2HDEA

Solution structure of human sap18
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
148
structure length
148
Chain Sequence
GSHMRVTQEEIKKEPEKPIDREKTSPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of SAP18: a ubiquitin fold in histone deacetylase complex assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Histone deacetylase complex subunit SAP18
total genus 17
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06487 SAP18 Sin3 associated polypeptide p18 (SAP18)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.550 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2hdeA01
4A6QA 4A90A 4A8XC 2HDEA
chains in the Genus database with same CATH superfamily
1I7HA 3H7PB 3NG0A 3NUHB 4ANWA 3TL5A 3LJ3A 1UWMA 3RNBC 5BMHA 4HLEA 3PRPB 3A4SC 1E8ZA 2Z8LA 4I6LB 1I4RA 1CJEA 2NMQA 1IYFA 2WXRA 4FULA 3MC0B 2WXPA 3V6EB 4GB9A 4G3XB 4HCNB 5H92C 2L76A 3LDZE 5C23A 3N9YC 1FPYA 3Q8BA 2K39A 3UQAA 2K22A 3ECIA 4MEMA 1TS5A 4YSXB 3PRZA 3ZVVA 3AE7B 4YTPB 1UWXA 2CS4A 1A5RA 4K7SA 1UGJA 1I4HA 3VDZA 2RR9A 1Q1OA 4A90A 4X57B 3RUIB 2JWZA 3APFA 4WH4A 3PZ7A 1F9JA 3CSTA 3VR9B 3AEBB 3WAMA 3B1LX 2CHWA 3DWGC 4S0RA 5HKHA 2UU7A 4OZAA 4XX5A 2JQRB 4IC7B 4K7WA 4MSQB 3VH3B 1WSPA 1KM7A 3P4RB 4GMVA 2CU1A 3RNFC 3NJTA 4NAWB 2I38A 5C3JB 3ZLZA 3KUZA 3SFDB 1EO6A 2JYTA 2R2OA 2AYOB 2MJDA 1OQQA 3C19A 3RN9C 5LLIA 1WGHA 3GZNI 3PV1A 1XO3A 3DDCB 1IGCA 3B0AA 2KNBA 2OOBB 1J7CA 4EZKA 3P2BA 2WXIA 1NI2A 4N9F4 3KW5B 2BWES 2PJHA 4CHKA 2ACZB 4WJQA 2KDFB 1Y56A 1V9JA 4EZLA 5GMVA 3RD2A 1P9DU 2OJWA 4AJWA 3HVDA 3W1SC 1FXAA 3I3TB 2INDC 2SAKA 4FBJB 2Z59B 4WWOA 2KMMA 3CIRB 3ABVB 2W3SA 3QHTA 1XEEA 3R8BA 4ICVA 3A9JB 3M63B 1UD7A 3BK2A 1WJ6A 2LGDA 2QEJC 4A55A 2RDHA 1YD8U 5EDSA 1YQ3B 2KYWA 4ANXA 1WM2A 3V60A 3I63C 2N7EA 1HQRD 1EUVB 4RM8A 3QCAA 1VCBA 1KOTA 1T0SC 4HDOA 2I2YA 1FXIA 3VAWA 2C60A 4GXBA 4YSYB 3ZJVA 4LDTB 2J7QB 1CQVA 2YEPF 3N30A 3BINA 2AQ2B 2AL6A 4II3B 1ZPSA 3GZNB 2QJLA 2FBWB 5BO4B 2ZW1A 4N59A 4K1RB 2JY6A 3VTUA 4HEA1 3NVZA 2PW9A 3DQVA 4IM3A 1WE6A 2HJ8A 3MJWA 4B0EA 2MH7A 3ZXVA 2LVOA 2PIAA 3ENEA 2MWSB 1XCTL 3NZ3A 2C5LC 2LUEA 1RRBA 3UIPB 2MHJA 2L32A 1VD2A 3NVVA 3EGRA 2A5UA 1J19A 3W1YA 2KVZA 3WANA 3LXFA 2M0AA 2KT7A 3H8HA 5JHAA 4I6NB 1STEA 2L0FA 2VZKB 4HCPB 5L83A 1D6EC 4ICUA 2KD0A 1T0RC 2ZCBA 2N0SB 3N1YC 3Q14C 1OFFA 1WX7A 1KH0A 2BS2B 4M01A 5BMGA 1UF0A 3RNGC 3B9JA 4K3BA 1T5XD 1L6VA 2MJEA 2NPTA 1ZW7A 3MHZA 2LGIA 1QQRA 1C76A 1AWDA 3DOWA 3U2SC 1LXDA 3PSEB 1JRPA 5E6OA 2K8BA 3H1UA 5J17A 2JZ3B 2NTSA 3I5JC 2KQSA 4IWPA 1GOZA 1SIJA 2WXFA 1D3ZA 2BS4B 1XQQA 3D32A 2G45B 4KSKC 4RFBA 4OVVA 1WXMA 2D3CA 2JVCA 1DOXA 3Q6BA 3H6NA 4HK2A 3H7PA 5D3IB 2C7MB 1PGBA 4URKA 2NR2A 2CKHB 4FJYA 4MDKE 4OHJA 4HKQA 2M19A 1L0XB 4HWIB 2KLGA 2MP2B 4EUTA 3CSFA 4DDGD 1NVID 4ZOHC 4RNAA 4MH0E 3AXCA 1KLGD 2LZ6A 1EWYC 1V80A 4ZYNA 2M56B 4MSMB 2N1VA 5CHVC 1HZ5A 2FIFA 1GC6A 2REXA 1WIAA 1LO5D 5BYRA 3L10B 2KX0A 4DK5A 3Q3JA 3R3MA 1NEKB 2JRIB 3GE3C 4KDIC 3I9V1 2MBHA 3WAPA 4KV2A 5G2NA 2GRIA 2Z0DB 2J52A 3R7QA 3W2DA 3EFCA 4C4VB 5DPWA 3P4QB 2ZEQA 1C1YB 1KJTA 2C9WB 2LUMA 4BBNF 2RPQA 1RAXA 5BYSA 1YJJA 4C7YA 1UH6A 1TGZB 1KLUD 4HPPA 2NPTB 5FK9C 1V5TA 2MBBB 2W9NA 4OZCA 1NI3A 4WQMA 3X23A 2KQ7A 3IT6B 2RPVA 3RFZB 1U4AA 3HVZA 3AECB 3PZ8A 3SD5A 3T3NA 4KKIA 1ZXHA 4ACFA 2N7DA 2KMCA 1WF9A 4USAA 1TIFA 3NZSA 1I4GA 2MRPA 4P16A 1VDVA 1WXSA 3KQ4A 1IGDA 2PLPA 1ET9A 3O13A 2KKCA 2L0TA 2QILA 1P0RA 1CMXB 2LWPA 2QIEB 4DXGA 1D5XC 2V3NA 1OEYA 3ZUNA 3B08A 2D3BA 3RMKC 2GB1A 1MHXA 3OJ4B 5GXGB 1I4XA 2CR5A 2KTFA 3M3JA 5L95C 4P7IA 1WJUA 1V1OA 3A1QA 2JSVX 3CF6E 3AM9A 4BKTA 4JL9A 2D2QA 3QQ8B 3HM3A 3BY4B 3VVWB 1ZOYB 4OZBA 2ZVNA 1V2YA 3U52E 2MP2A 1WXAA 3L08A 1T0QC 4GIVA 1DOYA 3ZNID 1C79A 1YMHE 1XLPA 3MFGA 1QOGA 3SU8X 4XWWA 3TIXA 1T3QA 2V3PA 1R4MI 2DYOA 1V86A 4WIPA 2D10A 3KUCB 4IUMB 2DX5B 3KYDD 4MELA 4GDKB 1E5WA 2MEKA 1E8XA 2PVOD 4PYZA 1BT0A 1SXTA 3TUOA 3ZTCA 2KWDA 1VLBA 2VRRB 3E56A 3QJZA 3A9KB 2DWQA 5AZHA 4NJCA 1ISNA 1NBFC 2L7RA 4KZCA 3P63A 1UGMA 2ZW0A 1HZ6A 1RFKA 1N61A 1AW7A 3ZNGC 5EE0A 3UIOB 4LCDE 2BB5A 1TZ1A 2V4LA 1JROA 3QARA 5IA7A 1YNTE 4A8XC 2LFIA 2JT4B 1N6ZA 4P1CC 1TKGA 3KVFB 4K7UA 4KSLC 3Q8AA 4LNKA 4RF0A 1C78A 3AEEB 3B2GA 3Q8CA 2WDRB 5DCNA 2GOWA 3VTVA 2M17A 4R3DA 2Y5BB 2BTEA 1SEBD 3ZGZA 2FE8A 4IWQA 1KF6B 1ZE3D 3PS6A 5D6JB 1PGAA 2ZZPB 4HROA 3A9KA 2N9EB 2AEHA 3DHHC 2XN9C 3TEWA 2LHDA 1HE8A 5C1ZA 2C7NB 3AE2B 1SE9A 2X38A 1C9FA 2WU5B 3T3OA 4OVUA 4BZAA 2LI5A 1FCCC 3OAWA 4HJKA 2INNE 4GU2A 1QZEA 3P42A 3QX1A 1YX6B 4IOIE 3NOBA 3HUIA 4EOYA 4DBGA 4K81A 3WAOA 1MI0A 2FAZA 4W9EA 2PEAA 4AOFA 2KX3A 3HHMA 4DWFA 2KQ4X 3H9DA 2XK5A 4KIKB 1IBXB 1YJIA 1ZKHA 1B9RA 1L4ZB 2K9XA 3RI7C 3SFEB 3A33B 3Q8EA 1N5WA 4CO7A 4ITKA 5E6NA 4N58A 4RGOS 2L3ZA 3VRBB 2KFKA 1P3QU 2NVUI 5I4DA 2RDBC 4M00A 3AEAB 1E9MA 2IJ0A 4IWOA 5EE1A 3DBHB 2WDTB 1XT9B 1WGYA 2AWTA 4FHKA 1H4RA 3AE4B 4JWSC 3DVGY 2JXXA 2ZCCA 1OQRA 2ASQA 2BQQA 3VR8B 4RGMA 1NYRA 1I35A 4MJSA 3AE8B 2WX0A 2LJ5A 1Z2MA 3Q3NC 4Q2JA 1GAQB 3C8YA 5BYQA 2IZVB 1JWMD 1EU3A 1C4AA 5D2MB 1UUPA 1N63A 1GUAB 3RZFA 1WJNA 4HDQA 1WZ3A 3ZRCA 3RZWC 3ZDTA 