3ZTCA

Pvhl54-213-elob-eloc complex _ (2s,4r)-n-((1,1'-biphenyl)-4-ylmethyl)- 4-hydroxy-1-(2-(3-methylisoxazol-5-yl)acetyl)pyrrolidine-2- carboxamide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
103
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADTFEALCIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 21
structure length 103
sequence length 104
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ztcA00
3NHEB 4LCDE 4EFOA 3H7SA 4M8NA 1XQQA 2WWZA 1WX7A 4II3B 2N1VA 3R7QA 3A1QA 2BYVE 1LM8B 4WJPA 1NBFC 2KWVB 2Z0DB 4BOZB 2XBBC 1WJ6A 2GBKA 3HK0A 1WX8A 3U7DA 3VQIA 3A9KA 2DAJA 2KDBA 4DHJB 3UQBA 3IHPC 1F9JA 3A9JB 1TGZB 4FA6A 4PYZA 3T9LA 4DDID 3RZWC 5D94A 2KDFB 4URKA 1V5TA 3OJ3A 4MGIE 3H7PA 3ZRCA 1XT9B 2KLGA 3KW5B 3C0RB 4DHZE 2O2VB 4JGHB 2MW5A 2N9PC 2Z0EB 3VAWA 4MJSA 4ZRKA 3ZDTA 1J8CA 3A1QB 1EO6A 1V49A 1WR6E 1WYWB 3PREA 3T8MA 3GOEA 4FHJA 2KMCA 4M0WB 3V6EB 1P98A 3QX1A 1GNUA 1OGWA 3MHSD 4HWIB 4A20A 2MBEA 1KJTA 3VUYA 3DVNU 3W1YA 3RZFA 2KANA 1KM7A 4W9KA 3A9KB 4WWNA 1NI2A 3ALBA 2GOWA 4EEWA 1J0GA 2RGFA 3KYCD 4ANWA 1V9JA 1UH6A 2IBIB 3ZVVA 2JRHA 2YLMA 2LASA 4LDTB 2M4NA 3H7PB 4MELA 2KC1A 2KX3A 1WX9A 4HK2A 4CHKA 3M3JA 3L16A 3DBHI 2LVQA 4FJZA 2K1FA 3IBEA 3PZDA 4BBNC 1WZ0A 1L2NA 4MEMA 4I6NB 1UGMA 3DVGX 4MSMB 4EKUA 1X1MA 4NY0A 4RM9A 2N7EA 3JW0X 3RCZA 1IP9A 2MSED 3WAOA 3L54A 2AEHA 2J7QB 4RM8A 3RD2A 2LGYA 4IG7B 3B0AA 1YQBA 1LFDA 2N9EB 3HHMA 1YX5B 4J6IA 4BKSD 3RULA 3ZNID 4GSWA 4K7WA 3SHQA 3V61A 3N32A 2K25A 3QC8B 2GMIC 3TIXA 2ASQA 3L13A 2DYOA 5E6NA 3VTUA 3V6CB 2J0JA 3QAQA 2KWCA 2W9NA 2ZNVB 1WXMA 2CHXA 4B6WA 2O6VA 1U4AA 3QQ8B 5JHBA 4A3OA 4EOYA 1S3SG 1WXSA 4M8MA 2KDEB 2DYMA 2BWES 1KLVA 2LI5A 1R4NI 2GBRA 2AWTA 3PLUA 4MGYE 1T0YA 2V3SA 2MBHA 4W9CA 3QARA 4I6LB 2BGFA 4FJVB 3PV1A 2M1MA 2IO2B 2RR9A 2KXJA 2KJRA 4WAAA 1WZ3A 2K39A 4KDLB 1D3ZA 2PE6B 1WH3A 4GOCA 4ANUA 4MSQB 1GC6A 4PS8A 3MTNB 2VRRB 3Q3FA 2Y5BB 2CR5A 3K9OB 2EKEC 2KKCA 4PYUA 2KTRA 4FN2A 3UIOB 1JRUA 3PRZA 3OAWA 5C23A 2B3AA 4E71A 3LJ3A 4HDOA 4ASWC 1EF5A 2DZKA 4I6PA 3RYTA 1E7VA 4DBGA 2MBBB 4GN1A 2ZVOA 2LD9A 3X0WA 3ONSA 3TJPA 1WM2A 2PPHA 4EZLA 3IFWB 4NAWB 4RMAA 1S1QB 1WE7A 3JVZX 2KHWB 1C1YB 3PVLA 4BKTA 1GJZA 5L95C 2FIFA 5D6JB 2KK8A 2BYFA 2D11A 4FJYA 4GXBA 3QHTA 1V81A 2HTHA 3EC8A 3CSTA 3QJZA 5G2NA 2OOBB 2JRIB 3NOBA 3W1SA 2DZIA 2M8SA 2AYOB 4KDIC 4MGZE 4MDKE 1UBQA 5AZHA 3Q3JA 3KH0A 2KTRB 5DCNA 1RAXA 5LLIA 3WIMA 1L7YA 4AWJA 2AL6A 4XZ4A 2L05A 1E8WA 2J0MA 2KTFA 2K8HA 2NPTA 1WMHA 3APCA 5EDSA 1LXDA 2UWQA 2XEWA 5FR6A 3OLMD 5D7GA 2L3ZA 4BKSA 1WR1A 3AULA 3M63B 4X57B 5LXIB 4XX5A 2FCQA 2K8CA 4HPLB 3L17A 4AP4C 1P1AA 2IZVB 5DPTA 2RPQA 3HM3A 4LJOB 5CTRC 2KJHB 3ZUNA 2FIDA 2IY0B 4OVVA 3WANA 3DQVA 2KO3A 2FCNA 2K6QA 4ANVA 3KUDB 2JT4B 3M62B 3L10B 1V5OA 4DDGD 1WY8A 3CF6E 4BOSC 1P9DU 1WIAA 4AJYB 5CHWA 3CMMB 4K1RB 4NJ6A 1WJNA 3NS8A 3ZW3A 5J18A 3H6NA 1OTRB 1ZGUB 2NPTB 2N1WA 3PRMB 4TUUA 4EZJA 2NS5A 1WMHB 4PS7A 2EMTA 3QA8A 4JQWC 2M17A 4DHJD 5JH5C 3KYDD 4KSLC 1WJUA 2KLCA 3QK0A 4HJKA 4E74A 4K7UA 4IC7B 2WX1A 1K8RB 2LUEA 4MJSB 3H9DA 2CKHB 2CHWA 1HE8A 3N3KB 3VUWA 3DPDA 2JY6A 2KVRA 3APFA 4DHZB 3DDCB 3VH4B 1OEYA 2LWPA 3QIJA 4MM3A 4W9FA 5BO4B 3PT2B 3KUZA 5CHFA 4GMVA 3R3MA 3LDZE 2I1JA 1GC7A 2HE7A 5HKHA 4G11A 3BY4B 3OJ4B 3AI5A 2N9XA 1H8CA 2K6DB 1V6EA 4LJPB 1UBIA 3A4RA 1ISNA 3N30A 2NVUI 4WWOA 4IM0A 2C60A 4LDTD 1E5WA 4W9GA 4F1SA 5KHQA 4CO7A 3U8ZA 3DOWA 2GBJA 4ICVA 4GDKA 5GMVA 3M95A 3WAMA 3SU8X 3PHXB 1PQSA 4DXAB 2G4DB 5DPRA 4BKGA 2FNJB 1A5RA 2KNBA 5J17A 3HM6X 1WFYA 1Z5SB 4B95A 3VH3B 2M0XA 2L00B 4KZCA 2L8JA 1R4MI 1P3QU 3ML9A 5DPWA 4E3CA 3ZTCA 3VVWB 2BKFA 2C7HA 3DVGY 3UGBB 4AJWA 2L7RA 4GIVA 1WJ4A 4II2B 2N4FA 4TV3A 2JPHA 3BINA 3JSVA 3DBRI 1WI0A 3VHTC 2C7MB 4GU2A 2V4LA 3V62A 2UYZB 5TR5A 1SGHA 4K81A 1YX6B 2O6VB 3R7RA 3WALA 5JHAA 2LGXA 5AEKB 4W9HA 4KV2A 2EMSA 4FBJB 2KQ7A 4MH0E 2GBMA 3AU4A 4GDKB 2IYDB 3TCAA 1OEYJ 4W9JA 4WJOA 5AZGA 1VCBA 5JZEB 1G6JA 4W9LA 3W1SC 3PSEB 1H4RA 1WGYA 4TQ0A 1M94A 1AARA 2MBQA 3L08A 2LXCA 2CHZA 4F8CB 2DX5B 3EECA 2LJ5A 2KMAA 4FLHA 4ANXA 2DAFA 3MJWA 1V80A 3UF8A 2MCNB 4P7IA 2NR2A 3ZNGC 1WM3A 3CSFA 4FADA 2PJHA 2FCSA 1FXTB 2JUOA 3JSVB 2DENB 4HDQA 1WGDA 3TMPB 4W9EA 3KVFB 2KN5A 4IWOA 3P2BA 4KSKC 3SDLC 3D32A 3PLVA 1KOTA 2YVCA 1ZW7A 1V86A 1VD2A 2C9WB 2LZ6A 2ZCCA 2ZZPB 4IM3A 1E8XA 4MGKE 1OQYA 2D3GA 2MRPA 3V60A 2J0KA 2C7NB 4KVGB 1V2YA 1UZXB 1BT0A 1WF9A 5DPSA 2REXA 3WA0A 2N7DA 3PPAA 2KQSA 4HCPB 1SE9A 4HXDA 2D2QA 4AOFA 4KIKA 2ZCBA 1Z2MA 3JYUA 3A4SC 3ML8A 2DYBA 1YIWA 2KFKA 2C5LC 1Y8RC 2IO3B 5KHOA 4ZYNA 2A5UA 3TL5A 5L83A 2R2OA 4WQOB 3ZLZA 1TTNA 2JZZA 4JIOU 2WDTB 2ZNVC 1TBEA 2R2QA 5C1ZA 3EHVA 4AUQC 2G45B 2MP2A 2G4SA 4BVUC 1Q0WB 4FULA 4WWPA 3VDZA 3PHWB 3AXCA 3HIZA 3ZTDA 2FCMA 3EFUA 4ZDVA 3B1LX 2IO1B 4N9F4 2GBNA 3WAPA 5CX3A 2D07B 2IY1B 2BYEA 2RSUA 2KWUB 2AL3A 1RFAA 1E7UA 4GGQA 4GB9A 2L0TA 4G0NB 2I1KA 1Q5WB 3VTWA 4IW0A 4KIKB 2QHOA 2DZMA 3UIPB 2A4ZA 2BWFA 2KFKB 3ZKJC 2NBUA 2XK5A 4XC2A 3PS6A 4IWPA 3IVFA 2JXXA 2V1YA 3NZUA 1MG8A 4CYEA 1YJ1A 4NJ7A 2NBWB 4NPNA 1P0RA 4DK5A 2MP2B 5LXHA 2JZ3B 4A3PA 4ZRJA 1SIFA 5AZFA 4F7ZA 3SD5A 2LVOA 2MBOA 2KDIA 3A33B 4FHKA 4G50A 4BFRA 2CU1A 3ZIMA 1Q1OA 2NBVB 1TZ1A 1E8ZA 2KOXA 2D10A 4HPMB 3ZO5B 2BKRB 3I3TB 3PRPB 4PS3A 1NDDA 3VXWA 4BBNF 1I42A 1UD7A 2MA9B 4B9KA 2OJRA 2ZEQA 1RRBA 2FUHB 3PGEA 5J2RA 3DBLI 3K9PB 3DBSA 4NNJB 2CS4A 5D2MB 4JLCA 2LGDA 1WRDB 5CHVC 4EZKA 5IAAC 2XK5B 2ZVNA 4ZRIA 3ZNHB 4EUTA 3QCAA 4KZ0A 1XD3B 2Z59B 2KC2A 1YD8U 1E90A 3DCGA 1GUAB 4HLEA 2BF8B 3VUXA 2KX0A 2LXAA 2ZJDA 4IM2A 3VTVA 2NCNA 1EF1A 3NZSA 3DVNV 2KFJA 2ZPYA 1IYFA 3U30A 3GZNI 4JL9A 3VFKA 2DHZA 4TQ1A 1WE6A 3UINB 1C3TA 5IA7A 2G3QB 1UELA 1WGHA 4ICUA 4WJNA 1RLFA 2HJ8A 4TKNA 4WJQA 2L0FA 3ECIA 3RUIB 1E8YA 4DWFA 1WGRA 2PEAA 2MLBA 4GDLA 4NQLB 3KUCB 1I35A 2JWZA 3NY5A 1J19A 2DZJA 2ZPNA 4HVBA 1IPGA 2JF5A 3O65B 1WXAA 4NQKE 4G3XB 3B08A 2JVCA 2LRUA 1EUVB 5G55A 5E6PA 3IG3A 4NAWA 4YL8A 5E6OA 2KZRA 4W9IA 3RT3B 3ZDMC 2RD0A 4K7SA 2WX0A 4HCNB 1CMXB 4IUMB 1GG3A 4IWQA 2HD5B 1WXVA 2KJ6A 3L0WB 1ZKHA 2LVPA 3UQAA 3ENEA 4GDLB 2BPSA 2K8BA 2MWSB 4W9DA 2L76A 3PTFC 3QWZB 2WYQA 2IO0B 3ZNZB 2FAZA 3A9JA 2KD0A 2LRWA 3S2AA 3APDA 3R66C 2PE9A 1WGGA 3AU5A 3ZRFA 3TBLD 3X23A 3H1UA 4OVUA 2O6VD 2MX2A 1QZEA 2O2VA 1LQBA 2MQJA
chains in the Genus database with same CATH superfamily
