2FNJB

Crystal structure of a b30.2/spry domain-containing protein gustavus in complex with elongin b and elongin c
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/signaling protein
molecule keywords CG2944-PF, isoform F
publication title Structural and functional insights into the B30.2/SPRY domain
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 25
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2fnjB00
4WJPA 3ALBA 5CX3A 2C9WB 3ECIA 3VHTC 2CHZA 2HD5B 4BKGA 2NCNA 1RLFA 3RZWC 3JYUA 2JPHA 3JVZX 3IVFA 4FJZA 5IAAC 2ZVNA 3UF8A 3D32A 3IFWB 3WA0A 2KKCA 3MJWA 2KX3A 2CR5A 2MSED 4NAWB 2Y5BB 2LVPA 2YVCA 1V49A 1WGDA 1XD3B 5D7GA 3A9JB 4B6WA 2IO2B 2MBEA 3K9OB 1VCBA 2AL6A 3ZIMA 2D3GA 3LDZE 3ZLZA 4BKSA 1OEYA 5JH5C 3H1UA 1H8CA 2IZVB 4ZRKA 2WWZA 2LI5A 4IM2A 2Z59B 3KH0A 1Q1OA 2K6QA 1WIAA 3O65B 2M8SA 2BYEA 3WIMA 3DVGY 4MM3A 3RYTA 3OJ3A 4I6LB 1J19A 2JXXA 4DBGA 2BPSA 2G4DB 1TGZB 3SDLC 2L0TA 2D2QA 4KZ0A 4GOCA 4M8NA 2N9XA 3H7PA 3ENEA 4WJNA 2FCSA 1YX6B 2WYQA 4F8CB 3DQVA 3GOEA 1YIWA 2LXAA 3Q3FA 4MDKE 4MGIE 3S2AA 1WH3A 2K8BA 1CMXB 1UBIA 4HK2A 4PYUA 2UYZB 1EF1A 1HE8A 1LXDA 2KZRA 4W9LA 3ZO5B 1P1AA 4X57B 1L7YA 2MP2B 3HIZA 5D6JB 2JWZA 2CKHB 1L2NA 2CHXA 1R4NI 4NY0A 1MG8A 2ZPYA 2KDFB 3H7SA 3NOBA 4BBNC 2IO0B 3N30A 5BO4B 3W1SC 1WFYA 4M8MA 2OJRA 4GSWA 2KX0A 4GGQA 1Y8RC 3IBEA 3A4SC 1Z5SB 4JQWC 2JZ3B 4F7ZA 3RT3B 1P98A 3EECA 4MGYE 1WXMA 2J0JA 1WGYA 2REXA 2V3SA 5JHAA 1KOTA 2N7EA 3PRPB 2O2VB 2KQSA 4RMAA 1IP9A 3V62A 2DZJA 4ZRIA 1BT0A 2LASA 3R3MA 3VH3B 2ZZPB 1UGMA 1WZ3A 2LGYA 1M94A 2KTRB 2L05A 2ZCCA 1NI2A 3VUWA 2DYOA 3KW5B 2KFKA 1TTNA 1V9JA 4KV2A 4N9F4 3VFKA 1U4AA 3NZSA 4E71A 2D11A 4RM9A 1UD7A 1FXTB 2DYMA 1UZXB 2OOBB 3APDA 3IG3A 3HHMA 2KHWB 4FHKA 2FAZA 4GU2A 3U30A 1PQSA 1YJ1A 4GDKA 3PT2B 3VUYA 3QC8B 4JGHB 2NPTB 2K1FA 3UIPB 2BKFA 2KN5A 2GBRA 2L7RA 2FCQA 1S1QB 5G55A 1Z2MA 3A1QB 1E8ZA 3DPDA 2KJRA 4DXAB 3H9DA 3UGBB 2WDTB 3DBSA 1WR1A 4K7SA 2MBHA 3L10B 4GDLB 3DDCB 2LUEA 3R66C 3ZVVA 4BBNF 3ZNID 2O6VB 3QA8A 4W9IA 4NNJB 4ICUA 2CU1A 1AARA 4LDTB 3L54A 2FIDA 3VTVA 3CSTA 4BKTA 3ML9A 3DOWA 4DWFA 4E74A 4GXBA 2O6VD 1LQBA 1WJ6A 4ZRJA 2GOWA 4WJQA 2XK5B 4RM8A 1E7UA 5JHBA 2IY1B 2LRUA 2HJ8A 3DBLI 4DHZB 2ZEQA 1RAXA 5AZGA 1E5WA 2RD0A 3AULA 4F1SA 3DVNU 3L08A 4M0WB 2GBKA 2PPHA 4J6IA 4MH0E 3IHPC 2M4NA 2M17A 1I42A 4EKUA 4B95A 1P0RA 1JRUA 2KC1A 2JRHA 2NBVB 1EF5A 3ML8A 4FJYA 3ZTDA 2JUOA 1WZ0A 2GMIC 4JL9A 2NBUA 4G11A 3V61A 1V5OA 4CYEA 4G3XB 2L76A 2I1JA 2JF5A 4IWPA 1V6EA 4W9CA 3ZNHB 2BYFA 2FNJB 4PYZA 3PV1A 5AZHA 3EHVA 4KIKA 2DX5B 4DHJB 1YX5B 4IWQA 5TR5A 3UQAA 2BGFA 3R7RA 3C0RB 4MJSB 3AU4A 3QK0A 4TQ1A 4A3OA 3APCA 5J17A 4WWPA 1J0GA 5L83A 4LJOB 4MELA 3ZW3A 2FUHB 4DHJD 1V5TA 1H4RA 1WJ4A 3B1LX 1WM2A 2DAJA 1WJNA 2NS5A 5G2NA 1SGHA 3ZUNA 1EUVB 2C60A 1IPGA 3K9PB 4TUUA 4MGKE 2UWQA 2BKRB 2DZKA 2AEHA 3JW0X 4HDOA 4HXDA 3VAWA 2MW5A 5E6PA 1G6JA 3JSVB 3KVFB 1WX9A 5J2RA 2Z0EB 2VRRB 2KMCA 1EO6A 4NAWA 4W9JA 3CMMB 4JLCA 1QZEA 2M1MA 1WMHB 4KVGB 1E90A 2KD0A 3A9JA 4AP4C 2IO3B 5DPWA 1F9JA 2L3ZA 3ZDMC 5GMVA 2IYDB 3QAQA 1J8CA 3AU5A 1K8RB 2DYBA 4W9EA 1KJTA 1WGGA 2LZ6A 2D10A 3AXCA 2MA9B 3HK0A 4G0NB 4II3B 4FA6A 1WYWB 2ZNVC 3VQIA 2NVUI 2KLGA 3PREA 3BINA 3QARA 2K25A 4IW0A 4EZJA 4EZLA 2CHWA 2L0FA 1ISNA 4YL8A 1WXSA 2GBJA 3UQBA 3VUXA 5C1ZA 1D3ZA 1RFAA 4KSKC 3PS6A 3X0WA 3Q3JA 3H6NA 2B3AA 3AI5A 4FADA 5CHVC 2GBNA 4W9GA 2DZMA 1VD2A 3PTFC 3U8ZA 2IO1B 2K39A 2YLMA 4WJOA 5AZFA 4HJKA 4FHJA 2DZIA 1V86A 2FCNA 2MBBB 2NBWB 3PRMB 3ZDTA 4HLEA 2MCNB 4IM3A 5E6NA 2MP2A 3PHWB 3QJZA 1UELA 3L13A 2KDEB 2LVOA 3RUIB 4P7IA 3DBHI 4OVVA 2KDIA 2C7MB 3NZUA 4AUQC 2BYVE 3PPAA 1Q0WB 2KO3A 1WGHA 1YD8U 4W9KA 3VXWA 5AEKB 3KUDB 4OVUA 3B08A 2KWUB 3WAMA 4ANWA 2KC2A 3A9KB 1C3TA 2A5UA 1GNUA 2ZVOA 2NR2A 1LM8B 2O2VA 3PLVA 4IUMB 2J7QB 4URKA 2WX1A 4KDLB 4BOSC 3DVGX 3SU8X 1WXVA 2N9PC 2KTRA 2N7DA 4FLHA 3RULA 3VVWB 4EFOA 4ZYNA 3WAOA 5D2MB 2LGXA 1OQYA 4MSQB 2N1VA 2V1YA 3RZFA 4DDID 3NS8A 3VH4B 3RD2A 3TMPB 4IWOA 3M62B 2PEAA 1GUAB 1OTRB 4E3CA 4IC7B 2FCMA 2MBQA 4EUTA 2JRIB 2R2OA 3MHSD 2NPTA 4FBJB 3OJ4B 3TJPA 2K8CA 3L17A 3TL5A 4CO7A 1RRBA 2KOXA 4FJVB 2XBBC 3A1QA 4XC2A 1C1YB 4GB9A 1Q5WB 2G4SA 4WWNA 1NDDA 1WJUA 3WAPA 4FN2A 4GDLA 4TQ0A 1T0YA 2JY6A 3QCAA 2N9EB 5DPSA 3QHTA 3WALA 2O6VA 2HE7A 2KWCA 3V6EB 2QHOA 3OAWA 4K81A 2PJHA 2FIFA 2RR9A 3VTWA 2N4FA 1UH6A 1V81A 2N1WA 5D94A 5E6OA 4DK5A 2IY0B 4ASWC 2XK5A 4FULA 3PHXB 4LJPB 1XQQA 2C5LC 3I3TB 2LWPA 1WE6A 3MTNB 3ZKJC 3ZRCA 5IA7A 2L8JA 2KJHB 4K7UA 3KUCB 4ANVA 1XT9B 2BWES 1WXAA 5DCNA 4BKSD 1I35A 1WX7A 2C7NB 2KLCA 2AL3A 4DHZE 3T8MA 2AYOB 4XX5A 4NJ7A 2ZJDA 3M95A 1V2YA 3H7PB 4MSMB 2KVRA 3BY4B 3UINB 3OLMD 3CSFA 1E8XA 1TBEA 4NQLB 2K6DB 3A33B 3V60A 4PS7A 2C7HA 4IG7B 3M63B 2BF8B 3DVNV 4I6NB 1V80A 4MJSA 2I1KA 3TIXA 2G3QB 4NQKE 4W9FA 1P3QU 3DCGA 2RGFA 1UBQA 1KM7A 2MLBA 3P2BA 4XZ4A 2MWSB 1E8WA 2ZNVB 3UIOB 2MQJA 1NBFC 4WQOB 3L0WB 2KFJA 3NY5A 4HCNB 2IBIB 2R2QA 4MEMA 2PE9A 3PGEA 4HPLB 2EMTA 2EKEC 3M3JA 4LCDE 5J18A 3JSVA 5DPTA 4AJYB 1WE7A 1X1MA 4NPNA 3ZNZB 5FR6A 1OGWA 2M0XA 1SIFA 1WMHA 2J0KA 2A4ZA 2W9NA 3VTUA 3ZRFA 1WY8A 3TBLD 4A20A 5KHQA 2Z0DB 5CHFA 2DAFA 2RSUA 4JIOU 5DPRA 3NHEB 1A5RA 2CS4A 2WX0A 1TZ1A 1ZGUB 3N32A 3QWZB 1ZKHA 3HM6X 3KUZA 4WAAA 1IYFA 3EC8A 5L95C 2KK8A 3CF6E 4I6PA 5CHWA 3SHQA 2D07B 1GJZA 4BOZB 1S3SG 4BVUC 3W1SA 3PLUA 2KFKB 4HPMB 2V4LA 2LJ5A 4GIVA 2PE6B 3V6CB 4W9HA 4KSLC 4AJWA 2RPQA 2DHZA 2LVQA 4CHKA 5EDSA 1ZW7A 2XEWA 1E8YA 2J0MA 3VDZA 2L00B 4GDKB 3LJ3A 5JZEB 4NJ6A 3W1YA 2MRPA 3WANA 4G50A 4PS3A 4EZKA 3APFA 3A4RA 4GN1A 2K8HA 2KXJA 1E7VA 2LD9A 3GZNI 3KYDD 4A3PA 1KLVA 4TKNA 4W9DA 3ZTCA 4IM0A 5HKHA 3QX1A 3PSEB 1GC7A 4EOYA 3TCAA 1WI0A 4B9KA 4HVBA 1GC6A 2JVCA 2KWVB 2G45B 2KDBA 3N3KB 4HCPB 3HM3A 4MGZE 1P9DU 2AWTA 4WWOA 2LXCA 3X23A 5LXHA 1WM3A 3L16A 3U7DA 2KANA 3T9LA 2KJ6A 3DBRI 1OEYJ 4II2B 4K7WA 5LLIA 5LXIB 4DDGD 4K1RB 1YQBA 3QQ8B 4GMVA 3PZDA 3KYCD 2KQ7A 2HTHA 4EEWA 2DENB 2EMSA 3A9KA 4PS8A 4ANXA 3SD5A 4BFRA 4ICVA 3B0AA 1SE9A 4HWIB 2KNBA 4AOFA 2KTFA 3PVLA 1R4MI 1WX8A 3ZNGC 1WR6E 3PRZA 5C23A 2JZZA 1WF9A 2LRWA 4AWJA 3QIJA 4KDIC 1GG3A 2BWFA 1WRDB 3EFUA 3RCZA 4KZCA 4ZDVA 4TV3A 2LGDA 1WGRA 2ASQA 3ONSA 2JT4B 2MBOA 4HDQA 5KHOA 4ANUA 2ZCBA 5CTRC 1LFDA 2ZPNA 2KMAA 4LDTD 4KIKB 3R7QA 2MX2A 2GBMA
chains in the Genus database with same CATH superfamily
