5D3DA

Crystal structure of staphylococcal superantigen-like protein 3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
190
structure length
190
Chain Sequence
KYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQLKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Staphylococcal Superantigen-Like protein 3
publication title Structural basis for inhibition of TLR2 by staphylococcal superantigen-like protein 3 (SSL3).
pubmed doi rcsb
source organism Staphylococcus aureus (strain nctc 8325)
total genus 53
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5d3dA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5d3dA01
2XRSD 4RHSA 1BXTA 1I4QA 1RF2D 2R61A 1LTBD 1GOZA 1PZKD 1LT6D 3KLSX 2NTSA 1HQRD 1JR0D 1G8ZD 1AW7A 1EEID 1XXGA 1LT3D 3BVGA 1D5XC 1FNWA 1PTOC 1SJED 1ENFA 3BVMA 1S5CD 1CHQD 3BVZA 3DWPA 3BZDB 1TS5A 1V1PA 3EFXD 3BYTB 1HA5A 2RDHA 4L63B 1YN4A 1XTCD 1B1ZA 1PTOD 5ELDA 1LTTD 4BWGB 1EU3A 4TSSA 1T5XD 4K6LA 4Z9CB 1MD2D 1TS2A 1QILA 1PRTC 1BCPB 1RD9D 4C56C 2ICIA 3O13A 1TS3A 1LT5D 1PYWD 2IJ0A 1I4RA 1S5BD 4RGOS 1S5FD 4ZYSA 1L0XB 1UNSA 1SEBD 1I4HA 2QEJC 5ELEA 1RCVD 1S5ED 1JQYD 3V05A 1LTRD 1PRTF 1M4VA 5D3DA 1CK1A 1EEFD 1D6EC 1FNVA 2SEBD 1LTID 3TSSA 2IPKD 1YN3A 2WV6D 4DXFA 1KLGD 1STEA 1V1PB 4RH6A 1ESFA 4DXGA 3GP7A 2XN9C 1ET9A 1KTKA 2NTTA 2O2LD 3DWQA 4OHJA 1EU4A 1PZJD 5D3IB 5FKAC 2J4XA 1LTSD 4RGMA 2CHBD 4O1NA 1KLUD 1V1OA 3MFGA 3SEBA 1BCPC 1CQVA 1RDPD 1PTOB 1YN5A 4RCOA 1LO5D 1F77A 3OWEB 4RFBA 2TSSA 1PRTD 1I4PA 4RGNA 5ELFA 1I4XA 1LLRD 3MC0B 5ELCA 2AQ1B 3CHBD 1TY0A 1FD7D 1SE2A 1UUPA 1SE3A 4L6TB 3R8BA 1D5MC 1BCPF 1SJHD 2Z8LA 3EA6A 5TSSA 1I4GA 1PRTB 1SE4A 2AQ3B 1EWCA 1CT1D 1CHPD 1DJRD 1FNUA 5I4DA 4NZLB 2XRQD 1SXTA 2AQ2B 2RDGA 5ELBA 5FK9C 2XNAC 3R2TA 1JWSD 1LTGD 3R2IA 4RHRA 4UDUC 1TS4A 3DWAA 2G9HD 1L0YB 1S5DD 1PZID 1JWMD 1DYQA 1PTOH 1TY2A 1EFID 1AN8A 2QILA 3BYYB 1HXYD 1BCPD 4RGTA 1FGBD 1LTAD 1SBBB 1LT4D 1B44D 3URYA 3W2DA 1D5ZC 1JWUD 1HTLD 1PTOF 1ET6A 1JCKB
chains in the Genus database with same CATH superfamily
4RHSA 1D2BA 1I3QH 3L9AX 4N8FA 1UBIA 3BIID 1U0LA 2VY3A 2KN5A 4P16A 1J7CA 5EPKA 4MZ9A 3M4OB 1V49A 4MACA 2B2TC 1WXAA 3L4PA 2CQOA 3PUWA 2KHWB 5IAAC 4HEDA 3CC2A 1T0SC 3BINA 4US8A 1UE1A 2L4NA 3QG1A 2K0PA 3MEHA 1O7IA 1RTOA 4Y7NB 3RLOA 1OXXK 3TMEA 3DVGX 3BYTB 3L10B 3I9V1 2QIEB 5C4JB 1UELA 1FVIA 1NAPA 1P0RA 1MKHA 3DVGY 1LM0A 3RNCC 4M1UB 4JOIC 4K8IA 4AH6A 1OFFA 5M5YB 3AEGB 4QQBX 1SNMA 3GTJH 4OWTB 1JC7A 4IUQA 3A56A 1K28A 3QOLA 1L0XB 5IGCA 2E2HB 2FIFA 4ACFA 2F0HA 1UE7A 2ZPYA 2G5DA 4C1NI 2DJFC 1B50A 2FUHB 3RULA 2HDEA 4NB3A 2K01A 2N4FA 4QAYA 3W1SA 4B3TL 5FO8B 1I50B 1KHIA 1SYDA 4HIOA 1LTRD 2RR9A 3RD2A 3L7ZC 3JW0X 4IUMB 3CF5A 1Q1BA 3T9LA 5L83A 3DCGA 3L16A 1IYFA 2L1AA 4DV0L 4A3DB 2FUG1 3TBLD 1JALA 1PA6A 2AUJD 3B0AA 3VVWB 2I2YA 1VJKA 4BBRG 3CMMB 4IWQA 1TKWB 1WTPA 5AFWA 1VQMA 2LGXA 3ZGZA 4J8QA 4AQYQ 1VQGA 2JU6X 3D8GA 1KDCA 5EGTA 5J2RA 2QKIC 2CWPA 1MPEA 4LF8Q 2ES2A 1X65A 5D65A 5JJKA 1GD7A 5FJ8G 1TT5B 2L83A 2KJ6A 2KVRA 1I4XA 1N33Q 2ONQA 3ITPA 3VQIA 3P4SB 3T51B 1VQHA 1Y56A 3D6CA 2A69D 3E9IA 3RZOB 1YBYA 4GMVA 1Z47A 4LUZA 1XD3B 4LCDE 2F3IA 2PE6B 1TYGB 1F2MA 2NZHA 3KLSA 5LXIB 4ZRIA 2MW5A 1J19A 4GLVB 2Y3AA 5BR8L 1WMHB 2NBWB 3C8YA 5CHWA 5TR5A 4M0WA 3CU7A 4OWWB 1L1OC 2IHEA 2PMZB 2KD0A 2M0AA 2QCPX 1ZPSA 2NBVB 2OF1A 2EMTA 3UINB 1HNWL 1PZID 2L05A 1U4MA 3RT3B 5CGKA 4ZOHC 3ULJA 4X6AH 1OQRA 1FXIA 1AN8A 3MWYW 1WYGA 2FCSA 2WS3B 3OG5A 2VL6A 1E5WA 2VUMB 1N34L 1RFKA 2EKIA 2IL8A 4FHJA 2F0GA 3T53B 2WKCA 3D0FA 3VFKA 4A90A 4G7ZC 2K8BA 2M0XA 4KZCA 2HUGA 4NP5A 4HJ9A 2DY7A 3AE5B 3A74A 2DY8A 4I6PA 3UQBA 1ZKHA 1N36L 3J81i 1X6OA 3SDZA 2GN5A 3GTOB 4FADA 1PFBA 3F1ZA 4APVA 1IGDA 2N9XA 1BQQT 4JGHB 1WGYA 3KLSX 3ND9A 1UGMA 1J7BA 3WAOA 5L95C 3PQIA 1VD2A 1LT3D 3RCZA 1PTOC 1IKMA 1U9RA 3AEFB 1KNEA 2WB1G 1E2VA 3BVMA 2KFKA 3H3VH 1P7FA 1C79A 1PFNA 1X3QA 4H0LC 2INDC 1N60A 3E6ZX 2ZXPA 3M4PA 3ZUNA 3HUIA 2WXPA 4DHJD 1SIJA 1W2BA 1GXDC 1WTOA 1SNDA 5G5GA 1T5XD 4M8AA 3I8ZA 1Q90A 4GKJL 1SSNA 4GOPC 2D11A 2OT2A 4BXXG 3K57A 3HOUH 2D10A 1EFWA 2MJ8A 3O13A 5IODA 4G7OC 1N6ZA 1QOGA 3MEFA 3I55A 1YQ4B 1A3VA 2BA0A 2MGSA 2QJLA 4ANVA 3IFDA 4RMAA 2HHHQ 1NBWA 3V6EB 1G2SA 1SEBD 1UNSA 1VQDA 1U4AA 5E6PA 3K6OA 1Q8IA 4MTKA 3H6NA 4A6QA 5CX3A 4LFBQ 1AWDA 4QB4A 4NW2A 2BPSA 1FL0A 3NWTA 5D3DA 3ONSA 1E22A 1FNVA 1LTID 2B2WA 4ILWA 4KTAA 1P3QU 2INCC 1TWFB 2N8NA 4PZ8A 3AE6B 3HOXB 4JL9A 2BYTA 3I4LA 4TRDA 1YNNC 2FJ2A 2JPHA 2WXRA 2YTVA 5EKIA 2WXHA 2ZM6L 3H9DA 1L1OA 1XX8A 1SYCA 2LY7A 3R3OA 1EY8A 4PZ6A 1ASYA 2R92H 2KA7A 3KQ4A 5C4XB 4J6IA 4LF6Q 3N20C 2B3GA 3HS0C 1IP9A 2QDBA 3OMGA 3A8IE 1WJUA 2KMCA 1GHJA 1STNA 1UE6A 3LYYA 5E1FA 3OIQA 1GC6A 4K14A 4ANWA 1N8RC 2K3UA 2R7ZG 4XC2A 3K5LA 5GROA 3Q3NC 4KZ0A 1SN8A 1XPRA 1BCPF 5JPNC 4K8JA 1TQOA 4KLKA 1K8RB 1DOMA 4GS3A 1U4PA 2WXLA 5F2DA 5DM73 3NJTA 1DJRD 1FNUA 2VQFL 4G50A 4HN7A 2M9VA 1QVCA 3UI2A 1WTVA 2LI5A 4KIKB 2RF4A 3MHZA 3A5ZB 2WX0A 2RSUA 1YNJC 1LTGD 4JI0L 1FRRA 1CI3M 2VS1A 2CKHB 3SFEB 5IYBG 4IJHA 4FDBA 5DPTA 3NQIA 3CW2C 4X3KA 5CR3A 3DWMA 3H6MA 3U4VA 4AUQC 4GNXC 1IL2A 4YY3L 1MBYA 4N9PA 5L37A 4DV6L 1JOQA 