2PJHA

Strctural model of the p97 n domain- npl4 ubd complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
AESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSSKSLHLLKIKHGDLLFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear protein localization protein 4 homolog
publication title Detailed structural insights into the p97-Npl4-Ufd1 interface.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 11
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11543 UN_NPL4 Nuclear pore localisation protein NPL4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2pjhA00
5E6PA 5AZHA 2MSED 1WMHB 1TZ1A 3Q3JA 1WI0A 3QK0A 1XQQA 5HKHA 4P7IA 2BYFA 1P0RA 1WJ4A 2DZKA 2N7EA 3V6CB 3TBLD 2GBNA 4X57B 4DK5A 2D2QA 2ZPNA 5JH5C 2K8HA 1NBFC 5AZGA 4AUQC 2V4LA 2JZZA 1WX7A 2MWSB 2FCSA 2KLCA 5AZFA 3DPDA 2K1FA 2O6VA 4TQ1A 4RM9A 1P98A 4FHKA 5BO4B 3CSFA 4HDQA 1KJTA 3UQBA 2RPQA 2KDFB 4CYEA 4G0NB 3QWZB 3AU5A 2EMTA 3V6EB 2C9WB 1RAXA 3BINA 3NOBA 1WXSA 2DYMA 2Z59B 3ZUNA 3AULA 2MLBA 3DBHI 1UBIA 1T0YA 3L17A 3VUXA 4FJZA 2NBUA 4JQWC 5EDSA 4HK2A 1YIWA 5CHVC 2D07B 5J17A 3PHXB 2UYZB 3JSVA 1KLVA 3DVNU 3T8MA 2LVOA 4BKTA 2J7QB 2RGFA 4KZCA 4HCNB 1ZGUB 4ZDVA 1RFAA 2N9PC 4A3PA 2LZ6A 4JL9A 4WAAA 3NHEB 1LXDA 4PS3A 1WH3A 2NCNA 4HPMB 2ZPYA 2KK8A 3CSTA 1UELA 4AP4C 3KVFB 3VQIA 2L8JA 5E6NA 3X23A 4TV3A 4XZ4A 3TIXA 1WM2A 3R66C 2Z0EB 4W9JA 3OJ3A 2JWZA 2L05A 1E8ZA 4ZRJA 3ZVVA 1WGRA 2PPHA 3L0WB 2IO1B 2GBKA 4KSKC 4K1RB 3VH4B 5TR5A 2DYBA 2JXXA 2NBWB 4NNJB 3HM3A 5IA7A 3P2BA 2LRWA 2G3QB 2MA9B 2XEWA 2KDIA 5IAAC 2YLMA 5KHOA 2QHOA 4W9HA 3UQAA 2GBJA 5CHFA 4TKNA 3ZLZA 2J0KA 2FAZA 4MSMB 1R4NI 3PS6A 2CR5A 1PQSA 3KW5B 1YD8U 1UGMA 1WR6E 4WWOA 2XBBC 2KWCA 1Z2MA 5C1ZA 2NS5A 3DBRI 3AU4A 2PE6B 2AL3A 2JVCA 2W9NA 3KUZA 1WJNA 2HE7A 2FCMA 1H8CA 2K8CA 3ENEA 3U7DA 2K39A 2RR9A 1SGHA 5CHWA 4MGIE 3X0WA 2ZCBA 4KIKA 2IO3B 2KX0A 2L0FA 3TJPA 2L3ZA 3KYCD 1Q5WB 2BYEA 3GZNI 1TGZB 4YL8A 3L13A 3OAWA 4DWFA 4ZYNA 4AJYB 5FR6A 3JW0X 1WR1A 2ZJDA 5J18A 4NY0A 4BBNC 3O65B 2GBRA 3PGEA 1H4RA 2CHZA 4I6PA 4GGQA 4A20A 3K9PB 1YJ1A 1V80A 1F9JA 3UINB 2KXJA 1OEYA 5DPRA 1WZ0A 4NAWB 4MELA 4FBJB 2MX2A 1QZEA 5LXHA 2DENB 2NVUI 3ML9A 3ZNHB 3ZDMC 4XX5A 4ANWA 2JUOA 4BVUC 3ZNID 4GXBA 2KQ7A 2LGXA 1ISNA 2MQJA 2KZRA 2NR2A 2MP2A 3DDCB 1TBEA 1WMHA 2ZNVC 3ML8A 1EF5A 3N3KB 4NQKE 2K6QA 4ZRIA 5C23A 3R7RA 4HLEA 2KC2A 2MBBB 1XT9B 3PRZA 4I6LB 3VHTC 1WIAA 4JGHB 2LRUA 3A4SC 3VXWA 3HK0A 3PHWB 1E8YA 3UGBB 4EZKA 3M62B 1WE6A 3RULA 1L2NA 3W1YA 2VRRB 5D2MB 4W9LA 4ICUA 4NJ6A 1VCBA 1GC7A 1V5OA 1X1MA 2ZVNA 1JRUA 3NZUA 3PV1A 3RT3B 4ANVA 4E74A 3RYTA 2KQSA 2V1YA 4PS7A 3IBEA 2MP2B 4CHKA 3DVGY 4ANUA 2J0JA 4MJSA 2JF5A 1MG8A 1E90A 1U4AA 1KM7A 1NI2A 1A5RA 3A9JA 3APCA 1LFDA 4K7WA 4HJKA 2KKCA 4G11A 1WJUA 2FIFA 2JY6A 3A33B 4EZLA 4AOFA 4WWNA 3T9LA 5DPWA 2R2OA 3DVNV 2ZEQA 2M0XA 4IW0A 3ZW3A 3QJZA 4MEMA 1WX9A 1GG3A 2KD0A 2G4DB 2LI5A 2BKFA 3WAPA 4MH0E 3D32A 3EFUA 3PSEB 4RMAA 4BKSD 3DCGA 2JT4B 4IG7B 4MJSB 3I3TB 2FUHB 3LDZE 2OJRA 4BKSA 3TMPB 1E7UA 5LXIB 4AJWA 2ZCCA 1UBQA 1Y8RC 2L0TA 3A9JB 3Q3FA 4GDLA 5GMVA 3S2AA 2HTHA 4K7SA 4IWPA 3EC8A 3VTWA 4G3XB 3ECIA 2FNJB 2K6DB 1OTRB 4E3CA 4EEWA 4AWJA 4B95A 3QA8A 3EECA 1IP9A 1D3ZA 3SHQA 2IBIB 1WGYA 3TCAA 4BBNF 2N7DA 3UIPB 2M1MA 4WJPA 1EO6A 3N30A 2KN5A 2ZZPB 2IZVB 2N1WA 2KHWB 3WIMA 2PJHA 2IO0B 1V2YA 2EMSA 3VUYA 1UD7A 4GDLB 3QCAA 4PS8A 5L95C 4NJ7A 2KFJA 1P3QU 4GB9A 2D11A 4CO7A 4GOCA 3SD5A 3WALA 4M0WB 3QQ8B 3V61A 3PLVA 4MGKE 1E8WA 3M95A 2KC1A 1WM3A 3PREA 4II3B 3IFWB 4WWPA 2V3SA 1I35A 2I1JA 4NAWA 4GDKA 3M3JA 1SIFA 5D94A 2KWUB 3ZRCA 3C0RB 4W9GA 4LDTD 2JZ3B 2KTRA 4IC7B 1WY8A 1VD2A 2BF8B 2C7HA 4GIVA 1UZXB 3RD2A 4M8NA 2KWVB 3PRMB 3HIZA 1EF1A 1J8CA 2YVCA 3PLUA 4IM0A 5CX3A 1I42A 2BYVE 1GNUA 2LVPA 2CU1A 4DDID 2ZVOA 1WF9A 2KANA 1GUAB 2M4NA 1SE9A 3H7SA 3SDLC 3L54A 2N9EB 3DBLI 2KX3A 2WX1A 3A1QA 4DXAB 2DAFA 2G4SA 2IYDB 4LCDE 3ONSA 1E7VA 3VTUA 4TUUA 1S1QB 2LUEA 1WZ3A 3L10B 4GDKB 2M8SA 2KTRB 3CF6E 3NS8A 4XC2A 2MCNB 2K8BA 5G55A 4LDTB 1G6JA 3UF8A 3U8ZA 2L76A 3B0AA 3QX1A 2JRHA 5D6JB 2L00B 5G2NA 3QC8B 1V49A 1V5TA 1WXAA 4NQLB 3ZTDA 3MTNB 2BGFA 4WJOA 3A1QB 2D3GA 4GN1A 2DAJA 1P9DU 4IUMB 4FJYA 2MRPA 2KOXA 2CS4A 4FN2A 4ZRKA 3ZTCA 3ZRFA 5KHQA 2DZMA 3RCZA 3W1SA 4DHZB 4FADA 2K25A 3WAMA 1V6EA 1K8RB 4PYZA 3IVFA 3KYDD 1YX6B 4ASWC 2BWFA 3U30A 3A4RA 2KVRA 3WANA 1E5WA 4RM8A 4DHJD 5J2RA 3OJ4B 5DPTA 2DYOA 5CTRC 4LJOB 2CKHB 4IWQA 3R7QA 1YQBA 4WJQA 4EOYA 3V62A 2AWTA 4EZJA 4NPNA 1EUVB 2LWPA 3NZSA 3WA0A 2DZIA 4KDIC 5JZEB 4URKA 1R4MI 4HPLB 3JYUA 2A5UA 1CMXB 4ICVA 2LASA 3CMMB 2IY0B 4FA6A 3AI5A 2BKRB 3VUWA 1WX8A 4G50A 2MBHA 2I1KA 3H1UA 2FCQA 3ZKJC 3ZNGC 4EKUA 2LXCA 1GJZA 1Q0WB 1J19A 2DZJA 3B08A 4FHJA 3R3MA 2O6VD 5JHBA 1NDDA 4W9EA 4W9IA 2DX5B 2BPSA 3TL5A 5E6OA 4DHJB 1TTNA 2GBMA 4II2B 3MJWA 1FXTB 1V86A 4GU2A 2LGDA 5DCNA 3W1SC 4EUTA 4TQ0A 1C3TA 3RZFA 2KFKA 4FULA 4W9FA 2OOBB 2J0MA 3BY4B 3OLMD 1Z5SB 2DHZA 2KMCA 1OEYJ 1WXVA 4K7UA 4MDKE 5L83A 5AEKB 2AL6A 3QHTA 4FJVB 2EKEC 4ANXA 5JHAA 3DOWA 1UH6A 2KDBA 3QIJA 4IWOA 3IHPC 4MSQB 4KV2A 1WFYA 2GMIC 2GOWA 2O6VB 1Q1OA 3RUIB 2RD0A 2AYOB 2IO2B 1OGWA 2C7MB 3NY5A 4DBGA 3H6NA 1C1YB 2CHXA 3KUCB 4MGZE 4W9DA 4HDOA 2KJHB 2N1VA 2KFKB 3GOEA 4HXDA 2B3AA 4MM3A 1J0GA 3N32A 4MGYE 2R2QA 2N4FA 1LM8B 3PVLA 2PEAA 2NBVB 2AEHA 4DDGD 1WGDA 2KDEB 2LD9A 1M94A 4KVGB 2WYQA 1LQBA 1KOTA 3DBSA 2PE9A 4F8CB 3B1LX 4A3OA 2KLGA 3JSVB 4BOSC 2O2VA 3VVWB 2XK5A 2KNBA 2MBEA 1IPGA 1XD3B 3APFA 2WX0A 3A9KA 1E8XA 3H7PA 2RSUA 4I6NB 3PZDA 5D7GA 3KUDB 2FIDA 4M8MA 4OVVA 2Y5BB 2UWQA 4DHZE 2M17A 4GMVA 4KSLC 2HD5B 1WJ6A 4N9F4 2KO3A 2HJ8A 2WWZA 3HHMA 1YX5B 3MHSD 2C60A 1ZW7A 3V60A 4B9KA 3VAWA 3VFKA 3KH0A 3AXCA 4HCPB 4JLCA 2LVQA 1RLFA 3EHVA 3VDZA 4LJPB 3IG3A 4HVBA 2KTFA 1OQYA 3ALBA 3M63B 4E71A 4KZ0A 2WDTB 1V81A 4W9CA 4KDLB 3PRPB 2O2VB 3VTVA 2XK5B 1WRDB 4B6WA 1GC6A 2KMAA 1RRBA 2KJRA 3VH3B 2N9XA 3A9KB 2ZNVB 4GSWA 3H9DA 3H7PB 2FCNA 1WGHA 2Z0DB 4W9KA 2ASQA 3PT2B 4FLHA 2L7RA 4IM2A 3L08A 2JRIB 3PTFC 2CHWA 5LLIA 4IM3A 2REXA 3K9OB 4WJNA 3SU8X 3LJ3A 2LGYA 1WYWB 2KJ6A 1P1AA 1S3SG 1WXMA 3QARA 1ZKHA 2MBQA 3UIOB 4EFOA 2NPTA 3JVZX 4K81A 4BKGA 4BFRA 1AARA 2MBOA 3DVGX 4KIKB 1BT0A 2BWES 4F7ZA 3DQVA 1IYFA 1L7YA 4JIOU 4WQOB 3L16A 1WGGA 3PPAA 2C5LC 3QAQA 2LJ5A 4F1SA 2D10A 2MW5A 4PYUA 3WAOA 3RZWC 2JPHA 2IY1B 4OVUA 1HE8A 4J6IA 5DPSA 3ZNZB 2A4ZA 3APDA 1WE7A 4BOZB 2G45B 3ZO5B 4HWIB 2LXAA 2C7NB 3ZIMA 2NPTB 3HM6X 1V9JA 3ZDTA
chains in the Genus database with same CATH superfamily
