1AYFA

Bovine adrenodoxin (oxidized)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
b'KITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADRENODOXIN
publication title New aspects of electron transfer revealed by the crystal structure of a truncated bovine adrenodoxin, Adx(4-108).
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
total genus 29
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ayfA00
2KAJA 1FRDA 5EE0A 1L6UA 1NI3A 2WDRB 1QOBA 1TKGA 3AEDB 3CIRB 2JX5A 2N0SB 2Q5WD 1E6EB 1AYFA 3HUIA 3AEAB 3AM9A 5EE3A 1E7PB 1ROEA 3DWMA 3L4PA 5C3JB 1R7SA 1V97A 2OHFA 2M19A 2G1EA 4JX1C 4YSYB 5AUKA 5H92C 2WP9B 1YJJA 3AEBB 1QLBB 1JALA 1N63A 3AE7B 1A70A 3P4SB 1RFKA 4YSZB 1F0ZA 1TKEA 1E0ZA 2DBYA 1E9MA 1FMAD 1JW9D 3KWLA 1XLOA 4C7YA 3AE9B 1VJKA 3NVWA 1DOIA 1PUTA 1FXIA 1J7CA 1VLBA 1JRPA 1CZPA 1UWMA 3B2GA 1WRIA 2CU3A 2QIEB 1L6VA 1OQRA 3AE6B 1JWAD 4WWMA 1KFYB 1L0VB 1FFVA 1OFFA 1RM6C 1GPXA 3SR6A 1GAQB 4C7ZA 2CJNA 1XLPA 3VRBB 1FXAA 4ZHPA 4N6EB 1AWDA 1E10A 1QOGA 1FFUA 2K5PA 1ZXIA 2LEKA 2WS3B 3AECB 1YQ4B 3ABVB 3AEFB 1EWYC 1N61A 3AV8A 3HVZA 3P4RB 3VRAB 1QF6A 1DOYA 3LXFA 4YTNB 2L83A 1QT9A 2W3RA 3HRDD 4N58A 3DWGC 2ACZB 4US9A 3W5VB 3EUB2 4YTMB 3NVZA 3P4QB 3AB5A 1J7AA 3NVVA 3LB8C 3NS1A 1FRRA 2BS2B 3P63A 3P4PB 1NYRA 4P6VF 2KMMA 2FBWB 2Y5CA 5G5GA 4ZHOA 1PDXA 1XLQA 3FAHA 3AE1B 4JWUC 4US8A 3SFEB 3AMZA 3VR9B 1TKYA 1SB3C 1WWTA 3NRZA 4N59A 3W5UB 1RYJA 1XLNA 3AEGB 3ZYYX 4C80A 2JQRB 3P1MA 3W9CB 3CWIA 2WLBA 5GXGB 1L5PA 2WDQB 2CJOA 1YJIA 2AX5A 2QJLA 3AE8B 1KF6B 3NVYA 3WCQA 3AH7A 1FO4A 1FIQA 1B9RA 2WU5B 2WQYB 1TJEA 2PKOA 2WU2B 1JWBD 5H8YE 3VR8B 4A9AA 4YTPB 1QOFA 1NVID 1NYQA 1ZOYB 2BS4B 4HROA 5EE1A 2E3TA 1PFDA 1V8CA 1WYGA 2MJDA 3FC4A 1JROA 1SF0A 1I7HA 3PO0A 1SIJA 2DWQA 1NEKB 2WDVB 1J7BA 1FM0D 1QOAA 5G5HA 2W55A 1WGKA 1VDVA 1OQQA 2W54A 2B76B 3B9JA 4JWSC 1DOXA 1IUEA 5EE9A 1ZP0B 1CJEA 4IDIA 4LTUA 2PIAA 4YXDB 2BT6A 2W3SA 2EKIA 2M56B 3RPFC 2MJEA 2K9XA 2MJ3A 1XO3A 3AE2B 2H89B 4ITKA 3AE3B 1DGJA 3BIID 2H88B 1TYGB 1ZUD2 5MPOA 1JQ4A 1YQ3B 2L52A 4HRSA 1RWSA 1WXQA 2PVGC 4ZOHC 1T3QA 2PVOD 1NENB 4YT0B 1N62A 3AE5B 4WQMA 3AN1A 5AUIA 2K22A 1N60A 1N5XA 2BS3B 2HTME 3ETRA 1N5WA 4FXCA 2MH7A 3AE4B 5C2TB 3AEEB 3B2FA 4KX6B 3SFDB 4YSXB 4USAA 1KRHA
chains in the Genus database with same CATH superfamily
2IY0B 3QAQA 5DPWA 2DYMA 1E7PB 2KN5A 3PRPB 5LNK1 2NBWB 2UYZB 4II2B 3AI5A 1A70A 1H4RA 1T0SC 4E3CA 1F0ZA 2WWZA 5JZEB 2WXLA 1T0YA 1WRDB 1XXGA 2GBKA 3R7RA 2LHEA 2O6VA 1GPXA 2KYWA 1GAQB 3ZIMA 1UNSA 1AWDA 1ZXIA 1V2YA 2M8SA 3AU4A 2BWES 3U30A 4HDOA 1V5TA 3DWGC 1R4MB 1WR1A 1I4QA 2K39A 1Y56A 2DYBA 5J18A 2DX5B 5MPOA 4C4VB 4IW0A 5BMIA 1VZ7A 4LDTD 3DHGC 5LLIA 2MQJA 2FCSA 4TQ1A 3GS2A 1ACCA 1G6JA 4REZA 3UGBB 1QKZA 3PHWB 4PK1A 4F1SA 2M0XA 3JSVB 3QJZA 1YNTE 1B9RA 4AWJA 4KIKA 3T3OA 3VR8B 4A9AA 3KYDD 3PS6A 2SAKA 2V4IB 2WXKA 2J0MA 3N1XC 3PO0A 2GOWA 3BWUD 3GB1A 3RNEC 4FJVB 4OZAA 1SGHA 3R2TA 5D6JB 4ASWC 1UD7A 2R2QA 2O2VB 1JQ4A 2L52A 4ACFA 4YT0B 3M3JA 2BS3B 4MH8A 4XDCA 3DBHB 3VUYA 4I6PA 3R8BA 4GIVA 3ZNGC 1TKGA 2JX5A 2D2QA 3ZDMC 4GXBA 4AS1A 2RD0A 4G11A 1V86A 3W1SC 1N63A 5IAAC 1GC6A 4RGMA 3I5JC 3DHIC 4FJYA 3VAWA 3NVWA 4AP4C 3E56A 2ZPNA 1ZPSA 1UWMA 3DBRI 3ZXRA 2G4SA 2KVZA 1LM8B 1TZOA 2YLMA 1P98A 3NS8A 1UWXA 2V4LA 2LRUA 2NTSA 4M02A 4XZ4A 3HVZA 3VRAB 4LNOA 3SDLC 2ACZB 2K1FA 2KN4A 2ZCBA 4KDLB 2IBIB 1QZEA 2L0TA 2LJ5A 3RMKC 2Z0DB 5IOIA 2LRWA 1WF9A 2RGFA 2BGFA 1C1YB 1YX5B 2DYOA 1TTNA 2KWVB 2UWQA 4KKIA 1KF6B 3ZNZB 5D94A 1JROA 2J7QB 4HCNB 4L2YA 1PGXA 5EE9A 3V62A 1AARA 3VHTC 2MW5A 4EE2A 4DXFA 1RAXA 2WXMA 2KWUB 3BZDB 4KGSA 5LXHA 2IJ0A 3AE4B 3AEEB 3B2FA 4K7WA 2NBUA 1WX9A 3I9V1 5G2NA 3PRZA 2UU7A 5BYQA 2OHFA 5E6NA 2KTFA 1EM7A 3QWZB 4IM3A 3VH3B 1RFKA 1BMLC 1TKEA 3M95A 5J2RA 1FMAD 3AE9B 1PUTA 1SE2A 2NPTB 3URYA 3MJWA 3ZO5B 1WRIA 3VH4B 2IO0B 3MTNB 1FFVA 1K53A 2D5GA 3U2SC 2ZNVC 3R3MA 1EU4A 2JSVX 3ZJUA 2HD5B 3VUWA 5L83A 4XE0A 3ZXVA 2C60A 1KOTA 2BB6A 2WXHA 5G5GA 2FBWB 4ANUA 3VR9B 5IKCM 1MI0A 3DBLB 3ZYYX 1OGWA 3DBSA 2RSUA 2NCNA 3WCQA 4RGOS 3ZQ4A 2WU5B 2WQYB 4BOSC 4FN2A 1ZXHA 1NVID 4IOIE 3L0WB 3FC4A 4HK2A 4DXAB 4K7SA 2FNJB 2DNFA 5KHQA 4MM3A 1I42A 2W54A 4MT5A 5DPSA 4YXDB 3GZNB 2K6QA 4GGQA 2D3GA 1Q0WB 3AE2B 4RNAA 2JYEA 3AE3B 1D3ZA 3NZUA 2KFKA 3UQAA 1L7YA 1T3QA 2PVOD 1V80A 1KLUD 2DAJA 3BY4B 5EE0A 4L23A 2L0FA 2SEBD 4IG7B 3QHTA 3KUDB 4JL9A 4Q2JA 4A3PA 3WAOA 2WXOA 3MHSD 1T5XD 2DBYA 3VVWB 4J3OD 2OEDA 2L7RA 1VLBA 3ZRFA 1V9JA 3UIOB 5T8IA 3B2GA 2NS5A 1JWSD 3ZJTA 3A4RA 1WXSA 1FFUA 2K5PA 2MP2B 4CO7A 2I1KA 3P4RB 2N9LA 2BVCA 1QT9A 3V60A 3HRDD 3L16A 1WGYA 2X8XX 4MELA 2JWZA 4K7UA 4ANXA 1LQBA 4FHJA 4JWUC 3KH0A 2V1YA 4JIOU 3TSSA 2VZKB 1XLNA 4M0WA 3TBLD 2L00B 2D3BA 2WLBA 4CYEA 5GXGB 3V3XA 4LNFA 4IM0A 3AE8B 3AH7A 4ARCA 1K51A 3U4EG 1IBXB 2CKHB 1NYQA 2V0GA 5CHFA 3RNGC 4TUUA 2L32A 1LFDA 2XK5A 2LVPA 1GC7A 1WGKA 2KDEB 1HZ5A 2ZEQA 1IP9A 2VH1A 2BT6A 3T3NA 1PYWD 3HHMA 2CHZA 2PVGC 2KX0A 3ZKJC 1T0QC 3BK2A 3W2DA 3Q8FA 2N9EB 4MGIE 4USAA 1XQQA 4LCDE 1WJ4A 1AYFA 1TZ1A 3AM9A 2BPSA 2LHDA 3R7QA 1Y8RC 1WIAA 4DXGA 4W9KA 2HJ1A 4OVZA 3LYYA 4G0NB 2R2OA 4JX1C 4A8XC 1S3SG 2WP9B 1YJJA 4MJSA 1SIFA 1WX7A 2C5LC 1CMXB 1U4AA 1ZGUB 1JW9D 4C7YA 2M0AA 1Z5SB 1P1AA 4HDQA 4WAFA 2CU3A 3RT3B 1WSPA 2GBJA 4K3CA 2KHWB 4RMAA 1TS2A 2PE9A 4DHZB 3BYYB 3H7SA 4NJ6A 1QQRA 1MJDA 5BMHA 5BYSA 3LJ3A 3VUXA 4N58A 3CSTA 2D3CA 4EOYA 1OEYJ 1PGAA 3BYTB 2KQ4X 3P2BA 2QSDA 2K3UA 1MPEA 1I4RA 1SEBD 3KYCD 4BKTA 1D4BA 3W5UB 4W9EA 3UQBA 2O6VD 1C4CA 2GMIC 1FO4A 1OTRB 1MG8A 2G45B 3C0RB 2MA9B 4HROA 2QC8A 1RFAA 3BVMA 4JGHB 4FHKA 1D5ZC 3DVNV 3D32A 4NAWB 3KW5B 4OW0A 4JE3B 2W3SA 4NY0A 2IGGA 