3ZTCA

Pvhl54-213-elob-eloc complex _ (2s,4r)-n-((1,1'-biphenyl)-4-ylmethyl)- 4-hydroxy-1-(2-(3-methylisoxazol-5-yl)acetyl)pyrrolidine-2- carboxamide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
103
Chain Sequence
b'MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADTFEALCIEPFSSPPELPDVMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 21
structure length 103
sequence length 104
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ztcA00
3H7PB 5JHAA 1V81A 4MH0E 3DBLI 4BKSA 1E90A 2LGYA 2IZVB 1RFAA 5CHWA 3IHPC 5C1ZA 4ZRIA 2R2OA 3UQAA 1OGWA 3AU4A 3SHQA 4IWOA 4BKGA 1WR1A 2NBUA 3AI5A 4HLEA 2I1JA 2PE6B 4ICUA 3PRPB 1TBEA 5E6PA 4TQ0A 1GG3A 2XBBC 1P9DU 3M62B 2KJ6A 2UWQA 1WXAA 2KC1A 3W1SC 2BYVE 3OJ3A 4JGHB 4KDLB 5KHOA 2AWTA 1L7YA 2C7HA 3ML8A 5J17A 4WWOA 5DPTA 3NZSA 4FA6A 5E6OA 1I35A 3DVGX 2C5LC 3IG3A 1WFYA 4EZLA 1Y8RC 2IO2B 2NBVB 4JIOU 4NQLB 1LXDA 1P0RA 2IO1B 3HM3A 2O6VB 4GB9A 2CHXA 4ZRKA 3PRZA 4NNJB 3WA0A 3ZKJC 2K39A 1KLVA 4FULA 3DBHI 4IWPA 1E7UA 2GBJA 2N4FA 4J6IA 4XZ4A 2M4NA 1J19A 3VH4B 2DZIA 5J18A 2KDFB 1ISNA 3NY5A 2CR5A 5G2NA 2NVUI 3R3MA 4HDOA 1TTNA 2PEAA 4MJSB 3KW5B 4WJOA 3U8ZA 3A9JB 4ANUA 4II2B 3VDZA 1K8RB 2DAFA 3EFUA 2JXXA 1S3SG 3X0WA 1RLFA 1XD3B 2MX2A 3R66C 1WZ3A 2KDBA 1LQBA 3VXWA 1LM8B 3R7QA 1FXTB 4W9LA 1L2NA 3JSVB 2BWES 2JWZA 2NPTA 2KD0A 1WGRA 4LDTD 4MSQB 2BWFA 4HWIB 4EZJA 3GZNI 4KSKC 1AARA 1WH3A 1JRUA 2LRUA 2GBKA 2ZJDA 1S1QB 2XEWA 4FJZA 2KK8A 4IUMB 1NI2A 2DYMA 4K7WA 5D94A 2UYZB 2C7NB 1WF9A 5CHVC 5G55A 4E3CA 2MSED 2LUEA 2C60A 2KMAA 3WAMA 3RT3B 2KZRA 4K1RB 4CO7A 4KSLC 2K25A 1E8XA 3NS8A 3VH3B 2K6DB 1SGHA 3ZNID 2KQ7A 4BFRA 2I1KA 2DAJA 3Q3JA 3SD5A 4DHZE 3IVFA 2XK5B 1IP9A 1R4NI 2LXAA 2MCNB 4DDID 2KWUB 3AXCA 4HDQA 4RMAA 3UF8A 2OOBB 3U30A 1ZGUB 3APFA 3N3KB 2DHZA 2JF5A 3ZNZB 1V80A 2N9EB 3MHSD 1GNUA 4GXBA 2YVCA 4EOYA 1VD2A 4W9GA 5IA7A 3RUIB 1EO6A 2DZMA 4DHJD 2L7RA 2FCNA 1C1YB 3RYTA 4NJ7A 3QX1A 1WZ0A 3NZUA 2CKHB 3BINA 2V1YA 3QA8A 3O65B 2ZNVB 3AU5A 3DBRI 3DBSA 4GGQA 1WX8A 2ZPYA 4NJ6A 4PS3A 4A3OA 1V9JA 3DPDA 4LJOB 4PS8A 4ZRJA 3UIOB 4E71A 1RRBA 1WJ6A 4WJNA 3ZIMA 3H9DA 2N1WA 3DVNV 4HPLB 4AJYB 2BGFA 3I3TB 2KLGA 2MA9B 4W9EA 4BBNF 2IBIB 2G4SA 3EECA 3WALA 1UBIA 3L13A 1V86A 4XX5A 4FLHA 4G11A 4W9CA 2JT4B 5DPSA 3N32A 3S2AA 2DZKA 2MBEA 2AEHA 3H7SA 2L00B 3OLMD 3LDZE 4IM0A 2O2VB 3A1QA 2LASA 2J0MA 1NBFC 2IY0B 3L0WB 1SE9A 2JPHA 1WX9A 3PT2B 3QCAA 4MGKE 3V61A 2CHWA 2PJHA 1I42A 4DK5A 2D11A 4KDIC 4KIKB 4TUUA 4AUQC 1KOTA 4IW0A 2JVCA 4FHKA 4MSMB 3K9PB 2MP2B 2NBWB 3KUZA 4MELA 4X57B 1EF5A 4MDKE 4EEWA 5BO4B 3W1SA 3VUXA 2MBQA 5JZEB 4URKA 2N7DA 3BY4B 3QQ8B 3ONSA 5JH5C 3KVFB 3WAOA 2MW5A 2V4LA 2VRRB 1OEYA 2K1FA 3PHXB 3C0RB 2RGFA 3NHEB 2N7EA 3DQVA 2QHOA 3QAQA 2O6VD 3V62A 1KJTA 2DYOA 4G3XB 2LVQA 3VTUA 3T8MA 2Z59B 3PPAA 1WE6A 3L17A 1G6JA 2BYFA 4KV2A 2D10A 2L05A 4PS7A 3A9KB 2LI5A 2KLCA 2G45B 2IO3B 2K8BA 2KFKA 4FHJA 1WMHA 2WX0A 4I6NB 3ZW3A 2JRHA 1YX6B 4GSWA 2KDIA 2Z0DB 2JZZA 5LXIB 1WXVA 5AZHA 3TCAA 1IYFA 3L16A 4DWFA 4WQOB 4DHZB 1V49A 2N9PC 2HE7A 2L3ZA 2N9XA 1F9JA 3APDA 1TZ1A 1OEYJ 2J0KA 3VFKA 3R7RA 2YLMA 3WAPA 1M94A 2L0TA 4NPNA 3ECIA 4GOCA 5DCNA 2LGXA 3V6EB 2DX5B 3H6NA 3CSFA 3ALBA 3PLVA 4I6PA 3ZNGC 2HJ8A 1U4AA 4HVBA 5LLIA 5AEKB 5GMVA 5DPWA 4ASWC 4LJPB 2EKEC 3DVGY 4K7UA 3PGEA 4P7IA 2Z0EB 4G50A 2FIFA 3VHTC 3M63B 1XT9B 2B3AA 2K8HA 4YL8A 1WM2A 2KX0A 2IY1B 4FJYA 1H8CA 3IBEA 2NR2A 5D7GA 1H4RA 4B9KA 4G0NB 2ZNVC 4B95A 1VCBA 2A5UA 2KFKB 2ZVOA 4K7SA 4F1SA 2KANA 1P3QU 4TQ1A 4EFOA 4NQKE 2WX1A 2JZ3B 4GU2A 4W9KA 4I6LB 3SDLC 3Q3FA 1WRDB 1GC6A 4CYEA 3P2BA 2CHZA 4FJVB 4GDKA 3K9OB 4MEMA 3VUWA 4BOZB 2KNBA 1Z5SB 3UIPB 2FCSA 2HTHA 2BKRB 3KH0A 4MGYE 2NPTB 2NCNA 2ZCBA 2W9NA 2D3GA 2KTRA 4DXAB 3H7PA 4HXDA 2G3QB 3B08A 2FIDA 3GOEA 4MM3A 1J0GA 4ZDVA 2DENB 2MRPA 3QJZA 4IC7B 3B1LX 1ZW7A 2ZPNA 3PREA 3PRMB 1V5TA 4IM2A 1UBQA 2MBOA 5KHQA 3HM6X 2WDTB 2REXA 1WGYA 1PQSA 3A33B 2FCMA 1WE7A 1WM3A 4HPMB 3TBLD 2JY6A 2K6QA 2D2QA 3VTVA 3ZVVA 3L08A 4JL9A 3ML9A 4TKNA 3OJ4B 4A3PA 3VAWA 2C7MB 1R4MI 1YIWA 4ZYNA 3ZRFA 1UELA 3PVLA 3W1YA 4ANXA 3L10B 3PHWB 3SU8X 1Q1OA 2O6VA 4FN2A 2FAZA 2AL3A 2RPQA 2IO0B 1WGDA 2KJHB 4FBJB 1GC7A 3EC8A 4AWJA 1WY8A 3QHTA 2D07B 3VQIA 3M3JA 1OQYA 3PV1A 5D6JB 2Y5BB 2KO3A 3CF6E 4NAWA 4W9DA 5AZFA 4TV3A 3TMPB 2FUHB 4M8NA 1NDDA 2EMTA 4MJSA 4WWNA 1KM7A 3A9JA 1V6EA 3PLUA 2LXCA 2RSUA 2ZZPB 1Q0WB 3B0AA 3ZDTA 4ANVA 1XQQA 1CMXB 1EUVB 3UQBA 4W9IA 4RM9A 4MGIE 3TL5A 4HJKA 3ENEA 2M0XA 3H1UA 5IAAC 3T9LA 4FADA 2A4ZA 2OJRA 1RAXA 1BT0A 2G4DB 3JSVA 2IYDB 2L76A 1E5WA 1WXMA 4GMVA 3RD2A 2ZVNA 2M8SA 4WJPA 2NS5A 4M8MA 2MBBB 2KOXA 4AJWA 2KC2A 1E7VA 4IM3A 3EHVA 4BKSD 3A1QB 3DDCB 3RCZA 3DOWA 4W9FA 3JW0X 1D3ZA 4M0WB 1UGMA 1A5RA 1IPGA 2KXJA 4GDLA 2KTFA 1UD7A 2FCQA 3VTWA 2KN5A 2N1VA 3RULA 2KKCA 3CSTA 2M1MA 2DYBA 5TR5A 2BYEA 5CTRC 1EF1A 1WX7A 2XK5A 5CX3A 4WAAA 3TIXA 2V3SA 2LVPA 3DCGA 4DBGA 1WJ4A 4HCNB 4W9HA 4KZ0A 3ZLZA 1OTRB 4NAWB 4KVGB 2KWVB 2ASQA 4OVVA 3CMMB 2GMIC 4ICVA 2KVRA 3HK0A 3HHMA 4GN1A 3AULA 1MG8A 3PZDA 2CS4A 2GBRA 3D32A 1E8WA 4II3B 2MWSB 1LFDA 2MLBA 4WWPA 4EKUA 4DDGD 5J2RA 3ZTDA 1WR6E 2BPSA 3WIMA 3A4SC 2EMSA 2PPHA 4F7ZA 2LJ5A 3JVZX 1YX5B 3VUYA 2MQJA 4IG7B 2K8CA 4PYZA 4CHKA 4BVUC 4LDTB 5EDSA 5AZGA 2ZCCA 5CHFA 5FR6A 3ZNHB 5JHBA 1UZXB 2J7QB 1YJ1A 4LCDE 1GJZA 1T0YA 1SIFA 1WMHB 5LXHA 1WYWB 1YD8U 2KWCA 3L54A 1E8ZA 2LZ6A 2LD9A 2WYQA 3UGBB 4A20A 2R2QA 4HK2A 3QK0A 3A4RA 3ZO5B 4GDLB 1WJUA 5DPRA 3IFWB 4KZCA 5L95C 3V6CB 1UH6A 2BF8B 2HD5B 1HE8A 3N30A 2LWPA 2RR9A 3KUCB 3MJWA 2RD0A 4EUTA 4GIVA 2FNJB 4PYUA 2DZJA 3KYCD 3WANA 3ZUNA 4JLCA 2O2VA 3M95A 1TGZB 3ZTCA 4JQWC 3RZFA 5L83A 1QZEA 3APCA 3MTNB 4E74A 4K81A 4BOSC 1GUAB 3NOBA 4KIKA 1ZKHA 4OVUA 3VVWB 3DVNU 2BKFA 3QIJA 2KMCA 1V2YA 3PSEB 2L0FA 4B6WA 1P1AA 1WXSA 2JUOA 2MP2A 4N9F4 3PS6A 2KFJA 4XC2A 2C9WB 2PE9A 5E6NA 2JRIB 2LVOA 5C23A 1V5OA 2KHWB 2GBMA 3QWZB 1X1MA 2CU1A 4MGZE 3U7DA 1WJNA 2KX3A 3KUDB 4IWQA 1Q5WB 2WWZA 4DHJB 2KDEB 2AL6A 1J8CA 1Z2MA 4EZKA 4RM8A 4WJQA 2KQSA 3UINB 4AP4C 4ANWA 1YQBA 4NY0A 3KYDD 2KJRA 2GOWA 1WGHA 2GBNA 1P98A 2M17A 2ZEQA 3PTFC 3LJ3A 4BKTA 3ZDMC 2LRWA 3RZWC 1WGGA 2J0JA 3QARA 3TJPA 1E8YA 3V60A 2L8JA 1C3TA 1WI0A 3X23A 4GDKB 3JYUA 3ZRCA 4F8CB 3A9KA 5HKHA 2LGDA 3OAWA 3QC8B 2MBHA 4HCPB 4BBNC 1WIAA 2AYOB 4AOFA 3HIZA 4W9JA 5D2MB 2KTRB
chains in the Genus database with same CATH superfamily
