2HDEA

Solution structure of human sap18
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
148
structure length
148
Chain Sequence
GSHMRVTQEEIKKEPEKPIDREKTSPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Histone deacetylase complex subunit SAP18
publication title Structure of SAP18: a ubiquitin fold in histone deacetylase complex assembly.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06487 SAP18 Sin3 associated polypeptide p18 (SAP18)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.550 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2hdeA01
4A8XC 2HDEA 4A6QA 4A90A
chains in the Genus database with same CATH superfamily
1J19A 3RUIB 4W9FA 1FEHA 2L3ZA 2BVCA 1ACCA 2R61A 3ZTCA 2LI5A 1MJDA 3FILB 1WXQA 4HDQA 4ICUA 5G5HA 4KIKB 2JZ3B 3GZNB 3DHGC 1Q0WB 2VZKD 2CJNA 3JSVA 2LZ6A 5JH5C 1FFUA 1HEZE 4MGYE 2WNMA 4WJNA 3Q8EA 3Q3MC 1QOGA 2D07B 5GXGB 1R4NI 2LVOA 1XLNA 2MSED 5IOIA 4N9F4 1GC7A 1IGDA 3H6NA 1TZOA 4LNIA 2N9PC 3LDZE 2BW2A 1TTNA 5JZEB 2GBRA 4XYCA 1CQVA 2DYBA 1F2RI 4FXCA 1YN3A 3ZIMA 1P7EA 5LNK1 4EE2A 1QF6A 4KVGB 3BY4B 1I4XA 2JXXA 1NI2A 1MFWA 4HVBA 4NPNA 4K81A 2SEBD 2C7HA 2VRRB 4HPLB 1C4CA 4EZKA 5D94A 2AX5A 4LLGM 4FA6A 2V3PA 4YWGG 5BYQA 3V6CB 2NVUI 3PTFC 4LDTB 3ZJTA 3NG0A 3A9KB 2CHZA 5J18A 2KZRA 4RNAA 2BB5A 5AUKA 3U7DA 4ZOHC 1MHXA 3L4PA 3N9YC 3TL5A 2XK5B 1P98A 3N3KB 2KVRA 1IUEA 4FJYA 3VTWA 1ZUD2 4UDUC 1SGHA 3WANA 2XEWA 2J52A 1KTKA 1E8WA 2G3QB 2O6VA 2YLMA 2NPTB 1SEBD 1WX8A 3QC8B 4A3OA 2BYEA 2KYWA 3AEDB 1FO4A 3FKYA 4GU2A 2L00B 1L6UA 3ABVB 3PREA 3VUWA 2FIDA 3ZJUA 4XWWA 3ZDMC 2TSSA 4DDGD 1K53A 1NYQA 4ANWA 4N58A 4Q2JA 3H9DA 1V5OA 1L2NA 1QOFA 4IG7B 1J7CA 2KWVB 2KACA 1OQYA 3Q6BA 4K7UA 3RULA 3RT3B 1OEYJ 1JMLA 2M0AA 2M8SA 1V5TA 4M0WA 1FM0D 1XXGA 2LMCA 2C7NB 1XO3A 2LHDA 1TBEA 2OOBB 3EC8A 2DYOA 1ET6A 2L32A 2LXAA 3BYTB 2WXHA 3RMKC 2J42A 1K51A 3P4SB 2QEJC 1T0YA 3UINB 2IY0B 3RZWC 2GMIC 2KJ6A 3QARA 5IAAC 4M01A 1EWCA 2DYMA 2BBCA 3TEYA 2G4DB 4MELA 1TKGA 4WJOA 1XLQA 1WRIA 4KX6B 2V3NA 2M19A 1R4NB 4DXGA 3RNFC 1J7AA 1WX9A 2FCSA 2N0SB 3DPDA 2UYZB 1YX5B 3IT4B 2K25A 4W9DA 4KGTA 5G55A 2JYTA 3T3OA 3I57A 1YIWA 2Y5CA 4W9IA 1RFAA 1V49A 2FCMA 2LGYA 2JVCA 2RMMA 3NZUA 4A55A 2KDFB 3AMZA 2MBHA 2WXRA 2KKCA 3V6EB 2DBYA 5E6JA 3R7QA 3A1QA 1E7VA 4RFBA 3KWLA 1V1PB 1J7BA 1JQ4A 4KV2A 3MJ5A 1TS2A 1T3QA 4ZRQA 3PRMB 3KUCB 1D6EC 3CF6E 1F1HA 3N1ZC 1WGHA 1TT5B 5GMVA 1L4DB 3QWZB 3OJ3A 4ZDVA 3HK0A 2IJ0A 1N62A 1NBFC 2KJRA 4P1BC 4AQ7A 3ENEA 3MTNB 1N6ZA 3P2BA 1SSNA 1NYRA 1WM3A 1V8CA 4JLCA 2J0MA 3A9JA 2R2QA 2KWCA 2KD0A 1HZ5A 3R66C 1U4AA 2QDFA 1A70A 4GMVA 2NS5A 1E8YA 3EFCA 1IGCA 4OZBA 3A33B 1WYGA 4GB9A 5L95C 2J0KA 4F1SA 1VDVA 3PS6A 4HPMB 2MJ3A 2BB6A 4RF1A 2KFJA 3ZKJC 3ZUNA 1YJ1A 3FC4A 4MM3B 3H7PB 4NJCA 2LASA 4AP4C 3T8MA 1LO5D 4IOIE 1FNVA 3UF8A 3C0RB 3W1SC 1HTQA 4E71A 3RNGC 4C4VA 2MJDA 1WWTA 2KFKA 1ZOYB 4PT5A 4AJWA 5CHWA 2K39A 1YNTE 4II2B 3TSSA 4NAMA 1SIFA 3Q3FA 1J0GA 2KMMA 5IN7A 1E8ZA 2N4FA 1ENFA 4JWUC 2K22A 5JHAA 1FXAA 3AECB 3DHIC 3MHZA 1I4QA 1NEKB 3DVNV 3P1MA 1WZ0A 4RGMA 3UQAA 1UGJA 2BWFA 1WFYA 4M02A 3U52E 2JY6A 1R7SA 2PTLA 1WGYA 1TY2A 1ZXHA 4ANXA 2NBUA 1CZPA 3BWUD 2Z0DB 3B0AA 4RGNA 3QQ8B 3MC8A 2EKIA 2QIEB 4MH0E 3GE3C 2YEPB 2EKEC 3AE8B 2L0TA 1WMHA 1L0VB 2AL3A 3AI5A 1VCBA 2V0GA 2N1WA 1C78A 3AE2B 3EECA 1E0ZA 4M00A 2ZW1A 2BS3B 4MH8A 2M56B 4A90A 1EU3A 3IFWB 3DVNU 2JWZA 3HM6X 3FILA 2KMAA 2QSDA 2VZKB 4B6WA 4W9CA 2NTSA 3GP7A 3QK0A 2RPQA 2MWSB 2A4ZA 1L0XB 4JX1C 2IO1B 4EUTA 3PT2B 4F8CB 4I6PA 5AUIA 3B2FA 3KQ4A 2KX3A 3TIXA 4BVUC 2V3SA 2IDYA 2HE7A 1P9DU 2HDEA 3VUXA 1WE7A 3QCAA 2ICIA 4GDKA 4YTMB 1FXIA 5EE1A 1P3QU 2LGXA 3S2AA 1ZE3D 2CU1A 3KH0A 2LEKA 4GSWA 4LJPB 4KGRA 4NQKE 2D3GA 3Q69A 4IWOA 1L0YB 3VRAB 3FAHA 3GOEA 2KDMA 2PIAA 2K5PA 2KLGA 1YX6B 1KF6B 5FR6A 1EF1A 1XCQL 3VFKA 4I6LB 1QOAA 2WDVB 4G3XB 2Y5BB 2K9XA 1YJIA 3V05A 3O13A 2XK5A 2IO2B 2JX5A 4IM0A 3W5VB 1NI3A 1GJZA 2LUMA 3SFEB 2Z0EB 4K7SA 5I4DA 1OQQA 1FRRA 2UU7A 3KUZA 1TGZB 2W82A 1IYFA 5BMGA 3R8BA 1WGGA 1ISNA 3GE8C 1YMHE 5E6OA 4CO7A 2N7JA 3I63C 3B2GA 1KM7A 1MG4A 1C76A 2KOXA 5E6PA 4J6IA 3NUHB 4A3PA 5D7GA 3URYA 3ONSA 2L05A 5KHQA 2AQ2B 1MVKA 1UH6A 3N32A 2WX1A 2JU6X 1MHHE 4HXDA 1SJHD 3WAPA 3PHXB 5G5GA 4DHJB 2EELA 1UNSA 2L8JA 1N61A 5EE3A 1P7FA 4FADA 3RN9C 4EZLA 3I5JC 1T0SC 2JF5A 4PK1A 3AULA 2JT4B 4OZAA 1QLBB 3VH3B 1RYJA 1EUVB 2FCNA 3GB1A 4OVVA 4YXDB 4XDDA 2MX2A 4REZA 4MACA 1LXDA 2NCNA 1V2YA 3NS8A 1V9JA 4HPPA 4FBJB 3A4SC 1VZ8A 3W2DA 3U30A 1VZ7A 2ZCBA 4FJVB 1N5XA 2AL6A 2BPSA 1B9RA 4USAA 4HWIB 3DVGX 3TBLD 1LFDA 2KAJA 2JZPA 3ALBA 4WWMA 2FCQA 3PLUA 2LGDA 3AM9A 2WXLA 1GB4A 4K3CA 2H89B 2PE6B 4JIOU 1CJEA 4RF0A 1JWBD 4HKZE 2K8HA 4W9HA 2DWQA 3ZNHB 3J9CA 3RD2A 1KLUD 1Y56A 2CU3A 5AEKB 4YSZB 4LNKA 5BMHA 5J17A 4K3BA 2D3CA 3PRPB 4FHJA 1FCCC 2OEDA 2WDQB 4XE0A 2C5LC 2M0XA 2FUG1 1ROEA 2HTHA 3KW5B 5HFYA 1KFYB 5DPSA 3HVZA 1DYQA 2MP2B 1VD2A 3BINA 3OWEB 3Q8CA 3MC0B 4DHZB 3W1SA 2KJHB 3P4PB 2PJHA 1UBQA 4GDLB 4NY0A 4BBNF 4NJ7A 2LXCA 2D10A 2GRIA 1MI0A 3B1LX 2KC1A 1VRAB 2PW9A 3IHPC 4L2YA 3SDLC 5CHVC 3PHWB 4ZRJA 2WXMA 3PZ8A 3BVMA 3E9SA 