;  1WX9 A;  2QHO A;  3H6N A;  3KUD B;  5J17 A;  2JPH A;  1C1Y B;  2MLB A;  2GMI C;  2KTF A;  2KD0 A;  3L54 A;  1Z2M A;  4NQL B;  2ZEQ A;  3N30 A;  5L83 A;  2M1M A;  3SDL C;  2LUE A;  3PPA A;  4GN1 A;  4G0N B;  4XX5 A;  4M0W B;  1OEY A;  1YIW A;  4I6L B;  4MEL A;  3HM3 A;  2LGX A;  3ZTC A;  5JH5 C;  2HTH A;  2K6Q A;  5CHV C;  2DYO A;  2UWQ A;  1E8W A;  4I6P A;  4K1R B;  5D7G A;  2C9W B;  4HPL B;  2O6V A;  5G55 A;  4IC7 B;  4NAW B;  5KHQ A;  2D10 A;  5DPW A;  3SU8 X;  2L05 A;  3DVG X;  2G4S A;  2KFK B;  1YJ1 A;  3ZNH B;  2KC1 A;  1RLF A;  1WXV A;  4W9D A;  5DPT A;  3JVZ X;  2KMA A;  3EFU A;  3KW5 B;  2ZPN A;  1G6J A;  2XK5 B;  4FLH A;  1XQQ A;  4TQ0 A;  1P3Q U;  4YL8 A;  3X23 A;  2ZCC A;  1WFY A;  2GBJ A;  3IG3 A;  3PTF C;  3P2B A;  3HHM A;  2HE7 A;  3QAR A;  4WAA A;  2KLG A;  3TJP A;  3V61 A;  4HDQ A;  2BKF A;  1RAX A;  2KWC A;  5AZF A;  2PEA A;  2KN5 A;  1EF5 A;  2JWZ A;  1XT9 B;  3L16 A;  4BOZ B;  2RR9 A;  4GB9 A;  2BKR B;  2M0X A;  4P7I A;  3VTU A;  1TGZ B;  5TR5 A;  2PE6 B;  3NHE B;  2KQS A;  1M94 A;  1H4R A;  1U4A A;  2K25 A;  3LJ3 A;  5BO4 B;  2LXA A;  3RZW C;  1KOT A;  3PT2 B;  4DDI D;  4DHJ D;  2V4L A;  2R2O A;  1CMX B;  3ZVV A;  1WI0 A;  3TCA A;  4MGY E;  2YVC A;  2ASQ A;  2DAJ A;  2KXJ A;  4AJY B;  2NR2 A;  2LWP A;  2KDI A;  3DBS A;  5C1Z A;  1UGM A;  4MSQ B;  4ZRJ A;  3OAW A;  3ZLZ A;  3K9P B;  5FR6 A;  3ML9 A;  4GU2 A;  4JLC A;  1L7Y A;  3SD5 A;  3Q3F A;  4XZ4 A;  4B95 A;  3BIN A;  1WGR A;  2CHW A;  4GDK A;  2RD0 A;  2AL3 A;  1I35 A;  2MSE D;  3PLV A;  5LLI A;  1OQY A;  3OJ3 A;  2HJ8 A;  4KIK B;  4OVU A;  1K8R B;  3LDZ E;  4F8C B;  4BOS C;  2Z0D B;  2J0M A;  3U30 A;  5E6N A;  2R2Q A;  1KJT A;  3APC A;  1Y8R C;  2DHZ A;  4EZK A;  2BGF A;  3JSV B;  2BPS A;  2ZJD A;  3VHT C;  4G3X B;  4HVB A;  2KMC A;  2Z0E B;  3PSE B;  2N9P C;  3KYD D;  1WJ6 A;  2KDE B;  2W9N A;  2YLM A;  2MCN B;  4AP4 C;  1E90 A;  4HLE A;  3DBH I;  1IP9 A;  3M62 B;  2XBB C;  2G3Q B;  1A5R A;  1NBF C;  1WXS A;  4WWO A;  2KX3 A;  2N7E A;  5AEK B;  4EOY A;  2FIF A;  2L0T A;  1UBI A;  1H8C A;  1KM7 A;  2LXC A;  2VRR B;  2RSU A;  3T9L A;  4AJW A;  1P1A A;  1TZ1 A;  2NS5 A;  1IPG A;  2REX A;  5L95 C;  2DX5 B;  2WX0 A;  4CO7 A;  1UEL A;  1WXM A;  3KUC B;  2IZV B;  3VTV A;  4M8N A;  3CSF A;  2BWF A;  2CS4 A;  2CHZ A;  3AI5 A;  1V2Y A;  2IBI B;  2UYZ B;  3MJW A;  2DEN B;  2GBN A;  4IUM B;  4TUU A;  2LVO A;  2WX1 A;  1OEY J;  4EFO A;  4ICU A;  3PHX B;  3N3K B;  3UIN B;  5E6P A;  3PRZ A;  4MGK E;  2BYE A;  3QIJ A;  3AXC A;  4IWP A;  4HPM B;  5J2R A;  3DBR I;  2KNB A;  1WXA A;  5AZH A;  2JRH A;  1Q0W B;  4F1S A;  3OJ4 B;  4AOF A;  2D11 A;  3PGE A;  1UD7 A;  3RD2 A;  1LQB A;  4LDT B;  2B3A A;  1MG8 A;  2EKE C;  3M63 B;  4N9F 4;  2DZM A;  3ZNI D;  1VD2 A;  4JGH B;  3VXW A;  2D2Q A;  1GC6 A;  2FAZ A;  1E8X A;  3VVW B;  1E7V A;  5E6O A;  2BYF A;  3H7S A;  3UIP B;  4NAW A;  5LXI B;  4TQ1 A;  1L2N A;  3WAO A;  2K39 A;  3Q3J A;  2MQJ A;  2DZK A;  2NBV B;  1V86 A;  1WY8 A;  1WZ0 A;  2KTR B;  4XC2 A;  2KFK A;  1WGG A;  4RM9 A;  2MBB B;  4TKN A;  5D6J B;  3NOB A;  4WJO A;  2AEH A;  3V60 A;  2FCQ A;  4DDG D;  4A3O A;  1QZE A;  2C7H A;  2JUO A;  2XK5 A;  4HK2 A;  3DVN V;  3IFW B;  2KQ7 A;  1ZGU B;  2KJ6 A;  2LVP A;  3UQA A;  4BBN F;  4IWQ A;  5IA7 A;  1WRD B;  3I3T B;  2WWZ A;  4GSW A;  4HDO A;  4KSL C;  4FBJ B;  2FCS A;  3A9J B;  3L0W B;  4W9L A;  2LJ5 A;  1S3S G;  2K8C A;  2IO0 B;  3H1U A;  3A4S C;  3QWZ B;  3RT3 B;  3EHV A;  4GMV A;  2PPH A;  2DYB A;  4W9F A;  2K8B A;  2KKC A;  1SIF A;  4HCP B;  3ZW3 A;  4HWI B;  2C7N B;  3K9O B;  3PHW B;  4LCD E;  1WYW B;  4FN2 A;  5DPS A;  4JQW C;  2C60 A;  2IO3 B;  4II2 B;  2CKH B;  5DCN A;  4ASW C;  4FAD A;  1WGY A;  2DZI A;  3ML8 A;  2LAS A;  3APD A;  3QX1 A;  5LXH A;  3QA8 A;  2BWE S;  1WR6 