2FNJB

Crystal structure of a b30.2/spry domain-containing protein gustavus in complex with elongin b and elongin c
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG2944-PF, isoform F
publication title Structural and functional insights into the B30.2/SPRY domain
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein transport/signaling protein
total genus 25
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2fnjB00
3VQIA 1WMHA 4MJSB 1WGRA 5JHAA 3DQVA 5D7GA 4JGHB 3PVLA 4W9DA 3VTUA 1M94A 2WDTB 2DZKA 4E74A 4E71A 2KWCA 1H8CA 1WMHB 1V6EA 4WQOB 2GBNA 2KLGA 1WR6E 4LJOB 4W9IA 2KDEB 4DDID 2N9PC 3IHPC 4MDKE 4GDLA 2KJHB 2MBQA 3VH3B 3DVGX 4N9F4 2KDFB 3QWZB 3R3MA 3ZNID 3SU8X 2RSUA 4IM2A 1WM2A 2BPSA 2DYBA 2PEAA 3BY4B 5J18A 1Q1OA 3HK0A 3M95A 4GDLB 4BOSC 4CHKA 4XC2A 4BOZB 2HJ8A 2MBEA 2CKHB 2DZIA 2HE7A 3VTVA 2KXJA 4ZDVA 2JXXA 2D2QA 1V9JA 3RT3B 3VVWB 1Q0WB 2K8CA 2LRWA 2KHWB 2NS5A 3EC8A 4IM3A 1OGWA 3JW0X 3A4SC 2QHOA 3SDLC 2HTHA 4XZ4A 3VDZA 4ASWC 1WGGA 4FHJA 2KJRA 2BF8B 1SE9A 4HPLB 3ZTCA 3KH0A 1ZW7A 5J17A 1OEYA 2V4LA 3UQAA 2C7NB 2MWSB 2NBVB 4A20A 1S1QB 4HXDA 4TQ0A 1ISNA 2MW5A 3EHVA 4ICVA 2RD0A 2D07B 2K8HA 2N9EB 1WE6A 2KN5A 2MBOA 3KUZA 3R7QA 4F7ZA 1WX8A 3GOEA 4NAWA 2GMIC 2BWES 5D2MB 1GC7A 2DZMA 2K6DB 4TUUA 4PYUA 2K1FA 2KX0A 2J0JA 1ZGUB 2LRUA 1P9DU 2JF5A 3VH4B 2CHWA 4K1RB 3V62A 3EECA 2PPHA 2IO2B 1WJ6A 3APDA 4W9FA 1WM3A 2LZ6A 2BKFA 2D11A 3ZO5B 3JYUA 4MGYE 5L95C 4IG7B 4KZ0A 3H6NA 3QX1A 3M3JA 3KUDB 2M8SA 4G50A 3SHQA 5IA7A 2MA9B 1OTRB 1KM7A 2ZEQA 3VUWA 2ZZPB 3PLVA 3N3KB 5FR6A 2KMAA 1IP9A 2MP2A 4RM9A 2KK8A 2KFKA 5AEKB 2FCQA 4FHKA 3IVFA 4BBNC 4URKA 2V3SA 3M62B 2J0MA 3S2AA 2RPQA 3R7RA 2JZZA 4K7WA 4A3PA 3TCAA 2GBRA 2MP2B 1NDDA 1TGZB 1WJ4A 2KFKB 4F8CB 2CS4A 2FCMA 2NBUA 1VD2A 3PHWB 4A3OA 4IWPA 3K9PB 1NBFC 2JRHA 3A33B 4BVUC 3CMMB 4II3B 3WALA 1GC6A 1EO6A 2DZJA 3APCA 5BO4B 4MM3A 4G3XB 4FJZA 2KWVB 1SGHA 1ZKHA 3TJPA 1L2NA 4EKUA 2R2OA 4W9GA 3B1LX 4ZYNA 4EOYA 5KHOA 3MTNB 2G4DB 3DBRI 5GMVA 3WA0A 3DVNV 3ZUNA 5C1ZA 2L0TA 2NPTA 1K8RB 1G6JA 3WANA 5AZGA 2N1WA 1E5WA 2FUHB 3X23A 2IO1B 4MGZE 3DBHI 1FXTB 2WX1A 2ZCBA 2KO3A 3PRMB 4GN1A 4GMVA 1C3TA 1P98A 2N4FA 3U30A 4OVUA 2PE6B 3KYDD 2JUOA 5CX3A 2NPTB 3T8MA 4IWQA 2Y5BB 1WXVA 5LXIB 3LJ3A 4BBNF 3VHTC 5DPWA 4NNJB 2L0FA 1LQBA 3W1SA 2GOWA 3ZRFA 4KSKC 3QK0A 3T9LA 3ZLZA 3ENEA 4LCDE 2G4SA 3DVGY 1WI0A 2V1YA 2KJ6A 2KNBA 2ZPNA 2LGDA 4AP4C 1RFAA 2MSED 2J7QB 1GUAB 3UIPB 4BKSA 2FIFA 4EZKA 3VXWA 4PS7A 2O6VD 1UELA 2RR9A 1WGYA 3H9DA 3ML9A 3AI5A 2AL3A 2JWZA 3RZFA 3ZIMA 2L76A 3W1YA 4EUTA 3ZDMC 1WGHA 1RLFA 2C5LC 2PJHA 4IUMB 2R2QA 2DYOA 3WIMA 2LJ5A 1UZXB 1RAXA 1RRBA 1WXAA 2CU1A 4JLCA 2UWQA 1WF9A 2Z0EB 2LD9A 3B08A 1HE8A 4GDKA 2YLMA 2WYQA 3RD2A 4ZRIA 2LXAA 3V60A 2K39A 4IWOA 2K25A 1R4MI 4M8NA 3UF8A 4DHJD 2CHZA 4GDKB 4TQ1A 4FADA 5G55A 3OJ3A 5E6NA 2LWPA 2RGFA 4KDIC 4TV3A 3A1QA 2L3ZA 2FNJB 3HM6X 3ZNGC 3APFA 2I1JA 3OJ4B 4NJ7A 5C23A 3RCZA 1J8CA 1OQYA 4I6LB 2IY1B 2O2VA 4HK2A 4JIOU 3A1QB 1E90A 1TBEA 4AJWA 2ZVOA 4GU2A 3DOWA 5G2NA 2L05A 2MBBB 2JY6A 4GB9A 2NR2A 3ONSA 2BWFA 2XEWA 3A9KA 3QAQA 4ZRKA 3NOBA 1IPGA 4LJPB 4WJPA 2O2VB 5JZEB 1U4AA 3RYTA 3HM3A 3N30A 4GSWA 3L0WB 1IYFA 1KLVA 3L16A 4RMAA 4BKGA 3X0WA 4B9KA 2MCNB 2M17A 4MGIE 2FAZA 3A9KB 4ANVA 1I35A 1L7YA 2XK5A 2DAFA 3CSTA 4ICUA 5D6JB 2KQSA 4WAAA 1YX5B 4XX5A 4P7IA 2KTRA 4J6IA 2W9NA 3Q3FA 4NY0A 4NJ6A 1WX9A 3VFKA 3C0RB 2XK5B 3WAPA 4FN2A 3ZKJC 1WZ3A 2D10A 2JZ3B 3B0AA 4FJYA 2KTRB 4NPNA 4DWFA 1VCBA 1WJNA 3CF6E 3DDCB 2BKRB 4II2B 3IBEA 2MRPA 3QC8B 2PE9A 2KANA 1R4NI 1S3SG 3MHSD 4KVGB 3PRPB 2LVOA 3PTFC 4B6WA 1T0YA 3R66C 3ZDTA 1C1YB 1YIWA 3GZNI 4HCPB 4ANWA 4GIVA 4W9EA 1UD7A 3NS8A 3A9JA 4WJOA 2XBBC 1TZ1A 2KDIA 3A4RA 3PHXB 5EDSA 4NQKE 4HVBA 5JHBA 5DPTA 1LXDA 3HIZA 3BINA 4MSMB 3QA8A 1V49A 2OJRA 2L00B 1KJTA 4KV2A 3PS6A 3A9JB 4AOFA 3DCGA 4LDTD 2KDBA 2ZNVB 4FJVB 4EFOA 1XD3B 2DAJA 2LVPA 2KKCA 3JVZX 5CHFA 4CO7A 1WYWB 4YL8A 2ZJDA 4IC7B 4G0NB 1V2YA 3ZW3A 4EZJA 2DX5B 1E7UA 1WIAA 2ZVNA 3PPAA 2WX0A 3RULA 2KX3A 3PV1A 3PREA 2KMCA 2NVUI 2LXCA 3IFWB 1KOTA 2IO0B 3PZDA 4BKTA 1Z5SB 3DBSA 3UGBB 4FA6A 3TL5A 2O6VA 4MSQB 4W9JA 3D32A 2OOBB 3PLUA 2C7MB 2Z59B 3V61A 2I1KA 1WX7A 2KVRA 4OVVA 1P3QU 3KW5B 2Z0DB 4EEWA 3DBLI 3HHMA 4HLEA 4W9CA 1V5OA 2MQJA 2EKEC 3P2BA 1WGDA 1X1MA 1E8YA 2O6VB 3EFUA 4HDOA 2LASA 4E3CA 3VUYA 3L08A 2BYVE 2YVCA 4HJKA 4W9KA 2IO3B 4K81A 2HD5B 4DK5A 4B95A 5CTRC 2J0KA 4FULA 5IAAC 3MJWA 3ECIA 3N32A 1P1AA 3TIXA 3TBLD 1EF1A 2BYEA 3QIJA 2MX2A 1Y8RC 2N9XA 1GG3A 1V86A 3UQBA 2N7EA 3DVNU 2LGYA 1V81A 1WH3A 4PYZA 3JSVA 2M0XA 3W1SC 5AZHA 5DPRA 3ZNHB 4DHJB 3SD5A 1EUVB 1WRDB 2G45B 2EMTA 1E8WA 4MGKE 3RUIB 3QARA 4DBGA 4RM8A 3JSVB 4DHZB 3KVFB 1XT9B 3AU5A 3KUCB 4PS3A 3VTWA 2GBMA 2CHXA 3OAWA 1LFDA 1J0GA 2B3AA 5J2RA 1OEYJ 5D94A 1GNUA 3VUXA 1WZ0A 4X57B 2A5UA 2A4ZA 2NBWB 3TMPB 4IW0A 3AULA 3QHTA 4W9HA 4GGQA 5E6PA 5JH5C 3DPDA 3UIOB 2IBIB 2BGFA 4K7SA 2KOXA 2LI5A 1BT0A 3L10B 4KZCA 2ZPYA 2JVCA 1UH6A 4AJYB 3M63B 2LUEA 4K7UA 3WAOA 2N1VA 1WFYA 4I6NB 5LLIA 2DHZA 1Z2MA 2KTFA 5DCNA 2L7RA 2FIDA 3UINB 4BKSD 4ANXA 5DPSA 3QJZA 2GBJA 3VAWA 1CMXB 1WR1A 1WJUA 4WJQA 2C60A 2KQ7A 1GJZA 2KC2A 2MLBA 3ML8A 5TR5A 1YQBA 1XQQA 4HCNB 1NI2A 5E6OA 2JRIB 3IG3A 2KD0A 3PT2B 3ZVVA 3H1UA 1YD8U 1QZEA 5CHVC 3QQ8B 1A5RA 2DENB 2LVQA 2KFJA 4PS8A 3PGEA 1AARA 3NZUA 2JPHA 3QCAA 3CSFA 4FLHA 3NHEB 4HPMB 1WXSA 1E8ZA 1UBQA 3O65B 3U8ZA 4HWIB 3V6EB 4AUQC 2KZRA 4I6PA 2C9WB 2L8JA 4BFRA 2JT4B 2NCNA 4LDTB 1UGMA 4DDGD 4WWOA 4NAWB 2EMSA 2M4NA 4GXBA 1YX6B 1EF5A 2CR5A 4CYEA 1SIFA 5AZFA 2C7HA 3WAMA 3NY5A 4JQWC 3L13A 2UYZB 4MELA 3NZSA 4M8MA 3Q3JA 1TTNA 2G3QB 3ZNZB 2M1MA 3OLMD 2KLCA 4ANUA 1J19A 4IM0A 5KHQA 1WXMA 2K6QA 1MG8A 1WE7A 2LGXA 3AXCA 4HDQA 4DHZE 1V5TA 2IZVB 1E7VA 2ZNVC 4WWNA 2D3GA 3H7PA 4WJNA 4M0WB 1PQSA 4AWJA 1E8XA 3AU4A 2GBKA 2IYDB 3RZWC 2FCSA 2MBHA 1Q5WB 3ZRCA 5HKHA 2K8BA 2DYMA 2AYOB 4NQLB 2AL6A 4MH0E 1V80A 3H7PB 3L54A 1WY8A 4FBJB 1LM8B 4GOCA 4MEMA 3ZTDA 2N7DA 3K9OB 3LDZE 2REXA 4ZRJA 2ZCCA 3PRZA 2AWTA 1F9JA 4KDLB 1I42A 4G11A 1H4RA 2ASQA 3I3TB 4DXAB 1YJ1A 1UBIA 4JL9A 3H7SA 5LXHA 1D3ZA 4WWPA 4KIKA 4TKNA 3KYCD 2BYFA 2AEHA 5L83A 5CHWA 3U7DA 2KC1A 2IY0B 4F1SA 2VRRB 3ALBA 2KWUB 4W9LA 4MJSA 2WWZA 3L17A 1JRUA 4KIKB 3PSEB 4KSLC 2FCNA 3V6CB 4EZLA 1P0RA
chains in the Genus database with same CATH superfamily