2RDGA 4URKA 2K1FA 3LB8C 2CKHB 3BZDB 2BT6A 3AU4A 3P4QB 2WXQA 3DBLB 2MCNB 4MM3A 3NVWA 3H7PA 5KHOA 4XGAB 4B0MA 3VRBB 2BQQA 3ZXVA 1I4HA 2L1AA 4G0NB 1TKEA 1JWAD 2FAZA 1WY8A 4OVUA 3H1UA 1SF0A 3R2TA 1XT9B 3U7ZA 3TMPB 1XF5L 3P42A 1F9JA 3EHVA 2RR9A 2L7RA 3WAOA 2NBWB 2QCZA 1EM7A 1JRPA 4DHJD 3Q8AA 2D11A 2B3AA 2MQJA 4A20A 3U8ZA 5IO9A 3CSTA 5T8IA 2BKRB 1WZ3A 2LJ5A 4AJYB 1P1AA 4AWJA 4HCNB 1RAXA 4H2AA 4KKIA 4W9KA 2W9NA 3DVGY 3KWVA 2MJEA 2C60A 1DOYA 3PSEB 5BYSA 1WM2A 3AEAB 1QT9A 5CTRC 2IGHA 4EFOA 3Q3JA 2KVZA 5DCNA 3UQBA 4HLEA 5AZFA 4A6QA 1WYWB 2DX5B 1I7HA 4IC7B 5HKHA 1WJ6A 2H88B 4MT5A 1T0RC 3R3MA 1K8RB 3VTVA 1I4PA 4C80A 4YTPB 2AWTA 2GOWA 2REXA 3I3TB 1XQQA 2GBNA 4WQMA 2LVPA 2PKOA 1E6EB 4WQOB 4JL9A 2K0PA 2ZPNA 1ZDVA 4HJGE 2ZPYA 1WH3A 2WYQA 4ZRIA 3ZW3A 3ETRA 3QHTA 4CQNA 1H8CA 4BZAA 2LWPA 2PEAA 4TQ1A 2PPHA 4XX5A 2KK8A 3RCZA 3ZQ4A 1Z2MA 2A5UA 2XBBC 2AQ1B 5IP4D 3K9PB 1I35A 3ZTDA 2GLSA 3MP9A 2IGDA 3C19A 1FIQA 1FRDA 1WF9A 2GI9A 4MJSB 2WXKA 3AE7B 4KSLC 1GUAB 4ZYSA 3HIZA 2BGFA 1Y8RC 4D2KA 1WIAA 4KZCA 1D4BA 3DDCB 2I2YA 4WIPA 5J2RA 2QC8A 1EF5A 4M8NA 1OTRB 3NJTA 3RZFA 1GC6A 3SHQA 4AUQC 5DPRA 1PQSA 2BYTA 1L5PA 2FBWB 2G1EA 4L1BA 1JWUD 3EGRA 2M1MA 5LLIA 1YD8U 1YQBA 3SR6A 3U2SC 2IGGA 2JYEA 2WQYB 3ZLZA 2WLBA 4RM9A 2RDHA 4ASWC 1KRHA 3KYCD 1G6JA 4AOFA 4B0EA 2DLBA 3AB5A 4JE3B 4E74A 3N1YC 3BYYB 4BKSD 4ARCA 1PDXA 2DAFA 2D2QA 2BF8B 3P4RB 2K8CA 3AN1A 4FLHA 3Q3NC 4B95A 4LTUA 3HHMA 4EZJA 4WWOA 1J8CA 1IBXA 1WSPA 3OG5A 3AEBB 5DPWA 5EDSA 2WXJA 3AE9B 1E10A 4US9A 1WRDB 3EA6A 1NDDA 3W5UB 3Q3OC 1JWSD 4M0WB 3JYUA 2JZZA 5E6NA 3MC9A 2QMTA 2KXJA 3WA0A 1AWDA 3MHSD 2IO0B 1HZ6A 4X57B 4HEA1 3NVYA 3KYDD 2RSUA 4HJKA 4C00A 1SE9A 2C7MB 3TEWA 4DXAB 2J7QB 2ACZB 3O65B 2J4XA 4KIKA 3RNEC 1VLBA 2K8BA 3JVZX 4WAAA 2WXGA 2KC2A 4G11A 3WCQA 4ANUA 5JHBA 4P16A 2WXNA 1C9FA 4GGQA 2ASQA 1NVID 2MBBB 1TIFA 4PYZA 2MA9B 2ZVNA 4PS3A 2JQRB 2D3AA 1CMXB 3ZNGC 2INNE 1JWMD 3AEFB 3ZNZB 4C7YA 2INCC 2MEKA 3IAS1 2KQ7A 1DGJA 1WI0A 2OHFA 3ZYYX 3M95A 2MBEA 3VAWA 1SB3C 3PVLA 2L52A 2KDBA 1FCLA 1FMAD 3DBRI 2W3RA 3DOWA 2PVGC 4GDLA 3ZO5B 1YN4A 1GPXA 2J53A 2FE8A 1PUTA 4YSYB 2BYFA 3A9KA 1WXVA 1YJJA 2N9LA 2WXFA 1QILA 1WJ4A 1ET9A 3AE4B 1IPGA 2BYVE 3ZXRA 2SAKA 2GBJA 3X23A 4XDCA 3RNBC 1UWMA 5TSSA 4JPSA 4RM8A 3VVWB 4EKUA 2LHEA 3RFZB 3L13A 1LQBA 2NPTA 2GBMA 3RNAC 2BTEA 4NJ6A 4DHZE 1VR9A 2KNBA 1C79A 4WH4A 3NOBA 2D3BA 1UBIA 1EU4A 1RWSA 2IO3B 3L17A 1GB1A 5HI1A 2HJ1A 3PZDA 4PS8A 5IKCM 3V3XA 5CHFA 3VTUA 1QKZA 3DBLI 4JGHB 5FK9C 2O6VD 5D6JB 4C4VB 2ZCCA 3MJWA 2LD9A 3DWGC 4MGIE 2I1JA 2KFKB 2LVQA 1LGRA 4WWNA 5TR5A 2L0FA 1VJKA 3EUB2 1N60A 1WX7A 2WU2B 3Q8FA 4OW0A 1TS5A 2CHWA 5C3JB 4MDKE 3WAMA 2V4IB 2ON8A 3TEZA 3NS1A 4GN1A 1SIJA 1V6EA 3QJZA 3M3JA 1JW9D 1JCKB 2DAJA 3R2IA 1KLGD 1T6BX 1GAQB 2DZKA 2HTME 3N20C 4OVZA 3TUOA 3QAQA 3L0WB 2W54A 3CSFA 2MBQA 1SJED 2KX0A 1STEA 1S1QB 2O2VB 4MEMA 2ZW0A 3ZVVA 2WDTB 1ESFA 4KKJA 3V61A 4HKQA 2G45B 1QQRA 2W3SA 1WXAA 3BVZA 4RCOA 3IVFA 2BWES 4WAFA 2WHIA 5BO4B 2R2OA 1TZ1A 1HQRD 4LCDE 4TKNA 3T3NA 1YQ3B 4MGKE 3DWMA 1UF0A 1V81A 1UGMA 1JROA 5HHDG 3Q14C 4DK5A 3DBRB 1V1PA 1YQ4B 2X38A 3ZJVA 3DHHC 1E7UA 1QOBA 2CHXA 2MH7A 4RMAA 1HE8A 1I4RA 2RPVA 4LJOB 4HDOA 5LXHA 3DBSA 5H92C 4IW0A 1WXMA 1C4AA 2G4SA 1Z5SB 5FR3A 4GDKB 4GXBA 4BBNC 1CK1A 1ZKHA 2Y5PA 3AH7A 3ZNID 3PZ7A 3UI3A 4E3CA 4YL8A 4MJSA 3NY5A 5G2NA 2DZIA 3VHTC 2KO3A 1EWYC 1L7YA 4DXFA 4TV3A 2X8XX 1PFDA 3DBHI 5L83A 2IPKD 1FNWA 2QJLA 3APFA 2PVOD 1UD7A 3P63A 4KSKC 3WALA 2Z59B 1V97A 2L76A 1X1MA 2AYOB 4BFRA 4IM2A 3M63B 3DCGA 3NZ3A 2ZEQA 4YSXB 4EEWA 3RPFC 2KQSA 1OEYA 4EOYA 2MHJA 1OFFA 4JWSC 4KGSA 4DBGA 4QAYA 4NAWB 2EMSA 3ZRFA 2KTRB 2BS4B 1XEEA 2NR2A 4IWPA 2LRUA 4R3DA 4YTNB 2V9HA 4HK2A 1BXTA 1T5XD 4PS7A 3QIJA 2JWUA 2ZVOA 2UWQA 3K9OB 4FULA 3TJPA 2KHWB 4MGZE 2E3TA 2N9EB 4ZHOA 4A8XC 5EE0A 5IA7A 1HTOA 2K6QA 4BKTA 3ECIA 2CS4A 1UUPA 1Q10A 2D5GA 4O1NA 2KANA 3IG3A 1LM8B 1DOXA 1RLFA 3NVVA 1P0RA 1WGRA 3HRDD 1Q5WB 1ZXIA 1FPYA 4YT0B 1D5ZC 2AQ3B 3X0WA 1AW7A 2RDBC 1TJEA 2L83A 1WE6A 3W1YA 2ONQA 2GBKA 2KDEB 4ZHPA 4WJPA 4P7IA 3D32A 4TSSA 2WS3B 4FJZA 3SEBA 1D5MC 1JALA 3ML9A 5JXVA 2EMTA 3U4EG 1JRUA 2JRHA 1M94A 1C3TA 3JW0X 4MSQB 2WXIA 4TUUA 2KDIA 3APCA 3GS2A 1V80A 4PYUA 1AN8A 4OZCA 2ZJDA 3KVFB 3ML8A 2B76B 2G9HD 5FKAC 5AZHA 1K52A 1SBBB 4ZRPA 3VDZA 2INPE 3JSVB 3AE6B 2V4LA 1BMLC 3IBEA 2JRIB 3B9JA 1GNUA 2Q5WD 2V1YA 1ZGUB 3BK2A 4WURA 1ZDXA 3VR9B 2RGFA 4FHKA 1D3ZA 1WGKA 3DBHB 2DNFA 3UIPB 1UZXB 1YN5A 3KUDB 4BOZB 4HRSA 2NTTA 2Z8LA 2XN9C 4ANVA 2N7DA 1UWXA 1TS4A 1H4RA 3Q8BA 2ZZPB 3NZSA 3PO0A 1RRBA 1D5XC 3TCAA 3EFUA 2CJOA 3VQIA 1F2RC 1OQRA 3CMMB 4N59A 4NQLB 1TKYA 2DZMA 2OJRA 1GG3A 1ZW7A 3LXFA 4NNJB 4XWTA 3ZDTA 1XD3B 4ZRKA 4W9GA 3TEXA 1WR1A 3V62A 4K7WA 2IYDB 4CYEA 1XLOA 3L10B 4C7ZA 2AEHA 4ACFA 4KDIC 4WWPA 4LDTD 2KQ4X 3RNCC 2PLPA 3I9V1 2MBOA 1R4MI 3CIRB 3W9CB 2FIFA 5C1ZA 2WWZA 3AEEB 5CX3A 2INDC 3HUIA 3IXSA 2O6VB 3VH4B 4S0RA 5EE9A 4XZ4A 1VZ6A 2IY1B 2K6DB 4HROA 1FNUA 4RGOS 2LFIA 3Q2AC 3OAWA 1WXSA 4MSMB 3VUYA 2WXPA 1F77A 3NHEB 1I42A 2KWDA 3CWIA 3BVGA 3VXWA 1KOTA 1F52A 3NRZA 5H8YE 1RFKA 3AXCA 