2PJHA

Strctural model of the p97 n domain- npl4 ubd complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
AESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSSKSLHLLKIKHGDLLFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear protein localization protein 4 homolog
publication title Detailed structural insights into the p97-Npl4-Ufd1 interface.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 11
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11543 UN_NPL4 Nuclear pore localisation protein NPL4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2pjhA00
3PVLA 3UGBB 1OTRB 3VH4B 4XX5A 5CTRC 4HVBA 1K8RB 3PRPB 4ZRKA 4NAWB 3U30A 1NDDA 5E6OA 3ZTCA 3ZUNA 2M1MA 2KANA 2MSED 2NPTA 2XEWA 4IM0A 5GMVA 3RZWC 4EZKA 2FCMA 3UQAA 1UBQA 2MW5A 2MP2A 2MBHA 3KUZA 4LDTB 1WXVA 2V1YA 3MHSD 4HCNB 1UBIA 3DBRI 2ASQA 3CSFA 1H8CA 1GC7A 1TBEA 2BWES 2K1FA 5L95C 3ECIA 1WRDB 2J7QB 4I6PA 2R2OA 1KJTA 3N3KB 4TV3A 1V2YA 3VTVA 2KDIA 4KVGB 5G2NA 4HDOA 2LGYA 4MDKE 4F8CB 3H6NA 4NJ7A 2FIFA 5D6JB 4HXDA 1WR1A 4HJKA 2ZNVB 2LVOA 3EECA 2BKFA 2GBRA 2RR9A 2LWPA 2HE7A 2L3ZA 3A1QA 5CHWA 2DHZA 2O6VA 2PE9A 4ICVA 4OVUA 4DXAB 2FAZA 3A9KA 3M62B 2C9WB 1E8YA 3KUCB 3N32A 2QHOA 3S2AA 1WJ4A 1RAXA 3SHQA 3VUXA 3HHMA 4KZCA 5CHVC 3W1SA 1FXTB 4M8NA 1NI2A 2LD9A 1KM7A 2W9NA 1IP9A 4WJQA 2CU1A 2LGDA 3DPDA 3ZVVA 4MGKE 5JZEB 1EO6A 2KTFA 3ALBA 2KNBA 4FA6A 4MM3A 1E8XA 1TTNA 2VRRB 3H9DA 5C23A 3QK0A 4CO7A 3ZDMC 1WGHA 3B1LX 2JRHA 4EFOA 2N1VA 3IVFA 3UIPB 3DVGY 3VQIA 2M17A 4FLHA 4K7WA 1R4NI 3QHTA 4AJWA 4F1SA 3KYDD 1WE7A 5EDSA 2B3AA 2KJHB 2N7EA 3A4RA 3PSEB 3LJ3A 4GXBA 4HPMB 1J19A 1XQQA 2CHWA 4N9F4 2LJ5A 2L0TA 3KH0A 1EF5A 3K9OB 3PV1A 3QX1A 1EF1A 3PREA 1P0RA 3ZTDA 1J0GA 4WAAA 3QIJA 1E7VA 5D7GA 4EEWA 4DHJD 1LQBA 2ZVNA 5LLIA 2C7MB 2HTHA 3V62A 1WXMA 5IAAC 1V6EA 2NBUA 2ZZPB 4JIOU 2AWTA 2KWCA 3AULA 2N4FA 2KO3A 4E74A 1LM8B 4FULA 4MJSA 3V61A 4ZDVA 2I1KA 3CSTA 2LVQA 1Z5SB 2A4ZA 3ONSA 1WH3A 1ISNA 2MBQA 1I42A 3ZNHB 2PE6B 2KX0A 3L16A 4LCDE 2R2QA 5DCNA 2DYMA 2WX1A 1YX6B 4ANVA 1YD8U 3PLVA 5J2RA 2PPHA 4FADA 4W9CA 3TBLD 3TMPB 2DAJA 3L13A 2KC1A 4GDKB 4W9JA 1E8WA 3HIZA 4KZ0A 1M94A 4MGZE 4A20A 4NAWA 4GDLA 1GC6A 1TGZB 3A9JB 3DVNU 4OVVA 1WGDA 5AZHA 1WF9A 1WXSA 4WJNA 4PS8A 2IO3B 3ZNID 4IW0A 5CHFA 1WY8A 3M3JA 1RLFA 1V80A 4X57B 3V6EB 4DK5A 2KLCA 1UGMA 2GBMA 3DCGA 3PZDA 3RULA 3ZKJC 2D07B 2GBNA 2MCNB 4DBGA 2K8HA 1NBFC 3WAPA 1KOTA 2KFKB 1WXAA 1Q1OA 2OOBB 3QJZA 4G11A 2AYOB 3AU4A 1WZ3A 2K39A 2J0KA 3DVGX 3NOBA 1EUVB 3PLUA 4DHJB 1WMHA 3ZRFA 3GOEA 3BY4B 1WM2A 4PS3A 1WGGA 1VD2A 2IY0B 3KUDB 4GU2A 2O6VD 2DYBA 1R4MI 2JZ3B 2PJHA 4KDIC 4WWOA 2DZKA 4ZYNA 3A4SC 4I6LB 4MEMA 3NY5A 1A5RA 4FJVB 4GOCA 4P7IA 4B6WA 3EFUA 3BINA 3VFKA 4K7UA 4ANUA 1Q5WB 2EKEC 4GSWA 2N7DA 4K7SA 2ZPNA 4FHKA 1S3SG 3H7PA 3VTUA 4II2B 1E7UA 1KLVA 2D2QA 4DHZE 2MLBA 1LXDA 4DWFA 2C7NB 3LDZE 4YL8A 2LZ6A 2FCSA 3CMMB 3DOWA 2N1WA 4NQLB 1P3QU 2BF8B 4PS7A 5BO4B 4FBJB 3IBEA 1TZ1A 3QC8B 4TUUA 4NJ6A 3WAOA 1WX8A 2G4SA 5D94A 3V6CB 3RZFA 2JF5A 4GMVA 5E6NA 2NPTB 4PYUA 1OGWA 1ZGUB 3VHTC 3ZDTA 3WANA 1P98A 4KSLC 1E8ZA 2MP2B 2IO0B 2WDTB 3TCAA 2AEHA 2V3SA 2GOWA 4M8MA 2KX3A 4FN2A 4W9KA 2K8BA 2DAFA 5AZFA 4GIVA 2CKHB 2JRIB 2N9XA 4BOZB 3VDZA 5JH5C 1IYFA 1ZKHA 4JQWC 2RGFA 2D3GA 2KC2A 4IUMB 2M0XA 2KTRB 4K1RB 3ZLZA 4NPNA 2BKRB 2A5UA 2KQSA 5LXIB 3N30A 1HE8A 3PRZA 3ZW3A 3DBHI 1X1MA 2O2VB 4KIKB 2JY6A 3NZSA 1C3TA 2LGXA 5CX3A 4W9FA 1D3ZA 4HK2A 2Z0DB 2O6VB 1OQYA 3IHPC 3A9KB 2FUHB 2I1JA 4BOSC 4WQOB 3PRMB 2YVCA 2RPQA 2ZVOA 3SU8X 3B08A 3HM6X 2FIDA 3M95A 4XZ4A 4DDID 4W9IA 3WA0A 4II3B 3JSVB 3RYTA 1OEYA 3U7DA 2KHWB 2LXAA 1YIWA 2BYFA 1GUAB 2ZEQA 3M63B 2IZVB 1L7YA 2JUOA 3H1UA 2J0MA 2MWSB 2L8JA 1Y8RC 5E6PA 4DHZB 4AOFA 2HD5B 5AEKB 2EMSA 2Z0EB 1V86A 4W9LA 2N9EB 1YJ1A 3R7QA 2IO2B 4FHJA 5LXHA 4GDKA 4NQKE 1AARA 4DDGD 2KN5A 3QARA 2WX0A 2OJRA 1YQBA 3NHEB 4BKSA 3A9JA 4W9HA 4TQ1A 3OAWA 2ZCCA 3R66C 3AI5A 3SD5A 4EUTA 2D11A 4NNJB 5TR5A 3W1SC 4CYEA 3RD2A 2IBIB 3PTFC 4J6IA 2GBJA 2MBEA 4ZRJA 1Z2MA 5AZGA 3QAQA 4AP4C 1L2NA 1U4AA 2Z59B 2V4LA 4W9EA 1WGRA 3ML8A 2CHZA 5KHQA 3EC8A 2DZMA 2JXXA 2XK5B 4AWJA 2REXA 2DX5B 5C1ZA 1WI0A 4BKGA 3NZUA 4ZRIA 4RM8A 4BVUC 3UIOB 4BKTA 4M0WB 2LI5A 3OLMD 3L08A 3VH3B 1Q0WB 4FJZA 3DDCB 2YLMA 1WIAA 1CMXB 4JLCA 2L05A 4WJPA 5FR6A 4XC2A 1LFDA 3JYUA 4WWNA 2ZPYA 3TL5A 4HDQA 1WJNA 1WJ6A 2MA9B 3UF8A 2L00B 1V5TA 3W1YA 1WX7A 4BBNC 4FJYA 3QCAA 3UINB 2KD0A 4IG7B 2WWZA 2BYEA 2KWUB 2KJRA 1T0YA 3D32A 1BT0A 2JPHA 3L10B 3AU5A 2IYDB 2ZCBA 3R3MA 1RRBA 1UD7A 5KHOA 2EMTA 3QWZB 4WWPA 3L0WB 1WR6E 3AXCA 1GNUA 2JWZA 3CF6E 3RT3B 4GDLB 2KOXA 1WYWB 4EZLA 5J17A 2Y5BB 3L17A 2DENB 4IWPA 1V9JA 2KMAA 3HM3A 4TKNA 3T9LA 2M4NA 3PGEA 4RM9A 2RD0A 1UELA 3O65B 3DQVA 3U8ZA 4HCPB 3KYCD 3VUWA 3VVWB 2L76A 5IA7A 1SGHA 3ZO5B 4AJYB 3NS8A 3ENEA 4W9DA 3ML9A 1E90A 2L7RA 1IPGA 4KV2A 2KTRA 2KXJA 2HJ8A 1WMHB 2KZRA 1F9JA 1UZXB 3K9PB 3L54A 4E3CA 2KDFB 2RSUA 1WJUA 3H7SA 1G6JA 3IG3A 1VCBA 1P9DU 2C5LC 3EHVA 2BWFA 3R7RA 3JW0X 5DPTA 1E5WA 1GG3A 2C7HA 2NR2A 2O2VA 2NCNA 4I6NB 5DPRA 4KSKC 2K8CA 4KIKA 4NY0A 3DBSA 3VAWA 2LASA 1MG8A 4HLEA 1V5OA 2CHXA 4ASWC 2K25A 3ZRCA 1WM3A 3MJWA 2KKCA 4TQ0A 4F7ZA 2MQJA 4IWQA 4AUQC 1V49A 1ZW7A 2JT4B 2BYVE 4E71A 4RMAA 2LVPA 2DZJA 4HWIB 1WE6A 2KLGA 2UYZB 3APCA 3GZNI 3H7PB 4LJPB 1SE9A 2JZZA 1YX5B 1RFAA 2G4DB 1P1AA 3A1QB 4IC7B 3JSVA 2LXCA 3UQBA 2J0JA 5DPSA 2IY1B 4MGYE 1PQSA 1I35A 5D2MB 3Q3JA 3VUYA 2G45B 3KW5B 1SIFA 5JHBA 2KMCA 4JGHB 4K81A 2CS4A 3PHWB 3ZNGC 1XD3B 4BKSD 5L83A 2ZNVC 3VTWA 2GMIC 2NS5A 2ZJDA 2D10A 2KVRA 2N9PC 2M8SA 4G3XB 1QZEA 1WZ0A 2KWVB 3APFA 4JL9A 3C0RB 4IWOA 2KK8A 3DVNV 4CHKA 3TIXA 3RCZA 4KDLB 4PYZA 1UH6A 4A3PA 3T8MA 3ZIMA 2LUEA 3IFWB 4ICUA 4B95A 3PHXB 1S1QB 2BPSA 3HK0A 3A33B 2MBBB 3RUIB 3V60A 4LDTD 4GN1A 3DBLI 2C60A 2XK5A 3TJPA 4G0NB 2KJ6A 4A3OA 1J8CA 1H4RA 4BFRA 3OJ4B 5JHAA 4W9GA 4MELA 1WX9A 2KDEB 3WIMA 3OJ3A 4B9KA 4EKUA 2IO1B 4MGIE 3JVZX 3I3TB 1OEYJ 3Q3FA 4IM3A 2DZIA 4ANXA 1WFYA 3PS6A 2MRPA 3X0WA 4MSQB 2KFKA 2XBBC 2K6QA 2G3QB 3PT2B 4GB9A 4BBNF 3MTNB 3SDLC 2BGFA 2LRUA 4HPLB 1XT9B 4LJOB 2MX2A 2JVCA 2PEAA 2WYQA 3QQ8B 4G50A 2FNJB 4EOYA 4IM2A 1WGYA 1V81A 2AL3A 2FCQA 2NBWB 1C1YB 5G55A 4MH0E 3B0AA 5HKHA 2LRWA 4MJSB 1JRUA 3PPAA 2KQ7A 3WAMA 2DYOA 3QA8A 2MBOA 4URKA 2AL6A 2FCNA 2L0FA 3KVFB 1GJZA 2NVUI 4MSMB 3VXWA 3X23A 5J18A 2KDBA 2KFJA 4EZJA 2CR5A 2GBKA 3WALA 4GGQA 2UWQA 3APDA 5DPWA 2NBVB 2K6DB 3P2BA 4ANWA 4WJOA 3ZNZB
chains in the Genus database with same CATH superfamily
