3ZTCA

Pvhl54-213-elob-eloc complex _ (2s,4r)-n-((1,1'-biphenyl)-4-ylmethyl)- 4-hydroxy-1-(2-(3-methylisoxazol-5-yl)acetyl)pyrrolidine-2- carboxamide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
103
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADTFEALCIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
total genus 21
structure length 103
sequence length 104
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ztcA00
3RZFA 4W9IA 3WALA 2Z0DB 2OOBB 1E7VA 2BGFA 3AI5A 2M0XA 3JVZX 3W1SC 3QCAA 3OJ3A 2UYZB 1WF9A 1KOTA 2AL6A 3A1QA 1WR1A 3ZO5B 2I1KA 2EKEC 4MH0E 3DVNV 2O6VA 4ICVA 4FJZA 3ENEA 3DBHI 3M62B 4ZYNA 2K8CA 1ZGUB 1C1YB 2IO2B 3N32A 4P7IA 2CHXA 4W9CA 1YD8U 1C3TA 2KXJA 3OLMD 2LVPA 2MCNB 2RGFA 3MJWA 3ZIMA 2D3GA 4WJNA 1AARA 1V2YA 2KHWB 3SU8X 1H8CA 3I3TB 2ZEQA 2DENB 2JY6A 5LXHA 3AU5A 4HCPB 4N9F4 3A33B 2DHZA 5JZEB 4NAWB 1V5OA 4MDKE 4DK5A 2KQSA 3OAWA 4JL9A 2KVRA 1V49A 3ZW3A 1P3QU 5CHVC 4F7ZA 3A4RA 3PSEB 4I6NB 4YL8A 1E8YA 1S3SG 1SIFA 4AJWA 3VTVA 4MM3A 4W9FA 4LJPB 2L0TA 2M1MA 4A3OA 2KC1A 5JHAA 4HCNB 4ICUA 2MX2A 3PV1A 1WJ4A 3V61A 1SE9A 4CHKA 2AL3A 3QX1A 3NHEB 2KTFA 3GOEA 4GXBA 2KFJA 3IBEA 4TQ0A 2JPHA 4IWOA 4ZRJA 2DZIA 4IM3A 2O6VD 2M17A 3CSTA 2ZVOA 3QA8A 3KH0A 1E8ZA 4HDQA 4HJKA 2XK5A 4DHZE 4GDKA 4G3XB 5FR6A 3QK0A 4GIVA 3W1SA 1WZ0A 2V4LA 3JSVA 3QHTA 4E71A 2LASA 2QHOA 1WX9A 4MJSB 5KHOA 1G6JA 5CHWA 3PVLA 2KMCA 4MSQB 2J0KA 2KX3A 1E8WA 2NCNA 4ANXA 4BFRA 2C5LC 4ZDVA 2L8JA 2LGYA 3TMPB 2KK8A 3KUCB 2CS4A 4W9EA 4BKGA 2V3SA 3APDA 5CX3A 1Q5WB 2N7DA 3KW5B 2BWES 4CO7A 4IM2A 1BT0A 3KYDD 3PT2B 3VHTC 2UWQA 3DBSA 1WFYA 4K7WA 2KDIA 1YJ1A 3VH4B 1KJTA 4W9KA 3MTNB 4PS7A 5JH5C 4K7SA 2WDTB 3NY5A 3PRPB 3VUYA 1T0YA 3ZVVA 2CU1A 4GB9A 4K1RB 4MELA 4RM9A 3SDLC 1NBFC 2DAJA 4G50A 5L83A 4KDIC 3HIZA 2ZNVC 2OJRA 3VTWA 4OVVA 4MSMB 2J7QB 2MBQA 4BOZB 4WWNA 2J0MA 3L08A 3UINB 1P9DU 3L54A 4PS8A 5HKHA 2G45B 2N1VA 4NJ7A 1IP9A 4KV2A 1Q1OA 2L00B 2BPSA 3UIOB 4B95A 4XC2A 3DDCB 4GGQA 5CHFA 4WWPA 2KNBA 3SD5A 2MLBA 3ONSA 5AZGA 2DAFA 3ZNZB 2MBOA 2IY0B 4II3B 2LGDA 2KQ7A 3HM6X 3UGBB 4HLEA 3M3JA 3DPDA 1WM3A 1JRUA 2FIDA 5J17A 1GJZA 2N9XA 2FCMA 4WAAA 1WRDB 2FAZA 5C23A 2KFKB 2IO0B 4NAWA 3VH3B 2EMSA 3HM3A 4AUQC 3T8MA 2LUEA 4I6LB 4IM0A 5GMVA 3TBLD 2YVCA 1WR6E 2KLGA 2KJHB 2M4NA 2GMIC 1WJ6A 1WH3A 2C60A 3H7SA 3R3MA 2N9EB 4EOYA 3ZTCA 4EZJA 5DPTA 1Z2MA 3NZUA 2KFKA 1WE6A 2B3AA 5JHBA 1RRBA 3H1UA 4DBGA 2ZCBA 1IPGA 3UQBA 1K8RB 2DYMA 1RLFA 4IG7B 2MRPA 3WAPA 4PYUA 4LDTB 4HPMB 2O6VB 3QWZB 4IUMB 3QC8B 2KOXA 3OJ4B 4ZRKA 1GG3A 5C1ZA 1V80A 2V1YA 4EZLA 1WGRA 3TL5A 2K1FA 1UGMA 1WZ3A 2LXCA 5IA7A 3EFUA 1E90A 3H7PB 4FHJA 2FCQA 2IYDB 4M8NA 2AYOB 1WX7A 4W9JA 4ANVA 1LQBA 2A5UA 4GDLA 3ZNID 3X0WA 5AEKB 1U4AA 2IO3B 3PRZA 3ZLZA 2IO1B 3ZDTA 3TJPA 4DDID 3Q3JA 3C0RB 3K9OB 4KZ0A 1L7YA 1KLVA 2BKRB 1YX5B 3APCA 2NPTB 4ANWA 5L95C 3M63B 5D7GA 3NOBA 2NBUA 1L2NA 3KYCD 3L0WB 2JRHA 2WX0A 3SHQA 2REXA 4F1SA 1CMXB 2LD9A 1EF5A 1LM8B 3K9PB 2LVOA 1EO6A 3QARA 4MGYE 3DVNU 3U8ZA 1WM2A 4FHKA 2LRWA 1QZEA 2BYFA 3PLUA 4G11A 2MBHA 2W9NA 2BKFA 2N7EA 4MJSA 3U30A 3IVFA 1OEYA 2JZZA 4K7UA 5IAAC 1WMHB 2FNJB 2DYBA 2DZKA 1J8CA 3WAOA 3JSVB 1S1QB 2N9PC 4WJOA 3PRMB 4IWQA 5D2MB 2K6DB 3R7QA 4DDGD 2JWZA 2HJ8A 2MQJA 4X57B 2XK5B 3PHWB 1VD2A 3WAMA 1OQYA 2MSED 1WXVA 2VRRB 3GZNI 3N3KB 2WWZA 2JT4B 4NQLB 4RMAA 3V6CB 1I42A 3A9JB 2XEWA 1TTNA 1H4RA 1WYWB 1LFDA 4FULA 4IC7B 2CKHB 2I1JA 2R2QA 2DX5B 1J19A 1GUAB 4BVUC 3WANA 1WXMA 3APFA 3DQVA 2RPQA 4NNJB 3L16A 4FN2A 1WGGA 3D32A 2NVUI 1PQSA 2Z0EB 4AP4C 4GN1A 2C7NB 3AULA 3AU4A 4HPLB 1IYFA 2LWPA 4FADA 2IZVB 1R4NI 1E5WA 1OGWA 2KKCA 3M95A 3QQ8B 3R7RA 2KWCA 3QJZA 3A9KA 3VXWA 2KWUB 1GNUA 3ML9A 2ZJDA 2JXXA 1V86A 4ZRIA 3VUWA 2K8BA 3H7PA 5G55A 3MHSD 4HWIB 1XQQA 1E7UA 2BYEA 2ZPNA 3LDZE 3DVGY 3O65B 2L3ZA 1TZ1A 1X1MA 3VTUA 3EECA 3VVWB 1ZKHA 1WJUA 5G2NA 3IHPC 2DZJA 2G3QB 2BWFA 2D11A 2RR9A 2MBEA 2KDBA 2LZ6A 4KSKC 4E3CA 1A5RA 4WQOB 4W9DA 2FIFA 3PS6A 1VCBA 3HHMA 5J18A 3EC8A 1NI2A 2C7HA 3EHVA 1OEYJ 3S2AA 2ZVNA 2KJ6A 1RAXA 5LLIA 4DXAB 4EKUA 2RSUA 2J0JA 4LCDE 3A1QB 2KJRA 2BF8B 1E8XA 2KDEB 2LRUA 3ZDMC 3PREA 3V62A 2DYOA 2GBMA 3RUIB 3V6EB 4M8MA 1F9JA 2GBKA 3CSFA 4OVUA 2M8SA 3ZKJC 5CTRC 2NBVB 2YLMA 3A9JA 4BKSA 4RM8A 5EDSA 4DHJD 3RCZA 3B0AA 1I35A 4F8CB 2G4DB 3A9KB 2K25A 4DWFA 3N30A 2HE7A 2KN5A 2PE9A 3CF6E 3KUZA 2JF5A 2L05A 1GC7A 2O2VB 1V9JA 2CHWA 4EEWA 5KHQA 3P2BA 1WI0A 1WMHA 4GMVA 1HE8A 4II2B 1P0RA 3ZNGC 1Y8RC 2LJ5A 3NZSA 4BKTA 1FXTB 2CR5A 2G4SA 4WJPA 4KIKA 4B9KA 2D07B 1KM7A 3UIPB 1D3ZA 4TKNA 4XZ4A 4DHZB 5D94A 4LDTD 2PJHA 4ANUA 4HXDA 2N4FA 4EZKA 4FA6A 2MP2B 4EFOA 2LI5A 4FBJB 3W1YA 1XD3B 4JQWC 4LJOB 1UELA 2RD0A 4K81A 1Z5SB 1YX6B 3IG3A 2FCNA 1WGHA 2NPTA 2NBWB 2C9WB 3B08A 4NY0A 2KC2A 2KMAA 3VFKA 1YQBA 2MWSB 2HTHA 4NQKE 4KSLC 2NR2A 1WJNA 4HDOA 4WWOA 1WGYA 1MG8A 4GSWA 4BBNC 3PPAA 4GDKB 3WIMA 4E74A 3ECIA 3UF8A 3L17A 4URKA 1V81A 4PYZA 4J6IA 3QIJA 4BOSC 2K39A 5DPSA 1P98A 4NJ6A 3L13A 3RZWC 3WA0A 3KVFB 2IBIB 2KTRB 2K6QA 3VAWA 3A4SC 4KIKB 1R4MI 2A4ZA 4BKSD 1WY8A 3RD2A 3PZDA 2CHZA 1UD7A 2WX1A 3IFWB 4W9HA 2L76A 2MBBB 4BBNF 2Y5BB 3VQIA 2JUOA 4GU2A 4FJYA 2KX0A 4MGZE 2WYQA 3LJ3A 5BO4B 3RULA 2C7MB 2KWVB 2K8HA 2N1WA 4TV3A 2AEHA 4XX5A 3V60A 1J0GA 4NPNA 2EMTA 4TUUA 4FLHA 4KZCA 2NS5A 4I6PA 3BINA 3L10B 5DPWA 1WXAA 3ZRCA 5TR5A 4AJYB 1RFAA 4HK2A 1Q0WB 2GBNA 3R66C 4KVGB 4GOCA 1V5TA 2L7RA 3H6NA 1WIAA 2PPHA 2ZPYA 5E6NA 3NS8A 2BYVE 4JIOU 1TBEA 3RT3B 1SGHA 3UQAA 2KD0A 3ZUNA 3B1LX 2ASQA 3Q3FA 4B6WA 2D2QA 2JZ3B 2IY1B 1WX8A 4DHJB 3PGEA 3ZNHB 4JLCA 1LXDA 4AWJA 2XBBC 2DZMA 2KTRA 3BY4B 4MEMA 4MGKE 5AZHA 2LVQA 2HD5B 4HVBA 1EF1A 1P1AA 2FCSA 3PHXB 4JGHB 5E6PA 2GBRA 5AZFA 3RYTA 3QAQA 2GBJA 2LXAA 3ALBA 2KO3A 3CMMB 4EUTA 2KZRA 3VDZA 1YIWA 1ZW7A 4A20A 2MW5A 4IWPA 2KLCA 2LGXA 1WXSA 2PE6B 2D10A 1TGZB 3JYUA 4IW0A 3H9DA 1UBIA 5DCNA 1UZXB 3DVGX 1M94A 4M0WB 1UH6A 2MA9B 2FUHB 4KDLB 5D6JB 2PEAA 3U7DA 3AXCA 3ML8A 1XT9B 2ZZPB 4WJQA 3VUXA 2R2OA 4FJVB 2KANA 3PTFC 3DBRI 3KUDB 4AOFA 1V6EA 2Z59B 5DPRA 3ZTDA 1GC6A 2JRIB 3DOWA 4MGIE 4G0NB 5LXIB 2AWTA 3DCGA 3HK0A 4ASWC 1ISNA 1WE7A 4W9LA 1UBQA 5E6OA 1OTRB 3X23A 2KDFB 2GOWA 4W9GA 4A3PA 4CYEA 4TQ1A 1NDDA 3TCAA 2O2VA 3ZRFA 2L0FA 2ZCCA 1EUVB 3T9LA 1WGDA 4GDLB 4PS3A 3PLVA 5J2RA 2JVCA 3DBLI 3JW0X 2MP2A 2ZNVB 3TIXA
chains in the Genus database with same CATH superfamily
