2HDEA

Solution structure of human sap18
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
148
structure length
148
Chain Sequence
GSHMRVTQEEIKKEPEKPIDREKTSPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone deacetylase complex subunit SAP18
publication title Structure of SAP18: a ubiquitin fold in histone deacetylase complex assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 17
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06487 SAP18 Sin3 associated polypeptide p18 (SAP18)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.550 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2hdeA01
4A6QA 4A90A 2HDEA 4A8XC
chains in the Genus database with same CATH superfamily
3Q3OC 2RMMA 2C7MB 1RYJA 2WXLA 4PS3A 4W9JA 2JRHA 3AEFB 4WJQA 4GB9A 4JLCA 2CHXA 5HHDG 2AL3A 3Q8FA 2MW5A 1SB3C 2WDQB 1ZXIA 2N4FA 1WSPA 4PK1A 4MEMA 3SEBA 4EZKA 4M00A 2HDEA 3A9JB 4P6VF 3RFZB 2MBBB 4K7WA 4GIVA 3A1QB 1RWSA 1LGRA 3U52E 2LVPA 4B6WA 1MI0A 2DAFA 1EU3A 5EDSA 2WNMA 3AE5B 1UGJA 3U7ZA 4TV3A 2GB1A 4MM3B 5J2RA 2K9XA 1P3QU 1WIAA 2Z59B 3QWZB 2DBYA 3A33B 4K7UA 4NJ6A 2UYZB 1P1AA 2LXAA 3NRZA 1K52A 2PE6B 4HDQA 1SIJA 5IA7A 5JXVA 5JZEB 2Q5WD 2JYEA 1C3TA 1P7FA 2D3CA 3AE4B 3N20C 3NZSA 1WXVA 2QILA 4KDLB 4LDTB 4R3DA 2LEKA 1IBXB 5AUKA 1FRRA 2KACA 3N1YC 4IM2A 4OZAA 4BOZB 1YQ3B 5GMVA 4YSZB 1NVID 1ZW7A 2WXKA 2KXJA 4KX6B 4H2AA 3MJ5A 3RZFA 5EE0A 1A70A 5E6JA 2OJRA 4KGTA 1QOBA 1TS4A 1I4PA 3R2TA 1PYWD 4JWSC 3PZ8A 3AEEB 4WWMA 2LMCA 2WDRB 1KRHA 3OAWA 4LNKA 3OG5A 4ANWA 4JGHB 2PLPA 2LJ5A 3ZJTA 3APCA 2KAJA 2KKCA 3N1XC 1WGYA 1C79A 1YJJA 2OOBB 2PE9A 5C3JB 2ZEQA 2WX0A 5LLIA 3JYUA 4HKQA 1GAQB 3P42A 1UUPA 3L10B 3Q14C 4HDOA 3KH0A 1SXTA 4NPNA 1M94A 2LGDA 5CTRC 5FR6A 2N1VA 1TTNA 2LWPA 2MWSB 3H7SA 3AH7A 1GNUA 1L0VB 4MT5A 1V8CA 5LXHA 1D3ZA 1WZ0A 1CZPA 2KMCA 1VZ7A 3JSVA 1KLGD 4ARIA 1STEA 4LK0M 1TS5A 3BYYB 3Q8EA 1A5RA 1H4RA 1V9JA 2ZJDA 1C78A 2MLBA 5AZGA 2X38A 3P4QB 3ML8A 4IWOA 2KTRA 1UWMA 4FBJB 4K7SA 4ICUA 3VDZA 1C4AA 4E3CA 2JF5A 3NHEB 5FKAC 1L0YB 5BMGA 1XLPA 3PHXB 2PEAA 1KLUD 2JWZA 1RLFA 1ZDVA 4HJGE 1F77A 1L6VA 2KWCA 3ZIMA 3A9JA 1IGCA 1PGXA 1I4XA 3FILB 1HQRD 4YTPB 2KVZA 1NYQA 3A1QA 3IT6B 4ICVA 3AECB 2RDGA 4XDDA 4XX5A 2EKEC 1LXDA 5H8YE 3H8HA 2L0TA 2D3AA 4AJYB 4GU2A 4FHKA 3DBLI 3AMZA 1E8WA 3AE3B 3HUIA 2WP9B 2BPSA 3VR8B 5DPSA 1PQSA 2G1EA 1EU4A 1MHXA 2G4DB 2TSSA 3RD2A 3BK2A 3EECA 1OFFA 1V6EA 2SEBD 1BT0A 5AEKB 4REZA 4GLSC 2REXA 1YX6B 3BVMA 2BYEA 4ANXA 4C56C 4EEWA 1ZGUB 1E8ZA 1JRUA 4FN2A 4IUMB 3QJZA 1OEYJ 4EUTA 2QJLA 3OJ3A 2G3QB 2BWES 2NBVB 3AE7B 2NBWB 4MGZE 2RPVA 3L08A 1T0RC 1L4ZB 1IYFA 4CO7A 4PT5A 4RGNA 4NAWB 2XK5B 3N32A 3D32A 2AQ1B 3FAHA 3TCAA 3TEXA 2WXQA 4NNJB 1TJEA 3GZNI 1WJ4A 3DBSA 1KF6B 3Q8CA 2NS5A 3RULA 1TS2A 1RFAA 4A6QA 4K3CA 2QMTA 1I35A 2WWZA 2KWUB 3VTWA 2CHZA 3TSSA 3UIPB 4ITKA 1OQYA 2UU7A 3H9DA 5G2NA 3AE8B 1D6EC 2JQRB 3APFA 4OZBA 2BS2B 1IP9A 3ZYYX 3ZTDA 4TQ1A 2LZ6A 4C4VB 4XC2A 1WR6E 1QKZA 2XBBC 1WGDA 4HRSA 1TKEA 2XEWA 2L00B 3ETRA 2IGHA 1D5XC 2LGXA 2DZIA 4FHJA 1J19A 2MBHA 2MQJA 2FBWB 1F1HA 2KK8A 4EZLA 4C7YA 3WANA 5G5HA 3C19A 1GG3A 1HA5A 2WHIA 4A90A 3QHTA 4I6PA 2K39A 3SFEB 1FFVA 4F8CB 2KT7A 4PS7A 2CU3A 3EGRA 1ZP0B 4FJZA 1OTRB 1JWBD 3DBLB 2LGYA 4O1NA 5EE1A 4KV2A 5IAAC 2O2VA 3KLSX 2LUMA 3QCAA 4DXGA 2K8BA 2KDFB 2FCNA 3DVNV 4II3B 5DPWA 1XLQA 2C9WB 1X1MA 3UGBB 4IKGA 1N63A 2VZKB 3A4RA 1I4RA 2BGFA 1Q0WB 2ASQA 1HE8A 1FMAD 2MHJA 3HVDA 1I42A 2CJNA 3IAM1 3WAOA 3JW0X 2O6VD 3GB1A 4EZJA 1WXQA 2SAKA 3RNFC 2AWTA 1YN4A 3MC9A 2AQ2B 3AU4A 3V60A 3VXWA 2WDVB 3B1LX 4EE2A 2ZNVB 5C23A 4ZOHC 1UH6A 4C00A 4KGSA 1TS3A 3QARA 2GOWA 4ZRPA 1MJDA 1E5WA 1WMHA 4IW0A 5AZHA 1QOGA 2JU6X 2KD0A 2IYDB 5D94A 3GZNB 3VQIA 4LJOB 3SU8X 3BINA 3BK1A 2KX3A 3MTNB 2D10A 2BS4B 4I6LB 1I4GA 4C80A 4AUQC 2MA9B 1QQRA 5CHWA 3PLUA 4J6IA 2G4SA 2NBUA 3NS1A 2WXOA 1JALA 5CHVC 4RNAA 4AOFA 2Y5CA 2Z0EB 4GDLA 1J7BA 3V3XA 3N30A 4HK2A 3MC8A 4CHKA 4NAMA 3PHWB 1Z5SB 1MHHE 2L3ZA 1AWDA 1NI2A 1XD3B 3PRZA 3VTUA 4UDUC 1D5MC 2X8XX 4W9GA 1SIFA 3EHVA 1WM3A 4ANVA 1FIQA 3ZJUA 2GBRA 1LO5D 1RRBA 2JSVX 4RH6A 4P7IA 3TMPB 1BMLC 1TKGA 1F0ZA 1NDDA 3RN9C 3AU5A 1L6UA 1YJIA 3N1ZC 2L1AA 2PKOA 3VH4B 3R3MA 4KGRA 1WX7A 1FCLA 1VLBA 3HHMA 5D6JB 2QDFA 3UQAA 2D11A 2GBMA 3L13A 1WRDB 1T0YA 2RR9A 2WXIA 3RNCC 4C4VA 2YVCA 2JX5A 5HFYA 3BWUD 2N7DA 5L83A 3VUWA 2NCNA 2HD5B 3PVLA 1GB4A 3W1SA 2ACZB 3W5UB 3RI7C 2KHWB 2PPHA 3JSVB 4Q2JA 3AE9B 4FLHA 5DPTA 2MX2A 1Q5WB 1SBBB 1V81A 3AXCA 2K8CA 4N58A 4W9LA 1GOZA 2BS3B 4DK5A 1L7YA 3DHGC 3C8YA 2KTRB 2KFKA 2KWDA 2J0KA 4AWJA 1Y8RC 1DOXA 3B9JA 1G6JA 3CF6E 1NBFC 4KZ0A 5JHBA 2JXTA 3Q6BA 3RNGC 4BBNF 4HROA 3DPDA 3H7PA 1MVKA 1SJED 1FXIA 1C4PA 3B2GA 2XNAC 4IM0A 4IM3A 2KX0A 4GMVA 5IO9A 2C60A 2WXRA 3AEDB 1ZUD2 1YJ1A 3QK0A 5E6PA 3CMMB 1CMXB 2GLSA 1WF9A 3WAMA 5G5GA 2W9NA 1N6ZA 4FULA 2JT4B 3QQ8B 1XLNA 3Q3FA 1SF0A 1BUIC 2WXNA 4DHJB 4JX1C 3V61A 2C7HA 4NJCA 4XE0A 3I3TB 4K1RB 4WQMA 1ZDXA 1IGDA 2QCZA 2ZW1A 1VD2A 1WJNA 2E3TA 4LJPB 1QLBB 1WZ3A 1WXSA 2BQQA 4BAXA 4HPMB 2AEHA 1E10A 3VRBB 2K1FA 3PRPB 4XWWA 2I2YA 2KQ7A 4NY0A 1QOFA 4RGOS 2JY6A 3RNEC 