1BXTA

Streptococcal superantigen (ssa) from streptococcus pyogenes
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
222
Chain Sequence
SSQPDPTPEQLNKSSQFTGVMGNLRCLYDNHFVEGTNVRSTGQLLQHDLIFPIKDLKLKNYDSVKTEFNSKDLATKYKNKDVDIFGSNYYYNCKTCMYGGVTEHHRNQIEGKFPNITVKVYEDNENILSFDITTNKKQVTVQELDCKTRKILVSRKNLYEFNNSPYETGYIKFIESSGDSFWYDMMPAPGAIFDQSKYLMLYNDNKTVSSSAIAIEVHLTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN (STREPTOCOCCAL SUPERANTIGEN)
publication title Structural basis for HLA-DQ binding by the streptococcal superantigen SSA.
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 60
structure length 222
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bxtA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1bxtA02
1LTBD 2AQ1B 1RF2D 3O13A 1BXTA 1HXYD 4O1NA 4RGOS 1PTOC 3MC0B 4TSSA 1ESFA 4OHJA 5ELEA 5FK9C 1FNUA 2QILA 2SEBD 1LTTD 1B1ZA 1G8ZD 2AQ3B 2TSSA 2XN9C 1PRTC 5TSSA 1B44D 5ELCA 1RDPD 3EA6A 1D5ZC 1BCPD 1JQYD 1TY0A 2CHBD 3BZDB 1YN5A 2RDGA 1RD9D 1CHPD 1SBBB 4ZYSA 4RCOA 1FGBD 1ENFA 1T5XD 1UUPA 2J4XA 2WV6D 1L0XB 1V1OA 3KLSX 1JR0D 1TS2A 1D6EC 4RH6A 1I4QA 1PZID 2ICIA 1MD2D 1PZJD 3TSSA 3EFXD 5ELBA 1UNSA 1CK1A 1LTSD 1JWMD 1FNVA 1QILA 1BCPB 1AW7A 1CT1D 1EEID 2QEJC 1LT3D 4L63B 4RFBA 1ET6A 3OWEB 1D5XC 1S5ED 2G9HD 1PRTD 4BWGB 1PTOH 1TS3A 1BCPF 3W2DA 3V05A 1TS5A 3R2IA 1I4XA 1LTGD 4DXFA 3DWAA 2IJ0A 2IPKD 5I4DA 4RGNA 1GOZA 1I4GA 2XNAC 1CHQD 3R2TA 1V1PB 1AN8A 1FD7D 1SEBD 1LT5D 1F77A 1SXTA 1HA5A 4RGTA 1PRTB 5D3IB 2NTSA 3GP7A 1LTID 1PZKD 1XTCD 4UDUC 1PYWD 1BCPC 1LT4D 3CHBD 1PTOD 1HTLD 1LT6D 3DWQA 3URYA 4DXGA 3SEBA 4RHSA 1EU4A 1SJED 5ELFA 1SE2A 5FKAC 1I4HA 3BYTB 4K6LA 1S5DD 4RHRA 3DWPA 1LTAD 1S5BD 3MFGA 2R61A 1EEFD 1JWSD 1STEA 1ET9A 1CQVA 4L6TB 1D5MC 1JCKB 1DYQA 1EU3A 1LLRD 2RDHA 2XRSD 1HQRD 1PTOB 3BVMA 1FNWA 5D3DA 1I4RA 3BYYB 1L0YB 1EFID 4NZLB 1DJRD 1LO5D 1M4VA 1SE3A 1LTRD 2AQ2B 1RCVD 1SJHD 5ELDA 1PTOF 1JWUD 1S5FD 2XRQD 3BVZA 4RGMA 1V1PA 4Z9CB 1PRTF 4C56C 1YN3A 2O2LD 3R8BA 1EWCA 1KLUD 1TY2A 2Z8LA 1TS4A 1S5CD 1I4PA 3BVGA 1KLGD 1KTKA 1SE4A 1YN4A 2NTTA 1XXGA
chains in the Genus database with same CATH superfamily
5M9OA 4IZ8A 2AQ1B 4HIOA 1X3PA 1PTOC 5JZEB 4OXPA 3OPOA 3P4RB 4J1MA 2WXRA 2HUGA 2L3ZA 2GRIA 1B7YB 1EWHA 3PCOB 2G5DA 1H4RA 4F1SA 5TSSA 2WXMA 4F8CB 2I07B 3FPPA 4B3MQ 1XLNA 3DMUA 1D5ZC 1XCTL 1VQBA 2K0PA 5D2MB 3J7A5 3TN2A 4EVOA 1HQMC 3LGJA 1WGRA 1N36L 1EQQA 1O7LA 3AMZA 3V3XA 4MTKA 4L1BA 1L0XB 2K28A 3Q2AC 2D5DA 1C77A 1Y1VG 5JJLA 1GB4A 4USAA 5IOCA 1K53A 1I4QA 3K7UC 3KF6B 3S16B 1MD2D 2LVOA 1WYGA 5ELBA 3QARA 2KFJA 4JLCA 3HOWG 4DQOC 4IJLA 3HFZB 4N9TA 4XT3B 2VW9A 1KQSA 4GN1A 5IN7A 3L54A 3ZLZA 1H9RA 2KCMA 1SFOB 4PYZA 4OVUA 2LY7A 2F0NA 4LF4L 2KWUB 2R92H 2JF5A 4A90A 2SAKA 2AMCB 2L12A 1PA6A 1G51A 2J0KA 5FJ8G 3PUXA 2YLMA 2PNRC 2K5HA 2L11A 4POGA 1AWDA 1V81A 4ZDVA 1EQTA 4ZAIA 3DWAA 1WZ0A 1Q8KA 2AYOB 2E2JB 3GZNI 2R7ZB 3I4OA 4MDKE 2IO2B 3PZ7A 3WALA 1MIUA 1E2ZA 2FHTA 5C5LA 2H89B 3IBEA 3HKZE 1AARA 3LX0A 4IUVA 1C0AA 2IX3A 5KRUA 2VY3A 4FA6A 4FO2A 2JSOA 4ANVA 4J3OD 3FP9A 2Q8TA 4TQ0A 4EZJA 3KDFA 4JOIC 1SYBA 3GP7A 1F2YA 1JWAD 2EYJA 1K51A 3DCGA 4RF0A 5I6YA 4X57B 3H0GG 1PTOD 2JYOA 2LUEA 4ANXA 4H44C 1MPEA 2DYMA 4HJ8A 2DENB 4DNRB 2SDFA 1EU4A 3UIPB 1E0ZA 3W1BA 4JI8L 4FXKC 5FLMH 2JQOA 1RFKA 1I6VC 5CV4A 3S1RB 3E6ZX 3IAM1 2F0PA 5D94A 1R4NI 1DOYA 3FKIG 1YZ6A 3PRZA 1EYCA 4CGYB 1XNRL 3OTOQ 3MTSA 1JCKB 3NG0A 2LHEA 2PCFB 1ROEA 4ZQ3A 2UUCQ 1ENCA 5CBEE 2EOTA 3ZRCA 3TQYA 4US8A 3JAMi 2G9DA 3PIP3 1ONLA 4DA2A 2ZJPA 2N9KA 1RL2A 1SE3A 2KUMA 3ZRFA 2F4VQ 3SHQA 1EM7A 3IFWB 1S5FD 5HFYA 2X6GA 4F8MA 1G6ZA 3ZNGC 2FNJB 2H88B 2EELA 1BBUA 1K3BC 3KLWA 2A8VA 3AEGB 1V86A 1CKNA 3VYRA 1UGMA 4JI2Q 5BMIA 4RM9A 4AQ7A 2RCFA 4DR5L 2GBMA 2LUMA 3CF6E 2JYEA 2ASBA 4ZUJA 4MHEA 4WAAA 4P75A 2B8FA 1BBWA 5K36G 3ABVB 1S3OA 3OLMD 3TP6A 2N7DA 4GKKQ 4S0RA 3GS2A 3J81j 3RNEC 1ML0D 4WH4A 1WWTA 3ZO5B 2IDYA 3Q8DA 3PVLA 3J7YW 4IUQA 2K6QA 2ZVOA 4HWIB 1C48A 3CCJA 2K04A 1GUAB 5FR6A 2LWPA 2D10A 2ZCCA 1K8MA 1H9SA 2YVCA 1WD1A 1Z2MA 4AS1A 4EQ5A 1SNOA 1WTRA 1NBWA 4A3JH 2CWPA 2F0TA 3V61A 3U7ZA 3T1YL 1D6EC 1SDFA 3AE9B 4H7BA 1D2BA 2WXPA 3PHXB 4KGRA 2ATWA 3H8HA 5M3FG 2UUAQ 3HOZH 1FIQA 4PYUA 1EIGA 2NN6I 3VH3B 2WAQG 3C46A 2MQJA 1AFPA 1C1YB 2PW5A 1VQCA 3DBRI 2GVAA 1VDZA 1XPOA 1CM9A 1I50H 3NXWA 4KKUA 1HA6A 3SK4A 1YHBA 1T0YA 4W9KA 2PQEA 1Y1VH 1F52A 1WCMB 3PO3B 3GE8C 3R2IA 3NSWA 3S2DH 3ZTCA 1HR0W 2INPE 2IJ0A 2R93G 1LFDA 1TKWB 3M4PA 1G2SA 2JQRB 1X9NA 4R4TA 1WTQA 4NAWA 1Q7YC 1AN8A 1H9MA 3UE1A 2NVYB 1NSNS 5JPMC 5AEKB 3ZJVA 3I55A 3KOJA 4DV0Q 1PRTB 2Q2UA 2IO0B 3SFDB 1HRJA 1OEYA 4ANWA 3S1MB 2J52A 1X55A 3CXCA 1LT6D 4ZUIA 4GNXC 3MEHA 1STNA 3SEBA 5AZFA 4YTMB 4J6HA 4M8AA 3PO2G 1B2TA 1J9OA 1I7HA 1SYDA 4IFDG 1A63A 2X38A 2PE9A 2CH4A 1XT9B 1ZKOA 4TQ1A 4KX6B 3J7AF 3NBIA 2F0JA 2CH4W 1LLRD 1KDCA 1Z47A 1BQQT 1PYSB 1XMQL 2NPTB 4DUYL 3UDXA 1E8YA 4IDIA 4LNIA 2K7VA 3AU4A 1KNAA 1MG8A 4DV4Q 1LO5D 4XGAB 4HCPB 1TWHB 3GDEA 2UWQA 4DHZE 2WDQB 2B76B 2ON8A 1I3QH 4AQYL 2A74C 2BE5C 1N36Q 3NBHB 4FP5D 2N9LA 1E5WA 1F2RI 2A69C 3M4OB 1XEEA 2PEAA 3R8BA 2I5MX 2OJRA 3IFTA 2ZTCA 4B9XA 3N52A 2AHOB 