1BXTA

Streptococcal superantigen (ssa) from streptococcus pyogenes
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
222
Chain Sequence
SSQPDPTPEQLNKSSQFTGVMGNLRCLYDNHFVEGTNVRSTGQLLQHDLIFPIKDLKLKNYDSVKTEFNSKDLATKYKNKDVDIFGSNYYYNCKTCMYGGVTEHHRNQIEGKFPNITVKVYEDNENILSFDITTNKKQVTVQELDCKTRKILVSRKNLYEFNNSPYETGYIKFIESSGDSFWYDMMPAPGAIFDQSKYLMLYNDNKTVSSSAIAIEVHLTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (STREPTOCOCCAL SUPERANTIGEN)
publication title Structural basis for HLA-DQ binding by the streptococcal superantigen SSA.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Immune system
total genus 60
structure length 222
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bxtA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1bxtA02
1PTOF 1F77A 3EFXD 4TSSA 1BXTA 1YN3A 1KTKA 1CHPD 3KLSX 1FNUA 3BYYB 2XN9C 2NTTA 5ELBA 1EWCA 1D5ZC 1D6EC 1KLUD 1PRTF 3MFGA 1BCPF 2TSSA 4C56C 4UDUC 2J4XA 2G9HD 1PZID 3URYA 1JWUD 1I4RA 3BVZA 1SE2A 1RF2D 5D3DA 1FNWA 1JR0D 1TS4A 5FKAC 1B44D 1D5XC 1L0YB 1PTOD 3DWAA 1RDPD 1EU3A 2XNAC 1JWSD 3R2IA 1UUPA 1S5ED 1PZKD 2RDGA 1PRTD 1YN5A 1V1PA 3EA6A 1BCPD 2CHBD 1ENFA 2RDHA 1RD9D 1SE3A 2WV6D 3R8BA 1JQYD 4RHSA 1I4XA 1AW7A 1CK1A 1CT1D 1HXYD 1ET9A 1LTAD 1TY2A 1XTCD 1XXGA 3OWEB 4L6TB 2IJ0A 4O1NA 5FK9C 1SXTA 1HA5A 1M4VA 5ELEA 1TS5A 1LTBD 1JCKB 5TSSA 3O13A 4RGTA 1LT6D 1FNVA 3V05A 4RGNA 4RHRA 3DWPA 1B1ZA 5ELFA 3R2TA 3SEBA 1ET6A 1SE4A 1PTOH 1HTLD 1KLGD 2XRQD 1I4HA 4RGMA 4Z9CB 3CHBD 1STEA 1LTGD 4RFBA 1SJHD 4RH6A 1S5FD 4ZYSA 5I4DA 1SBBB 1I4PA 1HQRD 1SEBD 1DYQA 1DJRD 4OHJA 3BVGA 1FD7D 1PZJD 2AQ2B 1I4QA 1LTRD 1FGBD 1PRTC 1EEID 1S5CD 4L63B 1G8ZD 4NZLB 2QEJC 1LO5D 1LT3D 4RGOS 4DXFA 4K6LA 2XRSD 1I4GA 2AQ1B 1GOZA 4RCOA 4BWGB 1S5DD 1RCVD 1MD2D 1YN4A 2IPKD 1EFID 1SJED 1V1OA 1CHQD 1LTSD 1ESFA 1V1PB 1CQVA 1TY0A 1PYWD 2Z8LA 1PTOC 2NTSA 1L0XB 1PTOB 2AQ3B 1EEFD 1AN8A 3BZDB 3MC0B 1T5XD 1LT5D 3BVMA 1TS2A 1UNSA 2QILA 5D3IB 3W2DA 4DXGA 1S5BD 3GP7A 1TS3A 1BCPC 2ICIA 1PRTB 5ELDA 1BCPB 1D5MC 1LLRD 1EU4A 1JWMD 2SEBD 1LTTD 1QILA 2R61A 5ELCA 1LT4D 1LTID 2O2LD 3BYTB 3TSSA 3DWQA
chains in the Genus database with same CATH superfamily
2PVOD 2EYPA 4AYBG 1EYGA 2KUMA 4A3FB 1F2LA 2NCNA 3A1QB 3GE3C 3Q8EA 4BKSD 4DV3L 2FINB 4WQOB 1FCLA 3R7RA 1WZ0A 2CW0C 1P9DU 2MGSA 3HOVH 3HOWH 4R8NA 2F0PA 1FXIA 3A55A 1PRTF 2W82A 1E0BA 3M7GA 3KBXA 1J5EL 1P7EA 1YHAA 3P1MA 4K2LA 3X3NA 2J4XA 3OJ3A 3V60A 1J7BA 4A3FG 4JWSC 4X66Q 2NS5A 4BKSA 4G4KA 5GXGB 3TL5A 5D3DA 4JYAQ 5FKAC 3NWSA 2YTXA 4GDKA 1L0YB 2NVQH 2OEDA 2Y3AA 1TWFB 3S17B 1BUVT 3AULA 2VZKD 2A74C 1TWCB 1RM6C 2LZ6A 4R4TA 3OMCA 1DOMA 4IUVA 2JUOA 3EQLC 2DYOA 4K7UA 5JEAG 5JVH3 2MBHA 4XXEA 1CUKA 4H2AA 1HNXL 4ANVA 5FR6A 5A2QL 3T4AC 1SROA 2AWNA 4ZKBB 2K1FA 5FLXL 4DR1Q 3RN5A 2WKDA 1IBKQ 1CT1D 3VYSA 1SFOH 4POFA 4JW0A 4J15A 2R92H 3CCMA 4FF3A 4W9CA 2XVSA 1JCKB 1SYGA 1A5RA 5TSSA 3DBRB 2HT1A 4AOFA 3GDEA 2DX5B 4R1JA 2QW7A 2NVXH 3V05A 4RGNA 4BBRB 4TKNA 3S1RH 2JA7B 2L83A 3GTPH 1L1OA 1GNUA 2WXFA 2DLBA 1SE4A 5CGKA 1HTLD 4GKJQ 1V9JA 2VW9A 1IGCA 3GTQB 4QF4A 4KY7A 3A4SC 4DA2A 2F0JA 4RFBA 3M3JA 1JE5A 3O65B 3ABVB 5LNK1 1WGKA 2PKOA 1K83H 2K5NA 3BVGA 4I7AA 4NDXA 3TDQA 1I4QA 1XPRA 4BBRG 1ZPSA 2A4ZA 2BS4B 4DNTB 3KUDB 2JA7G 4NZLB 2ZXPA 4IM3A 1XNRL 2OQKA 4G7OC 1WR1A 4RCNA 1V1QA 3AFPA 3DCGA 3BY4B 3T1HQ 4EZLA 3Q6SA 2H88B 1QZEA 1V80A 1SMXA 3EFCA 4DR2L 3B6YA 4EQNA 4WJQA 1IGDA 4CJ1B 3DPDA 1U9RA 1EQRA 3WOFA 5D7GA 5IYDG 4OO1G 3FILA 1TKEA 3OTOQ 1KXLA 1XO3A 3P7JA 1V43A 4JI1L 1E6EB 1NBFC 2B2UA 1ONLA 1CKMA 1YJNA 1XQQA 2PLPA 2QF7A 1L7YA 1LYLA 2D07B 3BZKA 4GN5A 3P4PB 1AN8A 3WAMA 3FKIH 4LNIA 3ML9A 2H5XA 1X3QA 3KWVA 5EGTA 5KEEA 3VR5A 1GUSA 4E6IA 4PS8A 4CQNA 1D8LA 1WJ6A 3VFKA 3I4NB 2MPMA 2N9XA 3VR6A 5H1SE 4MNOA 4BBRH 4JI6L 1Q1OA 1T3QA 2JA7H 2LXCA 4EZJA 5KNDA 4Y52H 2NR2A 5HGTA 3GTQH 4FHJA 3KDFA 1OTRB 2UUAQ 3GTJB 4A3EH 1KAWA 3QB3A 2JXXA 2EY2A 2QCPX 3BDCA 3VA5A 3K5OA 2LVOA 4Y7NH 3I4NG 4K0KQ 4IPDA 1B9NA 1LXDA 3ZJTA 3STBC 5IYDH 4C3JG 4DV0Q 3DUZA 2K6AA 3E5SA 4B08A 1A70A 2MLBA 1E9MA 3OAWA 3NENA 1FM0D 3AV8A 3PGZA 4MGYE 4KMUC 3BS1A 2PYKA 4AQ7A 2BF8B 4KHPQ 1Y8PB 1CTMA 3Q8DA 1QUQA 1WCMB 4ZUJA 2FJ2A 3Q24A 2ZW0A 1XMOQ 4KGSA 3CQZH 4H02A 3QA8A 2AMCB 2NYZD 1EU3A 3BDLA 1SGHA 2JVCA 4C2MB 2JA6B 2LGIA 2IY0B 3ZJYC 2G5DA 3DVNV 1E7ZA 4HROA 2L7RA 3PUWA 3AE4B 3S1QH 1WCMG 1PH7A 2IGHA 2RMMA 3R66C 3S2DB 4JI2Q 4WJOA 4EZKA 1VQHA 3L3OC 1PGAA 2ZCCA 3QWZB 5CV7A 2V0GA 4C3JH 3ZNID 4DUZQ 4YWLA 5IT9c 4J8QA 1NMGA 3PHXB 1VS0A 2JA6G 1ZXHA 1L6VA 3TQYA 4DN4M 3LX0A 1O7ZA 5HG2A 2K3UA 4F8CB 4ITKA 2BQQA 4IWPA 2F0QA 4H13C 4NXNL 1VQ7A 1WRIA 4QUCA 3Q8AA 1W2BA 1D7QA 1HZBA 2QDBA 4CHTB 4DK3C 1WGRA 3H3VC 4WWMA 1H9KA 3H7PB 1E3PA 3GV3A 3SVMA 3G4SA 2Z0EB 1S5FD 4HIMA 1X32A 2MUYA 3W5UB 2KX3A 4KJNA 5DPTA 2CU3A 3HVZA 5AFWA 3RZOB 4WWOA 5L37A 4WQMA 1EEID 1S5CD 3GTLH 1G8ZD 1VQOA 4K8IA 1IYJB 2JA5B 2AWTA 2BYTA 1LO5D 5J17A 4B3TL 2YYZA 1YJ1A 3ND9A 5E3FA 1RTNA 1VJKA 3RI7C 4LAAA 1TGZB 1F9QA 3RNCC 1PH2A 3HOUH 1YN4A 4CYEA 2N55A 2G45B 3KFUA 2KQ3A 2WFWA 2JA5G 4GOPA 4LDTB 1C4QA 2XGTA 1EYAA 1A3TA 4DV4L 1R7SA 3DVGX 5KHQA 3NY5A 3T3OA 2A1AA 5JAVA 2J0JA 3KLRA 