4M01A

N terminal fragment(residues 245-575) of binding region of srap
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
321
structure length
321
Chain Sequence
AVTANTITVNKDNLKQYMTTSGNATYDQSTGIVTLTQDAYSQKGAITLGTRIDSNKSFHFSGKVNLGNKYEGHGNGGDGIGFAFSPGVLGETGLNGAAVGIGGLSNAFGFKLDTYHNTSKPNSAAKANADPSNVAGGGAFGAFVTTDSYGVATTYTSSSTADNAAKLNVQPTNNTFQDFDINYNGDTKVMTVKYAGQTWTRNISDWIAKSGTTNFSLSMTASTGGATNLQQVQFGTFEYTESAVTQVRYVDVTTGKDIIPPKTYSGNVDQVVTIDNQQSALTAKGYNYTSVDSSYASTYNDTNKTVKMTNAGQSVTYYFTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into SraP-Mediated Staphylococcus aureus Adhesion to Host Cells
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
molecule keywords Serine-rich adhesin for platelets
total genus 92
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18483 Bact_lectin Bacterial lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4m01A01
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 4m01A02
2EF6A 2WSVA 5GALA 5JOZA 1DQ2A 4YFWA 5LK5A 5T5OA 4XDQA 1BKZA 1IS3A 2YMZA 1LENA 3RMXA 4GA9A 4XIOA 4XJ8A 3VKFC 4YZ1A 5H9RA 1Z78A 2VH9A 5HCBA 1DQ4A 1LU2A 1CONA 2PELA 4XBLA 2D6MA 1WD3A 2JKBA 4XMIA 1CPMA 2AREA 2ZHLA 3OBRA 1G7YA 1WW5A 4C1XA 1S0JA 3N36A 2ZMNA 5GZEA 4XJZA 4R9BA 1QKQA 2ZGQA 5HCFA 3AYDA 1S0DA 3AZVA 1LOCA 1AXKA 1Q8QA 5CB7A 1ULDA 2EXIA 4AGRA 1JUIA 3ZSMA 3B69A 4BQ1A 2CWSA 3AZZA 1DGLA 3ASIA 3AXDA 3ILNA 1X50A 1GZCA 1SCSA 2E7TA 3JUUA 1LEDA 2HYKA 4XHXA 1GYKA 1N1YA 5H9QA 2WJSA 1VALA 1V6KA 1D0HA 1UZYA 1OFSA 1W6MB 4ISQA 2E7QA 3FUOA 5F5QA 1UMZA 3O5SA 4FPJA 4U36A 1ZA4A 5E8AA 1GZWA 1W6OB 1S0GA 5GZDA 3ZSJA 4AWDA 5T5PA 4Y1ZA 3AK0A 4CRQA 1SBEA 1YIFA 4XILA 3T1MA 2C9AA 2D6OX 2UURA 5GM0A 3WOGA 2ZGSA 1W6OA 3T1LA 3QLQA 4GXLA 3UK9A 1KDKA 1A3KA 1AX2A 1ENQA 3ZPYA 4AGVA 1WLWA 2UWBA 5JMCA 2OW4A 3AYAA 2DTYA 3O0VA 1IS5A 3OBTA 4MYEA 5DG1A 1WW7A 3D6EA 2A3WA 4RA0A 3N7MA 3POWA 2W08A 1AF9A 2WT1A 4ISRA 4YW3A 1ZM1A 1CESA 2ZMLA 2H0BA 2PHRA 4FPEA 5EWSA 5GLZA 2FMDA 3M3EA 5GLVA 3WUDA 1MZ6A 5E88A 3WG3A 1QOOA 3WG1A 2DU1A 2ZGLA 3ZXFA 2ZAAA 1QNWA 4YM1A 5T50A 4XJWA 4R9DA 4FPGA 4YFZA 1LEMA 3BIWE 3GNEA 1FAYA 3POYA 4Q2FA 2LALA 1DHKB 3M3QA 1QOTA 1DFQA 3VV1A 3WDVA 2P34A 5IK8A 4M3CB 4U2AA 3V0AB 1GV9A 1QNYA 1VIWB 1CQ9A 4AVVA 1N3PA 1SLLA 3PJQA 3MEPA 4LBQA 1JYIA 2P3KA 3USUB 4DFSA 3ZSLA 2CNAA 4XHBA 1RIRA 4M3CE 1ULFA 1UN1A 3HR9A 4L8QA 1IOAA 4UW4A 3LCPA 1LU1A 3AZXA 5HCAA 2WT2A 1YXWA 2ZACA 1DLLA 2P3JA 1MVEA 1H9WA 1V6IA 3USUA 2A3XA 3OGGA 3PMEA 1LHOA 1GZWB 4OZXA 2PHFA 1HQWA 4YW4A 2A6XA 2FHRA 1QF3A 1CPNA 3A0NA 1FX5A 2TEPA 2UWCA 5EYYA 1S0IA 3AYCA 1IKPA 3SH3A 3FFZA 3A0KA 3BOPA 1LULA 2CWMA 2R49A 5T52A 2NM1A 2D6PA 1EPWA 1YRZA 4HANA 1Q8SA 4Q1PA 3WG4A 1SLIA 5DUUA 1QDOA 2WNEA 2ZBJA 4P9XA 1CIWA 1MS4A 3R4UA 1MZ5A 1BYHA 1LGNA 4LBNA 2YXSA 4Y1UA 2D7FA 1F5FA 1FATA 5BYNA 2NP0A 3O0WA 1J1TA 3QCWA 4WV8A 2G4IA 3FLPA 3AYEA 5AVAA 2R1BA 2WKKA 1LOFA 4Y22B 4Y1XA 2ZMKA 4UW3A 5EYXA 1JN2P 4PBOA 1LOAA 3MW4A 5KXDA 3D4KA 4PCRA 1ULEA 2JD4A 1N1SA 3DUIA 3RRDA 2OUJA 1R1ZA 3V64A 1MS5A 1KITA 2AUYA 3R05A 2GNBA 4SLIA 4XTPA 4R9AA 1AX1A 1ENRA 3V0AA 3WCRA 2DVGA 3AP5A 5GJ6A 4ATFA 4RL7A 1I1EA 2ZA9A 4P14A 3HMYA 4FPCA 1OKQA 1SLBA 1A78A 3IPVB 1W6PB 4K1YA 1QGLA 1W6QB 2ZHNA 1PZ7A 2GNTA 4XIKA 3AZWA 3BODA 4UW6A 1ONAA 3IN9A 5KXEA 2OVUA 5EXOA 2EXHA 2GALA 3ZXEA 2GDFA 1DQ1A 4P9WA 4XE9A 3OJBA 1GZ9A 2D6LX 2YY1A 2AENA 2ZGUA 3NWKA 2DYCA 2D6NA 4D69A 1N1TA 3WHUA 1N3OA 3D5OA 1C57A 1WCSA 2DU0A 1GKBA 3BTAA 3ATGA 1KQRA 4AVTA 3POSA 2A5ZA 3AXEA 1DZQA 4GKXA 1C4RA 2NZ9A 1OQ1A 3WDYA 3SH5A 1V6OA 5E89A 1U0AA 2VU9A 4ITCA 1CN1A 1SACA 2D43A 1FV3A 1A8DA 5KXBA 2GMEA 4FP3A 4FQZA 4FVVA 2GN7A 2P37A 2R1DA 2ZGKA 3AP4A 4CTEA 2ZKNA 4YZ3A 1W6NB 1HKDA 1DQ6A 2ZGRA 3FLTA 3N3HA 1BJQA 5T5JA 4AGGA 5DG2A 4M00A 4BLIA 3CNAA 1MS8A 1G8WA 3AZYA 3FUQA 2B7YA 1LHWA 4K20A 4Z8BA 1LODA 4NOTA 1W6NA 2E53A 1DQ5A 1V6JA 2DURA 1FYUA 3M3OA 5JVVA 4ATEA 3R4SA 2CY6A 2ZABA 3NV4A 1WW4A 4XZPA 2A3YA 1AXYA 1Q8VA 3GALA 3AP9A 4FQ4A 4TYSA 4XYXA 1D2SA 3VKLA 1SBFA 1O4YA 5KXCA 4Y22A 1MS1A 1IS4A 5CNAA 1GANA 2ZHKA 4UW5A 4YG3A 1UZZA 4I30A 5SV8A 5IK4A 1CJPA 1GNHA 3ZXJA 2GMMA 3RSJA 2YROA 3LSDA 2CYFA 4XOGA 3W59A 3WG2A 4YM3A 1Y7BA 1URXA 2ENRA 3SISA 4XJAA 3T2TA 4YG6A 2WT0A 4XXPA 2V5YA 5JDBA 1DIWA 1MS3A 1AJKA 4CZSA 5IT6A 2A6ZA 2DVAA 1B09A 4BM8A 4XMAA 3WZ1A 4XTMA 2KYWA 3O12A 2JE7A 1V6MA 1WBFA 1KDMA 4WVVA 2XB6C 1YI7A 4Y26A 2I2SA 2BQPA 1W6QA 1LTEA 2PHWA 1UL9A 1VLNA 1S0FA 2A6WA 1G9AA 4M3CA 3UJQA 1F9KA 3Q9OA 2DUQA 3DGTA 2KT7A 3WHTA 2R0FA 2UU8A 3ENRA 3WDWA 4AVSA 5F9TA 4YGCA 5IK5A 3VKOA 3O0XA 3I4IA 4IQPA 2ARBA 2VXRA 1WBLA 1SFYA 1UKGA 2EALA 4Y1YA 2SBAA 3WCSA 2A6VA 2DUPA 4FPKA 2PHUA 2D44A 3SNMA 1UX6A 3N35A 4K21A 2W39A 2E51A 3B9CA 4XXAA 1LHNA 1LOGA 3WNXA 2EXKA 1NXD1 2XG3A 1JOJA 1RINA 2DVDA 3AJZA 4W65A 3WUCA 3ZXLA 1W0OA 1LCLA 1S0BA 4DRRA 2NMNA 3VKNA 5JOWA 2Z42A 2ZZJA 1CR7A 2NN8A 1CVNA 3JU9A 2GNDA 2VUAA 2VY0A 4Y1VA 1FV2A 4PF5A 3LSEA 5FREA 3ZSKA 2KM2A 3N7JA 1JW6A 1S0CA 1NLSA 3MW2A 2VW2A 3NV3A 2P2KA 2D3RA 2ZGMA 2DVBA 2AGSA 4WVWA 5DUWA 1KRIA 3AX4A 1MS0A 1GLHA 2W68A 4LBOA 2CTVA 1RITA 1UAIA 3PVOA 1SCRA 5DUVA 5DZFA 1WLCA 1N1VA 2PHXA 3B00A 4FOQA 4FPYA 5FRAA 1QDCA 