3NHEB 4EFOA 3H7SA 4M8NA 4YSXB 1WX7A 4NJCA 4M00A 2BYVE 4RNAA 2KWVB 4M0WA 4DXGA 3IT6B 1UWXA 3VQIA 3A9KA 4FA6A 3T9LA 3RZWC 5D94A 3OJ3A 1SF0A 3KW5B 4DHZE 1KLGD 2O2VB 2JX5A 4JGHB 4ZRPA 1ZDVA 3C8YA 1VZ7A 1J8CA 1EO6A 2DWQA 3V6EB 2FBWB 4M0WB 3MHSD 2RDHA 1VZ8A 3A9KB 4WWNA 4EEWA 4LLGM 3ZVVA 3ZJVA 2YLMA 3Q3OC 2M4NA 2KC1A 2KX3A 4HK2A 3M3JA 3L16A 2V0GA 3DBHI 1T0RC 4FJZA 2BW2A 3SFDB 4C4VA 1C9FA 2EELA 2PMVA 1D6EC 2N7EA 4ZRQA 1IP9A 3L54A 2J7QB 2L52A 2LGYA 4J6IA 1YQBA 2N9EB 3NZ3A 1YX5B 1B9RA 3RULA 4OHJA 3ZXRA 3VTUA 2WHIA 3V6CB 4EE2A 2VH1A 1K50A 2ZNVB 3Q8AA 2WS3B 4RF0A 3NVYA 4C4VB 4YWGG 4UDUC 2PVGC 4TSSA 2RMMA 2ACZB 2QDFA 2RR9A 3AE5B 2K39A 1KRHA 2N9KA 3MTNB 3SR6A 3BZDB 1T3QA 3K9OB 2QCZA 1K52A 2LMCA 4ACFA 4FN2A 1E6EB 2BT6A 4RGTA 2B3AA 2QILA 5C2TB 1QF6A 2WP9B 2KQ4X 4NZLB 1NVID 4RMAA 3JVZX 1TY0A 4BKTA 2X38A 2FIFA 1IUEA 5D6JB 3Q14C 4MACA 1WXQA 3QHTA 1V81A 2HTHA 3EC8A 1BUIC 3RFZB 3W1SA 1TZOA 4N58A 2AYOB 4KDIC 4MDKE 1UBQA 3AEEB 1FXIA 5DCNA 3Q8FA 3C19A 2D3AA 2NPTA 1AW7A 2J0MA 1Y56A 4XZ4A 1SXTA 1WMHA 3HUIA 5FR6A 3OLMD 3AULA 1JW9D 1UGJA 3DHIC 1P1AA 2IZVB 1YMHE 3WANA 3TEWA 4M02A 3ABVB 1V5OA 1WY8A 4BOSC 4AJYB 1R4MB 5CHWA 4K1RB 4NJ6A 3Q8EA 2JXTA 5BMGA 1DYQA 1HA5A 2WXHA 1ZGUB 2NPTB 4XYCA 4DHJD 1WMHB 5JH5C 3MP9A 3U52E 3NVZA 4E74A 4K7UA 4MJSB 3H9DA 2CKHB 2M19A 3EA6A 2G1EA 3APFA 3IXSA 4DHZB 3DDCB 1JALA 2LWPA 2XNAC 3AEFB 3KUZA 5CHFA 4GMVA 3R3MA 3LDZE 1T6BX 5HKHA 5D3IB 4RH6A 2K6DB 2YEPB 1H8CA 1STEA 4LJPB 1UBIA 2N9LA 4IM0A 4LDTD 1FIQA 4F1SA 1MPEA 3B9JA 2IDYA 3WAMA 2J53A 3SU8X 3PHXB 1PQSA 4DXAB 1LO5D 1VZ6A 1IBXA 3BK2A 4YTMB 4KZCA 5DPWA 3ML9A 1C78A 4E3CA 3ZTCA 2BKFA 2C7HA 1JWSD 5IO9A 1TY2A 2FE8A 1ENFA 2JPHA 3DBRI 2C7MB 4GU2A 3U2SC 3EUB2 5JHAA 5AEKB 1C76A 3FAHA 2ONQA 1OEYJ 1VCBA 1M94A 1IBXB 5FKAC 4F8CB 2DX5B 1F2RC 4XE0A 2DAFA 3MJWA 2CJNA 1V80A 3UF8A 2FCSA 1FXTB 2DENB 1L0YB 3TMPB 1ET9A 2EKIA 3MHZA 2ZCCA 1YJIA 1D5ZC 2J52A 1BT0A 1WF9A 1EWCA 2KQSA 3PPAA 4HXDA 1Z2MA 3NG0A 3ML8A 3AE9B 3WCQA 1Y8RC 4D2KA 5KHOA 2A5UA 3I57A 3TL5A 3ZLZA 1TTNA 2JWUA 2PKOA 1TBEA 2H88B 2G4SA 2QJLA 1Q0WB 4FULA 5H8YE 1YJJA 3VDZA 3ZTDA 3MC0B 3B1LX 2D3CA 2BYEA 2RSUA 2KWUB 1RFAA 2SAKA 4GB9A 2I1KA 2L32A 3AECB 2QHOA 5D3DA 2A4ZA 2BWFA 2BVCA 4IWPA 4ZHPA 2JXXA 2V1YA 1ZUD2 1YJ1A 3AE4B 5LXHA 4ZRJA 4G50A 4BFRA 2KDIA 1N60A 2CU1A 1Q1OA 2NBVB 2D10A 1EU3A 2MJEA 2CU3A 4BBNF 1I42A 2MA9B 5J2RA 2KN4A 3DBSA 4NNJB 4JLCA 1WRDB 5IAAC 3QCAA 2KC2A 1CQVA 3BIID 3W5VB 2WXFA 3VRBB 3VTVA 2NCNA 1B1ZA 2ZPYA 3LB8C 3GZNI 4J3OD 3ZGZA 4ICUA 1WGHA 1ZOYB 4P1CC 4WJQA 2L0FA 2IGGA 4GDLA 2INDC 4JWSC 1JWAD 3NY5A 2K0PA 2DZJA 2ZPNA 3NVVA 5BMIA 4G3XB 3B08A 4PT5A 1SE2A 1PGXA 2V4IB 1HXYD 3RT3B 2WX0A 4YTPB 3T3NA 4IWQA 1LGRA 1WXVA 2KWDA 3L0WB 2LVPA 4JX1C 3UQAA 5E6JA 4GDLB 1T0QC 2BQQA 1L6UA 1YQ4B 1SJED 4ARIA 3P42A 3NS1A 3ZJTA 3PTFC 3AEDB 2IO0B 3ZNZB 3A9JA 1PGBA 2LUMA 2O6VD 3IBEA 1LQBA 3DBHB 4LCDE 2GI9A 4II3B 1LM8B 1A70A 2Z0DB 3GE3C 2XBBC 2DAJA 4WH4A 1UUPA 3A9JB 4PYZA 4DDID 1XT9B 1D5MC 3C0RB 1ZXHA 2N9PC 2WU2B 1V49A 1WYWB 2LFIA 3T8MA 4FHJA 1E10A 2KMCA 3QX1A 1OGWA 1D4BA 2MBEA 3W1YA 3RZFA 1FRDA 5HI1A 4W9KA 2KVZA 1J0GA 1V9JA 4XWTA 1WX9A 1PUTA 5EE3A 4BAXA 1SB3C 2K1FA 4BBNC 1WZ0A 1L2NA 3DVGX 4LK0M 5BYQA 3Q6BA 4NY0A 1FM0D 4HROA 3WAOA 4IKGA 4RM8A 3RD2A 4IG7B 3B0AA 3HHMA 4BKSD 4IOIE 2M0AA 4K7WA 3V61A 3N32A 1F1HA 1ROEA 2GMIC 5E6NA 2J0JA 2KWCA 2CHXA 4AQ7A 4B6WA 2O6VA 1NEKB 1N5XA 1U4AA 5JHBA 4A3OA 1S3SG 4N59A 2BWES 2N7JA 2BS2B 3PLUA 1KF6B 1FFVA 3Q69A 1T0YA 3E9SA 4I6LB 1TKGA 2K22A 3PV1A 1N6ZA 1D3ZA 3Q8BA 1E0ZA 2JYTA 3Q3FA 3MC9A 2JSVX 2HJ1A 2KTRA 3OAWA 3LJ3A 4I6PA 4GN1A 4YXDB 1WM2A 1YN3A 3VR8B 1BMLC 4HKZE 4NAWB 4ARCA 4Q2JA 4FJYA 4B0EA 1GB4A 2Z8LA 2OOBB 2JRIB 3NOBA 2DZIA 2M8SA 1MJDA 2KTRB 1PYWD 5C3JB 2LJIA 5LLIA 2V3NA 4AWJA 3RNFC 1E8WA 2KTFA 3APCA 2XEWA 2INCC 4A9AA 4BKSA 2YEPF 2JU6X 1R7SA 5LXIB 1DGJA 2FCQA 1N5WA 3L17A 1KH0A 4AP4C 4LJOB 1AN8A 3ZUNA 2IY0B 2FCNA 2W55A 2WXOA 4ANVA 3CWIA 3L10B 2BBCA 3FC4A 3CMMB 1WJNA 3CIRB 1L4ZB 1FPYA 3PRMB 4TUUA 2NS5A 3DBRB 3GP7A 2KLCA 1KFYB 2IPKD 3QK0A 4HJKA 3DPDA 3RNGC 1UF0A 4L2YA 3QIJA 4W9FA 1L0XB 1M4VA 4WQMA 4WWMA 1GPXA 1BXTA 4B0MA 2N9XA 2I2YA 1VR9A 3R8BA 1XLNA 2AQ2B 2NVUI 1I4XA 2FUG1 4MT5A 2WQYB 1E5WA 4W9GA 5KHQA 3BYYB 3DOWA 4P1BC 2GBJA 3M95A 2G4DB 5DPRA 4BKGA 3N20C 1TKEA 4B95A 3AE3B 3VH3B 2M0XA 2L00B 3DHGC 2QC8A 3HRDD 3RNEC 3VVWB 4AJWA 1WSPA 2R61A 1WI0A 2V4LA 3I5JC 5TR5A 2LGXA 5HG2A 3P4PB 4MH0E 4C7ZA 3TCAA 4W9JA 4XGAB 3W1SC 3R2TA 1SE3A 1H4RA 1QOFA 3PSEB 1JCKB 3L08A 3BYTB 2LXCA 4KX6B 2CHZA 3EECA 4DXFA 5G5GA 1GOZA 4JWUC 2MCNB 3ZNGC 1WM3A 3CSFA 2V9HA 1ZXIA 4W9EA 4KSKC 3P2BA 2YVCA 3AB5A 2LZ6A 5BYSA 1NI3A 4IM3A 4MGKE 2MRPA 2BS3B 2WLBA 1UZXB 3DWGC 2PVOD 3WA0A 2N7DA 3BVGA 2D2QA 1AYFA 3N1XC 3EGRA 1UNSA 3A4SC 1I4GA 1YIWA 1N61A 4P16A 4WQOB 2JZZA 4OW0A 2ZW0A 2G45B 2JYEA 4BVUC 2KT7A 3GB1A 3EFCA 2FCMA 2IO1B 1QQRA 5CX3A 3GZNB 4RF1A 4WAFA 3VTWA 1FNUA 3KWVA 2L1AA 1N62A 3AV8A 2XK5A 2BS4B 1FMAD 4ZHOA 1R4NB 3IVFA 4ZYSA 2PLPA 1MG8A 4S0RA 2NBWB 4NPNA 1YNTE 1SIFA 3SD5A 4FHKA 3ZIMA 1TZ1A 3P63A 4HPMB 3ZO5B 2BKRB 1NDDA 2IJ0A 2OJRA 1RRBA 3K9PB 1I4HA 1E9MA 1IGDA 2OEDA 5D2MB 4HKQA 3AEBB 2LGDA 2XK5B 2ZVNA 4ZRIA 3IAM1 1VLBA 2Z59B 2QEJC 4HLEA 1FXAA 2LXAA 3BVMA 1K53A 1GAQB 3AMZA 3NZSA 3BK1A 3I9V1 2KFJA 3U30A 2DHZA 4TQ1A 1WE6A 3UINB 4OZAA 5IA7A 3P4QB 1RLFA 4DWFA 3ECIA 1XO3A 3RUIB 1WGRA 2PEAA 1I35A 2PTLA 2QSDA 1UWMA 1TS4A 4HVBA 4KKJA 2JF5A 3O65B 1WXAA 3T3OA 4NQKE 2JVCA 2V3PA 1I7HA 3IG3A 2GB1A 4W9IA 4RFBA 2RD0A 1CMXB 1YN4A 1GG3A 2HD5B 2K9XA 2M56B 1RM6C 1XEEA 3AM9A 2MWSB 4H2AA 4W9DA 3VR9B 2L76A 2TSSA 3I63C 2KD0A 1MHHE 3APDA 3AU5A 4PK1A 1EU4A 3H1UA 4OVUA 1QZEA 1OQRA 3RNBC 1XQQA 1RWSA 4WJPA 1NBFC 3LYYA 2KMMA 2GBKA 1WX8A 2GRIA 4TMAB 1OQQA 4DHJB 1C77A 3AE8B 3GE8C 3IHPC 1F9JA 2WXRA 1TGZB 2KDFB 2LHEA 1V5TA 4KGSA 4URKA 1QILA 1J7CA 2WXKA 3VAWA 3ZDTA 4CQNA 3GOEA 1P98A 1GNUA 4HWIB 3VUYA 2QIEB 2LGIA 2J42A 1V1PA 3NVWA 1NI2A 2E3TA 4OVZA 3RPFC 4JPSA 3KYCD 3TUOA 2IBIB 3P4RB 4LDTB 3ZYYX 4MELA 2L83A 2LVQA 3PZDA 1K51A 4MEMA 3N1YC 1MHXA 1UGMA 4MSMB 4US9A 4YSYB 4EKUA 4RM9A 3RCZA 2MSED 3L4PA 1LFDA 1V1PB 3ZNID 3IAS1 2Q5WD 4GSWA 3SHQA 4YTNB 2RDBC 3QC8B 4USAA 4LNKA 2DYOA 3TSSA 3QAQA 2W9NA 1I4RA 4BZAA 1HQRD 3QQ8B 1TIFA 1WYGA 2SEBD 3N9YC 4EOYA 2KDEB 2DYMA 1SBBB 2LI5A 3VRAB 1R4NI 2AWTA 2VH2A 4RGOS 1ET6A 3QARA 3LXFA 2BGFA 3ZJUA 2M1MA 1GB1A 1WZ3A 4GOCA 4ANUA 4MSQB 1GC6A 4PS8A 1HZ5A 1XCQL 1F77A 2KKCA 3NRZA 2Y5CA 3MFGA 4RGMA 1VRAB 3PRZA 4E71A 4ASWC 2D3BA 2DLBA 4FXCA 3RYTA 2MBBB 2ZVOA 2LD9A 3TJPA 2KAJA 3IFWB 1S1QB 2KHWB 1TKYA 1C1YB 5L95C 2KK8A 3TEYA 2BYFA 2LHDA 2DBYA 3QJZA 5G2NA 5AZHA 1ACCA 3KH0A 1RAXA 3WIMA 1IGCA 1L7YA 3ETRA 1HEZE 4WIPA 4DQOC 2L05A 1I4PA 3KWLA 4XDCA 2K8HA 5EDSA 2B76B 5D7GA 2L3ZA 3GS2A 4X57B 3DWMA 4XX5A 2J4XA 5DPTA 3DQVA 3PZ7A 1P9DU 1WIAA 5J18A 3H6NA 1OTRB 4EZJA 3V3XA 4PS7A 2EMTA 3QA8A 4JQWC 4KSLC 2KACA 4IC7B 2LUEA 2CHWA 1HE8A 3N3KB 2JY6A 2KVRA 1PDXA 5FK9C 1CK1A 5BO4B 4MM3A 1SE4A 3PT2B 3NJTA 1TT5B 2I1JA 1GC7A 1V1OA 2HE7A 4G11A 2QMTA 3BY4B 3AI5A 3MC8A 3V05A 2WXLA 3A4RA 3N30A 4WWOA 2C60A 3AE1B 4LNNA 4A90A 3U8ZA 3KQ4A 4S17A 4KGTA 4MM3B 1QOBA 1A5RA 5J17A 3HM6X 1WFYA 4K3CA 4JE3B 1P3QU 1DOIA 1F2RI 2WXGA 1JRPA 2L7RA 4GIVA 2Y5PA 1KLUD 2G9HD 2N4FA 4II2B 3JSVA 4TV3A 2ON8A 5I4DA 1D5XC 1SGHA 4K81A 1YX6B 2O6VB 3R7RA 3WALA 4C7YA 4W9HA 2LGSA 1L4DB 1C4PA 3AU4A 2IYDB 2WXMA 5JZEB 5AZGA 1G6JA 2VZKD 1WGYA 4TQ0A 1FFUA 1AARA 3W9CB 2LJ5A 2KMAA 4FLHA 4ANXA 4A55A 3FILA 4FADA 2JUOA 3JSVB 1PFDA 2OJWA 1FCLA 3SDLC 3D32A 1N63A 3PLVA 1JWBD 1V86A 2ZZPB 3UQBA 1E8XA 1OQYA 5JXVA 2C7NB 2DNFA 4KVGB 1V2YA 5HFYA 5DPSA 1DOXA 4N6EB 1SE9A 4KIKA 1MFWA 2ZCBA 1JWMD 2DYBA 1HTOA 2C5LC 2AQ1B 1XCTL 5L83A 2R2OA 2AQ3B 3FILB 3W5UB 2WDTB 2ZNVC 3AEAB 2R2QA 1ESFA 3EHVA 4AUQC 3TEXA 1XF5L 4WWPA 2GLSA 4LNIA 1ZPSA 3AXCA 2D07B 2IY1B 2H89B 2K3UA 2AL3A 1TS3A 1E7UA 4GGQA 3DHHC 3OWEB 4KIKB 2DZMA 3UIPB 2INNE 1F52A 3ZKJC 2NBUA 3PS6A 3NZUA 1J7AA 3OG5A 1P0RA 1J7BA 2JZ3B 1MVKA 1RYJA 2KOXA 3PRPB 4PS3A 4OZBA 1EM7A 5T8IA 1JQ4A 1UD7A 3U4EG 4O1NA 4B9KA 1WWTA 3PO0A 2FUHB 3UI3A 5CHVC 4EUTA 4US8A 4KZ0A 1XD3B 1YD8U 1GUAB 4A6QA 