4WH4A 1WMHA 5JHAA 2BTEA 5D7GA 3KWLA 1QF6A 4W9DA 2WXMA 3W2DA 3VRAB 4D2KA 4DDID 4W9IA 3AB5A 4N9F4 1JWUD 1WM2A 2DYBA 3N1ZC 4ZRPA 3M95A 4GDLB 4BOZB 2CKHB 2DZIA 1VDVA 2JXXA 1Y56A 1Q0WB 2ACZB 2K8CA 4XWWA 3DBRB 2NMQA 3JW0X 2E6XA 3C8YA 1UNSA 2HTHA 4ASWC 1HXYD 3DBHB 4HPLB 1DOYA 1L6VA 1ZW7A 1OEYA 4N58A 3H8HA 2NBVB 4MACA 2KAJA 2RD0A 2KYWA 2D07B 2KN5A 2RMMA 3KUZA 3R7QA 3AE8B 3AEBB 3GOEA 2BWES 4TUUA 5AUKA 2PLPA 2LRUA 1P9DU 2ONQA 3VH4B 2WXOA 3UI3A 3APDA 2BKFA 2D11A 4IG7B 4KZ0A 3KUDB 1QOFA 3SHQA 2ZZPB 1DGJA 2WXHA 5AEKB 1YN4A 4URKA 3M62B 3S2AA 4K7WA 4GLSC 3RMKC 3TCAA 1TGZB 4IWPA 2WS3B 2JRHA 4BVUC 4C00A 2PKOA 3B9JA 4G3XB 1YN5A 3VRBB 3EFCA 4EKUA 2N0SB 4EOYA 4MM3B 2G4DB 3DVNV 1GB1A 2AQ1B 5BYRA 1G6JA 2WXNA 2FUHB 2IO1B 4GN1A 3U30A 4OVUA 4IWQA 1J7BA 2Y5BB 3AE5B 2JYTA 4CQNA 1HTOA 4BBNF 1C76A 1LQBA 1ZDXA 2G4SA 2KJ6A 2KNBA 4AP4C 4OHJA 2XNAC 4LNFA 3UIPB 1KH0A 2RR9A 3MHZA 3AN1A 3ML9A 2KACA 3GZNB 2AL3A 2JWZA 2N9KA 3ZDMC 1WGHA 2PJHA 3AEDB 1T0RC 2IJ0A 2IPKD 3WIMA 2LJ5A 1WXAA 4JLCA 1MVKA 3AE2B 5FKAC 3RFZB 3KLSX 3AV8A 3RD2A 4ZRIA 1R4MI 3UF8A 4TQ1A 4FADA 3P63A 2FNJB 4HPPA 4NJ7A 1J8CA 3DBLB 2IY1B 2O2VA 3B2FA 4P1BC 3A1QB 4ZOHC 4GB9A 2WP9B 3A9KA 3NOBA 4LJPB 5JZEB 3RYTA 3N30A 1KLVA 2LGSA 2KWDA 1MG4A 2XK5A 4B0MA 1XLNA 3CSTA 4ICUA 2X38A 2KQSA 1YX5B 4BZAA 3MC9A 2J52A 3C0RB 4USAA 4S17A 3B0AA 4DWFA 3DDCB 1XLOA 4II2B 3IBEA 3QC8B 2PE9A 4RGNA 2KANA 1R4NI 1C79A 1T0YA 2Y5CA 1AW7A 4GIVA 1UD7A 1DOXA 1TZ1A 5DPTA 2KN4A 1FM0D 1YOVB 4P1CC 3W5UB 3ZJUA 3A9JB 3DCGA 4FJVB 2WXIA 4CO7A 3AEFB 3ZW3A 1QOGA 3PPAA 2NVUI 2WQYB 3DBSA 3U52E 3UGBB 3TL5A 4MSQB 2FUG1 3PLUA 1PGAA 1WX7A 2KVRA 4OVVA 1P3QU 4YSZB 2MQJA 3EFUA 1E8YA 2O6VB 1OQQA 2LASA 2N9LA 3VUYA 4HJKA 2DNFA 4B95A 3ECIA 3N32A 1P1AA 1N60A 1QOBA 3QIJA 1PFDA 3Q14C 1N61A 3V3XA 1CZPA 1DOIA 2R61A 5TSSA 3ZGZA 5DPRA 4IOIE 1I4XA 4MGKE 3QARA 2B76B 3JSVB 3ABVB 3AU5A 1FRRA 1C4CA 2D3AA 2CHXA 1AN8A 3MFGA 2WXKA 2HTME 3BVGA 1FRDA 3TEZA 3URYA 5JH5C 3FC4A 3UIOB 2INDC 3L10B 4KZCA 2ZPYA 1UH6A 3WAOA 5JXVA 2W82A 3UINB 4ANXA 1L6UA 4IKGA 1WR1A 2I2YA 1WJUA 2QIEB 2C60A 1VR9A 2K5PA 1YQBA 1XQQA 1NI2A 1MHHE 1XLPA 3PT2B 4J3OD 3QQ8B 3MC0B 4PS8A 4WAFA 3NZUA 1JWSD 1BMLC 3CSFA 4DHZB 3NHEB 3O65B 3U8ZA 4HWIB 2V3PA 4I6PA 2C9WB 3Q3OC 4LDTB 1YQ4B 4NAWB 1RYJA 4GXBA 3NRZA 4YXDB 1ZE3D 5T8IA 3NZSA 4M8MA 5I4DA 1UF0A 1T6BX 4IM0A 3FILB 2EELA 1R4MB 4DHZE 1E7VA 2ZNVC 3H7PA 1JCKB 1FPYA 2GBKA 5HKHA 2FCSA 2MBHA 3RNGC 2D3CA 1HZ5A 5D3IB 1CK1A 1V80A 4GOCA 3TEXA 1L0XB 2AWTA 2ASQA 4C4VB 1YJ1A 3Q8CA 1UBIA 5AUIA 3U7DA 2KWUB 2BB6A 1MJDA 2ON8A 3L17A 3PSEB 1K51A 1V1PA 4O1NA 3RI7C 4MJSB 4K3CA 3N9YC 2W3RA 1VRAB 2QMTA 4JGHB 1UWMA 4E74A 4E71A 1WMHB 1TT5B 2GBNA 2KLGA 4LNOA 1R4NB 4LJOB 2N9PC 3IHPC 2MBQA 3MC8A 3R3MA 2RSUA 1D5MC 2BPSA 2PEAA 4TMAB 3Q2AC 1ZP0B 3U4EG 2QSDA 5HHDG 3HK0A 5IP4D 4BOSC 3Q6BA 2MBEA 4ZDVA 2D2QA 4TSSA 2NS5A 3BVZA 1OGWA 2ICIA 3SDLC 3OG5A 1GPXA 1ZUD2 3UQAA 4HROA 1A70A 4A90A 1S1QB 2K8HA 1JRPA 3C19A 1WX8A 4NAWA 1GC7A 2DZMA 2KX0A 1ZGUB 2CHWA 1HTQA 2IO2B 2D5GA 4W9FA 1WM3A 2LZ6A 1I4HA 5L95C 2L1AA 3H6NA 3M3JA 4JPSA 5EE1A 4G50A 2LJIA 2J42A 5FR6A 2MP2A 4RM9A 2KFKA 4L2YA 2FCQA 1E6EB 2INCC 1TS4A 4BBNC 4R3DA 1NYQA 3DWGC 3I57A 1FXIA 2WXFA 2GBRA 3K9PB 2WGSA 1IGDA 1PDXA 3WALA 3APCA 5BO4B 2HDEA 2KWVB 4ZHOA 1L2NA 4WWMA 1FFUA 4ZRQA 1XO3A 2NPTA 4YSXB 5AZGA 4LNKA 1E5WA 2M56B 2ZCBA 4GMVA 2KO3A 2N4FA 2JUOA 4XE0A 4C7YA 2WLBA 1NVID 5DPWA 3VHTC 3DWMA 2L0FA 3ZRFA 3NVWA 4KSKC 2BBCA 1WI0A 3BK2A 3V05A 4C56C 1C4PA 1T0SC 2FIFA 2O6VD 1WGYA 3ZIMA 4EUTA 2C5LC 1RLFA 1WYGA 4HEA1 1N5WA 1RRBA 4M00A 2UWQA 1WF9A 2VZKB 4GDKA 1I4GA 1SIJA 4IWOA 2UU7A 4M8NA 2OHFA 4YTNB 3T3OA 4LTUA 5G55A 2INPE 2LWPA 1T3QA 5H92C 3ZNGC 5BMHA 2CJNA 3OJ4B 3EUB2 1OQYA 4AJWA 2BQQA 2L05A 2JY6A 3AEGB 2NR2A 4LNIA 1UGJA 2XEWA 4EE2A 1IPGA 2O2VB 3HM3A 2NTTA 5BMGA 4RMAA 4MGIE 2FAZA 3A9KB 1KFYB 4WAAA 2WHIA 4XX5A 4P7IA 2KTRA 4J6IA 2W9NA 4NJ6A 2L83A 2XK5B 3ZKJC 3N1XC 1WZ3A 2D10A 4NPNA 1VCBA 3CF6E 2BKRB 1EWYC 2OJWA 2TSSA 3MHSD 3EA6A 3PRPB 2LVOA 3R66C 3ZDTA 1YIWA 4HCPB 3SFDB 2WU5B 3NS8A 3PHXB 5EDSA 2KDIA 2AQ3B 1OFFA 1R7SA 4HVBA 1JW9D 3AE4B 3BVMA 4N6EB 3QA8A 1V49A 1I7HA 1PUTA 1KJTA 3PS6A 4AOFA 4LDTD 3U7ZA 2KDBA 4EFOA 3JVZX 5CHFA 2VH2A 1E10A 2ZJDA 2WX0A 3PREA 2JYEA 1IUEA 1KOTA 3PZDA 4FA6A 2OOBB 2C7MB 2Z59B 1F77A 1GB4A 5FK9C 2Z0DB 3HHMA 4W9CA 3HRDD 1X1MA 3Q8EA 4HDOA 4RGTA 1N62A 4W9KA 2IO3B 4ARIA 1F0ZA 2PVOD 3TIXA 3AE9B 1K50A 2Q5WD 2BYEA 1Y8RC 3B2GA 3BYYB 1GG3A 3UQBA 3DVNU 5EE3A 2XN9C 2KT7A 1L4ZB 1WRDB 3RUIB 3Q69A 3I5JC 4PS3A 3VTWA 2GBMA 1OEYJ 5D94A 2BS4B 2NBWB 4IW0A 3AULA 3QHTA 4YTPB 1EM7A 1GOZA 3OWEB 2BGFA 4K7SA 2LI5A 2V3NA 4AJYB 2HJ1A 2LUEA 4K7UA 3P4SB 1SBBB 1SE3A 2W3SA 2WU2B 5LLIA 4DXGA 1K53A 4NZLB 5DPSA 2LHEA 3I9V1 3QJZA 1E9MA 1IBXA 4MH8A 3VAWA 1CMXB 2JU6X 1CQVA 1ZXIA 1V8CA 2KC2A 2MLBA 3ML8A 2JQRB 4UDUC 2KD0A 1SJHD 3AM9A 2KFJA 1TY2A 3PGEA 4HPMB 1AARA 2JPHA 3NS1A 4A3OA 1E8ZA 1EU3A 1UBQA 2RDHA 1WSPA 2KZRA 2L8JA 1XCTL 4JE3B 4DDGD 4WWOA 1TKYA 1N5XA 1EF5A 1SJED 4WQMA 2CR5A 1SIFA 2C7HA 3E56A 1TJEA 3Q3JA 3ZNZB 1TKEA 3OLMD 2KLCA 4M0WA 5KHQA 1WXMA 1V5TA 2IZVB 3BYTB 1MFWA 3CWIA 2D3GA 2PTLA 4WWNA 1HEZE 2GI9A 1NENB 4WJNA 1PQSA 2IYDB 1FNWA 2LFIA 2DYMA 2OEDA 2AL6A 4MH0E 3H7PB 1WY8A 1RM6C 1LM8B 4MEMA 3ZTDA 3K9OB 3LDZE 2REXA 2KMMA 2M0AA 1WGKA 1F9JA 2ZCCA 3W5VB 1I42A 2E3TA 4DXAB 4JL9A 1YN3A 3H7SA 4A9AA 5LXHA 4KIKA 2AEHA 5G5HA 5L83A 2N7JA 1PYWD 1KF6B 2VH1A 4RH6A 1FO4A 1TS2A 1WGRA 2JZPA 1YMHE 3PVLA 1V1PB 4OZAA 2K0PA 3AMZA 1H8CA 1V6EA 3N20C 5C2TB 3IAM1 2KDEB 2KJHB 3VH3B 3DVGX 4HKQA 2KDFB 3QWZB 3SU8X 2BB5A 4IM2A 3BY4B 5J18A 5EE9A 1VLBA 3FAHA 1HQRD 3IAS1 4WIPA 5LNK1 3VTVA 2G9HD 1D6EC 1V9JA 4JWSC 3VVWB 5HG2A 2LRWA 2KHWB 3EC8A 4IM3A 1K52A 1T5XD 3A4SC 2QHOA 4RCOA 3VDZA 2VZKD 4Q2JA 4FHJA 2G1EA 2V0GA 1DYQA 2K9XA 4L1BA 3Q8AA 2INNE 4HXDA 4TQ0A 2MW5A 3EHVA 4ICVA 3E9SA 1WE6A 4F7ZA 2V9HA 2DBYA 2K6DB 4PYUA 2K1FA 1NYRA 4K1RB 3EECA 1TIFA 2WDQB 4KGRA 1P7EA 3JYUA 1SB3C 4MGYE 5C3JB 2M8SA 4LNNA 5IA7A 2MA9B 1OTRB 1KM7A 2ZEQA 3N1YC 3VUWA 3N3KB 1IP9A 1ZOYB 1SE4A 2KK8A 2Y3AA 4FHKA 3IVFA 1B1ZA 2CU3A 4LK0M 1QT9A 3BIID 4RF1A 2MP2B 1WJ4A 2KFKB 2CS4A 1VD2A 3PHWB 3GE3C 4II3B 1GC6A 3AE1B 1EO6A 2DZJA 4A8XC 2LMCA 2K3UA 3P4RB 4ZHPA 1MHXA 1JWMD 2V4IB 1FNVA 2WXQA 2QJLA 2L52A 4B0EA 3B1LX 4ZYNA 5KHOA 3AECB 3MTNB 3DBRI 3WA0A 3PZ8A 3WANA 4MGZE 3DBHI 3PRMB 1C3TA 1P98A 2JX5A 2PE6B 3KYDD 5CX3A 1JMLA 1YNTE 2NPTB 5LXIB 1B9RA 4NNJB 2GOWA 5BYQA 3QK0A 3ENEA 3DVGY 2V1YA 2IDYA 2MSED 1JWAD 4YWGG 1GUAB 3AH7A 4BKSA 4EZKA 3VXWA 4PS7A 1UELA 3H9DA 4HKZE 3W1YA 3AEAB 4IUMB 2R2QA 3NVVA 3BWUD 2W55A 3B08A 4OW0A 3GE8C 2YLMA 3VR9B 2WYQA 3RNFC 1V1OA 3P4PB 2CHZA 4GDKB 3OJ3A 2L3ZA 4A6QA 2YEPB 3HM6X 1STEA 3APFA 2I1JA 5C23A 2H88B 4HK2A 3TUOA 4JIOU 1E90A 4YT0B 4GU2A 3DOWA 3RNAC 3ONSA 2BWFA 4ZRKA 1QOAA 3BZDB 4IDIA 3P4QB 3X0WA 2MCNB 2M17A 3GS2A 1I35A 2LUMA 1C9FA 4PT5A 1XLQA 4REZA 4AS1A 1N63A 3VFKA 1ACCA 3VR8B 3WAPA 2JZ3B 4FJYA 2KTRB 3J9CA 3NJTA 2MRPA 1S3SG 4KVGB 4B6WA 3GZNI 4ANWA 4W9EA 4WJOA 2J53A 2XBBC 1SF0A 5JHBA 1WWTA 5BYSA 1LXDA 4AQ7A 2OJRA 4M01A 2L00B 1F2RC 1ZDVA 2ZNVB 1XD3B 2DAJA 2LVPA 2KKCA 3RPFC 3PO0A 1WYWB 4IC7B 4FXCA 2MJEA 1E7UA 2D3BA 4US8A 3CIRB 1XEEA 1PGBA 2IO0B 4BKTA 1Z5SB 3D32A 4NAMA 3V61A 2I1KA 3DBLI 4HLEA 1LGRA 1V5OA 3Q3MC 4E3CA 3P42A 1GAQB 4ITKA 1JQ4A 3L08A 2BYVE 2YVCA 4K81A 2HD5B 1XXGA 2BVCA 5CTRC 5IAAC 4FULA 3MJWA 2X8XX 1D5ZC 2ZW0A 3TBLD 3TSSA 1EF1A 2MX2A 1L5PA 2N9XA 1WH3A 2MHJA 3W1SC 3ZNHB 4DHJB 2J4XA 3SD5A 4KKIA 2EMTA 4DBGA 1I4RA 2BYTA 1LFDA 1J0GA 5J2RA 3VUXA 1GNUA 1C4AA 1WZ0A 2LEKA 4X57B 2A5UA 5BMIA 3TEYA 3TMPB 1ZPSA 3R2IA 2IBIB 3EGRA 2KDMA 2KOXA 1Q10A 1BT0A 2JVCA 2N1VA 1WFYA 4I6NB 2DHZA 1Z2MA 5DCNA 2L7RA 2FIDA 4BKSD 2Y5PA 5HI1A 2SAKA 1OQRA 2GBJA 1MPEA 1KTKA 2BS2B 3ETRA 3P1MA 2KQ7A 4HCNB 1IBXB 4NJCA 5E6OA 2JRIB 1HA5A 4JWUC 4YTMB 3U2SC 3IG3A 3ZVVA 3H1UA 1YD8U 1QZEA 1A5RA 2LVQA 1AYFA 3SR6A 3QCAA 3FKYA 1C78A 3V6EB 1WXSA 3RNBC 2WXLA 2BT6A 2NCNA 1UGMA 2EMSA 2M4NA 2AX5A 3AE6B 2AQ2B 3W9CB 1E0ZA 5AZFA 3WAMA 4JQWC 3L13A 4MELA 4K3BA 1JROA 2RPVA 1L0YB 2M1MA 2WXPA 3LXFA 4ANUA 5IO9A 2LGXA 1WE7A 4US9A 2ZW1A 4M0WB 