1UWXA

P1.2 serosubtype antigen derived from n. meningitidis pora in complex with fab fragment
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
VTTYKLVINGKTLKGETTTKAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G-PRIME
publication title Structural Variation and Immune Recognition of the P1.2 Subtype Meningococcal Antigen.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Immune system
total genus 15
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1uwxA00
2JU6X 1QKZA 4KGSA 2I38A 2PTLA 1MPEA 2PLPA 2QSDA 2J52A 4GLSC 4OZBA 5HHDG 1F2RC 4D2KA 5HFYA 2N7JA 1YNTE 2RMMA 1HZ5A 1IGCA 2J53A 1FCLA 1XCTL 2KWDA 2NMQA 2LHDA 5JXVA 1K53A 4OZCA 3MP9A 2RPVA 2K0PA 2ZW1A 1MVKA 3FILB 2ONQA 4HJGE 1HZ6A 1K50A 1MHXA 2LGIA 3V3XA 2ON8A 3UI3A 2JZPA 2LUMA 1EM7A 4KGRA 1XF5L 2IGDA 1PGXA 2PW9A 3GB1A 4OZAA 1MI0A 1P7FA 1UWXA 2GB1A 5HI1A 1FCCC 1IGDA 2IGGA 4KGTA 1PGAA 3FILA 2ZW0A 1YMHE 1Q10A 2OEDA 2KACA 2KDMA 1C9FA 1D4BA 1GB4A 2N9LA 2QMTA 1K51A 1FD6A 1IBXB 2IGHA 2JWUA 5BMIA 1MHHE 1HEZE 2KQ4X 1XCQL 2LHEA 1GB1A 1P7EA 1ZXHA 4IOIE 1PGBA 2N9KA 4IKGA 2I2YA 4HKZE 2GI9A 2EELA 5BMGA 2JSVX 5BMHA 1K52A 1JMLA 5HG2A 4MACA 4WH4A 1IBXA 1F2RI 1KH0A 2KN4A 2JXTA
chains in the Genus database with same CATH superfamily
2PVGC 4DDGD 5KHQA 1E0ZA 2BKFA 3U2SC 5E6PA 3GE3C 1JWUD 3A1QB 5G55A 1N63A 3TSSA 2MBOA 1ZUD2 5D94A 3AE1B 1SSNA 3EFCA 3AI5A 1OGWA 3DBHB 4PS7A 3QHTA 4GDLA 2JRHA 3A9JB 1TTNA 3PREA 5MPOA 1HTQA 1L0XB 2SEBD 4N59A 4YT0B 2JPHA 1U4AA 2OJWA 4IM2A 1N61A 3SFEB 2KX3A 2HD5B 1C4AA 3BVZA 2DZMA 4ZRIA 1S1QB 5C1ZA 4CYEA 4C7ZA 1EWYC 1GG3A 2BBCA 3SU8X 1ZGUB 2WXMA 4CO7A 4LK0M 1L7YA 1WXVA 2KVRA 1JW9D 2ZCBA 3D32A 4W9IA 3QIJA 2MJEA 3VR9B 1K51A 1V1PB 4LNNA 1TS3A 4XE0A 1NVID 4USAA 2LHEA 4JWSC 4O1NA 1AW7A 5EE3A 4A8XC 1JWAD 2AL3A 4BOZB 2WNMA 1XD3B 4ARCA 4NNJB 3IAS1 2KMAA 2N1VA 1C3TA 1GNUA 3ZNID 4FJVB 2KK8A 4YSXB 2N1WA 1QKZA 4E71A 1L6UA 4KZCA 3R66C 4W9FA 4RCOA 2FUG1 2HJ8A 4S17A 3DBRI 2KNBA 2ZVNA 4GLSC 4W9HA 1IYFA 2NPTB 2WXLA 2K5PA 2ZNVB 3L54A 2W55A 3SR6A 1N6ZA 2Y5PA 2C7NB 3ALBA 3KW5B 3Q8FA 3RYTA 2MHJA 1ENFA 5IP4D 1C77A 4MEMA 3Q3OC 2R2OA 2K0PA 3FILB 4HJGE 1MHXA 4HK2A 1CMXB 1DOYA 4MH8A 4C00A 1ZW7A 4EKUA 5IO9A 4JGHB 1KF6B 2V3PA 4ZHPA 5IA7A 2LZ6A 2R61A 4M02A 4ACFA 3AEEB 2Y3AA 1P0RA 4GGQA 3BIID 4LNOA 1R4NB 1IGDA 1WI0A 1LFDA 2DZKA 5AUKA 1P1AA 2V4LA 1C9FA 3HHMA 3VQIA 2IGHA 4E74A 1WM2A 2BVCA 2RPQA 3A9JA 2O6VD 2W9NA 4KZ0A 2MJDA 5DCNA 5E6OA 1P7EA 1XEEA 2B3AA 4KIKA 3W5UB 2LVOA 4HKZE 2EELA 3CWIA 2GOWA 1QZEA 3W5VB 3AB5A 4JE3B 2KDBA 4B9KA 2JXTA 4YSZB 3AEDB 3HIZA 1T3QA 1AWDA 5AZFA 1ROEA 3DOWA 2KDEB 3V62A 3APCA 3N32A 5TR5A 4WJPA 2K1FA 4BFRA 2EKIA 1YQBA 1JQ4A 4JWUC 3MHZA 2MBHA 4NPNA 1H8CA 1E5WA 4FJZA 1CJEA 1WR6E 3BVMA 1KRHA 3RNEC 4XGAB 2KANA 1MG8A 1NYRA 3ZYYX 1C4CA 3ABVB 3BWUD 1YOVB 3VTVA 1XO3A 4MDKE 1ZDVA 4NY0A 2CU3A 4MT5A 2KDFB 3MTNB 1EU3A 4HXDA 1BUIC 2VH2A 2MQJA 1V49A 2MBBB 3AU5A 5D3IB 2LUEA 4US8A 2NR2A 1XF5L 3DVGY 1T0SC 4K3CA 2INNE 1WE6A 1MI0A 2GB1A 3RZWC 3GP7A 1FCCC 2NS5A 4N58A 4P16A 3T3OA 2ACZB 2PKOA 1TY0A 1YQ4B 2KDMA 1N60A 1VDVA 1E7UA 2BYTA 1I35A 2RDHA 1IBXB 1RLFA 3KQ4A 3SEBA 3DVNV 1WX8A 1WXAA 1J0GA 2ICIA 4G50A 3Q3FA 2L83A 4AP4C 2KDIA 2IO1B 5I4DA 2N9KA 2WWZA 2E6XA 2B76B 3ZNGC 2L32A 4W9JA 5IAAC 2JU6X 1QT9A 1NYQA 1RWSA 1UUPA 2ZEQA 3DBLB 4NAWA 3P2BA 2J7QB 2PTLA 2DYMA 3DDCB 4ANVA 3TIXA 3ZTCA 1GC6A 1M4VA 1TZ1A 1I4RA 3B2FA 4HCNB 1I4HA 2XNAC 2D07B 2KQSA 1E7VA 5EE1A 1OQRA 4RGMA 2WXPA 4RFBA 4KKJA 1FCLA 3AEBB 4HPLB 2I1JA 1WR1A 4G3XB 2NVUI 2MEKA 2PEAA 4IWOA 3FAHA 4PS8A 2MBQA 3OG5A 3R7QA 3WCQA 2RPVA 2IO2B 3TUOA 3ZGZA 3L13A 3VRBB 1MJDA 2FNJB 5LXIB 2AYOB 4EEWA 3VH3B 3V3XA 2KOXA 2KWVB 1VZ8A 1I4GA 4CHKA 1N5WA 2KYWA 1MFWA 2WLBA 3GZNB 4AUQC 1WX9A 3ONSA 2GBNA 1QF6A 1WXQA 2L7RA 2TSSA 2Z59B 2INPE 5LXHA 3DHGC 2XK5B 3DCGA 1SE2A 5DPWA 2WXQA 2IY1B 2KKCA 2LGYA 4HLEA 1J19A 4M8NA 4ANUA 3MJ5A 3NHEB 3PHXB 4L23A 3T8MA 2CHWA 4RH6A 4IKGA 1C78A 2HTHA 4W9CA 5LLIA 4NJ6A 1YN4A 2LJ5A 3MJWA 3RUIB 3M3JA 3SD5A 3CSTA 1VD2A 4LNIA 3VUWA 4MM3B 5AZHA 3ZNZB 3LYYA 3LJ3A 3NG0A 2REXA 2A4ZA 2QCZA 1SJHD 3B2GA 4RM8A 4LNKA 1V80A 3A4RA 1LXDA 3PLUA 1FXAA 4FHJA 3QX1A 2N7JA 2BS2B 3VR8B 2L05A 1FO4A 4AOFA 1EF1A 2V1YA 2J53A 1OEYJ 1DOXA 1SJED 4TQ0A 1UD7A 1KTKA 1XLQA 5IOIA 1R4MI 1F1HA 4XZ4A 4KKIA 2AWTA 4P1BC 2BGFA 1TKEA 1K8RB 2C5LC 3JSVA 3ZUNA 4DXAB 2HDEA 4JX1C 4RNAA 1TBEA 5D6JB 3UI3A 3RN9C 3U52E 3IG3A 3OJ3A 2N9EB 3ZJUA 4FULA 3C19A 1YJJA 2K25A 2YVCA 4KGTA 4JQWC 1PFDA 3KWLA 4W9GA 2KAJA 1RFKA 5IKCM 2RR9A 1IUEA 4ZRJA 2GBKA 2QMTA 5EE0A 1MG4A 3EA6A 3AH7A 2Z8LA 3TMPB 4TKNA 1VLBA 1OQYA 2RGFA 3DQVA 2LVPA 2Q5WD 2LRWA 4FADA 5C23A 5H92C 1Q5WB 1NENB 1ZXIA 3PHWB 1V81A 2L00B 1J7AA 3V6CB 4NQKE 2M0XA 4LLGM 2BYVE 3BK1A 3V60A 1FNWA 4XDDA 4HDQA 4ARIA 1V8CA 2IZVB 4D2KA 1ZOYB 3Q8EA 4BKGA 4LDTB 2KC2A 2XK5A 2D3GA 2C7MB 1HZ5A 4ZYSA 4YTPB 2BTEA 2J0KA 1I4QA 2UWQA 5C2TB 2JT4B 3ML9A 2WXFA 1SIFA 2M17A 2L52A 1K50A 2JYEA 1NEKB 2FCSA 2CJNA 4J6IA 4MM3A 2DENB 4J3OD 3OJ4B 2QIEB 2QJLA 2HJ1A 1DYQA 1TYGB 3DVGX 3BINA 2MA9B 1PGXA 1VCBA 4P1CC 4KIKB 3ZXVA 2JYTA 2PJHA 3RMKC 4FHKA 2WX1A 4X57B 1FEHA 1YMHE 4GSWA 1DOIA 3BYTB 1QILA 5BYSA 1VJKA 3I9V1 3RD2A 2KQ7A 1TKYA 3L0WB 1PUTA 3LB8C 2VZKB 1AYFA 2FBWB 3V05A 2KLGA 1JRPA 2UYZB 4LCDE 1DGJA 3VXWA 3TEWA 2VRRB 1FXTB 