4OIKA 2FCQA 3X0WA 4KHPL 1UWMA 3DHIC 4A9AA 1YNXA 1E0BA 4C3JB 1Y8PB 3OYYA 1SBBB 4ZAIA 3AE9B 4F8MA 4NJ7A 1KF6B 2PCFB 1E8XA 2KTRB 1I42A 3I5JC 4JBWA 4ZRJA 2CW0D 4W9KA 4WURA 2KLCA 2V3NA 1L6VA 1UGJA 4E74A 2B2YC 2VH1A 1VMPA 3PUVA 1QOHA 3QK0A 4JYAQ 4ALPA 1LTBD 1WI5A 4PMCA 1RWSA 2ID0A 2RHQB 1EIYB 5KNDA 4IJLA 2NUCA 4ID6A 4ZRPA 2NPTA 4FULA 1EYGA 5BMGA 2K05A 1NJIC 3AE3B 5C3EH 2KOLA 4C3IG 2N1VA 1HR0W 3I63C 1HA5A 1VQIA 4JI4L 2RMMA 4TQ0A 5JVH3 3A9JB 1Y1VH 5J1ZA 1E2ZA 1DGJA 3STBD 4IPCA 4H2AA 3AQQA 1EU3A 2HCCA 5EBCA 3GTJB 5C2TB 5DNFA 2L00B 3HOVH 5BR8Q 3L0WB 4LNIA 3D4DA 2G1EA 4IFDH 2ZNVC 2A69C 1S5BD 3PIOA 4F7ZA 4A20A 1YQ3B 2D62A 2R7DA 3VAWA 1HNZL 5IOCA 1WSPA 1XQQA 2PE9A 1FXTB 2O6VA 5LL6S 1T5EA 1TT2A 4K7SA 2OEDA 1JB3A 3FP9A 3KLWA 1D6EC 3CCSA 3ZKJC 1I5FA 1CMXB 3HKZG 4DR3L 2AWTA 1QKZA 1A6XA 4LK0M 1K0RA 3SK6A 3U2SC 4LDTB 3QHTA 2J4XA 1YJ9A 1PH5A 1FMAD 4F1SA 2KCMA 4C3HB 3S2DH 3S1RH 4K5VA 2JQRB 5BMIA 1N36Q 4RG1A 4FN2A 2XIWA 2D07B 3CRLC 4XYQA 3TREA 1RDPD 3BS1A 3K7AB 4YSYB 4YTPB 3ZRFA 1F77A 4GN3B 5FLXL 1CZWA 2JA7H 1PH6A 4RFBA 2Q8TA 3ZTCA 4AYBE 4J15A 1GUAB 3S14B 2VZKB 1JMCA 3UDXA 1I7HA 3I70A 3JAML 2Z4IA 1SE3A 2KEDA 5GQOA 3PLUA 3QO2A 4KN4C 1VDVA 4FJZA 2PNRC 2AL6A 3EFCA 4F87A 3RPFC 4CGYB 4FXGC 1NY4A 3AULA 1I4GA 1PRTB 2HJ8A 2B2YA 2K5PA 5GXGB 3GB1A 2ZJQA 4BY7B 5I4DA 4GKJQ 3QIAA 3QA8A 2VRRB 2BDNA 3NRZA 4B0EA 2ZXRA 2AQ2B 2GVAA 2L12A 1RJTA 2RDGA 2EELA 3AEDB 1SFOB 3FKIH 4MJSB 1JWSD 3KH0A 4C4VA 3L17A 4UDUC 2QEXA 3JC66 2JA8H 3J9CA 1VZ8A 2G9HD 3WOEA 1IBML 1SNCA 1HCZA 3FHWA 3VXWA 3R7RA 1DYQA 3H0GB 2V3PA 3C1FA 3S16B 1EFID 2OHFA 4RGTA 3W1YA 4TUUA 4HCSA 4XQNA 4LF9Q 1QOFA 2K75A 1R9TH 4P2CB 3FAHA 5CV6A 4XQJA 1EQRA 2KFJA 3VTWA 2F0PA 5LMNL 1PTOF 4MNOA 4EE2A 3AXCA 4DNIA 2ZVNA 3HFZB 3PF5A 5CBAE 1HUMA 3T1YL 3OWFA 2R61A 5FLXE 4TQUS 2IT1A 3U4EG 1IYVA 2N9PC 4QUFA 4JI1L 3Q6SA 3MC9A 1G8ZD 1WM3A 5IGBA 2J0TD 2FMCA 3JAME 4EZJA 1B4OA 1SJED 3V2TA 1KXLA 3RNEC 3K9PB 3M4YA 3U50C 3E9HA 2Q8RE 3A9KA 3IKJA 2L55A 3MJ5A 1XNQL 5IP9H 2KMAA 2PW9A 4DR1Q 1C76A 2N7EA 2YYZA 2VQEL 3A7LA 4WAFA 3HOUB 4MM3B 3KK7A 3I4MB 1ZP0B 2A8VA 1N63A 4A3KB 1MD2D 1SNOA 1TWHB 1BCPB 1H9KA 3ML8A 1LT5D 2K1BA 1VQKA 4LK1C 4KHVA 4KJNA 2O2VB 4OELB 2QEJC 3HG9A 4CYEA 3GV6A 1RM6C 2EY1A 4LF5Q 4A93G 3I4OA 2N9KA 1N61A 3AMUA 2HTME 3A1QB 4YY3Q 3E9SA 1GM5A 2R92G 2J0JA 3M4OH 4KHPQ 5JHBA 2OWOA 5CV4A 1JOKA 1CA5A 1E9MA 2JUOA 5E6NA 1GO3E 5IOIA 1F2RI 4OVVA 2FMMA 3C3LA 4KDLB 3J7YW 3P63A 2K5NA 4LF6L 3G71A 1LYLA 1TKEA 2LJ5A 1P7EA 1L0VB 2K8CA 2QCZA 4RM9A 5C4JH 5I9PA 3Q14C 5K36G 2LFNA 2AEHA 3HOWG 2K25A 4R1JA 5M5YH 3ZRCA 3I73A 3NG0A 2Y0SG 3DVNU 4YWLA 2JA6G 4B0MA 2JWZA 3P42A 3MAQA 1NUCA 4BKGA 4PK1A 4HSVA 2MCNB 3PPAA 1L6UA 1YHQA 2CW0C 1SE9A 1UD7A 3RFZB 3G6EA 3PSEB 2AQ1B 4YXDB 2B2UA 2J53A 5IP7G 1PH8A 3PO2G 2UXBL 4EFOA 5C0XJ 2FINB 1VQ7A 5FO9B 1A63A 2HCIA 4A3MG 2PVGC 3R93A 3N9YC 5M3MH 4FF2A 1F2LA 2IO3B 3K5MA 1NDDA 1CFMA 4I6LB 4A3DH 2BKRB 3I3CA 2CQAA 2XSCA 1XLNA 5CV7A 1SYFA 3NBHA 3JSVB 2ASQA 3U7ZA 1O78A 3N1ZC 2XGTA 3E5SA 1BVSA 5IYDG 1VQPA 4GDLB 1IGCA 3VR8B 2BS3B 1VR9A 1L0YB 1QOBA 3HRDD 4WQOB 1FD6A 1HNZQ 2JWUA 3STBC 1XCTL 2K1FA 4II3B 4DV5L 1HTOA 1NVID 2JRHA 4HPMB 1IHZA 4V190 1NMGA 3H91A 1HJPA 4DR3Q 1N62A 2MQJA 2K4KA 3RZOH 3AEAB 4KD3A 5H1SE 2ZJPA 3GTLH 2E2JB 1T9HA 2C7MB 3NS8A 1B53A 2RQXA 2LRWA 4DK3C 2RPVA 3P4QB 2XRSD 3A0JA 4HMJA 4CJ1B 2V4LA 2IZVB 1QQRA 5JJIA 1C4CA 1IL8A 4DAYA 2IX1A 3HOZG 1LT6D 3NPPA 1PFMA 3RLFA 5NUCA 5C3EB 5IIFA 2JN4A 3K81C 3KW5B 3UQAA 3SR1A 3ZNGC 1ACCA 2O5JC 1Y1VB 3DPDA 2KYWA 1JWAD 5C3WA 4IWPA 3AE7B 3DEOA 2Z6BA 1VF7A 5ELNA 3Q8CA 2SAKA 4JI3L 3KBGA 4BWGB 1J6QA 5IP4D 4K6LA 4KV6A 3MTSA 1C9FA 1TS2A 3KF8A 2LGSA 2C7NB 3L54A 1GUWA 3F2UA 4DR5L 4AQYL 3FPPA 1YITA 2L52A 2MBBB 1PH4A 2MBOA 4PYZA 2I07B 4KKTA 4FYDA 2LMCB 3M63B 5IO9A 1J9OA 2EJGC 2LASA 4Q5VA 1LFDA 2UUCL 4MT5A 1NEKB 3CSFA 1N33L 4QMGA 1MHWC 1WY8A 4BOZB 1GUNA 2WB1E 1Y8RC 4OL7A 4B3SL 3AE2B 3OAWA 4OGQC 1R4MB 1ZW7A 4IWOA 1Q8KA 2EYFA 3M7NA 4B3RQ 3VDYA 2LUEA 1ZDXA 2PVOD 3NY5A 1C48A 3VHTC 1EYAA 4DN4M 4IQZA 5DPRA 3ULLA 2QGQA 1B3QA 4FXKC 1BR9A 1XYIA 1Y8NB 3DLLA 2IX0A 3C2PA 3T16A 1XJVA 3IFTA 5LMNQ 1Z2MA 2A74C 2RD0A 4ICUA 3V62A 4DAVA 2BA1A 3T1YQ 1VQJA 4G0NB 1K51A 3AE1B 1PTOB 2L0TA 4DDID 4GLAC 4RKBA 1JW9D 5D2MB 4JV5L 2KOXA 4DQOC 2F3WA 3ML9A 1GKHA 1F0ZA 2TSSA 2WLBA 1R4MI 3K58A 1N32Q 3VR2A 3CC7A 4ZHPA 1TY0A 4HDQA 2A68D 1SF0A 3ZIMA 2KTRA 1G6ZA 1V43A 1XNQQ 2KDIA 1U4RA 3KWVA 4GOPB 3IT6B 3ZVVA 3HKSA 3FKIG 1IW7D 5TSSA 1EF5A 4XE0A 1IBXB 4L23A 1HTQA 1V8CA 2K5HA 3U8ZA 1TWFH 1E10A 3G6JB 2CVRA 1F2ZA 3CP0A 3HOXH 3HOYB 5I2XA 1E7UA 2AX5A 3APDA 3QJZA 2W54A 2ZTDA 3TP7A 3FILB 5JPMC 4IOIE 4DA2A 1SYGA 4BKTA 3R2IA 4JI5L 2V4DA 3A55A 5C4XH 5G2NA 1EY4A 3CIRB 3PVLA 1S5DD 5IA7A 4JG2A 1PGXA 3GTMB 1RAXA 3KYHC 4KKSA 2JEBI 2Q5WD 1A3UA 2BGFA 1FGBD 2KWCA 2VB3X 4WWPA 1SLJA 3W1SC 1WCMG 3Q22A 3L2PA 4HPLB 4YTMB 3DHQA 2YU9B 5IE8A 4MGYE 1GVPA 1IYJB 5C44B 2F4VL 2IO0B 3APCA 4KKJA 3E3XA 2XK5B 4V0BA 3TCAA 1H9RA 1AZPA 4L5SA 3M7GA 3TP8A 3VH4B 1X54A 3TZUA 3VYUA 1WGKA 2EPBA 1L2NA 2JA5H 2F52A 2MBHA 1G91A 1C4PA 2NVYH 3H7PB 3OTOL 4FP5D 2CH4W 2ZTCA 1D5XC 2Z0EB 2KDFB 