E;  4HXD A;  4KDI C;  4NJ6 A;  3KVF B;  1GG3 A;  3ZUN A;  3EC8 A;  4KIK A;  1WIA A;  1RRB A;  2KX0 A;  2RPQ A;  4II3 B;  2NBW B;  4I6N B;  1GC7 A;  3DVG Y;  3ONS A;  4LJO B;  4W9K A;  2FUH B;  2K1F A;  3JSV A;  1WE6 A;  3ENE A;  1WJ4 A;  4DK5 A;  2D3G A;  4X57 B;  4B6W A;  2CHX A;  2KK8 A;  2GBM A;  3UIO B;  2ZVO A;  3VQI A;  4PYZ A;  4BKT A;  1YQB A;  4CYE A;  4WJN A;  2DAF A;  2LZ6 A;  4GDL B;  2C5L C;  2L7R A;  2MA9 B;  2MWS B;  2ZPY A;  3O65 B;  4LDT D;  3PRP B;  4HCN B;  3U8Z A;  4BKS D;  1F9J A;  2HD5 B;  2DYM A;  1HE8 A;  4K81 A;  4B9K A;  2MX2 A;  3VAW A;  3NZU A;  4NQK E;  2ZNV C;  3M3J A;  4GGQ A;  2N1V A;  1KLV A;  3UQB A;  3V6E B;  4RMA A;  1YD8 U;  4ICV A;  3ZTD A;  5JHB A;  2ZZP B;  2JZZ A;  2K8H A;  2RGF A;  2WDT B;  3KH0 A;  1YX6 B;  1PQS A;  4AWJ A;  4EEW A;  3A1Q B;  3ALB A;  3RCZ A;  2L0F A;  2AL6 A;  2JXX A;  3RUL A;  3ZDM C;  4AUQ C;  2AWT A;  1WF9 A;  4EUT A;  2CR5 A;  4MJS A;  1ISN A;  4NJ7 A;  3AUL A;  5IAA C;  3S2A A;  3R66 C;  4IW0 A;  1WMH B;  3PZD A;  3H7P A;  1XD3 B;  4M8M A;  4E3C A;  4WWP A;  2A5U A;  3VDZ A;  4BKS A;  4ANW A;  1SGH A;  2Y5B B;  3U7D A;  4CHK A;  2LRW A;  2GBR A;  3V6C B;  3IVF A;  3PRE A;  2ZVN A;  2LD9 A;  2KWU B;  2OJR A;  4W9H A;  4W9G A;  1WM2 A;  2KZR A;  2KFJ A;  3GOE A;  4KZC A;  3X0W A;  2N7D A;  3JYU A;  2G4D B;  3MHS D;  4JL9 A;  1R4M I;  1V81 A;  2KTR A;  2KAN A;  2KO3 A;  3V62 A;  4MJS B;  4TV3 A;  4NPN A;  4EZJ A;  4BBN C;  2BYV E; 
#chains in the Genus database with same CATH topology
 5FK9 C;  2CU1 A;  4M00 A;  1ZW7 A;  2BB5 A;  5J18 A;  1WR1 A;  4XDD A;  2KDB A;  3I5J C;  2KJH B;  1LO5 D;  1UH6 A;  1I4H A;  2KAJ A;  3VFK A;  4IM0 A;  4FJV B;  1EF1 A;  4A20 A;  3NUH B;  4C7Y A;  5CHW A;  2KC2 A;  3RUI B;  4DHZ E;  1LM8 B;  2I1J A;  3GE8 C;  1Q1O A;  2C7M B;  5KHO A;  1LXD A;  3MTN B;  1BT0 A;  1AYF A;  5CX3 A;  4HRO A;  5EE3 A;  3QK0 A;  2V1Y A;  2FBW B;  1V6E A;  2GBK A;  3LYY A;  4ZDV A;  2NPT B;  1VCB A;  1TZO A;  2ZCB A;  4P1C C;  4BZA A;  2IJ0 A;  4KSK C;  2WDQ B;  3PLU A;  4ZRQ A;  1VDV A;  1KTK A;  1F2R C;  1GNU A;  4ZRP A;  3AU5 A;  3GS2 A;  1FRD A;  3AEF B;  1K51 A;  4MM3 A;  1LFD A;  2MW5 A;  1WX7 A;  2D07 B;  4FUL A;  2KHW B;  3EUB 2;  3N1Z C;  1C3T A;  3ZXR A;  4BAX A;  2WP9 B;  3L13 A;  2LHD A;  2O6V B;  1V80 A;  1TKY A;  1EO6 A;  2BQQ A;  1WM3 A;  3PV1 A;  1ROE A;  1J7A A;  3ZO5 B;  2J0J A;  1TS3 A;  1STE A;  2KOX A;  3Q8C A;  1FMA D;  1GB1 A;  2L8J A;  1CQV A;  1V5T A;  2BS3 B;  2M0A A;  4OZC A;  3HM6 X;  5EE0 A;  3H9D A;  1OQR A;  3W9C B;  5T8I A;  1I42 A;  3FIL A;  2JQR B;  3P4R B;  1QOG A;  3W1Y A;  2QJL A;  4C56 C;  3CST A;  4A9A A;  4E71 A;  5JXV A;  3QC8 B;  2N0S B;  1N61 A;  3VR9 B;  2BBC A;  3C19 A;  4PYU A;  2BB6 A;  1JAL A;  2QDF A;  4NNJ B;  1J0G A;  3U4E G;  2WXR A;  3AE8 B;  3ZDT A;  1EU3 A;  1OGW A;  4AQ7 A;  1YQ4 B;  1JWM D;  1E9M A;  4IWO A;  4DXF A;  1JWU D;  3DHH C;  3L17 A;  4K7U A;  4ANV A;  3FKY A;  1V8C A;  1F1H A;  1ENF A;  2WNM A;  3W2D A;  2JZ3 B;  3R3M A;  1C4C A;  2FID A;  3Q8B A;  1YQ3 B;  2GI9 A;  2MBH A;  5J17 A;  1C1Y B;  2PVG C;  4HKZ E;  2MHJ A;  1GPX A;  1Z2M A;  4NQL B;  2ZEQ A;  3RNB C;  4RF0 A;  5IN7 A;  1OEY A;  3ZTC A;  1I7H A;  2OED A;  5CHV C;  2UWQ A;  5D7G A;  1KLU D;  4HPL B;  2IGG A;  4ARC A;  2D10 A;  2AQ1 B;  3SU8 X;  2G4S A;  4KKJ A;  1YJ1 A;  3Q2A C;  2KC1 A;  4ITK A;  3KW5 B;  1G6J A;  2HJ1 A;  4TQ0 A;  3DWG C;  2ZCC A;  3IG3 A;  3P2B A;  2KLG A;  1RAX A;  2KWC A;  3B2F A;  1PDX A;  1EF5 A;  2JWZ A;  3L16 A;  1NEK B;  3OG5 A;  3P4S B;  2KQS A;  1M94 A;  1H4R A;  3LJ3 A;  1I4G A;  3MJ5 A;  4H2A A;  1KOT A;  3AMZ A;  3AE5 B;  4KGT A;  4DHJ D;  2R2O A;  4MT5 A;  1XLN A;  4MGY E;  3SFE B;  2ASQ A;  2RPV A;  5FR3 A;  1UGM A;  4MSQ B;  3ZLZ A;  5FR6 A;  4B95 A;  