3TEZA 2GI9A 4MGKE 1BT0A 1L5PA 2C60A 4K3BA 4F7ZA 4QAYA 2KD0A 2GLSA 2OHFA 3NJTA 4MH0E 3UF8A 4KGSA 4W9LA 1T0RC 4DK5A 1UWMA 2V4IB 3M62B 5J18A 2BB5A 3ZKJC 2PE6B 2ZVOA 3RI7C 1Z2MA 4Q2JA 1FNUA 3NS1A 4ANWA 1Q0WB 1D6EC 2K6DB 4W9KA 2LASA 1QOFA 3SHQA 1WGRA 2MP2B 2JWZA 4M0WA 4WJNA 3P1MA 1M94A 2LHDA 5JXVA 1K53A 4AJYB 2FCNA 4OZCA 2XN9C 1KFYB 3M63B 3CSFA 5D2MB 5BYQA 1TY2A 3RFZB 3Q2AC 4JIOU 4A3OA 2CU1A 1UH6A 3A33B 3PSEB 1E9MA 4GU2A 3TJPA 4UDUC 3DHHC 3U7ZA 3VH4B 3O13A 1TKGA 2N0SB 1WJ4A 4B0MA 3EECA 1P7FA 4R3DA 4C4VB 1WFYA 4LNFA 2WXHA 1B9RA 3CF6E 4JLCA 3JW0X 2KACA 3DBSA 2L8JA 1T6BX 1B1ZA 3AEGB 2WS3B 1YQ3B 1JWBD 4NAWB 3H7SA 4C80A 4HPMB 1V2YA 2K3UA 2KQ4X 3HVZA 3L10B 2O2VB 4DBGA 1VZ7A 1T0YA 1NI2A 2N4FA 1OEYA 1I4PA 1HE8A 2A5UA 1FPYA 1FXIA 1AN8A 4OVVA 4HPPA 3RNCC 2IBIB 1PQSA 3N20C 4OVZA 1F2RI 2FCMA 3L4PA 1FIQA 3N1ZC 2AX5A 3U4EG 1RAXA 4GOCA 4WJQA 2M0AA 2QDFA 3H6NA 1FMAD 4ZRPA 3ML8A 3PRMB 2L76A 2EMTA 3QQ8B 2WDRB 5JH5C 3NOBA 1Q1OA 5BO4B 1FRDA 2M8SA 3KH0A 3VFKA 3RCZA 2G3QB 2IJ0A 4RGTA 4II3B 2K8HA 2JZZA 4NAMA 2SAKA 2DHZA 2RDBC 1WF9A 4CQNA 3ZVVA 1HA5A 5CHVC 3AE9B 2GBMA 2PE9A 1E8WA 1E7PB 1L4DB 2WDQB 2ZW1A 2E3TA 2CHZA 2ZPNA 1KLVA 2G4SA 4WJOA 3ZRFA 2KVZA 1SEBD 2MBEA 4L1BA 3T9LA 3KUDB 3NS8A 4FBJB 1SIJA 1ZPSA 3PRPB 4YTNB 3WAPA 1WRIA 2IGDA 1CZPA 1YN3A 4WIPA 1X1MA 4LJPB 2DLBA 4ASWC 3VVWB 2C7HA 3FKYA 2Z0EB 1J7BA 3BK2A 2N7DA 3W1SC 3AM9A 2D5GA 2WYQA 4OHJA 5CHFA 4WWPA 1Q10A 3A4SC 2LGSA 3DHIC 1I42A 4E3CA 1WYWB 2ZZPB 4OVUA 3APDA 3PV1A 4GXBA 4BVUC 3WAOA 2MP2A 4GIVA 3PTFC 3QCAA 1WJ6A 4BKSD 3NVWA 1GJZA 4HJKA 1UGJA 2D3BA 2K8CA 2GBRA 4MACA 4WH4A 1E8ZA 4PYUA 3VUXA 3ZTDA 4IM3A 1LM8B 1JALA 3HVDA 1T5XD 3E9SA 3EFUA 3AECB 1KOTA 2LXCA 4JPSA 4KDIC 4C4VA 2M1MA 4MSQB 3JSVB 1FNVA 2H89B 4ZYNA 1TS2A 2L1AA 2WU5B 3MFGA 2BQQA 1N5XA 4ZRKA 4BBNC 2CJOA 2KWDA 4BKTA 3P4SB 4FLHA 3URYA 2O2VA 1ET6A 3J9CA 1IP9A 5HKHA 2I1KA 3L16A 5FR3A 1JWMD 2MW5A 2IPKD 2WXKA 3AMZA 2HE7A 3HRDD 1QQRA 3VUYA 1EM7A 4FXCA 3RNAC 2KT7A 3IXSA 1D3ZA 2K9XA 2X8XX 4REZA 1LQBA 4DQOC 1D5MC 4RM9A 5E6JA 1D4BA 4MJSB 2M4NA 2AQ2B 3L08A 3R7RA 4RGNA 4EFOA 3AE6B 2ZJDA 2M56B 1EWCA 1OQQA 2K8BA 3TBLD 2KO3A 3KYCD 3WIMA 1ZP0B 2KN5A 2CHXA 4DXGA 1WE7A 2JSVX 5BMHA 1P3QU 4OW0A 4TQ1A 2KHWB 2PPHA 4HVBA 1R4MB 1N62A 1V5TA 4B0EA 1C79A 1E8YA 1WGHA 4GDKA 2BYFA 2GBJA 1C76A 1PDXA 4I6LB 1JRUA 2INCC 1KLGD 4FN2A 3VAWA 2RSUA 1KJTA 1WGDA 5C3JB 3NVYA 3JVZX 3SFDB 2KLCA 3ZJVA 2DNFA 5D3DA 1GOZA 1V6EA 4M00A 3TCAA 2YLMA 5E6NA 4ANXA 2KTFA 3WAMA 1WJUA 2XEWA 3OAWA 2V9HA 4XX5A 4ICUA 1HZ6A 4DHJB 2M19A 1FFUA 3V61A 2LGIA 2UU7A 1ZKHA 3GS2A 1R7SA 2ON8A 3GOEA 2V3NA 3Q69A 1YJ1A 4KGRA 4B95A 4NZLB 1UZXB 2O6VA 4WQMA 1H4RA 4L2YA 5AZGA 2WXIA 4IM0A 4A3PA 2RD0A 4URKA 2JRIB 1TT5B 3HM6X 4DXFA 4K7SA 4ITKA 5EE9A 2ZW0A 3TEYA 3QK0A 3KUCB 1UNSA 5CHWA 3B0AA 2MX2A 4LDTD 1QLBB 2N7EA 2JWUA 4A55A 2DZIA 5BMIA 1WWTA 1WJNA 3AV8A 2FAZA 1F77A 2CS4A 1EO6A 2JX5A 3CIRB 1V86A 2LXAA 3QWZB 3PZ8A 1HTOA 3VHTC 4EE2A 3AE2B 1ISNA 2NTTA 3UQAA 2PVOD 3NZ3A 3R8BA 3AE4B 1T0QC 4C7YA 1YX6B 2JF5A 4M0WB 3R2IA 4GMVA 2D3AA 4AJWA 4BZAA 3CMMB 3ZNHB 4F8CB 2PLPA 2KC1A 3B1LX 3UIOB 1CK1A 4EUTA 4WURA 3W1YA 2LGDA 2OJRA 2QHOA 2ZPYA 1BMLC 5HHDG 1Y56A 1F9JA 1F2RC 1WMHA 3IVFA 2DYOA 3QJZA 4MJSA 2ZCCA 1IGCA 3AEFB 4WWNA 3W9CB 2VZKD 2KWCA 1XCTL 4F1SA 1J8CA 2XBBC 4ZRQA 2GMIC 3P63A 2ZNVC 3H8HA 3Q3JA 1FM0D 1V97A 1GPXA 4B6WA 4TUUA 1AARA 3X23A 3B08A 1UBIA 4FJYA 3ZQ4A 3VRAB 2H88B 2WDTB 2WQYB 3W1SA 2KJHB 2BT6A 1VR9A 4IG7B 2DX5B 3EGRA 5TSSA 4BBNF 3ZDMC 3WALA 2BF8B 2JZ3B 1RRBA 2LD9A 2Z0DB 5DPSA 3A9KA 3MC9A 1XCQL 1GB1A 1L4ZB 2BS3B 4EZKA 3ETRA 2MWSB 1E8XA 2I2YA 1XQQA 1TS4A 1WGYA 4EZLA 1SE9A 1ESFA 4RF1A 3QAQA 2KFKA 1C1YB 3RPFC 2MCNB 3DBRB 5D7GA 3Q8AA 1KH0A 2D11A 4AQ7A 4XDCA 3PZ7A 3Q14C 4HCPB 2WXNA 5JHAA 1SE4A 2Y5BB 1WIAA 3VTUA 4C56C 2X38A 5DPTA 1SB3C 2HTME 1WGKA 4ZHOA 1YNTE 4MGYE 3DPDA 3NZSA 4PT5A 2KMMA 2QEJC 4HDOA 3EHVA 3KLSX 2D3CA 1WZ3A 2NMQA 3H9DA 2WX0A 3R2TA 1MVKA 2AL6A 2W3RA 1YX5B 2BKRB 3PZDA 1QOGA 2IDYA 4NJ7A 2DWQA 3P4PB 4YWGG 1XLNA 2L0TA 4AS1A 2JQRB 4RMAA 4K81A 5EDSA 5LNK1 4KX6B 2AQ3B 3DBHI 3EC8A 3ENEA 5JZEB 2IGGA 4KSLC 3PS6A 1SBBB 4KV2A 2LI5A 2G1EA 1SE3A 3MC8A 4DHZB 4A9AA 2LRUA 2N9LA 2KWUB 2LWPA 1FRRA 1SGHA 1TJEA 1A5RA 3NVVA 4IWQA 3V6EB 3N1YC 5T8IA 1TIFA 2FUHB 3RT3B 4JL9A 1JROA 3NUHB 2PMVA 3Q8CA 5H8YE 3AE7B 1K52A 3OLMD 4LTUA 1I4XA 2BWES 4XYCA 3I57A 1WX7A 2BB6A 1OTRB 4KVGB 2J52A 2N9PC 1V1OA 1WXSA 2LGXA 2LEKA 4KSKC 5DPRA 3IT6B 2R2QA 2EMSA 3ZRCA 2MLBA 4WQOB 2FE8A 1WRDB 3BZDB 1ACCA 2W82A 5HFYA 3AU4A 3WA0A 3RNGC 2QILA 4WWMA 4ZOHC 2WXGA 2DYBA 4GB9A 1YD8U 1CQVA 1ZDXA 3IBEA 2LJIA 4GN1A 2GRIA 3VTWA 2BPSA 2JXXA 3A1QA 3N30A 3MP9A 4N6EB 1C4PA 2DAFA 3P42A 1TGZB 1WGGA 1WZ0A 2J42A 2J0JA 3VDZA 1D5XC 3PO0A 2NBWB 3PT2B 4LJOB 4OZAA 1Y8RC 3UGBB 4HKQA 3P4RB 1WSPA 2W3SA 3MHSD 2D2QA 4G11A 3TEXA 1LO5D 2K39A 3Q3MC 4XWWA 3RNFC 4FA6A 1RM6C 3PVLA 3HUIA 1G6JA 4W9DA 3PGEA 4GDKB 4II2B 2AQ1B 3FC4A 4IOIE 2JY6A 1PGBA 5JHBA 3WANA 2ASQA 1WYGA 2NCNA 2WHIA 3IAM1 3LXFA 5HG2A 4EZJA 1GC7A 3JYUA 4YSYB 1A70A 1EU4A 2WXRA 1R4NI 3KUZA 1V1PA 2IY0B 2WP9B 3NRZA 3H7PB 2MRPA 2I38A 1XT9B 3DWMA 1GUAB 1ET9A 1QOBA 3P4QB 2K22A 3KYDD 3Q6BA 3QC8B 3S2AA 4YXDB 2G45B 1XLPA 1YN5A 4ZDVA 4HROA 2G4DB 4M8MA 3BY4B 2KMCA 1EF5A 2O6VB 3APFA 3DWGC 5G5HA 3HK0A 2DZJA 4US9A 