2HDEA

Solution structure of human sap18
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
148
structure length
148
Chain Sequence
GSHMRVTQEEIKKEPEKPIDREKTSPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone deacetylase complex subunit SAP18
publication title Structure of SAP18: a ubiquitin fold in histone deacetylase complex assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 17
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06487 SAP18 Sin3 associated polypeptide p18 (SAP18)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.550 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2hdeA01
2HDEA 4A8XC 4A6QA 4A90A
chains in the Genus database with same CATH superfamily
5IOIA 5C1ZA 1SSNA 3RPFC 2RGFA 3LJ3A 3ZLZA 2GB1A 5BMGA 1FNWA 3W2DA 3AEGB 4P16A 2MBOA 1D4BA 2N9KA 3QJZA 2NTTA 4WWOA 2DAFA 2C9WB 2SEBD 1GG3A 1E7UA 4DHJB 2C60A 2JYEA 3PRZA 4GU2A 2JUOA 3WAMA 1R7SA 2JU6X 2DNFA 2QMTA 4GLSC 3KVFB 4HPMB 4HROA 1ET6A 1QLBB 3L0WB 1FO4A 3HVDA 1KH0A 3Q3MC 5CHVC 4WIPA 5EE0A 1G6JA 3DBHB 4URKA 2INPE 4PS8A 3TUOA 4OHJA 1PGBA 3PZ8A 3QK0A 3SU8X 3C8YA 4F8CB 2KC2A 1MG4A 3ABVB 1UWMA 1SIFA 2NBVB 1VD2A 1YMHE 1Z5SB 2MJ3A 1C79A 3ENEA 2WXRA 2ON8A 1S3SG 2AEHA 4P1CC 3ZGZA 3N1ZC 3UGBB 2L05A 1P7EA 2KWUB 2LXAA 2MP2B 1DOYA 3WA0A 3AE8B 2O2VB 4A3PA 3P42A 3FILB 4M0WB 4W9GA 3R8BA 2BTEA 2WXGA 2KWCA 4ACFA 2BBCA 2MA9B 4RF0A 2NPTB 2I2YA 3S2AA 1UGMA 2WNMA 3DWGC 1SE2A 4AWJA 1DGJA 2VH1A 1OQRA 2MBHA 4G3XB 1OQQA 1BXTA 2BT6A 2K0PA 2ICIA 1T6BX 4MELA 1D5XC 2SAKA 1WGHA 2RDHA 3HM6X 5HHDG 4HVBA 1UNSA 1K53A 4ZRPA 1GAQB 3B0AA 1NYRA 4M00A 3EFUA 1WMHB 2WX1A 4GDLA 1C4CA 3UQAA 1WR6E 2ZW1A 2E6XA 2IO0B 1ESFA 3W1SA 4H2AA 3AXCA 3R66C 4RM9A 5J17A 4II3B 2J42A 2B3AA 4L2YA 3E56A 3MHZA 1MHXA 4LLGM 4L23A 4A6QA 2GBRA 2MWSB 3URYA 3P1MA 4Q2JA 3U30A 4OVVA 3ZDMC 1YD8U 4HCNB 4BBNF 2LASA 1KLGD 3ZJVA 4G0NB 5JHAA 4ANWA 1E7PB 3V62A 1XLNA 1OFFA 4AOFA 4YXDB 5AEKB 3OJ4B 2C5LC 3TSSA 1QF6A 2ZCBA 4KV2A 4F1SA 4WURA 1YQ4B 2M4NA 1E9MA 4W9DA 1WXAA 3AULA 1IGCA 3L54A 1HTQA 2WXPA 3T3OA 1UUPA 2DAJA 3JSVA 1EO6A 2KN5A 2FCNA 2MQJA 4MSMB 2W3RA 4MM3A 2KK8A 2WLBA 1Q10A 4DHJD 1YQBA 4BKGA 3OWEB 3L10B 2KQSA 2W82A 3AH7A 2ACZB 4DWFA 1RM6C 3Q3JA 1VDVA 2FUHB 4C80A 3ZJUA 5CTRC 1V5TA 1TTNA 2D07B 1JROA 5BO4B 4N9F4 2H88B 3BWUD 3MC9A 2MHJA 1TZ1A 3AE7B 2IO2B 4ARCA 3IT4B 4TUUA 5FR6A 1FFUA 3TBLD 2JWZA 1HZ6A 3Q3FA 1C4PA 3DBLI 4GB9A 4K3BA 2GBNA 1I7HA 1MHHE 5JHBA 4LTUA 5EE9A 2XNAC 2KTFA 5LXIB 4IM2A 3AE9B 2KQ7A 3DBRB 2AX5A 1WIAA 3KUZA 4N58A 1E7VA 3Q14C 2ZNVB 2VZKB 2X38A 3OLMD 4FN2A 4OZBA 3ETRA 1TT5B 1V2YA 3X0WA 4FJZA 3QCAA 1I4QA 3ZRFA 2X8XX 4XYCA 2BS3B 1WJUA 4W9EA 4HRSA 1K51A 4KSKC 1P9DU 4KX6B 1SE3A 1I4HA 1WX7A 1VZ8A 3RMKC 2PPHA 2CJNA 2XK5A 4AS1A 4B9KA 2PMVA 4GSWA 4B6WA 4AP4C 2G1EA 3ZXVA 2LGYA 2NBWB 3VTVA 3IVFA 4HKQA 3N9YC 1MI0A 5TR5A 2WX0A 1FXTB 2HTME 3EFCA 4GMVA 4TKNA 2Z59B 5C3JB 3NZ3A 4K3CA 2L0FA 1F2RI 2MRPA 2INCC 4IDIA 4C7ZA 1F2RC 2GBKA 4GDLB 1WYWB 1S1QB 3VR9B 1WR1A 1MPEA 2M8SA 1HTOA 2Z8LA 2JWUA 4XWWA 5G55A 2KJRA 3V6CB 5BMHA 4C56C 2KFKA 3KWLA 1XCTL 2AQ1B 2LFIA 4LJPB 4K81A 4RMAA 3IAM1 3UI3A 1GUAB 2KFJA 2HJ8A 3RI7C 1D6EC 3E9SA 3OAWA 4JIOU 4R3DA 3NVZA 2FBWB 4YTPB 4C4VA 3AEAB 4US8A 4KSLC 2I1JA 3DDCB 2D3CA 4PS3A 4DK5A 2XBBC 3K9PB 4WWPA 3JSVB 2OJWA 3BZDB 4N6EB 4FJVB 1KLUD 4MM3B 4KIKB 2JXXA 2KZRA 3U2SC 2I1KA 1JWMD 1L2NA 4YSXB 3DPDA 4A8XC 5E6JA 3VAWA 1KM7A 2LVPA 1YOVB 3DWMA 2K6QA 3IAS1 3ONSA 5IO9A 1TJEA 4CQNA 4A3OA 1AWDA 2IO1B 3M63B 1H4RA 1QOBA 2J52A 3SD5A 5BYRA 2QIEB 1OTRB 2EMSA 5DPRA 1PGAA 2XEWA 4MGIE 1RLFA 1TY2A 2L83A 3V6EB 2Y5PA 1YJ1A 3VHTC 3WALA 4FULA 1F9JA 3VR8B 2L8JA 2IBIB 1E8ZA 1MFWA 4USAA 1R4NB 2K22A 1XEEA 1XQQA 4FHJA 1WRIA 2BS2B 4L1BA 1SE9A 1ZXHA 3QX1A 4RH6A 2D10A 2N7JA 2BYVE 1GC7A 3ZTDA 4XGAB 2VZKD 2ZCCA 4WAAA 1Q5WB 2ZEQA 1VCBA 2NVUI 3FILA 1GC6A 2LUMA 4KKJA 4M0WA 1ISNA 4LNNA 1I4PA 2IGHA 3DHIC 2DZIA 3CWIA 3NG0A 3P4PB 4KZ0A 2G3QB 2MX2A 1NVID 4CYEA 4ZHPA 1ENFA 3APCA 2XK5B 4DXFA 4NJ6A 4PS7A 3V3XA 2CS4A 2JRHA 3J9CA 1QOFA 1QOAA 2C7NB 1KRHA 1QZEA 4IWQA 1C4AA 1T0RC 5G5GA 1E8XA 3Q69A 1JRUA 3BYYB 1WX9A 3LXFA 4KZCA 4A9AA 3I63C 5BYSA 2W9NA 2Z0DB 1D5MC 3DBSA 2BF8B 2CJOA 1NYQA 3RULA 4FLHA 2N9XA 1AARA 3QIJA 1GB1A 1JMLA 1FM0D 2KKCA 1L4DB 2KFKB 2WP9B 3AEBB 3VDZA 2PW9A 1VR9A 1B1ZA 4OVZA 2QSDA 1WZ0A 1RAXA 2KDIA 2LXCA 3MC8A 4RGOS 1FNVA 4G50A 3Q2AC 4K7SA 4NY0A 1D3ZA 4S17A 1VJKA 1HA5A 2KMCA 5HG2A 3DOWA 4MACA 4W9JA 5LNK1 2NBUA 3ZRCA 2GMIC 4HDOA 1Z2MA 1P7FA 2KAJA 3A9JA 4MDKE 2BB5A 4NAMA 1SF0A 5LXHA 2DZMA 2N9EB 1IP9A 3GE3C 3N32A 5D3DA 4WAFA 4RM8A 2JX5A 1YJJA 2Y5BB 3VTWA 3RNCC 3ML9A 2NMQA 4AJWA 2Y3AA 2YVCA 5T8IA 2AYOB 1M4VA 3KQ4A 3PV1A 1UH6A 3SEBA 2N1WA 2PIAA 4FHKA 1WGKA 2WDQB 3Q8BA 4I6PA 3T8MA 3GZNB 2ONQA 3VRBB 4CO7A 1XLOA 1QT9A 2ZVNA 1TS4A 3ML8A 1ZPSA 1T5XD 4WWMA 2QC8A 2HJ1A 1FIQA 2OHFA 1V81A 1WM3A 2JRIB 2RMMA 4NNJB 1EM7A 1V1PA 2PVOD 2KVRA 1UBIA 3I9V1 3AU5A 3R7QA 4ICUA 3H7PA 2W55A 3HIZA 3L13A 2CR5A 3BINA 5BYQA 2FNJB 4X57B 2KJ6A 1VRAB 1RRBA 3L17A 3PGEA 3R2TA 4LNFA 4XE0A 4TQ1A 1WM2A 3EHVA 5HFYA 1R4MB 2K25A 2WHIA 2D3BA 1LM8B 