1AYFA

Bovine adrenodoxin (oxidized)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
KITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords ADRENODOXIN
publication title New aspects of electron transfer revealed by the crystal structure of a truncated bovine adrenodoxin, Adx(4-108).
pubmed doi rcsb
source organism Bos taurus
total genus 29
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ayfA00
5MPOA 3AECB 1WWTA 2B76B 3B2FA 3W9CB 1E6EB 1DOYA 1TKGA 1N62A 4JWSC 4P6VF 3LB8C 1GAQB 3AE8B 4KX6B 5G5HA 2HTME 2WDRB 1NENB 1XLOA 1TKYA 3BIID 5EE0A 4YXDB 2K5PA 1WXQA 4ITKA 4N6EB 1SIJA 2PVOD 3P4SB 5EE3A 1JROA 1RFKA 4IDIA 2MJDA 3DWGC 4WQMA 4YSZB 1OQQA 2KAJA 2WU2B 1QF6A 1T3QA 1EWYC 3P63A 3VRBB 1L0VB 3PO0A 1V8CA 2WS3B 1I7HA 1ZXIA 1J7BA 3B9JA 4HROA 2DBYA 4C80A 1SF0A 2L83A 1YJIA 1FO4A 1JWAD 5G5GA 2E3TA 3AEDB 4YTPB 1ZP0B 3NVWA 5AUIA 1XLNA 2DWQA 1A70A 2M19A 2PKOA 3L4PA 5AUKA 1FXIA 1JQ4A 2PVGC 3AEAB 4USAA 1NEKB 1VJKA 3NVYA 3SFEB 3VRAB 1KF6B 1QOFA 1NI3A 2W3SA 2MH7A 1L5PA 2W55A 1KFYB 1UWMA 1N60A 4N59A 3AE9B 1TYGB 1QOAA 3AE3B 3AEFB 4YSYB 4JWUC 4JX1C 4N58A 3AH7A 1QT9A 1XO3A 2JQRB 3KWLA 3RPFC 1RWSA 3NRZA 4YSXB 3AE4B 1RM6C 3W5UB 3W5VB 2BS3B 1R7SA 1NYQA 3AE1B 2ACZB 3EUB2 2Q5WD 2WU5B 3AE7B 1QLBB 3SFDB 2K22A 3AEGB 2WLBA 1N63A 1QOBA 3AM9A 2WP9B 4YTMB 2WDVB 1FM0D 1L6UA 3HUIA 3VR8B 1IUEA 3AE2B 1JW9D 1OFFA 3P4PB 3SR6A 1ZUD2 1CZPA 1E7PB 2BS4B 2LEKA 3CWIA 4C7YA 4ZHPA 1E9MA 1WRIA 3ETRA 2QIEB 2L52A 2H89B 5GXGB 4A9AA 1FIQA 1DOIA 1YQ3B 1CJEA 1WYGA 2AX5A 1FXAA 1XLPA 2CJNA 2H88B 1FFVA 5EE1A 1NVID 1XLQA 3CIRB 1VLBA 3FAHA 3LXFA 1DGJA 3P4QB 4ZOHC 5H92C 4C7ZA 1YJJA 1F0ZA 1J7AA 3P4RB 2KMMA 1GPXA 2CJOA 4US8A 4WWMA 1TKEA 1N5XA 1SB3C 2EKIA 2N0SB 2CU3A 3B2GA 3AMZA 2Y5CA 1V97A 2JX5A 3AB5A 4FXCA 4US9A 3AE5B 3HRDD 1JALA 2PIAA 1QOGA 1PUTA 2WQYB 3P1MA 2BT6A 1J7CA 3DWMA 3NVVA 2WDQB 1NYRA 3WCQA 1FRRA 1ROEA 3FC4A 5EE9A 5C2TB 3HVZA 2FBWB 3NS1A 1FRDA 1N61A 3AE6B 3VR9B 1DOXA 2K9XA 1E0ZA 1JRPA 1AYFA 2W54A 3AN1A 1OQRA 2QJLA 1KRHA 4ZHOA 5C3JB 3AEEB 1PDXA 4HRSA 3NVZA 1JWBD 2MJEA 3ABVB 3ZYYX 2OHFA 2BS2B 1AWDA 5H8YE 2G1EA 2MJ3A 1ZOYB 1YQ4B 3AV8A 1RYJA 1FFUA 1FMAD 2W3RA 1TJEA 3AEBB 1B9RA 1N5WA 1WGKA 1PFDA 1VDVA 2M56B 4YTNB 1E10A 4LTUA 1L6VA 4YT0B
chains in the Genus database with same CATH superfamily
1ZE3D 3RULA 5FKAC 1NENB 1PYWD 2O6VB 5BYRA 4ITKA 2JXTA 4NY0A 1JROA 3RNCC 4IDIA 2MJDA 4IM2A 2IO3B 2OEDA 1EWYC 1E7UA 1SIFA 3L16A 3OJ4B 1GUAB 1WR1A 1TT5B 3L13A 5T8IA 4DHZE 2WXGA 2OJWA 2KJHB 3M95A 2W55A 1KFYB 2L05A 1P9DU 1FNVA 2GMIC 1TZOA 4II3B 3KYDD 4W9DA 3AE4B 3RCZA 3LDZE 5BMGA 1NYQA 5IOIA 2KDEB 5HI1A 2DZMA 1L7YA 4BKSD 3QWZB 1T5XD 1ZUD2 3Q8AA 3ETRA 1PGBA 3ZJUA 1V81A 3KYCD 1L4DB 3DVNU 4OVVA 2UU7A 3CIRB 1VLBA 4MACA 4TUUA 4US8A 4XDDA 2JSVX 4US9A 1SSNA 3BZDB 2IBIB 2WQYB 1MVKA 1ROEA 3ZNZB 3H7PA 1V5OA 2NBUA 3NS1A 1JRPA 4L23A 5C3JB 3APCA 2INNE 3DBRB 2HE7A 1N6ZA 3H9DA 2W3RA 1N5WA 1PFDA 2MP2A 3RD2A 4KV2A 3AECB 3A1QA 3RYTA 4IG7B 1N62A 1NDDA 1D3ZA 1SIJA 2LGSA 3FKYA 3NJTA 4W9EA 1ZXIA 1XEEA 4KGRA 5BMHA 2LFIA 4S17A 4ACFA 1RRBA 3RNGC 3N30A 4TQ1A 2K8BA 3SFEB 4XE0A 2V1YA 4M0WA 4DBGA 3BVZA 1SGHA 3UQBA 1C3TA 3GP7A 3PHXB 4DWFA 4P1BC 4MJSB 2X38A 3SFDB 1KM7A 3AXCA 2D3AA 1WR6E 4P1CC 3SHQA 4K7UA 4EZKA 2YEPB 3AE2B 2KQSA 2LI5A 3C0RB 1E7PB 2IPKD 1WZ0A 2IGGA 1SEBD 2WXNA 4IOIE 1J19A 2KXJA 5CX3A 1M4VA 1IGDA 2KHWB 2EMTA 2PJHA 3B2GA 2JX5A 2LVPA 2JXXA 3PTFC 3V61A 5TSSA 1PUTA 1J7CA 3OJ3A 2MBOA 1ESFA 5EE9A 4CYEA 3MFGA 3R3MA 2DX5B 1I4RA 2JZZA 3IAS1 1Q0WB 1GOZA 2WXIA 2JRIB 3N1XC 1PDXA 2ZW0A 5E6OA 2WXOA 5DPSA 2MX2A 2M56B 4KKIA 2WXRA 2N9PC 3EC8A 2AQ2B 3IG3A 1Z2MA 4WJPA 1Q5WB 1D5XC 2QMTA 2IO0B 5JHBA 2WDRB 2Z59B 2QC8A 2N9XA 1WI0A 4PYUA 1RFKA 1VD2A 3VH4B 3IXSA 1CMXB 3RN9C 2O6VD 1GB1A 4KDIC 4HROA 5BYSA 4AOFA 4F8CB 4BFRA 1I4PA 4YTPB 3NS8A 3E56A 5TR5A 2M19A 2W82A 4EKUA 4USAA 3H7PB 2NTTA 2CU1A 3ALBA 1L5PA 4TSSA 4FLHA 2INPE 1TYGB 3AE3B 4YSYB 4JWUC 3U52E 2LUMA 1XO3A 4W9FA 3DBHB 4FA6A 1P7EA 5HG2A 4YSXB 3TBLD 2KQ7A 3W5UB 5KHOA 2K8HA 3PRMB 3AEGB 2WLBA 2GBKA 3UINB 2LRUA 3QAQA 4C4VA 3TEZA 4HEA1 2AX5A 1XLPA 4JGHB 3RNEC 3ZTCA 2VZKD 1KLGD 2IZVB 3P4RB 4LCDE 4E71A 2KKCA 2ZNVB 3ZNGC 1TGZB 3FILA 2NPTB 2WYQA 2IO1B 3SEBA 3AE5B 1JALA 3B1LX 1NYRA 3ZJVA 1Q10A 3UI3A 4HJGE 1UH6A 2LVQA 2ZCCA 4XYCA 4A6QA 5FR6A 4RCOA 3Q8FA 4FBJB 1P7FA 2G4DB 3AEBB 2Y5BB 3HIZA 2EMSA 1GC6A 1C9FA 5MPOA 3WA0A 2GOWA 1V1PA 2K6QA 2KX0A 2M17A 3RMKC 1RAXA 5C1ZA 1V86A 1H4RA 4O1NA 2V4IB 2C9WB 1ZKHA 4CHKA 3CSTA 1E5WA 2BVCA 1OTRB 2LMCA 4KSLC 2GBMA 2DBYA 1WXAA 1ZP0B 3NVWA 2Z0DB 3L4PA 3HHMA 3VFKA 1H8CA 2K0PA 3HM6X 4IUMB 1ZDVA 1YMHE 5BO4B 5D3DA 4OZBA 3Q3JA 2K1FA 2KANA 2E6XA 2IGHA 2QDFA 3RPFC 2FE8A 4GSWA 4GDKB 2ACZB 2EELA 2IY0B 1XXGA 2L76A 3NZSA 3KLSX 2SAKA 4P16A 5FR3A 1ZGUB 4NJ6A 1IP9A 2N7JA 4REZA 1U4AA 4W9IA 1FEHA 2YEPF 1ISNA 3RZWC 3P4QB 1YN5A 2L1AA 2KMMA 4GN1A 1TKEA 3U7DA 5DPWA 4ZDVA 3AB5A 1WXMA 3ZNID 3WAPA 3WCQA 1LXDA 5HHDG 2MW5A 1DOXA 4GIVA 1VCBA 1FCCC 1L0XB 1WSPA 1GB4A 2QJLA 1JMLA 2KWCA 4HKQA 2JUOA 2WXLA 2XK5A 4FN2A 1B1ZA 2WWZA 4BBNC 1WX8A 1YOVB 1T0RC 4C4VB 3B2FA 4WWPA 1HZ6A 2CKHB 5IKCM 1QILA 3AE8B 2D3GA 2B3AA 2KN4A 1WJNA 4N6EB 3VAWA 1EU4A 2WGSA 2EKEC 4HDQA 3QQ8B 4OHJA 3P63A 1YQBA 2LWPA 2RDBC 3FILB 3K9PB 3ML8A 2IYDB 2KJ6A 2BWES 3NOBA 1TIFA 2MBEA 1E8YA 1MPEA 5IA7A 1J8CA 2ZPNA 4N59A 1QOAA 2FUHB 4N58A 1T6BX 3PZ7A 1DYQA 2ICIA 1GNUA 2M8SA 2WX0A 2LHEA 3EUB2 4W9LA 1F77A 4XWWA 2BKFA 1N63A 2HJ8A 3AM9A 1L6UA 3P4PB 2PE9A 1V1PB 2LEKA 1V1OA 1WRIA 3TUOA 4PS3A 1R4MI 5D2MB 2I1KA 3U2SC 4XDCA 4C7ZA 1YJJA 1ZPSA 4F7ZA 2JZ3B 2LGXA 4RGTA 3BK1A 3KQ4A 3AMZA 5L83A 1WIAA 3P1MA 2PPHA 