5E6PA 1WMHB 1WI0A 4P7IA 2DZKA 2KWDA 3TBLD 4X57B 4DXFA 2K8HA 3BK2A 2V4LA 2JZZA 4ZRQA 3CSFA 1KJTA 2BQQA 3AB5A 3AU5A 3NRZA 3BINA 3C8YA 3DBHI 1D4BA 1SJED 4JQWC 1R4NB 1YIWA 2D07B 3MFGA 2UYZB 3JSVA 1KLVA 4KZCA 2JQRB 2J42A 2LZ6A 3NHEB 2NCNA 4OZAA 4AP4C 2L8JA 5E6NA 4TV3A 1F77A 2Z0EB 3L4PA 3OJ3A 2JWZA 1ZE3D 4JWSC 2IO1B 1F52A 4KSKC 2QEJC 3AECB 2G3QB 2IGDA 2ACZB 2MA9B 2KDIA 1J7BA 2QHOA 4W9HA 3UQAA 5CHFA 2FAZA 1SSNA 1YN3A 2KWCA 2JU6X 5C1ZA 3DBRI 3KUZA 1WJNA 3ZJUA 2K8CA 3ENEA 3U7DA 4A90A 4ARCA 1FCCC 1PFDA 1Q5WB 2BYEA 4OVZA 4YL8A 3L13A 1UF0A 4XWTA 2GBRA 2CHZA 4I6PA 3K9PB 2IDYA 2KXJA 4C80A 5LXHA 5LNK1 4BVUC 2KQ7A 2MQJA 2KZRA 2NR2A 2MP2A 3DDCB 3ZXVA 1WMHA 4YXDB 4RF0A 2K6QA 5C23A 4HLEA 4XDDA 3MP9A 2LEKA 1XT9B 1E10A 1FM0D 4UDUC 3PHWB 1RWSA 3UGBB 3M62B 3RULA 1L2NA 5IP4D 2VRRB 1DOXA 4IOIE 4ANVA 4E74A 2XNAC 1VDVA 2V1YA 4CHKA 4ANUA 4MJSA 1UGJA 1U4AA 2FBWB 3APCA 3TSSA 3NVWA 4S0RA 2FIFA 4AOFA 3NZ3A 4IW0A 1YQ4B 1N5WA 1C76A 3ZW3A 1WX9A 5FK9C 1FXAA 3PSEB 1F1HA 3SFDB 2M19A 2PVOD 2FUHB 1XO3A 3AE9B 3Q3FA 2HTHA 3IXSA 4K7SA 1HQRD 3FILA 4HJGE 4OW0A 4QAYA 4EEWA 4AWJA 1F0ZA 3RN9C 3EECA 3BWUD 5BMGA 1XCTL 3UIPB 2M1MA 2PLPA 3N1XC 1NENB 2IZVB 1WXQA 1D6EC 2EMSA 4ZHPA 3QCAA 4NJ7A 2KFJA 1P3QU 4GB9A 3WALA 1I4PA 1OFFA 4A55A 1E8WA 1SEBD 4TSSA 3IFWB 1I35A 1PGXA 2KTRA 4IC7B 1VD2A 2BF8B 1DGJA 3RD2A 1UZXB 4M8NA 2KWVB 3HIZA 1I42A 2YVCA 3PLUA 4IM0A 5CX3A 5GXGB 4LTUA 2N9EB 2WX1A 2DAFA 2G4SA 2IYDB 2V3NA 3ONSA 4TUUA 3NJTA 2LUEA 1FEHA 5IKCM 1UUPA 2BS2B 1L4ZB 3NS8A 1ZUD2 3Q3NC 4LDTB 3UF8A 4PK1A 5D6JB 5G2NA 1V49A 1MHXA 1JROA 3A1QB 4GN1A 3HVZA 2DAJA 4IUMB 2WU5B 3RI7C 2MRPA 4FN2A 2FE8A 2ON8A 2N9LA 3ZRFA 2DZMA 2K9XA 3RCZA 5KHQA 1XLQA 1K8RB 4H2AA 3A4RA 3WANA 1FD6A 5J2RA 3DBHB 2M56B 1T0RC 3V62A 2AWTA 4EZJA 1WRIA 3DHGC 1R4MI 3JYUA 5D3IB 2LASA 2LGSA 1TY2A 4ZOHC 3AEDB 3IAS1 3VUWA 4G50A 2DNFA 2I1KA 4EKUA 2VH1A 1ZXHA 3ZGZA 3R3MA 2O6VD 2QSDA 2WNMA 4W9EA 1L4DB 1AWDA 3TL5A 4DHJB 2GBMA 2PMVA 2X8XX 5EE3A 1C3TA 2BT6A 1OEYJ 3Q6BA 1V1PA 4K7UA 5AEKB 2AL6A 2EKEC 3DOWA 2SEBD 2LJIA 4MSQB 4AS1A 3DBRB 3RNFC 3RUIB 2RD0A 3U7ZA 3MJ5A 2C7MB 2CHXA 4MGZE 1ET6A 1CZPA 2KFKB 1NEKB 4MGYE 2R2QA 2NBVB 2PKOA 1LGRA 4KVGB 3VR8B 1XLOA 3DBSA 3B1LX 2KLGA 4BOSC 2O2VA 2XK5A 2W3RA 4KGRA 3H7PA 5D7GA 1SXTA 3KUDB 1IUEA 2Y5BB 2UWQA 3LXFA 4KSLC 1WJ6A 3MHSD 2W82A 3VAWA 3VFKA 4HCPB 1KRHA 3VDZA 3IG3A 4HVBA 1FRRA 1OQYA 3RNEC 4DXGA 4KDLB 4B6WA 4NJCA 1RRBA 2KJRA 3A9KB 1QLBB 2FCNA 5G5HA 4BZAA 2Z0DB 4W9KA 2RDGA 3PT2B 3VRBB 1SE2A 1PGAA 3PTFC 1CJEA 1C9FA 3RMKC 1TKEA 2KJ6A 1P1AA 2DWQA 2NPTA 3JVZX 2WXNA 3DHHC 3AE6B 2DLBA 2WXIA 3DQVA 1EU3A 5FKAC 4JIOU 1XCQL 2MW5A 3WAOA 3RZWC 1B9RA 1TS5A 3ZNZB 2LXAA 1N5XA 3ZIMA 3ZDTA 1AW7A 5AZHA 2MSED 3Q3MC 1TZ1A 4DQOC 2K22A 2M0AA 1XQQA 5HKHA 1I4HA 3V6CB 2KVZA 2ZPNA 2AQ3B 1NBFC 5AZGA 1TIFA 5IO9A 2MWSB 2FCSA 2KLCA 4TQ1A 1P98A 4FHKA 3RPFC 2W55A 4CYEA 3TEXA 4G0NB 3WCQA 2NTTA 3ZUNA 2N0SB 4HPPA 1KFYB 2MLBA 3AEAB 4A8XC 3VUXA 1N63A 1AN8A 3DVNU 2WXQA 4BKTA 2J7QB 2L83A 4HCNB 1ZGUB 4ZDVA 1TS4A 4WAAA 4PS3A 2ZPYA 3CSTA 2WDVB 3EFCA 4XYCA 4XZ4A 1WM2A 3R66C 2N9KA 1WGKA 4ZRJA 3L0WB 2H89B 3GE8C 3VH4B 1L0VB 2XEWA 2YLMA 4LNKA 2BS4B 4TKNA 3PS6A 2EELA 2CR5A 1PQSA 1V97A 2PE6B 5I4DA 1T3QA 1YOVB 2W9NA 4WURA 1DYQA 1H8CA 5CHWA 1EWCA 5EE0A 2ZCBA 2IO3B 1VZ7A 3TJPA 1JMLA 2JX5A 2WXOA 4DWFA 4ZYNA 1VZ6A 3O65B 3PGEA 2LUMA 1H4RA 4A20A 1E7PB 5BMHA 1F9JA 3UINB 1TJEA 1WZ0A 4NAWB 1QQRA 2MX2A 1QZEA 1RYJA 2NVUI 3ZNHB 4ANWA 2LGXA 4KKJA 4C7ZA 1T0QC 1MJDA 2JXTA 4WIPA 1R4MB 1D5MC 1STEA 3URYA 1XLNA 4N6EB 3VHTC 1BUIC 4YT0B 5H8YE 3A4SC 3VXWA 3HK0A 1WE6A 3SR6A 2JZPA 4W9LA 4ICUA 4NJ6A 5H92C 1GC7A 1X1MA 4RCOA 2I38A 2OHFA 1YN4A 2KQSA 3RYTA 3IBEA 2MP2B 2DBYA 4KGTA 2QJLA 2BB6A 3A9JA 4ZYSA 4K7WA 4HJKA 2KKCA 3Q8BA 1CQVA 1EWYC 1WJUA 4EZLA 3BVGA 4WWNA 2M0XA 1MFWA 2LI5A 2BKFA 3P4RB 4JWUC 4MH0E 4BKSD 3DCGA 2JT4B 4MJSB 3I3TB 2QDFA 3I63C 5T8IA 3FKYA 3TMPB 1XXGA 4AJWA 1A70A 1Y8RC 3KWLA 5GMVA 5IOIA 1MHHE 4LLGM 1SBBB 3EC8A 2KDMA 1I4GA 4ARIA 4B95A 4O1NA 2MJ3A 3TCAA 4BBNF 2N7DA 1C4CA 4WJPA 2ZZPB 2KHWB 4P6VF 3WIMA 3VUYA 1QOGA 4LK0M 3BYYB 4M0WB 3FILB 3QQ8B 4L2YA 3V61A 4WWMA 2LMCA 5HG2A 1WM3A 4II3B 4WAFA 3DWGC 2V3SA 2I1JA 4NAWA 2KYWA 2KWUB 3B9JA 3ZRCA 4W9GA 1FRDA 2C7HA 2UU7A 3ZJTA 2VZKB 2JYTA 3NUHB 3AE5B 2BYVE 1D5ZC 2JWUA 1WF9A 1FNUA 1GUAB 3SDLC 3L54A 2BB5A 4DXAB 4C56C 1R7SA 3O13A 4LCDE 4LNOA 3VTUA 1E7VA 3AH7A 2RPVA 5FR3A 2CU3A 3L10B 2M8SA 2KTRB 4HRSA 1MPEA 2WXLA 3CF6E 2MCNB 2Z8LA 5G55A 1HZ6A 3B0AA 1JWUD 2L00B 3AEGB 1TT5B 1V5TA 2L1AA 1WXAA 3MTNB 1E9MA 2BGFA 1FFVA 3I5JC 4WJOA 2WGSA 1D5XC 2KOXA 1IBXB 3ZTCA 1VZ8A 1ZDXA 4L23A 1N61A 4DHZB 3WAMA 1V6EA 1I4QA 4YSZB 1ET9A 1KLGD 1IGCA 2KVRA 1E5WA 4RM8A 1ROEA 5DPTA 2DYOA 4IWQA 1YQBA 4WJQA 2B76B 4EOYA 4ZRPA 2AQ1B 4KX6B 5JZEB 2DZIA 1WWTA 2ICIA 2IY0B 4FA6A 2HTME 2MBHA 3ZNGC 2WXRA 2LXCA 4KGSA 2DZJA 3B08A 2DX5B 3MJWA 3EGRA 4JE3B 1FXTB 1V86A 4M0WA 4TQ0A 2HDEA 2NTSA 1FNWA 3RFZB 2DHZA 2KMCA 2QILA 1WXVA 4RGOS 5L83A 1FCLA 4RH6A 3VRAB 5JHAA 2GLSA 1F2RI 3QIJA 4OZCA 4IWOA 1KTKA 2G1EA 2GOWA 1Q1OA 3NS1A 1OGWA 3NY5A 2INDC 4HDOA 1ZPSA 2KJHB 2WHIA 1J0GA 3B2FA 4DDGD 2KDEB 1C4AA 2LD9A 1V1PB 2PTLA 1KOTA 1MG4A 2PE9A 4F8CB 3P4PB 2KNBA 1TKYA 2MBEA 1K50A 2RSUA 4KKIA 3PZDA 3FAHA 2BVCA 1YNTE 2HJ8A 1YX5B 1ZW7A 1WYGA 1GB4A 4B9KA 1IBXA 2WXMA 2LVQA 1P7EA 4JX1C 1RLFA 3EHVA 4ZHOA 4US9A 3M63B 4E71A 2WDTB 2O2VB 2XK5B 1WRDB 2BW2A 3CIRB 2ZNVB 1YJIA 3H9DA 3H7PB 2D3BA 3GE3C 3BK1A 3J9CA 2ASQA 4FLHA 4IM2A 2L7RA 3GB1A 3KQ4A 5LLIA 2REXA 4WJNA 3IT6B 3MC0B 1WYWB 1S3SG 3P1MA 1WXMA 2K0PA 4EFOA 4BKGA 2KACA 2MBOA 2BYTA 1ESFA 4KIKB 1BT0A 2BWES 1ZP0B 1KH0A 4F7ZA 1J7CA 5AUIA 1IYFA 2BS3B 3PPAA 2C5LC 2IY1B 1ENFA 4BOZB 2G45B 1TS2A 3VR9B 2C7NB 2NPTB 3R2IA 3AM9A 2WDQB 3IAM1 3Q3JA 5BYSA 2BYFA 1P0RA 1WJ4A 2GBNA 4DK5A 2WXJA 5JH5C 4J3OD 2D3CA 1MVKA 5E6JA 3DPDA 2K1FA 1N60A 1QILA 5BO4B 3UQBA 3QWZB 3V6EB 2C9WB 1WXSA 2E3TA 2DYMA 2Z59B 3AULA 2LFIA 1UBIA 1T0YA 3HRDD 3N20C 3L17A 4FJZA 2NBUA 3I9V1 1L0XB 4MACA 2RGFA 3LYYA 2INCC 4PT5A 1RFAA 1I4XA 1KLUD 1LXDA 1SE4A 4K3BA 3U52E 2KK8A 1VR9A 1C77A 2BBCA 4YTNB 3ABVB 3X23A 3TIXA 1NYQA 4W9JA 2L05A 1E8ZA 1MI0A 1WGRA 2PPHA 2GBKA 5TR5A 4NNJB 4RGMA 5IA7A 1HXYD 2GBJA 3ZLZA 1K53A 2J0KA 2PIAA 2Y5CA 1R4NI 3KW5B 1YD8U 1UGMA 2IGGA 2XBBC 1Z2MA 2NMQA 2WXPA 1FPYA 2JVCA 2FCMA 2K39A 2RR9A 1SGHA 1TY0A 2KQ4X 1EU4A 4KIKA 2KX0A 2L0FA 3KYCD 1QOAA 2MH7A 3GZNI 3OAWA 3BVZA 3IT4B 3JW0X 1WR1A 1PGBA 4BBNC 1JWSD 3C19A 4MH8A 3V05A 3OG5A 1YJ1A 1V80A 3SFEB 5DPRA 4FBJB 3ML9A 3ZDMC 4XX5A 3P42A 3OWEB 3ZJVA 1ISNA 1TBEA 2H88B 2ZNVC 3N3KB 4NQKE 3TEYA 2JYEA 3R7RA 2MJEA 2MBBB 1WIAA 4WQMA 4YSXB 1E8YA 3W1YA 4A9AA 1V5OA 2ZVNA 3NZUA 3PV1A 3DVGY 4M01A 3B2GA 3T3OA 1L6VA 2JF5A 1MG8A 5C2TB 1A5RA 2V9HA 1LFDA 1VRAB 4US8A 1HEZE 3AE7B 2QC8A 2JY6A 3UI3A 1NI3A 4M02A 5DPWA 3DVNV 4HKZE 1ZXIA 3QJZA 4MEMA 4P1CC 3WAPA 3DHIC 3D32A 2WXGA 3E9SA 3EFUA 4RMAA 1VLBA 3LDZE 2OJRA 4BKSA 5LXIB 2ZCCA 1UBQA 2PW9A 2L0TA 3A9JB 4GDLA 3S2AA 3RNAC 3TEZA 3VTWA 4G3XB 2K6DB 4HKQA 1OTRB 3BYTB 3HVDA 2IBIB 1WGYA 3LB8C 2N1WA 4YWGG 2IO0B 1V2YA 1UD7A 1UWMA 3V3XA 2D11A 4CO7A 4GOCA 2LHEA 4MGKE 3M95A 4WWPA 1CK1A 1SIJA 4GDKA 2AX5A 2E6XA 1SIFA 3H8HA 4LDTD 4GIVA 4RGNA 3PRMB 2YEPF 1GPXA 1EF1A 2LVPA 1GNUA 2CU1A 4L1BA 4DDID 2KANA 3DBLI 2KX3A 1VJKA 4RF1A 2GRIA 1WZ3A 1TS3A 3MC8A 1I7HA 1SF0A 2W3SA 3BVMA 3TEWA 1G6JA 3CWIA 3U8ZA 2L76A 2GI9A 3QX1A 2JRHA 1TKGA 1KF6B 4NQLB 3ZTDA 1XLPA 1EM7A 2LGIA 2OEDA 4HEA1 4FJYA 2CS4A 3W5UB 4B0MA 3ZXRA 1QF6A 1E6EB 1JW9D 3W1SA 1FFUA 2SAKA 4FADA 2K25A 4PYZA 4XDCA 5JXVA 3IVFA 2AQ2B 3KYDD 1YX6B 4USAA 2BWFA 2D5GA 3U30A 2I2YA 4DHJD 3OJ4B 3R2TA 4D2KA 2J4XA 1EUVB 3NZSA 4FXCA 1K51A 4URKA 2WXFA 4HPLB 2BKRB 3H1UA 2FCQA 1GJZA 1J19A 1PYWD 1L6UA 4BAXA 1XEEA 2BPSA 5E6OA 1F2RC 1TTNA 1YN5A 5DCNA 3W1SC 3ZQ4A 4EUTA 3RZFA 4FULA 2OOBB 2J0MA 3BY4B 3OLMD 3KWVA 3AE2B 3P63A 4P16A 4MDKE 2CJOA 4FJVB 4EE2A 1FMAD 2TSSA 2KDBA 3IHPC 4KV2A 2O6VB 1BXTA 1J7AA 2IO2B 4DBGA 3H6NA 1C1YB 4W9DA 1ZDVA 1Q10A 2N1VA 4MM3A 5HHDG 3GZNB 