4XX5A 4O1NA 4D2KA 2WGSA 2WDQB 2L52A 2KANA 2NPTA 5AUKA 4IM0A 2VZKD 3RZWC 1P7EA 1UBQA 4HCNB 3GE8C 1MFWA 3CSFA 1GC7A 2KT7A 2X38A 4YT0B 2K1FA 5L95C 2V9HA 1KJTA 2WLBA 2KDIA 4KVGB 5G2NA 3BVZA 4F8CB 2CJNA 1SSNA 2ZNVB 1L0XB 2HE7A 5CHWA 2O6VA 2PE9A 2C9WB 3AM9A 3AEFB 3KUCB 2QHOA 1RAXA 3HHMA 1NI2A 1IP9A 2D3CA 4LNNA 4P1CC 5JZEB 1EO6A 1E8XA 1TTNA 1TS4A 4CO7A 1MHXA 1L4ZB 3ZDMC 3PO0A 3AE5B 2M17A 4K7WA 3Q3NC 4F1SA 1QOAA 4C7ZA 3FAHA 3A4RA 4HPMB 1XQQA 2XN9C 2L0TA 3KH0A 1EF5A 4RGOS 4ZHOA 1OQQA 1J0GA 1P0RA 3ZTDA 3AMZA 3GP7A 1E7VA 2J52A 1LQBA 3VR9B 2INDC 2W55A 5GXGB 1V6EA 2YEPB 2LEKA 2ZZPB 4JIOU 2AWTA 2KWCA 4ACFA 3T3OA 3AE8B 3BVMA 3Q8EA 1MI0A 4MJSA 5C2TB 3CSTA 3Q6BA 1ISNA 1I42A 2MEKA 3V3XA 3BVGA 5DCNA 1DYQA 1YNTE 3AECB 4ANVA 3PLVA 4FADA 4W9CA 3TBLD 2BBCA 5E6JA 4RCOA 3HIZA 1SE3A 4MGZE 1GC6A 4OVVA 1YQ3B 2IO3B 4P6VF 1WY8A 1V80A 3V6EB 1QLBB 3DCGA 3AV8A 3RULA 3ZKJC 3TUOA 2VH1A 2K8HA 2KFKB 3AU4A 1EUVB 2WQYB 4PS3A 3KUDB 4KDIC 4WWOA 5D3DA 3W2DA 1EU3A 4TMAB 2ACZB 3TEWA 4K7UA 1TKGA 1ACCA 4ANUA 2EKEC 1DOYA 2Y3AA 3Q3OC 2MH7A 3VTUA 4YWGG 1T0SC 1KLVA 4C56C 4XYCA 4DHZE 2WXKA 1LXDA 4YL8A 5FR3A 2BF8B 4PS7A 2J4XA 4FBJB 1TZ1A 3ZQ4A 1WX8A 2KMMA 2RPVA 5D94A 3P42A 3RZFA 3DWGC 1KRHA 5E6NA 2NPTB 1ZGUB 3WANA 4KKJA 4KSLC 2WDTB 1R7SA 2V3SA 2KX3A 2K8BA 4BZAA 2JRIB 4IKGA 3EA6A 5JH5C 4KGSA 1ZE3D 4ZRPA 1NVID 1X1MA 5BMIA 4KIKB 2LGXA 1D3ZA 2Z0DB 2O6VB 2UU7A 1OQYA 3IHPC 2IDYA 3R2IA 2W54A 3PZ7A 1ZP0B 1B1ZA 4B0EA 3IAM1 3PRMB 2RPQA 2ZVOA 3HM6X 2MJDA 2BB6A 1K50A 4DDID 1F0ZA 4W9IA 1OFFA 3IT4B 2KHWB 2LXAA 3NG0A 2BYFA 1KF6B 1VDVA 3DWMA 2IZVB 2JUOA 3H1UA 2PTLA 2AQ3B 4AOFA 2EMSA 1V86A 3ZJUA 2N9EB 4YSZB 1ZXHA 2KAJA 2IO2B 5LXHA 2KN5A 4JWUC 1FRRA 3OAWA 3TSSA 5TSSA 1R4MB 3BZDB 3RD2A 3PTFC 1K51A 2GBJA 2MBEA 3EGRA 4LNOA 4ZRJA 1QKZA 4AP4C 1L2NA 2V4LA 3T3NA 5KHQA 3ML8A 2CHZA 3EC8A 1IGCA 2DX5B 3NVYA 4BKGA 3VH3B 3DDCB 1WIAA 4JLCA 2L05A 4WIPA 5FR6A 4XC2A 4HKZE 1LFDA 3JYUA 3MHZA 4L1BA 3UF8A 2E3TA 1WX7A 4N58A 2W82A 3L4PA 3MJ5A 1TS3A 2XNAC 2KD0A 2WWZA 3L10B 3R3MA 1UD7A 5T8IA 3AEAB 2EMTA 3QWZB 1MPEA 4WWPA 1WR6E 2BQQA 3CF6E 2R61A 1SXTA 1WXQA 3L17A 2DENB 2LJIA 4IWPA 2M4NA 4DXGA 4RM9A 1UELA 3DQVA 1TIFA 3U8ZA 3VUWA 3KYCD 1QOGA 2L76A 3AE4B 4LNKA 4W9DA 1IPGA 4KV2A 1UZXB 2E6XA 1JALA 3J9CA 1WJUA 2C5LC 5BMGA 2BWFA 1GG3A 2K8CA 2LASA 3KWVA 1JMLA 1WM3A 2KKCA 1NYRA 2BYVE 4E71A 1FNWA 2PVGC 3WCQA 4LJPB 1KH0A 3U7ZA 2EKIA 2JZZA 1RFAA 1P1AA 4IC7B 3ZGZA 4A8XC 2J0JA 5DPSA 2JU6X 3Q3JA 1I4RA 1HZ6A 1ET9A 2CS4A 4HJGE 3ZNGC 2GRIA 4BKSD 1GAQB 2ZJDA 2KVRA 2N9PC 1K53A 2KWVB 4JL9A 1D5XC 2DLBA 4Q2JA 3Q69A 1UH6A 2JWUA 2SEBD 4A3PA 1ZXIA 4B95A 3PHXB 1JWUD 3Q8FA 1J8CA 2C60A 2XK5A 4A3OA 2HDEA 3IXSA 4B9KA 4MELA 2BS3B 4MGIE 5H92C 1OEYJ 1WFYA 3PS6A 2V4IB 3PT2B 4BBNF 3MTNB 3LXFA 5G5GA 2BGFA 4XWTA 2JVCA 2WYQA 3QQ8B 4EOYA 4MH0E 4C80A 3WAMA 2DYOA 3QA8A 4LTUA 4MSMB 1HTOA 2QSDA 4IOIE 4EZJA 2UWQA 3APDA 2VRRB 3PVLA 3RNFC 3UGBB 4L2YA 4NJCA 1C4PA 3TEYA 1K8RB 2ONQA 4ZRKA 1NDDA 5E6OA 2WU2B 3ZTCA 3B2GA 2WXFA 2VH2A 3ZUNA 2MSED 3GZNB 4EZKA 2KDMA 2FCMA 2MW5A 2MBHA 3VR8B 1WXVA 2AQ1B 3MHSD 1UBIA 1OQRA 1YN4A 4JE3B 1P7FA 4I6PA 4TV3A 1V2YA 3VTVA 5D3IB 1C78A 3AE6B 4HDOA 1C4CA 2LGYA 4MDKE 1V1PA 2FIFA 4ARIA 4HJKA 1QOFA 3EECA 2BKFA 3OWEB 4L23A 1ESFA 4ICVA 4DXAB 2FAZA 3A9KA 3VUXA 1WSPA 3V05A 1D5ZC 1UNSA 3B9JA 3FKYA 5BMHA 2CU1A 2LGSA 3DPDA 2JYEA 4TSSA 2Y5CA 4MM3A 3QK0A 4EFOA 2JRHA 2N1VA 3UIPB 3VQIA 4FLHA 2WDRB 4AJWA 1WE7A 3LJ3A 1CZPA 3RN9C 2LJ5A 1FXAA 1IGDA 3PREA 4YTPB 4C00A 5D7GA 2C7MB 1WGKA 1DOIA 2HTHA 4ZOHC 3AE1B 3AULA 4NAMA 1L0VB 2KO3A 4USAA 4E74A 4ZHPA 2LVQA 4WURA 1Z5SB 2ICIA 1FEHA 2RDGA 1CJEA 3ZJVA 3U4EG 4LCDE 3BYTB 3AEDB 1I7HA 3DBRB 5HFYA 1YX6B 5J2RA 1FMAD 2PPHA 1F77A 3TMPB 1EM7A 2KC1A 3NJTA 1E8WA 1M94A 4NAWA 4GDLA 2D3BA 1WGDA 1F52A 1Y56A 4X57B 4DK5A 3PZDA 2D07B 3QJZA 2AYOB 1FRDA 1WZ3A 2J0KA 3DVGX 3NOBA 2BS4B 4OW0A 3GOEA 2O6VD 2DYBA 1R4MI 2FE8A 4I6LB 4GOCA 1HZ5A 1L5PA 1SE4A 2MHJA 2N7DA 4K7SA 2ZPNA 4GLSC 1R4NB 2AQ2B 4KX6B 2FCSA 2N1WA 5BO4B 1HTQA 3HRDD 4WQMA 2G4SA 3V6CB 1RFKA 3VHTC 1PUTA 3MFGA 1RM6C 3AEEB 4FN2A 5AZFA 3BWUD 4GIVA 3U2SC 3AEGB 1ZKHA 3IAS1 2D3GA 4IUMB 2KTRB 4K1RB 2BKRB 2A5UA 5LXIB 1SB3C 3RNEC 3VRBB 2IGHA 2L32A 3PRZA 2BVCA 3KLSX 2O2VB 2JY6A 3NZSA 4W9FA 3Q14C 3A9KB 2I1JA 4WQOB 2WXOA 2FIDA 4XZ4A 3WA0A 4II3B 1N62A 1YIWA 1FO4A 3M63B 3NVZA 4WWMA 4C4VA 1RYJA 2J0MA 1Y8RC 5E6PA 4ZRQA 4DQOC 5AEKB 3DHGC 1YJ1A 1QF6A 4GDKA 4NQKE 1N63A 5HG2A 2WX0A 2OJRA 1YQBA 1FFVA 3A9JA 4W9HA 1QQRA 3R66C 1I4XA 1VZ8A 4NNJB 5TR5A 4CYEA 4OZAA 4A55A 1DGJA 4W9EA 4US8A 5LNK1 2JXXA 2REXA 1C79A 3NZUA 4PK1A 3AE9B 4ZRIA 4RM8A 3UIOB 4BKTA 4M0WB 3P4SB 1XLOA 2H89B 4WJPA 3W5UB 3TL5A 3ZYYX 4HDQA 2MA9B 3SFEB 1XO3A 3NRZA 3W1YA 3QCAA 3UINB 2K0PA 2INPE 2BYEA 2KJRA 2JPHA 1ZOYB 3AU5A 3GE3C 2ZCBA 1RRBA 1V1OA 2M0AA 3EUB2 1GNUA 2JWZA 3RT3B 3Q8CA 4GDLB 1WYWB 2IGGA 1V9JA 1IBXB 3DBHB 2PIAA 2CJOA 2RD0A 1UGJA 2ZW1A 1SGHA 2KQ4X 3ZO5B 3NS8A 2HJ8A 2KZRA 3K9PB 2KACA 3RNCC 1P9DU 3EHVA 1E5WA 2NR2A 4I6NB 4NY0A 2FBWB 4F7ZA 4AUQC 1V49A 1ZW7A 4RMAA 2LVPA 4RFBA 3GZNI 3APCA 3R2TA 1TY2A 1F2RC 4PT5A 4RGTA 1YX5B 4OZBA 2NMQA 2WP9B 5EE0A 2ZW0A 3DBLB 3JSVA 3BIID 4M01A 5G5HA 1I35A 2G45B 3B2FA 5JHBA 2KVZA 3PHWB 1SF0A 3CIRB 3ETRA 2BYTA 2ZNVC 2HTME 2NS5A 1NEKB 2M8SA 1F1HA 1UWMA 1WZ0A 4G3XB 1GB1A 4IWOA 4CHKA 3TIXA 2JYTA 2NTTA 1PGXA 4ICUA 3BYYB 2MJ3A 1H4RA 2QC8A 1GPXA 2G1EA 1WX9A 2KDEB 3OJ3A 2IO1B 3JVZX 3Q3FA 4ANXA 1JWSD 1YMHE 2WXMA 3SDLC 4EE2A 1QILA 4LJOB 2MX2A 2PEAA 4C4VB 1C1YB 3B0AA 4MJSB 2LHEA 3PPAA 2KQ7A 2V0GA 4URKA 2FCNA 2L0FA 2WXQA 2NVUI 3VXWA 3N9YC 2KDBA 2KFJA 1FNVA 4RF0A 1FFUA 3P2BA 4ANWA 4WJOA 2BB5A 1YN3A 2AX5A 5CTRC 4HVBA 4HEA1 3PRPB 4LNFA 3U30A 1XF5L 2RMMA 2M1MA 1VR9A 1FM0D 2V1YA 3DBRI 3SFDB 1TBEA 1V8CA 1FIQA 2NTSA 1WRDB 2J7QB 2JQRB 2R2OA 3AE3B 1A70A 3H6NA 3SR6A 2RR9A 1L6VA 2LWPA 2L3ZA 3A1QA 2DBYA 4OVUA 1QOBA 4RGNA 4YSXB 1MHHE 3S2AA 1WJ4A 3SHQA 1FXTB 4M8NA 3ZXVA 3ZVVA 2KTFA 3ALBA 2KNBA 3H9DA 4S17A 3B1LX 3DVGY 5BYSA 1R4NI 4ZYSA 3KYDD 5EDSA 1T5XD 1XCQL 2KJHB 4XGAB 3DHIC 1PGAA 1ROEA 3PSEB 1J19A 2CHWA 3K9OB 1EF1A 3HUIA 4WAAA 3QIJA 4A6QA 5IOIA 2MJEA 4EEWA 2ZVNA 5LLIA 3V62A 1XLPA 1UUPA 4RGMA 5IAAC 1HEZE 2NBUA 4K3BA 4MT5A 2QILA 2N4FA 4OVZA 3V61A 4ZDVA 2WHIA 2K3UA 2A4ZA 1TT5B 1LO5D 2MBQA 2PW9A 3GS2A 3ZNHB 2PE6B 3PZ8A 3L16A 4S0RA 2R2QA 2DYMA 2WX1A 2INCC 5EE1A 5H8YE 2DAJA 3L13A 3AE7B 4A20A 1JQ4A 1E0ZA 1WXSA 4WJNA 4PS8A 3ZNID 5CHFA 3LB8C 3M3JA 1RLFA 1UGMA 1C9FA 2GBNA 3OG5A 4DBGA 1JW9D 1FNUA 2WXJA 1XXGA 3ZJTA 1Q1OA 4G11A 2BS2B 2K39A 3AB5A 3PLUA 3GB1A 4DHJB 3ZRFA 3BY4B 2PLPA 1WGGA 4GU2A 5FK9C 2JZ3B 2DZKA 3A4SC 1A5RA 2INNE 4P7IA 4UDUC 4B6WA 1MJDA 3EFUA 3BINA 2ON8A 3MP9A 5IO9A 5IKCM 1L0YB 1Q5WB 1KLGD 3URYA 4HKQA 4FHKA 1I4QA 4II2B 1E7UA 2D2QA 4ITKA 1SE2A 3LDZE 3CMMB 3RMKC 4HRSA 1P3QU 5FKAC 3IBEA 4TUUA 4NJ6A 2X8XX 3E9SA 4GMVA 4PYUA 1BXTA 1OGWA 3ZDTA 1PDXA 1E8ZA 2GI9A 2IO0B 3TCAA 2AEHA 1I4GA 2GOWA 4M8MA 4W9KA 3N20C 1YJIA 4LK0M 2I2YA 2KC2A 3ZLZA 1FCCC 4A90A 2N0SB 4NPNA 2KQSA 2OEDA 3N30A 1AYFA 1TZOA 3ZW3A 3DBHI 1I4PA 1ET6A 4OZCA 2IJ0A 1KFYB 2FUHB 3R8BA 4BOSC 1HXYD 3I9V1 3SU8X 3M95A 3UI3A 2JX5A 1TYGB 4A9AA 3RYTA 3U7DA 3CWIA 3RNGC 1YN5A 2W3SA 4HPPA 4DHZB 2Z0EB 1FD6A 4FHJA 2Q5WD 2WXLA 4TQ1A 2ZCCA 2D3AA 3SD5A 4EUTA 3AH7A 3W1SC 1T6BX 1TS2A 3QAQA 4LNIA 1E9MA 2Z59B 1WGRA 4M00A 2EELA 2XK5B 5C1ZA 2G9HD 2L1AA 1WI0A 2RDHA 2LGIA 2LI5A 3OLMD 1BMLC 4FJZA 1WYGA 4US9A 5JXVA 2QEJC 1WJNA 1WJ6A 2L00B 4IG7B 2WXPA 1T0YA 2IYDB 4YTMB 2I38A 3AXCA 1PFDA 3AEBB 1IUEA 3W9CB 5J17A 2Y5BB 1K52A 1TJEA 1T0RC 3O13A 4TKNA 3PGEA 3T9LA 1WWTA 4HCPB 5IA7A 1JROA 3ENEA 1E90A 2L7RA 2K9XA 2KXJA 4E3CA 1F9JA 2KDFB 2RSUA 3RNBC 3IG3A 1VCBA 2QIEB 1KLUD 3R7RA 5DPTA 5DPRA 2C7HA 2HJ1A 2LFIA 4KIKA 3I57A 3DBSA 1FCLA 1V5OA 2CHXA 4ASWC 1N5WA 4TQ0A 3MJWA 2MQJA 4IWQA 5BYRA 3H8HA 1V1PB 2M56B 2KWDA 2G4DB 2LXCA 3NVVA 1VZ7A 1PQSA 5D2MB 3VUYA 4JX1C 1TKYA 4OHJA 1T0QC 1FPYA 3P4QB 1XD3B 5L83A 5IP4D 2GMIC 2D10A 4MM3B 1QZEA 3APFA 5C3JB 3DHHC 1MVKA 3TEZA 4B0MA 4KDLB 