2FNJB

Crystal structure of a b30.2/spry domain-containing protein gustavus in complex with elongin b and elongin c
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
b'MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG2944-PF, isoform F
publication title Structural and functional insights into the B30.2/SPRY domain
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein transport/signaling protein
total genus 25
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2fnjB00
3QWZB 2HTHA 3AU4A 4FULA 3IG3A 3AXCA 4LJPB 3ZKJC 3A1QB 2J7QB 4ICUA 4XZ4A 3R3MA 5C23A 3IFWB 4FHKA 4ANXA 3TBLD 2CKHB 1Q0WB 2J0KA 2LGYA 1E8WA 1P0RA 3L0WB 4TKNA 4DWFA 3U30A 3UGBB 3AULA 2ZCBA 4G3XB 3R7RA 2EKEC 2J0MA 3DPDA 3KW5B 2AWTA 3PZDA 4G0NB 5AZGA 2YLMA 2BKRB 5HKHA 1YX6B 2GBNA 3ZO5B 1E90A 1V86A 2IO0B 4NPNA 2LUEA 3T9LA 4II3B 3ALBA 2KJRA 2ASQA 4DDID 2D2QA 4K81A 2DYMA 2NPTB 4IM2A 4NQLB 4WJNA 3EFUA 1WZ0A 2FNJB 2KKCA 2REXA 3PHWB 3PTFC 3QC8B 3NZUA 4IM0A 5D6JB 4MDKE 4AJYB 2KNBA 2KWVB 1SE9A 2PJHA 1S3SG 2O2VB 2D3GA 3VFKA 4K7SA 3WAMA 4EZKA 1XT9B 2G3QB 3IVFA 2ZZPB 4XC2A 1V2YA 3JW0X 2MRPA 3UQBA 2IO1B 3EC8A 2ZJDA 2GBKA 1WRDB 2L7RA 2XEWA 2KX0A 5G2NA 4E71A 2MP2A 1UZXB 2KLGA 2KMCA 3IBEA 3NZSA 3PHXB 3ZRFA 3ZNGC 2DAFA 2C7HA 2MLBA 5BO4B 2JXXA 4G50A 1K8RB 2L8JA 3OAWA 3QAQA 2LRWA 3R66C 4GSWA 1WE6A 2KJ6A 3P2BA 4KV2A 1UD7A 2KOXA 1V81A 2KQ7A 5CTRC 1P9DU 4MGZE 4FLHA 1WH3A 4ICVA 4W9KA 5TR5A 4WWNA 3H7PB 4EOYA 4EZJA 3GOEA 3DBRI 4GOCA 2R2QA 2MCNB 4F1SA 2IO2B 1E8ZA 2I1KA 1RFAA 1UGMA 1TTNA 1WXSA 2MA9B 5C1ZA 2FAZA 5DPWA 2KXJA 2EMTA 3APFA 3APDA 1NI2A 2LGXA 4MJSA 1V9JA 1TGZB 4FJYA 2ZNVB 2BKFA 2C9WB 1VD2A 4MJSB 4E3CA 5E6OA 2IZVB 3QK0A 2KN5A 4TUUA 2LI5A 4M0WB 1WXVA 3AU5A 5JH5C 1XD3B 1L7YA 2N1WA 4OVVA 1WFYA 2MBQA 3VH3B 3ZLZA 4JIOU 3L10B 2MBEA 2DZJA 2NBUA 1WGDA 4B6WA 1WM2A 2GBRA 2K6QA 4X57B 5AZHA 2LASA 3U8ZA 2N7DA 1V49A 2CR5A 3V62A 2OJRA 3TL5A 2XK5A 3KUZA 3GZNI 1RRBA 3KUDB 5D94A 5KHOA 4CHKA 3MHSD 2XK5B 1OEYA 1FXTB 1Z5SB 2JRHA 2G4DB 3HK0A 3K9PB 2JF5A 2L05A 2RD0A 4IUMB 3QA8A 3HM6X 4GN1A 4NQKE 5DPRA 3UIPB 1NBFC 3ZTCA 2WX1A 3JYUA 4W9CA 4BOSC 4GDKA 2C7MB 2HJ8A 2LRUA 4HCPB 3ZIMA 4BBNF 1S1QB 3SD5A 2ZVOA 1V5OA 4EFOA 2NBWB 2B3AA 2V3SA 2V1YA 2G45B 1SGHA 4A3PA 2LVQA 3VXWA 4EEWA 2NCNA 2KTFA 2R2OA 3APCA 2MQJA 3M63B 1ZW7A 4F7ZA 1P98A 2JUOA 3ONSA 4ASWC 3UIOB 3SHQA 3R7QA 2M17A 3A4SC 4ZRKA 3TCAA 3L17A 2KWCA 3N3KB 3SDLC 3ECIA 4CYEA 4E74A 3AI5A 5CHFA 3DQVA 3X23A 1PQSA 3DDCB 1KJTA 4M8MA 3H9DA 5DPSA 4BKTA 2D11A 5J17A 4JLCA 2AEHA 5CHWA 3OJ4B 2BPSA 1WJ4A 5LXIB 2M0XA 3A9JA 4W9LA 4FBJB 4HWIB 4CO7A 1YQBA 2KLCA 3PVLA 1WM3A 3H7SA 5LXHA 4DHJD 5GMVA 2CS4A 5J2RA 1V80A 1E7VA 3RZWC 3VTUA 3KYDD 3ENEA 2LZ6A 4HDOA 2CU1A 2ZNVC 3DVGX 3S2AA 4DXAB 4A20A 2KJHB 3VUXA 3BY4B 4BKGA 4HPMB 3DBHI 4KIKA 3JVZX 4K7UA 3PRPB 2KVRA 3C0RB 3V61A 4BBNC 4F8CB 2KANA 4EZLA 4IW0A 3SU8X 3WIMA 2IY0B 3B1LX 2KTRA 3PV1A 4KIKB 4YL8A 4IM3A 3A9KA 5DCNA 2KZRA 2KFKA 1WIAA 1WZ3A 3QX1A 3VH4B 1WR6E 4MEMA 1WX9A 1ISNA 2DAJA 2MBOA 3A9KB 3PT2B 4OVUA 4ZDVA 4WJQA 4LDTD 1MG8A 2KHWB 4PS3A 2I1JA 2JRIB 2XBBC 4G11A 3V60A 4NNJB 5G55A 2D10A 2MBBB 3CF6E 2KQSA 4KVGB 2JZ3B 4W9IA 3I3TB 4P7IA 2BF8B 3DVNV 1LQBA 3W1SC 4URKA 1J0GA 2NVUI 4ZRJA 5J18A 3HHMA 2DYBA 3NOBA 3V6CB 4K7WA 4GMVA 2AL3A 2KX3A 4GDLA 3V6EB 1YX5B 4WAAA 4FHJA 2N9XA 4PS8A 5D7GA 1OGWA 1EF5A 4GDLB 2MP2B 4PYUA 2N4FA 3VUWA 2ZCCA 5E6PA 2AL6A 1WMHA 4BVUC 3RCZA 3L08A 4IWQA 1LM8B 3DBLI 4HCNB 2LD9A 3QIJA 2O6VA 3QQ8B 3NHEB 2L76A 2GMIC 1V6EA 2RPQA 3UINB 4HPLB 2PE9A 4MSMB 5AEKB 5JZEB 1GC6A 2FCMA 3PRZA 2JY6A 4ANVA 3QJZA 3A4RA 1RAXA 1WX8A 3ZVVA 2FCQA 3HM3A 4J6IA 4BFRA 4JL9A 1OEYJ 4LCDE 4MGKE 5IAAC 2ZPNA 2JT4B 1E5WA 1IPGA 3IHPC 3K9OB 3LDZE 3O65B 3WA0A 1L2NA 2UYZB 3QARA 2L0TA 2JPHA 4W9FA 3DVNU 3W1YA 2MBHA 4ANWA 5KHQA 3BINA 3EHVA 4BKSA 3TIXA 2MX2A 1M94A 4WWPA 3TMPB 1HE8A 2N9PC 1SIFA 3CMMB 4KZCA 3KYCD 3M95A 1WY8A 1E8YA 1NDDA 1WE7A 2KK8A 2KFJA 3ZDTA 2C7NB 2LXAA 1H4RA 4NAWA 1E8XA 2KDBA 2O6VD 3Q3FA 4PS7A 4TQ1A 3VUYA 2MW5A 4A3OA 1Y8RC 4DHZE 4W9EA 4FADA 3QHTA 2N9EB 4DHJB 3DVGY 3T8MA 3VVWB 3A33B 3VDZA 5CHVC 2EMSA 4GDKB 4FN2A 1KOTA 1J19A 2DYOA 4IG7B 3OLMD 1KLVA 3KUCB 4KSLC 3RULA 5CX3A 5JHAA 1WGYA 3WANA 1KM7A 3ZUNA 2FCSA 3ZNHB 1LXDA 1BT0A 2ZVNA 2MSED 5LLIA 3L54A 4B95A 3H6NA 2KDEB 2BWFA 4MGYE 5D2MB 3RD2A 2GBMA 2MWSB 1GG3A 3ML8A 1X1MA 2K1FA 4LDTB 2FCNA 2WWZA 1GNUA 3MJWA 4WJPA 4AJWA 2VRRB 4KSKC 3KH0A 4ZRIA 3PSEB 1GUAB 3CSFA 4BKSD 2CHWA 5FR6A 2PEAA 2NS5A 2KMAA 2FUHB 3ZDMC 2DZIA 1OTRB 4FA6A 2IYDB 2KD0A 1TBEA 2M8SA 4GB9A 1WX7A 1WJNA 4IWOA 1UELA 1WXAA 1WGGA 3A9JB 5EDSA 2IBIB 3PLVA 2YVCA 2Z59B 4MGIE 4GU2A 1YJ1A 4EUTA 1R4MI 2K8CA 3VHTC 2JVCA 1P1AA 1T0YA 4HXDA 4PYZA 4MSQB 4NJ6A 2J0JA 2WX0A 1WJ6A 4RMAA 4RM8A 3VTVA 3RUIB 3X0WA 1JRUA 2WDTB 2HD5B 2C5LC 2LVPA 3L13A 1Q5WB 2BYEA 2DZMA 2RR9A 4IC7B 4B9KA 3VTWA 4ZYNA 4DHZB 1P3QU 1A5RA 2KTRB 3ZNZB 1UBQA 2IO3B 3Q3JA 2KFKB 2M4NA 3U7DA 1QZEA 1WF9A 1Q1OA 1D3ZA 1ZGUB 3WAPA 1J8CA 4DBGA 3PRMB 2K8BA 3VAWA 3B0AA 4AP4C 4KDLB 5JHBA 1TZ1A 2NPTA 2ZEQA 5L95C 1WYWB 1IP9A 1OQYA 1EUVB 2Z0DB 5L83A 4HVBA 2KDIA 1R4NI 1WJUA 3UF8A 2QHOA 4W9GA 2LJ5A 4AUQC 3VQIA 2LGDA 3ML9A 1WI0A 2O2VA 3EECA 4I6NB 2KDFB 1WMHB 2RSUA 2WYQA 3DCGA 2PE6B 1RLFA 2Z0EB 1EF1A 3ZTDA 4MM3A 2O6VB 3M3JA 3OJ3A 1LFDA 1XQQA 2K6DB 2KC1A 4DDGD 2M1MA 3H1UA 4W9JA 4TQ0A 4RM9A 2LXCA 2N7EA 2HE7A 1C3TA 3ZNID 2JZZA 3NY5A 3QCAA 1G6JA 1AARA 4BOZB 2NBVB 4GGQA 1YIWA 4II2B 2GOWA 1YD8U 1GC7A 2IY1B 1I42A 2L00B 4EKUA 3H7PA 3PS6A 2BGFA 1WR1A 2CHZA 4AOFA 2FIDA 2RGFA 4XX5A 2L3ZA 4N9F4 2BYFA 5AZFA 2K25A 3ZW3A 2NR2A 1IYFA 2A5UA 3PLUA 4HK2A 4I6PA 4MELA 4JQWC 3WAOA 1EO6A 1WGRA 4NJ7A 2C60A 2N1VA 4M8NA 3DOWA 4FJZA 3RZFA 2D07B 2DHZA 3N30A 2AYOB 3D32A 2KO3A 4JGHB 4NY0A 4KZ0A 1UBIA 4WJOA 1H8CA 2KWUB 4NAWB 5E6NA 3TJPA 4TV3A 4HDQA 2DENB 4DK5A 4W9HA 1C1YB 2V4LA 4W9DA 4K1RB 3CSTA 1UH6A 1WGHA 2CHXA 3UQAA 4GIVA 2FIFA 4AWJA 4FJVB 3KVFB 2W9NA 2LVOA 4GXBA 2JWZA 5IA7A 2Y5BB 3W1SA 1GJZA 4WWOA 4HJKA 4LJOB 2G4SA 3WALA 1I35A 3RYTA 3NS8A 1ZKHA 2DX5B 3N32A 2OOBB 1V5TA 2LWPA 3HIZA 4IWPA 3B08A 1Z2MA 2ZPYA 2KC2A 4WQOB 2L0FA 5DPTA 3DBSA 2A4ZA 3RT3B 1U4AA 2K39A 3JSVA 2BYVE 3LJ3A 4KDIC 3PPAA 4ANUA 1E7UA 4I6LB 1WXMA 2DZKA 3JSVB 1F9JA 2UWQA 3L16A 3MTNB 3ZRCA 2GBJA 2BWES 4HLEA 1CMXB 3PGEA 3PREA 2K8HA 1VCBA 2PPHA 3M62B 3A1QA 4MH0E
chains in the Genus database with same CATH superfamily