2BT6A 3I5JC 3NVVA 3DBHI 2C60A 3ZVVA 1FRRA 4W9JA 4IM3A 4FULA 3PZ8A 3AULA 2JT4B 3AN1A 1AYFA 3IFWB 1WX9A 3AEEB 3ZXVA 3ABVB 2G1EA 3AU4A 4XGAB 1G6JA 4YTNB 1E10A 4F1SA 1FXTB 1F9JA 4S0RA 4LNKA 3W9CB 4GMVA 1E6EB 2V3NA 4P6VF 2ON8A 3TEWA 1P0RA 2ZVOA 2LGDA 3O65B 5BMIA 4JPSA 3Q3NC 2KWVB 4GGQA 4ZRQA 4C56C 2GBJA 2J0MA 1J7BA 1RFAA 2N7DA 4OVUA 3QARA 1ZDXA 5AUKA 3SD5A 3QA8A 1WZ3A 2FCNA 3PLUA 1QOFA 3UQAA 2CHWA 2N9LA 2XK5B 3QC8B 1QZEA 2VH1A 5HFYA 3AE1B 3RI7C 2Q5WD 2KDIA 3AE7B 1EF5A 4HKZE 1D6EC 3VR8B 2I38A 4A20A 4ZYNA 4ZHPA 3CWIA 4MH0E 2C5LC 2QIEB 1I4XA 4KIKA 1K51A 3IAM1 4B9KA 3QHTA 2FUG1 2G45B 1NBFC 1F0ZA 1J7AA 3QJZA 1T0QC 2L0TA 1A5RA 4II2B 2KTRA 4EUTA 2NBWB 3RT3B 3EHVA 4HLEA 4OZCA 3NZUA 2KMAA 2N0SB 2W9NA 2KDMA 4TV3A 4D2KA 5JZEB 3OG5A 3EFUA 2C7MB 1HE8A 4LNOA 4G11A 5C2TB 2WX1A 2BB5A 2VZKB 1FD6A 1GG3A 3PV1A 3DBLI 1UZXB 3VUWA 4DDGD 4HRSA 1P1AA 3EFCA 3EA6A 3QK0A 1AWDA 1LFDA 3ZLZA 2K6DB 1EUVB 1ZXHA 4AWJA 3ZGZA 1AN8A 2RMMA 2DAJA 3HM3A 4GXBA 4FHJA 3OLMD 1ENFA 3LB8C 5G5HA 1F2RC 2KFJA 2K5PA 4PYZA 3GZNB 4M8NA 1SE9A 4OVZA 1PGAA 2KDBA 4ANXA 2AYOB 4XC2A 1YX6B 4MGYE 1WH3A 1V8CA 4WAAA 2KWDA 4N9F4 1SF0A 2KZRA 4NQKE 3N32A 2MEKA 3HK0A 3KUCB 4LLGM 2IO2B 4L1BA 5I4DA 3AEAB 3NVYA 3D32A 4B6WA 1WGDA 1MI0A 1MFWA 5LLIA 3DOWA 3VTVA 4ZRIA 2JYEA 2NTSA 1QLBB 3BVGA 4MGIE 1LM8B 3PREA 1IUEA 2KC1A 1JW9D 1OFFA 5CTRC 4EE2A 1WE7A 2UYZB 5LXHA 4TKNA 1WGHA 2L52A 4AJWA 4BKGA 3W1YA 3X23A 4ZOHC 1DGJA 3BY4B 1OEYJ 3KUZA 5KHQA 3A9KB 3DWMA 3UIPB 4LDTB 4AP4C 4JL9A 1FRDA 1Z5SB 2ZW1A 4HWIB 4W9HA 2MLBA 1ZOYB 4OZAA 1RYJA 2MA9B 2ZNVC 4EZJA 2CR5A 3TEXA 1Y56A 4ZRJA 1YNTE 1WY8A 3VVWB 2KQ4X 2INCC 4BBNF 1L4ZB 3DCGA 4R3DA 4KIKB 1R4NI 2PW9A 2GRIA 4L2YA 2LJ5A 3Q3MC 1WJ6A 4KGSA 2PVOD 4WQMA 1FNWA 3GB1A 1SJED 3M63B 4EOYA 2KTRB 3B08A 4WWOA 2BPSA 4QAYA 3AEDB 2G9HD 1L0YB 1KF6B 2VH2A 1NI3A 1C78A 1UWMA 2N1WA 4EZLA 3MJ5A 3E9SA 2BYTA 3AH7A 1E7VA 2CS4A 2DENB 3ZJTA 1HXYD 3W5VB 3V62A 1V49A 4ICUA 4YTMB 3APDA 3Q14C 4MELA 1IYFA 3R8BA 2KTFA 4ZRKA 3Q3OC 2D3BA 2IDYA 4A9AA 5DCNA 2RSUA 2M0AA 5EE1A 1XLQA 4NJCA 1BT0A 4B0MA 2MP2B 2K39A 3VUYA 2FCQA 3A1QB 2INDC 3N3KB 4NJ7A 2HDEA 1V9JA 1J0GA 1MHXA 1N61A 1SE2A 2K9XA 3R7QA 1RLFA 4W9CA 1K50A 1MG8A 4GOCA 2LUEA 1K53A 2OHFA 3Q69A 1TS4A 2PMVA 4MM3A 2G4SA 5GMVA 1HTQA 5CHFA 4RFBA 3W1SA 4YT0B 1V5TA 3JYUA 1TKGA 2QEJC 2NR2A 1LGRA 4M0WB 4DHZB 1I4QA 5EE3A 1OQQA 3L54A 2J53A 4MEMA 4RNAA 4EFOA 2N7EA 4XZ4A 1K8RB 3Q8CA 5CHWA 2JRHA 1E8WA 4FHKA 4KVGB 1SE3A 4GDLA 1UELA 3ZTDA 3LJ3A 2KX3A 4JLCA 2D10A 1RWSA 4TQ0A 3R66C 1TTNA 4JIOU 3K9OB 5J17A 3DBRI 4DK5A 2H89B 2L00B 2D07B 1KH0A 1FIQA 2DZJA 1YQ3B 3V60A 2BYFA 1F1HA 4NPNA 3L08A 5H92C 5IN7A 1Q1OA 2MBBB 5DPRA 1WX7A 3ZDTA 5D94A 4LNFA 1XD3B 2RR9A 4ZRPA 1C76A 3VDZA 1YD8U 4RGOS 2KACA 4LDTD 1P98A 2LRWA 2FIFA 2BBCA 2BS2B 1UUPA 2RD0A 4K1RB 3V6EB 4A3OA 3U8ZA 1WMHA 2DYOA 3U4EG 3Q2AC 2LHDA 3IVFA 3HVDA 4KDLB 4FJZA 1SXTA 1KOTA 4MGZE 4I6LB 1BUIC 1E8XA 1GC7A 3GE3C 3V05A 2RPQA 4BZAA 4B0EA 4BOZB 3U7ZA 2LXCA 4YSZB 4PS7A 2WXPA 2WS3B 1EF1A 2C7NB 1P3QU 4YL8A 4JE3B 3ZRFA 4W9KA 2DLBA 2NBVB 4ANUA 3R2IA 3QX1A 4HVBA 3VRAB 4GB9A 1MJDA 1KLVA 4LNNA 4LJPB 3UIOB 4AQ7A 3P2BA 2V3SA 5LNK1 1C1YB 4AS1A 3WALA 2V4LA 2JQRB 2KOXA 1RM6C 1KLUD 4GU2A 4MM3B 2K22A 1F2RI 1HEZE 1MHHE 4TMAB 2WP9B 2NCNA 2MWSB 3RNAC 1EO6A 3SR6A 4RMAA 2JPHA 1I35A 3M3JA 4HXDA 2QSDA 4MSMB 3VXWA 1ET9A 2LD9A 2HD5B 1SJHD 3C8YA 1K52A 2DYMA 2WDTB 1YJ1A 4EEWA 1CK1A 2CHZA 4I6PA 3A4RA 4ARIA 5AZGA 3GE8C 2D11A 1I4GA 5JHAA 2WDQB 4GDLB 3PGEA 2PE6B 3I3TB 3AE6B 3T9LA 3T8MA 3VR9B 4IWQA 2BGFA 2J7QB 2KJRA 2XBBC 3AV8A 2JZPA 2RPVA 1QQRA 3GS2A 1F52A 1D4BA 2N9KA 2C7HA 3TCAA 4RF0A 5EE0A 2WXJA 4WH4A 3DVGX 1E90A 2X8XX 3IT4B 3TMPB 3R2TA 4K7SA 3GOEA 3VRBB 1I7HA 1TBEA 2O2VA 5D7GA 5G5GA 2WXHA 3IT6B 4WJNA 4ZYSA 2V0GA 3ZRCA 2DWQA 5HKHA 2KNBA 1VJKA 2WHIA 4JQWC 3KW5B 2D3CA 3UF8A 3UGBB 4PT5A 1C79A 3JVZX 1XCQL 5CHVC 4JX1C 1WYWB 1QT9A 1EM7A 2DYBA 3JSVA 4B95A 3I63C 3BINA 2KO3A 1WMHB 3V6CB 1CQVA 2K25A 2R61A 4I6NB 2BS4B 1WFYA 1VRAB 1E9MA 2QCZA 1DOIA 1CJEA 1WYGA 3BWUD 2CJNA 2LGIA 1V6EA 3NY5A 2KK8A 1XQQA 2KN5A 3N1YC 4IC7B 4MJSA 4LNIA 2YLMA 4CO7A 3HRDD 2GLSA 3ZNHB 3T3NA 4WJOA 3I57A 4A55A 2GBRA 5FK9C 2KYWA 4ASWC 1BXTA 2ZJDA 3MTNB 1UWXA 4Q2JA 4M02A 3X0WA 3RNFC 1B9RA 2ZEQA 5IP4D 2B76B 4NNJB 1TY2A 2L0FA 2M1MA 4BAXA 4KX6B 2BYEA 1XLOA 4KKJA 1WXQA 2ZPYA 3KWVA 2KAJA 1X1MA 2L83A 4FADA 2E3TA 2AQ3B 1A70A 5EDSA 1PQSA 1JCKB 3DDCB 3S2AA 1NEKB 2BWFA 2W3SA 1TS3A 2CHXA 1LO5D 4KGTA 1KJTA 3MC9A 3A9JA 3AEFB 1IBXA 3ENEA 4IKGA 3ZQ4A 4NAWA 2V9HA 3NRZA 1ET6A 2KVZA 2PTLA 2Z8LA 4K81A 1WXSA 1R7SA 4YWGG 5IO9A 4HDOA 2JWUA 3ZDMC 4HJKA 3Q3FA 2GI9A 4MGKE 1UGMA 1BMLC 1CZPA 4NAMA 3WAMA 4DHJB 5GXGB 4G0NB 3TEYA 3LYYA 3EECA 5D6JB 2H88B 1FFVA 2MBHA 1NVID 2J0KA 2AL3A 1TY0A 2WNMA 2RDGA 2O2VB 2QHOA 3DBSA 4DDID 2KD0A 4FXCA 3SDLC 2PIAA 4M01A 1QOGA 5J2RA 1OEYA 2XN9C 5E6NA 4RM8A 3PZDA 1C4PA 1E0ZA 2FCMA 4LK0M 4K7WA 3JSVB 1WGGA 2WXQA 4PK1A 1YX5B 2DNFA 4GLSC 4PS8A 2BQQA 2V3PA 4IW0A 3RUIB 3VHTC 2IY1B 2NPTA 2HJ1A 3H7SA 1C4CA 3N9YC 4LTUA 1UD7A 1JWMD 1UBQA 3BVMA 3AI5A 2LASA 3WAOA 2ZZPB 3Q6BA 1FNUA 4HCNB 2HTME 2G3QB 2JU6X 1TKYA 3BIID 3R7RA 2GB1A 4RH6A 2LZ6A 1T3QA 2D5GA 2AQ1B 3B9JA 1FO4A 1I42A 2L32A 3ML9A 1WXVA 1UGJA 1XLNA 1FXIA 4XX5A 4RF1A 3H8HA 3TIXA 2MH7A 3AE9B 2HTHA 2NS5A 4ANWA 5LXIB 2UWQA 3ZUNA 2DZKA 3RZFA 2N9EB 3AU5A 4A3PA 3QCAA 1WE6A 5G2NA 1T0SC 2WU5B 1TS2A 5BYQA 4XWTA 3HUIA 4CQNA 4C00A 2JYTA 4WJQA 2FCSA 3PS6A 3DQVA 4K3BA 5JXVA 4M8MA 4HPMB 2FNJB 4DXFA 4G3XB 3NZ3A 3LXFA 3VTWA 3ZO5B 4GDKA 1GPXA 2CJOA 1OGWA 3ZIMA 1SB3C 2KFKA 1V97A 5DPTA 1IGCA 2I1JA 1VZ8A 3MHSD 3A9JB 1IBXB 3OWEB 4NAWB 1WJ4A 3J9CA 