4YWGG 3BVGA 3GE8C 3FC4A 2DZKA 2A5UA 4US8A 2BVCA 4HWIB 2GMIC 3ENEA 1UWXA 4HXDA 2QHOA 3RMKC 2KDMA 1Z2MA 1QT9A 4M0WA 1TZ1A 2BKRB 2IBIB 1MG8A 1FNVA 2MJEA 3TBLD 3DHHC 3KYDD 2WXFA 2J53A 2JWUA 3ZXVA 4B9KA 1VZ8A 5H92C 2CR5A 2ZPYA 2NTTA 2JZ3B 1Y56A 1QOAA 4ZYSA 1OEYA 3S2AA 1C4CA 4II2B 5FK9C 1YOVB 4ZRJA 1HEZE 4IOIE 3GS2A 2ZW0A 3KQ4A 2LXCA 3KWLA 2KDIA 2K6DB 1S3SG 1PUTA 1XT9B 2LJIA 1GPXA 1JMLA 4L23A 4BVUC 2MJDA 4RF1A 2YEPF 1FFUA 3UINB 2R2OA 4YTMB 3TEZA 3U8ZA 1ESFA 1WI0A 2IY1B 4M02A 1MG4A 1WGRA 2K0PA 3ABVB 3BZDB 3W2DA 3ZDTA 2D2QA 1RAXA 3DWMA 2ZNVC 1UNSA 3LXFA 3VUYA 2L8JA 2IJ0A 4GGQA 3ALBA 1K51A 2CU1A 3VRAB 1F2RI 5AUIA 3ZLZA 3SD5A 1SE2A 4TSSA 4F1SA 4G0NB 3VFKA 2LVOA 2N9PC 2D07B 2MCNB 3P2BA 2CKHB 2BYVE 2WXJA 2MRPA 2O2VB 2AL6A 3RYTA 3ZNID 1ET6A 1V97A 2KFJA 4LNOA 4ANUA 2IO3B 2PIAA 2JZPA 2KZRA 3NS8A 5L95C 2DX5B 4PS8A 3PS6A 3DVGX 2BWFA 2AYOB 1I4HA 2N7JA 1DYQA 4BKSD 3AEAB 3ZNHB 3NJTA 2LD9A 3IFWB 4E74A 1JWMD 3M62B 4A9AA 5CHFA 1JQ4A 4G50A 3U7DA 5AZFA 4PYZA 2LGSA 1E90A 1XXGA 1R7SA 2G9HD 1E8XA 1JRPA 1TY2A 1WMHB 4KIKA 5JH5C 2R61A 3MFGA 1C77A 2L76A 3IAS1 2JVCA 1I4QA 3AULA 2KDEB 3L17A 2KMAA 2FCQA 2Y5BB 4EKUA 2L52A 1KOTA 4GDLB 1XLOA 3AB5A 4MSQB 2V3PA 4DQOC 2DYOA 2INNE 2Y3AA 1OGWA 3VTVA 2RSUA 1WWTA 2RDBC 3T9LA 3VVWB 3X0WA 3DHIC 3I57A 4MH0E 3APDA 2LHEA 4G3XB 2MBOA 1F52A 4OVZA 3EFUA 1I7HA 3UF8A 3URYA 2WXHA 3IT4B 4MH8A 1R4NI 2VH2A 3IVFA 3PPAA 2K8HA 3WAPA 1FNUA 1Q1OA 1HZ6A 3NVWA 3W9CB 4ARCA 2AQ3B 3DBHB 4MSMB 2CS4A 3VH3B 3H1UA 4NJ7A 4HVBA 4JL9A 4HLEA 4B0EA 5BYQA 2FAZA 4US9A 3RCZA 1YN3A 3PGEA 2NVUI 3M63B 4LDTD 3P1MA 3PRMB 1N62A 3M3JA 4S17A 2JZZA 3ZRFA 4BKTA 2WX1A 3Q3NC 2L32A 3KUCB 3ZKJC 4OVUA 1GC7A 5DCNA 1L2NA 3PV1A 3IXSA 3NZ3A 2IO1B 2KJRA 4WAFA 4FXCA 1EUVB 1S1QB 5HKHA 2M8SA 4W9KA 4WJNA 4WJPA 1E7VA 4PYUA 3EA6A 3NOBA 1TY0A 1QZEA 4GOCA 1SEBD 4C7ZA 2WXMA 2L7RA 2M4NA 3ZDMC 1HXYD 1XF5L 1KTKA 2O6VA 4B95A 1TBEA 2N1WA 1LM8B 1VJKA 3GP7A 2KFKB 5IOIA 2H89B 4RMAA 3VHTC 1GB1A 1FXAA 3Q3JA 2FUG1 3H7PB 3P4RB 4YXDB 3V05A 1J0GA 4X57B 4LNNA 2Y5PA 4W9FA 2LUEA 5D7GA 1DGJA 1LFDA 2HJ8A 2HJ1A 1Q10A 4YTNB 2K22A 1FO4A 4J3OD 4OZCA 4EOYA 2W3RA 5C1ZA 1TT5B 3Q69A 1P7EA 4M8MA 3P63A 2DZJA 4GDKA 3JVZX 1CQVA 2VRRB 3CSTA 4ZYNA 5BYSA 5KHOA 4KKJA 4OHJA 1AN8A 3DQVA 2DENB 1T6BX 1WY8A 1R4NB 3TIXA 5J17A 2BB6A 4L1BA 1IPGA 3J9CA 4MGKE 5EE9A 3ZXRA 3MC0B 3BYTB 4KSKC 3WALA 1IUEA 4E71A 4IDIA 2C5LC 2WYQA 3DOWA 2OEDA 1WGKA 1B9RA 1KFYB 2IO2B 4WURA 2YEPB 4YSXB 2PJHA 2JRIB 4YL8A 1EWCA 1WXMA 1WRIA 2V0GA 3HRDD 5I4DA 4MDKE 1JWAD 2V4LA 3E56A 2J7QB 4M0WB 3HVZA 5BMHA 4XZ4A 1T0SC 3BY4B 1E7PB 3PREA 3ZW3A 1N5XA 4TKNA 3IG3A 1SE9A 1RM6C 1JROA 2VH1A 4YT0B 2UWQA 4ZHOA 1N60A 1AARA 4AP4C 4M01A 1FXTB 2EMTA 2JXXA 2WQYB 1EWYC 2D3BA 2IZVB 1V49A 3GE3C 1WJ6A 4RM8A 1ZOYB 3I5JC 3HM3A 5HG2A 2N9LA 2J0JA 4M8NA 2BW2A 2IO0B 4JQWC 1OQQA 2INCC 2C7NB 4KZCA 2XN9C 4W9CA 3I9V1 1GC6A 2WXGA 5JHAA 2MH7A 1R4MI 1DOIA 3O13A 1E0ZA 3IHPC 3ML9A 1GJZA 4K3BA 5IP4D 2V4IB 4LNIA 2GBKA 2KN4A 2N9XA 2OJWA 4BZAA 2BKFA 4AJWA 4GXBA 5EE3A 3ZTCA 2ZPNA 1KJTA 2DYMA 2KWVB 3LB8C 5BYRA 3HIZA 2J4XA 1UGMA 1V1PA 4MJSA 1WJUA 1WM2A 2B3AA 3P4SB 4FJYA 1LQBA 2V3NA 1WFYA 2HE7A 4TMAB 1GUAB 4IG7B 1XEEA 1WE7A 3Q8BA 3I63C 1D4BA 2Z8LA 1T3QA 3DWGC 3AM9A 2MP2B 3B0AA 2DNFA 2FIDA 2MEKA 1TKYA 3KW5B 3SR6A 4EFOA 1ROEA 1KH0A 4AS1A 4CYEA 3ZUNA 1V1OA 1DOYA 3ZQ4A 4WWNA 4BFRA 3L4PA 5LNK1 2KO3A 4N9F4 4RF0A 1N61A 2ZVNA 4WWOA 3EUB2 3R7QA 2BBCA 2BF8B 1V80A 2CJOA 4P1CC 4LLGM 1ZE3D 3KVFB 1N5WA 3HK0A 2FNJB 5D2MB 1SJHD 2K3UA 2JYTA 1YX5B 3UQBA 4I6NB 4KIKB 1K8RB 2DLBA 2PW9A 3RPFC 1WYWB 4TQ0A 5G55A 1P0RA 3DVNU 2N9KA 1F2RC 4XDCA 4BBNC 2Z0DB 1NI3A 2PTLA 1WH3A 3ECIA 2FIFA 2RPQA 3NVYA 2ICIA 3N3KB 5CX3A 3R2IA 2DZMA 1UBIA 4IC7B 2VZKD 3CSFA 1HTQA 1C1YB 4DHZB 4FA6A 2INPE 4RCOA 2V1YA 1ZXHA 1YD8U 3W1SC 4HEA1 4KVGB 1YMHE 2MJ3A 2GRIA 4KSLC 3AN1A 1R4MB 3NVVA 2NTSA 2KVRA 4WJOA 5FR3A 1T0QC 1E6EB 4OW0A 2DHZA 3KYCD 1FNWA 3RZWC 2DYBA 3FKYA 5TR5A 2M56B 3Q3MC 4HCNB 4P1BC 4ZDVA 4JIOU 2KQ4X 2I1JA 4WIPA 3RUIB 3AE2B 4IWQA 2NPTB 3WA0A 3T8MA 3A9KB 1YQBA 2W3SA 3PLVA 2EMSA 1MFWA 1OQRA 4KKIA 3MP9A 2WS3B 2AX5A 4WAAA 3X23A 1PFDA 2G45B 1MPEA 3T3NA 2D5GA 1FCCC 4HCPB 3V6CB 1EF1A 1VDVA 2LRWA 3AEGB 4ZRQA 4HPLB 3DBHI 4RM9A 3R66C 1ZKHA 2D3GA 4ZRIA 2KNBA 1TIFA 1YNTE 3L54A 4BKSA 3UI3A 1H8CA 2O6VB 5J18A 2DWQA 5HI1A 1FM0D 1JCKB 1E9MA 2L83A 4MACA 2LVQA 5BO4B 4W9IA 4XGAB 3QC8B 4W9EA 3V6EB 1PDXA 3RNAC 1SE3A 4RGTA 2KLGA 5LXIB 2MP2A 1J7CA 2KC2A 3VUXA 3M95A 4LTUA 3ZNZB 1UF0A 3K9PB 3NZUA 3MJWA 4CQNA 2WU5B 2M1MA 1CJEA 2I1KA 4WH4A 1D5ZC 4GDKB 2OHFA 2RGFA 4A3OA 2V3SA 4FADA 3HM6X 1EM7A 3Q8AA 4DBGA 3VR9B 1XQQA 1QF6A 3C0RB 4BOSC 4LCDE 2KLCA 2MSED 2FCMA 2BYTA 1ZPSA 2KJ6A 2N7EA 1WX8A 4MM3A 5TSSA 5KHQA 2WDTB 3WCQA 3MHSD 4NQLB 4DDID 4XWTA 4USAA 3NVZA 2J42A 2INDC 3U2SC 3P4PB 2GI9A 1C9FA 2JPHA 1J8CA 3L0WB 3AV8A 4RFBA 3V62A 2CHWA 2WU2B 3W5VB 1UBQA 2NMQA 2LGIA 3LJ3A 3K9OB 1IBXA 5BMIA 1E7UA 2V9HA 1JWUD 2EELA 2IPKD 1RFKA 2HTME 2ZCBA 2BB5A 2GBJA 4DHJD 4KDIC 3LDZE 3DDCB 1AW7A 3KUDB 1YN5A 4A20A 4DHZE 3NUHB 2BTEA 1VRAB 3PTFC 3R8BA 2L0FA 4DWFA 4TUUA 2IY0B 