1FEHA 2KX0A 3TEZA 1EF1A 3DVNV 1IYFA 4JL9A 1C79A 4WJNA 1UELA 2BB6A 3O13A 2VZKB 2MLBA 3H8HA 3HVZA 1QOGA 1DOYA 1IPGA 1EUVB 5BYRA 2WU5B 1YOVB 5E6OA 5AUIA 3RNAC 2KZRA 1FNWA 3ZDMC 4HCNB 3HVDA 2KJ6A 1ZKHA 1XLQA 3URYA 5EE0A 3ENEA 2BPSA 1XLOA 1KTKA 3S2AA 3R66C 2PE9A 3N1ZC 1WGGA 3ZRFA 3TBLD 3X23A 2MX2A 1T5XD 4NAMA 2WWZA 3R7QA 1TS5A 2N1VA 4C80A 3A1QA 4L23A 5AUKA 4BOZB 1TYGB 1VDVA 1WJ6A 3HK0A 2HDEA 3Q8CA 3U7DA 2KDBA 1JROA 1WGKA 4P6VF 3RN9C 4MGIE 3H7PA 3ZRCA 2KLGA 4YSZB 2MW5A 2JQRB 2LEKA 2Z0EB 1QKZA 4MJSA 4ZRKA 3A1QB 1WR6E 3PREA 1CJEA 4A20A 2UU7A 1KJTA 3DVNU 2MHJA 2KANA 1KM7A 1P7FA 2I38A 3ALBA 2GOWA 2IGDA 2RGFA 4ANWA 1UH6A 4HJGE 2JRHA 2LASA 4HRSA 1HZ6A 3H7PB 2ICIA 4CHKA 2WXIA 3FKYA 4IDIA 2BYTA 4I6NB 1X1MA 5IP4D 4ZOHC 1OFFA 1SSNA 3JW0X 3AN1A 1V8CA 2AEHA 5HHDG 1E7PB 1PGAA 2K25A 3TIXA 2ASQA 1FRRA 3L13A 2OHFA 5H92C 4KKIA 2D5GA 3P1MA 4K3BA 1WXMA 1SIJA 1MG4A 2W82A 1L5PA 1WXSA 4M8MA 2BTEA 2WXJA 2AX5A 1KLVA 1VJKA 2GBRA 1FNVA 4MGYE 2V3SA 2MBHA 4W9CA 1XXGA 4FJVB 4XWWA 2IO2B 2KXJA 2KJRA 3R2IA 4GLSC 4WAAA 1CZPA 4KDLB 2PE6B 1WH3A 2MJ3A 3E56A 2VRRB 2NTTA 1JMLA 2Y5BB 2CR5A 2EKEC 4PYUA 3SFEB 3UIOB 1JRUA 5C23A 1SJHD 3J9CA 4HDOA 1EF5A 2DZKA 1SEBD 1E7VA 3RMKC 4DBGA 3PZ8A 1I4QA 3X0WA 3ONSA 4LNOA 1YQ3B 2PPHA 4EZLA 1WE7A 3PVLA 1Q10A 1GJZA 2WDRB 2D11A 4GXBA 1ZE3D 2MJDA 3CSTA 4MGZE 3Q3JA 5G5HA 1FD6A 4M01A 2AL6A 3DBLB 1LXDA 2UWQA 2KDMA 1WR1A 3M63B 2CJOA 2K8CA 2WNMA 4HPLB 3ZXVA 3IT4B 3SEBA 2RPQA 3HM3A 4ITKA 5CTRC 4AS1A 3U7ZA 2KJHB 2FIDA 4OVVA 4LTUA 2KO3A 2K6QA 3KUDB 2JT4B 3M62B 2WXNA 4DDGD 3CF6E 3MJ5A 5GXGB 3NS8A 3ZW3A 2W3RA 3KLSX 4HPPA 2N1WA 2PW9A 4C00A 1ZP0B 2RDGA 2M17A 3KYDD 1WJUA 3ZQ4A 1XLPA 2WX1A 1F0ZA 1K8RB 3VUWA 2MEKA 3VH4B 1OEYA 2RPVA 3AE7B 3BWUD 1EWYC 4RGNA 2K5PA 1FO4A 3OJ4B 3B2FA 1V6EA 1ISNA 2KYWA 2E6XA 2NTSA 4HEA1 4CO7A 4ICVA 4GDKA 5GMVA 1TJEA 2FNJB 2KNBA 1T0SC 1Z5SB 3AE2B 2L8JA 1R4MI 3UGBB 3DVGY 5LNK1 1WJ4A 3BINA 1C4AA 3VHTC 1ZDXA 3V62A 2UYZB 4KV2A 2EMSA 4FBJB 2KQ7A 2MH7A 2GBMA 4OZCA 4GDKB 4WJOA 1YN5A 4W9LA 4LNFA 5TSSA 3AE6B 2MBQA 4XDDA 1QT9A 5FR3A 4P7IA 2NR2A 2PJHA 4HDQA 1WGDA 3BVZA 3KVFB 2KN5A 4IWOA 2PIAA 1KOTA 1ZW7A 1VD2A 2C9WB 4AOFA 3V60A 2D3GA 4KGRA 2J0KA 1C4CA 2W54A 2NMQA 2REXA 2WDVB 4HCPB 5MPOA 1QLBB 3JYUA 2KFKA 2IO3B 4ZYNA 3NUHB 1FCCC 2N0SB 4JIOU 5C1ZA 2MP2A 2W3SA 3B2GA 2IGHA 3HIZA 3PHWB 3Q3MC 3EFUA 4ZDVA 5EE1A 4N9F4 2GBNA 3WAPA 2X8XX 2XN9C 3RI7C 2L0TA 4G0NB 1NENB 4QAYA 1Q5WB 4WURA 4IW0A 2Y3AA 2WDQB 2KFKB 4L1BA 3RNCC 4XC2A 1JWUD 4CYEA 1RFKA 4NJ7A 2BB5A 1V97A 5IOIA 2HTME 4DK5A 2MP2B 4A3PA 5AZFA 4F7ZA 2LVOA 2MBOA 3A33B 3AH7A 1E8ZA 4RCOA 3I3TB 3VXWA 1AWDA 2ZEQA 3PGEA 3DBLI 2CS4A 1P7EA 4EZKA 3ZNHB 1E90A 3DCGA 3Q3NC 2BF8B 3VUXA 2ZJDA 4IM2A 1NYRA 3VFKA 1C3TA 1TS2A 2G3QB 2WXQA 2HJ8A 2WXPA 3AEGB 4TKNA 1E8YA 4YT0B 4NQLB 1NYQA 1QOAA 3KUCB 2JWZA 4C56C 1J19A 4REZA 1MI0A 1L6VA 2JZPA 2LRUA 5G55A 1L0VB 3W2DA 4A8XC 5E6PA 5IKCM 4NAWA 4YL8A 1WRIA 4K7SA 4IUMB 3Q2AC 2INPE 5EE9A 4MH8A 1HTQA 5IN7A 2K8BA 3QWZB 2WYQA 4R3DA 2FAZA 3P4SB 5BMHA 2LRWA 2ZW1A 2WGSA 2O2VA 2MQJA
chains in the Genus database with same CATH topology
3NHEB 4LCDE 4EFOA 3H7SA 4M8NA 1XQQA 2WWZA 1WX7A 4II3B 2N1VA 3R7QA 3A1QA 2BYVE 1LM8B 4WJPA 1NBFC 2KWVB 2Z0DB 4BOZB 2XBBC 1WJ6A 2GBKA 3HK0A 1WX8A 3U7DA 3VQIA 3A9KA 2DAJA 2KDBA 4DHJB 3UQBA 3IHPC 1F9JA 3A9JB 1TGZB 4FA6A 4PYZA 3T9LA 4DDID 3RZWC 5D94A 2KDFB 4URKA 1V5TA 3OJ3A 4MGIE 3H7PA 3ZRCA 1XT9B 2KLGA 3KW5B 3C0RB 4DHZE 2O2VB 4JGHB 2MW5A 2N9PC 2Z0EB 3VAWA 4MJSA 4ZRKA 3ZDTA 1J8CA 3A1QB 1EO6A 1V49A 1WR6E 1WYWB 3PREA 3T8MA 3GOEA 4FHJA 2KMCA 4M0WB 3V6EB 1P98A 3QX1A 1GNUA 1OGWA 3MHSD 4HWIB 4A20A 2MBEA 1KJTA 3VUYA 3DVNU 3W1YA 3RZFA 2KANA 1KM7A 4W9KA 3A9KB 4WWNA 1NI2A 3ALBA 2GOWA 4EEWA 1J0GA 2RGFA 3KYCD 4ANWA 1V9JA 1UH6A 2IBIB 3ZVVA 2JRHA 2YLMA 2LASA 4LDTB 2M4NA 3H7PB 4MELA 2KC1A 2KX3A 1WX9A 4HK2A 4CHKA 3M3JA 3L16A 3DBHI 2LVQA 4FJZA 2K1FA 3IBEA 3PZDA 4BBNC 1WZ0A 1L2NA 4MEMA 4I6NB 1UGMA 3DVGX 4MSMB 4EKUA 1X1MA 4NY0A 4RM9A 2N7EA 3JW0X 3RCZA 1IP9A 2MSED 3WAOA 3L54A 2AEHA 2J7QB 4RM8A 3RD2A 2LGYA 4IG7B 3B0AA 1YQBA 1LFDA 2N9EB 3HHMA 1YX5B 4J6IA 4BKSD 3RULA 3ZNID 4GSWA 4K7WA 3SHQA 3V61A 3N32A 2K25A 3QC8B 2GMIC 3TIXA 2ASQA 3L13A 2DYOA 5E6NA 3VTUA 3V6CB 2J0JA 3QAQA 2KWCA 2W9NA 2ZNVB 1WXMA 2CHXA 4B6WA 2O6VA 1U4AA 3QQ8B 5JHBA 4A3OA 4EOYA 1S3SG 1WXSA 4M8MA 2KDEB 2DYMA 2BWES 1KLVA 2LI5A 1R4NI 2GBRA 2AWTA 3PLUA 4MGYE 1T0YA 2V3SA 2MBHA 4W9CA 3QARA 4I6LB 2BGFA 4FJVB 3PV1A 2M1MA 2IO2B 2RR9A 2KXJA 2KJRA 4WAAA 1WZ3A 2K39A 4KDLB 1D3ZA 2PE6B 1WH3A 4GOCA 4ANUA 4MSQB 1GC6A 4PS8A 3MTNB 2VRRB 3Q3FA 2Y5BB 2CR5A 3K9OB 2EKEC 2KKCA 4PYUA 2KTRA 4FN2A 3UIOB 1JRUA 3PRZA 3OAWA 5C23A 2B3AA 4E71A 3LJ3A 4HDOA 4ASWC 1EF5A 2DZKA 4I6PA 3RYTA 1E7VA 4DBGA 2MBBB 4GN1A 2ZVOA 2LD9A 3X0WA 3ONSA 3TJPA 1WM2A 2PPHA 4EZLA 3IFWB 4NAWB 4RMAA 1S1QB 1WE7A 3JVZX 2KHWB 1C1YB 3PVLA 4BKTA 1GJZA 5L95C 2FIFA 5D6JB 2KK8A 2BYFA 2D11A 4FJYA 4GXBA 3QHTA 1V81A 2HTHA 3EC8A 3CSTA 3QJZA 5G2NA 2OOBB 2JRIB 3NOBA 3W1SA 2DZIA 2M8SA 2AYOB 4KDIC 4MGZE 4MDKE 1UBQA 5AZHA 3Q3JA 3KH0A 2KTRB 5DCNA 1RAXA 5LLIA 3WIMA 1L7YA 4AWJA 2AL6A 4XZ4A 2L05A 1E8WA 2J0MA 2KTFA 2K8HA 2NPTA 1WMHA 3APCA 5EDSA 1LXDA 2UWQA 2XEWA 5FR6A 3OLMD 5D7GA 2L3ZA 4BKSA 1WR1A 3AULA 3M63B 4X57B 5LXIB 4XX5A 2FCQA 2K8CA 4HPLB 3L17A 4AP4C 1P1AA 2IZVB 5DPTA 2RPQA 3HM3A 4LJOB 5CTRC 2KJHB 3ZUNA 2FIDA 2IY0B 4OVVA 3WANA 3DQVA 2KO3A 2FCNA 2K6QA 4ANVA 3KUDB 2JT4B 3M62B 3L10B 1V5OA 4DDGD 1WY8A 3CF6E 4BOSC 1P9DU 1WIAA 4AJYB 5CHWA 3CMMB 4K1RB 4NJ6A 1WJNA 3NS8A 3ZW3A 5J18A 3H6NA 1OTRB 1ZGUB 2NPTB 2N1WA 3PRMB 4TUUA 4EZJA 2NS5A 1WMHB 4PS7A 2EMTA 3QA8A 4JQWC 2M17A 4DHJD 5JH5C 3KYDD 4KSLC 1WJUA 2KLCA 3QK0A 4HJKA 4E74A 4K7UA 4IC7B 2WX1A 1K8RB 2LUEA 4MJSB 3H9DA 2CKHB 2CHWA 1HE8A 3N3KB 3VUWA 3DPDA 2JY6A 2KVRA 3APFA 4DHZB 3DDCB 3VH4B 1OEYA 2LWPA 3QIJA 4MM3A 4W9FA 5BO4B 3PT2B 3KUZA 5CHFA 4GMVA 3R3MA 3LDZE 2I1JA 1GC7A 2HE7A 5HKHA 4G11A 3BY4B 3OJ4B 3AI5A 2N9XA 1H8CA 2K6DB 1V6EA 4LJPB 1UBIA 3A4RA 1ISNA 3N30A 2NVUI 4WWOA 4IM0A 2C60A 4LDTD 1E5WA 4W9GA 4F1SA 5KHQA 4CO7A 3U8ZA 3DOWA 2GBJA 4ICVA 4GDKA 5GMVA 3M95A 3WAMA 3SU8X 3PHXB 1PQSA 4DXAB 2G4DB 5DPRA 4BKGA 2FNJB 1A5RA 2KNBA 5J17A 3HM6X 1WFYA 1Z5SB 4B95A 3VH3B 2M0XA 2L00B 4KZCA 2L8JA 1R4MI 1P3QU 3ML9A 5DPWA 4E3CA 3ZTCA 3VVWB 2BKFA 2C7HA 3DVGY 3UGBB 4AJWA 2L7RA 4GIVA 1WJ4A 4II2B 2N4FA 4TV3A 2JPHA 3BINA 3JSVA 3DBRI 1WI0A 3VHTC 2C7MB 4GU2A 2V4LA 3V62A 2UYZB 5TR5A 1SGHA 4K81A 1YX6B 2O6VB 3R7RA 3WALA 5JHAA 2LGXA 5AEKB 4W9HA 4KV2A 2EMSA 4FBJB 2KQ7A 4MH0E 2GBMA 3AU4A 4GDKB 2IYDB 3TCAA 1OEYJ 4W9JA 4WJOA 5AZGA 1VCBA 5JZEB 1G6JA 4W9LA 3W1SC 3PSEB 1H4RA 1WGYA 4TQ0A 1M94A 1AARA 2MBQA 3L08A 2LXCA 2CHZA 4F8CB 2DX5B 3EECA 2LJ5A 2KMAA 4FLHA 4ANXA 2DAFA 3MJWA 1V80A 3UF8A 2MCNB 4P7IA 2NR2A 3ZNGC 1WM3A 3CSFA 4FADA 2PJHA 2FCSA 1FXTB 2JUOA 3JSVB 2DENB 4HDQA 1WGDA 3TMPB 4W9EA 3KVFB 2KN5A 4IWOA 3P2BA 4KSKC 3SDLC 3D32A 3PLVA 1KOTA 2YVCA 1ZW7A 1V86A 1VD2A 2C9WB 2LZ6A 2ZCCA 2ZZPB 4IM3A 1E8XA 4MGKE 1OQYA 2D3GA 2MRPA 3V60A 2J0KA 2C7NB 4KVGB 1V2YA 1UZXB 1BT0A 1WF9A 5DPSA 2REXA 3WA0A 2N7DA 3PPAA 2KQSA 4HCPB 1SE9A 4HXDA 2D2QA 4AOFA 4KIKA 2ZCBA 1Z2MA 3JYUA 3A4SC 3ML8A 2DYBA 1YIWA 2KFKA 2C5LC 1Y8RC 2IO3B 5KHOA 4ZYNA 2A5UA 