2K8CA 1HA5A 2WXMA 3DVNV 3N1ZC 5AEKB 1JWBD 1AARA 5H8YE 3TL5A 1I4HA 4BKSA 3IHPC 1YQ4B 1L6VA 3KH0A 1R4MB 3MC0B 1TJEA 2IGDA 2LXAA 2VRRB 2A5UA 3H1UA 3O13A 1GAQB 3ECIA 1VZ6A 2MRPA 2Z0EB 3DPDA 3MC8A 3DHGC 1WM3A 3RNBC 2OJRA 3PO0A 2LGYA 2LVOA 3V3XA 3APFA 3PRZA 2JF5A 1GJZA 1JQ4A 3JW0X 3I9V1 2PVGC 3RFZB 2MQJA 2L8JA 1ACCA 1N60A 1LQBA 4ARCA 3BYTB 4IM0A 2R2QA 2RGFA 4WWNA 2XNAC 5JH5C 2D2QA 4W9GA 2RDHA 1M94A 2BW2A 4RM9A 2ASQA 4WIPA 4KSKC 4G50A 4FJVB 5E6PA 1QOBA 2A4ZA 3NHEB 2BKRB 4AUQC 1T0YA 5IAAC 3PPAA 4KZCA 3Q8BA 1NI2A 2PEAA 1FXAA 2J4XA 3FAHA 4DHJD 1C77A 3H6NA 3DVGY 4WWMA 1WRDB 4NQLB 1V80A 1ZW7A 2KT7A 2KMCA 2CU3A 4DXGA 2Y5CA 4X57B 2WXKA 3PRPB 1S3SG 1MG4A 3GZNI 3SU8X 2TSSA 3W1SC 2Y3AA 1XF5L 3KVFB 5J18A 4P7IA 2BTEA 2W54A 4ZHOA 1HTOA 4J3OD 3NVZA 2MJEA 1XCTL 2J52A 5AZHA 3TSSA 3VUXA 1V2YA 4J6IA 4ICVA 3C19A 2Y5PA 4JWSC 1UNSA 2MSED 2I2YA 2M4NA 1L2NA 1XT9B 3P4SB 1UF0A 3DWGC 1QF6A 2WU2B 3MP9A 3L17A 1L0VB 4C80A 3PLVA 3IBEA 2KFKB 1UBIA 3DBLB 2YVCA 3P42A 5AUIA 1D5ZC 2PKOA 3A33B 2REXA 5L95C 4AJYB 4WQOB 5E6JA 4MSQB 3VQIA 2DHZA 3W2DA 3ZXRA 5C23A 2MCNB 1D5MC 1SE4A 4HPLB 4LJOB 1TS5A 3KWLA 2FAZA 2BS3B 4WURA 3TJPA 1YIWA 4OW0A 3KUDB 4NZLB 1FM0D 4RGNA 3PHWB 3ONSA 4HK2A 5D3IB 4BKTA 1JWUD 2XEWA 3QIJA 3VTUA 4K3CA 2O6VA 4MT5A 3NG0A 4DXAB 3PVLA 3U30A 2PLPA 1STEA 1HZ5A 3CSFA 1N5XA 1QKZA 2AL6A 2ZCBA 2JVCA 3NUHB 2BB6A 1OQYA 4E3CA 2BYVE 3CMMB 4A8XC 2DZIA 4BVUC 1S1QB 1OQRA 1WJUA 3MHZA 4FJYA 2OOBB 3L10B 3ZYYX 2QILA 3ZW3A 2MJ3A 2LJIA 4HCPB 1FPYA 1AW7A 2K3UA 1WGKA 1JWSD 1VDVA 2M0XA 3VH3B 1TZ1A 5G55A 3PT2B 2N1VA 3URYA 1WWTA 1WGRA 2KVRA 1KTKA 5AZFA 4YXDB 2ONQA 2KLCA 4A90A 1FCLA 2R2OA 2N4FA 2NVUI 4IWPA 4MDKE 3MJWA 3OAWA 2NMQA 2KWUB 3DHHC 1YJIA 4UDUC 1JWAD 3T3OA 3A4SC 4M00A 3WIMA 2SEBD 1HQRD 1SBBB 2L7RA 1IPGA 4H2AA 1EWCA 1WGYA 4IWOA 3B0AA 2KLGA 1VR9A 3WANA 3ZKJC 1EU3A 1WF9A 1R4NB 3DHIC 1JRUA 4E74A 2WDVB 4ANVA 1C4AA 4C7YA 2DAFA 3CF6E 2L3ZA 1WM2A 1E8ZA 3BYYB 4DQOC 4HPPA 2J42A 1YN4A 2KC2A 3EGRA 2GBNA 4MH8A 2AEHA 2EKIA 2FIDA 1DOYA 1YN3A 4URKA 2MBQA 2IJ0A 4WAFA 2JWZA 2KDFB 2MHJA 3FC4A 4KZ0A 2AWTA 3BK2A 3HVZA 2J0JA 2FBWB 1KRHA 2WXFA 4BOSC 3Q8EA 1Y8RC 2BF8B 3N20C 4RGMA 3L0WB 3M62B 2ZVNA 1PGXA 1FFUA 1FMAD 2JY6A 3A9KA 3PSEB 1VZ7A
chains in the Genus database with same CATH topology
1ZE3D 3B2FA 1HZ6A 1TKGA 1QILA 1FNUA 2QEJC 3AE8B 2HTME 5FKAC 2KN4A 1NENB 1PYWD 1TKYA 2JU6X 3BIID 5BYRA 4ITKA 4N6EB 1I4QA 2JXTA 1EU4A 5EE3A 1JROA 4IDIA 2MJDA 2GB1A 1OQQA 4RH6A 1T3QA 2J53A 1EWYC 2OEDA 3P63A 2D5GA 2AQ1B 4OHJA 3B9JA 4RNAA 1FO4A 3FILB 2L32A 3Q8CA 1UGJA 1XLNA 1FXIA 5T8IA 4RF1A 1SE3A 1MPEA 2WXGA 3H8HA 2MH7A 2W55A 1KFYB 4N59A 3AE9B 1QOAA 1FNVA 4N58A 1T6BX 1TZOA 1RWSA 3PZ7A 4TQ0A 1DYQA 2ICIA 3AE4B 5BMGA 1NYQA 2LHEA 3EUB2 2WU5B 1F77A 1TS2A 5HI1A 4XWWA 1N63A 5BYQA 3AM9A 4XWTA 1L6UA 3HUIA 3P4PB 1T5XD 1V1PB 4CQNA 1ZUD2 2JYTA 2LEKA 1V1OA 3Q8AA 1WRIA 3ETRA 1PGBA 3ZJUA 2H89B 5JXVA 3TUOA 1KH0A 1FIQA 1L4DB 1YQ3B 4DXFA 3NZ3A 3CIRB 1VLBA 3LXFA 5H92C 3U2SC 4XDCA 4C7ZA 1YJJA 1ZPSA 4MACA 1GPXA 2CJOA 4US8A 4XDDA 2JSVX 1SB3C 4RGTA 3BK1A 3KQ4A 1C76A 4ZRPA 3AMZA 4US9A 1SSNA 1V97A 1IGCA 3BZDB 2WQYB 3P1MA 1MVKA 2BT6A 3NVVA 1FRRA 1ROEA 4RGOS 1VZ8A 2KACA 1IBXB 3PZ8A 3NS1A 3OWEB 4NAWB 3J9CA 1JRPA 1AYFA 3AN1A 4L23A 5C3JB 1HA5A 2WXMA 2INNE 3AEEB 2BBCA 1JWBD 3ABVB 2BS2B 1UUPA 5H8YE 2G1EA 1I4HA 1YQ4B 3MC0B 2DYOA 2W3RA 1TJEA 2IGDA 1N5WA 4YTNB 1PFDA 3U4EG 1E10A 2LHDA 3HVDA 1SXTA 3AECB 3W9CB 1E6EB 1BUIC 3O13A 2V3NA 1N62A 4P6VF 3V05A 2ON8A 1GAQB 3TEWA 1VZ6A 4B0EA 1SIJA 3U7ZA 5BMIA 4JPSA 4YSZB 2WXPA 4ZRQA 4C56C 3PO0A 2WS3B 1ZXIA 1XEEA 1J7BA 4KGRA 5BMHA 2LFIA 4JE3B 3V3XA 4TQ1A 5AUKA 1ZDXA 2DLBA 1JQ4A 3I9V1 3R2IA 2PVGC 3RFZB 3SFEB 3VRAB 1QOFA 4AQ7A 1ACCA 4XE0A 5LNK1 1N60A 4AS1A 4M0WA 4ARCA 3BYTB 3BVZA 2JQRB 2N9LA 2XNAC 3GP7A 1RM6C 2RDHA 5HFYA 2BW2A 3AE1B 1KLUD 2X38A 2Q5WD 4MM3B 3AE7B 4WIPA 3SFDB 2K22A 1F2RI 1HEZE 1MHHE 1QOBA 4TMAB 2WP9B 4HKZE 2YEPB 1D6EC 3VR8B 3AE2B 2I38A 3SR6A 4ZHPA 1E7PB 3CWIA 2IPKD 2QIEB 3Q8BA 1I4XA 2IGGA 1K51A 1SEBD 2WXNA 3IAM1 1FXAA 2QSDA 4IOIE 2J4XA 1ET9A 1SJHD 3FAHA 2FUG1 3C8YA 1C77A 1F0ZA 1J7AA 1M4VA 1K52A 1IGDA 2DYMA 1CK1A 4WWMA 4OZCA 2N0SB 2CU3A 3B2GA 4DXGA 2Y5CA 4D2KA 2JX5A 2KDMA 4ARIA 2WXKA 5TSSA 1PUTA 1I4GA 1J7CA 2WDQB 4GDLB 2TSSA 1ESFA 2Y3AA 5EE9A 1XF5L 3MFGA 2BB5A 5C2TB 2VZKB 1I4RA 1FD6A 3AE6B 3VR9B 2BTEA 2W54A 4ZHOA 3IAS1 1GOZA 2WXIA 4J3OD 1PDXA 4HRSA 3NVZA 2ZW0A 2MJEA 2WXOA 3EA6A 1AWDA 1XCTL 3AV8A 2J52A 2JZPA 2RPVA 2M56B 4KKIA 2WXRA 1QQRA 3TSSA 1ZXHA 2AQ2B 3GS2A 3ZGZA 1AN8A 2RMMA 1D5XC 2QMTA 2Y5PA 1D4BA 4JWSC 1ENFA 1UNSA 2N9KA 3LB8C 4RF0A 2I2YA 5G5HA 2WDRB 5EE0A 1F2RC 2WXJA 2K5PA 4WH4A 4OVZA 3IT4B 1PGAA 3P4SB 1RFKA 3R2TA 3DWGC 3IXSA 1QF6A 2WU2B 3MP9A 3VRBB 1GB1A 1L0VB 1V8CA 4C80A 1I7HA 2KWDA 4HROA 1SF0A 5D7GA 5BYSA 1I4PA 2WXHA 2MEKA 3IT6B 4YTPB 5G5GA 4ZYSA 4LLGM 2V0GA 3P42A 3E56A 5AUIA 2DWQA 1D5ZC 2M19A 2PKOA 2W82A 4L1BA 5I4DA 3AEAB 4USAA 1VJKA 3NVYA 1MI0A 2NTTA 5E6JA 3VQIA 1L5PA 4TSSA 4PT5A 3W2DA 1C79A 2INPE 1TYGB 1XCQL 3AE3B 4YSYB 4JWUC 1D5MC 1SE4A 4JX1C 3U52E 1TS5A 2LUMA 1QT9A 1XO3A 3KWLA 1EM7A 1P7EA 5HG2A 4YSXB 3W5UB 2BS3B 4WURA 2JYEA 4OW0A 2NTSA 1QLBB 3BVGA 3AEGB 4NZLB 2WLBA 1CQVA 1FM0D 4RGNA 1IUEA 2R61A 1JW9D 1OFFA 4EE2A 2BS4B 1VRAB 1E9MA 5D3IB 2L52A 3TEZA 1JWUD 1DOIA 1CJEA 1WYGA 2AX5A 1XLPA 3BWUD 4HEA1 2CJNA 2LGIA 4MT5A 2VZKD 4ZOHC 1DGJA 1KLGD 3P4RB 2PLPA 1STEA 1HZ5A 1N5XA 3FILA 1QKZA 3SEBA 3AE5B 3HRDD 1JALA 3NUHB 3DWMA 2BB6A 1NYRA 3ZJVA 3T3NA 3I57A 4A55A 1Q10A 4A8XC 3UI3A 1FRDA 4HJGE 5FK9C 1BXTA 1OQRA 2ZW1A 4A6QA 3MHZA 4RCOA 1UWXA 3ZYYX 2QILA 4Q2JA 3Q8FA 2MJ3A 1ZOYB 