1PYWD 4YSZB 4NJ7A 1RLFA 2K8HA 2KDMA 2PE6B 1GC7A 3TEZA 5FKAC 1H8CA 3MHSD 4JQWC 2BBCA 1E8YA 1FXTB 1SSNA 1X1MA 1TT5B 1XCQL 4MGYE 2V0GA 3UI3A 1QILA 1VRAB 1F2RC 1KFYB 4UDUC 1S3SG 4FJZA 4LNNA 3DBHI 3AEDB 2RD0A 2DBYA 1VZ8A 2CHZA 1E90A 2PVGC 4HXDA 2J4XA 1JQ4A 1VZ6A 3RNEC 2BWFA 2UYZB 4TQ0A 2MW5A 3BYTB 1JWBD 3ALBA 1P98A 1SIFA 4ZRIA 3LB8C 3Q69A 3AMZA 1D5MC 5KHOA 2W54A 3OG5A 4FADA 1D5ZC 5HI1A 2L8JA 2J0MA 2JU6X 3PLUA 2WLBA 3L13A 1ESFA 3V62A 2L1AA 4US9A 3AB5A 4BBNC 3DHGC 2B76B 2ZNVC 4W9LA 1JWAD 3NRZA 4MH8A 4MACA 1OTRB 2GBJA 1WYWB 2HE7A 2FNJB 2KDEB 5JZEB 1YIWA 4G11A 1UBIA 2WWZA 1F2RI 2KDBA 2YLMA 4ZRJA 5DPTA 4A3OA 1E7UA 4G50A 5DPSA 4XE0A 5CHWA 3TJPA 4YXDB 2RMMA 1E10A 4TUUA 4F7ZA 4NAMA 3ZXRA 3MTNB 4MJSB 2O6VB 4FLHA 1QT9A 2O6VA 1NYQA 4XDCA 5D94A 1KTKA 4KVGB 3TCAA 1SF0A 4EFOA 1EF5A 3QK0A 1ROEA 2WQYB 2DHZA 3WA0A 3KUDB 3LYYA 4WWPA 2PPHA 1XD3B 2IYDB 1JW9D 2GMIC 2AX5A 3W5VB 4MM3B 2LVQA 2M4NA 4DHZB 2BS3B 5IO9A 4W9IA 1LQBA 1S1QB 3ZJTA 1P7FA 1L5PA 3AE1B 2NTTA 1WR1A 3MC9A 2CJOA 1QLBB 2D3GA 3IAS1 2IO2B 1WR6E 4TQ1A 2A4ZA 4KX6B 1GNUA 2TSSA 3IT4B 4HJGE 4GN1A 1FD6A 2LASA 3FILA 4GGQA 3TEYA 3A9JA 1TKYA 1WRDB 2WU2B 3PRMB 3PHXB 2I1KA 3V61A 1M94A 1DYQA 4N6EB 1PFDA 2PTLA 3JW0X 1EF1A 3C0RB 4NNJB 3VQIA 1RFAA 1XXGA 1SE2A 2G4SA 1YJ1A 2HDEA 2MJ3A 1SJHD 2IO1B 4GLSC 4MGIE 1GB4A 2LGSA 2KJHB 3IXSA 2LXAA 5LXHA 2IGDA 3GS2A 1LFDA 2H88B 2QSDA 2XBBC 3UGBB 2ZPYA 3GB1A 2FUG1 1TS2A 3HRDD 2G4DB 3BVZA 4C4VA 4ARIA 3DPDA 3OLMD 3AEFB 1ACCA 1FFVA 3PLVA 1BMLC 3DVGX 1WX8A 4IG7B 2MQJA 2IDYA 3O65B 2L00B 3FKYA 4EEWA 3B2FA 3KYCD 1L7YA 4M8NA 2Y5CA 2WYQA 1FNVA 2MCNB 4LNFA 1Q10A 1J7BA 2CJNA 2L52A 2BVCA 3V05A 4FN2A 3K9PB 3DHIC 2BYEA 4ANUA 3DBRI 3SEBA 2N7JA 4H2AA 5IAAC 3SR6A 1E8WA 4E74A 1WI0A 1P1AA 2WGSA 1J7AA 3NS8A 2WDVB 1K50A 3ONSA 4M0WB 3HK0A 2KFKB 3N1ZC 2IO3B 1SE4A 1WXVA 5HHDG 2MBEA 2ZNVB 1YN3A 3QAQA 2JWUA 1SB3C 4F8CB 4BFRA 3QWZB 3ZNHB 3N20C 4REZA 4WJPA 4AWJA 3A1QB 3FAHA 1WMHA 1YOVB 1QOAA 2WS3B 2WP9B 4I6PA 4LK0M 2DZIA 2IPKD 4HKZE 4KDLB 1HXYD 1IUEA 2YVCA 1K52A 3IVFA 1I4QA 1PGXA 1Y8RC 3BZDB 1FFUA 5C2TB 4W9GA 1D4BA 2JRHA 4E3CA 5AUIA 1K51A 3AE9B 4JLCA 2N9LA 5E6JA 2R2QA 1FCLA 1WX9A 1WH3A 4ZHPA 3AH7A 3DBRB 4AP4C 1Q5WB 2LHEA 3PPAA 3TSSA 2BKRB 1ZDXA 1WY8A 1JALA 2KMAA 2FCNA 3HIZA 2WHIA 1NENB 3VH4B 3W9CB 5HFYA 2IO0B 2V1YA 4QAYA 4IM0A 3PO0A 1Q0WB 3AI5A 1ZDVA 3DCGA 3TBLD 4WAFA 2KANA 1I42A 2KK8A 4NQKE 5EE9A 1WFYA 2BT6A 4DQOC 3IFWB 4HRSA 2XNAC 4LTUA 1E0ZA 1E7PB 3UF8A 3U7ZA 1ZUD2 3IAM1 4XC2A 3VXWA 1KLVA 3U4EG 2KWVB 2BPSA 1FIQA 3PREA 3DVNV 4IDIA 1T0YA 1R4NB 3ML8A 2K0PA 4MT5A 2W55A 3K9OB 2LD9A 2RGFA 2E6XA 2WX1A 1JWSD 4IKGA 1YQ4B 4BKGA 1BXTA 3AE3B 4IM2A 3DBSA 3QIJA 3L54A 2J0KA 1N60A 2K25A 3DVNU 4JGHB 4RM9A 3UQBA 3PGEA 5D7GA 2WNMA 3KWVA 1UZXB 3KLSX 4IW0A 3BIID 3RPFC 2KJ6A 1F1HA 2GBRA 4W9FA 2WXHA 4XYCA 4JIOU 3JSVB 3T8MA 4E71A 4DHZE 3P4PB 4A3PA 4KZ0A 5IKCM 3PVLA 2G3QB 2ON8A 1L6UA 2AQ1B 2DAFA 3PTFC 1DGJA 5BMIA 2D5GA 1WGDA 3BVMA 3Q3OC 2N4FA 4FXCA 2N9KA 1N62A 2M1MA 4P6VF 3JYUA 1TYGB 4FA6A 1JRUA 1MG8A 2EELA 3L17A 4LJOB 1HEZE 2JUOA 1GJZA 3GP7A 3EECA 2JX5A 2J0JA 1XF5L 3HM6X 5D3DA 3EC8A 3EA6A 5FR3A 2KOXA 1FMAD 2Z0EB 2KAJA 2WDQB 1J8CA 4ZRKA 5G55A 4ZDVA 3KWLA 4G0NB 5J2RA 3AE6B 4W9JA 3ZTDA 2J53A 1GG3A 1K53A 2FCQA 2OJRA 4KKJA 2K8CA 2K6QA 2MLBA 1TKEA 2KXJA 4LLGM 4B95A 5IP4D 2NBVB 1Z5SB 1WWTA 2KHWB 3P1MA 4WAAA 1V5OA 4BOSC 3RNAC 4BKSD 3QC8B 4CQNA 5FR6A 4HPMB 4MGKE 2MX2A 2GI9A 1WXQA 2BGFA 2WXLA 3MP9A 2QMTA 2PE9A 3R2TA 1GPXA 3DBLI 1C3TA 1TY0A 2V3SA 2KJRA 2K1FA 4EZJA 1WMHB 3OJ3A 2W82A 4XDDA 1JCKB 5DPRA 3VUYA 2JYEA 1CK1A 1AYFA 4TKNA 4PS8A 2ZJDA 4JPSA 2WXQA 2KC2A 3X0WA 3Q3FA 3RNCC 3CMMB 1OEYJ 4XWTA 2MBOA 4PS7A 3A4RA 2YEPB 1TZOA 3ZIMA 3ZJUA 4L1BA 5G5HA 1V81A 2DENB 2DLBA 2DYMA 5LNK1 3RYTA 4ANVA 4GSWA 4A9AA 5H8YE 2IY1B 1WRIA 1QF6A 1L2NA 1FRRA 2X8XX 3NY5A 1E6EB 1TY2A 1PQSA 1I4PA 3NHEB 3PHWB 1L0YB 2KN4A 4LDTD 4O1NA 2LEKA 1V1PB 2DAJA 2KACA 2D07B 4EE2A 2DZMA 3ZYYX 3Q2AC 2I1JA 3R2IA 2FUHB 4PK1A 1MJDA 3APCA 4KGTA 1NDDA 3L0WB 4NQLB 4WJOA 4DXAB 1QKZA 1SBBB 2K3UA 2KVRA 3ZDMC 4NZLB 3AEGB 2EKEC 1BUIC 4J6IA 4OW0A 2NBUA 3U8ZA 2MA9B 1IPGA 1VR9A 2NCNA 4GOCA 1FNWA 2K5PA 1V49A 2O2VB 4ZRQA 2JZZA 1UNSA 2WXNA 4B6WA 4YTNB 2N1WA 2N9PC 2Y5PA 3SDLC 2W3RA 1MVKA 2KTRB 2QC8A 1WM3A 4DDID 4BOZB 2INCC 1FEHA 2O2VA 2ZPNA 1V8CA 2DZKA 1WGKA 1PUTA 3MC8A 1R4MB 3U7DA 5TR5A 2BW2A 5JXVA 3V6CB 1ET6A 3ZO5B 2VH2A 3ZW3A 3H7SA 1L0VB 3TMPB 4K3CA 4C7ZA 1R7SA 2KWUB 5MPOA 3BYYB 2GLSA 1V1PA 4BAXA 2KZRA 3URYA 1TBEA 2M0XA 1M4VA 1WE7A 2VZKD 2MSED 2Y3AA 4DXFA 3SHQA 3FILB 1JWUD 2D11A 3L16A 1WGGA 2FCSA 2JXTA 3NS1A 2WXGA 3UINB 5AZGA 2KFJA 4OVZA 2LVPA 4BKSA 2WXMA 2RDGA 3M95A 3JSVA 4KIKA 1IBXA 4NJ6A 1SGHA 2HTHA 2RSUA 1DOIA 4MM3A 5CTRC 4ARCA 2J42A 3R66C 3BVGA 1WZ0A 3VHTC 2R61A 3JVZX 3FC4A 2ONQA 4WWNA 1UELA 4M8MA 4RF1A 3APDA 2INPE 5AEKB 1TJEA 3GOEA 3RCZA 2WXJA 2UWQA 4XZ4A 2OEDA 1ENFA 5AUKA 3VFKA 1J0GA 1XLNA 1ZGUB 4A6QA 1MPEA 4EKUA 4BVUC 1V6EA 3IHPC 1V97A 2V9HA 4KGSA 3NVWA 3NZUA 1YN5A 3RT3B 1AN8A 3CWIA 4PYUA 2V4IB 3EUB2 2HJ1A 1HTOA 4DHJB 1AARA 1IP9A 1EWCA 3I57A 4ZRPA 3PT2B 