4H55A 1F31A 4Q26A 1VAVA 4ASMB 2JECA 4DPNA 1DYKA 3V65A 1H30A 1LGCA 3AJYA 3MW3A 1N47A 4P9YA 1GSLA 4PBPA 4BLJA 2JJ6A 3M3CA 2DUOA 3N7LA 4FOVA 1PZ9A 4LBMA 1LHVA 4XJUA 4DS0A 2AR6A 3NV1A 2P3IA 1HDKA 4JCKA 3UL2A 5JOXA 1KJRA 1GICA 1YO8A 1QOSA 2WSUA 2A6YA 2EAKA 3C2UA 5JLVA 1HLCA 4GWMA 5H9PA 1JHNA 5GZFA 2RHPA 1GNZA 5GLWA 3IPVA 2OUHA 4AYUA 4NO4A 3PVNA 2ZGPA 5GLTA 2VW0A 2A7AA 4FP2A 1C1FA 2R0HA 1LJ7A 2NYYA 3B01A 3TAYA 3ZXKA 1Q8OA 1C1LA 4BPZA 5T55A 1SLAA 1V6NA 1VAMA 3RS6A 4Y20A 3V0BB 1DBNA 1YYNA 3AP7A 3AFKA 3RG0A 3WDTA 3OY8B 5GLUA 1IKQA 1V00A 3VKMA 3IM0A 1XQNA 4GKYA 1LECA 3TB0A 3HN1A 1QMJA 2W52A 4YGBA 3OYWB 2A75A 3ZVXA 1GBGA 5IUQA 1TEIA 2A71A 4BMBA 4ZKTB 1LOEA 3SLIA 3KM5A 4YZ2A 2V73A 4ZXKA 1AJOA 3WLUA 2R16A 5IK7A 3ILFA 1BQPA 1HQLA 1MACA 2DTWA 4LBLA 2CL2A 2SLIA 4YZ4A 1LHUA 2WQZC 3OYWA 2Q5TA 1MS9A 4LBQB 3RMYA 1ULGA 4C1WA 2WLQA 3KQRA 2UWAA 1JBCA 1APNA 1I3HA 4TZDA 3W58A 1WUVA 1SLCA 2KVZA 5GZGA 3IKWA 2DV9A 3FLRA 4GWNA 1AXZA 1G86A 1WLDA 1WW6A 3ZYRA 1V6LA 2D3PA 3PVEA 4FPHA 1BXHA 5DZGA 2ARXA 2ZGOA 4JRAA 4KBBA 2VW1A 4F83A 1G9BA 1MVQA 1G9CA 4FPOB 4FPLA 5CBLA 3H0OA 4Q27A 4R9CA 5DZEA 3IMNA 1SBDA 2GMPA 3FBYA 2GNMA 4XBQA 4BMEA 4PQ9A 4FPFA 3VUOA 1ULCA 4FOWA 4M01A 3A4UA 4YZ5A 3WV6A 3ILRA 4DQAA 3AP6A 5T54A 4Y24A 1DQ0A 4HL0A 2ES3A 3WDXA 1MR5A 1W6PA 5CA6A 4M3CF 4YM0A 1PZ8A 1SLTA 1JXNA 4Q1RA 2DWRA 3RQ0A 4YG0A 3M1HA 4WZFA 2PHTA 1QU0A 2A70A 2C5DA 1LESA 1N3QA 4YLZA 1Q8PA 3APBA 5DUXA 1AX0A 3SH4A 3B3QE 3WVJA 2LTNA 3INAA 2ERFA 2E6VA 2EXJA 1G9DA 1ENSA 4BOWA 2JE9A 3U4XA 3L2YA 4YM2A 4K1ZA 1W6MA 5GZCA 4M02A 1KJLA 1G9FA 2EIGA 5CAZA 4YW1A 1S0EA 1BZWA 2NMOA 5T5LA 1JYCA 2ZHMA 1AVBA 4Y20B 2ZGTA 4YGEA 1LOBA 3M2MA 4LBQD 3MPPG 2AH2A 3OY8A 4XBNA 1FNZA 4Q8KA 2AYHA 2D6KA 4GALA 1WD4A 4LBJA 4LBKA 3I8TA 2YZ4A 1LGBA 2JDZA 3V0BA 4Q8LA 2GN3A 1AZDA 1Z0HA 4XJ9A 4FOYA 5L73A 1LOFC 3ZYPA 1H9PA 1DYPA 4YW5A 5JOYA 2ZGNA 5H9SA 4DRVA 1S1AA 1W0PA 2DVFA 3UJOA 2YV8A 2D3SA 3N7KA 3SITA 5DXDA 1FNYA 4YGDA 1UPSA 3NV2A 3WDUA 3OPZA 4JC1A 1O4ZA 1Q56A 1IS6A 4YW2A
chains in the Genus database with same CATH superfamily
1H6XA 2WHIA 1IS3A 3UGFA 4OYUA 2WLPA 2G4SA 2VH1A 4GIVA 4BE3A 5D8AC 5IATA 4WVZA 4GB33 3N30A 3UYJA 2XJSA 1YQ6A 2FCVA 1QKQA 5LA0A 1PO13 1AXKA 1W2NA 3ZSMA 4XACA 2JZ3B 1DGLA 3ZYIB 4QQPA 1W8ZA 3DBRI 2N7GA 4G0NB 3NZUA 1OUXA 3P5BA 2LUWA 3RNEC 1Q3EA 3TEXA 4AWDA 2R043 4EZLA 3D0JA 3ZFEB 3IT4B 2RR11 1OPOA 2Y6GA 1XNDA 1POV3 1D4M1 4PT6A 3NVZA 2UWBA 4WWNA 3PDQA 3JB8A 3VB9A 3JBG2 5L83A 2YC2A 4OZAA 1N61A 1BBT1 3WG3A 2WDVB 4XQ4A 5T50A 1YIWA 4AQ7A 1C3HA 3GBWA 3P3PA 5D2MB 1UUPA 1N3PA 3DWGC 3USUB 3ZSLA 4K40A 2J22A 3VBUC 4UFMA 3M62B 2P3JA 4KBZA 5HHDG 3CIHA 3EMRA 5FYUA 5FZIA 2W2IA 1ASJ3 1H8TB 3AMHA 5HG2A 2LGXA 4P9XA 4G4FA 3N4MA 3PLUA 2DBYA 1F5FA 4YW6A 3O0WA 1J1TA 3QCWA 1NYQA 1OQYA 1J3PA 3O1RA 3RMKC 2VOKA 3T09A 1LOFA 1NOVA 4DUXA 1J3RA 1M94A 2R30A 4CVUA 4AI1A 4S2HA 2OUJA 3H7PA 4ZS2A 5GJ6A 4XUTA 2WBKA 2BNOA 1A78A 3IPVB 2C60A 1W6QB 3RFZB 2Z0DB 2QILA 1UYXA 2J1RA 1GZ9A 4Q4W1 5LA2A 2CDPA 3H9AA 3ENEA 1EP0A 4JTOA 2A5ZA 2W92A 1C8M1 4HMZA 3WP3A 3ABZA 4ITCA 5FYMA 4X6RB 1SACA 2WRAA 4HKOA 4CDXA 3GGLA 4P5HA 2E6XA 3VBFA 4M00A 4Z92B 5BNNB 4NIGA 2E53A 1AARA 3CEWA 3L16A 1JRPA 1IYFA 4P1CC 2ZABA 1GNUA 3KT7A 3VKLA 4ZYSA 3QCAA 1QH7A 2LHEA 2UYAA 1QKZA 4KSLC 4ZRQA 4YM3A 5LB6A 4K7WA 2DBNA 2ID4A 3B2FA 4XXPA 3ZN6B 3THDA 1FPN2 1G6JA 1NEKB 3MPBA 2QJVA 4B4RA 1QQP1 4YWGG 2PHWA 1VLNA 1ZE3D 4XABA 3GM8A 1H4HA 1FMD2 4GWIA 4IQPA 4KZCA 4AAPA 2VZUA 4XXAA 4LORA 4W65A 1ZA7A 5E6PA 5EE3A 5JOWA 2O6VD 3BPSA 3FHQA 2JU6X 1AR81 4XDDA 1WXVA 3J7MA 2BWES 1WIAA 1F31A 1VAVA 4ASMB 1MEC1 2FDGA 1KH0A 3O13A 4NROA 5FXZA 1V9U3 1TKEA 4GMVA 5JOXA 1R1A2 2PAKA 4JVAA 1WI0A 2A6YA 3NL1A 3VRBB 1SE4A 1GNZA 2DZIA 3LDZE 4WAAA 2OUHA 4PHZA 4NZLB 4Q4W2 3ZXKA 1AR73 4Y20A 4NHXA 3SKJE 1BVVA 3RG0A 2W95A 4A90A 4IESA 3JB4C 3AEEB 4GXBA 1J59A 3ECIA 1L0YB 4CDXC 5F39A 4AHXA 4IEPA 2QE3A 1P8JA 2JXXA 4LBLA 2K1FA 1LHUA 3QWZB 2WLQA 5DCNA 2ET7A 1JBCA 2PLV1 1WUVA 3P1IA 1F77A 1AXZA 3I2IA 5BYSA 3M8LA 1G9CA 5CBLA 3VUWA 1JUHA 2BS4B 2QHOA 2AC1A 5AZGA 1GOGA 2XH6A 4YZ5A 5G5GA 3AP6A 3N9MA 4ES8A 4QQHA 5CA6A 4KWUA 1LESA 1HTOA 4EKUA 1EPZA 5KHGA 1L7RA 1FEHA 2FBWB 4NHYA 1T0YA 5C3OA 4NPNA 3RNFC 2EIGA 4FXCA 2XLFA 1AVBA 1LOBA 1OD3A 4Q5OA 1F2NA 1QWRA 2YZ4A 3V0BA 2XEWA 4CDWB 3R6SA 2UYZB 4HPPA 4YW5A 2ZGNA 3P4PB 3ZX7A 3DKQA 3AB0A 1WMDA 4YW2A 2FD8A 4XDQA 2ETEA 1WR6E 4XIOA 3QX1A 4YZ1A 3O1VA 1UH6A 1FNUA 2XL7A 2JG9C 1R091 1CPMA 5CHFA 3RYPA 4K7UA 1VBA3 2QCZA 5LRSA 2QFEA 3AYDA 1US3A 1WXQA 2VNVA 1ZZ9A 1Q8QA 3ZYBA 4W9HA 4HWIB 3PIJA 2WJSA 4FJZA 5FP4A 1IQAA 3AN1A 2WZR1 4S0RA 5L36A 2BNNA 1FMAD 4AVAA 1V9U2 1W6OB 3ZDMC 3ZMOA 1BXTA 2WWUA 2BS3B 2KTRB 5DQ0A 3AMNA 4CEWB 4WM8B 5L7OB 2LEKA 4ZDVA 4IWQA 4CCCA 4PT5A 2RMU3 2WT1A 3PRMB 1UOJA 3A21A 1SE2A 1GC7A 3LEGA 4IEXA 5EIYB 3FILB 3AU4A 4A4AA 2CNAA 3WAPA 2M0AA 4L8QA 2JDKA 3ORJA 2VAUA 1YXWA 2ZACA 1FRDA 2RPQA 1FOD1 1PVC1 1QJFA 2WO2A 3FC4A 1ZOYB 2OYZA 4BK5A 3A0KA 5C70A 1LULA 2D6PA 1YN4A 1GOZA 2ZMKA 5EYXA 4L97A 2JG8A 1Q10A 3DUIA 1X1MA 2Y5CA 2BBVA 1AX1A 2DVGA 2N0SB 4ATFA 1TME3 2D5HA 4I6PA 2Q1MA 3ZYJB 5BNOA 1L5PA 3L2HA 3ES1A 4F8CB 3L0WB 4L0PA 4FULA 