1E2WA 3BDOA 2GBRA 3OMCA 1RHPA 2JZPA 1S5CD 3BVZA 4MDKE 2CJOA 3Q23A 3M4QA 5DM63 1WR6E 4BBNF 1EM7A 2Z6KC 3CPWA 4YSXB 4DDGD 4BY1G 4A3FG 1KM7A 2Q2HA 2X6GA 4R9WA 4KJOA 1MG4A 1Y1WB 3HVZA 4H02A 4GN4B 1T6BX 4YHHL 4CQNA 1CKOA 1QILA 2BS4B 3KVFB 2O6VD 2EYPA 4NXMQ 3KUZA 1SGHA 4E3CA 4ZKBB 3M95A 2CHXA 3DBLB 3T3OA 1KL9A 2E76C 4GNXB 3TUOA 5M3FG 4HJKA 3ICEA 1GHKA 2N9EB 2ZT9C 1MVKA 2CJNA 4HKZE 5JH5C 4CKCA 3FVQA 2BE5C 2DZJA 2KWDA 3OOCA 1WTRA 4B9KA 2D3AA 2N7DA 2NN6I 3H15A 4DV5Q 4QCLA 1RRBA 3ZJUA 3NHEB 4N58A 5BYQA 3E0EA 4N6EB 3ZTDA 2MP2B 1E6EB 2EY2A 4K2LA 1QJOA 5ELOA 2SNSA 4JC0A 2NTTA 4N9TA 2ZW1A 5HGQA 1WJJA 1FFVA 1PZJD 3KOJA 4K2KA 1E1OA 2D9UA 1WXVA 3DBLI 5EAYA 3X23A 4NXNQ 4ZUJA 4KGSA 4MTNA 4LAAA 1WZ3A 3GTGB 2GBJA 3AEEB 1UEAB 1EY6A 2REXA 4MJSA 4IPHA 4OIJA 1V80A 1NI2A 2CHWA 2YVCA 2Z0DB 4LNFA 3NVWA 1YN5A 5J3BA 1WFQA 2Z4HA 1N5WA 1A3TA 1C4AA 2UUBL 1K8GA 1XMOL 1NTGA 4RKLA 4W9IA 1JORA 1K83B 5J18A 3X3NA 5I6WA 3UDGA 1EY9A 3H94A 1WRIA 4B95A 1KAWA 4L6TB 3R8BA 2IY5B 5KYLA 5M3MB 3S2AA 2CU3A 2JYOA 3I91A 2PNHA 2ATWA 3EGRA 1WR1A 5C0XI 4W9JA 1EIFA 3EA6A 3HKZE 1FJGL 1YX6B 2GBMA 4EZKA 1KH0A 1TXYA 4JI3Q 2H4OA 1CT1D 2MLBA 3A33B 2KN4A 4A3JG 1ML0D 4FXDA 2HT1A 1JOOA 2DN8A 4DK6C 2UXDL 1WE6A 2GBNA 3ONAB 4JYAL 3SU8X 5CORA 4DR5Q 2A19A 3C46A 2BWES 2W3SA 4C3HH 1WYDA 1E7ZA 2KMMA 1FIQA 2MRPA 4XGAB 3BDLA 4MSMB 1JWMD 5CBEE 3TJPA 2NCNA 3PHWB 4K3CA 4YSZB 2UUCQ 3K7AH 4CDFC 2J0KA 3ND8A 2Z6KA 3TZDA 2KVZA 2EYHA 2EDGA 2V0GA 3DM1A 5D14A 4LFCL 4HWIB 1VQOA 3URYA 1X55A 4B3SQ 3GTLB 1PMRA 5CC4A 3S14H 4JX1C 4IM3A 1UBQA 5AZHA 4ABNA 2B2WC 3WCQA 1EWHA 2OCEA 1OQQA 3SE0A 4R4TA 2LXJA 1GB4A 3EBEA 4A4IA 1IBKQ 4JW0A 2KLGA 4LJPB 5KHQA 5J17A 4DUZQ 3QOJA 1B9NA 3U4ZA 4DHZE 3PSIA 2NVXB 4BY7H 3VTVA 2WINB 1SIFA 2L76A 2XTIA 1T0RC 2D2QA 4HLEA 5EE3A 3U58A 4JV5Q 2UXCL 3RN2A 1SFOH 1H95A 4B9XA 2VUMG 3AFQA 1XTDA 2N49A 4JCVE 2CU1A 3CSTA 3PT2B 1A5RA 4LWCA 1ICFB 4WFN3 1L2FA 3H0GH 2B63G 3TRZA 1NENB 1K50A 3S16H 4K7UA 3A8KE 4WIPA 2KACA 1GUSA 4C80A 3W5VB 2F0NA 4B6WA 4QIWB 5C1ZA 1NYQA 1VQ6A 1RODA 2B76B 2ON8A 1STHA 3S17B 2XWBB 1SNPA 1WGHA 2WDVB 3C19A 2KHJA 2A68C 4DHJB 4DFAA 1Q0WB 1S5FD 2MBEA 5IWAQ 1X9NA 3TN2A 4JI5Q 1B7YB 1SAPA 3AU4A 1J8CA 2A4ZA 3R66C 1IW7C 1C8CA 1V86A 4P1CC 3V05A 2D3CA 4A75A 3PV0A 1ONLA 3JYUA 3IL8A 2F0VA 3MZ5A 1PRTF 1M4VA 1SRUA 1EEFD 2IHFA 1Y14B 5EQ0A 5G3LD 3TEXA 1EQTA 5I9OA 1QNKA 1WOCA 3G7LA 4DU9A 1VQ8A 3ERSX 3NZSA 1IBLL 3I56A 5FKAC 4DGZA 2F4VQ 2J0MA 3CMEA 4K0KL 3LJ3A 4CO7A 3ER0A 1EO6A 4I7AA 3RNUA 1JMLA 3KDFA 3P4RB 4TMAB 2WP8J 1X3GA 5BN5A 1V1QA 3I4MH 2F0UA 1J7AA 2GBKA 1BBWA 2UUAL 4HJ7A 4A3KH 1TWHH 1BUIC 2F1MA 4HVBA 4ZKCB 3OTOQ 5EJWA 1VRAB 4PT5A 1E3PA 4BVUC 4XT3B 2HE7A 2BYEA 2BDOA 4XQQA 3OLMD 2OJRA 1PH9A 3MXNA 2WXOA 2I5LX 4A3BG 1T0QC 1D5MC 2HD3A 2KCNA 1CKNA 2NR2A 4LF9L 2Q2TA 4KN7C 3A8JE 1CZPA 4A3IG 3DBSA 2BVCA 1OXTA 4OO1G 4DPGA 1I6HH 1CHPD 1AYFA 1WH3A 4HK2A 4WJOA 3UI3A 1BBUA 1DOKA 2HIVA 4YHHQ 2QA4A 4NAWA 1G291 2L11A 1WGDA 5M5WH 1A70A 3MVVA 3J80c 3Q3JA 4BKSA 2O5IC 1EZ6A 3QWZB 4N9F4 2Y0SE 4J1MA 3MHSD 1QT9A 2V9HA 3KFUA 4EVOA 4FF1A 4JBKA 4A3OA 1CQFA 3RMKC 2PO4A 1OXSC 1HEZE 4JQWC 3UE0A 3HRZC 2JZZA 1ZOYB 2XVSA 5IGFA 3V96A 4DR1L 2YEPF 3WALA 1X1MA 1JWUD 2A73B 2V4IB 1LGRA 3HVDA 4WAAA 2JA5B 4DR6L 3N1XC 2NVYB 1E7VA 3PUZA 2KX3A 4ZUIA 3CCUA 4I65A 4IG7B 3J7ZC 1M1KC 2HD5B 3I7FA 3KF6B 3MXGA 4LUVA 3D32A 4CDDC 2KJHB 1PZKD 1W6KA 1TIFA 2ACZB 3Q8BA 2DJGC 1F1HA 5JEAH 2CCZA 4WWNA 1AW7A 2MFIA 2KANA 4CHKA 1H9JA 3GTPB 2UUBQ 4LF5L 2AWNA 3C0RB 4C3JG 2K5WA 4PZ7A 5GAEC 1XMOQ 4JI2L 3QX1A 1C78A 2VH2A 3PRMB 4A3GB 2RHSB 2H88B 3BWUD 3DWPA 4ULLA 1TIID 2A1AA 2DWQA 1BKBA 2MJDA 1QZHA 1WTXA 3K9OB 2KAJA 4DK0A 1C1YB 3S1MB 2J7ZA 1FJGQ 3Q8AA 4RF0A 3QB3A 1Q82C 4P6VF 3W1BA 4UP8A 1QG7A 2DYBA 3BJUA 5A35A 4IKGA 2UXDQ 2E2JH 1MSHA 2IJ0A 3J81L 1I4RA 3IG3A 4L1BA 2G45B 2MA9B 4GDKB 4IW0A 4EQPA 3KUCB 2KECA 4A3CH 1V97A 1ILQA 1MI2A 2H1EA 4CDEC 4I6NB 4ZRZA 1CK1A 3TSSA 4DUYQ 1O7YA 4LFCQ 1MIUA 1KLGD 4DV4L 1VLBA 4IM2A 1MJDA 3PRPB 2RSNA 2XN9C 3KUDB 3N32A 2BOSA 2JX5A 3CPFA 2DX5B 1WFYA 3NZUA 3NVVA 2JT4B 3WDNA 2C5LC 5JOBA 4URKA 4LF4L 1D1IA 5LLIA 4DAMA 1KOTA 1WX8A 2EYOA 1X3EA 3NHHA 1QVGA 2PJHA 3AFPA 2L1BA 4DR7Q 4NY0A 2EKEC 4S17A 2MO0A 3OWEB 3WANA 5LXHA 1Q12A 1L0WA 1ZE3D 2EIFA 2UXCQ 3A5UA 4S0RA 5BYRA 5ELFA 2M00A 5FLMH 4NDXA 2IO1B 3PO3H 2IGHA 3T56B 2B8GA 4O42A 4R4CA 1Z9FA 4IOAA 1WX7A 2AYOB 4N8X1 4C3IB 3Q0AA 5DPWA 2PQAA 3D6WA 4GLSC 3ALBA 1NE3A 1BO0A 2L3ZA 2KJXA 2JXMB 5AUIA 4DV2Q 4HROA 1EWCA 3M85A 4C2MB 2DHZA 4JIOU 4MH0E 3PIO3 3J81E 2NVUI 4NZLB 3TEWA 2SDFA 1XCQL 1PFSA 2OTJA 1J5EL 1MSGA 1CTMA 2F0JA 3I4NH 2YTXA 3UF8A 1H8CA 1MJCA 4HIDA 1QVFA 4KY7A 1RLFA 2MX2A 1PTOH 2X6LA 1T0YA 2DZMA 1M8AA 2KX0A 2W3RA 3NOBA 1D1KA 2ZTEA 1TWCB 2F0IA 3CMAA 2I5MX 2K5QA 3U9SA 1D3ZA 3H09A 2VXWA 2WAQE 4X3UA 4A76A 1WE7A 5EE0A 3W2DA 4D2KA 1D5ZC 3ABVB 4TV3A 2LS01 1EZ8A 2ZCBA 4A3EH 4BY7G 2PI2A 4PG3A 1IBLQ 4DF7A 2KCCA 5IT9L 5KGUA 1FPYA 2V3SA 1HHVA 5DCNA 2WU2B 1QUQA 2FCMA 2EE1A 1WD1A 4K0KQ 1I4QA 2V1CC 4B08A 5C3XA 5IN7A 3GD7A 1W6JA 4RWSC 3S9WA 4JLCA 2LZ6A 3HOYH 4BAXA 2UUAQ 1JICA 1B9MA 1SE8A 2K32A 4R8IA 1Q7YC 5DAUA 1G6PA 2UWQA 