1UWXA

P1.2 serosubtype antigen derived from n. meningitidis pora in complex with fab fragment
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
b'VTTYKLVINGKTLKGETTTKAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G-PRIME
publication title Structural Variation and Immune Recognition of the P1.2 Subtype Meningococcal Antigen.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Immune system
total genus 15
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1uwxA00
2N9KA 2EELA 4IOIE 1HZ5A 2IGHA 1MHXA 2RPVA 4MACA 1FCCC 1XCTL 4KGTA 5BMHA 2PTLA 2JSVX 2KN4A 2PW9A 2KDMA 5BMIA 1PGAA 1C9FA 1JMLA 2K0PA 3MP9A 2PLPA 1K53A 1IGDA 5JXVA 1IGCA 1GB1A 2IGGA 1PGXA 5HI1A 2JZPA 2QSDA 1GB4A 4WH4A 4OZAA 1F2RC 2KQ4X 3FILA 1ZXHA 2ON8A 2JU6X 2J53A 2IGDA 4KGRA 1MI0A 5BMGA 3UI3A 2OEDA 3GB1A 5HG2A 2GB1A 1YNTE 1HZ6A 2JWUA 3FILB 2ZW0A 1P7EA 2JXTA 1XCQL 2I38A 4OZBA 1IBXA 1K52A 2I2YA 2N9LA 1MVKA 2GI9A 2RMMA 2LGIA 1QKZA 4GLSC 1F2RI 2ZW1A 1PGBA 1D4BA 2LUMA 1Q10A 4KGSA 4HJGE 1XF5L 1HEZE 1UWXA 1IBXB 5HHDG 1K50A 2ONQA 1P7FA 1FCLA 2LHEA 2N7JA 1YMHE 1FD6A 2QMTA 1EM7A 4HKZE 1KH0A 2NMQA 2LHDA 2KACA 3V3XA 4D2KA 2KWDA 5HFYA 1K51A 1MHHE 1MPEA 4IKGA 2J52A 4OZCA
chains in the Genus database with same CATH superfamily
3UIOB 1R4MB 1BXTA 1WRIA 4G50A 2QEJC 3O13A 4HDQA 4XE0A 3AB5A 2DYOA 4K3BA 2Y5PA 1SE4A 3OJ4B 1WJUA 4YSXB 1A5RA 1EU3A 1UBIA 2KWUB 1QLBB 3W5UB 4WAFA 3VTVA 2WYQA 1GB1A 4L2YA 3P63A 3EGRA 3V60A 2MJEA 5D3DA 5BYRA 5D7GA 1WIAA 2JZPA 2GBNA 4BAXA 3TL5A 1F2RC 2LJIA 2LGDA 1MFWA 5EE9A 3EECA 1U4AA 4L23A 2V3NA 3GB1A 4GMVA 3JYUA 3AE4B 4LJPB 3RFZB 3PZ8A 2MJ3A 3I57A 1WGHA 3PZDA 3A1QA 3OWEB 4DHZE 4GOCA 2N9PC 1E8XA 2VH2A 1E7VA 3TSSA 1I35A 2DYMA 3BZDB 3C0RB 1I4RA 2KAJA 1WM3A 1AARA 2L00B 3HVZA 4G0NB 4HCNB 2D07B 3B08A 4MGYE 4N6EB 1ZPSA 2CKHB 2DENB 2KTFA 1ACCA 1IUEA 4BOZB 3DCGA 1PUTA 1UZXB 2M56B 1UUPA 2KJ6A 1AN8A 1E8WA 3GS2A 5BYSA 1MHHE 4W9FA 1V2YA 3QARA 1RWSA 2LVQA 3UQBA 1J0GA 1PYWD 2N9KA 3HVDA 1B1ZA 2IZVB 3NHEB 1OFFA 3SR6A 1UF0A 4NAMA 1MJDA 3ZO5B 3U4EG 4B0MA 1V5TA 5LXHA 2K22A 4HPPA 5AUIA 1C9FA 3PRMB 1E9MA 1V1OA 1P9DU 3VQIA 3W5VB 5JXVA 1EF5A 5CTRC 3RN9C 1VJKA 3TEZA 1LGRA 1ZOYB 2KTRB 2BYEA 4C80A 3VFKA 4JQWC 1FXIA 2ON8A 3NVYA 3TEXA 2MP2B 3ZIMA 2WU5B 3OJ3A 1C77A 4W9DA 4RCOA 3IG3A 3BK1A 3BY4B 1GUAB 1CMXB 1ZE3D 1AWDA 1OEYJ 3KW5B 2ZCCA 3QIJA 4AJWA 3JW0X 4K81A 2K8BA 3PHWB 4B9KA 3Q6BA 1KF6B 3ABVB 3E56A 3KQ4A 2ACZB 3QA8A 3EFUA 5E6OA 1S3SG 1V1PA 2LUMA 2Y5CA 1Q0WB 4W9LA 4A20A 2AL3A 1Q5WB 3WCQA 5G5GA 2X8XX 3A9KB 3EFCA 3KYCD 2JWZA 2X38A 2DZMA 1UD7A 4RMAA 2D5GA 4GDKB 3DBHI 4C4VB 4ZRPA 5HFYA 3L13A 4Q2JA 5FR6A 1YX6B 2PPHA 4LK0M 5GMVA 3W9CB 1GG3A 2GOWA 2LGXA 2MP2A 5AZHA 5JHBA 1XEEA 4E74A 2RPVA 2GBJA 4WWPA 2DZIA 2W3RA 5C2TB 3VR8B 2WLBA 3DBRI 5E6JA 2EKIA 2WXKA 4W9CA 1L4DB 3IXSA 3Q3NC 1D6EC 4ZRKA 2OJRA 3Q3OC 3ZNZB 3N1ZC 4KSLC 4BZAA 2AQ3B 4II2B 4S0RA 3A9KA 1XO3A 1CJEA 3AN1A 2PJHA 2KOXA 2WDTB 2PVOD 4GDKA 2OEDA 2SEBD 1WZ0A 1I4PA 2K8CA 3Q3JA 5LXIB 1Q1OA 1FXAA 3B1LX 3L0WB 5HG2A 2AYOB 3AXCA 1P7EA 5IO9A 2WXFA 4M8MA 2DWQA 3H8HA 1WJ6A 2FNJB 1XCQL 1IYFA 1BMLC 1IBXA 1TT5B 5DPWA 2IY1B 1OEYA 3PRZA 2ZVOA 1YN4A 3TEYA 2DNFA 2C5LC 1UWMA 3BYTB 2K39A 3DBLB 3P4SB 3Q14C 2NCNA 1ESFA 2KVZA 1WXSA 1XF5L 1UWXA 2N7JA 4IW0A 1KLGD 2L1AA 1WXAA 1HTQA 4HKZE 2V3PA 4W9EA 4NY0A 1JWBD 1OQRA 3M95A 3IFWB 3QHTA 1WMHA 2EMSA 2WXQA 3DBSA 3A9JA 2WWZA 3M62B 4RM8A 2KKCA 2KX0A 2BVCA 1SJED 1J8CA 2ZJDA 2QIEB 5GXGB 3MHZA 4MACA 5E6PA 3RULA 3AU5A 3HK0A 4ZHOA 3AV8A 3WAOA 4RGTA 2WU2B 2BW2A 1WXQA 3H1UA 3V6EB 4FA6A 4FBJB 1JW9D 1L4ZB 3N1YC 4WJNA 1P1AA 4K7WA 5KHQA 2L32A 3OLMD 3U2SC 2LZ6A 4FJVB 2MSED 2G1EA 1KM7A 3DVNV 3TIXA 2MBOA 4EZKA 4XYCA 1WXVA 5G5HA 1NDDA 1ZKHA 2KDFB 2WXJA 1ZXHA 4MM3B 4ICUA 5DPSA 2MBQA 3R66C 1V81A 2MBEA 1TZOA 2QJLA 2HJ1A 5CHFA 2C7MB 4DHJB 2L05A 2NPTB 1WGDA 4WQOB 5HKHA 2INPE 3AECB 4FHKA 2FCNA 2L52A 3FC4A 4IUMB 2FUHB 1C1YB 1TBEA 3LXFA 2LGIA 3NZSA 2KMCA 2R2QA 4DXAB 3UF8A 2RDBC 2J42A 5AZFA 4HJGE 4XWTA 2M8SA 4MSQB 1P7FA 4BKSA 1V86A 3Q8EA 4G11A 2XK5A 1A70A 4NAWB 3V05A 2NMQA 4TSSA 4KSKC 2KWCA 1YX5B 3PZ7A 2JY6A 4ZYSA 2PEAA 1AYFA 4KKIA 1EWYC 3T9LA 1HXYD 5EE0A 1WI0A 3ZJVA 1TY2A 1V49A 2LWPA 5IOIA 4A55A 1GPXA 2MJDA 1JWUD 2A4ZA 4KGTA 1WFYA 2O6VD 4KIKA 3FKYA 2QILA 1VZ8A 1PGAA 2FIDA 3MP9A 1E7PB 2VZKD 1SIJA 3B0AA 2N0SB 2HJ8A 1TY0A 2JYEA 1V8CA 4IDIA 2PE6B 4R3DA 4RF1A 1PGXA 3AE5B 1Z5SB 1FFUA 1TJEA 2L76A 4TUUA 1Z2MA 4WH4A 2O2VB 3TCAA 3DHHC 4KVGB 1D5ZC 4IC7B 4RF0A 2DHZA 3ZXRA 4KGRA 4W9IA 2MHJA 2VH1A 4TQ1A 1SB3C 2N1WA 2KZRA 1C4CA 1ZDXA 3FILB 3RCZA 2UWQA 3ZXVA 4ZOHC 3ALBA 2LJ5A 3JVZX 1BUIC 4DXFA 1YJJA 3APDA 3CWIA 2I2YA 2HE7A 2J0JA 4NPNA 4A9AA 4GU2A 4M00A 3PREA 4HEA1 4C7YA 4US9A 1FRRA 1E7UA 4ZRIA 1C3TA 2MBHA 1I4GA 2L3ZA 1GOZA 2LVPA 4FN2A 3RZFA 4YTNB 1E10A 2K5PA 2N4FA 1MG8A 2O2VA 3L17A 3AEFB 4JGHB 2BT6A 2KLGA 2ZNVC 4MDKE 3HIZA 2G3QB 2EMTA 4LNKA 3R2IA 1JALA 5BMHA 1WM2A 2GRIA 1TYGB 3IVFA 1N61A 4UDUC 1K53A 2M0AA 4X57B 1EUVB 1C4AA 4HPMB 1H4RA 3R3MA 3LJ3A 3R2TA 4AS1A 4EZLA 4XDCA 4LDTB 2V0GA 2KK8A 4YXDB 4AOFA 4IM0A 2XBBC 1QT9A 1VLBA 3RNEC 5EE3A 4C00A 3UGBB 2BWES 4W9HA 5BMGA 3W1SA 4MJSB 3URYA 3RNGC 1WR6E 3N9YC 3DBHB 1LO5D 3ZYYX 2NR2A 2Y5BB 1EU4A 2WGSA 3UINB 1SGHA 1V80A 2AEHA 2KC1A 4EZJA 1DOYA 2CU1A 2LXCA 2CJNA 2J4XA 4JX1C 