2BB6A 1L4DB 3ZNZB 1RYJA 1FO4A 1OQYA 1VZ7A 4II2B 1XLQA 2BYVE 2CHXA 1YX5B 2BF8B 2G9HD 2IGHA 2MBQA 3NVYA 2XK5B 1YQBA 4P1BC 5CHFA 1B1ZA 1EU4A 4TSSA 3IG3A 4M0WA 2KC1A 5JHBA 2IBIB 1QOBA 3AULA 3DWMA 4J3OD 3MJ5A 2KN5A 1C4CA 3KH0A 4PT5A 2LRUA 2QDFA 5EE3A 3N32A 4NY0A 2IGGA 2EKIA 1WYGA 4RCOA 1JMLA 3VUXA 1XLOA 4WURA 4NAWA 3T9LA 2KO3A 1UBQA 2FCMA 3ML9A 4RGNA 1VJKA 4WWMA 3RULA 4S17A 3AE5B 5HG2A 5IOIA 2HD5B 2SEBD 2L83A 2LGXA 5J18A 2IY0B 2WXOA 2ICIA 3L4PA 3DBLB 1PDXA 2E3TA 5CX3A 3P4SB 3AU4A 4TMAB 2LJIA 2NS5A 1CZPA 1WJ4A 1K8RB 4W9DA 4ASWC 2K6DB 2O6VD 2KDIA 3V3XA 4GDLB 1T6BX 1C4PA 3W5UB 2LXCA 4D2KA 4HPLB 1QOFA 2BYTA 4W9HA 2GBNA 3ZQ4A 4GDLA 4L2YA 2DYBA 1LM8B 1G6JA 3U30A 1EM7A 1YN4A 4AS1A 2M8SA 4XGAB 4CYEA 4M02A 4RH6A 1F52A 2LRWA 3AN1A 4RMAA 1ZXIA 2GBMA 3IBEA 4AQ7A 1KRHA 3AU5A 1FNUA 4MGZE 5LXIB 4W9CA 3M62B 1N5XA 4HVBA 4A20A 1WGRA 3EFUA 2QCZA 4KGRA 5TSSA 1SE3A 5JH5C 4RGTA 2KWCA 2JF5A 1TS3A 2KLCA 4WJNA 2KTRA 4YL8A 2AQ3B 4YT0B 3E9SA 3ETRA 3BK1A 5T8IA 2HTME 3W1SA 4YTMB 4US8A 3VRAB 4C56C 1SJED 1TTNA 3J9CA 4LJPB 4C00A 2JPHA 4PS3A 5G5GA 4B0MA 4FHJA 4W9KA 2XEWA 1MHHE 4ZHOA 1OGWA 2B3AA 2N9XA 5E6PA 3R7RA 2VH1A 2LGYA 2PMVA 5IN7A 1RWSA 2EMTA 3EHVA 1GB1A 3WIMA 3QA8A 3OWEB 4ZYSA 4JE3B 1C77A 1LGRA 1P7EA 3N1XC 1TS4A 2Q5WD 4NPNA 2JZPA 4LNOA 4AJYB 3WALA 1FRDA 2QHOA 2GBKA 1HA5A 4DHJD 1RM6C 2ZVOA 2FIDA 3GE8C 3AV8A 1F0ZA 4TV3A 2C7HA 3BWUD 1MG4A 1HTQA 2AL3A 2BYFA 4GDKA 4FJVB 4JWUC 4F1SA 4WQOB 2PKOA 4C80A 3VTWA 1ZP0B 3Q3MC 1E7VA 2DNFA 1A70A 3S2AA 3ZRFA 5KHQA 1R4NI 3TEXA 2G1EA 2BKFA 2NBWB 2CU3A 3Q8FA 4YWGG 4AUQC 2L05A 3VUWA 2D3AA 1F77A 2H89B 1FM0D 3ZKJC 2WXKA 4B9KA 5AZFA 4LNIA 1MFWA 2LMCA 2OHFA 3PZDA 4JX1C 2DZJA 4L23A 2EMSA 3N3KB 3WCQA
chains in the Genus database with same CATH topology
2DYMA 1I7HA 4HJGE 1FD6A 5LNK1 4USAA 3FILA 3NUHB 1I4GA 3TEYA 1UWMA 4A9AA 5BMHA 4P16A 1TKYA 5H8YE 1VDVA 3KQ4A 1IGDA 1WRIA 1ET9A 2PLPA 2WU2B 3O13A 1QF6A 1FRRA 2Z8LA 2QILA 1DYQA 4N6EB 1I4RA 1E6EB 1CJEA 1PFDA 1TY2A 2NMQA 2PTLA 2QIEB 2WXRA 3MC0B 1I4PA 1D5XC 2V3NA 4DXGA 2WXPA 1L0YB 3VQIA 2KN4A 2GB1A 4O1NA 1XXGA 2LEKA 1V1PB 2KACA 5H92C 1SE2A 1MHXA 5GXGB 4EE2A 1I4XA 3ZYYX 2HDEA 2MJ3A 3N9YC 3R2IA 1SJHD 4GLSC 3Q8BA 1GB4A 1V1OA 4KGTA 2JSVX 2K22A 1QKZA 3AM9A 1SBBB 1TS5A 2K3UA 3IXSA 4YSXB 4NZLB 3AEGB 3AE7B 1BUIC 1ZOYB 4OZBA 4OW0A 4YTPB 1UWXA 1VR9A 3U52E 1UGJA 1I4HA 4A90A 2IGDA 3GS2A 1FNWA 2H88B 2K5PA 2QSDA 4ZRQA 4WH4A 1DOYA 3PZ7A 3GB1A 1C79A 2FUG1 1UNSA 1TS2A 1XLPA 1YMHE 2WXNA 4YTNB 3VR9B 3MFGA 1QOGA 3HRDD 2Y5PA 3AEBB 4XWWA 3BVZA 2W3RA 1MVKA 3DWGC 1T3QA 2V3PA 4ARIA 1FEHA 4OZAA 1V8CA 2DYOA 4WIPA 3AEFB 1ACCA 1WGKA 1PUTA 1FFVA 1BMLC 2JQRB 2BW2A 4GDKB 5JXVA 1WSPA 2MEKA 3P4RB 1ET6A 2IDYA 2PVOD 3B2FA 4NAWB 1SXTA 2I38A 5C3JB 1L0VB 4C7ZA 5MPOA 1R7SA 3TUOA 3SFDB 2Y5CA 1FNVA 2JYTA 3BYYB 1Q10A 1J7BA 2CJNA 2L52A 3V05A 2KWDA 1VLBA 1V1PA 3E56A 2MJDA 3URYA 1OQQA 1M4VA 2VZKD 2DWQA 2Y3AA 4NJCA 4DXFA 3FILB 3SEBA 1JWUD 1XO3A 2N7JA 4H2AA 1IGCA 3SR6A 3P63A 1J7CA 2WXIA 2JXTA 3NS1A 2ZW0A 1J7AA 2WXGA 2WDVB 1K50A 1HZ6A 1RFKA 2ACZB 1SE4A 4KKIA 4OVZA 1N61A 1AW7A 2WXMA 5HHDG 5EE0A 1Y56A 2BB5A 2RDGA 1YN3A 2JWUA 1JROA 1SB3C 1YNTE 1IBXA 3HVDA 4A8XC 2LFIA 1FXAA 2SAKA 4REZA 1TKGA 1DOIA 2KMMA 3FAHA 3CIRB 3Q8AA 3ABVB 4ARCA 4RF0A 2W3SA 1C78A 1QOAA 3AEEB 3B2GA 2J42A 3Q8CA 2WS3B 1XEEA 3R8BA 2WP9B 3BVGA 4LK0M 2WDRB 2IPKD 4HKZE 2R61A 4R3DA 1HXYD 1IUEA 3FC4A 1K52A 2ONQA 2BTEA 1SEBD 1I4QA 3ZGZA 2FE8A 3BK2A 1KF6B 1PGXA 1ZE3D 1PGAA 3BZDB 4RF1A 1FFUA 4HROA 5C2TB 2QEJC 4A55A 2RDHA 1D4BA 2INPE 1TJEA 1YQ3B 5AUIA 1K51A 2XN9C 3TEWA 2LHDA 3AE9B 2WXJA 2N9LA 5E6JA 2OEDA 1FCLA 1ENFA 3AE2B 5AUKA 4ZHPA 1HQRD 2X38A 1C9FA 1XLNA 3AH7A 2WU5B 4A6QA 1MPEA 3T3OA 2LHEA 3TSSA 1FCCC 1ZDXA 1V97A 2INNE 1JALA 3P42A 3NVWA 4KGSA 1YN5A 4IOIE 1AN8A 2I2YA 3CWIA 3HUIA 1FXIA 2V4IB 1MI0A 3EUB2 1EWCA 3I57A 4ZRPA 1NENB 2BB6A 1L4DB 4YSYB 3W9CB 2KQ4X 1RYJA 3ZJVA 1FO4A 1IBXB 1CQVA 5HFYA 1VZ7A 2YEPF 1XLQA 1YJIA 3PO0A 2AQ2B 1ZPSA 1B9RA 1L4ZB 1ZDVA 2K9XA 2G9HD 2IGHA 2QJLA 2FBWB 3NVYA 2ZW1A 3SFEB 3Q8EA 4N59A 4WAFA 1N5WA 5EE9A 1B1ZA 1EU4A 4ITKA 2BT6A 4TSSA 4HEA1 4M0WA 3WCQA 4DQOC 3NVZA 2PW9A 4HRSA 4N58A 2XNAC 4LTUA 1E0ZA 1E7PB 1QOBA 4B0EA 2MH7A 3U7ZA 1ZUD2 2PIAA 3IAM1 3DWMA 1XCTL 4J3OD 3MJ5A 4RGOS 3VRBB 1C4CA 3NZ3A 5I4DA 4PT5A 5EE3A 3AEAB 1E9MA 2IJ0A 5EE1A 3U4EG 2IGGA 2EKIA 3AE4B 1WYGA 4JWSC 4RCOA 1OQRA 1JMLA 1FIQA 1XLOA 3VR8B 4RGMA 2L32A 4IDIA 4WURA 3NVVA 1NYRA 3EGRA 3AE8B 4RGNA 2K0PA 1VJKA 2W55A 1GAQB 3C8YA 3LXFA 4MT5A 4Q2JA 2E6XA 5BYQA 1JWMD 2M0AA 1EU3A 1JWSD 4WWMA 4IKGA 3AE5B 1YQ4B 3H8HA 5HG2A 1C4AA 2SEBD 1UUPA 1N63A 2L83A 1BXTA 2WXOA 3AE3B 2ICIA 1STEA 2VZKB 3L4PA 1D6EC 1PDXA 2E3TA 3P4SB 1N60A 1PYWD 4TMAB 4YSZB 2N0SB 5D7GA 2LJIA 1CZPA 2WNMA 2KDMA 1OFFA 3TEZA 3KWVA 1KH0A 3KLSX 3V3XA 4GDLB 5FKAC 3BIID 1T6BX 1C4PA 3RPFC 3W5UB 4D2KA 2BS2B 2BBCA 1QOFA 5BMGA 1SSNA 2WXHA 1ZXHA 1XCQL 2BYTA 3B9JA 3ZQ4A 2V0GA 3UI3A 4L2YA 1QILA 1T5XD 3P4PB 1VRAB 1F2RC 2MJEA 1L6VA 1KFYB 1EM7A 1YN4A 4UDUC 4AS1A 3MHZA 2LGIA 1QQRA 1C76A 1AWDA 2ON8A 1L6UA 4RH6A 2AQ1B 3AEDB 1DGJA 3U2SC 3AN1A 