1UWXA

P1.2 serosubtype antigen derived from n. meningitidis pora in complex with fab fragment
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
VTTYKLVINGKTLKGETTTKAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN G-PRIME
publication title Structural Variation and Immune Recognition of the P1.2 Subtype Meningococcal Antigen.
pubmed doi rcsb
source organism Streptococcus sp.
total genus 15
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1uwxA00
2QMTA 2RPVA 1UWXA 1XCQL 2N9KA 1C9FA 2LHDA 4IKGA 2N7JA 2PTLA 3FILB 1K50A 2KDMA 2RMMA 2KACA 2GB1A 1ZXHA 1P7FA 1PGXA 1GB1A 4KGSA 2PW9A 3MP9A 2I2YA 2ZW0A 2ZW1A 4IOIE 2OEDA 1IGCA 1HZ6A 1PGAA 2IGGA 1K53A 2JZPA 4OZCA 2I38A 2N9LA 5BMGA 4WH4A 1MPEA 2KN4A 2JXTA 1P7EA 1IGDA 1MHHE 2IGDA 5JXVA 3FILA 1K51A 1XCTL 2LUMA 1IBXB 2EELA 2J52A 2JWUA 4D2KA 2GI9A 1FCCC 1MI0A 1JMLA 2LHEA 1EM7A 1K52A 1PGBA 1FD6A 5HHDG 2KWDA 1F2RC 3V3XA 5HFYA 5HG2A 2JU6X 4GLSC 1FCLA 2K0PA 2NMQA 1YNTE 3GB1A 2ON8A 4KGRA 2PLPA 2ONQA 4KGTA 4HKZE 1MVKA 2IGHA 1HZ5A 3UI3A 5HI1A 2QSDA 2J53A 4MACA 2LGIA 1D4BA 1XF5L 1GB4A 4OZAA 1Q10A 4HJGE 1YMHE 5BMHA 5BMIA 1IBXA 1QKZA 2KQ4X 4OZBA 1F2RI 1HEZE 1KH0A 2JSVX 1MHXA
chains in the Genus database with same CATH superfamily
3BY4B 3ZLZA 3LXFA 1FRDA 4HXDA 2CHXA 1GG3A 4C7ZA 3RCZA 1PYWD 2KD0A 3Q6BA 3VR8B 4HPMB 4IOIE 4LNOA 3AEFB 4LDTD 1YX6B 3NVZA 2JRHA 4ICUA 2WDVB 4XGAB 3AI5A 2PE9A 2WS3B 3ONSA 4WQOB 2NPTB 3KUDB 3PLUA 1E6EB 3R8BA 4CO7A 2OHFA 4P1CC 4YSZB 3R3MA 2M4NA 3FILA 3BINA 4MJSA 2KVZA 1TS3A 1E8YA 1V49A 1CJEA 2NS5A 4JIOU 4TMAB 3A9KA 4ZOHC 3PHXB 4MSQB 4L23A 3VUXA 2RGFA 2QHOA 1WFYA 3Q3OC 2LRUA 2L00B 4CQNA 4TSSA 2BF8B 1WF9A 1V5TA 2KFJA 2FCNA 2K0PA 2O6VB 2MX2A 2V3NA 3WCQA 4B9KA 2ICIA 4AP4C 2PMVA 2ZJDA 4KGTA 2AQ2B 1LQBA 2Z59B 1WE7A 3TEZA 1JWMD 3Q8EA 2O2VB 1XXGA 5IA7A 3DVGY 2JF5A 4LTUA 3N1YC 4M01A 4BFRA 2KWUB 3V62A 2EKIA 4N9F4 3H6NA 3RPFC 3SD5A 1DOYA 2R61A 2DZKA 4PS3A 2J52A 1SB3C 4CHKA 4P1BC 2UWQA 4AS1A 3FKYA 4YSXB 3AE5B 2M8SA 1MG4A 2QDFA 2HE7A 3DPDA 1GC6A 1RFKA 3QCAA 2IY1B 1OQQA 3MP9A 4NAWB 1R4NB 4S0RA 2KOXA 3L17A 2WNMA 2M0XA 3ML8A 4C00A 2WDRB 4FBJB 4A20A 3RNAC 2N1WA 4HWIB 1Y8RC 4HPLB 1VZ6A 3WAOA 4L1BA 3B2GA 4A8XC 1UGJA 2L0FA 1QOBA 4B6WA 3O13A 2W9NA 4JQWC 1WM3A 2E6XA 2C5LC 4IM2A 1V5OA 1VD2A 1JWSD 3MJWA 3AEEB 2G1EA 1E10A 2L76A 3WA0A 2KFKA 2A5UA 1RAXA 3DBLI 2DZMA 3AE2B 3A4SC 2V3PA 1WMHB 5HHDG 2MW5A 2LI5A 3ZNGC 2C60A 1UBQA 2KLGA 2W3SA 3IT6B 1WXAA 2WHIA 3BK2A 4Q2JA 1P98A 4A3PA 5E6PA 4WWMA 2KDEB 4FJZA 3ZYYX 3X0WA 2DX5B 2EMSA 4K81A 4HCNB 1BXTA 1QT9A 2YVCA 3KW5B 3NUHB 3RNEC 1GB4A 3ZJUA 3AE6B 1DOIA 5CHFA 2N9XA 2RR9A 2UYZB 4JL9A 3ZTDA 3ZJTA 4WJQA 2CS4A 1OQRA 1UUPA 2L52A 2JZ3B 1IYFA 2CR5A 2DZJA 3R66C 2JVCA 3V6CB 1DGJA 3A33B 3VHTC 4URKA 4RNAA 2QEJC 2MH7A 2C7NB 5L83A 3FC4A 3UIPB 4EOYA 1SSNA 1JRUA 3NG0A 3L08A 5J18A 3VQIA 4PYUA 3P63A 3BK1A 4RH6A 2KTRA 2FCMA 2WXQA 1TYGB 4DHZB 4N58A 1OQYA 1GNUA 3JSVA 3T8MA 5EE9A 2JWUA 3MC0B 3EFUA 4JGHB 3GZNB 1J19A 3TBLD 3DDCB 4DDID 4QAYA 4HDOA 2ZCCA 3P4RB 1N5XA 3NS8A 1YN3A 2D3BA 1EF1A 4GN1A 1S3SG 2RDHA 3W5VB 1TIFA 1Q0WB 1M94A 2SEBD 4XZ4A 2DAFA 1ZGUB 2HJ8A 1H4RA 4EEWA 2J42A 4JX1C 3UQAA 4JWUC 3AN1A 1T0SC 1F0ZA 1V9JA 2FCQA 3NY5A 3UF8A 2DLBA 2XNAC 4RM8A 2KC2A 4XX5A 1J7CA 2MLBA 1T3QA 1XLQA 3SDLC 1I7HA 3P1MA 4GDLA 2QSDA 2MEKA 3ZW3A 2BBCA 3AULA 1K8RB 2V3SA 3VTWA 3ZO5B 2X8XX 3A9KB 2MWSB 4GDKA 1D3ZA 4MH0E 3UQBA 5BMIA 1IBXA 1QKZA 2BT6A 4C4VA 1WE6A 4EKUA 1RYJA 1C9FA 4ICVA 2GBMA 3WAMA 3KH0A 1VZ8A 3CMMB 1VRAB 2RMMA 1WZ0A 4GB9A 3EGRA 1E7VA 3GP7A 1PGXA 4KGSA 4USAA 2IBIB 3PGEA 3LB8C 1WXQA 2WXLA 3OG5A 2FBWB 3EHVA 3T3OA 2TSSA 1F52A 1RFAA 2KQ7A 3AH7A 2LEKA 4IW0A 1R4MB 4BVUC 4GIVA 2Z0EB 2WXRA 2AWTA 3IHPC 1HXYD 2YEPB 1OGWA 2IGDA 1I4RA 3ZDTA 2WQYB 3QX1A 1KLGD 5TR5A 3HHMA 1BT0A 3CSTA 3NHEB 1I4PA 1MI0A 3DBHI 3OLMD 2HDEA 1V6EA 3L16A 4LNIA 1AYFA 2NTSA 1TZ1A 5AUKA 2L1AA 4W9JA 4LDTB 3A9JB 4DWFA 2WXHA 2NMQA 4GSWA 1VR9A 4AOFA 3NVWA 3PVLA 3NJTA 2V4LA 4HKZE 3PZ8A 4DHJD 1RLFA 1MVKA 1WJNA 1YJJA 4F1SA 1FXTB 3I63C 3VH3B 1I4QA 1YOVB 3TUOA 4JWSC 4FLHA 2GBKA 3L54A 4I6PA 3AE7B 1TKGA 2LGIA 2DHZA 4G3XB 2IZVB 2KFKB 4AQ7A 1LXDA 5HKHA 2INNE 4KZCA 1MHXA 4HK2A 3ZXVA 3NS1A 3DBRB 4WAAA 1JQ4A 4MGZE 3RYTA 1AWDA 2BVCA 4BKSD 3HM3A 3AV8A 1WI0A 3DHHC 4HLEA 2N1VA 1F1HA 2DYMA 2V9HA 4LK0M 1VDVA 4J3OD 3H9DA 1KFYB 1WGHA 5G5GA 3R7QA 3RULA 3U30A 5LLIA 3ZDMC 4US9A 3R2IA 2EKEC 1PDXA 1E8ZA 2WU5B 4ANUA 4RGOS 2YLMA 1XD3B 2N9PC 2BYVE 3DWGC 3MC9A 3IFWB 2KJHB 1YIWA 4A9AA 5AZGA 3IAM1 2GRIA 1M4VA 1JMLA 1AW7A 4M00A 1SE4A 4W9KA 1WR6E 2KMCA 2IO3B 1TBEA 4BZAA 3V3XA 3L10B 5HFYA 2V0GA 4N59A 4IWQA 4LNNA 1YNTE 3L4PA 3N9YC 3O65B 3H1UA 5D94A 2KTRB 4ARIA 5GXGB 3H7SA 4M0WA 2INDC 3TMPB 2KNBA 1YQBA 3KUCB 3SHQA 5EE3A 4XDDA 3BYTB 3ZQ4A 3TSSA 4DQOC 4L2YA 1I4XA 1WWTA 2MP2B 1SBBB 2KT7A 1STEA 2WGSA 2KJRA 1SF0A 4NZLB 2K1FA 3VUYA 1FFUA 1YMHE 1KJTA 2RPVA 1E8XA 1ZOYB 2KTFA 1ZE3D 3DBRI 3IT4B 1HE8A 2KACA 3HVDA 2LVQA 3L0WB 4BKSA 2PW9A 1TGZB 1IPGA 4M8NA 3AE4B 4NQLB 3W5UB 1Z2MA 4WWNA 4P16A 4YXDB 3A1QA 2UU7A 2I38A 4GDLB 1V80A 4WH4A 2LGYA 4GMVA 2OOBB 2ZEQA 2JPHA 4XYCA 3VDZA 1MHHE 2W82A 3AEAB 4WAFA 3QA8A 3KUZA 1TY2A 2INCC 2N0SB 2REXA 4GDKB 3D32A 4LNKA 1IBXB 3QIJA 4C4VB 1FEHA 3QJZA 3MFGA 3N1XC 2BGFA 2V1YA 4ZRIA 2K6QA 1TS2A 4TUUA 4RGNA 