4W9IA 3AE2B 2OOBB 1E7VA 3JVZX 3W1SC 3OJ3A 1SBBB 1C77A 1WF9A 2BW2A 3A1QA 3U2SC 2EKEC 2I2YA 3DVNV 4ICVA 4FJZA 1CK1A 3DBHI 3P4QB 3FKYA 1C3TA 4DXFA 5H92C 2KXJA 2MHJA 3OLMD 1AARA 1V2YA 3DHIC 4P1CC 4M01A 1V5OA 4BZAA 4DK5A 1V49A 3DWGC 3ZW3A 4IDIA 1AW7A 4I6NB 4KKJA 1SIFA 1S3SG 5EE3A 4CQNA 2BQQA 3VTVA 4MM3A 1FXIA 1ZE3D 1YN4A 2GRIA 4ICUA 3NVVA 3V61A 3QX1A 4GXBA 3NHEB 1AYFA 1D6EC 1RWSA 4IWOA 3TEXA 3CSTA 1BUIC 2ZVOA 2CJNA 4JPSA 4DHZE 4GDKA 3R8BA 3QK0A 4GIVA 2KACA 4E71A 2QIEB 3PVLA 4US8A 3AE8B 1DOXA 4MSQB 1E8WA 2NCNA 4ANXA 4ZDVA 1UUPA 4W9EA 2CS4A 2V3SA 3APDA 1Q5WB 1JWSD 2UWQA 4K7WA 3U52E 3VH4B 4W9KA 2BS3B 1QOAA 4RM9A 1YN3A 4A55A 3HIZA 4OVVA 4MSMB 4BOZB 4H2AA 2G45B 1XCQL 1IP9A 4KV2A 4WURA 4B95A 1LO5D 2L52A 4B0EA 4DXGA 4Q2JA 1I4HA 5EE9A 2MLBA 2WXHA 1HTOA 2DLBA 2IY0B 2KQ7A 1TS2A 3UGBB 3M3JA 1ROEA 4WAAA 5E6JA 2ONQA 4RGMA 1IGCA 2FAZA 5C23A 2BS2B 3DWMA 2EKIA 2IJ0A 4RFBA 4NAWA 1C4CA 3HM3A 3T8MA 2YEPB 2KLGA 2KJHB 3V3XA 2LJIA 2N9EB 3R3MA 3ZTCA 1WGKA 2B3AA 1RRBA 3NRZA 4HKQA 2JU6X 4IG7B 2MRPA 3Q8FA 3QWZB 3Q2AC 2KOXA 3OJ4B 4WWMA 4ZRKA 2LFIA 1ZP0B 1YJJA 1WZ3A 2PMVA 2LXCA 3EFUA 2E3TA 3URYA 2RMMA 2IYDB 2AYOB 4ANVA 1LQBA 4GDLA 1QOFA 3X0WA 5AEKB 1IBXB 3PRZA 2WDQB 2IO1B 1FPYA 1IUEA 1KLVA 2NPTB 5L95C 5D7GA 1N63A 5IO9A 4F1SA 5IOIA 3U8ZA 1KLUD 4YXDB 4FHKA 1FFUA 4KKIA 4JWUC 3PLUA 4G11A 5HI1A 1N62A 1R7SA 4MJSA 3IVFA 4K7UA 5IAAC 3W9CB 4DDGD 3R7QA 2HJ8A 2RDHA 3WAMA 5FKAC 1TJEA 1WYWB 5HHDG 1C4AA 3D32A 1PQSA 3IXSA 1T0SC 2C7NB 3AULA 3AU4A 1TS5A 2KKCA 3QQ8B 2E6XA 1GNUA 4ZRIA 2K8BA 3H7PA 1XQQA 3LDZE 1TZ1A 4JWSC 5G2NA 2DZJA 2KDBA 4KSKC 2KAJA 3BVGA 4WQOB 2FIFA 1GAQB 3HHMA 2WNMA 1NI2A 1ESFA 3BVMA 3MHZA 3MC0B 4LCDE 2I38A 2KDEB 2WXGA 2N9LA 1L0XB 4HJGE 2GBKA 4REZA 4RM8A 5EDSA 4DHJD 1I35A 1D5MC 4USAA 2HE7A 2K9XA 5I4DA 3RNCC 2JF5A 2L05A 4MT5A 4OVZA 3P2BA 4OHJA 3ZNGC 3NZSA 4BKTA 1RYJA 1JROA 4TKNA 2H88B 1F77A 4D2KA 1MJDA 2NMQA 4EFOA 3V05A 1XD3B 4JQWC 4LJOB 2RD0A 1VR9A 3AEGB 3VFKA 4NQKE 4HDOA 2NR2A 4WWOA 1ZXIA 3PPAA 4GDKB 1KFYB 2PVGC 2WDRB 4URKA 3L17A 3I63C 4PYZA 2G9HD 4J6IA 4BOSC 2J52A 5DPSA 3Q6BA 2XN9C 1F2RI 3RZWC 1ET6A 3A4SC 1SE4A 3DBRB 3AEAB 2WX1A 4W9HA 2B76B 2Y5BB 3VQIA 2JUOA 3SR6A 3Q8EA 4A9AA 2INNE 3RULA 1J0GA 4TUUA 2EMTA 1A70A 2NS5A 3MJ5A 3L10B 3NJTA 4AJYB 3RNBC 4ARIA 2GBNA 2BTEA 3PO0A 2PKOA 2AQ1B 1V5TA 1EM7A 2ZPYA 3GZNB 3AB5A 1UF0A 3B1LX 3Q8AA 5D3IB 2L32A 3ZYYX 2NTSA 4AWJA 2DZMA 2W54A 2LVQA 1EF1A 1P1AA 2FCSA 4JGHB 5E6PA 2GBJA 2L1AA 2KO3A 2MW5A 3O13A 2LGXA 1WXSA 2RPVA 2D10A 2K3UA 1T0QC 1UBIA 1UH6A 3T3NA 3NVWA 2PEAA 3U7DA 3BVZA 4KGSA 3ML8A 1XT9B 2KANA 3DBRI 1RFKA 4AOFA 2Z59B 2FBWB 4HRSA 4G0NB 5LNK1 3DCGA 1ISNA 1NEKB 1UBQA 3X23A 1VZ7A 2KDFB 3TEYA 4PK1A 1CQVA 3E9SA 1J7AA 1PGAA 2JVCA 3JW0X 3AEBB 3TIXA 1K51A 3RZFA 2Z0DB 4WAFA 3AI5A 2M0XA 3QCAA 1SB3C 1L0YB 4RGOS 1C78A 1WR1A 3ZO5B 2QEJC 1EU3A 1QILA 3DHHC 1C1YB 2WXFA 5BMIA 4M00A 4LNNA 2CHXA 1ACCA 1GB4A 4KGTA 3AE6B 1T3QA 2MCNB 3ZIMA 2D3GA 2KHWB 1H8CA 3I3TB 3LB8C 4GLSC 5LXHA 3VRBB 4HCPB 1N5XA 3A33B 5JZEB 4NAWB 5G5GA 3BWUD 2KQSA 4F7ZA 3A4RA 1E8YA 1STEA 1HQRD 3E56A 5EE1A 1FNVA 4W9FA 4LJPB 2L0TA 1WRIA 2M1MA 2QMTA 1PFDA 3AE3B 2AL3A 1TKEA 2KTFA 3GOEA 4TQ0A 3IBEA 2DZIA 3QA8A 2H89B 3KH0A 1E8ZA 4HDQA 2XK5A 3RNFC 1JRPA 3W1SA 2V4LA 1SF0A 1R4MB 1WX9A 4MJSB 5KHOA 1I4PA 5CHWA 3AE5B 1UNSA 2JZPA 4BFRA 2GLSA 2KK8A 3KUCB 4BKGA 2N7DA 2KVZA 2BWES 1E7PB 3PT2B 1VJKA 1KRHA 2KDIA 5HG2A 1E9MA 1KJTA 5JH5C 3MTNB 4K7SA 3PRPB 3VUYA 1T0YA 2WDVB 4C4VA 3Q69A 1FCLA 4WQMA 1XXGA 2MBQA 2M56B 3DHGC 4NJ7A 5IP4D 1XO3A 3U7ZA 3UIOB 4XC2A 3DDCB 4GGQA 1PGBA 4LLGM 5CHFA 5D3DA 2Y5CA 2K0PA 1OFFA 1B9RA 1WM3A 2WLBA 1JRUA 3FC4A 5J17A 2W55A 2FCMA 2PTLA 4O1NA 1WRDB 2DWQA 4ARCA 3TSSA 2KFKB 1L4ZB 2JYTA 3Q8BA 2LUEA 5AUKA 1WR6E 2VH1A 1WH3A 2VH2A 1QQRA 4DBGA 2ZCBA 3UQBA 3GE3C 4PYUA 4HROA 1LGRA 2WU5B 2IGHA 4IUMB 2ICIA 1GG3A 4EZLA 1WGRA 3TL5A 2WXIA 2K1FA 3PZ7A 1MPEA 4RGNA 1E90A 3H7PB 2ON8A 2WP9B 4PT5A 1FEHA 4JX1C 3NS1A 3ZLZA 2IGDA 1MFWA 1L7YA 3U4EG 2BKRB 1YX5B 4ANWA 1MI0A 4ACFA 3RNEC 1SJED 1SE3A 4M02A 3SHQA 2WXNA 1EF5A 3QARA 1EO6A 3DVNU 1TZOA 2LRWA 1XF5L 2N7EA 2FNJB 3HRDD 1S1QB 3PRMB 2MQJA 2D3BA 1OQYA 2VRRB 4RMAA 3IT6B 3Q14C 2XEWA 4FULA 1TKGA 4IC7B 1N60A 2I1JA 1HXYD 1J19A 1GUAB 1HEZE 3WANA 3L16A 3MFGA 4FN2A 4N58A 1WGGA 2Z0EB 4AP4C 1JMLA 4HPLB 1MHHE 1OGWA 2WGSA 3DBLB 3QJZA 2QILA 2JXXA 5G55A 2N0SB 4HWIB 2ZPNA 1JCKB 1BMLC 1X1MA 3VTUA 3N1YC 2RR9A 2D11A 3EFCA 1J7BA 1YJIA 3PZ8A 1A5RA 1XLNA 4W9DA 3PS6A 3KLSX 2Z8LA 2C7HA 1I7HA 3S2AA 2ZVNA 2KJ6A 3AE9B 2RDBC 4EKUA 1T0RC 1WXQA 2RSUA 2J0JA 1TIFA 2WS3B 1E8XA 4P6VF 2IGGA 3W5VB 3V62A 4M8MA 1F9JA 3CSFA 3N20C 1I4QA 3NVZA 3A9KB 3N30A 2N9KA 1V9JA 4EEWA 5KHQA 4C4VB 3HUIA 1WI0A 1HE8A 1P0RA 3FILB 2LJ5A 2INPE 1FXTB 2CR5A 1B1ZA 5C3JB 1YQ3B 2D07B 4DHZB 1EU4A 5D94A 1PGXA 4ANUA 1XLQA 1UELA 4K81A 1Z5SB 2KN4A 2FCNA 1WGHA 4KX6B 1KLGD 3R2IA 1F0ZA 3BYYB 4YSZB 1YQBA 1WGYA 1FFVA 2D5GA 1TY0A 1V81A 3BZDB 3QIJA 3RN9C 2FUG1 1P98A 3CIRB 3KVFB 3VAWA 1P7FA 2KTRB 2SEBD 4BKSD 2HDEA 3RD2A 2MBBB 1SSNA 2KYWA 1EWYC 4FJYA 4XX5A 3V60A 4NPNA 4KZCA 4I6PA 2FE8A 1L5PA 1RFAA 1C76A 4HK2A 1Q0WB 3R66C 2INDC 4XGAB 3H6NA 5E6NA 2QSDA 4ZRQA 3NS8A 4ZYSA 1SGHA 3UQAA 2KD0A 4B6WA 3RI7C 4US9A 2JZ3B 2IY1B 1WX8A 3ETRA 3C19A 3PGEA 3GE8C 2XBBC 3BY4B 1DOIA 2KTRA 3P42A 4MGKE 1VDVA 4HVBA 3B2FA 2GBRA 2BS4B 2LXAA 2OJWA 1NYQA 2KZRA 1ZW7A 4IWPA 1DYQA 2KLCA 2PE6B 4NJCA 1TGZB 1UZXB 1VZ6A 2KWDA 2FUHB 2V3PA 1E6EB 2ZZPB 3VUXA 2BB6A 1GC6A 1D5ZC 3DOWA 4MGIE 5LXIB 1GB1A 4W9LA 5E6OA 1OTRB 2IDYA 3TCAA 4OZAA 3ZRFA 1EUVB 4B0MA 1TS3A 2D3CA 3DBLI 2MP2A 3W2DA 3WALA 2LGIA 1FO4A 5IKCM 4N6EB 4L2YA 1QKZA 1MG4A 1F52A 2O6VA 1XCTL 3M62B 4ZYNA 2IO2B 2KQ4X 3N32A 5BYRA 4P7IA 1KF6B 3AECB 4WJNA 2BVCA 3LXFA 1QOGA 1K53A 3AU5A 4N9F4 4MDKE 4JL9A 2KVRA 2SAKA 5CHVC 4YT0B 3PSEB 1UGJA 5HFYA 1J7CA 4AJWA 3SFDB 4TSSA 4K3CA 4A3OA 2KC1A 2KT7A 2MX2A 2KMMA 4BAXA 1SE9A 2K5PA 1SXTA 2G1EA 1QLBB 2W3RA 4ZRJA 5H8YE 2O6VD 3JSVA 1C79A 2W82A 1HTQA 2LASA 4HPPA 1ZXHA 3VR9B 4C00A 2BB5A 3TMPB 4HEA1 1BT0A 3KYDD 3DBSA 1WFYA 1BXTA 4WH4A 4K3BA 1PDXA 1R4NB 3ZVVA 2CU1A 4MELA 2LHEA 2DAJA 4G50A 4KDIC 4IOIE 2ZNVC 4C56C 2K22A 3SEBA 3VTWA 2TSSA 4WWNA 2JWUA 2PVOD 2MEKA 4AS1A 1JWAD 1Q1OA 3BIID 4WWPA 1FCCC 1KTKA 2KNBA 5AZGA 1VZ8A 2DAFA 3ZNZB 3ZXVA 4II3B 2LGDA 3AE4B 3HM6X 4HLEA 4C7ZA 2FIDA 1L0VB 5BMGA 3N9YC 2NTTA 4AUQC 1PYWD 1NENB 5GMVA 3TBLD 2YVCA 2GMIC 1WJ6A 2DNFA 1TY2A 2KFKA 3Q3MC 2CU3A 1IPGA 1K8RB 2QCZA 3WAPA 4LDTB 3P4SB 5IA7A 4FHJA 2PIAA 1E10A 4W9JA 1D4BA 1C4PA 3ZNID 1K50A 2M19A 3ZDTA 3C8YA 3K9OB 4KZ0A 1UWXA 2V4IB 3ZGZA 2Y5PA 3M63B 3RNGC 2NBUA 1L2NA 3KYCD 1ZDVA 2VZKB 1V97A 1CMXB 2LD9A 1LM8B 2LVOA 4MGYE 3ZJTA 1JW9D 1QZEA 2BYFA 2W9NA 2BKFA 3FILA 3U30A 1WMHB 3AEFB 2DZKA 1J8CA 4IWQA 2K6DB 4X57B 2XK5B 3PHWB 1FNUA 1K52A 2MSED 1WXVA 1CZPA 3GZNI 3N3KB 2QJLA 2M0AA 3A9JB 2CKHB 2DX5B 4BVUC 3DQVA 2N7JA 4YTPB 2NVUI 1V1OA 3N1XC 4GN1A 4J3OD 2LUMA 1IYFA 2AQ2B 3AEDB 1YOVB 3M95A 3R7RA 2KWCA 3VXWA 3B9JA 1V86A 3VUWA 3MHSD 3OG5A 4XWTA 2J53A 3DVGY 2L3ZA 4EE2A 3EECA 1ZKHA 4LNOA 1WJUA 2MJEA 3IHPC 2BWFA 3Q8CA 2MBEA 2LZ6A 1AWDA 1VCBA 5J18A 3EHVA 4LNKA 4DXAB 5BMHA 4MH8A 1OQRA 2DYOA 2GBMA 2YEPF 3RUIB 3WCQA 3ZKJC 2M8SA 5CTRC 2MH7A 3B0AA 3VR8B 2WXKA 2JX5A 3FAHA 4DWFA 3KUZA 2KN5A 3CF6E 1GC7A 2O2VB 2JSVX 4II2B 4GMVA 1Y8RC 2G4SA 4KIKA 1KM7A 3UIPB 2LGSA 4XZ4A 2X38A 4LDTD 2PJHA 4HXDA 2N4FA 4EZKA 4KGRA 2LI5A 3W1YA 1NI3A 2J42A 1YX6B 2AQ3B 4A90A 4NY0A 2KC2A 4OZBA 4BBNC 1WJNA 3BK1A 1EWCA 1JWUD 1MG8A 2LMCA 2MJDA 4E74A 3WIMA 4JE3B 3AV8A 4RNAA 1JWBD 3WA0A 2WXQA 1GOZA 2K6QA 1GPXA 1R4MI 3EA6A 3AM9A 1WY8A 3PZDA 1UD7A 2L76A 4BBNF 3ABVB 1RM6C 1JWMD 3H8HA 4MGZE 2WYQA 4AQ7A 2KWVB 2K8HA 4TV3A 4ZHOA 2CJOA 3BINA 5TR5A 4LNFA 4KVGB 4GOCA 2L7RA 4C7YA 1WIAA 4JIOU 1I4RA 1TBEA 2V0GA 1ZPSA 1QT9A 3MC9A 4DHJB 3ZNHB 1LXDA 2WU2B 4MEMA 5AZHA 2HD5B 4XYCA 3RYTA 3QAQA 3ALBA 4A8XC 1F1HA 3CMMB 3VDZA 4NZLB 1YIWA 4A20A 5EE0A 2R61A 3ZXRA 3RMKC 3AMZA 1HA5A 2ZW1A 3JYUA 4IW0A 3H9DA 1M94A 3I57A 3RPFC 2MA9B 4KDLB 5D6JB 3IT4B 3ZJUA 5AUIA 5TSSA 1WWTA 4WJQA 2R2OA 1TT5B 1V8CA 1ZDXA 4FJVB 2ZW0A 5DPRA 3ZTDA 1AN8A 1D5XC 4A6QA 