4ZRJA 1ZUD2 2PMVA 2KDFB 1UGMA 2CHWA 2KC1A 4FXCA 1WZ3A 2WDRB 1NI3A 3Q8EA 3DPDA 3OLMD 4A6QA 2KACA 4ZRQA 2WNMA 3HK0A 2INCC 3RNFC 5FR3A 3PT2B 2KQSA 2KJHB 4C4VA 4K3BA 1L4DB 1E9MA 2BBCA 3HM6X 2J0KA 1F2RC 2ZVOA 2WYQA 4GU2A 3WALA 4AJYB 2IYDB 1E8ZA 4BZAA 3IVFA 2WXFA 5IN7A 4PS7A 1KLGD 2N9KA 1P0RA 3WANA 3APDA 1OQRA 4NZLB 2JU6X 2D07B 4DDID 1E90A 3PGEA 1XLPA 3K9PB 1E10A 4BKSA 1YQ4B 4DHJB 1WMHB 4EZJA 3LXFA 1JMLA 1H8CA 1R4NI 2L83A 3N1ZC 1KTKA 4JPSA 3P4QB 2BTEA 3TEYA 4DWFA 2AQ2B 3PVLA 3GP7A 2QDFA 3PLUA 3TIXA 1P7EA 1ENFA 2N1WA 2AQ1B 1SJHD 2O2VA 2KJRA 2WXNA 3MC8A 1UH6A 2B3AA 3AXCA 2JYTA 2RPVA 1E7UA 2N9PC 1HQRD 2G4DB 1XEEA 3EECA 2DZIA 5D7GA 3Q69A 3X0WA 3TL5A 1YIWA 1FM0D 3OJ3A 4B95A 2ICIA 3N20C 2EKIA 2LI5A 2WXIA 4ARIA 3FKYA 1SSNA 3UINB 3QCAA 3BK1A 2GBNA 1V1OA 2MX2A 3EFCA 2JY6A 1YMHE 1I4GA 2WXJA 2DHZA 3NHEB 2N0SB 4MACA 1C3TA 2ZW0A 2LWPA 3I57A 4AUQC 1OQYA 2K25A 2RDBC 4NQLB 5H92C 1TS3A 2YEPF 2FCMA 2FCQA 2QEJC 2FCNA 4TKNA 5D3DA 3ZGZA 4W9GA 1CZPA 4EZKA 2R61A 2K0PA 1UGJA 3W1YA 2LVOA 3SR6A 3N9YC 3UI3A 2PEAA 4FLHA 1KM7A 4GDLA 2MBOA 3ONSA 2WDTB 3N32A 1F2RI 4TMAB 1HXYD 1C76A 1I4HA 2NMQA 3ZLZA 3NS1A 3P63A 3ZNID 3QARA 1NYRA 4RM8A 3FAHA 1VCBA 2BYFA 1HE8A 1WI0A 3NRZA 3NJTA 3RFZB 4GDKA 2LD9A 2RPQA 2BF8B 2HJ8A 2RDHA 3ECIA 3NVYA 4ZDVA 3MC9A 4W9HA 4ZRIA 4OHJA 4GB9A 4G50A 3V6CB 2W82A 4B9KA 4KDIC 1QOAA 1V5OA 5G5HA 2A5UA 3BVZA 2IGHA 1CJEA 1ZKHA 3Q3MC 2PIAA 3CF6E 3ZVVA 2K9XA 5I4DA 2H89B 3N1YC 2BKFA 2MHJA 2LUEA 3L08A 4HRSA 2KDIA 4QAYA 4NJ7A 2NPTA 3TEXA 1N62A 2LGDA 2AYOB 1UELA 1N5XA 2BYTA 3MP9A 1IGCA 2ZZPB 3KVFB 4YSXB 5D3IB 2KAJA 2LJIA 1L4ZB 1WE6A 1YD8U 2LZ6A 5EE3A 5IO9A 2M17A 1KH0A 2KT7A 2YVCA 1QLBB 1F1HA 3P4SB 3GE8C 1ZE3D 3ENEA 2YEPB 4M01A 4K1RB 4FULA 2INDC 3EFUA 1FCLA 4MEMA 1P9DU 3H9DA 2N1VA 5DPRA 5AZHA 2LGYA 2WS3B 3H7PA 4HPMB 3ABVB 4A90A 3DVNU 3L54A 2KTRA 4XWWA 5IA7A 4YTMB 1J0GA 3AB5A 1J7AA 3GE3C 3WAPA 2LXCA 4F7ZA 3TCAA 4ZHOA 4EEWA 4GLSC 3N3KB 2CHXA 4ZRKA 1TKYA 1TIFA 1FCCC 4W9LA 4LDTB 4LNKA 5J17A 1LO5D 2AX5A 3Q3OC 3NZ3A 2ON8A 2GBRA 4BVUC 3MC0B 4KV2A 3IAM1 3FILB 3O13A 2LVQA 4HPPA 2VRRB 1R4MI 4ICVA 1UZXB 2K6DB 2WDVB 1XCTL 1UBIA 2D10A 2MBQA 3KUCB 2C9WB 4JWSC 1DOXA 1JRUA 1YX6B 2IDYA 4PS8A 5TR5A 4JQWC 3IG3A 4WQMA 3AN1A 4L1BA 3BVGA 3DDCB 2Y3AA 1FEHA 1ET9A 2MP2A 2GLSA 3MHZA 1HEZE 2AQ3B 3AEAB 1F77A 1PQSA 4X57B 5DPTA 3PTFC 1TY2A 2I1JA 2ZJDA 1TY0A 2C7HA 3SD5A 3LDZE 1VJKA 2KZRA 4URKA 1ET6A 1YJ1A 3RNBC 4XWTA 3PSEB 3DBHI 3H1UA 1D5XC 4C7ZA 3KUZA 1FXAA 3CSFA 1IBXA 1N61A 2NR2A 5FK9C 3ALBA 4WURA 3RZWC 3NVVA 1VD2A 1FRRA 4S17A 2Y5CA 2KJ6A 3VTWA 1YN3A 2MRPA 2QCZA 1SB3C 1RYJA 1ISNA 2GI9A 1TGZB 2PPHA 4W9FA 4ANVA 2NTTA 3EA6A 4WAAA 3R2IA 1WZ0A 4TSSA 2N4FA 5HFYA 3Q8CA 2L05A 2N7DA 4W9CA 3V6EB 4B0EA 3L17A 2FAZA 5HG2A 3GOEA 4TQ0A 2MJ3A 4B6WA 1XO3A 4KVGB 2VH2A 5JHBA 1YQ3B 1WXQA 1NENB 2CU1A 1L0XB 4D2KA 3RYTA 2JPHA 4NJCA 1EO6A 2WHIA 1WR6E 3Q2AC 1E7VA 3TUOA 1E6EB 2PLPA 2DAFA 2KVRA 1UBQA 3DHHC 4GN1A 4KGTA 5HI1A 1ZDXA 1JALA 3VDZA 2Z59B 3JVZX 1C78A 5E6OA 3KWLA 4WJOA 4FBJB 2XN9C 1MFWA 4PYZA 2NBVB 5DCNA 1P3QU 2JZZA 4KGRA 2MLBA 3WIMA 5AZFA 3A1QB 2J42A 2TSSA 4ZYNA 4P16A 2IO3B 5BYRA 1XCQL 1CQVA 1FD6A 4BBNC 1SJED 1TS4A 1PDXA 1Q1OA 3NZSA 3IHPC 4KSKC 2N9XA 3U52E 1WXMA 2IZVB 3P1MA 2KXJA 1X1MA 3L10B 4HEA1 2L3ZA 3ML8A 3NOBA 3NUHB 1P7FA 4BKSD 3C19A 4HPLB 4WWPA 4FA6A 3WA0A 3A9KB 1WYGA 2MJDA 2KMCA 4FJZA 1SE9A 1WGGA 1ZDVA 3K9OB 4O1NA 1E8WA 1LGRA 2KX3A 2A4ZA 2BW2A 4EZLA 3DBLI 3KLSX 1B1ZA 3MJ5A 2M4NA 1YOVB 2M1MA 4YWGG 3DBRB 3ETRA 1EF1A 3UIPB 3SFDB 4KX6B 3OG5A 3U7DA 2RDGA 2V3SA 3DVGY 1A5RA 3M63B 1WMHA 2IO2B 4YSYB 2QMTA 1C79A 3GZNI 2ASQA 3SHQA 4I6LB 2D11A 1I4XA 5D2MB 2KMAA 2N7EA 2QIEB 1GB4A 1JWAD 5JHAA 2WX1A 4PYUA 2BYEA 3A9JB 3Q8AA 4PT5A 1RLFA 2FUHB 4KSLC 1D6EC 1FXTB 1EWYC 2W9NA 3TEWA 2W3RA 4WWOA 5E6PA 4XGAB 5L95C 4P1CC 4US9A 3ZJVA 4C56C 4W9IA 3LB8C 1M4VA 1XLQA 2DZJA 2KDMA 3AE1B 3SFEB 3AMZA 1V1PB 2JVCA 1HTOA 2WGSA 3JSVA 1IYFA 1L2NA 4GSWA 1DYQA 1L5PA 2WXPA 2PKOA 5H8YE 4A20A 2KWCA 4XC2A 1TS5A 2BS4B 5EE1A 2LMCA 1OEYA 1WGDA 1J7BA 5G55A 5CTRC 1BUIC 4LTUA 1WY8A 3RCZA 2G3QB 1STEA 3ML9A 4BFRA 1TT5B 3BIID 4A3OA 1TYGB 1GG3A 1RWSA 2K8BA 4ZOHC 3AE5B 2K22A 1N60A 4AJWA 1V6EA 2MH7A 5FKAC 1FRDA 3CIRB 3ZTDA 2NVUI 4KZ0A 4F8CB 1K52A 3APFA 4E74A 4RH6A 4KZCA 1V49A 1FNWA 1I4PA 3PREA 1DOIA 2MCNB 1L6VA 1HTQA 3ZNHB 4BKGA 2KDBA 3VRBB 1QOGA 1C4PA 4LLGM 3Q3NC 4ZRPA 3NY5A 4DDGD 3PZ8A 2CS4A 4A55A 2L8JA 3KQ4A 2KNBA 4XYCA 4P6VF 2KMMA 3WAMA 5JH5C 4DBGA 2KLGA 3Q3JA 5C1ZA 4CHKA 3CWIA 2GB1A 2O6VB 3KWVA 3ZUNA 1UUPA 2KANA 1YJIA 5EDSA 3RULA 2Z0EB 2L76A 3Q6BA 3IXSA 2CR5A 2PE6B 2FIFA 4XX5A 5AEKB 1IPGA 3QA8A 1SF0A 1WE7A 4DK5A 2REXA 2EELA 1JWUD 4DHZE 5KHOA 1IUEA 1ZP0B 3RPFC 2FUG1 4I6NB 4G3XB 1DGJA 2KWDA 3Q14C 2Y5PA 1WJNA 1WGRA 1MG4A 4KIKB 2KC2A 3CMMB 1QOBA 3AEDB 2I38A 2Q5WD 4LNNA 4MSQB 4FADA 3HUIA 1ROEA 5C3JB 3Q3FA 1V97A 1FNUA 1KLVA 2M19A 2QHOA 1J19A 3EGRA 5AUKA 3H6NA 2KK8A 3M62B 1WX8A 3O65B 3V05A 1XLOA 2I2YA 3OJ4B 3IFWB 3IBEA 4ANWA 2OOBB 1JRPA 1T0RC 3RD2A 2ZNVB 2ONQA 2E6XA 4ICUA 3AE6B 4WWMA 2BWFA 2GBMA 2IPKD 1RM6C 4HXDA 1OFFA 1XF5L 2CJNA 3PZDA 4WJNA 2LEKA 4HLEA 4OVUA 3AEFB 1VZ6A 3FILA 1WGHA 4IUMB 1WXAA 4GDLB 2AL6A 3H8HA 3NVZA 2LFIA 2BS2B 2D3AA 4RF1A 3ZTCA 4EFOA 4WQOB 1D5MC 4RM9A 2VZKD 1Z2MA 1JCKB 1J8CA 4C80A 4RGNA 2ZCCA 3B1LX 1VRAB 1WM3A 4MGYE 4IC7B 4S0RA 2K8HA 4GDKB 3A33B 2J4XA 3HM3A 3RUIB 3DVGX 1WFYA 4M00A 1BT0A 5TSSA 4BAXA 1UF0A 2MBEA 1ESFA 1I7HA 3APCA 4LJOB 3QC8B 1OQQA 5CX3A 3RN9C 1I35A 4H2AA 2IGDA 3EC8A 4HVBA 3P42A 1XT9B 2AEHA 1YQBA 5AZGA 3TEZA 1ZW7A 2H88B 3DQVA 1GB1A 1N6ZA 3RZFA 5AUIA 1Q5WB 2XBBC 2Z8LA 2J0JA 3OAWA 5C2TB 4WJPA 3IT6B 