1E8XA 3RZWC 1VZ6A 3ZRCA 1Q5WB 3SFEB 3NG0A 2K8BA 2PMVA 2AYOB 4NQLB 3L54A 4FBJB 2N7DA 2PW9A 4ZRJA 3PRZA 2DWQA 1H4RA 3I3TB 2WXRA 1ET9A 1D3ZA 2BYFA 4F1SA 2VRRB 4W9LA 3GP7A 1JRUA 2JXTA 4KIKB 2NTSA 1EWCA 4KSLC 3V6CB 4EZLA 3VQIA 5HFYA 2RDBC 2WXJA 3DQVA 3LB8C 4RFBA 3VTUA 1M94A 2WDTB 1BUIC 2DZKA 2KWCA 5GXGB 4WQOB 1KLUD 3MP9A 1WR6E 1F1HA 4MDKE 1SE2A 4GDLA 3Q3NC 3ZNID 1TZOA 1Q1OA 4CHKA 4XC2A 2HJ8A 3Q8FA 2HE7A 2Z8LA 2KXJA 2IGDA 2QEJC 1YJIA 1RWSA 3RT3B 2IGGA 1L0VB 1HZ6A 1QKZA 1SEBD 4XZ4A 3BK1A 3O13A 1WGGA 3R8BA 5E6JA 2KJRA 1D5XC 2BF8B 1AWDA 1SE9A 3ZTCA 3KH0A 5J17A 2V4LA 4DQOC 1MI0A 2C7NB 2MWSB 2I38A 4A20A 3NVYA 1ISNA 2N9EB 2MBOA 4LLGM 2GMIC 4JX1C 5D2MB 2J0JA 5H8YE 2JF5A 3V62A 1ROEA 2PPHA 1P7FA 1WJ6A 1BXTA 2QILA 3R2TA 3ZO5B 2M19A 3RNEC 3QX1A 1J7CA 1QILA 2BW2A 1NEKB 3PLVA 1T0QC 4HRSA 4P16A 2KMAA 3ZQ4A 1TY0A 2K22A 2V3SA 1EU4A 2J0MA 2RPQA 3R7RA 2JZZA 4A3PA 4RGMA 4F8CB 1NDDA 2FCMA 1QLBB 2NBUA 4A55A 4WURA 1VZ8A 2L32A 4BAXA 1NBFC 3A33B 3CMMB 4MM3A 1FFVA 3PZ7A 4FJZA 2RDGA 1SGHA 1ZKHA 3TJPA 2R2OA 2MJ3A 4W9GA 2MJDA 4ARCA 5GMVA 1FMAD 1FIQA 3ZUNA 5C1ZA 2L0TA 1K8RB 2CJOA 3L4PA 2N1WA 3X23A 1FXTB 2WX1A 1RFKA 3T8MA 1SSNA 1WXVA 3AE3B 3LJ3A 5IN7A 3W1SA 2JSVX 3T9LA 3ZLZA 2KQ4X 4LCDE 1C77A 5G5GA 2ZPNA 1FEHA 2LGDA 1RFAA 2J7QB 4N59A 3NZ3A 1CJEA 3AI5A 3DHGC 3RZFA 2L76A 3IT6B 4ACFA 1P0RA 2DYOA 1UZXB 1RAXA 2CU1A 1JALA 2Z0EB 2LD9A 1HE8A 2DLBA 2LXAA 3V60A 1I4QA 2K39A 2K25A 1WRIA 4DHJD 5IKCM 3AEEB 4KX6B 5EE0A 5E6NA 2RGFA 4KDIC 4TV3A 1L4DB 3A1QA 1J7AA 3RCZA 4I6LB 2FE8A 4PK1A 1TBEA 2IGHA 4P6VF 2ZVOA 2WXGA 5G2NA 2MBBB 3IT4B 2KVZA 3QAQA 4WJPA 4YSYB 1FNUA 1U4AA 1FCLA 4GSWA 3L0WB 1IYFA 3L16A 4BKGA 4B9KA 4ANVA 1TKGA 2PIAA 1L7YA 2DAFA 1V97A 1YJJA 5D6JB 1FCCC 3IXSA 2GRIA 3Q3FA 4NY0A 3SEBA 1WX9A 1SXTA 2BS3B 4FN2A 4OZBA 3NUHB 1WJNA 3HVDA 4H2AA 3PTFC 3KQ4A 1C1YB 1PGXA 1TS3A 3A9JA 3A4RA 4MT5A 4NQKE 4DXFA 3HIZA 3BINA 4MSMB 4C7ZA 4KV2A 4KGSA 1WXQA 3WCQA 4YL8A 4G0NB 1N6ZA 1V2YA 2QCZA 2DX5B 1WIAA 2ZVNA 4S0RA 3RULA 4EZJA 2KX3A 3PV1A 2KMCA 3RNCC 1LO5D 2LXCA 3IFWB 1F52A 3HVZA 2O6VA 4W9JA 3KW5B 4EEWA 1JWBD 2WDVB 3P2BA 2EKEC 1WGDA 3HUIA 1TYGB 2JWUA 2WDRB 4L23A 4DK5A 2GB1A 1ENFA 3ZYYX 2J0KA 1YQ3B 4XWTA 4XDDA 2WNMA 3AE7B 2GLSA 1VZ7A 1V86A 2N7EA 2LGYA 1V81A 4OVZA 3JSVA 2M0XA 4PYZA 5AZHA 1EUVB 2G45B 1E8WA 3ZJTA 1ZXHA 4RM8A 3KVFB 2FBWB 1XT9B 4RNAA 3KUCB 4XYCA 3GB1A 3OAWA 5FR3A 1ET6A 2B3AA 4KGTA 1ESFA 2MH7A 4OZCA 2A4ZA 4HJGE 1F2RI 3TEWA 1UWXA 1I4PA 4W9HA 4GGQA 5E6PA 3DPDA 3M63B 3ZXRA 1FXAA 3MJ5A 1E7PB 2KTFA 1D4BA 1UUPA 3ZXVA 1FD6A 4WJQA 3DHIC 4C80A 1GJZA 5D3DA 2EKIA 5TR5A 4ZYSA 4KKJA 3DHHC 4QAYA 2SEBD 2MEKA 5CHVC 1KRHA 2DENB 4XGAB 5IOIA 4FLHA 4AUQC 1VJKA 2LHDA 4BFRA 2JT4B 4XDCA 1YX6B 3T3NA 4CYEA 2YEPF 3NY5A 3FILA 1QQRA 2UYZB 3Q8BA 1TTNA 2G3QB 3LYYA 4M02A 1IGCA 1J19A 1M4VA 2K6QA 1MG8A 3AXCA 3ZJVA 4HDQA 3NVZA 4AWJA 1NI3A 3AU4A 2QC8A 4RF0A 4RGOS 4C4VA 1TS5A 1XCQL 1XF5L 4KDLB 4G11A 2W54A 3I63C 4WWPA 4TKNA 1KLGD 3KYCD 2H89B 5CHWA 2KC1A 2IY0B 3ALBA 3RN9C 4MJSA 2WWZA 2QDFA 2LGIA 2PVGC 5MPOA 2FCNA 3KWVA
chains in the Genus database with same CATH topology
3VQIA 1WMHA 4MJSB 1WGRA 5JHAA 3DQVA 5D7GA 4JGHB 3PVLA 4W9DA 3VTUA 1M94A 2WDTB 2DZKA 4E74A 4E71A 2KWCA 1H8CA 1WMHB 1V6EA 4WQOB 2GBNA 2KLGA 1WR6E 4LJOB 4W9IA 2KDEB 4DDID 2N9PC 3IHPC 4MDKE 4GDLA 2KJHB 2MBQA 3VH3B 3DVGX 4N9F4 2KDFB 3QWZB 3R3MA 3ZNID 3SU8X 2RSUA 4IM2A 1WM2A 2BPSA 2DYBA 2PEAA 3BY4B 5J18A 1Q1OA 3HK0A 3M95A 4GDLB 4BOSC 4CHKA 4XC2A 4BOZB 2HJ8A 2MBEA 2CKHB 2DZIA 2HE7A 3VTVA 2KXJA 4ZDVA 2JXXA 2D2QA 1V9JA 3RT3B 3VVWB 1Q0WB 2K8CA 2LRWA 2KHWB 2NS5A 3EC8A 4IM3A 1OGWA 3JW0X 3A4SC 2QHOA 3SDLC 2HTHA 4XZ4A 3VDZA 4ASWC 1WGGA 4FHJA 2KJRA 2BF8B 1SE9A 4HPLB 3ZTCA 3KH0A 1ZW7A 5J17A 1OEYA 2V4LA 3UQAA 2C7NB 2MWSB 2NBVB 4A20A 1S1QB 4HXDA 4TQ0A 1ISNA 2MW5A 3EHVA 4ICVA 2RD0A 2D07B 2K8HA 2N9EB 1WE6A 2KN5A 2MBOA 3KUZA 3R7QA 4F7ZA 1WX8A 3GOEA 4NAWA 2GMIC 2BWES 5D2MB 1GC7A 2DZMA 2K6DB 4TUUA 4PYUA 2K1FA 2KX0A 2J0JA 1ZGUB 2LRUA 1P9DU 2JF5A 3VH4B 2CHWA 4K1RB 3V62A 3EECA 2PPHA 2IO2B 1WJ6A 3APDA 4W9FA 1WM3A 2LZ6A 2BKFA 2D11A 3ZO5B 3JYUA 4MGYE 5L95C 4IG7B 4KZ0A 3H6NA 3QX1A 3M3JA 3KUDB 2M8SA 4G50A 3SHQA 5IA7A 2MA9B 1OTRB 1KM7A 2ZEQA 3VUWA 2ZZPB 3PLVA 3N3KB 5FR6A 2KMAA 1IP9A 2MP2A 4RM9A 2KK8A 2KFKA 5AEKB 2FCQA 4FHKA 3IVFA 4BBNC 4URKA 2V3SA 3M62B 2J0MA 3S2AA 2RPQA 3R7RA 2JZZA 4K7WA 4A3PA 3TCAA 2GBRA 2MP2B 1NDDA 1TGZB 1WJ4A 2KFKB 4F8CB 2CS4A 2FCMA 2NBUA 1VD2A 3PHWB 4A3OA 4IWPA 3K9PB 1NBFC 2JRHA 3A33B 4BVUC 3CMMB 4II3B 3WALA 1GC6A 1EO6A 2DZJA 3APCA 5BO4B 4MM3A 4G3XB 4FJZA 2KWVB 1SGHA 1ZKHA 3TJPA 1L2NA 4EKUA 2R2OA 4W9GA 3B1LX 4ZYNA 4EOYA 5KHOA 3MTNB 2G4DB 3DBRI 5GMVA 3WA0A 3DVNV 3ZUNA 5C1ZA 2L0TA 2NPTA 1K8RB 1G6JA 3WANA 5AZGA 2N1WA 1E5WA 2FUHB 3X23A 2IO1B 4MGZE 3DBHI 1FXTB 2WX1A 2ZCBA 2KO3A 3PRMB 4GN1A 4GMVA 1C3TA 1P98A 2N4FA 3U30A 4OVUA 2PE6B 3KYDD 2JUOA 5CX3A 2NPTB 3T8MA 4IWQA 2Y5BB 1WXVA 5LXIB 3LJ3A 4BBNF 3VHTC 5DPWA 4NNJB 2L0FA 1LQBA 3W1SA 2GOWA 3ZRFA 4KSKC 3QK0A 3T9LA 3ZLZA 3ENEA 4LCDE 2G4SA 3DVGY 1WI0A 2V1YA 2KJ6A 2KNBA 2ZPNA 2LGDA 4AP4C 1RFAA 2MSED 2J7QB 1GUAB 3UIPB 4BKSA 2FIFA 4EZKA 3VXWA 4PS7A 2O6VD 1UELA 2RR9A 1WGYA 3H9DA 3ML9A 3AI5A 2AL3A 2JWZA 3RZFA 3ZIMA 2L76A 3W1YA 4EUTA 3ZDMC 1WGHA 1RLFA 2C5LC 2PJHA 4IUMB 2R2QA 2DYOA 3WIMA 2LJ5A 1UZXB 1RAXA 1RRBA 1WXAA 2CU1A 4JLCA 2UWQA 1WF9A 2Z0EB 2LD9A 3B08A 1HE8A 4GDKA 2YLMA 2WYQA 3RD2A 4ZRIA 2LXAA 3V60A 2K39A 4IWOA 2K25A 1R4MI 4M8NA 3UF8A 4DHJD 2CHZA 4GDKB 4TQ1A 4FADA 5G55A 3OJ3A 5E6NA 2LWPA 2RGFA 4KDIC 4TV3A 3A1QA 2L3ZA 2FNJB 3HM6X 3ZNGC 3APFA 2I1JA 3OJ4B 4NJ7A 5C23A 3RCZA 1J8CA 1OQYA 4I6LB 2IY1B 2O2VA 4HK2A 4JIOU 3A1QB 1E90A 1TBEA 4AJWA 2ZVOA 4GU2A 3DOWA 5G2NA 2L05A 2MBBB 2JY6A 4GB9A 2NR2A 3ONSA 2BWFA 2XEWA 3A9KA 3QAQA 4ZRKA 3NOBA 1IPGA 4LJPB 4WJPA 2O2VB 5JZEB 1U4AA 3RYTA 3HM3A 3N30A 4GSWA 3L0WB 1IYFA 1KLVA 3L16A 4RMAA 4BKGA 3X0WA 4B9KA 2MCNB 2M17A 4MGIE 2FAZA 3A9KB 4ANVA 1I35A 1L7YA 2XK5A 2DAFA 3CSTA 4ICUA 5D6JB 2KQSA 4WAAA 1YX5B 4XX5A 4P7IA 2KTRA 4J6IA 2W9NA 3Q3FA 4NY0A 4NJ6A 1WX9A 3VFKA 3C0RB 2XK5B 3WAPA 4FN2A 3ZKJC 1WZ3A 2D10A 2JZ3B 3B0AA 4FJYA 2KTRB 4NPNA 4DWFA 1VCBA 1WJNA 3CF6E 3DDCB 2BKRB 4II2B 3IBEA 2MRPA 3QC8B 2PE9A 2KANA 1R4NI 1S3SG 3MHSD 4KVGB 3PRPB 2LVOA 3PTFC 4B6WA 1T0YA 3R66C 3ZDTA 1C1YB 1YIWA 3GZNI 4HCPB 4ANWA 4GIVA 4W9EA 1UD7A 3NS8A 3A9JA 4WJOA 2XBBC 1TZ1A 2KDIA 3A4RA 3PHXB 5EDSA 4NQKE 4HVBA 5JHBA 5DPTA 1LXDA 3HIZA 3BINA 4MSMB 3QA8A 1V49A 2OJRA 2L00B 1KJTA 4KV2A 3PS6A 3A9JB 4AOFA 3DCGA 4LDTD 2KDBA 2ZNVB 4FJVB 4EFOA 1XD3B 2DAJA 2LVPA 2KKCA 3JVZX 5CHFA 4CO7A 1WYWB 4YL8A 2ZJDA 4IC7B 4G0NB 1V2YA 3ZW3A 4EZJA 2DX5B 1E7UA 1WIAA 2ZVNA 3PPAA 2WX0A 3RULA 2KX3A 3PV1A 3PREA 2KMCA 2NVUI 2LXCA 3IFWB 1KOTA 2IO0B 3PZDA 4BKTA 1Z5SB 3DBSA 3UGBB 4FA6A 3TL5A 2O6VA 4MSQB 4W9JA 3D32A 2OOBB 3PLUA 2C7MB 2Z59B 3V61A 2I1KA 1WX7A 2KVRA 4OVVA 1P3QU 3KW5B 2Z0DB 4EEWA 3DBLI 3HHMA 4HLEA 4W9CA 1V5OA 2MQJA 2EKEC 3P2BA 1WGDA 1X1MA 1E8YA 2O6VB 3EFUA 4HDOA 2LASA 4E3CA 3VUYA 3L08A 2BYVE 2YVCA 4HJKA 4W9KA 2IO3B 4K81A 2HD5B 4DK5A 4B95A 5CTRC 2J0KA 4FULA 5IAAC 3MJWA 3ECIA 3N32A 1P1AA 3TIXA 3TBLD 1EF1A 2BYEA 3QIJA 2MX2A 1Y8RC 2N9XA 1GG3A 1V86A 3UQBA 2N7EA 3DVNU 2LGYA 1V81A 1WH3A 4PYZA 