5D3DA

Crystal structure of staphylococcal superantigen-like protein 3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
190
structure length
190
Chain Sequence
KYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQLKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal Superantigen-Like protein 3
publication title Structural basis for inhibition of TLR2 by staphylococcal superantigen-like protein 3 (SSL3).
pubmed doi rcsb
source organism Staphylococcus aureus (strain nctc 8325)
molecule tags Immune system
total genus 53
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5d3dA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5d3dA01
1V1OA 1FNVA 1EEFD 1S5BD 4RHSA 1I4GA 1S5CD 4DXFA 1CK1A 2AQ3B 1QILA 5FK9C 2XRQD 1BCPC 1ESFA 5D3DA 3V05A 1PTOF 1SJHD 4K6LA 1LTTD 1KTKA 1HA5A 3GP7A 2XRSD 1LTBD 1PYWD 5I4DA 1SJED 1PTOH 3BYTB 4Z9CB 1JWSD 3KLSX 1CHQD 1B1ZA 5ELBA 1EFID 1I4RA 1I4PA 4OHJA 1RD9D 1JR0D 1FGBD 3EA6A 3DWPA 1GOZA 1HTLD 1BCPB 1LT3D 1LLRD 1FNWA 2WV6D 1KLUD 1V1PB 5TSSA 1D5XC 1RCVD 2NTTA 1ENFA 1G8ZD 1LO5D 2RDGA 4RFBA 1ET6A 1T5XD 2SEBD 4RHRA 4C56C 1M4VA 1UUPA 1SE2A 1SXTA 2ICIA 1LTID 1LTAD 4ZYSA 1LT6D 1YN3A 5D3IB 1D6EC 2TSSA 4BWGB 1TS5A 2R61A 4L63B 4NZLB 1BCPF 4RGOS 1KLGD 1JCKB 1LTGD 2RDHA 3O13A 3MFGA 1S5DD 1JQYD 3DWQA 1YN5A 4DXGA 1PTOD 1PZJD 2CHBD 1MD2D 4TSSA 1CT1D 3EFXD 1DJRD 1HXYD 1TY2A 4RCOA 2QILA 1PRTC 1RDPD 4RGNA 1HQRD 2AQ1B 1SBBB 1D5MC 1JWUD 3URYA 1LTSD 1PZKD 1EU4A 1S5ED 1PZID 2IJ0A 3OWEB 1CQVA 2XN9C 5ELDA 1XTCD 3CHBD 3MC0B 1EEID 1PRTD 1SE3A 4RH6A 1L0YB 5ELEA 1PTOC 1D5ZC 1AW7A 5ELFA 3TSSA 2NTSA 1YN4A 2XNAC 1CHPD 3BZDB 2G9HD 1PRTB 1BXTA 3R2IA 1I4HA 2IPKD 1FNUA 3DWAA 1FD7D 3R2TA 1B44D 4RGMA 1I4QA 1UNSA 1TS4A 3R8BA 1TS3A 1STEA 4UDUC 1XXGA 1SEBD 2J4XA 3BVMA 4RGTA 1PTOB 1V1PA 1LTRD 1DYQA 3BYYB 2O2LD 1L0XB 1RF2D 1ET9A 1TY0A 4L6TB 4O1NA 3W2DA 1BCPD 2AQ2B 2QEJC 1LT5D 1EWCA 1SE4A 1AN8A 3BVGA 1S5FD 1EU3A 5ELCA 2Z8LA 3SEBA 1LT4D 3BVZA 1I4XA 1PRTF 5FKAC 1TS2A 1F77A 1JWMD
chains in the Genus database with same CATH superfamily
2L0TA 3BS1A 4NAWA 3IRBA 4J8QA 1V8QA 3PIP3 3V3XA 2P5ZX 3I4MB 1X55A 4JV5L 3AE5B 5IYDH 2KD0A 4WAAA 4HKQA 2MP1A 3SK4A 1C4PA 2E5LQ 3OYYA 4RMAA 4BZAA 1ESFA 3LWUA 4PZ7A 2RGFA 1AH9A 3WDNA 3ML8A 1FRRA 3STBC 1GHKA 2Q8TA 4ZHPA 4E74A 3NUHB 1XPUA 4XYCA 2GBJA 1Q82C 3KF8B 5I4DA 1PA6A 4LF7Q 4TQ1A 4PZ8A 4MGZE 1UBQA 2QIEB 5IYBG 3HS0C 4NXML 2MNAA 1SNQA 5C0XJ 4LF8L 5JJLA 2JZPA 4DUZQ 1C78A 4RKBA 4B0MA 2X8XX 4A3BB 4MIUA 1W6JA 4DV2Q 4GZYC 1Y1WH 2F4VL 4LNKA 1ZP0B 2PYKA 3D0FA 2I1JA 1GC7A 1OXUA 1PV4A 2BH8A 4XWWA 4LW1A 1MI0A 1TGZB 1SE8A 1NE3A 1ZXIA 2IL8A 4ZAIA 2M9VA 4BBRH 2D3CA 1QOFA 1ZYRC 1N33Q 2ICEC 1M4VA 4N9PA 1T0QC 5IP4D 2RCFA 2ICIA 4DAYB 1PXUA 4RWSC 1TWAB 5EDSA 4R4QA 2L1AA 1NSNS 4LJZC 1YN3A 5DM63 1HR0W 5HGQA 3QIJA 1V1QA 3BZKA 2GBRA 4KN7C 2K5VA 3J7A5 4IFDG 4DV4L 1AE2A 4ZUJA 4RGOS 2EZVA 3S9WA 4DFAA 2C60A 4DHJD 2N4FA 1GG3A 1B7YB 1LM0A 1KIXA 3TIXA 4F1SA 1DJRD 2G9DA 4G4KA 3G6EA 1B3AA 1CUKA 2L12A 4A3MG 3GTQB 2PMVA 3TQYA 3MZ5A 1VQ7A 1U4RA 3QC8B 1LTSD 4WJWA 5JH5C 1XNQL 4IW0A 3CCUA 1HHVA 1NDDA 5BYQA 1MIUA 3CC7A 3KVFB 3R7RA 1UF0A 1WOCA 1MSGA 4JCVE 3P63A 3AEDB 3Q3NC 2JP1A 1K73C 4ANWA 1QE6A 3QA8A 3S1MH 1XYIA 5EPJA 1Y1WB 4LNQA 1LFDA 4XIGS 4L8JA 1SE9A 3TEYA 1X56A 2F4VQ 4L5SA 3S2DH 1WJ4A 4HJGE 1ML0D 4XTCS 5I6YA 2H5XA 2KEEA 3KJOA 3NEMA 4HDQA 2V4DA 4YWKA 1ISNA 2EYMA 3AECB 4K14A 3VVWB 2F0QA 4A3LG 4BXXH 2N9LA 4W9KA 5FO9B 1WI0A 2QA4A 2L76A 1TTNA 1GVPA 2ON8A 1SSNA 4URKA 3DBHI 4GSWA 5KYIA 4GOCA 3WA0A 1N34Q 1SNOA 1X3QA 1P98A 2K4KA 2ZTCA 3HFZB 5J22A 3T1HL 1LT5D 4AJYB 1PYBA 2BS2B 4NXMQ 1K3BC 2D3AA 2IGDA 2MHJA 1Z6HA 2ZXPA 4LF8Q 3RYTA 4DXAB 5LL6S 3GD7A 4J15A 2VW9A 2ZTDA 1ESRA 1EF1A 4N6EB 3P1MA 1WTXA 1EY9A 2PVGC 2YU9H 4XDXA 3M7NA 3VYUA 3V6EB 1FL0A 2F0GA 2B2WA 1MJEA 3O65B 3TL5A 5C3EH 3P20A 2CKZB 3GP7A 4FYDA 4X57B 5EKIA 4RAUC 1WTOA 4ICUA 4ILWA 4DV1L 1F2RC 3S1MB 2V1CC 1BUIC 4YCVA 4WJ4A 2OXPA 2DAFA 1X9NA 3I3CA 4Z9CB 1WTRA 3CCRA 3KLSX 5ELBA 2BKFA 3E0JA 4LFBQ 1I4PA 2EOTA 3TP7A 2KDIA 2RCNA 4YT0B 3QQ8B 1LABA 1S3SG 1WXMA 2KA7A 3J81E 4KKIA 4N9TA 4DGZA 2H4OA 2Z4IA 4DV4Q 1TYGB 2R3ZA 5EE1A 4P73A 3PIOA 4FXGC 4HJ7A 1N60A 1X1MA 3T56B 2O6VD 3Q23A 4NKLA 5NUCA 5IAAC 1WIAA 2PE9A 4II2B 1JJGA 3A5UA 5JJIA 2UU9L 2B8FA 3H91A 5JJZA 5M5WH 3BDCA 2K39A 2NYZD 4BY1G 3I91A 2LS01 4C4VB 4YHHL 1FJGL 2PQEA 3RN2A 4TQ0A 1LT6D 5FLXE 1NMFA 2B3AA 4AWJA 2OQKA 3JC66 1NBFC 3DBLB 3QHTA 3SDZA 3OW7A 3DBRB 3PTFC 5KHOA 1WFQA 2JQRB 2YU9B 4C7YA 3PPAA 3MHBA 4TV3A 1GUAB 3OJ3A 2EDGA 3VYRA 4IUTA 1WZ3A 1NJIC 4L23A 1MD2D 4YWMA 2NCNA 2BF8B 1HXYD 3H3VH 2F0JA 4IPCA 1K8RB 1ZPSA 1HTQA 1FXIA 4YL8A 3S24A 3K5NA 4HVBA 1IZ6A 3C1FA 3NVZA 4B3TL 3H0GG 1WRIA 3MC9A 1GB4A 2OCEA 3LNNA 1SFOB 2GBKA 1E8XA 2WNMA 2ONQA 4GDKA 1DOYA 1R4NB 3B08A 4OELB 4BY7H 1A62A 2JA5H 5BMIA 3K59A 4RH6A 4A3EG 5MPOA 2Z6KC 2R93H 1DM0B 3AE8B 2A69D 1K8AC 3T1HQ 1N8RC 1FNUA 1B50A 4HJAA 4JWSC 2CCZA 5CV5A 1DGJA 5M5WB 2KENA 3OJ4B 4DNTB 2LUEA 2JYTA 3I5JC 4C2MH 4IJLA 3JSVB 1PTOB 2JXXA 3L4PA 2KHIA 2PQAB 5C4XB 3W2DA 2MGSA 2AQ2B 4GOPA 1S72A 4LJOB 1Q86C 1YEZA 1L4ZB 2M0AA 1SE4A 4LUOA 