2WLBA 1S5BD 3TIXA 3U9OA 4GDKB 4KZCA 1SMYD 3VYUA 2EXDA 4OGQC 4GMVA 1I42A 3T9LA 2A6HD 2EDGA 1SIFA 3A5UA 4LNOA 3EUB2 2XWBB 4FYDA 1SIJA 3LXFA 1FRDA 2G4SA 1FEHA 1T0QC 5G3LD 3TS0A 4WIPA 3QOLA 3A0JA 2GB1A 1I3QB 2IY1B 1YJ9A 3ONAB 1LV9A 3HRZC 3WALA 1YIJA 4XQNA 3K9PB 1Q81C 1U4RA 2TSSA 1N62A 3NZ3A 3N1ZC 4UDUC 2OXPA 3HGBA 2E2IB 4ICVA 3V2TA 3QARA 3K80C 4RF1A 1PDQA 3IFTA 2O5JC 4C3IB 1AARA 4NAWA 3T1YQ 1L1OB 2R7DA 2LXKA 3HFZB 2NBVB 5E6PA 4EE2A 3OW2A 2M19A 1KRSA 3TP6A 3DOWA 3RYTA 2DUDA 2UXBL 3RN9C 3AQQA 2INNE 1VDZA 2HD3A 3KYCD 3Q8CA 2H4OA 1UBIA 2YU9B 3H6MA 3C46A 5G5HA 1VQ8A 2N1WA 4IUMB 2BYEA 2LFNA 1GUWA 2MJDA 4HTHA 3CCUA 3LB8C 1GB1A 1C77A 3KK7A 3H0GH 4A3PA 1PRTD 3DXJC 3D4DA 4OIKA 1WD1A 1PFBA 2KECA 1EQVA 1A3UA 1WGDA 4UPAA 4XDXA 1XTCD 4L6TB 3TBIB 3B08A 3GQBA 2M8SA 5IE8A 1QOFA 1FGUA 2GBMA 4NXML 5ELEA 2ZNVC 3P2BA 2KN5A 3S9WA 1E7UA 2DWQA 1UZXB 4WFN3 4MM3A 1B1ZA 4IOAA 1ZXIA 4HJGE 2LMCB 3SEBA 1IZ6A 3CSTA 5CBAE 3NS1A 1RL2A 4NQKE 2WXGA 3HS0C 4BY7B 1CQFA 1SBBB 2NN6I 2KHWB 2CQOA 3VTWA 1QWYA 1HR0L 1O80A 1YITA 4II2B 1FGBD 2E6XA 1JWBD 2MEKA 3Q3JA 4A75A 1LT3D 1XT9B 2D11A 4DK0A 1WR6E 3MJWA 4J1MA 3KDFB 4N9F4 1JJGA 2I38A 1XYIA 3S16H 1TKWB 4BY7G 2MCNB 4BVUC 2N9EB 3J80E 4TQ0A 1V49A 3EFUA 3A8IE 3SK6A 4JI0Q 1JE4A 4AJWA 1K50A 4YSXB 3WAPA 3M4PA 1ISNA 1RLFA 4B3MQ 1WMHA 2O6VB 3RZFA 1L0XB 5IP7H 1MKHA 3ER0A 2MQHA 3S2HH 3TZUA 1VQCA 1M90C 4FXDA 3IT6B 1CKNA 2GLSA 1EY7A 4HRSA 3C1FA 4N8FA 2M1MA 3PGEA 4LK0M 1TWHH 4MACA 3WANA 1FJGQ 3IRBA 2ACZB 4JGHB 5CMDA 4KJOA 3VR9B 3DWGC 2Y0SE 1GUTA 3MJ5A 1LTID 5FO8B 1DGJA 4B3SQ 2C7MB 3TSSA 5JPNC 3I91A 5M5WB 2NBUA 2K39A 3PS6A 4FJZA 5LXHA 1HTQA 4RWSC 2DZIA 1SAPA 2E76C 5K36G 2BYVE 2WXQA 3PTFC 4JBMA 1R4QB 3MXNA 2BA0A 2UUBL 1LACA 4JOIA 5D14A 3A9JB 3Q23A 5NUCA 2Y5CA 2RQXA 1RFAA 4DAMA 4M0WA 4IPCA 4IALA 2G9DA 1P16A 4P6VF 5C0XJ 4C56C 2UYZB 1HJPA 2K8BA 3N1XC 3HZXA 2JE6I 4LTUA 2ZPYA 1OGWA 1UGJA 1YNJC 4DR7Q 1YEZA 5CV8A 4KDIC 2F3WA 5HKHA 3DVNU 4LK1C 1ROEA 5DPWA 1HNZQ 4HCSA 3NPPA 2L3ZA 2BB5A 3HM6X 5L95C 2ZJQA 1TS4A 1UELA 3JSVA 1EYCA 4PNYA 5EAYA 3TMPB 1WRDB 2J52A 3ETRA 4ZHOA 2EQSA 3W1SA 5LMUQ 2Z59B 2L4NA 5G5GA 1E5WA 1Z5SB 3DHGC 3VA7A 3V61A 4GLSC 1HUMA 3M7NA 2JEBI 3TEYA 2A68D 4HR7B 4GNXA 3EA6A 3A7LA 1XNQQ 4WJ3M 2V3NA 4IM2A 3AU4A 5C3XA 1C9OA 3S1MB 3M4OB 1F1HA 3B2FA 5IGEA 4Q0FA 4ASWC 4OXPA 3LWEA 1TS5A 3ULPA 3PO3G 1T6BX 2DN8A 1CJEA 4YHHL 2N7EA 3AEDB 1S4ZA 4LF9Q 2EY6A 2GA4B 1HE8A 3GTKB 4I6NB 5KNCA 1BBWA 5EPJA 2LS01 3DBLB 4ICUA 3U7DA 1G6ZA 3L08A 1X54A 2WS3B 4ARIA 2XRQD 1NVID 2WDTB 4DDID 4LFBL 4EEWA 4LNNA 3AH7A 3CD6A 1E0ZA 2NN6H 3PIOA 2K7VA 2PW7A 4UY8C 4JI4Q 4IURA 1L2FA 1SYCA 2KQ4X 3NVWA 3A5ZB 2Z9HA 3CCJA 1IYVA 3A1QA 4C7ZA 1FD7D 2VZAA 4KSLC 1PH4A 2F0UA 4DV7Q 4OX9L 3MC8A 4HPPA 2W3RA 3CPWA 4K6LA 5D2MB 2AQ1B 3LJ3A 3HUIA 3HEJA 4X62L 3N20C 2WB1E 3H15A 4NB3A 1KHIA 2F52A 5CV9A 5I9PA 4K3CA 1HA6A 3U2SC 3PO3H 3P1HA 4BS9A 3RZDB 3KVFB 2F4VQ 3S14B 4NP5A 2KN4A 2KCMA 3PV1A 3V3XA 2AEHA 2NBFA 2JX5A 4CDEC 1BBUA 2B39A 2VS1A 3QIAA 1CZPA 2IT1A 1T0RC 3APDA 4ZRKA 2JRIB 3VVWB 1EIYB 3NS8A 4DAPA 2WWZA 2E2JH 4KV6A 3Q8FA 1OXSC 4HMIA 1PFMA 2PIAA 5BN3A 1T5XD 3BVMA 1XLQA 2WXPA 4LFAQ 2VUMB 3MXUA 2UXCQ 2IW3A 3ONSA 3NTIA 1J7AA 1NSNS 3NUCA 2V4IB 1YOVB 4P71A 2JT4B 4P1CC 3I3TB 3MHBA 1YI2A 4HJ7A 1N60A 4H0LC 2W54A 3AE6B 5IGDA 1V5OA 2ZVNA 4A76A 3AM9A 1LLRD 2F0GA 1TQOA 5BR8L 1MIUA 3RUIB 2AL3A 4EQOA 4DWFA 1VD2A 2CJNA 1JB7A 3NQIA 1VCIA 3P20A 4JG2A 4HIKA 4A3KB 2KAJA 2F0SA 3QIJA 2W9NA 3PIPA 1C0AA 4IUUA 1RIPA 3FRPB 2F0TA 2TMPA 2PPHA 2B2YA 5D94A 2LGYA 2EJMA 2XN9C 2KQSA 4JV5L 2BBCA 2X6LA 4A3IG 2B63B 2L05A 2ZW1A 3HIZA 4P75A 2HHHQ 2F4IA 3SDLC 1R9TH 1IBXB 3GTMB 3VUXA 3ZJUA 5M3FB 2QMTA 4A3KG 4ALPA 4QIWE 2KOXA 1JWUD 4EGVA 3J81E 2LKVA 5C4ZA 1GUGA 1I50H 1X9NA 3S14H 1WXMA 5IKCM 2NVUI 4PMWA 2A69C 3CCEA 3LNNA 1B44D 1NBWA 3CCLA 2OEOA 3FP9A 2KEEA 4G3XB 4G50A 3QK0A 4NPNA 4XGAB 4L5RC 4S0RA 3TEWA 2NZ1D 4LNKA 1I6VC 4ZKCB 1PQSA 3DMUA 1VCBA 4MDKE 2V3PA 1Y1VG 2WB1G 5JPMC 5M3FG 4F87A 5COYA 1YD8U 1JALA 1SYBA 2D0PA 1JRUA 3RMHA 3K7AH 4RA8A 3C3LA 3MEHA 2PI2A 1RD9D 3D6CA 4LUZA 5IGGA 3CWIA 4BOSC 1JQYD 5JHBA 4YTPB 5DNFA 4DDGD 3A74A 4LF8Q 4ARCA 4DV5Q 4X65Q 2HDMA 1G2SA 3PZDA 1NUCA 1PH8A 1ZYRC 4A3IH 1G6PA 3PV0A 2JQRB 3CRKC 4US9A 1MVKA 1HZCA 2ON8A 3GTGB 2B8GA 1YHBA 2EYMA 2HJ8A 3AB5A 3C0RB 2PQEA 3U8ZA 2BPSA 1EUJA 4RGTA 1LT6D 4X66L 1WJUA 3EC8A 4A3KH 1EY5A 2K14A 2Q5WD 4NNJB 1PXUA 4JYAL 1S40A 2LY7A 2L8JA 3UIOB 4IPGA 2XEWA 4HAEA 2PMZE 1P3QU 3DDCB 5C4HA 1H9MA 4A3LG 2O2VA 3PUYA 3ZKJC 1QVFA 2A6EC 2CKZB 2K5VA 2G1EA 4HPLB 1STEA 1T5EA 3CMMB 4W9HA 4F8MA 2IO3B 3P75A 4R9WA 2CFMA 5GADC 4A3BB 1Y1VH 4OELB 1C4PA 3VRAB 4K1RB 5TR5A 3MEFA 2PEAA 3SE0A 4MSMB 2EYLA 1L2NA 1NY4A 1HNWQ 2KLGA 3RN2A 1GVPA 1IW7D 4DR1L 2JWZA 3ZXRA 4DXFA 1IBKL 1I4GA 1E8WA 4N58A 1ZDVA 4IDIA 2H89B 1S5DD 4UP7A 3RULA 2PZTA 4X6AH 4X3UA 3ZNHB 3MXNB 4EKUA 5BO4B 1FYCA 3H6NA 2EMTA 4WH4A 4DNRB 2IO2B 1HR0W 2NVTH 2XTIA 3AEGB 1RODA 2BKFA 4J3OD 5AZFA 4C3HB 4LF4L 1U4AA 1GG3A 1TIFA 1TKYA 4GKJL 1EEFD 5BN5A 2L11A 4A3LH 2A5UA 3Q3NC 1TS2A 1X6OA 2NWGA 1B70B 2YVCA 1ICWA 3MHZA 3UGBB 5HI1A 1XMQQ 2M9VA 4HJKA 2RF4A 4PG3A 3AYHB 5C44B 4C3HG 1IL2A 