4YXDB

Crystal structure of porcine heart mitochondrial complex ii bound with flutolanil
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
total genus 60
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4yxdB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4yxdB01
1L0VB 1KF6B 3W5VB 1N60A 5EE0A 2WS3B 1JROA 1V97A 3AEBB 3PO0A 1TKEA 1WWTA 5GXGB 1TYGB 1B9RA 1QOAA 1RFKA 1NVID 4N59A 3LXFA 2K5PA 1T3QA 2ACZB 3P4QB 3AB5A 1V8CA 1XLPA 1N5XA 3AEDB 1J7CA 2JQRB 2MJDA 3B2FA 3EUB2 2FBWB 1A70A 1L6UA 1PDXA 1FXAA 3SR6A 3W9CB 5MPOA 1IUEA 3WCQA 3AE1B 2H89B 3VR8B 1FRDA 1E0ZA 1GTEA 3VRAB 1ZOYB 2QIEB 1FRRA 1N5WA 5G5HA 2MH7A 4HRSA 1I7HA 1KRHA 1E6EB 3KWLA 1AYFA 1NEKB 4WQMA 1XLNA 1YJIA 2KAJA 3AE3B 1H7XA 1XO3A 1SIJA 1QT9A 1FM0D 1DOXA 3AE6B 4N6EB 2H88B 2KMMA 1PUTA 1FFVA 2L52A 1F0ZA 2WU2B 3NVWA 3AE8B 1H7WA 2E3TA 1GT8A 1YJJA 1ZP0B 1N63A 2DBYA 5H92C 1CZPA 1PFDA 2BS2B 2WDQB 2LEKA 2AX5A 2BS4B 1TKYA 2CJOA 3AEGB 1L5PA 3CIRB 1UWMA 2M56B 1EWYC 1FXIA 3NS1A 5EE3A 3W5UB 4C7YA 4ZHOA 4US9A 1QLBB 2WDRB 3AE4B 3FAHA 2M19A 3L4PA 1N62A 4WWMA 1FIQA 3B9JA 5EE1A 2PVGC 2CJNA 3RPFC 4KX6B 1ZXIA 2N0SB 2WU5B 1VJKA 2WP9B 3P63A 1WYGA 1E10A 3ABVB 3AH7A 2Q5WD 3AEEB 1N61A 1RWSA 1QOFA 2B76B 4YTMB 1QF6A 1L6VA 2WQYB 1TJEA 3P4SB 2JX5A 1J7BA 1JALA 2EKIA 3AN1A 4ZOHC 5EE9A 3AE9B 1QOBA 3HVZA 2WLBA 3VR9B 2MJEA 3ZYYX 1OQQA 1RYJA 2MJ3A 3AE5B 3LB8C 1YQ4B 2W3SA 1ZUD2 3DWGC 4JWSC 1GPXA 1NENB 3P4PB 4YTNB 4FXCA 1DOYA 2BT6A 1SF0A 2Y5CA 1RM6C 3FC4A 3DWMA 4US8A 1JRPA 4YTPB 2HTME 1ROEA 1E9MA 3AV8A 3AE2B 1JWBD 3HUIA 4HROA 3AECB 2W55A 4N58A 3ETRA 1R7SA 4YSZB 1XLQA 3AEAB 1J7AA 2PVOD 1WRIA 5AUKA 1E7PB 2K22A 3HRDD 1FMAD 1OQRA 3SFDB 1VLBA 4YXDB 1VDVA 4JWUC 3CWIA 1NYQA 3BIID 5G5GA 1OFFA 2PIAA 3CF4A 3B2GA 1YQ3B 4C80A 1JW9D 2K9XA 3NRZA 1JWAD 4A9AA 1GAQB 3P1MA 1WXQA 1FFUA 1JQ4A 2BS3B 1XLOA 4USAA 4ZHPA 3SFEB 3NVZA 2OHFA 1SB3C 2W3RA 1FO4A 4YT0B 1TKGA 4YSYB 5C2TB 4YSXB 2QJLA 1QOGA 1NYRA 2CU3A 2L83A 4P6VF 4JX1C 1KFYB 4C7ZA 2G1EA 3VRBB 3AM9A 1DOIA 4IDIA 1NI3A 5AUIA 1WGKA 1DGJA 1CJEA 1AWDA 2W54A 3AMZA 2PKOA 3NVVA 4ITKA 5H8YE 2DWQA 4LTUA 3NVYA 5C3JB 3P4RB 1GTHA 3AEFB 2WDVB 3AE7B
chains in the Genus database with same CATH superfamily
1FCLA 2JVCA 5BYQA 4DHZE 1UELA 2KNBA 3M62B 2KOXA 3ZTCA 2N1VA 1Q5WB 3PZDA 1WFYA 3WCQA 1EWCA 4DWFA 4RNAA 3A9JA 1UUPA 1NEKB 2AWTA 3QA8A 4ZYSA 5CHWA 2KJRA 4RCOA 1Z2MA 1CZPA 4EZKA 4LDTB 1ESFA 3OWEB 3QC8B 1P7FA 1FIQA 3IXSA 5IKCM 1FXTB 2WXIA 4RGTA 4GN1A 2A4ZA 1WSPA 2BKRB 1V1PB 3MJWA 2L3ZA 2DYMA 2JZZA 2BYTA 5HKHA 3AE2B 4MM3A 4MT5A 3ETRA 2LGSA 5LXHA 2KO3A 1OFFA 1E8ZA 3DCGA 3P1MA 4KZ0A 2VZKD 4BKGA 4PYZA 3PRPB 3W1SC 1TKGA 3V6CB 1L7YA 3V62A 3PTFC 5CTRC 4ACFA 3KYCD 4LCDE 2HJ8A 3VUYA 3AEFB 1TY2A 1D5MC 4M8MA 1D5XC 2AL6A 4JLCA 3W5VB 2J0JA 3TMPB 4IWOA 4ZRJA 2WHIA 1IP9A 1LFDA 2KHWB 2AL3A 3ZNID 2D3AA 2IGGA 3N9YC 2GLSA 1Q0WB 4MSQB 4WQMA 2JRIB 1TS5A 1GB4A 1PQSA 1XO3A 3DHHC 1HE8A 1KJTA 4IKGA 2KZRA 1N63A 2DZJA 2BS2B 3ZW3A 2K8CA 2N9LA 3DVGX 2HTHA 3RULA 3DBHI 1VR9A 1J8CA 3QJZA 3ZLZA 2VRRB 5D3IB 2WX0A 1FNVA 2V0GA 3QK0A 2CU1A 2KJHB 3R2TA 1E8YA 3ZYYX 1AW7A 2RDGA 2WXOA 2JYEA 2ZVOA 3VUWA 3RNCC 5FK9C 2BT6A 1I42A 2J0MA 2IO1B 3NS8A 2WDTB 3U7DA 2RGFA 3DBRB 3B08A 3ZTDA 1KTKA 1R4NB 1MPEA 4X57B 5LNK1 3H7SA 1NYQA 3PRZA 4C80A 4A9AA 1GAQB 1MHHE 2M0AA 1FFUA 1GOZA 4NQLB 4OHJA 2J53A 2WGSA 2L83A 2ZJDA 2KJ6A 4WAAA 1KFYB 5J2RA 4WJQA 4HDOA 3GE8C 3BYTB 1RAXA 4ITKA 3K9PB 1IGCA 2L0TA 1L2NA 1F77A 4W9HA 3A9KA 2V3SA 1PGXA 1L0VB 4TMAB 2V4IB 5BYSA 2I1JA 3DOWA 5L83A 2KFKB 2IBIB 3H8HA 1WX7A 1KOTA 1IPGA 1N5XA 3AEDB 1SE3A 3B2FA 2KQ7A 1KLVA 3DPDA 4K7UA 4IG7B 4DBGA 3A33B 3BYYB 1HTQA 1FD6A 1V49A 2QCZA 3QIJA 1CK1A 2IPKD 1SIJA 1WYWB 2QSDA 3LJ3A 3EECA 2J0KA 1PUTA 5IOIA 1VZ8A 2JZ3B 4ZRQA 4GOCA 2DNFA 5BO4B 1VZ7A 2O2VB 2KLGA 1MG4A 2I1KA 2SEBD 4E74A 2M1MA 3L4PA 2MA9B 2PE9A 2BB6A 2W9NA 1WYGA 2WXFA 1JRUA 2KC1A 1STEA 2B76B 4AJYB 1WRDB 1J7BA 4ANXA 1JALA 1GG3A 1SXTA 1GPXA 4TKNA 2R61A 2LWPA 3ZDMC 4K7SA 3FC4A 1I4RA 1E8XA 3AV8A 2G4SA 1NI2A 1C79A 4M0WA 3Q3OC 4MELA 1E7PB 5D2MB 3RD2A 4YXDB 4HPPA 4C4VB 1V81A 4F7ZA 4B95A 1UF0A 1U4AA 2LHEA 2INNE 2LRWA 4KGTA 4ZHPA 3OAWA 4W9LA 2R2OA 2D11A 3WALA 1NYRA 2UU7A 4W9IA 4L2YA 1E5WA 3VRBB 1LO5D 5TR5A 4OW0A 3TEYA 2W54A 4ZDVA 5CHFA 3TCAA 4NNJB 3AEBB 3P2BA 3PV1A 4RF1A 2O6VB 4C56C 2K25A 1T3QA 1V8CA 1XLPA 3IT6B 3Q69A 5T8IA 1V1PA 3GB1A 4DQOC 4RMAA 2MBOA 1TY0A 1Y8RC 3VRAB 2WXNA 2FIFA 2MWSB 2KAJA 3Q3NC 1YNTE 1TIFA 4W9KA 1M94A 4WJNA 3EFCA 1D4BA 1LXDA 1MI0A 2DBYA 1HEZE 2LJIA 4EUTA 4XDDA 1K50A 3NS1A 4G3XB 2FUHB 2FCSA 2GOWA 2KWDA 4IC7B 4AS1A 1ZGUB 2NTSA 3RNEC 2VH1A 4A90A 2WP9B 2LVQA 3OJ4B 3AN1A 5DPTA 2INCC 1G6JA 3S2AA 1OQQA 3LB8C 2BBCA 2W3SA 4JE3B 4US8A 1ZXHA 1ROEA 2M8SA 3UIPB 2KANA 4HROA 2W55A 3ZKJC 2IO0B 1XLQA 2FUG1 2KDBA 1V6EA 3OG5A 2NPTA 3CWIA 3BWUD 4G50A 4WAFA 3NRZA 3UF8A 2FAZA 4A3OA 4B9KA 1ISNA 3ZIMA 1EUVB 4HPLB 4P6VF 2BWFA 3AXCA 3RN9C 2DAJA 3JVZX 3VH4B 4NY0A 3LDZE 2L7RA 1GUAB 2JXTA 1JROA 2KFJA 5GXGB 2Z0EB 4A8XC 2XBBC 3P4QB 1TBEA 3KUDB 2QMTA 3KUCB 2NVUI 4NZLB 4JQWC 2XK5A 2OJWA 4MSMB 1E0ZA 3VTVA 1N5WA 3TJPA 4KDLB 2BW2A 3OJ3A 5E6OA 1ZW7A 4XDCA 4GDLA 5E6NA 4RF0A 1VCBA 3NJTA 5L95C 3VVWB 2NTTA 4F8CB 2L1AA 1K52A 2BS4B 2FE8A 4S0RA 3DHIC 4WWMA 1RLFA 2L0FA 4XX5A 1ET6A 2VH2A 1VZ6A 4KX6B 3PGEA 2DHZA 3AEEB 2LUEA 2C60A 1V5OA 4YTMB 2QDFA 5E6PA 1IGDA 2EELA 3N20C 3APDA 3RFZB 2QEJC 2WLBA 4LNKA 2CHWA 2HJ1A 2N9KA 3ZGZA 4LNFA 1L0YB 4YTNB 2ON8A 2KQSA 1WXSA 1Q10A 1RRBA 2KC2A 4HLEA 5JZEB 3AECB 2M0XA 3EA6A 1T0SC 2GRIA 2CS4A 2PVOD 1XCTL 3ZNGC 4WIPA 2JY6A 3HM3A 3AU4A 4PS8A 1XXGA 2BQQA 4K7WA 3KQ4A 2A5UA 2RPVA 5BMHA 1XEEA 4M02A 1PYWD 3BZDB 4WWNA 2KDMA 