2DBYA 1VZ8A 5BMIA 2PVGC 2D5GA 2J4XA 1JRPA 1ZXIA 4AQ7A 1JQ4A 3BVMA 1VZ6A 1KRHA 4FXCA 2N9KA 2NTSA 4TQ0A 1N62A 3BYTB 4P6VF 1TYGB 1JWBD 1FNUA 1GOZA 1SIJA 2EELA 2WXFA 2BS4B 1N5XA 4KGRA 5TSSA 3LB8C 1SE3A 1HEZE 3Q69A 3GP7A 4RGTA 3AMZA 2JX5A 1D5MC 1XF5L 2W54A 4RFBA 1TS3A 1D5ZC 5HI1A 2AQ3B 4YT0B 5D3DA 3E9SA 3ETRA 3BK1A 2JU6X 2WLBA 5T8IA 3EA6A 2HTME 1DOXA 1ESFA 3W1SA 5FR3A 4YTMB 2L1AA 5D3IB 1FMAD 4US9A 1PGBA 2KAJA 3AB5A 2WDQB 4US8A 3VRAB 4C56C 2B76B 1SJED 3J9CA 3KWLA 1JWAD 3NRZA 3AE6B 4MH8A 4MACA 4OHJA 2J53A 4HKQA 5G5GA 4B0MA 2M19A 1K53A 4KKJA 1L0XB 1MHHE 1TKEA 4ZHOA 4LLGM 1F2RI 1NVID 4ZOHC 2PMVA 1RWSA 1GB1A 4RNAA 1WWTA 3OWEB 3P1MA 1KLGD 4ZYSA 1EWYC 4JE3B 1C77A 4XE0A 2M56B 1P7EA 1HZ5A 1TS4A 2Q5WD 4YXDB 4CQNA 2RMMA 1E10A 2JZPA 1LO5D 4NAMA 5BYRA 1FRDA 2GI9A 1WXQA 2WXLA 3MP9A 1HA5A 1QT9A 1RM6C 1NYQA 4XDCA 1NEKB 1KTKA 3AV8A 3I9V1 1SF0A 1F0ZA 2QMTA 1ROEA 2WQYB 3BWUD 3R2TA 2GRIA 2J52A 1GPXA 3LYYA 3W2DA 1JW9D 3P4QB 1TY0A 4JWUC 2AX5A 3W5VB 2PKOA 4MM3B 4C80A 2W82A 2BS3B 2LUMA 1ZP0B 4XDDA 1JCKB 1A70A 5BYSA 3ZJTA 1YJJA 4C7YA 1P7FA 1L5PA 1KLUD 2NTTA 2JYEA 3AE1B 1CK1A 1AYFA 3TEXA 2G1EA 4JPSA 2WXQA 2CU3A 2CJOA 3Q8FA 5FK9C 1QLBB 4YWGG 3IAS1 4OZCA 1F77A 1NI3A 4WQMA 4XWTA 2H89B 1FM0D 2WXKA 3IT6B 2RPVA 3RFZB 4TQ1A 2LMCA 2OHFA 2YEPB 4JX1C 1TZOA 4KX6B 4L23A 3ZJUA 3HVZA 3AECB 3PZ8A 4L1BA 3T3NA 2TSSA 5G5HA 3IT4B 2DLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6Q A;  4A90 A;  4A8X C;  2HDE A; 
#chains in the Genus database with same CATH topology
 1I7H A;  3H7P B;  3NG0 A;  3NUH B;  4ANW A;  3TL5 A;  3LJ3 A;  1UWM A;  3RNB C;  5BMH A;  4HLE A;  3PRP B;  3A4S C;  1E8Z A;  2Z8L A;  4I6L B;  1I4R A;  1CJE A;  2NMQ A;  1IYF A;  2WXR A;  4FUL A;  3MC0 B;  2WXP A;  3V6E B;  4GB9 A;  4G3X B;  4HCN B;  5H92 C;  2L76 A;  3LDZ E;  5C23 A;  3N9Y C;  1FPY A;  3Q8B A;  2K39 A;  3UQA A;  2K22 A;  3ECI A;  4MEM A;  1TS5 A;  4YSX B;  3PRZ A;  3ZVV A;  3AE7 B;  4YTP B;  1UWX A;  2CS4 A;  1A5R A;  4K7S A;  1UGJ A;  1I4H A;  3VDZ A;  2RR9 A;  1Q1O A;  4A90 A;  4X57 B;  3RUI B;  2JWZ A;  3APF A;  4WH4 A;  3PZ7 A;  1F9J A;  3CST A;  3VR9 B;  3AEB B;  3WAM A;  3B1L X;  2CHW A;  3DWG C;  4S0R A;  5HKH A;  2UU7 A;  4OZA A;  4XX5 A;  2JQR B;  4IC7 B;  4K7W A;  4MSQ B;  3VH3 B;  1WSP A;  1KM7 A;  3P4R B;  4GMV A;  2CU1 A;  3RNF C;  3NJT A;  4NAW B;  2I38 A;  5C3J B;  3ZLZ A;  3KUZ A;  3SFD B;  1EO6 A;  2JYT A;  2R2O A;  2AYO B;  2MJD A;  1OQQ A;  3C19 A;  3RN9 C;  5LLI A;  1WGH A;  3GZN I;  3PV1 A;  1XO3 A;  3DDC B;  1IGC A;  3B0A A;  2KNB A;  2OOB B;  1J7C A;  4EZK A;  3P2B A;  2WXI A;  1NI2 A;  4N9F 4;  3KW5 B;  2BWE S;  2PJH A;  4CHK A;  2ACZ B;  4WJQ A;  2KDF B;  1Y56 A;  1V9J A;  4EZL A;  5GMV A;  3RD2 A;  1P9D U;  2OJW A;  4AJW A;  3HVD A;  3W1S C;  1FXA A;  3I3T B;  2IND C;  2SAK A;  4FBJ B;  2Z59 B;  4WWO A;  2KMM A;  3CIR B;  3ABV B;  2W3S A;  3QHT A;  1XEE A;  3R8B A;  4ICV A;  3A9J B;  3M63 B;  1UD7 A;  3BK2 A;  1WJ6 A;  2LGD A;  2QEJ C;  4A55 A;  2RDH A;  1YD8 U;  5EDS A;  1YQ3 B;  2KYW A;  4ANX A;  1WM2 A;  3V60 A;  3I63 C;  2N7E A;  1HQR D;  1EUV B;  4RM8 A;  3QCA A;  1VCB A;  1KOT A;  1T0S C;  4HDO A;  2I2Y A;  1FXI A;  3VAW A;  2C60 A;  4GXB A;  4YSY B;  3ZJV A;  4LDT B;  2J7Q B;  1CQV A;  2YEP F;  3N30 A;  3BIN A;  2AQ2 B;  2AL6 A;  4II3 B;  1ZPS A;  3GZN B;  2QJL A;  2FBW B;  5BO4 B;  2ZW1 A;  4N59 A;  4K1R B;  2JY6 A;  3VTU A;  4HEA 1;  3NVZ A;  2PW9 A;  3DQV A;  4IM3 A;  1WE6 A;  2HJ8 A;  3MJW A;  4B0E A;  2MH7 A;  3ZXV A;  2LVO A;  2PIA A;  3ENE A;  2MWS B;  1XCT L;  3NZ3 A;  2C5L C;  2LUE A;  1RRB A;  3UIP B;  2MHJ A;  2L32 A;  1VD2 A;  3NVV A;  3EGR A;  2A5U A;  1J19 A;  3W1Y A;  2KVZ A;  3WAN A;  3LXF A;  2M0A A;  2KT7 A;  3H8H A;  5JHA A;  4I6N B;  1STE A;  2L0F A;  2VZK B;  4HCP B;  5L83 A;  1D6E C;  4ICU A;  2KD0 A;  1T0R C;  2ZCB A;  2N0S B;  3N1Y C;  3Q14 C;  1OFF A;  1WX7 A;  1KH0 A;  2BS2 B;  4M01 A;  5BMG A;  1UF0 A;  3RNG C;  3B9J A;  4K3B A;  1T5X D;  1L6V A;  2MJE A;  2NPT A;  1ZW7 A;  3MHZ A;  2LGI A;  1QQR A;  1C76 A;  1AWD A;  3DOW A;  3U2S C;  1LXD A;  3PSE B;  1JRP A;  5E6O A;  2K8B A;  3H1U A;  5J17 A;  2JZ3 B;  2NTS A;  3I5J C;  2KQS A;  4IWP A;  1GOZ A;  1SIJ A;  2WXF A;  1D3Z A;  2BS4 B;  1XQQ A;  3D32 A;  2G45 B;  4KSK C;  4RFB A;  4OVV A;  1WXM A;  2D3C A;  2JVC A;  1DOX A;  3Q6B A;  3H6N A;  4HK2 A;  3H7P A;  5D3I B;  2C7M B;  1PGB A;  4URK A;  2NR2 A;  2CKH B;  4FJY A;  4MDK E;  4OHJ A;  4HKQ A;  2M19 A;  1L0X B;  4HWI B;  2KLG A;  2MP2 B;  4EUT A;  3CSF A;  4DDG D;  1NVI D;  4ZOH C;  4RNA A;  4MH0 E;  3AXC A;  1KLG D;  2LZ6 A;  1EWY C;  1V80 A;  4ZYN A;  2M56 B;  4MSM B;  2N1V A;  5CHV C;  1HZ5 A;  2FIF A;  1GC6 A;  2REX A;  1WIA A;  1LO5 D;  5BYR A;  3L10 B;  2KX0 A;  4DK5 A;  3Q3J A;  3R3M A;  1NEK B;  2JRI B;  3GE3 C;  4KDI C;  3I9V 1;  2MBH A;  3WAP A;  4KV2 A;  5G2N A;  2GRI A;  2Z0D B;  2J52 A;  3R7Q A;  3W2D A;  3EFC A;  4C4V B;  5DPW A;  3P4Q B;  2ZEQ A;  1C1Y B;  1KJT A;  2C9W B;  2LUM A;  4BBN F;  