1BXTA

Streptococcal superantigen (ssa) from streptococcus pyogenes
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
222
Chain Sequence
SSQPDPTPEQLNKSSQFTGVMGNLRCLYDNHFVEGTNVRSTGQLLQHDLIFPIKDLKLKNYDSVKTEFNSKDLATKYKNKDVDIFGSNYYYNCKTCMYGGVTEHHRNQIEGKFPNITVKVYEDNENILSFDITTNKKQVTVQELDCKTRKILVSRKNLYEFNNSPYETGYIKFIESSGDSFWYDMMPAPGAIFDQSKYLMLYNDNKTVSSSAIAIEVHLTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (STREPTOCOCCAL SUPERANTIGEN)
publication title Structural basis for HLA-DQ binding by the streptococcal superantigen SSA.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Immune system
total genus 60
structure length 222
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bxtA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1bxtA02
1YN5A 1SXTA 2QILA 1SJHD 1MD2D 2AQ3B 2Z8LA 2J4XA 1S5ED 3KLSX 5FK9C 4RHRA 4C56C 5ELCA 1LLRD 3CHBD 3R2IA 1I4HA 1S5BD 2AQ2B 1LT3D 1B1ZA 1EU4A 1PZID 3BYTB 1I4PA 1I4RA 1L0XB 5FKAC 4OHJA 1PYWD 3EFXD 2XN9C 1FNUA 2AQ1B 4RGTA 1FD7D 1RD9D 5ELDA 3R2TA 1XTCD 4ZYSA 1QILA 1TY2A 2G9HD 1GOZA 1I4XA 3MC0B 1TS2A 4TSSA 4RGNA 1XXGA 1RF2D 4L6TB 1LT6D 1V1OA 1PRTF 1FNWA 1LTSD 1FGBD 1DJRD 4O1NA 5ELFA 1SBBB 1S5CD 1RDPD 1SE4A 1V1PA 3GP7A 1PRTB 1D5XC 1D5MC 2XNAC 3BVMA 3EA6A 1ENFA 1CQVA 1STEA 1EFID 1AW7A 1PTOB 4BWGB 1HTLD 1S5FD 1M4VA 1TS4A 1UUPA 1ET6A 1BCPC 2RDHA 3BZDB 1LT5D 1LTTD 3DWQA 1SE2A 1KTKA 1LTBD 1V1PB 1HQRD 3URYA 2R61A 3TSSA 1EEFD 1PZKD 1PTOF 1SEBD 3DWAA 1CT1D 1BCPD 1JCKB 3V05A 1D6EC 2RDGA 4RHSA 1HXYD 4RH6A 1G8ZD 1TY0A 1ESFA 1TS5A 5I4DA 2NTTA 1PRTD 1SE3A 2ICIA 5D3DA 1RCVD 4RGOS 1JWUD 1LT4D 1B44D 4RFBA 1YN4A 3OWEB 1TS3A 2XRSD 4UDUC 2SEBD 1PZJD 1LTAD 3R8BA 3BVGA 1ET9A 5ELEA 1S5DD 2QEJC 1KLUD 1JWMD 4K6LA 1CHPD 1I4QA 2XRQD 4L63B 1BXTA 2CHBD 1PRTC 3O13A 5TSSA 4RCOA 2O2LD 1D5ZC 1L0YB 1KLGD 1F77A 1HA5A 4Z9CB 1PTOC 1LTRD 1BCPF 3MFGA 1EWCA 1FNVA 2NTSA 3BVZA 3SEBA 2IPKD 4DXFA 5ELBA 1JQYD 1I4GA 1CK1A 3DWPA 1T5XD 1JWSD 2TSSA 1LTGD 1DYQA 5D3IB 1CHQD 2WV6D 3W2DA 1EU3A 1AN8A 1JR0D 1LTID 4DXGA 4RGMA 1SJED 1PTOD 1LO5D 4NZLB 1BCPB 1PTOH 2IJ0A 1UNSA 1YN3A 3BYYB 1EEID
chains in the Genus database with same CATH superfamily
4H02A 2IX1A 5ELNA 4WFN3 5D65A 4X65Q 1FRDA 2K01A 1ZUD2 4FNFA 4A3IB 2VY3A 1RL2A 2MUYA 4IFDG 5JOBA 1W2BA 2BB6A 4M8MA 4GN3B 1NDDA 4A93B 3GZNB 4DR7L 1VQ5A 1B4OA 1ZKOA 4W9EA 4XWTA 3VUWA 3TP6A 1PH7A 4HSVA 5L83A 4PZ7A 4ANWA 2QKIC 2CKHB 4P73A 1KABA 4EQOA 3RCZA 2E8GA 5C3XA 3IT4B 2WXRA 3A8KE 2NB0A 2LUMA 1TWCB 4JLCA 2Y5CA 1V97A 2I1JA 3EECA 3N20C 3JAMc 2KVMA 4C3IB 1WF9A 5HI1A 3I2ZA 4DR7Q 3KFUA 4IJLA 4O1NA 3HOZH 1H9SB 4GU2A 2I2YA 5C23A 4G7OC 3FDTA 4JI0Q 2KA7A 1SE4A 3L3OC 2N8NA 3H91A 3J81L 1C1YB 3APDA 3N6RA 4IUUA 3MXNA 2JA7G 3DLLA 4K8IA 2RPVA 3I73A 1STEA 1RRBA 4NNJB 4YTMB 1GUTA 2F0WA 4C3JB 5M5WB 2L83A 2IO0B 2L12A 3SDZA 2WDVB 2C5CA 2WXPA 1E0ZA 4R4TA 4GLAC 2ZVOA 3OJ4B 1FCCC 3S1MH 1ZXHA 4LF4L 4OXPA 4QIWB 1MSGA 2L1BA 4DR4L 2RKSA 1PA6A 2LGXA 4JC0A 4B0EA 2VZKB 4NAWA 1WXVA 2YYZA 4C3HG 3DWAA 4FJVB 2EIFA 3TMEA 4HWIB 2N9XA 4DHJD 1Z9FA 3IXSA 3Q69A 1TR5A 1ROEA 3I55A 2DNFA 3SXHA 1X3FA 4LF8Q 1F2RI 2Z6BA 4EFOA 4JGHB 4WJWA 4LTUA 1WCMG 1TY0A 5M5XB 2R7DA 4R4IA 3M3YB 2MP2B 4NP5A 1WX9A 4J8QA 4HCEA 4GDKB 5LMNL 4BBNF 1ACCA 2VH1A 1CZWA 4KSKC 2N0SB 3I4OA 1F2ZA 1XYIA 3U9OA 2JYEA 1V80A 2N7EA 3CWIA 4AOFA 2WXLA 2G5DA 3CIRB 1YNND 5C3EG 1JRPA 5J22A 5IYCG 1LTAD 3QCAA 1X32A 3K80C 3CCLA 4DR6L 4C4VA 4REZA 3CW2C 5JEAH 1N33L 3AE1B 1V9PA 5E4WC 4MH0E 4OWWB 2PE6B 3MXGA 3QWZB 2JA7B 1TZ1A 2KO3A 4XWWA 2JA8H 3P42A 1IBXB 1SB3C 1S3OA 2O2LD 4XYCA 5LMNQ 1QOAA 3CCMA 4FXGC 1J7AA 1V5TA 3EC8A 1VDZA 4BA1I 1T6BX 1IHZA 3Q3JA 3RZDB 2R7ZH 5DM63 4HJ7A 2KJXA 5IP4D 4A3LH 2IPKD 3GO5A 2JA9A 1QZHA 2GBNA 2L4NA 4KDIC 2OTJA 5E6JA 1I4GA 1F9JA 5GAEC 4DR1Q 4LF6Q 4G3XB 1WM2A 4PYZA 1JWSD 3T3NA 3A8IE 2M8SA 1TT5B 5GADC 2QIEB 4B95A 1AN8A 1YJNA 3LYYA 3MXUA 4C3HB 1L1OB 1C4AA 2RSUA 2HDMA 1N34L 3SHQA 3QG1A 1X56A 3FPPA 3GTMH 1UE7A 3V2TA 3X3NA 1HNWL 3N30A 3RI7C 2BTEA 4HR7B 2MRPA 1SXTA 3I63C 3QC8B 4KZCA 3K5OA 3W1BA 2HUGA 1WCMB 4U673 2AWNA 3J81c 1IW7C 4JI2L 3PRPB 1VQ6A 1F2YA 3R2IA 5CV5A 5M3MG 3R7RA 1GM5A 1LT3D 1EU4A 4BS9A 1R4MI 1F2RC 1YJJA 4B6WA 2WFWA 1GUSA 5ELDA 2K3UA 3ML8A 4XYQA 3AMZA 2YTVA 1O7ZA 3HM6X 2MQHA 2PVGC 5C3EB 1FCLA 1N34Q 1TVXA 1PUTA 1Y69U 3I4MG 1HNWQ 3AEAB 3IFDA 4ULLA 3IHPC 4L6TB 1DCZA 4ACFA 3KW5B 5HURA 2C7NB 1PH2A 4R8NA 2N9PC 5JHAA 1LV9A 1KRSA 1Q8IA 2K05A 3EFCA 4M0WA 4CKBA 1NI2A 3AV8A 1FGBD 1HQMC 1NYQA 1HUMA 4CBVA 3AU5A 5JJIA 3DPDA 1EY7A 4N6EB 2OCEA 2BB5A 1Q12A 1S5CD 3K59A 4IOIE 2XSCA 4O42A 2GRIA 1KDBA 2PQAB 3CPWA 2VW9A 1CM9A 4XIGS 4IM3A 2DY8A 1IYJB 4IPHA 4TKOB 5BO4B 1HTLD 2I46A 2ICEC 2ZTCA 1DGJA 5E1FA 2QGQA 2PEAA 5J39A 3AULA 3DWQA 3RNUA 4WWNA 4YXDB 3CRLC 3DEPA 1GXDC 3S1QH 3TSSA 1E2ZA 4YSXB 3HOZG 4A8XC 5M3MB 3MHBA 4IUMB 2ZCCA 2LRUA 1EYDA 5KEEA 1CKOA 1BUIC 1HZBA 3HOWH 1M94A 1XF5L 1QE6A 4J6IA 1D6EC 5F2DA 1OO9B 4ZYNA 5CV7A 3T1YQ 3TIXA 1G8ZD 2IO2B 4OZAA 5CBEE 1K53A 2YEPB 2N7DA 1P7FA 2NBFA 3NELA 2QHOA 3F2BA 2A6HD 1C76A 1WE6A 4KK7A 4RGOS 3ONAB 3PUVA 1LT4D 2A69D 3VRAB 5IOIA 3UDGA 1JE4A 4LNNA 3TL5A 1K3BC 2NR2A 3ZDMC 2JEBI 