3ZTCA

Pvhl54-213-elob-eloc complex _ (2s,4r)-n-((1,1'-biphenyl)-4-ylmethyl)- 4-hydroxy-1-(2-(3-methylisoxazol-5-yl)acetyl)pyrrolidine-2- carboxamide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
103
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADTFEALCIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
total genus 21
structure length 103
sequence length 104
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ztcA00
2N1WA 2CR5A 3K9OB 2C7HA 1S1QB 1YX5B 1NBFC 2IO1B 2KTRA 2ZJDA 1WGHA 4B9KA 2ZNVB 4MGYE 5D94A 2K8CA 3A1QB 2BYFA 4TV3A 5KHQA 4WWPA 3DVGY 3W1YA 1WE7A 3CMMB 3PSEB 1F9JA 1YQBA 3T9LA 2NPTB 1GC6A 2K8HA 4GDLB 2GMIC 3ZO5B 2WDTB 1XT9B 1V81A 2KWCA 4BVUC 2HTHA 2DZIA 1K8RB 2KDIA 3HM3A 4TUUA 1P0RA 1UELA 4WWNA 3RULA 1KM7A 4BKGA 4DWFA 4ZDVA 4HXDA 3C0RB 3T8MA 2KNBA 1HE8A 4NPNA 1WE6A 4FJZA 2YVCA 2IO3B 2MP2B 1V2YA 3A33B 1WI0A 4NJ6A 2J0JA 3UF8A 3PS6A 1I42A 2LD9A 3QWZB 4RM9A 2KLCA 4I6NB 2AL3A 2LASA 2WYQA 5C23A 2RPQA 4K7SA 2KANA 5IAAC 2B3AA 2G4DB 2MP2A 1V5OA 2K39A 4E74A 3VH4B 3APFA 3QA8A 4NNJB 3A4RA 2KK8A 2WX1A 3ZRFA 4BBNC 3KVFB 4AJYB 4I6PA 1WY8A 2KDBA 4NAWA 5EDSA 3ZNZB 1ZKHA 3N30A 3W1SA 2KHWB 4GIVA 2J7QB 3ZLZA 2FIFA 3HIZA 2MCNB 2BWFA 1A5RA 2LWPA 3PRPB 1IPGA 1P1AA 1E8ZA 3NZSA 3SU8X 3ZIMA 2MBEA 2EKEC 4ICUA 4W9KA 2XK5A 3PHXB 4JQWC 2G4SA 3L08A 3V60A 4ZYNA 3ZW3A 1RFAA 1WR1A 4K7WA 2MBOA 3UIOB 4A3PA 3QK0A 5JHAA 3AI5A 3S2AA 2JRIB 3DCGA 2UWQA 3QC8B 4ANWA 3OJ4B 4W9IA 4LDTD 1TTNA 2JZ3B 1EF1A 1WJNA 1V9JA 2O6VB 2D3GA 2IZVB 2MBQA 3VXWA 3Q3FA 1WGDA 2FAZA 2AL6A 2MX2A 2N7EA 4KDLB 3ZNHB 2CHWA 3X23A 1V49A 3KW5B 2KOXA 2CS4A 3PLUA 5DCNA 2ZPYA 3IHPC 2A4ZA 4KIKB 2MA9B 4P7IA 1AARA 4NY0A 4MSMB 5CHVC 3EECA 1EF5A 1S3SG 3DVGX 2DZKA 3NZUA 3DVNU 1E7VA 4W9EA 1GUAB 4II2B 4RM8A 3RD2A 3H7SA 4LDTB 4WWOA 4EZKA 1P3QU 2EMTA 1YJ1A 3TBLD 3QHTA 2L3ZA 2GBRA 2C7NB 4LJOB 5GMVA 1WIAA 3AULA 2R2OA 2BYEA 3M3JA 3D32A 4FJVB 3A9JB 4HJKA 2G3QB 5E6OA 3DDCB 1YIWA 1LXDA 2L00B 4G3XB 2NVUI 3UINB 2IO0B 1WX8A 3OJ3A 4CYEA 1I35A 3PV1A 3H9DA 4IW0A 4OVVA 3H7PB 2NCNA 5L83A 2XEWA 1Z5SB 2KD0A 3MTNB 2KX3A 2LGYA 4I6LB 3H7PA 5J18A 1WZ3A 4NAWB 3VUWA 2ZCCA 4MSQB 3JYUA 2MBHA 3QJZA 1E90A 3MHSD 3R3MA 3Q3JA 1WXSA 1SE9A 4WQOB 3EC8A 3QAQA 2CHZA 2DZJA 4HCNB 3TL5A 4B6WA 4YL8A 1EUVB 2FCQA 3ML8A 4ANUA 4DXAB 1TZ1A 1WX9A 4ICVA 4FHJA 1WRDB 2IBIB 4K81A 2KMCA 1WM2A 4HK2A 4WJQA 2Z0DB 4TQ1A 1L7YA 2JZZA 3A9KB 4ANVA 2NR2A 4ZRJA 2RGFA 2BF8B 2DYOA 3VAWA 3RCZA 2Z0EB 3DBHI 1ZGUB 3ENEA 1Y8RC 4XZ4A 4XC2A 3IVFA 4PS7A 3UGBB 4BKSA 3KYCD 4EEWA 1SIFA 2KVRA 4KSLC 4GXBA 2GBKA 1XD3B 3R66C 2R2QA 4HVBA 1J0GA 1ISNA 1WXAA 2NBWB 4JL9A 3M63B 1CMXB 1OEYA 1TGZB 3PHWB 4G0NB 1IYFA 5HKHA 1Q0WB 1X1MA 3SDLC 1WYWB 3V6CB 2C5LC 2LVQA 2O2VB 2PEAA 4PYZA 2AWTA 2KFKB 3ZNGC 3DBLI 3SHQA 3V6EB 4AP4C 5D7GA 5DPTA 2KTRB 4BOZB 4WJNA 5IA7A 1KOTA 2W9NA 3HM6X 2J0KA 5JH5C 2JXXA 3NY5A 2ZCBA 2FCNA 2O2VA 2C9WB 2ZZPB 2MBBB 4MGKE 1V86A 3VTVA 4A20A 4OVUA 4PS3A 4ZRKA 2L8JA 2N9PC 3H6NA 1UBIA 2DAJA 4FN2A 1WGRA 4GDLA 3QIJA 5CHFA 3PLVA 5KHOA 3VTWA 2JVCA 3UQBA 3B08A 2DAFA 3ZDMC 1RAXA 2PJHA 3WA0A 3QQ8B 4KSKC 3I3TB 3X0WA 1WZ0A 4IWPA 4EZJA 2LRUA 1GC7A 1E8WA 4HDQA 3ZRCA 2KN5A 2XBBC 1E8YA 1WFYA 2JPHA 2OJRA 3R7RA 4GDKB 2A5UA 3IBEA 4X57B 4FADA 2FCSA 1LQBA 5G55A 3ECIA 5G2NA 3U30A 5D2MB 1J8CA 2N9EB 2RD0A 3TMPB 3AU5A 4CHKA 2DHZA 2IYDB 2LJ5A 1V6EA 1LFDA 2HD5B 3LJ3A 4N9F4 4TKNA 3VVWB 1KLVA 3L0WB 3PRMB 1WH3A 2N4FA 1UD7A 2UYZB 4IC7B 4E71A 2M8SA 2OOBB 4W9HA 1JRUA 5LLIA 2FCMA 4CO7A 4HLEA 1J19A 2C7MB 2K1FA 4IM2A 3TCAA 3WALA 4EFOA 4MDKE 4ZRIA 2LRWA 3PRZA 2V4LA 4KV2A 2N7DA 2L0TA 2RSUA 2NS5A 1P98A 4IG7B 1WJ6A 2D10A 2J0MA 2PE9A 2ZNVC 5J2RA 4KZCA 3N32A 3TJPA 3WAOA 4BFRA 4DDGD 5AEKB 4FLHA 5CTRC 5AZGA 2C60A 3TIXA 3A9KA 2CKHB 1EO6A 3B1LX 4DHZB 4GB9A 4IM0A 4HCPB 4DHJD 2KXJA 3GOEA 2ZVOA 3CSFA 3WIMA 2M1MA 1WGGA 2DX5B 2MW5A 3ZUNA 1GNUA 2K8BA 2KLGA 5J17A 3ONSA 5LXIB 3ALBA 3JW0X 3PZDA 4FBJB 3APDA 5AZFA 1SGHA 3V61A 1WMHB 4IM3A 1Q5WB 4EZLA 1V5TA 4W9CA 2GBMA 2L7RA 2BKFA 3KH0A 1P9DU 3VDZA 1FXTB 5LXHA 4IWQA 2AEHA 4MGIE 4EUTA 3ML9A 3RZWC 4EKUA 2IY0B 4MJSA 1V80A 3RUIB 3IG3A 2D11A 3U8ZA 5E6PA 3MJWA 3WAPA 4M0WB 2BGFA 4F1SA 1T0YA 3PT2B 1VCBA 3ZDTA 2K25A 2KJHB 4LCDE 2LZ6A 4AJWA 1G6JA 1OTRB 3R7QA 4JGHB 4GMVA 4BBNF 2JF5A 4AOFA 4IWOA 4DDID 3APCA 3DVNV 2KMAA 3K9PB 1VD2A 2LVPA 1MG8A 3DPDA 5CX3A 3VFKA 3JVZX 2KO3A 2N1VA 2NBUA 3NOBA 4NQKE 4WAAA 4DHJB 4NQLB 3OAWA 2GOWA 2JUOA 3A4SC 2QHOA 1C1YB 2L0FA 3DOWA 4NJ7A 2GBNA 3L17A 4BKTA 2PPHA 4DBGA 1TBEA 2IY1B 3VTUA 3DBSA 3OLMD 2D2QA 2EMSA 2MSED 2WWZA 2DYMA 3WANA 4B95A 1Q1OA 4W9LA 2LUEA 1GJZA 4MM3A 4A3OA 1KJTA 3L54A 2L05A 4W9GA 5L95C 2CU1A 2CHXA 3V62A 2XK5B 4FULA 4J6IA 1OQYA 3GZNI 3LDZE 2JT4B 1GG3A 2RR9A 2LVOA 2ZVNA 1WMHA 5TR5A 2KFJA 3RT3B 2HJ8A 1R4MI 4E3CA 2LI5A 2MRPA 4DHZE 4FA6A 4K7UA 4URKA 5CHWA 2DYBA 2LGDA 3KYDD 2Z59B 2KQ7A 2AYOB 4ASWC 3KUDB 3SD5A 3VUXA 4JIOU 2L76A 2LXAA 4PS8A 1UH6A 4WJPA 4JLCA 5DPWA 3CSTA 3DQVA 4HDOA 3L13A 4II3B 2V3SA 4GGQA 2KDEB 1WGYA 3B0AA 3UIPB 2K6DB 5C1ZA 2KJRA 2NPTA 1UGMA 3P2BA 2PE6B 3ZVVA 4M8NA 4W9JA 1BT0A 1WJ4A 3H1UA 3JSVB 3N3KB 3WAMA 1H8CA 4KZ0A 5DPRA 3RYTA 4KIKA 3IFWB 3ZTDA 4BOSC 1PQSA 1R4NI 2I1KA 1WXMA 2LXCA 2MWSB 3VH3B 1UZXB 1WR6E 1YX6B 1OEYJ 1QZEA 3JSVA 4FHKA 2G45B 4MELA 5BO4B 4AWJA 2BKRB 1ZW7A 2KFKA 4W9DA 4G11A 2MQJA 4WJOA 3ZKJC 4GN1A 3A1QA 4MH0E 4GSWA 1E7UA 2HE7A 5D6JB 4GDKA 1Z2MA 3ZTCA 2KWUB 2KJ6A 3W1SC 1NI2A 1RLFA 2BWES 3AU4A 5DPSA 2DZMA 1WJUA 4F7ZA 4AUQC 5FR6A 2JRHA 4GOCA 4KDIC 3BY4B 4W9FA 3VUYA 4MJSB 4LJPB 1WM3A 3PTFC 2FUHB 3QCAA 3NHEB 4BKSD 3M95A 4M8MA 3NS8A 3PVLA 2WX0A 2KDFB 5E6NA 3ZNID 3U7DA 2ASQA 3DBRI 1OGWA 4K1RB 2VRRB 3VQIA 2REXA 2KZRA 2D07B 3CF6E 3L10B 2LGXA 4G50A 2Y5BB 2JY6A 1LM8B 2M4NA 2BPSA 2JWZA 3PREA 3QARA 3KUZA 1WX7A 2I1JA 3A9JA 3EFUA 2MLBA 2V1YA 4PYUA 4ANXA 1WXVA 4HWIB 1U4AA 4IUMB 1C3TA 4TQ0A 2GBJA 3PGEA 3QX1A 2ZPNA 3BINA 4DK5A 4HPMB 2KC1A 3VHTC 2KKCA 1RRBA 2KTFA 5JZEB 3O65B 2IO2B 2K6QA 2O6VD 2KWVB 1NDDA 4F8CB 2KC2A 1UBQA 4RMAA 1E5WA 3PPAA 1L2NA 4MEMA 2ZEQA 3HHMA 1XQQA 3EHVA 4FJYA 1M94A 5JHBA 4HPLB 1WF9A 2M0XA 4XX5A 4GU2A 4MGZE 3RZFA 2DENB 2YLMA 1H4RA 2KX0A 1IP9A 2M17A 2N9XA 2NBVB 2O6VA 1YD8U 3AXCA 1D3ZA 2KQSA 1E8XA 4EOYA 3HK0A 3M62B 5AZHA 3KUCB 2FIDA 2FNJB 3UQAA 3L16A 4KVGB 2BYVE
chains in the Genus database with same CATH superfamily