4RNAA 1TS5A 4W9HA 2WU5B 3TJPA 1WJ4A 2EELA 3DBHI 2YLMA 4HWIB 4OVUA 1HZ5A 2GRIA 3P2BA 4I6LB 4KGTA 1P98A 1YNTE 2KVZA 1ZXIA 1TKYA 1NEKB 3P4QB 2LZ6A 1ROEA 1KOTA 5JZEB 4IWPA 1JW9D 1WXQA 2M56B 4J6IA 3JVZX 3H8HA 1OEYJ 3Q8CA 2HTHA 3ZYYX 3NZUA 2NR2A 4WJNA 2M0XA 3RYTA 2MJEA 1XO3A 2KNBA 2DX5B 2IY0B 3H7SA 1KFYB 1XLQA 1WXMA 2L1AA 2MH7A 4RF1A 2RR9A 3RNGC 1TY0A 1E90A 4BKSA 1JALA 4PYUA 4YTNB 1C1YB 4GGQA 3DVNV 1IGDA 2LRUA 4LNIA 2W54A 2L52A 3AU4A 2AWTA 3ZTCA 1TBEA 5LLIA 2JYTA 5FR3A 3PSEB 2CHXA 1UZXB 1RFAA 5KHOA 2IZVB 2Q5WD 2KJHB 2N9LA 2INDC 1XF5L 4DBGA 3A1QB 3A9JB 2JF5A 2WXNA 3VXWA 4OZCA 1I35A 4KIKA 4KGRA 3A33B 2BYEA 5DPSA 3UF8A 4GDKA 5L95C 1E0ZA 2JVCA 4EEWA 4BFRA 2W3SA 3U8ZA 2KANA 3N1YC 2NTSA 3BIID 4XX5A 1JRPA 1HE8A 1J19A 5JH5C 3AEEB 2L7RA 4GIVA 2PKOA 1OQYA 4WJQA 3PHWB 1TGZB 3AI5A 5IN7A 4K7WA 5IKCM 2H89B 2BPSA 3TIXA 5D3IB 1SJED 5D94A 2RSUA 1YX6B 3NVVA 2IDYA 3BVGA 5DCNA 2DZKA 1WI0A 2DENB 2G9HD 1F77A 3SR6A 1YIWA 2V0GA 3BVZA 2J4XA 2KYWA 1WWTA 4PYZA 3ZNHB 1PDXA 1V1PB 2L32A 4FADA 3UQBA 3VTUA 1K8RB 1ET9A 4FBJB 3H7PB 1H8CA 1BMLC 1RYJA 2L00B 3CMMB 3GP7A 1JWAD 1T3QA 2BW2A 2PTLA 4C00A 4YSZB 4LDTB 2BVCA 3T3NA 1WGDA 2QDFA 4HPLB 4N59A 4DXGA 2JQRB 4J3OD 1J7BA 3RNAC 4IC7B 3A4RA 3V05A 4P1BC 3EGRA 2KDBA 4IW0A 4GXBA 2R61A 2WS3B 1ZE3D 2CKHB 2WDVB 2RPQA 1F52A 4HJGE 2BGFA 3RUIB 4MT5A 4HK2A 1ACCA 1A70A 1MG8A 1N62A 2CU3A 1WH3A 1I42A 2D2QA 2KLGA 4DDID 1DYQA 4OW0A 4MGZE 2WDTB 4HJKA 3TL5A 1VZ7A 2ZNVC 2PJHA 3H9DA 4AQ7A 3NS8A 3HM3A 4WWNA 4ZHOA 4M8MA 1V97A 2KXJA 1T0SC 1ZKHA 1JWSD 1XXGA 4P6VF 2L0TA 1SXTA 2QILA 2WYQA 1C3TA 1WF9A 2D3GA 1KLVA 1CMXB 1CQVA 4YWGG 2NCNA 3HK0A 3FAHA 3SHQA 4HXDA 5HI1A 5CX3A 1L6VA 3KYDD 4W9KA 1V6EA 4F7ZA 4BOZB 3KWVA 3AE4B 3DVGX 2MSED 3U7DA 1WXSA 1J8CA 3ZW3A 1N5WA 4DDGD 2WXHA 3C0RB 3VUWA 1U4AA 2WXMA 1WY8A 3Q8FA 3W1SC 2FCQA 1TS2A 3QA8A 3KUDB 1T0QC 1FNUA 2J53A 1NI3A 2N1VA 2BS4B 2J0MA 5JXVA 2BQQA 2WXOA 1IBXA 2Y5CA 4ZYNA 1JWUD 1CJEA 4GDKB 4US9A 4BOSC 1F1HA 1NDDA 4P7IA 1GJZA 5TSSA 3AMZA 3HRDD 1JQ4A 3JW0X 4RFBA 3NS1A 3TCAA 4EFOA 3NHEB 2BKRB 4LJOB 4JWSC 2DHZA 3D32A 1J7CA 5AZGA 1CZPA 1BUIC 1WX8A 3H1UA 2AL6A 2J0KA 1L0XB 1NI2A 3LYYA 1I4XA 1LQBA 2KWDA 2LUEA 2L76A 4EE2A 4EKUA 1V80A 1RFKA 4NJ7A 3ZNGC 5IAAC 2K6DB 4HLEA 4ZRIA 2AQ3B 1E10A 3KYCD 1OGWA 2C7MB 2LVQA 4B95A 2M1MA 1KF6B 3MP9A 1PGXA 4W9FA 1YN5A 4A20A 2BWFA 2D3AA 4K1RB 3IG3A 3ALBA 2JY6A 3C19A 3U4EG 5CHWA 3M62B 2HE7A 1N6ZA 1MVKA 1NENB 4HPPA 3MC0B 4ZRJA 4HEA1 2DLBA 2KQ4X 3AE3B 3ZUNA 1WE7A 2D11A 4NPNA 5E6NA 4MGYE 1EF5A 4OZAA 1D5ZC 2LGSA 1R4NI 2KHWB 2KDFB 4QAYA 1YJIA 1Y56A 1TS3A 4BBNC 2DZJA 3BY4B 3PS6A 3WCQA 2RDGA 2QEJC 3TEWA 3SFEB 3I3TB 4LCDE 4BVUC 1FD6A 2IO3B 2LD9A 3PVLA 2LHDA 1L7YA 1ZW7A 3BK2A 3Q3NC 4IM3A 1SJHD 3FC4A 4JQWC 3WAPA 1STEA 3A4SC 3A9KA 3LB8C 2ASQA 2N9PC 3VFKA 4IOIE 2DWQA 2PE6B 3PREA 5D7GA 1WGRA 3N20C 4RGMA 4DHZE 3CSTA 4BKSD 4JE3B 5L83A 3AEDB 5MPOA 4YT0B 2EKEC 3AECB 3DHHC 2K5PA 2A4ZA 4AJYB 2REXA 2LGDA 2WXQA 2GI9A 4WH4A 3ZVVA 4MH0E 1DOXA 4KDLB 3ZXRA 2LWPA 1PQSA 3X23A 3VH3B 2KC1A 2OOBB 1QOGA 2V3PA 1JCKB 3W5VB 5GXGB 3SFDB 3MJWA 4KVGB 2FCSA 4JLCA 3A1QA 1J0GA 3LDZE 1IBXB 3R2IA 1I4RA 2OEDA 2FUG1 4E71A 4NAWA 1V5OA 4MH8A 2JXTA 2K3UA 3RZWC 3IHPC 3I5JC 3NJTA 3I57A 4KDIC 3CSFA 3B9JA 1UBQA 3VUYA 1BT0A 1YN4A 2LJ5A 1FEHA 1SE4A 3W9CB 5DPWA 2WXKA 3KUCB 1FFVA 2LJIA 4W9CA 4JGHB 1ZDXA 3VQIA 2IYDB 2FE8A 2O6VA 4MJSB 4XC2A 1IUEA 1EU4A 4UDUC 2JPHA 3VH4B 4EZJA 2OJRA 3TEYA 4C7YA 1ZOYB 4IWOA 1PUTA 2N7DA 3IBEA 2HDEA 2GBJA 1VZ6A 1ZUD2 3NOBA 4XZ4A 2N0SB 4WQMA 3Q8EA 4TV3A 2DBYA 4YL8A 3GS2A 4JWUC 5E6OA 3IXSA 5C2TB 4FJYA 2WWZA 2YEPF 4E3CA 3PTFC 3GOEA 2AQ2B 1GPXA 4E74A 1UD7A 1V9JA 4ITKA 2V1YA 2VRRB 2MBQA 1GOZA 1E5WA 3AE5B 4RCOA 2KD0A 2GBMA 2BKFA 1UF0A 2MBEA 5AUIA 1JWBD 1C78A 1ZDVA 3GZNI 1P3QU 3OJ3A 4K7UA 1C9FA 1FRRA 1EF1A 4HCPB 1XD3B 2GOWA 2LVOA 4ANVA 2QHOA 1T0YA 1ZP0B 3ZO5B 2PLPA 1YN3A 4ARIA 4IM0A 4NJCA 2WQYB 3H6NA 1UWXA 3R3MA 2ZZPB 3VVWB 4I6NB 4JPSA 2V4LA 1FRDA 2RDBC 1L5PA 2UU7A 1TKGA 1R4MI 4W9LA 3TMPB 2MLBA 2PE9A 1WFYA 3DCGA 4HDQA 1N60A 5I4DA 1X1MA 3KW5B 1N63A 1KJTA 3A9KB 2V9HA 1UGJA 3NUHB 1KTKA 3L08A 3HUIA 2KACA 3AE1B 4LNOA 2CHZA 3W1YA 1C76A 2LI5A 2RD0A 3ZIMA 2KDEB 1FPYA 3U7ZA 3IT6B 1V49A 4M02A 3Q6BA 3BYTB 2WU2B 1FXAA 3WIMA 3B08A 3O65B 4REZA 1TKEA 1XLPA 2UYZB 5C23A 2WXJA 3ZNID 2G4SA 3P4SB 2MCNB 3DQVA 2K8BA 2KTRA 1M94A 2Z0EB 3VUXA 4CHKA 1WE6A 3ECIA 2GLSA 5DPTA 2G4DB 1LXDA 3EC8A 1Y8RC 3DVNU 2INNE 1LGRA 4ZDVA 4NAWB 1V86A 2A5UA 5EE1A 4YTMB 2HD5B 4FXCA 4XWTA 2WGSA 5H8YE 1AW7A 1OEYA 3ZDTA 2DYMA 3N30A 3RCZA 2DYOA 2L3ZA 3DBLB 3T9LA 3UIPB 1SIJA 2FIDA 1QILA 1HQRD 3AEFB 3IFWB 4EOYA 4RGTA 3PO0A 3QAQA 3KH0A 3MJ5A 2O6VB 4B0EA 4ANXA 2PEAA 4AUQC 4LNKA 2V3NA 1FCCC 5KHQA 1E6EB 5AUKA 1EUVB 3QQ8B 5FKAC 4ZYSA 3AE2B 3ZJTA 1K50A 3PT2B 2EMTA 5EE3A 5IP4D 4O1NA 4BAXA 2KWVB 3PLVA 4LK0M 2FIFA 3MHSD 4YSYB 3UIOB 3HHMA 4TMAB 2DYBA 2M0AA 1WZ3A 3APFA 3Q8AA 2IGDA 1LFDA 3DVGY 3W5UB 3PRMB 2ZPNA 2J0JA 2MW5A 3RNBC 3ZQ4A 4DQOC 3B2GA 4RGNA 2EKIA 1SB3C 3RD2A 2KDMA 3QARA 1EWYC 3AN1A 2QCZA 1IYFA 3NZSA 2JZPA 5G2NA 1K52A 3PZ7A 3NY5A 2WXLA 1AYFA 3CIRB 