2QJLA 3UINB 2INNE 1VQMA 1AEXA 1C48A 4PYUA 5BYRA 3L17A 2A6ED 3DHHC 3ZLZA 4NKLA 2B8GA 4YTPB 1EQQA 5IO9A 3AE7B 4RM8A 4A20A 2J52A 2XEWA 3AM9A 4ICUA 4QB4A 3BVZA 1GPXA 1GHJA 4ODGA 3S15H 1ZYRD 3AB5A 4A3MH 4A3KG 4LFAL 3L54A 3V61A 4GOPA 3TREA 1D7QA 1WX8A 2IHFA 4Q2JA 3S24A 4DV0Q 4AUQC 3CCSA 2LI5A 3HOZB 2MJ8A 1KAWA 5JJLA 2Q8IB 3IAYA 2WAQG 1JW9D 3SD5A 1DZ1A 1B9RA 5BN5A 1E2VA 5CTRC 3NPPA 3VDZA 4EZJA 1Z2MA 1CQFA 1DONA 4IWOA 3CRKC 4X3TA 1NTGA 4LFAQ 1MVKA 2H88B 3I9V1 3BYTB 4A3JH 5EBCA 2R7ZG 1I5FA 1XQQA 4HEA1 4BZAA 4RGTA 4A3LG 2BF8B 2AKWB 3S1MB 4QQBX 1AARA 3VTUA 1B50A 4ZYSA 1E8WA 1PFDA 2B3AA 4XX5A 4Q5VA 2DZJA 2MWSB 3EHVA 3OWFA 3K5LA 4DV6L 2NVQH 4KGTA 2LHEA 2WU2B 4EEWA 3PQIA 4LF9Q 2CJOA 5IGBA 4AQYL 3P63A 3KDFB 2NBUA 3ZNGC 2QMTA 3UE1A 2J53A 3KF8B 3NENA 1XPRA 4W9FA 1NBFC 3OMCA 4DHJB 5IGFA 2UXBL 3BDLA 2K8CA 3ZXRA 3NTIA 1OQQA 2KKCA 5EPJA 2PMZE 1KOTA 2Z0SA 1RDPD 5I9PA 2IW3A 3RR5A 3HG9A 2WXMA 2MQJA 2NVYH 2DENB 5DM73 4KD4A 4DV6Q 4A3KB 5DLQE 1MFWA 1TU2B 2O2VA 3J81j 4AQYQ 2WKCA 3K9PB 2L8JA 1AW7A 3WAMA 3VTWA 2Y5BB 4V190 1E7VA 3J7A5 4BWGB 1VR9A 2WAQB 2KK8A 2QCZA 3AYHB 4S17A 4A3BG 5DAUA 2Z0EB 3A9KB 4WURA 5C2TB 3BK1A 1XPOA 2K04A 1SLJA 3DM1A 4NJ6A 3PO2G 2SNMA 1S3SG 3S1RH 5IODA 2R7ZB 3SFDB 4G0NB 2JY6A 1K9MC 1S72A 2LRWA 2F4IA 1A3TA 2L5TA 3IRBA 3K0YA 3I4NH 3C0RB 2IT1A 4BY7H 2CWPA 2KLGA 5HG2A 3D8GA 1TS5A 3CF5A 1YI2A 2LGSA 4QAYA 2JP1A 1WRIA 3UIOB 2BKRB 4JI4L 1AP0A 3GTMB 2EYFA 1FPYA 1JROA 2W55A 2N1VA 5IY0A 3FILA 4C00A 1SNOA 2DHZA 2F1MA 2INPE 2WXGA 2JXXA 3ZJTA 2BS2B 1ET9A 2ZXOA 2DYOA 1HE8A 2JWZA 2WXHA 2OEOA 3D6CA 5EPLA 3HOWG 3TZUA 2WS3B 4LCDE 5CHFA 2CHBD 1PRTC 3U8ZA 4OEMB 1L0YB 3K7UC 2K5NA 1LXDA 4N59A 1ENCA 4BAXA 1WGGA 2EQSA 4W9DA 4A3BB 1P1AA 4KLKA 1L7YA 4QUCA 1BO0A 1C4CA 1LTGD 1STNA 1QCBD 4YWGG 2KDEB 1VQKA 3PO2B 1UGJA 4YY3L 4GIVA 2YTXA 1RKNA 2KVRA 3E9SA 3NBHA 3H3VI 1GG3A 3VYSA 3H0GG 1Y1VH 1GJZA 2CQAA 4WQOB 3M62B 2EYHA 4MH8A 2LASA 4CKCA 2MGSA 2DLBA 1SJHD 5FK9C 2DAJA 3UQBA 1LYLA 4HIMA 1SN8A 4OVZA 3Q3MC 2J42A 2OJRA 4JBMA 2A68D 1PYWD 3ZJVA 4ME3A 3J80i 1Z5SB 3MZ5A 2BWFA 3U4ZA 1WTPA 4F8CB 1L4DB 4YY3Q 2LGYA 3Q8FA 1HPCA 3KVFB 1UWVA 2ZXRA 4DNIA 3S1QB 3DBLB 1F52A 1J0GA 1TS2A 3F2DA 1XXGA 2E76C 1WTRA 1VQBA 1N5WA 3UIPB 3GD7A 1EY0A 2SOBA 3HOWB 2UXDL 3MC9A 3I8ZA 5JPNC 3DHQA 1KH0A 4LLGM 4BKSD 3SK5A 3DVNU 4EZKA 2UU7A 2D2CC 1KHIA 1X6OA 3B9JA 5DNFA 3G48A 1J9OA 3IFTA 3RD4A 3T1HL 3P4PB 4TMAB 4KZ0A 3EIVA 4I6PA 5FLXc 5DPTA 3GP7A 1HH2P 1S4ZA 3FVQA 2ON8A 2PIAA 2CFMA 2DJFC 2JZZA 2I0QA 5CGKA 1YX6B 3L0WB 4YCWA 3TP8A 4HIOA 2UXDQ 1XCTL 4DQOC 1AH9A 2A73B 1K8MA 4ZCKA 2LVQA 3B2FA 3LGJA 1SR3A 3K0XA 4WJ4A 3WAPA 3T1HQ 3NWTA 4MZ9A 3ENEA 4JPSA 4KIKB 1AE3A 2V4LA 3VQIA 2GN5A 1NSNS 2EYJA 4DN4M 2BYFA 3I3TB 4RA8A 4OX9L 2KHIA 1B53A 4DK0A 1P98A 2GOWA 3KJOA 3S15B 2HHHQ 4HIDA 1Y1WH 4ZKCB 2F0DA 3CCQA 1T5EA 1QNUA 1VQ9A 5KYLA 3U4VA 2DN8A 3HP3A 2KQSA 2LJ5A 2CCZA 2V1YA 5FR6A 3H9DA 3J80E 2PZWA 3KQ4A 1JWUD 4FA6A 2CKZB 2INDC 4US8A 2D3GA 4RFBA 1H8CA 1CFMA 3OWEB 3M85A 3APFA 4QMGA 4R1JA 4UDUC 3TEHB 3OW2A 2Q2UA 1H95A 4NJ7A 2KYWA 3RUIB 1OGWA 4JW0A 3I5JC 2DYBA 4E6IA 2PPHA 1K51A 1YQBA 1SYGA 3RNCC 2JZPA 2ZXPA 3I4NG 3QJYA 1XMOL 1XWEA 2KMAA 3NQIA 1J8IA 3AFQA 1HA5A 4OELB 4C3IH 2HJ8A 1EYAA 1R4MB 2PKOA 4XC2A 2RDFA 1C77A 4L5QA 1YIWA 2RPQA 4EUTA 2LD9A 2KC2A 1D3ZA 3Q3FA 3QO2A 4XT1B 1VQHA 1BNZA 2LJIA 2OEDA 1MJCA 2RVLA 2LVPA 2KTFA 3SHLA 1EOVA 3M4YA 3ML9A 2WP9B 3GOEA 4F1SA 4IPDA 1XMOQ 3RPFC 2R93G 4AQ7A 5M5WH 4GGQA 2EYPA 2NVYB 3HOVG 4X66Q 4DUYL 1MGSA 1EEID 1JQ4A 3ZRFA 3EQLC 1ZXTA 1A3UA 2K6AA 2WDTB 2ZPNA 4K2LA 4LFBQ 2JSOA 1CKNA 4POGA 1MHXA 2GLSA 1QUQB 2VZKD 2ZNVC 3VR8B 3SR1A 4IFDH 4KHVA 1YN3A 1A6XA 1GD7A 3RN5A 4GLXA 3H3VH 3VRBB 4DFAA 1U4MA 4MSQB 1FMAD 1WXSA 4DPGA 3PUWA 3JYUA 1TY2A 4N8X1 1GOZA 4DUYQ 4IJHA 1YHAA 4GNXA 4FJYA 2MP1A 3S1RB 4BVUC 3VR3A 5M5XH 3M3YH 4BBNC 4GKJQ 1WD1A 2LFNA 4BFRA 1N36L 3I4NB 5IYDH 1V8CA 2KN5A 3G6EA 4UHVA 4HEDA 3OYYA 2Q2HA 3VA5A 3KYCD 1QLBB 1X65A 4L2YA 1YZ6A 3U52E 5FR3A 1BDOA 3RN2A 1TQOA 4NPNA 1NYRA 4PZ6A 5IT9E 4GS3A 4KHPL 2F0PA 1IGCA 1CZGA 4HDQA 3K7AH 4LF7Q 4HJ5A 3HKSA 3AEFB 4GN4B 4KVGB 3A5ZB 4JI6Q 4BOSC 3CMEA 2V9HA 1BBUA 1PTOB 2MA9B 1HJPA 1TKGA 1N36Q 1ZKHA 4YWKA 1BUVT 5IE8A 2R93B 2IO3B 3HOVB 5FO7B 3CF6E 1YNJC 1HCZA 3HOUG 1NR2A 2M56B 2Q2TA 1YD8U 1C9OA 3Q6SA 5GAHC 2X69A 2E5LL 4AYBG 1WXMA 2R61A 4HAEA 5T1GA 4KHPQ 2GBKA 4W9KA 3GTJH 1EIFA 4GOPC 3JVZX 3N1XC 4X64L 1QG7A 4C2MH 4Y7NH 1XLNA 1IKMA 4XTCS 3UE0A 2HD5B 3TP5A 2LY7A 5CBAE 3OTOL 2MBBB 2X38A 4ZRPA 1E3PA 1VJKA 5C6AA 4E74A 3PUZA 1WGRA 1HR0L 3H15A 2HDEA 1PH6A 4JI8L 4K6DA 2V4DA 4JI1Q 3NVZA 3ULJA 5C3JB 1VQNA 4BY1H 1STYA 1RLFA 1WCMH 4JVZA 1OQRA 1D4BA 5G3LD 2KQ7A 2ICIA 1VQOA 1KC8C 1XEEA 2PLPA 3NZSA 1WYWB 3UDIA 3MEFA 5IKCM 3HKZE 4X64Q 3PHWB 1SMYD 4IQZA 1PZJD 1WR6E 2BW2A 3LDZE 4EX5A 3P4SB 4P1BC 3NQTA 5CR3A 2IY0B 5IYCH 3HUIA 4P2CB 1JOQA 1HR0Q 1KLUD 1E0BA 3Q14C 4YHHL 2FFKB 2GVBA 2KDBA 2K4KA 4JI8Q 2VRRB 2Z59B 1BXTA 2JJQA 4CDFC 3JAML 1WMHA 1I35A 2F0NA 4XDDA 4TV3A 4IWQA 2L7RA 5EE1A 4A90A 2N3SA 3P75A 1V2YA 5ISRA 5E3FA 3J7AV 1IYUA 1HFNA 1STAA 3B6YA 1C0AA 1B9MA 4DXFA 4IALA 4DNRB 3VTVA 3HOUB 3A55A 5E6PA 2QW7A 4AYBB 