1YJIA 2L0FA 2NPTA 2ONQA 3PPAA 2KTRB 4BAXA 3ZXRA 4WAFA 2KFJA 3ZLZA 4H2AA 2W54A 2JZPA 3TL5A 3HM3A 3ZIMA 2KJ6A 2LUMA 4DWFA 2PW9A 3EUB2 2C9WB 2PIAA 2LVQA 5FR6A 4YL8A 2FCQA 3L17A 3FILA 1KLUD 3ZJTA 3RULA 2G9HD 1IPGA 2OEDA 2AEHA 4TV3A 1UF0A 1WXMA 3Q3NC 4WWOA 5FK9C 4PK1A 1KM7A 1MHHE 5G2NA 5BYRA 5J2RA 1LGRA 1SXTA 5FKAC 1BXTA 2BYEA 4NJCA 3M95A 4DHJD 1I7HA 1WMHB 2Y5CA 1S3SG 3UQBA 3AE3B 2VH1A 2WGSA 3RNBC 1L0YB 1MPEA 3AE5B 1UELA 1VRAB 5KHOA 1D5ZC 3C0RB 5GXGB 4OZBA 1NDDA 1XXGA 3IT4B 4NQLB 2QC8A 2DBYA 5AEKB 2IO3B 4HRSA 3IHPC 5G5GA 4A20A 4IWPA 1HQRD 2JUOA 3X0WA 5CX3A 1F52A 3N9YC 1YIWA 3BYYB 3NY5A 2D10A 3DBLI 1UBQA 4YTMB 3I5JC 4P6VF 2J4XA 2WDVB 3DVNU 3AEAB 2BS4B 3GE8C 1PYWD 2J0MA 2KJRA 2KX0A 1TS5A 2RDGA 4RGOS 3AXCA 3K9OB 4ICVA 4I6NB 1J7CA 4MGIE 3AE8B 1E10A 3A9KB 5GMVA 3U30A 3H1UA 3ZO5B 5AUIA 3B9JA 3ZDTA 3H7PA 3N3KB 3C8YA 1QOAA 3PRZA 4RF0A 1L2NA 1UWXA 1WM3A 2FIFA 2INDC 4TMAB 4N9F4 1P9DU 2IO0B 2KFKB 3O65B 4PS3A 4W9EA 1UGMA 4AWJA 1E6EB 4GDLB 4IUMB 1FD6A 4K7UA 1ZE3D 2WXJA 4HEA1 2YEPB 2LMCA 3E56A 1OFFA 1FFVA 1RFAA 1SF0A 3R3MA 4IC7B 3KVFB 3W2DA 3I63C 2CKHB 3PLVA 3GZNI 1V9JA 2MJ3A 5BMGA 2V0GA 3NZUA 2L3ZA 4A90A 1Z5SB 3SDLC 2FIDA 2KTRA 3QARA 1IBXA 4MSMB 1F0ZA 1P98A 2KXJA 1EUVB 5L83A 2QSDA 3RZFA 2NBUA 3Q8BA 3KWVA 2MSED 3K9PB 4WAAA 2OOBB 2JVCA 4EOYA 4G0NB 4XC2A 4DHZE 1E90A 2KZRA 3OWEB 1HXYD 2N9XA 2RMMA 2EKEC 2K6QA 4S0RA 1STEA 4M01A 3U8ZA 3T3NA 1VZ6A 1JCKB 4A6QA 5L95C 1L0VB 2CR5A 2V3SA 4MELA 4BOSC 4MGZE 2MH7A 3QA8A 1TZOA 1WH3A 3BVGA 4K7WA 4DDID 3N1XC 2LFIA 5IN7A 2DAJA 4KDLB 4K1RB 3UIPB 3ECIA 4TSSA 1GAQB 2BWFA 3GB1A 4P7IA 3NVZA 4BKSA 2WXOA 3LDZE 5HI1A 2NBVB 4PYZA 4IDIA 1PGAA 2BW2A 4I6PA 1RYJA 4HWIB 5CTRC 1GB4A 3ZW3A 2IYDB 1JWSD 4XWTA 1V5OA 3U7DA 2YEPF 2WU2B 1XLOA 1HEZE 1NI3A 3IFWB 5J17A 3I3TB 3AULA 2NTSA 3MC0B 1ZXHA 4IW0A 1NBFC 1L6VA 3UINB 1JMLA 1WY8A 2KN4A 3AN1A
chains in the Genus database with same CATH topology
3LYYA 2PVGC 3I57A 1JALA 1E0ZA 2BB6A 1SJHD 3HVDA 1T5XD 2J52A 3B2GA 3E9SA 3U2SC 1V1OA 3AECB 1JWUD 1N63A 2LEKA 4JPSA 3TSSA 3IT6B 1ZUD2 3AE1B 1SSNA 1FXAA 5HFYA 2FE8A 1FNVA 1ACCA 2H89B 1TS2A 2N7JA 2BS2B 2W82A 2L1AA 2WU5B 3BZDB 3VR8B 1FO4A 3MFGA 1N5XA 2J53A 5MPOA 2QILA 4WWMA 2CJOA 2KWDA 1DOXA 1L0XB 4ZOHC 3P4SB 1SJED 2SEBD 2WXGA 4N59A 4YT0B 1ET6A 3J9CA 3URYA 4TQ0A 1KTKA 1CQVA 1XLQA 1ZDXA 2LJIA 2GRIA 3MP9A 4N6EB 4KKIA 1N61A 1TKEA 3SFEB 1C4PA 5FR3A 1JWMD 2IPKD 3P42A 2WXKA 1C4AA 3AMZA 2HDEA 4JX1C 4RNAA 3HRDD 1QQRA 3BVZA 3UI3A 3U52E 2J42A 4C7ZA 1EM7A 1EWYC 4FXCA 1D5XC 3PO0A 3IXSA 2BBCA 3ZJUA 2K9XA 4OZAA 2WXMA 4HKQA 4LK0M 1YJJA 3P4RB 1WSPA 4KGTA 2W3SA 4REZA 3TEXA 1PFDA 1LO5D 4DQOC 4XWWA 1JW9D 1D5MC 3KWLA 2KAJA 1RM6C 5E6JA 1D4BA 1RFKA 2MJEA 1IUEA 3VR9B 2QMTA 2AQ2B 5EE0A 1K51A 3HUIA 1V1PB 1TS3A 4RGNA 3EA6A 3AH7A 4GDKB 3AE6B 4XE0A 1NVID 2M56B 2Z8LA 1EWCA 1OQQA 4USAA 2LHEA 1VLBA 2AQ1B 3FC4A 4IOIE 1PGBA 4JWSC 4O1NA 1AW7A 1ZP0B 5EE3A 4A8XC 2Q5WD 1JWAD 2WNMA 4DXGA 1WYGA 2JSVX 5BMHA 4ARCA 3IAM1 3LXFA 5HG2A 3IAS1 5H92C 1NENB 4OW0A 4TQ1A 4YSXB 4YSYB 1A70A 1EU4A 2WXRA 1N62A 1V1PA 1QKZA 1ZXIA 2WP9B 3NRZA 1C79A 4B0EA 1L6UA 1J7AA 2I38A 3DWMA 4RCOA 2FUG1 1C76A 1PDXA 1ET9A 1QOBA 3P4QB 4LLGM 2K22A 3BK1A 1KLGD 4GLSC 2WXLA 1FNWA 2K5PA 4XDDA 5C3JB 4YXDB 3NVYA 4ARIA 2W55A 1V8CA 3SFDB 3SR6A 1XLPA 1YN5A 4D2KA 3ZJVA 1ZOYB 3Q8EA 4HROA 5D3DA 1GOZA 2Y5PA 1HZ5A 4ZYSA 3Q8FA 4YTPB 1ENFA 2BTEA 1C77A 3DWGC 5G5HA 1I4QA 4US9A 5C2TB 1YJIA 2WXFA 2K0PA 3FILB 2L52A 2ONQA 4HJGE 1HZ6A 1K50A 2JYEA 2M19A 1FFUA 1MHXA 1NEKB 1DOYA 2LGIA 2CJNA 4MH8A 3GS2A 4WAFA 1R7SA 4H2AA 2ON8A 4J3OD 1KF6B 2V3PA 2W54A 2V3NA 4ZHPA 3Q69A 2JZPA 2QIEB 2QJLA 2R61A 1DYQA 1TYGB 2LUMA 3AEEB 4KGRA 2Y3AA 4NZLB 4WQMA 1PGXA 4L2YA 2PW9A 2WXIA 3EUB2 2PIAA 3BIID 2JYTA 1IGDA 4DXFA 5AUKA 3FILA 1KLUD 4ITKA 5EE9A 2ZW0A 3ZJTA 3TEYA 1FEHA 2G9HD 1YMHE 2OEDA 1C9FA 1DOIA 1UNSA 3BYTB 1QILA 1QLBB 3VQIA 2IGHA 2JWUA 4A55A 1VJKA 5BMIA 5BYSA 3I9V1 1TKYA 5FK9C 1WWTA 1PUTA 1MHHE 3LB8C 2VZKB 3AV8A 1AYFA 2FBWB 3V05A 2MJDA 5BYRA 1F77A 1P7EA 1SXTA 1JRPA 5FKAC 1XEEA 1BXTA 2JX5A 4NJCA 3CIRB 1DGJA 3TEWA 3W5UB 3PZ8A 4HKZE 3TEZA 2GI9A 2EELA 3CWIA 4EE2A 1I7HA 3AE2B 1L5PA 3W5VB 2Y5CA 2NTTA 3AB5A 2PVOD 3NZ3A 3R8BA 3AE4B 3AE3B 4JE3B 2OHFA 2JXTA 4YSZB 3AEDB 4C7YA 1L0YB 1T3QA 3R2IA 1AWDA 4KGSA 1ROEA 1MPEA 2PLPA 3AE5B 1CK1A 1VRAB 1D5ZC 4WURA 1UWMA 2V4IB 5GXGB 2BB5A 2EKIA 4OZBA 1XXGA 1BMLC 1JQ4A 3IT4B 5HHDG 4JWUC 1Y56A 1F2RC 2DBYA 3MHZA 4Q2JA 1FNUA 3NS1A 4HRSA 5G5GA 1D6EC 2DYOA 1CJEA 1QOFA 1IGCA 3BVMA 1HQRD 3AEFB 4M0WA 1KRHA 2VZKD 3W9CB 1XCTL 1NYRA 3P1MA 3N9YC 3ZYYX 1C4CA 2LHDA 5JXVA 3BYYB 1K53A 3ABVB 3BWUD 4OZCA 4YTMB 2XN9C 1XO3A 4P6VF 1KFYB 1ZDVA 2J4XA 2WDVB 3AEAB 2BS4B 1PYWD 4ZRQA 2CU3A 5BYQA 1TY2A 1TS5A 2RDGA 4MT5A 3RFZB 4RGOS 1EU3A 3P63A 3H8HA 1FM0D 1E9MA 1BUIC 1V97A 1GPXA 1J7CA 4UDUC 3AE8B 1E10A 5D3IB 4US8A 5AUIA 3U7ZA 3B9JA 3O13A 1XF5L 1TKGA 3VRAB 3ZQ4A 2H88B 2WQYB 3W1SA 2N0SB 3C8YA 1QOAA 4RF0A 2INNE 4B0MA 1MI0A 1P7FA 1UWXA 2GB1A 4R3DA 3GP7A 1FCCC 1VR9A 2BT6A 4N58A 4P16A 4TMAB 2WXHA 3T3OA 1B9RA 2ACZB 3EGRA 2PKOA 5TSSA 1TY0A 1YQ4B 2KACA 2KDMA 1N60A 1VDVA 1E6EB 4GDLB 1T6BX 2BYTA 1B1ZA 3AEGB 2WS3B 1YQ3B 2RDHA 1FD6A 1IBXB 1JWBD 1ZE3D 4NAWB 3KQ4A 2WXJA 4C80A 4HEA1 2YEPB 2LMCA 3SEBA 3E56A 1OFFA 2K3UA 1FFVA 2KQ4X 3HVZA 2ICIA 