3ZVVA 2RD0A 1K53A 4L2YA 5DPRA 3CIRB 3U4EG 3TL5A 3EC8A 2ZZPB 3CWIA 2W54A 5E6NA 2NPTA 2HTHA 2WLBA 4MGYE 5E6OA 1FRDA 1B1ZA 3A9KA 4A3PA 2E6XA 3QAQA 1VR9A 3VAWA 2KC1A 3B08A 1C76A 3AE1B 1AYFA 1JW9D 1L5PA 3U30A 4GN1A 2H88B 2I38A 3T3OA 1WYGA 5GXGB 3PO0A 3SDLC 3GOEA 4ZHPA 2WXPA 2IDYA 2N0SB 4W9DA 1WR1A 4ZRKA 4DDGD 3PT2B 3W1YA 2IGGA 3H6NA 3ONSA 2LHDA 4K81A 2R2QA 1V2YA 4DXAB 1F9JA 1V1PB 2ONQA 4MJSB 3WIMA 4P16A 2M0XA 2W82A 3DVGY 3DBRI 1XO3A 2M17A 3R7RA 1WE6A 1U4AA 2NR2A 3A4SC 1L4DB 2ZVOA 2LI5A 1FD6A 4HPPA 2YLMA 2A4ZA 3B2FA 3AE6B 3SHQA 1L0XB 1BXTA 4JE3B 3O65B 3EFCA 1XCTL 2KQSA 2KJHB 4NQKE 2GBNA 2PMVA 2ON8A 2FE8A 2WGSA 2JUOA 4LNFA 1ISNA 2KDBA 4MELA 3BVZA 1VZ6A 4N6EB 2MBQA 3ZNGC 5D3DA 1J7AA 5IN7A 3IBEA 1V5OA 2W55A 2K5PA 2K25A 1WXAA 3KUZA 4HKZE 3RNBC 2KN5A 1NEKB 3LYYA 3ZO5B 3TEYA 1HTOA 5D3IB 3FILA 4AQ7A 1PGAA 3PZ7A 1VCBA 1M4VA 1WGHA 1T5XD 4BKGA 2KTFA 4JWUC 2QSDA 1P98A 2J52A 4A8XC 2L05A 3OLMD 4HJKA 1FPYA 3UIOB 1JWSD 3ZRCA 1ET9A 2DAJA 3MHZA 2N9EB 2FUHB 1TZOA 4N59A 1FEHA 2QIEB 2QEJC 1XCQL 5C2TB 1WX9A 3PSEB 1ACCA 3BIID 1QILA 2EKIA 4B0MA 3ZJVA 2PVOD 3NG0A 1ENFA 3KWVA 1KLVA 3AI5A 3SFDB 2LASA 2MBEA 3N9YC 1TYGB 2M0AA 2PVGC 4NAWA 5T8IA 2QC8A 2XK5A 1EF5A 1E8YA 4G11A 1SSNA 4MGIE 4OVVA 2KOXA 4YSYB 3NY5A 1UELA 2BT6A 4WQOB 1YIWA 3DBRB 3TUOA 4URKA 3Q2AC 1NYRA 1V5TA 2RDHA 3QX1A 4ACFA 5MPOA 1CK1A 1NENB 1PGBA 2KANA 1UD7A 3TJPA 2M19A 4D2KA 3L16A 1K50A 4S0RA 1EO6A 2B76B 2ZCCA 4ASWC 3RT3B 4DXFA 1HZ5A 1YQ4B 1UZXB 1V86A 4JPSA 2LRUA 4F7ZA 4XYCA 4IWPA 3ZGZA 2KYWA 5IKCM 2BYFA 2LFIA 3QIJA 4RGMA 2J0MA 2K6QA 3PZDA 4NZLB 4QAYA 3TEWA 4A55A 4WWPA 1SGHA 2KMMA 3QA8A 1TGZB 1P9DU 3AEBB 3OJ4B 1KM7A 1SE4A 2FCSA 1WGGA 4GSWA 4W9HA 3OWEB 3E9SA 2IGDA 3DCGA 4FJVB
chains in the Genus database with same CATH topology
2WXHA 2RMMA 2AX5A 3IT4B 4MH8A 1RYJA 2WXLA 4ZRPA 3AEFB 1PFDA 1MPEA 3T3NA 2D5GA 1FCCC 1QOGA 2JU6X 1FNUA 1VDVA 5HHDG 3VQIA 3AEGB 4ZRQA 3Q8FA 1HZ6A 1SB3C 2WDQB 3BK1A 3NVWA 3W9CB 2BS4B 4ARCA 1ZXIA 1I4GA 1YNTE 2AQ3B 4C80A 1WSPA 3UI3A 1QQRA 2DWQA 5HI1A 1FM0D 1JCKB 1E9MA 3NS1A 2WXOA 1JALA 4RNAA 3SEBA 2L83A 2HDEA 4B0EA 4MACA 5BYQA 4US9A 2Y5CA 4P6VF 1J7BA 1YN3A 3RFZB 3V3XA 1RWSA 3P1MA 3U52E 1N62A 1PDXA 4NAMA 1MI0A 1SE3A 4RGTA 1EU3A 1MHHE 1AWDA 2WNMA 3AE5B 1UGJA 3U7ZA 2L32A 2GB1A 4MM3B 2K9XA 1J7CA 3IXSA 3NZ3A 2DBYA 4UDUC 3NRZA 4LTUA 1D5MC 4WAFA 4FXCA 1K52A 1SIJA 5JXVA 4CQNA 3ZJUA 1FIQA 2WU5B 2Q5WD 2JYEA 1P7FA 1CJEA 3AE4B 4WH4A 1LO5D 1D5ZC 3EA6A 4GDKB 2JSVX 2QILA 4RH6A 1TY0A 2OHFA 4C7ZA 1SEBD 2WXMA 1EM7A 4R3DA 1HXYD 1XF5L 1KTKA 3Q8AA 3VR9B 2LEKA 1IBXB 5AUKA 1BMLC 1VJKA 1TKGA 3GP7A 1QF6A 1F0ZA 1FRRA 1L6UA 1YJIA 2KACA 2L1AA 2PKOA 2H89B 4KGRA 1FCLA 4OZAA 1VLBA 1YQ3B 4YSZB 2BYTA 1GB1A 1ZPSA 1FXAA 1NVID 2WXKA 4KX6B 4H2AA 3MJ5A 5TSSA 2FUG1 3P4RB 5EE0A 1A70A 2WXIA 3V05A 4YXDB 5E6JA 2JX5A 2Y5PA 3WCQA 5HFYA 4KGTA 1QOBA 3BWUD 4XWTA 4USAA 3NVZA 5D7GA 1TS4A 1DGJA 2J42A 1I4PA 1PYWD 3R2TA 4JWSC 3U2SC 1Q10A 4YTNB 2K22A 1FO4A 4J3OD 3P4PB 2GI9A 4OZCA 1GB4A 3PZ8A 2ACZB 3W1SA 3W5UB 1C9FA 2W3RA 3AEEB 4WWMA 2LMCA 2WDRB 4Q2JA 1KRHA 3AE9B 3Q69A 1P7EA 3AV8A 4RFBA 3P63A 1SBBB 2PLPA 2WU2B 3ZJTA 3W5VB 2NMQA 2KAJA 1CQVA 2LGIA 4N58A 1GOZA 2BS3B 1C79A 1YJJA 1IBXA 3C8YA 5BMIA 5BYSA 5C3JB 2KWDA 4KKJA 4OHJA 1AN8A 1JWUD 2EELA 1DOXA 3B9JA 1GAQB 2IPKD 1RFKA 4HKQA 3P42A 1UUPA 2HTME 1T6BX 2BB5A 2JXTA 1AW7A 1SXTA 2BB6A 4L1BA 4HROA 1YN5A 3NUHB 3J9CA 2BTEA 1VRAB 5EE9A 3R8BA 3MC0B 3BYTB 1MVKA 1SJED 1IUEA 1FXIA 3AH7A 1C4PA 4IDIA 1L0VB 3B2GA 2OEDA 2XNAC 1WGKA 4MT5A 1K53A 4L2YA 1B9RA 1V8CA 1KFYB 1CZPA 2WXRA 3AEDB 3CIRB 1ZUD2 4WURA 3U4EG 2YEPB 4YSXB 1VZ7A 1KLGD 1EWCA 4ARIA 1STEA 4LK0M 3CWIA 2W54A 5G5GA 1TS5A 3BYYB 1WRIA 2V0GA 2WLBA 3HRDD 5I4DA 3Q8EA 1FRDA 1XLNA 1B1ZA 1C78A 1JWAD 1SF0A 3E56A 2X38A 1BUIC 3P4QB 2WXNA 2E6XA 1VR9A 3HVZA 4JX1C 5BMHA 4NJCA 4XE0A 1UWMA 4WQMA 1C76A 1ZDXA 1IGDA 3AE1B 1AYFA 2ZW1A 1E7PB 1JW9D 1L5PA 2E3TA 1QLBB 2H88B 2I38A 1N5XA 3T3OA 1WYGA 5GXGB 3PO0A 1C4AA 1RM6C 1JROA 5FKAC 4ZHPA 2WXPA 1L0YB 2IDYA 4YT0B 5BMGA 4ZHOA 1E10A 2N0SB 3VRBB 1N60A 1XLPA 4XWWA 2I2YA 2IGGA 2LHDA 1KLUD 1ZDVA 2WQYB 4HJGE 1QOFA 1V1PB 2ONQA 1EWYC 1F77A 1L6VA 4P16A 4RGOS 4YWGG 3BVGA 1IGCA 3FC4A 2W82A 1PGXA 1I4XA 3FILB 1HQRD 1XO3A 4YTPB 1NYQA 3IT6B 4US8A 3AECB 2RDGA 1ZOYB 4XDDA 1L4DB 1UWXA 5HG2A 2N9LA 2BW2A 2KDMA 5H8YE 1FD6A 3H8HA 1OQQA 1QT9A 3B2FA 3AE6B 4M0WA 3AMZA 1L0XB 2XN9C 1BXTA 3AE3B 4JE3B 3URYA 3HUIA 3I9V1 1FNVA 1XCTL 2WP9B 2MJEA 3VR8B 2WXGA 2MH7A 2G1EA 2PMVA 1EU4A 1DOIA 2WXFA 2J53A 2JWUA 1MHXA 2TSSA 3O13A 1E0ZA 2ON8A 3BK2A 1VZ8A 1OFFA 2V4IB 5H92C 2FE8A 2KN4A 2NTTA 2SEBD 1Y56A 1QOAA 3BVZA 4ZYSA 1VZ6A 4REZA 4GLSC 4N6EB 1C4CA 3BVMA 4C56C 5EE3A 5FK9C 5D3DA 2DYMA 1HEZE 1J7AA 3LB8C 5BYRA 4IOIE 2W55A 2J4XA 3GS2A 2K5PA 2ZW0A 3KQ4A 1V1PA 3KWLA 4HKZE 1NEKB 3P4SB 2QJLA 3LYYA 3TEYA 1PUTA 2V3NA 5D3IB 3FILA 4TMAB 4AQ7A 3AE7B 1PGAA 1XEEA 3PZ7A 3Q8BA 1M4VA 2LJIA 1T5XD 1D4BA 1GPXA 2RPVA 1JMLA 1T3QA 2Z8LA 3DWGC 4L23A 3AM9A 2MJDA 4RF1A 2YEPF 4JWUC 1L4ZB 2QSDA 4PT5A 1FFUA 2MEKA 4RGNA 4NAWB 4YTMB 2J52A 4A8XC 1TKYA 2AQ1B 3SR6A 3TEZA 3FAHA 