4LJPB 3A1QB 4ICUA 3U4EG 4ANXA 2J0KA 1JALA 1E8WA 1P0RA 5BMHA 1SB3C 3UGBB 2Y5PA 2ZCBA 4G3XB 2EKEC 1ZXIA 3GS2A 1TT5B 1E90A 1C79A 3P4QB 2KYWA 3ALBA 3RNCC 1DOIA 1HTOA 1FEHA 2D2QA 4K81A 2DYMA 4WJNA 1QOFA 4IM2A 4NQLB 1WZ0A 2REXA 2K22A 5D6JB 4MDKE 2KWVB 4XE0A 3J9CA 2D3GA 3VFKA 4K7SA 1XT9B 3IVFA 3O13A 1V2YA 3JW0X 2IO1B 2MP2A 3PHXB 3PO0A 4KGSA 1F52A 2L8JA 3OAWA 4GSWA 2J42A 2KJ6A 4KV2A 2KQ7A 4FLHA 1WH3A 1WWTA 3H7PB 3KWLA 3GOEA 3DBRI 2R2QA 2MCNB 1E8ZA 2I1KA 1RFAA 1UGMA 1TTNA 2L83A 1FXAA 1WXSA 2KXJA 1NI2A 3SEBA 1QOGA 4FJYA 2ZNVB 2N9LA 2BKFA 4B0EA 2IZVB 4TUUA 3AU5A 2J4XA 1L7YA 2MH7A 3VH3B 4BZAA 4RNAA 2L1AA 4US8A 4B6WA 2GBRA 2K6QA 4X57B 2LASA 2BT6A 2CR5A 1NVID 2IGGA 3GZNI 1DOXA 3MP9A 4KGRA 3KUDB 5KHOA 1D6EC 1Z5SB 1FXTB 2G4DB 2JF5A 2RD0A 4IUMB 4XGAB 1L6VA 4BOSC 4GDKA 1SXTA 4L1BA 3BVGA 4HCPB 2INPE 4FXCA 1V5OA 4EFOA 3ZJUA 2B3AA 3KQ4A 2N7JA 4A3PA 3T3NA 3AEBB 1FNWA 2JUOA 1JWSD 3SHQA 3A4SC 2KWCA 3N3KB 2QCZA 1N5XA 1SSNA 3AEGB 2PKOA 4LNFA 4M8MA 3H9DA 2WLBA 2AEHA 2N9KA 1PGAA 2M0XA 1FFUA 5I4DA 4HWIB 2R61A 1MFWA 1WM3A 4WURA 4DHJD 1V80A 4L23A 2BVCA 4DXAB 2KJHB 1L6UA 2X38A 3PRPB 1T0SC 2KANA 4EZLA 1C78A 4K3BA 3B1LX 3PV1A 2KTRA 5DCNA 1WX9A 1C9FA 4R3DA 2SEBD 2JRIB 2XBBC 2DLBA 3CF6E 4KVGB 4URKA 2DWQA 3VR9B 3Q3MC 3HHMA 3NOBA 4K7WA 2KX3A 4GDLA 3BVMA 4WAAA 4FHJA 4JPSA 4GDLB 1I4PA 2BTEA 5E6PA 2D3BA 1N62A 4IWQA 1LM8B 1PUTA 2MEKA 2WP9B 3QIJA 2O6VA 3QQ8B 3B2GA 2GMIC 3P4RB 2OHFA 2RPQA 4MSMB 4WH4A 5AEKB 3PRZA 2XN9C 3QJZA 1RAXA 2KAJA 4BFRA 4JL9A 1OEYJ 2QSDA 3ZXVA 4LCDE 3DBLB 1E5WA 1N63A 3LDZE 1L2NA 3WA0A 2HTME 2L0TA 2V0GA 4W9FA 1HZ5A 4BKSA 3TIXA 2MX2A 3EUB2 1HE8A 1SIFA 3CMMB 2WXJA 1VRAB 3KYCD 1WY8A 3M95A 1NDDA 1FPYA 2NTSA 3VUYA 3TUOA 3AEEB 1ESFA 5CHVC 3ZQ4A 4NAMA 1KOTA 1J7BA 3MC9A 3RULA 1GAQB 4RF1A 3ZUNA 4JWUC 3WANA 3ZNHB 2ZVNA 1ZUD2 2MSED 3L54A 2I38A 4B95A 2Z8LA 3MJWA 4WJPA 1IUEA 4ZRIA 2INCC 2CHWA 5FR6A 2NS5A 2KMAA 2SAKA 4FA6A 4GB9A 1WJNA 2IBIB 1KF6B 4GU2A 4EUTA 2EELA 4KKIA 3Q8BA 1P1AA 2WGSA 4HXDA 4P1CC 2LGIA 1D5XC 4MSQB 4NJ6A 2LVPA 1E10A 2JYEA 2BYEA 4IC7B 4B9KA 4ZYNA 1UBQA 5AUKA 5H8YE 1CZPA 5GXGB 1J8CA 4DBGA 3PRMB 3VAWA 2AX5A 4AP4C 1N61A 1LO5D 4OZBA 5BMGA 1L5PA 1C4PA 4D2KA 1WYWB 1OQYA 4LNKA 4HVBA 3TEWA 1FRDA 2QHOA 4I6NB 1WI0A 2O2VA 3EECA 2KDFB 4HJGE 2KQ4X 3AE5B 3DCGA 2PE6B 3M3JA 1IBXB 4DDGD 2M1MA 3EA6A 2LXCA 2N7EA 2HE7A 2W3SA 3NY5A 2E3TA 4NJCA 1GC7A 2IY1B 1F2RI 2BGFA 1I4QA 4AOFA 2RGFA 4N9F4 3ZW3A 1IYFA 2NR2A 3Q14C 2WDRB 4HK2A 1NENB 5G5HA 2C60A 2QC8A 1UGJA 3N30A 4M0WA 2KO3A 4JGHB 4WJOA 1H8CA 4TV3A 1SBBB 4DK5A 1A70A 3DBRB 4W9DA 2QILA 5BYSA 1FCLA 2CHXA 4XDCA 3AE2B 3B2FA 4HJKA 2G4SA 3W5UB 3MC8A 1ZDXA 4IWPA 3HIZA 3B08A 1Z2MA 2ZPYA 1HA5A 5JXVA 2A4ZA 3R2TA 2BYVE 3LJ3A 3PPAA 2OEDA 1LGRA 1FIQA 3MTNB 2GBJA 2WDQB 1VR9A 2BWES 4HLEA 1KH0A 3PGEA 5IKCM 4P16A 3M62B 1BXTA 3L4PA 2HTHA 2WQYB 2MJEA 3ZKJC 5IN7A 1KFYB 3IFWB 1Y56A 1XCQL 2VH2A 2LGYA 1ET6A 3L0WB 2JWUA 4TKNA 3ZYYX 2RDHA 4US9A 3R7RA 3AMZA 2J0MA 2QEJC 3DPDA 3KW5B 3PZDA 2WU2B 5AZGA 2YLMA 2BKRB 5HKHA 1GPXA 2LUEA 4II3B 1F2RC 1ROEA 3SR6A 1T6BX 2ASQA 1JCKB 2DNFA 1J7AA 1K53A 2FNJB 3PTFC 3QC8B 2BB5A 4IM0A 1TS5A 1MHHE 2VZKD 1YJJA 2GB1A 1JMLA 1E0ZA 1EWYC 1OQRA 3WAMA 2WXLA 2UU7A 2GBKA 2L7RA 2KX0A 2KMCA 3Q8FA 4YTPB 5BO4B 1K8RB 3AEDB 2LRWA 3URYA 3P2BA 1UD7A 2KOXA 5CTRC 3RNAC 1P9DU 1OQQA 4A6QA 4EOYA 2BBCA 2IO2B 4AQ7A 1YQ3B 2MA9B 2FAZA 2EMTA 3APFA 1B9RA 3DWGC 3NRZA 1PFDA 1VD2A 2KN5A 4KX6B 4MT5A 1XO3A 5JH5C 4OVVA 1JRPA 1JWAD 3ZLZA 4JIOU 4ITKA 1WM2A 3R8BA 5AZHA 1XXGA 3V62A 3TL5A 2XK5A 1FCCC 5EE1A 2XK5B 2JRHA 3HM6X 4NQKE 1XLNA 2C7MB 2WXRA 3MFGA 1S1QB 1E6EB 4ARIA 3SD5A 1TY0A 2V1YA 2J53A 2LVQA 3MC0B 2M56B 3APCA 1SE4A 3ONSA 1J7CA 3P1MA 2M17A 3L17A 4CYEA 1ENFA 1PQSA 3DDCB 3U7ZA 3ABVB 4JLCA 1T0RC 1WJ4A 2LJIA 3GP7A 1P7EA 3A9JA 1D5MC 4FBJB 4CO7A 2WXPA 5J2RA 1E7VA 3VTUA 1EM7A 4HDOA 4DXGA 3S2AA 3BYYB 3VUXA 4CQNA 4S17A 4LTUA 3DBHI 2KVRA 3C0RB 4BBNC 4YL8A 4BKGA 3EGRA 1WIAA 1WZ3A 3U52E 3QX1A 2DAJA 3PT2B 4OVUA 3TEZA 1MG8A 1L0XB 2KHWB 3TEYA 2I1JA 4G11A 3V60A 4NNJB 5G55A 2D10A 2MBBB 4W9IA 3I3TB 2BF8B 3DVNV 2NVUI 2DYBA 4C7YA 3TSSA 4MH8A 5D7GA 2GLSA 2MP2B 4BVUC 3RCZA 4HCNB 2LD9A 2IGHA 4EE2A 3NHEB 2L76A 3UINB 4HPLB 5JZEB 1GC6A 2JY6A 4ANVA 4C00A 1K52A 3HM3A 1SE2A 4J6IA 4MGKE 3AEAB 3DHHC 3FKYA 5IAAC 1V1OA 3IHPC 2KDMA 2JX5A 2UYZB 1TYGB 3AE8B 4LLGM 2KVZA 1V1PA 2MBHA 2RDBC 4ANWA 2YEPB 3BINA 1V1PB 1IGCA 1XEEA 5G5GA 5IO9A 3TMPB 4P1BC 1SJED 1VJKA 3RNEC 2KFJA 2C7NB 2LXAA 1H4RA 2KDBA 4PS7A 4TQ1A 2MW5A 1Y8RC 4FADA 1N60A 3QHTA 3T8MA 2PIAA 4GDKB 1N6ZA 1J19A 2DYOA 3E9SA 4WAFA 2YEPF 5CX3A 1NYRA 1WGYA 1LXDA 4DXFA 3RD2A 5EE9A 2MWSB 4LDTB 1KLGD 1XCTL 1PYWD 2WWZA 3RNFC 1GNUA 3T3OA 1I4HA 4HPPA 4KSKC 4LNIA 3CSFA 1DYQA 1TKYA 1TZOA 2FUHB 2IYDB 1TBEA 5D3DA 1WX7A 3NS1A 4IWOA 1UELA 1WGGA 3PLVA 2YVCA 3N20C 2Z59B 4ZHPA 4MGIE 4KGTA 1R4MI 3VHTC 2JVCA 3LB8C 1T0YA 1AWDA 2J0JA 1ZXHA 4RMAA 3VTVA 3X0WA 2WDTB 3Q3NC 4RF0A 3NUHB 1SE3A 2KTRB 3U7DA 1FFVA 2M4NA 2J52A 4TMAB 1ZGUB 4LK0M 1QQRA 2WXKA 2BW2A 2NPTA 2FUG1 2ZEQA 1EUVB 2NMQA 1R4NI 1M4VA 3UF8A 1FMAD 3VQIA 2QIEB 3ML9A 1RLFA 2WNMA 2W3RA 2IDYA 1QILA 4MM3A 2O6VB 4J3OD 2KC1A 4USAA 4HROA 1CK1A 3H1UA 4MM3B 4W9JA 1UUPA 1RYJA 2JZZA 3QCAA 4OW0A 2IGDA 4BAXA 3HVDA 4HRSA 4JX1C 4YTNB 1GOZA 1WR1A 1YN3A 2CHZA 2FIDA 4PT5A 4XX5A 4H2AA 2WU5B 2K0PA 3E56A 3PLUA 3BK2A 4I6PA 3WAOA 1DGJA 1WGRA 3VRBB 2N1VA 5C3JB 3GE8C 4FJZA 2FE8A 3RZFA 3D32A 4NY0A 1UBIA 1Q10A 2KWUB 1FM0D 4ZOHC 3TJPA 2DENB 4W9HA 1C1YB 4REZA 3CSTA 1UH6A 1WGHA 3UQAA 3BYTB 4AWJA 3KVFB 2W9NA 3Q8AA 1TKEA 3P4SB 2Y5BB 4WWOA 2V3PA 4RGMA 3DHGC 2OOBB 3GB1A 1EU4A 2WS3B 1HQRD 2D3CA 3DBSA 3RT3B 4IDIA 2K39A 3AE7B 3JSVA 2ONQA 4YT0B 4ANUA 4I6LB 1WXMA 3JSVB 3L16A 4UDUC 1CMXB 4MH0E 3QWZB 4FULA 3AXCA 3R3MA 1YN5A 4IKGA 3FILA 1FRRA 3TBLD 2CKHB 1JW9D 1KRHA 4YSYB 2RMMA 3N1YC 2PVOD 1TS4A 3DWMA 3AULA 1AN8A 4YSZB 4G0NB 3UI3A 2PLPA 1YX6B 2GBNA 4GLSC 4NPNA 2BS2B 2PVGC 2KJRA 4DDID 1WSPA 3EFUA 1VDVA 4AJYB 2KACA 3P63A 2KNBA 4S0RA 2O2VB 3Q8EA 1FNVA 4RFBA 2MRPA 3EC8A 3I57A 4N59A 1WRDB 4E71A 2JXTA 2KLGA 3IBEA 5C2TB 5LNK1 3ZNGC 1JWUD 2MLBA 2JXXA 4IOIE 4G50A 2ZW0A 2IJ0A 2MJ3A 3R66C 1RWSA 4MGZE 4W9KA 1HEZE 2MJDA 5TR5A 1WRIA 4EZJA 1RFKA 4GOCA 3V3XA 4F1SA 5BMIA 1L4ZB 3AN1A 5C1ZA 5DPWA 3APDA 2LGXA 4MJSA 2INNE 2JYTA 1V9JA 5FR3A 4MJSB 3Q6BA 5EE0A 4M0WB 2AQ2B 1XD3B 2MBQA 4WQMA 3R2IA 2MBEA 1F1HA 2DZJA 2NBUA 1WGDA 1C76A 4C4VA 4N6EB 2N7DA 4C4VB 2OJRA 3KUZA 1YJIA 3VR8B 5D94A 4CHKA 1OEYA 3K9PB 3HK0A 1K51A 3IAS1 1RM6C 2Q5WD 4GN1A 4A90A 1NBFC 3PZ8A 2WX1A 3JYUA 4W9CA 4M02A 2HJ8A 2LRUA 1I4XA 2ZVOA 5D3IB 2V3SA 2JSVX 2G45B 1SGHA 3GZNB 2EKIA 4EEWA 2NCNA 2KTFA 2R2OA 1P98A 4ASWC 3UIOB 1ZPSA 5FKAC 4ZRKA 1TKGA 4C7ZA 3NVZA 5FK9C 3SDLC 4E74A 3AI5A 5CHFA 2K9XA 3DQVA 3X23A 2V4IB 5DPSA 2D11A 5CHWA 1JROA 1FNUA 3ZGZA 2KLCA 3PVLA 3W5VB 4XWWA 5LXHA 5GMVA 3KYDD 1NI3A 2LZ6A 2CU1A 2ZNVC 3DVGX 4A20A 1MPEA 1WXQA 1ET9A 4HPMB 4K7UA 3WIMA 4IM3A 3A9KA 5E6JA 2KZRA 2KFKA 3VH4B 4MEMA 3A9KB 3RMKC 4WJQA 1NEKB 4PS3A 2VH1A 2KQSA 4ZHOA 4ARCA 1QOBA 1LQBA 3W1SC 2G9HD 1YN4A 4ZRQA 4P6VF 1ZE3D 4GMVA 4B0MA 2KWDA 2ACZB 4PS8A 1EF5A 3AV8A 2N4FA 3VUWA 2ZCCA 3AECB 1WMHA 3L08A 3DBLI 4QAYA 1V6EA 5HFYA 1P7FA 1YQ4B 4C80A 1SEBD 1TIFA 3AH7A 3A4RA 3ZVVA 2FCQA 2WXOA 4L2YA 2JT4B 3NZ3A 1IPGA 5TSSA 3K9OB 3QARA 1I4RA 4XWTA 5KHQA 3EHVA 4PK1A 3I63C 4WWPA 2N9PC 4KZCA 1E8YA 1WE7A 2W82A 4YSXB 2BQQA 2KK8A 3ZDTA 4NAWA 4A3OA 4W9EA 4DHJB 3VVWB 3A33B 2WHIA 1XLQA 1T0QC 2ICIA 1CQVA 4FN2A 2L52A 2N0SB 3KUCB 4KSLC 3GE3C 1KM7A 3P4PB 3RFZB 2JU6X 1BT0A 5LLIA 3SFDB 1PGXA 3H6NA 3NVVA 4MGYE 5D2MB 2GBMA 1GG3A 1X1MA 2FCNA 4AJWA 2VRRB 2PW9A 3ZXRA 1GUAB 1VLBA 1PGBA 2G1EA 3ZDMC 1OTRB 1I7HA 1VZ8A 3AEFB 4XDDA 1IGDA 1WXAA 3A9JB 5EDSA 3Q8CA 1D5ZC 2WXIA 4PYZA 2H88B 2WX0A 1WJ6A 4RM8A 5HG2A 1TS2A 3RUIB 1JRUA 3AM9A 2C5LC 4WIPA 1Q5WB 4WWMA 2DZMA 2JQRB 1YMHE 3VTWA 4DHZB 1A5RA 1P3QU 2IO3B 3Q3JA 3BWUD 1Q1OA 1D3ZA 2K8BA 3B0AA 4KDLB 3ZJTA 2E6XA 2QJLA 5JHBA 1TZ1A 2QMTA 3CWIA 2Z0DB 4ZRPA 2KDIA 4W9GA 2LJ5A 4AUQC 4NZLB 2LGDA 2MHJA 2RSUA 2BS4B 2Z0EB 3ZTDA 2K6DB 3BK1A 2LFIA 4TQ0A 4RM9A 