3EUB2 2C7HA 1NBFC 2ZJDA 1R4MB 4MGYE 2K8CA 3WCQA 3DVGY 3W1YA 4L23A 2KMMA 3HRDD 3HVZA 1GC6A 4GDLB 2WDTB 5I4DA 2DZIA 1P0RA 4BKGA 2I2YA 5LNK1 1YJJA 3AE4B 2N9KA 2YVCA 4TSSA 1T5XD 3IAS1 1XCQL 3A33B 1WI0A 1DOYA 1K51A 4WAFA 3UF8A 3PS6A 2WYQA 2LASA 2KANA 2K39A 4E74A 1C4AA 3NUHB 1FNUA 2JU6X 2HTME 4K3BA 1WY8A 3IT4B 2KDBA 4M01A 3ZNZB 3W1SA 4S17A 1PDXA 2BWFA 3PRPB 1YN3A 3C8YA 3SU8X 4P1CC 3ZIMA 2MBEA 2EKEC 2G4SA 2LUMA 2KN4A 4ZYNA 3ZW3A 4A55A 2PW9A 1WR1A 4C56C 5HG2A 3AI5A 4EE2A 3S2AA 2JRIB 3QC8B 2NTSA 4LDTD 1TTNA 2JZ3B 1AN8A 4JWUC 3Q3FA 1WGDA 4M0WA 4KDLB 4HPPA 2CHWA 3KW5B 2CS4A 2A4ZA 1AARA 1S3SG 3DVGX 3DVNU 1E7VA 1GUAB 2V3PA 4EZKA 4WWOA 1YJ1A 2L3ZA 3MHZA 4LJOB 3URYA 5GMVA 3AULA 2JWUA 2BYEA 3M3JA 4DXFA 3A9JB 3ZJTA 1LXDA 3OJ3A 5H8YE 2NCNA 5HI1A 2K0PA 3H7PA 4NAWB 3JYUA 1E90A 4KKIA 1WXSA 4BZAA 1SE9A 3EC8A 2YEPF 2IGGA 1EUVB 1JRPA 4ANUA 1TZ1A 4FHJA 1WRDB 3ZXVA 2IBIB 2BS2B 1VZ7A 1XCTL 1L7YA 4WQMA 2WGSA 2DYOA 1MHHE 2WXQA 2Z0EB 5EE0A 3ENEA 4XZ4A 4XC2A 4EEWA 2MEKA 1AWDA 2GBKA 1ET9A 2NBWB 1IGCA 2QILA 3PZ8A 1JALA 3SDLC 4PYZA 1VJKA 3DBLI 5D7GA 3SFEB 4BOZB 2W9NA 3HM6X 2J0KA 3NY5A 2C9WB 1V86A 3Q69A 1IBXA 2N9PC 3H6NA 1UBIA 2SEBD 3I57A 4GDLA 3ZYYX 3VTWA 3PLVA 1JW9D 1RAXA 2PJHA 3P42A 2DBYA 3I3TB 4USAA 5IO9A 4IWPA 4YSZB 4EZJA 3ZRCA 2A5UA 4X57B 2FCSA 1LQBA 2N9EB 3AU5A 4CHKA 1JWUD 4KKJA 4N9F4 3LJ3A 3VVWB 1KLVA 3AE5B 3R8BA 4ZYSA 2MJDA 3KQ4A 2WP9B 3ZGZA 4W9HA 5LLIA 2WLBA 3TCAA 3AB5A 3WALA 2NMQA 4ZRIA 4OZCA 2D10A 1I4PA 2KYWA 2PE9A 4KGTA 4FLHA 5CTRC 1EO6A 4DHJD 1TS5A 3WIMA 2M1MA 1WGGA 2K8BA 4XGAB 2LGSA 1TS3A 3W5VB 1QILA 1V5TA 2GBMA 2BKFA 3NJTA 3KWVA 3DHIC 5AUKA 2AEHA 1SE2A 3ML9A 4EUTA 1XLNA 4MJSA 2QSDA 1V80A 4GLSC 1OQRA 4WH4A 3RUIB 3W5UB 5E6PA 1T0YA 3PT2B 1V97A 2K25A 2KJHB 3R7QA 3AEDB 3GE3C 4JGHB 4BBNF 4IWOA 1MG8A 5CX3A 2N1VA 2NBUA 3NRZA 4DHJB 3N1ZC 3DOWA 3L17A 2W54A 4K3CA 2D2QA 2MSED 4B95A 1Q1OA 5IOIA 2LHEA 1NI3A 4UDUC 4A3OA 2CHXA 4KGRA 2K9XA 3RNGC 1PGXA 2AQ3B 1SB3C 3LDZE 2JT4B 3GZNB 2RR9A 3Q8AA 2ZVNA 4LNKA 5TR5A 4LK0M 4FXCA 5EE9A 1XLOA 3V05A 2DNFA 1T0SC 5CHWA 3NG0A 3GE8C 2V4IB 2AYOB 3SD5A 3VUXA 2L76A 3AN1A 5DPWA 1QOGA 4HDOA 2KDEB 1WGYA 3UIPB 5C1ZA 2KJRA 3TEZA 5IKCM 1UGMA 3ZVVA 4M8NA 2OHFA 3H1UA 2QJLA 1YNTE 2VH2A 1WXMA 2MWSB 1WR6E 1QZEA 5BO4B 2W55A 2VH1A 1PGAA 4G11A 2RMMA 4WJOA 3ZKJC 3A1QA 4REZA 4GDKA 1Z2MA 2JYEA 2PIAA 2KJ6A 1QOAA 2DZMA 4ITKA 5FR6A 4GOCA 2MHJA 4LJPB 2WU5B 4BKSD 2ASQA 4K1RB 4ZHOA 2REXA 1C76A 1LM8B 3ETRA 3PREA 1WX7A 1I4RA 2MLBA 1QF6A 1VDVA 1D5ZC 4TQ0A 1C3TA 4C00A 4AQ7A 2ZPNA 3BYYB 4OW0A 2KKCA 1RRBA 2GB1A 2KWVB 1GPXA 4F8CB 1TKYA 2AX5A 1IUEA 4RCOA 1E5WA 4MEMA 1PGBA 3EHVA 5JHBA 3OG5A 1WF9A 2M0XA 4XX5A 3P4PB 2PKOA 1UUPA 2M17A 2KQSA 5AZHA 2FIDA 2FNJB 4KVGB 2BYVE 3V6EB 2CR5A 1YX5B 2KTRA 1WGHA 5GXGB 1FNVA 5D94A 2N0SB 1EU3A 3A1QB 1Y56A 4TV3A 1HQRD 3PSEB 2INDC 1F9JA 1YQBA 4A6QA 2X38A 4KGSA 1V81A 2KDIA 1K8RB 4DWFA 3AE9B 1F2RI 4NPNA 1YQ3B 4FJZA 4ZRPA 3HUIA 3RNFC 2MP2B 4DXGA 1C79A 1I42A 2LD9A 2HJ1A 4I6NB 2AL3A 2D3AA 5IAAC 2MP2A 1P7FA 1MPEA 3VH4B 3AEGB 3APFA 2MJEA 4XWWA 3KLSX 4HJGE 3ZRFA 5FKAC 4AJYB 1N63A 2GI9A 4NAWA 5EDSA 1ZKHA 2KHWB 3LB8C 4GIVA 2FIFA 1QQRA 2I38A 3Q2AC 3DBHB 2B76B 4RH6A 1BXTA 4P1BC 3L08A 2PVOD 3FC4A 2MBOA 4A3PA 1SF0A 2M0AA 5BYQA 3V3XA 4W9IA 1CJEA 1EF1A 1WJNA 2DWQA 4A90A 2NTTA 2FAZA 2AL6A 4HKQA 2N7EA 3X23A 3I9V1 3PLUA 2ZPYA 4KIKB 4P7IA 2WXRA 3EECA 2E6XA 1QOFA 2DZKA 3NZUA 2HDEA 4RM8A 1P3QU 2VZKD 1B1ZA 1NEKB 2C7NB 1LGRA 2QIEB 2WU2B 3D32A 4HJKA 3NVZA 4S0RA 1YIWA 1FCLA 4G3XB 2NVUI 3UINB 1TIFA 4CYEA 3PV1A 4OVVA 3H7PB 5L83A 1Z5SB 2KD0A 2KX3A 5IN7A 5J18A 2ZCCA 3RN9C 3QJZA 2AQ1B 4HCNB 3TEXA 4YL8A 4P16A 4DXAB 4TMAB 2DLBA 1SXTA 4TQ1A 2RGFA 2BF8B 4N58A 3U7ZA 3DBHI 1ZGUB 1Y8RC 1L0XB 2KVRA 4GXBA 4HVBA 3R66C 4JL9A 2X8XX 1IYFA 1Q0WB 2C5LC 2LVQA 4YXDB 2KFKB 3SHQA 4YTPB 5DPTA 2KTRB 1TKGA 5G5GA 2ZCBA 5H92C 2ZZPB 1NYRA 4ZRKA 4FN2A 2EKIA 1TS2A 3QIJA 4YSYB 2DAFA 3ZDMC 3QQ8B 2WNMA 4XYCA 4C4VB 1WZ0A 2IGDA 1E8WA 1M4VA 2L52A 2KN5A 4IKGA 4A9AA 1E8YA 2JPHA 2OJRA 2WXJA 4GDKB 1ACCA 3IBEA 4FADA 2RDBC 3ECIA 5G2NA 5BMIA 1N60A 3TMPB 5E6JA 2DHZA 2WXMA 1C4PA 1ENFA 1NVID 1V6EA 4TKNA 1SJHD 4E71A 2M8SA 2OOBB 2J4XA 3B9JA 2FCMA 4CO7A 1E0ZA 4HLEA 2C7MB 2K1FA 2LRWA 3PRZA 2L0TA 2NS5A 1SSNA 1WJ6A 2J0MA 5J2RA 3TJPA 3WAOA 1UNSA 2V9HA 5AZGA 3DBRB 2C60A 4LNNA 3MJ5A 3P63A 3A9KA 4MM3B 2EELA 1ET6A 1TT5B 3RFZB 2KXJA 2ZVOA 3CSFA 2R61A 5BMGA 2DX5B 3KWLA 5AUIA 2KLGA 3ONSA 2L83A 3PZDA 1HEZE 1RWSA 5AZFA 1Q5WB 2L7RA 1P9DU 3U2SC 2XN9C 4M00A 3WAPA 1YN5A 1WYGA 1ROEA 3FILB 2LZ6A 1G6JA 1D5XC 4GMVA 4HEA1 2BQQA 3APCA 2KMAA 1V1PA 2LVPA 3JVZX 4NQKE 3NOBA 4NQLB 3OAWA 3B2FA 2GOWA 2JUOA 2ICIA 1B9RA 1P7EA 3DHGC 4NJ7A 2GBNA 4BKTA 4DQOC 1QKZA 2PPHA 1V1PB 3Q3NC 4B0MA 3W9CB 2IY1B 1L4DB 2WDRB 4LLGM 3OLMD 3RNEC 3RPFC 2DYMA 2WDVB 4MM3A 4D2KA 5L95C 3GP7A 3L4PA 2XK5B 3ABVB 3AH7A 4J3OD 1GG3A 3FAHA 1WMHA 2JXTA 2KFJA 3RT3B 4DHZE 1E9MA 2LGDA 2Z59B 2KQ7A 2BYTA 1SJED 1FRDA 1FMAD 4JIOU 2LXAA 2D3CA 1UH6A 1F0ZA 4N6EB 5T8IA 1JMLA 3L13A 2V3SA 4GGQA 3DWGC 2NPTA 3P2BA 2PE6B 1KLUD 1SE4A 1WJ4A 1E10A 1H8CA 4WIPA 4XWTA 5DPRA 4KIKA 3IFWB 1PQSA 1R4NI 1PYWD 2I1KA 3W2DA 2LXCA 1FM0D 3VH3B 3JSVA 2G45B 3ZQ4A 2BKRB 3RNBC 1ZW7A 3EA6A 4GN1A 4MH0E 2YEPB 1E7UA 1SIJA 1NI2A 4F7ZA 3BY4B 3VUYA 2L1AA 1K52A 1WM3A 2FUHB 3NHEB 4M8MA 5BYRA 3PVLA 4L1BA 1SE3A 1FPYA 1FCCC 2VRRB 1YOVB 2KZRA 3I5JC 2CJOA 3BVMA 2D07B 3CF6E 3L10B 4G50A 2Y5BB 5TSSA 1GAQB 3KUZA 1HTOA 3EFUA 2V1YA 4JPSA 1WXVA 1U4AA 4IUMB 1LO5D 2GBJA 2QC8A 4DK5A 1N6ZA 1CQVA 2LMCA 4L2YA 4P6VF 1F2RC 2O6VD 5FK9C 1YN4A 2KC2A 4RMAA 2K3UA 3PPAA 3R2TA 1L2NA 1MG4A 2ZEQA 3HHMA 1XQQA 1JQ4A 1TYGB 4HPLB 2N9XA 2O6VA 4LNFA 1D3ZA 5BMHA 4EOYA 5JH5C 2PVGC 4HRSA 1TS4A 2N1WA 4HROA 3MFGA 1S1QB 1F52A 4RGMA 2IO1B 3Q8FA 3BK1A 3CIRB 4B9KA 5KHQA 2BYFA 1WE7A 3CMMB 3T9LA 2KWCA 3AE7B 4TUUA 3HM3A 1UELA 3RULA 4ZDVA 2KNBA 1HE8A 1WE6A 1DYQA 2IO3B 2KLCA 1TKEA 2RPQA 1VR9A 4US8A 2B3AA 2G4DB 1T3QA 1V5OA 1T0RC 3U4EG 3IT6B 3QA8A 4NNJB 3A4RA 2KK8A 2WX1A 4IOIE 4BBNC 2VZKB 4I6PA 3IAM1 2Y5CA 3ZLZA 1UGJA 3HIZA 2MCNB 1A5RA 1D6EC 2LWPA 2RPVA 1IPGA 3AE6B 3LXFA 4MACA 4W9KA 1RFAA 1C9FA 3PZ7A 4K7WA 2J52A 3UIOB 5JHAA 5JXVA 2MJ3A 3T3OA 1VRAB 3DCGA 2UWQA 2N9LA 3VXWA 1ZDXA 1DGJA 1JROA 5DCNA 3TSSA 3IHPC 4JE3B 4MSMB 4NY0A 5CHVC 1EF5A 4YWGG 3AM9A 1MI0A 4II2B 3RD2A 3H7SA 1KRHA 3QHTA 2GBRA 1ZE3D 1WIAA 2KACA 3R2IA 2R2OA 3TEYA 4FJVB 2G3QB 3BWUD 4IW0A 1QLBB 3AECB 3Q3OC 2XEWA 3MTNB 1L4ZB 4I6LB 5HHDG 3E56A 3VUWA 4MSQB 2MBHA 2JSVX 3Q3JA 1N5XA 2L32A 4WQOB 2CHZA 2DZJA 3TL5A 4B6WA 2FCQA 2FUG1 1WX9A 4ICVA 1MJDA 2BW2A 1I4XA 3P4SB 4C7ZA 3DBLB 1L0VB 1N61A 4HK2A 4ZRJA 1FRRA 1EWYC 1C78A 2JYTA 3IVFA 3UGBB 3KYCD 4KSLC 2JQRB 3ZXRA 1J0GA 1WXAA 3M63B 4OZAA 1TGZB 2WDQB 3Q8EA 2UU7A 1I7HA 3IXSA 1WYWB 2TSSA 2PEAA 2XNAC 2AWTA 3AEFB 4AP4C 4WJNA 3UI3A 1KOTA 1XO3A 2FCNA 2MBBB 3DHHC 3VTVA 3BVZA 1HTQA 2L8JA 3BVGA 2DAJA 1WSPA 2KWDA 1WGRA 4RFBA 5KHOA 3B08A 4C4VA 3Q3MC 4KSKC 4R3DA 2BB6A 3FKYA 1GB1A 4OHJA 2LRUA 1GC7A 1WFYA 4CQNA 3R7RA 1C77A 1MFWA 4RGTA 3U30A 1JWMD 3AEBB 3ZJUA 3N1XC 2HD5B 4XDCA 3L0WB 3PRMB 3DWMA 4IC7B 2N4FA 1UD7A 2UYZB 3AE3B 4H2AA 3SEBA 4YSXB 4EFOA 4KV2A 2RSUA 1TY2A 1ZDVA 4WWMA 3T3NA 1AW7A 2ZNVC 3N9YC 3N32A 4KZCA 4DDGD 1EM7A 1MVKA 2WQYB 3TIXA 2CKHB 4IM0A 2E3TA 2LFIA 3ZUNA 5J17A 1GNUA 5LXIB 1JWBD 4FBJB 3APDA 3TUOA 3V61A 4IM3A 2BS4B 3NVYA 4YTMB 4W9CA 5LXHA 4MGIE 4EKUA 3IG3A 2D11A 1CK1A 1FEHA 3MJWA 2J42A 2JZPA 4M0WB 2BGFA 4F1SA 4AJWA 1YMHE 1OTRB 3TEWA 2JF5A 3C19A 1PFDA 3DVNV 1VD2A 3DPDA 1HZ5A 2M19A 2INCC 2ONQA 2KO3A 1UWXA 2D5GA 2PLPA 3A4SC 2QHOA 1C1YB 4ARIA 1L5PA 3MP9A 5MPOA 3EGRA 2Y3AA 4PK1A 2WWZA 1NYQA 2AQ2B 3WANA 4W9LA 2LUEA 1L0YB 5IP4D 1GJZA 1KJTA 4YTNB 4W9GA 3H8HA 5D3IB 1AYFA 3VR9B 4FULA 5FR3A 1FFVA 1OQYA 2IDYA 3GZNI 4ZHPA 5BYSA 2WHIA 2KDMA 2LVOA 2INPE 1R4MI 2LI5A 2MRPA 4FA6A 3J9CA 4K7UA 1ZXIA 2GLSA 1T6BX 3KYDD 3P4RB 4XE0A 4PS8A 3SR6A 2IPKD 4JLCA 3CSTA 3DQVA 3B0AA 2K6DB 1BT0A 1JWSD 2LEKA 2INNE 4KZ0A 3RYTA 2H88B 3N20C 3ZTDA 4BOSC 4NJCA 2ACZB 2QDFA 1UZXB 1YX6B 1OEYJ 4MELA 4AWJA 3ZJVA 1IBXB 1EWCA 2G1EA 4GSWA 2HE7A 2RDHA 3ZTCA 2KWUB 2BWES 3AU4A 5DPSA 