1VQ9A 3T3OA 3BVGA 1S5FD 5M5YB 3NG0A 4IPDA 3RZOH 2B76B 2G3QB 4MTNA 4N9F4 1I50H 3PGEA 3U30A 2MPMA 3PZDA 2LXKA 1Y8RC 3S1RH 3CQZH 3M4YA 4HPLB 1BBWA 3HKZB 4PYUA 1XF5L 2JSOA 1QILA 2DYMA 1R9TB 2PW7A 4G7ZC 1IGDA 2E75C 2Z0SA 4MGKE 4MM3B 4BY7B 3ML9A 4HCNB 3VFKA 2AUKA 4EFOA 4TKOB 2PZWA 3K80C 5GQOA 1Y1VB 3NTIA 3Q14C 1NAPA 3W5OA 2UU9Q 1VZ7A 2K3UA 3S1NB 2OOBB 4IJHA 2KCNA 5IOCA 2GRIA 5CV4A 3I4NB 1ZEQX 4YHHQ 3ZXRA 1VQ4A 2REXA 3HOWH 4QJFA 2DLBA 3FPUB 3OSOA 1CTMA 1U4AA 1HZCA 4TUUA 4BOSC 2KQSA 2R7DA 2JA7G 3QO2A 1V1PB 4WJNA 1G2TA 3PV1A 1CZPA 4C2MB 1NR2A 3IKJA 2PJHA 3W1SC 3HUIA 2D62A 4P71A 4NPNA 1FVIA 2K14A 2LJ5A 4MJSA 1SDFA 4KGRA 3NVYA 4BKGA 2GBNA 1AYFA 3Q69A 3UDFA 2K28A 2MHVA 2JYOA 4WFN3 4ZQ3A 4DR1L 4B3TQ 2IY0B 4RMFA 4FXCA 1H9RA 2QF7A 3HZXA 1I6VC 5J1ZA 3RZOB 3E56A 1I50B 1XMQL 4BWGB 4W9HA 4GN1A 3CCJA 4NJCA 1E1TA 4ZRPA 5K5PA 1KLGD 3D6WA 2RDHA 2F0OA 1GHJA 4CDFC 3HVDA 2DNCA 1CM9A 2F0DA 4DR7L 2VH2A 3V62A 1PGBA 4M0WB 2DUDA 5KYLA 2M56B 2CHWA 2KHSA 4XZ4A 4IUUA 3AB5A 1OO9B 2KJRA 2L5TA 2N1WA 4N58A 4IZ8A 2DNEA 1HQRD 4C00A 5M3FH 1D5MC 1JWUD 3UI3A 1XLQA 3L08A 1D3ZA 1UBIA 2GBMA 3IFTA 3I90A 2JJQA 2XN9C 4OGQC 3CCEA 1VDZA 3I7FA 5CORA 4YCUA 4HJ5A 3HOWB 2LD9A 3K5MA 1JB7A 4K0KL 2I2YA 2K25A 1IKLA 1E24A 3MTNB 2NTSA 2C9WB 4RCNA 5JJKA 4CJ0B 3DBLI 1WXAA 1WXVA 2HJ1A 1CKNB 1KAAA 1W3SA 3X3NA 3DBRI 4EUTA 3VR8B 2RF4A 4OWTB 2ZPNA 3TP8A 1VQPA 5IT9L 4C3JH 4J3OD 2E2JH 2N8NA 1SEBD 2AWTA 2CR5A 4ULLA 1ZKOA 5C0XI 1QJOA 4AYBB 2B2UA 1IL2A 3B2FA 3Q24A 1J7AA 3FC4A 3KYCD 4PNYA 1OGWA 4NP5A 4RKLA 1KOTA 2G4SA 2BPSA 2O2LD 3M4PA 2AWNA 4HJ9A 2VH1A 3DVGX 5HKHA 4POFA 2FCSA 1TT2A 4IC7B 4RF0A 1KHIA 1R4NI 5GAHC 4MELA 1X65A 1Q46A 1I4XA 5G55A 4DNRB 3NQTA 1L0WA 4MH0E 2QHOA 2O4XA 3PT2B 4BBNF 2XWJB 1XJVA 2F0PA 2RD0A 2F52A 1YIJA 3EN2A 3BINA 3T9LA 5JXVA 1VQGA 5M3FB 5LXIB 2JT4B 1QUQB 2QDBA 4IO9A 2F3WA 2HDLA 1V9PA 1CFMA 1SYCA 3TN2A 2I07B 4UP8A 1YBYA 1VCBA 3UIPB 4UAIA 5LHY1 4B9KA 3K5LA 1PYWD 2JVCA 3PO3B 2I0QA 3TBIB 4KLKA 2ZJDA 4LF9L 3QK0A 4DR1Q 3J81i 4I7AA 3I70A 1EY5A 3RZDH 3R7QA 1I4RA 4B9XA 3NWSA 4DK0A 1WM2A 3CSFA 3TCAA 4C3IH 1XMQQ 4FF2A 5JHAA 2K5WA 3PMFA 2WB1B 2E76C 2K05A 2CJOA 4ANVA 2BA1A 2DZJA 2YEPB 4HDOA 4CO7A 4POGA 1EFWA 2KFJA 1RFAA 2WACA 1KLUD 3I73A 2KYWA 3PVLA 4US8A 4PMBA 1YQ3B 5BN5A 1IBXA 4DR7Q 3QX1A 4XT1B 1ENFA 4IALA 3G71A 2VB2X 5FLMH 3KFUA 2WP9B 2RDBC 4JOIA 4K1RB 4N8X1 2JRHA 2LVQA 4L1BA 3A9KA 2F0LA 1MJDA 4K8IA 1C1YB 3A9JA 1I42A 1LTAD 1HZ5A 2MO1A 2VRRB 3CMAA 3B0AA 4WWPA 1IW7C 2MBHA 1I7HA 4JWUC 3M63B 3ZDMC 1VZ8A 3K9PB 2JQOA 4V190 3AI5A 1GUGA 3M7GA 1JCKB 3O13A 3NXWA 2NPTB 1E7PB 4EX5A 1WTHA 3GQBA 5JVG3 3LX0A 3VHTC 2W55A 2R92H 1N32L 4DDID 5M3MG 2SNMA 3APFA 1HR0Q 1PFSA 2QILA 4LAAA 4R8IA 2A5UA 3NS8A 3C1EA 2A5HA 2HCIA 2K52A 2OHFA 4HCEA 4MSMB 3HOUH 1YJJA 2A69C 2F0EA 2BYVE 1O78A 3ER0A 3PHWB 4FDBA 3S2AA 1C3TA 2ZNVB 1M90C 2DZIA 3D4DA 3K58A 3RZDB 4A3CH 2EJFC 4OO1I 2KDEB 3I63C 3FKYA 4PG3A 4DR4L 4QAYA 1YN4A 3PF4A 2Y0SB 2OT2A 2DENB 3C19A 1GJZA 1VQ8A 2LFIA 2LKVA 1SN8A 1WE6A 4XWTA 1T3QA 2CW0D 3IL8A 5C2TB 4RGMA 1YNJD 4J1MA 1Q5WB 2LJIA 1IYUA 2KTRB 1SIFA 4W9DA 4PS3A 1SNDA 3SK8A 1GPXA 3OMGA 2HQLA 3BVMA 3A56A 1JQ4A 2L8JA 2L15A 3ERSX 3KDFB 5C5LA 2ACZB 1O7LA 1RJTA 3VDYA 1QOBA 1QOAA 2J52A 2JYEA 1EIGA 4KGSA 1FGUA 2F0MA 3AB9A 4IWQA 2BYEA 2B39A 1FYCA 5IP9G 5JAVA 2KFKB 2LGYA 1EWCA 4DR2L 3AM9A 3EUB2 1NYRA 4ZRIA 3QG1A 2ZJRA 1P16A 1PRTF 4LF9Q 2R92B 1E5WA 1JICA 1JWMD 4LNIA 1E3PA 3GTGH 2DJGC 4HEA1 2NBFA 4JI5L 2MSED 2L55A 4RHSA 1J19A 2AMCB 2JZZA 1WSPA 1ZUD2 4DXFA 1N61A 3V60A 4Y7NH 1Q1OA 5FK9C 5FOBB 3NBHA 3K6OA 3HOUB 1SF0A 2WAQE 3AE2B 1N6ZA 2N9EB 2CFMA 1TZOA 1TKGA 1SJHD 1A2TA 4A3DG 3P7JA 1B9MA 1VQBA 4U673 2WXKA 4K5XA 4YXDB 3R93A 1UWXA 5CMDA 2EVBA 3ZNZB 3FKIH 2KN5A 2WKDA 1JWSD 2JPHA 2KO3A 5J18A 2D2CC 4ARIA 1J9OA 4R4IA 3PUYA 1FGBD 2SOBA 4P2CB 2DYBA 3IT4B 4AJWA 5IA7A 2WAQG 4A3FG 2MEKA 1WYGA 4A3IH 4A3JH 1XQQA 2E3TA 3U4VA 4P7IA 3VUYA 4I65A 4AOFA 3VR9B 1N32Q 1WGYA 2JA6G 1UE1A 5C44B 1G91A 4C3HG 2A68C 4K2KA 3DPDA 2IW3A 4QY7A 1YHAA 4C56C 4DK1A 2MRPA 5C1ZA 1EYAA 4ITKA 2RSUA 4PK1A 1X3GA 4MACA 2E2DC 2D3GA 4DR6L 4NNJB 4FHKA 1SYDA 3VRAB 1OQYA 2BCOA 2ZJQA 4RM8A 3GTGB 1L1OB 4ZRZA 1D7QA 2WINB 4JGHB 4MZ9A 4DR4Q 2WXFA 3CPWA 2IYDB 2WDQB 1GC6A 3K7AH 3MFGA 4Y7NB 2C7MB 4MDKE 4YCWA 1EIHA 3OWFA 1DCZA 4XDCA 3ZQ4A 4X66L 4B3SQ 2R7ZH 2OEDA 3S15B 1C4AA 3APDA 1LYLA 5LNK1 1Q12A 4X6AH 4Q5VA 3PO2H 2B8GA 1WXSA 3H6MA 4RGNA 2KCCA 3I4MG 1JB3A 2BTEA 3FKIB 4HSVA 2RMMA 2XIWA 3RNEC 1WGGA 1BQQT 4LNOA 2YVCA 2ZTEA 3FAHA 5LXHA 2ZW1A 3VA7A 2HD3A 2IGHA 1SE3A 5D65A 4A8XC 2NZ1D 2QCZA 5IP7H 2KDBA 1SYBA 4GS3A 4B3ML 4GIVA 3ECIA 3IXSA 4DR2Q 4A3IB 1JOKA 4A3JB 3QR8A 3CP0A 2C7NB 2DJFC 5ELOA 4KZCA 1QF6A 4DWFA 1BXTA 3R2IA 1IPGA 4TMAB 3ABVB 1VQKA 1FD7D 3H7PA 2NMQA 1VS0A 5JVH3 1TS4A 5IO9A 5GROA 4A3KB 4JI5Q 5EE3A 2VUMH 3M4OH 3RZFA 3H1UA 3ND9A 5EKKA 1UEAB 3HOZH 3N32A 1CSPA 4RGTA 2BH2A 3HEJA 1L0XB 4JL9A 5IYCG 1ET9A 1QQRA 1YNND 3EJIA 2K6DB 2DZKA 1L2FA 3DHGC 2KBNA 1WI5A 4L5RC 1AN8A 4ZOHC 3K7AB 3J80c 1QNUA 3BVZA 3PV0A 5GADC 1FFUA 2KWDA 4JW0A 1F1HA 2VZKB 4B9WA 4JX1C 3WALA 1L2NA 1IHZA 3J81L 4ZK9B 4DV6L 3PO2B 1WRDB 1XCQL 