2HDEA

Solution structure of human sap18
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
148
structure length
148
Chain Sequence
b'GSHMRVTQEEIKKEPEKPIDREKTSPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone deacetylase complex subunit SAP18
molecule tags Transcription
source organism Homo sapiens
publication title Structure of SAP18: a ubiquitin fold in histone deacetylase complex assembly.
pubmed doi rcsb
total genus 17
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06487 SAP18 Sin3 associated polypeptide p18 (SAP18)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.550 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2hdeA01
4A90A 4A8XC 2HDEA 4A6QA
chains in the Genus database with same CATH superfamily
3DBRI 2N1VA 1GOZA 1CZPA 2QSDA 3W1SA 3QA8A 4YXDB 3Q2AC 5IAAC 3QHTA 2KXJA 1GB4A 4H2AA 4MJSB 1JW9D 2K22A 2C9WB 3RI7C 2ZEQA 4AP4C 2KTRB 4ZYSA 2J0MA 2RGFA 2KWCA 2ZVNA 3EC8A 4C4VB 1I4GA 2JVCA 3NVWA 2NR2A 3IBEA 1ET9A 3PT2B 1NYRA 3TCAA 3LXFA 1RRBA 5FR6A 2V0GA 1OQYA 2HE7A 3PRPB 4GOCA 2W55A 4IM3A 1I4RA 3HRDD 1K51A 3SD5A 2MBQA 4GIVA 1J7CA 2X8XX 3RYTA 2I2YA 2YVCA 1TS5A 1JWUD 2XK5A 1SE4A 1JRPA 1KLUD 3AU5A 2M4NA 4MSMB 4FADA 3VXWA 2XBBC 2GBJA 1V49A 2LGDA 1UF0A 3CMMB 2M8SA 4EZLA 2BYFA 1I4XA 4NAWA 3T8MA 4DHJD 2BBCA 4ZRJA 3U30A 4E71A 3KUZA 3HVDA 3K9PB 2CR5A 2WX0A 4HLEA 2B3AA 3FC4A 1XO3A 1V5TA 4W9KA 1Q1OA 1QOBA 5H8YE 3IVFA 4II3B 1AARA 1NYQA 2H89B 2BVCA 4ARCA 4KGTA 2KLCA 4YTMB 1Z2MA 1TT5B 2LRWA 3NRZA 3SR6A 1UBIA 3NUHB 4XZ4A 4IM2A 4WURA 1WYWB 2WXNA 3OLMD 1QOAA 3ZXVA 1TKGA 5DCNA 1LGRA 3L0WB 1FXIA 4OVZA 2DLBA 1AN8A 2G4SA 3GP7A 1HE8A 5G2NA 1PGXA 3IT6B 2BS2B 3HUIA 2JYEA 1C1YB 1NI3A 1WJ4A 2LI5A 4N59A 4DK5A 2NTSA 1JWSD 4OZBA 1KM7A 3EA6A 1JROA 1MPEA 1TY0A 3ZDTA 1JMLA 1WI0A 2UU7A 2Z0EB 2W3SA 4HROA 1C3TA 4LNKA 2ASQA 1EWYC 4KKIA 3ZNHB 3W9CB 1IGCA 1GUAB 1N60A 2MLBA 2L8JA 4HVBA 3NZSA 4M0WA 4C80A 3MP9A 2AL6A 1FNUA 1PUTA 5AUKA 2RDGA 2JQRB 4B6WA 2WXIA 3PHWB 5C23A 3N9YC 1XLPA 2QHOA 1YQ3B 4YWGG 1GNUA 2NTTA 3HM6X 1WM3A 1Q5WB 1T0RC 4HJKA 1SEBD 1GAQB 1FRRA 3D32A 2V4IB 4W9EA 2JU6X 3URYA 3WCQA 3M3JA 4BAXA 4TQ1A 2D3AA 2DENB 2MRPA 1TIFA 2RPVA 4WJQA 2DAJA 2JZPA 2KVZA 4YTPB 3FKYA 2L32A 2BS3B 4WJNA 5HHDG 1UH6A 3M63B 4KDLB 3AE6B 3P4RB 3QQ8B 2K9XA 1WGKA 2Y5PA 1IBXB 4CO7A 5GXGB 3BVZA 1HZ5A 1QILA 1J7BA 4ACFA 5BYSA 2SAKA 3MHZA 3PZDA 1WZ3A 1SJED 2KDMA 4MACA 4TV3A 3ZRFA 4BZAA 4DHZE 4W9HA 3T9LA 4UDUC 1XLQA 2LVPA 1C4AA 1OQRA 3NVVA 1QOFA 3WAPA 2LGIA 1IP9A 4PS3A 2GLSA 4GDLA 4REZA 5BO4B 5DPSA 3U52E 1ZXHA 2MH7A 2JZ3B 2ICIA 2J0JA 3CIRB 4IUMB 1D6EC 4US9A 5J2RA 3BINA 3ZJTA 1VZ8A 2NBUA 2AEHA 5CX3A 3HIZA 3AEBB 1ZDXA 1V1PA 4WWOA 2LFIA 3IAS1 3RULA 3KLSX 4LDTD 4P1BC 1SF0A 4F7ZA 3ZNZB 1KLVA 3PS6A 1IYFA 1YNTE 4G50A 3JSVB 3A9KA 3APCA 3U8ZA 2UYZB 1OEYA 2VH1A 2LHEA 3BYTB 4TMAB 3IAM1 2LHDA 2DHZA 5LXIB 5E6PA 3Q8EA 5KHQA 3KUDB 4FHJA 4EFOA 1V81A 1P7EA 2YLMA 4JLCA 4GDKB 3UQAA 3V61A 1C4CA 3PREA 4YTNB 4LJOB 2PJHA 4ASWC 2GRIA 3U7ZA 4BKTA 2WU2B 2IO0B 4XDCA 1OGWA 5JXVA 1ESFA 4JE3B 3HM3A 2WXFA 2L05A 3UI3A 2LUEA 3DBHB 3NS8A 1OTRB 2AYOB 2V1YA 4XWTA 2JRIB 1FM0D 1T0QC 5DPTA 2INDC 2LRUA 5E6NA 1YX5B 2KTFA 2OOBB 3Q8CA 1D3ZA 3VH3B 3K9OB 2BF8B 3DBLB 4HPPA 2LJIA 3JYUA 1SE3A 4CQNA 1ZUD2 4JWUC 2MP2A 4AWJA 2BT6A 2EKIA 1XD3B 2N7EA 2N9KA 3Q3OC 1T5XD 1JRUA 4A8XC 4DHJB 3AULA 2JUOA 1I4QA 1BT0A 4S0RA 1N62A 4PS7A 1PGBA 4F8CB 2JXXA 1TTNA 3AM9A 1CQVA 1WXSA 1STEA 1KJTA 2KKCA 3DVNU 1E8XA 2AQ3B 1JCKB 1DYQA 4CYEA 4ZHOA 3ZQ4A 4B9KA 4M8MA 3PLUA 2FIDA 2L0TA 2RDBC 5G55A 5IO9A 2D07B 2QILA 3VAWA 2GMIC 2KJHB 1ZP0B 3TEWA 4ZDVA 3ZXRA 5BMIA 2KHWB 4GXBA 2MQJA 2LVQA 3UIPB 4MGZE 1UELA 1VRAB 4ICVA 5EE0A 5HG2A 2ON8A 1YD8U 2YEPF 3L16A 2K6QA 4I6PA 2RSUA 1QQRA 2ACZB 1YN3A 1WM2A 5IN7A 4N6EB 3P4QB 3PRZA 5EE1A 4M00A 3VUXA 1N63A 3HVZA 3P4PB 1WSPA 4MSQB 4RGTA 4LNIA 3EFCA 2PPHA 3PSEB 2KN5A 1MG4A 2XK5B 5CTRC 3ML9A 2PE6B 2GBNA 2K25A 4LTUA 2BB5A 2BS4B 4OZCA 1TZOA 4ANWA 2LASA 4FXCA 5HI1A 3ALBA 2WNMA 1UGMA 4ANUA 3Q8FA 3NVYA 1WIAA 2RMMA 1PYWD 1C4PA 3T3NA 2WXRA 3EGRA 1RFAA 2V3SA 4P16A 4OVVA 1QT9A 3MTNB 3RD2A 3ZTCA 1QLBB 2IO2B 4DDGD 3I5JC 3MJ5A 2WWZA 1J8CA 4OZAA 3I63C 3RMKC 1WJ6A 4MGYE 3RNAC 1E8YA 2VZKB 2V3NA 5IKCM 5D3IB 3ZJVA 2CHXA 4WAAA 3GE3C 4MT5A 3DVGY 4PT5A 2D3BA 3S2AA 3RT3B 1KRHA 1VJKA 3ZKJC 1NVID 1IBXA 4FN2A 5EE3A 3EFUA 1C9FA 4EZKA 1TS4A 4I6NB 1SB3C 3V3XA 3SEBA 3KYDD 4XWWA 2ZJDA 2WDTB 2KAJA 2IGDA 4EKUA 3NJTA 2EKEC 2KYWA 2KVRA 4HKQA 1K52A 2MCNB 3MC0B 1V6EA 1XEEA 2N9XA 1WH3A 4MM3A 1S3SG 1EO6A 2IO1B 3WIMA 3AXCA 2QIEB 1ISNA 4MJSA 2BKRB 2HD5B 2D3CA 1D5XC 3ML8A 2KQ4X 1LXDA 2D11A 3UQBA 1R4NB 1FD6A 3ETRA 5JHAA 4BBNF 2C5LC 1OFFA 3IFWB 5CHWA 3L10B 1YN4A 3H8HA 4XGAB 2WXGA 4QAYA 2X38A 3Q8BA 1E0ZA 1E7PB 2LXAA 3GB1A 1GC6A 3DBLI 5LXHA 3N1ZC 2K8HA 4N58A 2WX1A 1E7UA 5D94A 1D4BA 2JPHA 2KN4A 2WXJA 3A9JB 3L13A 4IC7B 2KNBA 3M95A 4G0NB 2JRHA 2DZIA 3UGBB 2C60A 1M4VA 2AQ2B 3AEAB 4W9CA 3E56A 3ZYYX 2PEAA 2FE8A 3FILA 3MC8A 4C00A 2O6VA 4MELA 1WMHA 2KX3A 5T8IA 2KANA 4NJ7A 3ZRCA 1FXAA 4DXGA 2G3QB 2J7QB 1WR6E 3PO0A 4ZRQA 4I6LB 2H88B 5IOIA 1H8CA 3OJ3A 