3DBRI 3AB5A 4EZKA 2N4FA 4WQOB 5FK9C 4B0MA 4D2KA 2LGIA 3NRZA 5E6PA 3N3KB 4ASWC 3MFGA 4XDDA 1PFDA 2FCMA 2AL3A 4TQ0A 2BB6A 2MBBB 1L6UA 1TYGB 3HVZA 5BMIA 2M17A 3B2FA 5D6JB 3ZNZB 1XCQL 2IJ0A 3RT3B 1YQ3B 3APDA 3PPAA 5H92C 4KKIA 1L4ZB 4PT5A 1F0ZA 1WSPA 1WJ6A 2YEPB 3M95A 2MEKA 1UELA 3B1LX 1EWCA 3U52E 4HKZE 2LGXA 1EU3A 2R2QA 3GE8C 3L16A 1DOIA 3AV8A 2KTRB 2VH2A 1ZGUB 1FXIA 2BYTA 4NZLB 4MGKE 4KGSA 2QJLA 4M8NA 2J7QB 4WJOA 1YX5B 2IGGA 2BWES 2G45B 3AE6B 1V8CA 3TEZA 4IUMB 1WGGA 4M01A 5J2RA 5D2MB 2N7EA 1Q1OA 3L4PA 1NBFC 2K1FA 2KN4A 3BK1A 3RNEC 5IA7A 2LHEA 2O6VD 4MJSA 3ZKJC 4DHZB 3M3JA 2KX3A 4ZOHC 1SBBB 4IKGA 5EDSA 1E8WA 3EA6A 2KO3A 3PZDA 1V1OA 4ZRQA 1Q0WB 1P1AA 2KMAA 3QWZB 3AM9A 5CHFA 3V61A 1MJDA 2V4IB 4TSSA 2I38A 3QC8B 4G11A 1HEZE 3RFZB 5GMVA 3DHGC 4A55A 2E3TA 4II2B 2LMCA 1WYGA 3R7RA 5AZFA 1I4GA 1WGYA 4XDCA 2JT4B 4LDTD 3VRAB 4EUTA 2XN9C 4PK1A 5G5HA 1L0YB 3RNFC 3N1XC 2NS5A 2KT7A 4GOCA 2V3SA 4BKTA 3RZFA 1E8YA 4EZLA 4ANUA 2WXFA 1GNUA 2IPKD 1A5RA 2JZ3B 3P4RB 1PYWD 2MJDA 3PHXB 2K8CA 1CK1A 3Q3OC 1L0VB 3K9OB 2BYFA 1B9RA 2ZJDA 2MP2A 2K8HA 3BVMA 3PRPB 2D5GA 2O2VA 2WXIA 3GB1A 2TSSA 4ICVA 1WRDB 2KLCA 3EECA 5J18A 1QKZA 3WAOA 2NPTA 4BZAA 2WDRB 3P63A 4GN1A 4WJPA 2CHWA 1J7AA 2B76B 4DXAB 3FKYA 5AZHA 2IY1B 1WJNA 1N5XA 3QHTA 2JZZA 2ZVOA 1QQRA 3SDLC 4MSQB 1HXYD 1FMAD 2K39A 2PVGC 2KMMA 1GB4A 2K9XA 2KOXA 3O13A 4MEMA 4FA6A 3EUB2 4A90A 1WMHA 2FAZA 1SEBD 3CF6E 2M19A 1FCLA 3WANA 1LO5D 2KX0A 2LRWA 4IG7B 3UINB 1IPGA 1C77A 2UWQA 4NQLB 4JL9A 3OG5A 4NQKE 3JYUA 2ZPYA 4ZRKA 1SGHA 2LEKA 1AN8A 1TIFA 1VLBA 1TZOA 1XT9B 4S0RA 1N61A 2JSVX 2C7HA 1RWSA 3NVYA 3TEXA 3KLSX 4JX1C 2ZW0A 3V60A 4W9IA 1P0RA 2RPVA 2R2OA 3PLUA 5HKHA 3RN9C 2CU1A 4C4VB 3MTNB 1WXVA 3NVWA
chains in the Genus database with same CATH topology
1TY2A 1UGJA 3V05A 3NUHB 2L83A 3EGRA 1KTKA 1SSNA 3HUIA 2Y5PA 2KACA 3RPFC 3AE1B 2GB1A 3VR8B 5BMGA 2R61A 2WS3B 1ZE3D 1FNWA 1C76A 2WDVB 3W2DA 3AEGB 4HJGE 4P16A 1D4BA 4MT5A 2N9KA 1ACCA 4USAA 1A70A 2NTTA 2SEBD 2K22A 1N62A 3U7ZA 3IT6B 1XEEA 2CU3A 1WRIA 3BYTB 2BS2B 2WU2B 1FXAA 4L1BA 1DYQA 1ZXHA 4OW0A 4REZA 4RH6A 1TKEA 1XLPA 2JYEA 2N7JA 2WXJA 1VZ7A 3P4SB 4AQ7A 4ZHOA 2VZKD 1V97A 1R7SA 2JU6X 2QMTA 1JWSD 1XXGA 4GLSC 4P6VF 4HROA 1ET6A 1QLBB 1SXTA 2QILA 1FO4A 3FILA 3HVDA 2LUMA 2INNE 4KKJA 4M0WA 1CQVA 1KH0A 4YWGG 4NAWB 1I4PA 2IGHA 5EE1A 3FAHA 4WIPA 3CWIA 3P4PB 4YTMB 5EE0A 4FXCA 5HI1A 4XWTA 1NVID 5H8YE 4ZHPA 1ENFA 2INPE 1AW7A 4DXFA 1L6VA 3TUOA 3KWVA 2DYMA 3V3XA 2DYOA 4OHJA 3AE4B 3J9CA 1SIJA 1QOFA 1PGBA 1QILA 1QOAA 3PZ8A 1KRHA 1HQRD 3AEFB 1N5WA 3C8YA 4RGTA 3PO0A 1C4AA 3ABVB 1UWMA 3MJ5A 4B0EA 5G5GA 2WXHA 1YMHE 2WXMA 2MJ3A 3Q69A 1C79A 2WXRA 3BYYB 2ON8A 3LXFA 3Q8FA 4A9AA 2V3NA 5BYSA 1FCCC 3ZGZA 1TS2A 1D5MC 1P7EA 1E6EB 5AUKA 5FKAC 1DOYA 2CJOA 1FNUA 4ZYSA 1NYQA 2J53A 1NI3A 3AE8B 3AE2B 2BS4B 5JXVA 3P42A 1K50A 3FILB 3ZJTA 2WXOA 1IBXA 2Y5CA 5EE3A 1GB1A 4O1NA 1JMLA 1FM0D 3R8BA 2WXGA 2BTEA 1JWUD 1L4DB 2WP9B 1CJEA 4GDKB 4LK0M 4US9A 2BBCA 4RF0A 3AEBB 2I2YA 2PW9A 4YSYB 1VR9A 1B1ZA 4OVZA 2WNMA 3DWGC 5TSSA 1SE2A 2QSDA 3AMZA 3HRDD 1JQ4A 1DGJA 4TMAB 4RFBA 1OQRA 2M0AA 3NS1A 1OQQA 1BXTA 2BT6A 2K0PA 2ICIA 2IGDA 1T6BX 3Q8AA 3W5UB 1D5XC 2SAKA 4JWSC 2RDHA 4RGOS 1J7CA 1FNVA 5HHDG 1UNSA 1CZPA 3ZQ4A 1K53A 4DQOC 4ZRPA 1GAQB 1BUIC 1NYRA 3B2GA 4RGNA 1L0XB 2EKIA 1VJKA 1SB3C 1I4XA 3LYYA 2KWDA 2KDMA 1C4CA 4EE2A 2ZW1A 1HA5A 5HG2A 1EWYC 2E6XA 3AN1A 4MACA 5LNK1 1ESFA 3W1SA 1RFKA 4H2AA 2JZPA 1P7FA 1K52A 2KAJA 2J42A 3PZ7A 2BB5A 4L2YA 4NAMA 3E56A 1SF0A 3MHZA 1MHXA 2WXLA 1AYFA 4LLGM 4L23A 3CIRB 3AB5A 2AQ3B 4A6QA 1E10A 5D3DA 4WAFA 3URYA 1KF6B 3P1MA 2JX5A 3MP9A 1PGXA 4Q2JA 1YJJA 1YN5A 5FK9C 4B0MA 1KLGD 4D2KA 3ZJVA 2LGIA 3NRZA 2NMQA 2Y3AA 3MFGA 1E7PB 3U4EG 1XLNA 1OFFA 4YXDB 5T8IA 4XDDA 1M4VA 3TSSA 1PFDA 1MVKA 4TQ0A 3KQ4A 1NENB 3MC0B 1QF6A 4HEA1 2BB6A 3SEBA 2DLBA 2KQ4X 3AE3B 1L6UA 1TYGB 2PIAA 1WGKA 2WDQB 3HVZA 3Q8BA 4WURA 5BMIA 1YQ4B 3VRBB 2ONQA 1E9MA 3B2FA 1IGCA 2WXPA 1XLOA 4OZAA 1QT9A 1UUPA 3T3OA 1D5ZC 1TS4A 1XCQL 1ZPSA 1T5XD 4WWMA 2IJ0A 1YQ3B 2W3RA 5H92C 1YJIA 4KKIA 1FIQA 2OHFA 1L4ZB 1Y56A 2WLBA 1Q10A 1TS3A 1WSPA 4PT5A 1F0ZA 2RMMA 2YEPB 1EM7A 1V1PA 2PVOD 3WCQA 3TEWA 2RDGA 2QEJC 2MEKA 3OWEB 3I9V1 2W82A 3AH7A 3SFEB 1EWCA 2ACZB 2W55A 1RM6C 3U52E 1FD6A 4HKZE 1EU3A 1DOIA 1VDVA 3AV8A 5BYQA 4C80A 3ZJUA 1VRAB 2LHDA 3R2TA 3BK2A 1FXIA 2BYTA 4NZLB 4XE0A 4TQ1A 4KGSA 2QJLA 1SJHD 3FC4A 5HFYA 1JROA 1STEA 2IGGA 2H88B 3LB8C 3BWUD 4RNAA 4IOIE 1TS5A 2DWQA 2WU5B 3AE7B 2EELA 3AE6B 4ARCA 1V8CA 5D7GA 4RGMA 3TEZA 3IT4B 1HZ5A 2GRIA 4JE3B 1FFUA 3AEDB 1HZ6A 5MPOA 1C4PA 4YT0B 3AECB 4KGTA 2K5PA 3L4PA 1YNTE 1I7HA 1MHHE 4LTUA 5EE9A 1ZXIA 1TKYA 1NEKB 2KN4A 3P4QB 3BK1A 1ROEA 2WXQA 2GI9A 2XNAC 4WH4A 1JW9D 2LHEA 1WXQA 2M56B 3AE9B 1DOXA 3H8HA 4ZOHC 2AX5A 1SBBB 3Q8CA 4IKGA 3ZYYX 3EA6A 1QOGA 2V3PA 4N58A 1JCKB 4ZRQA 1V1OA 2VZKB 3W5VB 2X38A 5GXGB 3SFDB 4OZBA 2MJEA 3ETRA 1XO3A 3AM9A 1I4QA 2V4IB 1KFYB 1XLQA 1IBXB 2BS3B 3R2IA 4TSSA 1I4RA 2I38A 2OEDA 2FUG1 2L1AA 2MH7A 4RF1A 4HRSA 1K51A 4KX6B 1HEZE 3RFZB 1SE3A 1TY0A 4A55A 4MH8A 2JXTA 1JALA 2K3UA 1I4HA 2E3TA 