2LJIA 1P7FA 1AW7A 4OZAA 1RYJA 2K3UA 3AEBB 1B9RA 1WGKA 1JWSD 1VDVA 3TEXA 1Y56A 1YNTE 1C9FA 5MPOA 3URYA 1WWTA 1V1PA 2B76B 2KQ4X 1L4ZB 4R3DA 1TY2A 1KTKA 4O1NA 2V4IB 4KX6B 2PW9A 1XLOA 2GRIA 4KKJA 4YXDB 1WXQA 2ONQA 4L2YA 4KGSA 4A90A 1FCLA 2PVOD 3KWVA 1FNWA 2KAJA 4WQMA 3GB1A 1SJED 2LMCA 2NMQA 2DBYA 2L83A 1YJIA 4UDUC 1JWAD 2E3TA 3AEDB 2AQ3B 3T3OA 1ZP0B 3NVWA 3L4PA 2G9HD 1A70A 1L0YB 1JCKB 2SEBD 1NEKB 2K0PA 1KF6B 1HQRD 1NI3A 1C78A 1SBBB 2W3SA 1TS3A 1UWMA 1YMHE 1ZDVA 1LO5D 4KGTA 5D3DA 4H2AA 4OZBA 1EWCA 3AEFB 1IBXA 4IKGA 3ZQ4A 2E6XA 3E9SA 3MJ5A 2BYTA 2IGHA 3AH7A 3RPFC 2FE8A 3NRZA 3ZJTA 1ET6A 1HXYD 1VR9A 2PTLA 2Z8LA 1EU3A 3W5VB 4GDKB 1R7SA 4YWGG 2ACZB 2EELA 2JWUA 1XXGA 4YTMB 2WDVB 3KLSX 2GI9A 3R8BA 1C4AA 2SAKA 1BMLC 1CZPA 4P16A 5FR3A 4C7YA 4NAMA 2IDYA 5GXGB 4A9AA 3TEYA 3LYYA 2N7JA 4REZA 2M0AA 3BYYB 2H88B 1FFVA 1FEHA 2YEPF 1NVID 5EE1A 4DQOC 1XLQA 3P4QB 2J42A 1YN4A 1YN5A 2L1AA 2KMMA 1TY0A 3EGRA 4NJCA 2WNMA 2RDGA 1TKEA 4MH8A 2EKIA 4B0MA 1YN3A 4FXCA 1DOYA 3AB5A 2PIAA 1QOGA 2IJ0A 4WAFA 3WCQA 3FC4A 2XN9C 3BK2A 3HVZA 2HDEA 5HHDG 1C4PA 2FBWB 1MHXA 1E0ZA 1N61A 1DOXA 4LK0M 1SE2A 2K9XA 1GB4A 1FCCC 1L0XB 1WSPA 2QJLA 1KRHA 2WXFA 1JMLA 1K50A 2WXQA 4HKQA 2WXLA 3Q8EA 1K53A 2OHFA 1B1ZA 4GLSC 4RGMA 3Q69A 1TS4A 1PGXA 2PMVA 2V3PA 1FFUA 1FMAD 1C4CA 3N9YC 4LTUA 4RFBA 1JWMD 1L6VA 1VZ7A 3BVMA 3W1SA 4YT0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5MPO A;  3AEC B;  1WWT A;  2B76 B;  3B2F A;  3W9C B;  1E6E B;  1DOY A;  1TKG A;  1N62 A;  4JWS C;  4P6V F;  3LB8 C;  1GAQ B;  3AE8 B;  4KX6 B;  5G5H A;  2HTM E;  2WDR B;  1NEN B;  1XLO A;  1TKY A;  3BII D;  5EE0 A;  4YXD B;  2K5P A;  1WXQ A;  4ITK A;  4N6E B;  1SIJ A;  2PVO D;  3P4S B;  5EE3 A;  1JRO A;  1RFK A;  4IDI A;  2MJD A;  3DWG C;  4WQM A;  4YSZ B;  1OQQ A;  2KAJ A;  2WU2 B;  1QF6 A;  1T3Q A;  1EWY C;  3P63 A;  3VRB B;  1L0V B;  3PO0 A;  1V8C A;  2WS3 B;  1I7H A;  1ZXI A;  1J7B A;  3B9J A;  4HRO A;  2DBY A;  4C80 A;  1SF0 A;  2L83 A;  1YJI A;  1FO4 A;  1JWA D;  5G5G A;  2E3T A;  3AED B;  4YTP B;  1ZP0 B;  3NVW A;  5AUI A;  1XLN A;  2DWQ A;  1A70 A;  2M19 A;  2PKO A;  3L4P A;  5AUK A;  1FXI A;  1JQ4 A;  2PVG C;  3AEA B;  4USA A;  1NEK B;  1VJK A;  3NVY A;  3SFE B;  3VRA B;  1KF6 B;  1QOF A;  1NI3 A;  2W3S A;  2MH7 A;  1L5P A;  2W55 A;  1KFY B;  1UWM A;  1N60 A;  4N59 A;  3AE9 B;  1TYG B;  1QOA A;  3AE3 B;  3AEF B;  4YSY B;  4JWU C;  4JX1 C;  4N58 A;  3AH7 A;  1QT9 A;  1XO3 A;  2JQR B;  3KWL A;  3RPF C;  1RWS A;  3NRZ A;  4YSX B;  3AE4 B;  1RM6 C;  3W5U B;  3W5V B;  2BS3 B;  1R7S A;  1NYQ A;  3AE1 B;  2ACZ B;  3EUB 2;  2Q5W D;  2WU5 B;  3AE7 B;  1QLB B;  3SFD B;  2K22 A;  3AEG B;  2WLB A;  1N63 A;  1QOB A;  3AM9 A;  2WP9 B;  4YTM B;  2WDV B;  1FM0 D;  1L6U A;  3HUI A;  3VR8 B;  1IUE A;  3AE2 B;  1JW9 D;  1OFF A;  3P4P B;  3SR6 A;  1ZUD 2;  1CZP A;  1E7P B;  2BS4 B;  2LEK A;  3CWI A;  4C7Y A;  4ZHP A;  1E9M A;  1WRI A;  3ETR A;  2QIE B;  2L52 A;  2H89 B;  5GXG B;  4A9A A;  1FIQ A;  1DOI A;  1YQ3 B;  1CJE A;  1WYG A;  2AX5 A;  1FXA A;  1XLP A;  2CJN A;  2H88 B;  1FFV A;  5EE1 A;  1NVI D;  1XLQ A;  3CIR B;  1VLB A;  3FAH A;  3LXF A;  1DGJ A;  3P4Q B;  4ZOH C;  5H92 C;  4C7Z A;  1YJJ A;  1F0Z A;  1J7A A;  3P4R B;  2KMM A;  1GPX A;  2CJO A;  4US8 A;  4WWM A;  1TKE A;  1N5X A;  1SB3 C;  2EKI A;  2N0S B;  2CU3 A;  3B2G A;  3AMZ A;  2Y5C A;  1V97 A;  2JX5 A;  3AB5 A;  4FXC A;  4US9 A;  3AE5 B;  3HRD D;  1JAL A;  2PIA A;  1QOG A;  1PUT A;  2WQY B;  3P1M A;  2BT6 A;  1J7C A;  3DWM A;  3NVV A;  2WDQ B;  1NYR A;  3WCQ A;  1FRR A;  1ROE A;  3FC4 A;  5EE9 A;  5C2T B;  3HVZ A;  2FBW B;  3NS1 A;  1FRD A;  1N61 A;  3AE6 B;  3VR9 B;  1DOX A;  2K9X A;  1E0Z A;  1JRP A;  1AYF A;  2W54 A;  3AN1 A;  1OQR A;  2QJL A;  1KRH A;  4ZHO A;  5C3J B;  3AEE B;  1PDX A;  4HRS A;  3NVZ A;  1JWB D;  2MJE A;  3ABV B;  3ZYY X;  2OHF A;  2BS2 B;  1AWD A;  5H8Y E;  2G1E A;  2MJ3 A;  1ZOY B;  1YQ4 B;  3AV8 A;  1RYJ A;  1FFU A;  1FMA D;  2W3R A;  1TJE A;  3AEB B;  1B9R A;  1N5W A;  1WGK A;  1PFD A;  1VDV A;  2M56 B;  4YTN B;  1E10 A;  4LTU A;  1L6V A;  4YT0 B; 
#chains in the Genus database with same CATH topology
 1ZE3 D;  3RUL A;  5FKA C;  1NEN B;  1PYW D;  2O6V B;  5BYR A;  4ITK A;  2JXT A;  4NY0 A;  1JRO A;  3RNC C;  4IDI A;  2MJD A;  4IM2 A;  2IO3 B;  2OED A;  1EWY C;  1E7U A;  1SIF A;  3L16 A;  3OJ4 B;  1GUA B;  1WR1 A;  1TT5 B;  3L13 A;  5T8I A;  4DHZ E;  2WXG A;  2OJW A;  2KJH B;  3M95 A;  2W55 A;  1KFY B;  2L05 A;  1P9D U;  1FNV A;  2GMI C;  1TZO A;  4II3 B;  3KYD D;  4W9D A;  3AE4 B;  3RCZ A;  3LDZ E;  5BMG A;  1NYQ A;  5IOI A;  2KDE B;  5HI1 A;  2DZM A;  1L7Y A;  4BKS D;  3QWZ B;  1T5X D;  1ZUD 2;  3Q8A A;  3ETR A;  1PGB A;  3ZJU A;  1V81 A;  3KYC D;  1L4D B;  3DVN U;  4OVV A;  2UU7 A;  3CIR B;  1VLB A;  4MAC A;  4TUU A;  4US8 A;  4XDD A;  2JSV X;  4US9 A;  1SSN A;  3BZD B;  2IBI B;  2WQY B;  1MVK A;  1ROE A;  3ZNZ B;  3H7P A;  1V5O A;  2NBU A;  3NS1 A;  1JRP A;  4L23 A;  5C3J B;  3APC A;  2INN E;  3DBR B;  2HE7 A;  1N6Z A;  3H9D A;  2W3R A;  1N5W A;  1PFD A;  2MP2 A;  3RD2 A;  4KV2 A;  3AEC B;  3A1Q A;  3RYT A;  4IG7 B;  1N62 A;  1NDD A;  1D3Z A;  1SIJ A;  2LGS A;  3FKY A;  3NJT A;  4W9E A;  1ZXI A;  1XEE A;  4KGR A;  5BMH A;  2LFI A;  4S17 A;  4ACF A;  1RRB A;  3RNG C;  3N30 A;  4TQ1 A;  2K8B A;  3SFE B;  4XE0 A;  2V1Y A;  4M0W A;  4DBG A;  3BVZ A;  1SGH A;  3UQB A;  1C3T A;  3GP7 A;  3PHX B;  4DWF A;  4P1B C;  4MJS B;  2X38 A;  3SFD B;  1KM7 A;  3AXC A;  2D3A A;  1WR6 E;  4P1C C;  3SHQ A;  4K7U A;  4EZK A;  