2NMQA 4HWIB 4ZYNA 2UWQA 3E9SA 1HTQA 4B95A 4A3OA 3PHXB 3VQIA 2RPQA 1TKEA 3V6EB 2LGXA 3L54A 4EOYA 2WU5B 4JQWC 1X1MA 4DWFA 3AE1B 2CKHB 3RUIB 1SGHA 1I4HA 4KVGB 2RR9A 4C7YA 3DOWA 2NBWB 4K7SA 3R3MA 5L95C 1WXQA 4L2YA 2AQ1B 2FCQA 1YMHE 4KGSA 1BXTA 3IXSA 4XDDA 3L17A 3RNBC 1P7FA 3AE7B 2D2QA 1WGHA 3Q3JA 4TUUA 2J4XA 1EU4A 4L1BA 3JVZX 2QC8A 2A4ZA 4RCOA 1I4PA 4RGNA 3QIJA 3RNFC 1F9JA 3AMZA 3WANA 3ZJUA 4F1SA 2EMSA 3V6CB 3ZDMC 1L0YB 1WFYA 4B0MA 3DHIC 4GDLB 1KTKA 2PKOA 3FAHA 4AOFA 5KHOA 1R4MB 4AJWA 1K50A 2JWUA 2KT7A 3CWIA 2OHFA 2ZPNA 2MEKA 3AH7A 3GOEA 3ZNID 3CSFA 1TZ1A 3A4SC 4K3CA 1YQ4B 3VDZA 4HCPB 3MHSD 4LNOA 2M1MA 1WYGA 2KFKA 3LDZE 2L0FA 2DWQA 2IJ0A 1FFVA 1D5ZC 5IP4D 4IDIA 2BWES 1J0GA 1Q0WB 4WWMA 1GB1A 1RYJA 2LJ5A 2JWZA 5BMHA 1KOTA 1CJEA 2WGSA 3NZUA 1FCLA 2KDIA 1SBBB 2L52A 1L4DB 4MGKE 1WE7A 3AE3B 3A1QB 1SSNA 2W82A 2PIAA 1UUPA 4R3DA 1L6UA 1HA5A 1TKYA 1AW7A 2N7DA 2GI9A 5I4DA 1N6ZA 3VRBB 1ENFA 3LYYA 1R4NI 4WJOA 2BKFA 2N9EB 4NAWB 2ZVOA 2JX5A 1E90A 2MX2A 3ENEA 3N3KB 2PVOD 4XC2A 2JF5A 1WX7A 2C7NB 2NPTB 4KZ0A 2MA9B 2KMCA 3QCAA 4M0WB 2K0PA 1WF9A 1SE2A 3RNCC 2AWTA 3BZDB 3AEDB 3BWUD 1QKZA 3NOBA 1T0YA 5G5HA 3QARA 2AL3A 2GB1A 3AECB 1RAXA 2IDYA 3RZWC 3QK0A 1HXYD 2IGGA 4ANXA 1XCQL 4RMAA 2NBVB 2JT4B 4K1RB 2ZPYA 3NS1A 1MVKA 1DOIA 3RCZA 1A5RA 1J19A 5DPRA 5HKHA 5J17A 2FAZA 5E6OA 4ANVA 2KX0A 3ZO5B 3ONSA 2KWUB 5D3DA 3OJ4B 2DYBA 2VH2A 3KH0A 5AZGA 3VVWB 3ECIA 4BBNC 4DXAB 1JALA 3H1UA 1YOVB 3W1YA 1LM8B 2M0XA 3IG3A 1FEHA 1EUVB 4S17A 1FNWA 1XQQA 3AE5B 1VDVA 2W54A 3A33B 4PS8A 4W9JA 4XYCA 4BKSD 1ET6A 2INPE 2QJLA 1I42A 2KC1A 1WGRA 2IZVB 1R7SA 2N4FA 4RNAA 2INCC 1VLBA 2INNE 2I1KA 3W1SC 3R7QA 3TL5A 4URKA 4L23A 1SJHD 1NBFC 3DPDA 2LVOA 3L4PA 1LFDA 4A3PA 1VCBA 3H9DA 1H4RA 2MJEA 3L08A 2WXLA 3MC9A 2L76A 4C56C 2Z0DB 5HFYA 3TJPA 1J7AA 2IYDB 3ABVB 1IPGA 1L6VA 2PE9A 1JQ4A 1FXTB 3U2SC 3DBRB 1N5WA 4KZCA 3DVNV 3PPAA 4IKGA 4KIKA 2REXA 3AE9B 5J18A 3GS2A 3KUCB 4NZLB 1WRDB 3H7SA 3OWEB 2FNJB 4LJPB 1ZGUB 3AB5A 2GBKA 2KWVB 1F0ZA 4HEA1 1PQSA 1L4ZB 2GBMA 1FFUA 1UBQA 2LGYA 3GE8C 3WA0A 4RFBA 4PK1A 4BOSC 4WQMA 1FPYA 1VR9A 5C3JB 4HCNB 1F2RI 2WXOA 1EU3A 2XEWA 1HTOA 1XXGA 1V8CA 2L83A 3UINB 4NQKE 1WE6A 4DXFA 3PTFC 1XT9B 3TEZA 4P6VF 2WDQB 3KW5B 5AZHA 2ZCCA 4USAA 3Q8AA 4A20A 4NPNA 2MBBB 3C19A 3VRAB 1E8ZA 3DHHC 1HZ6A 4OW0A 2WXPA 2K1FA 3DHGC 4RF1A 2J52A 1T6BX 5FKAC 3KWLA 2V3PA 4G3XB 4A90A 2BW2A 3PRMB 4K3BA 2PLPA 1XCTL 3P4SB 2L00B 2IGHA 1F1HA 2KLGA 3DWGC 2LUMA 3TBLD 3Q6BA 3B0AA 1OEYJ 5D7GA 3UIOB 4LNNA 2DNFA 3BY4B 3BIID 2N9PC 4W9IA 1FRDA 4XE0A 3EUB2 3TUOA 3PVLA 5JHBA 2BB6A 2HJ8A 1V2YA 2MBEA 1RM6C 3VFKA 3APFA 4IM0A 4KX6B 3JW0X 4LCDE 4TKNA 4IG7B 1XF5L 2CU1A 2FCNA 4MM3B 1AWDA 1VD2A 3A1QA 2KQ7A 2C7MB 3WAMA 3VUWA 3AN1A 2CJOA 3N20C 2M17A 1SE9A 4O1NA 2WXMA 4IWOA 1E10A 2BTEA 4AS1A 3PGEA 3VR8B 4MGIE 4RM9A 4FJYA 4W9GA 3HK0A 3M62B 3TIXA 3MFGA 4BFRA 3DBHI 4HDQA 3AE2B 4HPLB 2DAFA 5AZFA 2KJRA 2C7HA 1K8RB 3QX1A 3TEYA 2N0SB 1FIQA 4XX5A 2NVUI 5H92C 4MDKE 1D5MC 3BVMA 5IA7A 1U4AA 4DHZB 1WWTA 4FJZA 5FK9C 3J9CA 1NENB 2KJ6A 2KQSA 4EE2A 2V4LA 3N32A 3VUYA 1RLFA 4JPSA 4FJVB 2CJNA 2L1AA 5LNK1 2KK8A 5BMGA 3X23A 4D2KA 2L3ZA 5MPOA 3B9JA 2G9HD 2CHWA 3CF6E 1QF6A 2Y5BB 4OVUA 3I3TB 2KMMA 3ZNGC 4IOIE 2M56B 1YJIA 1TS2A 2FIFA 1WXAA 3BK2A 4RH6A 3NZ3A 2LZ6A 1VZ6A 2W3RA 2G1EA 4GB9A 2YEPB 2ZZPB 4BVUC 3EHVA 2HJ1A 1EF5A 4TSSA 2NS5A 3SFDB 1TGZB 3B08A 4BKGA 1JWBD 2KD0A 4K81A 3VTVA 1C76A 1GG3A 3T3OA 4ZHPA 3AE8B 3LB8C 2O2VA 4HJGE 1B1ZA 4WH4A 4JL9A 3P2BA 2BYEA 2OJRA 1F2RC 4NQLB 4YSXB 5D2MB 2KFKB 3GZNI 4FBJB 3A4RA 1IUEA 1UWXA 2WP9B 2RDHA 2V9HA 2J0KA 4IWPA 1FO4A 3A9JA 3WALA 1NI2A 3OG5A 1A70A 4NJCA 4A9AA 1EWCA 2R2QA 1E9MA 3V62A 4AJYB 3Q3FA 1MJDA 4RGOS 2JYTA 2LD9A 4DQOC 5DPWA 4II2B 3ZGZA 5EE9A 1IGDA 1WR1A 1P0RA 3TEXA 2OEDA 2K8BA 1KFYB 2O6VD 4DBGA 1TBEA 1YJJA 2WXKA 2I1JA 1QOGA 3EECA 3V05A 2N7JA 1SIJA 1V1OA 3B2FA 1N5XA 2FUG1 2IPKD 3U7DA 1FCCC 1L5PA 3ZIMA 4A55A 4E3CA 2JXTA 2KOXA 3B1LX 1F52A 2CS4A 1ZE3D 2HTHA 1Z5SB 1N61A 1P1AA 2ZNVB 1B9RA 4RF0A 2KO3A 2ZW1A 3AI5A 1T3QA 2HDEA 1I35A 1YQBA 3Q3NC 4WIPA 2N1WA 2HTME 3PLVA 3DQVA 2DBYA 4IWQA 4P7IA 2QCZA 4BKSA 1HEZE 1SIFA 1C77A 2E3TA 5CHFA 4M8NA 3HHMA 1MHXA 1JWAD 2KACA 2JSVX 2VZKD 2DZKA 2LMCA 4PYUA 2QMTA 2AX5A 4WAFA 5GMVA 1KH0A 1BUIC 3RNGC 2IBIB 4ZRIA 2Q5WD 5LLIA 1UNSA 3U4EG 2G45B 3VTUA 2MW5A 3O13A 2L7RA 2FUHB 2MBHA 2CU3A 3MJWA 2KMAA 3R7RA 1L2NA 4NY0A 3V60A 4OHJA 3JSVA 2MSED 3RZFA 1EM7A 3W2DA 3H6NA 2K39A 2KZRA 2SEBD 2O2VB 2J53A 3UF8A 2WHIA 4PYZA 3RN9C 2MJ3A 3RNEC 1TS3A 2GOWA 3NG0A 2D10A 1YJ1A 4HK2A 1MG8A 2K8CA 4JWSC 1RWSA 2FCSA 2VRRB 3R66C 1CMXB 1EF1A 2KTRA 4FLHA 1XLOA 2WXQA 1WJUA 3SHQA 4JIOU 5C2TB 4M02A 1TY2A 1C79A 1FNVA 1ZDVA 2JY6A 2IO3B 3BVGA 2Z8LA 1T0SC 3Q3MC 2PMVA 2WYQA 4E74A 3PZ8A 1TJEA 2DYMA 3P1MA 3ZTDA 4ZRPA 4KGRA 5TR5A 4FULA 3GZNB 3O65B 4WQOB 1XLNA 4A6QA 1JWMD 4HKZE 5FR3A 2LEKA 2M19A 3ZLZA 2KDFB 5L83A 1K53A 1PGAA 2OJWA 2D5GA 2BYVE 3Q69A 4YT0B 5JH5C 3DDCB 2K3UA 2I38A 1E7VA 4KSLC 2MBOA 4TQ0A 4AQ7A 4US8A 4N9F4 3VR9B 1LO5D 3PV1A 1LQBA 3IT4B 1Y56A 5D6JB 1V97A 5AUIA 2BQQA 2NPTA 1P3QU 1ROEA 5BYRA 4DDID 