3ZTCA

Pvhl54-213-elob-eloc complex _ (2s,4r)-n-((1,1'-biphenyl)-4-ylmethyl)- 4-hydroxy-1-(2-(3-methylisoxazol-5-yl)acetyl)pyrrolidine-2- carboxamide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
103
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADTFEALCIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 103
sequence length 104
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ztcA00
4G11A 2FIDA 3WAMA 3UIPB 3VXWA 3PRZA 1EF1A 2KXJA 2MBBB 3R3MA 4B95A 4BKSA 4CO7A 3KVFB 3A1QB 1SIFA 2HD5B 3DVGY 4GXBA 2RD0A 4J6IA 4NNJB 1WMHB 1VD2A 3UQBA 2LWPA 2M17A 2MP2A 3CMMB 2BPSA 2MQJA 2FCSA 4MGIE 1U4AA 4GDKA 3MHSD 3HM3A 2LD9A 3AXCA 3PLVA 4NJ6A 3QQ8B 3V6CB 4NAWB 3EECA 5BO4B 4PS8A 2I1KA 4XC2A 1WM3A 2KMCA 4ZRJA 3AU4A 2MBOA 2KX0A 2A5UA 4BKTA 3CSTA 3RT3B 3VUYA 4EUTA 2KQSA 2IO3B 4URKA 3A9KB 2DZJA 2ZNVC 3H1UA 2CHZA 4ANUA 2JRIB 2V4LA 2Y5BB 5AZGA 4I6NB 3PSEB 3BY4B 1WX9A 3AU5A 3WALA 4BOSC 4MDKE 3VAWA 1OEYJ 1Y8RC 3ZDTA 2M0XA 2AL3A 2IY0B 1GNUA 2J7QB 2WDTB 1XQQA 4PS3A 4MSQB 2QHOA 1RLFA 1WX8A 2KTRA 1A5RA 4RM9A 3ZNZB 5L83A 2C60A 2LJ5A 4G50A 1YX5B 5LXHA 1GG3A 4LDTD 4XZ4A 3VH4B 1WI0A 3B1LX 4NY0A 3KH0A 1WF9A 1UH6A 3W1SA 3VUXA 1KJTA 2NBVB 2BKFA 3B0AA 5TR5A 4IM0A 2LASA 3QCAA 1C1YB 3T9LA 2ZEQA 4FN2A 4KSLC 1OGWA 1GC7A 1V80A 3ZLZA 2JZZA 1WXAA 3O65B 1IP9A 2KWVB 3Q3JA 1GUAB 4LJOB 2JF5A 1JRUA 2MA9B 4MSMB 5JZEB 4A20A 3ALBA 4MJSB 3QA8A 4GIVA 4GDLB 3A4SC 3RYTA 3OJ4B 2KJHB 3X0WA 4IW0A 4E3CA 2ZVNA 5CHFA 4EZJA 2CR5A 2NVUI 4FHJA 2NR2A 3VH3B 3PS6A 2GBMA 2KDIA 1WH3A 2LI5A 4DWFA 5LXIB 1V2YA 3KYCD 3AULA 2JZ3B 2K8BA 3T8MA 4A3PA 4M8MA 4IUMB 4DK5A 1WZ3A 5IAAC 4FLHA 1UBIA 1IPGA 2KC2A 5KHQA 3L08A 3DOWA 1WXVA 3H6NA 3P2BA 3U8ZA 3U7DA 3RZWC 4MM3A 5G2NA 1YJ1A 2GBNA 3L10B 1I42A 4EZKA 4ANXA 3ZRFA 2NPTA 2GOWA 2O2VA 1XD3B 1YD8U 4TQ1A 2LVQA 2FCMA 3PT2B 2A4ZA 1WX7A 2JRHA 5DPRA 3L17A 3SHQA 2GBJA 4W9GA 2NCNA 4LDTB 3UF8A 2D2QA 2AWTA 4WQOB 3UQAA 3CSFA 4K7WA 2KO3A 3R7QA 4DDGD 5IA7A 1Q1OA 4ICUA 4HCPB 4NJ7A 2JXXA 5JH5C 4KIKB 2MBQA 3N32A 1OTRB 3WA0A 2XK5A 2IO2B 1S3SG 2DYMA 2LVOA 1UZXB 2KFKA 3DVNV 2LRUA 3KW5B 2KLGA 1R4MI 3AI5A 1WGYA 4ANWA 1ZKHA 2JT4B 3DQVA 1FXTB 4WJOA 4IM3A 1IYFA 1WE7A 3DBLI 5CHWA 4W9HA 3N3KB 3ZTDA 4W9CA 2O6VA 4GGQA 4EFOA 2PPHA 1V49A 2JPHA 4G3XB 4OVVA 2MP2B 2W9NA 3PPAA 4BBNC 3ZNHB 3QARA 3RD2A 4HK2A 4GDKB 2ASQA 3L0WB 3M63B 1WGRA 2G4SA 3JW0X 3VQIA 4BOZB 1R4NI 3A4RA 1WM2A 2V3SA 2KC1A 4MELA 4W9KA 3TIXA 3DVNU 3NOBA 3OAWA 3QJZA 1QZEA 2DX5B 1UD7A 3WAPA 3A1QA 3ZRCA 3EC8A 4M0WB 2FIFA 4WJNA 1WMHA 3ML8A 4ZRKA 2KNBA 3DBHI 5E6NA 3WIMA 2LGDA 2WWZA 3QX1A 2IO1B 1E7UA 4WWNA 1RAXA 2EKEC 4FJYA 1EUVB 3PVLA 5DCNA 3V62A 3ECIA 3MJWA 4DHZE 3OLMD 4ICVA 3GOEA 3VUWA 4DDID 1F9JA 1WGGA 2HJ8A 2BGFA 2KHWB 2N9EB 3A9JB 4PYZA 1TGZB 1OQYA 3JSVB 2AEHA 4LJPB 1SGHA 5DPTA 3VDZA 2AYOB 2PE9A 2N7DA 2K8CA 2FCNA 2HTHA 2WYQA 5KHOA 1CMXB 2DZKA 1GJZA 2C7HA 4GSWA 3VFKA 5CTRC 1YX6B 3RZFA 4K81A 4ZYNA 1P98A 2KOXA 2JWZA 3BINA 1NDDA 5D94A 4AP4C 1WYWB 4IC7B 2DHZA 1UBQA 2EMSA 4W9EA 1EO6A 2FNJB 2K6DB 3DCGA 4GMVA 4MGYE 3VTWA 4BVUC 3H7PB 4WWOA 4N9F4 4W9JA 1H8CA 4KV2A 4GN1A 4CHKA 4DHZB 3D32A 5J2RA 2N9XA 2L76A 2JVCA 4LCDE 2KN5A 3A33B 5CX3A 4WAAA 4W9LA 4BKSD 2XBBC 1V5OA 1WE6A 4YL8A 5C23A 1YQBA 3DDCB 2BYFA 3ZUNA 1WY8A 1WGDA 2RGFA 3TCAA 1UELA 2G45B 2GBRA 4JIOU 3KUZA 2M8SA 1RFAA 4M8NA 3NZUA 4A3OA 1XT9B 1WJ6A 1KLVA 4IG7B 4AOFA 4ZDVA 3OJ3A 2DYOA 4TQ0A 1I35A 1WXSA 2IO0B 3K9OB 3MTNB 3W1YA 4B6WA 4EZLA 3QC8B 5DPWA 2DAFA 1WR6E 3PLUA 3PZDA 3VTUA 4HVBA 2DENB 3CF6E 2BWES 2FUHB 2ZCBA 4MJSA 2DYBA 1Q5WB 1V5TA 2MWSB 1BT0A 2IBIB 3TMPB 3UINB 2L05A 3R66C 2LRWA 2I1JA 1WFYA 2MW5A 3IHPC 4HPLB 2DZIA 3SDLC 4ANVA 1J8CA 1V86A 3HIZA 5AZHA 2KWCA 4KZ0A 3TL5A 1P9DU 4ASWC 2L7RA 3RCZA 4AJWA 4HCNB 4W9FA 2CS4A 2K39A 2LXAA 2BF8B 2V1YA 3DBSA 3K9PB 4PYUA 3WAOA 3DPDA 2J0KA 2N4FA 1TTNA 1E7VA 4FJVB 4JL9A 4FA6A 2VRRB 2REXA 3ZKJC 4E74A 2N1VA 2ZPNA 4MH0E 2N1WA 4BKGA 3V60A 4F8CB 2XK5B 1L2NA 3ZTCA 3ZVVA 2MBEA 3NY5A 5FR6A 4OVUA 3R7RA 1WIAA 3IFWB 3ML9A 1E8WA 2MRPA 2R2OA 5JHAA 3KUDB 4II3B 2FAZA 4W9IA 3X23A 4K7SA 4GB9A 1V81A 4MGZE 5E6OA 1S1QB 1P0RA 2ZZPB 2IY1B 1NI2A 1LQBA 1WJNA 2HE7A 2YVCA 2IZVB 4KZCA 4KIKA 3ZO5B 1H4RA 1E8YA 2Z0EB 2KDEB 3H9DA 4HXDA 2L3ZA 4RM8A 1MG8A 1E90A 3HM6X 1NBFC 5HKHA 4KVGB 1SE9A 5JHBA 3LJ3A 3PV1A 3ZW3A 5G55A 3RUIB 2G3QB 4HWIB 2J0JA 3KUCB 3M3JA 2B3AA 5C1ZA 4EOYA 1YIWA 2BKRB 2MLBA 4K7UA 4HLEA 4CYEA 2YLMA 1V6EA 4GU2A 4TV3A 4E71A 4F7ZA 2GBKA 2K25A 3DVGX 4NQKE 1UGMA 3GZNI 1WZ0A 2M4NA 5L95C 2KWUB 5D7GA 1J0GA 4WJPA 2LGYA 3LDZE 3M62B 3PRPB 1LXDA 4EKUA 2KDBA 3ZDMC 3APFA 1Z2MA 2LXCA 3PTFC 5AEKB 3B08A 5CHVC 3NHEB 4NAWA 4ZRIA 1L7YA 2C7MB 2KTFA 2LZ6A 1M94A 3H7SA 2MSED 3PGEA 4KSKC 5DPSA 3L13A 2KTRB 4P7IA 1LM8B 3QK0A 2M1MA 3W1SC 3DBRI 3WANA 2NS5A 4MGKE 4TUUA 5D2MB 2MCNB 2K6QA 3UIOB 4IWOA 2RSUA 3A9KA 2UYZB 1E8ZA 2R2QA 2CU1A 2KLCA 2ZJDA 2ZPYA 4KDLB 5J17A 4FBJB 1KOTA 2J0MA 1K8RB 3ZNGC 2D07B 1ISNA 4BBNF 2BYEA 4HDQA 5LLIA 1E8XA 4GOCA 1WR1A 2PJHA 1GC6A 2ZNVB 1X1MA 2C5LC 1TBEA 3A9JA 4FJZA 3SD5A 3JSVA 3HK0A 3IVFA 4PS7A 2K8HA 2UWQA 4JLCA 3S2AA 2L0TA 1J19A 2D3GA 2L00B 2MBHA 4JGHB 1D3ZA 1KM7A 3VVWB 3PHXB 1PQSA 2EMTA 1TZ1A 3PREA 3NS8A 3C0RB 1P3QU 5EDSA 2LVPA 2O6VD 1WXMA 4NPNA 4AUQC 2CHXA 4DBGA 3L16A 2L0FA 3TBLD 1AARA 1EF5A 2DZMA 4TKNA 3ENEA 2L8JA 2Z0DB 3EFUA 3IBEA 2FCQA 2LUEA 2WX0A 3VHTC 3JVZX 3SU8X 4F1SA 1C3TA 3JYUA 4DHJD 3H7PA 3TJPA 2LGXA 3APDA 2OOBB 3VTVA 2KDFB 2MX2A 2OJRA 4KDIC 3APCA 1P1AA 2KJRA 3I3TB 4GDLA 2GMIC 4NQLB 2WX1A 1RRBA 5GMVA 2RPQA 4XX5A 2KZRA 2N7EA 2KD0A 4IM2A 1WJ4A 2K1FA 2BWFA 4HJKA 2JUOA 1V9JA 2XEWA 4I6PA 2KMAA 3PRMB 3QIJA 2NPTB 5D6JB 2KANA 2O2VB 4FADA 4FHKA 2KJ6A 1WJUA 4RMAA 1Q0WB 2CKHB 4II2B 3NZSA 2PE6B 4HPMB 2G4DB 2PEAA 4EEWA 1T0YA 3UGBB 4AJYB 3M95A 1ZGUB 3HHMA 4G0NB 2RR9A 1HE8A 4BFRA 5E6PA 3ONSA 2N9PC 3V6EB 2AL6A 3QAQA 4IWQA 2NBWB 3QHTA 2KQ7A 3L54A 4WWPA 4IWPA 5J18A 4FULA 1ZW7A 3EHVA 1E5WA 4B9KA 2KFKB 2IYDB 1OEYA 2D10A 1Z5SB 2KK8A 4AWJA 3QWZB 2D11A 3N30A 2Z59B 5AZFA 3ZIMA 2ZVOA 4HDOA 1VCBA 2KX3A 1WRDB 2NBUA 3U30A 2C9WB 4X57B 3KYDD 3V61A 1G6JA 2KFJA 3ZNID 4K1RB 2KKCA 2O6VB 3IG3A 2C7NB 2DAJA 4I6LB 2BYVE 3PHWB 4WJQA 1LFDA 2ZCCA 4MEMA 4W9DA 2CHWA 1WGHA 4DHJB 2JY6A 2KVRA 3Q3FA 3RULA 4JQWC 4DXAB
chains in the Genus database with same CATH superfamily
