1BXTA

Streptococcal superantigen (ssa) from streptococcus pyogenes
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
222
Chain Sequence
SSQPDPTPEQLNKSSQFTGVMGNLRCLYDNHFVEGTNVRSTGQLLQHDLIFPIKDLKLKNYDSVKTEFNSKDLATKYKNKDVDIFGSNYYYNCKTCMYGGVTEHHRNQIEGKFPNITVKVYEDNENILSFDITTNKKQVTVQELDCKTRKILVSRKNLYEFNNSPYETGYIKFIESSGDSFWYDMMPAPGAIFDQSKYLMLYNDNKTVSSSAIAIEVHLTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for HLA-DQ binding by the streptococcal superantigen SSA.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Immune system
molecule keywords PROTEIN (STREPTOCOCCAL SUPERANTIGEN)
total genus 60
structure length 222
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bxtA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1bxtA02
2Z8LA 2XRQD 4K6LA 3R2IA 1BCPC 5I4DA 2IPKD 3DWAA 5D3IB 1TY0A 2NTTA 3DWQA 3KLSX 3BYTB 1FD7D 1V1PA 1PYWD 1D5MC 1D5ZC 1TY2A 4ZYSA 1YN4A 1EEID 3R8BA 3BZDB 1PTOC 1JR0D 3EFXD 4BWGB 4RGTA 1SE3A 4RH6A 4C56C 1I4HA 1FGBD 1RDPD 1RF2D 2ICIA 1D6EC 1PZJD 1MD2D 3EA6A 1V1PB 4DXGA 4DXFA 3SEBA 1STEA 1G8ZD 4OHJA 1ET9A 3URYA 2SEBD 1LTID 3R2TA 1HQRD 2XNAC 4RGNA 1QILA 3BVZA 2O2LD 1S5CD 4O1NA 1JWUD 1M4VA 1V1OA 5ELFA 4UDUC 1LT3D 1BCPB 1SEBD 5TSSA 1UUPA 1ESFA 1JWMD 1RD9D 1LTTD 1JCKB 1BCPF 1PRTB 1CHPD 5ELCA 3BVGA 2RDHA 3DWPA 1S5FD 1FNUA 1PRTF 3BYYB 4L6TB 4RGOS 1I4XA 4RHRA 1YN5A 1KLGD 1S5BD 1F77A 1SE2A 3TSSA 3MFGA 4RCOA 3GP7A 2AQ1B 3MC0B 1LO5D 1PTOF 1SBBB 3BVMA 1CQVA 1AW7A 1TS3A 2G9HD 1HA5A 3V05A 4RHSA 1FNVA 1SXTA 1YN3A 2R61A 1KTKA 1LT5D 1LTAD 5D3DA 1JWSD 1AN8A 1LT6D 2QILA 1L0XB 1ENFA 1LT4D 4RGMA 2RDGA 1PRTD 2AQ2B 1TS4A 1I4GA 1HTLD 3OWEB 1DJRD 1GOZA 1RCVD 1PTOB 4NZLB 2WV6D 4TSSA 1TS2A 1I4QA 1LTGD 1S5DD 5FKAC 1T5XD 1HXYD 1LTSD 3O13A 4Z9CB 5ELDA 1ET6A 2CHBD 2AQ3B 1UNSA 2XRSD 1PRTC 2IJ0A 1XTCD 1SJED 1EEFD 2TSSA 1B1ZA 4L63B 1KLUD 1L0YB 1LTBD 1PTOD 1B44D 2J4XA 5ELBA 5FK9C 1I4PA 3CHBD 2NTSA 1SJHD 1D5XC 1BXTA 1EFID 2QEJC 1TS5A 1PZKD 1XXGA 1DYQA 1S5ED 2XN9C 1BCPD 1CK1A 1I4RA 1JQYD 1CHQD 1FNWA 1CT1D 1SE4A 5ELEA 4RFBA 1LLRD 1LTRD 3W2DA 1EU3A 1PTOH 1EWCA 1PZID 1EU4A
chains in the Genus database with same CATH superfamily
4DV6Q 3M4YA 1WTXA 2XRQD 2KQSA 5AZGA 4RG1A 3ALBA 1PFDA 1SSOA 5IY0A 3BDCA 1SROA 3PIPA 4B95A 4YWGG 3CSTA 2GA4B 1F2YA 2XWJB 3I90A 2YEPB 4JLCA 5CX3A 5JHAA 2R2QA 3NP8A 3O65B 4DV5L 4ZDVA 1BVSA 3OPOA 4DUYQ 3PRZA 5JVG3 3V60A 1HRJA 3IL8A 3KBGA 4K5WA 2VQEQ 1MD2D 5H92C 4JV5Q 3I3CA 2CWAA 2RSNA 1MSHA 2DZIA 4PYZA 3H6MA 1MVKA 2I1JA 3E9HA 3TJPA 2JA9A 2AL6A 1DOMA 1RL2A 2B2TC 4KTAA 4DR5L 1YJ1A 1DZ1A 2F0GA 2LS01 1A8VA 1S5CD 3NUCA 1QOGA 4FA6A 2KLGA 2M2LA 1PH7A 1N34Q 5ELFA 1GC6A 1I5FA 2ZEQA 1VQ9A 1EY9A 2IGHA 1BCPB 3BJUA 5TSSA 3TEYA 1UUPA 4LUVA 3IAYA 2GBJA 1N60A 3APCA 3ZJTA 5IO9A 2RCNA 4TQUS 1LXDA 3H09A 4NW2A 4X65Q 1DD2A 1E24A 2QDLA 4BBRH 4LFBQ 1PRTF 2H5XA 1O7YA 1E8YA 4OWWB 3UDFA 4F7ZA 2V4LA 4C3HG 2ZCCA 1XNRL 1Q90A 1TR5A 3H0GG 2REXA 1CQVA 4QIWE 1TS3A 3V05A 3AYHB 1FNVA 2DUDA 2FIDA 3EJIA 3Q8DA 3GZNI 1LT5D 3HOXB 2KTRA 2HJ1A 1CTMA 4IM2A 1XLNA 4V190 5IP7G 4OO1G 2YVCA 3A9JB 3OMCA 1I4GA 2KCCA 2N78A 2PI2A 2F0SA 4C3HH 1N8RC 4F8CB 1Q8KA 2ID0A 1CKNB 1VQAA 3FPPA 1J5EQ 2H89B 5C44G 1PH4A 2J0KA 3CCQA 2LEKA 3KUZA 1EWYC 2EPBA 1YEZA 1WF9A 2OF1A 2MP1A 1D7QA 2HQLA 3A74A 1GUGA 4IW0A 4AQYQ 5GADC 5IP7H 4G7ZC 1VQ8A 4X3KA 4W9IA 4XQJA 2CQOA 1ET6A 2KLCA 3HRZC 1KHIA 3K5NA 1PRTC 2K5NA 4DAVA 1FJGL 4EE2A 1DM0B 3V3XA 1SJED 5JOBA 4X66L 4B9KA 1D1IA 4L63B 3KF8A 2BH8A 4DV3L 1AWDA 2M0AA 2JA8G 3PLUA 3E3XA 3K5MA 4K3CA 4LNKA 3GTOB 3GTJB 2ZNVB 3K7AB 3HP3A 4X3UA 2KKCA 4DV1L 4DV0L 3S1MH 2ZM6Q 1EWIA 1QQRA 1Z2MA 3MJWA 2RR9A 1SFOB 3NHHA 3HOZG 1N61A 4ZRQA 1CT1D 3D32A 1NUCA 1HNXL 4G3XB 3RYTA 5GQOA 4QL5A 5AUIA 1U0LA 4IUTA 4POGA 4DWFA 1EWCA 2BT6A 2Y5PA 3EBEA 2R92H 4DV6L 4A3IH 2Q2IA 5D3IB 4DUZL 4EGVA 2FHTA 2L0CA 1EQQA 4US8A 4N59A 1K52A 2C7MB 3RUIB 1PH3A 2EYOA 4ZYSA 1YN4A 4I7AA 2MNAA 1S3SG 2PE6B 4I6PA 3AE5B 3PO2G 3KF6A 2E2HH 2OCEA 3RD4A 1OEYJ 2LZ6A 3PO3B 1F52A 1MI0A 5J39A 3WIMA 5M3FH 2E3TA 2ZTCA 2OJWA 3Q6SA 4A93G 4U68A 1K8RB 2B8FA 4NKLA 1E1TA 1WFQA 3WOFA 5EE1A 4DDID 1GUOA 4NXMQ 2JYEA 4XDDA 4R4IA 1MJCA 2XNAC 3SGIA 2CW0C 2K8BA 3CCLA 3DVGY 4S0RA 4DKAC 1CZWA 3RFZB 1WE7A 1UH6A 2IX0A 3ND9A 4UDUC 5ISRA 2RPVA 5M3FG 3JSVB 3PV1A 4IZ8A 2OTLA 2ZXRA 2VUMB 1ICFB 3CCJA 1TQOA 1ZKOA 1E5WA 1I3QB 1T0QC 2JA6G 1PRTB 3TMPB 3VH4B 2BCOA 3QG1A 4Q0FA 3WAOA 4IPDA 3WA0A 5DAUA 3C1EA 1PDQA 2EZVA 3AQQA 3B08A 3UIOB 4ARIA 1HR0Q 2CKHB 3V62A 3W3AA 4NDXA 1LO5D 1YNNC 4OZCA 3TMEA 1YIWA 3Q3FA 2NZHA 3QO2A 3GOEA 3ZTDA 3DHHC 3ZJVA 3LYYA 1VQPA 3K80C 1R9TH 4DR1Q 5J2RA 5BYSA 3TL5A 3S14B 1AN8A 2A68D 4B0MA 1ENFA 4X64L 3EROA 3IAS1 4R4OA 4PS7A 2F3WA 2AQ2B 4H7BA 3WAMA 3EQLC 1K3RA 3OWEB 4HJGE 4OZAA 3CU7A 5JEAJ 2UXBL 1KABA 2EXZA 4DR7Q 4XGAB 4OVVA 1F0ZA 3U4EG 2JA7H 2JQOA 1GUWA 1FXIA 1WJ6A 2FUG1 2HJ8A 1TS2A 2G9DA 4JPSA 4CKEA 4DV7L 2F1MA 1HXYD 4F8MA 4JI7Q 4MIUA 3A5UA 2BKRB 5J22A 5KYIA 3VDZA 5JAVA 2JWZA 3GTPH 1OTRB 3PUZA 3HEJA 3J80i 1WRIA 3E9IA 2BW2A 3KBXA 2JY6A 1VMPA 3I4MB 2WIIB 1NSNS 5IYBH 1Q82C 2O5JC 1VJKA 3Q3OC 3BY4B 1GM5A 1BR9A 2WX0A 3QX1A 3KLRA 3QCAA 3CHBD 3K81C 1NYQA 