2WXHA 1C3TA 4C56C 1PDXA 2WXGA 3H8HA 4XYCA 3P42A 1YD8U 2L00B 3H7PA 2GI9A 1XLPA 3DHIC 2BYFA 1TJEA 4RGOS 4MELA 4JQWC 5HHDG 1EO6A 2WXQA 3DOWA 2AQ3B 1XF5L 2AYOB 3BIID 1GB4A 2V4LA 4K1RB 4GIVA 2FIFA 4FJVB 1C4AA 2ON8A 2LVOA 4GXBA 3W1SA 4LJOB 4HEA1 1I35A 4RGTA 1ZKHA 2DX5B 2W54A 3N32A 1V5TA 2LWPA 4LNOA 2KC2A 4WQOB 3MJ5A 2L0FA 5DPTA 1U4AA 3IT4B 2DZKA 3AE4B 4HKQA 2UWQA 2DBYA 2NTTA 3PREA 2K8HA 1K50A 3AB5A 3AE6B 3AU4A 3IG3A 1OFFA 2J7QB 4XZ4A 5C23A 1STEA 1D4BA 2RPVA 4FHKA 1Q0WB 4DWFA 3U30A 4O1NA 3RNBC 4Q2JA 2AWTA 3RI7C 1QT9A 3ZO5B 1V86A 2IO0B 2CJOA 3TEXA 3T9LA 2ZW1A 3CIRB 2PMVA 3N1XC 2NPTB 1L0YB 1QLBB 2KKCA 3PHWB 4OHJA 3EFCA 3NZUA 5T8IA 1SE9A 2PJHA 1S3SG 2K3UA 1WYGA 3C8YA 4EZKA 4OZCA 2G3QB 1VZ6A 1QOAA 2ZZPB 4XC2A 3UQBA 2ZJDA 1UNSA 4LNNA 2XEWA 5G2NA 1UZXB 3NZSA 2M0AA 3ZRFA 1E9MA 2DAFA 2C7HA 3RN9C 3QAQA 1WE6A 2V3NA 3IT6B 2LGSA 1V81A 1ZOYB 4OVZA 2K5PA 4ICVA 3C19A 4WWNA 3ETRA 1EU3A 2OJWA 2B76B 3U2SC 4ZYSA 2XNAC 1UWMA 1TGZB 4RGNA 2C9WB 2WXFA 4E3CA 5E6OA 3QK0A 2LI5A 1T5XD 1WXVA 2N1WA 1WFYA 4TSSA 3L10B 1MHXA 3U8ZA 1V49A 1RRBA 3MHSD 5HI1A 2L05A 3NJTA 3QA8A 3UIPB 5DPRA 4M00A 3ZTCA 4A8XC 4HKZE 1MI0A 1JQ4A 4BBNF 3ZIMA 3BVZA 3OWEB 1N5WA 2NBWB 2WXNA 3VXWA 4YXDB 1JWMD 3M63B 2MQJA 4F7ZA 1ZW7A 2QDFA 3R7QA 3HVZA 4A9AA 1QF6A 3TCAA 2VZKB 3ECIA 1SJHD 1KJTA 3FAHA 4BKTA 5J17A 3FILB 3OJ4B 4YTMB 2BPSA 1HXYD 5LXIB 2LMCA 4W9LA 1F0ZA 2HJ1A 1YQBA 1F77A 5MPOA 3H7SA 2D5GA 2IPKD 2CS4A 1ZP0B 2BYTA 3RZWC 3ENEA 4M01A 3BY4B 4K3CA 4KIKA 3JVZX 3V61A 4F8CB 4IW0A 3SU8X 2IY0B 4KIKB 4A55A 1AW7A 3ZJVA 1WR6E 5IP4D 1ISNA 2MBOA 3OG5A 4ZDVA 4ACFA 3MHZA 4LDTD 5AUIA 2JZ3B 4P7IA 1GB1A 2H89B 3AE9B 1J0GA 3LYYA 3DBHB 4ZRJA 5J18A 3V6CB 3V6EB 2AL3A 4OZAA 1YX5B 2N9XA 1OGWA 4PYUA 2AL6A 2M19A 1YNTE 4KKJA 1IBXA 3VRAB 4YWGG 2PE9A 2FCMA 1CJEA 1HTQA 4N58A 2HDEA 3HUIA 2D3AA 5BYRA 1WX8A 3RNGC 1QKZA 1NYQA 3W9CB 3AE1B 3RPFC 2ZPNA 3O65B 2JPHA 2GRIA 2CJNA 3DVNU 3W1YA 2WXMA 1V8CA 3Q69A 1M94A 3IAM1 1V97A 3I9V1 2WDVB 1E8XA 1KLUD 1BUIC 2O6VD 3Q3FA 2TSSA 2BB6A 4DHZE 2N9EB 3DVGY 3VDZA 2EMSA 5H92C 3NVYA 4RH6A 4AS1A 4IG7B 3OLMD 1KLVA 5JHAA 4JE3B 2FCSA 2JZPA 2W55A 2KDEB 2BWFA 2Y3AA 3ML8A 2K1FA 1TY2A 1MG4A 3KH0A 1L4DB 3PSEB 4BKSD 3AE3B 2PEAA 3Q2AC 3KWVA 2DZIA 2FBWB 1YOVB 2RDGA 2KD0A 2KT7A 4MACA 1FO4A 2M8SA 2Y5CA 1ACCA 3W2DA 1SF0A 1YJ1A 2INDC 2LEKA 1E7PB 1BMLC 2K8CA 2V9HA 2KN4A 1XLOA 3KLSX 1VZ7A 2HD5B 3L13A 1EWCA 1TS3A 2RR9A 3ZNZB 2KFKB 1QZEA 1WF9A 2BS3B 1UWXA 3WAPA 1R4MB 3B9JA 2I2YA 5L95C 3LXFA 1IP9A 1DOYA 1MVKA 5L83A 1FXIA 1WJUA 1R7SA 3WCQA 3BZDB 1WMHB 1I4GA 5EE3A 2WYQA 3PZ7A 1EF1A 3OJ3A 1B1ZA 1LFDA 1XQQA 1UF0A 4DQOC 1T3QA 3ZNID 1WGKA 1G6JA 1AARA 4BOZB 1R4NB 2NBVB 4GGQA 1FD6A 1YIWA 4II2B 2GOWA 3NG0A 1I42A 4EKUA 3PS6A 2PTLA 2L3ZA 5AZFA 1JWBD 2K25A 3HRDD 5BYQA 1C4CA 2A5UA 3FC4A 4NJ7A 3IXSA 4M8NA 1C77A 1L0VB 2D07B 2DHZA 1MJDA 4RCOA 2L32A 3N9YC 4KZ0A 1ZDVA 4NAWB 5E6NA 4HDQA 2X8XX 4JWSC 3SFEB 3Q3OC 1SIJA 2JWZA 5IA7A 1AYFA 1GJZA 2LHEA 3I5JC 1KTKA 2AQ1B 3WALA 3N1ZC 3RYTA 3NS8A 2LUMA 2LHDA 3V05A 4KDIC 1E7UA 1F9JA 2KMMA 3ZRCA 1HZ6A 3NVWA 5IOIA 2CU3A 1VCBA 2PPHA 3A1QA
chains in the Genus database with same CATH topology
3QWZB 2HTHA 3AU4A 4FULA 3IG3A 3AXCA 4LJPB 3ZKJC 3A1QB 2J7QB 4ICUA 4XZ4A 3R3MA 5C23A 3IFWB 4FHKA 4ANXA 3TBLD 2CKHB 1Q0WB 2J0KA 2LGYA 1E8WA 1P0RA 3L0WB 4TKNA 4DWFA 3U30A 3UGBB 3AULA 2ZCBA 4G3XB 3R7RA 2EKEC 2J0MA 3DPDA 3KW5B 2AWTA 3PZDA 4G0NB 5AZGA 2YLMA 2BKRB 5HKHA 1YX6B 2GBNA 3ZO5B 1E90A 1V86A 2IO0B 4NPNA 2LUEA 3T9LA 4II3B 3ALBA 2KJRA 2ASQA 4DDID 2D2QA 4K81A 2DYMA 2NPTB 4IM2A 4NQLB 4WJNA 3EFUA 1WZ0A 2FNJB 2KKCA 2REXA 3PHWB 3PTFC 3QC8B 3NZUA 4IM0A 5D6JB 4MDKE 4AJYB 2KNBA 2KWVB 1SE9A 2PJHA 1S3SG 2O2VB 2D3GA 3VFKA 4K7SA 3WAMA 4EZKA 1XT9B 2G3QB 3IVFA 2ZZPB 4XC2A 1V2YA 3JW0X 2MRPA 3UQBA 2IO1B 3EC8A 2ZJDA 2GBKA 1WRDB 2L7RA 2XEWA 2KX0A 5G2NA 4E71A 2MP2A 1UZXB 2KLGA 2KMCA 3IBEA 3NZSA 3PHXB 3ZRFA 3ZNGC 2DAFA 2C7HA 2MLBA 5BO4B 2JXXA 4G50A 1K8RB 2L8JA 3OAWA 3QAQA 2LRWA 3R66C 4GSWA 1WE6A 2KJ6A 3P2BA 4KV2A 1UD7A 2KOXA 1V81A 2KQ7A 5CTRC 1P9DU 4MGZE 4FLHA 1WH3A 4ICVA 4W9KA 5TR5A 4WWNA 3H7PB 4EOYA 4EZJA 3GOEA 3DBRI 4GOCA 2R2QA 2MCNB 4F1SA 2IO2B 1E8ZA 2I1KA 1RFAA 1UGMA 1TTNA 1WXSA 2MA9B 5C1ZA 2FAZA 5DPWA 2KXJA 2EMTA 3APFA 3APDA 1NI2A 2LGXA 4MJSA 1V9JA 1TGZB 4FJYA 2ZNVB 2BKFA 2C9WB 1VD2A 4MJSB 4E3CA 5E6OA 2IZVB 3QK0A 2KN5A 4TUUA 2LI5A 4M0WB 1WXVA 3AU5A 5JH5C 1XD3B 1L7YA 2N1WA 4OVVA 1WFYA 2MBQA 3VH3B 3ZLZA 4JIOU 3L10B 2MBEA 2DZJA 2NBUA 1WGDA 4B6WA 1WM2A 2GBRA 2K6QA 4X57B 5AZHA 2LASA 3U8ZA 2N7DA 1V49A 2CR5A 3V62A 2OJRA 3TL5A 2XK5A 3KUZA 3GZNI 1RRBA 3KUDB 5D94A 5KHOA 4CHKA 3MHSD 2XK5B 1OEYA 1FXTB 1Z5SB 2JRHA 2G4DB 3HK0A 3K9PB 2JF5A 2L05A 2RD0A 4IUMB 3QA8A 3HM6X 4GN1A 4NQKE 5DPRA 3UIPB 1NBFC 3ZTCA 2WX1A 3JYUA 4W9CA 4BOSC 4GDKA 2C7MB 2HJ8A 2LRUA 4HCPB 3ZIMA 4BBNF 1S1QB 3SD5A 2ZVOA 1V5OA 4EFOA 2NBWB 2B3AA 2V3SA 2V1YA 2G45B 1SGHA 4A3PA 2LVQA 3VXWA 4EEWA 2NCNA 2KTFA 2R2OA 3APCA 2MQJA 3M63B 1ZW7A 4F7ZA 1P98A 2JUOA 3ONSA 4ASWC 3UIOB 3SHQA 3R7QA 2M17A 3A4SC 4ZRKA 3TCAA 3L17A 2KWCA 3N3KB 3SDLC 3ECIA 4CYEA 4E74A 3AI5A 5CHFA 3DQVA 3X23A 1PQSA 3DDCB 1KJTA 4M8MA 3H9DA 5DPSA 4BKTA 2D11A 5J17A 4JLCA 2AEHA 5CHWA 3OJ4B 2BPSA 1WJ4A 5LXIB 2M0XA 3A9JA 4W9LA 4FBJB 4HWIB 4CO7A 1YQBA 2KLCA 3PVLA 1WM3A 3H7SA 5LXHA 4DHJD 5GMVA 2CS4A 5J2RA 1V80A 1E7VA 3RZWC 3VTUA 3KYDD 3ENEA 2LZ6A 4HDOA 2CU1A 2ZNVC 3DVGX 3S2AA 4DXAB 4A20A 2KJHB 3VUXA 3BY4B 4BKGA 4HPMB 3DBHI 4KIKA 3JVZX 4K7UA 3PRPB 2KVRA 3C0RB 3V61A 4BBNC 4F8CB 2KANA 4EZLA 4IW0A 3SU8X 3WIMA 2IY0B 3B1LX 2KTRA 3PV1A 4KIKB 4YL8A 4IM3A 3A9KA 5DCNA 2KZRA 2KFKA 1WIAA 1WZ3A 3QX1A 3VH4B 1WR6E 4MEMA 1WX9A 1ISNA 2DAJA 2MBOA 3A9KB 3PT2B 4OVUA 4ZDVA 4WJQA 4LDTD 1MG8A 2KHWB 4PS3A 2I1JA 2JRIB 2XBBC 4G11A 3V60A 4NNJB 5G55A 2D10A 2MBBB 3CF6E 2KQSA 4KVGB 2JZ3B 4W9IA 3I3TB 4P7IA 2BF8B 3DVNV 1LQBA 3W1SC 4URKA 1J0GA 2NVUI 4ZRJA 5J18A 3HHMA 2DYBA 3NOBA 3V6CB 4K7WA 4GMVA 2AL3A 2KX3A 4GDLA 3V6EB 1YX5B 4WAAA 4FHJA 2N9XA 4PS8A 5D7GA 1OGWA 1EF5A 4GDLB 2MP2B 4PYUA 2N4FA 3VUWA 2ZCCA 5E6PA 2AL6A 1WMHA 4BVUC 3RCZA 3L08A 4IWQA 1LM8B 3DBLI 4HCNB 2LD9A 3QIJA 2O6VA 3QQ8B 3NHEB 2L76A 2GMIC 1V6EA 2RPQA 3UINB 4HPLB 2PE9A 4MSMB 5AEKB 5JZEB 1GC6A 2FCMA 3PRZA 2JY6A 4ANVA 3QJZA 3A4RA 1RAXA 1WX8A 3ZVVA 2FCQA 3HM3A 4J6IA 4BFRA 4JL9A 1OEYJ 4LCDE 4MGKE 5IAAC 2ZPNA 2JT4B 1E5WA 1IPGA 3IHPC 3K9OB 3LDZE 3O65B 3WA0A 1L2NA 2UYZB 3QARA 2L0TA 2JPHA 4W9FA 3DVNU 3W1YA 2MBHA 4ANWA 5KHQA 3BINA 3EHVA 4BKSA 3TIXA 2MX2A 1M94A 4WWPA 3TMPB 1HE8A 2N9PC 1SIFA 3CMMB 4KZCA 3KYCD 3M95A 1WY8A 1E8YA 1NDDA 1WE7A 2KK8A 2KFJA 3ZDTA 2C7NB 2LXAA 1H4RA 4NAWA 1E8XA 2KDBA 2O6VD 3Q3FA 4PS7A 4TQ1A 3VUYA 2MW5A 4A3OA 1Y8RC 4DHZE 4W9EA 4FADA 3QHTA 2N9EB 4DHJB 3DVGY 3T8MA 3VVWB 3A33B 3VDZA 5CHVC 2EMSA 4GDKB 4FN2A 1KOTA 1J19A 2DYOA 4IG7B 3OLMD 1KLVA 3KUCB 4KSLC 3RULA 5CX3A 5JHAA 1WGYA 3WANA 1KM7A 3ZUNA 2FCSA 3ZNHB 1LXDA 1BT0A 2ZVNA 2MSED 5LLIA 3L54A 4B95A 3H6NA 2KDEB 2BWFA 4MGYE 5D2MB 3RD2A 2GBMA 2MWSB 1GG3A 3ML8A 1X1MA 2K1FA 4LDTB 2FCNA 2WWZA 1GNUA 3MJWA 4WJPA 4AJWA 2VRRB 4KSKC 3KH0A 4ZRIA 3PSEB 1GUAB 3CSFA 4BKSD 2CHWA 5FR6A 2PEAA 2NS5A 2KMAA 2FUHB 3ZDMC 2DZIA 1OTRB 4FA6A 2IYDB 2KD0A 1TBEA 2M8SA 4GB9A 1WX7A 1WJNA 4IWOA 1UELA 1WXAA 1WGGA 