1TS3A 3ENEA 4KSLC 4GXBA 4KDIC 3BK2A 2RDHA 2N9PC 4W9JA 1GTHA 4KVGB 1ZKHA 2D10A 3VXWA 4IM2A 4EKUA 5D94A 2KACA 1YD8U 1WGHA 5FR6A 1J0GA 1V80A 3ZNHB 4I6LB 2X8XX 2YVCA 1MFWA 1P7EA 3R3MA 3C19A 4KKJA 2IYDB 1YJIA 2PLPA 3BVMA 3H1UA 3H9DA 3PVLA 1RFAA 4C4VA 1IBXB 2KT7A 1L4ZB 3KLSX 1QKZA 3MHSD 1FFVA 3ZVVA 3NVWA 3PS6A 3HVDA 1H7WA 2J4XA 2JT4B 2LEKA 3IVFA 2PMVA 3DBLB 3I63C 3PT2B 4ICUA 2ZCBA 3W5UB 4CO7A 4M0WB 1WZ0A 3RPFC 3NZUA 3ZXVA 3AH7A 4DHZB 1ZDXA 3PREA 2WQYB 1P3QU 4GDKA 3N3KB 2ZEQA 4PYUA 2O6VA 3KUZA 2INPE 2N9XA 2DX5B 3HUIA 4M01A 1UZXB 2D5GA 3Q8BA 2JXXA 4NJ6A 2QC8A 3IBEA 1XF5L 3CF4A 4AP4C 2Z8LA 4AUQC 2HE7A 2WXQA 1WJUA 4EOYA 1WX9A 4OZCA 2GBNA 1FCCC 3PPAA 2UWQA 4GU2A 4YT0B 1VD2A 2CU3A 2LXAA 2ZNVC 1HQRD 3NVVA 1I4GA 3DBSA 4YWGG 1H8CA 3GZNB 3MP9A 5IA7A 1A5RA 1WWTA 3Q8AA 1SE2A 1WXAA 1NVID 3HIZA 4WQOB 3N1XC 4HWIB 2N7DA 1EF5A 2QIEB 1YOVB 2MLBA 2TSSA 1C4AA 1P0RA 3WIMA 3I5JC 5D7GA 4ZRPA 4CHKA 1MJDA 2H88B 5JHAA 5DPRA 1GT8A 2MBHA 4ANUA 3M63B 4BKSA 1UWMA 2WYQA 3PZ7A 3ZO5B 2C9WB 3FAHA 2UYZB 2KDEB 3B9JA 2C5LC 3VTUA 1IYFA 2NPTB 1P1AA 1GC6A 2K39A 2M17A 1RWSA 1TJEA 2LJ5A 1WZ3A 3P4SB 2D3BA 3TL5A 3BVGA 1YQ4B 4GLSC 2BWES 3VDZA 1UBIA 3T3NA 3C0RB 2RD0A 1T6BX 1JWMD 1WR1A 2LGYA 2YEPF 1WM3A 2L76A 3KW5B 4YSZB 1KLUD 3M95A 3QHTA 1YQBA 4WJPA 1EF1A 4TV3A 2K6QA 2PIAA 4WH4A 1JWAD 3V61A 2NS5A 4MGZE 2DAFA 3Q3FA 3Q8EA 3IFWB 4B0EA 4FADA 1C76A 2JYTA 2W3RA 2W82A 2XK5B 4YSXB 1R4MB 4I6NB 3SU8X 2WXJA 1F2RI 1DGJA 4GIVA 3W2DA 3URYA 1EM7A 2C7HA 2KKCA 4MGYE 1YX6B 4GDLB 3RT3B 2VZKB 3IAS1 4J6IA 2NBUA 3QQ8B 3U30A 2N7EA 3N1ZC 2KWUB 2QILA 4L23A 1MVKA 4HKQA 3O13A 2LGDA 4KGSA 1I4QA 1ACCA 3J9CA 1J7CA 2QHOA 3O65B 3EUB2 2FBWB 1A70A 1FXAA 4M8NA 2MBBB 2XEWA 5G5HA 2MX2A 4RM8A 1AYFA 3PLUA 3TEZA 2LGXA 3Q14C 1WH3A 4AJWA 1XCQL 3PHXB 5JXVA 3X0WA 3ML8A 3KWVA 1WX8A 4E71A 3DVNV 2AX5A 2DZMA 3U2SC 1FXIA 4NAMA 1Q1OA 2LXCA 3L0WB 4GSWA 1ZPSA 4A55A 1E10A 4M00A 4DDID 1J19A 2D3CA 2WX1A 3Q2AC 1BUIC 2G4DB 1RYJA 2MJ3A 3AE5B 1ZUD2 2BYFA 2PTLA 2RPQA 1EO6A 4DXGA 4FA6A 3UIOB 4FHJA 1FMAD 1DYQA 1FNWA 1HXYD 3DHGC 2KTRA 1SBBB 3L13A 3Q3MC 2K9XA 1IBXA 4LLGM 1I35A 1WXQA 3CSTA 4DDGD 2JPHA 2GB1A 2FNJB 2CHZA 2N9EB 3RYTA 1QOGA 2XN9C 1NI3A 4ZRIA 1AWDA 1C3TA 4QAYA 3NVYA 3W1SA 2C7NB 3ZDTA 3Q3JA 4RGNA 1E6EB 2ONQA 3MC8A 4W9DA 2E6XA 3R7QA 1AN8A 2ICIA 1QOAA 5TSSA 4HPMB 2JQRB 4RGOS 4I6PA 3PLVA 2ZW0A 1FRDA 4N9F4 1WJ4A 4XWTA 1H7XA 2AQ2B 4GDKB 3VUXA 1QT9A 1S1QB 2KMMA 2WU2B 2DYBA 2HDEA 2LASA 4B6WA 3ZRFA 1C4CA 2ZZPB 1PFDA 2WDQB 4KGRA 1XQQA 5D3DA 1TKYA 4IOIE 2M56B 4C7YA 4II3B 4BOZB 1HZ6A 2PVGC 4HDQA 3ABVB 3SD5A 1WI0A 1UGMA 3DBHB 1BT0A 5IN7A 2WXKA 3JW0X 2KQ4X 2IY0B 1PGBA 5HI1A 1C1YB 3AE9B 3NUHB 2J52A 4K3CA 4XGAB 2CKHB 3V05A 1YN4A 3DWMA 3RNFC 1JRPA 2R2QA 3D32A 1SIFA 4AQ7A 1OEYJ 2I38A 5DPSA 4ICVA 2GBKA 2K22A 2RMMA 4KZCA 4HJGE 2L32A 2KWVB 2KLCA 4IM3A 2REXA 2N1WA 1T0YA 2K1FA 2LFIA 1YMHE 4C00A 1I4HA 2G45B 3IT4B 4FJVB 4A6QA 1ZDVA 4JX1C 4BBNC 2WXRA 4IDIA 1DOIA 5AUIA 1LM8B 2B3AA 3CMMB 1UH6A 3T8MA 5IP4D 3B2GA 3B0AA 1KF6B 1T0QC 2EKEC 1KLGD 5HFYA 1X1MA 3HM6X 5CHVC 4N59A 4ZRKA 1XT9B 3BY4B 2CR5A 2H89B 3MHZA 3VTWA 2WXLA 3N30A 3W1YA 1MHXA 4GMVA 3M3JA 2Y5PA 3A1QA 1XD3B 1JWSD 3I3TB 5GMVA 4DXFA 1DOXA 3U52E 2E3TA 1JMLA 5H92C 1H4RA 1WMHB 1EWYC 3RUIB 1F2RC 3V60A 3P63A 2MW5A 2Q5WD 1N61A 2KXJA 2N4FA 3SDLC 5J17A 3A4RA 2IY1B 1LGRA 1PGAA 1TS4A 3HK0A 3WANA 3PHWB 1M4VA 4K3BA 1BMLC 1WM2A 3GZNI 3AEAB 3GOEA 4IWQA 1WRIA 2KK8A 4MH8A 5AUKA 5BYRA 2V4LA 4FBJB 4HVBA 4XZ4A 5LXIB 1D6EC 1JQ4A 1Y56A 4NPNA 2FCMA 3ECIA 3E56A 1UD7A 5JH5C 4LJPB 1D5ZC 4WWOA 3BINA 3I9V1 4LTUA 3P4RB 1V1OA 2WDVB 3AE7B 2AYOB 4BKTA 3EGRA 2YEPB 2V1YA 4G0NB 1P98A 1TKEA 3AB5A 2Y5BB 3TSSA 5KHOA 5MPOA 1IUEA 2RDBC 3Q8FA 4LDTD 2ASQA 4CYEA 2KX3A 3RMKC 2GMIC 2PEAA 4DXAB 1SGHA 3KVFB 2MBEA 3NHEB 3ML9A 4RFBA 3ZUNA 1VRAB 3U4EG 3N1YC 2PPHA 4EZLA 4HCNB 2BF8B 3ZNZB 3AEGB 4MEMA 1S3SG 2WNMA 3H7PB 3LYYA 3FILB 2G9HD 3AE4B 2LVPA 5EE1A 2N0SB 2WU5B 2KDFB 2X38A 3ZJVA 1QOFA 2KTRB 1L6VA 2LRUA 1B1ZA 2WXHA 3DVNU 2ZNVB 3EC8A 3HVZA 3VR9B 1SJED 4JIOU 5AEKB 4ANVA 2BGFA 2KN5A 3DBRI 2XNAC 2BB5A 1SEBD 3VQIA 1FEHA 2HTME 3UQAA 1R4NI 2IGHA 3X23A 3TEXA 1R7SA 1OQRA 4W9GA 4PT5A 3KH0A 1VLBA 2D3GA 1WJNA 3PZ8A 3BIID 4G11A 3L10B 2LGIA 2CHXA 1HTOA 3AI5A 2IZVB 3TUOA 2IDYA 3IG3A 3ZQ4A 3U7ZA 2MP2B 3PRMB 2DENB 2RR9A 1E8WA 3NG0A 1CJEA 3AMZA 2PKOA 4BZAA 4IM0A 4FLHA 5KHQA 3MJ5A 4NJCA 1N60A 3PO0A 2IJ0A 1OEYA 4WURA 4OZBA 2D2QA 1RFKA 4NJ7A 4EEWA 1L6UA 3NZ3A 4HKZE 4O1NA 1ZOYB 3QCAA 1I7HA 5FR3A 1KRHA 3UINB 5E6JA 3E9SA 2KTFA 1TZ1A 4DHJD 3AE3B 4LNIA 4TUUA 2I2YA 2MBQA 2KVRA 3U8ZA 2BYEA 3GS2A 1WE7A 5I4DA 2L52A 1F0ZA 5G55A 1GJZA 3AU5A 2LVOA 3T9LA 2KDIA 2LZ6A 3QARA 1TTNA 4REZA 2WXGA 1V2YA 2DZKA 2ZCCA 4EZJA 2KX0A 1F9JA 4ZYNA 4KV2A 1QOBA 4DK5A 1C77A 3IHPC 1F1HA 1E90A 3CF6E 2NMQA 4LJOB 2MSED 4L1BA 3RNGC 5AZFA 2NR2A 2LMCA 3HRDD 1WF9A 4P7IA 5D6JB 2JF5A 4ASWC 1SE9A 5G2NA 2V3NA 2Z59B 3V3XA 3B1LX 2OHFA 4FJZA 3JYUA 1T5XD 4YSYB 5C2TB 2KMCA 1WMHA 4BVUC 3UGBB 1YX5B 2WWZA 3A1QB 3R8BA 1OGWA 2PE6B 4A3PA 4BOSC 1WGYA 1YN5A 4CQNA 1BXTA 1NDDA 4W9FA 3LXFA 1I4PA 2JRHA 4ANWA 4E3CA 2ZPNA 2V3PA 1WGGA 3W9CB 3SR6A 1FNUA 1WE6A 4J3OD 4DHJB 1GTEA 3EFUA 2MH7A 3KWLA 2BKFA 4HEA1 4JPSA 4OVVA 3NZSA 1KM7A 5DCNA 4RM9A 1FM0D 2N7JA 3AE6B 3RZWC 4GGQA 2LHDA 4EFOA 2LI5A 3MFGA 5AZGA 4ZHOA 3WA0A 4FHKA 5CX3A 1ET9A 2GBMA 2CJNA 1ZXIA 4LNNA 2OJRA 3ZXRA 4PS7A 3T3OA 2JX5A 4MGIE 1P9DU 5EE9A 4ZOHC 4RGMA 3RNBC 2BPSA 1NENB 4A20A 4FXCA 1RM6C 3Q6BA 3R2IA 4HK2A 3JSVB 2HD5B 3P42A 4XWWA 1MG8A 1E7UA 2PJHA 2JUOA 2KWCA 1AARA 4MGKE 4PK1A 2INDC 2K6DB 2ZPYA 4BFRA 2FCQA 3L08A 2DLBA 5JHBA 1NBFC 2K0PA 1FO4A 2O6VD 2L00B 2GBRA 2QJLA 