3V6CB 4DHZE 1LV9A 2QJLA 1FRDA 3KUPA 2XK5A 4FO2A 1OTCA 3S1QH 4MEMA 3RFZB 3TEWA 3CPFA 2B2YA 3AE9B 2K5DA 3QWNA 1Y8NB 5FO7B 4NXNL 2HDEA 3KUZA 2UXBL 2YLMA 1G51A 1VF7A 3ZJYC 2NVXH 5BR8L 1L7YA 2HIXA 4HAEA 5JPMC 2KMMA 1ENAA 2EQSA 2UXDL 4FJZA 5AJ3L 1SR3A 3P75A 3LGJA 4P6VF 5D2MB 5D6JB 2Z0EB 2WU5B 2WKCA 5FLXL 1G291 3HM3A 2EYFA 2K32A 4DR6Q 3C46A 2NBVB 2BB6A 4FJVB 5IIFA 3H7SA 1WGDA 4F87A 1U4PA 2K75A 3DWPA 3CCQA 4CGYB 1A3UA 4AQ7A 1LLRD 1Y1WG 3C0RB 2VUMB 1GUOA 3M4OB 1D1IA 3BU2A 1EQVA 4IKGA 1NBWA 2INPE 3OW2A 4X66Q 1WTPA 1EIFA 1KFYB 4LWCA 1IXRA 2DY7A 2G5DA 5G3LF 3ICEA 2V3SA 3AE4B 3LB8C 2KHJA 1Z7TA 2J42A 3T51B 1K8OA 5CBEE 4JVZA 2EKIA 3KYDD 4ZDVA 3RN5A 4YIJA 1G6PA 1KLVA 4QB4A 3JAMc 4EKUA 2UYZB 1XWEA 3HOVB 3PQIA 2V0GA 5A35A 1QB5D 2K8CA 1CJEA 1OEYJ 1AWDA 2R61A 5C23A 4GDLA 3T3NA 1T0YA 4GNXB 1S5DD 2VY3A 1WTQA 3E3XA 2DN8A 3S1QB 2BGFA 3WIMA 3LDZE 3RT3B 3K5OA 4K5WA 3V96A 2J53A 4NAWB 4D2KA 2MBQA 2KOLA 1HH2P 2B63G 4P72A 4X3SA 2WXJA 4P1BC 2NVUI 1K28A 1XNRL 3ZRFA 4XE0A 4LJPB 3DCGA 1HUMA 1WR6E 1NI2A 3ZTCA 1VQLA 3NRZA 2A8VA 1VQFA 1FIQA 4A3GH 1EEID 3MVVA 2DY8A 1P7EA 2CW0C 1C0AA 2M4NA 3VAWA 3X0WA 1YNJC 1PTOC 1AW7A 3J80E 2K22A 2LRUA 4OVZA 5I2YA 2INDC 1PH9A 2WX1A 1LGRA 4A93G 3QOJA 2C7HA 5JHBA 1VR9A 1GUNA 3PSEB 4GDKB 3DWGC 2KC1A 3VTVA 2LHEA 1I4QA 2V1YA 4N8FA 4RF1A 3ZNHB 5C6AA 2KT7A 4UDUC 4DV6Q 2MH7A 2WYQA 3VDZA 1I35A 5JPNC 1ZXHA 4BXXG 2CU3A 5DCNA 1JALA 4KGTA 4XQJA 1LTRD 1DYQA 2B2TC 5EQ0A 4A20A 2PI2E 2UXBQ 1L6VA 3VH3B 3AH7A 4IG7B 1F9PA 2M1MA 3UI2A 2UXDQ 2PCFB 3JW0X 1W6KA 5AJ3Q 2YV5A 2GI9A 3M95A 4A76A 5AFWA 1QLBB 4WWMA 3W1BA 1FFVA 1WE7A 4OL7A 2EKEC 2QCPX 2YYZA 1RHPA 1HFNA 4AIMA 4NAMA 3VUXA 1IBKL 4KKUA 2D0PA 3LXFA 4LK1C 3K0XA 4BBRB 2RPQA 1KAWA 1KXLA 4GOPB 3M85A 4JV5Q 1NYQA 4FN2A 2EPBA 5C0XG 1HA5A 4A3GB 3NP8A 1PH4A 2F3VA 1V5TA 4X3TA 3IG3A 3M3JA 3A54A 5L37A 3UDIA 2F0VA 1V86A 5KNBA 2DGYA 2O5IC 3DHIC 3HHMA 5CV7A 2F0IA 2JF5A 4IFDH 3I4LA 4UHVA 1SNMA 5LMUL 1KQSA 4IWPA 1Q8IA 1SLJA 2JXMB 2WFWA 2ZXOA 3U9OA 2NBWB 3BG3A 1J7BA 3HOYG 1NEKB 4YY3L 3KQ4A 2A73B 1KDCA 3TREA 1V80A 4DNIA 2WV6D 2KXJA 4W9GA 5E1FA 3KWVA 3ZNID 4R1JA 4XX5A 3RLFA 4A3MH 4I7ZC 5G5GA 5HY6A 4HSPA 2RDGA 1JMCA 1H9SB 3NPPA 1AZQA 2L05A 1BMLC 2NN6G 3PCOB 2MQJA 3DDCB 5KRUA 3GV3A 3OHXC 2WGSA 2EXZA 3NS1A 2HUGA 5J17A 3E0EA 4UP7A 2ZEQA 5CTRC 4HIOA 3ZW3A 3HKZE 4KY6A 1XNRQ 2PO4A 5D3IB 1FD6A 3AN1A 2LFNA 2PEAA 1OFFA 5ELNA 4JI0L 1VQCA 4DPGA 3S2DB 5C4XG 2IGGA 4QQBX 4HEDA 3ZDTA 2JEBI 1BCPF 1R7SA 1RIPA 3A7AB 3D4WA 4O0AA 1QNKA 2KWVB 3D3RA 5A2QE 3KH0A 2CHBD 4XGAB 3BIID 4AQYL 3KF6B 4A3LH 1AEXA 3D31A 4HMJA 1D4BA 1X6OA 3HKZG 1Y69U 4RM9A 1F2YA 2BKRB 2R6GA 3GTKH 1EU4A 5FJ8G 1HTOA 3AE7B 1O7YA 1STNA 1UE7A 4ZRJA 1QCBD 1XNQQ 2VXWA 4EEWA 2KN4A 3AEBB 2E2HH 5ELFA 1V6EA 1Y1VG 4YTMB 2CWPA 4ZRQA 1UELA 3UQBA 2KCTA 3KW5B 3KF8A 1K83H 1RTNA 4W9FA 4NJ6A 3I4NG 4XQNA 4M01A 5C3WA 5I9OA 4DBGA 1SNCA 5G3LD 3RMHA 5BYRA 5FR3A 3TMPB 5G2NA 4ID6A 4K2LA 3CCSA 2D07B 3K9OB 3NVWA 3VTWA 4QUCA 2FFKB 1YNNC 2YTXA 5C3EB 1IBKQ 1H9JA 1STEA 4GN4B 1E9MA 4ZYNA 3MP9A 2KK8A 1PH5A 4TQUS 3OLMD 1YJ9A 3I56A 1I6HH 3VR6A 2WDVB 5I9PA 5T1IA 3DVGY 1YX5B 4WAFA 1X3EA 3HM6X 3NQIA 2VZKD 2N0SB 1PYSB 2EY5A 4ZLTF 2QEJC 1E0BA 4OO1G 4ASWC 1WGHA 3EC8A 4PYZA 1TWFH 1XT9B 1BDOA 1UAPA 2I38A 2EY2A 3P4PB 2EE1A 1MVKA 1I3QH 2BDNA 5LMUQ 2C5LC 2GLSA 3GS2A 2K50A 4OZAA 4YTNB 4YY3Q 2MJ3A 4CBVA 4G50A 3GTKB 4R4OA 1EL0A 1II3A 4X64L 4DK3C 1TKYA 1JW9D 2BB5A 1BR9A 4BKTA 1LTBD 3T8MA 2FCMA 3Q6BA 1SMXA 4BA1I 5BYSA 5TR5A 4DA2A 1A63A 4GLXA 1F9SA 2LEKA 2Y5BB 3BYTB 1K83B 4XC2A 4DV1Q 1GD7A 3ULJA 2PVOD 3HOWG 3MEFA 4JI0Q 2KAJA 3UGBB 5JEAJ 1WX7A 1WJ6A 3ENEA 3CW2C 2BOSA 3AQQA 4PZ6A 5IGCA 1E8YA 4WORA 2DBYA 2WXPA 3RLOA 1RCVD 4DV3L 1I6HB 2K8HA 4S3SA 3RNBC 4RFBA 2AX5A 2ATWA 1GUSA 3PUVA 3M62B 3ZUNA 4AQYQ 3DM1A 4DQOC 1YD8U 3DWMA 3PRPB 4QUFA 3DQVA 2JA5B 1NVID 4A3EH 3GTOH 1LTID 3D4RA 2R93B 3WCQA 4CHKA 4MT5A 2RKSA 1FO4A 1J8CA 4DAVA 2UU7A 1TWFB 3N3KB 1HZ6A 3BK2A 1IBXB 1H9MA 1A2UA 3MEHA 1L6UA 1FJGQ 2ZNVC 1I3QB 4QIWB 3FILA 1TWHH 2IO3B 4LFCL 4BA2I 3J9CA 3L13A 4H44C 5IGEA 4LDTD 3ZVVA 3KYHC 3ZTDA 4DAMA 4YWLA 3A9KB 3AV8A 4JI4L 1VRAB 2ZJPA 1IUEA 3A9JB 4KHPL 2LASA 3U58A 4WWNA 3F8TA 1Y14B 1H4RA 1LM8B 2IY1B 2KECA 4ODGA 1I94L 1C4CA 2N9PC 2RVLA 2AQ1B 2G1EA 2CQAA 2KZRA 2OJRA 2ES2A 2EY1A 4DAPA 1D2BA 2WXQA 1DOKA 3OTOL 1WD0A 2JEAI 3RNAC 1RLFA 1JWAD 2QMTA 2QW7A 3AULA 3R3OA 3J80i 4ICVA 2Q5WD 3GTMH 4G7OC 1I5FA 1QOGA 3TSSA 2QGQA 3KUDB 3PO3G 4OVUA 1WH3A 3S1RB 3CQZB 3D8GA 3PLUA 2EJGC 1DZ1A 1BNZA 1JMLA 3AU4A 1WWTA 3UE0A 1UWMA 3KOJA 2FE8A 2PW5A 1HCZA 1KNEA 5C4HA 2A6HD 4PMCA 4LTUA 2KANA 1STGA 1RKNA 1EUVB 4A3EB 5EBDA 5M5XH 4DUYL 3GTOB 4MNOA 3R3MA 2NVYH 4OXPA 4Q2JA 2LY7A 3HGBA 5IGDA 2F3IA 4JYAL 4MH8A 3HG9A 3T53B 4AS1A 1BCPD 3NTKA 1F9QA 3CWIA 4KD3A 4JE3B 2HT1A 4IFDI 1XLOA 4PMWA 2Z8LA 1BBXC 1L0VB 1LT4D 1ZOYB 4K7UA 4R3DA 3DEPA 4ARCA 5DPSA 2BBCA 4C4VA 3MXNA 2OQ0A 2JA7H 3AE3B 1A0IA 2NVTH 1PMRA 4CYEA 3AFPA 4JBMA 1BT0A 2JU6X 1EQTA 4DV3Q 2LMCA 4DKAC 2LUMA 2PI2A 4N59A 5IGFA 1WVLA 3GTMB 5H1SE 3W1GA 3NK9A 1WMHA 5JEAH 1XCTL 2JA8G 2LRWA 2XBBC 2J0KA 4A55A 2ID0A 2K6QA 3A4SC 3TS0A 5K36H 4DR3L 