1D7QA 1HR0L 1VZ6A 3K5OA 3VA5A 4DK3C 5FO8B 2KOXA 4LNFA 4WJOA 4AH6A 4YWKA 4NKLA 1I94L 3O13A 4LF4Q 1O7YA 3H7SA 2JYTA 4FULA 2SEBD 4KI0A 3P2BA 3ECIA 2JXMB 1LTLA 1Q1BA 4JI5Q 1XLOA 3S17B 3E9SA 1JICA 2G4SA 3PREA 2VB3X 2EYFA 4MTNA 2M9VA 5C44H 3QC8B 4FJYA 2XWJB 3TEZA 1KLVA 4PS3A 4HTHA 3CC7A 1GUOA 3UIOB 4C80A 2O5IC 1FMAD 4A3BG 5CYUA 1DONA 3DVGX 1A6XA 3KDFB 2M0AA 1PLFA 2VUMG 3LYYA 4J6IA 5IT9E 3HZXA 4OW0A 5GROA 1LYLA 4AYBG 5K36H 2G3QB 1CZWA 3G48A 3HS0C 4IURA 2BH2A 2IHEA 1Q10A 2E2IH 2GBRA 2MJDA 3M95A 1IBKL 3PLVA 2ENBA 5IY0A 2I46A 4JI1L 3X3NA 2KDMA 2A4ZA 3VH4B 4EFOA 4M00A 2X8XX 2WHIA 5EQ0A 1VMPA 3RNCC 1AW7A 4OL7A 3HOXH 3RD4A 4IUUA 3VRBB 1VQPA 4JI8Q 2ZW0A 1V5TA 1EEID 2QEJC 1FYCA 4L63B 2JU6X 1SE9A 2IW3A 1OGWA 3DUZA 1L6VA 1TS3A 4IUNA 3VR3A 3V05A 4AIMA 4ZRJA 1FPYA 3TMEA 3CW2C 2A69D 5M3FH 2L7RA 2NR2A 3BDOA 1JQ4A 4RGNA 4JI3L 4ICVA 1UWXA 4YWGG 2DNFA 1VS0A 3RYTA 4ID6A 3F8TA 3CC2A 4A3FB 4B95A 5EPLA 2WXHA 2JXXA 1B3AA 5IKCM 2HDLA 2TMPA 1G6PA 2EMSA 4CKEA 3SK6A 3EVQA 4WWNA 4IO9A 4PV1C 3I56A 2JA6B 1HTLD 5I9OA 1TZOA 2KCNA 2INDC 2RPVA 1UEAB 4NDXA 5FKAC 3K5MA 1S5DD 3PSEB 4DWFA 5L95C 4PK1A 2R61A 3GTGH 1EEFD 5H1SE 1K8OA 1HTPA 3AE1B 1QT9A 3M3JA 1TWFB 2HQEA 3SR1A 2MO1A 4GU2A 2QDBA 4X3SA 2E2HB 2BKFA 2NVQB 1K8AC 5M5XH 2UXCL 1RIPA 5EE0A 3BYYB 1A3UA 2IGGA 2JWZA 2L9HA 2WKCA 4NJCA 2BTEA 5LXIB 2O6VA 1A3TA 4L2YA 4BVUC 2WWZA 1NVID 1I5FA 3S2HH 2O2VB 3MXGA 2NYZD 1C78A 2BDNA 2J0TD 3GTOH 3K8AA 3U50C 2R7ZG 3VR9B 4FADA 2KDFB 1XJVA 2N0SB 4YSXB 3JC66 2R2OA 1SYGA 1YJWA 4A3KB 2BCOA 1RKNA 5C3EB 4GKJQ 4MACA 2LGIA 1I4PA 3IG3A 4LAAA 2M8SA 5AUKA 3JSVA 1X3QA 2IHFA 2XTIA 4X3KA 3FHWA 2JSVX 5HGTA 1LTBD 4L5RC 2M00A 4LFAQ 2BS3B 1SYCA 1BUVT 3B08A 1ESFA 5BN3A 3FKYA 4A3MG 4IM0A 4OONA 1Y8NB 5HY6A 4LK0M 2K03A 3D4RA 2N9PC 3S15H 1RDPD 1STYA 3PLUA 4AOFA 4NAWB 3AE4B 4HCEA 2K33A 1FXAA 2CHBD 4HPMB 4M0WB 2XVSA 4LUOA 2WXGA 2MO0A 1WY8A 1WRDB 2EVBA 3GOEA 4HAEA 1YNJD 2BWFA 5E7NA 5C1ZA 1HUMA 1VQDA 4BKGA 3FDTA 1PFMA 2JUOA 3NVVA 1C8CA 5HGQA 4A20A 2XK5B 1HZ9A 2D5GA 3EROA 2HJ1A 2KMMA 4IJHA 4M8MA 4A3CH 3WOFA 1MJEA 4BBSB 2KQ7A 3KBGA 1JWMD 1VJKA 1IXRA 1WE7A 3V6EB 4KVGB 1Q3LA 4A9AA 3NUHB 2EJFC 5IWAL 2Z6KC 4G7OC 2G4DB 4C7ZA 3S14H 3D6CA 1SLJA 3RN5A 4BWGB 1S5ED 2HD3A 3RZDH 2L52A 4KIKB 2MWSB 3D4WA 5HI1A 2HIXA 2ZNVB 2ZXRA 1XMQQ 4DUYQ 1SN8A 1PHJA 1NTGA 2LJIA 1UWVA 2ZPNA 2QW7A 1VQ6A 3OSOA 3FKIB 1NDDA 2GMIC 1HFGA 4FXGC 3ZGZA 5BN4A 3PF5A 3ZXRA 3M4QA 1SXTA 1WTPA 2WLBA 4C3JB 2KTRA 4U673 4AQYQ 2EXDA 5CTRC 2W3SA 4I7AA 1WX9A 1LTID 1NUCA 4FVMA 3CHBD 2DNEA 4Q0FA 1GHKA 4PT5A 1HH2P 1L0WA 3GTQH 4NJ7A 4ICUA 4X64Q 5JEAJ 1ZE3D 2BBCA 1XWEA 4K6LA 2PIAA 1SNQA 3CKIB 1KL9A 2F0OA 3TZUA 2LASA 2PVOD 2ZEQA 3MHSD 4FLHA 4K81A 1ICWA 1L0VB 3HRDD 1N33Q 4MN3A 1ET9A 4RWSC 3IT6B 1VCBA 1I94Q 5IYCH 3O65B 1SIJA 2B2TA 1ASYA 2D3CA 2WXNA 1G6JA 4PS8A 3BVMA 1V5OA 2GOWA 3WA0A 1EQRA 5T1IA 4C2MB 3OMCA 4R4OA 5JEAG 2OEDA 3ML8A 3NTKA 4MZ9A 4JYAQ 4FXCA 3PUVA 2L32A 4XE0A 1N9WA 1WM3A 3B9JA 1PFSA 1HTQA 1WYDA 1TWGB 5IP9G 1WCMG 3J80E 3GTJB 1JWUD 3PO3G 1X3FA 1YX6B 1D1IA 2KTFA 1V1PA 3S16H 4FJZA 4I7ZC 1NI2A 5AZGA 3GTLB 1MVKA 2GBKA 4MGKE 5DPSA 3MXNA 1IBKQ 1K9MC 4JI1Q 5EAYA 3HOUB 2NUCA 4EQPA 5KYIA 4CKBA 1R4MI 1X1MA 2BPSA 2JVCA 2L1BA 3KVFB 4K1RB 2EYOA 1QUQB 1XXGA 3QAQA 1IZ6A 2E5LQ 1QG7A 1HXYD 1STGA 1GD7A 4HN7A 5M5YB 1SIFA 1NMGA 3QQ8B 1LTTD 2E2JH 2R7ZH 2XN9C 5CV7A 1QOGA 3E9IA 2WIIB 1KRTA 1XYIA 4BS9A 1WSPA 3LXFA 4TUUA 1ASZA 2LSSA 3G7LA 1EO6A 1IBXB 1A0IA 2OXPA 2Q8IB 3NK9A 1QOFA 1JT8A 2KHIA 1UZXB 2EYPA 2ID0A 4JI3Q 3T9LA 3AEEB 3HOYB 1R4NB 4B0MA 1P16A 2JZ3B 4GSWA 1YVCA 1GUTA 2L4NA 1ZW7A 2JX5A 1JR0D 5M3MB 4HJKA 3S1QB 2ICIA 4OZAA 4IPGA 4TRDA 5IODA 2IWHA 1WTOA 1E8WA 2OWOA 4JI4L 3UDIA 1BCPB 3S1RH 4KV2A 4MH8A 1VF5C 2UUCL 2DGYA 3QIAA 2EKIA 5IA7A 1CJEA 1YQ4B 2W9NA 3J81L 3AE3B 3OHXC 2UXDL 5D65A 2CQOA 1ESRA 3D31A 3K7AB 3MVVA 4U68A 4RFBA 2UUBQ 1QJOA 3NHEB 1W6KA 4ME3A 2A5HA 4MELA 4JOIA 2DZKA 2F4VL 2B3GA 1OXTA 2WB1B 1EY7A 2EQSA 2BOSA 2Z9HA 4QB4A 3DPDA 1LTGD 4KV6A 3MTNB 4WAFA 3PO2B 1EYAA 4A4IA 2DUDA 2XNAC 4XT1B 4RMFA 1CHQD 1YEZA 2F52A 4K6DA 4XYQA 4HJ7A 1P0RA 5HHDG 1QCBD 1VQLA 3ZJUA 4MSQB 4JE3B 3PQIA 4RAUC 4S3SA 1PH3A 3DVGY 1C9FA 2LEKA 2F0EA 5D3IB 4TQUS 3CPFA 2KDBA 3K81C 5C4JB 2L8JA 2ASQA 1WXMA 4Y7NB 4KHZA 1HTOA 1YQ3B 4FBJB 1DGJA 4QL5A 2YTXA 4LF8L 1MBYA 1Y56A 4GKKL 4ZKCB 3W5VB 1SE2A 2F3IA 2ICEC 3N32A 3FAHA 3I9V1 1D1KA 2BS4B 3VYSA 5IP7G 4FN2A 2JJQA 2Z0SA 1VQFA 2KN5A 3CCRA 2QCZA 3HM6X 2V1CC 4YCWA 3OIQA 3TP8A 2FXQA 3RNUA 4BXXG 4KGTA 1CZGA 2Z6BA 1FRRA 5IGDA 5C0XJ 1I4RA 4I6LB 1QVCA 3R66C 2K8BA 4NZLB 2GN5A 1X6OA 2BW2A 3MC9A 3GTMB 3Q8CA 4P74A 4L23A 4BBRG 3GV3A 3ZTDA 1SYFA 2AQ2B 3DXJC 4US9A 4JGHB 5ELDA 3EBEA 2K1BA 4BBNF 3DBRB 3HK0A 5LLIA 1MSHA 4DF7A 2LD9A 5IE8A 4A3LG 5GXGB 4CYEA 4GS3A 5IYBG 1GAQB 3LDZE 2ZCBA 1JOQA 4CQNA 1PFNA 1TT2A 1K3RA 2JRIB 4PG3A 1VQEA 5JEAH 3Q6BA 1EY6A 4A3FG 4A3BB 4W9CA 2QHOA 1YN4A 4O2DA 2D0PA 1DGSA 4HMJA 4EKUA 5COYA 3RMKC 4P72A 4WFN3 4RGOS 1WCMH 2JA6G 3PO3H 3TREA 1Z5SB 2N88A 1WTVA 4JI7L 1D4BA 2CKZB 1PH5A 2WAQE 3UF8A 2BYEA 1E9MA 3U9SA 4LF6L 1Q81C 5ELCA 2C5CA 3TBLD 4FXDA 1JQYD 4JPBW 4ME5A 2NVYH 2KTRB 4LW1A 3N1YC 3SDZA 