2YEP B;  3AE2 B;  2KQS A;  2LI5 A;  3C0R B;  1E7P B;  2IPK D;  1WZ0 A;  2IGG A;  1SEB D;  2WXN A;  4IOI E;  1J19 A;  2KXJ A;  5CX3 A;  1M4V A;  1IGD A;  2KHW B;  2EMT A;  2PJH A;  3B2G A;  2JX5 A;  2LVP A;  2JXX A;  3PTF C;  3V61 A;  5TSS A;  1PUT A;  1J7C A;  3OJ3 A;  2MBO A;  1ESF A;  5EE9 A;  4CYE A;  3MFG A;  3R3M A;  2DX5 B;  1I4R A;  2JZZ A;  3IAS 1;  1Q0W B;  1GOZ A;  2WXI A;  2JRI B;  3N1X C;  1PDX A;  2ZW0 A;  5E6O A;  2WXO A;  5DPS A;  2MX2 A;  2M56 B;  4KKI A;  2WXR A;  2N9P C;  3EC8 A;  2AQ2 B;  3IG3 A;  1Z2M A;  4WJP A;  1Q5W B;  1D5X C;  2QMT A;  2IO0 B;  5JHB A;  2WDR B;  2Z59 B;  2QC8 A;  2N9X A;  1WI0 A;  4PYU A;  1RFK A;  1VD2 A;  3VH4 B;  3IXS A;  1CMX B;  3RN9 C;  2O6V D;  1GB1 A;  4KDI C;  4HRO A;  5BYS A;  4AOF A;  4F8C B;  4BFR A;  1I4P A;  4YTP B;  3NS8 A;  3E56 A;  5TR5 A;  2M19 A;  2W82 A;  4EKU A;  4USA A;  3H7P B;  2NTT A;  2CU1 A;  3ALB A;  1L5P A;  4TSS A;  4FLH A;  2INP E;  1TYG B;  3AE3 B;  4YSY B;  4JWU C;  3U52 E;  2LUM A;  1XO3 A;  4W9F A;  3DBH B;  4FA6 A;  1P7E A;  5HG2 A;  4YSX B;  3TBL D;  2KQ7 A;  3W5U B;  5KHO A;  2K8H A;  3PRM B;  3AEG B;  2WLB A;  2GBK A;  3UIN B;  2LRU A;  3QAQ A;  4C4V A;  3TEZ A;  4HEA 1;  2AX5 A;  1XLP A;  4JGH B;  3RNE C;  3ZTC A;  2VZK D;  1KLG D;  2IZV B;  3P4R B;  4LCD E;  4E71 A;  2KKC A;  2ZNV B;  3ZNG C;  1TGZ B;  3FIL A;  2NPT B;  2WYQ A;  2IO1 B;  3SEB A;  3AE5 B;  1JAL A;  3B1L X;  1NYR A;  3ZJV A;  1Q10 A;  3UI3 A;  4HJG E;  1UH6 A;  2LVQ A;  2ZCC A;  4XYC A;  4A6Q A;  5FR6 A;  4RCO A;  3Q8F A;  4FBJ B;  1P7F A;  2G4D B;  3AEB B;  2Y5B B;  3HIZ A;  2EMS A;  1GC6 A;  1C9F A;  5MPO A;  3WA0 A;  2GOW A;  1V1P A;  2K6Q A;  2KX0 A;  2M17 A;  3RMK C;  1RAX A;  5C1Z A;  1V86 A;  1H4R A;  4O1N A;  2V4I B;  2C9W B;  1ZKH A;  4CHK A;  3CST A;  1E5W A;  2BVC A;  1OTR B;  2LMC A;  4KSL C;  2GBM A;  2DBY A;  1WXA A;  1ZP0 B;  3NVW A;  2Z0D B;  3L4P A;  3HHM A;  3VFK A;  1H8C A;  2K0P A;  3HM6 X;  4IUM B;  1ZDV A;  1YMH E;  5BO4 B;  5D3D A;  4OZB A;  3Q3J A;  2K1F A;  2KAN A;  2E6X A;  2IGH A;  2QDF A;  3RPF C;  2FE8 A;  4GSW A;  4GDK B;  2ACZ B;  2EEL A;  2IY0 B;  1XXG A;  2L76 A;  3NZS A;  3KLS X;  2SAK A;  4P16 A;  5FR3 A;  1ZGU B;  4NJ6 A;  1IP9 A;  2N7J A;  4REZ A;  1U4A A;  4W9I A;  1FEH A;  2YEP F;  1ISN A;  3RZW C;  3P4Q B;  1YN5 A;  2L1A A;  2KMM A;  4GN1 A;  1TKE A;  3U7D A;  5DPW A;  4ZDV A;  3AB5 A;  1WXM A;  3ZNI D;  3WAP A;  3WCQ A;  1LXD A;  5HHD G;  2MW5 A;  1DOX A;  4GIV A;  1VCB A;  1FCC C;  1L0X B;  1WSP A;  1GB4 A;  2QJL A;  1JML A;  2KWC A;  4HKQ A;  2JUO A;  2WXL A;  2XK5 A;  4FN2 A;  1B1Z A;  2WWZ A;  4BBN C;  1WX8 A;  1YOV B;  1T0R C;  4C4V B;  3B2F A;  4WWP A;  1HZ6 A;  2CKH B;  5IKC M;  1QIL A;  3AE8 B;  2D3G A;  2B3A A;  2KN4 A;  1WJN A;  4N6E B;  3VAW A;  1EU4 A;  2WGS A;  2EKE C;  4HDQ A;  3QQ8 B;  4OHJ A;  3P63 A;  1YQB A;  2LWP A;  2RDB C;  3FIL B;  3K9P B;  3ML8 A;  2IYD B;  2KJ6 A;  2BWE S;  3NOB A;  1TIF A;  2MBE A;  1E8Y A;  1MPE A;  5IA7 A;  1J8C A;  2ZPN A;  4N59 A;  1QOA A;  2FUH B;  4N58 A;  1T6B X;  3PZ7 A;  1DYQ A;  2ICI A;  1GNU A;  2M8S A;  2WX0 A;  2LHE A;  3EUB 2;  4W9L A;  1F77 A;  4XWW A;  2BKF A;  1N63 A;  2HJ8 A;  3AM9 A;  1L6U A;  3P4P B;  2PE9 A;  1V1P B;  2LEK A;  1V1O A;  1WRI A;  3TUO A;  4PS3 A;  1R4M I;  5D2M B;  2I1K A;  3U2S C;  4XDC A;  4C7Z A;  1YJJ A;  1ZPS A;  4F7Z A;  2JZ3 B;  2LGX A;  4RGT A;  3BK1 A;  3KQ4 A;  3AMZ A;  5L83 A;  1WIA A;  3P1M A;  2PPH A;  2BT6 A;  3I5J C;  3NVV A;  3DBH I;  2C60 A;  3ZVV A;  1FRR A;  4W9J A;  4IM3 A;  4FUL A;  3PZ8 A;  3AUL A;  2JT4 B;  3AN1 A;  1AYF A;  3IFW B;  1WX9 A;  3AEE B;  3ZXV A;  3ABV B;  2G1E A;  3AU4 A;  4XGA B;  1G6J A;  4YTN B;  1E10 A;  4F1S A;  1FXT B;  1F9J A;  4S0R A;  4LNK A;  3W9C B;  4GMV A;  1E6E B;  2V3N A;  4P6V F;  2ON8 A;  3TEW A;  1P0R A;  2ZVO A;  2LGD A;  3O65 B;  5BMI A;  4JPS A;  3Q3N C;  2KWV B;  4GGQ A;  4ZRQ A;  4C56 C;  2GBJ A;  2J0M A;  1J7B A;  1RFA A;  2N7D A;  4OVU A;  3QAR A;  1ZDX A;  5AUK A;  3SD5 A;  3QA8 A;  1WZ3 A;  2FCN A;  3PLU A;  1QOF A;  3UQA A;  2CHW A;  2N9L A;  2XK5 B;  3QC8 B;  1QZE A;  2VH1 A;  5HFY A;  3AE1 B;  3RI7 C;  2Q5W D;  2KDI A;  3AE7 B;  1EF5 A;  4HKZ E;  1D6E C;  3VR8 B;  2I38 A;  4A20 A;  4ZYN A;  4ZHP A;  3CWI A;  4MH0 E;  2C5L C;  2QIE B;  1I4X A;  4KIK A;  1K51 A;  3IAM 1;  4B9K A;  3QHT A;  2FUG 1;  2G45 B;  1NBF C;  1F0Z A;  1J7A A;  3QJZ A;  1T0Q C;  2L0T A;  1A5R A;  4II2 B;  2KTR A;  4EUT A;  2NBW B;  3RT3 B;  3EHV A;  4HLE A;  4OZC A;  3NZU A;  2KMA A;  2N0S B;  2W9N A;  2KDM A;  4TV3 A;  4D2K A;  5JZE B;  3OG5 A;  3EFU A;  2C7M B;  1HE8 A;  4LNO A;  4G11 A;  5C2T B;  2WX1 A;  2BB5 A;  2VZK B;  1FD6 A;  1GG3 A;  3PV1 A;  3DBL I;  1UZX B;  3VUW A;  4DDG D;  4HRS A;  1P1A A;  3EFC A;  3EA6 A;  3QK0 A;  1AWD A;  1LFD A;  3ZLZ A;  2K6D B;  1EUV B;  1ZXH A;  4AWJ A;  3ZGZ A;  1AN8 A;  2RMM A;  2DAJ A;  3HM3 A;  4GXB A;  4FHJ A;  3OLM D;  1ENF A;  3LB8 C;  5G5H A;  1F2R C;  2KFJ A;  2K5P A;  4PYZ A;  3GZN B;  4M8N A;  1SE9 A;  4OVZ A;  1PGA A;  2KDB A;  4ANX A;  2AYO B;  4XC2 A;  1YX6 B;  4MGY E;  1WH3 A;  1V8C A;  4WAA A;  2KWD A;  4N9F 4;  1SF0 A;  2KZR A;  4NQK E;  3N32 A;  2MEK A;  3HK0 A;  3KUC B;  4LLG M;  2IO2 B;  4L1B A;  5I4D A;  3AEA B;  3NVY A;  3D32 A;  4B6W A;  1WGD A;  1MI0 A;  1MFW A;  5LLI A;  3DOW A;  3VTV A;  4ZRI A;  2JYE A;  2NTS A;  1QLB B;  3BVG A;  4MGI E;  1LM8 B;  3PRE A;  1IUE A;  2KC1 A;  1JW9 D;  1OFF A;  5CTR C;  4EE2 A;  1WE7 A;  2UYZ B;  5LXH A;  