3A9JB 5EDSA 2IBIB 3PLVA 2YVCA 2Z59B 4MGIE 4GU2A 1YJ1A 4EUTA 1R4MI 2K8CA 3VHTC 2JVCA 1P1AA 1T0YA 4HXDA 4PYZA 4MSQB 4NJ6A 2J0JA 2WX0A 1WJ6A 4RMAA 4RM8A 3VTVA 3RUIB 3X0WA 1JRUA 2WDTB 2HD5B 2C5LC 2LVPA 3L13A 1Q5WB 2BYEA 2DZMA 2RR9A 4IC7B 4B9KA 3VTWA 4ZYNA 4DHZB 1P3QU 1A5RA 2KTRB 3ZNZB 1UBQA 2IO3B 3Q3JA 2KFKB 2M4NA 3U7DA 1QZEA 1WF9A 1Q1OA 1D3ZA 1ZGUB 3WAPA 1J8CA 4DBGA 3PRMB 2K8BA 3VAWA 3B0AA 4AP4C 4KDLB 5JHBA 1TZ1A 2NPTA 2ZEQA 5L95C 1WYWB 1IP9A 1OQYA 1EUVB 2Z0DB 5L83A 4HVBA 2KDIA 1R4NI 1WJUA 3UF8A 2QHOA 4W9GA 2LJ5A 4AUQC 3VQIA 2LGDA 3ML9A 1WI0A 2O2VA 3EECA 4I6NB 2KDFB 1WMHB 2RSUA 2WYQA 3DCGA 2PE6B 1RLFA 2Z0EB 1EF1A 3ZTDA 4MM3A 2O6VB 3M3JA 3OJ3A 1LFDA 1XQQA 2K6DB 2KC1A 4DDGD 2M1MA 3H1UA 4W9JA 4TQ0A 4RM9A 2LXCA 2N7EA 2HE7A 1C3TA 3ZNID 2JZZA 3NY5A 3QCAA 1G6JA 1AARA 4BOZB 2NBVB 4GGQA 1YIWA 4II2B 2GOWA 1YD8U 1GC7A 2IY1B 1I42A 2L00B 4EKUA 3H7PA 3PS6A 2BGFA 1WR1A 2CHZA 4AOFA 2FIDA 2RGFA 4XX5A 2L3ZA 4N9F4 2BYFA 5AZFA 2K25A 3ZW3A 2NR2A 1IYFA 2A5UA 3PLUA 4HK2A 4I6PA 4MELA 4JQWC 3WAOA 1EO6A 1WGRA 4NJ7A 2C60A 2N1VA 4M8NA 3DOWA 4FJZA 3RZFA 2D07B 2DHZA 3N30A 2AYOB 3D32A 2KO3A 4JGHB 4NY0A 4KZ0A 1UBIA 4WJOA 1H8CA 2KWUB 4NAWB 5E6NA 3TJPA 4TV3A 4HDQA 2DENB 4DK5A 4W9HA 1C1YB 2V4LA 4W9DA 4K1RB 3CSTA 1UH6A 1WGHA 2CHXA 3UQAA 4GIVA 2FIFA 4AWJA 4FJVB 3KVFB 2W9NA 2LVOA 4GXBA 2JWZA 5IA7A 2Y5BB 3W1SA 1GJZA 4WWOA 4HJKA 4LJOB 2G4SA 3WALA 1I35A 3RYTA 3NS8A 1ZKHA 2DX5B 3N32A 2OOBB 1V5TA 2LWPA 3HIZA 4IWPA 3B08A 1Z2MA 2ZPYA 2KC2A 4WQOB 2L0FA 5DPTA 3DBSA 2A4ZA 3RT3B 1U4AA 2K39A 3JSVA 2BYVE 3LJ3A 4KDIC 3PPAA 4ANUA 1E7UA 4I6LB 1WXMA 2DZKA 3JSVB 1F9JA 2UWQA 3L16A 3MTNB 3ZRCA 2GBJA 2BWES 4HLEA 1CMXB 3PGEA 3PREA 2K8HA 1VCBA 2PPHA 3M62B 3A1QA 4MH0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWZ B;  2HTH A;  3AU4 A;  4FUL A;  3IG3 A;  3AXC A;  4LJP B;  3ZKJ C;  3A1Q B;  2J7Q B;  4ICU A;  4XZ4 A;  3R3M A;  5C23 A;  3IFW B;  4FHK A;  4ANX A;  3TBL D;  2CKH B;  1Q0W B;  2J0K A;  2LGY A;  1E8W A;  1P0R A;  3L0W B;  4TKN A;  4DWF A;  3U30 A;  3UGB B;  3AUL A;  2ZCB A;  4G3X B;  3R7R A;  2EKE C;  2J0M A;  3DPD A;  3KW5 B;  2AWT A;  3PZD A;  4G0N B;  5AZG A;  2YLM A;  2BKR B;  5HKH A;  1YX6 B;  2GBN A;  3ZO5 B;  1E90 A;  1V86 A;  2IO0 B;  4NPN A;  2LUE A;  3T9L A;  4II3 B;  3ALB A;  2KJR A;  2ASQ A;  4DDI D;  2D2Q A;  4K81 A;  2DYM A;  2NPT B;  4IM2 A;  4NQL B;  4WJN A;  3EFU A;  1WZ0 A;  2FNJ B;  2KKC A;  2REX A;  3PHW B;  3PTF C;  3QC8 B;  3NZU A;  4IM0 A;  5D6J B;  4MDK E;  4AJY B;  2KNB A;  2KWV B;  1SE9 A;  2PJH A;  1S3S G;  2O2V B;  2D3G A;  3VFK A;  4K7S A;  3WAM A;  4EZK A;  1XT9 B;  2G3Q B;  3IVF A;  2ZZP B;  4XC2 A;  1V2Y A;  3JW0 X;  2MRP A;  3UQB A;  2IO1 B;  3EC8 A;  2ZJD A;  2GBK A;  1WRD B;  2L7R A;  2XEW A;  2KX0 A;  5G2N A;  4E71 A;  2MP2 A;  1UZX B;  2KLG A;  2KMC A;  3IBE A;  3NZS A;  3PHX B;  3ZRF A;  3ZNG C;  2DAF A;  2C7H A;  2MLB A;  5BO4 B;  2JXX A;  4G50 A;  1K8R B;  2L8J A;  3OAW A;  3QAQ A;  2LRW A;  3R66 C;  4GSW A;  1WE6 A;  2KJ6 A;  3P2B A;  4KV2 A;  1UD7 A;  2KOX A;  1V81 A;  2KQ7 A;  5CTR C;  1P9D U;  4MGZ E;  4FLH A;  1WH3 A;  4ICV A;  4W9K A;  5TR5 A;  4WWN A;  3H7P B;  4EOY A;  4EZJ A;  3GOE A;  3DBR I;  4GOC A;  2R2Q A;  2MCN B;  4F1S A;  2IO2 B;  1E8Z A;  2I1K A;  1RFA A;  1UGM A;  1TTN A;  1WXS A;  2MA9 B;  5C1Z A;  2FAZ A;  5DPW A;  2KXJ A;  2EMT A;  3APF A;  3APD A;  1NI2 A;  2LGX A;  4MJS A;  1V9J A;  1TGZ B;  4FJY A;  2ZNV B;  2BKF A;  2C9W B;  1VD2 A;  4MJS B;  4E3C A;  5E6O A;  2IZV B;  3QK0 A;  2KN5 A;  4TUU A;  2LI5 A;  4M0W B;  1WXV A;  3AU5 A;  5JH5 C;  1XD3 B;  1L7Y A;  2N1W A;  4OVV A;  1WFY A;  2MBQ A;  3VH3 B;  3ZLZ A;  4JIO U;  3L10 B;  2MBE A;  2DZJ A;  2NBU A;  1WGD A;  4B6W A;  1WM2 A;  2GBR A;  2K6Q A;  4X57 B;  5AZH A;  2LAS A;  3U8Z A;  2N7D A;  1V49 A;  2CR5 A;  3V62 A;  2OJR A;  3TL5 A;  2XK5 A;  3KUZ A;  3GZN I;  1RRB A;  3KUD B;  5D94 A;  5KHO A;  4CHK A;  3MHS D;  2XK5 B;  1OEY A;  1FXT B;  1Z5S B;  2JRH A;  2G4D B;  3HK0 A;  3K9P B;  2JF5 A;  2L05 A;  2RD0 A;  4IUM B;  3QA8 A;  3HM6 X;  4GN1 A;  4NQK E;  5DPR A;  3UIP B;  1NBF C;  3ZTC A;  2WX1 A;  3JYU A;  4W9C A;  4BOS C;  4GDK A;  2C7M B;  2HJ8 A;  2LRU A;  4HCP B;  3ZIM A;  4BBN F;  1S1Q B;  3SD5 A;  2ZVO A;  1V5O A;  4EFO A;  2NBW B;  2B3A A;  2V3S A;  2V1Y A;  2G45 B;  1SGH A;  4A3P A;  2LVQ A;  3VXW A;  4EEW A;  2NCN A;  2KTF A;  2R2O A;  3APC A;  2MQJ A;  3M63 B;  1ZW7 A;  4F7Z A;  1P98 A;  2JUO A;  3ONS A;  4ASW C;  3UIO B;  3SHQ A;  3R7Q A;  2M17 A;  3A4S C;  4ZRK A;  3TCA A;  3L17 A;  2KWC A;  3N3K B;  3SDL C;  3ECI A;  4CYE A;  4E74 A;  3AI5 A;  5CHF A;  3DQV A;  3X23 A;  1PQS A;  3DDC B;  1KJT A;  4M8M A;  3H9D A;  5DPS A;  4BKT A;  2D11 A;  5J17 A;  4JLC A;  2AEH A;  5CHW A;  3OJ4 B;  2BPS A;  1WJ4 A;  5LXI B;  2M0X A;  3A9J A;  4W9L A;  4FBJ B;  4HWI B;  4CO7 A;  1YQB A;  2KLC A;  3PVL A;  1WM3 A;  3H7S A;  5LXH A;  4DHJ D;  5GMV A;  2CS4 A;  5J2R A;  1V80 A;  1E7V A;  3RZW C;  3VTU A;  3KYD D;  3ENE A;  2LZ6 A;  4HDO A;  2CU1 A;  2ZNV C;  3DVG X;  3S2A A;  4DXA B;  4A20 A;  2KJH B;  3VUX A;  3BY4 B;  4BKG A;  4HPM B;  3DBH I;  4KIK A;  3JVZ X;  4K7U A;  3PRP B;  2KVR A;  3C0R B;  3V61 A;  4BBN C;  4F8C B;  2KAN A;  4EZL A;  4IW0 A;  3SU8 X;  3WIM A;  2IY0 B;  3B1L X;  2KTR A;  3PV1 A;  4KIK B;  4YL8 A;  4IM3 A;  3A9K A;  5DCN A;  2KZR A;  2KFK A;  1WIA A;  1WZ3 A;  3QX1 A;  3VH4 B;  1WR6 E;  4MEM A;  1WX9 A;  1ISN A;  2DAJ A;  2MBO A;  3A9K B;  3PT2 B;  4OVU A;  4ZDV A;  4WJQ A;  4LDT D;  1MG8 A;  2KHW B;  4PS3 A;  2I1J A;  2JRI B;  2XBB C;  4G11 A;  3V60 A;  4NNJ B;  5G55 A;  2D10 A;  2MBB B;  3CF6 E;  2KQS A;  4KVG B;  2JZ3 B;  4W9I A;  3I3T B;  4P7I A;  2BF8 B;  3DVN V;  1LQB A;  3W1S C;  4URK A;  1J0G A;  2NVU I;  4ZRJ A;  5J18 A;  3HHM A;  2DYB A;  3NOB A;  3V6C B;  4K7W A;  4GMV A;  2AL3 A;  2KX3 A;  4GDL A;  3V6E B;  1YX5 B;  4WAA A;  4FHJ A;  2N9X A;  4PS8 A;  5D7G A;  1OGW A;  1EF5 A;  4GDL B;  2MP2 B;  4PYU A;  2N4F A;  3VUW A;  2ZCC A;  5E6P A;  2AL6 A;  1WMH A;  4BVU C;  3RCZ A;  3L08 A;  4IWQ A;  1LM8 B;  3DBL I;  4HCN B;  2LD9 A;  3QIJ A;  2O6V A;  3QQ8 B;  3NHE B;  2L76 A;  2GMI C;  1V6E A;  2RPQ A;  3UIN B;  4HPL B;  2PE9 A;  4MSM B;  5AEK B;  5JZE B;  1GC6 A;  2FCM A;  3PRZ A;  2JY6 A;  4ANV A;  3QJZ A;  3A4R A;  1RAX A;  1WX8 A;  3ZVV A;  2FCQ A;  3HM3 A;  4J6I A;  4BFR A;  4JL9 A;  1OEY J;  4LCD E;  4MGK E;  5IAA C;  2ZPN A;  2JT4 B;  1E5W A;  1IPG A;  3IHP C;  3K9O B;  3LDZ E;  3O65 B;  3WA0 A;  1L2N A;  2UYZ B;  3QAR A;  2L0T A;  2JPH A;  4W9F A;  3DVN U;  3W1Y A;  2MBH A;  4ANW A;  5KHQ A;  3BIN A;  3EHV A;  4BKS A;  3TIX A;  2MX2 A;  1M94 A;  4WWP A;  3TMP B;  1HE8 A;  2N9P C;  1SIF A;  3CMM B;  4KZC A;  3KYC D;  3M95 A;  1WY8 A;  1E8Y A;  1NDD A;  1WE7 A;  2KK8 A;  2KFJ A;  3ZDT A;  2C7N B;  2LXA A;  1H4R A;  4NAW A;  1E8X A;  2KDB A;  2O6V D;  3Q3F A;  4PS7 A;  4TQ1 A;  3VUY A;  2MW5 A;  4A3O A;  1Y8R C;  4DHZ E;  4W9E A;  4FAD A;  3QHT A;  2N9E B;  4DHJ B;  3DVG Y;  3T8M A;  3VVW B;  3A33 B;  3VDZ A;  5CHV C;  2EMS A;  4GDK B;  4FN2 A;  1KOT A;  1J19 A;  2DYO