3BIN A;  2AL3 A;  1I35 A;  3PLV A;  1C79 A;  2HJ8 A;  4OVU A;  2I2Y A;  1K8R B;  4J3O D;  2R2Q A;  1KJT A;  1Y8R C;  2DHZ A;  2BGF A;  3JSV B;  4A90 A;  4AP4 C;  4HLE A;  3DBH I;  2G3Q B;  3TUO A;  3N1Y C;  3E9S A;  1UBI A;  1H8C A;  3RNF C;  4AJW A;  2RSU A;  2VZK D;  2REX A;  5L95 C;  5BYQ A;  2DX5 B;  2Y3A A;  1UEL A;  3VTV A;  4M8N A;  1SF0 A;  1TKE A;  1V2Y A;  2UYZ B;  4JE3 B;  2DEN B;  4NAM A;  4TUU A;  1YJI A;  1VLB A;  1OEY J;  4DXG A;  3UIN B;  2ZW1 A;  4O1N A;  4AOF A;  1HEZ E;  3ZNI D;  1GC6 A;  1E7V A;  2WHI A;  2NBV B;  1V86 A;  2KFK A;  1WGG A;  3NOB A;  5MPO A;  1YJJ A;  1KLG D;  2AEH A;  3V60 A;  2C7H A;  2JUO A;  2VH1 A;  5HI1 A;  4PT5 A;  5IKC M;  1XO3 A;  2KQ7 A;  1SE3 A;  5IA7 A;  1WRD B;  1XLQ A;  4KSL C;  2CJO A;  3R8B A;  3GE3 C;  2K8C A;  3H1U A;  2PMV A;  4OHJ A;  3RT3 B;  3AE7 B;  1I4P A;  1RWS A;  1EWY C;  4YTP B;  4II2 B;  4JWS C;  5DCN A;  3ML8 A;  2DZI A;  2LAS A;  1C76 A;  3QX1 A;  4USA A;  3EC8 A;  1WIA A;  2KX0 A;  3AED B;  3GB1 A;  4I6N B;  1FFU A;  1GC7 A;  2IND C;  1WJ4 A;  2WDV B;  2G9H D;  4IOI E;  4MM3 B;  4R3D A;  4WJN A;  2LZ6 A;  2L7R A;  2ZPY A;  3U8Z A;  4HCN B;  4BKS D;  2J53 A;  1HE8 A;  4K81 A;  2MX2 A;  2MJ3 A;  3PZ8 A;  3NZU A;  4NQK E;  3M3J A;  5FKA C;  2N1V A;  3UQB A;  3ZTD A;  4WH4 A;  2X38 A;  2K8H A;  3U2S C;  1PGB A;  3KH0 A;  1PQS A;  1VR9 A;  2LFI A;  1WYG A;  3R66 C;  3GP7 A;  1D6E C;  4TMA B;  4E3C A;  4BKS A;  1SGH A;  2V4I B;  3U7D A;  1F52 A;  2ZVN A;  2JYE A;  4W9H A;  1WM2 A;  3JYU A;  2G4D B;  4JL9 A;  4OVZ A;  2K5P A;  1R4M I;  2MJE A;  4NPN A;  4BBN C;  1FRR A;  4S0R A;  3PVL A;  2PJH A;  1V1O A;  4KV2 A;  3H7P B;  4WJQ A;  4DWF A;  2K6D B;  3VH4 B;  4B0M A;  3FIL B;  1AAR A;  1IYF A;  4MGZ E;  3WA0 A;  1HTQ A;  2KVR A;  5EDS A;  2WGS A;  1EM7 A;  2GOW A;  3EEC A;  1X1M A;  3A9J A;  1WRI A;  2K22 A;  4NY0 A;  5CTR C;  2NVU I;  3DOW A;  3MC9 A;  1D3Z A;  1P9D U;  3ZNZ B;  2KVZ A;  2J0K A;  3IHP C;  3T3N A;  3IBE A;  3QQ8 B;  2L00 B;  4FXC A;  3RYT A;  2G45 B;  3W1S A;  4XYC A;  1FCL A;  4G50 A;  2IY0 B;  1EUV B;  2IYD B;  2NMQ A;  4RM8 A;  2AX5 A;  2FCN A;  3RNG C;  4LNI A;  1MFW A;  4F7Z A;  2MBO A;  1HXY D;  1L0Y B;  3BK2 A;  4WWN A;  1WGH A;  2NCN A;  3ZJT A;  1SXT A;  1D5M C;  1Z5S B;  4LNF A;  3ECI A;  4FA6 A;  2JRI B;  3M95 A;  5D3I B;  4MEM A;  5H8Y E;  2ZNV B;  3NRZ A;  1L5P A;  2IO1 B;  5LNK 1;  5EE1 A;  1L0X B;  2PIA A;  3R7Q A;  4LNN A;  3AM9 A;  4W9I A;  2JF5 A;  2H88 B;  4IM2 A;  2L76 A;  4C00 A;  3R2T A;  1WMH A;  2Q5W D;  2QSD A;  2FNJ B;  3C0R B;  4LTU A;  4MH0 E;  3Q3O C;  2KWV B;  3TEW A;  1XXG A;  2PLP A;  3CMM B;  2WU5 B;  4RGM A;  3W1S C;  1QOB A;  1UZX B;  5C3J B;  5JHA A;  2JX5 A;  1SB3 C;  1ZOY B;  1XCQ L;  4ZHP A;  3AH7 A;  4N59 A;  3D32 A;  1NYR A;  1FFV A;  2N1W A;  5G5G A;  5HKH A;  2HTM E;  3NVZ A;  1P98 A;  4KDL B;  1V9J A;  4HJK A;  4YSY B;  1WWT A;  2YEP B;  3DBL I;  4DHJ B;  2O2V A;  2SEB D;  4IG7 B;  3PZ7 A;  4MSM B;  1FNW A;  4ZYN A;  3W5V B;  2LGY A;  4PS7 A;  1JCK B;  1RFA A;  1TBE A;  1YN5 A;  5TSS A;  1ET9 A;  2LRU A;  2MP2 A;  1R4N I;  2OOB B;  2W82 A;  2MH7 A;  2NTS A;  3L08 A;  2INN E;  2DZJ A;  5D3D A;  3GZN I;  4YT0 B;  4W9J A;  1D4B A;  1L6V A;  2V3S A;  3H6N A;  2FUG 1;  2JPH A;  1ZUD 2;  4RGO S;  2KTF A;  2KD0 A;  3L54 A;  3N30 A;  5L83 A;  3SDL C;  2VZK B;  3H8H A;  1E0Z A;  1F0Z A;  1T5X D;  4XX5 A;  1YIW A;  4I6L B;  4MEL A;  5JH5 C;  3HM3 A;  2LGX A;  5G55 A;  4HPP A;  4IC7 B;  1PGX A;  3BVM A;  1MHX A;  2L05 A;  3DVG X;  2KFK B;  3ZNH B;  1RLF A;  1WXV A;  3JVZ X;  3EFU A;  4GLS C;  1XQQ A;  1P3Q U;  3X23 A;  1WFY A;  1C4P A;  3PTF C;  2HE7 A;  3TJP A;  4HDQ A;  3Q8E A;  2KN5 A;  1QIL A;  1A70 A;  2M0X A;  3IT6 B;  2GB1 A;  3NHE B;  5BO4 B;  3RZW C;  5BMI A;  3PT2 