4BBSH 2A19A 3L2PA 3S17H 1HZ9A 1B1ZA 3L54A 3OG5A 4L2YA 3NBHB 4OHJA 3NUCA 4HIMA 2IO0B 1T6BX 2N1VA 1CKMA 2KLCA 2MBOA 4OONA 4WJQA 4LFCQ 4CKBA 3NJTA 3P4RB 1GUWA 4IM2A 1IYJB 1TIID 1L1OC 3A1QB 1HZAA 4BOZB 5M5XB 1HPCA 2C5CA 4JI4Q 1H95A 3PIO3 4KHPQ 4YSZB 3C8YA 1I94Q 3CAMA 2B3GA 2KC2A 3SR6A 3AEEB 3BY4B 1GNUA 3S16H 4NPSA 5CX3A 2L52A 1DGSA 5HFYA 1YZ6A 4JI1L 2KMAA 2MUYA 1B53A 1QZEA 3RCZA 1JJ2A 2JA7B 2JXTA 1YJWA 3JSVA 3A7LA 2NVTB 2PQAA 3APCA 3TEZA 4F7ZA 2MP2B 4HK2A 1A6XA 4OZBA 1EZ6A 2HDMA 1N36L 1KF6B 1YN5A 2D11A 3NY5A 4C3JB 2R92G 2M0XA 2E2JB 2H88B 1TY2A 2N9XA 3QWZB 1SMYD 4OWXB 3H3VI 1UEBA 2BWFA 1GKHA 5E6NA 1BKBA 2ZM6L 4DV0L 1BUVT 1RODA 3AU5A 3PUWA 1AFPA 4OX9L 1S5ED 3SDLC 1PZID 5E4XA 4DU9A 3OWEB 4DUYQ 4BBSB 3S17B 2DHZA 5FR6A 3S2HH 3F2UA 4W9EA 2PPBC 4H13C 4JYAQ 3CCVA 1VQ5A 4FJYA 3ONSA 1WY8A 1CHPD 4K0KQ 1PGAA 2BT6A 1K0RA 2E74C 3PZ8A 1PRTB 2PNRC 2W54A 1IKMA 3WWVA 5CHVC 3EIVA 4JPBW 4PS7A 1KRSA 2MWSB 2D0OA 1KRHA 4KZ0A 4JG2A 5J3BA 2IX1A 1UNSA 2J7ZA 1Q81C 2PW9A 1K8MA 2IY5B 1VQMA 1UE6A 3A8JE 5DAUA 1PQSA 3QJZA 2O2VA 3Q3MC 4B0EA 2AL6A 2WXOA 1W2BA 3NTHA 1M8AA 4GKJL 1V1PA 5GXGB 5C44G 1WXQA 4R4TA 1TY0A 3ZJVA 4ZUIA 1WJUA 2UWQA 3H6NA 4GMVA 2NUCA 4C3IB 1JOQA 2EYLA 1M94A 1XPOA 4DR3Q 3PIPA 3L0OA 2CHZA 3HIZA 2L0CA 2QDLA 4TVAB 1V1OA 4F8MA 1FNVA 3HOXH 2D9UA 5IT9c 1CA6A 1VCIA 2XWBB 4HPPA 1C9FA 2B2WC 2RSOA 3N1XC 1J8IA 2AQ3B 1Q1EA 2KDFB 1HFGA 2BDOA 3FRPB 4H02A 1FXTB 1SRUA 3PRMB 3NZ3A 5I6WA 1LTTD 4DK5A 3FP9A 3A4RA 3S2HB 3MFYA 4M0WA 1WTWA 3DLLA 1Q8KA 2UUCL 2HTME 2MJ8A 2K1FA 3N1YC 4DR5L 3GE8C 2X69A 2Q8RE 1R4MB 1VQAA 4NQLB 1KC8C 1VZ6A 3E9SA 1ZYRD 2MX2A 2KVZA 4JI1Q 1V97A 1B9RA 2GB1A 2XEWA 1V43A 1WM3A 1RD9D 4LNFA 5HI1A 2E2IH 1GB1A 4HKZE 1VD2A 4EOYA 3Q8BA 1M1KC 1YITA 4KDIC 5G5HA 5FO8B 3U4EG 5KHQA 4BVUC 4A3IG 1E6EB 1D5XC 4GNXC 1N36Q 1E8WA 1WYWB 2OTLA 2FMCA 2N9KA 1HRJA 2F0UA 4WRDA 2CKHB 4QGUA 3U7ZA 3E5SA 2SEBD 4IUNA 1PDQA 3FVQA 2Q2HA 1CKNA 2BE5D 5DLQE 4IOCA 1B2TA 3HRZC 3A55A 1SXTA 2JA9A 4A3KG 3T16A 2MJEA 1K0SA 5C4ZA 4W9IA 1A5RA 4DV0Q 2PLPA 1STAA 4KHZA 3RPFC 2WP8J 4GKKL 2JK8A 3N30A 4OX9Q 1SYEA 3CXCA 4B08A 1AZPA 2HJ8A 1EWHA 3R66C 3HOXB 3OAWA 3GOEA 2JZ3B 3VA5A 4NZLB 1U4LA 5DEHA 3SK5A 5HGTA 4OWWB 3ETRA 2K01A 3Q2AC 2NZOA 3J80L 1PH1A 2HCCA 2X6GA 3D6CA 4A75A 1GJXA 3JVZX 3K0YA 2V4LA 1YHBA 2XTIA 3AMUA 2BA0A 2YTVA 4RCOA 1K9MC 2AEHA 3GTPH 1D8LA 3NE5B 2KTFA 2EJMA 3D32A 4MGYE 2IO1B 1O7IA 1VQOA 2CWAA 4GDLB 3I4OA 1P0RA 1HNWL 2VNUD 1EY4A 1SIJA 3IBEA 4KKJA 3ZO5B 3DM3A 1NCVA 4ME5A 2FUHB 4ACFA 4GKJQ 1QUQA 1BO0A 4HWIB 2WXGA 1F2ZA 3MHSD 1WR1A 2E2IB 3ZJTA 2WXMA 2A6HC 1TWCH 5E4WC 4KX6B 1ZDXA 2Z6KA 2JWUA 2A1AA 5EPLA 4KV2A 1NY4A 3MXPA 4PQXA 4CKCA 3AEAB 4MGIE 1K3RA 2IO2B 1EYDA 3G6JB 5IT9E 3DWAA 1KDBA 1HTPA 4DN4M 1QVCA 2MBBB 2LGDA 2KLGA 2QKIC 4EQPA 1EF5A 1E2WA 1T0RC 5LMNW 3R8BA 3K81C 3U52E 4A90A 3RNGC 2KCMA 2RHSB 1Z5SB 3KUCB 4A3DH 3A8KE 1XXGA 2BYTA 3J7ZC 3KLRA 3SVMA 4EZLA 3BDOA 4B3RL 5IODA 3DHHC 3EFUA 3BYYB 4GOPC 2PKOA 2EY6A 4DK6C 2WWZA 4FADA 3Q0AA 1UGMA 3I72A 1MKHA 2V4IB 1C79A 2L0FA 1X3PA 2L11A 1TBEA 5BO4B 1EOVA 3L0WB 1XLNA 4HCPB 3Q8FA 3HOVG 4A3FH 4C7ZA 1K8GA 1E7UA 4IN3A 3GTPB 3AE1B 2EELA 3PS6A 2JA6H 4S17A 2KX3A 4PT5A 4C3HH 4JLCA 1CSQA 4CHTB 1AE3A 4XYOA 4A3BG 1ZE3D 5JOBA 3VXWA 2MO0A 3J81j 5DPRA 2RBMA 1GUTA 2NPTA 5D3DA 2MCNB 4PV1C 1QVGA 4LF4L 2F0WA 2KQ3A 2UUBL 1CA5A 3TMEA 2XRSD 2FHTA 3I55A 3BZCA 4IWOA 2K7VA 1ILQA 1B3QA 5AUIA 3MXUA 2K33A 4IUVA 1K53A 3GZNI 4YSXB 2Z1CA 4GKKQ 4R8NA 3IAS1 1A15A 1IL8A 5C5MA 3AEFB 4HIDA 3ZRCA 2R7ZB 3ULPA 2KNBA 5M9OA 4TKNA 2PZUA 4NB3A 2SAKA 1MI2A 1DOLA 3L7ZC 4A3DB 1P7FA 4HXDA 1RAXA 1BOSA 1PDXA 2NZHA 5A2QL 1LO5D 3TEHB 5IGGA 5IYDG 4LUZA 5IY0A 3I3TB 3T1YL 1KABA 2ZCCA 4K6DA 4KJOA 2ZVNA 3W1SA 1HJPA 4KY7A 4CDCC 1VQDA 4FXDA 2RQXA 1L4DB 2WXIA 3U4ZA 1HNWQ 2D2QA 3IHPC 4DHZB 1F2LA 3EHVA 3KDFA 1YI2A 1R4MI 1P3QU 4XYQA 1SMYC 2GVBA 2BVCA 1FCLA 1HQMC 2VZAA 4FF4A 2JA6B 1A70A 2L1BA 3U50C 1LUZA 3T13A 2FIFA 2CJNA 3RUZA 3DWQA 3FDTA 2KFKA 4LCDE 4IQZA 4A4IA 2J0MA 2WQYB 5L83A 2IWHA 4MN3A 3RR5A 4IFDJ 2CHXA 3QOLA 1YNTE 3MC8A 4V0BA 3HOZB 1YJNA 2M00A 4HJ8A 5EBCA 1UZXB 5AZGA 2WIIB 3CF5A 1B8AA 4BBRG 4CDEC 2WLBA 1STYA 5IYCH 4HN7A 1HE8A 3OIQA 2VB3X 4EQOA 1XTCD 1LQBA 1SB3C 2AKWB 1JJCB 1PRTD 3C3LA 4GN5A 4KIKA 1QOHA 1AP0A 1H9KA 1EY0A 1D5ZC 3NZUA 1FXAA 4DV5L 1OQRA 1WGRA 1BVSA 3IFDA 2Z6BA 3ZKJC 2FNJB 3QARA 3UDGA 4B3MQ 1FMAD 1GO3E 2K03A 3R2TA 4UPAA 1ZKHA 2HQEA 3SR1A 4CJ1B 3F2DA 1C48A 2B2UC 5CV9A 2W3RA 1MBYA 2Z59B 3DMUA 2NVXB 2J4XA 2HD5B 4EE2A 2K5HA 3GV6A 1N34L 1WX8A 4LDTB 2N7EA 1G6ZA 4KN4C 3GTQH 2D5GA 1E2VA 3B2GA 1Q90A 3UDXA 2UUBQ 4LF4Q 2K0PA 2X6LA 3UE1A 2W3SA 1UE5A 3PF5A 4JI7L 2N55A 4I6PA 3ZXVA 2V3PA 4FXKC 1ROEA 1WCMH 3MTSA 4WIPA 3G48A 1K51A 2W82A 5L95C 1YJIA 2L9HA 4E6IA 4JIOU 4K3CA 1UGJA 4A9AA 2EXDA 1IBML 3H15A 4A3OA 3MAQA 5BMHA 5LL6X 1EEFD 1EWYC 4LK0M 1I4GA 1VQ6A 2ZVOA 3DOWA 4BFRA 4M02A 5KNCA 1L1OA 2NS5A 1ILPA 2XRQD 4EQNA 3TUOA 5IE8A 3KWLA 3H3VC 1J7CA 3ITPA 1STBA 2F0TA 5J2RA 2L83A 3T1YQ 2WU2B 2VQEL 3NENA 1TR5A 4E71A 3SHLA 4HCSA 2ENBA 5IYBH 4NXNQ 4LFBL 5IN7A 3VH4B 5DPWA 1E0ZA 4IUMB 3K7UC 4WURA 3KLWA 5BR8Q 1G6JA 4ZHOA 1HNXL 3W5UB 