2LWPA 2Z59B 4HDOA 2WS3B 1UD7A 2KWDA 1GJZA 2R61A 1V80A 4AUQC 3TMPB 1QZEA 1ZOYB 2Y5CA 3KQ4A 1ZKHA 4P1CC 4JGHB 1ACCA 3AEEB 2CHZA 1MFWA 1WY8A 3PZ7A 4MH8A 2MHJA 1MI0A 4X57B 1KLGD 1V1PB 4W9DA 3WAOA 3C8YA 5JZEB 1WMHB 4KDIC 2KC2A 2FBWB 2K5PA 1HQRD 3W5UB 4NNJB 4BOZB 1P9DU 4C7ZA 3AV8A 4WWNA 1V9JA 3R2IA 1NEKB 4NJ6A 1PFDA 4LDTB 1V5OA 4ICUA 4Q2JA 5E6JA 1M94A 2PTLA 4GN1A 3LJ3A 2XNAC 1WZ0A 2BWFA 3I9V1 4YL8A 1VZ7A 1RFKA 3ZVVA 2J42A 1S1QB 1TYGB 1WXMA 2WXHA 3NHEB 1MHHE 2O6VB 1YN5A 3QAQA 2BPSA 4KIKB 4C4VA 4CHKA 3AEFB 2Y3AA 1Y8RC 3KWVA 2MJDA 2EELA 1KF6B 4GDKA 1DOXA 4WJPA 3X0WA 2ZW0A 2RD0A 2ZNVC 2W9NA 3B2GA 4GGQA 2QDFA 4EEWA 1WGDA 3RPFC 3APDA 3ZUNA 2G4DB 4J3OD 1OQQA 3AU4A 4HPMB 1WX8A 3ZW3A 3IHPC 2MP2B 2K6DB 2R2OA 1BMLC 1E6EB 1YX6B 3NY5A 4ARIA 2NCNA 4KSKC 4WWPA 1SXTA 4MH0E 3VTWA 1Q10A 1I7HA 2GBRA 3A9KB 3DBSA 5TSSA 4ITKA 1WXVA 2QEJC 2FCMA 2DZMA 1E8WA 3DWMA 4K7UA 2DZJA 3QWZB 3SDLC 4YSZB 3RFZB 3AE4B 4LLGM 2KDEB 1GC7A 3BK1A 1FMAD 1DOYA 4FHKA 1UZXB 2ONQA 3R8BA 5G5GA 2KFJA 4ZOHC 2B76B 1V86A 2E6XA 2D3GA 1L0XB 4GMVA 2IY0B 4NAMA 3KVFB 1L7YA 1WX9A 3SU8X 1CK1A 2EMTA 1DGJA 1E5WA 2LXCA 4B0EA 4LNFA 3H7PA 3NVZA 5C1ZA 4M01A 4ZRKA 1WRIA 1ZW7A 3P63A 3H7PB 1R4MI 2TSSA 1G6JA 2KDBA 1UWMA 3VH4B 3N30A 4GLSC 1L0VB 3KYCD 2BYTA 3Q14C 3VHTC 3TSSA 2N9LA 2XN9C 1WJNA 2MWSB 3FILB 3SFEB 1ZXIA 2WDRB 4HXDA 3N1YC 3R2TA 4W9LA 4YSYB 2ZCBA 4J6IA 3DCGA 3CSTA 4EUTA 4RM8A 2PVGC 4IW0A 5CHVC 3P42A 3DVGX 4W9FA 3QC8B 2WQYB 4GSWA 1P98A 2BGFA 3C0RB 1AYFA 1F77A 2LGSA 4JX1C 2IY1B 1YIWA 1WGYA 3N1XC 3BYYB 4GU2A 1C78A 2PW9A 4LK0M 1WGGA 4EZJA 4KKJA 2WDVB 3I57A 5EDSA 1NDDA 2DX5B 3W5VB 2JZZA 2WLBA 4RGMA 1PDXA 3QJZA 4G11A 2DYOA 3OAWA 4HRSA 4MEMA 5BYQA 2A5UA 2M0AA 1ZPSA 1UGJA 4FA6A 3AEGB 4K7WA 4KV2A 1GPXA 5AEKB
chains in the Genus database with same CATH topology
3NS1A 1MVKA 1DOIA 1GOZA 1CZPA 1ZE3D 2QSDA 1N61A 3W1SA 4YXDB 1VRAB 5EE0A 1B9RA 5HG2A 2ON8A 4RF0A 2ZW1A 1GB4A 4H2AA 1T3QA 2HDEA 2YEPF 1JW9D 2K22A 5D3DA 4WIPA 1QQRA 2ACZB 1YN3A 2HTME 4N6EB 3P4QB 5EE1A 1JALA 4ZYSA 1N63A 1I4GA 2DBYA 3NVWA 3HVZA 1FEHA 1ET9A 1HEZE 3P4PB 1FNWA 1WSPA 1C77A 1NYRA 4RGTA 3LXFA 3AE5B 2V0GA 1VDVA 2E3TA 2W54A 1MHXA 1JWAD 1ET6A 2KACA 2W55A 2JSVX 2INPE 1I4RA 2QJLA 2VZKD 2LMCA 3HRDD 4LTUA 2BB5A 1K51A 2QMTA 2BS4B 4OZCA 2AX5A 1J7CA 1TZOA 4WAFA 1R7SA 2I2YA 1TS5A 1JWUD 1KH0A 4FXCA 1SE4A 1BUIC 4RNAA 1JRPA 5HI1A 2WNMA 1KLUD 1VLBA 2Q5WD 2INNE 3Q8FA 3NVYA 1UNSA 4L23A 3U4EG 1SJHD 2RMMA 1PYWD 1C4PA 3O13A 3T3NA 3L4PA 2CU3A 2WXRA 3EGRA 4OHJA 1I4XA 2MJEA 1EM7A 3W2DA 2BBCA 4P16A 1QT9A 2SEBD 2WXLA 2J53A 3HVDA 1QLBB 4C56C 5HFYA 3FC4A 1J7AA 2MJ3A 3MJ5A 1XO3A 3ABVB 1QOBA 5H8YE 1TS3A 1NYQA 4OZAA 1L6VA 2H89B 4ARCA 4JWSC 4KGTA 1RWSA 1JQ4A 2VZKB 4YTMB 2V3NA 5D3IB 3NRZA 3SR6A 3NUHB 3U2SC 4WURA 3ZJVA 2WXNA 1N5WA 4IKGA 1QOAA 1XLOA 2WXQA 1TKGA 4MT5A 3AE9B 4PT5A 3GS2A 5C2TB 4NZLB 1KRHA 1FXIA 1C79A 1FNVA 1TY2A 1VJKA 2DLBA 1AN8A 1ZDVA 4OVZA 3GP7A 1NVID 3OWEB 1IBXA 3BVGA 2Z8LA 1PGXA 3IT6B 5EE3A 2BS2B 1C9FA 1TS4A 2PMVA 3AB5A 3HUIA 1SB3C 2JYEA 3SEBA 3PZ8A 1NI3A 3V3XA 4XWWA 1TJEA 2DYMA 1F0ZA 3P1MA 2KAJA 4ZRPA 4KGRA 2IGDA 4HEA1 1L4ZB 4N59A 1XLNA 4A6QA 1JWMD 4HKZE 2NTSA 5FR3A 2LEKA 2M19A 1JWSD 1FFUA 4HKQA 4OZBA 1K52A 3MC0B 3EA6A 1XEEA 4RFBA 1JROA 1K53A 1MPEA 4WQMA 1TY0A 1PGAA 1JMLA 1VR9A 2D5GA 5C3JB 3Q69A 4YT0B 2W3SA 4HROA 1F2RI 2WXOA 1EU3A 2K3UA 2I38A 2QIEB 1XXGA 4AQ7A 4TQ0A 1EWYC 1V8CA 2L83A 1D5XC 2KQ4X 4US8A 3VR9B 1LO5D 4KKIA 3W9CB 3IT4B 1IGCA 4DXFA 1Y56A 1FD6A 1N60A 4P6VF 3ETRA 3TEZA 1V97A 4M0WA 4C80A 2WDQB 5AUIA 3MP9A 1ROEA 5BYRA 4USAA 3Q8AA 1OFFA 1FNUA 1PUTA 5AUKA 2RDGA 3VRAB 2JQRB 2WS3B 2KWDA 2R61A 2WXIA 1YN4A 3H8HA 1HZ6A 4OW0A 2WXPA 3N9YC 2WXGA 1ZOYB 2X38A 2Y5CA 3Q8BA 1XLPA 1E0ZA 1E7PB 3KQ4A 3GB1A 1YQ3B 4RF1A 2J52A 4YWGG 2NTTA 1ACCA 1T6BX 5FKAC 3AEEB 3KWLA 2V3PA 4A90A 4N58A 2BW2A 3PZ7A 4MH8A 1SEBD 2PLPA 1MI0A 1XCTL 1D4BA 1GAQB 1FRRA 2V4IB 2KN4A 2WXJA 1KLGD 1V1PB 3P4SB 2IGHA 2JU6X 3URYA 3WCQA 3C8YA 4TQ1A 3DWGC 2LUMA 2FBWB 1M4VA 2AQ2B 1HQRD 2K5PA 2RPVA 3AEAB 5D7GA 3W5UB 3BIID 3E56A 4C7ZA 3AV8A 2JZPA 3R2IA 3ZYYX 1NEKB 4YTPB 1FRDA 2FE8A 3FILA 2L32A 2BS3B 5HHDG 1PFDA 4XE0A 3EUB2 3TUOA 3AE6B 2BB6A 3P4RB 5T8IA 4Q2JA 5E6JA 2PTLA 2K9XA 1FXAA 1WGKA 2XNAC 4DXGA 2Y5PA 3I9V1 1IBXB 3PO0A 5GXGB 1RM6C 1VZ7A 4ZRQA 1RFKA 3BVZA 2J42A 1HZ5A 1QILA 1TYGB 4KX6B 2WXHA 1J7BA 2H88B 1MHHE 1XF5L 1YN5A 2NMQA 5BYSA 4MM3B 1AWDA 2SAKA 3MHZA 3AEFB 2Y3AA 3E9SA 1SJED 3AN1A 2KDMA 2CJOA 4MACA 3KWVA 2MJDA 2EELA 1KF6B 1XLQA 4UDUC 1DOXA 4O1NA 2WXMA 3VQIA 1E10A 2ZW0A 1C4AA 1OQRA 1TKEA 2BTEA 4AS1A 3NVVA 3VR8B 3B2GA 1QOFA 2WU5B 3AE1B 3MFGA 3RPFC 2LGIA 4J3OD 1OQQA 4REZA 3U52E 3AE2B 1ZXHA 1I4HA 1BMLC 1E6EB 2MH7A 4ARIA 4C7YA 2ICIA 3TEYA 1SXTA 2N0SB 3CIRB 1FIQA 1D6EC 4US9A 1WXQA 1Q10A 1I7HA 4L2YA 2AQ1B 5H92C 3ZJTA 1YMHE 4KGSA 5TSSA 4ITKA 1BXTA 1VZ8A 3IXSA 1D5MC 4XDDA 2QEJC 3AEBB 3BVMA 1P7FA 1ZDXA 1V1PA 1WWTA 2LFIA 3IAS1 3AE7B 5FK9C 3DWMA 3KLSX 3J9CA 1NENB 1SF0A 2J4XA 4EE2A 3AE4B 4YSZB 4LLGM 3RFZB 1EU4A 4L1BA 4RCOA 1YNTE 1I4PA 3BK1A 4RGNA 1FMAD 3AMZA 4JPSA 1DOYA 2CJNA 2L1AA 5LNK1 3ZJUA 2ONQA 