5D3DA

Crystal structure of staphylococcal superantigen-like protein 3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
190
structure length
190
Chain Sequence
KYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQLKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition of TLR2 by staphylococcal superantigen-like protein 3 (SSL3).
pubmed doi rcsb
source organism Staphylococcus aureus (strain nctc 8325)
molecule tags Immune system
molecule keywords Staphylococcal Superantigen-Like protein 3
total genus 53
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5d3dA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5d3dA01
1T5XD 1S5CD 3EFXD 3GP7A 1CHPD 2G9HD 1PTOF 1UUPA 1XTCD 1PYWD 1FGBD 2SEBD 1I4HA 1LTTD 1HQRD 2CHBD 1D5MC 4RFBA 1PRTD 4NZLB 1AN8A 1RF2D 2IPKD 1B44D 5ELCA 1QILA 1EEID 1HA5A 2XRSD 1JWUD 1PZKD 1LO5D 1TS5A 3SEBA 1MD2D 3O13A 1SE3A 1SEBD 1M4VA 2Z8LA 3CHBD 1FNVA 5FKAC 1PRTC 1BCPC 1HTLD 4DXFA 1V1OA 1UNSA 2J4XA 1BCPF 1F77A 1LT3D 1V1PB 3EA6A 1KLGD 1CHQD 3R2IA 1G8ZD 5D3IB 3BVMA 1LTAD 1XXGA 1JR0D 1PTOH 1LT5D 2QEJC 1EWCA 4RHSA 1PRTB 1EEFD 1JQYD 5D3DA 3BVGA 1PTOC 4RGNA 5ELDA 1D5XC 3R2TA 1PZID 1TS4A 3V05A 3OWEB 1EU4A 1YN3A 1I4QA 1CK1A 1ENFA 4RGOS 2XNAC 3KLSX 1STEA 1S5ED 1S5FD 2AQ2B 1KTKA 2R61A 1PTOD 1LT6D 3BZDB 1YN4A 4L63B 1FNWA 4OHJA 5FK9C 4RGTA 3R8BA 1RD9D 5ELEA 4RHRA 4RH6A 1FD7D 1LTSD 1LTRD 1SJHD 2XN9C 4RCOA 5ELFA 1D6EC 1SJED 3URYA 1TY2A 1I4GA 2O2LD 1RDPD 2RDHA 3TSSA 1JWMD 1PTOB 3BYYB 1LLRD 1JWSD 1HXYD 1SE2A 4RGMA 1YN5A 1S5DD 4Z9CB 4K6LA 2NTTA 1LT4D 1S5BD 2ICIA 1TY0A 2QILA 2XRQD 5ELBA 1DYQA 1I4XA 2RDGA 4ZYSA 2IJ0A 1CT1D 1EFID 1RCVD 1TS2A 2TSSA 1EU3A 1GOZA 1PZJD 4DXGA 1D5ZC 4C56C 1DJRD 1PRTF 2AQ3B 3MFGA 1B1ZA 1FNUA 1TS3A 5TSSA 3DWQA 4UDUC 1BCPB 4BWGB 1KLUD 1BCPD 3DWAA 4TSSA 1ET6A 2NTSA 1I4RA 1V1PA 1ET9A 1LTBD 1LTGD 1L0YB 2WV6D 1CQVA 1LTID 1SE4A 1I4PA 1BXTA 1SBBB 4O1NA 1ESFA 1AW7A 1SXTA 1JCKB 3BVZA 4L6TB 1L0XB 3BYTB 3W2DA 3MC0B 3DWPA 5I4DA 2AQ1B
chains in the Genus database with same CATH superfamily
2RCNA 2AUJD 1PH9A 1PFSA 3SK4A 2LGDA 3J7ZC 5IP4D 4DR2Q 4HJAA 3CMMB 2WFWA 3QK0A 1TWCH 4HEA1 3HOVB 1QWYA 4G3XB 2W3RA 4XE0A 4BBSH 2MHVA 2UXDQ 3PREA 3RN5A 3S14H 1YNTE 1SE8A 3PHWB 4X3TA 1RF2D 3QA8A 1B44D 4OXPA 3RMHA 3V60A 4AUQC 2NN6G 3SK5A 4IUNA 5I2XA 4ZUJA 1V97A 2DWQA 5EQ0A 2B2UA 3SFDB 1M4VA 4ZAIA 4P73A 4IDIA 4TUUA 2XVSA 1V9PA 5FKAC 1X3GA 2MQHA 1Z7TA 1J5EL 1I5FA 3DCGA 2MFIA 4J3OD 4DR2L 2A8VA 1GHJA 4DN4M 4DV2Q 1IKMA 5H8YE 1LV9A 4LUOA 4XGAB 1BCPF 3OAWA 2WDQB 3MXNB 4CDFC 2JA6B 4GKJL 2IY0B 3AE5B 4DBGA 2JN4A 3PO3H 3AU7A 4I7AA 3I4NH 1L4ZB 3CF6E 2VQEQ 1NUCA 4YCWA 1EZ6A 3C3LA 2WAQB 2PE6B 3BVMA 3MXPA 1STBA 5IGEA 4XDXA 4XT3B 3PO3G 3ZRCA 1K51A 1GC6A 3L3OC 3M9BA 5HY6A 4C4VB 2F4IA 2TMPA 4A3BH 1UELA 3R2TA 2HTHA 1AYFA 1LFDA 2KTRB 1FYCA 2R2QA 2QCZA 4ME5A 4JI7L 1F52A 1WJUA 3K57A 3K58A 1O7YA 2NVQB 4JOIA 5E6NA 3QO2A 1YJNA 4KIKB 4MJSA 1IHZA 2K5VA 1NBFC 1ILPA 2WX1A 5J17A 4JI4L 4CJ0B 1WGYA 4TVAB 1WXAA 1X55A 4RF1A 4IFDG 3NTHA 4RH6A 3V6EB 5HG2A 2FBWB 3I70A 1LTRD 2N8NA 1BNZA 3QWNA 3IFDA 2HCIA 5IYDG 4HCEA 2QW7A 1ZXTA 5EE9A 4CDDC 1GUOA 3A0JA 3PO3B 4LFBQ 3URYA 3KUCB 4ANWA 2IY5B 3PLVA 2O2LD 1FCCC 4GZYC 4E71A 1X54A 4LF7Q 5DCNA 3EUB2 3D3RA 1K0SA 4CBVA 2Q2IA 3CKIB 2WLBA 4HK2A 1TQOA 3MC8A 3VRAB 3NQIA 3QOJA 4KKJA 4HIKA 4FXCA 5L37A 2NVTH 3S16B 3RZFA 1SSNA 1FXAA 2KFKA 3KF8A 3VRBB 3PUYA 5JJLA 1CUKA 1S5BD 2WDVB 1TY0A 2L55A 3N52A 5JJZA 2BW2A 2VW9A 3T1HL 2VUMG 4W9FA 3H7PA 3SXHA 3Q3JA 3ZTCA 3L54A 2XBBC 3CCLA 1V86A 3FILA 3G4SA 2MNAA 3DWQA 2CHXA 1VCBA 2G4DB 3TZUA 2KEDA 2I5HA 3KQ4A 3FAHA 3BZCA 2N9XA 1P1AA 1YQ4B 1XLPA 2DNCA 4MELA 5FR6A 4A3IG 3HK0A 2KCNA 3E0JA 5M3MB 4NKLA 2ON8A 4USAA 4TQUS 5COYA 2JPHA 3JVZX 1SYFA 3W1BA 3W2DA 1N33L 1EO6A 3DWPA 4GLVB 1C79A 2FE8A 2K9XA 1F0ZA 2AQ1B 4X64Q 2C7MB 2ZCBA 1DOXA 1XX8A 2RHQB 5T1IA 2BDOA 2DUDA 3NBHB 4C1NK 5JVH3 4HKZE 3OYYA 5IKCM 1Q46A 2GMIC 4K14A 2BWFA 4GNXC 4YSYB 2NB0A 2H89B 4JBMA 5FJ8H 3AMUA 4HRSA 1NENB 4AYBE 3IBEA 2EMTA 3S1MB 1NR2A 1A3UA 2O6VD 5ELCA 4AH6A 1Y8NB 2BB6A 3K9OB 1CMXB 2OXPA 2F1MA 4JYAL 2JA7B 1V6EA 3M62B 4ACFA 5IT9E 3APFA 1IBXB 4JI1L 4RM9A 1SFOB 3GTJB 3ZDMC 4KY6A 1I3QH 2G45B 2EYPA 3ZNHB 4RM8A 1JJ2A 3UIPB 2BYTA 1QOHA 4QGUA 4KIKA 2J4XA 3PUWA 3ULLA 1HQMC 4X65L 3HOVG 1KLGD 3WWVA 4DV5Q 1LXDA 3KJPA 3LDZE 4YTMB 3VH4B 4OGQC 2JY6A 5IE8A 1VQLA 1I42A 1K8MA 3HG9A 1JW9D 2IO3B 4XQNA 1H8CA 3M85A 1O78A 1L0VB 2BYVE 2OOBB 3AM9A 2JA7G 2KQ7A 2HHHQ 4J8QA 4LNKA 1L7YA 3V05A 3DEPA 2AWNA 1R4NI 1TWHB 2JT4B 2KX0A 4W9LA 4GN1A 5JEAG 4MSQB 3TP7A 3GTQB 2LASA 1A15A 1ENFA 2LY7A 2AEHA 2VY3A 4KGRA 1BOSA 1KAWA 2RR9A 1VQFA 3OW2A 1MVKA 3NRZA 3A9JA 2KACA 2I0QA 1CZGA 2IY1B 3IKJA 3R8BA 5ELEA 1E90A 3NWSA 3PSIA 3U52E 4K3CA 4IWOA 3P4SB 2GVAA 4LJOB 1Y1WB 1KDAA 2RSNA 2DENB 2RF4A 4JG2A 3WALA 2MBHA 1A3VA 3W3AA 2WHIA 1I4GA 5BMIA 4QQBX 3L7ZC 1DOLA 2D0OA 1EL0A 2FNJB 1Q81C 2CW0D 2HIXA 5IY0A 1JWBD 2M8SA 2NN6H 1HZBA 1SE2A 2MP2B 3J9CA 4H02A 4K6LA 3KFUA 2NTTA 2EYFA 4YWMA 2BQQA 2IZVB 1UE7A 3QJZA 4HSVA 5D14A 2KWCA 4JPSA 2GB1A 2WYQA 5JH5C 4G11A 4TKOB 4ASWC 1VQCA 1P7EA 3KYDD 1YBYA 1EIGA 3WOFA 