4FF1A 3J81c 1PFNA 2FBWB 3EA6A 1ASYA 2BE5C 4KHVA 2O6VA 1BCPB 2M8SA 4XT3B 2B63H 4M8NA 3LWEA 1EY7A 1DD2A 2XGTA 2PNHA 3N6RA 3PUXA 1O80A 2A74C 2GVAA 4JOIC 3VYSA 2ZPYA 1C4QA 1UUPA 1HZBA 3NELA 4FHJA 4F8CB 3WAOA 5C3EG 1CZWA 1Y8OB 1N63A 2WXLA 2WHIA 1WCMB 1TU2B 2I5HA 4EGVA 5FLXc 3JAME 4JI3L 2LHDA 5BN4A 2Y3AA 3TEXA 3HKSA 3VR4A 3LYYA 2WXNA 2N7JA 3QIAA 1NTGA 3X3MA 5BN3A 4A93H 3M4QA 1S4ZA 5IGBA 1WFYA 2LVPA 2BWES 3WOEA 3IFWB 4YTPB 1B9NA 4DV5Q 4H2AA 1XMOL 2K5PA 3HVZA 3AFQA 1VQIA 2KQ7A 1TQOA 2N3SA 2MQHA 5CBAE 2RPVA 4MHEA 3VQIA 1FEHA 3GO5A 1K50A 3NOBA 3EVQA 1EO6A 1ZDVA 2QDFA 2PMZB 3X23A 3A33B 1RDPD 4FP5D 4JC0A 2KUMA 3FILB 4BBNC 3RZWC 5HURA 2LGXA 1PZKD 3RLNA 2Y5PA 4LUVA 3E9HA 3NBIA 2K5QA 2E6XA 5ELDA 2GN5A 4EQ5A 3MC0B 4WJPA 4LFAL 3ND8A 1YQ4B 3CF6E 2NR2A 1E22A 3EQLC 3TP6A 4JI7Q 1E7VA 3KLSA 1IBLL 4G0NB 3EFCA 3H94A 2B63B 3L16A 2LVOA 1DOXA 1LTLA 1CI3M 2L7RA 2IPKD 4MJSB 4NJ7A 1IBMQ 2KMCA 1KJTA 4GXBA 1TS3A 2L32A 4JBWA 4QIWE 5C0XH 3PO0A 3MHZA 3M3YH 2LSSA 4PS8A 4P74A 2N7DA 2KVMA 2Z4HA 2N78A 2DNFA 3A8IE 1SFOH 2DAJA 4A93B 1MHXA 2VQEQ 3L3OC 4BY7G 2JA5G 2OTJA 1E8ZA 4P1CC 2R93G 3L9AX 2V3NA 2VS1A 2LWPA 5CHWA 3VTUA 2EYHA 4FF3A 3HOYH 2F03A 4NMZA 1X54A 4Y52H 1HNXQ 4WWOA 4A3MB 4K7SA 3Q8DA 3E9IA 1S5CD 4IM3A 2NN6H 1EYGA 1CK1A 2RSNA 4GLVB 3RNCC 4GNXA 3CC2A 4B6WA 5EJWA 1JWBD 3V05A 2HHHL 2G45B 3RNUA 1KTKA 5HG2A 2WX0A 1JOOA 3VR3A 1DOMA 2K5NA 4JK1C 5LMNL 2Q2UA 1CMXB 1SGHA 3MXNB 4KSLC 2FAZA 3CMEA 2IBIB 1V9JA 1PTOH 4JBKA 2I5LX 3B1LX 5C4XH 2D10A 5AEKB 1C9OA 1CHQD 2AWOA 4JI3Q 3MJ5A 2OF1A 4M8AA 4KY5A 1XEEA 1JR0D 2JWZA 4DAYA 2GMIC 4QF4A 3NSWA 5M5YH 1Q7YC 2LMCB 1GM5A 3H09A 4OVVA 4LF6L 1IW7D 2M2LA 1OXTA 1TKEA 3PREA 5CGKA 2V9HA 1WMHB 3M3YB 1XMOQ 3TP5A 2NTTA 4BAXA 1ET6A 3F1ZA 1HA6A 5LLIA 3N9YC 1V8CA 5FJ8H 4WQOB 3A5ZB 2KEDA 5H8YE 1R9TH 1UD7A 2A6ED 4AUQC 4BY1H 5EGTA 2JX5A 5CHFA 2ASBA 4LMQD 4E3CA 1H8CA 2N49A 2VL6A 3C2PA 2E2HB 1SSOA 1IYFA 1Y1VH 3CSTA 3CCLA 4II3B 3HOYB 2TSSA 1SYFA 4LFAQ 3S1NH 5EE0A 3SHQA 5D14A 4S0RA 4G7HC 3I4NH 2SNSA 4GN3B 3RMKC 1B4OA 4AYBE 1S40A 1IBLQ 4KJNA 1YOVB 4Q0FA 4HLEA 4DXGA 1PZJD 1Z2MA 1CT1D 1B70B 1E2ZA 3RD4A 5T8IA 1PRTC 5CC4A 1GXDC 1VJKA 2KX0A 2MBEA 1KM7A 2KJHB 3QJYA 2Z0DB 2ZXRA 3H0GH 2N88A 1SBBB 4JI2L 2ASQA 3PSIA 4I6NB 3URYA 2CU1A 5CV6A 3SD5A 1PFMA 3Q3OC 1Z47A 4APVA 4OO1H 2MW5A 3CHBD 4US9A 5D7GA 3HP3A 3U8ZA 3SE0A 3PGZA 1RRBA 4AYBG 4FLHA 3CC4A 3J7AF 1EYCA 3KBGA 5COYA 2IHEA 4LF5L 1EY8A 2IX0A 3ZJUA 2XNAC 1TXYA 2DYOA 5AUKA 2EIFA 4HROA 1BF4A 5T1GA 4JQWC 2Y5CA 3OMCA 1C77A 3P4SB 1GAQB 1RFKA 4EVOA 1O7ZA 2B2VC 2R2QA 3DVNU 4YWGG 1WTVA 3EGRA 1NUCA 4BY1B 3RN9C 2ZZPB 4G3XB 2J7QB 2F0SA 1ZXTA 3RUIB 3V61A 3I9V1 4M00A 1KL9A 4X3KA 2WB1E 4KV6A 1TWGH 4XQQA 1KNAA 3SGIA 3G4SA 5M3FG 2HHHQ 1SNPA 3TRZA 4ABNA 1H9SA 2HE7A 2K1BA 4G11A 5LMNQ 2DX5B 2KJXA 1TT5B 3U2SC 2OEOA 4K3BA 4W9LA 2Z9HA 3B9JA 1EU3A 4IOIE 2F0HA 2ALYB 3TDQA 1TS2A 2KWCA 4MSQB 2JE6I 4HR7B 2O2VB 3HK0A 2I5MX 4RNAA 3WAMA 4KD4A 2F1MA 1E90A 4GLSC 1JE5A 4IM0A 3BDLA 5C4JH 2SDFA 1X32A 2IDYA 2B2YC 3H0GB 3SFEB 3TJPA 4LF6Q 4H7BA 5KEEA 3IAYA 1L5PA 1TJEA 1WF9A 1ZW7A 2WB1G 3I2ZA 1LACA 4P16A 3VUWA 3VR2A 2C35B 3W1YA 1PTOF 4C3JG 2WXRA 5GAGC 4K6LA 5GAEC 1VLBA 3NZSA 1E7ZA 3DHQA 3AMZA 3KF6A 2AHOB 4X64Q 1SJED 3UIOB 3H8HA 4JI8L 5JEAG 1FR3A 2A68D 1TWHB 2BQQA 4BKSA 5K36G 1Q10A 1ENCA 4NW2A 4FNFA 4XXEA 1EFID 4BBSG 2L00B 1WYDA 1MJCA 4CQNA 4X3UA 1T0SC 1JE4A 1YIWA 1GOZA 2Q2TA 4IDIA 2BS4B 5D94A 2K04A 2XVSA 3GE3C 4C80A 5TSSA 1RL2A 1MSHA 1PFDA 1WJJA 1YMHE 1ICWA 1HEZE 3I57A 2LZ6A 2WXHA 1G8ZD 2I1KA 1EIYB 1ZGUB 3OPOA 2NVQH 5EKLA 1TWGB 4ZRKA 1N5XA 4K8JA 1F9JA 3DVNV 3KBXA 4CDDC 4USAA 2Y0SE 3I8ZA 2H1EA 3JAMi 2UUAL 1Q1BA 4A6QA 4FA6A 1OEYA 3T4AC 3IT6B 4GU2A 4JI2Q 2EYPA 4ZYSA 1PGXA 5IOIA 3BWUD 3AE6B 1Z9FA 5IWAL 3PO3H 2F0KA 1LXDA 1Q3LA 4DV7L 3CIRB 4JI6L 1S1QB 3QCAA 5HHDG 5ISRA 1CZGA 4C1NK 1NNXA 5C4JB 3RULA 2J0JA 1IYVA 1EM7A 4LF5Q 1HR0L 4C3IG 2EYJA 1JQYD 1P1AA 1XO3A 1QG7A 1ICFB 2Y0SG 3PHXB 3Q3JA 1SYGA 1X3FA 2NVYB 1V5OA 4K81A 4KMUC 1KD1C 4MTKA 2LI5A 2G4DB 1OXSC 1NI3A 5FLMG 3CKIB 3H9DA 1MG4A 2B29A 2INNE 3VRBB 5ELEA 4IUPA 3L10B 3Q8EA 3OTOQ 3A0JA 4HPMB 3SXHA 1U4MA 2FCNA 4ANUA 1TIFA 5H92C 3ZGZA 3SFDB 2PPHA 3AXCA 3K8AA 1G2SA 4FVMA 1DOIA 4JBJA 2RHQB 2KKCA 4DF7A 2NVQB 1SROA 3B6YA 4B95A 4FULA 3FEWX 2NN6I 3W3AA 5E3FA 2PZTA 2JRIB 3TZUA 2PIAA 1KH0A 2QEXA 1P8LA 3PRZA 2D5DA 5GMVA 1U0LA 3FPPA 2JA8H 3ZYYX 4I6LB 2F0NA 4R4CA 2WDRB 1BBUA 3HOUG 3U7DA 4X62L 1RF2D 5E7NA 4L6TB 1V2YA 1STHA 4R9WA 1U5KA 3DXJC 2IX3A 3MWYW 2B2TA 4ZKCB 1A8VA 2KVRA 2MJDA 3RI7C 5AZFA 2FCQA 3OIPA 4JI8Q 2ZT9C 4A3CG 4O2DA 4MM3A 1EZ8A 4ZCKA 1MHHE 5FKAC 1EOTA 1F77A 3Q8AA 1K52A 3KK7A 2LXAA 4NQKE 4YSYB 4OEMB 4BKSD 1RM6C 4XDDA 5DNFA 3HOXG 1S5BD 2JN4A 1EWIA 1ONLA 2NB0A 2Q8IB 5DM73 3KJPA 2UXCL 2BW2A 1EQQA 3WANA 2KDMA 4GB9A 1XTDA 2K6AA 3CRLC 5CYUA 5EPKA 4KK7A 3S16B 1FCCC 2EMSA 2E8GA 3N20C 3PZ7A 3GZNB 3ONAB 1EQRA 1JRPA 4KDLB 2UUAQ 1NENB 4KSKC 1JROA 3H7PB 1N9WA 1F52A 3M9BA 2HTHA 1HUNA 4A3PA 5C3XA 3ZLZA 3STBD 1D1KA 4F7XA 1PUTA 5IWAQ 2EYOA 5C3JB 4GGQA 4CJ2C 4M8MA 4DV7Q 2R7FA 1MFWA 2M17A 4JI6Q 1HTLD 2NBUA 4WQMA 2A6EC 2W9NA 1FNWA 3NWTA 4QCLA 2IHFA 2H89B 3S14H 1F0ZA 2OWOA 2KJ6A 2Q2IA 4O42A 2I46A 2JA8B 3ZIMA 1OXVA 1HNZL 4RHRA 2PTLA 2GOWA 1WD1A 1SE2A 3G7LA 2FJ2A 1IGCA 1PHJA 1MPEA 2WDTB 3TZDA 4NDXA 3EROA 3F2CA 4OZCA 2OJWA 2CH4W 1D6EC 4CKEA 3DEOA 3FKIG 1A3TA 2L3ZA 1OTRB 4K5VA 3GTJH 2K8BA 3ALBA 5JZEB 4L63B 3AU7A 4OW0A 1CKOA 5KIXA 2XK5B 4B3SL 3L17A 3RD2A 1LTGD 1C7YA 1MGSA 4HTHA 2KACA 2YEPF 3P4QB 3PLVA 4HJKA 5M3MH 2ZW0A 1PTOD 2FUG1 1YHQA 5BMGA 4QL5A 4A3JG 1J0GA 4KI0A 4OIJA 4UY8C 3Q6SA 1NR4A 2CVRA 1WZ0A 4DHJB 1EUJA 4FBJB 4IPHA 1UH6A 5C44H 1MHWC 5KNDA 2X38A 4WH4A 2IJ0A 2LXJA 4RA8A 1F2RI 2R2OA 2O5JC 2ZM6Q 2RDFA 2RA4A 3MXGA 1L0YB 1PFBA 1E1OA 3W9CB 4KKSA 4X62Q 1KRTA 1QZHA 2FXQA 3BZDB 3MA2B 1J5EL 3CCMA 1JRUA 4HMIA 3S14B 3JYUA 4WJOA 3UINB 5I2XA 2ZCBA 3TBLD 2YTYA 2NWGA 3NHHA 1N5WA 3TS2A 1R4PB 1B44D 3F2BA 1V81A 2L4NA 2R7ZG 2AL3A 3P1HA 2UXCQ 2JUOA 3S15H 4KIKB 5AZHA 2AYOB 4IOAA 4HIKA 3GDEA 1AARA 4J6HA 4W9JA 3EECA 2M19A 2VQFL 3CRKC 3OOCA 3PO2G 1QVFA 3CD6A 1YNXA 3A1QA 4J6IA 3GB1A 1VF5C 3MJWA 4L5TA 1ASZA 2KQ4X 2IZVB 3WAPA 3GTJB 3ULLA 1PVOA 3LJ3A 3FHWA 5IP9H 3U9SA 3CMMB 1WX9A 5CV8A 3V2TA 1TZ1A 1RWSA 3SU8X 5IP7G 2GA4B 5M3MB 2CQOA 2DZMA 1C8CA 1PH8A 5E6OA 1YVCA 2FIDA 4LNNA 4REZA 3BJUA 5E6JA 2JY6A 3W5VB 1VQNA 1T9HA 5KGUA 1YX6B 5IKCM 1MG8A 4KVGB 1BCPC 2MP2A 3CU7A 2MA9B 1T5EA 4A3KH 1FPYA 1JORA 2VUMG 1XD3B 3ZNGC 1VDVA 1HNZQ 4ANXA 3HOZG 2LGIA 1J6QA 4X65L 3Q8CA 3AYHB 1RTOA 1U9RA 2CH4A 4RG1A 2UUCQ 3DUZA 2BS3B 3JAML 4DR5Q 2PE6B 2QC8A 3AEGB 4WJ3M 3P2BA 2AUJD 1PLFA 4AH6A 4ALPA 4OIKA 1LT3D 1QWYA 2FMMA 3EBEA 1QT9A 4W9CA 2E5LL 4AP4C 1P9DU 1NMGA 1S3OA 4BS9A 2QSDA 1QKZA 4IURA 1A3VA 1VQEA 3GTLH 3VR5A 1T5XD 3BK1A 1PH3A 2KOXA 4LF7L 2FINB 5EE9A 1VQHA 1XPRA 4P75A 1QZGA 4UP9A 2INCC 1F2MA 2O6VB 4DUZL 1TWCB 2TMPA 1YQBA 2RR9A 3DBSA 1TS5A 4DV2L 4LLGM 2F4IA 2IT1A 3J7AV 2XSCA 4GLAC 1R4QB 4G57A 1Q0WB 3VYTA 4K7WA 3FMCA 5F2DA 3P42A 4EZKA 1J5EQ 3Q3FA 4TSSA 3EFXD 5J39A 1JC7A 1N33L 3J7YW 2DWQA 2KWUB 3PUZA 3I4MH 1V49A 3DBHB 1UWVA 2B2VA 3QB3A 3ERQA 3NHEB 4DDGD 1OXXK 1VMCA 2A4ZA 2F0FA 2BYFA 2WS3B 3WOFA 1CQVA 2VQFQ 2MFIA 5CR3A 2KTRA 1IP9A 4M1UB 1DXMA 1Y8PB 3IAM1 1Y56A 2WAQB 4IPGA 4A3FB 3HOVH 4JPSA 1XLPA 1TKWB 4C1NI 3AEVA 3K57A 2K9XA 1DONA 2LXCA 2G9HD 2KHWB 2D3BA 4NY0A 1VMPA 1I4HA 2CS4A 4C3HB 4H0LC 4L5QA 4ME3A 2EMTA 4A3BH 3GTLB 2J0TD 1E10A 1CQFA 1FM0D 2JSVX 3N52A 3HRDD 1JT8A 4HRSA 1YJ1A 4U68A 3N1ZC 3E6ZX 2LGSA 1ACCA 1C76A 1OQQA 1SAPA 1WGKA 5E6PA 3A74A 4KTAA 1TVXA 1N62A 1F9RA 5EAYA 1PH7A 3NVVA 3QAQA 5DPTA 3UQAA 4O1NA 1WJNA 1VQJA 3Q22A 3RNFC 4B3RQ 3SK6A 4EZJA 4X65Q 1TWAH 4A3GG 2PMZE 5ELCA 4KKTA 1XX8A 4IUQA 4QMGA 1WCMG 3SEBA 4ZKBB 2C9OA 1EY6A 1KDAA 2HIVA 1PH6A 1PH2A 2MLBA 1RYJA 3IVFA 3UF8A 4F88A 4TRDA
chains in the Genus database with same CATH topology
3BS1A 4J8QA 1V8QA 3PIP3 3I4MB 3AE5B 4HKQA 2MP1A 3SK4A 1C4PA 1ESFA 3LWUA 3WDNA 1FRRA 1GHKA 2Q8TA 4ZHPA 3NUHB 5I4DA 4TQ1A 2QIEB 3HS0C 1SNQA 5C0XJ 2JZPA 1C78A 4RKBA 4B0MA 4A3BB 4MIUA 1W6JA 4GZYC 1ZP0B 2PYKA 1OXUA 4XWWA 1MI0A 1ZXIA 2IL8A 4ZAIA 2M9VA 1QOFA 1ZYRC 2ICEC 1M4VA 4N9PA 2ICIA 1PXUA 4RWSC 1TWAB 2L1AA 1NSNS 4LJZC 1YN3A 5DM63 4KN7C 4IFDG 4ZUJA 4RGOS 2EZVA 3S9WA 4DFAA 1DJRD 2G9DA 4G4KA 1B3AA 2L12A 3GTQB 2PMVA 3MZ5A 1U4RA 1LTSD 4WJWA 1HHVA 5BYQA 3P63A 1MSGA 3AEDB 2JP1A 1QE6A 1XYIA 5EPJA 1Y1WB 4XIGS 4L8JA 3TEYA 4HJGE 1ML0D 4XTCS 5I6YA 2KEEA 2V4DA 2EYMA 3AECB 4K14A 2F0QA 2N9LA 5FO9B 2ON8A 1SSNA 5KYIA 1SNOA 1X3QA 5J22A 1LT5D 2BS2B 2IGDA 1Z6HA 2ZXPA 5LL6S 3GD7A 1ESRA 4N6EB 3P1MA 1WTXA 1EY9A 2PVGC 4XDXA 3M7NA 3VYUA 2F0GA 2B2WA 3P20A 3GP7A 4FYDA 5EKIA 4RAUC 1WTOA 4ILWA 1F2RC 3S1MB 1BUIC 2OXPA 3I3CA 4Z9CB 1WTRA 3KLSX 5ELBA 3E0JA 1I4PA 2EOTA 3TP7A 4YT0B 1LABA 2KA7A 3J81E 4KKIA 4N9TA 4DGZA 2H4OA 2Z4IA 1TYGB 2R3ZA 5EE1A 4FXGC 1N60A 3T56B 3Q23A 4NKLA 5NUCA 2B8FA 5JJZA 3H91A 3BDCA 2NYZD 3I91A 2LS01 2PQEA 4TQ0A 1LT6D 5FLXE 3SDZA 3OW7A 2JQRB 2YU9B 4C7YA 3MHBA 2EDGA 3VYRA 4IUTA 4L23A 1MD2D 1HXYD 1ZPSA 2F0JA 1FXIA 3K5NA 3C1FA 3NVZA 1WRIA 1GB4A 3LNNA 1SFOB 2WNMA 2ONQA 1DOYA 5BMIA 3K59A 4RH6A 5MPOA 1DM0B 3AE8B 2A69D 1FNUA 1B50A 4JWSC 5CV5A 1DGJA 5M5WB 4DNTB 2JYTA 1PTOB 3L4PA 5C4XB 3W2DA 2MGSA 2AQ2B 1L4ZB 2M0AA 1SE4A 3T3OA 3BVGA 1S5FD 5M5YB 2B76B 2MPMA 3M4YA 3HKZB 1XF5L 2JSOA 1QILA 2DYMA 1R9TB 2PW7A 4G7ZC 1IGDA 2E75C 4MM3B 4BY7B 2AUKA 4TKOB 2PZWA 1Y1VB 3NTIA 1NAPA 1VZ7A 2K3UA 3S1NB 5IOCA 2KCNA 2GRIA 5CV4A 3I4NB 1ZEQX 2DLBA 3FPUB 3OSOA 1CTMA 3QO2A 1V1PB 1G2TA 1CZPA 4C2MB 1NR2A 3IKJA 3HUIA 2D62A 1SDFA 4KGRA 3NVYA 1AYFA 3Q69A 2K28A 2MHVA 2JYOA 4WFN3 4ZQ3A 4FXCA 1H9RA 2QF7A 3HZXA 1I6VC 5J1ZA 3RZOB 3E56A 1I50B 4BWGB 4NJCA 4ZRPA 5K5PA 1KLGD 2RDHA 3D6WA 2F0OA 1GHJA 3HVDA 2DNCA 1CM9A 2F0DA 1PGBA 5KYLA 2M56B 2KHSA 4IUUA 3AB5A 1OO9B 2L5TA 4N58A 4IZ8A 2DNEA 1HQRD 1D5MC 1JWUD 3UI3A 1XLQA 3I90A 3IFTA 2XN9C 4OGQC 1VDZA 3HOWB 5CORA 2I2YA 3K5MA 1IKLA 2NTSA 4RCNA 4CJ0B 1KAAA 3X3NA 3VR8B 3TP8A 4J3OD 5IT9L 1SEBD 4ULLA 1ZKOA 5C0XI 1QJOA 4AYBB 2B2UA 3B2FA 3Q24A 1J7AA 3FC4A 4PNYA 4NP5A 4RKLA 2O2LD 2AWNA 1TT2A 4RF0A 1I4XA 4DNRB 3NQTA 2O4XA 2XWJB 2F0PA 5JXVA 5M3FB 2QDBA 2F3WA 2HDLA 1CFMA 1SYCA 3TN2A 2I07B 4UAIA 5LHY1 3K5LA 1PYWD 3PO3B 3TBIB 