4YXDB

Crystal structure of porcine heart mitochondrial complex ii bound with flutolanil
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 60
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4yxdB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4yxdB01
1GAQB 1PFDA 2N0SB 1XLQA 5C3JB 1YJJA 3B9JA 2WQYB 5EE9A 3P4RB 4YTNB 1GTHA 2JQRB 1PUTA 1XLNA 4C80A 3NVYA 3BIID 1N5WA 4IDIA 1N61A 3HVZA 1ZP0B 3AN1A 1CJEA 1DGJA 1H7XA 1L0VB 3AE9B 1FFVA 1JWBD 2DBYA 4N59A 1GT8A 2MH7A 1PDXA 2OHFA 1AYFA 4YTMB 1T3QA 4WQMA 1H7WA 4LTUA 1NEKB 2ACZB 3AMZA 1E0ZA 3DWMA 2PVOD 3ZYYX 1FRRA 2M19A 5H92C 1N62A 3B2GA 1QOFA 4HROA 1YQ3B 2LEKA 2HTME 3B2FA 2DWQA 2WDQB 1SB3C 3P4QB 3AE8B 2BS2B 5H8YE 4USAA 2KAJA 1FMAD 3RPFC 1WWTA 2B76B 1JALA 2K9XA 3PO0A 3P63A 4WWMA 1FIQA 3CF4A 5C2TB 1N63A 1GPXA 1XLOA 1RFKA 3AM9A 3EUB2 2W55A 5G5HA 3AE3B 4N58A 1QOGA 4US9A 3KWLA 2W3SA 2W54A 3DWGC 3VR9B 1VJKA 1WYGA 3AV8A 4A9AA 1WRIA 2K22A 3L4PA 4C7YA 4ZHOA 3P4PB 1WGKA 1I7HA 1TKGA 2K5PA 2W3RA 3NS1A 2E3TA 3ABVB 4P6VF 3W5VB 3NVVA 1E7PB 1VLBA 1DOYA 1TKYA 4JWUC 2FBWB 3NVWA 1GTEA 1N60A 1JW9D 1L6UA 1JRPA 1QLBB 1YJIA 1J7BA 4YSZB 1AWDA 1ZOYB 2QJLA 4JWSC 4ZHPA 3AEEB 1TYGB 5AUKA 1NVID 3SFDB 1IUEA 1TKEA 2WP9B 2CJOA 4ZOHC 1V97A 4FXCA 5G5GA 1CZPA 2WU5B 1FXIA 5GXGB 1V8CA 3NRZA 3NVZA 2WU2B 2Q5WD 2BS3B 3LXFA 3VR8B 3W5UB 4C7ZA 1L5PA 1J7CA 3VRAB 1OQQA 1ROEA 1QF6A 4YSYB 1RM6C 1A70A 3AEDB 1NI3A 1ZXIA 2QIEB 1E10A 1FO4A 2H89B 1N5XA 1F0ZA 2CJNA 4N6EB 3VRBB 2PKOA 3AB5A 4YXDB 1OFFA 1TJEA 1QOBA 1DOXA 4US8A 1QOAA 2BT6A 5EE1A 1FRDA 3P4SB 1JROA 3AECB 2L52A 2PVGC 5AUIA 2BS4B 1KFYB 2WS3B 2MJEA 4KX6B 2AX5A 2WLBA 4YT0B 1XLPA 1RYJA 2G1EA 1NYQA 2EKIA 2H88B 1NENB 3ETRA 4HRSA 1XO3A 1DOIA 3HUIA 5EE3A 1B9RA 2JX5A 3SR6A 1UWMA 3AE1B 1L6VA 3AEBB 1SF0A 2MJ3A 1FM0D 1R7SA 1KRHA 3AE6B 2M56B 1E9MA 1JWAD 1VDVA 3AEGB 3AEFB 3FAHA 2WDRB 3AE5B 1RWSA 3LB8C 1KF6B 1J7AA 3P1MA 3CIRB 1NYRA 1WXQA 1SIJA 3AE2B 3AEAB 1YQ4B 3FC4A 3W9CB 5EE0A 2L83A 2PIAA 3HRDD 1JQ4A 4YTPB 1E6EB 2KMMA 3AE7B 4ITKA 3AE4B 1FFUA 3CWIA 4YSXB 3WCQA 1OQRA 1FXAA 2MJDA 4JX1C 2WDVB 2CU3A 5MPOA 3AH7A 1EWYC 2Y5CA 1ZUD2 3SFEB 1QT9A
chains in the Genus database with same CATH superfamily
2CKHB 4AWJA 3K9OB 1M94A 5EE9A 2JQRB 3DHGC 3SD5A 2DHZA 4QAYA 1YN5A 4RF1A 4BFRA 2MH7A 3ZNZB 1K51A 1TS2A 2MA9B 4TUUA 1D4BA 1E0ZA 4AUQC 3H7PA 1FRRA 1N62A 1I4HA 4EKUA 1XF5L 5H8YE 4USAA 1ET6A 2L00B 2ONQA 2IO1B 4N58A 3ZXRA 3AV8A 4ZHOA 1L4DB 3P4PB 4A6QA 3ABVB 2YEPF 2MRPA 2QILA 2J0JA 1WXAA 4BOZB 1TKEA 1LFDA 2NBVB 3CSFA 4DWFA 3BY4B 4RCOA 4ZRQA 4EEWA 2K8BA 4OVVA 3BVMA 1ZE3D 3NJTA 4YXDB 1TJEA 1TS5A 3BYYB 2MWSB 2JSVX 5AUIA 3VQIA 3EA6A 3ZTDA 1YN3A 2L7RA 4EOYA 2GRIA 5FK9C 2NPTB 2KX0A 2INNE 5DPRA 1E90A 2RPQA 3Q3MC 2KD0A 3EGRA 5I4DA 1WXQA 2J4XA 3IAM1 1ZDXA 1XCTL 4YTPB 1E6EB 1FCCC 2LMCA 4ITKA 2XEWA 2KC1A 4KKJA 3Q8EA 2C5LC 3VVWB 3Q3NC 4GIVA 3Q8AA 4S0RA 1JMLA 2KJ6A 2R61A 4ARIA 4KV2A 3NVYA 4W9KA 2BTEA 4IDIA 4RF0A 3WALA 1CJEA 4N59A 4M00A 2W82A 1IGCA 2IY0B 2KN4A 2NTTA 2LRWA 3ZDMC 4M8NA 3PT2B 3ZYYX 2KVZA 1YMHE 3M62B 1GOZA 4LJOB 1MJDA 4RFBA 1ISNA 2INDC 2NMQA 3QX1A 3PLUA 2MP2B 3BYTB 2J7QB 1EM7A 1K50A 1B1ZA 4US9A 3H1UA 3TEZA 4JLCA 4FBJB 1V9JA 1LO5D 2D2QA 2XN9C 4K7WA 4LNFA 2JVCA 1VZ8A 4FN2A 2EELA 1T0SC 1RRBA 3Q3FA 1N60A 2WXFA 2RDBC 4GDLB 2O2VB 2KLCA 4M01A 4EUTA 3AEDB 1I4QA 2GMIC 3A9KB 1F0ZA 1GJZA 3S2AA 4NZLB 3RI7C 4GGQA 1UNSA 3P2BA 5IKCM 1SJHD 2LGSA 3Q8FA 4ASWC 3ONSA 4C4VB 2EKIA 3EHVA 4I6NB 3EFCA 3HUIA 4FHKA 1C76A 1WZ0A 4OVUA 2LGIA 1SE2A 4MM3B 3K9PB 1MG4A 4TMAB 1E9MA 3AEFB 2X38A 3AE5B 3KH0A 4A3OA 4DK5A 1V81A 2N9XA 2N9PC 5FR6A 2IJ0A 4NJCA 1SSNA 5BMHA 4LDTB 3RNFC 4FJYA 5MPOA 2D3CA 2Y5CA 4DHZB 1GAQB 2K8HA 3C8YA 3QWZB 2K3UA 4FLHA 5AZGA 1MHXA 4M02A 1UBQA 1WR6E 1GTHA 4URKA 1PUTA 5IA7A 2FCNA 3NZUA 1ZP0B 4OZBA 4KGRA 3EFUA 2BF8B 4MJSA 4YTMB 1T3QA 1WM2A 3AXCA 2WXQA 1UZXB 4BAXA 4HPMB 1OQYA 3B2FA 2M8SA 3Q2AC 4FULA 4K3CA 4IWQA 2JPHA 5G55A 2M4NA 3P63A 1KOTA 3UQAA 5G5HA 1WIAA 2LFIA 5GMVA 4LNNA 2K22A 2KWUB 1KH0A 2SAKA 4HJGE 2JXXA 4HDOA 1YNTE 2KWVB 2FUHB 1J7BA 1ENFA 4A8XC 1WXSA 3SFDB 4E71A 1ZXHA 1D6EC 4HVBA 3R7QA 2WU2B 4C7ZA 3V05A 1D5XC 4KSLC 5HHDG 2HJ8A 4HEA1 1CK1A 1PQSA 2RGFA 3BINA 3VTWA 1MI0A 2O6VB 1GUAB 2DX5B 4II2B 1P7EA 1XLPA 3PHWB 4PK1A 4NNJB 3T9LA 2M17A 2LVPA 1KRHA 3AE6B 4IM2A 1C78A 3Q8BA 3AEGB 3FAHA 3DBRB 1P9DU 3P1MA 1ZPSA 4HXDA 4BZAA 2WXKA 4BKSD 3V6EB 2ZNVB 3AEAB 4RM9A 4ANUA 4OZCA 3KQ4A 2WDVB 3HHMA 4NAWB 3HK0A 3H9DA 2KN5A 4M8MA 5IP4D 5HFYA 3ENEA 3RULA 3HIZA 3N3KB 1OEYA 1U4AA 1N61A 1Q0WB 2N9EB 3TEWA 1NBFC 4WQOB 2WXIA 2DBYA 3N1ZC 4RH6A 3PRMB 2IYDB 3ZKJC 2EMTA 1UELA 2D3BA 1MFWA 3M63B 3ML8A 4HROA 2JF5A 2NPTA 1EU4A 3QQ8B 1ZKHA 3EC8A 2CS4A 1WWTA 3PO0A 1VZ7A 2KANA 1N63A 4OHJA 5DPWA 1QILA 4EZLA 2WYQA 4W9CA 3TCAA 4A9AA 1ZW7A 4ICUA 1I7HA 1WMHB 4WWOA 2DNFA 4CQNA 3D32A 2BKFA 1F1HA 3T3OA 3T8MA 4ZHPA 1P7FA 4HLEA 3RN9C 2BYEA 3WAMA 2G3QB 3ZRFA 1F52A 3W5UB 2WXGA 1UD7A 1E10A 1FCLA 1AW7A 2AEHA 2A4ZA 3HM3A 2PKOA 3NZSA 1DOXA 4P1CC 4NPNA 2MEKA 4PT5A 2INCC 3W1YA 3JYUA 2J0MA 4LNIA 1R7SA 3DBHB 2KHWB 3ZIMA 3JW0X 3I63C 1GB4A 3A1QB 1STEA 1NYRA 3WAPA 3AE2B 2AQ3B 4BBNC 4GDLA 1OQRA 4TQ1A 4DHZE 3IT4B 3ZNHB 4E74A 2KQSA 3A9KA 3IHPC 4WJPA 3UIOB 3P4RB 2RPVA 2BW2A 2L3ZA 2GBMA 3LYYA 2MW5A 3AE9B 1C1YB 3ZJVA 1D3ZA 2MCNB 1VCBA 2ZZPB 4C4VA 2NR2A 3FKYA 1NEKB 2XBBC 2UYZB 4MM3A 4W9JA 5C1ZA 4WJNA 1JALA 3UI3A 3KVFB 2OOBB 3MFGA 2V0GA 3NG0A 5IOIA 3UIPB 2KACA 2KDEB 1WXVA 2K5PA 1QKZA 2NS5A 1TKYA 1M4VA 4MSQB 1Q10A 1ESFA 2BYTA 4FXCA 3MTNB 5IAAC 2JT4B 1ROEA 3N20C 4CHKA 1I4PA 1N5XA 4ARCA 1YX5B 4W9EA 1RLFA 4IWOA 3ZXVA 1KFYB 3W2DA 2MJEA 4NQKE 2OJRA 4YT0B 1XO3A 2MBEA 2LHDA 