5JHAA 2VZKB 4MM3B 5CHWA 3MC0B 3DHHC 1JROA 1WR1A 3EA6A 3FILA 1TBEA 3J9CA 5E6PA 1F52A 2BYTA 2XBBC 1P9DU 3M62B 1YN5A 3ETRA 4JGHB 4ZYSA 1OQRA 4WWOA 5DPTA 2KAJA 3AE4B 5E6OA 1QT9A 2C5LC 3IG3A 3BYTB 2IO1B 3KLSX 1E7UA 4XZ4A 2M19A 2KDFB 1MHHE 2WXOA 3R3MA 2MHJA 2PEAA 4D2KA 4ANUA 2W3RA 1K8RB 1V97A 5HFYA 3EFUA 1DOYA 2MX2A 3R66C 1I7HA 5D3IB 1AYFA 1WZ3A 2KDBA 1Q10A 3VRBB 1FXTB 2BWES 2JWZA 1WGRA 4HWIB 1QOGA 2D3BA 1AARA 1JRUA 1S1QB 4WQMA 2DYMA 3P4SB 2C7NB 1WF9A 1V1PA 2MSED 3EGRA 2KMAA 3WAMA 4CO7A 4KSLC 4BFRA 4B0EA 4DHZE 1IP9A 1I4HA 1J7BA 4HDQA 3UF8A 1ZGUB 3AE2B 2BTEA 3N3KB 2DHZA 3MHSD 4MH8A 4GXBA 1WGKA 2YVCA 2WXHA 4OZBA 1VD2A 5IA7A 3V3XA 1YN4A 2LGIA 1YOVB 1B9RA 3NZUA 3BINA 2V1YA 1FEHA 2ZNVB 2IDYA 3AU5A 3DBSA 1WX8A 4A3OA 4PS3A 3DPDA 4ZRJA 3UIOB 1WJ6A 4BAXA 4HPLB 4AJYB 2BGFA 2BQQA 3EUB2 3I3TB 2QSDA 2MA9B 4W9EA 1SSNA 4G11A 4W9CA 2PW9A 2DZKA 2IPKD 1L4DB 2AEHA 3H7SA 4IM0A 3LDZE 2QEJC 2LASA 1YJIA 4C56C 4DQOC 2JPHA 4MGKE 3GE3C 3SFDB 1SE3A 4KDIC 4XDDA 4AUQC 5HI1A 1L0YB 4X57B 3ZJUA 2EELA 1PDXA 1XCQL 1N6ZA 3GP7A 5JZEB 3BY4B 3C19A 3KVFB 4YT0B 1UWXA 3DQVA 2QHOA 1FO4A 2DYOA 4S17A 5C3JB 4A8XC 3PPAA 2BYFA 4KV2A 2KLCA 2IO3B 2KFKA 3NZ3A 2JRHA 4GSWA 2Z0DB 1D6EC 1KTKA 3GS2A 3Q3OC 1JRPA 3APDA 4LNKA 3VR9B 2J0KA 3IXSA 3WAPA 1M94A 4NPNA 3ECIA 2MH7A 2DX5B 3NJTA 3BYYB 3ABVB 5LLIA 5DPWA 3LB8C 1FXIA 2WXIA 3DVGY 4K7UA 3PGEA 2FIFA 3M63B 1XT9B 2KX0A 1N5XA 4K3CA 1ZDXA 2ZNVC 2ZVOA 2KFKB 2K0PA 1KH0A 1P3QU 4NQKE 2WXMA 1STEA 3Q3FA 1GC6A 1TS3A 1JALA 1EU3A 3R2TA 3VUWA 3LXFA 4TSSA 4REZA 3HRDD 4JPSA 1NVID 2ZCBA 4DXAB 2AQ2B 2DENB 2MRPA 1QF6A 1ZW7A 3PREA 1F0ZA 2PIAA 2MBOA 5KHQA 2GLSA 4A90A 1WGYA 3A33B 1GB4A 1WM3A 3KQ4A 2K6QA 3L08A 3ML9A 2WXQA 1NYRA 3DBLB 1TY0A 1UELA 3W1YA 4ANXA 4ITKA 3SU8X 3LYYA 1QOFA 2FAZA 2RPQA 3NVZA 3URYA 4ZHPA 4XWTA 4AWJA 5AZFA 2Y5BB 4TV3A 4YXDB 2FUHB 4M8NA 4MJSA 4ANVA 2LJIA 4MGIE 4PT5A 3TL5A 4HJKA 5IAAC 4LNFA 4RGMA 5T8IA 2QCZA 3JSVA 1WXMA 4GMVA 5EE3A 2ZVNA 1KLGD 1KF6B 4M8MA 2KC2A 4BKSD 1ENFA 3ZJVA 3RCZA 2Y3AA 1NEKB 4GDLA 1SB3C 1UD7A 2N1VA 1L0VB 2KKCA 3BVZA 5TR5A 4M02A 5CTRC 1EF1A 2HJ1A 3N1XC 2LVPA 3DCGA 4OHJA 4HCNB 4W9HA 3NG0A 4KZ0A 1OTRB 1C78A 3CMMB 2GMIC 2KVRA 3HK0A 3ZQ4A 2JU6X 1MG8A 2CS4A 2MLBA 4EKUA 3AEDB 4WWPA 2M0AA 2NTSA 1YX5B 3VUYA 2MQJA 3L4PA 5JHBA 3B2GA 1YJ1A 4LCDE 1GJZA 1SIFA 1C4AA 1WMHB 4AQ7A 1FRDA 1R7SA 2R2QA 4HK2A 4GDLB 5DPRA 1TKEA 3IFWB 1E7PB 5BYQA 3RNAC 3N30A 2OJWA 4XE0A 2RR9A 4GIVA 2FNJB 4PYUA 1TGZB 1XLNA 2WXRA 3MTNB 3AEEB 1FFVA 4ZOHC 3U52E 4BOSC 3WCQA 3VVWB 3QIJA 2KMCA 1V2YA 4B6WA 1L6UA 1P1AA 2BS2B 3Q14C 2KFJA 2AQ1B 2C9WB 3QWZB 2CU1A 3U7DA 4DHJB 4IWQA 2KDEB 2AL6A 1J8CA 1JWBD 4EZKA 4RM8A 3UINB 1V1OA 1YQBA 2L32A 1P98A 5LNK1 1XLPA 1KRHA 5EE1A 2MEKA 4GDKB 4F8CB 3A9KA 1FCCC 2AYOB 3HIZA 1ZE3D 1YQ4B 1IBXB 3H7PB 1D5MC 4BKSA 1N63A 1RFAA 2WXJA 1QILA 4ZRIA 5C1ZA 3UQAA 1OGWA 3AU4A 3SHQA 4IWOA 4BKGA 2NBUA 3MHZA 2N9KA 3RFZB 1GG3A 3AMZA 2KJ6A 2LMCA 2UWQA 2JWUA 2YEPB 3W1SC 3OJ3A 4KDLB 1SEBD 1GPXA 4M01A 1I4GA 1ZXIA 3DVGX 1Y8RC 2AX5A 3P4RB 4NQLB 4ZRKA 4NNJB 3NS1A 1XO3A 2K39A 3DBHI 4IWPA 2GBJA 2N4FA 2JQRB 4J6IA 4P16A 1I4XA 2PTLA 5J18A 1ISNA 3N20C 3A9JB 4II2B 2JXXA 1S3SG 1DYQA 4W9LA 1TYGB 1JWUD 4LDTD 2KD0A 3U2SC 4EZJA 3GZNI 1R4NB 2GBKA 1VDVA 2ZJDA 2XEWA 4IUMB 5D94A 5CHVC 1UF0A 5G55A 5MPOA 1ROEA 5BMIA 3ZGZA 1E8XA 2KQ7A 1DOXA 2LHEA 2B76B 2MCNB 3W5VB 1FRRA 1I4RA 2KWUB 4DDID 4YSXB 3U30A 3APFA 2ZW1A 3ZNZB 2WXLA 2N9EB 2PVGC 1C77A 1TT5B 4W9GA 1T6BX 1VR9A 4JWUC 2QDFA 4PS8A 1SF0A 1C79A 4AS1A 2N1WA 3CWIA 3DVNV 3T3OA 3Q3NC 2I2YA 4BBNF 2IBIB 1JW9D 3Q69A 1TKYA 2L52A 3N32A 3S2AA 1ZXHA 2L00B 4KKIA 2IY0B 4M0WA 2QMTA 3QCAA 3V61A 2PJHA 2ACZB 3Q8AA 2WXGA 4IW0A 4MSMB 1QLBB 2MP2B 4KKJA 3KUZA 4MELA 2J52A 1V8CA 3HVZA 4MDKE 5BO4B 3Q3MC 1EWCA 4C80A 1K53A 4HEA1 1WSPA 3WAOA 3PHXB 3C0RB 1HTQA 2N7EA 3QAQA 2O6VD 1PGXA 3I9V1 3MFGA 1D5XC 3VTUA 3T8MA 1WE6A 4LNIA 2D10A 3Q8BA 2K8BA 3I5JC 1YQ3B 3TSSA 2X38A 5FK9C 1YNTE 1P7FA 1XCTL 4OW0A 5IKCM 1IYFA 1MJDA 2HE7A 2L3ZA 3FILB 1TZ1A 2YLMA 1FNVA 4LK0M 5G5HA 2WQYB 4GOCA 2LGXA 2WXPA 2JZPA 3H6NA 2WXFA 3ZYYX 3PLVA 1U4AA 4P7IA 3AE6B 3VHTC 4YL8A 1WM2A 1YN3A 3AE5B 1LGRA 4HJGE 5D7GA 4G0NB 4RNAA 1VCBA 2PLPA 3AE9B 1GB1A 1M4VA 4TQ1A 1HZ6A 2CJNA 4EE2A 1FM0D 4W9KA 3P2BA 2CHZA 4MEMA 4BOZB 2KNBA 1I4PA 2QC8A 3KH0A 4HROA 2WDRB 2QILA 2KTRA 2ON8A 1L4ZB 4HXDA 2HDEA 3B08A 3GOEA 4IC7B 1R4MB 1MG4A 3R8BA 1V1PB 2D3CA 5BYSA 3BWUD 3AE8B 3HM6X 1CZPA 2WDTB 2FCMA 1WE7A 4HPMB 2JY6A 3ZVVA 1FMAD 2V4IB 1MPEA 1QKZA 4A3PA 3VAWA 3B9JA 4ZYNA 3PHWB 2O6VA 3SR6A 2IO0B 1WGDA 2N0SB 3EC8A 1WY8A 3QHTA 2D07B 3VQIA 3M3JA 1PGBA 4NAWA 4W9DA 3TMPB 2EMTA 4WWNA 2GRIA 1V6EA 3ZDTA 2LXCA 2RSUA 2ZZPB 3B0AA 3NRZA 1EUVB 1Y56A 3UQBA 4W9IA 5AUKA 4RM9A 2BBCA 1PFDA 2OJRA 1DGJA 2VH2A 1BT0A 2G4DB 4WIPA 1E5WA 3FKYA 3RD2A 2RDHA 1TS4A 3P4QB 3DWMA 1E7VA 3EHVA 3DDCB 3DOWA 3SEBA 1EWYC 1UGMA 4XDCA 4N59A 3BK2A 4DXGA 3CSTA 1F2RI 2XK5A 4ZHOA 1N61A 4NAWB 3AEAB 3HHMA 2Y5PA 2FUG1 3PZDA 2WU2B 1E6EB 2EMSA 2J4XA 2LJ5A 3JVZX 2AQ3B 4US9A 2KVZA 4BVUC 1BXTA 3ZNHB 5IOIA 2J7QB 2KMMA 2KWCA 2WYQA 3UGBB 3QK0A 3A4RA 4KZCA 3V6CB 2BF8B 1JMLA 3MJWA 4EUTA 2DZJA 3KYCD 2WXKA 3WANA 2O2VA 3RZFA 1ET9A 3APCA 4E74A 1EM7A 4KIKA 1ZKHA 4OVUA 3DVNU 5EE9A 3PSEB 2L0FA 1IGDA 4N9F4 3Q8EA 2JUOA 4C00A 2H89B 5H92C 2YEPF 2LVOA 1V5OA 4MGZE 1P7EA 1ZUD2 1Z2MA 4AP4C 4ANWA 2GOWA 2OEDA 3PTFC 2M17A 2ZEQA 1N62A 3LJ3A 4YTPB 1RM6C 1FXAA 4HKZE 3ZDMC 3RZWC 2W55A 3MJ5A 1WI0A 1DOIA 4ZRPA 1KFYB 2LGDA 4HCPB 4BBNC 1WIAA 4AOFA 1TZOA 4S0RA 1E90A 4NJCA 2IZVB 3IHPC 2BS3B 1AW7A 3BK1A 1SXTA 4KGRA 2GI9A 2I1JA 2PE6B 4ICUA 3PRPB 1FD6A 1QQRA 1WXAA 2KYWA 2AWTA 1L7YA 3ML8A 5J17A 3IT6B 4UDUC 4FA6A 2V0GA 2K5PA 4JIOU 2NBVB 4WH4A 3HM3A 4GB9A 1KLVA 2CHXA 3WA0A 4FXCA 2M4NA 1B1ZA 3NY5A 5G2NA 4RGTA 5HHDG 4HDOA 1TTNA 4MJSB 4P1CC 3U8ZA 1L0XB 3VDZA 4A9AA 1TIFA 2RPVA 2ZW0A 3C8YA 3Q8FA 3X0WA 3W2DA 1XD3B 4RF0A 1LM8B 1L2NA 2Q5WD 3JSVB 2NPTA 2D3AA 2INPE 3BIID 2WXNA 1WYGA 2GB1A 1VZ7A 1WH3A 3BVGA 1D4BA 4FJZA 1IUEA 2FBWB 3KWLA 4WWMA 1NI2A 1VLBA 4K7WA 2UYZB 4E3CA 2LUEA 2C60A 3Q6BA 4USAA 2ICIA 3NS8A 3VH3B 1ESFA 1SGHA 3TEZA 3Q3JA 1R4NI 3AXCA 4RMAA 3RNCC 4ARIA 3B2FA 3TUOA 2JF5A 2DWQA 1V80A 2WHIA 1GNUA 4EOYA 3AEFB 3RUIB 1EO6A 2DZMA 3O13A 1XLQA 2L7RA 1C1YB 3QX1A 2IGDA 1WZ0A 2XN9C 1NENB 2CKHB 2NTTA 2J42A 3DBRI 4NJ6A 4C7ZA 1FCLA 4LJOB 1RRBA 5BMGA 4WJNA 2WDQB 3WALA 2G4SA 1UBIA 1K50A 3L13A 4XX5A 4PK1A 3HUIA 2JT4B 2KDMA 4ACFA 2M56B 2MBEA 3SFEB 1VZ6A 1WWTA 2VZKD 3NVYA 3I57A 3A1QA 2J0MA 3PT2B 2CHWA 4DK5A 4P1BC 4K3BA 4TUUA 1KOTA 2JVCA 3ZXRA 3K9PB 4TMAB 4EEWA 2LHDA 3OWEB 4URKA 1SE4A 3QQ8B 3ONSA 3NUHB 2E6XA 2DLBA 4KGSA 2VRRB 2K1FA 2WP9B 2TSSA 2WLBA 3V62A 1CQVA 2K22A 1MHXA 3L17A 1E9MA 4RH6A 3A9KB 2LI5A 2WX0A 3ZW3A 1D5ZC 2JZZA 3BVMA 1L6VA 5LXIB 1WXVA 3TCAA 3L16A 3PZ8A 1FPYA 4WQOB 4DHZB 1SIJA 1OEYJ 3VFKA 3R7RA 4JE3B 5DCNA 3ALBA 3ZNGC 2HJ8A 4LJPB 4OVZA 2RMMA 2V3NA 2Z0EB 4G50A 1NI3A 2B3AA 3P42A 5IP4D 1CK1A 1H8CA 3AN1A 1TKGA 2NR2A 3ZXVA 1H4RA 4B9KA 2KWDA 4H2AA 2A5UA 4K7SA 4DXFA 2WU5B 1HXYD 1SE2A 4EFOA 4GU2A 4I6LB 3SDLC 1WRDB 2QJLA 4CYEA 4FJVB 1JWAD 1GAQB 1Z5SB 2FCSA 2BKRB 3OG5A 4MGYE 4XYCA 2NCNA 2W9NA 2D3GA 1UWMA 2G3QB 2FIDA 4MM3A 1J0GA 4ZDVA 3QJZA 1TJEA 3B1LX 2SAKA 3TEXA 2ZPNA 1ACCA 4JX1C 4IM2A 1UBQA 2MJEA 1I4QA 2REXA 1HZ5A 3N1ZC 1PUTA 1F1HA 3E56A 3RI7C 4JL9A 4NZLB 3OJ4B 4L23A 2C7MB 1R4MI 1C4PA 1Q1OA 3PZ7A 2AL3A 2INDC 1XLOA 2E3TA 1GC7A 3CF6E 1NDDA 1KM7A 3PLUA 1YMHE 5IO9A 1HQRD 4P6VF 2MJDA 4ARCA 4FADA 5BMHA 1N60A 3Q8CA 4ZRQA 3DBHB 3AH7A 4WJPA 2MBBB 5E6JA 2WGSA 4HKQA 4W9FA 3AEGB 3JW0X 4M0WB 1IPGA 2KXJA 1T5XD 4LNOA 3U7ZA 2KTFA 3VTWA 3RULA 3TEYA 2DYBA 2I38A 2BYEA 1WX7A 5CX3A 2DBYA 3TIXA 1C4CA 4MT5A 1WJ4A 2KQ4X 4HRSA 3GZNB 4KVGB 2KWVB 4OVVA 1K52A 2D5GA 5D3DA 2VH1A 2GBRA 4II3B 2PVOD 2LEKA 1FNUA 3HVDA 3WIMA 3A4SC 4KX6B 4F7ZA 1PGAA 4MACA 4IG7B 4CHKA 2K8CA 2BS4B 4BZAA 2HTME 4LDTB 5EDSA 5AZGA 2ZCCA 3AB5A 1UZXB 2RDGA 1T0YA 3MP9A 5LXHA 3GE8C 1WYWB 1YD8U 1E8ZA 3U4EG 4A20A 2LD9A 3ZO5B 3AE1B 3RPFC 3T3NA 2UU7A 1UH6A 1HE8A 4HPPA 2LWPA 3KUCB 2RD0A 5BYRA 3ZUNA 3IAM1 1E10A 3M95A 5L83A 1QZEA 2QIEB 3P1MA 