1ESFA 1ROEA 1KH0A 4AS1A 3TEXA 1JWSD 1V1OA 1DOYA 2WXQA 3ZQ4A 1TJEA 2K0PA 3ABVB 1ET9A 3L4PA 3BZDB 5LNK1 3MHZA 1KF6B 3W2DA 3Q8CA 1TZOA 1TS2A 4RF0A 4A6QA 1N61A 3DWMA 4N59A 1FEHA 1UNSA 2QIEB 2QEJC 3EUB2 3LXFA 2QMTA 2BBCA 2IJ0A 1XCQL 2CJOA 1K51A 5C2TB 3TSSA 3VRAB 1F2RI 5AUIA 4ITKA 1ZE3D 4LLGM 1SE2A 4TSSA 1N5WA 1ACCA 3AE8B 1D6EC 2JQRB 3BIID 1QILA 1SJHD 2EKIA 2K3UA 4OZBA 2JYTA 4B0MA 2WXJA 2BS2B 3ZJVA 1ET6A 1V97A 2PVOD 2DLBA 1ENFA 2PW9A 3RPFC 3ZYYX 3KWVA 3SFDB 3N9YC 2PIAA 4TQ1A 4TQ0A 1TYGB 2M0AA 2PVGC 2JZPA 2N9KA 5T8IA 1F2RC 4XDCA 1NI3A 1QKZA 1SSNA 2PTLA 4HRSA 1TKEA 3ETRA 2IGHA 1D5XC 4YSYB 3NVYA 1I4HA 2ICIA 1DYQA 2N7JA 2FBWB 3R2IA 4C7YA 3AEAB 2BT6A 2VZKD 5G5HA 3TUOA 1HA5A 4A90A 1NYRA 1JWMD 2INPE 4RCOA 2RDHA 3SFEB 4A9AA 1FFVA 1ZXHA 5MPOA 1JQ4A 2CU3A 4HEA1 3EGRA 1ZP0B 1JWBD 1YMHE 1XXGA 2MJ3A 1CK1A 1R7SA 4O1NA 2G9HD 5EE1A 2GRIA 3AN1A 1JRPA 1TY2A 1NENB 1PGBA 2M19A 4D2KA 3KLSX 3NVVA 1K50A 2LUMA 2NTSA 2R61A 2B76B 4DXGA 4DXFA 3MFGA 1C77A 1HZ5A 1XLQA 5FR3A 3IAS1 1YQ4B 1E6EB 4OW0A 4JPSA 1I4QA 1FNWA 4IKGA 3ZGZA 1N63A 2VZKB 1I4RA 2LFIA 1FMAD 2M56B 2L52A 3HVDA 2KQ4X 4GDLB 1XLOA 2CJNA 3AB5A 3IAM1 4WIPA 4RGMA 4NZLB 2V3PA 3AE2B 4DQOC 3TEWA 2DYOA 2INNE 3GB1A 2Y3AA 1WXQA 4A55A 2SAKA 1YN4A 2KMMA 2AQ2B 1WWTA 3AEBB 2WDVB 4EE2A 1SE4A 2W3SA 3I57A 4ZOHC 3OWEB 1OQRA 4KGSA 4KKIA 3E9SA 2LHEA 3MP9A 2WS3B 2IGDA 1TS3A 4OVZA 1I7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6Q A;  4A90 A;  2HDE A;  4A8X C; 
#chains in the Genus database with same CATH topology
 3Q3O C;  2RMM A;  2C7M B;  1RYJ A;  2WXL A;  4PS3 A;  4W9J A;  2JRH A;  3AEF B;  4WJQ A;  4GB9 A;  4JLC A;  2CHX A;  5HHD G;  2AL3 A;  3Q8F A;  2MW5 A;  1SB3 C;  2WDQ B;  1ZXI A;  2N4F A;  1WSP A;  4PK1 A;  4MEM A;  3SEB A;  4EZK A;  4M00 A;  2HDE A;  3A9J B;  4P6V F;  3RFZ B;  2MBB B;  4K7W A;  4GIV A;  3A1Q B;  1RWS A;  1LGR A;  3U52 E;  2LVP A;  4B6W A;  1MI0 A;  2DAF A;  1EU3 A;  5EDS A;  2WNM A;  3AE5 B;  1UGJ A;  3U7Z A;  4TV3 A;  2GB1 A;  4MM3 B;  5J2R A;  2K9X A;  1P3Q U;  1WIA A;  2Z59 B;  3QWZ B;  2DBY A;  3A33 B;  4K7U A;  4NJ6 A;  2UYZ B;  1P1A A;  2LXA A;  3NRZ A;  1K52 A;  2PE6 B;  4HDQ A;  1SIJ A;  5IA7 A;  5JXV A;  5JZE B;  2Q5W D;  2JYE A;  1C3T A;  1P7F A;  2D3C A;  3AE4 B;  3N20 C;  3NZS A;  1WXV A;  2QIL A;  4KDL B;  4LDT B;  4R3D A;  2LEK A;  1IBX B;  5AUK A;  1FRR A;  2KAC A;  3N1Y C;  4IM2 A;  4OZA A;  4BOZ B;  1YQ3 B;  5GMV A;  4YSZ B;  1NVI D;  1ZW7 A;  2WXK A;  2KXJ A;  4KX6 B;  4H2A A;  3MJ5 A;  3RZF A;  5EE0 A;  1A70 A;  5E6J A;  2OJR A;  4KGT A;  1QOB A;  1TS4 A;  1I4P A;  3R2T A;  1PYW D;  4JWS C;  3PZ8 A;  3AEE B;  4WWM A;  2LMC A;  2WDR B;  1KRH A;  3OAW A;  4LNK A;  3OG5 A;  4ANW A;  4JGH B;  2PLP A;  2LJ5 A;  3ZJT A;  3APC A;  2KAJ A;  2KKC A;  3N1X C;  1WGY A;  1C79 A;  1YJJ A;  2OOB B;  2PE9 A;  5C3J B;  2ZEQ A;  2WX0 A;  5LLI A;  3JYU A;  4HKQ A;  1GAQ B;  3P42 A;  1UUP A;  3L10 B;  3Q14 C;  4HDO A;  3KH0 A;  1SXT A;  4NPN A;  1M94 A;  2LGD A;  5CTR C;  5FR6 A;  2N1V A;  1TTN A;  2LWP A;  2MWS B;  3H7S A;  3AH7 A;  1GNU A;  1L0V B;  4MT5 A;  1V8C A;  5LXH A;  1D3Z A;  1WZ0 A;  1CZP A;  2KMC A;  1VZ7 A;  3JSV A;  1KLG D;  4ARI A;  1STE A;  4LK0 M;  1TS5 A;  3BYY B;  3Q8E A;  1A5R A;  1H4R A;  1V9J A;  2ZJD A;  1C78 A;  2MLB A;  5AZG A;  2X38 A;  3P4Q B;  3ML8 A;  4IWO A;  2KTR A;  1UWM A;  4FBJ B;  4K7S A;  4ICU A;  3VDZ A;  1C4A A;  4E3C A;  2JF5 A;  3NHE B;  5FKA C;  1L0Y B;  5BMG A;  1XLP A;  3PHX B;  2PEA A;  1KLU D;  2JWZ A;  1RLF A;  1ZDV A;  4HJG E;  1F77 A;  1L6V A;  2KWC A;  3ZIM A;  3A9J A;  1IGC A;  1PGX A;  1I4X A;  3FIL B;  1HQR D;  4YTP B;  2KVZ A;  1NYQ A;  3A1Q A;  3IT6 B;  4ICV A;  3AEC B;  2RDG A;  4XDD A;  4XX5 A;  2EKE C;  1LXD A;  5H8Y E;  3H8H A;  2L0T A;  2D3A A;  4AJY B;  4GU2 A;  4FHK A;  3DBL I;  3AMZ A;  1E8W A;  3AE3 B;  3HUI A;  2WP9 B;  2BPS A;  3VR8 B;  5DPS A;  1PQS A;  2G1E A;  1EU4 A;  1MHX A;  2G4D B;  2TSS A;  3RD2 A;  3BK2 A;  3EEC A;  1OFF A;  1V6E A;  2SEB D;  1BT0 A;  5AEK B;  4REZ A;  4GLS C;  2REX A;  1YX6 B;  3BVM A;  2BYE A;  4ANX A;  4C56 C;  4EEW A;  1ZGU B;  1E8Z A;  1JRU A;  4FN2 A;  4IUM B;  3QJZ A;  1OEY J;  4EUT A;  2QJL A;  3OJ3 A;  2G3Q B;  2BWE S;  2NBV B;  3AE7 B;  2NBW B;  4MGZ E;  2RPV A;  3L08 A;  1T0R C;  1L4Z B;  1IYF A;  4CO7 A;  4PT5 A;  4RGN A;  4NAW B;  2XK5 B;  3N32 A;  3D32 A;  2AQ1 B;  3FAH A;  3TCA A;  3TEX A;  2WXQ A;  4NNJ B;  1TJE A;  3GZN I;  1WJ4 A;  3DBS A;  1KF6 B;  3Q8C A;  2NS5 A;  3RUL A;  1TS2 A;  1RFA A;  4A6Q A;  4K3C A;  2QMT A;  1I35 A;  2WWZ A;  2KWU B;  3VTW A;  2CHZ A;  3TSS A;  3UIP B;  4ITK A;  1OQY A;  2UU7 A;  3H9D A;  5G2N A;  3AE8 B;  1D6E C;  2JQR B;  3APF A;  4OZB A;  2BS2 B;  1IP9 A;  3ZYY X;  3ZTD A;  4TQ1 A;  2LZ6 A;  4C4V B;  4XC2 A;  1WR6 E;  1QKZ A;  2XBB C;  1WGD A;  4HRS A;  1TKE A;  2XEW A;  2L00 B;  3ETR A;  2IGH A;  1D5X C;  2LGX A;  2DZI A;  4FHJ A;  1J19 A;  2MBH A;  2MQJ A;  2FBW B;  1F1H A;  2KK8 A;  4EZL A;  4C7Y A;  3WAN A;  5G5H A;  3C19 