1UWXA

P1.2 serosubtype antigen derived from n. meningitidis pora in complex with fab fragment
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
VTTYKLVINGKTLKGETTTKAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G-PRIME
publication title Structural Variation and Immune Recognition of the P1.2 Subtype Meningococcal Antigen.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Immune system
total genus 15
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1uwxA00
2I38A 1Q10A 4MACA 1IBXA 4KGRA 1MPEA 1P7EA 2JSVX 2LHDA 1F2RC 5HHDG 2JXTA 1PGBA 1UWXA 5HFYA 2N7JA 2PLPA 2IGDA 2PW9A 2IGHA 3V3XA 1K50A 1YMHE 1JMLA 5BMIA 4OZCA 2KWDA 2J52A 1XCTL 1GB1A 1ZXHA 1XF5L 1HZ5A 2K0PA 3FILB 2ON8A 3UI3A 1GB4A 2KN4A 2GB1A 1EM7A 1HZ6A 2LGIA 1MI0A 1IGDA 2J53A 4KGSA 2EELA 2GI9A 1FCCC 5BMGA 3MP9A 2ZW0A 2N9KA 2LHEA 4WH4A 1KH0A 4IKGA 1K52A 1PGXA 2PTLA 4GLSC 2KQ4X 4HKZE 5HI1A 1YNTE 2QMTA 2KDMA 1MHXA 3GB1A 2ZW1A 1MHHE 3FILA 5JXVA 2I2YA 1D4BA 1C9FA 2IGGA 2N9LA 1IBXB 1MVKA 1P7FA 5HG2A 2ONQA 1IGCA 2JWUA 4KGTA 4IOIE 1PGAA 4D2KA 2OEDA 2NMQA 1FD6A 1F2RI 1HEZE 1K53A 2QSDA 2JZPA 2KACA 1XCQL 2RPVA 4OZAA 4HJGE 1K51A 5BMHA 2LUMA 2JU6X 4OZBA 2RMMA 1QKZA 1FCLA
chains in the Genus database with same CATH superfamily
1T3QA 3DOWA 1UGMA 3WAMA 2Z59B 4J6IA 1PYWD 1NYQA 1CK1A 2I1JA 2RPQA 2L00B 3PTFC 2XK5A 4MJSA 3RNBC 2KTRB 1RM6C 2L05A 5FR3A 2BYEA 3H9DA 4W9DA 3ZLZA 4WJOA 2JF5A 2QHOA 4LJPB 4GDLA 2BWES 1JMLA 4GDKB 3EUB2 3GE8C 4MGZE 3PT2B 2EKIA 4CHKA 1V9JA 3KWVA 4QAYA 2KQ7A 1XF5L 1D6EC 5G2NA 3MC9A 2FNJB 2Z0DB 2BYVE 2GB1A 4IM0A 4ICVA 3LYYA 4A90A 1TBEA 1IP9A 2KVRA 4WJNA 2NCNA 5DCNA 1TYGB 2D10A 2LGYA 2V9HA 4WH4A 5KHQA 1K52A 4G11A 2V1YA 1IPGA 1K8RB 1I4QA 4A8XC 3JW0X 2BGFA 2KC2A 2V3PA 4GGQA 1WXSA 4FJZA 1MHHE 2CHWA 4ZRPA 4RFBA 4XC2A 2I2YA 1FNVA 1WH3A 3KVFB 5E6OA 4W9KA 3NHEB 3HM3A 2LZ6A 1E9MA 1V86A 2AWTA 2BT6A 3DCGA 1V81A 4GMVA 4ARIA 2MJ3A 4F7ZA 3QC8B 2QSDA 2KACA 4I6PA 1L2NA 2FCNA 3W1SA 4WIPA 4HLEA 3W2DA 2AYOB 5LNK1 2LUMA 4OW0A 2WDQB 1NEKB 2H89B 2HDEA 5AUIA 1D5ZC 3AE3B 1YJIA 2DZMA 4DXFA 4XGAB 5IN7A 4A3OA 3M95A 3AB5A 2BKRB 1VRAB 1VR9A 4KSLC 3H7SA 4KKIA 2ZZPB 3OG5A 2NS5A 2RDHA 3AH7A 1AYFA 1WGKA 2WXGA 4OZCA 1SJHD 4MELA 4LLGM 1XCTL 1ZXHA 3AXCA 4BVUC 2X38A 1E6EB 1HTQA 2TSSA 4L1BA 1E7PB 3EGRA 3PHXB 3QARA 3UQBA 3U8ZA 2NTTA 2N9XA 1VLBA 3UIOB 1ZDXA 4N9F4 2AQ3B 2OJWA 4NJ7A 2IBIB 1FXAA 4XE0A 1L0VB 3U30A 1I4PA 2M19A 3BVZA 3VHTC 2LMCA 3QWZB 3IG3A 2PTLA 1QF6A 4MJSB 2ACZB 4CQNA 4LNFA 1T0QC 4HKZE 4LNOA 3ZNID 3V62A 2MLBA 4GDLB 4WQMA 2KDFB 3GZNI 5C23A 1UD7A 1WYGA 5JXVA 2PJHA 2WQYB 2GBMA 2IGGA 2MWSB 3H7PA 3NRZA 1MVKA 3BZDB 4JLCA 1P1AA 1DOIA 3DBLB 2WU2B 3NZUA 4FHKA 5T8IA 2L83A 3V60A 3KH0A 2RSUA 3I5JC 4ANUA 3A9JA 4TUUA 1C79A 3RNAC 2L76A 1SXTA 4C00A 4WAFA 2CR5A 1LGRA 3ZKJC 3VAWA 2LASA 2PIAA 1C76A 2XBBC 4FJYA 1VCBA 1JALA 3ENEA 2D3BA 2KWCA 3UIPB 4NQLB 1IBXA 1GUAB 3JVZX 1JWMD 3NJTA 4JIOU 1SSNA 4YTNB 2KC1A 4AOFA 3CIRB 3Q3NC 1TGZB 2ZNVB 3EHVA 4S17A 1OEYA 4EEWA 2CJOA 4KVGB 1GB1A 2G3QB 2K22A 3SR6A 1TT5B 4ZYNA 4GU2A 1WGGA 4IM3A 1EWYC 4N6EB 1OGWA 2LJ5A 1ZP0B 1KLGD 4MGIE 4M8NA 2Y5PA 1VJKA 3Q3OC 2MEKA 2QCZA 2EELA 2GI9A 2VZKB 3R8BA 3PZ7A 1FNWA 1WI0A 1UF0A 5J2RA 4A3PA 1WXAA 1WXMA 2NVUI 3Q8CA 1BXTA 2C7NB 2MH7A 5BYSA 4DQOC 3QAQA 2AEHA 4E3CA 2J0JA 3SFDB 3VUYA 1TJEA 2HD5B 1C9FA 4LNKA 2MHJA 3J9CA 4MH0E 4PS7A 4REZA 1TS4A 4EOYA 2MRPA 3RD2A 3A4SC 1HA5A 2D3GA 3MFGA 1Z2MA 2ZPNA 2JRHA 1UUPA 1S3SG 3IT4B 2JU6X 2UYZB 1P9DU 1SJED 1WXVA 3DHHC 3H1UA 3X23A 5CTRC 2N4FA 1L5PA 1P7EA 2NBWB 3LJ3A 2G4SA 1OFFA 1Z5SB 5D3DA 2I1KA 1V1PA 1SE9A 4PYUA 1MJDA 2LRWA 3WANA 2EKEC 1LO5D 3RYTA 1FMAD 5H92C 4DHZE 5EE9A 4TSSA 3PVLA 2K0PA 2JWZA 4FHJA 1XLOA 2IO3B 4JGHB 2AQ1B 3X0WA 3AE8B 3OJ4B 4NAWA 2OJRA 1YIWA 2MBQA 2LXAA 2W54A 3KUDB 2E3TA 2ZW0A 4WWPA 4HKQA 1RWSA 1F1HA 2KJRA 1JQ4A 2OHFA 1JW9D 2KFKA 4ITKA 2KTFA 2LGXA 4R3DA 4GLSC 3DBHB 1KRHA 3P4RB 2KDEB 4DHJB 2ICIA 3B9JA 3ETRA 5KHOA 3R7QA 4II3B 2DYOA 3FC4A 3PGEA 4GSWA 2BQQA 2MQJA 1VZ7A 5EE0A 1QILA 3W9CB 4NY0A 1XO3A 1V1OA 3O13A 4FBJB 3BVMA 2K5PA 2PEAA 2FCSA 1OQRA 1ISNA 4EE2A 3AEFB 1LM8B 3EFUA 4ANVA 1HEZE 5I4DA 1XT9B 5EE3A 1YX5B 2KT7A 3ZXVA 1A70A 1XCQL 2A4ZA 3RT3B 4OZBA 2C9WB 3PSEB 3P1MA 1JROA 1ZOYB 3AE9B 3AE2B 2AL6A 2LI5A 4GN1A 3DPDA 3OAWA 3QA8A 2ZVOA 4L23A 1A5RA 1EWCA 2DAFA 4YT0B 1FFUA 1BT0A 3KW5B 1WGRA 1C3TA 1MFWA 4BZAA 2WLBA 3AEBB 2J7QB 3RNCC 1CQVA 1TY0A 3DWMA 1G6JA 3VQIA 1L0YB 1F9JA 5JHAA 4OVVA 3WIMA 4LDTB 4LNIA 3A33B 1NI3A 2LGIA 3M63B 1FFVA 2LVOA 5JZEB 2JT4B 1KOTA 1KM7A 3V05A 3HVZA 1NDDA 3SD5A 1PGXA 1V1PB 1RFAA 2KD0A 1C4CA 1WJNA 2DENB 4IWPA 2V4LA 1HTOA 2WXLA 4WWMA 4HJKA 5D3IB 5AUKA 1WJ4A 1YQ3B 1V8CA 2HTHA 3R3MA 3RN9C 4WQOB 3EECA 2G1EA 1ZDVA 1I42A 3EC8A 3AV8A 2FAZA 2PMVA 1NVID 2DZJA 1AW7A 1HE8A 1WMHA 2WXPA 4AS1A 2JVCA 3IAM1 2KFKB 2ZNVC 1P0RA 3TCAA 5BMHA 1WX7A 1QZEA 1JWBD 4JQWC 3D32A 1PUTA 2L0TA 3AECB 2JSVX 2WXKA 1ET6A 2Z8LA 2BS2B 4P1CC 3Q14C 4XYCA 2IY1B 4MGYE 2JXTA 5AEKB 3B1LX 3HRDD 3VFKA 2BPSA 3ZNZB 3Q8FA 2VH2A 2BB5A 1I35A 4KSKC 4DBGA 1UGJA 4ACFA 2IPKD 2KOXA 2RDGA 1RRBA 2FBWB 1E7VA 4B9KA 3TJPA 2UWQA 1OTRB 2BB6A 3FILB 4AWJA 3UI3A 3NVVA 4S0RA 2KN4A 4K7UA 1YOVB 2RDBC 3VXWA 5CHFA 1U4AA 3WA0A 1SB3C 3K9PB 2GBRA 4EZKA 3NVZA 1QOAA 3A4RA 4W9EA 1I7HA 1WX8A 2O6VD 3DBLI 5H8YE 