4JI8Q 4XT1B 4RNAA 1CHQD 4A3LH 5C5MA 1S72A 2LVOA 4NNJB 4W9FA 1E8YA 2D0OA 1L4ZB 3EFXD 4UY8C 3GTMH 4B3RL 2XEWA 3QQ8B 2B2UC 2Q2IA 3GQBA 1YNTE 4M02A 3VDZA 3RYTA 5GMVA 1NBFC 1EWYC 2EXZA 2KC1A 3RNAC 4Z9CB 1B70B 2NMQA 3FPUB 3RZFA 1J0GA 3ETRA 2YU9H 1PH1A 1PQSA 2NB0A 1AZQA 5T1GA 5C44H 1V81A 4DAPA 3W1GA 1XNRL 1WJNA 2KQ4X 3Q6BA 4P1BC 2I5HA 1Q86C 2F03A 4W9DA 3UIPB 4AS1A 4LW1A 1SDFA 4YWGG 4OX9L 2GOWA 4OW0A 1N32L 1XWEA 1ZXIA 1RCVD 1LM8B 1HZAA 3ZXVA 5IGDA 3OW2A 3ZNID 3IHPC 3SXHA 2EOTA 1NMFA 1ZXTA 3HM6X 2C9WB 3HOUG 5H92C 2CWAA 4F88A 1Q81C 1IUEA 5IT9E 3JVZX 4HCPB 4HEA1 4G3XB 2WNMA 3Q8EA 2PI2E 2NZ1D 3BK1A 4PYUA 4K5WA 2N88A 1YHBA 2CHBD 2YLMA 1WM2A 1YJNA 2YEPB 4DR6Q 2VZAA 4O1NA 3APFA 4M8MA 3VH3B 3AN1A 2D5GA 5KHOA 2NN6H 3DBHB 3GTKB 3HEJA 2GB1A 5G5HA 1RL2A 1Y1WH 3D31A 1XEEA 4LFAL 3GE3C 1OEYA 4AWJA 3OW7A 1UE5A 1SSOA 4GXBA 4CKEA 1DZ1A 2D2CC 3BZCA 1LLRD 4RGNA 2WACA 4JI2Q 4BBSB 3NENA 4HIKA 3QR8A 3CCLA 3LB8C 1I6HB 1H4RA 3GS2A 4LF7L 4KI0A 1D8LA 3GOEA 1HZ9A 1ZEQX 3TMPB 5AZGA 3J80i 2FIDA 3DBHI 2AQ3B 4X57B 3M3YB 1WMHA 5M5WB 5IYCH 5M5XB 2K50A 1HFNA 1OXVA 3ZJVA 4M0WB 1WI0A 5HURA 2RPQA 1WJ6A 5JXVA 2KK8A 3KJOA 2MSED 4DWFA 2XNAC 2EMSA 5LMUQ 1AP0A 4H13C 4RHRA 5C0XH 3C1EA 5HY6A 1ROEA 3GTGH 1YJWA 1QZEA 1V5OA 3W3AA 3PIPA 2MUYA 1E8WA 1TU2B 2PMVA 4A93B 3OHXC 4IO9A 2Z0SA 1HXYD 1BCPD 4KGTA 1BMLC 1K8OA 1LT4D 5CMDA 3PO0A 2WXGA 3LNNA 5C5LA 4Y52H 1LABA 1V2YA 1CSQA 1K83H 2K33A 4DV4Q 1WZ0A 4KVGB 1HTLD 1CZGA 2IX3A 3L3OC 5JEAG 1A15A 1ISNA 1D4BA 1UAPA 4EKUA 4NXML 3EIVA 4LF4Q 2ZJDA 2NS5A 1F9PA 3HOWB 3LGJA 4K5XA 3V6CB 4PS7A 4DV3Q 4X65Q 3MXPA 1VQFA 1JR0D 4POFA 1C0AA 4GGQA 4PMWA 4REZA 3DXJC 2JA6B 1XXGA 3QARA 4BFRA 4HCEA 2UU7A 4WWMA 5KNCA 3H8HA 2EYJA 3J81j 2EVBA 2Z9HA 3CCVA 2KFKB 3FEWX 3GZNB 2K5DA 3O65B 4F8CB 1VF5C 4PV1C 3RD4A 4OZCA 1XTCD 5KEEA 1EQVA 4XDXA 4ZLTF 4A3MB 2W9NA 1EWIA 4NXNL 2INPE 1PYSB 2ENBA 2PMZE 3SK8A 2J52A 5HG2A 3PZ8A 5C3EG 4BBRH 1J5EQ 3AEBB 2A5UA 3BY4B 1DOYA 2FE8A 3PS6A 3GZNI 1HR0L 3Q8FA 3IVFA 2NVXH 4X64L 1Y1VG 2LFIA 1E7PB 2YTYA 1QZGA 1G51A 4ZCKA 2RBMA 3F2BA 3HOVG 1HPCA 5FJ8H 1V1PB 4UP9A 3GP7A 4IFDG 5A2QL 1EIGA 2PPHA 3Q69A 1WJ4A 3AMZA 4OHJA 5EDSA 3M3JA 3RN9C 1L1OB 2DGYA 4ICVA 3ZNZB 4EOYA 4NQKE 2GA4B 3VUYA 1HQMC 4JE3B 3ZDMC 1V1OA 2WFWA 3MFGA 2C60A 2JSVX 1Q10A 2IW3A 2KJRA 2DENB 2PZTA 2VW9A 2L0FA 4MSQB 2Z1CA 2RGFA 1LO5D 1YHAA 4QL5A 3N6RA 4X66Q 3PO3B 2K6QA 3TBIB 3S17H 2KQSA 3KBXA 2D0PA 3MA2B 4G4KA 1I4PA 1KDBA 4NKLA 1TZ1A 4CJ0B 2IYDB 2LXCA 5ELCA 2N3SA 3CHBD 3A4SC 5JZEB 1OTCA 5I2YA 1OGWA 1L4DB 4P71A 3LDZE 1ESRA 1F9RA 4USAA 2LXKA 4MIUA 4JK1C 2NWGA 3AEVA 1F52A 1FXAA 1IYUA 2NVQB 4BKSD 3AECB 2LKVA 1VS0A 5DPSA 3QJYA 4FA6A 2JA7G 1IBKL 1GNUA 3I4NB 5GAGC 2ICEC 3VYTA 2F3VA 4DUZL 5D7GA 4KIKA 2KO3A 5T8IA 3CRKC 1XNRQ 2R93B 3NEMA 2N7JA 1VMCA 4ZK9B 2N1WA 1BUVT 4OX9Q 1S3OA 1XPUA 2FAZA 2K52A 4R4IA 2C35B 2B8FA 4TQ1A 4US9A 4P75A 2KXJA 5CYUA 4HJ5A 1MFWA 4IURA 4L8JA 3W5OA 4CDCC 4A3EB 5A2QE 3A54A 4YL8A 2WAQG 2FNJB 1B44D 1K8MA 2O4XA 3VA7A 4KY5A 2BYVE 3P2BA 3F8TA 3PLVA 4NAMA 3IXSA 1Q1EA 2WXMA 4ARIA 3NELA 2IBIB 2OQKA 2WGSA 2ZCCA 4GU2A 1EF1A 4DR4Q 2P5ZX 2JA8G 1ET6A 3RMHA 2WXIA 3N30A 2NVTB 2N55A 1XPOA 1BXTA 3HM3A 3E0JA 4R4QA 1A0IA 2N0SB 4W9HA 1IKLA 3LX0A 2WYQA 4A3PA 2RCFA 1WTHA 4UPAA 5IWAL 5FR3A 1YJJA 1C9OA 4HAEA 4LFAQ 2LUMA 3S24A 3KJPA 4BXXH 1BT0A 2IGDA 3WWVA 2NPTB 4MN3A 3K8AA 4AYBB 4EGVA 1BNZA 4JBMA 5IKCM 1O80A 1PHJA 1IXRA 2OQ0A 3IAYA 4ODGA 4HJ8A 3GTQB 3NXWA 1TS5A 1VQEA 3DM3A 5KNBA 1S3SG 3A9JA 1PTOD 4LF7Q 4MH8A 3IAS1 1LTLA 1LTTD 4GIVA 1VCBA 4TSSA 4AJYB 4RA8A 4LUOA 4R8NA 4RMFA 3CCQA 2ZJRA 4C56C 2XBBC 3T3NA 5CV9A 3CCMA 2BH2A 1PYWD 3VA5A 3KWLA 3EC8A 1STAA 2G9DA 2PIAA 3NS1A 3N3KB 3T8MA 5IP9G 4RAUC 2B39A 1EL0A 2E74C 5ELEA 4IZ8A 4JWUC 1X32A 2O6VB 5FLXc 2HIXA 1ZKOA 3H3VC 1Q46A 3PZ7A 4KKIA 3D3RA 2D5DA 3TP6A 4KMUC 1YN3A 3RUIB 3VR3A 2K04A 4G57A 3GTPH 2QC8A 2VNUD 4YTNB 2ALYB 4DXFA 2EY5A 1STEA 1NCVA 4OONA 4RH6A 1WCMB 3JAMc 2C7HA 3DWQA 1KTKA 2O2LD 4KY6A 3CXCA 4A3GH 1A62A 3LXFA 1EU4A 1TGZB 3U52E 1QF6A 4IUPA 2PZWA 5BYSA 1B9RA 4MHEA 5KIXA 4BS9A 3RI7C 2DNCA 3A4RA 4GKKQ 4UHVA 2W82A 2EQSA 5IT9c 4GB9A 4J3OD 3S1MH 3HZXA 2LHEA 3K7UC 3SEBA 1BCPC 1KQSA 1UWVA 3DUZA 1VQLA 1JJGA 4RCOA 4MEMA 1KDAA 1QB5D 2A6HD 3MXUA 3QIJA 1YEZA 2IGGA 4PMBA 4QGUA 3CAMA 1V9PA 4YWKA 4AIMA 3ZYYX 2KHIA 3WAMA 2F0WA 4POGA 3T1HL 1HH2P 1AEXA 1YX5B 1UUPA 4M01A 5I6YA 5IYBH 3BU2A 3HK0A 2WXFA 1VQ5A 1R7SA 1YVCA 1C77A 4NPNA 2MJEA 4EUTA 4K6DA 3ZJYC 2QDLA 3N52A 4A3FB 4BY1B 2KBNA 3VR9B 4KDIC 1VZ7A 3TL5A 2MO1A 1TWAB 4CKBA 1FYCA 2Y5BB 1XLOA 1Q1OA 2MNAA 1WXMA 1KRSA 1P8LA 2XWJB 4PS8A 3PHXB 2JF5A 5LNK1 4II2B 1FM0D 4C4VB 1FRDA 1YD8U 4W9LA 4HMIA 2UU9L 1JROA 4A8XC 2R2OA 5M3FB 1PDXA 2KEEA 1HR0Q 1S1QB 1K0SA 3MFYA 4X64Q 3CC4A 3TIXA 3NSWA 1YNJD 5M3MG 1RYJA 1SYBA 1QCBD 5AJ3L 4A3DG 3FC4A 3BDCA 5LHY1 1K8AC 1YOVB 1WTWA 1KIXA 2IO2B 3AB5A 3PF4A 2I38A 4DK1A 1I94L 4DV7L 1OQYA 1N5XA 5JHAA 4HRSA 2EYLA 1QE6A 4C3IH 5J22A 3S15H 3DVNV 4LJZC 1RFAA 2ZNVB 5EKKA 4Q2JA 2BKFA 4BA2I 2LEKA 4B3ML 1LV9A 4C2MH 2HQLA 3M62B 1GOZA 2L7RA 4W9EA 1HQRD 2KT7A 1OXUA 2BB5A 2JYEA 2RVLA 2WXNA 3Q24A 2B2VA 5AEKB 4UP7A 2KUMA 