1HZ5A 2N4FA 3PVLA 2PEAA 1WGDA 1M94A 2V4IB 2WYQA 3RNCC 1GOZA 3AV8A 1IPGA 1XD3B 3APFA 2WX0A 4B0EA 1E8XA 1QOBA 4M8MA 2M17A 4GMVA 2HD5B 2KO3A 2WWZA 3V60A 1IGDA 3AXCA 2WS3B 2IJ0A 3ALBA 3AN1A 3VTVA 4IDIA 3DWMA 1GC6A 3AE8B 4GSWA 1TYGB 1M4VA 4C7YA 1WGHA 2CJNA 2ZW1A 3L08A 4C4VA 3ETRA 4M00A 3ZYYX 3K9OB 3SU8X 2LGYA 2YEPB 2MBQA 3UIOB 1T6BX 2V0GA 4BFRA 1AARA 1DOYA 5BYQA 1RFKA 2BTEA 3NVZA 1L7YA 3U4EG 1C78A 3L16A 2LJ5A 2D10A 2PVGC 5MPOA 1V8CA 4Q2JA 4OZBA 4J6IA 2A4ZA 3APDA 1WE7A 3ZO5B 4S17A 4XE0A 3HM6X 4NZLB 1UWXA 2KT7A 3QK0A 2W54A 1DOIA 2JSVX 2N7EA 1WSPA 2D2QA 4AUQC 1WX7A 5AZFA 1P7FA 2O6VA 1YMHE 1T0SC 4RM9A 1SE3A 1BMLC 4HDQA 2RPQA 2KDFB 2EMTA 3NOBA 1RAXA 4P1BC 3Q8AA 2RMMA 1ACCA 5EDSA 4HK2A 5CHVC 5J17A 3PHXB 3T8MA 2LVOA 2J53A 1GB1A 1JALA 1OQRA 2N9PC 4A3PA 5D3DA 4JL9A 1WH3A 1UNSA 4HPMB 4IKGA 1UELA 1SB3C 3KVFB 3VQIA 3DBLB 2RDHA 1FIQA 3ZVVA 2FUG1 2K3UA 5HFYA 4ITKA 4K1RB 3SEBA 2WXKA 2DYBA 2JXXA 2NBWB 3HM3A 3P2BA 2LRWA 1B1ZA 5IAAC 2QIEB 2RDBC 5KHOA 5HI1A 1SJHD 4MSMB 3FC4A 1WR6E 2G9HD 4WWOA 2NS5A 3AU4A 2AL3A 2HE7A 5G5GA 3NVVA 4MGIE 3X0WA 2X38A 2L3ZA 1TGZB 4AJYB 5FR6A 2ZJDA 5J18A 4NY0A 4LNIA 5EE1A 4A6QA 4GGQA 3Q69A 3W5VB 3AEEB 1OEYA 4MELA 2DENB 2JUOA 3ZNID 4GXBA 4N59A 3Q2AC 3N1YC 3ML8A 1EF5A 4ZRIA 2KC2A 3PRZA 2L32A 4I6LB 4JGHB 4N58A 2LRUA 1Y56A 2VH2A 4EZKA 4YTPB 2MHJA 1ZOYB 5D2MB 4NAMA 5BYRA 3W9CB 1VCBA 1N6ZA 2OJWA 3RT3B 1JRUA 1FXIA 4PS7A 1C79A 2J0JA 1E90A 1KM7A 1NI2A 4RNAA 3EUB2 4G11A 1HTOA 3A33B 1NVID 3T9LA 2R2OA 2ZEQA 2KMMA 3NVYA 1GG3A 2KD0A 2G4DB 2WXHA 4HROA 4IG7B 1N62A 1E7UA 4LNNA 1RM6C 4C00A 3BZDB 3EA6A 1K52A 4IWPA 3RNBC 3N9YC 3GP7A 3ECIA 2FNJB 4E3CA 3QA8A 1IP9A 1D3ZA 3I57A 3SHQA 2INNE 2VZKD 4XGAB 1EO6A 2WLBA 2KN5A 3N30A 3RNGC 2PJHA 4GDLB 4PS8A 5L95C 3SD5A 4WH4A 3U2SC 1QOFA 2ONQA 2XN9C 3PLVA 3AEBB 2KC1A 2Y5PA 4K3CA 3W2DA 3PREA 2D3AA 3M3JA 5D94A 3C0RB 2JZ3B 1WY8A 2WP9B 3PO0A 1J8CA 2IPKD 4RGTA 1QT9A 2ZVOA 2M4NA 1SE9A 3H7SA 3A1QA 1S1QB 1NYRA 3Q8EA 4GDKB 2INPE 3P4SB 1HA5A 4XC2A 2K8BA 3QC8B 3KLSX 4CQNA 3PZ7A 2D3GA 1P9DU 1JCKB 4REZA 2WQYB 4ZRKA 2Q5WD 3HUIA 1T5XD 1PDXA 2J52A 4ASWC 4JPSA 5CTRC 4LJOB 2CKHB 3R7QA 1I4RA 3NG0A 3R8BA 3GS2A 3AE3B 4NPNA 2LWPA 1JWAD 3WA0A 4KDIC 2MJDA 3MHZA 2A5UA 1CMXB 1C4PA 4ACFA 4ICVA 3CMMB 4GLSC 2KAJA 3AI5A 1FNVA 1WX8A 4OHJA 3ZKJC 3AMZA 1Q0WB 4FHJA 1LO5D 1AYFA 4YSYB 5JHBA 1L0YB 1NDDA 4W9IA 1JQ4A 4LNFA 1GAQB 4II2B 2IGHA 1JWMD 4GU2A 2LGDA 2LHDA 2KFKA 3Q14C 2EKIA 4W9FA 2MEKA 4YTMB 3TUOA 1Z5SB 4RFBA 4MT5A 2KN4A 1QKZA 1JRPA 3Q3OC 4XWWA 1L5PA 3QHTA 4ANXA 2ZW0A 3PZ8A 2WDRB 1UH6A 1WFYA 1TZOA 2GMIC 2AYOB 2Y3AA 2V3PA 3Q8CA 3N1ZC 1XF5L 3KUCB 3GOEA 4HXDA 2B3AA 2N7JA 2R61A 3N32A 4AQ7A 1LM8B 2AEHA 1V1OA 1LQBA 4A3OA 3JSVB 3VVWB 1E0ZA 3AEFB 3MC9A 3A9KA 3BIID 2HJ1A 4I6NB 2FIDA 4OVVA 4DHZE 4N9F4 4MM3B 3HHMA 5BMIA 3Q8FA 2C60A 3KH0A 3E56A 2QMTA 4JLCA 4LJPB 2KTFA 1FO4A 3T3NA 4KZ0A 5EE9A 1V81A 4W9CA 3PRPB 1HTQA 2QCZA 5IN7A 2KMAA 3VH3B 2N9XA 3P4QB 1YJJA 3AE4B 2GB1A 2JRIB 4R3DA 2CHWA 5C3JB 1PUTA 4IM3A 3LJ3A 3QARA 3AE1B 1ZKHA 4K81A 1JWBD 3DVGX 1OQQA 4TMAB 5AUKA 2L52A 2K5PA 2WU2B 5TSSA 4WQOB 1WGGA 3QAQA 1YQ3B 4F1SA 4PYUA 2JPHA 4OVUA 4C4VB 1HE8A 5DPSA 4HWIB 1V9JA
chains in the Genus database with same CATH topology
5E6PA 5AZHA 2MSED 1WMHB 1TZ1A 3Q3JA 1WI0A 3QK0A 1XQQA 5HKHA 4P7IA 2BYFA 1P0RA 1WJ4A 2DZKA 2N7EA 3V6CB 3TBLD 2GBNA 4X57B 4DK5A 2D2QA 2ZPNA 5JH5C 2K8HA 1NBFC 5AZGA 4AUQC 2V4LA 2JZZA 1WX7A 2MWSB 2FCSA 2KLCA 5AZFA 3DPDA 2K1FA 2O6VA 4TQ1A 4RM9A 1P98A 4FHKA 5BO4B 3CSFA 4HDQA 1KJTA 3UQBA 2RPQA 2KDFB 4CYEA 4G0NB 3QWZB 3AU5A 2EMTA 3V6EB 2C9WB 1RAXA 3BINA 3NOBA 1WXSA 2DYMA 2Z59B 3ZUNA 3AULA 2MLBA 3DBHI 1UBIA 1T0YA 3L17A 3VUXA 4FJZA 2NBUA 4JQWC 5EDSA 4HK2A 1YIWA 5CHVC 2D07B 5J17A 3PHXB 2UYZB 3JSVA 1KLVA 3DVNU 3T8MA 2LVOA 4BKTA 2J7QB 2RGFA 4KZCA 4HCNB 1ZGUB 4ZDVA 1RFAA 2N9PC 4A3PA 2LZ6A 4JL9A 4WAAA 3NHEB 1LXDA 4PS3A 1WH3A 2NCNA 4HPMB 2ZPYA 2KK8A 3CSTA 1UELA 4AP4C 3KVFB 3VQIA 2L8JA 5E6NA 3X23A 4TV3A 4XZ4A 3TIXA 1WM2A 3R66C 2Z0EB 4W9JA 3OJ3A 2JWZA 2L05A 1E8ZA 4ZRJA 3ZVVA 1WGRA 2PPHA 3L0WB 2IO1B 2GBKA 4KSKC 4K1RB 3VH4B 5TR5A 2DYBA 2JXXA 2NBWB 4NNJB 3HM3A 5IA7A 3P2BA 2LRWA 2G3QB 2MA9B 2XEWA 2KDIA 5IAAC 2YLMA 5KHOA 2QHOA 4W9HA 3UQAA 2GBJA 5CHFA 4TKNA 3ZLZA 2J0KA 2FAZA 4MSMB 1R4NI 3PS6A 2CR5A 1PQSA 3KW5B 1YD8U 1UGMA 1WR6E 4WWOA 2XBBC 2KWCA 1Z2MA 5C1ZA 2NS5A 3DBRI 3AU4A 2PE6B 2AL3A 2JVCA 2W9NA 3KUZA 1WJNA 2HE7A 2FCMA 1H8CA 2K8CA 3ENEA 3U7DA 2K39A 2RR9A 1SGHA 5CHWA 4MGIE 3X0WA 2ZCBA 4KIKA 2IO3B 2KX0A 2L0FA 3TJPA 2L3ZA 3KYCD 1Q5WB 2BYEA 3GZNI 1TGZB 4YL8A 3L13A 3OAWA 4DWFA 4ZYNA 4AJYB 5FR6A 3JW0X 1WR1A 2ZJDA 5J18A 4NY0A 4BBNC 3O65B 2GBRA 3PGEA 1H4RA 2CHZA 4I6PA 4GGQA 4A20A 3K9PB 1YJ1A 1V80A 1F9JA 3UINB 2KXJA 1OEYA 5DPRA 1WZ0A 4NAWB 4MELA 4FBJB 2MX2A 1QZEA 5LXHA 2DENB 2NVUI 3ML9A 3ZNHB 3ZDMC 4XX5A 4ANWA 2JUOA 4BVUC 3ZNID 4GXBA 2KQ7A 2LGXA 1ISNA 2MQJA 2KZRA 2NR2A 2MP2A 3DDCB 1TBEA 1WMHA 2ZNVC 3ML8A 1EF5A 3N3KB 4NQKE 2K6QA 4ZRIA 5C23A 3R7RA 4HLEA 2KC2A 2MBBB 1XT9B 3PRZA 4I6LB 3VHTC 1WIAA 4JGHB 2LRUA 3A4SC 3VXWA 3HK0A 3PHWB 1E8YA 3UGBB 4EZKA 3M62B 1WE6A 3RULA 1L2NA 3W1YA 2VRRB 5D2MB 4W9LA 4ICUA 4NJ6A 1VCBA 1GC7A 1V5OA 1X1MA 2ZVNA 1JRUA 3NZUA 3PV1A 3RT3B 4ANVA 4E74A 3RYTA 2KQSA 2V1YA 4PS7A 3IBEA 2MP2B 4CHKA 3DVGY 4ANUA 2J0JA 4MJSA 2JF5A 1MG8A 1E90A 1U4AA 1KM7A 1NI2A 1A5RA 3A9JA 3APCA 1LFDA 4K7WA 4HJKA 2KKCA 4G11A 1WJUA 2FIFA 2JY6A 3A33B 4EZLA 4AOFA 4WWNA 3T9LA 5DPWA 2R2OA 3DVNV 2ZEQA 2M0XA 4IW0A 3ZW3A 3QJZA 4MEMA 1WX9A 1GG3A 2KD0A 2G4DB 2LI5A 2BKFA 3WAPA 4MH0E 3D32A 3EFUA 3PSEB 4RMAA 4BKSD 3DCGA 2JT4B 4IG7B 4MJSB 3I3TB 2FUHB 3LDZE 2OJRA 4BKSA 3TMPB 1E7UA 5LXIB 4AJWA 2ZCCA 1UBQA 1Y8RC 2L0TA 3A9JB 3Q3FA 4GDLA 5GMVA 3S2AA 2HTHA 4K7SA 4IWPA 3EC8A 3VTWA 4G3XB 3ECIA 2FNJB 2K6DB 1OTRB 4E3CA 4EEWA 4AWJA 4B95A 3QA8A 3EECA 1IP9A 1D3ZA 3SHQA 2IBIB 1WGYA 3TCAA 4BBNF 2N7DA 3UIPB 2M1MA 4WJPA 1EO6A 3N30A 2KN5A 2ZZPB 2IZVB 2N1WA 2KHWB 3WIMA 2PJHA 2IO0B 1V2YA 2EMSA 3VUYA 1UD7A 4GDLB 3QCAA 4PS8A 5L95C 4NJ7A 2KFJA 1P3QU 4GB9A 2D11A 4CO7A 4GOCA 3SD5A 3WALA 4M0WB 3QQ8B 3V61A 3PLVA 4MGKE 1E8WA 3M95A 2KC1A 1WM3A 3PREA 4II3B 3IFWB 4WWPA 2V3SA 1I35A 2I1JA 4NAWA 4GDKA 3M3JA 1SIFA 5D94A 2KWUB 3ZRCA 3C0RB 4W9GA 4LDTD 2JZ3B 2KTRA 4IC7B 1WY8A 1VD2A 2BF8B 2C7HA 4GIVA 1UZXB 3RD2A 4M8NA 2KWVB 3PRMB 3HIZA 1EF1A 1J8CA 2YVCA 3PLUA 4IM0A 5CX3A 1I42A 2BYVE 1GNUA 2LVPA 2CU1A 4DDID 2ZVOA 1WF9A 2KANA 1GUAB 2M4NA 1SE9A 3H7SA 3SDLC 3L54A 2N9EB 3DBLI 2KX3A 2WX1A 3A1QA 4DXAB 2DAFA 2G4SA 2IYDB 4LCDE 3ONSA 1E7VA 3VTUA 4TUUA 1S1QB 2LUEA 1WZ3A 3L10B 4GDKB 2M8SA 2KTRB 3CF6E 3NS8A 4XC2A 2MCNB 2K8BA 5G55A 4LDTB 1G6JA 3UF8A 3U8ZA 2L76A 3B0AA 3QX1A 2JRHA 5D6JB 2L00B 5G2NA 3QC8B 1V49A 1V5TA 1WXAA 4NQLB 3ZTDA 3MTNB 2BGFA 4WJOA 3A1QB 2D3GA 4GN1A 2DAJA 1P9DU 4IUMB 4FJYA 2MRPA 2KOXA 2CS4A 4FN2A 4ZRKA 3ZTCA 3ZRFA 5KHQA 2DZMA 3RCZA 3W1SA 4DHZB 4FADA 2K25A 3WAMA 1V6EA 1K8RB 4PYZA 3IVFA 3KYDD 1YX6B 4ASWC 2BWFA 3U30A 3A4RA 2KVRA 3WANA 1E5WA 4RM8A 4DHJD 5J2RA 3OJ4B 5DPTA 2DYOA 5CTRC 4LJOB 2CKHB 4IWQA 3R7QA 1YQBA 4WJQA 4EOYA 3V62A 2AWTA 4EZJA 4NPNA 1EUVB 2LWPA 3NZSA 3WA0A 2DZIA 4KDIC 5JZEB 4URKA 1R4MI 4HPLB 3JYUA 2A5UA 1CMXB 4ICVA 2LASA 3CMMB 2IY0B 4FA6A 3AI5A 2BKRB 3VUWA 1WX8A 4G50A 