3AEBB 3APCA 4XX5A 1KJTA 3H6NA 1L2NA 3ZDTA 3DCGA 4XZ4A 2GBRA 3DBHI 4FJZA 3LB8C 2GBJA 1WGDA 2CU1A 4MELA 2QHOA 1T5XD 3AE4B 3PRZA 2BVCA 2MJDA 4L1BA 1S1QB 2N0SB 4PS3A 2HD5B 2L0FA 4S17A 4RMAA 3Q69A 4C80A 4MEMA 1HA5A 4DXGA 4GSWA 1GT8A 2JY6A 1TZOA 3VUXA 3RT3B 2K25A 4LTUA 3PZ7A 2M19A 4BVUC 4L2YA 1SB3C 3P4QB 1PGBA 3AE8B 1XT9B 2JRHA 3DDCB 4KGSA 2AQ1B 2WNMA 1L0XB 3AE3B 2N7DA 4MGKE 3DWGC 2KT7A 5HG2A 4EZJA 3R2IA 1GNUA 2FIFA 2PMVA 4DDID 1E5WA 4NAWA 3PRPB 3VUWA 1EO6A 1IPGA 1VLBA 2KQ7A 1JW9D 4D2KA 3OJ3A 1TYGB 5G5GA 1T6BX 4HDQA 1FD6A 4GOCA 3TEXA 1BT0A 1Y56A 3PZ8A 4DQOC 3VH3B 1WFYA 1LXDA 2MBHA 1ZXIA 3AULA 1TBEA 1QOBA 2MHJA 3R8BA 3VDZA 2DAJA 3O13A 1NENB 4HRSA 4A3PA 2QC8A 1VRAB 1J8CA 1UUPA 3U4EG 5DCNA 4FHJA 2MJ3A 2NBUA 2FCSA 4E3CA 2ICIA 1IYFA 4K7SA 2KDFB 3PVLA 3BVZA 1T0RC 2CU3A 2BWFA 4US8A 1WJNA 2FCQA 1YJJA 2BB6A 1YN4A 5KHOA 4DHJD 2RDGA 3JVZX 3I9V1 3P42A 5TR5A 3UGBB 1XCQL 2LWPA 2D3GA 3N9YC 3APDA 2BB5A 2VH1A 3RYTA 4ZYSA 1V5TA 5JHBA 3VTUA 4II3B 3MJWA 5JXVA 4ZRJA 3RZWC 4TKNA 4WWPA 4AJWA 1T0QC 4HK2A 1SE3A 2ZCBA 3A1QA 3CF4A 5EDSA 2PPHA 1AN8A 1HZ6A 5BMIA 4B9KA 4GB9A 1D5ZC 1WRIA 3GP7A 3BK2A 3W1SA 1ACCA 3PHXB 1C9FA 3QC8B 3U52E 2KTFA 1ET9A 3TL5A 2FBWB 1S3SG 2L0TA 2KOXA 3W1SC 1ZOYB 3GE8C 1KM7A 3AEEB 2QDFA 2GLSA 4ZRIA 2DZMA 2KWCA 3NS8A 4DBGA 1WGGA 3NRZA 2C7NB 2J53A 1P3QU 3PV1A 5D2MB 1A70A 1FO4A 1SE4A 1WR1A 4C00A 4ACFA 5EE1A 1JROA 2IGGA 2SEBD 3RMKC 1WYWB 3RFZB 2I2YA 1YJ1A 5T8IA 1V6EA 2IPKD 2AYOB 3LJ3A 4PYZA 3NUHB 4H2AA 4WJQA 2Y5BB 1IP9A 3ZTCA 1WJ4A 3N30A 2KFKB 2N1VA 3A33B 5BYQA 1SIJA 3N1YC 3NZ3A 2N1WA 3FC4A 2TSSA 1H4RA 2KMMA 1FFUA 4JX1C 4B95A 3AH7A 3AMZA 3VH4B 3KLSX 2ZCCA 4JL9A 5C3JB 3B9JA 2KDBA 4YTNB 3ZQ4A 1F2RI 1EWCA 3QIJA 2LXAA 2WWZA 1DGJA 2JWUA 1L0VB 1SE9A 2LXCA 3H7SA 1FNWA 2DZJA 4HKZE 1I35A 5J2RA 3SEBA 2JZZA 2PTLA 3UINB 2LUEA 2IZVB 2K1FA 1FMAD 2JZ3B 3KUCB 2MBQA 1C4PA 4WWMA 1FIQA 3DHIC 5DPTA 2DAFA 4FJVB 1SIFA 1JRUA 1WGKA 2OEDA 4OZAA 3X23A 2E3TA 2EMSA 2LVQA 1WX7A 1R4MB 3NVWA 1WH3A 3WA0A 1TTNA 3T3NA 5GXGB 4ICVA 3IBEA 2VRRB 1L5PA 3VRAB 4WAAA 2KDIA 2C7HA 3AB5A 1L7YA 1HXYD 2PVGC 3TBLD 3AECB 2I1JA 2J52A 2AX5A 2PJHA 5LXHA 2Z0EB 2V3SA 3IXSA 1TY2A 3TIXA 4K1RB 3OJ4B 4PYUA 3NY5A 1X1MA 3MC9A 1YOVB 4IG7B 3CIRB 2R2QA 1Q5WB 2WXJA 4GXBA 2BKRB 3CWIA 3RNGC 3ML9A 2LJIA 4REZA 3IT6B 2FNJB 2K0PA 2MSED 4XYCA 1V1OA 1V1PB 3KYDD 4PS7A 1V80A 2FAZA 2MQJA 2RDHA 4LCDE 3ECIA 2VZKD 1P1AA 1V49A 3AN1A 2JZPA 1KLGD 2KO3A 1AYFA 5D6JB 2PE6B 2KFJA 4IM0A 1V5OA 2HTME 5BYSA 3ZNID 2KAJA 3RPFC 2L05A 2B3AA 2K9XA 1N6ZA 1XD3B 5C2TB 3X0WA 2N7EA 1QOGA 3ZGZA 4HJKA 3KWLA 4JGHB 2LD9A 1VJKA 2YLMA 3RNCC 1OTRB 3PREA 2INPE 3OAWA 2WHIA 4WH4A 1FEHA 4B6WA 1QF6A 2NBWB 1AWDA 2MX2A 1R4MI 2DZKA 2WP9B 2XK5B 4HKQA 1F2RC 2J42A 4F1SA 2G45B 4YSYB 2Z8LA 1NI3A 4A20A 1E8WA 5L95C 4J3OD 4OW0A 1YX6B 4G50A 1P98A 5E6NA 5DPSA 3ETRA 4ANWA 2GB1A 4Q2JA 1VDVA 5AZHA 1UBIA 5J18A 2RD0A 1RWSA 2AWTA 3JSVB 2LUMA 5C23A 4KIKB 2N4FA 4ZRKA 3W9CB 3ZO5B 2KYWA 3APFA 3U8ZA 3DBSA 1F9JA 4KVGB 2JXTA 2MP2A 2C7MB 2WX1A 4NJ6A 1PFDA 1Q1OA 3RNEC 1XLNA 4WJOA 5LLIA 3I57A 1FNVA 2DYOA 4K3BA 1SBBB 4MDKE 2IO0B 2MLBA 4IC7B 5LNK1 4DXAB 3BZDB 2CR5A 3Q3OC 2LEKA 2O2VA 2DWQA 2C60A 2CHZA 4AOFA 4J6IA 4ZRPA 1YD8U 4W9HA 4N9F4 3V60A 3V3XA 3AM9A 3ALBA 2K6QA 5CHWA 3CMMB 5FR3A 3DVGX 1GC6A 4XGAB 5E6PA 1C4AA 3WIMA 2KMAA 2W3RA 1TKGA 3NS1A 4HWIB 3W5VB 4BKSA 2ZEQA 5BYRA 1WGHA 1WX8A 3NVVA 3RD2A 3MHSD 1JRPA 3IG3A 2JUOA 5BMGA 4ZOHC 1AARA 2D5GA 2M0XA 4JIOU 2WGSA 4W9LA 2YVCA 1UH6A 3Q8CA 5HKHA 4MGZE 1J7CA 4XWWA 2JU6X 2BWES 1TS4A 4F8CB 3U30A 3B08A 3VRBB 2BT6A 2KXJA 3RNBC 3NOBA 3ZW3A 5CHVC 3KWVA 2WXRA 2LGDA 3DVNU 1CQVA 1PGAA 1C79A 3L08A 2JX5A 1UGMA 3SR6A 4K7UA 3AE1B 1SF0A 2WXPA 2GBKA 1FM0D 3B1LX 3E56A 1JWMD 2PEAA 2KNBA 4IM3A 2LI5A 1XEEA 2KJRA 4BKTA 3TUOA 3ZJTA 3MJ5A 4R3DA 3I3TB 3DPDA 4JE3B 4C56C 3VFKA 1SEBD 3R2TA 4KGTA 1WF9A 2QMTA 2QCZA 3TJPA 2BQQA 1PDXA 2BYVE 4DHJB 1NDDA 5G2NA 4ANXA 2LRUA 3U7DA 2PE9A 3NHEB 2AQ2B 3L10B 4WWNA 1L4ZB 4AQ7A 1JWUD 1XLOA 1H8CA 4XWTA 1WJUA 4BKGA 2I38A 2O6VA 2J0KA 5CX3A 4IOIE 3O65B 1V1PA 3URYA 2BBCA 4MJSB 1I4XA 1YJIA 1B9RA 1E7VA 1HQRD 2E6XA 3R7RA 3VXWA 3J9CA 1V8CA 4G3XB 2KWDA 4MT5A 1WY8A 2MBBB 1WX9A 1BXTA 3PSEB 2QSDA 4ZDVA 1JCKB 2K6DB 2ZNVC 2BS4B 2RSUA 1TT5B 3C19A 5AZFA 1YIWA 3OLMD 3ZLZA 4XDDA 3V61A 4GDKB 1TIFA 2IBIB 2DLBA 2HTHA 1K8RB 1QZEA 1YQ4B 3MP9A 2XK5A 1JQ4A 2LVOA 1TGZB 2WXLA 3CSTA 3GOEA 4HPLB 2L32A 3E9SA 4IUMB 4GMVA 3EUB2 2DENB 1XLQA 3TEYA 2WQYB 2WDTB 2QEJC 4OVZA 3AU4A 2UWQA 1K52A 1IGDA 1WMHA 1Z5SB 1H7XA 1JWBD 4RGMA 5IO9A 5J17A 1J19A 3QHTA 5H92C 1MHHE 1XQQA 4GN1A 1YQ3B 3MHZA 2N7JA 2R2OA 2WDQB 2BS2B 3A4SC 2G4DB 4WAFA 3C0RB 3DVGY 3JSVA 3QK0A 4KIKA 2IGDA 3BVGA 3R66C 1A5RA 3TSSA 2DYMA 3L4PA 4EFOA 5L83A 4MH8A 1V2YA 4MGYE 4O1NA 3KYCD 1HZ5A 2PW9A 2QJLA 1QLBB 3IVFA 4YSZB 2EKEC 5AUKA 2CJOA 2JWZA 4NAMA 4LK0M 2KKCA 5JH5C 2WU5B 1FXIA 1WJ6A 3NVZA 2K39A 3GS2A 3MC0B 2D07B 4M0WB 3BK1A 4N6EB 3KUDB 2KDMA 4AP4C 2C9WB 4XC2A 2LHEA 4P16A 4FA6A 1NYQA 5D94A 3V6CB 1DOIA 1G6JA 1L6VA 3TMPB 2LJ5A 1JWAD 3QARA 2ZW0A 1VR9A 1KF6B 4HPPA 2ZVOA 1I42A 4YSXB 2REXA 1FXAA 3AI5A 4G0NB 3SFEB 3M95A 4KDLB 1E8XA 1ZGUB 3A9JB 4NJ7A 3I5JC 4ANVA 2Z0DB 5HI1A 1YQBA 3BIID 2FIDA 2NTSA 2D10A 5TSSA 1DYQA 1MPEA 2ZJDA 4WQMA 4AJYB 2ACZB 2PVOD 2VZKB 5JZEB 2GOWA 1VD2A 4MACA 1WXMA 2B76B 2WXOA 4CYEA 4KDIC 2W55A 3U7ZA 5FKAC 4P7IA 2W54A 3VR9B 2AL6A 1E8ZA 3U2SC 1WM3A 2KX3A 4DDGD 2I1KA 1DOYA 3QJZA 1L6UA 1KLUD 3GE3C 3Q6BA 1NVID 1BUIC 3ZNGC 1F77A 1KLVA 3VR8B 2IDYA 2FUG1 4LNOA 4MSMB 3UQBA 1GB1A 2YEPB 4XDCA 1OFFA 3QAQA 3WANA 4EZKA 2CHWA 4W9GA 2HJ1A 2DZIA 3L0WB 1D5MC 2D11A 3SU8X 3MC8A 2OJWA 3GZNB 1UWMA 1EF1A 1GG3A 