4F7ZA 4NAMA 1WE6A 2KHSA 3AE7B 4YCWA 3T1HL 3VR3A 5IOIA 2D3BA 3UE1A 2BTEA 1EQQA 3IHPC 2KJRA 2WXLA 5IY0A 4JI3Q 4GN3B 3CW2C 2MHJA 1QB5D 1K3RA 1SYDA 2YEPF 4BZAA 1FL0A 1WF9A 1MJCA 3U58A 4GNXB 4IFDG 1E7VA 2QCZA 4HKZE 5EKLA 3VDYA 4JWUC 4PT5A 4ZYNA 3OTOL 4OWTB 3S2AA 4NQLB 2UUCQ 3KWLA 4FADA 3P4SB 3JYUA 4LF7Q 2D5GA 2OOBB 3H7PA 2AYOB 3W5VB 1KLUD 5A35A 4A3MB 4ZLTF 2N8NA 2E75C 2KMAA 3R3MA 3KUZA 1VQEA 1EIHA 2IO1B 3HOZH 2G4DB 3DBRI 5I6WA 3W5OA 3AMUA 2BDOA 2LRUA 4LDTD 4EQPA 4GIVA 4XYCA 5M5XB 1J7CA 1RJTA 1IXRA 2NVYH 1Z47A 5IT9L 4GSWA 3UDXA 4A3MG 4GN4B 3IXSA 2KNBA 4D2KA 2F0HA 2FMMA 2UUAL 2J53A 4KSKC 1X3FA 1JROA 1V2YA 4XIGS 4K0KL 2DYMA 1UE7A 3R8BA 4OO1I 1NDDA 1P8LA 1RAXA 1PLFA 3AN1A 4MGKE 5IN7A 4DV0L 3U4EG 2HCCA 1E1OA 1QJOA 1AW7A 1CK1A 4O2DA 4QL5A 3HKZB 4KD4A 2M56B 4A6QA 5D6JB 3U4ZA 2QHOA 2RPQA 3Q6BA 4RM9A 1O78A 3PZ8A 4B9WA 1HA5A 1M4VA 2EJFC 1TJEA 1QOHA 1D3ZA 3PUVA 2E74C 5M5YB 3JAMc 3CMAA 1N34Q 2ZNVB 4QY7A 3Q3MC 2Q8IB 4KHPL 4HVBA 2LXAA 3UINB 3W1BA 1YNNC 4RKLA 1OXVA 5JJLA 3DBSA 3QQ8B 1A2TA 2K05A 1XMOL 1PFDA 3L17A 4ZAIA 4KY5A 2KCNA 1ET6A 3HKZG 1A3VA 3K7UC 5FOBB 4GN1A 1I4HA 1ACCA 1R4NB 1FD6A 2NUCA 4P7IA 4RH6A 2PI2E 1EO6A 4DR3Q 4UP9A 2B29A 4JBJA 1DJRD 3U30A 1HTOA 2KENA 1LTLA 3NSWA 4JI2L 5KRUA 2RPVA 2Z6KC 1HH2P 3CIRB 5C1ZA 3OLMD 2XRSD 4DUZL 3EN2A 1XF5L 2BS2B 1QQRA 1XX8A 2OJWA 1C78A 1C3TA 4OVVA 1YVCA 4DXAB 1F9PA 1KAAA 1VQKA 4DK5A 3BK2A 1E8YA 3C8YA 4A3FH 3T56B 2DZKA 3DHQA 4L23A 4XDDA 1S72A 2F0EA 3FEWX 3DWMA 4PYZA 2X38A 1PTOC 2K0PA 1UAPA 2DZMA 2NTSA 1QNKA 3BZDB 3R93A 1WX7A 3IVFA 1Q3LA 1EUVB 3JW0X 4FHKA 1K8MA 1Y56A 4YY3Q 1MPEA 5E7NA 3ULJA 2K8HA 3NBHB 4ZQ3A 5JEAH 3KJOA 4CO7A 2LJ5A 4ZDVA 1BCPC 2ICIA 1OEYA 2ALYB 3F1ZA 1AEXA 3A7AB 4B9KA 2MP1A 2K4KA 3N9YC 1C8CA 1PH1A 1TWFH 3S17H 2MNAA 1O7IA 1C79A 2CU1A 2ZCBA 3NOBA 2D9UA 2BT6A 3K59A 1TWCH 1KDAA 2WGSA 3MWYW 2PW9A 1HUNA 4O42A 1KRTA 5JOBA 3B0AA 3IT4B 5EBDA 3MFYA 2KKCA 5J22A 1HQMC 3I4OA 3V6CB 5A2QE 2PZWA 2LXJA 1CHPD 2LMCA 3KLSX 1FNUA 5FLXE 1ZE3D 1OQYA 1WFYA 3SDZA 1AZQA 4BY1B 3VYTA 4L2YA 4G7ZC 1T9HA 2CHWA 2G9HD 3I90A 4J6IA 4A93B 4GDLB 3SR6A 2WP9B 1D1KA 1FNWA 5IOCA 3K5NA 2O2VB 2DAJA 3UI2A 2O6VD 1GUAB 3Q0AA 4FO2A 1K53A 1RTOA 3KF8B 3J7YW 4KGTA 4LW1A 4NJCA 4BY1G 1JWSD 5KGUA 5HHDG 2K9XA 4LUVA 1TVXA 3K5MA 4NJ6A 2MRPA 3AEEB 5CHVC 2RDGA 1WTXA 5HGQA 3NUHB 5C2TB 4OO1H 4A93G 2K5PA 2MJ3A 4XQQA 2CHBD 5IA7A 3VH3B 1UEBA 1F9RA 2LUEA 2MX2A 3Q3FA 3SGIA 4BKTA 4FBJB 1FCCC 2I5HA 5C4XB 1N33Q 3E6ZX 1KFYB 1ET9A 2O6VA 1WI0A 3CXCA 2KDIA 4O1NA 2KDMA 1U4MA 1ENCA 2K6QA 1BR9A 1HFGA 4ME3A 2WACA 2QSDA 1AE2A 2JP1A 4RF0A 3WIMA 5E4XA 1CSPA 5LLIA 1GD7A 1PUTA 4FJVB 1OQQA 4K3BA 1NAPA 3T1YL 2BE5D 3P4RB 3SU8X 3DWPA 3QJYA 5C4XG 1FO4A 5HURA 2LGSA 3WWVA 5DAUA 3KW5B 3R3OA 3PUXA 3IFDA 2IDYA 3PT2B 4IWOA 4BY1H 1PYBA 1WXQA 3V6EB 4V190 3FMCA 2KJHB 2KMCA 4JLCA 1I4PA 2Q2HA 4UHVA 4OHJA 3I4NH 4NJ7A 4ACFA 2D62A 2H1EA 1WGHA 3A9JA 4B0MA 2VH2A 4L63B 1PRTC 1Q10A 2KWVB 3SHLA 1UE1A 1V81A 3I2ZA 2FCNA 2IYDB 4MEMA 4AWJA 2Z0DB 1JORA 2DY7A 3KJPA 4PZ8A 3NK9A 4JI5Q 2INCC 3I73A 1IBMQ 1WYDA 1L0VB 4GLXA 4IUNA 3H1UA 5CBEE 2KA7A 3NJTA 2L5TA 1EYDA 2DNEA 1SSOA 4HCEA 3GTJH 2N7JA 3ERSX 1E7PB 2ASQA 4O0AA 3ML8A 4K7WA 2B2VC 3HOXB 1UWMA 2ZTCA 4HEDA 5C4XH 1PA6A 1VQ4A 2C7HA 3UF8A 4KKTA 2OQ0A 4LWCA 2FE8A 3NQTA 4QAYA 2RDFA 2KZRA 3GP7A 3M63B 2WXIA 1STGA 1WCMH 1TS3A 3PPAA 3K0XA 4YL8A 3HOXG 1YHQA 3TP5A 1TWAB 5J2RA 2GBRA 3ZYYX 3AE8B 1EY0A 4C80A 1F0ZA 2KC2A 1TXYA 1F2ZA 2KVRA 3ULLA 4C2MH 2JA6H 2BOSA 3DQVA 3W1YA 1DZ1A 3OW7A 3RFZB 4IW0A 1Y14B 3DLLA 5AJ3L 1DOIA 5BMHA 4US8A 3S15B 1BBXC 3S2DH 4KY6A 1GC6A 3IAS1 1S3OA 1RKNA 2K04A 4IJLA 3T53B 2UU9Q 1Q46A 4JI0L 1YIWA 1GAQB 4B3ML 1VZ6A 2JEAI 3SFEB 2PQAB 1GB4A 3H94A 1DXMA 2B8FA 2E5LQ 1B9RA 1WJ4A 2GBJA 3HHMA 4GLVB 4DV2Q 1NJIC 3CMEA 4L1BA 4JX1C 3QJZA 1FJGL 1AYFA 2MFIA 4M00A 1DM0B 1NYRA 2R7ZB 5J3BA 1MHXA 3ZDTA 4YCVA 5LXIB 5EBCA 4B3SL 3HK0A 2F0KA 3R2IA 1EIGA 1YX6B 3HOYB 4ZRJA 4BFRA 5FJ8G 4BBNF 2R93B 3NWTA 4G7HC 3RZOH 1YN5A 2EZVA 3T13A 1ENFA 1K73C 1B2TA 2BW2A 2R3ZA 2JA5H 4HDOA 5DEHA 5JZEB 1WVLA 1NR4A 2K50A 1PV4A 3A33B 1TY2A 3IL8A 4L5QA 2M00A 4RHRA 1ZKHA 1CA5A 2IJ0A 3E0EA 2AHOB 4NMZA 2F0VA 1EQTA 4POGA 3RCZA 1LTBD 2P5ZX 4L5SA 4MH8A 3O13A 4DR7L 3E3XA 2BWFA 3KUCB 3GO5A 1MJDA 1TWGB 3CSFA 2KYWA 1X3GA 3FAHA 1F2RC 3STBD 3MZ5A 3S15H 3RNGC 4A4IA 1FVIA 4OONA 5IIFA 1KM7A 3R2TA 2L32A 1VQ9A 4CHKA 4IUPA 5IYBG 4HK2A 1B50A 2E2DC 3PO2B 2KWUB 2C60A 3QHTA 5IYCG 5LMUL 1TKGA 2F0MA 4C3IG 2JRHA 1K28A 5KIXA 1BUIC 1KH0A 3GE8C 1XNQL 4B3RQ 1AWDA 2ZZPB 4CJ2C 3A9KA 3TJPA 4B6WA 4TVAB 2N78A 1GOZA 2BS3B 2JA8B 4TUUA 3PO2G 3EJIA 2BVCA 4I65A 2OCEA 3CCRA 3KQ4A 1IBXA 2JZ3B 1SF0A 4L8JA 4RKBA 4DR4Q 2OTLA 2IGDA 1EY4A 1NNXA 2A73B 2IHFA 3F2BA 2YLMA 3TBLD 1I3QH 2NZHA 4LF9L 3NEMA 3I4MB 3NZSA 4R3DA 2KTRB 2JA8G 2Y5PA 4F1SA 2HUGA 1IKMA 4II3B 2IX1A 2KDFB 1SE9A 3JAMi 1Z7TA 5E4WC 2E2IH 2CS4A 3L13A 5IYCH 3PRMB 4JI4L 4OW0A 5IO9A 4MJSB 4PK1A 2PJHA 2CWAA 1WXSA 4I7ZC 4C3IH 2VH1A 1VQGA 4ZRZA 4DR5Q 1TWGH 3L4PA 5ELDA 4DV7L 4WORA 1V5TA 2B3AA 4XC2A 2VY3A 4ULLA 1QILA 4ZCKA 2LASA 2LFIA 1V6EA 2BGFA 4UAIA 3K57A 3PO0A 2L15A 2JZZA 1ASZA 3F2UA 2YU9H 3OSOA 1OTCA 4HLEA 