3JSVA 2M0XA 3W1SC 5AZHA 5DPRA 3ZNHB 4DHJB 3SD5A 1EUVB 1WRDB 2G45B 2EMTA 1E8WA 4MGKE 3RUIB 3QARA 4DBGA 4RM8A 3JSVB 4DHZB 3KVFB 1XT9B 3AU5A 3KUCB 4PS3A 3VTWA 2GBMA 2CHXA 3OAWA 1LFDA 1J0GA 2B3AA 5J2RA 1OEYJ 5D94A 1GNUA 3VUXA 1WZ0A 4X57B 2A5UA 2A4ZA 2NBWB 3TMPB 4IW0A 3AULA 3QHTA 4W9HA 4GGQA 5E6PA 5JH5C 3DPDA 3UIOB 2IBIB 2BGFA 4K7SA 2KOXA 2LI5A 1BT0A 3L10B 4KZCA 2ZPYA 2JVCA 1UH6A 4AJYB 3M63B 2LUEA 4K7UA 3WAOA 2N1VA 1WFYA 4I6NB 5LLIA 2DHZA 1Z2MA 2KTFA 5DCNA 2L7RA 2FIDA 3UINB 4BKSD 4ANXA 5DPSA 3QJZA 2GBJA 3VAWA 1CMXB 1WR1A 1WJUA 4WJQA 2C60A 2KQ7A 1GJZA 2KC2A 2MLBA 3ML8A 5TR5A 1YQBA 1XQQA 4HCNB 1NI2A 5E6OA 2JRIB 3IG3A 2KD0A 3PT2B 3ZVVA 3H1UA 1YD8U 1QZEA 5CHVC 3QQ8B 1A5RA 2DENB 2LVQA 2KFJA 4PS8A 3PGEA 1AARA 3NZUA 2JPHA 3QCAA 3CSFA 4FLHA 3NHEB 4HPMB 1WXSA 1E8ZA 1UBQA 3O65B 3U8ZA 4HWIB 3V6EB 4AUQC 2KZRA 4I6PA 2C9WB 2L8JA 4BFRA 2JT4B 2NCNA 4LDTB 1UGMA 4DDGD 4WWOA 4NAWB 2EMSA 2M4NA 4GXBA 1YX6B 1EF5A 2CR5A 4CYEA 1SIFA 5AZFA 2C7HA 3WAMA 3NY5A 4JQWC 3L13A 2UYZB 4MELA 3NZSA 4M8MA 3Q3JA 1TTNA 2G3QB 3ZNZB 2M1MA 3OLMD 2KLCA 4ANUA 1J19A 4IM0A 5KHQA 1WXMA 2K6QA 1MG8A 1WE7A 2LGXA 3AXCA 4HDQA 4DHZE 1V5TA 2IZVB 1E7VA 2ZNVC 4WWNA 2D3GA 3H7PA 4WJNA 4M0WB 1PQSA 4AWJA 1E8XA 3AU4A 2GBKA 2IYDB 3RZWC 2FCSA 2MBHA 1Q5WB 3ZRCA 5HKHA 2K8BA 2DYMA 2AYOB 4NQLB 2AL6A 4MH0E 1V80A 3H7PB 3L54A 1WY8A 4FBJB 1LM8B 4GOCA 4MEMA 3ZTDA 2N7DA 3K9OB 3LDZE 2REXA 4ZRJA 2ZCCA 3PRZA 2AWTA 1F9JA 4KDLB 1I42A 4G11A 1H4RA 2ASQA 3I3TB 4DXAB 1YJ1A 1UBIA 4JL9A 3H7SA 5LXHA 1D3ZA 4WWPA 4KIKA 4TKNA 3KYCD 2BYFA 2AEHA 5L83A 5CHWA 3U7DA 2KC1A 2IY0B 4F1SA 2VRRB 3ALBA 2KWUB 4W9LA 4MJSA 2WWZA 3L17A 1JRUA 4KIKB 3PSEB 4KSLC 2FCNA 3V6CB 4EZLA 1P0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQI A;  1WMH A;  4MJS B;  1WGR A;  5JHA A;  3DQV A;  5D7G A;  4JGH B;  3PVL A;  4W9D A;  3VTU A;  1M94 A;  2WDT B;  2DZK A;  4E74 A;  4E71 A;  2KWC A;  1H8C A;  1WMH B;  1V6E A;  4WQO B;  2GBN A;  2KLG A;  1WR6 E;  4LJO B;  4W9I A;  2KDE B;  4DDI D;  2N9P C;  3IHP C;  4MDK E;  4GDL A;  2KJH B;  2MBQ A;  3VH3 B;  3DVG X;  4N9F 4;  2KDF B;  3QWZ B;  3R3M A;  3ZNI D;  3SU8 X;  2RSU A;  4IM2 A;  1WM2 A;  2BPS A;  2DYB A;  2PEA A;  3BY4 B;  5J18 A;  1Q1O A;  3HK0 A;  3M95 A;  4GDL B;  4BOS C;  4CHK A;  4XC2 A;  4BOZ B;  2HJ8 A;  2MBE A;  2CKH B;  2DZI A;  2HE7 A;  3VTV A;  2KXJ A;  4ZDV A;  2JXX A;  2D2Q A;  1V9J A;  3RT3 B;  3VVW B;  1Q0W B;  2K8C A;  2LRW A;  2KHW B;  2NS5 A;  3EC8 A;  4IM3 A;  1OGW A;  3JW0 X;  3A4S C;  2QHO A;  3SDL C;  2HTH A;  4XZ4 A;  3VDZ A;  4ASW C;  1WGG A;  4FHJ A;  2KJR A;  2BF8 B;  1SE9 A;  4HPL B;  3ZTC A;  3KH0 A;  1ZW7 A;  5J17 A;  1OEY A;  2V4L A;  3UQA A;  2C7N B;  2MWS B;  2NBV B;  4A20 A;  1S1Q B;  4HXD A;  4TQ0 A;  1ISN A;  2MW5 A;  3EHV A;  4ICV A;  2RD0 A;  2D07 B;  2K8H A;  2N9E B;  1WE6 A;  2KN5 A;  2MBO A;  3KUZ A;  3R7Q A;  4F7Z A;  1WX8 A;  3GOE A;  4NAW A;  2GMI C;  2BWE S;  5D2M B;  1GC7 A;  2DZM A;  2K6D B;  4TUU A;  4PYU A;  2K1F A;  2KX0 A;  2J0J A;  1ZGU B;  2LRU A;  1P9D U;  2JF5 A;  3VH4 B;  2CHW A;  4K1R B;  3V62 A;  3EEC A;  2PPH A;  2IO2 B;  1WJ6 A;  3APD A;  4W9F A;  1WM3 A;  2LZ6 A;  2BKF A;  2D11 A;  3ZO5 B;  3JYU A;  4MGY E;  5L95 C;  4IG7 B;  4KZ0 A;  3H6N A;  3QX1 A;  3M3J A;  3KUD B;  2M8S A;  4G50 A;  3SHQ A;  5IA7 A;  2MA9 B;  1OTR B;  1KM7 A;  2ZEQ A;  3VUW A;  2ZZP B;  3PLV A;  3N3K B;  5FR6 A;  2KMA A;  1IP9 A;  2MP2 A;  4RM9 A;  2KK8 A;  2KFK A;  5AEK B;  2FCQ A;  4FHK A;  3IVF A;  4BBN C;  4URK A;  2V3S A;  3M62 B;  2J0M A;  3S2A A;  2RPQ A;  3R7R A;  2JZZ A;  4K7W A;  4A3P A;  3TCA A;  2GBR A;  2MP2 B;  1NDD A;  1TGZ B;  1WJ4 A;  2KFK B;  4F8C B;  2CS4 A;  2FCM A;  2NBU A;  1VD2 A;  3PHW B;  4A3O A;  4IWP A;  3K9P B;  1NBF C;  2JRH A;  3A33 B;  4BVU C;  3CMM B;  4II3 B;  3WAL A;  1GC6 A;  1EO6 A;  2DZJ A;  3APC A;  5BO4 B;  4MM3 A;  4G3X B;  4FJZ A;  2KWV B;  1SGH A;  1ZKH A;  3TJP A;  1L2N A;  4EKU A;  2R2O A;  4W9G A;  3B1L X;  4ZYN A;  4EOY A;  5KHO A;  3MTN B;  2G4D B;  3DBR I;  5GMV A;  3WA0 A;  3DVN V;  3ZUN A;  5C1Z A;  2L0T A;  2NPT A;  1K8R B;  1G6J A;  3WAN A;  5AZG A;  2N1W A;  1E5W A;  2FUH B;  3X23 A;  2IO1 B;  4MGZ E;  3DBH I;  1FXT B;  2WX1 A;  2ZCB A;  2KO3 A;  3PRM B;  4GN1 A;  4GMV A;  1C3T A;  1P98 A;  2N4F A;  3U30 A;  4OVU A;  2PE6 B;  3KYD D;  2JUO A;  5CX3 A;  2NPT B;  3T8M A;  4IWQ A;  2Y5B B;  1WXV A;  5LXI B;  3LJ3 A;  4BBN F;  3VHT C;  5DPW A;  4NNJ B;  2L0F A;  1LQB A;  3W1S A;  2GOW A;  3ZRF A;  4KSK C;  3QK0 A;  3T9L A;  3ZLZ A;  3ENE A;  4LCD E;  2G4S A;  3DVG Y;  1WI0 A;  2V1Y A;  2KJ6 A;  2KNB A;  2ZPN A;  2LGD A;  4AP4 C;  1RFA A;  2MSE D;  2J7Q B;  1GUA B;  3UIP B;  4BKS A;  2FIF A;  4EZK A;  3VXW A;  4PS7 A;  2O6V D;  1UEL A;  2RR9 A;  1WGY A;  3H9D A;  3ML9 A;  3AI5 A;  2AL3 A;  2JWZ A;  3RZF A;  3ZIM A;  2L76 A;  3W1Y A;  4EUT A;  3ZDM C;  1WGH A;  1RLF A;  2C5L C;  2PJH A;  4IUM B;  2R2Q A;  2DYO A;  3WIM A;  2LJ5 A;  1UZX B;  1RAX A;  1RRB A;  1WXA A;  2CU1 A;  4JLC A;  2UWQ A;  1WF9 A;  2Z0E B;  2LD9 A;  3B08 A;  1HE8 A;  4GDK A;  2YLM A;  2WYQ A;  3RD2 A;  4ZRI A;  2LXA A;  3V60 A;  2K39 A;  4IWO A;  2K25 A;  1R4M I;  4M8N A;  3UF8 A;  4DHJ D;  2CHZ A;  4GDK B;  4TQ1 A;  4FAD A;  5G55 A;  3OJ3 A;  5E6N A;  2LWP A;  2RGF A;  4KDI C;  4TV3 A;  3A1Q A;  2L3Z A;  2FNJ B;  3HM6 X;  3ZNG C;  3APF A;  2I1J A;  3OJ4 B;  4NJ7 A;  5C23 A;  3RCZ A;  1J8C A;  1OQY A;  4I6L B;  2IY1 B;  2O2V A;  4HK2 A;  4JIO U;  3A1Q B;  1E90 A;  1TBE A;  4AJW A;  2ZVO A;  4GU2 A;  3DOW A;  5G2N A;  2L05 A;  2MBB B;  2JY6 A;  4GB9 A;  2NR2 A;  3ONS A;  2BWF A;  2XEW A;  3A9K A;  3QAQ A;  4ZRK A;  3NOB A;  1IPG A;  4LJP B;  4WJP A;  2O2V B;  5JZE B;  1U4A A;  3RYT A;  3HM3 A;  3N30 A;  4GSW A;  3L0W B;  1IYF A;  1KLV A;  3L16 A;  4RMA A;  4BKG A;  3X0W A;  4B9K A;  2MCN B;  2M17 A;  4MGI E;  2FAZ A;  3A9K B;  4ANV A;  1I35 A;  1L7Y A;  2XK5 A;  2DAF A;  3CST A;  4ICU A;  5D6J B;  2KQS A;  4WAA A;  1YX5 B;  4XX5 A;  4P7I A;  2KTR A;  4J6I A;  2W9N A;  3Q3F A;  4NY0 A;  4NJ6 A;  1WX9 A;  3VFK A;  3C0R B;  2XK5 B;  3WAP A;  4FN2 A;  3ZKJ C;  1WZ3 A;  2D10 A;  2JZ3 B;  3B0A A;  4FJY A;  2KTR B;  4NPN A;  4DWF A;  1VCB A;  1WJN A;  3CF6 E;  3DDC B;  2BKR B;  4II2 B;  3IBE A;  2MRP A;  3QC8 B;  2PE9 A;  2KAN A;  1R4N I;  1S3S G;  3MHS D;  4KVG B;  3PRP B;  2LVO A;  3PTF C;  4B6W A;  1T0Y A;  3R66 C;  3ZDT A;  1C1Y B;  1YIW A;  3GZN I;  4HCP B;  4ANW A;  4GIV A;  4W9E A;  1UD7 A;  3NS8 A;  3A9J A;  4WJO A;  2XBB C;  1TZ1 A;  2KDI A;  3A4R A;  3PHX B;  5EDS A;  4NQK E;  4HVB A;  5JHB A;  5DPT A;  1LXD A;  3HIZ A;  3BIN A;  4MSM B;  3QA8 A;  1V49 A;  2OJR A;  2L00 B;  1KJT A;  4KV2 A;  3PS6 A;  3A9J B;  4AOF A;  3DCG A;  4LDT D;  2KDB A;  2ZNV B;  4FJV B;  4EFO A;  1XD3 B;  2DAJ A;  2LVP A;  2KKC A;  3JVZ X;  5CHF A;  4CO7 A;  1WYW B;  4YL8 A;  2ZJD A;  4IC7 B;  4G0N B;  1V2Y A;  3ZW3 A;  4EZJ A;  2DX5 B;  1E7U A;  1WIA A;  2ZVN A;  3PPA A;  2WX0 A;  3RUL A;  2KX3 A;  3PV1 A;  3PRE A;  2KMC A;  2NVU I;  2LXC A;  3IFW B;  1KOT A;  2IO0 B;  3PZD A;  4BKT A;  1Z5S B;  3DBS A;  3UGB B;  