5D3DA

Crystal structure of staphylococcal superantigen-like protein 3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
190
structure length
190
Chain Sequence
KYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQLKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition of TLR2 by staphylococcal superantigen-like protein 3 (SSL3).
pubmed doi rcsb
source organism Staphylococcus aureus (strain nctc 8325)
molecule tags Immune system
molecule keywords Staphylococcal Superantigen-Like protein 3
total genus 53
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5d3dA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5d3dA01
1SBBB 1V1PB 1LLRD 4DXGA 4O1NA 1FD7D 1JWUD 2ICIA 1FNVA 1JWSD 1AN8A 1RD9D 2RDHA 2WV6D 2XNAC 2XRQD 4Z9CB 3BVGA 1EEID 1EEFD 2Z8LA 1EU3A 1SE4A 1XXGA 3R8BA 3DWAA 1HTLD 1PRTD 1TY0A 1CT1D 1PRTB 1BCPD 4ZYSA 1I4GA 4TSSA 1DJRD 3BVZA 1D5XC 1LT4D 1PZKD 2AQ1B 2J4XA 1TS4A 1V1OA 1L0XB 3O13A 1LTRD 3V05A 1TS3A 1HQRD 1RF2D 3BYTB 1S5CD 1D5ZC 1RDPD 1I4PA 1JR0D 1LTGD 1T5XD 4RHSA 3DWPA 1F77A 1PZJD 1LO5D 1KLGD 1BXTA 1SJED 3GP7A 1KTKA 1XTCD 1LT5D 1FGBD 4RHRA 1I4HA 1STEA 3R2IA 1UNSA 1KLUD 1SE3A 1B1ZA 5D3DA 2IPKD 3EA6A 1I4XA 1FNUA 1LT3D 2NTSA 3MC0B 1CQVA 1LTBD 4RGOS 2AQ3B 1SJHD 2QEJC 2QILA 1CK1A 1MD2D 2SEBD 2XN9C 3BYYB 2R61A 3SEBA 1G8ZD 4L6TB 4RGTA 4RGNA 3URYA 1I4QA 1I4RA 1PYWD 4DXFA 1PTOH 1PRTC 4RGMA 5ELBA 1TS5A 1CHPD 5ELFA 3EFXD 1DYQA 1SEBD 1V1PA 2XRSD 1RCVD 1S5BD 4RFBA 1QILA 1TY2A 1SE2A 1S5ED 4C56C 1LTTD 5I4DA 1LTAD 5ELDA 1YN5A 1JCKB 2TSSA 3CHBD 1HA5A 1D5MC 1JWMD 4K6LA 1ET6A 1HXYD 1L0YB 1M4VA 1UUPA 3KLSX 5ELEA 1ESFA 2IJ0A 1AW7A 1S5FD 2RDGA 5FK9C 1PTOC 1BCPC 1TS2A 1PTOD 1S5DD 1YN3A 1D6EC 2AQ2B 1FNWA 5TSSA 1JQYD 3MFGA 1LTID 1BCPF 3W2DA 3BVMA 4OHJA 1EFID 1PTOF 3DWQA 1GOZA 1CHQD 1ET9A 1LTSD 4RCOA 4NZLB 1ENFA 3OWEB 1YN4A 1B44D 1PTOB 2O2LD 3BZDB 4RH6A 1EWCA 2G9HD 5D3IB 2CHBD 1PRTF 1PZID 4L63B 1EU4A 5ELCA 4UDUC 3R2TA 1LT6D 5FKAC 1SXTA 3TSSA 4BWGB 1BCPB 2NTTA
chains in the Genus database with same CATH superfamily
4FULA 2N9LA 4DXGA 4DK1A 1Y69U 1L2FA 2NVYB 1XPRA 1FCLA 1FNVA 1JWSD 1Y1VG 2RVLA 2O5IC 4BBRH 3PRMB 3OW7A 2Z8LA 3I56A 3G71A 1G6ZA 3ZNGC 3HOVG 2PNHA 1JJ2A 3PRPB 4XDDA 3B08A 4CDFC 1QF6A 1YNJD 4HMJA 3APCA 1BCPD 2VS1A 4ZYSA 3T1YL 1UEAB 1YJ9A 3BVZA 4CKCA 3CF5A 2DENB 2B2YA 1QUQA 1TTNA 1EYAA 2LXKA 3ONAB 1SNCA 1XPOA 5EJWA 3STBD 2WACA 3CIRB 4EFOA 1QOFA 2F0VA 1KM7A 4DQOC 1AWDA 1E2VA 2B2WC 3J81i 1WXMA 2Z0DB 3VUYA 3QO2A 4DHJB 3RULA 3CCMA 4S17A 3ZDMC 2JYTA 4WJ4A 3LGJA 3HGBA 2WXFA 2IY5B 3SGIA 1FEHA 2WXHA 1W3SA 1VZ8A 2JSOA 1CTMA 1JOQA 2F0LA 3ZNHB 5IE8A 1XMOL 1FNUA 1IHZA 5CC4A 3FILA 1PGAA 2M00A 4JGHB 1MVKA 5BO4B 1EIYB 3HOVH 1XCQL 5HG2A 3ZJTA 2AEHA 5EQ0A 4DK3C 3AEDB 2F3WA 1MD2D 5LL6S 4AJWA 4J1MA 4BBRG 1HZ6A 2W3SA 1II3A 4A3IG 2JQRB 1VQIA 2K03A 3URYA 2DNCA 4NY0A 1PYWD 5IGDA 1HZCA 3KYHC 4KD3A 1C78A 2CJNA 2HUGA 1GO3E 4HDOA 2G4SA 3EFXD 1K51A 2ZJDA 4TV3A 5AEKB 3CCJA 5IODA 2CU3A 3KJPA 4ZRPA 3VTUA 3PO0A 1U4LA 3UDIA 4YHHQ 3HOXB 4WWPA 3E6ZX 1MSHA 1YBYA 2PQEA 4M1UB 2JPHA 4M0WA 2RBMA 4UPAA 3B6YA 2JA6B 1EF5A 3OOCA 4EX5A 5C23A 3RZFA 3VTWA 2H89B 4OW0A 1OXTA 1C4QA 1SYEA 2L0CA 3Q6SA 2V1CC 2KAJA 1KC8C 1AW7A 3W1BA 3I90A 3NTKA 2NVQH 1N6ZA 4GKKQ 2WX0A 4NXNQ 2F0FA 3FPUB 3KJOA 1TS2A 5AJ3Q 3G48A 3EVQA 4C3JB 1K28A 3K7AH 2ZCCA 1IYVA 3KVFB 3I4MB 1X3FA 3TMPB 1RJTA 2UUAL 4AP4C 3T51B 4B0EA 3BWUD 2KX0A 5IA7A 3S2HB 3N9YC 1O7LA 4B3SL 1QVFA 1CHQD 3T56B 2QMTA 3EECA 4II2B 3PQIA 2KUMA 4ZKCB 3H7SA 2BOSA 3P4SB 2NVTH 1YOVB 4DR2Q 5LXHA 1E2WA 2EDGA 3PSIA 2IYDB 3JAML 4OL7A 2OEOA 3X3MA 1H9RA 1R4QB 3S9WA 1ZDVA 2LXCA 4GNXC 1HJPA 2X6LA 1VMCA 2KANA 4DK5A 3ALBA 4LF9Q 3RZWC 2K32A 1DOXA 4ID6A 3F8TA 1B3AA 4DR1Q 4DR4L 5IGEA 4FNFA 2E2JB 1VQPA 4IALA 4A3MG 3KF6B 2LGIA 1AFPA 1NJIC 1BBXC 3R8BA 3M62B 1HTLD 5JPNC 3M63B 1R7SA 3RUIB 2ENBA 5J18A 4OONA 3ZIMA 1I4GA 5LL6X 3P1MA 4DXAB 4A3CG 2E2JH 4ZLTF 2D10A 2AQ1B 1HZ5A 4C2MH 5J2RA 1V1OA 3O13A 3MXNA 2KNBA 5H1SE 4W9KA 3MHSD 1BUVT 2IY1B 1FR3A 4FXCA 1JR0D 2F03A 4NAWB 1WSPA 1C4CA 4RMFA 4RWSC 4QIWB 2JU6X 4TVAB 4ZKBB 2RSNA 1TT2A 1OQRA 1WIAA 3TRZA 4LFCL 4YHHL 4LNNA 3WCQA 1E24A 4RKLA 4DU9A 4C3HH 1I4HA 3VYTA 2KC1A 3DBRI 1UNSA 1CMXB 2L12A 1EO6A 4RM9A 3I91A 1SSOA 2KO3A 4DV6L 2KLCA 4KY6A 4JQWC 2CR5A 5EKIA 1VZ7A 2NTSA 1E2ZA 4JI2Q 2KWUB 4YXDB 3BZCA 2CKHB 1V2YA 1KHIA 2KDMA 2BH8A 3HOYG 3MZ5A 3I5JC 5EKKA 1V6EA 4P7IA 1XYIA 2LVQA 1E1OA 1GC6A 3L4PA 3PUYA 1SNPA 1EOTA 3U58A 4IURA 2BYFA 5C3EG 1M1KC 3QQ8B 4ASWC 4BKSA 1BBWA 2HQLA 2I46A 2EELA 4MSMB 2VQEQ 3C46A 4DAVA 3CCSA 2Z59B 4H13C 1XEEA 1NY4A 3CD6A 3FC4A 3AE5B 1GUGA 5FOBB 3VRBB 1L1OA 5C0XH 2WXLA 5IGFA 3CCLA 1S5ED 2KHSA 3OSOA 4R4TA 1LTAD 5CV5A 3FDTA 1XF5L 5DLQE 1PYBA 2DGYA 3KF8A 1ET6A 1GVPA 1N62A 3WIMA 4JI6L 2N3SA 2JRIB 1MIUA 3PMFA 2G3QB 5DCNA 1F52A 2L8JA 4AQYL 3V6EB 5EE1A 2DNEA 4KGRA 1XMQL 3NBHB 2CFMA 3ZRCA 4LDTD 1A3UA 2E76C 3AE9B 2XEWA 4ZOHC 3VDZA 4LF6L 5HFYA 5JOBA 4QCLA 1FNWA 1QZGA 4KV6A 4MHEA 2UXBQ 1I7HA 2I38A 3U9SA 1VQEA 1GKHA 2EVBA 3BINA 4OXPA 1IPGA 5AUIA 4LF8Q 4X6AH 1O7IA 1TXYA 1A6XA 2YYZA 3J80i 5JEAG 1B44D 1C4AA 1KJTA 1WJ4A 2NN6H 1YJJA 