4A9AA 4X3TA 4KX6B 2X8XX 4MGZE 1VDVA 2ZM6Q 4NKLA 1LABA 2F4VL 1FPYA 4A3JB 2MSED 1PH6A 1XTDA 3FPUB 4KN7C 5T8IA 3AMZA 3CAMA 4GKKQ 1ILPA 1IHZA 4G0NB 3VH4B 2CHXA 2QGQA 1YJJA 1K8GA 1YZ6A 4CKEA 1J9OA 1E8ZA 3CCVA 2F0NA 4M1UB 2I0QA 1G51A 1IBLQ 1TBEA 4F88A 4LFAL 2MHVA 1Q7YC 2UXCL 1VLBA 4G11A 2VB3X 5IP4D 1RHPA 4A3JG 3HVDA 4EVOA 3RD4A 1NMFA 4DAYB 5IWAQ 1SE2A 1UGMA 2JJQA 3U4VA 2GOWA 1KLVA 5EPLA 2PCFB 5E6OA 2F0IA 3HG9A 2EJGC 3DWAA 3DBLI 2HCIA 3SHQA 3AEFB 4JVZA 4P72A 5CHWA 3ZTCA 1EWIA 1BQQT 3WAOA 4BY7H 2VL6A 3P63A 4IOIE 4DHJB 1PZKD 3PF5A 4WAFA 2EY1A 3LGJA 2PNRC 1H8CA 1VRAB 1E2ZA 3R7QA 1XXGA 4MTNA 3SFDB 3RNFC 2DYBA 2EOTA 2HHHL 1K0SA 2RKSA 2ZXRA 3A56A 1MI2A 1WE7A 3NHHA 1QG7A 4FP5D 4S17A 1VZ8A 1J8IA 5JVG3 4A3JH 2PVGC 3TMEA 1XLOA 2KJXA 2UU7A 4M8MA 1E22A 4C00A 4CGYB 3PSEB 5EKKA 3U52E 1KLGD 3K81C 3G48A 3Q22A 1QOBA 3JVZX 1J6QA 5K36H 4LUOA 1AH9A 1NYQA 3T16A 3S24A 2IBIB 3GTOB 5C5LA 2KDBA 2BH8A 1JB3A 1WH3A 2KWCA 1KNAA 4JI7Q 3AE3B 3FHWA 5CV6A 1TZ1A 5ELOA 1EWHA 4LF8L 1NCVA 1ZKOA 4DV5L 3D6WA 4X65L 3KOJA 5M5WH 3S1NB 4Q2JA 3AE5B 4LJZC 4WJNA 2LHEA 3AE9B 1D2BA 5M3MB 1DOYA 4N59A 2RCFA 2B2WC 3MA2B 2HDEA 2DNCA 1JJ2A 1IYFA 4N8X1 2N9KA 1ASYA 1GM5A 1N5WA 3GZNB 3C2PA 1WYWB 1GO3E 1PTOB 1V8QA 3PUZA 1MJEA 1Z6HA 1LT5D 3I55A 1YNTE 4K7SA 1XD3B 5M3MG 2K01A 1MBYA 4A3GB 1JT8A 4DXGA 2WXMA 3AEBB 5H8YE 1GUNA 4CDCC 1H9JA 4MHEA 4DU9A 1B7YB 1HNWL 1BCPB 3L9AX 4ZHPA 2HIXA 2FAZA 2E3TA 4JQWC 1LT4D 1NI2A 4PYUA 3CF6E 5BYRA 4LF6L 4M01A 2I5MX 2VRRB 3CKIB 5KHOA 2RDBC 2CQAA 2ONQA 4C1NK 4A3GG 2N4FA 3RZWC 1N36Q 4EFOA 4ZRQA 4DV1Q 3N6RA 1XLNA 3GTOH 1Q8IA 2N9LA 4URKA 5KNBA 4X64Q 4DR6Q 5JEAJ 1YNXA 4HJ8A 1N5XA 1KIXA 2Q2UA 2CWPA 3N30A 3S1MH 3M4OH 2NPTB 2IHEA 1S3SG 1X65A 1RFKA 3V96A 5IAAC 3S1NH 2KCTA 1LFDA 2LWPA 4OEMB 2X69A 2MBOA 3OHXC 2QEXA 2K8CA 3J80c 5M3MH 1XMQL 1Q12A 4DUYQ 1XPOA 1HPCA 3GTKH 1E90A 1NI3A 2WXJA 3IAM1 1HZ6A 4LNFA 4C7YA 3GB1A 2BCOA 5CV4A 3MXPA 2X6GA 4FXCA 4RMAA 4R4QA 2VUMG 3H3VI 1T0SC 3J7A5 2B76B 1EOVA 4JI3L 2GMIC 1N32Q 1WX9A 2PNHA 1VQFA 3JAML 4XWTA 3VTUA 1UUPA 1L0WA 2DY8A 3VXWA 4YTMB 3IKJA 4FA6A 4TQ1A 2HQEA 3A9KB 1C1YB 1CA6A 2WXNA 3NVVA 2UUCL 1B3QA 3AU7A 1XJVA 4JL9A 1I4XA 1HXYD 2VQFQ 4LF7L 3ZNGC 2IGGA 2MQJA 1HZAA 1SXTA 5IGFA 3ERQA 1FXTB 1I5FA 4IQZA 1NR2A 3M3YB 1WTVA 3QX1A 4KHZA 1Y1WB 3M9BA 2IWHA 4U68A 3RZDH 2K32A 4YIJA 3NBHA 3I3CA 5EKIA 4JI8Q 4EQ5A 1P98A 2K6DB 1EL0A 1FNVA 1QOGA 4A55A 3KF6A 5M9OA 4YSYB 2KVZA 2FUHB 1VQBA 2B63G 2N9PC 4WURA 2WDQB 1CM9A 1F2MA 4PS3A 4CDFC 2KOLA 5DPSA 2VUMH 2INPE 1FIQA 2K1BA 2WXHA 1HQRD 1IL8A 2YTYA 4DQOC 3WA0A 1TT2A 2K5WA 4IFDI 1E2WA 1WTHA 3BWUD 1VQIA 1F9SA 2WNMA 2LGXA 3E56A 3NZUA 3TCAA 2QEJC 2O4XA 4MZ9A 4RGOS 3E9IA 4TKOB 5CR3A 4MGIE 1Y69U 2VNUD 1WY8A 4CDDC 3MP9A 3MTSA 3ZIMA 5CORA 2DHZA 4XE0A 3B1LX 2SNMA 1WD0A 4GDLA 4LF5Q 2J0TD 5FO9B 1I94Q 3UQAA 1WTQA 3Q14C 2LI5A 2B63H 2EY5A 3KF8A 2J7ZA 5MPOA 2D0OA 3G6EA 4P2CB 1EY8A 3NVZA 2MJ8A 4Q5VA 5D3IB 1PYSB 5M3FH 4DR3L 3GTMH 3DBHB 5AUIA 4DHZB 2FHTA 4QB4A 3OIQA 5BYSA 5J18A 4RNAA 2RSOA 3X3MA 1M94A 4KKIA 3PHWB 2MO1A 3K8AA 2O2LD 4K2KA 4M8AA 1LGRA 2K03A 4XT3B 4IOCA 2KD0A 4YWMA 4A90A 4A3BG 1SN8A 5E6JA 3OG5A 1STAA 4K5XA 2ZJRA 3ZLZA 1PTOF 4LFCQ 3K5LA 4YXDB 1YJWA 3GD7A 2J0MA 4FXGC 4IPHA 4AJYB 3LDZE 1BXTA 2VB2X 1P1AA 4W9FA 1UWVA 5I2YA 1VF7A 4ILWA 4GXBA 2V1YA 2V1CC 1D5ZC 2ZJPA 1XPUA 1SYFA 1BCPF 3ITPA 2EELA 4YY3L 3GTGH 1NTGA 5LL6X 2ES2A 2L9HA 2KHJA 3AFQA 4OZAA 3TEXA 3HKZE 5L83A 4YWKA 2I07B 2B2UC 2HDLA 2DNFA 4IUTA 4FLHA 1SNMA 3H3VH 2I5LX 1RDPD 2E2HB 3ALBA 3MTNB 3TRZA 1YMHE 1RYJA 4LJOB 1R4NI 4B95A 1RWSA 1VQAA 2F03A 4A3BH 2K5QA 1K8RB 1SNCA 1I6HB 4GOCA 5C44G 4OZBA 2IL8A 5LMNQ 4XYQA 4RG1A 1SE3A 2D10A 2JN4A 2KHIA 3JC66 1W6KA 2FIFA 2K28A 3BU2A 5C0XG 1FXAA 4GGQA 4OVZA 4WWPA 3HOVB 3HOWB 3UDGA 3VDZA 2KBNA 2KVMA 1SE8A 3SK5A 4AQYQ 1J8CA 3KLSA 1E2VA 3KYHC 2RVLA 3CRLC 3D4RA 2C9WB 4HSPA 2FIDA 2MBEA 1KQSA 2DENB 3DHHC 1VQ5A 1BDOA 4C3HH 1YQBA 2QJLA 3PLVA 1A0IA 1D4BA 3NTKA 1STHA 2LGDA 1PFSA 3HOVG 4X3SA 2ENBA 2NVQB 3HOWG 4HSVA 1EZ8A 1EOTA 4OWXB 2R6GA 1AZPA 1G6JA 4Z9CB 1NENB 2Y5BB 4GB9A 3OIPA 2Q2TA 1KJTA 2FUG1 4QCLA 2JXMB 4IFDH 5GAGC 3J81c 2L52A 4KIKB 2WAQE 5C44H 4AYBB 2HD5B 4A8XC 2CH4W 3CC7A 1STBA 2A69D 2PO4A 3PREA 4GS3A 2Q8TA 1N33L 2Z6BA 1TR5A 1O7YA 4N9TA 1SNQA 4OIJA 3WDNA 4HJ5A 1SFOB 2PQAA 2R92B 4BOZB 2V4DA 3UI3A 2WU5B 1HFNA 1ENAA 2OWOA 5KYLA 2IPKD 3RNAC 5DCNA 3G71A 3CC2A 4G57A 4P74A 5DM63 2AX5A 5AZGA 1V1PB 3I7FA 4K5VA 4A3DB 2LRWA 2NVXB 2VXWA 2UXDQ 4BA1I 4DV6Q 1G291 1PYWD 2BE5C 3S1RB 4TRDA 3GTPB 2WDRB 3E0JA 4W9EA 1MFWA 1S1QB 3D3RA 2R92G 3E9SA 2ASBA 4A3MH 2KTFA 1X56A 5EE0A 1ZYRD 1WM2A 1YX5B 3TS2A 2SAKA 4AH6A 3BJUA 1WYGA 2EVBA 1PGBA 3ZTDA 4QUFA 3AI5A 1M8AA 4JPBW 2AKWB 1K83B 4A3DG 1UH6A 3H09A 2SEBD 4BA2I 5M5XH 4MH0E 1QVCA 2NMQA 1HEZE 1QZHA 3A8KE 3HM3A 2A6ED 4JI5L 1BOSA 5IT9E 1IBML 4AUQC 2JA9A 2AUJD 1SNOA 3NELA 1CZGA 2ZEQA 1WWTA 4FXKC 2KFJA 1QKZA 1VQMA 1R4MB 1F77A 1QT9A 5BMIA 5F2DA 3SXHA 1BKBA 1K8AC 4TSSA 4ZK9B 1PH5A 3AEVA 1YN3A 1ILQA 2MW5A 3X0WA 1MHWC 2WAQB 3A54A 2I2YA 3APCA 1UE5A 3E9HA 1BNZA 5AEKB 4ANXA 3FKIB 2M0XA 3KH0A 5EQ0A 5J1ZA 5M5YH 1L4DB 4E71A 5D65A 1I4RA 3KF6B 3J7AF 