2LGIA 4W9LA 4DQOC 5MPOA 3MFGA 1YOVB 1TS3A 1GOZA 4K1RB 1ZP0B 4AS1A 1WJUA 1PGBA 4US8A 1OGWA 3T9LA 3WIMA 3AU5A 3H7SA 3QX1A 2I1KA 1S3SG 4KZ0A 3ZGZA 4KDLB 1E7PB 3PPAA 4JQWC 5C2TB 1E8XA 3NVZA 2OJWA 2WU5B 4F7ZA 4IWQA 4B9KA 4IM3A 4GOCA 1I4GA 2YVCA 3OLMD 1L6VA 1FD6A 2O2VA 3DQVA 3E56A 2KTFA 2VH1A 2JXTA 1C1YB 4LNOA 2DENB 3IT6B 1SE3A 3HM3A 1KLVA 2J0JA 2KWUB 2MRPA 2W55A 4TQ0A 4A9AA 1B1ZA 2N9KA 4RH6A 2KN5A 5LXIB 3L54A 1A5RA 3PGEA 1BUIC 1PGAA 4BOSC 4GLSC 2GB1A 2KMCA 4GIVA 1WJNA 2WX0A 3PV1A 2BKFA 2JSVX 2I38A 2Y3AA 3LYYA 3VR8B 3SU8X 2LUEA 2E6XA 5BMIA 1F0ZA 4G50A 4ARIA 4ITKA 2QILA 5DPTA 3V60A 1K50A 3A1QB 1UELA 3AE3B 3APDA 3ZRCA 4RGTA 3RYTA 3L16A 2MP2A 4M8MA 4FN2A 1Q1OA 2YEPF 1N63A 2PMVA 4LK0M 4OHJA 3GZNI 3AEGB 2FNJB 1DOIA 2C9WB 1QZEA 1R4MB 2MW5A 1KH0A 3R7RA 4LNFA 4LNNA 2ZNVB 3N1XC 3L08A 4S17A 4II3B 2NMQA 3AE5B 1FXTB 1PGXA 4HCPB 2NBVB 1WGDA 2LJIA 3A9JB 3IAM1 3N30A 2FUHB 4IUMB 5BYRA 1N5WA 2QHOA 1AARA 1V86A 2PE9A 3LJ3A 1AYFA 3OJ4B 3H8HA 1TYGB 3UGBB 2HJ8A 1XCTL 4CHKA 3BK1A 3BIID 2DHZA 4L23A 4TMAB 2JPHA 3UIOB 2VH2A 4NAWA 2KTRA 1T0QC 2M4NA 2N1VA 4P1CC 1V1OA 4N6EB 3AE1B 2ZNVC 4BKSA 2KN4A 2CR5A 2WDRB 1C77A 4XC2A 3PRZA 1BT0A 1NENB 1ZPSA 3M62B 1L4ZB 1RM6C 2N7EA 4C56C 2XNAC 2N9XA 1HXYD 4W9JA 4ICVA 1XLPA 3SD5A 5D3DA 5C23A 1SE4A 2DZJA 4BKGA 4DDID 1SXTA 2WGSA 1MG8A 3HVDA 1SE2A 2WP9B 4W9EA 2BS2B 5AZGA 3C8YA 1EO6A 3KLSX 2IBIB 2M17A 4WJQA 1IP9A 4IDIA 5HG2A 4I6NB 3RI7C 2KLCA 1IBXB 2LGSA 3QA8A 2JUOA 1WR6E 1TY0A 1E9MA 2HD5B 1E90A 4IKGA 1C4PA 4ZYNA 5D2MB 4DWFA 3A4RA 1MPEA 4BAXA 1FFVA 2LRWA 1E5WA 2MLBA 4NZLB 5D3IB 3PLVA 2WXOA 1WMHB 4J3OD 1HA5A 3B08A 2K3UA 4P6VF 3AV8A 2IZVB 2RD0A 3SFDB 1M4VA 2KT7A 1KJTA 1PYWD
chains in the Genus database with same CATH topology
3Q69A 1L0YB 3VRAB 1FEHA 3FAHA 2KDMA 2PIAA 2K5PA 3SR6A 1ACCA 2R61A 3U2SC 2IGGA 2JYEA 3FILB 2WQYB 1WXQA 1UUPA 2WLBA 1Q10A 5G5HA 2D5GA 4O1NA 1KF6B 1XCQL 1DOXA 3NVVA 2RDHA 1KRHA 2VZKD 2CJNA 3HRDD 1QOAA 1ZXIA 4YT0B 1D5ZC 2AQ3B 4B0EA 1AW7A 2DLBA 1FFUA 1HEZE 2WDVB 2WNMA 3AB5A 3Q8EA 4JE3B 1TJEA 1QOGA 2L83A 5GXGB 1XLNA 2K9XA 1YJIA 3V05A 2ONQA 3O13A 4ZHPA 1IGDA 3BYYB 1TZOA 2JX5A 4TSSA 4ARCA 1PDXA 2BW2A 3W5VB 2WS3B 1NI3A 3SEBA 1D5MC 1JALA 2LUMA 3SFEB 5JXVA 1CQVA 3P4RB 3U4EG 1F2RI 3AN1A 1YN3A 4FXCA 1P7EA 5I4DA 1OQQA 5LNK1 1FRRA 4EE2A 1QF6A 4LTUA 1I4XA 2W82A 5BMGA 3R8BA 1IBXA 1WSPA 2WXIA 3AEBB 1YMHE 2SEBD 2WXJA 2N7JA 3AE9B 3GS2A 1AN8A 4US9A 1E10A 3B2GA 4OZCA 1C4CA 3EA6A 2B76B 2G9HD 1C76A 3W5UB 2AX5A 4LLGM 5FKAC 1JWSD 1K52A 1SBBB 4ZRPA 2V3PA 2QMTA 4YWGG 5BYQA 1AWDA 3NUHB 2INPE 5D7GA 3URYA 3AE6B 3ZJTA 1BMLC 1HZ6A 2AQ2B 1MVKA 3B9JA 4HEA1 4RNAA 2BB5A 5AUKA 2Q5WD 4ZOHC 3NVYA 1MHXA 3L4PA 2JU6X 1MHHE 1SJHD 3BK2A 3N9YC 4WURA 1ZDXA 5G5GA 3VR9B 2EELA 1UNSA 1WGKA 1IUEA 1N61A 5EE3A 1P7FA 3TEWA 1ZUD2 1YN5A 4UDUC 2ACZB 4HRSA 2J4XA 2J52A 2NTTA 1KTKA 2Z8LA 1VLBA 2XN9C 2WXGA 3WCQA 1UWXA 1TS4A 1SEBD 3Q8BA 4OZAA 1QLBB 1RYJA 3TEYA 4P16A 3PO0A 2WXNA 1D5XC 1C9FA 3GB1A 2CJOA 4YXDB 3AEDB 1NVID 4XDDA 3VQIA 1F2RC 1FO4A 1OQRA 4REZA 4N59A 4MACA 1L6UA 3ABVB 3ZJUA 1TKYA 4XWWA 2TSSA 3LXFA 1K53A 4XWTA 1NYQA 2JQRB 4N58A 1VZ8A 4Q2JA 3TEXA 2INNE 1JWMD 3AEFB 3W2DA 1XLOA 4C7YA 1VZ7A 4C7ZA 1N5XA 2MEKA 3IAS1 1QOFA 2KQ4X 1DGJA 2PLPA 3I9V1 4USAA 1B9RA 1J7CA 2OHFA 3ZYYX 2KACA 3CIRB 1SB3C 2L52A 1JMLA 2M0AA 2KAJA 1FCLA 1FMAD 2JZPA 3W9CB 4WWMA 2W3RA 3AEEB 4M0WA 3AM9A 2PVGC 1FM0D 1XXGA 3HUIA 2LMCA 2WXLA 3IXSA 1XO3A 1YN4A 1GB4A 2LHDA 2J53A 1GPXA 2H89B 2FE8A 1PUTA 4YSYB 5EE9A 1CJEA 1YJJA 1VZ6A 2DYOA 2N9LA 4RF0A 1ET6A 1JWBD 2L32A 2WXFA 3BYTB 2WXHA 4HROA 1QILA 4HKZE 2J42A 1FNUA 4RGOS 1ET9A 1K51A 3AE4B 2DWQA 2LFIA 3P4SB 3J9CA 1KLUD 1Y56A 2QEJC 2CU3A 2WXPA 1F77A 2SAKA 4YSZB 5BMHA 2KWDA 3CWIA 3BVGA 3NRZA 5H8YE 1RFKA 4XDCA 1FCCC 1EWCA 1UWMA 2BBCA 2DYMA 2LGIA 2OEDA 2WDQB 5TSSA 3MFGA 4DQOC 1TS3A 1TKGA 4JPSA 4XE0A 5MPOA 1GOZA 1XLQA 2LHEA 3RFZB 1WRIA 1ZP0B 4AS1A 2FUG1 2V3NA 1ROEA 4KX6B 2M19A 5HFYA 1KFYB 1PGBA 4DXGA 4US8A 1J7AA 3HVZA 2N0SB 2BTEA 1DYQA 1VR9A 1C79A 3IT4B 4WH4A 3OWEB 3Q8CA 3MC0B 2JYTA 4KGTA 3T3OA 3I57A 3ZGZA 3W1SA 1EU4A 1RWSA 3P4PB 1GB1A 1E7PB 5HI1A 2Y5CA 4GDLB 2GRIA 5C2TB 3NVZA 3V3XA 2WU5B 2RMMA 1MI0A 1QKZA 4A55A 1VRAB 2PW9A 3AMZA 5FK9C 2WXRA 4L2YA 1I4GA 2DBYA 5E6JA 1L6VA 1FD6A 3E56A 3DWGC 2WXMA 3PZ8A 4RFBA 2JXTA 3BVMA 1V1PB 3KWLA 1J7BA 2RDGA 3E9SA 1JQ4A 3MJ5A 3LB8C 1VJKA 3IT6B 1TS2A 1T3QA 1SE3A 4ZRQA 3BZDB 3EUB2 1N60A 2BT6A 3P4QB 1D6EC 3Q8FA 2W55A 2WU2B 4OW0A 4TQ0A 1TS5A 1B1ZA 2WXQA 4A9AA 2N9KA 4RH6A 1L4DB 5C3JB 3NVWA 2V4IB 2ON8A 3TEZA 3NS1A 2IJ0A 1SIJA 4B0MA 1N62A 3VRBB 1JW9D 1JCKB 4AQ7A 3R2IA 1BUIC 1PGAA 1KLGD 1T6BX 1GAQB 1I4HA 2L1AA 4GLSC 2GB1A 2HTME 2JSVX 2I38A 4OVZA 2Y3AA 3TUOA 3LYYA 1TKEA 3VR8B 5BMIA 2E6XA 1SSNA 1NYRA 1JWAD 1F0ZA 1V8CA 2W54A 4ARIA 1SJED 1HZ5A 4ITKA 1STEA 1SF0A 1A70A 2QILA 1K50A 3R2TA 3U7ZA 1XF5L 3P42A 3AE3B 2ZW0A 1IGCA 4OZBA 4RGTA 1WYGA 1ESFA 4KKJA 1VDVA 2MJ3A 2BB6A 4RF1A 4HKQA 1EM7A 2YEPF 1QQRA 1N63A 1JRPA 2W3SA 2PMVA 3Q8AA 3BVZA 4RCOA 4LK0M 4OHJA 3FC4A 4WAFA 4MM3B 3AEGB 1HQRD 3T3NA 4NJCA 1DOIA 5T8IA 1LO5D 1YQ3B 4IOIE 