2MBHA 2I1KA 3H1UA 2FCQA 3ZKJC 3ZNGC 4EKUA 2LXCA 1GJZA 1Q0WB 1J19A 2DZJA 3B08A 4FHJA 3R3MA 2O6VD 5JHBA 1NDDA 4W9EA 4W9IA 2DX5B 2BPSA 3TL5A 5E6OA 4DHJB 1TTNA 2GBMA 4II2B 3MJWA 1FXTB 1V86A 4GU2A 2LGDA 5DCNA 3W1SC 4EUTA 4TQ0A 1C3TA 3RZFA 2KFKA 4FULA 4W9FA 2OOBB 2J0MA 3BY4B 3OLMD 1Z5SB 2DHZA 2KMCA 1OEYJ 1WXVA 4K7UA 4MDKE 5L83A 5AEKB 2AL6A 3QHTA 4FJVB 2EKEC 4ANXA 5JHAA 3DOWA 1UH6A 2KDBA 3QIJA 4IWOA 3IHPC 4MSQB 4KV2A 1WFYA 2GMIC 2GOWA 2O6VB 1Q1OA 3RUIB 2RD0A 2AYOB 2IO2B 1OGWA 2C7MB 3NY5A 4DBGA 3H6NA 1C1YB 2CHXA 3KUCB 4MGZE 4W9DA 4HDOA 2KJHB 2N1VA 2KFKB 3GOEA 4HXDA 2B3AA 4MM3A 1J0GA 3N32A 4MGYE 2R2QA 2N4FA 1LM8B 3PVLA 2PEAA 2NBVB 2AEHA 4DDGD 1WGDA 2KDEB 2LD9A 1M94A 4KVGB 2WYQA 1LQBA 1KOTA 3DBSA 2PE9A 4F8CB 3B1LX 4A3OA 2KLGA 3JSVB 4BOSC 2O2VA 3VVWB 2XK5A 2KNBA 2MBEA 1IPGA 1XD3B 3APFA 2WX0A 3A9KA 1E8XA 3H7PA 2RSUA 4I6NB 3PZDA 5D7GA 3KUDB 2FIDA 4M8MA 4OVVA 2Y5BB 2UWQA 4DHZE 2M17A 4GMVA 4KSLC 2HD5B 1WJ6A 4N9F4 2KO3A 2HJ8A 2WWZA 3HHMA 1YX5B 3MHSD 2C60A 1ZW7A 3V60A 4B9KA 3VAWA 3VFKA 3KH0A 3AXCA 4HCPB 4JLCA 2LVQA 1RLFA 3EHVA 3VDZA 4LJPB 3IG3A 4HVBA 2KTFA 1OQYA 3ALBA 3M63B 4E71A 4KZ0A 2WDTB 1V81A 4W9CA 4KDLB 3PRPB 2O2VB 3VTVA 2XK5B 1WRDB 4B6WA 1GC6A 2KMAA 1RRBA 2KJRA 3VH3B 2N9XA 3A9KB 2ZNVB 4GSWA 3H9DA 3H7PB 2FCNA 1WGHA 2Z0DB 4W9KA 2ASQA 3PT2B 4FLHA 2L7RA 4IM2A 3L08A 2JRIB 3PTFC 2CHWA 5LLIA 4IM3A 2REXA 3K9OB 4WJNA 3SU8X 3LJ3A 2LGYA 1WYWB 2KJ6A 1P1AA 1S3SG 1WXMA 3QARA 1ZKHA 2MBQA 3UIOB 4EFOA 2NPTA 3JVZX 4K81A 4BKGA 4BFRA 1AARA 2MBOA 3DVGX 4KIKB 1BT0A 2BWES 4F7ZA 3DQVA 1IYFA 1L7YA 4JIOU 4WQOB 3L16A 1WGGA 3PPAA 2C5LC 3QAQA 2LJ5A 4F1SA 2D10A 2MW5A 4PYUA 3WAOA 3RZWC 2JPHA 2IY1B 4OVUA 1HE8A 4J6IA 5DPSA 3ZNZB 2A4ZA 3APDA 1WE7A 4BOZB 2G45B 3ZO5B 4HWIB 2LXAA 2C7NB 3ZIMA 2NPTB 3HM6X 1V9JA 3ZDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E6P A;  5AZH A;  2MSE D;  1WMH B;  1TZ1 A;  3Q3J A;  1WI0 A;  3QK0 A;  1XQQ A;  5HKH A;  4P7I A;  2BYF A;  1P0R A;  1WJ4 A;  2DZK A;  2N7E A;  3V6C B;  3TBL D;  2GBN A;  4X57 B;  4DK5 A;  2D2Q A;  2ZPN A;  5JH5 C;  2K8H A;  1NBF C;  5AZG A;  4AUQ C;  2V4L A;  2JZZ A;  1WX7 A;  2MWS B;  2FCS A;  2KLC A;  5AZF A;  3DPD A;  2K1F A;  2O6V A;  4TQ1 A;  4RM9 A;  1P98 A;  4FHK A;  5BO4 B;  3CSF A;  4HDQ A;  1KJT A;  3UQB A;  2RPQ A;  2KDF B;  4CYE A;  4G0N B;  3QWZ B;  3AU5 A;  2EMT A;  3V6E B;  2C9W B;  1RAX A;  3BIN A;  3NOB A;  1WXS A;  2DYM A;  2Z59 B;  3ZUN A;  3AUL A;  2MLB A;  3DBH I;  1UBI A;  1T0Y A;  3L17 A;  3VUX A;  4FJZ A;  2NBU A;  4JQW C;  5EDS A;  4HK2 A;  1YIW A;  5CHV C;  2D07 B;  5J17 A;  3PHX B;  2UYZ B;  3JSV A;  1KLV A;  3DVN U;  3T8M A;  2LVO A;  4BKT A;  2J7Q B;  2RGF A;  4KZC A;  4HCN B;  1ZGU B;  4ZDV A;  1RFA A;  2N9P C;  4A3P A;  2LZ6 A;  4JL9 A;  4WAA A;  3NHE B;  1LXD A;  4PS3 A;  1WH3 A;  2NCN A;  4HPM B;  2ZPY A;  2KK8 A;  3CST A;  1UEL A;  4AP4 C;  3KVF B;  3VQI A;  2L8J A;  5E6N A;  3X23 A;  4TV3 A;  4XZ4 A;  3TIX A;  1WM2 A;  3R66 C;  2Z0E B;  4W9J A;  3OJ3 A;  2JWZ A;  2L05 A;  1E8Z A;  4ZRJ A;  3ZVV A;  1WGR A;  2PPH A;  3L0W B;  2IO1 B;  2GBK A;  4KSK C;  4K1R B;  3VH4 B;  5TR5 A;  2DYB A;  2JXX A;  2NBW B;  4NNJ B;  3HM3 A;  5IA7 A;  3P2B A;  2LRW A;  2G3Q B;  2MA9 B;  2XEW A;  2KDI A;  5IAA C;  2YLM A;  5KHO A;  2QHO A;  4W9H A;  3UQA A;  2GBJ A;  5CHF A;  4TKN A;  3ZLZ A;  2J0K A;  2FAZ A;  4MSM B;  1R4N I;  3PS6 A;  2CR5 A;  1PQS A;  3KW5 B;  1YD8 U;  1UGM A;  1WR6 E;  4WWO A;  2XBB C;  2KWC A;  1Z2M A;  5C1Z A;  2NS5 A;  3DBR I;  3AU4 A;  2PE6 B;  2AL3 A;  2JVC A;  2W9N A;  3KUZ A;  1WJN A;  2HE7 A;  2FCM A;  1H8C A;  2K8C A;  3ENE A;  3U7D A;  2K39 A;  2RR9 A;  1SGH A;  5CHW A;  4MGI E;  3X0W A;  2ZCB A;  4KIK A;  2IO3 B;  2KX0 A;  2L0F A;  3TJP A;  2L3Z A;  3KYC D;  1Q5W B;  2BYE A;  3GZN I;  1TGZ B;  4YL8 A;  3L13 A;  3OAW A;  4DWF A;  4ZYN A;  4AJY B;  5FR6 A;  3JW0 X;  1WR1 A;  2ZJD A;  5J18 A;  4NY0 A;  4BBN C;  3O65 B;  2GBR A;  3PGE A;  1H4R A;  2CHZ A;  4I6P A;  4GGQ A;  4A20 A;  3K9P B;  1YJ1 A;  1V80 A;  1F9J A;  3UIN B;  2KXJ A;  1OEY A;  5DPR A;  1WZ0 A;  4NAW B;  4MEL A;  4FBJ B;  2MX2 A;  1QZE A;  5LXH A;  2DEN B;  2NVU I;  3ML9 A;  3ZNH B;  3ZDM C;  4XX5 A;  4ANW A;  2JUO A;  4BVU C;  3ZNI D;  4GXB A;  2KQ7 A;  2LGX A;  1ISN A;  2MQJ A;  2KZR A;  2NR2 A;  2MP2 A;  3DDC B;  1TBE A;  1WMH A;  2ZNV C;  3ML8 A;  1EF5 A;  3N3K B;  4NQK E;  2K6Q A;  4ZRI A;  5C23 A;  3R7R A;  4HLE A;  2KC2 A;  2MBB B;  1XT9 B;  3PRZ A;  4I6L B;  3VHT C;  1WIA A;  4JGH B;  2LRU A;  3A4S C;  3VXW A;  3HK0 A;  3PHW B;  1E8Y A;  3UGB B;  4EZK A;  3M62 B;  1WE6 A;  3RUL A;  1L2N A;  3W1Y A;  2VRR B;  5D2M B;  4W9L A;  4ICU A;  4NJ6 A;  1VCB A;  1GC7 A;  1V5O A;  1X1M A;  2ZVN A;  1JRU A;  3NZU A;  3PV1 A;  3RT3 B;  4ANV A;  4E74 A;  3RYT A;  2KQS A;  2V1Y A;  4PS7 A;  3IBE A;  2MP2 B;  4CHK A;  3DVG Y;  4ANU A;  2J0J A;  4MJS A;  2JF5 A;  1MG8 A;  1E90 A;  1U4A A;  1KM7 A;  1NI2 A;  1A5R A;  3A9J A;  3APC A;  1LFD A;  4K7W A;  4HJK A;  2KKC A;  4G11 A;  1WJU A;  2FIF A;  2JY6 A;  3A33 B;  4EZL A;  4AOF A;  4WWN A;  3T9L A;  5DPW A;  2R2O A;  3DVN V;  2ZEQ A;  2M0X A;  4IW0 A;  3ZW3 A;  3QJZ A;  4MEM A;  1WX9 A;  1GG3 A;  2KD0 A;  2G4D B;  2LI5 A;  2BKF A;  3WAP A;  4MH0 E;  3D32 A;  3EFU A;  3PSE B;  4RMA A;  4BKS D;  3DCG A;  2JT4 B;  4IG7 B;  4MJS B;  3I3T B;  2FUH B;  3LDZ E;  2OJR A;  4BKS A;  3TMP B;  1E7U A;  5LXI B;  4AJW A;  2ZCC A;  1UBQ A;  1Y8R C;  2L0T A;  3A9J B;  3Q3F A;  4GDL A;  5GMV A;  3S2A A;  2HTH A;  4K7S A;  4IWP A;  3EC8 A;  3VTW A;  4G3X B;  3ECI A;  2FNJ B;  2K6D B;  1OTR B;  4E3C A;  4EEW A;  4AWJ A;  4B95 A;  3QA8 A;  3EEC A;  1IP9 A;  1D3Z A;  3SHQ A;  2IBI B;  1WGY A;  3TCA A;  4BBN F;  2N7D A;  3UIP B;  2M1M A;  4WJP A;  1EO6 A;  3N30 A;  2KN5 A;  2ZZP B;  2IZV B;  2N1W A;  2KHW B;  3WIM A;  2PJH A;  2IO0 B;  1V2Y A;  2EMS A;  3VUY A;  1UD7 A;  4GDL B;  3QCA A;  4PS8 A;  5L95 C;  4NJ7 A;  2KFJ A;  1P3Q U;  4GB9 A;  2D11 A;  4CO7 A;  4GOC A;  3SD5 A;  3WAL A;  4M0W B;  3QQ8 B;  3V61 A;  3PLV A;  4MGK E;  1E8W A;  3M95 A;  2KC1 A;  1WM3 A;  3PRE A;  4II3 B;  3IFW B;  4WWP A;  2V3S A;  1I35 A;  2I1J A;  4NAW A;  4GDK A;  3M3J A;  1SIF A;  5D94 A;  2KWU B;  3ZRC A;  3C0R B;  4W9G A;  4LDT D;  2JZ3 B;  2KTR A;  4IC7 B;  1WY8 A;  1VD2 A;  2BF8 B;  2C7H A;  4GIV A;  1UZX B;  3RD2 A;  4M8N A;  2KWV B;  3PRM B;  3HIZ A;  1EF1 A;  1J8C A;  2YVC A;  3PLU A;  4IM0 A;  5CX3 A;  1I42 A;  2BYV E;  1GNU A;  2LVP A;  2CU1 A;  4DDI D;  2ZVO A;  1WF9 A;  2KAN A;  1GUA B;  2M4N A;  1SE9 A;  3H7S A;  3SDL C;  3L54 A;  2N9E B;  3DBL I;  2KX3 A;  2WX1 A;  3A1Q A;  4DXA B;  2DAF A;  2G4S A;  2IYD B;  4LCD E;  3ONS A;  1E7V A;  3VTU A;  4TUU A;  1S1Q B;  2LUE A;  1WZ3 A;  3L10 B;  4GDK B;  2M8S A;  2KTR B;  3CF6 E;  3NS8 A;  4XC2 A;  2MCN B;  2K8B A;  5G55 A;  4LDT B;  1G6J A;  3UF8 A;  3U8Z A;  2L76 A;  3B0A A;  3QX1 A;  2JRH A;  5D6J B;  2L00 B;  5G2N A;  3QC8 B;  1V49 A;  1V5T A;  1WXA A;  4NQL B;  3ZTD A;  3MTN B;  2BGF A;  4WJO A;  3A1Q B;  2D3G A;  4GN1 A;  2DAJ A;  1P9D U;  4IUM B;  4FJY A;  2MRP A;  2KOX A;  2CS4 A;  4FN2 A;  4ZRK A;  3ZTC