4K81A 3NOBA 1F77A 1SBBB 4KGTA 2H88B 1YJJA 1TS5A 1UGJA 1IGCA 3PS6A 2PE9A 2JRIB 2KHWB 3VR8B 2GBMA 2KX3A 4WJQA 1T0RC 2BVCA 2KJRA 4CQNA 4LLGM 3E9SA 1WGGA 3QARA 3TJPA 3V60A 3ZRCA 5HKHA 2KACA 1VJKA 4W9JA 2WS3B 5D2MB 2KTRB 1UNSA 1V81A 4MH0E 3DBLI 2LGYA 2R2OA 1EU4A 3AI5A 3AECB 4HLEA 1SJED 1HA5A 4TQ0A 4OZCA 2KN4A 2IJ0A 2KC1A 1ZP0B 2BYVE 5KHOA 1FIQA 4M00A 2C7HA 1ZDVA 3NZSA 1I35A 2INCC 1WFYA 5C2TB 5FKAC 4EZLA 2IO2B 1LXDA 1P0RA 2NMQA 2O6VB 3PRZA 3ZKJC 4FULA 2G9HD 3VH4B 1BUIC 1J19A 2DZIA 2SEBD 1CJEA 2CR5A 2NVUI 4LTUA 5IN7A 3KW5B 4WJOA 3VRAB 3TEWA 1WRIA 2BT6A 2DAFA 1RLFA 4Q2JA 1T3QA 1LQBA 3VXWA 3R7QA 3FC4A 4MSQB 1KLUD 2BWFA 4KSKC 2MJ3A 2LRUA 3MC9A 2KK8A 4YTNB 2W54A 3RMKC 3RT3B 2KZRA 4K1RB 1ET6A 2K25A 2K6DB 2N9LA 3ZNID 2I1KA 2DAJA 3SD5A 3IVFA 2XK5B 2LXAA 4YWGG 2OOBB 3PO0A 4J3OD 1MI0A 3DHIC 4YTMB 3R2IA 3AE7B 4DHJD 5H8YE 2FCNA 3RYTA 1PYWD 4NJ7A 3QA8A 3O65B 4GGQA 2ZPYA 1V9JA 4E71A 3ZIMA 3H9DA 2X8XX 2KLGA 4OZAA 3EECA 2BW2A 1V86A 4JWSC 4FLHA 3H8HA 5DPSA 4GLSC 4R3DA 2EKIA 5GXGB 5I4DA 2N7JA 3OLMD 2O2VB 1NBFC 3L0WB 1SE9A 1WX9A 1I42A 2D11A 4KIKB 1SJHD 4FHKA 4XWWA 1FFUA 2NBWB 4LNNA 1EF5A 3W5UB 1ZPSA 4RGNA 3W1SA 5G5GA 3VUXA 2MBQA 4A55A 2WDVB 2N7DA 3DHGC 3RN9C 5JH5C 4YSZB 3ZJTA 2G1EA 2LUMA 2MW5A 2V4LA 1OEYA 2RGFA 2WNMA 3NHEB 1XXGA 3W9CB 1KJTA 4G3XB 2LVQA 4C4VA 4N58A 2Z59B 2DNFA 1G6JA 2L05A 1JCKB 2Z8LA 5TSSA 4PS7A 3GB1A 4QAYA 3P63A 1BMLC 2G45B 3BZDB 4FHJA 1WMHA 1MFWA 2BB6A 4I6NB 1WXQA 2BB5A 1YX6B 2KDIA 5AZHA 2JYEA 4DWFA 1V49A 2N9PC 1GOZA 2LGSA 2N9XA 1F9JA 4NAMA 1OQQA 1VRAB 1QOAA 2L0TA 1L5PA 3V6EB 2L83A 3CSFA 5JXVA 4I6PA 4HVBA 5AEKB 1NYQA 5GMVA 2INNE 4ASWC 2EKEC 4XGAB 2CJOA 2JXTA 1JWMD 1K51A 2K8HA 4C4VB 2IY1B 2K3UA 1RWSA 4FJYA 3IBEA 3RNGC 2IGHA 3P4PB 4B95A 4F1SA 2IGGA 2KANA 2JSVX 3UI3A 2ONQA 2WX1A 2JZ3B 1T0QC 4GDKA 3K9OB 4RFBA 3MC8A 3UIPB 4US8A 2HTHA 1XF5L 2NPTB 1IBXA 3H7PA 2Y5CA 4WURA 2XNAC 2V9HA 3KWVA 3PRMB 1V5TA 1A70A 3RNFC 1JQ4A 4IKGA 1PQSA 1TS2A 3TBLD 4RCOA 2D2QA 3VTVA 2PKOA 4TKNA 3ZRFA 1YIWA 1RFKA 3V05A 3PVLA 3L10B 1TY2A 4FN2A 5AUIA 2JYTA 3AE3B 2KJHB 4FBJB 5FR3A 2KT7A 1OQYA 3PV1A 1F2RC 5D6JB 2KO3A 1VZ8A 3A9JA 1Q0WB 1RYJA 1AWDA 1XQQA 1CMXB 3NVWA 3FAHA 3ENEA 2M0XA 3H1UA 3T9LA 1T0SC 2A4ZA 3N1YC 1RAXA 1QOBA 1FNWA 2IYDB 2L76A 3AM9A 2M8SA 2PMVA 2NS5A 4A6QA 1ZOYB 2KOXA 4AJWA 4IM3A 3CIRB 1J7CA 3A1QB 1C9FA 1D3ZA 4IOIE 1A5RA 5HG2A 2FCQA 2KN5A 2M1MA 3IAS1 1N5WA 2JX5A 4WAAA 2V3SA 2OHFA 4DBGA 3EFCA 3ZLZA 2W82A 2RDBC 1AN8A 2ASQA 4YSYB 4ICVA 4GN1A 3AULA 2R61A 2V3PA 3D32A 1E8WA 4WAFA 2MWSB 1HTOA 1LFDA 4DDGD 5J2RA 3ZTDA 1WR6E 2BPSA 2PPHA 2LFIA 4PYZA 3DWGC 5CHFA 2J53A 5FR6A 1C76A 3L54A 4N6EB 2LZ6A 2W3SA 1UUPA 1WJUA 1MVKA 5L95C 3Q2AC 3I63C 1HEZE 1OFFA 2HD5B 3ZTCA 4JLCA 3DBRB 4JQWC 3RNBC 1JWSD 4B0MA 3NVVA 1GUAB 5EE0A 2BKFA 4L2YA 3RNEC 3IT4B 2MP2A 1WXSA 1E0ZA 4L1BA 4O1NA 4XC2A 5E6NA 1XEEA 5C23A 3AEBB 1X1MA 1WJNA 3KUDB 1Q5WB 2WWZA 2L1AA 2KQSA 4NY0A 3KYDD 1WGHA 2GBNA 3N9YC 4RGOS 1LO5D 2CU3A 4IDIA 4BKTA 2LRWA 2FE8A 4C7YA 2J0JA 2K9XA 4RF1A 1E8YA 2L8JA 1C3TA 3X23A 3JYUA 3AV8A 3OAWA 3QC8B 2MBHA 1J7AA
chains in the Genus database with same CATH topology
3H7PB 5JHAA 1V81A 4MH0E 3DBLI 4BKSA 1E90A 2LGYA 2IZVB 1RFAA 5CHWA 3IHPC 5C1ZA 4ZRIA 2R2OA 3UQAA 1OGWA 3AU4A 3SHQA 4IWOA 4BKGA 1WR1A 2NBUA 3AI5A 4HLEA 2I1JA 2PE6B 4ICUA 3PRPB 1TBEA 5E6PA 4TQ0A 1GG3A 2XBBC 1P9DU 3M62B 2KJ6A 2UWQA 1WXAA 2KC1A 3W1SC 2BYVE 3OJ3A 4JGHB 4KDLB 5KHOA 2AWTA 1L7YA 2C7HA 3ML8A 5J17A 4WWOA 5DPTA 3NZSA 4FA6A 5E6OA 1I35A 3DVGX 2C5LC 3IG3A 1WFYA 4EZLA 1Y8RC 2IO2B 2NBVB 4JIOU 4NQLB 1LXDA 1P0RA 2IO1B 3HM3A 2O6VB 4GB9A 2CHXA 4ZRKA 3PRZA 4NNJB 3WA0A 3ZKJC 2K39A 1KLVA 4FULA 3DBHI 4IWPA 1E7UA 2GBJA 2N4FA 4J6IA 4XZ4A 2M4NA 1J19A 3VH4B 2DZIA 5J18A 2KDFB 1ISNA 3NY5A 2CR5A 5G2NA 2NVUI 3R3MA 4HDOA 1TTNA 2PEAA 4MJSB 3KW5B 4WJOA 3U8ZA 3A9JB 4ANUA 4II2B 3VDZA 1K8RB 2DAFA 3EFUA 2JXXA 1S3SG 3X0WA 1RLFA 1XD3B 2MX2A 3R66C 1WZ3A 2KDBA 1LQBA 3VXWA 1LM8B 3R7QA 1FXTB 4W9LA 1L2NA 3JSVB 2BWES 2JWZA 2NPTA 2KD0A 1WGRA 4LDTD 4MSQB 2BWFA 4HWIB 4EZJA 3GZNI 4KSKC 1AARA 1WH3A 1JRUA 2LRUA 2GBKA 2ZJDA 1S1QB 2XEWA 4FJZA 2KK8A 4IUMB 1NI2A 2DYMA 4K7WA 5D94A 2UYZB 2C7NB 1WF9A 5CHVC 5G55A 4E3CA 2MSED 2LUEA 2C60A 2KMAA 3WAMA 3RT3B 2KZRA 4K1RB 4CO7A 4KSLC 2K25A 1E8XA 3NS8A 3VH3B 2K6DB 1SGHA 3ZNID 2KQ7A 4BFRA 2I1KA 2DAJA 3Q3JA 3SD5A 4DHZE 3IVFA 2XK5B 1IP9A 1R4NI 2LXAA 2MCNB 4DDID 2KWUB 3AXCA 4HDQA 4RMAA 3UF8A 2OOBB 3U30A 1ZGUB 3APFA 3N3KB 2DHZA 2JF5A 3ZNZB 1V80A 2N9EB 3MHSD 1GNUA 4GXBA 2YVCA 4EOYA 1VD2A 4W9GA 5IA7A 3RUIB 1EO6A 2DZMA 4DHJD 2L7RA 2FCNA 1C1YB 3RYTA 4NJ7A 3QX1A 1WZ0A 3NZUA 2CKHB 3BINA 2V1YA 3QA8A 3O65B 2ZNVB 3AU5A 3DBRI 3DBSA 4GGQA 1WX8A 2ZPYA 4NJ6A 4PS3A 4A3OA 1V9JA 3DPDA 4LJOB 4PS8A 4ZRJA 3UIOB 4E71A 1RRBA 1WJ6A 4WJNA 3ZIMA 3H9DA 2N1WA 3DVNV 4HPLB 4AJYB 2BGFA 3I3TB 2KLGA 2MA9B 4W9EA 4BBNF 2IBIB 2G4SA 3EECA 3WALA 1UBIA 3L13A 1V86A 4XX5A 4FLHA 4G11A 4W9CA 2JT4B 5DPSA 3N32A 3S2AA 2DZKA 2MBEA 2AEHA 3H7SA 2L00B 3OLMD 3LDZE 4IM0A 2O2VB 3A1QA 2LASA 2J0MA 1NBFC 2IY0B 3L0WB 1SE9A 2JPHA 1WX9A 3PT2B 3QCAA 4MGKE 3V61A 2CHWA 2PJHA 1I42A 4DK5A 2D11A 4KDIC 4KIKB 4TUUA 4AUQC 1KOTA 4IW0A 2JVCA 4FHKA 4MSMB 3K9PB 2MP2B 2NBWB 3KUZA 4MELA 4X57B 1EF5A 4MDKE 4EEWA 5BO4B 3W1SA 3VUXA 2MBQA 5JZEB 4URKA 2N7DA 3BY4B 3QQ8B 3ONSA 5JH5C 3KVFB 3WAOA 2MW5A 2V4LA 2VRRB 1OEYA 2K1FA 3PHXB 3C0RB 2RGFA 3NHEB 2N7EA 3DQVA 2QHOA 3QAQA 2O6VD 3V62A 1KJTA 2DYOA 4G3XB 2LVQA 3VTUA 3T8MA 2Z59B 3PPAA 1WE6A 3L17A 1G6JA 2BYFA 4KV2A 2D10A 2L05A 4PS7A 3A9KB 2LI5A 2KLCA 2G45B 2IO3B 2K8BA 2KFKA 4FHJA 1WMHA 2WX0A 4I6NB 3ZW3A 2JRHA 1YX6B 4GSWA 2KDIA 2Z0DB 2JZZA 5LXIB 1WXVA 5AZHA 3TCAA 1IYFA 3L16A 4DWFA 4WQOB 4DHZB 1V49A 2N9PC 2HE7A 2L3ZA 2N9XA 1F9JA 3APDA 1TZ1A 1OEYJ 2J0KA 3VFKA 3R7RA 2YLMA 3WAPA 1M94A 2L0TA 4NPNA 3ECIA 4GOCA 5DCNA 2LGXA 3V6EB 2DX5B 3H6NA 3CSFA 3ALBA 3PLVA 4I6PA 3ZNGC 2HJ8A 1U4AA 4HVBA 5LLIA 5AEKB 5GMVA 5DPWA 4ASWC 4LJPB 2EKEC 3DVGY 4K7UA 3PGEA 4P7IA 2Z0EB 4G50A 2FIFA 3VHTC 3M63B 1XT9B 2B3AA 2K8HA 4YL8A 1WM2A 2KX0A 2IY1B 4FJYA 1H8CA 3IBEA 2NR2A 5D7GA 1H4RA 4B9KA 4G0NB 2ZNVC 4B95A 1VCBA 2A5UA 2KFKB 2ZVOA 4K7SA 4F1SA 2KANA 1P3QU 4TQ1A 4EFOA 4NQKE 2WX1A 2JZ3B 4GU2A 4W9KA 4I6LB 3SDLC 3Q3FA 1WRDB 1GC6A 4CYEA 3P2BA 2CHZA 4FJVB 4GDKA 3K9OB 4MEMA 3VUWA 4BOZB 2KNBA 1Z5SB 3UIPB 2FCSA 2HTHA 2BKRB 3KH0A 4MGYE 2NPTB 2NCNA 2ZCBA 2W9NA 2D3GA 2KTRA 4DXAB 3H7PA 4HXDA 2G3QB 3B08A 2FIDA 3GOEA 4MM3A 1J0GA 4ZDVA 2DENB 2MRPA 3QJZA 4IC7B 3B1LX 1ZW7A 2ZPNA 3PREA 3PRMB 1V5TA 4IM2A 1UBQA 2MBOA 5KHQA 3HM6X 2WDTB 2REXA 1WGYA 1PQSA 3A33B 2FCMA 1WE7A 1WM3A 4HPMB 3TBLD 2JY6A 2K6QA 2D2QA 3VTVA 3ZVVA 3L08A 4JL9A 3ML9A 4TKNA 3OJ4B 4A3PA 3VAWA 2C7MB 1R4MI 1YIWA 4ZYNA 3ZRFA 1UELA 3PVLA 3W1YA 4ANXA 3L10B 3PHWB 3SU8X 1Q1OA 2O6VA 4FN2A 2FAZA 2AL3A 2RPQA 2IO0B 1WGDA 2KJHB 4FBJB 1GC7A 3EC8A 4AWJA 1WY8A 3QHTA 2D07B 3VQIA 3M3JA 1OQYA 3PV1A 5D6JB 2Y5BB 2KO3A 3CF6E 4NAWA 4W9DA 5AZFA 4TV3A 3TMPB 2FUHB 4M8NA 1NDDA 2EMTA 4MJSA 4WWNA 1KM7A 3A9JA 1V6EA 3PLUA 2LXCA 2RSUA 2ZZPB 1Q0WB 3B0AA 3ZDTA 4ANVA 1XQQA 1CMXB 1EUVB 3UQBA 4W9IA 4RM9A 4MGIE 3TL5A 4HJKA 3ENEA 2M0XA 3H1UA 5IAAC 3T9LA 4FADA 2A4ZA 2OJRA 1RAXA 1BT0A 2G4DB 3JSVA 2IYDB 2L76A 1E5WA 1WXMA 4GMVA 3RD2A 2ZVNA 2M8SA 