1FNVA 3DWMA 1KH0A 1JROA 5HHDG 2MJDA 4H2AA 1V1PA 1YQ4B 4KKIA 2X38A 1WWTA 1ZOYB 2NMQA 4PT5A 3ZJVA 3AE5B 1PGXA 1YNTE 1QOBA 2MH7A 2LJIA 3IAM1 3KWVA 3TSSA 4NAMA 2MJEA 1DOYA 2KMMA 1I4RA 2RPVA 5BYRA 5BYSA 1N5WA 3AEAB 1QT9A 1ENFA 4JWUC 2IGHA 2K22A 5H92C 1FXAA 3AECB 1C4AA 3MHZA 5FR3A 1AYFA 4GDKB 3H8HA 1I4QA 1NEKB 3P1MA 1TYGB 4A6QA 1CK1A 1XCTL 2Y5PA 3AH7A 4RGMA 1I7HA 3BK1A 1UGJA 3PZ7A 3BIID 4L23A 3UI3A 2H88B 4TMAB 4MT5A 3U52E 1R7SA 2PTLA 1TY2A 1I4PA 1ZXHA 4C80A 4YTPB 1V1OA 1CZPA 4N6EB 3AE1B 3BWUD 2KN4A 4RGNA 4WQMA 2WDRB 1C77A 2PKOA 1EWYC 1NENB 1ZPSA 4DXFA 1L4ZB 1E6EB 2EKIA 1PFDA 1RM6C 2IPKD 1FNWA 2QIEB 2QJLA 4C56C 2PVOD 2XNAC 2YEPB 3AE8B 1L0VB 3P63A 2K0PA 1HXYD 1ZDVA 2V0GA 1C78A 3AE2B 1V97A 4HJGE 1XLPA 1E0ZA 5D3DA 1SE4A 2ZW1A 2BS3B 4MH8A 3NZ3A 2M56B 3ETRA 4A90A 4YSXB 1EU3A 4CQNA 1SXTA 3RPFC 3HVDA 3FILA 1SE2A 4TQ1A 2WP9B 2QSDA 2VZKB 1OFFA 2BS2B 3ZQ4A 2NTSA 3GP7A 4JWSC 3C8YA 1L0XB 3KLSX 2AQ1B 4KGSA 4JX1C 4NAWB 3MP9A 2BS4B 2IGDA 1FIQA 1FRDA 4IDIA 2GI9A 5HG2A 5AUIA 1XEEA 2WXKA 3AE7B 3B2FA 1IBXB 3KQ4A 4ZYSA 1TY0A 4R3DA 4YTNB 1E9MA 4D2KA 4IKGA 1D4BA 1C4PA 2I2YA 2IDYA 4WIPA 2HDEA 1BXTA 1T5XD 1MPEA 2JWUA 2ICIA 1FFVA 4YTMB 5D3IB 4NZLB 1FXIA 5EE1A 2WXOA 4J3OD 1HA5A 2K3UA 4P6VF 2BYTA 3AV8A 1L5PA 1ZE3D 2E3TA 3SFDB 2FBWB 1M4VA 2G1EA 4L1BA 1JWUD 4A8XC 4ZHOA 2LEKA 5EE0A 4KGRA 3EGRA 1PYWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A8X C;  2HDE A;  4A6Q A;  4A90 A; 
#chains in the Genus database with same CATH topology
 1J19 A;  3RUI B;  4W9F A;  1FEH A;  2L3Z A;  2BVC A;  1ACC A;  2R61 A;  3ZTC A;  2LI5 A;  1MJD A;  3FIL B;  1WXQ A;  4HDQ A;  4ICU A;  5G5H A;  4KIK B;  2JZ3 B;  3GZN B;  3DHG C;  1Q0W B;  2VZK D;  2CJN A;  3JSV A;  2LZ6 A;  5JH5 C;  1FFU A;  1HEZ E;  4MGY E;  2WNM A;  4WJN A;  3Q8E A;  3Q3M C;  1QOG A;  2D07 B;  5GXG B;  1R4N I;  2LVO A;  1XLN A;  2MSE D;  5IOI A;  4N9F 4;  1GC7 A;  1IGD A;  3H6N A;  1TZO A;  4LNI A;  2N9P C;  3LDZ E;  2BW2 A;  1TTN A;  5JZE B;  2GBR A;  4XYC A;  1CQV A;  2DYB A;  1F2R I;  4FXC A;  1YN3 A;  3ZIM A;  1P7E A;  5LNK 1;  4EE2 A;  1QF6 A;  4KVG B;  3BY4 B;  1I4X A;  2JXX A;  1NI2 A;  1MFW A;  4HVB A;  4NPN A;  4K81 A;  2SEB D;  2C7H A;  2VRR B;  4HPL B;  1C4C A;  4EZK A;  5D94 A;  2AX5 A;  4LLG M;  4FA6 A;  2V3P A;  4YWG G;  5BYQ A;  3V6C B;  2NVU I;  3PTF C;  4LDT B;  3ZJT A;  3NG0 A;  3A9K B;  2CHZ A;  5J18 A;  2KZR A;  4RNA A;  2BB5 A;  5AUK A;  3U7D A;  4ZOH C;  1MHX A;  3L4P A;  3N9Y C;  3TL5 A;  2XK5 B;  1P98 A;  3N3K B;  2KVR A;  1IUE A;  4FJY A;  3VTW A;  1ZUD 2;  4UDU C;  1SGH A;  3WAN A;  2XEW A;  2J52 A;  1KTK A;  1E8W A;  2G3Q B;  2O6V A;  2YLM A;  2NPT B;  1SEB D;  1WX8 A;  3QC8 B;  4A3O A;  2BYE A;  2KYW A;  3AED B;  1FO4 A;  3FKY A;  4GU2 A;  2L00 B;  1L6U A;  3ABV B;  3PRE A;  3VUW A;  2FID A;  3ZJU A;  4XWW A;  3ZDM C;  2TSS A;  4DDG D;  1K53 A;  1NYQ A;  4ANW A;  4N58 A;  4Q2J A;  3H9D A;  1V5O A;  1L2N A;  1QOF A;  4IG7 B;  1J7C A;  2KWV B;  2KAC A;  1OQY A;  3Q6B A;  4K7U A;  3RUL A;  3RT3 B;  1OEY J;  1JML A;  2M0A A;  2M8S A;  1V5T A;  4M0W A;  1FM0 D;  1XXG A;  2LMC A;  2C7N B;  1XO3 A;  2LHD A;  1TBE A;  2OOB B;  3EC8 A;  2DYO A;  1ET6 A;  2L32 A;  2LXA A;  3BYT B;  2WXH A;  3RMK C;  2J42 A;  1K51 A;  3P4S B;  2QEJ C;  1T0Y A;  3UIN B;  2IY0 B;  3RZW C;  2GMI C;  2KJ6 A;  3QAR A;  5IAA C;  4M01 A;  1EWC A;  2DYM A;  2BBC A;  3TEY A;  2G4D B;  4MEL A;  1TKG A;  4WJO A;  1XLQ A;  1WRI A;  4KX6 B;  2V3N A;  2M19 A;  1R4N B;  4DXG A;  3RNF C;  1J7A A;  1WX9 A;  2FCS A;  2N0S B;  3DPD A;  2UYZ B;  1YX5 B;  3IT4 B;  2K25 A;  4W9D A;  4KGT A;  5G55 A;  2JYT A;  3T3O A;  3I57 A;  1YIW A;  2Y5C A;  4W9I A;  1RFA A;  1V49 A;  2FCM A;  2LGY A;  2JVC A;  2RMM A;  3NZU A;  4A55 A;  2KDF B;  3AMZ A;  2MBH A;  2WXR A;  2KKC A;  3V6E B;  2DBY A;  5E6J A;  3R7Q A;  3A1Q A;  1E7V A;  4RFB A;  3KWL A;  1V1P B;  1J7B A;  1JQ4 A;  4KV2 A;  3MJ5 A;  1TS2 A;  1T3Q A;  4ZRQ A;  3PRM B;  3KUC B;  1D6E C;  3CF6 E;  1F1H A;  3N1Z C;  1WGH A;  1TT5 B;  5GMV A;  1L4D B;  3QWZ B;  3OJ3 A;  4ZDV A;  3HK0 A;  2IJ0 A;  1N62 A;  1NBF C;  2KJR A;  4P1B C;  4AQ7 A;  3ENE A;  3MTN B;  1N6Z A;  3P2B A;  1SSN A;  1NYR A;  1WM3 A;  1V8C A;  4JLC A;  2J0M A;  3A9J A;  2R2Q A;  2KWC A;  2KD0 A;  1HZ5 A;  3R66 C;  1U4A A;  2QDF A;  1A70 A;  4GMV A;  2NS5 A;  1E8Y A;  3EFC A;  1IGC A;  4OZB A;  3A33 B;  1WYG A;  4GB9 A;  5L95 C;  2J0K A;  4F1S A;  1VDV A;  3PS6 A;  4HPM B;  2MJ3 A;  2BB6 A;  4RF1 A;  2KFJ A;  3ZKJ C;  3ZUN A;  1YJ1 A;  3FC4 A;  4MM3 B;  3H7P B;  4NJC A;  2LAS A;  4AP4 C;  3T8M A;  1LO5 D;  4IOI E;  1FNV A;  3UF8 A;  3C0R B;  3W1S C;  1HTQ A;  4E71 A;  3RNG C;  4C4V A;  2MJD A;  1WWT A;  2KFK A;  1ZOY B;  4PT5 A;  4AJW A;  5CHW A;  2K39 A;  1YNT E;  4II2 B;  3TSS A;  4NAM A;  1SIF A;  3Q3F A;  1J0G A;  2KMM A;  5IN7 A;  1E8Z A;  2N4F A;  1ENF A;  4JWU C;  2K22 A;  5JHA A;  1FXA A;  3AEC B;  3DHI C;  3MHZ A;  1I4Q A;  1NEK B;  3DVN V;  3P1M A;  1WZ0 A;  4RGM A;  3UQA A;  1UGJ A;  