1VZ8A 3I57A 2LMCA 1WYGA 4YTNB 2CJNA 1I4GA 4AS1A 2PMVA 3B9JA 2G1EA 4XDCA 1YN4A 3VRAB 1FEHA 1SE4A 3W9CB 2XN9C 3N9YC 4HKQA 2WXKA 1IGDA 1L0YB 1FFVA 1MI0A 2LJIA 5G5HA 1ZDXA 3VQIA 2W54A 2L52A 2HTME 2FE8A 2WXFA 1IUEA 2JYTA 1EU4A 3NZ3A 5C3JB 2IPKD 4UDUC 5FR3A 3TEYA 1F2RI 4IDIA 4C7ZA 1F2RC 4C7YA 3P4RB 1ZOYB 1PYWD 4GDLB 2MJDA 1CK1A 2Q5WD 1L0VB 1PUTA 1B9RA 2N9LA 1XF5L 3BVMA 2HDEA 1VZ6A 3VR9B 1ZUD2 2D5GA 2WXNA 2WXIA 3GB1A 2TSSA 1MPEA 4OZCA 2Z8LA 2N0SB 2JWUA 4WQMA 4XWWA 4KGRA 5BMHA 4C56C 3Q8EA 2DBYA 1QKZA 3GS2A 3KWLA 4JWUC 1E0ZA 3IXSA 1XCTL 2AQ1B 5C2TB 2W3SA 2YEPF 2WDRB 2LFIA 2AQ2B 1GPXA 2NTSA 3BIID 3P63A 1JRPA 3IAM1 3UI3A 4ITKA 1J7AA 1GOZA 2B76B 1D6EC 3AE5B 3AEEB 4RCOA 2PKOA 1N5XA 3E9SA 5AUIA 1JWBD 1C78A 1ZDVA 4R3DA 3NVZA 1C9FA 2FBWB 1QQRA 4YTPB 3AEAB 1FRRA 1HXYD 1FMAD 2PVGC 4US8A 2H89B 2KMMA 1GB4A 2K9XA 5D3IB 1SJED 3O13A 3EUB2 4A90A 3NVVA 2IDYA 3BVGA 1SEBD 2M19A 2G9HD 3BZDB 1F77A 4N6EB 1FCLA 3SR6A 1KLUD 1LO5D 1ZP0B 4MM3B 2V0GA 1C77A 3BVZA 2J4XA 1WWTA 2PLPA 1YN3A 1PDXA 3U2SC 1JWMD 1V1PB 4YSXB 2L32A 4ARIA 4NJCA 2WQYB 2LEKA 4A8XC 1ET9A 5E6JA 1AN8A 1UWXA 1BMLC 1VLBA 1RYJA 1TZOA 3DWMA 4JPSA 1FRDA 1N61A 2JSVX 1JWAD 3GP7A 3IAS1 1RWSA 1T3QA 2BW2A 3NVYA 2PTLA 3TEXA 1TJEA 4CQNA 1L5PA 4YSZB 1TKGA 3KLSX 1AWDA 4JX1C 3T3NA 2ZW0A 1QOBA 2J52A 5BYRA 2RPVA 1N60A 2QIEB 4N59A 4DXGA 5I4DA 2JQRB 1N63A 4J3OD 1J7BA 3NVWA 1PGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDE A;  4A8X C;  4A6Q A;  4A90 A; 
#chains in the Genus database with same CATH topology
 5IOI A;  5C1Z A;  1SSN A;  3RPF C;  2RGF A;  3LJ3 A;  3ZLZ A;  2GB1 A;  5BMG A;  1FNW A;  3W2D A;  3AEG B;  4P16 A;  2MBO A;  1D4B A;  2N9K A;  3QJZ A;  2NTT A;  4WWO A;  2DAF A;  2C9W B;  2SEB D;  1GG3 A;  1E7U A;  4DHJ B;  2C60 A;  2JYE A;  3PRZ A;  4GU2 A;  2JUO A;  3WAM A;  1R7S A;  2JU6 X;  2DNF A;  2QMT A;  4GLS C;  3KVF B;  4HPM B;  4HRO A;  1ET6 A;  1QLB B;  3L0W B;  1FO4 A;  3HVD A;  1KH0 A;  3Q3M C;  5CHV C;  4WIP A;  5EE0 A;  1G6J A;  3DBH B;  4URK A;  2INP E;  4PS8 A;  3TUO A;  4OHJ A;  1PGB A;  3PZ8 A;  3QK0 A;  3SU8 X;  3C8Y A;  4F8C B;  2KC2 A;  1MG4 A;  3ABV B;  1UWM A;  1SIF A;  2NBV B;  1VD2 A;  1YMH E;  1Z5S B;  2MJ3 A;  1C79 A;  3ENE A;  2WXR A;  2ON8 A;  1S3S G;  2AEH A;  4P1C C;  3ZGZ A;  3N1Z C;  3UGB B;  2L05 A;  1P7E A;  2KWU B;  2LXA A;  2MP2 B;  1DOY A;  3WA0 A;  3AE8 B;  2O2V B;  4A3P A;  3P42 A;  3FIL B;  4M0W B;  4W9G A;  3R8B A;  2BTE A;  2WXG A;  2KWC A;  4ACF A;  2BBC A;  2MA9 B;  4RF0 A;  2NPT B;  2I2Y A;  3S2A A;  1UGM A;  2WNM A;  3DWG C;  1SE2 A;  4AWJ A;  1DGJ A;  2VH1 A;  1OQR A;  2MBH A;  4G3X B;  1OQQ A;  1BXT A;  2BT6 A;  2K0P A;  2ICI A;  1T6B X;  4MEL A;  1D5X C;  2SAK A;  1WGH A;  2RDH A;  3HM6 X;  5HHD G;  4HVB A;  1UNS A;  1K53 A;  4ZRP A;  1GAQ B;  3B0A A;  1NYR A;  4M00 A;  3EFU A;  1WMH B;  2WX1 A;  4GDL A;  1C4C A;  3UQA A;  1WR6 E;  2ZW1 A;  2E6X A;  2IO0 B;  1ESF A;  3W1S A;  4H2A A;  3AXC A;  3R66 C;  4RM9 A;  5J17 A;  4II3 B;  2J42 A;  2B3A A;  4L2Y A;  3E56 A;  3MHZ A;  1MHX A;  4LLG M;  4L23 A;  4A6Q A;  2GBR A;  2MWS B;  3URY A;  3P1M A;  4Q2J A;  3U30 A;  4OVV A;  3ZDM C;  1YD8 U;  4HCN B;  4BBN F;  2LAS A;  1KLG D;  3ZJV A;  4G0N B;  5JHA A;  4ANW A;  1E7P B;  3V62 A;  1XLN A;  1OFF A;  4AOF A;  4YXD B;  5AEK B;  3OJ4 B;  2C5L C;  3TSS A;  1QF6 A;  2ZCB A;  4KV2 A;  4F1S A;  4WUR A;  1YQ4 B;  2M4N A;  1E9M A;  4W9D A;  1WXA A;  3AUL A;  1IGC A;  3L54 A;  1HTQ A;  2WXP A;  3T3O A;  1UUP A;  2DAJ A;  3JSV A;  1EO6 A;  2KN5 A;  2FCN A;  2MQJ A;  4MSM B;  2W3R A;  4MM3 A;  2KK8 A;  2WLB A;  1Q10 A;  4DHJ D;  1YQB A;  4BKG A;  3OWE B;  3L10 B;  2KQS A;  2W82 A;  3AH7 A;  2ACZ B;  4DWF A;  1RM6 C;  3Q3J A;  1VDV A;  2FUH B;  4C80 A;  3ZJU A;  5CTR C;  1V5T A;  1TTN A;  2D07 B;  1JRO A;  5BO4 B;  4N9F 4;  2H88 B;  3BWU D;  3MC9 A;  2MHJ A;  1TZ1 A;  3AE7 B;  2IO2 B;  4ARC A;  3IT4 B;  4TUU A;  5FR6 A;  1FFU A;  3TBL D;  2JWZ A;  1HZ6 A;  3Q3F A;  1C4P A;  3DBL I;  4GB9 A;  4K3B A;  2GBN A;  1I7H A;  1MHH E;  5JHB A;  4LTU A;  5EE9 A;  2XNA C;  2KTF A;  5LXI B;  4IM2 A;  3AE9 B;  2KQ7 A;  3DBR B;  2AX5 A;  1WIA A;  3KUZ A;  4N58 A;  1E7V A;  3Q14 C;  2ZNV B;  2VZK B;  2X38 A;  3OLM D;  4FN2 A;  4OZB A;  3ETR A;  1TT5 B;  1V2Y A;  3X0W A;  4FJZ A;  3QCA A;  1I4Q A;  3ZRF A;  2X8X X;  4XYC A;  2BS3 B;  1WJU A;  4W9E A;  4HRS A;  1K51 A;  4KSK C;  1P9D U;  4KX6 B;  1SE3 A;  1I4H A;  1WX7 A;  1VZ8 A;  3RMK C;  2PPH A;  2CJN A;  2XK5 A;  4AS1 A;  4B9K A;  2PMV A;  4GSW A;  4B6W A;  4AP4 C;  2G1E A;  3ZXV A;  2LGY A;  2NBW B;  3VTV A;  3IVF A;  4HKQ A;  3N9Y C;  1MI0 A;  5TR5 A;  2WX0 A;  1FXT B;  2HTM E;  3EFC A;  4GMV A;  4TKN A;  2Z59 B;  5C3J B;  3NZ3 A;  4K3C A;  2L0F A;  1F2R I;  2MRP A;  2INC C;  4IDI A;  4C7Z A;  1F2R C;  2GBK A;  4GDL B;  1WYW B;  1S1Q B;  3VR9 B;  1WR1 A;  1MPE A;  2M8S A;  1HTO A;  2Z8L A;  2JWU A;  4XWW A;  5G55 A;  2KJR A;  3V6C B;  5BMH A;  4C56 C;  2KFK A;  3KWL A;  1XCT L;  2AQ1 B;  2LFI A;  4LJP B;  4K81 