2AWTA 4ASWC 4RF1A 1T6BX 1NVID 3R2TA 2GOWA 4W9GA 4CYEA 2O2VA 2L0FA 2ZCCA 1WGDA 3GP7A 4GDLB 3RFZB 3PLVA 5J2RA 2BBCA 2ZNVB 2OEDA 2BGFA 2WQYB 2UYZB 4P16A 2PW9A 3NUHB 1KOTA 2AL6A 2JQRB 2I1KA 1PUTA 4MH0E 3SFEB 3ENEA 3LYYA 5FK9C 3OWEB 2K8CA 1ZGUB 1YNTE 3N1ZC 4W9CA 1YD8U 1V1PA 2LVPA 2RGFA 3MJWA 3IAS1 3SU8X 2ZEQA 2DENB 2JY6A 3NVYA 2DHZA 3VRAB 4YTNB 1XLOA 3OAWA 1SEBD 1P3QU 4YL8A 2BT6A 4N59A 1HZ5A 3AH7A 1MHXA 3P1MA 4HCNB 2LEKA 5BYQA 4MACA 1I4XA 4XWWA 3PV1A 1WJ4A 4CHKA 4YWGG 2KFJA 2JPHA 4IM3A 2M17A 3GS2A 4HJKA 4S17A 3BYTB 4P1BC 4G3XB 5FR6A 3NG0A 1P7EA 3ZJVA 1WZ0A 3QHTA 1Q10A 2KDMA 2QHOA 2WXJA 1DOYA 1G6JA 2KMCA 3P4PB 2J0KA 2KX3A 1WSPA 3T3OA 2C5LC 2L8JA 2LGYA 3UI3A 1E0ZA 1SIJA 4RH6A 5T8IA 5CX3A 3KW5B 3MP9A 4CO7A 4IM2A 3VHTC 1YJ1A 4PS7A 4YSXB 3AE1B 3B2GA 2WDTB 5FR3A 3NY5A 4GB9A 4K1RB 3SDLC 1NBFC 5L83A 2OJRA 2J7QB 2J0MA 3L08A 3UINB 1P9DU 3L54A 4PS8A 5HKHA 2N1VA 2WXMA 2L00B 2BPSA 4YSYB 3SD5A 3ONSA 1N5WA 1L6VA 2X8XX 2MBOA 1L6UA 3DPDA 3EUB2 2INCC 1IBXA 1GJZA 2N9XA 3W5UB 2IO0B 3VH3B 2EMSA 1MVKA 4I6LB 2HTME 4IM0A 2M4NA 1QF6A 1TYGB 2C60A 3H7SA 4L1BA 4EOYA 4EZJA 5DPTA 1Z2MA 3NZUA 1WE6A 5JHBA 3H1UA 4LK0M 5G5HA 2DYMA 1RLFA 4S0RA 2D3AA 4HPMB 2O6VB 1CJEA 2AX5A 1I4GA 3QC8B 1C9FA 2QC8A 5C1ZA 1V80A 2V1YA 2JYEA 1UGMA 1FM0D 1NYRA 2FCQA 4M8NA 1WX7A 2A5UA 1TS4A 1VRAB 1U4AA 2IO3B 5MPOA 3TJPA 4DDID 3P63A 2L83A 3Q3JA 3C0RB 1FMAD 3APCA 4C80A 3NOBA 3MC8A 2J4XA 2MJ3A 3L0WB 2JRHA 2WX0A 2REXA 3K9PB 1SJHD 1WM2A 4QAYA 2BYTA 2V9HA 2MBHA 4M0WA 4OW0A 1OEYA 2JZZA 2WXOA 1XLPA 4RF0A 2DYBA 1FIQA 3WAOA 3JSVB 2N9PC 4WJOA 5D2MB 1DGJA 4UDUC 2JWZA 3IAM1 1VD2A 3TEZA 2WWZA 2JT4B 4NQLB 3V6CB 1I42A 1H4RA 1TTNA 1OQQA 1LFDA 2HJ1A 4LNIA 2R2QA 1WXMA 3APFA 1FRDA 2RPQA 4NNJB 1YQ4B 3TEWA 1SE2A 3HVDA 4MM3B 3I9V1 3Q3OC 2LWPA 4FADA 2IZVB 1R4NI 1E5WA 1QOBA 3RNAC 3A9KA 2KWUB 3ML9A 2ZJDA 2GI9A 4YTMB 1FXAA 1WYGA 4FXCA 1E7UA 2BYEA 4ZOHC 3O65B 3L4PA 3HVZA 3VVWB 2G3QB 4E3CA 3Q3NC 1YN5A 3BK2A 3EC8A 3AEEB 1OEYJ 1RAXA 5LLIA 2ACZB 3A1QB 2KJRA 2BF8B 4NAMA 2IPKD 2LRUA 3ZDMC 3PREA 3V6EB 4OVUA 2NBVB 2YLMA 3A9JA 4OZCA 4BKSA 3GB1A 4XDDA 3RCZA 4F8CB 2G4DB 2K25A 1HZ6A 2PE9A 2RDGA 2QDFA 3J9CA 2DBYA 2CHWA 2Y3AA 5IN7A 1ET9A 1WMHA 3P4RB 2W3SA 2UU7A 4WJPA 3CWIA 4B9KA 3TUOA 1YMHE 1D3ZA 2EELA 3ZQ4A 4FA6A 2MP2B 3KWLA 4L23A 4FBJB 1FD6A 3IG3A 2NPTA 2NBWB 2C9WB 3B08A 4IKGA 2KMAA 2MWSB 4WIPA 2HTHA 4KSLC 1N6ZA 4RGTA 1ENFA 4GSWA 3EGRA 1KH0A 3ECIA 3UF8A 1JQ4A 4XE0A 1T5XD 2K39A 2Q5WD 2WHIA 1XEEA 4ZRPA 4NJ6A 3L13A 2LHDA 2IBIB 3NZ3A 4KIKB 2A4ZA 2CHZA 2WXPA 3IFWB 4GU2A 2KX0A 3LJ3A 5BO4B 2C7MB 2N1WA 2AEHA 4FLHA 1VLBA 3AN1A 1L4DB 5DPWA 1WXAA 3ZRCA 3KQ4A 1M4VA 1UWMA 5BYSA 1FNWA 1V1PB 2XNAC 1F2RC 2PPHA 1FRRA 5GXGB 2BYVE 1TKYA 3AE7B 3RT3B 2VZKD 1ZOYB 3ZUNA 2ASQA 3Q3FA 2PLPA 4R3DA 2D2QA 3DBHB 4DQOC 4JLCA 1Y56A 2OHFA 4LTUA 3I5JC 3PHXB 5AZFA 3KWVA 4EUTA 1N61A 4RCOA 4XDCA 2WXRA 1JALA 4ZHPA 2GB1A 5DCNA 3DVGX 4HKZE 4M0WB 3AXCA 2WXLA 3PTFC 1IGDA 2V3NA 3KUDB 1V6EA 2JXTA 4ITKA 2JRIB 1ZUD2 3HK0A 1WE7A 4A3PA 4TQ1A 1NDDA 5JXVA 4TMAB 3T9LA 4PS3A 5C2TB 5JHAA
chains in the Genus database with same CATH topology
3RZFA 4W9IA 3WALA 2Z0DB 2OOBB 1E7VA 2BGFA 3AI5A 2M0XA 3JVZX 3W1SC 3QCAA 3OJ3A 2UYZB 1WF9A 1KOTA 2AL6A 3A1QA 1WR1A 3ZO5B 2I1KA 2EKEC 4MH0E 3DVNV 2O6VA 4ICVA 4FJZA 3ENEA 3DBHI 3M62B 4ZYNA 2K8CA 1ZGUB 1C1YB 2IO2B 3N32A 4P7IA 2CHXA 4W9CA 1YD8U 1C3TA 2KXJA 3OLMD 2LVPA 2MCNB 2RGFA 3MJWA 3ZIMA 2D3GA 4WJNA 1AARA 1V2YA 2KHWB 3SU8X 1H8CA 3I3TB 2ZEQA 2DENB 2JY6A 5LXHA 3AU5A 4HCPB 4N9F4 3A33B 2DHZA 5JZEB 4NAWB 1V5OA 4MDKE 4DK5A 2KQSA 3OAWA 4JL9A 2KVRA 1V49A 3ZW3A 1P3QU 5CHVC 4F7ZA 3A4RA 3PSEB 4I6NB 4YL8A 1E8YA 1S3SG 1SIFA 4AJWA 3VTVA 4MM3A 4W9FA 4LJPB 2L0TA 2M1MA 4A3OA 2KC1A 5JHAA 4HCNB 4ICUA 2MX2A 3PV1A 1WJ4A 3V61A 1SE9A 4CHKA 2AL3A 3QX1A 3NHEB 2KTFA 3GOEA 4GXBA 2KFJA 3IBEA 4TQ0A 2JPHA 4IWOA 4ZRJA 2DZIA 4IM3A 2O6VD 2M17A 3CSTA 2ZVOA 3QA8A 3KH0A 1E8ZA 4HDQA 4HJKA 2XK5A 4DHZE 4GDKA 4G3XB 5FR6A 3QK0A 4GIVA 3W1SA 1WZ0A 2V4LA 3JSVA 3QHTA 4E71A 2LASA 2QHOA 1WX9A 4MJSB 5KHOA 1G6JA 5CHWA 3PVLA 2KMCA 4MSQB 2J0KA 2KX3A 1E8WA 2NCNA 4ANXA 4BFRA 2C5LC 4ZDVA 2L8JA 2LGYA 3TMPB 2KK8A 3KUCB 2CS4A 4W9EA 4BKGA 2V3SA 3APDA 5CX3A 1Q5WB 2N7DA 3KW5B 2BWES 4CO7A 4IM2A 1BT0A 3KYDD 3PT2B 3VHTC 2UWQA 3DBSA 1WFYA 4K7WA 2KDIA 1YJ1A 3VH4B 1KJTA 4W9KA 3MTNB 4PS7A 5JH5C 4K7SA 2WDTB 3NY5A 3PRPB 3VUYA 1T0YA 3ZVVA 2CU1A 4GB9A 4K1RB 4MELA 4RM9A 3SDLC 1NBFC 2DAJA 4G50A 5L83A 4KDIC 3HIZA 2ZNVC 2OJRA 3VTWA 4OVVA 4MSMB 2J7QB 2MBQA 4BOZB 4WWNA 2J0MA 3L08A 3UINB 1P9DU 3L54A 4PS8A 5HKHA 2G45B 2N1VA 4NJ7A 1IP9A 4KV2A 1Q1OA 2L00B 2BPSA 3UIOB 4B95A 4XC2A 3DDCB 4GGQA 5CHFA 4WWPA 2KNBA 3SD5A 2MLBA 3ONSA 5AZGA 2DAFA 3ZNZB 2MBOA 2IY0B 4II3B 2LGDA 2KQ7A 3HM6X 3UGBB 4HLEA 3M3JA 3DPDA 1WM3A 1JRUA 2FIDA 5J17A 1GJZA 2N9XA 2FCMA 4WAAA 1WRDB 2FAZA 5C23A 2KFKB 2IO0B 4NAWA 3VH3B 2EMSA 3HM3A 4AUQC 3T8MA 2LUEA 4I6LB 4IM0A 5GMVA 3TBLD 2YVCA 1WR6E 2KLGA 2KJHB 2M4NA 2GMIC 1WJ6A 1WH3A 2C60A 3H7SA 3R3MA 2N9EB 4EOYA 3ZTCA 4EZJA 5DPTA 1Z2MA 3NZUA 2KFKA 1WE6A 2B3AA 5JHBA 1RRBA 3H1UA 4DBGA 2ZCBA 1IPGA 3UQBA 1K8RB 2DYMA 1RLFA 4IG7B 2MRPA 3WAPA 4PYUA 4LDTB 4HPMB 2O6VB 3QWZB 4IUMB 3QC8B 2KOXA 3OJ4B 4ZRKA 1GG3A 5C1ZA 1V80A 2V1YA 4EZLA 1WGRA 3TL5A 2K1FA 1UGMA 1WZ3A 2LXCA 5IA7A 3EFUA 1E90A 3H7PB 4FHJA 2FCQA 2IYDB 4M8NA 2AYOB 1WX7A 4W9JA 4ANVA 1LQBA 2A5UA 4GDLA 3ZNID 3X0WA 5AEKB 1U4AA 2IO3B 3PRZA 3ZLZA 2IO1B 3ZDTA 3TJPA 4DDID 3Q3JA 3C0RB 3K9OB 4KZ0A 1L7YA 1KLVA 2BKRB 1YX5B 3APCA 2NPTB 4ANWA 5L95C 3M63B 5D7GA 3NOBA 2NBUA 1L2NA 3KYCD 3L0WB 2JRHA 2WX0A 3SHQA 2REXA 4F1SA 1CMXB 2LD9A 1EF5A 1LM8B 3K9PB 2LVOA 1EO6A 3QARA 4MGYE 3DVNU 3U8ZA 1WM2A 4FHKA 2LRWA 1QZEA 2BYFA 3PLUA 4G11A 2MBHA 2W9NA 2BKFA 2N7EA 4MJSA 3U30A 3IVFA 1OEYA 2JZZA 4K7UA 5IAAC 1WMHB 2FNJB 2DYBA 2DZKA 1J8CA 3WAOA 3JSVB 1S1QB 2N9PC 4WJOA 3PRMB 4IWQA 5D2MB 2K6DB 3R7QA 4DDGD 2JWZA 2HJ8A 2MQJA 4X57B 2XK5B 3PHWB 1VD2A 3WAMA 1OQYA 2MSED 1WXVA 2VRRB 3GZNI 3N3KB 2WWZA 2JT4B 4NQLB 4RMAA 3V6CB 1I42A 3A9JB 2XEWA 1TTNA 1H4RA 1WYWB 1LFDA 4FULA 4IC7B 2CKHB 2I1JA 2R2QA 2DX5B 1J19A 1GUAB 4BVUC 3WANA 1WXMA 3APFA 3DQVA 2RPQA 4NNJB 3L16A 4FN2A 1WGGA 3D32A 2NVUI 1PQSA 2Z0EB 4AP4C 4GN1A 2C7NB 3AULA 3AU4A 4HPLB 1IYFA 2LWPA 4FADA 2IZVB 1R4NI 1E5WA 1OGWA 2KKCA 3M95A 3QQ8B 3R7RA 2KWCA 3QJZA 3A9KA 3VXWA 2KWUB 1GNUA 3ML9A 2ZJDA 2JXXA 1V86A 4ZRIA 3VUWA 2K8BA 3H7PA 5G55A 3MHSD 4HWIB 1XQQA 1E7UA 2BYEA 2ZPNA 3LDZE 3DVGY 3O65B 2L3ZA 1TZ1A 1X1MA 3VTUA 3EECA 3VVWB 1ZKHA 1WJUA 5G2NA 3IHPC 2DZJA 2G3QB 2BWFA 2D11A 2RR9A 2MBEA 2KDBA 2LZ6A 4KSKC 4E3CA 1A5RA 4WQOB 4W9DA 2FIFA 3PS6A 1VCBA 3HHMA 5J18A 3EC8A 1NI2A 2C7HA 3EHVA 1OEYJ 3S2AA 2ZVNA 2KJ6A 1RAXA 5LLIA 4DXAB 4EKUA 2RSUA 2J0JA 4LCDE 3A1QB 2KJRA 2BF8B 1E8XA 2KDEB 2LRUA 3ZDMC 3PREA 3V62A 2DYOA 2GBMA 3RUIB 3V6EB 4M8MA 1F9JA 2GBKA 3CSFA 4OVUA 2M8SA 3ZKJC 5CTRC 2NBVB 2YLMA 3A9JA 4BKSA 4RM8A 5EDSA 4DHJD 3RCZA 3B0AA 1I35A 4F8CB 2G4DB 3A9KB 2K25A 4DWFA 3N30A 2HE7A 2KN5A 2PE9A 3CF6E 3KUZA 2JF5A 2L05A 1GC7A 2O2VB 1V9JA 2CHWA 4EEWA 5KHQA 3P2BA 1WI0A 1WMHA 4GMVA 1HE8A 4II2B 1P0RA 3ZNGC 1Y8RC 2LJ5A 3NZSA 4BKTA 1FXTB 2CR5A 2G4SA 4WJPA 4KIKA 4B9KA 2D07B 1KM7A 3UIPB 1D3ZA 4TKNA 4XZ4A 4DHZB 5D94A 4LDTD 2PJHA 4ANUA 