1JB3A 3MTNB 1OEYA 3H8HA 5ELNA 3BZKA 4X66Q 4L63B 5ELCA 4GNXA 4NAWA 5IN7A 2AWTA 5KNCA 1JROA 3CKIB 2IX0A 4DUYL 1ILQA 3U9OA 3IT4B 5EE0A 3T13A 4K8JA 3J81L 5M3FG 2KOLA 4A3MB 4DNRB 2PEAA 1WH3A 3KUZA 5KRUA 1EYCA 3H09A 2GOWA 3R3MA 4ICUA 4LF5L 4HIMA 2E2HH 2GBNA 4AQ7A 5H92C 1QOBA 2Z9HA 2LFIA 1XMOQ 1UZXB 4A76A 3DWAA 2EJGC 1PRTD 1OTRB 3L10B 3R66C 2CW0D 4LNIA 2R92G 3HOYB 1D5XC 4A3GH 2V3PA 1EM7A 2I5MX 1WXVA 4N8X1 2L32A 3SHLA 2RSUA 2UXCL 3ULPA 3TS0A 1EY8A 2B63G 2JXTA 2ICEC 4IG7B 1B4OA 1Q8IA 1HQMC 4LW1A 4XE0A 2A1AA 1T5XD 5L95C 1PZJD 2KVMA 1KLGD 1W6JA 5D65A 1Q1BA 3I4NH 1PUTA 3HRDD 1ICFB 3RLFA 2KOXA 3KLWA 3ABVB 5A2QE 4QIWE 1HR0Q 4K2LA 5DM63 1ENAA 2RD0A 4JW0A 4MH8A 3M85A 5E3FA 3R2IA 3KUDB 4PS8A 2JK8A 3R7QA 2HCIA 3D8GA 4B08A 4RKBA 1QE6A 4QGUA 2B2VC 4JC0A 1WTQA 2MBHA 1XJVA 1HCZA 4HJ5A 3HOZG 2BDNA 1STYA 3NENA 1MFWA 1IBXB 2RGFA 3Q8EA 2D07B 3PO3B 4RF1A 2VY3A 5E4WC 4MGIE 3S14B 1TS5A 3NE5B 4G7HC 1K0SA 2FJ2A 2JVCA 3HVDA 2JJQA 3T8MA 1DYQA 2MJEA 5I6WA 4HK2A 2IBIB 4Q0FA 1XT9B 1S5BD 2B2UC 4RFBA 1TWAB 2NUCA 3FILB 3AE4B 2ZM6Q 2NWGA 2QW7A 3M3YH 1EWHA 1JRUA 5EPJA 2A6ED 5IP7G 2ZJRA 5T8IA 3BK1A 1DGJA 1JMLA 3P1HA 1EQVA 4DDGD 1CKNA 1WF9A 4FHJA 3VR8B 1GHJA 2K04A 2Q8RE 1YX5B 1N63A 3UI3A 1ZXHA 4A3FG 4YTMB 3TEYA 2AQ2B 1SSNA 3NXWA 1LTID 3QARA 2B8GA 4RMAA 5IAAC 1WM3A 3I70A 2KBNA 4CJ2C 2BT6A 3P75A 4YWLA 4IFDI 1C48A 1SMXA 1PA6A 1LABA 4M01A 2ZXPA 3DWQA 1GOZA 1I3QB 5EPKA 4AWJA 1LTSD 1UEBA 2R7ZH 4G7OC 3OWEB 4GSWA 1GNUA 4R4IA 2D11A 3VA5A 3Q8FA 3N1YC 3ERSX 1PH8A 1YHAA 4G57A 4FJZA 1TWFB 4UDUC 5EE3A 2NS5A 4WAFA 3R2TA 4F7XA 4NMZA 4KD4A 1LV9A 2F3VA 2BDOA 5E1FA 3HOWB 1TKWB 2IX1A 4EZLA 2EZVA 3C2PA 3GZNI 4PS3A 4TKOB 3UDFA 3HOXH 3HOUH 1VJKA 1OXUA 3IHPC 3NBIA 2PO4A 2UUAQ 2A6HD 2H5XA 3QOJA 4DV7L 3S14H 3I3TB 1G6JA 2L1BA 2F4VQ 4A8XC 1DJRD 2GN5A 2A69C 1P16A 2LHEA 1C3TA 2E2IH 4A55A 2MQJA 4JK1C 2R93G 2J0TD 4AJYB 4HLEA 2OT2A 1RF2D 4BY7H 1BNZA 4L5SA 2KECA 1TKGA 1I4PA 1UGJA 1CKMA 2L0TA 1ML0D 4AOFA 2DJFC 5JEAJ 5M3MH 3CSFA 4A3FB 3HM3A 3P42A 3TUOA 2PMZB 1TWHH 1EL0A 4YSZB 3QR8A 1WVLA 4B3MQ 3VAWA 4K3CA 4DR1L 5AUKA 3KBXA 2MP1A 4PZ6A 1KLUD 1R4MI 3NP8A 4PMWA 1KDCA 1T9HA 2DBYA 3EFUA 1J0GA 3HKZG 3CCRA 4KKUA 2RPQA 2CS4A 3RD4A 3F2UA 4S3SA 3A8IE 4PZ8A 4JI6Q 2OF1A 1C4PA 1QUQB 3RN9C 5GADC 1VQLA 1XNRQ 4W9IA 4ANVA 4HKQA 2D3BA 3ZRFA 4FADA 1KIXA 3DVNU 4AQYQ 3HOYH 1MI2A 2R7FA 1P7FA 3M4YA 5T1IA 1WZ0A 4GOPC 2JUOA 4P16A 3U30A 2NZHA 4FXDA 2MWSB 3L9AX 1I50H 4XGAB 5M5WH 4LF7Q 2L5TA 1CKNB 2MA9B 3P4RB 4UHVA 2IGDA 2J7ZA 4E3CA 3DHQA 2IHEA 3GOEA 3S2HH 1E10A 1KOTA 2FMMA 4C3HG 4E74A 1QVCA 3K9PB 3CAMA 5GQOA 2XK5A 1PYSB 4J15A 1SE2A 3CPFA 5CV7A 4A9AA 1Y8NB 4MTKA 4X3KA 2A8VA 1JCKB 1K8MA 1SMYC 3H0GB 2O6VD 3TEZA 3W5OA 4X66L 4K5VA 2CWPA 1L0YB 1HH2P 2PKOA 4HVBA 4IJLA 1F9PA 1JJGA 1E8XA 2GA4B 4A3CH 5C4XH 2IO3B 3MJ5A 4OVZA 4DHZE 3KBGA 4FF4A 3BDLA 3WAPA 1PTOC 5FO9B 3HP3A 3GTGB 4AH6A 1VMPA 4FYDA 1EY0A 2MEKA 1J9OA 4KHZA 4M8AA 4LUOA 1IBKQ 1N60A 1E8WA 1EQQA 2DAJA 1HZBA 4A3MH 2HTME 4JPSA 3B2FA 3MWYW 4DAYB 5CV8A 2V4IB 1X55A 1IGCA 2ASQA 1RAXA 1YJIA 3RNGC 2L1AA 3JSVA 2K0PA 5F2DA 1K3RA 4NP5A 1C76A 3FKIG 3KLRA 2KTRB 3AEGB 3L13A 3NY5A 4IOIE 5G3LF 4MDKE 1FL0A 3IT6B 3Q6BA 1XX8A 5CHVC 2DLBA 3DEPA 1Y1VB 2N9KA 4DUZQ 4KDLB 3AE3B 1EU4A 2AUKA 2KHWB 4ANUA 1IBKL 2JA5H 1ZEQX 3HKSA 4P71A 2BPSA 1IP9A 4C1NI 2NVXB 2C7HA 1KRTA 4QAYA 2FUG1 2XSCA 1N33L 4JL9A 4IZ8A 3L3OC 1DONA 1V1PB 4C3IH 4LFBQ 2K6DB 3HEJA 3AB5A 4B3SQ 1KQSA 3NBHA 4Z9CB 3FEWX 3BVGA 1TZOA 2YTVA 1IBLL 2JA7B 2B63B 1STGA 1L1OC 3GTMH 4GOCA 4URKA 1XXGA 3QX1A 4WORA 4DUZL 3NUHB 5E6NA 3Q3JA 4BBSG 2NBUA 4GLXA 2IZVB 3DVGY 2JWUA 1QQRA 4JYAQ 1VQ9A 4MELA 4A3BH 2RR9A 1VCIA 1PH2A 2WXPA 2N9PC 4OGQC 4LNOA 3KYDD 4XDCA 2K3UA 4R4OA 1D5ZC 2QSDA 3SXHA 1G6PA 1X3PA 4MSQB 4L5QA 1SIFA 1LM0A 3D6WA 1FXTB 1EYDA 1O7YA 4YCUA 4YSXB 4RCNA 4L8JA 1LT5D 3AE7B 4APVA 2LS01 5DPTA 3KK7A 1NR2A 3CXCA 4DV0L 4LNQA 3D31A 3FHWA 4H0LC 4JI5Q 3CC7A 2DYBA 2OJWA 3U52E 2WKCA 4B95A 4ANXA 3A55A 3EA6A 2L7RA 4IWPA 1HZAA 4BBSH 2MX2A 1Z47A 3NZUA 3MAQA 3GB1A 1GHKA 5DPWA 4R4CA 2XN9C 2ZVOA 2KFKA 1N32Q 2FAZA 2Q2HA 3RCZA 1IW7D 1ASZA 3TEXA 1YQ3B 3AEVA 1PTOH 2ZTCA 1XNQL 4KLKA 4JI8L 3SR1A 4XTCS 4X64L 1ZPSA 1S4ZA 3IKJA 4MNOA 4A93G 2KD0A 5JHAA 2X6GA 5G5HA 2LI5A 3K7UC 2W9NA 5HGQA 3DWMA 1XLOA 3IVFA 1MJCA 3OIPA 2JYOA 5FR6A 1LTTD 2O6VB 2I5HA 1Y8RC 4HMIA 2KQ3A 3CHBD 1HA5A 3AV8A 2J53A 1D5MC 3CMMB 1KDAA 4G0NB 4K6LA 5M5YB 2V3NA 1A0IA 5JJKA 1L4DB 1VQJA 1K83H 1XTDA 3TEHB 1L4ZB 1WR1A 1I94Q 4ZK9B 2INDC 2HD3A 3OHXC 2MGSA 2QGQA 1CQFA 2O2VB 5CGKA 2GBJA 3GD7A 2W54A 2X69A 2BH2A 3I4MH 4IUUA 5G3LD 2FFKB 3H91A 2M4NA 1BCPF 2OTLA 2LMCA 3Q3MC 5E6OA 4OHJA 4Q2JA 3ZXRA 5LNK1 4HR7B 4YTPB 1X3QA 1WRDB 2H88B 4A3EG 3K8AA 3R3OA 3AE2B 2O2LD 3KF8B 2G9HD 2ZJQA 1S3SG 4NXNL 4KKIA 1PGXA 3JAMc 1X56A 3PUXA 2HDEA 4M00A 2EJMA 4GDLA 3MC8A 4OIJA 5BR8L 1HNWQ 4IOAA 5KNBA 1CUKA 2KEEA 1FM0D 3P4PB 3SK5A 2D3CA 3MVVA 5E4XA 1DZ1A 1T0QC 1K8AC 3A9KA 1LLRD 4IPCA 4F8MA 4FXGC 4O1NA 4PMCA 1YIWA 2ZT9C 4ZRKA 3VR4A 2Y5CA 4F7ZA 4DNIA 3EJIA 1RD9D 2XRQD 3EN2A 1R9TB 2JE6I 2R7DA 2QEXA 1G2TA 1D1KA 2BYEA 5G55A 4JI4L 2K8HA 1SE4A 2KN5A 1I5FA 2N78A 3K5NA 2MJDA 