4K3CA 1ENFA 2L32A 2FE8A 1T6BX 2I1KA 4RF1A 3CWIA 2WXGA 2B3AA 2ZVNA 2DWQA 3MC8A 3P2BA 1WJ6A 4LNFA 3W2DA 4FJVB 1T0YA 1CMXB 1HZ5A 3KYCD 5HI1A 5E6JA 1VZ7A 3B9JA 1WX7A 1E0ZA 1D4BA 2D10A 5LXHA 2FCSA 1FFVA 4OZBA 4P6VF 4ANVA 1KLVA 3T9LA 3C8YA 1Y56A 1FNWA 2WU2B 4X57B 1WR1A 4M8MA 3PHWB 2LASA 3AU5A 2PE6B 3AM9A 3ZNZB 3DHIC 2I2YA 2LMCA 1T0QC 2ZW1A 4ZRPA 2OEDA 3PREA 5G55A 3OJ3A 1HZ6A 4BOZB 2Q5WD 3APCA 5D7GA 3P4SB 2BQQA 2KX3A 4OZCA 4W9LA 4MGYE 1Z5SB 3JW0X 4K7SA 4PYZA 1WGYA 4J6IA 1SJHD 1FXAA 3BVGA 3P4PB 1WZ3A 2KDIA 4HRSA 4MH8A 4WJOA 1VJKA 3ZVVA 4M02A 4LJOB 2GI9A 3SEBA 1V86A 1ZDVA 4XDCA 5C3JB 4BOSC 2MA9B 4PT5A 1UELA 3WIMA 4EUTA 1K52A 1KTKA 3BVZA 2G9HD 4E74A 5G5HA 1A5RA 3EA6A 4IWOA 1P1AA 4ZYNA 1FCLA 3DBSA 4FHKA 1I4HA 4HDQA 1UH6A 4OVVA 5G2NA 1XLOA 4YTMB 1KLUD 2ACZB 4AJYB 1ZW7A 4C80A 1ROEA 1C79A 3VUWA 2BS2B 2H88B 4GXBA 1C1YB 4UDUC 5CX3A 3M62B 2PIAA 3I9V1 4US8A 1C4PA 1WGRA 3WAPA 4IG7B 1XF5L 1JROA 2M17A 1FXIA 3LJ3A 3NZ3A 3ZJVA 4DBGA 2BS4B 3V60A 1ZKHA 1E9MA 1NYQA 2OJRA 1HTOA 1IUEA 2Z8LA 3IAS1 3VRBB 1WJUA 3Q14C 1F9JA 4ZRKA 3AEDB 2W3RA 3PLVA 1SXTA 3RD2A 2GLSA 3U8ZA 3Q3FA 2HJ1A 1L0YB 4RMAA 3KYDD 3NRZA 3C0RB 2MRPA 1I35A 1TS5A 3ZIMA 4DHJB 4NY0A 3LYYA 2MQJA 4YWGG 1MG8A 3IVFA 4DXAB 1CK1A 1YJ1A 3HVZA 2PVOD 1YN4A 2WXFA 1C4AA 4G0NB 1GAQB 2KWVB 2L05A 1C76A 1SE3A 1K51A 3TEXA 3Q3JA 5H8YE 1NENB 2ZNVC 1R4NI 3RT3B 4LJPB 5TSSA 3N20C 3QWZB 2NTTA 2PVGC 4D2KA 4ZDVA 1L4ZB 2XN9C 3RNCC 3RUIB 4HPPA 2GMIC 1WGGA 3PZ7A 2NVUI 3NZUA 4I6LB 1BMLC 2D3GA 1EO6A 1S1QB 4IDIA 3GE8C 3ZRFA 3A1QB 2JYTA 1ZP0B 1D6EC 1UF0A 4LLGM 2XK5A 1QILA 2WDTB 4EZJA 5C23A 4WJNA 2ASQA 4OVZA 5C2TB 4TQ0A 1KF6B 2BYFA 2WWZA 3SU8X 2ZVOA 3Q69A 4PS7A 3OAWA 5IO9A 1XCQL 3QARA 4P7IA 2MJDA 3L13A 3FILB 4BKGA 2LFIA 2GB1A 4MJSB 2Y3AA 1E5WA 3ZRCA 2JRIB 1TT5B 2IY0B 4ZRQA 3AE3B 3GOEA 1J7BA 1WX8A 5LXIB 1XLPA 5DPRA 1L2NA 2JZPA 1SIJA 5JZEB 4MDKE 1X1MA 4MEMA 3NZSA 4EZLA 1DYQA 1L4DB 5FR3A 5JHAA 4HVBA 2WXOA 5E6NA 3W9CB 4RFBA 4MSMB 1I42A 2R2OA 1PQSA 4ASWC 4DDGD 1OEYJ 4AUQC 2K3UA 1NVID 1ZUD2 4NJCA 3APDA 3VRAB 2QJLA 3ENEA 1SE2A 5J17A 3HK0A 2M1MA 1L6VA 3ZNHB 1ISNA 3PO0A 3X23A 1HQRD 3N30A 3ML9A 2J7QB 1OFFA 4YTPB 3ZXRA 4PK1A 3GZNI 4REZA 2CJNA 1QQRA 1FIQA 2MBBB 2IO2B 1PUTA 3FAHA 1ACCA 1D5XC 2KHWB 2H89B 4MGIE 2KDBA 1G6JA 2IO0B 1Q10A 4HJGE 1E8WA 3OWEB 2KQ4X 4RGTA 1ZDXA 3IBEA 4IKGA 2C7HA 1SIFA 1WGDA 2BKFA 3I3TB 3N1ZC 1L0VB 1NI2A 2KDMA 2N4FA 2AL6A 4WIPA 3M3JA 3VAWA 4FA6A 1ZXHA 1P7FA 1QZEA 2WXMA 3NOBA 2C7MB 5IKCM 3EC8A 4O1NA 2IGGA 2KANA 3ZTCA 2N9LA 5BMGA 1IP9A 4NPNA 4W9DA 1P7EA 3B0AA 3LDZE 2W55A 2WDQB 2LUEA 5JXVA 1WRIA 2M0AA 2QIEB 2JYEA 4NAWA 1XEEA 4JPSA 1SGHA 3VVWB 3RFZB 3ZGZA 3AEBB 2MBQA 3BIID 3PRMB 3AE9B 2BPSA 3Q8FA 1R4MI 1PGBA 1V8CA 2DZIA 5CTRC 1FD6A 4IWPA 3QK0A 2LXCA 3PRPB 2D11A 2L3ZA 5FK9C 2BS3B 3IXSA 2NBUA 4A90A 3B08A 1UGMA 2AQ3B 2INPE 2JQRB 1QOAA 3DWMA 1MFWA 3DCGA 4E71A 3VH4B 1YN5A 1YX5B 2IYDB 1J7AA 1EWCA 5IOIA 3B2FA 2VH1A 3S2AA 5FR6A 1I4GA 3MHZA 4MT5A 2L0TA 1N61A 5EE0A 1LM8B 1TKEA 2ZCBA 2JY6A 1NDDA 5BMHA 1F2RI 4A55A 2KXJA 2BYTA 2KMAA 3K9OB 1UD7A 3RNBC 1JCKB 4KX6B 4H2AA 4OW0A 2R2QA 2LJIA 2K25A 1UWMA 3Q8BA 2AEHA 3T3NA 3IG3A 3JSVB 4E3CA 3N32A 2PEAA 5DPWA 1D5MC 3E9SA 2ZW0A 1WXVA 5AZFA 2KQSA 3AE8B 1V1PA 2WYQA 1IGCA 4RM9A 2WXNA 2FIDA 1PGAA 4HJKA 1YD8U 3UINB 4DHZE 5J2RA 2XK5B 5L95C 1FRRA 5EE1A 2KO3A 1YQ3B 3BYYB 1AARA 1C3TA 1JRPA 4YL8A 5AZHA 1NEKB 4WQMA 2RD0A 4IC7B 1PFDA 4HKQA 1NI3A 3AXCA 5GMVA 1UBIA 2DAJA 2BWES 5KHOA 1DOXA 1OTRB 1N5WA 2DENB 2KN5A 1FM0D 3Q2AC 4W9GA 4B95A 2KMMA 1KM7A 2Y5CA 3ABVB 5LNK1 4HROA 1JWAD 3BZDB 5BYSA 3TEYA 2ON8A 2G3QB 2PLPA 2ONQA 2L8JA 2WLBA 1N60A 2YEPF 1R7SA 2WXJA 2JWZA 2JXXA 2CU3A 3QC8B 1T5XD 1NYRA 3V6EB 2MBEA 4KIKA 2J4XA 2VRRB 2NCNA 4JE3B 4FXCA 2V4IB 4ARCA 1ET9A 1JWUD 3Q3NC 1V97A 1KH0A 3JVZX 5JH5C 5DPSA 2RDGA 1YQ4B 3ECIA 1FNUA 2N9KA 3DVGX 1WGKA 5FKAC 1J0GA 4W9FA 3W1SC 3K9PB 1ZXIA 3J9CA 2N7EA 4JLCA 1F77A 1OEYA 3CF6E 5BYQA 2J0JA 4XWTA 4TQ1A 2E3TA 2J0MA 5IN7A 1U4AA 4C7YA 1C4CA 1V1OA 1ESFA 1K53A 2L7RA 3KWVA 3ZKJC 1WXMA 1BUIC 3DBLB 2KN4A 2XBBC 2KAJA 4MM3A 1EUVB 1QF6A 3QAQA 1V81A 1GC7A 1WM2A 3RNFC 2NR2A 2Y5PA 1GJZA 1UNSA 2KJ6A 4WWOA 5D3DA 4FADA 1FCCC 3PS6A 2D2QA 1WRDB 3NVYA 1L6UA 1LO5D 3TIXA 1N6ZA 1FMAD 2LZ6A 4F7ZA 3CIRB 5T8IA 2MJEA 2BWFA 3RZWC 3RI7C 4GLSC 2IJ0A 3VFKA 4NJ6A 5D3IB 3AMZA 2KX0A 1MJDA 3H7PA 4KGRA 2KK8A 4FJYA 2BKRB 1VCBA 2AL3A 5BO4B 2KVRA 2FUHB 2JT4B 5C1ZA 3UI3A 1LGRA 2D5GA 3AE1B 1TTNA 4BKTA 2LXAA 1RRBA 3KLSX 4W9CA 2MSED 2N7DA 3TJPA 3A9JA 3A4RA 4F8CB 4BBNF 1TKYA 1H8CA 2NBWB 2DNFA 4NJ7A 1HEZE 1UWXA 4ZYSA 1CZPA 1AN8A 2K8CA 2M56B 3QHTA 2PTLA 1L7YA 4IM0A 2MJ3A 5JHBA 3HRDD 2JUOA 2MCNB 1WIAA 2QCZA 3P42A 3ZUNA 3BVMA 3SR6A 4K1RB 1FO4A 2CKHB 2WX0A 1WYWB 3RNGC 3OJ4B 1JWBD 1TY0A 4W9HA 1WJ4A 1WSPA 4K7WA 4TV3A 2BTEA 2CHWA 1MPEA 2I1JA 2VZKD 1TZOA 2GOWA 1EWYC 3V61A 5I4DA 3EFCA 5DPTA 3PZDA 2G4SA 2AX5A 3GS2A 2LUMA 2FNJB 4OHJA 4DXFA 2CU1A 3APFA 4M0WB 3Q8AA 4KKIA 1KOTA 1XQQA 4A3OA 4WWPA 3ETRA 5CHVC 2X38A 3RN9C 4GU2A 1XO3A 4ZHPA 4HEA1 2KWDA 1F2RC 2KC1A 1V1PB 2LJ5A 2Y5BB 1HA5A 3TEWA 2A4ZA 4B0EA 4NQKE 1L0XB 2FAZA 1EU3A 3VTVA 1GUAB 4ZHOA 4XC2A 1WXSA 3DVNV 4N6EB 3U52E 4EFOA 1N62A 2KKCA 1B9RA 4IM3A 4S17A 4XWWA 2LD9A 2GBRA 4G11A 2GBNA 2CHZA 3TL5A 1EF5A 1XT9B 1P0RA 3PV1A 4OZAA 5IAAC 5BYRA 2K39A 