3L2PA 2XK5B 4GOPC 2FXQA 2OTJA 1IUEA 4IJHA 4A3DH 2PTLA 2RSUA 2WAQG 3A8JE 3DM1A 3LWUA 4LF4Q 1OEYJ 1KF6B 4USAA 3FVQA 3I8ZA 1Q5WB 3FKIG 2OT2A 4K8JA 1MG4A 4IG7B 1QOAA 1JICA 5H92C 3D0FA 3SR1A 4W9GA 4A3EB 1WXAA 1Q0WB 1GJXA 4W9KA 4Y7NB 2EYOA 3NE5B 3ZDMC 1QCBD 2W55A 2FMCA 4KI0A 4MT5A 3AE1B 3P4QB 4ABNA 2UU9L 3QO2A 2KTRA 1ZUD2 4TMAB 2REXA 3PSIA 1FR3A 2WHIA 3ZJVA 4WRDA 4M8NA 5I9OA 4I6PA 1JMLA 5AUKA 1C76A 4NW2A 2K5DA 3H9DA 2E5LL 2FNJB 2MP2B 2NB0A 4MTKA 4MJSA 4B9XA 4A3EG 3TUOA 4DV2L 3I56A 3OYYA 5JJZA 5CX3A 1A2UA 1B8AA 4C1NI 1AE3A 1V9PA 1P0RA 1SMYC 5LMNW 3G6JB 2A6HC 3CQZB 4C4VA 1STYA 3VRBB 2IX0A 5FLMG 4AS1A 2MWSB 1JOQA 3J80i 4ZYSA 2F0DA 5I4DA 2SNSA 1PHJA 2KO3A 4K81A 1C48A 1FMAD 4APVA 1L5PA 4N9PA 4PV1C 3S1QB 2AQ2B 5GAHC 3UIPB 2MBQA 4ODGA 2CCZA 2L55A 4K5WA 3PZ7A 4NPSA 4EUTA 4XZ4A 1HTPA 4C3JB 2L0TA 2ZJDA 3AU5A 1TZOA 5CV5A 1PH9A 3VQIA 1WM3A 1QNUA 1RCVD 2FFKB 5JJIA 1WTPA 2K25A 2KLCA 2BA1A 2VQEQ 2LUMA 1V1OA 3MVVA 1WIAA 2JWUA 4DHJD 1DOLA 4I6LB 1CFMA 1U0LA 3NXWA 2DAFA 4DAYA 3QG1A 1CQVA 4KKJA 5IGBA 4DV3Q 2D2CC 4IWQA 2E8GA 2CW0D 3U9SA 3EGRA 4HEA1 4R8IA 1Q86C 2ZT9C 2PPBC 4LCDE 4TV3A 4GLAC 2BB6A 4UP8A 4F7XA 2RBMA 1LM8B 2I1JA 3DVGY 1V86A 1J5EQ 2R7FA 4ZRPA 5FLMH 2WDVB 1A15A 2XBBC 2QKIC 2WIIB 4A93H 4KHVA 4B3RL 1YNND 5BN4A 3SK8A 4KTAA 3GTLB 3TZDA 3OJ4B 1YJIA 1ZEQX 3D8GA 5C4JB 2KFKA 1HZ5A 2ID0A 3BYTB 4CJ0B 5G55A 3ZGZA 3T3NA 4R4OA 4YTNB 5T1GA 3ZQ4A 1YQ3B 3HOUB 2IZVB 1U5KA 4DR4L 4RM8A 2L0FA 4W9LA 3BINA 4ID6A 2M2LA 3TEHB 1HNXQ 2EIFA 4DBGA 1W3SA 3VHTC 1II3A 2WX0A 1K3BC 3VTVA 3AEAB 2FCSA 1R4PB 3I4LA 3C19A 2RHQB 4DF7A 3PF4A 1TIID 3HOUG 3K58A 2KANA 2F1MA 3VAWA 1SNDA 2JK8A 2CR5A 2W3SA 3VYRA 4LLGM 2CVRA 3C1EA 4WJ4A 2EYHA 1B4OA 1UF0A 3BVZA 4DR5L 2LVPA 2WQYB 1RF2D 1BO0A 2OF1A 3T51B 2BH2A 2WXOA 2HE7A 3HKSA 1ZW7A 2Z6KA 1K8OA 2EMSA 2WXKA 1H9SA 1CI3M 1PTOD 1TU2B 1WOCA 3TP7A 3VUWA 2EXZA 1X55A 1IP9A 2KK8A 3K9OB 3ZVVA 2ZM6L 1C4CA 2ZTDA 4IZ8A 5K5PA 2R2OA 3B2GA 1BCPD 1FFUA 2G3QB 4GKKL 4TQUS 5HY6A 4DAVA 4RHSA 1XNRQ 3QOJA 1WX8A 1LTAD 5C6AA 3LYYA 1WZ3A 5C4JH 2RA4A 3RUZA 5ISRA 1NEKB 3M62B 1KOTA 1IBLL 4DR2Q 2WXRA 4KVGB 1GPXA 3UQBA 4JOIC 5DM73 3PLUA 3ZO5B 4EOYA 5IWAL 1EM7A 1SB3C 3HOXH 1CMXB 1VR9A 4JI1Q 4DKAC 4YWGG 3ND8A 5FLXc 3MXGA 3RD2A 1GHJA 1E24A 4RGMA 1VMPA 3L10B 5IP9G 3CHBD 2OHFA 4HJ9A 4PQXA 3J9CA 1KDBA 4X57B 1BMLC 4FF4A 2I1KA 4V0BA 1X3PA 1SYEA 2D5DA 1OQRA 1DYQA 1WTRA 3H0GB 4HKQA 2R7ZG 1N9WA 2F3IA 3DEPA 2DGYA 2ZTEA 1A63A 3I5JC 1TWAH 1LUZA 1Y8OB 4JI6Q 4RCOA 3EIVA 4A3CG 2NPTA 3M4YA 4N6EB 1WJNA 2QDLA 3HOYG 3FKYA 1UBQA 3W1SC 4ME5A 1CSQA 1RRBA 2R93G 1CHQD 1JMCA 1HCZA 1KL9A 3AB9A 1HNZL 1IPGA 1ESFA 4GNXC 2MH7A 3RT3B 3H0GG 3A4RA 5JJKA 2D3GA 2F0LA 3SK4A 5DPRA 2WU2B 1O7LA 2IX3A 4IKGA 4WJPA 4JIOU 3ZRCA 1MHHE 4JBWA 1U4PA 2AQ3B 4PMBA 4A3OA 1I35A 4DPGA 2AWOA 2B3GA 1P7FA 2VZKB 3NRZA 2D3CA 4XX5A 5IP9H 1G2TA 5FJ8H 2A68C 1YBYA 3APFA 4FF2A 2INDC 1F2YA 2RHSB 4JI7L 1EU4A 2ZXOA 2R7ZH 1UD7A 1Q90A 2R61A 2IY5B 3P42A 1TTNA 4A3CH 1OXTA 2CH4A 4BBSB 3HOYH 3H8HA 3S16B 1KABA 5BYQA 3J81i 3J80L 2R93H 3ZUNA 2K52A 2A8VA 4XWWA 3IG3A 3EBEA 1ZXTA 5I6YA 1MG8A 3Q8BA 1KD1C 1EY6A 3HP3A 1WFQA 3BYYB 4S3SA 5IYBH 2NTTA 1OXUA 5ELBA 4HIOA 2NBWB 3GV6A 4BBSG 1NE3A 3S2HB 4HWIB 1C4AA 3RNEC 1HRJA 3ZRFA 4R4CA 1JRPA 3U50C 3I4MG 3FILB 2XWJB 5FO7B 5IODA 3OPOA 4NXNQ 4YSZB 1TWHB 1JR0D 2XIWA 2JPHA 4FDBA 5E1FA 4C4VB 1DOKA 1WI5A 4FF1A 2B2TC 3PO2H 1PGXA 2V4LA 5IP7G 3M95A 1PMRA 1JOOA 3I70A 2HJ1A 2XNAC 2RSNA 3UDIA 2SOBA 1N36L 1N63A 1SLJA 2CJOA 3ZXVA 4DV1L 3EECA 4BXXG 2DBYA 4X64L 4DR6L 2J7QB 1SSNA 3RPFC 3K6OA 2B2VA 4OL7A 3F2CA 4B3TQ 5C3JB 3N32A 2JA8H 1Q1BA 1DOXA 2M0AA 1N8RC 2HTME 3I72A 3PMFA 4ANUA 4BBSH 4E3CA 4XT1B 1EZ6A 3PCOB 2PW5A 2WKCA 2BWES 4JCVE 4XTCS 1VQDA 1WGYA 1SRUA 3ZNZB 1UEAB 3FDTA 4DUYL 3J7AV 5AJ3Q 3I4MH 2B2YC 1T0YA 2EYFA 2Q2IA 3CCSA 3M4QA 2JSOA 3OWFA 4YCUA 4GZYC 4KKUA 2J0KA 1DGSA 2RR9A 4DV4Q 3GZNI 2GVAA 3J7ZC 2LD9A 4EX5A 5CYUA 1LTGD 1N32L 1EY9A 4YT0B 1GKHA 1EIFA 3BDOA 1AFPA 3CF5A 2DJGC 1VQ6A 1QUQB 4MIUA 2QIEB 1G91A 3IFWB 4H7BA 4WWNA 2XSCA 1B3AA 4P73A 4BXXH 3NVYA 4XDCA 2KFKB 1VQJA 2F0FA 1JJCB 2VQFL 1PFNA 2CKHB 3OOCA 1VZ7A 2A5HA 4JC0A 1WTWA 1EFID 2OJRA 1F52A 1ZDXA 2JYOA 4IO9A 2PE9A 1LTSD 2KDEB 2N49A 4FNFA 4JI8L 3I9V1 2GI9A 4RAUC 2GVBA 1QF6A 4IFDJ 2JXTA 2IO0B 3CU7A 3NTHA 4KZ0A 5EE1A 5G2NA 1E10A 1EF5A 1YQ4B 2JY6A 3MC0B 4BBNC 3BG3A 4L5TA 1SNPA 2Z0SA 1Y8NB 3BK1A 4HCPB 4IM0A 5JH5C 4W9IA 2A19A 2EYJA 3PRZA 1A8VA 2YTVA 3AXCA 3KLWA 5LL6S 3I63C 4LJPB 1C7YA 3WCQA 1K0RA 1H9SB 4IUQA 1LTTD 3L0OA 1K51A 5HFYA 5CC4A 2PE6B 2JQOA 3U7ZA 2UXBQ 1GXDC 2WP8J 1A6XA 4U673 3OMGA 3GS2A 1VQLA 4ZUIA 2NN6G 3CPFA 4KN4C 2LVQA 3DHIC 3PO3B 3TEZA 1H4RA 4K6DA 2UWQA 3EFXD 4PZ7A 2D2QA 1HZ9A 1XWEA 4DNIA 1I94L 4LF5L 5DLQE 3QWNA 3W9CB 5J39A 4QQBX 4P1BC 4R4IA 1KTKA 2KCCA 3WOEA 5EE3A 3AECB 3RMKC 5EPKA 1D6EC 2E2JB 4NXMQ 1Q82C 1ESRA 1FFVA 2QA4A 1FRRA 3TN2A 2Y0SB 1PZID 3URYA 4DFAA 2ZVOA 4KIKA 2CHZA 3F8TA 3PIO3 2MA9B 1ZGUB 4BAXA 2QC8A 4GOPB 1IW7C 1N61A 2N88A 2RGFA 2FCQA 3J81j 4BKGA 3EVQA 4HXDA 1C9FA 4OWWB 1A62A 1Z9FA 3Q3OC 2KX0A 3RNBC 2Y0SG 4PMCA 3HRDD 1JQ4A 1KC8C 1S5ED 4LFCL 1HR0Q 4PZ6A 2KQ7A 1V1PA 3N52A 3VR4A 