3RUIB 2KLGA 4IW0A 1J7AA 3L17A 2ASQA 2L83A 2ZPNA 3HRDD 3AE7B 2NVUI 1PYWD 2BYFA 3SDLC 1WI0A 1HE8A 2K8CA 1N5WA 2KTRB 5LXIB 3HVZA 3QA8A 3DHHC 4YL8A 4UDUC 2LGXA 1RFAA 1JWSD 4HCPB 2G9HD 3DWMA 1WE6A 3H8HA 2G4SA 3ZRCA 2GI9A 4HCNB 1C4CA 4GDKA 1FNUA 2KC2A 4KZ0A 5BO4B 4B0MA 4X57B 1GPXA 1IBXB 2WXHA 1OEYJ 1TY0A 3OG5A 1I4RA 4MH0E 4LNKA 5JHAA 2FCMA 2ZPYA 3N1XC 3ZJUA 3N32A 3GB1A 1HEZE 3FILB 3R3MA 5D3IB 1GTEA 2HDEA 1LM8B 2L1AA 1MG8A 4JWSC 3SHQA 2Q5WD 2BS3B 4ZYNA 1LQBA 2WXMA 1RM6C 1Z2MA 2FE8A 2QIEB 4EE2A 2WX0A 2L76A 2M0AA 2VH2A 3PS6A 4KKIA 3KW5B 3ZUNA 4IKGA 2GBNA 1HTOA 2WS3B 4WURA 2G1EA 1RYJA 1R4NB 1VZ6A 2IGHA 2LZ6A 3DQVA 4B0EA 3H7PB 1WGYA 3DBLB 4I6PA 2JYEA 2M56B 2WXNA 2L8JA 3GZNI 1GC7A 4KSKC 1I4GA 4LDTD 2WDRB 2MBOA 3VAWA 4PS8A 5EE0A 2N9KA 2PIAA 4DXFA 2V1YA 3AU5A 1EWYC 1OGWA 1Y8RC 4M0WA 1FXTB 2V3PA 1E7UA 2HE7A 1L0YB 1WSPA 4W9IA 1V86A 1FFVA 2IO3B 4LJPB 4WIPA 2IO2B 1LGRA 2ZVNA 3B2GA 1QOFA 1WGRA 3PTFC 5E6JA 2NCNA 2DYBA 3VUYA 4W9DA 5KHQA 4L23A 1RFKA 3OWEB 1WYGA 4C7YA 1ZDVA 2CHXA 2KZRA 2XNAC 1NI2A 1QQRA 1PGXA 4XE0A 1SXTA 4P6VF 1SGHA 4JPSA 1E7PB 3A9JA 1WE7A 2IY1B 4RGOS 4JWUC 2Y5PA 3PPAA 1FPYA 2Y3AA 1IUEA 1V97A 1UF0A 2KJHB 1C3TA 2UU7A 2O6VD 5D3DA 2KFKA 1K53A 2BGFA 1MVKA 2H89B 3PZDA 2CJNA 3LDZE 4TV3A 3DBRI 4NQLB 1QOAA 1FRDA 1SJED 4A90A 2WLBA 3QCAA 4W9FA 2V9HA 3UF8A 3VTVA 1R4NI 3DOWA 4RGTA 4CO7A 3Q14C 2A5UA 3KUZA 1KTKA 3DBLI 2JRIB 1WRDB 2KMCA 2W9NA 2X8XX 3RZFA 4TQ0A 3L54A 1EU3A 2RMMA 3IAS1 2ZW1A 4LLGM 1HTQA 2JYTA 2M1MA 4BOSC 1QT9A 3WCQA 4RGNA 1UGJA 4NY0A 3ZVVA 2KQ4X 2OHFA 4I6LB 1H7WA 3BWUD 5AEKB 1C77A 4A55A 3L13A 3V62A 2KK8A 4GLSC 2N9LA 3HM6X 3IFWB 4TSSA 2W3SA 3A4RA 2ON8A 2RR9A 2KVRA 3WAOA 3CF6E 3RNAC 3PLVA 2BPSA 1T0YA 1RAXA 4RM8A 5IN7A 2KTRA 1BMLC 1CZPA 3LXFA 1OQQA 2D3AA 4MGIE 4K81A 3HVDA 1TS3A 2PLPA 4G11A 5E6OA 3RCZA 1TZ1A 3P4SB 2L52A 4F7ZA 4FADA 1E8YA 5D7GA 1P0RA 2LASA 4KX6B 4KZCA 1UWXA 4GU2A 4IWPA 2V4IB 1IBXA 2H88B 3L16A 4JQWC 3PGEA 5EE3A 1CMXB 1EF5A 2V3NA 3EECA 3VHTC 2Z59B 3Q3JA 3B0AA 1WZ3A 4RNAA 3M3JA 4AS1A 5CTRC 3DVNV 3FILA 2AL3A 4YWGG 4P1BC 1EUVB 1J0GA 5CHFA 4BBNF 2LGYA 1XXGA 1ZUD2 2V4LA
chains in the Genus database with same CATH topology
1V1OA 1V1PB 2RDHA 5EE9A 3P4RB 2RPVA 5HI1A 2JQRB 2BW2A 2VZKD 3BIID 3LYYA 2NTSA 3AN1A 2JZPA 1YN5A 1KLGD 3AE9B 4RF1A 5TSSA 3ZJVA 2MH7A 1DYQA 1AYFA 1MPEA 4WQMA 1K51A 1NEKB 2ACZB 1TS2A 1D4BA 1E0ZA 2PVOD 2VZKB 1FRRA 1N62A 1I4HA 2HTME 5BYSA 1XF5L 5H8YE 4MACA 4USAA 2KAJA 3RPFC 2B76B 1JALA 1ET6A 2WXOA 3UI3A 2K9XA 2ONQA 5C2TB 3MFGA 2V0GA 2W55A 3U7ZA 4N58A 1QOGA 5FKAC 3ZGZA 3KWLA 2W54A 2KACA 3VR9B 1VJKA 3AV8A 4ZHOA 1L4DB 3P4PB 4A6QA 2K5PA 3U2SC 1QKZA 3ABVB 2YEPF 2INPE 1DOYA 1TKYA 1M4VA 4WH4A 1FEHA 1Q10A 2QILA 1QF6A 1L6UA 1ESFA 1KLUD 1AWDA 2BYTA 1NVID 1TKEA 2WP9B 4FXCA 1BUIC 4HKQA 1F77A 1F2RC 2J42A 4RCOA 3VR8B 1ROEA 2IDYA 2FUG1 4YSYB 2Z8LA 4ZRQA 1NI3A 1I4PA 3BVMA 1N5XA 1GB1A 2YEPB 1ZE3D 4YXDB 1OFFA 1TJEA 1TS5A 3BYYB 4XDCA 4ARCA 2JSVX 5AUIA 3VQIA 1KFYB 3EA6A 4J3OD 2MJEA 4OW0A 1YN3A 3W2DA 4YT0B 1D5MC 3ETRA 1XO3A 2GB1A 1UWMA 2GRIA 2LHDA 3AEBB 5FK9C 4Q2JA 1VDVA 2INNE 1RWSA 3LB8C 1J7AA 3EGRA 5I4DA 2LUMA 1WXQA 2J4XA 3IAM1 1ZDXA 3W9CB 2L83A 3HRDD 1XCTL 4YTPB 1E6EB 1FCCC 1T5XD 3AE7B 2LMCA 3AE4B 4ITKA 2MJDA 4KKJA 4L1BA 2JXTA 3Q8EA 1PYWD 3Q8AA 1JMLA 1PFDA 2N0SB 2R61A 4ARIA 1XLNA 3Q69A 3NVYA 4C80A 1N5WA 2BTEA 4IDIA 4RF0A 3HVZA 1CJEA 3I57A 1HA5A 1FNVA 4N59A 2DYOA 4DXGA 2W82A 1GT8A 1IGCA 1SBBB 1TZOA 2KN4A 4UDUC 2NTTA 4LTUA 1JWSD 3PZ7A 2G9HD 5LNK1 3DWMA 3BZDB 3ZYYX 1YMHE 3H8HA 2M19A 1GOZA 2GI9A 2LEKA 4L2YA 2DWQA 1SB3C 1C4CA 3P4QB 1PGBA 4RFBA 3AE8B 1FNUA 4ZRPA 2NMQA 4B0MA 4KGSA 2AQ1B 3BYTB 3V3XA 2WNMA 2WXHA 1GPXA 1IBXB 3AM9A 1L0XB 1TY0A 1EM7A 1K50A 3AE3B 1I4RA 1B1ZA 4US9A 5FR3A 3DWGC 5HG2A 3TEZA 3R2IA 1C4AA 2PMVA 2W3RA 1LO5D 1TKGA 3NS1A 3ZJUA 2XN9C 3W5VB 1VZ8A 2EELA 5BYRA 3GB1A 1HEZE 3NVVA 3FILB 1VLBA 5D3IB 1GTEA 1N60A 1JW9D 1JRPA 2HDEA 2WXFA 4D2KA 2L1AA 4JWSC 1TYGB 5BMGA 5G5GA 1T6BX 4ZOHC 2D5GA 4GDLB 1FD6A 3TEXA 1Y56A 3PZ8A 4DQOC 2Q5WD 2BS3B 3Q8CA 1J7CA 4XWWA 2WXMA 2JU6X 1RM6C 1ZXIA 2FE8A 3AEDB 1I4QA 2QIEB 1TS4A 4EE2A 1F0ZA 4NZLB 3VRBB 2M0AA 1UNSA 4KKIA 1QOBA 2BT6A 3R8BA 4IKGA 1SJHD 3Q8FA 2WS3B 3KWVA 2WXRA 4WURA 2G1EA 1RYJA 1VZ6A 2EKIA 2IGHA 1NENB 3O13A 1CQVA 1PGAA 4HRSA 4B0EA 1C79A 3HUIA 2JX5A 3SR6A 1VRAB 1C76A 1UUPA 3AE1B 1SF0A 2LGIA 2WXPA 3U4EG 1SE2A 2MJ3A 1FM0D 4MM3B 4TMAB 2JYEA 2M56B 1E9MA 2WXNA 1I4GA 3AEFB 2X38A 2WDRB 3AE5B 3E56A 1JWMD 2ICIA 3BVZA 5EE0A 2N9KA 2PIAA 1XEEA 2IJ0A 4DXFA 4NJCA 1SSNA 3TUOA 5BMHA 3MJ5A 4R3DA 3ZJTA 2CU3A 5MPOA 1EWYC 2Y5CA 4US8A 1GAQB 4JE3B 4C56C 3C8YA 1YJJA 2K3UA 2BB6A 1YN4A 1MHXA 1SEBD 4M0WA 3R2TA 1GTHA 2RDGA 4KGTA 2V3PA 1PUTA 3I9V1 3P42A 1L0YB 1WSPA 1ZP0B 2QMTA 1XCQL 1FFVA 4OZBA 3N9YC 4KGRA 1PDXA 4WIPA 4YTMB 1T3QA 4ZYSA 2BB5A 2WXQA 3B2GA 1QOFA 3B2FA 5JXVA 5E6JA 2AQ2B 1SE3A 3P63A 3CF4A 4L23A 1L4ZB 4AQ7A 1JWUD 1RFKA 1XLOA 5G5HA 4XWTA 3OWEB 1AN8A 1HZ6A 2LFIA 5BMIA 2I38A 1WYGA 4C7YA 1D5ZC 1ZDVA 1WRIA 2K22A 3GP7A 3BK2A 1KH0A 3W1SA 1ACCA 2XNAC 1QQRA 1C9FA 2SAKA 1PGXA 4HJGE 4IOIE 4XE0A 1SXTA 4P6VF 3U52E 4JPSA 1V1PA 3URYA 1E7PB 2BBCA 1ET9A 1YNTE 1I4XA 4RGOS 4JWUC 2FBWB 1YJIA 1J7BA 1ENFA 1ZOYB 4A8XC 1B9RA 2Y5PA 3AEEB 2Y3AA 3SFDB 1IUEA 1HQRD 1V97A 2E6XA 1ZXHA 1D6EC 3J9CA 1V8CA 3NRZA 2WU2B 4C7ZA 2J53A 2KWDA 5D3DA 4MT5A 3V05A 1K53A 1A70A 1D5XC 1FO4A 1MVKA 2H89B 5HHDG 1BXTA 2CJNA 4HEA1 1SE4A 1CK1A 2QSDA 1JCKB 1QOAA 5EE1A 1FRDA 1JROA 1MI0A 1SJED 2IGGA 2BS4B 2SEBD 4A90A 3RFZB 2I2YA 1P7EA 2WLBA 5T8IA 1XLPA 2IPKD 4RGTA 4XDDA 1KRHA 3AE6B 3NUHB 4GDKB 4H2AA 1C78A 3Q8BA 1KTKA 3AEGB 3FAHA 2DLBA 1ZPSA 3P1MA 2WXKA 