2BWF A;  1WFY A;  4M02 A;  3U52 E;  2JY6 A;  1R7S A;  2PTL A;  1WGY A;  1TY2 A;  1ZXH A;  4ANX A;  2NBU A;  1CZP A;  3BWU D;  2Z0D B;  3B0A A;  4RGN A;  3QQ8 B;  3MC8 A;  2EKI A;  2QIE B;  4MH0 E;  3GE3 C;  2YEP B;  2EKE C;  3AE8 B;  2L0T A;  1WMH A;  1L0V B;  2AL3 A;  3AI5 A;  1VCB A;  2V0G A;  2N1W A;  1C78 A;  3AE2 B;  3EEC A;  1E0Z A;  4M00 A;  2ZW1 A;  2BS3 B;  4MH8 A;  2M56 B;  4A90 A;  1EU3 A;  3IFW B;  3DVN U;  2JWZ A;  3HM6 X;  3FIL A;  2KMA A;  2QSD A;  2VZK B;  4B6W A;  4W9C A;  2NTS A;  3GP7 A;  3QK0 A;  2RPQ A;  2MWS B;  2A4Z A;  1L0X B;  4JX1 C;  2IO1 B;  4EUT A;  3PT2 B;  4F8C B;  4I6P A;  5AUI A;  3B2F A;  3KQ4 A;  2KX3 A;  3TIX A;  4BVU C;  2V3S A;  2IDY A;  2HE7 A;  1P9D U;  2HDE A;  3VUX A;  1WE7 A;  3QCA A;  2ICI A;  4GDK A;  4YTM B;  1FXI A;  5EE1 A;  1P3Q U;  2LGX A;  3S2A A;  1ZE3 D;  2CU1 A;  3KH0 A;  2LEK A;  4GSW A;  4LJP B;  4KGR A;  4NQK E;  2D3G A;  3Q69 A;  4IWO A;  1L0Y B;  3VRA B;  3FAH A;  3GOE A;  2KDM A;  2PIA A;  2K5P A;  2KLG A;  1YX6 B;  1KF6 B;  5FR6 A;  1EF1 A;  1XCQ L;  3VFK A;  4I6L B;  1QOA A;  2WDV B;  4G3X B;  2Y5B B;  2K9X A;  1YJI A;  3V05 A;  3O13 A;  2XK5 A;  2IO2 B;  2JX5 A;  4IM0 A;  3W5V B;  1NI3 A;  1GJZ A;  2LUM A;  3SFE B;  2Z0E B;  4K7S A;  5I4D A;  1OQQ A;  1FRR A;  2UU7 A;  3KUZ A;  1TGZ B;  2W82 A;  1IYF A;  5BMG A;  3R8B A;  1WGG A;  1ISN A;  3GE8 C;  1YMH E;  5E6O A;  4CO7 A;  2N7J A;  3I63 C;  3B2G A;  1KM7 A;  1MG4 A;  1C76 A;  2KOX A;  5E6P A;  4J6I A;  3NUH B;  4A3P A;  5D7G A;  3URY A;  3ONS A;  2L05 A;  5KHQ A;  2AQ2 B;  1MVK A;  1UH6 A;  3N32 A;  2WX1 A;  2JU6 X;  1MHH E;  4HXD A;  1SJH D;  3WAP A;  3PHX B;  5G5G A;  4DHJ B;  2EEL A;  1UNS A;  2L8J A;  1N61 A;  5EE3 A;  1P7F A;  4FAD A;  3RN9 C;  4EZL A;  3I5J C;  1T0S C;  2JF5 A;  4PK1 A;  3AUL A;  2JT4 B;  4OZA A;  1QLB B;  3VH3 B;  1RYJ A;  1EUV B;  2FCN A;  3GB1 A;  4OVV A;  4YXD B;  4XDD A;  2MX2 A;  4REZ A;  4MAC A;  1LXD A;  2NCN A;  1V2Y A;  3NS8 A;  1V9J A;  4HPP A;  4FBJ B;  3A4S C;  1VZ8 A;  3W2D A;  3U30 A;  1VZ7 A;  2ZCB A;  4FJV B;  1N5X A;  2AL6 A;  2BPS A;  1B9R A;  4USA A;  4HWI B;  3DVG X;  3TBL D;  1LFD A;  2KAJ A;  2JZP A;  3ALB A;  4WWM A;  2FCQ A;  3PLU A;  2LGD A;  3AM9 A;  2WXL A;  1GB4 A;  4K3C A;  2H89 B;  2PE6 B;  4JIO U;  1CJE A;  4RF0 A;  1JWB D;  4HKZ E;  2K8H A;  4W9H A;  2DWQ A;  3ZNH B;  3J9C A;  3RD2 A;  1KLU D;  1Y56 A;  2CU3 A;  5AEK B;  4YSZ B;  4LNK A;  5BMH A;  5J17 A;  4K3B A;  2D3C A;  3PRP B;  4FHJ A;  1FCC C;  2OED A;  2WDQ B;  4XE0 A;  2C5L C;  2M0X A;  2FUG 1;  1ROE A;  2HTH A;  3KW5 B;  5HFY A;  1KFY B;  5DPS A;  3HVZ A;  1DYQ A;  2MP2 B;  1VD2 A;  3BIN A;  3OWE B;  3Q8C A;  3MC0 B;  4DHZ B;  3W1S A;  2KJH B;  3P4P B;  2PJH A;  1UBQ A;  4GDL B;  4NY0 A;  4BBN F;  4NJ7 A;  2LXC A;  2D10 A;  2GRI A;  1MI0 A;  3B1L X;  2KC1 A;  1VRA B;  2PW9 A;  3IHP C;  4L2Y A;  3SDL C;  5CHV C;  3PHW B;  4ZRJ A;  2WXM A;  3PZ8 A;  3BVM A;  3E9S A;  2RDG A;  4URK A;  2K1F A;  3LB8 C;  2CKH B;  3BZD B;  2BT6 A;  3AU4 A;  3P4Q B;  2WXQ A;  3DBL B;  2MCN B;  4MM3 A;  3NVW A;  3H7P A;  5KHO A;  4XGA B;  4B0M A;  3VRB B;  2BQQ A;  3ZXV A;  1I4H A;  2L1A A;  4G0N B;  1TKE A;  1JWA D;  2FAZ A;  1WY8 A;  4OVU A;  3H1U A;  1SF0 A;  3R2T A;  1XT9 B;  3U7Z A;  3TMP B;  1XF5 L;  3P42 A;  1F9J A;  3EHV A;  2RR9 A;  2L7R A;  3WAO A;  2NBW B;  2QCZ A;  1EM7 A;  1JRP A;  4DHJ D;  3Q8A A;  2D11 A;  2B3A A;  2MQJ A;  4A20 A;  3U8Z A;  5IO9 A;  3CST A;  5T8I A;  2BKR B;  1WZ3 A;  2LJ5 A;  4AJY B;  1P1A A;  4AWJ A;  4HCN B;  1RAX A;  4H2A A;  4KKI A;  4W9K A;  2W9N A;  3DVG Y;  3KWV A;  2MJE A;  2C60 A;  1DOY A;  3PSE B;  5BYS A;  1WM2 A;  3AEA B;  1QT9 A;  5CTR C;  2IGH A;  4EFO A;  3Q3J A;  2KVZ A;  5DCN A;  3UQB A;  4HLE A;  5AZF A;  4A6Q A;  1WYW B;  2DX5 B;  1I7H A;  4IC7 B;  5HKH A;  1WJ6 A;  2H88 B;  4MT5 A;  1T0R C;  3R3M A;  1K8R B;  3VTV A;  1I4P A;  4C80 A;  4YTP B;  2AWT A;  2GOW A;  2REX A;  3I3T B;  1XQQ A;  2GBN A;  4WQM A;  2LVP A;  2PKO A;  1E6E B;  4WQO B;  4JL9 A;  2K0P A;  2ZPN A;  1ZDV A;  4HJG E;  2ZPY A;  1WH3 A;  2WYQ A;  4ZRI A;  3ZW3 A;  3ETR A;  3QHT A;  4CQN A;  1H8C A;  4BZA A;  2LWP A;  2PEA A;  4TQ1 A;  2PPH A;  4XX5 A;  2KK8 A;  3RCZ A;  3ZQ4 A;  1Z2M A;  2A5U A;  2XBB C;  2AQ1 B;  5IP4 D;  3K9P B;  1I35 A;  3ZTD A;  2GLS A;  3MP9 A;  2IGD A;  3C19 A;  1FIQ A;  1FRD A;  1WF9 A;  2GI9 A;  4MJS B;  2WXK A;  3AE7 B;  4KSL C;  1GUA B;  4ZYS A;  3HIZ A;  2BGF A;  1Y8R C;  4D2K A;  1WIA A;  4KZC A;  1D4B A;  3DDC B;  2I2Y A;  4WIP A;  5J2R A;  2QC8 A;  1EF5 A;  4M8N A;  1OTR B;  3NJT A;  3RZF A;  1GC6 A;  3SHQ A;  4AUQ C;  5DPR A;  1PQS A;  2BYT A;  1L5P A;  2FBW B;  2G1E A;  4L1B A;  1JWU D;  3EGR A;  2M1M A;  5LLI A;  1YD8 U;  1YQB A;  3SR6 A;  3U2S C;  2IGG A;  2JYE A;  2WQY B;  3ZLZ A;  2WLB A;  4RM9 A;  2RDH A;  4ASW C;  1KRH A;  3KYC D;  1G6J A;  4AOF A;  4B0E A;  2DLB A;  3AB5 A;  4JE3 B;  4E74 A;  3N1Y C;  3BYY B;  4BKS D;  4ARC A;  1PDX A;  2DAF