2NTSA 1SXTA 4BKGA 1TZOA 2DBYA 1OFFA 2QMTA 3AH7A 2IGHA 2N7JA 1C4PA 1CQVA 4NAWB 2YVCA 1V49A 4US9A 5D7GA 3B2FA 2K22A 4XDCA 2D3GA 3LDZE 5JH5C 2INCC 2WXNA 2K6QA 4MM3A 1YJIA 2W82A 4DBGA 2G4DB 2L0TA 4KZ0A 2AX5A 2WLBA 3RNBC 3NVVA 3S2AA 1TY0A 4BZAA 4KKJA 1CMXB 4MH8A 4HK2A 2UYZB 3I63C 1HE8A 3ZGZA 1P1AA 1F52A 2RDGA 2INPE 4RNAA 3HIZA 1JWAD 2BS2B 4L23A 2CKHB 1L2NA 1BXTA 2KDFB 3NOBA 4BBNC 3W1SC 1WFYA 4GGQA 2JZ3B 4F7ZA 3IXSA 3EECA 4MGYE 1WXMA 2J0JA 3BVZA 2REXA 2YEPF 4NAMA 3PRPB 4ITKA 3AEEB 3R3MA 1UGMA 1YMHE 5EE3A 3NZ3A 3SFDB 1TTNA 4KV2A 3VFKA 1UD7A 1FXTB 2OOBB 2KHWB 3P4SB 3U30A 3VUYA 1HZ5A 3PT2B 3UIPB 4WAFA 5G55A 1E8ZA 3U7ZA 2KJRA 3H9DA 3NG0A 4XE0A 3DDCB 2HTME 2JX5A 3ZVVA 1QOGA 4A55A 4WURA 3QA8A 4NNJB 4ICUA 4LDTB 1D5MC 1WJ6A 3AE6B 1SJHD 1YQ4B 3MC0B 2LRUA 3DBLI 5AZGA 2RD0A 3AULA 2PPHA 1FXIA 1RM6C 2D3BA 1UGJA 2IJ0A 1I42A 1PGXA 3N1YC 1XF5L 1EF5A 3ZTDA 2GRIA 3V61A 4W9CA 3ZNHB 1WYGA 1YN5A 5TR5A 3N1XC 3UQAA 3SR6A 1NYQA 3R7RA 2QEJC 2MJEA 1M4VA 2LJIA 4ZHOA 3QK0A 4GLSC 4LJOB 4XDDA 3AE2B 1FCLA 3B1LX 2SAKA 4OZBA 1SGHA 1EUVB 4HDOA 2DZKA 3JW0X 1PYWD 5E6JA 1WX9A 3B9JA 4W9JA 3CMMB 1E7PB 2M1MA 3A9JA 5DPWA 2IO3B 2L3ZA 3ZDMC 2VZKB 3ZJUA 1WGGA 2LZ6A 2D10A 2VZKD 4WIPA 1SSNA 4II3B 4YTNB 3R2IA 1V97A 2ZNVC 2KLGA 3BINA 2K25A 4EZJA 1TS5A 3W5VB 1ISNA 4YL8A 1IUEA 1FEHA 2EELA 5C1ZA 4KSKC 3RNGC 3PS6A 4C4VA 1D5XC 2B3AA 2G1EA 3GS2A 1VD2A 1FO4A 1BMLC 1VZ7A 2K39A 2I2YA 1V86A 3W5UB 2FCNA 2MBBB 1SE4A 4HLEA 4IM3A 2ZW0A 3RUIB 4P7IA 4M01A 4OVZA 3NZUA 3RNAC 3PPAA 3RN9C 1Q0WB 2KO3A 2QJLA 3B2GA 4W9KA 4PK1A 2KWUB 1V1PA 1EU4A 2KC2A 4ANWA 3A9KB 4D2KA 5IO9A 4URKA 5FKAC 3HRDD 5T8IA 1JCKB 2N9PC 2N7DA 3VVWB 5D2MB 4NZLB 3RZFA 3NS8A 1DYQA 3RD2A 3URYA 4EUTA 5BMIA 1TKYA 2JRIB 2W3RA 1TS3A 2KMMA 4XC2A 2RPVA 1Q5WB 2G4SA 1WJUA 3WAPA 4ZOHC 4TQ0A 3QCAA 2BVCA 3QHTA 3RI7C 2HE7A 3V6EB 2PJHA 5D94A 5E6OA 4FULA 4LJPB 1XQQA 1WE6A 3Q8FA 2L8JA 2KJHB 4K7UA 3KUCB 1XT9B 1ZE3D 2BWES 1DOYA 2JYTA 2C7NB 2KLCA 2AL3A 2LHEA 2AYOB 3M95A 3TEWA 1VDVA 3AE5B 2DNFA 3UINB 2AQ2B 1E8XA 1TBEA 3A33B 3V60A 2PVOD 2QDFA 1KLGD 2LMCA 4NQKE 4W9FA 3RNCC 1FNUA 4A8XC 3J9CA 1E8WA 2ZNVB 3I57A 3DWMA 2MQJA 1NBFC 4H2AA 3RPFC 3L0WB 1L0XB 2PE9A 1OQQA 3PGEA 5J18A 1SJED 4AJYB 1X1MA 5FR6A 2M0XA 1D4BA 1SIFA 3VTUA 4A20A 2KWDA 1CJEA 1A5RA 1TZ1A 1ZGUB 2WXQA 1ZKHA 3EC8A 3WCQA 5CHWA 2D07B 1S3SG 1MHXA 1YOVB 2PE6B 3V6CB 4W9HA 4AJWA 2ACZB 2KQ4X 2RPQA 3AV8A 4CHKA 2L00B 3PZ8A 3O13A 5I4DA 2MRPA 5EE0A 4PS3A 4L1BA 4EZKA 4GN1A 2AQ3B 2KXJA 1FRDA 1KLVA 1N63A 3MC8A 1ZUD2 4YTPB 4EOYA 4B9KA 1GC6A 1KRHA 2G45B 2KDBA 2Q5WD 1P9DU 5TSSA 2WXGA 1HEZE 1XO3A 3GE3C 4XWTA 3ZQ4A 2KYWA 2JQRB 4BAXA 4K7WA 4DDGD 1SE3A 3QQ8B 2L1AA 2XN9C 2KNBA 1JMLA 1SIJA 3ZNGC 1QKZA 1TJEA 2JZZA 1WF9A 2JWUA 4Q2JA 2WXMA 4KDIC 1GG3A 2BWFA 2LGDA 1WGRA 4IOIE 3R7QA 2GBMA 3TJPA 4C7ZA 2INNE 2J4XA 3AEFB 3VHTC 2CHZA 2HD5B 4YT0B 1A70A 2CJNA 5IAAC 3UF8A 3W2DA 1NYRA 3E9SA 1EWCA 1HTOA 3IFWB 2KKCA 2CR5A 3N9YC 2Y5BB 1WGDA 1XD3B 4ZYSA 2L83A 4XWWA 3A9JB 3K9OB 2AL6A 1H8CA 4ZRKA 4QAYA 2WWZA 2Z59B 2WP9B 3KH0A 1WIAA 3TSSA 2IDYA 4LNIA 2BPSA 1PUTA 5D3IB 3UI3A 3TUOA 1YX6B 4F8CB 3GOEA 1YIWA 2LXAA 3Q3FA 4MGIE 2K8BA 5BYQA 5IOIA 1HA5A 3ZO5B 4HRSA 1QLBB 1JRPA 1WWTA 1ENFA 1QT9A 3P4QB 2JWZA 1B9RA 1R4NI 1MG8A 3H7SA 3KWLA 2IO0B 4P6VF 2KX0A 3IBEA 3A4SC 1Z5SB 3RT3B 1N62A 1DOIA 2ZW1A 1V1PB 1T0QC 1WGYA 5JHAA 2D3CA 1D6EC 2KQSA 4RMAA 1EWYC 3V62A 4HEA1 4ZRIA 1BT0A 1SB3C 3VH3B 2ZZPB 3BYTB 2LGYA 4JWUC 2ZCCA 3NZSA 4E71A 2D11A 4RM9A 3Q8BA 1UZXB 4K3BA 1QOFA 4FHKA 2WDQB 2VH2A 1PQSA 1YJ1A 2BKFA 2GBRA 2H88B 3LYYA 4RGOS 2WDTB 3BZDB 4JPSA 3L10B 4P1BC 4BBNF 2FBWB 3MFGA 4HPPA 3ML9A 3GP7A 4DWFA 4E74A 4GXBA 1LQBA 3N1ZC 3IT6B 5JHBA 1MJDA 3MJ5A 1L4DB 2WDRB 4MH0E 3ML8A 3P4PB 3GZNB 2GMIC 2MJDA 4G11A 1N5XA 1V5OA 1ROEA 4PYZA 1MVKA 5AZHA 3EHVA 2QSDA 1JWBD 3CIRB 3ABVB 4KIKA 2DX5B 4A9AA 4DHJB 1JROA 3DBRB 3KWVA 3C0RB 3AU4A 4A3OA 3APCA 4M0WA 4WWPA 5L83A 3ZW3A 2FUHB 4DHJD 1H4RA 1WJ4A 1WM2A 1WJNA 1R4MB 4HXDA 5E6PA 1G6JA 3KVFB 3ETRA 2K0PA 2VRRB 3IAM1 2KMCA 1YJJA 3IAS1 1I4RA 1QQRA 2IYDB 1J8CA 3Q8CA 3AU5A 1I4QA 1UUPA 3KQ4A 3HK0A 2MA9B 4FA6A 4KKIA 1WYWB 2NVUI 3PREA 3P63A 1YQ3B 4B0EA 1STEA 2L0FA 4DXFA 1WXSA 2GBJA 1RFAA 3Q3JA 2YLMA 4FHJA 5EE9A 2DZIA 1FCCC 3GE8C 1K53A 2L52A 2PMVA 3PRMB 4JX1C 1UELA 2Y5CA 2LVOA 1HXYD 4OVVA 4AS1A 1PGBA 3DHGC 4CQNA 2KDIA 3HVDA 2JXTA 4AUQC 1E10A 1WGHA 1AN8A 5IP4D 3I5JC 3IT4B 1C76A 4KGRA 1K50A 1XLQA 4C00A 5JXVA 3FC4A 2WX1A 4KDLB 2KTRA 3RULA 4MSQB 1OQYA 2N1VA 2V1YA 3PO0A 1TIFA 3VR8B 2QC8A 1HTQA 5BMHA 2FCMA 4HROA 3MHSD 1ZDXA 2NPTA 3OG5A 1T3QA 3L17A 1L5PA 3NVYA 4FJVB 2XBBC 1C1YB 4GB9A 4WWNA 4GDLA 2JY6A 5DPSA 1ZOYB 2KWCA 2QHOA 3OAWA 4K81A 3C19A 2BB6A 2N4FA 2IY0B 2XK5A 1FFVA 3PHXB 3ZKJC 3MTNB 1JWMD 2MH7A 5EE1A 1VZ8A 1ACCA 4PT5A 3H8HA 1CK1A 1MG4A 1I4PA 2WXKA 3P42A 3OLMD 3TEYA 2K6DB 4PS7A 2BBCA 2D5GA 2BTEA 2LEKA 3DVNV 3VRBB 4MJSA 2G3QB 3Q3OC 2RGFA 1KM7A 2MLBA 2DWQA 1ZP0B 4WQOB 3NY5A 2IBIB 5BYRA 4HPLB 1WRIA 3M3JA 5DPTA 2J42A 3ZNZB 2J0KA 3BK1A 2W9NA 3TBLD 5KHQA 2DAFA 4JIOU 3NHEB 1FM0D 4OW0A 3QWZB 2OJWA 4YXDB 4WAAA 2WXOA 3CF6E 3SFEB 1GJZA 4BVUC 3BVMA 4GIVA 3ZYYX 4KSLC 4LLGM 4L2YA 3Q14C 3Q3MC 3VDZA 3LJ3A 2VH1A 3W1YA 1VRAB 2BS3B 2E3TA 4G50A 1TYGB 3A4RA 1BUIC 3GZNI 3KYDD 2WU5B 1J7CA 4W9DA 2XNAC 4IM0A 3ZTCA 5HKHA 1AYFA 1GC7A 2K5PA 5C3JB 1QF6A 3U52E 3TCAA 4HVBA 2KWVB 4HCPB 3X23A 1WM3A 3FILA 3L16A 1UWMA 3DBRI 1LGRA 3AN1A 2BT6A 2LGIA 3KYCD 2HTHA 4EEWA 5BMGA 1SE9A 3R2TA 4HWIB 2PIAA 1JWSD 3C8YA 3PVLA 1R4MI 1WX8A 3PRZA 2LRWA 3QIJA 2Z8LA 2GI9A 2CJOA 4C56C 2D3AA 4HDQA 2M56B 3DBHB 4ANUA 1TY2A 1ET9A 1LFDA 2KMAA 3LB8C 1FIQA 4KIKB 2MX2A 1QOBA 2JU6X 4WJPA 3PZ7A 5CX3A 3Q6BA 3ECIA 3BWUD 1KFYB 2NCNA 5AUIA 3RZWC 1UWXA 2GLSA 2JPHA 4MM3B 3IVFA 1Q10A 2EKIA 3D32A 5FK9C 3WA0A 2MSED 2BB5A 1L4ZB 2LVPA 4B6WA 4YSXB 1VCBA 3ZIMA 3ZLZA 4BKSA 1OEYA 4KGTA 2IZVB 3U2SC 2LI5A 2N9LA 2N9KA 1N6ZA 1GB4A 1SE2A 3E56A 3DVGY 3OJ3A 1C78A 2H89B 2LHDA 1J19A 2JXXA 1TGZB 2WXPA 4M8NA 3H7PA 3ENEA 4WJNA 2FCSA 2WYQA 3DQVA 4HKZE 5LNK1 4MDKE 1EM7A 1WH3A 1UBIA 1JQ4A 1TS2A 3HVZA 3MP9A 1L7YA 1MHHE 2CHXA 4NY0A 2ZPYA 4RFBA 1NVID 3N30A 3EA6A 3Q69A 2KT7A 2PVGC 3BVGA 2V3SA 1KOTA 2N7EA 2DZJA 3T3NA 2LASA 1M94A 2KTRB 2L05A 3U4EG 3VUWA 2DYOA 3KW5B 2KFKA 4N6EB 4N9F4 1C4AA 1WXQA 2DYMA 3HHMA 3IG3A 2FAZA 4GDKA 4JGHB 2NPTB 2K1FA 3BK2A 2L7RA 2FCQA 3LXFA 1FNVA 1Z2MA 3DPDA 4DXAB 1WR1A 4XYCA 4GDLB 2LUEA 3R66C 2CU1A 1AARA 3L54A 2FIDA 3VTVA 1CZPA 3DOWA 1E0ZA 1VLBA 2FUG1 4P1CC 2GOWA 2XK5B 4KX6B 2IY1B 2HJ8A 2ZEQA 1RAXA 4F1SA 4RH6A 3DVNU 3L08A 2GBKA 1FFUA 3IHPC 1XLNA 3NJTA 2M4NA 2M17A 4EKUA 1JRUA 2HJ1A 2JRHA 2KC1A 4FJYA 2NBUA 1DGJA 1HQRD 1QOAA 4CYEA 3HUIA 4G3XB 2JF5A 1V6EA 4US8A 3AE1B 1I7HA 4IWQA 4RGNA 1YNTE 2BGFA 4MJSB 2G9HD 4TQ1A 1J0GA 5J17A 4MELA 1V5TA 3RNFC 4A6QA 2NS5A 4RCOA 2C60A 3K9PB 1ZDVA 2HDEA 2UWQA 3VAWA 2MW5A 2R61A 5J2RA 2ICIA 1EO6A 3RMKC 1PGAA 3NUHB 1UNSA 4JLCA 1QZEA 4TMAB 4C4VB 1XCTL 2KD0A 2GB1A 4AP4C 2KVZA 3QAQA 3P1MA 2MHJA 2DYBA 4W9EA 3AXCA 4G0NB 1N60A 2PLPA 3V05A 1V1OA 3BIID 4IW0A 1AW7A 2CHWA 1D3ZA 3X0WA 5CHVC 2GBNA 4W9GA 2DZMA 1ET6A 3U8ZA 2TSSA 5AZFA 4HKQA 1ESFA 3ZDTA 2MP2A 3QJZA 3L13A 1GOZA 3Q8AA 3DBHI 3MHZA 3FILB 1ZXHA 2BQQA 2WU2B 4NJCA 1YD8U 3VXWA 1HZ6A 3KUDB 4OVUA 3WAMA 2WNMA 1C3TA 1LM8B 2O2VA 3PLVA 2WXFA 3Q8EA 2J7QB 1ZXIA 4BOSC 1F2RC 3BYYB 3SU8X 1WXVA 4ZRPA 4ZYNA 3WAOA 2LGXA 3VH4B 3V3XA 2PEAA 1GUAB 1OTRB 4E3CA 1WGKA 1Y56A 4IC7B 4A90A 1PDXA 2BYTA 2R2OA 4UDUC 4YSZB 2WHIA 3OJ4B 3TL5A 2K8CA 4CO7A 1EU3A 3A1QA 4YSYB 4FN2A 5IN7A 1T0YA 1NEKB 2N9EB 3WALA 2O6VA 1VR9A 2WXJA 2FIFA 2RR9A 3VTWA 2N1WA 4DK5A 4WWMA 4ASWC 2PW9A 2WXRA 1OQRA 4ANVA 4R3DA 2W54A 4BKSD 3T8MA 4XX5A 2KDMA 1V2YA 4O1NA 3H7PB 3BY4B 2WQYB 3ZXVA 3CSFA 1JW9D 4NQLB 4IG7B 3M63B 2BF8B 1XEEA 4I6NB 1P3QU 2MWSB 1K52A 2KFJA 4HCNB 2R2QA 2CU3A 2EKEC 1RWSA 3DWGC 3JSVA 4OHJA 4NPNA 1WMHA 2A4ZA 4ARCA 2Z0DB 5CHFA 2W55A 1GPXA 1T6BX 2M0AA 5G5HA 2CS4A 2WX0A 3N32A 1D5ZC 5L95C 2KK8A 1SBBB 5C2TB 3PLUA 2KFKB 4WQMA 2V4LA 2LJ5A 4JE3B 5GXGB 2DHZA 2LVQA 1TKEA 2L32A 1E8YA 2J0MA 1WSPA 4GDKB 2LGSA 3WANA 2LUMA 2LD9A 4A3PA 3FAHA 2X8XX 3PSEB 1WI0A 1VZ6A 3N3KB 1J7AA 3HM3A 