1P7FA 3VR8B 1K8OA 3CMMB 3RUZA 3TS0A 3AECB 5EGTA 2M56B 3UQAA 5H8YE 1Y1VH 3MXNA 2JEAI 1TT2A 3ULJA 4K5XA 2WS3B 3A9JA 3HKZE 3PO3H 3A1QA 2UWQA 3M4QA 1A2UA 4H0LC 3HRDD 3ONAB 1J9OA 5L95C 3K0XA 5ELEA 1CFMA 3W2DA 4PMWA 5KHQA 5EAYA 4LMQD 3W9CB 5D2MB 2L8JA 5CTRC 2KJHB 1KQSA 2DY8A 4GN3B 4JI3Q 1PXUA 4MN3A 1Q81C 1FCLA 4OXPA 4L5QA 1D5ZC 2B2WA 1MI2A 4UAIA 3NUHB 4TQ0A 3QIJA 2HHHL 1PGXA 1E10A 2TMPA 4QY7A 1WJJA 4A6QA 4N9TA 3VUWA 4C56C 3NS1A 3QA8A 4EKUA 5IWAL 1B3AA 4NMZA 3NRZA 1PA6A 1D2BA 1ZYRC 1U4RA 2OXPA 3FAHA 4HKQA 2HD3A 2ENBA 1GXDC 1E7PB 2WXFA 4NXML 1T5EA 4PS3A 5EDSA 1G6PA 2KNBA 2D0OA 2KOLA 2M00A 4BBRB 4DV4L 2FINB 2KA7A 1V43A 2IT1A 1PVOA 2EKIA 1Z6HA 3TCAA 5FLXc 3RN9C 1H9RA 3QC8B 2QMTA 4HMJA 1HZ9A 4GB9A 3H3VC 1V81A 3I2ZA 3ZQ4A 3NEMA 4EZLA 1XPUA 2QIEB 1JWMD 3A54A 4BY7B 1JE5A 2KQ7A 4BBSG 1SAPA 3OW2A 2K75A 4DK3C 1HPCA 1DGJA 4J15A 3PF4A 4FNFA 5CHVC 2BWFA 2CU3A 4RCOA 4MGKE 5IOIA 3RD2A 3L4PA 4MDKE 5IN7A 3P7JA 5M5WB 3ZRFA 4JI6Q 2ZNVC 1LACA 3HFZB 5IT9L 2L00B 4JI8L 4KHVA 3I8ZA 3VFKA 3ULLA 3MXUA 4BBSH 4RCNA 4BA1I 4GZYC 4OZBA 1VCBA 2FE8A 2KC1A 2ZJDA 1X65A 4GKKQ 2HQEA 2D2CC 1WI5A 2KWCA 4GNXB 1A63A 5JJZA 5C0XH 3SU8X 3ERSX 5EKIA 1EZ6A 1N33Q 1MGSA 2M8SA 2WV6D 3W1BA 3AM9A 3BK2A 1QLBB 4K1RB 2WQYB 3FDTA 2EJMA 1X9NA 1HQMC 4KY6A 1EO6A 2EELA 5HFYA 3LWEA 1SNCA 1SYDA 4Z9CB 2N8NA 2A5HA 4XXEA 3HOYH 5DM73 1PGBA 3CRKC 3GZNB 3H6NA 3IAM1 2I0QA 4X62Q 1OXUA 2RHSB 4A3MG 2F0OA 1Q46A 2PKOA 3D0FA 1TKEA 2OQKA 2HD5B 2EQSA 4QGUA 4EEWA 3NZSA 3P4PB 4IJHA 2WINB 3RLOA 1X56A 4ABNA 4KSKC 4HJ5A 1KLUD 2HDLA 2K04A 2BE5D 2IX3A 3EC8A 3KQ4A 4ITKA 4IPGA 3VR2A 1L1OC 3PIP3 4HIDA 3P75A 4XC2A 2J7QB 3PCOB 4ZK9B 1PZKD 3KWLA 3Q3JA 1EY7A 4BAXA 1Z5SB 4IDIA 1I4RA 3LDZE 2JRIB 1CHQD 4IFDJ 3DVGX 3Q69A 4ME5A 3VTWA 3GTMB 3IG3A 3P4QB 4PMBA 1XF5L 5IGCA 2MWSB 2PMZB 2NVTB 4IPHA 4N58A 1PTOH 4WJPA 4GMVA 4TV3A 1PYSB 3L9AX 5I6WA 3ZYYX 2RDFA 1VDVA 2J42A 3M3JA 2NR2A 2DZMA 5EE3A 1E6EB 1UWMA 3OYYA 1H9SB 5CV5A 2Y5CA 4X66Q 5IYCG 2ZCBA 2AMCB 4K0KQ 4JBJA 1TWCB 1I94L 4DV3Q 4JPBW 2BYTA 4YWKA 1U4AA 2K39A 4RGTA 4ME3A 1CMXB 3R7QA 1IBXA 2F0FA 1WTPA 1F9JA 1RDPD 2PYKA 3CP0A 2BA0A 1YJ9A 3CCSA 4A93B 5G3LD 2EYMA 5C3WA 3K5LA 2VUMH 1VQFA 2AEHA 4B3TQ 2HTHA 4KKIA 3TZDA 2V1YA 1ZXTA 5IYCH 3WALA 5C4ZA 1NE3A 5JH5C 5M5WH 3P42A 4YSYB 4A20A 2KDFB 3H1UA 2A73B 4QMGA 3D4WA 3PUVA 4DR6L 4ICUA 4J6HA 4REZA 2A6ED 1TWFB 2M19A 2OEDA 2EYPA 5C4XH 4G0NB 5DPRA 5E6OA 3SFEB 4B3MQ 2KVRA 2LJIA 2VUMG 1Z47A 1JCKB 4JI4L 1ILPA 3HOVB 2K7VA 3N30A 4K7WA 4IUVA 4CKCA 3EN2A 4MM3B 5C3EH 4QAYA 3HOUG 2B63H 3R3MA 4PT5A 4BXXG 4HAEA 3MVVA 1J8CA 4DR2Q 3GTMH 3H8HA 2JA5G 1NBWA 2ZW1A 1SE2A 1WSPA 3CMEA 2JX5A 2WXKA 1R4NI 1PTOF 3V96A 5G5GA 4APVA 1FGUA 5KGUA 1RKNA 1HA5A 1PH5A 4IUNA 3GO5A 4RHSA 1FVIA 2JK8A 4QB4A 3A7AB 4ZQ3A 1RJTA 3DHQA 2QCZA 4GDKB 2BOSA 3GQBA 2WAQG 3DHGC 3HOUH 3L0OA 2V9HA 3L7ZC 3UDGA 1FL0A 3D4RA 4XE0A 1YNND 1BDOA 1MIUA 2JZ3B 1L2FA 5J3BA 1OEYA 2IYDB 2DY7A 2CFMA 4R3DA 5DPSA 2KO3A 1H9JA 4G11A 4BS9A 4JI0Q 3H3VH 3W1YA 4CKBA 1KL9A 5JEAH 1UGJA 3J7A5 2ACZB 2BWES 2MBEA 3BDOA 3I91A 3VYTA 2UYZB 2Y5BB 2BPSA 4MELA 5LL6S 2C7HA 4E3CA 2KN5A 1VQNA 3PHWB 1C76A 3AMUA 5C1ZA 2L11A 1QVCA 3NK9A 3NTKA 4AYBE 1RRBA 1IBKL 1VQ5A 2ALYB 3NVYA 4W9GA 4ZHPA 4A3KG 4X62L 5IGBA 3MHBA 3N52A 2NVXH 1J7BA 4LF4L 2E8GA 4IOIE 3DWMA 1B44D 2MJEA 3L2PA 3D8GA 5FK9C 5HURA 2L3ZA 4YL8A 2MX2A 2WXLA 3FKIH 3UIPB 3TP7A 2FJ2A 2E2IH 3RMKC 5C3EB 3WAPA 1VF5C 2LY7A 3M4PA 1NI2A 4ANWA 2K8HA 2XSCA 4G57A 1EYGA 1IXRA 1YNJC 2QGQA 1W2BA 2LSSA 1J7CA 2KHWB 2F0PA 1YHAA 4ZRZA 4WH4A 3IFDA 5E4WC 4RAUC 3SDZA 4JI7L 4J8QA 2IW3A 5A2QL 3HM6X 4OELB 3TQYA 3GE8C 4JBKA 4PG3A 5FLMG 4A3BH 1XNRQ 1HR0L 1V49A 3JC66 1F2RC 1QNKA 4M8AA 4A3JB 4LF5L 1JALA 1FD7D 1I42A 1PH2A 2LKVA 4JV5L 1L4DB 2D3BA 4C3JB 3GTKB 2HDMA 1AH9A 3IHPC 3TIXA 2Z59B 4FO2A 4IN3A 1ZYRD 3MA2B 3P4SB 1G291 1TBEA 4ZOHC 4X64Q 1MKHA 1I4HA 3M62B 1RF2D 3T3NA 1EUVB 2KFJA 1VQHA 4GSWA 3Q24A 1WYWB 5ELOA 3AH7A 2RVLA 4JCVE 3EFUA 1G6ZA 2M4NA 4BA2I 1TKWB 4LF8L 3I4NH 3ZNGC 3SE0A 4BKTA 4H13C 4YIJA 3N6RA 1EY8A 1V1QA 3GTGB 3KVFB 1O7IA 4R8IA 4YHHQ 2GBMA 3R66C 3I4LA 1YQ3B 2R3ZA 2XBBC 4M00A 3U2SC 3AEAB 5M9OA 5FOBB 4GIVA 1CKNA 3X0WA 2LVQA 1A3UA 1YOVB 4IPCA 3CW2C 2PTLA 4JI2L 3ZNID 2CJOA 3E6ZX 2UXDL 4F87A 3FMCA 3UDIA 1QKZA 1FNUA 3PZDA 2XTIA 3K9OB 1QNUA 1PMRA 4JI0L 4EVOA 2AQ1B 2CVRA 2A1AA 4R4CA 4C3IH 3KDFB 4PV1C 2KMCA 1E0ZA 1UZXB 3RZFA 1HUNA 2LGSA 4A3BB 4OO1I 2K6QA 1UAPA 1B9MA 1DGSA 1KC8C 4Y7NH 3AU4A 4JE3B 1HA6A 2EYLA 5I2YA 2VH1A 1GUTA 4NQKE 4A8XC 3J81i 1EUJA 2INPE 4UP9A 3IBEA 1HTLD 2N3SA 3EECA 1NR2A 3P4RB 1RCVD 2QDBA 5C44B 1E8WA 3APDA 1LYLA 4BKSD 4DUZQ 3U4ZA 3AE2B 2KBNA 4U673 4ILWA 3QJYA 1XD3B 2F52A 5TR5A 5CV9A 2C7NB 3GTLH 4MJSB 2FFKB 3NPPA 3I70A 1RM6C 3W5UB 2PW7A 4KK7A 1ZGUB 2K50A 1TWAB 3U58A 1HFGA 2RD0A 1QWYA 2UUBQ 1GAQB 1IBKQ 4LNFA 5COYA 5KIXA 1C1YB 3K57A 4XDCA 1QE6A 2VW9A 1BOSA 2MO0A 2Q2TA 3GE3C 3PT2B 4O42A 4TKOB 3U30A 4AOFA 4LFAQ 3RLFA 2XEWA 2FNJB 4E74A 3I56A 3BS1A 1CZGA 3PGZA 1XMQL 1E8XA 4HIKA 2IL8A 2L9HA 3LX0A 4XTCS 1HR0W 1B9RA 2UU9L 4JWUC 1FJGQ 1W6KA 1XXGA 2NMQA 3N20C 3HG9A 3G4SA 3A4SC 2F0DA 2MHJA 3MWYW 3AE8B 1X54A 1BBWA 2H4OA 1FEHA 