4FA6 A;  3TL5 A;  2O6V A;  4MSQ B;  4W9J A;  3D32 A;  2OOB B;  3PLU A;  2C7M B;  2Z59 B;  3V61 A;  2I1K A;  1WX7 A;  2KVR A;  4OVV A;  1P3Q U;  3KW5 B;  2Z0D B;  4EEW A;  3DBL I;  3HHM A;  4HLE A;  4W9C A;  1V5O A;  2MQJ A;  2EKE C;  3P2B A;  1WGD A;  1X1M A;  1E8Y A;  2O6V B;  3EFU A;  4HDO A;  2LAS A;  4E3C A;  3VUY A;  3L08 A;  2BYV E;  2YVC A;  4HJK A;  4W9K A;  2IO3 B;  4K81 A;  2HD5 B;  4DK5 A;  4B95 A;  5CTR C;  2J0K A;  4FUL A;  5IAA C;  3MJW A;  3ECI A;  3N32 A;  1P1A A;  3TIX A;  3TBL D;  1EF1 A;  2BYE A;  3QIJ A;  2MX2 A;  1Y8R C;  2N9X A;  1GG3 A;  1V86 A;  3UQB A;  2N7E A;  3DVN U;  2LGY A;  1V81 A;  1WH3 A;  4PYZ A;  3JSV A;  2M0X A;  3W1S C;  5AZH A;  5DPR A;  3ZNH B;  4DHJ B;  3SD5 A;  1EUV B;  1WRD B;  2G45 B;  2EMT A;  1E8W A;  4MGK E;  3RUI B;  3QAR A;  4DBG A;  4RM8 A;  3JSV B;  4DHZ B;  3KVF B;  1XT9 B;  3AU5 A;  3KUC B;  4PS3 A;  3VTW A;  2GBM A;  2CHX A;  3OAW A;  1LFD A;  1J0G A;  2B3A A;  5J2R A;  1OEY J;  5D94 A;  1GNU A;  3VUX A;  1WZ0 A;  4X57 B;  2A5U A;  2A4Z A;  2NBW B;  3TMP B;  4IW0 A;  3AUL A;  3QHT A;  4W9H A;  4GGQ A;  5E6P A;  5JH5 C;  3DPD A;  3UIO B;  2IBI B;  2BGF A;  4K7S A;  2KOX A;  2LI5 A;  1BT0 A;  3L10 B;  4KZC A;  2ZPY A;  2JVC A;  1UH6 A;  4AJY B;  3M63 B;  2LUE A;  4K7U A;  3WAO A;  2N1V A;  1WFY A;  4I6N B;  5LLI A;  2DHZ A;  1Z2M A;  2KTF A;  5DCN A;  2L7R A;  2FID A;  3UIN B;  4BKS D;  4ANX A;  5DPS A;  3QJZ A;  2GBJ A;  3VAW A;  1CMX B;  1WR1 A;  1WJU A;  4WJQ A;  2C60 A;  2KQ7 A;  1GJZ A;  2KC2 A;  2MLB A;  3ML8 A;  5TR5 A;  1YQB A;  1XQQ A;  4HCN B;  1NI2 A;  5E6O A;  2JRI B;  3IG3 A;  2KD0 A;  3PT2 B;  3ZVV A;  3H1U A;  1YD8 U;  1QZE A;  5CHV C;  3QQ8 B;  1A5R A;  2DEN B;  2LVQ A;  2KFJ A;  4PS8 A;  3PGE A;  1AAR A;  3NZU A;  2JPH A;  3QCA A;  3CSF A;  4FLH A;  3NHE B;  4HPM B;  1WXS A;  1E8Z A;  1UBQ A;  3O65 B;  3U8Z A;  4HWI B;  3V6E B;  4AUQ C;  2KZR A;  4I6P A;  2C9W B;  2L8J A;  4BFR A;  2JT4 B;  2NCN A;  4LDT B;  1UGM A;  4DDG D;  4WWO A;  4NAW B;  2EMS A;  2M4N A;  4GXB A;  1YX6 B;  1EF5 A;  2CR5 A;  4CYE A;  1SIF A;  5AZF A;  2C7H A;  3WAM A;  3NY5 A;  4JQW C;  3L13 A;  2UYZ B;  4MEL A;  3NZS A;  4M8M A;  3Q3J A;  1TTN A;  2G3Q B;  3ZNZ B;  2M1M A;  3OLM D;  2KLC A;  4ANU A;  1J19 A;  4IM0 A;  5KHQ A;  1WXM A;  2K6Q A;  1MG8 A;  1WE7 A;  2LGX A;  3AXC A;  4HDQ A;  4DHZ E;  1V5T A;  2IZV B;  1E7V A;  2ZNV C;  4WWN A;  2D3G A;  3H7P A;  4WJN A;  4M0W B;  1PQS A;  4AWJ A;  1E8X A;  3AU4 A;  2GBK A;  2IYD B;  3RZW C;  2FCS A;  2MBH A;  1Q5W B;  3ZRC A;  5HKH A;  2K8B A;  2DYM A;  2AYO B;  4NQL B;  2AL6 A;  4MH0 E;  1V80 A;  3H7P B;  3L54 A;  1WY8 A;  4FBJ B;  1LM8 B;  4GOC A;  4MEM A;  3ZTD A;  2N7D A;  3K9O B;  3LDZ E;  2REX A;  4ZRJ A;  2ZCC A;  3PRZ A;  2AWT A;  1F9J A;  4KDL B;  1I42 A;  4G11 A;  1H4R A;  2ASQ A;  3I3T B;  4DXA B;  1YJ1 A;  1UBI A;  4JL9 A;  3H7S A;  5LXH A;  1D3Z A;  4WWP A;  4KIK A;  4TKN A;  3KYC D;  2BYF A;  2AEH A;  5L83 A;  5CHW A;  3U7D A;  2KC1 A;  2IY0 B;  4F1S A;  2VRR B;  3ALB A;  2KWU B;  4W9L A;  4MJS A;  2WWZ A;  3L17 A;  1JRU A;  4KIK B;  3PSE B;  4KSL C;  2FCN A;  3V6C B;  4EZL A;  1P0R A; 
#chains in the Genus database with same CATH topology
 4WH4 A;  1WMH A;  5JHA A;  2BTE A;  5D7G A;  3KWL A;  1QF6 A;  4W9D A;  2WXM A;  3W2D A;  3VRA B;  4D2K A;  4DDI D;  4W9I A;  3AB5 A;  4N9F 4;  1JWU D;  1WM2 A;  2DYB A;  3N1Z C;  4ZRP A;  3M95 A;  4GDL B;  4BOZ B;  2CKH B;  2DZI A;  1VDV A;  2JXX A;  1Y56 A;  1Q0W B;  2ACZ B;  2K8C A;  4XWW A;  3DBR B;  2NMQ A;  3JW0 X;  2E6X A;  3C8Y A;  1UNS A;  2HTH A;  4ASW C;  1HXY D;  3DBH B;  4HPL B;  1DOY A;  1L6V A;  1ZW7 A;  1OEY A;  4N58 A;  3H8H A;  2NBV B;  4MAC A;  2KAJ A;  2RD0 A;  2KYW A;  2D07 B;  2KN5 A;  2RMM A;  3KUZ A;  3R7Q A;  3AE8 B;  3AEB B;  3GOE A;  2BWE S;  4TUU A;  5AUK A;  2PLP A;  2LRU A;  1P9D U;  2ONQ A;  3VH4 B;  2WXO A;  3UI3 A;  3APD A;  2BKF A;  2D11 A;  4IG7 B;  4KZ0 A;  3KUD B;  1QOF A;  3SHQ A;  2ZZP B;  1DGJ A;  2WXH A;  5AEK B;  1YN4 A;  4URK A;  3M62 B;  3S2A A;  4K7W A;  4GLS C;  3RMK C;  3TCA A;  1TGZ B;  4IWP A;  2WS3 B;  2JRH A;  4BVU C;  4C00 A;  2PKO A;  3B9J A;  4G3X B;  1YN5 A;  3VRB B;  3EFC A;  4EKU A;  2N0S B;  4EOY A;  4MM3 B;  2G4D B;  3DVN V;  1GB1 A;  2AQ1 B;  5BYR A;  1G6J A;  2WXN A;  2FUH B;  2IO1 B;  4GN1 A;  3U30 A;  4OVU A;  4IWQ A;  1J7B A;  2Y5B B;  3AE5 B;  2JYT A;  4CQN A;  1HTO A;  4BBN F;  1C76 A;  1LQB A;  1ZDX A;  2G4S A;  2KJ6 A;  2KNB A;  4AP4 C;  4OHJ A;  2XNA C;  4LNF A;  3UIP B;  1KH0 A;  2RR9 A;  3MHZ A;  3AN1 A;  3ML9 A;  2KAC A;  3GZN B;  2AL3 A;  2JWZ A;  2N9K A;  3ZDM C;  1WGH A;  2PJH A;  3AED B;  1T0R C;  2IJ0 A;  2IPK D;  3WIM A;  2LJ5 A;  1WXA A;  4JLC A;  1MVK A;  3AE2 B;  5FKA C;  3RFZ B;  3KLS X;  3AV8 A;  3RD2 A;  4ZRI A;  1R4M I;  3UF8 A;  4TQ1 A;  4FAD A;  3P63 A;  2FNJ B;  4HPP A;  4NJ7 A;  1J8C A;  3DBL B;  2IY1 B;  2O2V A;  3B2F A;  4P1B C;  3A1Q B;  4ZOH C;  4GB9 A;  2WP9 B;  3A9K A;  3NOB A;  4LJP B;  5JZE B;  3RYT A;  3N30 A;  1KLV A;  2LGS A;  2KWD A;  1MG4 A;  2XK5 A;  4B0M A;  1XLN A;  3CST A;  4ICU A;  2X38 A;  2KQS A;  1YX5 B;  4BZA A;  3MC9 A;  2J52 A;  3C0R B;  4USA A;  4S17 A;  3B0A A;  4DWF A;  3DDC B;  1XLO A;  4II2 B;  3IBE A;  3QC8 B;  2PE9 A;  4RGN A;  2KAN A;  1R4N I;  1C79 A;  1T0Y A;  2Y5C A;  1AW7 A;  4GIV A;  1UD7 A;  1DOX A;  1TZ1 A;  5DPT A;  2KN4 A;  1FM0 D;  1YOV B;  4P1C C;  3W5U B;  3ZJU A;  3A9J B;  3DCG A;  4FJV B;  2WXI A;  4CO7 A;  3AEF B;  3ZW3 A;  1QOG A;  3PPA A;  2NVU I;  2WQY B;  3DBS A;  3U52 E;  3UGB B;  3TL5 A;  4MSQ B;  2FUG 1;  3PLU A;  1PGA A;  1WX7 A;  2KVR A;  4OVV A;  1P3Q U;  4YSZ B;  2MQJ A;  3EFU A;  1E8Y A;  2O6V B;  1OQQ A;  2LAS A;  2N9L A;  3VUY A;  4HJK A;  2DNF A;  4B95 A;  3ECI A;  3N32 A;  1P1A A;  1N60 A;  1QOB A;  3QIJ A;  1PFD A;  3Q14 C;  1N61 A;  3V3X A;  1CZP A;  1DOI A;  2R61 A;  5TSS A;  3ZGZ A;  5DPR A;  4IOI E;  1I4X A;  4MGK E;  3QAR A;  2B76 B;  3JSV B;  3ABV B;  3AU5 A;  1FRR A;  1C4C A;  2D3A A;  2CHX A;  1AN8 A;  3MFG A;  2WXK A;  2HTM E;  3BVG A;  1FRD A;  3TEZ A;  3URY A;  5JH5 C;  3FC4 A;  3UIO B;  2IND C;  3L10 B;  4KZC A;  2ZPY A;  1UH6 A;  3WAO A;  5JXV A;  2W82 A;  3UIN B;  4ANX A;  1L6U A;  4IKG A;  1WR1 A;  2I2Y A;  1WJU A;  2QIE B;  2C60 A;  1VR9 A;  2K5P A;  1YQB A;  1XQQ A;  1NI2 A;  1MHH E;  1XLP A;  3PT2 B;  4J3O D;  3QQ8 B;  3MC0 B;  4PS8 A;  4WAF A;  3NZU A;  1JWS D;  1BML C;  3CSF A;  4DHZ B;  3NHE B;  3O65 B;  3U8Z A;  4HWI B;  2V3P A;  4I6P A;  2C9W B;  3Q3O C;  4LDT B;  1YQ4 B;  4NAW B;  1RYJ A;  4GXB A;  3NRZ A;  4YXD B;  1ZE3 D;  5T8I A;  3NZS A;  4M8M A;  5I4D A;  1UF0 A;  1T6B X;  4IM0 A;  3FIL B;  2EEL A;  1R4M B;  4DHZ E;  1E7V A;  2ZNV C;  3H7P A;  1JCK B;  1FPY A;  2GBK A;  5HKH A;  2FCS A;  2MBH A;  3RNG C;  2D3C A;  1HZ5 A;  5D3I B;  1CK1 A;  1V80 A;  4GOC A;  3TEX A;  1L0X B;  2AWT A;  2ASQ A;  4C4V B;  1YJ1 A;  3Q8C A;  1UBI A;  5AUI A;  3U7D A;  2KWU B;  2BB6 A;  1MJD A;  2ON8 A;  3L17 A;  3PSE B;  1K51 A;  1V1P A;  4O1N A;  3RI7 C;  4MJS B;  4K3C A;  