3RNBC 2JN4A 2ZJQA 4YXDB 3AN1A 3CCUA 5GAGC 2PPHA 2QGQA 3S1MH 3KLSX 5JVG3 3ICEA 4F7XA 5GADC 1E8XA 2F1MA 5MPOA 2D62A 4LNQA 3HEJA 1F0ZA 2K5WA 1PZID 4QJFA 5FR3A 1S3SG 3HRZC 2O5JC 1CK1A 2B2UC 3S24A 3A5UA 4BY7B 2KECA 4YSZB 2NB0A 2YV5A 1X65A 3A55A 3X3MA 2AX5A 2KQ3A 2KACA 2OQKA 4IOIE 4LTUA 4MGYE 2NZ1D 2Q2IA 3QK0A 3P4SB 2WB1E 1PFDA 2RSOA 4DAVA 1GC7A 1WJ4A 1FM0D 1XO3A 3AE2B 4KY7A 4DV4L 4NXNQ 1ET6A 2W82A 3JW0X 4ARIA 1ZOYB 2SNSA 3KF8A 4NXML 4A3KG 1WGKA 4N59A 3WDNA 1WF9A 1YJNA 3EECA 4K5VA 3UDGA 5C3EG 1JROA 4JK1C 1VQJA 2KO3A 2BGFA 1WH3A 2DJGC 1B8AA 3CQZB 4E74A 4DXFA 4IUMB 2WFWA 2H4OA 3DEOA 4GNXA 1HNZL 1I6HH 2DZMA 5AJ3Q 3HIZA 3NEMA 1TWHH 3C8YA 4CDEC 3IKJA 3N3KB 4HJ9A 3PUZA 3VDZA 3K59A 1V1PB 2KVMA 4DHJB 1UEBA 3SHLA 1SR3A 2MPMA 2V9HA 2JA5B 1TGZB 3M4OH 2I1JA 1VQ8A 2DWQA 1HJPA 1VQKA 3MXNB 3EC8A 4S17A 1Y1WG 2C9WB 5LMNQ 3CC4A 1JWBD 3H7PB 4GN3B 4LJZC 4DPGA 2OTJA 4F87A 4RHSA 3W1SC 2H1EA 5A2QL 4APVA 2YTVA 2IGHA 1C4CA 2FIFA 2QIEB 3TUOA 2DHZA 1E3PA 4JI5L 3A7AB 2MP2B 2LI5A 4J8QA 1CQVA 4BBSG 1GC6A 1D5MC 2N3SA 2D11A 4K5WA 1IYVA 1MKHA 3TZDA 2RA4A 3S17H 3JAME 1HQRD 1HE8A 4X62L 3SK5A 4KJOA 1ISNA 1IBML 4DAYA 1STHA 2EYMA 3U9OA 5IGBA 5J17A 4OX9L 3KYCD 4KN7C 1KAWA 3P1HA 3T56B 4KKJA 4JPSA 3TEXA 3TL5A 4YWMA 5IP7H 1EY0A 1K8RB 3PRMB 2RDFA 4A3MB 3HUIA 1E1OA 2LFNA 1VQ9A 3AFQA 3APCA 4ACFA 4WRDA 4PMWA 2KQSA 4BAXA 1PGBA 1B3QA 2WP9B 2EPBA 1QKZA 4YCUA 4AYBE 1DM0B 4PQXA 1S5CD 5T1GA 5IT9c 2NVXB 2MRPA 4C3JG 3ETRA 4JI4Q 2KC1A 4ZOHC 2KYWA 2NTTA 3MWYW 3NZSA 2ONQA 4WJNA 3DEPA 2UXDQ 2KAJA 1HZ5A 1UE6A 1G291 1CA5A 3I5JC 3Q3MC 4R4IA 3T16A 3H3VC 2INCC 2WXLA 1HNWL 2MJEA 2WXFA 2F3VA 4A3LH 5C0XH 3FILB 3QOJA 1QWYA 2L05A 1VQ4A 5J22A 2KNBA 3EA6A 3F2CA 2IY5B 2HD5B 5IOIA 2BB5A 2I2YA 1PXUA 2MP1A 2KCCA 4YWLA 4A3FH 5EPKA 3DHHC 5DCNA 2WNMA 3IVFA 1Z7TA 5IGGA 3ITPA 4KHPL 3MFYA 1L5PA 3NVZA 1OTCA 1Q1EA 4C3HB 4XIGS 3TSSA 5JAVA 4XTCS 2VRRB 3DBLB 2L55A 2MNAA 1GNUA 4QUCA 2WS3B 5C4XB 3L16A 4W9HA 3I72A 3HG9A 1KXLA 2ZVNA 4LF8Q 1VZ7A 5FLXE 3PIPA 3Q3OC 4LJOB 2AKWB 1IYFA 4DN4M 1P3QU 4A3EB 3APFA 1TWFH 3LB8C 2KEDA 5DPTA 4REZA 4ZRPA 2G9HD 3EIVA 2E2HH 1TTNA 1TU2B 3PUYA 1BCPF 2NVQH 1L6UA 4OVZA 2RVLA 3IL8A 2PI2E 3HOUG 3K58A 3AMUA 2HCIA 1VQGA 3NP8A 1XF5L 1TIID 2PTLA 3V6CB 2KX3A 4K7SA 5EBCA 2HE7A 5KHOA 3S1NB 3RLNA 2L00B 1M94A 3PT2B 2L0TA 3RZOB 1C76A 1QQRA 1VQ7A 4FF3A 3RT3B 5GMVA 4HKZE 4IW0A 5BYRA 1LT5D 4GKJL 4UY8C 4F7ZA 4O0AA 2ACZB 2F0SA 4FF4A 1B70B 3EFUA 1C3TA 4A3KH 4LWCA 5IYDG 1PYWD 5C4ZA 4HLEA 5C3EH 1PH6A 4IM2A 4LFAL 2B63B 4JV5Q 1SNCA 1UE7A 3L3OC 1UBQA 5IIFA 2Y5CA 3M62B 3J81i 4WJ3M 4C3IG 3CSTA 2KD0A 3HOYG 2LRWA 2WDTB 1T3QA 5J1ZA 3MFGA 5M3MG 5IGFA 1ILPA 1KRSA 2IX0A 2VH2A 3DHIC 1STBA 4B3TQ 4H0LC 3DDCB 1GO3E 4JWSC 2K50A 1YQBA 2EE1A 3HOWH 2AL3A 2J0MA 4MH0E 4A3IB 4JI7Q 2PZUA 4QQBX 2V4DA 4IFDJ 2ZJDA 1SMXA 3Q8AA 3NPPA 4LF6Q 2LFIA 4XDDA 2F3WA 2Y0SB 3FVQA 3M4YA 4ULLA 3GV6A 2WP8J 1EZ6A 3N9YC 4RMAA 5FJ8H 4TV3A 2KQ4X 2WB1G 3NUCA 4GN4B 3FC4A 4KKSA 2W55A 2MBQA 1VQIA 4RGMA 1U4AA 4AWJA 3K0YA 3RLFA 2B2YC 4Z9CB 4BBSH 4QUFA 5I6WA 4HIKA 1C79A 3UGBB 4POFA 1FRDA 4NNJB 2K01A 5T8IA 3SE0A 4YHHL 1SE4A 4EE2A 1PV4A 2LGSA 2C9OA 3C1EA 1OXSC 1S1QB 4HPPA 4XQJA 2N4FA 5E6JA 4HEDA 3NY5A 3H0GH 2A68D 1RWSA 4JWUC 4QIWB 4LNOA 2A1AA 4NPNA 3VUXA 2AQ3B 4K2LA 4NXMQ 3KUCB 4GLSC 4G11A 1Q1OA 2JP1A 2VL6A 3VTWA 1T9HA 2R6GA 2GBNA 3QO2A 5BMGA 1HNXQ 3FKIH 1HNZQ 4RNAA 1L1OC 1RD9D 4KD4A 3IXSA 1PYBA 4C3JH 4QY7A 1ENFA 2Z6KA 4GDLA 1EUJA 4RG1A 2JA7B 1V1OA 4X64L 2FUG1 1L4DB 2VZKB 5D6JB 3V2TA 4RH6A 4Y52H 3DQVA 2OCEA 1CSPA 1JB7A 1N33L 2B2WC 2WXIA 1FXTB 3MC8A 1B9MA 3H15A 2NN6G 4GN5A 1QILA 3WIMA 3UI2A 1N32L 3Q24A 2RF4A 4CDCC 3VR4A 1EY5A 2XBBC 1A5RA 4X65Q 3I3CA 1E2WA 4JYAL 1MFWA 3M3YB 1PRTD 3D8GA 3BZCA 3EFCA 5KHQA 1Z6HA 3B2GA 2ZTEA 5EKIA 5G5HA 4C2MH 3C0RB 2B39A 2FINB 3HOVG 1DXMA 4Q5VA 4ALPA 3A8KE 4X62Q 3VUWA 3NHHA 1IBMQ 1BR9A 1W3SA 4LF9L 4KTAA 2NVUI 1TWGH 2V4LA 4KZCA 3GTJH 1LV9A 1VCIA 2JEAI 1R4MB 5CGKA 4OX9Q 1FD6A 1P7EA 3KBXA 2F0UA 4K14A 5E6PA 4WIPA 2MJ8A 3QR8A 3BU2A 3OMGA 4DK1A 3MAQA 2FBWB 2KZRA 2M1MA 3GTLH 2DYBA 2NTSA 3OW7A 3SVMA 4WJWA 4RKLA 2MBEA 2E5LL 3HOUH 3CAMA 2NBUA 3URYA 2JE6I 3M7GA 2BVCA 4JBMA 4BBRB 3J80c 1V9JA 3B1LX 2JZPA 2KJ6A 2N9XA 1IHZA 4OO1I 1RFAA 1V97A 3KWLA 4PZ7A 3ZNID 5M5YH 3CIRB 1MHXA 5DPRA 4HSVA 4L6TB 3UQBA 1C4QA 1Y14B 4BY7G 3CPWA 1SAPA 2L15A 2K5DA 1JOKA 1NI3A 2DYOA 1TWAB 4OWXB 5IYDH 1NEKB 3A1QA 2DY7A 1HNWQ 4BKSD 4P73A 1L0YB 2EKEC 3U7DA 1PGXA 1CKNB 1XNQQ 1E7ZA 2BDOA 4NP5A 2ALYB 1A3VA 2D2CC 2D9UA 5M3MH 3A56A 3S1QH 3AXCA 4KHPQ 1YNJC 4R3DA 4DR6Q 2R93H 1X56A 1WD0A 2IO3B 4C56C 3OW2A 3AU7A 3K80C 2O2LD 5JJKA 3P7JA 2UUBL 3TCAA 1HFNA 3BS1A 4DR3Q 4BA2I 3X23A 3AB9A 4HR7B 5I2XA 1YJIA 3ZNHB 4UPAA 3ERSX 1QNKA 2JA5G 2RR9A 2OEOA 2F0QA 3H3VI 4YT0B 4FHJA 1EIFA 3L7ZC 4HSPA 3K0XA 1XLQA 4EZLA 3A5ZB 3TS0A 5J3BA 3PTFC 2J7QB 3PV1A 4QMGA 1H9SB 2L0FA 1TKEA 4BBNC 1QF6A 2RCNA 3DVNV 5AUIA 3PO2H 1EF5A 2UXBL 2BT6A 3EN2A 2J42A 3DHQA 3TDQA 2IT1A 4IFDH 1FO4A 4K8IA 4B3SL 4ILWA 3AB5A 3DM3A 3BZDB 1RTNA 4W9GA 2DBYA 3Q22A 2A5UA 3I4LA 4L5QA 1TQOA 4XDXA 3U4ZA 4EGVA 2Q2TA 1ENAA 5DNFA 5ISRA 2KFKA 3R7RA 5C4JH 3H1UA 5C6AA 4DUZL 