2J52A 3T9LA 2KJ6A 1OEYJ 4JWSC 4II2B 1K51A 1UF0A 5LXIB 1YQBA 1RFKA 4GMVA 4ARIA 2DENB 4PS8A 4ANXA 3ZJTA 2RDHA 4AOFA 2QILA 4AWJA 1SEBD 1FD6A 2KN4A 3EFUA 4ZDVA 4ZHPA 2ASQA 2JT4B 2ZCBA 2DLBA 5HG2A 5CTRC 4LDTD 3ZJVA 3ALBA 3NRZA 4IKGA 5HHDG 2C9WB 1TT5B 4S0RA 3AB5A 3GB1A 2Y5PA 1KTKA 1RLFA 2MEKA 4N58A 2WS3B 1IGCA 1XXGA 3JYUA 3JVZX 4FJZA 2ZVNA 2WXHA 4ZRQA 3MJWA 2KX3A 3W9CB 2M19A 2Y3AA 2OEDA 1IBXA 2IO2B 2MBEA 1P7FA 4B0MA 1GAQB 3H1UA 3AE4B 4IM2A 4KGSA 1Q1OA 3O65B 2M8SA 5IKCM 2BYEA 3WIMA 4N59A 3RYTA 4I6LB 1F0ZA 1SF0A 3SDLC 1JALA 1TS4A 2D2QA 2PTLA 4GOCA 2N9XA 3Q3NC 1J7BA 1MI0A 2QIEB 3AEAB 4PYUA 1EF1A 1LXDA 2KZRA 1YN4A 4W9LA 2J53A 2INDC 4X57B 1KF6B 2MP2B 5D6JB 2RDBC 1KLUD 1XLPA 2IGDA 4M02A 3VR9B 1B1ZA 5BO4B 4M8MA 2OJRA 4GSWA 1Y8RC 3AEDB 4JQWC 1GB1A 1P98A 1I4HA 1FRRA 4LNFA 5HFYA 1C9FA 5MPOA 4WH4A 1LO5D 4LK0M 2O2VB 1KH0A 2RMMA 4RF0A 1WZ3A 1NI2A 3T3OA 1V9JA 4USAA 1U4AA 2KAJA 1RYJA 3FKYA 3AE9B 3APDA 3L4PA 4GU2A 3QC8B 5H92C 2KN5A 1S1QB 3A1QB 4YTMB 3UGBB 3DBSA 4K7SA 2MBHA 1T5XD 3ZNID 2O6VB 1FNWA 4W9IA 1MFWA 4YWGG 1R4NB 3CSTA 4BKTA 2O6VD 4ZRJA 2E6XA 4WJQA 4RM8A 1E7UA 3I9V1 4DHZB 1AWDA 1E5WA 4M0WB 1VJKA 4J6IA 1L0YB 1E6EB 4ACFA 4C7YA 4B95A 1P0RA 2NBVB 1F1HA 5HI1A 2JUOA 1WZ0A 1T0RC 4JL9A 3AE7B 4IWPA 2L76A 2I1JA 2BYFA 2FNJB 3PV1A 2WXLA 1I4XA 1YX5B 3ZXRA 2B76B 2X38A 1C77A 1R7SA 2YEPB 4IDIA 2DAJA 4HJGE 2V4IB 5G2NA 3ZUNA 1FPYA 1C79A 3AM9A 4C80A 1IPGA 4TUUA 2JYEA 4MGKE 2BKRB 2ONQA 2AEHA 3AECB 3AEBB 1N61A 3TEXA 3JSVB 2Z0EB 1TKGA 4NAWA 1WMHB 4KVGB 1E90A 2V3PA 3NVWA 2KACA 1F9JA 2SEBD 5GMVA 4RF1A 2W3SA 1F2RI 1K8RB 4OZCA 1KJTA 2NTTA 3AE3B 1P7EA 3VQIA 1XLOA 1PFDA 3QARA 2V3NA 4EZLA 1ZPSA 3UQBA 3VUXA 2NMQA 3H6NA 3AI5A 4FADA 3PTFC 4M00A 2IO1B 1L0VB 2BW2A 2K3UA 4HJKA 4WJOA 2MJ3A 2NBWB 3P4RB 2MCNB 5E6NA 3PHWB 1I4GA 2KDEB 3TEZA 1F77A 2C7MB 5BYSA 2BYVE 5AEKB 2AQ1B 4MT5A 4S17A 3B08A 2WGSA 2N0SB 3VRAB 2A5UA 1GNUA 2ZVOA 2NR2A 2UU7A 4IUMB 1IGDA 4FXCA 3DVGX 4FLHA 4EFOA 2I38A 2WXIA 4DDID 4J3OD 1XCQL 3TMPB 4IWOA 3RNEC 3M62B 2MBQA 2IPKD 4FBJB 4K3CA 1NI3A 1RRBA 2KOXA 2OHFA 4REZA 1NDDA 1L6UA 3R8BA 2JZPA 1FXAA 4P16A 1UH6A 1V81A 3DHIC 1IBXB 2C5LC 3I3TB 2LWPA 3ZRCA 5IA7A 1L6VA 1WXAA 5DCNA 2K9XA 1N5WA 1I35A 1WX7A 2PKOA 4DHZE 4NJ7A 2ZJDA 1T0SC 3N20C 4MSMB 2KVRA 3OWEB 3EGRA 3MC9A 3RFZB 2C7HA 1MPEA 1V80A 2ON8A 2I1KA 1YN3A 3TIXA 1QILA 3DHHC 3DCGA 4DQOC 1UBQA 3P2BA 4XZ4A 3EUB2 3DBLB 3UIOB 4EE2A 4MEMA 2EMTA 1NENB 4LCDE 4LNNA 4DXGA 1WE7A 1OGWA 4MACA 5D3DA 3ZRFA 1WY8A 4LNOA 2RSUA 5DPRA 3AE8B 3HM6X 2BS4B 3KUZA 1IYFA 4LTUA 4I6PA 2V9HA 3SHQA 4RGMA 4BOZB 3NS1A 3W1SA 4HPMB 1FMAD 1V8CA 5EDSA 1ZW7A 2XEWA 4OZAA 3Q2AC 5AUKA 5JZEB 3CWIA 4NJ6A 3EFCA 2FE8A 3APFA 4RGTA 2K8HA 1E7VA 4TKNA 4TSSA 3QX1A 3KLSX 5G5GA 2JVCA 1JWUD 4WWOA 4MGZE 2AWTA 2LXCA 5LXHA 3U7DA 2KANA 2LFIA 2JSVX 1DOXA 2QCZA 5LLIA 2WDVB 4K1RB 3AMZA 3PZDA 2KQ7A 1IP9A 3A9KA 2EMSA 4XGAB 4BFRA 3SD5A 4ICVA 3B0AA 2KTFA 3NVZA 1WR6E 5C23A 4AQ7A 2V0GA 1C4CA 4LNKA 1WRDB 3RCZA 4KZCA 5FR3A 5H8YE 4TV3A 2IGGA 1E9MA 3SEBA 3ONSA 2MBOA 3AEGB 5KHOA 2ZPNA
chains in the Genus database with same CATH topology
4WJPA 3ALBA 5CX3A 2C9WB 3ECIA 3VHTC 2CHZA 2HD5B 4BKGA 2NCNA 1RLFA 3RZWC 3JYUA 2JPHA 3JVZX 3IVFA 4FJZA 5IAAC 2ZVNA 3UF8A 3D32A 3IFWB 3WA0A 2KKCA 3MJWA 2KX3A 2CR5A 2MSED 4NAWB 2Y5BB 2LVPA 2YVCA 1V49A 1WGDA 1XD3B 5D7GA 3A9JB 4B6WA 2IO2B 2MBEA 3K9OB 1VCBA 2AL6A 3ZIMA 2D3GA 3LDZE 3ZLZA 4BKSA 1OEYA 5JH5C 3H1UA 1H8CA 2IZVB 4ZRKA 2WWZA 2LI5A 4IM2A 2Z59B 3KH0A 1Q1OA 2K6QA 1WIAA 3O65B 2M8SA 2BYEA 3WIMA 3DVGY 4MM3A 3RYTA 3OJ3A 4I6LB 1J19A 2JXXA 4DBGA 2BPSA 2G4DB 1TGZB 3SDLC 2L0TA 2D2QA 4KZ0A 4GOCA 4M8NA 2N9XA 3H7PA 3ENEA 4WJNA 2FCSA 1YX6B 2WYQA 4F8CB 3DQVA 3GOEA 1YIWA 2LXAA 3Q3FA 4MDKE 4MGIE 3S2AA 1WH3A 2K8BA 1CMXB 1UBIA 4HK2A 4PYUA 2UYZB 1EF1A 1HE8A 1LXDA 2KZRA 4W9LA 3ZO5B 1P1AA 4X57B 1L7YA 2MP2B 3HIZA 5D6JB 2JWZA 2CKHB 1L2NA 2CHXA 1R4NI 4NY0A 1MG8A 2ZPYA 2KDFB 3H7SA 3NOBA 4BBNC 2IO0B 3N30A 5BO4B 3W1SC 1WFYA 4M8MA 2OJRA 4GSWA 2KX0A 4GGQA 1Y8RC 3IBEA 3A4SC 1Z5SB 4JQWC 2JZ3B 4F7ZA 3RT3B 1P98A 3EECA 4MGYE 1WXMA 2J0JA 1WGYA 2REXA 2V3SA 5JHAA 1KOTA 2N7EA 3PRPB 2O2VB 2KQSA 4RMAA 1IP9A 3V62A 2DZJA 4ZRIA 1BT0A 2LASA 3R3MA 3VH3B 2ZZPB 1UGMA 1WZ3A 2LGYA 1M94A 2KTRB 2L05A 2ZCCA 1NI2A 3VUWA 2DYOA 3KW5B 2KFKA 1TTNA 1V9JA 4KV2A 4N9F4 3VFKA 1U4AA 3NZSA 4E71A 2D11A 4RM9A 1UD7A 1FXTB 2DYMA 1UZXB 2OOBB 3APDA 3IG3A 3HHMA 2KHWB 4FHKA 2FAZA 4GU2A 3U30A 1PQSA 1YJ1A 4GDKA 3PT2B 3VUYA 3QC8B 4JGHB 2NPTB 2K1FA 3UIPB 2BKFA 2KN5A 2GBRA 2L7RA 2FCQA 1S1QB 5G55A 1Z2MA 3A1QB 1E8ZA 3DPDA 2KJRA 4DXAB 3H9DA 3UGBB 2WDTB 3DBSA 1WR1A 4K7SA 2MBHA 3L10B 4GDLB 3DDCB 2LUEA 3R66C 3ZVVA 4BBNF 3ZNID 2O6VB 3QA8A 4W9IA 4NNJB 4ICUA 2CU1A 1AARA 4LDTB 3L54A 2FIDA 3VTVA 3CSTA 4BKTA 3ML9A 3DOWA 4DWFA 4E74A 4GXBA 2O6VD 1LQBA 1WJ6A 4ZRJA 2GOWA 4WJQA 2XK5B 4RM8A 1E7UA 5JHBA 2IY1B 2LRUA 2HJ8A 3DBLI 4DHZB 2ZEQA 1RAXA 5AZGA 1E5WA 2RD0A 3AULA 4F1SA 3DVNU 3L08A 4M0WB 2GBKA 2PPHA 4J6IA 4MH0E 3IHPC 2M4NA 2M17A 1I42A 4EKUA 4B95A 1P0RA 1JRUA 2KC1A 2JRHA 2NBVB 1EF5A 3ML8A 4FJYA 3ZTDA 2JUOA 1WZ0A 2GMIC 4JL9A 2NBUA 4G11A 3V61A 1V5OA 4CYEA 4G3XB 2L76A 2I1JA 2JF5A 4IWPA 1V6EA 4W9CA 3ZNHB 2BYFA 2FNJB 4PYZA 3PV1A 5AZHA 3EHVA 4KIKA 2DX5B 4DHJB 1YX5B 4IWQA 5TR5A 3UQAA 2BGFA 3R7RA 3C0RB 4MJSB 3AU4A 3QK0A 4TQ1A 4A3OA 3APCA 5J17A 4WWPA 1J0GA 5L83A 4LJOB 4MELA 3ZW3A 2FUHB 4DHJD 1V5TA 1H4RA 1WJ4A 3B1LX 1WM2A 2DAJA 1WJNA 2NS5A 5G2NA 1SGHA 3ZUNA 1EUVB 2C60A 1IPGA 3K9PB 4TUUA 4MGKE 2UWQA 2BKRB 2DZKA 2AEHA 3JW0X 4HDOA 4HXDA 3VAWA 2MW5A 5E6PA 1G6JA 3JSVB 3KVFB 1WX9A 5J2RA 2Z0EB 2VRRB 2KMCA 1EO6A 4NAWA 4W9JA 3CMMB 4JLCA 1QZEA 2M1MA 1WMHB 4KVGB 1E90A 2KD0A 3A9JA 4AP4C 2IO3B 5DPWA 1F9JA 2L3ZA 3ZDMC 5GMVA 2IYDB 3QAQA 1J8CA 3AU5A 1K8RB 2DYBA 4W9EA 1KJTA 1WGGA 2LZ6A 2D10A 3AXCA 2MA9B 3HK0A 4G0NB 4II3B 4FA6A 1WYWB 2ZNVC 3VQIA 2NVUI 2KLGA 3PREA 3BINA 3QARA 2K25A 4IW0A 4EZJA 4EZLA 2CHWA 2L0FA 1ISNA 4YL8A 1WXSA 2GBJA 3UQBA 3VUXA 5C1ZA 1D3ZA 1RFAA 4KSKC 3PS6A 3X0WA 3Q3JA 3H6NA 2B3AA 3AI5A 4FADA 5CHVC 2GBNA 4W9GA 2DZMA 1VD2A 3PTFC 3U8ZA 2IO1B 2K39A 2YLMA 4WJOA 5AZFA 4HJKA 4FHJA 2DZIA 1V86A 2FCNA 2MBBB 2NBWB 3PRMB 3ZDTA 4HLEA 2MCNB 4IM3A 5E6NA 2MP2A 3PHWB 3QJZA 1UELA 3L13A 2KDEB 2LVOA 3RUIB 4P7IA 3DBHI 4OVVA 2KDIA 2C7MB 3NZUA 4AUQC 2BYVE 3PPAA 1Q0WB 2KO3A 1WGHA 1YD8U 4W9KA 3VXWA 5AEKB 3KUDB 4OVUA 3B08A 2KWUB 3WAMA 4ANWA 2KC2A 3A9KB 1C3TA 2A5UA 1GNUA 2ZVOA 2NR2A 1LM8B 2O2VA 3PLVA 4IUMB 2J7QB 4URKA 2WX1A 4KDLB 4BOSC 3DVGX 3SU8X 1WXVA 2N9PC 2KTRA 2N7DA 4FLHA 3RULA 3VVWB 4EFOA 4ZYNA 3WAOA 5D2MB 2LGXA 1OQYA 4MSQB 2N1VA 2V1YA 3RZFA 4DDID 3NS8A 3VH4B 3RD2A 3TMPB 4IWOA 3M62B 2PEAA 1GUAB 1OTRB 4E3CA 4IC7B 2FCMA 2MBQA 4EUTA 2JRIB 2R2OA 3MHSD 2NPTA 4FBJB 3OJ4B 3TJPA 2K8CA 3L17A 3TL5A 4CO7A 1RRBA 2KOXA 4FJVB 2XBBC 3A1QA 4XC2A 1C1YB 4GB9A 1Q5WB 2G4SA 4WWNA 1NDDA 1WJUA 3WAPA 4FN2A 4GDLA 4TQ0A 1T0YA 2JY6A 3QCAA 2N9EB 5DPSA 3QHTA 3WALA 2O6VA 2HE7A 2KWCA 3V6EB 2QHOA 3OAWA 4K81A 2PJHA 2FIFA 2RR9A 3VTWA 2N4FA 1UH6A 1V81A 2N1WA 5D94A 5E6OA 4DK5A 2IY0B 4ASWC 2XK5A 4FULA 3PHXB 4LJPB 1XQQA 2C5LC 3I3TB 2LWPA 1WE6A 3MTNB 3ZKJC 3ZRCA 5IA7A 2L8JA 2KJHB 4K7UA 3KUCB 4ANVA 1XT9B 2BWES 1WXAA 5DCNA 4BKSD 1I35A 1WX7A 2C7NB 2KLCA 