1V5TA 3A9KB 4ANUA 3H7SA 4K7WA 4JI6L 5D6JB 4DUYL 4EQ5A 4MGZE 3AE8B 2RDHA 1MJEA 2EYMA 3CD6A 2WXQA 3MC8A 4XDCA 1TWCH 1E90A 4MM3A 1XLPA 4NJCA 2J7QB 2R3ZA 1AARA 4BBRB 1O7ZA 3P1HA 1HZ6A 4A3JB 3I90A 3AE4B 3G48A 2M17A 5E3FA 2M2LA 3FMCA 1SYEA 4XXEA 5JJZA 4DR7L 2O2VA 4HCNB 4WJ4A 4RM8A 5IY0A 2LWPA 2PTLA 4OZAA 3V3XA 3EROA 2G4SA 3SK5A 1FCLA 4P72A 1HA6A 3K0YA 2UYZB 3A1QA 1HNXL 4WORA 2RKSA 3F2CA 2MJ3A 2WV6D 1EOTA 2WDRB 1ESFA 2B29A 1WGGA 4ZDVA 1ILPA 4O2DA 4WRDA 5EBDA 3R3MA 4DV2L 3CKIB 4WJWA 1LTSD 4NMZA 4WQMA 2N78A 2R6GA 3PCOB 4PNYA 3NBIA 5E4WC 1KLUD 1BOSA 2GVBA 4S3SA 4K81A 1PH3A 3S2HH 2B2TA 2C9OA 2PLPA 3RLNA 4YT0B 4AP4C 1F2RC 1XO3A 1H9SB 2BTEA 2BBCA 3B2GA 3NWSA 4YIJA 1JJCB 1G2TA 3MC0B 2G4DB 3KLRA 1SE2A 1F9JA 5C3JB 3RZDB 4JOIA 2CHZA 2FHTA 1BF4A 3EHVA 4A55A 4C7YA 4C7ZA 2DYOA 2K22A 2B63B 1UF0A 3VRBB 5EPLA 2F0EA 2E3TA 3P20A 4N59A 3RNGC 3WOFA 1WD0A 5HFYA 4OEMB 4LNOA 5MPOA 2ZZPB 4HR7B 3NBHB 3JSVA 2AKWB 1B2TA 5LMNW 3RNBC 1FO4A 4JBJA 4GDLA 2KENA 2OOBB 4GSWA 1NSNS 3TEHB 2Q2UA 1UWXA 3VTUA 2YV5A 2AUKA 3GTKH 1DGSA 4TKNA 2F0FA 3Q8DA 5FOBB 4JI8L 3RZWC 1JE4A 3GV3A 4NPSA 1VQ9A 1HE8A 1JWBD 5CTRC 2E5LQ 1LTAD 2OEOA 2WB1B 1GUTA 3U9OA 3HOXG 1DOLA 4L5RC 1GUOA 1LUZA 5HHDG 1EY0A 3DWGC 1WYWB 3ZLZA 4BBSH 2N9LA 4K1RB 1EQQA 1JCKB 2PW5A 3RN5A 3S1NB 5C4XG 1TWGB 2BYFA 2LGDA 5LL6X 5BN4A 5KRUA 5M5XH 3M3YH 1SB3C 1TBEA 2CKZB 1EYDA 4RCNA 4DAYB 2J42A 4P74A 1A2UA 2JE6I 2A6ED 2EZVA 3VR5A 3BVGA 1K3BC 5DEHA 1ZXHA 4ASWC 3PREA 5JVG3 1MHXA 5EE9A 3T1HQ 3Q3OC 3HIZA 2WU5B 1V1PA 2FBWB 4A3BB 4JPSA 4G7HC 5KYIA 2F0QA 3WA0A 4A93H 1M90C 2ZPNA 2JA5G 3A7AB 3IBEA 3U30A 4A3IB 2GMIC 2A6HC 4O0AA 2CH4A 3KF8B 4IUVA 3SD5A 2JXXA 1RD9D 1K52A 1AE3A 2EXDA 2DUDA 3VUWA 3X3MA 4FJYA 5C4ZA 1ASZA 5COYA 2H89B 3PV1A 2LMCA 3L0OA 2UU9Q 3RNFC 1O7LA 4FXCA 3JAMi 3CCEA 4A3GG 1QNUA 3HOWH 1JQYD 4YWMA 1S40A 2JEAI 5K36H 3QC8B 2M19A 2JA9A 2RDFA 1WRDB 1WF9A 1H9MA 4IDIA 3IRBA 3I57A 1HTPA 1KNAA 3EJIA 2JA6H 2IPKD 5AJ3Q 2WHIA 2R7ZB 1JB7A 3UDFA 4OO1I 2E75C 5E7NA 4DXGA 2KQ3A 2WX1A 4GOCA 5D3IB 1CM9A 1I94Q 1HZBA 4DV7Q 1C3TA 1V8QA 4IUUA 1I6VC 5IP7H 5GAHC 3PO2H 1FFUA 3SR6A 3TS0A 3NVZA 4MGKE 3D4RA 2KDBA 4CBVA 3MTNB 1STBA 3PUYA 4A3MH 3PTFC 4B3MQ 5LMUL 2DAFA 1WGRA 2JZ3B 3ZNHB 2BH8A 5FO7B 5T1IA 3ZO5B 2GLSA 2E6XA 4B3TQ 3PGZA 1CSPA 3VR6A 2BS2B 3CQZB 3IAM1 5BMHA 1E8ZA 4LJOB 5IYDH 1SROA 2DAJA 2X69A 3KYCD 4DV0Q 3S1QH 4JI6Q 1K73C 2FCNA 5JEAJ 1PLFA 4GOPA 1I3QB 2Z59B 2JXTA 1IBXA 3HGBA 3BZKA 4P7IA 3TQYA 3P1MA 4FNFA 2JY6A 4EEWA 1FGUA 1B8AA 5FK9C 2DZIA 3RUZA 3FILA 5H8YE 1KFYB 4U673 4DV3L 3HP3A 4X65L 3D4WA 4W9GA 3DWAA 1K53A 3PZDA 2SOBA 3KYDD 1TKYA 2VB2X 1V6EA 2LHDA 4BOSC 3P4PB 4ZRQA 4G11A 1HNXQ 2MH7A 3HOZH 2WIIB 1YMHE 3CWIA 4KGRA 1RKNA 2PZUA 4WWOA 1U5KA 1ZYRD 3S15B 4GN1A 5HI1A 4IC7B 1WIAA 2XK5A 4C3HG 1MI0A 4ZQ3A 2L0CA 2BW2A 2F0MA 3FKYA 5DLQE 2L32A 4OVZA 2NVQH 1C7YA 2BB6A 2ZXOA 1QLBB 2I1KA 3NVYA 4OXPA 1WVLA 1PXUA 3H7PA 3M9BA 3NUCA 3HHMA 3DHGC 2NTSA 3NQTA 3NUHB 1K9MC 1EEID 1PYBA 1SNQA 1X3FA 1HNWQ 1P9DU 2R93H 2KHSA 3Q2AC 3Q3FA 3SVMA 3UE1A 1ENFA 4BZAA 5EKLA 4IFDJ 2K5VA 4KX6B 3BZDB 4IALA 1N34Q 2FXQA 4IUNA 4DV1L 4L63B 1YN4A 3AI5A 2PYKA 2LSSA 1CJEA 5ELDA 2CFMA 1AFPA 3HKZB 1JQ4A 3LWUA 3GE8C 1HZCA 2C5CA 4OZBA 1NR4A 2R2QA 4WH4A 4AJWA 3K80C 2ZW0A 4XWTA 1VQCA 2H5XA 1HRJA 3AV8A 2ICIA 2I0QA 3DQVA 2L5TA 3I72A 1DONA 1CUKA 3DHHC 1R4PB 3PRZA 2F0SA 1EOVA 3IT4B 4RGOS 4GNXA 2NVTH 4X66L 4XTCS 3H0GG 3K0XA 2I1JA 3DOWA 4IUTA 4LDTD 4LMQD 2KWVB 3OJ4B 2A5HA 1JE5A 1KJTA 5JJLA 2K9XA 2KTFA 1GG3A 4FVMA 2LVPA 3ZXRA 2LJIA 2MP2A 2E2IH 1PH2A 1DOIA 2M4NA 1ET9A 3AU5A 2LGYA 1RIPA 2MPMA 1R4NB 1VCIA 3GTQH 1SMYD 1FEHA 3ERQA 2QW7A 5CHVC 3S2HB 4DR2L 3U7DA 3QAQA 2VZKD 1STGA 2AL3A 4LNKA 4HPPA 4BA1I 2W55A 1CQVA 2LRUA 3L08A 1XF5L 4C00A 4DHZB 1VQAA 3TP5A 4C1NK 1B3AA 1GAQB 2Q8IB 1PGBA 2QSDA 1D7QA 3CF6E 3WIMA 1S4ZA 2D3BA 3B2FA 1Z7TA 1PVOA 1VQ4A 1PRTD 4XX5A 3SHQA 3DBRB 2OJWA 4YCUA 1FD7D 1R4NI 3ZW3A 1WXSA 5IGGA 3KUPA 3B9JA 5G55A 4DXAB 3DDCB 4JI7L 2BWFA 3T13A 3I4MG 3NP8A 4XDDA 4YCVA 4A3KG 4XYOA 4DR4L 2WWZA 4JWSC 1E1TA 2ZM6Q 2A6EC 1XMQL 3NK9A 4L5QA 4OVUA 4LTUA 1WCMH 2R7FA 2F0DA 1YJ1A 2QDFA 4HJGE 4LNNA 4XYCA 1JRUA 5ELBA 2MEKA 4U68A 2JJQA 2WP9B 3DBRI 4ARCA 1F9SA 2JK8A 2KWUB 1EYCA 1GB1A 2F0OA 4KHZA 1G6JA 2AWOA 2SNMA 3P75A 4BBSG 2AHOB 3W9CB 4ANXA 4B9WA 2G3QB 3G4SA 1WXQA 2WKDA 3NZ3A 1II3A 3I2ZA 1PH7A 2PKOA 4FJVB 2MHJA 2EY6A 2OTLA 3NTKA 4XIGS 4KV2A 3BK2A 1E24A 3ZQ4A 3AM9A 5C23A 1CA6A 2L8JA 4MELA 3H3VI 4QF4A 2VQFQ 1ZDVA 4A3FH 4BY1H 5JAVA 3R7QA 4BBNC 5HKHA 1NR2A 2BT6A 4ZRKA 3IFWB 3EECA 2M56B 1TWAH 2MWSB 2HQEA 4JI0Q 1FCCC 3QWNA 2ZEQA 3ENEA 1MG8A 1X56A 4X62L 4FLHA 1FNWA 4EX5A 2JVCA 4DV6Q 3T4AC 4RF1A 3TEYA 4IM0A 5EPJA 3VYSA 3VYRA 5C6AA 5M3FH 3DEPA 1VDZA 3FDTA 2RA4A 5E4XA 4GLXA 2IWHA 2R92B 3RR5A 2GRIA 2B3AA 2NBUA 4Y7NH 5E6OA 2OXPA 2KDMA 1RTNA 3VRAB 1K3RA 2WXJA 2HDMA 4KSLC 1DM0B 4ZHOA 1GC7A 3E56A 4IPGA 4GKKL 4IPDA 4HIMA 3AH7A 3OPOA 2HJ1A 4AQ7A 1Y8OB 3PIP3 2KKCA 4X3SA 4DNTB 1H9SA 1C4QA 2BQQA 4HSPA 2X8XX 2NYZD 4NJ6A 2Y0SB 3PGEA 1S5ED 2LD9A 2K28A 1GPXA 2E2HH 3K5OA 4TKOB 1OTRB 1SMXA 2LVQA 3OSOA 1A8VA 2SEBD 3SGIA 2CS4A 1HUNA 1I50H 2K6DB 