5FO7B 1EL0A 4Y7NH 1FFVA 1OTRB 1W2BA 3AU5A 3RZFA 4W9EA 3ZUNA 2JA9A 3LWEA 3RN9C 1Q46A 3I90A 5AFWA 3JYUA 1R9TH 3GTPB 2IZVB 5JJIA 4ANUA 2DZIA 3L0WB 3D4DA 2PO4A 4EQNA 5L37A 5G55A 4C7YA 3AFPA 3UQAA 2KJHB 2CCZA 1LT3D 1TWCB 4L8JA 2GVBA 3OWEB 2WKDA 4K7WA 2F03A 1HPCA 1Y1WB 5KIXA 3CMAA 3KW5B 4IPHA 1NYQA 2BS2B 1BUIC 1WXQA 2D3GA 2NZOA 2KMAA 3VQIA 3GTMH 2C7HA 3AEBB 4FDBA 3E5SA 2NN6H 2QDLA 2KOLA 4JIOU 4KJNA 1GVPA 1QVGA 2K6DB 3BWUD 3VA7A 3PSIA 1K0SA 1VDVA 4KDLB 5JXVA 1HHVA 5KNDA 1GM5A 2K32A 2KN4A 1WXSA 3W5OA 2LRUA 2K05A 4A3BH 5LMNW 2VUMH 4NMZA 2KLCA 1RYJA 3L17A 4GB9A 1WGGA 1VQOA 2AWNA 2NVTB 4YHHQ 4C3HG 2N1WA 1MI0A 4QF4A 4C4VA 1ZP0B 3QOLA 4MIUA 1WFYA 3E56A 3TJPA 2YU9B 2Z59B 5EKKA 4R1JA 4G7HC 4A8XC 4IWPA 4ABNA 1F9PA 5C4XG 1LQBA 3NE5B 1FNWA 5CR3A 3EJIA 1E7VA 2JEBI 2OHFA 1HZAA 3HHMA 2MSED 4A55A 4JQWC 4A3EG 1B4OA 5C5MA 3RR5A 5LHY1 3Q3FA 1M4VA 4B6WA 2EY5A 3PRPB 1SMYC 4KY6A 2QMTA 4II2B 1WFQA 1ZPSA 4K5XA 2KJRA 1S72A 4R8NA 4IWQA 2CKHB 3GD7A 3A7LA 3NWTA 3KWVA 1RRBA 1PRTF 4BY7H 1PVOA 1UD7A 1YN3A 4N6EB 4CHKA 5DAUA 4NXNL 4O42A 4C00A 3PMFA 3NQIA 2UU9L 3I3TB 2DAJA 4LK1C 2DNCA 2OOBB 1YOVB 3LJ3A 2KA7A 2LKVA 4R4CA 3PHWB 1P7FA 4JI0Q 1N32Q 2CJNA 4W9LA 5AJ3L 3AECB 3P42A 1RF2D 2N49A 1UE5A 4GOPA 3MC0B 4W9IA 2B63G 3CQZH 5ELEA 1E10A 2I5HA 1GJXA 4A3DB 1R7SA 2QC8A 1A15A 1NMFA 2HHHQ 2RKSA 1IUEA 1B44D 2B2UA 2QF7A 1K28A 5CV6A 2LJ5A 2W3RA 3I63C 2JPHA 2KC2A 1TJEA 3OJ4B 1TY0A 1T6BX 5E4WC 5CHFA 1DOMA 3IFDA 2VQFQ 5LMNL 5H8YE 4EX5A 4WWMA 1SBBB 4LUVA 4E3CA 2N55A 2KBNA 2JA5H 4LF9Q 2GI9A 2J4XA 3HVZA 3DM1A 2EYHA 2Z0EB 4URKA 4QGUA 4A3IG 5EE3A 3GZNB 5E6NA 5C44B 1SFOH 1WJ6A 2Y0SG 2LXJA 2AUJD 1M1KC 4B9WA 2JA8B 1UGJA 4EQOA 1Q90A 1ZXHA 2V3SA 1MHHE 2MW5A 3QB3A 3I57A 4IKGA 3AEFB 4OWTB 1K8GA 4DR2Q 3I4NB 1HZ6A 2PI2A 2CW0D 1FXIA 3U2SC 4N8FA 3K57A 2AWOA 4KY5A 3KF6A 2HTME 3A1QB 1SMYD 3DHGC 1EOTA 2DJFC 1TS5A 1OQYA 1YJ1A 4HROA 5LL6X 4C3IB 4DK0A 1V8CA 1DOLA 3W1SA 3PV0A 3D3RA 2KK8A 4A3GG 3KLSA 4FHKA 3L10B 4ZRQA 4DNTB 2KDIA 1XX8A 1OFFA 4A3MH 2C7MB 1FD7D 3JAMc 3KJOA 1W6JA 2HQLA 1V8QA 5J18A 2IYDB 4HDQA 2MQHA 1V49A 1QB5D 2PE6B 3AH7A 4KGSA 3SU8X 3U4VA 4UDUC 1BCPC 2KCTA 1X3GA 3DWQA 4LFCL 2NVXH 4LFBQ 1RM6C 4HDOA 3W3AA 2JA7G 4F88A 3BYTB 1PH2A 4IALA 4IUTA 3ULLA 2IGDA 1J0GA 1LTAD 1PH1A 2OF1A 5KNCA 5C0XI 4A93B 1AH9A 2O6VB 1CI3M 3DBSA 1BF4A 3L13A 4YY3L 3TEYA 1E90A 3AI5A 3Q69A 4DAPA 2FFKB 1WE6A 3NELA 2KWDA 3G4SA 5CHVC 1Q82C 2J7ZA 4DK6C 5C4HA 4LJPB 2MCNB 2UXBQ 3Q14C 4IQZA 1UE1A 4DV1Q 3GTGB 2NZHA 1DJRD 3M7NA 2M17A 2MLBA 1EY8A 1U4MA 5FLXL 1ZYRD 4B3SQ 3RLOA 1SE8A 4KLKA 1FFUA 2F0MA 5JVH3 4JL9A 1AE3A 4DAMA 2M56B 5BR8L 3GB1A 1FR3A 3Q8FA 3JSVB 2L0CA 1XPUA 4JI6L 1P9DU 1ZXIA 3AULA 4LDTB 3I4MB 4KSKC 5BYSA 3ONAB 1O80A 2R92G 1JMLA 1X32A 4DUZQ 1C4AA 2KWCA 4FJVB 2KENA 2CWAA 3CU7A 3Q0AA 5C4XH 4ZK9B 4P7IA 1QE6A 4IWOA 1SF0A 4CDDC 2R7DA 3AM9A 3BG3A 1EY9A 3IT4B 4B9KA 4BOSC 1KLGD 4K7UA 1Q8IA 1Y8PB 2P5ZX 2FUHB 2JWUA 5M5WB 1SYEA 1J7CA 4B0EA 3ZXVA 3TP5A 1NENB 4TSSA 1IL2A 2ZT9C 2C60A 2HIVA 2QILA 2TSSA 1N60A 3ND9A 1JRUA 3AE8B 5IO9A 4HRSA 2UU7A 3S1NH 5FLXc 2BWES 4ZRZA 4MNOA 3RZOH 4DV5Q 1BCPD 1VF7A 4OWWB 4PMBA 4TKNA 5G2NA 4ZYSA 5ELNA 4JV5L 1L2FA 4RCOA 3QJYA 4G3XB 1TXYA 2KKCA 4LMQD 3K5LA 3BJUA 2INNE 2YYZA 2RBMA 1YBYA 3N1ZC 4DDID 4BZAA 5JHAA 4MJSA 2ZZPB 4BY1B 2B63H 1MJCA 2FCMA 1TS2A 2K3UA 2WQYB 4IC7B 3HOVB 1PZJD 2RQXA 5KNBA 1UNSA 3GTKB 3L0OA 4B3TL 2CS4A 3NQTA 3HP3A 5G3LF 2DX5B 2FCSA 5IP9H 3H6NA 1BT0A 3UINB 2R7FA 4DV3L 1J19A 2EDGA 3ZDTA 3TEWA 4ZKBB 3KUDB 2GA4B 3MA2B 1B50A 3I7FA 1T0RC 1H8CA 3G6EA 1N8RC 5E4XA 1YNND 1F9SA 1EF1A 4HCSA 2F0VA 1Y8RC 2WDVB 1DOXA 1IKLA 4LLGM 4P1CC 3PIO3 2MEKA 2YEPB 2ZTDA 4GOPC 3P20A 3V62A 3WCQA 1T0QC 3C3LA 2PVGC 1UF0A 1PMRA 1BBXC 2KVZA 3R7QA 3ULPA 1TKYA 3NOBA 1F77A 1HA5A 1K83B 3I70A 4RGTA 1UBIA 1HZCA 1UH6A 1QNUA 5AZHA 2WXKA 5IAAC 1O7IA 2PYKA 4IUPA 4K0KQ 3MEFA 3R3MA 1U4RA 2QKIC 5EJWA 2JY6A 3VAWA 2VNUD 2KANA 5JJZA 2PZTA 1IBLL 3CCSA 1BO0A 5BMHA 2A6ED 3KJPA 2UU9Q 4KKTA 5KGUA 1XD3B 5C3WA 1YNTE 2WX0A 3KK7A 4WJPA 1KDAA 1L4ZB 4JBWA 1HNXL 1SGHA 2QDFA 4X66L 4RM8A 3GTQB 1CQFA 3PIOA 2K8HA 1WZ3A 1G91A 2B2YA 1NYRA 2HCCA 5CBAE 3J9CA 3RFZB 1OEYJ 2XRSD 2B29A 2IO1B 3APDA 2D0OA 3OYYA 3WOEA 1PTOB 2LS01 2ZM6Q 2CHXA 1QZHA 1Q12A 4A3JG 3M9BA 4NAMA 3CRLC 4LCDE 1WXVA 3V60A 4XYCA 5D7GA 1T0SC 1TIFA 2JA7H 3HOZG 3WWVA 3I2ZA 1YHQA 1VQHA 3DOWA 2WYQA 1E1TA 4X6AH 2G45B 1V9PA 2Z4IA 3GQBA 2FE8A 2NPTA 4DK5A 2NWGA 3VR5A 1KD1C 3T51B 2KEEA 1KNEA 2K75A 3BVZA 2VZAA 3PZ8A 3R3OA 1KJTA 2MHJA 4X65L 3CCVA 3BDCA 3D32A 4XYOA 3P4PB 3KUPA 1XMOL 1LACA 1TS4A 1KFYB 5IT9L 4HIDA 2IY1B 4WORA 1L1OA 3CRKC 3AE6B 3J7AV 1FGUA 5HKHA 5CORA 3U58A 4FF2A 4GLAC 3MJ5A 3X0WA 3NBHA 3M3YH 4K8JA 2MH7A 3ZQ4A 2N78A 2PZWA 3ZKJC 2Y3AA 4E71A 1HZBA 1YX5B 4BKSA 4M02A 4N9PA 4JG2A 3CMEA 1K73C 3ZNZB 1UAPA 3NTHA 1QOBA 4DFAA 1WJUA 2B2WA 1LUZA 3K6OA 4HJAA 1WR6E 2EJGC 1A62A 1JE5A 1Q0WB 2RDGA 3EUB2 3ML9A 4K3CA 2NMQA 5EBDA 3UE0A 3A54A 3WANA 3ZIMA 1IW7D 1FGBD 4BXXH 5C3JB 4GZYC 4DV7L 1WX7A 2CR5A 3R93A 3T4AC 1KRHA 1P1AA 4HMIA 1JJ2A 2K5PA 3MXUA 3U52E 4DV6L 2LXKA 1DD2A 3T3OA 4BBRH 5ELOA 2KLGA 2L1AA 1LTSD 4LFCQ 2BA1A 2IL8A 5KEEA 3QA8A 