2IO2B 4ANWA 4FLHA 1PGBA 5JHAA 3Q2AC 4NQLB 2FAZA 3DBRB 1XLOA 3SFDB 1NYQA 4IM2A 1DOIA 1B9RA 3AE6B 3N30A 4J3OD 2N9EB 3JSVB 2CR5A 3ENEA 1KH0A 2LHDA 2J0MA 1FMAD 2ZCBA 1JWAD 4IWOA 2Z0DB 2KWVB 5L95C 4A3PA 1IP9A 1WF9A 3D32A 3NG0A 1PQSA 3Q8BA 2RDGA 2BYTA 2D10A 2EELA 4IOIE 4ICVA 2WXOA 2PTLA 2ICIA 3MC8A 5H8YE 1OQYA 2FCMA 1RFAA 3MFGA 1J7BA 1FRDA 2KQ7A 3VXWA 3DWGC 3P1MA 2K8HA 3RZWC 3CSFA 3KWLA 1RYJA 4B6WA 3R7QA 3RT3B 2JRHA 2AQ1B 2NS5A 3JSVA 2C60A 2ZPYA 4JPSA 4NJCA 2BS3B 3ZRCA 4LCDE 4YL8A 4EOYA 3VUWA 2YVCA 4PS3A 5C3JB 3Q3FA 2WNMA 3J9CA 4JWSC 1UGJA 4GXBA 2LD9A 4LJOB 1WWTA 1K52A 5J2RA 3QX1A 2L0FA 3P2BA 1ENFA 2BS2B 3GE3C 2MQJA 4WJQA 4KV2A 4MT5A 4YT0B 2DX5B 3DWMA 4KX6B 4DXGA 3N3KB 4A6QA 5HHDG 1RLFA 4HPLB 2NVUI 1FCLA 4YSYB 3TMPB 2TSSA 2OHFA 1M94A 2MH7A 3AEAB 2RD0A 2BKRB 4D2KA 4F7ZA 4GDLB 4LNIA 2KT7A 3A33B 1E8ZA 2KFJA 4N59A 2M19A 1PDXA 1C78A 4HROA 1WR1A 3PV1A 1WE7A 3KH0A 4WQMA 2IGHA 2FCQA 2IDYA 1HE8A 1FCCC 2UYZB 4KZCA 4P7IA 2KTRA 2I1JA 1UNSA 1NI2A 2B3AA 3IAS1 4OVVA 3AH7A 2N1VA 2WDVB 3DDCB 1BT0A 4ZRQA 2KVRA 2LMCA 1R4NI 3PVLA 1TKEA 3AULA 4WURA 4ZRJA 1E8YA 3NVZA 3WALA 3AE2B 1TTNA 1L6VA 3RMKC 2LFIA 1CZPA 3DPDA 1RAXA 1I42A 3P4PB 2HDEA 3H6NA 2L83A 1T0YA 4MH0E 2VRRB 4GDLA 4A8XC 3NS8A 2KX3A 5MPOA 1SJHD 2Y3AA 3RNAC 2WDRB 1XXGA 3T8MA 2JXTA 2KFKB 1TIFA 1WXMA 1ET9A 4W9JA 3R7RA 2ASQA 1SBBB 4K7UA 2ZW1A 3CF6E 4CHKA 3GOEA 4HKQA 2KQSA 4WJOA 4USAA 4C4VA 3A4SC 2H89B 4KGSA 1ZXIA 4HRSA 3U30A 3DVNU 1WRDB 3ML8A 5IKCM 1UH6A 2JZZA 3ZW3A 5BO4B 3VAWA 3A4RA 2ZPNA 2HTHA 4WAAA 4BKGA 4L1BA 4W9GA 4BVUC 3N32A 1FEHA 4DBGA 2GMIC 4K3CA 4OZCA 5D2MB 3NRZA 3PGEA 4DWFA 3APCA 1YQ3B 1N5WA 3HM3A 5TSSA 3MTNB 2GLSA 3ZNGC 2PMVA 3O65B 2K0PA 2INDC 2PLPA 2SAKA 2BKFA 1WJNA 3BIID 2D3BA 3BVZA 4WWNA 4EFOA 3I9V1 4EKUA 3TUOA 5HI1A 3ZDTA 1GJZA 2WXHA 2YEPF 3CIRB 1XLNA 3ZGZA 2FUG1 3P42A 3RNFC 3Q8FA 3U52E 3NOBA 3NZ3A 1XLQA 2Z8LA 2BYFA 2IYDB 2KDBA 3PLVA 4FJYA 3S2AA 1SE2A 2BYVE 3QQ8B 3SDLC 4YWGG 3VH3B 2LASA 3OAWA 2BS4B 3SFEB 3E9SA 3V61A 2NBUA 1F0ZA 4H2AA 4OZBA 3RUIB 3HM6X 3NVWA 1MVKA 2GI9A 4ITKA 1LFDA 4RNAA 1NI3A 3CSTA 4GGQA 1QQRA 2CHWA 3PT2B 2FIFA 2ZEQA 1CK1A 1HEZE 3MJWA 2D3CA 1HA5A 4JWUC 4OW0A 1KFYB 1QOAA 5D6JB 2JXXA 3C19A 3I5JC 2WXNA 3ZNHB 1Y56A 1L0YB 2BGFA 2KJHB 1MPEA 1KLUD 4IKGA 4HJKA 3L16A 1T6BX 1UBQA 2J0KA 4IG7B 1HZ5A 3U7ZA 1XQQA 3N20C 1RFKA 2Z0EB 1XCTL 3DOWA 3GP7A 3V62A 4OVUA 1UELA 3W1YA 4RFBA 2YEPB 2OOBB 1E6EB 1JRPA 4PS7A 3LB8C 4B95A 1IGCA 3AE3B 4MM3A 3H7PB 3NJTA 1YJIA 4BBNC 4GSWA 2WP9B 3ZUNA 2DZJA 2KDEB 3AEDB 3RNCC 3IHPC 3AMZA 1LXDA 2A5UA 2BPSA 4C7ZA 4I6LB 4HDOA 2G45B 1T5XD 2NPTA 4CYEA 2J53A 5CHVC 5C23A 1NVID 3ZLZA 1D5MC 3U7DA 2GBRA 3AEBB 4E3CA 3IT4B 4EE2A 1QZEA 2KD0A 4K7SA 4WIPA 3P4RB 2PVGC 3ZTDA 3SEBA 2KMAA 1ZW7A 5BYQA 4M02A 2LXAA 4RGNA 2IPKD 4F8CB 2JYTA 3AE1B 4NAWA 2WXGA 3VUXA 2XN9C 2LGYA 4NNJB 4US8A 2DLBA 5D94A 4KDIC 3ML9A 2KC2A 2CHZA 4M0WB 2LHEA 1T3QA 3OG5A 2GBMA 4DQOC 2QMTA 4OVZA 2LRWA 4BFRA 5AZGA 1TKYA 3UIPB 1MG4A 4RM9A 3MHSD 2VZKB 3VTWA 1PFDA 4YTMB 1WSPA 1NEKB 3BWUD 3ZNID 2LRUA 4WWOA 1UGMA 4NJ7A 4JLCA 2JT4B 3K9OB 1QILA 4S17A 3T3NA 1RRBA 2REXA 2DAFA 3QC8B 4EUTA 2JSVX 4URKA 5FR3A 2N7DA 5FK9C 3VDZA 1I4HA 2NBVB 4JE3B 4GB9A 2IGGA 3C8YA 1J7AA 4FJZA 3IBEA 1D5XC 2Q5WD 2M1MA 1NBFC 5G2NA 1JQ4A 3QWZB 1KJTA 4M0WA 3BK2A 3FILA 3Q3MC 3X23A 4JIOU 2RGFA 2K3UA 2N9XA 2Z59B 3ECIA 1FNVA 4N58A 3AM9A 3PS6A 2M17A 2QHOA 4JL9A 3ONSA 1ZUD2 4LLGM 3TEWA 2RPQA 2C7NB 1CQVA 3GZNI 1QKZA 3M63B 3KLSX 4XGAB 4AWJA 1H8CA 1WGKA 3EUB2 3KUCB 1Q10A 2QDFA 1SIFA 4P1CC 1YIWA 4CQNA 4AQ7A 3RYTA 5AEKB 2I1KA 4WWMA 1WGGA 4B0EA 4PYUA 2BB5A 2LGSA 1JWSD 1R4NB 4ANUA 3WAPA 1K51A 2QC8A 2LI5A 1F9JA 3AU4A 1F77A 5IA7A 1GC7A 2WDQB 2W9NA 3DHGC 3H9DA 2MA9B 1WY8A 1J7CA 1ZP0B 2DZKA 3NUHB 1XLPA 2KANA 3B2FA 1TKGA 2W54A 2JF5A 3IAM1 1F52A 4QAYA 2IBIB 3L4PA 1FM0D 1JRUA 1KLVA 1VCBA 4REZA 3LYYA 2KDIA 2JVCA 3ZTCA 4TQ0A 4MJSA 1SE3A 1STEA 2KMMA 1YOVB 2MX2A 2K1FA 4ZYNA 1C79A 1SEBD 3AE8B 2D3AA 1LQBA 2JU6X 5LLIA 3ZJTA 1VZ7A 3I63C 2ZVNA 1SF0A 1MI0A 2FBWB 2V4LA 4LNNA 5E6NA 2M0XA 4YTPB 3MC0B 3DHIC 3KUZA 3VH4B 1Y8RC 1HQRD 3KWVA 1GC6A 3PLUA 2DYBA 3NZUA 4WJPA 2RDHA 3GE8C 4TV3A 1VR9A 2N9LA 1V9JA 3NY5A 1TS5A 2C7HA 4GN1A 4M8NA 3UQAA 2INNE 2N7EA 5DCNA 1L5PA 1NENB 2J7QB 2MLBA 2D3GA 4P1BC 1WGYA 1VD2A 1FO4A 3ZRFA 4HCPB 2G4SA 4A90A 4ANXA 2MBBB 1SE9A 2WQYB 3MC9A 4OHJA 1L2NA 2DBYA 4KKJA 1V1PB 3QAQA 2KHWB 4F1SA 2JPHA 1ZDVA 4ARIA 3HRDD 3QCAA 2R2OA 4ASWC 4DDID 1IPGA 1TGZB 4FADA 2BQQA 3VR9B 2KN5A 1MHXA 3CMMB 3W2DA 1OQQA 2MW5A 1KTKA 2NBWB 1V97A 3V6CB 5I4DA 4XDDA 1I4XA 2WX1A 1WX7A 3KYDD 5LNK1 2W55A 4E71A 3Q8AA 2ZNVB 4PT5A 3VRBB 2V9HA 4FULA 4PK1A 5T8IA 1DOXA 4NQKE 4P6VF 4ZHPA 3DVGX 1YN3A 3AE9B 4MEMA 2AX5A 3L08A 1EO6A 1R4MI 1EWCA 5EDSA 4TKNA 1ET6A 3PO0A 4ANVA 2PIAA 3EHVA 1OGWA 1EF1A 2GB1A 1YNTE 1HZ6A 3ZDMC 3I3TB 1YD8U 1QOBA 3ETRA 1P98A 2WHIA 4AP4C 3Q8CA 2L8JA 3QK0A 2K9XA 5J17A 1YN5A 1FXTB 1YJ1A 4XZ4A 3AEEB 5G55A 3K9PB 4ACFA 5KHOA 4MH8A 3WIMA 1IBXB 1DYQA 5IP4D 2H88B 1YMHE 4KZ0A 1WX9A 3LDZE 2W3SA 2JQRB 1R7SA 1K8RB 1QOFA 3B9JA 1L7YA 2KLCA 4RGMA 3X0WA 1XT9B 2JRIB 4O1NA 3RD2A 2JX5A 4I6NB 1WH3A 5IN7A 2WX0A 1VZ6A 2CS4A 2L7RA 4C56C 5C1ZA 4PYZA 1KOTA 2L0TA 2K25A 2KXJA 1WMHB 2MEKA 2MWSB 3A9JB 2UU7A 2RSUA 5BMIA 2LUEA 1N5XA 4GIVA 1JMLA 3BINA 3M3JA 4J6IA 1JCKB 