2D6LX 2XUEA 4AJYB 4QX5A 4MUVA 1EF5A 2QQMA 1RMU1 3RJRA 1SE3A 3ATGA 2EKIA 2NZ9A 3N9YC 1C3TA 4ZZ5A 1POV1 3GB1A 1MQTB 3BN6A 5JMOA 4AHYA 3AVRA 1ASJ1 4ZS3A 4LITA 5FMOL 3H3ZA 2WQ8A 3LF7A 2XVGA 2FCNA 3ML8A 1FYUA 3KV9A 1UWMA 2RM21 3GALA 2BPA2 1UZXB 1SBFA 4BAXA 3KUCB 2GC1A 4LKDA 2ZXQA 4BZAA 3S5QA 1OGWA 4XOGA 5FY9A 3RYTA 2ZX2A 5C3RA 3EO6A 2P6HA 1VZ8A 5C9AB 5F3EA 1I7HA 1Y9QA 3H6NA 3VHTC 5HPOA 1OTRB 1G9AA 2W91A 1Z5SB 5A7WA 1PM7A 2VPVA 3KCXA 5F1RA 4IDIA 1ZNPA 3AE5B 1RINA 2QBXA 3AJZA 5CX3A 1X9TA 2RGFA 1S0BA 4NJCA 4CEWA 2NMNA 1BK1A 4AJWA 5J96B 2N9EB 1FV2A 4AR2A 1W9TA 3T2QA 2D3RA 3LB8C 1XQQA 1WJ6A 4US9A 3PVOA 1N1VA 5ACA3 1GWKA 1P7EA 2JDAA 3BVCA 1PFDA 1WR1A 4NIHA 1LGRA 4JCKA 3M63B 4ORFA 2B3AA 3WP4A 4MG2A 1RUI1 1D3ZA 1ZRDA 2IGGA 5EE1A 1YJ1A 1JWAD 2JXTA 3TAYA 4OI0A 4IV3C 1VAMA 2BFUL 2PTLA 1HRV2 3AP7A 1WXAA 3AMMA 2QEJC 4B7EA 4XUQA 3VDDB 1V97A 4TXWA 2D11A 2R16A 5IK7A 4DXFA 4A6SA 1XNCA 3L08A 2DV9A 4MGKE 1WLDA 2WNMA 4PS3A 3PVEA 2GC3A 4GB9A 4TLGA 4CSWA 1W2OA 3H0OA 4NAWA 2WX0A 3BTYA 2J7QB 1V0AA 3SDLC 3WV6A 1FXTB 3N32A 1M4WA 2YPDA 4M3CF 5A7NA 4XAAA 2DWRA 3R2TA 3PNAA 3WAMA 4BZ4A 1AX0A 4GMP0 2O6VB 3MGUA 4FTSA 1C5IA 3TUOA 2JRHA 4M02A 4JIOU 5ABJC 1BZWA 1REFA 4QQ2A 3PU3A 2PHLA 1QJZA 4TLFA 4Q8KA 3N9PA 3S7EA 2KTRA 4HN0A 5IVFA 3VD7A 5EPAA 3SCGA 4FFHA 3WNKA 1VZ6A 3CDZB 2YV8A 5ACA2 1T6GC 4ONUA 2I45A 4WQOB 1O4ZA 3GZAA 2FDIA 3R7RA 3PURA 3K4DA 2W3RA 2GC2A 3NNLA 3WF1A 3AECB 1ZRIA 2MBHA 2ZHLA 5CZKA 5K7PA 5G04L 3NRZA 1JHJA 1TIFA 1IGDA 3I2JA 2ZPNA 1GQGA 4JV4A 1W2AX 2K8BA 4QGMA 4B8EA 3JZVA 4IGOA 2BTVC 2AQ1B 2ZAHA 2E7TA 4FAHA 1O91A 2Q8OA 1L3JA 1ZA4A 5E8AA 5FBJA 3VH4B 3KCCA 2FCQA 4A9AA 4WM8A 1SZBA 1AR82 1PIV3 2D6OX 2UURA 5DPTA 3FWEA 4XFGA 1BCXA 2OW4A 3THPA 2CGOA 2W5FA 4IM2A 2ZMLA 1O4TA 2H0BA 4QHOA 2WXJA 4FHKA 1VB2A 4NIDA 2OJWA 4Q0VA 1MVKA 2VMGA 5LBCA 3KZ4C 3DHIC 2XUMA 3S57A 3E5UA 3IT8A 3B9JA 1FT9A 1X36A 4RD7A 3RNCC 3SEEA 1PO12 2DFBA 4ASWC 1OC1A 4OVEA 4LIVA 2E9QA 2O0OA 4GDLA 3BTZA 2UWCA 2MCNB 5FR3A 2HWD1 2OPKA 2V4AA 3R66C 4HANA 3WG4A 1SLIA 3W5MA 2LD9A 4LUKA 1BYHA 2JG8B 1N62A 1FATA 1KJTA 3AYEA 3H8OA 4Y1XA 4KU8A 4N59A 3FZ3A 1RYYA 1P98A 3FILA 3V64A 3OUJA 2Y38A 3RNAC 2RM22 2BB6A 1MPEA 3V0AA 1RUE2 2JWPA 2DHZA 1ISNA 3GZEA 2KWDA 3HMYA 3GE8C 3NUHB 1L7YA 1FXAA 4ZXEA 3VHPA 4LMFA 1YJKA 1GR3A 1N1TA 5FZ3A 1K8RB 4M8NA 3BTAA 3VD9A 5KHHA 3AXEA 3UT0A 4BQWA 1VRH2 4FVVA 3AP4A 2GI9A 3JVZX 1GQPA 1AYN1 4URAA 1JYVA 1S55A 3MI8A 4YYOA 4XETA 4C4VB 4LLGM 2WNVB 3IXSA 3RZJA 1O4YA 5FYTA 1MS1A 1CJDA 5IVEA 2ZHKA 1ZDXA 1FI2A 2LI5A 3AE6B 3PGEA 1HZ6A 1OXCA 2MPFA 3A1QA 2ZTNA 2JF5A 2EIEA 4XTMA 2XBBC 3ZN6A 1TGZB 3OGRA 1V86A 1PGBA 2A6WA 5L9VA 3QK0A 2L8JA 1JODA 2ZCBA 4L92A 4NWWA 2W55A 1PX3A 2OQ7A 2X5IC 5FZFA 4QXCA 3DPRC 3BOWA 1PNFA 2K3UA 4AF9A 3NJYA 4HCNB 4BQYA 3BK2A 1JOJA 4IV3B 5IVCA 3NKTA 2X05A 1CZVA 3GHMA 3ZFEA 1FD6A 3TNQA 2DVBA 1HB3A 3A9JA 4G3XB 1UAIA 4XC9A 1SCRA 4FPYA 4Q26A 1IP9A 2UU7A 2KLCA 1VCBA 4P9YA 1BMV1 2MEV2 1CZTA 1UBQA 4NUBA 4XX5A 2XR4A 2VZKB 4QDRA 1UF0A 4OULA 2WL1A 4HPKB 4BDVB 1DCSA 2HTHA 4N58A 1W8TA 1TNFA 1R081 1PHMA 4EQVA 4BPZA 4FXKB 2KJHB 1YQCA 1DBNA 2XOMA 1NUKA 3AFKA 2R7EB 4DOUA 4WH4A 4GKYA 1UX7A 4LKFA 4YGBA 2ZW0A 2IO3B 3UQBA 4A6QA 2HTME 4ZXKA 2ORZA 1H2KA 2CL2A 1RUOA 3CQOA 3DL3A 2R062 2G3QB 1TTNA 1COV3 4IOIE 1HXS1 2MLBA 4RMAA 5F32A 4FPHA 4S2GA 1V1PA 4W9JA 3I49A 1YX6B 4FPOB 2BZDA 2JQRB 1FRRA 2GLSA 1RUI3 5B2GB 1WJUA 3WEZA 2E33A 3BPZA 4GLSC 3WDXA 1MR5A 2AL6A 2WO1A 4CDUB 1RUNA 2WQ4A 1PK6C 3DV8A 3AKPA 1KFXL 5T5LA 1HRI2 4CP9B 2ZHMA 3M2MA 1CAWA 4S17A 4OHJA 3MV01 5FZGA 5E6NA 3QHTA 3A9KA 2PQSA 2ZZQA 3A7QA 1UELA 3HM6X 4YGDA 5KR7A 2LRPA 4DXTA 1T2XA 1U12A 1YD8U 1BKZA 3BYTB 1YQ3B 3KLSA 5H9RA 3NS1A 1C8M2 4WURA 3NHEB 3LDBA 5B4XA 4A3OA 4NPRA 3IVFA 4J1WA 3HT1A 3C7EA 1IPJA 1YLLA 4K3UA 3WANA 3AXDA 4S2DA 4JGZC 4DUWA 3U7ZA 3C3VA 3VBFB 3U11A 1GP4A 2RDGA 4Q4Y2 5I0TA 1M06G 3NZSA 4JX0A 1EV11 4FPJA 4OVZA 1UO9A 4CDQA 2BU9A 4RNAA 5GZDA 1SEFA 3FFQA 1YIFA 3ZXDA 1RUJ3 2VZ1A 3PUIA 1WLWA 4EYUA 2H6BA 2CHXA 3D6EA 3NJZA 2PLPA 4Q2JA 4UFIA 3M3EA 4O1NA 2M4NA 2DWQA 1CX4A 2B8MA 2PHDA 3BU7A 4MV2A 3U52E 2N7DA 3TNPB 1QOTA 3MJWA 1QNYA 4RQPC 3UGBB 4WM8C 3SEPA 2IXKA 2KOXA 3IIIA 3EJKA 3IHPC 3AMPA 2CV6A 3MDPA 3WNOA 1VBA2 3HN3A 4ZY9A 5AEKB 3Q69A 4OHZA 3BOPA 2GRIA 1EPWA 1AR92 2WNEA 1VAKA 2R2QA 1HX6A 4LBNA 2JX9A 2BV4A 3VR8B 2C9WB 1PGXA 2Y6LA 3DKWA 2R1BA 5LCWL 1D5MC 1LOAA 1QJEA 2V09A 1FM0D 2JD4A 1BK0A 3KV4A 1CZSA 3DEMA 3D32A 4DEVA 5C23A 4QD2A 1Y3TA 4RL7A 2KWCA 3BGAA 4TQ0A 3T3OA 3BODA 1ONAA 2HWC2 5KXEA 5EXOA 4LOTA 3PS6A 4XE9A 2AENA 1EU3A 3RGBA 4B7KA 4ZPIA 2VR4A 5BMIA 3LKJA 4LCDE 4IKGA 5DPWA 4JDNA 2BUKA 2WA4A 3C7HA 2VU9A 2G45B 3C8YA 2D43A 5KXBA 1A8DA 2GMEA 4DNYA 1A8MA 1XBFA 2INCC 4JAAA 4OHYA 2XN9C 2OXBA 2AX5A 2ASQA 3KD4A 5FPAA 4QKDA 2L0TA 4IG7B 4A2UA 2VZVA 4GZ9A 1YI9A 3VLBB 2VE1A 1IG0A 4XZPA 1VR3A 1EAH1 4OZBA 3HNMA 1AYM1 2VULA 3KGLA 1K5MA 4XF1A 3LSDA 4KWJA 4LK6A 4WM7A 4YG6A 1V1PB 3J8F2 2PMVA 4V2VA 1B09A 3ZLZA 1KDMA 4RSUA 4BFRA 3ZVVA 2A5UA 1KXGA 1OF4A 3Q9OA 5IP4D 2DUQA 2KT7A 1L0VB 5IK5A 3VKOA 4UAPA 1CWPA 3UNPA 2WXRA 1SFYA 2SBAA 2DUPA 3WP5A 1FXZA 3VBRA 2E51A 3OPWA 4GJZA 5D6JB 3VKNA 1NA1B 2RS31 