4TQ0A 5BYQA 1SIJA 3AEAB 1YQ4B 3FC4A 3NZ3A 1EU3A 2TSSA 2RMMA 3IAS1 3MP9A 4OZCA 1JQ4A 2KMMA 2WXLA 2ZW1A 1FFUA 4LLGM 3KQ4A 2L32A 4JX1C 2WDVB 3E9SA 4NAWB 2JYTA 3AH7A 3AMZA 3EUB2 1QT9A 3WCQA 4RGNA 3KLSX 1UGJA 1XLQA 5C3JB 5HFYA 3B9JA 3TEYA 2WQYB 4YTNB 2QEJC 3ZQ4A 4OVZA 1F2RI 1N61A 1K52A 3TEWA 1EWCA 1IGDA 1DGJA 1H7XA 1L0VB 1JWBD 2JWUA 2WXIA 2DBYA 4RGMA 2KQ4X 2OHFA 4RH6A 1H7WA 1FNWA 4HKZE 3BWUD 5H92C 1MHHE 4HROA 3SEBA 1YQ3B 1C77A 3MHZA 2N7JA 1EU4A 2WDQB 2PTLA 4A55A 2BS2B 1FMAD 4WAFA 1WWTA 3PO0A 1C4PA 1VZ7A 4GLSC 4WWMA 1FIQA 1N63A 2N9LA 4OHJA 1QILA 4TSSA 2IGDA 3BVGA 2W3SA 4A9AA 2ON8A 3TSSA 2DYMA 3L4PA 1WGKA 1I7HA 2OEDA 4MH8A 4OZAA 2E3TA 4O1NA 4CQNA 1HZ5A 3NVWA 2PW9A 3T3OA 2QJLA 1QLBB 4ZHPA 4YSZB 1P7FA 5AUKA 2CJOA 4NAMA 1BMLC 4LK0M 1CZPA 2WU5B 1FXIA 3T3NA 5GXGB 3NVZA 3LXFA 3W5UB 2WXGA 1L5PA 3VRAB 1OQQA 1E10A 1FCLA 1AW7A 3GS2A 3MC0B 3HVDA 1TS3A 2PLPA 3BK1A 4N6EB 2PKOA 3AB5A 2KDMA 1DOXA 1HXYD 3P4SB 2L52A 3AECB 2PVGC 2MEKA 4PT5A 5D7GA 2J52A 4KX6B 1UWXA 2AX5A 2LHEA 4P16A 1NYQA 2V4IB 1IBXA 2H88B 1DOIA 5EE3A 3IXSA 1TY2A 2V3NA 1L6VA 1R7SA 1JWAD 4RNAA 4AS1A 2ZW0A 1VR9A 1GB4A 3FILA 1KF6B 3CIRB 1STEA 1NYRA 3AE2B 2AQ3B 4YWGG 2WXJA 3CWIA 4YSXB 1OQRA 1FXAA 2LJIA 1XXGA 4REZA 4TQ1A 3IT6B 3IT4B 1ZUD2 3SFEB 2K0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GAQ B;  1PFD A;  2N0S B;  1XLQ A;  5C3J B;  1YJJ A;  3B9J A;  2WQY B;  5EE9 A;  3P4R B;  4YTN B;  1GTH A;  2JQR B;  1PUT A;  1XLN A;  4C80 A;  3NVY A;  3BII D;  1N5W A;  4IDI A;  1N61 A;  3HVZ A;  1ZP0 B;  3AN1 A;  1CJE A;  1DGJ A;  1H7X A;  1L0V B;  3AE9 B;  1FFV A;  1JWB D;  2DBY A;  4N59 A;  1GT8 A;  2MH7 A;  1PDX A;  2OHF A;  1AYF A;  4YTM B;  1T3Q A;  4WQM A;  1H7W A;  4LTU A;  1NEK B;  2ACZ B;  3AMZ A;  1E0Z A;  3DWM A;  2PVO D;  3ZYY X;  1FRR A;  2M19 A;  5H92 C;  1N62 A;  3B2G A;  1QOF A;  4HRO A;  1YQ3 B;  2LEK A;  2HTM E;  3B2F A;  2DWQ A;  2WDQ B;  1SB3 C;  3P4Q B;  3AE8 B;  2BS2 B;  5H8Y E;  4USA A;  2KAJ A;  1FMA D;  3RPF C;  1WWT A;  2B76 B;  1JAL A;  2K9X A;  3PO0 A;  3P63 A;  4WWM A;  1FIQ A;  3CF4 A;  5C2T B;  1N63 A;  1GPX A;  1XLO A;  1RFK A;  3AM9 A;  3EUB 2;  2W55 A;  5G5H A;  3AE3 B;  4N58 A;  1QOG A;  4US9 A;  3KWL A;  2W3S A;  2W54 A;  3DWG C;  3VR9 B;  1VJK A;  1WYG A;  3AV8 A;  4A9A A;  1WRI A;  2K22 A;  3L4P A;  4C7Y A;  4ZHO A;  3P4P B;  1WGK A;  1I7H A;  1TKG A;  2K5P A;  2W3R A;  3NS1 A;  2E3T A;  3ABV B;  4P6V F;  3W5V B;  3NVV A;  1E7P B;  1VLB A;  1DOY A;  1TKY A;  4JWU C;  2FBW B;  3NVW A;  1GTE A;  1N60 A;  1JW9 D;  1L6U A;  1JRP A;  1QLB B;  1YJI A;  1J7B A;  4YSZ B;  1AWD A;  1ZOY B;  2QJL A;  4JWS C;  4ZHP A;  3AEE B;  1TYG B;  5AUK A;  1NVI D;  3SFD B;  1IUE A;  1TKE A;  2WP9 B;  2CJO A;  4ZOH C;  1V97 A;  4FXC A;  5G5G A;  1CZP A;  2WU5 B;  1FXI A;  5GXG B;  1V8C A;  3NRZ A;  3NVZ A;  2WU2 B;  2Q5W D;  2BS3 B;  3LXF A;  3VR8 B;  3W5U B;  4C7Z A;  1L5P A;  1J7C A;  3VRA B;  1OQQ A;  1ROE A;  1QF6 A;  4YSY B;  1RM6 C;  1A70 A;  3AED B;  1NI3 A;  1ZXI A;  2QIE B;  1E10 A;  1FO4 A;  2H89 B;  1N5X A;  1F0Z A;  2CJN A;  4N6E B;  3VRB B;  2PKO A;  3AB5 A;  4YXD B;  1OFF A;  1TJE A;  1QOB A;  1DOX A;  4US8 A;  1QOA A;  2BT6 A;  5EE1 A;  1FRD A;  3P4S B;  1JRO A;  3AEC B;  2L52 A;  2PVG C;  5AUI A;  2BS4 B;  1KFY B;  2WS3 B;  2MJE A;  4KX6 B;  2AX5 A;  2WLB A;  4YT0 B;  1XLP A;  1RYJ A;  2G1E A;  1NYQ A;  2EKI A;  2H88 B;  1NEN B;  3ETR A;  4HRS A;  1XO3 A;  1DOI A;  3HUI A;  5EE3 A;  1B9R A;  2JX5 A;  3SR6 A;  1UWM A;  3AE1 B;  1L6V A;  3AEB B;  1SF0 A;  2MJ3 A;  1FM0 D;  1R7S A;  1KRH A;  3AE6 B;  2M56 B;  1E9M A;  1JWA D;  1VDV A;  3AEG B;  3AEF B;  3FAH A;  2WDR B;  3AE5 B;  1RWS A;  3LB8 C;  1KF6 B;  1J7A A;  3P1M A;  3CIR B;  1NYR A;  1WXQ A;  1SIJ A;  3AE2 B;  3AEA B;  1YQ4 B;  3FC4 A;  3W9C B;  5EE0 A;  2L83 A;  2PIA A;  3HRD D;  1JQ4 A;  4YTP B;  1E6E B;  2KMM A;  3AE7 B;  4ITK A;  3AE4 B;  1FFU A;  3CWI A;  4YSX B;  3WCQ A;  1OQR A;  1FXA A;  2MJD A;  4JX1 C;  2WDV B;  2CU3 A;  5MPO A;  3AH7 A;  1EWY C;  2Y5C A;  1ZUD 2;  3SFE B;  1QT9 A; 
#chains in the Genus database with same CATH topology
 2CKH B;  4AWJ A;  3K9O B;  1M94 A;  5EE9 A;  2JQR B;  3DHG C;  3SD5 A;  2DHZ A;  4QAY A;  1YN5 A;  4RF1 A;  4BFR A;  2MH7 A;  3ZNZ B;  1K51 A;  1TS2 A;  2MA9 B;  4TUU A;  1D4B A;  1E0Z A;  4AUQ C;  3H7P A;  1FRR A;  1N62 A;  1I4H A;  4EKU A;  1XF5 L;  5H8Y E;  4USA A;  1ET6 A;  2L00 B;  2ONQ A;  2IO1 B;  4N58 A;  3ZXR A;  3AV8 A;  4ZHO A;  1L4D B;  3P4P B;  4A6Q A;  3ABV B;  2YEP F;  2MRP A;  2QIL A;  2J0J A;  1WXA A;  4BOZ B;  1TKE A;  1LFD A;  2NBV B;  3CSF A;  4DWF A;  3BY4 B;  4RCO A;  4ZRQ A;  4EEW A;  2K8B A;  4OVV A;  3BVM A;  1ZE3 D;  3NJT A;  4YXD B;  1TJE A;  1TS5 A;  3BYY B;  2MWS B;  2JSV X;  5AUI A;  3VQI A;  3EA6 A;  3ZTD A;  1YN3 A;  2L7R A;  4EOY A;  2GRI A;  5FK9 C;  2NPT B;  2KX0 A;  2INN E;  5DPR A;  1E90 A;  2RPQ A;  3Q3M C;  2KD0 A;  3EGR A;  5I4D A;  1WXQ A;  2J4X A;  3IAM 1;  1ZDX A;  1XCT L;  4YTP B;  1E6E B;  1FCC C;  2LMC A;  4ITK A;  2XEW A;  2KC1 A;  4KKJ A;  3Q8E A;  2C5L C;  3VVW B;  3Q3N C;  4GIV A;  3Q8A A;  4S0R A;  1JML A;  2KJ6 A;  2R61 A;  4ARI A;  4KV2 A;  3NVY A;  4W9K A;  2BTE A;  4IDI A;  4RF0 A;  3WAL A;  1CJE A;  4N59 A;  4M00 A;  2W82 A;  1IGC A;  2IY0 B;  2KN4 A;  2NTT A;  2LRW A;  3ZDM C;  4M8N A;  3PT2 B;  3ZYY X;  2KVZ A;  1YMH E;  3M62 B;  1GOZ A;  4LJO B;  1MJD A;  4RFB A;  1ISN A;  2IND C;  2NMQ A;  3QX1 A;  3PLU A;  2MP2 B;  3BYT B;  2J7Q B;  1EM7 A;  1K50 A;  1B1Z A;  4US9 A;  3H1U A;  3TEZ A;  4JLC A;  