2YLMA 3ZRCA 3H7PA 3DQVA 3FILA 2BTEA 2G1EA 1OQYA 3AM9A 3SHQA 3IAM1 3K9OB 1WGKA 1V86A 1OTRB 4P16A 4MDKE 2MEKA 4S17A 4HJKA 5J18A 4XC2A 2WS3B 1V97A 3ALBA 4FN2A 4OVZA 1FPYA 2D07B 1WJ6A 1V9JA 2SAKA 4LNOA 5EDSA 2K5PA 2MCNB 4KIKB 3SEBA 3WAOA 2L05A 4IWPA 4WWPA 1WGRA 3VR8B 4K81A 4D2KA 2C7MB 2MQJA 2WXPA 1GB1A 4HRSA 4KSKC 2EMTA 4MJSA 3VAWA 1WIAA 4N6EB 4NAWB 5DPWA 2JWUA 2KYWA 1YJJA 3RZFA 4W9EA 2CJOA 3DDCB 5EE3A 3NY5A 4R3DA 2WDRB 2IGDA 2AQ1B 5FKAC 4FULA 1VJKA 3DVGY 2MP2A 4GB9A 2WXMA 5IAAC 1Z5SB 1T0RC 2MJEA 2IO3B 2IO2B 4K1RB 2L8JA 1L0XB 3R7RA 3VHTC 3DWGC 4AOFA 2KN4A 3P4PB 3UI3A 4B0MA 1YN3A 4TQ1A 4HXDA 4BKSD 3BVZA 3APFA 3GE3C 1JWBD 1HZ5A 4NQKE 2MHJA 1QQRA 4N58A 2BYVE 3A9JB 2V9HA 1J7AA 3NOBA 5HG2A 3SFDB 2JSVX 5G5GA 2PW9A 2ZVNA 1UGJA 4OZAA 2NCNA 2RSUA 1QZEA 4XYCA 1TT5B 3TEWA 3L17A 2AEHA 2JZPA 3GP7A 1LQBA 1TS2A 1KH0A 2DWQA 5C3JB 4F1SA 4P1CC 1WR6E 3FKYA 3MC9A 5LLIA 4TQ0A 3Q8CA 1GNUA 2ACZB 1CMXB 1UBQA 4MM3B 4W9CA 4Q2JA 1PDXA 1WGDA 1YIWA 4BAXA 2Z0DB 4H2AA 4URKA 1K51A 1SJHD 4ARIA 2OEDA 4KKIA 3QX1A 1N6ZA 3MC0B 5BMIA 1WY8A 3DBLI 1GC7A 3AE8B 4JGHB 1CQVA 3HHMA 1C9FA 1L5PA 3CIRB 2MRPA 2M19A 2Y3AA 3KYDD 3WAMA 3TBLD 1UNSA 4II2B 2G3QB 4AWJA 4HCPB 2DZIA 3AULA 3H6NA 5C1ZA 1D3ZA 2LUMA 2K8BA 5AZHA 3APCA 2Y5CA 1SF0A 2OOBB 4YTPB 4IW0A 5C23A 1VDVA 4JWUC 5BMGA 1YQ3B 1JW9D 2GI9A 2BS3B 2NBVB 4USAA 1K53A 3NVZA 2GBJA 1SSNA 1L4DB 2DYOA 2EMSA 3QWZB 1E7VA 3WAPA 1QILA 1WXVA 2BVCA 2ZW1A 5H8YE 2LD9A 3V6EB 1EU4A 3PSEB 4OVUA 2J7QB 4MACA 5EE0A 3A4SC 1TYGB 1B9RA 3ZJTA 2KD0A 3ONSA 1EU3A 1V5TA 2MJDA 3AE1B 2FIDA 3CSFA 2JWZA 1FRRA 3JSVA 4YL8A 1C4PA 1UWXA 3R66C 1XLNA 1HA5A 2KMAA 2NBWB 4UDUC 4P1BC 3QAQA 3RNAC 1ZP0B 3VFKA 4TSSA 3BK1A 1SE4A 1TGZB 2KFKA 2JU6X 4US9A 1QLBB 4BBNF 2M4NA 1N62A 5HHDG 4LK0M 4JL9A 3A9KB 1QF6A 4RH6A 4FJYA 2KVZA 3EHVA 2EKIA 1WXMA 4JWSC 1TZOA 4EE2A 3UQBA 2K3UA 4PS3A 1ENFA 1K8RB 3L54A 1DOYA 1C78A 3C8YA 4MH0E 3RCZA 2O2VA 1E9MA 5IO9A 4KIKA 2FCNA 1F52A 3MTNB 2J42A 3OLMD 2AQ3B 3L16A 3N32A 4NAWA 1XLOA 3I57A 3SFEB 1R4MI 1SB3C 1JCKB 4ARCA 2K8HA 1ZE3D 4IUMB 1I4XA 4C7ZA 4WJOA 1YJ1A 3TIXA 3VH3B 4MJSB 1JWUD 3ZJUA 3RI7C 4XE0A
chains in the Genus database with same CATH topology
1FCLA 2E6XA 2JXTA 1JROA 5BYQA 1YN5A 1AN8A 5GXGB 1BXTA 4CQNA 2ICIA 4A8XC 1QOAA 5TSSA 3LXFA 1I4PA 3P4QB 2V3PA 2QMTA 2JQRB 4NZLB 4RGOS 3W9CB 3SR6A 1FNUA 3WCQA 1EWCA 4J3OD 2ZW0A 1FRDA 1E0ZA 1GTEA 1N5WA 2MH7A 4RNAA 3KWLA 1UUPA 1NEKB 2BW2A 4XWTA 4HEA1 4JPSA 1H7XA 2AQ2B 4GDKB 1QT9A 4XDCA 1FM0D 2N7JA 3AE6B 4RF0A 2KMMA 4ZYSA 2WU2B 2HDEA 2NTTA 4RCOA 2LHDA 1C4CA 2L1AA 3MFGA 1CZPA 1PFDA 2WDQB 1K52A 4KGRA 5D3DA 2BS4B 1TKYA 4IOIE 2M56B 4ZHOA 1ESFA 4C7YA 2FE8A 1ET9A 3OWEB 4WWMA 1ET6A 1P7FA 1FIQA 1HZ6A 2CJNA 2PVGC 1VZ6A 3IXSA 4KX6B 1ZXIA 3ABVB 3AEEB 4YTMB 2WXIA 2WXKA 3T3OA 2KQ4X 4RGTA 2JX5A 1PGBA 1IGDA 2EELA 5EE9A 4ZOHC 5HI1A 3AE9B 3RFZB 2QEJC 2WLBA 4RGMA 3NUHB 2J52A 2N9KA 3ZGZA 1NENB 1WSPA 1V1PB 1L0YB 4YTNB 4FXCA 2ON8A 3V05A 1RM6C 1YN4A 3DWMA 2DYMA 2BYTA 1Q10A 1JRPA 3R2IA 3AE2B 4AQ7A 3AECB 4MT5A 3P42A 2I38A 3EA6A 3ETRA 2GRIA 4XWWA 2PVOD 1XCTL 2K22A 2RMMA 4WIPA 1OFFA 4HJGE 1XXGA 2L32A 3P1MA 2VZKD 3KQ4A 2DLBA 2LFIA 2RPVA 1YMHE 5BMHA 1XEEA 2K0PA 1PYWD 3BZDB 1FO4A 1TKGA 1I4HA 2QJLA 2KDMA 3IT4B 4A6QA 1TS3A 1ZDVA 4JX1C 3FILA 2BTEA 2G1EA 2WXRA 3AM9A 1DOIA 4IDIA 3IAM1 5AUIA 1WGKA 3BK2A 4P16A 2RDHA 2MEKA 1GTHA 3AEFB 1TY2A 1D5MC 3B2GA 1D5XC 1KF6B 3W5VB 2WS3B 1V97A 1KLGD 4OVZA 2KACA 2SAKA 5HFYA 4N59A 2K5PA 3SEBA 2H89B 3VR8B 3MHZA 4D2KA 2WXLA 1MHXA 1P7EA 2WXPA 1GB1A 2IGGA 3N9YC 4HRSA 2Y5PA 4KKJA 4WQMA 1YJIA 2PLPA 1TS5A 3BVMA 1JWSD 1GB4A 1XO3A 4DXFA 1IBXB 1L4ZB 1DOXA 4N6EB 4NAWB 3KLSX 1QKZA 2JWUA 1FFVA 3U52E 3NVWA 4IKGA 3HVDA 1H7WA 2E3TA 2J4XA 1YJJA 1JMLA 1N63A 5H92C 2LEKA 2BS2B 2PMVA 2CJOA 1EWYC 5EE3A 3W5UB 4R3DA 2WDRB 1F2RC 2N9LA 2IGDA 2AQ1B 5FKAC 3RPFC 1VR9A 1VJKA 3P63A 3AH7A 2Q5WD 1N61A 2WXMA 1ZDXA 5D3IB 1FNVA 2V0GA 2WQYB 3R2TA 2MJEA 3ZYYX 1AW7A 1L0XB 2RDGA 2WXOA 2KN4A 3DWGC 2JYEA 3P4PB 3UI3A 4B0MA 1YN3A 5FK9C 2BT6A 4TQ1A 1PGAA 3BVZA 1TS4A 2INPE 1JWBD 1HZ5A 3HUIA 1QQRA 1M4VA 1BMLC 4N58A 1KTKA 4MH8A 3AEAB 1J7AA 5BYRA 1WRIA 5HG2A 5AUKA 2D5GA 3Q8BA 1MPEA 3SFDB 5LNK1 2JSVX 1NYQA 1XF5L 5G5GA 3CF4A 1D6EC 2PW9A 1UGJA 2Z8LA 4OZAA 4C80A 2WXQA 4A9AA 1GAQB 1MHHE 2M0AA 1FFUA 1JQ4A 1GOZA 1Y56A 4OHJA 4OZCA 3TEWA 1FCCC 4YT0B 2J53A 2JZPA 3E56A 3GP7A 2CU3A 2L83A 1D5ZC 1TS2A 1KFYB 3BYTB 1HQRD 4ITKA 3NVVA 1KH0A 3I9V1 1IGCA 2DWQA 1I4GA 4LTUA 5C3JB 4YWGG 3P4RB 1V1OA 1F77A 2WDVB 3MP9A 3AE7B 1PGXA 1L0VB 3EGRA 2YEPB 4TMAB 2V4IB 1TKEA 1WWTA 3Q8AA 4TQ0A 5BYSA 1SE2A 3Q8CA 3H8HA 1NVID 2ACZB 3AB5A 1N5XA 3AEDB 1SE3A 4MM3B 3B2FA 3TSSA 4Q2JA 1PDXA 5MPOA 1IUEA 4H2AA 3Q8FA 2QIEB 1K51A 2TSSA 3BYYB 1C4AA 1FD6A 1SJHD 4ARIA 2OEDA 4KKIA 1CK1A 2IPKD 1SIJA 5D7GA 4ZRPA 2QSDA 3MC0B 5BMIA 2H88B 1PUTA 1VZ8A 4RFBA 3AE8B 1GT8A 1VRAB 4ZRQA 3U4EG 1CQVA 1VZ7A 3AEGB 1L5PA 1C9FA 3CIRB 1UWMA 3LYYA 2WNMA 2SEBD 3FILB 3PZ7A 2G9HD 3AE4B 3L4PA 3FAHA 2M19A 2Y3AA 3B9JA 5EE1A 2BB6A 2N0SB 1UNSA 2WU5B 1WYGA 2WXFA 2X38A 3ZJVA 1RWSA 1QOFA 2B76B 1STEA 1L6VA 1TJEA 1B1ZA 3P4SB 2WXHA 1J7BA 1JALA 3HVZA 3VR9B 1SJED 1SXTA 3BVGA 1YQ4B 4GLSC 1GPXA 2LUMA 3T3NA 2R61A 2XNAC 2Y5CA 1SF0A 2BB5A 1SEBD 1T6BX 3FC4A 1I4RA 1JWMD 4YTPB 1FEHA 2HTME 3AV8A 3VQIA 2YEPF 1C79A 2IGHA 4M0WA 3TEXA 1R7SA 4YSZB 1KLUD 1E7PB 1OQRA 4PT5A 1VLBA 4YXDB 1VDVA 4JWUC 3PZ8A 3BIID 2PIAA 5BMGA 1YQ3B 1JW9D 4WH4A 1JWAD 2LHEA 2INNE 3Q8EA 2GI9A 2BS3B 4USAA 1K53A 4KGTA 4ZHPA 2LGIA 3NVZA 4B0EA 1C76A 2JYTA 1SSNA 1L4DB 2DYOA 2IDYA 2W3RA 2W82A 3TUOA 4YSXB 1NYRA 1QILA 2WXJA 3ZQ4A 4L2YA 3VRBB 1LO5D 3U7ZA 1F2RI 1DGJA 2ZW1A 4OW0A 1CJEA 