4LK0M 2HTHA 4NQKE 5FR6A 3VTUA 2INPE 2MSED 4P7IA 2WX0A 5CHWA 3DWMA 3L4PA 4IWPA 1R7SA 1AW7A 2JF5A 1MHHE 1EU3A 4BBNF 1TBEA 3HVDA 2BB5A 1WM2A 3AEBB 3JW0X 4C00A 3AE7B 4WIPA 3I3TB 3UF8A 4YSZB 2N7JA 5BO4B 2FIDA 2JWUA 3AULA 2MWSB 1FXIA 2DZMA 3RNCC 4LNIA 2LGIA 1GOZA 4IKGA 2RR9A 3PPAA 3EHVA 2K8CA 1K50A 1KFYB 4N6EB 1GUAB 4MH0E 4NAMA 4K81A 1EUVB 3H7PB 3HIZA 4DQOC 2AWTA 3W5VB 5C23A 3EUB2 1YN5A 2KTRB 1XD3B 2LXAA 5HHDG 3P4PB 2PW9A 3MFGA 4CQNA 3QK0A 3OWEB 2AL3A 2PJHA 3V61A 3AEGB 2JQRB 3W9CB 2WDQB 3Q8BA 4UDUC 4JLCA 4M8NA 4OZCA 1FIQA 3IT4B 4B0MA 4HWIB 2WU2B 1QOFA 3B0AA 1V8CA 3U8ZA 1EWCA 3N30A 2Y5BB 2XNAC 2DWQA 1NEKB 3U7ZA 1NDDA 2EMTA 2HDEA 1PGBA 1VDVA 3IAS1 1EF5A 2JZPA 4HCPB 2V3NA 4P1BC 2GRIA 2MBHA 1WJ6A 1K8RB 4HKQA 2IO1B 2C7MB 2V3PA 2ZPYA 2BQQA 3QX1A 1RRBA 1N5WA 1F52A 3DOWA 1HZ6A 3A1QA 2LGXA 1L6UA 3DCGA 1IGDA 4WJQA 2KOXA 2JUOA 2V9HA 1R4NB 2IY1B 1QILA 4E71A 4MM3B 1WYWB 1FPYA 1E0ZA 3L13A 4NPNA 4MDKE 3TJPA 3JYUA 1J7CA 2KFKB 1C77A 4IWOA 4LJPB 4ZHPA 4IWQA 3AECB 4R3DA 4DHJD 1QF6A 3A9KA 3NG0A 4YTNB 3T9LA 4TV3A 1WH3A 1Q10A 4II3B 1JWMD 2OJRA 4HKZE 4ZYSA 4WWNA 4US8A 1FNVA 5IP4D 1NBFC 3E9SA 4RFBA 1SE4A 4IM2A 1WWTA 4N59A 1GNUA 5LXIB 3QIJA 3C8YA 4KKJA 4OVVA 5HKHA 3PZ7A 2BKRB 1E8XA 2KFJA 2JT4B 4AQ7A 1KJTA 1WJUA 4GOCA 2L1AA 4NNJB 1L0YB 2J52A 2E3TA 2RMMA 3ZRCA 4NAWA 4W9DA 2MBBB 1AN8A 2ZVNA 2G9HD 1HA5A 3VXWA 2JXTA 2W55A 2B76B 1GJZA 3B9JA 3TMPB 2KKCA 3SU8X 4RGTA 4IDIA 1MHXA 2DZKA 2JRIB 4J6IA 2MJEA 4M8MA 3B08A 4ITKA 2KLCA 1C9FA 4M0WB 3PHXB 1SXTA 4MGKE 4MSMB 2HTME 2ZW1A 4RF0A 1MVKA 3VTVA 5JXVA 1KRHA 4MGZE 2KO3A 3A9JA 2DLBA 2MEKA 2J53A 4N9F4 2JXXA 3R66C 1CK1A 4EKUA 2BYVE 2KD0A 3VFKA 2XK5B 4PS3A 2G1EA 2PTLA 3VQIA 2LGSA 2LASA 2FE8A 3S2AA 4W9JA 4OZBA 3J9CA 2WXQA 1VR9A 1SBBB 1V1PA 1E8YA 3PV1A 1LXDA 1T6BX 3PRMB 4GMVA 2QILA 1L0VB 3ZDTA 1F9JA 2KQ7A 2OJWA 3AV8A 3A4SC 1DOYA 3PLVA 3QQ8B 2XEWA 1YN4A 4XDDA 2DENB 2X38A 1BXTA 1E5WA 4HJGE 3T8MA 4MJSB 3I63C 4RCOA 2C7NB 4HJKA 2EMSA 2JRHA 4BOZB 5CHVC 2WXGA 4EUTA 2WXRA 2CJOA 2QJLA 5E6JA 1WXVA 1TJEA 1NI2A 5GMVA 1JWBD 3X23A 4YTPB 3RNAC 1ZOYB 2JZ3B 1PFDA 4YL8A 3W1SA 3SEBA 1SIJA 2EKEC 1VZ8A 3ZW3A 3AU5A 2M56B 1C4AA 4WH4A 4AOFA 1V81A 1M94A 2INNE 3RI7C 5BMGA 1SE3A 2LUMA 1S1QB 2HE7A 3BINA
chains in the Genus database with same CATH topology
1QOBA 3AEDB 2I38A 3MHZA 2Q5WD 1AYFA 1HEZE 2AQ3B 2DYMA 3AEAB 3AM9A 1E7PB 1ROEA 1F77A 3HUIA 5C3JB 2LHDA 5LNK1 4DXGA 1V97A 1FNUA 2M19A 4OVZA 3LYYA 4JX1C 3EGRA 5AUKA 4A8XC 2WP9B 1YJJA 1TY2A 1A70A 1F0ZA 3V05A 1JW9D 1TY0A 4C7YA 1XLOA 2I2YA 2M0AA 1VJKA 2WXLA 1ET6A 1JRPA 1XXGA 4WAFA 4XWTA 2CU3A 2ONQA 2E6XA 1WSPA 3AE6B 1D5XC 2LHEA 4WWMA 2IPKD 1RM6C 1GPXA 1OFFA 1TS2A 1XF5L 4C7ZA 1GAQB 3BYYB 2CJNA 1UNSA 1FXAA 1QQRA 1AWDA 5BMHA 2LEKA 1ZXIA 3AEFB 1IBXA 1VZ6A 1N61A 5BYSA 5FK9C 3FILA 4N58A 4WURA 3DWGC 4GDLB 1PGAA 3BYTB 1I4QA 2KQ4X 1Y56A 3H8HA 3NVZA 2QSDA 2K3UA 2LFIA 3NVVA 5MPOA 1FRRA 2BS2B 2Y5CA 1MPEA 4RF1A 1YN3A 1I4RA 5BMIA 1SEBD 1D5MC 1VZ7A 2VZKD 1SB3C 1D4BA 3W5UB 1RYJA 1JCKB 2GI9A 4TQ1A 3GS2A 1ACCA 4C80A 4REZA 4RGNA 1C4CA 1VRAB 1QKZA 1FO4A 4GDKB 2NTTA 3EA6A 1YNTE 1B9RA 2J4XA 3R2IA 3T3OA 4TSSA 3VR8B 4A9AA 4HROA 2SAKA 2V4IB 5HFYA 2WXKA 3BVMA 3Q8CA 5TSSA 1ESFA 1D5ZC 1I7HA 3PO0A 3BWUD 4B0EA 4NAWB 3GB1A 1OQQA 4OZAA 4H2AA 5HG2A 2IGDA 4OW0A 4JE3B 3R2TA 2W3SA 3P42A 4TQ0A 2MJ3A 3TEZA 1XO3A 2IGGA 2H88B 1GB1A 1ZUD2 1JQ4A 1YQ3B 2L52A 2PMVA 1WXQA 1NENB 4YT0B 5AUIA 1L0XB 2BS3B 4MH8A 4D2KA 4FXCA 2Z8LA 5C2TB 4XDCA 3IT6B 4LK0M 4NJCA 2INPE 3R8BA 2WDRB 1NI3A 3Q8EA 1TKGA 2JX5A 3TUOA 1E6EB 2PLPA 3DWMA 3L4PA 1R7SA 1AW7A 4A6QA 1MHHE 1EU3A 4AS1A 2KACA 4ZRQA 4KGTA 3HVDA 2WNMA 5HI1A 2BB5A 5FR3A 3AEBB 1ZDXA 1JALA 1N63A 3AE7B 4WIPA 4YSZB 4RGMA 1C78A 1L4DB 1E9MA 2BBCA 2N7JA 3KWLA 1F2RC 3NVWA 2JWUA 2XN9C 3E56A 1FXIA 2WXFA 1ZPSA 1KLGD 1UWMA 2N9KA 2LGIA 1GOZA 4IKGA 1OQRA 4NZLB 1TZOA 1K50A 4KGRA 2JU6X 1KFYB 1UWXA 1XLPA 4N6EB 2NTSA 1E10A 2J42A 1YQ4B 3HVZA 4NAMA 3VRAB 3LXFA 1JMLA 2L83A 1KTKA 2ACZB 4DQOC 2TSSA 3W5VB 3EUB2 4JPSA 2KN4A 4P16A 1YN5A 3P4QB 5BYRA 1XCQL 5HHDG 1CQVA 3P4PB 1FD6A 2BTEA 1SJED 2PW9A 1TS4A 3TEYA 1PDXA 2AQ2B 3MFGA 3GP7A 4CQNA 3OWEB 1P7EA 1ENFA 3AEGB 3U52E 2AQ1B 1SJHD 2JQRB 2WXNA 2DYOA 3P1MA 3W9CB 4HEA1 2WDQB 3Q8BA 4KKIA 4UDUC 1KF6B 3NUHB 2JYTA 1P7FA 4OZCA 1FIQA 2RPVA 3IT4B 1HQRD 4B0MA 1XEEA 2WU2B 1QOFA 5D7GA 3Q69A 1V8CA 1WYGA 2MJDA 1JROA 1EWCA 2XNAC 2DWQA 1NEKB 3U7ZA 1FM0D 1ZDVA 2HDEA 1PGBA 4L2YA 4O1NA 1VDVA 3IAS1 2JZPA 1PGXA 5EE9A 2ICIA 2V3NA 2EKIA 2GRIA 2WXIA 4ARIA 4EE2A 2BW2A 4DXFA 1SSNA 3BK1A 3KLSX 1B1ZA 3MJ5A 4HKQA 1V1OA 2WXMA 3BZDB 4KGSA 4YWGG 2V3PA 3ETRA 1N5WA 2IJ0A 3AE4B 3AEEB 3B2FA 4KX6B 3SFDB 1HZ6A 1YMHE 2RDGA 1I4GA 2WXJA 1L6UA 3I9V1 1IGDA 2N0SB 4MACA 2ZW0A 3I57A 5BYQA 2OHFA 1EM7A 1QILA 4MM3B 4YSYB 5H92C 1TS3A 2QMTA 1C79A 2YEPF 1RFKA 1BMLC 1TKEA 1E0ZA 2QEJC 1FMAD 3AE9B 1I4XA 1PUTA 1J7CA 1SE2A 5D3DA 3ZGZA 1C77A 1CZPA 3URYA 2R61A 1GB4A 1WRIA 2K0PA 2QIEB 1JWAD 1UGJA 1FFVA 1K53A 3SR6A 2D5GA 3N9YC 3U2SC 3Q8AA 4PT5A 3UI3A 4ZHPA 3AECB 4R3DA 1D6EC 1EU4A 1EWYC 2JSVX 1QF6A 3ZJUA 4YTNB 3TEWA 2W3RA 1Q10A 4XE0A 1F2RI 4US9A 1JWMD 4TMAB 1HXYD 3ZJVA 1C76A 4HKZE 4C56C 1I4HA 2NMQA 2BB6A 4ZYSA 3LB8C 3NS1A 3P63A 2WXHA 1M4VA 1NYRA 5G5GA 2FBWB 1XLQA 2KDMA 3FAHA 3AE1B 4US8A 1FNVA 3SFEB 3AMZA 3E9SA 3VR9B 1V1PB 4RFBA 1SE4A 1MI0A 1WWTA 3NRZA 4N59A 3ZYYX 3C8YA 4KKJA 3RFZB 3PZ7A 1DYQA 1L5PA 2RDHA 2WXPA 3NVYA 3WCQA 4AQ7A 4RGOS 3ZQ4A 2WU5B 2WQYB 2PKOA 2L1AA 5H8YE 1L0YB 1NVID 1ZXHA 1TS5A 2BS4B 4IOIE 2J52A 2E3TA 2RMMA 3FC4A 4OHJA 5EE1A 2LMCA 1AN8A 2W82A 2G9HD 1J7BA 1HA5A 1QOAA 5G5HA 2JXTA 2W55A 2W54A 2B76B 3B9JA 1BUIC 3BVZA 