2B8GA 1A62A 2Z1CA 1DJRD 1O7IA 1L2FA 4O42A 2OT2A 4GOPC 3CD6A 1QOGA 2JX5A 3P4PB 3PGEA 1DOYA 3PRZA 5KYIA 3S2DH 1Y1WH 1F2RI 5JAVA 4EGVA 2PMZE 1N5XA 4A3BB 3C8YA 5K36G 1DGJA 5AFWA 4WJWA 4HJ8A 1V1PA 3D6CA 1OQQA 5KYLA 3IG3A 4P72A 5JJKA 4URKA 3CCRA 3TMEA 1QUQB 3VYUA 1MI0A 3N20C 1AEXA 5GADC 4A3IH 2UWQA 4ZRPA 3J80L 5JJIA 2N7DA 2DAJA 4KTAA 4L6TB 1YNXA 2KJXA 3UI3A 4UP9A 4DNTB 4NPNA 3K80C 3NTIA 2Q2TA 1ZXIA 4HCSA 4X62Q 4DF7A 3RR5A 3MJ5A 1WYGA 3CQZB 1LACA 2HQLA 4FVMA 1TU2B 4A3JH 1VQKA 3ICEA 3S9WA 2KD0A 3UE0A 3VR6A 5M5XB 1E0BA 4IPGA 2R93H 3PO0A 3I7FA 1OFFA 4DR5L 2F3VA 1F9JA 3OMCA 2JA5H 4HLEA 2LXAA 2A69C 4KLKA 1KJTA 1WTWA 1X3QA 3S1RB 2LKVA 4EX5A 2OF1A 2A6HD 2BBCA 1MSGA 4GKKQ 3UI2A 4CKCA 1C4CA 4BOZB 4HWIB 1SAPA 3MC9A 3AEEB 2I1JA 1WFQA 3SEBA 3A56A 1MD2D 2WINB 1F2YA 3AEBB 3TEZA 1E24A 1SNDA 4HDOA 5C4HA 2DZKA 2EY2A 2I5LX 5D2MB 1H9SA 4HXDA 3CF5A 2HD5B 1QOAA 5C0XJ 4OVZA 1BCPC 2Z0DB 3PRMB 4F8MA 1D3ZA 5CX3A 3Q8BA 4M8NA 2O2VA 1V1OA 3ZJYC 1HR0Q 1H9MA 2WX0A 4QUCA 1VQAA 3NZ3A 3UQBA 4A75A 2R6GA 4HTHA 3I9V1 1SMYC 4L2YA 4AS1A 2EYLA 4JI6Q 3DM1A 2GA4B 1HTOA 1UD7A 3N1ZC 4GDLA 2VXWA 5J22A 3A74A 1KOTA 3T53B 3E56A 4F7ZA 3AQQA 3GZNB 4QIWE 1GG3A 1U5KA 4GNXB 3EBEA 4OWWB 2PE9A 3KLSA 4YHHQ 3S1RH 5C44B 1HZCA 4WQMA 1WR6E 2WKDA 3KF8B 2WXFA 4XYCA 1E22A 2J0JA 4K7SA 1NBWA 4NQKE 5M5XH 5TR5A 3SU8X 2F0VA 1XLOA 2A6HC 3HKZG 3PO2G 3HS0C 1PLFA 4BA1I 3AE8B 3CWIA 2WP8J 4A3FB 4RGTA 3I4MB 3H09A 2C7HA 2D2CC 1U9RA 4F88A 2EVBA 2RDBC 3GS2A 3Q8CA 4B9KA 3TEYA 2R93G 4HJ7A 1SIFA 4MM3A 4MACA 1L6UA 1WX9A 2KFJA 4JI7Q 4DHZB 5ELOA 1PH8A 2KOXA 4EZKA 3Q0AA 5C3JB 2I38A 3NJTA 3VH3B 2EJFC 5M5YH 5H92C 4K6DA 4S3SA 1P0RA 2EY5A 3K81C 2FHTA 3GTPH 3NP8A 4CHTB 2NR2A 3S2DB 3DWGC 3OIPA 3RNCC 3UQAA 4FF3A 4PS8A 1DYQA 3NBHA 4JWUC 4S17A 2WACA 2PPBC 2B76B 1JE4A 4DXGA 4EVOA 4V190 4M01A 1ZW7A 2L00B 5KNDA 2CCZA 1HZ5A 3J81c 3A5UA 5LXIB 3HM3A 2LJ5A 1WF9A 4WJQA 4X62L 2R92B 3D4RA 1NMGA 5C3EB 2INPE 2M1MA 2UUCQ 1GNUA 4YWLA 2YEPF 3UDXA 1T3QA 1WJNA 3CMAA 5K5PA 4W9EA 1FXIA 1IBMQ 3Q8DA 3U4ZA 1JCKB 2PI2E 2OWOA 3PUXA 1WE7A 2N3SA 3W5VB 3HVZA 1X9NA 5J2RA 5FLXL 2BTEA 4RAUC 1O7LA 4M00A 5FLMH 1Q1OA 2OHFA 5HGTA 5BR8L 1CTMA 3ML8A 3OHXC 5AUKA 2QCPX 3S17H 5KNBA 4GDLB 3QARA 2FIDA 2K1FA 3NENA 2LHDA 1HQRD 2I46A 1VZ8A 1C9FA 3I4NB 1ONLA 3X23A 1VQ7A 2ZVOA 2WXGA 5M3MH 2JYOA 3VUXA 3I90A 5NUCA 5I2YA 5DPTA 3K7AH 4X6AH 2EIFA 1GAQB 4P75A 1T0QC 3QX1A 1IYFA 5IODA 4BA2I 1YD8U 1UE5A 3GTOH 2PVOD 2GBNA 1CZPA 1E2VA 3GO5A 2PNRC 4JI6L 1YX5B 3ZYYX 1MI2A 1EIHA 1PGAA 2G1EA 4ICVA 5CBAE 1VQ4A 2LUEA 4OZBA 4W9CA 3ZXRA 1RKNA 1IL8A 2ZNVB 4DXFA 3H0GH 3I57A 3TP6A 3NVWA 2Z6KA 4DV1Q 3RCZA 1TYGB 4KVGB 1QKZA 4G7OC 4K0KL 3T16A 1GB4A 5FJ8G 1ILQA 3PIOA 3ZIMA 4MM3B 3GTJH 4BBSB 3HKSA 4GN3B 4C3HG 3D0FA 4YWGG 4YY3L 1YIJA 3SR6A 1YHBA 4DV4Q 4DK0A 2UU7A 1TWCB 4QUFA 3BINA 1ZEQX 2KWDA 3BVGA 4FXGC 4NXNQ 5C4XG 4RGNA 1XF5L 2WKCA 4GLAC 5IYBG 5ELDA 1IYVA 2K6QA 3NZUA 1XT9B 3PUZA 1EYCA 4R4IA 2KQSA 2N55A 4PMCA 3NY5A 2B8FA 1I7HA 1QNUA 2LMCA 1NNXA 4XIGS 4WQOB 3ZUNA 1EY9A 3TP5A 2FUG1 4EZLA 4RGOS 1H9KA 3CQZH 1HFNA 4ANXA 3GV3A 3RNFC 1WRIA 1PV4A 2DAFA 3ZXVA 3BZDB 3V61A 1TBEA 2NVXH 4FJZA 5C4JB 3R3MA 1L4DB 4L5QA 1B70B 1GUGA 1U4LA 2K5QA 5KGUA 3HOYB 2RMMA 4A3IB 1D6EC 2JP1A 1Z9FA 4PNYA 3E0EA 4XX5A 3F2CA 2MWSB 1FCLA 4ANUA 3ND9A 3DBHB 2LUMA 2VB3X 3PT2B 3HKZE 5ELNA 2X8XX 3I72A 3DQVA 5I9PA 1PHJA 1XMOQ 4TMAB 3GTGB 1I4XA 3CP0A 3NHEB 3RULA 4P1CC 3I3TB 3PSEB 2JK8A 1EU3A 2K5HA 3MZ5A 3PV0A 4P16A 4P1BC 5F2DA 1WH3A 3WIMA 1L1OA 2QSDA 1FO4A 4MDKE 3A8IE 4UDUC 1ML0D 3KWLA 3VYTA 4DK6C 2MBEA 3T8MA 4BWGB 2WU2B 2MSED 2F0QA 3U2SC 3MP9A 4DV3L 3VAWA 5CV7A 3VR2A 3BDLA 2LGXA 2F0IA 3AU5A 4XQJA 1CA5A 5DPRA 3RUZA 2B2TC 2RSUA 1G6JA 1XMOL 2WB1B 2J42A 3GTLH 1M94A 2EOTA 1HRJA 4JI5L 2HJ8A 4LK1C 4NXMQ 3RN9C 2HCCA 5C0XG 1WSPA 3ZTDA 3U4EG 2EYMA 3A1QB 2QDBA 1PH3A 1K28A 5HKHA 4WURA 1GJXA 3NG0A 4AJYB 1OXUA 3HRZC 4C00A 1JQ4A 1NJIC 3SDZA 2JA6G 2GI9A 3DBRI 1B7YB 2E3TA 2E75C 3DEOA 3IL8A 2JEBI 3WA0A 1CFMA 4I7ZC 3I4NG 2EJGC 1Y1VG 4ZLTF 2LSSA 2UU9Q 2IX1A 2NVUI 1AN8A 2JA5G 2KQ3A 4GN5A 4KK7A 4ICUA 1JWUD 1LO5D 1VQ9A 4HR7B 4CJ1B 4OL7A 1J9OA 5E7NA 1VCIA 1VQMA 1QVCA 3OPOA 1HNXQ 2PEAA 3H8HA 4BZAA 1EQTA 3V62A 4GLSC 4DR5Q 5L95C 2J53A 2A73B 1DOIA 2M0AA 3CCEA 3RNGC 2K01A 2IT1A 1GJZA 2F0EA 5GAGC 1V43A 3TDQA 1Q12A 1WTQA 4FBJB 5G55A 1TTNA 2M56B 3VUYA 1IL2A 1VS0A 4IPHA 4X66Q 3RZDH 3ONSA 1L1OB 1K0RA 3DHHC 3J80E 1K73C 1SDFA 2KJHB 2L15A 1R9TH 3FILB 1PRTB 2KECA 1E1OA 1R4QB 1IGCA 4JK1C 4JI8Q 3W9CB 4JLCA 2REXA 3RT3B 3QB3A 2OCEA 5EDSA 5CV6A 2K52A 1MPEA 4BKSA 1B2TA 2K5PA 1C3TA 3UINB 2MLBA 2KVMA 4JV5L 1L5PA 1JOKA 1S5FD 3A7LA 5E6JA 5GMVA 4Q0FA 2EELA 2N88A 3DM3A 2Q8TA 2M4NA 2MO0A 1CM9A 2KA7A 4YIJA 3B0AA 4X66L 2EYJA 1Q90A 4B3TQ 3L4PA 4FA6A 3JAMi 3S17B 4LF8Q 4KZ0A 3T1HQ 2YU9H 4FADA 5IOIA 3AI5A 3H3VI 2ZJRA 3LNNA 4MEMA 3MEFA 3VQIA 3FP9A 1B3AA 1F2LA 4G57A 1QF6A 4YCUA 3KF6B 2NZ1D 2NBWB 1E8XA 5HHDG 2BS2B 2LS01 5LMNQ 4R9WA 1EIFA 4GB9A 4JI2Q 3BG3A 5IP7H 3VTVA 2F0LA 2DYMA 4KGSA 4PQXA 3NBIA 1EFID 2XWJB 1WGGA 4L5SA 1T0SC 4E3CA 2W54A 3QOLA 3W5UB 4A3GH 3S14B 3ND8A 1GPXA 2AQ3B 3S16H 2NVTB 2CJOA 1VQPA 2W55A 2G9DA 