2AL3A 4DHZE 3T8MA 2AYOB 4XX5A 4NJ7A 2ZJDA 3M95A 1V2YA 3H7PB 4MSMB 2KVRA 3BY4B 3UINB 3OLMD 3CSFA 1E8XA 1TBEA 4NQLB 2K6DB 3A33B 3V60A 4PS7A 2C7HA 4IG7B 3M63B 2BF8B 3DVNV 4I6NB 1V80A 4MJSA 2I1KA 3TIXA 2G3QB 4NQKE 4W9FA 1P3QU 3DCGA 2RGFA 1UBQA 1KM7A 2MLBA 3P2BA 4XZ4A 2MWSB 1E8WA 2ZNVB 3UIOB 2MQJA 1NBFC 4WQOB 3L0WB 2KFJA 3NY5A 4HCNB 2IBIB 2R2QA 4MEMA 2PE9A 3PGEA 4HPLB 2EMTA 2EKEC 3M3JA 4LCDE 5J18A 3JSVA 5DPTA 4AJYB 1WE7A 1X1MA 4NPNA 3ZNZB 5FR6A 1OGWA 2M0XA 1SIFA 1WMHA 2J0KA 2A4ZA 2W9NA 3VTUA 3ZRFA 1WY8A 3TBLD 4A20A 5KHQA 2Z0DB 5CHFA 2DAFA 2RSUA 4JIOU 5DPRA 3NHEB 1A5RA 2CS4A 2WX0A 1TZ1A 1ZGUB 3N32A 3QWZB 1ZKHA 3HM6X 3KUZA 4WAAA 1IYFA 3EC8A 5L95C 2KK8A 3CF6E 4I6PA 5CHWA 3SHQA 2D07B 1GJZA 4BOZB 1S3SG 4BVUC 3W1SA 3PLUA 2KFKB 4HPMB 2V4LA 2LJ5A 4GIVA 2PE6B 3V6CB 4W9HA 4KSLC 4AJWA 2RPQA 2DHZA 2LVQA 4CHKA 5EDSA 1ZW7A 2XEWA 1E8YA 2J0MA 3VDZA 2L00B 4GDKB 3LJ3A 5JZEB 4NJ6A 3W1YA 2MRPA 3WANA 4G50A 4PS3A 4EZKA 3APFA 3A4RA 4GN1A 2K8HA 2KXJA 1E7VA 2LD9A 3GZNI 3KYDD 4A3PA 1KLVA 4TKNA 4W9DA 3ZTCA 4IM0A 5HKHA 3QX1A 3PSEB 1GC7A 4EOYA 3TCAA 1WI0A 4B9KA 4HVBA 1GC6A 2JVCA 2KWVB 2G45B 2KDBA 3N3KB 4HCPB 3HM3A 4MGZE 1P9DU 2AWTA 4WWOA 2LXCA 3X23A 5LXHA 1WM3A 3L16A 3U7DA 2KANA 3T9LA 2KJ6A 3DBRI 1OEYJ 4II2B 4K7WA 5LLIA 5LXIB 4DDGD 4K1RB 1YQBA 3QQ8B 4GMVA 3PZDA 3KYCD 2KQ7A 2HTHA 4EEWA 2DENB 2EMSA 3A9KA 4PS8A 4ANXA 3SD5A 4BFRA 4ICVA 3B0AA 1SE9A 4HWIB 2KNBA 4AOFA 2KTFA 3PVLA 1R4MI 1WX8A 3ZNGC 1WR6E 3PRZA 5C23A 2JZZA 1WF9A 2LRWA 4AWJA 3QIJA 4KDIC 1GG3A 2BWFA 1WRDB 3EFUA 3RCZA 4KZCA 4ZDVA 4TV3A 2LGDA 1WGRA 2ASQA 3ONSA 2JT4B 2MBOA 4HDQA 5KHOA 4ANUA 2ZCBA 5CTRC 1LFDA 2ZPNA 2KMAA 4LDTD 4KIKB 3R7QA 2MX2A 2GBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WJP A;  3ALB A;  5CX3 A;  2C9W B;  3ECI A;  3VHT C;  2CHZ A;  2HD5 B;  4BKG A;  2NCN A;  1RLF A;  3RZW C;  3JYU A;  2JPH A;  3JVZ X;  3IVF A;  4FJZ A;  5IAA C;  2ZVN A;  3UF8 A;  3D32 A;  3IFW B;  3WA0 A;  2KKC A;  3MJW A;  2KX3 A;  2CR5 A;  2MSE D;  4NAW B;  2Y5B B;  2LVP A;  2YVC A;  1V49 A;  1WGD A;  1XD3 B;  5D7G A;  3A9J B;  4B6W A;  2IO2 B;  2MBE A;  3K9O B;  1VCB A;  2AL6 A;  3ZIM A;  2D3G A;  3LDZ E;  3ZLZ A;  4BKS A;  1OEY A;  5JH5 C;  3H1U A;  1H8C A;  2IZV B;  4ZRK A;  2WWZ A;  2LI5 A;  4IM2 A;  2Z59 B;  3KH0 A;  1Q1O A;  2K6Q A;  1WIA A;  3O65 B;  2M8S A;  2BYE A;  3WIM A;  3DVG Y;  4MM3 A;  3RYT A;  3OJ3 A;  4I6L B;  1J19 A;  2JXX A;  4DBG A;  2BPS A;  2G4D B;  1TGZ B;  3SDL C;  2L0T A;  2D2Q A;  4KZ0 A;  4GOC A;  4M8N A;  2N9X A;  3H7P A;  3ENE A;  4WJN A;  2FCS A;  1YX6 B;  2WYQ A;  4F8C B;  3DQV A;  3GOE A;  1YIW A;  2LXA A;  3Q3F A;  4MDK E;  4MGI E;  3S2A A;  1WH3 A;  2K8B A;  1CMX B;  1UBI A;  4HK2 A;  4PYU A;  2UYZ B;  1EF1 A;  1HE8 A;  1LXD A;  2KZR A;  4W9L A;  3ZO5 B;  1P1A A;  4X57 B;  1L7Y A;  2MP2 B;  3HIZ A;  5D6J B;  2JWZ A;  2CKH B;  1L2N A;  2CHX A;  1R4N I;  4NY0 A;  1MG8 A;  2ZPY A;  2KDF B;  3H7S A;  3NOB A;  4BBN C;  2IO0 B;  3N30 A;  5BO4 B;  3W1S C;  1WFY A;  4M8M A;  2OJR A;  4GSW A;  2KX0 A;  4GGQ A;  1Y8R C;  3IBE A;  3A4S C;  1Z5S B;  4JQW C;  2JZ3 B;  4F7Z A;  3RT3 B;  1P98 A;  3EEC A;  4MGY E;  1WXM A;  2J0J A;  1WGY A;  2REX A;  2V3S A;  5JHA A;  1KOT A;  2N7E A;  3PRP B;  2O2V B;  2KQS A;  4RMA A;  1IP9 A;  3V62 A;  2DZJ A;  4ZRI A;  1BT0 A;  2LAS A;  3R3M A;  3VH3 B;  2ZZP B;  1UGM A;  1WZ3 A;  2LGY A;  1M94 A;  2KTR B;  2L05 A;  2ZCC A;  1NI2 A;  3VUW A;  2DYO A;  3KW5 B;  2KFK A;  1TTN A;  1V9J A;  4KV2 A;  4N9F 4;  3VFK A;  1U4A A;  3NZS A;  4E71 A;  2D11 A;  4RM9 A;  1UD7 A;  1FXT B;  2DYM A;  1UZX B;  2OOB B;  3APD A;  3IG3 A;  3HHM A;  2KHW B;  4FHK A;  2FAZ A;  4GU2 A;  3U30 A;  1PQS A;  1YJ1 A;  4GDK A;  3PT2 B;  3VUY A;  3QC8 B;  4JGH B;  2NPT B;  2K1F A;  3UIP B;  2BKF A;  2KN5 A;  2GBR A;  2L7R A;  2FCQ A;  1S1Q B;  5G55 A;  1Z2M A;  3A1Q B;  1E8Z A;  3DPD A;  2KJR A;  4DXA B;  3H9D A;  3UGB B;  2WDT B;  3DBS A;  1WR1 A;  4K7S A;  2MBH A;  3L10 B;  4GDL B;  3DDC B;  2LUE A;  3R66 C;  3ZVV A;  4BBN F;  3ZNI D;  2O6V B;  3QA8 A;  4W9I A;  4NNJ B;  4ICU A;  2CU1 A;  1AAR A;  4LDT B;  3L54 A;  2FID A;  3VTV A;  3CST A;  4BKT A;  3ML9 A;  3DOW A;  4DWF A;  4E74 A;  4GXB A;  2O6V D;  1LQB A;  1WJ6 A;  4ZRJ A;  2GOW A;  4WJQ A;  2XK5 B;  4RM8 A;  1E7U A;  5JHB A;  2IY1 B;  2LRU A;  2HJ8 A;  3DBL I;  4DHZ B;  2ZEQ A;  1RAX A;  5AZG A;  1E5W A;  2RD0 A;  3AUL A;  4F1S A;  3DVN U;  3L08 A;  4M0W B;  2GBK A;  2PPH A;  4J6I A;  4MH0 E;  3IHP C;  2M4N A;  2M17 A;  1I42 A;  4EKU A;  4B95 A;  1P0R A;  1JRU A;  2KC1 A;  2JRH A;  2NBV B;  1EF5 A;  3ML8 A;  4FJY A;  3ZTD A;  2JUO A;  1WZ0 A;  2GMI C;  4JL9 A;  2NBU A;  4G11 A;  3V61 A;  1V5O A;  4CYE A;  4G3X B;  2L76 A;  2I1J A;  2JF5 A;  4IWP A;  1V6E A;  4W9C A;  3ZNH B;  2BYF A;  2FNJ B;  4PYZ A;  3PV1 A;  5AZH A;  3EHV A;  4KIK A;  2DX5 B;  4DHJ B;  1YX5 B;  4IWQ A;  5TR5 A;  3UQA A;  2BGF A;  3R7R A;  3C0R B;  4MJS B;  3AU4 A;  3QK0 A;  4TQ1 A;  4A3O A;  3APC A;  5J17 A;  4WWP A;  1J0G A;  5L83 A;  4LJO B;  4MEL A;  3ZW3 A;  2FUH B;  4DHJ D;  1V5T A;  1H4R A;  1WJ4 A;  3B1L X;  1WM2 A;  2DAJ A;  1WJN A;  2NS5 A;  5G2N A;  1SGH A;  3ZUN A;  1EUV B;  2C60 A;  1IPG A;  3K9P B;  4TUU A;  4MGK E;  2UWQ A;  2BKR B;  2DZK A;  2AEH A;  3JW0 X;  4HDO A;  4HXD A;  3VAW A;  2MW5 A;  5E6P A;  1G6J A;  3JSV B;  3KVF B;  1WX9 A;  5J2R A;  2Z0E B;  2VRR B;  2KMC A;  1EO6 A;  4NAW A;  4W9J A;  3CMM B;  4JLC A;  1QZE A;  2M1M A;  1WMH B;  4KVG B;  1E90 A;  2KD0 A;  3A9J A;  4AP4 C;  2IO3 B;  5DPW A;  1F9J A;  2L3Z A;  3ZDM C;  5GMV A;  2IYD B;  3QAQ A;  1J8C A;  3AU5 A;  1K8R B;  2DYB A;  4W9E A;  1KJT A;  1WGG A;  2LZ6 A;  2D10 A;  3AXC A;  2MA9 B;  3HK0 A;  4G0N B;  4II3 B;  4FA6 A;  1WYW B;  2ZNV C;  3VQI A;  2NVU I;  2KLG A;  3PRE A;  3BIN A;  3QAR A;  2K25 A;  4IW0 A;  4EZJ A;  4EZL A;  2CHW A;  2L0F A;  1ISN A;  4YL8 A;  1WXS A;  2GBJ A;  3UQB A;  3VUX A;  5C1Z A;  1D3Z A;  1RFA A;  4KSK C;  3PS6 A;  3X0W A;  3Q3J A;  3H6N A;  2B3A A;  3AI5 A;  4FAD A;  5CHV C;  2GBN A;  4W9G A;  2DZM A;  1VD2 A;  3PTF C;  3U8Z A;  2IO1 B;  2K39 A;  2YLM A;  4WJO A;  5AZF A;  4HJK A;  4FHJ A;  2DZI A;  1V86 A;  2FCN A;  2MBB B;  2NBW B;  3PRM B;  3ZDT A;  4HLE A;  2MCN B;  4IM3 A;  5E6N A;  2MP2 A;  3PHW B;  3QJZ A;  1UEL A;  3L13 A;  2KDE B;  2LVO A;  3RUI B;  4P7I A;  3DBH I;  4OVV A;  2KDI A;  2C7M B;  3NZU A;  4AUQ C;  2BYV E;  3PPA A;  1Q0W B;  2KO3 A;  1WGH A;  1YD8 U;  4W9K A;  3VXW A;  5AEK B;  3KUD B;  4OVU A;  3B08 A;  2KWU B;  3WAM A;  4ANW A;  2KC2 A;  3A9K B;  1C3T A;  2A5U A;  1GNU A;  2ZVO A;  2NR2 A;  1LM8 B;  2O2V A;  3PLV A;  4IUM B;  2J7Q B;  4URK A;  2WX1 A;  4KDL B;  4BOS C;  3DVG X;  3SU8 X;  1WXV A;  2N9P C;  2KTR A;  2N7D A;  4FLH A;  3RUL A;  3VVW B;  4EFO A;  4ZYN A;  3WAO A;  5D2M B;  2LGX A;  1OQY A;  4MSQ B;  2N1V A;  2V1Y A;  3RZF A;  4DDI D;  3NS8 A;  3VH4 B;  3RD2 A;  3TMP B;  4IWO A;  3M62 B;  2PEA A;  1GUA B;  1OTR B;  4E3C A;  4IC7 B;  2FCM A;  2MBQ A;  4EUT A;  2JRI B;  2R2O A;  3MHS D;  2NPT A;  4FBJ B;  3OJ4 B;  3TJP A;  2K8C A;  3L17 A;  3TL5 A;  