A;  4RMA A;  3IAM 1;  3UI3 A;  1GUA B;  2KFJ A;  2HJ8 A;  3RI7 C;  1D6E C;  3E9S A;  3OAW A;  4JIO U;  4R3D A;  3NVZ A;  2FBW B;  4YTP B;  4C4V A;  3AEA B;  4US8 A;  4KSL C;  2I1J A;  3DDC B;  2D3C A;  4PS3 A;  4DK5 A;  2XBB C;  3K9P B;  4WWP A;  3JSV B;  2OJW A;  3BZD B;  4N6E B;  4FJV B;  1KLU D;  4MM3 B;  4KIK B;  2JXX A;  2KZR A;  3U2S C;  2I1K A;  1JWM D;  1L2N A;  4YSX B;  3DPD A;  4A8X C;  5E6J A;  3VAW A;  1KM7 A;  2LVP A;  1YOV B;  3DWM A;  2K6Q A;  3IAS 1;  3ONS A;  5IO9 A;  1TJE A;  4CQN A;  4A3O A;  1AWD A;  2IO1 B;  3M63 B;  1H4R A;  1QOB A;  2J52 A;  3SD5 A;  5BYR A;  2QIE B;  1OTR B;  2EMS A;  5DPR A;  1PGA A;  2XEW A;  4MGI E;  1RLF A;  1TY2 A;  2L83 A;  3V6E B;  2Y5P A;  1YJ1 A;  3VHT C;  3WAL A;  4FUL A;  1F9J A;  3VR8 B;  2L8J A;  2IBI B;  1E8Z A;  1MFW A;  4USA A;  1R4N B;  2K22 A;  1XEE A;  1XQQ A;  4FHJ A;  1WRI A;  2BS2 B;  4L1B A;  1SE9 A;  1ZXH A;  3QX1 A;  4RH6 A;  2D10 A;  2N7J A;  2BYV E;  1GC7 A;  3ZTD A;  4XGA B;  2VZK D;  2ZCC A;  4WAA A;  1Q5W B;  2ZEQ A;  1VCB A;  2NVU I;  3FIL A;  1GC6 A;  2LUM A;  4KKJ A;  4M0W A;  1ISN A;  4LNN A;  1I4P A;  2IGH A;  3DHI C;  2DZI A;  3CWI A;  3NG0 A;  3P4P B;  4KZ0 A;  2G3Q B;  2MX2 A;  1NVI D;  4CYE A;  4ZHP A;  1ENF A;  3APC A;  2XK5 B;  4DXF A;  4NJ6 A;  4PS7 A;  3V3X A;  2CS4 A;  2JRH A;  3J9C A;  1QOF A;  1QOA A;  2C7N B;  1KRH A;  1QZE A;  4IWQ A;  1C4A A;  1T0R C;  5G5G A;  1E8X A;  3Q69 A;  1JRU A;  3BYY B;  1WX9 A;  3LXF A;  4KZC A;  4A9A A;  3I63 C;  5BYS A;  2W9N A;  2Z0D B;  1D5M C;  3DBS A;  2BF8 B;  2CJO A;  1NYQ A;  3RUL A;  4FLH A;  2N9X A;  1AAR A;  3QIJ A;  1GB1 A;  1JML A;  1FM0 D;  2KKC A;  1L4D B;  2KFK B;  2WP9 B;  3AEB B;  3VDZ A;  2PW9 A;  1VR9 A;  1B1Z A;  4OVZ A;  2QSD A;  1WZ0 A;  1RAX A;  2KDI A;  2LXC A;  3MC8 A;  4RGO S;  1FNV A;  4G50 A;  3Q2A C;  4K7S A;  4NY0 A;  1D3Z A;  4S17 A;  1VJK A;  1HA5 A;  2KMC A;  5HG2 A;  3DOW A;  4MAC A;  4W9J A;  5LNK 1;  2NBU A;  3ZRC A;  2GMI C;  4HDO A;  1Z2M A;  1P7F A;  2KAJ A;  3A9J A;  4MDK E;  2BB5 A;  4NAM A;  1SF0 A;  5LXH A;  2DZM A;  2N9E B;  1IP9 A;  3GE3 C;  3N32 A;  5D3D A;  4WAF A;  4RM8 A;  2JX5 A;  1YJJ A;  2Y5B B;  3VTW A;  3RNC C;  3ML9 A;  2NMQ A;  4AJW A;  2Y3A A;  2YVC A;  5T8I A;  2AYO B;  1M4V A;  3KQ4 A;  3PV1 A;  1UH6 A;  3SEB A;  2N1W A;  2PIA A;  4FHK A;  1WGK A;  2WDQ B;  3Q8B A;  4I6P A;  3T8M A;  3GZN B;  2ONQ A;  3VRB B;  4CO7 A;  1XLO A;  1QT9 A;  2ZVN A;  1TS4 A;  3ML8 A;  1ZPS A;  1T5X D;  4WWM A;  2QC8 A;  2HJ1 A;  1FIQ A;  2OHF A;  1V81 A;  1WM3 A;  2JRI B;  2RMM A;  4NNJ B;  1EM7 A;  1V1P A;  2PVO D;  2KVR A;  1UBI A;  3I9V 1;  3AU5 A;  3R7Q A;  4ICU A;  3H7P A;  2W55 A;  3HIZ A;  3L13 A;  2CR5 A;  3BIN A;  5BYQ A;  2FNJ B;  4X57 B;  2KJ6 A;  1VRA B;  1RRB A;  3L17 A;  3PGE A;  3R2T A;  4LNF A;  4XE0 A;  4TQ1 A;  1WM2 A;  3EHV A;  5HFY A;  1R4M B;  2K25 A;  2WHI A;  2D3B A;  1LM8 B;  4RNA A;  1TS5 A;  4W9H A;  2WU5 B;  3TJP A;  1WJ4 A;  2EEL A;  3DBH I;  2YLM A;  4HWI B;  4OVU A;  1HZ5 A;  2GRI A;  3P2B A;  4I6L B;  4KGT A;  1P98 A;  1YNT E;  2KVZ A;  1ZXI A;  1TKY A;  1NEK B;  3P4Q B;  2LZ6 A;  1ROE A;  1KOT A;  5JZE B;  4IWP A;  1JW9 D;  1WXQ A;  2M56 B;  4J6I A;  3JVZ X;  3H8H A;  1OEY J;  3Q8C A;  2HTH A;  3ZYY X;  3NZU A;  2NR2 A;  4WJN A;  2M0X A;  3RYT A;  2MJE A;  1XO3 A;  2KNB A;  2DX5 B;  2IY0 B;  3H7S A;  1KFY B;  1XLQ A;  1WXM A;  2L1A A;  2MH7 A;  4RF1 A;  2RR9 A;  3RNG C;  1TY0 A;  1E90 A;  4BKS A;  1JAL A;  4PYU A;  4YTN B;  1C1Y B;  4GGQ A;  3DVN V;  1IGD A;  2LRU A;  4LNI A;  2W54 A;  2L52 A;  3AU4 A;  2AWT A;  3ZTC A;  1TBE A;  5LLI A;  2JYT A;  5FR3 A;  3PSE B;  2CHX A;  1UZX B;  1RFA A;  5KHO A;  2IZV B;  2Q5W D;  2KJH B;  2N9L A;  2IND C;  1XF5 L;  4DBG A;  3A1Q B;  3A9J B;  2JF5 A;  2WXN A;  3VXW A;  4OZC A;  1I35 A;  4KIK A;  4KGR A;  3A33 B;  2BYE A;  5DPS A;  3UF8 A;  4GDK A;  5L95 C;  1E0Z A;  2JVC A;  4EEW A;  4BFR A;  2W3S A;  3U8Z A;  2KAN A;  3N1Y C;  2NTS A;  3BII D;  4XX5 A;  1JRP A;  1HE8 A;  1J19 A;  5JH5 C;  3AEE B;  2L7R A;  4GIV A;  2PKO A;  1OQY A;  4WJQ A;  3PHW B;  1TGZ B;  3AI5 A;  5IN7 A;  4K7W A;  5IKC M;  2H89 B;  2BPS A;  3TIX A;  5D3I B;  1SJE D;  5D94 A;  2RSU A;  1YX6 B;  3NVV A;  2IDY A;  3BVG A;  5DCN A;  2DZK A;  1WI0 A;  2DEN B;  2G9H D;  1F77 A;  3SR6 A;  1YIW A;  2V0G A;  3BVZ A;  2J4X A;  2KYW A;  1WWT A;  4PYZ A;  3ZNH B;  1PDX A;  1V1P B;  2L32 A;  4FAD A;  3UQB A;  3VTU A;  1K8R B;  1ET9 A;  4FBJ B;  3H7P B;  1H8C A;  1BML C;  1RYJ A;  2L00 B;  3CMM B;  3GP7 A;  1JWA D;  1T3Q A;  2BW2 A;  2PTL A;  4C00 A;  4YSZ B;  4LDT B;  2BVC A;  3T3N A;  1WGD A;  2QDF A;  4HPL B;  4N59 A;  4DXG A;  2JQR B;  4J3O D;  1J7B A;  3RNA C;  4IC7 B;  3A4R A;  3V05 A;  4P1B C;  3EGR A;  2KDB A;  4IW0 A;  4GXB A;  2R61 A;  2WS3 B;  1ZE3 D;  2CKH B;  2WDV B;  2RPQ A;  1F52 A;  4HJG E;  2BGF A;  3RUI B;  4MT5 A;  4HK2 A;  1ACC A;  1A70 A;  1MG8 A;  1N62 A;  2CU3 A;  1WH3 A;  1I42 A;  2D2Q A;  2KLG A;  4DDI