1NI2A 3LYYA 2LZ6A 1Q1BA 4NXML 4FO2A 1BCPB 4A3BG 4TSSA 4KV6A 3AB9A 3A7AB 1WTOA 2LRWA 1LTGD 4GU2A 4BY7G 1L0YB 3L10B 1NAPA 1VF7A 1QE6A 3D31A 5LL6S 2L5TA 4IQZA 2YU9B 1I4PA 1IXRA 5FO8B 4FF1A 1JWAD 1MHXA 2K25A 4WWMA 1EY4A 5AJ3L 3NZSA 2FCMA 2NBVB 2K14A 5IP9G 3IXSA 3R93A 1SNMA 5M5YB 3MAQA 5IOCA 1ROEA 1M90C 5DEHA 2DBYA 1TT5B 3RLFA 2B63G 2HTME 1RFKA 3TEHB 4IKGA 1V49A 4LCDE 2WS3B 1ZDVA 1VZ7A 5DM63 1B50A 3FC4A 2V0GA 4L5TA 1O7ZA 4DHZE 1DD2A 2PI2A 3GZNI 2SNMA 2NVYB 2I07B 3RNUA 1I4HA 2Z59B 2AUKA 3K5LA 5CTRC 2ZJQA 1W6KA 3CCJA 4DV7L 3EN2A 1HA5A 2KHWB 3U50C 4KKUA 4X65Q 2KCMA 4S0RA 2N49A 4HCNB 3R3OA 2VS1A 3RFZB 4RKBA 4NPSA 1P98A 1SEBD 2GBRA 3ABVB 3RZOB 4ZHPA 2BH8A 4DV0Q 1SLJA 2F3WA 2A1AA 2FCQA 2D62A 1WM3A 1UH6A 1WXMA 2BYEA 3QWZB 5AZHA 4QIWB 1IKLA 3LWEA 3NXWA 1FFUA 3AEAB 3EA6A 2Q8IB 1PGBA 3ZVVA 4A93H 1VF5C 3IRBA 1LTAD 2DYOA 1VMCA 2KK8A 3Q8EA 4RMAA 4HMJA 5IGBA 4AJWA 4X3UA 1XPRA 2JZZA 3AE6B 1Z5SB 3CRKC 2WU5B 3S1NB 5JEAJ 1TJEA 2CQOA 4RNAA 3VYSA 5JHAA 2C5CA 4TRDA 2M2LA 2EJMA 3WCQA 3J81i 4IOIE 4OW0A 2FIFA 3DVGY 3IT6B 4QY7A 4FN2A 1LGRA 3DBLB 2R61A 1VQNA 1K83H 3W5OA 4AYBG 1QQRA 1HZ9A 5BYRA 3GE8C 4I6PA 2BDNA 3K6OA 2FJ2A 4P2CB 3U4VA 3VHTC 1WMHA 1TT2A 2QF7A 3J7AV 1WYDA 5BMHA 3PZDA 4A8XC 3AH7A 1H9JA 1E9MA 1VQ6A 2RPQA 2X6GA 3DPDA 1YJWA 3R7RA 3CPWA 2R92H 3IHPC 2R7ZB 3ZW3A 3OWFA 2F0JA 4IN3A 4WH4A 3UF8A 2H88B 3O65B 2ZCCA 1WX8A 1IBLL 1KDCA 5ELBA 1F1HA 4ZYSA 1XMQL 5KRUA 3RMKC 2TSSA 3N3KB 3W1YA 2A19A 3HFZB 3TP8A 5AJ3Q 3H1UA 4EZJA 1BBWA 2PMZB 2KFKB 3MFGA 1JMLA 2M9VA 1RIPA 3LX0A 4XYQA 4FHKA 1LYLA 1OEYJ 3KJOA 3G48A 1RWSA 2ZZPB 2ZNVC 3PMFA 3SE0A 4KHVA 3A5ZB 5IYDH 1RODA 4ZQ3A 1E7ZA 2PQAA 3ZNGC 3SDLC 4GXBA 1XO3A 1RJTA 1HNZQ 1SBBB 1C4PA 2KVRA 5CR3A 4POFA 3B08A 2QDLA 2F03A 4C3IB 4MT5A 4TKNA 4D2KA 4DDGD 4LNIA 3V6CB 2CKHB 1W2BA 4IURA 1EWIA 4IM2A 2JA8H 3MWYW 3TS2A 1D8LA 3EFXD 1AZPA 3GP7A 4LF6L 1N63A 3EECA 4X57B 1VDZA 1SIJA 1DXMA 1VDVA 3M3YB 1RL2A 2JXMB 4CQNA 5JPMC 3K5NA 3W1GA 1PYWD 2JA5B 1F2RC 4BY7B 1SNQA 4OWXB 2KC2A 4GOPA 2BE5D 4REZA 1AH9A 2JUOA 3N1YC 3Q3MC 3FMCA 5IT9L 1S3SG 1WXQA 3U7DA 3RN2A 1VQIA 1RAXA 4UY8C 4GLXA 1UEAB 4DA2A 2D10A 1HR0W 1TGZB 4V0BA 3GV6A 1TS5A 5K36H 1K3BC 2CR5A 3GTMB 1GHKA 4X3SA 2V1YA 4AWJA 1NMFA 1PXUA 2Z8LA 3UDGA 2HD3A 5E1FA 4A3LG 3A8JE 1RLFA 2MW5A 1X3EA 2F0WA 1VQ5A 4B3ML 1N9WA 2CFMA 3CIRB 5CHWA 2KLCA 3LJ3A 1MBYA 3MJWA 1STAA 3R66C 5JOBA 4XWWA 5EPLA 1FJGQ 2ICEC 4JI1Q 5C3EG 1VZ6A 5IGCA 2D5GA 2KDMA 2W9NA 4MGYE 5CHFA 3P4RB 3EROA 4OZAA 1QJOA 1EUJA 1F9PA 1HCZA 2V4DA 2QEXA 4OX9L 3BWUD 1FM0D 4PS3A 4NMZA 4JBJA 1PFBA 5E4XA 2FUHB 2UXCL 1V80A 3TMPB 4KSLC 2PCFB 2DYBA 4BY1G 4WFN3 3A9KA 3AEGB 1JROA 1Q8IA 1YN3A 3Q23A 1T9HA 5EKLA 2BYFA 3ZKJC 4LW1A 2R7ZH 2VZAA 1V81A 3AN1A 4C3IG 1EYDA 4DV1L 2Y0SB 2AQ2B 2WXIA 2BGFA 1F9QA 1VRAB 3ETRA 1LM0A 5C3WA 1WE6A 3NSWA 4K0KQ 4AYBB 2LI5A 2GRIA 2IDYA 2YLMA 4NAMA 1A6XA 4H7BA 4DR1L 1ISNA 1I35A 2C5LC 2KEEA 3FHWA 3NPPA 4C3JB 1JOQA 2PW9A 2KHIA 5AZFA 1JB7A 1STNA 2R92G 1E6EB 1LUZA 2V1CC 2QIEB 2QDFA 4HN7A 2N7EA 4DXAB 1KNAA 3HEJA 4JI4Q 4OO1H 4LNNA 3GTQH 2WDRB 4IW0A 1E2WA 4DR4L 2BS3B 2D11A 2Z0SA 4CJ2C 2D9UA 4NB3A 2ZJPA 1WIAA 2VH1A 4PYUA 4HIDA 4K8JA 1T5EA 1I6HB 2D07B 4QL5A 3EQLC 4IWPA 2MP1A 2XWBB 4C56C 2KQ4X 3MTSA 1B1ZA 1C4QA 4LTUA 3LGJA 5GXGB 1EY7A 4IUTA 4NP5A 1EF1A 1S40A 4GOCA 1KLUD 1CSPA 1ZXHA 2NTSA 1LTBD 3ULPA 4GDKB 4ITKA 2AL3A 3AEFB 2NMQA 2UXDL 3QG1A 3IVFA 1SFOH 1QT9A 1PMRA 3N9YC 1G291 1EQVA 5DM73 4BBNC 5HI1A 3ITPA 2IGGA 1BO0A 1CKOA 5A2QL 2KDFB 2IHFA 1D4BA 2KDBA 1EZ8A 4C3JH 2BVCA 4YT0B 1ASYA 3ERSX 3NOBA 3A54A 2K50A 1E7PB 1J5EQ 1D5MC 4NNJB 4EFOA 3G6JB 1Q10A 2K22A 2M19A 4MSMB 3VUWA 5EBDA 2RQXA 3SHQA 4QB4A 1PA6A 2Y0SE 1AZQA 1YQBA 1SB3C 4XWTA 3HIZA 3SD5A 4L23A 1YJ1A 4RCNA 4CKBA 2K75A 2NUCA 5CV5A 3KWVA 4CKEA 1X3PA 1FNVA 5IA7A 3QIJA 4IZ8A 2CU1A 1JJCB 3MXNA 2HE7A 3UGBB 4G0NB 1MJEA 2ZPNA 2RA4A 1B4OA 5IWAQ 2VUMH 4A3EG 3NVVA 1A63A 1RHPA 2M0XA 2K4KA 1IW7D 5JPNC 3Q6BA 5BN4A 2WAQE 4G4KA 4GGQA 1N62A 2KDIA 3HOUH 2UU9L 1FR3A 2C9WB 4DR3L 3E3XA 1N32Q 3KVFB 1HH2P 2JRHA 1JQYD 4F7XA 1XD3B 3PVLA 2QHOA 2PW5A 3M4OB 2JQRB 2IO1B 5IYCG 3B6YA 1RFAA 2KZRA 3T3OA 3K0XA 5H1SE 1JE5A 3H6NA 4DNRB 2CKZB 5FLMG 5C0XH 1YOVB 3NUCA 3FVQA 1JC7A 1I4QA 2CWAA 1T6BX 4TQ1A 4W9HA 2FCNA 4M0WB 4MN3A 3EGRA 3KUZA 3HOXB 5FR3A 4NQLB 1JT8A 2RD0A 3I91A 2LRUA 1EOTA 2LXJA 1RTOA 1NVID 4YHHL 3HOZB 4YCVA 5CV9A 2GBJA 1SJHD 4LJZC 4LNQA 1VQGA 1I50H 4K8IA 2AWOA 4IJHA 2ZM6L 1S72A 4OX9Q 2XTIA 3HOVH 1R4MI 1TY2A 4LF5L 4A3DB 1SN8A 2LFIA 3IFWB 4GDKA 4BKSD 3KH0A 2K0PA 1S4ZA 4LUVA 2L1BA 2F0PA 4DGZA 2LWPA 4DKAC 2NBFA 2JA8B 3VDYA 1G2TA 3HHMA 2JXXA 4BY1B 1IW7C 2KXJA 1U4PA 4IOAA 1CKNB 3MHZA 2KWUB 4FJYA 3OTOL 3FPUB 1EY8A 1Q82C 2F0UA 1ZYRC 3HOWH 1GUAB 2WXOA 1N34Q 2XK5A 2KANA 3FKYA 5EPJA 4KI0A 5BN3A 1UE1A 4K1RB 2WAQG 3IAYA 3DHIC 1IBKL 1E8WA 1V8CA 4DQOC 2AX5A 4GOPB 2K8CA 1UGJA 3DVNU 4HDQA 2FINB 1BMLC 2N9PC 3DWAA 5GROA 2YTVA 3HGBA 3MXUA 3BK1A 1QVGA 4I6NB 5DNFA 4F87A 4BBRG 3M4YA 4DUZL 1NEKB 4B9WA 1FIQA 2K28A 1D1IA 2WXKA 2V9HA 3LXFA 4II3B 1WTXA 3VR5A 5G3LD 1HNWQ 1BT0A 2LEKA 5EE0A 1C48A 1WTHA 1T5XD 3A4SC 1S5CD 2SDFA 1V9JA 4YXDB 4MJSB 3EC8A 