A;  1GG3 A;  1HA5 A;  2WHI A;  4A90 A;  3QHT A;  4I6P A;  2K39 A;  3SFE B;  1FFV A;  4F8C B;  2KT7 A;  4PS7 A;  2CU3 A;  3EGR A;  1ZP0 B;  4FJZ A;  1OTR B;  1JWB D;  3DBL B;  2LGY A;  4O1N A;  5EE1 A;  4KV2 A;  5IAA C;  2O2V A;  3KLS X;  2LUM A;  3QCA A;  4DXG A;  2K8B A;  2KDF B;  2FCN A;  3DVN V;  4II3 B;  5DPW A;  1XLQ A;  2C9W B;  1X1M A;  3UGB B;  4IKG A;  1N63 A;  2VZK B;  3A4R A;  1I4R A;  2BGF A;  1Q0W B;  2ASQ A;  1HE8 A;  1FMA D;  2MHJ A;  3HVD A;  1I42 A;  2CJN A;  3IAM 1;  3WAO A;  3JW0 X;  2O6V D;  3GB1 A;  4EZJ A;  1WXQ A;  2SAK A;  3RNF C;  2AWT A;  1YN4 A;  3MC9 A;  2AQ2 B;  3AU4 A;  3V60 A;  3VXW A;  2WDV B;  3B1L X;  4EE2 A;  2ZNV B;  5C23 A;  4ZOH C;  1UH6 A;  4C00 A;  4KGS A;  1TS3 A;  3QAR A;  2GOW A;  4ZRP A;  1MJD A;  1E5W A;  1WMH A;  4IW0 A;  5AZH A;  1QOG A;  2JU6 X;  2KD0 A;  2IYD B;  5D94 A;  3GZN B;  3VQI A;  4LJO B;  3SU8 X;  3BIN A;  3BK1 A;  2KX3 A;  3MTN B;  2D10 A;  2BS4 B;  4I6L B;  1I4G A;  4C80 A;  4AUQ C;  2MA9 B;  1QQR A;  5CHW A;  3PLU A;  4J6I A;  2G4S A;  2NBU A;  3NS1 A;  2WXO A;  1JAL A;  5CHV C;  4RNA A;  4AOF A;  2Y5C A;  2Z0E B;  4GDL A;  1J7B A;  3V3X A;  3N30 A;  4HK2 A;  3MC8 A;  4CHK A;  4NAM A;  3PHW B;  1Z5S B;  1MHH E;  2L3Z A;  1AWD A;  1NI2 A;  1XD3 B;  3PRZ A;  3VTU A;  4UDU C;  1D5M C;  2X8X X;  4W9G A;  1SIF A;  3EHV A;  1WM3 A;  4ANV A;  1FIQ A;  3ZJU A;  2GBR A;  1LO5 D;  1RRB A;  2JSV X;  4RH6 A;  4P7I A;  3TMP B;  1BML C;  1TKG A;  1F0Z A;  1NDD A;  3RN9 C;  3AU5 A;  1L6U A;  1YJI A;  3N1Z C;  2L1A A;  2PKO A;  3VH4 B;  3R3M A;  4KGR A;  1WX7 A;  1FCL A;  1VLB A;  3HHM A;  5D6J B;  2QDF A;  3UQA A;  2D11 A;  2GBM A;  3L13 A;  1WRD B;  1T0Y A;  2RR9 A;  2WXI A;  3RNC C;  4C4V A;  2YVC A;  2JX5 A;  5HFY A;  3BWU D;  2N7D A;  5L83 A;  3VUW A;  2NCN A;  2HD5 B;  3PVL A;  1GB4 A;  3W1S A;  2ACZ B;  3W5U B;  3RI7 C;  2KHW B;  2PPH A;  3JSV B;  4Q2J A;  3AE9 B;  4FLH A;  5DPT A;  2MX2 A;  1Q5W B;  1SBB B;  1V81 A;  3AXC A;  2K8C A;  4N58 A;  4W9L A;  1GOZ A;  2BS3 B;  4DK5 A;  1L7Y A;  3DHG C;  3C8Y A;  2KTR B;  2KFK A;  2KWD A;  2J0K A;  4AWJ A;  1Y8R C;  1DOX A;  3B9J A;  1G6J A;  3CF6 E;  1NBF C;  4KZ0 A;  5JHB A;  2JXT A;  3Q6B A;  3RNG C;  4BBN F;  4HRO A;  3DPD A;  3H7P A;  1MVK A;  1SJE D;  1FXI A;  1C4P A;  3B2G A;  2XNA C;  4IM0 A;  4IM3 A;  2KX0 A;  4GMV A;  5IO9 A;  2C60 A;  2WXR A;  3AED B;  1ZUD 2;  1YJ1 A;  3QK0 A;  5E6P A;  3CMM B;  1CMX B;  2GLS A;  1WF9 A;  3WAM A;  5G5G A;  2W9N A;  1N6Z A;  4FUL A;  2JT4 B;  3QQ8 B;  1XLN A;  3Q3F A;  1SF0 A;  1BUI C;  2WXN A;  4DHJ B;  4JX1 C;  3V61 A;  2C7H A;  4NJC A;  4XE0 A;  3I3T B;  4K1R B;  4WQM A;  1ZDX A;  1IGD A;  2QCZ A;  2ZW1 A;  1VD2 A;  1WJN A;  2E3T A;  4LJP B;  1QLB B;  1WZ3 A;  1WXS A;  2BQQ A;  4BAX A;  4HPM B;  2AEH A;  1E10 A;  3VRB B;  2K1F A;  3PRP B;  4XWW A;  2I2Y A;  2KQ7 A;  4NY0 A;  1QOF A;  4RGO S;  2JY6 A;  3RNE C;  4YWG G;  3BVG A;  3GE8 C;  3FC4 A;  2DZK A;  2A5U A;  4US8 A;  2BVC A;  4HWI B;  2GMI C;  3ENE A;  1UWX A;  4HXD A;  2QHO A;  3RMK C;  2KDM A;  1Z2M A;  1QT9 A;  4M0W A;  1TZ1 A;  2BKR B;  2IBI B;  1MG8 A;  1FNV A;  2MJE A;  3TBL D;  3DHH C;  3KYD D;  2WXF A;  2J53 A;  2JWU A;  3ZXV A;  4B9K A;  1VZ8 A;  5H92 C;  2CR5 A;  2ZPY A;  2NTT A;  2JZ3 B;  1Y56 A;  1QOA A;  4ZYS A;  1OEY A;  3S2A A;  1C4C A;  4II2 B;  5FK9 C;  1YOV B;  4ZRJ A;  1HEZ E;  4IOI E;  3GS2 A;  2ZW0 A;  3KQ4 A;  2LXC A;  3KWL A;  2KDI A;  2K6D B;  1S3S G;  1PUT A;  1XT9 B;  2LJI A;  1GPX A;  1JML A;  4L23 A;  4BVU C;  2MJD A;  4RF1 A;  2YEP F;  1FFU A;  3UIN B;  2R2O A;  4YTM B;  3TEZ A;  3U8Z A;  1ESF A;  1WI0 A;  2IY1 B;  4M02 A;  1MG4 A;  1WGR A;  2K0P A;  3ABV B;  3BZD B;  3W2D A;  3ZDT A;  2D2Q A;  1RAX A;  3DWM A;  2ZNV C;  1UNS A;  3LXF A;  3VUY A;  2L8J A;  2IJ0 A;  4GGQ A;  3ALB A;  1K51 A;  2CU1 A;  3VRA B;  1F2R I;  5AUI A;  3ZLZ A;  3SD5 A;  1SE2 A;  4TSS A;  4F1S A;  4G0N B;  3VFK A;  2LVO A;  2N9P C;  2D07 B;  2MCN B;  3P2B A;  2CKH B;  2BYV E;  2WXJ A;  2MRP A;  2O2V B;  2AL6 A;  3RYT A;  3ZNI D;  1ET6 A;  1V97 A;  2KFJ A;  4LNO A;  4ANU A;  2IO3 B;  2PIA A;  2JZP A;  2KZR A;  3NS8 A;  5L95 C;  2DX5 B;  4PS8 A;  3PS6 A;  3DVG X;  2BWF A;  2AYO B;  1I4H A;  2N7J A;  1DYQ A;  4BKS D;  3AEA B;  3ZNH B;  3NJT A;  2LD9 A;  3IFW B;  4E74 A;  1JWM D;  3M62 B;  4A9A A;  5CHF A;  1JQ4 A;  4G50 A;  3U7D A;  5AZF A;  4PYZ A;  2LGS A;  1E90 A;  1XXG A;  1R7S A;  2G9H D;  1E8X A;  1JRP A;  1TY2 A;  1WMH B;  4KIK A;  5JH5 C;  2R61 A;  3MFG A;  1C77 A;  2L76 A;  3IAS 1;  2JVC A;  1I4Q A;  3AUL A;  2KDE B;  3L17 A;  2KMA A;  2FCQ A;  2Y5B B;  4EKU A;  2L52 A;  1KOT A;  4GDL B;  1XLO A;  3AB5 A;  4MSQ B;  2V3P A;  4DQO C;  2DYO A;  2INN E;  2Y3A A;  1OGW A;  3VTV A;  2RSU A;  1WWT A;  2RDB C;  3T9L A;  3VVW B;  3X0W A;  3DHI C;  3I57 A;  4MH0 E;  3APD A;  2LHE A;  4G3X B;  2MBO A;  1F52 A;  4OVZ A;  3EFU A;  1I7H A;  3UF8 A;  3URY A;  2WXH A;  3IT4 B;  4MH8 A;  1R4N I;  2VH2 A;  3IVF A;  3PPA