2R7ZB 3CCMA 1VQ6A 1WCMH 1LTRD 4MSQB 1EQTA 3HS0C 2CS4A 2WXHA 3CC4A 1T0YA 3UE1A 1EU4A 3S17H 2MP2A 3K7AH 3J81c 3MC9A 2SNMA 4B3RQ 2LJ5A 1PH6A 2N9LA 2PIAA 2WP9B 1SN8A 4EX5A 4DPGA 3KLSX 3T3OA 2KDEB 1A70A 1PYWD 4CJ1B 5CORA 2G45B 4GKJQ 4W9DA 1E2WA 1ONLA 3W1SA 1STNA 3R8BA 2M0XA 3M3YH 3VR3A 3JAMc 5M3MG 2Q2HA 4HPMB 4HJAA 3QR8A 2NVQH 3T53B 1E8ZA 2ICIA 5C4XB 3DBLB 1GKHA 2F0QA 2UUAQ 3AE9B 1EIHA 4AQ7A 4A3DH 4B0EA 1ZE3D 4OHJA 4USAA 2SEBD 5EQ0A 4C2MH 2ONQA 2G4SA 2VL6A 1TTNA 2FXQA 4HCSA 3SK8A 4A76A 2C60A 1FRRA 3M63B 2HIXA 4BY1H 2K5QA 4AS1A 4LK0M 2N1VA 5C0XI 1CSQA 2UUCQ 4CJ2C 5C4JH 1MHXA 1JE4A 3VR6A 5IOCA 1XQQA 2SNSA 1ASYA 3HUIA 1CA5A 1XMOL 2E2JB 4DR6Q 1YNTE 1KM7A 2MEKA 5C44H 5DPTA 1XEEA 4O2DA 4WJ4A 2KEEA 1J7AA 1KRSA 1ML0D 1S5FD 1SNDA 1U9RA 1CZPA 3J9CA 1Q10A 5FR3A 1YJNA 2F0NA 3EVQA 3TP6A 1M90C 4L5SA 2A8VA 1K51A 3MC0B 5IP9H 1RTNA 2PJHA 2WXRA 1AFPA 1HUMA 4AJYB 2R92G 4R4QA 4W9JA 2UXBQ 2PCFB 4GXBA 4HJ7A 2B2UC 4DV5Q 1SYCA 3AE3B 2A5UA 1C48A 2L52A 4FXGC 1E2ZA 1BQQT 4HRSA 2UXCQ 2MQJA 3DWGC 2A4ZA 2Z9HA 4MGIE 1YHBA 1IL8A 3FKYA 5JHBA 2JZPA 5JJLA 1EFWA 5C3JB 2KJXA 1LUZA 4ZLTF 5IT9c 3STBD 1KXLA 1B8AA 4IJLA 1LTGD 4MM3A 2NVUI 4WJ3M 1PFNA 3F2CA 3PVLA 1SMYD 3CRLC 5LXHA 3CAMA 2NBUA 2N7EA 1Y1WG 2R7ZH 1JJGA 1UBIA 1XLOA 2DHZA 2KK8A 3AEDB 3ZTCA 3VR4A 2RHQB 2UUBL 1DOLA 3I4MG 1Y8NB 1O80A 5G55A 1C8CA 3C2PA 4M0WB 4A3IG 4KV6A 4A3CH 2F0MA 1WGHA 4A3FB 3A0JA 1J19A 1YITA 4RM8A 3AV8A 1XX8A 2QKIC 1WVLA 1S4ZA 4G50A 1EL0A 2B8GA 1S5ED 1HNWL 5LL6X 1XJVA 3I4MH 2IO2B 2HCCA 5EBDA 4I7ZC 4P2CB 4A3JH 2D2QA 4CDEC 2K5DA 1HNZL 2LUEA 3PGEA 1KIXA 2MBQA 5D6JB 1FNWA 3SDLC 1WTRA 3VRBB 4YTMB 3APFA 1EIFA 1EOVA 3KK7A 1JB3A 4J3OD 1I50B 1VQIA 3AULA 4DK6C 4IG7B 2A6HD 2KJRA 5IT9E 1WY8A 2ON8A 5AUKA 4DHZB 4FN2A 1RTOA 3MTSA 2NTTA 2UXCL 1S72A 2MJ8A 1QUQA 1V1PA 2NB0A 1DOKA 2K1BA 5IODA 4A3JG 2O6VB 2JPHA 3FILA 5JJKA 1LGRA 1WJNA 1ESRA 1B50A 4C3JG 1JMCA 1E1OA 1F9QA 1VR9A 5BMGA 3NJTA 2MRPA 2I5HA 1JR0D 2KDMA 2D3AA 3U9SA 1H9MA 1OXXK 2KACA 1OXSC 2LASA 3MTNB 2JU6X 1B3QA 1RLFA 3NVZA 1D6EC 1WM3A 1ISNA 1PGAA 2K3UA 2VZKB 1FXTB 3LGJA 4FP5D 1YZ6A 2MFIA 4XIGS 3URYA 3H94A 4QUCA 4CJ0B 5IYDG 2C9WB 4LNNA 4K7SA 3MFYA 1R4MB 4EQNA 2AUKA 1IHZA 1M4VA 1AARA 4KI0A 4W9FA 3LWUA 4DK0A 2K0PA 3RULA 2PVGC 4F7XA 3CC7A 2F4VQ 3NWSA 1Q3LA 2KD0A 1A6XA 2DNCA 4BY7G 1Y1VG 2KANA 4WAAA 4IKGA 1F2MA 3B0AA 4KGTA 1P8LA 4L1BA 1L7YA 2INNE 4FHJA 4FLHA 3A8KE 4OWTB 4II2B 1M8AA 1YNJD 2LVOA 4LLGM 3DBRI 2EY2A 3AE6B 1RHPA 2BKFA 4C4VB 2DNFA 5E3FA 3P20A 3ZKJC 2ZT9C 3GP7A 4NPSA 2BTEA 2JSOA 1KDBA 4CBVA 4DR4L 4WJNA 1S3OA 4AUQC 4KKTA 1F2RI 4BY7H 2KYWA 3V61A 5LLIA 1LTAD 1JWSD 4YCVA 2ZW0A 5G2NA 2HHHQ 2RKSA 4B3SQ 3BINA 4HPPA 2PZUA 2LGIA 1QOFA 4DV0Q 3VR9B 4EQPA 1X55A 2MGSA 5LXIB 2I1KA 3PRPB 3AE7B 4ZYNA 4HDOA 5AEKB 1E7ZA 3J81E 4HTHA 1GC7A 3NG0A 1T5XD 4JC0A 1Y8OB 2BQQA 2IGDA 2UXDQ 4A55A 1SMXA 2JYTA 5HKHA 3PZ7A 1MJEA 2WP8J 1EY5A 4A75A 3MEHA 2MP2B 2QJLA 2ZJQA 3T8MA 4DAYA 1LTLA 1SYEA 5NUCA 5FJ8G 1EEFD 3J7ZC 4X3TA 3I9V1 4JI1Q 3M95A 4IFDH 1LTBD 4V0BA 2J4XA 5EPJA 2VNUD 3EIVA 5CV7A 1TIFA 1VQEA 4XYQA 2FBWB 3VQIA 2JRHA 3ER0A 4X6AH 1MG4A 4ASWC 1DYQA 2F0KA 1VDZA 3NVVA 1NBFC 2KCMA 3JYUA 1WTWA 4DHJB 1BCPD 5FJ8H 5HGQA 5IGDA 4UP8A 1KFYB 3BZCA 4IFDG 1HNZQ 3OSOA 3U9OA 4AH6A 1HH2P 5EPKA 2NYZD 2DLBA 3ML8A 1EU3A 3T51B 4ID6A 2KTFA 5CC4A 4XWWA 2Z8LA 4OGQC 1RIPA 1H95A 2NVQB 1JRPA 3QOJA 4ALPA 2NBFA 4BBRG 1QZGA 4P6VF 5CHFA 2YEPF 3DWQA 1XT9B 2D62A 3PIOA 1IL2A 5FR6A 1GHKA 1M94A 2Z4HA 1D5MC 3E9SA 3UGBB 2Z1CA 2D5GA 3HVZA 4B6WA 2KCTA 1PTOC 4ZRKA 3EFXD 2Z0EB 2D3CA 4N8FA 2NBVB 4J1MA 3DCGA 3S2AA 1HZCA 1C4PA 4MNOA 4OONA 3HOYG 4OO1H 2LHDA 1QUQB 1V1PB 2E5LL 2JEBI 2O6VA 3S24A 4DXGA 5IGEA 4A3MH 2DN8A 4WQMA 3ZIMA 2MO1A 4H02A 4H44C 2DZKA 4KD3A 3RZDB 1TWCH 2L5TA 1X6OA 1JW9D 2CH4A 4LWCA 2VS1A 1SIJA 1JOOA 5M5YB 1KJTA 1ZUD2 2GLSA 2D11A 4DHJD 2JJQA 4CDDC 3OAWA 1EOTA 1RD9D 3NBHB 1B53A 2BB5A 1ACCA 3DBLI 4XQNA 4OEMB 1O7LA 4XYOA 2CH4W 4DK1A 3PIO3 4JK1C 3CD6A 4W9CA 1B70B 5CR3A 3GS2A 4IWOA 4RHRA 1L5PA 2K4KA 2N4FA 5D94A 4DR1L 1K8AC 4DNTB 4YCWA 3KH0A 2LHEA 5IE8A 1TKYA 1HJPA 1TZ1A 2JA8H 3Q2AC 1IYFA 2D0PA 3PO0A 3RNUA 2WB1G 4HN7A 3M9BA 3A4RA 1ZXHA 1XCTL 3RNBC 2A74C 3S1NH 1L0XB 2EY1A 3HGBA 5H1SE 2Y0SB 2HCIA 1WXAA 3M4OB 1H9KA 2YU9B 3KJPA 1UF0A 4JG2A 3SVMA 5C4HA 3GTOH 3GTJH 3AEBB 1NMFA 2K5HA 4B3TL 3VR5A 2W9NA 3HIZA 4GLAC 5BN3A 4YT0B 4AQYL 3ZUNA 2E5LQ 4DAMA 2L32A 3NS8A 3M7NA 2WKCA 2IZVB 2WLBA 4WAFA 1YX6B 4AJWA 1IW7D 5FO8B 2XRSD 3PO2H 2R93B 2CQAA 3NTHA 1WGDA 4UHVA 1BMLC 3QJZA 4FYDA 4XZ4A 4KKSA 3CF5A 3J7YW 2NBWB 3J80E 1C4QA 4A3IB 1UD7A 4K3BA 2MJ3A 1L0YB 2Z6KC 1SNMA 4FVMA 4DF7A 1N32Q 1FXAA 3G71A 3BWUD 4KIKB 3UINB 4A3PA 4IUMB 2NTSA 5IIFA 4FJYA 1NI3A 4DR2L 3OWFA 3KYDD 4HIOA 5C3EG 1VQCA 1WXQA 1I50H 3TEZA 3NSWA 3CPWA 2WAQE 3SHQA 2IY0B 3DVNU 4HCPB 2E2HB 2NVXB 2KMMA 1KDAA 1TWFH 4NP5A 4HEA1 4ZUJA 4K2KA 2RSUA 4IO9A 3VAWA 2YTYA 3C8YA 1WD1A 2F4IA 3GD7A 3FKIB 5JZEB 2VZAA 3HOVH 3SEBA 1L0WA 2K22A 5HGTA 2R2OA 1F9PA 3R2IA 4GS3A 1VCIA 3V6CB 2GN5A 3V6EB 1KNEA 2OHFA 1Q12A 2BS4B 3TBIB 5IWAQ 1FIQA 4N6EB 3KUPA 2C35B 1RYJA 2PPHA 1EEID 2A6EC 4DAYB 3AEVA 2FCMA 2N7DA 3HOVG 4OIJA 4NAWA 