3TL5A 5L83A 2R2OA 4WQOB 3ZLZA 1TTNA 2JZZA 4JIOU 2WDTB 2ZNVC 1TBEA 2R2QA 5C1ZA 3EHVA 4AUQC 2G45B 2MP2A 2G4SA 4BVUC 1Q0WB 4FULA 4WWPA 3VDZA 3PHWB 3AXCA 3HIZA 3ZTDA 2FCMA 3EFUA 4ZDVA 3B1LX 2IO1B 4N9F4 2GBNA 3WAPA 5CX3A 2D07B 2IY1B 2BYEA 2RSUA 2KWUB 2AL3A 1RFAA 1E7UA 4GGQA 4GB9A 2L0TA 4G0NB 2I1KA 1Q5WB 3VTWA 4IW0A 4KIKB 2QHOA 2DZMA 3UIPB 2A4ZA 2BWFA 2KFKB 3ZKJC 2NBUA 2XK5A 4XC2A 3PS6A 4IWPA 3IVFA 2JXXA 2V1YA 3NZUA 1MG8A 4CYEA 1YJ1A 4NJ7A 2NBWB 4NPNA 1P0RA 4DK5A 2MP2B 5LXHA 2JZ3B 4A3PA 4ZRJA 1SIFA 5AZFA 4F7ZA 3SD5A 2LVOA 2MBOA 2KDIA 3A33B 4FHKA 4G50A 4BFRA 2CU1A 3ZIMA 1Q1OA 2NBVB 1TZ1A 1E8ZA 2KOXA 2D10A 4HPMB 3ZO5B 2BKRB 3I3TB 3PRPB 4PS3A 1NDDA 3VXWA 4BBNF 1I42A 1UD7A 2MA9B 4B9KA 2OJRA 2ZEQA 1RRBA 2FUHB 3PGEA 5J2RA 3DBLI 3K9PB 3DBSA 4NNJB 2CS4A 5D2MB 4JLCA 2LGDA 1WRDB 5CHVC 4EZKA 5IAAC 2XK5B 2ZVNA 4ZRIA 3ZNHB 4EUTA 3QCAA 4KZ0A 1XD3B 2Z59B 2KC2A 1YD8U 1E90A 3DCGA 1GUAB 4HLEA 2BF8B 3VUXA 2KX0A 2LXAA 2ZJDA 4IM2A 3VTVA 2NCNA 1EF1A 3NZSA 3DVNV 2KFJA 2ZPYA 1IYFA 3U30A 3GZNI 4JL9A 3VFKA 2DHZA 4TQ1A 1WE6A 3UINB 1C3TA 5IA7A 2G3QB 1UELA 1WGHA 4ICUA 4WJNA 1RLFA 2HJ8A 4TKNA 4WJQA 2L0FA 3ECIA 3RUIB 1E8YA 4DWFA 1WGRA 2PEAA 2MLBA 4GDLA 4NQLB 3KUCB 1I35A 2JWZA 3NY5A 1J19A 2DZJA 2ZPNA 4HVBA 1IPGA 2JF5A 3O65B 1WXAA 4NQKE 4G3XB 3B08A 2JVCA 2LRUA 1EUVB 5G55A 5E6PA 3IG3A 4NAWA 4YL8A 5E6OA 2KZRA 4W9IA 3RT3B 3ZDMC 2RD0A 4K7SA 2WX0A 4HCNB 1CMXB 4IUMB 1GG3A 4IWQA 2HD5B 1WXVA 2KJ6A 3L0WB 1ZKHA 2LVPA 3UQAA 3ENEA 4GDLB 2BPSA 2K8BA 2MWSB 4W9DA 2L76A 3PTFC 3QWZB 2WYQA 2IO0B 3ZNZB 2FAZA 3A9JA 2KD0A 2LRWA 3S2AA 3APDA 3R66C 2PE9A 1WGGA 3AU5A 3ZRFA 3TBLD 3X23A 3H1UA 4OVUA 2O6VD 2MX2A 1QZEA 2O2VA 1LQBA 2MQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHE B;  4LCD E;  4EFO A;  3H7S A;  4M8N A;  1XQQ A;  2WWZ A;  1WX7 A;  4II3 B;  2N1V A;  3R7Q A;  3A1Q A;  2BYV E;  1LM8 B;  4WJP A;  1NBF C;  2KWV B;  2Z0D B;  4BOZ B;  2XBB C;  1WJ6 A;  2GBK A;  3HK0 A;  1WX8 A;  3U7D A;  3VQI A;  3A9K A;  2DAJ A;  2KDB A;  4DHJ B;  3UQB A;  3IHP C;  1F9J A;  3A9J B;  1TGZ B;  4FA6 A;  4PYZ A;  3T9L A;  4DDI D;  3RZW C;  5D94 A;  2KDF B;  4URK A;  1V5T A;  3OJ3 A;  4MGI E;  3H7P A;  3ZRC A;  1XT9 B;  2KLG A;  3KW5 B;  3C0R B;  4DHZ E;  2O2V B;  4JGH B;  2MW5 A;  2N9P C;  2Z0E B;  3VAW A;  4MJS A;  4ZRK A;  3ZDT A;  1J8C A;  3A1Q B;  1EO6 A;  1V49 A;  1WR6 E;  1WYW B;  3PRE A;  3T8M A;  3GOE A;  4FHJ A;  2KMC A;  4M0W B;  3V6E B;  1P98 A;  3QX1 A;  1GNU A;  1OGW A;  3MHS D;  4HWI B;  4A20 A;  2MBE A;  1KJT A;  3VUY A;  3DVN U;  3W1Y A;  3RZF A;  2KAN A;  1KM7 A;  4W9K A;  3A9K B;  4WWN A;  1NI2 A;  3ALB A;  2GOW A;  4EEW A;  1J0G A;  2RGF A;  3KYC D;  4ANW A;  1V9J A;  1UH6 A;  2IBI B;  3ZVV A;  2JRH A;  2YLM A;  2LAS A;  4LDT B;  2M4N A;  3H7P B;  4MEL A;  2KC1 A;  2KX3 A;  1WX9 A;  4HK2 A;  4CHK A;  3M3J A;  3L16 A;  3DBH I;  2LVQ A;  4FJZ A;  2K1F A;  3IBE A;  3PZD A;  4BBN C;  1WZ0 A;  1L2N A;  4MEM A;  4I6N B;  1UGM A;  3DVG X;  4MSM B;  4EKU A;  1X1M A;  4NY0 A;  4RM9 A;  2N7E A;  3JW0 X;  3RCZ A;  1IP9 A;  2MSE D;  3WAO A;  3L54 A;  2AEH A;  2J7Q B;  4RM8 A;  3RD2 A;  2LGY A;  4IG7 B;  3B0A A;  1YQB A;  1LFD A;  2N9E B;  3HHM A;  1YX5 B;  4J6I A;  4BKS D;  3RUL A;  3ZNI D;  4GSW A;  4K7W A;  3SHQ A;  3V61 A;  3N32 A;  2K25 A;  3QC8 B;  2GMI C;  3TIX A;  2ASQ A;  3L13 A;  2DYO A;  5E6N A;  3VTU A;  3V6C B;  2J0J A;  3QAQ A;  2KWC A;  2W9N A;  2ZNV B;  1WXM A;  2CHX A;  4B6W A;  2O6V A;  1U4A A;  3QQ8 B;  5JHB A;  4A3O A;  4EOY A;  1S3S G;  1WXS A;  4M8M A;  2KDE B;  2DYM A;  2BWE S;  1KLV A;  2LI5 A;  1R4N I;  2GBR A;  2AWT A;  3PLU A;  4MGY E;  1T0Y A;  2V3S A;  2MBH A;  4W9C A;  3QAR A;  4I6L B;  2BGF A;  4FJV B;  3PV1 A;  2M1M A;  2IO2 B;  2RR9 A;  2KXJ A;  2KJR A;  4WAA A;  1WZ3 A;  2K39 A;  4KDL B;  1D3Z A;  2PE6 B;  1WH3 A;  4GOC A;  4ANU A;  4MSQ B;  1GC6 A;  4PS8 A;  3MTN B;  2VRR B;  3Q3F A;  2Y5B B;  2CR5 A;  3K9O B;  2EKE C;  2KKC A;  4PYU A;  2KTR A;  4FN2 A;  3UIO B;  1JRU A;  3PRZ A;  3OAW A;  5C23 A;  2B3A A;  4E71 A;  3LJ3 A;  4HDO A;  4ASW C;  1EF5 A;  2DZK A;  4I6P A;  3RYT A;  1E7V A;  4DBG A;  2MBB B;  4GN1 A;  2ZVO A;  2LD9 A;  3X0W A;  3ONS A;  3TJP A;  1WM2 A;  2PPH A;  4EZL A;  3IFW B;  4NAW B;  4RMA A;  1S1Q B;  1WE7 A;  3JVZ X;  2KHW B;  1C1Y B;  3PVL A;  4BKT A;  1GJZ A;  5L95 C;  2FIF A;  5D6J B;  2KK8 A;  2BYF A;  2D11 A;  4FJY A;  4GXB A;  3QHT A;  1V81 A;  2HTH A;  3EC8 A;  3CST A;  3QJZ A;  5G2N A;  2OOB B;  2JRI B;  3NOB A;  3W1S A;  2DZI A;  2M8S A;  2AYO B;  4KDI C;  4MGZ E;  4MDK E;  1UBQ A;  5AZH A;  3Q3J A;  3KH0 A;  2KTR B;  5DCN A;  1RAX A;  5LLI A;  3WIM A;  1L7Y A;  4AWJ A;  2AL6 A;  4XZ4 A;  2L05 A;  1E8W A;  2J0M A;  2KTF A;  2K8H A;  2NPT A;  1WMH A;  3APC A;  5EDS A;  1LXD A;  2UWQ A;  2XEW A;  5FR6 A;  3OLM D;  5D7G A;  2L3Z A;  4BKS A;  1WR1 A;  3AUL A;  3M63 B;  4X57 B;  5LXI B;  4XX5 A;  2FCQ A;  2K8C A;  4HPL B;  3L17 A;  4AP4 C;  1P1A A;  2IZV B;  5DPT A;  2RPQ A;  3HM3 A;  4LJO B;  5CTR C;  2KJH B;  3ZUN A;  2FID A;  2IY0 B;  4OVV A;  3WAN A;  3DQV A;  2KO3 A;  2FCN A;  2K6Q A;  4ANV A;  3KUD B;  2JT4 B;  3M62 B;  3L10 B;  1V5O A;  4DDG D;  1WY8 A;  3CF6 E;  4BOS C;  1P9D U;  1WIA A;  4AJY B;  5CHW A;  3CMM B;  4K1R B;  4NJ6 A;  1WJN A;  3NS8 A;  3ZW3 A;  5J18 A;  3H6N A;  1OTR B;  1ZGU B;  2NPT B;  2N1W A;  3PRM B;  4TUU A;  4EZJ A;  2NS5 A;  1WMH B;  4PS7 A;  2EMT A;  3QA8 A;  4JQW C;  2M17 A;  4DHJ D;  5JH5 C;  3KYD D;  4KSL C;  1WJU A;  2KLC A;  3QK0 A;  4HJK A;  4E74 A;  4K7U A;  4IC7 B;  2WX1 A;  1K8R B;  2LUE A;  4MJS B;  3H9D A;  2CKH B;  2CHW A;  1HE8 A;  3N3K B;  3VUW A;  3DPD A;  2JY6 A;  2KVR A;  3APF A;  4DHZ B;  3DDC B;  3VH4 B;  1OEY A;  2LWP A;  3QIJ A;  4MM3 A;  4W9F A;  5BO4 B;  3PT2 B;  3KUZ A;  5CHF A;  4GMV A;  3R3M A;  3LDZ E;  2I1J A;  1GC7 A;  2HE7 A;  5HKH A;  4G11 A;  3BY4 B;  3OJ4 B;  3AI5 A;  2N9X A;  1H8C A;  2K6D B;  1V6E A;  4LJP B;  1UBI A;  3A4R A;  1ISN A;  3N30 A;  2NVU I;  4WWO A;  4IM0 A;  2C60 A;  4LDT D;  1E5W A;  4W9G A;  4F1S A;  5KHQ A;  4CO7 A;  3U8Z A;  3DOW A;  2GBJ A;  4ICV A;  4GDK A;  5GMV A;  3M95 A;  3WAM A;  3SU8 X;  3PHX B;  1PQS A;  4DXA B;  2G4D B;  5DPR A;  4BKG A;  2FNJ B;  1A5R A;  2KNB A;  5J17 A;  3HM6 X;  1WFY A;  1Z5S B;  4B95 A;  3VH3 B;  2M0X A;  2L00 B;  4KZC A;  2L8J A;  1R4M I;  1P3Q U;  3ML9 A;  5DPW A;  4E3C A;  3ZTC A;  3VVW B;  2BKF A;  2C7H A;  3DVG Y;  3UGB B;  4AJW A;  2L7R A;  4GIV A;  1WJ4 A;  4II2 B;  2N4F A;  4TV3 A;  2JPH A;  3BIN A;  3JSV A;  3DBR I;  1WI0 A;  3VHT C;  2C7M B;  4GU2 A;  2V4L A;  3V62 A;  2UYZ B;  5TR5 A;  1SGH A;  4K81 A;  1YX6 B;  2O6V B;  3R7R A;  3WAL A;  5JHA A;  2LGX A;  5AEK B;  4W9H A;  4KV2 A;  2EMS A;  4FBJ B;  2KQ7 A;  4MH0 E;  2GBM A;  3AU4 A;  4GDK B;  2IYD B;  3TCA A;  1OEY J;  4W9J A;  4WJO A;  5AZG A;  1VCB A;  5JZE B;  1G6J A;  4W9L A;  3W1S C;  3PSE B;  1H4R A;  1WGY A;  4TQ0 A;  1M94 A;  1AAR A;  2MBQ A;  3L08 A;  2LXC A;  2CHZ A;  4F8C B;  2DX5 B;  3EEC A;  2LJ5 A;  2KMA A;  4FLH A;  4ANX A;  2DAF A;  3MJW A;  1V80 A;  3UF8 A;  2MCN B;  4P7I A;  