B;  1CMX B;  3Q3N C;  3ZVV A;  1N62 A;  1WI0 A;  3DBH B;  2YVC A;  1J7C A;  3AE4 B;  4AJY B;  2LWP A;  3DBS A;  2L83 A;  3K9P B;  3ZJV A;  4JLC A;  1L7Y A;  3SD5 A;  3Q3F A;  4XZ4 A;  4K3C A;  1WGR A;  4GDK A;  1FO4 A;  3LDZ E;  2INP E;  2BPS A;  4G3X B;  3PSE B;  1SE4 A;  1TJE A;  2XBB C;  2KX3 A;  2BS4 B;  4EOY A;  2WU2 B;  4AS1 A;  2G1E A;  1TZ1 A;  3URY A;  2IZV B;  2CS4 A;  3P42 A;  2GBN A;  2WXP A;  3KQ4 A;  2LVO A;  3MC8 A;  2BYT A;  3QIJ A;  1N6Z A;  2JWU A;  5J2R A;  3V05 A;  2KNB A;  1WXA A;  2JRH A;  3OJ4 B;  2D11 A;  3PGE A;  1UD7 A;  3RD2 A;  4KKI A;  1MG8 A;  3M63 B;  4ZOH C;  4M0W A;  2D2Q A;  3VVW B;  5E6O A;  5BMG A;  2BYF A;  1E10 A;  3FAH A;  3I9V 1;  3CIR B;  3WAO A;  4N58 A;  2MQJ A;  2DZK A;  5AUI A;  1WY8 A;  4RM9 A;  4TKN A;  4WJO A;  4DDG D;  3DVN V;  3RFZ B;  2WS3 B;  1ZGU B;  1P7E A;  4BBN F;  2PVO D;  3I3T B;  1B9R A;  2W3R A;  1WSP A;  4XE0 A;  1FD6 A;  3A9J B;  4IDI A;  2QMT A;  2LJ5 A;  1DYQ A;  1ESF A;  1TS2 A;  2IO0 B;  2FE8 A;  2WXJ A;  4W9F A;  2PPH A;  2DYB A;  4HCP B;  4A6Q A;  4HWI B;  2LGS A;  1MHH E;  4KGS A;  5DPS A;  4JQW C;  2IO3 B;  4LK0 M;  4YWG G;  1J7B A;  2IGH A;  1IGD A;  1RYJ A;  5LXH A;  2D3B A;  4HXD A;  3KWL A;  1GG3 A;  4KIK A;  1RRB A;  1ZXI A;  1FPY A;  2L1A A;  4W9K A;  1WE6 A;  2D3G A;  1VZ7 A;  2WLB A;  4TSS A;  1K50 A;  2GBM A;  1WGK A;  2ZVO A;  4BKT A;  2C5L C;  3UI3 A;  2MA9 B;  2MWS B;  4LDT D;  3O65 B;  3IXS A;  4ACF A;  4B9K A;  1E6E B;  2N9L A;  2ZNV C;  4US8 A;  4UDU C;  4ICV A;  2ZZP B;  2RGF A;  2WDT B;  1TT5 B;  3DBR B;  1ZP0 B;  4XGA B;  2IPK D;  1ET6 A;  1ZE3 D;  4AWJ A;  4EEW A;  4WQM A;  3ALB A;  2L0F A;  2AL6 A;  4AUQ C;  2JZP A;  3B9J A;  2KQ4 X;  1ISN A;  4NJ7 A;  3Q3M C;  2D3A A;  2LUM A;  1WMH B;  3PZD A;  1XD3 B;  2A5U A;  3VDZ A;  4RFB A;  3VR8 B;  1TS5 A;  4CHK A;  2I38 A;  1KRH A;  3V6C B;  2BW2 A;  1T6B X;  5C2T B;  3Q69 A;  2RDG A;  4KZC A;  2W54 A;  1UF0 A;  3BZD B;  4EZJ A;  4MJS B;  4TV3 A;  4L23 A;  3DWM A;  2BYV E;  4RH6 A;  3U7Z A;  5GMV A;  4BKG A;  3WAP A;  3TEX A;  2IO2 B;  1P0R A;  1HZ5 A;  4RGT A;  1WXQ A;  2KYW A;  3WAL A;  4MGI E;  3AN1 A;  4S17 A;  4EKU A;  2M4N A;  4BVU C;  3QAQ A;  3APF A;  2BF8 B;  3PRM B;  2BVC A;  1QF6 A;  1SEB D;  2O2V B;  2NBU A;  3U52 E;  1QT9 A;  1N5W A;  5HHD G;  3Q8F A;  1TTN A;  3UGB B;  3BVZ A;  3VTW A;  3I57 A;  1WH3 A;  3DCG A;  5D94 A;  5CHF A;  1UUP A;  4W9E A;  2MP2 B;  4IM3 A;  4ZYS A;  3R7R A;  1YOV B;  3DQV A;  2AQ3 B;  2V3N A;  1V97 A;  3HVD A;  2EMS A;  3EA6 A;  3NJT A;  3L10 B;  4J6I A;  3C8Y A;  3VUW A;  3HK0 A;  3TSS A;  4FJZ A;  1BML C;  1C4A A;  3CWI A;  3VUX A;  1JW9 D;  4C4V A;  4Q2J A;  2I1K A;  4PS8 A;  1UGJ A;  3JW0 X;  2DBY A;  4DHZ B;  1YN3 A;  1J19 A;  1QLB B;  1Q10 A;  1D5X C;  1VRA B;  3CF6 E;  2N9K A;  1SE9 A;  3B1L X;  3TL5 A;  2J7Q B;  1M4V A;  3IT4 B;  1AWD A;  2DWQ A;  3QHT A;  3Q6B A;  4PS3 A;  1ZPS A;  1WJN A;  2PE9 A;  2N9X A;  4FHJ A;  3QJZ A;  2KLC A;  3DHG C;  4JIO U;  3A33 B;  3SEB A;  1R7S A;  3N32 A;  1VZ8 A;  1YN4 A;  2JVC A;  5I4D A;  1N60 A;  4IKG A;  1VJK A;  3QCA A;  2LMC A;  4G11 A;  3ZRF A;  2JSV X;  2LJI A;  3DDC B;  1NDD A;  3NVW A;  4GXB A;  2HDE A;  2ON8 A;  1E8Z A;  1R4N B;  3DVN U;  4GDK B;  1E7U A;  3VUY A;  4LJP B;  4EZL A;  1FIQ A;  4URK A;  4A3P A;  3A9K A;  3SHQ A;  3OLM D;  1UWX A;  4XDC A;  3NZS A;  3AE1 B;  1E7P B;  2JU6 X;  4KX6 B;  3TIX A;  3RZF A;  1K52 A;  1V1P A;  1GOZ A;  3ZKJ C;  1C78 A;  4FHK A;  3ABV B;  1FXT B;  1NEN B;  3WAM A;  1GJZ A;  3RPF C;  3ZNG C;  3DPD A;  4ANX A;  4A8X C;  2LGD A;  4RF1 A;  4DXA B;  3Q14 C;  1Q5W B;  4BFR A;  2QHO A;  3KUD B;  2PTL A;  2MLB A;  4YTM B;  2GMI C;  4JX1 C;  1T0S C;  4XWW A;  2LUE A;  3L4P A;  1DOI A;  4M0W B;  2HTH A;  2K6Q A;  1E8W A;  2C9W B;  