3PTFC 2EOTA 3AB9A 2G4DB 2NBFA 3HOZB 3GTLB 1HTOA 3QC8B 3T9LA 5JJIA 4KDIC 1R4MB 2WFWA 1L0XB 1AZPA 4C2MB 4DV2L 3GZNB 1EY9A 3PUZA 3UI2A 4KHPL 1FFUA 2WDRB 3FAHA 3D6CA 1OXVA 5CV4A 4MACA 5HKHA 1SMYD 1STNA 1SJED 4JI4Q 5KNDA 4A3JG 4HEDA 3PSEB 3PZ7A 3IFTA 3VH3B 3CSTA 1SYGA 2R93H 2K9XA 5E7NA 3GS2A 4J3OD 3KQ4A 2NBVB 4A6QA 1D3ZA 5GAHC 3RNFC 2CHWA 2J7QB 2PLPA 1B1ZA 3AU7A 3J81c 1TIFA 2FIFA 2ZW1A 2LJ5A 5BYRA 5IP4D 1LT3D 4X3TA 4BS9A 5FLXL 4N58A 1PH7A 4DV2Q 2IO0B 2MBBB 1CQVA 2KDEB 2AQ3B 2QEJC 3S1RH 3EGRA 1CK1A 3AU4A 2PTLA 3QA8A 3L0WB 4GDLB 4XYCA 2BCOA 3BYYB 2JP1A 5DNFA 3J81E 2NVTB 3SHQA 4EQ5A 4ARCA 2BQQA 4L6TB 1A2UA 3S1NB 2KLGA 1IZ6A 2BS3B 2Z0EB 3HOUB 1STBA 1IW7C 1QCBD 3HOWG 4DF7A 3A9JA 3HHMA 3ZTCA 4B0MA 2NZOA 2PYKA 4F87A 3U4EG 4AYBG 4DV5Q 3M4OH 1RLFA 2VZAA 4XXEA 3DXJC 2FINB 2CCZA 4BZAA 1V1PA 2R6GA 4ZRIA 3V96A 4JI2L 1TBEA 4C4VB 2EYPA 2INCC 5M5XB 4JBMA 4H2AA 1S3OA 3ND9A 3CCVA 1WD1A 4PYZA 2F1MA 5M5XH 4GKJL 5IT9E 4R9WA 3V62A 4DV3L 1R4NB 2FCQA 4N9F4 3A4RA 1E0ZA 4BBNC 1E3PA 2WHIA 4XYOA 4V190 3H3VH 4LF8L 3CC2A 3PUVA 2M0XA 1TWGB 4G4KA 1XNRL 3PREA 4YT0B 3W1SC 4RA8A 3RFZB 4EZKA 1E7ZA 2DYMA 4A3FH 2RCNA 4XQJA 3Q0AA 2QA4A 1WZ3A 2I07B 1HZ9A 4FDBA 2JXMB 2KHIA 3QJYA 4HJGE 2MP2A 4LFBL 5BYQA 4BKGA 1TWGH 5IT9L 2EXDA 5BMHA 2KJXA 1KABA 2A68C 1HNWL 4AUQC 1B70B 5CBEE 3J80E 5GAEC 1U5KA 3T4AC 4BFRA 5JHBA 3BVMA 2E2DC 4K14A 1JALA 2KA7A 2WDQB 3H1UA 4KK7A 2F0SA 2ZM6L 3N1XC 1WOCA 4CKBA 3RLNA 1WI5A 5IP7H 3BS1A 1KFYB 3NZ3A 3DPDA 1PTOB 1WTPA 3PRZA 3M4OB 1WCMH 5I2YA 4L2YA 4YTNB 5BMIA 4QQBX 3RMKC 5EDSA 2IHFA 1Z7TA 4N9PA 1CZGA 4IUTA 1SFOB 2JXXA 4DAYA 3EHVA 5IOCA 2HIXA 5GROA 2JT4B 1AZQA 1JWUD 4XC2A 1STAA 5CTRC 3IFWB 3B0AA 4LNFA 3E9IA 5HHDG 1GC7A 4YY3Q 5IWAL 4X62Q 2LGXA 2VQFL 2L0FA 4WAAA 4Q5VA 1HR0L 5C2TB 5TR5A 3AXCA 4DN4M 3CMEA 1XWEA 1RRBA 1PQSA 2QDLA 4DV6Q 2H1EA 5LMUL 1L0VB 2BYVE 2KCCA 1WE6A 4H02A 1S5CD 1AE2A 2N7DA 3T3NA 2RA4A 2WXGA 1KXLA 1YNTE 3BIID 4DV5L 3TBIB 3U8ZA 3U4ZA 3UDXA 4I7AA 1LUZA 4KIKB 3GP7A 2MRPA 3W1SA 2HD5B 4EUTA 3DHHC 1MBYA 2BBCA 2K1FA 2DZMA 1I6VC 3SD5A 2B63H 1T0SC 2C35B 1EUJA 2L9HA 1WYDA 4ILWA 4EQNA 1K8RB 3IXSA 2PCFB 4LNKA 1B9MA 1STEA 3D4WA 2ZNVC 2PIAA 1JJCB 2B8FA 4JPBW 3VFKA 2IGHA 4BKSD 3SDZA 1I4XA 4JV5Q 1AH9A 3C8YA 1SJHD 1NTGA 4KN7C 5IGGA 1E9MA 3JYUA 1F9QA 4DA2A 4JYAL 5C4ZA 2K28A 2E5LL 1NVID 1YI2A 1WGGA 2FCNA 2GBKA 3SFDB 3K9OB 3A8JE 1RTNA 1TKEA 4USAA 3CCQA 4HROA 4QL5A 4OO1G 1SYFA 5C3WA 4IW0A 3TBLD 4BXXG 4YIJA 3FKIB 2R2QA 2KJHB 1EIHA 4KIKA 2EQSA 2C5LC 3CRKC 3OWFA 2XRSD 1Z6HA 2BB6A 3A9KB 3AN1A 2MH7A 2Q5WD 1Z9FA 1N34Q 4HPLB 3ZNID 2OOBB 1TJEA 2X8XX 1BKBA 1CSQA 2LY7A 3OJ3A 5IKCM 2GMIC 1YN5A 4RF0A 1VQHA 2SOBA 1HTQA 1XO3A 3KLSA 2D2CC 2FCMA 1NYRA 1QNKA 4EKUA 5ELEA 1WXSA 4BY7B 2KDBA 4KHVA 3H7PA 3KFUA 4WH4A 3V3XA 4KY7A 1EZ6A 5C4JH 1SN8A 2LXAA 3ITPA 1MSGA 4P1CC 1SAPA 1RTOA 3WDNA 1BUIC 1TKYA 3H0GG 4X65Q 2C60A 4GDKB 4O0AA 4X64Q 3J81j 1IUEA 4CJ1B 4FXKC 4LLGM 4D2KA 2MP2B 3BDOA 3EQLC 3UQAA 2PI2A 2HE7A 2WDVB 1FVIA 3SVMA 2XK5B 1FO4A 3VR2A 4DR7Q 1PTOF 4V0BA 2IGGA 3LXFA 1B8AA 2A5UA 4Y7NH 5CBAE 5C44H 1A3TA 1ZE3D 3E0JA 2F0TA 3IFDA 5C0XG 3S17B 1Z2MA 1A5RA 4KHPQ 5EBCA 1KNAA 1WCMG 2Q2TA 2E2HB 2LGSA 4LTUA 1AE3A 1UWVA 3A7LA 4AS1A 2D2QA 4HAEA 3AE6B 3ZXVA 3K7AB 3OTOQ 1RKNA 1RIPA 4HEA1 1HUNA 5LHY1 1EY6A 4IUMB 4KX6B 1SBBB 5C3EH 1WY8A 3D4RA 3AEFB 1TR5A 3X23A 2JA5B 1HE8A 2YTYA 3EROA 4ZQ3A 3FKYA 4I6LB 1ACCA 2LXJA 2JA8H 3W1GA 5IYCH 4GMVA 1T0YA 2PQAA 2CH4A 3VXWA 1HNXL 2DN8A 2JRHA 1TU2B 1VQ6A 1G91A 3UGBB 2B2TC 2Y0SB 2M9VA 3DBRB 1V43A 4TRDA 2PPHA 4HJ7A 1F2MA 5COYA 3V60A 4CBVA 3BG3A 4JI3L 1ZW7A 2WXOA 1B9NA 3LNNA 1VDVA 2QIEB 4WWMA 3MXNB 3PO2H 2MUYA 5KIXA 3LDZE 4JCVE 3W5UB 3DWPA 1G291 1MHHE 1LM8B 2AHOB 1N33Q 3HK0A 1Q10A 1PHJA 2ACZB 5GAGC 2UUCQ 3VR9B 2OQ0A 3VHTC 4RHRA 1Q5WB 5MPOA 1PH6A 4UP7A 4A3OA 1Q0WB 3MTSA 4BVUC 1H95A 1LTBD 1QG7A 3HOWH 2D0PA 3L2PA 1A70A 3BK2A 1VS0A 3BJUA 3MP9A 1R4NI 3V2TA 1X32A 2KEDA 3DLLA 5EE9A 1DGSA 5FLXc 1WFQA 3KH0A 1I4RA 1XMQQ 2M56B 4KZ0A 1NMGA 2DY8A 2XTIA 3S16H 4NQKE 1TGZB 4GZYC 1I50B 3DHGC 4LF6Q 3GTQB 4GU2A 1SE9A 1PH1A 5FLXE 5HI1A 3GTPH 3WWVA 1NNXA 2RKSA 1Q82C 3ZKJC 1SF0A 2L52A 1TWCB 3R93A 3AU5A 4A3JH 1RL2A 4WJOA 3TQYA 5CYUA 3S15H 3I7FA 1L1OB 2ZJPA 3P4QB 1N32L 2ZW0A 1Y1WB 5IYBG 1EYGA 2EY5A 2DZIA 5K5PA 1XNQQ 1PH5A 2N7JA 1DOYA 4NW2A 1JICA 2K8BA 5LXIB 1Q46A 4II3B 1ESFA 3Q3OC 2NCNA 3ZJVA 2K52A 1EQRA 2K33A 2HJ1A 4JE3B 2ZPYA 1EY5A 1EF1A 2RDGA 1NI3A 4XWWA 1A2TA 3KWVA 1X65A 3AMUA 2Z0SA 5HGTA 4JIOU 1H9SB 3NVZA 3I4LA 2JA7G 5EBDA 1EIGA 1Y14B 2YV5A 4X62L 2G5DA 4A20A 2YVCA 3P7JA 1W2BA 4QY7A 3VTVA 1EFID 2K50A 3U7DA 3TZDA 2PW9A 1UE5A 4NZLB 4ZRJA 3I2ZA 2AUJD 3BZDB 1EWCA 3AEAB 2CHBD 2F0QA 1WM2A 2K22A 3NUCA 5AJ3L 1XPUA 2KWVB 3KDFB 2WAQE 2RHSB 3L16A 5E6JA 3NELA 3J7AF 1YJ1A 3TSSA 5C3EB 1BVSA 2WU2B 1V9PA 3DCGA 3PV0A 1IBML 4YCWA 4EQPA 2DJGC 3PHXB 3HFZB 1VQOA 3J7AV 5GXGB 2XNAC 2WV6D 2YU9B 2EY6A 1FRDA 4GOPB 2MCNB 4F8CB 5IYDH 1BO0A 1EEID 2LSSA 3D32A 2WB1G 3I4MG 1AP0A 1H8CA 3TREA 1GG3A 2L76A 3IBEA 3X3NA 2WX1A 3SDLC 2OWOA 1JC7A 4BY1B 3VQIA 1Q7YC 5I9PA 4JX1C 1LT4D 1NYQA 4HWIB 1N61A 4OEMB 2WU5B 3VH4B 3A1QA 3DBHB 4KSKC 