4HXDA 2N4FA 4EZKA 4FA6A 2MP2B 4EFOA 2LI5A 4FBJB 3W1YA 1XD3B 4JQWC 4LJOB 1UELA 2RD0A 4K81A 1Z5SB 1YX6B 3IG3A 2FCNA 1WGHA 2NPTA 2NBWB 2C9WB 3B08A 4NY0A 2KC2A 2KMAA 3VFKA 1YQBA 2MWSB 2HTHA 4NQKE 4KSLC 2NR2A 1WJNA 4HDOA 4WWOA 1WGYA 1MG8A 4GSWA 4BBNC 3PPAA 4GDKB 3WIMA 4E74A 3ECIA 3UF8A 3L17A 4URKA 1V81A 4PYZA 4J6IA 3QIJA 4BOSC 2K39A 5DPSA 1P98A 4NJ6A 3L13A 3RZWC 3WA0A 3KVFB 2IBIB 2KTRB 2K6QA 3VAWA 3A4SC 4KIKB 1R4MI 2A4ZA 4BKSD 1WY8A 3RD2A 3PZDA 2CHZA 1UD7A 2WX1A 3IFWB 4W9HA 2L76A 2MBBB 4BBNF 2Y5BB 3VQIA 2JUOA 4GU2A 4FJYA 2KX0A 4MGZE 2WYQA 3LJ3A 5BO4B 3RULA 2C7MB 2KWVB 2K8HA 2N1WA 4TV3A 2AEHA 4XX5A 3V60A 1J0GA 4NPNA 2EMTA 4TUUA 4FLHA 4KZCA 2NS5A 4I6PA 3BINA 3L10B 5DPWA 1WXAA 3ZRCA 5TR5A 4AJYB 1RFAA 4HK2A 1Q0WB 2GBNA 3R66C 4KVGB 4GOCA 1V5TA 2L7RA 3H6NA 1WIAA 2PPHA 2ZPYA 5E6NA 3NS8A 2BYVE 4JIOU 1TBEA 3RT3B 1SGHA 3UQAA 2KD0A 3ZUNA 3B1LX 2ASQA 3Q3FA 4B6WA 2D2QA 2JZ3B 2IY1B 1WX8A 4DHJB 3PGEA 3ZNHB 4JLCA 1LXDA 4AWJA 2XBBC 2DZMA 2KTRA 3BY4B 4MEMA 4MGKE 5AZHA 2LVQA 2HD5B 4HVBA 1EF1A 1P1AA 2FCSA 3PHXB 4JGHB 5E6PA 2GBRA 5AZFA 3RYTA 3QAQA 2GBJA 2LXAA 3ALBA 2KO3A 3CMMB 4EUTA 2KZRA 3VDZA 1YIWA 1ZW7A 4A20A 2MW5A 4IWPA 2KLCA 2LGXA 1WXSA 2PE6B 2D10A 1TGZB 3JYUA 4IW0A 3H9DA 1UBIA 5DCNA 1UZXB 3DVGX 1M94A 4M0WB 1UH6A 2MA9B 2FUHB 4KDLB 5D6JB 2PEAA 3U7DA 3AXCA 3ML8A 1XT9B 2ZZPB 4WJQA 3VUXA 2R2OA 4FJVB 2KANA 3PTFC 3DBRI 3KUDB 4AOFA 1V6EA 2Z59B 5DPRA 3ZTDA 1GC6A 2JRIB 3DOWA 4MGIE 4G0NB 5LXIB 2AWTA 3DCGA 3HK0A 4ASWC 1ISNA 1WE7A 4W9LA 1UBQA 5E6OA 1OTRB 3X23A 2KDFB 2GOWA 4W9GA 4A3PA 4CYEA 4TQ1A 1NDDA 3TCAA 2O2VA 3ZRFA 2L0FA 2ZCCA 1EUVB 3T9LA 1WGDA 4GDLB 4PS3A 3PLVA 5J2RA 2JVCA 3DBLI 3JW0X 2MP2A 2ZNVB 3TIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZF A;  4W9I A;  3WAL A;  2Z0D B;  2OOB B;  1E7V A;  2BGF A;  3AI5 A;  2M0X A;  3JVZ X;  3W1S C;  3QCA A;  3OJ3 A;  2UYZ B;  1WF9 A;  1KOT A;  2AL6 A;  3A1Q A;  1WR1 A;  3ZO5 B;  2I1K A;  2EKE C;  4MH0 E;  3DVN V;  2O6V A;  4ICV A;  4FJZ A;  3ENE A;  3DBH I;  3M62 B;  4ZYN A;  2K8C A;  1ZGU B;  1C1Y B;  2IO2 B;  3N32 A;  4P7I A;  2CHX A;  4W9C A;  1YD8 U;  1C3T A;  2KXJ A;  3OLM D;  2LVP A;  2MCN B;  2RGF A;  3MJW A;  3ZIM A;  2D3G A;  4WJN A;  1AAR A;  1V2Y A;  2KHW B;  3SU8 X;  1H8C A;  3I3T B;  2ZEQ A;  2DEN B;  2JY6 A;  5LXH A;  3AU5 A;  4HCP B;  4N9F 4;  3A33 B;  2DHZ A;  5JZE B;  4NAW B;  1V5O A;  4MDK E;  4DK5 A;  2KQS A;  3OAW A;  4JL9 A;  2KVR A;  1V49 A;  3ZW3 A;  1P3Q U;  5CHV C;  4F7Z A;  3A4R A;  3PSE B;  4I6N B;  4YL8 A;  1E8Y A;  1S3S G;  1SIF A;  4AJW A;  3VTV A;  4MM3 A;  4W9F A;  4LJP B;  2L0T A;  2M1M A;  4A3O A;  2KC1 A;  5JHA A;  4HCN B;  4ICU A;  2MX2 A;  3PV1 A;  1WJ4 A;  3V61 A;  1SE9 A;  4CHK A;  2AL3 A;  3QX1 A;  3NHE B;  2KTF A;  3GOE A;  4GXB A;  2KFJ A;  3IBE A;  4TQ0 A;  2JPH A;  4IWO A;  4ZRJ A;  2DZI A;  4IM3 A;  2O6V D;  2M17 A;  3CST A;  2ZVO A;  3QA8 A;  3KH0 A;  1E8Z A;  4HDQ A;  4HJK A;  2XK5 A;  4DHZ E;  4GDK A;  4G3X B;  5FR6 A;  3QK0 A;  4GIV A;  3W1S A;  1WZ0 A;  2V4L A;  3JSV A;  3QHT A;  4E71 A;  2LAS A;  2QHO A;  1WX9 A;  4MJS B;  5KHO A;  1G6J A;  5CHW A;  3PVL A;  2KMC A;  4MSQ B;  2J0K A;  2KX3 A;  1E8W A;  2NCN A;  4ANX A;  4BFR A;  2C5L C;  4ZDV A;  2L8J A;  2LGY A;  3TMP B;  2KK8 A;  3KUC B;  2CS4 A;  4W9E A;  4BKG A;  2V3S A;  3APD A;  5CX3 A;  1Q5W B;  2N7D A;  3KW5 B;  2BWE S;  4CO7 A;  4IM2 A;  1BT0 A;  3KYD D;  3PT2 B;  3VHT C;  2UWQ A;  3DBS A;  1WFY A;  4K7W A;  2KDI A;  1YJ1 A;  3VH4 B;  1KJT A;  4W9K A;  3MTN B;  4PS7 A;  5JH5 C;  4K7S A;  2WDT B;  3NY5 A;  3PRP B;  3VUY A;  1T0Y A;  3ZVV A;  2CU1 A;  4GB9 A;  4K1R B;  4MEL A;  4RM9 A;  3SDL C;  1NBF C;  2DAJ A;  4G50 A;  5L83 A;  4KDI C;  3HIZ A;  2ZNV C;  2OJR A;  3VTW A;  4OVV A;  4MSM B;  2J7Q B;  2MBQ A;  4BOZ B;  4WWN A;  2J0M A;  3L08 A;  3UIN B;  1P9D U;  3L54 A;  4PS8 A;  5HKH A;  2G45 B;  2N1V A;  4NJ7 A;  1IP9 A;  4KV2 A;  1Q1O A;  2L00 B;  2BPS A;  3UIO B;  4B95 A;  4XC2 A;  3DDC B;  4GGQ A;  5CHF A;  4WWP A;  2KNB A;  3SD5 A;  2MLB A;  3ONS A;  5AZG A;  2DAF A;  3ZNZ B;  2MBO A;  2IY0 B;  4II3 B;  2LGD A;  2KQ7 A;  3HM6 X;  3UGB B;  4HLE A;  3M3J A;  3DPD A;  1WM3 A;  1JRU A;  2FID A;  5J17 A;  1GJZ A;  2N9X A;  2FCM A;  4WAA A;  1WRD B;  2FAZ A;  5C23 A;  2KFK B;  2IO0 B;  4NAW A;  3VH3 B;  2EMS A;  3HM3 A;  4AUQ C;  3T8M A;  2LUE A;  4I6L B;  4IM0 A;  5GMV A;  3TBL D;  2YVC A;  1WR6 E;  2KLG A;  2KJH B;  2M4N A;  2GMI C;  1WJ6 A;  1WH3 A;  2C60 A;  3H7S A;  3R3M A;  2N9E B;  4EOY A;  3ZTC A;  4EZJ A;  5DPT A;  1Z2M A;  3NZU A;  2KFK A;  1WE6 A;  2B3A A;  5JHB A;  1RRB A;  3H1U A;  4DBG A;  2ZCB A;  1IPG A;  3UQB A;  1K8R B;  2DYM A;  1RLF A;  4IG7 B;  2MRP A;  3WAP A;  4PYU A;  4LDT B;  4HPM B;  2O6V B;  3QWZ B;  4IUM B;  3QC8 B;  2KOX A;  3OJ4 B;  4ZRK A;  1GG3 A;  5C1Z A;  1V80 A;  2V1Y A;  4EZL A;  1WGR A;  3TL5 A;  2K1F A;  1UGM A;  1WZ3 A;  2LXC A;  5IA7 A;  3EFU A;  1E90 A;  3H7P B;  4FHJ A;  2FCQ A;  2IYD B;  4M8N A;  2AYO B;  1WX7 A;  4W9J A;  4ANV A;  1LQB A;  2A5U A;  4GDL A;  3ZNI D;  3X0W A;  5AEK B;  1U4A A;  2IO3 B;  3PRZ A;  3ZLZ A;  2IO1 B;  3ZDT A;  3TJP A;  4DDI D;  3Q3J A;  3C0R B;  3K9O B;  4KZ0 A;  1L7Y A;  1KLV A;  2BKR B;  1YX5 B;  3APC A;  2NPT B;  4ANW A;  5L95 C;  3M63 B;  5D7G A;  3NOB A;  2NBU A;  1L2N A;  3KYC D;  3L0W B;  2JRH A;  2WX0 A;  3SHQ A;  2REX A;  4F1S A;  1CMX B;  2LD9 A;  1EF5 A;  1LM8 B;  3K9P B;  2LVO A;  1EO6 A;  3QAR A;  4MGY E;  3DVN U;  3U8Z A;  1WM2 A;  4FHK A;  2LRW A;  1QZE A;  2BYF A;  3PLU A;  4G11 A;  2MBH A;  2W9N A;  2BKF A;  2N7E A;  4MJS A;  3U30 A;  3IVF A;  1OEY A;  2JZZ A;  4K7U A;  5IAA C;  1WMH B;  2FNJ B;  2DYB A;  2DZK A;  1J8C A;  3WAO A;  3JSV B;  1S1Q B;  2N9P C;  4WJO A;  3PRM B;  4IWQ A;  5D2M B;  2K6D B;  3R7Q A;  4DDG D;  2JWZ A;  2HJ8 A;  2MQJ A;  4X57 B;  2XK5 B;  3PHW B;  1VD2 A;  3WAM A;  1OQY A;  2MSE D;  1WXV A;  2VRR B;  3GZN I;  3N3K B;  2WWZ A;  2JT4 B;  4NQL B;  4RMA A;  3V6C B;  1I42 A;  3A9J B;  2XEW A;  1TTN A;  1H4R A;  1WYW B;  1LFD A;  4FUL A;  4IC7 B;  2CKH B;  2I1J A;  2R2Q A;  2DX5 B;  1J19 A;  1GUA B;  4BVU C;  3WAN A;  1WXM A;  3APF A;  3DQV A;  2RPQ A;  4NNJ B;  3L16 A;  4FN2 A;  1WGG A;  3D32 A;  2NVU I;  1PQS A;  2Z0E B;  4AP4 C;  4GN1 A;  2C7N B;  3AUL A;  3AU4 A;  4HPL B;  1IYF A;  2LWP A;  4FAD A;  2IZV B;  1R4N I;  1E5W A;  1OGW A;  2KKC A;  3M95 A;  3QQ8 B;  3R7R A;  2KWC A;  3QJZ A;  3A9K A;  3VXW A;  2KWU B;  1GNU A;  3ML9 A;  2ZJD A;  2JXX A;  1V86 A;  4ZRI A;  3VUW A;  2K8B A;  3H7P A;  5G55 A;  3MHS D;  4HWI B;  1XQQ A;  1E7U A;  2BYE A;  2ZPN A;  3LDZ E;  3DVG Y;  3O65 B;  2L3Z A;  1TZ1 A;  1X1M A;  3VTU A;  3EEC A;  3VVW B;  1ZKH A;  1WJU A;  5G2N A;  3IHP C;  2DZJ A;  2G3Q B;  2BWF A;  2D11 A;  2RR9 A;  2MBE A;  2KDB A;  2LZ6 A;  4KSK C;  4E3C A;  1A5R A;  4WQO B;  4W9D A;  2FIF A;  3PS6 A;  1VCB A;  3HHM A;  5J18 A;  3EC8 A;  1NI2 A;  2C7H A;  3EHV A;  1OEY J;  3S2A A;  2ZVN A;  2KJ6 A;  1RAX A;  5LLI A;  4DXA B;  4EKU A;  2RSU A;  2J0J A;  4LCD E;  3A1Q B;  2KJR A;  2BF8 B;  1E8X A;  2KDE B;  2LRU A;  3ZDM C;  3PRE