1SF0A 1VZ7A 1XCQL 1GB1A 1L4ZB 2L83A 2BS3B 5I4DA 2N9KA 3ETRA 3W2DA 2I2YA 1TS4A 2E6XA 1I4PA 2B76B 2MJ3A 5BMGA 2V0GA 1ESFA 2L32A 1FXIA 4RF1A 1AN8A 4A90A 3RPFC 4OVZA 1F2RI 3L4PA 1FIQA 5D7GA 2AX5A 1KH0A 3Q8AA 3U4EG 4AQ7A 1IBXA 2JU6X 1QT9A 1NYQA 1RWSA 1UUPA 2M0AA 4XDCA 1F0ZA 1FMAD 2PTLA 3PZ7A 4ZRPA 2WXNA 2QSDA 2DYMA 2WDRB 3Q8BA 1FRDA 3KWVA 1M4VA 1SE4A 1I4RA 3B2FA 1I4HA 2XNAC 4C56C 2X38A 1SB3C 2HTME 2IJ0A 1WGKA 4RGTA 4ZHOA 1YNTE 5EE1A 4NAMA 2SAKA 3OWEB 1OQRA 4CQNA 4RGMA 1HXYD 2RMMA 2WXPA 1HA5A 4RFBA 4PT5A 2KMMA 2QEJC 4KKJA 1FCLA 3AE9B 3AEBB 3KLSX 1STEA 3T3NA 2NMQA 1VZ6A 2MEKA 1JCKB 1E7PB 4A6QA 1L0VB 3FAHA 1L4DB 3WCQA 3R2TA 2RPVA 2WDQB 2ZW1A 1MVKA 2E3TA 2W3RA 3TUOA 3ZGZA 2MH7A 3VRBB 1TZOA 1QOGA 2IDYA 2DWQA 3P4PB 4YWGG 3V3XA 1XLNA 1SEBD 1VZ8A 3BVGA 2LFIA 4L1BA 1I4GA 1N5WA 4AS1A 2WLBA 4TSSA 1SIJA 1GAQB 1ZPSA 2JQRB 4YTNB 1WRIA 5LNK1 4KX6B 2IGDA 1CZPA 2AQ3B 1YN3A 3GB1A 4WIPA 3NVZA 2DLBA 1QF6A 1WXQA 2WXOA 2TSSA 5HI1A 2IGGA 4IDIA 1PGAA 3BK2A 1J7BA 2BW2A 3AM9A 2INPE 2D5GA 1SBBB 4OHJA 1RYJA 2G1EA 1Q10A 1SE3A 1GB4A 4A9AA 1SE2A 2N9LA 2WXQA 1FRRA 1JWSD 1TJEA 4XWTA 2YEPF 3NVVA 2WU2B 1XLOA 1HEZE 1NI3A 5T8IA 3MJ5A 2NTSA 3MC0B 4L23A 3NVWA 1ZXHA 1JROA 4RH6A 1UGJA 4IKGA 1C78A 3NUHB 2PMVA 3Q8CA 1L6VA 5H8YE 1YN4A 3AE7B 1K52A 1JMLA 4MACA 4LTUA 4WH4A 4MM3B 1I4XA 2KN4A 3AN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JU6 X;  1QKZ A;  4KGS A;  2I38 A;  2PTL A;  1MPE A;  2PLP A;  2QSD A;  2J52 A;  4GLS C;  4OZB A;  5HHD G;  1F2R C;  4D2K A;  5HFY A;  2N7J A;  1YNT E;  2RMM A;  1HZ5 A;  1IGC A;  2J53 A;  1FCL A;  1XCT L;  2KWD A;  2NMQ A;  2LHD A;  5JXV A;  1K53 A;  4OZC A;  3MP9 A;  2RPV A;  2K0P A;  2ZW1 A;  1MVK A;  3FIL B;  2ONQ A;  4HJG E;  1HZ6 A;  1K50 A;  1MHX A;  2LGI A;  3V3X A;  2ON8 A;  3UI3 A;  2JZP A;  2LUM A;  1EM7 A;  4KGR A;  1XF5 L;  2IGD A;  1PGX A;  2PW9 A;  3GB1 A;  4OZA A;  1MI0 A;  1P7F A;  1UWX A;  2GB1 A;  5HI1 A;  1FCC C;  1IGD A;  2IGG A;  4KGT A;  1PGA A;  3FIL A;  2ZW0 A;  1YMH E;  1Q10 A;  2OED A;  2KAC A;  2KDM A;  1C9F A;  1D4B A;  1GB4 A;  2N9L A;  2QMT A;  1K51 A;  1FD6 A;  1IBX B;  2IGH A;  2JWU A;  5BMI A;  1MHH E;  1HEZ E;  2KQ4 X;  1XCQ L;  2LHE A;  1GB1 A;  1P7E A;  1ZXH A;  4IOI E;  1PGB A;  2N9K A;  4IKG A;  2I2Y A;  4HKZ E;  2GI9 A;  2EEL A;  5BMG A;  2JSV X;  5BMH A;  1K52 A;  1JML A;  5HG2 A;  4MAC A;  4WH4 A;  1IBX A;  1F2R I;  1KH0 A;  2KN4 A;  2JXT A; 
#chains in the Genus database with same CATH topology
 2PVG C;  4DDG D;  5KHQ A;  1E0Z A;  2BKF A;  3U2S C;  5E6P A;  3GE3 C;  1JWU D;  3A1Q B;  5G55 A;  1N63 A;  3TSS A;  2MBO A;  1ZUD 2;  5D94 A;  3AE1 B;  1SSN A;  3EFC A;  3AI5 A;  1OGW A;  3DBH B;  4PS7 A;  3QHT A;  4GDL A;  2JRH A;  3A9J B;  1TTN A;  3PRE A;  5MPO A;  1HTQ A;  1L0X B;  2SEB D;  4N59 A;  4YT0 B;  2JPH A;  1U4A A;  2OJW A;  4IM2 A;  1N61 A;  3SFE B;  2KX3 A;  2HD5 B;  1C4A A;  3BVZ A;  2DZM A;  4ZRI A;  1S1Q B;  5C1Z A;  4CYE A;  4C7Z A;  1EWY C;  1GG3 A;  2BBC A;  3SU8 X;  1ZGU B;  2WXM A;  4CO7 A;  4LK0 M;  1L7Y A;  1WXV A;  2KVR A;  1JW9 D;  2ZCB A;  3D32 A;  4W9I A;  3QIJ A;  2MJE A;  3VR9 B;  1K51 A;  1V1P B;  4LNN A;  1TS3 A;  4XE0 A;  1NVI D;  4USA A;  2LHE A;  4JWS C;  4O1N A;  1AW7 A;  5EE3 A;  4A8X C;  1JWA D;  2AL3 A;  4BOZ B;  2WNM A;  1XD3 B;  4ARC A;  4NNJ B;  3IAS 1;  2KMA A;  2N1V A;  1C3T A;  1GNU A;  3ZNI D;  4FJV B;  2KK8 A;  4YSX B;  2N1W A;  1QKZ A;  4E71 A;  1L6U A;  4KZC A;  3R66 C;  4W9F A;  4RCO A;  2FUG 1;  2HJ8 A;  4S17 A;  3DBR I;  2KNB A;  2ZVN A;  4GLS C;  4W9H A;  1IYF A;  2NPT B;  2WXL A;  2K5P A;  2ZNV B;  3L54 A;  2W55 A;  3SR6 A;  1N6Z A;  2Y5P A;  2C7N B;  3ALB A;  3KW5 B;  3Q8F A;  3RYT A;  2MHJ A;  1ENF A;  5IP4 D;  1C77 A;  4MEM A;  3Q3O C;  2R2O A;  2K0P A;  3FIL B;  4HJG E;  1MHX A;  4HK2 A;  1CMX B;  1DOY A;  4MH8 A;  4C00 A;  1ZW7 A;  4EKU A;  5IO9 A;  4JGH B;  1KF6 B;  2V3P A;  4ZHP A;  5IA7 A;  2LZ6 A;  2R61 A;  4M02 A;  4ACF A;  3AEE B;  2Y3A A;  1P0R A;  4GGQ A;  3BII D;  4LNO A;  1R4N B;  1IGD A;  1WI0 A;  1LFD A;  2DZK A;  5AUK A;  1P1A A;  2V4L A;  1C9F A;  3HHM A;  3VQI A;  2IGH A;  4E74 A;  1WM2 A;  2BVC A;  2RPQ A;  3A9J A;  2O6V D;  2W9N A;  4KZ0 A;  2MJD A;  5DCN A;  5E6O A;  1P7E A;  1XEE A;  2B3A A;  4KIK A;  3W5U B;  2LVO A;  4HKZ E;  2EEL A;  3CWI A;  2GOW A;  1QZE A;  3W5V B;  3AB5 A;  4JE3 B;  2KDB A;  4B9K A;  2JXT A;  4YSZ B;  3AED B;  3HIZ A;  1T3Q A;  1AWD A;  5AZF A;  1ROE A;  3DOW A;  2KDE B;  3V62 A;  3APC A;  3N32 A;  5TR5 A;  4WJP A;  2K1F A;  4BFR A;  2EKI A;  1YQB A;  1JQ4 A;  4JWU C;  3MHZ A;  2MBH A;  4NPN A;  1H8C A;  1E5W A;  4FJZ A;  1CJE A;  1WR6 E;  3BVM A;  1KRH A;  3RNE C;  4XGA B;  2KAN A;  1MG8 A;  1NYR A;  3ZYY X;  1C4C A;  3ABV B;  3BWU D;  1YOV B;  3VTV A;  1XO3 A;  4MDK E;  1ZDV A;  4NY0 A;  2CU3 A;  4MT5 A;  2KDF B;  3MTN B;  1EU3 A;  4HXD A;  1BUI C;  2VH2 A;  2MQJ A;  1V49 A;  2MBB B;  3AU5 A;  5D3I B;  2LUE A;  4US8 A;  2NR2 A;  1XF5 L;  3DVG Y;  1T0S C;  4K3C A;  2INN E;  1WE6 A;  1MI0 A;  2GB1 A;  3RZW C;  3GP7 A;  1FCC C;  2NS5 A;  4N58 A;  4P16 A;  3T3O A;  2ACZ B;  2PKO A;  1TY0 A;  1YQ4 B;  2KDM A;  1N60 A;  1VDV A;  1E7U A;  2BYT A;  1I35 A;  2RDH A;  