3I70A 1EY5A 1I4RA 4B9XA 3NWSA 4DK0A 4FF2A 2K5WA 3PMFA 2WB1B 2E76C 2K05A 2CJOA 2BA1A 2YEPB 2WACA 1KLUD 3I73A 4US8A 1IBXA 4PMBA 1YQ3B 5BN5A 4XT1B 1ENFA 4IALA 2VB2X 2WP9B 4L1BA 2F0LA 4K8IA 1LTAD 1HZ5A 1IW7C 1I7HA 4JWUC 1VZ8A 4V190 1GUGA 3M7GA 1JCKB 3O13A 3NXWA 1E7PB 3GQBA 5JVG3 3LX0A 2W55A 2SNMA 2QILA 4LAAA 4R8IA 3C1EA 2A5HA 2HCIA 2OHFA 4HCEA 1YJJA 2A69C 2F0EA 1O78A 3D4DA 3K58A 3RZDB 2EJFC 4OO1I 1YN4A 2Y0SB 2OT2A 2LFIA 2LKVA 4XWTA 1T3QA 2CW0D 3IL8A 5C2TB 4RGMA 1YNJD 4J1MA 2LJIA 1IYUA 1SNDA 3SK8A 3OMGA 1JQ4A 3BVMA 3A56A 5C5LA 2J52A 2ACZB 1O7LA 1RJTA 1QOAA 1QOBA 2JYEA 4KGSA 1EIGA 2F0MA 3AB9A 2B39A 1FYCA 5JAVA 3AM9A 1EWCA 3EUB2 1NYRA 3QG1A 1PRTF 2R92B 1JICA 1JWMD 4HEA1 2NBFA 2L55A 4RHSA 1WSPA 1ZUD2 4DXFA 1N61A 3AE2B 5FK9C 5FOBB 3NBHA 3K6OA 3HOUB 1SF0A 1TZOA 1TKGA 1SJHD 1A2TA 3P7JA 1B9MA 4U673 2WXKA 4K5XA 4YXDB 3R93A 1UWXA 5CMDA 2EVBA 2WKDA 1JWSD 2D2CC 4ARIA 1J9OA 3PUYA 1FGBD 2SOBA 4P2CB 3IT4B 2MEKA 1WYGA 2E3TA 4I65A 3VR9B 5C44B 1G91A 4C3HG 2A68C 4K2KA 2IW3A 4C56C 4DK1A 1EYAA 4ITKA 4MACA 2E2DC 1SYDA 3VRAB 2BCOA 3GTGB 4ZRZA 2WINB 2WXFA 2WDQB 3MFGA 4Y7NB 4XDCA 3ZQ4A 1EIHA 3OWFA 1DCZA 2OEDA 3S15B 1C4AA 5LNK1 1Q12A 4Q5VA 2B8GA 4RGNA 3H6MA 2KCCA 1JB3A 2BTEA 3FKIB 4HSVA 2RMMA 2XIWA 1BQQT 3FAHA 2ZW1A 3VA7A 2IGHA 1SE3A 5D65A 4A8XC 2NZ1D 1SYBA 3IXSA 4A3IB 1JOKA 4A3JB 1QF6A 1BXTA 3R2IA 4TMAB 3ABVB 1FD7D 2NMQA 5JVH3 1TS4A 4A3KB 5EE3A 3ND9A 5EKKA 1UEAB 4RGTA 3HEJA 1L0XB 1QQRA 1ET9A 1YNND 3EJIA 1AN8A 4ZOHC 3K7AB 1QNUA 3BVZA 3PV0A 1FFUA 2KWDA 2VZKB 4B9WA 4JX1C 1IHZA 3J81L 4ZK9B 3PO2B 1XCQL 1LV9A 2QJLA 1FRDA 3KUPA 3TEWA 4FO2A 3RFZB 2B2YA 3AE9B 2K5DA 3QWNA 1Y8NB 5FO7B 2HDEA 1VF7A 2KMMA 4HAEA 5JPMC 1ENAA 3P75A 4P6VF 2WU5B 2WKCA 5FLXL 1G291 2EYFA 2K32A 3C46A 2BB6A 5IIFA 4F87A 1U4PA 3DWPA 4AQ7A 4CGYB 1A3UA 1LLRD 2VUMB 1GUOA 3M4OB 1D1IA 1EQVA 4IKGA 2INPE 1WTPA 1KFYB 2DY7A 5G3LF 3AE4B 3LB8C 1Z7TA 2J42A 3T51B 1K8OA 5CBEE 2EKIA 4YIJA 4QB4A 1XWEA 3HOVB 2V0GA 5A35A 1QB5D 1CJEA 1AWDA 2R61A 3T3NA 1S5DD 1WTQA 2DN8A 3S1QB 3K5OA 4K5WA 3V96A 2J53A 4NAWB 4D2KA 2KOLA 4X3SA 2WXJA 4XE0A 1HUMA 3NRZA 1FIQA 1EEID 3MVVA 2DY8A 1P7EA 2CW0C 1YNJC 1PTOC 1AW7A 3J80E 2K22A 4OVZA 5I2YA 3QOJA 1VR9A 1GUNA 4GDKB 3DWGC 2LHEA 1I4QA 4RF1A 5C6AA 2MH7A 4UDUC 5JPNC 1ZXHA 2CU3A 1JALA 4KGTA 4XQJA 1LTRD 1DYQA 2B2TC 5EQ0A 1L6VA 3AH7A 1F9PA 3UI2A 2PCFB 1W6KA 2GI9A 5AFWA 1QLBB 4WWMA 1FFVA 4OL7A 2QCPX 2YYZA 1RHPA 1HFNA 4NAMA 4KKUA 3LXFA 4LK1C 4BBRB 3M85A 1NYQA 2EPBA 5C0XG 1HA5A 4A3GB 3NP8A 2F3VA 4X3TA 3A54A 2F0VA 5KNBA 2O5IC 5CV7A 2F0IA 4IFDH 3I4LA 1SNMA 1Q8IA 2JXMB 2ZXOA 3U9OA 3BG3A 1J7BA 1NEKB 3V3XA 3KQ4A 2A73B 1KDCA 2WV6D 5E1FA 3KWVA 3RLFA 5G5GA 4I7ZC 4HSPA 2RDGA 1H9SB 3NPPA 1AZQA 1BMLC 2NN6G 5KRUA 3GV3A 3OHXC 3NS1A 2EXZA 2HUGA 4KY6A 2PO4A 5D3IB 1FD6A 3AN1A 2LFNA 1OFFA 3S2DB 2IGGA 4HEDA 2JEBI 1BCPF 1R7SA 3A7AB 3D4WA 1QNKA 3D3RA 5A2QE 2CHBD 3BIID 1AEXA 3D31A 4HMJA 1D4BA 1Y69U 1F2YA 2R6GA 1EU4A 3AE7B 1O7YA 1STNA 1QCBD 2VXWA 2KN4A 3AEBB 5ELFA 4YTMB 4ZRQA 3KF8A 1RTNA 4XQNA 5C3WA 5I9OA 1SNCA 5G3LD 3RMHA 5BYRA 5FR3A 4ID6A 4K2LA 3NVWA 4QUCA 2FFKB 1YNNC 5C3EB 1H9JA 1STEA 1E9MA 3MP9A 4TQUS 3VR6A 2WDVB 5I9PA 5T1IA 4WAFA 3NQIA 2VZKD 2N0SB 2EY5A 4ZLTF 2QEJC 1E0BA 4OO1G 1BDOA 1UAPA 2I38A 2EY2A 3P4PB 2EE1A 1MVKA 2BDNA 3GS2A 4OZAA 4YTNB 2MJ3A 4CBVA 3GTKB 1EL0A 1II3A 1TKYA 1JW9D 2BB5A 1BR9A 1LTBD 4BA1I 5BYSA 4DA2A 1F9SA 2LEKA 3BYTB 1K83B 2PVOD 2KAJA 5JEAJ 2BOSA 5IGCA 2DBYA 4WORA 2WXPA 1RCVD 1I6HB 4S3SA 4RFBA 2AX5A 1GUSA 3PUVA 3DM1A 3DWMA 4QUFA 2JA5B 1NVID 3WCQA 1LTID 3D4RA 2R93B 1FO4A 4MT5A 2RKSA 4DAVA 1TWFB 1HZ6A 3BK2A 1IBXB 1H9MA 1A2UA 3MEHA 1L6UA 1I3QB 4QIWB 3FILA 3J9CA 4BA2I 4H44C 5IGEA 3AV8A 1VRAB 1IUEA 2KECA 4ODGA 1C4CA 2RVLA 2AQ1B 2G1EA 2CQAA 2EY1A 4DAPA 1D2BA 2WXQA 1DOKA 1WD0A 2JEAI 1JWAD 2QMTA 3R3OA 2Q5WD 4G7OC 1QOGA 3TSSA 3S1RB 3CQZB 3D8GA 2EJGC 1DZ1A 1BNZA 1JMLA 1WWTA 2FE8A 1UWMA 5C4HA 1HCZA 1KNEA 2PW5A 2A6HD 4PMCA 4LTUA 1STGA 1RKNA 4A3EB 5EBDA 3GTOB 4Q2JA 2LY7A 3HGBA 5IGDA 4MH8A 3HG9A 3T53B 4AS1A 1BCPD 3NTKA 1F9QA 3CWIA 4KD3A 4JE3B 4IFDI 1XLOA 4PMWA 2Z8LA 1BBXC 1L0VB 1LT4D 1ZOYB 4R3DA 4ARCA 3DEPA 2BBCA 3MXNA 3AE3B 1PMRA 2JU6X 1EQTA 2LMCA 2LUMA 4N59A 5IGFA 1WVLA 3GTMB 3NK9A 1XCTL 5JEAH 4A55A 2ID0A 5K36H 1B1ZA 4L2YA 4OHJA 3NUCA 1T6BX 4CKBA 3P4RB 1GUWA 1TIID 5M5XB 1HPCA 2C5CA 3PIO3 4YSZB 3C8YA 3SR6A 3AEEB 2L52A 5HFYA 2MUYA 1B53A 2JA7B 2JXTA 3A7LA 2NVTB 3TEZA 1A6XA 4OZBA 1EZ6A 2HDMA 1KF6B 1YN5A 4C3JB 2E2JB 2H88B 1TY2A 1SMYD 1BUVT 1RODA 3PUWA 1AFPA 1S5ED 1PZID 5E4XA 4DU9A 3OWEB 4BBSB 3S17B 3F2UA 2PPBC 4H13C 1CHPD 1PGAA 2BT6A 2E74C 3PZ8A 1PRTB 2PNRC 2W54A 1IKMA 1KRHA 2IX1A 1UNSA 2J7ZA 2PW9A 1K8MA 3A8JE 5DAUA 4B0EA 2WXOA 3NTHA 1M8AA 5GXGB 1V1PA 1WXQA 1TY0A 3ZJVA 4ZUIA 2NUCA 4C3IB 1JOQA 2EYLA 2L0CA 4F8MA 1GPXA 1V1OA 1CA6A 1FNVA 2D9UA 1VCIA 2XWBB 1C9FA 2B2WC 2RSOA 1J8IA 2AQ3B 1Q1EA 1HFGA 2BDOA 3FRPB 3NZ3A 5I6WA 1LTTD 3S2HB 3MFYA 4M0WA 1WTWA 2HTME 2MJ8A 2X69A 2Q8RE 1VZ6A 3E9SA 1ZYRD 1V97A 1B9RA 2GB1A 1V43A 1RD9D 5HI1A 1GB1A 4HKZE 3Q8BA 5G5HA 3U4EG 5FO8B 1E6EB 1D5XC 2N9KA 2FMCA 1HRJA 2F0UA 4WRDA 3U7ZA 3E5SA 2SEBD 4IUNA 