4MGYE 1GUTA 4KI0A 2FBWB 3VVWB 3SK8A 2KT7A 1LYLA 3BYTB 3ZNZB 4LJOB 2AWOA 3G6EA 4OZAA 4J8QA 2CHZA 1O78A 2B2VA 3QHTA 1F77A 2CVRA 2JWZA 2VB3X 5M9OA 3AM9A 3ND8A 1MG8A 1I3QH 1YNND 1A63A 1MHWC 1WGHA 1JOOA 3T1YQ 1EUVB 4A93H 1WYWB 1QNUA 3FRPB 3A4SC 3P20A 2B29A 1C1YB 1Y8OB 2E8GA 1WJNA 3MC0B 4OELB 1NENB 2JYEA 3GO5A 5NUCA 3NPPA 3PZ8A 5IY0A 1CA6A 1BQQT 1STHA 1FYCA 4LJPB 1Y1VH 2R2OA 4KKTA 2PZUA 5LMUQ 4RGTA 4BBRB 1NBFC 2JSVX 3QJZA 1O7ZA 3A5ZB 1WTOA 4DK0A 4ZDVA 1P9DU 1RFKA 4MZ9A 1I35A 2NB0A 5LMNW 1SNQA 4XQQA 2Q2UA 4A3PA 3I72A 1WGKA 1PXUA 1K8GA 4N59A 4M0WB 1VF5C 4U68A 4HJ8A 2FE8A 4WJPA 3AYHB 3ZVVA 4KN4C 1WFYA 1ISNA 1Q1EA 1E7VA 4WWNA 3D0FA 1FJGL 2AL3A 1JWMD 2K5NA 1A62A 1Q90A 4ME3A 4B3TQ 4A3BB 2VRRB 3Q14C 1VLBA 2Y3AA 3N6RA 5K36G 2FXQA 4ODGA 2KQSA 4A3BG 4W9EA 3STBC 2F0JA 4J6IA 4IM3A 1U0LA 2KJ6A 4R8NA 1J7BA 2WXMA 3RMHA 4ZYNA 3B2GA 2Y5BB 1PTOD 4K0KQ 4BBSB 1SLJA 5A35A 5KGUA 3T16A 1WGDA 3F2BA 1ESRA 1SYBA 1PFNA 1T5EA 4REZA 2KCNA 4LFAL 3TP7A 4A93B 3K5LA 3F2CA 3RZOB 5FLMH 3APDA 1RFAA 1CA5A 3TP6A 3N1ZC 1QT9A 2CJOA 2ASBA 2INPE 1PFDA 2MPMA 4C7YA 2RMMA 2NBWB 3PLVA 5IGCA 2WXRA 4P6VF 4WJNA 1SYCA 2UU9L 1UBQA 2NVYH 2FIDA 2P5ZX 1I42A 4WJWA 3NQIA 3QCAA 4KVGB 1KF6B 1BCPB 1ZKOA 2WINB 3KOJA 2NTTA 4P2CB 1FPYA 3NS8A 4PS7A 5DPSA 3RYTA 4HIOA 3S1QH 4IKGA 1L6UA 4FLHA 4J6HA 1JE4A 4BY1H 4IC7B 4ANWA 1N5WA 4GIVA 1E8YA 3KUCB 4HPMB 4KSLC 2DZKA 3GTOB 1WYGA 2ZVNA 5G2NA 4W9JA 2LVPA 2F0EA 4A3LH 1HPCA 2SNMA 2MHVA 5EAYA 1ILPA 4H44C 3UE1A 3DBSA 1PZKD 3ER0A 5CR3A 4HJAA 3WA0A 1GB4A 2D5GA 1TS4A 3RNEC 2MJ3A 1YX6B 1TS3A 1HQRD 2FMCA 4K6DA 2A74C 3MEFA 1LFDA 3RNCC 2Z1CA 2RDFA 2QCZA 2LASA 4B6WA 2E3TA 5ELOA 1LTGD 2I5LX 1DOMA 1R4PB 4OWWB 2V9HA 1YEZA 2Z6BA 3RLOA 1MI0A 2F0DA 3UQBA 3H6MA 1WD0A 2PPBC 1YNNC 2N9XA 2L05A 1WJJA 1BF4A 4XYQA 4FVMA 1SE3A 2LKVA 3MC9A 2WB1E 1FXAA 3HM6X 2VQFQ 5A2QL 3OYYA 2QILA 2GI9A 2K39A 2SNSA 2DHZA 4DPGA 2WXIA 2X38A 3ZJUA 2PW7A 4XWTA 3RZDB 2ES2A 4UAIA 5BN4A 1MGSA 3T1HL 1I4QA 4LFCQ 2UXCQ 5C0XI 4DXFA 2K6AA 3P63A 4K0KL 1E0BA 1VQCA 2PZTA 1N36Q 5J3BA 2FHTA 1V8QA 1X9NA 2N1WA 1I94L 4LDTB 3TCAA 1Q8KA 4KV2A 1WX9A 2BTEA 2ZEQA 2LWPA 1RHPA 3GTKH 1XLPA 2KFJA 3DDCB 4BAXA 2EXZA 3I8ZA 2OEDA 5M3MG 4ZAIA 3OJ4B 4NXMQ 1SFOH 1N5XA 3KDFA 2EY2A 5ELDA 1OGWA 1RM6C 3PCOB 4IN3A 1V81A 1WMHB 1J5EQ 1ZKHA 2N1VA 2N88A 5C6AA 4JG2A 4NB3A 1UWXA 1SGHA 3B9JA 3N20C 3ZW3A 5L83A 1WTRA 3M9BA 1B53A 3NTHA 5LMNQ 2HT1A 3TP8A 1WJ6A 2VNUD 1E1TA 2IY0B 3QWZB 3PPAA 1C9FA 1GUOA 4ZHPA 1SE8A 3NEMA 2CQOA 3ML8A 1IBMQ 5BMGA 2WQYB 3NTIA 1V80A 2B3GA 4JI7L 2VL6A 4JI0L 1HFNA 1DXMA 2C7MB 4GDKA 2N4FA 1SR3A 3HOUG 3HOXG 3G6JB 2Z4IA 3PGZA 2K5PA 1WCMB 3NQTA 2E74C 1ZXTA 2BWFA 3K5OA 4NKLA 3TL5A 1FXIA 1V9JA 2K8CA 4L23A 4S0RA 1PH4A 1ENFA 5T1GA 2PJHA 4P75A 2WS3B 1ASYA 2ONQA 3A33B 3PO2B 3DQVA 2L4NA 1CM9A 4A3IB 1Q1OA 5KHOA 1GD7A 4ME5A 1QZEA 3PHWB 4G50A 2CH4W 5FKAC 3W9CB 3M95A 4BWGB 4BKTA 3S1MH 2KYWA 3RD2A 2GRIA 3OAWA 4OO1H 1WTWA 2R3ZA 5J22A 2FUHB 4JOIA 1Y8PB 1EFWA 1NAPA 3GTKB 4NJCA 4CJ0B 3OLMD 2ZNVB 2WAQG 3RUZA 1TY0A 1P8LA 1YJNA 4DBGA 1QOAA 1PRTB 3SFEB 1SNDA 4JLCA 2KFKB 2VW9A 5AZHA 1FGUA 2VH2A 4R4QA 2YU9H 1P7EA 4IPGA 1KLVA 4TQ1A 4JV5L 4DV1L 4FN2A 3CP0A 3CPWA 3NHHA 4GN1A 4I65A 4CHKA 2WB1B 4JI8Q 1A3VA 2NR2A 1BR9A 3NWSA 5DM73 1Q3LA 2KDFB 4FF3A 3LYYA 4HJKA 4KKJA 1LO5D 2EYHA 5IWAQ 1BXTA 3PV1A 4LUVA 2IDYA 4WIPA 4WRDA 1XTCD 1QKZA 5IT9c 4HCEA 1JQ4A 2K14A 2A68D 4CKEA 1N36L 3H6NA 3VRAB 4MM3A 2N49A 2RHQB 3F2DA 4NJ7A 4HXDA 3MJWA 3AEEB 1FJGQ 3PO3H 3S1MB 4RGOS 2BKFA 1WTVA 1J6QA 1SB3C 4WQOB 2MBEA 4TMAB 3A7AB 3HOZH 3SEBA 3K80C 1J5EL 1SYDA 4NPNA 2MBQA 2LUEA 2PE9A 2Z4HA 3Q3FA 5M3FB 1K3BC 4C3IB 1YJWA 3J80c 3PIPA 1ROEA 1DM0B 3U2SC 4P74A 3C3LA 4ALPA 3DBLB 4C00A 1MJDA 2CHXA 1TWAH 3ZDTA 3OG5A 1QILA 3JVZX 3LB8C 4B3ML 3I4NG 4WFN3 4JI0Q 5I4DA 2MW5A 1L7YA 3VA7A 5JJLA 3S15B 1IGDA 4W9LA 4C4VA 4JWUC 1PFMA 2KCMA 1WE7A 4PZ7A 4KJNA 2OQKA 5IGBA 3H15A 1WRIA 3OW2A 1D2BA 4X57B 4ZUJA 2KK8A 4GLSC 4E6IA 1M4VA 2ZXOA 1VQKA 2Y0SE 3IRBA 1G2SA 3DM3A 3ZO5B 1IYUA 1DOLA 3ICEA 4A3GG 5EKLA 5C4HA 4HDQA 2EY1A 3N52A 5G5GA 3PIO3 3CRLC 3TIXA 3TDQA 1JT8A 3GTGH 4HRSA 4PYUA 1GM5A 1X6OA 3Q3NC 4DR4Q 2C9OA 2K5HA 2EYOA 3OTOL 5C4XB 2V0GA 1X54A 1GJXA 1WJUA 3ULLA 2WWZA 1TVXA 5H8YE 1Y56A 3SK4A 1JWBD 2EPBA 4R1JA 3UF8A 3ZTDA 1GUNA 2MJ8A 4RCOA 3DHIC 1FIQA 2DYOA 2PVOD 2JZPA 5CHWA 3SU8X 4EE2A 4KMUC 4PQXA 4BA2I 1DOIA 4IM2A 5C1ZA 1YD8U 2EMTA 2UUBQ 5IOIA 3KW5B 5EGTA 4HIDA 1V97A 1NR4A 2KCTA 1F2YA 2NN6G 4B9KA 5JEAH 1SXTA 3LWEA 4XZ4A 4HTHA 5C5LA 3F1ZA 5C4JB 4WJ3M 3IAM1 2K7VA 5D6JB 4GN5A 4AYBB 2RDHA 3RZOH 4PNYA 5C5MA 2JZZA 4L5TA 3PF5A 2DZJA 3EFCA 1U4PA 2O5JC 2KTRA 1L6VA 3A9JB 4XIGS 1GJZA 2WXJA 1X3EA 2Q8TA 2L3ZA 1JMCA 1CT1D 1TIID 1YNXA 3B1LX 4XQNA 2B2UA 1VQMA 2GBRA 2KHJA 3TN2A 3CCUA 3HRZC 4JBWA 2UYZB 4PG3A 4A3DB 1C79A 3ZQ4A 5D7GA 4QUFA 4A3DH 1J7CA 3DBLI 4ICVA 3QIAA 2W82A 4JBJA 2QHOA 2L15A 1IXRA 2BF8B 4ACFA 2KKCA 5BR8Q 4NJ6A 2WGSA 1E6EB 4FF1A 4DV7Q 3I3CA 2M2LA 2REXA 5BN5A 3GTOH 1JW9D 2C5CA 4KZCA 2YEPF 2FCSA 3A8KE 1PGBA 1SROA 3C0RB 3KYCD 3M4QA 3L54A 2EMSA 2MQHA 1CZPA 2M17A 4KY5A 4JVZA 1YIJA 3MFYA 4IO9A 3NZSA 1HNZQ 1HTPA 4CDCC 2AMCB 2MO1A 