2LHDA 5CHWA 3SFEB 2KDFB 2N7JA 2LGXA 3N3KB 3PSEB 1JALA 3EUB2 1LFDA 1E7PB 3VR9B 2MP2A 4AWJA 2O6VD 1P9DU 3UGBB 3DBHB 5DCNA 2XEWA 4KIKB 3PPAA 3KQ4A 1A70A 1KRHA 1TS4A 3P4QB 5D6JB 4XE0A 2W54A 3DVNU 4BBNC 4WJPA 2EELA 4CYEA 3VXWA 4FULA 2DYOA 2GBJA 4YT0B 2WXIA 4K3BA 2OJWA 3WALA 4G50A 3AEGB 3URYA 3JYUA 2G45B 2PKOA 4NAMA 1L5PA 3MHSD 2NBVB 1WYGA 1SEBD 2JU6X 3I5JC 1UZXB 4BAXA 4WURA 5E6OA 3HUIA 1YJIA 4MELA 4PS8A 3Q3MC 4FN2A 5MPOA 3EECA 4MM3B 4II3B 2NPTA 3RZFA 1D5ZC 2ZZPB 2K22A 1GOZA 4GOCA 4EZKA 1CQVA 3TCAA 3SFDB 2K9XA 1WX9A 3PT2B 4II2B 4FHJA 4KSKC 1WY8A 1NBFC 2LVPA 2JSVX 4MGKE 1QOFA 2D3CA 3UIOB 1JW9D 4C56C 4NNJB 1K50A 1E90A 4KZ0A 4I6NB 1GB1A 4IUMB 4RGMA 3H7PB 4R3DA 1RWSA 4RCOA 2VH2A 4ANWA 3MTNB 2C9WB 4KVGB 2L83A 2BB6A 2O6VA 2IDYA 4KSLC 3H8HA 4GGQA 4DXGA 1J8CA 2JXTA 2DYBA 2Z0DB 2JX5A 4ITKA 2WP9B 2O2VA 2LWPA 4LCDE 2KLCA 1B1ZA 3AECB 2SAKA 2QILA 1XCTL 3ZNID 1ZPSA 2LGDA 2BYEA 3DQVA 2LGSA 2RDBC 3B1LX 1HTQA 4KDIC 4YSYB 1V2YA 1ET6A 1E7UA 2ZNVB 2LHEA 3DOWA 3BWUD 4HCPB 2PJHA 1EM7A 2PPHA 4AJWA 3M95A 2MBOA 2JZZA 3V05A 2B76B 3U2SC 2N9EB 4W9IA 2K8HA 4ZRJA 3ALBA 5EDSA 2HTHA 3AU4A 2IPKD 1QLBB 2D3AA 2ZPYA 2LRWA 3KVFB 2K5PA 3E56A 2LVOA 1WH3A 5H92C 1RM6C 2IO1B 2ZPNA 3DHGC 1TJEA 1T0RC 2FUG1 2BB5A 3HIZA 1Q5WB 3CSFA 2RPQA 5AEKB 2QMTA 4A6QA 2KWCA 1EU4A 2WX1A 3GE3C 3NVVA 4ACFA 2K8BA 2G4DB 1WMHA 2WXPA 2CJOA 1SE9A 1VLBA 4KDLB 4DK5A 5AUIA 4OVUA 1Q1OA 3HM6X 2QC8A 2MHJA 3U7ZA 1IGDA 4K7UA 1C77A 1FNVA 2AQ1B 1QOGA 3W1YA 2AYOB 3M63B 3R7RA 4EE2A 4KV2A 3QQ8B 3MJ5A 3WANA 3C19A 4YTNB 2D07B 3PRZA 2HD5B 4KKJA 1SJED 3KWLA 2KYWA 2RSUA 3I57A 5D2MB 1P3QU 3RMKC 5HG2A 3U4EG 2J0KA 3GB1A 2WXKA 1C78A 2K6DB 2HTME 3U7DA 4W9EA 2FIFA 1XLNA 3Q8CA 4ANXA 4B0MA 3W1SA 3PTFC 2EMTA 2BW2A 2M19A 2VZKB 2IGHA 5KHQA 4TKNA 3AB5A 2J53A 4MACA 2DBYA 4RF0A 1FPYA 1N63A 5IP4D 2MBHA 1GPXA 3R2TA 3VTUA 2KZRA
chains in the Genus database with same CATH topology
1UWXA 1XCQL 4ZYSA 1CZPA 1AN8A 3NS1A 3LXFA 2M56B 1FRDA 2MJDA 2PTLA 3FILB 1JQ4A 2MJ3A 1AWDA 2LFIA 3HRDD 2GB1A 4C7ZA 2Y3AA 1PYWD 3AV8A 3P42A 3VR8B 3BVMA 3SR6A 1FO4A 4IOIE 2DYMA 3AEFB 4LK0M 1VDVA 3NVZA 2WDVB 4ZRQA 1JWBD 1TY0A 3AE3B 4J3OD 1KFYB 2WS3B 1J7BA 1WSPA 5G5GA 1XLPA 1E6EB 2JZPA 3R8BA 1SIJA 2OHFA 4US9A 3R2IA 2BTEA 2VZKD 1MPEA 4YSZB 1PDXA 1TZOA 2WU5B 4RGOS 1EWYC 5I4DA 3FILA 3DWGC 2AX5A 3GS2A 1DYQA 2LUMA 1L4DB 1TS3A 4A9AA 5FR3A 4OHJA 1CJEA 4DXFA 2WXOA 3W9CB 3IAM1 4TMAB 2GRIA 1M4VA 3Q8AA 4KKIA 4RFBA 4ZOHC 1JMLA 1AW7A 3ETRA 2K3UA 1NVID 1ZUD2 2X38A 4NJCA 3VRAB 2QJLA 1SE2A 1XO3A 1SE4A 4L23A 1L6VA 4ZHPA 4HEA1 2KWDA 1F2RC 3V3XA 1V1PB 3PO0A 5HFYA 1HQRD 2V0GA 4CQNA 4TSSA 4N59A 1HA5A 3TEWA 2K0PA 1OFFA 4YTPB 1YNTE 2V3NA 3L4PA 3N9YC 3WCQA 4B0EA 2ICIA 1L0XB 1EU3A 2PMVA 4REZA 2CJNA 4ZHOA 1QQRA 1FIQA 4KGTA 2AQ2B 4N6EB 4ARIA 5GXGB 1JWMD 3TEZA 4M0WA 3Q8EA 3U52E 1N62A 1XXGA 1B9RA 4LTUA 5EE3A 4XDDA 4XWWA 3BYTB 1PUTA 3ZQ4A 3FAHA 1ACCA 1D5XC 3TSSA 4DQOC 4L2YA 2EKIA 1I4XA 1WWTA 1SBBB 1STEA 3RPFC 2H89B 1SF0A 1DOYA 4NZLB 4OZAA 1Q10A 1FFUA 4HJGE 1YMHE 3OWEB 2R61A 2KQ4X 5BYRA 4RGTA 2J52A 1ZDXA 1SB3C 2RPVA 1ZOYB 4AS1A 2LHDA 4IKGA 3SFEB 1ZE3D 4YSXB 2N7JA 3AE5B 3IT4B 1L0VB 2KDMA 4WIPA 2KACA 3HVDA 1ZXHA 1P7FA 2WXMA 1RFKA 1JALA 2PW9A 1OQQA 3EUB2 3MP9A 4NAWB 1E7PB 4O1NA 3VR9B 3AE4B 3W5UB 2WNMA 2IGGA 2WDRB 4P16A 4YXDB 1VZ6A 2I38A 4GDLB 4L1BA 2N9LA 3B2GA 4WH4A 5BMGA 4A8XC 1UGJA 1QOBA 3O13A 3KQ4A 1A70A 1KRHA 1P7EA 2W55A 1MHHE 2E6XA 2W82A 2WDQB 3AEAB 4WAFA 5JXVA 1TS4A 3P4QB 1TY2A 2N0SB 4XE0A 4GDKB 1WRIA 2W54A 2M0AA 1JWSD 1IBXB 3AEEB 2QIEB 2JYEA 2G1EA 2EELA 1XEEA 4JPSA 1FEHA 3MFGA 2DYOA 4YT0B 1E10A 3RFZB 2WXIA 3ZGZA 3AEBB 1TS2A 3BIID 3AE9B 3Q8FA 3AEGB 4RGNA 3AE2B 1ENFA 1PGBA 1V8CA 2L32A 3URYA 1FD6A 2V3PA 2PKOA 4NAMA 5HHDG 1L5PA 5FK9C 1WYGA 2FE8A 1SEBD 1T6BX 2JU6X 2BS3B 3IXSA 4WURA 4A90A 2W3SA 3IT6B 2AQ3B 2INPE 2JQRB 3HUIA 1YJIA 4RF1A 3CWIA 1QOAA 3DWMA 2WXGA 2DWQA 5MPOA 3BK2A 4Q2JA 3W2DA 4MM3B 1YN5A 1J7AA 4WWMA 1EWCA 1HZ5A 1D5ZC 3B2FA 2K22A 5HI1A 1GOZA 5E6JA 3ZYYX 1I4GA 1VZ7A 3B9JA 3MHZA 1CQVA 3SFDB 2K9XA 4MT5A 5EE0A 1N61A 1E0ZA 1BXTA 1QT9A 1TKEA 1D4BA 3NUHB 1GB4A 3ZJUA 3AE6B 5BMHA 1DOIA 1FFVA 4OZBA 1F2RI 4A55A 2JSVX 4P6VF 2BYTA 3ZJTA 1QOFA 1JCKB 4KX6B 3C8YA 4H2AA 1JW9D 4C56C 1Y56A 1OQRA 4OW0A 1UUPA 2L52A 2LJIA 1FNWA 1UWMA 1K50A 2WU2B 3Q8BA 3T3NA 1DGJA 1GB1A 4RGMA 3AM9A 4RNAA 1D5MC 3E9SA 4R3DA 2QEJC 2I2YA 1RWSA 2LMCA 2ZW0A 2ZW1A 4RCOA 4ZRPA 2OEDA 3AE8B 2MH7A 1V1PA 1IGCA 1HZ6A 3FC4A 2L83A 2BB6A 2WXNA 2Q5WD 1PGAA 1SSNA 2IDYA 5D7GA 3P4SB 1FRRA 4OZCA 5EE1A 3H8HA 3VQIA 1YQ3B 3BYYB 3P63A 3BK1A 4DXGA 1JRPA 4RH6A 1NEKB 2JXTA 4WQMA 1SJHD 2JX5A 4ITKA 2WP9B 1FXAA 2WXQA 1TYGB 3AECB 1B1ZA 3BVGA 2SAKA 4N58A 3P4PB 2QILA 1PFDA 4HRSA 1XCTL 1ZPSA 4HKQA 4MH8A 1NI3A 1VJKA 5EE9A 2JWUA 3MC0B 2GI9A 3SEBA 4YSYB 1ET6A 1ZDVA 1DOXA 4XDCA 5C3JB 2LHEA 1N5WA 3BWUD 3P4RB 1N5XA 4PT5A 1YN3A 1FM0D 1EM7A 1K52A 1KTKA 3BVZA 2G9HD 2KMMA 5G5HA 3V05A 2Y5CA 2RDHA 2B76B 3U2SC 3W5VB 3EA6A 2SEBD 3ABVB 5LNK1 1FCLA 4HROA 1I4HA 1JWAD 3BZDB 5BYSA 3TEYA 2J42A 4JX1C 1XLOA 4YTMB 2ON8A 2PLPA 4JWUC 3AN1A 1KLUD 2ONQA 1F0ZA 2ACZB 4C80A 2WLBA 2DLBA 2XNAC 1N60A 2IPKD 1QLBB 1ROEA 2YEPF 1R7SA 1C79A 1J7CA 2WXJA 1T3QA 1XLQA 2CU3A 2K5PA 1I7HA 1T5XD 3P1MA 2QSDA 2MEKA 1NYRA 2BS2B 2H88B 4UDUC 3E56A 2J4XA 2BBCA 2PIAA 