2CH4A 4A3KB 4ZKBB 1CHPD 3PIO3 4ZRQA 3ZJTA 2HQEA 4JC0A 2MJEA 2L52A 5CV8A 2SEBD 3EFCA 1SYGA 3B9JA 1PGXA 2VH2A 2XGTA 4IFDH 1WXVA 3D6WA 3J81E 2E2DC 3X3MA 2B39A 4HCPB 1B8AA 4DUZQ 2B2WC 3S2HB 4WORA 1XYIA 2JYEA 2PVGC 1KC8C 4OVVA 2Z6KC 3T9LA 3NE5B 2B3GA 3L17A 1WXSA 2JA8G 2C7NB 3RNEC 4IFDI 2KHSA 1J8IA 5C4JH 4PV1C 1SNOA 4IJLA 2A6ED 2O2VB 1N36Q 5BN5A 3EFUA 5A2QE 1KABA 3HOXH 1QZHA 1Y1VH 2YTXA 5M5WB 1WTPA 4ARIA 1LM8B 2LVOA 3JSVB 2BA0A 4LFAL 1WJ6A 3PV1A 1A3TA 5CYUA 2SOBA 2KTRA 3D4WA 5IGGA 5MPOA 4RHSA 4DV7Q 1X3FA 3M4OH 2EZVA 4FDBA 3H15A 2PKOA 1E10A 1D5XC 3UDIA 4DR7L 5IAAC 1NR4A 4OONA 3AXCA 4MIUA 4B3RL 2J7QB 2KTFA 2JSOA 3GTOB 2C9OA 2DHZA 4JIOU 4DHJB 2L3ZA 2EXDA 4DK3C 1KHIA 1KTKA 2QC8A 2UYZB 3A1QA 1LT6D 1XMQQ 4LF4L 1T0YA 5IP7G 3U30A 1X32A 1P9DU 4ME3A 2JVCA 3CPFA 3OTOQ 4JOIC 1QZEA 4LDTB 4WJOA 3AU4A 1SNCA 2I5MX 2XN9C 3N1XC 3ZNID 3F2DA 1MG8A 2WXPA 3FPPA 1HPCA 1HFGA 5LMNW 1Q86C 4KZCA 4A6QA 1JALA 1Y56A 2DZIA 2INCC 3D4DA 4EUTA 1J19A 1YI2A 4KY5A 3CCVA 3DVGX 3OJ3A 3BYYB 3CU7A 3KBGA 1DOMA 4RGMA 4EQ5A 3G7LA 3E9IA 1VD2A 1TWFB 2L9HA 1QZGA 1Y8RC 1Q5WB 3WDNA 4G50A 4RF0A 3U7ZA 2C60A 5C3EH 1SYCA 2A68C 2DNEA 1GOZA 1PH1A 1D5ZC 3MHSD 3RZDB 2WXMA 3AEDB 4HJ9A 2N78A 5IGFA 1JB3A 3CSFA 1QB5D 4IOCA 4X64L 2V4LA 2P5ZX 2ONQA 4HJKA 2GOWA 3KYCD 3BK2A 4RMFA 1KH0A 5G5GA 4GIVA 2PQAB 4R3DA 3H91A 2ATWA 1CZWA 2AYOB 5BO4B 5G3LF 1AW7A 3B2FA 3MA2B 3PO2H 1I6VC 3MC0B 2J0KA 2WDTB 2A69D 5E6PA 4OIJA 3SK6A 4GNXA 1P16A 1DCZA 1XWEA 3M7NA 2Q8RE 4Y7NH 1WZ0A 3VR8B 4NAWA 4C7YA 3MHBA 1FPYA 3TBIB 5D7GA 5C1ZA 1SYDA 5J18A 4EQOA 4RKLA 1Y69U 1TKEA 1F2MA 4FULA 2CHBD 2JE6I 2OTJA 2KVZA 2NCNA 4W9KA 4HEDA 3AV8A 3D8GA 1TWAH 4DV4L 4GN4B 2HDEA 4EOYA 4PK1A 2PZUA 2V3PA 2R3ZA 4JBWA 4JX1C 3BDCA 3G71A 1Y8OB 1UGMA 2NVYH 1I94L 4RA8A 1F2ZA 5G5HA 3HOZH 1K50A 4R4QA 1WY8A 3TBLD 3Q14C 1PRTC 4OELB 1ZOYB 1KIXA 2NVXB 5D94A 2K03A 1YNJC 2D3BA 4R8IA 5IP9H 3QCAA 1C78A 2HUGA 5AUIA 3HOWG 1ENAA 3C0RB 3S1QH 2B2VA 3PO2B 3L0OA 1TVXA 3N32A 4FF4A 4BY7H 1G8ZD 1MKHA 4LWCA 1IPGA 3VDZA 1XXGA 3PZ7A 3ENEA 3MTNB 3NVZA 4LFBL 4MGZE 2E8GA 1EWCA 1UEBA 2J7ZA 4K7UA 2OQKA 4C3HB 3J80i 4G7ZC 1PTOC 1K53A 3BIID 4W9GA 1Q1EA 2YTYA 1OEYA 2XK5B 1VQBA 4Q5VA 3M63B 2E2JH 1KF6B 3NVYA 1GKHA 1TS4A 4KDIC 1NSNS 1FRDA 4ZCKA 2WQYB 5KIXA 1VLBA 1HTPA 1UBQA 4KKIA 3OW7A 1AE2A 2ZT9C 1WI5A 1N36L 3K0YA 4ZHOA 1UAPA 3T3NA 1CQFA 1GXDC 5I6YA 1X56A 3HVDA 3V96A 2K8BA 3A4RA 5L83A 2Z4IA 5LMNL 1M1KC 2O5IC 5EE3A 5EKKA 1SJED 5DPSA 3GTMH 2CU3A 1YNJD 4JV5Q 4Y52H 4O2DA 3GE3C 3RD2A 2IGDA 4PMWA 4EKUA 4C2MH 3GD7A 2N4FA 4IUPA 2XIWA 3TSSA 5LMUL 4OO1I 1MJCA 4AOFA 3TEWA 3RLOA 2ZPYA 4OIKA 2AKWB 2WB1E 1N60A 4B3TL 2LHEA 3U8ZA 5LNK1 4A3EH 2ICIA 4QMGA 1VJKA 1LTLA 5C3XA 4FF2A 1G6PA 1U0LA 4Q2JA 4NAWB 2K39A 5EE1A 1WJJA 1BBXC 1C1YB 2MJ3A 2ZVNA 4R4OA 1RYJA 4JI0L 3KOJA 4ZDVA 4BS9A 5M9OA 1BCPD 1KAAA 2F0TA 2G5DA 1I4RA 1ZKOA 3JC66 4B6WA 4WJNA 3TCAA 2WV6D 2DJFC 1DGSA 1YHQA 3Q69A 3ZLZA 2ACZB 1SE4A 4AIMA 1TWAB 3CSTA 3ECIA 2E76C 4ZYNA 2HT1A 1PYBA 2Z0EB 1FD6A 3LWUA 3FKIG 3F8TA 3ZJVA 1X65A 3TZDA 3P42A 3HKZB 3VA7A 3T56B 1C76A 4JGHB 2NZOA 2PNHA 2UXBL 1WGHA 5C5MA 1PQSA 2J52A 1TWGH 3KDFA 4OVUA 4C1NI 1MHWC 2VQEL 1STGA 5C4XB 1KXLA 2Y5CA 3SFEB 2N1VA 1FEHA 1WGRA 4R8NA 4JI5Q 2IX0A 1RTNA 3Q22A 1B9MA 1XNRL 4H2AA 5CHVC 1VQ8A 5C6AA 2MJDA 4C80A 2R7ZG 1HZ6A 2JU6X 5JZEB 2K05A 2MP2A 5HURA 1SRUA 3EHVA 1CSQA 4N8X1 4NJ6A 2K1BA 2GBMA 2B29A 4DAPA 3I56A 2QA4A 2DGYA 1CA6A 3HOZG 2F0HA 4KD4A 2D5DA 2MEKA 4L8JA 4YWKA 3UE1A 3T51B 1OXTA 3PZ8A 1MSHA 1R4MB 1W6JA 2BPSA 4KD3A 2MX2A 2ENBA 1TWGB 5D3IB 4HVBA 1VQJA 2K33A 3E9SA 1GUTA 1JR0D 1ZYRD 1HJPA 2JSVX 3U9OA 2D3GA 5D3DA 3HOYG 2H1EA 1WI0A 4M8MA 3OJ4B 4LNOA 2F0DA 3RLNA 3ZNZB 2HIVA 1WCMH 5G2NA 3GTPB 3EJIA 4A76A 4KHPQ 1VQOA 3I73A 1G51A 1E5WA 2PPHA 1SROA 5IWAL 1V2YA 3OMGA 2BKRB 3CC2A 2INDC 3Q3NC 3EIVA 4OHJA 4WAAA 4WRDA 5CBEE 2N7JA 2ZEQA 3ONAB 2OJWA 4JL9A 4R1JA 2FAZA 2I1KA 2KHJA 4RCOA 4LF9L 2WWZA 2L4NA 2VQFL 2WNMA 2B2VC 1N32L 2YEPB 3RUIB 5JXVA 4NDXA 1Q8KA 3HM6X 4JBKA 3TS0A 3UDFA 3E6ZX 1K3RA 1YJJA 2EYHA 2Y5PA 1JWSD 1YN5A 1WJ4A 1WFYA 4Z9CB 2JF5A 4J6IA 4DV6Q 4XT1B 3DOWA 2KT7A 3J7AF 2K32A 2K5NA 1VMPA 3PF4A 1HNWL 2BB5A 1WX7A 4P6VF 2K8HA 4XDDA 1RCVD 4PZ7A 2KN5A 4BFRA 1SE9A 1A2TA 3EVQA 1HA6A 3HUIA 1EY5A 2CW0C 3KLRA 2AMCB 4UAIA 3VFKA 5E4WC 4BXXH 4DHJD 2B2YC 2EDGA 3PRPB 1WTRA 3L0WB 2K5DA 1NYQA 1CQVA 2R2OA 2E2HH 4NJCA 1TIFA 1E8ZA 2X38A 2VL6A 3A33B 3U58A 4KN4C 1YQ3B 3BVZA 1Q0WB 2ZTEA 3CC4A 2KLGA 4N58A 2LXCA 2KAJA 1D1KA 4ZK9B 5I4DA 4M02A 5A35A 1U4AA 1BBUA 2BCOA 2C35B 3QIAA 5GQOA 3PIP3 1JJGA 3H0GB 1OXSC 4LFCL 1J7AA 1N5WA 2JZPA 3KUDB 2MBBB 2MRPA 4IUUA 4M0WA 1YVCA 2BT6A 1PTOF 3T1YL 2M17A 4N59A 4CYEA 4I65A 2MQJA 4OEMB 2L11A 2ZTDA 4K2KA 2UUAL 1PRTD 4NZLB 4A3DG 1BR9A 2W82A 3NS1A 1O80A 2IPKD 1H95A 3HOUG 1SSOA 4PZ8A 2PTLA 3H6MA 2XRSD 4LF6Q 3F1ZA 5EBCA 2MCNB 1Z2MA 5JEAH 1ZKHA 1ZPSA 3ML9A 3TIXA 1SE3A 1UBIA 3L2PA 2RVLA 3CHBD 4HJ5A 1OTCA 3APCA 4JVZA 1IUEA 3BZKA 3KK7A 1GVPA 4F1SA 3CCUA 4MGKE 3K5OA 1U4RA 2B2UC 1HEZE 4LAAA 5IT9c 1V1PB 2L83A 4LF4Q 4DWFA 2NPTA 5FLXc 1A8VA 1PTOH 1X6OA 3DHQA 3P75A 2OJRA 4HJGE 1FRRA 2FFKB 1Y14B 4W9DA 2Y3AA 4B3MQ 