3B2GA 2B3AA 1GPXA 3BWUD 1WWTA 1OQYA 2DWQA 1YN3A 1TKYA 2WXMA 5DPTA 4YWGG 3AU5A 2DYBA 4RF0A 3MJ5A 1ESFA 4H2AA 2M56B 1N60A 1T0YA 4M0WA 2N9LA 4BKTA 1PQSA 1ZGUB 2WXHA 3PLVA 4M01A 1EO6A 1L4DB 2M8SA 3T3OA 2LJIA 1Y8RC 2J4XA 3AEDB 1ACCA 1WE7A 2UU7A 4RF1A 2YEPF 4G3XB 4M02A 3QX1A 4ZRKA 4W9HA 4NAMA 1UELA 1QKZA 3E56A 2IO2B 2BS4B 1D5XC 5HHDG 4HRSA 3U2SC 5L95C 2ZCBA 5FR6A 1WZ0A 3KYDD 4AUQC 4BBNC 3ZGZA 2N1VA 1EU4A 2CU1A 3VR9B 4CYEA 3AE1B 4A55A 2JUOA 3DDCB 3V3XA 3QJZA 1V2YA 2KWDA 1UNSA 2EMTA 2MBOA 1Y56A 2BTEA 1WMHB 5D2MB 2IYDB 5MPOA 3N1YC 3AEGB 2ZCCA 3LXFA 4BAXA 1V5TA 2WHIA 2DLBA 1KJTA 3PPAA 2NBUA 1TKGA 1OQQA 1JCKB 2MSED 3HVDA 5BMGA 1WYWB 2WDTB 1QOBA 4IDIA 2PPHA 3AMZA 4KDIC 3VDZA 3PRMB 4Q2JA 2LVQA 4HPMB 2R2OA 1N61A 3AEAB 4FA6A 5J17A 1SIJA 3OWEB 2LVPA 1FNUA 2KK8A 2WXOA 4YTMB 1GJZA 4HVBA 5CX3A 3WALA 3V61A 1H4RA 2R2QA 1QQRA 2ONQA 3P63A 3ABVB 1RAXA 3A1QA 3ZDMC 2XK5B 4USAA 2ASQA 1TZ1A 4LCDE 3MJWA 3DBRB 2WXQA 3ZTCA 5TSSA 2RPVA 2MBEA 1SEBD 1V80A 2HJ8A 4RM9A 3ZUNA 1Q5WB 2DBYA 1NYRA 2W9NA 5LLIA 1TZOA 1FCLA 4IW0A 1FXTB 3UF8A 2NR2A 3L17A 4II2B 2D11A 2Y3AA 4AJWA 1ET9A 2QEJC 5FK9C 1IYFA 2N7JA 1Q0WB 2Y5CA 2PLPA 3TEXA 1VDVA 2YLMA 2NBVB 2IGHA 2RGFA 4OVUA 1J7BA 3L54A 3VUWA 5E6PA 4ZHOA 2WYQA 4NPNA 4ZOHC 3W5VB 1YJJA 4W9CA 2R61A 3DBHI 3NOBA 1FEHA 3R2IA 3VRBB 2FCQA 3VTUA 1HXYD 4K1RB 4TV3A 2WX1A 3N32A 3VUXA 2N7EA 3QQ8B 3VTVA 4J3OD 3URYA 2LEKA 2KWUB 4US9A 5FKAC 4MT5A 1LXDA 3N3KB 2J0MA 2WP9B 2L7RA 1YJ1A 3L16A 2LGDA 4P1BC 4IWQA 3EA6A 2CHXA 1E0ZA 3PLUA 2WXRA 3P4QB 4HDQA 2K25A 3KWLA 4MM3A 2KWVB 4IG7B 2KANA 2KAJA 4NQKE 4KKJA 4JWSC 2JWUA 3OLMD 4IOIE 2VRRB 1MG8A 3IAS1 2H88B 1V97A 3ZJVA 1K53A 1L6UA 3U4EG 2QJLA 2FIDA 1YD8U 3AE7B 3MC8A 4N59A 5J18A 2ZEQA 4L2YA 4O1NA 5G5HA 1N63A 2K3UA 4KX6B 3I3TB 3Q8AA 1R4MB 2ZJDA 2DNFA 4XDDA 2BVCA 1C78A 1E7UA 4W9LA 4EFOA 4W9FA 2KDIA 3KLSX 3RZFA 2L32A 1V5OA 3KYCD 1YN4A 3HHMA 4RM8A 2LGSA 1GC7A 3APDA 1VD2A 4RGMA 1ZUD2 3A1QB 2OOBB 3P4PB 4K7WA 1C77A 3Q2AC 4HROA 4A20A 1RLFA 5IKCM 2YEPB 3VTWA 4RGNA 2K8HA 1WX9A 5IO9A 4UDUC 2L3ZA 2ON8A 4PS8A 1GOZA 4WWOA 1SE3A 3VVWB 4URKA 3H8HA 1UWMA 3H7PB 4K3CA 3N30A 3L4PA 2FUHB 2J53A 4W9GA 1FCCC 3NUHB 3SHQA 1WSPA 2JZZA 3ZTDA 3R66C 4HEA1 1E8ZA 3A9JB 2GBKA 1C4AA 1YNTE 3HM6X 2JQRB 3JSVA 2ZW1A 2GRIA 3IVFA 4BKSD 3K9OB 3TSSA 3UINB 2N1WA 1IBXB 2KKCA 1QOFA 4KZ0A 1XLPA 2DHZA 1KTKA 3ML8A 2REXA 3VH4B 3RPFC 2KX0A 4RGOS 3SU8X 2INNE 2FUG1 2IY0B 2M17A 3EFCA 4AP4C 1M94A 1AARA 1VZ6A 2C7HA 2B76B 1TIFA 3WCQA 1R7SA 2WXNA 2MJEA 1P98A 3TMPB 4NJCA 2MJDA 2D07B 2GBNA 2YVCA 3B08A 1J7AA 5AZHA 3U7DA 4MM3B 3TL5A 3TEWA 1RYJA 3MC0B 3IBEA 4ARCA 1ZKHA 3DWGC 2KVZA 3APCA 4FLHA 1NBFC 1TS2A 3BIID 3DQVA 4HCPB 3PRPB 1E10A 3ZNHB 5BYQA 2SEBD 5LXHA 3CF6E 2NPTA 3RUIB 1UH6A 2DYMA 2K9XA 2O6VA 3CSTA 3B0AA 2V3SA 1BMLC 1UBIA 1EF1A 1MI0A 2KTRA 4LK0M 3ZW3A 2WNMA 3MP9A 3N20C 4GB9A 4IC7B 4EZLA 1YQ4B 3Q69A 2AL3A 4GDKA 4F1SA 1WZ3A 2JRIB 5HI1A 2PKOA 1JRUA 4GXBA 1KFYB 4ZDVA 1MHXA 3GB1A 3TIXA 3BK2A 4NJ6A 1WJUA 2MX2A 3WAOA 3Q3JA 5C2TB 4KDLB 3R7RA 3HK0A 4W9JA 2MBHA 4K3BA 2WXJA 3KQ4A 2FE8A 2BBCA 3Q8EA 1PGAA 3VR8B 2OEDA 1YN5A 3SEBA 1SGHA 1EF5A 1K51A 4DHZB 3APFA 2WX0A 1FRRA 5TR5A 4JE3B 4DXGA 1L4ZB 3ZJTA 4C7ZA 4WJQA 2N9PC 3H6NA 4HWIB 1FXIA 1YX6B 2KJ6A 2M1MA 1WJ6A 1I4HA 2KMAA 1YQBA 2LHDA 3SFEB 1D5MC 4DDID 2AX5A 4NAWB 1WF9A 2IZVB 2DAJA 1UWXA 3P42A 1F77A 1XLNA 3RFZB 2LD9A 3N9YC 2K39A 3BYTB 3Q3MC 3C8YA 4MSMB 3BVGA 2HE7A 2J52A 5D6JB 2GBJA 1VZ8A 2JY6A 3W1SC 3T3NA 3I57A 2D3CA 2C7MB 2IJ0A 1EM7A 1HZ6A 2KJHB 4KGSA 1JWAD 1EU3A 2KFJA 2AQ2B 2J42A 3DHIC 5CHWA 5EE1A 2K1FA 2LHEA 2JYEA 1KH0A 4FULA 5DPWA 1WGYA 1N5WA 2QIEB 3DBRI 2XEWA 4E71A 1GC6A 2W3RA 2NPTB 3ZVVA 4CO7A 4DWFA 4MEMA 3NS1A 3PRZA 5L83A 2O6VB 3LDZE 5C3JB 2Q5WD 4DK5A 2V3NA 1SF0A 4KGTA 3NZ3A 1IUEA 1F2RI 1M4VA 4WJPA 2JPHA 2QILA 2G9HD 3VRAB 4P16A 4HJGE 2PE6B 3PS6A 3RI7C 2XNAC 3DVNV 1JWSD 2WDRB 2NTSA 4IUMB 1E5WA 4ZRIA 1Q10A 3A9KA 3NZSA 4F8CB 1MPEA 3RNGC 3DVNU 4A9AA 2CU3A 3IFWB 2WDVB 4C56C 2VH1A 5AZGA 3ZYYX 1KF6B 2IO0B 2KQSA 3ZXRA 2MBBB 4FJVB 3I9V1 4TQ1A 2LUEA 2Z0EB 1TY2A 1P3QU 2WGSA 3ZO5B 4AJYB 1KLUD 1DOXA 1XQQA 1SBBB 2QDFA 3IXSA 2D5GA 1L7YA 1T5XD 2V4IB 4LNNA 3S2AA 4B6WA 4HDOA 5LXIB 1WM3A 2GLSA 4BOSC 1JWUD 3U52E 1TS5A 2MCNB 4HK2A 1R4NB 5C1ZA 3AE5B 2KNBA 3AULA 3ALBA 3L08A 4I6NB 2GOWA 3AU4A 4YXDB 3NY5A 1V6EA 1I4GA 1L6VA 4B0EA 1D4BA 1SIFA 2BWFA 4MH8A 4RCOA 4RMAA 2M4NA 1R4MI 4ZHPA 1C1YB 4DDGD 2INCC 2M0XA 4BBNF 4IWOA 2BYTA 1WY8A 2MA9B 1L0XB 1H8CA 1X1MA 3RMKC 3L13A 4PK1A 4JWUC 3FKYA 3NS8A 3I63C 1WM2A 4JX1C 4OVZA 3UQAA 3NVWA 4K81A 5BO4B 3PZ8A 1PGBA 3CMMB 4ICUA 4HXDA 1T0RC 4C80A 1FM0D 3AE4B 1I4RA 2IGDA 2L0FA 2L8JA 2WXIA 1K50A 2HJ1A 3ZQ4A 4I6LB 2CJNA 3M3JA 4DXAB 2KDBA 3LB8C 3SDLC 1J0GA 2K8BA 2MP2A 3ZJUA 1NENB 2BF8B 3P2BA 1GB4A 4M0WB 4X57B 1IGDA 3A9KB 3AEEB 3P4SB 4BKSA 4HPPA 1D3ZA 3R2TA 5D7GA 1XEEA 4PS3A 3RZWC 2XN9C 1FPYA 1BUIC 4RH6A 1XXGA 1T6BX 2G45B 3UGBB 5JH5C 2PE9A 3C19A 2PVGC 4MSQB 4ZYSA 2C5LC 3RNEC 1PFDA 3T8MA 1WIAA 4XX5A 3WAPA 3NVYA 1WGHA 4IM2A 2W55A 5IAAC 4YSXB 3TEZA 3BK1A 4A6QA 3RNFC 3JYUA 2Y5BB 4YSYB 1N6ZA 3KUCB 1V49A 3AM9A 4XWTA 3HIZA 1C4PA 3AE6B 1B9RA 2EMSA 1ZE3D 1CJEA 4ZRQA 2RMMA 3ZNGC 2JYTA 1WFYA 5G5GA 1DOYA 5DPRA 2O2VA 1B1ZA 2INPE 2BKFA 1ZPSA 3O65B 4TMAB 3BINA 3DVGX 1QLBB 1SE4A 2W82A 2KX3A 3L10B 