4WJPA 2NS5A 4M8MA 2MBBB 2KOXA 4AJWA 2KC2A 1E7VA 4IM3A 3EHVA 4BKSD 3A1QB 3DDCB 3RCZA 3DOWA 4W9FA 3JW0X 1D3ZA 4M0WB 1UGMA 1A5RA 1IPGA 2KXJA 4GDLA 2KTFA 1UD7A 2FCQA 3VTWA 2KN5A 2N1VA 3RULA 2KKCA 3CSTA 2M1MA 2DYBA 5TR5A 2BYEA 5CTRC 1EF1A 1WX7A 2XK5A 5CX3A 4WAAA 3TIXA 2V3SA 2LVPA 3DCGA 4DBGA 1WJ4A 4HCNB 4W9HA 4KZ0A 3ZLZA 1OTRB 4NAWB 4KVGB 2KWVB 2ASQA 4OVVA 3CMMB 2GMIC 4ICVA 2KVRA 3HK0A 3HHMA 4GN1A 3AULA 1MG8A 3PZDA 2CS4A 2GBRA 3D32A 1E8WA 4II3B 2MWSB 1LFDA 2MLBA 4WWPA 4EKUA 4DDGD 5J2RA 3ZTDA 1WR6E 2BPSA 3WIMA 3A4SC 2EMSA 2PPHA 4F7ZA 2LJ5A 3JVZX 1YX5B 3VUYA 2MQJA 4IG7B 2K8CA 4PYZA 4CHKA 4BVUC 4LDTB 5EDSA 5AZGA 2ZCCA 5CHFA 5FR6A 3ZNHB 5JHBA 1UZXB 2J7QB 1YJ1A 4LCDE 1GJZA 1T0YA 1SIFA 1WMHB 5LXHA 1WYWB 1YD8U 2KWCA 3L54A 1E8ZA 2LZ6A 2LD9A 2WYQA 3UGBB 4A20A 2R2QA 4HK2A 3QK0A 3A4RA 3ZO5B 4GDLB 1WJUA 5DPRA 3IFWB 4KZCA 5L95C 3V6CB 1UH6A 2BF8B 2HD5B 1HE8A 3N30A 2LWPA 2RR9A 3KUCB 3MJWA 2RD0A 4EUTA 4GIVA 2FNJB 4PYUA 2DZJA 3KYCD 3WANA 3ZUNA 4JLCA 2O2VA 3M95A 1TGZB 3ZTCA 4JQWC 3RZFA 5L83A 1QZEA 3APCA 3MTNB 4E74A 4K81A 4BOSC 1GUAB 3NOBA 4KIKA 1ZKHA 4OVUA 3VVWB 3DVNU 2BKFA 3QIJA 2KMCA 1V2YA 3PSEB 2L0FA 4B6WA 1P1AA 1WXSA 2JUOA 2MP2A 4N9F4 3PS6A 2KFJA 4XC2A 2C9WB 2PE9A 5E6NA 2JRIB 2LVOA 5C23A 1V5OA 2KHWB 2GBMA 3QWZB 1X1MA 2CU1A 4MGZE 3U7DA 1WJNA 2KX3A 3KUDB 4IWQA 1Q5WB 2WWZA 4DHJB 2KDEB 2AL6A 1J8CA 1Z2MA 4EZKA 4RM8A 4WJQA 2KQSA 3UINB 4AP4C 4ANWA 1YQBA 4NY0A 3KYDD 2KJRA 2GOWA 1WGHA 2GBNA 1P98A 2M17A 2ZEQA 3PTFC 3LJ3A 4BKTA 3ZDMC 2LRWA 3RZWC 1WGGA 2J0JA 3QARA 3TJPA 1E8YA 3V60A 2L8JA 1C3TA 1WI0A 3X23A 4GDKB 3JYUA 3ZRCA 4F8CB 3A9KA 5HKHA 2LGDA 3OAWA 3QC8B 2MBHA 4HCPB 4BBNC 1WIAA 2AYOB 4AOFA 3HIZA 4W9JA 5D2MB 2KTRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H7P B;  5JHA A;  1V81 A;  4MH0 E;  3DBL I;  4BKS A;  1E90 A;  2LGY A;  2IZV B;  1RFA A;  5CHW A;  3IHP C;  5C1Z A;  4ZRI A;  2R2O A;  3UQA A;  1OGW A;  3AU4 A;  3SHQ A;  4IWO A;  4BKG A;  1WR1 A;  2NBU A;  3AI5 A;  4HLE A;  2I1J A;  2PE6 B;  4ICU A;  3PRP B;  1TBE A;  5E6P A;  4TQ0 A;  1GG3 A;  2XBB C;  1P9D U;  3M62 B;  2KJ6 A;  2UWQ A;  1WXA A;  2KC1 A;  3W1S C;  2BYV E;  3OJ3 A;  4JGH B;  4KDL B;  5KHO A;  2AWT A;  1L7Y A;  2C7H A;  3ML8 A;  5J17 A;  4WWO A;  5DPT A;  3NZS A;  4FA6 A;  5E6O A;  1I35 A;  3DVG X;  2C5L C;  3IG3 A;  1WFY A;  4EZL A;  1Y8R C;  2IO2 B;  2NBV B;  4JIO U;  4NQL B;  1LXD A;  1P0R A;  2IO1 B;  3HM3 A;  2O6V B;  4GB9 A;  2CHX A;  4ZRK A;  3PRZ A;  4NNJ B;  3WA0 A;  3ZKJ C;  2K39 A;  1KLV A;  4FUL A;  3DBH I;  4IWP A;  1E7U A;  2GBJ A;  2N4F A;  4J6I A;  4XZ4 A;  2M4N A;  1J19 A;  3VH4 B;  2DZI A;  5J18 A;  2KDF B;  1ISN A;  3NY5 A;  2CR5 A;  5G2N A;  2NVU I;  3R3M A;  4HDO A;  1TTN A;  2PEA A;  4MJS B;  3KW5 B;  4WJO A;  3U8Z A;  3A9J B;  4ANU A;  4II2 B;  3VDZ A;  1K8R B;  2DAF A;  3EFU A;  2JXX A;  1S3S G;  3X0W A;  1RLF A;  1XD3 B;  2MX2 A;  3R66 C;  1WZ3 A;  2KDB A;  1LQB A;  3VXW A;  1LM8 B;  3R7Q A;  1FXT B;  4W9L A;  1L2N A;  3JSV B;  2BWE S;  2JWZ A;  2NPT A;  2KD0 A;  1WGR A;  4LDT D;  4MSQ B;  2BWF A;  4HWI B;  4EZJ A;  3GZN I;  4KSK C;  1AAR A;  1WH3 A;  1JRU A;  2LRU A;  2GBK A;  2ZJD A;  1S1Q B;  2XEW A;  4FJZ A;  2KK8 A;  4IUM B;  1NI2 A;  2DYM A;  4K7W A;  5D94 A;  2UYZ B;  2C7N B;  1WF9 A;  5CHV C;  5G55 A;  4E3C A;  2MSE D;  2LUE A;  2C60 A;  2KMA A;  3WAM A;  3RT3 B;  2KZR A;  4K1R B;  4CO7 A;  4KSL C;  2K25 A;  1E8X A;  3NS8 A;  3VH3 B;  2K6D B;  1SGH A;  3ZNI D;  2KQ7 A;  4BFR A;  2I1K A;  2DAJ A;  3Q3J A;  3SD5 A;  4DHZ E;  3IVF A;  2XK5 B;  1IP9 A;  1R4N I;  2LXA A;  2MCN B;  4DDI D;  2KWU B;  3AXC A;  4HDQ A;  4RMA A;  3UF8 A;  2OOB B;  3U30 A;  1ZGU B;  3APF A;  3N3K B;  2DHZ A;  2JF5 A;  3ZNZ B;  1V80 A;  2N9E B;  3MHS D;  1GNU A;  4GXB A;  2YVC A;  4EOY A;  1VD2 A;  4W9G A;  5IA7 A;  3RUI B;  1EO6 A;  2DZM A;  4DHJ D;  2L7R A;  2FCN A;  1C1Y B;  3RYT A;  4NJ7 A;  3QX1 A;  1WZ0 A;  3NZU A;  2CKH B;  3BIN A;  2V1Y A;  3QA8 A;  3O65 B;  2ZNV B;  3AU5 A;  3DBR I;  3DBS A;  4GGQ A;  1WX8 A;  2ZPY A;  4NJ6 A;  4PS3 A;  4A3O A;  1V9J A;  3DPD A;  4LJO B;  4PS8 A;  4ZRJ A;  3UIO B;  4E71 A;  1RRB A;  1WJ6 A;  4WJN A;  3ZIM A;  3H9D A;  2N1W A;  3DVN V;  4HPL B;  4AJY B;  2BGF A;  3I3T B;  2KLG A;  2MA9 B;  4W9E A;  4BBN F;  2IBI B;  2G4S A;  3EEC A;  3WAL A;  1UBI A;  3L13 A;  1V86 A;  4XX5 A;  4FLH A;  4G11 A;  4W9C A;  2JT4 B;  5DPS A;  3N32 A;  3S2A A;  2DZK A;  2MBE A;  2AEH A;  3H7S A;  2L00 B;  3OLM D;  3LDZ E;  4IM0 A;  2O2V B;  3A1Q A;  2LAS A;  2J0M A;  1NBF C;  2IY0 B;  3L0W B;  1SE9 A;  2JPH A;  1WX9 A;  3PT2 B;  3QCA A;  4MGK E;  3V61 A;  2CHW A;  2PJH A;  1I42 A;  4DK5 A;  2D11 A;  4KDI C;  4KIK B;  4TUU A;  4AUQ C;  1KOT A;  4IW0 A;  2JVC A;  4FHK A;  4MSM B;  3K9P B;  2MP2 B;  2NBW B;  3KUZ A;  4MEL A;  4X57 B;  1EF5 A;  4MDK E;  4EEW A;  5BO4 B;  3W1S A;  3VUX A;  2MBQ A;  5JZE B;  4URK A;  2N7D A;  3BY4 B;  3QQ8 B;  3ONS A;  5JH5 C;  3KVF B;  3WAO A;  2MW5 A;  2V4L A;  2VRR B;  1OEY A;  2K1F A;  3PHX B;  3C0R B;  2RGF A;  3NHE B;  2N7E A;  3DQV A;  2QHO A;  3QAQ A;  2O6V D;  3V62 A;  1KJT A;  2DYO A;  4G3X B;  2LVQ A;  3VTU A;  3T8M A;  2Z59 B;  3PPA A;  1WE6 A;  3L17 A;  1G6J A;  2BYF A;  4KV2 A;  2D10 A;  2L05 A;  4PS7 A;  3A9K B;  2LI5 A;  2KLC A;  2G45 B;  2IO3 B;  2K8B A;  2KFK A;  4FHJ A;  1WMH A;  2WX0 A;  4I6N B;  3ZW3 A;  2JRH A;  1YX6 B;  4GSW A;  2KDI A;  2Z0D B;  2JZZ A;  5LXI B;  1WXV A;  5AZH A;  3TCA A;  1IYF A;  3L16 A;  4DWF A;  4WQO B;  4DHZ B;  1V49 A;  2N9P C;  2HE7 A;  2L3Z A;  2N9X A;  1F9J A;  3APD A;  1TZ1 A;  1OEY J;  2J0K A;  3VFK A;  3R7R A;  2YLM A;  3WAP A;  1M94 A;  2L0T A;  4NPN A;  3ECI A;  4GOC A;  5DCN A;  2LGX A;  3V6E B;  2DX5 B;  3H6N A;  3CSF A;  3ALB A;  3PLV A;  4I6P A;  3ZNG C;  2HJ8 A;  1U4A A;  4HVB A;  5LLI A;  5AEK B;  5GMV A;  5DPW A;  4ASW C;  4LJP B;  2EKE C;  3DVG Y;  4K7U A;  3PGE A;  4P7I A;  2Z0E B;  4G50 A;  2FIF A;  3VHT C;  3M63 B;  1XT9 B;  2B3A A;  2K8H A;  4YL8 A;  1WM2 A;  2KX0 A;  2IY1 B;  4FJY A;  1H8C A;  3IBE A;  2NR2 A;  5D7G A;  1H4R A;  4B9K A;  4G0N B;  2ZNV C;  4B95 A;  1VCB A;  2A5U A;  2KFK B;  2ZVO A;  4K7S A;  4F1S A;  2KAN A;  1P3Q U;  4TQ1 A;  4EFO A;  4NQK E;  2WX1 A;  2JZ3 B;  4GU2 A;  4W9K A;  4I6L B;  3SDL C;  3Q3F A;  1WRD B;  1GC6 A;  4CYE A;  3P2B A;  2CHZ A;  4FJV B;  4GDK A;  3K9O B;  4MEM A;  3VUW A;  4BOZ B;  2KNB A;  1Z5S B;  3UIP B;  2FCS A;  2HTH A;  2BKR B;  3KH0 A;  4MGY E;  2NPT B;  2NCN A;  2ZCB A;  2W9N A;  2D3G A;  2KTR A;  4DXA B;  3H7P A;  4HXD A;  2G3Q B;  3B08 A;  2FID A;  3GOE A;  4MM3 A;  1J0G A;  4ZDV A;  2DEN B;  2MRP A;  3QJZ A;  4IC7 B;  3B1L X;  1ZW7 A;  2ZPN A;  3PRE A;  3PRM B;  1V5T A;  4IM2 A;  1UBQ A;  2MBO A;  5KHQ A;  3HM6 X;  2WDT B;  2REX A;  1WGY A;  1PQS A;  3A33 B;  2FCM A;  1WE7 A;  1WM3 A;  4HPM B;  3TBL D;  2JY6 A;  2K6Q A;  2D2Q A;  3VTV A;  3ZVV A;  3L08 A;  4JL9 A;  3ML9 A;  4TKN A;  3OJ4 B;  4A3P A;  3VAW A;  2C7M B;  1R4M I;  1YIW A;  4ZYN A;  3ZRF A;  1UEL A;  3PVL A;  3W1Y A;  4ANX A;  3L10 B;  3PHW B;  3SU8 X;  1Q1O A;  2O6V A;  4FN2 A;  2FAZ A;  2AL3 