4AUQC 3NVVA 1WXQA 3QCAA 2K5PA 3M95A 1V1OA 3NS8A 3AE2B 3RMKC 2WX0A 3U7DA 3DBRI 1XXGA 3FILA 3NS1A 2LGXA 1XLQA 2BPSA 3QARA 3MC0B 2I1JA 3A9JA 4PYUA 3QX1A 1UWMA 4HPMB 2KTFA 3O65B 2ZW1A 2LGIA 2K6QA 4RGOS 1NDDA 1DOIA 1A70A 5EE3A 3RZFA 2DENB 2KX0A 1IP9A 2BB5A 2NBVB 3AXCA 2CU3A 1E6EB 1E8XA 4ZRQA 3M62B 3KUCB 3L16A 5D6JB 3K9OB 2W3RA 4HKZE 1J7CA 4RF0A 2ZNVB 1VZ8A 1FFUA 4ZOHC 4WWPA 2D3BA 2NPTB 2K8HA 2GMIC 1F77A 3VR8B 5EE1A 3ZO5B 1XT9B 4BVUC 2HTHA 4WWNA 1KM7A 4HXDA 3C0RB 3T8MA 2LHDA 2OEDA 1GOZA 1V2YA 1IGDA 1FO4A 4NJ6A 2J0JA 2FBWB 2KAJA 3QWZB 4RM9A 5C23A 3BZDB 5C3JB 4K7SA 3LYYA 2IGHA 3KVFB 2WS3B 3N30A 3Q8CA 2J7QB 4O1NA 1ZUD2 1P1AA 1E8ZA 2QMTA 1TZOA 3NZSA 1VLBA 2KT7A 4ICUA 2XK5A 3PHXB 4JQWC 2KVZA 3V60A 3GS2A 1CZPA 3Q14C 2QEJC 5C2TB 3GB1A 1N62A 3QK0A 3Q8BA 4OVZA 4ANWA 1HZ6A 3OJ4B 4YT0B 2O6VB 1V9JA 2D3GA 2IZVB 2MBQA 2MX2A 3ZNHB 1K50A 3AEEB 2V3NA 1V49A 2KOXA 2MA9B 1C4CA 1ZP0B 4W9EA 4LDTB 2EMTA 1QT9A 3TBLD 1TJEA 4RF1A 4RNAA 4N59A 1VZ6A 5E6OA 3AE1B 3DDCB 2L00B 2IO0B 1WX8A 1I35A 3H9DA 1OQQA 2KQ4X 2LGYA 1GB4A 2WXPA 1WZ3A 3PO0A 3MHSD 2WXIA 3R3MA 3QAQA 3ML8A 2Y5PA 1FXIA 1KLGD 4K81A 1BMLC 2KMCA 2OJWA 1WM2A 4WJQA 1FXAA 2Z0DB 3O13A 5G5HA 3VRBB 2JZZA 1Q10A 3A9KB 3U52E 2NR2A 4ANVA 5D3DA 3VAWA 1RM6C 3RCZA 1YQ4B 4PS7A 4BKSA 1SIFA 2WXGA 1FD6A 1XD3B 2R2QA 4JX1C 1ISNA 2W3SA 1CMXB 1OEYA 3PHWB 4G0NB 1SEBD 5HKHA 1X1MA 3V6CB 2O2VB 3ZNGC 4NAMA 5IA7A 1XEEA 3B2GA 1KH0A 2JXXA 2O2VA 1D4BA 1MHXA 4MGKE 4A20A 4OVUA 4PS3A 1RFKA 2WXNA 3SFDB 5CHFA 1JCKB 2JVCA 3UQBA 1V8CA 2CJNA 3WA0A 4C80A 1UF0A 3X0WA 1DOXA 2W82A 3E9SA 4HDQA 2XBBC 4ACFA 3AE8B 4B0EA 2BVCA 5G55A 3AEAB 5D2MB 1J8CA 2RD0A 1ZXHA 2IYDB 2LJ5A 1LFDA 1QOBA 3BIID 4IDIA 4QAYA 3BK2A 2G9HD 3CWIA 1EU4A 1WH3A 2J53A 1I4QA 2SAKA 1YJIA 1WWTA 1D5MC 4A8XC 1JRUA 1J19A 4IM2A 1ESFA 4MDKE 2V4LA 3P1MA 2N7DA 1P98A 4IG7B 2BTEA 4BFRA 5AEKB 3VRAB 2N7JA 3B1LX 3HVDA 4DHZB 4GB9A 4HCPB 3GOEA 1FNWA 3EFCA 1HA5A 2MW5A 3ALBA 3JW0X 1SGHA 1WMHB 4NZLB 4EZLA 2K22A 3KH0A 3VDZA 1FXTB 1F1HA 4IWQA 3RZWC 2IY0B 4C7YA 1SBBB 3U8ZA 4Q2JA 3ZDTA 1VCBA 4LCDE 3BYTB 1J7AA 4AOFA 4DDID 2WXFA 3RI7C 3N1YC 3K9PB 2MH7A 3MC8A 3VFKA 1R7SA 1KFYB 4WAAA 2L0FA 1NENB 2BT6A 3OWEB 1TBEA 4DBGA 2BS3B 1XF5L 2PMVA 3VTUA 4BAXA 3DBSA 2H89B 2EMSA 3RNAC 1JWAD 1L6UA 2QCZA 3L54A 2L05A 1TY0A 2CU1A 3V62A 2M56B 2V0GA 4J6IA 2Q5WD 1OFFA 2IJ0A 1I4GA 3NVWA 2WXKA 3NZ3A 2HJ8A 4E3CA 4PT5A 1K53A 4URKA 2DYBA 4ASWC 2WXHA 3KUDB 1PUTA 4WJPA 2BBCA 1WGKA 2JX5A 4II3B 2PTLA 4LTUA 2RDGA 2ON8A 2WXOA 3Q6BA 4W9JA 1KF6B 2GRIA 3JSVB 3N3KB 3WAMA 1FIQA 4MH8A 4XDDA 3MC9A 2ZW0A 4FHKA 3AMZA 1KTKA 1STEA 2KFKA 4W9DA 2MQJA 1ZOYB 2WXLA 1J7BA 1HXYD 4AS1A 2LJIA 3W1SC 1RLFA 1WJUA 1T0QC 3P4QB 1N5WA 2JRHA 4KDIC 1RYJA 4W9FA 4MJSB 3PTFC 3RNCC 3AV8A 5E6NA 2KDFB 3ZNID 1OGWA 3VQIA 1XLPA 4KX6B 2JY6A 2M4NA 4LNIA 2JWZA 1ZPSA 4ANXA 4HWIB 1E7PB 3PGEA 3BINA 1L6VA 2Z8LA 2KC1A 4WURA 3VHTC 1R4NB 5JZEB 4US9A 2IO2B 4MT5A 2FE8A 4JWSC 4ARCA 4LNOA 1UBQA 1BUIC 3I63C 4FJYA 1M94A 4RGNA 4GU2A 4MGZE 4OZBA 2YLMA 1H4RA 1WRIA 4M02A 1YD8U 3HK0A 1I4HA 5HFYA 3UQAA
chains in the Genus database with same CATH topology
2N1WA 2CR5A 3K9OB 2C7HA 1S1QB 1YX5B 1NBFC 2IO1B 2KTRA 2ZJDA 1WGHA 4B9KA 2ZNVB 4MGYE 5D94A 2K8CA 3A1QB 2BYFA 4TV3A 5KHQA 4WWPA 3DVGY 3W1YA 1WE7A 3CMMB 3PSEB 1F9JA 1YQBA 3T9LA 2NPTB 1GC6A 2K8HA 4GDLB 2GMIC 3ZO5B 2WDTB 1XT9B 1V81A 2KWCA 4BVUC 2HTHA 2DZIA 1K8RB 2KDIA 3HM3A 4TUUA 1P0RA 1UELA 4WWNA 3RULA 1KM7A 4BKGA 4DWFA 4ZDVA 4HXDA 3C0RB 3T8MA 2KNBA 1HE8A 4NPNA 1WE6A 4FJZA 2YVCA 2IO3B 2MP2B 1V2YA 3A33B 1WI0A 4NJ6A 2J0JA 3UF8A 3PS6A 1I42A 2LD9A 3QWZB 4RM9A 2KLCA 4I6NB 2AL3A 2LASA 2WYQA 5C23A 2RPQA 4K7SA 2KANA 5IAAC 2B3AA 2G4DB 2MP2A 1V5OA 2K39A 4E74A 3VH4B 3APFA 3QA8A 4NNJB 3A4RA 2KK8A 2WX1A 3ZRFA 4BBNC 3KVFB 4AJYB 4I6PA 1WY8A 2KDBA 4NAWA 5EDSA 3ZNZB 1ZKHA 3N30A 3W1SA 2KHWB 4GIVA 2J7QB 3ZLZA 2FIFA 3HIZA 2MCNB 2BWFA 1A5RA 2LWPA 3PRPB 1IPGA 1P1AA 1E8ZA 3NZSA 3SU8X 3ZIMA 2MBEA 2EKEC 4ICUA 4W9KA 2XK5A 3PHXB 4JQWC 2G4SA 3L08A 3V60A 4ZYNA 3ZW3A 1RFAA 1WR1A 4K7WA 2MBOA 3UIOB 4A3PA 3QK0A 5JHAA 3AI5A 3S2AA 2JRIB 3DCGA 2UWQA 3QC8B 4ANWA 3OJ4B 4W9IA 4LDTD 1TTNA 2JZ3B 1EF1A 1WJNA 1V9JA 2O6VB 2D3GA 2IZVB 2MBQA 3VXWA 3Q3FA 1WGDA 2FAZA 2AL6A 2MX2A 2N7EA 4KDLB 3ZNHB 2CHWA 3X23A 1V49A 3KW5B 2KOXA 2CS4A 3PLUA 5DCNA 2ZPYA 3IHPC 2A4ZA 4KIKB 2MA9B 4P7IA 1AARA 4NY0A 4MSMB 5CHVC 3EECA 1EF5A 1S3SG 3DVGX 2DZKA 3NZUA 3DVNU 1E7VA 4W9EA 1GUAB 4II2B 4RM8A 3RD2A 3H7SA 4LDTB 4WWOA 4EZKA 1P3QU 2EMTA 1YJ1A 3TBLD 3QHTA 2L3ZA 2GBRA 2C7NB 4LJOB 5GMVA 1WIAA 3AULA 2R2OA 2BYEA 3M3JA 3D32A 4FJVB 3A9JB 4HJKA 2G3QB 5E6OA 3DDCB 1YIWA 1LXDA 2L00B 4G3XB 2NVUI 3UINB 2IO0B 1WX8A 3OJ3A 4CYEA 1I35A 3PV1A 3H9DA 4IW0A 4OVVA 3H7PB 2NCNA 5L83A 2XEWA 1Z5SB 2KD0A 3MTNB 2KX3A 2LGYA 4I6LB 3H7PA 5J18A 1WZ3A 4NAWB 3VUWA 2ZCCA 4MSQB 3JYUA 2MBHA 3QJZA 1E90A 3MHSD 3R3MA 3Q3JA 1WXSA 1SE9A 4WQOB 3EC8A 3QAQA 2CHZA 2DZJA 4HCNB 3TL5A 4B6WA 4YL8A 1EUVB 2FCQA 3ML8A 4ANUA 4DXAB 1TZ1A 1WX9A 4ICVA 4FHJA 1WRDB 2IBIB 4K81A 2KMCA 1WM2A 4HK2A 4WJQA 2Z0DB 4TQ1A 1L7YA 2JZZA 3A9KB 4ANVA 2NR2A 4ZRJA 2RGFA 2BF8B 2DYOA 3VAWA 3RCZA 2Z0EB 3DBHI 1ZGUB 3ENEA 1Y8RC 4XZ4A 4XC2A 3IVFA 4PS7A 3UGBB 4BKSA 3KYCD 4EEWA 1SIFA 2KVRA 4KSLC 4GXBA 2GBKA 1XD3B 3R66C 2R2QA 4HVBA 1J0GA 1ISNA 1WXAA 2NBWB 4JL9A 3M63B 1CMXB 1OEYA 1TGZB 3PHWB 4G0NB 1IYFA 5HKHA 1Q0WB 1X1MA 3SDLC 1WYWB 3V6CB 2C5LC 2LVQA 2O2VB 2PEAA 4PYZA 2AWTA 2KFKB 3ZNGC 3DBLI 3SHQA 3V6EB 4AP4C 5D7GA 5DPTA 2KTRB 4BOZB 4WJNA 5IA7A 1KOTA 2W9NA 3HM6X 2J0KA 5JH5C 2JXXA 3NY5A 2ZCBA 2FCNA 2O2VA 2C9WB 2ZZPB 2MBBB 4MGKE 1V86A 3VTVA 4A20A 4OVUA 4PS3A 4ZRKA 2L8JA 2N9PC 3H6NA 1UBIA 2DAJA 4FN2A 1WGRA 4GDLA 3QIJA 5CHFA 3PLVA 5KHOA 3VTWA 2JVCA 3UQBA 3B08A 2DAFA 3ZDMC 1RAXA 2PJHA 3WA0A 3QQ8B 4KSKC 3I3TB 3X0WA 1WZ0A 4IWPA 4EZJA 2LRUA 1GC7A 1E8WA 4HDQA 3ZRCA 2KN5A 2XBBC 1E8YA 1WFYA 2JPHA 2OJRA 3R7RA 4GDKB 2A5UA 3IBEA 4X57B 4FADA 2FCSA 1LQBA 5G55A 3ECIA 5G2NA 3U30A 5D2MB 1J8CA 2N9EB 2RD0A 3TMPB 3AU5A 4CHKA 2DHZA 2IYDB 2LJ5A 1V6EA 1LFDA 2HD5B 3LJ3A 4N9F4 4TKNA 3VVWB 1KLVA 3L0WB 3PRMB 1WH3A 2N4FA 1UD7A 2UYZB 4IC7B 4E71A 2M8SA 2OOBB 4W9HA 1JRUA 5LLIA 2FCMA 4CO7A 4HLEA 1J19A 2C7MB 2K1FA 4IM2A 3TCAA 3WALA 4EFOA 4MDKE 4ZRIA 2LRWA 3PRZA 2V4LA 4KV2A 2N7DA 2L0TA 2RSUA 2NS5A 1P98A 4IG7B 1WJ6A 2D10A 2J0MA 2PE9A 2ZNVC 5J2RA 4KZCA 3N32A 3TJPA 3WAOA 4BFRA 4DDGD 5AEKB 4FLHA 5CTRC 5AZGA 2C60A 3TIXA 3A9KA 2CKHB 1EO6A 3B1LX 4DHZB 4GB9A 4IM0A 4HCPB 4DHJD 2KXJA 3GOEA 2ZVOA 3CSFA 3WIMA 2M1MA 1WGGA 2DX5B 2MW5A 3ZUNA 1GNUA 2K8BA 2KLGA 5J17A 3ONSA 5LXIB 3ALBA 3JW0X 3PZDA 4FBJB 3APDA 5AZFA 1SGHA 3V61A 1WMHB 4IM3A 1Q5WB 4EZLA 1V5TA 4W9CA 2GBMA 2L7RA 2BKFA 3KH0A 1P9DU 3VDZA 1FXTB 5LXHA 4IWQA 2AEHA 4MGIE 4EUTA 3ML9A 3RZWC 4EKUA 2IY0B 4MJSA 1V80A 3RUIB 3IG3A 2D11A 3U8ZA 5E6PA 3MJWA 3WAPA 4M0WB 2BGFA 4F1SA 1T0YA 3PT2B 1VCBA 3ZDTA 2K25A 2KJHB 4LCDE 2LZ6A 4AJWA 1G6JA 1OTRB 3R7QA 4JGHB 4GMVA 4BBNF 2JF5A 4AOFA 4IWOA 4DDID 3APCA 3DVNV 2KMAA 3K9PB 1VD2A 2LVPA 1MG8A 3DPDA 5CX3A 3VFKA 3JVZX 2KO3A 2N1VA 2NBUA 3NOBA 4NQKE 4WAAA 4DHJB 4NQLB 3OAWA 2GOWA 2JUOA 3A4SC 2QHOA 1C1YB 2L0FA 3DOWA 4NJ7A 2GBNA 3L17A 4BKTA 2PPHA 4DBGA 1TBEA 2IY1B 3VTUA 3DBSA 3OLMD 2D2QA 2EMSA 2MSED 2WWZA 2DYMA 3WANA 