1YMHE 4ANXA 3GE3C 1CMXB 5GXGB 3N1XC 5BMIA 2QC8A 2VZKD 3TBLD 1AWDA 5AZFA 3W1YA 5EDSA 1N5XA 2D2QA 3CWIA 2CHZA 5E6NA 3GOEA 3NG0A 4XWWA 4PYZA 2JZ3B 4LJOB 4HCNB 2BYFA 2DZKA 2GMIC 1DGJA 3PV1A 2JXXA 2K6QA 4N58A 3TUOA 4IKGA 1WR1A 2G4DB 2KLGA 2JX5A 3Q8BA 2KDMA 1WRDB 4XZ4A 3VH3B 1FO4A 2LFIA 3GS2A 1E8YA 1CZPA 3DHGC 5IA7A 2MP2B 1I4XA 4EUTA 4OHJA 3E9SA 1J7CA 1QOGA 3MHSD 3PREA 3T9LA 1F0ZA 2LXCA 4NZLB 5IP4D 3RULA 1STEA 4G0NB 1TTNA 3MHZA 5E6JA 1WE6A 3GZNB 4LTUA 4OZAA 4G50A 2CKHB 3QK0A 1WGDA 1F52A 2WU5B 1WR6E 1RFKA 4E74A 1EUVB 2L52A 2DX5B 3RCZA 3QCAA 2I38A 4MACA 4MDKE 3Q3FA 1J19A 4KGRA 4JPSA 3V6CB 1UBQA 1NI2A 3TEYA 4P6VF 4M00A 4AQ7A 1KLVA 2N9EB 5IOIA 2LRUA 2KYWA 2CS4A 4ZRJA 4C4VA 5G55A 2K6DB 3AI5A 4XDCA 3BYYB 4B0MA 2KMMA 4JL9A 4EKUA 4TKNA 1JRPA 4RNAA 5D94A 2L1AA 2LWPA 2KN5A 2KMCA 2E6XA 4HPLB 4DHJD 2D3AA 4KZCA 1OEYJ 4BKGA 1ENFA 3FAHA 2N9KA 2O2VB 4KIKA 1GAQB 4ANWA 1FRDA 3IHPC 4FN2A 1ZW7A 1S1QB 4B95A 1SE2A 5HKHA 2KQ4X 2RR9A 1N62A 2N7DA 1WXQA 3OJ3A 1QT9A 3B2FA 2QMTA 4US8A 2SAKA 3FILA 1MG4A 3ZDTA 4BFRA 2DZIA 5DPSA 2FIFA 5GMVA 1E8WA 1P7FA 5HG2A 2WWZA 1TS3A 4YSZB 3CSFA 2KXJA 3HUIA 3N1ZC 5CHVC 3ZRFA 2KLCA 2JZPA 3AN1A 3BY4B 4FADA 2J0KA 1TKEA 3ONSA 3U7ZA 1XD3B 1E90A 3C0RB 1DYQA 1F2RC 1ROEA 2HTME 1Q1OA 2K8CA 3DVGY 2FCMA 4PT5A 4W9IA 5HFYA 1GNUA 1LFDA 5JHBA 4GOCA 2W3SA 3PZDA 3GP7A 2PW9A 4LDTD 2RD0A 4WURA 1AN8A 2ZVNA 2MW5A 1FIQA 4FXCA 1LQBA 2C60A 1R4NI 2PVOD 1T0SC 3ZRCA 4M8MA 1GG3A 1HZ5A 3JSVB 4YTPB 5BYRA 2KZRA 3PO0A 3ECIA 2ZPYA 1J8CA 4NNJB 1PDXA 3W5UB 2N0SB 3QHTA 2V0GA 2KO3A 1HQRD 3MTNB 4RGTA 4WWNA 3DBSA 4GIVA 4C4VB 4WAAA 4YL8A 2KHWB 4P7IA 3V6EB 4BOZB 2A5UA 2M0AA 2BS3B 1E8XA 4EZJA 1XLQA 1IGCA 1WRIA 2BW2A 3PHWB 3ML9A 2X8XX 2WXFA 2INDC 4D2KA 2NMQA 1FD6A 4MGKE 4ASWC 2WS3B 3L0WB 3IT6B 3KUZA 3Q6BA 3M62B 3ZIMA 2IO1B 4C7YA 4KIKB 4KV2A 4K7SA 2IDYA 4TQ0A 1UZXB 1ZXIA 3QIJA
chains in the Genus database with same CATH topology
1T3QA 1JROA 3Q8AA 1ZOYB 3AE9B 3AE2B 1PYWD 1NYQA 3NVWA 4XDDA 1CK1A 1C78A 3KLSX 2L32A 3PZ8A 1PGBA 4L23A 1YN4A 1RM6C 4C80A 5FR3A 1FM0D 3AE4B 1EWCA 1I4RA 2IGDA 4YT0B 1FFUA 4RGMA 1ZUD2 2WXIA 3P4PB 2WLBA 1K50A 3AEBB 1JMLA 1C77A 4GDKB 3EUB2 4HROA 3ZQ4A 2CJNA 1CQVA 2YEPB 1TY0A 3DWMA 4RGNA 3LB8C 2EKIA 3KWVA 1XF5L 4JX1C 3VQIA 1D6EC 1L0YB 3ZJUA 4UDUC 1NENB 2ON8A 1GOZA 1SE3A 1GB4A 3H8HA 1UWMA 2GB1A 1NI3A 2LGIA 3LYYA 3L4PA 1FFVA 4A90A 1IGDA 2J53A 1FCCC 3AEEB 3NUHB 3P4SB 1TYGB 1WSPA 3V05A 3HVZA 3R2TA 4HEA1 5D7GA 4WH4A 1XEEA 1K52A 1PGXA 1V1PB 1C4AA 1I4QA 2XN9C 1C4CA 4A8XC 1YNTE 1BUIC 2JQRB 1XXGA 1T6BX 2V3PA 4RH6A 2WXLA 2PVGC 2ZW1A 1MHHE 4WWMA 4ZYSA 4ZRPA 2GRIA 4RFBA 2I2YA 1PFDA 5D3IB 3TSSA 5AUKA 1FNVA 1IBXB 1YQ3B 1V8CA 3NVYA 1QOFA 1XLPA 1KTKA 2G1EA 2W55A 1ZDVA 4YSXB 3TEZA 3BK1A 4A6QA 1E9MA 2BT6A 3RPFC 4RGOS 2INNE 3AV8A 2PMVA 2FUG1 1NVID 4ARIA 4YSYB 2MJ3A 1AW7A 2WXPA 3AM9A 4XWTA 4AS1A 2QSDA 1VZ6A 2KACA 1C4PA 2B76B 3W1SA 3AE6B 3IAM1 4WIPA 3WCQA 3W2DA 1B9RA 1R7SA 1ZE3D 5BMHA 1CJEA 4ZRQA 2LUMA 5LNK1 4OW0A 2WXNA 2RMMA 2WDQB 2MJEA 1JWBD 1NEKB 2H89B 2HDEA 5AUIA 2JYTA 1D5ZC 3AE3B 1YJIA 4NJCA 2MJDA 1PUTA 3AECB 1J7AA 5G5GA 4DXFA 1DOYA 2JSVX 2WXKA 1ET6A 1B1ZA 2INPE 2Z8LA 2BS2B 1RYJA 4MM3B 3TEWA 3MC0B 2JXTA 1ZPSA 4ARCA 3AB5A 3DWGC 1VRAB 4TMAB 1VR9A 3HRDD 1TS2A 3BIID 4KKIA 1QLBB 3Q8FA 1SE4A 1E10A 2W82A 1YMHE 2RDHA 2BB5A 2SEBD 5BYQA 3AH7A 1AYFA 1WGKA 2WXGA 5GXGB 4OZCA 5BMIA 1UGJA 1SJHD 2VZKD 4LLGM 1AWDA 1XCTL 2IPKD 1N5XA 1ZXHA 2RDGA 2DYMA 3CWIA 2FBWB 1E6EB 2K9XA 2X38A 2TSSA 4L1BA 1E7PB 3EGRA 2NTTA 1VLBA 2BB6A 1ZDXA 3FILB 2AQ3B 3UI3A 3NVVA 1BMLC 2KN4A 4XWWA 1FXAA 1MI0A 4XE0A 1DGJA 1L0VB 1SB3C 4LK0M 2WNMA 3MP9A 1I4PA 2M19A 3BVZA 1QOAA 3NVZA 4N58A 2LMCA 1I7HA 3TUOA 4IKGA 1YQ4B 2PTLA 3Q69A 1QF6A 2ACZB 4CQNA 5H8YE 3B2GA 2JX5A 3Q8BA 4HKZE 3BWUD 5HI1A 1WWTA 1GPXA 2PKOA 2DWQA 1YN3A 1TKYA 2WXMA 1KFYB 4GDLB 4YWGG 4WQMA 2KDMA 4RF0A 3MJ5A 1MHXA 3GB1A 1ESFA 4H2AA 2M56B 1WYGA 3BK2A 5JXVA 1FO4A 2LFIA 1N60A 3GS2A 2WQYB 5C2TB 2IGGA 2N9LA 3NRZA 4M0WA 1CZPA 1MVKA 3BZDB 2WXHA 2WXJA 1I4XA 3KQ4A 1DOIA 2FE8A 4OHJA 3E9SA 1J7CA 1QOGA 2BBCA 2WU2B 5T8IA 3Q8EA 2L83A 1PGAA 3VR8B 1F0ZA 2OEDA 4NZLB 1L4DB 1YN5A 1STEA 3SEBA 3T3OA 1C79A 2LJIA 3MHZA 5E6JA 1SXTA 4WAFA 4LTUA 2J4XA 4OZAA 3AEDB 1ACCA 1K51A 4RF1A 2YEPF 1FRRA 2WU5B 4JE3B 4DXGA 1L4ZB 2PIAA 1C76A 1RFKA 3ZJTA 4NAMA 1QKZA 2L52A 3E56A 4C7ZA 1JALA 2I38A 1FXIA 4MACA 1IBXA 4KGRA 4JPSA 1I4HA 2BS4B 1D5XC 1JWMD 2LHDA 5HHDG 1D5MC 3SFEB 2AX5A 4HRSA 3U2SC 3TEYA 1SSNA 4NAWB 4P6VF 1UWXA 3ZGZA 4YTNB 4AQ7A 3P42A 1F77A 1XLNA 1EU4A 3VR9B 3CIRB 3AE1B 3RFZB 4A55A 3N9YC 3BYTB 3V3XA 3C8YA 3BVGA 4XDCA 2CJOA 2KWDA 1UNSA 2J52A 3BYYB 4B0MA 2KMMA 1GB1A 2K22A 3SR6A 1Y56A 2BTEA 1VZ8A 5MPOA 3T3NA 1JRPA 3AEGB 3I57A 3LXFA 4RNAA 1EWYC 2DLBA 4N6EB 2L1AA 1ZP0B 1KLGD 2E6XA 2IJ0A 1EM7A 1HZ6A 1OQQA 1TKGA 1JCKB 2Y5PA 1VJKA 2MEKA 4KGSA 3HVDA 2EELA 2GI9A 2VZKB 1JWAD 5BMGA 1EU3A 1ENFA 2AQ2B 2J42A 3FAHA 3R8BA 1QOBA 2N9KA 3PZ7A 1GAQB 1FNWA 3AMZA 4IDIA 5EE1A 2LHEA 1FRDA 2JYEA 1KH0A 4Q2JA 1SE2A 2KQ4X 1N5WA 1N61A 1N62A 3AEAB 3Q8CA 1SIJA 1BXTA 1WXQA 1QT9A 2QIEB 2QMTA 3B2FA 3OWEB 1FNUA 2MH7A 2WXOA 4YTMB 4US8A 4DQOC 5BYSA 2W3RA 2SAKA 3SFDB 3FILA 3NS1A 1TJEA 1C9FA 5C3JB 1P7FA 1QQRA 5HG2A 2ONQA 2Q5WD 3P63A 2V3NA 3ABVB 3J9CA 4REZA 1TS3A 1SF0A 1TS4A 4USAA 1HA5A 