4JYAQ 2K7VA 4JW0A 3TUOA 3VYRA 1SMYD 2IHEA 2L1AA 1E3PA 1EU4A 3KYHC 1OXXK 4PZ6A 3K8AA 1FXTB 3I4OA 1CKNA 2ZM6Q 1C9OA 4DAMA 2IYDB 3C19A 4TV3A 3GQBA 4XDCA 3TL5A 4DK5A 3ZJUA 3VA5A 3KLSX 1N8RC 3PPAA 4A3OA 2CJNA 4YL8A 1A2UA 4L63B 4NXNL 3S2AA 2DN8A 2UXCQ 2L0CA 1FD7D 3A8KE 1JRPA 4YSXB 1LTSD 3X3NA 4AQ7A 3PQIA 3JAME 4AQYL 2DZJA 3RI7C 1PUTA 1XJVA 1KM7A 3WAPA 4B0EA 4UPAA 4J6HA 1EM7A 2F52A 3JW0X 4NW2A 1RDPD 3C46A 4BVUC 3R7QA 1DONA 4FXDA 1J0GA 2QKIC 1PTOB 3PCOB 5IYBH 3ER0A 1LLRD 1TWHH 3NQTA 2WGSA 5J39A 2B63B 4WJPA 4MH8A 1L2NA 1G6ZA 3H3VH 3ZO5B 4MGIE 4IO9A 1LT4D 2R7FA 1KD1C 4XYOA 4BOSC 5CGKA 2YV5A 2IJ0A 2VUMB 1PH6A 1GD7A 3Q8FA 4UP7A 2VZKD 4CDCC 1BDOA 2UUBQ 2Y5BB 3P63A 4FP5D 1BF4A 2JZ3B 3JYUA 2SNSA 3IT4B 1EWYC 1FNUA 5EAYA 1HE8A 3HOYH 1EIYB 1UF0A 1C77A 1WD0A 5C44H 4LF5Q 4HPMB 4W9JA 5I6WA 2CVRA 4C2MB 3QQ8B 1L1OC 2F0OA 4JPBW 4CGYB 5HFYA 1IP9A 1SYBA 4LFCQ 2CQAA 3AECB 4IC7B 3MXGA 1BQQT 3FKIB 1BXTA 1CKMA 2RKSA 3MVVA 2LMCB 2KENA 3VR4A 4JI0Q 2DNFA 1GUNA 1ZUD2 1D2BA 1PYSB 3PTFC 1W3SA 3HOXG 1WCMG 5ISRA 1PH5A 2UUBL 1R4PB 1YX6B 5CMDA 4CDEC 2D3CA 2WP9B 3SGIA 3ULJA 1IBKQ 1HR0L 4K2LA 2UUCL 2B3AA 4IPCA 3H7PB 3GTGH 3M95A 2KDEB 1TZ1A 1V8QA 4OWTB 3ZDTA 5AZGA 1FJGL 2E2JB 2FCSA 2L32A 3V2TA 1S1QB 1BUIC 4IWQA 3J81j 1PDXA 4K7WA 4CHKA 3RNAC 1WR1A 3Q3OC 1TR5A 1EEID 2KUMA 1DOKA 4CO7A 2IGHA 3SVMA 5E3FA 2DX5B 1TWFH 1RM6C 1NCVA 4J15A 3DLLA 1KLVA 1AE3A 2MGSA 4A9AA 1WGDA 1CI3M 3AULA 5EPKA 1HTLD 3NWTA 1XPOA 1UZXB 2JQOA 3SR1A 3FKIH 3TREA 1TZOA 1AFPA 2A5UA 1Z6HA 4BXXG 3TJPA 1HHVA 1N61A 1NE3A 3CCQA 3HOWB 2AL6A 4ARCA 3FDTA 2O6VA 1P8LA 2E2IH 3M4QA 1CHQD 1PDQA 4RG1A 5LL6X 3DHGC 2BWES 2KKCA 1E8YA 1EEFD 3P7JA 1ZGUB 4L5RC 1Y1WG 4QAYA 3KUPA 2H5XA 4LF7L 4IALA 1EF5A 3NS8A 2N9EB 4X3KA 4WJ4A 4BBRB 1E2ZA 1UWMA 5M3FB 3AE4B 4IUVA 3I4LA 5LLIA 2PYKA 1GB1A 3OWEB 2Z6BA 2WXJA 2NPTB 3JSVA 3MEHA 3AMZA 1STHA 2ZW1A 1CK1A 3PIPA 2HDMA 1EY0A 4A3KH 1S5ED 3S1NH 1GUWA 2EQSA 4K5WA 1QOFA 5E6OA 3ZRFA 1LQBA 5FK9C 4QCLA 1MHHE 3E9HA 1WMHB 4I6LB 3C1FA 4B9XA 5J1ZA 3BS1A 3AE2B 2KMMA 3DBSA 5CV4A 4XC2A 4IUMB 2JXTA 1BVSA 5T1GA 3T4AC 3S1QB 3BY4B 3CW2C 1E0ZA 2Q5WD 4US9A 5C2TB 3KBXA 1ZP0B 4KJOA 1EFWA 5C4ZA 1B53A 3T13A 1ENCA 4HIMA 2RDHA 5M3FG 4DAYA 1OQYA 4ZOHC 3CCSA 3C1EA 4PG3A 1HXYD 1NY4A 3GDEA 2GVBA 4P74A 4A90A 4BKTA 4BBRH 4DNIA 2XRQD 1N33Q 3S2HH 2QMTA 4W9IA 2Z9HA 3W1SA 4JI3Q 1TS2A 2KBNA 1XNQQ 2MPMA 1BKBA 2D3AA 3M7GA 4POGA 2FMCA 3GB1A 2IBIB 3AEVA 4A3JG 1TS3A 4FNFA 3AE3B 5TSSA 4QF4A 4AQYQ 2LJIA 4ILWA 5EGTA 3BJUA 2JA6H 4DAYB 2XSCA 4P71A 5LHY1 1QUQA 1ET6A 2O6VB 2JJQA 4JWSC 4WWNA 2PQEA 4PMBA 1JRUA 3AFPA 4DFAA 3H9DA 4FLHA 2F0NA 3DVNV 4A3DH 2NZHA 1K8OA 4US8A 1I50B 1SR3A 4GS3A 3SHLA 2R7DA 1UWXA 3Q2AC 4A93B 3J7YW 1YJ9A 5GAEC 1XCTL 2WXHA 5D6JB 2LGSA 4JI3L 1XNQL 1TXYA 3CXCA 2VB2X 3AE9B 3S15B 4R4TA 4FXKC 5FO9B 4B3SQ 4GKJQ 4M1UB 2RBMA 4DAVA 4DV5L 1VQDA 3PUVA 3KDFB 5CORA 2B2WA 1LTTD 1Q3LA 3U9SA 2PLPA 4RFBA 2L12A 1P3QU 2WXNA 2E2HB 4P7IA 2Q2HA 3CC7A 1UWVA 2Q2UA 2F0SA 1VQHA 2F3IA 1PH7A 4PYZA 2CH4W 2DZMA 1HNZL 1PZKD 5C44G 3NELA 3DWMA 2WIIB 2RHSB 3QHTA 1B3QA 4C7ZA 2DY8A 4LFAQ 5IIFA 4DR6L 4DDID 1WCMB 2L7RA 2Y0SG 1JOOA 4EQNA 3I5JC 3H7SA 5IYCH 2KO3A 3Q6SA 4A3FH 4PS7A 1I6HH 3ZQ4A 4OZCA 3K7AB 1X1MA 1UNSA 1XTDA 2KWVB 2X69A 1F77A 1LT3D 1UE6A 5KEEA 1WVLA 3C2PA 1PVOA 1XLNA 3STBD 3K59A 2J0MA 2XEWA 3PHXB 4FHJA 1EQQA 1A0IA 1KDBA 1ICWA 1K8RB 4WWOA 1IYJB 1EY6A 1VR9A 1LT5D 5KHQA 5FO7B 4C3JG 4LF8L 3DBRB 4A3JB 1GUSA 2ASQA 5LXHA 4NY0A 4ZRZA 2ALYB 4ULLA 2EYOA 1QVFA 3V3XA 1PZID 4QJFA 4HROA 1E7UA 5C0XI 1MFWA 4J1MA 3HP3A 1STEA 2LXKA 1WRDB 2NWGA 2BA1A 4A93G 1IZ6A 5LMUQ 2WXRA 5BMGA 1FNWA 1YIWA 4JI8L 3J7A5 3P20A 4DR7Q 4BBNF 2FXQA 3I2ZA 4N9PA 3F2UA 2ZJDA 1J8CA 4DR4Q 1TKWB 3VTWA 3M4PA 1IBLQ 4IG7B 4KJNA 3I3CA 2JWUA 2N9KA 4OO1G 4PT5A 4A3CG 1EOVA 3D32A 1EYAA 4H44C 1YZ6A 4HIOA 1OGWA 2SAKA 2PZWA 3N6RA 1FFVA 4BAXA 3RD4A 3H3VC 4H13C 3KW5B 1PFMA 3SK8A 4KHPL 1H9SB 3OIQA 4GKKL 2LD9A 1S5DD 1U4MA 1P7FA 4L1BA 2NBUA 2VNUD 1E1TA 1QLBB 2RDGA 3G6EA 4DV3Q 1CT1D 3H0GG 4K81A 1AP0A 4HAEA 2EKIA 2NVQH 3RYTA 4A20A 2MUYA 1A5RA 4HSPA 1CJEA 4K5VA 2DLBA 4DR1Q 2B63H 2VQFQ 1ESRA 1MG4A 3I4MH 4N8FA 1B9NA 4AP4C 2PIAA 4ODGA 2IW3A 3TRZA 1II3A 3AE1B 1ET9A 3VR9B 1WYWB 4HPPA 2G4SA 3L13A 4O0AA 5M3MG 4DUYQ 5IO9A 1OQRA 4KGTA 4O1NA 3LB8C 4A3MB 1ESFA 1L0WA 3Q24A 2KMAA 3AE7B 4WWPA 1SXTA 5I9OA 1L0XB 3BYTB 1PH4A 3RNBC 4EQPA 2F0GA 2BF8B 3WAMA 3QC8B 1GM5A 3I55A 1PFDA 1WWTA 1IBXA 2RDFA 3S24A 4LNFA 4TQ0A 1YNND 1KFYB 3CRLC 3I63C 3Q8AA 4GMVA 4LDTD 2G3QB 2K6DB 1ZDXA 1QNKA 2QGQA 2RCFA 5FOBB 1HNXL 3W1SC 1XTCD 2EE1A 1TIID 2CWPA 2ZXPA 1FGBD 2X6LA 3BU2A 3TQYA 2RSOA 1IBML 1V5TA 2W3SA 3KF6A 2CHWA 1NYRA 2K3UA 1YMHE 4DV2L 1EWHA 1K8AC 2YVCA 2I2YA 2QJLA 3IFTA 1GO3E 2J0TD 1WOCA 3HZXA 2D2QA 5IGDA 3J81L 4A3MG 1WD1A 4K5XA 1XLQA 3O13A 2HHHL 1WGKA 3VVWB 4WIPA 3AYHB 4BY1H 4LJPB 4JE3B 3NTKA 4A3MH 2RGFA 4M8AA 2F4VQ 1IYUA 2UXBQ 5DLQE 2ZW0A 4KY7A 4E6IA 3WANA 1HUMA 2F0FA 4HMIA 2EY6A 2OEOA 3J80c 1EYGA 2L05A 4A3EB 1IGDA 2GN5A 2LGIA 3R2IA 2MHJA 2VZKB 2DY7A 5EJWA 2EKEC 3P1HA 2EMSA 2KNBA 3A9KB 3M3YH 2MH7A 3GTKB 5AEKB 2QEJC 2KCCA 1K8GA 1N6ZA 3HRDD 3UIOB 1TKYA 