2RPQ A;  1RAX A;  5BYS A;  1YJJ A;  4C7Y A;  1UH6 A;  1TGZ B;  1KLU D;  4HPP A;  2NPT B;  5FK9 C;  1V5T A;  2MBB B;  2W9N A;  4OZC A;  1NI3 A;  4WQM A;  3X23 A;  2KQ7 A;  3IT6 B;  2RPV A;  3RFZ B;  1U4A A;  3HVZ A;  3AEC B;  3PZ8 A;  3SD5 A;  3T3N A;  4KKI A;  1ZXH A;  4ACF A;  2N7D A;  2KMC A;  1WF9 A;  4USA A;  1TIF A;  3NZS A;  1I4G A;  2MRP A;  4P16 A;  1VDV A;  1WXS A;  3KQ4 A;  1IGD A;  2PLP A;  1ET9 A;  3O13 A;  2KKC A;  2L0T A;  2QIL A;  1P0R A;  1CMX B;  2LWP A;  2QIE B;  4DXG A;  1D5X C;  2V3N A;  1OEY A;  3ZUN A;  3B08 A;  2D3B A;  3RMK C;  2GB1 A;  1MHX A;  3OJ4 B;  5GXG B;  1I4X A;  2CR5 A;  2KTF A;  3M3J A;  5L95 C;  4P7I A;  1WJU A;  1V1O A;  3A1Q A;  2JSV X;  3CF6 E;  3AM9 A;  4BKT A;  4JL9 A;  2D2Q A;  3QQ8 B;  3HM3 A;  3BY4 B;  3VVW B;  1ZOY B;  4OZB A;  2ZVN A;  1V2Y A;  3U52 E;  2MP2 A;  1WXA A;  3L08 A;  1T0Q C;  4GIV A;  1DOY A;  3ZNI D;  1C79 A;  1YMH E;  1XLP A;  3MFG A;  1QOG A;  3SU8 X;  4XWW A;  3TIX A;  1T3Q A;  2V3P A;  1R4M I;  2DYO A;  1V86 A;  4WIP A;  2D10 A;  3KUC B;  4IUM B;  2DX5 B;  3KYD D;  4MEL A;  4GDK B;  1E5W A;  2MEK A;  1E8X A;  2PVO D;  4PYZ A;  1BT0 A;  1SXT A;  3TUO A;  3ZTC A;  2KWD A;  1VLB A;  2VRR B;  3E56 A;  3QJZ A;  3A9K B;  2DWQ A;  5AZH A;  4NJC A;  1ISN A;  1NBF C;  2L7R A;  4KZC A;  3P63 A;  1UGM A;  2ZW0 A;  1HZ6 A;  1RFK A;  1N61 A;  1AW7 A;  3ZNG C;  5EE0 A;  3UIO B;  4LCD E;  2BB5 A;  1TZ1 A;  2V4L A;  1JRO A;  3QAR A;  5IA7 A;  1YNT E;  4A8X C;  2LFI A;  2JT4 B;  1N6Z A;  4P1C C;  1TKG A;  3KVF B;  4K7U A;  4KSL C;  3Q8A A;  4LNK A;  4RF0 A;  1C78 A;  3AEE B;  3B2G A;  3Q8C A;  2WDR B;  5DCN A;  2GOW A;  3VTV A;  2M17 A;  4R3D A;  2Y5B B;  2BTE A;  1SEB D;  3ZGZ A;  2FE8 A;  4IWQ A;  1KF6 B;  1ZE3 D;  3PS6 A;  5D6J B;  1PGA A;  2ZZP B;  4HRO A;  3A9K A;  2N9E B;  2AEH A;  3DHH C;  2XN9 C;  3TEW A;  2LHD A;  1HE8 A;  5C1Z A;  2C7N B;  3AE2 B;  1SE9 A;  2X38 A;  1C9F A;  2WU5 B;  3T3O A;  4OVU A;  4BZA A;  2LI5 A;  1FCC C;  3OAW A;  4HJK A;  2INN E;  4GU2 A;  1QZE A;  3P42 A;  3QX1 A;  1YX6 B;  4IOI E;  3NOB A;  3HUI A;  4EOY A;  4DBG A;  4K81 A;  3WAO A;  1MI0 A;  2FAZ A;  4W9E A;  2PEA A;  4AOF A;  2KX3 A;  3HHM A;  4DWF A;  2KQ4 X;  3H9D A;  2XK5 A;  4KIK B;  1IBX B;  1YJI A;  1ZKH A;  1B9R A;  1L4Z B;  2K9X A;  3RI7 C;  3SFE B;  3A33 B;  3Q8E A;  1N5W A;  4CO7 A;  4ITK A;  5E6N A;  4N58 A;  4RGO S;  2L3Z A;  3VRB B;  2KFK A;  1P3Q U;  2NVU I;  5I4D A;  2RDB C;  4M00 A;  3AEA B;  1E9M A;  2IJ0 A;  4IWO A;  5EE1 A;  3DBH B;  2WDT B;  1XT9 B;  1WGY A;  2AWT A;  4FHK A;  1H4R A;  3AE4 B;  4JWS C;  3DVG Y;  2JXX A;  2ZCC A;  1OQR A;  2ASQ A;  2BQQ A;  3VR8 B;  4RGM A;  1NYR A;  1I35 A;  4MJS A;  3AE8 B;  2WX0 A;  2LJ5 A;  1Z2M A;  3Q3N C;  4Q2J A;  1GAQ B;  3C8Y A;  5BYQ A;  2IZV B;  1JWM D;  1EU3 A;  1C4A A;  5D2M B;  1UUP A;  1N63 A;  1GUA B;  3RZF A;  1WJN A;  4HDQ A;  1WZ3 A;  3ZRC A;  3RZW C;  3ZDT A;  1PYW D;  4YSZ B;  4NJ7 A;  1RLF A;  2K8H A;  2KDM A;  2PE6 B;  1GC7 A;  3TEZ A;  5FKA C;  1H8C A;  3MHS D;  4JQW C;  2BBC A;  1E8Y A;  1FXT B;  1SSN A;  1X1M A;  1TT5 B;  1XCQ L;  4MGY E;  2V0G A;  3UI3 A;  1QIL A;  1VRA B;  1F2R C;  1KFY B;  4UDU C;  1S3S G;  4FJZ A;  4LNN A;  3DBH I;  3AED B;  2RD0 A;  2DBY A;  1VZ8 A;  2CHZ A;  1E90 A;  2PVG C;  4HXD A;  2J4X A;  1JQ4 A;  1VZ6 A;  3RNE C;  2BWF A;  2UYZ B;  4TQ0 A;  2MW5 A;  3BYT B;  1JWB D;  3ALB A;  1P98 A;  1SIF A;  4ZRI A;  3LB8 C;  3Q69 A;  3AMZ A;  1D5M C;  5KHO A;  2W54 A;  3OG5 A;  4FAD A;  1D5Z C;  5HI1 A;  2L8J A;  2J0M A;  2JU6 X;  3PLU A;  2WLB A;  3L13 A;  1ESF A;  3V62 A;  2L1A A;  4US9 A;  3AB5 A;  4BBN C;  3DHG C;  2B76 B;  2ZNV C;  4W9L A;  1JWA D;  3NRZ A;  4MH8 A;  4MAC A;  1OTR B;  2GBJ A;  1WYW B;  2HE7 A;  2FNJ B;  2KDE B;  5JZE B;  1YIW A;  4G11 A;  1UBI A;  2WWZ A;  1F2R I;  2KDB A;  2YLM A;  4ZRJ A;  5DPT A;  4A3O A;  1E7U A;  4G50 A;  5DPS A;  4XE0 A;  5CHW A;  3TJP A;  4YXD B;  2RMM A;  1E10 A;  4TUU A;  4F7Z A;  4NAM A;  3ZXR A;  3MTN B;  4MJS B;  2O6V B;  4FLH A;  1QT9 A;  2O6V A;  1NYQ A;  4XDC A;  5D94 A;  1KTK A;  4KVG B;  3TCA A;  1SF0 A;  4EFO A;  1EF5 A;  3QK0 A;  1ROE A;  2WQY B;  2DHZ A;  3WA0 A;  3KUD B;  3LYY A;  4WWP A;  2PPH A;  1XD3 B;  2IYD B;  1JW9 D;  2GMI C;  2AX5 A;  3W5V B;  4MM3 B;  2LVQ A;  2M4N A;  4DHZ B;  2BS3 B;  5IO9 A;  4W9I A;  1LQB A;  1S1Q B;  3ZJT A;  1P7F A;  1L5P A;  3AE1 B;  2NTT A;  1WR1 A;  3MC9 A;  2CJO A;  1QLB B;  2D3G A;  3IAS 1;  2IO2 B;  1WR6 E;  4TQ1 A;  2A4Z A;  4KX6 B;  1GNU A;  2TSS A;  3IT4 B;  4HJG E;  4GN1 A;  1FD6 A;  2LAS A;  3FIL A;  4GGQ A;  3TEY A;  3A9J A;  1TKY A;  1WRD B;  2WU2 B;  3PRM B;  3PHX B;  2I1K A;  3V61 A;  1M94 A;  1DYQ A;  4N6E B;  1PFD A;  2PTL A;  3JW0 X;  1EF1 A;  3C0R B;  4NNJ B;  3VQI A;  1RFA A;  1XXG A;  1SE2 A;  2G4S A;  1YJ1 A;  2HDE A;  2MJ3 A;  1SJH D;  2IO1 B;  4GLS C;  4MGI E;  1GB4 A;  2LGS A;  2KJH B;  3IXS A;  2LXA A;  5LXH A;  2IGD A;  3GS2 A;  1LFD A;  2H88 B;  2QSD A;  2XBB C;  