4B95A 1Q1OA 4W9LA 2LUEA 1GJZA 4MM3A 4A3OA 1KJTA 3L54A 2L05A 4W9GA 5L95C 2CU1A 2CHXA 3V62A 2XK5B 4FULA 4J6IA 1OQYA 3GZNI 3LDZE 2JT4B 1GG3A 2RR9A 2LVOA 2ZVNA 1WMHA 5TR5A 2KFJA 3RT3B 2HJ8A 1R4MI 4E3CA 2LI5A 2MRPA 4DHZE 4FA6A 4K7UA 4URKA 5CHWA 2DYBA 2LGDA 3KYDD 2Z59B 2KQ7A 2AYOB 4ASWC 3KUDB 3SD5A 3VUXA 4JIOU 2L76A 2LXAA 4PS8A 1UH6A 4WJPA 4JLCA 5DPWA 3CSTA 3DQVA 4HDOA 3L13A 4II3B 2V3SA 4GGQA 2KDEB 1WGYA 3B0AA 3UIPB 2K6DB 5C1ZA 2KJRA 2NPTA 1UGMA 3P2BA 2PE6B 3ZVVA 4M8NA 4W9JA 1BT0A 1WJ4A 3H1UA 3JSVB 3N3KB 3WAMA 1H8CA 4KZ0A 5DPRA 3RYTA 4KIKA 3IFWB 3ZTDA 4BOSC 1PQSA 1R4NI 2I1KA 1WXMA 2LXCA 2MWSB 3VH3B 1UZXB 1WR6E 1YX6B 1OEYJ 1QZEA 3JSVA 4FHKA 2G45B 4MELA 5BO4B 4AWJA 2BKRB 1ZW7A 2KFKA 4W9DA 4G11A 2MQJA 4WJOA 3ZKJC 4GN1A 3A1QA 4MH0E 4GSWA 1E7UA 2HE7A 5D6JB 4GDKA 1Z2MA 3ZTCA 2KWUB 2KJ6A 3W1SC 1NI2A 1RLFA 2BWES 3AU4A 5DPSA 2DZMA 1WJUA 4F7ZA 4AUQC 5FR6A 2JRHA 4GOCA 4KDIC 3BY4B 4W9FA 3VUYA 4MJSB 4LJPB 1WM3A 3PTFC 2FUHB 3QCAA 3NHEB 4BKSD 3M95A 4M8MA 3NS8A 3PVLA 2WX0A 2KDFB 5E6NA 3ZNID 3U7DA 2ASQA 3DBRI 1OGWA 4K1RB 2VRRB 3VQIA 2REXA 2KZRA 2D07B 3CF6E 3L10B 2LGXA 4G50A 2Y5BB 2JY6A 1LM8B 2M4NA 2BPSA 2JWZA 3PREA 3QARA 3KUZA 1WX7A 2I1JA 3A9JA 3EFUA 2MLBA 2V1YA 4PYUA 4ANXA 1WXVA 4HWIB 1U4AA 4IUMB 1C3TA 4TQ0A 2GBJA 3PGEA 3QX1A 2ZPNA 3BINA 4DK5A 4HPMB 2KC1A 3VHTC 2KKCA 1RRBA 2KTFA 5JZEB 3O65B 2IO2B 2K6QA 2O6VD 2KWVB 1NDDA 4F8CB 2KC2A 1UBQA 4RMAA 1E5WA 3PPAA 1L2NA 4MEMA 2ZEQA 3HHMA 1XQQA 3EHVA 4FJYA 1M94A 5JHBA 4HPLB 1WF9A 2M0XA 4XX5A 4GU2A 4MGZE 3RZFA 2DENB 2YLMA 1H4RA 2KX0A 1IP9A 2M17A 2N9XA 2NBVB 2O6VA 1YD8U 3AXCA 1D3ZA 2KQSA 1E8XA 4EOYA 3HK0A 3M62B 5AZHA 3KUCB 2FIDA 2FNJB 3UQAA 3L16A 4KVGB 2BYVE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1W A;  2CR5 A;  3K9O B;  2C7H A;  1S1Q B;  1YX5 B;  1NBF C;  2IO1 B;  2KTR A;  2ZJD A;  1WGH A;  4B9K A;  2ZNV B;  4MGY E;  5D94 A;  2K8C A;  3A1Q B;  2BYF A;  4TV3 A;  5KHQ A;  4WWP A;  3DVG Y;  3W1Y A;  1WE7 A;  3CMM B;  3PSE B;  1F9J A;  1YQB A;  3T9L A;  2NPT B;  1GC6 A;  2K8H A;  4GDL B;  2GMI C;  3ZO5 B;  2WDT B;  1XT9 B;  1V81 A;  2KWC A;  4BVU C;  2HTH A;  2DZI A;  1K8R B;  2KDI A;  3HM3 A;  4TUU A;  1P0R A;  1UEL A;  4WWN A;  3RUL A;  1KM7 A;  4BKG A;  4DWF A;  4ZDV A;  4HXD A;  3C0R B;  3T8M A;  2KNB A;  1HE8 A;  4NPN A;  1WE6 A;  4FJZ A;  2YVC A;  2IO3 B;  2MP2 B;  1V2Y A;  3A33 B;  1WI0 A;  4NJ6 A;  2J0J A;  3UF8 A;  3PS6 A;  1I42 A;  2LD9 A;  3QWZ B;  4RM9 A;  2KLC A;  4I6N B;  2AL3 A;  2LAS A;  2WYQ A;  5C23 A;  2RPQ A;  4K7S A;  2KAN A;  5IAA C;  2B3A A;  2G4D B;  2MP2 A;  1V5O A;  2K39 A;  4E74 A;  3VH4 B;  3APF A;  3QA8 A;  4NNJ B;  3A4R A;  2KK8 A;  2WX1 A;  3ZRF A;  4BBN C;  3KVF B;  4AJY B;  4I6P A;  1WY8 A;  2KDB A;  4NAW A;  5EDS A;  3ZNZ B;  1ZKH A;  3N30 A;  3W1S A;  2KHW B;  4GIV A;  2J7Q B;  3ZLZ A;  2FIF A;  3HIZ A;  2MCN B;  2BWF A;  1A5R A;  2LWP A;  3PRP B;  1IPG A;  1P1A A;  1E8Z A;  3NZS A;  3SU8 X;  3ZIM A;  2MBE A;  2EKE C;  4ICU A;  4W9K A;  2XK5 A;  3PHX B;  4JQW C;  2G4S A;  3L08 A;  3V60 A;  4ZYN A;  3ZW3 A;  1RFA A;  1WR1 A;  4K7W A;  2MBO A;  3UIO B;  4A3P A;  3QK0 A;  5JHA A;  3AI5 A;  3S2A A;  2JRI B;  3DCG A;  2UWQ A;  3QC8 B;  4ANW A;  3OJ4 B;  4W9I A;  4LDT D;  1TTN A;  2JZ3 B;  1EF1 A;  1WJN A;  1V9J A;  2O6V B;  2D3G A;  2IZV B;  2MBQ A;  3VXW A;  3Q3F A;  1WGD A;  2FAZ A;  2AL6 A;  2MX2 A;  2N7E A;  4KDL B;  3ZNH B;  2CHW A;  3X23 A;  1V49 A;  3KW5 B;  2KOX A;  2CS4 A;  3PLU A;  5DCN A;  2ZPY A;  3IHP C;  2A4Z A;  4KIK B;  2MA9 B;  4P7I A;  1AAR A;  4NY0 A;  4MSM B;  5CHV C;  3EEC A;  1EF5 A;  1S3S G;  3DVG X;  2DZK A;  3NZU A;  3DVN U;  1E7V A;  4W9E A;  1GUA B;  4II2 B;  4RM8 A;  3RD2 A;  3H7S A;  4LDT B;  4WWO A;  4EZK A;  1P3Q U;  2EMT A;  1YJ1 A;  3TBL D;  3QHT A;  2L3Z A;  2GBR A;  2C7N B;  4LJO B;  5GMV A;  1WIA A;  3AUL A;  2R2O A;  2BYE A;  3M3J A;  3D32 A;  4FJV B;  3A9J B;  4HJK A;  2G3Q B;  5E6O A;  3DDC B;  1YIW A;  1LXD A;  2L00 B;  4G3X B;  2NVU I;  3UIN B;  2IO0 B;  1WX8 A;  3OJ3 A;  4CYE A;  1I35 A;  3PV1 A;  3H9D A;  4IW0 A;  4OVV A;  3H7P B;  2NCN A;  5L83 A;  2XEW A;  1Z5S B;  2KD0 A;  3MTN B;  2KX3 A;  2LGY A;  4I6L B;  3H7P A;  5J18 A;  1WZ3 A;  4NAW B;  3VUW A;  2ZCC A;  4MSQ B;  3JYU A;  2MBH A;  3QJZ A;  1E90 A;  3MHS D;  3R3M A;  3Q3J A;  1WXS A;  1SE9 A;  4WQO B;  3EC8 A;  3QAQ A;  2CHZ A;  2DZJ A;  4HCN B;  3TL5 A;  4B6W A;  4YL8 A;  1EUV B;  2FCQ A;  3ML8 A;  4ANU A;  4DXA B;  1TZ1 A;  1WX9 A;  4ICV A;  4FHJ A;  1WRD B;  2IBI B;  4K81 A;  2KMC A;  1WM2 A;  4HK2 A;  4WJQ A;  2Z0D B;  4TQ1 A;  1L7Y A;  2JZZ A;  3A9K B;  4ANV A;  2NR2 A;  4ZRJ A;  2RGF A;  2BF8 B;  2DYO A;  3VAW A;  3RCZ A;  2Z0E B;  3DBH I;  1ZGU B;  3ENE A;  1Y8R C;  4XZ4 A;  4XC2 A;  3IVF A;  4PS7 A;  3UGB B;  4BKS A;  3KYC D;  4EEW A;  1SIF A;  2KVR A;  4KSL C;  4GXB A;  2GBK A;  1XD3 B;  3R66 C;  2R2Q A;  4HVB A;  1J0G A;  1ISN A;  1WXA A;  2NBW B;  4JL9 A;  3M63 B;  1CMX B;  1OEY A;  1TGZ B;  3PHW B;  4G0N B;  1IYF A;  5HKH A;  1Q0W B;  1X1M A;  3SDL C;  1WYW B;  3V6C B;  2C5L C;  2LVQ A;  2O2V B;  2PEA A;  4PYZ A;  2AWT A;  2KFK B;  3ZNG C;  3DBL I;  3SHQ A;  3V6E B;  4AP4 C;  5D7G A;  5DPT A;  2KTR B;  4BOZ B;  4WJN A;  5IA7 A;  1KOT A;  2W9N A;  3HM6 X;  2J0K A;  5JH5 C;  2JXX A;  3NY5 A;  2ZCB A;  2FCN A;  2O2V A;  2C9W B;  2ZZP B;  2MBB B;  4MGK E;  1V86 A;  3VTV A;  4A20 A;  4OVU A;  4PS3 A;  4ZRK A;  2L8J A;  2N9P C;  3H6N A;  1UBI A;  2DAJ A;  4FN2 A;  1WGR A;  4GDL A;  3QIJ A;  5CHF A;  3PLV A;  5KHO A;  3VTW A;  2JVC A;  3UQB A;  3B08 A;  2DAF A;  3ZDM C;  1RAX A;  2PJH A;  3WA0 A;  3QQ8 B;  4KSK C;  3I3T B;  3X0W A;  1WZ0 A;  4IWP A;  4EZJ A;  2LRU A;  1GC7 A;  1E8W A;  4HDQ A;  3ZRC A;  2KN5 A;  2XBB C;  1E8Y A;  1WFY A;  2JPH A;  2OJR A;  3R7R A;  4GDK B;  2A5U A;  3IBE A;  4X57 B;  4FAD A;  2FCS A;  1LQB A;  5G55 A;  3ECI A;  5G2N A;  3U30 A;  5D2M B;  1J8C A;  2N9E B;  2RD0 A;  3TMP B;  3AU5 A;  4CHK A;  2DHZ A;  2IYD B;  2LJ5 A;  1V6E A;  1LFD A;  2HD5 B;  3LJ3 A;  4N9F 4;  4TKN A;  3VVW B;  1KLV A;  3L0W B;  3PRM B;  1WH3 A;  2N4F A;  1UD7 A;  2UYZ B;  4IC7 B;  4E71 A;  2M8S A;  2OOB B;  4W9H A;  1JRU A;  5LLI A;  2FCM A;  4CO7 A;  4HLE A;  1J19 A;  2C7M B;  2K1F A;  4IM2 A;  3TCA A;  3WAL A;  4EFO A;  4MDK E;  4ZRI A;  2LRW A;  3PRZ A;  2V4L A;  4KV2 A;  2N7D A;  2L0T A;  2RSU A;  2NS5 A;  1P98 A;  4IG7 B;  1WJ6 A;  2D10 A;  2J0M A;  2PE9 A;  2ZNV C;  5J2R A;  4KZC A;  3N32 A;  3TJP A;  3WAO A;  4BFR A;  4DDG D;  5AEK B;  4FLH A;  5CTR C;  5AZG A;  2C60 A;  3TIX A;  3A9K A;  2CKH B;  1EO6 A;  3B1L X;  4DHZ B;  4GB9 A;  4IM0 A;  4HCP B;  4DHJ D;  2KXJ A;  3GOE A;  2ZVO A;  3CSF A;  3WIM A;  2M1M A;  1WGG A;  2DX5 B;  2MW5 A;  3ZUN A;  1GNU A;  2K8B A;  2KLG A;  5J17 A;  3ONS A;  5LXI B;  3ALB A;  3JW0 X;  3PZD A;  4FBJ B;  3APD A;  5AZF A;  1SGH A;  3V61 A;  1WMH B;  4IM3 A;  1Q5W B;  4EZL A;  1V5T A;  4W9C A;  2GBM A;  2L7R A;  2BKF A;  3KH0 A;  1P9D U;  3VDZ A;  1FXT B;  5LXH A;  4IWQ A;  2AEH A;  4MGI E;  4EUT A;  3ML9 A;  3RZW C;  4EKU A;  2IY0 B;  4MJS A;  1V80 A;  3RUI B;  3IG3 