3R8BA 5G5GA 5BMGA 2LHEA 4ZOHC 4D2KA 1L0YB 3BYTB 2B76B 2E6XA 4TMAB 3IAM1 4B0MA 2LHDA 5MPOA 3B9JA 1L0XB 2G9HD 4GDLB 1KTKA 4NAMA 1QF6A 3Q8EA 2PKOA 3FAHA 2KMMA 4IOIE 2M56B 1YJIA 1TS2A 1CK1A 1K50A 3BK2A 1DGJA 2JWUA 4RH6A 3NZ3A 1VZ6A 3CWIA 2W3RA 1P7EA 2OHFA 2G1EA 4B0EA 2MEKA 2YEPB 4GDKB 3AH7A 1C4CA 3NVZA 4YTNB 1WRIA 4TSSA 1YQ4B 2GRIA 3P63A 3U7ZA 2WU2B 3SFDB 4XDCA 1WYGA 5JXVA 1ESFA 4JE3B 1JWBD 2TSSA 2DWQA 2WXFA 2IJ0A 1FFVA 3UI3A 1UWMA 1D5ZC 4GLSC 4IDIA 1L0VB 1C76A 4WWMA 2BYTA 1GB1A 1RYJA 4XWTA 3T3OA 4ZHPA 3AE8B 3TSSA 5BMHA 1CJEA 1FM0D 2N9LA 3LB8C 2XN9C 4HJGE 1B1ZA 1FCLA 4WH4A 3FILB 3SFEB 1F2RC 1ZXIA 2WDRB 1SBBB 3Q8CA 2L52A 1L4DB 4YSXB 3R2TA 4YSYB 1IUEA 2LJIA 3AE3B 1SE3A 1UWXA 2WP9B 4CQNA 1SSNA 2RDHA 1ZUD2 2W82A 2PVGC 2PIAA 4JWUC 3P42A 1UUPA 2BT6A 4R3DA 1L6UA 2EKIA 1HA5A 2WQYB 2N9KA 1FO4A 1TKYA 1AW7A 1T5XD 5I4DA 2GI9A 4A8XC 1A70A 1AYFA 1F77A 4NJCA 4JX1C 1I4QA 1N62A 3VRBB 4A9AA 1EWCA 1ENFA 3LYYA 1E9MA 1PGBA 4NAWB 2JX5A 4RGOS 3AM9A 2PVOD 2JYTA 1CQVA 3BYYB 4DQOC 1STEA 3ZGZA 5EE9A 1IGDA 1C78A 2PW9A 4LK0M 3TEXA 2K0PA 2OEDA 4KKJA 2WDVB 3I57A 1KFYB 1SE2A 2AQ3B 3W5VB 1JCKB 1DYQA 2WLBA 3BZDB 3AEDB 4ZHOA 4RGMA 1YJJA 3BWUD 2WXKA 1QKZA 1PDXA 1QOGA 5G5HA 3ZQ4A 3V05A 2DYOA 2N7JA 1SIJA 1V1OA 4HRSA 3B2FA 1N5XA 2FUG1 2IPKD 2GB1A 2M0AA 3AECB 5BYQA 1FCCC 1L5PA 2IDYA 1ZPSA 1HXYD 2IGGA 4A55A 2QILA 1UGJA 1XCQL 2JXTA 3AEGB 1ZP0B 3TEWA 1GPXA 5BMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A90 A;  4A8X C;  2HDE A;  4A6Q A; 
#chains in the Genus database with same CATH topology
 3DBR I;  2N1V A;  1GOZ A;  1CZP A;  2QSD A;  3W1S A;  3QA8 A;  4YXD B;  3Q2A C;  5IAA C;  3QHT A;  2KXJ A;  1GB4 A;  4H2A A;  4MJS B;  1JW9 D;  2K22 A;  2C9W B;  3RI7 C;  2ZEQ A;  4AP4 C;  2KTR B;  4ZYS A;  2J0M A;  2RGF A;  2KWC A;  2ZVN A;  3EC8 A;  4C4V B;  1I4G A;  2JVC A;  3NVW A;  2NR2 A;  3IBE A;  1ET9 A;  3PT2 B;  1NYR A;  3TCA A;  3LXF A;  1RRB A;  5FR6 A;  2V0G A;  1OQY A;  2HE7 A;  3PRP B;  4GOC A;  2W55 A;  4IM3 A;  1I4R A;  3HRD D;  1K51 A;  3SD5 A;  2MBQ A;  4GIV A;  1J7C A;  2X8X X;  3RYT A;  2I2Y A;  2YVC A;  1TS5 A;  1JWU D;  2XK5 A;  1SE4 A;  1JRP A;  1KLU D;  3AU5 A;  2M4N A;  4MSM B;  4FAD A;  3VXW A;  2XBB C;  2GBJ A;  1V49 A;  2LGD A;  1UF0 A;  3CMM B;  2M8S A;  4EZL A;  2BYF A;  1I4X A;  4NAW A;  3T8M A;  4DHJ D;  2BBC A;  4ZRJ A;  3U30 A;  4E71 A;  3KUZ A;  3HVD A;  3K9P B;  2CR5 A;  2WX0 A;  4HLE A;  2B3A A;  3FC4 A;  1XO3 A;  1V5T A;  4W9K A;  1Q1O A;  1QOB A;  5H8Y E;  3IVF A;  4II3 B;  1AAR A;  1NYQ A;  2H89 B;  2BVC A;  4ARC A;  4KGT A;  2KLC A;  4YTM B;  1Z2M A;  1TT5 B;  2LRW A;  3NRZ A;  3SR6 A;  1UBI A;  3NUH B;  4XZ4 A;  4IM2 A;  4WUR A;  1WYW B;  2WXN A;  3OLM D;  1QOA A;  3ZXV A;  1TKG A;  5DCN A;  1LGR A;  3L0W B;  1FXI A;  4OVZ A;  2DLB A;  1AN8 A;  2G4S A;  3GP7 A;  1HE8 A;  5G2N A;  1PGX A;  3IT6 B;  2BS2 B;  3HUI A;  2JYE A;  1C1Y B;  1NI3 A;  1WJ4 A;  2LI5 A;  4N59 A;  4DK5 A;  2NTS A;  1JWS D;  4OZB A;  1KM7 A;  3EA6 A;  1JRO A;  1MPE A;  1TY0 A;  3ZDT A;  1JML A;  1WI0 A;  2UU7 A;  2Z0E B;  2W3S A;  4HRO A;  1C3T A;  4LNK A;  2ASQ A;  1EWY C;  4KKI A;  3ZNH B;  3W9C B;  1IGC A;  1GUA B;  1N60 A;  2MLB A;  2L8J A;  4HVB A;  3NZS A;  4M0W A;  4C80 A;  3MP9 A;  2AL6 A;  1FNU A;  1PUT A;  5AUK A;  2RDG A;  2JQR B;  4B6W A;  2WXI A;  3PHW B;  5C23 A;  3N9Y C;  1XLP A;  2QHO A;  1YQ3 B;  4YWG G;  1GNU A;  2NTT A;  3HM6 X;  1WM3 A;  1Q5W B;  1T0R C;  4HJK A;  1SEB D;  1GAQ B;  1FRR A;  3D32 A;  2V4I B;  4W9E A;  2JU6 X;  3URY A;  3WCQ A;  3M3J A;  4BAX A;  4TQ1 A;  2D3A A;  2DEN B;  2MRP A;  1TIF A;  2RPV A;  4WJQ A;  2DAJ A;  2JZP A;  2KVZ A;  4YTP B;  3FKY A;  2L32 A;  2BS3 B;  4WJN A;  5HHD G;  1UH6 A;  3M63 B;  4KDL B;  3AE6 B;  3P4R B;  3QQ8 B;  2K9X A;  1WGK A;  2Y5P A;  1IBX B;  4CO7 A;  5GXG B;  3BVZ A;  1HZ5 A;  1QIL A;  1J7B A;  4ACF A;  5BYS A;  2SAK A;  3MHZ A;  3PZD A;  1WZ3 A;  1SJE D;  2KDM A;  4MAC A;  4TV3 A;  3ZRF A;  4BZA A;  4DHZ E;  4W9H A;  3T9L A;  4UDU C;  1XLQ A;  2LVP A;  1C4A A;  1OQR A;  3NVV A;  1QOF A;  3WAP A;  2LGI A;  1IP9 A;  4PS3 A;  2GLS A;  4GDL A;  4REZ A;  5BO4 B;  5DPS A;  3U52 E;  1ZXH A;  2MH7 A;  2JZ3 B;  2ICI A;  2J0J A;  3CIR B;  4IUM B;  1D6E C;  4US9 A;  5J2R A;  3BIN A;  3ZJT A;  1VZ8 A;  2NBU A;  2AEH A;  5CX3 A;  3HIZ A;  3AEB B;  1ZDX A;  1V1P A;  4WWO A;  2LFI A;  3IAS 1;  3RUL A;  3KLS X;  4LDT D;  4P1B C;  1SF0 A;  4F7Z A;  3ZNZ B;  1KLV A;  3PS6 A;  1IYF A;  1YNT E;  4G50 A;  3JSV B;  3A9K A;  3APC A;  3U8Z A;  2UYZ B;  1OEY A;  2VH1 A;  2LHE A;  3BYT B;  4TMA B;  3IAM 1;  2LHD A;  2DHZ A;  5LXI B;  5E6P A;  3Q8E A;  5KHQ A;  3KUD B;  4FHJ A;  4EFO A;  1V81 A;  1P7E A;  2YLM A;  4JLC A;  4GDK B;  3UQA A;  3V61 A;  1C4C A;  3PRE A;  4YTN B;  4LJO B;  2PJH A;  4ASW C;  2GRI A;  3U7Z A;  4BKT A;  2WU2 B;  2IO0 B;  4XDC A;  1OGW A;  5JXV A;  1ESF A;  4JE3 B;  3HM3 A;  2WXF A;  2L05 A;  3UI3 A;  2LUE A;  3DBH B;  3NS8 A;  1OTR B;  2AYO B;  2V1Y A;  4XWT A;  2JRI B;  1FM0 D;  