3N9Y C;  2W3R A;  1VRA B;  2QMT A;  4JGH B;  1UWM A;  4E74 A;  4E71 A;  1WMH B;  1TT5 B;  2GBN A;  2KLG A;  4LNO A;  1R4N B;  4LJO B;  2N9P C;  3IHP C;  2MBQ A;  3MC8 A;  3R3M A;  2RSU A;  1D5M C;  2BPS A;  2PEA A;  4TMA B;  3Q2A C;  1ZP0 B;  3U4E G;  2QSD A;  5HHD G;  3HK0 A;  5IP4 D;  4BOS C;  3Q6B A;  2MBE A;  4ZDV A;  2D2Q A;  4TSS A;  2NS5 A;  3BVZ A;  1OGW A;  2ICI A;  3SDL C;  3OG5 A;  1GPX A;  1ZUD 2;  3UQA A;  4HRO A;  1A70 A;  4A90 A;  1S1Q B;  2K8H A;  1JRP A;  3C19 A;  1WX8 A;  4NAW A;  1GC7 A;  2DZM A;  2KX0 A;  1ZGU B;  2CHW A;  1HTQ A;  2IO2 B;  2D5G A;  4W9F A;  1WM3 A;  2LZ6 A;  1I4H A;  5L95 C;  2L1A A;  3H6N A;  3M3J A;  4JPS A;  5EE1 A;  4G50 A;  2LJI A;  2J42 A;  5FR6 A;  2MP2 A;  4RM9 A;  2KFK A;  4L2Y A;  2FCQ A;  1E6E B;  2INC C;  1TS4 A;  4BBN C;  4R3D A;  1NYQ A;  3DWG C;  3I57 A;  1FXI A;  2WXF A;  2GBR A;  3K9P B;  2WGS A;  1IGD A;  1PDX A;  3WAL A;  3APC A;  5BO4 B;  2HDE A;  2KWV B;  4ZHO A;  1L2N A;  4WWM A;  1FFU A;  4ZRQ A;  1XO3 A;  2NPT A;  4YSX B;  5AZG A;  4LNK A;  1E5W A;  2M56 B;  2ZCB A;  4GMV A;  2KO3 A;  2N4F A;  2JUO A;  4XE0 A;  4C7Y A;  2WLB A;  1NVI D;  5DPW A;  3VHT C;  3DWM A;  2L0F A;  3ZRF A;  3NVW A;  4KSK C;  2BBC A;  1WI0 A;  3BK2 A;  3V05 A;  4C56 C;  1C4P A;  1T0S C;  2FIF A;  2O6V D;  1WGY A;  3ZIM A;  4EUT A;  2C5L C;  1RLF A;  1WYG A;  4HEA 1;  1N5W A;  1RRB A;  4M00 A;  2UWQ A;  1WF9 A;  2VZK B;  4GDK A;  1I4G A;  1SIJ A;  4IWO A;  2UU7 A;  4M8N A;  2OHF A;  4YTN B;  3T3O A;  4LTU A;  5G55 A;  2INP E;  2LWP A;  1T3Q A;  5H92 C;  3ZNG C;  5BMH A;  2CJN A;  3OJ4 B;  3EUB 2;  1OQY A;  4AJW A;  2BQQ A;  2L05 A;  2JY6 A;  3AEG B;  2NR2 A;  4LNI A;  1UGJ A;  2XEW A;  4EE2 A;  1IPG A;  2O2V B;  3HM3 A;  2NTT A;  5BMG A;  4RMA A;  4MGI E;  2FAZ A;  3A9K B;  1KFY B;  4WAA A;  2WHI A;  4XX5 A;  4P7I A;  2KTR A;  4J6I A;  2W9N A;  4NJ6 A;  2L83 A;  2XK5 B;  3ZKJ C;  3N1X C;  1WZ3 A;  2D10 A;  4NPN A;  1VCB A;  3CF6 E;  2BKR B;  1EWY C;  2OJW A;  2TSS A;  3MHS D;  3EA6 A;  3PRP B;  2LVO A;  3R66 C;  3ZDT A;  1YIW A;  4HCP B;  3SFD B;  2WU5 B;  3NS8 A;  3PHX B;  5EDS A;  2KDI A;  2AQ3 B;  1OFF A;  1R7S A;  4HVB A;  1JW9 D;  3AE4 B;  3BVM A;  4N6E B;  3QA8 A;  1V49 A;  1I7H A;  1PUT A;  1KJT A;  3PS6 A;  4AOF A;  4LDT D;  3U7Z A;  2KDB A;  4EFO A;  3JVZ X;  5CHF A;  2VH2 A;  1E10 A;  2ZJD A;  2WX0 A;  3PRE A;  2JYE A;  1IUE A;  1KOT A;  3PZD A;  4FA6 A;  2OOB B;  2C7M B;  2Z59 B;  1F77 A;  1GB4 A;  5FK9 C;  2Z0D B;  3HHM A;  4W9C A;  3HRD D;  1X1M A;  3Q8E A;  4HDO A;  4RGT A;  1N62 A;  4W9K A;  2IO3 B;  4ARI A;  1F0Z A;  2PVO D;  3TIX A;  3AE9 B;  1K50 A;  2Q5W D;  2BYE A;  1Y8R C;  3B2G A;  3BYY B;  1GG3 A;  3UQB A;  3DVN U;  5EE3 A;  2XN9 C;  2KT7 A;  1L4Z B;  1WRD B;  3RUI B;  3Q69 A;  3I5J C;  4PS3 A;  3VTW A;  2GBM A;  1OEY J;  5D94 A;  2BS4 B;  2NBW B;  4IW0 A;  3AUL A;  3QHT A;  4YTP B;  1EM7 A;  1GOZ A;  3OWE B;  2BGF A;  4K7S A;  2LI5 A;  2V3N A;  4AJY B;  2HJ1 A;  2LUE A;  4K7U A;  3P4S B;  1SBB B;  1SE3 A;  2W3S A;  2WU2 B;  5LLI A;  4DXG A;  1K53 A;  4NZL B;  5DPS A;  2LHE A;  3I9V 1;  3QJZ A;  1E9M A;  1IBX A;  4MH8 A;  3VAW A;  1CMX B;  2JU6 X;  1CQV A;  1ZXI A;  1V8C A;  2KC2 A;  2MLB A;  3ML8 A;  2JQR B;  4UDU C;  2KD0 A;  1SJH D;  3AM9 A;  2KFJ A;  1TY2 A;  3PGE A;  4HPM B;  1AAR A;  2JPH A;  3NS1 A;  4A3O A;  1E8Z A;  1EU3 A;  1UBQ A;  2RDH A;  1WSP A;  2KZR A;  2L8J A;  1XCT L;  4JE3 B;  4DDG D;  4WWO A;  1TKY A;  1N5X A;  1EF5 A;  1SJE D;  4WQM A;  2CR5 A;  1SIF A;  2C7H A;  3E56 A;  1TJE A;  3Q3J A;  3ZNZ B;  1TKE A;  3OLM D;  2KLC A;  4M0W A;  5KHQ A;  1WXM A;  1V5T A;  2IZV B;  3BYT B;  1MFW A;  3CWI A;  2D3G A;  2PTL A;  4WWN A;  1HEZ E;  2GI9 A;  1NEN B;  4WJN A;  1PQS A;  2IYD B;  1FNW A;  2LFI A;  2DYM A;  2OED A;  2AL6 A;  4MH0 E;  3H7P B;  1WY8 A;  1RM6 C;  1LM8 B;  4MEM A;  3ZTD A;  3K9O B;  3LDZ E;  2REX A;  2KMM A;  2M0A A;  1WGK A;  1F9J A;  2ZCC A;  3W5V B;  1I42 A;  2E3T A;  4DXA B;  4JL9 A;  1YN3 A;  3H7S A;  4A9A A;  5LXH A;  4KIK A;  2AEH A;  5G5H A;  5L83 A;  2N7J A;  1PYW D;  1KF6 B;  2VH1 A;  4RH6 A;  1FO4 A;  1TS2 A;  1WGR A;  2JZP A;  1YMH E;  3PVL A;  1V1P B;  4OZA A;  2K0P A;  3AMZ A;  1H8C A;  1V6E A;  3N20 C;  5C2T B;  3IAM 1;  2KDE B;  2KJH B;  3VH3 B;  3DVG X;  4HKQ A;  2KDF B;  3QWZ B;  3SU8 X;  2BB5 A;  4IM2 A;  3BY4 B;  5J18 A;  5EE9 A;  1VLB A;  3FAH A;  1HQR D;  3IAS 1;  4WIP A;  5LNK 1;  3VTV A;  2G9H D;  1D6E C;  1V9J A;  4JWS C;  3VVW B;  5HG2 A;  2LRW A;  2KHW B;  3EC8 A;  4IM3 A;  1K52 A;  1T5X D;  3A4S C;  2QHO A;  4RCO A;  3VDZ A;  2VZK D;  4Q2J A;  4FHJ A;  2G1E A;  2V0G A;  1DYQ A;  2K9X A;  4L1B A;  3Q8A A;  2INN E;  4HXD A;  4TQ0 A;  2MW5 A;  3EHV A;  4ICV A;  3E9S A;  1WE6 A;  4F7Z A;  2V9H A;  2DBY A;  2K6D B;  4PYU A;  2K1F A;  1NYR A;  4K1R B;  3EEC A;  1TIF A;  2WDQ B;  4KGR A;  1P7E A;  3JYU A;  1SB3 C;  4MGY E;  5C3J B;  2M8S A;  4LNN A;  5IA7 A;  2MA9 B;  1OTR B;  1KM7 A;  2ZEQ A;  3N1Y C;  3VUW A;  3N3K B;  1IP9 A;  1ZOY B;  1SE4 A;  2KK8 A;  2Y3A A;  4FHK A;  3IVF A;  1B1Z A;  2CU3 A;  4LK0 M;  1QT9 A;  3BII D;  4RF1 A;  2MP2 B;  1WJ4 A;  2KFK B;  2CS4 A;  1VD2 A;  3PHW B;  3GE3 C;  4II3 B;  1GC6 A;  3AE1 B;  1EO6 A;  2DZJ A;  4A8X C;  2LMC A;  2K3U A;  3P4R B;  4ZHP A;  1MHX A;  1JWM D;  2V4I B;  1FNV A;  2WXQ A;  2QJL A;  2L52 A;  4B0E A;  3B1L X;  4ZYN A;  5KHO A;  3AEC B;  3MTN B;  3DBR I;  3WA0 A;  3PZ8 A;  3WAN A;  4MGZ E;  3DBH I;  3PRM B;  1C3T A;  1P98 A;  2JX5 A;  2PE6 B;  3KYD D;  5CX3 A;  1JML A;  1YNT E;  2NPT B;  5LXI B;  1B9R A;  4NNJ B;  2GOW A;  5BYQ A;  3QK0 A;  3ENE A;  3DVG Y;  2V1Y A;  2IDY A;  2MSE D;  1JWA D;  4YWG G;  1GUA B;  3AH7 A;  4BKS A;  4EZK A;  3VXW A;  4PS7 A;  1UEL A;  3H9D A;  4HKZ E;  3W1Y A;  3AEA B;  4IUM B;  2R2Q A;  3NVV A;  3BWU D;  2W55 A;  3B08 A;  4OW0 A;  3GE8 C;  2YLM A;  3VR9 B;  2WYQ A;  3RNF C;  1V1O A;  3P4P B;  2CHZ A;  4GDK B;  3OJ3 A;  2L3Z A;  4A6Q A;  2YEP B;  3HM6 X;  1STE A;  3APF A;  2I1J A;  5C23 A;  2H88 B;  4HK2 A;  3TUO A;  4JIO U;  1E90 A;  4YT0 B;  4GU2 A;  3DOW A;  3RNA C;  3ONS A;  2BWF A;  4ZRK A;  1QOA A;  3BZD B;  4IDI A;  3P4Q B;  3X0W A;  2MCN B;  2M17 A;  3GS2 A;  1I35 A;  2LUM A;  1C9F A;  4PT5 A;  1XLQ A;  4REZ A;  4AS1 A;  1N63 A;  3VFK A;  1ACC A;  3VR8 B;  3WAP A;  2JZ3 B;  4FJY A;  2KTR B;  3J9C A;  3NJT A;  2MRP A;  1S3S G;  4KVG B;  4B6W A;  3GZN I;  4ANW A;  4W9E A;  4WJO A;  2J53 A;  2XBB C;  1SF0 A;  5JHB A;  1WWT A;  5BYS A;  1LXD A;  4AQ7 A;  2OJR A;  4M01 A;  2L00 B;  1F2R C;  1ZDV A;  2ZNV B;  1XD3 B;  2DAJ A;  2LVP A;  2KKC A;  3RPF C;  3PO0 A;  1WYW B;  4IC7 B;  4FXC A;  2MJE A;  1E7U A;  2D3B A;  4US8 A;  3CIR B;  1XEE A;  1PGB A;  2IO0 B;  4BKT A;  1Z5S B;  3D32 A;  4NAM A;  3V61 A;  2I1K A;  3DBL I;  4HLE A;  1LGR A;  1V5O A;  3Q3M C;  4E3C A;  3P42 A;  1GAQ B;  4ITK A;  1JQ4 A;  3L08 A;  2BYV E;  2YVC A;  4K81 A;  2HD5 B;  1XXG A;  2BVC A;  5CTR C;  5IAA C;  4FUL A;  3MJW A;  2X8X X;  1D5Z C;  2ZW0 A;  3TBL D;  3TSS A;  1EF1 A;  2MX2 A;  1L5P A;  2N9X