2NR2 A;  3ZNG C;  1WM3 A;  3CSF A;  4FAD A;  2PJH A;  2FCS A;  1FXT B;  2JUO A;  3JSV B;  2DEN B;  4HDQ A;  1WGD A;  3TMP B;  4W9E A;  3KVF B;  2KN5 A;  4IWO A;  3P2B A;  4KSK C;  3SDL C;  3D32 A;  3PLV A;  1KOT A;  2YVC A;  1ZW7 A;  1V86 A;  1VD2 A;  2C9W B;  2LZ6 A;  2ZCC A;  2ZZP B;  4IM3 A;  1E8X A;  4MGK E;  1OQY A;  2D3G A;  2MRP A;  3V60 A;  2J0K A;  2C7N B;  4KVG B;  1V2Y A;  1UZX B;  1BT0 A;  1WF9 A;  5DPS A;  2REX A;  3WA0 A;  2N7D A;  3PPA A;  2KQS A;  4HCP B;  1SE9 A;  4HXD A;  2D2Q A;  4AOF A;  4KIK A;  2ZCB A;  1Z2M A;  3JYU A;  3A4S C;  3ML8 A;  2DYB A;  1YIW A;  2KFK A;  2C5L C;  1Y8R C;  2IO3 B;  5KHO A;  4ZYN A;  2A5U A;  3TL5 A;  5L83 A;  2R2O A;  4WQO B;  3ZLZ A;  1TTN A;  2JZZ A;  4JIO U;  2WDT B;  2ZNV C;  1TBE A;  2R2Q A;  5C1Z A;  3EHV A;  4AUQ C;  2G45 B;  2MP2 A;  2G4S A;  4BVU C;  1Q0W B;  4FUL A;  4WWP A;  3VDZ A;  3PHW B;  3AXC A;  3HIZ A;  3ZTD A;  2FCM A;  3EFU A;  4ZDV A;  3B1L X;  2IO1 B;  4N9F 4;  2GBN A;  3WAP A;  5CX3 A;  2D07 B;  2IY1 B;  2BYE A;  2RSU A;  2KWU B;  2AL3 A;  1RFA A;  1E7U A;  4GGQ A;  4GB9 A;  2L0T A;  4G0N B;  2I1K A;  1Q5W B;  3VTW A;  4IW0 A;  4KIK B;  2QHO A;  2DZM A;  3UIP B;  2A4Z A;  2BWF A;  2KFK B;  3ZKJ C;  2NBU A;  2XK5 A;  4XC2 A;  3PS6 A;  4IWP A;  3IVF A;  2JXX A;  2V1Y A;  3NZU A;  1MG8 A;  4CYE A;  1YJ1 A;  4NJ7 A;  2NBW B;  4NPN A;  1P0R A;  4DK5 A;  2MP2 B;  5LXH A;  2JZ3 B;  4A3P A;  4ZRJ A;  1SIF A;  5AZF A;  4F7Z A;  3SD5 A;  2LVO A;  2MBO A;  2KDI A;  3A33 B;  4FHK A;  4G50 A;  4BFR A;  2CU1 A;  3ZIM A;  1Q1O A;  2NBV B;  1TZ1 A;  1E8Z A;  2KOX A;  2D10 A;  4HPM B;  3ZO5 B;  2BKR B;  3I3T B;  3PRP B;  4PS3 A;  1NDD A;  3VXW A;  4BBN F;  1I42 A;  1UD7 A;  2MA9 B;  4B9K A;  2OJR A;  2ZEQ A;  1RRB A;  2FUH B;  3PGE A;  5J2R A;  3DBL I;  3K9P B;  3DBS A;  4NNJ B;  2CS4 A;  5D2M B;  4JLC A;  2LGD A;  1WRD B;  5CHV C;  4EZK A;  5IAA C;  2XK5 B;  2ZVN A;  4ZRI A;  3ZNH B;  4EUT A;  3QCA A;  4KZ0 A;  1XD3 B;  2Z59 B;  2KC2 A;  1YD8 U;  1E90 A;  3DCG A;  1GUA B;  4HLE A;  2BF8 B;  3VUX A;  2KX0 A;  2LXA A;  2ZJD A;  4IM2 A;  3VTV A;  2NCN A;  1EF1 A;  3NZS A;  3DVN V;  2KFJ A;  2ZPY A;  1IYF A;  3U30 A;  3GZN I;  4JL9 A;  3VFK A;  2DHZ A;  4TQ1 A;  1WE6 A;  3UIN B;  1C3T A;  5IA7 A;  2G3Q B;  1UEL A;  1WGH A;  4ICU A;  4WJN A;  1RLF A;  2HJ8 A;  4TKN A;  4WJQ A;  2L0F A;  3ECI A;  3RUI B;  1E8Y A;  4DWF A;  1WGR A;  2PEA A;  2MLB A;  4GDL A;  4NQL B;  3KUC B;  1I35 A;  2JWZ A;  3NY5 A;  1J19 A;  2DZJ A;  2ZPN A;  4HVB A;  1IPG A;  2JF5 A;  3O65 B;  1WXA A;  4NQK E;  4G3X B;  3B08 A;  2JVC A;  2LRU A;  1EUV B;  5G55 A;  5E6P A;  3IG3 A;  4NAW A;  4YL8 A;  5E6O A;  2KZR A;  4W9I A;  3RT3 B;  3ZDM C;  2RD0 A;  4K7S A;  2WX0 A;  4HCN B;  1CMX B;  4IUM B;  1GG3 A;  4IWQ A;  2HD5 B;  1WXV A;  2KJ6 A;  3L0W B;  1ZKH A;  2LVP A;  3UQA A;  3ENE A;  4GDL B;  2BPS A;  2K8B A;  2MWS B;  4W9D A;  2L76 A;  3PTF C;  3QWZ B;  2WYQ A;  2IO0 B;  3ZNZ B;  2FAZ A;  3A9J A;  2KD0 A;  2LRW A;  3S2A A;  3APD A;  3R66 C;  2PE9 A;  1WGG A;  3AU5 A;  3ZRF A;  3TBL D;  3X23 A;  3H1U A;  4OVU A;  2O6V D;  2MX2 A;  1QZE A;  2O2V A;  1LQB A;  2MQJ A; 
#chains in the Genus database with same CATH topology
 3NHE B;  4EFO A;  3H7S A;  4M8N A;  4YSX B;  1WX7 A;  4NJC A;  4M00 A;  2BYV E;  4RNA A;  2KWV B;  4M0W A;  4DXG A;  3IT6 B;  1UWX A;  3VQI A;  3A9K A;  4FA6 A;  3T9L A;  3RZW C;  5D94 A;  3OJ3 A;  1SF0 A;  3KW5 B;  4DHZ E;  1KLG D;  2O2V B;  2JX5 A;  4JGH B;  4ZRP A;  1ZDV A;  3C8Y A;  1VZ7 A;  1J8C A;  1EO6 A;  2DWQ A;  3V6E B;  2FBW B;  4M0W B;  3MHS D;  2RDH A;  1VZ8 A;  3A9K B;  4WWN A;  4EEW A;  4LLG M;  3ZVV A;  3ZJV A;  2YLM A;  3Q3O C;  2M4N A;  2KC1 A;  2KX3 A;  4HK2 A;  3M3J A;  3L16 A;  2V0G A;  3DBH I;  1T0R C;  4FJZ A;  2BW2 A;  3SFD B;  4C4V A;  1C9F A;  2EEL A;  2PMV A;  1D6E C;  2N7E A;  4ZRQ A;  1IP9 A;  3L54 A;  2J7Q B;  2L52 A;  2LGY A;  4J6I A;  1YQB A;  2N9E B;  3NZ3 A;  1YX5 B;  1B9R A;  3RUL A;  4OHJ A;  3ZXR A;  3VTU A;  2WHI A;  3V6C B;  4EE2 A;  2VH1 A;  1K50 A;  2ZNV B;  3Q8A A;  2WS3 B;  4RF0 A;  3NVY A;  4C4V B;  4YWG G;  4UDU C;  2PVG C;  4TSS A;  2RMM A;  2ACZ B;  2QDF A;  2RR9 A;  3AE5 B;  2K39 A;  1KRH A;  2N9K A;  3MTN B;  3SR6 A;  3BZD B;  1T3Q A;  3K9O B;  2QCZ A;  1K52 A;  2LMC A;  4ACF A;  4FN2 A;  1E6E B;  2BT6 A;  4RGT A;  2B3A A;  2QIL A;  5C2T B;  1QF6 A;  2WP9 B;  2KQ4 X;  4NZL B;  1NVI D;  4RMA A;  3JVZ X;  1TY0 A;  4BKT A;  2X38 A;  2FIF A;  1IUE A;  5D6J B;  3Q14 C;  4MAC A;  1WXQ A;  3QHT A;  1V81 A;  2HTH A;  3EC8 A;  1BUI C;  3RFZ B;  3W1S A;  1TZO A;  4N58 A;  2AYO B;  4KDI C;  4MDK E;  1UBQ A;  3AEE B;  1FXI A;  5DCN A;  3Q8F A;  3C19 A;  2D3A A;  2NPT A;  1AW7 A;  2J0M A;  1Y56 A;  4XZ4 A;  1SXT A;  1WMH A;  3HUI A;  5FR6 A;  3OLM D;  3AUL A;  1JW9 D;  1UGJ A;  3DHI C;  1P1A A;  2IZV B;  1YMH E;  3WAN A;  3TEW A;  4M02 A;  3ABV B;  1V5O A;  1WY8 A;  4BOS C;  4AJY B;  1R4M B;  5CHW A;  4K1R B;  4NJ6 A;  3Q8E A;  2JXT A;  5BMG A;  1DYQ A;  1HA5 A;  2WXH A;  1ZGU B;  2NPT B;  4XYC A;  4DHJ D;  1WMH B;  5JH5 C;  3MP9 A;  3U52 E;  3NVZ A;  4E74 A;  4K7U A;  4MJS B;  3H9D A;  2CKH B;  2M19 A;  3EA6 A;  2G1E A;  3APF A;  3IXS A;  4DHZ B;  3DDC B;  1JAL A;  2LWP A;  2XNA C;  3AEF B;  3KUZ A;  5CHF A;  4GMV A;  3R3M A;  3LDZ E;  1T6B X;  5HKH A;  5D3I B;  4RH6 A;  2K6D B;  2YEP B;  1H8C A;  1STE A;  4LJP B;  1UBI A;  2N9L A;  4IM0 A;  4LDT D;  1FIQ A;  4F1S A;  1MPE A;  3B9J A;  2IDY A;  3WAM A;  2J53 A;  3SU8 X;  3PHX B;  1PQS A;  4DXA B;  1LO5 D;  1VZ6 A;  1IBX A;  3BK2 A;  4YTM B;  4KZC A;  5DPW A;  3ML9 A;  1C78 A;  4E3C A;  3ZTC A;  2BKF A;  2C7H A;  1JWS D;  5IO9 A;  1TY2 A;  2FE8 A;  1ENF A;  2JPH A;  3DBR I;  2C7M B;  4GU2 A;  3U2S C;  3EUB 2;  5JHA A;  5AEK B;  1C76 A;  3FAH A;  2ONQ A;  1OEY J;  1VCB A;  1M94 A;  1IBX B;  5FKA C;  4F8C B;  2DX5 B;  1F2R C;  4XE0 A;  2DAF A;  3MJW A;  2CJN A;  1V80 A;  3UF8 A;  2FCS A;  1FXT B;  2DEN B;  1L0Y B;  3TMP B;  1ET9 A;  2EKI A;  3MHZ A;  2ZCC A;  1YJI A;  1D5Z C;  2J52 A;  1BT0 A;  1WF9 A;  1EWC A;  2KQS A;  3PPA A;  4HXD A;  1Z2M A;  3NG0 A;  3ML8 A;  3AE9 B;  3WCQ A;  1Y8R C;  4D2K A;  5KHO A;  2A5U A;  3I57 A;  3TL5 A;  3ZLZ A;  1TTN A;  2JWU A;  2PKO A;  1TBE A;  2H88 B;  2G4S A;  2QJL A;  1Q0W B;  4FUL A;  5H8Y E;  1YJJ A;  3VDZ A;  3ZTD A;  3MC0 B;  3B1L X;  2D3C A;  2BYE A;  2RSU A;  2KWU B;  1RFA A;  2SAK A;  4GB9 A;  2I1K A;  2L32 A;  3AEC B;  2QHO A;  5D3D A;  2A4Z A;  2BWF A;  2BVC A;  4IWP A;  4ZHP A;  2JXX A;  2V1Y A;  1ZUD 2;  1YJ1 A;  3AE4 B;  5LXH A;  4ZRJ A;  4G50 A;  4BFR A;  2KDI A;  1N60 A;  2CU1 A;  1Q1O A;  2NBV B;  2D10 A;  1EU3 A;  2MJE A;  2CU3 A;  4BBN F;  1I42 A;  2MA9 B;  5J2R A;  2KN4 A;  3DBS A;  4NNJ B;  4JLC A;  1WRD B;  5IAA C;  3QCA A;  2KC2 A;  1CQV A;  3BII D;  3W5V B;  2WXF A;  3VRB B;  3VTV A;  2NCN A;  1B1Z A;  2ZPY A;  3LB8 C;  3GZN I;  4J3O D;  3ZGZ A;  4ICU A;  1WGH A;  1ZOY B;  4P1C C;  4WJQ A;  2L0F A;  2IGG A;  4GDL A;  2IND C;  4JWS C;  1JWA D;  3NY5 A;  2K0P A;  2DZJ A;  2ZPN A;  3NVV A;  