2IYDB 4ARCA 2L55A 3QX1A 1CKMA 3ZQ4A 2JZ3B 2MO0A 1IKLA 4DXGA 1MHHE 2LXAA 2ZVNA 2XWJB 3ZVVA 1LO5D 4PK1A 1G51A 3PCOB 3SFEB 1P7EA 3C1EA 3DMUA 2DZIA 3FKIG 4IURA 2B2VA 1TBEA 4ICVA 3AI5A 1LFDA 2LXKA 1PFMA 4FADA 3I72A 1MD2D 2RCNA 3GTGH 2Q8TA 1SRUA 4LJZC 4UP9A 5ELCA 2YLMA 1I4HA 1JRUA 2DJGC 1TT2A 1I4RA 3E3XA 2C7HA 1HTQA 4KKSA 3EFXD 4DU9A 1HRJA 3FP9A 1U4PA 4IUNA 2VQFL 1GUOA 1K52A 1SNMA 2M0AA 1OXXK 1XTCD 3X3MA 4EGVA 4JI3Q 1QILA 1TWFH 2PI2E 2MBEA 2G9HD 1MHWC 3SGIA 4EQ5A 5EE9A 3V3XA 1A2UA 2MBQA 3I4MH 5BMHA 3A74A 5EPKA 1HNZL 2A8VA 3V60A 3STBC 1T0RC 2AL6A 2KQ4X 3HIZA 3U50C 1FVIA 2Z0DB 2H1EA 5CHVC 4P7IA 2E2DC 2BDNA 1V1PA 2EY2A 1PHJA 2FCMA 2QSDA 3NHHA 4A76A 1JJGA 3VR6A 3MJWA 1K3RA 1YIJA 1AZPA 1RIPA 1GUNA 3MTSA 1L4ZB 3C8YA 2W9NA 4MEMA 3AMUA 4P71A 3A56A 2WX1A 3X0WA 3FKIB 5IYBG 3TQYA 1K0RA 2KTRA 2PPBC 5IYDG 3L7ZC 3Q8DA 1A70A 4G50A 3Q8AA 5C4JH 4DAVA 4K14A 4HXDA 1JMCA 4C7YA 3ONSA 3K57A 2I1KA 4B9XA 3PIO3 3VDYA 2IHEA 2K5HA 4IOAA 2M0XA 2RBMA 1HR0W 2UXCL 2NMQA 3JSVA 1WTHA 4PNYA 4DAYA 2M00A 4GKKL 2BYVE 2D9UA 5D3DA 2X6LA 2KWCA 3DHGC 4J3OD 2RSOA 3NVVA 3P4QB 1FJGL 1N32L 1TS3A 1PH3A 5K5PA 3FKYA 3PV0A 5FO8B 4IM0A 4NXNL 3ALBA 2W3SA 5A2QL 1E8ZA 4P1CC 1PXUA 2B2UA 4ME5A 3PO3G 4L1BA 2XTIA 3I7FA 1GUGA 4II3B 4DV1L 5TSSA 2CWAA 2UXCQ 2HDLA 4OWXB 1D5ZC 5EQ0A 2DZMA 2Z4HA 3D6WA 3NG0A 1U9RA 4JK1C 4KY6A 1ZPSA 4E3CA 1EWCA 2KJ6A 4BY1G 5C44H 1FJGQ 3ZJYC 1WYDA 2HCCA 3GTOH 4CJ2C 3C3LA 3UF8A 1JQYD 1NE3A 4LF4Q 3HOYG 3NSWA 4NXNQ 1MPEA 4GN5A 4DR4Q 3L2PA 4A3EH 2OHFA 1Q7YC 4A3KH 3VH4B 2DUDA 3GV6A 1R7SA 4ZUJA 4DV2L 3KH0A 4CO7A 2KOXA 4E71A 4FF3A 4DV1Q 4ZRQA 3TRZA 4RAUC 1ZDVA 3R7QA 2H5XA 3V62A 1BCPB 2WQYB 3PIOA 3HK0A 2XWBB 1U4LA 3K7AB 1Q0WB 2N1WA 1VQ4A 5LL6X 2J4XA 1EWHA 4W9JA 3I70A 4ALPA 1KLVA 2EELA 1JC7A 1Q90A 3RMHA 5FKAC 4KV6A 3V05A 1BMLC 1ENAA 1WTOA 3A9JB 3I57A 5HKHA 2AQ1B 4DV2Q 3B08A 2D3CA 4K5WA 2WXQA 4DF7A 1Y8RC 1H9SA 4HPMB 4GB9A 2DBYA 2UUBL 1GUWA 1VQDA 4OVVA 3M95A 3AQQA 3GTJB 2E6XA 3PO3B 4DR6Q 1TZOA 2FCNA 1L2NA 1VZ7A 1N33Q 3TS2A 4Y7NB 4C2MB 4M02A 4AWJA 2HT1A 1JT8A 1TWAH 5D2MB 2AMCB 2JN4A 3V6CB 2OJWA 3MTNB 2K03A 3EFUA 1L6UA 1SSOA 2LGIA 2HIXA 1VDVA 3PGEA 4LK0M 4M00A 2J0KA 4A6QA 4ID6A 4ZK9B 4BY1B 2UUBQ 1VQJA 3H8HA 4YSYB 3S1NB 2PNRC 4IG7B 1L6VA 4F7XA 1ENFA 4FDBA 4MELA 4J15A 2BKFA 2KCTA 2BQQA 4MGIE 3E9HA 5I9OA 3FHWA 3U9SA 2E2IH 4LNQA 4C1NK 3QARA 4N9TA 5AZFA 5AZHA 1E22A 4A3BH 2QCPX 2MP2A 2NWGA 3ITPA 1QOBA 2WYQA 4JI2Q 3NS8A 2KACA 1B3QA 4GDKA 2B76B 1TJEA 2MLBA 2BOSA 1WJUA 5ELOA 2A6HC 3PO2H 3DWMA 4RHSA 4K8JA 1E8XA 3FAHA 1OXTA 3M4OB 3AEGB 2AHOB 1PVOA 2XIWA 4A3GG 2BS4B 2ALYB 3CMAA 2AX5A 1IBXA 4DAPA 3PZ7A 4B3RL 2H89B 1HTOA 1RTNA 1SE3A 1EUVB 4C1NI 4JBJA 3LWUA 4CDCC 1A62A 2JF5A 1H4RA 1Q10A 3MP9A 2YV5A 3GTGB 2EXZA 1ONLA 3MC8A 3DXJC 3T3OA 2MFIA 3MVVA 1HZCA 2K50A 1K8AC 1ZYRC 4FF1A 4JWUC 4GNXC 2LZ6A 2A74C 4HJKA 2AYOB 3D31A 2JU6X 1TWFB 3NWSA 5C0XI 1N61A 1C4PA 4B3RQ 2K5PA 2ZW1A 1B3AA 1B2TA 4ZKBB 1L1OA 1EWYC 4IPCA 4QCLA 1QWYA 3T53B 4FJZA 3I4MB 1EY9A 2FCQA 4RCNA 2DNCA 3M7GA 1TWGB 4MM3B 4MGKE 3VHTC 2Y0SE 1UD7A 3BJUA 4JX1C 3AEBB 3PV1A 3PGZA 4NZLB 2BYEA 3EBEA 5E6NA 2I38A 4X3SA 4DR3L 3B2GA 1Q82C 1UNSA 1FYCA 4XDXA 4NXML 1D2BA 2OQKA 4N58A 2PYKA 3CXCA 3H0GH 1PQSA 3RNFC 3VR5A 1BOSA 2AQ3B 2WWZA 1XNQL 5C5LA 1YHQA 4A3GB 2K0PA 4M8AA 2XK5B 2ZW0A 1C7YA 3ZTDA 1B1ZA 1XD3B 3J81i 3KUCB 5C44G 5H92C 1HUNA 2MBOA 3UDFA 1RD9D 1UF0A 5A35A 4QY7A 3N52A 4JPBW 2O6VD 4HPLB 1VQLA 3DVNV 2EKIA 4ITKA 1CTMA 2D0PA 4A3EG 3E0EA 5C4JB 3UDXA 1WI5A 4DK6C 3K6OA 1NR4A 3DCGA 4W9CA 1LTLA 2PQAA 5IA7A 1XNQQ 2VUMH 4IC7B 3WIMA 3NTHA 3HVZA 1EO6A 1MJEA 3P20A 3KF6B 3AECB 5LLIA 3GTQB 1QZEA 5ELFA 3Q8CA 4HN7A 2B63H 1MI2A 2NZ1D 3PLUA 2D07B 3F2CA 1W6KA 3NXWA 3QR8A 2VS1A 2KLCA 4F8MA 1PDXA 4HCNB 1D5MC 1YBYA 3RLOA 1EOTA 3RZFA 3BVMA 2WINB 3MFYA 1Q81C 2AL3A 2QC8A 2A5UA 2SAKA 2KVZA 3NZ3A 1SNDA 4JWSC 4DHZE 4DGZA 2ZJQA 1IPGA 1UH6A 3NP8A 3V96A 1IBKL 2HJ1A 2JYTA 2CHWA 5K36G 1DXMA 1HEZE 2OWOA 2JX5A 4LDTB 2Q8RE 4H0LC 2IO1B 2R3ZA 2KD0A 4IUPA 2KCMA 3OOCA 5AFWA 1EYGA 4R3DA 1IL8A 1F9RA 3H7SA 2F52A 4R8IA 3M9BA 3SVMA 5C44B 1MSHA 3P1HA 3GTOB 1MJDA 2NBVB 4NQKE 2O5IC 2CHZA 2G9DA 4QL5A 4UAIA 5IWAL 5AJ3L 3PRMB 4ZUIA 5KHOA 1L5PA 4GDLB 2FMMA 1GKHA 2KXJA 4KKUA 4A3EB 3K81C 2B2VC 3A7LA 3SK6A 2KEEA 1ESFA 5C0XJ 2HE7A 3J81E 2IY1B 1B7YB 4X57B 2BDOA 2G4SA 2RHSB 4S0RA 1KDAA 1SYCA 3W5UB 4XE0A 4JI5L 5AEKB 2ZJRA 1WOCA 4DHZB 2UXBQ 1LM8B 1RM6C 2SDFA 3ULPA 2Q5WD 5DPRA 5BR8L 2EKEC 1L2FA 4X6AH 5AJ3Q 3OLMD 2WXJA 1VQEA 2V3NA 5C4XG 2XVSA 4OO1I 4EQNA 3P7JA 4JOIA 1WXAA 1K8RB 2K6DB 2RGFA 5JJZA 4A4IA 3RZOH 3FEWX 3TZDA 3J80c 1G6PA 4WAFA 3ZIMA 1WFYA 4BBRG 1PH8A 4K0KL 4RKBA 1Z6HA 3M3JA 2B2YC 2F3VA 2PMZB 4JI5Q 5C4ZA 1JOOA 5FLXL 2IGHA 5IN7A 3GTKH 3F1ZA 1DOIA 1UBIA 3ND9A 3DBHI 3OW7A 1TWAB 1R9TB 1CK1A 3S9WA 3NBIA 5D14A 4POFA 3P4RB 2ASQA 4DV4L 3A1QB 3KLWA 1LM0A 1JR0D 2GBMA 2LHDA 3T9LA 4YT0B 3CC2A 4FXDA 3NOBA 1PTOD 4WQMA 3BG3A 4HKZE 1PTOH 2GBRA 3I4LA 4ZQ3A 4F88A 4K81A 2F0KA 4PMCA 4K0KQ 1TKYA 3CMMB 1F9QA 3J9CA 2R93H 3HOVH 3GZNI 3KLSX 2X6GA 2Z8LA 1P8LA 2WACA 4OONA 4HCSA 1WYGA 2K5VA 3KDFA 3AE2B 3QOJA 4IUQA 2D5GA 3TEWA 3AFPA 3KF8A 2JEAI 4JI4Q 4DV4Q 