4KX6B 4B08A 2HDLA 3JAML 4ZRIA 4A3LH 3PLUA 3L9AX 2NS5A 3DDCB 1ASZA 2E74C 1TKGA 3NHHA 2EY1A 2JRIB 2WXQA 1RRBA 4II2B 1YJIA 4YY3Q 1FMAD 5DAUA 1NDDA 2JYTA 3Q3FA 3E5SA 3AB5A 4A3PA 2ES2A 1RD9D 2Z4HA 1F9SA 1I3QB 3VTUA 5ELFA 4B3RQ 1G91A 1H9RA 4JI2L 1NTGA 2KYWA 4KN7C 2PMVA 3OLMD 1A70A 1HZAA 3NK9A 3K7UC 5JVG3 2EPBA 4E74A 2NN6I 1HTQA 2MBQA 3I8ZA 2N1WA 1R9TB 3NEMA 3IAM1 1JICA 1JWMD 4DU9A 4HKQA 4H0LC 2YYZA 4R4CA 1SF0A 1SNPA 2AHOB 3TN2A 3L16A 1B9RA 2QILA 2L0FA 4NJ7A 3RZWC 1FGUA 2D0PA 2OEDA 1ACCA 3OOCA 4ZKCB 1C7YA 1JMCA 1EUVB 2KOLA 1R4NB 1SGHA 5D65A 2WB1G 3NUHB 4JQWC 3AFQA 4BBSG 4KDLB 1PZJD 2PW7A 4U673 4IUQA 1V5OA 3GTKH 3I4MG 2E6XA 2KMCA 5BR8Q 1J7CA 4KKTA 3VXWA 3DBLI 2PZTA 1Y8PB 2K6AA 3GOEA 4JCVE 1QG7A 3A55A 2PJHA 5J3BA 2A74C 4N9F4 3PGZA 1KRSA 2ZXOA 2ASBA 2A68D 1LTID 3DUZA 2LVQA 1BUVT 4ANVA 2ZTCA 1FVIA 3PS6A 4B0MA 3K5MA 1C8CA 5C23A 1I94Q 5IN7A 2L8JA 4LMQD 2N9LA 1K83B 4A4IA 1ZE3D 2GBKA 3P1MA 4Y7NB 2O5JC 2B2TA 3CCMA 3QAQA 1XNRQ 2KC1A 5FLXE 3VR3A 1QCBD 2F0KA 3B2GA 4B95A 4A3FG 2G9HD 1YEZA 1UUPA 4KKSA 3JAMc 3CAMA 4DV0L 1AARA 2LFNA 4KSKC 2MJ8A 2OQ0A 1LABA 2BKFA 4N9TA 2A5HA 4ZUIA 1SMXA 1YNNC 1DM0B 2V3SA 1QILA 4DUYL 4DPGA 3S15H 4C3HH 5T8IA 5DPWA 2O4XA 1STYA 3DMUA 3P4QB 2DJGC 3STBC 4LUZA 2KCTA 4BKGA 4RWSC 2LVPA 3DXJC 1K9MC 2MA9B 4ZRJA 1XCQL 4XZ4A 4YTPB 1WTVA 1G2SA 4N6EB 1AWDA 3WAOA 3FEWX 2MBOA 4DR3Q 1C4AA 1J7BA 2E5LL 4GSWA 4HPLB 5BYSA 4ID6A 2INNE 1SYEA 5C5LA 3A9JB 2F0MA 3ALBA 3FRPB 1F9RA 4UHVA 5EKIA 2BH2A 1KRTA 3ERQA 4DK1A 1OTRB 3B1LX 3RZOH 1YHAA 2LGYA 1VQEA 3H94A 4UP8A 1FL0A 4IM0A 4MH0E 4KMUC 1KL9A 1MGSA 2IX3A 4FYDA 2K04A 5KNCA 1XPUA 4IFDJ 3K9PB 4ALPA 3BDOA 4MNOA 2IL8A 1HUNA 3X0WA 4C4VA 4MZ9A 4A55A 1PH2A 5C4XH 3GTLB 1PFNA 1S3OA 2IWHA 2IO0B 4MHEA 2KJ6A 3DBHI 1V1QA 2HJ1A 4F8CB 2F4VL 1K52A 2E5LQ 2FMMA 4XQQA 3PF5A 1WZ3A 2V4IB 2XNAC 2WXLA 1GC7A 1EQRA 4APVA 1PTOD 1Q7YC 1YN4A 1KRHA 2JWZA 2L0TA 4YTNB 1MIUA 4EEWA 1JORA 4RHRA 3N30A 4LK0M 2CS4A 3ZGZA 2A4ZA 1R7SA 2IO2B 4IM3A 5KHOA 3WOEA 3M3JA 1OXVA 1XEEA 4MTNA 1N34L 4A3GB 2JA7H 4ABNA 3MFYA 2KJRA 3F2BA 4G7HC 2JEAI 4YSZB 3S1MH 4WJ3M 4A3CH 1XQQA 3CMEA 3OG5A 1OO9B 1J6QA 4XTCS 2L76A 3HOUB 3IAS1 4KV2A 4FJVB 2KN4A 2RPVA 2VRRB 2ZXRA 4LF9Q 5M3FH 2EXZA 1MJDA 3QR8A 1D7QA 2GLSA 4XXEA 2B2YA 1WM2A 1QOBA 1L6VA 4A3KG 1T0RC 1PRTF 1KNEA 4ZRKA 4B3SL 1NI3A 3APDA 3RPFC 2BS4B 2AWTA 4A3GG 2N0SB 1ICFB 2BOSA 2MO1A 2R93B 2E2IB 2CHZA 2V3NA 1KQSA 3KLWA 4EE2A 1Y1VB 5M5WH 4DV6L 1YITA 1E7VA 3L08A 3P2BA 4WAFA 1H4RA 2ID0A 4K3BA 2A6EC 5CC4A 4U68A 3QJYA 1Z47A 2KX3A 3OSOA 1M8AA 2JA9A 2K5WA 4IPDA 3T1YQ 2M00A 3TEXA 2OTLA 5GAHC 4MTKA 2NYZD 4C3IH 2UUAQ 4DR6Q 5BYQA 5JHBA 2BE5C 2H4OA 2PO4A 5HGQA 1DZ1A 4KHZA 4LLGM 1C0AA
chains in the Genus database with same CATH topology
2AUJD 3SK4A 4HEA1 3HOVB 1QWYA 2W3RA 4XE0A 2MHVA 1YNTE 4X3TA 1RF2D 1B44D 3RMHA 2NN6G 3SK5A 4IUNA 5I2XA 4ZUJA 1V97A 2DWQA 5EQ0A 2B2UA 3SFDB 1M4VA 4ZAIA 4IDIA 2XVSA 5FKAC 1Z7TA 4J3OD 1GHJA 4DN4M 1IKMA 5H8YE 1LV9A 1BCPF 2WDQB 2JA6B 3AE5B 3AU7A 1L4ZB 1NUCA 1EZ6A 3C3LA 2WAQB 3BVMA 3MXPA 1STBA 5IGEA 4XDXA 4XT3B 1K51A 3L3OC 2F4IA 2TMPA 3R2TA 1AYFA 1FYCA 4ME5A 3K57A 3K58A 1O7YA 2NVQB 3QO2A 1IHZA 1ILPA 4CJ0B 4RF1A 4IFDG 3NTHA 4RH6A 5HG2A 2FBWB 3I70A 1LTRD 1BNZA 3QWNA 3IFDA 2HCIA 5EE9A 4HCEA 1ZXTA 1GUOA 3PO3B 3URYA 2O2LD 1FCCC 4GZYC 3EUB2 3D3RA 4CBVA 3CKIB 2WLBA 1TQOA 3VRAB 3NQIA 3QOJA 4KKJA 4FXCA 3S16B 1SSNA 1FXAA 3KF8A 3VRBB 3PUYA 3KWVA 1S5BD 2WDVB 1TY0A 2L55A 3N52A 5JJZA 2BW2A 3SXHA 3FILA 3DWQA 3TZUA 2KEDA 3KQ4A 3FAHA 1YQ4B 1XLPA 2DNCA 2KCNA 3E0JA 5M3MB 4NKLA 2ON8A 4USAA 4TQUS 5COYA 1SYFA 3W2DA 3DWPA 1C79A 2K9XA 2FE8A 1F0ZA 2AQ1B 1DOXA 1XX8A 5T1IA 2BDOA 4C1NK 5JVH3 4HKZE 4K14A 4YSYB 2NB0A 2H89B 3AMUA 4HRSA 1NENB 3S1MB 1NR2A 1A3UA 5ELCA 1Y8NB 2BB6A 2OXPA 2F1MA 2JA7B 1IBXB 5IT9E 1SFOB 3GTJB 4KY6A 2EYPA 1QOHA 2J4XA 3PUWA 1HQMC 1KLGD 4YTMB 4OGQC 1K8MA 3HG9A 1JW9D 4XQNA 3M85A 1O78A 1L0VB 3AM9A 4J8QA 3V05A 3DEPA 2AWNA 1TWHB 5JEAG 3TP7A 3GTQB 1A15A 1ENFA 2LY7A 4KGRA 1BOSA 3NRZA 1MVKA 2KACA 1CZGA 3IKJA 3R8BA 5ELEA 3NWSA 3U52E 3P4SB 1Y1WB 1KDAA 2RSNA 1A3VA 3W3AA 1I4GA 5BMIA 3L7ZC 1DOLA 1EL0A 2CW0D 1JWBD 2NN6H 1SE2A 3J9CA 4K6LA 2NTTA 2EYFA 4HSVA 5D14A 4JPSA 2GB1A 4TKOB 1P7EA 1EIGA 3WOFA 2B8GA 2Z1CA 1MHHE 1DJRD 2OT2A 5AUKA 4O42A 2JX5A 3P4PB 1DOYA 5KYIA 1F2RI 5JAVA 4EGVA 1N5XA 4A3BB 3C8YA 5K36G 1DGJA 5AFWA 4WJWA 1V1PA 3D6CA 1OQQA 5KYLA 3TMEA 3VYUA 1MI0A 4ZRPA 1AEXA 3J80L 4KTAA 4L6TB 2KJXA 3UI3A 4DNTB 3NTIA 1ZXIA 4HCSA 4DF7A 3MJ5A 1WYGA 3CQZB 1LACA 4FVMA 1TU2B 3S9WA 3VR6A 5M5XB 3PO0A 1E0BA 1OFFA 2F3VA 3OMCA 2A69C 1WTWA 1X3QA 3S1RB 2LKVA 2OF1A 2A6HD 2BBCA 1MSGA 1C4CA 3UI2A 4CKCA 1SAPA 3AEEB 3SEBA 3A56A 1MD2D 2WINB 1F2YA 3AEBB 3TEZA 1SNDA 5C4HA 2EY2A 1H9SA 1QOAA 5C0XJ 4OVZA 1BCPC 4F8MA 3Q8BA 1V1OA 1H9MA 4QUCA 3NZ3A 2R6GA 4HTHA 3I9V1 1SMYC 4L2YA 4AS1A 2EYLA 2BYTA 3DM1A 2GA4B 2VXWA 5J22A 3T53B 3E56A 3KLSA 5C44B 4WQMA 2WKDA 2F0VA 1XLOA 2A6HC 3HS0C 1PLFA 4BA1I 3AE8B 3CWIA 2WP8J 4A3FB 4RGTA 3I4MB 3H09A 2D2CC 1U9RA 4F88A 2EVBA 3GS2A 3Q8CA 3TEYA 4YSXB 4MACA 1L6UA 3Q0AA 5C3JB 2I38A 2EJFC 5H92C 4K6DA 4S3SA 2EY5A 2FHTA 3NP8A 4CHTB 