4JE3B 4FXCA 3I9V1 4US8A 2V4IB 1C4PA 5H92C 4ARCA 1ET9A 1RM6C 1XF5L 1JROA 3NZ3A 1FXIA 1TJEA 3ZJVA 1JWUD 2FUG1 5BMIA 2BB5A 1IBXA 1QKZA 1V97A 1KH0A 2BT6A 2QMTA 1YQ4B 2BS4B 2RDGA 4A6QA 1FNUA 2N9KA 1RYJA 1WGKA 1C9FA 5FKAC 1E9MA 1EU4A 1NYQA 1VZ8A 2Z8LA 1IUEA 3IAS1 1ZXIA 3J9CA 3VRBB 1VRAB 1F77A 2RMMA 3NVVA 3EGRA 5BYQA 3GP7A 4XWTA 4TQ1A 1PGXA 2E3TA 2W3RA 3AEDB 1SXTA 4KGSA 4USAA 1L0YB 2WXPA 2CJOA 1VLBA 3LB8C 3NRZA 1WXQA 4C7YA 2WXLA 1C4CA 1TS5A 1V1OA 1ESFA 2FBWB 1K53A 3KWVA 2TSSA 5AUIA 3T3OA 3AH7A 3LYYA 4YWGG 1CK1A 2LEKA 1BUIC 3HVZA 2KN4A 2PVOD 2WXRA 3U7ZA 1YN4A 2KAJA 1C4AA 2WXFA 1IGDA 1HXYD 2YEPB 2IGDA 1QF6A 1I4RA 1GAQB 1C77A 1C76A 1FNVA 1SE3A 1QOGA 2AQ1B 1K51A 3TEXA 5H8YE 1NENB 2WQYB 2Y5PA 1KLGD 1UNSA 5TSSA 2NTTA 2PVGC 4D2KA 4EE2A 1L4ZB 3MJ5A 5D3DA 1I4PA 1FCCC 1MI0A 2XN9C 2HDEA 3NVYA 1L6UA 1LO5D 4YTNB 1FMAD 4KKJA 1SJED 3KWLA 1AYFA 3CIRB 5T8IA 3PZ7A 3I57A 2MJEA 2NTSA 5AUKA 5HG2A 2L1AA 4GLSC 3U4EG 1BMLC 2IJ0A 2WXHA 2NMQA 4IDIA 2WXKA 1C78A 3AMZA 3GB1A 1VR9A 5D3IB 2HTME 1XLNA 3Q8CA 4KGRA 4B0MA 2JYTA 3NVWA 3W1SA 1ZP0B 1D6EC 2BW2A 2M19A 3PZ8A 4HKZE 1MVKA 2VZKB 2IGHA 1YJJA 4LLGM 3UI3A 1I4QA 1QILA 2D5GA 3AE1B 3TUOA 3AB5A 2J53A 4JWSC 4MACA 2DBYA 3AE7B 4RF0A 1TKGA 3KLSX 1N63A 2LGIA 4OVZA 5C2TB 4TQ0A 1KF6B 4AQ7A 1TKYA 1GPXA 3R2TA 2INNE 1HEZE 1MHXA 3Q69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QMT A;  2RPV A;  1UWX A;  1XCQ L;  2N9K A;  1C9F A;  2LHD A;  4IKG A;  2N7J A;  2PTL A;  3FIL B;  1K50 A;  2KDM A;  2RMM A;  2KAC A;  2GB1 A;  1ZXH A;  1P7F A;  1PGX A;  1GB1 A;  4KGS A;  2PW9 A;  3MP9 A;  2I2Y A;  2ZW0 A;  2ZW1 A;  4IOI E;  2OED A;  1IGC A;  1HZ6 A;  1PGA A;  2IGG A;  1K53 A;  2JZP A;  4OZC A;  2I38 A;  2N9L A;  5BMG A;  4WH4 A;  1MPE A;  2KN4 A;  2JXT A;  1P7E A;  1IGD A;  1MHH E;  2IGD A;  5JXV A;  3FIL A;  1K51 A;  1XCT L;  2LUM A;  1IBX B;  2EEL A;  2J52 A;  2JWU A;  4D2K A;  2GI9 A;  1FCC C;  1MI0 A;  1JML A;  2LHE A;  1EM7 A;  1K52 A;  1PGB A;  1FD6 A;  5HHD G;  2KWD A;  1F2R C;  3V3X A;  5HFY A;  5HG2 A;  2JU6 X;  4GLS C;  1FCL A;  2K0P A;  2NMQ A;  1YNT E;  3GB1 A;  2ON8 A;  4KGR A;  2PLP A;  2ONQ A;  4KGT A;  4HKZ E;  1MVK A;  2IGH A;  1HZ5 A;  3UI3 A;  5HI1 A;  2QSD A;  2J53 A;  4MAC A;  2LGI A;  1D4B A;  1XF5 L;  1GB4 A;  4OZA A;  1Q10 A;  4HJG E;  1YMH E;  5BMH A;  5BMI A;  1IBX A;  1QKZ A;  2KQ4 X;  4OZB A;  1F2R I;  1HEZ E;  1KH0 A;  2JSV X;  1MHX A; 
#chains in the Genus database with same CATH topology
 3BY4 B;  3ZLZ A;  3LXF A;  1FRD A;  4HXD A;  2CHX A;  1GG3 A;  4C7Z A;  3RCZ A;  1PYW D;  2KD0 A;  3Q6B A;  3VR8 B;  4HPM B;  4IOI E;  4LNO A;  3AEF B;  4LDT D;  1YX6 B;  3NVZ A;  2JRH A;  4ICU A;  2WDV B;  4XGA B;  3AI5 A;  2PE9 A;  2WS3 B;  3ONS A;  4WQO B;  2NPT B;  3KUD B;  3PLU A;  1E6E B;  3R8B A;  4CO7 A;  2OHF A;  4P1C C;  4YSZ B;  3R3M A;  2M4N A;  3FIL A;  3BIN A;  4MJS A;  2KVZ A;  1TS3 A;  1E8Y A;  1V49 A;  1CJE A;  2NS5 A;  4JIO U;  4TMA B;  3A9K A;  4ZOH C;  3PHX B;  4MSQ B;  4L23 A;  3VUX A;  2RGF A;  2QHO A;  1WFY A;  3Q3O C;  2LRU A;  2L00 B;  4CQN A;  4TSS A;  2BF8 B;  1WF9 A;  1V5T A;  2KFJ A;  2FCN A;  2K0P A;  2O6V B;  2MX2 A;  2V3N A;  3WCQ A;  4B9K A;  2ICI A;  4AP4 C;  2PMV A;  2ZJD A;  4KGT A;  2AQ2 B;  1LQB A;  2Z59 B;  1WE7 A;  3TEZ A;  1JWM D;  3Q8E A;  2O2V B;  1XXG A;  5IA7 A;  3DVG Y;  2JF5 A;  4LTU A;  3N1Y C;  4M01 A;  4BFR A;  2KWU B;  3V62 A;  2EKI A;  4N9F 4;  3H6N A;  3RPF C;  3SD5 A;  1DOY A;  2R61 A;  2DZK A;  4PS3 A;  2J52 A;  1SB3 C;  4CHK A;  4P1B C;  2UWQ A;  4AS1 A;  3FKY A;  4YSX B;  3AE5 B;  2M8S A;  1MG4 A;  2QDF A;  2HE7 A;  3DPD A;  1GC6 A;  1RFK A;  3QCA A;  2IY1 B;  1OQQ A;  3MP9 A;  4NAW B;  1R4N B;  4S0R A;  2KOX A;  3L17 A;  2WNM A;  2M0X A;  3ML8 A;  4C00 A;  2WDR B;  4FBJ B;  4A20 A;  3RNA C;  2N1W A;  4HWI B;  1Y8R C;  4HPL B;  1VZ6 A;  3WAO A;  4L1B A;  3B2G A;  4A8X C;  1UGJ A;  2L0F A;  1QOB A;  4B6W A;  3O13 A;  2W9N A;  4JQW C;  1WM3 A;  2E6X A;  2C5L C;  4IM2 A;  1V5O A;  1VD2 A;  1JWS D;  3MJW A;  3AEE B;  2G1E A;  1E10 A;  2L76 A;  3WA0 A;  2KFK A;  2A5U A;  1RAX A;  3DBL I;  2DZM A;  3AE2 B;  3A4S C;  2V3P A;  1WMH B;  5HHD G;  2MW5 A;  2LI5 A;  3ZNG C;  2C60 A;  1UBQ A;  2KLG A;  2W3S A;  3IT6 B;  1WXA A;  2WHI A;  3BK2 A;  4Q2J A;  1P98 A;  4A3P A;  5E6P A;  4WWM A;  2KDE B;  4FJZ A;  3ZYY X;  3X0W A;  2DX5 B;  2EMS A;  4K81 A;  4HCN B;  1BXT A;  1QT9 A;  2YVC A;  3KW5 B;  3NUH B;  3RNE C;  1GB4 A;  3ZJU A;  3AE6 B;  1DOI A;  5CHF A;  2N9X A;  2RR9 A;  2UYZ B;  4JL9 A;  3ZTD A;  3ZJT A;  4WJQ A;  2CS4 A;  1OQR A;  1UUP A;  2L52 A;  2JZ3 B;  1IYF A;  2CR5 A;  2DZJ A;  3R66 C;  2JVC A;  3V6C B;  1DGJ A;  3A33 B;  3VHT C;  4URK A;  4RNA A;  2QEJ C;  2MH7 A;  2C7N B;  5L83 A;  3FC4 A;  3UIP B;  4EOY A;  1SSN A;  1JRU A;  3NG0 A;  3L08 A;  5J18 A;  3VQI A;  4PYU A;  3P63 A;  3BK1 A;  4RH6 A;  2KTR A;  2FCM A;  2WXQ A;  1TYG B;  4DHZ B;  4N58 A;  1OQY A;  1GNU A;  3JSV A;  3T8M A;  5EE9 A;  2JWU A;  3MC0 B;  3EFU A;  4JGH B;  3GZN B;  1J19 A;  3TBL D;  3DDC B;  4DDI D;  4QAY A;  4HDO A;  2ZCC A;  3P4R B;  1N5X A;  3NS8 A;  1YN3 A;  2D3B A;  1EF1 A;  4GN1 A;  1S3S G;  2RDH A;  3W5V B;  1TIF A;  1Q0W B;  1M94 A;  