1QT9A 4PYZA 1TS5A 3T8MA 3ZIMA 2LUEA 1S1QB 2BPSA 3HK0A 3A33B 3TJPA 4G0NB 4ARCA 3OJ4B 5JHAA 3WIMA 4EKUA 1L4DB 3I3TB 1M4VA 3NS1A 4IM3A 2DZIA 2WXHA 3Q8BA 3U52E 2MRPA 2SAKA 1E7PB 3P1MA 2XBBC 2K6QA 2H88B 2LRUA 4HPLB 1XT9B 3LYYA 4P16A 3SEBA 4G50A 2FNJB 4N6EB 1WGYA 2TSSA 1V81A 4LLGM 3MC8A 2LRWA 3Q3MC 3NZ3A 2WXGA 2MBOA 3BK2A 2AL6A 1GJZA 3X23A 5J18A 1ZDVA 5IN7A 2CR5A 4KGRA 4MH8A 4GGQA 2K6DB 3ZNZB 3IT6B 2QCZA 1OTRB 3VH4B 4WH4A 1TKEA 3FILA 4NAWB 3VRAB 1VJKA 2WDVB 1D6EC 1JWBD 2XEWA 5GMVA 3UQAA 2MP2A 3KUZA 4LDTB 1D4BA 2JSVX 2ASQA 1H8CA 2BWES 2LMCA 4YTNB 3ECIA 3N3KB 2PKOA 1SBBB 5BYQA 4NJ7A 5D6JB 4HXDA 4JWSC 1WR1A 1GB4A 2KN4A 2LVOA 2GBRA 4J3OD 1C76A 2DHZA 2N9LA 3M62B 1E8YA 3N32A 4C7YA 4KZCA 5CHVC 3W1SA 2LD9A 1KM7A 2W9NA 4WJQA 2LGDA 4MGKE 1XLQA 4FA6A 4K3CA 3Q2AC 3P4PB 5C23A 1J7BA 1WGHA 3IVFA 2W3RA 3P63A 3QHTA 2LUMA 1EU4A 2B3AA 2N7EA 2VZKB 4AS1A 3I5JC 2WXRA 4GXBA 1Q10A 4N9F4 1SJHD 2QJLA 3PV1A 3QX1A 1E10A 2Y5PA 1UF0A 4DHJD 1WXMA 4RF1A 3KQ4A 2JXTA 4REZA 1FXIA 1LM8B 4FULA 2BW2A 2I1KA 2M19A 2YEPF 3AN1A 1B9RA 3ONSA 1WH3A 2K22A 2KX0A 1T3QA 1AN8A 1YD8U 1YOVB 4RH6A 4GDKB 4W9JA 4KZ0A 1N6ZA 1TGZB 3DVNU 3A9JB 5AZHA 1NI3A 1WF9A 4IW0A 4KKIA 2KLCA 3NUHB 2QMTA 2GBMA 1YQ4B 2K5PA 2MCNB 1NBFC 3WAPA 1KOTA 1WXAA 2OOBB 4M02A 1VLBA 3HVDA 1WMHA 1WM2A 3TEXA 1VD2A 2IY0B 1NENB 1N5XA 2PJHA 4ZYNA 4MEMA 3NY5A 1CK1A 4FJVB 2IPKD 3VFKA 3NVWA 4GSWA 4CQNA 2WS3B 1STEA 4IDIA 1S3SG 2FUG1 3H7PA 3RPFC 1LGRA 2MLBA 4DWFA 2C7NB 3ZXRA 2LZ6A 3EFCA 3DOWA 4NQLB 1KTKA 3FILB 3QC8B 4MACA 3WAOA 2V3NA 5MPOA 2PMVA 1JCKB 2JF5A 2N7JA 1P98A 2V3PA 2MP2B 4KGTA 1J7CA 2DAFA 2CKHB 2N9XA 4DXFA 4BOZB 2N9KA 3VDZA 3HVZA 2KYWA 1IYFA 4JQWC 2RGFA 2M0XA 1HE8A 1RWSA 1JWMD 4XDCA 1PGBA 3N1XC 4YXDB 1C3TA 5CX3A 1F2RI 4HK2A 2PVOD 2YVCA 3B08A 1BUIC 1J7AA 3JSVB 1AWDA 1OEYA 4XE0A 1C4AA 2BT6A 1ZDXA 1GUAB 2ZEQA 1L7YA 4BAXA 2MWSB 1CQVA 2L8JA 1C77A 3AE2B 2HD5B 4W9LA 1EWCA 3R7QA 2GLSA 1AARA 3N1ZC 3QARA 1ENFA 3BK1A 1DOXA 3NHEB 4BKSA 3MC9A 3KWLA 3AI5A 4HROA 2Z8LA 2D11A 5HI1A 2IBIB 4J6IA 1XEEA 1Z2MA 3I63C 5AZGA 2WXIA 2JZPA 1U4AA 3N1YC 1V97A 2DZMA 4AWJA 2DWQA 4BVUC 3L08A 4XDDA 1Q0WB 3FC4A 2YLMA 2OHFA 3W5VB 1CMXB 3ABVB 4WWNA 2ZPYA 3RFZB 1V5TA 4BBNC 4FJYA 3RNAC 2KWUB 3D32A 5EE3A 1BT0A 4NZLB 5KHOA 1N61A 3MC0B 3L0WB 4P1BC 1MG4A 1E6EB 2B76B 2KOXA 3P4RB 4EZLA 1L6UA 2KMAA 3HM3A 2QDFA 3O65B 3VVWB 1NYQA 4AJYB 5AUIA 2J42A 1D5MC 4RNAA 3ML9A 1GOZA 2KTRA 1WMHB 3L54A 3H7SA 1G6JA 5HHDG 4QAYA 1TY0A 3JW0X 1JWAD 4DDGD 2O2VA 2NCNA 4H2AA 4KSKC 2D5GA 3VAWA 4HLEA 1MG8A 1JRPA 1N60A 2K25A 3ZRCA 2GB1A 1HQRD 2JT4B 1XCTL 4YSYB 2DZJA 4HWIB 1WE6A 1SJED 2KLGA 2UYZB 3H7PB 4JPSA 1SE9A 1ZUD2 3A1QB 3UQBA 1HA5A 2IY1B 1EWYC 4MGYE 4FXCA 1PYWD 5I4DA 3KW5B 1SIFA 1XLNA 4AQ7A 2KMCA 4K81A 4JGHB 2J53A 3E56A 3RI7C 1SIJA 3VTWA 2CU3A 1AW7A 2LHDA 3C0RB 2KK8A 4WAFA 3DVNV 3RCZA 1I4HA 1ZPSA 2BTEA 1VZ6A 3IFWB 5EE9A 3RUIB 3V60A 5HKHA 2MBBB 4LDTD 4GN1A 3DBLI 2KJ6A 2DNFA 4BFRA 4W9GA 2OJWA 4M0WA 1UWXA 1YJJA 3X0WA 4MSQB 2KFKA 4GB9A 3C8YA 2G3QB 2RDBC 3C19A 4IM2A 2AL3A 2FCQA 2NBWB 4N59A 5G55A 1VRAB 1JRUA 2IGDA 4XWWA 3Q8AA 1SEBD 2L83A 1WRIA 3KVFB 4R3DA 2WNMA 2GBKA 3WALA 2WXNA 5DPWA 2NBVB 1IBXA 2WU5B
chains in the Genus database with same CATH topology
3PVLA 3UGBB 1OTRB 3VH4B 4XX5A 5CTRC 4HVBA 1K8RB 3PRPB 4ZRKA 4NAWB 3U30A 1NDDA 5E6OA 3ZTCA 3ZUNA 2M1MA 2KANA 2MSED 2NPTA 2XEWA 4IM0A 5GMVA 3RZWC 4EZKA 2FCMA 3UQAA 1UBQA 2MW5A 2MP2A 2MBHA 3KUZA 4LDTB 1WXVA 2V1YA 3MHSD 4HCNB 1UBIA 3DBRI 2ASQA 3CSFA 1H8CA 1GC7A 1TBEA 2BWES 2K1FA 5L95C 3ECIA 1WRDB 2J7QB 4I6PA 2R2OA 1KJTA 3N3KB 4TV3A 1V2YA 3VTVA 2KDIA 4KVGB 5G2NA 4HDOA 2LGYA 4MDKE 4F8CB 3H6NA 4NJ7A 2FIFA 5D6JB 4HXDA 1WR1A 4HJKA 2ZNVB 2LVOA 3EECA 2BKFA 2GBRA 2RR9A 2LWPA 2HE7A 2L3ZA 3A1QA 5CHWA 2DHZA 2O6VA 2PE9A 4ICVA 4OVUA 4DXAB 2FAZA 3A9KA 3M62B 2C9WB 1E8YA 3KUCB 3N32A 2QHOA 3S2AA 1WJ4A 1RAXA 3SHQA 3VUXA 3HHMA 4KZCA 5CHVC 3W1SA 1FXTB 4M8NA 1NI2A 2LD9A 1KM7A 2W9NA 1IP9A 4WJQA 2CU1A 2LGDA 3DPDA 3ZVVA 4MGKE 5JZEB 1EO6A 2KTFA 3ALBA 2KNBA 4FA6A 4MM3A 1E8XA 1TTNA 2VRRB 3H9DA 5C23A 3QK0A 4CO7A 3ZDMC 1WGHA 3B1LX 2JRHA 4EFOA 2N1VA 3IVFA 3UIPB 3DVGY 3VQIA 2M17A 4FLHA 4K7WA 1R4NI 3QHTA 4AJWA 4F1SA 3KYDD 1WE7A 5EDSA 2B3AA 2KJHB 2N7EA 3A4RA 3PSEB 3LJ3A 4GXBA 4HPMB 1J19A 1XQQA 2CHWA 4N9F4 2LJ5A 2L0TA 3KH0A 1EF5A 3K9OB 3PV1A 3QX1A 1EF1A 3PREA 1P0RA 3ZTDA 1J0GA 4WAAA 3QIJA 1E7VA 5D7GA 4EEWA 4DHJD 1LQBA 2ZVNA 5LLIA 2C7MB 2HTHA 3V62A 1WXMA 5IAAC 1V6EA 2NBUA 2ZZPB 4JIOU 2AWTA 2KWCA 3AULA 2N4FA 2KO3A 4E74A 1LM8B 4FULA 4MJSA 3V61A 4ZDVA 2I1KA 3CSTA 2LVQA 1Z5SB 2A4ZA 3ONSA 1WH3A 1ISNA 2MBQA 1I42A 3ZNHB 2PE6B 2KX0A 3L16A 4LCDE 2R2QA 5DCNA 2DYMA 2WX1A 1YX6B 4ANVA 1YD8U 3PLVA 5J2RA 2PPHA 4FADA 4W9CA 3TBLD 3TMPB 2DAJA 3L13A 2KC1A 4GDKB 4W9JA 1E8WA 3HIZA 4KZ0A 1M94A 4MGZE 4A20A 4NAWA 4GDLA 1GC6A 1TGZB 3A9JB 3DVNU 4OVVA 1WGDA 5AZHA 1WF9A 1WXSA 4WJNA 4PS8A 2IO3B 3ZNID 4IW0A 5CHFA 1WY8A 3M3JA 1RLFA 1V80A 4X57B 3V6EB 4DK5A 2KLCA 1UGMA 2GBMA 3DCGA 3PZDA 3RULA 3ZKJC 2D07B 2GBNA 2MCNB 4DBGA 2K8HA 1NBFC 3WAPA 1KOTA 2KFKB 1WXAA 1Q1OA 2OOBB 3QJZA 4G11A 2AYOB 3AU4A 1WZ3A 2K39A 2J0KA 3DVGX 3NOBA 1EUVB 3PLUA 4DHJB 1WMHA 3ZRFA 3GOEA 3BY4B 1WM2A 4PS3A 1WGGA 1VD2A 2IY0B 3KUDB 4GU2A 2O6VD 2DYBA 1R4MI 2JZ3B 2PJHA 4KDIC 4WWOA 2DZKA 4ZYNA 3A4SC 4I6LB 4MEMA 3NY5A 1A5RA 4FJVB 4GOCA 4P7IA 4B6WA 3EFUA 3BINA 3VFKA 4K7UA 4ANUA 1Q5WB 2EKEC 4GSWA 2N7DA 4K7SA 2ZPNA 4FHKA 1S3SG 3H7PA 3VTUA 4II2B 1E7UA 1KLVA 2D2QA 4DHZE 2MLBA 1LXDA 4DWFA 2C7NB 3LDZE 4YL8A 2LZ6A 2FCSA 3CMMB 3DOWA 2N1WA 4NQLB 1P3QU 2BF8B 4PS7A 5BO4B 4FBJB 3IBEA 1TZ1A 3QC8B 4TUUA 4NJ6A 3WAOA 1WX8A 2G4SA 5D94A 3V6CB 3RZFA 2JF5A 4GMVA 5E6NA 2NPTB 4PYUA 1OGWA 1ZGUB 3VHTC 3ZDTA 3WANA 1P98A 4KSLC 1E8ZA 2MP2B 2IO0B 2WDTB 3TCAA 2AEHA 2V3SA 2GOWA 4M8MA 2KX3A 4FN2A 4W9KA 2K8BA 2DAFA 5AZFA 4GIVA 2CKHB 2JRIB 2N9XA 4BOZB 3VDZA 5JH5C 1IYFA 1ZKHA 4JQWC 2RGFA 2D3GA 2KC2A 4IUMB 2M0XA 2KTRB 4K1RB 3ZLZA 4NPNA 2BKRB 2A5UA 2KQSA 5LXIB 3N30A 1HE8A 3PRZA 3ZW3A 3DBHI 1X1MA 2O2VB 4KIKB 2JY6A 3NZSA 1C3TA 2LGXA 5CX3A 4W9FA 1D3ZA 4HK2A 2Z0DB 2O6VB 1OQYA 3IHPC 3A9KB 2FUHB 2I1JA 4BOSC 4WQOB 3PRMB 2YVCA 2RPQA 2ZVOA 3SU8X 3B08A 3HM6X 2FIDA 3M95A 4XZ4A 4DDID 4W9IA 3WA0A 4II3B 3JSVB 3RYTA 1OEYA 3U7DA 2KHWB 2LXAA 1YIWA 2BYFA 1GUAB 2ZEQA 3M63B 2IZVB 1L7YA 2JUOA 3H1UA 2J0MA 2MWSB 2L8JA 1Y8RC 5E6PA 4DHZB 4AOFA 2HD5B 5AEKB 2EMSA 2Z0EB 1V86A 4W9LA 2N9EB 1YJ1A 3R7QA 2IO2B 4FHJA 5LXHA 4GDKA 4NQKE 1AARA 4DDGD 2KN5A 3QARA 2WX0A 2OJRA 1YQBA 3NHEB 4BKSA 3A9JA 4W9HA 4TQ1A 3OAWA 2ZCCA 3R66C 3AI5A 3SD5A 4EUTA 2D11A 4NNJB 5TR5A 3W1SC 4CYEA 3RD2A 2IBIB 3PTFC 4J6IA 2GBJA 2MBEA 4ZRJA 1Z2MA 5AZGA 3QAQA 4AP4C 1L2NA 1U4AA 2Z59B 2V4LA 4W9EA 1WGRA 3ML8A 2CHZA 5KHQA 3EC8A 2DZMA 2JXXA 2XK5B 4AWJA 2REXA 2DX5B 5C1ZA 1WI0A 4BKGA 3NZUA 4ZRIA 4RM8A 4BVUC 3UIOB 4BKTA 4M0WB 2LI5A 3OLMD 3L08A 3VH3B 1Q0WB 4FJZA 3DDCB 2YLMA 1WIAA 1CMXB 4JLCA 2L05A 4WJPA 5FR6A 4XC2A 1LFDA 3JYUA 4WWNA 2ZPYA 3TL5A 4HDQA 1WJNA 1WJ6A 2MA9B 3UF8A 2L00B 1V5TA 3W1YA 1WX7A 4BBNC 4FJYA 3QCAA 3UINB 2KD0A 4IG7B 2WWZA 2BYEA 2KWUB 2KJRA 1T0YA 3D32A 1BT0A 2JPHA 3L10B 3AU5A 2IYDB 2ZCBA 3R3MA 1RRBA 1UD7A 5KHOA 2EMTA 3QWZB 4WWPA 3L0WB 1WR6E 3AXCA 1GNUA 2JWZA 3CF6E 3RT3B 4GDLB 2KOXA 1WYWB 4EZLA 5J17A 