1IBX B;  1RLF A;  3KQ4 A;  3SEB A;  3DVN V;  1WX8 A;  1WXA A;  1J0G A;  2ICI A;  4G50 A;  3Q3F A;  2L83 A;  4AP4 C;  2KDI A;  2IO1 B;  5I4D A;  2N9K A;  2WWZ A;  2E6X A;  2B76 B;  3ZNG C;  2L32 A;  4W9J A;  5IAA C;  2JU6 X;  1QT9 A;  1NYQ A;  1RWS A;  1UUP A;  2ZEQ A;  3DBL B;  4NAW A;  3P2B A;  2J7Q B;  2PTL A;  2DYM A;  3DDC B;  4ANV A;  3TIX A;  3ZTC A;  1GC6 A;  1M4V A;  1TZ1 A;  1I4R A;  3B2F A;  4HCN B;  1I4H A;  2XNA C;  2D07 B;  2KQS A;  1E7V A;  5EE1 A;  1OQR A;  4RGM A;  2WXP A;  4RFB A;  4KKJ A;  1FCL A;  3AEB B;  4HPL B;  2I1J A;  1WR1 A;  4G3X B;  2NVU I;  2MEK A;  2PEA A;  4IWO A;  3FAH A;  4PS8 A;  2MBQ A;  3OG5 A;  3R7Q A;  3WCQ A;  2RPV A;  2IO2 B;  3TUO A;  3ZGZ A;  3L13 A;  3VRB B;  1MJD A;  2FNJ B;  5LXI B;  2AYO B;  4EEW A;  3VH3 B;  3V3X A;  2KOX A;  2KWV B;  1VZ8 A;  1I4G A;  4CHK A;  1N5W A;  2KYW A;  1MFW A;  2WLB A;  3GZN B;  4AUQ C;  1WX9 A;  3ONS A;  2GBN A;  1QF6 A;  1WXQ A;  2L7R A;  2TSS A;  2Z59 B;  2INP E;  5LXH A;  3DHG C;  2XK5 B;  3DCG A;  1SE2 A;  5DPW A;  2WXQ A;  2IY1 B;  2KKC A;  2LGY A;  4HLE A;  1J19 A;  4M8N A;  4ANU A;  3MJ5 A;  3NHE B;  3PHX B;  4L23 A;  3T8M A;  2CHW A;  4RH6 A;  4IKG A;  1C78 A;  2HTH A;  4W9C A;  5LLI A;  4NJ6 A;  1YN4 A;  2LJ5 A;  3MJW A;  3RUI B;  3M3J A;  3SD5 A;  3CST A;  1VD2 A;  4LNI A;  3VUW A;  4MM3 B;  5AZH A;  3ZNZ B;  3LYY A;  3LJ3 A;  3NG0 A;  2REX A;  2A4Z A;  2QCZ A;  1SJH D;  3B2G A;  4RM8 A;  4LNK A;  1V80 A;  3A4R A;  1LXD A;  3PLU A;  1FXA A;  4FHJ A;  3QX1 A;  2N7J A;  2BS2 B;  3VR8 B;  2L05 A;  1FO4 A;  4AOF A;  1EF1 A;  2V1Y A;  2J53 A;  1OEY J;  1DOX A;  1SJE D;  4TQ0 A;  1UD7 A;  1KTK A;  1XLQ A;  5IOI A;  1R4M I;  1F1H A;  4XZ4 A;  4KKI A;  2AWT A;  4P1B C;  2BGF A;  1TKE A;  1K8R B;  2C5L C;  3JSV A;  3ZUN A;  4DXA B;  2HDE A;  4JX1 C;  4RNA A;  1TBE A;  5D6J B;  3UI3 A;  3RN9 C;  3U52 E;  3IG3 A;  3OJ3 A;  2N9E B;  3ZJU A;  4FUL A;  3C19 A;  1YJJ A;  2K25 A;  2YVC A;  4KGT A;  4JQW C;  1PFD A;  3KWL A;  4W9G A;  2KAJ A;  1RFK A;  5IKC M;  2RR9 A;  1IUE A;  4ZRJ A;  2GBK A;  2QMT A;  5EE0 A;  1MG4 A;  3EA6 A;  3AH7 A;  2Z8L A;  3TMP B;  4TKN A;  1VLB A;  1OQY A;  2RGF A;  3DQV A;  2LVP A;  2Q5W D;  2LRW A;  4FAD A;  5C23 A;  5H92 C;  1Q5W B;  1NEN B;  1ZXI A;  3PHW B;  1V81 A;  2L00 B;  1J7A A;  3V6C B;  4NQK E;  2M0X A;  4LLG M;  2BYV E;  3BK1 A;  3V60 A;  1FNW A;  4XDD A;  4HDQ A;  4ARI A;  1V8C A;  2IZV B;  4D2K A;  1ZOY B;  3Q8E A;  4BKG A;  4LDT B;  2KC2 A;  2XK5 A;  2D3G A;  2C7M B;  1HZ5 A;  4ZYS A;  4YTP B;  2BTE A;  2J0K A;  1I4Q A;  2UWQ A;  5C2T B;  2JT4 B;  3ML9 A;  2WXF A;  1SIF A;  2M17 A;  2L52 A;  1K50 A;  2JYE A;  1NEK B;  2FCS A;  2CJN A;  4J6I A;  4MM3 A;  2DEN B;  4J3O D;  3OJ4 B;  2QIE B;  2QJL A;  2HJ1 A;  1DYQ A;  1TYG B;  3DVG X;  3BIN A;  2MA9 B;  1PGX A;  1VCB A;  4P1C C;  4KIK B;  3ZXV A;  2JYT A;  2PJH A;  3RMK C;  4FHK A;  2WX1 A;  4X57 B;  1FEH A;  1YMH E;  4GSW A;  1DOI A;  3BYT B;  1QIL A;  5BYS A;  1VJK A;  3I9V 1;  3RD2 A;  2KQ7 A;  1TKY A;  3L0W B;  1PUT A;  3LB8 C;  2VZK B;  1AYF A;  2FBW B;  3V05 A;  2KLG A;  1JRP A;  2UYZ B;  4LCD E;  1DGJ A;  3VXW A;  3TEW A;  2VRR B;  1FXT B;  3TEZ A;  2GI9 A;  4MGK E;  1BT0 A;  1L5P A;  2C60 A;  4K3B A;  4F7Z A;  4QAY A;  2KD0 A;  2GLS A;  2OHF A;  3NJT A;  4MH0 E;  3UF8 A;  4KGS A;  4W9L A;  1T0R C;  4DK5 A;  1UWM A;  2V4I B;  3M62 B;  5J18 A;  2BB5 A;  3ZKJ C;  2PE6 B;  2ZVO A;  3RI7 C;  1Z2M A;  4Q2J A;  1FNU A;  3NS1 A;  4ANW A;  1Q0W B;  1D6E C;  2K6D B;  4W9K A;  2LAS A;  1QOF A;  3SHQ A;  1WGR A;  2MP2 B;  2JWZ A;  4M0W A;  4WJN A;  3P1M A;  1M94 A;  2LHD A;  5JXV A;  1K53 A;  4AJY B;  2FCN A;  4OZC A;  2XN9 C;  1KFY B;  3M63 B;  3CSF A;  5D2M B;  5BYQ A;  1TY2 A;  3RFZ B;  3Q2A C;  4JIO U;  4A3O A;  2CU1 A;  1UH6 A;  3A33 B;  3PSE B;  1E9M A;  4GU2 A;  3TJP A;  4UDU C;  3DHH C;  3U7Z A;  3VH4 B;  3O13 A;  1TKG A;  2N0S B;  1WJ4 A;  4B0M A;  3EEC A;  1P7F A;  4R3D A;  4C4V B;  1WFY A;  4LNF A;  2WXH A;  1B9R A;  3CF6 E;  4JLC A;  3JW0 X;  2KAC A;  3DBS A;  2L8J A;  1T6B X;  1B1Z A;  3AEG B;  2WS3 B;  1YQ3 B;  1JWB D;  4NAW B;  3H7S A;  4C80 A;  4HPM B;  1V2Y A;  2K3U A;  2KQ4 X;  3HVZ A;  3L10 B;  2O2V B;  4DBG A;  1VZ7 A;  1T0Y A;  1NI2 A;  2N4F A;  1OEY A;  1I4P A;  1HE8 A;  2A5U A;  1FPY A;  1FXI A;  1AN8 A;  4OVV A;  4HPP A;  3RNC C;  2IBI B;  1PQS A;  3N20 C;  4OVZ A;  1F2R I;  2FCM A;  3L4P A;  1FIQ A;  3N1Z C;  2AX5 A;  3U4E G;  1RAX A;  4GOC A;  4WJQ A;  2M0A A;  2QDF A;  3H6N A;  1FMA D;  4ZRP A;  3ML8 A;  3PRM B;  2L76 A;  2EMT A;  3QQ8 B;  2WDR B;  5JH5 C;  3NOB A;  1Q1O A;  5BO4 B;  1FRD A;  2M8S A;  3KH0 A;  3VFK A;  3RCZ A;  2G3Q B;  2IJ0 A;  4RGT A;  4II3 B;  2K8H A;  2JZZ A;  4NAM A;  2SAK A;  2DHZ A;  2RDB C;  1WF9 A;  4CQN A;  3ZVV A;  1HA5 A;  5CHV C;  3AE9 B;  2GBM A;  2PE9 A;  1E8W A;  1E7P B;  1L4D B;  2WDQ B;  2ZW1 A;  2E3T A;  2CHZ A;  2ZPN A;  1KLV A;  2G4S A;  4WJO A;  3ZRF A;  2KVZ A;  1SEB D;  2MBE A;  4L1B A;  3T9L A;  3KUD B;  3NS8 A;  4FBJ B;  1SIJ A;  1ZPS A;  3PRP B;  4YTN B;  3WAP A;  1WRI A;  2IGD A;  1CZP A;  1YN3 A;  4WIP A;  1X1M A;  4LJP B;  2DLB A;  4ASW C;  3VVW B;  2C7H A;  3FKY