4TKN A;  1WGH A;  2L52 A;  4AJW A;  4BKG A;  3W1Y A;  3X23 A;  4ZOH C;  1DGJ A;  3BY4 B;  1OEY J;  3KUZ A;  5KHQ A;  3A9K B;  3DWM A;  3UIP B;  4LDT B;  4AP4 C;  4JL9 A;  1FRD A;  1Z5S B;  2ZW1 A;  4HWI B;  4W9H A;  2MLB A;  1ZOY B;  4OZA A;  1RYJ A;  2MA9 B;  2ZNV C;  4EZJ A;  2CR5 A;  3TEX A;  1Y56 A;  4ZRJ A;  1YNT E;  1WY8 A;  3VVW B;  2KQ4 X;  2INC C;  4BBN F;  1L4Z B;  3DCG A;  4R3D A;  4KIK B;  1R4N I;  2PW9 A;  2GRI A;  4L2Y A;  2LJ5 A;  3Q3M C;  1WJ6 A;  4KGS A;  2PVO D;  4WQM A;  1FNW A;  3GB1 A;  1SJE D;  3M63 B;  4EOY A;  2KTR B;  3B08 A;  4WWO A;  2BPS A;  4QAY A;  3AED B;  2G9H D;  1L0Y B;  1KF6 B;  2VH2 A;  1NI3 A;  1C78 A;  1UWM A;  2N1W A;  4EZL A;  3MJ5 A;  3E9S A;  2BYT A;  3AH7 A;  1E7V A;  2CS4 A;  2DEN B;  3ZJT A;  1HXY D;  3W5V B;  3V62 A;  1V49 A;  4ICU A;  4YTM B;  3APD A;  3Q14 C;  4MEL A;  1IYF A;  3R8B A;  2KTF A;  4ZRK A;  3Q3O C;  2D3B A;  2IDY A;  4A9A A;  5DCN A;  2RSU A;  2M0A A;  5EE1 A;  1XLQ A;  4NJC A;  1BT0 A;  4B0M A;  2MP2 B;  2K39 A;  3VUY A;  2FCQ A;  3A1Q B;  2IND C;  3N3K B;  4NJ7 A;  2HDE A;  1V9J A;  1J0G A;  1MHX A;  1N61 A;  1SE2 A;  2K9X A;  3R7Q A;  1RLF A;  4W9C A;  1K50 A;  1MG8 A;  4GOC A;  2LUE A;  1K53 A;  2OHF A;  3Q69 A;  1TS4 A;  2PMV A;  4MM3 A;  2G4S A;  5GMV A;  1HTQ A;  5CHF A;  4RFB A;  3W1S A;  4YT0 B;  1V5T A;  3JYU A;  1TKG A;  2QEJ C;  2NR2 A;  1LGR A;  4M0W B;  4DHZ B;  1I4Q A;  5EE3 A;  1OQQ A;  3L54 A;  2J53 A;  4MEM A;  4RNA A;  4EFO A;  2N7E A;  4XZ4 A;  1K8R B;  3Q8C A;  5CHW A;  2JRH A;  1E8W A;  4FHK A;  4KVG B;  1SE3 A;  4GDL A;  1UEL A;  3ZTD A;  3LJ3 A;  2KX3 A;  4JLC A;  2D10 A;  1RWS A;  4TQ0 A;  3R66 C;  1TTN A;  4JIO U;  3K9O B;  5J17 A;  3DBR I;  4DK5 A;  2H89 B;  2L00 B;  2D07 B;  1KH0 A;  1FIQ A;  2DZJ A;  1YQ3 B;  3V60 A;  2BYF A;  1F1H A;  4NPN A;  3L08 A;  5H92 C;  5IN7 A;  1Q1O A;  2MBB B;  5DPR A;  1WX7 A;  3ZDT A;  5D94 A;  4LNF A;  1XD3 B;  2RR9 A;  4ZRP A;  1C76 A;  3VDZ A;  1YD8 U;  4RGO S;  2KAC A;  4LDT D;  1P98 A;  2LRW A;  2FIF A;  2BBC A;  2BS2 B;  1UUP A;  2RD0 A;  4K1R B;  3V6E B;  4A3O A;  3U8Z A;  1WMH A;  2DYO A;  3U4E G;  3Q2A C;  2LHD A;  3IVF A;  3HVD A;  4KDL B;  4FJZ A;  1SXT A;  1KOT A;  4MGZ E;  4I6L B;  1BUI C;  1E8X A;  1GC7 A;  3GE3 C;  3V05 A;  2RPQ A;  4BZA A;  4B0E A;  4BOZ B;  3U7Z A;  2LXC A;  4YSZ B;  4PS7 A;  2WXP A;  2WS3 B;  1EF1 A;  2C7N B;  1P3Q U;  4YL8 A;  4JE3 B;  3ZRF A;  4W9K A;  2DLB A;  2NBV B;  4ANU A;  3R2I A;  3QX1 A;  4HVB A;  3VRA B;  4GB9 A;  1MJD A;  1KLV A;  4LNN A;  4LJP B;  3UIO B;  4AQ7 A;  3P2B A;  2V3S A;  5LNK 1;  1C1Y B;  4AS1 A;  3WAL A;  2V4L A;  2JQR B;  2KOX A;  1RM6 C;  1KLU D;  4GU2 A;  4MM3 B;  2K22 A;  1F2R I;  1HEZ E;  1MHH E;  4TMA B;  2WP9 B;  2NCN A;  2MWS B;  3RNA C;  1EO6 A;  3SR6 A;  4RMA A;  2JPH A;  1I35 A;  3M3J A;  4HXD A;  2QSD A;  4MSM B;  3VXW A;  1ET9 A;  2LD9 A;  2HD5 B;  1SJH D;  3C8Y A;  1K52 A;  2DYM A;  2WDT B;  1YJ1 A;  4EEW A;  1CK1 A;  2CHZ A;  4I6P A;  3A4R A;  4ARI A;  5AZG A;  3GE8 C;  2D11 A;  1I4G A;  5JHA A;  2WDQ B;  4GDL B;  3PGE A;  2PE6 B;  3I3T B;  3AE6 B;  3T9L A;  3T8M A;  3VR9 B;  4IWQ A;  2BGF A;  2J7Q B;  2KJR A;  2XBB C;  3AV8 A;  2JZP A;  2RPV A;  1QQR A;  3GS2 A;  1F52 A;  1D4B A;  2N9K A;  2C7H A;  3TCA A;  4RF0 A;  5EE0 A;  2WXJ A;  4WH4 A;  3DVG X;  1E90 A;  2X8X X;  3IT4 B;  3TMP B;  3R2T A;  4K7S A;  3GOE A;  3VRB B;  1I7H A;  1TBE A;  2O2V A;  5D7G A;  5G5G A;  2WXH A;  3IT6 B;  4WJN A;  4ZYS A;  2V0G A;  3ZRC A;  2DWQ A;  5HKH A;  2KNB A;  1VJK A;  2WHI A;  4JQW C;  3KW5 B;  2D3C A;  3UF8 A;  3UGB B;  4PT5 A;  1C79 A;  3JVZ X;  1XCQ L;  5CHV C;  4JX1 C;  1WYW B;  1QT9 A;  1EM7 A;  2DYB A;  3JSV A;  4B95 A;  3I63 C;  3BIN A;  2KO3 A;  1WMH B;  3V6C B;  1CQV A;  2K25 A;  2R61 A;  4I6N B;  2BS4 B;  1WFY A;  1VRA B;  1E9M A;  2QCZ A;  1DOI A;  1CJE A;  1WYG A;  3BWU D;  2CJN A;  2LGI A;  1V6E A;  3NY5 A;  2KK8 A;  1XQQ A;  2KN5 A;  3N1Y C;  4IC7 B;  4MJS A;  4LNI A;  2YLM A;  4CO7 A;  3HRD D;  2GLS A;  3ZNH B;  3T3N A;  4WJO A;  3I57 A;  4A55 A;  2GBR A;  5FK9 C;  2KYW A;  4ASW C;  1BXT A;  2ZJD A;  3MTN B;  1UWX A;  4Q2J A;  4M02 A;  3X0W A;  3RNF C;  1B9R A;  2ZEQ A;  5IP4 D;  2B76 B;  4NNJ B;  1TY2 A;  2L0F A;  2M1M A;  4BAX A;  4KX6 B;  2BYE A;  1XLO A;  4KKJ A;  1WXQ A;  2ZPY A;  3KWV A;  2KAJ A;  1X1M A;  2L83 A;  4FAD A;  2E3T A;  2AQ3 B;  1A70 A;  5EDS A;  1PQS A;  1JCK B;  3DDC B;  3S2A A;  1NEK B;  2BWF A;  2W3S A;  1TS3 A;  2CHX A;  1LO5 D;  4KGT A;  1KJT A;  3MC9 A;  3A9J A;  3AEF B;  1IBX A;  3ENE A;  4IKG A;  3ZQ4 A;  4NAW A;  2V9H A;  3NRZ A;  1ET6 A;  2KVZ A;  2PTL A;  2Z8L A;  4K81 A;  1WXS A;  1R7S A;  4YWG G;  5IO9 A;  4HDO A;  2JWU A;  3ZDM C;  4HJK A;  3Q3F A;  2GI9 A;  4MGK E;  1UGM A;  1BML C;  1CZP A;  4NAM A;  3WAM A;  4DHJ B;  5GXG B;  4G0N B;  3TEY A;  3LYY A;  3EEC A;  5D6J B;  2H88 B;  1FFV A;  2MBH A;  1NVI D;  2J0K A;  2AL3 A;  1TY0 A;  2WNM A;  2RDG A;  2O2V B;  2QHO A;  3DBS A;  4DDI D;  2KD0 A;  4FXC A;  3SDL C;  2PIA A;  4M01 A;  1QOG A;  5J2R A;  1OEY A;  2XN9 C;  5E6N A;  4RM8 A;  3PZD A;  1C4P A;  1E0Z A;  2FCM A;  4LK0 M;  4K7W A;  3JSV B;  1WGG A;  2WXQ A;  4PK1 A;  1YX5 B;  2DNF A;  4GLS C;  4PS8 A;  2BQQ A;  2V3P A;  4IW0 A;  3RUI B;  3VHT C;  2IY1 B;  2NPT A;  2HJ1 A;  3H7S A;  1C4C A;  3N9Y C;  4LTU A;  1UD7 A;  1JWM D;  1UBQ A;  3BVM A;  3AI5 A;  2LAS A;  3WAO A;  2ZZP B;  3Q6B A;  1FNU A;  4HCN B;  2HTM E;  2G3Q B;  2JU6 X;  1TKY A;  3BII D;  3R7R A;  2GB1 A;  