3H7YA 1CR7A 3K46A 4IE7A 2EMSA 1AR91 2ZPYA 3AMZA 2DENB 1OH3A 1MPXA 2K9XA 2XGXA 3KCYA 2VCMA 4DZGA 4DPNA 2BVCA 5T3NA 2IXLA 2P3IA 1OOPA 5LA9A 4LNVA 4JLCA 5D7GA 5H9PA 5GZFA 2RHPA 1R4NI 4Z2AA 5AUIA 4AEDB 1YYNA 3N9LA 1XQNA 1M4VA 4IEOA 2KD0A 1U5YA 4KGQA 2ZVOA 4BMBA 4LLFA 3X29B 1RVF1 3MBWA 3PUAA 1N5WA 3RZZA 2CKHB 2IGHA 4C1WA 1MS9A 3VL9A 3TEWA 4HONA 1GOFA 2QQVA 2LJIA 1ND3A 1AYN2 1YEWA 1G6NA 4A44A 2V4LA 1S2KA 4LNIA 4HDQA 1BXHA 4SBVA 3K51A 4KBBA 1G9BA 1JW9D 4EZJA 4F8AA 2ZEWA 4NNJB 4WQMA 2GNMA 3H8HA 4US8A 3R2IA 3JW0X 2AL3A 2VBDA 2BS2B 4Y24A 2VBPA 2DLBA 2C5DA 4COZA 3MIFA 2Z5WA 1LAJA 2D3BA 1Q1OA 1Y4WA 4IXLA 1KJLA 4AG4A 4XUPA 4YW1A 4RFRB 2YPJA 2KN5A 5FZBA 4CDWA 3P3NA 2CHHA 4KKIA 1YQBA 1UF2C 5F6KA 4CCMA 2MP2A 1VRH1 4XURA 5A6QA 4IV1B 2RS52 2D3SA 5CFCA 2K46A 1NKGA 1Q56A 2Q5WD 3ZLIA 1PMIA 3IIAA 1WRIA 5FO8B 2PELA 2B45X 2AREA 3OBRA 1G7YA 1K51A 4QHBA 3QARA 2V5DA 4YNIA 3SC7X 2DAFA 4NRPA 2CU5A 4AGRA 1VRBA 2P3YA 4QX2A 4YW7A 4UDUC 2DFCA 3VBRB 3TJPA 2RDHA 3HVZA 1KOTA 3DWMA 1ZBE3 1CX1A 1D0HA 1UZYA 1F4HA 2P17A 3C0RB 5F5QA 1CIYA 4EOYA 5FZEA 4EE2A 1GZWA 3KV6A 1S0GA 1ZZBA 4UYBA 3ZSJA 4Y1ZA 5GM0A 4JHZA 4D94A 3RDIA 2YEPF 4QB1A 5FZ7A 2B42B 3JBG3 4FO9A 1I9RA 1BMLC 3O0VA 1AYFA 3ZNHB 1WW7A 4DBGA 2PHRA 2Y5BB 3W20A 1BVP1 1CD3G 1WMHB 2ZGLA 2ZAAA 1KLVA 3E5XA 1LEMA 1XT9B 4F3JA 1UY2A 2GZWA 3IB3A 2VXJA 2VM9A 4DFSA 4M3CE 1R1A1 3HR9A 4JQRA 4CU8A 4XUOA 2Z79A 2A6XA 4BKGA 3AYCA 5G5HA 4E2QA 4UWDA 5ACA1 1UD7A 5LBEA 2IY0B 2LRUA 5EDSA 5DUUA 2JVCA 2RJ2A 1MS4A 2AZ5A 2GSYA 4XFFA 5A7PA 5DN2A 4E2GA 2RR13 2WKKA 5FZ0A 5KXDA 1R1ZA 1KITA 2DZKA 2V3SA 1V49A 4R9AA 1UWWA 3AP5A 2ZA9A 4P14A 1E9MA 1PZ7A 2AACA 1W99A 1CZPA 3A33B 1ESFA 3CSTA 3H1MA 4RGGA 3KUZA 5J37A 3TMPB 3POSA 4EEWA 4CCJA 3ZIWA 3HPNA 3VTUA 5E89A 1U0AA 4A55A 4IEQA 3MYXA 4PIXA 1Z7S3 1OQRA 1XF5L 3MLLA 2BOJA 4OMCA 1KLUD 2W46A 3AFGA 2MNGA 4BLIA 1MS8A 2HKXA 5JXJA 3GCXA 3FUQA 3K9OB 4LR4A 5K0UB 4I3GA 1NT0A 3WNMA 5FPVA 2JWZA 1ZGUB 1AXYA 1Q8VA 4TYSA 4Y22A 3VGIA 2OEDA 5LXHA 1YQ8A 5FYIA 4ARCA 3SFDB 4YSXB 3WG2A 5GMVA 5DDJ3 1URXA 1OFNA 4XJAA 3LJ3A 1ZW7A 4XF9A 2GB1A 3DBSA 2KYWA 4MGQA 3HBKA 2LGSA 1OPMA 4GULA 1WGYA 1DF0A 4N43A 1C8NA 2VXRA 3MC0B 1VD2A 4RQPB 1QJY3 2R063 1E6EB 1FIQA 3B9CA 1FCCC 1LOGA 2RR12 2EXKA 2XG3A 5FPXA 3ZXLA 1W0OA 3ROUA 3DHHC 4QAYA 4E27A 4PLOA 2RMU2 4XE0A 1S0CA 1NLSA 2BB5A 3HM3A 3HIZA 4TTGA 2FQPA 1W9YA 1WLCA 1AYM3 4W6YA 1JYXA 1QDCA 3PZ7A 3I59B 1TZ1A 3DDCB 1H30A 1LGCA 5C4WA 2GH8A 2JJ6A 3DHGC 2DUOA 3OEBA 1RJ7A 3ZXAC 2P1BA 1L7LA 3LOIA 2W47A 4HVQA 3O1OA 4XDPA 4B6WA 4QX7A 3T08A 2WS93 4DB5A 3SCHA 5B4NA 1I4PA 3PO0A 1C1FA 1Q8OA 1C1LA 4FSJA 1OLQA 2KTFA 2JDNA 1YFYA 5BNOC 3AC0A 5F5CA 2MEKA 2VUJA 4K6BA 2MP2B 3OYWB 4IM0A 2OT7A 1A6CA 5FY5A 3ILFA 3HNBM 3M95A 1DZRA 3O7OA 4D7TA 3I59A 3UV9A 3W58A 5CISA 3H7SA 1G86A 4CCKA 1L4DB 3SR6A 3AI5A 4XWWA 4JRAA 3Q8CA 3DCQA 4R9CA 1RMU2 5DZEA 3IMNA 2W82A 5C8CB 1OEYA 5FZDA 4BMEA 5E1RA 1UZWA 4AL9A 3VUOA 3VBHA 1NQDA 1P3QU 2KFJA 2HWC1 3WW2A 1JXNA 1OD5A 2A4ZA 5HI0A 1Q8PA 1K3IA 2UYBA 5I8YA 2E6VA 2BYVE 4JGZB 1N5XA 3L2YA 2JX5A 4YM2A 1PX4A 4MSVA 5FUIA 4FBFA 4MM3A 1NQJA 5C6CA 2YGLA 2QC8A 4W9DA 2RS11 4W6WA 2M8SA 4FHJA 2WDRB 1Z0HA 5C71A 1IPKA 1YN5A 4W9GA 3KHBA 3RZKA 4JC1A 3LPFA 1DGWX 1DQ2A 5JHAA 1R4MB 4LULA 4YSFA 5HCBA 1JWSD 5FZLA 2XJUA 2LW8A 1JZ5A 2ILMA 4NAWB 2VD7A 4GMP3 5GZEA 3W5UB 5D21A 1J7CA 5EJ1B 4O61A 2PEAA 4ET7A 1LOCA 5BNPA 3HIFA 2YEPB 2RM23 1OOPB 5JPNB 3ILNA 1JZ3A 1BBT3 3W1SA 2O14A 4AFCA 1RGSA 4C7ZA 3D8CA 1JWMD 3PUSA 1VBD3 3KF5A 4N90A 2YC4A 1RRBA 3EGRA 4NRMA 2C9AA 2Y5PA 2ZW1A 2VMEA 4P9IA 3WSOA 1RUG1 2IZWA 4AI3A 4XQWA 1TS4A 1TJEA 1IS5A 1MI0A 1AR61 5EWSA 2PXJA 5IYYA 2DU1A 3GNEA 1I42A 2WUHA 3B5LB 3VV1A 5IK8A 3PJYA 2VZRA 3HUIA 4AFMA 3BCWA 3DPRB 1VBB2 5AC92 3MIHA 1I4QA 1LU1A 2XHNA 3LPGA 2JEMA 3OGGA 3T2PA 2VGDA 3AM2A 4ZU7A 4KIKA 3MFCA 1C4CA 3MHSD 1ND2B 1S0IA 1UGJA 1UMIA 3VXWA 3FFZA 2CWMA 2L7RA 5T52A 4AEJA 2INNE 2VL4A 4G3YC 3QD6A 4URTA 5AVAA 4Y22B 1TVGA 2ZX1A 4PBOA 1XE8A 1N1SA 3I5JC 3VZLA 5FYYA 4ARIA 5TSWA 5BY5A 2VZ3A 4TMAB 2GNBA 3WCRA 5AVPA 5FWJA 3WF2A 1QXJA 1VBC2 4OMDA 3GBGA 1LQBA 3RWKX 5IOIA 3TN92 1VBE2 3AVSA 3T0AA 3PHMA 1KS4A 2VVDA 4AEDC 2CAUA 2DU0A 3R3MA 3F95A 4Q4V3 1C4RA 3WDYA 1K50A 2I07B 4OQ9A 1PVC3 5HI1A 1W03A 4FQZA 3EFCA 3ZFGC 3EXUA 2ZGRA 3NAPC 1W3XA 5T5JA 2P5BA 3K77A 3NOBA 3N1ZC 4Q0QA 3ECQA 3ZXVA 3PV1A 4ATEA 3R4SA 2B39A 2A3YA 4Y4YA 1OVPA 1V80A 1XLPA 4LHSA 4I30A 3L13A 3ZXJA 3OLMD 1SMVA 2GMMA 4XYCA 2FCMA 2BOIA 1EUTA 5FP7A 1WGGA 2KDBA 5IT6A 4PK1A 5MPOA 3IMMA 1WWYA 4XZ4A 4FT8A 5FPZA 5FYSA 4NPMA 3ZDTA 2XKPA 2ON8A 4NN0A 1COV2 4D8MA 1UKGA 3NKGA 4Y1YA 3AE1B 1I35A 2D44A 1GNYA 5BNOB 2JIGA 3LEIA 4FCAA 4D7YA 2JB4A 1J3QA 2HDEA 2ZJCA 3WP6A 2HWB3 5JIAA 1Z2MA 2J1SA 1UOBA 1WCQA 3PHXB 3VBOB 1AL21 1C78A 4OUEA 2UY8A 5K4LA 5FRAA 4DXZA 4NR1A 3K3NA 3LDRA 2Y0OA 1RLFA 3JYUA 4LLOA 3N7LA 3FX3A 1XYPA 1BT0A 4KU7A 1I4RA 4K3CA 1QOSA 2ATFA 1WRDB 2O8OA 1GC6A 1K52A 2PLV3 1J83A 3BZDB 4AEKA 4UBGA 4Q4V2 4QMAA 5T55A 5C3SA 3V62A 3V0BB 2NCNA 2ZX0A 2GH2A 2IPKD 2M56B 1NVID 2R071 1FOD2 5GLUA 4DMIA 1EUUA 2PIAA 1RUD3 1ET6A 1LECA 3CJIC 3U4SA 3CU7A 4CXXA 5AFEA 4Q4X1 1EF1A 4MH8A 1B35A 2V73A 2L3ZA 3GBFA 2KMAA 