3TEYA 2W54A 3AMZA 2PKOA 1EU4A 5H8YE 3URYA 1EM7A 3W2DA 4GDLB 2VZKB 3IAS1 3MJ5A 4MACA 4NJCA 1N60A 5EE0A 3AEBB 3PO0A 2IJ0A 2QILA 4L23A 4WURA 1TYGB 4RF1A 1MVKA 4HKQA 1B9RA 4OZBA 4C56C 1RFKA 3ZJTA 3O13A 4KGSA 1T3QA 1I4QA 1V8CA 1ACCA 1XLPA 1EU3A 3IT6B 3J9CA 3Q69A 5T8IA 1V1PA 1J7CA 2MJDA 3EUB2 2FBWB 1A70A 1L6UA 3GB1A 1FXAA 3NZ3A 4HKZE 4O1NA 4DQOC 3AE1B 1TY0A 3VRAB 1ZOYB 2WXNA 1FRRA 5G5HA 1I7HA 5FR3A 1C4PA 1KRHA 1UWXA 1AYFA 5E6JA 3E9SA 1XLNA 3TEZA 2KAJA 3AE3B 1YNTE 1HA5A 2I2YA 1XCQL 4UDUC 5JXVA 3GS2A 3KWVA 5I4DA 2L52A 1F0ZA 1D4BA 1ZP0B 1MI0A 4TSSA 3BK1A 1SE4A 1HEZE 2DBYA 2LJIA 2JU6X 2AX5A 1K50A 4XDDA 3U2SC 3NS1A 1FXIA 2KWDA 4NAMA 4US9A 4AS1A 1QLBB 1N62A 4REZA 2NTSA 2WXGA 5HHDG 1ZPSA 4A90A 4A55A 4LK0M 2WP9B 1E10A 1QF6A 4RH6A 2EKIA 3AN1A 1QOBA 1BUIC 1OQQA 1RYJA 2MJ3A 3AE5B 3LB8C 2BBCA 2W3SA 1C77A 1TZOA 1ZUD2 4JE3B 4JWSC 4EE2A 2K3UA 2PTLA 1ENFA 1DOYA 4US8A 1C78A 3C8YA 1ZXHA 2NMQA 4DXGA 1ROEA 1E9MA 4HROA 4L1BA 2W55A 1XLQA 2FUG1 2LMCA 3HRDD 1FMAD 1DYQA 2J42A 1FNWA 3CWIA 1HXYD 3BWUD 1SBBB 2K9XA 4WAFA 3NRZA 2AQ3B 1IBXA 2V3NA 4LLGM 1WXQA 1XLOA 3I57A 2GB1A 3SFEB 3V3XA 2OHFA 1SB3C 1JCKB 4ARCA 1T5XD 1ZE3D 4YSYB 1I4XA 5C2TB 1QOGA 4P6VF 2XN9C 4C7ZA 1NI3A 1AWDA 3R8BA 3NVYA 1JWUD 3W1SA 3ZJUA 4XE0A 4RGNA 1E6EB 2ONQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0V B;  1KF6 B;  3W5V B;  1N60 A;  5EE0 A;  2WS3 B;  1JRO A;  1V97 A;  3AEB B;  3PO0 A;  1TKE A;  1WWT A;  5GXG B;  1TYG B;  1B9R A;  1QOA A;  1RFK A;  1NVI D;  4N59 A;  3LXF A;  2K5P A;  1T3Q A;  2ACZ B;  3P4Q B;  3AB5 A;  1V8C A;  1XLP A;  1N5X A;  3AED B;  1J7C A;  2JQR B;  2MJD A;  3B2F A;  3EUB 2;  2FBW B;  1A70 A;  1L6U A;  1PDX A;  1FXA A;  3SR6 A;  3W9C B;  5MPO A;  1IUE A;  3WCQ A;  3AE1 B;  2H89 B;  3VR8 B;  1FRD A;  1E0Z A;  1GTE A;  3VRA B;  1ZOY B;  2QIE B;  1FRR A;  1N5W A;  5G5H A;  2MH7 A;  4HRS A;  1I7H A;  1KRH A;  1E6E B;  3KWL A;  1AYF A;  1NEK B;  4WQM A;  1XLN A;  1YJI A;  2KAJ A;  3AE3 B;  1H7X A;  1XO3 A;  1SIJ A;  1QT9 A;  1FM0 D;  1DOX A;  3AE6 B;  4N6E B;  2H88 B;  2KMM A;  1PUT A;  1FFV A;  2L52 A;  1F0Z A;  2WU2 B;  3NVW A;  3AE8 B;  1H7W A;  2E3T A;  1GT8 A;  1YJJ A;  1ZP0 B;  1N63 A;  2DBY A;  5H92 C;  1CZP A;  1PFD A;  2BS2 B;  2WDQ B;  2LEK A;  2AX5 A;  2BS4 B;  1TKY A;  2CJO A;  3AEG B;  1L5P A;  3CIR B;  1UWM A;  2M56 B;  1EWY C;  1FXI A;  3NS1 A;  5EE3 A;  3W5U B;  4C7Y A;  4ZHO A;  4US9 A;  1QLB B;  2WDR B;  3AE4 B;  3FAH A;  2M19 A;  3L4P A;  1N62 A;  4WWM A;  1FIQ A;  3B9J A;  5EE1 A;  2PVG C;  2CJN A;  3RPF C;  4KX6 B;  1ZXI A;  2N0S B;  2WU5 B;  1VJK A;  2WP9 B;  3P63 A;  1WYG A;  1E10 A;  3ABV B;  3AH7 A;  2Q5W D;  3AEE B;  1N61 A;  1RWS A;  1QOF A;  2B76 B;  4YTM B;  1QF6 A;  1L6V A;  2WQY B;  1TJE A;  3P4S B;  2JX5 A;  1J7B A;  1JAL A;  2EKI A;  3AN1 A;  4ZOH C;  5EE9 A;  3AE9 B;  1QOB A;  3HVZ A;  2WLB A;  3VR9 B;  2MJE A;  3ZYY X;  1OQQ A;  1RYJ A;  2MJ3 A;  3AE5 B;  3LB8 C;  1YQ4 B;  2W3S A;  1ZUD 2;  3DWG C;  4JWS C;  1GPX A;  1NEN B;  3P4P B;  4YTN B;  4FXC A;  1DOY A;  2BT6 A;  1SF0 A;  2Y5C A;  1RM6 C;  3FC4 A;  3DWM A;  4US8 A;  1JRP A;  4YTP B;  2HTM E;  1ROE A;  1E9M A;  3AV8 A;  3AE2 B;  1JWB D;  3HUI A;  4HRO A;  3AEC B;  2W55 A;  4N58 A;  3ETR A;  1R7S A;  4YSZ B;  1XLQ A;  3AEA B;  1J7A A;  2PVO D;  1WRI A;  5AUK A;  1E7P B;  2K22 A;  3HRD D;  1FMA D;  1OQR A;  3SFD B;  1VLB A;  4YXD B;  1VDV A;  4JWU C;  3CWI A;  1NYQ A;  3BII D;  5G5G A;  1OFF A;  2PIA A;  3CF4 A;  3B2G A;  1YQ3 B;  4C80 A;  1JW9 D;  2K9X A;  3NRZ A;  1JWA D;  4A9A A;  1GAQ B;  3P1M A;  1WXQ A;  1FFU A;  1JQ4 A;  2BS3 B;  1XLO A;  4USA A;  4ZHP A;  3SFE B;  3NVZ A;  2OHF A;  1SB3 C;  2W3R A;  1FO4 A;  4YT0 B;  1TKG A;  4YSY B;  5C2T B;  4YSX B;  2QJL A;  1QOG A;  1NYR A;  2CU3 A;  2L83 A;  4P6V F;  4JX1 C;  1KFY B;  4C7Z A;  2G1E A;  3VRB B;  3AM9 A;  1DOI A;  4IDI A;  1NI3 A;  5AUI A;  1WGK A;  1DGJ A;  1CJE A;  1AWD A;  2W54 A;  3AMZ A;  2PKO A;  3NVV A;  4ITK A;  5H8Y E;  2DWQ A;  4LTU A;  3NVY A;  5C3J B;  3P4R B;  1GTH A;  3AEF B;  2WDV B;  3AE7 B; 
#chains in the Genus database with same CATH topology
 1FCL A;  2JVC A;  5BYQ A;  4DHZ E;  1UEL A;  2KNB A;  3M62 B;  2KOX A;  3ZTC A;  2N1V A;  1Q5W B;  3PZD A;  1WFY A;  3WCQ A;  1EWC A;  4DWF A;  4RNA A;  3A9J A;  1UUP A;  1NEK B;  2AWT A;  3QA8 A;  4ZYS A;  5CHW A;  2KJR A;  4RCO A;  1Z2M A;  1CZP A;  4EZK A;  4LDT B;  1ESF A;  3OWE B;  3QC8 B;  1P7F A;  1FIQ A;  3IXS A;  5IKC M;  1FXT B;  2WXI A;  4RGT A;  4GN1 A;  2A4Z A;  1WSP A;  2BKR B;  1V1P B;  3MJW A;  2L3Z A;  2DYM A;  2JZZ A;  2BYT A;  5HKH A;  3AE2 B;  4MM3 A;  4MT5 A;  3ETR A;  2LGS A;  5LXH A;  2KO3 A;  1OFF A;  1E8Z A;  3DCG A;  3P1M A;  4KZ0 A;  2VZK D;  4BKG A;  4PYZ A;  3PRP B;  3W1S C;  1TKG A;  3V6C B;  1L7Y A;  3V62 A;  3PTF C;  5CTR C;  4ACF A;  3KYC D;  4LCD E;  2HJ8 A;  3VUY A;  3AEF B;  1TY2 A;  1D5M C;  4M8M A;  1D5X C;  2AL6 A;  4JLC A;  3W5V B;  2J0J A;  3TMP B;  4IWO A;  4ZRJ A;  2WHI A;  1IP9 A;  1LFD A;  2KHW B;  2AL3 A;  3ZNI D;  2D3A A;  2IGG A;  3N9Y C;  2GLS A;  1Q0W B;  4MSQ B;  4WQM A;  2JRI B;  1TS5 A;  1GB4 A;  1PQS A;  1XO3 A;  3DHH C;  1HE8 A;  1KJT A;  4IKG A;  2KZR A;  1N63 A;  2DZJ A;  2BS2 B;  3ZW3 A;  2K8C A;  2N9L A;  3DVG X;  2HTH A;  3RUL A;  3DBH I;  1VR9 A;  1J8C A;  3QJZ A;  3ZLZ A;  2VRR B;  5D3I B;  2WX0 A;  1FNV A;  2V0G A;  3QK0 A;  2CU1 A;  2KJH B;  3R2T A;  1E8Y A;  3ZYY X;  1AW7 A;  2RDG A;  2WXO A;  2JYE A;  2ZVO A;  3VUW A;  3RNC C;  5FK9 C;  2BT6 A;  1I42 A;  2J0M A;  2IO1 B;  3NS8 A;  2WDT