A;  2K8H A;  3WAP A;  1FNU A;  1Q1O A;  1HZ6 A;  3NVW A;  3W9C B;  4ARC A;  2AQ3 B;  3DBH B;  4MSM B;  2CS4 A;  3VH3 B;  3H1U A;  4NJ7 A;  4HVB A;  4JL9 A;  4HLE A;  4B0E A;  5BYQ A;  2FAZ A;  4US9 A;  3RCZ A;  1YN3 A;  3PGE A;  2NVU I;  3M63 B;  4LDT D;  3P1M A;  3PRM B;  1N62 A;  3M3J A;  4S17 A;  2JZZ A;  3ZRF A;  4BKT A;  2WX1 A;  3Q3N C;  2L32 A;  3KUC B;  3ZKJ C;  4OVU A;  1GC7 A;  5DCN A;  1L2N A;  3PV1 A;  3IXS A;  3NZ3 A;  2IO1 B;  2KJR A;  4WAF A;  4FXC A;  1EUV B;  1S1Q B;  5HKH A;  2M8S A;  4W9K A;  4WJN A;  4WJP A;  1E7V A;  4PYU A;  3EA6 A;  3NOB A;  1TY0 A;  1QZE A;  4GOC A;  1SEB D;  4C7Z A;  2WXM A;  2L7R A;  2M4N A;  3ZDM C;  1HXY D;  1XF5 L;  1KTK A;  2O6V A;  4B95 A;  1TBE A;  2N1W A;  1LM8 B;  1VJK A;  3GP7 A;  2KFK B;  5IOI A;  2H89 B;  4RMA A;  3VHT C;  1GB1 A;  1FXA A;  3Q3J A;  2FUG 1;  3H7P B;  3P4R B;  4YXD B;  3V05 A;  1J0G A;  4X57 B;  4LNN A;  2Y5P A;  4W9F A;  2LUE A;  5D7G A;  1DGJ A;  1LFD A;  2HJ8 A;  2HJ1 A;  1Q10 A;  4YTN B;  2K22 A;  1FO4 A;  4J3O D;  4OZC A;  4EOY A;  2W3R A;  5C1Z A;  1TT5 B;  3Q69 A;  1P7E A;  4M8M A;  3P63 A;  2DZJ A;  4GDK A;  3JVZ X;  1CQV A;  2VRR B;  3CST A;  4ZYN A;  5BYS A;  5KHO A;  4KKJ A;  4OHJ A;  1AN8 A;  3DQV A;  2DEN B;  1T6B X;  1WY8 A;  1R4N B;  3TIX A;  5J17 A;  2BB6 A;  4L1B A;  1IPG A;  3J9C A;  4MGK E;  5EE9 A;  3ZXR A;  3MC0 B;  3BYT B;  4KSK C;  3WAL A;  1IUE A;  4E71 A;  4IDI A;  2C5L C;  2WYQ A;  3DOW A;  2OED A;  1WGK A;  1B9R A;  1KFY B;  2IO2 B;  4WUR A;  2YEP B;  4YSX B;  2PJH A;  2JRI B;  4YL8 A;  1EWC A;  1WXM A;  1WRI A;  2V0G A;  3HRD D;  5I4D A;  4MDK E;  1JWA D;  2V4L A;  3E56 A;  2J7Q B;  4M0W B;  3HVZ A;  5BMH A;  4XZ4 A;  1T0S C;  3BY4 B;  1E7P B;  3PRE A;  3ZW3 A;  1N5X A;  4TKN A;  3IG3 A;  1SE9 A;  1RM6 C;  1JRO A;  2VH1 A;  4YT0 B;  2UWQ A;  4ZHO A;  1N60 A;  1AAR A;  4AP4 C;  4M01 A;  1FXT B;  2EMT A;  2JXX A;  2WQY B;  1EWY C;  2D3B A;  2IZV B;  1V49 A;  3GE3 C;  1WJ6 A;  4RM8 A;  1ZOY B;  3I5J C;  3HM3 A;  5HG2 A;  2N9L A;  2J0J A;  4M8N A;  2BW2 A;  2IO0 B;  4JQW C;  1OQQ A;  2INC C;  2C7N B;  4KZC A;  2XN9 C;  4W9C A;  3I9V 1;  1GC6 A;  2WXG A;  5JHA A;  2MH7 A;  1R4M I;  1DOI A;  3O13 A;  1E0Z A;  3IHP C;  3ML9 A;  1GJZ A;  4K3B A;  5IP4 D;  2V4I B;  4LNI A;  2GBK A;  2KN4 A;  2N9X A;  2OJW A;  4BZA A;  2BKF A;  4AJW A;  4GXB A;  5EE3 A;  3ZTC A;  2ZPN A;  1KJT A;  2DYM A;  2KWV B;  3LB8 C;  5BYR A;  3HIZ A;  2J4X A;  1UGM A;  1V1P A;  4MJS A;  1WJU A;  1WM2 A;  2B3A A;  3P4S B;  4FJY A;  1LQB A;  2V3N A;  1WFY A;  2HE7 A;  4TMA B;  1GUA B;  4IG7 B;  1XEE A;  1WE7 A;  3Q8B A;  3I63 C;  1D4B A;  2Z8L A;  1T3Q A;  3DWG C;  3AM9 A;  2MP2 B;  3B0A A;  2DNF A;  2FID A;  2MEK A;  1TKY A;  3KW5 B;  3SR6 A;  4EFO A;  1ROE A;  1KH0 A;  4AS1 A;  4CYE A;  3ZUN A;  1V1O A;  1DOY A;  3ZQ4 A;  4WWN A;  4BFR A;  3L4P A;  5LNK 1;  2KO3 A;  4N9F 4;  4RF0 A;  1N61 A;  2ZVN A;  4WWO A;  3EUB 2;  3R7Q A;  2BBC A;  2BF8 B;  1V80 A;  2CJO A;  4P1C C;  4LLG M;  1ZE3 D;  3KVF B;  1N5W A;  3HK0 A;  2FNJ B;  5D2M B;  1SJH D;  2K3U A;  2JYT A;  1YX5 B;  3UQB A;  4I6N B;  4KIK B;  1K8R B;  2DLB A;  2PW9 A;  3RPF C;  1WYW B;  4TQ0 A;  5G55 A;  1P0R A;  3DVN U;  2N9K A;  1F2R C;  4XDC A;  4BBN C;  2Z0D B;  1NI3 A;  2PTL A;  1WH3 A;  3ECI A;  2FIF A;  2RPQ A;  3NVY A;  2ICI A;  3N3K B;  5CX3 A;  3R2I A;  2DZM A;  1UBI A;  4IC7 B;  2VZK D;  3CSF A;  1HTQ A;  1C1Y B;  4DHZ B;  4FA6 A;  2INP E;  4RCO A;  2V1Y A;  1ZXH A;  1YD8 U;  3W1S C;  4HEA 1;  4KVG B;  1YMH E;  2MJ3 A;  2GRI A;  4KSL C;  3AN1 A;  1R4M B;  3NVV A;  2NTS A;  2KVR A;  4WJO A;  5FR3 A;  1T0Q C;  1E6E B;  4OW0 A;  2DHZ A;  3KYC D;  1FNW A;  3RZW C;  2DYB A;  3FKY A;  5TR5 A;  2M56 B;  3Q3M C;  4HCN B;  4P1B C;  4ZDV A;  4JIO U;  2KQ4 X;  2I1J A;  4WIP A;  3RUI B;  3AE2 B;  4IWQ A;  2NPT B;  3WA0 A;  3T8M A;  3A9K B;  1YQB A;  2W3S A;  3PLV A;  2EMS A;  1MFW A;  1OQR A;  4KKI A;  3MP9 A;  2WS3 B;  2AX5 A;  4WAA A;  3X23 A;  1PFD A;  2G45 B;  1MPE A;  3T3N A;  2D5G A;  1FCC C;  4HCP B;  3V6C B;  1EF1 A;  1VDV A;  2LRW A;  3AEG B;  4ZRQ A;  4HPL B;  3DBH I;  4RM9 A;  3R66 C;  1ZKH A;  2D3G A;  4ZRI A;  2KNB A;  1TIF A;  1YNT E;  3L54 A;  4BKS A;  3UI3 A;  1H8C A;  2O6V B;  5J18 A;  2DWQ A;  5HI1 A;  1FM0 D;  1JCK B;  1E9M A;  2L83 A;  4MAC A;  2LVQ A;  5BO4 B;  4W9I A;  4XGA B;  3QC8 B;  4W9E A;  3V6E B;  1PDX A;  3RNA C;  1SE3 A;  4RGT A;  2KLG A;  5LXI B;  2MP2 A;  1J7C A;  2KC2 A;  3VUX A;  3M95 A;  4LTU A;  3ZNZ B;  1UF0 A;  3K9P B;  3NZU A;  3MJW A;  4CQN A;  2WU5 B;  2M1M A;  1CJE A;  2I1K A;  4WH4 A;  1D5Z C;  4GDK B;  2OHF A;  2RGF A;  4A3O A;  2V3S A;  4FAD A;  3HM6 X;  1EM7 A;  3Q8A A;  4DBG A;  3VR9 B;  1XQQ A;  1QF6 A;  3C0R B;  4BOS C;  4LCD E;  2KLC A;  2MSE D;  2FCM A;  2BYT A;  1ZPS A;  2KJ6 A;  2N7E A;  1WX8 A;  4MM3 A;  5TSS A;  5KHQ A;  2WDT B;  3WCQ A;  3MHS D;  4NQL B;  4DDI D;  4XWT A;  4USA A;  3NVZ A;  2J42 A;  2IND C;  3U2S C;  3P4P B;  2GI9 A;  1C9F