1XPRA 4GMVA 4RCNA 5IGCA 2E74C 1E2VA 2NS5A 2L5TA 4DHJD 4KDIC 2CU1A 3M63B 3H9DA 1EY4A 5IYBH 1N6ZA 2N1VA 1H9KA 4B08A 4CJ1B 1TWAH 4YY3Q 2Y5BB 3FPUB 3IHPC 1XNQL 2WU2B 2JK8A 1C4PA 1F1HA 2BQQA 1EOVA 3NS8A 3D6WA 2KHSA 2CQAA 2IPKD 2SNMA 4IN3A 4UP7A 4DR6L 2FCNA 4HXDA 1MG4A 1CTMA 1YNXA 1WI0A 1A2UA 1PFBA 2REXA 1KABA 3VDYA 2JA6H 3Q3JA 4A6QA 3L08A 1KOTA 1YIJA 4DR3L 5DPWA 2I1KA 4A3DG 2DN8A 4M1UB 2PKOA 3STBC 2K5VA 3MJWA 5BR8Q 2VQEQ 3ZW3A 1N34Q 4JI6Q 4IPDA 1PZKD 3J81E 2RGFA 1RTOA 1J6QA 4CJ2C 4LNKA 3NENA 3H91A 3KFUA 4PS7A 4YTNB 3RI7C 4XQNA 2QA4A 1EIYB 1LXDA 3PS6A 4DBGA 3ZJTA 2NBWB 1I4HA 3BDLA 1GG3A 4DHZB 1PH8A 1KDBA 4ZLTF 1RAXA 1EWYC 4LF5L 5C44G 1WMHA 1JWSD 4IFDI 4EOYA 2VH1A 1STEA 2PLPA 2JA8G 4MM3A 1DYQA 2QCPX 2A6HC 2B2VC 3A0JA 2A68C 2K8CA 5KYLA 1U4PA 5CV9A 4DR4L 2F0WA 3I4NG 1EUVB 2Q8RE 3VTVA 3P1MA 1J8CA 4UP8A 2V4IB 1FL0A 3C2PA 3VYTA 1IL8A 1WJNA 2D3BA 3HKSA 3ERQA 3ALBA 1PH7A 1VRAB 4ITKA 3N20C 2LGDA 4MJSB 1OXVA 3HOXG 2CU3A 2XRQD 3ER0A 5JOBA 3GO5A 3HGBA 3Q6SA 3FRPB 3VR6A 3RUZA 4RF1A 3GTPH 2XEWA 1VQAA 3CSFA 1E7UA 3B6YA 3C19A 2NBFA 4FNFA 3DBHI 2LXAA 3VXWA 1ZKHA 2OQ0A 4NPSA 3W1YA 2ZXPA 2O2VA 1BNZA 2LVQA 3TMPB 3UDFA 1PH4A 3T8MA 2GLSA 4JX1C 1TWCH 5C2TB 1Q5WB 2ZW1A 1Y1WH 2RSUA 4DV3Q 2BKRB 4O1NA 4MT5A 4WWPA 1CSQA 4GGQA 5FK9C 2K1FA 3FMCA 1AYFA 2LMCA 1G8ZD 3N1XC 5NUCA 4JBJA 4G7ZC 5EKLA 4CHTB 3STBD 1PRTC 3T1HL 3ZJYC 1RHPA 1PGAA 1XTDA 2E8GA 4PNYA 4XX5A 1E0BA 4G4KA 4LF7Q 3K9OB 4A93G 1F9RA 4OIJA 4DR1L 3C1FA 1KF6B 3IAS1 4LNNA 2EMTA 1WI5A 1ACCA 4BFRA 3ZVVA 1UUPA 1AP0A 1E7PB 1ZDXA 3BY4B 3ENEA 2I0QA 2Z4HA 2BYFA 4V190 3SFEB 4GDKB 3L9AX 2ZPYA 2MUYA 3RUIB 2J0JA 2W54A 4ZRKA 4M0WA 2KMCA 2ZXOA 3EFXD 3KF8B 4R8IA 3CMMB 1ZDVA 1BOSA 4OZCA 4A3GB 4OZBA 2A6HD 3M85A 1EWIA 2NVTH 1CT1D 4GNXB 1PH9A 1IBLQ 4DR7L 3I4MG 5JH5C 1G2TA 1ZUD2 2YU9H 2XK5A 3T53B 3CCQA 2JT4B 3VUYA 5LNK1 2Y5PA 2MFIA 4C1NK 2DY8A 2K52A 4X66Q 3AQQA 1F9JA 1PDQA 1SNMA 1L7YA 4DU9A 1AZPA 4XWTA 5H92C 1AE2A 3LWUA 1CMXB 3NRZA 1CFMA 4KIKA 1SEBD 1I6HB 3NWSA 4PMCA 1A2TA 2Z0DB 2YEPF 1EQVA 1KAAA 3AEVA 3A9KA 4JI0L 3Q8EA 1LT4D 1L1OB 2SOBA 1FEHA 1D3ZA 2UYZB 4C1NI 3E0EA 2O4XA 1GB1A 3J80L 1IGDA 1TKGA 1P8LA 3B2FA 2E75C 5ELFA 1GUWA 1XMOQ 5D14A 4KD3A 1CZPA 3A74A 1B9RA 4DAYB 2HHHL 4TVAB 3PGZA 3E3XA 2M0XA 4NY0A 3LNNA 3A33B 4BY1G 2Q2HA 1N5XA 1E22A 2L76A 4NQLB 3DLLA 4BOZB 1ILQA 5GAEC 3RD2A 4A3DH 2VQFL 2R92B 1GPXA 4R9WA 3HKZG 2IY0B 1X54A 3VTUA 2RDHA 2F0DA 5BYQA 3NS1A 4G57A 4ODGA 2RD0A 1K0RA 5LMUL 2B3AA 4HIMA 4IPCA 3BINA 2E6XA 4RA8A 4IOCA 3TP7A 3A8JE 1YHAA 3A8IE 4A3CG 4YSYB 2BYTA 4HKQA 5EGTA 1EYGA 2EY1A 4PZ6A 2JRHA 4HPLB 1E8ZA 1OQQA 1RCVD 3BIID 1SJHD 2BA0A 2K39A 1PTOF 1QVFA 5A2QE 3WAMA 3TIXA 4IM3A 3QX1A 4DR2L 2WINB 1CKMA 2JA8H 1M90C 4DV7Q 4OVVA 3VR8B 1R4PB 1EWCA 1KLUD 1R4QB 1TVXA 4H13C 4DV6Q 3G71A 3I4NH 2BYVE 2K22A 4WQOB 4XC2A 3RN2A 1V1QA 5CV5A 2Y0SE 2KJXA 2F0FA 1J7AA 2CHWA 2MHVA 1BXTA 2AEHA 1EYDA 2G1EA 2DLBA 1JORA 2VZKD 1FNUA 2KX0A 1WYWB 3BZKA 2AWTA 2WX1A 5CC4A 5EE9A 4C3IH 4JW0A 1IPGA 4WWOA 3VVWB 3HOYH 2HJ8A 2Z1CA 4HCNB 4DKAC 3KUZA 3S2AA 1WRIA 1C9OA 1GHJA 1VZ8A 1QUQA 1XNRQ 1BKBA 5GQOA 2WDRB 2FMMA 1SNDA 2N7JA 2BE5D 2LXCA 3K5NA 3H6MA 4LFBL 1RLFA 1T5EA 1NJIC 3PZDA 3DWGC 3OG5A 1MGSA 4YTPB 1DCZA 2K6AA 4J15A 4ZRIA 4V0BA 1IBXA 4QIWE 3TEHB 3I73A 4DDGD 3K7AH 1SNPA 5IYCG 1I42A 3CF5A 3RMHA 1VR9A 1NY4A 2QEXA 4IOAA 1WMHB 5EDSA 3A9JA 4OIKA 1MI2A 4A93H 3RULA 2M19A 4BKTA 4TMAB 4D2KA 4MM3B 3J7ZC 1WGDA 3QJZA 4DV1L 2HDMA 2MGSA 1A8VA 4LF5Q 5IP4D 1D5XC 4N8X1 3CD6A 3RNAC 4CKCA 3RNFC 5LXHA 4P71A 2WACA 3N6RA 4DR5Q 3F2UA 1WGYA 1LGRA 1I4XA 3NTIA 2CFMA 3U8ZA 2RSNA 1GUSA 2N7EA 3BK2A 1FJGL 4DR4Q 3SGIA 3VR2A 2BB6A 2EJMA 1KHIA 4YL8A 1GOZA 4TKOB 4R4QA 3DBLI 3ONSA 1NNXA 1ZEQX 3R2TA 4KN4C 4DNIA 2D07B 1VD2A 2LVPA 5DM73 2KHJA 3I4MH 5HG2A 2OJWA 3W9CB 5J39A 5DM63 2PMZB 4I65A 2EY2A 3Q8BA 4IG7B 4AUQC 1XTCD 1WTWA 5DLQE 2HDEA 4A3JB 2K25A 4JC0A 5K5PA 4M8NA 2FCQA 3UI3A 3E0JA 1QOHA 4NB3A 4QAYA 4P6VF 4OO1G 1H9JA 3HOZB 3OOCA 5M5WH 3DWPA 3QCAA 3T1YQ 2RHSB 2A73B 1S5BD 3SK8A 2LMCB 4H02A 4B3RL 4ZHOA 4DV5L 2DZJA 2RHQB 5CV8A 2KT7A 2WXJA 1JE4A 2CHZA 3MHBA 1JMCA 3NVYA 1EU3A 2V3NA 1FVIA 1I50B 2MBHA 1U4LA 2GB1A 4N58A 1Y1VB 2I5LX 4YIJA 5D3DA 2FMCA 2H5XA 4HJ5A 1H95A 1DOIA 4GOCA 1IYJB 3T1HQ 3S2DB 4XDCA 4G50A 1CUKA 4HJGE 4GLXA 2HT1A 4GIVA 1LTRD 4DR1Q 1YD8U 3QIJA 3HOWB 3AYHB 1JJGA 1ICFB 4K3BA 1J7BA 4BY1H 2K5QA 2D2QA 3HOVH 1GKHA 5E1FA 3GTKH 1TY2A 2V3PA 2WXOA 1F2MA 1WOCA 1EZ8A 2N9EB 4XQQA 3BVGA 2ZNVC 1TZ1A 2LZ6A 3HVDA 4DV2L 4W9DA 5C23A 1BVSA 1IKMA 1EIHA 4FYDA 5G3LD 4DR7Q 1PUTA 3F2BA 1KIXA 3KH0A 1UWMA 2LHDA 3G6JB 2CW0C 1P98A 1WGHA 1GUGA 4L5SA 4GDLB 1Y8OB 2PNHA 2AL6A 2MBBB 2KVRA 1YIWA 3SDLC 2PQAA 3PF4A 1NBFC 1J5EL 1IGCA 3H09A 3T3NA 4P2CB 3AEAB 1WTXA 3H0GB 3TRZA 4K0KL 3SXHA 4CJ0B 1CHPD 4W9JA 1K83H 1T5XD 3FEWX 3NZ3A 2WV6D 2GBJA 3A9KB 1IYUA 1JC7A 3CWIA 1F2LA 1I3QB 2EZVA 2XSCA 4XXEA 2WXQA 3P63A 3OAWA 3H94A 2ZJRA 3RPFC 5CHWA 2BF8B 3ZDMC 1IP9A 4WJQA 1EFWA 4X3TA 4DGZA 4WJ4A 2NBVB 4XZ4A 1FNVA 2FJ2A 3D0FA 1LM8B 1F2ZA 3E9HA 2RPQA 2ZM6L 3HM3A 1PDXA 2KXJA 3MZ5A 1NAPA 5EE1A 3IAYA 2J53A 3WAPA 1HR0Q 2KDEB 1PTOH 4I6PA 4II3B 3AV8A 2XIWA 1U5KA 