4OW0A 1GD7A 2N7JA 5EBCA 5G3LF 4ULLA 3S9WA 1C78A 2CKZB 1I7HA 3E5SA 3I4OA 2NPTA 3VTVA 4QF4A 4QCLA 3P63A 1IZ6A 1IKMA 4URKA 1QJOA 2YTVA 1TIID 4QIWB 2ASBA 4JOIC 1SF0A 4J6IA 3RT3B 1HQRD 3NOBA 4L8JA 5J18A 4CDCC 1L2NA 3JVZX 4KJNA 1HTOA 2ATWA 1JWUD 5AJ3L 1MJDA 4X57B 3A5ZB 3JSVA 2WXGA 1LT3D 2NN6G 1J6QA 2GRIA 2M17A 3PV0A 3OIPA 2IO3B 3TEHB 2YYZA 1IBMQ 1Y1VB 2WACA 3GV6A 1V6EA 4GN5A 4NNJB 2A19A 3CQZB 3X3NA 4IUUA 4YHHL 2IWHA 5KRUA 3Q8BA 5IKCM 5CHWA 1Y8PB 2WB1E 1R4MI 2E2IB 2NN6H 1FO4A 2G9HD 3WWVA 1K0RA 5A2QE 2QEXA 3NENA 5D3DA 2CHZA 2PQAA 2M1MA 1YJIA 3R7RA 4G7OC 4HLEA 2N49A 3EUB2 4TVAB 4DDGD 1WR1A 1P1AA 3OW7A 1M1KC 4JGHB 3T13A 2VQFL 4GOCA 1WTVA 4PNYA 4JYAQ 4LFCQ 5LMNQ 2ZTEA 2O2VB 2WXMA 4L23A 4M01A 4CHTB 2B2TA 3PZ8A 3D6CA 1WXVA 3IFTA 1H8CA 1VZ8A 2PLPA 4NZLB 2QW7A 5FKAC 2Q8RE 1NVID 4PMCA 4JBWA 3BU2A 4LFAL 2H88B 1PYBA 2WWZA 2CHBD 2ZXPA 3GTKH 2Y3AA 1XPRA 1IBLQ 1AE3A 1ICWA 3CKIB 4L5TA 5DM63 4BOSC 2WAQB 3MAQA 3T1HQ 3RR5A 1B1ZA 2EY6A 2ZPYA 5F2DA 3OHXC 2B29A 1JWAD 2LVPA 3KF8B 2X8XX 3TS2A 5AZFA 1X32A 2MJDA 2KHIA 4BVUC 4KDIC 4YWLA 3SHLA 3MHSD 2MA9B 1OQQA 3K8AA 1FMAD 1GUNA 1D8LA 1UE6A 1T6BX 2G4DB 2KQ4X 2BS3B 4OWXB 2XK5B 2KVZA 3U8ZA 2Z0DB 1WGYA 1X3EA 4A3GH 2WNMA 3BK1A 3QQ8B 5T8IA 4LUZA 1LABA 1OXVA 3A33B 4AYBG 4A3KB 1K28A 3FRPB 1E90A 4IURA 2ZPNA 4HMIA 5CBAE 2H1EA 3I4NG 5CV6A 1PH9A 2N88A 1BCPC 4M0WA 1A3VA 1K3BC 5KYLA 5GMVA 1CM9A 2NUCA 2UUAL 3CSFA 5LMNL 2V0GA 1IYUA 1TY2A 1Q86C 4WWNA 2KENA 4WRDA 3BZDB 5M3MB 3ECIA 4ZRIA 5GAGC 4JBMA 1LM8B 4ZAIA 3RZOH 3RPFC 3MEFA 4RH6A 4E6IA 3ML9A 4GDKA 4WURA 3CQZH 3WANA 1CJEA 3B6YA 2LGYA 4LAAA 1XWEA 1G51A 2QHOA 1WTHA 1YNXA 2N55A 1HZAA 2EVBA 2XIWA 1LTID 1X3PA 3K7UC 5CV8A 3VA7A 5C0XG 1LQBA 2W54A 2KECA 3BVZA 1XMQQ 3M3YB 3Q8EA 1OFFA 4FJVB 3SK6A 1CI3M 2O2LD 3A56A 4AIMA 4YY3L 1VQGA 1ZDXA 5KHOA 4OIKA 4RNAA 1DXMA 5J17A 1VQOA 2D5DA 1WZ3A 3G6EA 1MSGA 1OTCA 3ETRA 5GXGB 3N32A 4RF1A 1QVFA 3AEEB 3SFDB 5CGKA 1BCPF 1KAAA 1MFWA 4KKJA 2IHFA 5E4XA 3CXCA 4US9A 4DBGA 3UQBA 2UUCL 2F0TA 4BY1B 2X6GA 3NE5B 4L6TB 1QZHA 2KOXA 1I4XA 1KLGD 2ZVNA 2FCSA 3DM3A 1LFDA 3HOWB 2A69C 4OX9L 1VZ6A 2BYVE 2PVOD 4LF4Q 5C0XJ 4DNRB 1T9HA 1IBXB 4K8IA 2MBOA 4BBNC 3S1RH 3IRBA 4NXNQ 2B2WC 2B2VC 4GKKL 1WGKA 4WWPA 2KCNA 3JW0X 2EYFA 1PRTD 2V4DA 1ROEA 3MC8A 1DJRD 3JAMi 5M3MH 1UELA 2K05A 3H91A 1EIYB 1N33L 2E74C 1QOBA 4P71A 4DN4M 1J5EL 5AZHA 2I5LX 4LCDE 1OXTA 3NBIA 3S2DB 2M9VA 1WTQA 3J81j 4A3DG 2KMAA 1E7VA 1BUVT 1A5RA 4A4IA 2Z0SA 4FF4A 2RMMA 1Y1WB 1JRUA 2DX5B 1SIFA 3FEWX 4A3GB 2W3SA 1EF5A 1WGGA 3HOXH 1A15A 4YY3Q 1G91A 4WQOB 1HNXQ 2LRUA 3C19A 4NAWB 3EGRA 4OVUA 4RKLA 4DHZE 2KX3A 3M85A 3QOLA 4LK1C 2L55A 1YIJA 1HNWQ 3DLLA 1Q5WB 1Y8RC 1EM7A 4R8NA 2G5DA 1P9DU 4CO7A 2JQRB 4C2MB 2K33A 2QEJC 2L0TA 2J0TD 1N32L 4B08A 1L1OB 4GN4B 5C4JB 4PK1A 1MHWC 5C4XG 2PW9A 2IO0B 1ZPSA 4YTNB 4W9LA 4NJCA 4HVBA 4HJ8A 2WX1A 4ANVA 2PO4A 3AE4B 4JI6L 3L0WB 1FFVA 4M8MA 3S1RB 1NAPA 3KYCD 1V9PA 2K32A 2B63G 1P3QU 1SGHA 3Q8CA 2BBCA 5DCNA 5I4DA 2N9XA 3DWAA 4LTUA 4KHZA 4D2KA 1S40A 1CQFA 2L15A 3GTLB 1TY0A 2L1BA 5CV4A 3J80c 4QQBX 4HCNB 1V9JA 5G5HA 3BYTB 4B9WA 2PW5A 3UF8A 3DM1A 1SDFA 4DR7L 4LDTD 1GJZA 3A9KB 2F0JA 4LF6L 4X3SA 1D3ZA 3S15B 3KFUA 4H2AA 3GTQB 2F0VA 1JICA 3P1HA 1SE3A 4OL7A 4LJZC 1DOIA 1X3QA 3CF6E 3BZKA 1SFOH 1WGRA 1PZJD 1PLFA 4II3B 1STBA 1H9SA 4GLVB 1Y1WH 2MHVA 2R7ZG 1K83H 4DXFA 2NZ1D 4W9HA 5E6PA 1TU2B 1STEA 1G8ZD 3QHTA 4K2LA 2R92B 1BBUA 1SMYC 3QIAA 3EHVA 4NY0A 1ENCA 2V1CC 5EKLA 3NVWA 2V3PA 3F2DA 2NPTB 2ASQA 2HTME 2J53A 3RNGC 1TXYA 3T9LA 2NVYB 1JJCB 1VQJA 5I2XA 5CBEE 2B2VA 1BBXC 1J0GA 4JI4Q 1Q8IA 2F3VA 4KMUC 1LTTD 2L76A 3B9JA 3Q0AA 2OTJA 3Q8AA 5LMUQ 2F0UA 2INCC 2JP1A 3BVGA 5C2TB 2CCZA 1VS0A 2PZTA 3DWPA 2WHIA 2WXQA 4LNOA 2AUJD 4P1CC 2FMCA 4WJWA 1XLPA 3AEFB 1O78A 4JI5Q 1KRHA 3TN2A 4KN7C 4HJKA 3BVMA 2A69D 4X65L 3FPUB 1AW7A 2V3NA 3NHEB 4LF7Q 2E2DC 4NAMA 4A3EH 3UE0A 2ICEC 4MSMB 4KHPL 5BMHA 4B3ML 3VYRA 4P7IA 1F2LA 3PPAA 4BOZB 4K6DA 3I72A 3VRAB 4C3JH 2WFWA 4ZCKA 4A3FG 5AJ3Q 1TT5B 1XYIA 4Y52H 4IUPA 5DPWA 2F0IA 3GTQH 3PLVA 2KUMA 4P72A 1S5DD 4A3EG 2X6LA 2J7ZA 1IBML 2JZZA 1SNPA 4DU9A 4FF1A 5EE0A 2WXOA 3RNFC 3ZDTA 2MPMA 4LFBL 1E7UA 1C79A 4R4TA 2K8CA 3PSIA 1G2SA 3UDXA 2KEDA 4HKZE 4BBNF 2JA6H 2JUOA 4DV4Q 1ZKHA 1R7SA 3ENEA 1WRDB 3OLMD 3MXNB 1YJWA 4DAPA 2A68C 2LD9A 1XO3A 4GKJL 3QWNA 3OMGA 1STYA 5ELBA 4GDLA 3VVWB 1BXTA 3DEOA 2HUGA 2O6VD 3CIRB 2AX5A 3K0YA 3PQIA 2VQFQ 2V4IB 2RSOA 4JYAL 1C0AA 1SE9A 4JI1L 5C6AA 3RCZA 2KT7A 2D10A 1IUEA 4Q2JA 2V3SA 1QG7A 3S1QH 2Z6BA 1PUTA 1BNZA 1WXMA 1DONA 3U52E 1YMHE 4JWSC 4OVZA 1PZID 5E7NA 2JA7G 1F9RA 1S1QB 4IM3A 3IVFA 3SXHA 4K6LA 3I4NB 2WU2B 1JOKA 3K58A 3GTGH 4JW0A 1WD0A 4LF5Q 1A62A 1U4PA 5BN5A 3LXFA 2Q5WD 3K59A 4C3IG 5BN4A 2WDQB 3HHMA 2RPQA 3SR1A 1C3TA 2BE5C 3JAME 2I38A 1ZW7A 2L1AA 2NN6I 1YQBA 3DOWA 2RA4A 2SOBA 5IYBG 3KWVA 5K36G 1N5XA 3G48A 3BG3A 4C3HB 2L0FA 3AMZA 3H3VI 2L12A 3SK5A 4LF8Q 3DQVA 3ZW3A 3T1YL 3OTOL 4I6LB 3H15A 4JOIA 1DCZA 1QILA 2K5VA 1N36L 3H7PA 3S16H 4O1NA 1QVGA 2BGFA 3RNEC 2BB6A 3E56A 4LNQA 4HROA 1UWVA 3C46A 1K8MA 1NR4A 4DFAA 3IXSA 1OGWA 2W3RA 2L7RA 1UE1A 1IBLL 2G1EA 3E0JA 5IA7A 1CHPD 5LHY1 3QK0A 4M8NA 3RZDH 5C3XA 