A;  2JPH A;  1J8C A;  3L0W B;  3AV8 A;  4RFB A;  3V62 A;  2CHW A;  2WU2 B;  3W5V B;  1UBQ A;  2NMQ A;  2LGI A;  3LJ3 A;  3K9O B;  1IBX A;  5BMI A;  1E7U A;  2V9H A;  1JWU D;  2EEL A;  2IPK D;  1RFK A;  2HTM E;  2ZCB A;  2BB5 A;  2GBJ A;  4DHJ D;  4KDI C;  3LDZ E;  3DDC B;  1AW7 A;  3KUD B;  1YN5 A;  4A20 A;  4DHZ E;  3NUH B;  2BTE A;  1VRA B;  3PTF C;  3R8B A;  2L0F A;  4DWF A;  4TUU A;  2IY0 B;  3ZVV A;  2RD0 A;  1K53 A;  4L2Y A;  5DPR A;  3CIR B;  3U4E G;  3TL5 A;  3EC8 A;  2ZZP B;  3CWI A;  2W54 A;  5E6N A;  2NPT A;  2HTH A;  2WLB A;  4MGY E;  5E6O A;  1FRD A;  1B1Z A;  3A9K A;  4A3P A;  2E6X A;  3QAQ A;  1VR9 A;  3VAW A;  2KC1 A;  3B08 A;  1C76 A;  3AE1 B;  1AYF A;  1JW9 D;  1L5P A;  3U30 A;  4GN1 A;  2H88 B;  2I38 A;  3T3O A;  1WYG A;  5GXG B;  3PO0 A;  3SDL C;  3GOE A;  4ZHP A;  2WXP A;  2IDY A;  2N0S B;  4W9D A;  1WR1 A;  4ZRK A;  4DDG D;  3PT2 B;  3W1Y A;  2IGG A;  3H6N A;  3ONS A;  2LHD A;  4K81 A;  2R2Q A;  1V2Y A;  4DXA B;  1F9J A;  1V1P B;  2ONQ A;  4MJS B;  3WIM A;  4P16 A;  2M0X A;  2W82 A;  3DVG Y;  3DBR I;  1XO3 A;  2M17 A;  3R7R A;  1WE6 A;  1U4A A;  2NR2 A;  3A4S C;  1L4D B;  2ZVO A;  2LI5 A;  1FD6 A;  4HPP A;  2YLM A;  2A4Z A;  3B2F A;  3AE6 B;  3SHQ A;  1L0X B;  1BXT A;  4JE3 B;  3O65 B;  3EFC A;  1XCT L;  2KQS A;  2KJH B;  4NQK E;  2GBN A;  2PMV A;  2ON8 A;  2FE8 A;  2WGS A;  2JUO A;  4LNF A;  1ISN A;  2KDB A;  4MEL A;  3BVZ A;  1VZ6 A;  4N6E B;  2MBQ A;  3ZNG C;  5D3D A;  1J7A A;  5IN7 A;  3IBE A;  1V5O A;  2W55 A;  2K5P A;  2K25 A;  1WXA A;  3KUZ A;  4HKZ E;  3RNB C;  2KN5 A;  1NEK B;  3LYY A;  3ZO5 B;  3TEY A;  1HTO A;  5D3I B;  3FIL A;  4AQ7 A;  1PGA A;  3PZ7 A;  1VCB A;  1M4V A;  1WGH A;  1T5X D;  4BKG A;  2KTF A;  4JWU C;  2QSD A;  1P98 A;  2J52 A;  4A8X C;  2L05 A;  3OLM D;  4HJK A;  1FPY A;  3UIO B;  1JWS D;  3ZRC A;  1ET9 A;  2DAJ A;  3MHZ A;  2N9E B;  2FUH B;  1TZO A;  4N59 A;  1FEH A;  2QIE B;  2QEJ C;  1XCQ L;  5C2T B;  1WX9 A;  3PSE B;  1ACC A;  3BII D;  1QIL A;  2EKI A;  4B0M A;  3ZJV A;  2PVO D;  3NG0 A;  1ENF A;  3KWV A;  1KLV A;  3AI5 A;  3SFD B;  2LAS A;  2MBE A;  3N9Y C;  1TYG B;  2M0A A;  2PVG C;  4NAW A;  5T8I A;  2QC8 A;  2XK5 A;  1EF5 A;  1E8Y A;  4G11 A;  1SSN A;  4MGI E;  4OVV A;  2KOX A;  4YSY B;  3NY5 A;  1UEL A;  2BT6 A;  4WQO B;  1YIW A;  3DBR B;  3TUO A;  4URK A;  3Q2A C;  1NYR A;  1V5T A;  2RDH A;  3QX1 A;  4ACF A;  5MPO A;  1CK1 A;  1NEN B;  1PGB A;  2KAN A;  1UD7 A;  3TJP A;  2M19 A;  4D2K A;  3L16 A;  1K50 A;  4S0R A;  1EO6 A;  2B76 B;  2ZCC A;  4ASW C;  3RT3 B;  4DXF A;  1HZ5 A;  1YQ4 B;  1UZX B;  1V86 A;  4JPS A;  2LRU A;  4F7Z A;  4XYC A;  4IWP A;  3ZGZ A;  2KYW A;  5IKC M;  2BYF A;  2LFI A;  3QIJ A;  4RGM A;  2J0M A;  2K6Q A;  3PZD A;  4NZL B;  4QAY A;  3TEW A;  4A55 A;  4WWP A;  1SGH A;  2KMM A;  3QA8 A;  1TGZ B;  1P9D U;  3AEB B;  3OJ4 B;  1KM7 A;  1SE4 A;  2FCS A;  1WGG A;  4GSW A;  4W9H A;  3OWE B;  3E9S A;  2IGD A;  3DCG A;  4FJV B; 
#chains in the Genus database with same CATH homology
 2WXH A;  2RMM A;  2AX5 A;  3IT4 B;  4MH8 A;  1RYJ A;  2WXL A;  4ZRP A;  3AEF B;  1PFD A;  1MPE A;  3T3N A;  2D5G A;  1FCC C;  1QOG A;  2JU6 X;  1FNU A;  1VDV A;  5HHD G;  3VQI A;  3AEG B;  4ZRQ A;  3Q8F A;  1HZ6 A;  1SB3 C;  2WDQ B;  3BK1 A;  3NVW A;  3W9C B;  2BS4 B;  4ARC A;  1ZXI A;  1I4G A;  1YNT E;  2AQ3 B;  4C80 A;  1WSP A;  3UI3 A;  1QQR A;  2DWQ A;  5HI1 A;  1FM0 D;  1JCK B;  1E9M A;  3NS1 A;  2WXO A;  1JAL A;  4RNA A;  3SEB A;  2L83 A;  2HDE A;  4B0E A;  4MAC A;  5BYQ A;  4US9 A;  2Y5C A;  4P6V F;  1J7B A;  1YN3 A;  3RFZ B;  3V3X A;  1RWS A;  3P1M A;  3U52 E;  1N62 A;  1PDX A;  4NAM A;  1MI0 A;  1SE3 A;  4RGT A;  1EU3 A;  1MHH E;  1AWD A;  2WNM A;  3AE5 B;  1UGJ A;  3U7Z A;  2L32 A;  2GB1 A;  4MM3 B;  2K9X A;  1J7C A;  3IXS A;  3NZ3 A;  2DBY A;  4UDU C;  3NRZ A;  4LTU A;  1D5M C;  4WAF A;  4FXC A;  1K52 A;  1SIJ A;  5JXV A;  4CQN A;  3ZJU A;  1FIQ A;  2WU5 B;  2Q5W D;  2JYE A;  1P7F A;  1CJE A;  3AE4 B;  4WH4 A;  1LO5 D;  1D5Z C;  3EA6 A;  4GDK B;  2JSV X;  2QIL A;  4RH6 A;  1TY0 A;  2OHF A;  4C7Z A;  1SEB D;  2WXM A;  1EM7 A;  4R3D A;  1HXY D;  1XF5 L;  1KTK A;  3Q8A A;  3VR9 B;  2LEK A;  1IBX B;  5AUK A;  1BML C;  1VJK A;  1TKG A;  3GP7 A;  1QF6 A;  1F0Z A;  1FRR A;  1L6U A;  1YJI A;  2KAC A;  2L1A A;  2PKO A;  2H89 B;  4KGR A;  1FCL A;  4OZA A;  1VLB A;  1YQ3 B;  4YSZ B;  2BYT A;  1GB1 A;  1ZPS A;  1FXA A;  1NVI D;  2WXK A;  4KX6 B;  4H2A A;  3MJ5 A;  5TSS A;  2FUG 1;  3P4R B;  5EE0 A;  1A70 A;  2WXI A;  3V05 A;  4YXD B;  5E6J A;  2JX5 A;  2Y5P A;  3WCQ A;  5HFY A;  4KGT A;  1QOB A;  3BWU D;  4XWT A;  4USA A;  3NVZ A;  5D7G A;  1TS4 A;  1DGJ A;  2J42 A;  1I4P A;  1PYW D;  3R2T A;  4JWS C;  3U2S C;  1Q10 A;  4YTN B;  2K22 A;  1FO4 A;  4J3O D;  3P4P B;  2GI9 A;  4OZC A;  1GB4 A;  3PZ8 A;  2ACZ B;  3W1S A;  3W5U B;  1C9F A;  2W3R A;  3AEE B;  4WWM A;  2LMC A;  2WDR B;  4Q2J A;  1KRH A;  3AE9 B;  3Q69 A;  1P7E A;  3AV8 A;  4RFB A;  3P63 A;  1SBB B;  2PLP