2Y5BB 3L17A 2DENB 4IWPA 1V9JA 2KMAA 3HM3A 4TKNA 3T9LA 2M4NA 3PGEA 4RM9A 2RD0A 1UELA 3O65B 3DQVA 3U8ZA 4HCPB 3KYCD 3VUWA 3VVWB 2L76A 5IA7A 1SGHA 3ZO5B 4AJYB 3NS8A 3ENEA 4W9DA 3ML9A 1E90A 2L7RA 1IPGA 4KV2A 2KTRA 2KXJA 2HJ8A 1WMHB 2KZRA 1F9JA 1UZXB 3K9PB 3L54A 4E3CA 2KDFB 2RSUA 1WJUA 3H7SA 1G6JA 3IG3A 1VCBA 1P9DU 2C5LC 3EHVA 2BWFA 3R7RA 3JW0X 5DPTA 1E5WA 1GG3A 2C7HA 2NR2A 2O2VA 2NCNA 4I6NB 5DPRA 4KSKC 2K8CA 4KIKA 4NY0A 3DBSA 3VAWA 2LASA 1MG8A 4HLEA 1V5OA 2CHXA 4ASWC 2K25A 3ZRCA 1WM3A 3MJWA 2KKCA 4TQ0A 4F7ZA 2MQJA 4IWQA 4AUQC 1V49A 1ZW7A 2JT4B 2BYVE 4E71A 4RMAA 2LVPA 2DZJA 4HWIB 1WE6A 2KLGA 2UYZB 3APCA 3GZNI 3H7PB 4LJPB 1SE9A 2JZZA 1YX5B 1RFAA 2G4DB 1P1AA 3A1QB 4IC7B 3JSVA 2LXCA 3UQBA 2J0JA 5DPSA 2IY1B 4MGYE 1PQSA 1I35A 5D2MB 3Q3JA 3VUYA 2G45B 3KW5B 1SIFA 5JHBA 2KMCA 4JGHB 4K81A 2CS4A 3PHWB 3ZNGC 1XD3B 4BKSD 5L83A 2ZNVC 3VTWA 2GMIC 2NS5A 2ZJDA 2D10A 2KVRA 2N9PC 2M8SA 4G3XB 1QZEA 1WZ0A 2KWVB 3APFA 4JL9A 3C0RB 4IWOA 2KK8A 3DVNV 4CHKA 3TIXA 3RCZA 4KDLB 4PYZA 1UH6A 4A3PA 3T8MA 3ZIMA 2LUEA 3IFWB 4ICUA 4B95A 3PHXB 1S1QB 2BPSA 3HK0A 3A33B 2MBBB 3RUIB 3V60A 4LDTD 4GN1A 3DBLI 2C60A 2XK5A 3TJPA 4G0NB 2KJ6A 4A3OA 1J8CA 1H4RA 4BFRA 3OJ4B 5JHAA 4W9GA 4MELA 1WX9A 2KDEB 3WIMA 3OJ3A 4B9KA 4EKUA 2IO1B 4MGIE 3JVZX 3I3TB 1OEYJ 3Q3FA 4IM3A 2DZIA 4ANXA 1WFYA 3PS6A 2MRPA 3X0WA 4MSQB 2KFKA 2XBBC 2K6QA 2G3QB 3PT2B 4GB9A 4BBNF 3MTNB 3SDLC 2BGFA 2LRUA 4HPLB 1XT9B 4LJOB 2MX2A 2JVCA 2PEAA 2WYQA 3QQ8B 4G50A 2FNJB 4EOYA 4IM2A 1WGYA 1V81A 2AL3A 2FCQA 2NBWB 1C1YB 5G55A 4MH0E 3B0AA 5HKHA 2LRWA 4MJSB 1JRUA 3PPAA 2KQ7A 3WAMA 2DYOA 3QA8A 2MBOA 4URKA 2AL6A 2FCNA 2L0FA 3KVFB 1GJZA 2NVUI 4MSMB 3VXWA 3X23A 5J18A 2KDBA 2KFJA 4EZJA 2CR5A 2GBKA 3WALA 4GGQA 2UWQA 3APDA 5DPWA 2NBVB 2K6DB 3P2BA 4ANWA 4WJOA 3ZNZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVL A;  3UGB B;  1OTR B;  3VH4 B;  4XX5 A;  5CTR C;  4HVB A;  1K8R B;  3PRP B;  4ZRK A;  4NAW B;  3U30 A;  1NDD A;  5E6O A;  3ZTC A;  3ZUN A;  2M1M A;  2KAN A;  2MSE D;  2NPT A;  2XEW A;  4IM0 A;  5GMV A;  3RZW C;  4EZK A;  2FCM A;  3UQA A;  1UBQ A;  2MW5 A;  2MP2 A;  2MBH A;  3KUZ A;  4LDT B;  1WXV A;  2V1Y A;  3MHS D;  4HCN B;  1UBI A;  3DBR I;  2ASQ A;  3CSF A;  1H8C A;  1GC7 A;  1TBE A;  2BWE S;  2K1F A;  5L95 C;  3ECI A;  1WRD B;  2J7Q B;  4I6P A;  2R2O A;  1KJT A;  3N3K B;  4TV3 A;  1V2Y A;  3VTV A;  2KDI A;  4KVG B;  5G2N A;  4HDO A;  2LGY A;  4MDK E;  4F8C B;  3H6N A;  4NJ7 A;  2FIF A;  5D6J B;  4HXD A;  1WR1 A;  4HJK A;  2ZNV B;  2LVO A;  3EEC A;  2BKF A;  2GBR A;  2RR9 A;  2LWP A;  2HE7 A;  2L3Z A;  3A1Q A;  5CHW A;  2DHZ A;  2O6V A;  2PE9 A;  4ICV A;  4OVU A;  4DXA B;  2FAZ A;  3A9K A;  3M62 B;  2C9W B;  1E8Y A;  3KUC B;  3N32 A;  2QHO A;  3S2A A;  1WJ4 A;  1RAX A;  3SHQ A;  3VUX A;  3HHM A;  4KZC A;  5CHV C;  3W1S A;  1FXT B;  4M8N A;  1NI2 A;  2LD9 A;  1KM7 A;  2W9N A;  1IP9 A;  4WJQ A;  2CU1 A;  2LGD A;  3DPD A;  3ZVV A;  4MGK E;  5JZE B;  1EO6 A;  2KTF A;  3ALB A;  2KNB A;  4FA6 A;  4MM3 A;  1E8X A;  1TTN A;  2VRR B;  3H9D A;  5C23 A;  3QK0 A;  4CO7 A;  3ZDM C;  1WGH A;  3B1L X;  2JRH A;  4EFO A;  2N1V A;  3IVF A;  3UIP B;  3DVG Y;  3VQI A;  2M17 A;  4FLH A;  4K7W A;  1R4N I;  3QHT A;  4AJW A;  4F1S A;  3KYD D;  1WE7 A;  5EDS A;  2B3A A;  2KJH B;  2N7E A;  3A4R A;  3PSE B;  3LJ3 A;  4GXB A;  4HPM B;  1J19 A;  1XQQ A;  2CHW A;  4N9F 4;  2LJ5 A;  2L0T A;  3KH0 A;  1EF5 A;  3K9O B;  3PV1 A;  3QX1 A;  1EF1 A;  3PRE A;  1P0R A;  3ZTD A;  1J0G A;  4WAA A;  3QIJ A;  1E7V A;  5D7G A;  4EEW A;  4DHJ D;  1LQB A;  2ZVN A;  5LLI A;  2C7M B;  2HTH A;  3V62 A;  1WXM A;  5IAA C;  1V6E A;  2NBU A;  2ZZP B;  4JIO U;  2AWT A;  2KWC A;  3AUL A;  2N4F A;  2KO3 A;  4E74 A;  1LM8 B;  4FUL A;  4MJS A;  3V61 A;  4ZDV A;  2I1K A;  3CST A;  2LVQ A;  1Z5S B;  2A4Z A;  3ONS A;  1WH3 A;  1ISN A;  2MBQ A;  1I42 A;  3ZNH B;  2PE6 B;  2KX0 A;  3L16 A;  4LCD E;  2R2Q A;  5DCN A;  2DYM A;  2WX1 A;  1YX6 B;  4ANV A;  1YD8 U;  3PLV A;  5J2R A;  2PPH A;  4FAD A;  4W9C A;  3TBL D;  3TMP B;  2DAJ A;  3L13 A;  2KC1 A;  4GDK B;  4W9J A;  1E8W A;  3HIZ A;  4KZ0 A;  1M94 A;  4MGZ E;  4A20 A;  4NAW A;  4GDL A;  1GC6 A;  1TGZ B;  3A9J B;  3DVN U;  4OVV A;  1WGD A;  5AZH A;  1WF9 A;  1WXS A;  4WJN A;  4PS8 A;  2IO3 B;  3ZNI D;  4IW0 A;  5CHF A;  1WY8 A;  3M3J A;  1RLF A;  1V80 A;  4X57 B;  3V6E B;  4DK5 A;  2KLC A;  1UGM A;  2GBM A;  3DCG A;  3PZD A;  3RUL A;  3ZKJ C;  2D07 B;  2GBN A;  2MCN B;  4DBG A;  2K8H A;  1NBF C;  3WAP A;  1KOT A;  2KFK B;  1WXA A;  1Q1O A;  2OOB B;  3QJZ A;  4G11 A;  2AYO B;  3AU4 A;  1WZ3 A;  2K39 A;  2J0K A;  3DVG X;  3NOB A;  1EUV B;  3PLU A;  4DHJ B;  1WMH A;  3ZRF A;  3GOE A;  3BY4 B;  1WM2 A;  4PS3 A;  1WGG A;  1VD2 A;  2IY0 B;  3KUD B;  4GU2 A;  2O6V D;  2DYB A;  1R4M I;  2JZ3 B;  2PJH A;  4KDI C;  4WWO A;  2DZK A;  4ZYN A;  3A4S C;  4I6L B;  4MEM A;  3NY5 A;  1A5R A;  4FJV B;  4GOC A;  4P7I A;  4B6W A;  3EFU A;  3BIN A;  3VFK A;  4K7U A;  4ANU A;  1Q5W B;  2EKE C;  4GSW A;  2N7D A;  4K7S A;  2ZPN A;  4FHK A;  1S3S G;  3H7P A;  3VTU A;  4II2 B;  1E7U A;  1KLV A;  2D2Q A;  4DHZ E;  2MLB A;  1LXD A;  4DWF A;  2C7N B;  3LDZ E;  4YL8 A;  2LZ6 A;  2FCS A;  3CMM B;  3DOW A;  2N1W A;  4NQL B;  1P3Q U;  2BF8 B;  4PS7 A;  5BO4 B;  4FBJ B;  3IBE A;  1TZ1 A;  3QC8 B;  4TUU A;  4NJ6 A;  3WAO A;  1WX8 A;  2G4S A;  5D94 A;  3V6C B;  3RZF A;  2JF5 A;  4GMV A;  5E6N A;  2NPT B;  4PYU A;  1OGW A;  1ZGU B;  3VHT C;  3ZDT A;  3WAN A;  1P98 A;  4KSL C;  1E8Z A;  2MP2 B;  2IO0 B;  2WDT B;  3TCA A;  2AEH A;  2V3S A;  2GOW A;  4M8M A;  2KX3 A;  4FN2 A;  4W9K A;  2K8B A;  2DAF A;  5AZF A;  4GIV A;  2CKH B;  2JRI B;  2N9X A;  4BOZ B;  3VDZ A;  5JH5 C;  1IYF A;  1ZKH A;  4JQW C;  2RGF A;  2D3G A;  2KC2 A;  4IUM B;  2M0X A;  2KTR B;  4K1R B;  3ZLZ A;  4NPN A;  2BKR B;  2A5U A;  2KQS A;  5LXI B;  3N30 A;  1HE8 A;  3PRZ A;  3ZW3 A;  3DBH I;  1X1M A;  2O2V B;  4KIK B;  2JY6 A;  3NZS A;  1C3T A;  2LGX A;  5CX3 A;  4W9F A;  1D3Z A;  4HK2 A;  2Z0D B;  2O6V B;  1OQY A;  3IHP C;  3A9K B;  2FUH B;  2I1J A;  4BOS C;  4WQO B;  3PRM B;  2YVC A;  2RPQ A;  2ZVO A;  3SU8 X;  3B08 A;  3HM6 X;  2FID A;  3M95 A;  4XZ4 A;  4DDI D;  4W9I A;  3WA0 A;  4II3 B;  3JSV B;  3RYT A;  1OEY A;  3U7D A;  2KHW B;  2LXA A;  1YIW A;  2BYF A;  1GUA B;  2ZEQ A;  3M63 B;  2IZV B;  1L7Y A;  2JUO A;  3H1U A;  2J0M A;  2MWS B;  2L8J A;  1Y8R C;  5E6P A;  4DHZ B;  4AOF A;  2HD5 B;  5AEK B;  2EMS A;  2Z0E B;  1V86 A;  4W9L A;  2N9E B;  1YJ1 A;  3R7Q A;  2IO2 B;  4FHJ A;  5LXH A;  4GDK A;  4NQK E;  1AAR A;  4DDG D;  2KN5 A;  3QAR A;  2WX0 A;  2OJR A;  1YQB A;  3NHE B;  4BKS A;  3A9J A;  4W9H A;  4TQ1 A;  3OAW A;  2ZCC A;  3R66 C;  3AI5 A;  3SD5 A;  4EUT A;  2D11 A;  4NNJ B;  5TR5 A;  3W1S C;  4CYE A;  3RD2 A;  2IBI B;  3PTF C;  4J6I A;  2GBJ A;  2MBE A;  4ZRJ A;  1Z2M A;  5AZG A;  3QAQ A;  4AP4 C;  1L2N A;  1U4A A;  2Z59 B;  2V4L A;  4W9E A;  1WGR A;  3ML8 A;  2CHZ A;  5KHQ A;  3EC8 A;  2DZM A;  2JXX A;  2XK5 B;  4AWJ A;  2REX A;  2DX5 B;  5C1Z A;  1WI0 A;  4BKG A;  3NZU A;  4ZRI A;  4RM8 A;  4BVU C;  3UIO B;  4BKT A;  4M0W B;  2LI5 A;  3OLM