5BMI A;  4G3X B;  3B08 A;  4PT5 A;  1SE2 A;  1PGX A;  2V4I B;  1HXY D;  3RT3 B;  2WX0 A;  4YTP B;  3T3N A;  4IWQ A;  1LGR A;  1WXV A;  2KWD A;  3L0W B;  2LVP A;  4JX1 C;  3UQA A;  5E6J A;  4GDL B;  1T0Q C;  2BQQ A;  1L6U A;  1YQ4 B;  1SJE D;  4ARI A;  3P42 A;  3NS1 A;  3ZJT A;  3PTF C;  3AED B;  2IO0 B;  3ZNZ B;  3A9J A;  1PGB A;  2LUM A;  2O6V D;  3IBE A;  1LQB A;  3DBH B;  4LCD E;  2GI9 A;  4II3 B;  1LM8 B;  1A70 A;  2Z0D B;  3GE3 C;  2XBB C;  2DAJ A;  4WH4 A;  1UUP A;  3A9J B;  4PYZ A;  4DDI D;  1XT9 B;  1D5M C;  3C0R B;  1ZXH A;  2N9P C;  2WU2 B;  1V49 A;  1WYW B;  2LFI A;  3T8M A;  4FHJ A;  1E10 A;  2KMC A;  3QX1 A;  1OGW A;  1D4B A;  2MBE A;  3W1Y A;  3RZF A;  1FRD A;  5HI1 A;  4W9K A;  2KVZ A;  1J0G A;  1V9J A;  4XWT A;  1WX9 A;  1PUT A;  5EE3 A;  4BAX A;  1SB3 C;  2K1F A;  4BBN C;  1WZ0 A;  1L2N A;  3DVG X;  4LK0 M;  5BYQ A;  3Q6B A;  4NY0 A;  1FM0 D;  4HRO A;  3WAO A;  4IKG A;  4RM8 A;  3RD2 A;  4IG7 B;  3B0A A;  3HHM A;  4BKS D;  4IOI E;  2M0A A;  4K7W A;  3V61 A;  3N32 A;  1F1H A;  1ROE A;  2GMI C;  5E6N A;  2J0J A;  2KWC A;  2CHX A;  4AQ7 A;  4B6W A;  2O6V A;  1NEK B;  1N5X A;  1U4A A;  5JHB A;  4A3O A;  1S3S G;  4N59 A;  2BWE S;  2N7J A;  2BS2 B;  3PLU A;  1KF6 B;  1FFV A;  3Q69 A;  1T0Y A;  3E9S A;  4I6L B;  1TKG A;  2K22 A;  3PV1 A;  1N6Z A;  1D3Z A;  3Q8B A;  1E0Z A;  2JYT A;  3Q3F A;  3MC9 A;  2JSV X;  2HJ1 A;  2KTR A;  3OAW A;  3LJ3 A;  4I6P A;  4GN1 A;  4YXD B;  1WM2 A;  1YN3 A;  3VR8 B;  1BML C;  4HKZ E;  4NAW B;  4ARC A;  4Q2J A;  4FJY A;  4B0E A;  1GB4 A;  2Z8L A;  2OOB B;  2JRI B;  3NOB A;  2DZI A;  2M8S A;  1MJD A;  2KTR B;  1PYW D;  5C3J B;  2LJI A;  5LLI A;  2V3N A;  4AWJ A;  3RNF C;  1E8W A;  2KTF A;  3APC A;  2XEW A;  2INC C;  4A9A A;  4BKS A;  2YEP F;  2JU6 X;  1R7S A;  5LXI B;  1DGJ A;  2FCQ A;  1N5W A;  3L17 A;  1KH0 A;  4AP4 C;  4LJO B;  1AN8 A;  3ZUN A;  2IY0 B;  2FCN A;  2W55 A;  2WXO A;  4ANV A;  3CWI A;  3L10 B;  2BBC A;  3FC4 A;  3CMM B;  1WJN A;  3CIR B;  1L4Z B;  1FPY A;  3PRM B;  4TUU A;  2NS5 A;  3DBR B;  3GP7 A;  2KLC A;  1KFY B;  2IPK D;  3QK0 A;  4HJK A;  3DPD A;  3RNG C;  1UF0 A;  4L2Y A;  3QIJ A;  4W9F A;  1L0X B;  1M4V A;  4WQM A;  4WWM A;  1GPX A;  1BXT A;  4B0M A;  2N9X A;  2I2Y A;  1VR9 A;  3R8B A;  1XLN A;  2AQ2 B;  2NVU I;  1I4X A;  2FUG 1;  4MT5 A;  2WQY B;  1E5W A;  4W9G A;  5KHQ A;  3BYY B;  3DOW A;  4P1B C;  2GBJ A;  3M95 A;  2G4D B;  5DPR A;  4BKG A;  3N20 C;  1TKE A;  4B95 A;  3AE3 B;  3VH3 B;  2M0X A;  2L00 B;  3DHG C;  2QC8 A;  3HRD D;  3RNE C;  3VVW B;  4AJW A;  1WSP A;  2R61 A;  1WI0 A;  2V4L A;  3I5J C;  5TR5 A;  2LGX A;  5HG2 A;  3P4P B;  4MH0 E;  4C7Z A;  3TCA A;  4W9J A;  4XGA B;  3W1S C;  3R2T A;  1SE3 A;  1H4R A;  1QOF A;  3PSE B;  1JCK B;  3L08 A;  3BYT B;  2LXC A;  4KX6 B;  2CHZ A;  3EEC A;  4DXF A;  5G5G A;  1GOZ A;  4JWU C;  2MCN B;  3ZNG C;  1WM3 A;  3CSF A;  2V9H A;  1ZXI A;  4W9E A;  4KSK C;  3P2B A;  2YVC A;  3AB5 A;  2LZ6 A;  5BYS A;  1NI3 A;  4IM3 A;  4MGK E;  2MRP A;  2BS3 B;  2WLB A;  1UZX B;  3DWG C;  2PVO D;  3WA0 A;  2N7D A;  3BVG A;  2D2Q A;  1AYF A;  3N1X C;  3EGR A;  1UNS A;  3A4S C;  1I4G A;  1YIW A;  1N61 A;  4P16 A;  4WQO B;  2JZZ A;  4OW0 A;  2ZW0 A;  2G45 B;  2JYE A;  4BVU C;  2KT7 A;  3GB1 A;  3EFC A;  2FCM A;  2IO1 B;  1QQR A;  5CX3 A;  3GZN B;  4RF1 A;  4WAF A;  3VTW A;  1FNU A;  3KWV A;  2L1A A;  1N62 A;  3AV8 A;  2XK5 A;  2BS4 B;  1FMA D;  4ZHO A;  1R4N B;  3IVF A;  4ZYS A;  2PLP A;  1MG8 A;  4S0R A;  2NBW B;  4NPN A;  1YNT E;  1SIF A;  3SD5 A;  4FHK A;  3ZIM A;  1TZ1 A;  3P63 A;  4HPM B;  3ZO5 B;  2BKR B;  1NDD A;  2IJ0 A;  2OJR A;  1RRB A;  3K9P B;  1I4H A;  1E9M A;  1IGD A;  2OED A;  5D2M B;  4HKQ A;  3AEB B;  2LGD A;  2XK5 B;  2ZVN A;  4ZRI A;  3IAM 1;  1VLB A;  2Z59 B;  2QEJ C;  4HLE A;  1FXA A;  2LXA A;  3BVM A;  1K53 A;  1GAQ B;  3AMZ A;  3NZS A;  3BK1 A;  3I9V 1;  2KFJ A;  3U30 A;  2DHZ A;  4TQ1 A;  1WE6 A;  3UIN B;  4OZA A;  5IA7 A;  3P4Q B;  1RLF A;  4DWF A;  3ECI A;  1XO3 A;  3RUI B;  1WGR A;  2PEA A;  1I35 A;  2PTL A;  2QSD A;  1UWM A;  1TS4 A;  4HVB A;  4KKJ A;  2JF5 A;  3O65 B;  1WXA A;  3T3O A;  4NQK E;  2JVC A;  2V3P A;  1I7H A;  3IG3 A;  2GB1 A;  4W9I A;  4RFB A;  2RD0 A;  1CMX B;  1YN4 A;  1GG3 A;  2HD5 B;  2K9X A;  2M56 B;  1RM6 C;  1XEE A;  3AM9 A;  2MWS B;  4H2A A;  4W9D A;  3VR9 B;  2L76 A;  2TSS A;  3I63 C;  2KD0 A;  1MHH E;  3APD A;  3AU5 A;  4PK1 A;  1EU4 A;  3H1U A;  4OVU A;  1QZE A;  1OQR A;  3RNB C;  1XQQ A;  1RWS A;  4WJP A;  1NBF C;  3LYY A;  2KMM A;  2GBK A;  1WX8 A;  2GRI A;  4TMA B;  1OQQ A;  4DHJ B;  1C77 A;  3AE8 B;  3GE8 C;  3IHP C;  1F9J A;  2WXR A;  1TGZ B;  2KDF B;  2LHE A;  1V5T A;  4KGS A;  4URK A;  1QIL A;  1J7C A;  2WXK A;  3VAW A;  3ZDT A;  4CQN A;  3GOE A;  1P98 A;  1GNU A;  4HWI B;  3VUY A;  2QIE B;  2LGI A;  2J42 A;  1V1P A;  3NVW A;  1NI2 A;  2E3T A;  4OVZ A;  3RPF C;  4JPS A;  3KYC D;  3TUO A;  2IBI B;  3P4R B;  4LDT B;  3ZYY X;  4MEL A;  2L83 A;  2LVQ A;  3PZD A;  1K51 A;  4MEM A;  3N1Y C;  1MHX A;  1UGM A;  4MSM B;  4US9 A;  4YSY B;  4EKU A;  4RM9 A;  3RCZ A;  2MSE D;  3L4P A;  1LFD A;  1V1P B;  3ZNI D;  3IAS 1;  2Q5W D;  4GSW A;  3SHQ A;  4YTN B;  2RDB C;  3QC8 B;  4USA A;  4LNK A;  2DYO A;  3TSS A;  3QAQ A;  2W9N A;  1I4R A;  4BZA A;  1HQR D;  3QQ8 B;  1TIF A;  1WYG A;  2SEB D;  3N9Y C;  4EOY A;  2KDE B;  2DYM A;  1SBB B;  2LI5 A;  3VRA B;  1R4N I;  2AWT A;  2VH2 A;  4RGO S;  1ET6 A;  3QAR A;  3LXF A;  2BGF A;  3ZJU A;  2M1M A;  1GB1 A;  1WZ3 A;  4GOC A;  4ANU A;  4MSQ B;  1GC6 A;  4PS8 A;  1HZ5 A;  1XCQ L;  1F77 A;  2KKC A;  3NRZ A;  2Y5C A;  3MFG A;  4RGM A;  1VRA B;  3PRZ A;  4E71 A;  4ASW C;  2D3B A;  2DLB A;  4FXC A;  3RYT A;  2MBB B;  2ZVO A;  2LD9 A;  3TJP A;  2KAJ A;  3IFW B;  1S1Q B;  2KHW B;  1TKY A;  1C1Y B;  5L95 C;  2KK8 A;  3TEY A;  2BYF A;  2LHD A;  2DBY A;  3QJZ A;  5G2N A;  5AZH A;  1ACC A;  3KH0 A;  1RAX A;  3WIM A;  1IGC A;  1L7Y A;  3ETR A;  1HEZ E;  4WIP A;  4DQO C;  2L05 A;  1I4P A;  3KWL A;  4XDC A;  2K8H A;  5EDS A;  2B76 B;  5D7G A;  2L3Z A;  3GS2 A;  4X57 B;  3DWM A;  4XX5 A;  2J4X A;  5DPT A;  3DQV A;  3PZ7 A;  1P9D U;  1WIA A;  5J18 A;  3H6N A;  1OTR B;  4EZJ A;  3V3X A;  4PS7 A;  2EMT A;  3QA8 A;  4JQW C;  4KSL C;  2KAC A;  4IC7 B;  2LUE A;  2CHW A;  1HE8 A;  3N3K B;  2JY6 A;  2KVR A;  1PDX A;  5FK9 C;  1CK1 A;  5BO4 B;  4MM3 A;  1SE4 A;  3PT2 B;  3NJT A;  1TT5 B;  2I1J A;  1GC7 A;  1V1O A;  2HE7 A;  4G11 A;  2QMT A;  3BY4 B;  3AI5 A;  3MC8 A;  3V05 A;  2WXL A;  3A4R A;  3N30 A;  4WWO A;  2C60 A;  3AE1 B;  4LNN A;  4A90 A;  3U8Z A;  3KQ4 A;  4S17 A;  4KGT A;  4MM3 B;  1QOB A;  1A5R A;  5J17 A;  3HM6 X;  1WFY A;  4K3C A;  4JE3 B;  1P3Q U;  1DOI A;  1F2R I;  2WXG A;  1JRP A;  2L7R A;  4GIV A;  2Y5P A;  1KLU D;  2G9H D;  2N4F A;  4II2 B;  3JSV A;  4TV3 A;  2ON8 A;  5I4D A;  1D5X C;  1SGH A;  4K81 A;  1YX6 B;  2O6V B;  3R7R A;  3WAL A;  4C7Y A;  4W9H A;  2LGS A;  1L4D B;  1C4P A;  3AU4 A;  2IYD B;  2WXM A;  5JZE B;  5AZG A;  1G6J A;  2VZK D;  1WGY A;  4TQ0 A;  1FFU A;  1AAR A;  3W9C B;  2LJ5 A;  