3UGB B;  2ZPY A;  3GB1 A;  2FUG 1;  1TS2 A;  3HRD D;  2G4D B;  3BVZ A;  4C4V A;  4ARI A;  3DPD A;  3OLM D;  3AEF B;  1ACC A;  1FFV A;  3PLV A;  1BML C;  3DVG X;  1WX8 A;  4IG7 B;  2MQJ A;  2IDY A;  3O65 B;  2L00 B;  3FKY A;  4EEW A;  3B2F A;  3KYC D;  1L7Y A;  4M8N A;  2Y5C A;  2WYQ A;  1FNV A;  2MCN B;  4LNF A;  1Q10 A;  1J7B A;  2CJN A;  2L52 A;  2BVC A;  3V05 A;  4FN2 A;  3K9P B;  3DHI C;  2BYE A;  4ANU A;  3DBR I;  3SEB A;  2N7J A;  4H2A A;  5IAA C;  3SR6 A;  1E8W A;  4E74 A;  1WI0 A;  1P1A A;  2WGS A;  1J7A A;  3NS8 A;  2WDV B;  1K50 A;  3ONS A;  4M0W B;  3HK0 A;  2KFK B;  3N1Z C;  2IO3 B;  1SE4 A;  1WXV A;  5HHD G;  2MBE A;  2ZNV B;  1YN3 A;  3QAQ A;  2JWU A;  1SB3 C;  4F8C B;  4BFR A;  3QWZ B;  3ZNH B;  3N20 C;  4REZ A;  4WJP A;  4AWJ A;  3A1Q B;  3FAH A;  1WMH A;  1YOV B;  1QOA A;  2WS3 B;  2WP9 B;  4I6P A;  4LK0 M;  2DZI A;  2IPK D;  4HKZ E;  4KDL B;  1HXY D;  1IUE A;  2YVC A;  1K52 A;  3IVF A;  1I4Q A;  1PGX A;  1Y8R C;  3BZD B;  1FFU A;  5C2T B;  4W9G A;  1D4B A;  2JRH A;  4E3C A;  5AUI A;  1K51 A;  3AE9 B;  4JLC A;  2N9L A;  5E6J A;  2R2Q A;  1FCL A;  1WX9 A;  1WH3 A;  4ZHP A;  3AH7 A;  3DBR B;  4AP4 C;  1Q5W B;  2LHE A;  3PPA A;  3TSS A;  2BKR B;  1ZDX A;  1WY8 A;  1JAL A;  2KMA A;  2FCN A;  3HIZ A;  2WHI A;  1NEN B;  3VH4 B;  3W9C B;  5HFY A;  2IO0 B;  2V1Y A;  4QAY A;  4IM0 A;  3PO0 A;  1Q0W B;  3AI5 A;  1ZDV A;  3DCG A;  3TBL D;  4WAF A;  2KAN A;  1I42 A;  2KK8 A;  4NQK E;  5EE9 A;  1WFY A;  2BT6 A;  4DQO C;  3IFW B;  4HRS A;  2XNA C;  4LTU A;  1E0Z A;  1E7P B;  3UF8 A;  3U7Z A;  1ZUD 2;  3IAM 1;  4XC2 A;  3VXW A;  1KLV A;  3U4E G;  2KWV B;  2BPS A;  1FIQ A;  3PRE A;  3DVN V;  4IDI A;  1T0Y A;  1R4N B;  3ML8 A;  2K0P A;  4MT5 A;  2W55 A;  3K9O B;  2LD9 A;  2RGF A;  2E6X A;  2WX1 A;  1JWS D;  4IKG A;  1YQ4 B;  4BKG A;  1BXT A;  3AE3 B;  4IM2 A;  3DBS A;  3QIJ A;  3L54 A;  2J0K A;  1N60 A;  2K25 A;  3DVN U;  4JGH B;  4RM9 A;  3UQB A;  3PGE A;  5D7G A;  2WNM A;  3KWV A;  1UZX B;  3KLS X;  4IW0 A;  3BII D;  3RPF C;  2KJ6 A;  1F1H A;  2GBR A;  4W9F A;  2WXH A;  4XYC A;  4JIO U;  3JSV B;  3T8M A;  4E71 A;  4DHZ E;  3P4P B;  4A3P A;  4KZ0 A;  5IKC M;  3PVL A;  2G3Q B;  2ON8 A;  1L6U A;  2AQ1 B;  2DAF A;  3PTF C;  1DGJ A;  5BMI A;  2D5G A;  1WGD A;  3BVM A;  3Q3O C;  2N4F A;  4FXC A;  2N9K A;  1N62 A;  2M1M A;  4P6V F;  3JYU A;  1TYG B;  4FA6 A;  1JRU A;  1MG8 A;  2EEL A;  3L17 A;  4LJO B;  1HEZ E;  2JUO A;  1GJZ A;  3GP7 A;  3EEC A;  2JX5 A;  2J0J A;  1XF5 L;  3HM6 X;  5D3D A;  3EC8 A;  3EA6 A;  5FR3 A;  2KOX A;  1FMA D;  2Z0E B;  2KAJ A;  2WDQ B;  1J8C A;  4ZRK A;  5G55 A;  4ZDV A;  3KWL A;  4G0N B;  5J2R A;  3AE6 B;  4W9J A;  3ZTD A;  2J53 A;  1GG3 A;  1K53 A;  2FCQ A;  2OJR A;  4KKJ A;  2K8C A;  2K6Q A;  2MLB A;  1TKE A;  2KXJ A;  4LLG M;  4B95 A;  5IP4 D;  2NBV B;  1Z5S B;  1WWT A;  2KHW B;  3P1M A;  4WAA A;  1V5O A;  4BOS C;  3RNA C;  4BKS D;  3QC8 B;  4CQN A;  5FR6 A;  4HPM B;  4MGK E;  2MX2 A;  2GI9 A;  1WXQ A;  2BGF A;  2WXL A;  3MP9 A;  2QMT A;  2PE9 A;  3R2T A;  1GPX A;  3DBL I;  1C3T A;  1TY0 A;  2V3S A;  2KJR A;  2K1F A;  4EZJ A;  1WMH B;  3OJ3 A;  2W82 A;  4XDD A;  1JCK B;  5DPR A;  3VUY A;  2JYE A;  1CK1 A;  1AYF A;  4TKN A;  4PS8 A;  2ZJD A;  4JPS A;  2WXQ A;  2KC2 A;  3X0W A;  3Q3F A;  3RNC C;  3CMM B;  1OEY J;  4XWT A;  2MBO A;  4PS7 A;  3A4R A;  2YEP B;  1TZO A;  3ZIM A;  3ZJU A;  4L1B A;  5G5H A;  1V81 A;  2DEN B;  2DLB A;  2DYM A;  5LNK 1;  3RYT A;  4ANV A;  4GSW A;  4A9A A;  5H8Y E;  2IY1 B;  1WRI A;  1QF6 A;  1L2N A;  1FRR A;  2X8X X;  3NY5 A;  1E6E B;  1TY2 A;  1PQS A;  1I4P A;  3NHE B;  3PHW B;  1L0Y B;  2KN4 A;  4LDT D;  4O1N A;  2LEK A;  1V1P B;  2DAJ A;  2KAC A;  2D07 B;  4EE2 A;  2DZM A;  3ZYY X;  3Q2A C;  2I1J A;  3R2I A;  2FUH B;  4PK1 A;  1MJD A;  3APC A;  4KGT A;  1NDD A;  3L0W B;  4NQL B;  4WJO A;  4DXA B;  1QKZ A;  1SBB B;  2K3U A;  2KVR A;  3ZDM C;  4NZL B;  3AEG B;  2EKE C;  1BUI C;  4J6I A;  4OW0 A;  2NBU A;  3U8Z A;  2MA9 B;  1IPG A;  1VR9 A;  2NCN A;  4GOC A;  1FNW A;  2K5P A;  1V49 A;  2O2V B;  4ZRQ A;  2JZZ A;  1UNS A;  2WXN A;  4B6W A;  4YTN B;  2N1W A;  2N9P C;  2Y5P A;  3SDL C;  2W3R A;  1MVK A;  2KTR B;  2QC8 A;  1WM3 A;  4DDI D;  4BOZ B;  2INC C;  1FEH A;  2O2V A;  2ZPN A;  1V8C A;  2DZK A;  1WGK A;  1PUT A;  3MC8 A;  1R4M B;  3U7D A;  5TR5 A;  2BW2 A;  5JXV A;  3V6C B;  1ET6 A;  3ZO5 B;  2VH2 A;  3ZW3 A;  3H7S A;  1L0V B;  3TMP B;  4K3C A;  4C7Z A;  1R7S A;  2KWU B;  5MPO A;  3BYY B;  2GLS A;  1V1P A;  4BAX A;  2KZR A;  3URY A;  1TBE A;  2M0X A;  1M4V A;  1WE7 A;  2VZK D;  2MSE D;  2Y3A A;  4DXF A;  3SHQ A;  3FIL B;  1JWU D;  2D11 A;  3L16 A;  1WGG A;  2FCS A;  2JXT A;  3NS1 A;  2WXG A;  3UIN B;  5AZG A;  2KFJ A;  4OVZ A;  2LVP A;  4BKS A;  2WXM A;  2RDG A;  3M95 A;  3JSV A;  4KIK A;  1IBX A;  4NJ6 A;  1SGH A;  2HTH A;  2RSU A;  1DOI A;  4MM3 A;  5CTR C;  4ARC A;  2J42 A;  3R66 C;  3BVG A;  1WZ0 A;  3VHT C;  2R61 A;  3JVZ X;  3FC4 A;  2ONQ A;  4WWN A;  