2SEB D;  4XZ4 A;  2DAF A;  1ZGU B;  2HJ8 A;  1H4R A;  4EEW A;  2J42 A;  4JX1 C;  3UQA A;  4JWU C;  3AN1 A;  1T0S C;  1F0Z A;  1V9J A;  2FCQ A;  3NY5 A;  3UF8 A;  2DLB A;  2XNA C;  4RM8 A;  2KC2 A;  4XX5 A;  1J7C A;  2MLB A;  1T3Q A;  1XLQ A;  3SDL C;  1I7H A;  3P1M A;  4GDL A;  2QSD A;  2MEK A;  3ZW3 A;  2BBC A;  3AUL A;  1K8R B;  2V3S A;  3VTW A;  3ZO5 B;  2X8X X;  3A9K B;  2MWS B;  4GDK A;  1D3Z A;  4MH0 E;  3UQB A;  5BMI A;  1IBX A;  1QKZ A;  2BT6 A;  4C4V A;  1WE6 A;  4EKU A;  1RYJ A;  1C9F A;  4ICV A;  2GBM A;  3WAM A;  3KH0 A;  1VZ8 A;  3CMM B;  1VRA B;  2RMM A;  1WZ0 A;  4GB9 A;  3EGR A;  1E7V A;  3GP7 A;  1PGX A;  4KGS A;  4USA A;  2IBI B;  3PGE A;  3LB8 C;  1WXQ A;  2WXL A;  3OG5 A;  2FBW B;  3EHV A;  3T3O A;  2TSS A;  1F52 A;  1RFA A;  2KQ7 A;  3AH7 A;  2LEK A;  4IW0 A;  1R4M B;  4BVU C;  4GIV A;  2Z0E B;  2WXR A;  2AWT A;  3IHP C;  1HXY D;  2YEP B;  1OGW A;  2IGD A;  1I4R A;  3ZDT A;  2WQY B;  3QX1 A;  1KLG D;  5TR5 A;  3HHM A;  1BT0 A;  3CST A;  3NHE B;  1I4P A;  1MI0 A;  3DBH I;  3OLM D;  2HDE A;  1V6E A;  3L16 A;  4LNI A;  1AYF A;  2NTS A;  1TZ1 A;  5AUK A;  2L1A A;  4W9J A;  4LDT B;  3A9J B;  4DWF A;  2WXH A;  2NMQ A;  4GSW A;  1VR9 A;  4AOF A;  3NVW A;  3PVL A;  3NJT A;  2V4L A;  4HKZ E;  3PZ8 A;  4DHJ D;  1RLF A;  1MVK A;  1WJN A;  1YJJ A;  4F1S A;  1FXT B;  3I63 C;  3VH3 B;  1I4Q A;  1YOV B;  3TUO A;  4JWS C;  4FLH A;  2GBK A;  3L54 A;  4I6P A;  3AE7 B;  1TKG A;  2LGI A;  2DHZ A;  4G3X B;  2IZV B;  2KFK B;  4AQ7 A;  1LXD A;  5HKH A;  2INN E;  4KZC A;  1MHX A;  4HK2 A;  3ZXV A;  3NS1 A;  3DBR B;  4WAA A;  1JQ4 A;  4MGZ E;  3RYT A;  1AWD A;  2BVC A;  4BKS D;  3HM3 A;  3AV8 A;  1WI0 A;  3DHH C;  4HLE A;  2N1V A;  1F1H A;  2DYM A;  2V9H A;  4LK0 M;  1VDV A;  4J3O D;  3H9D A;  1KFY B;  1WGH A;  5G5G A;  3R7Q A;  3RUL A;  3U30 A;  5LLI A;  3ZDM C;  4US9 A;  3R2I A;  2EKE C;  1PDX A;  1E8Z A;  2WU5 B;  4ANU A;  4RGO S;  2YLM A;  1XD3 B;  2N9P C;  2BYV E;  3DWG C;  3MC9 A;  3IFW B;  2KJH B;  1YIW A;  4A9A A;  5AZG A;  3IAM 1;  2GRI A;  1M4V A;  1JML A;  1AW7 A;  4M00 A;  1SE4 A;  4W9K A;  1WR6 E;  2KMC A;  2IO3 B;  1TBE A;  4BZA A;  3V3X A;  3L10 B;  5HFY A;  2V0G A;  4N59 A;  4IWQ A;  4LNN A;  1YNT E;  3L4P A;  3N9Y C;  3O65 B;  3H1U A;  5D94 A;  2KTR B;  4ARI A;  5GXG B;  3H7S A;  4M0W A;  2IND C;  3TMP B;  2KNB A;  1YQB A;  3KUC B;  3SHQ A;  5EE3 A;  4XDD A;  3BYT B;  3ZQ4 A;  3TSS A;  4DQO C;  4L2Y A;  1I4X A;  1WWT A;  2MP2 B;  1SBB B;  2KT7 A;  1STE A;  2WGS A;  2KJR A;  1SF0 A;  4NZL B;  2K1F A;  3VUY A;  1FFU A;  1YMH E;  1KJT A;  2RPV A;  1E8X A;  1ZOY B;  2KTF A;  1ZE3 D;  3DBR I;  3IT4 B;  1HE8 A;  2KAC A;  3HVD A;  2LVQ A;  3L0W B;  4BKS A;  2PW9 A;  1TGZ B;  1IPG A;  4M8N A;  3AE4 B;  4NQL B;  3W5U B;  1Z2M A;  4WWN A;  4P16 A;  4YXD B;  3A1Q A;  2UU7 A;  2I38 A;  4GDL B;  1V80 A;  4WH4 A;  2LGY A;  4GMV A;  2OOB B;  2ZEQ A;  2JPH A;  4XYC A;  3VDZ A;  1MHH E;  2W82 A;  3AEA B;  4WAF A;  3QA8 A;  3KUZ A;  1TY2 A;  2INC C;  2N0S B;  2REX A;  4GDK B;  3D32 A;  4LNK A;  1IBX B;  3QIJ A;  4C4V B;  1FEH A;  3QJZ A;  3MFG A;  3N1X C;  2BGF A;  2V1Y A;  4ZRI A;  2K6Q A;  1TS2 A;  4TUU A;  4RGN A;  4K3C A;  1ENF A;  2L32 A;  2FE8 A;  1T6B X;  2I1K A;  4RF1 A;  3CWI A;  2WXG A;  2B3A A;  2ZVN A;  2DWQ A;  3MC8 A;  3P2B A;  1WJ6 A;  4LNF A;  3W2D A;  4FJV B;  1T0Y A;  1CMX B;  1HZ5 A;  3KYC D;  5HI1 A;  5E6J A;  1VZ7 A;  3B9J A;  1WX7 A;  1E0Z A;  1D4B A;  2D10 A;  5LXH A;  2FCS A;  1FFV A;  4OZB A;  4P6V F;  4ANV A;  1KLV A;  3T9L A;  3C8Y A;  1Y56 A;  1FNW A;  2WU2 B;  4X57 B;  1WR1 A;  4M8M A;  3PHW B;  2LAS A;  3AU5 A;  2PE6 B;  3AM9 A;  3ZNZ B;  3DHI C;  2I2Y A;  2LMC A;  1T0Q C;  2ZW1 A;  4ZRP A;  2OED A;  3PRE A;  5G55 A;  3OJ3 A;  1HZ6 A;  4BOZ B;  2Q5W D;  3APC A;  5D7G A;  3P4S B;  2BQQ A;  2KX3 A;  4OZC A;  4W9L A;  4MGY E;  1Z5S B;  3JW0 X;  4K7S A;  4PYZ A;  1WGY A;  4J6I A;  1SJH D;  1FXA A;  3BVG A;  3P4P B;  1WZ3 A;  2KDI A;  4HRS A;  4MH8 A;  4WJO A;  1VJK A;  3ZVV A;  4M02 A;  4LJO B;  2GI9 A;  3SEB A;  1V86 A;  1ZDV A;  4XDC A;  5C3J B;  4BOS C;  2MA9 B;  4PT5 A;  1UEL A;  3WIM A;  4EUT A;  1K52 A;  1KTK A;  3BVZ A;  2G9H D;  4E74 A;  5G5H A;  1A5R A;  3EA6 A;  4IWO A;  1P1A A;  4ZYN A;  1FCL A;  3DBS A;  4FHK A;  1I4H A;  4HDQ A;  1UH6 A;  4OVV A;  5G2N A;  1XLO A;  4YTM B;  1KLU D;  2ACZ B;  4AJY B;  1ZW7 A;  4C80 A;  1ROE A;  1C79 A;  3VUW A;  2BS2 B;  2H88 B;  4GXB A;  1C1Y B;  4UDU C;  5CX3 A;  3M62 B;  2PIA A;  3I9V 1;  4US8 A;  1C4P A;  1WGR A;  3WAP A;  4IG7 B;  1XF5 L;  1JRO A;  2M17 A;  1FXI A;  3LJ3 A;  3NZ3 A;  3ZJV A;  4DBG A;  2BS4 B;  3V60 A;  1ZKH A;  1E9M A;  1NYQ A;  2OJR A;  1HTO A;  1IUE A;  2Z8L A;  3IAS 1;  3VRB B;  1WJU A;  3Q14 C;  1F9J A;  4ZRK A;  3AED B;  2W3R A;  3PLV A;  1SXT A;  3RD2 A;  2GLS A;  3U8Z A;  3Q3F A;  2HJ1 A;  1L0Y B;  4RMA A;  3KYD D;  3NRZ A;  3C0R B;  2MRP A;  1I35 A;  1TS5 A;  3ZIM A;  4DHJ B;  4NY0 A;  3LYY A;  2MQJ A;  4YWG G;  1MG8 A;  3IVF A;  4DXA B;  1CK1 A;  1YJ1 A;  3HVZ A;  2PVO D;  1YN4 A;  2WXF A;  1C4A A;  4G0N B;  1GAQ B;  2KWV B;  2L05 A;  1C76 A;  1SE3 A;  1K51 A;  3TEX A;  3Q3J A;  5H8Y E;  