A;  2RPQ A;  2IO0 B;  1WGD A;  2KJH B;  4FBJ B;  1GC7 A;  3EC8 A;  4AWJ A;  1WY8 A;  3QHT A;  2D07 B;  3VQI A;  3M3J A;  1OQY A;  3PV1 A;  5D6J B;  2Y5B B;  2KO3 A;  3CF6 E;  4NAW A;  4W9D A;  5AZF A;  4TV3 A;  3TMP B;  2FUH B;  4M8N A;  1NDD A;  2EMT A;  4MJS A;  4WWN A;  1KM7 A;  3A9J A;  1V6E A;  3PLU A;  2LXC A;  2RSU A;  2ZZP B;  1Q0W B;  3B0A A;  3ZDT A;  4ANV A;  1XQQ A;  1CMX B;  1EUV B;  3UQB A;  4W9I A;  4RM9 A;  4MGI E;  3TL5 A;  4HJK A;  3ENE A;  2M0X A;  3H1U A;  5IAA C;  3T9L A;  4FAD A;  2A4Z A;  2OJR A;  1RAX A;  1BT0 A;  2G4D B;  3JSV A;  2IYD B;  2L76 A;  1E5W A;  1WXM A;  4GMV A;  3RD2 A;  2ZVN A;  2M8S A;  4WJP A;  2NS5 A;  4M8M A;  2MBB B;  2KOX A;  4AJW A;  2KC2 A;  1E7V A;  4IM3 A;  3EHV A;  4BKS D;  3A1Q B;  3DDC B;  3RCZ A;  3DOW A;  4W9F A;  3JW0 X;  1D3Z A;  4M0W B;  1UGM A;  1A5R A;  1IPG A;  2KXJ A;  4GDL A;  2KTF A;  1UD7 A;  2FCQ A;  3VTW A;  2KN5 A;  2N1V A;  3RUL A;  2KKC A;  3CST A;  2M1M A;  2DYB A;  5TR5 A;  2BYE A;  5CTR C;  1EF1 A;  1WX7 A;  2XK5 A;  5CX3 A;  4WAA A;  3TIX A;  2V3S A;  2LVP A;  3DCG A;  4DBG A;  1WJ4 A;  4HCN B;  4W9H A;  4KZ0 A;  3ZLZ A;  1OTR B;  4NAW B;  4KVG B;  2KWV B;  2ASQ A;  4OVV A;  3CMM B;  2GMI C;  4ICV A;  2KVR A;  3HK0 A;  3HHM A;  4GN1 A;  3AUL A;  1MG8 A;  3PZD A;  2CS4 A;  2GBR A;  3D32 A;  1E8W A;  4II3 B;  2MWS B;  1LFD A;  2MLB A;  4WWP A;  4EKU A;  4DDG D;  5J2R A;  3ZTD A;  1WR6 E;  2BPS A;  3WIM A;  3A4S C;  2EMS A;  2PPH A;  4F7Z A;  2LJ5 A;  3JVZ X;  1YX5 B;  3VUY A;  2MQJ A;  4IG7 B;  2K8C A;  4PYZ A;  4CHK A;  4BVU C;  4LDT B;  5EDS A;  5AZG A;  2ZCC A;  5CHF A;  5FR6 A;  3ZNH B;  5JHB A;  1UZX B;  2J7Q B;  1YJ1 A;  4LCD E;  1GJZ A;  1T0Y A;  1SIF A;  1WMH B;  5LXH A;  1WYW B;  1YD8 U;  2KWC A;  3L54 A;  1E8Z A;  2LZ6 A;  2LD9 A;  2WYQ A;  3UGB B;  4A20 A;  2R2Q A;  4HK2 A;  3QK0 A;  3A4R A;  3ZO5 B;  4GDL B;  1WJU A;  5DPR A;  3IFW B;  4KZC A;  5L95 C;  3V6C B;  1UH6 A;  2BF8 B;  2HD5 B;  1HE8 A;  3N30 A;  2LWP A;  2RR9 A;  3KUC B;  3MJW A;  2RD0 A;  4EUT A;  4GIV A;  2FNJ B;  4PYU A;  2DZJ A;  3KYC D;  3WAN A;  3ZUN A;  4JLC A;  2O2V A;  3M95 A;  1TGZ B;  3ZTC A;  4JQW C;  3RZF A;  5L83 A;  1QZE A;  3APC A;  3MTN B;  4E74 A;  4K81 A;  4BOS C;  1GUA B;  3NOB A;  4KIK A;  1ZKH A;  4OVU A;  3VVW B;  3DVN U;  2BKF A;  3QIJ A;  2KMC A;  1V2Y A;  3PSE B;  2L0F A;  4B6W A;  1P1A A;  1WXS A;  2JUO A;  2MP2 A;  4N9F 4;  3PS6 A;  2KFJ A;  4XC2 A;  2C9W B;  2PE9 A;  5E6N A;  2JRI B;  2LVO A;  5C23 A;  1V5O A;  2KHW B;  2GBM A;  3QWZ B;  1X1M A;  2CU1 A;  4MGZ E;  3U7D A;  1WJN A;  2KX3 A;  3KUD B;  4IWQ A;  1Q5W B;  2WWZ A;  4DHJ B;  2KDE B;  2AL6 A;  1J8C A;  1Z2M A;  4EZK A;  4RM8 A;  4WJQ A;  2KQS A;  3UIN B;  4AP4 C;  4ANW A;  1YQB A;  4NY0 A;  3KYD D;  2KJR A;  2GOW A;  1WGH A;  2GBN A;  1P98 A;  2M17 A;  2ZEQ A;  3PTF C;  3LJ3 A;  4BKT A;  3ZDM C;  2LRW A;  3RZW C;  1WGG A;  2J0J A;  3QAR A;  3TJP A;  1E8Y A;  3V60 A;  2L8J A;  1C3T A;  1WI0 A;  3X23 A;  4GDK B;  3JYU A;  3ZRC A;  4F8C B;  3A9K A;  5HKH A;  2LGD A;  3OAW A;  3QC8 B;  2MBH A;  4HCP B;  4BBN C;  1WIA A;  2AYO B;  4AOF A;  3HIZ A;  4W9J A;  5D2M B;  2KTR B; 
#chains in the Genus database with same CATH topology
 5JHA A;  2VZK B;  4MM3 B;  5CHW A;  3MC0 B;  3DHH C;  1JRO A;  1WR1 A;  3EA6 A;  3FIL A;  1TBE A;  3J9C A;  5E6P A;  1F52 A;  2BYT A;  2XBB C;  1P9D U;  3M62 B;  1YN5 A;  3ETR A;  4JGH B;  4ZYS A;  1OQR A;  4WWO A;  5DPT A;  2KAJ A;  3AE4 B;  5E6O A;  1QT9 A;  2C5L C;  3IG3 A;  3BYT B;  2IO1 B;  3KLS X;  1E7U A;  4XZ4 A;  2M19 A;  2KDF B;  1MHH E;  2WXO A;  3R3M A;  2MHJ A;  2PEA A;  4D2K A;  4ANU A;  2W3R A;  1K8R B;  1V97 A;  5HFY A;  3EFU A;  1DOY A;  2MX2 A;  3R66 C;  1I7H A;  5D3I B;  1AYF A;  1WZ3 A;  2KDB A;  1Q10 A;  3VRB B;  1FXT B;  2BWE S;  2JWZ A;  1WGR A;  4HWI B;  1QOG A;  2D3B A;  1AAR A;  1JRU A;  1S1Q B;  4WQM A;  2DYM A;  3P4S B;  2C7N B;  1WF9 A;  1V1P A;  2MSE D;  3EGR A;  2KMA A;  3WAM A;  4CO7 A;  4KSL C;  4BFR A;  4B0E A;  4DHZ E;  1IP9 A;  1I4H A;  1J7B A;  4HDQ A;  3UF8 A;  1ZGU B;  3AE2 B;  2BTE A;  3N3K B;  2DHZ A;  3MHS D;  4MH8 A;  4GXB A;  1WGK A;  2YVC A;  2WXH A;  4OZB A;  1VD2 A;  5IA7 A;  3V3X A;  1YN4 A;  2LGI A;  1YOV B;  1B9R A;  3NZU A;  3BIN A;  2V1Y A;  1FEH A;  2ZNV B;  2IDY A;  3AU5 A;  3DBS A;  1WX8 A;  4A3O A;  4PS3 A;  3DPD A;  4ZRJ A;  3UIO B;  1WJ6 A;  4BAX A;  4HPL B;  4AJY B;  2BGF A;  2BQQ A;  3EUB 2;  3I3T B;  2QSD A;  2MA9 B;  4W9E A;  1SSN A;  4G11 A;  4W9C A;  2PW9 A;  2DZK A;  2IPK D;  1L4D B;  2AEH A;  3H7S A;  4IM0 A;  3LDZ E;  2QEJ C;  2LAS A;  1YJI A;  4C56 C;  4DQO C;  2JPH A;  4MGK E;  3GE3 C;  3SFD B;  1SE3 A;  4KDI C;  4XDD A;  4AUQ C;  5HI1 A;  1L0Y B;  4X57 B;  3ZJU A;  2EEL A;  1PDX A;  1XCQ L;  1N6Z A;  3GP7 A;  5JZE B;  3BY4 B;  3C19 A;  3KVF B;  4YT0 B;  1UWX A;  3DQV A;  2QHO A;  1FO4 A;  2DYO A;  4S17 A;  5C3J B;  4A8X C;  3PPA A;  2BYF A;  4KV2 A;  2KLC A;  2IO3 B;  2KFK A;  3NZ3 A;  2JRH A;  4GSW A;  2Z0D B;  1D6E C;  1KTK A;  3GS2 A;  3Q3O C;  1JRP A;  3APD A;  4LNK A;  3VR9 B;  2J0K A;  3IXS A;  3WAP A;  1M94 A;  4NPN A;  3ECI A;  2MH7 A;  2DX5 B;  3NJT A;  3BYY B;  3ABV B;  5LLI A;  5DPW A;  3LB8 C;  1FXI A;  2WXI A;  3DVG Y;  4K7U A;  3PGE A;  2FIF A;  3M63 B;  1XT9 B;  2KX0 A;  1N5X A;  4K3C A;  1ZDX A;  2ZNV C;  2ZVO A;  2KFK B;  2K0P A;  1KH0 A;  1P3Q U;  4NQK E;  2WXM A;  1STE A;  3Q3F A;  1GC6 A;  1TS3 A;  1JAL A;  1EU3 A;  3R2T A;  3VUW A;  3LXF A;  4TSS A;  4REZ A;  3HRD D;  4JPS A;  1NVI D;  2ZCB A;  4DXA B;  2AQ2 B;  2DEN B;  2MRP A;  1QF6 A;  1ZW7 A;  3PRE A;  1F0Z A;  2PIA A;  2MBO A;  5KHQ A;  2GLS A;  4A90 A;  1WGY A;  3A33 B;  1GB4 A;  1WM3 A;  3KQ4 A;  2K6Q A;  3L08 A;  3ML9 A;  2WXQ A;  1NYR A;  3DBL B;  1TY0 A;  1UEL A;  3W1Y A;  4ANX A;  4ITK A;  3SU8 X;  3LYY A;  1QOF A;  2FAZ A;  2RPQ A;  3NVZ A;  3URY A;  4ZHP A;  4XWT A;  4AWJ A;  5AZF A;  2Y5B B;  4TV3 A;  4YXD B;  2FUH B;  4M8N A;  4MJS A;  4ANV A;  2LJI A;  4MGI E;  4PT5 A;  3TL5 A;  4HJK A;  5IAA C;  4LNF A;  4RGM A;  5T8I A;  2QCZ A;  3JSV A;  1WXM A;  4GMV A;  5EE3 A;  2ZVN A;  1KLG D;  1KF6 B;  4M8M A;  2KC2 A;  4BKS D;  1ENF A;  3ZJV A;  3RCZ A;  2Y3A A;  1NEK B;  4GDL A;  1SB3 C;  1UD7 A;  2N1V A;  1L0V B;  2KKC A;  3BVZ A;  5TR5 A;  4M02 A;  5CTR C;  1EF1 A;  2HJ1 A;  3N1X C;  2LVP A;  3DCG A;  4OHJ A;  4HCN B;  4W9H A;  3NG0 A;  4KZ0 A;  1OTR B;  1C78 A;  3CMM B;  2GMI C;  2KVR A;  3HK0 A;  3ZQ4 A;  2JU6 X;  1MG8 A;  2CS4 A;  2MLB A;  4EKU A;  3AED B;  4WWP A;  2M0A A;  2NTS A;  1YX5 B;  3VUY A;  2MQJ A;  3L4P A;  5JHB A;  3B2G A;  1YJ1 A;  4LCD E;  1GJZ A;  1SIF A;  1C4A A;  1WMH B;  4AQ7 A;  1FRD A;  1R7S A;  2R2Q A;  4HK2 A;  4GDL B;  5DPR A;  1TKE A;  3IFW B;  1E7P B;  5BYQ A;  3RNA C;  3N30 A;  2OJW A;  4XE0 A;  2RR9 A;  4GIV A;  2FNJ B;  4PYU A;  1TGZ B;  1XLN A;  2WXR A;  3MTN B;  3AEE B;  1FFV A;  4ZOH C;  3U52 E;  4BOS C;  3WCQ A;  3VVW B;  3QIJ A;  2KMC A;  1V2Y A;  4B6W A;  1L6U A;  1P1A A;  2BS2 B;  3Q14 C;  2KFJ A;  2AQ1 B;  2C9W B;  3QWZ B;  2CU1 