A;  1WH3 A;  2MHJ A;  3W1S C;  3ZNH B;  4DHJ B;  2J4X A;  3SD5 A;  4KKI A;  2EMT A;  4DBG A;  1I4R A;  2BYT A;  1LFD A;  1J0G A;  5J2R A;  3VUX A;  1GNU A;  1C4A A;  1WZ0 A;  2LEK A;  4X57 B;  2A5U A;  5BMI A;  3TEY A;  3TMP B;  1ZPS A;  3R2I A;  2IBI B;  3EGR A;  2KDM A;  2KOX A;  1Q10 A;  1BT0 A;  2JVC A;  2N1V A;  1WFY A;  4I6N B;  2DHZ A;  1Z2M A;  5DCN A;  2L7R A;  2FID A;  4BKS D;  2Y5P A;  5HI1 A;  2SAK A;  1OQR A;  2GBJ A;  1MPE A;  1KTK A;  2BS2 B;  3ETR A;  3P1M A;  2KQ7 A;  4HCN B;  1IBX B;  4NJC A;  5E6O A;  2JRI B;  1HA5 A;  4JWU C;  4YTM B;  3U2S C;  3IG3 A;  3ZVV A;  3H1U A;  1YD8 U;  1QZE A;  1A5R A;  2LVQ A;  1AYF A;  3SR6 A;  3QCA A;  3FKY A;  1C78 A;  3V6E B;  1WXS A;  3RNB C;  2WXL A;  2BT6 A;  2NCN A;  1UGM A;  2EMS A;  2M4N A;  2AX5 A;  3AE6 B;  2AQ2 B;  3W9C B;  1E0Z A;  5AZF A;  3WAM A;  4JQW C;  3L13 A;  4MEL A;  4K3B A;  1JRO A;  2RPV A;  1L0Y B;  2M1M A;  2WXP A;  3LXF A;  4ANU A;  5IO9 A;  2LGX A;  1WE7 A;  4US9 A;  2ZW1 A;  4M0W B;  1E8X A;  3RZW C;  1VZ6 A;  3ZRC A;  1Q5W B;  3SFE B;  3NG0 A;  2K8B A;  2PMV A;  2AYO B;  4NQL B;  3L54 A;  4FBJ B;  2N7D A;  2PW9 A;  4ZRJ A;  3PRZ A;  2DWQ A;  1H4R A;  3I3T B;  2WXR A;  1ET9 A;  1D3Z A;  2BYF A;  4F1S A;  2VRR B;  4W9L A;  3GP7 A;  1JRU A;  2JXT A;  4KIK B;  2NTS A;  1EWC A;  4KSL C;  3V6C B;  4EZL A;  3VQI A;  5HFY A;  2RDB C;  2WXJ A;  3DQV A;  3LB8 C;  4RFB A;  3VTU A;  1M94 A;  2WDT B;  1BUI C;  2DZK A;  2KWC A;  5GXG B;  4WQO B;  1KLU D;  3MP9 A;  1WR6 E;  1F1H A;  4MDK E;  1SE2 A;  4GDL A;  3Q3N C;  3ZNI D;  1TZO A;  1Q1O A;  4CHK A;  4XC2 A;  2HJ8 A;  3Q8F A;  2HE7 A;  2Z8L A;  2KXJ A;  2IGD A;  2QEJ C;  1YJI A;  1RWS A;  3RT3 B;  2IGG A;  1L0V B;  1HZ6 A;  1QKZ A;  1SEB D;  4XZ4 A;  3BK1 A;  3O13 A;  1WGG A;  3R8B A;  5E6J A;  2KJR A;  1D5X C;  2BF8 B;  1AWD A;  1SE9 A;  3ZTC A;  3KH0 A;  5J17 A;  2V4L A;  4DQO C;  1MI0 A;  2C7N B;  2MWS B;  2I38 A;  4A20 A;  3NVY A;  1ISN A;  2N9E B;  2MBO A;  4LLG M;  2GMI C;  4JX1 C;  5D2M B;  2J0J A;  5H8Y E;  2JF5 A;  3V62 A;  1ROE A;  2PPH A;  1P7F A;  1WJ6 A;  1BXT A;  2QIL A;  3R2T A;  3ZO5 B;  2M19 A;  3RNE C;  3QX1 A;  1J7C A;  1QIL A;  2BW2 A;  1NEK B;  3PLV A;  1T0Q C;  4HRS A;  4P16 A;  2KMA A;  3ZQ4 A;  1TY0 A;  2K22 A;  2V3S A;  1EU4 A;  2J0M A;  2RPQ A;  3R7R A;  2JZZ A;  4A3P A;  4RGM A;  4F8C B;  1NDD A;  2FCM A;  1QLB B;  2NBU A;  4A55 A;  4WUR A;  1VZ8 A;  2L32 A;  4BAX A;  1NBF C;  3A33 B;  3CMM B;  4MM3 A;  1FFV A;  3PZ7 A;  4FJZ A;  2RDG A;  1SGH A;  1ZKH A;  3TJP A;  2R2O A;  2MJ3 A;  4W9G A;  2MJD A;  4ARC A;  5GMV A;  1FMA D;  1FIQ A;  3ZUN A;  5C1Z A;  2L0T A;  1K8R B;  2CJO A;  3L4P A;  2N1W A;  3X23 A;  1FXT B;  2WX1 A;  1RFK A;  3T8M A;  1SSN A;  1WXV A;  3AE3 B;  3LJ3 A;  5IN7 A;  3W1S A;  2JSV X;  3T9L A;  3ZLZ A;  2KQ4 X;  4LCD E;  1C77 A;  5G5G A;  2ZPN A;  1FEH A;  2LGD A;  1RFA A;  2J7Q B;  4N59 A;  3NZ3 A;  1CJE A;  3AI5 A;  3DHG C;  3RZF A;  2L76 A;  3IT6 B;  4ACF A;  1P0R A;  2DYO A;  1UZX B;  1RAX A;  2CU1 A;  1JAL A;  2Z0E B;  2LD9 A;  1HE8 A;  2DLB A;  2LXA A;  3V60 A;  1I4Q A;  2K39 A;  2K25 A;  1WRI A;  4DHJ D;  5IKC M;  3AEE B;  4KX6 B;  5EE0 A;  5E6N A;  2RGF A;  4KDI C;  4TV3 A;  1L4D B;  3A1Q A;  1J7A A;  3RCZ A;  4I6L B;  2FE8 A;  4PK1 A;  1TBE A;  2IGH A;  4P6V F;  2ZVO A;  2WXG A;  5G2N A;  2MBB B;  3IT4 B;  2KVZ A;  3QAQ A;  4WJP A;  4YSY B;  1FNU A;  1U4A A;  1FCL A;  4GSW A;  3L0W B;  1IYF A;  3L16 A;  4BKG A;  4B9K A;  4ANV A;  1TKG A;  2PIA A;  1L7Y A;  2DAF A;  1V97 A;  1YJJ A;  5D6J B;  1FCC C;  3IXS A;  2GRI A;  3Q3F A;  4NY0 A;  3SEB A;  1WX9 A;  1SXT A;  2BS3 B;  4FN2 A;  4OZB A;  3NUH B;  1WJN A;  3HVD A;  4H2A A;  3PTF C;  3KQ4 A;  1C1Y B;  1PGX A;  1TS3 A;  3A9J A;  3A4R A;  4MT5 A;  4NQK E;  4DXF A;  3HIZ A;  3BIN A;  4MSM B;  4C7Z A;  4KV2 A;  4KGS A;  1WXQ A;  3WCQ A;  4YL8 A;  4G0N B;  1N6Z A;  1V2Y A;  2QCZ A;  2DX5 B;  1WIA A;  2ZVN A;  4S0R A;  3RUL A;  4EZJ A;  2KX3 A;  3PV1 A;  2KMC A;  3RNC C;  1LO5 D;  2LXC A;  3IFW B;  1F52 A;  3HVZ A;  2O6V A;  4W9J A;  3KW5 B;  4EEW A;  1JWB D;  2WDV B;  3P2B A;  2EKE C;  1WGD A;  3HUI A;  1TYG B;  2JWU A;  2WDR B;  4L23 A;  4DK5 A;  2GB1 A;  1ENF A;  3ZYY X;  2J0K A;  1YQ3 B;  4XWT A;  4XDD A;  2WNM A;  3AE7 B;  2GLS A;  1VZ7 A;  1V86 A;  2N7E A;  2LGY A;  1V81 A;  4OVZ A;  3JSV A;  2M0X A;  4PYZ A;  5AZH A;  1EUV B;  2G45 B;  1E8W A;  3ZJT A;  1ZXH A;  4RM8 A;  3KVF B;  2FBW B;  1XT9 B;  4RNA A;  3KUC B;  4XYC A;  3GB1 A;  3OAW A;  5FR3 A;  1ET6 A;  2B3A A;  4KGT A;  1ESF A;  2MH7 A;  4OZC A;  2A4Z A;  4HJG E;  1F2R I;  3TEW A;  1UWX A;  1I4P A;  4W9H A;  4GGQ A;  5E6P A;  3DPD A;  3M63 B;  3ZXR A;  1FXA A;  3MJ5 A;  1E7P B;  2KTF A;  1D4B A;  1UUP A;  3ZXV A;  1FD6 A;  4WJQ A;  3DHI C;  4C80 A;  1GJZ A;  5D3D A;  2EKI A;  5TR5 A;  4ZYS A;  4KKJ A;  3DHH C;  4QAY A;  2SEB D;  2MEK A;  5CHV C;  1KRH A;  2DEN B;  4XGA B;  5IOI A;  4FLH A;  4AUQ C;  1VJK A;  2LHD A;  4BFR A;  2JT4 B;  4XDC A;  1YX6 B;  3T3N A;  4CYE A;  2YEP F;  3NY5 A;  3FIL A;  1QQR A;  2UYZ B;  3Q8B A;  1TTN A;  2G3Q B;  3LYY A;  4M02 A;  1IGC A;  1J19 A;  1M4V A;  2K6Q A;  1MG8 A;  3AXC A;  3ZJV A;  4HDQ A;  3NVZ A;  4AWJ A;  1NI3 A;  3AU4 A;  2QC8 A;  4RF0 A;  4RGO S;  4C4V A;  1TS5 A;  1XCQ L;  1XF5 L;  4KDL B;  4G11 A;  2W54 A;  3I63 C;  4WWP A;  4TKN A;  1KLG D;  3KYC D;  2H89 B;  5CHW A;  2KC1 A;  2IY0 B;  3ALB A;  3RN9 C;  4MJS A;  2WWZ A;  2QDF A;  2LGI A;  2PVG C;  5MPO A;  2FCN A;  3KWV A; 
#chains in the Genus database with same CATH homology
 3VQI A;  1WMH A;  4MJS B;  1WGR A;  5JHA A;  3DQV A;  5D7G A;  4JGH B;  3PVL A;  4W9D A;  3VTU A;  1M94 A;  2WDT B;  2DZK A;  4E74 A;  4E71 A;  2KWC A;  1H8C A;  1WMH B;  1V6E A;  4WQO B;  2GBN A;  2KLG A;  1WR6 E;  4LJO B;  4W9I A;  2KDE B;  4DDI D;  2N9P C;  3IHP C;  4MDK E;  4GDL A;  2KJH B;  2MBQ A;  3VH3 B;  3DVG X;  4N9F 4;  2KDF B;  3QWZ B;  3R3M A;  3ZNI D;  3SU8 X;  2RSU A;  4IM2 A;  1WM2 A;  2BPS A;  2DYB A;  2PEA A;  3BY4 B;  5J18 A;  1Q1O A;  3HK0 A;  3M95 A;  4GDL B;  4BOS C;  4CHK A;  4XC2 A;  4BOZ B;  2HJ8 A;  2MBE A;  2CKH B;  2DZI A;  2HE7 A;  3VTV A;  2KXJ A;  4ZDV A;  2JXX A;  2D2Q A;  1V9J A;  3RT3 B;  3VVW B;  1Q0W B;  2K8C A;  2LRW A;  2KHW B;  2NS5 A;  3EC8 A;  4IM3 A;  1OGW A;  3JW0 X;  3A4S C;  2QHO A;  3SDL C;  2HTH A;  4XZ4 A;  3VDZ A;  4ASW C;  1WGG A;  4FHJ A;  2KJR A;  2BF8 B;  1SE9 A;  4HPL B;  3ZTC A;  3KH0 A;  1ZW7 A;  5J17 A;  1OEY A;  2V4L A;  3UQA A;  2C7N B;  2MWS B;  2NBV B;  4A20 A;  1S1Q B;  4HXD A;  4TQ0 A;  1ISN A;  2MW5 A;  3EHV A;  4ICV A;  2RD0 A;  2D07 B;  2K8H A;  2N9E B;  1WE6 A;  2KN5 A;  2MBO A;  3KUZ A;  3R7Q A;  4F7Z A;  1WX8 A;  3GOE A;  4NAW A;  2GMI C;  2BWE S;  5D2M B;  1GC7 A;  2DZM A;  2K6D B;  4TUU A;  4PYU A;  2K1F A;  2KX0 A;  2J0J A;  1ZGU B;  2LRU A;  1P9D U;  2JF5 A;  3VH4 B;  2CHW A;  4K1R B;  3V62 A;  3EEC A;  2PPH A;  2IO2 B;  1WJ6 A;  3APD A;  4W9F A;  1WM3 A;  2LZ6 A;  2BKF A;  2D11 A;  3ZO5 B;  3JYU A;  4MGY E;  5L95 C;  4IG7 B;  4KZ0 A;  3H6N A;  3QX1 