A;  3V62 A;  2DYO A;  2GBM A;  3RUI B;  3V6E B;  4M8M A;  1F9J A;  2GBK A;  3CSF A;  4OVU A;  2M8S A;  3ZKJ C;  5CTR C;  2NBV B;  2YLM A;  3A9J A;  4BKS A;  4RM8 A;  5EDS A;  4DHJ D;  3RCZ A;  3B0A A;  1I35 A;  4F8C B;  2G4D B;  3A9K B;  2K25 A;  4DWF A;  3N30 A;  2HE7 A;  2KN5 A;  2PE9 A;  3CF6 E;  3KUZ A;  2JF5 A;  2L05 A;  1GC7 A;  2O2V B;  1V9J A;  2CHW A;  4EEW A;  5KHQ A;  3P2B A;  1WI0 A;  1WMH A;  4GMV A;  1HE8 A;  4II2 B;  1P0R A;  3ZNG C;  1Y8R C;  2LJ5 A;  3NZS A;  4BKT A;  1FXT B;  2CR5 A;  2G4S A;  4WJP A;  4KIK A;  4B9K A;  2D07 B;  1KM7 A;  3UIP B;  1D3Z A;  4TKN A;  4XZ4 A;  4DHZ B;  5D94 A;  4LDT D;  2PJH A;  4ANU A;  4HXD A;  2N4F A;  4EZK A;  4FA6 A;  2MP2 B;  4EFO A;  2LI5 A;  4FBJ B;  3W1Y A;  1XD3 B;  4JQW C;  4LJO B;  1UEL A;  2RD0 A;  4K81 A;  1Z5S B;  1YX6 B;  3IG3 A;  2FCN A;  1WGH A;  2NPT A;  2NBW B;  2C9W B;  3B08 A;  4NY0 A;  2KC2 A;  2KMA A;  3VFK A;  1YQB A;  2MWS B;  2HTH A;  4NQK E;  4KSL C;  2NR2 A;  1WJN A;  4HDO A;  4WWO A;  1WGY A;  1MG8 A;  4GSW A;  4BBN C;  3PPA A;  4GDK B;  3WIM A;  4E74 A;  3ECI A;  3UF8 A;  3L17 A;  4URK A;  1V81 A;  4PYZ A;  4J6I A;  3QIJ A;  4BOS C;  2K39 A;  5DPS A;  1P98 A;  4NJ6 A;  3L13 A;  3RZW C;  3WA0 A;  3KVF B;  2IBI B;  2KTR B;  2K6Q A;  3VAW A;  3A4S C;  4KIK B;  1R4M I;  2A4Z A;  4BKS D;  1WY8 A;  3RD2 A;  3PZD A;  2CHZ A;  1UD7 A;  2WX1 A;  3IFW B;  4W9H A;  2L76 A;  2MBB B;  4BBN F;  2Y5B B;  3VQI A;  2JUO A;  4GU2 A;  4FJY A;  2KX0 A;  4MGZ E;  2WYQ A;  3LJ3 A;  5BO4 B;  3RUL A;  2C7M B;  2KWV B;  2K8H A;  2N1W A;  4TV3 A;  2AEH A;  4XX5 A;  3V60 A;  1J0G A;  4NPN A;  2EMT A;  4TUU A;  4FLH A;  4KZC A;  2NS5 A;  4I6P A;  3BIN A;  3L10 B;  5DPW A;  1WXA A;  3ZRC A;  5TR5 A;  4AJY B;  1RFA A;  4HK2 A;  1Q0W B;  2GBN A;  3R66 C;  4KVG B;  4GOC A;  1V5T A;  2L7R A;  3H6N A;  1WIA A;  2PPH A;  2ZPY A;  5E6N A;  3NS8 A;  2BYV E;  4JIO U;  1TBE A;  3RT3 B;  1SGH A;  3UQA A;  2KD0 A;  3ZUN A;  3B1L X;  2ASQ A;  3Q3F A;  4B6W A;  2D2Q A;  2JZ3 B;  2IY1 B;  1WX8 A;  4DHJ B;  3PGE A;  3ZNH B;  4JLC A;  1LXD A;  4AWJ A;  2XBB C;  2DZM A;  2KTR A;  3BY4 B;  4MEM A;  4MGK E;  5AZH A;  2LVQ A;  2HD5 B;  4HVB A;  1EF1 A;  1P1A A;  2FCS A;  3PHX B;  4JGH B;  5E6P A;  2GBR A;  5AZF A;  3RYT A;  3QAQ A;  2GBJ A;  2LXA A;  3ALB A;  2KO3 A;  3CMM B;  4EUT A;  2KZR A;  3VDZ A;  1YIW A;  1ZW7 A;  4A20 A;  2MW5 A;  4IWP A;  2KLC A;  2LGX A;  1WXS A;  2PE6 B;  2D10 A;  1TGZ B;  3JYU A;  4IW0 A;  3H9D A;  1UBI A;  5DCN A;  1UZX B;  3DVG X;  1M94 A;  4M0W B;  1UH6 A;  2MA9 B;  2FUH B;  4KDL B;  5D6J B;  2PEA A;  3U7D A;  3AXC A;  3ML8 A;  1XT9 B;  2ZZP B;  4WJQ A;  3VUX A;  2R2O A;  4FJV B;  2KAN A;  3PTF C;  3DBR I;  3KUD B;  4AOF A;  1V6E A;  2Z59 B;  5DPR A;  3ZTD A;  1GC6 A;  2JRI B;  3DOW A;  4MGI E;  4G0N B;  5LXI B;  2AWT A;  3DCG A;  3HK0 A;  4ASW C;  1ISN A;  1WE7 A;  4W9L A;  1UBQ A;  5E6O A;  1OTR B;  3X23 A;  2KDF B;  2GOW A;  4W9G A;  4A3P A;  4CYE A;  4TQ1 A;  1NDD A;  3TCA A;  2O2V A;  3ZRF A;  2L0F A;  2ZCC A;  1EUV B;  3T9L A;  1WGD A;  4GDL B;  4PS3 A;  3PLV A;  5J2R A;  2JVC A;  3DBL I;  3JW0 X;  2MP2 A;  2ZNV B;  3TIX A; 
#chains in the Genus database with same CATH topology
 4W9I A;  3AE2 B;  2OOB B;  1E7V A;  3JVZ X;  3W1S C;  3OJ3 A;  1SBB B;  1C77 A;  1WF9 A;  2BW2 A;  3A1Q A;  3U2S C;  2EKE C;  2I2Y A;  3DVN V;  4ICV A;  4FJZ A;  1CK1 A;  3DBH I;  3P4Q B;  3FKY A;  1C3T A;  4DXF A;  5H92 C;  2KXJ A;  2MHJ A;  3OLM D;  1AAR A;  1V2Y A;  3DHI C;  4P1C C;  4M01 A;  1V5O A;  4BZA A;  4DK5 A;  1V49 A;  3DWG C;  3ZW3 A;  4IDI A;  1AW7 A;  4I6N B;  4KKJ A;  1SIF A;  1S3S G;  5EE3 A;  4CQN A;  2BQQ A;  3VTV A;  4MM3 A;  1FXI A;  1ZE3 D;  1YN4 A;  2GRI A;  4ICU A;  3NVV A;  3V61 A;  3QX1 A;  4GXB A;  3NHE B;  1AYF A;  1D6E C;  1RWS A;  4IWO A;  3TEX A;  3CST A;  1BUI C;  2ZVO A;  2CJN A;  4JPS A;  4DHZ E;  4GDK A;  3R8B A;  3QK0 A;  4GIV A;  2KAC A;  4E71 A;  2QIE B;  3PVL A;  4US8 A;  3AE8 B;  1DOX A;  4MSQ B;  1E8W A;  2NCN A;  4ANX A;  4ZDV A;  1UUP A;  4W9E A;  2CS4 A;  2V3S A;  3APD A;  1Q5W B;  1JWS D;  2UWQ A;  4K7W A;  3U52 E;  3VH4 B;  4W9K A;  2BS3 B;  1QOA A;  4RM9 A;  1YN3 A;  4A55 A;  3HIZ A;  4OVV A;  4MSM B;  4BOZ B;  4H2A A;  2G45 B;  1XCQ L;  1IP9 A;  4KV2 A;  4WUR A;  4B95 A;  1LO5 D;  2L52 A;  4B0E A;  4DXG A;  4Q2J A;  1I4H A;  5EE9 A;  2MLB A;  2WXH A;  1HTO A;  2DLB A;  2IY0 B;  2KQ7 A;  1TS2 A;  3UGB B;  3M3J A;  1ROE A;  4WAA A;  5E6J A;  2ONQ A;  4RGM A;  1IGC A;  2FAZ A;  5C23 A;  2BS2 B;  3DWM A;  2EKI A;  2IJ0 A;  4RFB A;  4NAW A;  1C4C A;  3HM3 A;  3T8M A;  2YEP B;  2KLG A;  2KJH B;  3V3X A;  2LJI A;  2N9E B;  3R3M A;  3ZTC A;  1WGK A;  2B3A A;  1RRB A;  3NRZ A;  4HKQ A;  2JU6 X;  4IG7 B;  2MRP A;  3Q8F A;  3QWZ B;  3Q2A C;  2KOX A;  3OJ4 B;  4WWM A;  4ZRK A;  2LFI A;  1ZP0 B;  1YJJ A;  1WZ3 A;  2PMV A;  2LXC A;  3EFU A;  2E3T A;  3URY A;  2RMM A;  2IYD B;  2AYO B;  4ANV A;  1LQB A;  4GDL A;  1QOF A;  3X0W A;  5AEK B;  1IBX B;  3PRZ A;  2WDQ B;  2IO1 B;  1FPY A;  1IUE A;  1KLV A;  2NPT B;  5L95 C;  5D7G A;  1N63 A;  5IO9 A;  4F1S A;  5IOI A;  3U8Z A;  1KLU D;  4YXD B;  4FHK A;  1FFU A;  4KKI A;  4JWU C;  3PLU A;  4G11 A;  5HI1 A;  1N62 A;  1R7S A;  4MJS A;  3IVF A;  4K7U A;  5IAA C;  3W9C B;  4DDG D;  3R7Q A;  2HJ8 A;  2RDH A;  3WAM A;  5FKA C;  1TJE A;  1WYW B;  5HHD G;  1C4A A;  3D32 A;  1PQS A;  3IXS A;  1T0S C;  2C7N B;  3AUL A;  3AU4 A;  1TS5 A;  2KKC A;  3QQ8 B;  2E6X A;  1GNU A;  4ZRI A;  2K8B A;  3H7P A;  1XQQ A;  3LDZ E;  1TZ1 A;  4JWS C;  5G2N A;  2DZJ A;  2KDB A;  4KSK C;  2KAJ A;  3BVG A;  4WQO B;  2FIF A;  1GAQ B;  3HHM A;  2WNM A;  1NI2 A;  1ESF A;  3BVM A;  3MHZ A;  3MC0 B;  4LCD E;  2I38 A;  2KDE B;  2WXG A;  2N9L A;  1L0X B;  4HJG E;  2GBK A;  4REZ A;  4RM8 A;  5EDS A;  4DHJ D;  1I35 A;  1D5M C;  4USA A;  2HE7 A;  2K9X A;  5I4D A;  3RNC C;  2JF5 A;  2L05 A;  4MT5 A;  4OVZ A;  3P2B A;  4OHJ A;  3ZNG C;  3NZS A;  4BKT A;  1RYJ A;  1JRO A;  4TKN A;  2H88 B;  1F77 A;  4D2K A;  1MJD A;  2NMQ A;  4EFO A;  3V05 A;  1XD3 B;  4JQW C;  4LJO B;  2RD0 A;  1VR9 A;  3AEG B;  3VFK A;  4NQK E;  4HDO A;  2NR2 A;  4WWO A;  1ZXI A;  3PPA A;  4GDK B;  1KFY B;  2PVG C;  2WDR B;  4URK A;  3L17 A;  3I63 C;  4PYZ A;  2G9H D;  4J6I A;  4BOS C;  2J52 A;  5DPS A;  3Q6B A;  2XN9 C;  1F2R I;  3RZW C;  1ET6 A;  3A4S C;  1SE4 A;  3DBR B;  3AEA B;  2WX1 A;  4W9H A;  2B76 B;  2Y5B B;  3VQI A;  2JUO A;  3SR6 A;  3Q8E A;  4A9A A;  2INN E;  3RUL A;  1J0G A;  4TUU A;  2EMT A;  1A70 A;  2NS5 A;  3MJ5 A;  3L10 B;  3NJT A;  4AJY B;  3RNB C;  4ARI A;  2GBN A;  2BTE A;  3PO0 A;  2PKO A;  2AQ1 B;  1V5T A;  1EM7 A;  2ZPY A;  3GZN B;  3AB5 A;  1UF0 A;  3B1L X;  3Q8A A;  5D3I B;  2L32 A;  3ZYY X;  2NTS A;  4AWJ A;  2DZM A;  2W54 A;  2LVQ A;  1EF1 A;  1P1A A;  2FCS A;  4JGH B;  5E6P A;  2GBJ A;  2L1A A;  2KO3 A;  2MW5 A;  3O13 A;  2LGX A;  1WXS A;  2RPV A;  2D10 A;  2K3U A;  1T0Q C;  1UBI A;  1UH6 A;  3T3N A;  3NVW A;  2PEA A;  3U7D A;  3BVZ A;  4KGS A;  3ML8 A;  1XT9 B;  2KAN A;  3DBR I;  1RFK A;  4AOF