4G11A 2FIDA 1EF1A 2KXJA 2MBBB 3EA6A 2BS3B 2HD5B 2KAJA 3TUOA 4GXBA 1VZ7A 2RD0A 3ZGZA 1F2RI 2MHJA 3UQBA 2LWPA 1R4MB 2MP2A 3CMMB 2MQJA 2FCSA 1U4AA 1WSPA 3VRAB 5MPOA 2BQQA 3PLVA 5HG2A 1EWCA 3TSSA 3V6CB 4NAWB 3EECA 1L0YB 4PS8A 4DQOC 4B0MA 2WXPA 3RMKC 2VH1A 2MBOA 2AQ1B 2KQSA 3KWVA 4URKA 2ZNVC 4ARIA 1PGAA 1WX9A 3AU5A 2H89B 2K9XA 3VAWA 1TS3A 1GNUA 2WDTB 3GZNB 3DBHB 1WX8A 5I4DA 3KWLA 1YX5B 1VRAB 4XZ4A 3VH4B 1WI0A 4N58A 1UH6A 3E9SA 2BKFA 3B0AA 2LASA 3QCAA 4XDDA 4FN2A 3ZLZA 1V80A 5G5GA 2JZZA 1IP9A 3AE5B 2KWVB 3Q3JA 4L23A 2ON8A 3QA8A 4BZAA 5FR3A 3A4SC 3OJ4B 2KJHB 5CHFA 3BWUD 4FHJA 3PS6A 1ACCA 2LI5A 2BW2A 1V2YA 4IKGA 4DK5A 4IUMB 1WZ3A 2MEKA 3BYTB 2KC2A 3FC4A 2WXQA 2NTTA 1XLNA 3U7DA 3L10B 3B2FA 3ZRFA 2NPTA 2AQ2B 2FCMA 3PT2B 1KF6B 2IDYA 3P4QB 5BMIA 3BIID 2NCNA 1NYRA 4LDTB 3I63C 2AWTA 3UQAA 2RPVA 2KO3A 2JXXA 4KIKB 2MBQA 3GP7A 1PYWD 2IGHA 3DVNV 5E6JA 2LRUA 1R7SA 1R4MI 3AI5A 4WWMA 1ZKHA 1KLGD 1WE7A 4YTMB 4W9HA 3N3KB 3ZTDA 4GGQA 2PPHA 4G3XB 1FXAA 3T3NA 3RN9C 4KGSA 3RD2A 1I4GA 1KH0A 2KMMA 3A4RA 4D2KA 4MELA 4W9KA 3TIXA 3NOBA 1FXIA 3WAPA 3ZRCA 3EC8A 2X8XX 2Y5CA 2X38A 1GPXA 3ML8A 1N5XA 3DBHI 2ZW0A 3KQ4A 2WWZA 2INPE 2FE8A 3EUB2 3V05A 3GOEA 3AE3B 4PYZA 1B9RA 3A9JB 2AEHA 2D3AA 4M02A 1CMXB 1VLBA 4C00A 3VFKA 3RZFA 1E7PB 1SJED 2KOXA 5D94A 3MC0B 4W9EA 2FNJB 4MGYE 2LMCA 4GMVA 4C80A 2K0PA 4N9F4 4DHZB 4YTPB 2JVCA 2KN5A 3A33B 4WAAA 1FNUA 2INDC 1WE6A 5C23A 1YQBA 2QDFA 4BAXA 2RGFA 3KUZA 2L32A 1CZPA 1XT9B 1IBXB 1KLVA 4IG7B 4AOFA 2WLBA 4TQ0A 1I35A 2PMVA 3K9OB 4B6WA 2DAFA 2R61A 3PLUA 3PZDA 2GB1A 4REZA 3VTUA 1UGJA 2BWES 2DYBA 4M00A 1V5TA 4WAFA 1BT0A 2IBIB 3TMPB 3AE8B 3R66C 3SDLC 2KWCA 3TL5A 1MHXA 4AJWA 3RCZA 4W9FA 2CS4A 2BF8B 3DBSA 3WAOA 2GRIA 2J0KA 2N4FA 5T8IA 1YJIA 3NVYA 3ZKJC 1FD6A 2XK5B 2MBEA 3NY5A 1IGCA 3ML9A 2WXNA 1XCTL 2FAZA 4W9IA 3X23A 2WS3B 1Q10A 4LK0M 3BVZA 1C4CA 1J7BA 2WXKA 2WXLA 1KRHA 3PZ8A 4KIKA 3ZO5B 4DXFA 3IT4B 1E90A 1NBFC 5JHBA 3ZW3A 2BTEA 4RH6A 2J4XA 3KUCB 1D4BA 4HLEA 4K7UA 4CYEA 3NVZA 2KWUB 2Q5WD 1F2RC 2LGYA 4WJPA 3AV8A 1LXDA 4EKUA 4OHJA 1FIQA 3NVWA 3NHEB 4ZRIA 3N1XC 2MSED 5DPSA 3QK0A 2M1MA 2NS5A 3R8BA 4IWOA 3A9KA 2UYZB 1KOTA 1WYGA 2ZJDA 1C79A 1K8RB 1UWMA 3ZNGC 1ISNA 2FBWB 1NVID 1FFVA 3A9JA 3HK0A 4YSXB 3AEFB 2RDHA 2L0TA 1J19A 1F1HA 2D3GA 3VVWB 3PHXB 1K50A 1TZ1A 3TEZA 2WNMA 3PREA 2LHDA 2JWUA 4NPNA 1JWAD 4AUQC 3DHGC 1FPYA 1EF5A 1QILA 2LUEA 3VHTC 1C3TA 3JVZX 3SU8X 2WXMA 1XLPA 2OOBB 2MX2A 1P1AA 4OZAA 2KJRA 1M4VA 3I3TB 4NQLB 1RRBA 2KZRA 1C76A 4IM2A 4MM3B 2DNFA 1IGDA 2K1FA 2V0GA 1V9JA 2KMAA 3PRMB 2KANA 4FHKA 2KJ6A 1WJUA 1BUIC 1L5PA 4JWUC 1SB3C 2PEAA 3UGBB 4AJYB 1J7AA 1AW7A 1TS4A 1TT5B 4C56C 4HRSA 3L54A 4IWPA 1E9MA 3BZDB 4FULA 3EHVA 1JWUD 2D10A 1Z5SB 3N30A 2Z59B 3ZIMA 1SE3A 2ZVOA 1VCBA 2C9WB 2HTME 3KYDD 2DBYA 2KFJA 1TS2A 3ZNID 2C7NB 4HKQA 2BYVE 1K52A 1HEZE 3PHWB 4WJQA 5H92C 4W9DA 3Q3OC 4DXAB 2BB6A 1FCCC 4B95A 4CO7A 1SIFA 3DVGY 3Q14C 2W3RA 1FNWA 4J6IA 1DYQA 5C2TB 2PW9A 1LGRA 4MGIE 4GDKA 1QQRA 3HM3A 3AXCA 4NJ6A 3NRZA 1XEEA 1NEKB 2W82A 5BO4B 2DWQA 3HVZA 2KMCA 4ZRJA 3AU4A 3CSTA 3RT3B 1AWDA 2IO3B 2CHZA 3U7ZA 2Y5BB 3EGRA 3RNEC 3WALA 1OEYJ 1Y8RC 2QEJC 3ZDTA 1FFUA 2AL3A 2J7QB 4YXDB 1QF6A 2QHOA 1JWMD 3R2IA 3ZNZB 5L83A 3FAHA 1GG3A 3ETRA 1WXQA 4LDTD 3B1LX 1XLQA 5IO9A 3W1SA 1LO5D 2KDMA 4N6EB 2NBVB 4GLSC 5IN7A 1OGWA 1GC7A 1SBBB 1UNSA 1GUAB 2MA9B 1JRUA 1GOZA 2K3UA 3ALBA 1N61A 4MJSB 4GDLB 3RYTA 1V8CA 4E3CA 4EZJA 2NVUI 2WXFA 2NR2A 2GBMA 3RNBC 1MFWA 1WH3A 3RNGC 4DWFA 3AULA 2K8BA 3T8MA 4ZRQA 5IAAC 4FLHA 1IPGA 3DOWA 3J9CA 1ZP0B 1EWYC 4KGTA 4MM3A 5HFYA 3IT6B 1YJ1A 2GBNA 1E10A 1HTOA 1WX7A 1GAQB 2JRHA 3L17A 4XE0A 1QKZA 3UF8A 2D2QA 4WQOB 3HRDD 3R7QA 4DDGD 5IA7A 1Q1OA 4ICUA 2HDEA 3N32A 1OTRB 1D5ZC 2DYMA 3KW5B 4LNNA 1WGYA 2N7JA 3AEBB 3ZJUA 2PTLA 1N62A 1IYFA 3DBLI 2LUMA 5BYSA 4W9CA 4PT5A 1V49A 1JW9D 2MJDA 1I4XA 4HK2A 3P4RB 3M63B 2G4SA 1YJJA 3VQIA 2AX5A 3GB1A 3QJZA 1C9FA 2DX5B 3URYA 2H88B 4WJNA 4ZRKA 3AEDB 3NZ3A 5E6NA 1FNVA 3NG0A 2LGDA 3Q6BA 3WIMA 3QX1A 2XNAC 5LNK1 2EKEC 1EUVB 1SE4A 4UDUC 4ZHPA 3ECIA 3AN1A 3OLMD 3VUWA 1F9JA 1WGGA 2BGFA 1OQYA 4LJPB 1SGHA 5DPTA 4WH4A 2PE9A 2HTHA 2DZKA 2C7HA 5CTRC 1YX6B 3AE7B 2JWZA 2BYTA 3DHHC 2EMSA 1DOXA 2K6DB 2K22A 4WWOA 4GN1A 5J2RA 2N9XA 1ROEA 3PZ7A 4W9LA 1JWSD 1V5OA 2XBBC 4YL8A 3DDCB 2BYFA 4LNKA 4XGAB 3MFGA 3TCAA 2G45B 2M8SA 1RFAA 1I4PA 4A3OA 1CQVA 1C4AA 1WGKA 3QC8B 5DPWA 4HVBA 3CF6E 4MJSA 1ET9A 1Q5WB 1YN3A 2BVCA 2L05A 4HEA1 2I1JA 1QOFA 3Q8FA 4ANVA 1V86A 4US8A 4A8XC 2V3NA 1P9DU 4ASWC 5GXGB 4HCNB 2KYWA 2K39A 2N0SB 2V1YA 3TEYA 1HQRD 3AEAB 1E7VA 4FA6A 2VRRB 4KKIA 4E74A 5BYQA 2ZPNA 4MH0E 2N1WA 5IOIA 1L2NA 2I38A 5FR6A 2BT6A 1HXYD 3RI7C 2MRPA 5JXVA 5JHAA 2MJEA 2HJ1A 4MGZE 3ZQ4A 3IXSA 1NI2A 2YVCA 2IZVB 1L6VA 4LNIA 1E8YA 3H9DA 2KDEB 2L3ZA 4KVGB 1SE9A 5G55A 4HWIB 2J0JA 4H2AA 1OQQA 1YIWA 2BKRB 2MLBA 2M0AA 2YLMA 1PUTA 1OFFA 3GZNI 1WZ0A 3AE2B 5D7GA 1J0GA 3NUHB 3M62B 3PRPB 3PTFC 1Z2MA 4R3DA 5AEKB 3B08A 4NAWA 2L1AA 3H7SA 1YOVB 2BBCA 2KTRB 2WDQB 3W1SC 1MI0A 3MHZA 2MCNB 4C7ZA 2RSUA 1E8ZA 2KLCA 5J17A 2D07B 5FK9C 2KWDA 1C4PA 1E8XA 1CJEA 2ZNVB 1X1MA 2L83A 3SD5A 2K8HA 4S0RA 4RF1A 4JLCA 1EM7A 1JROA 1D3ZA 1KM7A 1TY0A 2OEDA 1P3QU 3MJ5A 5EDSA 4DBGA 2CHXA 1AARA 1RYJA 2GLSA 3ENEA 4TKNA 2Z0DB 4S17A 1D5XC 2WX0A 1UWXA 2Y5PA 4F1SA 1TY2A 3JYUA 3TJPA 2LGXA 3APDA 4KDIC 2JXTA 3APCA 1A70A 3CWIA 3B2GA 2GMIC 5GMVA 2RPQA 1RFKA 4XX5A 2KD0A 1GB1A 3R2TA 4HJKA 2XEWA 3AECB 2QILA 2O2VB 3C8YA 4RMAA 4K3CA 3NZSA 1T0YA 3M95A 2I2YA 2N9PC 3V6EB 3QAQA 3QHTA 1YN5A 4WWPA 1QLBB 3TEXA 4XDCA 1ZW7A 1SJHD 1E5WA 4IDIA 4B9KA 2KFKB 2IYDB 2KK8A 2W54A 5HHDG 1K51A 1P7EA 4US9A 3QWZB 2D11A 5AZFA 1WRDB 1B1ZA 3V61A 5EE1A 2KKCA 1HA5A 1FMAD 4RCOA 2DAJA 4MEMA 2CHWA 1WGHA 4DHJB 1V97A 1FRRA 1SEBD 1L0XB 3UIPB 1YN4A 3BK1A 3KVFB 3A1QB 2V3PA 3Q2AC 2WXIA 3N20C 3I57A 4NNJB 1WMHB 1VD2A 3ZYYX 1ZOYB 2LD9A 2WXGA 3UI3A 2JYEA 4OZBA 4RGNA 4RGMA 4MACA 4JPSA 4NAMA 2I1KA 4XC2A 3ZXRA 1L6UA 2MJ3A 1ZDXA 3AE1B 2KX0A 4BKTA 4EUTA 3VUYA 4XWWA 2V9HA 1R4NB 3H1UA 1NYQA 1VZ8A 2JRIB 4I6NB 4OZCA 2NTSA 4YSZB 1ZDVA 2M0XA 4PS3A 4MSQB 2WXJA 2KTRA 2K5PA 3E56A 4WQMA 1A5RA 2C60A 2LJ5A 4G50A 3MC9A 1T0QC 3TEWA 2QCZA 3KH0A 3VUXA 4HJGE 3FILB 1KJTA 5TR5A 4IM0A 1C1YB 2ZEQA 4KSLC 1TS5A 3DBRB 1WXAA 1FEHA 4LJOB 1WWTA 2JF5A 3AB5A 4MSMB 4A20A 4LNOA 5D3DA 4IW0A 2ZVNA 2CR5A 2J52A 2KACA 1FCLA 1IBXA 2JZ3B 4M8MA 3AE9B 1YQ4B 1YQ3B 2NMQA 2UU7A 1ENFA 1V1OA 2IJ0A 4O1NA 3H6NA 3Q69A 1EU3A 3U8ZA 2BS2B 2ONQA 2PVOD 5G2NA 1ZPSA 1GB4A 4EZKA 3RFZB 4ANXA 2O2VA 5FKAC 1XD3B 4P6VF 4TQ1A 2LVQA 4A90A 2WXRA 4B0EA 3SHQA 2GBJA 4W9GA 2AQ3B 4XYCA 3AEEB 5JH5C 4NJ7A 3LXFA 3WA0A 2XK5A 2LVOA 2KFKA 1C77A 2WDVB 3P42A 2JT4B 1FXTB 4RGOS 1FM0D 3BK2A 2LGSA 2E6XA 2QJLA 4EFOA 2WXOA 1TZOA 3CIRB 2MP2B 1EU4A 2LJIA 2WGSA 2CJOA 3L0WB 1TJEA 1F0ZA 3JW0X 1R4NI 1WM2A 2V3SA 2KC1A 1RM6C 3DVNU 4YWGG 3A1QA 1WMHA 1MVKA 2SEBD 3P1MA 2IO1B 4WWNA 1RAXA 4FJYA 1N60A 3V62A 3MJWA 4ICVA 4DDID 4LTUA 3Q8CA 2HJ8A 2N9EB 2KHWB 2MH7A 1E0ZA 2WYQA 2N7DA 2FCNA 5KHOA 4K81A 4ZYNA 1P98A 3BINA 1NDDA 4AP4C 4IC7B 1UBQA 1EO6A 3DCGA 3VTWA 2LEKA 3H7PB 4W9JA 1I4RA 4KV2A 3D32A 3AM9A 1STEA 4A6QA 3N1ZC 2L76A 5CX3A 2BB5A 1I4HA 1OQRA 1D6EC 3ZJVA 3ZUNA 3H8HA 1WY8A 4MT5A 2GBRA 3FILA 4M8NA 1WJ6A 2YEPF 1L4ZB 4ZDVA 3OJ3A 3Q3NC 3W9CB 3MTNB 3W1YA 1WR6E 4M01A 2DENB 4ARCA 1PFDA 4LNFA 4HPPA 3UINB 4HPLB 1WFYA 2MW5A 3IHPC 2LGIA 1J8CA 1SE2A 5AZHA 3HIZA 4KZ0A 1WRIA 3I5JC 1T0SC 3K9PB 2GI9A 3BVMA 2Y3AA 3DPDA 1K53A 4FJVB 1VR9A 2CJNA 4JL9A 2REXA 1MPEA 2RDGA 3V60A 4F8CB 4XWTA 1AN8A 3OG5A 4OVUA 3R7RA 1XLOA 2R2OA 1AYFA 4KGRA 4II3B 3SEBA 4GB9A 1JQ4A 1TYGB 5E6OA 5H8YE 1VZ6A 4WIPA 1P0RA 2ZZPB 1P7FA 1LQBA 2HE7A 1TKEA 1H4RA 3RPFC 2VZKB 3HM6X 5HKHA 3LJ3A 3PV1A 3RUIB 2G3QB 2PLPA 2E3TA 3M3JA 1J7CA 2CU3A 4EE2A 3KLSX 4E71A 1V6EA 2GBKA 2K25A 1D5MC 4OW0A 1UGMA 1TKYA 4ZYSA 3LDZE 4P1BC 1UF0A 2KDBA 2PKOA 3ZDMC 3APFA 1SF0A 1L7YA 2C7MB 2KTFA 4ACFA 2LZ6A 3PGEA 2M19A 1LM8B 3WANA 4TUUA 4MGKE 2K6QA 1KFYB 4KDLB 2R2QA 3MC8A 1UUPA 4N59A 2J0MA 2BYEA 4HDQA 5LLIA 4GOCA 1WR1A 2PJHA 3ZJTA 4J3OD 1JCKB 4PS7A 4RGTA 2WP9B 2L00B 1HZ5A 2EKIA 1PQSA 2W55A 1SSNA 3C0RB 2LVPA 4HKZE 1XCQL 4L2YA 1XO3A 