1NEN B;  2ZNV C;  1R4N I;  3RT3 B;  4LJP B;  5TSS A;  3N20 C;  3QWZ B;  2NTT A;  2PVG C;  4D2K A;  4ZDV A;  1L4Z B;  2XN9 C;  3RNC C;  3RUI B;  4HPP A;  2GMI C;  1WGG A;  3PZ7 A;  2NVU I;  3NZU A;  4I6L B;  1BML C;  2D3G A;  1EO6 A;  1S1Q B;  4IDI A;  3GE8 C;  3ZRF A;  3A1Q B;  2JYT A;  1ZP0 B;  1D6E C;  1UF0 A;  4LLG M;  2XK5 A;  1QIL A;  2WDT B;  4EZJ A;  5C23 A;  4WJN A;  2ASQ A;  4OVZ A;  5C2T B;  4TQ0 A;  1KF6 B;  2BYF A;  2WWZ A;  3SU8 X;  2ZVO A;  3Q69 A;  4PS7 A;  3OAW A;  5IO9 A;  1XCQ L;  3QAR A;  4P7I A;  2MJD A;  3L13 A;  3FIL B;  4BKG A;  2LFI A;  2GB1 A;  4MJS B;  2Y3A A;  1E5W A;  3ZRC A;  2JRI B;  1TT5 B;  2IY0 B;  4ZRQ A;  3AE3 B;  3GOE A;  1J7B A;  1WX8 A;  5LXI B;  1XLP A;  5DPR A;  1L2N A;  2JZP A;  1SIJ A;  5JZE B;  4MDK E;  1X1M A;  4MEM A;  3NZS A;  4EZL A;  1DYQ A;  1L4D B;  5FR3 A;  5JHA A;  4HVB A;  2WXO A;  5E6N A;  3W9C B;  4RFB A;  4MSM B;  1I42 A;  2R2O A;  1PQS A;  4ASW C;  4DDG D;  1OEY J;  4AUQ C;  2K3U A;  1NVI D;  1ZUD 2;  4NJC A;  3APD A;  3VRA B;  2QJL A;  3ENE A;  1SE2 A;  5J17 A;  3HK0 A;  2M1M A;  1L6V A;  3ZNH B;  1ISN A;  3PO0 A;  3X23 A;  1HQR D;  3N30 A;  3ML9 A;  2J7Q B;  1OFF A;  4YTP B;  3ZXR A;  4PK1 A;  3GZN I;  4REZ A;  2CJN A;  1QQR A;  1FIQ A;  2MBB B;  2IO2 B;  1PUT A;  3FAH A;  1ACC A;  1D5X C;  2KHW B;  2H89 B;  4MGI E;  2KDB A;  1G6J A;  2IO0 B;  1Q10 A;  4HJG E;  1E8W A;  3OWE B;  2KQ4 X;  4RGT A;  1ZDX A;  3IBE A;  4IKG A;  2C7H A;  1SIF A;  1WGD A;  2BKF A;  3I3T B;  3N1Z C;  1L0V B;  1NI2 A;  2KDM A;  2N4F A;  2AL6 A;  4WIP A;  3M3J A;  3VAW A;  4FA6 A;  1ZXH A;  1P7F A;  1QZE A;  2WXM A;  3NOB A;  2C7M B;  5IKC M;  3EC8 A;  4O1N A;  2IGG A;  2KAN A;  3ZTC A;  2N9L A;  5BMG A;  1IP9 A;  4NPN A;  4W9D A;  1P7E A;  3B0A A;  3LDZ E;  2W55 A;  2WDQ B;  2LUE A;  5JXV A;  1WRI A;  2M0A A;  2QIE B;  2JYE A;  4NAW A;  1XEE A;  4JPS A;  1SGH A;  3VVW B;  3RFZ B;  3ZGZ A;  3AEB B;  2MBQ A;  3BII D;  3PRM B;  3AE9 B;  2BPS A;  3Q8F A;  1R4M I;  1PGB A;  1V8C A;  2DZI A;  5CTR C;  1FD6 A;  4IWP A;  3QK0 A;  2LXC A;  3PRP B;  2D11 A;  2L3Z A;  5FK9 C;  2BS3 B;  3IXS A;  2NBU A;  4A90 A;  3B08 A;  1UGM A;  2AQ3 B;  2INP E;  2JQR B;  1QOA A;  3DWM A;  1MFW A;  3DCG A;  4E71 A;  3VH4 B;  1YN5 A;  1YX5 B;  2IYD B;  1J7A A;  1EWC A;  5IOI A;  3B2F A;  2VH1 A;  3S2A A;  5FR6 A;  1I4G A;  3MHZ A;  4MT5 A;  2L0T A;  1N61 A;  5EE0 A;  1LM8 B;  1TKE A;  2ZCB A;  2JY6 A;  1NDD A;  5BMH A;  1F2R I;  4A55 A;  2KXJ A;  2BYT A;  2KMA A;  3K9O B;  1UD7 A;  3RNB C;  1JCK B;  4KX6 B;  4H2A A;  4OW0 A;  2R2Q A;  2LJI A;  2K25 A;  1UWM A;  3Q8B A;  2AEH A;  3T3N A;  3IG3 A;  3JSV B;  4E3C A;  3N32 A;  2PEA A;  5DPW A;  1D5M C;  3E9S A;  2ZW0 A;  1WXV A;  5AZF A;  2KQS A;  3AE8 B;  1V1P A;  2WYQ A;  1IGC A;  4RM9 A;  2WXN A;  2FID A;  1PGA A;  4HJK A;  1YD8 U;  3UIN B;  4DHZ E;  5J2R A;  2XK5 B;  5L95 C;  1FRR A;  5EE1 A;  2KO3 A;  1YQ3 B;  3BYY B;  1AAR A;  1C3T A;  1JRP A;  4YL8 A;  5AZH A;  1NEK B;  4WQM A;  2RD0 A;  4IC7 B;  1PFD A;  4HKQ A;  1NI3 A;  3AXC A;  5GMV A;  1UBI A;  2DAJ A;  2BWE S;  5KHO A;  1DOX A;  1OTR B;  1N5W A;  2DEN B;  2KN5 A;  1FM0 D;  3Q2A C;  4W9G A;  4B95 A;  2KMM A;  1KM7 A;  2Y5C A;  3ABV B;  5LNK 1;  4HRO A;  1JWA D;  3BZD B;  5BYS A;  3TEY A;  2ON8 A;  2G3Q B;  2PLP A;  2ONQ A;  2L8J A;  2WLB A;  1N60 A;  2YEP F;  1R7S A;  2WXJ A;  2JWZ A;  2JXX A;  2CU3 A;  3QC8 B;  1T5X D;  1NYR A;  3V6E B;  2MBE A;  4KIK A;  2J4X A;  2VRR B;  2NCN A;  4JE3 B;  4FXC A;  2V4I B;  4ARC A;  1ET9 A;  1JWU D;  3Q3N C;  1V97 A;  1KH0 A;  3JVZ X;  5JH5 C;  5DPS A;  2RDG A;  1YQ4 B;  3ECI A;  1FNU A;  2N9K A;  3DVG X;  1WGK A;  5FKA C;  1J0G A;  4W9F A;  3W1S C;  3K9P B;  1ZXI A;  3J9C A;  2N7E A;  4JLC A;  1F77 A;  1OEY A;  3CF6 E;  5BYQ A;  2J0J A;  4XWT A;  4TQ1 A;  2E3T A;  2J0M A;  5IN7 A;  1U4A A;  4C7Y A;  1C4C A;  1V1O A;  1ESF A;  1K53 A;  2L7R A;  3KWV A;  3ZKJ C;  1WXM A;  1BUI C;  3DBL B;  2KN4 A;  2XBB C;  2KAJ A;  4MM3 A;  1EUV B;  1QF6 A;  3QAQ A;  1V81 A;  1GC7 A;  1WM2 A;  3RNF C;  2NR2 A;  2Y5P A;  1GJZ A;  1UNS A;  2KJ6 A;  4WWO A;  5D3D A;  4FAD A;  1FCC C;  3PS6 A;  2D2Q A;  1WRD B;  3NVY A;  1L6U A;  1LO5 D;  3TIX A;  1N6Z A;  1FMA D;  2LZ6 A;  4F7Z A;  3CIR B;  5T8I A;  2MJE A;  2BWF A;  3RZW C;  3RI7 C;  4GLS C;  2IJ0 A;  3VFK A;  4NJ6 A;  5D3I B;  3AMZ A;  2KX0 A;  1MJD A;  3H7P A;  4KGR A;  2KK8 A;  4FJY A;  2BKR B;  1VCB A;  2AL3 A;  5BO4 B;  2KVR A;  2FUH B;  2JT4 B;  5C1Z A;  3UI3 A;  1LGR A;  2D5G A;  3AE1 B;  1TTN A;  4BKT A;  2LXA A;  1RRB A;  3KLS X;  4W9C A;  2MSE D;  2N7D A;  3TJP A;  3A9J A;  3A4R A;  4F8C B;  4BBN F;  1TKY A;  1H8C A;  2NBW B;  2DNF A;  4NJ7 A;  1HEZ E;  1UWX A;  4ZYS A;  1CZP A;  1AN8 A;  2K8C A;  2M56 B;  3QHT A;  2PTL A;  1L7Y A;  4IM0 A;  2MJ3 A;  5JHB A;  3HRD D;  2JUO A;  2MCN B;  1WIA A;  2QCZ A;  3P42 A;  3ZUN A;  3BVM A;  3SR6 A;  4K1R B;  1FO4 A;  2CKH B;  2WX0 A;  1WYW B;  3RNG C;  3OJ4 B;  1JWB D;  1TY0 A;  4W9H A;  1WJ4 A;  1WSP A;  4K7W A;  4TV3 A;  2BTE A;  2CHW A;  1MPE A;  2I1J A;  2VZK D;  1TZO A;  2GOW A;  1EWY C;  3V61 A;  5I4D A;  3EFC A;  5DPT A;  3PZD A;  2G4S A;  2AX5 A;  3GS2 