4KKSA 1U4LA 3BZCA 4AP4C 2C9OA 1WSPA 4HCNB 2N0SB 2HQLA 4QMGA 2EKEC 2GBNA 4AIMA 1EWYC 3OWEB 3N1YC 3QR8A 1AP0A 1M1KC 2AUKA 1B53A 5C3WA 1R9TB 1DONA 3CCQA 1KRHA 3KYDD 3J81L 3RLNA 1JWAD 3D31A 1K52A 3UE0A 1I50B 2KACA 1VF5C 1TT5B 2LJIA 4PS7A 4DGZA 2KC1A 1MSHA 2YEPB 1OXXK 4IC7B 5CTRC 3ECIA 4FULA 1PTOH 1SDFA 2Q8RE 4DK6C 3GOEA 3NG0A 3EHVA 1L6UA 2BKRB 4HDQA 1SJHD 1BVSA 2B2TA 3CC4A 1MSGA 4QJFA 4A3GH 3DBHI 1SEBD 1WXVA 3CP0A 2I46A 1XCQL 5LMNL 2L1BA 1DD2A 4NAWB 3K7AB 1LTRD 2V9HA 4KGRA 5CHFA 4ANWA 1IKLA 2ATWA 2PMVA 2Z4HA 2DJFC 3FPPA 2KJ6A 3PIP3 1E1TA 4BWGB 2RD0A 4CKCA 3MC9A 4DHZE 4A20A 4KK7A 2GN5A 4JBKA 5C5MA 4WJWA 1IYUA 4AQYL 4GU2A 4H44C 4A3IB 2C35B 4K14A 3AE2B 5E6NA 3PQIA 1SJED 4W9JA 4CBVA 2UUBQ 4HJAA 1KNEA 1QVGA 2N1VA 2XK5A 2WINB 4MN3A 3RLFA 3N3KB 1TY0A 2WYQA 4HIDA 3I57A 1I7HA 2KXJA 4J6HA 1Y1WG 2K75A 4REZA 2F0WA 4IN3A 1YNJD 3H7SA 1GHKA 3NBIA 4LNQA 3W2DA 3SD5A 3QC8B 3QCAA 1Y1VB 2WB1B 1PH3A 5BMGA 5KYIA 4MM3B 1PRTB 4HMJA 4CKBA 2KMMA 1D5MC 2GBKA 2K33A 3H91A 3D32A 3L54A 5I2XA 5ELCA 1XLPA 5C0XI 5T1IA 4JK1C 1K9MC 4HPMB 4FVMA 2LHDA 2QDFA 2Z4IA 4HN7A 1N34L 1QLBB 3EROA 2JU6X 2AL6A 2MP2A 3DWQA 3JAME 2C7NB 3VUYA 3F2DA 1Z2MA 1HHVA 4OZCA 1J0GA 2NVTB 5GAEC 2D3AA 2UXDL 1WGGA 4DV6L 5C3EB 4KD3A 2EE1A 4KLKA 2N7DA 1UE6A 3K0YA 1EWCA 1X3EA 2EPBA 2RCNA 2L0CA 1ICFB 1X1MA 1CZWA 4ZRIA 3MFGA 2R2QA 3FC4A 5GQOA 3M3YH 2M4NA 1Y1WH 4KDLB 1WJJA 4XYOA 1L1OC 4XQJA 4YHHQ 2KEDA 2O5IC 2GRIA 2N3SA 1SR3A 3G7LA 5C3EG 2C5LC 2WX1A 1J19A 1D5XC 1F2RI 4DK1A 2JYTA 2L76A 2LSSA 4W9DA 1WMHB 2FBWB 3NP8A 1F9JA 3RNUA 1QE6A 2J42A 4LFBQ 2KT7A 1OFFA 3B9JA 1EFWA 1EF1A 4E74A 1CKNB 4WAAA 1PDXA 2BYFA 2DZJA 2B2WA 1JC7A 2RDHA 3L7ZC 2F0OA 2SDFA 2WV6D 1H9RA 4OX9Q 3ICEA 2JF5A 2KWDA 1WTOA 4QIWB 1VQNA 4OVUA 1MI0A 5C23A 4X62Q 2Z1CA 5FK9C 3DEOA 2FCMA 4LF6Q 1GC7A 2L1AA 1D1IA 3L0WB 5JHAA 1STNA 4AYBE 2JSVX 3PVLA 1V8CA 3HOZB 4M02A 2PZUA 3MHSD 2HIVA 3BIID 4FN2A 3UDFA 1W6JA 4QGUA 1N6ZA 1ML0D 3RLOA 1OO9B 1VMCA 3W1GA 1L4ZB 1TYGB 3DM3A 3VR8B 2NZOA 5ELFA 1V97A 2L00B 1Q1EA 2ZPNA 2MO0A 1MGSA 4M0WB 5C3EH 2HTHA 2NVYB 1GJZA 5FR3A 1LQBA 3PRPB 4MSQB 3QAQA 1BT0A 1QZGA 1GUOA 2MBBB 3HOZG 3D4WA 2M17A 4LMQD 1PZJD 1E8XA 1JOKA 3RR5A 5AZHA 3JSVB 5LHY1 4NY0A 4P16A 5BR8Q 1ZP0B 3ENEA 3KUPA 5IGCA 2JYEA 3KBGA 3ZW3A 1KDCA 1MD2D 2PMZB 4JE3B 5GMVA 1XEEA 1PVOA 2BDNA 2K22A 2K5HA 4B0EA 1H95A 1R4MI 4JPSA 3T8MA 1UWXA 1CKOA 3X23A 2V3SA 4KV2A 5ELNA 2Z8LA 2JZPA 3L16A 3Q2AC 3MAQA 1DCZA 5G3LF 5GROA 4JV5Q 4ZOHC 2ICEC 1ZOYB 2MJEA 3Q69A 1Y8RC 5EDSA 3W3AA 2L12A 1BF4A 1UNSA 2QILA 5JXVA 3IAYA 3IBEA 2EKIA 5EJWA 1Q8KA 2LEKA 1JW9D 3NHEB 1JWMD 5C0XH 1B9MA 2C5CA 1LM0A 3TREA 2E2HH 4MELA 2YV5A 3M85A 1XCTL 5EE9A 2F3VA 2VQEL 3TP8A 1VQPA 4FJYA 4RMFA 3VR2A 1I6HH 3V62A 4X3KA
chains in the Genus database with same CATH topology
2PVOD 2EYPA 2KUMA 4A3FB 1F2LA 3Q8EA 2FINB 1FCLA 2CW0C 2MGSA 4R8NA 2F0PA 1FXIA 3A55A 1PRTF 2W82A 1E0BA 3M7GA 3KBXA 1P7EA 3P1MA 4K2LA 3X3NA 2J4XA 1J7BA 4JWSC 4G4KA 5GXGB 5D3DA 5FKAC 3NWSA 1L0YB 2Y3AA 2OEDA 1TWFB 3S17B 1BUVT 2VZKD 2A74C 1TWCB 1RM6C 3OMCA 1DOMA 4IUVA 3EQLC 2DYOA 5JEAG 5JVH3 4XXEA 4H2AA 5A2QL 3T4AC 4ZKBB 2AWNA 5FLXL 2WKDA 1CT1D 3VYSA 4FF3A 2XVSA 1JCKB 1SYGA 5TSSA 3V05A 4RGNA 4BBRB 2JA7B 2L83A 2WXFA 2DLBA 1SE4A 5CGKA 1HTLD 1IGCA 3GTQB 4QF4A 4KY7A 4DA2A 2F0JA 4RFBA 3ABVB 5LNK1 1WGKA 2PKOA 4NDXA 3BVGA 3TDQA 1ZPSA 1I4QA 2BS4B 4DNTB 4NZLB 2ZXPA 4OZAA 4G7OC 4RCNA 3Q6SA 2H88B 4EQNA 1IGDA 4CJ1B 1U9RA 3WOFA 5D7GA 4OO1G 3FILA 1TKEA 1XO3A 3P7JA 1V43A 1E6EB 2B2UA 1ONLA 2PLPA 2QF7A 3P4PB 1AN8A 1X3QA 3KWVA 5EGTA 5KEEA 3VR5A 1GUSA 4E6IA 4CQNA 3I4NB 2MPMA 3VR6A 1T3QA 5KNDA 5HGTA 3GTJB 3QB3A 2EY2A 2QCPX 3BDCA 3VA5A 3K5OA 1B9NA 3ZJTA 4C3JG 3DUZA 2K6AA 3E5SA 4B08A 1A70A 1E9MA 1FM0D 3AV8A 4KMUC 3BS1A 2PYKA 4AQ7A 1Y8PB 1CTMA 1WCMB 4ZUJA 2FJ2A 3Q24A 2ZW0A 4KGSA 2NYZD 1EU3A 3BDLA 4C2MB 2JA6B 2LGIA 4HROA 3PUWA 3AE4B 2IGHA 2RMMA 3S2DB 3L3OC 1PGAA 2V0GA 5CV7A 4J8QA 1ZXHA 1L6VA 4DN4M 3LX0A 1O7ZA 5HG2A 2K3UA 4ITKA 2F0QA 4H13C 1WRIA 4QUCA 3Q8AA 2QDBA 4CHTB 3H3VC 4WWMA 1H9KA 3GV3A 3SVMA 1S5FD 1X32A 2MUYA 3W5UB 4KJNA 2CU3A 3HVZA 5AFWA 3RZOB 4WQMA 1EEID 1S5CD 2BYTA 1G8ZD 2JA5B 4K8IA 1LO5D 2YYZA 3ND9A 5E3FA 1RTNA 1VJKA 4LAAA 1F9QA 1YN4A 2N55A 2KQ3A 1C4QA 1EYAA 1A3TA 1R7SA 3T3OA 5JAVA 3KLRA 2WLBA 1S5BD 3U9OA 4GDKB 1SMYD 3VYUA 4OGQC 2A6HD 2EDGA 3EUB2 2XWBB 4FYDA 1SIJA 3LXFA 1FRDA 1FEHA 5G3LD 4WIPA 3QOLA 2GB1A 1I3QB 3ONAB 1LV9A 3HRZC 4XQNA 1U4RA 2TSSA 1N62A 3NZ3A 4UDUC 2OXPA 3HGBA 2E2IB 3V2TA 4RF1A 1PDQA 3IFTA 2O5JC 4C3IB 4EE2A 2M19A 3TP6A 2INNE 1VDZA 3Q8CA 2H4OA 2YU9B 3H6MA 3C46A 5G5HA 2LFNA 1GUWA 2MJDA 4HTHA 1GB1A 3LB8C 1C77A 3KK7A 1PRTD 3D4DA 3DXJC 4OIKA 1WD1A 1PFBA 2KECA 1EQVA 1A3UA 4XDXA 1XTCD 4L6TB 3TBIB 3GQBA 1QOFA 5ELEA 3S9WA 2DWQA 4WFN3 1B1ZA 1ZXIA 4HJGE 2LMCB 3SEBA 5CBAE 3NS1A 2WXGA 3HS0C 4BY7B 1CQFA 1SBBB 2NN6I 1QWYA 1O80A 1FGBD 2E6XA 1JWBD 2MEKA 1LT3D 4DK0A 4J1MA 2I38A 1XYIA 1TKWB 3J80E 4TQ0A 3A8IE 3SK6A 1JE4A 4YSXB 1K50A 1L0XB 3TZUA 4FXDA 3IT6B 1EY7A 4HRSA 3C1FA 4LK0M 4MACA 2ACZB 5CMDA 4KJOA 3VR9B 3DWGC 1GUTA 3MJ5A 1LTID 5FO8B 1DGJA 5EE1A 3TSSA 5JPNC 3I91A 5M5WB 4RWSC 1SAPA 2E76C 5K36G 