A;  2Z59 B;  2FBW B;  4HRS A;  4G0N B;  5LNK 1;  3DCG A;  1ISN A;  1NEK B;  1UBQ A;  3X23 A;  1VZ7 A;  2KDF B;  3TEY A;  4PK1 A;  1CQV A;  3E9S A;  1J7A A;  1PGA A;  2JVC A;  3JW0 X;  3AEB B;  3TIX A;  1K51 A;  3RZF A;  2Z0D B;  4WAF A;  3AI5 A;  2M0X A;  3QCA A;  1SB3 C;  1L0Y B;  4RGO S;  1C78 A;  1WR1 A;  3ZO5 B;  2QEJ C;  1EU3 A;  1QIL A;  3DHH C;  1C1Y B;  2WXF A;  5BMI A;  4M00 A;  4LNN A;  2CHX A;  1ACC A;  1GB4 A;  4KGT A;  3AE6 B;  1T3Q A;  2MCN B;  3ZIM A;  2D3G A;  2KHW B;  1H8C A;  3I3T B;  3LB8 C;  4GLS C;  5LXH A;  3VRB B;  4HCP B;  1N5X A;  3A33 B;  5JZE B;  4NAW B;  5G5G A;  3BWU D;  2KQS A;  4F7Z A;  3A4R A;  1E8Y A;  1STE A;  1HQR D;  3E56 A;  5EE1 A;  1FNV A;  4W9F A;  4LJP B;  2L0T A;  1WRI A;  2M1M A;  2QMT A;  1PFD A;  3AE3 B;  2AL3 A;  1TKE A;  2KTF A;  3GOE A;  4TQ0 A;  3IBE A;  2DZI A;  3QA8 A;  2H89 B;  3KH0 A;  1E8Z A;  4HDQ A;  2XK5 A;  3RNF C;  1JRP A;  3W1S A;  2V4L A;  1SF0 A;  1R4M B;  1WX9 A;  4MJS B;  5KHO A;  1I4P A;  5CHW A;  3AE5 B;  1UNS A;  2JZP A;  4BFR A;  2GLS A;  2KK8 A;  3KUC B;  4BKG A;  2N7D A;  2KVZ A;  2BWE S;  1E7P B;  3PT2 B;  1VJK A;  1KRH A;  2KDI A;  5HG2 A;  1E9M A;  1KJT A;  5JH5 C;  3MTN B;  4K7S A;  3PRP B;  3VUY A;  1T0Y A;  2WDV B;  4C4V A;  3Q69 A;  1FCL A;  4WQM A;  1XXG A;  2MBQ A;  2M56 B;  3DHG C;  4NJ7 A;  5IP4 D;  1XO3 A;  3U7Z A;  3UIO B;  4XC2 A;  3DDC B;  4GGQ A;  1PGB A;  4LLG M;  5CHF A;  5D3D A;  2Y5C A;  2K0P A;  1OFF A;  1B9R A;  1WM3 A;  2WLB A;  1JRU A;  3FC4 A;  5J17 A;  2W55 A;  2FCM A;  2PTL A;  4O1N A;  1WRD B;  2DWQ A;  4ARC A;  3TSS A;  2KFK B;  1L4Z B;  2JYT A;  3Q8B A;  2LUE A;  5AUK A;  1WR6 E;  2VH1 A;  1WH3 A;  2VH2 A;  1QQR A;  4DBG A;  2ZCB A;  3UQB A;  3GE3 C;  4PYU A;  4HRO A;  1LGR A;  2WU5 B;  2IGH A;  4IUM B;  2ICI A;  1GG3 A;  4EZL A;  1WGR A;  3TL5 A;  2WXI A;  2K1F A;  3PZ7 A;  1MPE A;  4RGN A;  1E90 A;  3H7P B;  2ON8 A;  2WP9 B;  4PT5 A;  1FEH A;  4JX1 C;  3NS1 A;  3ZLZ A;  2IGD A;  1MFW A;  1L7Y A;  3U4E G;  2BKR B;  1YX5 B;  4ANW A;  1MI0 A;  4ACF A;  3RNE C;  1SJE D;  1SE3 A;  4M02 A;  3SHQ A;  2WXN A;  1EF5 A;  3QAR A;  1EO6 A;  3DVN U;  1TZO A;  2LRW A;  1XF5 L;  2N7E A;  2FNJ B;  3HRD D;  1S1Q B;  3PRM B;  2MQJ A;  2D3B A;  1OQY A;  2VRR B;  4RMA A;  3IT6 B;  3Q14 C;  2XEW A;  4FUL A;  1TKG A;  4IC7 B;  1N60 A;  2I1J A;  1HXY D;  1J19 A;  1GUA B;  1HEZ E;  3WAN A;  3L16 A;  3MFG A;  4FN2 A;  4N58 A;  1WGG A;  2Z0E B;  4AP4 C;  1JML A;  4HPL B;  1MHH E;  1OGW A;  2WGS A;  3DBL B;  3QJZ A;  2QIL A;  2JXX A;  5G55 A;  2N0S B;  4HWI B;  2ZPN A;  1JCK B;  1BML C;  1X1M A;  3VTU A;  3N1Y C;  2RR9 A;  2D11 A;  3EFC A;  1J7B A;  1YJI A;  3PZ8 A;  1A5R A;  1XLN A;  4W9D A;  3PS6 A;  3KLS X;  2Z8L A;  2C7H A;  1I7H A;  3S2A A;  2ZVN A;  2KJ6 A;  3AE9 B;  2RDB C;  4EKU A;  1T0R C;  1WXQ A;  2RSU A;  2J0J A;  1TIF A;  2WS3 B;  1E8X A;  4P6V F;  2IGG A;  3W5V B;  3V62 A;  4M8M A;  1F9J A;  3CSF A;  3N20 C;  1I4Q A;  3NVZ A;  3A9K B;  3N30 A;  2N9K A;  1V9J A;  4EEW A;  5KHQ A;  4C4V B;  3HUI A;  1WI0 A;  1HE8 A;  1P0R A;  3FIL B;  2LJ5 A;  2INP E;  1FXT B;  2CR5 A;  1B1Z A;  5C3J B;  1YQ3 B;  2D07 B;  4DHZ B;  1EU4 A;  5D94 A;  1PGX A;  4ANU A;  1XLQ A;  1UEL A;  4K81 A;  1Z5S B;  2KN4 A;  2FCN A;  1WGH A;  4KX6 B;  1KLG D;  3R2I A;  1F0Z A;  3BYY B;  4YSZ B;  1YQB A;  1WGY A;  1FFV A;  2D5G A;  1TY0 A;  1V81 A;  3BZD B;  3QIJ A;  3RN9 C;  2FUG 1;  1P98 A;  3CIR B;  3KVF B;  3VAW A;  1P7F A;  2KTR B;  2SEB D;  4BKS D;  2HDE A;  3RD2 A;  2MBB B;  1SSN A;  2KYW A;  1EWY C;  4FJY A;  4XX5 A;  3V60 A;  4NPN A;  4KZC A;  4I6P A;  2FE8 A;  1L5P A;  1RFA A;  1C76 A;  4HK2 A;  1Q0W B;  3R66 C;  2IND C;  4XGA B;  3H6N A;  5E6N A;  2QSD A;  4ZRQ A;  3NS8 A;  4ZYS A;  1SGH A;  3UQA A;  2KD0 A;  4B6W A;  3RI7 C;  4US9 A;  2JZ3 B;  2IY1 B;  1WX8 A;  3ETR A;  3C19 A;  3PGE A;  3GE8 C;  2XBB C;  3BY4 B;  1DOI A;  2KTR A;  3P42 A;  4MGK E;  1VDV A;  4HVB A;  3B2F A;  2GBR A;  2BS4 B;  2LXA A;  2OJW A;  1NYQ A;  2KZR A;  1ZW7 A;  4IWP A;  1DYQ A;  2KLC A;  2PE6 B;  4NJC A;  1TGZ B;  1UZX B;  1VZ6 A;  2KWD A;  2FUH B;  2V3P A;  1E6E B;  2ZZP B;  3VUX A;  2BB6 A;  1GC6 A;  1D5Z C;  3DOW A;  4MGI E;  5LXI B;  1GB1 A;  4W9L A;  5E6O A;  1OTR B;  2IDY A;  3TCA A;  4OZA A;  3ZRF A;  1EUV B;  4B0M A;  1TS3 A;  2D3C A;  3DBL I;  2MP2 A;  3W2D A;  3WAL A;  2LGI A;  1FO4 A;  5IKC M;  4N6E B;  4L2Y A;  1QKZ A;  1MG4 A;  1F52 A;  2O6V A;  1XCT L;  3M62 B;  4ZYN A;  2IO2 B;  2KQ4 X;  3N32 A;  5BYR A;  4P7I A;  1KF6 B;  3AEC B;  4WJN A;  2BVC A;  3LXF A;  1QOG A;  1K53 A;  3AU5 A;  4N9F 4;  4MDK E;  4JL9 A;  2KVR A;  2SAK A;  5CHV C;  4YT0 B;  3PSE B;  1UGJ A;  5HFY A;  1J7C A;  4AJW A;  3SFD B;  4TSS A;  4K3C A;  4A3O A;  2KC1 A;  2KT7 A;  2MX2 A;  2KMM A;  4BAX A;  1SE9 A;  2K5P A;  1SXT A;  2G1E A;  1QLB B;  2W3R A;  4ZRJ A;  5H8Y E;  2O6V D;  3JSV A;  1C79 A;  2W82 A;  1HTQ A;  2LAS A;  4HPP A;  1ZXH A;  3VR9 B;  4C00 A;  2BB5 A;  3TMP B;  4HEA 1;  1BT0 A;  3KYD D;  3DBS A;  1WFY A;  1BXT A;  4WH4 A;  4K3B A;  1PDX A;  1R4N B;  3ZVV A;  2CU1 A;  4MEL A;  2LHE A;  2DAJ A;  4G50 A;  4KDI C;  4IOI E;  2ZNV C;  4C56 C;  2K22 A;  3SEB A;  3VTW A;  2TSS A;  4WWN A;  2JWU A;  2PVO D;  2MEK A;  4AS1 A;  1JWA D;  1Q1O A;  3BII D;  4WWP A;  1FCC C;  1KTK A;  2KNB A;  5AZG A;  1VZ8 A;  2DAF A;  3ZNZ B;  3ZXV A;  4II3 B;  2LGD A;  3AE4 B;  3HM6 X;  4HLE A;  4C7Z A;  2FID A;  1L0V B;  5BMG A;  3N9Y C;  2NTT A;  4AUQ C;  1PYW D;  1NEN B;  5GMV A;  3TBL D;  2YVC A;  2GMI C;  1WJ6 A;  2DNF A;  1TY2 A;  2KFK A;  3Q3M C;  2CU3 A;  1IPG A;  1K8R B;  2QCZ A;  3WAP A;  4LDT B;  3P4S B;  5IA7 A;  4FHJ A;  2PIA A;  1E10 A;  4W9J A;  1D4B A;  1C4P A;  3ZNI D;  1K50 A;  2M19 A;  3ZDT A;  3C8Y A;  3K9O B;  4KZ0 A;  1UWX A;  2V4I B;  3ZGZ A;  2Y5P A;  3M63 B;  3RNG C;  2NBU A;  1L2N A;  3KYC D;  1ZDV A;  2VZK B;  1V97 A;  1CMX B;  2LD9 A;  1LM8 B;  2LVO A;  4MGY E;  3ZJT A;  1JW9 D;  1QZE A;  2BYF A;  2W9N A;  2BKF A;  3FIL A;  3U30 A;  1WMH B;  3AEF B;  2DZK A;  1J8C A;  4IWQ A;  2K6D B;  4X57 B;  2XK5 B;  3PHW B;  1FNU A;  1K52 A;  2MSE D;  1WXV A;  1CZP A;  3GZN I;  3N3K B;  2QJL A;  2M0A A;  3A9J B;  2CKH B;  2DX5 B;  4BVU C;  3DQV A;  2N7J A;  4YTP B;  2NVU I;  1V1O A;  3N1X C;  4GN1 A;  4J3O D;  2LUM A;  1IYF A;  2AQ2 B;  3AED B;  1YOV B;  3M95 A;  3R7R A;  2KWC A;  3VXW A;  3B9J A;  1V86 A;  3VUW A;  3MHS D;  3OG5 A;  4XWT A;  2J53 A;  3DVG Y;  2L3Z A;  4EE2 A;  3EEC A;  1ZKH A;  4LNO A;  1WJU A;  2MJE A;  3IHP C;  2BWF A;  3Q8C A;  2MBE A;  2LZ6 A;  1AWD A;  1VCB A;  5J18 A;  3EHV A;  4LNK A;  4DXA B;  5BMH A;  4MH8 A;  1OQR A;  2DYO A;  2GBM A;  2YEP F;  3RUI B;  3WCQ A;  3ZKJ C;  2M8S A;  5CTR C;  2MH7 A;  3B0A A;  3VR8 B;  2WXK A;  2JX5 A;  3FAH A;  4DWF A;  3KUZ A;  2KN5 A;  3CF6 E;  1GC7 A;  2O2V B;  2JSV X;  4II2 B;  4GMV A;  1Y8R C;  2G4S A;  4KIK A;  1KM7 A;  3UIP B;  2LGS A;  4XZ4 A;  2X38 A;  4LDT D;  2PJH A;  4HXD A;  2N4F A;  4EZK A;  4KGR A;  2LI5 A;  3W1Y A;  1NI3 A;  2J42 A;  1YX6 B;  2AQ3 B;  4A90 A;  4NY0 