4JI4Q 1J8IA 4KD4A 3PO2B 2GI9A 1R4QB 2BE5D 4P73A 2TMPA 2QMTA 1A2TA 4L2YA 3VUXA 3EVQA 1LQBA 5CHFA 2NBFA 2FFKB 4R3DA 3H1UA 2RDBC 3K5NA 1LACA 3GO5A 3KDFB 4H44C 4A3CG 2KC2A 2KDEB 3EFUA 1EY5A 1GJXA 1OO9B 2F0KA 5GADC 1VQBA 1XT9B 2D3GA 3UGBB 4CJ2C 4EQOA 2WXKA 3OIPA 5AZFA 3WAPA 4Q0FA 3LWEA 2KQ7A 2L9HA 2PW7A 4DBGA 4A3JH 1ZYRC 4GZYC 1TTNA 1STYA 5CV5A 3DMUA 1P1AA 3S1QB 3SDLC 5K5PA 2QF7A 1GUGA 3MXNB 3J7A5 1ENCA 3NE5B 4JPBW 4WJQA 1CKNB 2JP1A 1Q3LA 5C4HA 1U4LA 1SJHD 4ITKA 4DV1Q 3AYHB 1SE4A 4LNQA 3FRPB 2HTHA 4QIWE 2ASBA 5IGEA 1NI3A 4WJNA 1OEYJ 1ENAA 2E2DC 5FR6A 4EZLA 1SXTA 4NAWB 1EY7A 4F7XA 5FLMG 4HKQA 3PO3G 3R2TA 1YIWA 4FHKA 1WTQA 2IY1B 1P98A 1T3QA 1TS4A 4L5TA 2IY0B 4ZYNA 3W5UB 2CR5A 4KK7A 2X38A 1Y69U 1PFDA 1QWYA 3HOZB 1HZ5A 3ZJTA 1TY2A 1DXMA 2E8GA 1I35A 2QILA 1PDQA 3BYYB 1UEBA 1IPGA 1N9WA 2PPBC 4LLGM 2JRIB 3Q3MC 2BCOA 4QUCA 3HOVB 1P16A 4HTHA 4R4OA 3B08A 3N1YC 3OJ3A 5E6JA 2VUMH 1KAAA 4JVZA 3I4NG 1TKGA 4KSKC 3ZDTA 3RZDH 4FBJB 3PMFA 1AE2A 2AMCB 3J80L 3CCRA 1RF2D 2B63H 2EJFC 4KKUA 4DR2Q 2R93G 1VZ6A 1UZXB 2V1YA 3QCAA 2RCNA 2PQEA 4LF8L 5BO4B 3KF6A 1TJEA 3VR4A 2EJMA 1ICWA 3GTOH 1EUVB 1KC8C 4PS3A 1IBMQ 1KRTA 4FO2A 3J81c 3TEZA 1GJZA 3J7AV 3TS2A 2Y5PA 4K3BA 4A3EG 1NYRA 1SMYC 2WQYB 2K14A 2Y5CA 4IFDI 3AB9A 1YQBA 1BDOA 3S2DB 1B1ZA 2K03A 5G3LF 3S1RB 4JI7Q 1AH9A 1M94A 2DBYA 5J39A 2K8HA 2F0LA 3CCJA 1YJIA 3V60A 2DYMA 3HOYG 4AOFA 2KVMA 3UIOB 3TDQA 4ME5A 1XMQQ 1PRTC 4WJPA 2JA7B 1YZ6A 5EE1A 1Z6HA 2JSOA 1YIJA 1Q5WB 2MBQA 2DNEA 1TS3A 4OWXB 1V9JA 4E71A 4XWWA 1VQNA 2RSOA 3NTHA 4DKAC 2I46A 1IZ6A 3S1NH 4ZYSA 4A3LG 2MHVA 2WDTB 4M00A 2L15A 1TWGH 4JI1Q 1SR3A 1I4HA 1TVXA 2K7VA 2KCTA 4AYBG 2DLBA 4GDKA 3J7AF 5D94A 1BBXC 2K6AA 1EIHA 1KRHA 3V61A 4GN5A 1KLVA 2E2IB 2NZOA 4I7ZC 4NQLB 4XZ4A 1XLQA 2INNE 1QOAA 1E0ZA 2WAQB 5CV8A 5C44G 2VQEQ 1L5PA 3J80E 1DCZA 1YI2A 1PGAA 4TVAB 2F4IA 2KNBA 2IDYA 1HFGA 3FKIB 4RGMA 1F9QA 4A3BH 3B1LX 2JA8B 4WJ3M 3NTIA 1PUTA 2WDQB 3BG3A 4FF3A 1LXDA 4A3IH 4W9CA 3I3TB 3ULPA 2BF8B 4OO1H 1WX9A 1WWTA 4DK5A 5M9OA 3SK4A 1L7YA 2LXAA 3MP9A 2K39A 2F0TA 2PEAA 3K59A 3F2DA 4IOCA 1ZGUB 1W3SA 4X3TA 3MHBA 4HXDA 4X62Q 4CHTB 3MJWA 3AU7A 1R9TB 1NNXA 3UDIA 4FF4A 2JYTA 1JJ2A 1TR5A 2E5LL 1FR3A 4UAIA 2QHOA 1DOXA 1ZUD2 4HJAA 3L13A 2B2VC 3B6YA 2PQAB 2DZKA 2Z8LA 3PUXA 4E6IA 4M8NA 2NN6G 5AUKA 4EQNA 1JT8A 4ME3A 1Y1WG 3GDEA 2R7ZH 4QJFA 3EUB2 3ECIA 2MQHA 2JQOA 2XRQD 1EUJA 4YCWA 2HHHL 1Z5SB 5ISRA 1YNND 2M1MA 4IN3A 1UH6A 4PQXA 2M8SA 4HDOA 4H7BA 2KZRA 5HGTA 4LFBL 3SFDB 1KD1C 1JRPA 3SHLA 1X3PA 2LGIA 5IYCG 3EN2A 2UXBQ 2MP1A 5BN3A 1CKMA 1F2YA 1TZOA 1MGSA 3CQZH 2HDLA 4C3JH 2DNFA 4DNRB 2ZVOA 4QY7A 3EQLC 3P7JA 1DD2A 5C0XG 4MGIE 1KABA 1PV4A 1MHHE 4J6HA 1QUQB
chains in the Genus database with same CATH topology
4RHSA 1D2BA 3L9AX 3BIID 4P16A 1J7CA 5EPKA 3M4OB 4MACA 2B2TC 3L4PA 3PUWA 4HEDA 4US8A 2L4NA 3QG1A 2K0PA 3MEHA 1RTOA 4Y7NB 1OXXK 3TMEA 3BYTB 3I9V1 2QIEB 5C4JB 1NAPA 4M1UB 4K8IA 1OFFA 5M5YB 3AEGB 1SNMA 1JC7A 4IUQA 3A56A 3QOLA 1L0XB 5IGCA 2E2HB 2F0HA 1B50A 4C1NI 2HDEA 2K01A 3W1SA 5FO8B 1I50B 1SYDA 1LTRD 3L7ZC 1Q1BA 2L1AA 4A3DB 2FUG1 1JALA 2AUJD 2I2YA 1VJKA 1TKWB 1WTPA 5AFWA 3ZGZA 4J8QA 2JU6X 3D8GA 1KDCA 5EGTA 2QKIC 1MPEA 5D65A 2L83A 1I4XA 2ONQA 3VQIA 3ITPA 3P4SB 3T51B 1Y56A 3D6CA 2A69D 3RZOB 1Z47A 1TYGB 1F2MA 3KLSA 2Y3AA 3C8YA 4M0WA 3CU7A 2PMZB 2M0AA 2QCPX 1ZPSA 2OF1A 1PZID 1U4MA 5CGKA 4ZOHC 1OQRA 1FXIA 1AN8A 3MWYW 1WYGA 2WS3B 2VUMB 1RFKA 2EKIA 2IL8A 2F0GA 3T53B 2WKCA 4A90A 4G7ZC 2HUGA 4NP5A 2DY7A 3AE5B 2DY8A 3SDZA 3GTOB 1PFBA 1IGDA 1BQQT 3KLSX 3ND9A 1J7BA 1LT3D 1PTOC 1IKMA 1U9RA 3AEFB 1KNEA 1E2VA 3BVMA 1P7FA 1C79A 1PFNA 1X3QA 4H0LC 1N60A 3E6ZX 2ZXPA 3HUIA 2WXPA 1SIJA 1GXDC 1WTOA 1SNDA 5G5GA 1T5XD 4M8AA 3I8ZA 1Q90A 1SSNA 2OT2A 3K57A 2MJ8A 3O13A 5IODA 4G7OC 1QOGA 1YQ4B 1A3VA 2BA0A 2MGSA 2QJLA 3IFDA 1G2SA 1SEBD 1UNSA 3K6OA 1Q8IA 4A6QA 1AWDA 4QB4A 4NW2A 5D3DA 3NWTA 1FNVA 2B2WA 1LTID 4ILWA 4KTAA 1TWFB 3AE6B 3HOXB 2BYTA 3I4LA 4TRDA 1YNNC 2FJ2A 2WXRA 5EKIA 2WXHA 3LXFA 1XX8A 1SYCA 2LY7A 3R3OA 1EY8A 3KQ4A 2KA7A 5C4XB 3HS0C 2QDBA 3OMGA 3A8IE 1GHJA 1STNA 3LYYA 5E1FA 3OIQA 4K14A 2K3UA 3K5LA 1BCPF 5JPNC 4K8JA 1TQOA 1DOMA 1U4PA 2WXLA 5F2DA 5DM73 1DJRD 1FNUA 4HN7A 2M9VA 3UI2A 1WTVA 3MHZA 1YNJC 1LTGD 1FRRA 1CI3M 3SFEB 3NQIA 4X3KA 3DWMA 5CR3A 3H6MA 1MBYA 4N9PA 1JOQA 4OIKA 1UWMA 4A9AA 4C3JB 1E0BA 1Y8PB 4ZAIA 1SBBB 3AE9B 4F8MA 1KF6B 2PCFB 4JBWA 2CW0D 4WURA 2V3NA 1L6VA 1UGJA 2B2YC 1VMPA 3PUVA 1QOHA 1LTBD 1RWSA 4PMCA 2ID0A 5KNDA 2NUCA 4ID6A 4ZRPA 5BMGA 2K05A 3AE3B 2KOLA 4C3IG 1HA5A 2RMMA 4TQ0A 5JVH3 5J1ZA 1E2ZA 1DGJA 4H2AA 1EU3A 2HCCA 5EBCA 3GTJB 5C2TB 5DNFA 3D4DA 2G1EA 4IFDH 2A69C 1S5BD 1YQ3B 2D62A 1WSPA 5IOCA 5LL6S 1T5EA 1TT2A 2OEDA 1JB3A 1D6EC 1QKZA 1A6XA 4LK0M 3SK6A 2J4XA 1FMAD 4C3HB 4K5VA 2JQRB 5BMIA 2XIWA 3CRLC 4XYQA 4YTPB 1RDPD 3BS1A 3K7AB 4YSYB 1F77A 5FLXL 1CZWA 4RFBA 2Q8TA 2VZKB 3S14B 1I7HA 3I70A 3JAML 2Z4IA 1SE3A 2KEDA 3QO2A 4KN4C 1VDVA 2PNRC 3RPFC 4F87A 4CGYB 4FXGC 1I4GA 1PRTB 2B2YA 2K5PA 5GXGB 3GB1A 4BY7B 5I4DA 3QIAA 4B0EA 2BDNA 3NRZA 2ZXRA 2AQ2B 2L12A 2RDGA 1RJTA 2EELA 3AEDB 1SFOB 1JWSD 4UDUC 3J9CA 1VZ8A 2G9HD 