1UAPA 2E2IB 2M17A 1X3PA 4O0AA 4CJ0B 3R2TA 4LF5L 1P3QU 1SIJA 2FUHB 5D7GA 3VAWA 2PNHA 1OEYJ 3H7PB 4KD3A 2G3QB 5KNDA 5AZGA 5M3FG 4WJOA 2NVXH 2LEKA 2XBBC 1I3QH 1WGKA 3U30A 2KFKB 1R4PB 1UEBA 2PCFB 3J7ZC 2PJHA 2OXPA 1L0VB 4PV1C 4MJSB 4MTNA 1E5WA 2UYZB 4BBRB 1XLPA 2K75A 4V0BA 1E2WA 1P9DU 5IAAC 2JRHA 1DOLA 1D1KA 3BDCA 5JAVA 4LF5Q 4A3CH 4IZ8A 1DD2A 3AU7A 1V5OA 2KNBA 3A9KA 3EGRA 3DUZA 1RJTA 4DR2L 1C79A 1OXVA 2B2UC 2UU9L 3VA7A 1R4NI 5CX3A 3MHZA 3AXCA 1YNXA 3EA6A 2WXNA 3OIPA 5JXVA 1CSPA 2L0FA 3FPUB 1LQBA 1H9JA 1G6ZA 4IWPA 1CUKA 3A33B 3NVYA 5L95C 2L15A 1S5FD 4A9AA 4XQNA 5AUKA 3FMCA 3HEJA 3PRZA 4ANUA 2VUMG 4LWCA 1SYFA 5IT9c 1HQRD 3HOUH 4L5TA 2HQEA 4DR2Q 3CCVA 1LUZA 4KI0A 3PSEB 3ERSX 2B63G 4IUVA 1EY6A 4G7ZC 5G5GA 1VZ6A 1CT1D 2NVUI 1YX5B 1WWTA 3TEYA 2B2TA 1IL2A 3DBRI 3AE5B 1JE5A 2EDGA 4JIOU 4MGYE 2I07B 1KIXA 5M3FB 3H6NA 4HJGE 2BH8A 3V6EB 3GE3C 3TP7A 2CQOA 2Z6KA 2CW0C 3M4PA 5JVH3 1IBLL 1Q3LA 3G4SA 4DV7L 1FIQA 2NTTA 1PGXA 1PRTD 3D4RA 1UGMA 1YOVB 1WTWA 2BPSA 3Q6BA 5BMGA 2F0OA 4WJ3M 1Q1OA 1CJEA 4LJOB 3K58A 2CVRA 1J5EL 2QF7A 3H0GB 1Y8OB 1ZXIA 2WXFA 5HFYA 3W5OA 2BE5C 4O2DA 2YU9B 3AE9B 2F3IA 1EZ6A 2NZHA 5NUCA 1YJWA 1QQRA 1U4RA 4LJPB 4MT5A 4A3DH 1B9NA 2FBWB 1I4QA 4L23A 1HNXL 2KECA 1IBLQ 4YSZB 4DV7Q 2O6VB 4ANVA 1FD6A 3KWLA 2HTHA 2F0GA 2EOTA 2BGFA 1MKHA 4B3ML 4F87A 4FXKC 3B1LX 3WWVA 2NTSA 4NDXA 4CDEC 3I91A 2WXIA 5EKLA 4K7SA 3F8TA 2VUMB 3DVGY 1WH3A 4PS3A 4PS7A 2TSSA 2ES2A 4LMQD 3G71A 3HRDD 1IYFA 2H4OA 3DOWA 1WY8A 1HNXQ 4OX9Q 2B63B 1A2TA 3IAM1 3TBIB 3K9OB 1A8VA 3PUXA 2RQXA 5GAGC 3W1SA 5KNBA 3IKJA 2N9KA 2XGTA 2IJ0A 1MG8A 4I6NB 1KFYB 3BYYB 1EYCA 2EVBA 3CKIB 4KN7C 1E24A 3LWEA 5CORA 4B3MQ 4FXCA 2ZJPA 4IM2A 3FKIH 3MA2B 5IIFA 1TGZB 1SAPA 3ZXVA 2JQOA 5KNCA 2HTME 4BXXG 4W9GA 2KJHB 2QDBA 2XN9C 2R92H 1FEHA 3KUZA 4HCPB 1II3A 4A3PA 4GMVA 4ZHOA 1WM3A 1GB4A 1ZW7A 2KFJA 2VB2X 3QB3A 2VL6A 5C0XG 1M1KC 2KZRA 1AZQA 1I4XA 1IP9A 2WB1E 4TSSA 2JA6G 4BBSG 2F0JA 1YVCA 4DUZL 4ZRKA 5M5YH 4B0MA 2IBIB 2BBCA 2E2JH 1SNQA 4JI7L 1KF6B 3OG5A 3PT2B 4R4OA 4N9PA 5FO9B 5BYSA 1A15A 2UUAL 3PVLA 1WTVA 2VH2A 3CU7A 1SYDA 1V86A 3DQVA 4HROA 3MXPA 1OTCA 4KIKA 2PW9A 1N6ZA 2MJDA 1I6HB 1DOMA 4URKA 1QOFA 3A8JE 2K39A 2BA0A 4I7ZC 4JYAL 3AEEB 1STGA 1XPUA 2I5MX 2LFIA 4RNAA 3GQBA 3D4WA 1J8CA 2UUAQ 2RDHA 3RMKC 3QK0A 2KENA 2MBHA 1LTBD 4IKGA 4RM9A 3C2PA 3ABVB 5J2RA 3RZOB 2GB1A 2K5DA 5IYBH 4BA2I 1XO3A 4ZAIA 2NPTB 2NN6I 1NMGA 1PZKD 4DA2A 2CU3A 4HDOA 4WWMA 4ANXA 1PGBA 3GTKB 4A3CG 4FN2A 4JL9A 1T0QC 1BCPD 1NVID 3ZNID 3U4EG 3MAQA 1OXSC 1VQAA 1Z7TA 3Q23A 1TIFA 4NB3A 4HJ9A 2L9HA 3S16H 2WKDA 5C4HA 2JA6B 4BBSB 1QVCA 1HZ6A 1WX7A 4RG1A 3SK4A 4L8JA 1N60A 1X55A 4FULA 1WIAA 4QUFA 5TR5A 1B44D 1VCIA 3BZCA 4MHEA 4AP4C 2ID0A 2MW5A 2ZZPB 3R8BA 3DEOA 4MN3A 2KDIA 2PE9A 4GSWA 1A0IA 3Q3NC 3W5VB 2R6GA 5IP7H 4PS8A 5T1IA 1VQCA 3CC4A 3AB9A 3PO3H 1YHBA 5JH5C 2EY5A 2FIDA 3GS2A 3HKZG 1KLGD 2FMCA 2NVXB 1I3QB 3S17H 3QA8A 1GNUA 2GVAA 2ZCBA 4AS1A 1FNVA 1BT0A 4HMJA 2JRIB 3QOLA 2J0JA 3AU4A 3DWPA 3TMPB 2IX0A 4CGYB 2E5LQ 1AYFA 3HOYH 3S1NH 1QUQA 4KJNA 3W2DA 3CSTA 3BINA 2PMVA 1JJCB 4ASWC 2F03A 2L52A 2GA4B 2PW7A 2VQEL 3OTOQ 2K33A 4A3DG 3BWUD 4QJFA 2LMCB 1RODA 3NS1A 1YQ3B 3R3MA 2NS5A 1PYSB 4OIKA 4B08A 4RHRA 1RFKA 3ZJUA 5CV8A 1S5BD 4RMFA 4QGUA 4OL7A 4IOCA 2K9XA 3C46A 4G4KA 5CYUA 3AH7A 4TRDA 2QDLA 1CMXB 4TVAB 2JXMB 4OO1G 2V4IB 1DOYA 2F0TA 2RSNA 1VF5C 1NENB 2B2WA 2MEKA 3RD2A 2NVTB 1W3SA 2WU5B 5JJKA 5IGEA 4RKLA 5GMVA 3PS6A 2O4XA 3M4OH 3T8MA 4CDDC 3RLFA 4DR5L 4YHHQ 4LAAA 4P6VF 1LTSD 4A3FG 3VUYA 2M2LA 1JJ2A 1V1QA 3HKZB 4K7WA 3ZNZB 1WJ4A 2WXOA 1ESRA 1DJRD 5CV6A 2PTLA 4G57A 2ASBA 4JBKA 2OT2A 2F0HA 1YNJD 1J19A 1E8YA 3LJ3A 1C8CA 1I6VC 1O7LA 1PRTB 2KHWB 2R92G 2L00B 2V3PA 5E7NA 2XNAC 4DR5Q 1NUCA 1C9FA 1FO4A 1EFID 4JOIC 1RHPA 4ZHPA 2ZT9C 1A5RA 2LS01 1UUPA 4CJ1B 1YITA 3DWGC 3HGBA 2CR5A 3BZDB 4A3DB 2M9VA 4TQUS 3WCQA 5EDSA 1OXUA 4QIWE 4R4QA 2EY6A 3R3OA 5CV4A 2DAFA 3FRPB 2JVCA 3E56A 1HTPA 3MXNB 3URYA 1TWHB 1NY4A 1TWGH 3MJ5A 1EEFD 5EBDA 4EZLA 2PQEA 4GXBA 1VQ7A 2WDQB 3WOEA 4B9KA 2ZEQA 1GHKA 1U5KA 2VQFQ 2F0EA 3W1YA 2AWOA 3CD6A 1GVPA 2EMTA 3PHXB 1ASYA 1BF4A 4IPGA 2JT4B 5DPWA 2D3BA 2EYOA 4NAMA 5I2XA 3J7AF 3QHTA 1T0SC 2KQ3A 4WJQA 5I4DA 3IG3A 2RD0A 4NAWB 1EQRA 4NJCA 4A3GH 4I7AA 2WHIA 4YL8A 2D5DA 5FLMH 2D3AA 1HNZQ 3DBHB 4EOYA 5DPSA 2Y3AA 5DCNA 1YN4A 3VUXA 1GJXA 4KN4C 2LSSA 1VMCA 1WD0A 3BDOA 4FLHA 4W9HA 4GOCA 1S5DD 2J0MA 1UE6A 1CHPD 2ATWA 4BKSA 2R92B 3Q2AC 3CAMA 1VZ8A 3UGBB 5HY6A 1K0SA 1WTXA 1WJJA 3KYHC 2KWVB 4P75A 1DOXA 2D0OA 4UP7A 1YNNC 2FJ2A 2OTLA 1BCPF 3BY4B 3FC4A 4JI0L 3GTQH 1ISNA 5M5YB 1XLOA 2PVOD 1MIUA 1XTDA 1BQQT 3H6MA 2E2JB 2BS3B 4HLEA 1X54A 4C4VB 1STBA 3KLRA 5M9OA 2FIFA 4EVOA 1UZXB 2EY1A 2RCFA 1PH5A 2K5QA 2JA5G 1I50H 1KL9A 1LTID 1Q46A 1SE9A 2WXKA 1ICWA 3TEXA 1WGDA 5EGTA 1Y56A 3L4PA 3PLVA 3CPFA 1DM0B 1KD1C 5IP7G 4J6HA 2E3TA 3OPOA 2IZVB 1WJ6A 3PPAA 1LABA 4AJWA 5E4XA 3A4RA 3OAWA 1GB1A 2L1AA 4LDTD 4I65A 1LLRD 3ICEA 4WRDA 4MDKE 2BA1A 3QIJA 1I4PA 1QB5D 3STBD 4GKKQ 4A3OA 2YVCA 3K5MA 3DBLI 4HJAA 4BKTA 1R4NB 4OIJA 1N32Q 2L76A 4YIJA 3U7ZA 1G6JA 4LF8L 2B2TC 1SE8A 4K7UA 5LHY1 3MC0B 1PDQA 5KGUA 5JEAJ 1PH1A 