A;  2D11 A;  3U8Z A;  5E6P A;  3MJW A;  3WAP A;  4M0W B;  2BGF A;  4F1S A;  1T0Y A;  3PT2 B;  1VCB A;  3ZDT A;  2K25 A;  2KJH B;  4LCD E;  2LZ6 A;  4AJW A;  1G6J A;  1OTR B;  3R7Q A;  4JGH B;  4GMV A;  4BBN F;  2JF5 A;  4AOF A;  4IWO A;  4DDI D;  3APC A;  3DVN V;  2KMA A;  3K9P B;  1VD2 A;  2LVP A;  1MG8 A;  3DPD A;  5CX3 A;  3VFK A;  3JVZ X;  2KO3 A;  2N1V A;  2NBU A;  3NOB A;  4NQK E;  4WAA A;  4DHJ B;  4NQL B;  3OAW A;  2GOW A;  2JUO A;  3A4S C;  2QHO A;  1C1Y B;  2L0F A;  3DOW A;  4NJ7 A;  2GBN A;  3L17 A;  4BKT A;  2PPH A;  4DBG A;  1TBE A;  2IY1 B;  3VTU A;  3DBS A;  3OLM D;  2D2Q A;  2EMS A;  2MSE D;  2WWZ A;  2DYM A;  3WAN A;  4B95 A;  1Q1O A;  4W9L A;  2LUE A;  1GJZ A;  4MM3 A;  4A3O A;  1KJT A;  3L54 A;  2L05 A;  4W9G A;  5L95 C;  2CU1 A;  2CHX A;  3V62 A;  2XK5 B;  4FUL A;  4J6I A;  1OQY A;  3GZN I;  3LDZ E;  2JT4 B;  1GG3 A;  2RR9 A;  2LVO A;  2ZVN A;  1WMH A;  5TR5 A;  2KFJ A;  3RT3 B;  2HJ8 A;  1R4M I;  4E3C A;  2LI5 A;  2MRP A;  4DHZ E;  4FA6 A;  4K7U A;  4URK A;  5CHW A;  2DYB A;  2LGD A;  3KYD D;  2Z59 B;  2KQ7 A;  2AYO B;  4ASW C;  3KUD B;  3SD5 A;  3VUX A;  4JIO U;  2L76 A;  2LXA A;  4PS8 A;  1UH6 A;  4WJP A;  4JLC A;  5DPW A;  3CST A;  3DQV A;  4HDO A;  3L13 A;  4II3 B;  2V3S A;  4GGQ A;  2KDE B;  1WGY A;  3B0A A;  3UIP B;  2K6D B;  5C1Z A;  2KJR A;  2NPT A;  1UGM A;  3P2B A;  2PE6 B;  3ZVV A;  4M8N A;  4W9J A;  1BT0 A;  1WJ4 A;  3H1U A;  3JSV B;  3N3K B;  3WAM A;  1H8C A;  4KZ0 A;  5DPR A;  3RYT A;  4KIK A;  3IFW B;  3ZTD A;  4BOS C;  1PQS A;  1R4N I;  2I1K A;  1WXM A;  2LXC A;  2MWS B;  3VH3 B;  1UZX B;  1WR6 E;  1YX6 B;  1OEY J;  1QZE A;  3JSV A;  4FHK A;  2G45 B;  4MEL A;  5BO4 B;  4AWJ A;  2BKR B;  1ZW7 A;  2KFK A;  4W9D A;  4G11 A;  2MQJ A;  4WJO A;  3ZKJ C;  4GN1 A;  3A1Q A;  4MH0 E;  4GSW A;  1E7U A;  2HE7 A;  5D6J B;  4GDK A;  1Z2M A;  3ZTC A;  2KWU B;  2KJ6 A;  3W1S C;  1NI2 A;  1RLF A;  2BWE S;  3AU4 A;  5DPS A;  2DZM A;  1WJU A;  4F7Z A;  4AUQ C;  5FR6 A;  2JRH A;  4GOC A;  4KDI C;  3BY4 B;  4W9F A;  3VUY A;  4MJS B;  4LJP B;  1WM3 A;  3PTF C;  2FUH B;  3QCA A;  3NHE B;  4BKS D;  3M95 A;  4M8M A;  3NS8 A;  3PVL A;  2WX0 A;  2KDF B;  5E6N A;  3ZNI D;  3U7D A;  2ASQ A;  3DBR I;  1OGW A;  4K1R B;  2VRR B;  3VQI A;  2REX A;  2KZR A;  2D07 B;  3CF6 E;  3L10 B;  2LGX A;  4G50 A;  2Y5B B;  2JY6 A;  1LM8 B;  2M4N A;  2BPS A;  2JWZ A;  3PRE A;  3QAR A;  3KUZ A;  1WX7 A;  2I1J A;  3A9J A;  3EFU A;  2MLB A;  2V1Y A;  4PYU A;  4ANX A;  1WXV A;  4HWI B;  1U4A A;  4IUM B;  1C3T A;  4TQ0 A;  2GBJ A;  3PGE A;  3QX1 A;  2ZPN A;  3BIN A;  4DK5 A;  4HPM B;  2KC1 A;  3VHT C;  2KKC A;  1RRB A;  2KTF A;  5JZE B;  3O65 B;  2IO2 B;  2K6Q A;  2O6V D;  2KWV B;  1NDD A;  4F8C B;  2KC2 A;  1UBQ A;  4RMA A;  1E5W A;  3PPA A;  1L2N A;  4MEM A;  2ZEQ A;  3HHM A;  1XQQ A;  3EHV A;  4FJY A;  1M94 A;  5JHB A;  4HPL B;  1WF9 A;  2M0X A;  4XX5 A;  4GU2 A;  4MGZ E;  3RZF A;  2DEN B;  2YLM A;  1H4R A;  2KX0 A;  1IP9 A;  2M17 A;  2N9X A;  2NBV B;  2O6V A;  1YD8 U;  3AXC A;  1D3Z A;  2KQS A;  1E8X A;  4EOY A;  3HK0 A;  3M62 B;  5AZH A;  3KUC B;  2FID A;  2FNJ B;  3UQA A;  3L16 A;  4KVG B;  2BYV E; 
#chains in the Genus database with same CATH topology
 3EUB 2;  2C7H A;  1NBF C;  2ZJD A;  1R4M B;  4MGY E;  2K8C A;  3WCQ A;  3DVG Y;  3W1Y A;  4L23 A;  2KMM A;  3HRD D;  3HVZ A;  1GC6 A;  4GDL B;  2WDT B;  5I4D A;  2DZI A;  1P0R A;  4BKG A;  2I2Y A;  5LNK 1;  1YJJ A;  3AE4 B;  2N9K A;  2YVC A;  4TSS A;  1T5X D;  3IAS 1;  1XCQ L;  3A33 B;  1WI0 A;  1DOY A;  1K51 A;  4WAF A;  3UF8 A;  3PS6 A;  2WYQ A;  2LAS A;  2KAN A;  2K39 A;  4E74 A;  1C4A A;  3NUH B;  1FNU A;  2JU6 X;  2HTM E;  4K3B A;  1WY8 A;  3IT4 B;  2KDB A;  4M01 A;  3ZNZ B;  3W1S A;  4S17 A;  1PDX A;  2BWF A;  3PRP B;  1YN3 A;  3C8Y A;  3SU8 X;  4P1C C;  3ZIM A;  2MBE A;  2EKE C;  2G4S A;  2LUM A;  2KN4 A;  4ZYN A;  3ZW3 A;  4A55 A;  2PW9 A;  1WR1 A;  4C56 C;  5HG2 A;  3AI5 A;  4EE2 A;  3S2A A;  2JRI B;  3QC8 B;  2NTS A;  4LDT D;  1TTN A;  2JZ3 B;  1AN8 A;  4JWU C;  3Q3F A;  1WGD A;  4M0W A;  4KDL B;  4HPP A;  2CHW A;  3KW5 B;  2CS4 A;  2A4Z A;  1AAR A;  1S3S G;  3DVG X;  3DVN U;  1E7V A;  1GUA B;  2V3P A;  4EZK A;  4WWO A;  1YJ1 A;  2L3Z A;  3MHZ A;  4LJO B;  3URY A;  5GMV A;  3AUL A;  2JWU A;  2BYE A;  3M3J A;  4DXF A;  3A9J B;  3ZJT A;  1LXD A;  3OJ3 A;  5H8Y E;  2NCN A;  5HI1 A;  2K0P A;  3H7P A;  4NAW B;  3JYU A;  1E90 A;  4KKI A;  1WXS A;  4BZA A;  1SE9 A;  3EC8 A;  2YEP F;  2IGG A;  1EUV B;  1JRP A;  4ANU A;  1TZ1 A;  4FHJ A;  1WRD B;  3ZXV A;  2IBI B;  2BS2 B;  1VZ7 A;  1XCT L;  1L7Y A;  4WQM A;  2WGS A;  2DYO A;  1MHH E;  2WXQ A;  2Z0E B;  5EE0 A;  3ENE A;  4XZ4 A;  4XC2 A;  4EEW A;  2MEK A;  1AWD A;  2GBK A;  1ET9 A;  2NBW B;  1IGC A;  2QIL A;  3PZ8 A;  1JAL A;  3SDL C;  4PYZ A;  1VJK A;  3DBL I;  5D7G A;  3SFE B;  4BOZ B;  2W9N A;  3HM6 X;  2J0K A;  3NY5 A;  2C9W B;  1V86 A;  3Q69 A;  1IBX A;  2N9P C;  3H6N A;  1UBI A;  2SEB D;  3I57 A;  4GDL A;  3ZYY X;  3VTW A;  3PLV A;  1JW9 D;  1RAX A;  2PJH A;  3P42 A;  2DBY A;  3I3T B;  4USA A;  5IO9 A;  4IWP A;  4YSZ B;  4EZJ A;  3ZRC A;  2A5U A;  4X57 B;  2FCS A;  1LQB A;  2N9E B;  3AU5 A;  4CHK A;  1JWU D;  4KKJ A;  4N9F 4;  3LJ3 A;  3VVW B;  1KLV A;  3AE5 B;  3R8B A;  4ZYS A;  2MJD A;  3KQ4 A;  2WP9 B;  3ZGZ A;  4W9H A;  5LLI A;  2WLB A;  3TCA A;  3AB5 A;  3WAL A;  2NMQ A;  4ZRI A;  4OZC A;  2D10 A;  1I4P A;  2KYW A;  2PE9 A;  4KGT A;  4FLH A;  5CTR C;  1EO6 A;  4DHJ D;  1TS5 A;  3WIM A;  2M1M A;  1WGG A;  2K8B A;  4XGA B;  2LGS A;  1TS3 A;  3W5V B;  1QIL A;  1V5T A;  2GBM A;  2BKF A;  3NJT A;  3KWV A;  3DHI C;  5AUK A;  2AEH A;  1SE2 A;  3ML9 A;  4EUT A;  1XLN A;  4MJS A;  2QSD A;  1V80 A;  4GLS C;  1OQR A;  4WH4 A;  3RUI B;  3W5U B;  5E6P A;  1T0Y A;  3PT2 B;  1V97 A;  2K25 A;  2KJH B;  3R7Q A;  3AED B;  3GE3 C;  4JGH B;  4BBN F;  4IWO A;  1MG8 A;  5CX3 A;  2N1V A;  2NBU A;  3NRZ A;  4DHJ B;  3N1Z C;  3DOW A;  3L17 A;  2W54 A;  4K3C A;  2D2Q A;  2MSE D;  4B95 A;  1Q1O A;  5IOI A;  2LHE A;  1NI3 A;  4UDU C;  4A3O A;  2CHX A;  4KGR A;  2K9X A;  3RNG C;  1PGX A;  2AQ3 B;  1SB3 C;  3LDZ E;  2JT4 B;  3GZN B;  2RR9 A;  3Q8A A;  2ZVN A;  4LNK A;  5TR5 A;  4LK0 M;  4FXC A;  5EE9 A;  1XLO A;  3V05 A;  2DNF A;  1T0S C;  5CHW A;  3NG0 A;  3GE8 C;  2V4I B;  2AYO B;  3SD5 A;  3VUX A;  2L76 A;  3AN1 A;  5DPW A;  1QOG A;  4HDO A;  2KDE B;  1WGY A;  3UIP B;  5C1Z A;  2KJR A;  3TEZ A;  5IKC M;  1UGM A;  3ZVV A;  4M8N A;  2OHF A;  3H1U A;  2QJL A;  1YNT E;  2VH2 A;  1WXM A;  2MWS B;  1WR6 E;  1QZE A;  5BO4 B;  2W55 A;  2VH1 A;  1PGA A;  4G11 A;  2RMM A;  4WJO A;  3ZKJ C;  3A1Q A;  4REZ A;  4GDK A;  1Z2M A;  2JYE A;  2PIA A;  2KJ6 A;  1QOA A;  2DZM A;  4ITK A;  5FR6 A;  4GOC A;  2MHJ A;  4LJP B;  2WU5 B;  4BKS D;  2ASQ A;  4K1R B;  4ZHO A;  2REX A;  1C76 A;  1LM8 B;  3ETR A;  3PRE A;  1WX7 A;  1I4R A;  2MLB A;  1QF6 A;  1VDV A;  1D5Z C;  4TQ0 A;  1C3T A;  4C00 A;  4AQ7 A;  2ZPN A;  3BYY B;  4OW0 A;  2KKC A;  1RRB A;  2GB1 A;  2KWV B;  1GPX A;  4F8C B;  1TKY A;  2AX5 A;  1IUE A;  4RCO