4AS1A 2L8JA 1QOAA 2FCQA 4DHJD 3H7PA 3VTVA 3OWEB 1QOGA 1RWSA 3Q8AA 4GDLA 1BXTA 3Q8BA 3PO0A 2INCC 2JUOA 4I6PA 3QIJA 1KLUD 1T6BX 4FADA 1Q0WB 2L52A 2CKHB 4II2B 4EEWA 3NS1A 4YT0B 1HE8A 5E6PA 3ONSA 3NJTA 4IWQA 3EFCA 2N9LA 4ITKA 4JX1C 2D3BA 2KX3A 2NBUA 3U30A 4X57B 5G5HA 3IG3A 2O6VB 1L0VB 2Z8LA 4A55A 4YTNB 2V4IB 3V3XA 2JYTA 3NVVA 2JY6A 3WAMA 1SXTA 3DWGC 3VXWA 3PRZA 3R3MA 4BKSA 2QSDA 5C3JB 4Q2JA 2M17A 2BPSA 1E6EB 3U4EG 2OHFA 3MHSD 4LLGM 3QQ8B 2VH2A 1PDXA 2B76B 1TKGA 3BYYB 1CK1A 1WM3A 4QAYA 2A5UA 3IAS1 2PVGC 1YMHE 2FUG1 3A9KB 2DZJA 4ANUA 2V4LA 4FXCA 5AZGA 3RNFC 3VRBB 3PSEB 3BY4B 4BOSC 4P16A 4MDKE 3WCQA 2IY0B 1XQQA 1RLFA 4RM9A 3MP9A 5LXHA 1F77A 2WU2B 3ZXVA 2IGDA 4NY0A 4TMAB 1WF9A 3DWMA 2JU6X 4OVZA 1HTQA 1XXGA 3T9LA 1VJKA 1N63A 3O65B 3B9JA 5JZEB 2M56B 4GIVA 3IAM1 2D3CA 3X0WA 4HROA 3VH3B 4C7YA 2KDIA 5IP4D 5LXIB 3KYCD 2KVZA 4A3PA 1T0RC 3W5VB 1UBIA 3AMZA 5KHQA 3L08A 2IGGA 2JSVX 3AH7A 1WXVA 3RNCC 3P2BA 2J53A 1VDVA 3I9V1 3RZWC 1TIFA 1ZUD2 1I42A 3AE4B 3SFDB 4USAA 2GOWA 1YD8U 1I7HA 2A4ZA 5DPRA 3U2SC 2TSSA 3CSFA 4K7WA 2IPKD 4HCPB 2PIAA 2DLBA 2QMTA 4ZHOA 2IO2B 3W5UB 2W3SA 1S3SG 5IKCM 1UZXB 4PK1A 4ANWA 2KLGA 1JALA 3DQVA 4WJOA 4IM3A 4K3BA 5CHWA 2O6VA 2JPHA 4OVVA 2W9NA 3SR6A 3PPAA 1N6ZA 2EELA 4BBNC 3ZNHB 3QARA 4GDKB 2ASQA 1WGRA 2OJWA 4BOZB 3ABVB 4WURA 3OAWA 3HUIA 1QZEA 3HVDA 1UD7A 3VR8B 4JE3B 4M0WB 2FIFA 2WXHA 2KNBA 5AUIA 1JWBD 1MHHE 1E7UA 1PGBA 2J42A 3PVLA 4KKJA 5DCNA 4DHZE 1DOIA 3GE3C 1TGZB 2JZPA 3JSVB 1NENB 3VDZA 2AYOB 2K8CA 1ZXIA 2WDRB 1GJZA 4GSWA 3LB8C 2RMMA 4ZRPA 4RNAA 1ESFA 1WYWB 2DHZA 1ET6A 4BVUC 1QOBA 1H8CA 4CHKA 5BMHA 4DXGA 2INNE 4LCDE 4ZOHC 5EE0A 4AQ7A 4BKSD 2LHEA 1DOYA 3FKYA 3U52E 5AUKA 1WGDA 1UELA 4JIOU 3NZUA 3C19A 2VZKD 2DYOA 4L1BA 1WXSA 2IO0B 4EZLA 3RNAC 2FUHB 2ZCBA 1MG4A 4P1CC 2MWSB 2WHIA 1V1PB 2LRWA 2DZIA 4MH8A 4C4VB 1PGXA 2L7RA 2LXAA 3O13A 4PYUA 3Q3MC 1NI3A 2RDBC 1TTNA 3GE8C 2N1VA 4BKGA 5TSSA 3N9YC 3ZTCA 3ZVVA 4JWSC 1WIAA 3IFWB 1E8WA 2LFIA 2KN4A 3KUDB 4NZLB 1XF5L 4K7SA 1V81A 2ICIA 4RF0A 1S1QB 1JMLA 1ZE3D 2IY1B 3AEGB 1WJNA 4KZCA 1BMLC 4A9AA 2Z0EB 4HXDA 4RM8A 1MG8A 1QT9A 3L4PA 3SFEB 3T3OA 3P63A 2B3AA 5C1ZA 1T5XD 4EOYA 3Q8EA 4TV3A 4GU2A 4F7ZA 5BYRA 3DVGX 4NQKE 2M4NA 5L95C 1MJDA 3DBLB 4CQNA 2LXCA 1YNTE 5CHVC 2SAKA 1C78A 1M94A 4KSKC 2JX5A 3L13A 4P7IA 4M0WA 3DBRI 5D2MB 3UIOB 2G9HD 2ZPYA 2CU1A 1FRDA 5EE3A 4FBJB 4BBNF 1I4QA 1GC6A 2YEPB 3W2DA 2C5LC 1TBEA 4FJZA 4YSYB 2QC8A 3JSVA 3IVFA 2UWQA 3S2AA 4JGHB 2MBHA 2JQRB 5D3IB 2KT7A 2EMTA 3NS8A 2G1EA 2O6VD 1WXMA 1IUEA 2L0FA 3DHIC 3L16A 3TBLD 2DZMA 3IBEA 3EFUA 2KQ4X 2WQYB 2KDFB 2OJRA 5HI1A 2N9KA 4KX6B 1L4DB 1T3QA 2WX1A 1F52A 2N7EA 1WJ4A 2BWFA 2ZW1A 2WU5B 4IOIE 1KTKA 2NPTB 5D6JB 4NJCA 1DGJA 3P4PB 5BMGA 1SIJA 1FO4A 2ACZB 2PE6B 3BVGA 2G4DB 4HPMB 3VR9B 3N1YC 1ZGUB 3HHMA 4G0NB 2RR9A 2QIEB 4BFRA 1HZ6A 1ZXHA 1N5WA 2AL6A 3P4SB 2NBWB 2KQ7A 1V1PA 2XN9C 5J18A 1JRPA 3LYYA 4TSSA 5EE9A 4RFBA 4C4VA 1OEYA 4AWJA 4HDOA 1G6JA 4K1RB 3AE6B 4I6LB 1Y56A 1LFDA 3GS2A 2BS4B 2D5GA 2ZCCA 2KVRA 3Q3FA 3RULA 4JQWC
chains in the Genus database with same CATH topology
4G11A 2FIDA 3WAMA 3UIPB 3VXWA 3PRZA 1EF1A 2KXJA 2MBBB 3R3MA 4B95A 4BKSA 4CO7A 3KVFB 3A1QB 1SIFA 2HD5B 3DVGY 4GXBA 2RD0A 4J6IA 4NNJB 1WMHB 1VD2A 3UQBA 2LWPA 2M17A 2MP2A 3CMMB 2BPSA 2MQJA 2FCSA 4MGIE 1U4AA 4GDKA 3MHSD 3HM3A 2LD9A 3AXCA 3PLVA 4NJ6A 3QQ8B 3V6CB 4NAWB 3EECA 5BO4B 4PS8A 2I1KA 4XC2A 1WM3A 2KMCA 4ZRJA 3AU4A 2MBOA 2KX0A 2A5UA 4BKTA 3CSTA 3RT3B 3VUYA 4EUTA 2KQSA 2IO3B 4URKA 3A9KB 2DZJA 2ZNVC 3H1UA 2CHZA 4ANUA 2JRIB 2V4LA 2Y5BB 5AZGA 4I6NB 3PSEB 3BY4B 1WX9A 3AU5A 3WALA 4BOSC 4MDKE 3VAWA 1OEYJ 1Y8RC 3ZDTA 2M0XA 2AL3A 2IY0B 1GNUA 2J7QB 2WDTB 1XQQA 4PS3A 4MSQB 2QHOA 1RLFA 1WX8A 2KTRA 1A5RA 4RM9A 3ZNZB 5L83A 2C60A 2LJ5A 4G50A 1YX5B 5LXHA 1GG3A 4LDTD 4XZ4A 3VH4B 1WI0A 3B1LX 4NY0A 3KH0A 1WF9A 1UH6A 3W1SA 3VUXA 1KJTA 2NBVB 2BKFA 3B0AA 5TR5A 4IM0A 2LASA 3QCAA 1C1YB 3T9LA 2ZEQA 4FN2A 4KSLC 1OGWA 1GC7A 1V80A 3ZLZA 2JZZA 1WXAA 3O65B 1IP9A 2KWVB 3Q3JA 1GUAB 4LJOB 2JF5A 1JRUA 2MA9B 4MSMB 5JZEB 4A20A 3ALBA 4MJSB 3QA8A 4GIVA 4GDLB 3A4SC 3RYTA 3OJ4B 2KJHB 3X0WA 4IW0A 4E3CA 2ZVNA 5CHFA 4EZJA 2CR5A 2NVUI 4FHJA 2NR2A 3VH3B 3PS6A 2GBMA 2KDIA 1WH3A 2LI5A 4DWFA 5LXIB 1V2YA 3KYCD 3AULA 2JZ3B 2K8BA 3T8MA 4A3PA 4M8MA 4IUMB 4DK5A 1WZ3A 5IAAC 4FLHA 1UBIA 1IPGA 2KC2A 5KHQA 3L08A 3DOWA 1WXVA 3H6NA 3P2BA 3U8ZA 3U7DA 3RZWC 4MM3A 5G2NA 1YJ1A 2GBNA 3L10B 1I42A 4EZKA 4ANXA 3ZRFA 2NPTA 2GOWA 2O2VA 1XD3B 1YD8U 4TQ1A 2LVQA 2FCMA 3PT2B 2A4ZA 1WX7A 2JRHA 5DPRA 3L17A 3SHQA 2GBJA 4W9GA 2NCNA 4LDTB 3UF8A 2D2QA 2AWTA 4WQOB 3UQAA 3CSFA 4K7WA 2KO3A 3R7QA 4DDGD 5IA7A 1Q1OA 4ICUA 4HCPB 4NJ7A 2JXXA 5JH5C 4KIKB 2MBQA 3N32A 1OTRB 3WA0A 2XK5A 2IO2B 1S3SG 2DYMA 2LVOA 1UZXB 2KFKA 3DVNV 2LRUA 3KW5B 2KLGA 1R4MI 3AI5A 1WGYA 4ANWA 1ZKHA 2JT4B 3DQVA 1FXTB 4WJOA 4IM3A 1IYFA 1WE7A 3DBLI 5CHWA 4W9HA 3N3KB 3ZTDA 4W9CA 2O6VA 4GGQA 4EFOA 2PPHA 1V49A 2JPHA 4G3XB 4OVVA 2MP2B 2W9NA 3PPAA 4BBNC 3ZNHB 3QARA 3RD2A 4HK2A 4GDKB 2ASQA 3L0WB 3M63B 1WGRA 2G4SA 3JW0X 3VQIA 4BOZB 1R4NI 3A4RA 1WM2A 2V3SA 2KC1A 4MELA 4W9KA 3TIXA 3DVNU 3NOBA 3OAWA 3QJZA 1QZEA 2DX5B 1UD7A 3WAPA 3A1QA 3ZRCA 3EC8A 4M0WB 2FIFA 4WJNA 1WMHA 3ML8A 4ZRKA 2KNBA 3DBHI 5E6NA 3WIMA 2LGDA 2WWZA 3QX1A 2IO1B 1E7UA 4WWNA 1RAXA 2EKEC 4FJYA 1EUVB 3PVLA 5DCNA 3V62A 3ECIA 3MJWA 4DHZE 3OLMD 4ICVA 3GOEA 3VUWA 4DDID 1F9JA 1WGGA 2HJ8A 2BGFA 2KHWB 2N9EB 3A9JB 4PYZA 1TGZB 1OQYA 3JSVB 2AEHA 4LJPB 1SGHA 5DPTA 3VDZA 2AYOB 2PE9A 2N7DA 2K8CA 2FCNA 2HTHA 2WYQA 5KHOA 1CMXB 2DZKA 1GJZA 2C7HA 4GSWA 3VFKA 5CTRC 1YX6B 3RZFA 4K81A 4ZYNA 1P98A 2KOXA 2JWZA 3BINA 1NDDA 5D94A 4AP4C 1WYWB 4IC7B 2DHZA 1UBQA 2EMSA 4W9EA 1EO6A 2FNJB 2K6DB 3DCGA 4GMVA 4MGYE 3VTWA 4BVUC 3H7PB 4WWOA 4N9F4 4W9JA 1H8CA 4KV2A 4GN1A 4CHKA 4DHZB 3D32A 5J2RA 2N9XA 2L76A 2JVCA 4LCDE 2KN5A 3A33B 5CX3A 4WAAA 4W9LA 4BKSD 2XBBC 1V5OA 1WE6A 4YL8A 5C23A 1YQBA 3DDCB 2BYFA 3ZUNA 1WY8A 1WGDA 2RGFA 3TCAA 1UELA 2G45B 2GBRA 4JIOU 3KUZA 2M8SA 1RFAA 4M8NA 3NZUA 4A3OA 1XT9B 1WJ6A 1KLVA 4IG7B 4AOFA 4ZDVA 3OJ3A 2DYOA 4TQ0A 1I35A 1WXSA 2IO0B 3K9OB 3MTNB 3W1YA 4B6WA 4EZLA 3QC8B 5DPWA 2DAFA 1WR6E 3PLUA 3PZDA 3VTUA 4HVBA 2DENB 3CF6E 2BWES 2FUHB 2ZCBA 4MJSA 2DYBA 1Q5WB 1V5TA 2MWSB 1BT0A 2IBIB 3TMPB 3UINB 2L05A 3R66C 2LRWA 2I1JA 1WFYA 2MW5A 3IHPC 4HPLB 2DZIA 3SDLC 4ANVA 1J8CA 1V86A 3HIZA 5AZHA 2KWCA 4KZ0A 3TL5A 1P9DU 4ASWC 2L7RA 3RCZA 4AJWA 4HCNB 4W9FA 2CS4A 2K39A 2LXAA 2BF8B 2V1YA 3DBSA 3K9PB 4PYUA 3WAOA 3DPDA 2J0KA 2N4FA 1TTNA 1E7VA 4FJVB 4JL9A 4FA6A 2VRRB 2REXA 3ZKJC 4E74A 2N1VA 2ZPNA 4MH0E 2N1WA 4BKGA 3V60A 4F8CB 2XK5B 1L2NA 3ZTCA 3ZVVA 2MBEA 3NY5A 5FR6A 4OVUA 3R7RA 1WIAA 3IFWB 3ML9A 1E8WA 2MRPA 2R2OA 5JHAA 3KUDB 4II3B 2FAZA 4W9IA 3X23A 4K7SA 4GB9A 1V81A 4MGZE 5E6OA 1S1QB 1P0RA 2ZZPB 2IY1B 1NI2A 1LQBA 1WJNA 2HE7A 2YVCA 2IZVB 4KZCA 4KIKA 3ZO5B 1H4RA 1E8YA 2Z0EB 2KDEB 3H9DA 4HXDA 2L3ZA 4RM8A 1MG8A 1E90A 3HM6X 1NBFC 5HKHA 4KVGB 1SE9A 5JHBA 3LJ3A 3PV1A 3ZW3A 5G55A 3RUIB 2G3QB 4HWIB 2J0JA 3KUCB 3M3JA 2B3AA 5C1ZA 4EOYA 1YIWA 2BKRB 2MLBA 4K7UA 4HLEA 4CYEA 2YLMA 1V6EA 4GU2A 4TV3A 4E71A 4F7ZA 2GBKA 2K25A 3DVGX 4NQKE 1UGMA 3GZNI 1WZ0A 2M4NA 5L95C 2KWUB 5D7GA 1J0GA 4WJPA 2LGYA 3LDZE 3M62B 3PRPB 