A;  2D2Q A;  2BF8 B;  3P4R B;  2K8C A;  3AN1 A;  4FLH A;  3Q3N C;  4B95 A;  4LTU A;  3HHM A;  4EZJ A;  4WWO A;  1J8C A;  1IBX A;  1WSP A;  3OG5 A;  3AEB B;  5DPW A;  5EDS A;  2WXJ A;  3AE9 B;  1E10 A;  4US9 A;  1WRD B;  3EA6 A;  1NDD A;  3W5U B;  3Q3O C;  1JWS D;  4M0W B;  3JYU A;  2JZZ A;  5E6N A;  3MC9 A;  2QMT A;  2KXJ A;  3WA0 A;  1AWD A;  3MHS D;  2IO0 B;  1HZ6 A;  4X57 B;  4HEA 1;  3NVY A;  3KYD D;  2RSU A;  4HJK A;  4C00 A;  1SE9 A;  2C7M B;  3TEW A;  4DXA B;  2J7Q B;  2ACZ B;  3O65 B;  2J4X A;  4KIK A;  3RNE C;  1VLB A;  2K8B A;  3JVZ X;  4WAA A;  2WXG A;  2KC2 A;  4G11 A;  3WCQ A;  4ANU A;  5JHB A;  4P16 A;  2WXN A;  1C9F A;  4GGQ A;  2ASQ A;  1NVI D;  2MBB B;  1TIF A;  4PYZ A;  2MA9 B;  2ZVN A;  4PS3 A;  2JQR B;  2D3A A;  1CMX B;  3ZNG C;  2INN E;  1JWM D;  3AEF B;  3ZNZ B;  4C7Y A;  2INC C;  2MEK A;  3IAS 1;  2KQ7 A;  1DGJ A;  1WI0 A;  2OHF A;  3ZYY X;  3M95 A;  2MBE A;  3VAW A;  1SB3 C;  3PVL A;  2L52 A;  2KDB A;  1FCL A;  1FMA D;  3DBR I;  2W3R A;  3DOW A;  2PVG C;  4GDL A;  3ZO5 B;  1YN4 A;  1GPX A;  2J53 A;  2FE8 A;  1PUT A;  4YSY B;  2BYF A;  3A9K A;  1WXV A;  1YJJ A;  2N9L A;  2WXF A;  1QIL A;  1WJ4 A;  1ET9 A;  3AE4 B;  1IPG A;  2BYV E;  3ZXR A;  2SAK A;  2GBJ A;  3X23 A;  4XDC A;  3RNB C;  1UWM A;  5TSS A;  4JPS A;  4RM8 A;  3VVW B;  4EKU A;  2LHE A;  3RFZ B;  3L13 A;  1LQB A;  2NPT A;  2GBM A;  3RNA C;  2BTE A;  4NJ6 A;  4DHZ E;  1VR9 A;  2KNB A;  1C79 A;  4WH4 A;  3NOB A;  2D3B A;  1UBI A;  1EU4 A;  1RWS A;  2IO3 B;  3L17 A;  1GB1 A;  5HI1 A;  2HJ1 A;  3PZD A;  4PS8 A;  5IKC M;  3V3X A;  5CHF A;  3VTU A;  1QKZ A;  3DBL I;  4JGH B;  5FK9 C;  2O6V D;  5D6J B;  4C4V B;  2ZCC A;  3MJW A;  2LD9 A;  3DWG C;  4MGI E;  2I1J A;  2KFK B;  2LVQ A;  1LGR A;  4WWN A;  5TR5 A;  2L0F A;  1VJK A;  3EUB 2;  1N60 A;  1WX7 A;  2WU2 B;  3Q8F A;  4OW0 A;  1TS5 A;  2CHW A;  5C3J B;  4MDK E;  3WAM A;  2V4I B;  2ON8 A;  3TEZ A;  3NS1 A;  4GN1 A;  1SIJ A;  1V6E A;  3QJZ A;  3M3J A;  1JW9 D;  1JCK B;  2DAJ A;  3R2I A;  1KLG D;  1T6B X;  1GAQ B;  2DZK A;  2HTM E;  3N20 C;  4OVZ A;  3TUO A;  3QAQ A;  3L0W B;  2W54 A;  3CSF A;  2MBQ A;  1SJE D;  2KX0 A;  1STE A;  1S1Q B;  2O2V B;  4MEM A;  2ZW0 A;  3ZVV A;  2WDT B;  1ESF A;  4KKJ A;  3V61 A;  4HKQ A;  2G45 B;  1QQR A;  2W3S A;  1WXA A;  3BVZ A;  4RCO A;  3IVF A;  2BWE S;  4WAF A;  2WHI A;  5BO4 B;  2R2O A;  1TZ1 A;  1HQR D;  4LCD E;  4TKN A;  3T3N A;  1YQ3 B;  4MGK E;  3DWM A;  1UF0 A;  1V81 A;  1UGM A;  1JRO A;  5HHD G;  3Q14 C;  4DK5 A;  3DBR B;  1V1P A;  1YQ4 B;  2X38 A;  3ZJV A;  3DHH C;  1E7U A;  1QOB A;  2CHX A;  2MH7 A;  4RMA A;  1HE8 A;  1I4R A;  2RPV A;  4LJO B;  4HDO A;  5LXH A;  3DBS A;  5H92 C;  4IW0 A;  1WXM A;  1C4A A;  2G4S A;  1Z5S B;  5FR3 A;  4GDK B;  4GXB A;  4BBN C;  1CK1 A;  1ZKH A;  2Y5P A;  3AH7 A;  3ZNI D;  3PZ7 A;  3UI3 A;  4E3C A;  4YL8 A;  4MJS A;  3NY5 A;  5G2N A;  2DZI A;  3VHT C;  2KO3 A;  1EWY C;  1L7Y A;  4DXF A;  4TV3 A;  2X8X X;  1PFD A;  3DBH I;  5L83 A;  2IPK D;  1FNW A;  2QJL A;  3APF A;  2PVO D;  1UD7 A;  3P63 A;  4KSK C;  3WAL A;  2Z59 B;  1V97 A;  2L76 A;  1X1M A;  2AYO B;  4BFR A;  4IM2 A;  3M63 B;  3DCG A;  3NZ3 A;  2ZEQ A;  4YSX B;  4EEW A;  3RPF C;  2KQS A;  1OEY A;  4EOY A;  2MHJ A;  1OFF A;  4JWS C;  4KGS A;  4DBG A;  4QAY A;  4NAW B;  2EMS A;  3ZRF A;  2KTR B;  2BS4 B;  1XEE A;  2NR2 A;  4IWP A;  2LRU A;  4R3D A;  4YTN B;  2V9H A;  4HK2 A;  1BXT A;  1T5X D;  4PS7 A;  3QIJ A;  2JWU A;  2ZVO A;  2UWQ A;  3K9O B;  4FUL A;  3TJP A;  2KHW B;  4MGZ E;  2E3T A;  2N9E B;  4ZHO A;  4A8X C;  5EE0 A;  5IA7 A;  1HTO A;  2K6Q A;  4BKT A;  3ECI A;  2CS4 A;  1UUP A;  1Q10 A;  2D5G A;  4O1N A;  2KAN A;  3IG3 A;  1LM8 B;  1DOX A;  1RLF A;  3NVV A;  1P0R A;  1WGR A;  3HRD D;  1Q5W B;  1ZXI A;  1FPY A;  4YT0 B;  1D5Z C;  2AQ3 B;  3X0W A;  1AW7 A;  2RDB C;  1TJE A;  2L83 A;  1WE6 A;  3W1Y A;  2ONQ A;  2GBK A;  2KDE B;  4ZHP A;  4WJP A;  4P7I A;  3D32 A;  4TSS A;  2WS3 B;  4FJZ A;  3SEB A;  1D5M C;  1JAL A;  3ML9 A;  5JXV A;  2EMT A;  3U4E G;  1JRU A;  2JRH A;  1M94 A;  1C3T A;  3JW0 X;  4MSQ B;  2WXI A;  4TUU A;  2KDI A;  3APC A;  3GS2 A;  1V80 A;  4PYU A;  1AN8 A;  4OZC A;  2ZJD A;  3KVF B;  3ML8 A;  2B76 B;  2G9H D;  5FKA C;  5AZH A;  1K52 A;  1SBB B;  4ZRP A;  3VDZ A;  2INP E;  3JSV B;  3AE6 B;  2V4L A;  1BML C;  3IBE A;  2JRI B;  3B9J A;  1GNU A;  2Q5W D;  2V1Y A;  1ZGU B;  3BK2 A;  4WUR A;  1ZDX A;  3VR9 B;  2RGF A;  4FHK A;  1D3Z A;  1WGK A;  3DBH B;  2DNF A;  3UIP B;  1UZX B;  1YN5 A;  3KUD B;  4BOZ B;  4HRS A;  2NTT A;  2Z8L A;  2XN9 C;  4ANV A;  2N7D A;  1UWX A;  1TS4 A;  1H4R A;  3Q8B A;  2ZZP B;  3NZS A;  3PO0 A;  1RRB A;  1D5X C;  3TCA A;  3EFU A;  2CJO A;  3VQI A;  1F2R C;  1OQR A;  3CMM B;  4N59 A;  4NQL B;  1TKY A;  2DZM A;  2OJR A;  1GG3 A;  1ZW7 A;  3LXF A;  4NNJ B;  4XWT A;  3ZDT A;  1XD3 B;  4ZRK A;  4W9G A;  3TEX A;  1WR1 A;  3V62 A;  4K7W A;  2IYD B;  4CYE A;  1XLO A;  3L10 B;  4C7Z A;  2AEH A;  4ACF A;  4KDI C;  