A;  2Z0E B;  1J7B A;  3BK2 A;  2N7D A;  3W1S C;  3AM9 A;  2D5G A;  2WYQ A;  4OHJ A;  5CHF A;  4WWP A;  1Q10 A;  3A4S C;  2LGS A;  3DHI C;  1I42 A;  4E3C A;  1WYW B;  2ZZP B;  4OVU A;  3APD A;  3PV1 A;  4GXB A;  4BVU C;  3WAO A;  2MP2 A;  4GIV A;  3PTF C;  3QCA A;  1WJ6 A;  4BKS D;  3NVW A;  1GJZ A;  4HJK A;  1UGJ A;  2D3B A;  2K8C A;  2GBR A;  4MAC A;  4WH4 A;  1E8Z A;  4PYU A;  3VUX A;  3ZTD A;  4IM3 A;  1LM8 B;  1JAL A;  3HVD A;  1T5X D;  3E9S A;  3EFU A;  3AEC B;  1KOT A;  2LXC A;  4JPS A;  4KDI C;  4C4V A;  2M1M A;  4MSQ B;  3JSV B;  1FNV A;  2H89 B;  4ZYN A;  1TS2 A;  2L1A A;  2WU5 B;  3MFG A;  2BQQ A;  1N5X A;  4ZRK A;  4BBN C;  2CJO A;  2KWD A;  4BKT A;  3P4S B;  4FLH A;  3URY A;  2O2V A;  1ET6 A;  3J9C A;  1IP9 A;  5HKH A;  2I1K A;  3L16 A;  5FR3 A;  1JWM D;  2MW5 A;  2IPK D;  2WXK A;  3AMZ A;  2HE7 A;  3HRD D;  1QQR A;  3VUY A;  1EM7 A;  4FXC A;  3RNA C;  2KT7 A;  3IXS A;  1D3Z A;  2K9X A;  2X8X X;  4REZ A;  1LQB A;  4DQO C;  1D5M C;  4RM9 A;  5E6J A;  1D4B A;  4MJS B;  2M4N A;  2AQ2 B;  3L08 A;  3R7R A;  4RGN A;  4EFO A;  3AE6 B;  2ZJD A;  2M56 B;  1EWC A;  1OQQ A;  2K8B A;  3TBL D;  2KO3 A;  3KYC D;  3WIM A;  1ZP0 B;  2KN5 A;  2CHX A;  4DXG A;  1WE7 A;  2JSV X;  5BMH A;  1P3Q U;  4OW0 A;  4TQ1 A;  2KHW B;  2PPH A;  4HVB A;  1R4M B;  1N62 A;  1V5T A;  4B0E A;  1C79 A;  1E8Y A;  1WGH A;  4GDK A;  2BYF A;  2GBJ A;  1C76 A;  1PDX A;  4I6L B;  1JRU A;  2INC C;  1KLG D;  4FN2 A;  3VAW A;  2RSU A;  1KJT A;  1WGD A;  5C3J B;  3NVY A;  3JVZ X;  3SFD B;  2KLC A;  3ZJV A;  2DNF A;  5D3D A;  1GOZ A;  1V6E A;  4M00 A;  3TCA A;  2YLM A;  5E6N A;  4ANX A;  2KTF A;  3WAM A;  1WJU A;  2XEW A;  3OAW A;  2V9H A;  4XX5 A;  4ICU A;  1HZ6 A;  4DHJ B;  2M19 A;  1FFU A;  3V61 A;  2LGI A;  2UU7 A;  1ZKH A;  3GS2 A;  1R7S A;  2ON8 A;  3GOE A;  2V3N A;  3Q69 A;  1YJ1 A;  4KGR A;  4B95 A;  4NZL B;  1UZX B;  2O6V A;  4WQM A;  1H4R A;  4L2Y A;  5AZG A;  2WXI A;  4IM0 A;  4A3P A;  2RD0 A;  4URK A;  2JRI B;  1TT5 B;  3HM6 X;  4DXF A;  4K7S A;  4ITK A;  5EE9 A;  2ZW0 A;  3TEY A;  3QK0 A;  3KUC B;  1UNS A;  5CHW A;  3B0A A;  2MX2 A;  4LDT D;  1QLB B;  2N7E A;  2JWU A;  4A55 A;  2DZI A;  5BMI A;  1WWT A;  1WJN A;  3AV8 A;  2FAZ A;  1F77 A;  2CS4 A;  1EO6 A;  2JX5 A;  3CIR B;  1V86 A;  2LXA A;  3QWZ B;  3PZ8 A;  1HTO A;  3VHT C;  4EE2 A;  3AE2 B;  1ISN A;  2NTT A;  3UQA A;  2PVO D;  3NZ3 A;  3R8B A;  3AE4 B;  1T0Q C;  4C7Y A;  1YX6 B;  2JF5 A;  4M0W B;  3R2I A;  4GMV A;  2D3A A;  4AJW A;  4BZA A;  3CMM B;  3ZNH B;  4F8C B;  2PLP A;  2KC1 A;  3B1L X;  3UIO B;  1CK1 A;  4EUT A;  4WUR A;  3W1Y A;  2LGD A;  2OJR A;  2QHO A;  2ZPY A;  1BML C;  5HHD G;  1Y56 A;  1F9J A;  1F2R C;  1WMH A;  3IVF A;  2DYO A;  3QJZ A;  4MJS A;  2ZCC A;  1IGC A;  3AEF B;  4WWN A;  3W9C B;  2VZK D;  2KWC A;  1XCT L;  4F1S A;  1J8C A;  2XBB C;  4ZRQ A;  2GMI C;  3P63 A;  2ZNV C;  3H8H A;  3Q3J A;  1FM0 D;  1V97 A;  1GPX A;  4B6W A;  4TUU A;  1AAR A;  3X23 A;  3B08 A;  1UBI A;  4FJY A;  3ZQ4 A;  3VRA B;  2H88 B;  2WDT B;  2WQY B;  3W1S A;  2KJH B;  2BT6 A;  1VR9 A;  4IG7 B;  2DX5 B;  3EGR A;  5TSS A;  4BBN F;  3ZDM C;  3WAL A;  2BF8 B;  2JZ3 B;  1RRB A;  2LD9 A;  2Z0D B;  5DPS A;  3A9K A;  3MC9 A;  1XCQ L;  1GB1 A;  1L4Z B;  2BS3 B;  4EZK A;  3ETR A;  2MWS B;  1E8X A;  2I2Y A;  1XQQ A;  1TS4 A;  1WGY A;  4EZL A;  1SE9 A;  1ESF A;  4RF1 A;  3QAQ A;  2KFK A;  1C1Y B;  3RPF C;  2MCN B;  3DBR B;  5D7G A;  3Q8A A;  1KH0 A;  2D11 A;  4AQ7 A;  4XDC A;  3PZ7 A;  3Q14 C;  4HCP B;  2WXN A;  5JHA A;  1SE4 A;  2Y5B B;  1WIA A;  3VTU A;  4C56 C;  2X38 A;  5DPT A;  1SB3 C;  2HTM E;  1WGK A;  4ZHO A;  1YNT E;  4MGY E;  3DPD A;  3NZS A;  4PT5 A;  2KMM A;  2QEJ C;  4HDO A;  3EHV A;  3KLS X;  2D3C A;  1WZ3 A;  2NMQ A;  3H9D A;  2WX0 A;  3R2T A;  1MVK A;  2AL6 A;  2W3R A;  1YX5 B;  2BKR B;  3PZD A;  1QOG A;  2IDY A;  4NJ7 A;  2DWQ A;  3P4P B;  4YWG G;  1XLN A;  2L0T A;  4AS1 A;  2JQR B;  4RMA A;  4K81 A;  5EDS A;  5LNK 1;  4KX6 B;  2AQ3 B;  3DBH I;  3EC8 A;  3ENE A;  5JZE B;  2IGG A;  4KSL C;  3PS6 A;  1SBB B;  4KV2 A;  2LI5 A;  2G1E A;  1SE3 A;  3MC8 A;  4DHZ B;  4A9A A;  2LRU A;  2N9L A;  2KWU B;  2LWP A;  1FRR A;  1SGH A;  1TJE A;  1A5R A;  3NVV A;  4IWQ A;  3V6E B;  3N1Y C;  5T8I A;  1TIF A;  2FUH B;  3RT3 B;  4JL9 A;  1JRO A;  3NUH B;  2PMV A;  3Q8C A;  5H8Y E;  3AE7 B;  1K52 A;  3OLM D;  4LTU A;  1I4X A;  2BWE S;  4XYC A;  3I57 A;  1WX7 A;  2BB6 A;  1OTR B;  4KVG B;  2J52 A;  2N9P C;  1V1O A;  1WXS A;  2LGX A;  2LEK A;  4KSK C;  5DPR A;  3IT6 B;  2R2Q A;  2EMS A;  3ZRC A;  2MLB A;  4WQO B;  2FE8 A;  1WRD B;  3BZD B;  1ACC A;  2W82 A;  5HFY A;  3AU4 A;  3WA0 A;  3RNG C;  2QIL A;  4WWM A;  4ZOH C;  2WXG A;  2DYB A;  4GB9 A;  1YD8 U;  1CQV A;  1ZDX A;  3IBE A;  2LJI A;  4GN1 A;  2GRI A;  3VTW A;  2BPS A;  2JXX A;  3A1Q A;  3N30 A;  3MP9 A;  4N6E B;  1C4P A;  2DAF A;  3P42 A;  1TGZ B;  1WGG A;  1WZ0 A;  2J42 A;  2J0J A;  3VDZ A;  1D5X C;  3PO0 A;  2NBW B;  3PT2 B;  4LJO B;  4OZA A;  1Y8R C;  3UGB B;  4HKQ A;  3P4R B;  1WSP A;  2W3S A;  3MHS D;  2D2Q A;  4G11 A;  3TEX A;  1LO5 D;  2K39 A;  3Q3M C;  4XWW A;  3RNF C;  4FA6 A;  1RM6 C;  3PVL A;  3HUI A;  1G6J A;  