D;  3L08 A;  3VH3 B;  1Q0W B;  4FJZ A;  3DDC B;  2YLM A;  1WIA A;  1CMX B;  4JLC A;  2L05 A;  4WJP A;  5FR6 A;  4XC2 A;  1LFD A;  3JYU A;  4WWN A;  2ZPY A;  3TL5 A;  4HDQ A;  1WJN A;  1WJ6 A;  2MA9 B;  3UF8 A;  2L00 B;  1V5T A;  3W1Y A;  1WX7 A;  4BBN C;  4FJY A;  3QCA A;  3UIN B;  2KD0 A;  4IG7 B;  2WWZ A;  2BYE A;  2KWU B;  2KJR A;  1T0Y A;  3D32 A;  1BT0 A;  2JPH A;  3L10 B;  3AU5 A;  2IYD B;  2ZCB A;  3R3M A;  1RRB A;  1UD7 A;  5KHO A;  2EMT A;  3QWZ B;  4WWP A;  3L0W B;  1WR6 E;  3AXC A;  1GNU A;  2JWZ A;  3CF6 E;  3RT3 B;  4GDL B;  2KOX A;  1WYW B;  4EZL A;  5J17 A;  2Y5B B;  3L17 A;  2DEN B;  4IWP A;  1V9J A;  2KMA A;  3HM3 A;  4TKN A;  3T9L A;  2M4N A;  3PGE A;  4RM9 A;  2RD0 A;  1UEL A;  3O65 B;  3DQV A;  3U8Z A;  4HCP B;  3KYC D;  3VUW A;  3VVW B;  2L76 A;  5IA7 A;  1SGH A;  3ZO5 B;  4AJY B;  3NS8 A;  3ENE A;  4W9D A;  3ML9 A;  1E90 A;  2L7R A;  1IPG A;  4KV2 A;  2KTR A;  2KXJ A;  2HJ8 A;  1WMH B;  2KZR A;  1F9J A;  1UZX B;  3K9P B;  3L54 A;  4E3C A;  2KDF B;  2RSU A;  1WJU A;  3H7S A;  1G6J A;  3IG3 A;  1VCB A;  1P9D U;  2C5L C;  3EHV A;  2BWF A;  3R7R A;  3JW0 X;  5DPT A;  1E5W A;  1GG3 A;  2C7H A;  2NR2 A;  2O2V A;  2NCN A;  4I6N B;  5DPR A;  4KSK C;  2K8C A;  4KIK A;  4NY0 A;  3DBS A;  3VAW A;  2LAS A;  1MG8 A;  4HLE A;  1V5O A;  2CHX A;  4ASW C;  2K25 A;  3ZRC A;  1WM3 A;  3MJW A;  2KKC A;  4TQ0 A;  4F7Z A;  2MQJ A;  4IWQ A;  4AUQ C;  1V49 A;  1ZW7 A;  2JT4 B;  2BYV E;  4E71 A;  4RMA A;  2LVP A;  2DZJ A;  4HWI B;  1WE6 A;  2KLG A;  2UYZ B;  3APC A;  3GZN I;  3H7P B;  4LJP B;  1SE9 A;  2JZZ A;  1YX5 B;  1RFA A;  2G4D B;  1P1A A;  3A1Q B;  4IC7 B;  3JSV A;  2LXC A;  3UQB A;  2J0J A;  5DPS A;  2IY1 B;  4MGY E;  1PQS A;  1I35 A;  5D2M B;  3Q3J A;  3VUY A;  2G45 B;  3KW5 B;  1SIF A;  5JHB A;  2KMC A;  4JGH B;  4K81 A;  2CS4 A;  3PHW B;  3ZNG C;  1XD3 B;  4BKS D;  5L83 A;  2ZNV C;  3VTW A;  2GMI C;  2NS5 A;  2ZJD A;  2D10 A;  2KVR A;  2N9P C;  2M8S A;  4G3X B;  1QZE A;  1WZ0 A;  2KWV B;  3APF A;  4JL9 A;  3C0R B;  4IWO A;  2KK8 A;  3DVN V;  4CHK A;  3TIX A;  3RCZ A;  4KDL B;  4PYZ A;  1UH6 A;  4A3P A;  3T8M A;  3ZIM A;  2LUE A;  3IFW B;  4ICU A;  4B95 A;  3PHX B;  1S1Q B;  2BPS A;  3HK0 A;  3A33 B;  2MBB B;  3RUI B;  3V60 A;  4LDT D;  4GN1 A;  3DBL I;  2C60 A;  2XK5 A;  3TJP A;  4G0N B;  2KJ6 A;  4A3O A;  1J8C A;  1H4R A;  4BFR A;  3OJ4 B;  5JHA A;  4W9G A;  4MEL A;  1WX9 A;  2KDE B;  3WIM A;  3OJ3 A;  4B9K A;  4EKU A;  2IO1 B;  4MGI E;  3JVZ X;  3I3T B;  1OEY J;  3Q3F A;  4IM3 A;  2DZI A;  4ANX A;  1WFY A;  3PS6 A;  2MRP A;  3X0W A;  4MSQ B;  2KFK A;  2XBB C;  2K6Q A;  2G3Q B;  3PT2 B;  4GB9 A;  4BBN F;  3MTN B;  3SDL C;  2BGF A;  2LRU A;  4HPL B;  1XT9 B;  4LJO B;  2MX2 A;  2JVC A;  2PEA A;  2WYQ A;  3QQ8 B;  4G50 A;  2FNJ B;  4EOY A;  4IM2 A;  1WGY A;  1V81 A;  2AL3 A;  2FCQ A;  2NBW B;  1C1Y B;  5G55 A;  4MH0 E;  3B0A A;  5HKH A;  2LRW A;  4MJS B;  1JRU A;  3PPA A;  2KQ7 A;  3WAM A;  2DYO A;  3QA8 A;  2MBO A;  4URK A;  2AL6 A;  2FCN A;  2L0F A;  3KVF B;  1GJZ A;  2NVU I;  4MSM B;  3VXW A;  3X23 A;  5J18 A;  2KDB A;  2KFJ A;  4EZJ A;  2CR5 A;  2GBK A;  3WAL A;  4GGQ A;  2UWQ A;  3APD A;  5DPW A;  2NBV B;  2K6D B;  3P2B A;  4ANW A;  4WJO A;  3ZNZ B; 
#chains in the Genus database with same CATH topology
 4XX5 A;  4O1N A;  4D2K A;  2WGS A;  2WDQ B;  2L52 A;  2KAN A;  2NPT A;  5AUK A;  4IM0 A;  2VZK D;  3RZW C;  1P7E A;  1UBQ A;  4HCN B;  3GE8 C;  1MFW A;  3CSF A;  1GC7 A;  2KT7 A;  2X38 A;  4YT0 B;  2K1F A;  5L95 C;  2V9H A;  1KJT A;  2WLB A;  2KDI A;  4KVG B;  5G2N A;  3BVZ A;  4F8C B;  2CJN A;  1SSN A;  2ZNV B;  1L0X B;  2HE7 A;  5CHW A;  2O6V A;  2PE9 A;  2C9W B;  3AM9 A;  3AEF B;  3KUC B;  2QHO A;  1RAX A;  3HHM A;  1NI2 A;  1IP9 A;  2D3C A;  4LNN A;  4P1C C;  5JZE B;  1EO6 A;  1E8X A;  1TTN A;  1TS4 A;  4CO7 A;  1MHX A;  1L4Z B;  3ZDM C;  3PO0 A;  3AE5 B;  2M17 A;  4K7W A;  3Q3N C;  4F1S A;  1QOA A;  4C7Z A;  3FAH A;  3A4R A;  4HPM B;  1XQQ A;  2XN9 C;  2L0T A;  3KH0 A;  1EF5 A;  4RGO S;  4ZHO A;  1OQQ A;  1J0G A;  1P0R A;  3ZTD A;  3AMZ A;  3GP7 A;  1E7V A;  2J52 A;  1LQB A;  3VR9 B;  2IND C;  2W55 A;  5GXG B;  1V6E A;  2YEP B;  2LEK A;  2ZZP B;  4JIO U;  2AWT A;  2KWC A;  4ACF A;  3T3O A;  3AE8 B;  3BVM A;  3Q8E A;  1MI0 A;  4MJS A;  5C2T B;  3CST A;  3Q6B A;  1ISN A;  1I42 A;  2MEK A;  3V3X A;  3BVG A;  5DCN A;  1DYQ A;  1YNT E;  3AEC B;  4ANV A;  3PLV A;  4FAD A;  4W9C A;  3TBL D;  2BBC A;  5E6J A;  4RCO A;  3HIZ A;  1SE3 A;  4MGZ E;  1GC6 A;  4OVV A;  1YQ3 B;  2IO3 B;  4P6V F;  1WY8 A;  1V80 A;  3V6E B;  1QLB B;  3DCG A;  3AV8 A;  3RUL A;  3ZKJ C;  3TUO A;  2VH1 A;  2K8H A;  2KFK B;  3AU4 A;  1EUV B;  2WQY B;  4PS3 A;  3KUD B;  4KDI C;  4WWO A;  5D3D A;  3W2D A;  1EU3 A;  4TMA B;  2ACZ B;  3TEW A;  4K7U A;  1TKG A;  1ACC A;  4ANU A;  2EKE C;  1DOY A;  2Y3A A;  3Q3O C;  2MH7 A;  3VTU A;  4YWG G;  1T0S C;  1KLV A;  4C56 C;  4XYC A;  4DHZ E;  2WXK A;  1LXD A;  4YL8 A;  5FR3 A;  2BF8 B;  4PS7 A;  2J4X A;  4FBJ B;  1TZ1 A;  3ZQ4 A;  1WX8 A;  2KMM A;  2RPV A;  5D94 A;  3P42 A;  3RZF A;  3DWG C;  1KRH A;  5E6N A;  2NPT B;  1ZGU B;  3WAN A;  4KKJ A;  4KSL C;  2WDT B;  1R7S A;  2V3S A;  2KX3 A;  2K8B A;  4BZA A;  2JRI B;  4IKG A;  3EA6 A;  5JH5 C;  4KGS A;  1ZE3 D;  4ZRP A;  1NVI D;  1X1M A;  5BMI A;  4KIK B;  2LGX A;  1D3Z A;  2Z0D B;  2O6V B;  2UU7 A;  1OQY A;  3IHP C;  2IDY A;  3R2I A;  2W54 A;  3PZ7 A;  1ZP0 B;  1B1Z A;  4B0E A;  3IAM 1;  3PRM B;  2RPQ A;  2ZVO A;  3HM6 X;  2MJD A;  2BB6 A;  1K50 A;  4DDI D;  1F0Z A;  4W9I A;  1OFF A;  3IT4 B;  2KHW B;  2LXA A;  3NG0 A;  2BYF A;  1KF6 B;  1VDV A;  3DWM A;  2IZV B;  2JUO A;  3H1U A;  2PTL A;  2AQ3 B;  4AOF A;  2EMS A;  1V86 A;  3ZJU A;  2N9E B;  4YSZ B;  1ZXH A;  2KAJ A;  2IO2 B;  5LXH A;  2KN5 A;  4JWU C;  1FRR A;  3OAW A;  3TSS A;  5TSS A;  1R4M B;  3BZD B;  3RD2 A;  3PTF C;  1K51 A;  2GBJ A;  2MBE A;  3EGR A;  4LNO A;  4ZRJ A;  1QKZ A;  4AP4 C;  1L2N A;  2V4L A;  3T3N A;  5KHQ A;  3ML8 A;  2CHZ A;  3EC8 A;  1IGC A;  2DX5 B;  3NVY A;  4BKG A;  3VH3 B;  3DDC B;  1WIA A;  4JLC A;  2L05 A;  4WIP A;  5FR6 A;  4XC2 A;  4HKZ E;  1LFD A;  3JYU A;  3MHZ A;  4L1B A;  3UF8 A;  2E3T A;  1WX7 A;  4N58 A;  2W82 A;  3L4P A;  3MJ5 A;  1TS3 A;  2XNA C;  2KD0 A;  2WWZ A;  3L10 B;  3R3M A;  1UD7 A;  5T8I A;  3AEA B;  2EMT A;  3QWZ B;  1MPE A;  4WWP A;  1WR6 E;  2BQQ A;  3CF6 E;  2R61 A;  1SXT A;  1WXQ A;  3L17 A;  2DEN B;  2LJI A;  4IWP A;  2M4N A;  4DXG A;  4RM9 A;  1UEL A;  3DQV A;  1TIF A;  3U8Z A;  3VUW A;  3KYC D;  1QOG A;  2L76 A;  3AE4 B;  4LNK A;  4W9D A;  1IPG A;  4KV2 A;  1UZX B;  2E6X A;  1JAL A;  3J9C A;  1WJU A;  2C5L C;  5BMG A;  2BWF A;  1GG3 A;  2K8C A;  2LAS A;  3KWV A;  1JML A;  1WM3 A;  2KKC A;  1NYR A;  2BYV E;  4E71 A;  1FNW A;  2PVG C;  3WCQ A;  4LJP B;  1KH0 A;  3U7Z A;  2EKI A;  2JZZ A;  1RFA A;  1P1A A;  4IC7 B;  3ZGZ A;  4A8X C;  2J0J A;  5DPS A;  2JU6 X;  3Q3J A;  1I4R A;  1HZ6 A;  1ET9 A;  2CS4 A;  4HJG E;  3ZNG C;  2GRI A;  4BKS D;  1GAQ B;  2ZJD A;  2KVR A;  2N9P C;  1K53 A;  2KWV B;  4JL9 A;  1D5X C;  2DLB