2KMAA 2SEBD 3FVQA 2IW3A 2G1EA 1VRAB 1CFMA 1EOVA 1L0WA 3HG9A 1A15A 3SK6A 4OWTB 5AFWA 3K58A 3DVNV 3KF6A 4I6NB 3GTMB 1U4AA 1CHPD 4ARIA 3JW0X 4QUCA 5CV6A 1UBIA 3C19A 4C3HB 2W55A 1UD7A 2AYOB 3EUB2 3CQZB 3NS1A 1UE6A 4YCVA 1OXXK 4X65L 4P73A 4DR5Q 1Q81C 2W3RA 2KVRA 5LLIA 4C56C 4A3EH 3NOBA 1K73C 2I2YA 2EKEC 1YQ4B 3OIQA 5DAUA 1B50A 1AEXA 2RSOA 4LMQD 4IM0A 4DHJD 1HUMA 5JPMC 2OJRA 2PI2E 2VH1A 3I4OA 4QB4A 4C1NK 1NE3A 4L5RC 4N6EB 3LWUA 4W9FA 3CF6E 4E71A 2QKIC 3C1FA 1HFGA 1C8CA 4NQLB 1BCPC 1MKHA 4EGVA 4M8NA 2ATWA 2F0NA 1PH9A 4LF5Q 1D7QA 3K6OA 5TSSA 3R7RA 1JQYD 2D3AA 1EWYC 2F0KA 2KDIA 2B2YC 2Q2IA 2RQXA 2LJIA 1U9RA 3TMEA 2MHJA 2RCFA 2I0QA 1C7YA 1IKLA 1H9MA 2VZKB 4WWOA 4ZCKA 1T6BX 4QJFA 2CQAA 4FF2A 1XCTL 2EE1A 1EY4A 4IFDJ 3ZJYC 4GKKL 1YHQA 4W9GA 1PRTF 1Y1WG 2K1BA 2VUMG 2M1MA 4HKZE 4ZRQA 3AFPA 2K5DA 2L00B 3QG1A 3GV3A 2INNE 3RN2A 4A3KB 1FD7D 1NI2A 3L08A 4FBJB 1N9WA 2CW0C 1J8IA 2BS2B 2BGFA 3BY4B 4U673 4I7ZC 4PMBA 1OTCA 4IJHA 2NVQB 1S1QB 3NSWA 2UU9Q 1LGRA 1PFBA 4IWOA 4JI5L 3TS2A 3E9HA 3SE0A 2N7EA 1PDXA 4DV4L 5K36H 2L83A 3PT2B 2SAKA 3H3VC 2K5WA 1E8ZA 3EIVA 4GS3A 1QB5D 4DR2L 3J7A5 4OZCA 4LF7L 2ZXRA 3S17H 1F9JA 1RYJA 3RNAC 1U4MA 4DR3L 3VYUA 5KYIA 4DUYQ 4DDID 1IL2A 3UDGA 4RHSA 2KC2A 3NJTA 3QOLA 2QJLA 1UH6A 1KTKA 4QMGA 4B3RL 2OTJA 1TWHB 2M19A 1V5OA 2MSED 1FGBD 1PMRA 4LAAA 5BN3A 3GTJH 4OIKA 3HKZE 4HIKA 1LXDA 2N0SB 5FR3A 2G45B 1QVGA 2J42A 4G3XB 4DV4Q 2K6QA 3L7ZC 2LD9A 2RDBC 4YY3L 3PS6A 3UIPB 1YVCA 1UELA 2VZKD 3RT3B 2BB5A 1ZUD2 2EYLA 4DAPA 3M3YB 3GTQH 5BYSA 4DR3Q 3VYRA 2QDFA 5L37A 2IWHA 4A3IH 4KGTA 2A19A 4O2DA 1F2LA 4IUVA 2M8SA 1RODA 1OO9B 2TMPA 4C3IG 3S2DH 4X3UA 1PRTC 5M3MB 4B3TL 3M3JA 2JN4A 1XLNA 4YL8A 1WGYA 1N8RC 4EVOA 2LVOA 1LACA 2JY6A 3KUPA 2VUMH 1D1IA 2JA5G 3OMGA 2LRUA 1Q12A 4IDIA 3MXUA 3WALA 1CJEA 1Y1WH 2A6HC 2JA8B 3UE0A 2HDLA 1WTXA 3AEBB 2YTXA 4BBNF 1DCZA 3LJ3A 2K75A 2ZPNA 2JQOA 2PZWA 2LHDA 3DM1A 1B2TA 1GUAB 3VDYA 4GLAC 3FKIH 2F0GA 2SDFA 1EIFA 2TSSA 1I6HH 2HTHA 4DWFA 4MJSA 4Y52H 3AFQA 2MNAA 4B9WA 2Z6KA 2MO0A 4GB9A 2IX3A 3DVGX 3J9CA 5D94A 1GUWA 2LGYA 3JSVB 3CMAA 1AARA 3U7ZA 1UAPA 1VCBA 5C4XG 1BMLC 3U4VA 5I6YA 4LF4L 1V86A 4A3JB 2JX5A 1BDOA 5IYDG 4MGZE 2CWAA 2V3SA 3W2DA 3K0XA 1TWFH 4JBKA 3Q2AC 4WJQA 3Q24A 1LTLA 2IO1B 4A3GB 3WOFA 5LMNL 2D62A 1H4RA 1MJEA 1LQBA 4NXML 2QC8A 4FJYA 2K4KA 1H9KA 4N8FA 5HY6A 4DV3Q 1VQBA 1IBLQ 2NN6I 2D3GA 3WAMA 4TQ0A 4MJSB 1FFVA 4RM8A 3RZDH 4K3BA 2KACA 5CMDA 3HIZA 3UIOB 2PE6B 3PGEA 3I73A 4JI7Q 4FO2A 1F9RA 5JJZA 1VZ6A 4OVVA 3GE8C 3IL8A 1ZYRC 5C44B 1B7YB 4B3RQ 4XX5A 3FP9A 5ISRA 2ICIA 4HCNB 3N30A 5IO9A 5JXVA 2NYZD 4RNAA 1AN8A 2HDMA 2KJRA 1QZHA 5IIFA 1PDQA 2JA7H 3GTLH 2MLBA 2WP9B 2XWJB 4PT5A 3NWTA 3J7YW 2H4OA 1EU3A 4TUUA 3H9DA 5IP9H 1HNZL 3E56A 2QF7A 2WKDA 5FJ8G 4KTAA 2K5VA 3MXGA 2KN4A 4GN4B 4ABNA 1SNOA 4EZJA 2J4XA 4JI1L 4A4IA 3IG3A 4CDDC 4A90A 3CC4A 3DMUA 1VR9A 2LFNA 1JB7A 1EWIA 2EIFA 4K1RB 3CU7A 5JH5C 3PUWA 3AE8B 3HUIA 5IYBH 3Q23A 1L5PA 1F1HA 4FHKA 4BY7G 1WXAA 2CKZB 3RR5A 2K25A 4YWMA 4CDEC 2BVCA 2AWNA 4A3DG 4IQZA 1JORA 2KMCA 1NSNS 1NCVA 3NRZA 4A75A 1OQYA 2WXNA 4OVUA 5JZEB 2ZTEA 5D3DA 3VR3A 4R3DA 3MA2B 2RPVA 3AI5A 4A3EB 4BOZB 3Q8DA 2L55A 4ZRZA 1VQGA 4AIMA 2F4VL 2J0JA 3NVVA 1L2NA 3X0WA 1KH0A 1XLQA 2WNMA 2R61A 4A3KG 1G8ZD 3ERQA 1FRRA 4GGQA 3O65B 3RPFC 4NPSA 1VD2A 4YSYB 1CI3M 1GXDC 1KNEA 2E75C 3WOEA 2O4XA 1WR6E 2VXWA 3DWGC 4AYBE 4P72A 1MG4A 2I1JA 3N3KB 1E5WA 1ZYRD 2K5QA 2KZRA 4GXBA 1K9MC 3W5VB 2KX3A 4K5XA 1I6HB 4XDXA 1JRPA 3TZUA 3APFA 3L17A 4IUPA 5E6PA 1DOKA 4LCDE 1VQ4A 4TQUS 3SR6A 1BBUA 2R7ZG 2B2TA 1VQDA 4UP8A 1X3GA 1ZXIA 3PO2G 4LFAQ 2YLMA 4IPHA 2O2VA 3Q8CA 3ML9A 1UUPA 3KLSX 3QIJA 3QK0A 4KGSA 1EY7A 3MHBA 2IO2B 3AMZA 1M94A 2UXDQ 2B2WA 2WXKA 1XQQA 2F0WA 2WLBA 1FMAD 2BWES 5FK9C 2JA6G 3UINB 3KWLA 1H9JA 1JE5A 4C3JH 3AE1B 3HZXA 1WWTA 2JA9A 3Q8BA 3ZGZA 3EC8A 2NVXH 3JAME 1O80A 2XBBC 2AKWB 2HHHL 3M4PA 4MGKE 1HRJA 5IYCG 2JA8G 4K7UA 1A8VA 1WI0A 2XIWA 3D4DA 2OHFA 3QB3A 2BA0A 2RF4A 2DAFA 1F2ZA 2UWQA 3ZLZA 1ET9A 4IWQA 3J80L 1FD6A 1VQ5A 3H94A 3GTJB 1YN4A 3NHEB 4LK0M 4RH6A 1F0ZA 5C0XJ 5D3IB 2AL6A 2AX5A 4DNTB 3GDEA 1UWMA 1YHBA 2ON8A 5JVG3 3VUWA 5C44G 5M5WB 2WP8J 5AZGA 1S72A 2F0HA 2EYJA 2KMMA 3PZDA 1TWCH 3PF4A 3AULA 1CSPA 1C9OA 2D5DA 3HKZB 4CGYB 4G7ZC 3TP5A 4IOCA 3GTPB 1YNJC 1CZWA 2HQEA 1C0AA 1ZGUB 1IYJB 5KHQA 4W9CA 1B9RA 2JF5A 1TQOA 3K59A 1GB1A 1HA6A 2N8NA 2UUBL 4DGZA 5KYLA 5J1ZA 3PO3G 1KAAA 3H0GH 2KQ7A 3PVLA 4NNJB 4LWCA 5AZFA 5CORA 2EYMA 2F0PA 5J17A 1WMHA 5C3XA 2KWDA 3AQQA 5HURA 3T1HQ 1WTHA 3CWIA 3DOWA 4K7SA 3NVYA 3D3RA 2JZ3B 2XWBB 1VQAA 2J0MA 1PFSA 1EZ8A 3C1EA 2PW5A 5I2XA 2BYTA 4GLVB 4R8IA 1DD2A 2NPTA 3RN5A 2BE5C 3I55A 4YWKA 2CU1A 3VR6A 2R7ZB 3GQBA 3Q69A 2E2IB 1GUSA 1G51A 5DEHA 3S16B 3L0OA 4IFDG 3I63C 5CHFA 3G7LA 4EEWA 1D4BA 3U50C 4GKJQ 4BA1I 1V1QA 1WX8A 3AH7A 4FJVB 5D2MB 1T0RC 2DWQA 1HNXQ 2EYFA 1K50A 4W9DA 3ZUNA 1Z5SB 4CO7A 2R92H 1SRUA 2Y0SG 1ENCA 4BXXH 2BKRB 2C7NB 2WDTB 4G11A 1IKMA 1C77A 2LEKA 4C80A 1WGRA 3HS0C 3BU2A 3V61A 4MEMA 3T53B 2PVGC 3QWNA 1IYFA 1NMFA 4B9XA 2IL8A 2QDBA 3FMCA 1PV4A 2UXDL 2VUMB 2C9WB 4OX9Q 3JC66 4MIUA 1D8LA 4RGNA 3Q22A 1VQ8A 2KWCA 4JI3Q 