4W9D A;  3PGE A;  4GDK B;  4II2 B;  2AQ1 B;  3FC4 A;  4IOI E;  2JY6 A;  1PGB A;  5JHB A;  3WAN A;  2ASQ A;  1WYG A;  2NCN A;  2WHI A;  3IAM 1;  3LXF A;  5HG2 A;  4EZJ A;  1GC7 A;  3JYU A;  4YSY B;  1A70 A;  1EU4 A;  2WXR A;  1R4N I;  3KUZ A;  1V1P A;  2IY0 B;  2WP9 B;  3NRZ A;  3H7P B;  2MRP A;  2I38 A;  1XT9 B;  3DWM A;  1GUA B;  1ET9 A;  1QOB A;  3P4Q B;  2K22 A;  3KYD D;  3Q6B A;  3QC8 B;  3S2A A;  4YXD B;  2G45 B;  1XLP A;  1YN5 A;  4ZDV A;  4HRO A;  2G4D B;  4M8M A;  3BY4 B;  2KMC A;  1EF5 A;  2O6V B;  3APF A;  3DWG C;  5G5H A;  3HK0 A;  2DZJ A;  4US9 A;  1YJI A;  2L0F A;  2NPT A;  2ONQ A;  3PPA A;  2KTR B;  4BAX A;  3ZXR A;  4WAF A;  2KFJ A;  3ZLZ A;  4H2A A;  2W54 A;  2JZP A;  3TL5 A;  3HM3 A;  3ZIM A;  2KJ6 A;  2LUM A;  4DWF A;  2PW9 A;  3EUB 2;  2C9W B;  2PIA A;  2LVQ A;  5FR6 A;  4YL8 A;  2FCQ A;  3L17 A;  3FIL A;  1KLU D;  3ZJT A;  3RUL A;  2G9H D;  1IPG A;  2OED A;  2AEH A;  4TV3 A;  1UF0 A;  1WXM A;  3Q3N C;  4WWO A;  5FK9 C;  4PK1 A;  1KM7 A;  1MHH E;  5G2N A;  5BYR A;  5J2R A;  1LGR A;  1SXT A;  5FKA C;  1BXT A;  2BYE A;  4NJC A;  3M95 A;  4DHJ D;  1I7H A;  1WMH B;  2Y5C A;  1S3S G;  3UQB A;  3AE3 B;  2VH1 A;  2WGS A;  3RNB C;  1L0Y B;  1MPE A;  3AE5 B;  1UEL A;  1VRA B;  5KHO A;  1D5Z C;  3C0R B;  5GXG B;  4OZB A;  1NDD A;  1XXG A;  3IT4 B;  4NQL B;  2QC8 A;  2DBY A;  5AEK B;  2IO3 B;  4HRS A;  3IHP C;  5G5G A;  4A20 A;  4IWP A;  1HQR D;  2JUO A;  3X0W A;  5CX3 A;  1F52 A;  3N9Y C;  1YIW A;  3BYY B;  3NY5 A;  2D10 A;  3DBL I;  1UBQ A;  4YTM B;  3I5J C;  4P6V F;  2J4X A;  2WDV B;  3DVN U;  3AEA B;  2BS4 B;  3GE8 C;  1PYW D;  2J0M A;  2KJR A;  2KX0 A;  1TS5 A;  2RDG A;  4RGO S;  3AXC A;  3K9O B;  4ICV A;  4I6N B;  1J7C A;  4MGI E;  3AE8 B;  1E10 A;  3A9K B;  5GMV A;  3U30 A;  3H1U A;  3ZO5 B;  5AUI A;  3B9J A;  3ZDT A;  3H7P A;  3N3K B;  3C8Y A;  1QOA A;  3PRZ A;  4RF0 A;  1L2N A;  1UWX A;  1WM3 A;  2FIF A;  2IND C;  4TMA B;  4N9F 4;  1P9D U;  2IO0 B;  2KFK B;  3O65 B;  4PS3 A;  4W9E A;  1UGM A;  4AWJ A;  1E6E B;  4GDL B;  4IUM B;  1FD6 A;  4K7U A;  1ZE3 D;  2WXJ A;  4HEA 1;  2YEP B;  2LMC A;  3E56 A;  1OFF A;  1FFV A;  1RFA A;  1SF0 A;  3R3M A;  4IC7 B;  3KVF B;  3W2D A;  3I63 C;  2CKH B;  3PLV A;  3GZN I;  1V9J A;  2MJ3 A;  5BMG A;  2V0G A;  3NZU A;  2L3Z A;  4A90 A;  1Z5S B;  3SDL C;  2FID A;  2KTR A;  3QAR A;  1IBX A;  4MSM B;  1F0Z A;  1P98 A;  2KXJ A;  1EUV B;  5L83 A;  2QSD A;  3RZF A;  2NBU A;  3Q8B A;  3KWV A;  2MSE D;  3K9P B;  4WAA A;  2OOB B;  2JVC A;  4EOY A;  4G0N B;  4XC2 A;  4DHZ E;  1E90 A;  2KZR A;  3OWE B;  1HXY D;  2N9X A;  2RMM A;  2EKE C;  2K6Q A;  4S0R A;  1STE A;  4M01 A;  3U8Z A;  3T3N A;  1VZ6 A;  1JCK B;  4A6Q A;  5L95 C;  1L0V B;  2CR5 A;  2V3S A;  4MEL A;  4BOS C;  4MGZ E;  2MH7 A;  3QA8 A;  1TZO A;  1WH3 A;  3BVG A;  4K7W A;  4DDI D;  3N1X C;  2LFI A;  5IN7 A;  2DAJ A;  4KDL B;  4K1R B;  3UIP B;  3ECI A;  4TSS A;  1GAQ B;  2BWF A;  3GB1 A;  4P7I A;  3NVZ A;  4BKS A;  2WXO A;  3LDZ E;  5HI1 A;  2NBV B;  4PYZ A;  4IDI A;  1PGA A;  2BW2 A;  4I6P A;  1RYJ A;  4HWI B;  5CTR C;  1GB4 A;  3ZW3 A;  2IYD B;  1JWS D;  4XWT A;  1V5O A;  3U7D A;  2YEP F;  2WU2 B;  1XLO A;  1HEZ E;  1NI3 A;  3IFW B;  5J17 A;  3I3T B;  3AUL A;  2NTS A;  3MC0 B;  1ZXH A;  4IW0 A;  1NBF C;  1L6V A;  3UIN B;  1JML A;  1WY8 A;  2KN4 A;  3AN1 A; 
#chains in the Genus database with same CATH homology
 3LYY A;  2PVG C;  3I57 A;  1JAL A;  1E0Z A;  2BB6 A;  1SJH D;  3HVD A;  1T5X D;  2J52 A;  3B2G A;  3E9S A;  3U2S C;  1V1O A;  3AEC B;  1JWU D;  1N63 A;  2LEK A;  4JPS A;  3TSS A;  3IT6 B;  1ZUD 2;  3AE1 B;  1SSN A;  1FXA A;  5HFY A;  2FE8 A;  1FNV A;  1ACC A;  2H89 B;  1TS2 A;  2N7J A;  2BS2 B;  2W82 A;  2L1A A;  2WU5 B;  3BZD B;  3VR8 B;  1FO4 A;  3MFG A;  1N5X A;  2J53 A;  5MPO A;  2QIL A;  4WWM A;  2CJO A;  2KWD A;  1DOX A;  1L0X B;  4ZOH C;  3P4S B;  1SJE D;  2SEB D;  2WXG A;  4N59 A;  4YT0 B;  1ET6 A;  3J9C A;  3URY A;  4TQ0 A;  1KTK A;  1CQV A;  1XLQ A;  1ZDX A;  2LJI A;  2GRI A;  3MP9 A;  4N6E B;  4KKI A;  1N61 A;  1TKE A;  3SFE B;  1C4P A;  5FR3 A;  1JWM D;  2IPK D;  3P42 A;  2WXK A;  1C4A A;  3AMZ A;  2HDE A;  4JX1 C;  4RNA A;  3HRD D;  1QQR A;  3BVZ A;  3UI3 A;  3U52 E;  2J42 A;  4C7Z A;  1EM7 A;  1EWY C;  4FXC A;  1D5X C;  3PO0 A;  3IXS A;  2BBC A;  3ZJU A;  2K9X A;  4OZA A;  2WXM A;  4HKQ A;  4LK0 M;  1YJJ A;  3P4R B;  1WSP A;  4KGT A;  2W3S A;  4REZ A;  3TEX A;  1PFD A;  1LO5 D;  4DQO C;  4XWW A;  1JW9 D;  1D5M C;  3KWL A;  2KAJ A;  1RM6 C;  5E6J A;  1D4B A;  1RFK A;  2MJE A;  1IUE A;  3VR9 B;  2QMT A;  2AQ2 B;  5EE0 A;  1K51 A;  3HUI A;  1V1P B;  1TS3 A;  4RGN A;  3EA6 A;  3AH7 A;  4GDK B;  3AE6 B;  4XE0 A;  1NVI D;  2M56 B;  2Z8L A;  1EWC A;  1OQQ A;  4USA A;  2LHE A;  1VLB A;  2AQ1 B;  3FC4 A;  4IOI E;  1PGB A;  4JWS C;  4O1N A;  1AW7 A;  1ZP0 B;  5EE3 A;  4A8X C;  2Q5W D;  1JWA D;  2WNM A;  4DXG A;  1WYG A;  2JSV X;  5BMH A;  4ARC A;  3IAM 1;  3LXF A;  5HG2 A;  3IAS 1;  5H92 C;  1NEN B;  4OW0 A;  4TQ1 A;  4YSX B;  4YSY B;  1A70 A;  1EU4 A;  2WXR A;  1N62 A;  1V1P A;  1QKZ A;  1ZXI A;  2WP9 B;  3NRZ A;  1C79 A;  4B0E A;  1L6U A;  1J7A A;  2I38 A;  3DWM A;  4RCO A;  