4NZLB 3PSEB 1HTOA 2KNBA 1N6ZA 3HHMA 2PKOA 3HUIA 2LEKA 3N1XC 3VUYA 5JH5C 2WS3B 1JWMD 3ZVVA 2IO3B 3TJPA 2OJWA 4MGIE 3T3OA 2KFKA 2IGDA 2KO3A 1FPYA 1QF6A 5AUKA 4BKSD 1I7HA 3Q69A 4XC2A 4HXDA 2MRPA 3L54A 4YSZB 3KUDB 2JWUA 2FCSA 2ZW0A 2IO1B 3DVGY 1WJ4A 1FNWA 1SSNA 2D2QA 2JZ3B 2WXRA 2W82A 1M4VA 2MCNB 2BF8B 2C9WB 4PS8A 2JUOA 3W1SC 3ZJUA 1E0ZA 1TS2A 1WE6A 1WX8A 3L10B 4RGOS 3SU8X 1JROA 4DHJD 2ONQA 4BOSC 1L0XB 2K6QA 1FD6A 1EM7A 4DHZB 1C76A 4AJYB 3VHTC 1J19A 3V3XA 2HD5B 2KWDA 5IAAC 5D3IB 3SHQA 4HWIB 4XX5A 2XK5B 1L0VB 1S1QB 4K1RB 5H92C 2V4IB 2B76B 1T0QC 3BYYB 2KN4A 2FE8A 4ARCA 2HTME 1KRHA 1N62A 4EEWA 1TS3A 5TR5A 1V5OA 2BTEA 3RPFC 1T0RC 2RR9A 3VTUA 4MGZE 2NTTA 3GZNB 4KIKB 2WXPA 3B2GA 3R8BA 2QSDA 1X1MA 4OZAA 3NVVA 2XNAC 3FAHA 3NS1A 2D11A 4HK2A 3UI3A 3BVMA 3PRPB 4LNOA 1ROEA 2EKEC 2BWFA 2WXIA 3AE7B 2INCC 4MGKE 2I38A 2NTSA 4MSMB 4KDLB 1YQ4B 2CHXA 4AUQC 2RMMA 3PTFC 4DDGD 4BKTA 4GLSC 1F2RI 2DAJA 5J18A 4NJ6A 4W9KA 3WA0A 1N63A 5DPTA 1LM8B 2K6DB 2E6XA 3MJ5A 3H7SA 2LVOA 1OTRB 1ISNA 2QCZA 5JZEB 1V6EA 1AW7A 5CX3A 3AI5A 2CU3A 1TZ1A 1C4PA 4M01A 4HVBA 3AEGB 2KACA 1F1HA 1DGJA 1N60A 2AQ2B 2J52A 1VRAB 4IWQA 4A3OA 3VVWB 2G4DB 2AL6A 2WXLA 2KYWA 2V1YA 1WYWB 3H7PA 5CHWA 2KJRA 1RM6C 3DBLI 2O6VB 2PW9A 3APFA 2KDMA 4FXCA 5EE1A 3RNBC 3VRAB 1YQBA 4IWPA 3TBLD 1IGDA 4N9F4 4P16A 1FFVA 2IY0B 1WZ3A 1D3ZA 2E3TA 3EC8A 4MELA 1FNUA 1GB4A 2IJ0A 1I4QA 2AWTA 2BB6A 1L6UA 3KVFB 2KQ4X 3P4QB 1WYGA 1P0RA 2WXMA 4RH6A 2ZZPB 1G6JA 3WAMA 3SD5A 2CJOA 2PE9A 4ZDVA 3ZKJC 3U8ZA 3EA6A 4HLEA 5DPRA 1T0SC 2XEWA 2V3SA 1XD3B 4LDTD 5FKAC 2YLMA 2G9HD 3IT6B 1E90A 1P3QU 3QJZA 4BBNF 3PHXB 3PPAA 1GNUA 3DQVA 4XWWA 1E5WA 4LTUA 4I6PA 2O6VA 5L83A 3ZQ4A 1D4BA 3WANA 1VDVA 2BBCA 1QOGA 4II3B 1K50A 1SXTA 1FIQA 1TS4A 2R61A 2IO0B 4LNFA 4G3XB 4FHJA 4IM3A 4TMAB 2M4NA 1GAQB 1WGRA 4DK5A 2GBKA 3BVGA 4CO7A 3A1QB 3RI7C 1ZGUB 1NYRA
chains in the Genus database with same CATH topology
1HXYD 5EE0A 3HRDD 1BXTA 1WRIA 1N5WA 1YQ3B 3ZJVA 1TY2A 5TSSA 3VR9B 2QEJC 3O13A 1MHXA 4XE0A 3AB5A 4A55A 3W2DA 2MJDA 2DYOA 1GPXA 1OQQA 1JWUD 1KTKA 2Y5PA 4KGTA 1SE4A 4YSXB 1V97A 2QILA 1EU3A 1VZ8A 1PGAA 5I4DA 2PMVA 1QLBB 4XDDA 2K0PA 3MP9A 3W5UB 1E7PB 1I4XA 2PLPA 2SAKA 2VZKD 1SIJA 4WAFA 3BIID 5LNK1 2W55A 3BVZA 3Q8AA 4PT5A 2N0SB 3I9V1 1GB1A 4L2YA 3P63A 3VRBB 3EGRA 1TY0A 2JYEA 1V8CA 2MJEA 4IDIA 4R3DA 4RF1A 1PGXA 3AE5B 5D3DA 5T8IA 3TUOA 5BYRA 5D7GA 2JZPA 5HI1A 1DOXA 4P6VF 1FFUA 4ZHPA 2WXHA 1TJEA 1YN3A 3AE9B 2YEPF 4WH4A 3CIRB 1D5ZC 1F2RC 2AX5A 2LJIA 1XLNA 3ZGZA 2FUG1 3P42A 4RF0A 3Q8FA 3U52E 3NZ3A 1EWCA 1XLQA 1ET6A 2Z8LA 4KGRA 5EE9A 3PO0A 2PIAA 4TQ1A 1SB3C 4L23A 2V3NA 3GB1A 1SE2A 3RFZB 3AE4B 3PZ8A 2MJ3A 3I57A 4YWGG 1C4CA 2GB1A 1YNTE 1HZ6A 1ZDXA 3FILB 3OWEB 2BS4B 4ZOHC 3SFEB 3E9SA 1BUIC 1QOBA 1YJJA 4DXFA 1F0ZA 3ETRA 4H2AA 4OZBA 3CWIA 3TSSA 2I2YA 3NVWA 3Q8CA 1MVKA 2GI9A 2K9XA 4ITKA 4RNAA 4A9AA 1NI3A 1YN5A 2DYMA 3BZDB 1I4RA 2KAJA 4HEA1 4C7YA 4US9A 1QQRA 1FRRA 3AEEB 3HVZA 4N6EB 1ZPSA 4MH8A 1CK1A 1HEZE 1IBXB 1DYQA 1HA5A 1I4GA 4JWUC 2H88B 1GOZA 1YMHE 4OW0A 1KFYB 2W3SA 4YTNB 1ACCA 1QOAA 1IUEA 1E10A 2JQRB 1PUTA 1R7SA 2K5PA 2M56B 1UUPA 1AN8A 2WXNA 1QOFA 3GS2A 5BYSA 3B9JA 1Y56A 1L0YB 3AEFB 1MHHE 1MPEA 1KLUD 4IKGA 1RWSA 2BT6A 4RGMA 1T6BX 1PYWD 2N9KA 3HVDA 4O1NA 1B1ZA 2JX5A 1OFFA 1HZ5A 3SR6A 3U7ZA 1VZ6A 4NAMA 4C56C 3U4EG 1RFKA 4B0MA 1JALA 3R2IA 5BMHA 1XCTL 2MEKA 2K22A 3GP7A 5AUIA 2GRIA 1TYGB 5BMIA 1C9FA 1N5XA 4RFBA 1JMLA 1N61A 1JCKB 1E9MA 1V1OA 2YEPB 1E6EB 1JRPA 4NZLB 1K53A 4UDUC 2M0AA 3VQIA 3LB8C 3W5VB 5JXVA 1C4AA 1IGCA 3AE3B 1YJIA 3R2TA 2WP9B 4AS1A 1VJKA 3TEZA 3AEDB 3AMZA 4XDCA 1ZOYB 2PKOA 3HUIA 2V0GA 4C80A 2LEKA 4C7ZA 4YXDB 1T5XD 2WS3B 1JWMD 1FXIA 2ON8A 1QT9A 1VLBA 5EE3A 3NVYA 2J53A 3TEXA 3T3OA 2IGDA 1NVID 2WU5B 5BMGA 3W1SA 3URYA 1QF6A 1D5MC 5AUKA 1I7HA 3Q69A 1C77A 3AEBB 3N9YC 4RCOA 3BK1A 4YSZB 1LO5D 3ZYYX 2JWUA 2ZW0A 3IT4B 1ZE3D 1AWDA 4EE2A 1EU4A 1FNWA 4WIPA 3P4RB 1SSNA 2PVGC 2WXRA 2W82A 1M4VA 3SEBA 5BYQA 1DOYA 3ZJUA 1E0ZA 1TS2A 1KF6B 3ABVB 2CJNA 4RGNA 2IPKD 2J4XA 3E56A 4JX1C 2JYTA 3AE1B 4RGOS 2WXGA 1PGBA 2ACZB 2XN9C 3KQ4A 4US8A 2DLBA 1V1PA 2LUMA 2Y5CA 1JROA 1XLOA 3SFDB 1NYQA 2ONQA 1DOIA 1B9RA 1L0XB 2LHEA 3AE6B 3WCQA 5G5GA 1FD6A 1T3QA 4J3OD 4DQOC 2QMTA 1EM7A 2X38A 4OVZA 1KH0A 1C76A 2LHDA 2D5GA 1TKYA 4GDKB 1FMAD 3V3XA 1JWAD 2KWDA 4ZRPA 5HFYA 2VZKB 4Q2JA 1PFDA 4LK0M 3W9CB 3Q8BA 5D3IB 2RDGA 1WSPA 4YTMB 2BYTA 1NEKB 2EELA 1L0VB 3BWUD 4IOIE 1XEEA 5H92C 2RPVA 2V4IB 2B76B 2WXOA 3BYYB 1QILA 3T3NA 2PTLA 2ICIA 2KN4A 2JSVX 2FE8A 2W3RA 4ARCA 2HTME 5C2TB 5FR3A 3VR8B 2WLBA 5H8YE 1KRHA 1N62A 5E6JA 2EKIA 5FK9C 3MFGA 1I4HA 1J7BA 1FRDA 2WXKA 1TS3A 4JE3B 2BTEA 3RPFC 2IGGA 1L4DB 3IXSA 1D6EC 2NTTA 1J7AA 3C8YA 2WXPA 3B2GA 3DWGC 3P1MA 3R8BA 1D5XC 2Q5WD 3KWLA 1RYJA 2QSDA 1JQ4A 4OZAA 2AQ1B 3NVVA 4M0WA 3BK2A 2XNAC 2AQ3B 3FAHA 3FILA 1XO3A 3NS1A 4JPSA 1CJEA 4NJCA 3AN1A 2BS3B 2PVOD 3UI3A 2OEDA 2SEBD 3BVMA 1I4PA 2K3UA 5C3JB 1FXAA 1FNVA 4N58A 3AM9A 5HG2A 2WNMA 3J9CA 1P7EA 1ROEA 2WXFA 2DWQA 4JWSC 1UGJA 3H8HA 2WXIA 3AE7B 1ZUD2 4LLGM 1XCQL 2I38A 2NTSA 1BMLC 3TEWA 1YQ4B 1IBXA 1WWTA 1K52A 1CQVA 2RMMA 1QKZA 1ENFA 1YN4A 3TEYA 2BS2B 3KLSX 4GLSC 1F2RI 1UWMA 3BYTB 4MT5A 3P4SB 1WGKA 3EUB2 4YT0B 3DWMA 1N63A 1ESFA 1Q10A 4KX6B 4DXGA 2E6XA 3MJ5A 1XF5L 4A6QA 1UWXA 5HHDG 