3WOEA 1SNCA 1HCZA 1DYQA 3H0GB 2V3PA 3C1FA 3S16B 1EFID 2OHFA 4RGTA 4HCSA 4XQNA 1QOFA 4P2CB 3FAHA 5CV6A 4XQJA 2F0PA 1PTOF 4EE2A 5CBAE 1HUMA 3OWFA 2R61A 5FLXE 4TQUS 2IT1A 3U4EG 1IYVA 4QUFA 3Q6SA 1G8ZD 5IGBA 2J0TD 2FMCA 3JAME 1B4OA 1SJED 3V2TA 3M4YA 2Q8RE 3IKJA 2L55A 3MJ5A 2PW9A 1C76A 2YYZA 3A7LA 4WAFA 3HOUB 4MM3B 3KK7A 3I4MB 1ZP0B 1N63A 4A3KB 1MD2D 1SNOA 1TWHB 1BCPB 1H9KA 1LT5D 2K1BA 4LK1C 4KHVA 4KJNA 2QEJC 3HG9A 3GV6A 1RM6C 2EY1A 2N9KA 1N61A 3AMUA 2HTME 3E9SA 5CV4A 1JOKA 1CA5A 1E9MA 2FMMA 3C3LA 3J7YW 3P63A 1TKEA 1P7EA 1L0VB 5I9PA 5K36G 2LFNA 3I73A 4B0MA 3P42A 3MAQA 1NUCA 4HSVA 1L6UA 2CW0C 3RFZB 2AQ1B 4YXDB 2B2UA 2J53A 5C0XJ 2FINB 5FO9B 2HCIA 2PVGC 3R93A 3N9YC 4FF2A 1F2LA 3K5MA 1CFMA 3I3CA 2CQAA 2XSCA 1XLNA 5CV7A 1SYFA 3NBHA 3U7ZA 1O78A 3E5SA 4GDLB 1IGCA 3VR8B 2BS3B 1VR9A 1L0YB 1QOBA 3HRDD 1FD6A 2JWUA 1XCTL 1NVID 1IHZA 4V190 3H91A 1N62A 3AEAB 4KD3A 2E2JB 1B53A 2RQXA 2RPVA 3P4QB 2XRSD 4HMJA 4CJ1B 1QQRA 1C4CA 1IL8A 4DAYA 2IX1A 1LT6D 3NPPA 1PFMA 3RLFA 5NUCA 5C3EB 5IIFA 3SR1A 1ACCA 2O5JC 1Y1VB 1JWAD 5C3WA 3AE7B 3DEOA 1VF7A 3Q8CA 2SAKA 3KBGA 4BWGB 4K6LA 4KV6A 3MTSA 1TS2A 3KF8A 1GUWA 3F2UA 3FPPA 2L52A 2I07B 4KKTA 4FYDA 2LMCB 1J9OA 2EJGC 4Q5VA 4MT5A 1NEKB 4QMGA 1GUNA 3AE2B 4OL7A 4OGQC 3M7NA 2EYFA 1C9FA 2PVOD 1ZDXA 1C48A 1EYAA 4DN4M 4IQZA 1F2RI 4FXKC 1BR9A 1XYIA 1Y8NB 3C2PA 2IX0A 3T16A 3IFTA 2A74C 4DAVA 2BA1A 1K51A 3AE1B 1PTOB 1JW9D 4RKBA 4DQOC 2F3WA 1F0ZA 2TSSA 2WLBA 3K58A 3VR2A 4ZHPA 1TY0A 2A68D 1SF0A 1G6ZA 1V43A 3KWVA 1U4RA 3IT6B 5TSSA 4XE0A 1IW7D 1IBXB 4L23A 1V8CA 1E10A 3G6JB 2CVRA 1F2ZA 3HOYB 5I2XA 2AX5A 2W54A 3TP7A 3FILB 5JPMC 4IOIE 4DA2A 1SYGA 3R2IA 2V4DA 3A55A 1EY4A 3CIRB 1S5DD 1PGXA 3GTMB 4KKSA 2JEBI 2Q5WD 1A3UA 1FGBD 2VB3X 3Q22A 4YTMB 3DHQA 2YU9B 5C44B 4KKJA 4V0BA 1H9RA 1AZPA 3M7GA 3TP8A 3TZUA 3VYUA 1WGKA 2EPBA 1G91A 1C4PA 4FP5D 1D5XC 1E2WA 3BDOA 1RHPA 3OMCA 2JZPA 1S5CD 3BVZA 2CJOA 3Q23A 5DM63 1EM7A 4YSXB 2X6GA 4R9WA 4KJOA 1Y1WB 3HVZA 1T6BX 4CQNA 1QILA 2BS4B 2EYPA 4ZKBB 3T3OA 2E76C 3TUOA 1GHKA 2ZT9C 1MVKA 2CJNA 4HKZE 4CKCA 3FVQA 2BE5C 2KWDA 3OOCA 1WTRA 2NN6I 4QCLA 3ZJUA 4N58A 5BYQA 4N6EB 1E6EB 2EY2A 4K2LA 1QJOA 2ZW1A 2SNSA 2NTTA 4N9TA 1FFVA 1PZJD 4K2KA 2D9UA 4ZUJA 4KGSA 4LAAA 3GTGB 3AEEB 1UEAB 1EY6A 4OIJA 3NVWA 1YN5A 2Z4HA 1N5WA 1A3TA 1C4AA 4RKLA 1JORA 1K83B 3X3NA 5I6WA 1EY9A 3H94A 1WRIA 4L6TB 3R8BA 5KYLA 5M3MB 2CU3A 2JYOA 3I91A 3EGRA 5C0XI 3EA6A 1KH0A 2H4OA 1CT1D 2KN4A 1ML0D 4FXDA 1JOOA 2DN8A 3ONAB 5CORA 3C46A 2W3SA 2KMMA 1FIQA 3BDLA 1JWMD 5CBEE 4YSZB 2V0GA 3ND8A 3TZDA 2EYHA 2EDGA 3DM1A 5D14A 3URYA 3GTLB 1PMRA 5CC4A 4JX1C 4ABNA 2B2WC 3WCQA 1EWHA 1OQQA 3SE0A 1GB4A 3QOJA 1B9NA 2NVXB 2WINB 5EE3A 4B9XA 4WFN3 1NENB 1K50A 3A8KE 4WIPA 2KACA 1GUSA 4C80A 3W5VB 2F0NA 4QIWB 1NYQA 2B76B 1RODA 2ON8A 1STHA 3S17B 2XWBB 1SNPA 2WDVB 2A68C 4DFAA 1S5FD 3TN2A 1SAPA 1IW7C 1C8CA 3V05A 1ONLA 3PV0A 3IL8A 2F0VA 3MZ5A 1PRTF 1M4VA 3TEXA 1EEFD 5EQ0A 5G3LD 1EQTA 5I9OA 1QNKA 4DU9A 3G7LA 5FKAC 4DGZA 1JMLA 3P4RB 4TMAB 2WP8J 5BN5A 2F0UA 1J7AA 1BUIC 2F1MA 4ZKCB 5EJWA 1VRAB 4PT5A 4XT3B 2BDOA 4XQQA 2WXOA 3MXNA 1D5MC 2KCNA 4KN7C 3A8JE 1CZPA 1OXTA 4OO1G 1AYFA 1CHPD 3UI3A 1DOKA 1G291 2L11A 1A70A 3MVVA 2O5IC 1EZ6A 4J1MA 1QT9A 4EVOA 4FF1A 1CQFA 2PO4A 1OXSC 1HEZE 3HRZC 1ZOYB 2XVSA 5IGFA 3V96A 2YEPF 1JWUD 2A73B 2V4IB 3HVDA 2JA5B 2NVYB 3PUZA 4ZUIA 4I65A 3MXGA 1PZKD 1W6KA 3Q8BA 2ACZB 5JEAH 1AW7A 1H9JA 3GTPB 2AWNA 4C3JG 2K5WA 1C78A 4A3GB 2H88B 3BWUD 3DWPA 4ULLA 1TIID 2DWQA 2MJDA 1WTXA 2KAJA 4DK0A 3S1MB 2J7ZA 3Q8AA 4RF0A 3QB3A 4P6VF 1QG7A 5A35A 4IKGA 1MSHA 2IJ0A 3J81L 1I4RA 4L1BA 4GDKB 4EQPA 2KECA 1V97A 1ILQA 1MI2A 2H1EA 4ZRZA 1CK1A 3TSSA 1O7YA 1VLBA 1KLGD 2RSNA 2XN9C 2BOSA 2JX5A 3NVVA 3WDNA 5JOBA 1D1IA 2EYOA 3NHHA 2L1BA 3OWEB 1Q12A 1ZE3D 5BYRA 5ELFA 2M00A 4NDXA 2IGHA 3T56B 2B8GA 4O42A 3U2SC 3Q0AA 4C3IB 3D6WA 4GLSC 1BO0A 2KJXA 2JXMB 5AUIA 4HROA 1EWCA 3M85A 4C2MB 3PIO3 3J81E 4NZLB 3TEWA 2SDFA 1XCQL 1MSGA 1CTMA 2F0JA 4KY7A 1PTOH 2X6LA 2W3RA 1M8AA 1D1KA 1TWCB 2F0IA 2K5QA 3U9SA 3H09A 2VXWA 4X3UA 5EE0A 3W2DA 4D2KA 1D5ZC 3ABVB 2LS01 1EZ8A 4DF7A 2KCCA 5IT9L 5KGUA 1HHVA 2WU2B 2EE1A 1WD1A 1I4QA 4B08A 5C3XA 3GD7A 1W6JA 4RWSC 3S9WA 1JICA 1B9MA 2K32A 4R8IA 5DAUA 4XT1B 4RNAA 1CHQD 5C5MA 1L4ZB 3EFXD 2B2UC 3GQBA 1YNTE 1EWYC 2EXZA 4Z9CB 2NMQA 3FPUB 3ETRA 2NB0A 1AZQA 5T1GA 4DAPA 2KQ4X 2F03A 4AS1A 1SDFA 4YWGG 4OW0A 1XWEA 1ZXIA 1RCVD 5IGDA 3SXHA 2EOTA 1ZXTA 5H92C 4F88A 1IUEA 4HEA1 5IT9E 2WNMA 3Q8EA 2NZ1D 3BK1A 4K5WA 2N88A 2CHBD 2YEPB 4O1NA 3AN1A 2D5GA 2NN6H 3GTKB 3HEJA 2GB1A 5G5HA 3D31A 1XEEA 3OW7A 1SSOA 4CKEA 1DZ1A 2D2CC 4RGNA 1LLRD 2WACA 4BBSB 3LB8C 1I6HB 3GS2A 4KI0A 1ZEQX 2AQ3B 3M3YB 5M5WB 5M5XB 1HFNA 3ZJVA 1OXVA 5HURA 5JXVA 2XNAC 1AP0A 4H13C 4RHRA 5C0XH 3C1EA 1ROEA 3W3AA 2MUYA 1TU2B 2PMVA 4A93B 3OHXC 1HXYD 1BCPD 4KGTA 1BMLC 1K8OA 1LT4D 5CMDA 3PO0A 2WXGA 3LNNA 5C5LA 1LABA 2K33A 1HTLD 1CZGA 2IX3A 3L3OC 5JEAG 1A15A 1D4BA 1UAPA 1F9PA 3HOWB 4K5XA 3MXPA 1JR0D 4PMWA 4REZA 3DXJC 2JA6B 1XXGA 4HCEA 4WWMA 5KNCA 3H8HA 2EYJA 2EVBA 3FEWX 2K5DA 1VF5C 4PV1C 3RD4A 4OZCA 1XTCD 5KEEA 1EQVA 4XDXA 4ZLTF 4A3MB 2INPE 2ENBA 