1T0Q C;  5DPT A;  2IND C;  2LRU A;  5E6N A;  1YX5 B;  2KTF A;  2OOB B;  3Q8C A;  1D3Z A;  3VH3 B;  3K9O B;  2BF8 B;  3DBL B;  4HPP A;  2LJI A;  3JYU A;  1SE3 A;  4CQN A;  1ZUD 2;  4JWU C;  2MP2 A;  4AWJ A;  2BT6 A;  2EKI A;  1XD3 B;  2N7E A;  2N9K A;  3Q3O C;  1T5X D;  1JRU A;  4A8X C;  4DHJ B;  3AUL A;  2JUO A;  1I4Q A;  1BT0 A;  4S0R A;  1N62 A;  4PS7 A;  1PGB A;  4F8C B;  2JXX A;  1TTN A;  3AM9 A;  1CQV A;  1WXS A;  1STE A;  1KJT A;  2KKC A;  3DVN U;  1E8X A;  2AQ3 B;  1JCK B;  1DYQ A;  4CYE A;  4ZHO A;  3ZQ4 A;  4B9K A;  4M8M A;  3PLU A;  2FID A;  2L0T A;  2RDB C;  5G55 A;  5IO9 A;  2D07 B;  2QIL A;  3VAW A;  2GMI C;  2KJH B;  1ZP0 B;  3TEW A;  4ZDV A;  3ZXR A;  5BMI A;  2KHW B;  4GXB A;  2MQJ A;  2LVQ A;  3UIP B;  4MGZ E;  1UEL A;  1VRA B;  4ICV A;  5EE0 A;  5HG2 A;  2ON8 A;  1YD8 U;  2YEP F;  3L16 A;  2K6Q A;  4I6P A;  2RSU A;  1QQR A;  2ACZ B;  1YN3 A;  1WM2 A;  5IN7 A;  4N6E B;  3P4Q B;  3PRZ A;  5EE1 A;  4M00 A;  3VUX A;  1N63 A;  3HVZ A;  3P4P B;  1WSP A;  4MSQ B;  4RGT A;  4LNI A;  3EFC A;  2PPH A;  3PSE B;  2KN5 A;  1MG4 A;  2XK5 B;  5CTR C;  3ML9 A;  2PE6 B;  2GBN A;  2K25 A;  4LTU A;  2BB5 A;  2BS4 B;  4OZC A;  1TZO A;  4ANW A;  2LAS A;  4FXC A;  5HI1 A;  3ALB A;  2WNM A;  1UGM A;  4ANU A;  3Q8F A;  3NVY A;  1WIA A;  2RMM A;  1PYW D;  1C4P A;  3T3N A;  2WXR A;  3EGR A;  1RFA A;  2V3S A;  4P16 A;  4OVV A;  1QT9 A;  3MTN B;  3RD2 A;  3ZTC A;  1QLB B;  2IO2 B;  4DDG D;  3I5J C;  3MJ5 A;  2WWZ A;  1J8C A;  4OZA A;  3I63 C;  3RMK C;  1WJ6 A;  4MGY E;  3RNA C;  1E8Y A;  2VZK B;  2V3N A;  5IKC M;  5D3I B;  3ZJV A;  2CHX A;  4WAA A;  3GE3 C;  4MT5 A;  3DVG Y;  4PT5 A;  2D3B A;  3S2A A;  3RT3 B;  1KRH A;  1VJK A;  3ZKJ C;  1NVI D;  1IBX A;  4FN2 A;  5EE3 A;  3EFU A;  1C9F A;  4EZK A;  1TS4 A;  4I6N B;  1SB3 C;  3V3X A;  3SEB A;  3KYD D;  4XWW A;  2ZJD A;  2WDT B;  2KAJ A;  2IGD A;  4EKU A;  3NJT A;  2EKE C;  2KYW A;  2KVR A;  4HKQ A;  1K52 A;  2MCN B;  3MC0 B;  1V6E A;  1XEE A;  2N9X A;  1WH3 A;  4MM3 A;  1S3S G;  1EO6 A;  2IO1 B;  3WIM A;  3AXC A;  2QIE B;  1ISN A;  4MJS A;  2BKR B;  2HD5 B;  2D3C A;  1D5X C;  3ML8 A;  2KQ4 X;  1LXD A;  2D11 A;  3UQB A;  1R4N B;  1FD6 A;  3ETR A;  5JHA A;  4BBN F;  2C5L C;  1OFF A;  3IFW B;  5CHW A;  3L10 B;  1YN4 A;  3H8H A;  4XGA B;  2WXG A;  4QAY A;  2X38 A;  3Q8B A;  1E0Z A;  1E7P B;  2LXA A;  3GB1 A;  1GC6 A;  3DBL I;  5LXH A;  3N1Z C;  2K8H A;  4N58 A;  2WX1 A;  1E7U A;  5D94 A;  1D4B A;  2JPH A;  2KN4 A;  2WXJ A;  3A9J B;  3L13 A;  4IC7 B;  2KNB A;  3M95 A;  4G0N B;  2JRH A;  2DZI A;  3UGB B;  2C60 A;  1M4V A;  2AQ2 B;  3AEA B;  4W9C A;  3E56 A;  3ZYY X;  2PEA A;  2FE8 A;  3FIL A;  3MC8 A;  4C00 A;  2O6V A;  4MEL A;  1WMH A;  2KX3 A;  5T8I A;  2KAN A;  4NJ7 A;  3ZRC A;  1FXA A;  4DXG A;  2G3Q B;  2J7Q B;  1WR6 E;  3PO0 A;  4ZRQ A;  4I6L B;  2H88 B;  5IOI A;  1H8C A;  3OJ3 A;  2NMQ A;  4HWI B;  4ZYN A;  2UWQ A;  3E9S A;  1HTQ A;  4B95 A;  4A3O A;  3PHX B;  3VQI A;  2RPQ A;  1TKE A;  3V6E B;  2LGX A;  3L54 A;  4EOY A;  2WU5 B;  4JQW C;  1X1M A;  4DWF A;  3AE1 B;  2CKH B;  3RUI B;  1SGH A;  1I4H A;  4KVG B;  2RR9 A;  4C7Y A;  3DOW A;  2NBW B;  4K7S A;  3R3M A;  5L95 C;  1WXQ A;  4L2Y A;  2AQ1 B;  2FCQ A;  1YMH E;  4KGS A;  1BXT A;  3IXS A;  4XDD A;  3L17 A;  3RNB C;  1P7F A;  3AE7 B;  2D2Q A;  1WGH A;  3Q3J A;  4TUU A;  2J4X A;  1EU4 A;  4L1B A;  3JVZ X;  2QC8 A;  2A4Z A;  4RCO A;  1I4P A;  4RGN A;  3QIJ A;  3RNF C;  1F9J A;  3AMZ A;  3WAN A;  3ZJU A;  4F1S A;  2EMS A;  3V6C B;  3ZDM C;  1L0Y B;  1WFY A;  4B0M A;  3DHI C;  4GDL B;  1KTK A;  2PKO A;  3FAH A;  4AOF A;  5KHO A;  1R4M B;  4AJW A;  1K50 A;  2JWU A;  2KT7 A;  3CWI A;  2OHF A;  2ZPN A;  2MEK A;  3AH7 A;  3GOE A;  3ZNI D;  3CSF A;  1TZ1 A;  3A4S C;  4K3C A;  1YQ4 B;  3VDZ A;  4HCP B;  3MHS D;  4LNO A;  2M1M A;  1WYG A;  2KFK A;  3LDZ E;  2L0F A;  2DWQ A;  2IJ0 A;  1FFV A;  1D5Z C;  5IP4 D;  4IDI A;  2BWE S;  1J0G A;  1Q0W B;  4WWM A;  1GB1 A;  1RYJ A;  2LJ5 A;  2JWZ A;  5BMH A;  1KOT A;  1CJE A;  2WGS A;  3NZU A;  1FCL A;  2KDI A;  1SBB B;  2L52 A;  1L4D B;  4MGK E;  1WE7 A;  3AE3 B;  3A1Q B;  1SSN A;  2W82 A;  2PIA A;  1UUP A;  4R3D A;  1L6U A;  1HA5 A;  1TKY A;  1AW7 A;  2N7D A;  2GI9 A;  5I4D A;  1N6Z A;  3VRB B;  1ENF A;  3LYY A;  1R4N I;  4WJO A;  2BKF A;  2N9E B;  4NAW B;  2ZVO A;  2JX5 A;  1E90 A;  2MX2 A;  3ENE A;  3N3K B;  2PVO D;  4XC2 A;  2JF5 A;  1WX7 A;  2C7N B;  2NPT B;  4KZ0 A;  2MA9 B;  2KMC A;  3QCA A;  4M0W B;  2K0P A;  1WF9 A;  1SE2 A;  3RNC C;  2AWT A;  3BZD B;  3AED B;  3BWU D;  1QKZ A;  3NOB A;  1T0Y A;  5G5H A;  3QAR A;  2AL3 A;  2GB1 A;  3AEC B;  1RAX A;  2IDY A;  3RZW C;  3QK0 A;  1HXY D;  2IGG A;  4ANX A;  1XCQ L;  4RMA A;  2NBV B;  2JT4 B;  4K1R B;  2ZPY A;  3NS1 A;  1MVK A;  1DOI A;  3RCZ A;  1A5R A;  1J19 A;  5DPR A;  5HKH A;  5J17 A;  2FAZ A;  5E6O A;  4ANV A;  2KX0 A;  3ZO5 B;  3ONS A;  2KWU B;  5D3D A;  3OJ4 B;  2DYB A;  2VH2 A;  3KH0 A;  5AZG A;  3VVW B;  3ECI A;  4BBN C;  4DXA B;  