2EY5A 4AWJA 5BMIA 2ZXOA 4B9XA 1YN5A 2VXWA 3S1QB 1ZDVA 5M5YH 4YXDB 1N62A 3Q8FA 1F77A 3DHIC 2SDFA 4KY7A 3TSSA 3FHWA 2QDFA 1SBBB 3LB8C 5L83A 4IWQA 1UWXA 3ICEA 2GOWA 1YN3A 1D1KA 3R3OA 1YX5B 2LFNA 2PQAB 1K0SA 5DNFA 1PH1A 1WMHA 4TUUA 4EZKA 4DV2Q 3CWIA 2GB1A 5EPLA 4RGMA 2RDGA 2PMVA 2VRRB 4C00A 4JI2Q 1NJIC 1WCMG 1R4PB 2K6DB 2QF7A 4PYUA 1UGMA 4PS8A 3R93A 2CJNA 4JL9A 2WDTB 4XX5A 2LUMA 1NNXA 3AEGB 1L1OA 5GROA 4GOPB 3A7LA 3F2UA 2JVCA 4EUTA 3CPFA 4FBJB 1EQVA 4TSSA 1HHVA 2MW5A 1WJUA 3HK0A 1CUKA 1Y56A 1L4ZB 2CR5A 2KAJA 2PE9A 3H0GH 5ELDA 4HR7B 4QUFA 3HOZB 1GNUA 1VQBA 1XNQQ 2AQ3B 4TKNA 2YU9H 1WFYA 4ANUA 2R93G 2AL3A 3D6WA 1UBQA 2JF5A 4XDXA 4MEMA 2IJ0A 2WU5B 1NMGA 3L54A 1B9NA 3DXJC 2TSSA 3AI5A 4ICVA 3U7DA 2KTRB 4FF3A 3DBSA 3AFPA 4HJ9A 1JMLA 1Q7YC 3TRZA 4LUOA 1CSPA 2LXAA 4KVGB 1W3SA 4WFN3 2IY1B 5FO9B 4FXCA 1EZ8A 1FRDA 2JYOA 2CU1A 5IGFA 1PFMA 2Y0SE 4RKBA 2GI9A 4YSXB 3PO2B 2R93H 3UI3A 4DR3L 1C4AA 3WOEA 1UEBA 1VQ4A 1KF6B 2JSVX 1CK1A 2EIFA 2JXTA 3H7PB 1KH0A 4IUQA 3HOYB 2LFIA 2B3GA 3I63C 1SE8A 1SE4A 3ZDMC 5IP4D 1LLRD 4FF2A 2JT4B 3TBLD 2N1WA 2ES2A 1HZBA 4A3LH 5JXVA 4RA8A 1WR6E 5D65A 3HKZG 1GG3A 4L2YA 3ZGZA 2WKDA 4G4KA 5KNDA 1WX9A 1WM2A 3L17A 2O4XA 3T1YQ 2KFKA 1DOXA 3S16B 4HDQA 5FLXL 1Q1OA 3PUXA 4M02A 2F3IA 3VA5A 5IP9G 3AN1A 2GVAA 2PZWA 3SK4A 2PNHA 2DNEA 4FXDA 2B39A 4A3LG 4A9AA 4AP4C 4GU2A 4BWGB 3Q22A 4CQNA 3TEXA 3OJ4B 1BKBA 1ASZA 1OQYA 4G7HC 1QOAA 1X1MA 1ZOYB 2CWPA 1VMCA 2EYJA 5LMNW 4DR4Q 2EMTA 1EY0A 4HCEA 1P7EA 1I6HB 4KZ0A 1FPYA 1T0RC 1K8GA 4DQOC 1IW7C 3RI7C 4C1NI 1C4CA 3HM3A 1JOQA 3L08A 2KXJA 3FVQA 3KF6B 4IC7B 2WB1B 3OTOQ 1PH8A 1L0VB 2JWUA 4GGQA 1VF7A 3PUYA 4TRDA 1Q1EA 4HIMA 3S1MB 1NY4A 3HKSA 1Z7TA 3B1LX 2LRWA 2NWGA 3LNNA 1WYDA 3VYUA 1C9FA 4HSPA 3TEWA 4CHKA 3GTPB 1LM0A 2J52A 2O2VA 1SYGA 2BDOA 1E0BA 4F88A 1EY6A 3LJ3A 5HI1A 1ILQA 2INDC 2MBBB 2QC8A 2F0LA 3Q14C 3P1MA 1EYDA 2DYOA 3NY5A 1N34L 4ACFA 5EE9A 4ARCA 2OJRA 3CC2A 4A93H 1S5BD 2HIVA 4C4VA 1II3A 2DJGC 1B2TA 4LJPB 2IDYA 2VY3A 3KJOA 1TWGH 3H0GB 3HOZH 1QOHA 1HCZA 5E6NA 3NZ3A 5BR8Q 2NVTH 2IO1B 1KTKA 4KZCA 4XT1B 4MGZE 1XMOQ 3PS6A 1O7ZA 1XLQA 4ANXA 4HXDA 1LT4D 1UEAB 2JN4A 1JORA 4DUYL 3C0RB 2GBNA 3NXWA 1WYGA 2LMCB 2VB2X 4FDBA 3HZXA 5I6YA 1RAXA 2J0MA 2MCNB 1A2TA 5GAHC 2HE7A 3ZVVA 1R4NB 1I4QA 2K28A 3A8IE 3PMFA 1I6HH 2CW0D 1I35A 3M7GA 1HTPA 4LNIA 3OOCA 3GB1A 4XT3B 2RGFA 2Z4IA 1UNSA 4P16A 4MGYE 3G6JB 2YV5A 4HEDA 1DOYA 2BVCA 2Y0SG 3MXPA 3QAQA 3CCVA 5ELNA 3RN5A 3OJ3A 1IKLA 4YCUA 1PTOD 3NELA 4S3SA 2JA5H 3A1QB 1QCBD 3I3TB 4K81A 1IGCA 1SLJA 3D31A 1WOCA 1WTOA 3K6OA 3DDCB 3FC4A 5DLQE 2JA8B 2IHEA 1RFAA 2KWVB 3T1HL 3CCRA 1SR3A 2XWBB 1R9TB 1AEXA 4ODGA 2ZJPA 4KV2A 4BZAA 2GVBA 4KX6B 2G3QB 1NTGA 2B2UA 2BYFA 3WCQA 3M4OH 3ZO5B 1E3PA 2K6AA 3J81L 4RMFA 4DA2A 2PPBC 2W55A 3X23A 4IM0A 4FADA 4R9WA 2BYEA 1STHA 2JA7B 2KFKB 3I57A 3QARA 1GJXA 1HE8A 3ZNHB 4LFCL 4K14A 5JEAG 3U4VA 1VD2A 2X38A 1Y14B 2DJFC 3IKJA 4DXAB 4KKUA 1L6UA 1CA6A 3TUOA 1OQRA 4GN1A 1K50A 3L16A 3J7AV 2EYHA 4A3KH 4CYEA 1VLBA 1NCVA 2L05A 3EFCA 1KDCA 3QB3A 3VH3B 4BBSB 4DK5A 5HY6A 1FGBD 3SD5A 4RM9A 3PO3G 1T0SC 4P73A 2DAFA 2LGXA 2R7FA 2EJFC 1C7YA 2KWUB 4L5RC 2RBMA 3FKIG 1KLVA 1F2ZA 4ZRJA 3DBRB 4YSZB 1WH3A 2I5MX 1SRUA 1TWGB 4RGNA 1VQLA 1A3TA 2ZZPB 3AU5A 2KQ3A 4BKGA 3RZOB 2K1FA 1UE7A 3ONSA 2SAKA 4KN4C 1V1OA 3V2TA 2OQ0A 1TJEA 1N6ZA 2D9UA 3A55A 1CKOA 1CKMA 3F1ZA 4POFA 3CCEA 1VQ7A 1ESFA 5BYRA 5MPOA 3QWZB 3NQIA 1VQMA 3FILB 4NJ7A 2F0WA 2J0JA 4JX1C 1JQ4A 5FLMH 3T16A 1JJ2A 3AU7A 5GAEC 4MTNA 5L37A 4ZHOA 4PQXA 4NB3A 3A8JE 3Q23A 5JJIA 3RZWC 2F0EA 1E2VA 2GBRA 2Z6KA 1C9OA 2C5CA 3KDFA 4JIOU 4EQ5A 2KHSA 2DYMA 3VUYA 1N63A 1V86A 3ZJYC 1QT9A 1ENAA 1WJ4A 1AZQA 3AB9A 1EWHA 1SXTA 3DMUA 1KOTA 1XTDA 2R61A 3L10B 4WWMA 4GNXC 3L3OC 2KZRA 4WWOA 3I55A 1NENB 3ULPA 3SR6A 3C1FA 5J1ZA 2N9KA 1ZEQX 2XK5A 2DWQA 4R1JA 4W9EA 3MHZA 1ZXIA 1PTOB 1B7YB 1MHHE 1F1HA 2K25A 3T4AC 4CDFC 2E76C 3Q6BA 2B2YA 3OIQA 2L83A 3VTUA 4K7UA 1QZEA 1F9SA 2NZOA 2LGDA 2AWOA 4N9F4 5M5XB 2R7DA 2PMZE 1V8CA 1LTSD 4MH8A 1TWHH 2OT2A 5KNBA 3MJ5A 2VH2A 4A3GG 1HFNA 1EIGA 1EYAA 1I6VC 2X69A 2CHXA 3AE1B 2YLMA 3FP9A 4UY8C 1KRTA 4XQQA 2B3AA 1HZ5A 3VDYA 4BKSA 3N9YC 4C80A 2RQXA 5CYUA 2K5PA 3VYSA 1HZ6A 4GDLB 2KHJA 1N36Q 2RF4A 4MZ9A 2DENB 5I9OA 3RN2A 5E1FA 3DBHI 3NWTA 4I6NB 1D4BA 1TVXA 1R4QB 3WDNA 1JT8A 1U4MA 1IYJB 3KLSA 2FMMA 3VUXA 4IOAA 2LMCA 4NXNL 3UI2A 5IAAC 5FLXE 4A3MB 2IY5B 3IT4B 1SB3C 1HTQA 3A9KA 1U4LA 3NZUA 4TQ1A 2B2YC 2B63B 3P2BA 2VZKD 2K5WA 1GUAB 4JI5L 1GB1A 4WJQA 2F03A 2IPKD 3BDLA 2QSDA 1J8IA 4ZUIA 5HHDG 1SSNA 1TKGA 3J7AF 2DZJA 4XWTA 1LV9A 3DEPA 5D7GA 4KY5A 4PZ7A 2QA4A 2VQEL 1FCCC 1VZ7A 3ABVB 4HPLB 4KHPQ 3ZNZB 2PI2E 3IT6B 5BYQA 4A3OA 3U50C 4MHEA 4W9KA 4DV2L 1BF4A 1JWBD 3PF5A 3F2BA 2YTXA 1YQ4B 5KNCA 4P1BC 4DNIA 1TWHB 4JI3L 3EA6A 2AKWB 1WE6A 2BA1A 1RODA 4DR3Q 3ZLZA 2Q8IB 2K52A 4RF0A 5C5LA 4IWPA 1GO3E 4AYBB 4FHKA 3S17B 1ET9A 2EE1A 1TWAH 1WX7A 4KDLB 2WXIA 3AB5A 1AP0A 2IX1A 4XYCA 3TP8A 3DVNV 1FD6A 3S2DH 3TDQA 1VQKA 4LW1A 3S1NB 1EYCA 1K73C 1SEBD 1FM0D 1Q1BA 1K83B 4EOYA 3RMHA 4P75A 4C1NK 2NCNA 4M1UB 1IGDA 2DAJA 5ELCA 4BFRA 3I73A 4IFDI 1K9MC 3PUWA 4LF7L 2LXKA 1IP9A 2KWDA 2BDNA 