4KGTA 4YSZB 3HUIA 3NZ3A 1IUEA 1F2RI 1M4VA 3MFGA 2WXQA 2QILA 2G9HD 2JZPA 3VRAB 5TSSA 2RPVA 3AN1A 4P16A 1SEBD 4HJGE 2XNAC 1UUPA 3IT4B 1TKEA 1JWSD 2JU6X 2DBYA 1NYRA 2WDRB 2NTSA 1TZOA 3U7ZA 1SJED 1FCLA 1Q10A 1L5PA 2Y3AA 1MPEA 1P7EA 1DYQA 1F2RC 1ROEA 1ET9A 1OFFA 2HTME 2QEJC 4PT5A 5D3DA 4A9AA 5HFYA 2CU3A 5FK9C 1V1PA 2N7JA 2WDVB 4C56C 2Y5CA 2PLPA 2W3SA 3TEXA 3GP7A 2PW9A 1VDVA 3ZYYX 1KF6B 2IGHA 1LO5D 4WURA 1AN8A 4TQ1A 3I9V1 1J7BA 1FIQA 4FXCA 1TY2A 4ZHOA 1FMAD 5H92C 2PVOD 5EE9A 4TSSA 4ZOHC 3W5VB 1KLUD 1DOXA 1YJJA 1HZ5A 2K0PA 1SBBB 4YTPB 5BYRA 3IXSA 2R61A 3PO0A 1FEHA 3R2IA 3VRBB 1XLOA 1HXYD 2AQ1B 2D5GA 3AE8B 1T5XD 2V4IB 4J3OD 1PDXA 3URYA 2LEKA 3W5UB 2N0SB 2W54A 2E3TA 2ZW0A 4US9A 4HKQA 1RWSA 1JWUD 5FKAC 3U52E 2V0GA 1JQ4A 4MT5A 1TS5A 2OHFA 1JW9D 4ITKA 1HQRD 2WP9B 4R3DA 4RGTA 4GLSC 3AE5B 3EA6A 1E0ZA 1KRHA 3P4RB 4YXDB 2ICIA 3B9JA 2WXRA 3ETRA 3P4QB 1I4GA 3KWLA 2DYOA 1L6VA 3FC4A 4B0EA 1D4BA 2M0AA 2KAJA 2BS3B 1VZ7A 4MH8A 1QILA 4RCOA 5EE0A 3W9CB 4KKJA 1XLQA 1XO3A 1V1OA 1IGCA 1WRIA 2BW2A 3O13A 4JWSC 3BVMA 2K5PA 4ZHPA 2JWUA 2WXFA 4IOIE 1OQRA 3IAS1 4D2KA 2NMQA 2H88B 4EE2A 1FD6A 3AEFB 1HEZE 2WS3B 1V97A 3ZJVA 1K53A 1L6UA 3IT6B 2BYTA 3U4EG 5I4DA 2QJLA 1L0XB 5EE3A 4C7YA 1A70A 1XCQL 3AE7B 4N59A 4JWUC 4L2YA 4O1NA 4OZBA 5G5HA 2IDYA 1N63A 4TQ0A 2K3UA 1ZXIA 4KX6B 3P1MA 4OVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I38 A;  1Q10 A;  4MAC A;  1IBX A;  4KGR A;  1MPE A;  1P7E A;  2JSV X;  2LHD A;  1F2R C;  5HHD G;  2JXT A;  1PGB A;  1UWX A;  5HFY A;  2N7J A;  2PLP A;  2IGD A;  2PW9 A;  2IGH A;  3V3X A;  1K50 A;  1YMH E;  1JML A;  5BMI A;  4OZC A;  2KWD A;  2J52 A;  1XCT L;  1GB1 A;  1ZXH A;  1XF5 L;  1HZ5 A;  2K0P A;  3FIL B;  2ON8 A;  3UI3 A;  1GB4 A;  2KN4 A;  2GB1 A;  1EM7 A;  1HZ6 A;  2LGI A;  1MI0 A;  1IGD A;  2J53 A;  4KGS A;  2EEL A;  2GI9 A;  1FCC C;  5BMG A;  3MP9 A;  2ZW0 A;  2N9K A;  2LHE A;  4WH4 A;  1KH0 A;  4IKG A;  1K52 A;  1PGX A;  2PTL A;  4GLS C;  2KQ4 X;  4HKZ E;  5HI1 A;  1YNT E;  2QMT A;  2KDM A;  1MHX A;  3GB1 A;  2ZW1 A;  1MHH E;  3FIL A;  5JXV A;  2I2Y A;  1D4B A;  1C9F A;  2IGG A;  2N9L A;  1IBX B;  1MVK A;  1P7F A;  5HG2 A;  2ONQ A;  1IGC A;  2JWU A;  4KGT A;  4IOI E;  1PGA A;  4D2K A;  2OED A;  2NMQ A;  1FD6 A;  1F2R I;  1HEZ E;  1K53 A;  2QSD A;  2JZP A;  2KAC A;  1XCQ L;  2RPV A;  4OZA A;  4HJG E;  1K51 A;  5BMH A;  2LUM A;  2JU6 X;  4OZB A;  2RMM A;  1QKZ A;  1FCL A; 
#chains in the Genus database with same CATH topology
 1T3Q A;  3DOW A;  1UGM A;  3WAM A;  2Z59 B;  4J6I A;  1PYW D;  1NYQ A;  1CK1 A;  2I1J A;  2RPQ A;  2L00 B;  3PTF C;  2XK5 A;  4MJS A;  3RNB C;  2KTR B;  1RM6 C;  2L05 A;  5FR3 A;  2BYE A;  3H9D A;  4W9D A;  3ZLZ A;  4WJO A;  2JF5 A;  2QHO A;  4LJP B;  4GDL A;  2BWE S;  1JML A;  4GDK B;  3EUB 2;  3GE8 C;  4MGZ E;  3PT2 B;  2EKI A;  4CHK A;  1V9J A;  3KWV A;  4QAY A;  2KQ7 A;  1XF5 L;  1D6E C;  5G2N A;  3MC9 A;  2FNJ B;  2Z0D B;  2BYV E;  2GB1 A;  4IM0 A;  4ICV A;  3LYY A;  4A90 A;  1TBE A;  1IP9 A;  2KVR A;  4WJN A;  2NCN A;  5DCN A;  1TYG B;  2D10 A;  2LGY A;  2V9H A;  4WH4 A;  5KHQ A;  1K52 A;  4G11 A;  2V1Y A;  1IPG A;  1K8R B;  1I4Q A;  4A8X C;  3JW0 X;  2BGF A;  2KC2 A;  2V3P A;  4GGQ A;  1WXS A;  4FJZ A;  1MHH E;  2CHW A;  4ZRP A;  4RFB A;  4XC2 A;  2I2Y A;  1FNV A;  1WH3 A;  3KVF B;  5E6O A;  4W9K A;  3NHE B;  3HM3 A;  2LZ6 A;  1E9M A;  1V86 A;  2AWT A;  2BT6 A;  3DCG A;  1V81 A;  4GMV A;  4ARI A;  2MJ3 A;  4F7Z A;  3QC8 B;  2QSD A;  2KAC A;  4I6P A;  1L2N A;  2FCN A;  3W1S A;  4WIP A;  4HLE A;  3W2D A;  2AYO B;  5LNK 1;  2LUM A;  4OW0 A;  2WDQ B;  1NEK B;  2H89 B;  2HDE A;  5AUI A;  1D5Z C;  3AE3 B;  1YJI A;  2DZM A;  4DXF A;  4XGA B;  5IN7 A;  4A3O A;  3M95 A;  3AB5 A;  2BKR B;  1VRA B;  1VR9 A;  4KSL C;  3H7S A;  4KKI A;  2ZZP B;  3OG5 A;  2NS5 A;  2RDH A;  3AH7 A;  1AYF A;  1WGK A;  2WXG A;  4OZC A;  1SJH D;  4MEL A;  4LLG M;  1XCT L;  1ZXH A;  3AXC A;  4BVU C;  2X38 A;  1E6E B;  1HTQ A;  2TSS A;  4L1B A;  1E7P B;  3EGR A;  3PHX B;  3QAR A;  3UQB A;  3U8Z A;  2NTT A;  2N9X A;  1VLB A;  3UIO B;  1ZDX A;  4N9F 4;  2AQ3 B;  2OJW A;  4NJ7 A;  2IBI B;  1FXA A;  4XE0 A;  1L0V B;  3U30 A;  1I4P A;  2M19 A;  3BVZ A;  3VHT C;  2LMC A;  3QWZ B;  3IG3 A;  2PTL A;  1QF6 A;  4MJS B;  2ACZ B;  4CQN A;  4LNF A;  1T0Q C;  4HKZ E;  4LNO A;  3ZNI D;  3V62 A;  2MLB A;  4GDL B;  4WQM A;  2KDF B;  3GZN I;  5C23 A;  1UD7 A;  1WYG A;  5JXV A;  2PJH A;  2WQY B;  2GBM A;  2IGG A;  2MWS B;  3H7P A;  3NRZ A;  1MVK A;  3BZD B;  4JLC A;  1P1A A;  1DOI A;  3DBL B;  2WU2 B;  3NZU A;  4FHK A;  5T8I A;  2L83 A;  3V60 A;  3KH0 A;  2RSU A;  3I5J C;  4ANU A;  3A9J A;  4TUU A;  1C79 A;  3RNA C;  2L76 A;  1SXT A;  4C00 A;  4WAF A;  2CR5 A;  1LGR A;  3ZKJ C;  3VAW A;  2LAS A;  2PIA A;  1C76 A;  2XBB C;  4FJY A;  1VCB A;  1JAL A;  3ENE A;  2D3B A;  2KWC A;  3UIP B;  4NQL B;  1IBX A;  1GUA B;  3JVZ X;  1JWM D;  3NJT A;  4JIO U;  1SSN A;  4YTN B;  2KC1 A;  4AOF A;  3CIR B;  3Q3N C;  1TGZ B;  2ZNV B;  3EHV A;  4S17 A;  1OEY A;  4EEW A;  2CJO A;  4KVG B;  1GB1 A;  2G3Q B;  2K22 A;  3SR6 A;  1TT5 B;  4ZYN A;  4GU2 A;  1WGG A;  4IM3 A;  1EWY C;  4N6E B;  1OGW A;  2LJ5 A;  1ZP0 B;  1KLG D;  4MGI E;  