2WXQA 1R4QB 3MXNA 2BA0A 1LACA 5D14A 3Q23A 5NUCA 2Y5CA 2RQXA 4M0WA 4IALA 2G9DA 4P6VF 5C0XJ 4C56C 3HZXA 2JE6I 1UGJA 1YNJC 5CV8A 2F3WA 4LK1C 1ROEA 4HCSA 3NPPA 2BB5A 1TS4A 1EYCA 4PNYA 3ETRA 2J52A 4ZHOA 3W1SA 2L4NA 5G5GA 3VA7A 4GLSC 1HUMA 3M7NA 2JEBI 3TEYA 2A68D 4HR7B 3EA6A 3A7LA 2V3NA 5C3XA 3S1MB 3M4OB 3B2FA 5IGEA 4Q0FA 3LWEA 1TS5A 1T6BX 2DN8A 1CJEA 3AEDB 1S4ZA 2EY6A 2GA4B 3GTKB 5KNCA 5EPJA 2LS01 1G6ZA 2WS3B 4ARIA 2XRQD 1NVID 3AH7A 1E0ZA 2NN6H 2K7VA 2PW7A 2KQ4X 4IURA 3NVWA 1SYCA 1IYVA 4C7ZA 1FD7D 2F0UA 2W3RA 4K6LA 2AQ1B 3HUIA 3HEJA 5I9PA 5CV9A 1HA6A 3U2SC 3P1HA 4BS9A 3RZDB 3S14B 4NP5A 2KN4A 3V3XA 2NBFA 2JX5A 1CZPA 2B39A 3QIAA 2IT1A 4DAPA 3Q8FA 4KV6A 1OXSC 4HMIA 1PFMA 2PIAA 5BN3A 1T5XD 3BVMA 1XLQA 2WXPA 2VUMB 3MXUA 2IW3A 3NTIA 1J7AA 1NSNS 3NUCA 2V4IB 3MHBA 1N60A 3AE6B 4H0LC 2W54A 5IGDA 3AM9A 1LLRD 2F0GA 1TQOA 4EQOA 2CJNA 3NQIA 1VCIA 3P20A 4A3KB 2KAJA 2F0SA 4IUUA 3FRPB 2F0TA 2TMPA 2B2YA 2EJMA 2XN9C 2ZW1A 2BBCA 2X6LA 2B63B 2F4IA 1IBXB 3GTMB 3ZJUA 5M3FB 2QMTA 1JWUD 4EGVA 3J81E 2LKVA 5C4ZA 1GUGA 4PMWA 2A69C 3LNNA 1B44D 2OEOA 2KEEA 3TEWA 2NZ1D 1I6VC 4ZKCB 3DMUA 2V3PA 5JPMC 4F87A 5COYA 1JALA 1SYBA 3RMHA 3C3LA 4RA8A 3MEHA 1RD9D 3D6CA 5IGGA 3CWIA 1JQYD 4YTPB 5DNFA 4ARCA 2HDMA 1G2SA 1NUCA 1ZYRC 2JQRB 3PV0A 3CRKC 4US9A 1MVKA 2ON8A 3GTGB 2B8GA 2EYMA 3AB5A 2PQEA 4RGTA 1LT6D 1EY5A 2Q5WD 1PXUA 2LY7A 4HAEA 5C4HA 1H9MA 3PUYA 2A6EC 2G1EA 1STEA 1T5EA 4F8MA 3P75A 4R9WA 4A3BB 1C4PA 3VRAB 3SE0A 2EYLA 1IW7D 4DXFA 1I4GA 4N58A 1ZDVA 4IDIA 2H89B 1S5DD 2PZTA 4X3UA 1FYCA 4WH4A 4DNRB 3AEGB 1RODA 4J3OD 4C3HB 1TKYA 1EEFD 5BN5A 2L11A 1TS2A 2NWGA 3MHZA 1ICWA 5HI1A 2M9VA 5C44B 4C3HG 4NAMA 2KHSA 3AE7B 2BTEA 3VR3A 2WXLA 2YEPF 1QB5D 1SYDA 4IFDG 4HKZE 5EKLA 4JWUC 4PT5A 3KWLA 3P4SB 2D5GA 3W5VB 1KLUD 5A35A 4A3MB 4ZLTF 2E75C 1EIHA 5I6WA 3AMUA 2BDOA 4EQPA 5M5XB 1J7CA 1RJTA 1Z47A 5IT9L 3IXSA 4D2KA 2F0HA 2FMMA 2J53A 1JROA 4XIGS 2DYMA 3R8BA 4OO1I 1PLFA 3AN1A 3U4EG 2HCCA 1QJOA 1AW7A 1CK1A 2M56B 3HKZB 4KD4A 4A6QA 1O78A 3PZ8A 4B9WA 1HA5A 1M4VA 2EJFC 1TJEA 1QOHA 3PUVA 2E74C 5M5YB 2Q8IB 1YNNC 4RKLA 1OXVA 1A2TA 2K05A 1PFDA 4ZAIA 4KY5A 2KCNA 1ET6A 5FOBB 1A3VA 1I4HA 1ACCA 2NUCA 4RH6A 1DJRD 3NSWA 5KRUA 2RPVA 3CIRB 2XRSD 1XF5L 2BS2B 1QQRA 1XX8A 1C78A 1F9PA 1KAAA 3BK2A 3C8YA 3T56B 3DHQA 4L23A 4XDDA 2F0EA 3FEWX 3DWMA 2X38A 1PTOC 2K0PA 1UAPA 2NTSA 1QNKA 3BZDB 3R93A 1Q3LA 1K8MA 1Y56A 1MPEA 5JEAH 4ZQ3A 1BCPC 2ICIA 1AEXA 3A7AB 2MP1A 3N9YC 1C8CA 1C79A 2D9UA 2BT6A 3K59A 1KDAA 3MWYW 2PW9A 1HUNA 4O42A 5JOBA 3IT4B 5EBDA 3MFYA 5J22A 1HQMC 5A2QE 2PZWA 1CHPD 2LMCA 3KLSX 1FNUA 5FLXE 1ZE3D 3SDZA 1AZQA 4BY1B 3VYTA 4L2YA 4G7ZC 2G9HD 3I90A 4A93B 4GDLB 3SR6A 2WP9B 1D1KA 1FNWA 5IOCA 3K5NA 3UI2A 3Q0AA 4FO2A 1K53A 1RTOA 3J7YW 4KGTA 4NJCA 1JWSD 5KGUA 5HHDG 2K9XA 1TVXA 3K5MA 3AEEB 2RDGA 1WTXA 3NUHB 5C2TB 4OO1H 2K5PA 2MJ3A 4XQQA 2CHBD 1F9RA 1FCCC 5C4XB 3E6ZX 1KFYB 1ET9A 4O1NA 2KDMA 1U4MA 1ENCA 1BR9A 1HFGA 2WACA 2QSDA 2JP1A 4RF0A 5E4XA 1PUTA 1OQQA 1NAPA 2BE5D 3P4RB 3DWPA 3QJYA 1FO4A 5HURA 5DAUA 3R3OA 3PUXA 3IFDA 2IDYA 1WXQA 4V190 3FMCA 1I4PA 4OHJA 2D62A 2H1EA 4B0MA 4L63B 1PRTC 1Q10A 3SHLA 1JORA 2DY7A 3NK9A 3I73A 1L0VB 4IUNA 5CBEE 2KA7A 2L5TA 1EYDA 2DNEA 1SSOA 4HCEA 2N7JA 1E7PB 2B2VC 3HOXB 1UWMA 4HEDA 4KKTA 2FE8A 3NQTA 2RDFA 3GP7A 2WXIA 1STGA 1TS3A 3TP5A 1TWAB 3AE8B 3ZYYX 4C80A 1EY0A 1F0ZA 1F2ZA 2BOSA 1DZ1A 3OW7A 3RFZB 1DOIA 5BMHA 4US8A 3S15B 1BBXC 4KY6A 3IAS1 1RKNA 2K04A 3T53B 1GAQB 1VZ6A 2JEAI 3SFEB 1GB4A 3H94A 1DXMA 2B8FA 1B9RA 4L1BA 4JX1C 1AYFA 1DM0B 1NYRA 2R7ZB 1MHXA 5EBCA 2F0KA 3R2IA 1EIGA 3HOYB 2R93B 3NWTA 4G7HC 1YN5A 2EZVA 3T13A 1ENFA 1B2TA 2BW2A 2R3ZA 5DEHA 1WVLA 1NR4A 1TY2A 3IL8A 4RHRA 2M00A 1CA5A 2IJ0A 4NMZA 2F0VA 1EQTA 1LTBD 4MH8A 3O13A 3GO5A 1TWGB 3FAHA 1F2RC 3MZ5A 5IIFA 3R2TA 2L32A 4IUPA 1B50A 2E2DC 3PO2B 1TKGA 2F0MA 4C3IG 5KIXA 1BUIC 1KH0A 1AWDA 4CJ2C 1GOZA 2BS3B 2JA8B 3EJIA 4I65A 3KQ4A 1IBXA 1SF0A 4L8JA 4RKBA 2IGDA 1EY4A 2A73B 3I4MB 4R3DA 2Y5PA 2HUGA 1IKMA 2IX1A 1Z7TA 5E4WC 4OW0A 4I7ZC 4ZRZA 3L4PA 5ELDA 4WORA 4ULLA 1QILA 2LFIA 4UAIA 3K57A 3PO0A 3F2UA 3OSOA 4A9AA 4X3TA 4KX6B 1VDVA 4NKLA 1LABA 4A3JB 3FPUB 4KN7C 5T8IA 3AMZA 1ILPA 1IHZA 1YJJA 4CKEA 1J9OA 2F0NA 4M1UB 4F88A 2MHVA 1VLBA 2VB3X 1RHPA 3HVDA 4EVOA 3RD4A 1SE2A 5EPLA 2PCFB 2F0IA 3HG9A 2EJGC 3DWAA 2HCIA 3AEFB 1BQQT 3P63A 4IOIE 1PZKD 4WAFA 2EY1A 2PNRC 1VRAB 1E2ZA 1XXGA 3SFDB 2EOTA 2RKSA 2ZXRA 3A56A 1MI2A 3NHHA 1QG7A 4FP5D 1VZ8A 1J8IA 5JVG3 2PVGC 3TMEA 1XLOA 2KJXA 4CGYB 5EKKA 3U52E 1KLGD 3Q22A 1QOBA 5K36H 1NYQA 3T16A 3GTOB 5C5LA 1JB3A 1KNAA 3AE3B 5CV6A 1EWHA 1NCVA 1ZKOA 3D6WA 3S1NB 4Q2JA 3AE5B 4LJZC 2LHEA 3AE9B 1D2BA 5M3MB 1DOYA 4N59A 2B2WC 3MA2B 2HDEA 2DNCA 2N9KA 1N5WA 3C2PA 1PTOB 1V8QA 3PUZA 1Z6HA 1LT5D 1YNTE 2K01A 1MBYA 4A3GB 3AEBB 4DXGA 2WXMA 5H8YE 1GUNA 1H9JA 4MHEA 4DU9A 1BCPB 3L9AX 4ZHPA 2E3TA 1LT4D 5BYRA 3CKIB 2CQAA 2ONQA 4C1NK 4ZRQA 1XLNA 3N6RA 2N9LA 1Q8IA 5KNBA 5JEAJ 1N5XA 1RFKA 3V96A 2X69A 3OHXC 1Q12A 1HPCA 1NI3A 2WXJA 3IAM1 1HZ6A 4C7YA 3GB1A 2BCOA 5CV4A 3MXPA 2X6GA 4FXCA 2B76B 3JAML 4XWTA 1UUPA 2DY8A 4YTMB 3IKJA 4TQ1A 2HQEA 1CA6A 2WXNA 3NVVA 3AU7A 1I4XA 1HXYD 