A;  2LUM A;  2FNJ B;  4OHJ A;  4DXF A;  2CU1 A;  3APF A;  4M0W B;  3Q8A A;  4KKI A;  1KOT A;  1XQQ A;  4A3O A;  4WWP A;  3ETR A;  5CHV C;  2X38 A;  3RN9 C;  4GU2 A;  1XO3 A;  4ZHP A;  4HEA 1;  2KWD A;  1F2R C;  2KC1 A;  1V1P B;  2LJ5 A;  2Y5B B;  1HA5 A;  3TEW A;  2A4Z A;  4B0E A;  4NQK E;  1L0X B;  2FAZ A;  1EU3 A;  3VTV A;  1GUA B;  4ZHO A;  4XC2 A;  1WXS A;  3DVN V;  4N6E B;  3U52 E;  4EFO A;  1N62 A;  2KKC A;  1B9R A;  4IM3 A;  4S17 A;  4XWW A;  2LD9 A;  2GBR A;  4G11 A;  2GBN A;  2CHZ A;  3TL5 A;  1EF5 A;  1XT9 B;  1P0R A;  3PV1 A;  4OZA A;  5IAA C;  5BYR A;  2K39 A;  2LHD A;  5CHW A;  3SFE B;  2KDF B;  2N7J A;  2LGX A;  3N3K B;  3PSE B;  1JAL A;  3EUB 2;  1LFD A;  1E7P B;  3VR9 B;  2MP2 A;  4AWJ A;  2O6V D;  1P9D U;  3UGB B;  3DBH B;  5DCN A;  2XEW A;  4KIK B;  3PPA A;  3KQ4 A;  1A70 A;  1KRH A;  1TS4 A;  3P4Q B;  5D6J B;  4XE0 A;  2W54 A;  3DVN U;  4BBN C;  4WJP A;  2EEL A;  4CYE A;  3VXW A;  4FUL A;  2DYO A;  2GBJ A;  4YT0 B;  2WXI A;  4K3B A;  2OJW A;  3WAL A;  4G50 A;  3AEG B;  3URY A;  3JYU A;  2G45 B;  2PKO A;  4NAM A;  1L5P A;  3MHS D;  2NBV B;  1WYG A;  1SEB D;  2JU6 X;  3I5J C;  1UZX B;  4BAX A;  4WUR A;  5E6O A;  3HUI A;  1YJI A;  4MEL A;  4PS8 A;  3Q3M C;  4FN2 A;  5MPO A;  3EEC A;  4MM3 B;  4II3 B;  2NPT A;  3RZF A;  1D5Z C;  2ZZP B;  2K22 A;  1GOZ A;  4GOC A;  4EZK A;  1CQV A;  3TCA A;  3SFD B;  2K9X A;  1WX9 A;  3PT2 B;  4II2 B;  4FHJ A;  4KSK C;  1WY8 A;  1NBF C;  2LVP A;  2JSV X;  4MGK E;  1QOF A;  2D3C A;  3UIO B;  1JW9 D;  4C56 C;  4NNJ B;  1K50 A;  1E90 A;  4KZ0 A;  4I6N B;  1GB1 A;  4IUM B;  4RGM A;  3H7P B;  4R3D A;  1RWS A;  4RCO A;  2VH2 A;  4ANW A;  3MTN B;  2C9W B;  4KVG B;  2L83 A;  2BB6 A;  2O6V A;  2IDY A;  4KSL C;  3H8H A;  4GGQ A;  4DXG A;  1J8C A;  2JXT A;  2DYB A;  2Z0D B;  2JX5 A;  4ITK A;  2WP9 B;  2O2V A;  2LWP A;  4LCD E;  2KLC A;  1B1Z A;  3AEC B;  2SAK A;  2QIL A;  1XCT L;  3ZNI D;  1ZPS A;  2LGD A;  2BYE A;  3DQV A;  2LGS A;  2RDB C;  3B1L X;  1HTQ A;  4KDI C;  4YSY B;  1V2Y A;  1ET6 A;  1E7U A;  2ZNV B;  2LHE A;  3DOW A;  3BWU D;  4HCP B;  2PJH A;  1EM7 A;  2PPH A;  4AJW A;  3M95 A;  2MBO A;  2JZZ A;  3V05 A;  2B76 B;  3U2S C;  2N9E B;  4W9I A;  2K8H A;  4ZRJ A;  3ALB A;  5EDS A;  2HTH A;  3AU4 A;  2IPK D;  1QLB B;  2D3A A;  2ZPY A;  2LRW A;  3KVF B;  2K5P A;  3E56 A;  2LVO A;  1WH3 A;  5H92 C;  1RM6 C;  2IO1 B;  2ZPN A;  3DHG C;  1TJE A;  1T0R C;  2FUG 1;  2BB5 A;  3HIZ A;  1Q5W B;  3CSF A;  2RPQ A;  5AEK B;  2QMT A;  4A6Q A;  2KWC A;  1EU4 A;  2WX1 A;  3GE3 C;  3NVV A;  4ACF A;  2K8B A;  2G4D B;  1WMH A;  2WXP A;  2CJO A;  1SE9 A;  1VLB A;  4KDL B;  4DK5 A;  5AUI A;  4OVU A;  1Q1O A;  3HM6 X;  2QC8 A;  2MHJ A;  3U7Z A;  1IGD A;  4K7U A;  1C77 A;  1FNV A;  2AQ1 B;  1QOG A;  3W1Y A;  2AYO B;  3M63 B;  3R7R A;  4EE2 A;  4KV2 A;  3QQ8 B;  3MJ5 A;  3WAN A;  3C19 A;  4YTN B;  2D07 B;  3PRZ A;  2HD5 B;  4KKJ A;  1SJE D;  3KWL A;  2KYW A;  2RSU A;  3I57 A;  5D2M B;  1P3Q U;  3RMK C;  5HG2 A;  3U4E G;  2J0K A;  3GB1 A;  2WXK A;  1C78 A;  2K6D B;  2HTM E;  3U7D A;  4W9E A;  2FIF A;  1XLN A;  3Q8C A;  4ANX A;  4B0M A;  3W1S A;  3PTF C;  2EMT A;  2BW2 A;  2M19 A;  2VZK B;  2IGH A;  5KHQ A;  4TKN A;  3AB5 A;  2J53 A;  4MAC A;  2DBY A;  4RF0 A;  1FPY A;  1N63 A;  5IP4 D;  2MBH A;  1GPX A;  3R2T A;  3VTU A;  2KZR A; 
#chains in the Genus database with same CATH homology
 1UWX A;  1XCQ L;  4ZYS A;  1CZP A;  1AN8 A;  3NS1 A;  3LXF A;  2M56 B;  1FRD A;  2MJD A;  2PTL A;  3FIL B;  1JQ4 A;  2MJ3 A;  1AWD A;  2LFI A;  3HRD D;  2GB1 A;  4C7Z A;  2Y3A A;  1PYW D;  3AV8 A;  3P42 A;  3VR8 B;  3BVM A;  3SR6 A;  1FO4 A;  4IOI E;  2DYM A;  3AEF B;  4LK0 M;  1VDV A;  3NVZ A;  2WDV B;  4ZRQ A;  1JWB D;  1TY0 A;  3AE3 B;  4J3O D;  1KFY B;  2WS3 B;  1J7B A;  1WSP A;  5G5G A;  1XLP A;  1E6E B;  2JZP A;  3R8B A;  1SIJ A;  2OHF A;  4US9 A;  3R2I A;  2BTE A;  2VZK D;  1MPE A;  4YSZ B;  1PDX A;  1TZO A;  2WU5 B;  4RGO S;  1EWY C;  5I4D A;  3FIL A;  3DWG C;  2AX5 A;  3GS2 A;  1DYQ A;  2LUM A;  1L4D B;  1TS3 A;  4A9A A;  5FR3 A;  4OHJ A;  1CJE A;  4DXF A;  2WXO A;  3W9C B;  3IAM 1;  4TMA B;  2GRI A;  1M4V A;  3Q8A A;  4KKI A;  4RFB A;  4ZOH C;  1JML A;  1AW7 A;  3ETR A;  2K3U A;  1NVI D;  1ZUD 2;  2X38 A;  4NJC A;  3VRA B;  2QJL A;  1SE2 A;  1XO3 A;  1SE4 A;  4L23 A;  1L6V A;  4ZHP A;  4HEA 1;  2KWD A;  1F2R C;  3V3X A;  1V1P B;  3PO0 A;  5HFY A;  1HQR D;  2V0G A;  4CQN A;  4TSS A;  4N59 A;  1HA5 A;  3TEW A;  2K0P A;  1OFF A;  4YTP B;  1YNT E;  2V3N A;  3L4P A;  3N9Y C;  3WCQ A;  4B0E A;  2ICI A;  1L0X B;  1EU3 A;  2PMV A;  4REZ A;  2CJN A;  4ZHO A;  1QQR A;  1FIQ A;  4KGT A;  2AQ2 B;  4N6E B;  4ARI A;  5GXG B;  1JWM D;  3TEZ A;  4M0W A;  3Q8E A;  3U52 E;  1N62 A;  1XXG A;  1B9R A;  4LTU A;  5EE3 A;  4XDD A;  4XWW A;  3BYT B;  1PUT A;  3ZQ4 A;  3FAH A;  1ACC A;  1D5X C;  3TSS A;  4DQO C;  4L2Y A;  2EKI A;  1I4X A;  1WWT A;  1SBB B;  1STE A;  3RPF C;  2H89 B;  1SF0 A;  1DOY A;  4NZL B;  4OZA A;  1Q10 A;  1FFU A;  4HJG E;  1YMH E;  3OWE B;  2R61 A;  2KQ4 X;  5BYR A;  4RGT A;  2J52 A;  1ZDX A;  1SB3 C;  2RPV A;  1ZOY B;  4AS1 A;  2LHD A;  4IKG A;  3SFE B;  1ZE3 D;  4YSX B;  2N7J