A;  4IG7 B;  3OLM D;  1KLV A;  3KUC B;  4KSL C;  3RUL A;  5CX3 A;  5JHA A;  1WGY A;  3WAN A;  1KM7 A;  3ZUN A;  2FCS A;  3ZNH B;  1LXD A;  1BT0 A;  2ZVN A;  2MSE D;  5LLI A;  3L54 A;  4B95 A;  3H6N A;  2KDE B;  2BWF A;  4MGY E;  5D2M B;  3RD2 A;  2GBM A;  2MWS B;  1GG3 A;  3ML8 A;  1X1M A;  2K1F A;  4LDT B;  2FCN A;  2WWZ A;  1GNU A;  3MJW A;  4WJP A;  4AJW A;  2VRR B;  4KSK C;  3KH0 A;  4ZRI A;  3PSE B;  1GUA B;  3CSF A;  4BKS D;  2CHW A;  5FR6 A;  2PEA A;  2NS5 A;  2KMA A;  2FUH B;  3ZDM C;  2DZI A;  1OTR B;  4FA6 A;  2IYD B;  2KD0 A;  1TBE A;  2M8S A;  4GB9 A;  1WX7 A;  1WJN A;  4IWO A;  1UEL A;  1WXA A;  1WGG A;  3A9J B;  5EDS A;  2IBI B;  3PLV A;  2YVC A;  2Z59 B;  4MGI E;  4GU2 A;  1YJ1 A;  4EUT A;  1R4M I;  2K8C A;  3VHT C;  2JVC A;  1P1A A;  1T0Y A;  4HXD A;  4PYZ A;  4MSQ B;  4NJ6 A;  2J0J A;  2WX0 A;  1WJ6 A;  4RMA A;  4RM8 A;  3VTV A;  3RUI B;  3X0W A;  1JRU A;  2WDT B;  2HD5 B;  2C5L C;  2LVP A;  3L13 A;  1Q5W B;  2BYE A;  2DZM A;  2RR9 A;  4IC7 B;  4B9K A;  3VTW A;  4ZYN A;  4DHZ B;  1P3Q U;  1A5R A;  2KTR B;  3ZNZ B;  1UBQ A;  2IO3 B;  3Q3J A;  2KFK B;  2M4N A;  3U7D A;  1QZE A;  1WF9 A;  1Q1O A;  1D3Z A;  1ZGU B;  3WAP A;  1J8C A;  4DBG A;  3PRM B;  2K8B A;  3VAW A;  3B0A A;  4AP4 C;  4KDL B;  5JHB A;  1TZ1 A;  2NPT A;  2ZEQ A;  5L95 C;  1WYW B;  1IP9 A;  1OQY A;  1EUV B;  2Z0D B;  5L83 A;  4HVB A;  2KDI A;  1R4N I;  1WJU A;  3UF8 A;  2QHO A;  4W9G A;  2LJ5 A;  4AUQ C;  3VQI A;  2LGD A;  3ML9 A;  1WI0 A;  2O2V A;  3EEC A;  4I6N B;  2KDF B;  1WMH B;  2RSU A;  2WYQ A;  3DCG A;  2PE6 B;  1RLF A;  2Z0E B;  1EF1 A;  3ZTD A;  4MM3 A;  2O6V B;  3M3J A;  3OJ3 A;  1LFD A;  1XQQ A;  2K6D B;  2KC1 A;  4DDG D;  2M1M A;  3H1U A;  4W9J A;  4TQ0 A;  4RM9 A;  2LXC A;  2N7E A;  2HE7 A;  1C3T A;  3ZNI D;  2JZZ A;  3NY5 A;  3QCA A;  1G6J A;  1AAR A;  4BOZ B;  2NBV B;  4GGQ A;  1YIW A;  4II2 B;  2GOW A;  1YD8 U;  1GC7 A;  2IY1 B;  1I42 A;  2L00 B;  4EKU A;  3H7P A;  3PS6 A;  2BGF A;  1WR1 A;  2CHZ A;  4AOF A;  2FID A;  2RGF A;  4XX5 A;  2L3Z A;  4N9F 4;  2BYF A;  5AZF A;  2K25 A;  3ZW3 A;  2NR2 A;  1IYF A;  2A5U A;  3PLU A;  4HK2 A;  4I6P A;  4MEL A;  4JQW C;  3WAO A;  1EO6 A;  1WGR A;  4NJ7 A;  2C60 A;  2N1V A;  4M8N A;  3DOW A;  4FJZ A;  3RZF A;  2D07 B;  2DHZ A;  3N30 A;  2AYO B;  3D32 A;  2KO3 A;  4JGH B;  4NY0 A;  4KZ0 A;  1UBI A;  4WJO A;  1H8C A;  2KWU B;  4NAW B;  5E6N A;  3TJP A;  4TV3 A;  4HDQ A;  2DEN B;  4DK5 A;  4W9H A;  1C1Y B;  2V4L A;  4W9D A;  4K1R B;  3CST A;  1UH6 A;  1WGH A;  2CHX A;  3UQA A;  4GIV A;  2FIF A;  4AWJ A;  4FJV B;  3KVF B;  2W9N A;  2LVO A;  4GXB A;  2JWZ A;  5IA7 A;  2Y5B B;  3W1S A;  1GJZ A;  4WWO A;  4HJK A;  4LJO B;  2G4S A;  3WAL A;  1I35 A;  3RYT A;  3NS8 A;  1ZKH A;  2DX5 B;  3N32 A;  2OOB B;  1V5T A;  2LWP A;  3HIZ A;  4IWP A;  3B08 A;  1Z2M A;  2ZPY A;  2KC2 A;  4WQO B;  2L0F A;  5DPT A;  3DBS A;  2A4Z A;  3RT3 B;  1U4A A;  2K39 A;  3JSV A;  2BYV E;  3LJ3 A;  4KDI C;  3PPA A;  4ANU A;  1E7U A;  4I6L B;  1WXM A;  2DZK A;  3JSV B;  1F9J A;  2UWQ A;  3L16 A;  3MTN B;  3ZRC A;  2GBJ A;  2BWE S;  4HLE A;  1CMX B;  3PGE A;  3PRE A;  2K8H A;  1VCB A;  2PPH A;  3M62 B;  3A1Q A;  4MH0 E; 
#chains in the Genus database with same CATH topology
 4LJP B;  3A1Q B;  4ICU A;  3U4E G;  4ANX A;  2J0K A;  1JAL A;  1E8W A;  1P0R A;  5BMH A;  1SB3 C;  3UGB B;  2Y5P A;  2ZCB A;  4G3X B;  2EKE C;  1ZXI A;  3GS2 A;  1TT5 B;  1E90 A;  1C79 A;  3P4Q B;  2KYW A;  3ALB A;  3RNC C;  1DOI A;  1HTO A;  1FEH A;  2D2Q A;  4K81 A;  2DYM A;  4WJN A;  1QOF A;  4IM2 A;  4NQL B;  1WZ0 A;  2REX A;  2K22 A;  5D6J B;  4MDK E;  2KWV B;  4XE0 A;  3J9C A;  2D3G A;  3VFK A;  4K7S A;  1XT9 B;  3IVF A;  3O13 A;  1V2Y A;  3JW0 X;  2IO1 B;  2MP2 A;  3PHX B;  3PO0 A;  4KGS A;  1F52 A;  2L8J A;  3OAW A;  4GSW A;  2J42 A;  2KJ6 A;  4KV2 A;  2KQ7 A;  4FLH A;  1WH3 A;  1WWT A;  3H7P B;  3KWL A;  3GOE A;  3DBR I;  2R2Q A;  2MCN B;  1E8Z A;  2I1K A;  1RFA A;  1UGM A;  1TTN A;  2L83 A;  1FXA A;  1WXS A;  2KXJ A;  1NI2 A;  3SEB A;  1QOG A;  4FJY A;  2ZNV B;  2N9L A;  2BKF A;  4B0E A;  2IZV B;  4TUU A;  3AU5 A;  2J4X A;  1L7Y A;  2MH7 A;  3VH3 B;  4BZA A;  4RNA A;  2L1A A;  4US8 A;  4B6W A;  2GBR A;  2K6Q A;  4X57 B;  2LAS A;  2BT6 A;  2CR5 A;  1NVI D;  2IGG A;  3GZN I;  1DOX A;  3MP9 A;  4KGR A;  3KUD B;  5KHO A;  1D6E C;  1Z5S B;  1FXT B;  2G4D B;  2JF5 A;  2RD0 A;  4IUM B;  4XGA B;  1L6V A;  4BOS C;  4GDK A;  1SXT A;  4L1B A;  3BVG A;  4HCP B;  2INP E;  4FXC A;  1V5O A;  4EFO A;  3ZJU A;  2B3A A;  3KQ4 A;  2N7J A;  4A3P A;  3T3N A;  3AEB B;  1FNW A;  2JUO A;  1JWS D;  3SHQ A;  3A4S C;  2KWC A;  3N3K B;  2QCZ A;  1N5X A;  1SSN A;  3AEG B;  2PKO A;  4LNF A;  4M8M A;  3H9D A;  2WLB A;  2AEH A;  2N9K A;  1PGA A;  2M0X A;  1FFU A;  5I4D A;  4HWI B;  2R61 A;  1MFW A;  1WM3 A;  4WUR A;  4DHJ D;  1V80 A;  4L23 A;  2BVC A;  4DXA B;  2KJH B;  1L6U A;  2X38 A;  3PRP B;  1T0S C;  2KAN A;  4EZL A;  1C78 A;  4K3B A;  3B1L X;  3PV1 A;  2KTR A;  5DCN A;  1WX9 A;  1C9F A;  4R3D A;  2SEB D;  2JRI B;  2XBB C;  2DLB A;  3CF6 E;  4KVG B;  4URK A;  2DWQ A;  3VR9 B;  3Q3M C;  3HHM A;  3NOB A;  4K7W A;  2KX3 A;  4GDL A;  3BVM A;  4WAA A;  4FHJ A;  4JPS A;  4GDL B;  1I4P A;  2BTE A;  5E6P A;  2D3B A;  1N62 A;  4IWQ A;  1LM8 B;  1PUT A;  2MEK A;  2WP9 B;  3QIJ A;  2O6V A;  3QQ8 B;  3B2G A;  2GMI C;  3P4R B;  2OHF A;  2RPQ A;  4MSM B;  4WH4 A;  5AEK B;  3PRZ A;  2XN9 C;  3QJZ A;  1RAX A;  2KAJ A;  4BFR A;  4JL9 A;  1OEY J;  2QSD A;  3ZXV A;  4LCD E;  3DBL B;  1E5W A;  1N63 A;  3LDZ E;  1L2N A;  3WA0 A;  2HTM E;  2L0T A;  2V0G A;  4W9F A;  1HZ5 A;  4BKS A;  3TIX A;  2MX2 A;  3EUB 2;  1HE8 A;  1SIF A;  3CMM B;  2WXJ A;  1VRA B;  3KYC D;  1WY8 A;  3M95 A;  1NDD A;  1FPY A;  2NTS A;  3VUY A;  3TUO A;  3AEE B;  1ESF A;  5CHV C;  3ZQ4 A;  4NAM A;  1KOT A;  1J7B A;  3MC9 A;  3RUL A;  1GAQ B;  4RF1 A;  3ZUN A;  4JWU C;  3WAN A;  3ZNH B;  2ZVN A;  1ZUD 2;  2MSE D;  3L54 A;  2I38 A;  4B95 A;  2Z8L A;  3MJW A;  4WJP A;  1IUE A;  4ZRI A;  2INC C;  2CHW A;  5FR6 A;  2NS5 A;  2KMA A;  2SAK A;  4FA6 A;  4GB9 A;  1WJN A;  2IBI B;  1KF6 B;  4GU2 A;  4EUT A;  2EEL A;  4KKI A;  3Q8B A;  1P1A A;  2WGS A;  4HXD A;  4P1C C;  2LGI A;  1D5X C;  4MSQ B;  4NJ6 A;  2LVP A;  1E10 A;  2JYE A;  2BYE A;  4IC7 B;  4B9K A;  4ZYN A;  1UBQ A;  5AUK A;  5H8Y E;  1CZP A;  5GXG B;  1J8C A;  4DBG A;  3PRM B;  3VAW A;  2AX5 A;  4AP4 C;  1N61 A;  1LO5 D;  4OZB A;  5BMG A;  1L5P A;  1C4P A;  4D2K A;  1WYW B;  1OQY A;  4LNK A;  4HVB A;  3TEW A;  1FRD A;  2QHO A;  4I6N B;  1WI0 A;  2O2V A;  3EEC A;  2KDF B;  4HJG E;  2KQ4 X;  3AE5 B;  3DCG A;  2PE6 B;  3M3J A;  1IBX B;  4DDG D;  2M1M A;  3EA6 A;  2LXC A;  2N7E A;  2HE7 A;  2W3S A;  3NY5 A;  2E3T A;  4NJC A;  1GC7 A;  2IY1 B;  1F2R I;  2BGF A;  1I4Q A;  4AOF A;  2RGF A;  4N9F 4;  3ZW3 A;  1IYF A;  2NR2 A;  3Q14 C;  2WDR B;  4HK2 A;  1NEN B;  5G5H A;  2C60 A;  2QC8 A;  1UGJ A;  3N30 A;  4M0W A;  2KO3 A;  4JGH B;  4WJO A;  1H8C A;  4TV3 A;  1SBB B;  4DK5 A;  1A70 A;  3DBR B;  4W9D A;  2QIL A;  5BYS A;  1FCL A;  2CHX