1FCLA 2N7JA 4YSYB 1AW7A 4AQ7A 4CQNA 1KLGD 2TSSA 2CU3A 4WWMA 2L1AA 4HKZE 2V3PA 4B0EA 1C4PA 1JWBD 2OHFA 1OQRA 2BB5A 2MH7A 3AEAB 3AEGB 2KACA 1JWSD 4D2KA 1DGJA 1N60A 4GDLB 2WXQA 1K51A 4N59A 2AQ2B 2J52A 2M19A 1VRAB 1PDXA 1C78A 1F77A 4HROA 2WDQB 1SJED 2WXLA 4WQMA 2IGHA 2QIEB 1J7CA 2IDYA 5GXGB 1ZP0B 3MHZA 3NUHB 4MACA 1FCCC 4ZHOA 1RM6C 3AV8A 1XLPA 3B2FA 1TKGA 2PW9A 4RGTA 2KDMA 2W54A 4FXCA 5EE1A 2WU2B 3IAM1 2BW2A 3VRAB 1UNSA 3L4PA 1WXQA 3IAS1 1IGDA 1FM0D 4P16A 1FFVA 1JW9D 3AH7A 1L4ZB 4REZA 2WDVB 3LYYA 2E3TA 2L32A 4ZRQA 4TQ0A 3U2SC 2LMCA 2G1EA 1SE3A 1STEA 2KMMA 1FNUA 1TKEA 1GB4A 2IJ0A 1I4QA 2BB6A 1L6UA 4WURA 5G5HA 3NVZA 2KQ4X 3P4QB 1WYGA 3AE2B 1C79A 1SEBD 3AE8B 2WXMA 2WXJA 1L6VA 1ZXHA 4MM3B 4RH6A 2LFIA 2JU6X 1CZPA 3ZJTA 1VZ7A 2HDEA 3P4PB 1SF0A 1MI0A 2FBWB 2L83A 2CJOA 1TZOA 4A8XC 2QJLA 3EA6A 4YTPB 1SJHD 5MPOA 2Y3AA 3MC0B 2WDRB 1XXGA 1HQRD 3KWVA 5FKAC 2JXTA 2INPE 3AECB 2G9HD 3IT6B 2L52A 1ET9A 2RDHA 3FC4A 1VR9A 1SBBB 2N9LA 3LXFA 2LGIA 1TS5A 4XWWA 4LTUA 2ZW1A 2INNE 3ZQ4A 4HKQA 1D4BA 4USAA 1L5PA 2H89B 1VDVA 1NENB 2BBCA 2J42A 4KGSA 1ZXIA 1QOGA 4HJGE 4HRSA 1K50A 4XWTA 1P7FA 1SXTA 1FIQA 1TS4A 1FO4A 3Q8EA 2R61A 4A90A 1A70A 4NAWB 2WQYB 4OHJA 3V05A 2NMQA 4TMAB 4TSSA 2DBYA 1GAQB 4KKJA 1V1PB 4L1BA 3PZ7A 3BVGA 4ZYSA 1FEHA 1AYFA 4OZCA 1ZDVA 1NYRA 4KKIA 3NRZA 1EWYC 4ARIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N9K A;  2EEL A;  4IOI E;  1HZ5 A;  2IGH A;  1MHX A;  2RPV A;  4MAC A;  1FCC C;  1XCT L;  4KGT A;  5BMH A;  2PTL A;  2JSV X;  2KN4 A;  2PW9 A;  2KDM A;  5BMI A;  1PGA A;  1C9F A;  1JML A;  2K0P A;  3MP9 A;  2PLP A;  1K53 A;  1IGD A;  5JXV A;  1IGC A;  1GB1 A;  2IGG A;  1PGX A;  5HI1 A;  2JZP A;  2QSD A;  1GB4 A;  4WH4 A;  4OZA A;  1F2R C;  2KQ4 X;  3FIL A;  1ZXH A;  2ON8 A;  2JU6 X;  2J53 A;  2IGD A;  4KGR A;  1MI0 A;  5BMG A;  3UI3 A;  2OED A;  3GB1 A;  5HG2 A;  2GB1 A;  1YNT E;  1HZ6 A;  2JWU A;  3FIL B;  2ZW0 A;  1P7E A;  2JXT A;  1XCQ L;  2I38 A;  4OZB A;  1IBX A;  1K52 A;  2I2Y A;  2N9L A;  1MVK A;  2GI9 A;  2RMM A;  2LGI A;  1QKZ A;  4GLS C;  1F2R I;  2ZW1 A;  1PGB A;  1D4B A;  2LUM A;  1Q10 A;  4KGS A;  4HJG E;  1XF5 L;  1HEZ E;  1UWX A;  1IBX B;  5HHD G;  1K50 A;  2ONQ A;  1P7F A;  1FCL A;  2LHE A;  2N7J A;  1YMH E;  1FD6 A;  2QMT A;  1EM7 A;  4HKZ E;  1KH0 A;  2NMQ A;  2LHD A;  2KAC A;  3V3X A;  4D2K A;  2KWD A;  5HFY A;  1K51 A;  1MHH E;  1MPE A;  4IKG A;  2J52 A;  4OZC A; 
#chains in the Genus database with same CATH topology
 3UIO B;  1R4M B;  1BXT A;  1WRI A;  4G50 A;  2QEJ C;  3O13 A;  4HDQ A;  4XE0 A;  3AB5 A;  2DYO A;  4K3B A;  2Y5P A;  1SE4 A;  3OJ4 B;  1WJU A;  4YSX B;  1A5R A;  1EU3 A;  1UBI A;  2KWU B;  1QLB B;  3W5U B;  4WAF A;  3VTV A;  2WYQ A;  1GB1 A;  4L2Y A;  3P63 A;  3EGR A;  3V60 A;  2MJE A;  5D3D A;  5BYR A;  5D7G A;  1WIA A;  2JZP A;  2GBN A;  4BAX A;  3TL5 A;  1F2R C;  2LJI A;  2LGD A;  1MFW A;  5EE9 A;  3EEC A;  1U4A A;  4L23 A;  2V3N A;  3GB1 A;  4GMV A;  3JYU A;  3AE4 B;  4LJP B;  3RFZ B;  3PZ8 A;  2MJ3 A;  3I57 A;  1WGH A;  3PZD A;  3A1Q A;  3OWE B;  4DHZ E;  4GOC A;  2N9P C;  1E8X A;  2VH2 A;  1E7V A;  3TSS A;  1I35 A;  2DYM A;  3BZD B;  3C0R B;  1I4R A;  2KAJ A;  1WM3 A;  1AAR A;  2L00 B;  3HVZ A;  4G0N B;  4HCN B;  2D07 B;  3B08 A;  4MGY E;  4N6E B;  1ZPS A;  2CKH B;  2DEN B;  2KTF A;  1ACC A;  1IUE A;  4BOZ B;  3DCG A;  1PUT A;  1UZX B;  2M56 B;  1UUP A;  2KJ6 A;  1AN8 A;  1E8W A;  3GS2 A;  5BYS A;  1MHH E;  4W9F A;  1V2Y A;  3QAR A;  1RWS A;  2LVQ A;  3UQB A;  1J0G A;  1PYW D;  2N9K A;  3HVD A;  1B1Z A;  2IZV B;  3NHE B;  1OFF A;  3SR6 A;  1UF0 A;  4NAM A;  1MJD A;  3ZO5 B;  3U4E G;  4B0M A;  1V5T A;  5LXH A;  2K22 A;  4HPP A;  5AUI A;  1C9F A;  3PRM B;  1E9M A;  1V1O A;  1P9D U;  3VQI A;  3W5V B;  5JXV A;  1EF5 A;  5CTR C;  3RN9 C;  1VJK A;  3TEZ A;  1LGR A;  1ZOY B;  2KTR B;  2BYE A;  4C80 A;  3VFK A;  4JQW C;  1FXI A;  2ON8 A;  3NVY A;  3TEX A;  2MP2 B;  3ZIM A;  2WU5 B;  3OJ3 A;  1C77 A;  4W9D A;  4RCO A;  3IG3 A;  3BK1 A;  3BY4 B;  1GUA B;  1CMX B;  1ZE3 D;  1AWD A;  1OEY J;  3KW5 B;  2ZCC A;  3QIJ A;  4AJW A;  3JW0 X;  4K81 A;  2K8B A;  3PHW B;  4B9K A;  3Q6B A;  1KF6 B;  3ABV B;  3E56 A;  3KQ4 A;  2ACZ B;  3QA8 A;  3EFU A;  5E6O A;  1S3S G;  1V1P A;  2LUM A;  2Y5C A;  1Q0W B;  4W9L A;  4A20 A;  2AL3 A;  1Q5W B;  3WCQ A;  5G5G A;  2X8X X;  3A9K B;  3EFC A;  3KYC D;  2JWZ A;  2X38 A;  2DZM A;  1UD7 A;  4RMA A;  2D5G A;  4GDK B;  3DBH I;  4C4V B;  4ZRP A;  5HFY A;  3L13 A;  4Q2J A;  5FR6 A;  1YX6 B;  2PPH A;  4LK0 M;  5GMV A;  3W9C B;  1GG3 A;  2GOW A;  2LGX A;  2MP2 A;  5AZH A;  5JHB A;  1XEE A;  4E74 A;  2RPV A;  2GBJ A;  4WWP A;  2DZI A;  2W3R A;  5C2T B;  3VR8 B;  2WLB A;  3DBR I;  5E6J A;  2EKI A;  2WXK A;  4W9C A;  1L4D B;  3IXS A;  3Q3N C;  1D6E C;  4ZRK A;  2OJR A;  3Q3O C;  3ZNZ B;  3N1Z C;  4KSL C;  4BZA A;  2AQ3 B;  4II2 B;  4S0R A;  3A9K A;  1XO3 A;  1CJE A;  3AN1 A;  2PJH A;  2KOX A;  2WDT B;  2PVO D;  4GDK A;  2OED A;  2SEB D;  1WZ0 A;  1I4P A;  2K8C A;  3Q3J A;  5LXI B;  1Q1O A;  1FXA A;  3B1L X;  3L0W B;  5HG2 A;  2AYO B;  3AXC A;  1P7E A;  5IO9 A;  2WXF A;  4M8M A;  2DWQ A;  3H8H A;  1WJ6 A;  2FNJ B;  1XCQ L;  1IYF A;  1BML C;  1IBX A;  