4WWP A;  4LDT D;  2KQ4 X;  3RNC C;  2PLP A;  3I9V 1;  2MBO A;  1R4M I;  3CIR B;  3W9C B;  2FIF A;  5C1Z A;  2WWZ A;  3AEE B;  5CX3 A;  2IND C;  3HUI A;  3IXS A;  2O6V B;  3VH4 B;  4S0R A;  5EE9 A;  4XZ4 A;  1VZ6 A;  2IY1 B;  2K6D B;  4HRO A;  1FNU A;  4RGO S;  2LFI A;  3Q2A C;  3OAW A;  1WXS A;  4MSM B;  3VUY A;  2WXP A;  1F77 A;  3NHE B;  1I42 A;  2KWD A;  3CWI A;  3BVG A;  3VXW A;  1KOT A;  1F52 A;  3NRZ A;  5H8Y E;  1RFK A;  3AXC A;  2LGI A;  4W9L A;  4DQO C;  5MPO A;  3MFG A;  1YOV B;  1TS3 A;  1GOZ A;  4K1R B;  1ZP0 B;  4AS1 A;  1WJU A;  1PGB A;  4US8 A;  1OGW A;  3T9L A;  3WIM A;  3AU5 A;  3H7S A;  3QX1 A;  2I1K A;  1S3S G;  4KZ0 A;  3ZGZ A;  4KDL B;  1E7P B;  3PPA A;  4JQW C;  5C2T B;  1E8X A;  3NVZ A;  2OJW A;  2WU5 B;  4F7Z A;  4IWQ A;  4B9K A;  4IM3 A;  4GOC A;  1I4G A;  2YVC A;  3OLM D;  1L6V A;  1FD6 A;  2O2V A;  3DQV A;  3E56 A;  2KTF A;  2VH1 A;  2JXT A;  1C1Y B;  4LNO A;  2DEN B;  3IT6 B;  1SE3 A;  3HM3 A;  1KLV A;  2J0J A;  2KWU B;  2MRP A;  2W55 A;  4TQ0 A;  4A9A A;  1B1Z A;  2N9K A;  4RH6 A;  2KN5 A;  5LXI B;  3L54 A;  1A5R A;  3PGE A;  1BUI C;  1PGA A;  4BOS C;  4GLS C;  2GB1 A;  2KMC A;  4GIV A;  1WJN A;  2WX0 A;  3PV1 A;  2BKF A;  2JSV X;  2I38 A;  2Y3A A;  3LYY A;  3VR8 B;  3SU8 X;  2LUE A;  2E6X A;  5BMI A;  1F0Z A;  4G50 A;  4ARI A;  4ITK A;  2QIL A;  5DPT A;  3V60 A;  1K50 A;  3A1Q B;  1UEL A;  3AE3 B;  3APD A;  3ZRC A;  4RGT A;  3RYT A;  3L16 A;  2MP2 A;  4M8M A;  4FN2 A;  1Q1O A;  2YEP F;  1N63 A;  2PMV A;  4LK0 M;  4OHJ A;  3GZN I;  3AEG B;  2FNJ B;  1DOI A;  2C9W B;  1QZE A;  1R4M B;  2MW5 A;  1KH0 A;  3R7R A;  4LNF A;  4LNN A;  2ZNV B;  3N1X C;  3L08 A;  4S17 A;  4II3 B;  2NMQ A;  3AE5 B;  1FXT B;  1PGX A;  4HCP B;  2NBV B;  1WGD A;  2LJI A;  3A9J B;  3IAM 1;  3N30 A;  2FUH B;  4IUM B;  5BYR A;  1N5W A;  2QHO A;  1AAR A;  1V86 A;  2PE9 A;  3LJ3 A;  1AYF A;  3OJ4 B;  3H8H A;  1TYG B;  3UGB B;  2HJ8 A;  1XCT L;  4CHK A;  3BK1 A;  3BII D;  2DHZ A;  4L23 A;  4TMA B;  2JPH A;  3UIO B;  2VH2 A;  4NAW A;  2KTR A;  1T0Q C;  2M4N A;  2N1V A;  4P1C C;  1V1O A;  4N6E B;  3AE1 B;  2ZNV C;  4BKS A;  2KN4 A;  2CR5 A;  2WDR B;  1C77 A;  4XC2 A;  3PRZ A;  1BT0 A;  1NEN B;  1ZPS A;  3M62 B;  1L4Z B;  1RM6 C;  2N7E A;  4C56 C;  2XNA C;  2N9X A;  1HXY D;  4W9J A;  4ICV A;  1XLP A;  3SD5 A;  5D3D A;  5C23 A;  1SE4 A;  2DZJ A;  4BKG A;  4DDI D;  1SXT A;  2WGS A;  1MG8 A;  3HVD A;  1SE2 A;  2WP9 B;  4W9E A;  2BS2 B;  5AZG A;  3C8Y A;  1EO6 A;  3KLS X;  2IBI B;  2M17 A;  4WJQ A;  1IP9 A;  4IDI A;  5HG2 A;  4I6N B;  3RI7 C;  2KLC A;  1IBX B;  2LGS A;  3QA8 A;  2JUO A;  1WR6 E;  1TY0 A;  1E9M A;  2HD5 B;  1E90 A;  4IKG A;  1C4P A;  4ZYN A;  5D2M B;  4DWF A;  3A4R A;  1MPE A;  4BAX A;  1FFV A;  2LRW A;  1E5W A;  2MLB A;  4NZL B;  5D3I B;  3PLV A;  2WXO A;  1WMH B;  4J3O D;  1HA5 A;  3B08 A;  2K3U A;  4P6V F;  3AV8 A;  2IZV B;  2RD0 A;  3SFD B;  1M4V A;  2KT7 A;  1KJT A;  1PYW D; 
#chains in the Genus database with same CATH homology
 3Q69 A;  1L0Y B;  3VRA B;  1FEH A;  3FAH A;  2KDM A;  2PIA A;  2K5P A;  3SR6 A;  1ACC A;  2R61 A;  3U2S C;  2IGG A;  2JYE A;  3FIL B;  2WQY B;  1WXQ A;  1UUP A;  2WLB A;  1Q10 A;  5G5H A;  2D5G A;  4O1N A;  1KF6 B;  1XCQ L;  1DOX A;  3NVV A;  2RDH A;  1KRH A;  2VZK D;  2CJN A;  3HRD D;  1QOA A;  1ZXI A;  4YT0 B;  1D5Z C;  2AQ3 B;  4B0E A;  1AW7 A;  2DLB A;  1FFU A;  1HEZ E;  2WDV B;  2WNM A;  3AB5 A;  3Q8E A;  4JE3 B;  1TJE A;  1QOG A;  2L83 A;  5GXG B;  1XLN A;  2K9X A;  1YJI A;  3V05 A;  2ONQ A;  3O13 A;  4ZHP A;  1IGD A;  3BYY B;  1TZO A;  2JX5 A;  4TSS A;  4ARC A;  1PDX A;  2BW2 A;  3W5V B;  2WS3 B;  1NI3 A;  3SEB A;  1D5M C;  1JAL A;  2LUM A;  3SFE B;  5JXV A;  1CQV A;  3P4R B;  3U4E G;  1F2R I;  3AN1 A;  1YN3 A;  4FXC A;  1P7E A;  5I4D A;  1OQQ A;  5LNK 1;  1FRR A;  4EE2 A;  1QF6 A;  4LTU A;  1I4X A;  2W82 A;  5BMG A;  3R8B A;  1IBX A;  1WSP A;  2WXI A;  3AEB B;  1YMH E;  2SEB D;  2WXJ A;  2N7J A;  3AE9 B;  3GS2 A;  1AN8 A;  4US9 A;  1E10 A;  3B2G A;  4OZC A;  1C4C A;  3EA6 A;  2B76 B;  2G9H D;  1C76 A;  3W5U B;  2AX5 A;  4LLG M;  5FKA C;  1JWS D;  1K52 A;  1SBB B;  4ZRP A;  2V3P A;  2QMT A;  4YWG G;  5BYQ A;  1AWD A;  3NUH B;  2INP E;  5D7G A;  3URY A;  3AE6 B;  3ZJT A;  1BML C;  1HZ6 A;  2AQ2 B;  1MVK A;  3B9J A;  4HEA 1;  4RNA A;  2BB5 A;  5AUK A;  2Q5W D;  4ZOH C;  3NVY A;  1MHX A;  3L4P A;  2JU6 X;  1MHH E;  1SJH D;  3BK2 A;  3N9Y C;  4WUR A;  1ZDX A;  5G5G A;  3VR9 B;  2EEL A;  1UNS A;  1WGK A;  1IUE A;  1N61 A;  5EE3 A;  1P7F A;  3TEW A;  1ZUD 2;  1YN5 A;  4UDU C;  2ACZ B;  4HRS A;  2J4X A;  2J52 A;  2NTT A;  1KTK A;  2Z8L A;  1VLB A;  2XN9 C;  2WXG A;  3WCQ A;  1UWX A;  1TS4 A;  1SEB D;  3Q8B A;  4OZA A;  1QLB B;  1RYJ A;  3TEY A;  4P16 A;  3PO0 A;  2WXN A;  1D5X C;  1C9F A;  3GB1 A;  2CJO A;  4YXD B;  3AED B;  1NVI D;  4XDD A;  3VQI A;  1F2R C;  1FO4 A;  1OQR A;  4REZ A;  4N59 A;  4MAC A;  1L6U A;  3ABV B;  3ZJU A;  1TKY A;  4XWW A;  2TSS A;  3LXF A;  