4CO7 A;  1RRB A;  2KOX A;  4FJV B;  2XBB C;  3A1Q A;  4XC2 A;  1C1Y B;  4GB9 A;  1Q5W B;  2G4S A;  4WWN A;  1NDD A;  1WJU A;  3WAP A;  4FN2 A;  4GDL A;  4TQ0 A;  1T0Y A;  2JY6 A;  3QCA A;  2N9E B;  5DPS A;  3QHT A;  3WAL A;  2O6V A;  2HE7 A;  2KWC A;  3V6E B;  2QHO A;  3OAW A;  4K81 A;  2PJH A;  2FIF A;  2RR9 A;  3VTW A;  2N4F A;  1UH6 A;  1V81 A;  2N1W A;  5D94 A;  5E6O A;  4DK5 A;  2IY0 B;  4ASW C;  2XK5 A;  4FUL A;  3PHX B;  4LJP B;  1XQQ A;  2C5L C;  3I3T B;  2LWP A;  1WE6 A;  3MTN B;  3ZKJ C;  3ZRC A;  5IA7 A;  2L8J A;  2KJH B;  4K7U A;  3KUC B;  4ANV A;  1XT9 B;  2BWE S;  1WXA A;  5DCN A;  4BKS D;  1I35 A;  1WX7 A;  2C7N B;  2KLC A;  2AL3 A;  4DHZ E;  3T8M A;  2AYO B;  4XX5 A;  4NJ7 A;  2ZJD A;  3M95 A;  1V2Y A;  3H7P B;  4MSM B;  2KVR A;  3BY4 B;  3UIN B;  3OLM D;  3CSF A;  1E8X A;  1TBE A;  4NQL B;  2K6D B;  3A33 B;  3V60 A;  4PS7 A;  2C7H A;  4IG7 B;  3M63 B;  2BF8 B;  3DVN V;  4I6N B;  1V80 A;  4MJS A;  2I1K A;  3TIX A;  2G3Q B;  4NQK E;  4W9F A;  1P3Q U;  3DCG A;  2RGF A;  1UBQ A;  1KM7 A;  2MLB A;  3P2B A;  4XZ4 A;  2MWS B;  1E8W A;  2ZNV B;  3UIO B;  2MQJ A;  1NBF C;  4WQO B;  3L0W B;  2KFJ A;  3NY5 A;  4HCN B;  2IBI B;  2R2Q A;  4MEM A;  2PE9 A;  3PGE A;  4HPL B;  2EMT A;  2EKE C;  3M3J A;  4LCD E;  5J18 A;  3JSV A;  5DPT A;  4AJY B;  1WE7 A;  1X1M A;  4NPN A;  3ZNZ B;  5FR6 A;  1OGW A;  2M0X A;  1SIF A;  1WMH A;  2J0K A;  2A4Z A;  2W9N A;  3VTU A;  3ZRF A;  1WY8 A;  3TBL D;  4A20 A;  5KHQ A;  2Z0D B;  5CHF A;  2DAF A;  2RSU A;  4JIO U;  5DPR A;  3NHE B;  1A5R A;  2CS4 A;  2WX0 A;  1TZ1 A;  1ZGU B;  3N32 A;  3QWZ B;  1ZKH A;  3HM6 X;  3KUZ A;  4WAA A;  1IYF A;  3EC8 A;  5L95 C;  2KK8 A;  3CF6 E;  4I6P A;  5CHW A;  3SHQ A;  2D07 B;  1GJZ A;  4BOZ B;  1S3S G;  4BVU C;  3W1S A;  3PLU A;  2KFK B;  4HPM B;  2V4L A;  2LJ5 A;  4GIV A;  2PE6 B;  3V6C B;  4W9H A;  4KSL C;  4AJW A;  2RPQ A;  2DHZ A;  2LVQ A;  4CHK A;  5EDS A;  1ZW7 A;  2XEW A;  1E8Y A;  2J0M A;  3VDZ A;  2L00 B;  4GDK B;  3LJ3 A;  5JZE B;  4NJ6 A;  3W1Y A;  2MRP A;  3WAN A;  4G50 A;  4PS3 A;  4EZK A;  3APF A;  3A4R A;  4GN1 A;  2K8H A;  2KXJ A;  1E7V A;  2LD9 A;  3GZN I;  3KYD D;  4A3P A;  1KLV A;  4TKN A;  4W9D A;  3ZTC A;  4IM0 A;  5HKH A;  3QX1 A;  3PSE B;  1GC7 A;  4EOY A;  3TCA A;  1WI0 A;  4B9K A;  4HVB A;  1GC6 A;  2JVC A;  2KWV B;  2G45 B;  2KDB A;  3N3K B;  4HCP B;  3HM3 A;  4MGZ E;  1P9D U;  2AWT A;  4WWO A;  2LXC A;  3X23 A;  5LXH A;  1WM3 A;  3L16 A;  3U7D A;  2KAN A;  3T9L A;  2KJ6 A;  3DBR I;  1OEY J;  4II2 B;  4K7W A;  5LLI A;  5LXI B;  4DDG D;  4K1R B;  1YQB A;  3QQ8 B;  4GMV A;  3PZD A;  3KYC D;  2KQ7 A;  2HTH A;  4EEW A;  2DEN B;  2EMS A;  3A9K A;  4PS8 A;  4ANX A;  3SD5 A;  4BFR A;  4ICV A;  3B0A A;  1SE9 A;  4HWI B;  2KNB A;  4AOF A;  2KTF A;  3PVL A;  1R4M I;  1WX8 A;  3ZNG C;  1WR6 E;  3PRZ A;  5C23 A;  2JZZ A;  1WF9 A;  2LRW A;  4AWJ A;  3QIJ A;  4KDI C;  1GG3 A;  2BWF A;  1WRD B;  3EFU A;  3RCZ A;  4KZC A;  4ZDV A;  4TV3 A;  2LGD A;  1WGR A;  2ASQ A;  3ONS A;  2JT4 B;  2MBO A;  4HDQ A;  5KHO A;  4ANU A;  2ZCB A;  5CTR C;  1LFD A;  2ZPN A;  2KMA A;  4LDT D;  4KIK B;  3R7Q A;  2MX2 A;  2GBM A; 
#chains in the Genus database with same CATH topology
 2NTS A;  1SXT A;  4BKG A;  1TZO A;  2DBY A;  1OFF A;  2QMT A;  3AH7 A;  2IGH A;  2N7J A;  1C4P A;  1CQV A;  4NAW B;  2YVC A;  1V49 A;  4US9 A;  5D7G A;  3B2F A;  2K22 A;  4XDC A;  2D3G A;  3LDZ E;  5JH5 C;  2INC C;  2WXN A;  2K6Q A;  4MM3 A;  1YJI A;  2W82 A;  4DBG A;  2G4D B;  2L0T A;  4KZ0 A;  2AX5 A;  2WLB A;  3RNB C;  3NVV A;  3S2A A;  1TY0 A;  4BZA A;  4KKJ A;  1CMX B;  4MH8 A;  4HK2 A;  2UYZ B;  3I63 C;  1HE8 A;  3ZGZ A;  1P1A A;  1F52 A;  2RDG A;  2INP E;  4RNA A;  3HIZ A;  1JWA D;  2BS2 B;  4L23 A;  2CKH B;  1L2N A;  1BXT A;  2KDF B;  3NOB A;  4BBN C;  3W1S C;  1WFY A;  4GGQ A;  2JZ3 B;  4F7Z A;  3IXS A;  3EEC A;  4MGY E;  1WXM A;  2J0J A;  3BVZ A;  2REX A;  2YEP F;  4NAM A;  3PRP B;  4ITK A;  3AEE B;  3R3M A;  1UGM A;  1YMH E;  5EE3 A;  3NZ3 A;  3SFD B;  1TTN A;  4KV2 A;  3VFK A;  1UD7 A;  1FXT B;  2OOB B;  2KHW B;  3P4S B;  3U30 A;  3VUY A;  1HZ5 A;  3PT2 B;  3UIP B;  4WAF A;  5G55 A;  1E8Z A;  3U7Z A;  2KJR A;  3H9D A;  3NG0 A;  4XE0 A;  3DDC B;  2HTM E;  2JX5 A;  3ZVV A;  1QOG A;  4A55 A;  4WUR A;  3QA8 A;  4NNJ B;  4ICU A;  4LDT B;  1D5M C;  1WJ6 A;  3AE6 B;  1SJH D;  1YQ4 B;  3MC0 B;  2LRU A;  3DBL I;  5AZG A;  2RD0 A;  3AUL A;  2PPH A;  1FXI A;  1RM6 C;  2D3B A;  1UGJ A;  2IJ0 A;  1I42 A;  1PGX A;  3N1Y C;  1XF5 L;  1EF5 A;  3ZTD A;  2GRI A;  3V61 A;  4W9C A;  3ZNH B;  1WYG A;  1YN5 A;  5TR5 A;  3N1X C;  3UQA A;  3SR6 A;  1NYQ A;  3R7R A;  2QEJ C;  2MJE A;  1M4V A;  2LJI A;  4ZHO A;  3QK0 A;  4GLS C;  4LJO B;  4XDD A;  3AE2 B;  1FCL A;  3B1L X;  2SAK A;  4OZB A;  1SGH A;  1EUV B;  4HDO A;  2DZK A;  3JW0 X;  1PYW D;  5E6J A;  1WX9 A;  3B9J A;  4W9J A;  3CMM B;  1E7P B;  2M1M A;  3A9J A;  5DPW A;  2IO3 B;  2L3Z A;  3ZDM C;  2VZK B;  3ZJU A;  1WGG A;  2LZ6 A;  2D10 A;  2VZK D;  4WIP A;  1SSN A;  4II3 B;  4YTN B;  3R2I A;  1V97 A;  2ZNV C;  2KLG A;  3BIN A;  2K25 A;  4EZJ A;  1TS5 A;  3W5V B;  1ISN A;  4YL8 A;  1IUE A;  1FEH A;  2EEL A;  5C1Z A;  4KSK C;  3RNG C;  3PS6 A;  4C4V A;  1D5X C;  2B3A A;  2G1E A;  3GS2 A;  1VD2 A;  1FO4 A;  1BML C;  1VZ7 A;  2K39 A;  2I2Y A;  1V86 A;  3W5U B;  2FCN A;  2MBB B;  1SE4 A;  4HLE A;  4IM3 A;  2ZW0 A;  3RUI B;  4P7I A;  4M01 A;  4OVZ A;  3NZU A;  3RNA C;  3PPA A;  3RN9 C;  1Q0W B;  2KO3 A;  2QJL A;  3B2G A;  4W9K A;  4PK1 A;  2KWU B;  1V1P A;  1EU4 A;  2KC2 A;  4ANW A;  3A9K B;  4D2K A;  5IO9 A;  4URK A;  5FKA C;  3HRD D;  5T8I A;  1JCK B;  2N9P C;  2N7D A;  3VVW B;  5D2M B;  4NZL B;  3RZF A;  3NS8 A;  1DYQ A;  3RD2 A;  3URY A;  4EUT A;  5BMI A;  1TKY A;  2JRI B;  2W3R A;  1TS3 A;  2KMM A;  4XC2 A;  2RPV A;  1Q5W B;  2G4S A;  1WJU A;  3WAP A;  4ZOH C;  4TQ0 A;  3QCA A;  2BVC A;  3QHT A;  3RI7 C;  2HE7 A;  3V6E B;  2PJH A;  5D94 A;  5E6O A;  4FUL A;  4LJP B;  1XQQ A;  1WE6 A;  3Q8F A;  2L8J A;  2KJH B;  4K7U A;  3KUC B;  1XT9 B;  1ZE3 D;  2BWE S;  1DOY A;  2JYT A;  2C7N B;  2KLC A;  2AL3 A;  2LHE A;  2AYO B;  3M95 A;  3TEW A;  1VDV A;  3AE5 B;  2DNF A;  3UIN B;  2AQ2 B;  1E8X A;  1TBE A;  3A33 B;  3V60 A;  2PVO D;  2QDF A;  1KLG D;  2LMC A;  4NQK E;  4W9F A;  3RNC C;  1FNU A;  4A8X C;  3J9C A;  1E8W A;  2ZNV B;  3I57 A;  3DWM A;  2MQJ A;  1NBF C;  4H2A A;  3RPF C;  3L0W B;  1L0X B;  2PE9 A;  1OQQ A;  3PGE A;  5J18 A;  1SJE D;  4AJY B;  1X1M A;  5FR6 A;  2M0X A;  1D4B A;  1SIF A;  3VTU A;  4A20 A;  2KWD A;  1CJE A;  1A5R A;  1TZ1 A;  1ZGU B;  2WXQ A;  1ZKH A;  3EC8 A;  3WCQ A;  5CHW A;  2D07 B;  1S3S G;  1MHX A;  1YOV B;  2PE6 B;  3V6C B;  4W9H A;  4AJW A;  2ACZ B;  2KQ4 X;  2RPQ A;  3AV8 A;  4CHK A;  2L00 B;  3PZ8 A;  3O13 A;  5I4D A;  2MRP A;  5EE0 A;  4PS3 A;  4L1B A;  4EZK A;  4GN1 A;  2AQ3 B;  2KXJ A;  1FRD A;  1KLV A;  1N63 A;  3MC8 A;  1ZUD 2;  4YTP B;  4EOY A;  4B9K A;  1GC6 A;  1KRH A;  2G45 B;  2KDB A;  2Q5W D;  1P9D U;  5TSS A;  2WXG A;  1HEZ E;  1XO3 A;  3GE3 C;  4XWT A;  