1UEL A;  4M8M A;  4RF1 A;  3APD A;  2INP E;  5AEK B;  1TJE A;  3GOE A;  3RCZ A;  2WXJ A;  2UWQ A;  4XZ4 A;  2OED A;  1ENF A;  5AUK A;  3VFK A;  1J0G A;  1XLN A;  1ZGU B;  4A6Q A;  1MPE A;  4EKU A;  4BVU C;  1V6E A;  3IHP C;  1V97 A;  2V9H A;  4KGS A;  3NVW A;  3NZU A;  1YN5 A;  3RT3 B;  1AN8 A;  3CWI A;  4PYU A;  2V4I B;  3EUB 2;  2HJ1 A;  1HTO A;  4DHJ B;  1AAR A;  1IP9 A;  1EWC A;  3I57 A;  4ZRP A;  3PT2 B;  2BB6 A;  1L4D B;  3ZNZ B;  1RYJ A;  1FO4 A;  1OQY A;  1VZ7 A;  4II2 B;  1XLQ A;  2BYV E;  2CHX A;  1YX5 B;  2BF8 B;  2G9H D;  2IGH A;  2MBQ A;  3NVY A;  2XK5 B;  1YQB A;  4P1B C;  5CHF A;  1B1Z A;  1EU4 A;  4TSS A;  3IG3 A;  4M0W A;  2KC1 A;  5JHB A;  2IBI B;  1QOB A;  3AUL A;  3DWM A;  4J3O D;  3MJ5 A;  2KN5 A;  1C4C A;  3KH0 A;  4PT5 A;  2LRU A;  2QDF A;  5EE3 A;  3N32 A;  4NY0 A;  2IGG A;  2EKI A;  1WYG A;  4RCO A;  1JML A;  3VUX A;  1XLO A;  4WUR A;  4NAW A;  3T9L A;  2KO3 A;  1UBQ A;  2FCM A;  3ML9 A;  4RGN A;  1VJK A;  4WWM A;  3RUL A;  4S17 A;  3AE5 B;  5HG2 A;  5IOI A;  2HD5 B;  2SEB D;  2L83 A;  2LGX A;  5J18 A;  2IY0 B;  2WXO A;  2ICI A;  3L4P A;  3DBL B;  1PDX A;  2E3T A;  5CX3 A;  3P4S B;  3AU4 A;  4TMA B;  2LJI A;  2NS5 A;  1CZP A;  1WJ4 A;  1K8R B;  4W9D A;  4ASW C;  2K6D B;  2O6V D;  2KDI A;  3V3X A;  4GDL B;  1T6B X;  1C4P A;  3W5U B;  2LXC A;  4D2K A;  4HPL B;  1QOF A;  2BYT A;  4W9H A;  2GBN A;  3ZQ4 A;  4GDL A;  4L2Y A;  2DYB A;  1LM8 B;  1G6J A;  3U30 A;  1EM7 A;  1YN4 A;  4AS1 A;  2M8S A;  4XGA B;  4CYE A;  4M02 A;  4RH6 A;  1F52 A;  2LRW A;  3AN1 A;  4RMA A;  1ZXI A;  2GBM A;  3IBE A;  4AQ7 A;  1KRH A;  3AU5 A;  1FNU A;  4MGZ E;  5LXI B;  4W9C A;  3M62 B;  1N5X A;  4HVB A;  4A20 A;  1WGR A;  3EFU A;  2QCZ A;  4KGR A;  5TSS A;  1SE3 A;  5JH5 C;  4RGT A;  2KWC A;  2JF5 A;  1TS3 A;  2KLC A;  4WJN A;  2KTR A;  4YL8 A;  2AQ3 B;  4YT0 B;  3E9S A;  3ETR A;  3BK1 A;  5T8I A;  2HTM E;  3W1S A;  4YTM B;  4US8 A;  3VRA B;  4C56 C;  1SJE D;  1TTN A;  3J9C A;  4LJP B;  4C00 A;  2JPH A;  4PS3 A;  5G5G A;  4B0M A;  4FHJ A;  4W9K A;  2XEW A;  1MHH E;  4ZHO A;  1OGW A;  2B3A A;  2N9X A;  5E6P A;  3R7R A;  2VH1 A;  2LGY A;  2PMV A;  5IN7 A;  1RWS A;  2EMT A;  3EHV A;  1GB1 A;  3WIM A;  3QA8 A;  3OWE B;  4ZYS A;  4JE3 B;  1C77 A;  1LGR A;  1P7E A;  3N1X C;  1TS4 A;  2Q5W D;  4NPN A;  2JZP A;  4LNO A;  4AJY B;  3WAL A;  1FRD A;  2QHO A;  2GBK A;  1HA5 A;  4DHJ D;  1RM6 C;  2ZVO A;  2FID A;  3GE8 C;  3AV8 A;  1F0Z A;  4TV3 A;  2C7H A;  3BWU D;  1MG4 A;  1HTQ A;  2AL3 A;  2BYF A;  4GDK A;  4FJV B;  4JWU C;  4F1S A;  4WQO B;  2PKO A;  4C80 A;  3VTW A;  1ZP0 B;  3Q3M C;  1E7V A;  2DNF A;  1A70 A;  3S2A A;  3ZRF A;  5KHQ A;  1R4N I;  3TEX A;  2G1E A;  2BKF A;  2NBW B;  2CU3 A;  3Q8F A;  4YWG G;  4AUQ C;  2L05 A;  3VUW A;  2D3A A;  1F77 A;  2H89 B;  1FM0 D;  3ZKJ C;  2WXK A;  4B9K A;  5AZF A;  4LNI A;  1MFW A;  2LMC A;  2OHF A;  3PZD A;  4JX1 C;  2DZJ A;  4L23 A;  2EMS A;  3N3K B;  3WCQ A; 
#chains in the Genus database with same CATH homology
 2DYM A;  1I7H A;  4HJG E;  1FD6 A;  5LNK 1;  4USA A;  3FIL A;  3NUH B;  1I4G A;  3TEY A;  1UWM A;  4A9A A;  5BMH A;  4P16 A;  1TKY A;  5H8Y E;  1VDV A;  3KQ4 A;  1IGD A;  1WRI A;  1ET9 A;  2PLP A;  2WU2 B;  3O13 A;  1QF6 A;  1FRR A;  2Z8L A;  2QIL A;  1DYQ A;  4N6E B;  1I4R A;  1E6E B;  1CJE A;  1PFD A;  1TY2 A;  2NMQ A;  2PTL A;  2QIE B;  2WXR A;  3MC0 B;  1I4P A;  1D5X C;  2V3N A;  4DXG A;  2WXP A;  1L0Y B;  3VQI A;  2KN4 A;  2GB1 A;  4O1N A;  1XXG A;  2LEK A;  1V1P B;  2KAC A;  5H92 C;  1SE2 A;  1MHX A;  5GXG B;  4EE2 A;  1I4X A;  3ZYY X;  2HDE A;  2MJ3 A;  3N9Y C;  3R2I A;  1SJH D;  4GLS C;  3Q8B A;  1GB4 A;  1V1O A;  4KGT A;  2JSV X;  2K22 A;  1QKZ A;  3AM9 A;  1SBB B;  1TS5 A;  2K3U A;  3IXS A;  4YSX B;  4NZL B;  3AEG B;  3AE7 B;  1BUI C;  1ZOY B;  4OZB A;  4OW0 A;  4YTP B;  1UWX A;  1VR9 A;  3U52 E;  1UGJ A;  1I4H A;  4A90 A;  2IGD A;  3GS2 A;  1FNW A;  2H88 B;  2K5P A;  2QSD A;  4ZRQ A;  4WH4 A;  1DOY A;  3PZ7 A;  3GB1 A;  1C79 A;  2FUG 1;  1UNS A;  1TS2 A;  1XLP A;  1YMH E;  2WXN A;  4YTN B;  3VR9 B;  3MFG A;  1QOG A;  3HRD D;  2Y5P A;  3AEB B;  4XWW A;  3BVZ A;  2W3R A;  1MVK A;  3DWG C;  1T3Q A;  2V3P A;  4ARI A;  1FEH A;  4OZA A;  1V8C A;  2DYO A;  4WIP A;  3AEF B;  1ACC A;  1WGK A;  1PUT A;  1FFV A;  1BML C;  2JQR B;  2BW2 A;  4GDK B;  5JXV A;  1WSP A;  2MEK A;  3P4R B;  1ET6 A;  2IDY A;  2PVO D;  3B2F A;  4NAW B;  1SXT A;  2I38 A;  5C3J B;  1L0V B;  4C7Z A;  5MPO A;  1R7S A;  3TUO A;  3SFD B;  2Y5C A;  1FNV A;  2JYT A;  3BYY B;  1Q10 A;  1J7B A;  2CJN A;  2L52 A;  3V05 A;  2KWD A;  1VLB A;  1V1P A;  3E56 A;  2MJD A;  3URY A;  1OQQ A;  1M4V A;  2VZK D;  2DWQ A;  2Y3A A;  4NJC A;  4DXF A;  3FIL B;  3SEB A;  1JWU D;  1XO3 A;  2N7J A;  4H2A A;  1IGC A;  3SR6 A;  3P63 A;  1J7C A;  2WXI A;  2JXT A;  3NS1 A;  2ZW0 A;  1J7A A;  2WXG A;  2WDV B;  1K50 A;  1HZ6 A;  1RFK A;  2ACZ B;  1SE4 A;  4KKI A;  4OVZ A;  1N61 A;  1AW7 A;  2WXM A;  5HHD G;  5EE0 A;  1Y56 