2KMA A;  4FLH A;  4ANX A;  4A55 A;  3FIL A;  4FAD A;  2JUO A;  3JSV B;  1PFD A;  2OJW A;  1FCL A;  3SDL C;  3D32 A;  1N63 A;  3PLV A;  1JWB D;  1V86 A;  2ZZP B;  3UQB A;  1E8X A;  1OQY A;  5JXV A;  2C7N B;  2DNF A;  4KVG B;  1V2Y A;  5HFY A;  5DPS A;  1DOX A;  4N6E B;  1SE9 A;  4KIK A;  1MFW A;  2ZCB A;  1JWM D;  2DYB A;  1HTO A;  2C5L C;  2AQ1 B;  1XCT L;  5L83 A;  2R2O A;  2AQ3 B;  3FIL B;  3W5U B;  2WDT B;  2ZNV C;  3AEA B;  2R2Q A;  1ESF A;  3EHV A;  4AUQ C;  3TEX A;  1XF5 L;  4WWP A;  2GLS A;  4LNI A;  1ZPS A;  3AXC A;  2D07 B;  2IY1 B;  2H89 B;  2K3U A;  2AL3 A;  1TS3 A;  1E7U A;  4GGQ A;  3DHH C;  3OWE B;  4KIK B;  2DZM A;  3UIP B;  2INN E;  1F52 A;  3ZKJ C;  2NBU A;  3PS6 A;  3NZU A;  1J7A A;  3OG5 A;  1P0R A;  1J7B A;  2JZ3 B;  1MVK A;  1RYJ A;  2KOX A;  3PRP B;  4PS3 A;  4OZB A;  1EM7 A;  5T8I A;  1JQ4 A;  1UD7 A;  3U4E G;  4O1N A;  4B9K A;  1WWT A;  3PO0 A;  2FUH B;  3UI3 A;  5CHV C;  4EUT A;  4US8 A;  4KZ0 A;  1XD3 B;  1YD8 U;  1GUA B;  4A6Q A;  1FEH A;  2KX0 A;  3TEZ A;  1EF1 A;  3DVN V;  1IYF A;  4JL9 A;  1C79 A;  4WJN A;  1UEL A;  2BB6 A;  3O13 A;  2VZK B;  2MLB A;  3H8H A;  3HVZ A;  1QOG A;  1DOY A;  1IPG A;  1EUV B;  5BYR A;  2WU5 B;  1YOV B;  5E6O A;  5AUI A;  3RNA C;  2KZR A;  1FNW A;  3ZDM C;  4HCN B;  3HVD A;  2KJ6 A;  1ZKH A;  1XLQ A;  3URY A;  5EE0 A;  3ENE A;  2BPS A;  1XLO A;  1KTK A;  3S2A A;  3R66 C;  2PE9 A;  3N1Z C;  1WGG A;  3ZRF A;  3TBL D;  3X23 A;  2MX2 A;  1T5X D;  4NAM A;  2WWZ A;  3R7Q A;  1TS5 A;  2N1V A;  4C80 A;  3A1Q A;  4L23 A;  5AUK A;  4BOZ B;  1TYG B;  1VDV A;  1WJ6 A;  3HK0 A;  2HDE A;  3Q8C A;  3U7D A;  2KDB A;  1JRO A;  1WGK A;  4P6V F;  3RN9 C;  4MGI E;  3H7P A;  3ZRC A;  2KLG A;  4YSZ B;  2MW5 A;  2JQR B;  2LEK A;  2Z0E B;  1QKZ A;  4MJS A;  4ZRK A;  3A1Q B;  1WR6 E;  3PRE A;  1CJE A;  4A20 A;  2UU7 A;  1KJT A;  3DVN U;  2MHJ A;  2KAN A;  1KM7 A;  1P7F A;  2I38 A;  3ALB A;  2GOW A;  2IGD A;  2RGF A;  4ANW A;  1UH6 A;  4HJG E;  2JRH A;  2LAS A;  4HRS A;  1HZ6 A;  3H7P B;  2ICI A;  4CHK A;  2WXI A;  3FKY A;  4IDI A;  2BYT A;  4I6N B;  1X1M A;  5IP4 D;  4ZOH C;  1OFF A;  1SSN A;  3JW0 X;  3AN1 A;  1V8C A;  2AEH A;  5HHD G;  1E7P B;  1PGA A;  2K25 A;  3TIX A;  2ASQ A;  1FRR A;  3L13 A;  2OHF A;  5H92 C;  4KKI A;  2D5G A;  3P1M A;  4K3B A;  1WXM A;  1SIJ A;  1MG4 A;  2W82 A;  1L5P A;  1WXS A;  4M8M A;  2BTE A;  2WXJ A;  2AX5 A;  1KLV A;  1VJK A;  2GBR A;  1FNV A;  4MGY E;  2V3S A;  2MBH A;  4W9C A;  1XXG A;  4FJV B;  4XWW A;  2IO2 B;  2KXJ A;  2KJR A;  3R2I A;  4GLS C;  4WAA A;  1CZP A;  4KDL B;  2PE6 B;  1WH3 A;  2MJ3 A;  3E56 A;  2VRR B;  2NTT A;  1JML A;  2Y5B B;  2CR5 A;  2EKE C;  4PYU A;  3SFE B;  3UIO B;  1JRU A;  5C23 A;  1SJH D;  3J9C A;  4HDO A;  1EF5 A;  2DZK A;  1SEB D;  1E7V A;  3RMK C;  4DBG A;  3PZ8 A;  1I4Q A;  3X0W A;  3ONS A;  4LNO A;  1YQ3 B;  2PPH A;  4EZL A;  1WE7 A;  3PVL A;  1Q10 A;  1GJZ A;  2WDR B;  2D11 A;  4GXB A;  1ZE3 D;  2MJD A;  3CST A;  4MGZ E;  3Q3J A;  5G5H A;  1FD6 A;  4M01 A;  2AL6 A;  3DBL B;  1LXD A;  2UWQ A;  2KDM A;  1WR1 A;  3M63 B;  2CJO A;  2K8C A;  2WNM A;  4HPL B;  3ZXV A;  3IT4 B;  3SEB A;  2RPQ A;  3HM3 A;  4ITK A;  5CTR C;  4AS1 A;  3U7Z A;  2KJH B;  2FID A;  4OVV A;  4LTU A;  2KO3 A;  2K6Q A;  3KUD B;  2JT4 B;  3M62 B;  2WXN A;  4DDG D;  3CF6 E;  3MJ5 A;  5GXG B;  3NS8 A;  3ZW3 A;  2W3R A;  3KLS X;  4HPP A;  2N1W A;  2PW9 A;  4C00 A;  1ZP0 B;  2RDG A;  2M17 A;  3KYD D;  1WJU A;  3ZQ4 A;  1XLP A;  2WX1 A;  1F0Z A;  1K8R B;  3VUW A;  2MEK A;  3VH4 B;  1OEY A;  2RPV A;  3AE7 B;  3BWU D;  1EWY C;  4RGN A;  2K5P A;  1FO4 A;  3OJ4 B;  3B2F A;  1V6E A;  1ISN A;  2KYW A;  2E6X A;  2NTS A;  4HEA 1;  4CO7 A;  4ICV A;  4GDK A;  5GMV A;  1TJE A;  2FNJ B;  2KNB A;  1T0S C;  1Z5S B;  3AE2 B;  2L8J A;  1R4M I;  3UGB B;  3DVG Y;  5LNK 1;  1WJ4 A;  3BIN A;  1C4A A;  3VHT C;  1ZDX A;  3V62 A;  2UYZ B;  4KV2 A;  2EMS A;  4FBJ B;  2KQ7 A;  2MH7 A;  2GBM A;  4OZC A;  4GDK B;  4WJO A;  1YN5 A;  4W9L A;  4LNF A;  5TSS A;  3AE6 B;  2MBQ A;  4XDD A;  1QT9 A;  5FR3 A;  4P7I A;  2NR2 A;  2PJH A;  4HDQ A;  1WGD A;  3BVZ A;  3KVF B;  2KN5 A;  4IWO A;  2PIA A;  1KOT A;  1ZW7 A;  1VD2 A;  2C9W B;  4AOF A;  3V60 A;  2D3G A;  4KGR A;  2J0K A;  1C4C A;  2W54 A;  2NMQ A;  2REX A;  2WDV B;  4HCP B;  5MPO A;  1QLB B;  3JYU A;  2KFK A;  2IO3 B;  4ZYN A;  3NUH B;  1FCC C;  2N0S B;  4JIO U;  5C1Z A;  2MP2 A;  2W3S A;  3B2G A;  2IGH A;  3HIZ A;  3PHW B;  3Q3M C;  3EFU A;  4ZDV A;  5EE1 A;  4N9F 4;  2GBN A;  3WAP A;  2X8X X;  2XN9 C;  3RI7 C;  2L0T A;  4G0N B;  1NEN B;  4QAY A;  1Q5W B;  4WUR A;  4IW0 A;  2Y3A A;  2WDQ B;  2KFK B;  4L1B A;  3RNC C;  4XC2 A;  1JWU D;  4CYE A;  1RFK A;  4NJ7 A;  2BB5 A;  1V97 A;  5IOI A;  2HTM E;  4DK5 A;  2MP2 B;  4A3P A;  5AZF A;  4F7Z A;  2LVO A;  2MBO A;  3A33 B;  3AH7 A;  1E8Z A;  4RCO A;  3I3T B;  3VXW A;  1AWD A;  2ZEQ A;  3PGE A;  3DBL I;  2CS4 A;  1P7E A;  4EZK A;  3ZNH B;  1E90 A;  3DCG A;  3Q3N C;  2BF8 B;  3VUX A;  2ZJD A;  4IM2 A;  1NYR A;  3VFK A;  1C3T A;  1TS2 A;  2G3Q B;  2WXQ A;  2HJ8 A;  2WXP A;  3AEG B;  4TKN A;  1E8Y A;  4YT0 B;  4NQL B;  1NYQ A;  1QOA A;  3KUC B;  2JWZ A;  4C56 C;  1J19 A;  4REZ A;  1MI0 A;  1L6V A;  2JZP A;  2LRU A;  5G55 A;  1L0V B;  3W2D A;  4A8X C;  5E6P A;  5IKC M;  4NAW A;  4YL8 A;  1WRI A;  4K7S A;  4IUM B;  3Q2A C;  2INP E;  5EE9 A;  4MH8 A;  1HTQ A;  5IN7 A;  2K8B A;  3QWZ B;  2WYQ A;  4R3D A;  2FAZ A;  3P4S B;  5BMH A;  2LRW A;  2ZW1 A;  2WGS A;  2O2V A;  2MQJ A; 
#chains in the Genus database with same CATH homology
 3NHE B;  4LCD E;  4EFO A;  3H7S A;  4M8N A;  1XQQ A;  2WWZ A;  1WX7 A;  4II3 B;  2N1V A;  3R7Q A;  3A1Q A;  2BYV E;  1LM8 B;  4WJP A;  1NBF C;  2KWV B;  2Z0D B;  4BOZ B;  2XBB C;  1WJ6 A;  2GBK A;  3HK0 A;  1WX8 A;  3U7D A;  3VQI A;  3A9K A;  2DAJ A;  2KDB A;  4DHJ B;  3UQB A;  3IHP C;  1F9J A;  3A9J B;  1TGZ B;  4FA6 A;  4PYZ A;  3T9L A;  4DDI D;  3RZW C;  5D94 A;  2KDF B;  4URK A;  1V5T A;  3OJ3 A;  4MGI E;  3H7P A;  3ZRC A;  1XT9 B;  2KLG A;  3KW5 B;  3C0R B;  4DHZ E;  2O2V B;  4JGH B;  2MW5 A;  2N9P C;  2Z0E B;  3VAW A;  4MJS A;  4ZRK A;  3ZDT A;  1J8C A;  3A1Q B;  1EO6 A;  1V49 A;  1WR6 E;  1WYW B;  3PRE A;  3T8M A;  3GOE A;  4FHJ A;  2KMC A;  4M0W B;  3V6E B;  1P98 A;  3QX1 A;  1GNU A;  1OGW A;  3MHS D;  4HWI B;  4A20 A;  2MBE A;  1KJT A;  3VUY A;  3DVN U;  3W1Y A;  3RZF A;  2KAN A;  1KM7 A;  4W9K A;  3A9K B;  4WWN A;  1NI2 A;  3ALB A;  2GOW A;  4EEW A;  1J0G A;  2RGF A;  3KYC D;  4ANW A;  1V9J A;  1UH6 A;  2IBI B;  3ZVV A;  2JRH A;  2YLM A;  2LAS A;  4LDT B;  2M4N A;  3H7P B;  4MEL A;  2KC1 A;  2KX3 A;  1WX9 A;  4HK2 A;  4CHK A;  3M3J A;  3L16 A;  3DBH I;  2LVQ A;  4FJZ A;  2K1F A;  3IBE A;  3PZD A;  4BBN C;  1WZ0 A;  1L2N A;  4MEM A;  4I6N B;  1UGM A;  3DVG X;  4MSM B;  4EKU A;  1X1M A;  4NY0 A;  4RM9 A;  2N7E A;  3JW0 X;  3RCZ A;  1IP9 A;  2MSE D;  3WAO A;  3L54 A;  2AEH A;  2J7Q B;  4RM8 A;  3RD2 A;  2LGY A;  4IG7 B;  3B0A A;  1YQB A;  1LFD A;  2N9E B;  3HHM A;  1YX5 B;  4J6I A;  4BKS D;  3RUL A;  3ZNI D;  4GSW