4B3ML 1FCLA 4CBVA 1JJCB 4ASWC 2HTHA 1V43A 4WURA 5LMUQ 5E6OA 3ND8A 4OELB 3V96A 1I4GA 1BMLC 2PMZE 1YJ9A 3JAML 1S4ZA 3Q23A 1N63A 5J2RA 1ZYRC 2KHWB 2F0GA 1YMHE 2D3AA 4MGIE 3I8ZA 1KC8C 1QLBB 1U9RA 2V0GA 2F0HA 4MSMB 3KYDD 1GJZA 2C7NB 4HVBA 5EPJA 3T13A 4DXGA 4KZ0A 2E2IB 1Y69U 3CP0A 1NR4A 3KYHC 1V80A 5A35A 1LM0A 1SROA 2M2LA 2PW9A 3BK1A 4ARCA 1NR2A 1OXXK 4ZCKA 3HOXB 2CJOA 2PJHA 2VS1A 2BH8A 2QJLA 3U30A 1S40A 3EGRA 2X69A 3VHTC 2RDBC 3DVNU 4YCVA 3H7PA 3CCLA 3PO0A 1L2NA 1D8LA 3A4RA 1II3A 5FO9B 4CDFC 2V1YA 2QSDA 3MP9A 2EXZA 3NJTA 2DAFA 3MHZA 1Z9FA 2MP2A 4AJWA 1JB3A 4OO1H 5M3FB 1FCCC 1OQRA 1WJJA 3KQ4A 2X6LA 3OIPA 4GDKA 1N5WA 1YJJA 2WAQB 3AE7B 1MJDA 1AZQA 1M8AA 4A76A 3QWNA 3J80i 5L83A 3W1GA 3EHVA 1K50A 2IBIB 3A9JB 2F0KA 2Z8LA 4H2AA 1C7YA 5C3XA 1VQNA 1WR1A 3PPAA 1NE3A 5G5GA 2EIFA 3L4PA 1KTKA 1JRPA 1VLBA 2R93B 2K9XA 1KM7A 1NCVA 5LL6S 3OTOL 4MEMA 3W5UB 4EZKA 1QZEA 3I91A 3QG1A 2JXTA 4G0NB 3IRBA 3P75A 4OHJA 3DWMA 2K4KA 4KK7A 4KSLC 4ZYNA 2PW7A 1SRUA 1B1ZA 2KFKB 2MJ3A 1DZ1A 4JVZA 4X3UA 3CCMA 3RZWC 2E76C 2R2QA 2F0IA 2PPBC 1TR5A 4QCLA 1YNNC 2VQEL 3GE3C 1N34L 4C3HH 5M5XB 1U0LA 1V6EA 1YN5A 2MA9B 3VFKA 1FJGQ 2MX2A 3H3VH 1MHWC 4I6NB 5BO4B 1CKOA 1N62A 1E6EB 3P4QB 5TR5A 1STAA 1HEZE 5CMDA 1SSNA 2UXCQ 4K2KA 2JZZA 4L5TA 4GXBA 1CA6A 3S2HB 4M01A 3FILA 2OTLA 2AUKA 3AEDB 2B8GA 5I9PA 4A3EH 4N9F4 1J8IA 1WVLA 4EUTA 3GTOB 4JI2L 1QZGA 3WAOA 1E24A 1O7ZA 1JALA 4A3PA 1GXDC 5F2DA 5CX3A 1JOOA 1V2YA 1VMCA 1Q86C 1RJTA 3JVZX 1RODA 4AP4C 1TBEA 1HCZA 3TBIB 2C5LC 2A6EC 2VXWA 3J81c 2RMMA 1R9TB 4UAIA 3QHTA 5FOBB 3ZYYX 4B3RQ 3N30A 4HK2A 4KHVA 1XLPA 3VRAB 3W2DA 2PMVA 1B9NA 2R3ZA 5DEHA 3PUWA 1HUNA 3L2PA 4WQMA 1A70A 1XCQL 5I4DA 1QOAA 4MGZE 3NZUA 2ES2A 4P1BC 3KLRA 4UP9A 1OO9B 1AEXA 5FLMG 3DBHB 3S15B 4BA1I 2K14A 1XQQA 2F0LA 1I35A 2XGTA 1WIAA 4A75A 2O6VD 4OGQC 2FAZA 1WTHA 2K5NA 1WX8A 2E2DC 3HKZB 3S9WA 4AJYB 3ULJA 4C4VB 1DOKA 1F9QA 1UELA 2I38A 2B2VA 2UUAL 2EYLA 1TT5B 2MBOA 2EY6A 3EQLC 1VQ5A 1SJED 4EEWA 3F2DA 1OXUA 1GUNA 5HURA 5IGEA 5C0XG 4HEA1 2N8NA 4RHRA 4A3IH 1WXAA 4RKBA 4CO7A 4FF1A 4NW2A 1PQSA 5JHBA 4LF7L 4DV2Q 2YTYA 4GLVB 1N61A 1KH0A 1BDOA 2PQAB 4LDTD 3U4EG 5GAHC 4DXAB 3S14B 3AE5B 1X3EA 2OT2A 1LABA 3F1ZA 4KMUC 5JPNC 4JBKA 2VUMB 4E6IA 1WM2A 2LGYA 2E3TA 4W9FA 3SR6A 3NVWA 2XWBB 3RZDB 4AYBB 3PGEA 4XWWA 5BN5A 5IWAQ 2M4NA 3A4SC 4KKIA 4Q2JA 1EFID 4A3OA 4UHVA 1K52A 2C35B 1J5EQ 4P16A 1MSGA 5E3FA 2F4IA 1JW9D 1SSOA 4NQKE 4DV0L 3TS2A 2WGSA 3VYUA 2Q5WD 1SB3C 2WU5B 3SD5A 4LUZA 2A19A 1IW7C 2CVRA 1YITA 2KWVB 3OWFA 2B2TC 3QWZB 2NCNA 4A3GH 2FIDA 4GOPB 1O78A 3Q3NC 3K9PB 3OJ3A 3RNGC 1YI2A 3MXPA 4ZHPA 2LGXA 1ZXTA 1VQMA 2L83A 1B53A 1TYGB 4PZ8A 3CCEA 1F2RC 4JCVE 3B0AA 2IX1A 2VB2X 3RCZA 5I2YA 4NJ6A 4OEMB 1ZGUB
chains in the Genus database with same CATH topology
5M9OA 4IZ8A 2AQ1B 1X3PA 1PTOC 3OPOA 3P4RB 4J1MA 2WXRA 2HUGA 2GRIA 1EWHA 5TSSA 2WXMA 2I07B 3FPPA 1XLNA 3DMUA 1D5ZC 1XCTL 2K0PA 3TN2A 4EVOA 1HQMC 1O7LA 3AMZA 3V3XA 1L0XB 2K28A 2D5DA 1C77A 1GB4A 4USAA 5IOCA 1K53A 1I4QA 3S16B 1MD2D 1WYGA 5ELBA 4DQOC 4N9TA 4XT3B 1H9RA 1SFOB 2LY7A 2F0NA 4A90A 2SAKA 2L12A 3PUXA 2PNRC 2L11A 1AWDA 1EQTA 4ZAIA 3DWAA 2E2JB 2R7ZB 3PZ7A 1E2ZA 2FHTA 5C5LA 2H89B 3LX0A 4IUVA 2IX3A 5KRUA 4FO2A 2JSOA 4J3OD 2Q8TA 4TQ0A 1SYBA 3GP7A 1F2YA 1JWAD 2EYJA 1K51A 4RF0A 5I6YA 1PTOD 2JYOA 4H44C 1MPEA 2DYMA 4DNRB 2SDFA 1EU4A 1E0ZA 4FXKC 1RFKA 1I6VC 5CV4A 3S1RB 3E6ZX 3IAM1 2F0PA 1DOYA 1EYCA 4CGYB 3MTSA 1JCKB 2LHEA 2PCFB 1ROEA 4ZQ3A 1ENCA 5CBEE 2EOTA 4US8A 2G9DA 3PIP3 1ONLA 4DA2A 2N9KA 2KUMA 1SE3A 1EM7A 1S5FD 5HFYA 2X6GA 4F8MA 1G6ZA 2H88B 2EELA 3AEGB 3VYRA 5BMIA 4AQ7A 2LUMA 2JYEA 4ZUJA 4MHEA 2B8FA 5K36G 3ABVB 3TP6A 3GS2A 1ML0D 4WH4A 1WWTA 2IDYA 3J7YW 4IUQA 1C48A 2K04A 1K8MA 1H9SA 1WD1A 4AS1A 1SNOA 1WTRA 2F0TA 3U7ZA 1D6EC 1SDFA 3AE9B 4H7BA 1D2BA 2WXPA 4KGRA 3H8HA 1FIQA 1EIGA 2NN6I 3C46A 1AFPA 2PW5A 1VDZA 1CM9A 3NXWA 1HA6A 4KKUA 3SK4A 2PQEA 1WCMB 3PO3B 3R2IA 3NSWA 2INPE 2IJ0A 1TKWB 1G2SA 2JQRB 1WTQA 1AN8A 1H9MA 2NVYB 1NSNS 5JPMC 3ZJVA 1PRTB 3SFDB 1HRJA 3S1MB 2J52A 1LT6D 4ZUIA 3MEHA 1STNA 3SEBA 4YTMB 4J6HA 4M8AA 1B2TA 1J9OA 1I7HA 1SYDA 4IFDG 2X38A 1ZKOA 4TQ1A 4KX6B 3J7AF 3NBIA 2F0JA 1LLRD 1KDCA 1Z47A 1BQQT 4IDIA 2K7VA 1KNAA 1LO5D 1TWHB 2WDQB 2B76B 2ON8A 2A74C 2BE5C 4FP5D 2N9LA 1F2RI 2A69C 3M4OB 1XEEA 3R8BA 3IFTA 4B9XA 3N52A 1VZ6A 3VA5A 3K5OA 5FO8B 4NKLA 3O13A 1O7YA 2JYTA 2SEBD 4KI0A 2JXMB 3E9SA 1Q1BA 1XLOA 3S17B 1JICA 2VB3X 2EYFA 2M9VA 2XWJB 3TEZA 4HTHA 1GUOA 4C80A 2O5IC 1FMAD 5CYUA 1DONA 1A6XA 2M0AA 1PLFA 3LYYA 5IT9E 3HZXA 4OW0A 5K36H 1CZWA 3HS0C 4IURA 1Q10A 2MJDA 2ENBA 2I46A 3X3NA 2KDMA 5EQ0A 1VMPA 1AW7A 4OL7A 3VRBB 3RD4A 4IUUA 2ZW0A 1EEID 2QEJC 1FYCA 4L63B 2JU6X 2IW3A 3DUZA 1L6VA 1TS3A 4IUNA 3VR3A 3V05A 3TMEA 2A69D 3BDOA 1JQ4A 4RGNA 1UWXA 4YWGG 4ID6A 4A3FB 5EPLA 2WXHA 1B3AA 2HDLA 2TMPA 4CKEA 3SK6A 3EVQA 4PV1C 2JA6B 1HTLD 5I9OA 1TZOA 2KCNA 2RPVA 1UEAB 4NDXA 5FKAC 3K5MA 1S5DD 2R61A 1EEFD 1K8OA 1HTPA 3AE1B 1QT9A 1TWFB 2HQEA 3SR1A 2QDBA 4X3SA 2E2HB 2NVQB 5EE0A 3BYYB 1A3UA 2IGGA 2L9HA 2WKCA 4NJCA 2BTEA 1A3TA 4L2YA 1NVID 3MXGA 2NYZD 1C78A 2BDNA 2J0TD 4YSXB 2N0SB 1SYGA 4A3KB 2BCOA 