1TT5 B;  5DPW A;  2IY1 B;  1OEY A;  3PRZ A;  2ZVO A;  1YN4 A;  3TEY A;  2DNF A;  2C5L C;  1UWM A;  3BYT B;  2K39 A;  3DBL B;  3P4S B;  3Q14 C;  2NCN A;  1ESF A;  2KVZ A;  1WXS A;  1XF5 L;  1UWX A;  2N7J A;  4IW0 A;  1KLG D;  2L1A A;  1WXA A;  1HTQ A;  4HKZ E;  2V3P A;  4W9E A;  4NY0 A;  1JWB D;  1OQR A;  3M95 A;  3IFW B;  3QHT A;  1WMH A;  2EMS A;  2WXQ A;  3DBS A;  3A9J A;  2WWZ A;  3M62 B;  4RM8 A;  2KKC A;  2KX0 A;  2BVC A;  1SJE D;  1J8C A;  2ZJD A;  2QIE B;  5GXG B;  3MHZ A;  4MAC A;  5E6P A;  3RUL A;  3AU5 A;  3HK0 A;  4ZHO A;  3AV8 A;  3WAO A;  4RGT A;  2WU2 B;  2BW2 A;  1WXQ A;  3H1U A;  3V6E B;  4FA6 A;  4FBJ B;  1JW9 D;  1L4Z B;  3N1Y C;  4WJN A;  1P1A A;  4K7W A;  5KHQ A;  2L32 A;  3OLM D;  3U2S C;  2LZ6 A;  4FJV B;  2MSE D;  2G1E A;  1KM7 A;  3DVN V;  3TIX A;  2MBO A;  4EZK A;  4XYC A;  1WXV A;  5G5H A;  1NDD A;  1ZKH A;  2KDF B;  2WXJ A;  1ZXH A;  4MM3 B;  4ICU A;  5DPS A;  2MBQ A;  3R66 C;  1V81 A;  2MBE A;  1TZO A;  2QJL A;  2HJ1 A;  5CHF A;  2C7M B;  4DHJ B;  2L05 A;  2NPT B;  1WGD A;  4WQO B;  5HKH A;  2INP E;  3AEC B;  4FHK A;  2FCN A;  2L52 A;  3FC4 A;  4IUM B;  2FUH B;  1C1Y B;  1TBE A;  3LXF A;  2LGI A;  3NZS A;  2KMC A;  2R2Q A;  4DXA B;  3UF8 A;  2RDB C;  2J42 A;  5AZF A;  4HJG E;  4XWT A;  2M8S A;  4MSQ B;  1P7F A;  4BKS A;  1V86 A;  3Q8E A;  4G11 A;  2XK5 A;  1A70 A;  4NAW B;  3V05 A;  2NMQ A;  4TSS A;  4KSK C;  2KWC A;  1YX5 B;  3PZ7 A;  2JY6 A;  4ZYS A;  2PEA A;  1AYF A;  4KKI A;  1EWY C;  3T9L A;  1HXY D;  5EE0 A;  1WI0 A;  3ZJV A;  1TY2 A;  1V49 A;  2LWP A;  5IOI A;  4A55 A;  1GPX A;  2MJD A;  1JWU D;  2A4Z A;  4KGT A;  1WFY A;  2O6V D;  4KIK A;  3FKY A;  2QIL A;  1VZ8 A;  1PGA A;  2FID A;  3MP9 A;  1E7P B;  2VZK D;  1SIJ A;  3B0A A;  2N0S B;  2HJ8 A;  1TY0 A;  2JYE A;  1V8C A;  4IDI A;  2PE6 B;  4R3D A;  4RF1 A;  1PGX A;  3AE5 B;  1Z5S B;  1FFU A;  1TJE A;  2L76 A;  4TUU A;  1Z2M A;  4WH4 A;  2O2V B;  3TCA A;  3DHH C;  4KVG B;  1D5Z C;  4IC7 B;  4RF0 A;  2DHZ A;  3ZXR A;  4KGR A;  4W9I A;  2MHJ A;  2VH1 A;  4TQ1 A;  1SB3 C;  2N1W A;  2KZR A;  1C4C A;  1ZDX A;  3FIL B;  3RCZ A;  2UWQ A;  3ZXV A;  4ZOH C;  3ALB A;  2LJ5 A;  3JVZ X;  1BUI C;  4DXF A;  1YJJ A;  3APD A;  3CWI A;  2I2Y A;  2HE7 A;  2J0J A;  4NPN A;  4A9A A;  4GU2 A;  4M00 A;  3PRE A;  4HEA 1;  4C7Y A;  4US9 A;  1FRR A;  1E7U A;  4ZRI A;  1C3T A;  2MBH A;  1I4G A;  2L3Z A;  1GOZ A;  2LVP A;  4FN2 A;  3RZF A;  4YTN B;  1E10 A;  2K5P A;  2N4F A;  1MG8 A;  2O2V A;  3L17 A;  3AEF B;  4JGH B;  2BT6 A;  2KLG A;  2ZNV C;  4MDK E;  3HIZ A;  2G3Q B;  2EMT A;  4LNK A;  3R2I A;  1JAL A;  5BMH A;  1WM2 A;  2GRI A;  1TYG B;  3IVF A;  1N61 A;  4UDU C;  1K53 A;  2M0A A;  4X57 B;  1EUV B;  1C4A A;  4HPM B;  1H4R A;  3R3M A;  3LJ3 A;  3R2T A;  4AS1 A;  4EZL A;  4XDC A;  4LDT B;  2V0G A;  2KK8 A;  4YXD B;  4AOF A;  4IM0 A;  2XBB C;  1QT9 A;  1VLB A;  3RNE C;  5EE3 A;  4C00 A;  3UGB B;  2BWE S;  4W9H A;  5BMG A;  3W1S A;  4MJS B;  3URY A;  3RNG C;  1WR6 E;  3N9Y C;  3DBH B;  1LO5 D;  3ZYY X;  2NR2 A;  2Y5B B;  1EU4 A;  2WGS A;  3UIN B;  1SGH A;  1V80 A;  2AEH A;  2KC1 A;  4EZJ A;  1DOY A;  2CU1 A;  2LXC A;  2CJN A;  2J4X A;  4JX1 C;  2IO2 B;  4ANW A;  4FLH A;  1PGB A;  5JHA A;  3Q2A C;  4NQL B;  2FAZ A;  3DBR B;  1XLO A;  3SFD B;  1NYQ A;  4IM2 A;  1DOI A;  1B9R A;  3AE6 B;  3N30 A;  4J3O D;  2N9E B;  3JSV B;  2CR5 A;  3ENE A;  1KH0 A;  2LHD A;  2J0M A;  1FMA D;  2ZCB A;  1JWA D;  4IWO A;  2Z0D B;  2KWV B;  5L95 C;  4A3P A;  1IP9 A;  1WF9 A;  3D32 A;  3NG0 A;  1PQS A;  3Q8B A;  2RDG A;  2BYT A;  2D10 A;  2EEL A;  4IOI E;  4ICV A;  2WXO A;  2PTL A;  2ICI A;  3MC8 A;  5H8Y E;  1OQY A;  2FCM A;  1RFA A;  3MFG A;  1J7B A;  1FRD A;  2KQ7 A;  3VXW A;  3DWG C;  3P1M A;  2K8H A;  3RZW C;  3CSF A;  3KWL A;  1RYJ A;  4B6W A;  3R7Q A;  3RT3 B;  2JRH A;  2AQ1 B;  2NS5 A;  3JSV A;  2C60 A;  2ZPY A;  4JPS A;  4NJC A;  2BS3 B;  3ZRC A;  4LCD E;  4YL8 A;  4EOY A;  3VUW A;  2YVC A;  4PS3 A;  5C3J B;  3Q3F A;  2WNM A;  3J9C A;  4JWS C;  1UGJ A;  4GXB A;  2LD9 A;  4LJO B;  1WWT A;  1K52 A;  5J2R A;  3QX1 A;  2L0F A;  3P2B A;  1ENF A;  2BS2 B;  3GE3 C;  2MQJ A;  4WJQ A;  4KV2 A;  4MT5 A;  4YT0 B;  2DX5 B;  3DWM A;  4KX6 B;  4DXG A;  3N3K B;  4A6Q A;  5HHD G;  1RLF A;  4HPL B;  2NVU I;  1FCL A;  4YSY B;  3TMP B;  2TSS A;  2OHF A;  1M94 A;  2MH7 A;  3AEA B;  2RD0 A;  2BKR B;  4D2K A;  4F7Z A;  4GDL B;  4LNI A;  2KT7 A;  3A33 B;  1E8Z A;  2KFJ A;  4N59 A;  2M19 A;  1PDX A;  1C78 A;  4HRO A;  1WR1 A;  3PV1 A;  1WE7 A;  3KH0 A;  4WQM A;  2IGH A;  2FCQ A;  2IDY A;  1HE8 A;  1FCC C;  2UYZ B;  4KZC A;  4P7I A;  2KTR A;  2I1J A;  1UNS A;  1NI2 A;  2B3A A;  3IAS 1;  4OVV A;  3AH7 A;  2N1V A;  2WDV B;  3DDC B;  1BT0 A;  4ZRQ A;  2KVR A;  2LMC A;  1R4N I;  3PVL A;  1TKE A;  3AUL A;  4WUR A;  4ZRJ A;  1E8Y A;  3NVZ A;  3WAL A;  3AE2 B;  1TTN A;  1L6V A;  3RMK C;  2LFI A;  1CZP A;  3DPD A;  1RAX A;  1I42 A;  3P4P B;  2HDE A;  3H6N A;  2L83 A;  1T0Y A;  4MH0 E;  2VRR B;  4GDL A;  4A8X C;  3NS8 A;  2KX3 A;  5MPO A;  1SJH D;  2Y3A A;  3RNA C;  2WDR B;  1XXG A;  3T8M A;  2JXT A;  2KFK B;  1TIF A;  1WXM A;  1ET9 A;  4W9J A;  3R7R A;  2ASQ A;  1SBB B;  4K7U