1LXDA 4EKUA 2KDBA 3ZDMC 3APFA 1Z2MA 2LXCA 3PTFC 5AEKB 3B08A 5CHVC 3NHEB 4NAWA 4ZRIA 1L7YA 2C7MB 2KTFA 2LZ6A 1M94A 3H7SA 2MSED 3PGEA 4KSKC 5DPSA 3L13A 2KTRB 4P7IA 1LM8B 3QK0A 2M1MA 3W1SC 3DBRI 3WANA 2NS5A 4MGKE 4TUUA 5D2MB 2MCNB 2K6QA 3UIOB 4IWOA 2RSUA 3A9KA 2UYZB 1E8ZA 2R2QA 2CU1A 2KLCA 2ZJDA 2ZPYA 4KDLB 5J17A 4FBJB 1KOTA 2J0MA 1K8RB 3ZNGC 2D07B 1ISNA 4BBNF 2BYEA 4HDQA 5LLIA 1E8XA 4GOCA 1WR1A 2PJHA 1GC6A 2ZNVB 1X1MA 2C5LC 1TBEA 3A9JA 4FJZA 3SD5A 3JSVA 3HK0A 3IVFA 4PS7A 2K8HA 2UWQA 4JLCA 3S2AA 2L0TA 1J19A 2D3GA 2L00B 2MBHA 4JGHB 1D3ZA 1KM7A 3VVWB 3PHXB 1PQSA 2EMTA 1TZ1A 3PREA 3NS8A 3C0RB 1P3QU 5EDSA 2LVPA 2O6VD 1WXMA 4NPNA 4AUQC 2CHXA 4DBGA 3L16A 2L0FA 3TBLD 1AARA 1EF5A 2DZMA 4TKNA 3ENEA 2L8JA 2Z0DB 3EFUA 3IBEA 2FCQA 2LUEA 2WX0A 3VHTC 3JVZX 3SU8X 4F1SA 1C3TA 3JYUA 4DHJD 3H7PA 3TJPA 2LGXA 3APDA 2OOBB 3VTVA 2KDFB 2MX2A 2OJRA 4KDIC 3APCA 1P1AA 2KJRA 3I3TB 4GDLA 2GMIC 4NQLB 2WX1A 1RRBA 5GMVA 2RPQA 4XX5A 2KZRA 2N7EA 2KD0A 4IM2A 1WJ4A 2K1FA 2BWFA 4HJKA 2JUOA 1V9JA 2XEWA 4I6PA 2KMAA 3PRMB 3QIJA 2NPTB 5D6JB 2KANA 2O2VB 4FADA 4FHKA 2KJ6A 1WJUA 4RMAA 1Q0WB 2CKHB 4II2B 3NZSA 2PE6B 4HPMB 2G4DB 2PEAA 4EEWA 1T0YA 3UGBB 4AJYB 3M95A 1ZGUB 3HHMA 4G0NB 2RR9A 1HE8A 4BFRA 5E6PA 3ONSA 2N9PC 3V6EB 2AL6A 3QAQA 4IWQA 2NBWB 3QHTA 2KQ7A 3L54A 4WWPA 4IWPA 5J18A 4FULA 1ZW7A 3EHVA 1E5WA 4B9KA 2KFKB 2IYDB 1OEYA 2D10A 1Z5SB 2KK8A 4AWJA 3QWZB 2D11A 3N30A 2Z59B 5AZFA 3ZIMA 2ZVOA 4HDOA 1VCBA 2KX3A 1WRDB 2NBUA 3U30A 2C9WB 4X57B 3KYDD 3V61A 1G6JA 2KFJA 3ZNID 4K1RB 2KKCA 2O6VB 3IG3A 2C7NB 2DAJA 4I6LB 2BYVE 3PHWB 4WJQA 1LFDA 2ZCCA 4MEMA 4W9DA 2CHWA 1WGHA 4DHJB 2JY6A 2KVRA 3Q3FA 3RULA 4JQWC 4DXAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G11 A;  2FID A;  3WAM A;  3UIP B;  3VXW A;  3PRZ A;  1EF1 A;  2KXJ A;  2MBB B;  3R3M A;  4B95 A;  4BKS A;  4CO7 A;  3KVF B;  3A1Q B;  1SIF A;  2HD5 B;  3DVG Y;  4GXB A;  2RD0 A;  4J6I A;  4NNJ B;  1WMH B;  1VD2 A;  3UQB A;  2LWP A;  2M17 A;  2MP2 A;  3CMM B;  2BPS A;  2MQJ A;  2FCS A;  4MGI E;  1U4A A;  4GDK A;  3MHS D;  3HM3 A;  2LD9 A;  3AXC A;  3PLV A;  4NJ6 A;  3QQ8 B;  3V6C B;  4NAW B;  3EEC A;  5BO4 B;  4PS8 A;  2I1K A;  4XC2 A;  1WM3 A;  2KMC A;  4ZRJ A;  3AU4 A;  2MBO A;  2KX0 A;  2A5U A;  4BKT A;  3CST A;  3RT3 B;  3VUY A;  4EUT A;  2KQS A;  2IO3 B;  4URK A;  3A9K B;  2DZJ A;  2ZNV C;  3H1U A;  2CHZ A;  4ANU A;  2JRI B;  2V4L A;  2Y5B B;  5AZG A;  4I6N B;  3PSE B;  3BY4 B;  1WX9 A;  3AU5 A;  3WAL A;  4BOS C;  4MDK E;  3VAW A;  1OEY J;  1Y8R C;  3ZDT A;  2M0X A;  2AL3 A;  2IY0 B;  1GNU A;  2J7Q B;  2WDT B;  1XQQ A;  4PS3 A;  4MSQ B;  2QHO A;  1RLF A;  1WX8 A;  2KTR A;  1A5R A;  4RM9 A;  3ZNZ B;  5L83 A;  2C60 A;  2LJ5 A;  4G50 A;  1YX5 B;  5LXH A;  1GG3 A;  4LDT D;  4XZ4 A;  3VH4 B;  1WI0 A;  3B1L X;  4NY0 A;  3KH0 A;  1WF9 A;  1UH6 A;  3W1S A;  3VUX A;  1KJT A;  2NBV B;  2BKF A;  3B0A A;  5TR5 A;  4IM0 A;  2LAS A;  3QCA A;  1C1Y B;  3T9L A;  2ZEQ A;  4FN2 A;  4KSL C;  1OGW A;  1GC7 A;  1V80 A;  3ZLZ A;  2JZZ A;  1WXA A;  3O65 B;  1IP9 A;  2KWV B;  3Q3J A;  1GUA B;  4LJO B;  2JF5 A;  1JRU A;  2MA9 B;  4MSM B;  5JZE B;  4A20 A;  3ALB A;  4MJS B;  3QA8 A;  4GIV A;  4GDL B;  3A4S C;  3RYT A;  3OJ4 B;  2KJH B;  3X0W A;  4IW0 A;  4E3C A;  2ZVN A;  5CHF A;  4EZJ A;  2CR5 A;  2NVU I;  4FHJ A;  2NR2 A;  3VH3 B;  3PS6 A;  2GBM A;  2KDI A;  1WH3 A;  2LI5 A;  4DWF A;  5LXI B;  1V2Y A;  3KYC D;  3AUL A;  2JZ3 B;  2K8B A;  3T8M A;  4A3P A;  4M8M A;  4IUM B;  4DK5 A;  1WZ3 A;  5IAA C;  4FLH A;  1UBI A;  1IPG A;  2KC2 A;  5KHQ A;  3L08 A;  3DOW A;  1WXV A;  3H6N A;  3P2B A;  3U8Z A;  3U7D A;  3RZW C;  4MM3 A;  5G2N A;  1YJ1 A;  2GBN A;  3L10 B;  1I42 A;  4EZK A;  4ANX A;  3ZRF A;  2NPT A;  2GOW A;  2O2V A;  1XD3 B;  1YD8 U;  4TQ1 A;  2LVQ A;  2FCM A;  3PT2 B;  2A4Z A;  1WX7 A;  2JRH A;  5DPR A;  3L17 A;  3SHQ A;  2GBJ A;  4W9G A;  2NCN A;  4LDT B;  3UF8 A;  2D2Q A;  2AWT A;  4WQO B;  3UQA A;  3CSF A;  4K7W A;  2KO3 A;  3R7Q A;  4DDG D;  5IA7 A;  1Q1O A;  4ICU A;  4HCP B;  4NJ7 A;  2JXX A;  5JH5 C;  4KIK B;  2MBQ A;  3N32 A;  1OTR B;  3WA0 A;  2XK5 A;  2IO2 B;  1S3S G;  2DYM A;  2LVO A;  1UZX B;  2KFK A;  3DVN V;  2LRU A;  3KW5 B;  2KLG A;  1R4M I;  3AI5 A;  1WGY A;  4ANW A;  1ZKH A;  2JT4 B;  3DQV A;  1FXT B;  4WJO A;  4IM3 A;  1IYF A;  1WE7 A;  3DBL I;  5CHW A;  4W9H A;  3N3K B;  3ZTD A;  4W9C A;  2O6V A;  4GGQ A;  4EFO A;  2PPH A;  1V49 A;  2JPH A;  4G3X B;  4OVV A;  2MP2 B;  2W9N A;  3PPA A;  4BBN C;  3ZNH B;  3QAR A;  3RD2 A;  4HK2 A;  4GDK B;  2ASQ A;  3L0W B;  3M63 B;  1WGR A;  2G4S A;  3JW0 X;  3VQI A;  4BOZ B;  1R4N I;  3A4R A;  1WM2 A;  2V3S A;  2KC1 A;  4MEL A;  4W9K A;  3TIX A;  3DVN U;  3NOB A;  3OAW A;  3QJZ A;  1QZE A;  2DX5 B;  1UD7 A;  3WAP A;  3A1Q A;  3ZRC A;  3EC8 A;  4M0W B;  2FIF A;  4WJN A;  1WMH A;  3ML8 A;  4ZRK A;  2KNB A;  3DBH I;  5E6N A;  3WIM A;  2LGD A;  2WWZ A;  3QX1 A;  2IO1 B;  1E7U A;  4WWN A;  1RAX A;  2EKE C;  4FJY A;  1EUV B;  3PVL A;  5DCN A;  3V62 A;  3ECI A;  3MJW A;  4DHZ E;  3OLM D;  4ICV A;  3GOE A;  3VUW A;  4DDI D;  1F9J A;  1WGG A;  2HJ8 A;  2BGF A;  2KHW B;  2N9E B;  3A9J B;  4PYZ A;  1TGZ B;  1OQY A;  3JSV B;  2AEH A;  4LJP B;  1SGH A;  5DPT A;  3VDZ A;  2AYO B;  2PE9 A;  2N7D A;  2K8C A;  2FCN A;  2HTH A;  2WYQ A;  5KHO A;  1CMX B;  2DZK A;  1GJZ A;  2C7H A;  4GSW A;  3VFK A;  5CTR C;  1YX6 B;  3RZF A;  4K81 A;  4ZYN A;  1P98 A;  2KOX A;  2JWZ A;  3BIN A;  1NDD A;  5D94 A;  4AP4 C;  1WYW B;  4IC7 B;  2DHZ A;  1UBQ A;  2EMS A;  4W9E A;  1EO6 A;  2FNJ B;  2K6D B;  3DCG A;  4GMV A;  4MGY E;  3VTW A;  4BVU C;  3H7P B;  4WWO A;  4N9F 4;  4W9J A;  1H8C A;  4KV2 A;  4GN1 A;  4CHK A;  4DHZ B;  3D32 A;  5J2R A;  2N9X A;  2L76 A;  2JVC A;  4LCD E;  2KN5 A;  3A33 B;  5CX3 A;  4WAA A;  4W9L A;  4BKS D;  2XBB C;  1V5O A;  1WE6 A;  4YL8 A;  5C23 A;  1YQB A;  3DDC B;  2BYF A;  3ZUN A;  1WY8 A;  1WGD A;  2RGF A;  3TCA A;  1UEL A;  2G45 B;  2GBR A;  4JIO U;  3KUZ A;  2M8S A;  1RFA A;  4M8N A;  3NZU A;  4A3O A;  1XT9 B;  1WJ6 A;  1KLV A;  4IG7 B;  4AOF A;  4ZDV A;  3OJ3 A;  2DYO A;  4TQ0 A;  1I35 A;  1WXS A;  2IO0 B;  3K9O B;  3MTN B;  3W1Y A;  4B6W A;  4EZL A;  3QC8 B;  5DPW A;  2DAF A;  1WR6 E;  3PLU A;  3PZD A;  3VTU A;  4HVB A;  2DEN B;  3CF6 E;  2BWE S;  2FUH B;  2ZCB A;  4MJS A;  2DYB A;  1Q5W B;  1V5T A;  2MWS B;  1BT0 A;  2IBI B;  3TMP B;  3UIN B;  2L05 A;  3R66 C;  2LRW A;  2I1J A;  1WFY A;  2MW5 A;  3IHP C;  4HPL B;  2DZI A;  3SDL C;  4ANV A;  1J8C A;  1V86 A;  3HIZ A;  5AZH A;  2KWC A;  4KZ0 A;  3TL5 A;  1P9D U;  4ASW C;  2L7R A;  3RCZ A;  4AJW A;  4HCN B;  4W9F A;  2CS4 A;  2K39 A;  2LXA A;  2BF8 B;  2V1Y A;  3DBS A;  3K9P B;  4PYU A;  3WAO A;  3DPD A;  2J0K A;  2N4F A;  1TTN A;  1E7V A;  4FJV B;  4JL9 A;  4FA6 A;  2VRR B;  2REX A;  3ZKJ C;  4E74 A;  2N1V A;  2ZPN A;  4MH0 E;  2N1W A;  4BKG A;  3V60 A;  4F8C B;  2XK5 B;  1L2N A;  3ZTC A;  3ZVV A;  2MBE A;  3NY5 A;  5FR6 A;  4OVU A;  3R7R A;  1WIA A;  3IFW B;  3ML9 A;  1E8W A;  2MRP A;  2R2O A;  5JHA A;  3KUD B;  4II3 B;  2FAZ A;  4W9I A;  3X23 A;  4K7S A;  4GB9 A;  1V81 A;  