A;  4XDC A;  3AE2 B;  3B2F A;  4HJK A;  2G4S A;  3W5U B;  3MC8 A;  1ZDX A;  4IWP A;  3HIZ A;  3B08 A;  1Z2M A;  2ZPY A;  1HA5 A;  5JXV A;  2A4Z A;  3R2T A;  2BYV E;  3LJ3 A;  3PPA A;  2OED A;  1LGR A;  1FIQ A;  3MTN B;  2GBJ A;  2WDQ B;  1VR9 A;  2BWE S;  4HLE A;  1KH0 A;  3PGE A;  5IKC M;  4P16 A;  3M62 B;  1BXT A;  3L4P A;  2HTH A;  2WQY B;  2MJE A;  3ZKJ C;  5IN7 A;  1KFY B;  3IFW B;  1Y56 A;  1XCQ L;  2VH2 A;  2LGY A;  1ET6 A;  3L0W B;  2JWU A;  4TKN A;  3ZYY X;  2RDH A;  4US9 A;  3R7R A;  3AMZ A;  2J0M A;  2QEJ C;  3DPD A;  3KW5 B;  3PZD A;  2WU2 B;  5AZG A;  2YLM A;  2BKR B;  5HKH A;  1GPX A;  2LUE A;  4II3 B;  1F2R C;  1ROE A;  3SR6 A;  1T6B X;  2ASQ A;  1JCK B;  2DNF A;  1J7A A;  1K53 A;  2FNJ B;  3PTF C;  3QC8 B;  2BB5 A;  4IM0 A;  1TS5 A;  1MHH E;  2VZK D;  1YJJ A;  2GB1 A;  1JML A;  1E0Z A;  1EWY C;  1OQR A;  3WAM A;  2WXL A;  2UU7 A;  2GBK A;  2L7R A;  2KX0 A;  2KMC A;  3Q8F A;  4YTP B;  5BO4 B;  1K8R B;  3AED B;  2LRW A;  3URY A;  3P2B A;  1UD7 A;  2KOX A;  5CTR C;  3RNA C;  1P9D U;  1OQQ A;  4A6Q A;  4EOY A;  2BBC A;  2IO2 B;  4AQ7 A;  1YQ3 B;  2MA9 B;  2FAZ A;  2EMT A;  3APF A;  1B9R A;  3DWG C;  3NRZ A;  1PFD A;  1VD2 A;  2KN5 A;  4KX6 B;  4MT5 A;  1XO3 A;  5JH5 C;  4OVV A;  1JRP A;  1JWA D;  3ZLZ A;  4JIO U;  4ITK A;  1WM2 A;  3R8B A;  5AZH A;  1XXG A;  3V62 A;  3TL5 A;  2XK5 A;  1FCC C;  5EE1 A;  2XK5 B;  2JRH A;  3HM6 X;  4NQK E;  1XLN A;  2C7M B;  2WXR A;  3MFG A;  1S1Q B;  1E6E B;  4ARI A;  3SD5 A;  1TY0 A;  2V1Y A;  2J53 A;  2LVQ A;  3MC0 B;  2M56 B;  3APC A;  1SE4 A;  3ONS A;  1J7C A;  3P1M A;  2M17 A;  3L17 A;  4CYE A;  1ENF A;  1PQS A;  3DDC B;  3U7Z A;  3ABV B;  4JLC A;  1T0R C;  1WJ4 A;  2LJI A;  3GP7 A;  1P7E A;  3A9J A;  1D5M C;  4FBJ B;  4CO7 A;  2WXP A;  5J2R A;  1E7V A;  3VTU A;  1EM7 A;  4HDO A;  4DXG A;  3S2A A;  3BYY B;  3VUX A;  4CQN A;  4S17 A;  4LTU A;  3DBH I;  2KVR A;  3C0R B;  4BBN C;  4YL8 A;  4BKG A;  3EGR A;  1WIA A;  1WZ3 A;  3U52 E;  3QX1 A;  2DAJ A;  3PT2 B;  4OVU A;  3TEZ A;  1MG8 A;  1L0X B;  2KHW B;  3TEY A;  2I1J A;  4G11 A;  3V60 A;  4NNJ B;  5G55 A;  2D10 A;  2MBB B;  4W9I A;  3I3T B;  2BF8 B;  3DVN V;  2NVU I;  2DYB A;  4C7Y A;  3TSS A;  4MH8 A;  5D7G A;  2GLS A;  2MP2 B;  4BVU C;  3RCZ A;  4HCN B;  2LD9 A;  2IGH A;  4EE2 A;  3NHE B;  2L76 A;  3UIN B;  4HPL B;  5JZE B;  1GC6 A;  2JY6 A;  4ANV A;  4C00 A;  1K52 A;  3HM3 A;  1SE2 A;  4J6I A;  4MGK E;  3AEA B;  3DHH C;  3FKY A;  5IAA C;  1V1O A;  3IHP C;  2KDM A;  2JX5 A;  2UYZ B;  1TYG B;  3AE8 B;  4LLG M;  2KVZ A;  1V1P A;  2MBH A;  2RDB C;  4ANW A;  2YEP B;  3BIN A;  1V1P B;  1IGC A;  1XEE A;  5G5G A;  5IO9 A;  3TMP B;  4P1B C;  1SJE D;  1VJK A;  3RNE C;  2KFJ A;  2C7N B;  2LXA A;  1H4R A;  2KDB A;  4PS7 A;  4TQ1 A;  2MW5 A;  1Y8R C;  4FAD A;  1N60 A;  3QHT A;  3T8M A;  2PIA A;  4GDK B;  1N6Z A;  1J19 A;  2DYO A;  3E9S A;  4WAF A;  2YEP F;  5CX3 A;  1NYR A;  1WGY A;  1LXD A;  4DXF A;  3RD2 A;  5EE9 A;  2MWS B;  4LDT B;  1KLG D;  1XCT L;  1PYW D;  2WWZ A;  3RNF C;  1GNU A;  3T3O A;  1I4H A;  4HPP A;  4KSK C;  4LNI A;  3CSF A;  1DYQ A;  1TKY A;  1TZO A;  2FUH B;  2IYD B;  1TBE A;  5D3D A;  1WX7 A;  3NS1 A;  4IWO A;  1UEL A;  1WGG A;  3PLV A;  2YVC A;  3N20 C;  2Z59 B;  4ZHP A;  4MGI E;  4KGT A;  1R4M I;  3VHT C;  2JVC A;  3LB8 C;  1T0Y A;  1AWD A;  2J0J A;  1ZXH A;  4RMA A;  3VTV A;  3X0W A;  2WDT B;  3Q3N C;  4RF0 A;  3NUH B;  1SE3 A;  2KTR B;  3U7D A;  1FFV A;  2M4N A;  2J52 A;  4TMA B;  1ZGU B;  4LK0 M;  1QQR A;  2WXK A;  2BW2 A;  2NPT A;  2FUG 1;  2ZEQ A;  1EUV B;  2NMQ A;  1R4N I;  1M4V A;  3UF8 A;  1FMA D;  3VQI A;  2QIE B;  3ML9 A;  1RLF A;  2WNM A;  2W3R A;  2IDY A;  1QIL A;  4MM3 A;  2O6V B;  4J3O D;  2KC1 A;  4USA A;  4HRO A;  1CK1 A;  3H1U A;  4MM3 B;  4W9J A;  1UUP A;  1RYJ A;  2JZZ A;  3QCA A;  4OW0 A;  2IGD A;  4BAX A;  3HVD A;  4HRS A;  4JX1 C;  4YTN B;  1GOZ A;  1WR1 A;  1YN3 A;  2CHZ A;  2FID A;  4PT5 A;  4XX5 A;  4H2A A;  2WU5 B;  2K0P A;  3E56 A;  3PLU A;  3BK2 A;  4I6P A;  3WAO A;  1DGJ A;  1WGR A;  3VRB B;  2N1V A;  5C3J B;  3GE8 C;  4FJZ A;  2FE8 A;  3RZF A;  3D32 A;  4NY0 A;  1UBI A;  1Q10 A;  2KWU B;  1FM0 D;  4ZOH C;  3TJP A;  2DEN B;  4W9H A;  1C1Y B;  4REZ A;  3CST A;  1UH6 A;  1WGH A;  3UQA A;  3BYT B;  4AWJ A;  3KVF B;  2W9N A;  3Q8A A;  1TKE A;  3P4S B;  2Y5B B;  4WWO A;  2V3P A;  4RGM A;  3DHG C;  2OOB B;  3GB1 A;  1EU4 A;  2WS3 B;  1HQR D;  2D3C A;  3DBS A;  3RT3 B;  4IDI A;  2K39 A;  3AE7 B;  3JSV A;  2ONQ A;  4YT0 B;  4ANU A;  4I6L B;  1WXM A;  3JSV B;  3L16 A;  4UDU C;  1CMX B;  4MH0 E;  3QWZ B;  4FUL A;  3AXC A;  3R3M A;  1YN5 A;  4IKG A;  3FIL A;  1FRR A;  3TBL D;  2CKH B;  1JW9 D;  1KRH A;  4YSY B;  2RMM A;  3N1Y C;  2PVO D;  1TS4 A;  3DWM A;  3AUL A;  1AN8 A;  4YSZ B;  4G0N B;  3UI3 A;  2PLP A;  1YX6 B;  2GBN A;  4GLS C;  4NPN A;  2BS2 B;  2PVG C;  2KJR A;  4DDI D;  1WSP A;  3EFU A;  1VDV A;  4AJY B;  2KAC A;  3P63 A;  2KNB A;  4S0R A;  2O2V B;  3Q8E A;  1FNV A;  4RFB A;  2MRP A;  3EC8 A;  3I57 A;  4N59 A;  1WRD B;  4E71 A;  2JXT A;  2KLG A;  3IBE A;  5C2T B;  5LNK 1;  3ZNG C;  1JWU D;  2MLB A;  2JXX A;  4IOI E;  4G50 A;  2ZW0 A;  2IJ0 A;  2MJ3 A;  3R66 C;  1RWS A;  4MGZ E;  4W9K A;  1HEZ E;  2MJD A;  5TR5 A;  1WRI A;  4EZJ A;  1RFK A;  4GOC A;  3V3X A;  4F1S A;  5BMI A;  1L4Z B;  3AN1 A;  5C1Z A;  5DPW A;  3APD A;  2LGX A;  4MJS A;  2INN E;  2JYT A;  1V9J A;  5FR3 A;  4MJS B;  3Q6B A;  5EE0 A;  4M0W B;  2AQ2 B;  1XD3 B;  2MBQ A;  4WQM A;  3R2I A;  2MBE A;  1F1H A;  2DZJ A;  2NBU A;  1WGD A;  1C76 A;  4C4V A;  4N6E B;  2N7D A;  4C4V B;  2OJR A;  3KUZ A;  1YJI A;  3VR8 B;  5D94 A;  4CHK A;  1OEY A;  3K9P B;  3HK0 A;  1K51 A;  3IAS 1;  1RM6 C;  2Q5W D;  4GN1 A;  4A90 A;  1NBF C;  3PZ8 A;  2WX1 A;  3JYU A;  4W9C A;  4M02 A;  2HJ8 A;  2LRU A;  1I4X A;  2ZVO A;  5D3I B;  2V3S A;  2JSV X;  2G45 B;  1SGH A;  3GZN B;  2EKI A;  4EEW A;  2NCN A;  2KTF A;  2R2O A;  1P98 A;  4ASW C;  3UIO B;  1ZPS A;  5FKA C;  4ZRK A;  1TKG A;  4C7Z A;  3NVZ A;  5FK9 C;  3SDL C;  4E74 A;  3AI5 A;  5CHF A;  2K9X A;  3DQV A;  3X23 A;  2V4I B;  5DPS A;  2D11 A;  5CHW A;  1JRO A;  1FNU A;  3ZGZ A;  2KLC A;  3PVL A;  3W5V B;  4XWW A;  5LXH A;  5GMV A;  3KYD D;  1NI3 A;  2LZ6 A;  2CU1 A;  2ZNV C;  3DVG X;  4A20 A;  1MPE A;  1WXQ A;  1ET9 A;  4HPM B;  4K7U A;  3WIM A;  4IM3 A;  3A9K A;  5E6J A;  2KZR A;  2KFK A;  3VH4 B;  4MEM A;  3A9K B;  3RMK C;  4WJQ A;  1NEK B;  4PS3 A;  2VH1 A;  2KQS A;  4ZHO A;  4ARC A;  1QOB A;  1LQB A;  3W1S C;  2G9H D;  1YN4 A;  4ZRQ A;  4P6V F;  1ZE3 D;  4GMV A;  4B0M A;  2KWD A;  2ACZ B;  4PS8 A;  1EF5 A;  3AV8 A;  2N4F A;  3VUW A;  2ZCC A;  3AEC B;  1WMH A;  3L08 A;  3DBL I;  4QAY A;  1V6E A;  5HFY A;  1P7F A;  1YQ4 B;  4C80 A;  1SEB D;  1TIF A;  3AH7 A;  3A4R A;  3ZVV A;  2FCQ A;  2WXO A;  4L2Y A;  2JT4 B;  3NZ3 A;  1IPG A;  5TSS A;  3K9O B;  3QAR A;  1I4R A;  4XWT A;  5KHQ A;  3EHV A;  4PK1 A;  3I63 C;  4WWP A;  2N9P C;  4KZC A;  1E8Y A;  1WE7 A;  2W82 A;  4YSX B;  2BQQ A;  2KK8 A;  3ZDT A;  4NAW A;  4A3O A;  4W9E A;  4DHJ B;  3VVW B;  