3TEY A;  3T3O A;  4MAC A;  2ACZ B;  4REZ A;  3DHI C;  1OFF A;  2BT6 A;  5KHQ A;  2QEJ C;  2WXM A;  5DPW A;  3RNE C;  1F2R I;  5DPT A;  1FXI A;  1NYQ A;  3MC0 B;  2B76 B;  2WXN A;  1PYW D;  3HHM A;  4WAA A;  3V61 A;  3R2I A;  4RCO A;  5AZF A;  2DNF A;  2PEA A;  1JQ4 A;  4BOZ B;  2RR9 A;  4GB9 A;  2BKR B;  3MP9 A;  3VTU A;  3WCQ A;  1TGZ B;  5TR5 A;  2PE6 B;  2WXO A;  4DDI D;  1ZXH A;  2V4L A;  1UWM A;  3VRB B;  2DAJ A;  2KXJ A;  1QOF A;  2KDI A;  1DGJ A;  1JWB D;  2VH2 A;  2ICI A;  4ZRJ A;  1CZP A;  1PFD A;  4GU2 A;  2BTE A;  1SE2 A;  3BK1 A;  3HVZ A;  2MSE D;  2TSS A;  2WXF A;  4KIK B;  4F8C B;  2J0M A;  2JYT A;  2L32 A;  3U30 A;  2ZJD A;  3VHT C;  2N9P C;  3KYD D;  1WJ6 A;  2W9N A;  1NVI D;  1A5R A;  1NBF C;  2FIF A;  3E56 A;  2LXC A;  2VRR B;  1IPG A;  4OZB A;  2KDM A;  4CO7 A;  3KUC B;  1CJE A;  1EWC A;  2BWF A;  2CHZ A;  5IOI A;  1TY0 A;  3MJW A;  3RI7 C;  3NVV A;  3HRD D;  1IGC A;  3PHX B;  1P7F A;  4MGK E;  3OWE B;  4HPM B;  3TEZ A;  1FXA A;  5AZH A;  4F1S A;  1RM6 C;  2WXL A;  5BMH A;  2IGD A;  4N6E B;  1Y56 A;  4M02 A;  4LDT B;  2B3A A;  2RMM A;  4N9F 4;  5G5H A;  3I63 C;  1EU4 A;  1MJD A;  1VD2 A;  3VXW A;  2IDY A;  2FAZ A;  1MG4 A;  3H7S A;  3UIP B;  4NAW A;  1UNS A;  2QIL A;  4TQ1 A;  5D6J B;  2FCQ A;  2J52 A;  4A3O A;  2XK5 A;  4HK2 A;  2SAK A;  3IFW B;  3IAS 1;  2KJ6 A;  1B1Z A;  3N20 C;  4GSW A;  3ZQ4 A;  4HJG E;  4W9L A;  2E3T A;  3AE3 B;  2KT7 A;  5IP4 D;  1XEE A;  4GMV A;  2K8B A;  2KKC A;  2C7N B;  2ZW0 A;  2C60 A;  1HTO A;  4ASW C;  5EE9 A;  2YEP F;  3APD A;  1HZ6 A;  4NJ6 A;  4KDI C;  1WR6 E;  1HQR D;  3ZUN A;  3RN9 C;  2RPQ A;  3N1X C;  2RDH A;  1IBX A;  4C7Z A;  2K1F A;  2XN9 C;  3BII D;  3ENE A;  4DK5 A;  4XWT A;  4X57 B;  4B6W A;  2CHX A;  1L6U A;  2KK8 A;  3PO0 A;  3UIO B;  4YTN B;  4PYZ A;  3V3X A;  1YQB A;  3AB5 A;  2V3P A;  1F9J A;  1SIJ A;  2HD5 B;  2JXT A;  2EEL A;  4C4V B;  3VAW A;  3B2G A;  3LXF A;  1KLV A;  1N63 A;  3V6E B;  4RMA A;  1YD8 U;  2JZZ A;  2GLS A;  2D5G A;  4EUT A;  2AWT A;  3ETR A;  3AUL A;  4P1B C;  4MH8 A;  1TYG B;  3H7P A;  1PUT A;  4WWP A;  4RNA A;  4ANW A;  1FCC C;  2J4X A;  2LRW A;  1ZDX A;  3MFG A;  2OJR A;  4W9G A;  1BUI C;  2KZR A;  2KFJ A;  3GOE A;  2N7D A;  3O13 A;  3AEA B;  2WXK A;  2QCZ A;  3MHS D;  3V62 A;  2KAN A;  2KTR A;  2KO3 A;  2OJW A;  2AQ2 B;  1TY2 A;  4MDK E;  3P4Q B;  4ZRI A;  5GXG B;  3VH3 B;  2XEW A;  1GUA B;  3TMP B;  2L52 A;  4KGR A;  2R61 A;  2WYQ A;  2AYO B;  5D2M B;  3KYC D;  2MEK A;  2OHF A;  5DPR A;  3A9K B;  3T8M A;  3P1M A;  1E8Y A;  1WJU A;  4KZ0 A;  5IO9 A;  2L3Z A;  1ZDV A;  2WQY B;  2FCM A;  3ZRC A;  1V1P B;  3A4R A;  3HIZ A;  1I4X A;  5AZG A;  1NI3 A;  4HKQ A;  3HUI A;  2MRP A;  4A55 A;  2K0P A;  1FEH A;  1YMH E;  4LLG M;  3AEC B;  3B08 A;  2LVQ A;  3Q8A A;  1TS4 A;  3PS6 A;  4OW0 A;  3NS8 A;  2KAC A;  4ZRK A;  3WIM A;  2WXQ A;  2EKI A;  3NY5 A;  1C77 A;  3ZJU A;  4GDL A;  5HFY A;  1IUE A;  3P4P B;  2MBE A;  3WAN A;  4OVV A;  4WJP A;  1NI2 A;  4YXD B;  2MJD A;  1S1Q B;  3NG0 A;  3AEB B;  4NJC A;  3B0A A;  4K7W A;  4KVG B;  1D5Z C;  2KDF B;  4ANU A;  1QOA A;  4GIV A;  1FNU A;  2N9E B;  1WGD A;  2M8S A;  3A1Q A;  3BYT B;  2J42 A;  2A4Z A;  5G2N A;  1JRU A;  3BY4 B;  4DBG A;  1ZKH A;  3TBL D;  4OZA A;  2JT4 B;  2M17 A;  2WXH A;  2Y5P A;  3ZIM A;  1V49 A;  1GAQ B;  4W9C A;  4GOC A;  3W5U B;  2M56 B;  2KJR A;  1YX5 B;  1R4M B;  4E74 A;  4EE2 A;  2N4F A;  1L4Z B;  1KFY B;  5BYS A;  4NZL B;  2MBQ A;  1QQR A;  4WQO B;  3NS1 A;  1E5W A;  4FJY A;  1L0V B;  5C23 A;  1PGA A;  2WXI A;  5JZE B;  2JY6 A;  1WE7 A;  4LNK A;  1TKG A;  1OTR B;  5HG2 A;  1VZ6 A;  2X8X X;  2K3U A;  1BXT A;  3KUZ A;  3UF8 A;  1GB4 A;  2LI5 A;  2M19 A;  2EMT A;  1UBQ A;  4L1B A;  3AU4 A;  2PW9 A;  1WX8 A;  1FNV A;  1HA5 A;  1J8C A;  5BYR A;  