1RFKA 1YVCA 2RDHA 4O0AA 1PHJA 3KUDB 4RGOS 2JE6I 1V80A 1WWTA 4A3DB 2K01A 3K9PB 5D14A 3MFGA 3K5OA 3TP5A 2OOBB 3ND8A 2LWPA 4NJ6A 5LMUL 2FCNA 3HOXG 4A90A 1FFUA 1YI2A 2DYBA 4GLSC 1X3GA 3OG5A 2MQHA 1LT6D 2QILA 1K53A 2GBKA 3X3MA 4LF6Q 1P16A 2WXNA 2DBYA 4NPNA 3W1GA 2WGSA 3RLNA 1MBYA 3ZXVA 2E75C 1PFBA 1SYBA 3DUZA 2EMSA 4ZRPA 5BR8L 1PFSA 1GOZA 4DV1Q 4HSVA 1WZ0A 1EF1A 1G2TA 4WIPA 1AYFA 4C7ZA 4JQWC 4ZKBB 4BXXH 3F8TA 4BY1G 1G6JA 1AZPA 4GLXA 2JA5B 2KDBA 5C23A 4IALA 1VQDA 4K8JA 3J80L 2P5ZX 3DBHB 3HOWG 2B76B 1AE2A 4GNXA 3KW5B 4KGRA 2C5LC 3RNCC 3S15H 3U7ZA 1KNAA 4UP7A 5EJWA 5IGGA 4PZ6A 1FYCA 3NQTA 1SNQA 4MTKA 2JXMB 4MJSA 4KIKA 1C77A 2RCFA 2R6GA 4EQOA 4WORA 4PZ8A 2ZM6L 2BH2A 1I4PA 3D3RA 4IOCA 1BUIC 1SJHD 1WIAA 1QF6A 1EY4A 1SYFA 2RDBC 3HOWH 3ZXRA 3GDEA 4IQZA 1GUSA 4OX9Q 3AXCA 2E2JH 2BF8B 4LJOB 4YWMA 3PRMB 3VHTC 5A35A 2FIFA 2N9PC 4NQLB 4P74A 2KC2A 2PEAA 2XN9C 4GOPA 2MH7A 2KDIA 4UPAA 4LF9L 2LXCA 2IGGA 3PREA 4DGZA 4QJFA 1BT0A 1B4OA 3CCUA 1RWSA 3S2HB 2IBIB 4RFBA 3HVDA 5KEEA 2K9XA 2WXJA 1KAWA 1ZP0B 1N5WA 4K0KL 2MLBA 1GPXA 2FUHB 1HEZE 2XGTA 3ERQA 2WXPA 3D4DA 2O5IC 1V5OA 2PQEA 2I2YA 2ZVOA 3CMAA 4C3IB 3MZ5A 4MT5A 3N1XC 3Q3MC 3ITPA 4KGSA 4EFOA 1NDDA 2FAZA 5FO7B 2K03A 2OEOA 1WXSA 2GMIC 5C5MA 5EKKA 1PQSA 4YTPB 4Y7NB 2KN4A 4A3CG 1N9WA 4I65A 5T1GA 1Y69U 1TZOA 2BS2B 2KX0A 2LXJA 2KJ6A 3VXWA 5AFWA 5JPMC 2I07B 5LNK1 1QB5D 2N0SB 3W5VB 2WDRB 5E6JA 5JVH3 1TGZB 3KUCB 3NBHA 1Z9FA 3R2TA 1PV4A 1YD8U 3Q3NC 1GB4A 4RWSC 2EJGC 4A3BG 2JXXA 1UE5A 5HG2A 1BO0A 2EOTA 4KD4A 2D3GA 3B2FA 3W1SC 1IPGA 2KVMA 1V8QA 5M3FB 1Q0WB 1NEKB 3H7SA 3I5JC 2EXDA 2F4VL 3KYHC 1JC7A 4A3FH 2D07B 2JA6B 4S17A 4FULA 2QCPX 2HDEA 3NTIA 1WX8A 2VB3X 1V97A 3B2GA 1V2YA 2PNRC 2A6HC 4E71A 1STGA 3HOUB 5T1IA 4LF9Q 3BYYB 1U5KA 2OWOA 2C9OA 2I46A 1PDXA 3DPDA 3G7LA 4DR5Q 2CHWA 4N9PA 1YBYA 2AHOB 2XVSA 4ZKCB 1XPOA 2UU9Q 3GV3A 1I3QH 5CMDA 3T56B 2FCQA 2Q8TA 5M5XH 1V5TA 1I94Q 2Q2UA 2AWTA 2LI5A 2NS5A 4B3SL 1TS4A 1MPEA 5JPNC 2ZTDA 1WCMB 1YHQA 4DV7Q 1VRAB 3AFQA 1XNQL 5IYDH 4B3RL 1T3QA 1WMHB 1W6JA 3KLWA 2F0HA 1GHJA 1H4RA 4JVZA 3S14H 3BIID 1JB7A 4FJZA 4TMAB 3W5OA 4CGYB 3MP9A 1SNOA 1X3FA 2L4NA 3O13A 2HT1A 1TYGB 3PTFC 1YJJA 4MH0E 1KD1C 2WYQA 4GOPC 3KOJA 3L13A 5BO4B 2NVYH 4WJOA 3S2HH 4KJOA 1IYVA 1MG8A 1E9MA 2DGYA 3C3LA 2WDVB 3PHXB 2AWNA 1XTCD 2W82A 1NYRA 2EDGA 3STBC 1P0RA 5K5PA 4LDTB 5I9PA 4HK2A 4KSLC 2MSED 3ZJUA 1L6VA 3RNAC 1FR3A 4K5VA 2UU7A 1EQRA 1XCQL 1D5XC 4F1SA 5DEHA 3JAML 2K14A 1P98A 2E6XA 1GVPA 4C7YA 1E22A 1EFID 3TZUA 1TS5A 3I7FA 3ZRCA 3N1YC 4Q5VA 4A3EB 4JI8Q 1JROA 3MXGA 3N3KB 4FXKC 3TREA 2AYOB 1OO9B 1WI0A 1A0IA 1JQYD 2MBHA 4RMAA 2EKEC 4EZJA 5K36H 3PSEB 4HWIB 2N9EB 4N8X1 3IFWB 1STAA 3E0EA 3N1ZC 3H9DA 2ZJRA 4MACA 2MUYA 3HKZB 4KLKA
chains in the Genus database with same CATH topology
3M4YA 1WTXA 2XRQD 1PFDA 1SSOA 3BDCA 4YWGG 2GA4B 1F2YA 2XWJB 3I90A 2YEPB 3NP8A 3OPOA 5JVG3 1HRJA 3IL8A 3KBGA 4K5WA 5H92C 1MD2D 3I3CA 2RSNA 1MSHA 3H6MA 1MVKA 1DOMA 2B2TC 4KTAA 1DZ1A 2F0GA 2LS01 1S5CD 3NUCA 1QOGA 2M2LA 5ELFA 1EY9A 2IGHA 1BCPB 5TSSA 3TEYA 1UUPA 3IAYA 1N60A 3ZJTA 4TQUS 3H09A 4NW2A 1DD2A 1PRTF 1O7YA 4C3HG 1Q90A 1TR5A 1CQVA 1TS3A 3V05A 1FNVA 3EJIA 1LT5D 3HOXB 1CTMA 1XLNA 4V190 4OO1G 3OMCA 1I4GA 2KCCA 2F0SA 2ID0A 3FPPA 2H89B 2LEKA 1EWYC 2EPBA 2OF1A 2MP1A 1GUGA 4G7ZC 4X3KA 4XQJA 1ET6A 3HRZC 3K5NA 1PRTC 4DAVA 4EE2A 1DM0B 3V3XA 1SJED 5JOBA 1D1IA 4L63B 3KF8A 1AWDA 2M0AA 3K5MA 3GTOB 3GTJB 3K7AB 3HP3A 4X3UA 1QQRA 1SFOB 3NHHA 1N61A 4ZRQA 1CT1D 1NUCA 5AUIA 4IUTA 1EWCA 2BT6A 2Y5PA 5D3IB 4EGVA 2FHTA 2L0CA 4US8A 4N59A 1K52A 2EYOA 4ZYSA 1YN4A 3AE5B 3RD4A 3PO3B 1MI0A 5J39A 2E3TA 3Q6SA 4U68A 2B8FA 4NKLA 3WOFA 5EE1A 1GUOA 2JYEA 4XDDA 2XNAC 2CW0C 3RFZB 1CZWA 2IX0A 3ND9A 4UDUC 5ISRA 2RPVA 4IZ8A 2ZXRA 2VUMB 1TQOA 1ZKOA 1I3QB 1PRTB 2BCOA 3QG1A 4Q0FA 5DAUA 3C1EA 1PDQA 2EZVA 4ARIA 3W3AA 4NDXA 1LO5D 1YNNC 4OZCA 3TMEA 3QO2A 3ZJVA 3LYYA 5BYSA 3S14B 1AN8A 2A68D 4B0MA 1ENFA 3EROA 3IAS1 2F3WA 2AQ2B 4H7BA 3EQLC 3OWEB 4HJGE 4OZAA 3CU7A 5JEAJ 1KABA 2EXZA 1F0ZA 3U4EG 1GUWA 1FXIA 2FUG1 1TS2A 2G9DA 4JPSA 4CKEA 2F1MA 1HXYD 4F8MA 4MIUA 5J22A 5KYIA 5JAVA 3PUZA 3HEJA 1WRIA 2BW2A 3KBXA 1VMPA 3I4MB 2WIIB 1NSNS 2O5JC 1VJKA 1BR9A 3KLRA 3CHBD 1NYQA 1P7FA 3VR8B 1K8OA 3RUZA 3AECB 5EGTA 2M56B 5H8YE 3MXNA 2JEAI 1TT2A 4K5XA 2WS3B 1A2UA 4H0LC 3HRDD 3ONAB 1J9OA 3W2DA 5ELEA 1CFMA 4PMWA 4LMQD 3W9CB 2DY8A 1PXUA 4MN3A 1FCLA 1D5ZC 2B2WA 1MI2A 4UAIA 3NUHB 4TQ0A 1PGXA 1E10A 2TMPA 4A6QA 4N9TA 4C56C 3NS1A 1B3AA 4NMZA 3NRZA 1D2BA 1ZYRC 1U4RA 2OXPA 3FAHA 4HKQA 2ENBA 1GXDC 1E7PB 2WXFA 1T5EA 2KOLA 4BBRB 2M00A 2FINB 2KA7A 1V43A 2IT1A 2EKIA 1Z6HA 1H9RA 2QMTA 4HMJA 3H3VC 3ZQ4A 2QIEB 1JWMD 3A54A 4BY7B 1SAPA 1HPCA 1DGJA 4FNFA 2CU3A 4RCOA 3P7JA 5M5WB 1LACA 5IT9L 4KHVA 3I8ZA 3MXUA 4RCNA 4BA1I 4GZYC 4OZBA 2FE8A 2HQEA 2D2CC 5JJZA 5C0XH 5EKIA 1EZ6A 1MGSA 2WV6D 3AM9A 3BK2A 1QLBB 2WQYB 3FDTA 2EJMA 5HFYA 1HQMC 4KY6A 2EELA 3LWEA 1SNCA 1SYDA 4Z9CB 2A5HA 4XXEA 1PGBA 5DM73 3CRKC 3IAM1 1OXUA 2F0OA 2PKOA 1TKEA 3P4PB 2WINB 4ABNA 1KLUD 2IX3A 2HDLA 2BE5D 2K04A 3KQ4A 4ITKA 3VR2A 3PIP3 3P75A 4ZK9B 1PZKD 3KWLA 1EY7A 4IDIA 1I4RA 1CHQD 4IFDJ 3Q69A 4ME5A 