A;  3M3J A;  3KUD B;  2M8S A;  4G50 A;  3SHQ A;  5IA7 A;  2MA9 B;  1OTR B;  1KM7 A;  2ZEQ A;  3VUW A;  2ZZP B;  3PLV A;  3N3K B;  5FR6 A;  2KMA A;  1IP9 A;  2MP2 A;  4RM9 A;  2KK8 A;  2KFK A;  5AEK B;  2FCQ A;  4FHK A;  3IVF A;  4BBN C;  4URK A;  2V3S A;  3M62 B;  2J0M A;  3S2A A;  2RPQ A;  3R7R A;  2JZZ A;  4K7W A;  4A3P A;  3TCA A;  2GBR A;  2MP2 B;  1NDD A;  1TGZ B;  1WJ4 A;  2KFK B;  4F8C B;  2CS4 A;  2FCM A;  2NBU A;  1VD2 A;  3PHW B;  4A3O A;  4IWP A;  3K9P B;  1NBF C;  2JRH A;  3A33 B;  4BVU C;  3CMM B;  4II3 B;  3WAL A;  1GC6 A;  1EO6 A;  2DZJ A;  3APC A;  5BO4 B;  4MM3 A;  4G3X B;  4FJZ A;  2KWV B;  1SGH A;  1ZKH A;  3TJP A;  1L2N A;  4EKU A;  2R2O A;  4W9G A;  3B1L X;  4ZYN A;  4EOY A;  5KHO A;  3MTN B;  2G4D B;  3DBR I;  5GMV A;  3WA0 A;  3DVN V;  3ZUN A;  5C1Z A;  2L0T A;  2NPT A;  1K8R B;  1G6J A;  3WAN A;  5AZG A;  2N1W A;  1E5W A;  2FUH B;  3X23 A;  2IO1 B;  4MGZ E;  3DBH I;  1FXT B;  2WX1 A;  2ZCB A;  2KO3 A;  3PRM B;  4GN1 A;  4GMV A;  1C3T A;  1P98 A;  2N4F A;  3U30 A;  4OVU A;  2PE6 B;  3KYD D;  2JUO A;  5CX3 A;  2NPT B;  3T8M A;  4IWQ A;  2Y5B B;  1WXV A;  5LXI B;  3LJ3 A;  4BBN F;  3VHT C;  5DPW A;  4NNJ B;  2L0F A;  1LQB A;  3W1S A;  2GOW A;  3ZRF A;  4KSK C;  3QK0 A;  3T9L A;  3ZLZ A;  3ENE A;  4LCD E;  2G4S A;  3DVG Y;  1WI0 A;  2V1Y A;  2KJ6 A;  2KNB A;  2ZPN A;  2LGD A;  4AP4 C;  1RFA A;  2MSE D;  2J7Q B;  1GUA B;  3UIP B;  4BKS A;  2FIF A;  4EZK A;  3VXW A;  4PS7 A;  2O6V D;  1UEL A;  2RR9 A;  1WGY A;  3H9D A;  3ML9 A;  3AI5 A;  2AL3 A;  2JWZ A;  3RZF A;  3ZIM A;  2L76 A;  3W1Y A;  4EUT A;  3ZDM C;  1WGH A;  1RLF A;  2C5L C;  2PJH A;  4IUM B;  2R2Q A;  2DYO A;  3WIM A;  2LJ5 A;  1UZX B;  1RAX A;  1RRB A;  1WXA A;  2CU1 A;  4JLC A;  2UWQ A;  1WF9 A;  2Z0E B;  2LD9 A;  3B08 A;  1HE8 A;  4GDK A;  2YLM A;  2WYQ A;  3RD2 A;  4ZRI A;  2LXA A;  3V60 A;  2K39 A;  4IWO A;  2K25 A;  1R4M I;  4M8N A;  3UF8 A;  4DHJ D;  2CHZ A;  4GDK B;  4TQ1 A;  4FAD A;  5G55 A;  3OJ3 A;  5E6N A;  2LWP A;  2RGF A;  4KDI C;  4TV3 A;  3A1Q A;  2L3Z A;  2FNJ B;  3HM6 X;  3ZNG C;  3APF A;  2I1J A;  3OJ4 B;  4NJ7 A;  5C23 A;  3RCZ A;  1J8C A;  1OQY A;  4I6L B;  2IY1 B;  2O2V A;  4HK2 A;  4JIO U;  3A1Q B;  1E90 A;  1TBE A;  4AJW A;  2ZVO A;  4GU2 A;  3DOW A;  5G2N A;  2L05 A;  2MBB B;  2JY6 A;  4GB9 A;  2NR2 A;  3ONS A;  2BWF A;  2XEW A;  3A9K A;  3QAQ A;  4ZRK A;  3NOB A;  1IPG A;  4LJP B;  4WJP A;  2O2V B;  5JZE B;  1U4A A;  3RYT A;  3HM3 A;  3N30 A;  4GSW A;  3L0W B;  1IYF A;  1KLV A;  3L16 A;  4RMA A;  4BKG A;  3X0W A;  4B9K A;  2MCN B;  2M17 A;  4MGI E;  2FAZ A;  3A9K B;  4ANV A;  1I35 A;  1L7Y A;  2XK5 A;  2DAF A;  3CST A;  4ICU A;  5D6J B;  2KQS A;  4WAA A;  1YX5 B;  4XX5 A;  4P7I A;  2KTR A;  4J6I A;  2W9N A;  3Q3F A;  4NY0 A;  4NJ6 A;  1WX9 A;  3VFK A;  3C0R B;  2XK5 B;  3WAP A;  4FN2 A;  3ZKJ C;  1WZ3 A;  2D10 A;  2JZ3 B;  3B0A A;  4FJY A;  2KTR B;  4NPN A;  4DWF A;  1VCB A;  1WJN A;  3CF6 E;  3DDC B;  2BKR B;  4II2 B;  3IBE A;  2MRP A;  3QC8 B;  2PE9 A;  2KAN A;  1R4N I;  1S3S G;  3MHS D;  4KVG B;  3PRP B;  2LVO A;  3PTF C;  4B6W A;  1T0Y A;  3R66 C;  3ZDT A;  1C1Y B;  1YIW A;  3GZN I;  4HCP B;  4ANW A;  4GIV A;  4W9E A;  1UD7 A;  3NS8 A;  3A9J A;  4WJO A;  2XBB C;  1TZ1 A;  2KDI A;  3A4R A;  3PHX B;  5EDS A;  4NQK E;  4HVB A;  5JHB A;  5DPT A;  1LXD A;  3HIZ A;  3BIN A;  4MSM B;  3QA8 A;  1V49 A;  2OJR A;  2L00 B;  1KJT A;  4KV2 A;  3PS6 A;  3A9J B;  4AOF A;  3DCG A;  4LDT D;  2KDB A;  2ZNV B;  4FJV B;  4EFO A;  1XD3 B;  2DAJ A;  2LVP A;  2KKC A;  3JVZ X;  5CHF A;  4CO7 A;  1WYW B;  4YL8 A;  2ZJD A;  4IC7 B;  4G0N B;  1V2Y A;  3ZW3 A;  4EZJ A;  2DX5 B;  1E7U A;  1WIA A;  2ZVN A;  3PPA A;  2WX0 A;  3RUL A;  2KX3 A;  3PV1 A;  3PRE A;  2KMC A;  2NVU I;  2LXC A;  3IFW B;  1KOT A;  2IO0 B;  3PZD A;  4BKT A;  1Z5S B;  3DBS A;  3UGB B;  4FA6 A;  3TL5 A;  2O6V A;  4MSQ B;  4W9J A;  3D32 A;  2OOB B;  3PLU A;  2C7M B;  2Z59 B;  3V61 A;  2I1K A;  1WX7 A;  2KVR A;  4OVV A;  1P3Q U;  3KW5 B;  2Z0D B;  4EEW A;  3DBL I;  3HHM A;  4HLE A;  4W9C A;  1V5O A;  2MQJ A;  2EKE C;  3P2B A;  1WGD A;  1X1M A;  1E8Y A;  2O6V B;  3EFU A;  4HDO A;  2LAS A;  4E3C A;  3VUY A;  3L08 A;  2BYV E;  2YVC A;  4HJK A;  4W9K A;  2IO3 B;  4K81 A;  2HD5 B;  4DK5 A;  4B95 A;  5CTR C;  2J0K A;  4FUL A;  5IAA C;  3MJW A;  3ECI A;  3N32 A;  1P1A A;  3TIX A;  3TBL D;  1EF1 A;  2BYE A;  3QIJ A;  2MX2 A;  1Y8R C;  2N9X A;  1GG3 A;  1V86 A;  3UQB A;  2N7E A;  3DVN U;  2LGY A;  1V81 A;  1WH3 A;  4PYZ A;  3JSV A;  2M0X A;  3W1S C;  5AZH A;  5DPR A;  3ZNH B;  4DHJ B;  3SD5 A;  1EUV B;  1WRD B;  2G45 B;  2EMT A;  1E8W A;  4MGK E;  3RUI B;  3QAR A;  4DBG A;  4RM8 A;  3JSV B;  4DHZ B;  3KVF B;  1XT9 B;  3AU5 A;  3KUC B;  4PS3 A;  3VTW A;  2GBM A;  2CHX A;  3OAW A;  1LFD A;  1J0G A;  2B3A A;  5J2R A;  1OEY J;  5D94 A;  1GNU A;  3VUX A;  1WZ0 A;  4X57 B;  2A5U A;  2A4Z A;  2NBW B;  3TMP B;  4IW0 A;  3AUL A;  3QHT A;  4W9H A;  4GGQ A;  5E6P A;  5JH5 C;  3DPD A;  3UIO B;  2IBI B;  2BGF A;  4K7S A;  2KOX A;  2LI5 A;  1BT0 A;  3L10 B;  4KZC A;  2ZPY A;  2JVC A;  1UH6 A;  4AJY B;  3M63 B;  2LUE A;  4K7U A;  3WAO A;  2N1V A;  1WFY A;  4I6N B;  5LLI A;  2DHZ A;  1Z2M A;  2KTF A;  5DCN A;  2L7R A;  2FID A;  3UIN B;  4BKS D;  4ANX A;  5DPS A;  3QJZ A;  2GBJ A;  3VAW A;  1CMX B;  1WR1 A;  1WJU A;  4WJQ A;  2C60 A;  2KQ7 A;  1GJZ A;  2KC2 A;  2MLB A;  3ML8 A;  5TR5 A;  1YQB A;  1XQQ A;  4HCN B;  1NI2 A;  5E6O A;  2JRI B;  3IG3 A;  2KD0 A;  3PT2 B;  3ZVV A;  3H1U A;  1YD8 U;  1QZE A;  5CHV C;  3QQ8 B;  1A5R A;  2DEN B;  2LVQ A;  2KFJ A;  4PS8 A;  3PGE A;  1AAR A;  3NZU A;  2JPH A;  3QCA A;  3CSF A;  4FLH A;  3NHE B;  4HPM B;  1WXS A;  1E8Z A;  1UBQ A;  3O65 B;  3U8Z A;  4HWI B;  3V6E B;  4AUQ C;  2KZR A;  4I6P A;  2C9W B;  2L8J A;  4BFR A;  2JT4 B;  2NCN A;  4LDT B;  1UGM A;  4DDG D;  4WWO A;  4NAW B;  2EMS A;  2M4N A;  4GXB A;  1YX6 B;  1EF5 A;  2CR5 A;  4CYE A;  1SIF A;  5AZF A;  2C7H A;  3WAM A;  3NY5 A;  4JQW C;  3L13 A;  2UYZ B;  4MEL A;  3NZS A;  4M8M A;  3Q3J A;  1TTN A;  2G3Q B;  3ZNZ B;  2M1M A;  3OLM D;  2KLC A;  4ANU A;  1J19 A;  4IM0 A;  5KHQ A;  1WXM A;  2K6Q A;  1MG8 A;  1WE7 A;  2LGX A;  3AXC A;  4HDQ A;  4DHZ E;  1V5T A;  2IZV B;  1E7V A;  2ZNV C;  4WWN A;  2D3G A;  3H7P A;  4WJN A;  4M0W B;  1PQS A;  4AWJ A;  1E8X A;  3AU4 A;  2GBK A;  2IYD B;  3RZW C;  2FCS A;  2MBH A;  1Q5W B;  3ZRC A;  5HKH A;  2K8B A;  2DYM A;  2AYO B;  4NQL B;  2AL6 A;  4MH0 E;  1V80 A;  3H7P B;  3L54 A;  1WY8 A;  4FBJ B;  1LM8 B;  4GOC A;  4MEM A;  3ZTD A;  2N7D A;  3K9O B;  3LDZ E;  2REX A;  4ZRJ A;  2ZCC A;  3PRZ A;  2AWT A;  1F9J A;  4KDL B;  1I42 A;  4G11 A;  1H4R A;  2ASQ A;  3I3T B;  4DXA B;  1YJ1 A;  1UBI A;  4JL9 A;  3H7S A;  5LXH A;  1D3Z A;  4WWP A;  4KIK A;  4TKN A;  3KYC D;  2BYF A;  2AEH A;  5L83 A;  5CHW A;  3U7D A;  2KC1 A;  2IY0 B;  4F1S A;  2VRR B;  3ALB A;  2KWU B;  4W9L A;  4MJS A;  2WWZ A;  3L17 A;  1JRU A;  4KIK B;  3PSE B;  4KSL C;  2FCN A;  3V6C B;  4EZL A;  1P0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...