A;  2BB5 A;  2RDG A;  1YN3 A;  2JWU A;  1JRO A;  1SB3 C;  1YNT E;  1IBX A;  3HVD A;  4A8X C;  2LFI A;  1FXA A;  2SAK A;  4REZ A;  1TKG A;  1DOI A;  2KMM A;  3FAH A;  3CIR B;  3Q8A A;  3ABV B;  4ARC A;  4RF0 A;  2W3S A;  1C78 A;  1QOA A;  3AEE B;  3B2G A;  2J42 A;  3Q8C A;  2WS3 B;  1XEE A;  3R8B A;  2WP9 B;  3BVG A;  4LK0 M;  2WDR B;  2IPK D;  4HKZ E;  2R61 A;  4R3D A;  1HXY D;  1IUE A;  3FC4 A;  1K52 A;  2ONQ A;  2BTE A;  1SEB D;  1I4Q A;  3ZGZ A;  2FE8 A;  3BK2 A;  1KF6 B;  1PGX A;  1ZE3 D;  1PGA A;  3BZD B;  4RF1 A;  1FFU A;  4HRO A;  5C2T B;  2QEJ C;  4A55 A;  2RDH A;  1D4B A;  2INP E;  1TJE A;  1YQ3 B;  5AUI A;  1K51 A;  2XN9 C;  3TEW A;  2LHD A;  3AE9 B;  2WXJ A;  2N9L A;  5E6J A;  2OED A;  1FCL A;  1ENF A;  3AE2 B;  5AUK A;  4ZHP A;  1HQR D;  2X38 A;  1C9F A;  1XLN A;  3AH7 A;  2WU5 B;  4A6Q A;  1MPE A;  3T3O A;  2LHE A;  3TSS A;  1FCC C;  1ZDX A;  1V97 A;  2INN E;  1JAL A;  3P42 A;  3NVW A;  4KGS A;  1YN5 A;  4IOI E;  1AN8 A;  2I2Y A;  3CWI A;  3HUI A;  1FXI A;  2V4I B;  1MI0 A;  3EUB 2;  1EWC A;  3I57 A;  4ZRP A;  1NEN B;  2BB6 A;  1L4D B;  4YSY B;  3W9C B;  2KQ4 X;  1RYJ A;  3ZJV A;  1FO4 A;  1IBX B;  1CQV A;  5HFY A;  1VZ7 A;  2YEP F;  1XLQ A;  1YJI A;  3PO0 A;  2AQ2 B;  1ZPS A;  1B9R A;  1L4Z B;  1ZDV A;  2K9X A;  2G9H D;  2IGH A;  2QJL A;  2FBW B;  3NVY A;  2ZW1 A;  3SFE B;  3Q8E A;  4N59 A;  4WAF A;  1N5W A;  5EE9 A;  1B1Z A;  1EU4 A;  4ITK A;  2BT6 A;  4TSS A;  4HEA 1;  4M0W A;  3WCQ A;  4DQO C;  3NVZ A;  2PW9 A;  4HRS A;  4N58 A;  2XNA C;  4LTU A;  1E0Z A;  1E7P B;  1QOB A;  4B0E A;  2MH7 A;  3U7Z A;  1ZUD 2;  2PIA A;  3IAM 1;  3DWM A;  1XCT L;  4J3O D;  3MJ5 A;  4RGO S;  3VRB B;  1C4C A;  3NZ3 A;  5I4D A;  4PT5 A;  5EE3 A;  3AEA B;  1E9M A;  2IJ0 A;  5EE1 A;  3U4E G;  2IGG A;  2EKI A;  3AE4 B;  1WYG A;  4JWS C;  4RCO A;  1OQR A;  1JML A;  1FIQ A;  1XLO A;  3VR8 B;  4RGM A;  2L32 A;  4IDI A;  4WUR A;  3NVV A;  1NYR A;  3EGR A;  3AE8 B;  4RGN A;  2K0P A;  1VJK A;  2W55 A;  1GAQ B;  3C8Y A;  3LXF A;  4MT5 A;  4Q2J A;  2E6X A;  5BYQ A;  1JWM D;  2M0A A;  1EU3 A;  1JWS D;  4WWM A;  4IKG A;  3AE5 B;  1YQ4 B;  3H8H A;  5HG2 A;  1C4A A;  2SEB D;  1UUP A;  1N63 A;  2L83 A;  1BXT A;  2WXO A;  3AE3 B;  2ICI A;  1STE A;  2VZK B;  3L4P A;  1D6E C;  1PDX A;  2E3T A;  3P4S B;  1N60 A;  1PYW D;  4TMA B;  4YSZ B;  2N0S B;  5D7G A;  2LJI A;  1CZP A;  2WNM A;  2KDM A;  1OFF A;  3TEZ A;  3KWV A;  1KH0 A;  3KLS X;  3V3X A;  4GDL B;  5FKA C;  3BII D;  1T6B X;  1C4P A;  3RPF C;  3W5U B;  4D2K A;  2BS2 B;  2BBC A;  1QOF A;  5BMG A;  1SSN A;  2WXH A;  1ZXH A;  1XCQ L;  2BYT A;  3B9J A;  3ZQ4 A;  2V0G A;  3UI3 A;  4L2Y A;  1QIL A;  1T5X D;  3P4P B;  1VRA B;  1F2R C;  2MJE A;  1L6V A;  1KFY B;  1EM7 A;  1YN4 A;  4UDU C;  4AS1 A;  3MHZ A;  2LGI A;  1QQR A;  1C76 A;  1AWD A;  2ON8 A;  1L6U A;  4RH6 A;  2AQ1 B;  3AED B;  1DGJ A;  3U2S C;  3AN1 A;  2DBY A;  1VZ8 A;  5BMI A;  2PVG C;  2D5G A;  2J4X A;  1JRP A;  1ZXI A;  4AQ7 A;  1JQ4 A;  3BVM A;  1VZ6 A;  1KRH A;  4FXC A;  2N9K A;  2NTS A;  4TQ0 A;  1N62 A;  3BYT B;  4P6V F;  1TYG B;  1JWB D;  1FNU A;  1GOZ A;  1SIJ A;  2EEL A;  2WXF A;  2BS4 B;  1N5X A;  4KGR A;  5TSS A;  3LB8 C;  1SE3 A;  1HEZ E;  3Q69 A;  3GP7 A;  4RGT A;  3AMZ A;  2JX5 A;  1D5M C;  1XF5 L;  2W54 A;  4RFB A;  1TS3 A;  1D5Z C;  5HI1 A;  2AQ3 B;  4YT0 B;  5D3D A;  3E9S A;  3ETR A;  3BK1 A;  2JU6 X;  2WLB A;  5T8I A;  3EA6 A;  2HTM E;  1DOX A;  1ESF A;  3W1S A;  5FR3 A;  4YTM B;  2L1A A;  5D3I B;  1FMA D;  4US9 A;  1PGB A;  2KAJ A;  3AB5 A;  2WDQ B;  4US8 A;  3VRA B;  4C56 C;  2B76 B;  1SJE D;  3J9C A;  3KWL A;  1JWA D;  3NRZ A;  3AE6 B;  4MH8 A;  4MAC A;  4OHJ A;  2J53 A;  4HKQ A;  5G5G A;  4B0M A;  2M19 A;  1K53 A;  4KKJ A;  1L0X B;  1MHH E;  1TKE A;  4ZHO A;  4LLG M;  1F2R I;  1NVI D;  4ZOH C;  2PMV A;  1RWS A;  1GB1 A;  4RNA A;  1WWT A;  3OWE B;  3P1M A;  1KLG D;  4ZYS A;  1EWY C;  4JE3 B;  1C77 A;  4XE0 A;  2M56 B;  1P7E A;  1HZ5 A;  1TS4 A;  2Q5W D;  4YXD B;  4CQN A;  2RMM A;  1E10 A;  2JZP A;  1LO5 D;  4NAM A;  5BYR A;  1FRD A;  2GI9 A;  1WXQ A;  2WXL A;  3MP9 A;  1HA5 A;  1QT9 A;  1RM6 C;  1NYQ A;  4XDC A;  1NEK B;  1KTK A;  3AV8 A;  3I9V 1;  1SF0 A;  1F0Z A;  2QMT A;  1ROE A;  2WQY B;  3BWU D;  3R2T A;  2GRI A;  2J52 A;  1GPX A;  3LYY A;  3W2D A;  1JW9 D;  3P4Q B;  1TY0 A;  4JWU C;  2AX5 A;  3W5V B;  2PKO A;  4MM3 B;  4C80 A;  2W82 A;  2BS3 B;  2LUM A;  1ZP0 B;  4XDD A;  1JCK B;  1A70 A;  5BYS A;  3ZJT A;  1YJJ A;  4C7Y A;  1P7F A;  1L5P A;  1KLU D;  2NTT A;  2JYE A;  3AE1 B;  1CK1 A;  1AYF A;  3TEX A;  2G1E A;  4JPS A;  2WXQ A;  2CU3 A;  2CJO A;  3Q8F A;  5FK9 C;  1QLB B;  4YWG G;  3IAS 1;  4OZC A;  1F77 A;  1NI3 A;  4WQM A;  4XWT A;  2H89 B;  1FM0 D;  2WXK A;  3IT6 B;  2RPV A;  3RFZ B;  4TQ1 A;  2LMC A;  2OHF A;  2YEP B;  4JX1 C;  1TZO A;  4KX6 B;  4L23 A;  3ZJU A;  3HVZ A;  3AEC B;  3PZ8 A;  4L1B A;  3T3N A;  2TSS A;  5G5H A;  3IT4 B;  2DLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...