A;  2KC2 A;  4OZB A;  4BBN C;  1WJN A;  3BK1 A;  1EWC A;  1JWU D;  1MG8 A;  2LMC A;  2MJD A;  4E74 A;  3WIM A;  4JE3 B;  3AV8 A;  4RNA A;  1JWB D;  3WA0 A;  2WXQ A;  1GOZ A;  2K6Q A;  1GPX A;  1R4M I;  3EA6 A;  3AM9 A;  1WY8 A;  3PZD A;  1UD7 A;  2L76 A;  4BBN F;  3ABV B;  1RM6 C;  1JWM D;  3H8H A;  4MGZ E;  2WYQ A;  4AQ7 A;  2KWV B;  2K8H A;  4TV3 A;  4ZHO A;  2CJO A;  3BIN A;  5TR5 A;  4LNF A;  4KVG B;  4GOC A;  2L7R A;  4C7Y A;  1WIA A;  4JIO U;  1I4R A;  1TBE A;  2V0G A;  1ZPS A;  1QT9 A;  3MC9 A;  4DHJ B;  3ZNH B;  1LXD A;  2WU2 B;  4MEM A;  5AZH A;  2HD5 B;  4XYC A;  3RYT A;  3QAQ A;  3ALB A;  4A8X C;  1F1H A;  3CMM B;  3VDZ A;  4NZL B;  1YIW A;  4A20 A;  5EE0 A;  2R61 A;  3ZXR A;  3RMK C;  3AMZ A;  1HA5 A;  2ZW1 A;  3JYU A;  4IW0 A;  3H9D A;  1M94 A;  3I57 A;  3RPF C;  2MA9 B;  4KDL B;  5D6J B;  3IT4 B;  3ZJU A;  5AUI A;  5TSS A;  1WWT A;  4WJQ A;  2R2O A;  1TT5 B;  1V8C A;  1ZDX A;  4FJV B;  2ZW0 A;  5DPR A;  3ZTD A;  1AN8 A;  1D5X C;  4A6Q A;  2AWT A;  4ASW C;  4RF1 A;  1T6B X;  1NVI D;  3R2T A;  2GOW A;  4W9G A;  4CYE A;  2O2V A;  2L0F A;  2ZCC A;  1WGD A;  3GP7 A;  4GDL B;  3RFZ B;  3PLV A;  5J2R A;  2BBC A;  2ZNV B;  2OED A;  2BGF A;  2WQY B;  2UYZ B;  4P16 A;  2PW9 A;  3NUH B;  1KOT A;  2AL6 A;  2JQR B;  2I1K A;  1PUT A;  4MH0 E;  3SFE B;  3ENE A;  3LYY A;  5FK9 C;  3OWE B;  2K8C A;  1ZGU B;  1YNT E;  3N1Z C;  4W9C A;  1YD8 U;  1V1P A;  2LVP A;  2RGF A;  3MJW A;  3IAS 1;  3SU8 X;  2ZEQ A;  2DEN B;  2JY6 A;  3NVY A;  2DHZ A;  3VRA B;  4YTN B;  1XLO A;  3OAW A;  1SEB D;  1P3Q U;  4YL8 A;  2BT6 A;  4N59 A;  1HZ5 A;  3AH7 A;  1MHX A;  3P1M A;  4HCN B;  2LEK A;  5BYQ A;  4MAC A;  1I4X A;  4XWW A;  3PV1 A;  1WJ4 A;  4CHK A;  4YWG G;  2KFJ A;  2JPH A;  4IM3 A;  2M17 A;  3GS2 A;  4HJK A;  4S17 A;  3BYT B;  4P1B C;  4G3X B;  5FR6 A;  3NG0 A;  1P7E A;  3ZJV A;  1WZ0 A;  3QHT A;  1Q10 A;  2KDM A;  2QHO A;  2WXJ A;  1DOY A;  1G6J A;  2KMC A;  3P4P B;  2J0K A;  2KX3 A;  1WSP A;  3T3O A;  2C5L C;  2L8J A;  2LGY A;  3UI3 A;  1E0Z A;  1SIJ A;  4RH6 A;  5T8I A;  5CX3 A;  3KW5 B;  3MP9 A;  4CO7 A;  4IM2 A;  3VHT C;  1YJ1 A;  4PS7 A;  4YSX B;  3AE1 B;  3B2G A;  2WDT B;  5FR3 A;  3NY5 A;  4GB9 A;  4K1R B;  3SDL C;  1NBF C;  5L83 A;  2OJR A;  2J7Q B;  2J0M A;  3L08 A;  3UIN B;  1P9D U;  3L54 A;  4PS8 A;  5HKH A;  2N1V A;  2WXM A;  2L00 B;  2BPS A;  4YSY B;  3SD5 A;  3ONS A;  1N5W A;  1L6V A;  2X8X X;  2MBO A;  1L6U A;  3DPD A;  3EUB 2;  2INC C;  1IBX A;  1GJZ A;  2N9X A;  3W5U B;  2IO0 B;  3VH3 B;  2EMS A;  1MVK A;  4I6L B;  2HTM E;  4IM0 A;  2M4N A;  1QF6 A;  1TYG B;  2C60 A;  3H7S A;  4L1B A;  4EOY A;  4EZJ A;  5DPT A;  1Z2M A;  3NZU A;  1WE6 A;  5JHB A;  3H1U A;  4LK0 M;  5G5H A;  2DYM A;  1RLF A;  4S0R A;  2D3A A;  4HPM B;  2O6V B;  1CJE A;  2AX5 A;  1I4G A;  3QC8 B;  1C9F A;  2QC8 A;  5C1Z A;  1V80 A;  2V1Y A;  2JYE A;  1UGM A;  1FM0 D;  1NYR A;  2FCQ A;  4M8N A;  1WX7 A;  2A5U A;  1TS4 A;  1VRA B;  1U4A A;  2IO3 B;  5MPO A;  3TJP A;  4DDI D;  3P63 A;  2L83 A;  3Q3J A;  3C0R B;  1FMA D;  3APC A;  4C80 A;  3NOB A;  3MC8 A;  2J4X A;  2MJ3 A;  3L0W B;  2JRH A;  2WX0 A;  2REX A;  3K9P B;  1SJH D;  1WM2 A;  4QAY A;  2BYT A;  2V9H A;  2MBH A;  4M0W A;  4OW0 A;  1OEY A;  2JZZ A;  2WXO A;  1XLP A;  4RF0 A;  2DYB A;  1FIQ A;  3WAO A;  3JSV B;  2N9P C;  4WJO A;  5D2M B;  1DGJ A;  4UDU C;  2JWZ A;  3IAM 1;  1VD2 A;  3TEZ A;  2WWZ A;  2JT4 B;  4NQL B;  3V6C B;  1I42 A;  1H4R A;  1TTN A;  1OQQ A;  1LFD A;  2HJ1 A;  4LNI A;  2R2Q A;  1WXM A;  3APF A;  1FRD A;  2RPQ A;  4NNJ B;  1YQ4 B;  3TEW A;  1SE2 A;  3HVD A;  4MM3 B;  3I9V 1;  3Q3O C;  2LWP A;  4FAD A;  2IZV B;  1R4N I;  1E5W A;  1QOB A;  3RNA C;  3A9K A;  2KWU B;  3ML9 A;  2ZJD A;  2GI9 A;  4YTM B;  1FXA A;  1WYG A;  4FXC A;  1E7U A;  2BYE A;  4ZOH C;  3O65 B;  3L4P A;  3HVZ A;  3VVW B;  2G3Q B;  4E3C A;  3Q3N C;  1YN5 A;  3BK2 A;  3EC8 A;  3AEE B;  1OEY J;  1RAX A;  5LLI A;  2ACZ B;  3A1Q B;  2KJR A;  2BF8 B;  4NAM A;  2IPK D;  2LRU A;  3ZDM C;  3PRE A;  3V6E B;  4OVU A;  2NBV B;  2YLM A;  3A9J A;  4OZC A;  4BKS A;  3GB1 A;  4XDD A;  3RCZ A;  4F8C B;  2G4D B;  2K25 A;  1HZ6 A;  2PE9 A;  2RDG A;  2QDF A;  3J9C A;  2DBY A;  2CHW A;  2Y3A A;  5IN7 A;  1ET9 A;  1WMH A;  3P4R B;  2W3S A;  2UU7 A;  4WJP A;  3CWI A;  4B9K A;  3TUO A;  1YMH E;  1D3Z A;  2EEL A;  3ZQ4 A;  4FA6 A;  2MP2 B;  3KWL A;  4L23 A;  4FBJ B;  1FD6 A;  3IG3 A;  2NPT A;  2NBW B;  2C9W B;  3B08 A;  4IKG A;  2KMA A;  2MWS B;  4WIP A;  2HTH A;  4KSL C;  1N6Z A;  4RGT A;  1ENF A;  4GSW A;  3EGR A;  1KH0 A;  3ECI A;  3UF8 A;  1JQ4 A;  4XE0 A;  1T5X D;  2K39 A;  2Q5W D;  2WHI A;  1XEE A;  4ZRP A;  4NJ6 A;  3L13 A;  2LHD A;  2IBI B;  3NZ3 A;  4KIK B;  2A4Z A;  2CHZ A;  2WXP A;  3IFW B;  4GU2 A;  2KX0 A;  3LJ3 A;  5BO4 B;  2C7M B;  2N1W A;  2AEH A;  4FLH A;  1VLB A;  3AN1 A;  1L4D B;  5DPW A;  1WXA A;  3ZRC A;  3KQ4 A;  1M4V A;  1UWM A;  5BYS A;  1FNW A;  1V1P B;  2XNA C;  1F2R C;  2PPH A;  1FRR A;  5GXG B;  2BYV E;  1TKY A;  3AE7 B;  3RT3 B;  2VZK D;  1ZOY B;  3ZUN A;  2ASQ A;  3Q3F A;  2PLP A;  4R3D A;  2D2Q A;  3DBH B;  4DQO C;  4JLC A;  1Y56 A;  2OHF A;  4LTU A;  3I5J C;  3PHX B;  5AZF A;  3KWV A;  4EUT A;  1N61 A;  4RCO A;  4XDC A;  2WXR A;  1JAL A;  4ZHP A;  2GB1 A;  5DCN A;  3DVG X;  4HKZ E;  4M0W B;  3AXC A;  2WXL A;  3PTF C;  1IGD A;  2V3N A;  3KUD B;  1V6E A;  2JXT A;  4ITK A;  2JRI B;  1ZUD 2;  3HK0 A;  1WE7 A;  4A3P A;  4TQ1 A;  1NDD A;  5JXV A;  4TMA B;  3T9L A;  4PS3 A;  5C2T B;  5JHA A; 
#chains in the Genus database with same CATH homology
 3RZF A;  4W9I A;  3WAL A;  2Z0D B;  2OOB B;  1E7V A;  2BGF A;  3AI5 A;  2M0X A;  3JVZ X;  3W1S C;  3QCA A;  3OJ3 A;  2UYZ B;  1WF9 A;  1KOT A;  2AL6 A;  3A1Q A;  1WR1 A;  3ZO5 B;  2I1K A;  2EKE C;  4MH0 E;  3DVN V;  2O6V A;  4ICV A;  4FJZ A;  3ENE A;  3DBH I;  3M62 B;  4ZYN A;  2K8C A;  1ZGU B;  1C1Y B;  2IO2 B;  3N32 A;  4P7I A;  2CHX A;  4W9C A;  1YD8 U;  1C3T A;  2KXJ A;  3OLM D;  2LVP A;  2MCN B;  2RGF A;  3MJW A;  3ZIM A;  2D3G A;  4WJN A;  1AAR A;  1V2Y A;  2KHW B;  3SU8 X;  1H8C A;  3I3T B;  2ZEQ A;  2DEN B;  2JY6 A;  5LXH A;  3AU5 A;  4HCP B;  4N9F 4;  3A33 B;  2DHZ A;  5JZE B;  4NAW B;  1V5O A;  4MDK E;  4DK5 A;  2KQS A;  3OAW A;  4JL9 A;  2KVR A;  1V49 A;  3ZW3 A;  1P3Q U;  5CHV C;  4F7Z A;  3A4R A;  3PSE B;  4I6N B;  4YL8 A;  1E8Y A;  1S3S G;  1SIF A;  4AJW A;  3VTV A;  4MM3 A;  4W9F A;  4LJP B;  2L0T A;  2M1M A;  4A3O A;  2KC1 A;  5JHA A;  4HCN B;  4ICU A;  2MX2 A;  3PV1 A;  1WJ4 A;  3V61 A;  1SE9 A;  4CHK A;  2AL3 A;  3QX1 A;  3NHE B;  2KTF A;  3GOE A;  4GXB A;  2KFJ A;  3IBE A;  4TQ0 A;  2JPH A;  4IWO A;  4ZRJ A;  2DZI A;  4IM3 A;  2O6V D;  2M17 A;  3CST A;  2ZVO A;  3QA8 A;  3KH0 A;  1E8Z A;  4HDQ A;  4HJK A;  2XK5 A;  4DHZ E;  4GDK A;  4G3X B;  5FR6 A;  3QK0 A;  4GIV A;  3W1S A;  1WZ0 A;  2V4L A;  3JSV A;  3QHT A;  4E71 A;  2LAS A;  2QHO A;  1WX9 A;  4MJS B;  5KHO A;  1G6J A;  5CHW A;  3PVL A;  2KMC A;  4MSQ B;  2J0K A;  2KX3 A;  1E8W A;  2NCN A;  4ANX A;  4BFR A;  2C5L C;  4ZDV A;  2L8J A;  2LGY A;  3TMP