2V9H A;  1V5O A;  1WZ3 A;  4JPS A;  2NPT A;  2Z59 B;  2O6V D;  1T0Y A;  4K7S A;  2IY1 B;  3AE2 B;  3AEG B;  1WX9 A;  1ACC A;  1KH0 A;  1MPE A;  1DOX A;  3MHZ A;  1SBB B;  2M1M A;  4YSX B;  1CK1 A;  3PPA A;  1KF6 B;  4GN1 A;  4G0N B;  2WXG A;  3BYY B;  2DYO A;  4I6P A;  4K1R B;  2O6V A;  4NAW B;  1SJE D;  4D2K A;  4WUR A;  2DLB A;  1JWS D;  1T3Q A;  4US9 A;  4W9D A;  5H92 C;  1I4R A;  2XNA C;  2KMA A;  2ZPN A;  2XK5 B;  2H89 B;  4FLH A;  4YL8 A;  2LEK A;  2GBJ A;  3QAR A;  1LGR A;  4M01 A;  2BKF A;  4PK1 A;  1XF5 L;  1XT9 B;  2WDR B;  4JWU C;  1T0Q C;  2LGI A;  4P7I A;  1JWA D;  1U4A A;  2K25 A;  2LXA A;  3LB8 C;  4L2Y A;  5E6J A;  3RNC C;  3AE9 B;  3N9Y C;  3BVG A;  3KWV A;  3ZGZ A;  2N7J A;  3TCA A;  3AE6 B;  4WAF A;  2NR2 A;  4RGN A;  5C1Z A;  3OAW A;  3ML9 A;  2CHW A;  4CQN A;  2RD0 A;  5LLI A;  1OQY A;  1FM0 D;  3OJ3 A;  3DBL B;  4BOS C;  2Z0D B;  5E6N A;  1IBX B;  3APC A;  4EZK A;  3RNA C;  1JRP A;  4HVB A;  3EGR A;  2KMC A;  2Z0E B;  4WWM A;  2MCN B;  2KDE B;  2YLM A;  1E90 A;  1IP9 A;  3M62 B;  1YNT E;  4WWO A;  1WXS A;  2N7E A;  5AEK B;  2L0T A;  1KM7 A;  3T9L A;  1P1A A;  2NS5 A;  2WX0 A;  3GZN B;  1WXM A;  1N5X A;  2Z8L A;  3CSF A;  4ARI A;  3AI5 A;  2IBI B;  5AUK A;  4IUM B;  3KLS X;  2WX1 A;  4EFO A;  2LHE A;  4ICU A;  3J9C A;  3N3K B;  3SFD B;  5E6P A;  3PRZ A;  2BYE A;  3AXC A;  4IWP A;  3DBR I;  4C80 A;  1OQQ A;  1Q0W B;  3EFC A;  1LQB A;  3FC4 A;  1L4D B;  1TIF A;  3BWU D;  2EKE C;  1T0R C;  2DZM A;  4JGH B;  2W55 A;  1E8X A;  4YSZ B;  3AV8 A;  3IAM 1;  2KMM A;  5LXI B;  4DQO C;  1L2N A;  2K39 A;  3Q3J A;  2BS2 B;  1WZ0 A;  2KTR B;  4XC2 A;  1K53 A;  2MBB B;  2QIE B;  1C9F A;  4HEA 1;  4HRS A;  1QZE A;  3ZXV A;  1SSN A;  3SR6 A;  1I4Q A;  1SJH D;  2CJN A;  2NTT A;  2LVP A;  3UQA A;  4IWQ A;  3P63 A;  2WWZ A;  4HDO A;  1JRO A;  3ZYY X;  4FBJ B;  2FCS A;  3L0W B;  3NVY A;  1S3S G;  2Y5C A;  2CU3 A;  4P6V F;  3A4S C;  4LNO A;  2UU7 A;  3QWZ B;  3EHV A;  3ZW3 A;  1SIF A;  2QC8 A;  3K9O B;  3PHW B;  4LCD E;  1WYW B;  4FN2 A;  1QKZ A;  4K3B A;  2CKH B;  4FAD A;  2GRI A;  1WGY A;  4WIP A;  1MI0 A;  3QA8 A;  2BWE S;  3KVF B;  3RMK C;  1MVK A;  4II3 B;  2K9X A;  2NBW B;  3DVG Y;  3ONS A;  4LJO B;  2FUH B;  3JSV A;  1DOY A;  2PKO A;  3VRA B;  4P16 A;  3VQI A;  4CYE A;  2DAF A;  4GDL B;  2ONQ A;  1AW7 A;  3PRP B;  2DYM A;  2INC C;  1F77 A;  4QAY A;  4GGQ A;  2KWD A;  4B0E A;  2W3S A;  5JHB A;  1JML A;  3AEE B;  1YX6 B;  2D3C A;  1XLO A;  3A1Q B;  3RCZ A;  3RUL A;  3ZDM C;  2JXX A;  1WF9 A;  2RDB C;  2CR5 A;  4MJS A;  5IAA C;  3S2A A;  3NZ3 A;  2E6X A;  4ZHO A;  4IW0 A;  4M8M A;  2Y5B B;  2KN4 A;  2GBR A;  3IVF A;  3PRE A;  2LD9 A;  2KWU B;  1RFK A;  3X0W A;  1AN8 A;  1XCT L;  1V81 A;  2V0G A;  1XLP A; 
#chains in the Genus database with same CATH homology
 3PVL A;  4MDK E;  2PJH A;  4KV2 A;  4WJQ A;  3H7P B;  4DWF A;  4ZRI A;  2CU1 A;  5GMV A;  2K6D B;  3VH4 B;  4BKG A;  3VH3 B;  1AAR A;  2XEW A;  3WAP A;  1IYF A;  1ZW7 A;  2IO2 B;  4MGZ E;  3WA0 A;  1GUA B;  1P0R A;  5J18 A;  3TMP B;  1WR1 A;  2KVR A;  3WAL A;  5EDS A;  4MGI E;  2KDB A;  2KJH B;  2WYQ A;  1UH6 A;  2GOW A;  2AYO B;  3EEC A;  1X1M A;  3A9J A;  3VFK A;  5D2M B;  4IM0 A;  4FJV B;  1EF1 A;  3KYC D;  4NY0 A;  5CTR C;  4A20 A;  4EKU A;  2M4N A;  2NVU I;  5DPR A;  3DOW A;  5CHW A;  2KC2 A;  4BVU C;  3A9K B;  3T8M A;  3QAQ A;  3APF A;  1E8Y A;  2BF8 B;  1WJU A;  3RUI B;  4DHZ E;  1LM8 B;  3PRM B;  2I1J A;  4KZ0 A;  1Q1O A;  2O2V B;  2NBU A;  2C7M B;  1D3Z A;  5KHO A;  1LXD A;  2L3Z A;  1P9D U;  1TTN A;  3UGB B;  3ZNZ B;  3VTW A;  2FCM A;  3MTN B;  2J0K A;  3IHP C;  3IBE A;  3ZRC A;  1WH3 A;  1BT0 A;  3QQ8 B;  3A4R A;  3DCG A;  3HIZ A;  2L00 B;  5CX3 A;  5D94 A;  3RYT A;  2G45 B;  5CHF A;  3QK0 A;  3W1S A;  2V1Y A;  4W9E