4FBJ B;  1V9J A;  1LO5 D;  2D2Q A;  2XN9 C;  4K7W A;  4LNF A;  2JVC A;  1VZ8 A;  4FN2 A;  2EEL A;  1T0S C;  1RRB A;  3Q3F A;  1N60 A;  2WXF A;  2RDB C;  4GDL B;  2O2V B;  2KLC A;  4M01 A;  4EUT A;  3AED B;  1I4Q A;  2GMI C;  3A9K B;  1F0Z A;  1GJZ A;  3S2A A;  4NZL B;  3RI7 C;  4GGQ A;  1UNS A;  3P2B A;  5IKC M;  1SJH D;  2LGS A;  3Q8F A;  4ASW C;  3ONS A;  4C4V B;  2EKI A;  3EHV A;  4I6N B;  3EFC A;  3HUI A;  4FHK A;  1C76 A;  1WZ0 A;  4OVU A;  2LGI A;  1SE2 A;  4MM3 B;  3K9P B;  1MG4 A;  4TMA B;  1E9M A;  3AEF B;  2X38 A;  3AE5 B;  3KH0 A;  4A3O A;  4DK5 A;  1V81 A;  2N9X A;  2N9P C;  5FR6 A;  2IJ0 A;  4NJC A;  1SSN A;  5BMH A;  4LDT B;  3RNF C;  4FJY A;  5MPO A;  2D3C A;  2Y5C A;  4DHZ B;  1GAQ B;  2K8H A;  3C8Y A;  3QWZ B;  2K3U A;  4FLH A;  5AZG A;  1MHX A;  4M02 A;  1UBQ A;  1WR6 E;  1GTH A;  4URK A;  1PUT A;  5IA7 A;  2FCN A;  3NZU A;  1ZP0 B;  4OZB A;  4KGR A;  3EFU A;  2BF8 B;  4MJS A;  4YTM B;  1T3Q A;  1WM2 A;  3AXC A;  2WXQ A;  1UZX B;  4BAX A;  4HPM B;  1OQY A;  3B2F A;  2M8S A;  3Q2A C;  4FUL A;  4K3C A;  4IWQ A;  2JPH A;  5G55 A;  2M4N A;  3P63 A;  1KOT A;  3UQA A;  5G5H A;  1WIA A;  2LFI A;  5GMV A;  4LNN A;  2K22 A;  2KWU B;  1KH0 A;  2SAK A;  4HJG E;  2JXX A;  4HDO A;  1YNT E;  2KWV B;  2FUH B;  1J7B A;  1ENF A;  4A8X C;  1WXS A;  3SFD B;  4E71 A;  1ZXH A;  1D6E C;  4HVB A;  3R7Q A;  2WU2 B;  4C7Z A;  3V05 A;  1D5X C;  4KSL C;  5HHD G;  2HJ8 A;  4HEA 1;  1CK1 A;  1PQS A;  2RGF A;  3BIN A;  3VTW A;  1MI0 A;  2O6V B;  1GUA B;  2DX5 B;  4II2 B;  1P7E A;  1XLP A;  3PHW B;  4PK1 A;  4NNJ B;  3T9L A;  2M17 A;  2LVP A;  1KRH A;  3AE6 B;  4IM2 A;  1C78 A;  3Q8B A;  3AEG B;  3FAH A;  3DBR B;  1P9D U;  3P1M A;  1ZPS A;  4HXD A;  4BZA A;  2WXK A;  4BKS D;  3V6E B;  2ZNV B;  3AEA B;  4RM9 A;  4ANU A;  4OZC A;  3KQ4 A;  2WDV B;  3HHM A;  4NAW B;  3HK0 A;  3H9D A;  2KN5 A;  4M8M A;  5IP4 D;  5HFY A;  3ENE A;  3RUL A;  3HIZ A;  3N3K B;  1OEY A;  1U4A A;  1N61 A;  1Q0W B;  2N9E B;  3TEW A;  1NBF C;  4WQO B;  2WXI A;  2DBY A;  3N1Z C;  4RH6 A;  3PRM B;  2IYD B;  3ZKJ C;  2EMT A;  1UEL A;  2D3B A;  1MFW A;  3M63 B;  3ML8 A;  4HRO A;  2JF5 A;  2NPT A;  1EU4 A;  3QQ8 B;  1ZKH A;  3EC8 A;  2CS4 A;  1WWT A;  3PO0 A;  1VZ7 A;  2KAN A;  1N63 A;  4OHJ A;  5DPW A;  1QIL A;  4EZL A;  2WYQ A;  4W9C A;  3TCA A;  4A9A A;  1ZW7 A;  4ICU A;  1I7H A;  1WMH B;  4WWO A;  2DNF A;  4CQN A;  3D32 A;  2BKF A;  1F1H A;  3T3O A;  3T8M A;  4ZHP A;  1P7F A;  4HLE A;  3RN9 C;  2BYE A;  3WAM A;  2G3Q B;  3ZRF A;  1F52 A;  3W5U B;  2WXG A;  1UD7 A;  1E10 A;  1FCL A;  1AW7 A;  2AEH A;  2A4Z A;  3HM3 A;  2PKO A;  3NZS A;  1DOX A;  4P1C C;  4NPN A;  2MEK A;  4PT5 A;  2INC C;  3W1Y A;  3JYU A;  2J0M A;  4LNI A;  1R7S A;  3DBH B;  2KHW B;  3ZIM A;  3JW0 X;  3I63 C;  1GB4 A;  3A1Q B;  1STE A;  1NYR A;  3WAP A;  3AE2 B;  2AQ3 B;  4BBN C;  4GDL A;  1OQR A;  4TQ1 A;  4DHZ E;  3IT4 B;  3ZNH B;  4E74 A;  2KQS A;  3A9K A;  3IHP C;  4WJP A;  3UIO B;  3P4R B;  2RPV A;  2BW2 A;  2L3Z A;  2GBM A;  3LYY A;  2MW5 A;  3AE9 B;  1C1Y B;  3ZJV A;  1D3Z A;  2MCN B;  1VCB A;  2ZZP B;  4C4V A;  2NR2 A;  3FKY A;  1NEK B;  2XBB C;  2UYZ B;  4MM3 A;  4W9J A;  5C1Z A;  4WJN A;  1JAL A;  3UI3 A;  3KVF B;  2OOB B;  3MFG A;  2V0G A;  3NG0 A;  5IOI A;  3UIP B;  2KAC A;  2KDE B;  1WXV A;  2K5P A;  1QKZ A;  2NS5 A;  1TKY A;  1M4V A;  4MSQ B;  1Q10 A;  1ESF A;  2BYT A;  4FXC A;  3MTN B;  5IAA C;  2JT4 B;  1ROE A;  3N20 C;  4CHK A;  1I4P A;  1N5X A;  4ARC A;  1YX5 B;  4W9E A;  1RLF A;  4IWO A;  3ZXV A;  1KFY B;  3W2D A;  2MJE A;  4NQK E;  2OJR A;  4YT0 B;  1XO3 A;  2MBE A;  2LHD A;  3AEB B;  3APC A;  4XX5 A;  1KJT A;  3H6N A;  1L2N A;  3ZDT A;  3DCG A;  4XZ4 A;  2GBR A;  3DBH I;  4FJZ A;  3LB8 C;  2GBJ A;  1WGD A;  2CU1 A;  4MEL A;  2QHO A;  1T5X D;  3AE4 B;  3PRZ A;  2BVC A;  2MJD A;  4L1B A;  1S1Q B;  2N0S B;  4PS3 A;  2HD5 B;  2L0F A;  4S17 A;  4RMA A;  3Q69 A;  4C80 A;  4MEM A;  1HA5 A;  4DXG A;  4GSW A;  1GT8 A;  2JY6 A;  1TZO A;  3VUX A;  3RT3 B;  2K25 A;  4LTU A;  3PZ7 A;  2M19 A;  4BVU C;  4L2Y A;  1SB3 C;  3P4Q B;  1PGB A;  3AE8 B;  1XT9 B;  2JRH A;  3DDC B;  4KGS A;  2AQ1 B;  2WNM A;  1L0X B;  3AE3 B;  2N7D A;  4MGK E;  3DWG C;  2KT7 A;  5HG2 A;  4EZJ A;  3R2I A;  1GNU A;  2FIF A;  2PMV A;  4DDI D;  1E5W A;  4NAW A;  3PRP B;  3VUW A;  1EO6 A;  1IPG A;  1VLB A;  2KQ7 A;  1JW9 D;  4D2K A;  3OJ3 A;  1TYG B;  5G5G A;  1T6B X;  4HDQ A;  1FD6 A;  4GOC A;  3TEX A;  1BT0 A;  1Y56 A;  3PZ8 A;  4DQO C;  3VH3 B;  1WFY A;  1LXD A;  2MBH A;  1ZXI A;  3AUL A;  1TBE A;  1QOB A;  2MHJ A;  3R8B A;  3VDZ A;  2DAJ A;  3O13 A;  1NEN B;  4HRS A;  4A3P A;  2QC8 A;  1VRA B;  1J8C A;  1UUP A;  3U4E G;  5DCN A;  4FHJ A;  2MJ3 A;  2NBU A;  2FCS A;  4E3C A;  2ICI A;  1IYF A;  4K7S A;  2KDF B;  3PVL A;  3BVZ A;  1T0R C;  2CU3 A;  2BWF A;  4US8 A;  1WJN A;  2FCQ A;  1YJJ A;  2BB6 A;  1YN4 A;  5KHO A;  4DHJ D;  2RDG A;  3JVZ X;  3I9V 1;  3P42 A;  5TR5 A;  3UGB B;  1XCQ L;  2LWP A;  2D3G A;  3N9Y C;  3APD A;  2BB5 A;  2VH1 A;  3RYT A;  4ZYS A;  1V5T A;  5JHB A;  3VTU A;  4II3 B;  3MJW A;  5JXV A;  4ZRJ A;  3RZW C;  4TKN A;  4WWP A;  4AJW A;  1T0Q C;  4HK2 A;  1SE3 A;  2ZCB A;  3A1Q A;  3CF4 A;  5EDS A;  2PPH A;  1AN8 A;  1HZ6 A;  5BMI A;  4B9K A;  4GB9 A;  1D5Z C;  1WRI A;  3GP7 A;  3BK2 A;  3W1S A;  1ACC A;  3PHX B;  1C9F A;  3QC8 B;  3U52 E;  2KTF A;  1ET9 A;  3TL5 A;  2FBW B;  1S3S G;  2L0T A;  2KOX A;  3W1S C;  1ZOY B;  3GE8 C;  1KM7 A;  3AEE B;  2QDF A;  2GLS A;  4ZRI A;  2DZM A;  2KWC A;  3NS8 A;  