1E22A 2ZZPB 3ETRA 4PV1C 5GMVA 2F52A 2HCCA 2ID0A 4RGMA 3TEWA 4X3SA 3E5SA 4N9TA 5CV9A 5M3FH 4GOPA 1P3QU 4YWGG 1P98A 2ZTDA 2Y5PA 2D0OA 4BOSC 4P1BC 2A6EC 1UF0A 2WIIB 2F0OA 1M90C 3I9V1 3RI7C 4CYEA 2O6VA 4CQNA 2UUCL 4HJ9A 4IFDH 2N55A 5CX3A 2DX5B 2R93B 3J7ZC 1NUCA 1KRHA 1UGMA 4DHZB 2F0IA 4F88A 4QF4A 1MPEA 4W9HA 3RNBC 2V4DA 4KJOA 2NZ1D 3GV6A 3S2DB 3OPOA 1UE1A 4XT3B 3S2AA 2OCEA 4HN7A 1TZ1A 2D9UA 1KL9A 2J0KA 4HCPB 3ENEA 5D14A 4LF9L 3S1NH 3VYSA 1QJOA 4EOYA 3M7NA 1HEZE 2L11A 1KRSA 2F4IA 3ULJA 1E7UA 1PVOA 1S5DD 3G4SA 2KTFA 3DBHI 1VF7A 2BA1A 4LK1C 1D6EC 2FNJB 4JWSC 4MH0E 2A5HA 2A4ZA 1JWAD 3V6CB 1VDZA 3DUZA 4OWXB 1IL8A 2QCPX 2KENA 3LX0A 3EBEA 4RG1A 4POFA 1YITA 1R9TH 1T3QA 2HJ8A 4M02A 2B3AA 1NDDA 4Y7NB 1FCCC 3I4NB 2WYQA 3BDCA 3DEOA 4JOIC 4JI1Q 2GVBA 1K0RA 3FPPA 5JVH3 4DAMA 3CCEA 4CHTB 2DNFA 2NPTB 4ZUIA 1MHXA 1LT6D 1UE7A 4POGA 3NVWA 4NDXA 3S1RB 2K01A 3GE3C 4MT5A 1CKOA 1H9SA 1VQ7A 4HSPA 5EPLA 2LZ6A 4IUQA 4WQMA 4DR7L 1HHVA 3K57A 1RWSA 4NAMA 1BOSA 4LF4Q 2PMVA 3E9SA 2WXQA 2A69D 1EEFD 2NMQA 1YZ6A 2KXJA 3A5UA 2A73B 3M7GA 1ZDXA 2JEAI 4F1SA 3K0YA 3MXPA 2YEPB 2PQAB 4C3JG 4DFAA 5I9OA 1SIJA 2EKIA 2JA6H 1VQFA 2BS4B 1NBWA 2XVSA 4TSSA 1JOKA 4L1BA 3K5MA 2GB1A 4HSVA 4K2KA 1K8OA 1LTRD 4OZBA 3HOVB 3V05A 1X1MA 1YMHE 3P2BA 2JEBI 2KVZA 4GN3B 1WX7A 1RDPD 3VUXA 2VQEL 5M5YH 2E5LQ 2R92B 3OMCA 4MN3A 4DR6L 1F2RI 1YQBA 4OX9L 1Q86C 3VR5A 2B39A 1SDFA 1E7PB 2F0UA 2XGTA 5KEEA 4IUNA 4RAUC 1N34L 5C3JB 2GVAA 4K8IA 1QOGA 4KKSA 4DKAC 2IPKD 1K52A 1V49A 1ICWA 1ZP0B 4UP9A 3E3XA 2ALYB 2WAQB 3H3VI 4A3LG 5DPRA 3A1QB 3RNUA 1PLFA 3CW2C 3A54A 1WXQA 1K53A 4LJZC 4A3KH 4MTNA 2Q8IB 4H7BA 1P0RA 3PLUA 3NK9A 4O42A 4DR6Q 1QLBB 2ZCBA 4I6PA 2Z6KC 4BY1G 3JAMi 1VQNA 1F2RC 2LRWA 2VB2X 1B3QA 3ZYYX 1J19A 1V8CA 4FP5D 2DY7A 2G9DA 2MFIA 5ELBA 3PIP3 3H7PB 3Q8AA 1ZOYB 5ELFA 4C7ZA 3A74A 5FO8B 3S1QB 4K7WA 1QWYA 2LUMA 1KDBA 3W3AA 2HHHQ 1OEYJ 1QOHA 4K81A 2UXBL 2B76B 3K81C 2BW2A 4M8MA 1GAQB 3WAOA 2UU7A 1SEBD 3IAS1 1EQTA 1RCVD 2DUDA 1PH3A 1TYGB 1KD1C 1TY2A 1P1AA 4DV0Q 3HVZA 2F3IA 1V5TA 2OXPA 3T3OA 3E0EA 1OXSC 4EQOA 3CQZH 1OFFA 3ECIA 3AECB 4GNXB 2V4LA 5FLMG 1M8AA 3MEHA 2IT1A 4HCSA 4OO1I 2F0MA 4ULLA 1E90A 1OQQA 2NVUI 1HXYD 3NG0A 4PK1A 1J8CA 4DK6C 4US9A 3W1YA 1K83B 1U4RA 2IJ0A 4TKNA 2BE5D 2PMZE 1S5FD 4US8A 1ONLA 5FJ8H 2EJFC 1IBXA 1S40A 3ONSA 5IP9G 2PNRC 2LMCB 1F9SA 5J39A 4DR5L 3IAYA 1YN3A 2K05A 1J7AA 2E6XA 3MFGA 3N32A 4HPPA 4IPDA 2I1KA 3S24A 2MBOA 2N9EB 4MM3B 2GLSA 1BT0A 1HR0W 1XD3B 4WURA 3MHZA 2KQ4X 4LUZA 3TJPA 4XT1B 2J52A 2V1YA 4FA6A 2HIVA 5JAVA 3A0JA 4UY8C 1TT5B 4DV1Q 1SNMA 4K5WA 3I57A 1PZID 3WANA 3A56A 1GPXA 4ITKA 3PIOA 4ZHOA 1AYFA 5FO7B 1NEKB 1KAWA 2GBMA 2LGDA 3QAQA 2M0AA 1W6KA
chains in the Genus database with same CATH topology
2N9LA 4DXGA 4DK1A 1Y69U 2NVYB 1FCLA 1FNVA 1JWSD 2RVLA 2O5IC 3OW7A 2Z8LA 1G6ZA 4XDDA 1QF6A 1YNJD 4HMJA 1BCPD 4ZYSA 1UEAB 3BVZA 4CKCA 2B2YA 1EYAA 3ONAB 1SNCA 5EJWA 3CIRB 2WACA 1QOFA 2F0VA 4DQOC 1AWDA 1E2VA 2B2WC 3QO2A 2JYTA 3HGBA 2WXFA 1FEHA 2WXHA 1VZ8A 2JSOA 1CTMA 1JOQA 2F0LA 1FNUA 1IHZA 5CC4A 3FILA 1PGAA 2M00A 1MVKA 1XCQL 5HG2A 3ZJTA 3AEDB 5EQ0A 2F3WA 1MD2D 5LL6S 4J1MA 1HZ6A 2W3SA 1II3A 2JQRB 2K03A 3URYA 2DNCA 1PYWD 5IGDA 4KD3A 1C78A 2CJNA 2HUGA 3EFXD 1K51A 5IODA 2CU3A 4ZRPA 3PO0A 1U4LA 3HOXB 3E6ZX 1MSHA 2PQEA 4M1UB 4M0WA 2RBMA 2JA6B 3OOCA 2H89B 4OW0A 1OXTA 1C4QA 1SYEA 2L0CA 3Q6SA 2KAJA 1AW7A 3I90A 3NTKA 2F0FA 3FPUB 1TS2A 3EVQA 4C3JB 1IYVA 3I4MB 1RJTA 4B0EA 3T51B 3BWUD 3S2HB 3N9YC 1O7LA 1CHQD 3T56B 2QMTA 2KUMA 4ZKCB 2BOSA 3P4SB 1E2WA 2EDGA 3JAML 4OL7A 2OEOA 3X3MA 1H9RA 1R4QB 3S9WA 1ZDVA 2X6LA 1VMCA 2K32A 1DOXA 4ID6A 1B3AA 5IGEA 4FNFA 2E2JB 4IALA 2LGIA 1AFPA 1BBXC 3R8BA 1HTLD 5JPNC 1R7SA 2ENBA 1I4GA 5LL6X 3P1MA 4ZLTF 2AQ1B 1HZ5A 1V1OA 3O13A 3MXNA 1BUVT 1FR3A 4FXCA 1JR0D 2F03A 4NAWB 1WSPA 1C4CA 4RWSC 2JU6X 4QIWB 4ZKBB 2RSNA 1TT2A 1OQRA 3WCQA 4RKLA 4DU9A 1I4HA 3VYTA 1UNSA 2L12A 3I91A 1SSOA 4KY6A 5EKIA 1VZ7A 2NTSA 1E2ZA 4YXDB 2KDMA 3MZ5A 5EKKA 1XYIA 3L4PA 3PUYA 1SNPA 1EOTA 4IURA 2I46A 2EELA 3C46A 4DAVA 4H13C 1XEEA 3FC4A 3AE5B 1GUGA 5FOBB 3VRBB 5C0XH 2WXLA 5IGFA 1S5ED 2KHSA 3OSOA 1LTAD 5CV5A 3FDTA 1XF5L 3KF8A 1ET6A 1N62A 3PMFA 5EE1A 2DNEA 4KGRA 1A3UA 2E76C 3AE9B 4ZOHC 5HFYA 5JOBA 4QCLA 1FNWA 4KV6A 4MHEA 1I7HA 2I38A 3U9SA 2EVBA 5AUIA 1A6XA 2YYZA 5JEAG 1B44D 1C4AA 1YJJA 2NN6H 1JB3A 3H8HA 4L63B 5ELCA 5KNCA 1JROA 3CKIB 2IX0A 1ILQA 3U9OA 3IT4B 5EE0A 3T13A 4K8JA 3J81L 2KOLA 4A3MB 4DNRB 5KRUA 1EYCA 3H09A 4AQ7A 5H92C 1QOBA 2LFIA 3DWAA 2EJGC 1PRTD 2CW0D 3HOYB 1D5XC 2V3PA 1EM7A 2L32A 3SHLA 1EY8A 2JXTA 2ICEC 1Q8IA 1B4OA 1HQMC 4XE0A 1T5XD 1PZJD 2KVMA 1KLGD 1W6JA 5D65A 1Q1BA 1PUTA 3HRDD 3RLFA 3ABVB 5A2QE 4K2LA 5DM63 1ENAA 4MH8A 3M85A 5E3FA 3R2IA 2HCIA 3D8GA 4B08A 4RKBA 1QE6A 2B2VC 1WTQA 1HCZA 2BDNA 1STYA 1IBXB 3Q8EA 3PO3B 4RF1A 5E4WC 3S14B 1TS5A 3NE5B 4G7HC 2FJ2A 3HVDA 1DYQA 2MJEA 5I6WA 4Q0FA 1S5BD 2B2UC 4RFBA 1TWAB 2NUCA 3FILB 3AE4B 2NWGA 1EWHA 5EPJA 2A6ED 5T8IA 3BK1A 1DGJA 1JMLA 3P1HA 1EQVA 3VR8B 1GHJA 2K04A 2Q8RE 1N63A 3UI3A 1ZXHA 4YTMB 3TEYA 2AQ2B 1SSNA 3NXWA 1LTID 2B8GA 3I70A 2BT6A 4CJ2C 3P75A 4IFDI 1C48A 1LABA 