A;  2MP2 B;  4IM3 A;  4G50 A;  5AZG A;  3R7R A;  2IY0 B;  1V6E A;  1EUV B;  2GBK A;  2IYD B;  2MRP A;  4ZDV A;  3DQV A;  2NPT B;  1VCB A;  2ZCB A;  4RM8 A;  4KSK C;  2FCN A;  3PLU A;  2EMS A;  3B08 A;  2LVQ A;  3L10 B;  4F7Z A;  3PS6 A;  4J6I A;  2MBO A;  3NS8 A;  4ZRK A;  3WIM A;  1GNU A;  3AU5 A;  3NY5 A;  4MM3 A;  1LFD A;  4WWN A;  4GDL A;  1WGH A;  2MW5 A;  3VUW A;  2NCN A;  3HK0 A;  4FJZ A;  1WX7 A;  2D07 B;  1Z5S B;  3ECI A;  4FUL A;  4FA6 A;  2KHW B;  3VUX A;  2MBE A;  3WAN A;  4OVV A;  4WJP A;  2JRI B;  3M95 A;  1C3T A;  4MEM A;  2I1K A;  2ZNV B;  1NI2 A;  4PS8 A;  3L13 A;  3JW0 X;  2IO1 B;  4DHZ B;  2O6V B;  1V80 A;  1J19 A;  1S1Q B;  1EO6 A;  3R7Q A;  3B0A A;  3CF6 E;  4K7W A;  4KVG B;  1SE9 A;  4W9I A;  1WM3 A;  2JF5 A;  2KDF B;  4GIV A;  3B1L X;  4ANU A;  3TL5 A;  2J7Q B;  2N9E B;  1WGD A;  2M8S A;  3A1Q A;  3PV1 A;  3QHT A;  3ZO5 B;  2A4Z A;  4IM2 A;  5G2N A;  1JRU A;  2L76 A;  3BY4 B;  2J0J A;  4PS3 A;  4DBG A;  1ZKH A;  3TBL D;  1WMH A;  1WJN A;  2JT4 B;  2PE9 A;  2N9X A;  4FHJ A;  2FNJ B;  2KOX A;  2M17 A;  3C0R B;  3QJZ A;  4MH0 E;  2KLC A;  3ZIM A;  4JIO U;  2KWV B;  1V49 A;  2L8J A;  3A33 B;  4W9C A;  1V5T A;  3N32 A;  4GOC A;  2KJR A;  1YX5 B;  3CMM B;  4E74 A;  2JVC A;  3W1S C;  2N4F A;  3HM6 X;  1UZX B;  3H9D A;  2MBQ A;  5JHA A;  3QCA A;  4WQO B;  4G11 A;  3ZRF A;  1I42 A;  1E5W A;  4FJY A;  5C23 A;  3D32 A;  3DDC B;  1NDD A;  4GXB A;  3W1Y A;  5JZE B;  3CST A;  1E8Z A;  2N1W A;  4E71 A;  2JY6 A;  5HKH A;  3QC8 B;  3DVN U;  1WE7 A;  1E7U A;  4GDK B;  3VUY A;  1P98 A;  4KDL B;  4LJP B;  4EZL A;  4URK A;  1V9J A;  4A3P A;  1OTR B;  4HJK A;  4PYU A;  3A9K A;  3SHQ A;  3OLM D;  3DBL I;  3KUZ A;  3NZS A;  3UF8 A;  4DHJ B;  2O2V A;  4IG7 B;  4NNJ B;  4MSM B;  2LI5 A;  1J0G A;  2EMT A;  4ZYN A;  3ZDT A;  2LGY A;  1UBQ A;  3TIX A;  4PS7 A;  3AU4 A;  3RZF A;  1RFA A;  1TBE A;  1WX8 A;  1OGW A;  2LRU A;  3ZKJ C;  1J8C A;  2MP2 A;  1R4N I;  2OOB B;  4FHK A;  4IWO A;  1V5O A;  1WZ3 A;  3L08 A;  1FXT B;  3WAM A;  2NPT A;  1GJZ A;  3ZNG C;  2DZJ A;  3L17 A;  3DPD A;  2Z59 B;  4K7U A;  3GZN I;  2O6V D;  4ANV A;  4W9J A;  1T0Y A;  4K7S A;  4ANX A;  2IY1 B;  2JZ3 B;  2LGD A;  3R3M A;  2FID A;  4DXA B;  2MBH A;  1Q5W B;  2V3S A;  4BFR A;  1WX9 A;  2QHO A;  3H6N A;  3KUD B;  5J17 A;  2JPH A;  1C1Y B;  2MLB A;  2GMI C;  2KTF A;  2KD0 A;  3L54 A;  1Z2M A;  4NQL B;  2ZEQ A;  3N30 A;  5L83 A;  2M1M A;  3SDL C;  2LUE A;  3PPA A;  4GN1 A;  4G0N B;  4XX5 A;  4M0W B;  1OEY A;  1YIW A;  4I6L B;  4MEL A;  3HM3 A;  2LGX A;  3ZTC A;  5JH5 C;  2HTH A;  2K6Q A;  5CHV C;  2DYO A;  2UWQ A;  1E8W A;  4I6P A;  4K1R B;  5D7G A;  2C9W B;  4HPL B;  2O6V A;  5G55 A;  4IC7 B;  4NAW B;  5KHQ A;  2D10 A;  5DPW A;  3SU8 X;  2L05 A;  3DVG X;  2G4S A;  2KFK B;  1YJ1 A;  3ZNH B;  2KC1 A;  1RLF A;  1WXV A;  4W9D A;  5DPT A;  3JVZ X;  2KMA A;  3EFU A;  3KW5 B;  2ZPN A;  1G6J A;  2XK5 B;  4FLH A;  1XQQ A;  4TQ0 A;  1P3Q U;  4YL8 A;  3X23 A;  2ZCC A;  1WFY A;  2GBJ A;  3IG3 A;  3PTF C;  3P2B A;  3HHM A;  2HE7 A;  3QAR A;  4WAA A;  2KLG A;  3TJP A;  3V61 A;  4HDQ A;  2BKF A;  1RAX A;  2KWC A;  5AZF A;  2PEA A;  2KN5 A;  1EF5 A;  2JWZ A;  1XT9 B;  3L16 A;  4BOZ B;  2RR9 A;  4GB9 A;  2BKR B;  2M0X A;  4P7I A;  3VTU A;  1TGZ B;  5TR5 A;  2PE6 B;  3NHE B;  2KQS A;  1M94 A;  1H4R A;  1U4A A;  2K25 A;  3LJ3 A;  5BO4 B;  2LXA A;  3RZW C;  1KOT A;  3PT2 B;  4DDI D;  4DHJ D;  2V4L A;  2R2O A;  1CMX B;  3ZVV A;  1WI0 A;  3TCA A;  4MGY E;  2YVC A;  2ASQ A;  2DAJ A;  2KXJ A;  4AJY B;  2NR2 A;  2LWP A;  2KDI A;  3DBS A;  5C1Z A;  1UGM A;  4MSQ B;  4ZRJ A;  3OAW A;  3ZLZ A;  3K9P B;  5FR6 A;  3ML9 A;  4GU2 A;  4JLC A;  1L7Y A;  3SD5 A;  3Q3F A;  4XZ4 A;  4B95 A;  3BIN A;  1WGR A;  2CHW A;  4GDK A;  2RD0 A;  2AL3 A;  1I35 A;  