A;  2WU2 B;  3ZJT A;  3W5V B;  2NMQ A;  2KAJ A;  1CQV A;  2LGI A;  4N58 A;  1GOZ A;  2BS3 B;  1C79 A;  1YJJ A;  1IBX A;  3C8Y A;  5BMI A;  5BYS A;  5C3J B;  2KWD A;  4KKJ A;  4OHJ A;  1AN8 A;  1JWU D;  2EEL A;  1DOX A;  3B9J A;  1GAQ B;  2IPK D;  1RFK A;  4HKQ A;  3P42 A;  1UUP A;  2HTM E;  1T6B X;  2BB5 A;  2JXT A;  1AW7 A;  1SXT A;  2BB6 A;  4L1B A;  4HRO A;  1YN5 A;  3NUH B;  3J9C A;  2BTE A;  1VRA B;  5EE9 A;  3R8B A;  3MC0 B;  3BYT B;  1MVK A;  1SJE D;  1IUE A;  1FXI A;  3AH7 A;  1C4P A;  4IDI A;  1L0V B;  3B2G A;  2OED A;  2XNA C;  1WGK A;  4MT5 A;  1K53 A;  4L2Y A;  1B9R A;  1V8C A;  1KFY B;  1CZP A;  2WXR A;  3AED B;  3CIR B;  1ZUD 2;  4WUR A;  3U4E G;  2YEP B;  4YSX B;  1VZ7 A;  1KLG D;  1EWC A;  4ARI A;  1STE A;  4LK0 M;  3CWI A;  2W54 A;  5G5G A;  1TS5 A;  3BYY B;  1WRI A;  2V0G A;  2WLB A;  3HRD D;  5I4D A;  3Q8E A;  1FRD A;  1XLN A;  1B1Z A;  1C78 A;  1JWA D;  1SF0 A;  3E56 A;  2X38 A;  1BUI C;  3P4Q B;  2WXN A;  2E6X A;  1VR9 A;  3HVZ A;  4JX1 C;  5BMH A;  4NJC A;  4XE0 A;  1UWM A;  4WQM A;  1C76 A;  1ZDX A;  1IGD A;  3AE1 B;  1AYF A;  2ZW1 A;  1E7P B;  1JW9 D;  1L5P A;  2E3T A;  1QLB B;  2H88 B;  2I38 A;  1N5X A;  3T3O A;  1WYG A;  5GXG B;  3PO0 A;  1C4A A;  1RM6 C;  1JRO A;  5FKA C;  4ZHP A;  2WXP A;  1L0Y B;  2IDY A;  4YT0 B;  5BMG A;  4ZHO A;  1E10 A;  2N0S B;  3VRB B;  1N60 A;  1XLP A;  4XWW A;  2I2Y A;  2IGG A;  2LHD A;  1KLU D;  1ZDV A;  2WQY B;  4HJG E;  1QOF A;  1V1P B;  2ONQ A;  1EWY C;  1F77 A;  1L6V A;  4P16 A;  4RGO S;  4YWG G;  3BVG A;  1IGC A;  3FC4 A;  2W82 A;  1PGX A;  1I4X A;  3FIL B;  1HQR D;  1XO3 A;  4YTP B;  1NYQ A;  3IT6 B;  4US8 A;  3AEC B;  2RDG A;  1ZOY B;  4XDD A;  1L4D B;  1UWX A;  5HG2 A;  2N9L A;  2BW2 A;  2KDM A;  5H8Y E;  1FD6 A;  3H8H A;  1OQQ A;  1QT9 A;  3B2F A;  3AE6 B;  4M0W A;  3AMZ A;  1L0X B;  2XN9 C;  1BXT A;  3AE3 B;  4JE3 B;  3URY A;  3HUI A;  3I9V 1;  1FNV A;  1XCT L;  2WP9 B;  2MJE A;  3VR8 B;  2WXG A;  2MH7 A;  2G1E A;  2PMV A;  1EU4 A;  1DOI A;  2WXF A;  2J53 A;  2JWU A;  1MHX A;  2TSS A;  3O13 A;  1E0Z A;  2ON8 A;  3BK2 A;  1VZ8 A;  1OFF A;  2V4I B;  5H92 C;  2FE8 A;  2KN4 A;  2NTT A;  2SEB D;  1Y56 A;  1QOA A;  3BVZ A;  4ZYS A;  1VZ6 A;  4REZ A;  4GLS C;  4N6E B;  1C4C A;  3BVM A;  4C56 C;  5EE3 A;  5FK9 C;  5D3D A;  2DYM A;  1HEZ E;  1J7A A;  3LB8 C;  5BYR A;  4IOI E;  2W55 A;  2J4X A;  3GS2 A;  2K5P A;  2ZW0 A;  3KQ4 A;  1V1P A;  3KWL A;  4HKZ E;  1NEK B;  3P4S B;  2QJL A;  3LYY A;  3TEY A;  1PUT A;  2V3N A;  5D3I B;  3FIL A;  4TMA B;  4AQ7 A;  3AE7 B;  1PGA A;  1XEE A;  3PZ7 A;  3Q8B A;  1M4V A;  2LJI A;  1T5X D;  1D4B A;  1GPX A;  2RPV A;  1JML A;  1T3Q A;  2Z8L A;  3DWG C;  4L23 A;  3AM9 A;  2MJD A;  4RF1 A;  2YEP F;  4JWU C;  1L4Z B;  2QSD A;  4PT5 A;  1FFU A;  2MEK A;  4RGN A;  4NAW B;  4YTM B;  2J52 A;  4A8X C;  1TKY A;  2AQ1 B;  3SR6 A;  3TEZ A;  3FAH A;  1ESF A;  1ROE A;  1KH0 A;  4AS1 A;  3TEX A;  1JWS D;  1V1O A;  1DOY A;  2WXQ A;  3ZQ4 A;  1TJE A;  2K0P A;  3ABV B;  1ET9 A;  3L4P A;  3BZD B;  5LNK 1;  3MHZ A;  1KF6 B;  3W2D A;  3Q8C A;  1TZO A;  1TS2 A;  4RF0 A;  4A6Q A;  1N61 A;  3DWM A;  4N59 A;  1FEH A;  1UNS A;  2QIE B;  2QEJ C;  3EUB 2;  3LXF A;  2QMT A;  2BBC A;  2IJ0 A;  1XCQ L;  2CJO A;  1K51 A;  5C2T B;  3TSS A;  3VRA B;  1F2R I;  5AUI A;  4ITK A;  1ZE3 D;  4LLG M;  1SE2 A;  4TSS A;  1N5W A;  1ACC A;  3AE8 B;  1D6E C;  2JQR B;  3BII D;  1QIL A;  1SJH D;  2EKI A;  2K3U A;  4OZB A;  2JYT A;  4B0M A;  2WXJ A;  2BS2 B;  3ZJV A;  1ET6 A;  1V97 A;  2PVO D;  2DLB A;  1ENF A;  2PW9 A;  3RPF C;  3ZYY X;  3KWV A;  3SFD B;  3N9Y C;  2PIA A;  4TQ1 A;  4TQ0 A;  1TYG B;  2M0A A;  2PVG C;  2JZP A;  2N9K A;  5T8I A;  1F2R C;  4XDC A;  1NI3 A;  1QKZ A;  1SSN A;  2PTL A;  4HRS A;  1TKE A;  3ETR A;  2IGH A;  1D5X C;  4YSY B;  3NVY A;  1I4H A;  2ICI A;  1DYQ A;  2N7J A;  2FBW B;  3R2I A;  4C7Y A;  3AEA B;  2BT6 A;  2VZK D;  5G5H A;  3TUO A;  1HA5 A;  4A90 A;  1NYR A;  1JWM D;  2INP E;  4RCO A;  2RDH A;  3SFE B;  4A9A A;  1FFV A;  1ZXH A;  5MPO A;  1JQ4 A;  2CU3 A;  4HEA 1;  3EGR A;  1ZP0 B;  1JWB D;  1YMH E;  1XXG A;  2MJ3 A;  1CK1 A;  1R7S A;  4O1N A;  2G9H D;  5EE1 A;  2GRI A;  3AN1 A;  1JRP A;  1TY2 A;  1NEN B;  1PGB A;  2M19 A;  4D2K A;  3KLS X;  3NVV A;  1K50 A;  2LUM A;  2NTS A;  2R61 A;  2B76 B;  4DXG A;  4DXF A;  3MFG A;  1C77 A;  1HZ5 A;  1XLQ A;  5FR3 A;  3IAS 1;  1YQ4 B;  1E6E B;  4OW0 A;  4JPS A;  1I4Q A;  1FNW A;  4IKG A;  3ZGZ A;  1N63 A;  2VZK B;  1I4R A;  2LFI A;  1FMA D;  2M56 B;  2L52 A;  3HVD A;  2KQ4 X;  4GDL B;  1XLO A;  2CJN A;  3AB5 A;  3IAM 1;  4WIP A;  4RGM A;  4NZL B;  2V3P A;  3AE2 B;  4DQO C;  3TEW A;  2DYO A;  2INN E;  3GB1 A;  2Y3A A;  1WXQ A;  4A55 A;  2SAK A;  1YN4 A;  2KMM A;  2AQ2 B;  1WWT A;  3AEB B;  2WDV B;  4EE2 A;  1SE4 A;  2W3S A;  3I57 A;  4ZOH C;  3OWE B;  1OQR A;  4KGS A;  4KKI A;  3E9S A;  2LHE A;  3MP9 A;  2WS3 B;  2IGD A;  1TS3 A;  4OVZ A;  1I7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...