A;  3U7D A;  4DHJ B;  4IWQ A;  2KDE B;  2AL6 A;  1J8C A;  1JWB D;  4EZK A;  4RM8 A;  3UIN B;  1V1O A;  1YQB A;  2L32 A;  1P98 A;  5LNK 1;  1XLP A;  1KRH A;  5EE1 A;  2MEK A;  4GDK B;  4F8C B;  3A9K A;  1FCC C;  2AYO B;  3HIZ A;  1ZE3 D;  1YQ4 B;  1IBX B;  3H7P B;  1D5M C;  4BKS A;  1N63 A;  1RFA A;  2WXJ A;  1QIL A;  4ZRI A;  5C1Z A;  3UQA A;  1OGW A;  3AU4 A;  3SHQ A;  4IWO A;  4BKG A;  2NBU A;  3MHZ A;  2N9K A;  3RFZ B;  1GG3 A;  3AMZ A;  2KJ6 A;  2LMC A;  2UWQ A;  2JWU A;  2YEP B;  3W1S C;  3OJ3 A;  4KDL B;  1SEB D;  1GPX A;  4M01 A;  1I4G A;  1ZXI A;  3DVG X;  1Y8R C;  2AX5 A;  3P4R B;  4NQL B;  4ZRK A;  4NNJ B;  3NS1 A;  1XO3 A;  2K39 A;  3DBH I;  4IWP A;  2GBJ A;  2N4F A;  2JQR B;  4J6I A;  4P16 A;  1I4X A;  2PTL A;  5J18 A;  1ISN A;  3N20 C;  3A9J B;  4II2 B;  2JXX A;  1S3S G;  1DYQ A;  4W9L A;  1TYG B;  1JWU D;  4LDT D;  2KD0 A;  3U2S C;  4EZJ A;  3GZN I;  1R4N B;  2GBK A;  1VDV A;  2ZJD A;  2XEW A;  4IUM B;  5D94 A;  5CHV C;  1UF0 A;  5G55 A;  5MPO A;  1ROE A;  5BMI A;  3ZGZ A;  1E8X A;  2KQ7 A;  1DOX A;  2LHE A;  2B76 B;  2MCN B;  3W5V B;  1FRR A;  1I4R A;  2KWU B;  4DDI D;  4YSX B;  3U30 A;  3APF A;  2ZW1 A;  3ZNZ B;  2WXL A;  2N9E B;  2PVG C;  1C77 A;  1TT5 B;  4W9G A;  1T6B X;  1VR9 A;  4JWU C;  2QDF A;  4PS8 A;  1SF0 A;  1C79 A;  4AS1 A;  2N1W A;  3CWI A;  3DVN V;  3T3O A;  3Q3N C;  2I2Y A;  4BBN F;  2IBI B;  1JW9 D;  3Q69 A;  1TKY A;  2L52 A;  3N32 A;  3S2A A;  1ZXH A;  2L00 B;  4KKI A;  2IY0 B;  4M0W A;  2QMT A;  3QCA A;  3V61 A;  2PJH A;  2ACZ B;  3Q8A A;  2WXG A;  4IW0 A;  4MSM B;  1QLB B;  2MP2 B;  4KKJ A;  3KUZ A;  4MEL A;  2J52 A;  1V8C A;  3HVZ A;  4MDK E;  5BO4 B;  3Q3M C;  1EWC A;  4C80 A;  1K53 A;  4HEA 1;  1WSP A;  3WAO A;  3PHX B;  3C0R B;  1HTQ A;  2N7E A;  3QAQ A;  2O6V D;  1PGX A;  3I9V 1;  3MFG A;  1D5X C;  3VTU A;  3T8M A;  1WE6 A;  4LNI A;  2D10 A;  3Q8B A;  2K8B A;  3I5J C;  1YQ3 B;  3TSS A;  2X38 A;  5FK9 C;  1YNT E;  1P7F A;  1XCT L;  4OW0 A;  5IKC M;  1IYF A;  1MJD A;  2HE7 A;  2L3Z A;  3FIL B;  1TZ1 A;  2YLM A;  1FNV A;  4LK0 M;  5G5H A;  2WQY B;  4GOC A;  2LGX A;  2WXP A;  2JZP A;  3H6N A;  2WXF A;  3ZYY X;  3PLV A;  1U4A A;  4P7I A;  3AE6 B;  3VHT C;  4YL8 A;  1WM2 A;  1YN3 A;  3AE5 B;  1LGR A;  4HJG E;  5D7G A;  4G0N B;  4RNA A;  1VCB A;  2PLP A;  3AE9 B;  1GB1 A;  1M4V A;  4TQ1 A;  1HZ6 A;  2CJN A;  4EE2 A;  1FM0 D;  4W9K A;  3P2B A;  2CHZ A;  4MEM A;  4BOZ B;  2KNB A;  1I4P A;  2QC8 A;  3KH0 A;  4HRO A;  2WDR B;  2QIL A;  2KTR A;  2ON8 A;  1L4Z B;  4HXD A;  2HDE A;  3B08 A;  3GOE A;  4IC7 B;  1R4M B;  1MG4 A;  3R8B A;  1V1P B;  2D3C A;  5BYS A;  3BWU D;  3AE8 B;  3HM6 X;  1CZP A;  2WDT B;  2FCM A;  1WE7 A;  4HPM B;  2JY6 A;  3ZVV A;  1FMA D;  2V4I B;  1MPE A;  1QKZ A;  4A3P A;  3VAW A;  3B9J A;  4ZYN A;  3PHW B;  2O6V A;  3SR6 A;  2IO0 B;  1WGD A;  2N0S B;  3EC8 A;  1WY8 A;  3QHT A;  2D07 B;  3VQI A;  3M3J A;  1PGB A;  4NAW A;  4W9D A;  3TMP B;  2EMT A;  4WWN A;  2GRI A;  1V6E A;  3ZDT A;  2LXC A;  2RSU A;  2ZZP B;  3B0A A;  3NRZ A;  1EUV B;  1Y56 A;  3UQB A;  4W9I A;  5AUK A;  4RM9 A;  2BBC A;  1PFD A;  2OJR A;  1DGJ A;  2VH2 A;  1BT0 A;  2G4D B;  4WIP A;  1E5W A;  3FKY A;  3RD2 A;  2RDH A;  1TS4 A;  3P4Q B;  3DWM A;  1E7V A;  3EHV A;  3DDC B;  3DOW A;  3SEB A;  1EWY C;  1UGM A;  4XDC A;  4N59 A;  3BK2 A;  4DXG A;  3CST A;  1F2R I;  2XK5 A;  4ZHO A;  1N61 A;  4NAW B;  3AEA B;  3HHM A;  2Y5P A;  2FUG 1;  3PZD A;  2WU2 B;  1E6E B;  2EMS A;  2J4X A;  2LJ5 A;  3JVZ X;  2AQ3 B;  4US9 A;  2KVZ A;  4BVU C;  1BXT A;  3ZNH B;  5IOI A;  2J7Q B;  2KMM A;  2KWC A;  2WYQ A;  3UGB B;  3QK0 A;  3A4R A;  4KZC A;  3V6C B;  2BF8 B;  1JML A;  3MJW A;  4EUT A;  2DZJ A;  3KYC D;  2WXK A;  3WAN A;  2O2V A;  3RZF A;  1ET9 A;  3APC A;  4E74 A;  1EM7 A;  4KIK A;  1ZKH A;  4OVU A;  3DVN U;  5EE9 A;  3PSE B;  2L0F A;  1IGD A;  4N9F 4;  3Q8E A;  2JUO A;  4C00 A;  2H89 B;  5H92 C;  2YEP F;  2LVO A;  1V5O A;  4MGZ E;  1P7E A;  1ZUD 2;  1Z2M A;  4AP4 C;  4ANW A;  2GOW A;  2OED A;  3PTF C;  2M17 A;  2ZEQ A;  1N62 A;  3LJ3 A;  4YTP B;  1RM6 C;  1FXA A;  4HKZ E;  3ZDM C;  3RZW C;  2W55 A;  3MJ5 A;  1WI0 A;  1DOI A;  4ZRP A;  1KFY B;  2LGD A;  4HCP B;  4BBN C;  1WIA A;  4AOF A;  1TZO A;  4S0R A;  1E90 A;  4NJC A;  2IZV B;  3IHP C;  2BS3 B;  1AW7 A;  3BK1 A;  1SXT A;  4KGR A;  2GI9 A;  2I1J A;  2PE6 B;  4ICU A;  3PRP B;  1FD6 A;  1QQR A;  1WXA A;  2KYW A;  2AWT A;  1L7Y A;  3ML8 A;  5J17 A;  3IT6 B;  4UDU C;  4FA6 A;  2V0G A;  2K5P A;  4JIO U;  2NBV B;  4WH4 A;  3HM3 A;  4GB9 A;  1KLV A;  2CHX A;  3WA0 A;  4FXC A;  2M4N A;  1B1Z A;  3NY5 A;  5G2N A;  4RGT A;  5HHD G;  4HDO A;  1TTN A;  4MJS B;  4P1C C;  3U8Z A;  1L0X B;  3VDZ A;  4A9A A;  1TIF A;  2RPV A;  2ZW0 A;  3C8Y A;  3Q8F A;  3X0W A;  3W2D A;  1XD3 B;  4RF0 A;  1LM8 B;  1L2N A;  2Q5W D;  3JSV B;  2NPT A;  2D3A A;  2INP E;  3BII D;  2WXN A;  1WYG A;  2GB1 A;  1VZ7 A;  1WH3 A;  3BVG A;  1D4B A;  4FJZ A;  1IUE A;  2FBW B;  3KWL A;  4WWM A;  1NI2 A;  1VLB A;  4K7W A;  2UYZ B;  4E3C A;  2LUE A;  2C60 A;  3Q6B A;  4USA A;  2ICI A;  3NS8 A;  3VH3 B;  1ESF A;  1SGH A;  3TEZ A;  3Q3J A;  1R4N I;  3AXC A;  4RMA A;  3RNC C;  4ARI A;  3B2F A;  3TUO A;  2JF5 A;  2DWQ A;  1V80 A;  2WHI A;  1GNU A;  4EOY A;  3AEF B;  3RUI B;  1EO6 A;  2DZM A;  3O13 A;  1XLQ A;  2L7R A;  1C1Y B;  3QX1 A;  2IGD A;  1WZ0 A;  2XN9 C;  1NEN B;  2CKH B;  2NTT A;  2J42 A;  3DBR I;  4NJ6 A;  4C7Z A;  1FCL A;  4LJO B;  1RRB A;  5BMG A;  4WJN A;  2WDQ B;  3WAL A;  2G4S A;  1UBI A;  1K50 A;  3L13 A;  4XX5 A;  4PK1 A;  3HUI A;  2JT4 B;  2KDM A;  4ACF A;  2M56 B;  2MBE A;  3SFE B;  1VZ6 A;  1WWT A;  2VZK D;  3NVY A;  3I57 A;  3A1Q A;  2J0M A;  3PT2 B;  2CHW A;  4DK5 A;  4P1B C;  4K3B A;  4TUU A;  1KOT A;  2JVC A;  3ZXR A;  3K9P B;  4TMA B;  4EEW A;  2LHD A;  3OWE B;  4URK A;  1SE4 A;  3QQ8 B;  3ONS A;  3NUH B;  2E6X A;  2DLB A;  4KGS A;  2VRR B;  2K1F A;  2WP9 B;  2TSS A;  2WLB A;  3V62 A;  1CQV A;  2K22 A;  1MHX A;  3L17 A;  1E9M A;  4RH6 A;  3A9K B;  2LI5 A;  2WX0 A;  3ZW3 A;  1D5Z C;  2JZZ A;  3BVM A;  1L6V A;  5LXI B;  1WXV A;  3TCA A;  3L16 A;  3PZ8 A;  1FPY A;  4WQO B;  4DHZ B;  1SIJ A;  1OEY J;  3VFK A;  3R7R A;  4JE3 B;  5DCN A;  3ALB A;  3ZNG C;  2HJ8 A;  4LJP B;  4OVZ A;  2RMM A;  2V3N A;  2Z0E B;  4G50 A;  1NI3 A;  2B3A A;  3P42 A;  5IP4 D;  1CK1 A;  1H8C A;  3AN1 A;  1TKG A;  2NR2 A;  3ZXV A;  1H4R A;  4B9K A;  2KWD A;  4H2A A;  2A5U A;  4K7S A;  4DXF A;  2WU5 B;  1HXY D;  1SE2 A;  4EFO A;  4GU2 A;  4I6L B;  3SDL C;  1WRD B;  2QJL A;  4CYE A;  4FJV B;  1JWA D;  1GAQ B;  1Z5S B;  2FCS A;  2BKR B;  3OG5 A;  4MGY E;  4XYC A;  2NCN A;  2W9N A;  2D3G A;  1UWM A;  2G3Q B;  2FID A;  4MM3 A;  1J0G A;  4ZDV A;  3QJZ A;  1TJE A;  3B1L X;  2SAK A;  3TEX A;  2ZPN A;  1ACC A;  4JX1 C;  4IM2 A;  1UBQ A;  2MJE A;  1I4Q A;  2REX A;  1HZ5 A;  3N1Z C;  1PUT A;  1F1H A;  3E56 A;  3RI7 C;  4JL9 A;  4NZL B;  3OJ4 B;  4L23 A;  2C7M B;  1R4M I;  1C4P A;  1Q1O A;  3PZ7 A;  2AL3 A;  2IND C;  1XLO A;  2E3T A;  1GC7 A;  3CF6 E;  1NDD A;  1KM7 A;  3PLU A;  1YMH E;  