B;  3U7D A;  2RGF A;  3DBR B;  3B08 A;  3ZTD A;  1KTK A;  1R4N B;  1MPE A;  4X57 B;  5LNK 1;  3H7S A;  1NYQ A;  3PRZ A;  4C80 A;  4A9A A;  1GAQ B;  1MHH E;  2M0A A;  1FFU A;  1GOZ A;  4NQL B;  4OHJ A;  2J53 A;  2WGS A;  2L83 A;  2ZJD A;  2KJ6 A;  4WAA A;  1KFY B;  5J2R A;  4WJQ A;  4HDO A;  3GE8 C;  3BYT B;  1RAX A;  4ITK A;  3K9P B;  1IGC A;  2L0T A;  1L2N A;  1F77 A;  4W9H A;  3A9K A;  2V3S A;  1PGX A;  1L0V B;  4TMA B;  2V4I B;  5BYS A;  2I1J A;  3DOW A;  5L83 A;  2KFK B;  2IBI B;  3H8H A;  1WX7 A;  1KOT A;  1IPG A;  1N5X A;  3AED B;  1SE3 A;  3B2F A;  2KQ7 A;  1KLV A;  3DPD A;  4K7U A;  4IG7 B;  4DBG A;  3A33 B;  3BYY B;  1HTQ A;  1FD6 A;  1V49 A;  2QCZ A;  3QIJ A;  1CK1 A;  2IPK D;  1SIJ A;  1WYW B;  2QSD A;  3LJ3 A;  3EEC A;  2J0K A;  1PUT A;  5IOI A;  1VZ8 A;  2JZ3 B;  4ZRQ A;  4GOC A;  2DNF A;  5BO4 B;  1VZ7 A;  2O2V B;  2KLG A;  1MG4 A;  2I1K A;  2SEB D;  4E74 A;  2M1M A;  3L4P A;  2MA9 B;  2PE9 A;  2BB6 A;  2W9N A;  1WYG A;  2WXF A;  1JRU A;  2KC1 A;  1STE A;  2B76 B;  4AJY B;  1WRD B;  1J7B A;  4ANX A;  1JAL A;  1GG3 A;  1SXT A;  1GPX A;  4TKN A;  2R61 A;  2LWP A;  3ZDM C;  4K7S A;  3FC4 A;  1I4R A;  1E8X A;  3AV8 A;  2G4S A;  1NI2 A;  1C79 A;  4M0W A;  3Q3O C;  4MEL A;  1E7P B;  5D2M B;  3RD2 A;  4YXD B;  4HPP A;  4C4V B;  1V81 A;  4F7Z A;  4B95 A;  1UF0 A;  1U4A A;  2LHE A;  2INN E;  2LRW A;  4KGT A;  4ZHP A;  3OAW A;  4W9L A;  2R2O A;  2D11 A;  3WAL A;  1NYR A;  2UU7 A;  4W9I A;  4L2Y A;  1E5W A;  3VRB B;  1LO5 D;  5TR5 A;  4OW0 A;  3TEY A;  2W54 A;  4ZDV A;  5CHF A;  3TCA A;  4NNJ B;  3AEB B;  3P2B A;  3PV1 A;  4RF1 A;  2O6V B;  4C56 C;  2K25 A;  1T3Q A;  1V8C A;  1XLP A;  3IT6 B;  3Q69 A;  5T8I A;  1V1P A;  3GB1 A;  4DQO C;  4RMA A;  2MBO A;  1TY0 A;  1Y8R C;  3VRA B;  2WXN A;  2FIF A;  2MWS B;  2KAJ A;  3Q3N C;  1YNT E;  1TIF A;  4W9K A;  1M94 A;  4WJN A;  3EFC A;  1D4B A;  1LXD A;  1MI0 A;  2DBY A;  1HEZ E;  2LJI A;  4EUT A;  4XDD A;  1K50 A;  3NS1 A;  4G3X B;  2FUH B;  2FCS A;  2GOW A;  2KWD A;  4IC7 B;  4AS1 A;  1ZGU B;  2NTS A;  3RNE C;  2VH1 A;  4A90 A;  2WP9 B;  2LVQ A;  3OJ4 B;  3AN1 A;  5DPT A;  2INC C;  1G6J A;  3S2A A;  1OQQ A;  3LB8 C;  2BBC A;  2W3S A;  4JE3 B;  4US8 A;  1ZXH A;  1ROE A;  2M8S A;  3UIP B;  2KAN A;  4HRO A;  2W55 A;  3ZKJ C;  2IO0 B;  1XLQ A;  2FUG 1;  2KDB A;  1V6E A;  3OG5 A;  2NPT A;  3CWI A;  3BWU D;  4G50 A;  4WAF A;  3NRZ A;  3UF8 A;  2FAZ A;  4A3O A;  4B9K A;  1ISN A;  3ZIM A;  1EUV B;  4HPL B;  4P6V F;  2BWF A;  3AXC A;  3RN9 C;  2DAJ A;  3JVZ X;  3VH4 B;  4NY0 A;  3LDZ E;  2L7R A;  1GUA B;  2JXT A;  1JRO A;  2KFJ A;  5GXG B;  2Z0E B;  4A8X C;  2XBB C;  3P4Q B;  1TBE A;  3KUD B;  2QMT A;  3KUC B;  2NVU I;  4NZL B;  4JQW C;  2XK5 A;  2OJW A;  4MSM B;  1E0Z A;  3VTV A;  1N5W A;  3TJP A;  4KDL B;  2BW2 A;  3OJ3 A;  5E6O A;  1ZW7 A;  4XDC A;  4GDL A;  5E6N A;  4RF0 A;  1VCB A;  3NJT A;  5L95 C;  3VVW B;  2NTT A;  4F8C B;  2L1A A;  1K52 A;  2BS4 B;  2FE8 A;  4S0R A;  3DHI C;  4WWM A;  1RLF A;  2L0F A;  4XX5 A;  1ET6 A;  2VH2 A;  1VZ6 A;  4KX6 B;  3PGE A;  2DHZ A;  3AEE B;  2LUE A;  2C60 A;  1V5O A;  4YTM B;  2QDF A;  5E6P A;  1IGD A;  2EEL A;  3N20 C;  3APD A;  3RFZ B;  2QEJ C;  2WLB A;  4LNK A;  2CHW A;  2HJ1 A;  2N9K A;  3ZGZ A;  4LNF A;  1L0Y B;  4YTN B;  2ON8 A;  2KQS A;  1WXS A;  1Q10 A;  1RRB A;  2KC2 A;  4HLE A;  5JZE B;  3AEC B;  2M0X A;  3EA6 A;  1T0S C;  2GRI A;  2CS4 A;  2PVO D;  1XCT L;  3ZNG C;  4WIP A;  2JY6 A;  3HM3 A;  3AU4 A;  4PS8 A;  1XXG A;  2BQQ A;  4K7W A;  3KQ4 A;  2A5U A;  2RPV A;  5BMH A;  1XEE A;  4M02 A;  1PYW D;  3BZD B;  4WWN A;  2KDM A;  1TS3 A;  3ENE A;  4KSL C;  4GXB A;  4KDI C;  3BK2 A;  2RDH A;  2N9P C;  4W9J A;  1GTH A;  4KVG B;  1ZKH A;  2D10 A;  3VXW A;  4IM2 A;  4EKU A;  5D94 A;  2KAC A;  1YD8 U;  1WGH A;  5FR6 A;  1J0G A;  1V80 A;  3ZNH B;  4I6L B;  2X8X X;  2YVC A;  1MFW A;  1P7E A;  3R3M A;  3C19 A;  4KKJ A;  2IYD B;  1YJI A;  2PLP A;  3BVM A;  3H1U A;  3H9D A;  3PVL A;  1RFA A;  4C4V A;  1IBX B;  2KT7 A;  1L4Z B;  3KLS X;  1QKZ A;  3MHS D;  1FFV A;  3ZVV A;  3NVW A;  3PS6 A;  3HVD A;  1H7W A;  2J4X A;  2JT4 B;  2LEK A;  3IVF A;  2PMV A;  3DBL B;  3I63 C;  3PT2 B;  4ICU A;  2ZCB A;  3W5U B;  4CO7 A;  4M0W B;  1WZ0 A;  3RPF C;  3NZU A;  3ZXV A;  3AH7 A;  4DHZ B;  1ZDX A;  3PRE A;  2WQY B;  1P3Q U;  4GDK A;  3N3K B;  2ZEQ A;  4PYU A;  2O6V A;  3KUZ A;  2INP E;  2N9X A;  2DX5 B;  3HUI A;  4M01 A;  1UZX B;  2D5G A;  3Q8B A;  2JXX A;  4NJ6 A;  2QC8 A;  3IBE A;  1XF5 L;  3CF4 A;  4AP4 C;  2Z8L A;  4AUQ C;  2HE7 A;  2WXQ A;  1WJU A;  4EOY A;  1WX9 A;  4OZC A;  2GBN A;  1FCC C;  3PPA A;  2UWQ A;  4GU2 A;  4YT0 B;  1VD2 A;  2CU3 A;  2LXA A;  2ZNV C;  1HQR D;  3NVV A;  1I4G A;  3DBS A;  4YWG G;  1H8C A;  3GZN B;  3MP9 A;  5IA7 A;  1A5R A;  1WWT A;  3Q8A A;  1SE2 A;  1WXA A;  1NVI D;  3HIZ A;  4WQO B;  3N1X C;  4HWI B;  2N7D A;  1EF5 A;  2QIE B;  1YOV B;  2MLB A;  2TSS A;  1C4A A;  1P0R A;  3WIM A;  3I5J C;  5D7G A;  4ZRP A;  4CHK A;  1MJD A;  2H88 B;  5JHA A;  5DPR A;  1GT8 A;  2MBH A;  4ANU A;  3M63 B;  4BKS A;  1UWM A;  2WYQ A;  3PZ7 A;  3ZO5 B;  2C9W B;  3FAH A;  2UYZ B;  2KDE B;  3B9J A;  2C5L C;  3VTU A;  1IYF A;  2NPT B;  1P1A A;  1GC6 A;  2K39 A;  2M17 A;  1RWS A;  1TJE A;  2LJ5 A;  1WZ3 A;  3P4S B;  2D3B A;  3TL5 A;  3BVG A;  1YQ4 B;  4GLS C;  2BWE S;  3VDZ A;  1UBI A;  3T3N A;  3C0R B;  2RD0 A;  1T6B X;  1JWM D;  1WR1 A;  2LGY A;  2YEP F;  1WM3 A;  2L76 A;  3KW5 B;  4YSZ B;  1KLU D;  3M95 A;  3QHT A;  1YQB A;  4WJP A;  1EF1 A;  4TV3 