A;  3AE5 B;  3IT4 B;  1L0V B;  2KDM A;  4WIP A;  2KAC A;  3HVD A;  1ZXH A;  1P7F A;  2WXM A;  1RFK A;  1JAL A;  2PW9 A;  1OQQ A;  3EUB 2;  3MP9 A;  4NAW B;  1E7P B;  4O1N A;  3VR9 B;  3AE4 B;  3W5U B;  2WNM A;  2IGG A;  2WDR B;  4P16 A;  4YXD B;  1VZ6 A;  2I38 A;  4GDL B;  4L1B A;  2N9L A;  3B2G A;  4WH4 A;  5BMG A;  4A8X C;  1UGJ A;  1QOB A;  3O13 A;  3KQ4 A;  1A70 A;  1KRH A;  1P7E A;  2W55 A;  1MHH E;  2E6X A;  2W82 A;  2WDQ B;  3AEA B;  4WAF A;  5JXV A;  1TS4 A;  3P4Q B;  1TY2 A;  2N0S B;  4XE0 A;  4GDK B;  1WRI A;  2W54 A;  2M0A A;  1JWS D;  1IBX B;  3AEE B;  2QIE B;  2JYE A;  2G1E A;  2EEL A;  1XEE A;  4JPS A;  1FEH A;  3MFG A;  2DYO A;  4YT0 B;  1E10 A;  3RFZ B;  2WXI A;  3ZGZ A;  3AEB B;  1TS2 A;  3BII D;  3AE9 B;  3Q8F A;  3AEG B;  4RGN A;  3AE2 B;  1ENF A;  1PGB A;  1V8C A;  2L32 A;  3URY A;  1FD6 A;  2V3P A;  2PKO A;  4NAM A;  5HHD G;  1L5P A;  5FK9 C;  1WYG A;  2FE8 A;  1SEB D;  1T6B X;  2JU6 X;  2BS3 B;  3IXS A;  4WUR A;  4A90 A;  2W3S A;  3IT6 B;  2AQ3 B;  2INP E;  2JQR B;  3HUI A;  1YJI A;  4RF1 A;  3CWI A;  1QOA A;  3DWM A;  2WXG A;  2DWQ A;  5MPO A;  3BK2 A;  4Q2J A;  3W2D A;  4MM3 B;  1YN5 A;  1J7A A;  4WWM A;  1EWC A;  1HZ5 A;  1D5Z C;  3B2F A;  2K22 A;  5HI1 A;  1GOZ A;  5E6J A;  3ZYY X;  1I4G A;  1VZ7 A;  3B9J A;  3MHZ A;  1CQV A;  3SFD B;  2K9X A;  4MT5 A;  5EE0 A;  1N61 A;  1E0Z A;  1BXT A;  1QT9 A;  1TKE A;  1D4B A;  3NUH B;  1GB4 A;  3ZJU A;  3AE6 B;  5BMH A;  1DOI A;  1FFV A;  4OZB A;  1F2R I;  4A55 A;  2JSV X;  4P6V F;  2BYT A;  3ZJT A;  1QOF A;  1JCK B;  4KX6 B;  3C8Y A;  4H2A A;  1JW9 D;  4C56 C;  1Y56 A;  1OQR A;  4OW0 A;  1UUP A;  2L52 A;  2LJI A;  1FNW A;  1UWM A;  1K50 A;  2WU2 B;  3Q8B A;  3T3N A;  1DGJ A;  1GB1 A;  4RGM A;  3AM9 A;  4RNA A;  1D5M C;  3E9S A;  4R3D A;  2QEJ C;  2I2Y A;  1RWS A;  2LMC A;  2ZW0 A;  2ZW1 A;  4RCO A;  4ZRP A;  2OED A;  3AE8 B;  2MH7 A;  1V1P A;  1IGC A;  1HZ6 A;  3FC4 A;  2L83 A;  2BB6 A;  2WXN A;  2Q5W D;  1PGA A;  1SSN A;  2IDY A;  5D7G A;  3P4S B;  1FRR A;  4OZC A;  5EE1 A;  3H8H A;  3VQI A;  1YQ3 B;  3BYY B;  3P63 A;  3BK1 A;  4DXG A;  1JRP A;  4RH6 A;  1NEK B;  2JXT A;  4WQM A;  1SJH D;  2JX5 A;  4ITK A;  2WP9 B;  1FXA A;  2WXQ A;  1TYG B;  3AEC B;  1B1Z A;  3BVG A;  2SAK A;  4N58 A;  3P4P B;  2QIL A;  1PFD A;  4HRS A;  1XCT L;  1ZPS A;  4HKQ A;  4MH8 A;  1NI3 A;  1VJK A;  5EE9 A;  2JWU A;  3MC0 B;  2GI9 A;  3SEB A;  4YSY B;  1ET6 A;  1ZDV A;  1DOX A;  4XDC A;  5C3J B;  2LHE A;  1N5W A;  3BWU D;  3P4R B;  1N5X A;  4PT5 A;  1YN3 A;  1FM0 D;  1EM7 A;  1K52 A;  1KTK A;  3BVZ A;  2G9H D;  2KMM A;  5G5H A;  3V05 A;  2Y5C A;  2RDH A;  2B76 B;  3U2S C;  3W5V B;  3EA6 A;  2SEB D;  3ABV B;  5LNK 1;  1FCL A;  4HRO A;  1I4H A;  1JWA D;  3BZD B;  5BYS A;  3TEY A;  2J42 A;  4JX1 C;  1XLO A;  4YTM B;  2ON8 A;  2PLP A;  4JWU C;  3AN1 A;  1KLU D;  2ONQ A;  1F0Z A;  2ACZ B;  4C80 A;  2WLB A;  2DLB A;  2XNA C;  1N60 A;  2IPK D;  1QLB B;  1ROE A;  2YEP F;  1R7S A;  1C79 A;  1J7C A;  2WXJ A;  1T3Q A;  1XLQ A;  2CU3 A;  2K5P A;  1I7H A;  1T5X D;  3P1M A;  2QSD A;  2MEK A;  1NYR A;  2BS2 B;  2H88 B;  4UDU C;  3E56 A;  2J4X A;  2BBC A;  2PIA A;  4JE3 B;  4FXC A;  3I9V 1;  4US8 A;  2V4I B;  1C4P A;  5H92 C;  4ARC A;  1ET9 A;  1RM6 C;  1XF5 L;  1JRO A;  3NZ3 A;  1FXI A;  1TJE A;  3ZJV A;  1JWU D;  2FUG 1;  5BMI A;  2BB5 A;  1IBX A;  1QKZ A;  1V97 A;  1KH0 A;  2BT6 A;  2QMT A;  1YQ4 B;  2BS4 B;  2RDG A;  4A6Q A;  1FNU A;  2N9K A;  1RYJ A;  1WGK A;  1C9F A;  5FKA C;  1E9M A;  1EU4 A;  1NYQ A;  1VZ8 A;  2Z8L A;  1IUE A;  3IAS 1;  1ZXI A;  3J9C A;  3VRB B;  1VRA B;  1F77 A;  2RMM A;  3NVV A;  3EGR A;  5BYQ A;  3GP7 A;  4XWT A;  4TQ1 A;  1PGX A;  2E3T A;  2W3R A;  3AED B;  1SXT A;  4KGS A;  4USA A;  1L0Y B;  2WXP A;  2CJO A;  1VLB A;  3LB8 C;  3NRZ A;  1WXQ A;  4C7Y A;  2WXL A;  1C4C A;  1TS5 A;  1V1O A;  1ESF A;  2FBW B;  1K53 A;  3KWV A;  2TSS A;  5AUI A;  3T3O A;  3AH7 A;  3LYY A;  4YWG G;  1CK1 A;  2LEK A;  1BUI C;  3HVZ A;  2KN4 A;  2PVO D;  2WXR A;  3U7Z A;  1YN4 A;  2KAJ A;  1C4A A;  2WXF A;  1IGD A;  1HXY D;  2YEP B;  2IGD A;  1QF6 A;  1I4R A;  1GAQ B;  1C77 A;  1C76 A;  1FNV A;  1SE3 A;  1QOG A;  2AQ1 B;  1K51 A;  3TEX A;  5H8Y E;  1NEN B;  2WQY B;  2Y5P A;  1KLG D;  1UNS A;  5TSS A;  2NTT A;  2PVG C;  4D2K A;  4EE2 A;  1L4Z B;  3MJ5 A;  5D3D A;  1I4P A;  1FCC C;  1MI0 A;  2XN9 C;  2HDE A;  3NVY A;  1L6U A;  1LO5 D;  4YTN B;  1FMA D;  4KKJ A;  1SJE D;  3KWL A;  1AYF A;  3CIR B;  5T8I A;  3PZ7 A;  3I57 A;  2MJE A;  2NTS A;  5AUK A;  5HG2 A;  2L1A A;  4GLS C;  3U4E G;  1BML C;  2IJ0 A;  2WXH A;  2NMQ A;  4IDI A;  2WXK A;  1C78 A;  3AMZ A;  3GB1 A;  1VR9 A;  5D3I B;  2HTM E;  1XLN A;  3Q8C A;  4KGR A;  4B0M A;  2JYT A;  3NVW A;  3W1S A;  1ZP0 B;  1D6E C;  2BW2 A;  2M19 A;  3PZ8 A;  4HKZ E;  1MVK A;  2VZK B;  2IGH A;  1YJJ A;  4LLG M;  3UI3 A;  1I4Q A;  1QIL A;  2D5G A;  3AE1 B;  3TUO A;  3AB5 A;  2J53 A;  4JWS C;  4MAC A;  2DBY A;  3AE7 B;  4RF0 A;  1TKG A;  3KLS X;  1N63 A;  2LGI A;  4OVZ A;  5C2T B;  4TQ0 A;  1KF6 B;  4AQ7 A;  1TKY A;  1GPX A;  3R2T A;  2INN E;  1HEZ E;  1MHX A;  3Q69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...