2IGHA 1CJEA 4RGTA 4IDIA 1MHXA 2PIAA 4LTUA 4MT5A 4YXDB 2MJEA 2K9XA 5I4DA 1STEA 3AE2B 2H89B 4RNAA 2JYEA 4ITKA 1C9FA 3AE3B 3BIID 1TYGB 4HRSA 1RWSA 4ZOHC 1T3QA 2PVOD 1SXTA 3TEXA 1N62A 3AE5B 2K22A 1N60A 1N5XA 1KLUD 2HTME 2ZW1A 3MP9A 4RF0A 1IGCA 1MVKA 2MH7A 2BYTA 4YSXB 5JXVA 1KRHA 5D3IB 5FKAC 2KAJA 2DLBA 1FRDA 5EE0A 2LJIA 1L4ZB 2J53A 2MEKA 4L23A 1CK1A 3CIRB 2SEBD 5EE3A 2G1EA 2PTLA 1KH0A 4Q2JA 3VQIA 2FE8A 2WXOA 1QLBB 4OZBA 1K52A 3P4SB 3J9CA 1T5XD 1ZE3D 2WXQA 2DBYA 4RH6A 1VR9A 1SBBB 1FNWA 1V1PA 1I4PA 2YEPB 4J3OD 1DOIA 2OEDA 1VLBA 1T6BX 5T8IA 3B2GA 1L6VA 2QILA 1FCLA 1JWSD 1L0VB 3ZJTA 3VRBB 1QOGA 1FFUA 2K5PA 2WS3B 1C4PA 3ABVB 3AV8A 4LLGM 4A90A 3P4RB 4ZRPA 1DOYA 2N9LA 1QT9A 1YN4A 3HRDD 3PZ8A 4XDDA 2X38A 1BXTA 4HJGE 4A55A 4XWWA 4YTMB 3KQ4A 3AB5A 1J7AA 4RCOA 4ZHOA 4P6VF 2KMMA 4GLSC 4JWUC 1TKYA 3TSSA 2VZKB 1FCCC 3Q8FA 1XLNA 4M0WA 2WXGA 2WXRA 3CWIA 2GB1A 2WLBA 3KWVA 5GXGB 1LO5D 3V3XA 1UUPA 2CJOA 1YJIA 2AX5A 2QJLA 3AE8B 5E6JA 3AH7A 3NZ3A 4ARCA 1K51A 1TJEA 2ON8A 3U4EG 1IBXB 1JWBD 3MC0B 3IAM1 3FILB 4YTPB 3IXSA 1ZOYB 1NYQA 3O13A 2V0GA 1PFDA 3W1SA 1SF0A 2L32A 3SEBA 1SIJA 2WDVB 1XCTL 1VZ8A 2EELA 1WGKA 1JWUD 4JWSC 1DOXA 1IUEA 1HZ5A 1ZP0B 2BT6A 2M56B 3RPFC 3T3NA 1PYWD 2FUG1 1C4AA 4WH4A 1DGJA 2IDYA 2KWDA 2PVGC 2Y5PA 2INNE 4WQMA 3AN1A 4L1BA 5BMGA 1SE3A 2LUMA 3BVGA 3BK2A 3W2DA 2Y3AA 4USAA 1FEHA 1ET9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KAJ A;  1FRD A;  5EE0 A;  1L6U A;  1NI3 A;  2WDR B;  1QOB A;  1TKG A;  3AED B;  3CIR B;  2JX5 A;  2N0S B;  2Q5W D;  1E6E B;  1AYF A;  3HUI A;  3AEA B;  3AM9 A;  5EE3 A;  1E7P B;  1ROE A;  3DWM A;  3L4P A;  5C3J B;  1R7S A;  1V97 A;  2OHF A;  2M19 A;  2G1E A;  4JX1 C;  4YSY B;  5AUK A;  5H92 C;  2WP9 B;  1YJJ A;  3AEB B;  1QLB B;  1JAL A;  1N63 A;  3AE7 B;  1A70 A;  3P4S B;  1RFK A;  4YSZ B;  1F0Z A;  1TKE A;  1E0Z A;  2DBY A;  1E9M A;  1FMA D;  1JW9 D;  3KWL A;  1XLO A;  4C7Y A;  3AE9 B;  1VJK A;  3NVW A;  1DOI A;  1PUT A;  1FXI A;  1J7C A;  1VLB A;  1JRP A;  1CZP A;  1UWM A;  3B2G A;  1WRI A;  2CU3 A;  2QIE B;  1L6V A;  1OQR A;  3AE6 B;  1JWA D;  4WWM A;  1KFY B;  1L0V B;  1FFV A;  1OFF A;  1RM6 C;  1GPX A;  3SR6 A;  1GAQ B;  4C7Z A;  2CJN A;  1XLP A;  3VRB B;  1FXA A;  4ZHP A;  4N6E B;  1AWD A;  1E10 A;  1QOG A;  1FFU A;  2K5P A;  1ZXI A;  2LEK A;  2WS3 B;  3AEC B;  1YQ4 B;  3ABV B;  3AEF B;  1EWY C;  1N61 A;  3AV8 A;  3HVZ A;  3P4R B;  3VRA B;  1QF6 A;  1DOY A;  3LXF A;  4YTN B;  2L83 A;  1QT9 A;  2W3R A;  3HRD D;  4N58 A;  3DWG C;  2ACZ B;  4US9 A;  3W5V B;  3EUB 2;  4YTM B;  3NVZ A;  3P4Q B;  3AB5 A;  1J7A A;  3NVV A;  3LB8 C;  3NS1 A;  1FRR A;  2BS2 B;  3P63 A;  3P4P B;  1NYR A;  4P6V F;  2KMM A;  2FBW B;  2Y5C A;  5G5G A;  4ZHO A;  1PDX A;  1XLQ A;  3FAH A;  3AE1 B;  4JWU C;  4US8 A;  3SFE B;  3AMZ A;  3VR9 B;  1TKY A;  1SB3 C;  1WWT A;  3NRZ A;  4N59 A;  3W5U B;  1RYJ A;  1XLN A;  3AEG B;  3ZYY X;  4C80 A;  2JQR B;  3P1M A;  3W9C B;  3CWI A;  2WLB A;  5GXG B;  1L5P A;  2WDQ B;  2CJO A;  1YJI A;  2AX5 A;  2QJL A;  3AE8 B;  1KF6 B;  3NVY A;  3WCQ A;  3AH7 A;  1FO4 A;  1FIQ A;  1B9R A;  2WU5 B;  2WQY B;  1TJE A;  2PKO A;  2WU2 B;  1JWB D;  5H8Y E;  3VR8 B;  4A9A A;  4YTP B;  1QOF A;  1NVI D;  1NYQ A;  1ZOY B;  2BS4 B;  4HRO A;  5EE1 A;  2E3T A;  1PFD A;  1V8C A;  1WYG A;  2MJD A;  3FC4 A;  1JRO A;  1SF0 A;  1I7H A;  3PO0 A;  1SIJ A;  2DWQ A;  1NEK B;  2WDV B;  1J7B A;  1FM0 D;  1QOA A;  5G5H A;  2W55 A;  1WGK A;  1VDV A;  1OQQ A;  2W54 A;  2B76 B;  3B9J A;  4JWS C;  1DOX A;  1IUE A;  5EE9 A;  1ZP0 B;  1CJE A;  4IDI A;  4LTU A;  2PIA A;  4YXD B;  2BT6 A;  2W3S A;  2EKI A;  2M56 B;  3RPF C;  2MJE A;  2K9X A;  2MJ3 A;  1XO3 A;  3AE2 B;  2H89 B;  4ITK A;  3AE3 B;  1DGJ A;  3BII D;  2H88 B;  1TYG B;  1ZUD 2;  5MPO A;  1JQ4 A;  1YQ3 B;  2L52 A;  4HRS A;  1RWS A;  1WXQ A;  2PVG C;  4ZOH C;  1T3Q A;  2PVO D;  1NEN B;  4YT0 B;  1N62 A;  3AE5 B;  4WQM A;  3AN1 A;  5AUI A;  2K22 A;  1N60 A;  1N5X A;  2BS3 B;  2HTM E;  3ETR A;  1N5W A;  4FXC A;  2MH7 A;  3AE4 B;  5C2T B;  3AEE B;  3B2F A;  4KX6 B;  3SFD B;  4YSX B;  4USA A;  1KRH A; 
#chains in the Genus database with same CATH topology
 2IY0 B;  3QAQ A;  5DPW A;  2DYM A;  1E7P B;  2KN5 A;  3PRP B;  5LNK 1;  2NBW B;  2UYZ B;  4II2 B;  3AI5 A;  1A70 A;  1H4R A;  1T0S C;  4E3C A;  1F0Z A;  2WWZ A;  5JZE B;  2WXL A;  1T0Y A;  1WRD B;  1XXG A;  2GBK A;  3R7R A;  2LHE A;  2O6V A;  1GPX A;  2KYW A;  1GAQ B;  3ZIM A;  1UNS A;  1AWD A;  1ZXI A;  1V2Y A;  2M8S A;  3AU4 A;  2BWE S;  3U30 A;  4HDO A;  1V5T A;  3DWG C;  1R4M B;  1WR1 A;  1I4Q A;  2K39 A;  1Y56 A;  2DYB A;  5J18 A;  2DX5 B;  5MPO A;  4C4V B;  4IW0 A;  5BMI A;  1VZ7 A;  4LDT D;  3DHG C;  5LLI A;  2MQJ A;  2FCS A;  4TQ1 A;  3GS2 A;  1ACC A;  1G6J A;  4REZ A;  3UGB B;  1QKZ A;  3PHW B;  4PK1 A;  4F1S A;  2M0X A;  3JSV B;  3QJZ A;  1YNT E;  1B9R A;  4AWJ A;  4KIK A;  3T3O A;  3VR8 B;  4A9A A;  3KYD D;  3PS6 A;  2SAK A;  2V4I B;  2WXK A;  2J0M A;  3N1X C;  3PO0 A;  2GOW A;  3BWU D;  3GB1 A;  3RNE C;  4FJV B;  4OZA A;  1SGH A;  3R2T A;  5D6J B;  4ASW C;  1UD7 A;  2R2Q A;  2O2V B;  1JQ4 A;  2L52 A;  4ACF A;  4YT0 B;  3M3J A;  2BS3 B;  4MH8 A;  4XDC A;  3DBH B;  3VUY A;  4I6P A;  3R8B A;  4GIV A;  3ZNG C;  1TKG A;  2JX5 A;  2D2Q A;  3ZDM C;  4GXB A;  4AS1 A;  2RD0 A;  4G11 A;  1V86 A;  3W1S C;  1N63 A;  5IAA C;  1GC6 A;  4RGM A;  3I5J C;  3DHI C;  4FJY A;  3VAW A;  3NVW A;  4AP4 C;  3E56 A;  2ZPN A;  1ZPS A;  1UWM A;  3DBR I;  3ZXR A;  2G4S A;  2KVZ A;  1LM8 B;  1TZO A;  2YLM A;  1P98 A;  3NS8 