4PQXA 4HVBA 4ZLTF 4R4CA 1V1OA 1RYJA 3T51B 2Z6KC 5G3LF 2KC1A 1EY8A 2LUEA 2IL8A 4X62L 5GROA 3PF4A 1WRDB 2JUOA 3IT6B 1H9KA 1DGSA 4TQ1A 3S16B 1HHVA 3ECIA 2PI2A 3CCUA 2KT7A 3NHEB 3B0AA 1QVFA 2DNEA 2KCNA 2N55A 5IOCA 2IY5B 1C78A 4APVA 3LX0A 1XT9B 3DDCB 3VH3B 2DWQA 1YJ9A 2K14A 4BOZB 3RNEC 3W1GA 1PYBA 1SNPA 1X3QA 3DBRB 4RF0A 1CQVA 4MGZE 2JA5B 4M0WB 4JV5L 1Y8PB 3S2HH 3M63B 4X62Q 2Q2IA 3D4DA 2E74C 3BU2A 4P72A 4FP5D 2JSVX 3W9CB 1SFOB 4C80A 2PZUA 3HVDA 4DR1L 4LF6L 1DOKA 2F0VA 3NTKA 1R9TH 5K36H 1GUAB 2FNJB 4CKEA 1QNKA 5FJ8H 4DV3L 1IYVA 3ETRA 3T56B 5H8YE 3S17B 2WP8J 3A54A 4ZDVA 1ICFB 1U0LA 4K5XA 2A19A 3JAMi 1VLBA 2BCOA 4JV5Q 2JQRB 2RDGA 3KJPA 2KHSA 2G45B 3W1SC 1I7HA 5LXHA 3IBEA 1HXYD 1PFBA 1V8QA 2K52A 3HOYB 3S2DH 1QJOA 2KMMA 4FBJB 2ZNVB 1E6EB 2WGSA 2RA4A 3GE8C 3NUCA 4ZRIA 1KDCA 4RF1A 1N5XA 4XGAB 2KAJA 1FXTB 5IGCA 4RMAA 4DV3Q 2IGGA 4ZOHC 2L11A 2K22A 1VRAB 2KEDA 2L0CA 1NNXA 4DK3C 1YMHE 4M1UB 2R2QA 3AN1A 2AUJD 2KANA 1L0WA 1STHA 2KMCA 5E6OA 2K5WA 1RFAA 3J7YW 2KX0A 3L10B 2YEPF 3RULA 5C4XH 2EZVA 1KXLA 4RCOA 1IGDA 3C1FA 3G6JB 2A69C 1YNTE 4Z9CB 1ZP0B 4BBRH 2NN6G 5BMIA 3U58A 4HPPA 4CQNA 4OW0A 5FLMG 2G4DB 1EUJA 4B3SL 3GB1A 1DYQA 3K8AA 4PT5A 2W82A 1BKBA 2A6EC 4EKUA 1BBWA 1EU3A 1Q1BA 3HOXG 3A9JA 4RGMA 4FHJA 1F1HA 4K3BA 5C1ZA 3CC7A 3QAQA 4DDID 1E7UA 5T8IA 1YN5A 3TJPA 2NZOA 2Y0SG 2F0FA 4RWSC 4C56C 4GOPB 4H2AA 2MCNB 2AQ2B 3PREA 4BKGA 2BVCA 3JAME 1L0XB 3HRZC 4B3SQ 3KOJA 5G2NA 3LB8C 1Q86C 1ZOYB 4M01A 1A63A 1FD7D 3ZUNA 4ZRJA 2KWDA 1V43A 1XLQA 3HS0C 3G7LA 1HZ5A 3T1YL 1X9NA 2V0GA 4MACA 1IW7D 3ZYYX 3A4SC 5M3FH 4R9WA 1E7ZA 1LT6D 4K3CA 5LMUL 1QZGA 4USAA 4CHTB 4WIPA 1FNWA 2KCCA 1OQYA 4EE2A 3Q8BA 4QF4A 2N78A 1E7PB 4II2B 4NQLB 2K8HA 2B39A 1SBBB 2L32A 2RDBC 4DXAB 3NEMA 2QEXA 4MIUA 2YU9H 1FL0A 1RTOA 3H94A 3JW0X 4AJYB 4DK5A 1SYBA 3J80L 1UE1A 1I94L 3RNGC 2P5ZX 2RMMA 5JVG3 3A5UA 5LMUQ 2A4ZA 3HOXB 2MO1A 2ENBA 4A75A 1NI3A 5LMNW 1S1QB 4DR3Q 4NXMQ 3VR4A 3PMFA 3BIID 1VQ8A 5KRUA 3RZWC 4JBWA 1K8GA 2N9LA 2Y0SB 5KHQA 4S3SA 2MH7A 4DV0L 1SGHA 2O2VB 4XZ4A 3S2AA 2FUG1 2ZM6Q 2K6QA 5JPMC 3RT3B 2KX3A 1I94Q 3RLNA 4XXEA 1JCKB 2EJMA 3AEDB 1KAAA 3TBLD 4TQ0A 2KUMA 5G55A 1J6QA 1K28A 1E9MA 4OWTB 2WX0A 3HHMA 2F0SA 3AEVA 2VB3X 4HSPA 4AIMA 2NCNA 1I50B 4Y52H 1MI0A 2N7JA 4OZCA 2RR9A 2V1CC 3EROA 2CU1A 3I56A 3P1MA 4LW1A 2F0MA 4LUOA 1VQGA 5J1ZA 1WGYA 1H9MA 1N62A 2B3GA 2B2WC 1JICA 5JEAG 1G2SA 3BVGA 3R93A 5FJ8G 2HD3A 4LF9L 1E1TA 1K83H 2EJGC 2JA8G 1VCBA 3OHXC 4W9IA 4MM3A 4K1RB 1KNAA 1FGUA 1YJIA 4KGSA 4KGRA 1H9RA 1IBML 3APCA 3SR6A 3OSOA 3WAOA 1NMFA 3FILB 4NY0A 4CYEA 1PTOC 1LTRD 2WAQE 3ZKJC 3N32A 4MTKA 1IBKQ 3SEBA 2QDFA 2V3SA 2KBNA 3UI2A 4FHKA 1PH9A 3ZTCA 1PV4A 4US9A 1UE5A 2K7VA 2XK5A 1I6HH 3NY5A 1GO3E 2L05A 4KKIA 1SJED 1BVSA 4LK1C 1R4QB 3KYDD 2RF4A 2BWES 2REXA 1IBMQ 4XT3B 1TTNA 2C9WB 2FE8A 3ZRCA 1I42A 4YCVA 2TMPA 5IWAQ 1ILPA 2OF1A 2K1BA 3ER0A 4UY8C 5IT9L 2WDRB 5A2QE 2QILA 3I3CA 4HKQA 4GLSC 1CSQA 3S2HB 3PUYA 2FXQA 1PZID 1WTQA 4WWPA 1UWMA 2B8FA 1TYGB 1E1OA 1G291 4BXXH 4LNIA 3AE4B 3KF6A 3NBHB 1N63A 3PZDA 4TUUA 2WNMA 1JB3A 4DV5L 5BR8Q 4HK2A 5BYQA 2J0TD 3QJZA 5KYIA 1EF5A 4GN1A 3W3AA 1ASZA 4RGNA 3U7DA 5C0XH 1RF2D 2JA8B 1ZDXA 1CZPA 4BBSH 1JOKA 2JA6H 3H1UA 4PG3A 3CQZH 1SROA 2N88A 2A68C 2DY7A 1Q5WB 1T3QA 1SMXA 5HGTA 3RNAC 1IUEA 2KJRA 1EFWA 3S2DB 1V49A 1X3GA 2K28A 1FFVA 5I6YA 4JCVE 2HCIA 3HZXA 3EJIA 3OJ3A 1SSNA 4DV5Q 5LL6S 4IN3A 1XJVA 4FYDA 4LUZA 3CP0A 3N1ZC 1D5XC 1K8OA 2C5LC 5GXGB 3F2UA 2UUCL 2F0QA 2Z4IA 1RWSA 3TUOA 5JHBA 2EXDA 4G11A 4OGQC 3PO0A 2ZTDA 1NBWA 4GDLA 1F9SA 4KDLB 4KHZA 4D2KA 1SE2A 2BT6A 5C4XB 1WVLA 5CC4A 2QA4A 4XQQA 1CI3M 2J7QB 2N9EB 3GV3A 1HZ9A 1X3EA 3IVFA 3WANA 3D32A 3CSFA 2EYLA 5GQOA 2PZTA 3PZ8A 1GC6A 2VXWA 1WJNA 2UUCQ 2NUCA 3GTPH 1XMQL 4PZ8A 2L3ZA 1KNEA 1Y14B 4HIKA 3SE0A 2C60A 2ZJDA 3O65B 4HJ8A 1XX8A 4KKTA 1VQPA 3TEZA 1WE7A 2LXJA 3Q24A 3DVGX 4I6LB 4KTAA 4OZBA 4F7ZA 2CHXA 2I5HA 4HTHA 2E2HH 1LACA 1C4QA 4IFDI 2VZAA 2OOBB 2ACZB 2F0LA 2NVTH 1XMQQ 3T4AC 4DWFA 4LUVA 1LGRA 4FVMA 2QEJC 4IO9A 2F4VL 2GMIC 1JWMD 5EE3A 2UU9Q 1KJTA 3MHSD 1ZEQX 3A1QA 3EVQA 2BH2A 2Y5PA 5HHDG 5EAYA 1FR3A 1V9JA 2DGYA 1J7BA 1F77A 2FCSA 4K5VA 2L0TA 1JWAD 1TXYA 2CJNA 2EMSA 3MFGA 1VQIA 1K50A 1UEAB 4NW2A 4A3MG 1M90C 3CCRA 1C3TA 4K2KA 2OQ0A 4JG2A 2CS4A 1T5XD 1JB7A 5J18A 2N49A 4C7ZA 2WV6D 2F4VQ 2MJEA 4WH4A 1D8LA 1F2MA 4GLVB 1YJ1A 2W54A 1N8RC 1HFGA 1OFFA 1YQ4B 3M7NA 1Q8KA 1VD2A 3H7PA 3ZGZA 3N1YC 4XDCA 1SF0A 2MHJA 4AH6A 1AE2A 5DEHA 1G91A 1JWBD 3ZO5B 2KFKA 1OTRB 5L37A 1T9HA 1EZ8A 4A3JG 1PH4A 3CCJA 2ZPYA 3HM3A 4LNFA 5D94A 4N8FA 2FHTA 2K8BA 2KDFB 2MJ3A 4MJSA 1EY5A 3SDLC 1TWHH 2CH4W 2SNSA 4OHJA 2MX2A 1FNUA 4DKAC 1B8AA 2HHHL 2RHQB 1J5EQ 5IP9H 1EM7A 5JZEB 4OO1H 1JALA 4KSLC 5G5HA 3U2SC 3GTLH 3EN2A 1VS0A 3NVWA 3ZNHB 1KRHA 1WZ3A 4HRSA 5KIXA 3ZDTA 1CKNB 1NEKB 2G1EA 3H3VC 2KN4A 1UBQA 2WLBA 5IGDA 3ERQA 4P16A 2MNAA 4ABNA 2IX3A 1EQTA 4A3FH 2WIIB 1KRTA 1G2TA 4KJOA 2HQLA 1EF1A 2WB1G 3NJTA 4A3MB 2MSED 3S14H 4ILWA 1PLFA 4GNXB 3L16A 3X23A 4NPSA 4KMUC 2JK8A 1GC7A 4XQJA 4A3IH 3KBXA 4OVUA 5LXIB 2VNUD 1E90A 4DK1A 1P0RA 3L13A 2I5LX 4A93H 1M4VA 1TS4A 4WWOA 1AWDA 1BCPC 1K83B 5BN4A 1LTTD 4FO2A 1VF7A 