A;  4K7W A;  3SHQ A;  3V61 A;  3N32 A;  2K25 A;  3QC8 B;  2GMI C;  3TIX A;  2ASQ A;  3L13 A;  2DYO A;  5E6N A;  3VTU A;  3V6C B;  2J0J A;  3QAQ A;  2KWC A;  2W9N A;  2ZNV B;  1WXM A;  2CHX A;  4B6W A;  2O6V A;  1U4A A;  3QQ8 B;  5JHB A;  4A3O A;  4EOY A;  1S3S G;  1WXS A;  4M8M A;  2KDE B;  2DYM A;  2BWE S;  1KLV A;  2LI5 A;  1R4N I;  2GBR A;  2AWT A;  3PLU A;  4MGY E;  1T0Y A;  2V3S A;  2MBH A;  4W9C A;  3QAR A;  4I6L B;  2BGF A;  4FJV B;  3PV1 A;  2M1M A;  2IO2 B;  2RR9 A;  2KXJ A;  2KJR A;  4WAA A;  1WZ3 A;  2K39 A;  4KDL B;  1D3Z A;  2PE6 B;  1WH3 A;  4GOC A;  4ANU A;  4MSQ B;  1GC6 A;  4PS8 A;  3MTN B;  2VRR B;  3Q3F A;  2Y5B B;  2CR5 A;  3K9O B;  2EKE C;  2KKC A;  4PYU A;  2KTR A;  4FN2 A;  3UIO B;  1JRU A;  3PRZ A;  3OAW A;  5C23 A;  2B3A A;  4E71 A;  3LJ3 A;  4HDO A;  4ASW C;  1EF5 A;  2DZK A;  4I6P A;  3RYT A;  1E7V A;  4DBG A;  2MBB B;  4GN1 A;  2ZVO A;  2LD9 A;  3X0W A;  3ONS A;  3TJP A;  1WM2 A;  2PPH A;  4EZL A;  3IFW B;  4NAW B;  4RMA A;  1S1Q B;  1WE7 A;  3JVZ X;  2KHW B;  1C1Y B;  3PVL A;  4BKT A;  1GJZ A;  5L95 C;  2FIF A;  5D6J B;  2KK8 A;  2BYF A;  2D11 A;  4FJY A;  4GXB A;  3QHT A;  1V81 A;  2HTH A;  3EC8 A;  3CST A;  3QJZ A;  5G2N A;  2OOB B;  2JRI B;  3NOB A;  3W1S A;  2DZI A;  2M8S A;  2AYO B;  4KDI C;  4MGZ E;  4MDK E;  1UBQ A;  5AZH A;  3Q3J A;  3KH0 A;  2KTR B;  5DCN A;  1RAX A;  5LLI A;  3WIM A;  1L7Y A;  4AWJ A;  2AL6 A;  4XZ4 A;  2L05 A;  1E8W A;  2J0M A;  2KTF A;  2K8H A;  2NPT A;  1WMH A;  3APC A;  5EDS A;  1LXD A;  2UWQ A;  2XEW A;  5FR6 A;  3OLM D;  5D7G A;  2L3Z A;  4BKS A;  1WR1 A;  3AUL A;  3M63 B;  4X57 B;  5LXI B;  4XX5 A;  2FCQ A;  2K8C A;  4HPL B;  3L17 A;  4AP4 C;  1P1A A;  2IZV B;  5DPT A;  2RPQ A;  3HM3 A;  4LJO B;  5CTR C;  2KJH B;  3ZUN A;  2FID A;  2IY0 B;  4OVV A;  3WAN A;  3DQV A;  2KO3 A;  2FCN A;  2K6Q A;  4ANV A;  3KUD B;  2JT4 B;  3M62 B;  3L10 B;  1V5O A;  4DDG D;  1WY8 A;  3CF6 E;  4BOS C;  1P9D U;  1WIA A;  4AJY B;  5CHW A;  3CMM B;  4K1R B;  4NJ6 A;  1WJN A;  3NS8 A;  3ZW3 A;  5J18 A;  3H6N A;  1OTR B;  1ZGU B;  2NPT B;  2N1W A;  3PRM B;  4TUU A;  4EZJ A;  2NS5 A;  1WMH B;  4PS7 A;  2EMT A;  3QA8 A;  4JQW C;  2M17 A;  4DHJ D;  5JH5 C;  3KYD D;  4KSL C;  1WJU A;  2KLC A;  3QK0 A;  4HJK A;  4E74 A;  4K7U A;  4IC7 B;  2WX1 A;  1K8R B;  2LUE A;  4MJS B;  3H9D A;  2CKH B;  2CHW A;  1HE8 A;  3N3K B;  3VUW A;  3DPD A;  2JY6 A;  2KVR A;  3APF A;  4DHZ B;  3DDC B;  3VH4 B;  1OEY A;  2LWP A;  3QIJ A;  4MM3 A;  4W9F A;  5BO4 B;  3PT2 B;  3KUZ A;  5CHF A;  4GMV A;  3R3M A;  3LDZ E;  2I1J A;  1GC7 A;  2HE7 A;  5HKH A;  4G11 A;  3BY4 B;  3OJ4 B;  3AI5 A;  2N9X A;  1H8C A;  2K6D B;  1V6E A;  4LJP B;  1UBI A;  3A4R A;  1ISN A;  3N30 A;  2NVU I;  4WWO A;  4IM0 A;  2C60 A;  4LDT D;  1E5W A;  4W9G A;  4F1S A;  5KHQ A;  4CO7 A;  3U8Z A;  3DOW A;  2GBJ A;  4ICV A;  4GDK A;  5GMV A;  3M95 A;  3WAM A;  3SU8 X;  3PHX B;  1PQS A;  4DXA B;  2G4D B;  5DPR A;  4BKG A;  2FNJ B;  1A5R A;  2KNB A;  5J17 A;  3HM6 X;  1WFY A;  1Z5S B;  4B95 A;  3VH3 B;  2M0X A;  2L00 B;  4KZC A;  2L8J A;  1R4M I;  1P3Q U;  3ML9 A;  5DPW A;  4E3C A;  3ZTC A;  3VVW B;  2BKF A;  2C7H A;  3DVG Y;  3UGB B;  4AJW A;  2L7R A;  4GIV A;  1WJ4 A;  4II2 B;  2N4F A;  4TV3 A;  2JPH A;  3BIN A;  3JSV A;  3DBR I;  1WI0 A;  3VHT C;  2C7M B;  4GU2 A;  2V4L A;  3V62 A;  2UYZ B;  5TR5 A;  1SGH A;  4K81 A;  1YX6 B;  2O6V B;  3R7R A;  3WAL A;  5JHA A;  2LGX A;  5AEK B;  4W9H A;  4KV2 A;  2EMS A;  4FBJ B;  2KQ7 A;  4MH0 E;  2GBM A;  3AU4 A;  4GDK B;  2IYD B;  3TCA A;  1OEY J;  4W9J A;  4WJO A;  5AZG A;  1VCB A;  5JZE B;  1G6J A;  4W9L A;  3W1S C;  3PSE B;  1H4R A;  1WGY A;  4TQ0 A;  1M94 A;  1AAR A;  2MBQ A;  3L08 A;  2LXC A;  2CHZ A;  4F8C B;  2DX5 B;  3EEC A;  2LJ5 A;  2KMA A;  4FLH A;  4ANX A;  2DAF A;  3MJW A;  1V80 A;  3UF8 A;  2MCN B;  4P7I A;  2NR2 A;  3ZNG C;  1WM3 A;  3CSF A;  4FAD A;  2PJH A;  2FCS A;  1FXT B;  2JUO A;  3JSV B;  2DEN B;  4HDQ A;  1WGD A;  3TMP B;  4W9E A;  3KVF B;  2KN5 A;  4IWO A;  3P2B A;  4KSK C;  3SDL C;  3D32 A;  3PLV A;  1KOT A;  2YVC A;  1ZW7 A;  1V86 A;  1VD2 A;  2C9W B;  2LZ6 A;  2ZCC A;  2ZZP B;  4IM3 A;  1E8X A;  4MGK E;  1OQY A;  2D3G A;  2MRP A;  3V60 A;  2J0K A;  2C7N B;  4KVG B;  1V2Y A;  1UZX B;  1BT0 A;  1WF9 A;  5DPS A;  2REX A;  3WA0 A;  2N7D A;  3PPA A;  2KQS A;  4HCP B;  1SE9 A;  4HXD A;  2D2Q A;  4AOF A;  4KIK A;  2ZCB A;  1Z2M A;  3JYU A;  3A4S C;  3ML8 A;  2DYB A;  1YIW A;  2KFK A;  2C5L C;  1Y8R C;  2IO3 B;  5KHO A;  4ZYN A;  2A5U A;  3TL5 A;  5L83 A;  2R2O A;  4WQO B;  3ZLZ A;  1TTN A;  2JZZ A;  4JIO U;  2WDT B;  2ZNV C;  1TBE A;  2R2Q A;  5C1Z A;  3EHV A;  4AUQ C;  2G45 B;  2MP2 A;  2G4S A;  4BVU C;  1Q0W B;  4FUL A;  4WWP A;  3VDZ A;  3PHW B;  3AXC A;  3HIZ A;  3ZTD A;  2FCM A;  3EFU A;  4ZDV A;  3B1L X;  2IO1 B;  4N9F 4;  2GBN A;  3WAP A;  5CX3 A;  2D07 B;  2IY1 B;  2BYE A;  2RSU A;  2KWU B;  2AL3 A;  1RFA A;  1E7U A;  4GGQ A;  4GB9 A;  2L0T A;  4G0N B;  2I1K A;  1Q5W B;  3VTW A;  4IW0 A;  4KIK B;  2QHO A;  2DZM A;  3UIP B;  2A4Z A;  2BWF A;  2KFK B;  3ZKJ C;  2NBU A;  2XK5 A;  4XC2 A;  3PS6 A;  4IWP A;  3IVF A;  2JXX A;  2V1Y A;  3NZU A;  1MG8 A;  4CYE A;  1YJ1 A;  4NJ7 A;  2NBW B;  4NPN A;  1P0R A;  4DK5 A;  2MP2 B;  5LXH A;  2JZ3 B;  4A3P A;  4ZRJ A;  1SIF A;  5AZF A;  4F7Z A;  3SD5 A;  2LVO A;  2MBO A;  2KDI A;  3A33 B;  4FHK A;  4G50 A;  4BFR A;  2CU1 A;  3ZIM A;  1Q1O A;  2NBV B;  1TZ1 A;  1E8Z A;  2KOX A;  2D10 A;  4HPM B;  3ZO5 B;  2BKR B;  3I3T B;  3PRP B;  4PS3 A;  1NDD A;  3VXW A;  4BBN F;  1I42 A;  1UD7 A;  2MA9 B;  4B9K A;  2OJR A;  2ZEQ A;  1RRB A;  2FUH B;  3PGE A;  5J2R A;  3DBL I;  3K9P B;  3DBS A;  4NNJ B;  2CS4 A;  5D2M B;  4JLC A;  2LGD A;  1WRD B;  5CHV C;  4EZK A;  5IAA C;  2XK5 B;  2ZVN A;  4ZRI A;  3ZNH B;  4EUT A;  3QCA A;  4KZ0 A;  1XD3 B;  2Z59 B;  2KC2 A;  1YD8 U;  1E90 A;  3DCG A;  1GUA B;  4HLE A;  2BF8 B;  3VUX A;  2KX0 A;  2LXA A;  2ZJD A;  4IM2 A;  3VTV A;  2NCN A;  1EF1 A;  3NZS A;  3DVN V;  2KFJ A;  2ZPY A;  1IYF A;  3U30 A;  3GZN I;  4JL9 A;  3VFK A;  2DHZ A;  4TQ1 A;  1WE6 A;  3UIN B;  1C3T A;  5IA7 A;  2G3Q B;  1UEL A;  1WGH A;  4ICU A;  4WJN A;  1RLF A;  2HJ8 A;  4TKN A;  4WJQ A;  2L0F A;  3ECI A;  3RUI B;  1E8Y A;  4DWF A;  1WGR A;  2PEA A;  2MLB A;  4GDL A;  4NQL B;  3KUC B;  1I35 A;  2JWZ A;  3NY5 A;  1J19 A;  2DZJ A;  2ZPN A;  4HVB A;  1IPG A;  2JF5 A;  3O65 B;  1WXA A;  4NQK E;  4G3X B;  3B08 A;  2JVC A;  2LRU A;  1EUV B;  5G55 A;  5E6P A;  3IG3 A;  4NAW A;  4YL8 A;  5E6O A;  2KZR A;  4W9I A;  3RT3 B;  3ZDM C;  2RD0 A;  4K7S A;  2WX0 A;  4HCN B;  1CMX B;  4IUM B;  1GG3 A;  4IWQ A;  2HD5 B;  1WXV A;  2KJ6 A;  3L0W B;  1ZKH A;  2LVP A;  3UQA A;  3ENE A;  4GDL B;  2BPS A;  2K8B A;  2MWS B;  4W9D A;  2L76 A;  3PTF C;  3QWZ B;  2WYQ A;  2IO0 B;  3ZNZ B;  2FAZ A;  3A9J A;  2KD0 A;  2LRW A;  3S2A A;  3APD A;  3R66 C;  2PE9 A;  1WGG A;  3AU5 A;  3ZRF A;  3TBL D;  3X23 A;  3H1U A;  4OVU A;  2O6V D;  2MX2 A;  1QZE A;  2O2V A;  1LQB A;  2MQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...