D;  1DYQ A;  4OW0 A;  4MGZ E;  2WDT B;  4HJK A;  3TL5 A;  1VZ7 A;  2ZNV C;  2PJH A;  3H9D A;  4AQ7 A;  3NS8 A;  3HM3 A;  4WWN A;  4ZHO A;  4M8M A;  1V97 A;  2KXJ A;  1T0S C;  1ZKH A;  1JWS D;  1XXG A;  4P6V F;  2L0T A;  1SXT A;  2QIL A;  2WYQ A;  1C3T A;  1WF9 A;  2D3G A;  1KLV A;  1CMX B;  1CQV A;  4YWG G;  2NCN A;  3HK0 A;  3FAH A;  3SHQ A;  4HXD A;  5HI1 A;  5CX3 A;  1L6V A;  3KYD D;  4W9K A;  1V6E A;  4F7Z A;  4BOZ B;  3KWV A;  3AE4 B;  3DVG X;  2MSE D;  3U7D A;  1WXS A;  1J8C A;  3ZW3 A;  1N5W A;  4DDG D;  2WXH A;  3C0R B;  3VUW A;  1U4A A;  2WXM A;  1WY8 A;  3Q8F A;  3W1S C;  2FCQ A;  1TS2 A;  3QA8 A;  3KUD B;  1T0Q C;  1FNU A;  2J53 A;  1NI3 A;  2N1V A;  2BS4 B;  2J0M A;  5JXV A;  2BQQ A;  2WXO A;  1IBX A;  2Y5C A;  4ZYN A;  1JWU D;  1CJE A;  4GDK B;  4US9 A;  4BOS C;  1F1H A;  1NDD A;  4P7I A;  1GJZ A;  5TSS A;  3AMZ A;  3HRD D;  1JQ4 A;  3JW0 X;  4RFB A;  3NS1 A;  3TCA A;  4EFO A;  3NHE B;  2BKR B;  4LJO B;  4JWS C;  2DHZ A;  3D32 A;  1J7C A;  5AZG A;  1CZP A;  1BUI C;  1WX8 A;  3H1U A;  2AL6 A;  2J0K A;  1L0X B;  1NI2 A;  3LYY A;  1I4X A;  1LQB A;  2KWD A;  2LUE A;  2L76 A;  4EE2 A;  4EKU A;  1V80 A;  1RFK A;  4NJ7 A;  3ZNG C;  5IAA C;  2K6D B;  4HLE A;  4ZRI A;  2AQ3 B;  1E10 A;  3KYC D;  1OGW A;  2C7M B;  2LVQ A;  4B95 A;  2M1M A;  1KF6 B;  3MP9 A;  1PGX A;  4W9F A;  1YN5 A;  4A20 A;  2BWF A;  2D3A A;  4K1R B;  3IG3 A;  3ALB A;  2JY6 A;  3C19 A;  3U4E G;  5CHW A;  3M62 B;  2HE7 A;  1N6Z A;  1MVK A;  1NEN B;  4HPP A;  3MC0 B;  4ZRJ A;  4HEA 1;  2DLB A;  2KQ4 X;  3AE3 B;  3ZUN A;  1WE7 A;  2D11 A;  4NPN A;  5E6N A;  4MGY E;  1EF5 A;  4OZA A;  1D5Z C;  2LGS A;  1R4N I;  2KHW B;  2KDF B;  4QAY A;  1YJI A;  1Y56 A;  1TS3 A;  4BBN C;  2DZJ A;  3BY4 B;  3PS6 A;  3WCQ A;  2RDG A;  2QEJ C;  3TEW A;  3SFE B;  3I3T B;  4LCD E;  4BVU C;  1FD6 A;  2IO3 B;  2LD9 A;  3PVL A;  2LHD A;  1L7Y A;  1ZW7 A;  3BK2 A;  3Q3N C;  4IM3 A;  1SJH D;  3FC4 A;  4JQW C;  3WAP A;  1STE A;  3A4S C;  3A9K A;  3LB8 C;  2ASQ A;  2N9P C;  3VFK A;  4IOI E;  2DWQ A;  2PE6 B;  3PRE A;  5D7G A;  1WGR A;  3N20 C;  4RGM A;  4DHZ E;  3CST A;  4BKS D;  4JE3 B;  5L83 A;  3AED B;  5MPO A;  4YT0 B;  2EKE C;  3AEC B;  3DHH C;  2K5P A;  2A4Z A;  4AJY B;  2REX A;  2LGD A;  2WXQ A;  2GI9 A;  4WH4 A;  3ZVV A;  4MH0 E;  1DOX A;  4KDL B;  3ZXR A;  2LWP A;  1PQS A;  3X23 A;  3VH3 B;  2KC1 A;  2OOB B;  1QOG A;  2V3P A;  1JCK B;  3W5V B;  5GXG B;  3SFD B;  3MJW A;  4KVG B;  2FCS A;  4JLC A;  3A1Q A;  1J0G A;  3LDZ E;  1IBX B;  3R2I A;  1I4R A;  2OED A;  2FUG 1;  4E71 A;  4NAW A;  1V5O A;  4MH8 A;  2JXT A;  2K3U A;  3RZW C;  3IHP C;  3I5J C;  3NJT A;  3I57 A;  4KDI C;  3CSF A;  3B9J A;  1UBQ A;  3VUY A;  1BT0 A;  1YN4 A;  2LJ5 A;  1FEH A;  1SE4 A;  3W9C B;  5DPW A;  2WXK A;  3KUC B;  1FFV A;  2LJI A;  4W9C A;  4JGH B;  1ZDX A;  3VQI A;  2IYD B;  2FE8 A;  2O6V A;  4MJS B;  4XC2 A;  1IUE A;  1EU4 A;  4UDU C;  2JPH A;  3VH4 B;  4EZJ A;  2OJR A;  3TEY A;  4C7Y A;  1ZOY B;  4IWO A;  1PUT A;  2N7D A;  3IBE A;  2HDE A;  2GBJ A;  1VZ6 A;  1ZUD 2;  3NOB A;  4XZ4 A;  2N0S B;  4WQM A;  3Q8E A;  4TV3 A;  2DBY A;  4YL8 A;  3GS2 A;  4JWU C;  5E6O A;  3IXS A;  5C2T B;  4FJY A;  2WWZ A;  2YEP F;  4E3C A;  3PTF C;  3GOE A;  2AQ2 B;  1GPX A;  4E74 A;  1UD7 A;  1V9J A;  4ITK A;  2V1Y A;  2VRR B;  2MBQ A;  1GOZ A;  1E5W A;  3AE5 B;  4RCO A;  2KD0 A;  2GBM A;  2BKF A;  1UF0 A;  2MBE A;  5AUI A;  1JWB D;  1C78 A;  1ZDV A;  3GZN I;  1P3Q U;  3OJ3 A;  4K7U A;  1C9F A;  1FRR A;  1EF1 A;  4HCP B;  1XD3 B;  2GOW A;  2LVO A;  4ANV A;  2QHO A;  1T0Y A;  1ZP0 B;  3ZO5 B;  2PLP A;  1YN3 A;  4ARI A;  4IM0 A;  4NJC A;  2WQY B;  3H6N A;  1UWX A;  3R3M A;  2ZZP B;  3VVW B;  4I6N B;  4JPS A;  2V4L A;  1FRD A;  2RDB C;  1L5P A;  2UU7 A;  1TKG A;  1R4M I;  4W9L A;  3TMP B;  2MLB A;  2PE9 A;  1WFY A;  3DCG A;  4HDQ A;  1N60 A;  5I4D A;  1X1M A;  3KW5 B;  1N63 A;  1KJT A;  3A9K B;  2V9H A;  1UGJ A;  3NUH B;  1KTK A;  3L08 A;  3HUI A;  2KAC A;  3AE1 B;  4LNO A;  2CHZ A;  3W1Y A;  1C76 A;  2LI5 A;  2RD0 A;  3ZIM A;  2KDE B;  1FPY A;  3U7Z A;  3IT6 B;  1V49 A;  4M02 A;  3Q6B A;  3BYT B;  2WU2 B;  1FXA A;  3WIM A;  3B08 A;  3O65 B;  4REZ A;  1TKE A;  1XLP A;  2UYZ B;  5C23 A;  2WXJ A;  3ZNI D;  2G4S A;  3P4S B;  2MCN B;  3DQV A;  2K8B A;  2KTR A;  1M94 A;  2Z0E B;  3VUX A;  4CHK A;  1WE6 A;  3ECI A;  2GLS A;  5DPT A;  2G4D B;  1LXD A;  3EC8 A;  1Y8R C;  3DVN U;  2INN E;  1LGR A;  4ZDV A;  4NAW B;  1V86 A;  2A5U A;  5EE1 A;  4YTM B;  2HD5 B;  4FXC A;  4XWT A;  2WGS A;  5H8Y E;  1AW7 A;  1OEY A;  3ZDT A;  2DYM A;  3N30 A;  3RCZ A;  2DYO A;  2L3Z A;  3DBL B;  3T9L A;  3UIP B;  1SIJ A;  2FID A;  1QIL A;  1HQR D;  3AEF B;  3IFW B;  4EOY A;  4RGT A;  3PO0 A;  3QAQ A;  3KH0 A;  3MJ5 A;  2O6V B;  4B0E A;  4ANX A;  2PEA A;  4AUQ C;  4LNK A;  2V3N A;  1FCC C;  5KHQ A;  1E6E B;  5AUK A;  1EUV B;  3QQ8 B;  5FKA C;  4ZYS A;  3AE2 B;  3ZJT A;  1K50 A;  3PT2 B;  2EMT A;  5EE3 A;  5IP4 D;  4O1N A;  4BAX A;  2KWV