3A33 B;  2WHI A;  1XLQ A;  1T0Q C;  2ICI A;  1CQV A;  4FN2 A;  2L52 A;  2N0S B;  3KUC B;  4KSL C;  3GE3 C;  1KM7 A;  3P4P B;  3RFZ B;  2JU6 X;  1BT0 A;  5LLI A;  3SFD B;  1PGX A;  3H6N A;  3NVV A;  4MGY E;  5D2M B;  2GBM A;  1GG3 A;  1X1M A;  2FCN A;  4AJW A;  2VRR B;  2PW9 A;  3ZXR A;  1GUA B;  1VLB A;  1PGB A;  2G1E A;  3ZDM C;  1OTR B;  1I7H A;  1VZ8 A;  3AEF B;  4XDD A;  1IGD A;  1WXA A;  3A9J B;  5EDS A;  3Q8C A;  1D5Z C;  2WXI A;  4PYZ A;  2H88 B;  2WX0 A;  1WJ6 A;  4RM8 A;  5HG2 A;  1TS2 A;  3RUI B;  1JRU A;  3AM9 A;  2C5L C;  4WIP A;  1Q5W B;  4WWM A;  2DZM A;  2JQR B;  1YMH E;  3VTW A;  4DHZ B;  1A5R A;  1P3Q U;  2IO3 B;  3Q3J A;  3BWU D;  1Q1O A;  1D3Z A;  2K8B A;  3B0A A;  4KDL B;  3ZJT A;  2E6X A;  2QJL A;  5JHB A;  1TZ1 A;  2QMT A;  3CWI A;  2Z0D B;  4ZRP A;  2KDI A;  4W9G A;  2LJ5 A;  4AUQ C;  4NZL B;  2LGD A;  2MHJ A;  2RSU A;  2BS4 B;  2Z0E B;  3ZTD A;  2K6D B;  3BK1 A;  2LFI A;  4TQ0 A;  4RM9 A;  2WXH A;  1C3T A;  4C56 C;  1PDX A;  2WXG A;  3H8H A;  4XYC A;  3P42 A;  1YD8 U;  2L00 B;  3H7P A;  2GI9 A;  1XLP A;  3DHI C;  2BYF A;  1TJE A;  4RGO S;  4MEL A;  4JQW C;  5HHD G;  1EO6 A;  2WXQ A;  3DOW A;  2AQ3 B;  1XF5 L;  2AYO B;  3BII D;  1GB4 A;  2V4L A;  4K1R B;  4GIV A;  2FIF A;  4FJV B;  1C4A A;  2ON8 A;  2LVO A;  4GXB A;  3W1S A;  4LJO B;  4HEA 1;  1I35 A;  4RGT A;  1ZKH A;  2DX5 B;  2W54 A;  3N32 A;  1V5T A;  2LWP A;  4LNO A;  2KC2 A;  4WQO B;  3MJ5 A;  2L0F A;  5DPT A;  1U4A A;  3IT4 B;  2DZK A;  3AE4 B;  4HKQ A;  2UWQ A;  2DBY A;  2NTT A;  3PRE A;  2K8H A;  1K50 A;  3AB5 A;  3AE6 B;  3AU4 A;  3IG3 A;  1OFF A;  2J7Q B;  4XZ4 A;  5C23 A;  1STE A;  1D4B A;  2RPV A;  4FHK A;  1Q0W B;  4DWF A;  3U30 A;  4O1N A;  3RNB C;  4Q2J A;  2AWT A;  3RI7 C;  1QT9 A;  3ZO5 B;  1V86 A;  2IO0 B;  2CJO A;  3TEX A;  3T9L A;  2ZW1 A;  3CIR B;  2PMV A;  3N1X C;  2NPT B;  1L0Y B;  1QLB B;  2KKC A;  3PHW B;  4OHJ A;  3EFC A;  3NZU A;  5T8I A;  1SE9 A;  2PJH A;  1S3S G;  2K3U A;  1WYG A;  3C8Y A;  4EZK A;  4OZC A;  2G3Q B;  1VZ6 A;  1QOA A;  2ZZP B;  4XC2 A;  3UQB A;  2ZJD A;  1UNS A;  4LNN A;  2XEW A;  5G2N A;  1UZX B;  3NZS A;  2M0A A;  3ZRF A;  1E9M A;  2DAF A;  2C7H A;  3RN9 C;  3QAQ A;  1WE6 A;  2V3N A;  3IT6 B;  2LGS A;  1V81 A;  1ZOY B;  4OVZ A;  2K5P A;  4ICV A;  3C19 A;  4WWN A;  3ETR A;  1EU3 A;  2OJW A;  2B76 B;  3U2S C;  4ZYS A;  2XNA C;  1UWM A;  1TGZ B;  4RGN A;  2C9W B;  2WXF A;  4E3C A;  5E6O A;  3QK0 A;  2LI5 A;  1T5X D;  1WXV A;  2N1W A;  1WFY A;  4TSS A;  3L10 B;  1MHX A;  3U8Z A;  1V49 A;  1RRB A;  3MHS D;  5HI1 A;  2L05 A;  3NJT A;  3QA8 A;  3UIP B;  5DPR A;  4M00 A;  3ZTC A;  4A8X C;  4HKZ E;  1MI0 A;  1JQ4 A;  4BBN F;  3ZIM A;  3BVZ A;  3OWE B;  1N5W A;  2NBW B;  2WXN A;  3VXW A;  4YXD B;  1JWM D;  3M63 B;  2MQJ A;  4F7Z A;  1ZW7 A;  2QDF A;  3R7Q A;  3HVZ A;  4A9A A;  1QF6 A;  3TCA A;  2VZK B;  3ECI A;  1SJH D;  1KJT A;  3FAH A;  4BKT A;  5J17 A;  3FIL B;  3OJ4 B;  4YTM B;  2BPS A;  1HXY D;  5LXI B;  2LMC A;  4W9L A;  1F0Z A;  2HJ1 A;  1YQB A;  1F77 A;  5MPO A;  3H7S A;  2D5G A;  2IPK D;  2CS4 A;  1ZP0 B;  2BYT A;  3RZW C;  3ENE A;  4M01 A;  3BY4 B;  4K3C A;  4KIK A;  3JVZ X;  3V61 A;  4F8C B;  4IW0 A;  3SU8 X;  2IY0 B;  4KIK B;  4A55 A;  1AW7 A;  3ZJV A;  1WR6 E;  5IP4 D;  1ISN A;  2MBO A;  3OG5 A;  4ZDV A;  4ACF A;  3MHZ A;  4LDT D;  5AUI A;  2JZ3 B;  4P7I A;  1GB1 A;  2H89 B;  3AE9 B;  1J0G A;  3LYY A;  3DBH B;  4ZRJ A;  5J18 A;  3V6C B;  3V6E B;  2AL3 A;  4OZA A;  1YX5 B;  2N9X A;  1OGW A;  4PYU A;  2AL6 A;  2M19 A;  1YNT E;  4KKJ A;  1IBX A;  3VRA B;  4YWG G;  2PE9 A;  2FCM A;  1CJE A;  1HTQ A;  4N58 A;  2HDE A;  3HUI A;  2D3A A;  5BYR A;  1WX8 A;  3RNG C;  1QKZ A;  1NYQ A;  3W9C B;  3AE1 B;  3RPF C;  2ZPN A;  3O65 B;  2JPH A;  2GRI A;  2CJN A;  3DVN U;  3W1Y A;  2WXM A;  1V8C A;  3Q69 A;  1M94 A;  3IAM 1;  1V97 A;  3I9V 1;  2WDV B;  1E8X A;  1KLU D;  1BUI C;  2O6V D;  3Q3F A;  2TSS A;  2BB6 A;  4DHZ E;  2N9E B;  3DVG Y;  3VDZ A;  2EMS A;  5H92 C;  3NVY A;  4RH6 A;  4AS1 A;  4IG7 B;  3OLM D;  1KLV A;  5JHA A;  4JE3 B;  2FCS A;  2JZP A;  2W55 A;  2KDE B;  2BWF A;  2Y3A A;  3ML8 A;  2K1F A;  1TY2 A;  1MG4 A;  3KH0 A;  1L4D B;  3PSE B;  4BKS D;  3AE3 B;  2PEA A;  3Q2A C;  3KWV A;  2DZI A;  2FBW B;  1YOV B;  2RDG A;  2KD0 A;  2KT7 A;  4MAC A;  1FO4 A;  2M8S A;  2Y5C A;  1ACC A;  3W2D A;  1SF0 A;  1YJ1 A;  2IND C;  2LEK A;  1E7P B;  1BML C;  2K8C A;  2V9H A;  2KN4 A;  1XLO A;  3KLS X;  1VZ7 A;  2HD5 B;  3L13 A;  1EWC A;  1TS3 A;  2RR9 A;  3ZNZ B;  2KFK B;  1QZE A;  1WF9 A;  2BS3 B;  1UWX A;  3WAP A;  1R4M B;  3B9J A;  2I2Y A;  5L95 C;  3LXF A;  1IP9 A;  1DOY A;  1MVK A;  5L83 A;  1FXI A;  1WJU A;  1R7S A;  3WCQ A;  3BZD B;  1WMH B;  1I4G A;  5EE3 A;  2WYQ A;  3PZ7 A;  1EF1 A;  3OJ3 A;  1B1Z A;  1LFD A;  1XQQ A;  1UF0 A;  4DQO C;  1T3Q A;  3ZNI D;  1WGK A;  1G6J A;  1AAR A;  4BOZ B;  1R4N B;  2NBV B;  4GGQ A;  1FD6 A;  1YIW A;  4II2 B;  2GOW A;  3NG0 A;  1I42 A;  4EKU A;  3PS6 A;  2PTL A;  2L3Z A;  5AZF A;  1JWB D;  2K25 A;  3HRD D;  5BYQ A;  1C4C A;  2A5U A;  3FC4 A;  4NJ7 A;  3IXS A;  4M8N A;  1C77 A;  1L0V B;  2D07 B;  2DHZ A;  1MJD A;  4RCO A;  2L32 A;  3N9Y C;  4KZ0 A;  1ZDV A;  4NAW B;  5E6N A;  4HDQ A;  2X8X X;  4JWS C;  3SFE B;  3Q3O C;  1SIJ A;  2JWZ A;  5IA7 A;  1AYF A;  1GJZ A;  2LHE A;  3I5J C;  1KTK A;  2AQ1 B;  3WAL A;  3N1Z C;  3RYT A;  3NS8 A;  2LUM A;  2LHD A;  3V05 A;  4KDI C;  1E7U A;  1F9J A;  2KMM A;  3ZRC A;  1HZ6 A;  3NVW A;  5IOI A;  2CU3 A;  1VCB A;  2PPH A;  3A1Q A; 
#chains in the Genus database with same CATH homology
 3QWZ B;  2HTH A;  3AU4 A;  4FUL A;  3IG3 A;  3AXC A;  4LJP B;  3ZKJ C;  3A1Q B;  2J7Q B;  4ICU A;  4XZ4 A;  3R3M A;  5C23 A;  3IFW B;  4FHK A;  4ANX A;  3TBL D;  2CKH B;  1Q0W B;  2J0K A;  2LGY A;  1E8W A;  1P0R A;  3L0W B;  4TKN A;  4DWF A;  3U30 A;  3UGB B;  3AUL A;  2ZCB A;  4G3X B;  3R7R A;  2EKE C;  2J0M A;  3DPD A;  3KW5 B;  2AWT A;  3PZD A;  4G0N B;  5AZG A;  2YLM A;  2BKR B;  5HKH A;  1YX6 B;  2GBN A;  3ZO5 B;  1E90 A;  1V86 A;  2IO0 B;  4NPN A;  2LUE A;  3T9L A;  4II3 B;  3ALB A;  2KJR A;  2ASQ A;  4DDI D;  2D2Q A;  4K81 A;  2DYM A;  2NPT B;  4IM2 A;  4NQL B;  4WJN A;  3EFU A;  1WZ0 A;  2FNJ B;  2KKC A;  2REX A;  3PHW B;  3PTF C;  3QC8 B;  3NZU A;  4IM0 A;  5D6J B;  4MDK E;  4AJY B;  2KNB A;  2KWV B;  1SE9 A;  2PJH A;  1S3S G;  2O2V B;  2D3G A;  3VFK A;  4K7S A;  3WAM A;  4EZK A;  1XT9 B;  2G3Q B;  3IVF A;  2ZZP B;  4XC2 A;  1V2Y A;  3JW0 X;  2MRP A;  3UQB A;  2IO1 B;  3EC8 A;  2ZJD A;  2GBK A;  1WRD B;  2L7R A;  2XEW A;  2KX0 A;  5G2N A;  4E71 A;  2MP2 A;  1UZX B;  2KLG A;  2KMC A;  3IBE A;  3NZS A;  3PHX B;  3ZRF A;  3ZNG C;  2DAF A;  2C7H A;  2MLB A;  5BO4 B;  2JXX A;  4G50 A;  1K8R B;  2L8J A;  3OAW A;  3QAQ A;  2LRW A;  3R66 C;  4GSW A;  1WE6 A;  2KJ6 A;  3P2B A;  4KV2 A;  1UD7 A;  2KOX A;  1V81 A;  2KQ7 A;  5CTR C;  1P9D U;  4MGZ E;  4FLH A;  1WH3 A;  4ICV A;  4W9K A;  5TR5 A;  4WWN A;  3H7P B;  4EOY A;  4EZJ A;  3GOE A;  3DBR I;  4GOC A;  2R2Q A;  2MCN B;  4F1S A;  2IO2 B;  1E8Z A;  2I1K A;  1RFA A;  1UGM A;  1TTN A;  1WXS A;  2MA9 B;  5C1Z A;  2FAZ A;  5DPW A;  2KXJ A;  2EMT A;  3APF A;  3APD A;  1NI2 A;  2LGX A;  4MJS A;  1V9J A;  1TGZ B;  4FJY A;  2ZNV B;  2BKF A;  2C9W B;  1VD2 A;  4MJS B;  4E3C A;  5E6O A;  2IZV B;  3QK0 A;  2KN5 A;  4TUU A;  2LI5 A;  4M0W B;  1WXV A;  3AU5 A;  5JH5 C;  1XD3 B;  1L7Y A;  2N1W A;  4OVV A;  1WFY A;  2MBQ A;  3VH3 B;  3ZLZ A;  4JIO U;  3L10 B;  2MBE A;  2DZJ A;  2NBU A;  1WGD A;  4B6W A;  1WM2 A;  2GBR A;  2K6Q A;  4X57 B;  5AZH A;  2LAS A;  3U8Z A;  2N7D A;  1V49 A;  2CR5 A;  3V62 A;  2OJR A;  3TL5 A;  2XK5 A;  3KUZ A;  3GZN I;  1RRB A;  3KUD B;  5D94 A;  5KHO A;  4CHK A;  3MHS D;  2XK5 B;  1OEY A;  1FXT B;  1Z5S B;  2JRH A;  2G4D B;  3HK0 A;  3K9P B;  2JF5 A;  2L05 A;  2RD0 A;  4IUM B;  3QA8 A;  3HM6 X;  4GN1 A;  4NQK E;  5DPR A;  3UIP B;  1NBF C;  3ZTC A;  2WX1 A;  3JYU A;  4W9C A;  4BOS C;  4GDK A;  2C7M B;  2HJ8 A;  2LRU A;  4HCP B;  3ZIM A;  4BBN F;  1S1Q B;  3SD5 A;  2ZVO A;  1V5O A;  4EFO A;  2NBW B;  2B3A A;  2V3S A;  2V1Y A;  2G45 B;  1SGH A;  4A3P A;  2LVQ A;  3VXW A;  4EEW A;  2NCN A;  2KTF A;  2R2O A;  3APC A;  2MQJ A;  3M63 B;  1ZW7 A;  4F7Z A;  1P98 A;  2JUO A;  3ONS A;  4ASW C;  3UIO B;  3SHQ A;  3R7Q A;  2M17 A;  3A4S C;  4ZRK A;  3TCA A;  3L17 A;  2KWC A;  3N3K B;  3SDL C;  3ECI A;  4CYE A;  4E74 A;  3AI5 A;  5CHF A;  3DQV A;  3X23 A;  1PQS A;  3DDC B;  1KJT A;  4M8M A;  3H9D A;  5DPS A;  4BKT A;  2D11 A;  5J17 A;  4JLC A;  2AEH A;  5CHW A;  3OJ4 B;  2BPS A;  1WJ4 A;  5LXI B;  2M0X A;  3A9J A;  4W9L A;  4FBJ B;  4HWI B;  4CO7 A;  1YQB A;  2KLC A;  3PVL A;  1WM3 A;  3H7S A;  5LXH A;  4DHJ D;  5GMV A;  2CS4 A;  5J2R A;  1V80 A;  1E7V A;  3RZW C;  3VTU A;  3KYD D;  3ENE A;  2LZ6 A;  4HDO A;  2CU1 A;  2ZNV C;  3DVG X;  3S2A A;  4DXA B;  4A20 A;  2KJH B;  3VUX A;  3BY4 B;  4BKG A;  4HPM B;  3DBH I;  4KIK A;  3JVZ X;  4K7U A;  3PRP B;  2KVR A;  3C0R B;  3V61 A;  4BBN C;  4F8C B;  2KAN A;  4EZL A;  4IW0 A;  3SU8 X;  3WIM A;  2IY0 B;  3B1L X;  2KTR A;  3PV1 A;  4KIK B;  4YL8 A;  4IM3 A;  3A9K A;  5DCN A;  2KZR A;  2KFK A;  1WIA A;  1WZ3 A;  3QX1 A;  3VH4 B;  1WR6 E;  4MEM A;  1WX9 A;  1ISN A;  2DAJ A;  2MBO A;  3A9K B;  3PT2 B;  4OVU A;  4ZDV A;  4WJQ A;  4LDT D;  1MG8 A;  2KHW B;  4PS3 A;  2I1J A;  2JRI B;  2XBB C;  4G11 A;  3V60 A;  4NNJ B;  5G55 A;  2D10 A;  2MBB B;  3CF6 E;  2KQS A;  4KVG B;  2JZ3 B;  4W9I A;  3I3T B;  4P7I A;  2BF8 B;  3DVN V;  1LQB A;  3W1S C;  4URK A;  1J0G A;  2NVU I;  4ZRJ A;  5J18 A;  3HHM A;  2DYB A;  3NOB A;  3V6C B;  4K7W A;  4GMV A;  2AL3 A;  2KX3 A;  4GDL A;  3V6E B;  1YX5 B;  4WAA A;  4FHJ A;  2N9X A;  4PS8 A;  5D7G A;  1OGW A;  1EF5 A;  4GDL B;  2MP2 B;  4PYU A;  2N4F A;  3VUW A;  2ZCC A;  5E6P A;  2AL6 A;  1WMH A;  4BVU C;  3RCZ A;  3L08 A;  4IWQ A;  1LM8 B;  3DBL I;  4HCN B;  2LD9 A;  3QIJ A;  2O6V A;  3QQ8 B;  3NHE B;  2L76 A;  2GMI C;  1V6E A;  2RPQ A;  3UIN B;  4HPL B;  2PE9 A;  4MSM B;  5AEK B;  5JZE B;  1GC6 A;  2FCM A;  3PRZ A;  2JY6 A;  4ANV A;  3QJZ A;  3A4R A;  1RAX A;  1WX8 A;  3ZVV A;  2FCQ A;  3HM3 A;  4J6I A;  4BFR A;  4JL9 A;  1OEY J;  4LCD E;  4MGK E;  5IAA C;  2ZPN A;  2JT4 B;  1E5W A;  1IPG A;  3IHP C;  3K9O B;  3LDZ E;  3O65 B;  3WA0 A;  1L2N A;  2UYZ B;  3QAR A;  2L0T A;  2JPH A;  4W9F A;  3DVN U;  3W1Y A;  2MBH A;  4ANW A;  5KHQ A;  3BIN A;  3EHV A;  4BKS A;  3TIX A;  2MX2 A;  1M94 A;  4WWP A;  3TMP B;  1HE8 A;  2N9P C;  1SIF A;  3CMM B;  4KZC A;  3KYC D;  3M95 A;  1WY8 A;  1E8Y A;  1NDD A;  1WE7 A;  2KK8 A;  2KFJ A;  3ZDT A;  2C7N B;  2LXA A;  1H4R A;  4NAW A;  1E8X A;  2KDB A;  2O6V D;  3Q3F A;  4PS7 A;  4TQ1 A;  3VUY A;  2MW5 A;  4A3O A;  1Y8R C;  4DHZ E;  4W9E A;  4FAD A;  3QHT A;  2N9E B;  4DHJ B;  3DVG Y;  3T8M A;  3VVW B;  3A33 B;  3VDZ A;  5CHV C;  2EMS A;  4GDK B;  4FN2 A;  1KOT A;  1J19 A;  2DYO A;  4IG7 B;  3OLM D;  1KLV A;  3KUC B;  4KSL C;  3RUL A;  5CX3 A;  5JHA A;  1WGY A;  3WAN A;  1KM7 A;  3ZUN A;  2FCS A;  3ZNH B;  1LXD A;  1BT0 A;  2ZVN A;  2MSE D;  5LLI A;  3L54 A;  4B95 A;  3H6N A;  2KDE B;  2BWF A;  4MGY E;  5D2M B;  3RD2 A;  2GBM A;  2MWS B;  1GG3 A;  3ML8 A;  1X1M A;  2K1F A;  4LDT B;  2FCN A;  2WWZ A;  1GNU A;  3MJW A;  4WJP A;  4AJW A;  2VRR B;  4KSK C;  3KH0 A;  4ZRI A;  3PSE B;  1GUA B;  3CSF A;  4BKS D;  2CHW A;  5FR6 A;  2PEA A;  2NS5 A;  2KMA A;  2FUH B;  3ZDM C;  2DZI A;  1OTR B;  4FA6 A;  2IYD B;  2KD0 A;  1TBE A;  2M8S A;  4GB9 A;  1WX7 A;  1WJN A;  4IWO A;  1UEL A;  1WXA A;  1WGG A;  3A9J B;  5EDS A;  2IBI B;  3PLV A;  2YVC A;  2Z59 B;  4MGI E;  4GU2 A;  1YJ1 A;  4EUT A;  1R4M I;  2K8C A;  3VHT C;  2JVC A;  1P1A A;  1T0Y A;  4HXD A;  4PYZ A;  4MSQ B;  4NJ6 A;  2J0J A;  2WX0 A;  1WJ6 A;  4RMA A;  4RM8 A;  3VTV A;  3RUI B;  3X0W A;  1JRU A;  2WDT B;  2HD5 B;  2C5L C;  2LVP A;  3L13 A;  1Q5W B;  2BYE A;  2DZM A;  2RR9 A;  4IC7 B;  4B9K A;  3VTW A;  4ZYN A;  4DHZ B;  1P3Q U;  1A5R A;  2KTR B;  3ZNZ B;  1UBQ A;  2IO3 B;  3Q3J A;  2KFK B;  2M4N A;  3U7D A;  1QZE A;  1WF9 A;  1Q1O A;  1D3Z A;  1ZGU B;  3WAP A;  1J8C A;  4DBG A;  3PRM B;  2K8B A;  3VAW A;  3B0A A;  4AP4 C;  4KDL B;  5JHB A;  1TZ1 A;  2NPT A;  2ZEQ A;  5L95 C;  1WYW B;  1IP9 A;  1OQY A;  1EUV B;  2Z0D B;  5L83 A;  4HVB A;  2KDI A;  1R4N I;  1WJU A;  3UF8 A;  2QHO A;  4W9G A;  2LJ5 A;  4AUQ C;  3VQI A;  2LGD A;  3ML9 A;  1WI0 A;  2O2V A;  3EEC A;  4I6N B;  2KDF B;  1WMH B;  2RSU A;  2WYQ A;  3DCG A;  2PE6 B;  1RLF A;  2Z0E B;  1EF1 A;  3ZTD A;  4MM3 A;  2O6V B;  3M3J A;  3OJ3 A;  1LFD A;  1XQQ A;  2K6D B;  2KC1 A;  4DDG D;  2M1M A;  3H1U A;  4W9J A;  4TQ0 A;  4RM9 A;  2LXC A;  2N7E A;  2HE7 A;  1C3T A;  3ZNI D;  2JZZ A;  3NY5 A;  3QCA A;  1G6J A;  1AAR A;  4BOZ B;  2NBV B;  4GGQ A;  1YIW A;  4II2 B;  2GOW A;  1YD8 U;  1GC7 A;  2IY1 B;  1I42 A;  2L00 B;  4EKU A;  3H7P A;  3PS6 A;  2BGF A;  1WR1 A;  2CHZ A;  4AOF A;  2FID A;  2RGF A;  4XX5 A;  2L3Z A;  4N9F 4;  2BYF A;  5AZF A;  2K25 A;  3ZW3 A;  2NR2 A;  1IYF A;  2A5U A;  3PLU A;  4HK2 A;  4I6P A;  4MEL A;  4JQW C;  3WAO A;  1EO6 A;  1WGR A;  4NJ7 A;  2C60 A;  2N1V A;  4M8N A;  3DOW A;  4FJZ A;  3RZF A;  2D07 B;  2DHZ A;  3N30 A;  2AYO B;  3D32 A;  2KO3 A;  4JGH B;  4NY0 A;  4KZ0 A;  1UBI A;  4WJO A;  1H8C A;  2KWU B;  4NAW B;  5E6N A;  3TJP A;  4TV3 A;  4HDQ A;  2DEN B;  4DK5 A;  4W9H A;  1C1Y B;  2V4L A;  4W9D A;  4K1R B;  3CST A;  1UH6 A;  1WGH A;  2CHX A;  3UQA A;  4GIV A;  2FIF A;  4AWJ A;  4FJV B;  3KVF B;  2W9N A;  2LVO A;  4GXB A;  2JWZ A;  5IA7 A;  2Y5B B;  3W1S A;  1GJZ A;  4WWO A;  4HJK A;  4LJO B;  2G4S A;  3WAL A;  1I35 A;  3RYT A;  3NS8 A;  1ZKH A;  2DX5 B;  3N32 A;  2OOB B;  1V5T A;  2LWP A;  3HIZ A;  4IWP A;  3B08 A;  1Z2M A;  2ZPY A;  2KC2 A;  4WQO B;  2L0F A;  5DPT A;  3DBS A;  2A4Z A;  3RT3 B;  1U4A A;  2K39 A;  3JSV A;  2BYV E;  3LJ3 A;  4KDI C;  3PPA A;  4ANU A;  1E7U A;  4I6L B;  1WXM A;  2DZK A;  3JSV B;  1F9J A;  2UWQ A;  3L16 A;  3MTN B;  3ZRC A;  2GBJ A;  2BWE S;  4HLE A;  1CMX B;  3PGE A;  3PRE A;  2K8H A;  1VCB A;  2PPH A;  3M62 B;  3A1Q A;  4MH0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...