4M8N A;  2Y5P A;  1VJK A;  3Q3O C;  2MEK A;  2QCZ A;  2EEL A;  2GI9 A;  2VZK B;  3R8B A;  3PZ7 A;  1FNW A;  1WI0 A;  1UF0 A;  5J2R A;  4A3P A;  1WXA A;  1WXM A;  2NVU I;  3Q8C A;  1BXT A;  2C7N B;  2MH7 A;  5BYS A;  4DQO C;  3QAQ A;  2AEH A;  4E3C A;  2J0J A;  3SFD B;  3VUY A;  1TJE A;  2HD5 B;  1C9F A;  4LNK A;  2MHJ A;  3J9C A;  4MH0 E;  4PS7 A;  4REZ A;  1TS4 A;  4EOY A;  2MRP A;  3RD2 A;  3A4S C;  1HA5 A;  2D3G A;  3MFG A;  1Z2M A;  2ZPN A;  2JRH A;  1UUP A;  1S3S G;  3IT4 B;  2JU6 X;  2UYZ B;  1P9D U;  1SJE D;  1WXV A;  3DHH C;  3H1U A;  3X23 A;  5CTR C;  2N4F A;  1L5P A;  1P7E A;  2NBW B;  3LJ3 A;  2G4S A;  1OFF A;  1Z5S B;  5D3D A;  2I1K A;  1V1P A;  1SE9 A;  4PYU A;  1MJD A;  2LRW A;  3WAN A;  2EKE C;  1LO5 D;  3RYT A;  1FMA D;  5H92 C;  4DHZ E;  5EE9 A;  4TSS A;  3PVL A;  2K0P A;  2JWZ A;  4FHJ A;  1XLO A;  2IO3 B;  4JGH B;  2AQ1 B;  3X0W A;  3AE8 B;  3OJ4 B;  4NAW A;  2OJR A;  1YIW A;  2MBQ A;  2LXA A;  2W54 A;  3KUD B;  2E3T A;  2ZW0 A;  4WWP A;  4HKQ A;  1RWS A;  1F1H A;  2KJR A;  1JQ4 A;  2OHF A;  1JW9 D;  2KFK A;  4ITK A;  2KTF A;  2LGX A;  4R3D A;  4GLS C;  3DBH B;  1KRH A;  3P4R B;  2KDE B;  4DHJ B;  2ICI A;  3B9J A;  3ETR A;  5KHO A;  3R7Q A;  4II3 B;  2DYO A;  3FC4 A;  3PGE A;  4GSW A;  2BQQ A;  2MQJ A;  1VZ7 A;  5EE0 A;  1QIL A;  3W9C B;  4NY0 A;  1XO3 A;  1V1O A;  3O13 A;  4FBJ B;  3BVM A;  2K5P A;  2PEA A;  2FCS A;  1OQR A;  1ISN A;  4EE2 A;  3AEF B;  1LM8 B;  3EFU A;  4ANV A;  1HEZ E;  5I4D A;  1XT9 B;  5EE3 A;  1YX5 B;  2KT7 A;  3ZXV A;  1A70 A;  1XCQ L;  2A4Z A;  3RT3 B;  4OZB A;  2C9W B;  3PSE B;  3P1M A;  1JRO A;  1ZOY B;  3AE9 B;  3AE2 B;  2AL6 A;  2LI5 A;  4GN1 A;  3DPD A;  3OAW A;  3QA8 A;  2ZVO A;  4L23 A;  1A5R A;  1EWC A;  2DAF A;  4YT0 B;  1FFU A;  1BT0 A;  3KW5 B;  1WGR A;  1C3T A;  1MFW A;  4BZA A;  2WLB A;  3AEB B;  2J7Q B;  3RNC C;  1CQV A;  1TY0 A;  3DWM A;  1G6J A;  3VQI A;  1L0Y B;  1F9J A;  5JHA A;  4OVV A;  3WIM A;  4LDT B;  4LNI A;  3A33 B;  1NI3 A;  2LGI A;  3M63 B;  1FFV A;  2LVO A;  5JZE B;  2JT4 B;  1KOT A;  1KM7 A;  3V05 A;  3HVZ A;  1NDD A;  3SD5 A;  1PGX A;  1V1P B;  1RFA A;  2KD0 A;  1C4C A;  1WJN A;  2DEN B;  4IWP A;  2V4L A;  1HTO A;  2WXL A;  4WWM A;  4HJK A;  5D3I B;  5AUK A;  1WJ4 A;  1YQ3 B;  1V8C A;  2HTH A;  3R3M A;  3RN9 C;  4WQO B;  3EEC A;  2G1E A;  1ZDV A;  1I42 A;  3EC8 A;  3AV8 A;  2FAZ A;  2PMV A;  1NVI D;  2DZJ A;  1AW7 A;  1HE8 A;  1WMH A;  2WXP A;  4AS1 A;  2JVC A;  3IAM 1;  2KFK B;  2ZNV C;  1P0R A;  3TCA A;  5BMH A;  1WX7 A;  1QZE A;  1JWB D;  4JQW C;  3D32 A;  1PUT A;  2L0T A;  3AEC B;  2JSV X;  2WXK A;  1ET6 A;  2Z8L A;  2BS2 B;  4P1C C;  3Q14 C;  4XYC A;  2IY1 B;  4MGY E;  2JXT A;  5AEK B;  3B1L X;  3HRD D;  3VFK A;  2BPS A;  3ZNZ B;  3Q8F A;  2VH2 A;  2BB5 A;  1I35 A;  4KSK C;  4DBG A;  1UGJ A;  4ACF A;  2IPK D;  2KOX A;  2RDG A;  1RRB A;  2FBW B;  1E7V A;  4B9K A;  3TJP A;  2UWQ A;  1OTR B;  2BB6 A;  3FIL B;  4AWJ A;  3UI3 A;  3NVV A;  4S0R A;  2KN4 A;  4K7U A;  1YOV B;  2RDB C;  3VXW A;  5CHF A;  1U4A A;  3WA0 A;  1SB3 C;  3K9P B;  2GBR A;  4EZK A;  3NVZ A;  1QOA A;  3A4R A;  4W9E A;  1I7H A;  1WX8 A;  2O6V D;  3DBL I;  5H8Y E;  3B2G A;  2B3A A;  1GPX A;  3BWU D;  1WWT A;  1OQY A;  2DWQ A;  1YN3 A;  1TKY A;  2WXM A;  5DPT A;  4YWG G;  3AU5 A;  2DYB A;  4RF0 A;  3MJ5 A;  1ESF A;  4H2A A;  2M56 B;  1N60 A;  1T0Y A;  4M0W A;  2N9L A;  4BKT A;  1PQS A;  1ZGU B;  2WXH A;  3PLV A;  4M01 A;  1EO6 A;  1L4D B;  2M8S A;  3T3O A;  2LJI A;  1Y8R C;  2J4X A;  3AED B;  1ACC A;  1WE7 A;  2UU7 A;  4RF1 A;  2YEP F;  4G3X B;  4M02 A;  3QX1 A;  4ZRK A;  4W9H A;  4NAM A;  1UEL A;  1QKZ A;  3E56 A;  2IO2 B;  2BS4 B;  1D5X C;  5HHD G;  4HRS A;  3U2S C;  5L95 C;  2ZCB A;  5FR6 A;  1WZ0 A;  3KYD D;  4AUQ C;  4BBN C;  3ZGZ A;  2N1V A;  1EU4 A;  2CU1 A;  3VR9 B;  4CYE A;  3AE1 B;  4A55 A;  2JUO A;  3DDC B;  3V3X A;  3QJZ A;  1V2Y A;  2KWD A;  1UNS A;  2EMT A;  2MBO A;  1Y56 A;  2BTE A;  1WMH B;  5D2M B;  2IYD B;  5MPO A;  3N1Y C;  3AEG B;  2ZCC A;  3LXF A;  4BAX A;  1V5T A;  2WHI A;  2DLB A;  1KJT A;  3PPA A;  2NBU A;  1TKG A;  1OQQ A;  1JCK B;  2MSE D;  3HVD A;  5BMG A;  1WYW B;  2WDT B;  1QOB A;  4IDI A;  2PPH A;  3AMZ A;  4KDI C;  3VDZ A;  3PRM B;  4Q2J A;  2LVQ A;  4HPM B;  2R2O A;  1N61 A;  3AEA B;  4FA6 A;  5J17 A;  1SIJ A;  3OWE B;  2LVP A;  1FNU A;  2KK8 A;  2WXO A;  4YTM B;  1GJZ A;  4HVB A;  5CX3 A;  3WAL A;  3V61 A;  1H4R A;  2R2Q A;  1QQR A;  2ONQ A;  3P63 A;  3ABV B;  1RAX A;  3A1Q A;  3ZDM C;  2XK5 B;  4USA A;  2ASQ A;  1TZ1 A;  4LCD E;  3MJW A;  3DBR B;  2WXQ A;  3ZTC A;  5TSS A;  2RPV A;  2MBE A;  1SEB D;  1V80 A;  2HJ8 A;  4RM9 A;  3ZUN A;  1Q5W B;  2DBY A;  1NYR A;  2W9N A;  5LLI A;  1TZO A;  1FCL A;  4IW0 A;  1FXT B;  3UF8 A;  2NR2 A;  3L17 A;  4II2 B;  2D11 A;  2Y3A A;  4AJW A;  1ET9 A;  2QEJ C;  5FK9 C;  1IYF A;  2N7J A;  1Q0W B;  2Y5C A;  2PLP A;  3TEX A;  1VDV A;  2YLM A;  2NBV B;  2IGH A;  2RGF A;  4OVU A;  1J7B A;  3L54 A;  3VUW A;  5E6P A;  4ZHO A;  2WYQ A;  4NPN A;  4ZOH C;  3W5V B;  1YJJ A;  4W9C A;  2R61 A;  3DBH I;  3NOB A;  1FEH A;  3R2I A;  3VRB B;  2FCQ A;  3VTU A;  1HXY D;  4K1R B;  4TV3 A;  2WX1 A;  3N32 