B;  2KK8 A;  3KUC B;  2CS4 A;  4W9E A;  4BKG A;  2V3S A;  3APD A;  5CX3 A;  1Q5W B;  2N7D A;  3KW5 B;  2BWE S;  4CO7 A;  4IM2 A;  1BT0 A;  3KYD D;  3PT2 B;  3VHT C;  2UWQ A;  3DBS A;  1WFY A;  4K7W A;  2KDI A;  1YJ1 A;  3VH4 B;  1KJT A;  4W9K A;  3MTN B;  4PS7 A;  5JH5 C;  4K7S A;  2WDT B;  3NY5 A;  3PRP B;  3VUY A;  1T0Y A;  3ZVV A;  2CU1 A;  4GB9 A;  4K1R B;  4MEL A;  4RM9 A;  3SDL C;  1NBF C;  2DAJ A;  4G50 A;  5L83 A;  4KDI C;  3HIZ A;  2ZNV C;  2OJR A;  3VTW A;  4OVV A;  4MSM B;  2J7Q B;  2MBQ A;  4BOZ B;  4WWN A;  2J0M A;  3L08 A;  3UIN B;  1P9D U;  3L54 A;  4PS8 A;  5HKH A;  2G45 B;  2N1V A;  4NJ7 A;  1IP9 A;  4KV2 A;  1Q1O A;  2L00 B;  2BPS A;  3UIO B;  4B95 A;  4XC2 A;  3DDC B;  4GGQ A;  5CHF A;  4WWP A;  2KNB A;  3SD5 A;  2MLB A;  3ONS A;  5AZG A;  2DAF A;  3ZNZ B;  2MBO A;  2IY0 B;  4II3 B;  2LGD A;  2KQ7 A;  3HM6 X;  3UGB B;  4HLE A;  3M3J A;  3DPD A;  1WM3 A;  1JRU A;  2FID A;  5J17 A;  1GJZ A;  2N9X A;  2FCM A;  4WAA A;  1WRD B;  2FAZ A;  5C23 A;  2KFK B;  2IO0 B;  4NAW A;  3VH3 B;  2EMS A;  3HM3 A;  4AUQ C;  3T8M A;  2LUE A;  4I6L B;  4IM0 A;  5GMV A;  3TBL D;  2YVC A;  1WR6 E;  2KLG A;  2KJH B;  2M4N A;  2GMI C;  1WJ6 A;  1WH3 A;  2C60 A;  3H7S A;  3R3M A;  2N9E B;  4EOY A;  3ZTC A;  4EZJ A;  5DPT A;  1Z2M A;  3NZU A;  2KFK A;  1WE6 A;  2B3A A;  5JHB A;  1RRB A;  3H1U A;  4DBG A;  2ZCB A;  1IPG A;  3UQB A;  1K8R B;  2DYM A;  1RLF A;  4IG7 B;  2MRP A;  3WAP A;  4PYU A;  4LDT B;  4HPM B;  2O6V B;  3QWZ B;  4IUM B;  3QC8 B;  2KOX A;  3OJ4 B;  4ZRK A;  1GG3 A;  5C1Z A;  1V80 A;  2V1Y A;  4EZL A;  1WGR A;  3TL5 A;  2K1F A;  1UGM A;  1WZ3 A;  2LXC A;  5IA7 A;  3EFU A;  1E90 A;  3H7P B;  4FHJ A;  2FCQ A;  2IYD B;  4M8N A;  2AYO B;  1WX7 A;  4W9J A;  4ANV A;  1LQB A;  2A5U A;  4GDL A;  3ZNI D;  3X0W A;  5AEK B;  1U4A A;  2IO3 B;  3PRZ A;  3ZLZ A;  2IO1 B;  3ZDT A;  3TJP A;  4DDI D;  3Q3J A;  3C0R B;  3K9O B;  4KZ0 A;  1L7Y A;  1KLV A;  2BKR B;  1YX5 B;  3APC A;  2NPT B;  4ANW A;  5L95 C;  3M63 B;  5D7G A;  3NOB A;  2NBU A;  1L2N A;  3KYC D;  3L0W B;  2JRH A;  2WX0 A;  3SHQ A;  2REX A;  4F1S A;  1CMX B;  2LD9 A;  1EF5 A;  1LM8 B;  3K9P B;  2LVO A;  1EO6 A;  3QAR A;  4MGY E;  3DVN U;  3U8Z A;  1WM2 A;  4FHK A;  2LRW A;  1QZE A;  2BYF A;  3PLU A;  4G11 A;  2MBH A;  2W9N A;  2BKF A;  2N7E A;  4MJS A;  3U30 A;  3IVF A;  1OEY A;  2JZZ A;  4K7U A;  5IAA C;  1WMH B;  2FNJ B;  2DYB A;  2DZK A;  1J8C A;  3WAO A;  3JSV B;  1S1Q B;  2N9P C;  4WJO A;  3PRM B;  4IWQ A;  5D2M B;  2K6D B;  3R7Q A;  4DDG D;  2JWZ A;  2HJ8 A;  2MQJ A;  4X57 B;  2XK5 B;  3PHW B;  1VD2 A;  3WAM A;  1OQY A;  2MSE D;  1WXV A;  2VRR B;  3GZN I;  3N3K B;  2WWZ A;  2JT4 B;  4NQL B;  4RMA A;  3V6C B;  1I42 A;  3A9J B;  2XEW A;  1TTN A;  1H4R A;  1WYW B;  1LFD A;  4FUL A;  4IC7 B;  2CKH B;  2I1J A;  2R2Q A;  2DX5 B;  1J19 A;  1GUA B;  4BVU C;  3WAN A;  1WXM A;  3APF A;  3DQV A;  2RPQ A;  4NNJ B;  3L16 A;  4FN2 A;  1WGG A;  3D32 A;  2NVU I;  1PQS A;  2Z0E B;  4AP4 C;  4GN1 A;  2C7N B;  3AUL A;  3AU4 A;  4HPL B;  1IYF A;  2LWP A;  4FAD A;  2IZV B;  1R4N I;  1E5W A;  1OGW A;  2KKC A;  3M95 A;  3QQ8 B;  3R7R A;  2KWC A;  3QJZ A;  3A9K A;  3VXW A;  2KWU B;  1GNU A;  3ML9 A;  2ZJD A;  2JXX A;  1V86 A;  4ZRI A;  3VUW A;  2K8B A;  3H7P A;  5G55 A;  3MHS D;  4HWI B;  1XQQ A;  1E7U A;  2BYE A;  2ZPN A;  3LDZ E;  3DVG Y;  3O65 B;  2L3Z A;  1TZ1 A;  1X1M A;  3VTU A;  3EEC A;  3VVW B;  1ZKH A;  1WJU A;  5G2N A;  3IHP C;  2DZJ A;  2G3Q B;  2BWF A;  2D11 A;  2RR9 A;  2MBE A;  2KDB A;  2LZ6 A;  4KSK C;  4E3C A;  1A5R A;  4WQO B;  4W9D A;  2FIF A;  3PS6 A;  1VCB A;  3HHM A;  5J18 A;  3EC8 A;  1NI2 A;  2C7H A;  3EHV A;  1OEY J;  3S2A A;  2ZVN A;  2KJ6 A;  1RAX A;  5LLI A;  4DXA B;  4EKU A;  2RSU A;  2J0J A;  4LCD E;  3A1Q B;  2KJR A;  2BF8 B;  1E8X A;  2KDE B;  2LRU A;  3ZDM C;  3PRE A;  3V62 A;  2DYO A;  2GBM A;  3RUI B;  3V6E B;  4M8M A;  1F9J A;  2GBK A;  3CSF A;  4OVU A;  2M8S A;  3ZKJ C;  5CTR C;  2NBV B;  2YLM A;  3A9J A;  4BKS A;  4RM8 A;  5EDS A;  4DHJ D;  3RCZ A;  3B0A A;  1I35 A;  4F8C B;  2G4D B;  3A9K B;  2K25 A;  4DWF A;  3N30 A;  2HE7 A;  2KN5 A;  2PE9 A;  3CF6 E;  3KUZ A;  2JF5 A;  2L05 A;  1GC7 A;  2O2V B;  1V9J A;  2CHW A;  4EEW A;  5KHQ A;  3P2B A;  1WI0 A;  1WMH A;  4GMV A;  1HE8 A;  4II2 B;  1P0R A;  3ZNG C;  1Y8R C;  2LJ5 A;  3NZS A;  4BKT A;  1FXT B;  2CR5 A;  2G4S A;  4WJP A;  4KIK A;  4B9K A;  2D07 B;  1KM7 A;  3UIP B;  1D3Z A;  4TKN A;  4XZ4 A;  4DHZ B;  5D94 A;  4LDT D;  2PJH A;  4ANU A;  4HXD A;  2N4F A;  4EZK A;  4FA6 A;  2MP2 B;  4EFO A;  2LI5 A;  4FBJ B;  3W1Y A;  1XD3 B;  4JQW C;  4LJO B;  1UEL A;  2RD0 A;  4K81 A;  1Z5S B;  1YX6 B;  3IG3 A;  2FCN A;  1WGH A;  2NPT A;  2NBW B;  2C9W B;  3B08 A;  4NY0 A;  2KC2 A;  2KMA A;  3VFK A;  1YQB A;  2MWS B;  2HTH A;  4NQK E;  4KSL C;  2NR2 A;  1WJN A;  4HDO A;  4WWO A;  1WGY A;  1MG8 A;  4GSW A;  4BBN C;  3PPA A;  4GDK B;  3WIM A;  4E74 A;  3ECI A;  3UF8 A;  3L17 A;  4URK A;  1V81 A;  4PYZ A;  4J6I A;  3QIJ A;  4BOS C;  2K39 A;  5DPS A;  1P98 A;  4NJ6 A;  3L13 A;  3RZW C;  3WA0 A;  3KVF B;  2IBI B;  2KTR B;  2K6Q A;  3VAW A;  3A4S C;  4KIK B;  1R4M I;  2A4Z A;  4BKS D;  1WY8 A;  3RD2 A;  3PZD A;  2CHZ A;  1UD7 A;  2WX1 A;  3IFW B;  4W9H A;  2L76 A;  2MBB B;  4BBN F;  2Y5B B;  3VQI A;  2JUO A;  4GU2 A;  4FJY A;  2KX0 A;  4MGZ E;  2WYQ A;  3LJ3 A;  5BO4 B;  3RUL A;  2C7M B;  2KWV B;  2K8H A;  2N1W A;  4TV3 A;  2AEH A;  4XX5 A;  3V60 A;  1J0G A;  4NPN A;  2EMT A;  4TUU A;  4FLH A;  4KZC A;  2NS5 A;  4I6P A;  3BIN A;  3L10 B;  5DPW A;  1WXA A;  3ZRC A;  5TR5 A;  4AJY B;  1RFA A;  4HK2 A;  1Q0W B;  2GBN A;  3R66 C;  4KVG B;  4GOC A;  1V5T A;  2L7R A;  3H6N A;  1WIA A;  2PPH A;  2ZPY A;  5E6N A;  3NS8 A;  2BYV E;  4JIO U;  1TBE A;  3RT3 B;  1SGH A;  3UQA A;  2KD0 A;  3ZUN A;  3B1L X;  2ASQ A;  3Q3F A;  4B6W A;  2D2Q A;  2JZ3 B;  2IY1 B;  1WX8 A;  4DHJ B;  3PGE A;  3ZNH B;  4JLC A;  1LXD A;  4AWJ A;  2XBB C;  2DZM A;  2KTR A;  3BY4 B;  4MEM A;  4MGK E;  5AZH A;  2LVQ A;  2HD5 B;  4HVB A;  1EF1 A;  1P1A A;  2FCS A;  3PHX B;  4JGH B;  5E6P A;  2GBR A;  5AZF A;  3RYT A;  3QAQ A;  2GBJ A;  2LXA A;  3ALB A;  2KO3 A;  3CMM B;  4EUT A;  2KZR A;  3VDZ A;  1YIW A;  1ZW7 A;  4A20 A;  2MW5 A;  4IWP A;  2KLC A;  2LGX A;  1WXS A;  2PE6 B;  2D10 A;  1TGZ B;  3JYU A;  4IW0 A;  3H9D A;  1UBI A;  5DCN A;  1UZX B;  3DVG X;  1M94 A;  4M0W B;  1UH6 A;  2MA9 B;  2FUH B;  4KDL B;  5D6J B;  2PEA A;  3U7D A;  3AXC A;  3ML8 A;  1XT9 B;  2ZZP B;  4WJQ A;  3VUX A;  2R2O A;  4FJV B;  2KAN A;  3PTF C;  3DBR I;  3KUD B;  4AOF A;  1V6E A;  2Z59 B;  5DPR A;  3ZTD A;  1GC6 A;  2JRI B;  3DOW A;  4MGI E;  4G0N B;  5LXI B;  2AWT A;  3DCG A;  3HK0 A;  4ASW C;  1ISN A;  1WE7 A;  4W9L A;  1UBQ A;  5E6O A;  1OTR B;  3X23 A;  2KDF B;  2GOW A;  4W9G A;  4A3P A;  4CYE A;  4TQ1 A;  1NDD A;  3TCA A;  2O2V A;  3ZRF A;  2L0F A;  2ZCC A;  1EUV B;  3T9L A;  1WGD A;  4GDL B;  4PS3 A;  3PLV A;  5J2R A;  2JVC A;  3DBL I;  3JW0 X;  2MP2 A;  2ZNV B;  3TIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...