A;  1UWX A;  2V4L A;  2LRU A;  2NTS A;  4M02 A;  4XZ4 A;  3HVZ A;  3VRA B;  4LNO A;  3SDL C;  2ACZ B;  2K1F A;  2KN4 A;  2ZCB A;  4KDL B;  2IBI B;  1QZE A;  2L0T A;  2LJ5 A;  3RMK C;  2Z0D B;  5IOI A;  2LRW A;  1WF9 A;  2RGF A;  2BGF A;  1C1Y B;  1YX5 B;  2DYO A;  1TTN A;  2KWV B;  2UWQ A;  4KKI A;  1KF6 B;  3ZNZ B;  5D94 A;  1JRO A;  2J7Q B;  4HCN B;  4L2Y A;  1PGX A;  5EE9 A;  3V62 A;  1AAR A;  3VHT C;  2MW5 A;  4EE2 A;  4DXF A;  1RAX A;  2WXM A;  2KWU B;  3BZD B;  4KGS A;  5LXH A;  2IJ0 A;  3AE4 B;  3AEE B;  3B2F A;  4K7W A;  2NBU A;  1WX9 A;  3I9V 1;  5G2N A;  3PRZ A;  2UU7 A;  5BYQ A;  2OHF A;  5E6N A;  2KTF A;  1EM7 A;  3QWZ B;  4IM3 A;  3VH3 B;  1RFK A;  1BML C;  1TKE A;  3M95 A;  5J2R A;  1FMA D;  3AE9 B;  1PUT A;  1SE2 A;  2NPT B;  3URY A;  3MJW A;  3ZO5 B;  1WRI A;  3VH4 B;  2IO0 B;  3MTN B;  1FFV A;  1K53 A;  2D5G A;  3U2S C;  2ZNV C;  3R3M A;  1EU4 A;  2JSV X;  3ZJU A;  2HD5 B;  3VUW A;  5L83 A;  4XE0 A;  3ZXV A;  2C60 A;  1KOT A;  2BB6 A;  2WXH A;  5G5G A;  2FBW B;  4ANU A;  3VR9 B;  5IKC M;  1MI0 A;  3DBL B;  3ZYY X;  1OGW A;  3DBS A;  2RSU A;  2NCN A;  3WCQ A;  4RGO S;  3ZQ4 A;  2WU5 B;  2WQY B;  4BOS C;  4FN2 A;  1ZXH A;  1NVI D;  4IOI E;  3L0W B;  3FC4 A;  4HK2 A;  4DXA B;  4K7S A;  2FNJ B;  2DNF A;  5KHQ A;  4MM3 A;  1I42 A;  2W54 A;  4MT5 A;  5DPS A;  4YXD B;  3GZN B;  2K6Q A;  4GGQ A;  2D3G A;  1Q0W B;  3AE2 B;  4RNA A;  2JYE A;  3AE3 B;  1D3Z A;  3NZU A;  2KFK A;  3UQA A;  1L7Y A;  1T3Q A;  2PVO D;  1V80 A;  1KLU D;  2DAJ A;  3BY4 B;  5EE0 A;  4L23 A;  2L0F A;  2SEB D;  4IG7 B;  3QHT A;  3KUD B;  4JL9 A;  4Q2J A;  4A3P A;  3WAO A;  2WXO A;  3MHS D;  1T5X D;  2DBY A;  3VVW B;  4J3O D;  2OED A;  2L7R A;  1VLB A;  3ZRF A;  1V9J A;  3UIO B;  5T8I A;  3B2G A;  2NS5 A;  1JWS D;  3ZJT A;  3A4R A;  1WXS A;  1FFU A;  2K5P A;  2MP2 B;  4CO7 A;  2I1K A;  3P4R B;  2N9L A;  2BVC A;  1QT9 A;  3V60 A;  3HRD D;  3L16 A;  1WGY A;  2X8X X;  4MEL A;  2JWZ A;  4K7U A;  4ANX A;  1LQB A;  4FHJ A;  4JWU C;  3KH0 A;  2V1Y A;  4JIO U;  3TSS A;  2VZK B;  1XLN A;  4M0W A;  3TBL D;  2L00 B;  2D3B A;  2WLB A;  4CYE A;  5GXG B;  3V3X A;  4LNF A;  4IM0 A;  3AE8 B;  3AH7 A;  4ARC A;  1K51 A;  3U4E G;  1IBX B;  2CKH B;  1NYQ A;  2V0G A;  5CHF A;  3RNG C;  4TUU A;  2L32 A;  1LFD A;  2XK5 A;  2LVP A;  1GC7 A;  1WGK A;  2KDE B;  1HZ5 A;  2ZEQ A;  1IP9 A;  2VH1 A;  2BT6 A;  3T3N A;  1PYW D;  3HHM A;  2CHZ A;  2PVG C;  2KX0 A;  3ZKJ C;  1T0Q C;  3BK2 A;  3W2D A;  3Q8F A;  2N9E B;  4MGI E;  4USA A;  1XQQ A;  4LCD E;  1WJ4 A;  1AYF A;  1TZ1 A;  3AM9 A;  2BPS A;  2LHD A;  3R7Q A;  1Y8R C;  1WIA A;  4DXG A;  4W9K A;  2HJ1 A;  4OVZ A;  3LYY A;  4G0N B;  2R2O A;  4JX1 C;  4A8X C;  1S3S G;  2WP9 B;  1YJJ A;  4MJS A;  1SIF A;  1WX7 A;  2C5L C;  1CMX B;  1U4A A;  1ZGU B;  1JW9 D;  4C7Y A;  2M0A A;  1Z5S B;  1P1A A;  4HDQ A;  4WAF A;  2CU3 A;  3RT3 B;  1WSP A;  2GBJ A;  4K3C A;  2KHW B;  4RMA A;  1TS2 A;  2PE9 A;  4DHZ B;  3BYY B;  3H7S A;  4NJ6 A;  1QQR A;  1MJD A;  5BMH A;  5BYS A;  3LJ3 A;  3VUX A;  4N58 A;  3CST A;  2D3C A;  4EOY A;  1OEY J;  1PGA A;  3BYT B;  2KQ4 X;  3P2B A;  2QSD A;  2K3U A;  1MPE A;  1I4R A;  1SEB D;  3KYC D;  4BKT A;  1D4B A;  3W5U B;  4W9E A;  3UQB A;  2O6V D;  1C4C A;  2GMI C;  1FO4 A;  1OTR B;  1MG8 A;  2G45 B;  3C0R B;  2MA9 B;  4HRO A;  2QC8 A;  1RFA A;  3BVM A;  4JGH B;  4FHK A;  1D5Z C;  3DVN V;  3D32 A;  4NAW B;  3KW5 B;  4OW0 A;  4JE3 B;  2W3S A;  4NY0 A;  2IGG A;  4ZRJ A;  1ZUD 2;  2PMV A;  2KDF B;  1UGM A;  2CHW A;  2KC1 A;  4FXC A;  1WZ3 A;  2WDR B;  1NI3 A;  3Q8E A;  3DPD A;  3OLM D;  4A6Q A;  2KAC A;  4ZRQ A;  2WNM A;  3HK0 A;  2INC C;  3RNF C;  5FR3 A;  3PT2 B;  2KQS A;  2KJH B;  4C4V A;  4K3B A;  1L4D B;  1E9M A;  2BBC A;  3HM6 X;  2J0K A;  1F2R C;  2ZVO A;  2WYQ A;  4GU2 A;  3WAL A;  4AJY B;  2IYD B;  1E8Z A;  4BZA A;  3IVF A;  2WXF A;  5IN7 A;  4PS7 A;  1KLG D;  2N9K A;  1P0R A;  3WAN A;  3APD A;  1OQR A;  4NZL B;  2JU6 X;  2D07 B;  4DDI D;  1E90 A;  3PGE A;  1XLP A;  3K9P B;  1E10 A;  4BKS A;  1YQ4 B;  4DHJ B;  1WMH B;  4EZJ A;  3LXF A;  1JML A;  1H8C A;  1R4N I;  2L83 A;  3N1Z C;  1KTK A;  4JPS A;  3P4Q B;  2BTE A;  3TEY A;  4DWF A;  2AQ2 B;  3PVL A;  3GP7 A;  2QDF A;  3PLU A;  3TIX A;  1P7E A;  1ENF A;  2N1W A;  2AQ1 B;  1SJH D;  2O2V A;  2KJR A;  2WXN A;  3MC8 A;  1UH6 A;  2B3A A;  3AXC A;  2JYT A;  2RPV A;  1E7U A;  2N9P C;  1HQR D;  2G4D B;  1XEE A;  3EEC A;  2DZI A;  5D7G A;  3Q69 A;  3X0W A;  3TL5 A;  1YIW A;  1FM0 D;  3OJ3 A;  4B95 A;  2ICI A;  3N20 C;  2EKI A;  2LI5 A;  2WXI A;  4ARI A;  3FKY A;  1SSN A;  3UIN B;  3QCA A;  3BK1 A;  2GBN A;  1V1O A;  2MX2 A;  3EFC A;  2JY6 A;  1YMH E;  1I4G A;  2WXJ A;  2DHZ A;  3NHE B;  2N0S B;  4MAC A;  1C3T A;  2ZW0 A;  2LWP A;  3I57 A;  4AUQ C;  1OQY A;  2K25 A;  2RDB C;  4NQL B;  5H92 C;  1TS3 A;  2YEP F;  2FCM A;  2FCQ A;  2QEJ C;  2FCN A;  4TKN A;  5D3D A;  3ZGZ A;  4W9G A;  1CZP A;  4EZK A;  2R61 A;  2K0P A;  1UGJ A;  3W1Y A;  2LVO A;  3SR6 A;  3N9Y C;  3UI3 A;  2PEA A;  4FLH A;  1KM7 A;  4GDL A;  2MBO A;  3ONS A;  2WDT B;  3N32 A;  1F2R I;  4TMA B;  1HXY D;  1C76 A;  1I4H A;  2NMQ A;  3ZLZ A;  3NS1 A;  3P63 A;  3ZNI D;  3QAR A;  1NYR A;  4RM8 A;  3FAH A;  1VCB A;  2BYF A;  1HE8 A;  1WI0 A;  3NRZ A;  3NJT A;  3RFZ B;  4GDK A;  2LD9 A;  2RPQ A;  2BF8 B;  2HJ8 A;  2RDH A;  3ECI A;  3NVY A;  4ZDV A;  3MC9 A;  4W9H A;  4ZRI A;  4OHJ A;  4GB9 A;  4G50 A;  3V6C B;  2W82 A;  4B9K A;  4KDI C;  1QOA A;  1V5O A;  5G5H A;  2A5U A;  3BVZ A;  2IGH