1RKNA 5C3EB 4MACA 2LGIA 1I4PA 4LAAA 5AUKA 1X3QA 4X3KA 2JSVX 5HGTA 1LTBD 2M00A 2BS3B 1SYCA 1BUVT 1ESFA 5BN3A 1Y8NB 4LK0M 2K03A 3D4RA 1RDPD 1STYA 4NAWB 3AE4B 4HCEA 2K33A 1FXAA 2CHBD 2XVSA 2WXGA 2EVBA 4HAEA 1YNJD 1HUMA 3FDTA 1PFMA 3NVVA 1C8CA 2D5GA 2KMMA 3EROA 3WOFA 4BBSB 3KBGA 1JWMD 1VJKA 1Q3LA 4A9AA 3NUHB 2EJFC 4G7OC 4C7ZA 3D6CA 4BWGB 1S5ED 2L52A 3D4WA 5HI1A 2ZXRA 2LJIA 3OSOA 3FKIB 1HFGA 4FXGC 3ZGZA 5BN4A 1SXTA 1WTPA 2WLBA 4C3JB 4U673 2W3SA 1LTID 1NUCA 4FVMA 3CHBD 2DNEA 4Q0FA 1GHKA 4PT5A 1ZE3D 5JEAJ 2BBCA 2PIAA 1XWEA 4K6LA 1SNQA 3CKIB 2PVOD 2F0OA 3TZUA 1ICWA 1L0VB 3HRDD 4MN3A 1ET9A 4RWSC 3IT6B 1SIJA 2B2TA 2WXNA 3BVMA 5T1IA 4C2MB 3OMCA 5JEAG 2OEDA 3NTKA 4FXCA 3PUVA 2L32A 4XE0A 3B9JA 1TWGB 3J80E 3GTJB 1JWUD 1D1IA 1V1PA 4I7ZC 3GTLB 1MVKA 3MXNA 3HOUB 2NUCA 4EQPA 5KYIA 4CKBA 2L1BA 2EYOA 1XXGA 1QG7A 1HXYD 1STGA 4HN7A 5M5YB 1LTTD 2XN9C 5CV7A 1QOGA 1WSPA 2WIIB 1XYIA 4BS9A 3LXFA 3G7LA 1IBXB 2OXPA 2Q8IB 3NK9A 1QOFA 2EYPA 2ID0A 3AEEB 3HOYB 4B0MA 1GUTA 2L4NA 2JX5A 1JR0D 5M3MB 3S1QB 2ICIA 4OZAA 4TRDA 5IODA 2IWHA 1WTOA 1BCPB 4MH8A 1VF5C 2EKIA 3QIAA 1CJEA 1YQ4B 3J81L 3AE3B 3OHXC 5D65A 3D31A 1ESRA 3MVVA 3K7AB 4U68A 4RFBA 1QJOA 1W6KA 2A5HA 1OXTA 2WB1B 1EY7A 4QB4A 2BOSA 1LTGD 4KV6A 4WAFA 3PO2B 1EYAA 2XNAC 4XT1B 1CHQD 4K6DA 4XYQA 3ZJUA 5HHDG 1QCBD 4JE3B 4RAUC 4S3SA 1C9FA 2LEKA 2F0EA 5D3IB 4TQUS 5C4JB 4Y7NB 4KHZA 1YQ3B 1DGJA 1MBYA 1Y56A 4ZKCB 3W5VB 1SE2A 2ICEC 3FAHA 3I9V1 1D1KA 2BS4B 3VYSA 3TP8A 3OIQA 4KGTA 1CZGA 1FRRA 5IGDA 5C0XJ 1I4RA 4NZLB 2BW2A 3Q8CA 3GTMB 4L23A 3GV3A 1SYFA 2AQ2B 3DXJC 4US9A 5ELDA 2K1BA 1MSHA 4DF7A 5GXGB 1GAQB 1JOQA 4CQNA 1PFNA 1TT2A 5JEAH 1EY6A 4A3BB 1YN4A 4HMJA 5COYA 4WFN3 4RGOS 2N88A 1WTVA 1D4BA 1E9MA 3U9SA 5ELCA 2C5CA 4FXDA 1JQYD 4ME5A 3SDZA 4YXDB 3AN1A 3KLSX 5JVG3 4F7XA 2F1MA 5MPOA 2D62A 3HEJA 1F0ZA 2K5WA 1PZID 5FR3A 3HRZC 2O5JC 1CK1A 2B2UC 4BY7B 4YSZB 2KECA 2NB0A 2AX5A 3A55A 3X3MA 2KACA 2KQ3A 4LTUA 4IOIE 2NZ1D 3P4SB 1PFDA 1XO3A 2RSOA 4DAVA 3AE2B 1FM0D 4KY7A 1ET6A 2W82A 4ARIA 1ZOYB 2SNSA 3KF8A 1WGKA 4N59A 3WDNA 4K5VA 1JROA 4JK1C 3CQZB 4DXFA 2H4OA 3DEOA 3C8YA 3IKJA 3PUZA 3K59A 1V1PB 2KVMA 3SHLA 2MPMA 2JA5B 2DWQA 1JWBD 4LJZC 4F87A 4RHSA 2H1EA 5A2QL 2IGHA 1C4CA 2QIEB 3TUOA 3A7AB 4J8QA 1CQVA 1D5MC 4K5WA 1IYVA 3TZDA 2RA4A 3JAME 1HQRD 3SK5A 4KJOA 4DAYA 1STHA 2EYMA 3U9OA 5IGBA 4KN7C 3P1HA 3T56B 4KKJA 4JPSA 3TEXA 1EY0A 2RDFA 4A3MB 3HUIA 2LFNA 4WRDA 4PMWA 1PGBA 2WP9B 2EPBA 1QKZA 1DM0B 4PQXA 1S5CD 5T1GA 2NVXB 3ETRA 4C3JG 4ZOHC 2NTTA 3MWYW 2ONQA 3DEPA 2KAJA 1HZ5A 1G291 1CA5A 3H3VC 3T16A 2WXLA 2MJEA 2WXFA 2F3VA 5C0XH 3FILB 3QOJA 1QWYA 5J22A 3EA6A 2BB5A 2I2YA 1PXUA 2MP1A 2KCCA 5EPKA 2WNMA 1Z7TA 5IGGA 3ITPA 3MFYA 1L5PA 3NVZA 1Q1EA 4C3HB 4XIGS 3TSSA 5JAVA 4XTCS 2L55A 4QUCA 2WS3B 5C4XB 3I72A 3HG9A 1VZ7A 5FLXE 4DN4M 4A3EB 3LB8C 2KEDA 4REZA 4ZRPA 2G9HD 1TU2B 3PUYA 1BCPF 4OVZA 1L6UA 2RVLA 3IL8A 3K58A 3AMUA 2HCIA 3NP8A 1XF5L 1TIID 2PTLA 5EBCA 3S1NB 3RZOB 1C76A 1QQRA 4FF3A 4HKZE 5BYRA 1LT5D 2ACZB 2F0SA 4FF4A 1PYWD 5C4ZA 2B63B 1SNCA 3L3OC 2Y5CA 5IIFA 4C3IG 1T3QA 5J1ZA 3MFGA 5IGFA 1ILPA 2IX0A 1STBA 4H0LC 4JWSC 2EE1A 4A3IB 2PZUA 4IFDJ 2V4DA 3Q8AA 3NPPA 2LFIA 4XDDA 2F3WA 2Y0SB 3FVQA 3M4YA 4ULLA 3GV6A 2WP8J 1EZ6A 3N9YC 2KQ4X 3NUCA 3FC4A 4KKSA 2W55A 4RGMA 3K0YA 3RLFA 2B2YC 4Z9CB 4QUFA 5I6WA 1C79A 1FRDA 2K01A 5T8IA 3SE0A 1SE4A 4EE2A 2C9OA 3C1EA 1OXSC 4XQJA 5E6JA 4HEDA 2A68D 1RWSA 4JWUC 4QIWB 2AQ3B 4K2LA 4GLSC 2JP1A 2R6GA 5BMGA 3QO2A 4RNAA 1RD9D 4KD4A 3IXSA 1ENFA 2JA7B 1V1OA 2FUG1 1L4DB 2VZKB 3V2TA 4RH6A 2WXIA 2B2WC 1B9MA 2NN6G 1QILA 3UI2A 3Q24A 3VR4A 1EY5A 3I3CA 1E2WA 3M3YB 1PRTD 3D8GA 1Z6HA 3B2GA 5EKIA 5G5HA 2B39A 2FINB 1DXMA 4Q5VA 3A8KE 3NHHA 1BR9A 4KTAA 1LV9A 1VCIA 2JEAI 5CGKA 1P7EA 3KBXA 2F0UA 4K14A 4WIPA 2MJ8A 4DK1A 3MAQA 3OMGA 2FBWB 2NTSA 3OW7A 3SVMA 4WJWA 4RKLA 3URYA 2JE6I 3M7GA 4BBRB 2JZPA 1IHZA 4OO1I 1V97A 3KWLA 3CIRB 1MHXA 4HSVA 4L6TB 1C4QA 1SAPA 2K5DA 1JOKA 1NI3A 2DYOA 1TWAB 1NEKB 2DY7A 1L0YB 1PGXA 4NP5A 2BDOA 1A3VA 2D2CC 2D9UA 3A56A 1YNJC 4R3DA 1WD0A 4C56C 3AU7A 2O2LD 3P7JA 1HFNA 3BS1A 4BA2I 3AB9A 4HR7B 5I2XA 1YJIA 1QNKA 2OEOA 2F0QA 4YT0B 3L7ZC 4HSPA 1XLQA 4QMGA 1H9SB 1TKEA 1QF6A 5AUIA 2BT6A 2J42A 3DHQA 3TDQA 2IT1A 4IFDH 1FO4A 4K8IA 4ILWA 3AB5A 3BZDB 1RTNA 2DBYA 3Q22A 3I4LA 4EGVA 1TQOA 4XDXA 1ENAA 5DNFA 5ISRA 5C6AA 1FFVA 5FO7B 1EL0A 3LWEA 3I90A 5AFWA 3GTPB 3D4DA 2PO4A 4EQNA 4C7YA 1LT3D 1TWCB 4L8JA 3OWEB 2WKDA 2F03A 1HPCA 1Y1WB 5KIXA 1NYQA 2BS2B 1BUIC 1WXQA 3VQIA 3AEBB 3E5SA 2NN6H 2KOLA 4KJNA 3BWUD 3VA7A 1VDVA 5JXVA 1HHVA 5KNDA 2K32A 2KN4A 2K05A 4NMZA 1RYJA 2AWNA 2NVTB 4C3HG 1MI0A 4QF4A 1ZP0B 3QOLA 4MIUA 3E56A 2YU9B 5EKKA 4G7HC 4A8XC 4ABNA 1F9PA 3NE5B 1FNWA 5CR3A 3EJIA 2OHFA 2JEBI 4A55A 1B4OA 5C5MA 5LHY1 1M4VA 2EY5A 1SMYC 4KY6A 2QMTA 1ZPSA 4K5XA 4R8NA 3GD7A 3A7LA 3NWTA 3KWVA 1PRTF 1YN3A 4N6EB 5DAUA 4O42A 3PMFA 3NQIA 4LK1C 2DNCA 2KA7A 2LKVA 1P7FA 2CJNA 3AECB 3P42A 1RF2D 3MC0B 5ELEA 1E10A 1GJXA 4A3DB 1R7SA 1A15A 2RKSA 1IUEA 1B44D 2B2UA 2QF7A 2W3RA 5CV6A 1TJEA 1TY0A 1T6BX 5E4WC 5H8YE 1DOMA 3IFDA 3VR9B 4WWMA 1SBBB 2N55A 2GI9A 2J4XA 3HVZA 3DM1A 2EYHA 5EE3A 5C44B 2JA8B 2AUJD 