1JAL A;  3H1U A;  1YOV B;  3W1Y A;  1LM8 B;  2M0X A;  3IG3 A;  1FEH A;  1EUV B;  4S17 A;  1FNW A;  1XQQ A;  3AE5 B;  1VDV A;  2W54 A;  3A33 B;  4PS8 A;  4W9J A;  4XYC A;  4BKS D;  1ET6 A;  2INP E;  2QJL A;  1I42 A;  2KC1 A;  1WGR A;  2IZV B;  1R7S A;  2N4F A;  4RNA A;  2INC C;  1VLB A;  2INN E;  2I1K A;  3W1S C;  3R7Q A;  3TL5 A;  4URK A;  4L23 A;  1SJH D;  1NBF C;  3DPD A;  2LVO A;  3L4P A;  1LFD A;  4A3P A;  1VCB A;  3H9D A;  1H4R A;  2MJE A;  3L08 A;  2WXL A;  3MC9 A;  2L76 A;  4C56 C;  2Z0D B;  5HFY A;  3TJP A;  1J7A A;  2IYD B;  3ABV B;  1IPG A;  1L6V A;  2PE9 A;  1JQ4 A;  1FXT B;  3U2S C;  3DBR B;  1N5W A;  4KZC A;  3DVN V;  3PPA A;  4IKG A;  4KIK A;  2REX A;  3AE9 B;  5J18 A;  3GS2 A;  3KUC B;  4NZL B;  1WRD B;  3H7S A;  3OWE B;  2FNJ B;  4LJP B;  1ZGU B;  3AB5 A;  2GBK A;  2KWV B;  1F0Z A;  4HEA 1;  1PQS A;  1L4Z B;  2GBM A;  1FFU A;  1UBQ A;  2LGY A;  3GE8 C;  3WA0 A;  4RFB A;  4PK1 A;  4BOS C;  4WQM A;  1FPY A;  1VR9 A;  5C3J B;  4HCN B;  1F2R I;  2WXO A;  1EU3 A;  2XEW A;  1HTO A;  1XXG A;  1V8C A;  2L83 A;  3UIN B;  4NQK E;  1WE6 A;  4DXF A;  3PTF C;  1XT9 B;  3TEZ A;  4P6V F;  2WDQ B;  3KW5 B;  5AZH A;  2ZCC A;  4USA A;  3Q8A A;  4A20 A;  4NPN A;  2MBB B;  3C19 A;  3VRA B;  1E8Z A;  3DHH C;  1HZ6 A;  4OW0 A;  2WXP A;  2K1F A;  3DHG C;  4RF1 A;  2J52 A;  1T6B X;  5FKA C;  3KWL A;  2V3P A;  4G3X B;  4A90 A;  2BW2 A;  3PRM B;  4K3B A;  2PLP A;  1XCT L;  3P4S B;  2L00 B;  2IGH A;  1F1H A;  2KLG A;  3DWG C;  2LUM A;  3TBL D;  3Q6B A;  3B0A A;  1OEY J;  5D7G A;  3UIO B;  4LNN A;  2DNF A;  3BY4 B;  3BII D;  2N9P C;  4W9I A;  1FRD A;  4XE0 A;  3EUB 2;  3TUO A;  3PVL A;  5JHB A;  2BB6 A;  2HJ8 A;  1V2Y A;  2MBE A;  1RM6 C;  3VFK A;  3APF A;  4IM0 A;  4KX6 B;  3JW0 X;  4LCD E;  4TKN A;  4IG7 B;  1XF5 L;  2CU1 A;  2FCN A;  4MM3 B;  1AWD A;  1VD2 A;  3A1Q A;  2KQ7 A;  2C7M B;  3WAM A;  3VUW A;  3AN1 A;  2CJO A;  3N20 C;  2M17 A;  1SE9 A;  4O1N A;  2WXM A;  4IWO A;  1E10 A;  2BTE A;  4AS1 A;  3PGE A;  3VR8 B;  4MGI E;  4RM9 A;  4FJY A;  4W9G A;  3HK0 A;  3M62 B;  3TIX A;  3MFG A;  4BFR A;  3DBH I;  4HDQ A;  3AE2 B;  4HPL B;  2DAF A;  5AZF A;  2KJR A;  2C7H A;  1K8R B;  3QX1 A;  3TEY A;  2N0S B;  1FIQ A;  4XX5 A;  2NVU I;  5H92 C;  4MDK E;  1D5M C;  3BVM A;  5IA7 A;  1U4A A;  4DHZ B;  1WWT A;  4FJZ A;  5FK9 C;  3J9C A;  1NEN B;  2KJ6 A;  2KQS A;  4EE2 A;  2V4L A;  3N32 A;  3VUY A;  1RLF A;  4JPS A;  4FJV B;  2CJN A;  2L1A A;  5LNK 1;  2KK8 A;  5BMG A;  3X23 A;  4D2K A;  2L3Z A;  5MPO A;  3B9J A;  2G9H D;  2CHW A;  3CF6 E;  1QF6 A;  2Y5B B;  4OVU A;  3I3T B;  2KMM A;  3ZNG C;  4IOI E;  2M56 B;  1YJI A;  1TS2 A;  2FIF A;  1WXA A;  3BK2 A;  4RH6 A;  3NZ3 A;  2LZ6 A;  1VZ6 A;  2W3R A;  2G1E A;  4GB9 A;  2YEP B;  2ZZP B;  4BVU C;  3EHV A;  2HJ1 A;  1EF5 A;  4TSS A;  2NS5 A;  3SFD B;  1TGZ B;  3B08 A;  4BKG A;  1JWB D;  2KD0 A;  4K81 A;  3VTV A;  1C76 A;  1GG3 A;  3T3O A;  4ZHP A;  3AE8 B;  3LB8 C;  2O2V A;  4HJG E;  1B1Z A;  4WH4 A;  4JL9 A;  3P2B A;  2BYE A;  2OJR A;  1F2R C;  4NQL B;  4YSX B;  5D2M B;  2KFK B;  3GZN I;  4FBJ B;  3A4R A;  1IUE A;  1UWX A;  2WP9 B;  2RDH A;  2V9H A;  2J0K A;  4IWP A;  1FO4 A;  3A9J A;  3WAL A;  1NI2 A;  3OG5 A;  1A70 A;  4NJC A;  4A9A A;  1EWC A;  2R2Q A;  1E9M A;  3V62 A;  4AJY B;  3Q3F A;  1MJD A;  4RGO S;  2JYT A;  2LD9 A;  4DQO C;  5DPW A;  4II2 B;  3ZGZ A;  5EE9 A;  1IGD A;  1WR1 A;  1P0R A;  3TEX A;  2OED A;  2K8B A;  1KFY B;  2O6V D;  4DBG A;  1TBE A;  1YJJ A;  2WXK A;  2I1J A;  1QOG A;  3EEC A;  3V05 A;  2N7J A;  1SIJ A;  1V1O A;  3B2F A;  1N5X A;  2FUG 1;  2IPK D;  3U7D A;  1FCC C;  1L5P A;  3ZIM A;  4A55 A;  4E3C A;  2JXT A;  2KOX A;  3B1L X;  1F52 A;  2CS4 A;  1ZE3 D;  2HTH A;  1Z5S B;  1N61 A;  1P1A A;  2ZNV B;  1B9R A;  4RF0 A;  2KO3 A;  2ZW1 A;  3AI5 A;  1T3Q A;  2HDE A;  1I35 A;  1YQB A;  3Q3N C;  4WIP A;  2N1W A;  2HTM E;  3PLV A;  3DQV A;  2DBY A;  4IWQ A;  4P7I A;  2QCZ A;  4BKS A;  1HEZ E;  1SIF A;  1C77 A;  2E3T A;  5CHF A;  4M8N A;  3HHM A;  1MHX A;  1JWA D;  2KAC A;  2JSV X;  2VZK D;  2DZK A;  2LMC A;  4PYU A;  2QMT A;  2AX5 A;  4WAF A;  5GMV A;  1KH0 A;  1BUI C;  3RNG C;  2IBI B;  4ZRI A;  2Q5W D;  5LLI A;  1UNS A;  3U4E G;  2G45 B;  3VTU A;  2MW5 A;  3O13 A;  2L7R A;  2FUH B;  2MBH A;  2CU3 A;  3MJW A;  2KMA A;  3R7R A;  1L2N A;  4NY0 A;  3V60 A;  4OHJ A;  3JSV A;  2MSE D;  3RZF A;  1EM7 A;  3W2D A;  3H6N A;  2K39 A;  2KZR A;  2SEB D;  2O2V B;  2J53 A;  3UF8 A;  2WHI A;  4PYZ A;  3RN9 C;  2MJ3 A;  3RNE C;  1TS3 A;  2GOW A;  3NG0 A;  2D10 A;  1YJ1 A;  4HK2 A;  1MG8 A;  2K8C A;  4JWS C;  1RWS A;  2FCS A;  2VRR B;  3R66 C;  1CMX B;  1EF1 A;  2KTR A;  4FLH A;  1XLO A;  2WXQ A;  1WJU A;  3SHQ A;  4JIO U;  5C2T B;  4M02 A;  1TY2 A;  1C79 A;  1FNV A;  1ZDV A;  2JY6 A;  2IO3 B;  3BVG A;  2Z8L A;  1T0S C;  3Q3M C;  2PMV A;  2WYQ A;  4E74 A;  3PZ8 A;  1TJE A;  2DYM A;  3P1M A;  3ZTD A;  4ZRP A;  4KGR A;  5TR5 A;  4FUL A;  3GZN B;  3O65 B;  4WQO B;  1XLN A;  4A6Q A;  1JWM