A;  3ZRF A;  5KHQ A;  2DZM A;  3RCZ A;  3W1S A;  4DHZ B;  4FAD A;  2K25 A;  3WAM A;  1V6E A;  1K8R B;  4PYZ A;  3IVF A;  3KYD D;  1YX6 B;  4ASW C;  2BWF A;  3U30 A;  3A4R A;  2KVR A;  3WAN A;  1E5W A;  4RM8 A;  4DHJ D;  5J2R A;  3OJ4 B;  5DPT A;  2DYO A;  5CTR C;  4LJO B;  2CKH B;  4IWQ A;  3R7Q A;  1YQB A;  4WJQ A;  4EOY A;  3V62 A;  2AWT A;  4EZJ A;  4NPN A;  1EUV B;  2LWP A;  3NZS A;  3WA0 A;  2DZI A;  4KDI C;  5JZE B;  4URK A;  1R4M I;  4HPL B;  3JYU A;  2A5U A;  1CMX B;  4ICV A;  2LAS A;  3CMM B;  2IY0 B;  4FA6 A;  3AI5 A;  2BKR B;  3VUW A;  1WX8 A;  4G50 A;  2MBH A;  2I1K A;  3H1U A;  2FCQ A;  3ZKJ C;  3ZNG C;  4EKU A;  2LXC A;  1GJZ A;  1Q0W B;  1J19 A;  2DZJ A;  3B08 A;  4FHJ A;  3R3M A;  2O6V D;  5JHB A;  1NDD A;  4W9E A;  4W9I A;  2DX5 B;  2BPS A;  3TL5 A;  5E6O A;  4DHJ B;  1TTN A;  2GBM A;  4II2 B;  3MJW A;  1FXT B;  1V86 A;  4GU2 A;  2LGD A;  5DCN A;  3W1S C;  4EUT A;  4TQ0 A;  1C3T A;  3RZF A;  2KFK A;  4FUL A;  4W9F A;  2OOB B;  2J0M A;  3BY4 B;  3OLM D;  1Z5S B;  2DHZ A;  2KMC A;  1OEY J;  1WXV A;  4K7U A;  4MDK E;  5L83 A;  5AEK B;  2AL6 A;  3QHT A;  4FJV B;  2EKE C;  4ANX A;  5JHA A;  3DOW A;  1UH6 A;  2KDB A;  3QIJ A;  4IWO A;  3IHP C;  4MSQ B;  4KV2 A;  1WFY A;  2GMI C;  2GOW A;  2O6V B;  1Q1O A;  3RUI B;  2RD0 A;  2AYO B;  2IO2 B;  1OGW A;  2C7M B;  3NY5 A;  4DBG A;  3H6N A;  1C1Y B;  2CHX A;  3KUC B;  4MGZ E;  4W9D A;  4HDO A;  2KJH B;  2N1V A;  2KFK B;  3GOE A;  4HXD A;  2B3A A;  4MM3 A;  1J0G A;  3N32 A;  4MGY E;  2R2Q A;  2N4F A;  1LM8 B;  3PVL A;  2PEA A;  2NBV B;  2AEH A;  4DDG D;  1WGD A;  2KDE B;  2LD9 A;  1M94 A;  4KVG B;  2WYQ A;  1LQB A;  1KOT A;  3DBS A;  2PE9 A;  4F8C B;  3B1L X;  4A3O A;  2KLG A;  3JSV B;  4BOS C;  2O2V A;  3VVW B;  2XK5 A;  2KNB A;  2MBE A;  1IPG A;  1XD3 B;  3APF A;  2WX0 A;  3A9K A;  1E8X A;  3H7P A;  2RSU A;  4I6N B;  3PZD A;  5D7G A;  3KUD B;  2FID A;  4M8M A;  4OVV A;  2Y5B B;  2UWQ A;  4DHZ E;  2M17 A;  4GMV A;  4KSL C;  2HD5 B;  1WJ6 A;  4N9F 4;  2KO3 A;  2HJ8 A;  2WWZ A;  3HHM A;  1YX5 B;  3MHS D;  2C60 A;  1ZW7 A;  3V60 A;  4B9K A;  3VAW A;  3VFK A;  3KH0 A;  3AXC A;  4HCP B;  4JLC A;  2LVQ A;  1RLF A;  3EHV A;  3VDZ A;  4LJP B;  3IG3 A;  4HVB A;  2KTF A;  1OQY A;  3ALB A;  3M63 B;  4E71 A;  4KZ0 A;  2WDT B;  1V81 A;  4W9C A;  4KDL B;  3PRP B;  2O2V B;  3VTV A;  2XK5 B;  1WRD B;  4B6W A;  1GC6 A;  2KMA A;  1RRB A;  2KJR A;  3VH3 B;  2N9X A;  3A9K B;  2ZNV B;  4GSW A;  3H9D A;  3H7P B;  2FCN A;  1WGH A;  2Z0D B;  4W9K A;  2ASQ A;  3PT2 B;  4FLH A;  2L7R A;  4IM2 A;  3L08 A;  2JRI B;  3PTF C;  2CHW A;  5LLI A;  4IM3 A;  2REX A;  3K9O B;  4WJN A;  3SU8 X;  3LJ3 A;  2LGY A;  1WYW B;  2KJ6 A;  1P1A A;  1S3S G;  1WXM A;  3QAR A;  1ZKH A;  2MBQ A;  3UIO B;  4EFO A;  2NPT A;  3JVZ X;  4K81 A;  4BKG A;  4BFR A;  1AAR A;  2MBO A;  3DVG X;  4KIK B;  1BT0 A;  2BWE S;  4F7Z A;  3DQV A;  1IYF A;  1L7Y A;  4JIO U;  4WQO B;  3L16 A;  1WGG A;  3PPA A;  2C5L C;  3QAQ A;  2LJ5 A;  4F1S A;  2D10 A;  2MW5 A;  4PYU A;  3WAO A;  3RZW C;  2JPH A;  2IY1 B;  4OVU A;  1HE8 A;  4J6I A;  5DPS A;  3ZNZ B;  2A4Z A;  3APD A;  1WE7 A;  4BOZ B;  2G45 B;  3ZO5 B;  4HWI B;  2LXA A;  2C7N B;  3ZIM A;  2NPT B;  3HM6 X;  1V9J A;  3ZDT A; 
#chains in the Genus database with same CATH topology
 5E6P A;  1WMH B;  1WI0 A;  4P7I A;  2DZK A;  2KWD A;  3TBL D;  4X57 B;  4DXF A;  2K8H A;  3BK2 A;  2V4L A;  2JZZ A;  4ZRQ A;  3CSF A;  1KJT A;  2BQQ A;  3AB5 A;  3AU5 A;  3NRZ A;  3BIN A;  3C8Y A;  3DBH I;  1D4B A;  1SJE D;  4JQW C;  1R4N B;  1YIW A;  2D07 B;  3MFG A;  2UYZ B;  3JSV A;  1KLV A;  4KZC A;  2JQR B;  2J42 A;  2LZ6 A;  3NHE B;  2NCN A;  4OZA A;  4AP4 C;  2L8J A;  5E6N A;  4TV3 A;  1F77 A;  2Z0E B;  3L4P A;  3OJ3 A;  2JWZ A;  1ZE3 D;  4JWS C;  2IO1 B;  1F52 A;  4KSK C;  2QEJ C;  3AEC B;  2G3Q B;  2IGD A;  2ACZ B;  2MA9 B;  2KDI A;  1J7B A;  2QHO A;  4W9H A;  3UQA A;  5CHF A;  2FAZ A;  1SSN A;  1YN3 A;  2KWC A;  2JU6 X;  5C1Z A;  3DBR I;  3KUZ A;  1WJN A;  3ZJU A;  2K8C A;  3ENE A;  3U7D A;  4A90 A;  4ARC A;  1FCC C;  1PFD A;  1Q5W B;  2BYE A;  4OVZ A;  4YL8 A;  3L13 A;  1UF0 A;  4XWT A;  2GBR A;  2CHZ A;  4I6P A;  3K9P B;  2IDY A;  2KXJ A;  4C80 A;  5LXH A;  5LNK 1;  4BVU C;  2KQ7 A;  2MQJ A;  2KZR A;  2NR2 A;  2MP2 A;  3DDC B;  3ZXV A;  1WMH A;  4YXD B;  4RF0 A;  2K6Q A;  5C23 A;  4HLE A;  4XDD A;  3MP9 A;  2LEK A;  1XT9 B;  1E10 A;  1FM0 D;  4UDU C;  3PHW B;  1RWS A;  3UGB B;  3M62 B;  3RUL A;  1L2N A;  5IP4 D;  2VRR B;  1DOX A;  4IOI E;  4ANV A;  4E74 A;  2XNA C;  1VDV A;  2V1Y A;  4CHK A;  4ANU A;  4MJS A;  1UGJ A;  1U4A A;  2FBW B;  3APC A;  3TSS A;  3NVW A;  4S0R A;  2FIF A;  4AOF A;  3NZ3 A;  4IW0 A;  1YQ4 B;  1N5W A;  1C76 A;  3ZW3 A;  1WX9 A;  5FK9 C;  1FXA A;  3PSE B;  1F1H A;  3SFD B;  2M19 A;  2PVO D;  2FUH B;  1XO3 A;  3AE9 B;  3Q3F A;  2HTH A;  3IXS A;  4K7S A;  1HQR D;  3FIL A;  4HJG E;  4OW0 A;  4QAY A;  4EEW A;  4AWJ A;  1F0Z A;  3RN9 C;  3EEC A;  3BWU D;  5BMG A;  1XCT L;  3UIP B;  2M1M A;  2PLP A;  3N1X C;  1NEN B;  2IZV B;  1WXQ A;  1D6E C;  2EMS A;  4ZHP A;  3QCA A;  4NJ7 A;  2KFJ A;  1P3Q U;  4GB9 A;  3WAL A;  1I4P A;  1OFF A;  4A55 A;  1E8W A;  1SEB D;  4TSS A;  3IFW B;  1I35 A;  1PGX A;  2KTR A;  4IC7 B;  1VD2 A;  2BF8 B;  1DGJ A;  3RD2 A;  1UZX B;  4M8N A;  2KWV B;  3HIZ A;  1I42 A;  2YVC A;  3PLU A;  4IM0 A;  5CX3 A;  5GXG B;  4LTU A;  2N9E B;  2WX1 A;  2DAF A;  2G4S A;  2IYD B;  2V3N A;  3ONS A;  4TUU A;  3NJT A;  2LUE A;  1FEH A;  5IKC M;  1UUP A;  2BS2 B;  1L4Z B;  3NS8 A;  1ZUD 2;  3Q3N C;  4LDT B;  3UF8 A;  4PK1 A;  5D6J B;  5G2N A;  1V49 A;  1MHX A;  1JRO A;  3A1Q B;  4GN1 A;  3HVZ A;  2DAJ A;  4IUM B;  2WU5 B;  3RI7 C;  2MRP A;  4FN2 A;  2FE8 A;  2ON8 A;  2N9L A;  3ZRF A;  2DZM A;  2K9X A;  3RCZ A;  5KHQ A;  1XLQ A;  1K8R B;  4H2A A;  3A4R A;  3WAN A;  1FD6 A;  5J2R A;  3DBH B;  2M56 B;  1T0R C;  3V62 A;  2AWT A;  4EZJ A;  1WRI A;  3DHG C;  1R4M I;  3JYU A;  5D3I B;  2LAS A;  2LGS A;  1TY2 A;  4ZOH C;  3AED B;  3IAS 1;  3VUW A;  4G50 A;  2DNF A;  2I1K A;  4EKU A;  2VH1 A;  1ZXH A;  3ZGZ A;  3R3M A;  2O6V D;  2QSD A;  2WNM A;  4W9E A;  1L4D B;  1AWD A;  3TL5 A;  4DHJ B;  2GBM A;  2PMV A;  2X8X X;  5EE3 A;  1C3T A;  2BT6 A;  1OEY J;  3Q6B A;  1V1P A;  4K7U A;  5AEK B;  2AL6 A;  2EKE C;  3DOW A;  2SEB D;  2LJI A;  4MSQ B;  4AS1 A;  3DBR B;  3RNF C;  3RUI B;  2RD0 A;  3U7Z A;  3MJ5 A;  2C7M B;  2CHX A;  4MGZ E;  1ET6 A;  1CZP A;  2KFK B;  1NEK B;  4MGY E;  2R2Q A;  2NBV B;  2PKO A;  1LGR A;  4KVG B;  3VR8 B;  1XLO A;  3DBS A;  3B1L X;  2KLG A;  4BOS C;  2O2V A;  2XK5 A;  2W3R A;  4KGR A;  3H7P A;  5D7G A;  1SXT A;  3KUD B;  1IUE A;  2Y5B B;  2UWQ A;  3LXF A;  4KSL C;  1WJ6 A;  3MHS D;  2W82 A;  3VAW A;  3VFK A;  4HCP B;  1KRH A;  3VDZ A;  3IG3 A;  4HVB A;  1FRR A;  1OQY A;  3RNE C;  4DXG A;  4KDL B;  4B6W A;  4NJC A;  1RRB A;  2KJR A;  3A9K B;  1QLB B;  2FCN A;  5G5H A;  4BZA A;  2Z0D B;  4W9K A;  2RDG A;  3PT2 B;  3VRB B;  1SE2 A;  1PGA A;  3PTF C;  1CJE A;  1C9F A;  3RMK C;  1TKE A;  2KJ6 A;  1P1A A;  2DWQ A;  2NPT A;  3JVZ X;  2WXN