A;  3VUX A;  2N7E A;  3QQ8 B;  3VTV A;  4J3O D;  3URY A;  2LEK A;  2KWU B;  4US9 A;  5FKA C;  4MT5 A;  1LXD A;  3N3K B;  2J0M A;  2WP9 B;  2L7R A;  1YJ1 A;  3L16 A;  2LGD A;  4P1B C;  4IWQ A;  3EA6 A;  2CHX A;  1E0Z A;  3PLU A;  2WXR A;  3P4Q B;  4HDQ A;  2K25 A;  3KWL A;  4MM3 A;  2KWV B;  4IG7 B;  2KAN A;  2KAJ A;  4NQK E;  4KKJ A;  4JWS C;  2JWU A;  3OLM D;  4IOI E;  2VRR B;  1MG8 A;  3IAS 1;  2H88 B;  1V97 A;  3ZJV A;  1K53 A;  1L6U A;  3U4E G;  2QJL A;  2FID A;  1YD8 U;  3AE7 B;  3MC8 A;  4N59 A;  5J18 A;  2ZEQ A;  4L2Y A;  4O1N A;  5G5H A;  1N63 A;  2K3U A;  4KX6 B;  3I3T B;  3Q8A A;  1R4M B;  2ZJD A;  2DNF A;  4XDD A;  2BVC A;  1C78 A;  1E7U A;  4W9L A;  4EFO A;  4W9F A;  2KDI A;  3KLS X;  3RZF A;  2L32 A;  1V5O A;  3KYC D;  1YN4 A;  3HHM A;  4RM8 A;  2LGS A;  1GC7 A;  3APD A;  1VD2 A;  4RGM A;  1ZUD 2;  3A1Q B;  2OOB B;  3P4P B;  4K7W A;  1C77 A;  3Q2A C;  4HRO A;  4A20 A;  1RLF A;  5IKC M;  2YEP B;  3VTW A;  4RGN A;  2K8H A;  1WX9 A;  5IO9 A;  4UDU C;  2L3Z A;  2ON8 A;  4PS8 A;  1GOZ A;  4WWO A;  1SE3 A;  3VVW B;  4URK A;  3H8H A;  1UWM A;  3H7P B;  4K3C A;  3N30 A;  3L4P A;  2FUH B;  2J53 A;  4W9G A;  1FCC C;  3NUH B;  3SHQ A;  1WSP A;  2JZZ A;  3ZTD A;  3R66 C;  4HEA 1;  1E8Z A;  3A9J B;  2GBK A;  1C4A A;  1YNT E;  3HM6 X;  2JQR B;  3JSV A;  2ZW1 A;  2GRI A;  3IVF A;  4BKS D;  3K9O B;  3TSS A;  3UIN B;  2N1W A;  1IBX B;  2KKC A;  1QOF A;  4KZ0 A;  1XLP A;  2DHZ A;  1KTK A;  3ML8 A;  2REX A;  3VH4 B;  3RPF C;  2KX0 A;  4RGO S;  3SU8 X;  2INN E;  2FUG 1;  2IY0 B;  2M17 A;  3EFC A;  4AP4 C;  1M94 A;  1AAR A;  1VZ6 A;  2C7H A;  2B76 B;  1TIF A;  3WCQ A;  1R7S A;  2WXN A;  2MJE A;  1P98 A;  3TMP B;  4NJC A;  2MJD A;  2D07 B;  2GBN A;  2YVC A;  3B08 A;  1J7A A;  5AZH A;  3U7D A;  4MM3 B;  3TL5 A;  3TEW A;  1RYJ A;  3MC0 B;  3IBE A;  4ARC A;  1ZKH A;  3DWG C;  2KVZ A;  3APC A;  4FLH A;  1NBF C;  1TS2 A;  3BII D;  3DQV A;  4HCP B;  3PRP B;  1E10 A;  3ZNH B;  5BYQ A;  2SEB D;  5LXH A;  3CF6 E;  2NPT A;  3RUI B;  1UH6 A;  2DYM A;  2K9X A;  2O6V A;  3CST A;  3B0A A;  2V3S A;  1BML C;  1UBI A;  1EF1 A;  1MI0 A;  2KTR A;  4LK0 M;  3ZW3 A;  2WNM A;  3MP9 A;  3N20 C;  4GB9 A;  4IC7 B;  4EZL A;  1YQ4 B;  3Q69 A;  2AL3 A;  4GDK A;  4F1S A;  1WZ3 A;  2JRI B;  5HI1 A;  2PKO A;  1JRU A;  4GXB A;  1KFY B;  4ZDV A;  1MHX A;  3GB1 A;  3TIX A;  3BK2 A;  4NJ6 A;  1WJU A;  2MX2 A;  3WAO A;  3Q3J A;  5C2T B;  4KDL B;  3R7R A;  3HK0 A;  4W9J A;  2MBH A;  4K3B A;  2WXJ A;  3KQ4 A;  2FE8 A;  2BBC A;  3Q8E A;  1PGA A;  3VR8 B;  2OED A;  1YN5 A;  3SEB A;  1SGH A;  1EF5 A;  1K51 A;  4DHZ B;  3APF A;  2WX0 A;  1FRR A;  5TR5 A;  4JE3 B;  4DXG A;  1L4Z B;  3ZJT A;  4C7Z A;  4WJQ A;  2N9P C;  3H6N A;  4HWI B;  1FXI A;  1YX6 B;  2KJ6 A;  2M1M A;  1WJ6 A;  1I4H A;  2KMA A;  1YQB A;  2LHD A;  3SFE B;  1D5M C;  4DDI D;  2AX5 A;  4NAW B;  1WF9 A;  2IZV B;  2DAJ A;  1UWX A;  3P42 A;  1F77 A;  1XLN A;  3RFZ B;  2LD9 A;  3N9Y C;  2K39 A;  3BYT B;  3Q3M C;  3C8Y A;  4MSM B;  3BVG A;  2HE7 A;  2J52 A;  5D6J B;  2GBJ A;  1VZ8 A;  2JY6 A;  3W1S C;  3T3N A;  3I57 A;  2D3C A;  2C7M B;  2IJ0 A;  1EM7 A;  1HZ6 A;  2KJH B;  4KGS A;  1JWA D;  1EU3 A;  2KFJ A;  2AQ2 B;  2J42 A;  3DHI C;  5CHW A;  5EE1 A;  2K1F A;  2LHE A;  2JYE A;  1KH0 A;  4FUL A;  5DPW A;  1WGY A;  1N5W A;  2QIE B;  3DBR I;  2XEW A;  4E71 A;  1GC6 A;  2W3R A;  2NPT B;  3ZVV A;  4CO7 A;  4DWF A;  4MEM A;  3NS1 A;  3PRZ A;  5L83 A;  2O6V B;  3LDZ E;  5C3J B;  2Q5W D;  4DK5 A;  2V3N A;  1SF0 A;  4KGT A;  3NZ3 A;  1IUE A;  1F2R I;  1M4V A;  4WJP A;  2JPH A;  2QIL A;  2G9H D;  3VRA B;  4P16 A;  4HJG E;  2PE6 B;  3PS6 A;  3RI7 C;  2XNA C;  3DVN V;  1JWS D;  2WDR B;  2NTS A;  4IUM B;  1E5W A;  4ZRI A;  1Q10 A;  3A9K A;  3NZS A;  4F8C B;  1MPE A;  3RNG C;  3DVN U;  4A9A A;  2CU3 A;  3IFW B;  2WDV B;  4C56 C;  2VH1 A;  5AZG A;  3ZYY X;  1KF6 B;  2IO0 B;  2KQS A;  3ZXR A;  2MBB B;  4FJV B;  3I9V 1;  4TQ1 A;  2LUE A;  2Z0E B;  1TY2 A;  1P3Q U;  2WGS A;  3ZO5 B;  4AJY B;  1KLU D;  1DOX A;  1XQQ A;  1SBB B;  2QDF A;  3IXS A;  2D5G A;  1L7Y A;  1T5X D;  2V4I B;  4LNN A;  3S2A A;  4B6W A;  4HDO A;  5LXI B;  1WM3 A;  2GLS A;  4BOS C;  1JWU D;  3U52 E;  1TS5 A;  2MCN B;  4HK2 A;  1R4N B;  5C1Z A;  3AE5 B;  2KNB A;  3AUL A;  3ALB A;  3L08 A;  4I6N B;  2GOW A;  3AU4 A;  4YXD B;  3NY5 A;  1V6E A;  1I4G A;  1L6V A;  4B0E A;  1D4B A;  1SIF A;  2BWF A;  4MH8 A;  4RCO A;  4RMA A;  2M4N A;  1R4M I;  4ZHP A;  1C1Y B;  4DDG D;  2INC C;  2M0X A;  4BBN F;  4IWO A;  2BYT A;  1WY8 A;  2MA9 B;  1L0X B;  1H8C A;  1X1M A;  3RMK C;  3L13 A;  4PK1 A;  4JWU C;  3FKY A;  3NS8 A;  3I63 C;  1WM2 A;  4JX1 C;  4OVZ A;  3UQA A;  3NVW A;  4K81 A;  5BO4 B;  3PZ8 A;  1PGB A;  3CMM B;  4ICU A;  4HXD A;  1T0R C;  4C80 A;  1FM0 D;  3AE4 B;  1I4R A;  2IGD A;  2L0F A;  2L8J A;  2WXI A;  1K50 A;  2HJ1 A;  3ZQ4 A;  4I6L B;  2CJN A;  3M3J A;  4DXA B;  2KDB A;  3LB8 C;  3SDL C;  1J0G A;  2K8B A;  2MP2 A;  3ZJU A;  1NEN B;  2BF8 B;  3P2B A;  1GB4 A;  4M0W B;  4X57 B;  1IGD A;  3A9K B;  3AEE B;  3P4S B;  4BKS A;  4HPP A;  1D3Z A;  3R2T A;  5D7G A;  1XEE A;  4PS3 A;  3RZW C;  2XN9 C;  1FPY A;  1BUI C;  4RH6 A;  1XXG A;  