B;  3PLV A;  4LK0 M;  2FIF A;  3MHS D;  4YSY B;  3UIO B;  3HHM A;  4TMA B;  2DYB A;  2M0A A;  1WZ3 A;  3APF A;  3Q8A A;  2IGD A;  1LFD A;  3DVG Y;  3W5U B;  3PRM B;  2ZPN A;  2J0J A;  2MW5 A;  3RNB C;  3ZQ4 A;  4DQO C;  3B2G A;  4RGN A;  2EKI A;  1SB3 C;  3RD2 A;  2KDM A;  3QAR A;  1EWY C;  3AN1 A;  2QCZ A;  1IYF A;  3NZS A;  2JZP A;  5G2N A;  1K52 A;  3PZ7 A;  3NY5 A;  2WXL A;  1AYF A;  3CIR B;  3DBR I;  3AB5 A;  4EZK A;  2N4F A;  4WQO B;  5FK9 C;  4B0M A;  4D2K A;  2LGI A;  3NRZ A;  5E6P A;  3N3K B;  4ASW C;  3MFG A;  4XDD A;  1PFD A;  2FCM A;  2AL3 A;  4TQ0 A;  2BB6 A;  2MBB B;  1L6U A;  1TYG B;  3HVZ A;  5BMI A;  2M17 A;  3B2F A;  5D6J B;  3ZNZ B;  1XCQ L;  2IJ0 A;  3RT3 B;  1YQ3 B;  3APD A;  3PPA A;  5H92 C;  4KKI A;  1L4Z B;  4PT5 A;  1F0Z A;  1WSP A;  1WJ6 A;  2YEP B;  3M95 A;  2MEK A;  1UEL A;  3B1L X;  1EWC A;  3U52 E;  4HKZ E;  2LGX A;  1EU3 A;  2R2Q A;  3GE8 C;  3L16 A;  1DOI A;  3AV8 A;  2KTR B;  2VH2 A;  1ZGU B;  1FXI A;  2BYT A;  4NZL B;  4MGK E;  4KGS A;  2QJL A;  4M8N A;  2J7Q B;  4WJO A;  1YX5 B;  2IGG A;  2BWE S;  2G45 B;  3AE6 B;  1V8C A;  3TEZ A;  4IUM B;  1WGG A;  4M01 A;  5J2R A;  5D2M B;  2N7E A;  1Q1O A;  3L4P A;  1NBF C;  2K1F A;  2KN4 A;  3BK1 A;  3RNE C;  5IA7 A;  2LHE A;  2O6V D;  4MJS A;  3ZKJ C;  4DHZ B;  3M3J A;  2KX3 A;  4ZOH C;  1SBB B;  4IKG A;  5EDS A;  1E8W A;  3EA6 A;  2KO3 A;  3PZD A;  1V1O A;  4ZRQ A;  1Q0W B;  1P1A A;  2KMA A;  3QWZ B;  3AM9 A;  5CHF A;  3V61 A;  1MJD A;  2V4I B;  4TSS A;  2I38 A;  3QC8 B;  4G11 A;  1HEZ E;  3RFZ B;  5GMV A;  3DHG C;  4A55 A;  2E3T A;  4II2 B;  2LMC A;  1WYG A;  3R7R A;  5AZF A;  1I4G A;  1WGY A;  4XDC A;  2JT4 B;  4LDT D;  3VRA B;  4EUT A;  2XN9 C;  4PK1 A;  5G5H A;  1L0Y B;  3RNF C;  3N1X C;  2NS5 A;  2KT7 A;  4GOC A;  2V3S A;  4BKT A;  3RZF A;  1E8Y A;  4EZL A;  4ANU A;  2WXF A;  1GNU A;  2IPK D;  1A5R A;  2JZ3 B;  3P4R B;  1PYW D;  2MJD A;  3PHX B;  2K8C A;  1CK1 A;  3Q3O C;  1L0V B;  3K9O B;  2BYF A;  1B9R A;  2ZJD A;  2MP2 A;  2K8H A;  3BVM A;  3PRP B;  2D5G A;  2O2V A;  2WXI A;  3GB1 A;  2TSS A;  4ICV A;  1WRD B;  2KLC A;  3EEC A;  5J18 A;  1QKZ A;  3WAO A;  2NPT A;  4BZA A;  2WDR B;  3P63 A;  4GN1 A;  4WJP A;  2CHW A;  1J7A A;  2B76 B;  4DXA B;  3FKY A;  5AZH A;  2IY1 B;  1WJN A;  1N5X A;  3QHT A;  2JZZ A;  2ZVO A;  1QQR A;  3SDL C;  4MSQ B;  1HXY D;  1FMA D;  2K39 A;  2PVG C;  2KMM A;  1GB4 A;  2K9X A;  2KOX A;  3O13 A;  4MEM A;  4FA6 A;  3EUB 2;  4A90 A;  1WMH A;  2FAZ A;  1SEB D;  3CF6 E;  2M19 A;  1FCL A;  3WAN A;  1LO5 D;  2KX0 A;  2LRW A;  4IG7 B;  3UIN B;  1IPG A;  1C77 A;  2UWQ A;  4NQL B;  4JL9 A;  3OG5 A;  4NQK E;  3JYU A;  2ZPY A;  4ZRK A;  1SGH A;  2LEK A;  1AN8 A;  1TIF A;  1VLB A;  1TZO A;  1XT9 B;  4S0R A;  1N61 A;  2JSV X;  2C7H A;  1RWS A;  3NVY A;  3TEX A;  3KLS X;  4JX1 C;  2ZW0 A;  3V60 A;  4W9I A;  1P0R A;  2RPV A;  2R2O A;  3PLU A;  5HKH A;  3RN9 C;  2CU1 A;  4C4V B;  3MTN B;  1WXV A;  3NVW A; 
#chains in the Genus database with same CATH homology
 1TY2 A;  1UGJ A;  3V05 A;  3NUH B;  2L83 A;  3EGR A;  1KTK A;  1SSN A;  3HUI A;  2Y5P A;  2KAC A;  3RPF C;  3AE1 B;  2GB1 A;  3VR8 B;  5BMG A;  2R61 A;  2WS3 B;  1ZE3 D;  1FNW A;  1C76 A;  2WDV B;  3W2D A;  3AEG B;  4HJG E;  4P16 A;  1D4B A;  4MT5 A;  2N9K A;  1ACC A;  4USA A;  1A70 A;  2NTT A;  2SEB D;  2K22 A;  1N62 A;  3U7Z A;  3IT6 B;  1XEE A;  2CU3 A;  1WRI A;  3BYT B;  2BS2 B;  2WU2 B;  1FXA A;  4L1B A;  1DYQ A;  1ZXH A;  4OW0 A;  4REZ A;  4RH6 A;  1TKE A;  1XLP A;  2JYE A;  2N7J A;  2WXJ A;  1VZ7 A;  3P4S B;  4AQ7 A;  4ZHO A;  2VZK D;  1V97 A;  1R7S A;  2JU6 X;  2QMT A;  1JWS D;  1XXG A;  4GLS C;  4P6V F;  4HRO A;  1ET6 A;  1QLB B;  1SXT A;  2QIL A;  1FO4 A;  3FIL A;  3HVD A;  2LUM A;  2INN E;  4KKJ A;  4M0W A;  1CQV A;  1KH0 A;  4YWG G;  4NAW B;  1I4P A;  2IGH A;  5EE1 A;  3FAH A;  4WIP A;  3CWI A;  3P4P B;  4YTM B;  5EE0 A;  4FXC A;  5HI1 A;  4XWT A;  1NVI D;  5H8Y E;  4ZHP A;  1ENF A;  2INP E;  1AW7 A;  4DXF A;  1L6V A;  3TUO A;  3KWV A;  2DYM A;  3V3X A;  2DYO A;  4OHJ A;  3AE4 B;  3J9C A;  1SIJ A;  1QOF A;  1PGB A;  1QIL A;  1QOA A;  3PZ8 A;  1KRH A;  1HQR D;  3AEF B;  1N5W A;  3C8Y A;  4RGT A;  3PO0 A;  1C4A A;  3ABV B;  1UWM A;  3MJ5 A;  4B0E A;  5G5G A;  2WXH A;  1YMH E;  2WXM A;  2MJ3 A;  3Q69 A;  1C79 A;  2WXR A;  3BYY B;  2ON8 A;  3LXF A;  3Q8F A;  4A9A A;  2V3N A;  5BYS A;  1FCC C;  3ZGZ A;  1TS2 A;  1D5M C;  1P7E A;  1E6E B;  5AUK A;  5FKA C;  1DOY A;  2CJO A;  1FNU A;  4ZYS A;  1NYQ A;  2J53 A;  1NI3 A;  3AE8 B;  3AE2 B;  2BS4 B;  5JXV A;  3P42 A;  1K50 A;  3FIL B;  3ZJT A;  2WXO A;  1IBX A;  2Y5C A;  5EE3 A;  1GB1 A;  4O1N A;  1JML A;  1FM0 D;  3R8B A;  2WXG A;  2BTE A;  1JWU D;  1L4D B;  2WP9 B;  1CJE A;  4GDK B;  4LK0 M;  4US9 A;  2BBC A;  4RF0 A;  3AEB B;  2I2Y A;  2PW9 A;  4YSY B;  1VR9 A;  1B1Z A;  4OVZ A;  2WNM A;  3DWG C;  5TSS A;  1SE2 A;  2QSD A;  3AMZ A;  3HRD D;  1JQ4 A;  1DGJ A;  4TMA B;  4RFB A;  1OQR A;  2M0A A;  3NS1 A;  1OQQ A;  1BXT A;  2BT6 A;  2K0P A;  2ICI A;  2IGD A;  1T6B X;  3Q8A A;  3W5U B;  1D5X C;  2SAK A;  4JWS C;  2RDH A;  4RGO S;  1J7C A;  1FNV A;  5HHD G;  1UNS A;  1CZP A;  3ZQ4 A;  1K53 A;  4DQO C;  4ZRP A;  1GAQ B;  1BUI C;  1NYR A;  3B2G A;  4RGN A;  1L0X B;  2EKI A;  1VJK A;  1SB3 C;  1I4X A;  3LYY A;  2KWD A;  2KDM A;  1C4C A;  4EE2 A;  2ZW1 A;  1HA5 A;  5HG2 A;  1EWY C;  2E6X A;  3AN1 A;  4MAC A;  5LNK 1;  1ESF A;  3W1S A;  1RFK A;  4H2A A;  2JZP A;  1P7F A;  1K52 A;  2KAJ A;  2J42 A;  3PZ7 A;  2BB5 A;  4L2Y A;  4NAM A;  3E56 A;  1SF0 A;  3MHZ A;  1MHX A;  2WXL A;  1AYF A;  4LLG M;  4L23 A;  3CIR B;  3AB5 A;  2AQ3 B;  4A6Q A;  1E10 A;  5D3D A;  4WAF A;  3URY A;  1KF6 B;  3P1M A;  2JX5 A;  3MP9 A;  1PGX A;  4Q2J A;  1YJJ A;  1YN5 A;  5FK9 C;  4B0M A;  1KLG D;  4D2K A;  3ZJV A;  2LGI A;  3NRZ A;  2NMQ A;  2Y3A A;  3MFG A;  1E7P B;  3U4E G;  1XLN A;  1OFF A;  4YXD B;  5T8I A;  4XDD A;  1M4V A;  3TSS A;  1PFD A;  1MVK A;  4TQ0 A;  3KQ4 A;  1NEN B;  3MC0 B;  1QF6 A;  4HEA 1;  2BB6 A;  3SEB A;  2DLB A;  2KQ4 X;  3AE3 B;  1L6U A;  1TYG B;  2PIA A;  1WGK A;  2WDQ B;  3HVZ A;  3Q8B A;  4WUR A;  5BMI A;  1YQ4 B;  3VRB B;  2ONQ A;  1E9M A;  3B2F A;  1IGC A;  2WXP A;  1XLO A;  4OZA A;  1QT9 A;  1UUP A;  3T3O A;  1D5Z C;  1TS4 A;  1XCQ L;  1ZPS A;  1T5X D;  4WWM A;  2IJ0 A;  1YQ3 B;  2W3R A;  5H92 C;  1YJI A;  4KKI A;  1FIQ A;  2OHF A;  1L4Z B;  1Y56 A;  2WLB A;  1Q10 A;  1TS3 A;  1WSP A;  4PT5 A;  1F0Z A;  2RMM A;  2YEP B;  1EM7 A;  1V1P A;  2PVO D;  3WCQ A;  3TEW A;  2RDG A;  2QEJ C;  2MEK A;  3OWE B;  3I9V 1;  2W82 A;  3AH7 A;  3SFE B;  1EWC A;  2ACZ B;  2W55 A;  1RM6 C;  3U52 E;  1FD6 A;  4HKZ E;  1EU3 A;  1DOI A;  1VDV A;  3AV8 A;  5BYQ A;  4C80 A;  3ZJU A;  1VRA B;  2LHD A;  3R2T A;  3BK2 A;  1FXI A;  2BYT A;  4NZL B;  4XE0 A;  4TQ1 A;  4KGS A;  2QJL A;  1SJH D;  3FC4 A;  5HFY A;  1JRO A;  1STE A;  2IGG A;  2H88 B;  3LB8 C;  3BWU D;  4RNA A;  4IOI E;  1TS5 A;  2DWQ A;  2WU5 B;  3AE7 B;  2EEL A;  3AE6 B;  4ARC A;  1V8C A;  5D7G A;  4RGM A;  3TEZ A;  3IT4 B;  1HZ5 A;  2GRI A;  4JE3 B;  1FFU A;  3AED B;  1HZ6 A;  5MPO A;  1C4P A;  4YT0 B;  3AEC B;  4KGT A;  2K5P A;  3L4P A;  1YNT E;  1I7H A;  1MHH E;  4LTU A;  5EE9 A;  1ZXI A;  1TKY A;  1NEK B;  2KN4 A;  3P4Q B;  3BK1 A;  1ROE A;  2WXQ A;  2GI9 A;  2XNA C;  4WH4 A;  1JW9 D;  2LHE A;  1WXQ A;  2M56 B;  3AE9 B;  1DOX A;  3H8H A;  4ZOH C;  2AX5 A;  1SBB B;  3Q8C A;  4IKG A;  3ZYY X;  3EA6 A;  1QOG A;  2V3P A;  4N58 A;  1JCK B;  4ZRQ A;  1V1O A;  2VZK B;  3W5V B;  2X38 A;  5GXG B;  3SFD B;  4OZB A;  2MJE A;  3ETR A;  1XO3 A;  3AM9 A;  1I4Q A;  2V4I B;  1KFY B;  1XLQ A;  1IBX B;  2BS3 B;  3R2I A;  4TSS A;  1I4R A;  2I38 A;  2OED A;  2FUG 1;  2L1A A;  2MH7 A;  4RF1 A;  4HRS A;  1K51 A;  4KX6 B;  1HEZ E;  3RFZ B;  1SE3 A;  1TY0 A;  4A55 A;  4MH8 A;  2JXT A;  1JAL A;  2K3U A;  1I4H A;  2E3T A;  1VZ8 A;  3I57 A;  2LMC A;  1WYG A;  4YTN B;  2CJN A;  1I4G A;  4AS1 A;  2PMV A;  3B9J A;  2G1E A;  4XDC A;  1YN4 A;  3VRA B;  1FEH A;  1SE4 A;  3W9C B;  2XN9 C;  3N9Y C;  4HKQ A;  2WXK A;  1IGD A;  1L0Y B;  1FFV A;  1MI0 A;  2LJI A;  5G5H A;  1ZDX A;  3VQI A;  2W54 A;  2L52 A;  2HTM E;  2FE8 A;  2WXF A;  1IUE A;  2JYT A;  1EU4 A;  3NZ3 A;  5C3J B;  2IPK D;  4UDU C;  5FR3 A;  3TEY A;  1F2R I;  4IDI A;  4C7Z A;  1F2R C;  4C7Y A;  3P4R B;  1ZOY B;  1PYW D;  4GDL B;  2MJD A;  1CK1 A;  2Q5W D;  1L0V B;  1PUT A;  1B9R A;  2N9L A;  1XF5 L;  3BVM A;  2HDE A;  1VZ6 A;  3VR9 B;  1ZUD 2;  2D5G A;  2WXN A;  2WXI A;  3GB1 A;  2TSS A;  1MPE A;  4OZC A;  2Z8L A;  2N0S B;  2JWU A;  4WQM A;  4XWW A;  4KGR A;  5BMH A;  4C56 C;  3Q8E A;  2DBY A;  1QKZ A;  3GS2 A;  3KWL A;  4JWU C;  1E0Z A;  3IXS A;  1XCT L;  2AQ1 B;  5C2T B;  2W3S A;  2YEP F;  2WDR B;  2LFI A;  2AQ2 B;  1GPX A;  2NTS A;  3BII D;  3P63 A;  1JRP A;  3IAM 1;  3UI3 A;  4ITK A;  1J7A A;  1GOZ A;  2B76 B;  1D6E C;  3AE5 B;  3AEE B;  4RCO A;  2PKO A;  1N5X A;  3E9S A;  5AUI A;  1JWB D;  1C78 A;  1ZDV A;  4R3D A;  3NVZ A;  1C9F A;  2FBW B;  1QQR A;  4YTP B;  3AEA B;  1FRR A;  1HXY D;  1FMA D;  2PVG C;  4US8 A;  2H89 B;  2KMM A;  1GB4 A;  2K9X A;  5D3I B;  1SJE D;  3O13 A;  3EUB 2;  4A90 A;  3NVV A;  2IDY A;  3BVG A;  1SEB D;  2M19 A;  2G9H D;  3BZD B;  1F77 A;  4N6E B;  1FCL A;  3SR6 A;  1KLU D;  1LO5 D;  1ZP0 B;  4MM3 B;  2V0G A;  1C77 A;  3BVZ A;  2J4X A;  1WWT A;  2PLP A;  1YN3 A;  1PDX A;  3U2S C;  1JWM D;  1V1P B;  4YSX B;  2L32 A;  4ARI A;  4NJC A;  2WQY B;  2LEK A;  4A8X C;  1ET9 A;  5E6J A;  1AN8 A;  1UWX A;  1BML C;  1VLB A;  1RYJ A;  1TZO A;  3DWM A;  4JPS A;  1FRD A;  1N61 A;  2JSV X;  1JWA D;  3GP7 A;  3IAS 1;  1RWS A;  1T3Q A;  2BW2 A;  3NVY A;  2PTL A;  3TEX A;  1TJE A;  4CQN A;  1L5P A;  4YSZ B;  1TKG A;  3KLS X;  1AWD A;  4JX1 C;  3T3N A;  2ZW0 A;  1QOB A;  2J52 A;  5BYR A;  2RPV A;  1N60 A;  2QIE B;  4N59 A;  4DXG A;  5I4D A;  2JQR B;  1N63 A;  4J3O D;  1J7B A;  3NVW A;  1PGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...