3S2DB 3DWGC 3OIPA 4FF3A 1DYQA 3NBHA 4JWUC 2WACA 2PPBC 2B76B 4DXGA 4V190 1JE4A 4EVOA 5KNDA 1HZ5A 2R92B 3D4RA 2INPE 5C3EB 2YEPF 1T3QA 5K5PA 1FXIA 1JCKB 3PUXA 3W5VB 3HVZA 5FLXL 2BTEA 4RAUC 1O7LA 2OHFA 5HGTA 1CTMA 3OHXC 2QCPX 5KNBA 4GDLB 2LHDA 1HQRD 2I46A 1VZ8A 1C9FA 3I4NB 1ONLA 2WXGA 2JYOA 3I90A 5NUCA 5I2YA 1GAQB 5IODA 4BA2I 2PVOD 1CZPA 1E2VA 3GO5A 2PNRC 3ZYYX 1MI2A 1EIHA 1PGAA 2G1EA 5CBAE 4OZBA 1RKNA 1IL8A 3I57A 4DXFA 3TP6A 3NVWA 1TYGB 1QKZA 4G7OC 1GB4A 3T16A 1ILQA 4MM3B 4BBSB 4C3HG 4YWGG 3SR6A 4DK0A 1TWCB 4QUFA 1ZEQX 2KWDA 3BVGA 4FXGC 4RGNA 1XF5L 2WKCA 1IYVA 5ELDA 3PUZA 1EYCA 2N55A 4PMCA 2B8FA 1I7HA 1QNUA 2LMCA 4XIGS 1EY9A 3TP5A 2FUG1 4RGOS 1H9KA 1HFNA 3GV3A 1WRIA 3BZDB 5C4JB 1L4DB 1GUGA 1U4LA 2K5QA 5KGUA 3HOYB 2RMMA 4A3IB 1D6EC 2JP1A 4PNYA 1FCLA 3ND9A 2LUMA 2VB3X 3I72A 5I9PA 4TMAB 3GTGB 1I4XA 1EU3A 3MZ5A 3PV0A 4P16A 5F2DA 2QSDA 1FO4A 3A8IE 4UDUC 1ML0D 3KWLA 3VYTA 4BWGB 2WU2B 2F0QA 3U2SC 3MP9A 5CV7A 3VR2A 3BDLA 2F0IA 4XQJA 1CA5A 3RUZA 2B2TC 2WB1B 2J42A 2EOTA 1HRJA 4LK1C 2HCCA 5C0XG 1WSPA 3U4EG 2EYMA 2QDBA 4WURA 1GJXA 1JQ4A 1OXUA 3HRZC 3SDZA 2GI9A 2E3TA 2E75C 3DEOA 3IL8A 2JEBI 1CFMA 4I7ZC 2EJGC 4ZLTF 2IX1A 1AN8A 2KQ3A 4KK7A 1JWUD 1LO5D 4HR7B 4CJ1B 4OL7A 1J9OA 1VCIA 3OPOA 3H8HA 1EQTA 4GLSC 2J53A 2A73B 1DOIA 2M0AA 2K01A 2IT1A 2F0EA 1V43A 3TDQA 1Q12A 1WTQA 2M56B 3J80E 1SDFA 3FILB 1PRTB 2KECA 1R4QB 1IGCA 4JK1C 3W9CB 3QB3A 5CV6A 1MPEA 1B2TA 2K5PA 2KVMA 1L5PA 1JOKA 1S5FD 3A7LA 5E6JA 4Q0FA 2EELA 2N88A 2Q8TA 1CM9A 2KA7A 4YIJA 3L4PA 2EYJA 1Q90A 3S17B 3LNNA 3VQIA 1B3AA 1F2LA 4G57A 1QF6A 2NZ1D 5HHDG 2BS2B 2LS01 4R9WA 3BG3A 2F0LA 2DYMA 4KGSA 4PQXA 3NBIA 1EFID 2XWJB 2W54A 3QOLA 3W5UB 3S14B 3ND8A 1GPXA 2AQ3B 2NVTB 2CJOA 2W55A 2G9DA 3LYYA 1Q1BA 4FO2A 1BCPB 4TSSA 4KV6A 3AB9A 3A7AB 1WTOA 1LTGD 1L0YB 1NAPA 1VF7A 1QE6A 3D31A 5LL6S 2L5TA 4IQZA 2YU9B 1I4PA 4FF1A 5FO8B 1JWAD 1MHXA 4WWMA 1EY4A 3IXSA 3R93A 1SNMA 5M5YB 3MAQA 5IOCA 1ROEA 5DEHA 2DBYA 3RLFA 2HTME 1RFKA 4IKGA 2WS3B 1ZDVA 1VZ7A 5DM63 1B50A 3FC4A 2V0GA 1O7ZA 1DD2A 2SNMA 2NVYB 2I07B 1I4HA 2AUKA 3K5LA 1W6KA 1HA5A 4KKUA 3R3OA 3RFZB 4RKBA 1SEBD 3ABVB 3RZOB 4ZHPA 2F3WA 2D62A 4QIWB 1IKLA 3LWEA 3NXWA 1FFUA 3AEAB 3EA6A 2Q8IB 1PGBA 1VF5C 1LTAD 2DYOA 1VMCA 3Q8EA 4HMJA 5IGBA 4X3UA 3AE6B 3CRKC 2WU5B 3S1NB 5JEAJ 1TJEA 4RNAA 3VYSA 2C5CA 4TRDA 2M2LA 2EJMA 3WCQA 4IOIE 4OW0A 3IT6B 2R61A 1QQRA 5BYRA 2BDNA 3K6OA 2FJ2A 4P2CB 1TT2A 2QF7A 3J7AV 5BMHA 4A8XC 3AH7A 1H9JA 1E9MA 2X6GA 2R7ZB 3OWFA 2F0JA 4IN3A 4WH4A 2H88B 1KDCA 5ELBA 4ZYSA 5KRUA 2TSSA 3TP8A 2PMZB 3MFGA 1JMLA 2M9VA 3LX0A 4XYQA 1RWSA 3PMFA 3SE0A 4KHVA 1RODA 4ZQ3A 1XO3A 1RJTA 1SBBB 1C4PA 5CR3A 2F03A 4C3IB 4MT5A 4D2KA 4IURA 3MWYW 3EFXD 1AZPA 3GP7A 1N63A 1VDZA 1SIJA 1DXMA 1VDVA 3M3YB 2JXMB 4CQNA 5JPMC 3K5NA 1PYWD 2JA5B 1F2RC 4BY7B 1SNQA 2BE5D 4REZA 3FMCA 5IT9L 1WXQA 1UEAB 4DA2A 4V0BA 3GV6A 1TS5A 5K36H 3GTMB 1GHKA 4X3SA 1PXUA 2Z8LA 5E1FA 3A8JE 2F0WA 3CIRB 1MBYA 1STAA 5JOBA 4XWWA 5EPLA 2ICEC 1VZ6A 2D5GA 5IGCA 2KDMA 3P4RB 3EROA 4OZAA 1QJOA 1F9PA 1HCZA 2V4DA 3BWUD 1FM0D 4NMZA 1PFBA 5E4XA 2PCFB 4WFN3 3AEGB 1JROA 1Q8IA 1YN3A 3Q23A 5EKLA 3AN1A 4C3IG 1EYDA 2Y0SB 2AQ2B 2WXIA 3ETRA 1F9QA 1VRAB 5C3WA 3NSWA 4AYBB 2GRIA 2IDYA 4NAMA 1A6XA 4H7BA 2KEEA 3NPPA 1JOQA 4C3JB 2PW9A 1STNA 1E6EB 2QIEB 4HN7A 1KNAA 3HEJA 4OO1H 2WDRB 1E2WA 2BS3B 4CJ2C 2D9UA 4K8JA 1T5EA 1I6HB 3EQLC 2MP1A 2XWBB 4C56C 2KQ4X 3MTSA 1B1ZA 1C4QA 4LTUA 5GXGB 1EY7A 4IUTA 4NP5A 1KLUD 1ZXHA 2NTSA 1LTBD 4GDKB 4ITKA 3AEFB 2NMQA 3QG1A 1QT9A 1PMRA 3N9YC 1G291 1EQVA 5DM73 5HI1A 3ITPA 2IGGA 1BO0A 5A2QL 1D4BA 1EZ8A 4YT0B 3A54A 1E7PB 1D5MC 3G6JB 1Q10A 2K22A 2M19A 5EBDA 2RQXA 4QB4A 1AZQA 4XWTA 1SB3C 4L23A 4RCNA 4CKBA 2NUCA 5CV5A 4CKEA 1X3PA 1FNVA 4IZ8A 3MXNA 2RA4A 1B4OA 3NVVA 1RHPA 1IW7D 5JPNC 5BN4A 4G4KA 1N62A 1FR3A 1JQYD 4F7XA 2PW5A 3M4OB 2JQRB 3T3OA 4DNRB 5C0XH 4TQ1A 3NUCA 3FVQA 1JC7A 1I4QA 1T6BX 5FR3A 4MN3A 3EGRA 3HOXB 3I91A 1EOTA 1RTOA 1NVID 3HOZB 5CV9A 1SJHD 4LJZC 4K8IA 2AWOA 1TY2A 4A3DB 2LFIA 2K0PA 1S4ZA 2L1BA 2F0PA 4DGZA 1G2TA 2NBFA 2JA8B 4BY1B 1IW7C 1U4PA 3MHZA 3FPUB 1EY8A 2F0UA 1ZYRC 2WXOA 5EPJA 4KI0A 5BN3A 3IAYA 4DQOC 1V8CA 2AX5A 1UGJA 2FINB 1BMLC 3DWAA 3HGBA 3MXUA 3BK1A 5DNFA 4F87A 3M4YA 1NEKB 4B9WA 1FIQA 2K28A 1D1IA 2WXKA 3LXFA 1WTXA 3VR5A 5G3LD 2LEKA 5EE0A 1C48A 1T5XD 1S5CD 2SDFA 4YXDB 4A3KB 4ZKBB 1CHPD 3PIO3 4ZRQA 3ZJTA 2HQEA 2MJEA 2L52A 5CV8A 2SEBD 1SYGA 3B9JA 1PGXA 4IFDH 3D6WA 3J81E 2E2DC 3X3MA 2B39A 2B2WC 3S2HB 4WORA 1XYIA 2JYEA 2PVGC 3NE5B 4IFDI 2KHSA 1J8IA 4PV1C 1SNOA 2A6ED 5BN5A 5A2QE 1KABA 5M5WB 1WTPA 4ARIA 2BA0A 1A3TA 5CYUA 2SOBA 3D4WA 5IGGA 5MPOA 4RHSA 2EZVA 2PKOA 1E10A 1D5XC 1NR4A 4MIUA 2JSOA 3GTOB 2C9OA 1KTKA 1LT6D 1X32A 1SNCA 2XN9C 2WXPA 3FPPA 1HPCA 1HFGA 4A6QA 1JALA 1Y56A 3D4DA 4KY5A 3BYYB 3CU7A 3KBGA 1DOMA 4RGMA 3G7LA 1TWFB 2L9HA 3WDNA 4RF0A 3U7ZA 1SYCA 2A68C 2DNEA 1GOZA 1D5ZC 3RZDB 2WXMA 3AEDB 5IGFA 1JB3A 1QB5D 2ONQA 3BK2A 5G5GA 1KH0A 4R3DA 3H91A 1CZWA 5G3LF 1AW7A 3B2FA 3MA2B 1I6VC 3MC0B 2A69D 4OIJA 3SK6A 1DCZA 1XWEA 3M7NA 2Q8RE 3VR8B 4C7YA 3MHBA 3TBIB 5D7GA 1SYDA 4EQOA 4RKLA 1Y69U 1TKEA 1F2MA 2CHBD 2JE6I 4HEDA 