1K53 A;  4XWT A;  1NYQ A;  2JQR B;  4N58 A;  1VZ8 A;  4Q2J A;  3TEX A;  2INN E;  1JWM D;  3AEF B;  3W2D A;  1XLO A;  4C7Y A;  1VZ7 A;  4C7Z A;  1N5X A;  2MEK A;  3IAS 1;  1QOF A;  2KQ4 X;  1DGJ A;  2PLP A;  3I9V 1;  4USA A;  1B9R A;  1J7C A;  2OHF A;  3ZYY X;  2KAC A;  3CIR B;  1SB3 C;  2L52 A;  1JML A;  2M0A A;  2KAJ A;  1FCL A;  1FMA D;  2JZP A;  3W9C B;  4WWM A;  2W3R A;  3AEE B;  4M0W A;  3AM9 A;  2PVG C;  1FM0 D;  1XXG A;  3HUI A;  2LMC A;  2WXL A;  3IXS A;  1XO3 A;  1YN4 A;  1GB4 A;  2LHD A;  2J53 A;  1GPX A;  2H89 B;  2FE8 A;  1PUT A;  4YSY B;  5EE9 A;  1CJE A;  1YJJ A;  1VZ6 A;  2DYO A;  2N9L A;  4RF0 A;  1ET6 A;  1JWB D;  2L32 A;  2WXF A;  3BYT B;  2WXH A;  4HRO A;  1QIL A;  4HKZ E;  2J42 A;  1FNU A;  4RGO S;  1ET9 A;  1K51 A;  3AE4 B;  2DWQ A;  2LFI A;  3P4S B;  3J9C A;  1KLU D;  1Y56 A;  2QEJ C;  2CU3 A;  2WXP A;  1F77 A;  2SAK A;  4YSZ B;  5BMH A;  2KWD A;  3CWI A;  3BVG A;  3NRZ A;  5H8Y E;  1RFK A;  4XDC A;  1FCC C;  1EWC A;  1UWM A;  2BBC A;  2DYM A;  2LGI A;  2OED A;  2WDQ B;  5TSS A;  3MFG A;  4DQO C;  1TS3 A;  1TKG A;  4JPS A;  4XE0 A;  5MPO A;  1GOZ A;  1XLQ A;  2LHE A;  3RFZ B;  1WRI A;  1ZP0 B;  4AS1 A;  2FUG 1;  2V3N A;  1ROE A;  4KX6 B;  2M19 A;  5HFY A;  1KFY B;  1PGB A;  4DXG A;  4US8 A;  1J7A A;  3HVZ A;  2N0S B;  2BTE A;  1DYQ A;  1VR9 A;  1C79 A;  3IT4 B;  4WH4 A;  3OWE B;  3Q8C A;  3MC0 B;  2JYT A;  4KGT A;  3T3O A;  3I57 A;  3ZGZ A;  3W1S A;  1EU4 A;  1RWS A;  3P4P B;  1GB1 A;  1E7P B;  5HI1 A;  2Y5C A;  4GDL B;  2GRI A;  5C2T B;  3NVZ A;  3V3X A;  2WU5 B;  2RMM A;  1MI0 A;  1QKZ A;  4A55 A;  1VRA B;  2PW9 A;  3AMZ A;  5FK9 C;  2WXR A;  4L2Y A;  1I4G A;  2DBY A;  5E6J A;  1L6V A;  1FD6 A;  3E56 A;  3DWG C;  2WXM A;  3PZ8 A;  4RFB A;  2JXT A;  3BVM A;  1V1P B;  3KWL A;  1J7B A;  2RDG A;  3E9S A;  1JQ4 A;  3MJ5 A;  3LB8 C;  1VJK A;  3IT6 B;  1TS2 A;  1T3Q A;  1SE3 A;  4ZRQ A;  3BZD B;  3EUB 2;  1N60 A;  2BT6 A;  3P4Q B;  1D6E C;  3Q8F A;  2W55 A;  2WU2 B;  4OW0 A;  4TQ0 A;  1TS5 A;  1B1Z A;  2WXQ A;  4A9A A;  2N9K A;  4RH6 A;  1L4D B;  5C3J B;  3NVW A;  2V4I B;  2ON8 A;  3TEZ A;  3NS1 A;  2IJ0 A;  1SIJ A;  4B0M A;  1N62 A;  3VRB B;  1JW9 D;  1JCK B;  4AQ7 A;  3R2I A;  1BUI C;  1PGA A;  1KLG D;  1T6B X;  1GAQ B;  1I4H A;  2L1A A;  4GLS C;  2GB1 A;  2HTM E;  2JSV X;  2I38 A;  4OVZ A;  2Y3A A;  3TUO A;  3LYY A;  1TKE A;  3VR8 B;  5BMI A;  2E6X A;  1SSN A;  1NYR A;  1JWA D;  1F0Z A;  1V8C A;  2W54 A;  4ARI A;  1SJE D;  1HZ5 A;  4ITK A;  1STE A;  1SF0 A;  1A70 A;  2QIL A;  1K50 A;  3R2T A;  3U7Z A;  1XF5 L;  3P42 A;  3AE3 B;  2ZW0 A;  1IGC A;  4OZB A;  4RGT A;  1WYG A;  1ESF A;  4KKJ A;  1VDV A;  2MJ3 A;  2BB6 A;  4RF1 A;  4HKQ A;  1EM7 A;  2YEP F;  1QQR A;  1N63 A;  1JRP A;  2W3S A;  2PMV A;  3Q8A A;  3BVZ A;  4RCO A;  4LK0 M;  4OHJ A;  3FC4 A;  4WAF A;  4MM3 B;  3AEG B;  1HQR D;  3T3N A;  4NJC A;  1DOI A;  5T8I A;  1LO5 D;  1YQ3 B;  4IOI E;  1FNV A;  3DWM A;  1KH0 A;  1JRO A;  5HHD G;  2MJD A;  4H2A A;  1V1P A;  1YQ4 B;  4KKI A;  2X38 A;  1WWT A;  1ZOY B;  2NMQ A;  4PT5 A;  3ZJV A;  3AE5 B;  1PGX A;  1YNT E;  1QOB A;  2MH7 A;  2LJI A;  3IAM 1;  3KWV A;  3TSS A;  4NAM A;  2MJE A;  1DOY A;  2KMM A;  1I4R A;  2RPV A;  5BYR A;  5BYS A;  1N5W A;  3AEA B;  1QT9 A;  1ENF A;  4JWU C;  2IGH A;  2K22 A;  5H92 C;  1FXA A;  3AEC B;  1C4A A;  3MHZ A;  5FR3 A;  1AYF A;  4GDK B;  3H8H A;  1I4Q A;  1NEK B;  3P1M A;  1TYG B;  4A6Q A;  1CK1 A;  1XCT L;  2Y5P A;  3AH7 A;  4RGM A;  1I7H A;  3BK1 A;  1UGJ A;  3PZ7 A;  3BII D;  4L23 A;  3UI3 A;  2H88 B;  4TMA B;  4MT5 A;  3U52 E;  1R7S A;  2PTL A;  1TY2 A;  1I4P A;  1ZXH A;  4C80 A;  4YTP B;  1V1O A;  1CZP A;  4N6E B;  3AE1 B;  3BWU D;  2KN4 A;  4RGN A;  4WQM A;  2WDR B;  1C77 A;  2PKO A;  1EWY C;  1NEN B;  1ZPS A;  4DXF A;  1L4Z B;  1E6E B;  2EKI A;  1PFD A;  1RM6 C;  2IPK D;  1FNW A;  2QIE B;  2QJL A;  4C56 C;  2PVO D;  2XNA C;  2YEP B;  3AE8 B;  1L0V B;  3P63 A;  2K0P A;  1HXY D;  1ZDV A;  2V0G A;  1C78 A;  3AE2 B;  1V97 A;  4HJG E;  1XLP A;  1E0Z A;  5D3D A;  1SE4 A;  2ZW1 A;  2BS3 B;  4MH8 A;  3NZ3 A;  2M56 B;  3ETR A;  4A90 A;  4YSX B;  1EU3 A;  4CQN A;  1SXT A;  3RPF C;  3HVD A;  3FIL A;  1SE2 A;  4TQ1 A;  2WP9 B;  2QSD A;  2VZK B;  1OFF A;  2BS2 B;  3ZQ4 A;  2NTS A;  3GP7 A;  4JWS C;  3C8Y A;  1L0X B;  3KLS X;  2AQ1 B;  4KGS A;  4JX1 C;  4NAW B;  3MP9 A;  2BS4 B;  2IGD A;  1FIQ A;  1FRD A;  4IDI A;  2GI9 A;  5HG2 A;  5AUI A;  1XEE A;  2WXK A;  3AE7 B;  3B2F A;  1IBX B;  3KQ4 A;  4ZYS A;  1TY0 A;  4R3D A;  4YTN B;  1E9M A;  4D2K A;  4IKG A;  1D4B A;  1C4P A;  2I2Y A;  2IDY A;  4WIP A;  2HDE A;  1BXT A;  1T5X D;  1MPE A;  2JWU A;  2ICI A;  1FFV A;  4YTM B;  5D3I B;  4NZL B;  1FXI A;  5EE1 A;  2WXO A;  4J3O D;  1HA5 A;  2K3U A;  4P6V F;  2BYT A;  3AV8 A;  1L5P A;  1ZE3 D;  2E3T A;  3SFD B;  2FBW B;  1M4V A;  2G1E A;  4L1B A;  1JWU D;  4A8X C;  4ZHO A;  2LEK A;  5EE0 A;  4KGR A;  3EGR A;  1PYW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...