A;  3DHH C;  3AE6 B;  2DLB A;  2WXI A;  3DQV A;  1EU3 A;  5FKA C;  4JIO U;  1XCQ L;  2MW5 A;  3WAO A;  3RZW C;  1B9R A;  1TS5 A;  3ZNZ B;  2LXA A;  1N5X A;  3ZIM A;  3ZDT A;  1AW7 A;  5AZH A;  2MSE D;  3Q3M C;  1TZ1 A;  4DQO C;  2K22 A;  2M0A A;  1XQQ A;  5HKH A;  1I4H A;  3V6C B;  2KVZ A;  2ZPN A;  2AQ3 B;  1NBF C;  5AZG A;  1TIF A;  5IO9 A;  2MWS B;  2FCS A;  2KLC A;  4TQ1 A;  1P98 A;  4FHK A;  3RPF C;  2W55 A;  4CYE A;  3TEX A;  4G0N B;  3WCQ A;  2NTT A;  3ZUN A;  2N0S B;  4HPP A;  1KFY B;  2MLB A;  3AEA B;  4A8X C;  3VUX A;  1N63 A;  1AN8 A;  3DVN U;  2WXQ A;  4BKT A;  2J7Q B;  2L83 A;  4HCN B;  1ZGU B;  4ZDV A;  1TS4 A;  4WAA A;  4PS3 A;  2ZPY A;  3CST A;  2WDV B;  3EFC A;  4XYC A;  4XZ4 A;  1WM2 A;  3R66 C;  2N9K A;  1WGK A;  4ZRJ A;  3L0W B;  2H89 B;  3GE8 C;  3VH4 B;  1L0V B;  2XEW A;  2YLM A;  4LNK A;  2BS4 B;  4TKN A;  3PS6 A;  2EEL A;  2CR5 A;  1PQS A;  1V97 A;  2PE6 B;  5I4D A;  1T3Q A;  1YOV B;  2W9N A;  4WUR A;  1DYQ A;  1H8C A;  5CHW A;  1EWC A;  5EE0 A;  2ZCB A;  2IO3 B;  1VZ7 A;  3TJP A;  1JML A;  2JX5 A;  2WXO A;  4DWF A;  4ZYN A;  1VZ6 A;  3O65 B;  3PGE A;  2LUM A;  1H4R A;  4A20 A;  1E7P B;  5BMH A;  1F9J A;  3UIN B;  1TJE A;  1WZ0 A;  4NAW B;  1QQR A;  2MX2 A;  1QZE A;  1RYJ A;  2NVU I;  3ZNH B;  4ANW A;  2LGX A;  4KKJ A;  4C7Z A;  1T0Q C;  1MJD A;  2JXT A;  4WIP A;  1R4M B;  1D5M C;  1STE A;  3URY A;  1XLN A;  4N6E B;  3VHT C;  1BUI C;  4YT0 B;  5H8Y E;  3A4S C;  3VXW A;  3HK0 A;  1WE6 A;  3SR6 A;  2JZP A;  4W9L A;  4ICU A;  4NJ6 A;  5H92 C;  1GC7 A;  1X1M A;  4RCO A;  2I38 A;  2OHF A;  1YN4 A;  2KQS A;  3RYT A;  3IBE A;  2MP2 B;  2DBY A;  4KGT A;  2QJL A;  2BB6 A;  3A9J A;  4ZYS A;  4K7W A;  4HJK A;  2KKC A;  3Q8B A;  1CQV A;  1EWY C;  1WJU A;  4EZL A;  3BVG A;  4WWN A;  2M0X A;  1MFW A;  2LI5 A;  2BKF A;  3P4R B;  4JWU C;  4MH0 E;  4BKS D;  3DCG A;  2JT4 B;  4MJS B;  3I3T B;  2QDF A;  3I63 C;  5T8I A;  3FKY A;  3TMP B;  1XXG A;  4AJW A;  1A70 A;  1Y8R C;  3KWL A;  5GMV A;  5IOI A;  1MHH E;  4LLG M;  1SBB B;  3EC8 A;  2KDM A;  1I4G A;  4ARI A;  4B95 A;  4O1N A;  2MJ3 A;  3TCA A;  4BBN F;  2N7D A;  1C4C A;  4WJP A;  2ZZP B;  2KHW B;  4P6V F;  3WIM A;  3VUY A;  1QOG A;  4LK0 M;  3BYY B;  4M0W B;  3FIL B;  3QQ8 B;  4L2Y A;  3V61 A;  4WWM A;  2LMC A;  5HG2 A;  1WM3 A;  4II3 B;  4WAF A;  3DWG C;  2V3S A;  2I1J A;  4NAW A;  2KYW A;  2KWU B;  3B9J A;  3ZRC A;  4W9G A;  1FRD A;  2C7H A;  2UU7 A;  3ZJT A;  2VZK B;  2JYT A;  3NUH B;  3AE5 B;  2BYV E;  1D5Z C;  2JWU A;  1WF9 A;  1FNU A;  1GUA B;  3SDL C;  3L54 A;  2BB5 A;  4DXA B;  4C56 C;  1R7S A;  3O13 A;  4LCD E;  4LNO A;  3VTU A;  1E7V A;  3AH7 A;  2RPV A;  5FR3 A;  2CU3 A;  3L10 B;  2M8S A;  2KTR B;  4HRS A;  1MPE A;  2WXL A;  3CF6 E;  2MCN B;  2Z8L A;  5G55 A;  1HZ6 A;  3B0A A;  1JWU D;  2L00 B;  3AEG B;  1TT5 B;  1V5T A;  2L1A A;  1WXA A;  3MTN B;  1E9M A;  2BGF A;  1FFV A;  3I5J C;  4WJO A;  2WGS A;  1D5X C;  2KOX A;  1IBX B;  3ZTC A;  1VZ8 A;  1ZDX A;  4L23 A;  1N61 A;  4DHZ B;  3WAM A;  1V6E A;  1I4Q A;  4YSZ B;  1ET9 A;  1KLG D;  1IGC A;  2KVR A;  1E5W A;  4RM8 A;  1ROE A;  5DPT A;  2DYO A;  4IWQ A;  1YQB A;  4WJQ A;  2B76 B;  4EOY A;  4ZRP A;  2AQ1 B;  4KX6 B;  5JZE B;  2DZI A;  1WWT A;  2ICI A;  2IY0 B;  4FA6 A;  2HTM E;  2MBH A;  3ZNG C;  2WXR A;  2LXC A;  4KGS A;  2DZJ A;  3B08 A;  2DX5 B;  3MJW A;  3EGR A;  4JE3 B;  1FXT B;  1V86 A;  4M0W A;  4TQ0 A;  2HDE A;  2NTS A;  1FNW A;  3RFZ B;  2DHZ A;  2KMC A;  2QIL A;  1WXV A;  4RGO S;  5L83 A;  1FCL A;  4RH6 A;  3VRA B;  5JHA A;  2GLS A;  1F2R I;  3QIJ A;  4OZC A;  4IWO A;  1KTK A;  2G1E A;  2GOW A;  1Q1O A;  3NS1 A;  1OGW A;  3NY5 A;  2IND C;  4HDO A;  1ZPS A;  2KJH B;  2WHI A;  1J0G A;  3B2F A;  4DDG D;  2KDE B;  1C4A A;  2LD9 A;  1V1P B;  2PTL A;  1KOT A;  1MG4 A;  2PE9 A;  4F8C B;  3P4P B;  2KNB A;  1TKY A;  2MBE A;  1K50 A;  2RSU A;  4KKI A;  3PZD A;  3FAH A;  2BVC A;  1YNT E;  2HJ8 A;  1YX5 B;  1ZW7 A;  1WYG A;  1GB4 A;  4B9K A;  1IBX A;  2WXM A;  2LVQ A;  1P7E A;  4JX1 C;  1RLF A;  3EHV A;  4ZHO A;  4US9 A;  3M63 B;  4E71 A;  2WDT B;  2O2V B;  2XK5 B;  1WRD B;  2BW2 A;  3CIR B;  2ZNV B;  1YJI A;  3H9D A;  3H7P B;  2D3B A;  3GE3 C;  3BK1 A;  3J9C A;  2ASQ A;  4FLH A;  4IM2 A;  2L7R A;  3GB1 A;  3KQ4 A;  5LLI A;  2REX A;  4WJN A;  3IT6 B;  3MC0 B;  1WYW B;  1S3S G;  3P1M A;  1WXM A;  2K0P A;  4EFO A;  4BKG A;  2KAC A;  2MBO A;  2BYT A;  1ESF A;  4KIK B;  1BT0 A;  2BWE S;  1ZP0 B;  1KH0 A;  4F7Z A;  1J7C A;  5AUI A;  1IYF A;  2BS3 B;  3PPA A;  2C5L C;  2IY1 B;  1ENF A;  4BOZ B;  2G45 B;  1TS2 A;  3VR9 B;  2C7N B;  2NPT B;  3R2I A;  3AM9 A;  2WDQ B;  3IAM 1;  3Q3J A;  5BYS A;  2BYF A;  1P0R A;  1WJ4 A;  2GBN A;  4DK5 A;  2WXJ A;  5JH5 C;  4J3O D;  2D3C A;  1MVK A;  5E6J A;  3DPD A;  2K1F A;  1N60 A;  1QIL A;  5BO4 B;  3UQB A;  3QWZ B;  3V6E B;  2C9W B;  1WXS A;  2E3T A;  2DYM A;  2Z59 B;  3AUL A;  2LFI A;  1UBI A;  1T0Y A;  3HRD D;  3N20 C;  3L17 A;  4FJZ A;  2NBU A;  3I9V 1;  1L0X B;  4MAC A;  2RGF A;  3LYY A;  2INC C;  4PT5 A;  1RFA A;  1I4X A;  1KLU D;  1LXD A;  1SE4 A;  4K3B A;  3U52 E;  2KK8 A;  1VR9 A;  1C77 A;  2BBC A;  4YTN B;  3ABV B;  3X23 A;  3TIX A;  1NYQ A;  4W9J A;  2L05 A;  1E8Z A;  1MI0 A;  1WGR A;  2PPH A;  2GBK A;  5TR5 A;  4NNJ B;  4RGM A;  5IA7 A;  1HXY D;  2GBJ A;  3ZLZ A;  1K53 A;  2J0K A;  2PIA A;  2Y5C A;  1R4N I;  3KW5 B;  1YD8 U;  1UGM A;  2IGG A;  2XBB C;  1Z2M A;  2NMQ A;  2WXP A;  1FPY A;  2JVC A;  2FCM A;  2K39 A;  2RR9 A;  1SGH A;  1TY0 A;  2KQ4 X;  1EU4 A;  4KIK A;  2KX0 A;  2L0F A;  3KYC D;  1QOA A;  2MH7 A;  3GZN I;  3OAW A;  3BVZ A;  3IT4 B;  3JW0 X;  1WR1 A;  1PGB A;  4BBN C;  1JWS D;  3C19 A;  4MH8 A;  3V05 A;  3OG5 A;  1YJ1 A;  1V80 A;  3SFE B;  5DPR A;  4FBJ B;  3ML9 A;  3ZDM C;  4XX5 A;  3P42 A;  3OWE B;  3ZJV A;  1ISN A;  1TBE A;  2H88 B;  2ZNV C;  3N3K B;  4NQK E;  3TEY A;  2JYE A;  3R7R A;  2MJE A;  2MBB B;  1WIA A;  4WQM A;  4YSX B;  1E8Y A;  3W1Y A;  4A9A A;  1V5O A;  2ZVN A;  3NZU A;  3PV1 A;  3DVG Y;  4M01 A;  3B2G A;  3T3O A;  1L6V A;  2JF5 A;  1MG8 A;  5C2T B;  1A5R A;  2V9H A;  1LFD A;  1VRA B;  4US8 A;  1HEZ E;  3AE7 B;  2QC8 A;  2JY6 A;  3UI3 A;  1NI3 A;  4M02 A;  5DPW A;  3DVN V;  4HKZ E;  1ZXI A;  3QJZ A;  4MEM A;  4P1C C;  3WAP A;  3DHI C;  3D32 A;  2WXG A;  3E9S A;  3EFU A;  4RMA A;  1VLB A;  3LDZ E;  2OJR A;  4BKS A;  5LXI B;  2ZCC A;  1UBQ A;  2PW9 A;  2L0T A;  3A9J B;  4GDL A;  3S2A A;  3RNA C;  3TEZ A;  3VTW A;  4G3X B;  2K6D B;  4HKQ A;  1OTR B;  3BYT B;  3HVD A;  2IBI B;  1WGY A;  3LB8 C;  2N1W A;  4YWG G;  2IO0 B;  1V2Y A;  1UD7 A;  1UWM A;  3V3X A;  2D11 A;  4CO7 A;  4GOC A;  2LHE A;  4MGK E;  3M95 A;  4WWP A;  1CK1 A;  1SIJ A;  4GDK A;  2AX5 A;  2E6X A;  1SIF A;  3H8H A;  4LDT D;  4GIV A;  4RGN A;  3PRM B;  2YEP F;  1GPX A;  1EF1 A;  2LVP A;  1GNU A;  2CU1 A;  4L1B A;  4DDI D;  2KAN A;  3DBL I;  2KX3 A;  1VJK A;  4RF1 A;  2GRI A;  1WZ3 A;  1TS3 A;  3MC8 A;  1I7H A;  1SF0 A;  2W3S A;  3BVM A;  3TEW A;  1G6J A;  3CWI A;  3U8Z A;  2L76 A;  2GI9 A;  3QX1 A;  2JRH A;  1TKG A;  1KF6 B;  4NQL B;  3ZTD