A;  1CJE A;  1ZKH A;  3Q3M C;  2PIA A;  3CF6 E;  3ZVV A;  2K9X A;  5I4D A;  2H89 B;  3N1Y C;  2BKF A;  2MHJ A;  2LUE A;  3L08 A;  4HRS A;  2KDI A;  4QAY A;  4NJ7 A;  2NPT A;  3TEX A;  1N62 A;  2LGD A;  2AYO B;  1UEL A;  1N5X A;  2BYT A;  3MP9 A;  1IGC A;  2ZZP B;  3KVF B;  4YSX B;  5D3I B;  2KAJ A;  2LJI A;  1L4Z B;  1WE6 A;  1YD8 U;  2LZ6 A;  5EE3 A;  5IO9 A;  2M17 A;  1KH0 A;  2KT7 A;  2YVC A;  1QLB B;  1F1H A;  3P4S B;  3GE8 C;  1ZE3 D;  3ENE A;  2YEP B;  4M01 A;  4K1R B;  4FUL A;  2IND C;  3EFU A;  1FCL A;  4MEM A;  1P9D U;  3H9D A;  2N1V A;  5DPR A;  5AZH A;  2LGY A;  2WS3 B;  3H7P A;  4HPM B;  3ABV B;  4A90 A;  3DVN U;  3L54 A;  2KTR A;  4XWW A;  5IA7 A;  4YTM B;  1J0G A;  3AB5 A;  1J7A A;  3GE3 C;  3WAP A;  2LXC A;  4F7Z A;  3TCA A;  4ZHO A;  4EEW A;  4GLS C;  3N3K B;  2CHX A;  4ZRK A;  1TKY A;  1TIF A;  1FCC C;  4W9L A;  4LDT B;  4LNK A;  5J17 A;  1LO5 D;  2AX5 A;  3Q3O C;  3NZ3 A;  2ON8 A;  2GBR A;  4BVU C;  3MC0 B;  4KV2 A;  3IAM 1;  3FIL B;  3O13 A;  2LVQ A;  4HPP A;  2VRR B;  1R4M I;  4ICV A;  1UZX B;  2K6D B;  2WDV B;  1XCT L;  1UBI A;  2D10 A;  2MBQ A;  3KUC B;  2C9W B;  4JWS C;  1DOX A;  1JRU A;  1YX6 B;  2IDY A;  4PS8 A;  5TR5 A;  4JQW C;  3IG3 A;  4WQM A;  3AN1 A;  4L1B A;  3BVG A;  3DDC B;  2Y3A A;  1FEH A;  1ET9 A;  2MP2 A;  2GLS A;  3MHZ A;  1HEZ E;  2AQ3 B;  3AEA B;  1F77 A;  1PQS A;  4X57 B;  5DPT A;  3PTF C;  1TY2 A;  2I1J A;  2ZJD A;  1TY0 A;  2C7H A;  3SD5 A;  3LDZ E;  1VJK A;  2KZR A;  4URK A;  1ET6 A;  1YJ1 A;  3RNB C;  4XWT A;  3PSE B;  3DBH I;  3H1U A;  1D5X C;  4C7Z A;  3KUZ A;  1FXA A;  3CSF A;  1IBX A;  1N61 A;  2NR2 A;  5FK9 C;  3ALB A;  4WUR A;  3RZW C;  3NVV A;  1VD2 A;  1FRR A;  4S17 A;  2Y5C A;  2KJ6 A;  3VTW A;  1YN3 A;  2MRP A;  2QCZ A;  1SB3 C;  1RYJ A;  1ISN A;  2GI9 A;  1TGZ B;  2PPH A;  4W9F A;  4ANV A;  2NTT A;  3EA6 A;  4WAA A;  3R2I A;  1WZ0 A;  4TSS A;  2N4F A;  5HFY A;  3Q8C A;  2L05 A;  2N7D A;  4W9C A;  3V6E B;  4B0E A;  3L17 A;  2FAZ A;  5HG2 A;  3GOE A;  4TQ0 A;  2MJ3 A;  4B6W A;  1XO3 A;  4KVG B;  2VH2 A;  5JHB A;  1YQ3 B;  1WXQ A;  1NEN B;  2CU1 A;  1L0X B;  4D2K A;  3RYT A;  2JPH A;  4NJC A;  1EO6 A;  2WHI A;  1WR6 E;  3Q2A C;  1E7V A;  3TUO A;  1E6E B;  2PLP A;  2DAF A;  2KVR A;  1UBQ A;  3DHH C;  4GN1 A;  4KGT A;  5HI1 A;  1ZDX A;  1JAL A;  3VDZ A;  2Z59 B;  3JVZ X;  1C78 A;  5E6O A;  3KWL A;  4WJO A;  4FBJ B;  2XN9 C;  1MFW A;  4PYZ A;  2NBV B;  5DCN A;  1P3Q U;  2JZZ A;  4KGR A;  2MLB A;  3WIM A;  5AZF A;  3A1Q B;  2J42 A;  2TSS A;  4ZYN A;  4P16 A;  2IO3 B;  5BYR A;  1XCQ L;  1CQV A;  1FD6 A;  4BBN C;  1SJE D;  1TS4 A;  1PDX A;  1Q1O A;  3NZS A;  3IHP C;  4KSK C;  2N9X A;  3U52 E;  1WXM A;  2IZV B;  3P1M A;  2KXJ A;  1X1M A;  3L10 B;  4HEA 1;  2L3Z A;  3ML8 A;  3NOB A;  3NUH B;  1P7F A;  4BKS D;  3C19 A;  4HPL B;  4WWP A;  4FA6 A;  3WA0 A;  3A9K B;  1WYG A;  2MJD A;  2KMC A;  4FJZ A;  1SE9 A;  1WGG A;  1ZDV A;  3K9O B;  4O1N A;  1E8W A;  1LGR A;  2KX3 A;  2A4Z A;  2BW2 A;  4EZL A;  3DBL I;  3KLS X;  1B1Z A;  3MJ5 A;  2M4N A;  1YOV B;  2M1M A;  4YWG G;  3DBR B;  3ETR A;  1EF1 A;  3UIP B;  3SFD B;  4KX6 B;  3OG5 A;  3U7D A;  2RDG A;  2V3S A;  3DVG Y;  1A5R A;  3M63 B;  1WMH A;  2IO2 B;  4YSY B;  2QMT A;  1C79 A;  3GZN I;  2ASQ A;  3SHQ A;  4I6L B;  2D11 A;  1I4X A;  5D2M B;  2KMA A;  2N7E A;  2QIE B;  1GB4 A;  1JWA D;  5JHA A;  2WX1 A;  4PYU A;  2BYE A;  3A9J B;  3Q8A A;  4PT5 A;  1RLF A;  2FUH B;  4KSL C;  1D6E C;  1FXT B;  1EWY C;  2W9N A;  3TEW A;  2W3R A;  4WWO A;  5E6P A;  4XGA B;  5L95 C;  4P1C C;  4US9 A;  3ZJV A;  4C56 C;  4W9I A;  3LB8 C;  1M4V A;  1XLQ A;  2DZJ A;  2KDM A;  3AE1 B;  3SFE B;  3AMZ A;  1V1P B;  2JVC A;  1HTO A;  2WGS A;  3JSV A;  1IYF A;  1L2N A;  4GSW A;  1DYQ A;  1L5P A;  2WXP A;  2PKO A;  5H8Y E;  4A20 A;  2KWC A;  4XC2 A;  1TS5 A;  2BS4 B;  5EE1 A;  2LMC A;  1OEY A;  1WGD A;  1J7B A;  5G55 A;  5CTR C;  1BUI C;  4LTU A;  1WY8 A;  3RCZ A;  2G3Q B;  1STE A;  3ML9 A;  4BFR A;  1TT5 B;  3BII D;  4A3O A;  1TYG B;  1GG3 A;  1RWS A;  2K8B A;  4ZOH C;  3AE5 B;  2K22 A;  1N60 A;  4AJW A;  1V6E A;  2MH7 A;  5FKA C;  1FRD A;  3CIR B;  3ZTD A;  2NVU I;  4KZ0 A;  4F8C B;  1K52 A;  3APF A;  4E74 A;  4RH6 A;  4KZC A;  1V49 A;  1FNW A;  1I4P A;  3PRE A;  1DOI A;  2MCN B;  1L6V A;  1HTQ A;  3ZNH B;  4BKG A;  2KDB A;  3VRB B;  1QOG A;  1C4P A;  4LLG M;  3Q3N C;  4ZRP A;  3NY5 A;  4DDG D;  3PZ8 A;  2CS4 A;  4A55 A;  2L8J A;  3KQ4 A;  2KNB A;  4XYC A;  4P6V F;  2KMM A;  3WAM A;  5JH5 C;  4DBG A;  2KLG A;  3Q3J A;  5C1Z A;  4CHK A;  3CWI A;  2GB1 A;  2O6V B;  3KWV A;  3ZUN A;  1UUP A;  2KAN A;  1YJI A;  5EDS A;  3RUL A;  2Z0E B;  2L76 A;  3Q6B A;  3IXS A;  2CR5 A;  2PE6 B;  2FIF A;  4XX5 A;  5AEK B;  1IPG A;  3QA8 A;  1SF0 A;  1WE7 A;  4DK5 A;  2REX A;  2EEL A;  1JWU D;  4DHZ E;  5KHO A;  1IUE A;  1ZP0 B;  3RPF C;  2FUG 1;  4I6N B;  4G3X B;  1DGJ A;  2KWD A;  3Q14 C;  2Y5P A;  1WJN A;  1WGR A;  1MG4 A;  4KIK B;  2KC2 A;  3CMM B;  1QOB A;  3AED B;  2I38 A;  2Q5W D;  4LNN A;  4MSQ B;  4FAD A;  3HUI A;  1ROE A;  5C3J B;  3Q3F A;  1V97 A;  1FNU A;  1KLV A;  2M19 A;  2QHO A;  1J19 A;  3EGR A;  5AUK A;  3H6N A;  2KK8 A;  3M62 B;  1WX8 A;  3O65 B;  3V05 A;  1XLO A;  2I2Y A;  3OJ4 B;  3IFW B;  3IBE A;  4ANW A;  2OOB B;  1JRP A;  1T0R C;  3RD2 A;  2ZNV B;  2ONQ A;  2E6X A;  4ICU A;  3AE6 B;  4WWM A;  2BWF A;  2GBM A;  2IPK D;  1RM6 C;  4HXD A;  1OFF A;  1XF5 L;  2CJN A;  3PZD A;  4WJN A;  2LEK A;  4HLE A;  4OVU A;  3AEF B;  1VZ6 A;  3FIL A;  1WGH