D;  4HKZ E;  5FR3 A;  2LEK A;  2M19 A;  3ZLZ A;  2KDF B;  5L83 A;  1K53 A;  1PGA A;  2OJW A;  2D5G A;  2BYV E;  3Q69 A;  4YT0 B;  5JH5 C;  3DDC B;  2K3U A;  2I38 A;  1E7V A;  4KSL C;  2MBO A;  4TQ0 A;  4AQ7 A;  4US8 A;  4N9F 4;  3VR9 B;  1LO5 D;  3PV1 A;  1LQB A;  3IT4 B;  1Y56 A;  5D6J B;  1V97 A;  5AUI A;  2BQQ A;  2NPT A;  1P3Q U;  1ROE A;  5BYR A;  4DDI D;  2LWP A;  2Z59 B;  4HDO A;  2WS3 B;  1UD7 A;  2KWD A;  1GJZ A;  2R61 A;  1V80 A;  4AUQ C;  3TMP B;  1QZE A;  1ZOY B;  2Y5C A;  3KQ4 A;  1ZKH A;  4P1C C;  4JGH B;  1ACC A;  3AEE B;  2CHZ A;  1MFW A;  1WY8 A;  3PZ7 A;  4MH8 A;  2MHJ A;  1MI0 A;  4X57 B;  1KLG D;  1V1P B;  4W9D A;  3WAO A;  3C8Y A;  5JZE B;  1WMH B;  4KDI C;  2KC2 A;  2FBW B;  2K5P A;  1HQR D;  3W5U B;  4NNJ B;  4BOZ B;  1P9D U;  4C7Z A;  3AV8 A;  4WWN A;  1V9J A;  3R2I A;  1NEK B;  4NJ6 A;  1PFD A;  4LDT B;  1V5O A;  4ICU A;  4Q2J A;  5E6J A;  1M94 A;  2PTL A;  4GN1 A;  3LJ3 A;  2XNA C;  1WZ0 A;  2BWF A;  3I9V 1;  4YL8 A;  1VZ7 A;  1RFK A;  3ZVV A;  2J42 A;  1S1Q B;  1TYG B;  1WXM A;  2WXH A;  3NHE B;  1MHH E;  2O6V B;  1YN5 A;  3QAQ A;  2BPS A;  4KIK B;  4C4V A;  4CHK A;  3AEF B;  2Y3A A;  1Y8R C;  3KWV A;  2MJD A;  2EEL A;  1KF6 B;  4GDK A;  1DOX A;  4WJP A;  3X0W A;  2ZW0 A;  2RD0 A;  2ZNV C;  2W9N A;  3B2G A;  4GGQ A;  2QDF A;  4EEW A;  1WGD A;  3RPF C;  3APD A;  3ZUN A;  2G4D B;  4J3O D;  1OQQ A;  3AU4 A;  4HPM B;  1WX8 A;  3ZW3 A;  3IHP C;  2MP2 B;  2K6D B;  2R2O A;  1BML C;  1E6E B;  1YX6 B;  3NY5 A;  4ARI A;  2NCN A;  4KSK C;  4WWP A;  1SXT A;  4MH0 E;  3VTW A;  1Q10 A;  1I7H A;  2GBR A;  3A9K B;  3DBS A;  5TSS A;  4ITK A;  1WXV A;  2QEJ C;  2FCM A;  2DZM A;  1E8W A;  3DWM A;  4K7U A;  2DZJ A;  3QWZ B;  3SDL C;  4YSZ B;  3RFZ B;  3AE4 B;  4LLG M;  2KDE B;  1GC7 A;  3BK1 A;  1FMA D;  1DOY A;  4FHK A;  1UZX B;  2ONQ A;  3R8B A;  5G5G A;  2KFJ A;  4ZOH C;  2B76 B;  1V86 A;  2E6X A;  2D3G A;  1L0X B;  4GMV A;  2IY0 B;  4NAM A;  3KVF B;  1L7Y A;  1WX9 A;  3SU8 X;  1CK1 A;  2EMT A;  1DGJ A;  1E5W A;  2LXC A;  4B0E A;  4LNF A;  3H7P A;  3NVZ A;  5C1Z A;  4M01 A;  4ZRK A;  1WRI A;  1ZW7 A;  3P63 A;  3H7P B;  1R4M I;  2TSS A;  1G6J A;  2KDB A;  1UWM A;  3VH4 B;  3N30 A;  4GLS C;  1L0V B;  3KYC D;  2BYT A;  3Q14 C;  3VHT C;  3TSS A;  2N9L A;  2XN9 C;  1WJN A;  2MWS B;  3FIL B;  3SFE B;  1ZXI A;  2WDR B;  4HXD A;  3N1Y C;  3R2T A;  4W9L A;  4YSY B;  2ZCB A;  4J6I A;  3DCG A;  3CST A;  4EUT A;  4RM8 A;  2PVG C;  4IW0 A;  5CHV C;  3P42 A;  3DVG X;  4W9F A;  3QC8 B;  2WQY B;  4GSW A;  1P98 A;  2BGF A;  3C0R B;  1AYF A;  1F77 A;  2LGS A;  4JX1 C;  2IY1 B;  1YIW A;  1WGY A;  3N1X C;  3BYY B;  4GU2 A;  1C78 A;  2PW9 A;  4LK0 M;  1WGG A;  4EZJ A;  4KKJ A;  2WDV B;  3I57 A;  5EDS A;  1NDD A;  2DX5 B;  3W5V B;  2JZZ A;  2WLB A;  4RGM A;  1PDX A;  3QJZ A;  4G11 A;  2DYO A;  3OAW A;  4HRS A;  4MEM A;  5BYQ A;  2A5U A;  2M0A A;  1ZPS A;  1UGJ A;  4FA6 A;  3AEG B;  4K7W A;  4KV2 A;  1GPX A;  5AEK B; 
#chains in the Genus database with same CATH homology
 3NS1 A;  1MVK A;  1DOI A;  1GOZ A;  1CZP A;  1ZE3 D;  2QSD A;  1N61 A;  3W1S A;  4YXD B;  1VRA B;  5EE0 A;  1B9R A;  5HG2 A;  2ON8 A;  4RF0 A;  2ZW1 A;  1GB4 A;  4H2A A;  1T3Q A;  2HDE A;  2YEP F;  1JW9 D;  2K22 A;  5D3D A;  4WIP A;  1QQR A;  2ACZ B;  1YN3 A;  2HTM E;  4N6E B;  3P4Q B;  5EE1 A;  1JAL A;  4ZYS A;  1N63 A;  1I4G A;  2DBY A;  3NVW A;  3HVZ A;  1FEH A;  1ET9 A;  1HEZ E;  3P4P B;  1FNW A;  1WSP A;  1C77 A;  1NYR A;  4RGT A;  3LXF A;  3AE5 B;  2V0G A;  1VDV A;  2E3T A;  2W54 A;  1MHX A;  1JWA D;  1ET6 A;  2KAC A;  2W55 A;  2JSV X;  2INP E;  1I4R A;  2QJL A;  2VZK D;  2LMC A;  3HRD D;  4LTU A;  2BB5 A;  1K51 A;  2QMT A;  2BS4 B;  4OZC A;  2AX5 A;  1J7C A;  1TZO A;  4WAF A;  1R7S A;  2I2Y A;  1TS5 A;  1JWU D;  1KH0 A;  4FXC A;  1SE4 A;  1BUI C;  4RNA A;  1JRP A;  5HI1 A;  2WNM A;  1KLU D;  1VLB A;  2Q5W D;  2INN E;  3Q8F A;  3NVY A;  1UNS A;  4L23 A;  3U4E G;  1SJH D;  2RMM A;  1PYW D;  1C4P A;  3O13 A;  3T3N A;  3L4P A;  2CU3 A;  2WXR A;  3EGR A;  4OHJ A;  1I4X A;  2MJE A;  1EM7 A;  3W2D A;  2BBC A;  4P16 A;  1QT9 A;  2SEB D;  2WXL A;  2J53 A;  3HVD A;  1QLB B;  4C56 C;  5HFY A;  3FC4 A;  1J7A A;  2MJ3 A;  3MJ5 A;  1XO3 A;  3ABV B;  1QOB A;  5H8Y E;  1TS3 A;  1NYQ A;  4OZA A;  1L6V A;  2H89 B;  4ARC A;  4JWS C;  4KGT A;  1RWS A;  1JQ4 A;  2VZK B;  4YTM B;  2V3N A;  5D3I B;  3NRZ A;  3SR6 A;  3NUH B;  3U2S C;  4WUR A;  3ZJV A;  2WXN A;  1N5W A;  4IKG A;  1QOA A;  1XLO A;  2WXQ A;  1TKG A;  4MT5 A;  3AE9 B;  4PT5 A;  3GS2 A;  5C2T B;  4NZL B;  1KRH A;  1FXI A;  1C79 A;  1FNV A;  1TY2 A;  1VJK A;  2DLB A;  1AN8 A;  1ZDV A;  4OVZ A;  3GP7 A;  1NVI D;  3OWE B;  1IBX A;  3BVG A;  2Z8L A;  1PGX A;  3IT6 B;  5EE3 A;  2BS2 B;  1C9F A;  1TS4 A;  2PMV A;  3AB5 A;  3HUI A;  1SB3 C;  2JYE A;  3SEB A;  3PZ8 A;  1NI3 A;  3V3X A;  4XWW A;  1TJE A;  2DYM A;  1F0Z A;  3P1M A;  2KAJ A;  4ZRP A;  4KGR A;  2IGD A;  4HEA 1;  1L4Z B;  4N59 A;  1XLN A;  4A6Q A;  1JWM D;  