A;  2ZW1 A;  3CF6 E;  4CHK A;  3GOE A;  4HKQ A;  2KQS A;  4WJO A;  4USA A;  4C4V A;  3A4S C;  2H89 B;  4KGS A;  1ZXI A;  4HRS A;  3U30 A;  3DVN U;  1WRD B;  3ML8 A;  5IKC M;  1UH6 A;  2JZZ A;  3ZW3 A;  5BO4 B;  3VAW A;  3A4R A;  2ZPN A;  2HTH A;  4WAA A;  4BKG A;  4L1B A;  4W9G A;  4BVU C;  3N32 A;  1FEH A;  4DBG A;  2GMI C;  4K3C A;  4OZC A;  5D2M B;  3NRZ A;  3PGE A;  4DWF A;  3APC A;  1YQ3 B;  1N5W A;  3HM3 A;  5TSS A;  3MTN B;  2GLS A;  3ZNG C;  2PMV A;  3O65 B;  2K0P A;  2IND C;  2PLP A;  2SAK A;  2BKF A;  1WJN A;  3BII D;  2D3B A;  3BVZ A;  4WWN A;  4EFO A;  3I9V 1;  4EKU A;  3TUO A;  5HI1 A;  3ZDT A;  1GJZ A;  2WXH A;  2YEP F;  3CIR B;  1XLN A;  3ZGZ A;  2FUG 1;  3P42 A;  3RNF C;  3Q8F A;  3U52 E;  3NOB A;  3NZ3 A;  1XLQ A;  2Z8L A;  2BYF A;  2IYD B;  2KDB A;  3PLV A;  4FJY A;  3S2A A;  1SE2 A;  2BYV E;  3QQ8 B;  3SDL C;  4YWG G;  3VH3 B;  2LAS A;  3OAW A;  2BS4 B;  3SFE B;  3E9S A;  3V61 A;  2NBU A;  1F0Z A;  4H2A A;  4OZB A;  3RUI B;  3HM6 X;  3NVW A;  1MVK A;  2GI9 A;  4ITK A;  1LFD A;  4RNA A;  1NI3 A;  3CST A;  4GGQ A;  1QQR A;  2CHW A;  3PT2 B;  2FIF A;  2ZEQ A;  1CK1 A;  1HEZ E;  3MJW A;  2D3C A;  1HA5 A;  4JWU C;  4OW0 A;  1KFY B;  1QOA A;  5D6J B;  2JXX A;  3C19 A;  3I5J C;  2WXN A;  3ZNH B;  1Y56 A;  1L0Y B;  2BGF A;  2KJH B;  1MPE A;  1KLU D;  4IKG A;  4HJK A;  3L16 A;  1T6B X;  1UBQ A;  2J0K A;  4IG7 B;  1HZ5 A;  3U7Z A;  1XQQ A;  3N20 C;  1RFK A;  2Z0E B;  1XCT L;  3DOW A;  3GP7 A;  3V62 A;  4OVU A;  1UEL A;  3W1Y A;  4RFB A;  2YEP B;  2OOB B;  1E6E B;  1JRP A;  4PS7 A;  3LB8 C;  4B95 A;  1IGC A;  3AE3 B;  4MM3 A;  3H7P B;  3NJT A;  1YJI A;  4BBN C;  4GSW A;  2WP9 B;  3ZUN A;  2DZJ A;  2KDE B;  3AED B;  3RNC C;  3IHP C;  3AMZ A;  1LXD A;  2A5U A;  2BPS A;  4C7Z A;  4I6L B;  4HDO A;  2G45 B;  1T5X D;  2NPT A;  4CYE A;  2J53 A;  5CHV C;  5C23 A;  1NVI D;  3ZLZ A;  1D5M C;  3U7D A;  2GBR A;  3AEB B;  4E3C A;  3IT4 B;  4EE2 A;  1QZE A;  2KD0 A;  4K7S A;  4WIP A;  3P4R B;  2PVG C;  3ZTD A;  3SEB A;  2KMA A;  1ZW7 A;  5BYQ A;  4M02 A;  2LXA A;  4RGN A;  2IPK D;  4F8C B;  2JYT A;  3AE1 B;  4NAW A;  2WXG A;  3VUX A;  2XN9 C;  2LGY A;  4NNJ B;  4US8 A;  2DLB A;  5D94 A;  4KDI C;  3ML9 A;  2KC2 A;  2CHZ A;  4M0W B;  2LHE A;  1T3Q A;  3OG5 A;  2GBM A;  4DQO C;  2QMT A;  4OVZ A;  2LRW A;  4BFR A;  5AZG A;  1TKY A;  3UIP B;  1MG4 A;  4RM9 A;  3MHS D;  2VZK B;  3VTW A;  1PFD A;  4YTM B;  1WSP A;  1NEK B;  3BWU D;  3ZNI D;  2LRU A;  4WWO A;  1UGM A;  4NJ7 A;  4JLC A;  2JT4 B;  3K9O B;  1QIL A;  4S17 A;  3T3N A;  1RRB A;  2REX A;  2DAF A;  3QC8 B;  4EUT A;  2JSV X;  4URK A;  5FR3 A;  2N7D A;  5FK9 C;  3VDZ A;  1I4H A;  2NBV B;  4JE3 B;  4GB9 A;  2IGG A;  3C8Y A;  1J7A A;  4FJZ A;  3IBE A;  1D5X C;  2Q5W D;  2M1M A;  1NBF C;  5G2N A;  1JQ4 A;  3QWZ B;  1KJT A;  4M0W A;  3BK2 A;  3FIL A;  3Q3M C;  3X23 A;  4JIO U;  2RGF A;  2K3U A;  2N9X A;  2Z59 B;  3ECI A;  1FNV A;  4N58 A;  3AM9 A;  3PS6 A;  2M17 A;  2QHO A;  4JL9 A;  3ONS A;  1ZUD 2;  4LLG M;  3TEW A;  2RPQ A;  2C7N B;  1CQV A;  3GZN I;  1QKZ A;  3M63 B;  3KLS X;  4XGA B;  4AWJ A;  1H8C A;  1WGK A;  3EUB 2;  3KUC B;  1Q10 A;  2QDF A;  1SIF A;  4P1C C;  1YIW A;  4CQN A;  4AQ7 A;  3RYT A;  5AEK B;  2I1K A;  4WWM A;  1WGG A;  4B0E A;  4PYU A;  2BB5 A;  2LGS A;  1JWS D;  1R4N B;  4ANU A;  3WAP A;  1K51 A;  2QC8 A;  2LI5 A;  1F9J A;  3AU4 A;  1F77 A;  5IA7 A;  1GC7 A;  2WDQ B;  2W9N A;  3DHG C;  3H9D A;  2MA9 B;  1WY8 A;  1J7C A;  1ZP0 B;  2DZK A;  3NUH B;  1XLP A;  2KAN A;  3B2F A;  1TKG A;  2W54 A;  2JF5 A;  3IAM 1;  1F52 A;  4QAY A;  2IBI B;  3L4P A;  1FM0 D;  1JRU A;  1KLV A;  1VCB A;  4REZ A;  3LYY A;  2KDI A;  2JVC A;  3ZTC A;  4TQ0 A;  4MJS A;  1SE3 A;  1STE A;  2KMM A;  1YOV B;  2MX2 A;  2K1F A;  4ZYN A;  1C79 A;  1SEB D;  3AE8 B;  2D3A A;  1LQB A;  2JU6 X;  5LLI A;  3ZJT A;  1VZ7 A;  3I63 C;  2ZVN A;  1SF0 A;  1MI0 A;  2FBW B;  2V4L A;  4LNN A;  5E6N A;  2M0X A;  4YTP B;  3MC0 B;  3DHI C;  3KUZ A;  3VH4 B;  1Y8R C;  1HQR D;  3KWV A;  1GC6 A;  3PLU A;  2DYB A;  3NZU A;  4WJP A;  2RDH A;  3GE8 C;  4TV3 A;  1VR9 A;  2N9L A;  1V9J A;  3NY5 A;  1TS5 A;  2C7H A;  4GN1 A;  4M8N A;  3UQA A;  2INN E;  2N7E A;  5DCN A;  1L5P A;  1NEN B;  2J7Q B;  2MLB A;  2D3G A;  4P1B C;  1WGY A;  1VD2 A;  1FO4 A;  3ZRF A;  4HCP B;  2G4S A;  4A90 A;  4ANX A;  2MBB B;  1SE9 A;  2WQY B;  3MC9 A;  4OHJ A;  1L2N A;  2DBY A;  4KKJ A;  1V1P B;  3QAQ A;  2KHW B;  4F1S A;  2JPH A;  1ZDV A;  4ARI A;  3HRD D;  3QCA A;  2R2O A;  4ASW C;  4DDI D;  1IPG A;  1TGZ B;  4FAD A;  2BQQ A;  3VR9 B;  2KN5 A;  1MHX A;  3CMM B;  3W2D A;  1OQQ A;  2MW5 A;  1KTK A;  2NBW B;  1V97 A;  3V6C B;  5I4D A;  4XDD A;  1I4X A;  2WX1 A;  1WX7 A;  3KYD D;  5LNK 1;  2W55 A;  4E71 A;  3Q8A A;  2ZNV B;  4PT5 A;  3VRB B;  2V9H A;  4FUL A;  4PK1 A;  5T8I A;  1DOX A;  4NQK E;  4P6V F;  4ZHP A;  3DVG X;  1YN3 A;  3AE9 B;  4MEM A;  2AX5 A;  3L08 A;  1EO6 A;  1R4M I;  1EWC A;  5EDS A;  4TKN A;  1ET6 A;  3PO0 A;  4ANV A;  2PIA A;  3EHV A;  1OGW A;  1EF1 A;  2GB1 A;  1YNT E;  1HZ6 A;  3ZDM C;  3I3T B;  1YD8 U;  1QOB A;  3ETR A;  1P98 A;  2WHI A;  4AP4 C;  3Q8C A;  2L8J A;  3QK0 A;  2K9X A;  5J17 A;  