1PDQA 3FVQA 2BE5D 1B2TA 3HRZC 3A55A 1SXTA 2MJEA 3T16A 5C4ZA 2PLPA 1STAA 4KHZA 3RPFC 2WP8J 1SYEA 1AZPA 4B08A 1EWHA 3HOXB 3VA5A 4NZLB 1U4LA 5DEHA 3SK5A 5HGTA 3ETRA 2K01A 3J80L 2HCCA 2X6GA 3D6CA 1GJXA 3K0YA 3AMUA 2BA0A 4RCOA 3NE5B 2EJMA 4GDLB 2VNUD 1EY4A 1SIJA 4KKJA 4ME5A 1NCVA 1BO0A 2WXGA 1F2ZA 3ZJTA 2E2IB 2WXMA 2A6HC 5E4WC 4KX6B 1ZDXA 2JWUA 5EPLA 3MXPA 4PQXA 4CKCA 3AEAB 1EYDA 3G6JB 5IT9E 3DWAA 1KDBA 1HTPA 4DN4M 2QKIC 4EQPA 1E2WA 3U52E 3R8BA 4A90A 3A8KE 1XXGA 2BYTA 3KLRA 3SVMA 3BDOA 5IODA 3BYYB 2PKOA 2EY6A 3Q0AA 3I72A 2V4IB 1C79A 1X3PA 2L11A 1XLNA 3Q8FA 4C7ZA 4IN3A 3GTPB 3AE1B 2EELA 4PT5A 4CHTB 4XYOA 1ZE3D 5JOBA 2RBMA 1GUTA 5D3DA 4PV1C 2F0WA 2KQ3A 1CA5A 3TMEA 2XRSD 2FHTA 2K7VA 1ILQA 5AUIA 3MXUA 2K33A 4IUVA 1K53A 4YSXB 2Z1CA 4R8NA 3IAS1 1A15A 1IL8A 5C5MA 3AEFB 2R7ZB 5M9OA 2PZUA 2SAKA 1MI2A 1DOLA 3L7ZC 4A3DB 1P7FA 1BOSA 1PDXA 5A2QL 1LO5D 5IGGA 1KABA 4K6DA 4KJOA 3W1SA 4KY7A 4FXDA 2RQXA 1L4DB 2WXIA 1F2LA 4XYQA 1SMYC 1FCLA 1HQMC 4FF4A 2JA6B 1A70A 2L1BA 3T13A 2CJNA 3RUZA 3DWQA 3FDTA 4IQZA 2WQYB 2IWHA 4MN3A 4IFDJ 3QOLA 1YNTE 4V0BA 3HOZB 2M00A 5EBCA 2WIIB 2WLBA 1STYA 4HN7A 3OIQA 2VB3X 4EQOA 1XTCD 1SB3C 1PRTD 3C3LA 1QOHA 1AP0A 1H9KA 1EY0A 1D5ZC 1FXAA 1OQRA 3IFDA 1FMAD 2K03A 3R2TA 2HQEA 3SR1A 4CJ1B 1C48A 2B2UC 5CV9A 2W3RA 1MBYA 4EE2A 3DMUA 2NVXB 2J4XA 3GV6A 1G6ZA 4KN4C 2D5GA 1E2VA 3B2GA 1Q90A 2K0PA 2X6LA 2W3SA 2N55A 2V3PA 4FXKC 1ROEA 3MTSA 4WIPA 1K51A 2W82A 1YJIA 2L9HA 4E6IA 1UGJA 4A9AA 3MAQA 5BMHA 5LL6X 1EEFD 1EWYC 4LK0M 1I4GA 5KNCA 1ILPA 2XRQD 4EQNA 3TUOA 3KWLA 3H3VC 1J7CA 3ITPA 1STBA 2F0TA 2L83A 2WU2B 1TR5A 3SHLA 4HCSA 2ENBA 1E0ZA 4WURA 4ZHOA 3W5UB 4FF1A 1PFNA 2FBWB 3EA6A 2BE5C 4KHVA 1BCPB 4XT3B 3LWEA 1EY7A 1DD2A 3N6RA 3PUXA 1O80A 2A74C 3VYSA 1C4QA 1UUPA 1CZWA 1Y8OB 1N63A 2WXLA 1WCMB 1TU2B 3JAME 4EGVA 2LHDA 5BN4A 2Y3AA 3TEXA 3VR4A 3LYYA 2WXNA 2N7JA 3QIAA 3X3MA 5BN3A 1S4ZA 5IGBA 3WOEA 4YTPB 1B9NA 4H2AA 2K5PA 3HVZA 1TQOA 5CBAE 2RPVA 4MHEA 3VQIA 1FEHA 3GO5A 1K50A 3EVQA 1ZDVA 2PMZB 1RDPD 4FP5D 2KUMA 3FILB 5HURA 2Y5PA 1PZKD 3NBIA 2K5QA 2E6XA 5ELDA 3MC0B 3ND8A 1YQ4B 3EQLC 3TP6A 3KLSA 3H94A 2B63B 1DOXA 1CI3M 2IPKD 1TS3A 2L32A 4JBWA 5C0XH 3PO0A 3MHZA 2KVMA 2Z4HA 3A8IE 4A93B 1MHXA 3L3OC 3L9AX 2V3NA 2EYHA 4FF3A 2F03A 4NMZA 4A3MB 1S5CD 2NN6H 1CK1A 2RSNA 5EJWA 1JWBD 3V05A 1KTKA 5HG2A 1JOOA 3VR3A 1DOMA 4JK1C 1PTOH 1CHQD 2AWOA 3MJ5A 2OF1A 4M8AA 4KY5A 1XEEA 1JR0D 4DAYA 4QF4A 3NSWA 2LMCB 3H09A 1IW7D 2M2LA 1OXTA 1TKEA 5CGKA 3M3YB 3TP5A 2NTTA 1ET6A 1HA6A 3N9YC 1V8CA 2KEDA 5H8YE 2A6ED 5EGTA 2JX5A 4LMQD 3C2PA 2E2HB 1SSOA 3HOYB 2TSSA 1SYFA 5EE0A 5D14A 4G7HC 2SNSA 1B4OA 4KJNA 4Q0FA 4DXGA 1PZJD 1CT1D 1E2ZA 3RD4A 5T8IA 1PRTC 5CC4A 1GXDC 1VJKA 3QJYA 2ZXRA 2N88A 1SBBB 3URYA 5CV6A 1PFMA 1Z47A 4OO1H 3CHBD 4US9A 5D7GA 3HP3A 3SE0A 3J7AF 1EYCA 3KBGA 5COYA 1EY8A 2IX0A 3ZJUA 2XNAC 2DYOA 5AUKA 4HROA 1BF4A 5T1GA 2Y5CA 3OMCA 1C77A 3P4SB 1GAQB 1RFKA 4EVOA 1O7ZA 2B2VC 4YWGG 1WTVA 3EGRA 1NUCA 4BY1B 2F0SA 1ZXTA 3I9V1 4X3KA 4XQQA 4KV6A 1KNAA 1SNPA 4ABNA 1H9SA 2K1BA 2KJXA 3U2SC 2OEOA 3B9JA 1EU3A 4IOIE 2F0HA 3TDQA 1TS2A 2JE6I 4HR7B 4RNAA 4KD4A 2F1MA 4GLSC 3BDLA 2SDFA 1X32A 2IDYA 2B2YC 3H0GB 3SFEB 4H7BA 5KEEA 3IAYA 1L5PA 1TJEA 4P16A 1LACA 3VR2A 1PTOF 4C3JG 2WXRA 4K6LA 1VLBA 3DHQA 3AMZA 1SJED 3H8HA 5JEAG 1FR3A 2A68D 1TWHB 5K36G 1Q10A 1ENCA 4NW2A 4FNFA 4XXEA 1EFID 4CQNA 4X3UA 1JE4A 1GOZA 4IDIA 2BS4B 2K04A 2XVSA 4C80A 5TSSA 1PFDA 1MSHA 3I57A 1YMHE 1ICWA 1HEZE 2WXHA 1G8ZD 3OPOA 5EKLA 1TWGB 1N5XA 4K8JA 3KBXA 4USAA 3I8ZA 4A6QA 2H1EA 1Q1BA 3IT6B 3T4AC 2EYPA 4ZYSA 1PGXA 3BWUD 3AE6B 2F0KA 1Q3LA 3CIRB 5HHDG 5ISRA 1CZGA 4C1NK 5C4JB 1IYVA 1EM7A 4C3IG 2EYJA 1JQYD 1XO3A 1QG7A 1SYGA 2NVYB 4KMUC 1OXSC 1NI3A 3CKIB 2INNE 3VRBB 5ELEA 4IUPA 3Q8EA 3SXHA 1U4MA 5H92C 3ZGZA 3SFDB 1G2SA 4FVMA 1DOIA 4DF7A 2NVQB 3FEWX 2NN6I 3W3AA 5E3FA 2PZTA 3TZUA 2PIAA 1KH0A 2D5DA 3FPPA 3ZYYX 2F0NA 2WDRB 1RF2D 4L6TB 1STHA 4R9WA 3DXJC 2IX3A 3MWYW 2B2TA 4ZKCB 2MJDA 3OIPA 2ZT9C 1EZ8A 1MHHE 5FKAC 1EOTA 1F77A 3Q8AA 1K52A 3KK7A 4YSYB 1RM6C 4XDDA 5DNFA 1S5BD 2Q8IB 1ONLA 2NB0A 5DM73 2BW2A 2KDMA 2K6AA 3CRLC 5CYUA 5EPKA 4KK7A 3S16B 1FCCC 3PZ7A 3ONAB 1JRPA 1NENB 1JROA 1HUNA 5C3XA 1D1KA 4F7XA 1PUTA 2EYOA 5C3JB 4CJ2C 1HTLD 4WQMA 2A6EC 1FNWA 3NWTA 4QCLA 2H89B 1F0ZA 4O42A 2I46A 2JA8B 1OXVA 4RHRA 2PTLA 1WD1A 1SE2A 3G7LA 2FJ2A 1IGCA 1MPEA 3TZDA 4NDXA 3EROA 4OZCA 1D6EC 4CKEA 3DEOA 1A3TA 4K5VA 4L63B 3AU7A 4OW0A 5KIXA 1LTGD 1MGSA 4HTHA 2KACA 2YEPF 3P4QB 2ZW0A 1PTOD 2FUG1 5BMGA 4KI0A 4OIJA 3Q6SA 1NR4A 2CVRA 5KNDA 2X38A 4WH4A 2IJ0A 4RA8A 1F2RI 2O5JC 2RDFA 2RA4A 3MXGA 1L0YB 1PFBA 3W9CB 4KKSA 3BZDB 3MA2B 4HMIA 3S14B 5I2XA 2NWGA 3NHHA 1N5WA 1R4PB 1B44D 2L4NA 3P1HA 4J6HA 2M19A 3CRKC 3OOCA 3GB1A 1VF5C 2KQ4X 3GTJB 3U9SA 5CV8A 3V2TA 1RWSA 2GA4B 5M3MB 1C8CA 4REZA 5E6JA 3W5VB 5KGUA 1BCPC 3CU7A 1T5EA 1JORA 1VDVA 2LGIA 3Q8CA 1RTOA 1U9RA 2BS3B 3DUZA 3JAML 3AEGB 2AUJD 1PLFA 4OIKA 1LT3D 1QWYA 2FMMA 1QT9A 4BS9A 2QSDA 1QKZA 4IURA 1A3VA 3VR5A 1T5XD 3BK1A 2FINB 5EE9A 1F2MA 1TWCB 2TMPA 1TS5A 4LLGM 2F4IA 2IT1A 3J7AV 2XSCA 1R4QB 4G57A 3VYTA 3FMCA 5F2DA 3P42A 4TSSA 3EFXD 5J39A 1JC7