1T6B X;  2G45 B;  3UGB B;  5JH5 C;  2PE9 A;  3C19 A;  2PVG C;  4MSQ B;  4ZYS A;  2C5L C;  3RNE C;  1PFD A;  3T8M A;  1WIA A;  4XX5 A;  3WAP A;  3NVY A;  1WGH A;  4IM2 A;  2W55 A;  5IAA C;  4YSX B;  3TEZ A;  3BK1 A;  4A6Q A;  3RNF C;  3JYU A;  2Y5B B;  4YSY B;  1N6Z A;  3KUC B;  1V49 A;  3AM9 A;  4XWT A;  3HIZ A;  1C4P A;  3AE6 B;  1B9R A;  2EMS A;  1ZE3 D;  1CJE A;  4ZRQ A;  2RMM A;  3ZNG C;  2JYT A;  1WFY A;  5G5G A;  1DOY A;  5DPR A;  2O2V A;  1B1Z A;  2INP E;  2BKF A;  1ZPS A;  3O65 B;  4TMA B;  3BIN A;  3DVG X;  1QLB B;  1SE4 A;  2W82 A;  2KX3 A;  3L10 B;  1YMH E;  4ANX A;  3GE3 C;  1CMX B;  5GXG B;  3N1X C;  5BMI A;  2QC8 A;  2VZK D;  3TBL D;  1AWD A;  5AZF A;  3W1Y A;  5EDS A;  1N5X A;  2D2Q A;  3CWI A;  2CHZ A;  5E6N A;  3GOE A;  3NG0 A;  4XWW A;  4PYZ A;  2JZ3 B;  4LJO B;  4HCN B;  2BYF A;  2DZK A;  2GMI C;  1DGJ A;  3PV1 A;  2JXX A;  2K6Q A;  4N58 A;  3TUO A;  4IKG A;  1WR1 A;  2G4D B;  2KLG A;  2JX5 A;  3Q8B A;  2KDM A;  1WRD B;  4XZ4 A;  3VH3 B;  1FO4 A;  2LFI A;  3GS2 A;  1E8Y A;  1CZP A;  3DHG C;  5IA7 A;  2MP2 B;  1I4X A;  4EUT A;  4OHJ A;  3E9S A;  1J7C A;  1QOG A;  3MHS D;  3PRE A;  3T9L A;  1F0Z A;  2LXC A;  4NZL B;  5IP4 D;  3RUL A;  1STE A;  4G0N B;  1TTN A;  3MHZ A;  5E6J A;  1WE6 A;  3GZN B;  4LTU A;  4OZA A;  4G50 A;  2CKH B;  3QK0 A;  1WGD A;  1F52 A;  2WU5 B;  1WR6 E;  1RFK A;  4E74 A;  1EUV B;  2L52 A;  2DX5 B;  3RCZ A;  3QCA A;  2I38 A;  4MAC A;  4MDK E;  3Q3F A;  1J19 A;  4KGR A;  4JPS A;  3V6C B;  1UBQ A;  1NI2 A;  3TEY A;  4P6V F;  4M00 A;  4AQ7 A;  1KLV A;  2N9E B;  5IOI A;  2LRU A;  2KYW A;  2CS4 A;  4ZRJ A;  4C4V A;  5G55 A;  2K6D B;  3AI5 A;  4XDC A;  3BYY B;  4B0M A;  2KMM A;  4JL9 A;  4EKU A;  4TKN A;  1JRP A;  4RNA A;  5D94 A;  2L1A A;  2LWP A;  2KN5 A;  2KMC A;  2E6X A;  4HPL B;  4DHJ D;  2D3A A;  4KZC A;  1OEY J;  4BKG A;  1ENF A;  3FAH A;  2N9K A;  2O2V B;  4KIK A;  1GAQ B;  4ANW A;  1FRD A;  3IHP C;  4FN2 A;  1ZW7 A;  1S1Q B;  4B95 A;  1SE2 A;  5HKH A;  2KQ4 X;  2RR9 A;  1N62 A;  2N7D A;  1WXQ A;  3OJ3 A;  1QT9 A;  3B2F A;  2QMT A;  4US8 A;  2SAK A;  3FIL A;  1MG4 A;  3ZDT A;  4BFR A;  2DZI A;  5DPS A;  2FIF A;  5GMV A;  1E8W A;  1P7F A;  5HG2 A;  2WWZ A;  1TS3 A;  4YSZ B;  3CSF A;  2KXJ A;  3HUI A;  3N1Z C;  5CHV C;  3ZRF A;  2KLC A;  2JZP A;  3AN1 A;  3BY4 B;  4FAD A;  2J0K A;  1TKE A;  3ONS A;  3U7Z A;  1XD3 B;  1E90 A;  3C0R B;  1DYQ A;  1F2R C;  1ROE A;  2HTM E;  1Q1O A;  2K8C A;  3DVG Y;  2FCM A;  4PT5 A;  4W9I A;  5HFY A;  1GNU A;  1LFD A;  5JHB A;  4GOC A;  2W3S A;  3PZD A;  3GP7 A;  2PW9 A;  4LDT D;  2RD0 A;  4WUR A;  1AN8 A;  2ZVN A;  2MW5 A;  1FIQ A;  4FXC A;  1LQB A;  2C60 A;  1R4N I;  2PVO D;  1T0S C;  3ZRC A;  4M8M A;  1GG3 A;  1HZ5 A;  3JSV B;  4YTP B;  5BYR A;  2KZR A;  3PO0 A;  3ECI A;  2ZPY A;  1J8C A;  4NNJ B;  1PDX A;  3W5U B;  2N0S B;  3QHT A;  2V0G A;  2KO3 A;  1HQR D;  3MTN B;  4RGT A;  4WWN A;  3DBS A;  4GIV A;  4C4V B;  4WAA A;  4YL8 A;  2KHW B;  4P7I A;  3V6E B;  4BOZ B;  2A5U A;  2M0A A;  2BS3 B;  1E8X A;  4EZJ A;  1XLQ A;  1IGC A;  1WRI A;  2BW2 A;  3PHW B;  3ML9 A;  2X8X X;  2WXF A;  2IND C;  4D2K A;  2NMQ A;  1FD6 A;  4MGK E;  4ASW C;  2WS3 B;  3L0W B;  3IT6 B;  3KUZ A;  3Q6B A;  3M62 B;  3ZIM A;  2IO1 B;  4C7Y A;  4KIK B;  4KV2 A;  4K7S A;  2IDY A;  4TQ0 A;  1UZX B;  1ZXI A;  3QIJ A; 
#chains in the Genus database with same CATH homology
 1T3Q A;  1JRO A;  3Q8A A;  1ZOY B;  3AE9 B;  3AE2 B;  1PYW D;  1NYQ A;  3NVW A;  4XDD A;  1CK1 A;  1C78 A;  3KLS X;  2L32 A;  3PZ8 A;  1PGB A;  4L23 A;  1YN4 A;  1RM6 C;  4C80 A;  5FR3 A;  1FM0 D;  3AE4 B;  1EWC A;  1I4R A;  2IGD A;  4YT0 B;  1FFU A;  4RGM A;  1ZUD 2;  2WXI A;  3P4P B;  2WLB A;  1K50 A;  3AEB B;  1JML A;  1C77 A;  4GDK B;  3EUB 2;  4HRO A;  3ZQ4 A;  2CJN A;  1CQV A;  2YEP B;  1TY0 A;  3DWM A;  4RGN A;  3LB8 C;  2EKI A;  3KWV A;  1XF5 L;  4JX1 C;  3VQI A;  1D6E C;  1L0Y B;  3ZJU A;  4UDU C;  1NEN B;  2ON8 A;  1GOZ A;  1SE3 A;  1GB4 A;  3H8H A;  1UWM A;  2GB1 A;  1NI3 A;  2LGI A;  3LYY A;  3L4P A;  1FFV A;  4A90 A;  1IGD A;  2J53 A;  1FCC C;  3AEE B;  3NUH B;  3P4S B;  1TYG B;  1WSP A;  3V05 A;  3HVZ A;  3R2T A;  4HEA 1;  5D7G A;  4WH4 A;  1XEE A;  1K52 A;  1PGX A;  1V1P B;  1C4A A;  1I4Q A;  2XN9 C;  1C4C A;  4A8X C;  1YNT E;  1BUI C;  2JQR B;  1XXG A;  1T6B X;  2V3P A;  4RH6 A;  2WXL A;  2PVG C;  2ZW1 A;  1MHH E;  4WWM A;  4ZYS A;  4ZRP A;  2GRI A;  4RFB A;  2I2Y A;  1PFD A;  5D3I B;  3TSS A;  5AUK A;  1FNV A;  1IBX B;  1YQ3 B;  1V8C A;  3NVY A;  1QOF A;  1XLP A;  1KTK A;  2G1E A;  2W55 A;  1ZDV A;  4YSX B;  3TEZ A;  3BK1 A;  4A6Q A;  1E9M A;  2BT6 A;  3RPF C;  4RGO S;  2INN E;  3AV8 A;  2PMV A;  2FUG 1;  1NVI D;  4ARI A;  4YSY B;  2MJ3 A;  1AW7 A;  2WXP A;  3AM9 A;  4XWT A;  4AS1 A;  2QSD A;  1VZ6 A;  2KAC A;  1C4P A;  2B76 B;  3W1S A;  3AE6 B;  3IAM 1;  4WIP A;  3WCQ A;  3W2D A;  1B9R A;  1R7S A;  1ZE3 D;  5BMH A;  1CJE A;  4ZRQ A;  2LUM A;  5LNK 1;  4OW0 A;  2WXN A;  2RMM A;  2WDQ B;  2MJE A;  1JWB D;  1NEK B;  2H89 B;  2HDE A;  5AUI A;  2JYT A;  1D5Z C;  3AE3 B;  1YJI A;  4NJC A;  2MJD A;  1PUT A;  3AEC B;  1J7A A;  5G5G A;  4DXF A;  1DOY A;  2JSV X;  2WXK A;  