A;  1E5W A;  4MEM A;  1PGB A;  3EHV A;  5JHB A;  3OG5 A;  1WF9 A;  2M0X A;  4XX5 A;  3P4P B;  2PKO A;  1UUP A;  2M17 A;  2KQS A;  5AZH A;  2FID A;  2FNJ B;  4KVG B;  2BYV E;  3V6E B;  2CR5 A;  1YX5 B;  2KTR A;  1WGH A;  5GXG B;  1FNV A;  5D94 A;  2N0S B;  1EU3 A;  3A1Q B;  1Y56 A;  4TV3 A;  1HQR D;  3PSE B;  2IND C;  1F9J A;  1YQB A;  4A6Q A;  2X38 A;  4KGS A;  1V81 A;  2KDI A;  1K8R B;  4DWF A;  3AE9 B;  1F2R I;  4NPN A;  1YQ3 B;  4FJZ A;  4ZRP A;  3HUI A;  3RNF C;  2MP2 B;  4DXG A;  1C79 A;  1I42 A;  2LD9 A;  2HJ1 A;  4I6N B;  2AL3 A;  2D3A A;  5IAA C;  2MP2 A;  1P7F A;  1MPE A;  3VH4 B;  3AEG B;  3APF A;  2MJE A;  4XWW A;  3KLS X;  4HJG E;  3ZRF A;  5FKA C;  4AJY B;  1N63 A;  2GI9 A;  4NAW A;  5EDS A;  1ZKH A;  2KHW B;  3LB8 C;  4GIV A;  2FIF A;  1QQR A;  2I38 A;  3Q2A C;  3DBH B;  2B76 B;  4RH6 A;  1BXT A;  4P1B C;  3L08 A;  2PVO D;  3FC4 A;  2MBO A;  4A3P A;  1SF0 A;  2M0A A;  5BYQ A;  3V3X A;  4W9I A;  1CJE A;  1EF1 A;  1WJN A;  2DWQ A;  4A90 A;  2NTT A;  2FAZ A;  2AL6 A;  4HKQ A;  2N7E A;  3X23 A;  3I9V 1;  3PLU A;  2ZPY A;  4KIK B;  4P7I A;  2WXR A;  3EEC A;  2E6X A;  1QOF A;  2DZK A;  3NZU A;  2HDE A;  4RM8 A;  1P3Q U;  2VZK D;  1B1Z A;  1NEK B;  2C7N B;  1LGR A;  2QIE B;  2WU2 B;  3D32 A;  4HJK A;  3NVZ A;  4S0R A;  1YIW A;  1FCL A;  4G3X B;  2NVU I;  3UIN B;  1TIF A;  4CYE A;  3PV1 A;  4OVV A;  3H7P B;  5L83 A;  1Z5S B;  2KD0 A;  2KX3 A;  5IN7 A;  5J18 A;  2ZCC A;  3RN9 C;  3QJZ A;  2AQ1 B;  4HCN B;  3TEX A;  4YL8 A;  4P16 A;  4DXA B;  4TMA B;  2DLB A;  1SXT A;  4TQ1 A;  2RGF A;  2BF8 B;  4N58 A;  3U7Z A;  3DBH I;  1ZGU B;  1Y8R C;  1L0X B;  2KVR A;  4GXB A;  4HVB A;  3R66 C;  4JL9 A;  2X8X X;  1IYF A;  1Q0W B;  2C5L C;  2LVQ A;  4YXD B;  2KFK B;  3SHQ A;  4YTP B;  5DPT A;  2KTR B;  1TKG A;  5G5G A;  2ZCB A;  5H92 C;  2ZZP B;  1NYR A;  4ZRK A;  4FN2 A;  2EKI A;  1TS2 A;  3QIJ A;  4YSY B;  2DAF A;  3ZDM C;  3QQ8 B;  2WNM A;  4XYC A;  4C4V B;  1WZ0 A;  2IGD A;  1E8W A;  1M4V A;  2L52 A;  2KN5 A;  4IKG A;  4A9A A;  1E8Y A;  2JPH A;  2OJR A;  2WXJ A;  4GDK B;  1ACC A;  3IBE A;  4FAD A;  2RDB C;  3ECI A;  5G2N A;  5BMI A;  1N60 A;  3TMP B;  5E6J A;  2DHZ A;  2WXM A;  1C4P A;  1ENF A;  1NVI D;  1V6E A;  4TKN A;  1SJH D;  4E71 A;  2M8S A;  2OOB B;  2J4X A;  3B9J A;  2FCM A;  4CO7 A;  1E0Z A;  4HLE A;  2C7M B;  2K1F A;  2LRW A;  3PRZ A;  2L0T A;  2NS5 A;  1SSN A;  1WJ6 A;  2J0M A;  5J2R A;  3TJP A;  3WAO A;  1UNS A;  2V9H A;  5AZG A;  3DBR B;  2C60 A;  4LNN A;  3MJ5 A;  3P63 A;  3A9K A;  4MM3 B;  2EEL A;  1ET6 A;  1TT5 B;  3RFZ B;  2KXJ A;  2ZVO A;  3CSF A;  2R61 A;  5BMG A;  2DX5 B;  3KWL A;  5AUI A;  2KLG A;  3ONS A;  2L83 A;  3PZD A;  1HEZ E;  1RWS A;  5AZF A;  1Q5W B;  2L7R A;  1P9D U;  3U2S C;  2XN9 C;  4M00 A;  3WAP A;  1YN5 A;  1WYG A;  1ROE A;  3FIL B;  2LZ6 A;  1G6J A;  1D5X C;  4GMV A;  4HEA 1;  2BQQ A;  3APC A;  2KMA A;  1V1P A;  2LVP A;  3JVZ X;  4NQK E;  3NOB A;  4NQL B;  3OAW A;  3B2F A;  2GOW A;  2JUO A;  2ICI A;  1B9R A;  1P7E A;  3DHG C;  4NJ7 A;  2GBN A;  4BKT A;  4DQO C;  1QKZ A;  2PPH A;  1V1P B;  3Q3N C;  4B0M A;  3W9C B;  2IY1 B;  1L4D B;  2WDR B;  4LLG M;  3OLM D;  3RNE C;  3RPF C;  2DYM A;  2WDV B;  4MM3 A;  4D2K A;  5L95 C;  3GP7 A;  3L4P A;  2XK5 B;  3ABV B;  3AH7 A;  4J3O D;  1GG3 A;  3FAH A;  1WMH A;  2JXT A;  2KFJ A;  3RT3 B;  4DHZ E;  1E9M A;  2LGD A;  2Z59 B;  2KQ7 A;  2BYT A;  1SJE D;  1FRD A;  1FMA D;  4JIO U;  2LXA A;  2D3C A;  1UH6 A;  1F0Z A;  4N6E B;  5T8I A;  1JML A;  3L13 A;  2V3S A;  4GGQ A;  3DWG C;  2NPT A;  3P2B A;  2PE6 B;  1KLU D;  1SE4 A;  1WJ4 A;  1E10 A;  1H8C A;  4WIP A;  4XWT A;  5DPR A;  4KIK A;  3IFW B;  1PQS A;  1R4N I;  1PYW D;  2I1K A;  3W2D A;  2LXC A;  1FM0 D;  3VH3 B;  3JSV A;  2G45 B;  3ZQ4 A;  2BKR B;  3RNB C;  1ZW7 A;  3EA6 A;  4GN1 A;  4MH0 E;  2YEP B;  1E7U A;  1SIJ A;  1NI2 A;  4F7Z A;  3BY4 B;  3VUY A;  2L1A A;  1K52 A;  1WM3 A;  2FUH B;  3NHE B;  4M8M A;  5BYR A;  3PVL A;  4L1B A;  1SE3 A;  1FPY A;  1FCC C;  2VRR B;  1YOV B;  2KZR A;  3I5J C;  2CJO A;  3BVM A;  2D07 B;  3CF6 E;  3L10 B;  4G50 A;  2Y5B B;  5TSS A;  1GAQ B;  3KUZ A;  1HTO A;  3EFU A;  2V1Y A;  4JPS A;  1WXV A;  1U4A A;  4IUM B;  1LO5 D;  2GBJ A;  2QC8 A;  4DK5 A;  1N6Z A;  1CQV A;  2LMC A;  4L2Y A;  4P6V F;  1F2R C;  2O6V D;  5FK9 C;  1YN4 A;  2KC2 A;  4RMA A;  2K3U A;  3PPA A;  3R2T A;  1L2N A;  1MG4 A;  2ZEQ A;  3HHM A;  1XQQ A;  1JQ4 A;  1TYG B;  4HPL B;  2N9X A;  2O6V A;  4LNF A;  1D3Z A;  5BMH A;  4EOY A;  5JH5 C;  2PVG C;  4HRS A;  1TS4 A;  2N1W A;  4HRO A;  3MFG A;  1S1Q B;  1F52 A;  4RGM A;  2IO1 B;  3Q8F A;  3BK1 A;  3CIR B;  4B9K A;  5KHQ A;  2BYF A;  1WE7 A;  3CMM B;  3T9L A;  2KWC A;  3AE7 B;  4TUU A;  3HM3 A;  1UEL A;  3RUL A;  4ZDV A;  2KNB A;  1HE8 A;  1WE6 A;  1DYQ A;  2IO3 B;  2KLC A;  1TKE A;  2RPQ A;  1VR9 A;  4US8 A;  2B3A A;  2G4D B;  1T3Q A;  1V5O A;  1T0R C;  3U4E G;  3IT6 B;  3QA8 A;  4NNJ B;  3A4R A;  2KK8 A;  2WX1 A;  4IOI E;  4BBN C;  2VZK B;  4I6P A;  3IAM 1;  2Y5C A;  3ZLZ A;  1UGJ A;  3HIZ A;  2MCN B;  1A5R A;  1D6E C;  2LWP A;  2RPV A;  1IPG A;  3AE6 B;  3LXF A;  4MAC A;  4W9K A;  1RFA A;  1C9F A;  3PZ7 A;  4K7W A;  2J52 A;  3UIO B;  5JHA A;  5JXV A;  2MJ3 A;  3T3O A;  1VRA B;  3DCG A;  2UWQ A;  2N9L A;  3VXW A;  1ZDX A;  1DGJ A;  1JRO A;  5DCN A;  3TSS A;  3IHP C;  4JE3 B;  4MSM B;  4NY0 A;  5CHV C;  1EF5 A;  4YWG G;  3AM9 A;  1MI0 A;  4II2 B;  3RD2 A;  3H7S A;  1KRH A;  3QHT A;  2GBR A;  1ZE3 D;  1WIA A;  2KAC A;  3R2I A;  2R2O A;  3TEY A;  4FJV B;  2G3Q B;  3BWU D;  4IW0 A;  1QLB B;  3AEC B;  3Q3O C;  2XEW A;  3MTN B;  1L4Z B;  4I6L B;  5HHD G;  3E56 A;  3VUW A;  4MSQ B;  2MBH A;  2JSV X;  3Q3J A;  1N5X A;  2L32 A;  4WQO B;  2CHZ A;  2DZJ A;  3TL5 A;  4B6W A;  2FCQ A;  2FUG 1;  1WX9 A;  4ICV A;  1MJD A;  2BW2 A;  1I4X A;  3P4S B;  4C7Z A;  3DBL B;  1L0V B;  1N61 A;  4HK2 A;  4ZRJ A;  1FRR A;  1EWY C;  1C78 A;  2JYT A;  3IVF A;  3UGB B;  3KYC D;  4KSL C;  2JQR B;  3ZXR A;  1J0G A;  1WXA A;  3M63 B;  4OZA A;  1TGZ B;  2WDQ B;  3Q8E A;  2UU7 A;  1I7H A;  3IXS A;  1WYW B;  2TSS A;  2PEA A;  2XNA C;  2AWT A;  3AEF B;  4AP4 C;  4WJN A;  3UI3 A;  1KOT A;  1XO3 A;  2FCN A;  2MBB B;  3DHH C;  3VTV A;  3BVZ A;  1HTQ A;  2L8J A;  3BVG A;  2DAJ A;  1WSP A;  2KWD A;  1WGR A;  4RFB A;  5KHO A;  3B08 A;  4C4V A;  3Q3M C;  4KSK C;  4R3D A;  2BB6 A;  3FKY A;  1GB1 A;  4OHJ A;  2LRU A;  1GC7 A;  1WFY A;  4CQN A;  3R7R A;  1C77 A;  1MFW A;  4RGT A;  3U30 A;  1JWM D;  3AEB B;  3ZJU A;  3N1X C;  2HD5 B;  4XDC A;  3L0W B;  3PRM B;  3DWM A;  4IC7 B;  2N4F A;  1UD7 A;  2UYZ B;  3AE3 B;  4H2A A;  3SEB A;  4YSX B;  4EFO A;  4KV2 A;  2RSU A;  1TY2 A;  1ZDV A;  4WWM A;  3T3N A;  1AW7 A;  2ZNV C;  3N9Y C;  3N32 A;  4KZC A;  4DDG D;  1EM7 A;  1MVK A;  2WQY B;  3TIX A;  2CKH B;  4IM0 A;  2E3T A;  2LFI A;  3ZUN A;  5J17 A;  1GNU A;  5LXI B;  1JWB D;  4FBJ B;  3APD A;  3TUO A;  3V61 A;  4IM3 A;  2BS4 B;  3NVY A;  4YTM B;  4W9C A;  5LXH A;  4MGI E;  4EKU A;  3IG3 A;  2D11 A;  1CK1 A;  1FEH A;  3MJW A;  2J42 A;  2JZP A;  4M0W B;  2BGF