3SK8A 2J52A 5HG2A 3PZ8A 3AEBB 1DOYA 2FE8A 3Q8FA 2LFIA 1E7PB 2RBMA 1HPCA 1V1PB 3GP7A 4IFDG 5A2QL 1EIGA 3Q69A 3AMZA 4OHJA 2GA4B 1HQMC 4JE3B 1V1OA 3MFGA 2JSVX 1Q10A 2IW3A 2PZTA 2Z1CA 1LO5D 3N6RA 3PO3B 3TBIB 3KBXA 3MA2B 4G4KA 1I4PA 1KDBA 4NKLA 4CJ0B 5ELCA 3CHBD 5I2YA 1L4DB 1ESRA 1F9RA 4USAA 4MIUA 4JK1C 2NWGA 1FXAA 1IYUA 2NVQB 3AECB 2LKVA 3QJYA 3I4NB 2ICEC 3VYTA 2F3VA 5D7GA 5T8IA 3CRKC 2R93B 2N7JA 1VMCA 4ZK9B 1BUVT 4TQ1A 2B8FA 4US9A 5CYUA 4IURA 4L8JA 4A3EB 5A2QE 3A54A 1B44D 1K8MA 2O4XA 3VA7A 4KY5A 4NAMA 3IXSA 1Q1EA 2WXMA 4ARIA 1ET6A 3RMHA 2WXIA 2NVTB 2N55A 1BXTA 3E0JA 2N0SB 1IKLA 3LX0A 5FR3A 1YJJA 4HAEA 2IGDA 4MN3A 4AYBB 4EGVA 1BNZA 1O80A 3IAYA 4ODGA 3GTQB 3NXWA 1TS5A 5KNBA 4MH8A 1PTOD 3IAS1 1LTTD 4TSSA 4RA8A 4R8NA 4C56C 3T3NA 5CV9A 1PYWD 3VA5A 3KWLA 1STAA 2G9DA 2PIAA 3NS1A 4RAUC 2B39A 1EL0A 2E74C 5ELEA 4IZ8A 4JWUC 1X32A 1ZKOA 3H3VC 3PZ7A 4KKIA 3D3RA 2D5DA 3TP6A 4KMUC 1YN3A 3VR3A 2K04A 4G57A 4YTNB 2VNUD 4DXFA 2EY5A 1STEA 1NCVA 4RH6A 1WCMB 3DWQA 1KTKA 2O2LD 4KY6A 3U52E 1EU4A 1QF6A 4IUPA 2PZWA 5BYSA 1B9RA 4MHEA 5KIXA 4BS9A 2DNCA 2W82A 4J3OD 3HZXA 2LHEA 3SEBA 1BCPC 3DUZA 4RCOA 1KDAA 1QB5D 2A6HD 3MXUA 2IGGA 4PMBA 3ZYYX 2F0WA 1AEXA 1UUPA 5I6YA 2WXFA 1R7SA 1C77A 2MJEA 4K6DA 3N52A 4A3FB 4BY1B 3VR9B 1VZ7A 1TWAB 4CKBA 1FYCA 1XLOA 2XWJB 5LNK1 1FM0D 1FRDA 4HMIA 4A8XC 1JROA 5M3FB 1PDXA 2KEEA 3MFYA 3NSWA 1YNJD 1RYJA 1SYBA 1QCBD 3FC4A 3BDCA 5LHY1 1WTWA 3AB5A 2I38A 4DK1A 1N5XA 4HRSA 2EYLA 1QE6A 5J22A 4LJZC 5EKKA 4Q2JA 4BA2I 2LEKA 1LV9A 1GOZA 1HQRD 1OXUA 2BB5A 2JYEA 2RVLA 2WXNA 3Q24A 2B2VA 2KUMA 3AE8B 2RDHA 2EYMA 2WXQA 4XDCA 1XLPA 4NJCA 2R3ZA 4BBRB 1O7ZA 3P1HA 1HZ6A 4A3JB 3I90A 3AE4B 5E3FA 2M2LA 3FMCA 1SYEA 4XXEA 5JJZA 2PTLA 4OZAA 3V3XA 3EROA 3SK5A 1FCLA 1HA6A 3K0YA 4WORA 2RKSA 2MJ3A 2WV6D 1EOTA 2WDRB 1ESFA 1ILPA 4WRDA 5EBDA 3CKIB 4WJWA 1LTSD 4NMZA 4WQMA 2R6GA 4PNYA 3NBIA 5E4WC 1KLUD 1BOSA 4S3SA 2B2TA 2C9OA 2PLPA 4YT0B 1F2RC 1XO3A 1H9SB 2BTEA 2BBCA 3B2GA 3NWSA 4YIJA 1G2TA 3MC0B 3KLRA 1SE2A 5C3JB 3RZDB 2FHTA 1BF4A 4A55A 4C7YA 4C7ZA 2DYOA 2K22A 2B63B 3VRBB 5EPLA 2F0EA 2E3TA 3P20A 4N59A 3WOFA 1WD0A 5HFYA 5MPOA 4HR7B 1B2TA 1FO4A 1NSNS 1UWXA 2AUKA 2F0FA 5FOBB 1JE4A 3GV3A 1JWBD 1LTAD 2OEOA 2WB1B 1GUTA 3U9OA 1DOLA 1GUOA 5HHDG 1EY0A 3DWGC 2N9LA 1JCKB 2PW5A 3S1NB 1TWGB 5LL6X 5BN4A 5KRUA 1SB3C 4RCNA 1EYDA 2J42A 1A2UA 2JE6I 2A6ED 2EZVA 3VR5A 3BVGA 5DEHA 1ZXHA 5JVG3 1MHXA 5EE9A 2WU5B 1V1PA 2FBWB 4A3BB 4JPSA 4G7HC 5KYIA 2F0QA 3A7AB 4A3IB 2A6HC 4IUVA 1RD9D 1K52A 3X3MA 5C4ZA 5COYA 2H89B 2LMCA 1O7LA 4FXCA 2JYTA 5K36H 3TEYA 1QNUA 1JQYD 2JEAI 2M19A 2RDFA 1H9MA 4IDIA 3I57A 1HTPA 1KNAA 3EJIA 2IPKD 2R7ZB 4OO1I 2E75C 4DXGA 2KQ3A 5D3IB 1CM9A 1V8QA 4IUUA 1I6VC 1FFUA 3SR6A 3NVZA 3D4RA 4CBVA 1STBA 3PUYA 5FO7B 5T1IA 2E6XA 2BS2B 3VR6A 3CQZB 3IAM1 5BMHA 2X69A 5JEAJ 1PLFA 1I3QB 2JXTA 1IBXA 3HGBA 3P1MA 4FNFA 5FK9C 3FILA 3RUZA 5H8YE 1KFYB 4U673 3HP3A 3D4WA 3DWAA 1K53A 2SOBA 1TKYA 2VB2X 2LHDA 3P4PB 4ZRQA 2MH7A 1YMHE 2WIIB 4KGRA 3CWIA 1RKNA 2PZUA 1ZYRD 3S15B 5HI1A 4C3HG 1MI0A 4ZQ3A 2L0CA 2BW2A 2F0MA 2L32A 4OVZA 2BB6A 2ZXOA 1QLBB 3NVYA 1WVLA 1PXUA 3NUCA 2NTSA 3NQTA 3NUHB 1EEID 1SNQA 2KHSA 3SVMA 1ENFA 5EKLA 4IFDJ 4KX6B 3BZDB 4IALA 4IUNA 4L63B 1YN4A 2PYKA 1CJEA 5ELDA 1AFPA 3HKZB 1JQ4A 3LWUA 4OZBA 4WH4A 2C5CA 1NR4A 2ZW0A 4XWTA 1HRJA 3AV8A 2ICIA 2L5TA 3I72A 1DONA 1R4PB 2F0SA 3IT4B 4RGOS 4XTCS 4IUTA 4LMQD 2A5HA 2K9XA 4FVMA 2LJIA 1DOIA 1ET9A 2MPMA 1VCIA 1FEHA 1SMYD 3ERQA 3S2HB 2VZKD 1STGA 4BA1I 2W55A 1CQVA 1XF5L 3TP5A 4C1NK 1GAQB 1B3AA 1PGBA 2Q8IB 2QSDA 1S4ZA 3B2FA 1Z7TA 1PRTD 1FD7D 3B9JA 5IGGA 3KUPA 3T13A 3NP8A 4XDDA 4XYOA 4JWSC 2A6EC 3NK9A 4LTUA 4HJGE 2F0DA 5ELBA 2MEKA 4U68A 2WP9B 4ARCA 1F9SA 1EYCA 1GB1A 2F0OA 4KHZA 2AWOA 2SNMA 3P75A 3W9CB 4B9WA 1WXQA 2WKDA 3NZ3A 1II3A 2PKOA 2EY6A 3NTKA 4XIGS 3BK2A 3ZQ4A 3AM9A 1CA6A 4QF4A 1ZDVA 5JAVA 1NR2A 2BT6A 2M56B 2HQEA 1FCCC 3QWNA 1FNWA 3T4AC 4RF1A 5EPJA 3VYSA 3VYRA 5C6AA 3DEPA 1VDZA 3FDTA 2RA4A 5E4XA 2IWHA 2R92B 2GRIA 2OXPA 2KDMA 1RTNA 3VRAB 2WXJA 2HDMA 1DM0B 4ZHOA 3E56A 3AH7A 3OPOA 4AQ7A 1Y8OB 3PIP3 4X3SA 4DNTB 1H9SA 1C4QA 4HSPA 2NYZD 2Y0SB 1S5ED 2K28A 1GPXA 3K5OA 4TKOB 3OSOA 2SEBD 1HUNA 1J8IA 4KD4A 3PO2B 2GI9A 1R4QB 2BE5D 2QMTA 2TMPA 1A2TA 4L2YA 3EVQA 2NBFA 2FFKB 4R3DA 3K5NA 1LACA 3GO5A 4H44C 1EY5A 1GJXA 1OO9B 2F0KA 4CJ2C 4EQOA 2WXKA 3OIPA 4Q0FA 3LWEA 2L9HA 2PW7A 1ZYRC 4GZYC 1STYA 5CV5A 3DMUA 3S1QB 5K5PA 2QF7A 1GUGA 1ENCA 3NE5B 2JP1A 1Q3LA 5C4HA 1U4LA 1SJHD 4ITKA 1SE4A 3FRPB 5IGEA 1NI3A 1ENAA 2E2DC 1SXTA 4NAWB 1EY7A 4F7XA 4HKQA 3R2TA 1WTQA 1T3QA 1TS4A 3W5UB 2X38A 4KK7A 1Y69U 1PFDA 1QWYA 3HOZB 1HZ5A 3ZJTA 1TY2A 1DXMA 2QILA 1PDQA 3BYYB 2PPBC 4LLGM 2BCOA 4QUCA 3HOVB 4HTHA 5E6JA 1KAAA 1TKGA 3PMFA 3J80L 1VZ6A 1RF2D 2EJFC 4KKUA 2PQEA 1TJEA 3VR4A 2EJMA 1ICWA 4FO2A 3TEZA 3J7AV 2Y5PA 1NYRA 1SMYC 2WQYB 2Y5CA 4IFDI 3AB9A 1BDOA 3S2DB 1B1ZA 2K03A 5G3LF 3S1RB 2DBYA 5J39A 2F0LA 1YJIA 2DYMA 2KVMA 3TDQA 4ME5A 1PRTC 2JA7B 5EE1A 1Z6HA 2JSOA 2DNEA 1TS3A 4XWWA 2RSOA 3NTHA 2I46A 4ZYSA 2MHVA 2LUMA 1TVXA 1I4HA 2K7VA 2DLBA 3J7AF 1BBXC 2K6AA 1EIHA 1KRHA 2E2IB 4I7ZC 1XLQA 2INNE 1QOAA