2JYOA 4IDIA 3PSIA 1KTKA 1S40A 3Q22A 1V6EA 4A55A 3I90A 3MWYW 2CW0D 4A3JB 5J17A 3E0JA 4IFDJ 2J7ZA 3PIP3 3SK8A 2M4NA 4MNOA 3DHIC 1PTOF 1SEBD 3Q3OC 1TWCH 1A3VA 3KUDB 2R2OA 1KQSA 3KBGA 1SDFA 2BYTA 3A0JA 1YEZA 5CV9A 3GDEA 4X66L 4G7HC 4BY7G 2NVQB 2JXTA 3L08A 3N9YC 4WJPA 2BE5D 1TKEA 2R7FA 2Z1CA 2FINB 1CA6A 4RH6A 3OIQA 5C5MA 4PMWA 1P16A 4LFBL 1Y8NB 4DUZQ 3DBSA 3VYRA 2K32A 4FF4A 4EQPA 4X3UA 3CCEA 2N4FA 3KWVA 4JI7Q 2PO4A 2D10A 2O6VA 4M8NA 3VVWB 1L1OC 4CHKA 2ONQA 3D3RA 3DM3A 2XRSD 1O7IA 3E9IA 4U68A 4C3JH 2WB1B 1KM7A 3EUB2 3Q0AA 5ELEA 4WAAA 2C35B 1NCVA 3D0FA 4K6LA 2A5HA 1EL0A 4L63B 1WR1A 2DX5B 4GKJL 4FF2A 3O13A 1HZAA 1HA6A 2GBJA 5LNK1 2AUKA 1FXIA 4JYAQ 4LNKA 1QF6A 2UWQA 1IZ6A 4J1MA 1B70B 3WALA 1SMYC 3UI3A 1EIHA 3HFZB 1ZGUB 2NYZD 5ELBA 1ILQA 1TIID 3CQZB 4LF7L 3BK2A 1E10A 3VFKA 1QOHA 2ZTEA 3PIPA 2K1FA 5D3IB 1EY4A 3BS1A 1CHQD 4JI6L 1PFNA 1WMHB 1X1MA 2EE1A 3E6ZX 2IDYA 4N9F4 5H1SE 3WOFA 1Y1VG 2B29A 1Z47A 2JA5H 1QOGA 1WGHA 2KOLA 3M4QA 3NE5B 3C19A 2A1AA 1NAPA 4LFCL 4BY7B 1Q1EA 3PTFC 3H09A 1U4AA 2D62A 3E5SA 1SFOH 4XYOA 1S5ED 3VXWA 2KHJA 3CHBD 4P74A 1PGAA 4JQWC 1F0ZA 1FXAA 4X3KA 1TKWB 5AUIA 5EKKA 2LWPA 2JA7H 2Z9HA 2D11A 4KV2A 2GI9A 2AWTA 3RNBC 2NBWB 2O5JC 5FLXE 1NJIC 1SNCA 3ZW3A 5EKIA 1V81A 3RN9C 2IWHA 4LFCQ 1PMRA 4JI1L 3RZDH 1WSPA 3OMGA 1AFPA 3AE8B 5BN3A 2M19A 1F9PA 5FOBB 3JC66 2JWUA 3WA0A 1PRTF 2K25A 2X8XX 1CA5A 3GTPB 4NMZA 3KK7A 2KDMA 3P2BA 5C3WA 5CHWA 4H7BA 1FFUA 1UELA 3VR9B 1O7YA 1WFQA 1QVGA 4C3HH 4UP8A 1MBYA 3T13A 4MSMB 1VQFA 4TKNA 4IW0A 3T16A 4B9WA 2MHVA 1WXQA 1RAXA 1EQVA 4H44C 3IL8A 2NPTA 3VYTA 5IP9G 4AYBE 3L9AX 2E2HB 2F0IA 5I6WA 3R66C 4WJNA 1SYEA 2C9OA 1F2LA 1BR9A 3TDQA 3VYUA 3LNNA 3KLSA 1J7CA 4LNOA 1Y1VB 3L0OA 1FM0D 1ET6A 2MPMA 2EJFC 2VQEQ 1QKZA 1LT5D 2F0UA 1QT9A 5J3BA 2LGDA 5CMDA 3RYTA 1V1PB 1O78A 2EYMA 1JORA 1K73C 4L5RC 4YTNB 5C3EH 4Q0FA 4GZYC 5EE0A 2AEHA 3IAS1 3QQ8B 3TS0A 2LVOA 2JPHA 3K5NA 4YWMA 3IFWB 1Y1WG 3N3KB 4KX6B 5COYA 3KUPA 2IGDA 4DDGD 2LKVA 4B3TL 1T0YA 2E75C 1EWIA 1M8AA 1BBXC 2INCC 2KWUB 4A3IG 2M1MA 2FAZA 1WZ0A 2KTRB 2DYMA 1EIGA 4ARIA 1PFSA 4A93G 4L5SA 5HGQA 1FRRA 3WDNA 1RCVD 2YTYA 3RFZB 1MG4A 2PW5A 3AE3B 1XCQL 4YCUA 1VMPA 4JI3L 1GAQB 4ZRZA 5MPOA 3BZKA 4KY5A 1ML0D 2JE6I 5I2YA 3NZUA 2SEBD 3UQAA 2C7MB 1N9WA 5D6JB 4B3TQ 1XNRL 5EJWA 1WI0A 2D2QA 3JSVB 2CH4A 3A7AB 4H13C 3NRZA 2XRQD 1IXRA 4HMIA 4PMBA 3VR2A 4DAYB 4JE3B 2W3RA 4C3IG 3AE6B 3Q8EA 3NK9A 4KY7A 3GTLB 2DZKA 5M3MH 4IUTA 1EIYB 3PF5A 2ZM6L 5IGGA 2LXCA 4X65L 1W6JA 1JMLA 4UPAA 1D1IA 2LMCA 3RUZA 2NN6H 3ND8A 4DBGA 1O80A 3QWNA 1XNRQ 2EPBA 3QIAA 2HIVA 4A3FB 3ULLA 3NUHB 4DAMA 1UWXA 3TCAA 4C3JG 1ZE3D 4W9LA 1Y1WB 1SIFA 3HOXH 2B2YA 4WORA 3S14B 4DNTB 1OEYA 4KKJA 4YWLA 3SU8X 3LXFA 2F3WA 3MEHA 3TN2A
chains in the Genus database with same CATH topology
2IX1A 1FRDA 4WFN3 5D65A 1ZUD2 2K01A 4FNFA 4A3IB 2MUYA 4IFDG 5JOBA 2BB6A 4A93B 1B4OA 1ZKOA 4XWTA 3TP6A 4HSVA 2QKIC 1KABA 4EQOA 5C3XA 3IT4B 2WXRA 3A8KE 2NB0A 2LUMA 1TWCB 2Y5CA 1V97A 2KVMA 4C3IB 5HI1A 2I2YA 4O1NA 1H9SB 4G7OC 3FDTA 2KA7A 1SE4A 3L3OC 3H91A 3J81L 3N6RA 4IUUA 3MXNA 4K8IA 2RPVA 3I73A 1STEA 4YTMB 1GUTA 2F0WA 4C3JB 5M5WB 2L83A 2L12A 3SDZA 2WDVB 2C5CA 2WXPA 1E0ZA 1FCCC 1ZXHA 1MSGA 2L1BA 2RKSA 4B0EA 2VZKB 2YYZA 4C3HG 3DWAA 3TMEA 3IXSA 3Q69A 1TR5A 1ROEA 4A6QA 3SXHA 1F2RI 4WJWA 4LTUA 5M5XB 1TY0A 3M3YB 4NP5A 4J8QA 4HCEA 4GDKB 1ACCA 1CZWA 2N0SB 1F2ZA 1XYIA 3U9OA 2JYEA 3CWIA 2WXLA 3CIRB 1YNND 1JRPA 5J22A 1LTAD 1X32A 4REZA 5JEAH 3AE1B 5E4WC 1IBXB 3MXGA 2JA7B 4XWWA 3P42A 1SB3C 2O2LD 1QOAA 4FXGC 1J7AA 1VDZA 4BA1I 1T6BX 1IHZA 3RZDB 5DM63 2KJXA 5E6JA 2IPKD 3GO5A 2L4NA 1I4GA 1JWSD 3T3NA 3A8IE 2QIEB 1AN8A 3LYYA 3MXUA 2F3WA 4C3HB 1C4AA 2HDMA 3QG1A 3FPPA 3V2TA 3X3NA 2BTEA 4HR7B 1SXTA 3K5OA 2HUGA 1WCMB 4U673 2AWNA 1IW7C 1F2YA 3R2IA 5CV5A 1LT3D 1EU4A 4BS9A 1F2RC 1YJJA 1GUSA 5ELDA 2K3UA 4XYQA 3AMZA 1O7ZA 2PVGC 5C3EB 1FCLA 1TVXA 1PUTA 1Y69U 3AEAB 3IFDA 4ULLA 4L6TB 1DCZA 5HURA 4R8NA 1LV9A 4M0WA 1Q8IA 2K05A 4CKBA 3AV8A 1FGBD 1HQMC 1NYQA 1HUMA 4CBVA 4N6EB 1EY7A 2BB5A 1Q12A 1S5CD 3K59A 4IOIE 2XSCA 4O42A 2GRIA 1KDBA 1CM9A 4XIGS 2DY8A 4TKOB 1HTLD 2I46A 2ICEC 1DGJA 5E1FA 5J39A 3DWQA 4YXDB 3CRLC 3DEPA 1GXDC 3TSSA 1E2ZA 4YSXB 4A8XC 5M3MB 3MHBA 1EYDA 5KEEA 1BUIC 1XF5L 1QE6A 1D6EC 5F2DA 1OO9B 5CV7A 1G8ZD 4OZAA 5CBEE 1K53A 2YEPB 1P7FA 2NBFA 2A6HD 1C76A 4KK7A 4RGOS 3ONAB 3PUVA 1LT4D 2A69D 3VRAB 1JE4A 2JEBI 2QJLA 2INNE 1AEXA 1C48A 5BYRA 2A6ED 4NKLA 2B8GA 4YTPB 3AE7B 2J52A 3AM9A 4QB4A 3BVZA 1GPXA 1GHJA 4ODGA 1ZYRD 3AB5A 4Q2JA 3HOZB 2MJ8A 2Q8IB 3IAYA 1JW9D 1DZ1A 1B9RA 5BN5A 1E2VA 3NPPA 1CQFA 1DONA 3CRKC 4X3TA 1MVKA 2H88B 3I9V1 3BYTB 5EBCA 4HEA1 4RGTA 3S1MB 1B50A 4ZYSA 1PFDA 4Q5VA 3OWFA 3K5LA 4KGTA 2LHEA 2WU2B 2CJOA 5IGBA 3P63A 2QMTA 2J53A 3OMCA 5IGFA 3BDLA 3NTIA 1OQQA 5EPJA 1RDPD 5I9PA 2IW3A 3HG9A 2WXMA 5DM73 4KD4A 4A3KB 1TU2B 2WKCA 1AW7A 4V190 4BWGB 1VR9A 2WAQB 5DAUA 4WURA 5C2TB 3BK1A 2K04A 3DM1A 2SNMA 5IODA 2R7ZB 3SFDB 2F4IA 1A3TA 2L5TA 3K0YA 2IT1A 5HG2A 3D8GA 1TS5A 2JP1A 1WRIA 1AP0A 3GTMB 2EYFA 2W55A 1JROA 3FILA 1SNOA 2F1MA 2INPE 2WXGA 3ZJTA 2BS2B 1ET9A 2ZXOA 2DYOA 2WXHA 2OEOA 3D6CA 5EPLA 2WS3B 3TZUA 