5IO9 A;  1HQR D;  4P6V F;  2MJD A;  4ARC A;  4FAD A;  5BMH A;  1N60 A;  3Q8C A;  4ZRQ A;  3DBH B;  3AH7 A;  4WJP A;  2MBB B;  5E6J A;  2WGS A;  4HKQ A;  4W9F A;  3AEG B;  3JW0 X;  4M0W B;  1IPG A;  2KXJ A;  1T5X D;  4LNO A;  3U7Z A;  2KTF A;  3VTW A;  3RUL A;  3TEY A;  2DYB A;  2I38 A;  2BYE A;  1WX7 A;  5CX3 A;  2DBY A;  3TIX A;  1C4C A;  4MT5 A;  1WJ4 A;  2KQ4 X;  4HRS A;  3GZN B;  4KVG B;  2KWV B;  4OVV A;  1K52 A;  2D5G A;  5D3D A;  2VH1 A;  2GBR A;  4II3 B;  2PVO D;  2LEK A;  1FNU A;  3HVD A;  3WIM A;  3A4S C;  4KX6 B;  4F7Z A;  1PGA A;  4MAC A;  4IG7 B;  4CHK A;  2K8C A;  2BS4 B;  4BZA A;  2HTM E;  4LDT B;  5EDS A;  5AZG A;  2ZCC A;  3AB5 A;  1UZX B;  2RDG A;  1T0Y A;  3MP9 A;  5LXH A;  3GE8 C;  1WYW B;  1YD8 U;  1E8Z A;  3U4E G;  4A20 A;  2LD9 A;  3ZO5 B;  3AE1 B;  3RPF C;  3T3N A;  2UU7 A;  1UH6 A;  1HE8 A;  4HPP A;  2LWP A;  3KUC B;  2RD0 A;  5BYR A;  3ZUN A;  3IAM 1;  1E10 A;  3M95 A;  5L83 A;  1QZE A;  2QIE B;  3P1M A;  4K81 A;  3NOB A;  1F77 A;  1SBB B;  4KGT A;  2H88 B;  1YJJ A;  1TS5 A;  1UGJ A;  1IGC A;  3PS6 A;  2PE9 A;  2JRI B;  2KHW B;  3VR8 B;  2GBM A;  2KX3 A;  4WJQ A;  1T0R C;  2BVC A;  2KJR A;  4CQN A;  4LLG M;  3E9S A;  1WGG A;  3QAR A;  3TJP A;  3V60 A;  3ZRC A;  5HKH A;  2KAC A;  1VJK A;  4W9J A;  2WS3 B;  5D2M B;  2KTR B;  1UNS A;  1V81 A;  4MH0 E;  3DBL I;  2LGY A;  2R2O A;  1EU4 A;  3AI5 A;  3AEC B;  4HLE A;  1SJE D;  1HA5 A;  4TQ0 A;  4OZC A;  2KN4 A;  2IJ0 A;  2KC1 A;  1ZP0 B;  2BYV E;  5KHO A;  1FIQ A;  4M00 A;  2C7H A;  1ZDV A;  3NZS A;  1I35 A;  2INC C;  1WFY A;  5C2T B;  5FKA C;  4EZL A;  2IO2 B;  1LXD A;  1P0R A;  2NMQ A;  2O6V B;  3PRZ A;  3ZKJ C;  4FUL A;  2G9H D;  3VH4 B;  1BUI C;  1J19 A;  2DZI A;  2SEB D;  1CJE A;  2CR5 A;  2NVU I;  4LTU A;  5IN7 A;  3KW5 B;  4WJO A;  3VRA B;  3TEW A;  1WRI A;  2BT6 A;  2DAF A;  1RLF A;  4Q2J A;  1T3Q A;  1LQB A;  3VXW A;  3R7Q A;  3FC4 A;  4MSQ B;  1KLU D;  2BWF A;  4KSK C;  2MJ3 A;  2LRU A;  3MC9 A;  2KK8 A;  4YTN B;  2W54 A;  3RMK C;  3RT3 B;  2KZR A;  4K1R B;  1ET6 A;  2K25 A;  2K6D B;  2N9L A;  3ZNI D;  2I1K A;  2DAJ A;  3SD5 A;  3IVF A;  2XK5 B;  2LXA A;  4YWG G;  2OOB B;  3PO0 A;  4J3O D;  1MI0 A;  3DHI C;  4YTM B;  3R2I A;  3AE7 B;  4DHJ D;  5H8Y E;  2FCN A;  3RYT A;  1PYW D;  4NJ7 A;  3QA8 A;  3O65 B;  4GGQ A;  2ZPY A;  1V9J A;  4E71 A;  3ZIM A;  3H9D A;  2X8X X;  2KLG A;  4OZA A;  3EEC A;  2BW2 A;  1V86 A;  4JWS C;  4FLH A;  3H8H A;  5DPS A;  4GLS C;  4R3D A;  2EKI A;  5GXG B;  5I4D A;  2N7J A;  3OLM D;  2O2V B;  1NBF C;  3L0W B;  1SE9 A;  1WX9 A;  1I42 A;  2D11 A;  4KIK B;  1SJH D;  4FHK A;  4XWW A;  1FFU A;  2NBW B;  4LNN A;  1EF5 A;  3W5U B;  1ZPS A;  4RGN A;  3W1S A;  5G5G A;  3VUX A;  2MBQ A;  4A55 A;  2WDV B;  2N7D A;  3DHG C;  3RN9 C;  5JH5 C;  4YSZ B;  3ZJT A;  2G1E A;  2LUM A;  2MW5 A;  2V4L A;  1OEY A;  2RGF A;  2WNM A;  3NHE B;  1XXG A;  3W9C B;  1KJT A;  4G3X B;  2LVQ A;  4C4V A;  4N58 A;  2Z59 B;  2DNF A;  1G6J A;  2L05 A;  1JCK B;  2Z8L A;  5TSS A;  4PS7 A;  3GB1 A;  4QAY A;  3P63 A;  1BML C;  2G45 B;  3BZD B;  4FHJ A;  1WMH A;  1MFW A;  2BB6 A;  4I6N B;  1WXQ A;  2BB5 A;  1YX6 B;  2KDI A;  5AZH A;  2JYE A;  4DWF A;  1V49 A;  2N9P C;  1GOZ A;  2LGS A;  2N9X A;  1F9J A;  4NAM A;  1OQQ A;  1VRA B;  1QOA A;  2L0T A;  1L5P A;  3V6E B;  2L83 A;  3CSF A;  5JXV A;  4I6P A;  4HVB A;  5AEK B;  1NYQ A;  5GMV A;  2INN E;  4ASW C;  2EKE C;  4XGA B;  2CJO A;  2JXT A;  1JWM D;  1K51 A;  2K8H A;  4C4V B;  2IY1 B;  2K3U A;  1RWS A;  4FJY A;  3IBE A;  3RNG C;  2IGH A;  3P4P B;  4B95 A;  4F1S A;  2IGG A;  2KAN A;  2JSV X;  3UI3 A;  2ONQ A;  2WX1 A;  2JZ3 B;  1T0Q C;  4GDK A;  3K9O B;  4RFB A;  3MC8 A;  3UIP B;  4US8 A;  2HTH A;  1XF5 L;  2NPT B;  1IBX A;  3H7P A;  2Y5C A;  4WUR A;  2XNA C;  2V9H A;  3KWV A;  3PRM B;  1V5T A;  1A70 A;  3RNF C;  1JQ4 A;  4IKG A;  1PQS A;  1TS2 A;  3TBL D;  4RCO A;  2D2Q A;  3VTV A;  2PKO A;  4TKN A;  3ZRF A;  1YIW A;  1RFK A;  3V05 A;  3PVL A;  3L10 B;  1TY2 A;  4FN2 A;  5AUI A;  2JYT A;  3AE3 B;  2KJH B;  4FBJ B;  5FR3 A;  2KT7 A;  1OQY A;  3PV1 A;  1F2R C;  5D6J B;  2KO3 A;  1VZ8 A;  3A9J A;  1Q0W B;  1RYJ A;  1AWD A;  1XQQ A;  1CMX B;  3NVW A;  3FAH A;  3ENE A;  2M0X A;  3H1U A;  3T9L A;  1T0S C;  2A4Z A;  3N1Y C;  1RAX A;  1QOB A;  1FNW A;  2IYD B;  2L76 A;  3AM9 A;  2M8S A;  2PMV A;  2NS5 A;  4A6Q A;  1ZOY B;  2KOX A;  4AJW A;  4IM3 A;  3CIR B;  1J7C A;  3A1Q B;  1C9F A;  1D3Z A;  4IOI E;  1A5R A;  5HG2 A;  2FCQ A;  2KN5 A;  2M1M A;  3IAS 1;  1N5W A;  2JX5 A;  4WAA A;  2V3S A;  2OHF A;  4DBG A;  3EFC A;  3ZLZ A;  2W82 A;  2RDB C;  1AN8 A;  2ASQ A;  4YSY B;  4ICV A;  4GN1 A;  3AUL A;  2R61 A;  2V3P A;  3D32 A;  1E8W A;  4WAF A;  2MWS B;  1HTO A;  1LFD A;  4DDG D;  5J2R A;  3ZTD A;  1WR6 E;  2BPS A;  2PPH A;  2LFI A;  4PYZ A;  3DWG C;  5CHF A;  2J53 A;  5FR6 A;  1C76 A;  3L54 A;  4N6E B;  2LZ6 A;  2W3S A;  1UUP A;  1WJU A;  1MVK A;  5L95 C;  3Q2A C;  3I63 C;  1HEZ E;  1OFF A;  2HD5 B;  3ZTC A;  4JLC A;  3DBR B;  4JQW C;  3RNB C;  1JWS D;  4B0M A;  3NVV A;  1GUA B;  5EE0 A;  2BKF A;  4L2Y A;  3RNE C;  3IT4 B;  2MP2 A;  1WXS A;  1E0Z A;  4L1B A;  4O1N A;  4XC2 A;  5E6N A;  1XEE A;  5C23 A;  3AEB B;  1X1M A;  1WJN A;  3KUD B;  1Q5W B;  2WWZ A;  2L1A A;  2KQS A;  4NY0 A;  3KYD D;  1WGH A;  2GBN A;  3N9Y C;  4RGO S;  1LO5 D;  2CU3 A;  4IDI A;  4BKT A;  2LRW A;  2FE8 A;  4C7Y A;  2J0J A;  2K9X A;  4RF1 A;  1E8Y A;  2L8J A;  1C3T A;  3X23 A;  3JYU A;  3AV8 A;  3OAW A;  3QC8 B;  2MBH A;  1J7A A; 
#chains in the Genus database with same CATH homology
 3H7P B;  5JHA A;  1V81 A;  4MH0 E;  3DBL I;  4BKS A;  1E90 A;  2LGY A;  2IZV B;  1RFA A;  5CHW A;  3IHP C;  5C1Z A;  4ZRI A;  2R2O A;  3UQA A;  1OGW A;  3AU4 A;  3SHQ A;  4IWO A;  4BKG A;  1WR1 A;  2NBU A;  3AI5 A;  4HLE A;  2I1J A;  2PE6 B;  4ICU A;  3PRP B;  1TBE A;  5E6P A;  4TQ0 A;  1GG3 A;  2XBB C;  1P9D U;  3M62 B;  2KJ6 A;  2UWQ A;  1WXA A;  2KC1 A;  3W1S C;  2BYV E;  3OJ3 A;  4JGH B;  4KDL B;  5KHO A;  2AWT A;  1L7Y A;  2C7H A;  3ML8 A;  5J17 A;  4WWO A;  5DPT A;  3NZS A;  4FA6 A;  5E6O A;  1I35 A;  3DVG X;  2C5L C;  3IG3 A;  1WFY A;  4EZL A;  1Y8R C;  2IO2 B;  2NBV B;  4JIO U;  4NQL B;  1LXD A;  1P0R A;  2IO1 B;  3HM3 A;  2O6V B;  4GB9 A;  2CHX A;  4ZRK A;  3PRZ A;  4NNJ B;  3WA0 A;  3ZKJ C;  2K39 A;  1KLV A;  4FUL A;  3DBH I;  4IWP A;  1E7U A;  2GBJ A;  2N4F A;  4J6I A;  4XZ4 A;  2M4N A;  1J19 A;  3VH4 B;  2DZI A;  5J18 A;  2KDF B;  1ISN A;  3NY5 A;  2CR5 A;  5G2N A;  2NVU I;  3R3M A;  4HDO A;  1TTN A;  2PEA A;  4MJS B;  3KW5 B;  4WJO A;  3U8Z A;  3A9J B;  4ANU A;  4II2 B;  3VDZ A;  1K8R B;  2DAF A;  3EFU A;  2JXX A;  1S3S G;  3X0W A;  1RLF A;  1XD3 B;  2MX2 A;  3R66 C;  1WZ3 A;  2KDB A;  1LQB A;  3VXW A;  1LM8 B;  3R7Q A;  1FXT B;  4W9L A;  1L2N A;  3JSV B;  2BWE S;  2JWZ A;  2NPT A;  2KD0 A;  1WGR A;  4LDT D;  4MSQ B;  2BWF A;  4HWI B;  4EZJ A;  3GZN I;  4KSK C;  1AAR A;  1WH3 A;  1JRU A;  2LRU A;  2GBK A;  2ZJD A;  1S1Q B;  2XEW A;  4FJZ A;  2KK8 A;  4IUM B;  1NI2 A;  2DYM A;  4K7W A;  5D94 A;  2UYZ B;  