1YN5 A;  1FXT B;  1YJ1 A;  4XZ4 A;  3AEE B;  5G55 A;  3K9P B;  4ACF A;  5KHO A;  4MH8 A;  3WIM A;  1IBX B;  1DYQ A;  5IP4 D;  2H88 B;  1YMH E;  4KZ0 A;  1WX9 A;  3LDZ E;  2W3S A;  2JQR B;  1R7S A;  1K8R B;  1QOF A;  3B9J A;  1L7Y A;  2KLC A;  4RGM A;  3X0W A;  1XT9 B;  2JRI B;  4O1N A;  3RD2 A;  2JX5 A;  4I6N B;  1WH3 A;  5IN7 A;  2WX0 A;  1VZ6 A;  2CS4 A;  2L7R A;  4C56 C;  5C1Z A;  4PYZ A;  1KOT A;  2L0T A;  2K25 A;  2KXJ A;  1WMH B;  2MEK A;  2MWS B;  3A9J B;  2UU7 A;  2RSU A;  5BMI A;  2LUE A;  1N5X A;  4GIV A;  1JML A;  3BIN A;  3M3J A;  4J6I A;  1JCK B;  4NZL B;  3PSE B;  1HTO A;  2KNB A;  1N6Z A;  3HHM A;  2PKO A;  3HUI A;  2LEK A;  3N1X C;  3VUY A;  5JH5 C;  2WS3 B;  1JWM D;  3ZVV A;  2IO3 B;  3TJP A;  2OJW A;  4MGI E;  3T3O A;  2KFK A;  2IGD A;  2KO3 A;  1FPY A;  1QF6 A;  5AUK A;  4BKS D;  1I7H A;  3Q69 A;  4XC2 A;  4HXD A;  2MRP A;  3L54 A;  4YSZ B;  3KUD B;  2JWU A;  2FCS A;  2ZW0 A;  2IO1 B;  3DVG Y;  1WJ4 A;  1FNW A;  1SSN A;  2D2Q A;  2JZ3 B;  2WXR A;  2W82 A;  1M4V A;  2MCN B;  2BF8 B;  2C9W B;  4PS8 A;  2JUO A;  3W1S C;  3ZJU A;  1E0Z A;  1TS2 A;  1WE6 A;  1WX8 A;  3L10 B;  4RGO S;  3SU8 X;  1JRO A;  4DHJ D;  2ONQ A;  4BOS C;  1L0X B;  2K6Q A;  1FD6 A;  1EM7 A;  4DHZ B;  1C76 A;  4AJY B;  3VHT C;  1J19 A;  3V3X A;  2HD5 B;  2KWD A;  5IAA C;  5D3I B;  3SHQ A;  4HWI B;  4XX5 A;  2XK5 B;  1L0V B;  1S1Q B;  4K1R B;  5H92 C;  2V4I B;  2B76 B;  1T0Q C;  3BYY B;  2KN4 A;  2FE8 A;  4ARC A;  2HTM E;  1KRH A;  1N62 A;  4EEW A;  1TS3 A;  5TR5 A;  1V5O A;  2BTE A;  3RPF C;  1T0R C;  2RR9 A;  3VTU A;  4MGZ E;  2NTT A;  3GZN B;  4KIK B;  2WXP A;  3B2G A;  3R8B A;  2QSD A;  1X1M A;  4OZA A;  3NVV A;  2XNA C;  3FAH A;  3NS1 A;  2D11 A;  4HK2 A;  3UI3 A;  3BVM A;  3PRP B;  4LNO A;  1ROE A;  2EKE C;  2BWF A;  2WXI A;  3AE7 B;  2INC C;  4MGK E;  2I38 A;  2NTS A;  4MSM B;  4KDL B;  1YQ4 B;  2CHX A;  4AUQ C;  2RMM A;  3PTF C;  4DDG D;  4BKT A;  4GLS C;  1F2R I;  2DAJ A;  5J18 A;  4NJ6 A;  4W9K A;  3WA0 A;  1N63 A;  5DPT A;  1LM8 B;  2K6D B;  2E6X A;  3MJ5 A;  3H7S A;  2LVO A;  1OTR B;  1ISN A;  2QCZ A;  5JZE B;  1V6E A;  1AW7 A;  5CX3 A;  3AI5 A;  2CU3 A;  1TZ1 A;  1C4P A;  4M01 A;  4HVB A;  3AEG B;  2KAC A;  1F1H A;  1DGJ A;  1N60 A;  2AQ2 B;  2J52 A;  1VRA B;  4IWQ A;  4A3O A;  3VVW B;  2G4D B;  2AL6 A;  2WXL A;  2KYW A;  2V1Y A;  1WYW B;  3H7P A;  5CHW A;  2KJR A;  1RM6 C;  3DBL I;  2O6V B;  2PW9 A;  3APF A;  2KDM A;  4FXC A;  5EE1 A;  3RNB C;  3VRA B;  1YQB A;  4IWP A;  3TBL D;  1IGD A;  4N9F 4;  4P16 A;  1FFV A;  2IY0 B;  1WZ3 A;  1D3Z A;  2E3T A;  3EC8 A;  4MEL A;  1FNU A;  1GB4 A;  2IJ0 A;  1I4Q A;  2AWT A;  2BB6 A;  1L6U A;  3KVF B;  2KQ4 X;  3P4Q B;  1WYG A;  1P0R A;  2WXM A;  4RH6 A;  2ZZP B;  1G6J A;  3WAM A;  3SD5 A;  2CJO A;  2PE9 A;  4ZDV A;  3ZKJ C;  3U8Z A;  3EA6 A;  4HLE A;  5DPR A;  1T0S C;  2XEW A;  2V3S A;  1XD3 B;  4LDT D;  5FKA C;  2YLM A;  2G9H D;  3IT6 B;  1E90 A;  1P3Q U;  3QJZ A;  4BBN F;  3PHX B;  3PPA A;  1GNU A;  3DQV A;  4XWW A;  1E5W A;  4LTU A;  4I6P A;  2O6V A;  5L83 A;  3ZQ4 A;  1D4B A;  3WAN A;  1VDV A;  2BBC A;  1QOG A;  4II3 B;  1K50 A;  1SXT A;  1FIQ A;  1TS4 A;  2R61 A;  2IO0 B;  4LNF A;  4G3X B;  4FHJ A;  4IM3 A;  4TMA B;  2M4N A;  1GAQ B;  1WGR A;  4DK5 A;  2GBK A;  3BVG A;  4CO7 A;  3A1Q B;  3RI7 C;  1ZGU B;  1NYR A; 
#chains in the Genus database with same CATH homology
 1HXY D;  5EE0 A;  3HRD D;  1BXT A;  1WRI A;  1N5W A;  1YQ3 B;  3ZJV A;  1TY2 A;  5TSS A;  3VR9 B;  2QEJ C;  3O13 A;  1MHX A;  4XE0 A;  3AB5 A;  4A55 A;  3W2D A;  2MJD A;  2DYO A;  1GPX A;  1OQQ A;  1JWU D;  1KTK A;  2Y5P A;  4KGT A;  1SE4 A;  4YSX B;  1V97 A;  2QIL A;  1EU3 A;  1VZ8 A;  1PGA A;  5I4D A;  2PMV A;  1QLB B;  4XDD A;  2K0P A;  3MP9 A;  3W5U B;  1E7P B;  1I4X A;  2PLP A;  2SAK A;  2VZK D;  1SIJ A;  4WAF A;  3BII D;  5LNK 1;  2W55 A;  3BVZ A;  3Q8A A;  4PT5 A;  2N0S B;  3I9V 1;  1GB1 A;  4L2Y A;  3P63 A;  3VRB B;  3EGR A;  1TY0 A;  2JYE A;  1V8C A;  2MJE A;  4IDI A;  4R3D A;  4RF1 A;  1PGX A;  3AE5 B;  5D3D A;  5T8I A;  3TUO A;  5BYR A;  5D7G A;  2JZP A;  5HI1 A;  1DOX A;  4P6V F;  1FFU A;  4ZHP A;  2WXH A;  1TJE A;  1YN3 A;  3AE9 B;  2YEP F;  4WH4 A;  3CIR B;  1D5Z C;  1F2R C;  2AX5 A;  2LJI A;  1XLN A;  3ZGZ A;  2FUG 1;  3P42 A;  4RF0 A;  3Q8F A;  3U52 E;  3NZ3 A;  1EWC A;  1XLQ A;  1ET6 A;  2Z8L A;  4KGR A;  5EE9 A;  3PO0 A;  2PIA A;  4TQ1 A;  1SB3 C;  4L23 A;  2V3N A;  3GB1 A;  1SE2 A;  3RFZ B;  3AE4 B;  3PZ8 A;  2MJ3 A;  3I57 A;  4YWG G;  1C4C A;  2GB1 A;  1YNT E;  1HZ6 A;  1ZDX A;  3FIL B;  3OWE B;  2BS4 B;  4ZOH C;  3SFE B;  3E9S A;  1BUI C;  1QOB A;  1YJJ A;  4DXF A;  1F0Z A;  3ETR A;  4H2A A;  4OZB A;  3CWI A;  3TSS A;  2I2Y A;  3NVW A;  3Q8C A;  1MVK A;  2GI9 A;  2K9X A;  4ITK A;  4RNA A;  4A9A A;  1NI3 A;  1YN5 A;  2DYM A;  3BZD B;  1I4R A;  2KAJ A;  4HEA 1;  4C7Y A;  4US9 A;  1QQR A;  1FRR A;  3AEE B;  3HVZ A;  4N6E B;  1ZPS A;  4MH8 A;  1CK1 A;  1HEZ E;  1IBX B;  1DYQ A;  1HA5 A;  1I4G A;  4JWU C;  2H88 B;  1GOZ A;  1YMH E;  4OW0 A;  1KFY B;  2W3S A;  4YTN B;  1ACC A;  1QOA A;  1IUE A;  1E10 A;  2JQR B;  1PUT A;  1R7S A;  2K5P A;  2M56 B;  1UUP A;  1AN8 A;  