A;  4F1S A;  4AJW A;  1YMH E;  1OTR B;  3TEW A;  2JF5 A;  3C19 A;  1PFD A;  3DVN V;  1VD2 A;  3DPD A;  1HZ5 A;  2M19 A;  2INC C;  2ONQ A;  2KO3 A;  1UWX A;  2D5G A;  2PLP A;  3A4S C;  2QHO A;  1C1Y B;  4ARI A;  1L5P A;  3MP9 A;  5MPO A;  3EGR A;  2Y3A A;  4PK1 A;  2WWZ A;  1NYQ A;  2AQ2 B;  3WAN A;  4W9L A;  2LUE A;  1L0Y B;  5IP4 D;  1GJZ A;  1KJT A;  4YTN B;  4W9G A;  3H8H A;  5D3I B;  1AYF A;  3VR9 B;  4FUL A;  5FR3 A;  1FFV A;  1OQY A;  2IDY A;  3GZN I;  4ZHP A;  5BYS A;  2WHI A;  2KDM A;  2LVO A;  2INP E;  1R4M I;  2LI5 A;  2MRP A;  4FA6 A;  3J9C A;  4K7U A;  1ZXI A;  2GLS A;  1T6B X;  3KYD D;  3P4R B;  4XE0 A;  4PS8 A;  3SR6 A;  2IPK D;  4JLC A;  3CST A;  3DQV A;  3B0A A;  2K6D B;  1BT0 A;  1JWS D;  2LEK A;  2INN E;  4KZ0 A;  3RYT A;  2H88 B;  3N20 C;  3ZTD A;  4BOS C;  4NJC A;  2ACZ B;  2QDF A;  1UZX B;  1YX6 B;  1OEY J;  4MEL A;  4AWJ A;  3ZJV A;  1IBX B;  1EWC A;  2G1E A;  4GSW A;  2HE7 A;  2RDH A;  3ZTC A;  2KWU B;  2BWE S;  3AU4 A;  5DPS A;  4AUQ C;  3NVV A;  1WXQ A;  3QCA A;  2K5P A;  3M95 A;  1V1O A;  3NS8 A;  3AE2 B;  3RMK C;  2WX0 A;  3U7D A;  3DBR I;  1XXG A;  3FIL A;  3NS1 A;  2LGX A;  1XLQ A;  2BPS A;  3QAR A;  3MC0 B;  2I1J A;  3A9J A;  4PYU A;  3QX1 A;  1UWM A;  4HPM B;  2KTF A;  3O65 B;  2ZW1 A;  2LGI A;  2K6Q A;  4RGO S;  1NDD A;  1DOI A;  1A70 A;  5EE3 A;  3RZF A;  2DEN B;  2KX0 A;  1IP9 A;  2BB5 A;  2NBV B;  3AXC A;  2CU3 A;  1E6E B;  1E8X A;  4ZRQ A;  3M62 B;  3KUC B;  3L16 A;  5D6J B;  3K9O B;  2W3R A;  4HKZ E;  1J7C A;  4RF0 A;  2ZNV B;  1VZ8 A;  1FFU A;  4ZOH C;  4WWP A;  2D3B A;  2NPT B;  2K8H A;  2GMI C;  1F77 A;  3VR8 B;  5EE1 A;  3ZO5 B;  1XT9 B;  4BVU C;  2HTH A;  4WWN A;  1KM7 A;  4HXD A;  3C0R B;  3T8M A;  2LHD A;  2OED A;  1GOZ A;  1V2Y A;  1IGD A;  1FO4 A;  4NJ6 A;  2J0J A;  2FBW B;  2KAJ A;  3QWZ B;  4RM9 A;  5C23 A;  3BZD B;  5C3J B;  4K7S A;  3LYY A;  2IGH A;  3KVF B;  2WS3 B;  3N30 A;  3Q8C A;  2J7Q B;  4O1N A;  1ZUD 2;  1P1A A;  1E8Z A;  2QMT A;  1TZO A;  3NZS A;  1VLB A;  2KT7 A;  4ICU A;  2XK5 A;  3PHX B;  4JQW C;  2KVZ A;  3V60 A;  3GS2 A;  1CZP A;  3Q14 C;  2QEJ C;  5C2T B;  3GB1 A;  1N62 A;  3QK0 A;  3Q8B A;  4OVZ A;  4ANW A;  1HZ6 A;  3OJ4 B;  4YT0 B;  2O6V B;  1V9J A;  2D3G A;  2IZV B;  2MBQ A;  2MX2 A;  3ZNH B;  1K50 A;  3AEE B;  2V3N A;  1V49 A;  2KOX A;  2MA9 B;  1C4C A;  1ZP0 B;  4W9E A;  4LDT B;  2EMT A;  1QT9 A;  3TBL D;  1TJE A;  4RF1 A;  4RNA A;  4N59 A;  1VZ6 A;  5E6O A;  3AE1 B;  3DDC B;  2L00 B;  2IO0 B;  1WX8 A;  1I35 A;  3H9D A;  1OQQ A;  2KQ4 X;  2LGY A;  1GB4 A;  2WXP A;  1WZ3 A;  3PO0 A;  3MHS D;  2WXI A;  3R3M A;  3QAQ A;  3ML8 A;  2Y5P A;  1FXI A;  1KLG D;  4K81 A;  1BML C;  2KMC A;  2OJW A;  1WM2 A;  4WJQ A;  1FXA A;  2Z0D B;  3O13 A;  5G5H A;  3VRB B;  2JZZ A;  1Q10 A;  3A9K B;  3U52 E;  2NR2 A;  4ANV A;  5D3D A;  3VAW A;  1RM6 C;  3RCZ A;  1YQ4 B;  4PS7 A;  4BKS A;  1SIF A;  2WXG A;  1FD6 A;  1XD3 B;  2R2Q A;  4JX1 C;  1ISN A;  2W3S A;  1CMX B;  1OEY A;  3PHW B;  4G0N B;  1SEB D;  5HKH A;  1X1M A;  3V6C B;  2O2V B;  3ZNG C;  4NAM A;  5IA7 A;  1XEE A;  3B2G A;  1KH0 A;  2JXX A;  2O2V A;  1D4B A;  1MHX A;  4MGK E;  4A20 A;  4OVU A;  4PS3 A;  1RFK A;  2WXN A;  3SFD B;  5CHF A;  1JCK B;  2JVC A;  3UQB A;  1V8C A;  2CJN A;  3WA0 A;  4C80 A;  1UF0 A;  3X0W A;  1DOX A;  2W82 A;  3E9S A;  4HDQ A;  2XBB C;  4ACF A;  3AE8 B;  4B0E A;  2BVC A;  5G55 A;  3AEA B;  5D2M B;  1J8C A;  2RD0 A;  1ZXH A;  2IYD B;  2LJ5 A;  1LFD A;  1QOB A;  3BII D;  4IDI A;  4QAY A;  3BK2 A;  2G9H D;  3CWI A;  1EU4 A;  1WH3 A;  2J53 A;  1I4Q A;  2SAK A;  1YJI A;  1WWT A;  1D5M C;  4A8X C;  1JRU A;  1J19 A;  4IM2 A;  1ESF A;  4MDK E;  2V4L A;  3P1M A;  2N7D A;  1P98 A;  4IG7 B;  2BTE A;  4BFR A;  5AEK B;  3VRA B;  2N7J A;  3B1L X;  3HVD A;  4DHZ B;  4GB9 A;  4HCP B;  3GOE A;  1FNW A;  3EFC A;  1HA5 A;  2MW5 A;  3ALB A;  3JW0 X;  1SGH A;  1WMH B;  4NZL B;  4EZL A;  2K22 A;  3KH0 A;  3VDZ A;  1FXT B;  1F1H A;  4IWQ A;  3RZW C;  2IY0 B;  4C7Y A;  1SBB B;  3U8Z A;  4Q2J A;  3ZDT A;  1VCB A;  4LCD E;  3BYT B;  1J7A A;  4AOF A;  4DDI D;  2WXF A;  3RI7 C;  3N1Y C;  3K9P B;  2MH7 A;  3MC8 A;  3VFK A;  1R7S A;  1KFY B;  4WAA A;  2L0F A;  1NEN B;  2BT6 A;  3OWE B;  1TBE A;  4DBG A;  2BS3 B;  1XF5 L;  2PMV A;  3VTU A;  4BAX A;  3DBS A;  2H89 B;  2EMS A;  3RNA C;  1JWA D;  1L6U A;  2QCZ A;  3L54 A;  2L05 A;  1TY0 A;  2CU1 A;  3V62 A;  2M56 B;  2V0G A;  4J6I A;  2Q5W D;  1OFF A;  2IJ0 A;  1I4G A;  3NVW A;  2WXK A;  3NZ3 A;  2HJ8 A;  4E3C A;  4PT5 A;  1K53 A;  4URK A;  2DYB A;  4ASW C;  2WXH A;  3KUD B;  1PUT A;  4WJP A;  2BBC A;  1WGK A;  2JX5 A;  4II3 B;  2PTL A;  4LTU A;  2RDG A;  2ON8 A;  2WXO A;  3Q6B A;  4W9J A;  1KF6 B;  2GRI A;  3JSV B;  3N3K B;  3WAM A;  1FIQ A;  4MH8 A;  4XDD A;  3MC9 A;  2ZW0 A;  4FHK A;  3AMZ A;  1KTK A;  1STE A;  2KFK A;  4W9D A;  2MQJ A;  1ZOY B;  2WXL A;  1J7B A;  1HXY D;  4AS1 A;  2LJI A;  3W1S C;  1RLF A;  1WJU A;  1T0Q C;  3P4Q B;  1N5W A;  2JRH A;  4KDI C;  1RYJ A;  4W9F A;  4MJS B;  3PTF C;  3RNC C;  3AV8 A;  5E6N A;  2KDF B;  3ZNI D;  1OGW A;  3VQI A;  1XLP A;  4KX6 B;  2JY6 A;  2M4N A;  4LNI A;  2JWZ A;  1ZPS A;  4ANX A;  4HWI B;  1E7P B;  3PGE A;  3BIN A;  1L6V A;  2Z8L A;  2KC1 A;  4WUR A;  3VHT C;  1R4N B;  5JZE B;  4US9 A;  2IO2 B;  4MT5 A;  2FE8 A;  4JWS C;  4ARC A;  4LNO A;  1UBQ A;  1BUI C;  3I63 C;  4FJY A;  1M94 A;  4RGN A;  4GU2 A;  4MGZ E;  4OZB A;  2YLM A;  1H4R A;  1WRI A;  4M02 A;  1YD8 U;  3HK0 A;  1I4H A;  5HFY A;  3UQA A; 
#chains in the Genus database with same CATH homology
 2N1W A;  2CR5 A;  3K9O B;  2C7H A;  1S1Q B;  1YX5 B;  1NBF C;  2IO1 B;  2KTR A;  2ZJD A;  1WGH A;  4B9K A;  2ZNV B;  4MGY E;  5D94 A;  2K8C A;  3A1Q B;  2BYF A;  4TV3 A;  5KHQ A;  4WWP A;  3DVG Y;  3W1Y A;  1WE7 A;  3CMM B;  3PSE B;  1F9J A;  1YQB A;  3T9L A;  2NPT B;  1GC6 A;  2K8H A;  4GDL B;  2GMI C;  3ZO5 B;  2WDT B;  1XT9 B;  1V81 A;  2KWC A;  4BVU C;  2HTH A;  2DZI A;  1K8R B;  2KDI A;  3HM3 A;  4TUU A;  1P0R A;  1UEL A;  4WWN A;  3RUL A;  1KM7 A;  4BKG A;  4DWF A;  4ZDV A;  4HXD A;  3C0R B;  3T8M A;  2KNB A;  1HE8 A;  4NPN A;  1WE6 A;  4FJZ A;  2YVC A;  2IO3 B;  2MP2 B;  1V2Y A;  3A33 B;  1WI0 A;  4NJ6 A;  2J0J A;  3UF8 A;  3PS6 A;  1I42 A;  2LD9 A;  3QWZ B;  4RM9 A;  2KLC A;  4I6N B;  2AL3 A;  2LAS A;  2WYQ A;  5C23 A;  2RPQ A;  4K7S A;  2KAN A;  5IAA C;  2B3A A;  2G4D B;  2MP2 A;  1V5O A;  2K39 A;  4E74 A;  3VH4 B;  3APF A;  3QA8 A;  4NNJ B;  3A4R A;  2KK8 A;  2WX1 A;  3ZRF A;  4BBN C;  3KVF B;  4AJY B;  4I6P A;  1WY8 A;  2KDB A;  4NAW A;  5EDS A;  3ZNZ B;  1ZKH A;  3N30 A;  3W1S A;  2KHW B;  4GIV A;  2J7Q B;  3ZLZ A;  2FIF A;  3HIZ A;  2MCN B;  2BWF A;  1A5R A;  2LWP A;  3PRP B;  1IPG A;  1P1A A;  1E8Z A;  3NZS A;  3SU8 X;  3ZIM A;  2MBE A;  2EKE C;  4ICU A;  4W9K A;  2XK5 A;  3PHX B;  4JQW C;  2G4S A;  3L08 A;  3V60 A;  4ZYN A;  3ZW3 A;  1RFA A;  1WR1 A;  4K7W A;  2MBO A;  3UIO B;  4A3P A;  3QK0 A;  5JHA A;  3AI5 A;  3S2A A;  2JRI B;  3DCG A;  2UWQ A;  3QC8 B;  4ANW A;  3OJ4 B;  4W9I A;  4LDT D;  1TTN A;  2JZ3 