3ZQ4 A;  2KYW A;  2JQR B;  4BAX A;  4K7W A;  4DDG D;  1SE3 A;  3QQ8 B;  2L1A A;  2XN9 C;  2KNB A;  1JML A;  1SIJ A;  3ZNG C;  1QKZ A;  1TJE A;  2JZZ A;  1WF9 A;  2JWU A;  4Q2J A;  2WXM A;  4KDI C;  1GG3 A;  2BWF A;  2LGD A;  1WGR A;  4IOI E;  3R7Q A;  2GBM A;  3TJP A;  4C7Z A;  2INN E;  2J4X A;  3AEF B;  3VHT C;  2CHZ A;  2HD5 B;  4YT0 B;  1A70 A;  2CJN A;  5IAA C;  3UF8 A;  3W2D A;  1NYR A;  3E9S A;  1EWC A;  1HTO A;  3IFW B;  2KKC A;  2CR5 A;  3N9Y C;  2Y5B B;  1WGD A;  1XD3 B;  4ZYS A;  2L83 A;  4XWW A;  3A9J B;  3K9O B;  2AL6 A;  1H8C A;  4ZRK A;  4QAY A;  2WWZ A;  2Z59 B;  2WP9 B;  3KH0 A;  1WIA A;  3TSS A;  2IDY A;  4LNI A;  2BPS A;  1PUT A;  5D3I B;  3UI3 A;  3TUO A;  1YX6 B;  4F8C B;  3GOE A;  1YIW A;  2LXA A;  3Q3F A;  4MGI E;  2K8B A;  5BYQ A;  5IOI A;  1HA5 A;  3ZO5 B;  4HRS A;  1QLB B;  1JRP A;  1WWT A;  1ENF A;  1QT9 A;  3P4Q B;  2JWZ A;  1B9R A;  1R4N I;  1MG8 A;  3H7S A;  3KWL A;  2IO0 B;  4P6V F;  2KX0 A;  3IBE A;  3A4S C;  1Z5S B;  3RT3 B;  1N62 A;  1DOI A;  2ZW1 A;  1V1P B;  1T0Q C;  1WGY A;  5JHA A;  2D3C A;  1D6E C;  2KQS A;  4RMA A;  1EWY C;  3V62 A;  4HEA 1;  4ZRI A;  1BT0 A;  1SB3 C;  3VH3 B;  2ZZP B;  3BYT B;  2LGY A;  4JWU C;  2ZCC A;  3NZS A;  4E71 A;  2D11 A;  4RM9 A;  3Q8B A;  1UZX B;  4K3B A;  1QOF A;  4FHK A;  2WDQ B;  2VH2 A;  1PQS A;  1YJ1 A;  2BKF A;  2GBR A;  2H88 B;  3LYY A;  4RGO S;  2WDT B;  3BZD B;  4JPS A;  3L10 B;  4P1B C;  4BBN F;  2FBW B;  3MFG A;  4HPP A;  3ML9 A;  3GP7 A;  4DWF A;  4E74 A;  4GXB A;  1LQB A;  3N1Z C;  3IT6 B;  5JHB A;  1MJD A;  3MJ5 A;  1L4D B;  2WDR B;  4MH0 E;  3ML8 A;  3P4P B;  3GZN B;  2GMI C;  2MJD A;  4G11 A;  1N5X A;  1V5O A;  1ROE A;  4PYZ A;  1MVK A;  5AZH A;  3EHV A;  2QSD A;  1JWB D;  3CIR B;  3ABV B;  4KIK A;  2DX5 B;  4A9A A;  4DHJ B;  1JRO A;  3DBR B;  3KWV A;  3C0R B;  3AU4 A;  4A3O A;  3APC A;  4M0W A;  4WWP A;  5L83 A;  3ZW3 A;  2FUH B;  4DHJ D;  1H4R A;  1WJ4 A;  1WM2 A;  1WJN A;  1R4M B;  4HXD A;  5E6P A;  1G6J A;  3KVF B;  3ETR A;  2K0P A;  2VRR B;  3IAM 1;  2KMC A;  1YJJ A;  3IAS 1;  1I4R A;  1QQR A;  2IYD B;  1J8C A;  3Q8C A;  3AU5 A;  1I4Q A;  1UUP A;  3KQ4 A;  3HK0 A;  2MA9 B;  4FA6 A;  4KKI A;  1WYW B;  2NVU I;  3PRE A;  3P63 A;  1YQ3 B;  4B0E A;  1STE A;  2L0F A;  4DXF A;  1WXS A;  2GBJ A;  1RFA A;  3Q3J A;  2YLM A;  4FHJ A;  5EE9 A;  2DZI A;  1FCC C;  3GE8 C;  1K53 A;  2L52 A;  2PMV A;  3PRM B;  4JX1 C;  1UEL A;  2Y5C A;  2LVO A;  1HXY D;  4OVV A;  4AS1 A;  1PGB A;  3DHG C;  4CQN A;  2KDI A;  3HVD A;  2JXT A;  4AUQ C;  1E10 A;  1WGH A;  1AN8 A;  5IP4 D;  3I5J C;  3IT4 B;  1C76 A;  4KGR A;  1K50 A;  1XLQ A;  4C00 A;  5JXV A;  3FC4 A;  2WX1 A;  4KDL B;  2KTR A;  3RUL A;  4MSQ B;  1OQY A;  2N1V A;  2V1Y A;  3PO0 A;  1TIF A;  3VR8 B;  2QC8 A;  1HTQ A;  5BMH A;  2FCM A;  4HRO A;  3MHS D;  1ZDX A;  2NPT A;  3OG5 A;  1T3Q A;  3L17 A;  1L5P A;  3NVY A;  4FJV B;  2XBB C;  1C1Y B;  4GB9 A;  4WWN A;  4GDL A;  2JY6 A;  5DPS A;  1ZOY B;  2KWC A;  2QHO A;  3OAW A;  4K81 A;  3C19 A;  2BB6 A;  2N4F A;  2IY0 B;  2XK5 A;  1FFV A;  3PHX B;  3ZKJ C;  3MTN B;  1JWM D;  2MH7 A;  5EE1 A;  1VZ8 A;  1ACC A;  4PT5 A;  3H8H A;  1CK1 A;  1MG4 A;  1I4P A;  2WXK A;  3P42 A;  3OLM D;  3TEY A;  2K6D B;  4PS7 A;  2BBC A;  2D5G A;  2BTE A;  2LEK A;  3DVN V;  3VRB B;  4MJS A;  2G3Q B;  3Q3O C;  2RGF A;  1KM7 A;  2MLB A;  2DWQ A;  1ZP0 B;  4WQO B;  3NY5 A;  2IBI B;  5BYR A;  4HPL B;  1WRI A;  3M3J A;  5DPT A;  2J42 A;  3ZNZ B;  2J0K A;  3BK1 A;  2W9N A;  3TBL D;  5KHQ A;  2DAF A;  4JIO U;  3NHE B;  1FM0 D;  4OW0 A;  3QWZ B;  2OJW A;  4YXD B;  4WAA A;  2WXO A;  3CF6 E;  3SFE B;  1GJZ A;  4BVU C;  3BVM A;  4GIV A;  3ZYY X;  4KSL C;  4LLG M;  4L2Y A;  3Q14 C;  3Q3M C;  3VDZ A;  3LJ3 A;  2VH1 A;  3W1Y A;  1VRA B;  2BS3 B;  2E3T A;  4G50 A;  1TYG B;  3A4R A;  1BUI C;  3GZN I;  3KYD D;  2WU5 B;  1J7C A;  4W9D A;  2XNA C;  4IM0 A;  3ZTC A;  5HKH A;  1AYF A;  1GC7 A;  2K5P A;  5C3J B;  1QF6 A;  3U52 E;  3TCA A;  4HVB A;  2KWV B;  4HCP B;  3X23 A;  1WM3 A;  3FIL A;  3L16 A;  1UWM A;  3DBR I;  1LGR A;  3AN1 A;  2BT6 A;  2LGI A;  3KYC D;  2HTH A;  4EEW A;  5BMG A;  1SE9 A;  3R2T A;  4HWI B;  2PIA A;  1JWS D;  3C8Y A;  3PVL A;  1R4M I;  1WX8 A;  3PRZ A;  2LRW A;  3QIJ A;  2Z8L A;  2GI9 A;  2CJO A;  4C56 C;  2D3A A;  4HDQ A;  2M56 B;  3DBH B;  4ANU A;  1TY2 A;  1ET9 A;  1LFD A;  2KMA A;  3LB8 C;  1FIQ A;  4KIK B;  2MX2 A;  1QOB A;  2JU6 X;  4WJP A;  3PZ7 A;  5CX3 A;  3Q6B A;  3ECI A;  3BWU D;  1KFY B;  2NCN A;  5AUI A;  3RZW C;  1UWX A;  2GLS A;  2JPH A;  4MM3 B;  3IVF A;  1Q10 A;  2EKI A;  3D32 A;  5FK9 C;  3WA0 A;  2MSE D;  2BB5 A;  1L4Z B;  2LVP A;  4B6W A;  4YSX B;  1VCB A;  3ZIM A;  3ZLZ A;  4BKS A;  1OEY A;  4KGT A;  2IZV B;  3U2S C;  2LI5 A;  2N9L A;  2N9K A;  1N6Z A;  1GB4 A;  1SE2 A;  3E56 A;  3DVG Y;  3OJ3 A;  1C78 A;  2H89 B;  2LHD A;  1J19 A;  2JXX A;  1TGZ B;  2WXP A;  4M8N A;  3H7P A;  3ENE A;  4WJN A;  2FCS A;  2WYQ A;  3DQV A;  4HKZ E;  5LNK 1;  4MDK E;  1EM7 A;  1WH3 A;  1UBI A;  1JQ4 A;  1TS2 A;  3HVZ A;  3MP9 A;  1L7Y A;  1MHH E;  2CHX A;  4NY0 A;  2ZPY A;  4RFB A;  1NVI D;  3N30 A;  3EA6 A;  3Q69 A;  2KT7 A;  2PVG C;  3BVG A;  2V3S A;  1KOT A;  2N7E A;  2DZJ A;  3T3N A;  2LAS A;  1M94 A;  2KTR B;  2L05 A;  3U4E G;  3VUW A;  2DYO A;  3KW5 B;  2KFK A;  4N6E B;  4N9F 4;  1C4A A;  1WXQ A;  2DYM A;  3HHM A;  3IG3 A;  2FAZ A;  4GDK A;  4JGH B;  2NPT B;  2K1F A;  3BK2 A;  2L7R A;  2FCQ A;  3LXF A;  1FNV A;  1Z2M A;  3DPD A;  4DXA B;  1WR1 A;  4XYC A;  4GDL B;  2LUE A;  3R66 C;  2CU1 A;  1AAR A;  3L54 A;  2FID A;  3VTV A;  1CZP A;  3DOW A;  1E0Z A;  1VLB A;  2FUG 1;  4P1C C;  2GOW A;  2XK5 B;  4KX6 B;  2IY1 B;  2HJ8 A;  2ZEQ A;  1RAX A;  4F1S A;  4RH6 A;  3DVN U;  3L08 A;  2GBK A;  1FFU A;  3IHP C;  1XLN A;  3NJT A;  2M4N A;  2M17 A;  4EKU A;  1JRU A;  2HJ1 A;  2JRH A;  2KC1 A;  4FJY A;  2NBU A;  1DGJ A;  1HQR D;  1QOA A;  4CYE A;  3HUI A;  4G3X B;  2JF5 A;  1V6E A;  4US8 A;  3AE1 B;  1I7H A;  4IWQ A;  4RGN A;  1YNT E;  2BGF A;  4MJS B;  2G9H D;  4TQ1 A;  1J0G A;  5J17 A;  4MEL A;  1V5T A;  3RNF C;  4A6Q A;  2NS5 A;  4RCO A;  2C60 A;  3K9P B;  1ZDV A;  2HDE A;  2UWQ A;  3VAW A;  2MW5 A;  2R61 A;  5J2R A;  2ICI A;  1EO6 A;  3RMK C;  1PGA A;  3NUH B;  1UNS A;  4JLC A;  1QZE A;  4TMA B;  4C4V B;  1XCT L;  2KD0 A;  2GB1 A;  4AP4 C;  2KVZ A;  3QAQ A;  3P1M A;  2MHJ A;  2DYB A;  4W9E A;  3AXC A;  4G0N B;  1N60 A;  2PLP A;  3V05 A;  1V1O A;  3BII D;  4IW0 A;  1AW7 A;  2CHW A;  1D3Z A;  3X0W A;  5CHV C;  2GBN A;  4W9G A;  2DZM A;  1ET6 A;  3U8Z A;  2TSS A;  5AZF A;  4HKQ A;  1ESF A;  3ZDT A;  2MP2 A;  3QJZ A;  3L13 A;  1GOZ A;  3Q8A A;  3DBH I;  3MHZ A;  3FIL B;  1ZXH A;  2BQQ A;  2WU2 B;  4NJC A;  1YD8 U;  3VXW A;  1HZ6 A;  3KUD B;  4OVU A;  3WAM A;  2WNM A;  1C3T A;  1LM8 B;  2O2V A;  3PLV A;  2WXF A;  3Q8E A;  2J7Q B;  1ZXI A;  4BOS C;  1F2R C;  3BYY B;  3SU8 X;  1WXV A;  4ZRP A;  4ZYN A;  3WAO A;  2LGX A;  3VH4 B;  3V3X A;  2PEA A;  1GUA B;  1OTR B;  4E3C A;  1WGK A;  1Y56 A;  4IC7 B;  4A90 A;  1PDX A;  2BYT A;  2R2O A;  