4B9WA 1UGJA 4EQOA 1Q90A 1ZXHA 1MHHE 3I57A 3QB3A 4IKGA 3AEFB 3I4NB 1HZ6A 2CW0D 1FXIA 3U2SC 3K57A 2AWOA 4KY5A 2HTME 1SMYD 1EOTA 4HROA 1TS5A 5LL6X 4C3IB 4DK0A 1V8CA 1DOLA 3W1SA 3PV0A 3D3RA 3KLSA 4ZRQA 4DNTB 1XX8A 1OFFA 1FD7D 1W6JA 1V8QA 4KGSA 1QB5D 3AH7A 4UDUC 1BCPC 3DWQA 1RM6C 3W3AA 4F88A 3BYTB 4IALA 4IUTA 2IGDA 1LTAD 2OF1A 5KNCA 5C0XI 4A93B 1CI3M 1BF4A 3TEYA 3Q69A 4DAPA 2FFKB 2KWDA 2J7ZA 5C4HA 4IQZA 3GTGB 3M7NA 4L1BA 1DJRD 1EY8A 1U4MA 5FLXL 1ZYRD 1FFUA 2F0MA 5JVH3 2M56B 3GB1A 3Q8FA 1FR3A 2L0CA 1ZXIA 3I4MB 5BYSA 3ONAB 1O80A 1JMLA 1X32A 1C4AA 3CU7A 3Q0AA 4ZK9B 1QE6A 1SF0A 3AM9A 3BG3A 1EY9A 3IT4B 1KLGD 1Q8IA 1Y8PB 2JWUA 5M5WB 1SYEA 1J7CA 4B0EA 3TP5A 1NENB 4TSSA 2ZT9C 2QILA 2TSSA 1N60A 3ND9A 3AE8B 4HRSA 4ZRZA 1BCPD 1VF7A 4PMBA 4ZYSA 4RCOA 3QJYA 4LMQD 3K5LA 2INNE 2YYZA 2RBMA 4BY1B 2WQYB 2K3UA 1TS2A 3HOVB 1PZJD 2RQXA 5KNBA 1UNSA 3GTKB 3NQTA 3HP3A 5G3LF 2EDGA 3TEWA 4ZKBB 2GA4B 3MA2B 1B50A 5E4XA 1YNND 1F9SA 4HCSA 2F0VA 2WDVB 1DOXA 1IKLA 4LLGM 3PIO3 2MEKA 2YEPB 3P20A 3WCQA 3C3LA 2PVGC 1PMRA 1BBXC 1TKYA 1F77A 1HA5A 1K83B 3I70A 4RGTA 1QNUA 2WXKA 2PYKA 4IUPA 1U4RA 2QKIC 5EJWA 2VNUD 5JJZA 2PZTA 1BO0A 5BMHA 2A6ED 4KKTA 5KGUA 5C3WA 1YNTE 3KK7A 1KDAA 1L4ZB 4JBWA 3GTQB 1CQFA 1G91A 2B2YA 1NYRA 2HCCA 5CBAE 3J9CA 3RFZB 2XRSD 3WOEA 1FD6A 1PTOB 2LS01 4NAMA 1Q12A 3CRLC 5D7GA 2Z4IA 3GQBA 2FE8A 2NWGA 3VR5A 3T51B 2KEEA 1KNEA 3BVZA 3PZ8A 3R3OA 3BDCA 3P4PB 3KUPA 1LACA 1TS4A 1KFYB 5IT9L 4WORA 3CRKC 3AE6B 3J7AV 5CORA 4FF2A 3MJ5A 3NBHA 4K8JA 2MH7A 3ZQ4A 2PZWA 2Y3AA 4N9PA 1UAPA 3NTHA 1QOBA 4DFAA 2B2WA 3K6OA 2EJGC 3EUB2 2RDGA 2NMQA 5EBDA 3A54A 1IW7D 1FGBD 5C3JB 4GZYC 3R93A 3T4AC 1KRHA 4HMIA 2K5PA 3MXUA 3U52E 1DD2A 3T3OA 2L1AA 1LTSD 2BA1A 2IL8A 5KEEA 4RCNA 5IGCA 2E74C 1E2VA 2L5TA 1EY4A 1H9KA 4B08A 4CJ1B 3FPUB 2WU2B 1C4PA 3D6WA 2KHSA 2CQAA 2IPKD 2SNMA 4IN3A 1CTMA 1A2UA 1PFBA 1KABA 4A6QA 2DN8A 4M1UB 2PKOA 1PZKD 3J81E 1RTOA 4CJ2C 4YTNB 3H91A 4XQNA 3ZJTA 1I4HA 3BDLA 1KDBA 4ZLTF 1EWYC 1JWSD 4IFDI 1STEA 2PLPA 1DYQA 2QCPX 2A6HC 2B2VC 2A68C 5KYLA 1U4PA 5CV9A 2F0WA 2Q8RE 3P1MA 2V4IB 3C2PA 3VYTA 1IL8A 3ERQA 1VRAB 4ITKA 1OXVA 2CU3A 2XRQD 5JOBA 3GO5A 3HGBA 3Q6SA 3FRPB 3VR6A 3RUZA 4RF1A 2NBFA 4FNFA 2ZXPA 1BNZA 4JX1C 5C2TB 2ZW1A 4O1NA 4MT5A 5FK9C 3FMCA 1AYFA 2LMCA 1G8ZD 5NUCA 4G7ZC 5EKLA 4CHTB 1PRTC 1RHPA 1PGAA 4PNYA 1E0BA 4G4KA 1F9RA 4OIJA 3C1FA 1KF6B 3IAS1 1ACCA 1UUPA 1AP0A 1E7PB 1ZDXA 2Z4HA 4V190 3SFEB 4GDKB 3L9AX 2MUYA 2W54A 4M0WA 2ZXOA 3EFXD 4R8IA 1ZDVA 1BOSA 4OZCA 4A3GB 4OZBA 2A6HD 3M85A 1CT1D 1G2TA 1ZUD2 3T53B 5LNK1 2Y5PA 4C1NK 2DY8A 1PDQA 1SNMA 4DU9A 1AZPA 4XWTA 5H92C 3LWUA 3NRZA 1CFMA 1SEBD 1I6HB 3NWSA 4PMCA 1A2TA 2YEPF 1EQVA 1KAAA 3Q8EA 1LT4D 2SOBA 1FEHA 4C1NI 2O4XA 1GB1A 3J80L 1IGDA 1TKGA 3B2FA 2E75C 5ELFA 1GUWA 1CZPA 5D14A 4KD3A 1B9RA 3LNNA 1N5XA 1ILQA 2R92B 1GPXA 4R9WA 2RDHA 2F0DA 5BYQA 3NS1A 4G57A 4ODGA 2E6XA 4RA8A 4HKQA 3TP7A 3A8JE 3A8IE 2BYTA 4YSYB 5EGTA 2EY1A 1OQQA 1RCVD 3BIID 1SJHD 2BA0A 1PTOF 5A2QE 2WINB 3VR8B 1R4PB 1EWCA 1KLUD 1R4QB 1TVXA 4H13C 2K22A 5CV5A 2KJXA 2F0FA 1J7AA 2MHVA 1BXTA 1EYDA 2G1EA 2DLBA 1JORA 2VZKD 1FNUA 5CC4A 5EE9A 2Z1CA 1WRIA 1GHJA 1VZ8A 2WDRB 2FMMA 1SNDA 2N7JA 2BE5D 3K5NA 3H6MA 1T5EA 3DWGC 1MGSA 4YTPB 1DCZA 2K6AA 4V0BA 1IBXA 3I73A 1SNPA 1VR9A 3RMHA 4OIKA 1MI2A 4D2KA 2M19A 4TMAB 4MM3B 2HDMA 2MGSA 1D5XC 4CKCA 2WACA 3N6RA 3F2UA 1I4XA 3NTIA 2RSNA 1GUSA 3BK2A 3VR2A 2BB6A 2EJMA 1GOZA 4TKOB 1ZEQX 3R2TA 4KN4C 5DM73 5HG2A 3W9CB 5J39A 5DM63 2PMZB 4I65A 2EY2A 3Q8BA 1XTCD 1WTWA 2HDEA 4A3JB 5K5PA 3UI3A 3E0JA 1QOHA 4P6VF 4OO1G 1H9JA 3HOZB 3OOCA 3DWPA 2A73B 1S5BD 3SK8A 2LMCB 4ZHOA 2WXJA 5CV8A 1JE4A 3MHBA 3NVYA 1EU3A 2V3NA 1I50B 1U4LA 2GB1A 4N58A 1Y1VB 5D3DA 4YIJA 2FMCA 1DOIA 3S2DB 4XDCA 4HJGE 1LTRD 3HOWB 1J7BA 2K5QA 5E1FA 1TY2A 2V3PA 2WXOA 1F2MA 1EZ8A 4XQQA 3BVGA 3HVDA 1EIHA 1IKMA 4FYDA 5G3LD 1PUTA 1UWMA 2LHDA 3G6JB 2CW0C 1GUGA 4GDLB 1Y8OB 1IGCA 3H09A 3T3NA 4P2CB 3AEAB 1WTXA 3H0GB 3SXHA 4CJ0B 1CHPD 1T5XD 3FEWX 3NZ3A 2WV6D 1IYUA 1JC7A 3CWIA 1F2LA 1I3QB 2EZVA 2XSCA 4XXEA 2WXQA 3P63A 3H94A 3RPFC 4X3TA 4DGZA 1FNVA 2FJ2A 1F2ZA 1PDXA 3MZ5A 1NAPA 5EE1A 3IAYA 2J53A 1PTOH 3AV8A 2XIWA 1FCLA 4CBVA 1V43A 4WURA 3ND8A 3V96A 1I4GA 1BMLC 3JAML 1S4ZA 3Q23A 1N63A 1ZYRC 2F0GA 1YMHE 3I8ZA 1QLBB 2V0GA 1U9RA 2F0HA 5EPJA 3T13A 4DXGA 2E2IB 1Y69U 1NR4A 5A35A 2M2LA 2PW9A 3BK1A 4ARCA 1NR2A 1OXXK 3HOXB 2CJOA 2QJLA 3EGRA 2X69A 3PO0A 1II3A 5FO9B 2QSDA 3MP9A 2EXZA 3MHZA 1JB3A 4OO1H 5M3FB 1FCCC 1OQRA 3KQ4A 2X6LA 3OIPA 1N5WA 1YJJA 2WAQB 3AE7B 1AZQA 1M8AA 3QWNA 1K50A 4H2AA 2F0KA 2Z8LA 2VB2X 5C3XA 5G5GA 3L4PA 1KTKA 1JRPA 1VLBA 2R93B 2K9XA 1NCVA 5LL6S 3W5UB 3I91A 3QG1A 2JXTA 3P75A 4OHJA 3DWMA 4KK7A 2PW7A 1B1ZA 2MJ3A 1DZ1A 4X3UA 2E76C 2F0IA 2PPBC 1TR5A 4QCLA 1YNNC 5M5XB 1YN5A 1N62A 3P4QB 1E6EB 1STAA 1HEZE 5CMDA 1SSNA 4K2KA 1CA6A 3S2HB 3FILA 2AUKA 3AEDB 2B8GA 5I9PA 1J8IA 1WVLA 3GTOB 1O7ZA 1JALA 1GXDC 5F2DA 1JOOA 1VMCA 1RJTA 1RODA 1HCZA 3TBIB 2A6EC 2VXWA 2RMMA 1R9TB 4UAIA 5FOBB 3ZYYX 4KHVA 1XLPA 3VRAB 3W2DA 2PMVA 1B9NA 2R3ZA 5DEHA 3PUWA 1HUNA 4WQMA 1A70A 1XCQL 5I4DA 1QOAA 3KLRA 1OO9B 1AEXA 3S15B 4BA1I 2F0LA 4OGQ