2MSE D;  3PLV A;  5LLI A;  1OQY A;  3OJ3 A;  2HJ8 A;  4KIK B;  4OVU A;  1K8R B;  3LDZ E;  4F8C B;  4BOS C;  2Z0D B;  2J0M A;  3U30 A;  5E6N A;  2R2Q A;  1KJT A;  3APC A;  1Y8R C;  2DHZ A;  4EZK A;  2BGF A;  3JSV B;  2BPS A;  2ZJD A;  3VHT C;  4G3X B;  4HVB A;  2KMC A;  2Z0E B;  3PSE B;  2N9P C;  3KYD D;  1WJ6 A;  2KDE B;  2W9N A;  2YLM A;  2MCN B;  4AP4 C;  1E90 A;  4HLE A;  3DBH I;  1IP9 A;  3M62 B;  2XBB C;  2G3Q B;  1A5R A;  1NBF C;  1WXS A;  4WWO A;  2KX3 A;  2N7E A;  5AEK B;  4EOY A;  2FIF A;  2L0T A;  1UBI A;  1H8C A;  1KM7 A;  2LXC A;  2VRR B;  2RSU A;  3T9L A;  4AJW A;  1P1A A;  1TZ1 A;  2NS5 A;  1IPG A;  2REX A;  5L95 C;  2DX5 B;  2WX0 A;  4CO7 A;  1UEL A;  1WXM A;  3KUC B;  2IZV B;  3VTV A;  4M8N A;  3CSF A;  2BWF A;  2CS4 A;  2CHZ A;  3AI5 A;  1V2Y A;  2IBI B;  2UYZ B;  3MJW A;  2DEN B;  2GBN A;  4IUM B;  4TUU A;  2LVO A;  2WX1 A;  1OEY J;  4EFO A;  4ICU A;  3PHX B;  3N3K B;  3UIN B;  5E6P A;  3PRZ A;  4MGK E;  2BYE A;  3QIJ A;  3AXC A;  4IWP A;  4HPM B;  5J2R A;  3DBR I;  2KNB A;  1WXA A;  5AZH A;  2JRH A;  1Q0W B;  4F1S A;  3OJ4 B;  4AOF A;  2D11 A;  3PGE A;  1UD7 A;  3RD2 A;  1LQB A;  4LDT B;  2B3A A;  1MG8 A;  2EKE C;  3M63 B;  4N9F 4;  2DZM A;  3ZNI D;  1VD2 A;  4JGH B;  3VXW A;  2D2Q A;  1GC6 A;  2FAZ A;  1E8X A;  3VVW B;  1E7V A;  5E6O A;  2BYF A;  3H7S A;  3UIP B;  4NAW A;  5LXI B;  4TQ1 A;  1L2N A;  3WAO A;  2K39 A;  3Q3J A;  2MQJ A;  2DZK A;  2NBV B;  1V86 A;  1WY8 A;  1WZ0 A;  2KTR B;  4XC2 A;  2KFK A;  1WGG A;  4RM9 A;  2MBB B;  4TKN A;  5D6J B;  3NOB A;  4WJO A;  2AEH A;  3V60 A;  2FCQ A;  4DDG D;  4A3O A;  1QZE A;  2C7H A;  2JUO A;  2XK5 A;  4HK2 A;  3DVN V;  3IFW B;  2KQ7 A;  1ZGU B;  2KJ6 A;  2LVP A;  3UQA A;  4BBN F;  4IWQ A;  5IA7 A;  1WRD B;  3I3T B;  2WWZ A;  4GSW A;  4HDO A;  4KSL C;  4FBJ B;  2FCS A;  3A9J B;  3L0W B;  4W9L A;  2LJ5 A;  1S3S G;  2K8C A;  2IO0 B;  3H1U A;  3A4S C;  3QWZ B;  3RT3 B;  3EHV A;  4GMV A;  2PPH A;  2DYB A;  4W9F A;  2K8B A;  2KKC A;  1SIF A;  4HCP B;  3ZW3 A;  4HWI B;  2C7N B;  3K9O B;  3PHW B;  4LCD E;  1WYW B;  4FN2 A;  5DPS A;  4JQW C;  2C60 A;  2IO3 B;  4II2 B;  2CKH B;  5DCN A;  4ASW C;  4FAD A;  1WGY A;  2DZI A;  3ML8 A;  2LAS A;  3APD A;  3QX1 A;  5LXH A;  3QA8 A;  2BWE S;  1WR6 E;  4HXD A;  4KDI C;  4NJ6 A;  3KVF B;  1GG3 A;  3ZUN A;  3EC8 A;  4KIK A;  1WIA A;  1RRB A;  2KX0 A;  2RPQ A;  4II3 B;  2NBW B;  4I6N B;  1GC7 A;  3DVG Y;  3ONS A;  4LJO B;  4W9K A;  2FUH B;  2K1F A;  3JSV A;  1WE6 A;  3ENE A;  1WJ4 A;  4DK5 A;  2D3G A;  4X57 B;  4B6W A;  2CHX A;  2KK8 A;  2GBM A;  3UIO B;  2ZVO A;  3VQI A;  4PYZ A;  4BKT A;  1YQB A;  4CYE A;  4WJN A;  2DAF A;  2LZ6 A;  4GDL B;  2C5L C;  2L7R A;  2MA9 B;  2MWS B;  2ZPY A;  3O65 B;  4LDT D;  3PRP B;  4HCN B;  3U8Z A;  4BKS D;  1F9J A;  2HD5 B;  2DYM A;  1HE8 A;  4K81 A;  4B9K A;  2MX2 A;  3VAW A;  3NZU A;  4NQK E;  2ZNV C;  3M3J A;  4GGQ A;  2N1V A;  1KLV A;  3UQB A;  3V6E B;  4RMA A;  1YD8 U;  4ICV A;  3ZTD A;  5JHB A;  2ZZP B;  2JZZ A;  2K8H A;  2RGF A;  2WDT B;  3KH0 A;  1YX6 B;  1PQS A;  4AWJ A;  4EEW A;  3A1Q B;  3ALB A;  3RCZ A;  2L0F A;  2AL6 A;  2JXX A;  3RUL A;  3ZDM C;  4AUQ C;  2AWT A;  1WF9 A;  4EUT A;  2CR5 A;  4MJS A;  1ISN A;  4NJ7 A;  3AUL A;  5IAA C;  3S2A A;  3R66 C;  4IW0 A;  1WMH B;  3PZD A;  3H7P A;  1XD3 B;  4M8M A;  4E3C A;  4WWP A;  2A5U A;  3VDZ A;  4BKS A;  4ANW A;  1SGH A;  2Y5B B;  3U7D A;  4CHK A;  2LRW A;  2GBR A;  3V6C B;  3IVF A;  3PRE A;  2ZVN A;  2LD9 A;  2KWU B;  2OJR A;  4W9H A;  4W9G A;  1WM2 A;  2KZR A;  2KFJ A;  3GOE A;  4KZC A;  3X0W A;  2N7D A;  3JYU A;  2G4D B;  3MHS D;  4JL9 A;  1R4M I;  1V81 A;  2KTR A;  2KAN A;  2KO3 A;  3V62 A;  4MJS B;  4TV3 A;  4NPN A;  4EZJ A;  4BBN C;  2BYV E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...