4MGZ E;  5E6O A;  1S1Q B;  1P0R A;  2ZZP B;  2IY1 B;  1NI2 A;  1LQB A;  1WJN A;  2HE7 A;  2YVC A;  2IZV B;  4KZC A;  4KIK A;  3ZO5 B;  1H4R A;  1E8Y A;  2Z0E B;  2KDE B;  3H9D A;  4HXD A;  2L3Z A;  4RM8 A;  1MG8 A;  1E90 A;  3HM6 X;  1NBF C;  5HKH A;  4KVG B;  1SE9 A;  5JHB A;  3LJ3 A;  3PV1 A;  3ZW3 A;  5G55 A;  3RUI B;  2G3Q B;  4HWI B;  2J0J A;  3KUC B;  3M3J A;  2B3A A;  5C1Z A;  4EOY A;  1YIW A;  2BKR B;  2MLB A;  4K7U A;  4HLE A;  4CYE A;  2YLM A;  1V6E A;  4GU2 A;  4TV3 A;  4E71 A;  4F7Z A;  2GBK A;  2K25 A;  3DVG X;  4NQK E;  1UGM A;  3GZN I;  1WZ0 A;  2M4N A;  5L95 C;  2KWU B;  5D7G A;  1J0G A;  4WJP A;  2LGY A;  3LDZ E;  3M62 B;  3PRP B;  1LXD A;  4EKU A;  2KDB A;  3ZDM C;  3APF A;  1Z2M A;  2LXC A;  3PTF C;  5AEK B;  3B08 A;  5CHV C;  3NHE B;  4NAW A;  4ZRI A;  1L7Y A;  2C7M B;  2KTF A;  2LZ6 A;  1M94 A;  3H7S A;  2MSE D;  3PGE A;  4KSK C;  5DPS A;  3L13 A;  2KTR B;  4P7I A;  1LM8 B;  3QK0 A;  2M1M A;  3W1S C;  3DBR I;  3WAN A;  2NS5 A;  4MGK E;  4TUU A;  5D2M B;  2MCN B;  2K6Q A;  3UIO B;  4IWO A;  2RSU A;  3A9K A;  2UYZ B;  1E8Z A;  2R2Q A;  2CU1 A;  2KLC A;  2ZJD A;  2ZPY A;  4KDL B;  5J17 A;  4FBJ B;  1KOT A;  2J0M A;  1K8R B;  3ZNG C;  2D07 B;  1ISN A;  4BBN F;  2BYE A;  4HDQ A;  5LLI A;  1E8X A;  4GOC A;  1WR1 A;  2PJH A;  1GC6 A;  2ZNV B;  1X1M A;  2C5L C;  1TBE A;  3A9J A;  4FJZ A;  3SD5 A;  3JSV A;  3HK0 A;  3IVF A;  4PS7 A;  2K8H A;  2UWQ A;  4JLC A;  3S2A A;  2L0T A;  1J19 A;  2D3G A;  2L00 B;  2MBH A;  4JGH B;  1D3Z A;  1KM7 A;  3VVW B;  3PHX B;  1PQS A;  2EMT A;  1TZ1 A;  3PRE A;  3NS8 A;  3C0R B;  1P3Q U;  5EDS A;  2LVP A;  2O6V D;  1WXM A;  4NPN A;  4AUQ C;  2CHX A;  4DBG A;  3L16 A;  2L0F A;  3TBL D;  1AAR A;  1EF5 A;  2DZM A;  4TKN A;  3ENE A;  2L8J A;  2Z0D B;  3EFU A;  3IBE A;  2FCQ A;  2LUE A;  2WX0 A;  3VHT C;  3JVZ X;  3SU8 X;  4F1S A;  1C3T A;  3JYU A;  4DHJ D;  3H7P A;  3TJP A;  2LGX A;  3APD A;  2OOB B;  3VTV A;  2KDF B;  2MX2 A;  2OJR A;  4KDI C;  3APC A;  1P1A A;  2KJR A;  3I3T B;  4GDL A;  2GMI C;  4NQL B;  2WX1 A;  1RRB A;  5GMV A;  2RPQ A;  4XX5 A;  2KZR A;  2N7E A;  2KD0 A;  4IM2 A;  1WJ4 A;  2K1F A;  2BWF A;  4HJK A;  2JUO A;  1V9J A;  2XEW A;  4I6P A;  2KMA A;  3PRM B;  3QIJ A;  2NPT B;  5D6J B;  2KAN A;  2O2V B;  4FAD A;  4FHK A;  2KJ6 A;  1WJU A;  4RMA A;  1Q0W B;  2CKH B;  4II2 B;  3NZS A;  2PE6 B;  4HPM B;  2G4D B;  2PEA A;  4EEW A;  1T0Y A;  3UGB B;  4AJY B;  3M95 A;  1ZGU B;  3HHM A;  4G0N B;  2RR9 A;  1HE8 A;  4BFR A;  5E6P A;  3ONS A;  2N9P C;  3V6E B;  2AL6 A;  3QAQ A;  4IWQ A;  2NBW B;  3QHT A;  2KQ7 A;  3L54 A;  4WWP A;  4IWP A;  5J18 A;  4FUL A;  1ZW7 A;  3EHV A;  1E5W A;  4B9K A;  2KFK B;  2IYD B;  1OEY A;  2D10 A;  1Z5S B;  2KK8 A;  4AWJ A;  3QWZ B;  2D11 A;  3N30 A;  2Z59 B;  5AZF A;  3ZIM A;  2ZVO A;  4HDO A;  1VCB A;  2KX3 A;  1WRD B;  2NBU A;  3U30 A;  2C9W B;  4X57 B;  3KYD D;  3V61 A;  1G6J A;  2KFJ A;  3ZNI D;  4K1R B;  2KKC A;  2O6V B;  3IG3 A;  2C7N B;  2DAJ A;  4I6L B;  2BYV E;  3PHW B;  4WJQ A;  1LFD A;  2ZCC A;  4MEM A;  4W9D A;  2CHW A;  1WGH A;  4DHJ B;  2JY6 A;  2KVR A;  3Q3F A;  3RUL A;  4JQW C;  4DXA B; 
#chains in the Genus database with same CATH topology
 4G11 A;  2FID A;  1EF1 A;  2KXJ A;  2MBB B;  3EA6 A;  2BS3 B;  2HD5 B;  2KAJ A;  3TUO A;  4GXB A;  1VZ7 A;  2RD0 A;  3ZGZ A;  1F2R I;  2MHJ A;  3UQB A;  2LWP A;  1R4M B;  2MP2 A;  3CMM B;  2MQJ A;  2FCS A;  1U4A A;  1WSP A;  3VRA B;  5MPO A;  2BQQ A;  3PLV A;  5HG2 A;  1EWC A;  3TSS A;  3V6C B;  4NAW B;  3EEC A;  1L0Y B;  4PS8 A;  4DQO C;  4B0M A;  2WXP A;  3RMK C;  2VH1 A;  2MBO A;  2AQ1 B;  2KQS A;  3KWV A;  4URK A;  2ZNV C;  4ARI A;  1PGA A;  1WX9 A;  3AU5 A;  2H89 B;  2K9X A;  3VAW A;  1TS3 A;  1GNU A;  2WDT B;  3GZN B;  3DBH B;  1WX8 A;  5I4D A;  3KWL A;  1YX5 B;  1VRA B;  4XZ4 A;  3VH4 B;  1WI0 A;  4N58 A;  1UH6 A;  3E9S A;  2BKF A;  3B0A A;  2LAS A;  3QCA A;  4XDD A;  4FN2 A;  3ZLZ A;  1V80 A;  5G5G A;  2JZZ A;  1IP9 A;  3AE5 B;  2KWV B;  3Q3J A;  4L23 A;  2ON8 A;  3QA8 A;  4BZA A;  5FR3 A;  3A4S C;  3OJ4 B;  2KJH B;  5CHF A;  3BWU D;  4FHJ A;  3PS6 A;  1ACC A;  2LI5 A;  2BW2 A;  1V2Y A;  4IKG A;  4DK5 A;  4IUM B;  1WZ3 A;  2MEK A;  3BYT B;  2KC2 A;  3FC4 A;  2WXQ A;  2NTT A;  1XLN A;  3U7D A;  3L10 B;  3B2F A;  3ZRF A;  2NPT A;  2AQ2 B;  2FCM A;  3PT2 B;  1KF6 B;  2IDY A;  3P4Q B;  5BMI A;  3BII D;  2NCN A;  1NYR A;  4LDT B;  3I63 C;  2AWT A;  3UQA A;  2RPV A;  2KO3 A;  2JXX A;  4KIK B;  2MBQ A;  3GP7 A;  1PYW D;  2IGH A;  3DVN V;  5E6J A;  2LRU A;  1R7S A;  1R4M I;  3AI5 A;  4WWM A;  1ZKH A;  1KLG D;  1WE7 A;  4YTM B;  4W9H A;  3N3K B;  3ZTD A;  4GGQ A;  2PPH A;  4G3X B;  1FXA A;  3T3N A;  3RN9 C;  4KGS A;  3RD2 A;  1I4G A;  1KH0 A;  2KMM A;  3A4R A;  4D2K A;  4MEL A;  4W9K A;  3TIX A;  3NOB A;  1FXI A;  3WAP A;  3ZRC A;  3EC8 A;  2X8X X;  2Y5C A;  2X38 A;  1GPX A;  3ML8 A;  1N5X A;  3DBH I;  2ZW0 A;  3KQ4 A;  2WWZ A;  2INP E;  2FE8 A;  3EUB 2;  3V05 A;  3GOE A;  3AE3 B;  4PYZ A;  1B9R A;  3A9J B;  2AEH A;  2D3A A;  4M02 A;  1CMX B;  1VLB A;  4C00 A;  3VFK A;  3RZF A;  1E7P B;  1SJE D;  2KOX A;  5D94 A;  3MC0 B;  4W9E A;  2FNJ B;  4MGY E;  2LMC A;  4GMV A;  4C80 A;  2K0P A;  4N9F 4;  4DHZ B;  4YTP B;  2JVC A;  2KN5 A;  3A33 B;  4WAA A;  1FNU A;  2IND C;  1WE6 A;  5C23 A;  1YQB A;  2QDF A;  4BAX A;  2RGF A;  3KUZ A;  2L32 A;  1CZP A;  1XT9 B;  1IBX B;  1KLV A;  4IG7 B;  4AOF A;  2WLB A;  4TQ0 A;  1I35 A;  2PMV A;  3K9O B;  4B6W A;  2DAF A;  2R61 A;  3PLU A;  3PZD A;  2GB1 A;  4REZ A;  3VTU A;  1UGJ A;  2BWE S;  2DYB A;  4M00 A;  1V5T A;  4WAF A;  1BT0 A;  2IBI B;  3TMP B;  3AE8 B;  3R66 C;  3SDL C;  2KWC A;  3TL5 A;  1MHX A;  4AJW A;  3RCZ A;  4W9F A;  2CS4 A;  2BF8 B;  3DBS A;  3WAO A;  2GRI A;  2J0K A;  2N4F A;  5T8I A;  1YJI A;  3NVY A;  3ZKJ C;  1FD6 A;  2XK5 B;  2MBE A;  3NY5 A;  1IGC A;  3ML9 A;  2WXN A;  1XCT L;  2FAZ A;  4W9I A;  3X23 A;  2WS3 B;  1Q10 A;  4LK0 M;  3BVZ A;  1C4C A;  1J7B A;  2WXK A;  2WXL A;  1KRH A;  3PZ8 A;  4KIK A;  3ZO5 B;  4DXF A;  3IT4 B;  1E90 A;  1NBF C;  5JHB A;  3ZW3 A;  2BTE A;  4RH6 A;  2J4X A;  3KUC B;  1D4B A;  4HLE A;  4K7U A;  4CYE A;  3NVZ A;  2KWU B;  2Q5W D;  1F2R C;  2LGY A;  4WJP A;  3AV8 A;  1LXD A;  4EKU A;  4OHJ A;  1FIQ A;  3NVW A;  3NHE B;  4ZRI A;  3N1X C;  2MSE D;  5DPS A;  3QK0 A;  2M1M A;  2NS5 A;  3R8B A;  4IWO A;  3A9K A;  2UYZ B;  1KOT A;  1WYG A;  2ZJD A;  1C79 A;  1K8R B;  1UWM A;  3ZNG C;  1ISN A;  2FBW B;  1NVI D;  1FFV A;  3A9J A;  3HK0 A;  4YSX B;  3AEF B;  2RDH A;  2L0T A;  1J19 A;  1F1H A;  2D3G A;  3VVW B;  3PHX B;  1K50 A;  1TZ1 A;  3TEZ A;  2WNM A;  3PRE A;  2LHD A;  2JWU A;  4NPN A;  1JWA D;  4AUQ C;  3DHG C;  1FPY A;  1EF5 A;  1QIL A;  2LUE A;  3VHT C;  1C3T A;  3JVZ X;  3SU8 X;  2WXM A;  1XLP A;  2OOB B;  2MX2 A;  1P1A A;  4OZA A;  2KJR A;  1M4V A;  3I3T B;  4NQL B;  1RRB A;  2KZR A;  1C76 A;  4IM2 A;  4MM3 B;  2DNF A;  1IGD A;  2K1F A;  2V0G A;  1V9J A;  2KMA A;  3PRM B;  2KAN A;  4FHK A;  2KJ6 A;  1WJU A;  1BUI C;  1L5P A;  4JWU C;  1SB3 C;  2PEA A;  3UGB