2CHBD 1PRTC 1L0YB 4N59A 1ENCA 4A3BB 4QUCA 1BO0A 1C4CA 1LTGD 1STNA 1QCBD 4YWGG 3PO2B 1UGJA 1RKNA 3E9SA 3NBHA 3VYSA 2CQAA 4MH8A 2EYHA 4CKCA 2MGSA 2DLBA 1SJHD 5FK9C 4OVZA 2J42A 3ZJVA 2A68D 1PYWD 3MZ5A 1WTPA 1L4DB 3Q8FA 1HPCA 3S1QB 2ZXRA 1TS2A 1WTRA 1XXGA 2E76C 1N5WA 3GD7A 1EY0A 2SOBA 3HOWB 3I8ZA 5JPNC 3DHQA 1KH0A 4LLGM 3SK5A 2D2CC 3B9JA 5DNFA 3IFTA 1J9OA 3RD4A 3P4PB 4TMAB 3GP7A 1S4ZA 3FVQA 2ON8A 2PIAA 5CGKA 1XCTL 3TP8A 4DQOC 2A73B 1K8MA 3B2FA 3NWTA 4JPSA 3VQIA 1NSNS 2EYJA 4DN4M 4RA8A 1B53A 4DK0A 3S15B 4ZKCB 2F0DA 1T5EA 1QNUA 5KYLA 2DN8A 3HP3A 3J80E 2PZWA 3KQ4A 1JWUD 4US8A 4RFBA 1CFMA 3OWEB 3M85A 4QMGA 4UDUC 4E6IA 1K51A 1SYGA 2JZPA 2ZXPA 3QJYA 1XWEA 3NQIA 1J8IA 1HA5A 1EYAA 2PKOA 2RDFA 1C77A 3QO2A 4XT1B 1BNZA 2LJIA 2OEDA 2RVLA 3SHLA 3M4YA 2WP9B 3RPFC 4AQ7A 2EYPA 2NVYB 1JQ4A 1MGSA 1EEID 3EQLC 1ZXTA 1A3UA 2K6AA 4K2LA 2JSOA 1MHXA 2VZKD 3VR8B 3SR1A 4IFDH 4KHVA 1YN3A 1A6XA 3VRBB 4DFAA 1U4MA 1FMAD 3PUWA 1TY2A 1GOZA 2MP1A 3S1RB 3VR3A 1WD1A 2LFNA 3I4NB 1V8CA 4HEDA 3VA5A 1QLBB 3U52E 4L2YA 5FR3A 1BDOA 1TQOA 1NYRA 5IT9E 1IGCA 2F0PA 1CZGA 3AEFB 1PTOB 1TKGA 1BUVT 2R93B 3HOVB 5FO7B 1YNJC 1HCZA 1NR2A 2M56B 3Q6SA 2X69A 2R61A 4HAEA 5T1GA 1QG7A 1XLNA 1IKMA 4XTCS 2X38A 3TP5A 2LY7A 5CBAE 4ZRPA 1VJKA 5C6AA 3PUZA 2HDEA 4K6DA 2V4DA 3NVZA 5C3JB 1STYA 1OQRA 1D4BA 5G3LD 2ICIA 1XEEA 2PLPA 1SMYD 4IQZA 1PZJD 2BW2A 3P4SB 3NQTA 5CR3A 3HUIA 4P2CB 1JOQA 1KLUD 1E0BA 2FFKB 1BXTA 3JAML 2F0NA 4XDDA 5EE1A 4A90A 3P75A 5ISRA 5E3FA 3J7AV 1IYUA 1HFNA 1STAA 1B9MA 4DXFA 4IALA 4DNRB 3HOUB 3A55A 4AYBB 4ARCA 2L55A 3ZQ4A 1IKLA 4DXGA 1MHHE 2XWJB 1LO5D 3SFEB 1P7EA 3C1EA 3DMUA 4IURA 2B2VA 1PFMA 3I72A 1MD2D 2Q8TA 4LJZC 5ELCA 1I4HA 1TT2A 1I4RA 4KKSA 3EFXD 4DU9A 1HRJA 1U4PA 4IUNA 1GUOA 1K52A 1SNMA 2M0AA 1OXXK 1XTCD 3X3MA 4EGVA 1QILA 2G9HD 3V3XA 5EE9A 1A2UA 5BMHA 5EPKA 2KQ4X 2H1EA 2E2DC 2BDNA 1V1PA 2EY2A 2QSDA 3NHHA 3VR6A 1AZPA 1GUNA 3MTSA 1L4ZB 3C8YA 3AMUA 3A56A 3FKIB 2PPBC 3L7ZC 1A70A 3Q8AA 4DAVA 4K14A 4C7YA 3K57A 4B9XA 3PIO3 2RBMA 2NMQA 4PNYA 4DAYA 2M00A 2D9UA 5D3DA 2X6LA 4J3OD 2RSOA 3NVVA 3P4QB 1TS3A 5K5PA 3PV0A 5FO8B 2W3SA 5A2QL 1PXUA 2B2UA 4ME5A 4L1BA 1GUGA 5TSSA 2HDLA 1D5ZC 5EQ0A 2Z4HA 3D6WA 1U9RA 4JK1C 4KY6A 1ZPSA 1EWCA 2HCCA 4CJ2C 3C3LA 1JQYD 1MPEA 3NSWA 2OHFA 1R7SA 3GV6A 4ZUJA 4FF3A 4ZRQA 4RAUC 1ZDVA 1BCPB 2WQYB 2XWBB 1U4LA 3K7AB 5LL6X 2J4XA 1EWHA 3I70A 2EELA 1JC7A 1Q90A 3RMHA 5FKAC 4KV6A 3V05A 1BMLC 1ENAA 1WTOA 3I57A 2AQ1B 4K5WA 2WXQA 4DF7A 1H9SA 2DBYA 1GUWA 3GTJB 2E6XA 3PO3B 1TZOA 1VZ7A 4Y7NB 4C2MB 2K03A 1L6UA 1SSOA 2LGIA 1VDVA 4LK0M 4ID6A 4ZK9B 4BY1B 3H8HA 4YSYB 3S1NB 2PNRC 1L6VA 4F7XA 1ENFA 5I9OA 3U9SA 4C1NK 4N9TA 2QCPX 2NWGA 3ITPA 1QOBA 2KACA 2B76B 1TJEA 2BOSA 2A6HC 3DWMA 4RHSA 4K8JA 3FAHA 1OXTA 3M4OB 3AEGB 2XIWA 2BS4B 2AX5A 1IBXA 4DAPA 3PZ7A 2H89B 1RTNA 1SE3A 4C1NI 3LWUA 1Q10A 3MP9A 3GTGB 2EXZA 1ONLA 3DXJC 3T3OA 3MVVA 4FF1A 1ZYRC 4JWUC 2A74C 3D31A 2JU6X 1TWFB 3NWSA 5C0XI 1N61A 1C4PA 2K5PA 2ZW1A 1B3AA 1B2TA 4ZKBB 1EWYC 4QCLA 1QWYA 3T53B 3I4MB 1EY9A 4RCNA 2DNCA 3M7GA 1TWGB 4MM3B 4JX1C 3AEBB 4NZLB 2I38A 4X3SA 3B2GA 1UNSA 1FYCA 4XDXA 1D2BA 4N58A 2PYKA 3VR5A 1BOSA 2AQ3B 5C5LA 4A3GB 2K0PA 4M8AA 2ZW0A 1B1ZA 5H92C 1HUNA 1RD9D 5A35A 3N52A 2EKIA 4ITKA 1CTMA 5C4JB 3K6OA 1NR4A 3NTHA 3HVZA 3P20A 3AECB 3GTQB 5ELFA 3Q8CA 4HN7A 1MI2A 2NZ1D 1W6KA 3NXWA 4F8MA 1PDXA 1D5MC 1EOTA 3BVMA 2WINB 3MFYA 2SAKA 3NZ3A 1SNDA 4JWSC 4DGZA 3NP8A 3V96A 2JYTA 5K36G 1DXMA 1HEZE 2JX5A 2Q8RE 4H0LC 2R3ZA 4IUPA 4R3DA 3OOCA 5AFWA 1IL8A 1F9RA 4R8IA 3SVMA 5C44B 1MSHA 3P1HA 3GTOB 2O5IC 2G9DA 4UAIA 4ZUIA 1L5PA 4GDLB 2FMMA 4KKUA 4A3EB 2B2VC 3A7LA 3SK6A 2KEEA 1ESFA 5C0XJ 3J81E 2BDOA 1KDAA 1SYCA 3W5UB 4XE0A 1RM6C 2SDFA 2Q5WD 2WXJA 2V3NA 2XVSA 4OO1I 4EQNA 3P7JA 5JJZA 3FEWX 3TZDA 4WAFA 4RKBA 1Z6HA 2B2YC 2F3VA 2PMZB 2IGHA 5C4ZA 1JOOA 5FLXL 1DOIA 3ND9A 3OW7A 1TWAB 1R9TB 1CK1A 3S9WA 3NBIA 5D14A 3P4RB 1JR0D 2LHDA 4YT0B 4FXDA 4WQMA 1PTOD 3BG3A 4HKZE 1PTOH 3I4LA 4ZQ3A 4F88A 2F0KA 4PMCA 1TKYA 1F9QA 3J9CA 3KLSX 2X6GA 2Z8LA 2WACA 4HCSA 1WYGA 3AE2B 3QOJA 4IUQA 2D5GA 3TEWA 3KF8A 2JEAI 1UAPA 2E2IB 1X3PA 4CJ0B 3R2TA 5D7GA 1SIJA 4KD3A 5KNDA 2LEKA 1WGKA 1R4PB 2PCFB 2OXPA 1L0VB 4PV1C 4BBRB 1XLPA 4V0BA 1E2WA 1DOLA 1D1KA 3BDCA 5JAVA 1DD2A 4IZ8A 3AU7A 3EGRA 3DUZA 1RJTA 1C79A 1OXVA 2B2UC 3VA7A 3MHZA 3EA6A 2WXNA 3OIPA 5JXVA 3FPUB 1H9JA 1G6ZA 3NVYA 1S5FD 4A9AA 4XQNA 5AUKA 3FMCA 3HEJA 1SYFA 1HQRD 2HQEA 4KI0A 4IUVA 1EY6A 4G7ZC 5G5GA 1VZ6A 1CT1D 1WWTA 3TEYA 2B2TA 3AE5B 2EDGA 2I07B 5M3FB 4HJGE 3TP7A 2CW0C 5JVH3 1FIQA 1Q3LA 1PGXA 2NTTA 1PRTD 3D4RA 1WTWA 5BMGA 2F0OA 1CJEA 3K58A 2CVRA 2QF7A 3H0GB 1Y8OB 1ZXIA 2WXFA 5HFYA 2YU9B 2BE5C 3AE9B 1EZ6A 5NUCA 1QQRA 4MT5A 1U4RA 1B9NA 2FBWB 1I4QA 4L23A 2KECA 4YSZB 1FD6A 3KWLA 2F0GA 2EOTA 4F87A 4FXKC 2NTSA 4NDXA 3I91A 2WXIA 5EKLA 2VUMB 2TSSA 4LMQD 3HRDD 2H4OA 3IAM1 2B63B 1A2TA 3TBIB 2RQXA 3PUXA 3W1SA 5KNBA 3IKJA 2N9KA 2IJ0A 1KFYB 3BYYB 1EYCA 2EVBA 3CKIB 4KN7C 3LWEA 5CORA 4FXCA 3MA2B 5IIFA 1SAPA 5KNCA 2HTME 2QDBA 2XN9C 1FEHA 1II3A 4ZHOA 1GB4A 2VB2X 3QB3A 5C0XG 1AZQA 1I4XA 4TSSA 2F0JA 4B0MA 2BBCA 1SNQA 1KF6B 5FO9B 4N9PA 5BYSA 1A15A 1WTVA 