A;  4Q2J A;  3Q69 A;  1UH6 A;  2JWU A;  2SEB D;  4A3P A;  1ZXI A;  4B95 A;  3PHX B;  1JWU D;  3Q8F A;  1J8C A;  2C60 A;  2XK5 A;  4A3O A;  2HDE A;  3IXS A;  4B9K A;  4MEL A;  2BS3 B;  4MGI E;  5H92 C;  1OEY J;  1WFY A;  3PS6 A;  2V4I B;  3PT2 B;  4BBN F;  3MTN B;  3LXF A;  5G5G A;  2BGF A;  4XWT A;  2JVC A;  2WYQ A;  3QQ8 B;  4EOY A;  4MH0 E;  4C80 A;  3WAM A;  2DYO A;  3QA8 A;  4LTU A;  4MSM B;  1HTO A;  2QSD A;  4IOI E;  4EZJ A;  2UWQ A;  3APD A;  2VRR B;  3PVL A;  3RNF C;  3UGB B;  4L2Y A;  4NJC A;  1C4P A;  3TEY A;  1K8R B;  2ONQ A;  4ZRK A;  1NDD A;  5E6O A;  2WU2 B;  3ZTC A;  3B2G A;  2WXF A;  2VH2 A;  3ZUN A;  2MSE D;  3GZN B;  4EZK A;  2KDM A;  2FCM A;  2MW5 A;  2MBH A;  3VR8 B;  1WXV A;  2AQ1 B;  3MHS D;  1UBI A;  1OQR A;  1YN4 A;  4JE3 B;  1P7F A;  4I6P A;  4TV3 A;  1V2Y A;  3VTV A;  5D3I B;  1C78 A;  3AE6 B;  4HDO A;  1C4C A;  2LGY A;  4MDK E;  1V1P A;  2FIF A;  4ARI A;  4HJK A;  1QOF A;  3EEC A;  2BKF A;  3OWE B;  4L23 A;  1ESF A;  4ICV A;  4DXA B;  2FAZ A;  3A9K A;  3VUX A;  1WSP A;  3V05 A;  1D5Z C;  1UNS A;  3B9J A;  3FKY A;  5BMH A;  2CU1 A;  2LGS A;  3DPD A;  2JYE A;  4TSS A;  2Y5C A;  4MM3 A;  3QK0 A;  4EFO A;  2JRH A;  2N1V A;  3UIP B;  3VQI A;  4FLH A;  2WDR B;  4AJW A;  1WE7 A;  3LJ3 A;  1CZP A;  3RN9 C;  2LJ5 A;  1FXA A;  1IGD A;  3PRE A;  4YTP B;  4C00 A;  5D7G A;  2C7M B;  1WGK A;  1DOI A;  2HTH A;  4ZOH C;  3AE1 B;  3AUL A;  4NAM A;  1L0V B;  2KO3 A;  4USA A;  4E74 A;  4ZHP A;  2LVQ A;  4WUR A;  1Z5S B;  2ICI A;  1FEH A;  2RDG A;  1CJE A;  3ZJV A;  3U4E G;  4LCD E;  3BYT B;  3AED B;  1I7H A;  3DBR B;  5HFY A;  1YX6 B;  5J2R A;  1FMA D;  2PPH A;  1F77 A;  3TMP B;  1EM7 A;  2KC1 A;  3NJT A;  1E8W A;  1M94 A;  4NAW A;  4GDL A;  2D3B A;  1WGD A;  1F52 A;  1Y56 A;  4X57 B;  4DK5 A;  3PZD A;  2D07 B;  3QJZ A;  2AYO B;  1FRD A;  1WZ3 A;  2J0K A;  3DVG X;  3NOB A;  2BS4 B;  4OW0 A;  3GOE A;  2O6V D;  2DYB A;  1R4M I;  2FE8 A;  4I6L B;  4GOC A;  1HZ5 A;  1L5P A;  1SE4 A;  2MHJ A;  2N7D A;  4K7S A;  2ZPN A;  4GLS C;  1R4N B;  2AQ2 B;  4KX6 B;  2FCS A;  2N1W A;  5BO4 B;  1HTQ A;  3HRD D;  4WQM A;  2G4S A;  3V6C B;  1RFK A;  3VHT C;  1PUT A;  3MFG A;  1RM6 C;  3AEE B;  4FN2 A;  5AZF A;  3BWU D;  4GIV A;  3U2S C;  3AEG B;  1ZKH A;  3IAS 1;  2D3G A;  4IUM B;  2KTR B;  4K1R B;  2BKR B;  2A5U A;  5LXI B;  1SB3 C;  3RNE C;  3VRB B;  2IGH A;  2L32 A;  3PRZ A;  2BVC A;  3KLS X;  2O2V B;  2JY6 A;  3NZS A;  4W9F A;  3Q14 C;  3A9K B;  2I1J A;  4WQO B;  2WXO A;  2FID A;  4XZ4 A;  3WA0 A;  4II3 B;  1N62 A;  1YIW A;  1FO4 A;  3M63 B;  3NVZ A;  4WWM A;  4C4V A;  1RYJ A;  2J0M A;  1Y8R C;  5E6P A;  4ZRQ A;  4DQO C;  5AEK B;  3DHG C;  1YJ1 A;  1QF6 A;  4GDK A;  4NQK E;  1N63 A;  5HG2 A;  2WX0 A;  2OJR A;  1YQB A;  1FFV A;  3A9J A;  4W9H A;  1QQR A;  3R66 C;  1I4X A;  1VZ8 A;  4NNJ B;  5TR5 A;  4CYE A;  4OZA A;  4A55 A;  1DGJ A;  4W9E A;  4US8 A;  5LNK 1;  2JXX A;  2REX A;  1C79 A;  3NZU A;  4PK1 A;  3AE9 B;  4ZRI A;  4RM8 A;  3UIO B;  4BKT A;  4M0W B;  3P4S B;  1XLO A;  2H89 B;  4WJP A;  3W5U B;  3TL5 A;  3ZYY X;  4HDQ A;  2MA9 B;  3SFE B;  1XO3 A;  3NRZ A;  3W1Y A;  3QCA A;  3UIN B;  2K0P A;  2INP E;  2BYE A;  2KJR A;  2JPH A;  1ZOY B;  3AU5 A;  3GE3 C;  2ZCB A;  1RRB A;  1V1O A;  2M0A A;  3EUB 2;  1GNU A;  2JWZ A;  3RT3 B;  3Q8C A;  4GDL B;  1WYW B;  2IGG A;  1V9J A;  1IBX B;  3DBH B;  2PIA A;  2CJO A;  2RD0 A;  1UGJ A;  2ZW1 A;  1SGH A;  2KQ4 X;  3ZO5 B;  3NS8 A;  2HJ8 A;  2KZR A;  3K9P B;  2KAC A;  3RNC C;  1P9D U;  3EHV A;  1E5W A;  2NR2 A;  4I6N B;  4NY0 A;  2FBW B;  4F7Z A;  4AUQ C;  1V49 A;  1ZW7 A;  4RMA A;  2LVP A;  4RFB A;  3GZN I;  3APC A;  3R2T A;  1TY2 A;  1F2R C;  4PT5 A;  4RGT A;  1YX5 B;  4OZB A;  2NMQ A;  2WP9 B;  5EE0 A;  2ZW0 A;  3DBL B;  3JSV A;  3BII D;  4M01 A;  5G5H A;  1I35 A;  2G45 B;  3B2F A;  5JHB A;  2KVZ A;  3PHW B;  1SF0 A;  3CIR B;  3ETR A;  2BYT A;  2ZNV C;  2HTM E;  2NS5 A;  1NEK B;  2M8S A;  1F1H A;  1UWM A;  1WZ0 A;  4G3X B;  1GB1 A;  4IWO A;  4CHK A;  3TIX A;  2JYT A;  2NTT A;  1PGX A;  4ICU A;  3BYY B;  2MJ3 A;  1H4R A;  2QC8 A;  1GPX A;  2G1E A;  1WX9 A;  2KDE B;  3OJ3 A;  2IO1 B;  3JVZ X;  3Q3F A;  4ANX A;  1JWS D;  1YMH E;  2WXM A;  3SDL C;  4EE2 A;  1QIL A;  4LJO B;  2MX2 A;  2PEA A;  4C4V B;  1C1Y B;  3B0A A;  4MJS B;  2LHE A;  3PPA A;  2KQ7 A;  2V0G A;  4URK A;  2FCN A;  2L0F A;  2WXQ A;  2NVU I;  3VXW A;  3N9Y C;  2KDB A;  2KFJ A;  1FNV A;  4RF0 A;  1FFU A;  3P2B A;  4ANW A;  4WJO A;  2BB5 A;  1YN3 A;  2AX5 A;  5CTR C;  4HVB A;  4HEA 1;  3PRP B;  4LNF A;  3U30 A;  1XF5 L;  2RMM A;  2M1M A;  1VR9 A;  1FM0 D;  2V1Y A;  3DBR I;  3SFD B;  1TBE A;  1V8C A;  1FIQ A;  2NTS A;  1WRD B;  2J7Q B;  2JQR B;  2R2O A;  3AE3 B;  1A70 A;  3H6N A;  3SR6 A;  2RR9 A;  1L6V A;  2LWP A;  2L3Z A;  3A1Q A;  2DBY A;  4OVU A;  1QOB A;  4RGN A;  4YSX B;  1MHH E;  3S2A A;  1WJ4 A;  3SHQ A;  1FXT B;  4M8N A;  3ZXV A;  3ZVV A;  2KTF A;  3ALB A;  2KNB A;  3H9D A;  4S17 A;  3B1L X;  3DVG Y;  5BYS A;  1R4N I;  4ZYS A;  3KYD D;  5EDS A;  1T5X D;  1XCQ L;  2KJH B;  4XGA B;  3DHI C;  1PGA A;  1ROE A;  3PSE B;  1J19 A;  2CHW A;  3K9O B;  1EF1 A;  3HUI A;  4WAA A;  3QIJ A;  4A6Q A;  5IOI A;  2MJE A;  4EEW A;  2ZVN A;  5LLI A;  3V62 A;  1XLP A;  1UUP A;  4RGM A;  5IAA C;  1HEZ E;  2NBU A;  4K3B A;  4MT5 A;  2QIL A;  2N4F A;  4OVZ A;  3V61 A;  4ZDV A;  2WHI A;  2K3U A;  2A4Z A;  1TT5 B;  1LO5 D;  2MBQ A;  2PW9 A;  3GS2 A;  3ZNH B;  2PE6 B;  3PZ8 A;  3L16 A;  4S0R A;  2R2Q A;  2DYM A;  2WX1 A;  2INC C;  5EE1 A;  5H8Y E;  2DAJ A;  3L13 A;  3AE7 B;  4A20 A;  1JQ4 A;  1E0Z A;  1WXS A;  4WJN A;  4PS8 A;  3ZNI D;  5CHF A;  3LB8 C;  3M3J A;  1RLF A;  1UGM A;  1C9F A;  2GBN A;  3OG5 A;  4DBG A;  1JW9 D;  1FNU A;  2WXJ A;  1XXG A;  3ZJT A;  1Q1O A;  4G11 A;  2BS2 B;  2K39 A;  3AB5 A;  3PLU A;  3GB1 A;  4DHJ B;  3ZRF A;  3BY4 B;  2PLP A;  1WGG A;  4GU2 A;  5FK9 C;  2JZ3 B;  2DZK A;  3A4S C;  1A5R A;  2INN E;  4P7I A;  4UDU C;  4B6W A;  1MJD A;  3EFU A;  3BIN A;  2ON8 A;  3MP9 A;  5IO9 A;  5IKC M;  1L0Y B;  1Q5W B;  1KLG D;  3URY A;  4HKQ A;  4FHK A;  1I4Q A;  4II2 B;  1E7U A;  2D2Q A;  4ITK A;  1SE2 A;  3LDZ E;  3CMM B;  3RMK C;  4HRS A;  1P3Q U;  5FKA C;  3IBE A;  4TUU A;  4NJ6 A;  2X8X X;  3E9S A;  4GMV A;  4PYU A;  1BXT A;  1OGW A;  3ZDT A;  1PDX A;  1E8Z A;  2GI9 A;  2IO0 B;  3TCA A;  2AEH A;  1I4G A;  2GOW A;  4M8M A;  4W9K A;  3N20 C;  1YJI A;  4LK0 M;  2I2Y A;  2KC2 A;  3ZLZ A;  1FCC C;  4A90 A;  2N0S B;  4NPN A;  2KQS A;  2OED A;  3N30 A;  1AYF A;  1TZO A;  3ZW3 A;  3DBH I;  1I4P A;  1ET6 A;  4OZC A;  2IJ0 A;  1KFY B;  2FUH B;  3R8B A;  4BOS C;  1HXY D;  3I9V 1;  3SU8 X;  3M95 A;  3UI3 A;  2JX5 A;  1TYG B;  4A9A A;  3RYT A;  3U7D A;  3CWI A;  3RNG C;  1YN5 A;  2W3S A;  4HPP A;  4DHZ B;  2Z0E B;  1FD6 A;  4FHJ A;  2Q5W D;  2WXL A;  4TQ1 A;  2ZCC A;  2D3A A;  3SD5 A;  4EUT A;  3AH7 A;  3W1S C;  1T6B X;  1TS2 A;  3QAQ A;  4LNI A;  1E9M A;  2Z59 B;  1WGR A;  4M00 A;  2EEL A;  2XK5 B;  5C1Z A;  2G9H D;  2L1A A;  1WI0 A;  2RDH A;  2LGI A;  2LI5 A;  3OLM D;  1BML C;  4FJZ A;  1WYG A;  4US9 