B;  1EF1 A;  1WJN A;  1V9J A;  2O6V B;  2D3G A;  2IZV B;  2MBQ A;  3VXW A;  3Q3F A;  1WGD A;  2FAZ A;  2AL6 A;  2MX2 A;  2N7E A;  4KDL B;  3ZNH B;  2CHW A;  3X23 A;  1V49 A;  3KW5 B;  2KOX A;  2CS4 A;  3PLU A;  5DCN A;  2ZPY A;  3IHP C;  2A4Z A;  4KIK B;  2MA9 B;  4P7I A;  1AAR A;  4NY0 A;  4MSM B;  5CHV C;  3EEC A;  1EF5 A;  1S3S G;  3DVG X;  2DZK A;  3NZU A;  3DVN U;  1E7V A;  4W9E A;  1GUA B;  4II2 B;  4RM8 A;  3RD2 A;  3H7S A;  4LDT B;  4WWO A;  4EZK A;  1P3Q U;  2EMT A;  1YJ1 A;  3TBL D;  3QHT A;  2L3Z A;  2GBR A;  2C7N B;  4LJO B;  5GMV A;  1WIA A;  3AUL A;  2R2O A;  2BYE A;  3M3J A;  3D32 A;  4FJV B;  3A9J B;  4HJK A;  2G3Q B;  5E6O A;  3DDC B;  1YIW A;  1LXD A;  2L00 B;  4G3X B;  2NVU I;  3UIN B;  2IO0 B;  1WX8 A;  3OJ3 A;  4CYE A;  1I35 A;  3PV1 A;  3H9D A;  4IW0 A;  4OVV A;  3H7P B;  2NCN A;  5L83 A;  2XEW A;  1Z5S B;  2KD0 A;  3MTN B;  2KX3 A;  2LGY A;  4I6L B;  3H7P A;  5J18 A;  1WZ3 A;  4NAW B;  3VUW A;  2ZCC A;  4MSQ B;  3JYU A;  2MBH A;  3QJZ A;  1E90 A;  3MHS D;  3R3M A;  3Q3J A;  1WXS A;  1SE9 A;  4WQO B;  3EC8 A;  3QAQ A;  2CHZ A;  2DZJ A;  4HCN B;  3TL5 A;  4B6W A;  4YL8 A;  1EUV B;  2FCQ A;  3ML8 A;  4ANU A;  4DXA B;  1TZ1 A;  1WX9 A;  4ICV A;  4FHJ A;  1WRD B;  2IBI B;  4K81 A;  2KMC A;  1WM2 A;  4HK2 A;  4WJQ A;  2Z0D B;  4TQ1 A;  1L7Y A;  2JZZ A;  3A9K B;  4ANV A;  2NR2 A;  4ZRJ A;  2RGF A;  2BF8 B;  2DYO A;  3VAW A;  3RCZ A;  2Z0E B;  3DBH I;  1ZGU B;  3ENE A;  1Y8R C;  4XZ4 A;  4XC2 A;  3IVF A;  4PS7 A;  3UGB B;  4BKS A;  3KYC D;  4EEW A;  1SIF A;  2KVR A;  4KSL C;  4GXB A;  2GBK A;  1XD3 B;  3R66 C;  2R2Q A;  4HVB A;  1J0G A;  1ISN A;  1WXA A;  2NBW B;  4JL9 A;  3M63 B;  1CMX B;  1OEY A;  1TGZ B;  3PHW B;  4G0N B;  1IYF A;  5HKH A;  1Q0W B;  1X1M A;  3SDL C;  1WYW B;  3V6C B;  2C5L C;  2LVQ A;  2O2V B;  2PEA A;  4PYZ A;  2AWT A;  2KFK B;  3ZNG C;  3DBL I;  3SHQ A;  3V6E B;  4AP4 C;  5D7G A;  5DPT A;  2KTR B;  4BOZ B;  4WJN A;  5IA7 A;  1KOT A;  2W9N A;  3HM6 X;  2J0K A;  5JH5 C;  2JXX A;  3NY5 A;  2ZCB A;  2FCN A;  2O2V A;  2C9W B;  2ZZP B;  2MBB B;  4MGK E;  1V86 A;  3VTV A;  4A20 A;  4OVU A;  4PS3 A;  4ZRK A;  2L8J A;  2N9P C;  3H6N A;  1UBI A;  2DAJ A;  4FN2 A;  1WGR A;  4GDL A;  3QIJ A;  5CHF A;  3PLV A;  5KHO A;  3VTW A;  2JVC A;  3UQB A;  3B08 A;  2DAF A;  3ZDM C;  1RAX A;  2PJH A;  3WA0 A;  3QQ8 B;  4KSK C;  3I3T B;  3X0W A;  1WZ0 A;  4IWP A;  4EZJ A;  2LRU A;  1GC7 A;  1E8W A;  4HDQ A;  3ZRC A;  2KN5 A;  2XBB C;  1E8Y A;  1WFY A;  2JPH A;  2OJR A;  3R7R A;  4GDK B;  2A5U A;  3IBE A;  4X57 B;  4FAD A;  2FCS A;  1LQB A;  5G55 A;  3ECI A;  5G2N A;  3U30 A;  5D2M B;  1J8C A;  2N9E B;  2RD0 A;  3TMP B;  3AU5 A;  4CHK A;  2DHZ A;  2IYD B;  2LJ5 A;  1V6E A;  1LFD A;  2HD5 B;  3LJ3 A;  4N9F 4;  4TKN A;  3VVW B;  1KLV A;  3L0W B;  3PRM B;  1WH3 A;  2N4F A;  1UD7 A;  2UYZ B;  4IC7 B;  4E71 A;  2M8S A;  2OOB B;  4W9H A;  1JRU A;  5LLI A;  2FCM A;  4CO7 A;  4HLE A;  1J19 A;  2C7M B;  2K1F A;  4IM2 A;  3TCA A;  3WAL A;  4EFO A;  4MDK E;  4ZRI A;  2LRW A;  3PRZ A;  2V4L A;  4KV2 A;  2N7D A;  2L0T A;  2RSU A;  2NS5 A;  1P98 A;  4IG7 B;  1WJ6 A;  2D10 A;  2J0M A;  2PE9 A;  2ZNV C;  5J2R A;  4KZC A;  3N32 A;  3TJP A;  3WAO A;  4BFR A;  4DDG D;  5AEK B;  4FLH A;  5CTR C;  5AZG A;  2C60 A;  3TIX A;  3A9K A;  2CKH B;  1EO6 A;  3B1L X;  4DHZ B;  4GB9 A;  4IM0 A;  4HCP B;  4DHJ D;  2KXJ A;  3GOE A;  2ZVO A;  3CSF A;  3WIM A;  2M1M A;  1WGG A;  2DX5 B;  2MW5 A;  3ZUN A;  1GNU A;  2K8B A;  2KLG A;  5J17 A;  3ONS A;  5LXI B;  3ALB A;  3JW0 X;  3PZD A;  4FBJ B;  3APD A;  5AZF A;  1SGH A;  3V61 A;  1WMH B;  4IM3 A;  1Q5W B;  4EZL A;  1V5T A;  4W9C A;  2GBM A;  2L7R A;  2BKF A;  3KH0 A;  1P9D U;  3VDZ A;  1FXT B;  5LXH A;  4IWQ A;  2AEH A;  4MGI E;  4EUT A;  3ML9 A;  3RZW C;  4EKU A;  2IY0 B;  4MJS A;  1V80 A;  3RUI B;  3IG3 A;  2D11 A;  3U8Z A;  5E6P A;  3MJW A;  3WAP A;  4M0W B;  2BGF A;  4F1S A;  1T0Y A;  3PT2 B;  1VCB A;  3ZDT A;  2K25 A;  2KJH B;  4LCD E;  2LZ6 A;  4AJW A;  1G6J A;  1OTR B;  3R7Q A;  4JGH B;  4GMV A;  4BBN F;  2JF5 A;  4AOF A;  4IWO A;  4DDI D;  3APC A;  3DVN V;  2KMA A;  3K9P B;  1VD2 A;  2LVP A;  1MG8 A;  3DPD A;  5CX3 A;  3VFK A;  3JVZ X;  2KO3 A;  2N1V A;  2NBU A;  3NOB A;  4NQK E;  4WAA A;  4DHJ B;  4NQL B;  3OAW A;  2GOW A;  2JUO A;  3A4S C;  2QHO A;  1C1Y B;  2L0F A;  3DOW A;  4NJ7 A;  2GBN A;  3L17 A;  4BKT A;  2PPH A;  4DBG A;  1TBE A;  2IY1 B;  3VTU A;  3DBS A;  3OLM D;  2D2Q A;  2EMS A;  2MSE D;  2WWZ A;  2DYM A;  3WAN A;  4B95 A;  1Q1O A;  4W9L A;  2LUE A;  1GJZ A;  4MM3 A;  4A3O A;  1KJT A;  3L54 A;  2L05 A;  4W9G A;  5L95 C;  2CU1 A;  2CHX A;  3V62 A;  2XK5 B;  4FUL A;  4J6I A;  1OQY A;  3GZN I;  3LDZ E;  2JT4 B;  1GG3 A;  2RR9 A;  2LVO A;  2ZVN A;  1WMH A;  5TR5 A;  2KFJ A;  3RT3 B;  2HJ8 A;  1R4M I;  4E3C A;  2LI5 A;  2MRP A;  4DHZ E;  4FA6 A;  4K7U A;  4URK A;  5CHW A;  2DYB A;  2LGD A;  3KYD D;  2Z59 B;  2KQ7 A;  2AYO B;  4ASW C;  3KUD B;  3SD5 A;  3VUX A;  4JIO U;  2L76 A;  2LXA A;  4PS8 A;  1UH6 A;  4WJP A;  4JLC A;  5DPW A;  3CST A;  3DQV A;  4HDO A;  3L13 A;  4II3 B;  2V3S A;  4GGQ A;  2KDE B;  1WGY A;  3B0A A;  3UIP B;  2K6D B;  5C1Z A;  2KJR A;  2NPT A;  1UGM A;  3P2B A;  2PE6 B;  3ZVV A;  4M8N A;  4W9J A;  1BT0 A;  1WJ4 A;  3H1U A;  3JSV B;  3N3K B;  3WAM A;  1H8C A;  4KZ0 A;  5DPR A;  3RYT A;  4KIK A;  3IFW B;  3ZTD A;  4BOS C;  1PQS A;  1R4N I;  2I1K A;  1WXM A;  2LXC A;  2MWS B;  3VH3 B;  1UZX B;  1WR6 E;  1YX6 B;  1OEY J;  1QZE A;  3JSV A;  4FHK A;  2G45 B;  4MEL A;  5BO4 B;  4AWJ A;  2BKR B;  1ZW7 A;  2KFK A;  4W9D A;  4G11 A;  2MQJ A;  4WJO A;  3ZKJ C;  4GN1 A;  3A1Q A;  4MH0 E;  4GSW A;  1E7U A;  2HE7 A;  5D6J B;  4GDK A;  1Z2M A;  3ZTC A;  2KWU B;  2KJ6 A;  3W1S C;  1NI2 A;  1RLF A;  2BWE S;  3AU4 A;  5DPS A;  2DZM A;  1WJU A;  4F7Z A;  4AUQ C;  5FR6 A;  2JRH A;  4GOC A;  4KDI C;  3BY4 B;  4W9F A;  3VUY A;  4MJS B;  4LJP B;  1WM3 A;  3PTF C;  2FUH B;  3QCA A;  3NHE B;  4BKS D;  3M95 A;  4M8M A;  3NS8 A;  3PVL A;  2WX0 A;  2KDF B;  5E6N A;  3ZNI D;  3U7D A;  2ASQ A;  3DBR I;  1OGW A;  4K1R B;  2VRR B;  3VQI A;  2REX A;  2KZR A;  2D07 B;  3CF6 E;  3L10 B;  2LGX A;  4G50 A;  2Y5B B;  2JY6 A;  1LM8 B;  2M4N A;  2BPS A;  2JWZ A;  3PRE A;  3QAR A;  3KUZ A;  1WX7 A;  2I1J A;  3A9J A;  3EFU A;  2MLB A;  2V1Y A;  4PYU A;  4ANX A;  1WXV A;  4HWI B;  1U4A A;  4IUM B;  1C3T A;  4TQ0 A;  2GBJ A;  3PGE A;  3QX1 A;  2ZPN A;  3BIN A;  4DK5 A;  4HPM B;  2KC1 A;  3VHT C;  2KKC A;  1RRB A;  2KTF A;  5JZE B;  3O65 B;  2IO2 B;  2K6Q A;  2O6V D;  2KWV B;  1NDD A;  4F8C B;  2KC2 A;  1UBQ A;  4RMA A;  1E5W A;  3PPA A;  1L2N A;  4MEM A;  2ZEQ A;  3HHM A;  1XQQ A;  3EHV A;  4FJY A;  1M94 A;  5JHB A;  4HPL B;  1WF9 A;  2M0X A;  4XX5 A;  4GU2 A;  4MGZ E;  3RZF A;  2DEN B;  2YLM A;  1H4R A;  2KX0 A;  1IP9 A;  2M17 A;  2N9X A;  2NBV B;  2O6V A;  1YD8 U;  3AXC A;  1D3Z A;  2KQS A;  1E8X A;  4EOY A;  3HK0 A;  3M62 B;  5AZH A;  3KUC B;  2FID A;  2FNJ B;  3UQA A;  3L16 A;  4KVG B;  2BYV E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...