A;  2K6Q A;  2PIA A;  4WH4 A;  1JWA D;  3V61 A;  2NS5 A;  4MGZ E;  2DAF A;  3Q3F A;  3Q8E A;  3IFW B;  4B0E A;  4FAD A;  1C76 A;  2JYT A;  2W3R A;  2W82 A;  2XK5 B;  4YSX B;  1R4M B;  4I6N B;  3SU8 X;  2WXJ A;  1F2R I;  1DGJ A;  4GIV A;  3W2D A;  3URY A;  1EM7 A;  2C7H A;  2KKC A;  4MGY E;  1YX6 B;  4GDL B;  3RT3 B;  2VZK B;  3IAS 1;  4J6I A;  2NBU A;  3QQ8 B;  3U30 A;  2N7E A;  3N1Z C;  2KWU B;  2QIL A;  4L23 A;  1MVK A;  4HKQ A;  3O13 A;  2LGD A;  4KGS A;  1I4Q A;  1ACC A;  3J9C A;  1J7C A;  2QHO A;  3O65 B;  3EUB 2;  2FBW B;  1A70 A;  1FXA A;  4M8N A;  2MBB B;  2XEW A;  5G5H A;  2MX2 A;  4RM8 A;  1AYF A;  3PLU A;  3TEZ A;  2LGX A;  3Q14 C;  1WH3 A;  4AJW A;  1XCQ L;  3PHX B;  5JXV A;  3X0W A;  3ML8 A;  3KWV A;  1WX8 A;  4E71 A;  3DVN V;  2AX5 A;  2DZM A;  3U2S C;  1FXI A;  4NAM A;  1Q1O A;  2LXC A;  3L0W B;  4GSW A;  1ZPS A;  4A55 A;  1E10 A;  4M00 A;  4DDI D;  1J19 A;  2D3C A;  2WX1 A;  3Q2A C;  1BUI C;  2G4D B;  1RYJ A;  2MJ3 A;  3AE5 B;  1ZUD 2;  2BYF A;  2PTL A;  2RPQ A;  1EO6 A;  4DXG A;  4FA6 A;  3UIO B;  4FHJ A;  1FMA D;  1DYQ A;  1FNW A;  1HXY D;  3DHG C;  2KTR A;  1SBB B;  3L13 A;  3Q3M C;  2K9X A;  1IBX A;  4LLG M;  1I35 A;  1WXQ A;  3CST A;  4DDG D;  2JPH A;  2GB1 A;  2FNJ B;  2CHZ A;  2N9E B;  3RYT A;  1QOG A;  2XN9 C;  1NI3 A;  4ZRI A;  1AWD A;  1C3T A;  4QAY A;  3NVY A;  3W1S A;  2C7N B;  3ZDT A;  3Q3J A;  4RGN A;  1E6E B;  2ONQ A;  3MC8 A;  4W9D A;  2E6X A;  3R7Q A;  1AN8 A;  2ICI A;  1QOA A;  5TSS A;  4HPM B;  2JQR B;  4RGO S;  4I6P A;  3PLV A;  2ZW0 A;  1FRD A;  4N9F 4;  1WJ4 A;  4XWT A;  1H7X A;  2AQ2 B;  4GDK B;  3VUX A;  1QT9 A;  1S1Q B;  2KMM A;  2WU2 B;  2DYB A;  2HDE A;  2LAS A;  4B6W A;  3ZRF A;  1C4C A;  2ZZP B;  1PFD A;  2WDQ B;  4KGR A;  1XQQ A;  5D3D A;  1TKY A;  4IOI E;  2M56 B;  4C7Y A;  4II3 B;  4BOZ B;  1HZ6 A;  2PVG C;  4HDQ A;  3ABV B;  3SD5 A;  1WI0 A;  1UGM A;  3DBH B;  1BT0 A;  5IN7 A;  2WXK A;  3JW0 X;  2KQ4 X;  2IY0 B;  1PGB A;  5HI1 A;  1C1Y B;  3AE9 B;  3NUH B;  2J52 A;  4K3C A;  4XGA B;  2CKH B;  3V05 A;  1YN4 A;  3DWM A;  3RNF C;  1JRP A;  2R2Q A;  3D32 A;  1SIF A;  4AQ7 A;  1OEY J;  2I38 A;  5DPS A;  4ICV A;  2GBK A;  2K22 A;  2RMM A;  4KZC A;  4HJG E;  2L32 A;  2KWV B;  2KLC A;  4IM3 A;  2REX A;  2N1W A;  1T0Y A;  2K1F A;  2LFI A;  1YMH E;  4C00 A;  1I4H A;  2G45 B;  3IT4 B;  4FJV B;  4A6Q A;  1ZDV A;  4JX1 C;  4BBN C;  2WXR A;  4IDI A;  1DOI A;  5AUI A;  1LM8 B;  2B3A A;  3CMM B;  1UH6 A;  3T8M A;  5IP4 D;  3B2G A;  3B0A A;  1KF6 B;  1T0Q C;  2EKE C;  1KLG D;  5HFY A;  1X1M A;  3HM6 X;  5CHV C;  4N59 A;  4ZRK A;  1XT9 B;  3BY4 B;  2CR5 A;  2H89 B;  3MHZ A;  3VTW A;  2WXL A;  3N30 A;  3W1Y A;  1MHX A;  4GMV A;  3M3J A;  2Y5P A;  3A1Q A;  1XD3 B;  1JWS D;  3I3T B;  5GMV A;  4DXF A;  1DOX A;  3U52 E;  2E3T A;  1JML A;  5H92 C;  1H4R A;  1WMH B;  1EWY C;  3RUI B;  1F2R C;  3V60 A;  3P63 A;  2MW5 A;  2Q5W D;  1N61 A;  2KXJ A;  2N4F A;  3SDL C;  5J17 A;  3A4R A;  2IY1 B;  1LGR A;  1PGA A;  1TS4 A;  3HK0 A;  3WAN A;  3PHW B;  1M4V A;  4K3B A;  1BML C;  1WM2 A;  3GZN I;  3AEA B;  3GOE A;  4IWQ A;  1WRI A;  2KK8 A;  4MH8 A;  5AUK A;  5BYR A;  2V4L A;  4FBJ B;  4HVB A;  4XZ4 A;  5LXI B;  1D6E C;  1JQ4 A;  1Y56 A;  4NPN A;  2FCM A;  3ECI A;  3E56 A;  1UD7 A;  5JH5 C;  4LJP B;  1D5Z C;  4WWO A;  3BIN A;  3I9V 1;  4LTU A;  3P4R B;  1V1O A;  2WDV B;  3AE7 B;  2AYO B;  4BKT A;  3EGR A;  2YEP B;  2V1Y A;  4G0N B;  1P98 A;  1TKE A;  3AB5 A;  2Y5B B;  3TSS A;  5KHO A;  5MPO A;  1IUE A;  2RDB C;  3Q8F A;  4LDT D;  2ASQ A;  4CYE A;  2KX3 A;  3RMK C;  2GMI C;  2PEA A;  4DXA B;  1SGH A;  3KVF B;  2MBE A;  3NHE B;  3ML9 A;  4RFB A;  3ZUN A;  1VRA B;  3U4E G;  3N1Y C;  2PPH A;  4EZL A;  4HCN B;  2BF8 B;  3ZNZ B;  3AEG B;  4MEM A;  1S3S G;  2WNM A;  3H7P B;  3LYY A;  3FIL B;  2G9H D;  3AE4 B;  2LVP A;  5EE1 A;  2N0S B;  2WU5 B;  2KDF B;  2X38 A;  3ZJV A;  1QOF A;  2KTR B;  1L6V A;  2LRU A;  1B1Z A;  2WXH A;  3DVN U;  2ZNV B;  3EC8 A;  3HVZ A;  3VR9 B;  1SJE D;  4JIO U;  5AEK B;  4ANV A;  2BGF A;  2KN5 A;  3DBR I;  2XNA C;  2BB5 A;  1SEB D;  3VQI A;  1FEH A;  2HTM E;  3UQA A;  1R4N I;  2IGH A;  3X23 A;  3TEX A;  1R7S A;  1OQR A;  4W9G A;  4PT5 A;  3KH0 A;  1VLB A;  2D3G A;  1WJN A;  3PZ8 A;  3BII D;  4G11 A;  3L10 B;  2LGI A;  2CHX A;  1HTO A;  3AI5 A;  2IZV B;  3TUO A;  2IDY A;  3IG3 A;  3ZQ4 A;  3U7Z A;  2MP2 B;  3PRM B;  2DEN B;  2RR9 A;  1E8W A;  3NG0 A;  1CJE A;  3AMZ A;  2PKO A;  4BZA A;  4IM0 A;  4FLH A;  5KHQ A;  3MJ5 A;  4NJC A;  1N60 A;  3PO0 A;  2IJ0 A;  1OEY A;  4WUR A;  4OZB A;  2D2Q A;  1RFK A;  4NJ7 A;  4EEW A;  1L6U A;  3NZ3 A;  4HKZ E;  4O1N A;  1ZOY B;  3QCA A;  1I7H A;  5FR3 A;  1KRH A;  3UIN B;  5E6J A;  3E9S A;  2KTF A;  1TZ1 A;  4DHJ D;  3AE3 B;  4LNI A;  4TUU A;  2I2Y A;  2MBQ A;  2KVR A;  3U8Z A;  2BYE A;  3GS2 A;  1WE7 A;  5I4D A;  2L52 A;  1F0Z A;  5G55 A;  1GJZ A;  3AU5 A;  2LVO A;  3T9L A;  2KDI A;  2LZ6 A;  3QAR A;  1TTN A;  4REZ A;  2WXG A;  1V2Y A;  2DZK A;  2ZCC A;  4EZJ A;  2KX0 A;  1F9J A;  4ZYN A;  4KV2 A;  1QOB A;  4DK5 A;  1C77 A;  3IHP C;  1F1H A;  1E90 A;  3CF6 E;  2NMQ A;  4LJO B;  2MSE D;  4L1B A;  3RNG C;  5AZF A;  2NR2 A;  2LMC A;  3HRD D;  1WF9 A;  4P7I A;  5D6J B;  2JF5 A;  4ASW C;  1SE9 A;  5G2N A;  2V3N A;  2Z59 B;  3V3X A;  3B1L X;  2OHF A;  4FJZ A;  3JYU A;  1T5X D;  4YSY B;  5C2T B;  2KMC A;  1WMH A;  4BVU C;  3UGB B;  1YX5 B;  2WWZ A;  3A1Q B;  3R8B A;  1OGW A;  2PE6 B;  4A3P A;  4BOS C;  1WGY A;  1YN5 A;  4CQN A;  1BXT A;  1NDD A;  4W9F A;  