2FUG 1;  1C76 A;  1PDX A;  1ET9 A;  1QOB A;  3P4Q B;  4LLG M;  2K22 A;  3BK1 A;  1KLG D;  4GLS C;  2WXL A;  1FNW A;  2K5P A;  4XDD A;  5C3J B;  4YXD B;  3NVY A;  4ARI A;  2W55 A;  1V8C A;  3SFD B;  3SR6 A;  1XLP A;  1YN5 A;  4D2K A;  3ZJV A;  1ZOY B;  3Q8E A;  4HRO A;  5D3D A;  1GOZ A;  2Y5P A;  1HZ5 A;  4ZYS A;  3Q8F A;  4YTP B;  1ENF A;  2BTE A;  1C77 A;  3DWG C;  5G5H A;  1I4Q A;  4US9 A;  5C2T B;  1YJI A;  2WXF A;  2K0P A;  3FIL B;  2L52 A;  2ONQ A;  4HJG E;  1HZ6 A;  1K50 A;  2JYE A;  2M19 A;  1FFU A;  1MHX A;  1NEK B;  1DOY A;  2LGI A;  2CJN A;  4MH8 A;  3GS2 A;  4WAF A;  1R7S A;  4H2A A;  2ON8 A;  4J3O D;  1KF6 B;  2V3P A;  2W54 A;  2V3N A;  4ZHP A;  3Q69 A;  2JZP A;  2QIE B;  2QJL A;  2R61 A;  1DYQ A;  1TYG B;  2LUM A;  3AEE B;  4KGR A;  2Y3A A;  4NZL B;  4WQM A;  1PGX A;  4L2Y A;  2PW9 A;  2WXI A;  3EUB 2;  2PIA A;  3BII D;  2JYT A;  1IGD A;  4DXF A;  5AUK A;  3FIL A;  1KLU D;  4ITK A;  5EE9 A;  2ZW0 A;  3ZJT A;  3TEY A;  1FEH A;  2G9H D;  1YMH E;  2OED A;  1C9F A;  1DOI A;  1UNS A;  3BYT B;  1QIL A;  1QLB B;  3VQI A;  2IGH A;  2JWU A;  4A55 A;  1VJK A;  5BMI A;  5BYS A;  3I9V 1;  1TKY A;  5FK9 C;  1WWT A;  1PUT A;  1MHH E;  3LB8 C;  2VZK B;  3AV8 A;  1AYF A;  2FBW B;  3V05 A;  2MJD A;  5BYR A;  1F77 A;  1P7E A;  1SXT A;  1JRP A;  5FKA C;  1XEE A;  1BXT A;  2JX5 A;  4NJC A;  3CIR B;  1DGJ A;  3TEW A;  3W5U B;  3PZ8 A;  4HKZ E;  3TEZ A;  2GI9 A;  2EEL A;  3CWI A;  4EE2 A;  1I7H A;  3AE2 B;  1L5P A;  3W5V B;  2Y5C A;  2NTT A;  3AB5 A;  2PVO D;  3NZ3 A;  3R8B A;  3AE4 B;  3AE3 B;  4JE3 B;  2OHF A;  2JXT A;  4YSZ B;  3AED B;  4C7Y A;  1L0Y B;  1T3Q A;  3R2I A;  1AWD A;  4KGS A;  1ROE A;  1MPE A;  2PLP A;  3AE5 B;  1CK1 A;  1VRA B;  1D5Z C;  4WUR A;  1UWM A;  2V4I B;  5GXG B;  2BB5 A;  2EKI A;  4OZB A;  1XXG A;  1BML C;  1JQ4 A;  3IT4 B;  5HHD G;  4JWU C;  1Y56 A;  1F2R C;  2DBY A;  3MHZ A;  4Q2J A;  1FNU A;  3NS1 A;  4HRS A;  5G5G A;  1D6E C;  2DYO A;  1CJE A;  1QOF A;  1IGC A;  3BVM A;  1HQR D;  3AEF B;  4M0W A;  1KRH A;  2VZK D;  3W9C B;  1XCT L;  1NYR A;  3P1M A;  3N9Y C;  3ZYY X;  1C4C A;  2LHD A;  5JXV A;  3BYY B;  1K53 A;  3ABV B;  3BWU D;  4OZC A;  4YTM B;  2XN9 C;  1XO3 A;  4P6V F;  1KFY B;  1ZDV A;  2J4X A;  2WDV B;  3AEA B;  2BS4 B;  1PYW D;  4ZRQ A;  2CU3 A;  5BYQ A;  1TY2 A;  1TS5 A;  2RDG A;  4MT5 A;  3RFZ B;  4RGO S;  1EU3 A;  3P63 A;  3H8H A;  1FM0 D;  1E9M A;  1BUI C;  1V97 A;  1GPX A;  1J7C A;  4UDU C;  3AE8 B;  1E10 A;  5D3I B;  4US8 A;  5AUI A;  3U7Z A;  3B9J A;  3O13 A;  1XF5 L;  1TKG A;  3VRA B;  3ZQ4 A;  2H88 B;  2WQY B;  3W1S A;  2N0S B;  3C8Y A;  1QOA A;  4RF0 A;  2INN E;  4B0M A;  1MI0 A;  1P7F A;  1UWX A;  2GB1 A;  4R3D A;  3GP7 A;  1FCC C;  1VR9 A;  2BT6 A;  4N58 A;  4P16 A;  4TMA B;  2WXH A;  3T3O A;  1B9R A;  2ACZ B;  3EGR A;  2PKO A;  5TSS A;  1TY0 A;  1YQ4 B;  2KAC A;  2KDM A;  1N60 A;  1VDV A;  1E6E B;  4GDL B;  1T6B X;  2BYT A;  1B1Z A;  3AEG B;  2WS3 B;  1YQ3 B;  2RDH A;  1FD6 A;  1IBX B;  1JWB D;  1ZE3 D;  4NAW B;  3KQ4 A;  2WXJ A;  4C80 A;  4HEA 1;  2YEP B;  2LMC A;  3SEB A;  3E56 A;  1OFF A;  2K3U A;  1FFV A;  2KQ4 X;  3HVZ A;  2ICI A;  1SF0 A;  1VZ7 A;  1XCQ L;  1GB1 A;  1L4Z B;  2L83 A;  2BS3 B;  5I4D A;  2N9K A;  3ETR A;  3W2D A;  2I2Y A;  1TS4 A;  2E6X A;  1I4P A;  2B76 B;  2MJ3 A;  5BMG A;  2V0G A;  1ESF A;  2L32 A;  1FXI A;  4RF1 A;  1AN8 A;  4A90 A;  3RPF C;  4OVZ A;  1F2R I;  3L4P A;  1FIQ A;  5D7G A;  2AX5 A;  1KH0 A;  3Q8A A;  3U4E G;  4AQ7 A;  1IBX A;  2JU6 X;  1QT9 A;  1NYQ A;  1RWS A;  1UUP A;  2M0A A;  4XDC A;  1F0Z A;  1FMA D;  2PTL A;  3PZ7 A;  4ZRP A;  2WXN A;  2QSD A;  2DYM A;  2WDR B;  3Q8B A;  1FRD A;  3KWV A;  1M4V A;  1SE4 A;  1I4R A;  3B2F A;  1I4H A;  2XNA C;  4C56 C;  2X38 A;  1SB3 C;  2HTM E;  2IJ0 A;  1WGK A;  4RGT A;  4ZHO A;  1YNT E;  5EE1 A;  4NAM A;  2SAK A;  3OWE B;  1OQR A;  4CQN A;  4RGM A;  1HXY D;  2RMM A;  2WXP A;  1HA5 A;  4RFB A;  4PT5 A;  2KMM A;  2QEJ C;  4KKJ A;  1FCL A;  3AE9 B;  3AEB B;  3KLS X;  1STE A;  3T3N A;  2NMQ A;  1VZ6 A;  2MEK A;  1JCK B;  1E7P B;  4A6Q A;  1L0V B;  3FAH A;  1L4D B;  3WCQ A;  3R2T A;  2RPV A;  2WDQ B;  2ZW1 A;  1MVK A;  2E3T A;  2W3R A;  3TUO A;  3ZGZ A;  2MH7 A;  3VRB B;  1TZO A;  1QOG A;  2IDY A;  2DWQ A;  3P4P B;  4YWG G;  3V3X A;  1XLN A;  1SEB D;  1VZ8 A;  3BVG A;  2LFI A;  4L1B A;  1I4G A;  1N5W A;  4AS1 A;  2WLB A;  4TSS A;  1SIJ A;  1GAQ B;  1ZPS A;  2JQR B;  4YTN B;  1WRI A;  5LNK 1;  4KX6 B;  2IGD A;  1CZP A;  2AQ3 B;  1YN3 A;  3GB1 A;  4WIP A;  3NVZ A;  2DLB A;  1QF6 A;  1WXQ A;  2WXO A;  2TSS A;  5HI1 A;  2IGG A;  4IDI A;  1PGA A;  3BK2 A;  1J7B A;  2BW2 A;  3AM9 A;  2INP E;  2D5G A;  1SBB B;  4OHJ A;  1RYJ A;  2G1E A;  1Q10 A;  1SE3 A;  1GB4 A;  4A9A A;  1SE2 A;  2N9L A;  2WXQ A;  1FRR A;  1JWS D;  1TJE A;  4XWT A;  2YEP F;  3NVV A;  2WU2 B;  1XLO A;  1HEZ E;  1NI3 A;  5T8I A;  3MJ5 A;  2NTS A;  3MC0 B;  4L23 A;  3NVW A;  1ZXH A;  1JRO A;  4RH6 A;  1UGJ A;  4IKG A;  1C78 A;  3NUH B;  2PMV A;  3Q8C A;  1L6V A;  5H8Y E;  1YN4 A;  3AE7 B;  1K52 A;  1JML A;  4MAC A;  4LTU A;  4WH4 A;  4MM3 B;  1I4X A;  2KN4 A;  3AN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...