A;  4IUM B;  1WXA A;  4GDL B;  2AL6 A;  3H8H A;  3NVZ A;  2LFI A;  2BS2 B;  2D3A A;  4RF1 A;  3ZTC A;  4EFO A;  4WQO B;  1D5M C;  4RM9 A;  2VZK D;  1Z2M A;  1JCK B;  1J8C A;  4C80 A;  4RGN A;  2ZCC A;  3B1L X;  1VRA B;  1WM3 A;  4MGY E;  4IC7 B;  4S0R A;  2K8H A;  4GDK B;  3A33 B;  2J4X A;  3HM3 A;  3RUI B;  3DVG X;  1WFY A;  4M00 A;  1BT0 A;  5TSS A;  4BAX A;  1UF0 A;  2MBE A;  1ESF A;  1I7H A;  3APC A;  4LJO B;  3QC8 B;  1OQQ A;  5CX3 A;  3RN9 C;  1I35 A;  4H2A A;  2IGD A;  3EC8 A;  4HVB A;  3P42 A;  1XT9 B;  2AEH A;  1YQB A;  5AZG A;  3TEZ A;  1ZW7 A;  2H88 B;  3DQV A;  1GB1 A;  1N6Z A;  3RZF A;  5AUI A;  1Q5W B;  2XBB C;  2Z8L A;  2J0J A;  3OAW A;  5C2T B;  4WJP A;  3IT6 B;  4LK0 M;  2HTH A;  4NQK E;  5FR6 A;  3VTU A;  2INP E;  2MSE D;  4P7I A;  2WX0 A;  5CHW A;  3DWM A;  3L4P A;  4IWP A;  1R7S A;  1AW7 A;  2JF5 A;  1MHH E;  1EU3 A;  4BBN F;  1TBE A;  3HVD A;  2BB5 A;  1WM2 A;  3AEB B;  3JW0 X;  4C00 A;  3AE7 B;  4WIP A;  3I3T B;  3UF8 A;  4YSZ B;  2N7J A;  5BO4 B;  2FID A;  2JWU A;  3AUL A;  2MWS B;  1FXI A;  2DZM A;  3RNC C;  4LNI A;  2LGI A;  1GOZ A;  4IKG A;  2RR9 A;  3PPA A;  3EHV A;  2K8C A;  1K50 A;  1KFY B;  4N6E B;  1GUA B;  4MH0 E;  4NAM A;  4K81 A;  1EUV B;  3H7P B;  3HIZ A;  4DQO C;  2AWT A;  3W5V B;  5C23 A;  3EUB 2;  1YN5 A;  2KTR B;  1XD3 B;  2LXA A;  5HHD G;  3P4P B;  2PW9 A;  3MFG A;  4CQN A;  3QK0 A;  3OWE B;  2AL3 A;  2PJH A;  3V61 A;  3AEG B;  2JQR B;  3W9C B;  2WDQ B;  3Q8B A;  4UDU C;  4JLC A;  4M8N A;  4OZC A;  1FIQ A;  3IT4 B;  4B0M A;  4HWI B;  2WU2 B;  1QOF A;  3B0A A;  1V8C A;  3U8Z A;  1EWC A;  3N30 A;  2Y5B B;  2XNA C;  2DWQ A;  1NEK B;  3U7Z A;  1NDD A;  2EMT A;  2HDE A;  1PGB A;  1VDV A;  3IAS 1;  1EF5 A;  2JZP A;  4HCP B;  2V3N A;  4P1B C;  2GRI A;  2MBH A;  1WJ6 A;  1K8R B;  4HKQ A;  2IO1 B;  2C7M B;  2V3P A;  2ZPY A;  2BQQ A;  3QX1 A;  1RRB A;  1N5W A;  1F52 A;  3DOW A;  1HZ6 A;  3A1Q A;  2LGX A;  1L6U A;  3DCG A;  1IGD A;  4WJQ A;  2KOX A;  2JUO A;  2V9H A;  1R4N B;  2IY1 B;  1QIL A;  4E71 A;  4MM3 B;  1WYW B;  1FPY A;  1E0Z A;  3L13 A;  4NPN A;  4MDK E;  3TJP A;  3JYU A;  1J7C A;  2KFK B;  1C77 A;  4IWO A;  4LJP B;  4ZHP A;  4IWQ A;  3AEC B;  4R3D A;  4DHJ D;  1QF6 A;  3A9K A;  3NG0 A;  4YTN B;  3T9L A;  4TV3 A;  1WH3 A;  1Q10 A;  4II3 B;  1JWM D;  2OJR A;  4HKZ E;  4ZYS A;  4WWN A;  4US8 A;  1FNV A;  5IP4 D;  1NBF C;  3E9S A;  4RFB A;  1SE4 A;  4IM2 A;  1WWT A;  4N59 A;  1GNU A;  5LXI B;  3QIJ A;  3C8Y A;  4KKJ A;  4OVV A;  5HKH A;  3PZ7 A;  2BKR B;  1E8X A;  2KFJ A;  2JT4 B;  4AQ7 A;  1KJT A;  1WJU A;  4GOC A;  2L1A A;  4NNJ B;  1L0Y B;  2J52 A;  2E3T A;  2RMM A;  3ZRC A;  4NAW A;  4W9D A;  2MBB B;  1AN8 A;  2ZVN A;  2G9H D;  1HA5 A;  3VXW A;  2JXT A;  2W55 A;  2B76 B;  1GJZ A;  3B9J A;  3TMP B;  2KKC A;  3SU8 X;  4RGT A;  4IDI A;  1MHX A;  2DZK A;  2JRI B;  4J6I A;  2MJE A;  4M8M A;  3B08 A;  4ITK A;  2KLC A;  1C9F A;  4M0W B;  3PHX B;  1SXT A;  4MGK E;  4MSM B;  2HTM E;  2ZW1 A;  4RF0 A;  1MVK A;  3VTV A;  5JXV A;  1KRH A;  4MGZ E;  2KO3 A;  3A9J A;  2DLB A;  2MEK A;  2J53 A;  4N9F 4;  2JXX A;  3R66 C;  1CK1 A;  4EKU A;  2BYV E;  2KD0 A;  3VFK A;  2XK5 B;  4PS3 A;  2G1E A;  2PTL A;  3VQI A;  2LGS A;  2LAS A;  2FE8 A;  3S2A A;  4W9J A;  4OZB A;  3J9C A;  2WXQ A;  1VR9 A;  1SBB B;  1V1P A;  1E8Y A;  3PV1 A;  1LXD A;  1T6B X;  3PRM B;  4GMV A;  2QIL A;  1L0V B;  3ZDT A;  1F9J A;  2KQ7 A;  2OJW A;  3AV8 A;  3A4S C;  1DOY A;  3PLV A;  3QQ8 B;  2XEW A;  1YN4 A;  4XDD A;  2DEN B;  2X38 A;  1BXT A;  1E5W A;  4HJG E;  3T8M A;  4MJS B;  3I63 C;  4RCO A;  2C7N B;  4HJK A;  2EMS A;  2JRH A;  4BOZ B;  5CHV C;  2WXG A;  4EUT A;  2WXR A;  2CJO A;  2QJL A;  5E6J A;  1WXV A;  1TJE A;  1NI2 A;  5GMV A;  1JWB D;  3X23 A;  4YTP B;  3RNA C;  1ZOY B;  2JZ3 B;  1PFD A;  4YL8 A;  3W1S A;  3SEB A;  1SIJ A;  2EKE C;  1VZ8 A;  3ZW3 A;  3AU5 A;  2M56 B;  1C4A A;  4WH4 A;  4AOF A;  1V81 A;  1M94 A;  2INN E;  3RI7 C;  5BMG A;  1SE3 A;  2LUM A;  1S1Q B;  2HE7 A;  3BIN A; 
#chains in the Genus database with same CATH homology
 1QOB A;  3AED B;  2I38 A;  3MHZ A;  2Q5W D;  1AYF A;  1HEZ E;  2AQ3 B;  2DYM A;  3AEA B;  3AM9 A;  1E7P B;  1ROE A;  1F77 A;  3HUI A;  5C3J B;  2LHD A;  5LNK 1;  4DXG A;  1V97 A;  1FNU A;  2M19 A;  4OVZ A;  3LYY A;  4JX1 C;  3EGR A;  5AUK A;  4A8X C;  2WP9 B;  1YJJ A;  1TY2 A;  1A70 A;  1F0Z A;  3V05 A;  1JW9 D;  1TY0 A;  4C7Y A;  1XLO A;  2I2Y A;  2M0A A;  1VJK A;  2WXL A;  1ET6 A;  1JRP A;  1XXG A;  4WAF A;  4XWT A;  2CU3 A;  2ONQ A;  2E6X A;  1WSP A;  3AE6 B;  1D5X C;  2LHE A;  4WWM A;  2IPK D;  1RM6 C;  1GPX A;  1OFF A;  1TS2 A;  1XF5 L;  4C7Z A;  1GAQ B;  3BYY B;  2CJN A;  1UNS A;  1FXA A;  1QQR A;  1AWD A;  5BMH A;  2LEK A;  1ZXI A;  3AEF B;  1IBX A;  1VZ6 A;  1N61 A;  5BYS A;  5FK9 C;  3FIL A;  4N58 A;  4WUR A;  3DWG C;  4GDL B;  1PGA A;  3BYT B;  1I4Q A;  2KQ4 X;  1Y56 A;  3H8H A;  3NVZ A;  2QSD A;  2K3U A;  2LFI A;  3NVV A;  5MPO A;  1FRR A;  2BS2 B;  2Y5C A;  1MPE A;  4RF1 A;  1YN3 A;  1I4R A;  5BMI A;  1SEB D;  1D5M C;  1VZ7 A;  2VZK D;  1SB3 C;  1D4B A;  3W5U B;  1RYJ A;  1JCK B;  2GI9 A;  4TQ1 A;  3GS2 A;  1ACC A;  4C80 A;  4REZ A;  4RGN A;  1C4C A;  1VRA B;  1QKZ A;  1FO4 A;  4GDK B;  2NTT A;  3EA6 A;  1YNT E;  1B9R A;  2J4X A;  3R2I A;  3T3O A;  4TSS A;  3VR8 B;  4A9A A;  4HRO A;  2SAK A;  2V4I B;  5HFY A;  2WXK A;  3BVM A;  3Q8C A;  5TSS A;  1ESF A;  1D5Z C;  1I7H A;  3PO0 A;  3BWU D;  4B0E A;  4NAW B;  3GB1 A;  1OQQ A;  4OZA A;  4H2A A;  5HG2 A;  2IGD