4DBG A;  1WGG A;  3NRZ A;  2C7N B;  2J53 A;  1P3Q U;  3PV1 A;  5D2M B;  1A70 A;  1FO4 A;  1SE4 A;  1WR1 A;  4C00 A;  4ACF A;  5EE1 A;  1JRO A;  2IGG A;  2SEB D;  3RMK C;  1WYW B;  3RFZ B;  2I2Y A;  1YJ1 A;  5T8I A;  1V6E A;  2IPK D;  2AYO B;  3LJ3 A;  4PYZ A;  3NUH B;  4H2A A;  4WJQ A;  2Y5B B;  1IP9 A;  3ZTC A;  1WJ4 A;  3N30 A;  2KFK B;  2N1V A;  3A33 B;  5BYQ A;  1SIJ A;  3N1Y C;  3NZ3 A;  2N1W A;  3FC4 A;  2TSS A;  1H4R A;  2KMM A;  1FFU A;  4JX1 C;  4B95 A;  3AH7 A;  3AMZ A;  3VH4 B;  3KLS X;  2ZCC A;  4JL9 A;  5C3J B;  3B9J A;  2KDB A;  4YTN B;  3ZQ4 A;  1F2R I;  1EWC A;  3QIJ A;  2LXA A;  2WWZ A;  1DGJ A;  2JWU A;  1L0V B;  1SE9 A;  2LXC A;  3H7S A;  1FNW A;  2DZJ A;  4HKZ E;  1I35 A;  5J2R A;  3SEB A;  2JZZ A;  2PTL A;  3UIN B;  2LUE A;  2IZV B;  2K1F A;  1FMA D;  2JZ3 B;  3KUC B;  2MBQ A;  1C4P A;  4WWM A;  1FIQ A;  3DHI C;  5DPT A;  2DAF A;  4FJV B;  1SIF A;  1JRU A;  1WGK A;  2OED A;  4OZA A;  3X23 A;  2E3T A;  2EMS A;  2LVQ A;  1WX7 A;  1R4M B;  3NVW A;  1WH3 A;  3WA0 A;  1TTN A;  3T3N A;  5GXG B;  4ICV A;  3IBE A;  2VRR B;  1L5P A;  3VRA B;  4WAA A;  2KDI A;  2C7H A;  3AB5 A;  1L7Y A;  1HXY D;  2PVG C;  3TBL D;  3AEC B;  2I1J A;  2J52 A;  2AX5 A;  2PJH A;  5LXH A;  2Z0E B;  2V3S A;  3IXS A;  1TY2 A;  3TIX A;  4K1R B;  3OJ4 B;  4PYU A;  3NY5 A;  1X1M A;  3MC9 A;  1YOV B;  4IG7 B;  3CIR B;  2R2Q A;  1Q5W B;  2WXJ A;  4GXB A;  2BKR B;  3CWI A;  3RNG C;  3ML9 A;  2LJI A;  4REZ A;  3IT6 B;  2FNJ B;  2K0P A;  2MSE D;  4XYC A;  1V1O A;  1V1P B;  3KYD D;  4PS7 A;  1V80 A;  2FAZ A;  2MQJ A;  2RDH A;  4LCD E;  3ECI A;  2VZK D;  1P1A A;  1V49 A;  3AN1 A;  2JZP A;  1KLG D;  2KO3 A;  1AYF A;  5D6J B;  2PE6 B;  2KFJ A;  4IM0 A;  1V5O A;  2HTM E;  5BYS A;  3ZNI D;  2KAJ A;  3RPF C;  2L05 A;  2B3A A;  2K9X A;  1N6Z A;  1XD3 B;  5C2T B;  3X0W A;  2N7E A;  1QOG A;  3ZGZ A;  4HJK A;  3KWL A;  4JGH B;  2LD9 A;  1VJK A;  2YLM A;  3RNC C;  1OTR B;  3PRE A;  2INP E;  3OAW A;  2WHI A;  4WH4 A;  1FEH A;  4B6W A;  1QF6 A;  2NBW B;  1AWD A;  2MX2 A;  1R4M I;  2DZK A;  2WP9 B;  2XK5 B;  4HKQ A;  1F2R C;  2J42 A;  4F1S A;  2G45 B;  4YSY B;  2Z8L A;  1NI3 A;  4A20 A;  1E8W A;  5L95 C;  4J3O D;  4OW0 A;  1YX6 B;  4G50 A;  1P98 A;  5E6N A;  5DPS A;  3ETR A;  4ANW A;  2GB1 A;  4Q2J A;  1VDV A;  5AZH A;  1UBI A;  5J18 A;  2RD0 A;  1RWS A;  2AWT A;  3JSV B;  2LUM A;  5C23 A;  4KIK B;  2N4F A;  4ZRK A;  3W9C B;  3ZO5 B;  2KYW A;  3APF A;  3U8Z A;  3DBS A;  1F9J A;  4KVG B;  2JXT A;  2MP2 A;  2C7M B;  2WX1 A;  4NJ6 A;  1PFD A;  1Q1O A;  3RNE C;  1XLN A;  4WJO A;  5LLI A;  3I57 A;  1FNV A;  2DYO A;  4K3B A;  1SBB B;  4MDK E;  2IO0 B;  2MLB A;  4IC7 B;  5LNK 1;  4DXA B;  3BZD B;  2CR5 A;  3Q3O C;  2LEK A;  2O2V A;  2DWQ A;  2C60 A;  2CHZ A;  4AOF A;  4J6I A;  4ZRP A;  1YD8 U;  4W9H A;  4N9F 4;  3V60 A;  3V3X A;  3AM9 A;  3ALB A;  2K6Q A;  5CHW A;  3CMM B;  5FR3 A;  3DVG X;  1GC6 A;  4XGA B;  5E6P A;  1C4A A;  3WIM A;  2KMA A;  2W3R A;  1TKG A;  3NS1 A;  4HWI B;  3W5V B;  4BKS A;  2ZEQ A;  5BYR A;  1WGH A;  1WX8 A;  3NVV A;  3RD2 A;  3MHS D;  1JRP A;  3IG3 A;  2JUO A;  5BMG A;  4ZOH C;  1AAR A;  2D5G A;  2M0X A;  4JIO U;  2WGS A;  4W9L A;  2YVC A;  1UH6 A;  3Q8C A;  5HKH A;  4MGZ E;  1J7C A;  4XWW A;  2JU6 X;  2BWE S;  1TS4 A;  4F8C B;  3U30 A;  3B08 A;  3VRB B;  2BT6 A;  2KXJ A;  3RNB C;  3NOB A;  3ZW3 A;  5CHV C;  3KWV A;  2WXR A;  2LGD A;  3DVN U;  1CQV A;  1PGA A;  1C79 A;  3L08 A;  2JX5 A;  1UGM A;  3SR6 A;  4K7U A;  3AE1 B;  1SF0 A;  2WXP A;  2GBK A;  1FM0 D;  3B1L X;  3E56 A;  1JWM D;  2PEA A;  2KNB A;  4IM3 A;  2LI5 A;  1XEE A;  2KJR A;  4BKT A;  3TUO A;  3ZJT A;  3MJ5 A;  4R3D A;  3I3T B;  3DPD A;  4JE3 B;  4C56 C;  3VFK A;  1SEB D;  3R2T A;  4KGT A;  1WF9 A;  2QMT A;  2QCZ A;  3TJP A;  2BQQ A;  1PDX A;  2BYV E;  4DHJ B;  1NDD A;  5G2N A;  4ANX A;  2LRU A;  3U7D A;  2PE9 A;  3NHE B;  2AQ2 B;  3L10 B;  4WWN A;  1L4Z B;  4AQ7 A;  1JWU D;  1XLO A;  1H8C A;  4XWT A;  1WJU A;  4BKG A;  2I38 A;  2O6V A;  2J0K A;  5CX3 A;  4IOI E;  3O65 B;  1V1P A;  3URY A;  2BBC A;  4MJS B;  1I4X A;  1YJI A;  1B9R A;  1E7V A;  1HQR D;  2E6X A;  3R7R A;  3VXW A;  3J9C A;  1V8C A;  4G3X B;  2KWD A;  4MT5 A;  1WY8 A;  2MBB B;  1WX9 A;  1BXT A;  3PSE B;  2QSD A;  4ZDV A;  1JCK B;  2K6D B;  2ZNV C;  2BS4 B;  2RSU A;  1TT5 B;  3C19 A;  5AZF A;  1YIW A;  3OLM D;  3ZLZ A;  4XDD A;  3V61 A;  4GDK B;  1TIF A;  2IBI B;  2DLB A;  2HTH A;  1K8R B;  1QZE A;  1YQ4 B;  3MP9 A;  2XK5 A;  1JQ4 A;  2LVO A;  1TGZ B;  2WXL A;  3CST A;  3GOE A;  4HPL B;  2L32 A;  3E9S A;  4IUM B;  4GMV A;  3EUB 2;  2DEN B;  1XLQ A;  3TEY A;  2WQY B;  2WDT B;  2QEJ C;  4OVZ A;  3AU4 A;  2UWQ A;  1K52 A;  1IGD A;  1WMH A;  1Z5S B;  1H7X A;  1JWB D;  4RGM A;  5IO9 A;  5J17 A;  1J19 A;  3QHT A;  5H92 C;  1MHH E;  1XQQ A;  4GN1 A;  1YQ3 B;  3MHZ A;  2N7J A;  2R2O A;  2WDQ B;  2BS2 B;  3A4S C;  2G4D B;  4WAF A;  3C0R B;  3DVG Y;  3JSV A;  3QK0 A;  4KIK A;  2IGD A;  3BVG A;  3R66 C;  1A5R A;  3TSS A;  2DYM A;  3L4P A;  4EFO A;  5L83 A;  4MH8 A;  1V2Y A;  4MGY E;  4O1N A;  3KYC D;  1HZ5 A;  2PW9 A;  2QJL A;  1QLB B;  3IVF A;  4YSZ B;  2EKE C;  5AUK A;  2CJO A;  2JWZ A;  4NAM A;  4LK0 M;  2KKC A;  5JH5 C;  2WU5 B;  1FXI A;  1WJ6 A;  3NVZ A;  2K39 A;  3GS2 A;  3MC0 B;  2D07 B;  4M0W B;  3BK1 A;  4N6E B;  3KUD B;  2KDM A;  4AP4 C;  2C9W B;  4XC2 A;  2LHE A;  4P16 A;  4FA6 A;  1NYQ A;  5D94 A;  3V6C B;  1DOI A;  1G6J A;  1L6V A;  3TMP B;  2LJ5 A;  1JWA D;  3QAR A;  2ZW0 A;  1VR9 A;  1KF6 B;  4HPP A;  2ZVO