3AV8A 3D8GA 2HDEA 2PZUA 2V3PA 2R3ZA 4JBWA 4JX1C 3BDCA 1Y8OB 4RA8A 1F2ZA 5G5HA 1K50A 1PRTC 1ZOYB 2NVXB 2K03A 1YNJC 4R8IA 1C78A 2HUGA 5AUIA 1ENAA 2B2VA 3PO2B 1TVXA 4FF4A 1G8ZD 1XXGA 3PZ7A 3NVZA 1EWCA 2J7ZA 4C3HB 3BIID 4G7ZC 1PTOC 1K53A 1Q1EA 4Q5VA 1KF6B 3NVYA 1TS4A 1NSNS 1FRDA 2WQYB 5KIXA 1VLBA 1HTPA 4KKIA 2ZT9C 3OW7A 3K0YA 4ZHOA 1UAPA 3T3NA 1CQFA 1GXDC 5I6YA 3HVDA 3V96A 2Z4IA 2O5IC 5EE3A 5EKKA 1SJED 2CU3A 1YNJD 2IGDA 4PMWA 3GD7A 4IUPA 2XIWA 3TSSA 4OO1I 3TEWA 4OIKA 1N60A 2LHEA 5LNK1 2ICIA 4QMGA 1VJKA 5C3XA 4FF2A 4Q2JA 4NAWB 5EE1A 1BBXC 2MJ3A 1RYJA 4BS9A 5M9OA 1BCPD 1KAAA 2F0TA 1I4RA 1ZKOA 2WV6D 3Q69A 2ACZB 1SE4A 1TWAB 2E76C 1FD6A 3LWUA 3ZJVA 3TZDA 3P42A 3HKZB 3VA7A 3T56B 1C76A 5C5MA 2J52A 4C1NI 1STGA 5C4XB 2Y5CA 3SFEB 1FEHA 4R8NA 2IX0A 1RTNA 3Q22A 1B9MA 4H2AA 5C6AA 2MJDA 4C80A 1HZ6A 2JU6X 2K05A 5HURA 2K1BA 4DAPA 1CA6A 2F0HA 4KD4A 2D5DA 2MEKA 4L8JA 3T51B 1OXTA 3PZ8A 1MSHA 1W6JA 4KD3A 2ENBA 1TWGB 5D3IB 2K33A 3E9SA 1GUTA 1JR0D 1ZYRD 2JSVX 3U9OA 5D3DA 2H1EA 2F0DA 3GTPB 3EJIA 3I73A 3OMGA 4OHJA 4WRDA 5CBEE 2N7JA 3ONAB 4RCOA 2L4NA 2WNMA 2YEPB 2B2VC 5JXVA 4NDXA 3E6ZX 1YJJA 2EYHA 2Y5PA 1JWSD 1YN5A 4Z9CB 4XT1B 3J7AF 2K32A 1VMPA 2BB5A 4P6VF 4XDDA 1RCVD 3HUIA 1A2TA 3EVQA 1HA6A 1EY5A 2CW0C 3KLRA 4UAIA 5E4WC 2B2YC 2EDGA 1WTRA 2K5DA 1NYQA 1CQVA 4NJCA 2X38A 4KN4C 1YQ3B 3BVZA 4N58A 2KAJA 1D1KA 4ZK9B 5I4DA 5A35A 2BCOA 3QIAA 3PIP3 2JZPA 1J7AA 3H0GB 1OXSC 4M0WA 1N5WA 4IUUA 2BT6A 1PTOF 4N59A 4I65A 2L11A 4K2KA 1PRTD 4NZLB 1BR9A 2W82A 3NS1A 1O80A 2IPKD 1SSOA 2PTLA 3H6MA 2XRSD 5EBCA 5JEAH 1ZPSA 1SE3A 2RVLA 3CHBD 1IUEA 3KK7A 3K5OA 1U4RA 2B2UC 1HEZE 4LAAA 1V1PB 2L83A 1PTOH 3DHQA 3P75A 4HJGE 1FRRA 2FFKB 2Y3AA 2K7VA 3TUOA 3VYRA 1SMYD 2L1AA 1OXXK 1EU4A 3GQBA 4XDCA 3ZJUA 3VA5A 3KLSX 2CJNA 1A2UA 4L63B 2DN8A 2L0CA 1FD7D 3A8KE 1JRPA 1LTSD 3X3NA 4AQ7A 3JAME 4B0EA 1PUTA 4J6HA 1EM7A 4NW2A 1RDPD 3C46A 1DONA 4FXDA 2QKIC 1PTOB 1LLRD 3NQTA 5J39A 2B63B 4MH8A 1G6ZA 1LT4D 4XYOA 5CGKA 2IJ0A 2VUMB 3Q8FA 2VZKD 1BDOA 3P63A 4FP5D 1BF4A 2SNSA 3IT4B 1EWYC 1FNUA 1C77A 1WD0A 5I6WA 2CVRA 4C2MB 2F0OA 4CGYB 5HFYA 1SYBA 2CQAA 3AECB 3MXGA 1BQQT 3FKIB 1BXTA 2RKSA 3MVVA 2LMCB 3VR4A 1GUNA 1ZUD2 1D2BA 2WXFA 5ISRA 1R4PB 2WP9B 5CMDA 4K2LA 1V8QA 2E2JB 2L32A 3V2TA 1BUIC 1PDXA 1TR5A 1EEID 2KUMA 1DOKA 2IGHA 3SVMA 5E3FA 1RM6C 1NCVA 2MGSA 4A9AA 1CI3M 5EPKA 1HTLD 3NWTA 3SR1A 1TZOA 1AFPA 1Z6HA 1HHVA 1N61A 4ARCA 3HOWB 3FDTA 1CHQD 1PDQA 5LL6X 1EEFD 3P7JA 3KUPA 4IALA 4X3KA 1UWMA 4BBRB 1E2ZA 3AE4B 5M3FB 4IUVA 3I4LA 1GB1A 2PYKA 3OWEB 2WXJA 3MEHA 3AMZA 1STHA 2ZW1A 1CK1A 2HDMA 1EY0A 1S5ED 1GUWA 4K5WA 1QOFA 5FK9C 4QCLA 3C1FA 4B9XA 5J1ZA 3BS1A 3AE2B 2KMMA 5CV4A 2JXTA 5T1GA 3T4AC 3S1QB 1E0ZA 2Q5WD 4US9A 5C2TB 3KBXA 1ZP0B 4KJOA 5C4ZA 1B53A 3T13A 1ENCA 2RDHA 4ZOHC 4DAYA 3C1EA 1HXYD 4A90A 2XRQD 2QMTA 3W1SA 1TS2A 2MPMA 3M7GA 2FMCA 3GB1A 1TS3A 4FNFA 3AE3B 5TSSA 4QF4A 2LJIA 4ILWA 5EGTA 4JWSC 2XSCA 5LHY1 1ET6A 2PQEA 4PMBA 4DFAA 2F0NA 4US8A 1K8OA 1I50B 3SHLA 1UWXA 4A93B 3J7YW 1XCTL 2WXHA 2VB2X 3AE9B 3S15B 4FXKC 5FO9B 4M1UB 2RBMA 4DAVA 5CORA 3PUVA 2PLPA 2B2WA 1LTTD 1Q3LA 3U9SA 4RFBA 2L12A 2WXNA 2E2HB 2F0SA 1PZKD 3DWMA 2WIIB 4C7ZA 2DY8A 5IIFA 1WCMB 1JOOA 4EQNA 3Q6SA 3ZQ4A 4OZCA 3K7AB 1UNSA 2X69A 1F77A 1LT3D 5KEEA 1WVLA 1XLNA 3C2PA 3K59A 1KDBA 1ICWA 1EY6A 1VR9A 1LT5D 5FO7B 4C3JG 4A3JB 1GUSA 4ZRZA 4ULLA 2EYOA 3V3XA 1PZID 4HROA 5C0XI 4J1MA 3HP3A 1STEA 2NWGA 2BA1A 2WXRA 5BMGA 1FNWA 3P20A 4N9PA 3F2UA 1TKWB 4KJNA 3I3CA 2JWUA 2N9KA 4OO1G 4PT5A 1EYAA 4H44C 2SAKA 2PZWA 3N6RA 1FFVA 3RD4A 3H3VC 4H13C 1PFMA 3SK8A 1H9SB 3OIQA 4L1BA 1S5DD 1U4MA 1P7FA 2VNUD 1QLBB 2RDGA 1CT1D 1AP0A 4HAEA 2EKIA 2MUYA 4HSPA 1CJEA 4K5VA 2DLBA 1ESRA 1B9NA 2PIAA 2IW3A 4ODGA 1II3A 3AE1B 1ET9A 3VR9B 1OQRA 4KGTA 4O1NA 3LB8C 4A3MB 1ESFA 3Q24A 3AE7B 1SXTA 5I9OA 1L0XB 3BYTB 4EQPA 2F0GA 1PFDA 1WWTA 1IBXA 2RDFA 4TQ0A 1YNND 1KFYB 3CRLC 3Q8AA 1ZDXA 1QNKA 5FOBB 1XTCD 2EE1A 1TIID 1QOGA 2ZXPA 1FGBD 2X6LA 2RSOA 2W3SA 1NYRA 2K3UA 1YMHE 1EWHA 2I2YA 2QJLA 3IFTA 2J0TD 3HZXA 5IGDA 3J81L 1WD1A 1XLQA 4K5XA 3O13A 1WGKA 4WIPA 4JE3B 3NTKA 4M8AA 1IYUA 2ZW0A 4KY7A 4E6IA 1HUMA 2F0FA 4HMIA 2EY6A 2OEOA 4A3EB 1IGDA 2LGIA 3R2IA 2VZKB 2DY7A 5EJWA 3P1HA 2MH7A 3GTKB 2QEJC 2KCCA 3HRDD 1TKYA 4KX6B 4B08A 2HDLA 3JAML 3L9AX 2E74C 1TKGA 3NHHA 2EY1A 2WXQA 1YJIA 1FMAD 5DAUA 2JYTA 3E5SA 3AB5A 1RD9D 2Z4HA 1F9SA 1I3QB 5ELFA 1G91A 1H9RA 4KN7C 2PMVA 1A70A 3NK9A 5JVG3 2EPBA 2NN6I 3I8ZA 1R9TB 3IAM1 1JICA 1JWMD 4DU9A 4HKQA 4H0LC 2YYZA 1SF0A 1SNPA 1B9RA 3TN2A 2QILA 2OEDA 1ACCA 3OOCA 4ZKCB 2KOLA 5D65A 3NUHB 1PZJD 2PW7A 4U673 4IUQA 2E6XA 1J7CA 4KKTA 2PZTA 1Y8PB 2K6AA 1QG7A 3A55A 2A74C 2ZXOA 2A68D 1LTID 3DUZA 1BUVT 4B0MA 3K5MA 1C8CA 4LMQD 2N9LA 1K83B 1ZE3D 3P1MA 4Y7NB 2O5JC 2B2TA 5FLXE 3VR3A 1QCBD 2F0KA 3B2GA 2G9HD 1UUPA 4KKSA 2LFNA 2MJ8A 1LABA 4N9TA 2A5HA 4ZUIA 1YNNC 1DM0B 1QILA 5T8IA 2O4XA 1STYA 3DMUA 3P4QB 4RWSC 3DXJC 1XCQL 4YTPB 1WTVA 1G2SA 4N6EB 1AWDA 3FEWX 1C4AA 1J7BA 5BYSA 4ID6A 2INNE 1SYEA 5C5LA 2F0MA 3FRPB 1F9RA 5EKIA 3ERQA 4DK1A 3H94A 4KMUC 1MGSA 4FYDA 2IX3A 2K04A 5KNCA 4IFDJ 3BDOA 2IL8A 1HUNA 4A55A 3GTLB 1PFNA