1ET6 A;  1B1Z A;  2INP E;  2Z8L A;  2BS2 B;  1RYJ A;  4MM3 B;  3TEW A;  3MC0 B;  2JXT A;  1ZPS A;  4ARC A;  3AB5 A;  3DWG C;  1VRA B;  4TMA B;  1VR9 A;  3HRD D;  1TS2 A;  3BII D;  4KKI A;  1QLB B;  3Q8F A;  1SE4 A;  1E10 A;  2W82 A;  1YMH E;  2RDH A;  2BB5 A;  2SEB D;  5BYQ A;  3AH7 A;  1AYF A;  1WGK A;  2WXG A;  5GXG B;  4OZC A;  5BMI A;  1UGJ A;  1SJH D;  2VZK D;  4LLG M;  1AWD A;  1XCT L;  2IPK D;  1N5X A;  1ZXH A;  2RDG A;  2DYM A;  3CWI A;  2FBW B;  1E6E B;  2K9X A;  2X38 A;  2TSS A;  4L1B A;  1E7P B;  3EGR A;  2NTT A;  1VLB A;  2BB6 A;  1ZDX A;  3FIL B;  2AQ3 B;  3UI3 A;  3NVV A;  1BML C;  2KN4 A;  4XWW A;  1FXA A;  1MI0 A;  4XE0 A;  1DGJ A;  1L0V B;  1SB3 C;  4LK0 M;  2WNM A;  3MP9 A;  1I4P A;  2M19 A;  3BVZ A;  1QOA A;  3NVZ A;  4N58 A;  2LMC A;  1I7H A;  3TUO A;  4IKG A;  1YQ4 B;  2PTL A;  3Q69 A;  1QF6 A;  2ACZ B;  4CQN A;  5H8Y E;  3B2G A;  2JX5 A;  3Q8B A;  4HKZ E;  3BWU D;  5HI1 A;  1WWT A;  1GPX A;  2PKO A;  2DWQ A;  1YN3 A;  1TKY A;  2WXM A;  1KFY B;  4GDL B;  4YWG G;  4WQM A;  2KDM A;  4RF0 A;  3MJ5 A;  1MHX A;  3GB1 A;  1ESF A;  4H2A A;  2M56 B;  1WYG A;  3BK2 A;  5JXV A;  1FO4 A;  2LFI A;  1N60 A;  3GS2 A;  2WQY B;  5C2T B;  2IGG A;  2N9L A;  3NRZ A;  4M0W A;  1CZP A;  1MVK A;  3BZD B;  2WXH A;  2WXJ A;  1I4X A;  3KQ4 A;  1DOI A;  2FE8 A;  4OHJ A;  3E9S A;  1J7C A;  1QOG A;  2BBC A;  2WU2 B;  5T8I A;  3Q8E A;  2L83 A;  1PGA A;  3VR8 B;  1F0Z A;  2OED A;  4NZL B;  1L4D B;  1YN5 A;  1STE A;  3SEB A;  3T3O A;  1C79 A;  2LJI A;  3MHZ A;  5E6J A;  1SXT A;  4WAF A;  4LTU A;  2J4X A;  4OZA A;  3AED B;  1ACC A;  1K51 A;  4RF1 A;  2YEP F;  1FRR A;  2WU5 B;  4JE3 B;  4DXG A;  1L4Z B;  2PIA A;  1C76 A;  1RFK A;  3ZJT A;  4NAM A;  1QKZ A;  2L52 A;  3E56 A;  4C7Z A;  1JAL A;  2I38 A;  1FXI A;  4MAC A;  1IBX A;  4KGR A;  4JPS A;  1I4H A;  2BS4 B;  1D5X C;  1JWM D;  2LHD A;  5HHD G;  1D5M C;  3SFE B;  2AX5 A;  4HRS A;  3U2S C;  3TEY A;  1SSN A;  4NAW B;  4P6V F;  1UWX A;  3ZGZ A;  4YTN B;  4AQ7 A;  3P42 A;  1F77 A;  1XLN A;  1EU4 A;  3VR9 B;  3CIR B;  3AE1 B;  3RFZ B;  4A55 A;  3N9Y C;  3BYT B;  3V3X A;  3C8Y A;  3BVG A;  4XDC A;  2CJO A;  2KWD A;  1UNS A;  2J52 A;  3BYY B;  4B0M A;  2KMM A;  1GB1 A;  2K22 A;  3SR6 A;  1Y56 A;  2BTE A;  1VZ8 A;  5MPO A;  3T3N A;  1JRP A;  3AEG B;  3I57 A;  3LXF A;  4RNA A;  1EWY C;  2DLB A;  4N6E B;  2L1A A;  1ZP0 B;  1KLG D;  2E6X A;  2IJ0 A;  1EM7 A;  1HZ6 A;  1OQQ A;  1TKG A;  1JCK B;  2Y5P A;  1VJK A;  2MEK A;  4KGS A;  3HVD A;  2EEL A;  2GI9 A;  2VZK B;  1JWA D;  5BMG A;  1EU3 A;  1ENF A;  2AQ2 B;  2J42 A;  3FAH A;  3R8B A;  1QOB A;  2N9K A;  3PZ7 A;  1GAQ B;  1FNW A;  3AMZ A;  4IDI A;  5EE1 A;  2LHE A;  1FRD A;  2JYE A;  1KH0 A;  4Q2J A;  1SE2 A;  2KQ4 X;  1N5W A;  1N61 A;  1N62 A;  3AEA B;  3Q8C A;  1SIJ A;  1BXT A;  1WXQ A;  1QT9 A;  2QIE B;  2QMT A;  3B2F A;  3OWE B;  1FNU A;  2MH7 A;  2WXO A;  4YTM B;  4US8 A;  4DQO C;  5BYS A;  2W3R A;  2SAK A;  3SFD B;  3FIL A;  3NS1 A;  1TJE A;  1C9F A;  5C3J B;  1P7F A;  1QQR A;  5HG2 A;  2ONQ A;  2Q5W D;  3P63 A;  2V3N A;  3ABV B;  3J9C A;  4REZ A;  1TS3 A;  1SF0 A;  1TS4 A;  4USA A;  1HA5 A;  4KGT A;  4YSZ B;  3HUI A;  3NZ3 A;  1IUE A;  1F2R I;  1M4V A;  3MFG A;  2WXQ A;  2QIL A;  2G9H D;  2JZP A;  3VRA B;  5TSS A;  2RPV A;  3AN1 A;  4P16 A;  1SEB D;  4HJG E;  2XNA C;  1UUP A;  3IT4 B;  1TKE A;  1JWS D;  2JU6 X;  2DBY A;  1NYR A;  2WDR B;  2NTS A;  1TZO A;  3U7Z A;  1SJE D;  1FCL A;  1Q10 A;  1L5P A;  2Y3A A;  1MPE A;  1P7E A;  1DYQ A;  1F2R C;  1ROE A;  1ET9 A;  1OFF A;  2HTM E;  2QEJ C;  4PT5 A;  5D3D A;  4A9A A;  5HFY A;  2CU3 A;  5FK9 C;  1V1P A;  2N7J A;  2WDV B;  4C56 C;  2Y5C A;  2PLP A;  2W3S A;  3TEX A;  3GP7 A;  2PW9 A;  1VDV A;  3ZYY X;  1KF6 B;  2IGH A;  1LO5 D;  4WUR A;  1AN8 A;  4TQ1 A;  3I9V 1;  1J7B A;  1FIQ A;  4FXC A;  1TY2 A;  4ZHO A;  1FMA D;  5H92 C;  2PVO D;  5EE9 A;  4TSS A;  4ZOH C;  3W5V B;  1KLU D;  1DOX A;  1YJJ A;  1HZ5 A;  2K0P A;  1SBB B;  4YTP B;  5BYR A;  3IXS A;  2R61 A;  3PO0 A;  1FEH A;  3R2I A;  3VRB B;  1XLO A;  1HXY D;  2AQ1 B;  2D5G A;  3AE8 B;  1T5X D;  2V4I B;  4J3O D;  1PDX A;  3URY A;  2LEK A;  3W5U B;  2N0S B;  2W54 A;  2E3T A;  2ZW0 A;  4US9 A;  4HKQ A;  1RWS A;  1JWU D;  5FKA C;  3U52 E;  2V0G A;  1JQ4 A;  4MT5 A;  1TS5 A;  2OHF A;  1JW9 D;  4ITK A;  1HQR D;  2WP9 B;  4R3D A;  4RGT A;  4GLS C;  3AE5 B;  3EA6 A;  1E0Z A;  1KRH A;  3P4R B;  4YXD B;  2ICI A;  3B9J A;  2WXR A;  3ETR A;  3P4Q B;  1I4G A;  3KWL A;  2DYO A;  1L6V A;  3FC4 A;  4B0E A;  1D4B A;  2M0A A;  2KAJ A;  2BS3 B;  1VZ7 A;  4MH8 A;  1QIL A;  4RCO A;  5EE0 A;  3W9C B;  4KKJ A;  1XLQ A;  1XO3 A;  1V1O A;  1IGC A;  1WRI A;  2BW2 A;  3O13 A;  4JWS C;  3BVM A;  2K5P A;  4ZHP A;  2JWU A;  2WXF A;  4IOI E;  1OQR A;  3IAS 1;  4D2K A;  2NMQ A;  2H88 B;  4EE2 A;  1FD6 A;  3AEF B;  1HEZ E;  2WS3 B;  1V97 A;  3ZJV A;  1K53 A;  1L6U A;  3IT6 B;  2BYT A;  3U4E G;  5I4D A;  2QJL A;  1L0X B;  5EE3 A;  4C7Y A;  1A70 A;  1XCQ L;  3AE7 B;  4N59 A;  4JWU C;  4L2Y A;  4O1N A;  4OZB A;  5G5H A;  2IDY A;  1N63 A;  4TQ0 A;  2K3U A;  1ZXI A;  4KX6 B;  3P1M A;  4OVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...