A;  1I42 A;  4YSX B;  2REX A;  1FXA A;  3AI5 A;  4G0N B;  3SFE B;  3M95 A;  4KDL B;  1E8X A;  1ZGU B;  3A9J B;  4NJ7 A;  3I5J C;  4ANV A;  2Z0D B;  5HI1 A;  1YQB A;  3BII D;  2FID A;  2NTS A;  2D10 A;  5TSS A;  1DYQ A;  1MPE A;  2ZJD A;  4WQM A;  4AJY B;  2ACZ B;  2PVO D;  2VZK B;  5JZE B;  2GOW A;  1VD2 A;  4MAC A;  1WXM A;  2B76 B;  2WXO A;  4CYE A;  4KDI C;  2W55 A;  3U7Z A;  5FKA C;  4P7I A;  2W54 A;  3VR9 B;  2AL6 A;  1E8Z A;  3U2S C;  1WM3 A;  2KX3 A;  4DDG D;  2I1K A;  1DOY A;  3QJZ A;  1L6U A;  1KLU D;  3GE3 C;  3Q6B A;  1NVI D;  1BUI C;  3ZNG C;  1F77 A;  1KLV A;  3VR8 B;  2IDY A;  2FUG 1;  4LNO A;  4MSM B;  3UQB A;  1GB1 A;  2YEP B;  4XDC A;  1OFF A;  3QAQ A;  3WAN A;  4EZK A;  2CHW A;  4W9G A;  2HJ1 A;  2DZI A;  3L0W B;  1D5M C;  2D11 A;  3SU8 X;  3MC8 A;  2OJW A;  3GZN B;  1UWM A;  1EF1 A;  1GG3 A;  3RUI B;  2KLG A;  4IW0 A;  1J7A A;  3L17 A;  2ASQ A;  2L83 A;  2ZPN A;  3HRD D;  3AE7 B;  2NVU I;  1PYW D;  2BYF A;  3SDL C;  1WI0 A;  1HE8 A;  2K8C A;  1N5W A;  2KTR B;  5LXI B;  3HVZ A;  3QA8 A;  3DHH C;  4YL8 A;  4UDU C;  2LGX A;  1RFA A;  1JWS D;  4HCP B;  2G9H D;  3DWM A;  1WE6 A;  3H8H A;  2G4S A;  3ZRC A;  2GI9 A;  4HCN B;  1C4C A;  4GDK A;  1FNU A;  2KC2 A;  4KZ0 A;  5BO4 B;  4B0M A;  4X57 B;  1GPX A;  1IBX B;  2WXH A;  1OEY J;  1TY0 A;  3OG5 A;  1I4R A;  4MH0 E;  4LNK A;  5JHA A;  2FCM A;  2ZPY A;  3N1X C;  3ZJU A;  3N32 A;  3GB1 A;  1HEZ E;  3FIL B;  3R3M A;  5D3I B;  1GTE A;  2HDE A;  1LM8 B;  2L1A A;  1MG8 A;  4JWS C;  3SHQ A;  2Q5W D;  2BS3 B;  4ZYN A;  1LQB A;  2WXM A;  1RM6 C;  1Z2M A;  2FE8 A;  2QIE B;  4EE2 A;  2WX0 A;  2L76 A;  2M0A A;  2VH2 A;  3PS6 A;  4KKI A;  3KW5 B;  3ZUN A;  4IKG A;  2GBN A;  1HTO A;  2WS3 B;  4WUR A;  2G1E A;  1RYJ A;  1R4N B;  1VZ6 A;  2IGH A;  2LZ6 A;  3DQV A;  4B0E A;  3H7P B;  1WGY A;  3DBL B;  4I6P A;  2JYE A;  2M56 B;  2WXN A;  2L8J A;  3GZN I;  1GC7 A;  4KSK C;  1I4G A;  4LDT D;  2WDR B;  2MBO A;  3VAW A;  4PS8 A;  5EE0 A;  2N9K A;  2PIA A;  4DXF A;  2V1Y A;  3AU5 A;  1EWY C;  1OGW A;  1Y8R C;  4M0W A;  1FXT B;  2V3P A;  1E7U A;  2HE7 A;  1L0Y B;  1WSP A;  4W9I A;  1V86 A;  1FFV A;  2IO3 B;  4LJP B;  4WIP A;  2IO2 B;  1LGR A;  2ZVN A;  3B2G A;  1QOF A;  1WGR A;  3PTF C;  5E6J A;  2NCN A;  2DYB A;  3VUY A;  4W9D A;  5KHQ A;  4L23 A;  1RFK A;  3OWE B;  1WYG A;  4C7Y A;  1ZDV A;  2CHX A;  2KZR A;  2XNA C;  1NI2 A;  1QQR A;  1PGX A;  4XE0 A;  1SXT A;  4P6V F;  1SGH A;  4JPS A;  1E7P B;  3A9J A;  1WE7 A;  2IY1 B;  4RGO S;  4JWU C;  2Y5P A;  3PPA A;  1FPY A;  2Y3A A;  1IUE A;  1V97 A;  1UF0 A;  2KJH B;  1C3T A;  2UU7 A;  2O6V D;  5D3D A;  2KFK A;  1K53 A;  2BGF A;  1MVK A;  2H89 B;  3PZD A;  2CJN A;  3LDZ E;  4TV3 A;  3DBR I;  4NQL B;  1QOA A;  1FRD A;  1SJE D;  4A90 A;  2WLB A;  3QCA A;  4W9F A;  2V9H A;  3UF8 A;  3VTV A;  1R4N I;  3DOW A;  4RGT A;  4CO7 A;  3Q14 C;  2A5U A;  3KUZ A;  1KTK A;  3DBL I;  2JRI B;  1WRD B;  2KMC A;  2W9N A;  2X8X X;  3RZF A;  4TQ0 A;  3L54 A;  1EU3 A;  2RMM A;  3IAS 1;  2ZW1 A;  4LLG M;  1HTQ A;  2JYT A;  2M1M A;  4BOS C;  1QT9 A;  3WCQ A;  4RGN A;  1UGJ A;  4NY0 A;  3ZVV A;  2KQ4 X;  2OHF A;  4I6L B;  1H7W A;  3BWU D;  5AEK B;  1C77 A;  4A55 A;  3L13 A;  3V62 A;  2KK8 A;  4GLS C;  2N9L A;  3HM6 X;  3IFW B;  4TSS A;  2W3S A;  3A4R A;  2ON8 A;  2RR9 A;  2KVR A;  3WAO A;  3CF6 E;  3RNA C;  3PLV A;  2BPS A;  1T0Y A;  1RAX A;  4RM8 A;  5IN7 A;  2KTR A;  1BML C;  1CZP A;  3LXF A;  1OQQ A;  2D3A A;  4MGI E;  4K81 A;  3HVD A;  1TS3 A;  2PLP A;  4G11 A;  5E6O A;  3RCZ A;  1TZ1 A;  3P4S B;  2L52 A;  4F7Z A;  4FAD A;  1E8Y A;  5D7G A;  1P0R A;  2LAS A;  4KX6 B;  4KZC A;  1UWX A;  4GU2 A;  4IWP A;  2V4I B;  1IBX A;  2H88 B;  3L16 A;  4JQW C;  3PGE A;  5EE3 A;  1CMX B;  1EF5 A;  2V3N A;  3EEC A;  3VHT C;  2Z59 B;  3Q3J A;  3B0A A;  1WZ3 A;  4RNA A;  3M3J A;  4AS1 A;  5CTR C;  3DVN V;  3FIL A;  2AL3 A;  4YWG G;  4P1B C;  1EUV B;  1J0G A;  5CHF A;  4BBN F;  2LGY A;  1XXG A;  1ZUD 2;  2V4L A; 
#chains in the Genus database with same CATH homology
 1V1O A;  1V1P B;  2RDH A;  5EE9 A;  3P4R B;  2RPV A;  5HI1 A;  2JQR B;  2BW2 A;  2VZK D;  3BII D;  3LYY A;  2NTS A;  3AN1 A;  2JZP A;  1YN5 A;  1KLG D;  3AE9 B;  4RF1 A;  5TSS A;  3ZJV A;  2MH7 A;  1DYQ A;  1AYF A;  1MPE A;  4WQM A;  1K51 A;  1NEK B;  2ACZ B;  1TS2 A;  1D4B A;  1E0Z A;  2PVO D;  2VZK B;  1FRR A;  1N62 A;  1I4H A;  2HTM E;  5BYS A;  1XF5 L;  5H8Y E;  4MAC A;  4USA A;  2KAJ A;  3RPF C;  2B76 B;  1JAL A;  1ET6 A;  2WXO A;  3UI3 A;  2K9X A;  2ONQ A;  5C2T B;  3MFG A;  2V0G A;  2W55 A;  3U7Z A;  4N58 A;  1QOG A;  5FKA C;  3ZGZ A;  3KWL A;  2W54 A;  2KAC A;  3VR9 B;  1VJK A;  3AV8 A;  4ZHO A;  1L4D B;  3P4P B;  4A6Q A;  2K5P A;  3U2S C;  1QKZ A;  3ABV B;  2YEP F;  2INP E;  1DOY A;  1TKY A;  1M4V A;  4WH4 A;  1FEH A;  1Q10 A;  2QIL A;  1QF6 A;  1L6U A;  1ESF A;  1KLU D;  1AWD A;  2BYT A;  1NVI D;  1TKE A;  2WP9 B;  4FXC A;  1BUI C;  4HKQ A;  1F77 A;  1F2R C;  2J42 A;  4RCO A;  3VR8 B;  1ROE A;  2IDY A;  2FUG 1;  4YSY B;  2Z8L A;  4ZRQ A;  1NI3 A;  1I4P A;  3BVM A;  1N5X A;  1GB1 A;  2YEP B;  1ZE3 D;  4YXD B;  1OFF A;  1TJE A;  1TS5 A;  3BYY B;  4XDC A;  4ARC A;  2JSV X;  5AUI A;  3VQI A;  1KFY B;  3EA6 A;  4J3O D;  2MJE A;  4OW0 A;  1YN3 A;  3W2D A;  4YT0 B;  1D5M C;  3ETR A;  1XO3 A;  2GB1 A;  1UWM A;  2GRI A;  2LHD A;  3AEB B;  5FK9 C;  4Q2J A;  1VDV A;  2INN E;  1RWS A;  3LB8 C;  1J7A A;  3EGR A;  5I4D A;  2LUM A;  1WXQ A;  2J4X A;  3IAM 1;  1ZDX A;  3W9C B;  2L83 A;  3HRD D;  1XCT L;  4YTP B;  