B;  4AJY B;  1J7A A;  1AW7 A;  1TS4 A;  1TT5 B;  4C56 C;  4HRS A;  3L54 A;  4IWP A;  1E9M A;  3BZD B;  4FUL A;  3EHV A;  1JWU D;  2D10 A;  1Z5S B;  3N30 A;  2Z59 B;  3ZIM A;  1SE3 A;  2ZVO A;  1VCB A;  2C9W B;  2HTM E;  3KYD D;  2DBY A;  2KFJ A;  1TS2 A;  3ZNI D;  2C7N B;  4HKQ A;  2BYV E;  1K52 A;  1HEZ E;  3PHW B;  4WJQ A;  5H92 C;  4W9D A;  3Q3O C;  4DXA B;  2BB6 A;  1FCC C;  4B95 A;  4CO7 A;  1SIF A;  3DVG Y;  3Q14 C;  2W3R A;  1FNW A;  4J6I A;  1DYQ A;  5C2T B;  2PW9 A;  1LGR A;  4MGI E;  4GDK A;  1QQR A;  3HM3 A;  3AXC A;  4NJ6 A;  3NRZ A;  1XEE A;  1NEK B;  2W82 A;  5BO4 B;  2DWQ A;  3HVZ A;  2KMC A;  4ZRJ A;  3AU4 A;  3CST A;  3RT3 B;  1AWD A;  2IO3 B;  2CHZ A;  3U7Z A;  2Y5B B;  3EGR A;  3RNE C;  3WAL A;  1OEY J;  1Y8R C;  2QEJ C;  3ZDT A;  1FFU A;  2AL3 A;  2J7Q B;  4YXD B;  1QF6 A;  2QHO A;  1JWM D;  3R2I A;  3ZNZ B;  5L83 A;  3FAH A;  1GG3 A;  3ETR A;  1WXQ A;  4LDT D;  3B1L X;  1XLQ A;  5IO9 A;  3W1S A;  1LO5 D;  2KDM A;  4N6E B;  2NBV B;  4GLS C;  5IN7 A;  1OGW A;  1GC7 A;  1SBB B;  1UNS A;  1GUA B;  2MA9 B;  1JRU A;  1GOZ A;  2K3U A;  3ALB A;  1N61 A;  4MJS B;  4GDL B;  3RYT A;  1V8C A;  4E3C A;  4EZJ A;  2NVU I;  2WXF A;  2NR2 A;  2GBM A;  3RNB C;  1MFW A;  1WH3 A;  3RNG C;  4DWF A;  3AUL A;  2K8B A;  3T8M A;  4ZRQ A;  5IAA C;  4FLH A;  1IPG A;  3DOW A;  3J9C A;  1ZP0 B;  1EWY C;  4KGT A;  4MM3 A;  5HFY A;  3IT6 B;  1YJ1 A;  2GBN A;  1E10 A;  1HTO A;  1WX7 A;  1GAQ B;  2JRH A;  3L17 A;  4XE0 A;  1QKZ A;  3UF8 A;  2D2Q A;  4WQO B;  3HRD D;  3R7Q A;  4DDG D;  5IA7 A;  1Q1O A;  4ICU A;  2HDE A;  3N32 A;  1OTR B;  1D5Z C;  2DYM A;  3KW5 B;  4LNN A;  1WGY A;  2N7J A;  3AEB B;  3ZJU A;  2PTL A;  1N62 A;  1IYF A;  3DBL I;  2LUM A;  5BYS A;  4W9C A;  4PT5 A;  1V49 A;  1JW9 D;  2MJD A;  1I4X A;  4HK2 A;  3P4R B;  3M63 B;  2G4S A;  1YJJ A;  3VQI A;  2AX5 A;  3GB1 A;  3QJZ A;  1C9F A;  2DX5 B;  3URY A;  2H88 B;  4WJN A;  4ZRK A;  3AED B;  3NZ3 A;  5E6N A;  1FNV A;  3NG0 A;  2LGD A;  3Q6B A;  3WIM A;  3QX1 A;  2XNA C;  5LNK 1;  2EKE C;  1EUV B;  1SE4 A;  4UDU C;  4ZHP A;  3ECI A;  3AN1 A;  3OLM D;  3VUW A;  1F9J A;  1WGG A;  2BGF A;  1OQY A;  4LJP B;  1SGH A;  5DPT A;  4WH4 A;  2PE9 A;  2HTH A;  2DZK A;  2C7H A;  5CTR C;  1YX6 B;  3AE7 B;  2JWZ A;  2BYT A;  3DHH C;  2EMS A;  1DOX A;  2K6D B;  2K22 A;  4WWO A;  4GN1 A;  5J2R A;  2N9X A;  1ROE A;  3PZ7 A;  4W9L A;  1JWS D;  1V5O A;  2XBB C;  4YL8 A;  3DDC B;  2BYF A;  4LNK A;  4XGA B;  3MFG A;  3TCA A;  2G45 B;  2M8S A;  1RFA A;  1I4P A;  4A3O A;  1CQV A;  1C4A A;  1WGK A;  3QC8 B;  5DPW A;  4HVB A;  3CF6 E;  4MJS A;  1ET9 A;  1Q5W B;  1YN3 A;  2BVC A;  2L05 A;  4HEA 1;  2I1J A;  1QOF A;  3Q8F A;  4ANV A;  1V86 A;  4US8 A;  4A8X C;  2V3N A;  1P9D U;  4ASW C;  5GXG B;  4HCN B;  2KYW A;  2K39 A;  2N0S B;  2V1Y A;  3TEY A;  1HQR D;  3AEA B;  1E7V A;  4FA6 A;  2VRR B;  4KKI A;  4E74 A;  5BYQ A;  2ZPN A;  4MH0 E;  2N1W A;  5IOI A;  1L2N A;  2I38 A;  5FR6 A;  2BT6 A;  1HXY D;  3RI7 C;  2MRP A;  5JXV A;  5JHA A;  2MJE A;  2HJ1 A;  4MGZ E;  3ZQ4 A;  3IXS A;  1NI2 A;  2YVC A;  2IZV B;  1L6V A;  4LNI A;  1E8Y A;  3H9D A;  2KDE B;  2L3Z A;  4KVG B;  1SE9 A;  5G55 A;  4HWI B;  2J0J A;  4H2A A;  1OQQ A;  1YIW A;  2BKR B;  2MLB A;  2M0A A;  2YLM A;  1PUT A;  1OFF A;  3GZN I;  1WZ0 A;  3AE2 B;  5D7G A;  1J0G A;  3NUH B;  3M62 B;  3PRP B;  3PTF C;  1Z2M A;  4R3D A;  5AEK B;  3B08 A;  4NAW A;  2L1A A;  3H7S A;  1YOV B;  2BBC A;  2KTR B;  2WDQ B;  3W1S C;  1MI0 A;  3MHZ A;  2MCN B;  4C7Z A;  2RSU A;  1E8Z A;  2KLC A;  5J17 A;  2D07 B;  5FK9 C;  2KWD A;  1C4P A;  1E8X A;  1CJE A;  2ZNV B;  1X1M A;  2L83 A;  3SD5 A;  2K8H A;  4S0R A;  4RF1 A;  4JLC A;  1EM7 A;  1JRO A;  1D3Z A;  1KM7 A;  1TY0 A;  2OED A;  1P3Q U;  3MJ5 A;  5EDS A;  4DBG A;  2CHX A;  1AAR A;  1RYJ A;  2GLS A;  3ENE A;  4TKN A;  2Z0D B;  4S17 A;  1D5X C;  2WX0 A;  1UWX A;  2Y5P A;  4F1S A;  1TY2 A;  3JYU A;  3TJP A;  2LGX A;  3APD A;  4KDI C;  2JXT A;  3APC A;  1A70 A;  3CWI A;  3B2G A;  2GMI C;  5GMV A;  2RPQ A;  1RFK A;  4XX5 A;  2KD0 A;  1GB1 A;  3R2T A;  4HJK A;  2XEW A;  3AEC B;  2QIL A;  2O2V B;  3C8Y A;  4RMA A;  4K3C A;  3NZS A;  1T0Y A;  3M95 A;  2I2Y A;  2N9P C;  3V6E B;  3QAQ A;  3QHT A;  1YN5 A;  4WWP A;  1QLB B;  3TEX A;  4XDC A;  1ZW7 A;  1SJH D;  1E5W A;  4IDI A;  4B9K A;  2KFK B;  2IYD B;  2KK8 A;  2W54 A;  5HHD G;  1K51 A;  1P7E A;  4US9 A;  3QWZ B;  2D11 A;  5AZF A;  1WRD B;  1B1Z A;  3V61 A;  5EE1 A;  2KKC A;  1HA5 A;  1FMA D;  4RCO A;  2DAJ A;  4MEM A;  2CHW A;  1WGH A;  4DHJ B;  1V97 A;  1FRR A;  1SEB D;  1L0X B;  3UIP B;  1YN4 A;  3BK1 A;  3KVF B;  3A1Q B;  2V3P A;  3Q2A C;  2WXI A;  3N20 C;  3I57 A;  4NNJ B;  1WMH B;  1VD2 A;  3ZYY X;  1ZOY B;  2LD9 A;  2WXG A;  3UI3 A;  2JYE A;  4OZB A;  4RGN A;  4RGM A;  4MAC A;  4JPS A;  4NAM A;  2I1K A;  4XC2 A;  3ZXR A;  1L6U A;  2MJ3 A;  1ZDX A;  3AE1 B;  2KX0 A;  4BKT A;  4EUT A;  3VUY A;  4XWW A;  2V9H A;  1R4N B;  3H1U A;  1NYQ A;  1VZ8 A;  2JRI B;  4I6N B;  4OZC A;  2NTS A;  4YSZ B;  1ZDV A;  2M0X A;  4PS3 A;  4MSQ B;  2WXJ A;  2KTR A;  2K5P A;  3E56 A;  4WQM A;  1A5R A;  2C60 A;  2LJ5 A;  4G50 A;  3MC9 A;  1T0Q C;  3TEW A;  2QCZ A;  3KH0 A;  3VUX A;  4HJG E;  3FIL B;  1KJT A;  5TR5 A;  4IM0 A;  1C1Y B;  2ZEQ A;  4KSL C;  1TS5 A;  3DBR B;  1WXA A;  1FEH A;  4LJO B;  1WWT A;  2JF5 A;  3AB5 A;  4MSM B;  4A20 A;  4LNO A;  5D3D A;  4IW0 A;  2ZVN A;  2CR5 A;  2J52 A;  2KAC A;  1FCL A;  1IBX A;  2JZ3 B;  4M8M A;  3AE9 B;  1YQ4 B;  1YQ3 B;  2NMQ A;  2UU7 A;  1ENF A;  1V1O A;  2IJ0 A;  4O1N A;  3H6N A;  3Q69 A;  1EU3 A;  3U8Z A;  2BS2 B;  2ONQ A;  2PVO D;  5G2N A;  1ZPS A;  1GB4 A;  4EZK A;  3RFZ B;  4ANX A;  2O2V A;  5FKA C;  1XD3 B;  4P6V F;  4TQ1 A;  2LVQ A;  4A90 A;  2WXR A;  4B0E A;  3SHQ A;  2GBJ A;  4W9G A;  2AQ3 B;  4XYC A;  3AEE B;  5JH5 C;  4NJ7 A;  3LXF A;  3WA0 A;  2XK5 A;  2LVO A;  2KFK A;  1C77 A;  2WDV B;  3P42 A;  2JT4 B;  1FXT B;  4RGO S;  1FM0 D;  3BK2 A;  2LGS A;  2E6X A;  2QJL A;  4EFO A;  2WXO A;  1TZO A;  3CIR B;  2MP2 B;  1EU4 A;  2LJI A;  2WGS A;  2CJO A;  3L0W B;  1TJE A;  1F0Z A;  3JW0 X;  1R4N I;  1WM2 A;  2V3S A;  2KC1 A;  1RM6 C;  3DVN U;  4YWG G;  3A1Q A;  1WMH A;  1MVK A;  2SEB D;  3P1M A;  2IO1 B;  4WWN A;  1RAX A;  4FJY A;  1N60 A;  3V62 A;  3MJW A;  4ICV A;  4DDI D;  4LTU A;  3Q8C A;  2HJ8 A;  2N9E B;  2KHW B;  2MH7 A;  1E0Z A;  2WYQ A;  2N7D A;  2FCN A;  5KHO A;  4K81 A;  4ZYN A;  1P98 A;  3BIN A;  1NDD A;  4AP4 C;  4IC7 B;  1UBQ A;  1EO6 A;  3DCG A;  3VTW A;  2LEK A;  3H7P B;  4W9J A;  1I4R A;  4KV2 A;  3D32 A;  3AM9 A;  1STE A;  4A6Q A;  3N1Z C;  2L76 A;  5CX3 A;  2BB5 A;  1I4H A;  1OQR A;  1D6E C;  3ZJV A;  3ZUN A;  3H8H A;  1WY8 A;  4MT5 A;  2GBR A;  3FIL A;  4M8N A;  1WJ6 A;  2YEP F;  1L4Z B;  4ZDV A;  3OJ3 A;  3Q3N C;  3W9C B;  3MTN B;  3W1Y A;  1WR6 E;  4M01 A;  2DEN B;  4ARC A;  1PFD A;  4LNF A;  4HPP A;  3UIN B;  4HPL B;  1WFY A;  2MW5 A;  3IHP C;  2LGI A;  1J8C A;  1SE2 A;  5AZH A;  3HIZ A;  4KZ0 A;  1WRI A;  3I5J C;  1T0S C;  3K9P B;  2GI9 A;  3BVM A;  2Y3A A;  3DPD