4UDU C;  4YSZ B;  2WHI A;  3OJ4 B;  3TL5 A;  2K8C A;  4CO7 A;  1EU3 A;  3A1Q A;  4YSY B;  4FN2 A;  5IN7 A;  1T0Y A;  1NEK B;  2N9E B;  3WAL A;  2O6V A;  1VR9 A;  2WXJ A;  2FIF A;  2RR9 A;  3VTW A;  2N1W A;  4DK5 A;  4WWM A;  4ASW C;  2PW9 A;  2WXR A;  1OQR A;  4ANV A;  4R3D A;  2W54 A;  4BKS D;  3T8M A;  4XX5 A;  2KDM A;  1V2Y A;  4O1N A;  3H7P B;  3BY4 B;  2WQY B;  3ZXV A;  3CSF A;  1JW9 D;  4NQL B;  4IG7 B;  3M63 B;  2BF8 B;  1XEE A;  4I6N B;  1P3Q U;  2MWS B;  1K52 A;  2KFJ A;  4HCN B;  2R2Q A;  2CU3 A;  2EKE C;  1RWS A;  3DWG C;  3JSV A;  4OHJ A;  4NPN A;  1WMH A;  2A4Z A;  4ARC A;  2Z0D B;  5CHF A;  2W55 A;  1GPX A;  1T6B X;  2M0A A;  5G5H A;  2CS4 A;  2WX0 A;  3N32 A;  1D5Z C;  5L95 C;  2KK8 A;  1SBB B;  5C2T B;  3PLU A;  2KFK B;  4WQM A;  2V4L A;  2LJ5 A;  4JE3 B;  5GXG B;  2DHZ A;  2LVQ A;  1TKE A;  2L32 A;  1E8Y A;  2J0M A;  1WSP A;  4GDK B;  2LGS A;  3WAN A;  2LUM A;  2LD9 A;  4A3P A;  3FAH A;  2X8X X;  3PSE B;  1WI0 A;  1VZ6 A;  3N3K B;  1J7A A;  3HM3 A;  2J52 A;  3T9L A;  2KJ6 A;  1OEY J;  4JWS C;  4II2 B;  1K51 A;  1UF0 A;  5LXI B;  1YQB A;  1RFK A;  4GMV A;  4ARI A;  2DEN B;  4PS8 A;  4ANX A;  3ZJT A;  2RDH A;  4AOF A;  2QIL A;  4AWJ A;  1SEB D;  1FD6 A;  2KN4 A;  3EFU A;  4ZDV A;  4ZHP A;  2ASQ A;  2JT4 B;  2ZCB A;  2DLB A;  5HG2 A;  5CTR C;  4LDT D;  3ZJV A;  3ALB A;  3NRZ A;  4IKG A;  5HHD G;  2C9W B;  1TT5 B;  4S0R A;  3AB5 A;  3GB1 A;  2Y5P A;  1KTK A;  1RLF A;  2MEK A;  4N58 A;  2WS3 B;  1IGC A;  1XXG A;  3JYU A;  3JVZ X;  4FJZ A;  2ZVN A;  2WXH A;  4ZRQ A;  3MJW A;  2KX3 A;  3W9C B;  2M19 A;  2Y3A A;  2OED A;  1IBX A;  2IO2 B;  2MBE A;  1P7F A;  4B0M A;  1GAQ B;  3H1U A;  3AE4 B;  4IM2 A;  4KGS A;  1Q1O A;  3O65 B;  2M8S A;  5IKC M;  2BYE A;  3WIM A;  4N59 A;  3RYT A;  4I6L B;  1F0Z A;  1SF0 A;  3SDL C;  1JAL A;  1TS4 A;  2D2Q A;  2PTL A;  4GOC A;  2N9X A;  3Q3N C;  1J7B A;  1MI0 A;  2QIE B;  3AEA B;  4PYU A;  1EF1 A;  1LXD A;  2KZR A;  1YN4 A;  4W9L A;  2J53 A;  2IND C;  4X57 B;  1KF6 B;  2MP2 B;  5D6J B;  2RDB C;  1KLU D;  1XLP A;  2IGD A;  4M02 A;  3VR9 B;  1B1Z A;  5BO4 B;  4M8M A;  2OJR A;  4GSW A;  1Y8R C;  3AED B;  4JQW C;  1GB1 A;  1P98 A;  1I4H A;  1FRR A;  4LNF A;  5HFY A;  1C9F A;  5MPO A;  4WH4 A;  1LO5 D;  4LK0 M;  2O2V B;  1KH0 A;  2RMM A;  4RF0 A;  1WZ3 A;  1NI2 A;  3T3O A;  1V9J A;  4USA A;  1U4A A;  2KAJ A;  1RYJ A;  3FKY A;  3AE9 B;  3APD A;  3L4P A;  4GU2 A;  3QC8 B;  5H92 C;  2KN5 A;  1S1Q B;  3A1Q B;  4YTM B;  3UGB B;  3DBS A;  4K7S A;  2MBH A;  1T5X D;  3ZNI D;  2O6V B;  1FNW A;  4W9I A;  1MFW A;  4YWG G;  1R4N B;  3CST A;  4BKT A;  2O6V D;  4ZRJ A;  2E6X A;  4WJQ A;  4RM8 A;  1E7U A;  3I9V 1;  4DHZ B;  1AWD A;  1E5W A;  4M0W B;  1VJK A;  4J6I A;  1L0Y B;  1E6E B;  4ACF A;  4C7Y A;  4B95 A;  1P0R A;  2NBV B;  1F1H A;  5HI1 A;  2JUO A;  1WZ0 A;  1T0R C;  4JL9 A;  3AE7 B;  4IWP A;  2L76 A;  2I1J A;  2BYF A;  2FNJ B;  3PV1 A;  2WXL A;  1I4X A;  1YX5 B;  3ZXR A;  2B76 B;  2X38 A;  1C77 A;  1R7S A;  2YEP B;  4IDI A;  2DAJ A;  4HJG E;  2V4I B;  5G2N A;  3ZUN A;  1FPY A;  1C79 A;  3AM9 A;  4C80 A;  1IPG A;  4TUU A;  2JYE A;  4MGK E;  2BKR B;  2ONQ A;  2AEH A;  3AEC B;  3AEB B;  1N61 A;  3TEX A;  3JSV B;  2Z0E B;  1TKG A;  4NAW A;  1WMH B;  4KVG B;  1E90 A;  2V3P A;  3NVW A;  2KAC A;  1F9J A;  2SEB D;  5GMV A;  4RF1 A;  2W3S A;  1F2R I;  1K8R B;  4OZC A;  1KJT A;  2NTT A;  3AE3 B;  1P7E A;  3VQI A;  1XLO A;  1PFD A;  3QAR A;  2V3N A;  4EZL A;  1ZPS A;  3UQB A;  3VUX A;  2NMQ A;  3H6N A;  3AI5 A;  4FAD A;  3PTF C;  4M00 A;  2IO1 B;  1L0V B;  2BW2 A;  2K3U A;  4HJK A;  4WJO A;  2MJ3 A;  2NBW B;  3P4R B;  2MCN B;  5E6N A;  3PHW B;  1I4G A;  2KDE B;  3TEZ A;  1F77 A;  2C7M B;  5BYS A;  2BYV E;  5AEK B;  2AQ1 B;  4MT5 A;  4S17 A;  3B08 A;  2WGS A;  2N0S B;  3VRA B;  2A5U A;  1GNU A;  2ZVO A;  2NR2 A;  2UU7 A;  4IUM B;  1IGD A;  4FXC A;  3DVG X;  4FLH A;  4EFO A;  2I38 A;  2WXI A;  4DDI D;  4J3O D;  1XCQ L;  3TMP B;  4IWO A;  3RNE C;  3M62 B;  2MBQ A;  2IPK D;  4FBJ B;  4K3C A;  1NI3 A;  1RRB A;  2KOX A;  2OHF A;  4REZ A;  1NDD A;  1L6U A;  3R8B A;  2JZP A;  1FXA A;  4P16 A;  1UH6 A;  1V81 A;  3DHI C;  1IBX B;  2C5L C;  3I3T B;  2LWP A;  3ZRC A;  5IA7 A;  1L6V A;  1WXA A;  5DCN A;  2K9X A;  1N5W A;  1I35 A;  1WX7 A;  2PKO A;  4DHZ E;  4NJ7 A;  2ZJD A;  1T0S C;  3N20 C;  4MSM B;  2KVR A;  3OWE B;  3EGR A;  3MC9 A;  3RFZ B;  2C7H A;  1MPE A;  1V80 A;  2ON8 A;  2I1K A;  1YN3 A;  3TIX A;  1QIL A;  3DHH C;  3DCG A;  4DQO C;  1UBQ A;  3P2B A;  4XZ4 A;  3EUB 2;  3DBL B;  3UIO B;  4EE2 A;  4MEM A;  2EMT A;  1NEN B;  4LCD E;  4LNN A;  4DXG A;  1WE7 A;  1OGW A;  4MAC A;  5D3D A;  3ZRF A;  1WY8 A;  4LNO A;  2RSU A;  5DPR A;  3AE8 B;  3HM6 X;  2BS4 B;  3KUZ A;  1IYF A;  4LTU A;  4I6P A;  2V9H A;  3SHQ A;  4RGM A;  4BOZ B;  3NS1 A;  3W1S A;  4HPM B;  1FMA D;  1V8C A;  5EDS A;  1ZW7 A;  2XEW A;  4OZA A;  3Q2A C;  5AUK A;  5JZE B;  3CWI A;  4NJ6 A;  3EFC A;  2FE8 A;  3APF A;  4RGT A;  2K8H A;  1E7V A;  4TKN A;  4TSS A;  3QX1 A;  3KLS X;  5G5G A;  2JVC A;  1JWU D;  4WWO A;  4MGZ E;  2AWT A;  2LXC A;  5LXH A;  3U7D A;  2KAN A;  2LFI A;  2JSV X;  1DOX A;  2QCZ A;  5LLI A;  2WDV B;  4K1R B;  3AMZ A;  3PZD A;  2KQ7 A;  1IP9 A;  3A9K A;  2EMS A;  4XGA B;  4BFR A;  3SD5 A;  4ICV A;  3B0A A;  2KTF A;  3NVZ A;  1WR6 E;  5C23 A;  4AQ7 A;  2V0G A;  1C4C A;  4LNK A;  1WRD B;  3RCZ A;  4KZC A;  5FR3 A;  5H8Y E;  4TV3 A;  2IGG A;  1E9M A;  3SEB A;  3ONS A;  2MBO A;  3AEG B;  5KHO A;  2ZPN A; 
#chains in the Genus database with same CATH homology
 4WJP A;  3ALB A;  5CX3 A;  2C9W B;  3ECI A;  3VHT C;  2CHZ A;  2HD5 B;  4BKG A;  2NCN A;  1RLF A;  3RZW C;  3JYU A;  2JPH A;  3JVZ X;  3IVF A;  4FJZ A;  5IAA C;  2ZVN A;  3UF8 A;  3D32 A;  3IFW B;  3WA0 A;  2KKC A;  3MJW A;  2KX3 A;  2CR5 A;  2MSE D;  4NAW B;  2Y5B B;  2LVP A;  2YVC A;  1V49 A;  1WGD A;  1XD3 B;  5D7G A;  3A9J B;  4B6W A;  2IO2 B;  2MBE A;  3K9O B;  1VCB A;  2AL6 A;  3ZIM A;  2D3G A;  3LDZ E;  3ZLZ A;  4BKS A;  1OEY A;  5JH5 C;  3H1U A;  1H8C A;  2IZV B;  4ZRK A;  2WWZ A;  2LI5 A;  4IM2 A;  2Z59 B;  3KH0 A;  1Q1O A;  2K6Q A;  1WIA A;  3O65 B;  2M8S A;  2BYE A;  3WIM A;  3DVG Y;  4MM3 A;  3RYT A;  3OJ3 A;  4I6L B;  1J19 A;  2JXX A;  4DBG A;  2BPS A;  2G4D B;  1TGZ B;  3SDL C;  2L0T A;  2D2Q A;  4KZ0 A;  4GOC A;  4M8N A;  2N9X A;  3H7P A;  3ENE A;  4WJN A;  2FCS A;  1YX6 B;  2WYQ A;  4F8C B;  3DQV A;  3GOE A;  1YIW A;  2LXA A;  3Q3F A;  4MDK E;  4MGI E;  3S2A A;  1WH3 A;  2K8B A;  1CMX B;  1UBI A;  4HK2 A;  4PYU A;  2UYZ B;  1EF1 A;  1HE8 A;  1LXD A;  2KZR A;  4W9L A;  3ZO5 B;  1P1A A;  4X57 B;  1L7Y A;  2MP2 B;  3HIZ A;  5D6J B;  2JWZ A;  2CKH B;  1L2N A;  2CHX A;  1R4N I;  4NY0 A;  1MG8 A;  2ZPY A;  2KDF B;  3H7S A;  3NOB A;  4BBN C;  2IO0 B;  3N30 A;  5BO4 B;  3W1S C;  1WFY A;  4M8M A;  2OJR A;  4GSW A;  2KX0 A;  4GGQ A;  1Y8R C;  3IBE A;  3A4S C;  1Z5S B;  4JQW C;  2JZ3 B;  4F7Z A;  3RT3 B;  1P98 A;  3EEC A;  4MGY E;  1WXM A;  2J0J A;  1WGY A;  2REX A;  2V3S A;  5JHA A;  1KOT A;  2N7E A;  3PRP B;  2O2V