2IGGA 1SXTA 5IGFA 3ERQA 4IQZA 1NR2A 3M3YB 1WTVA 4KHZA 1Y1WB 2IWHA 4U68A 2K32A 4YIJA 3NBHA 3I3CA 5EKIA 1EL0A 1FNVA 1QOGA 4A55A 5M9OA 4YSYB 4WURA 2WDQB 1CM9A 1F2MA 2KOLA 2INPE 1FIQA 2K1BA 2WXHA 1HQRD 1IL8A 4DQOC 1TT2A 2K5WA 4IFDI 1E2WA 3BWUD 1F9SA 2WNMA 3E56A 2QEJC 2O4XA 4RGOS 4TKOB 5CR3A 1Y69U 2VNUD 3MP9A 3MTSA 5CORA 4XE0A 2SNMA 1WD0A 2J0TD 5FO9B 1WTQA 2EY5A 3KF8A 2J7ZA 5MPOA 4P2CB 1EY8A 3NVZA 2MJ8A 4Q5VA 5D3IB 5AUIA 2FHTA 4QB4A 3OIQA 5BYSA 4RNAA 2RSOA 3X3MA 4KKIA 2O2LD 4K2KA 4M8AA 4A90A 2K03A 4XT3B 5E6JA 1STAA 4K5XA 1PTOF 3K5LA 4YXDB 3GD7A 4FXGC 1BXTA 2VB2X 5I2YA 1VF7A 4ILWA 1D5ZC 1SYFA 1BCPF 3ITPA 2EELA 5LL6X 2L9HA 3TEXA 2I07B 2B2UC 2HDLA 4IUTA 1SNMA 2E2HB 1RDPD 1YMHE 1RYJA 1RWSA 2F03A 2K5QA 1SNCA 1I6HB 4OZBA 2IL8A 4XYQA 1SE3A 1W6KA 2K28A 5C0XG 1FXAA 4OVZA 3HOVB 3HOWB 2KVMA 3SK5A 3KLSA 1E2VA 2RVLA 3CRLC 3D4RA 4HSPA 1BDOA 2QJLA 1D4BA 3NTKA 1STHA 4X3SA 2ENBA 2NVQB 4HSVA 1EZ8A 1EOTA 1AZPA 2R6GA 4Z9CB 1NENB 3OIPA 2FUG1 4QCLA 2JXMB 4IFDH 2L52A 4AYBB 4A8XC 1STBA 2A69D 2PO4A 2Q8TA 1TR5A 1O7YA 4N9TA 1SNQA 4OIJA 3WDNA 1SFOB 2R92B 2V4DA 3UI3A 2WU5B 1HFNA 1ENAA 5KYLA 2IPKD 4G57A 5DM63 2AX5A 1V1PB 4K5VA 4A3DB 2NVXB 2VXWA 4BA1I 3S1RB 1G291 1PYWD 2BE5C 4TRDA 3GTPB 2WDRB 3E0JA 3D3RA 3E9SA 5EE0A 1ZYRD 2SAKA 1WYGA 2EVBA 1PGBA 4QUFA 1M8AA 1K83B 3H09A 2SEBD 4BA2I 2NMQA 1HEZE 3A8KE 2A6ED 5IT9E 1BOSA 2AUJD 1SNOA 1CZGA 1WWTA 4FXKC 1QKZA 1F77A 1QT9A 5BMIA 5F2DA 3SXHA 4TSSA 4ZK9B 1YN3A 1ILQA 3A54A 2WAQB 2I2YA 1BNZA 3FKIB 5EQ0A 5J1ZA 1L4DB 5D65A 1I4RA 3J7AF 1IUEA 2PTLA 3A8JE 3DM1A 3LWUA 4USAA 1KF6B 3FVQA 3I8ZA 2OT2A 4K8JA 5H92C 1QOAA 1JICA 3SR1A 4A3EB 1GJXA 4Y7NB 2EYOA 3NE5B 1QCBD 2W55A 2FMCA 4KI0A 4MT5A 3AE1B 3P4QB 4ABNA 3QO2A 4TMAB 1ZUD2 1FR3A 3ZJVA 4WRDA 5I9OA 1JMLA 5AUKA 1C76A 4NW2A 2K5DA 2NB0A 3TUOA 4B9XA 5JJZA 1A2UA 4C1NI 1SMYC 3G6JB 2A6HC 3CQZB 1STYA 3VRBB 2IX0A 4AS1A 1JOQA 4ZYSA 2F0DA 5I4DA 2SNSA 1C48A 1FMAD 1L5PA 4N9PA 4PV1C 3S1QB 2AQ2B 4ODGA 2L55A 4K5WA 3PZ7A 1HTPA 4C3JB 3VQIA 1TZOA 5CV5A 1QNUA 1RCVD 2FFKB 2LUMA 1WTPA 1QF6A 2BA1A 1V1OA 3MVVA 2JWUA 1DOLA 1CFMA 3NXWA 4DAYA 3QG1A 1CQVA 4KKJA 5IGBA 2D2CC 2CW0D 3U9SA 3EGRA 4HEA1 4R8IA 2ZT9C 2PPBC 2BB6A 4F7XA 2RBMA 4ZRPA 2WDVB 1A15A 2QKIC 2WIIB 4KHVA 1YNND 5BN4A 3SK8A 4KTAA 3GTLB 3TZDA 1YJIA 1ZEQX 3D8GA 5C4JB 1HZ5A 2ID0A 3BYTB 4CJ0B 3ZGZA 3T3NA 4YTNB 5T1GA 3ZQ4A 1YQ3B 3HOUB 4ID6A 2M2LA 1II3A 3AEAB 1R4PB 3I4LA 4DF7A 1TIID 3K58A 2F1MA 1SNDA 2W3SA 3VYRA 4LLGM 2CVRA 3C1EA 4LTUA 2EYHA 1B4OA 3BVZA 2WQYB 1RF2D 1BO0A 2OF1A 3T51B 2WXOA 1K8OA 2WXKA 1H9SA 1CI3M 1PTOD 1TU2B 3TP7A 2EXZA 1C4CA 4IZ8A 5K5PA 3B2GA 1BCPD 1FFUA 4TQUS 4DAVA 4RHSA 3QOJA 1LTAD 5C6AA 3LYYA 2RA4A 3RUZA 5ISRA 1NEKB 2WXRA 1GPXA 5DM73 1EM7A 1SB3C 4YWGG 1VR9A 3ND8A 3MXGA 1GHJA 4RGMA 1VMPA 1FD6A 3CHBD 2OHFA 4PQXA 3J9CA 1KDBA 1BMLC 4FF4A 4V0BA 1X3PA 1SYEA 2D5DA 1OQRA 1DYQA 1WTRA 3H0GB 4HKQA 3DEPA 1Y8OB 4RCOA 3M4YA 4N6EB 4ME5A 1CHQD 1HCZA 3AB9A 2MH7A 1ESFA 2F0LA 3SK4A 2WU2B 1O7LA 2IX3A 4IKGA 1MHHE 4JBWA 1U4PA 2AQ3B 4PMBA 2AWOA 2VZKB 1P7FA 3NRZA 1G2TA 2A68C 4FF2A 1F2YA 1EU4A 2ZXOA 1Q90A 2R61A 3P42A 1OXTA 4BBSB 3H8HA 3S16B 1KABA 5BYQA 3J80L 4XWWA 1ZXTA 5I6YA 3Q8BA 1EY6A 3HP3A 3BYYB 4S3SA 2NTTA 1OXUA 5ELBA 3GV6A 3S2HB 1C4AA 1HRJA 1JRPA 3FILB 2XWJB 5FO7B 5IODA 3OPOA 4YSZB 1TWHB 1JR0D 2XIWA 5E1FA 1DOKA 4FF1A 2B2TC 1PGXA 1PMRA 1JOOA 3I70A 2XNAC 2RSNA 2SOBA 1N63A 2CJOA 2DBYA 1SSNA 3RPFC 3K6OA 2B2VA 4OL7A 5C3JB 1DOXA 1Q1BA 2M0AA 2HTME 3I72A 3PMFA 4XT1B 1EZ6A 2PW5A 2WKCA 4XTCS 1UEAB 3FDTA 3J7AV 2B2YC 2EYFA 4GZYC 2JSOA 3OWFA 4KKUA 5CYUA 1LTGD 4YT0B 1EY9A 3BDOA 1AFPA 4MIUA 2QIEB 1G91A 4H7BA 2XSCA 1B3AA 3NVYA 4XDCA 2F0FA 1PFNA 3OOCA 1VZ7A 2A5HA 1WTWA 1EFID 1ZDXA 2JYOA 1LTSD 4FNFA 3I9V1 2GI9A 4RAUC 4IFDJ 2JXTA 3CU7A 3NTHA 1E10A 1YQ4B 3MC0B 3BG3A 1SNPA 3BK1A 1Y8NB 2EYJA 5LL6S 3WCQA 4IUQA 1H9SB 1LTTD 1K51A 5HFYA 5CC4A 3U7ZA 1GXDC 2WP8J 1A6XA 4U673 3OMGA 3GS2A 4ZUIA 2NN6G 4KN4C 3PO3B 3TEZA 4K6DA 3EFXD 1XWEA 3QWNA 3W9CB 5J39A 5EE3A 1KTKA 2KCCA 3WOEA 3AECB 5EPKA 1D6EC 2E2JB 1ESRA 1FFVA 1FRRA 3TN2A 2Y0SB 1PZID 3URYA 4DFAA 3PIO3 1N61A 1IW7C 2N88A 3EVQA 1C9FA 1JQ4A 4PMCA 3HRDD 1S5ED 1V1PA 3N52A 3VR4A 4KKSA 1U4LA 2C9OA 1WSPA 2N0SB 4QMGA 1EWYC 3OWEB 1AP0A 2AUKA 1B53A 5C3WA 1R9TB 1DONA 1KRHA 3J81L 1JWAD 3D31A 1K52A 1I50B 2KACA 1VF5C 2LJIA 4DGZA 1MSHA 2YEPB 1OXXK 1PTOH 1SDFA 2Q8RE 1L6UA 1SJHD 2B2TA 1MSGA 1SEBD 1XCQL 2I46A 2L1BA 1DD2A 4NAWB 3K7AB 1LTRD 4KGRA 1IKLA 2PMVA 2Z4HA 3FPPA 3PIP3 4BWGB 4CKCA 4KK7A 5C5MA 4WJWA 1IYUA 4H44C 4A3IB 4K14A 3AE2B 1SJED 4CBVA 1KNEA 2WINB 4MN3A 3RLFA 1TY0A 3I57A 1I7HA 4J6HA 4REZA 2F0WA 4IN3A 1YNJD 1GHKA 3NBIA 3W2DA 1Y1VB 2WB1B 5BMGA 5KYIA 4MM3B 1PRTB 4HMJA 4CKBA 2KMMA 1D5MC 2K33A 3H91A 5I2XA 5ELCA 1XLPA 5C0XI 5T1IA 4JK1C 4FVMA 2LHDA 2Z4IA 4HN7A 1QLBB 3EROA 2JU6X 3DWQA 3JAME 1HHVA 4OZCA 2NVTB 5C3EB 4KD3A 2EE1A 3K0YA 1EWCA 2EPBA 2L0CA 1CZWA 3MFGA 3FC4A 4XYOA 4XQJA 2KEDA 2O5IC 2GRIA 3G7LA 2JYTA 1D5XC 1F2RI 4DK1A 2FBWB 3NP8A 1QE6A 2J42A 3B9JA 1OFFA 1PDXA 2B2WA 1JC7A 2RDHA 3L7ZC 2F0OA 2SDFA 2WV6D 1H9RA 2KWDA 1WTOA 4QIWB 1MI0A 2Z1CA 5FK9C 3DEOA 2L1AA 1D1IA 1STNA 2JSVX 1V8CA