3LXF A;  1I4P A;  2JRH A;  4ANW A;  4E3C A;  2ZPN A;  2V3P A;  1WGG A;  3W9C B;  3SR6 A;  1FNU A;  1WE6 A;  4J3O D;  4DHJ B;  1GTE A;  3EFU A;  2MH7 A;  3KWL A;  2BKF A;  4HEA 1;  4JPS A;  4OVV A;  3NZS A;  1KM7 A;  5DCN A;  4RM9 A;  1FM0 D;  2N7J A;  3AE6 B;  3RZW C;  4GGQ A;  2LHD A;  4EFO A;  2LI5 A;  3MFG A;  5AZG A;  4ZHO A;  3WA0 A;  4FHK A;  5CX3 A;  1ET9 A;  2GBM A;  2CJN A;  1ZXI A;  4LNN A;  2OJR A;  3ZXR A;  4PS7 A;  3T3O A;  2JX5 A;  4MGI E;  1P9D U;  5EE9 A;  4ZOH C;  4RGM A;  3RNB C;  2BPS A;  1NEN B;  4A20 A;  4FXC A;  1RM6 C;  3Q6B A;  3R2I A;  4HK2 A;  3JSV B;  2HD5 B;  3P42 A;  4XWW A;  1MG8 A;  1E7U A;  2PJH A;  2JUO A;  2KWC A;  1AAR A;  4MGK E;  4PK1 A;  2IND C;  2K6D B;  2ZPY A;  4BFR A;  2FCQ A;  3L08 A;  2DLB A;  5JHB A;  1NBF C;  2K0P A;  1FO4 A;  2O6V D;  2L00 B;  2GBR A;  2QJL A;  2YLM A;  3ZRC A;  3H7P A;  3DQV A;  3FIL A;  2BTE A;  2G1E A;  1OQY A;  3AM9 A;  3SHQ A;  3IAM 1;  3K9O B;  1WGK A;  1V86 A;  1OTR B;  4P16 A;  4MDK E;  2MEK A;  4S17 A;  4HJK A;  5J18 A;  4XC2 A;  2WS3 B;  1V97 A;  3ALB A;  4FN2 A;  4OVZ A;  1FPY A;  2D07 B;  1WJ6 A;  1V9J A;  2SAK A;  4LNO A;  5EDS A;  2K5P A;  2MCN B;  4KIK B;  3SEB A;  3WAO A;  2L05 A;  4IWP A;  4WWP A;  1WGR A;  3VR8 B;  4K81 A;  4D2K A;  2C7M B;  2MQJ A;  2WXP A;  1GB1 A;  4HRS A;  4KSK C;  2EMT A;  4MJS A;  3VAW A;  1WIA A;  4N6E B;  4NAW B;  5DPW A;  2JWU A;  2KYW A;  1YJJ A;  3RZF A;  4W9E A;  2CJO A;  3DDC B;  5EE3 A;  3NY5 A;  4R3D A;  2WDR B;  2IGD A;  2AQ1 B;  5FKA C;  4FUL A;  1VJK A;  3DVG Y;  2MP2 A;  4GB9 A;  2WXM A;  5IAA C;  1Z5S B;  1T0R C;  2MJE A;  2IO3 B;  2IO2 B;  4K1R B;  2L8J A;  1L0X B;  3R7R A;  3VHT C;  3DWG C;  4AOF A;  2KN4 A;  3P4P B;  3UI3 A;  4B0M A;  1YN3 A;  4TQ1 A;  4HXD A;  4BKS D;  3BVZ A;  3APF A;  3GE3 C;  1JWB D;  1HZ5 A;  4NQK E;  2MHJ A;  1QQR A;  4N58 A;  2BYV E;  3A9J B;  2V9H A;  1J7A A;  3NOB A;  5HG2 A;  3SFD B;  2JSV X;  5G5G A;  2PW9 A;  2ZVN A;  1UGJ A;  4OZA A;  2NCN A;  2RSU A;  1QZE A;  4XYC A;  1TT5 B;  3TEW A;  3L17 A;  2AEH A;  2JZP A;  3GP7 A;  1LQB A;  1TS2 A;  1KH0 A;  2DWQ A;  5C3J B;  4F1S A;  4P1C C;  1WR6 E;  3FKY A;  3MC9 A;  5LLI A;  4TQ0 A;  3Q8C A;  1GNU A;  2ACZ B;  1CMX B;  1UBQ A;  4MM3 B;  4W9C A;  4Q2J A;  1PDX A;  1WGD A;  1YIW A;  4BAX A;  2Z0D B;  4H2A A;  4URK A;  1K51 A;  1SJH D;  4ARI A;  2OED A;  4KKI A;  3QX1 A;  1N6Z A;  3MC0 B;  5BMI A;  1WY8 A;  3DBL I;  1GC7 A;  3AE8 B;  4JGH B;  1CQV A;  3HHM A;  1C9F A;  1L5P A;  3CIR B;  2MRP A;  2M19 A;  2Y3A A;  3KYD D;  3WAM A;  3TBL D;  1UNS A;  4II2 B;  2G3Q B;  4AWJ A;  4HCP B;  2DZI A;  3AUL A;  3H6N A;  5C1Z A;  1D3Z A;  2LUM A;  2K8B A;  5AZH A;  3APC A;  2Y5C A;  1SF0 A;  2OOB B;  4YTP B;  4IW0 A;  5C23 A;  1VDV A;  4JWU C;  5BMG A;  1YQ3 B;  1JW9 D;  2GI9 A;  2BS3 B;  2NBV B;  4USA A;  1K53 A;  3NVZ A;  2GBJ A;  1SSN A;  1L4D B;  2DYO A;  2EMS A;  3QWZ B;  1E7V A;  3WAP A;  1QIL A;  1WXV A;  2BVC A;  2ZW1 A;  5H8Y E;  2LD9 A;  3V6E B;  1EU4 A;  3PSE B;  4OVU A;  2J7Q B;  4MAC A;  5EE0 A;  3A4S C;  1TYG B;  1B9R A;  3ZJT A;  2KD0 A;  3ONS A;  1EU3 A;  1V5T A;  2MJD A;  3AE1 B;  2FID A;  3CSF A;  2JWZ A;  1FRR A;  3JSV A;  4YL8 A;  1C4P A;  1UWX A;  3R66 C;  1XLN A;  1HA5 A;  2KMA A;  2NBW B;  4UDU C;  4P1B C;  3QAQ A;  3RNA C;  1ZP0 B;  3VFK A;  4TSS A;  3BK1 A;  1SE4 A;  1TGZ B;  2KFK A;  2JU6 X;  4US9 A;  1QLB B;  4BBN F;  2M4N A;  1N62 A;  5HHD G;  4LK0 M;  4JL9 A;  3A9K B;  1QF6 A;  4RH6 A;  4FJY A;  2KVZ A;  3EHV A;  2EKI A;  1WXM A;  4JWS C;  1TZO A;  4EE2 A;  3UQB A;  2K3U A;  4PS3 A;  1ENF A;  1K8R B;  3L54 A;  1DOY A;  1C78 A;  3C8Y A;  4MH0 E;  3RCZ A;  2O2V A;  1E9M A;  5IO9 A;  4KIK A;  2FCN A;  1F52 A;  3MTN B;  2J42 A;  3OLM D;  2AQ3 B;  3L16 A;  3N32 A;  4NAW A;  1XLO A;  3I57 A;  3SFE B;  1R4M I;  1SB3 C;  1JCK B;  4ARC A;  2K8H A;  1ZE3 D;  4IUM B;  1I4X A;  4C7Z A;  4WJO A;  1YJ1 A;  3TIX A;  3VH3 B;  4MJS B;  1JWU D;  3ZJU A;  3RI7 C;  4XE0 A; 
#chains in the Genus database with same CATH homology
 1FCL A;  2E6X A;  2JXT A;  1JRO A;  5BYQ A;  1YN5 A;  1AN8 A;  5GXG B;  1BXT A;  4CQN A;  2ICI A;  4A8X C;  1QOA A;  5TSS A;  3LXF A;  1I4P A;  3P4Q B;  2V3P A;  2QMT A;  2JQR B;  4NZL B;  4RGO S;  3W9C B;  3SR6 A;  1FNU A;  3WCQ A;  1EWC A;  4J3O D;  2ZW0 A;  1FRD A;  1E0Z A;  1GTE A;  1N5W A;  2MH7 A;  4RNA A;  3KWL A;  1UUP A;  1NEK B;  2BW2 A;  4XWT A;  4HEA 1;  4JPS A;  1H7X A;  2AQ2 B;  4GDK B;  1QT9 A;  4XDC A;  1FM0 D;  2N7J A;  3AE6 B;  4RF0 A;  2KMM A;  4ZYS A;  2WU2 B;  2HDE A;  2NTT A;  4RCO A;  2LHD A;  1C4C A;  2L1A A;  3MFG A;  1CZP A;  1PFD A;  2WDQ B;  1K52 A;  4KGR A;  5D3D A;  2BS4 B;  1TKY A;  4IOI E;  2M56 B;  4ZHO A;  1ESF A;  4C7Y A;  2FE8 A;  1ET9 A;  3OWE B;  4WWM A;  1ET6 A;  1P7F A;  1FIQ A;  1HZ6 A;  2CJN A;  2PVG C;  1VZ6 A;  3IXS A;  4KX6 B;  1ZXI A;  3ABV B;  3AEE B;  4YTM B;  2WXI A;  2WXK A;  3T3O A;  2KQ4 X;  4RGT A;  2JX5 A;  1PGB A;  1IGD A;  2EEL A;  5EE9 A;  4ZOH C;  5HI1 A;  3AE9 B;  3RFZ B;  2QEJ C;  2WLB A;  4RGM A;  3NUH B;  2J52 A;  2N9K A;  3ZGZ A;  1NEN B;  1WSP A;  1V1P B;  1L0Y B;  4YTN B;  4FXC A;  2ON8 A;  3V05 A;  1RM6 C;  1YN4 A;  3DWM A;  2DYM A;  2BYT A;  1Q10 A;  1JRP A;  3R2I A;  3AE2 B;  4AQ7 A;  3AEC B;  4MT5 A;  3P42 A;  2I38 A;  3EA6 A;  3ETR A;  2GRI A;  4XWW A;  2PVO D;  1XCT L;  2K22 A;  2RMM A;  4WIP A;  1OFF A;  4HJG E;  1XXG A;  2L32 A;  3P1M A;  2VZK D;  3KQ4 A;  2DLB A;  2LFI A;  2RPV A;  1YMH E;  5BMH A;  1XEE A;  2K0P A;  1PYW D;  3BZD B;  