1E6E B;  1FCC C;  1T5X D;  3AE7 B;  2LMC A;  3AE4 B;  4ITK A;  2MJD A;  4KKJ A;  4L1B A;  2JXT A;  3Q8E A;  1PYW D;  3Q8A A;  1JML A;  1PFD A;  2N0S B;  2R61 A;  4ARI A;  1XLN A;  3Q69 A;  3NVY A;  4C80 A;  1N5W A;  2BTE A;  4IDI A;  4RF0 A;  3HVZ A;  1CJE A;  3I57 A;  1HA5 A;  1FNV A;  4N59 A;  2DYO A;  4DXG A;  2W82 A;  1GT8 A;  1IGC A;  1SBB B;  1TZO A;  2KN4 A;  4UDU C;  2NTT A;  4LTU A;  1JWS D;  3PZ7 A;  2G9H D;  5LNK 1;  3DWM A;  3BZD B;  3ZYY X;  1YMH E;  3H8H A;  2M19 A;  1GOZ A;  2GI9 A;  2LEK A;  4L2Y A;  2DWQ A;  1SB3 C;  1C4C A;  3P4Q B;  1PGB A;  4RFB A;  3AE8 B;  1FNU A;  4ZRP A;  2NMQ A;  4B0M A;  4KGS A;  2AQ1 B;  3BYT B;  3V3X A;  2WNM A;  2WXH A;  1GPX A;  1IBX B;  3AM9 A;  1L0X B;  1TY0 A;  1EM7 A;  1K50 A;  3AE3 B;  1I4R A;  1B1Z A;  4US9 A;  5FR3 A;  3DWG C;  5HG2 A;  3TEZ A;  3R2I A;  1C4A A;  2PMV A;  2W3R A;  1LO5 D;  1TKG A;  3NS1 A;  3ZJU A;  2XN9 C;  3W5V B;  1VZ8 A;  2EEL A;  5BYR A;  3GB1 A;  1HEZ E;  3NVV A;  3FIL B;  1VLB A;  5D3I B;  1GTE A;  1N60 A;  1JW9 D;  1JRP A;  2HDE A;  2WXF A;  4D2K A;  2L1A A;  4JWS C;  1TYG B;  5BMG A;  5G5G A;  1T6B X;  4ZOH C;  2D5G A;  4GDL B;  1FD6 A;  3TEX A;  1Y56 A;  3PZ8 A;  4DQO C;  2Q5W D;  2BS3 B;  3Q8C A;  1J7C A;  4XWW A;  2WXM A;  2JU6 X;  1RM6 C;  1ZXI A;  2FE8 A;  3AED B;  1I4Q A;  2QIE B;  1TS4 A;  4EE2 A;  1F0Z A;  4NZL B;  3VRB B;  2M0A A;  1UNS A;  4KKI A;  1QOB A;  2BT6 A;  3R8B A;  4IKG A;  1SJH D;  3Q8F A;  2WS3 B;  3KWV A;  2WXR A;  4WUR A;  2G1E A;  1RYJ A;  1VZ6 A;  2EKI A;  2IGH A;  1NEN B;  3O13 A;  1CQV A;  1PGA A;  4HRS A;  4B0E A;  1C79 A;  3HUI A;  2JX5 A;  3SR6 A;  1VRA B;  1C76 A;  1UUP A;  3AE1 B;  1SF0 A;  2LGI A;  2WXP A;  3U4E G;  1SE2 A;  2MJ3 A;  1FM0 D;  4MM3 B;  4TMA B;  2JYE A;  2M56 B;  1E9M A;  2WXN A;  1I4G A;  3AEF B;  2X38 A;  2WDR B;  3AE5 B;  3E56 A;  1JWM D;  2ICI A;  3BVZ A;  5EE0 A;  2N9K A;  2PIA A;  1XEE A;  2IJ0 A;  4DXF A;  4NJC A;  1SSN A;  3TUO A;  5BMH A;  3MJ5 A;  4R3D A;  3ZJT A;  2CU3 A;  5MPO A;  1EWY C;  2Y5C A;  4US8 A;  1GAQ B;  4JE3 B;  4C56 C;  3C8Y A;  1YJJ A;  2K3U A;  2BB6 A;  1YN4 A;  1MHX A;  1SEB D;  4M0W A;  3R2T A;  1GTH A;  2RDG A;  4KGT A;  2V3P A;  1PUT A;  3I9V 1;  3P42 A;  1L0Y B;  1WSP A;  1ZP0 B;  2QMT A;  1XCQ L;  1FFV A;  4OZB A;  3N9Y C;  4KGR A;  1PDX A;  4WIP A;  4YTM B;  1T3Q A;  4ZYS A;  2BB5 A;  2WXQ A;  3B2G A;  1QOF A;  3B2F A;  5JXV A;  5E6J A;  2AQ2 B;  1SE3 A;  3P63 A;  3CF4 A;  4L23 A;  1L4Z B;  4AQ7 A;  1JWU D;  1RFK A;  1XLO A;  5G5H A;  4XWT A;  3OWE B;  1AN8 A;  1HZ6 A;  2LFI A;  5BMI A;  2I38 A;  1WYG A;  4C7Y A;  1D5Z C;  1ZDV A;  1WRI A;  2K22 A;  3GP7 A;  3BK2 A;  1KH0 A;  3W1S A;  1ACC A;  2XNA C;  1QQR A;  1C9F A;  2SAK A;  1PGX A;  4HJG E;  4IOI E;  4XE0 A;  1SXT A;  4P6V F;  3U52 E;  4JPS A;  1V1P A;  3URY A;  1E7P B;  2BBC A;  1ET9 A;  1YNT E;  1I4X A;  4RGO S;  4JWU C;  2FBW B;  1YJI A;  1J7B A;  1ENF A;  1ZOY B;  4A8X C;  1B9R A;  2Y5P A;  3AEE B;  2Y3A A;  3SFD B;  1IUE A;  1HQR D;  1V97 A;  2E6X A;  1ZXH A;  1D6E C;  3J9C A;  1V8C A;  3NRZ A;  2WU2 B;  4C7Z A;  2J53 A;  2KWD A;  5D3D A;  4MT5 A;  3V05 A;  1K53 A;  1A70 A;  1D5X C;  1FO4 A;  1MVK A;  2H89 B;  5HHD G;  1BXT A;  2CJN A;  4HEA 1;  1SE4 A;  1CK1 A;  2QSD A;  1JCK B;  1QOA A;  5EE1 A;  1FRD A;  1JRO A;  1MI0 A;  1SJE D;  2IGG A;  2BS4 B;  2SEB D;  4A90 A;  3RFZ B;  2I2Y A;  1P7E A;  2WLB A;  5T8I A;  1XLP A;  2IPK D;  4RGT A;  4XDD A;  1KRH A;  3AE6 B;  3NUH B;  4GDK B;  4H2A A;  1C78 A;  3Q8B A;  1KTK A;  3AEG B;  3FAH A;  2DLB A;  1ZPS A;  3P1M A;  2WXK A;  4TQ0 A;  5BYQ A;  1SIJ A;  3AEA B;  1YQ4 B;  3FC4 A;  3NZ3 A;  1EU3 A;  2TSS A;  2RMM A;  3IAS 1;  3MP9 A;  4OZC A;  1JQ4 A;  2KMM A;  2WXL A;  2ZW1 A;  1FFU A;  4LLG M;  3KQ4 A;  2L32 A;  4JX1 C;  2WDV B;  3E9S A;  4NAW B;  2JYT A;  3AH7 A;  3AMZ A;  3EUB 2;  1QT9 A;  3WCQ A;  4RGN A;  3KLS X;  1UGJ A;  1XLQ A;  5C3J B;  5HFY A;  3B9J A;  3TEY A;  2WQY B;  4YTN B;  2QEJ C;  3ZQ4 A;  4OVZ A;  1F2R I;  1N61 A;  1K52 A;  3TEW A;  1EWC A;  1IGD A;  1DGJ A;  1H7X A;  1L0V B;  1JWB D;  2JWU A;  2WXI A;  2DBY A;  4RGM A;  2KQ4 X;  2OHF A;  4RH6 A;  1H7W A;  1FNW A;  4HKZ E;  3BWU D;  5H92 C;  1MHH E;  4HRO A;  3SEB A;  1YQ3 B;  1C77 A;  3MHZ A;  2N7J A;  1EU4 A;  2WDQ B;  2PTL A;  4A55 A;  2BS2 B;  1FMA D;  4WAF A;  1WWT A;  3PO0 A;  1C4P A;  1VZ7 A;  4GLS C;  4WWM A;  1FIQ A;  1N63 A;  2N9L A;  4OHJ A;  1QIL A;  4TSS A;  2IGD A;  3BVG A;  2W3S A;  4A9A A;  2ON8 A;  3TSS A;  2DYM A;  3L4P A;  1WGK A;  1I7H A;  2OED A;  4MH8 A;  4OZA A;  2E3T A;  4O1N A;  4CQN A;  1HZ5 A;  3NVW A;  2PW9 A;  3T3O A;  2QJL A;  1QLB B;  4ZHP A;  4YSZ B;  1P7F A;  5AUK A;  2CJO A;  4NAM A;  1BML C;  4LK0 M;  1CZP A;  2WU5 B;  1FXI A;  3T3N A;  5GXG B;  3NVZ A;  3LXF A;  3W5U B;  2WXG A;  1L5P A;  3VRA B;  1OQQ A;  1E10 A;  1FCL A;  1AW7 A;  3GS2 A;  3MC0 B;  3HVD A;  1TS3 A;  2PLP A;  3BK1 A;  4N6E B;  2PKO A;  3AB5 A;  2KDM A;  1DOX A;  1HXY D;  3P4S B;  2L52 A;  3AEC B;  2PVG C;  2MEK A;  4PT5 A;  5D7G A;  2J52 A;  4KX6 B;  1UWX A;  2AX5 A;  2LHE A;  4P16 A;  1NYQ A;  2V4I B;  1IBX A;  2H88 B;  1DOI A;  5EE3 A;  3IXS A;  1TY2 A;  2V3N A;  1L6V A;  1R7S A;  1JWA D;  4RNA A;  4AS1 A;  2ZW0 A;  1VR9 A;  1GB4 A;  3FIL A;  1KF6 B;  3CIR B;  1STE A;  1NYR A;  3AE2 B;  2AQ3 B;  4YWG G;  2WXJ A;  3CWI A;  4YSX B;  1OQR A;  1FXA A;  2LJI A;  1XXG A;  4REZ A;  4TQ1 A;  3IT6 B;  3IT4 B;  1ZUD 2;  3SFE B;  2K0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...