A;  1K53 A;  4FJV B;  1VR9 A;  2CJN A;  4JL9 A;  2REX A;  1MPE A;  2RDG A;  3V60 A;  4F8C B;  4XWT A;  1AN8 A;  3OG5 A;  4OVU A;  3R7R A;  1XLO A;  2R2O A;  1AYF A;  4KGR A;  4II3 B;  3SEB A;  4GB9 A;  1JQ4 A;  1TYG B;  5E6O A;  5H8Y E;  1VZ6 A;  4WIP A;  1P0R A;  2ZZP B;  1P7F A;  1LQB A;  2HE7 A;  1TKE A;  1H4R A;  3RPF C;  2VZK B;  3HM6 X;  5HKH A;  3LJ3 A;  3PV1 A;  3RUI B;  2G3Q B;  2PLP A;  2E3T A;  3M3J A;  1J7C A;  2CU3 A;  4EE2 A;  3KLS X;  4E71 A;  1V6E A;  2GBK A;  2K25 A;  1D5M C;  4OW0 A;  1UGM A;  1TKY A;  4ZYS A;  3LDZ E;  4P1B C;  1UF0 A;  2KDB A;  2PKO A;  3ZDM C;  3APF A;  1SF0 A;  1L7Y A;  2C7M B;  2KTF A;  4ACF A;  2LZ6 A;  3PGE A;  2M19 A;  1LM8 B;  3WAN A;  4TUU A;  4MGK E;  2K6Q A;  1KFY B;  4KDL B;  2R2Q A;  3MC8 A;  1UUP A;  4N59 A;  2J0M A;  2BYE A;  4HDQ A;  5LLI A;  4GOC A;  1WR1 A;  2PJH A;  3ZJT A;  4J3O D;  1JCK B;  4PS7 A;  4RGT A;  2WP9 B;  2L00 B;  1HZ5 A;  2EKI A;  1PQS A;  2W55 A;  1SSN A;  3C0R B;  2LVP A;  4HKZ E;  1XCQ L;  4L2Y A;  1XO3 A;  4AS1 A;  2L8J A;  1QOA A;  2FCQ A;  4DHJ D;  3H7P A;  3VTV A;  3OWE B;  1QOG A;  1RWS A;  3Q8A A;  4GDL A;  1BXT A;  3Q8B A;  3PO0 A;  2INC C;  2JUO A;  4I6P A;  3QIJ A;  1KLU D;  1T6B X;  4FAD A;  1Q0W B;  2L52 A;  2CKH B;  4II2 B;  4EEW A;  3NS1 A;  4YT0 B;  1HE8 A;  5E6P A;  3ONS A;  3NJT A;  4IWQ A;  3EFC A;  2N9L A;  4ITK A;  4JX1 C;  2D3B A;  2KX3 A;  2NBU A;  3U30 A;  4X57 B;  5G5H A;  3IG3 A;  2O6V B;  1L0V B;  2Z8L A;  4A55 A;  4YTN B;  2V4I B;  3V3X A;  2JYT A;  3NVV A;  2JY6 A;  3WAM A;  1SXT A;  3DWG C;  3VXW A;  3PRZ A;  3R3M A;  4BKS A;  2QSD A;  5C3J B;  4Q2J A;  2M17 A;  2BPS A;  1E6E B;  3U4E G;  2OHF A;  3MHS D;  4LLG M;  3QQ8 B;  2VH2 A;  1PDX A;  2B76 B;  1TKG A;  3BYY B;  1CK1 A;  1WM3 A;  4QAY A;  2A5U A;  3IAS 1;  2PVG C;  1YMH E;  2FUG 1;  3A9K B;  2DZJ A;  4ANU A;  2V4L A;  4FXC A;  5AZG A;  3RNF C;  3VRB B;  3PSE B;  3BY4 B;  4BOS C;  4P16 A;  4MDK E;  3WCQ A;  2IY0 B;  1XQQ A;  1RLF A;  4RM9 A;  3MP9 A;  5LXH A;  1F77 A;  2WU2 B;  3ZXV A;  2IGD A;  4NY0 A;  4TMA B;  1WF9 A;  3DWM A;  2JU6 X;  4OVZ A;  1HTQ A;  1XXG A;  3T9L A;  1VJK A;  1N63 A;  3O65 B;  3B9J A;  5JZE B;  2M56 B;  4GIV A;  3IAM 1;  2D3C A;  3X0W A;  4HRO A;  3VH3 B;  4C7Y A;  2KDI A;  5IP4 D;  5LXI B;  3KYC D;  2KVZ A;  4A3P A;  1T0R C;  3W5V B;  1UBI A;  3AMZ A;  5KHQ A;  3L08 A;  2IGG A;  2JSV X;  3AH7 A;  1WXV A;  3RNC C;  3P2B A;  2J53 A;  1VDV A;  3I9V 1;  3RZW C;  1TIF A;  1ZUD 2;  1I42 A;  3AE4 B;  3SFD B;  4USA A;  2GOW A;  1YD8 U;  1I7H A;  2A4Z A;  5DPR A;  3U2S C;  2TSS A;  3CSF A;  4K7W A;  2IPK D;  4HCP B;  2PIA A;  2DLB A;  2QMT A;  4ZHO A;  2IO2 B;  3W5U B;  2W3S A;  1S3S G;  5IKC M;  1UZX B;  4PK1 A;  4ANW A;  2KLG A;  1JAL A;  3DQV A;  4WJO A;  4IM3 A;  4K3B A;  5CHW A;  2O6V A;  2JPH A;  4OVV A;  2W9N A;  3SR6 A;  3PPA A;  1N6Z A;  2EEL A;  4BBN C;  3ZNH B;  3QAR A;  4GDK B;  2ASQ A;  1WGR A;  2OJW A;  4BOZ B;  3ABV B;  4WUR A;  3OAW A;  3HUI A;  1QZE A;  3HVD A;  1UD7 A;  3VR8 B;  4JE3 B;  4M0W B;  2FIF A;  2WXH A;  2KNB A;  5AUI A;  1JWB D;  1MHH E;  1E7U A;  1PGB A;  2J42 A;  3PVL A;  4KKJ A;  5DCN A;  4DHZ E;  1DOI A;  3GE3 C;  1TGZ B;  2JZP A;  3JSV B;  1NEN B;  3VDZ A;  2AYO B;  2K8C A;  1ZXI A;  2WDR B;  1GJZ A;  4GSW A;  3LB8 C;  2RMM A;  4ZRP A;  4RNA A;  1ESF A;  1WYW B;  2DHZ A;  1ET6 A;  4BVU C;  1QOB A;  1H8C A;  4CHK A;  5BMH A;  4DXG A;  2INN E;  4LCD E;  4ZOH C;  5EE0 A;  4AQ7 A;  4BKS D;  2LHE A;  1DOY A;  3FKY A;  3U52 E;  5AUK A;  1WGD A;  1UEL A;  4JIO U;  3NZU A;  3C19 A;  2VZK D;  2DYO A;  4L1B A;  1WXS A;  2IO0 B;  4EZL A;  3RNA C;  2FUH B;  2ZCB A;  1MG4 A;  4P1C C;  2MWS B;  2WHI A;  1V1P B;  2LRW A;  2DZI A;  4MH8 A;  4C4V B;  1PGX A;  2L7R A;  2LXA A;  3O13 A;  4PYU A;  3Q3M C;  1NI3 A;  2RDB C;  1TTN A;  3GE8 C;  2N1V A;  4BKG A;  5TSS A;  3N9Y C;  3ZTC A;  3ZVV A;  4JWS C;  1WIA A;  3IFW B;  1E8W A;  2LFI A;  2KN4 A;  3KUD B;  4NZL B;  1XF5 L;  4K7S A;  1V81 A;  2ICI A;  4RF0 A;  1S1Q B;  1JML A;  1ZE3 D;  2IY1 B;  3AEG B;  1WJN A;  4KZC A;  1BML C;  4A9A A;  2Z0E B;  4HXD A;  4RM8 A;  1MG8 A;  1QT9 A;  3L4P A;  3SFE B;  3T3O A;  3P63 A;  2B3A A;  5C1Z A;  1T5X D;  4EOY A;  3Q8E A;  4TV3 A;  4GU2 A;  4F7Z A;  5BYR A;  3DVG X;  4NQK E;  2M4N A;  5L95 C;  1MJD A;  3DBL B;  4CQN A;  2LXC A;  1YNT E;  5CHV C;  2SAK A;  1C78 A;  1M94 A;  4KSK C;  2JX5 A;  3L13 A;  4P7I A;  4M0W A;  3DBR I;  5D2M B;  3UIO B;  2G9H D;  2ZPY A;  2CU1 A;  1FRD A;  5EE3 A;  4FBJ B;  4BBN F;  1I4Q A;  1GC6 A;  2YEP B;  3W2D A;  2C5L C;  1TBE A;  4FJZ A;  4YSY B;  2QC8 A;  3JSV A;  3IVF A;  2UWQ A;  3S2A A;  4JGH B;  2MBH A;  2JQR B;  5D3I B;  2KT7 A;  2EMT A;  3NS8 A;  2G1E A;  2O6V D;  1WXM A;  1IUE A;  2L0F A;  3DHI C;  3L16 A;  3TBL D;  2DZM A;  3IBE A;  3EFU A;  2KQ4 X;  2WQY B;  2KDF B;  2OJR A;  5HI1 A;  2N9K A;  4KX6 B;  1L4D B;  1T3Q A;  2WX1 A;  1F52 A;  2N7E A;  1WJ4 A;  2BWF A;  2ZW1 A;  2WU5 B;  4IOI E;  1KTK A;  2NPT B;  5D6J B;  4NJC A;  1DGJ A;  3P4P B;  5BMG A;  1SIJ A;  1FO4 A;  2ACZ B;  2PE6 B;  3BVG A;  2G4D B;  4HPM B;  3VR9 B;  3N1Y C;  1ZGU B;  3HHM A;  4G0N B;  2RR9 A;  2QIE B;  4BFR A;  1HZ6 A;  1ZXH A;  1N5W A;  2AL6 A;  3P4S B;  2NBW B;  2KQ7 A;  1V1P A;  2XN9 C;  5J18 A;  1JRP A;  3LYY A;  4TSS A;  5EE9 A;  4RFB A;  4C4V A;  1OEY A;  4AWJ A;  4HDO A;  1G6J A;  4K1R B;  3AE6 B;  4I6L B;  1Y56 A;  1LFD A;  3GS2 A;  2BS4 B;  2D5G A;  2ZCC A;  2KVR A;  3Q3F A;  3RUL A;  4JQW C; 
#chains in the Genus database with same CATH homology
 4G11 A;  2FID A;  3WAM A;  3UIP B;  3VXW A;  3PRZ A;  1EF1 A;  2KXJ A;  2MBB B;  3R3M A;  4B95 A;  4BKS A;  4CO7 A;  3KVF B;  3A1Q B;  1SIF A;  2HD5 B;  3DVG Y;  4GXB A;  2RD0 A;  4J6I A;  4NNJ B;  1WMH B;  1VD2 A;  3UQB A;  2LWP A;  2M17 A;  2MP2 A;  3CMM B;  2BPS A;  2MQJ A;  2FCS A;  4MGI E;  1U4A A;  4GDK A;  3MHS D;  3HM3 A;  2LD9 A;  3AXC A;  3PLV A;  4NJ6 A;  3QQ8 B;  3V6C B;  4NAW B;  3EEC A;  5BO4 B;  4PS8 A;  2I1K A;  4XC2 A;  1WM3 A;  2KMC A;  4ZRJ A;  3AU4 A;  2MBO A;  2KX0 A;  2A5U A;  4BKT A;  3CST A;  3RT3 B;  3VUY A;  4EUT A;  2KQS A;  2IO3 B;  4URK A;  3A9K B;  2DZJ A;  2ZNV C;  3H1U A;  2CHZ A;  4ANU A;  2JRI B;  2V4L A;  2Y5B B;  5AZG A;  4I6N B;  3PSE B;  3BY4 B;  1WX9 A;  3AU5 A;  3WAL A;  4BOS C;  4MDK E;  3VAW A;  1OEY J;  1Y8R C;  3ZDT A;  2M0X A;  2AL3 A;  2IY0 B;  1GNU A;  2J7Q B;  2WDT B;  1XQQ A;  4PS3 A;  4MSQ B;  2QHO A;  1RLF A;  1WX8 A;  2KTR A;  1A5R A;  4RM9 A;  3ZNZ B;  5L83 A;  2C60 A;  2LJ5 A;  4G50 A;  1YX5 B;  5LXH A;  1GG3 A;  4LDT D;  4XZ4 A;  3VH4 B;  1WI0 A;  3B1L X;  4NY0 A;  3KH0 A;  1WF9 A;  1UH6 A;  3W1S A;  3VUX A;  1KJT A;  2NBV B;  2BKF A;  3B0A A;  5TR5 A;  4IM0 A;  2LAS A;  3QCA A;  1C1Y B;  3T9L A;  2ZEQ A;  4FN2 A;  4KSL C;  1OGW A;  1GC7 A;  1V80 A;  3ZLZ A;  2JZZ A;  1WXA A;  3O65 B;  1IP9 A;  2KWV B;  3Q3J A;  1GUA B;  4LJO B;  2JF5 A;  1JRU A;  2MA9 B;  4MSM B;  5JZE B;  4A20 A;  3ALB A;  4MJS B;  3QA8 A;  4GIV A;  4GDL B;  3A4S C;  3RYT A;  3OJ4 B;  2KJH B;  3X0W A;  