1AR71 4GD4A 1ULGA 4WJPA 2UWAA 3I7DA 4QXBA 1YX5B 4LNKA 3FLRA 1T0QC 1L4ZB 5FZHA 5KWRA 2DNFA 1MVQA 2FUHB 3J7HA 2V4VA 2KN4A 2LGDA 5E16A 5CG8A 4DHZE 4GIQA 3CZJA 3BU0A 3H50A 4MXVA 2DBIA 4X8NA 4TSVA 3WQ0A 1H8TA 2VOVA 3S30A 2EXJA 4JKLA 4N6EB 3FMGA 4K1ZA 1FO4A 1Q5OA 5GZCA 1NENB 4RHV1 5K8SA 2NMOA 1YOVB 1J7AA 4D7SA 5FY1A 5C3JB 4LBJA 5BNQA 3ZYPA 2WXQA 1DYPA 4MGZE 1S1AA 5FK7A 5FKAC 4C4VA 2E26A 3N7KA 1OVSA 1GOHA 3LEMA 2VQUA 3I54A 2FE8A 3N1XC 2HWF3 2YBKA 2D6MA 4G11A 2ZNVB 2VRRB 1AL0G 5C3QA 1TKGA 3Q2AC 4R9BA 4IEYA 4A6OA 5C4WB 3AZVA 5FCCA 1WFYA 4XCAA 1SB3C 5T8IA 4E4HA 2RS13 4ACFA 2MX2A 1R1A3 5J3UA 1VALA 3H7PB 4TKNA 5D3IB 1WJ4A 4IE5A 2LHDA 1KGYA 4LO8A 3ZFFC 4GXLA 1KDKA 1A3KA 2FNJB 1X8MA 3DXUA 4IERA 4KWKA 2XPJA 4BJ0A 1A70A 1MHHE 4HZFA 5A1LA 5KC5A 1ZRRA 3WUDA 2C9KA 2TSSA 2HEYF 4Z07A 3WR0A 3BIWE 4V2WA 1K5JA 2BERA 2E31A 3ZIMA 1YUDA 1V1OA 3N9OA 3APCA 1P9DU 2C4XA 2QQIA 1V5OA 2P4EA 4MGSA 3W5VB 4B1LA 5CFCC 5HXMA 5BMHA 1DLLA 3DN7A 5APAA 4HKQA 5F2SA 1LHOA 4OZXA 2J53A 1HQWA 2JENA 2D3AA 3ALQA 3A0NA 4LJOB 3ZKYA 3E5QA 1B35B 4D2KA 2RS32 2XKOA 3H9DA 5A33B 4K7JA 2QQPA 2NM1A 5C9AC 4C90A 3FAHA 4FJYA 3DBLB 2HBUA 2D7FA 5BV6A 2EIBA 2D5FA 4L99A 4N7UA 1HRI1 3AE3B 3MIGA 5F3IA 1JYNA 4KVGB 1MS5A 2Y6FA 2AUYA 1AR63 3TIXA 4IWOA 3U75A 2AQ3B 2ZKLA 3VD4A 1W6PB 2GNTA 2GDFA 3CO2A 4P9WA 1W0NA 1MQTC 3LA3A 2IFRA 4A8XC 2XHKA 5JR7B 1C57A 3W21A 4MJSB 1NBFC 5H8YE 2HWB2 1PO23 2V3NA 2P37A 5A1AA 2QJLA 1B1ZA 3AU5A 3T4HB 1LRHA 4IETA 3GS2A 1XSQA 1I4GA 2B7YA 4QU1A 2O1QA 5FYBA 2AYOB 1DQ5A 2Y0IA 1YWKA 4A20A 2ZCCA 2VBBA 1K5MB 1WGHA 4BKSA 2FIFA 5D3DA 5CNAA 1O3SA 5IK4A 1GNHA 2JT4B 2JZPA 4KH9A 1XEEA 2CYFA 3W59A 3T2TA 2V5YA 1WCDJ 1ZPSA 1MS3A 3U30A 3NAPA 5ANNA 5JPMB 4CDQC 5JXVA 2XB6C 3SEBA 2I2SA 4IM3A 2BQPA 3N3KB 4YTNB 4CP9A 1S0FA 5F5IA 3WDWA 2KZRA 3CMMB 1OUSA 2ARBA 3SNMA 4CCLA 1UX6A 1UIKA 4XDCA 4LKSA 1VE0A 1R093 1H4RA 3ZR5A 4I6LB 2RE9A 5FPBA 5DUWA 4PF1A 3AX4A 1AR72 3ABVB 1POV0 3N9QA 2JG8C 1JOPA 1NCQC 2J0KA 1ENXA 4DY5A 3UQAA 4RFBA 3ZQ4A 2JY6A 5I0SA 1LHVA 2NTSA 3H1YA 3KVBA 1W05A 5FFOC 4BQXA 2WGSA 1PUTA 3C2UA 4GWMA 4EFOA 1JHNA 3I2KA 4D6RA 2XVKA 2O2VA 4TQ1A 5CEHA 4NO4A 1WZ0A 4COWA 3VTWA 2VW0A 2DCJA 2R0HA 3B01A 3RS6A 4NAOA 1J19A 4PLNA 2WN2A 5LBFA 3X0WA 4XFBA 3FJSA 1X9PA 4Y4RA 4MHUA 4QPIA 3PTRB 2R042 3WINE 3SLIA 1UY3A 2C7NB 3GZNI 1QJX1 3E97A 2SLIA 2E63A 2IGDA 4AI2A 1TMF3 3JSVB 3MUY1 1VBD1 3I2GA 5FYVA 3H8UA 2WU2B 1T0SC 3NNGA 1RL3A 1W9FA 3VHOA 4GN1A 3P4SB 4PQ9A 1EY2A 2J42A 2GBKA 1IGCA 2ES3A 4JGZA 4WZFA 2R073 4LHLA 1VBC1 3I3EA 2LTNA 4KSKC 3INAA 5JZGC 2ERFA 2W0XA 4I6NB 3JCIA 1HTQA 1DOIA 2VMCA 4GQ7A 1DGJA 5JSOA 4MGYE 4XBNA 5HXVA 1E5SA 4WVMB 4KDLB 1WMEA 5L73A 4AQTA 3BIEA 4CCNA 1QJU3 2Z8LA 1W0PA 1VRAB 5FYHA 1E57A 1RTVA 1AHSA 2BNMA 3OPZA 2M1MA 3TYJA 2VZTA 5IAVA 2DF7A 1GAQB 1REEA 2HLEA 3C19A 1T3QA 4RGOS 2BYTA 3HBZA 4CDXB 2JKBA 2NBVB 4ZHNA 2OKXA 2GBRA 1YQ5A 4GDLB 4MSQB 1SDWA 3IBMA 1S0DA 1QH6A 3MIEA 4BQ1A 4I3PA 4JE3B 1S2BA 2KJRA 5FOJB 1YQ2A 4HK8A 1CAVA 4DK5A 4RS5C 1LEDA 2HYKA 1RVF2 3NVVA 2UY9A 4RS5B 1W6MB 1E8WA 1UOGA 5DDJ1 1NLRA 3AK0A 4Q4V1 3DQVA 1ZVFA 2J7MA 1WWTA 1VR9A 2OX0A 1SPPA 1SJHD 3O65B 3X23A 1ASJ2 5JMCA 5JXGA 3P63A 1CESA 2FMYA 2N9KA 2QZ2A 1QOOA 4YM1A 3DPRA 4R9DA 3RCZA 3VUYA 1FAYA 3C7OA 1DU3D 2BFUS 2LALA 2P34A 4RHV3 1XU2A 1E5WA 2F6BA 5EZWA 3F2ZA 1ZZCA 3PJQA 1HEZE 4UW4A 2X53S 5F37A 2BGCA 2WT2A 3EBRA 4GWJA 1ZXIA 1SE9A 3A22A 2QDFA 1RUD2 5F3CA 3OD4A 3RI8A 3SH3A 4YVWB 1US2A 2WXOA 4XQDA 4EJRA 2P6CA 4IE4A 3H8XA 1CIWA 1UU6A 1WGKA 3VDAA 3ZSEA 3ETPA 3AE9B 3MFAA 5HFYA 3KV5A 5EJ3A 1W2UA 5FXVA 5KHQA 4B29A 3H1WA 3R05A 4SLIA 1W8OA 3SHQA 1I1EA 1SXTA 2VCBA 2G1EA 2VZQA 1QF6A 2ZHNA 3M3IA 1YCIA 2WXFA 3AZWA 3VDDC 3ZXEA 4GH4B 4QPGC 4CXYA 4OHWA 2D6NA 4NIIA 1N3OA 2XLAA 2PKOA 1KQRA 2YB7A 1DZQA 5LBBA 1RFKA 3VD5A 1CN1A 4RN5A 5KHJA 3RNGC 2ZGKA 5GXGB 5C1ZA 5A3NA 4KQ7A 2OOBB 1UY1A 1RJ8A 3CIRB 5C5UA 4E3CA 1SHWB 2DAJA 4S2FA 4CDUC 5IVBA 4DHJB 3POGA 3RJ2X 3KQ4B 4CPBA 3A4RA 4XYXA 4RR3B 5CKNA 3ACLA 1OF3A 4Q4X3 4LHKA 5FZ6A 3J7NA 2WXMA 1C1YB 4RFT0 1JTZX 2OIIA 5A7SA 5IFTA 2K0GA 3SMHA 4CE8A 5FZMA 2Y3AA 2YBSA 4XC2A 2QDRA 1STMA 5AZFA 1RUE3 2RDRA 2KQ4X 4URKA 2PYTA 3CKHA 3ENRA 5F9TA 3O0XA 2X8XX 1HRI3 3ACIA 3KYCD 2OJRA 2A6VA 4FPKA 4Z2WA 4MGTA 5J98B 3DECA 4ZHOA 4IWPA 3CJXA 5E6HA 4DRRA 1SEBD 2LS6A 2KO3A 2WXPA 3KWVA 1RUD1 4BHPA 1V70A 3JU9A 1WJNA 2SAKA 1JWUD 1KRIA 1EO6A 2HWE1 1SF0A 5C3PA 1PQSA 2Y26A 1H8VA 2GP3A 5F3GA 3PUQA 5FMOS 4KL1A 2B9VA 4FOVA 5J7MA 1K5MC 2WX1A 4JDOA 2L76A 4X57B 1HDKA 2GBNA 4P16A 3SU8X 2A7AA 3Q6BA 3LE0A 3K75B 4OVVA 3S2AA 1GUAB 4II3B 2XK5B 3PIGA 2ZEXA 1IKQA 4RQPA 3HN1A 1UWXA 2EVXA 2Q8EA 3BIID 3NZ3A 1KEXA 4JGYA 2BVVA 4CU7A 3KQRA 4C91A 1TG7A 4TZDA 1SPPB 2IUWA 4Y5SA 4AEMA 3ZYRA 3OOXA 4RR3C 1SGHA 1C4PA 3L4PA 2XQRA 5A32A 2RV9A 3ZNID 2FIDA 3UIPB 4M0WA 1FPN3 3HQXA 1VP6A 1S2EA 4HL0A 3PVLA 3MF6A 3Q3FA 4AS1A 3H1UA 1VBE1 2C5LC 2NQYA 4LQRA 1ENSA 1JMUB 1UBIA 3VQIA 1L2NA 3OD0A 4ZU4A 4QPIB 1DDLA 4OVUA 4YL8A 1QJX2 3HOBA 3OY8A 5FO9B 3VH3B 4JZRA 5LWBA 1V8CA 1LKNA 1E8YA 3AV8A 2PLV2 3RFRA 4AXOA 3NRUA 2WZPP 4UFHA 1R082 5CFDB 3MHZA 4I0WB 1ZRFA 5D8AB 3IAM1 4HKLA 1NE6A 1TY0A 2WYFA 2G9GA 2IYDB 5ANQA 5FPUA 