A;  5JXV A;  2QEJ C;  1WJN A;  1WJ6 A;  2L00 B;  4IG7 B;  2WXP A;  1T0Y A;  2IYD B;  4YTM B;  2I38 A;  3AXC A;  1PFD A;  3AEB B;  1IUE A;  3W9C B;  5J17 A;  2Y5B B;  1K52 A;  1TJE A;  1T0R C;  3O13 A;  4TKN A;  3PGE A;  3T9L A;  1WWT A;  4HCP B;  5IA7 A;  1JRO A;  3ENE A;  1E90 A;  2L7R A;  2K9X A;  2KXJ A;  4E3C A;  1F9J A;  2KDF B;  2RSU A;  3RNB C;  3IG3 A;  1VCB A;  2QIE B;  1KLU D;  3R7R A;  5DPT A;  5DPR A;  2C7H A;  2HJ1 A;  2LFI A;  4KIK A;  3I57 A;  3DBS A;  1FCL A;  1V5O A;  2CHX A;  4ASW C;  1N5W A;  4TQ0 A;  3MJW A;  2MQJ A;  4IWQ A;  5BYR A;  3H8H A;  1V1P B;  2M56 B;  2KWD A;  2G4D B;  2LXC A;  3NVV A;  1VZ7 A;  1PQS A;  5D2M B;  3VUY A;  4JX1 C;  1TKY A;  4OHJ A;  1T0Q C;  1FPY A;  3P4Q B;  1XD3 B;  5L83 A;  5IP4 D;  2GMI C;  2D10 A;  4MM3 B;  1QZE A;  3APF A;  5C3J B;  3DHH C;  1MVK A;  3TEZ A;  4B0M A;  4KDL B;  1QT9 A;  4PYZ A;  1TS5 A;  3T8M A;  3ZIM A;  2LUE A;  1S1Q B;  2BPS A;  3HK0 A;  3A33 B;  3TJP A;  4G0N B;  4ARC A;  3OJ4 B;  5JHA A;  3WIM A;  4EKU A;  1L4D B;  3I3T B;  1M4V A;  3NS1 A;  4IM3 A;  2DZI A;  2WXH A;  3Q8B A;  3U52 E;  2MRP A;  2SAK A;  1E7P B;  3P1M A;  2XBB C;  2K6Q A;  2H88 B;  2LRU A;  4HPL B;  1XT9 B;  3LYY A;  4P16 A;  3SEB A;  4G50 A;  2FNJ B;  4N6E B;  1WGY A;  2TSS A;  1V81 A;  4LLG M;  3MC8 A;  2LRW A;  3Q3M C;  3NZ3 A;  2WXG A;  2MBO A;  3BK2 A;  2AL6 A;  1GJZ A;  3X23 A;  5J18 A;  1ZDV A;  5IN7 A;  2CR5 A;  4KGR A;  4MH8 A;  4GGQ A;  2K6D B;  3ZNZ B;  3IT6 B;  2QCZ A;  1OTR B;  3VH4 B;  4WH4 A;  1TKE A;  3FIL A;  4NAW B;  3VRA B;  1VJK A;  2WDV B;  1D6E C;  1JWB D;  2XEW A;  5GMV A;  3UQA A;  2MP2 A;  3KUZ A;  4LDT B;  1D4B A;  2JSV X;  2ASQ A;  1H8C A;  2BWE S;  2LMC A;  4YTN B;  3ECI A;  3N3K B;  2PKO A;  1SBB B;  5BYQ A;  4NJ7 A;  5D6J B;  4HXD A;  4JWS C;  1WR1 A;  1GB4 A;  2KN4 A;  2LVO A;  2GBR A;  4J3O D;  1C76 A;  2DHZ A;  2N9L A;  3M62 B;  1E8Y A;  3N32 A;  4C7Y A;  4KZC A;  5CHV C;  3W1S A;  2LD9 A;  1KM7 A;  2W9N A;  4WJQ A;  2LGD A;  4MGK E;  1XLQ A;  4FA6 A;  4K3C A;  3Q2A C;  3P4P B;  5C23 A;  1J7B A;  1WGH A;  3IVF A;  2W3R A;  3P63 A;  3QHT A;  2LUM A;  1EU4 A;  2B3A A;  2N7E A;  2VZK B;  4AS1 A;  3I5J C;  2WXR A;  4GXB A;  1Q10 A;  4N9F 4;  1SJH D;  2QJL A;  3PV1 A;  3QX1 A;  1E10 A;  2Y5P A;  1UF0 A;  4DHJ D;  1WXM A;  4RF1 A;  3KQ4 A;  2JXT A;  4REZ A;  1FXI A;  1LM8 B;  4FUL A;  2BW2 A;  2I1K A;  2M19 A;  2YEP F;  3AN1 A;  1B9R A;  3ONS A;  1WH3 A;  2K22 A;  2KX0 A;  1T3Q A;  1AN8 A;  1YD8 U;  1YOV B;  4RH6 A;  4GDK B;  4W9J A;  4KZ0 A;  1N6Z A;  1TGZ B;  3DVN U;  3A9J B;  5AZH A;  1NI3 A;  1WF9 A;  4IW0 A;  4KKI A;  2KLC A;  3NUH B;  2QMT A;  2GBM A;  1YQ4 B;  2K5P A;  2MCN B;  1NBF C;  3WAP A;  1KOT A;  1WXA A;  2OOB B;  4M02 A;  1VLB A;  3HVD A;  1WMH A;  1WM2 A;  3TEX A;  1VD2 A;  2IY0 B;  1NEN B;  1N5X A;  2PJH A;  4ZYN A;  4MEM A;  3NY5 A;  1CK1 A;  4FJV B;  2IPK D;  3VFK A;  3NVW A;  4GSW A;  4CQN A;  2WS3 B;  1STE A;  4IDI A;  1S3S G;  2FUG 1;  3H7P A;  3RPF C;  1LGR A;  2MLB A;  4DWF A;  2C7N B;  3ZXR A;  2LZ6 A;  3EFC A;  3DOW A;  4NQL B;  1KTK A;  3FIL B;  3QC8 B;  4MAC A;  3WAO A;  2V3N A;  5MPO A;  2PMV A;  1JCK B;  2JF5 A;  2N7J A;  1P98 A;  2V3P A;  2MP2 B;  4KGT A;  1J7C A;  2DAF A;  2CKH B;  2N9X A;  4DXF A;  4BOZ B;  2N9K A;  3VDZ A;  3HVZ A;  2KYW A;  1IYF A;  4JQW C;  2RGF A;  2M0X A;  1HE8 A;  1RWS A;  1JWM D;  4XDC A;  1PGB A;  3N1X C;  4YXD B;  1C3T A;  5CX3 A;  1F2R I;  4HK2 A;  2PVO D;  2YVC A;  3B08 A;  1BUI C;  1J7A A;  3JSV B;  1AWD A;  1OEY A;  4XE0 A;  1C4A A;  2BT6 A;  1ZDX A;  1GUA B;  2ZEQ A;  1L7Y A;  4BAX A;  2MWS B;  1CQV A;  2L8J A;  1C77 A;  3AE2 B;  2HD5 B;  4W9L A;  1EWC A;  3R7Q A;  2GLS A;  1AAR A;  3N1Z C;  3QAR A;  1ENF A;  3BK1 A;  1DOX A;  3NHE B;  4BKS A;  3MC9 A;  3KWL A;  3AI5 A;  4HRO A;  2Z8L A;  2D11 A;  5HI1 A;  2IBI B;  4J6I A;  1XEE A;  1Z2M A;  3I63 C;  5AZG A;  2WXI A;  2JZP A;  1U4A A;  3N1Y C;  1V97 A;  2DZM A;  4AWJ A;  2DWQ A;  4BVU C;  3L08 A;  4XDD A;  1Q0W B;  3FC4 A;  2YLM A;  2OHF A;  3W5V B;  1CMX B;  3ABV B;  4WWN A;  2ZPY A;  3RFZ B;  1V5T A;  4BBN C;  4FJY A;  3RNA C;  2KWU B;  3D32 A;  5EE3 A;  1BT0 A;  4NZL B;  5KHO A;  1N61 A;  3MC0 B;  3L0W B;  4P1B C;  1MG4 A;  1E6E B;  2B76 B;  2KOX A;  3P4R B;  4EZL A;  1L6U A;  2KMA A;  3HM3 A;  2QDF A;  3O65 B;  3VVW B;  1NYQ A;  4AJY B;  5AUI A;  2J42 A;  1D5M C;  4RNA A;  3ML9 A;  1GOZ A;  2KTR A;  1WMH B;  3L54 A;  3H7S A;  1G6J A;  5HHD G;  4QAY A;  1TY0 A;  3JW0 X;  1JWA D;  4DDG D;  2O2V A;  2NCN A;  4H2A A;  4KSK C;  2D5G A;  3VAW A;  4HLE A;  1MG8 A;  1JRP A;  1N60 A;  2K25 A;  3ZRC A;  2GB1 A;  1HQR D;  2JT4 B;  1XCT L;  4YSY B;  2DZJ A;  4HWI B;  1WE6 A;  1SJE D;  2KLG A;  2UYZ B;  3H7P B;  4JPS A;  1SE9 A;  1ZUD 2;  3A1Q B;  3UQB A;  1HA5 A;  2IY1 B;  1EWY C;  4MGY E;  4FXC A;  1PYW D;  5I4D A;  3KW5 B;  1SIF A;  1XLN A;  4AQ7 A;  2KMC A;  4K81 A;  4JGH B;  2J53 A;  3E56 A;  3RI7 C;  1SIJ A;  3VTW A;  2CU3 A;  1AW7 A;  2LHD A;  3C0R B;  2KK8 A;  4WAF A;  3DVN V;  3RCZ A;  1I4H A;  1ZPS A;  2BTE A;  1VZ6 A;  3IFW B;  5EE9 A;  3RUI B;  3V60 A;  5HKH A;  2MBB B;  4LDT D;  4GN1 A;  3DBL I;  2KJ6 A;  2DNF A;  4BFR A;  4W9G A;  2OJW A;  4M0W A;  1UWX A;  1YJJ A;  3X0W A;  4MSQ B;  2KFK A;  4GB9 A;  3C8Y A;  2G3Q B;  2RDB C;  3C19 A;  4IM2 A;  2AL3 A;  2FCQ A;  2NBW B;  4N59 A;  5G55 A;  1VRA B;  1JRU A;  2IGD A;  4XWW A;  3Q8A A;  1SEB D;  2L83 A;  1WRI A;  3KVF B;  4R3D A;  2WNM A;  2GBK A;  3WAL A;  2WXN A;  5DPW A;  2NBV B;  1IBX A;  2WU5 B; 
#chains in the Genus database with same CATH homology
 3PVL A;  3UGB B;  1OTR B;  3VH4 B;  4XX5 A;  5CTR C;  4HVB A;  1K8R B;  3PRP B;  4ZRK A;  4NAW B;  3U30 A;  1NDD A;  5E6O A;  3ZTC A;  3ZUN A;  2M1M A;  2KAN A;  2MSE D;  2NPT A;  2XEW A;  4IM0 A;  5GMV A;  3RZW C;  4EZK A;  2FCM A;  3UQA A;  1UBQ A;  2MW5 A;  2MP2 A;  2MBH A;  3KUZ A;  4LDT B;  1WXV A;  2V1Y A;  3MHS D;  4HCN B;  1UBI A;  3DBR I;  2ASQ A;  3CSF A;  1H8C A;  1GC7 A;  1TBE A;  2BWE S;  2K1F A;  5L95 C;  3ECI A;  1WRD B;  2J7Q B;  4I6P A;  2R2O A;  1KJT A;  3N3K B;  4TV3 A;  1V2Y A;  3VTV A;  2KDI A;  4KVG B;  5G2N A;  4HDO A;  2LGY A;  4MDK E;  4F8C B;  3H6N A;  4NJ7 A;  2FIF A;  5D6J B;  4HXD A;  1WR1 A;  4HJK A;  2ZNV B;  2LVO A;  3EEC A;  2BKF A;  2GBR A;  2RR9 A;  2LWP A;  2HE7 A;  2L3Z A;  3A1Q A;  5CHW A;  2DHZ A;  2O6V A;  2PE9 A;  4ICV A;  4OVU A;  4DXA B;  2FAZ A;  3A9K A;  3M62 B;  2C9W B;  1E8Y A;  3KUC B;  3N32 A;  2QHO A;  3S2A A;  1WJ4 A;  1RAX A;  3SHQ A;  3VUX A;  3HHM A;  4KZC A;  5CHV C;  3W1S A;  1FXT B;  4M8N A;  1NI2 A;  2LD9 A;  1KM7 A;  2W9N A;  1IP9 A;  4WJQ A;  2CU1 A;  2LGD A;  3DPD A;  3ZVV A;  4MGK E;  5JZE B;  1EO6 A;  2KTF A;  3ALB A;  2KNB A;  4FA6 A;  4MM3 A;  1E8X A;  1TTN A;  2VRR B;  3H9D A;  5C23 A;  3QK0 A;  4CO7 A;  3ZDM C;  1WGH A;  3B1L X;  2JRH A;  4EFO A;  2N1V A;  3IVF A;  3UIP B;  3DVG Y;  3VQI A;  2M17 A;  4FLH A;  4K7W A;  1R4N I;  3QHT A;  4AJW A;  4F1S A;  3KYD D;  1WE7 A;  5EDS A;  2B3A A;  2KJH B;  2N7E A;  3A4R A;  3PSE B;  3LJ3 A;  4GXB