2ZXPA 3DWQA 1GOZA 1I3QB 5EPKA 1LTSD 4G7OC 3OWEB 3VA5A 3Q8FA 4G57A 1TWFB 4UDUC 5EE3A 4WAFA 3R2TA 4F7XA 4NMZA 4KD4A 1LV9A 2F3VA 2BDOA 5E1FA 3HOWB 1TKWB 2IX1A 2EZVA 3C2PA 4TKOB 1VJKA 1OXUA 3NBIA 2PO4A 2A6HD 3QOJA 2L1BA 4A8XC 1DJRD 2A69C 2LHEA 4A55A 4JK1C 2J0TD 2OT2A 1RF2D 1BNZA 2KECA 1TKGA 1I4PA 1UGJA 1ML0D 5JEAJ 3TUOA 3P42A 4A3FB 2PMZB 1EL0A 4YSZB 1WVLA 5AUKA 3KBXA 2MP1A 1KLUD 3NP8A 4PMWA 1KDCA 2DBYA 4KKUA 3RD4A 3F2UA 4S3SA 3A8IE 2OF1A 1C4PA 4HKQA 1MI2A 1P7FA 3M4YA 5T1IA 4P16A 4FXDA 3L9AX 2L5TA 3P4RB 2IGDA 2J7ZA 3DHQA 1E10A 2FMMA 4C3HG 1SE2A 5CV7A 4A9AA 1Y8NB 4X3KA 1JCKB 1K8MA 1SMYC 3H0GB 3TEZA 4K5VA 2PKOA 1L0YB 1F9PA 2GA4B 3MJ5A 4OVZA 3KBGA 4FF4A 3BDLA 5FO9B 1PTOC 3GTGB 3HP3A 4FYDA 1VMPA 2MEKA 1EY0A 1J9OA 4KHZA 4M8AA 1N60A 4JPSA 2HTME 3B2FA 3MWYW 5CV8A 2V4IB 1IGCA 1YJIA 2L1AA 2K0PA 5F2DA 4IOIE 4NP5A 1C76A 3KLRA 3AEGB 5G3LF 3IT6B 1XX8A 2DLBA 3DEPA 1Y1VB 2N9KA 3AE3B 1EU4A 2AUKA 1ZEQX 4C1NI 2NVXB 2FUG1 2XSCA 4IZ8A 3L3OC 1DONA 1V1PB 3HEJA 3AB5A 3NBHA 4Z9CB 3FEWX 3BVGA 1TZOA 2JA7B 2B63B 1STGA 1XXGA 4WORA 3NUHB 2JWUA 1QQRA 1VCIA 2WXPA 4OGQC 4XDCA 2K3UA 1D5ZC 2QSDA 3SXHA 1X3PA 3D6WA 1EYDA 1O7YA 4YSXB 4RCNA 4L8JA 1LT5D 3AE7B 2LS01 3KK7A 1NR2A 3U52E 3D31A 4H0LC 2WKCA 3A55A 3EA6A 1Z47A 3MAQA 3GB1A 1GHKA 2XN9C 1IW7D 3TEXA 1YQ3B 1PTOH 3SR1A 4XTCS 1ZPSA 1S4ZA 3IKJA 2X6GA 5G5HA 3DWMA 1XLOA 3OIPA 2JYOA 1LTTD 4HMIA 2KQ3A 3CHBD 1HA5A 3AV8A 2J53A 1D5MC 1KDAA 4K6LA 5M5YB 2V3NA 1L4DB 1L4ZB 4ZK9B 3OHXC 2MGSA 1CQFA 5CGKA 3GD7A 2W54A 2X69A 4IUUA 5G3LD 2FFKB 3H91A 1BCPF 2LMCA 4OHJA 4Q2JA 5LNK1 4HR7B 4YTPB 1X3QA 2H88B 3R3OA 3AE2B 2O2LD 2G9HD 4KKIA 1PGXA 3PUXA 2HDEA 2EJMA 4OIJA 5KNBA 2KEEA 1FM0D 3P4PB 3SK5A 3MVVA 5E4XA 1DZ1A 1LLRD 4F8MA 4FXGC 4O1NA 4PMCA 2ZT9C 3VR4A 2Y5CA 3EJIA 1RD9D 2XRQD 1R9TB 2JE6I 1G2TA 1D1KA 1SE4A 2MJDA 3K5NA 2EOTA 3AB9A 2NBFA 3HOZB 3GTLB 1AZPA 1L0XB 4C2MB 1EY9A 3PUZA 3UI2A 1FFUA 2WDRB 3FAHA 3D6CA 1OXVA 5CV4A 4MACA 1SMYD 1STNA 1SJED 5KNDA 4HEDA 3PZ7A 3IFTA 1SYGA 2K9XA 3GS2A 4J3OD 3KQ4A 4A6QA 2PLPA 1B1ZA 3AU7A 2ZW1A 5BYRA 1LT3D 4X3TA 4BS9A 5FLXL 4N58A 1CQVA 2AQ3B 2QEJC 3EGRA 1CK1A 2PTLA 4GDLB 2BCOA 3BYYB 2JP1A 5DNFA 3J81E 2NVTB 4ARCA 4L6TB 1A2UA 3S1NB 2BS3B 3HOUB 1STBA 1IW7C 1QCBD 4DF7A 4B0MA 2PYKA 4F87A 4XXEA 3DXJC 2FINB 1V1PA 2R6GA 3V96A 2EYPA 5M5XB 4H2AA 3ND9A 1WD1A 2F1MA 5IT9E 4R9WA 1E0ZA 4XYOA 4V190 4YT0B 3PUVA 3RFZB 1TWGB 4G4KA 4RA8A 2DYMA 4XQJA 3Q0AA 2I07B 2JXMB 3QJYA 4HJGE 5IT9L 5BMHA 2KJXA 1KABA 2A68C 5CBEE 3J80E 3T4AC 3BVMA 2E2DC 4K14A 1JALA 2KA7A 2WDQB 4KK7A 2F0SA 4CKBA 3BS1A 1KFYB 3NZ3A 1PTOB 1WTPA 3M4OB 5I2YA 4L2YA 4YTNB 5BMIA 1Z7TA 4N9PA 1CZGA 4IUTA 1SFOB 4DAYA 5IOCA 1AZQA 1JWUD 1STAA 5HHDG 4Q5VA 5C2TB 4DN4M 1XWEA 2H1EA 1L0VB 2KCCA 1S5CD 3T3NA 2RA4A 2WXGA 1YNTE 3BIID 3TBIB 3GP7A 3W1SA 1MBYA 2BBCA 1I6VC 4EQNA 2L9HA 4ILWA 3IXSA 2PCFB 1B9MA 1STEA 3D4WA 2PIAA 2B8FA 2IGHA 3SDZA 1I4XA 3C8YA 1SJHD 4KN7C 5IGGA 1E9MA 1F9QA 4DA2A 5C4ZA 2K28A 1NVID 3SFDB 3A8JE 1RTNA 1TKEA 4USAA 4HROA 4OO1G 1SYFA 5C3WA 4YIJA 3FKIB 1EIHA 3CRKC 3OWFA 2XRSD 1Z6HA 2BB6A 3AN1A 2MH7A 2Q5WD 1TJEA 2LY7A 4RF0A 1YN5A 2SOBA 1XO3A 3KLSA 2D2CC 1NYRA 1QNKA 5ELEA 4BY7B 4KHVA 4WH4A 3V3XA 4KY7A 1EZ6A 3ITPA 1MSGA 1SAPA 1RTOA 3WDNA 1BUIC 1TKYA 4GDKB 1IUEA 4CJ1B 4FXKC 4LLGM 4D2KA 3BDOA 3EQLC 2WDVB 3SVMA 1FO4A 3VR2A 1PTOF 4V0BA 2IGGA 3LXFA 5CBAE 1A3TA 1ZE3D 3E0JA 2F0TA 3IFDA 5C0XG 3S17B 5EBCA 1KNAA 2E2HB 4LTUA 3A7LA 4AS1A 4HAEA 3AE6B 3K7AB 1RKNA 4HEA1 1HUNA 5LHY1 1EY6A 4KX6B 1SBBB 3D4RA 3AEFB 1TR5A 2JA5B 3EROA 4ZQ3A 1ACCA 2DN8A 1TU2B 1G91A 2B2TC 2Y0SB 2M9VA 1V43A 4TRDA 1F2MA 5COYA 4CBVA 3BG3A 2WXOA 1B9NA 3LNNA 1VDVA 2QIEB 4WWMA 2MUYA 5KIXA 3W5UB 3DWPA 1G291 1MHHE 1Q10A 2ACZB 3VR9B 4RHRA 5MPOA 3MTSA 1LTBD 1QG7A 3BK2A 1A70A 3MP9A 3V2TA 1X32A 2KEDA 5EE9A 1I4RA 2M56B 2DY8A 4GZYC 1I50B 3GTQB 5FLXE 5HI1A 2RKSA 1SF0A 2L52A 1TWCB 3R93A 5CYUA 3P4QB 2ZW0A 1Y1WB 2EY5A 2N7JA 5K5PA 1DOYA 4NW2A 1JICA 3ZJVA 1ESFA 2K33A 4JE3B 1EY5A 4XWWA 2RDGA 1NI3A 1A2TA 3KWVA 3AMUA 5HGTA 1H9SB 3NVZA 3I4LA 5EBDA 1EIGA 3P7JA 1EFID 3TZDA 2PW9A 4NZLB 2AUJD 3BZDB 1EWCA 3AEAB 2CHBD 2F0QA 2K22A 3NUCA 5E6JA 3J7AF 3TSSA 5C3EB 2WU2B 3PV0A 4EQPA 3J7AV 5GXGB 2XNAC 2WV6D 2YU9B 2EY6A 1FRDA 1BO0A 1EEID 1AP0A 3X3NA 1JC7A 4BY1B 3VQIA 5I9PA 4JX1C 1LT4D 1NYQA 1N61A 2WU5B 1GUTA 4KI0A 2FBWB 3SK8A 3BYTB 2AWOA 4OZAA 4J8QA 1O78A 2B2VA 1F77A 2CVRA 2VB3X 5M9OA 3AM9A 3ND8A 1YNND 1JOOA 1QNUA 3FRPB 3P20A 1Y8OB 3MC0B 2JYEA 1NENB 3GO5A 5NUCA 3NPPA 3PZ8A 1CA6A 1BQQT 1STHA 1FYCA 4KKTA 2PZUA 4RGTA 4BBRB 2JSVX 1O7ZA 1WTOA 4DK0A 1RFKA 2NB0A 1SNQA 4XQQA 3I72A 1WGKA 1PXUA 4N59A 1VF5C 4U68A 2FE8A 4KN4C 1Q1EA 1JWMD 1Q90A 4A3BB 1VLBA 2Y3AA 3N6RA 5K36G 4ODGA 2F0JA 4R8NA 1J7BA 2WXMA 3RMHA 3B2GA 1PTOD 4BBSB 5A35A 5KGUA 3T16A 1ESRA 1SYBA 1PFNA 1T5EA 4REZA 2KCNA 3TP7A 4A93B 3K5LA 3RZOB 1CA5A 3TP6A 1QT9A 2CJOA 2INPE 1PFDA 2MPMA 4C7YA 2RMMA 5IGCA 2WXRA 4P6VF 1SYCA 4WJWA 3NQIA 1KF6B 1BCPB 1ZKOA 2WINB 2NTTA 4P2CB 4IKGA 1L6UA 4J6HA 1JE4A 1N5WA 3GTOB 1WYGA 2F0EA 1HPCA 2SNMA 2MHVA 1ILPA 4H44C 1PZKD 5CR3A 1GB4A 2D5GA 1TS4A 2MJ3A 1TS3A 1HQRD 2FMCA 4K6DA 2A74C 2Z1CA 2RDFA 