3DYPA 2WXHA 3KLSX 3W5NA 5IWFA 2YMZA 3RMXA 1MZFA 4GA9A 2BYFA 1LO5D 4EV0A 5E6JA 2NLRA 4MJSA 1RUJ1 2X29A 2V4IB 2ZGQA 2MEV1 3I2OA 4L2NA 5CB7A 2EXIA 1JUIA 2V0GA 1XJAA 3U14A 3ZJVA 4XHXA 3MP9A 3T3NA 4OFGA 1E7UA 5FY8A 2HJ8A 2C26A 1O3RA 2Z69A 2E7QA 3FUOA 2WNVA 5M0TA 2QCSB 1Q0WB 5C4WC 4HETA 2EKEC 2BRTA 2HBTA 4PDWA 2ZNVC 3OBTA 5DG1A 4MYEA 1JS9A 4B9KA 1WH3A 4W9IA 4XW3A 5FMCA 5I8TA 2K8HA 4FFFA 1NCRA 3I3QA 5FKBA 2FMDA 2R041 1VBC3 2LVPA 1RUI2 2G9HD 3MO4A 1ODNA 1DYOA 4YFZA 1XOYA 4HVBA 1WYGA 4D0QA 3M3QA 5EQUA 4LJPB 3WDVA 1JZ4A 4LA3A 4AVVA 4PLMA 1GWMA 3MEPA 1UNBA 2WNOA 1H6YA 5DPRA 2XMLA 1V5TA 3LCPA 2J1UA 3VN4A 1HB1A 3HD8B 3KS7A 2HWE3 2IDYA 1GZWB 1PK6A 5LZ6A 4MXWB 2YU2A 1IKPA 1AUYA 3GDBA 1VZ7A 2JYTA 2YXSA 4E71A 4P08A 5JUVA 3KUDB 3LXFA 2WZ8A 4COUA 1XXNA 2BQQA 4PIYA 1IPGA 4QHZA 4OZCA 1R083 3P4RB 1EV12 3B1LX 1DP0A 2BYEA 3CLPA 3ZNGC 1OKQA 4IEWA 4E4ZA 4BOZB 3DVGY 2WNUC 1QOGA 1GWLA 1D6EC 2IXHA 5DAVA 4B3NA 1EWYC 4LTAA 4WWMA 1F1HA 1YJJA 1H4GA 3NNFA 3PHWB 3BVGA 3SH5A 1MJDA 2ZPXA 5ABJA 5J09A 4PS7A 1KF6B 2G4DB 5K9YA 4KI5M 2KWVB 1QEXA 5DG2A 3WT3A 3U78A 4YT0B 3J9CA 1RUC3 3ZYFA 2WZR3 1HXS3 2JDYA 1AN8A 1FFVA 1WW4A 5A7WB 2VTXJ 4NIAA 4J3OD 4BYYA 3I97A 1OMIA 5FYCA 5BNNC 1CJEA 3ST7A 2IO2B 4NHLA 4AFDA 1P0RA 5LNK1 2RS33 1ZREA 1WBFA 2NVUI 1FNVA 3O1UA 3KYDD 1W6QA 4MVTA 1XB9A 2VTXA 4LNFA 3I4IA 4I2OA 4QDQA 4Z1VA 4UI9L 4K21A 4KMQA 2I74A 4I0AA 1WA4A 1V6EA 5A3MA 2DVDA 3C8XA 2XJVA 5AZHA 1D4BA 1HN0A 3USSA 1MFWA 3Q3MC 1QT9A 2ZGMA 4HDOA 3TCAA 2INPE 2W68A 4WAFA 2CTVA 2HWD2 3OCPA 3L17A 3AMQA 5DZFA 4FBJB 3BINA 4H55A 3VUXA 2WXKA 2EIDA 1W06A 1DYKA 1YIPA 4BLJA 1N47A 2PW9A 5C7GA 1PO11 1E8XA 1OLMA 1QJY2 1KRHA 5GLWA 3NJTA 5DAWA 4C8DA 4BBNF 1RUE1 2KJ6A 1MEC3 1D2QA 4COVA 5CG9A 1SLAA 4MSMB 4MM3B 1W28A 3UF8A 3Q3OC 2QQJA 2WXGA 3OY8B 3ME2A 1NXMA 2OZJA 3ZNZB 4L9BA 2AEZA 2QQUA 1GBGA 2W3JA 3ZVXA 4ZKTB 5H92C 2G9ZA 1HE8A 3AE2B 1BQPA 2N1VA 1QIQA 4HPKA 3AE8B 4EWDA 3I63C 4RF1A 3IKWA 1SDDB 4A3ZA 3OF1A 2ARXA 4BKSD 3EFUA 3C7GA 2EMTA 5HCHA 1ULCA 2J1TA 3CMGA 4BIFA 4DQAA 5FMBA 2Q8DA 2CSGA 1SLTA 1VDVA 3ZDVA 1RUJ2 2R32A 1HQRD 4YVWA 4GDKB 3ACGA 4B0EA 5I4DA 3EECA 5LY2A 3MPPG 2MJ3A 1ZP0B 3MC8A 1FMD3 5I0DA 2WS92 2GN3A 3SFEB 5HV0A 1S3SG 4QDSA 2BGFA 1TBEA 5FZAA 3OGJA 3J8F1 4AK3A 1IS6A 5CFDA 5JOZA 3MZHA 4HJKA 4OLLA 1E5IA 1K45A 1L0XB 4G50A 3WCQA 1XC6A 3BK1A 1N63A 2WFF3 1WW5A 4XJZA 2SEBD 3POEA 3ML9A 2KNBA 3VAWA 3A9KB 2ZVNA 2KQ7A 1MEC2 2MJDA 1OQEA 4M4PA 2AEHA 1GZCA 4IUMB 1TKYA 3ZJTA 3QA8A 2HH9A 3PTYA 5LASA 1UD1A 4KGTA 4XILA 2R072 2L1AA 3T1LA 4W9LA 1NCRB 3ZPYA 2IFWA 2Z4FA 3MUZ1 3OGVA 3BALA 2VMIA 3N7MA 3BVMA 3L9JT 4ISRA 2JE8A 1AL22 4FPEA 3G7DA 3MF9A 1HXYD 1UNSA 3ZRCA 2ZZPB 1W90A 1RAXA 4XJWA 1RUF3 2VNGA 1CQ9A 1RHI2 3TOJA 4I02A 1RIRA 1LNSA 1VMHA 3TN91 1IOAA 4A45A 3AZXA 2XL9A 1PO22 4BISA 1YJIA 2QQLA 3CSFA 1A5RA 1MVEA 1H9WA 1V6IA 2BKRB 1ZXHA 2A3XA 5J36A 3QACA 4A7KA 1JZ6A 2RMU1 2L05A 3JD71 1NA1A 5IVYA 2R49A 2KFKB 4X8PA 1NI2A 3BYWA 2ZBJA 2D98A 4J6IA 3R4UA 2YU1A 4Y1UA 1YNTE 5BYNA 4H3WA 5FKCA 1F15A 2CJOA 1EYBA 1VJ2A 2H0VA 5FR6A 4QX1A 3AB5A 3ETQA 3RRDA 4YSZB 2K25A 4N8MA 1D5ZC 4GH4A 1QGLA 2CGNA 2VJXA 3ZYYX 2GU9A 1RM6C 2Z2SB 3IN9A 2VNOA 4ZOHC 2GALA 1DQ1A 1DOXA 2DYCA 2LZ6A 4D69A 1HRV3 1CAXA 3WHUA 3ACFA 5L7OA 1TME1 5JI9A 1JZ2A 1E7PB 1OQ1A 4NVPA 4J6GA 4LT5A 2VZKD 1WA6X 2ZKNA 1R7SA 4H14A 4JHTA 1WX9A 1JYWA 4P6VF 3AKRA 3CNAA 2MJEA 4IEUA 2MH7A 3RUIB 2IO0B 4A42A 1V6JA 1GG3A 2DURA 4Q0SA 3AL6A 2GC0A 3AP9A 3HRDD 2JDUA 1Q43A 5A3LA 5KBFA 4L23A 5FLHA 4EWEA 2YDEA 4NQLB 3RYKA 3ZN5A 3WIMA 4OQ8A 5JDBA 4CCEA 3DBHI 1DIWA 2WO3A 4CZSA 1CMXB 4CEYC 4BM8A 3WW4A 1IZ3A 2W1QA 3O12A 1BEV3 4KGSA 2YGMA 2RS12 5ISLA 3ZFFA 1A34A 1F9KA 3S7IA 1JYTA 1NZIA 3ZN4A 2DCZA 4P9GA 3JQXA 2EA7A 4GU2A 1GB1A 3WNNA 5LEKA 3RPFC 1RUF2 5JAXA 4RCOA 4NPLA 2IWGB 2Z59B 3QH6A 1O3QA 4ES9A 3H3LA 2HWD3 2B76B 2NN8A 1NE4A 4PF5A 2KM2A 1JW6A 1UU5A 1PYWD 1MS0A 1GLHA 4JQTA 4ANXA 4G9SB 5IJRA 1W8HA 4C56C 3M70A 5FXXA 2YFUA 2HEWF 4XJUA 3NV1A 4XUNA 3UL2A 4DINB 2BF8B 2WSUA 5JLVA 3GOEA 2QQKA 1BBT2 5F5AA 2M19A 1O3TA 2XJTA 1OQQA 1WKYA 5GLTA 3KB5A 4ZRKA 2XK5A 4XF0A 1FFUA 4O9GA 2WXNA 3IT6B 2N7JA 2VC9A 3OJ4B 4RGAA 2JDPA 2JYEA 1V00A 3N20C 1TS5A 2D97A 3DF0A 3E1F1 1H2LA 4P9LA 3JBG1 4ASLA 2NTTA 4CQNA 1PGW1 2HWB1 1BUIC 5JSPA 1HQLA 2WQZC 4CU9A 2Q5TA 1UXXX 3VVWB 2ONQA 4B1MA 2CDOA 1GP6A 1SLCA 2KVZA 5GZGA 5A6YA 3O1SA 5LY1A 1V6LA 1OI6A 1ZBA2 3IG3A 3PRZA 2M17A 3NVWA 5FUNA 3L54A 2GMPA 2W9XA 2PJHA 5JR2A 4MADA 3POBA 3AEGB 1RUH3 1ND2C 1FOD3 1W6PA 4L2YA 4ZHPA 2BVBA 2L0FA 5I93A 5DUXA 3WQ1A 4DXGA 2Y6JA 4JGYB 1GPXA 1G9DA 1X33A 1DGRN 4XFCA 2QSDA 3N1YC 2CU3A 4M0NA 1N6ZA 1XLOA 4MACA 1GQHA 3OUIA 4XZUG 2WP9B 1AZDA 5TSSA 1WE7A 4MO3M 3ZR6A 4BH9A 2EICA 5LW9A 4QGNA 4COYA 2QNKA 4AHWA 4WWPA 5CVRA 4DXSA 1Z78A 1JZ7A 2DYOA 2G19A 3VDDA 5C33A 4XMIA 2KVRA 4JTNA 1UIJA 4KDIC 3BB6A 2KDEB 4YPJA 1S0JA 2ZMNA 1REDA 1QHDA 2QTWB 4E9KA 4MOAA 4WWOA 1TYGB 2HEVF 3T0BA 1WGDA 1UYZA 5GKAC 4E2SA 4REZA 4K1RB 3TSSA 2HJ1A 2KXLA 4ZYNA 2Q0AA 5A1FA 2WU5B 2N9XA 1H8TC 3CHXA 3ZIXA 3R0RA 2KC2A 2IY1B 5CHWA 1UMZA 5FP3A 2GBJA 4LOSA 1FMD1 5IAXA 3WOGA 4RYDA 2IBIB 3UK9A 3VBUB 4KG8A 1XNAA 2W08A 4YW3A 4M8MA 5GLZA 1TME2 2NR2A 