A;  4HPM B;  1J19 A;  1XQQ A;  2CHW A;  4N9F 4;  2LJ5 A;  2L0T A;  3KH0 A;  1EF5 A;  3K9O B;  3PV1 A;  3QX1 A;  1EF1 A;  3PRE A;  1P0R A;  3ZTD A;  1J0G A;  4WAA A;  3QIJ A;  1E7V A;  5D7G A;  4EEW A;  4DHJ D;  1LQB A;  2ZVN A;  5LLI A;  2C7M B;  2HTH A;  3V62 A;  1WXM A;  5IAA C;  1V6E A;  2NBU A;  2ZZP B;  4JIO U;  2AWT A;  2KWC A;  3AUL A;  2N4F A;  2KO3 A;  4E74 A;  1LM8 B;  4FUL A;  4MJS A;  3V61 A;  4ZDV A;  2I1K A;  3CST A;  2LVQ A;  1Z5S B;  2A4Z A;  3ONS A;  1WH3 A;  1ISN A;  2MBQ A;  1I42 A;  3ZNH B;  2PE6 B;  2KX0 A;  3L16 A;  4LCD E;  2R2Q A;  5DCN A;  2DYM A;  2WX1 A;  1YX6 B;  4ANV A;  1YD8 U;  3PLV A;  5J2R A;  2PPH A;  4FAD A;  4W9C A;  3TBL D;  3TMP B;  2DAJ A;  3L13 A;  2KC1 A;  4GDK B;  4W9J A;  1E8W A;  3HIZ A;  4KZ0 A;  1M94 A;  4MGZ E;  4A20 A;  4NAW A;  4GDL A;  1GC6 A;  1TGZ B;  3A9J B;  3DVN U;  4OVV A;  1WGD A;  5AZH A;  1WF9 A;  1WXS A;  4WJN A;  4PS8 A;  2IO3 B;  3ZNI D;  4IW0 A;  5CHF A;  1WY8 A;  3M3J A;  1RLF A;  1V80 A;  4X57 B;  3V6E B;  4DK5 A;  2KLC A;  1UGM A;  2GBM A;  3DCG A;  3PZD A;  3RUL A;  3ZKJ C;  2D07 B;  2GBN A;  2MCN B;  4DBG A;  2K8H A;  1NBF C;  3WAP A;  1KOT A;  2KFK B;  1WXA A;  1Q1O A;  2OOB B;  3QJZ A;  4G11 A;  2AYO B;  3AU4 A;  1WZ3 A;  2K39 A;  2J0K A;  3DVG X;  3NOB A;  1EUV B;  3PLU A;  4DHJ B;  1WMH A;  3ZRF A;  3GOE A;  3BY4 B;  1WM2 A;  4PS3 A;  1WGG A;  1VD2 A;  2IY0 B;  3KUD B;  4GU2 A;  2O6V D;  2DYB A;  1R4M I;  2JZ3 B;  2PJH A;  4KDI C;  4WWO A;  2DZK A;  4ZYN A;  3A4S C;  4I6L B;  4MEM A;  3NY5 A;  1A5R A;  4FJV B;  4GOC A;  4P7I A;  4B6W A;  3EFU A;  3BIN A;  3VFK A;  4K7U A;  4ANU A;  1Q5W B;  2EKE C;  4GSW A;  2N7D A;  4K7S A;  2ZPN A;  4FHK A;  1S3S G;  3H7P A;  3VTU A;  4II2 B;  1E7U A;  1KLV A;  2D2Q A;  4DHZ E;  2MLB A;  1LXD A;  4DWF A;  2C7N B;  3LDZ E;  4YL8 A;  2LZ6 A;  2FCS A;  3CMM B;  3DOW A;  2N1W A;  4NQL B;  1P3Q U;  2BF8 B;  4PS7 A;  5BO4 B;  4FBJ B;  3IBE A;  1TZ1 A;  3QC8 B;  4TUU A;  4NJ6 A;  3WAO A;  1WX8 A;  2G4S A;  5D94 A;  3V6C B;  3RZF A;  2JF5 A;  4GMV A;  5E6N A;  2NPT B;  4PYU A;  1OGW A;  1ZGU B;  3VHT C;  3ZDT A;  3WAN A;  1P98 A;  4KSL C;  1E8Z A;  2MP2 B;  2IO0 B;  2WDT B;  3TCA A;  2AEH A;  2V3S A;  2GOW A;  4M8M A;  2KX3 A;  4FN2 A;  4W9K A;  2K8B A;  2DAF A;  5AZF A;  4GIV A;  2CKH B;  2JRI B;  2N9X A;  4BOZ B;  3VDZ A;  5JH5 C;  1IYF A;  1ZKH A;  4JQW C;  2RGF A;  2D3G A;  2KC2 A;  4IUM B;  2M0X A;  2KTR B;  4K1R B;  3ZLZ A;  4NPN A;  2BKR B;  2A5U A;  2KQS A;  5LXI B;  3N30 A;  1HE8 A;  3PRZ A;  3ZW3 A;  3DBH I;  1X1M A;  2O2V B;  4KIK B;  2JY6 A;  3NZS A;  1C3T A;  2LGX A;  5CX3 A;  4W9F A;  1D3Z A;  4HK2 A;  2Z0D B;  2O6V B;  1OQY A;  3IHP C;  3A9K B;  2FUH B;  2I1J A;  4BOS C;  4WQO B;  3PRM B;  2YVC A;  2RPQ A;  2ZVO A;  3SU8 X;  3B08 A;  3HM6 X;  2FID A;  3M95 A;  4XZ4 A;  4DDI D;  4W9I A;  3WA0 A;  4II3 B;  3JSV B;  3RYT A;  1OEY A;  3U7D A;  2KHW B;  2LXA A;  1YIW A;  2BYF A;  1GUA B;  2ZEQ A;  3M63 B;  2IZV B;  1L7Y A;  2JUO A;  3H1U A;  2J0M A;  2MWS B;  2L8J A;  1Y8R C;  5E6P A;  4DHZ B;  4AOF A;  2HD5 B;  5AEK B;  2EMS A;  2Z0E B;  1V86 A;  4W9L A;  2N9E B;  1YJ1 A;  3R7Q A;  2IO2 B;  4FHJ A;  5LXH A;  4GDK A;  4NQK E;  1AAR A;  4DDG D;  2KN5 A;  3QAR A;  2WX0 A;  2OJR A;  1YQB A;  3NHE B;  4BKS A;  3A9J A;  4W9H A;  4TQ1 A;  3OAW A;  2ZCC A;  3R66 C;  3AI5 A;  3SD5 A;  4EUT A;  2D11 A;  4NNJ B;  5TR5 A;  3W1S C;  4CYE A;  3RD2 A;  2IBI B;  3PTF C;  4J6I A;  2GBJ A;  2MBE A;  4ZRJ A;  1Z2M A;  5AZG A;  3QAQ A;  4AP4 C;  1L2N A;  1U4A A;  2Z59 B;  2V4L A;  4W9E A;  1WGR A;  3ML8 A;  2CHZ A;  5KHQ A;  3EC8 A;  2DZM A;  2JXX A;  2XK5 B;  4AWJ A;  2REX A;  2DX5 B;  5C1Z A;  1WI0 A;  4BKG A;  3NZU A;  4ZRI A;  4RM8 A;  4BVU C;  3UIO B;  4BKT A;  4M0W B;  2LI5 A;  3OLM D;  3L08 A;  3VH3 B;  1Q0W B;  4FJZ A;  3DDC B;  2YLM A;  1WIA A;  1CMX B;  4JLC A;  2L05 A;  4WJP A;  5FR6 A;  4XC2 A;  1LFD A;  3JYU A;  4WWN A;  2ZPY A;  3TL5 A;  4HDQ A;  1WJN A;  1WJ6 A;  2MA9 B;  3UF8 A;  2L00 B;  1V5T A;  3W1Y A;  1WX7 A;  4BBN C;  4FJY A;  3QCA A;  3UIN B;  2KD0 A;  4IG7 B;  2WWZ A;  2BYE A;  2KWU B;  2KJR A;  1T0Y A;  3D32 A;  1BT0 A;  2JPH A;  3L10 B;  3AU5 A;  2IYD B;  2ZCB A;  3R3M A;  1RRB A;  1UD7 A;  5KHO A;  2EMT A;  3QWZ B;  4WWP A;  3L0W B;  1WR6 E;  3AXC A;  1GNU A;  2JWZ A;  3CF6 E;  3RT3 B;  4GDL B;  2KOX A;  1WYW B;  4EZL A;  5J17 A;  2Y5B B;  3L17 A;  2DEN B;  4IWP A;  1V9J A;  2KMA A;  3HM3 A;  4TKN A;  3T9L A;  2M4N A;  3PGE A;  4RM9 A;  2RD0 A;  1UEL A;  3O65 B;  3DQV A;  3U8Z A;  4HCP B;  3KYC D;  3VUW A;  3VVW B;  2L76 A;  5IA7 A;  1SGH A;  3ZO5 B;  4AJY B;  3NS8 A;  3ENE A;  4W9D A;  3ML9 A;  1E90 A;  2L7R A;  1IPG A;  4KV2 A;  2KTR A;  2KXJ A;  2HJ8 A;  1WMH B;  2KZR A;  1F9J A;  1UZX B;  3K9P B;  3L54 A;  4E3C A;  2KDF B;  2RSU A;  1WJU A;  3H7S A;  1G6J A;  3IG3 A;  1VCB A;  1P9D U;  2C5L C;  3EHV A;  2BWF A;  3R7R A;  3JW0 X;  5DPT A;  1E5W A;  1GG3 A;  2C7H A;  2NR2 A;  2O2V A;  2NCN A;  4I6N B;  5DPR A;  4KSK C;  2K8C A;  4KIK A;  4NY0 A;  3DBS A;  3VAW A;  2LAS A;  1MG8 A;  4HLE A;  1V5O A;  2CHX A;  4ASW C;  2K25 A;  3ZRC A;  1WM3 A;  3MJW A;  2KKC A;  4TQ0 A;  4F7Z A;  2MQJ A;  4IWQ A;  4AUQ C;  1V49 A;  1ZW7 A;  2JT4 B;  2BYV E;  4E71 A;  4RMA A;  2LVP A;  2DZJ A;  4HWI B;  1WE6 A;  2KLG A;  2UYZ B;  3APC A;  3GZN I;  3H7P B;  4LJP B;  1SE9 A;  2JZZ A;  1YX5 B;  1RFA A;  2G4D B;  1P1A A;  3A1Q B;  4IC7 B;  3JSV A;  2LXC A;  3UQB A;  2J0J A;  5DPS A;  2IY1 B;  4MGY E;  1PQS A;  1I35 A;  5D2M B;  3Q3J A;  3VUY A;  2G45 B;  3KW5 B;  1SIF A;  5JHB A;  2KMC A;  4JGH B;  4K81 A;  2CS4 A;  3PHW B;  3ZNG C;  1XD3 B;  4BKS D;  5L83 A;  2ZNV C;  3VTW A;  2GMI C;  2NS5 A;  2ZJD A;  2D10 A;  2KVR A;  2N9P C;  2M8S A;  4G3X B;  1QZE A;  1WZ0 A;  2KWV B;  3APF A;  4JL9 A;  3C0R B;  4IWO A;  2KK8 A;  3DVN V;  4CHK A;  3TIX A;  3RCZ A;  4KDL B;  4PYZ A;  1UH6 A;  4A3P A;  3T8M A;  3ZIM A;  2LUE A;  3IFW B;  4ICU A;  4B95 A;  3PHX B;  1S1Q B;  2BPS A;  3HK0 A;  3A33 B;  2MBB B;  3RUI B;  3V60 A;  4LDT D;  4GN1 A;  3DBL I;  2C60 A;  2XK5 A;  3TJP A;  4G0N B;  2KJ6 A;  4A3O A;  1J8C A;  1H4R A;  4BFR A;  3OJ4 B;  5JHA A;  4W9G A;  4MEL A;  1WX9 A;  2KDE B;  3WIM A;  3OJ3 A;  4B9K A;  4EKU A;  2IO1 B;  4MGI E;  3JVZ X;  3I3T B;  1OEY J;  3Q3F A;  4IM3 A;  2DZI A;  4ANX A;  1WFY A;  3PS6 A;  2MRP A;  3X0W A;  4MSQ B;  2KFK A;  2XBB C;  2K6Q A;  2G3Q B;  3PT2 B;  4GB9 A;  4BBN F;  3MTN B;  3SDL C;  2BGF A;  2LRU A;  4HPL B;  1XT9 B;  4LJO B;  2MX2 A;  2JVC A;  2PEA A;  2WYQ A;  3QQ8 B;  4G50 A;  2FNJ B;  4EOY A;  4IM2 A;  1WGY A;  1V81 A;  2AL3 A;  2FCQ A;  2NBW B;  1C1Y B;  5G55 A;  4MH0 E;  3B0A A;  5HKH A;  2LRW A;  4MJS B;  1JRU A;  3PPA A;  2KQ7 A;  3WAM A;  2DYO A;  3QA8 A;  2MBO A;  4URK A;  2AL6 A;  2FCN A;  2L0F A;  3KVF B;  1GJZ A;  2NVU I;  4MSM B;  3VXW A;  3X23 A;  5J18 A;  2KDB A;  2KFJ A;  4EZJ A;  2CR5 A;  2GBK A;  3WAL A;  4GGQ A;  2UWQ A;  3APD A;  5DPW A;  2NBV B;  2K6D B;  3P2B A;  4ANW A;  4WJO A;  3ZNZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...