4HKZ E;  2NTS A;  5FR3 A;  2LEK A;  2M19 A;  1JWS D;  1FFU A;  4HKQ A;  4OZB A;  1K52 A;  3MC0 B;  3EA6 A;  1XEE A;  4RFB A;  1JRO A;  1K53 A;  1MPE A;  4WQM A;  1TY0 A;  1PGA A;  1JML A;  1VR9 A;  2D5G A;  5C3J B;  3Q69 A;  4YT0 B;  2W3S A;  4HRO A;  1F2R I;  2WXO A;  1EU3 A;  2K3U A;  2I38 A;  2QIE B;  1XXG A;  4AQ7 A;  4TQ0 A;  1EWY C;  1V8C A;  2L83 A;  1D5X C;  2KQ4 X;  4US8 A;  3VR9 B;  1LO5 D;  4KKI A;  3W9C B;  3IT4 B;  1IGC A;  4DXF A;  1Y56 A;  1FD6 A;  1N60 A;  4P6V F;  3ETR A;  3TEZ A;  1V97 A;  4M0W A;  4C80 A;  2WDQ B;  5AUI A;  3MP9 A;  1ROE A;  5BYR A;  4USA A;  3Q8A A;  1OFF A;  1FNU A;  1PUT A;  5AUK A;  2RDG A;  3VRA B;  2JQR B;  2WS3 B;  2KWD A;  2R61 A;  2WXI A;  1YN4 A;  3H8H A;  1HZ6 A;  4OW0 A;  2WXP A;  3N9Y C;  2WXG A;  1ZOY B;  2X38 A;  2Y5C A;  3Q8B A;  1XLP A;  1E0Z A;  1E7P B;  3KQ4 A;  3GB1 A;  1YQ3 B;  4RF1 A;  2J52 A;  4YWG G;  2NTT A;  1ACC A;  1T6B X;  5FKA C;  3AEE B;  3KWL A;  2V3P A;  4A90 A;  4N58 A;  2BW2 A;  3PZ7 A;  4MH8 A;  1SEB D;  2PLP A;  1MI0 A;  1XCT L;  1D4B A;  1GAQ B;  1FRR A;  2V4I B;  2KN4 A;  2WXJ A;  1KLG D;  1V1P B;  3P4S B;  2IGH A;  2JU6 X;  3URY A;  3WCQ A;  3C8Y A;  4TQ1 A;  3DWG C;  2LUM A;  2FBW B;  1M4V A;  2AQ2 B;  1HQR D;  2K5P A;  2RPV A;  3AEA B;  5D7G A;  3W5U B;  3BII D;  3E56 A;  4C7Z A;  3AV8 A;  2JZP A;  3R2I A;  3ZYY X;  1NEK B;  4YTP B;  1FRD A;  2FE8 A;  3FIL A;  2L32 A;  2BS3 B;  5HHD G;  1PFD A;  4XE0 A;  3EUB 2;  3TUO A;  3AE6 B;  2BB6 A;  3P4R B;  5T8I A;  4Q2J A;  5E6J A;  2PTL A;  2K9X A;  1FXA A;  1WGK A;  2XNA C;  4DXG A;  2Y5P A;  3I9V 1;  1IBX B;  3PO0 A;  5GXG B;  1RM6 C;  1VZ7 A;  4ZRQ A;  1RFK A;  3BVZ A;  2J42 A;  1HZ5 A;  1QIL A;  1TYG B;  4KX6 B;  2WXH A;  1J7B A;  2H88 B;  1MHH E;  1XF5 L;  1YN5 A;  2NMQ A;  5BYS A;  4MM3 B;  1AWD A;  2SAK A;  3MHZ A;  3AEF B;  2Y3A A;  3E9S A;  1SJE D;  3AN1 A;  2KDM A;  2CJO A;  4MAC A;  3KWV A;  2MJD A;  2EEL A;  1KF6 B;  1XLQ A;  4UDU C;  1DOX A;  4O1N A;  2WXM A;  3VQI A;  1E10 A;  2ZW0 A;  1C4A A;  1OQR A;  1TKE A;  2BTE A;  4AS1 A;  3NVV A;  3VR8 B;  3B2G A;  1QOF A;  2WU5 B;  3AE1 B;  3MFG A;  3RPF C;  2LGI A;  4J3O D;  1OQQ A;  4REZ A;  3U52 E;  3AE2 B;  1ZXH A;  1I4H A;  1BML C;  1E6E B;  2MH7 A;  4ARI A;  4C7Y A;  2ICI A;  3TEY A;  1SXT A;  2N0S B;  3CIR B;  1FIQ A;  1D6E C;  4US9 A;  1WXQ A;  1Q10 A;  1I7H A;  4L2Y A;  2AQ1 B;  5H92 C;  3ZJT A;  1YMH E;  4KGS A;  5TSS A;  4ITK A;  1BXT A;  1VZ8 A;  3IXS A;  1D5M C;  4XDD A;  2QEJ C;  3AEB B;  3BVM A;  1P7F A;  1ZDX A;  1V1P A;  1WWT A;  2LFI A;  3IAS 1;  3AE7 B;  5FK9 C;  3DWM A;  3KLS X;  3J9C A;  1NEN B;  1SF0 A;  2J4X A;  4EE2 A;  3AE4 B;  4YSZ B;  4LLG M;  3RFZ B;  1EU4 A;  4L1B A;  4RCO A;  1YNT E;  1I4P A;  3BK1 A;  4RGN A;  1FMA D;  3AMZ A;  4JPS A;  1DOY A;  2CJN A;  2L1A A;  5LNK 1;  3ZJU A;  2ONQ A;  3R8B A;  5G5G A;  5BMG A;  2LHE A;  4ZOH C;  4D2K A;  1L0Y B;  3BYT B;  2B76 B;  2E6X A;  4TMA B;  3IAM 1;  4B0M A;  2LHD A;  5MPO A;  3B9J A;  1L0X B;  2G9H D;  4GDL B;  1KTK A;  4NAM A;  1QF6 A;  3Q8E A;  2PKO A;  3FAH A;  2KMM A;  4IOI E;  2M56 B;  1YJI A;  1TS2 A;  1CK1 A;  1K50 A;  3BK2 A;  1DGJ A;  2JWU A;  4RH6 A;  3NZ3 A;  1VZ6 A;  3CWI A;  2W3R A;  1P7E A;  2OHF A;  2G1E A;  4B0E A;  2MEK A;  2YEP B;  4GDK B;  3AH7 A;  1C4C A;  3NVZ A;  4YTN B;  1WRI A;  4TSS A;  1YQ4 B;  2GRI A;  3P63 A;  3U7Z A;  2WU2 B;  3SFD B;  4XDC A;  1WYG A;  5JXV A;  1ESF A;  4JE3 B;  1JWB D;  2TSS A;  2DWQ A;  2WXF A;  2IJ0 A;  1FFV A;  3UI3 A;  1UWM A;  1D5Z C;  4GLS C;  4IDI A;  1L0V B;  1C76 A;  4WWM A;  2BYT A;  1GB1 A;  1RYJ A;  4XWT A;  3T3O A;  4ZHP A;  3AE8 B;  3TSS A;  5BMH A;  1CJE A;  1FM0 D;  2N9L A;  3LB8 C;  2XN9 C;  4HJG E;  1B1Z A;  1FCL A;  4WH4 A;  3FIL B;  3SFE B;  1F2R C;  1ZXI A;  2WDR B;  1SBB B;  3Q8C A;  2L52 A;  1L4D B;  4YSX B;  3R2T A;  4YSY B;  1IUE A;  2LJI A;  3AE3 B;  1SE3 A;  1UWX A;  2WP9 B;  4CQN A;  1SSN A;  2RDH A;  1ZUD 2;  2W82 A;  2PVG C;  2PIA A;  4JWU C;  3P42 A;  1UUP A;  2BT6 A;  4R3D A;  1L6U A;  2EKI A;  1HA5 A;  2WQY B;  2N9K A;  1FO4 A;  1TKY A;  1AW7 A;  1T5X D;  5I4D A;  2GI9 A;  4A8X C;  1A70 A;  1AYF A;  1F77 A;  4NJC A;  4JX1 C;  1I4Q A;  1N62 A;  3VRB B;  4A9A A;  1EWC A;  1ENF A;  3LYY A;  1E9M A;  1PGB A;  4NAW B;  2JX5 A;  4RGO S;  3AM9 A;  2PVO D;  2JYT A;  1CQV A;  3BYY B;  4DQO C;  1STE A;  3ZGZ A;  5EE9 A;  1IGD A;  1C78 A;  2PW9 A;  4LK0 M;  3TEX A;  2K0P A;  2OED A;  4KKJ A;  2WDV B;  3I57 A;  1KFY B;  1SE2 A;  2AQ3 B;  3W5V B;  1JCK B;  1DYQ A;  2WLB A;  3BZD B;  3AED B;  4ZHO A;  4RGM A;  1YJJ A;  3BWU D;  2WXK A;  1QKZ A;  1PDX A;  1QOG A;  5G5H A;  3ZQ4 A;  3V05 A;  2DYO A;  2N7J A;  1SIJ A;  1V1O A;  4HRS A;  3B2F A;  1N5X A;  2FUG 1;  2IPK D;  2GB1 A;  2M0A A;  3AEC B;  5BYQ A;  1FCC C;  1L5P A;  2IDY A;  1ZPS A;  1HXY D;  2IGG A;  4A55 A;  2QIL A;  1UGJ A;  1XCQ L;  2JXT A;  3AEG B;  1ZP0 B;  3TEW A;  1GPX A;  5BMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...