5GLVA 2K6QA 2FDKA 2AWTA 2HWF1 4FPGA 3RN9C 5JH5C 1DFQA 2ET1A 1CAUA 3V0AB 4KZ0A 5FLIA 1WM3A 3GCWA 1VLBA 1O5UA 5IVJA 3LFIA 3EHVA 3OTFA 3EUB2 1PGAA 2Y34A 2KWUB 2CU1A 5JHBA 2K6DB 4YW4A 4ASKA 2UWQA 2BBCA 2WXLA 1SIJA 3L10B 1GU3A 1YQ4B 5D8AA 1L7QA 3HJRA 4Q1PA 4L11A 1LGNA 3HQRA 2VQ0A 5DPNA 3TWIA 3P2BA 3B93A 1ZYBA 3O1TA 3ZXGA 5IO9A 2BEOA 5IA7A 4LA2A 1ENRA 5IFPA 1AYN3 1HQNA 4O65A 1WGPA 3WW1A 1NA1C 1HB4A 3DBHB 1W8WA 4TN7A 3IAQA 3OJBA 5JIUA 1GJZA 4M0WB 2F4PA 4KIKB 3G6JB 3QBQA 1C28A 4AOCA 4QQLA 1UOFA 3LA7A 1CAXB 3PREA 4CHKA 2VZOA 1VBB3 3KSCA 2KACA 4UXAA 3N3HA 1HXS2 3AZYA 2HD5B 4PJYA 4FTBA 3POJA 1IBXA 3PSEB 4JGYC 1RUF1 5TR5A 5A3WA 4LPLA 2WN3A 1FPYA 1J58A 2JG9B 4FI9A 1UYYA 2XDVA 4YG3A 2NS5A 1CJPA 4HRSA 3RSJA 1NDDA 4C00A 3K4ZA 4QX3A 4NE9A 1LFDA 3T9LA 1PGL2 2ACZB 2A6ZA 3CBNA 3T2OA 2FCTA 3V56A 3UINB 4BXSV 1GUIA 3POFA 2RR9A 3PMSA 3NY5A 2R0FA 2UU8A 4IEZA 3LYYA 4CU6A 2BTEA 3WCSA 1DG6A 3N35A 2W39A 2WFF2 2L52A 3VBSB 4DWFA 4C7YA 2OS2A 3GHNA 1F5JA 4M4RA 1JMLA 5FWEA 4HEA1 3OAWA 3N7JA 5E6OA 5FY4A 1QXRA 5JXHA 2AEYA 1YJLA 1WX7A 1ZZ6A 2JIJA 4XPVA 4FOQA 2PE6B 5L95C 5LA1A 4HBNA 3IDEA 4ICUA 1RYJA 2OA2A 3Q8FA 2XXZA 4QX8A 4BKTA 2EAKA 3BWUD 3CF6E 5JZEB 1CAVB 2IJ0A 3IPVA 4GSWA 4QU2A 3BY4B 4UBHA 1RHI1 1DZTA 3PVNA 3U2SC 4RH6A 4I09A 3NO8A 5A6XA 2NYYA 2LXCA 2RDNA 2WR9A 1PDXA 2F4LA 4ZZ8A 1PIV1 1W04A 4BBNC 5CHVC 1I5ZA 4Y3OA 5FYZA 4Q4W3 2ZEZA 2A75A 2QKDA 4FFIA 3MJ5A 4YZ2A 3W2DA 1HW5A 5A7OA 3ZKJC 1DGWA 2DX5B 3ELNA 3O1PA 4NHMA 4QPGA 1LXDA 2IVJA 2AQ2B 2KX0A 3H8RA 3FBMA 3PL0A 4Q27A 2XLGA 2H6CA 3FBYA 5K0UC 1COV1 1QILA 1ROEA 1GFF2 1ZUD2 4RS5A 2WQYB 4LNNA 5LEJA 2WXIA 3APBA 2VOTA 3U7DA 3B3QE 3FHIB 4OHXA 3WVJA 2XQXA 3O1MA 4LUMA 1W6MA 5I91A 4HT1T 3V6EB 2DCYA 3NW4A 1ZDVA 5F6LB 4P9JA 4DUVA 4EROA 3TN93 2W3SA 2HYXA 1YNAA 3ZM8A 3I57A 2YFZA 3U10A 1LOFC 1OHFA 5JOYA 4K81A 5A3PA 3NNJA 3AL5A 3NV2A 5AC91 3T0DA 2W1UA 1RUG2 3QC8B 1TMF1 1ULPA 5LK5A 3VZNA 1XLNA 4KKJA 2RG4A 2INDC 4B95A 2YHJA 1LU2A 1CONA 3AKQA 3H3UA 4UOJA 4LE4A 3LD8A 2TUNA 2BT6A 4QPWA 4Q4Y3 3IAS1 4ARXA 1O7FA 1SSNA 1X50A 4K9SA 4AP4C 4W9EA 4HCPB 3I3DA 1V6KA 4O9EA 3VBFC 2K2SA 4PYUA 3MIDA 2PVGC 4BOSC 4XVHA 4CPBD 5T5PA 1WE6A 4OI1A 1NCQB 4AVCA 5FV3A 3HHMA 2DDUA 2DTYA 2BPSA 2JB8A 2LASA 4WZCA 3Q8BA 1AF9A 5BNNA 1V2YA 1R092 1RB8G 3TL5A 1U5IA 1QNWA 1RUC2 2MW5A 4JPSA 4XDOA 4AQSA 5FP9A 3Q8EA 4XF4A 1JYIA 1O8PA 1UN1A 5JSRA 2FUG1 5HCAA 5D1IA 2TBVA 3DOWA 2BW2A 1WZXA 2FDFA 4PS8A 2K9ZA 1OA4A 3VBRC 1NZCA 4WJQA 1CPNA 3W9CB 3KMHA 5EYYA 2Q8CA 1KM7A 1BEV1 3KQ4A 1NCQA 2VTFA 1R4MI 4EN6B 1F35A 1QOBA 3VBOA 1QDOA 3JXSA 4IGPA 4J25A 2G4IA 1UXZA 3FLPA 4P5YA 5D94A 3ZW3A 1FNWA 2XBO2 3ACHA 1ULEA 4LNOA 2WZR2 5F2WA 1WXSA 3T8MA 2I1KA 1FXIA 5EFUA 2IXJA 2FZ1A 2VG9A 4OW0A 3UKVA 4HXCA 4WBBA 1RFAA 4WM7B 4BQ3A 5J18A 4YXDB 1KLGD 4JWUC 3DYOA 4N53B 3TRSB 3NJVA 3D5OA 4HG6B 3OWEB 1ZZ7A 2X5IB 4LE3A 2R1DA 3WD5A 4NHKA 1S1QB 2GOWA 1HKDA 1DQ6A 3VZMA 4AQ2A 1ZBE1 4K7SA 1SFNA 3MV11 2D2QA 4FAGA 1JI6A 1NY72 4Z8BA 2L9LA 4C80A 1PO21 3M3OA 3EA6A 3NV4A 2I2YA 1GMMA 1OT5A 1CQVA 2XJQA 4Y5TA 2R2OA 1XYNA 1GANA 1C8M3 1UZZA 1H0BA 1TZOA 3K2OA 1QQP3 2VVFA 4IUGA 4CYDA 3PZ8A 2WNVC 2N9LA 4UFLA 2WT0A 5FO7B 4UFJA 1CK1A 2KMCA 1VBD2 1QLBB 2VOWA 5IAAC 1WMXA 1W2TA 3JD72 1OA2A 5BNPC 2LUEA 4RGNA 4EN8B 5FK9C 4M3CA 3UJQA 4AQ6A 3DXTA 3EHKA 1P7FA 2LGIA 1EAH3 2PAEA 3GZUC 4PDWC 3GZTB 3ZYHA 2MBQA 4LDTD 1VBB1 1Y56A 3UI3A 2XBO1 1V9JA 1TNRA 3WNXA 3GJBA 3ZTDA 2LUMA 2JUOA 4HPMB 3PTFC 2Y6HA 2LJ5A 3WF0A 4W9FA 2VY0A 5LRRA 2KANA 3U37A 5JWPA 3CWIA 1ZKHA 2AGSA 5FBZA 1HJFA 4KGGA 3HWJA 2CHZA 1UU4A 3B00A 2RS53 3ITQA 5FZ9A 4NJ7A 1D0GA 4IW0A 1CAWB 5IW0A 2VZSA 3M3CA 2W1WA 1PZ9A 2WFPA 2BWAA 3KW5B 1RC6A 1RVF3 2BWFA 2C24A 4IDZA 4AAXA 2ZGPA 4AZZA 4LO7A 4NAMA 1C76A 1V6NA 1HV0A 3K4AA 3URFA 4AWJA 2D10A 4FTEA 3AEFB 1YMHE 2WWZA 2XVLA 3B0AA 2XJPA 3I2DA 2W52A 1NYRA 1C4AA 2QVSB 1RMU3 3ZUNA 4CEYB 1MACA 2DYBA 2JXAA 2VQAA 2PAMA 5FZCA 1BMV2 3E9SA 2N9PC 3DBRB 1QJU2 1HN1A 3ZMNA 1JU3A 4FPLA 1LR5A 3WA0A 1QJX3 3OEAA 2QDNA 4W9CA 3JD73 4FPFA 2OZ6A 1ALYA 3MIBA 4HPLB 3LA2A 2RJLA 2MRPA 3THTA 1ZZ8A 4ZRIA 1PZ8A 4AEDA 3M1HA 1JH5A 2HJIA 3RD2A 3I2FA 3U8ZA 5FJKA 2JE9A 4XWTA 3RI7C 1JYCA 3NVYA 1IBXB 2JKXA 2R061 2VCAA 3KWLA 1LGBA 1Y9MA 4R3DA 4FOYA 1ZBA3 3APDA 2A73B 5H9SA 3AE4B 2ZOEB 3ZTCA 5DXDA 5FQ0B 1UY0A 1UGMA 2NPTA 2VH2A 4MLOA 2J52A 4R4XA 4YFWA 5T5OA 2B4KA 2WYSA 4Q0PA 4HXDA 2I38A 3IWZA 4I01A 1DQ4A 4XBLA 4BCUA 3RWNA 2DCTA 1K12A 4C1XA 1MHXA 1SJED 4QB2A 4QQOA 2BJSA 3HNYM 2DYMA 4C0BA 1JWBD 2VO5A 2KDIA 2D40A 4QWNA 4RM8A 3Q3NC 1OLME 3I2HA 1GYKA 2X5IA 3J4UH 3SQOA 4P7IA 4JKKA 4HSJA 5C8CA 1YFXA 5BUVA 1I4HA 1Y43B 4EZ4A 3T1MA 2D93A 4ANVA 3NQHA 1K53A 1H2MA 1AX2A 5EE9A 5J17A 2A3WA 3W9AA 2ZJDA 4Q29A 3LIHA 1MZ6A 5E88A 4EN0A 3QH7A 3DPDA 5DAQA 1OLRA 3V6CB 3P42A 5FAXA 3NG0A 1DLCA 2PFWA 2ADDA 4LBQA 4H7MA 2P3KA 3S5AA 3URYA 2VECA 4XHBA 1ULFA 1VPHA 4Q4Y1 1JZ8A 1KD7A 1BLZA 5DAXA 3B02A 2PHFA 4CYEA 4FN2A 2KDFB 3ZYGA 3PT2B 1MZ5A 4KV2A 2J0MA 2N4FA 2NP0A 1PNGA 1W9SA 2K39A 2VUDA 1JN2P 4QM8A 4CP0A 5J2RA 5IN7A 1J7BA 4XTPA 4TSSA 3LQCA 4WJNA 4CUBA 4FPCA 1DYQA 4WVMA 1SLBA 2O2VB 4PIZA 4LEJA 4UW6A 4ARYA 1Z7S1 4QX0A 5FPLA 4EN7B 2YY1A 2ZGUA 3LB9A 