3GTMB 3P4QB 4PMBA 1XF5L 5IGCA 2PMZB 2NVTB 4N58A 1PTOH 5I6WA 3L9AX 1VDVA 3ZYYX 2RDFA 2J42A 5EE3A 1E6EB 1UWMA 2Y5CA 1H9SB 5CV5A 1TWCB 2BYTA 4RGTA 1IBXA 2F0FA 1WTPA 1RDPD 2PYKA 2BA0A 4A93B 5G3LD 2EYMA 5C3WA 3K5LA 4KKIA 3TZDA 1ZXTA 5C4ZA 4YSYB 3P42A 2A73B 4QMGA 3D4WA 3PUVA 4J6HA 4REZA 2A6ED 1TWFB 2M19A 2OEDA 2EYPA 3SFEB 2LJIA 1Z47A 1JCKB 1ILPA 3HOVB 2K7VA 4IUVA 4CKCA 4MM3B 4PT5A 4HAEA 3MVVA 3H8HA 2ZW1A 1SE2A 1WSPA 2WXKA 2JX5A 1PTOF 3V96A 5G5GA 5KGUA 1RKNA 1HA5A 4IUNA 3GO5A 4RHSA 4QB4A 3A7AB 4ZQ3A 1RJTA 3DHQA 4GDKB 2BOSA 3GQBA 3L7ZC 3D4RA 4XE0A 1YNND 1BDOA 2DY7A 4R3DA 1H9JA 4BS9A 4CKBA 5JEAH 1UGJA 2ACZB 3BDOA 3I91A 3VYTA 5LL6S 1C76A 3AMUA 2L11A 3NK9A 3NTKA 3NVYA 4ZHPA 5IGBA 3MHBA 3N52A 1J7BA 4IOIE 3DWMA 1B44D 2MJEA 3D8GA 5FK9C 5HURA 2WXLA 3TP7A 2FJ2A 5C3EB 1VF5C 2LY7A 2XSCA 4G57A 1YNJC 1J7CA 2F0PA 4ZRZA 4WH4A 3IFDA 5E4WC 4RAUC 3SDZA 4J8QA 5A2QL 2IW3A 1F2RC 1QNKA 4M8AA 4A3JB 1JALA 1FD7D 2LKVA 1L4DB 4C3JB 3GTKB 2HDMA 4FO2A 4IN3A 1ZYRD 3MA2B 3P4SB 1G291 4ZOHC 1I4HA 1RF2D 3T3NA 3Q24A 3AH7A 2RVLA 1G6ZA 4BA2I 1TKWB 3SE0A 4H13C 4YIJA 3N6RA 1EY8A 3GTGB 4R8IA 3I4LA 1YQ3B 2R3ZA 3U2SC 3AEAB 5M9OA 5FOBB 1A3UA 2PTLA 2CJOA 3E6ZX 4F87A 3FMCA 1QKZA 1FNUA 1QNUA 1PMRA 4EVOA 2AQ1B 2CVRA 4PV1C 1E0ZA 1HUNA 4A3BB 4OO1I 1UAPA 1B9MA 4JE3B 1HA6A 2EYLA 5I2YA 1GUTA 4A8XC 2INPE 1HTLD 3P4RB 1NR2A 1RCVD 2QDBA 5C44B 3AE2B 4U673 4ILWA 3QJYA 5CV9A 2FFKB 3NPPA 3I70A 1RM6C 3W5UB 2PW7A 4KK7A 1TWAB 1HFGA 1QWYA 1GAQB 5COYA 5KIXA 3K57A 4XDCA 1QE6A 1BOSA 4O42A 4TKOB 3RLFA 3BS1A 1CZGA 2IL8A 2L9HA 3LX0A 4XTCS 1B9RA 4JWUC 1W6KA 1XXGA 2NMQA 3HG9A 2F0DA 3MWYW 3AE8B 2H4OA 1FEHA 2R7ZB 1LTRD 1EQTA 3HS0C 2WXHA 1EU4A 2SNMA 2N9LA 2PIAA 2WP9B 3KLSX 3T3OA 1A70A 1PYWD 4CJ1B 5CORA 1E2WA 1ONLA 3W1SA 1STNA 3R8BA 3VR3A 3T53B 2ICIA 5C4XB 2F0QA 3AE9B 1EIHA 4AQ7A 4B0EA 1ZE3D 4OHJA 4USAA 2SEBD 5EQ0A 2ONQA 4HCSA 3SK8A 1FRRA 4AS1A 2K5QA 4LK0M 5C0XI 4CJ2C 1MHXA 1JE4A 3VR6A 5IOCA 2SNSA 3HUIA 1CA5A 2E2JB 1YNTE 2MEKA 1XEEA 2KEEA 1J7AA 1ML0D 1S5FD 1SNDA 1U9RA 1CZPA 3J9CA 1Q10A 5FR3A 2F0NA 3EVQA 3TP6A 1K51A 3MC0B 1RTNA 2WXRA 1AFPA 1HUMA 2PCFB 2B2UC 1SYCA 3AE3B 1C48A 2L52A 4FXGC 1E2ZA 1BQQT 4HRSA 3DWGC 1IL8A 2JZPA 5C3JB 2KJXA 4ZLTF 1LTGD 1PFNA 1SMYD 3CRLC 1XLOA 3AEDB 3VR4A 1DOLA 1Y8NB 1O80A 1C8CA 3C2PA 4KV6A 2F0MA 4A3FB 3AV8A 1XX8A 2QKIC 1WVLA 1S4ZA 1EL0A 2B8GA 1S5ED 5LL6X 2HCCA 5EBDA 4I7ZC 4P2CB 2K5DA 3VRBB 4YTMB 1FNWA 1WTRA 3KK7A 1JB3A 4J3OD 1I50B 2A6HD 5IT9E 5AUKA 2ON8A 1RTOA 3MTSA 2NTTA 2MJ8A 1V1PA 2NB0A 1DOKA 2K1BA 5IODA 3FILA 1ESRA 1B50A 4C3JG 1F9QA 1VR9A 5BMGA 1JR0D 2KDMA 3U9SA 1H9MA 1OXXK 2KACA 1OXSC 2JU6X 3NVZA 1D6EC 1PGAA 2K3UA 2VZKB 4FP5D 4XIGS 3URYA 3H94A 4QUCA 4CJ0B 3MFYA 4EQNA 2AUKA 1IHZA 1M4VA 4KI0A 3LWUA 4DK0A 2K0PA 2PVGC 4F7XA 3NWSA 1Q3LA 1A6XA 2DNCA 4IKGA 1F2MA 4KGTA 4L1BA 2INNE 3A8KE 1M8AA 1YNJD 4LLGM 2EY2A 3AE6B 1RHPA 5E3FA 3P20A 2ZT9C 3GP7A 2BTEA 2JSOA 1KDBA 4CBVA 4KKTA 1F2RI 1LTAD 1JWSD 2ZW0A 2RKSA 2PZUA 2LGIA 1QOFA 3VR9B 4EQPA 2MGSA 3AE7B 3J81E 4HTHA 1T5XD 1Y8OB 2IGDA 4A55A 2JYTA 3PZ7A 2WP8J 1EY5A 3MEHA 2QJLA 4DAYA 1SYEA 5NUCA 1EEFD 4X3TA 3I9V1 4IFDH 1LTBD 4V0BA 2J4XA 5EPJA 2VNUD 5CV7A 4XYQA 2FBWB 3VQIA 1DYQA 2F0KA 1VDZA 3NVVA 1WTWA 1BCPD 5IGDA 1KFYB 4IFDG 3OSOA 3U9OA 5EPKA 2NYZD 2DLBA 1EU3A 3T51B 4ID6A 5CC4A 4XWWA 2Z8LA 4OGQC 1JRPA 2NVQB 3QOJA 2NBFA 4P6VF 2YEPF 3DWQA 2D62A 1GHKA 2Z4HA 1D5MC 3E9SA 2Z1CA 2D5GA 3HVZA 1PTOC 3EFXD 4J1MA 1C4PA 4OO1H 2LHDA 1V1PB 2JEBI 4DXGA 5IGEA 2DN8A 4WQMA 4H44C 4KD3A 3RZDB 2L5TA 1JW9D 1SIJA 1JOOA 5M5YB 1ZUD2 1EOTA 1RD9D 1B53A 2BB5A 1ACCA 4XQNA 1O7LA 4XYOA 4DK1A 3PIO3 4JK1C 5CR3A 3GS2A 4RHRA 1L5PA 4DNTB 2LHEA 1TKYA 3PO0A 1ZXHA 1XCTL 2A74C 1L0XB 2EY1A 3HGBA 2Y0SB 2HCIA 3M4OB 1H9KA 2YU9B 3SVMA 5C4HA 3AEBB 3VR5A 5BN3A 4YT0B 2L32A 3M7NA 2WKCA 2WLBA 4WAFA 1IW7D 5FO8B 2XRSD 2R93B 2CQAA 3NTHA 1BMLC 4FYDA 4KKSA 3J7YW 3J80E 1C4QA 4A3IB 2MJ3A 1L0YB 4FVMA 1SNMA 4DF7A 1FXAA 3BWUD 2NTSA 5IIFA 1NI3A 3OWFA 1WXQA 3TEZA 3NSWA 2E2HB 2NVXB 2KMMA 1KDAA 4HEA1 4NP5A 4ZUJA 4K2KA 3C8YA 1WD1A 2F4IA 3GD7A 3FKIB 3SEBA 2K22A 5HGTA 1F9PA 3R2IA 1VCIA 1KNEA 2OHFA 1Q12A 2BS4B 3TBIB 1FIQA 4N6EB 3KUPA 1RYJA 1EEID 2A6EC 4OIJA 4OW0A 2N7JA 5EBCA 5G3LF 4ULLA 3S9WA 1C78A 1I7HA 3E5SA 4QF4A 4QCLA 3P63A 1IKMA 1QJOA 4QIWB 1TIID 1SF0A 1HQRD 4L8JA 4KJNA 1JWUD 2WXGA 1LT3D 2NN6G 2GRIA 3PV0A 3OIPA 2YYZA 1Y1VB 2WACA 3GV6A 3CQZB 3X3NA 4IUUA 2IWHA 5KRUA 3Q8BA 1Y8PB 2E2IB 2NN6H 1FO4A 2G9HD 5A2QE 5D3DA 1YJIA 4G7OC 3EUB2 3OW7A 3T13A 1WTVA 4PNYA 2WXMA 4L23A 4CHTB 2B2TA 3PZ8A 3D6CA 3IFTA 1VZ8A 2PLPA 4NZLB 1NVID 5FKAC 2Q8RE 4PMCA 4JBWA 2H88B 2CHBD 2ZXPA 2Y3AA 1ICWA 3CKIB 5DM63 2WAQB 3MAQA 1B1ZA 2EY6A 5F2DA 3OHXC 1JWAD 1X32A 2MJDA 3SHLA 1OQQA 1FMAD 1T6BX 1GUNA 2KQ4X 2BS3B 3BK1A 5T8IA 2WNMA 1LABA 1OXVA 4A3KB 3FRPB 4IURA 4HMIA 5CBAE 2H1EA 5CV6A 2N88A 1BCPC 1A3VA 5KYLA 1CM9A 2NUCA 2V0GA 1IYUA 1TY2A 4WRDA 3BZDB 5M3MB 4ZAIA 3RPFC 4RH6A 4E6IA 4WURA 1CJEA 4LAAA 1XWEA 2N55A 2EVBA 2XIWA 5CV8A 1LTID 1X3PA 3L4PA 3VA7A 5C0XG 3Q8EA 2W54A 2KECA 3BVZA 3M3YB 1OFFA 3SK6A 1CI3M 2O2LD 3A56A 1ZDXA 4OIKA 4RNAA 1DXMA 2D5DA 1MSGA 3ETRA 5GXGB 4RF1A 3AEEB 