2WXN A;  1QOF A;  3GS2 A;  5BYS A;  3B9J A;  1Y56 A;  1L0Y B;  3AEF B;  1MHH E;  1MPE A;  1KLU D;  4IKG A;  1RWS A;  2BT6 A;  4RGM A;  1T6B X;  1PYW D;  2N9K A;  3HVD A;  4O1N A;  1B1Z A;  2JX5 A;  1OFF A;  1HZ5 A;  3SR6 A;  3U7Z A;  1VZ6 A;  4NAM A;  4C56 C;  3U4E G;  1RFK A;  4B0M A;  1JAL A;  3R2I A;  5BMH A;  1XCT L;  2MEK A;  2K22 A;  3GP7 A;  5AUI A;  2GRI A;  1TYG B;  5BMI A;  1C9F A;  1N5X A;  4RFB A;  1JML A;  1N61 A;  1JCK B;  1E9M A;  1V1O A;  2YEP B;  1E6E B;  1JRP A;  4NZL B;  1K53 A;  4UDU C;  2M0A A;  3VQI A;  3LB8 C;  3W5V B;  5JXV A;  1C4A A;  1IGC A;  3AE3 B;  1YJI A;  3R2T A;  2WP9 B;  4AS1 A;  1VJK A;  3TEZ A;  3AED B;  3AMZ A;  4XDC A;  1ZOY B;  2PKO A;  3HUI A;  2V0G A;  4C80 A;  2LEK A;  4C7Z A;  4YXD B;  1T5X D;  2WS3 B;  1JWM D;  1FXI A;  2ON8 A;  1QT9 A;  1VLB A;  5EE3 A;  3NVY A;  2J53 A;  3TEX A;  3T3O A;  2IGD A;  1NVI D;  2WU5 B;  5BMG A;  3W1S A;  3URY A;  1QF6 A;  1D5M C;  5AUK A;  1I7H A;  3Q69 A;  1C77 A;  3AEB B;  3N9Y C;  4RCO A;  3BK1 A;  4YSZ B;  1LO5 D;  3ZYY X;  2JWU A;  2ZW0 A;  3IT4 B;  1ZE3 D;  1AWD A;  4EE2 A;  1EU4 A;  1FNW A;  4WIP A;  3P4R B;  1SSN A;  2PVG C;  2WXR A;  2W82 A;  1M4V A;  3SEB A;  5BYQ A;  1DOY A;  3ZJU A;  1E0Z A;  1TS2 A;  1KF6 B;  3ABV B;  2CJN A;  4RGN A;  2IPK D;  2J4X A;  3E56 A;  4JX1 C;  2JYT A;  3AE1 B;  4RGO S;  2WXG A;  1PGB A;  2ACZ B;  2XN9 C;  3KQ4 A;  4US8 A;  2DLB A;  1V1P A;  2LUM A;  2Y5C A;  1JRO A;  1XLO A;  3SFD B;  1NYQ A;  2ONQ A;  1DOI A;  1B9R A;  1L0X B;  2LHE A;  3AE6 B;  3WCQ A;  5G5G A;  1FD6 A;  1T3Q A;  4J3O D;  4DQO C;  2QMT A;  1EM7 A;  2X38 A;  4OVZ A;  1KH0 A;  1C76 A;  2LHD A;  2D5G A;  1TKY A;  4GDK B;  1FMA D;  3V3X A;  1JWA D;  2KWD A;  4ZRP A;  5HFY A;  2VZK B;  4Q2J A;  1PFD A;  4LK0 M;  3W9C B;  3Q8B A;  5D3I B;  2RDG A;  1WSP A;  4YTM B;  2BYT A;  1NEK B;  2EEL A;  1L0V B;  3BWU D;  4IOI E;  1XEE A;  5H92 C;  2RPV A;  2V4I B;  2B76 B;  2WXO A;  3BYY B;  1QIL A;  3T3N A;  2PTL A;  2ICI A;  2KN4 A;  2JSV X;  2FE8 A;  2W3R A;  4ARC A;  2HTM E;  5C2T B;  5FR3 A;  3VR8 B;  2WLB A;  5H8Y E;  1KRH A;  1N62 A;  5E6J A;  2EKI A;  5FK9 C;  3MFG A;  1I4H A;  1J7B A;  1FRD A;  2WXK A;  1TS3 A;  4JE3 B;  2BTE A;  3RPF C;  2IGG A;  1L4D B;  3IXS A;  1D6E C;  2NTT A;  1J7A A;  3C8Y A;  2WXP A;  3B2G A;  3DWG C;  3P1M A;  3R8B A;  1D5X C;  2Q5W D;  3KWL A;  1RYJ A;  2QSD A;  1JQ4 A;  4OZA A;  2AQ1 B;  3NVV A;  4M0W A;  3BK2 A;  2XNA C;  2AQ3 B;  3FAH A;  3FIL A;  1XO3 A;  3NS1 A;  4JPS A;  1CJE A;  4NJC A;  3AN1 A;  2BS3 B;  2PVO D;  3UI3 A;  2OED A;  2SEB D;  3BVM A;  1I4P A;  2K3U A;  5C3J B;  1FXA A;  1FNV A;  4N58 A;  3AM9 A;  5HG2 A;  2WNM A;  3J9C A;  1P7E A;  1ROE A;  2WXF A;  2DWQ A;  4JWS C;  1UGJ A;  3H8H A;  2WXI A;  3AE7 B;  1ZUD 2;  4LLG M;  1XCQ L;  2I38 A;  2NTS A;  1BML C;  3TEW A;  1YQ4 B;  1IBX A;  1WWT A;  1K52 A;  1CQV A;  2RMM A;  1QKZ A;  1ENF A;  1YN4 A;  3TEY A;  2BS2 B;  3KLS X;  4GLS C;  1F2R I;  1UWM A;  3BYT B;  4MT5 A;  3P4S B;  1WGK A;  3EUB 2;  4YT0 B;  3DWM A;  1N63 A;  1ESF A;  1Q10 A;  4KX6 B;  4DXG A;  2E6X A;  3MJ5 A;  1XF5 L;  4A6Q A;  1UWX A;  5HHD G;  1FCL A;  2N7J A;  4YSY B;  1AW7 A;  4AQ7 A;  4CQN A;  1KLG D;  2TSS A;  2CU3 A;  4WWM A;  2L1A A;  4HKZ E;  2V3P A;  4B0E A;  1C4P A;  1JWB D;  2OHF A;  1OQR A;  2BB5 A;  2MH7 A;  3AEA B;  3AEG B;  2KAC A;  1JWS D;  4D2K A;  1DGJ A;  1N60 A;  4GDL B;  2WXQ A;  1K51 A;  4N59 A;  2AQ2 B;  2J52 A;  2M19 A;  1VRA B;  1PDX A;  1C78 A;  1F77 A;  4HRO A;  2WDQ B;  1SJE D;  2WXL A;  4WQM A;  2IGH A;  2QIE B;  1J7C A;  2IDY A;  5GXG B;  1ZP0 B;  3MHZ A;  3NUH B;  4MAC A;  1FCC C;  4ZHO A;  1RM6 C;  3AV8 A;  1XLP A;  3B2F A;  1TKG A;  2PW9 A;  4RGT A;  2KDM A;  2W54 A;  4FXC A;  5EE1 A;  2WU2 B;  3IAM 1;  2BW2 A;  3VRA B;  1UNS A;  3L4P A;  1WXQ A;  3IAS 1;  1IGD A;  1FM0 D;  4P16 A;  1FFV A;  1JW9 D;  3AH7 A;  1L4Z B;  4REZ A;  2WDV B;  3LYY A;  2E3T A;  2L32 A;  4ZRQ A;  4TQ0 A;  3U2S C;  2LMC A;  2G1E A;  1SE3 A;  1STE A;  2KMM A;  1FNU A;  1TKE A;  1GB4 A;  2IJ0 A;  1I4Q A;  2BB6 A;  1L6U A;  4WUR A;  5G5H A;  3NVZ A;  2KQ4 X;  3P4Q B;  1WYG A;  3AE2 B;  1C79 A;  1SEB D;  3AE8 B;  2WXM A;  2WXJ A;  1L6V A;  1ZXH A;  4MM3 B;  4RH6 A;  2LFI A;  2JU6 X;  1CZP A;  3ZJT A;  1VZ7 A;  2HDE A;  3P4P B;  1SF0 A;  1MI0 A;  2FBW B;  2L83 A;  2CJO A;  1TZO A;  4A8X C;  2QJL A;  3EA6 A;  4YTP B;  1SJH D;  5MPO A;  2Y3A A;  3MC0 B;  2WDR B;  1XXG A;  1HQR D;  3KWV A;  5FKA C;  2JXT A;  2INP E;  3AEC B;  2G9H D;  3IT6 B;  2L52 A;  1ET9 A;  2RDH A;  3FC4 A;  1VR9 A;  1SBB B;  2N9L A;  3LXF A;  2LGI A;  1TS5 A;  4XWW A;  4LTU A;  2ZW1 A;  2INN E;  3ZQ4 A;  4HKQ A;  1D4B A;  4USA A;  1L5P A;  2H89 B;  1VDV A;  1NEN B;  2BBC A;  2J42 A;  4KGS A;  1ZXI A;  1QOG A;  4HJG E;  4HRS A;  1K50 A;  4XWT A;  1P7F A;  1SXT A;  1FIQ A;  1TS4 A;  1FO4 A;  3Q8E A;  2R61 A;  4A90 A;  1A70 A;  4NAW B;  2WQY B;  4OHJ A;  3V05 A;  2NMQ A;  4TMA B;  4TSS A;  2DBY A;  1GAQ B;  4KKJ A;  1V1P B;  4L1B A;  3PZ7 A;  3BVG A;  4ZYS A;  1FEH A;  1AYF A;  4OZC A;  1ZDV A;  1NYR A;  4KKI A;  3NRZ A;  1EWY C;  4ARI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...