4RH6 A;  2LZ6 A;  1T3Q A;  2D5G A;  2AQ1 B;  3B9J A;  1FO4 A;  1I42 A;  2L32 A;  3ML9 A;  1WXV A;  1UGJ A;  1XLN A;  1FXI A;  4XX5 A;  4RF1 A;  3H8H A;  3TIX A;  2MH7 A;  3AE9 B;  2HTH A;  2NS5 A;  4ANW A;  5LXI B;  2UWQ A;  3ZUN A;  2DZK A;  3RZF A;  2N9E B;  3AU5 A;  4A3P A;  3QCA A;  1WE6 A;  5G2N A;  1T0S C;  2WU5 B;  1TS2 A;  5BYQ A;  4XWT A;  3HUI A;  4CQN A;  4C00 A;  2JYT A;  4WJQ A;  2FCS A;  3PS6 A;  3DQV A;  4K3B A;  5JXV A;  4M8M A;  4HPM B;  2FNJ B;  4DXF A;  4G3X B;  3NZ3 A;  3LXF A;  3VTW A;  3ZO5 B;  4GDK A;  1GPX A;  2CJO A;  1OGW A;  3ZIM A;  1SB3 C;  2KFK A;  1V97 A;  5DPT A;  1IGC A;  2I1J A;  1VZ8 A;  3MHS D;  3A9J B;  1IBX B;  3OWE B;  4NAW B;  1WJ4 A;  3J9C A;  2K8C A;  1HA5 A;  2WXM A;  3DVN V;  3N1Z C;  5AEK B;  1JWB D;  1AAR A;  5H8Y E;  3TL5 A;  1I4H A;  4BKS A;  3IHP C;  1YQ4 B;  1L6V A;  3KH0 A;  1R4M B;  3MC0 B;  1TJE A;  2IGD A;  2LXA A;  2VRR B;  2A5U A;  3H1U A;  3O13 A;  1GAQ B;  3ECI A;  1VZ6 A;  2MRP A;  2Z0E B;  3DPD A;  3MC8 A;  3DHG C;  1WM3 A;  3RNB C;  2OJR A;  3PO0 A;  2LGY A;  2LVO A;  3V3X A;  3APF A;  3PRZ A;  2JF5 A;  1GJZ A;  1JQ4 A;  3JW0 X;  3I9V 1;  2PVG C;  3RFZ B;  2MQJ A;  2L8J A;  1ACC A;  1N60 A;  1LQB A;  4ARC A;  3BYT B;  4IM0 A;  2R2Q A;  2RGF A;  4WWN A;  2XNA C;  5JH5 C;  2D2Q A;  4W9G A;  2RDH A;  1M94 A;  2BW2 A;  4RM9 A;  2ASQ A;  4WIP A;  4KSK C;  4G50 A;  4FJV B;  5E6P A;  1QOB A;  2A4Z A;  3NHE B;  2BKR B;  4AUQ C;  1T0Y A;  5IAA C;  3PPA A;  4KZC A;  3Q8B A;  1NI2 A;  2PEA A;  1FXA A;  2J4X A;  3FAH A;  4DHJ D;  1C77 A;  3H6N A;  3DVG Y;  4WWM A;  1WRD B;  4NQL B;  1V80 A;  1ZW7 A;  2KT7 A;  2KMC A;  2CU3 A;  4DXG A;  2Y5C A;  4X57 B;  2WXK A;  3PRP B;  1S3S G;  1MG4 A;  3GZN I;  3SU8 X;  2TSS A;  3W1S C;  2Y3A A;  1XF5 L;  3KVF B;  5J18 A;  4P7I A;  2BTE A;  2W54 A;  4ZHO A;  1HTO A;  4J3O D;  3NVZ A;  2MJE A;  1XCT L;  2J52 A;  5AZH A;  3TSS A;  3VUX A;  1V2Y A;  4J6I A;  4ICV A;  3C19 A;  2Y5P A;  4JWS C;  1UNS A;  2MSE D;  2I2Y A;  2M4N A;  1L2N A;  1XT9 B;  3P4S B;  1UF0 A;  3DWG C;  1QF6 A;  2WU2 B;  3MP9 A;  3L17 A;  1L0V B;  4C80 A;  3PLV A;  3IBE A;  2KFK B;  1UBI A;  3DBL B;  2YVC A;  3P42 A;  5AUI A;  1D5Z C;  2PKO A;  3A33 B;  2REX A;  5L95 C;  4AJY B;  4WQO B;  5E6J A;  4MSQ B;  3VQI A;  2DHZ A;  3W2D A;  3ZXR A;  5C23 A;  2MCN B;  1D5M C;  1SE4 A;  4HPL B;  4LJO B;  1TS5 A;  3KWL A;  2FAZ A;  2BS3 B;  4WUR A;  3TJP A;  1YIW A;  4OW0 A;  3KUD B;  4NZL B;  1FM0 D;  4RGN A;  3PHW B;  3ONS A;  4HK2 A;  5D3I B;  4BKT A;  1JWU D;  2XEW A;  3QIJ A;  3VTU A;  4K3C A;  2O6V A;  4MT5 A;  3NG0 A;  4DXA B;  3PVL A;  3U30 A;  2PLP A;  1STE A;  1HZ5 A;  3CSF A;  1N5X A;  1QKZ A;  2AL6 A;  2ZCB A;  2JVC A;  3NUH B;  2BB6 A;  1OQY A;  4E3C A;  2BYV E;  3CMM B;  4A8X C;  2DZI A;  4BVU C;  1S1Q B;  1OQR A;  1WJU A;  3MHZ A;  4FJY A;  2OOB B;  3L10 B;  3ZYY X;  2QIL A;  3ZW3 A;  2MJ3 A;  2LJI A;  4HCP B;  1FPY A;  1AW7 A;  2K3U A;  1WGK A;  1JWS D;  1VDV A;  2M0X A;  3VH3 B;  1TZ1 A;  5G55 A;  3PT2 B;  2N1V A;  3URY A;  1WWT A;  1WGR A;  2KVR A;  1KTK A;  5AZF A;  4YXD B;  2ONQ A;  2KLC A;  4A90 A;  1FCL A;  2R2O A;  2N4F A;  2NVU I;  4IWP A;  4MDK E;  3MJW A;  3OAW A;  2NMQ A;  2KWU B;  3DHH C;  1YJI A;  4UDU C;  1JWA D;  3T3O A;  3A4S C;  4M00 A;  3WIM A;  2SEB D;  1HQR D;  1SBB B;  2L7R A;  1IPG A;  4H2A A;  1EWC A;  1WGY A;  4IWO A;  3B0A A;  2KLG A;  1VR9 A;  3WAN A;  3ZKJ C;  1EU3 A;  1WF9 A;  1R4N B;  3DHI C;  1JRU A;  4E74 A;  2WDV B;  4ANV A;  1C4A A;  4C7Y A;  2DAF A;  3CF6 E;  2L3Z A;  1WM2 A;  1E8Z A;  3BYY B;  4DQO C;  4HPP A;  2J42 A;  1YN4 A;  2KC2 A;  3EGR A;  2GBN A;  4MH8 A;  2AEH A;  2EKI A;  2FID A;  1DOY A;  1YN3 A;  4URK A;  2MBQ A;  2IJ0 A;  4WAF A;  2JWZ A;  2KDF B;  2MHJ A;  3FC4 A;  4KZ0 A;  2AWT A;  3BK2 A;  3HVZ A;  2J0J A;  2FBW B;  1KRH A;  2WXF A;  4BOS C;  3Q8E A;  1Y8R C;  2BF8 B;  3N20 C;  4RGM A;  3L0W B;  3M62 B;  2ZVN A;  1PGX A;  1FFU A;  1FMA D;  2JY6 A;  3A9K A;  3PSE B;  1VZ7 A; 
#chains in the Genus database with same CATH homology
 1ZE3 D;  3B2F A;  1HZ6 A;  1TKG A;  1QIL A;  1FNU A;  2QEJ C;  3AE8 B;  2HTM E;  5FKA C;  2KN4 A;  1NEN B;  1PYW D;  1TKY A;  2JU6 X;  3BII D;  5BYR A;  4ITK A;  4N6E B;  1I4Q A;  2JXT A;  1EU4 A;  5EE3 A;  1JRO A;  4IDI A;  2MJD A;  2GB1 A;  1OQQ A;  4RH6 A;  1T3Q A;  2J53 A;  1EWY C;  2OED A;  3P63 A;  2D5G A;  2AQ1 B;  4OHJ A;  3B9J A;  4RNA A;  1FO4 A;  3FIL B;  2L32 A;  3Q8C A;  1UGJ A;  1XLN A;  1FXI A;  5T8I A;  4RF1 A;  1SE3 A;  1MPE A;  2WXG A;  3H8H A;  2MH7 A;  2W55 A;  1KFY B;  4N59 A;  3AE9 B;  1QOA A;  1FNV A;  4N58 A;  1T6B X;  1TZO A;  1RWS A;  3PZ7 A;  4TQ0 A;  1DYQ A;  2ICI A;  3AE4 B;  5BMG A;  1NYQ A;  2LHE A;  3EUB 2;  2WU5 B;  1F77 A;  1TS2 A;  5HI1 A;  4XWW A;  1N63 A;  5BYQ A;  3AM9 A;  4XWT A;  1L6U A;  3HUI A;  3P4P B;  1T5X D;  1V1P B;  4CQN A;  1ZUD 2;  2JYT A;  2LEK A;  1V1O A;  3Q8A A;  1WRI A;  3ETR A;  1PGB A;  3ZJU A;  2H89 B;  5JXV A;  3TUO A;  1KH0 A;  1FIQ A;  1L4D B;  1YQ3 B;  4DXF A;  3NZ3 A;  3CIR B;  1VLB A;  3LXF A;  5H92 C;  3U2S C;  4XDC A;  4C7Z A;  1YJJ A;  1ZPS A;  4MAC A;  1GPX A;  2CJO A;  4US8 A;  4XDD A;  2JSV X;  1SB3 C;  4RGT A;  3BK1 A;  3KQ4 A;  1C76 A;  4ZRP A;  3AMZ A;  4US9 A;  1SSN A;  1V97 A;  1IGC A;  3BZD B;  2WQY B;  3P1M A;  1MVK A;  2BT6 A;  3NVV A;  1FRR A;  1ROE A;  4RGO S;  1VZ8 A;  2KAC A;  1IBX B;  3PZ8 A;  3NS1 A;  3OWE B;  4NAW B;  3J9C A;  1JRP A;  1AYF A;  3AN1 A;  4L23 A;  5C3J B;  1HA5 A;  2WXM