3CU7A 1SYDA 4HROA 3MXPA 2PW9A 2MJDA 1I6HB 1DOMA 1QOFA 3A8JE 2BA0A 4I7ZC 3AEEB 1STGA 4RNAA 2LFIA 3GQBA 3D4WA 2RDHA 1LTBD 4IKGA 3C2PA 3ABVB 3RZOB 2GB1A 2K5DA 1XO3A 4BA2I 4ZAIA 2NN6I 1PZKD 4DA2A 2CU3A 4WWMA 1PGBA 3GTKB 1BCPD 1NVID 3U4EG 3MAQA 1OXSC 1Z7TA 3Q23A 2L9HA 2WKDA 5C4HA 2JA6B 4BBSB 1HZ6A 3SK4A 4L8JA 1N60A 4QUFA 1B44D 1VCIA 4MHEA 2ID0A 1C9FA 3R8BA 3DEOA 4MN3A 3W5VB 2R6GA 5T1IA 3AB9A 2EY5A 3GS2A 1KLGD 2FMCA 2NVXB 1I3QB 4AS1A 1FNVA 4HMJA 3QOLA 3DWPA 2IX0A 4CGYB 1AYFA 4KJNA 3W2DA 2PMVA 2F03A 2L52A 2GA4B 2PW7A 2K33A 3BWUD 2LMCB 1RODA 3NS1A 1YQ3B 4OIKA 4B08A 4RHRA 1RFKA 3ZJUA 5CV8A 1S5BD 4OL7A 2K9XA 3C46A 4G4KA 5CYUA 3AH7A 4TRDA 2V4IB 2JXMB 4OO1G 1DOYA 2F0TA 2RSNA 1VF5C 1NENB 2B2WA 2MEKA 2NVTB 2WU5B 5IGEA 4RKLA 2O4XA 3RLFA 4LAAA 4P6VF 1LTSD 2M2LA 3HKZB 2WXOA 1ESRA 1DJRD 5CV6A 2PTLA 4G57A 2OT2A 2F0HA 1YNJD 1C8CA 1I6VC 1O7LA 1PRTB 2V3PA 2XNAC 1NUCA 1FO4A 1EFID 1RHPA 4ZHPA 2ZT9C 2LS01 1UUPA 4CJ1B 3DWGC 3HGBA 3BZDB 4A3DB 2M9VA 4TQUS 3WCQA 1OXUA 2EY6A 3R3OA 5CV4A 3E56A 3FRPB 1HTPA 3URYA 1TWHB 3MJ5A 1EEFD 5EBDA 2PQEA 2WDQB 3WOEA 1GHKA 2F0EA 2AWOA 1BF4A 2EYOA 4NAMA 5I2XA 3J7AF 2KQ3A 5I4DA 4NAWB 4NJCA 2D5DA 2Y3AA 1YN4A 1GJXA 4KN4C 1VMCA 1WD0A 3BDOA 1S5DD 1CHPD 2R92B 1VZ8A 1WTXA 1DOXA 1YNNC 2FJ2A 1BCPF 3FC4A 5M5YB 1XLOA 2PVOD 3H6MA 1BQQT 2BS3B 2E2JB 1STBA 3KLRA 5M9OA 4EVOA 2EY1A 2WXKA 2K5QA 3TEXA 1LTID 1ICWA 5EGTA 1Y56A 3L4PA 1DM0B 4J6HA 2E3TA 3OPOA 1LABA 5E4XA 1GB1A 2L1AA 4I65A 1LLRD 4WRDA 2BA1A 1I4PA 1QB5D 3K5MA 4OIJA 3U7ZA 4YIJA 2B2TC 5LHY1 5KGUA 3MC0B 1PDQA 5JEAJ 4PQXA 4ZLTF 1V1OA 1RYJA 3T51B 5G3LF 1EY8A 2IL8A 3IT6B 1H9KA 4TQ1A 3S16B 1HHVA 1C78A 5IOCA 2DNEA 2KCNA 2N55A 3LX0A 2DWQA 1SNPA 1X3QA 4RF0A 1CQVA 2JA5B 1Y8PB 3D4DA 2E74C 4FP5D 2JSVX 3W9CB 1SFOB 4C80A 2PZUA 3HVDA 1DOKA 2F0VA 3NTKA 5K36H 4CKEA 1QNKA 1IYVA 5H8YE 3ETRA 3T56B 3S17B 2WP8J 3A54A 4K5XA 1VLBA 2BCOA 2JQRB 2RDGA 2KHSA 1I7HA 1HXYD 1PFBA 1V8QA 2KMMA 3HOYB 1QJOA 1E6EB 2RA4A 3NUCA 1KDCA 4RF1A 1N5XA 2KAJA 5IGCA 2IGGA 4ZOHC 2L11A 2K22A 1VRAB 2KEDA 2L0CA 1YMHE 3AN1A 4M1UB 2AUJD 1STHA 2K5WA 3J7YW 2YEPF 2EZVA 4RCOA 1IGDA 3C1FA 3G6JB 2A69C 1YNTE 4Z9CB 1ZP0B 2NN6G 5BMIA 4CQNA 4OW0A 3GB1A 1DYQA 4PT5A 2W82A 2A6EC 1EU3A 1Q1BA 4RGMA 5T8IA 1YN5A 2F0FA 4RWSC 4C56C 4H2AA 2AQ2B 3JAME 1L0XB 3HRZC 3LB8C 1ZOYB 1FD7D 2KWDA 1V43A 1XLQA 3HS0C 3G7LA 1HZ5A 2V0GA 4MACA 1IW7D 3ZYYX 4R9WA 1LT6D 4USAA 4CHTB 4WIPA 1FNWA 2KCCA 4EE2A 3Q8BA 4QF4A 1E7PB 2B39A 1SBBB 2L32A 4MIUA 1RTOA 3H94A 1SYBA 3J80L 2RMMA 5JVG3 3HOXB 2ENBA 1NI3A 3VR4A 3PMFA 3BIID 5KRUA 4JBWA 2N9LA 2Y0SB 4S3SA 2MH7A 2FUG1 5JPMC 4XXEA 1JCKB 2EJMA 3AEDB 1KAAA 4TQ0A 2KUMA 1E9MA 2F0SA 2VB3X 4HSPA 1I50B 1MI0A 2N7JA 4OZCA 3EROA 3P1MA 2F0MA 5J1ZA 1H9MA 1N62A 2B2WC 1JICA 5JEAG 1G2SA 3BVGA 3R93A 2EJGC 3OHXC 1KNAA 1YJIA 4KGSA 4KGRA 1H9RA 3SR6A 3OSOA 3FILB 1PTOC 1LTRD 3SEBA 3UI2A 4US9A 2K7VA 4KKIA 1SJED 4LK1C 1R4QB 2FE8A 4XT3B 2TMPA 1ILPA 2OF1A 2K1BA 5IT9L 2WDRB 5A2QE 2QILA 3I3CA 4HKQA 4GLSC 3S2HB 3PUYA 1PZID 1WTQA 1UWMA 2B8FA 1TYGB 1G291 3AE4B 1N63A 2WNMA 1JB3A 5BYQA 2J0TD 5KYIA 3W3AA 4RGNA 5C0XH 1RF2D 2JA8B 1ZDXA 1CZPA 1JOKA 2N88A 2A68C 2DY7A 1T3QA 5HGTA 1IUEA 3S2DB 2K28A 1FFVA 5I6YA 2HCIA 3HZXA 3EJIA 1SSNA 5LL6S 4IN3A 4FYDA 1D5XC 1K8OA 5GXGB 3F2UA 2F0QA 2Z4IA 1RWSA 3TUOA 4OGQC 3PO0A 1F9SA 4KHZA 4D2KA 1SE2A 2BT6A 5C4XB 1WVLA 5CC4A 4XQQA 1CI3M 3GV3A 2EYLA 2PZTA 3PZ8A 2VXWA 2NUCA 1KNEA 3SE0A 1XX8A 4KKTA 3TEZA 3Q24A 4KTAA 4OZBA 4HTHA 1LACA 1C4QA 4IFDI 2ACZB 2F0LA 3T4AC 4FVMA 2QEJC 5EE3A 1JWMD 1ZEQX 3EVQA 2Y5PA 5HHDG 1FR3A 1J7BA 1F77A 4K5VA 1JWAD 2CJNA 3MFGA 1K50A 1UEAB 4NW2A 4K2KA 1T5XD 4C7ZA 2WV6D 2MJEA 4WH4A 1F2MA 2W54A 1HFGA 1OFFA 1YQ4B 3M7NA 3ZGZA 4XDCA 1SF0A 1JWBD 5DEHA 1G91A 1EZ8A 2FHTA 2MJ3A 1EY5A 2SNSA 4OHJA 1FNUA 1EM7A 4OO1H 1JALA 5G5HA 3U2SC 3NVWA 1KRHA 4HRSA 5KIXA 1NEKB 2G1EA 3H3VC 2KN4A 2WLBA 5IGDA 3ERQA 4P16A 4ABNA 2IX3A 1EQTA 2WIIB 1G2TA 4KJOA 4A3MB 4ILWA 1PLFA 4KMUC 4XQJA 3KBXA 2VNUD 4DK1A 1M4VA 1TS4A 1AWDA 1BCPC 1K83B 5BN4A 1LTTD 4FO2A 1VF7A 2JYOA 4IDIA 1KTKA 3Q22A 4A55A 3I90A 3MWYW 2CW0D 4A3JB 3E0JA 4IFDJ 2J7ZA 3PIP3 3SK8A 1PTOF 1SEBD 1A3VA 3KBGA 1SDFA 2BYTA 5CV9A 2JXTA 4G7HC 2NVQB 3N9YC 2BE5D 1TKEA 2Z1CA 2FINB 1CA6A 4RH6A 3OIQA 5C5MA 4PMWA 1Y8NB 3VYRA 2K32A 4FF4A 4EQPA 4X3UA 3KWVA 2PO4A 2ONQA 3D3RA 2XRSD 4U68A 2WB1B 3EUB2 3Q0AA 5ELEA 1NCVA 4K6LA 2A5HA 1EL0A 4L63B 5LNK1 4FF2A 3O13A 1HA6A 2AUKA 1FXIA 1QF6A 4J1MA 1SMYC 3UI3A 1EIHA 2NYZD 5ELBA 1ILQA 1TIID 3CQZB 3BK2A 1E10A 1QOHA 5D3IB 1EY4A 3BS1A 1CHQD 1PFNA 2EE1A 3E6ZX 2IDYA 1QOGA 3WOFA 1Z47A 2KOLA 3NE5B 1NAPA 4BY7B 1Q1EA 3H09A 2D62A 3E5SA 4XYOA 1S5ED 3CHBD 1PGAA 1F0ZA 1FXAA 4X3KA 1TKWB 5AUIA 5EKKA 2GI9A 2O5JC 5FLXE 1SNCA 5EKIA 2IWHA 1PMRA 3AE8B 1WSPA 3OMGA 1AFPA 5BN3A 2M19A 1F9PA 5FOBB 2JWUA 1PRTF 1CA5A 3GTPB 4NMZA 3KK7A 2KDMA 5C3WA 4H7BA 1FFUA 3VR9B 1O7YA 1MBYA 3T13A 3T16A 4B9WA 2MHVA 1WXQA 1EQVA 4H44C 3IL8A 3VYTA 2E2HB 3L9AX 2F0IA 5I6WA 1SYEA 2C9OA 1F2LA 1BR9A 3TDQA 3VYUA 3LNNA 3KLSA 1J7CA 1Y1VB 1FM0D 1ET6A 2MPMA 2EJFC 1QKZA 1QT9A 1LT5D 2F0UA 5CMDA 1V1PB 1O78A 2EYMA 1JORA 4YTNB 4Q0FA 4GZYC 5EE0A 3IAS1 3K5NA 4KX6B