2C7N B;  1WF9 A;  5CHV C;  5G55 A;  4E3C A;  2MSE D;  2LUE A;  2C60 A;  2KMA A;  3WAM A;  3RT3 B;  2KZR A;  4K1R B;  4CO7 A;  4KSL C;  2K25 A;  1E8X A;  3NS8 A;  3VH3 B;  2K6D B;  1SGH A;  3ZNI D;  2KQ7 A;  4BFR A;  2I1K A;  2DAJ A;  3Q3J A;  3SD5 A;  4DHZ E;  3IVF A;  2XK5 B;  1IP9 A;  1R4N I;  2LXA A;  2MCN B;  4DDI D;  2KWU B;  3AXC A;  4HDQ A;  4RMA A;  3UF8 A;  2OOB B;  3U30 A;  1ZGU B;  3APF A;  3N3K B;  2DHZ A;  2JF5 A;  3ZNZ B;  1V80 A;  2N9E B;  3MHS D;  1GNU A;  4GXB A;  2YVC A;  4EOY A;  1VD2 A;  4W9G A;  5IA7 A;  3RUI B;  1EO6 A;  2DZM A;  4DHJ D;  2L7R A;  2FCN A;  1C1Y B;  3RYT A;  4NJ7 A;  3QX1 A;  1WZ0 A;  3NZU A;  2CKH B;  3BIN A;  2V1Y A;  3QA8 A;  3O65 B;  2ZNV B;  3AU5 A;  3DBR I;  3DBS A;  4GGQ A;  1WX8 A;  2ZPY A;  4NJ6 A;  4PS3 A;  4A3O A;  1V9J A;  3DPD A;  4LJO B;  4PS8 A;  4ZRJ A;  3UIO B;  4E71 A;  1RRB A;  1WJ6 A;  4WJN A;  3ZIM A;  3H9D A;  2N1W A;  3DVN V;  4HPL B;  4AJY B;  2BGF A;  3I3T B;  2KLG A;  2MA9 B;  4W9E A;  4BBN F;  2IBI B;  2G4S A;  3EEC A;  3WAL A;  1UBI A;  3L13 A;  1V86 A;  4XX5 A;  4FLH A;  4G11 A;  4W9C A;  2JT4 B;  5DPS A;  3N32 A;  3S2A A;  2DZK A;  2MBE A;  2AEH A;  3H7S A;  2L00 B;  3OLM D;  3LDZ E;  4IM0 A;  2O2V B;  3A1Q A;  2LAS A;  2J0M A;  1NBF C;  2IY0 B;  3L0W B;  1SE9 A;  2JPH A;  1WX9 A;  3PT2 B;  3QCA A;  4MGK E;  3V61 A;  2CHW A;  2PJH A;  1I42 A;  4DK5 A;  2D11 A;  4KDI C;  4KIK B;  4TUU A;  4AUQ C;  1KOT A;  4IW0 A;  2JVC A;  4FHK A;  4MSM B;  3K9P B;  2MP2 B;  2NBW B;  3KUZ A;  4MEL A;  4X57 B;  1EF5 A;  4MDK E;  4EEW A;  5BO4 B;  3W1S A;  3VUX A;  2MBQ A;  5JZE B;  4URK A;  2N7D A;  3BY4 B;  3QQ8 B;  3ONS A;  5JH5 C;  3KVF B;  3WAO A;  2MW5 A;  2V4L A;  2VRR B;  1OEY A;  2K1F A;  3PHX B;  3C0R B;  2RGF A;  3NHE B;  2N7E A;  3DQV A;  2QHO A;  3QAQ A;  2O6V D;  3V62 A;  1KJT A;  2DYO A;  4G3X B;  2LVQ A;  3VTU A;  3T8M A;  2Z59 B;  3PPA A;  1WE6 A;  3L17 A;  1G6J A;  2BYF A;  4KV2 A;  2D10 A;  2L05 A;  4PS7 A;  3A9K B;  2LI5 A;  2KLC A;  2G45 B;  2IO3 B;  2K8B A;  2KFK A;  4FHJ A;  1WMH A;  2WX0 A;  4I6N B;  3ZW3 A;  2JRH A;  1YX6 B;  4GSW A;  2KDI A;  2Z0D B;  2JZZ A;  5LXI B;  1WXV A;  5AZH A;  3TCA A;  1IYF A;  3L16 A;  4DWF A;  4WQO B;  4DHZ B;  1V49 A;  2N9P C;  2HE7 A;  2L3Z A;  2N9X A;  1F9J A;  3APD A;  1TZ1 A;  1OEY J;  2J0K A;  3VFK A;  3R7R A;  2YLM A;  3WAP A;  1M94 A;  2L0T A;  4NPN A;  3ECI A;  4GOC A;  5DCN A;  2LGX A;  3V6E B;  2DX5 B;  3H6N A;  3CSF A;  3ALB A;  3PLV A;  4I6P A;  3ZNG C;  2HJ8 A;  1U4A A;  4HVB A;  5LLI A;  5AEK B;  5GMV A;  5DPW A;  4ASW C;  4LJP B;  2EKE C;  3DVG Y;  4K7U A;  3PGE A;  4P7I A;  2Z0E B;  4G50 A;  2FIF A;  3VHT C;  3M63 B;  1XT9 B;  2B3A A;  2K8H A;  4YL8 A;  1WM2 A;  2KX0 A;  2IY1 B;  4FJY A;  1H8C A;  3IBE A;  2NR2 A;  5D7G A;  1H4R A;  4B9K A;  4G0N B;  2ZNV C;  4B95 A;  1VCB A;  2A5U A;  2KFK B;  2ZVO A;  4K7S A;  4F1S A;  2KAN A;  1P3Q U;  4TQ1 A;  4EFO A;  4NQK E;  2WX1 A;  2JZ3 B;  4GU2 A;  4W9K A;  4I6L B;  3SDL C;  3Q3F A;  1WRD B;  1GC6 A;  4CYE A;  3P2B A;  2CHZ A;  4FJV B;  4GDK A;  3K9O B;  4MEM A;  3VUW A;  4BOZ B;  2KNB A;  1Z5S B;  3UIP B;  2FCS A;  2HTH A;  2BKR B;  3KH0 A;  4MGY E;  2NPT B;  2NCN A;  2ZCB A;  2W9N A;  2D3G A;  2KTR A;  4DXA B;  3H7P A;  4HXD A;  2G3Q B;  3B08 A;  2FID A;  3GOE A;  4MM3 A;  1J0G A;  4ZDV A;  2DEN B;  2MRP A;  3QJZ A;  4IC7 B;  3B1L X;  1ZW7 A;  2ZPN A;  3PRE A;  3PRM B;  1V5T A;  4IM2 A;  1UBQ A;  2MBO A;  5KHQ A;  3HM6 X;  2WDT B;  2REX A;  1WGY A;  1PQS A;  3A33 B;  2FCM A;  1WE7 A;  1WM3 A;  4HPM B;  3TBL D;  2JY6 A;  2K6Q A;  2D2Q A;  3VTV A;  3ZVV A;  3L08 A;  4JL9 A;  3ML9 A;  4TKN A;  3OJ4 B;  4A3P A;  3VAW A;  2C7M B;  1R4M I;  1YIW A;  4ZYN A;  3ZRF A;  1UEL A;  3PVL A;  3W1Y A;  4ANX A;  3L10 B;  3PHW B;  3SU8 X;  1Q1O A;  2O6V A;  4FN2 A;  2FAZ A;  2AL3 A;  2RPQ A;  2IO0 B;  1WGD A;  2KJH B;  4FBJ B;  1GC7 A;  3EC8 A;  4AWJ A;  1WY8 A;  3QHT A;  2D07 B;  3VQI A;  3M3J A;  1OQY A;  3PV1 A;  5D6J B;  2Y5B B;  2KO3 A;  3CF6 E;  4NAW A;  4W9D A;  5AZF A;  4TV3 A;  3TMP B;  2FUH B;  4M8N A;  1NDD A;  2EMT A;  4MJS A;  4WWN A;  1KM7 A;  3A9J A;  1V6E A;  3PLU A;  2LXC A;  2RSU A;  2ZZP B;  1Q0W B;  3B0A A;  3ZDT A;  4ANV A;  1XQQ A;  1CMX B;  1EUV B;  3UQB A;  4W9I A;  4RM9 A;  4MGI E;  3TL5 A;  4HJK A;  3ENE A;  2M0X A;  3H1U A;  5IAA C;  3T9L A;  4FAD A;  2A4Z A;  2OJR A;  1RAX A;  1BT0 A;  2G4D B;  3JSV A;  2IYD B;  2L76 A;  1E5W A;  1WXM A;  4GMV A;  3RD2 A;  2ZVN A;  2M8S A;  4WJP A;  2NS5 A;  4M8M A;  2MBB B;  2KOX A;  4AJW A;  2KC2 A;  1E7V A;  4IM3 A;  3EHV A;  4BKS D;  3A1Q B;  3DDC B;  3RCZ A;  3DOW A;  4W9F A;  3JW0 X;  1D3Z A;  4M0W B;  1UGM A;  1A5R A;  1IPG A;  2KXJ A;  4GDL A;  2KTF A;  1UD7 A;  2FCQ A;  3VTW A;  2KN5 A;  2N1V A;  3RUL A;  2KKC A;  3CST A;  2M1M A;  2DYB A;  5TR5 A;  2BYE A;  5CTR C;  1EF1 A;  1WX7 A;  2XK5 A;  5CX3 A;  4WAA A;  3TIX A;  2V3S A;  2LVP A;  3DCG A;  4DBG A;  1WJ4 A;  4HCN B;  4W9H A;  4KZ0 A;  3ZLZ A;  1OTR B;  4NAW B;  4KVG B;  2KWV B;  2ASQ A;  4OVV A;  3CMM B;  2GMI C;  4ICV A;  2KVR A;  3HK0 A;  3HHM A;  4GN1 A;  3AUL A;  1MG8 A;  3PZD A;  2CS4 A;  2GBR A;  3D32 A;  1E8W A;  4II3 B;  2MWS B;  1LFD A;  2MLB A;  4WWP A;  4EKU A;  4DDG D;  5J2R A;  3ZTD A;  1WR6 E;  2BPS A;  3WIM A;  3A4S C;  2EMS A;  2PPH A;  4F7Z A;  2LJ5 A;  3JVZ X;  1YX5 B;  3VUY A;  2MQJ A;  4IG7 B;  2K8C A;  4PYZ A;  4CHK A;  4BVU C;  4LDT B;  5EDS A;  5AZG A;  2ZCC A;  5CHF A;  5FR6 A;  3ZNH B;  5JHB A;  1UZX B;  2J7Q B;  1YJ1 A;  4LCD E;  1GJZ A;  1T0Y A;  1SIF A;  1WMH B;  5LXH A;  1WYW B;  1YD8 U;  2KWC A;  3L54 A;  1E8Z A;  2LZ6 A;  2LD9 A;  2WYQ A;  3UGB B;  4A20 A;  2R2Q A;  4HK2 A;  3QK0 A;  3A4R A;  3ZO5 B;  4GDL B;  1WJU A;  5DPR A;  3IFW B;  4KZC A;  5L95 C;  3V6C B;  1UH6 A;  2BF8 B;  2HD5 B;  1HE8 A;  3N30 A;  2LWP A;  2RR9 A;  3KUC B;  3MJW A;  2RD0 A;  4EUT A;  4GIV A;  2FNJ B;  4PYU A;  2DZJ A;  3KYC D;  3WAN A;  3ZUN A;  4JLC A;  2O2V A;  3M95 A;  1TGZ B;  3ZTC A;  4JQW C;  3RZF A;  5L83 A;  1QZE A;  3APC A;  3MTN B;  4E74 A;  4K81 A;  4BOS C;  1GUA B;  3NOB A;  4KIK A;  1ZKH A;  4OVU A;  3VVW B;  3DVN U;  2BKF A;  3QIJ A;  2KMC A;  1V2Y A;  3PSE B;  2L0F A;  4B6W A;  1P1A A;  1WXS A;  2JUO A;  2MP2 A;  4N9F 4;  3PS6 A;  2KFJ A;  4XC2 A;  2C9W B;  2PE9 A;  5E6N A;  2JRI B;  2LVO A;  5C23 A;  1V5O A;  2KHW B;  2GBM A;  3QWZ B;  1X1M A;  2CU1 A;  4MGZ E;  3U7D A;  1WJN A;  2KX3 A;  3KUD B;  4IWQ A;  1Q5W B;  2WWZ A;  4DHJ B;  2KDE B;  2AL6 A;  1J8C A;  1Z2M A;  4EZK A;  4RM8 A;  4WJQ A;  2KQS A;  3UIN B;  4AP4 C;  4ANW A;  1YQB A;  4NY0 A;  3KYD D;  2KJR A;  2GOW A;  1WGH A;  2GBN A;  1P98 A;  2M17 A;  2ZEQ A;  3PTF C;  3LJ3 A;  4BKT A;  3ZDM C;  2LRW A;  3RZW C;  1WGG A;  2J0J A;  3QAR A;  3TJP A;  1E8Y A;  3V60 A;  2L8J A;  1C3T A;  1WI0 A;  3X23 A;  4GDK B;  3JYU A;  3ZRC A;  4F8C B;  3A9K A;  5HKH A;  2LGD A;  3OAW A;  3QC8 B;  2MBH A;  4HCP B;  4BBN C;  1WIA A;  2AYO B;  4AOF A;  3HIZ A;  4W9J A;  5D2M B;  2KTR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...