1FO4 A;  1TKG A;  1I4H A;  2QJL A;  2KDM A;  3IT4 B;  4A6Q A;  1TS3 A;  1ZDV A;  4JX1 C;  3FIL A;  2BTE A;  2G1E A;  2WXR A;  3AM9 A;  1DOI A;  4IDI A;  3IAM 1;  5AUI A;  1WGK A;  3BK2 A;  4P16 A;  2RDH A;  2MEK A;  1GTH A;  3AEF B;  1TY2 A;  1D5M C;  3B2G A;  1D5X C;  1KF6 B;  3W5V B;  2WS3 B;  1V97 A;  1KLG D;  4OVZ A;  2KAC A;  2SAK A;  5HFY A;  4N59 A;  2K5P A;  3SEB A;  2H89 B;  3VR8 B;  3MHZ A;  4D2K A;  2WXL A;  1MHX A;  1P7E A;  2WXP A;  1GB1 A;  2IGG A;  3N9Y C;  4HRS A;  2Y5P A;  4KKJ A;  4WQM A;  1YJI A;  2PLP A;  1TS5 A;  3BVM A;  1JWS D;  1GB4 A;  1XO3 A;  4DXF A;  1IBX B;  1L4Z B;  1DOX A;  4N6E B;  4NAW B;  3KLS X;  1QKZ A;  2JWU A;  1FFV A;  3U52 E;  3NVW A;  4IKG A;  3HVD A;  1H7W A;  2E3T A;  2J4X A;  1YJJ A;  1JML A;  1N63 A;  5H92 C;  2LEK A;  2BS2 B;  2PMV A;  2CJO A;  1EWY C;  5EE3 A;  3W5U B;  4R3D A;  2WDR B;  1F2R C;  2N9L A;  2IGD A;  2AQ1 B;  5FKA C;  3RPF C;  1VR9 A;  1VJK A;  3P63 A;  3AH7 A;  2Q5W D;  1N61 A;  2WXM A;  1ZDX A;  5D3I B;  1FNV A;  2V0G A;  2WQY B;  3R2T A;  2MJE A;  3ZYY X;  1AW7 A;  1L0X B;  2RDG A;  2WXO A;  2KN4 A;  3DWG C;  2JYE A;  3P4P B;  3UI3 A;  4B0M A;  1YN3 A;  5FK9 C;  2BT6 A;  4TQ1 A;  1PGA A;  3BVZ A;  1TS4 A;  2INP E;  1JWB D;  1HZ5 A;  3HUI A;  1QQR A;  1M4V A;  1BML C;  4N58 A;  1KTK A;  4MH8 A;  3AEA B;  1J7A A;  5BYR A;  1WRI A;  5HG2 A;  5AUK A;  2D5G A;  3Q8B A;  1MPE A;  3SFD B;  5LNK 1;  2JSV X;  1NYQ A;  1XF5 L;  5G5G A;  3CF4 A;  1D6E C;  2PW9 A;  1UGJ A;  2Z8L A;  4OZA A;  4C80 A;  2WXQ A;  4A9A A;  1GAQ B;  1MHH E;  2M0A A;  1FFU A;  1JQ4 A;  1GOZ A;  1Y56 A;  4OHJ A;  4OZC A;  3TEW A;  1FCC C;  4YT0 B;  2J53 A;  2JZP A;  3E56 A;  3GP7 A;  2CU3 A;  2L83 A;  1D5Z C;  1TS2 A;  1KFY B;  3BYT B;  1HQR D;  4ITK A;  3NVV A;  1KH0 A;  3I9V 1;  1IGC A;  2DWQ A;  1I4G A;  4LTU A;  5C3J B;  4YWG G;  3P4R B;  1V1O A;  1F77 A;  2WDV B;  3MP9 A;  3AE7 B;  1PGX A;  1L0V B;  3EGR A;  2YEP B;  4TMA B;  2V4I B;  1TKE A;  1WWT A;  3Q8A A;  4TQ0 A;  5BYS A;  1SE2 A;  3Q8C A;  3H8H A;  1NVI D;  2ACZ B;  3AB5 A;  1N5X A;  3AED B;  1SE3 A;  4MM3 B;  3B2F A;  3TSS A;  4Q2J A;  1PDX A;  5MPO A;  1IUE A;  4H2A A;  3Q8F A;  2QIE B;  1K51 A;  2TSS A;  3BYY B;  1C4A A;  1FD6 A;  1SJH D;  4ARI A;  2OED A;  4KKI A;  1CK1 A;  2IPK D;  1SIJ A;  5D7G A;  4ZRP A;  2QSD A;  3MC0 B;  5BMI A;  2H88 B;  1PUT A;  1VZ8 A;  4RFB A;  3AE8 B;  1GT8 A;  1VRA B;  4ZRQ A;  3U4E G;  1CQV A;  1VZ7 A;  3AEG B;  1L5P A;  1C9F A;  3CIR B;  1UWM A;  3LYY A;  2WNM A;  2SEB D;  3FIL B;  3PZ7 A;  2G9H D;  3AE4 B;  3L4P A;  3FAH A;  2M19 A;  2Y3A A;  3B9J A;  5EE1 A;  2BB6 A;  2N0S B;  1UNS A;  2WU5 B;  1WYG A;  2WXF A;  2X38 A;  3ZJV A;  1RWS A;  1QOF A;  2B76 B;  1STE A;  1L6V A;  1TJE A;  1B1Z A;  3P4S B;  2WXH A;  1J7B A;  1JAL A;  3HVZ A;  3VR9 B;  1SJE D;  1SXT A;  3BVG A;  1YQ4 B;  4GLS C;  1GPX A;  2LUM A;  3T3N A;  2R61 A;  2XNA C;  2Y5C A;  1SF0 A;  2BB5 A;  1SEB D;  1T6B X;  3FC4 A;  1I4R A;  1JWM D;  4YTP B;  1FEH A;  2HTM E;  3AV8 A;  3VQI A;  2YEP F;  1C79 A;  2IGH A;  4M0W A;  3TEX A;  1R7S A;  4YSZ B;  1KLU D;  1E7P B;  1OQR A;  4PT5 A;  1VLB A;  4YXD B;  1VDV A;  4JWU C;  3PZ8 A;  3BII D;  2PIA A;  5BMG A;  1YQ3 B;  1JW9 D;  4WH4 A;  1JWA D;  2LHE A;  2INN E;  3Q8E A;  2GI9 A;  2BS3 B;  4USA A;  1K53 A;  4KGT A;  4ZHP A;  2LGI A;  3NVZ A;  4B0E A;  1C76 A;  2JYT A;  1SSN A;  1L4D B;  2DYO A;  2IDY A;  2W3R A;  2W82 A;  3TUO A;  4YSX B;  1NYR A;  1QIL A;  2WXJ A;  3ZQ4 A;  4L2Y A;  3VRB B;  1LO5 D;  3U7Z A;  1F2R I;  1DGJ A;  2ZW1 A;  4OW0 A;  1CJE A;  3TEY A;  2W54 A;  3AMZ A;  2PKO A;  1EU4 A;  5H8Y E;  3URY A;  1EM7 A;  3W2D A;  4GDL B;  2VZK B;  3IAS 1;  3MJ5 A;  4MAC A;  4NJC A;  1N60 A;  5EE0 A;  3AEB B;  3PO0 A;  2IJ0 A;  2QIL A;  4L23 A;  4WUR A;  1TYG B;  4RF1 A;  1MVK A;  4HKQ A;  1B9R A;  4OZB A;  4C56 C;  1RFK A;  3ZJT A;  3O13 A;  4KGS A;  1T3Q A;  1I4Q A;  1V8C A;  1ACC A;  1XLP A;  1EU3 A;  3IT6 B;  3J9C A;  3Q69 A;  5T8I A;  1V1P A;  1J7C A;  2MJD A;  3EUB 2;  2FBW B;  1A70 A;  1L6U A;  3GB1 A;  1FXA A;  3NZ3 A;  4HKZ E;  4O1N A;  4DQO C;  3AE1 B;  1TY0 A;  3VRA B;  1ZOY B;  2WXN A;  1FRR A;  5G5H A;  1I7H A;  5FR3 A;  1C4P A;  1KRH A;  1UWX A;  1AYF A;  5E6J A;  3E9S A;  1XLN A;  3TEZ A;  2KAJ A;  3AE3 B;  1YNT E;  1HA5 A;  2I2Y A;  1XCQ L;  4UDU C;  5JXV A;  3GS2 A;  3KWV A;  5I4D A;  2L52 A;  1F0Z A;  1D4B A;  1ZP0 B;  1MI0 A;  4TSS A;  3BK1 A;  1SE4 A;  1HEZ E;  2DBY A;  2LJI A;  2JU6 X;  2AX5 A;  1K50 A;  4XDD A;  3U2S C;  3NS1 A;  1FXI A;  2KWD A;  4NAM A;  4US9 A;  4AS1 A;  1QLB B;  1N62 A;  4REZ A;  2NTS A;  2WXG A;  5HHD G;  1ZPS A;  4A90 A;  4A55 A;  4LK0 M;  2WP9 B;  1E10 A;  1QF6 A;  4RH6 A;  2EKI A;  3AN1 A;  1QOB A;  1BUI C;  1OQQ A;  1RYJ A;  2MJ3 A;  3AE5 B;  3LB8 C;  2BBC A;  2W3S A;  1C77 A;  1TZO A;  1ZUD 2;  4JE3 B;  4JWS C;  4EE2 A;  2K3U A;  2PTL A;  1ENF A;  1DOY A;  4US8 A;  1C78 A;  3C8Y A;  1ZXH A;  2NMQ A;  4DXG A;  1ROE A;  1E9M A;  4HRO A;  4L1B A;  2W55 A;  1XLQ A;  2FUG 1;  2LMC A;  3HRD D;  1FMA D;  1DYQ A;  2J42 A;  1FNW A;  3CWI A;  1HXY D;  3BWU D;  1SBB B;  2K9X A;  4WAF A;  3NRZ A;  2AQ3 B;  1IBX A;  2V3N A;  4LLG M;  1WXQ A;  1XLO A;  3I57 A;  2GB1 A;  3SFE B;  3V3X A;  2OHF A;  1SB3 C;  1JCK B;  4ARC A;  1T5X D;  1ZE3 D;  4YSY B;  1I4X A;  5C2T B;  1QOG A;  4P6V F;  2XN9 C;  4C7Z A;  1NI3 A;  1AWD A;  3R8B A;  3NVY A;  1JWU D;  3W1S A;  3ZJU A;  4XE0 A;  4RGN A;  1E6E B;  2ONQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...