B;  2KQS A;  4RMA A;  1IP9 A;  3V62 A;  2DZJ A;  4ZRI A;  1BT0 A;  2LAS A;  3R3M A;  3VH3 B;  2ZZP B;  1UGM A;  1WZ3 A;  2LGY A;  1M94 A;  2KTR B;  2L05 A;  2ZCC A;  1NI2 A;  3VUW A;  2DYO A;  3KW5 B;  2KFK A;  1TTN A;  1V9J A;  4KV2 A;  4N9F 4;  3VFK A;  1U4A A;  3NZS A;  4E71 A;  2D11 A;  4RM9 A;  1UD7 A;  1FXT B;  2DYM A;  1UZX B;  2OOB B;  3APD A;  3IG3 A;  3HHM A;  2KHW B;  4FHK A;  2FAZ A;  4GU2 A;  3U30 A;  1PQS A;  1YJ1 A;  4GDK A;  3PT2 B;  3VUY A;  3QC8 B;  4JGH B;  2NPT B;  2K1F A;  3UIP B;  2BKF A;  2KN5 A;  2GBR A;  2L7R A;  2FCQ A;  1S1Q B;  5G55 A;  1Z2M A;  3A1Q B;  1E8Z A;  3DPD A;  2KJR A;  4DXA B;  3H9D A;  3UGB B;  2WDT B;  3DBS A;  1WR1 A;  4K7S A;  2MBH A;  3L10 B;  4GDL B;  3DDC B;  2LUE A;  3R66 C;  3ZVV A;  4BBN F;  3ZNI D;  2O6V B;  3QA8 A;  4W9I A;  4NNJ B;  4ICU A;  2CU1 A;  1AAR A;  4LDT B;  3L54 A;  2FID A;  3VTV A;  3CST A;  4BKT A;  3ML9 A;  3DOW A;  4DWF A;  4E74 A;  4GXB A;  2O6V D;  1LQB A;  1WJ6 A;  4ZRJ A;  2GOW A;  4WJQ A;  2XK5 B;  4RM8 A;  1E7U A;  5JHB A;  2IY1 B;  2LRU A;  2HJ8 A;  3DBL I;  4DHZ B;  2ZEQ A;  1RAX A;  5AZG A;  1E5W A;  2RD0 A;  3AUL A;  4F1S A;  3DVN U;  3L08 A;  4M0W B;  2GBK A;  2PPH A;  4J6I A;  4MH0 E;  3IHP C;  2M4N A;  2M17 A;  1I42 A;  4EKU A;  4B95 A;  1P0R A;  1JRU A;  2KC1 A;  2JRH A;  2NBV B;  1EF5 A;  3ML8 A;  4FJY A;  3ZTD A;  2JUO A;  1WZ0 A;  2GMI C;  4JL9 A;  2NBU A;  4G11 A;  3V61 A;  1V5O A;  4CYE A;  4G3X B;  2L76 A;  2I1J A;  2JF5 A;  4IWP A;  1V6E A;  4W9C A;  3ZNH B;  2BYF A;  2FNJ B;  4PYZ A;  3PV1 A;  5AZH A;  3EHV A;  4KIK A;  2DX5 B;  4DHJ B;  1YX5 B;  4IWQ A;  5TR5 A;  3UQA A;  2BGF A;  3R7R A;  3C0R B;  4MJS B;  3AU4 A;  3QK0 A;  4TQ1 A;  4A3O A;  3APC A;  5J17 A;  4WWP A;  1J0G A;  5L83 A;  4LJO B;  4MEL A;  3ZW3 A;  2FUH B;  4DHJ D;  1V5T A;  1H4R A;  1WJ4 A;  3B1L X;  1WM2 A;  2DAJ A;  1WJN A;  2NS5 A;  5G2N A;  1SGH A;  3ZUN A;  1EUV B;  2C60 A;  1IPG A;  3K9P B;  4TUU A;  4MGK E;  2UWQ A;  2BKR B;  2DZK A;  2AEH A;  3JW0 X;  4HDO A;  4HXD A;  3VAW A;  2MW5 A;  5E6P A;  1G6J A;  3JSV B;  3KVF B;  1WX9 A;  5J2R A;  2Z0E B;  2VRR B;  2KMC A;  1EO6 A;  4NAW A;  4W9J A;  3CMM B;  4JLC A;  1QZE A;  2M1M A;  1WMH B;  4KVG B;  1E90 A;  2KD0 A;  3A9J A;  4AP4 C;  2IO3 B;  5DPW A;  1F9J A;  2L3Z A;  3ZDM C;  5GMV A;  2IYD B;  3QAQ A;  1J8C A;  3AU5 A;  1K8R B;  2DYB A;  4W9E A;  1KJT A;  1WGG A;  2LZ6 A;  2D10 A;  3AXC A;  2MA9 B;  3HK0 A;  4G0N B;  4II3 B;  4FA6 A;  1WYW B;  2ZNV C;  3VQI A;  2NVU I;  2KLG A;  3PRE A;  3BIN A;  3QAR A;  2K25 A;  4IW0 A;  4EZJ A;  4EZL A;  2CHW A;  2L0F A;  1ISN A;  4YL8 A;  1WXS A;  2GBJ A;  3UQB A;  3VUX A;  5C1Z A;  1D3Z A;  1RFA A;  4KSK C;  3PS6 A;  3X0W A;  3Q3J A;  3H6N A;  2B3A A;  3AI5 A;  4FAD A;  5CHV C;  2GBN A;  4W9G A;  2DZM A;  1VD2 A;  3PTF C;  3U8Z A;  2IO1 B;  2K39 A;  2YLM A;  4WJO A;  5AZF A;  4HJK A;  4FHJ A;  2DZI A;  1V86 A;  2FCN A;  2MBB B;  2NBW B;  3PRM B;  3ZDT A;  4HLE A;  2MCN B;  4IM3 A;  5E6N A;  2MP2 A;  3PHW B;  3QJZ A;  1UEL A;  3L13 A;  2KDE B;  2LVO A;  3RUI B;  4P7I A;  3DBH I;  4OVV A;  2KDI A;  2C7M B;  3NZU A;  4AUQ C;  2BYV E;  3PPA A;  1Q0W B;  2KO3 A;  1WGH A;  1YD8 U;  4W9K A;  3VXW A;  5AEK B;  3KUD B;  4OVU A;  3B08 A;  2KWU B;  3WAM A;  4ANW A;  2KC2 A;  3A9K B;  1C3T A;  2A5U A;  1GNU A;  2ZVO A;  2NR2 A;  1LM8 B;  2O2V A;  3PLV A;  4IUM B;  2J7Q B;  4URK A;  2WX1 A;  4KDL B;  4BOS C;  3DVG X;  3SU8 X;  1WXV A;  2N9P C;  2KTR A;  2N7D A;  4FLH A;  3RUL A;  3VVW B;  4EFO A;  4ZYN A;  3WAO A;  5D2M B;  2LGX A;  1OQY A;  4MSQ B;  2N1V A;  2V1Y A;  3RZF A;  4DDI D;  3NS8 A;  3VH4 B;  3RD2 A;  3TMP B;  4IWO A;  3M62 B;  2PEA A;  1GUA B;  1OTR B;  4E3C A;  4IC7 B;  2FCM A;  2MBQ A;  4EUT A;  2JRI B;  2R2O A;  3MHS D;  2NPT A;  4FBJ B;  3OJ4 B;  3TJP A;  2K8C A;  3L17 A;  3TL5 A;  4CO7 A;  1RRB A;  2KOX A;  4FJV B;  2XBB C;  3A1Q A;  4XC2 A;  1C1Y B;  4GB9 A;  1Q5W B;  2G4S A;  4WWN A;  1NDD A;  1WJU A;  3WAP A;  4FN2 A;  4GDL A;  4TQ0 A;  1T0Y A;  2JY6 A;  3QCA A;  2N9E B;  5DPS A;  3QHT A;  3WAL A;  2O6V A;  2HE7 A;  2KWC A;  3V6E B;  2QHO A;  3OAW A;  4K81 A;  2PJH A;  2FIF A;  2RR9 A;  3VTW A;  2N4F A;  1UH6 A;  1V81 A;  2N1W A;  5D94 A;  5E6O A;  4DK5 A;  2IY0 B;  4ASW C;  2XK5 A;  4FUL A;  3PHX B;  4LJP B;  1XQQ A;  2C5L C;  3I3T B;  2LWP A;  1WE6 A;  3MTN B;  3ZKJ C;  3ZRC A;  5IA7 A;  2L8J A;  2KJH B;  4K7U A;  3KUC B;  4ANV A;  1XT9 B;  2BWE S;  1WXA A;  5DCN A;  4BKS D;  1I35 A;  1WX7 A;  2C7N B;  2KLC A;  2AL3 A;  4DHZ E;  3T8M A;  2AYO B;  4XX5 A;  4NJ7 A;  2ZJD A;  3M95 A;  1V2Y A;  3H7P B;  4MSM B;  2KVR A;  3BY4 B;  3UIN B;  3OLM D;  3CSF A;  1E8X A;  1TBE A;  4NQL B;  2K6D B;  3A33 B;  3V60 A;  4PS7 A;  2C7H A;  4IG7 B;  3M63 B;  2BF8 B;  3DVN V;  4I6N B;  1V80 A;  4MJS A;  2I1K A;  3TIX A;  2G3Q B;  4NQK E;  4W9F A;  1P3Q U;  3DCG A;  2RGF A;  1UBQ A;  1KM7 A;  2MLB A;  3P2B A;  4XZ4 A;  2MWS B;  1E8W A;  2ZNV B;  3UIO B;  2MQJ A;  1NBF C;  4WQO B;  3L0W B;  2KFJ A;  3NY5 A;  4HCN B;  2IBI B;  2R2Q A;  4MEM A;  2PE9 A;  3PGE A;  4HPL B;  2EMT A;  2EKE C;  3M3J A;  4LCD E;  5J18 A;  3JSV A;  5DPT A;  4AJY B;  1WE7 A;  1X1M A;  4NPN A;  3ZNZ B;  5FR6 A;  1OGW A;  2M0X A;  1SIF A;  1WMH A;  2J0K A;  2A4Z A;  2W9N A;  3VTU A;  3ZRF A;  1WY8 A;  3TBL D;  4A20 A;  5KHQ A;  2Z0D B;  5CHF A;  2DAF A;  2RSU A;  4JIO U;  5DPR A;  3NHE B;  1A5R A;  2CS4 A;  2WX0 A;  1TZ1 A;  1ZGU B;  3N32 A;  3QWZ B;  1ZKH A;  3HM6 X;  3KUZ A;  4WAA A;  1IYF A;  3EC8 A;  5L95 C;  2KK8 A;  3CF6 E;  4I6P A;  5CHW A;  3SHQ A;  2D07 B;  1GJZ A;  4BOZ B;  1S3S G;  4BVU C;  3W1S A;  3PLU A;  2KFK B;  4HPM B;  2V4L A;  2LJ5 A;  4GIV A;  2PE6 B;  3V6C B;  4W9H A;  4KSL C;  4AJW A;  2RPQ A;  2DHZ A;  2LVQ A;  4CHK A;  5EDS A;  1ZW7 A;  2XEW A;  1E8Y A;  2J0M A;  3VDZ A;  2L00 B;  4GDK B;  3LJ3 A;  5JZE B;  4NJ6 A;  3W1Y A;  2MRP A;  3WAN A;  4G50 A;  4PS3 A;  4EZK A;  3APF A;  3A4R A;  4GN1 A;  2K8H A;  2KXJ A;  1E7V A;  2LD9 A;  3GZN I;  3KYD D;  4A3P A;  1KLV A;  4TKN A;  4W9D A;  3ZTC A;  4IM0 A;  5HKH A;  3QX1 A;  3PSE B;  1GC7 A;  4EOY A;  3TCA A;  1WI0 A;  4B9K A;  4HVB A;  1GC6 A;  2JVC A;  2KWV B;  2G45 B;  2KDB A;  3N3K B;  4HCP B;  3HM3 A;  4MGZ E;  1P9D U;  2AWT A;  4WWO A;  2LXC A;  3X23 A;  5LXH A;  1WM3 A;  3L16 A;  3U7D A;  2KAN A;  3T9L A;  2KJ6 A;  3DBR I;  1OEY J;  4II2 B;  4K7W A;  5LLI A;  5LXI B;  4DDG D;  4K1R B;  1YQB A;  3QQ8 B;  4GMV A;  3PZD A;  3KYC D;  2KQ7 A;  2HTH A;  4EEW A;  2DEN B;  2EMS A;  3A9K A;  4PS8 A;  4ANX A;  3SD5 A;  4BFR A;  4ICV A;  3B0A A;  1SE9 A;  4HWI B;  2KNB A;  4AOF A;  2KTF A;  3PVL A;  1R4M I;  1WX8 A;  3ZNG C;  1WR6 E;  3PRZ A;  5C23 A;  2JZZ A;  1WF9 A;  2LRW A;  4AWJ A;  3QIJ A;  4KDI C;  1GG3 A;  2BWF A;  1WRD B;  3EFU A;  3RCZ A;  4KZC A;  4ZDV A;  4TV3 A;  2LGD A;  1WGR A;  2ASQ A;  3ONS A;  2JT4 B;  2MBO A;  4HDQ A;  5KHO A;  4ANU A;  2ZCB A;  5CTR C;  1LFD A;  2ZPN A;  2KMA A;  4LDT D;  4KIK B;  3R7Q A;  2MX2 A;  2GBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...