A;  1XLP A;  1EM7 A;  2LGI A;  2OED A;  4HEA 1;  4FJY A;  2CS4 A;  3W5U B;  4B0M A;  3ZXR A;  1QF6 A;  1E6E B;  1JW9 D;  3W1S A;  1FFU A;  2SAK A;  4FAD A;  2K25 A;  4PYZ A;  4XDC A;  5JXV A;  3IVF A;  2AQ2 B;  3KYD D;  1YX6 B;  4USA A;  2BWF A;  2D5G A;  3U30 A;  2I2Y A;  4DHJ D;  3OJ4 B;  3R2T A;  4D2K A;  2J4X A;  1EUV B;  3NZS A;  4FXC A;  1K51 A;  4URK A;  2WXF A;  4HPL B;  2BKR B;  3H1U A;  2FCQ A;  1GJZ A;  1J19 A;  1PYW D;  1L6U A;  4BAX A;  1XEE A;  2BPS A;  5E6O A;  1F2R C;  1TTN A;  1YN5 A;  5DCN A;  3W1S C;  3ZQ4 A;  4EUT A;  3RZF A;  4FUL A;  2OOB B;  2J0M A;  3BY4 B;  3OLM D;  3KWV A;  3AE2 B;  3P63 A;  4P16 A;  4MDK E;  2CJO A;  4FJV B;  4EE2 A;  1FMA D;  2TSS A;  2KDB A;  3IHP C;  4KV2 A;  2O6V B;  1BXT A;  1J7A A;  2IO2 B;  4DBG A;  3H6N A;  1C1Y B;  4W9D A;  1ZDV A;  1Q10 A;  2N1V A;  4MM3 A;  5HHD G;  3GZN B;  1HZ5 A;  2N4F A;  3PVL A;  2PEA A;  1WGD A;  1M94 A;  2V4I B;  2WYQ A;  3RNC C;  1GOZ A;  3AV8 A;  1IPG A;  1XD3 B;  3APF A;  2WX0 A;  4B0E A;  1E8X A;  1QOB A;  4M8M A;  2M17 A;  4GMV A;  2HD5 B;  2KO3 A;  2WWZ A;  3V60 A;  1IGD A;  3AXC A;  2WS3 B;  2IJ0 A;  3ALB A;  3AN1 A;  3VTV A;  4IDI A;  3DWM A;  1GC6 A;  3AE8 B;  4GSW A;  1TYG B;  1M4V A;  4C7Y A;  1WGH A;  2CJN A;  2ZW1 A;  3L08 A;  4C4V A;  3ETR A;  4M00 A;  3ZYY X;  3K9O B;  3SU8 X;  2LGY A;  2YEP B;  2MBQ A;  3UIO B;  1T6B X;  2V0G A;  4BFR A;  1AAR A;  1DOY A;  5BYQ A;  1RFK A;  2BTE A;  3NVZ A;  1L7Y A;  3U4E G;  1C78 A;  3L16 A;  2LJ5 A;  2D10 A;  2PVG C;  5MPO A;  1V8C A;  4Q2J A;  4OZB A;  4J6I A;  2A4Z A;  3APD A;  1WE7 A;  3ZO5 B;  4S17 A;  4XE0 A;  3HM6 X;  4NZL B;  1UWX A;  2KT7 A;  3QK0 A;  2W54 A;  1DOI A;  2JSV X;  2N7E A;  1WSP A;  2D2Q A;  4AUQ C;  1WX7 A;  5AZF A;  1P7F A;  2O6V A;  1YMH E;  1T0S C;  4RM9 A;  1SE3 A;  1BML C;  4HDQ A;  2RPQ A;  2KDF B;  2EMT A;  3NOB A;  1RAX A;  4P1B C;  3Q8A A;  2RMM A;  1ACC A;  5EDS A;  4HK2 A;  5CHV C;  5J17 A;  3PHX B;  3T8M A;  2LVO A;  2J53 A;  1GB1 A;  1JAL A;  1OQR A;  2N9P C;  4A3P A;  5D3D A;  4JL9 A;  1WH3 A;  1UNS A;  4HPM B;  4IKG A;  1UEL A;  1SB3 C;  3KVF B;  3VQI A;  3DBL B;  2RDH A;  1FIQ A;  3ZVV A;  2FUG 1;  2K3U A;  5HFY A;  4ITK A;  4K1R B;  3SEB A;  2WXK A;  2DYB A;  2JXX A;  2NBW B;  3HM3 A;  3P2B A;  2LRW A;  1B1Z A;  5IAA C;  2QIE B;  2RDB C;  5KHO A;  5HI1 A;  1SJH D;  4MSM B;  3FC4 A;  1WR6 E;  2G9H D;  4WWO A;  2NS5 A;  3AU4 A;  2AL3 A;  2HE7 A;  5G5G A;  3NVV A;  4MGI E;  3X0W A;  2X38 A;  2L3Z A;  1TGZ B;  4AJY B;  5FR6 A;  2ZJD A;  5J18 A;  4NY0 A;  4LNI A;  5EE1 A;  4A6Q A;  4GGQ A;  3Q69 A;  3W5V B;  3AEE B;  1OEY A;  4MEL A;  2DEN B;  2JUO A;  3ZNI D;  4GXB A;  4N59 A;  3Q2A C;  3N1Y C;  3ML8 A;  1EF5 A;  4ZRI A;  2KC2 A;  3PRZ A;  2L32 A;  4I6L B;  4JGH B;  4N58 A;  2LRU A;  1Y56 A;  2VH2 A;  4EZK A;  4YTP B;  2MHJ A;  1ZOY B;  5D2M B;  4NAM A;  5BYR A;  3W9C B;  1VCB A;  1N6Z A;  2OJW A;  3RT3 B;  1JRU A;  1FXI A;  4PS7 A;  1C79 A;  2J0J A;  1E90 A;  1KM7 A;  1NI2 A;  4RNA A;  3EUB 2;  4G11 A;  1HTO A;  3A33 B;  1NVI D;  3T9L A;  2R2O A;  2ZEQ A;  2KMM A;  3NVY A;  1GG3 A;  2KD0 A;  2G4D B;  2WXH A;  4HRO A;  4IG7 B;  1N62 A;  1E7U A;  4LNN A;  1RM6 C;  4C00 A;  3BZD B;  3EA6 A;  1K52 A;  4IWP A;  3RNB C;  3N9Y C;  3GP7 A;  3ECI A;  2FNJ B;  4E3C A;  3QA8 A;  1IP9 A;  1D3Z A;  3I57 A;  3SHQ A;  2INN E;  2VZK D;  4XGA B;  1EO6 A;  2WLB A;  2KN5 A;  3N30 A;  3RNG C;  2PJH A;  4GDL B;  4PS8 A;  5L95 C;  3SD5 A;  4WH4 A;  3U2S C;  1QOF A;  2ONQ A;  2XN9 C;  3PLV A;  3AEB B;  2KC1 A;  2Y5P A;  4K3C A;  3W2D A;  3PRE A;  2D3A A;  3M3J A;  5D94 A;  3C0R B;  2JZ3 B;  1WY8 A;  2WP9 B;  3PO0 A;  1J8C A;  2IPK D;  4RGT A;  1QT9 A;  2ZVO A;  2M4N A;  1SE9 A;  3H7S A;  3A1Q A;  1S1Q B;  1NYR A;  3Q8E A;  4GDK B;  2INP E;  3P4S B;  1HA5 A;  4XC2 A;  2K8B A;  3QC8 B;  3KLS X;  4CQN A;  3PZ7 A;  2D3G A;  1P9D U;  1JCK B;  4REZ A;  2WQY B;  4ZRK A;  2Q5W D;  3HUI A;  1T5X D;  1PDX A;  2J52 A;  4ASW C;  4JPS A;  5CTR C;  4LJO B;  2CKH B;  3R7Q A;  1I4R A;  3NG0 A;  3R8B A;  3GS2 A;  3AE3 B;  4NPN A;  2LWP A;  1JWA D;  3WA0 A;  4KDI C;  2MJD A;  3MHZ A;  2A5U A;  1CMX B;  1C4P A;  4ACF A;  4ICV A;  3CMM B;  4GLS C;  2KAJ A;  3AI5 A;  1FNV A;  1WX8 A;  4OHJ A;  3ZKJ C;  3AMZ A;  1Q0W B;  4FHJ A;  1LO5 D;  1AYF A;  4YSY B;  5JHB A;  1L0Y B;  1NDD A;  4W9I A;  1JQ4 A;  4LNF A;  1GAQ B;  4II2 B;  2IGH A;  1JWM D;  4GU2 A;  2LGD A;  2LHD A;  2KFK A;  3Q14 C;  2EKI A;  4W9F A;  2MEK A;  4YTM B;  3TUO A;  1Z5S B;  4RFB A;  4MT5 A;  2KN4 A;  1QKZ A;  1JRP A;  3Q3O C;  4XWW A;  1L5P A;  3QHT A;  4ANX A;  2ZW0 A;  3PZ8 A;  2WDR B;  1UH6 A;  1WFY A;  1TZO A;  2GMI C;  2AYO B;  2Y3A A;  2V3P A;  3Q8C A;  3N1Z C;  1XF5 L;  3KUC B;  3GOE A;  4HXD A;  2B3A A;  2N7J A;  2R61 A;  3N32 A;  4AQ7 A;  1LM8 B;  2AEH A;  1V1O A;  1LQB A;  4A3O A;  3JSV B;  3VVW B;  1E0Z A;  3AEF B;  3MC9 A;  3A9K A;  3BII D;  2HJ1 A;  4I6N B;  2FID A;  4OVV A;  4DHZ E;  4N9F 4;  4MM3 B;  3HHM A;  5BMI A;  3Q8F A;  2C60 A;  3KH0 A;  3E56 A;  2QMT A;  4JLC A;  4LJP B;  2KTF A;  1FO4 A;  3T3N A;  4KZ0 A;  5EE9 A;  1V81 A;  4W9C A;  3PRP B;  1HTQ A;  2QCZ A;  5IN7 A;  2KMA A;  3VH3 B;  2N9X A;  3P4Q B;  1YJJ A;  3AE4 B;  2GB1 A;  2JRI B;  4R3D A;  2CHW A;  5C3J B;  1PUT A;  4IM3 A;  3LJ3 A;  3QAR A;  3AE1 B;  1ZKH A;  4K81 A;  1JWB D;  3DVG X;  1OQQ A;  4TMA B;  5AUK A;  2L52 A;  2K5P A;  2WU2 B;  5TSS A;  4WQO B;  1WGG A;  3QAQ A;  1YQ3 B;  4F1S A;  4PYU A;  2JPH A;  4OVU A;  4C4V B;  1HE8 A;  5DPS A;  4HWI B;  1V9J A; 
#chains in the Genus database with same CATH homology
 5E6P A;  5AZH A;  2MSE D;  1WMH B;  1TZ1 A;  3Q3J A;  1WI0 A;  3QK0 A;  1XQQ A;  5HKH A;  4P7I A;  2BYF A;  1P0R A;  1WJ4 A;  2DZK A;  2N7E A;  3V6C B;  3TBL D;  2GBN A;  4X57 B;  4DK5 A;  2D2Q A;  2ZPN A;  5JH5 C;  2K8H A;  1NBF C;  5AZG A;  4AUQ C;  2V4L A;  2JZZ A;  1WX7 A;  2MWS B;  2FCS A;  2KLC A;  5AZF A;  3DPD A;  2K1F A;  2O6V A;  4TQ1 A;  4RM9 A;  1P98 A;  4FHK A;  5BO4 B;  3CSF A;  4HDQ A;  1KJT A;  3UQB A;  2RPQ A;  2KDF B;  4CYE A;  4G0N B;  3QWZ B;  3AU5 A;  2EMT A;  3V6E B;  2C9W B;  1RAX A;  3BIN A;  3NOB A;  1WXS A;  2DYM A;  2Z59 B;  3ZUN A;  3AUL A;  2MLB A;  3DBH I;  1UBI A;  1T0Y A;  3L17 A;  3VUX A;  4FJZ A;  2NBU A;  4JQW C;  5EDS A;  4HK2 A;  1YIW A;  5CHV C;  2D07 B;  5J17 A;  3PHX B;  2UYZ B;  3JSV A;  1KLV A;  3DVN U;  3T8M A;  2LVO A;  4BKT A;  2J7Q B;  2RGF A;  4KZC A;  4HCN B;  1ZGU B;  4ZDV A;  1RFA A;  2N9P C;  4A3P A;  2LZ6 A;  4JL9 A;  4WAA A;  3NHE B;  1LXD A;  4PS3 A;  1WH3 A;  2NCN A;  4HPM B;  2ZPY A;  2KK8 A;  3CST A;  1UEL A;  4AP4 C;  3KVF B;  3VQI A;  2L8J A;  5E6N A;  3X23 A;  4TV3 A;  4XZ4 A;  3TIX A;  1WM2 A;  3R66 C;  2Z0E B;  4W9J A;  3OJ3 A;  2JWZ A;  2L05 A;  1E8Z A;  4ZRJ A;  3ZVV A;  1WGR A;  2PPH A;  3L0W B;  2IO1 B;  2GBK A;  4KSK C;  4K1R B;  3VH4 B;  5TR5 A;  2DYB A;  2JXX A;  2NBW B;  4NNJ B;  3HM3 A;  5IA7 A;  3P2B A;  2LRW A;  2G3Q B;  2MA9 B;  2XEW A;  2KDI A;  5IAA C;  2YLM A;  5KHO A;  2QHO A;  4W9H A;  3UQA A;  2GBJ A;  5CHF A;  4TKN A;  3ZLZ A;  2J0K A;  2FAZ A;  4MSM B;  1R4N I;  3PS6 A;  2CR5 A;  1PQS A;  3KW5 B;  1YD8 U;  1UGM A;  1WR6 E;  4WWO A;  2XBB C;  2KWC A;  1Z2M A;  5C1Z A;  2NS5 A;  3DBR I;  3AU4 A;  2PE6 B;  2AL3 A;  2JVC A;  2W9N A;  3KUZ A;  1WJN A;  2HE7 A;  2FCM A;  1H8C A;  2K8C A;  3ENE A;  3U7D A;  2K39 A;  2RR9 A;  1SGH A;  5CHW A;  4MGI E;  3X0W A;  2ZCB A;  4KIK A;  2IO3 B;  2KX0 A;  2L0F A;  3TJP A;  2L3Z A;  3KYC D;  1Q5W B;  2BYE A;  3GZN I;  1TGZ B;  4YL8 A;  3L13 A;  3OAW A;  4DWF A;  4ZYN A;  4AJY B;  5FR6 A;  3JW0 X;  1WR1 A;  2ZJD A;  5J18 A;  4NY0 A;  4BBN C;  3O65 B;  2GBR A;  3PGE A;  1H4R A;  2CHZ A;  4I6P A;  4GGQ A;  4A20 A;  3K9P B;  1YJ1 A;  1V80 A;  1F9J A;  3UIN B;  2KXJ A;  1OEY A;  5DPR A;  1WZ0 A;  4NAW B;  4MEL A;  4FBJ B;  2MX2 A;  1QZE A;  5LXH A;  2DEN B;  2NVU I;  3ML9 A;  3ZNH B;  3ZDM C;  4XX5 A;  4ANW A;  2JUO A;  4BVU C;  3ZNI D;  4GXB A;  2KQ7 A;  2LGX A;  1ISN A;  2MQJ A;  2KZR A;  2NR2 A;  2MP2 A;  3DDC B;  1TBE A;  1WMH A;  2ZNV C;  3ML8 A;  1EF5 A;  3N3K B;  4NQK E;  2K6Q A;  4ZRI A;  5C23 A;  3R7R A;  4HLE A;  2KC2 A;  2MBB B;  1XT9 B;  3PRZ A;  4I6L B;  3VHT C;  1WIA A;  4JGH B;  2LRU A;  3A4S C;  3VXW A;  3HK0 A;  3PHW B;  1E8Y A;  3UGB B;  4EZK A;  3M62 B;  1WE6 A;  3RUL A;  1L2N A;  3W1Y A;  2VRR B;  5D2M B;  4W9L A;  4ICU A;  4NJ6 A;  1VCB A;  1GC7 A;  1V5O A;  1X1M A;  2ZVN A;  1JRU A;  3NZU A;  3PV1 A;  3RT3 B;  4ANV A;  4E74 A;  3RYT A;  2KQS A;  2V1Y A;  4PS7 A;  3IBE A;  2MP2 B;  4CHK A;  3DVG Y;  4ANU A;  2J0J A;  4MJS A;  2JF5 A;  1MG8 A;  1E90 A;  1U4A A;  1KM7 A;  1NI2 A;  1A5R A;  3A9J A;  3APC A;  1LFD A;  4K7W A;  4HJK A;  2KKC A;  4G11 A;  1WJU A;  2FIF A;  2JY6 A;  3A33 B;  4EZL A;  4AOF A;  4WWN A;  3T9L A;  5DPW A;  2R2O A;  3DVN V;  2ZEQ A;  2M0X A;  4IW0 A;  3ZW3 A;  3QJZ A;  4MEM A;  1WX9 A;  1GG3 A;  2KD0 A;  2G4D B;  2LI5 A;  2BKF A;  3WAP A;  4MH0 E;  3D32 A;  3EFU A;  3PSE B;  4RMA A;  4BKS D;  3DCG A;  2JT4 B;  4IG7 B;  4MJS B;  3I3T B;  2FUH B;  3LDZ E;  2OJR A;  4BKS A;  3TMP B;  1E7U A;  5LXI B;  4AJW A;  2ZCC A;  1UBQ A;  1Y8R C;  2L0T A;  3A9J B;  3Q3F A;  4GDL A;  5GMV A;  3S2A A;  2HTH A;  4K7S A;  4IWP A;  3EC8 A;  3VTW A;  4G3X B;  3ECI A;  2FNJ B;  2K6D B;  1OTR B;  4E3C A;  4EEW A;  4AWJ A;  4B95 A;  3QA8 A;  3EEC A;  1IP9 A;  1D3Z A;  3SHQ A;  2IBI B;  1WGY A;  3TCA A;  4BBN F;  2N7D A;  3UIP B;  2M1M A;  4WJP A;  1EO6 A;  3N30 A;  2KN5 A;  2ZZP B;  2IZV B;  2N1W A;  2KHW B;  3WIM A;  2PJH A;  2IO0 B;  1V2Y A;  2EMS A;  3VUY A;  1UD7 A;  4GDL B;  3QCA A;  4PS8 A;  5L95 C;  4NJ7 A;  2KFJ A;  1P3Q U;  4GB9 A;  2D11 A;  4CO7 A;  4GOC A;  3SD5 A;  3WAL A;  4M0W B;  3QQ8 B;  3V61 A;  3PLV A;  4MGK E;  1E8W A;  3M95 A;  2KC1 A;  1WM3 A;  3PRE A;  4II3 B;  3IFW B;  4WWP A;  2V3S A;  1I35 A;  2I1J A;  4NAW A;  4GDK A;  3M3J A;  1SIF A;  5D94 A;  2KWU B;  3ZRC A;  3C0R B;  4W9G A;  4LDT D;  2JZ3 B;  2KTR A;  4IC7 B;  1WY8 A;  1VD2 A;  2BF8 B;  2C7H A;  4GIV A;  1UZX B;  3RD2 A;  4M8N A;  2KWV B;  3PRM B;  3HIZ A;  1EF1 A;  1J8C A;  2YVC A;  3PLU A;  4IM0 A;  5CX3 A;  1I42 A;  2BYV E;  1GNU A;  2LVP A;  2CU1 A;  4DDI D;  2ZVO A;  1WF9 A;  2KAN A;  1GUA B;  2M4N A;  1SE9 A;  3H7S A;  3SDL C;  3L54 A;  2N9E B;  3DBL I;  2KX3 A;  2WX1 A;  3A1Q A;  4DXA B;  2DAF A;  2G4S A;  2IYD B;  4LCD E;  3ONS A;  1E7V A;  3VTU A;  4TUU A;  1S1Q B;  2LUE A;  1WZ3 A;  3L10 B;  4GDK B;  2M8S A;  2KTR B;  3CF6 E;  3NS8 A;  4XC2 A;  2MCN B;  2K8B A;  5G55 A;  4LDT B;  1G6J A;  3UF8 A;  3U8Z A;  2L76 A;  3B0A A;  3QX1 A;  2JRH A;  5D6J B;  2L00 B;  5G2N A;  3QC8 B;  1V49 A;  1V5T A;  1WXA A;  4NQL B;  3ZTD A;  3MTN B;  2BGF A;  4WJO A;  3A1Q B;  2D3G A;  4GN1 A;  2DAJ A;  1P9D U;  4IUM B;  4FJY A;  2MRP A;  2KOX A;  2CS4 A;  4FN2 A;  4ZRK A;  3ZTC A;  3ZRF A;  5KHQ A;  2DZM A;  3RCZ A;  3W1S A;  4DHZ B;  4FAD A;  2K25 A;  3WAM A;  1V6E A;  1K8R B;  4PYZ A;  3IVF A;  3KYD D;  1YX6 B;  4ASW C;  2BWF A;  3U30 A;  3A4R A;  2KVR A;  3WAN A;  1E5W A;  4RM8 A;  4DHJ D;  5J2R A;  3OJ4 B;  5DPT A;  2DYO A;  5CTR C;  4LJO B;  2CKH B;  4IWQ A;  3R7Q A;  1YQB A;  4WJQ A;  4EOY A;  3V62 A;  2AWT A;  4EZJ A;  4NPN A;  1EUV B;  2LWP A;  3NZS A;  3WA0 A;  2DZI A;  4KDI C;  5JZE B;  4URK A;  1R4M I;  4HPL B;  3JYU A;  2A5U A;  1CMX B;  4ICV A;  2LAS A;  3CMM B;  2IY0 B;  4FA6 A;  3AI5 A;  2BKR B;  3VUW A;  1WX8 A;  4G50 A;  2MBH A;  2I1K A;  3H1U A;  2FCQ A;  3ZKJ C;  3ZNG C;  4EKU A;  2LXC A;  1GJZ A;  1Q0W B;  1J19 A;  2DZJ A;  3B08 A;  4FHJ A;  3R3M A;  2O6V D;  5JHB A;  1NDD A;  4W9E A;  4W9I A;  2DX5 B;  2BPS A;  3TL5 A;  5E6O A;  4DHJ B;  1TTN A;  2GBM A;  4II2 B;  3MJW A;  1FXT B;  1V86 A;  4GU2 A;  2LGD A;  5DCN A;  3W1S C;  4EUT A;  4TQ0 A;  1C3T A;  3RZF A;  2KFK A;  4FUL A;  4W9F A;  2OOB B;  2J0M A;  3BY4 B;  3OLM D;  1Z5S B;  2DHZ A;  2KMC A;  1OEY J;  1WXV A;  4K7U A;  4MDK E;  5L83 A;  5AEK B;  2AL6 A;  3QHT A;  4FJV B;  2EKE C;  4ANX A;  5JHA A;  3DOW A;  1UH6 A;  2KDB A;  3QIJ A;  4IWO A;  3IHP C;  4MSQ B;  4KV2 A;  1WFY A;  2GMI C;  2GOW A;  2O6V B;  1Q1O A;  3RUI B;  2RD0 A;  2AYO B;  2IO2 B;  1OGW A;  2C7M B;  3NY5 A;  4DBG A;  3H6N A;  1C1Y B;  2CHX A;  3KUC B;  4MGZ E;  4W9D A;  4HDO A;  2KJH B;  2N1V A;  2KFK B;  3GOE A;  4HXD A;  2B3A A;  4MM3 A;  1J0G A;  3N32 A;  4MGY E;  2R2Q A;  2N4F A;  1LM8 B;  3PVL A;  2PEA A;  2NBV B;  2AEH A;  4DDG D;  1WGD A;  2KDE B;  2LD9 A;  1M94 A;  4KVG B;  2WYQ A;  1LQB A;  1KOT A;  3DBS A;  2PE9 A;  4F8C B;  3B1L X;  4A3O A;  2KLG A;  3JSV B;  4BOS C;  2O2V A;  3VVW B;  2XK5 A;  2KNB A;  2MBE A;  1IPG A;  1XD3 B;  3APF A;  2WX0 A;  3A9K A;  1E8X A;  3H7P A;  2RSU A;  4I6N B;  3PZD A;  5D7G A;  3KUD B;  2FID A;  4M8M A;  4OVV A;  2Y5B B;  2UWQ A;  4DHZ E;  2M17 A;  4GMV A;  4KSL C;  2HD5 B;  1WJ6 A;  4N9F 4;  2KO3 A;  2HJ8 A;  2WWZ A;  3HHM A;  1YX5 B;  3MHS D;  2C60 A;  1ZW7 A;  3V60 A;  4B9K A;  3VAW A;  3VFK A;  3KH0 A;  3AXC A;  4HCP B;  4JLC A;  2LVQ A;  1RLF A;  3EHV A;  3VDZ A;  4LJP B;  3IG3 A;  4HVB A;  2KTF A;  1OQY A;  3ALB A;  3M63 B;  4E71 A;  4KZ0 A;  2WDT B;  1V81 A;  4W9C A;  4KDL B;  3PRP B;  2O2V B;  3VTV A;  2XK5 B;  1WRD B;  4B6W A;  1GC6 A;  2KMA A;  1RRB A;  2KJR A;  3VH3 B;  2N9X A;  3A9K B;  2ZNV B;  4GSW A;  3H9D A;  3H7P B;  2FCN A;  1WGH A;  2Z0D B;  4W9K A;  2ASQ A;  3PT2 B;  4FLH A;  2L7R A;  4IM2 A;  3L08 A;  2JRI B;  3PTF C;  2CHW A;  5LLI A;  4IM3 A;  2REX A;  3K9O B;  4WJN A;  3SU8 X;  3LJ3 A;  2LGY A;  1WYW B;  2KJ6 A;  1P1A A;  1S3S G;  1WXM A;  3QAR A;  1ZKH A;  2MBQ A;  3UIO B;  4EFO A;  2NPT A;  3JVZ X;  4K81 A;  4BKG A;  4BFR A;  1AAR A;  2MBO A;  3DVG X;  4KIK B;  1BT0 A;  2BWE S;  4F7Z A;  3DQV A;  1IYF A;  1L7Y A;  4JIO U;  4WQO B;  3L16 A;  1WGG A;  3PPA A;  2C5L C;  3QAQ A;  2LJ5 A;  4F1S A;  2D10 A;  2MW5 A;  4PYU A;  3WAO A;  3RZW C;  2JPH A;  2IY1 B;  4OVU A;  1HE8 A;  4J6I A;  5DPS A;  3ZNZ B;  2A4Z A;  3APD A;  1WE7 A;  4BOZ B;  2G45 B;  3ZO5 B;  4HWI B;  2LXA A;  2C7N B;  3ZIM A;  2NPT B;  3HM6 X;  1V9J A;  3ZDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...