1KS5A 2BW8A 1WCSA 4HFSA 5FMDA 5CFDC 3VFKA 4YWAA 3WALA 4JKMA 2KK8A 3H7JA 4PDWB 4P1BC 1Y9GA 2JRIB 2KFKA 3VHNA 2R61A 3VR9B 4AFAA 4M0HA 4BU2A 4NQKE 3E6DA 5EV7A 3FLTA 2JPHA 4RHV2 1IPSA 1LHWA 1UYPA 3SXWA 4NOTA 4A41A 4ZRJA 2JG9A 2KA3A 5I0RA 5CU1A 4GAZA 2N1WA 5KXCA 2QQNA 4D6SA 3VZOA 1SG3A 3HVDA 4LDTB 1R64A 1QOAA 1XD3B 3VBHC 5CTRC 2DVAA 1ST8A 2JE7A 1ZBA1 2PQQA 4BVUC 5L9BA 5IVVA 4DY3A 1PM4A 3M4FA 3IDBB 4YGCA 2CAVA 3UESA 1WBLA 3PUHA 2EAAA 1RHI3 4QKNA 1D4VB 5JI7A 1VRH3 4N53C 2MQJA 3VBHB 1QY4A 1XE0A 4QM9A 4UT5A 1LCLA 3AM9A 1SQ4A 4BB3A 2ZZJA 1AYM2 2Y8KA 1IG3A 1X8EA 3MW2A 4GB32 2IVIB 4WVWA 1XSRA 4LBOA 1RITA 3OBAA 3UKNA 1E5HA 3VDZA 3S6PA 4H7LA 2WABA 3V65A 1QZEA 1I5PA 1B35C 4IE0A 2MA9B 4DS0A 2AR6A 4D6QA 2VMFA 4HVRA 2OQ6A 4LIUA 1KJRA 2F17A 1NI3A 5DAPA 3UETA 1HLCA 4XCBA 4AI9A 1CAUB 4RGMA 5KHOA 5CFCB 4IV1A 2ORXA 1E10A 3W1SC 1HA5A 5HV4A 4CCOA 3KT1A 4HLTA 1OBNA 2Q1ZB 2CGPA 3UKTA 1EM7A 5CKMA 2WDQB 3VBUA 5D2AA 5IUQA 3SD5A 3KM5A 5FY0A 2G9FA 4QT6A 2B9UA 3FHAA 4CDUA 1APNA 2LRWA 4GWNA 4HSLA 4QPYA 2X09A 1WW6A 4LO5B 2ZGOA 1VJKA 4YTPB 1XCQL 1RXGA 4TUUA 4XBQA 5LLIA 1C9FA 2QUOA 3EQEA 3HAGA 1TQ5A 3RZGA 1VB4A 1VBA1 5T54A 4DHZB 1DQ0A 1NAEA 2QIEB 4Q1RA 4HOOA 4P00B 3RQ0A 2HWF2 3VDBA 2PHTA 3OUHA 2A70A 1TE1B 3N9NA 5IKCM 2REXA 1J1LA 4R4ZA 1G9FA 4N43C 1XNTA 4Y20B 1OKOA 3D0SA 3IBEA 2HWC3 4CEYA 3C7FA 4LTUA 2AYHA 4MH0E 3U4EG 2JDZA 4XJ9A 2N7EA 4DHJD 3O14A 1EU4A 2WNUB 4XEZA 5LATA 4HROA 2C1FA 2E3TA 5J48A 3RULA 4IC7B 5JXIA 4MDKE 4DEQA 5GALA 2FDHA 2J0JA 4HK9A 4ITKA 4OI2A 2V72A 3VKFC 4TV3A 2XWJB 4AHZA 3SCFA 4E8DA 1WMFA 3IFWB 4NRQA 4CUGA 1IQDC 2RDQA 1AR83 1PIV2 3FKYA 3B69A 2WDTB 4Z82A 3ASIA 1UQXA 5H9QA 3P1MA 4HJGE 4YVWC 4ISQA 1H2NA 2MEV3 3O5SA 4WIPA 4NJ6A 1SBEA 4D3WA 2JSVX 4ZRPA 1XU1A 2GP5A 5FZ4A 5CKQA 4AGVA 2XWBB 3PVBB 1JOBA 3B08A 4E4DX 1XLQA 4CP2A 3J8F3 2KQSA 4XAEA 3T4VA 5FZ1A 3RPQA 2VOXA 4BIOA 4P02B 2VCCA 3ZO5B 1N60A 1V81A 3PU8A 2WAAA 1DHKB 1WXMA 1O59A 4Y33A 4M3CB 3VTVA 3WX5A 4USAA 5BO4B 1RXFA 5ABJB 3M3JA 1QXPA 2CJNA 3HT2A 1E8ZA 1QJY1 2FAZA 4QB6A 3PMEA 2FHRA 5CYYA 2Y6KA 2NPIA 3LZZA 1ODMA 5FIXA 4A3PA 1MZEA 4XFAA 2R6QA 1MQTA 3B7MA 4WV8A 4XGAB 3ZRFA 3AEAB 5CADA 2L83A 4PCRA 1VMJA 1OSGA 4L1BA 4DDID 2EELA 3RNSA 1I6XA 4MXWA 3K9PB 5L19A 1DOYA 4K1YA 3PRPB 4N7IA 2OVUA 4NMIA 3NWKA 1KFYB 1STEA 1EWCA 1ULOA 4UF0A 2J1EA 3LOBA 1NX9A 1HJGA 3R8BA 5LK7B 1WZ3A 1S4CA 5JZGA 5C8WA 2Y33A 4IGQA 1U5XA 4Q4X2 4IW3A 2GN7A 3MLJA 4YZ3A 3SKVA 1W6NB 2JDHA 1H1MA 3DBLI 1BJQA 4AGGA 4A3XA 3K48A 4N43B 3T3YA 4YTMB 1G8WA 3A1QB 4KNCA 1LM8B 2Q1FA 3NVCA 1XE7A 3KHCA 2ZX4A 1AR62 4K20A 4JX1C 1LODA 1D7PM 4XFIA 3RYRA 1EV13 2NPTB 1JU4A 2VZPA 1MG8A 2CY6A 3ZOIA 4FQ4A 5J1XA 3ZO0B 4C0HA 4AI0A 3P6BA 1UKRA 5SV8A 4F7ZA 2E7AA 5A80A 1Y7BA 3U1XA 3NS8A 3KF3A 4N9IA 3LGRA 2PVOD 5A33A 2BDRA 1HZ5A 3RZMA 1AJKA 1SIFA 3V60A 4RGKA 4XMAA 1VBE3 1J84A 4PYZA 1V6MA 1YI7A 1TY2A 2H88B 2KAJA 1UL9A 5KHKA 3VD3A 5L9RA 4OZOA 4R8HA 5AC93 2WAOA 4RR3A 1I4XA 1E90A 2ARCA 1JCKB 5LXIB 5EHDA 4A7ZA 2ICIA 4AOFA 2BGPA 3I9V1 4HKZE 2J1AA 5I0UA 3UGGA 2MBEA 2C6SA 2RDBC 5DDJ2 4MHRA 3GXUA 1C79A 3A23A 1YHFA 4W8JA 5EE0A 3NV3A 4AVBA 1PGW2 2PA7A 2WC2A 4EN9B 5G2NA 1U5ZA 2ARAA 2K22A 2JECA 5KC6A 3ALBA 3BI3A 2I1JA 3E6CC 3AEDB 1YO8A 1UW8A 1GB4A 3OPTA 3OJ3A 4H2AA 1YN3A 1WYWB 5C2TB 1WY8A 2NBWB 2V1YA 4FP2A 1LJ7A 2RVAA 5EJZB 1AL23 3R7QA 3QOPA 5DABA 1WX8A 4FADA 5I8SA 4LHNA 1SFPA 1Z7S2 3VKMA 1WF9A 2WS3B 3IM0A 4WM7C 3WNPA 4IL7A 1XCTL 3S0MA 3WY6A 2DTWA 5FDBA 2KLGA 4CDQB 1OH4A 1I3HA 3HEIA 2KDMA 4HLEA 4IE6A 4RM9A 3RNBC 1IUEA 3V05A 3ZXRA 2VW1A 1WSPA 1SBDA 3JQWA 1FCLA 4QGLA 3A4UA 1VMFA 1KTKA 2MWSB 2X38A 2L00B 4YLZA 3BTXA 4DIQA 2IZVB 1XRUA 4K3BA 3DYMA 1HIXA 1W8FA 3GF6A 5AUKA 4UF0B 3U4XA 2X8KA 4BQ2A 5CAZA 1YC61 5C9AA 1HV1A 4YGEA 3RZLA 4LBQD 4KG0A 2JDMA 1FNZA 2FCUA 5A7QA 4JGHB 3RVHA 1XPWA 4GALA 1JROA 4GH4C 4QPGB 4QAWA 2RSUA 4ANUA 4XF3A 2D07B 3LWCA 4DRVA 4EUTA 2Q4SA 1BEV2 3OB8A 5A3UA 5BMGA 1PGL1 3E56A 1Q5WB 4J1XA 2BWCA 3ONSA 2WSVA 5L7OC 3UGHA 1AR93 4B4QA 1RWSA 4XJ8A 3U07A 2VH9A 4LK7A 2LROA 3POIA 1TS3A 3IZOA 4PQQA 2KKCA 3N36A 1PVXA 4EZHA 3ZFEC 5AFBA 3V3XA 1F8VA 1ZBE2 3J9SA 1QQRA 2X10A 1ULDA 1UY4A 2CWSA 3CL1A 3Q8AA 1MG4A 1SCSA 3JUUA 3WNLA 1N1YA 2WFF1 3IDAA 3AKTA 5FK8A 4N9HA 2DZJA 4TWTA 2M0XA 3FL7A 2WNUA 4YSYB 2WZEA 1F2RC 1XYOA 4BXFA 1J0GA 2XONA 4BA6A 3TEYA 4RA0A 4YARA 4GB31 1OFFA 3D82A 4DQOC 3WG1A 3GJAA 4O7XA 4CEWC 4CDWC 1KFUL 4LXLA 4Q2FA 4AFBA 4IEVA 4E74A 1GV9A 1XNKA 3NMBA 4XFHA 5FY7A 3NNMA 3ON7A 1W9WA 5A3TA 5CIRA 1E7VA 2CHWA 1POQA 4DO0A 3WQ7A 2O6VA 2RS51 4W9KA 3NJXA 2VQTA 4INDA 1YRZA 2FZ2A 1Q8SA 2PTMA 4I0BA 4HK2A 1XNBA 1K42A 3MLKA 2CS4A 2RMMA 4UW3A 3NSTA 2LM3A 2HE7A 3MW4A 3D4KA 4Q0UA 3APFA 4W4ZA 4CUCA 2IO1B 5A3OA 1O8SA 4LKEA 2MBOA 2KHWB 3OSDA 3T30A 3D3AA 2QQWA 4META 2EXHA 2LXAA 1C5HA 3TBDA 2A1XA 3B9IA 4LJHA 1ZX5A 3PZDA 1V6OA 3WF4A 2MHJA 4YVSC 3VDCA 5JZGB 2LWPA 4AE2A 4DXAB 2W94A 2YVCA 5BYRA 4BK4A 2Z0EB 2ZS6B 1NG0A 5JVVA 5FLJA 2W54A 1AWDA 1W8UA 4MGIE 2LVOA 1ND3C 4ZONA 3EC8A 4OHVA 1ACCA 3VZJA 4AI8A 4GJYA 3ZPOA 4UW5A 2OHFA 4KGRA 4FXGB 3AE7B 3CZUA 2YROA 3SISA 2H89B 1J8CA 1Y8RC 4GDKA 4FLHA 4LO4B 4WVVA 2LFIA 4V1PA 4Y26A 1JQ4A 2GBMA 3E6BA 5C5TA 2QQOA