4IW0 A;  4E3C A;  2ZVN A;  5CHF A;  4EZJ A;  2CR5 A;  2NVU I;  4FHJ A;  2NR2 A;  3VH3 B;  3PS6 A;  2GBM A;  2KDI A;  1WH3 A;  2LI5 A;  4DWF A;  5LXI B;  1V2Y A;  3KYC D;  3AUL A;  2JZ3 B;  2K8B A;  3T8M A;  4A3P A;  4M8M A;  4IUM B;  4DK5 A;  1WZ3 A;  5IAA C;  4FLH A;  1UBI A;  1IPG A;  2KC2 A;  5KHQ A;  3L08 A;  3DOW A;  1WXV A;  3H6N A;  3P2B A;  3U8Z A;  3U7D A;  3RZW C;  4MM3 A;  5G2N A;  1YJ1 A;  2GBN A;  3L10 B;  1I42 A;  4EZK A;  4ANX A;  3ZRF A;  2NPT A;  2GOW A;  2O2V A;  1XD3 B;  1YD8 U;  4TQ1 A;  2LVQ A;  2FCM A;  3PT2 B;  2A4Z A;  1WX7 A;  2JRH A;  5DPR A;  3L17 A;  3SHQ A;  2GBJ A;  4W9G A;  2NCN A;  4LDT B;  3UF8 A;  2D2Q A;  2AWT A;  4WQO B;  3UQA A;  3CSF A;  4K7W A;  2KO3 A;  3R7Q A;  4DDG D;  5IA7 A;  1Q1O A;  4ICU A;  4HCP B;  4NJ7 A;  2JXX A;  5JH5 C;  4KIK B;  2MBQ A;  3N32 A;  1OTR B;  3WA0 A;  2XK5 A;  2IO2 B;  1S3S G;  2DYM A;  2LVO A;  1UZX B;  2KFK A;  3DVN V;  2LRU A;  3KW5 B;  2KLG A;  1R4M I;  3AI5 A;  1WGY A;  4ANW A;  1ZKH A;  2JT4 B;  3DQV A;  1FXT B;  4WJO A;  4IM3 A;  1IYF A;  1WE7 A;  3DBL I;  5CHW A;  4W9H A;  3N3K B;  3ZTD A;  4W9C A;  2O6V A;  4GGQ A;  4EFO A;  2PPH A;  1V49 A;  2JPH A;  4G3X B;  4OVV A;  2MP2 B;  2W9N A;  3PPA A;  4BBN C;  3ZNH B;  3QAR A;  3RD2 A;  4HK2 A;  4GDK B;  2ASQ A;  3L0W B;  3M63 B;  1WGR A;  2G4S A;  3JW0 X;  3VQI A;  4BOZ B;  1R4N I;  3A4R A;  1WM2 A;  2V3S A;  2KC1 A;  4MEL A;  4W9K A;  3TIX A;  3DVN U;  3NOB A;  3OAW A;  3QJZ A;  1QZE A;  2DX5 B;  1UD7 A;  3WAP A;  3A1Q A;  3ZRC A;  3EC8 A;  4M0W B;  2FIF A;  4WJN A;  1WMH A;  3ML8 A;  4ZRK A;  2KNB A;  3DBH I;  5E6N A;  3WIM A;  2LGD A;  2WWZ A;  3QX1 A;  2IO1 B;  1E7U A;  4WWN A;  1RAX A;  2EKE C;  4FJY A;  1EUV B;  3PVL A;  5DCN A;  3V62 A;  3ECI A;  3MJW A;  4DHZ E;  3OLM D;  4ICV A;  3GOE A;  3VUW A;  4DDI D;  1F9J A;  1WGG A;  2HJ8 A;  2BGF A;  2KHW B;  2N9E B;  3A9J B;  4PYZ A;  1TGZ B;  1OQY A;  3JSV B;  2AEH A;  4LJP B;  1SGH A;  5DPT A;  3VDZ A;  2AYO B;  2PE9 A;  2N7D A;  2K8C A;  2FCN A;  2HTH A;  2WYQ A;  5KHO A;  1CMX B;  2DZK A;  1GJZ A;  2C7H A;  4GSW A;  3VFK A;  5CTR C;  1YX6 B;  3RZF A;  4K81 A;  4ZYN A;  1P98 A;  2KOX A;  2JWZ A;  3BIN A;  1NDD A;  5D94 A;  4AP4 C;  1WYW B;  4IC7 B;  2DHZ A;  1UBQ A;  2EMS A;  4W9E A;  1EO6 A;  2FNJ B;  2K6D B;  3DCG A;  4GMV A;  4MGY E;  3VTW A;  4BVU C;  3H7P B;  4WWO A;  4N9F 4;  4W9J A;  1H8C A;  4KV2 A;  4GN1 A;  4CHK A;  4DHZ B;  3D32 A;  5J2R A;  2N9X A;  2L76 A;  2JVC A;  4LCD E;  2KN5 A;  3A33 B;  5CX3 A;  4WAA A;  4W9L A;  4BKS D;  2XBB C;  1V5O A;  1WE6 A;  4YL8 A;  5C23 A;  1YQB A;  3DDC B;  2BYF A;  3ZUN A;  1WY8 A;  1WGD A;  2RGF A;  3TCA A;  1UEL A;  2G45 B;  2GBR A;  4JIO U;  3KUZ A;  2M8S A;  1RFA A;  4M8N A;  3NZU A;  4A3O A;  1XT9 B;  1WJ6 A;  1KLV A;  4IG7 B;  4AOF A;  4ZDV A;  3OJ3 A;  2DYO A;  4TQ0 A;  1I35 A;  1WXS A;  2IO0 B;  3K9O B;  3MTN B;  3W1Y A;  4B6W A;  4EZL A;  3QC8 B;  5DPW A;  2DAF A;  1WR6 E;  3PLU A;  3PZD A;  3VTU A;  4HVB A;  2DEN B;  3CF6 E;  2BWE S;  2FUH B;  2ZCB A;  4MJS A;  2DYB A;  1Q5W B;  1V5T A;  2MWS B;  1BT0 A;  2IBI B;  3TMP B;  3UIN B;  2L05 A;  3R66 C;  2LRW A;  2I1J A;  1WFY A;  2MW5 A;  3IHP C;  4HPL B;  2DZI A;  3SDL C;  4ANV A;  1J8C A;  1V86 A;  3HIZ A;  5AZH A;  2KWC A;  4KZ0 A;  3TL5 A;  1P9D U;  4ASW C;  2L7R A;  3RCZ A;  4AJW A;  4HCN B;  4W9F A;  2CS4 A;  2K39 A;  2LXA A;  2BF8 B;  2V1Y A;  3DBS A;  3K9P B;  4PYU A;  3WAO A;  3DPD A;  2J0K A;  2N4F A;  1TTN A;  1E7V A;  4FJV B;  4JL9 A;  4FA6 A;  2VRR B;  2REX A;  3ZKJ C;  4E74 A;  2N1V A;  2ZPN A;  4MH0 E;  2N1W A;  4BKG A;  3V60 A;  4F8C B;  2XK5 B;  1L2N A;  3ZTC A;  3ZVV A;  2MBE A;  3NY5 A;  5FR6 A;  4OVU A;  3R7R A;  1WIA A;  3IFW B;  3ML9 A;  1E8W A;  2MRP A;  2R2O A;  5JHA A;  3KUD B;  4II3 B;  2FAZ A;  4W9I A;  3X23 A;  4K7S A;  4GB9 A;  1V81 A;  4MGZ E;  5E6O A;  1S1Q B;  1P0R A;  2ZZP B;  2IY1 B;  1NI2 A;  1LQB A;  1WJN A;  2HE7 A;  2YVC A;  2IZV B;  4KZC A;  4KIK A;  3ZO5 B;  1H4R A;  1E8Y A;  2Z0E B;  2KDE B;  3H9D A;  4HXD A;  2L3Z A;  4RM8 A;  1MG8 A;  1E90 A;  3HM6 X;  1NBF C;  5HKH A;  4KVG B;  1SE9 A;  5JHB A;  3LJ3 A;  3PV1 A;  3ZW3 A;  5G55 A;  3RUI B;  2G3Q B;  4HWI B;  2J0J A;  3KUC B;  3M3J A;  2B3A A;  5C1Z A;  4EOY A;  1YIW A;  2BKR B;  2MLB A;  4K7U A;  4HLE A;  4CYE A;  2YLM A;  1V6E A;  4GU2 A;  4TV3 A;  4E71 A;  4F7Z A;  2GBK A;  2K25 A;  3DVG X;  4NQK E;  1UGM A;  3GZN I;  1WZ0 A;  2M4N A;  5L95 C;  2KWU B;  5D7G A;  1J0G A;  4WJP A;  2LGY A;  3LDZ E;  3M62 B;  3PRP B;  1LXD A;  4EKU A;  2KDB A;  3ZDM C;  3APF A;  1Z2M A;  2LXC A;  3PTF C;  5AEK B;  3B08 A;  5CHV C;  3NHE B;  4NAW A;  4ZRI A;  1L7Y A;  2C7M B;  2KTF A;  2LZ6 A;  1M94 A;  3H7S A;  2MSE D;  3PGE A;  4KSK C;  5DPS A;  3L13 A;  2KTR B;  4P7I A;  1LM8 B;  3QK0 A;  2M1M A;  3W1S C;  3DBR I;  3WAN A;  2NS5 A;  4MGK E;  4TUU A;  5D2M B;  2MCN B;  2K6Q A;  3UIO B;  4IWO A;  2RSU A;  3A9K A;  2UYZ B;  1E8Z A;  2R2Q A;  2CU1 A;  2KLC A;  2ZJD A;  2ZPY A;  4KDL B;  5J17 A;  4FBJ B;  1KOT A;  2J0M A;  1K8R B;  3ZNG C;  2D07 B;  1ISN A;  4BBN F;  2BYE A;  4HDQ A;  5LLI A;  1E8X A;  4GOC A;  1WR1 A;  2PJH A;  1GC6 A;  2ZNV B;  1X1M A;  2C5L C;  1TBE A;  3A9J A;  4FJZ A;  3SD5 A;  3JSV A;  3HK0 A;  3IVF A;  4PS7 A;  2K8H A;  2UWQ A;  4JLC A;  3S2A A;  2L0T A;  1J19 A;  2D3G A;  2L00 B;  2MBH A;  4JGH B;  1D3Z A;  1KM7 A;  3VVW B;  3PHX B;  1PQS A;  2EMT A;  1TZ1 A;  3PRE A;  3NS8 A;  3C0R B;  1P3Q U;  5EDS A;  2LVP A;  2O6V D;  1WXM A;  4NPN A;  4AUQ C;  2CHX A;  4DBG A;  3L16 A;  2L0F A;  3TBL D;  1AAR A;  1EF5 A;  2DZM A;  4TKN A;  3ENE A;  2L8J A;  2Z0D B;  3EFU A;  3IBE A;  2FCQ A;  2LUE A;  2WX0 A;  3VHT C;  3JVZ X;  3SU8 X;  4F1S A;  1C3T A;  3JYU A;  4DHJ D;  3H7P A;  3TJP A;  2LGX A;  3APD A;  2OOB B;  3VTV A;  2KDF B;  2MX2 A;  2OJR A;  4KDI C;  3APC A;  1P1A A;  2KJR A;  3I3T B;  4GDL A;  2GMI C;  4NQL B;  2WX1 A;  1RRB A;  5GMV A;  2RPQ A;  4XX5 A;  2KZR A;  2N7E A;  2KD0 A;  4IM2 A;  1WJ4 A;  2K1F A;  2BWF A;  4HJK A;  2JUO A;  1V9J A;  2XEW A;  4I6P A;  2KMA A;  3PRM B;  3QIJ A;  2NPT B;  5D6J B;  2KAN A;  2O2V B;  4FAD A;  4FHK A;  2KJ6 A;  1WJU A;  4RMA A;  1Q0W B;  2CKH B;  4II2 B;  3NZS A;  2PE6 B;  4HPM B;  2G4D B;  2PEA A;  4EEW A;  1T0Y A;  3UGB B;  4AJY B;  3M95 A;  1ZGU B;  3HHM A;  4G0N B;  2RR9 A;  1HE8 A;  4BFR A;  5E6P A;  3ONS A;  2N9P C;  3V6E B;  2AL6 A;  3QAQ A;  4IWQ A;  2NBW B;  3QHT A;  2KQ7 A;  3L54 A;  4WWP A;  4IWP A;  5J18 A;  4FUL A;  1ZW7 A;  3EHV A;  1E5W A;  4B9K A;  2KFK B;  2IYD B;  1OEY A;  2D10 A;  1Z5S B;  2KK8 A;  4AWJ A;  3QWZ B;  2D11 A;  3N30 A;  2Z59 B;  5AZF A;  3ZIM A;  2ZVO A;  4HDO A;  1VCB A;  2KX3 A;  1WRD B;  2NBU A;  3U30 A;  2C9W B;  4X57 B;  3KYD D;  3V61 A;  1G6J A;  2KFJ A;  3ZNI D;  4K1R B;  2KKC A;  2O6V B;  3IG3 A;  2C7N B;  2DAJ A;  4I6L B;  2BYV E;  3PHW B;  4WJQ A;  1LFD A;  2ZCC A;  4MEM A;  4W9D A;  2CHW A;  1WGH A;  4DHJ B;  2JY6 A;  2KVR A;  3Q3F A;  3RUL A;  4JQW C;  4DXA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...