3SFDB 5CGKA 1BCPF 1KAAA 4KKJA 5E4XA 4US9A 2F0TA 4BY1B 2X6GA 3NE5B 4L6TB 1I4XA 1KLGD 3HOWB 2A69C 1VZ6A 2PVOD 5C0XJ 4DNRB 1IBXB 4K8IA 2B2WC 2B2VC 1WGKA 2KCNA 2EYFA 1PRTD 2V4DA 1ROEA 1DJRD 2K05A 3H91A 2E74C 1QOBA 4DN4M 1OXTA 3NBIA 3S2DB 2M9VA 1WTQA 1BUVT 4FF4A 2RMMA 1Y1WB 3FEWX 4A3GB 2W3SA 1A15A 1G91A 4NAWB 3EGRA 4RKLA 3M85A 3QOLA 4LK1C 2L55A 1EM7A 4R8NA 2JQRB 4C2MB 2K33A 2QEJC 2J0TD 4B08A 5C4JB 2PW9A 1ZPSA 4YTNB 4NJCA 2PO4A 3AE4B 1FFVA 3S1RB 1NAPA 3Q8CA 2K32A 2BBCA 5I4DA 4D2KA 3DWAA 4LTUA 4KHZA 4M0WA 1CQFA 3GTLB 1TY0A 2L1BA 5CV4A 5G5HA 4B9WA 3BYTB 2PW5A 3DM1A 1SDFA 2F0JA 4X3SA 3S15B 4H2AA 3GTQB 2F0VA 1JICA 3P1HA 1SE3A 4OL7A 4LJZC 1DOIA 1X3QA 1PZJD 1PLFA 1STBA 1H9SA 2MHVA 4DXFA 2NZ1D 1TU2B 1STEA 1G8ZD 4K2LA 2R92B 1SMYC 3QIAA 1ENCA 5EKLA 3NVWA 2V3PA 2HTME 2J53A 2NVYB 5I2XA 5CBEE 2B2VA 1BBXC 1Q8IA 2F3VA 4KMUC 1LTTD 3B9JA 3Q0AA 3Q8AA 2F0UA 2JP1A 3BVGA 5C2TB 2PZTA 3DWPA 2WXQA 2AUJD 2FMCA 4WJWA 1XLPA 3AEFB 1O78A 1KRHA 3TN2A 4KN7C 3BVMA 2A69D 3FPUB 1AW7A 2V3NA 2E2DC 4NAMA 2ICEC 5BMHA 3VYRA 1F2LA 4K6DA 3I72A 3VRAB 1XYIA 4IUPA 2F0IA 2KUMA 1S5DD 2X6LA 2J7ZA 1SNPA 4DU9A 4FF1A 5EE0A 2WXOA 2MPMA 1C79A 1G2SA 2KEDA 4HKZE 1R7SA 4DAPA 2A68C 1XO3A 3QWNA 3OMGA 1STYA 5ELBA 1BXTA 3DEOA 2HUGA 3CIRB 2AX5A 3K0YA 2V4IB 2RSOA 5C6AA 1IUEA 4Q2JA 1QG7A 1PUTA 1BNZA 1DONA 3U52E 1YMHE 4JWSC 4OVZA 1PZID 1F9RA 3SXHA 4K6LA 3I4NB 2WU2B 1JOKA 3K58A 1WD0A 1U4PA 5BN5A 3LXFA 2Q5WD 3K59A 4C3IG 5BN4A 2WDQB 3SR1A 2BE5C 3JAME 2I38A 2L1AA 2NN6I 2RA4A 2SOBA 3KWVA 5K36G 1N5XA 3BG3A 4C3HB 3AMZA 2L12A 3SK5A 1DCZA 1QILA 4O1NA 2BB6A 3E56A 4HROA 3C46A 1K8MA 1NR4A 4DFAA 3IXSA 2W3RA 2G1EA 3E0JA 1CHPD 5LHY1 5C3XA 2EY5A 5BMIA 2ZXOA 4B9XA 1YN5A 2VXWA 3S1QB 1ZDVA 4YXDB 1N62A 3Q8FA 1F77A 2SDFA 4KY7A 3TSSA 1SBBB 3LB8C 1UWXA 1YN3A 1D1KA 3R3OA 2LFNA 5DNFA 3CWIA 2GB1A 5EPLA 4RGMA 2RDGA 2PMVA 1R4PB 2QF7A 3R93A 2CJNA 2LUMA 3AEGB 3A7LA 3F2UA 1EQVA 4TSSA 1HHVA 1Y56A 1L4ZB 2KAJA 5ELDA 4QUFA 4HR7B 3HOZB 2AQ3B 3D6WA 4XDXA 2IJ0A 2WU5B 1B9NA 3DXJC 2TSSA 4FF3A 1JMLA 4WFN3 5FO9B 4FXCA 1EZ8A 1FRDA 2JYOA 5IGFA 1PFMA 4RKBA 2GI9A 4YSXB 3PO2B 3UI3A 1C4AA 3WOEA 1KF6B 2JSVX 1CK1A 2JXTA 1KH0A 4IUQA 3HOYB 2LFIA 1SE4A 1LLRD 4FF2A 5JXVA 4RA8A 5D65A 3ZGZA 4L2YA 2WKDA 4G4KA 5KNDA 2O4XA 1DOXA 3S16B 5FLXL 3PUXA 3AN1A 3VA5A 2PZWA 3SK4A 2DNEA 4FXDA 2B39A 4A9AA 4BWGB 3Q22A 4CQNA 3TEXA 1QOAA 4G7HC 1ZOYB 1VMCA 2EYJA 3U7ZA 1EY0A 4HCEA 1P7EA 1I6HB 4DQOC 1IW7C 4C1NI 1C4CA 1JOQA 3FVQA 2WB1B 2JWUA 1L0VB 1VF7A 3PUYA 4TRDA 1Q1EA 3S1MB 1Z7TA 2NWGA 3LNNA 3VYUA 1C9FA 4HSPA 3TEWA 3GTPB 2J52A 1SYGA 2BDOA 1E0BA 4F88A 1EY6A 5HI1A 1ILQA 2F0LA 3P1MA 1EYDA 2DYOA 5EE9A 4ARCA 1S5BD 1II3A 1B2TA 2IDYA 3H0GB 1QOHA 1HCZA 3NZ3A 1KTKA 4XT1B 1O7ZA 1XLQA 1LT4D 1UEAB 1JORA 3NXWA 1WYGA 2LMCB 2VB2X 3HZXA 5I6YA 1A2TA 1I4QA 2K28A 3A8IE 3PMFA 2CW0D 3M7GA 1HTPA 3OOCA 3GB1A 4XT3B 2Z4IA 1UNSA 4P16A 3G6JB 4HEDA 1DOYA 3MXPA 1IKLA 1PTOD 4S3SA 1QCBD 1IGCA 3D31A 1WTOA 3K6OA 3FC4A 2JA8B 1R9TB 2XWBB 1AEXA 4ODGA 4KX6B 2B2UA 3WCQA 2K6AA 3J81L 4DA2A 2PPBC 2W55A 4R9WA 1STHA 2JA7B 3I57A 1GJXA 4K14A 5JEAG 2X38A 3IKJA 4KKUA 1L6UA 1CA6A 3TUOA 1OQRA 1K50A 3J7AV 2EYHA 1VLBA 1NCVA 1KDCA 3QB3A 4BBSB 1FGBD 2EJFC 2RBMA 1F2ZA 4YSZB 1TWGB 4RGNA 1A3TA 2KQ3A 3RZOB 2SAKA 4KN4C 1V1OA 3V2TA 1TJEA 2D9UA 3A55A 1ESFA 5BYRA 5MPOA 3NQIA 3FILB 2F0WA 4JX1C 1JQ4A 3T16A 3AU7A 4ZHOA 4PQXA 3A8JE 3Q23A 2F0EA 1E2VA 2C5CA 2KHSA 2DYMA 1N63A 1QT9A 1ENAA 1AZQA 3AB9A 1EWHA 1SXTA 3DMUA 2R61A 4WWMA 3L3OC 1NENB 3SR6A 3C1FA 5J1ZA 2N9KA 1ZEQX 2DWQA 3MHZA 1ZXIA 1PTOB 1MHHE 3T4AC 2E76C 2B2YA 3OIQA 2L83A 1F9SA 2AWOA 5M5XB 1V8CA 1LTSD 4MH8A 2OT2A 5KNBA 3MJ5A 1HFNA 1EIGA 1EYAA 1I6VC 2X69A 3AE1B 4XQQA 1HZ5A 3N9YC 4C80A 2RQXA 5CYUA 2K5PA 3VYSA 1HZ6A 4GDLB 5I9OA 5E1FA 1D4BA 3NWTA 1TVXA 1R4QB 3WDNA 1U4MA 3KLSA 2FMMA 2LMCA 3UI2A 5FLXE 4A3MB 3IT4B 1SB3C 1U4LA 4TQ1A 2B2YC 2B63B 2VZKD 2K5WA 1GB1A 2F03A 2IPKD 3BDLA 2QSDA 1J8IA 4ZUIA 5HHDG 1SSNA 1TKGA 3J7AF 4XWTA 1LV9A 3DEPA 5D7GA 4KY5A 1VZ7A 1FCCC 3ABVB 3IT6B 5BYQA 4MHEA 1BF4A 1JWBD 1YQ4B 5KNCA 1TWHB 3EA6A 2BA1A 1RODA 2Q8IB 4RF0A 5C5LA 4AYBB 3S17B 1ET9A 2EE1A 2WXIA 3AB5A 1AP0A 2IX1A 3TP8A 1FD6A 3TDQA 3S1NB 1EYCA 1SEBD 1FM0D 1Q1BA 1K83B 3RMHA 4C1NK 4M1UB 1IGDA 5ELCA 3I73A 4IFDI 3PUWA 2KWDA 2BDNA 1RFKA 2RDHA 4RGOS 2JE6I 1WWTA 4A3DB 2K01A 5D14A 3MFGA 3K5OA 3TP5A 3ND8A 4A90A 1FFUA 4GLSC 1LT6D 2QILA 1K53A 3X3MA 2WXNA 2DBYA 1MBYA 2E75C 1PFBA 1SYBA 3DUZA 4ZRPA 1GOZA 4HSVA 1G2TA 4WIPA 1AYFA 4C7ZA 4ZKBB 1AZPA 2JA5B 4IALA 3J80L 4K8JA 2B76B 4KGRA 1KNAA 5EJWA 5IGGA 1FYCA 3NQTA 1SNQA 2JXMB 1C77A 2R6GA 4EQOA 4WORA 1BUIC 1I4PA 3D3RA 1SJHD 1QF6A 1EY4A 1SYFA 4IQZA 1GUSA 5A35A 2XN9C 2MH7A 2IGGA 4DGZA 1RWSA 1B4OA 3S2HB 4RFBA 3HVDA 5KEEA 2K9XA 2WXJA 1ZP0B 1N5WA 1GPXA 1HEZE 3ERQA 2WXPA 3D4DA 2O5IC 2PQEA 2I2YA 4C3IB 3MZ5A 4MT5A 3ITPA 4KGSA 5FO7B 2K03A 2OEOA 5C5MA 5EKKA 4YTPB 4Y7NB 2KN4A 4I65A 5T1GA 1Y69U 1TZOA 2BS2B 5AFWA 5JPMC 2I07B 5LNK1 1QB5D 2N0SB 3W5VB 2WDRB 5E6JA 5JVH3 3NBHA 3R2TA 1GB4A 4RWSC 2EJGC 5HG2A 1BO0A 2EOTA 4KD4A 3B2FA 2KVMA 1V8QA 5M3FB 1NEKB 1JC7A 2JA6B 2QCPX 2HDEA 3NTIA 2VB3X 1V97A 3B2GA 2PNRC 2A6HC 1STGA