A;  4OW0 A;  4JE3 B;  3R2T A;  2W3S A;  3P42 A;  4TQ0 A;  2MJ3 A;  3TEZ A;  1XO3 A;  2IGG A;  2H88 B;  1GB1 A;  1ZUD 2;  1JQ4 A;  1YQ3 B;  2L52 A;  2PMV A;  1WXQ A;  1NEN B;  4YT0 B;  5AUI A;  1L0X B;  2BS3 B;  4MH8 A;  4D2K A;  4FXC A;  2Z8L A;  5C2T B;  4XDC A;  3IT6 B;  4LK0 M;  4NJC A;  2INP E;  3R8B A;  2WDR B;  1NI3 A;  3Q8E A;  1TKG A;  2JX5 A;  3TUO A;  1E6E B;  2PLP A;  3DWM A;  3L4P A;  1R7S A;  1AW7 A;  4A6Q A;  1MHH E;  1EU3 A;  4AS1 A;  2KAC A;  4ZRQ A;  4KGT A;  3HVD A;  2WNM A;  5HI1 A;  2BB5 A;  5FR3 A;  3AEB B;  1ZDX A;  1JAL A;  1N63 A;  3AE7 B;  4WIP A;  4YSZ B;  4RGM A;  1C78 A;  1L4D B;  1E9M A;  2BBC A;  2N7J A;  3KWL A;  1F2R C;  3NVW A;  2JWU A;  2XN9 C;  3E56 A;  1FXI A;  2WXF A;  1ZPS A;  1KLG D;  1UWM A;  2N9K A;  2LGI A;  1GOZ A;  4IKG A;  1OQR A;  4NZL B;  1TZO A;  1K50 A;  4KGR A;  2JU6 X;  1KFY B;  1UWX A;  1XLP A;  4N6E B;  2NTS A;  1E10 A;  2J42 A;  1YQ4 B;  3HVZ A;  4NAM A;  3VRA B;  3LXF A;  1JML A;  2L83 A;  1KTK A;  2ACZ B;  4DQO C;  2TSS A;  3W5V B;  3EUB 2;  4JPS A;  2KN4 A;  4P16 A;  1YN5 A;  3P4Q B;  5BYR A;  1XCQ L;  5HHD G;  1CQV A;  3P4P B;  1FD6 A;  2BTE A;  1SJE D;  2PW9 A;  1TS4 A;  3TEY A;  1PDX A;  2AQ2 B;  3MFG A;  3GP7 A;  4CQN A;  3OWE B;  1P7E A;  1ENF A;  3AEG B;  3U52 E;  2AQ1 B;  1SJH D;  2JQR B;  2WXN A;  2DYO A;  3P1M A;  3W9C B;  4HEA 1;  2WDQ B;  3Q8B A;  4KKI A;  4UDU C;  1KF6 B;  3NUH B;  2JYT A;  1P7F A;  4OZC A;  1FIQ A;  2RPV A;  3IT4 B;  1HQR D;  4B0M A;  1XEE A;  2WU2 B;  1QOF A;  5D7G A;  3Q69 A;  1V8C A;  1WYG A;  2MJD A;  1JRO A;  1EWC A;  2XNA C;  2DWQ A;  1NEK B;  3U7Z A;  1FM0 D;  1ZDV A;  2HDE A;  1PGB A;  4L2Y A;  4O1N A;  1VDV A;  3IAS 1;  2JZP A;  1PGX A;  5EE9 A;  2ICI A;  2V3N A;  2EKI A;  2GRI A;  2WXI A;  4ARI A;  4EE2 A;  2BW2 A;  4DXF A;  1SSN A;  3BK1 A;  3KLS X;  1B1Z A;  3MJ5 A;  4HKQ A;  1V1O A;  2WXM A;  3BZD B;  4KGS A;  4YWG G;  2V3P A;  3ETR A;  1N5W A;  2IJ0 A;  3AE4 B;  3AEE B;  3B2F A;  4KX6 B;  3SFD B;  1HZ6 A;  1YMH E;  2RDG A;  1I4G A;  2WXJ A;  1L6U A;  3I9V 1;  1IGD A;  2N0S B;  4MAC A;  2ZW0 A;  3I57 A;  5BYQ A;  2OHF A;  1EM7 A;  1QIL A;  4MM3 B;  4YSY B;  5H92 C;  1TS3 A;  2QMT A;  1C79 A;  2YEP F;  1RFK A;  1BML C;  1TKE A;  1E0Z A;  2QEJ C;  1FMA D;  3AE9 B;  1I4X A;  1PUT A;  1J7C A;  1SE2 A;  5D3D A;  3ZGZ A;  1C77 A;  1CZP A;  3URY A;  2R61 A;  1GB4 A;  1WRI A;  2K0P A;  2QIE B;  1JWA D;  1UGJ A;  1FFV A;  1K53 A;  3SR6 A;  2D5G A;  3N9Y C;  3U2S C;  3Q8A A;  4PT5 A;  3UI3 A;  4ZHP A;  3AEC B;  4R3D A;  1D6E C;  1EU4 A;  1EWY C;  2JSV X;  1QF6 A;  3ZJU A;  4YTN B;  3TEW A;  2W3R A;  1Q10 A;  4XE0 A;  1F2R I;  4US9 A;  1JWM D;  4TMA B;  1HXY D;  3ZJV A;  1C76 A;  4HKZ E;  4C56 C;  1I4H A;  2NMQ A;  2BB6 A;  4ZYS A;  3LB8 C;  3NS1 A;  3P63 A;  2WXH A;  1M4V A;  1NYR A;  5G5G A;  2FBW B;  1XLQ A;  2KDM A;  3FAH A;  3AE1 B;  4US8 A;  1FNV A;  3SFE B;  3AMZ A;  3E9S A;  3VR9 B;  1V1P B;  4RFB A;  1SE4 A;  1MI0 A;  1WWT A;  3NRZ A;  4N59 A;  3ZYY X;  3C8Y A;  4KKJ A;  3RFZ B;  3PZ7 A;  1DYQ A;  1L5P A;  2RDH A;  2WXP A;  3NVY A;  3WCQ A;  4AQ7 A;  4RGO S;  3ZQ4 A;  2WU5 B;  2WQY B;  2PKO A;  2L1A A;  5H8Y E;  1L0Y B;  1NVI D;  1ZXH A;  1TS5 A;  2BS4 B;  4IOI E;  2J52 A;  2E3T A;  2RMM A;  3FC4 A;  4OHJ A;  5EE1 A;  2LMC A;  1AN8 A;  2W82 A;  2G9H D;  1J7B A;  1HA5 A;  1QOA A;  5G5H A;  2JXT A;  2W55 A;  2W54 A;  2B76 B;  3B9J A;  1BUI C;  3BVZ A;  2IGH A;  1CJE A;  4RGT A;  4IDI A;  1MHX A;  2PIA A;  4LTU A;  4MT5 A;  4YXD B;  2MJE A;  2K9X A;  5I4D A;  1STE A;  3AE2 B;  2H89 B;  4RNA A;  2JYE A;  4ITK A;  1C9F A;  3AE3 B;  3BII D;  1TYG B;  4HRS A;  1RWS A;  4ZOH C;  1T3Q A;  2PVO D;  1SXT A;  3TEX A;  1N62 A;  3AE5 B;  2K22 A;  1N60 A;  1N5X A;  1KLU D;  2HTM E;  2ZW1 A;  3MP9 A;  4RF0 A;  1IGC A;  1MVK A;  2MH7 A;  2BYT A;  4YSX B;  5JXV A;  1KRH A;  5D3I B;  5FKA C;  2KAJ A;  2DLB A;  1FRD A;  5EE0 A;  2LJI A;  1L4Z B;  2J53 A;  2MEK A;  4L23 A;  1CK1 A;  3CIR B;  2SEB D;  5EE3 A;  2G1E A;  2PTL A;  1KH0 A;  4Q2J A;  3VQI A;  2FE8 A;  2WXO A;  1QLB B;  4OZB A;  1K52 A;  3P4S B;  3J9C A;  1T5X D;  1ZE3 D;  2WXQ A;  2DBY A;  4RH6 A;  1VR9 A;  1SBB B;  1FNW A;  1V1P A;  1I4P A;  2YEP B;  4J3O D;  1DOI A;  2OED A;  1VLB A;  1T6B X;  5T8I A;  3B2G A;  1L6V A;  2QIL A;  1FCL A;  1JWS D;  1L0V B;  3ZJT A;  3VRB B;  1QOG A;  1FFU A;  2K5P A;  2WS3 B;  1C4P A;  3ABV B;  3AV8 A;  4LLG M;  4A90 A;  3P4R B;  4ZRP A;  1DOY A;  2N9L A;  1QT9 A;  1YN4 A;  3HRD D;  3PZ8 A;  4XDD A;  2X38 A;  1BXT A;  4HJG E;  4A55 A;  4XWW A;  4YTM B;  3KQ4 A;  3AB5 A;  1J7A A;  4RCO A;  4ZHO A;  4P6V F;  2KMM A;  4GLS C;  4JWU C;  1TKY A;  3TSS A;  2VZK B;  1FCC C;  3Q8F A;  1XLN A;  4M0W A;  2WXG A;  2WXR A;  3CWI A;  2GB1 A;  2WLB A;  3KWV A;  5GXG B;  1LO5 D;  3V3X A;  1UUP A;  2CJO A;  1YJI A;  2AX5 A;  2QJL A;  3AE8 B;  5E6J A;  3AH7 A;  3NZ3 A;  4ARC A;  1K51 A;  1TJE A;  2ON8 A;  3U4E G;  1IBX B;  1JWB D;  3MC0 B;  3IAM 1;  3FIL B;  4YTP B;  3IXS A;  1ZOY B;  1NYQ A;  3O13 A;  2V0G A;  1PFD A;  3W1S A;  1SF0 A;  2L32 A;  3SEB A;  1SIJ A;  2WDV B;  1XCT L;  1VZ8 A;  2EEL A;  1WGK A;  1JWU D;  4JWS C;  1DOX A;  1IUE A;  1HZ5 A;  1ZP0 B;  2BT6 A;  2M56 B;  3RPF C;  3T3N A;  1PYW D;  2FUG 1;  1C4A A;  4WH4 A;  1DGJ A;  2IDY A;  2KWD A;  2PVG C;  2Y5P A;  2INN E;  4WQM A;  3AN1 A;  4L1B A;  5BMG A;  1SE3 A;  2LUM A;  3BVG A;  3BK2 A;  3W2D A;  2Y3A A;  4USA A;  1FEH A;  1ET9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...