2E3TA 1LTGD 1DOMA 1R4PB 1MI0A 2F0DA 3H6MA 1WD0A 2PPBC 1YNNC 1BF4A 4XYQA 4FVMA 1SE3A 2LKVA 1FXAA 5A2QL 2QILA 2GI9A 2WXIA 2SNSA 2X38A 3ZJUA 2PW7A 4XWTA 3RZDB 4UAIA 5BN4A 1MGSA 1I4QA 5C0XI 4DXFA 2K6AA 3P63A 1E0BA 2PZTA 2FHTA 1V8QA 2BTEA 1RHPA 1XLPA 2EXZA 3I8ZA 2OEDA 4ZAIA 1N5XA 2EY2A 5ELDA 1RM6C 4IN3A 2N88A 5C6AA 1UWXA 3B9JA 1WTRA 1B53A 3NTHA 3TP8A 2VNUD 1C9FA 1GUOA 4ZHPA 5BMGA 2WQYB 3NTIA 1HFNA 1DXMA 3G6JB 2Z4IA 2K5PA 1WCMB 3NQTA 2E74C 1ZXTA 3K5OA 4NKLA 1FXIA 4L23A 1ENFA 5T1GA 2WS3B 2ONQA 3PO2B 2L4NA 1CM9A 4A3IB 4ME5A 5FKAC 3W9CB 4BWGB 2GRIA 4OO1H 1WTWA 2R3ZA 5J22A 1Y8PB 1NAPA 3GTKB 4NJCA 4CJ0B 3RUZA 1TY0A 1QOAA 1PRTB 3SFEB 1SNDA 1P7EA 4TQ1A 3NHHA 4I65A 2WB1B 1A3VA 1BR9A 3NWSA 5DM73 1Q3LA 4FF3A 3LYYA 4KKJA 1LO5D 2EYHA 1BXTA 2IDYA 4WIPA 4WRDA 1XTCD 1QKZA 4HCEA 1JQ4A 2A68D 4CKEA 3VRAB 3AEEB 3S1MB 4RGOS 1WTVA 1SB3C 4TMAB 3A7AB 3SEBA 1SYDA 2Z4HA 5M3FB 4C3IB 1ROEA 1DM0B 3U2SC 3C3LA 1QILA 3LB8C 4WFN3 5I4DA 3VA7A 3S15B 1IGDA 4JWUC 1PFMA 4KJNA 5IGBA 1WRIA 1D2BA 4ZUJA 4GLSC 4E6IA 1M4VA 2ZXOA 1G2SA 1IYUA 1DOLA 5EKLA 5C4HA 2EY1A 3N52A 5G5GA 3PIO3 3CRLC 3TDQA 4HRSA 2C9OA 5C4XB 2EYOA 2V0GA 1GJXA 1TVXA 5H8YE 1Y56A 3SK4A 1JWBD 2EPBA 1GUNA 2MJ8A 4RCOA 1FIQA 2DYOA 2PVOD 2JZPA 4EE2A 4KMUC 4PQXA 4BA2I 1DOIA 5EGTA 1V97A 1NR4A 1F2YA 2NN6G 5JEAH 1SXTA 3LWEA 4HTHA 5C5LA 5C4JB 3IAM1 2K7VA 4AYBB 2RDHA 4PNYA 5C5MA 1U4PA 2O5JC 1L6VA 4XIGS 2WXJA 2Q8TA 1CT1D 1TIID 4XQNA 2B2UA 3TN2A 3HRZC 4JBWA 4A3DB 1C79A 3ZQ4A 5D7GA 4QUFA 1J7CA 3QIAA 2W82A 1E6EB 4FF1A 3I3CA 2M2LA 5BN5A 1JW9D 2C5CA 2YEPF 3A8KE 1PGBA 1CZPA 4KY5A 3MFYA 1HTPA 2SEBD 3FVQA 2IW3A 2G1EA 1VRAB 1CFMA 3HG9A 1A15A 3SK6A 3K58A 5AFWA 3GTMB 1CHPD 4ARIA 4QUCA 5CV6A 4C3HB 2W55A 3EUB2 3CQZB 3NS1A 1OXXK 2W3RA 4C56C 2I2YA 1YQ4B 3OIQA 5DAUA 1B50A 1AEXA 2RSOA 4LMQD 1HUMA 5JPMC 4QB4A 4C1NK 4N6EB 3LWUA 2QKIC 1C8CA 1HFGA 3C1FA 1BCPC 4EGVA 2F0NA 3K6OA 5TSSA 1JQYD 1EWYC 2F0KA 2B2YC 2RQXA 2LJIA 1U9RA 3TMEA 1IKLA 1H9MA 2VZKB 1T6BX 4FF2A 2CQAA 1XCTL 2EE1A 1EY4A 4IFDJ 1PRTF 2K1BA 4HKZE 4ZRQA 2K5DA 3QG1A 3GV3A 2INNE 4A3KB 1FD7D 2CW0C 1J8IA 2BS2B 4U673 4I7ZC 4PMBA 2NVQB 3NSWA 1PFBA 3SE0A 1PDXA 5K36H 2L83A 2SAKA 3H3VC 2K5WA 4OZCA 1QB5D 2ZXRA 1RYJA 1U4MA 3VYUA 5KYIA 4RHSA 3QOLA 2QJLA 1KTKA 4QMGA 2M19A 1TWHB 1FGBD 1PMRA 4LAAA 5BN3A 4OIKA 2N0SB 5FR3A 2J42A 3L7ZC 2VZKD 2BB5A 1ZUD2 2EYLA 4DAPA 3M3YB 5BYSA 3VYRA 2IWHA 4KGTA 1F2LA 4IUVA 1RODA 1OO9B 2TMPA 4C3IG 4X3UA 1PRTC 5M3MB 1XLNA 4EVOA 1LACA 3KUPA 1D1IA 4IDIA 3OMGA 1Q12A 3MXUA 1CJEA 2A6HC 2JA8B 2HDLA 1WTXA 3AEBB 1DCZA 2PZWA 2LHDA 3DM1A 1B2TA 2F0GA 2SDFA 2TSSA 4B9WA 2IX3A 3J9CA 1GUWA 3U7ZA 1UAPA 1BMLC 5I6YA 2JX5A 4A3JB 1BDOA 3W2DA 3Q24A 4A3GB 3WOFA 2D62A 1H9KA 2NN6I 4TQ0A 1FFVA 2KACA 5CMDA 3I73A 4FO2A 1F9RA 5JJZA 1VZ6A 3IL8A 1ZYRC 5C44B 5ISRA 2ICIA 5JXVA 2NYZD 4RNAA 1AN8A 2HDMA 5BYQA 5IIFA 1PDQA 2WP9B 4PT5A 2XWJB 3NWTA 3J7YW 2H4OA 1EU3A 3E56A 2QF7A 2WKDA 4KTAA 3MXGA 2KN4A 4ABNA 1SNOA 2J4XA 4A90A 3DMUA 1VR9A 2LFNA 3CU7A 3PUWA 3AE8B 3HUIA 3Q23A 1L5PA 2AWNA 4IQZA 1JORA 1NSNS 1NCVA 3NRZA 2WXNA 5D3DA 3VR3A 4R3DA 3MA2B 2RPVA 4A3EB 4ZRZA 2L55A 3NVVA 1KH0A 1XLQA 2WNMA 2R61A 1FRRA 1G8ZD 3ERQA 3RPFC 4YSYB 1CI3M 1GXDC 1KNEA 2E75C 3WOEA 2O4XA 2VXWA 3DWGC 3U4EG 1ZYRD 2K5QA 3W5VB 4K5XA 1I6HB 4XDXA 1JRPA 3TZUA 4IUPA 1DOKA 4TQUS 3SR6A 2B2TA 1ZXIA 3Q8CA 1UUPA 3KLSX 4KGSA 1EY7A 3MHBA 3AMZA 2B2WA 2WXKA 2F0WA 2WLBA 1FMAD 5FK9C 3KWLA 1H9JA 3Q8BA 3ZGZA 3AE1B 3HZXA 1WWTA 3JAME 1O80A 1HRJA 2XIWA 3D4DA 2OHFA 3QB3A 2BA0A 1F2ZA 1ET9A 3J80L 1FD6A 3H94A 3GTJB 1YN4A 4LK0M 4RH6A 1F0ZA 5C0XJ 5D3IB 2AX5A 4DNTB 1UWMA 2ON8A 5JVG3 5M5WB 2WP8J 2F0HA 2EYJA 2KMMA 4G7ZC 2D5DA 3HKZB 4CGYB 3TP5A 3GTPB 1YNJC 1CZWA 2HQEA 1B9RA 1TQOA 3K59A 1GB1A 1HA6A 4DGZA 5KYLA 5J1ZA 1KAAA 5CORA 2EYMA 2F0PA 2KWDA 5C3XA 5HURA 3CWIA 3NVYA 3D3RA 2XWBB 1EZ8A 3C1EA 2PW5A 5I2XA 2BYTA 4R8IA 1DD2A 2BE5C 3VR6A 2R7ZB 3GQBA 3Q69A 2E2IB 1GUSA 5DEHA 3S16B 4IFDG 3G7LA 1D4BA 4BA1I 3AH7A 2DWQA 1K50A 2EYFA 1ENCA 1IKMA 1C77A 2LEKA 4C80A 3HS0C 3T53B 2PVGC 3QWNA 4B9XA 2IL8A 2QDBA 3FMCA 2VUMB 4MIUA 4RGNA 3Q22A 3ETRA 4PV1C 2HCCA 2ID0A 4RGMA 3TEWA 4X3SA 3E5SA 4N9TA 5CV9A 4YWGG 2Y5PA 2A6EC 2WIIB 2F0OA 3I9V1 4CQNA 4IFDH 2N55A 2R93B 1NUCA 1KRHA 2F0IA 4F88A 4QF4A 1MPEA 2V4DA 4KJOA 2NZ1D 3GV6A 3S2DB 3OPOA 4XT3B 4HN7A 2D9UA 5D14A 3VYSA 1QJOA 3M7NA 1HEZE 2L11A 2F4IA 1S5DD 1VF7A 2BA1A 4LK1C 1D6EC 4JWSC 2A5HA 1JWAD 1VDZA 3DUZA 1IL8A 2QCPX 3LX0A 1T3QA 4Y7NB 1FCCC 3I4NB 3BDCA 3DEOA 3FPPA 5JVH3 4CHTB 4ZUIA 1MHXA 1LT6D 3NVWA 4NDXA 3S1RB 2K01A 4MT5A 1H9SA 4HSPA 5EPLA 4IUQA 4WQMA 1HHVA 3K57A 1RWSA 4NAMA 1BOSA 2PMVA 3E9SA 2WXQA 2A69D 1EEFD 2NMQA 2A73B 3M7GA 1ZDXA 2JEAI 3K0YA 3MXPA 2YEPB 4C3JG 4DFAA 5I9OA 1SIJA 2EKIA 2BS4B 2XVSA 4TSSA 1JOKA 4L1BA 3K5MA 2GB1A 4HSVA 4K2KA 1K8OA 1LTRD 4OZBA 3HOVB 3V05A 1YMHE 2JEBI 1RDPD 2R92B 3OMCA 4MN3A 1F2RI 3VR5A 2B39A 1SDFA 1E7PB 2F0UA 5KEEA 4IUNA 4RAUC 5C3JB 4K8IA 1QOGA 4KKSA 2IPKD 1K52A 1ICWA 1ZP0B 2WAQB 1PLFA 3A54A 1WXQA 1K53A 4LJZC 2Q8IB 4H7BA 3NK9A 4O42A 1QLBB 1F2RC 2VB2X 3ZYYX 1V8CA 4FP5D 2DY7A 2G9DA 3PIP3 5ELBA 3Q8AA 1ZOYB 5ELFA 4C7ZA 5FO8B 3S1QB