A;  2INN E;  3AEE B;  2BBC A;  1JWB D;  3ABV B;  2BS2 B;  1UUP A;  5H8Y E;  2G1E A;  1I4H A;  1YQ4 B;  3MC0 B;  2DYO A;  2W3R A;  1TJE A;  2IGD A;  1N5W A;  4YTN B;  1PFD A;  3U4E G;  1E10 A;  2LHD A;  3HVD A;  1SXT A;  3AEC B;  3W9C B;  1E6E B;  1BUI C;  3O13 A;  2V3N A;  1N62 A;  4P6V F;  3V05 A;  2ON8 A;  1GAQ B;  3TEW A;  1VZ6 A;  4B0E A;  1SIJ A;  3U7Z A;  5BMI A;  4JPS A;  4YSZ B;  2WXP A;  4ZRQ A;  4C56 C;  3PO0 A;  2WS3 B;  1ZXI A;  1XEE A;  1J7B A;  4KGR A;  5BMH A;  2LFI A;  4JE3 B;  3V3X A;  4TQ1 A;  5AUK A;  1ZDX A;  2DLB A;  1JQ4 A;  3I9V 1;  3R2I A;  2PVG C;  3RFZ B;  3SFE B;  3VRA B;  1QOF A;  4AQ7 A;  1ACC A;  4XE0 A;  5LNK 1;  1N60 A;  4AS1 A;  4M0W A;  4ARC A;  3BYT B;  3BVZ A;  2JQR B;  2N9L A;  2XNA C;  3GP7 A;  1RM6 C;  2RDH A;  5HFY A;  2BW2 A;  3AE1 B;  1KLU D;  2X38 A;  2Q5W D;  4MM3 B;  3AE7 B;  4WIP A;  3SFD B;  2K22 A;  1F2R I;  1HEZ E;  1MHH E;  1QOB A;  4TMA B;  2WP9 B;  4HKZ E;  2YEP B;  1D6E C;  3VR8 B;  3AE2 B;  2I38 A;  3SR6 A;  4ZHP A;  1E7P B;  3CWI A;  2IPK D;  2QIE B;  3Q8B A;  1I4X A;  2IGG A;  1K51 A;  1SEB D;  2WXN A;  3IAM 1;  1FXA A;  2QSD A;  4IOI E;  2J4X A;  1ET9 A;  1SJH D;  3FAH A;  2FUG 1;  3C8Y A;  1C77 A;  1F0Z A;  1J7A A;  1M4V A;  1K52 A;  1IGD A;  2DYM A;  1CK1 A;  4WWM A;  4OZC A;  2N0S B;  2CU3 A;  3B2G A;  4DXG A;  2Y5C A;  4D2K A;  2JX5 A;  2KDM A;  4ARI A;  2WXK A;  5TSS A;  1PUT A;  1I4G A;  1J7C A;  2WDQ B;  4GDL B;  2TSS A;  1ESF A;  2Y3A A;  5EE9 A;  1XF5 L;  3MFG A;  2BB5 A;  5C2T B;  2VZK B;  1I4R A;  1FD6 A;  3AE6 B;  3VR9 B;  2BTE A;  2W54 A;  4ZHO A;  3IAS 1;  1GOZ A;  2WXI A;  4J3O D;  1PDX A;  4HRS A;  3NVZ A;  2ZW0 A;  2MJE A;  2WXO A;  3EA6 A;  1AWD A;  1XCT L;  3AV8 A;  2J52 A;  2JZP A;  2RPV A;  2M56 B;  4KKI A;  2WXR A;  1QQR A;  3TSS A;  1ZXH A;  2AQ2 B;  3GS2 A;  3ZGZ A;  1AN8 A;  2RMM A;  1D5X C;  2QMT A;  2Y5P A;  1D4B A;  4JWS C;  1ENF A;  1UNS A;  2N9K A;  3LB8 C;  4RF0 A;  2I2Y A;  5G5H A;  2WDR B;  5EE0 A;  1F2R C;  2WXJ A;  2K5P A;  4WH4 A;  4OVZ A;  3IT4 B;  1PGA A;  3P4S B;  1RFK A;  3R2T A;  3DWG C;  3IXS A;  1QF6 A;  2WU2 B;  3MP9 A;  3VRB B;  1GB1 A;  1L0V B;  1V8C A;  4C80 A;  1I7H A;  2KWD A;  4HRO A;  1SF0 A;  5D7G A;  5BYS A;  1I4P A;  2WXH A;  2MEK A;  3IT6 B;  4YTP B;  5G5G A;  4ZYS A;  4LLG M;  2V0G A;  3P42 A;  3E56 A;  5AUI A;  2DWQ A;  1D5Z C;  2M19 A;  2PKO A;  2W82 A;  4L1B A;  5I4D A;  3AEA B;  4USA A;  1VJK A;  3NVY A;  1MI0 A;  2NTT A;  5E6J A;  3VQI A;  1L5P A;  4TSS A;  4PT5 A;  3W2D A;  1C79 A;  2INP E;  1TYG B;  1XCQ L;  3AE3 B;  4YSY B;  4JWU C;  1D5M C;  1SE4 A;  4JX1 C;  3U52 E;  1TS5 A;  2LUM A;  1QT9 A;  1XO3 A;  3KWL A;  1EM7 A;  1P7E A;  5HG2 A;  4YSX B;  3W5U B;  2BS3 B;  4WUR A;  2JYE A;  4OW0 A;  2NTS A;  1QLB B;  3BVG A;  3AEG B;  4NZL B;  2WLB A;  1CQV A;  1FM0 D;  4RGN A;  1IUE A;  2R61 A;  1JW9 D;  1OFF A;  4EE2 A;  2BS4 B;  1VRA B;  1E9M A;  5D3I B;  2L52 A;  3TEZ A;  1JWU D;  1DOI A;  1CJE A;  1WYG A;  2AX5 A;  1XLP A;  3BWU D;  4HEA 1;  2CJN A;  2LGI A;  4MT5 A;  2VZK D;  4ZOH C;  1DGJ A;  1KLG D;  3P4R B;  2PLP A;  1STE A;  1HZ5 A;  1N5X A;  3FIL A;  1QKZ A;  3SEB A;  3AE5 B;  3HRD D;  1JAL A;  3NUH B;  3DWM A;  2BB6 A;  1NYR A;  3ZJV A;  3T3N A;  3I57 A;  4A55 A;  1Q10 A;  4A8X C;  3UI3 A;  1FRD A;  4HJG E;  5FK9 C;  1BXT A;  1OQR A;  2ZW1 A;  4A6Q A;  3MHZ A;  4RCO A;  1UWX A;  3ZYY X;  2QIL A;  4Q2J A;  3Q8F A;  2MJ3 A;  1ZOY B;  2LJI A;  1P7F A;  1AW7 A;  4OZA A;  1RYJ A;  2K3U A;  3AEB B;  1B9R A;  1WGK A;  1JWS D;  1VDV A;  3TEX A;  1Y56 A;  1YNT E;  1C9F A;  5MPO A;  3URY A;  1WWT A;  1V1P A;  2B76 B;  2KQ4 X;  1L4Z B;  4R3D A;  1TY2 A;  1KTK A;  4O1N A;  2V4I B;  4KX6 B;  2PW9 A;  1XLO A;  2GRI A;  4KKJ A;  4YXD B;  1WXQ A;  2ONQ A;  4L2Y A;  4KGS A;  4A90 A;  1FCL A;  2PVO D;  3KWV A;  1FNW A;  2KAJ A;  4WQM A;  3GB1 A;  1SJE D;  2LMC A;  2NMQ A;  2DBY A;  2L83 A;  1YJI A;  4UDU C;  1JWA D;  2E3T A;  3AED B;  2AQ3 B;  3T3O A;  1ZP0 B;  3NVW A;  3L4P A;  2G9H D;  1A70 A;  1L0Y B;  1JCK B;  2SEB D;  1NEK B;  2K0P A;  1KF6 B;  1HQR D;  1NI3 A;  1C78 A;  1SBB B;  2W3S A;  1TS3 A;  1UWM A;  1YMH E;  1ZDV A;  1LO5 D;  4KGT A;  5D3D A;  4H2A A;  4OZB A;  1EWC A;  3AEF B;  1IBX A;  4IKG A;  3ZQ4 A;  2E6X A;  3E9S A;  3MJ5 A;  2BYT A;  2IGH A;  3AH7 A;  3RPF C;  2FE8 A;  3NRZ A;  3ZJT A;  1ET6 A;  1HXY D;  1VR9 A;  2PTL A;  2Z8L A;  1EU3 A;  3W5V B;  4GDK B;  1R7S A;  4YWG G;  2ACZ B;  2EEL A;  2JWU A;  1XXG A;  4YTM B;  2WDV B;  3KLS X;  2GI9 A;  3R8B A;  1C4A A;  2SAK A;  1BML C;  1CZP A;  4P16 A;  5FR3 A;  4C7Y A;  4NAM A;  2IDY A;  5GXG B;  4A9A A;  3TEY A;  3LYY A;  2N7J A;  4REZ A;  2M0A A;  3BYY B;  2H88 B;  1FFV A;  1FEH A;  2YEP F;  1NVI D;  5EE1 A;  4DQO C;  1XLQ A;  3P4Q B;  2J42 A;  1YN4 A;  1YN5 A;  2L1A A;  2KMM A;  1TY0 A;  3EGR A;  4NJC A;  2WNM A;  2RDG A;  1TKE A;  4MH8 A;  2EKI A;  4B0M A;  1YN3 A;  4FXC A;  1DOY A;  3AB5 A;  2PIA A;  1QOG A;  2IJ0 A;  4WAF A;  3WCQ A;  3FC4 A;  2XN9 C;  3BK2 A;  3HVZ A;  2HDE A;  5HHD G;  1C4P A;  2FBW B;  1MHX A;  1E0Z A;  1N61 A;  1DOX A;  4LK0 M;  1SE2 A;  2K9X A;  1GB4 A;  1FCC C;  1L0X B;  1WSP A;  2QJL A;  1KRH A;  2WXF A;  1JML A;  1K50 A;  2WXQ A;  4HKQ A;  2WXL A;  3Q8E A;  1K53 A;  2OHF A;  1B1Z A;  4GLS C;  4RGM A;  3Q69 A;  1TS4 A;  1PGX A;  2PMV A;  2V3P A;  1FFU A;  1FMA D;  1C4C A;  3N9Y C;  4LTU A;  4RFB A;  1JWM D;  1L6V A;  1VZ7 A;  3BVM A;  3W1S A;  4YT0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...