4M01A

N terminal fragment(residues 245-575) of binding region of srap
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
321
structure length
321
Chain Sequence
AVTANTITVNKDNLKQYMTTSGNATYDQSTGIVTLTQDAYSQKGAITLGTRIDSNKSFHFSGKVNLGNKYEGHGNGGDGIGFAFSPGVLGETGLNGAAVGIGGLSNAFGFKLDTYHNTSKPNSAAKANADPSNVAGGGAFGAFVTTDSYGVATTYTSSSTADNAAKLNVQPTNNTFQDFDINYNGDTKVMTVKYAGQTWTRNISDWIAKSGTTNFSLSMTASTGGATNLQQVQFGTFEYTESAVTQVRYVDVTTGKDIIPPKTYSGNVDQVVTIDNQQSALTAKGYNYTSVDSSYASTYNDTNKTVKMTNAGQSVTYYFTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine-rich adhesin for platelets
publication title Structural Insights into SraP-Mediated Staphylococcus aureus Adhesion to Host Cells
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
total genus 92
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18483 Bact_lectin Bacterial lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4m01A01
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 4m01A02
2ZGRA 4FPEA 5H9QA 1F9KA 2GALA 2WT0A 5JOWA 2DVGA 5CBLA 3B3QE 2PHRA 2ES3A 4P14A 3V0AB 2DU1A 2W68A 3OY8A 3L2YA 5KXCA 1LHVA 1S0FA 4FPCA 1W6MB 3AK0A 2EXHA 4DS0A 5T5LA 2A3YA 2ZHMA 2ZMLA 4Y24A 3AXEA 3TB0A 5SV8A 2A6YA 3DUIA 4YFZA 4I30A 3WG3A 4BOWA 1JYIA 1GSLA 2WKKA 1LU2A 3WOGA 4HL0A 2R0HA 4YW4A 3WDVA 1CONA 1JUIA 2GDFA 3ZXLA 2P3JA 2VXRA 2WT1A 4XJUA 3SISA 1LEMA 3WDUA 5IT6A 3T1MA 1PZ8A 4M02A 1MS8A 3T2TA 1ULCA 1S0CA 4YW2A 3INAA 3A4UA 2ZGOA 2WQZC 1YI7A 4FQ4A 2NP0A 2R1DA 1XQNA 2BQPA 2ERFA 2D7FA 4MYEA 1LTEA 3ASIA 3CNAA 3KQRA 1N3PA 1V6LA 5T54A 1JBCA 1B09A 3VKFC 1WUVA 1G9AA 1V6IA 2DVBA 1SBEA 2D6LX 1W6MA 3NV4A 3SNMA 2NZ9A 4GKXA 4H55A 1LOCA 1YRZA 5DG2A 1GBGA 3USUB 2PHFA 5JOXA 4XMIA 4XBQA 2DTWA 2V5YA 2E7TA 3RMXA 2WSVA 1Z0HA 1MZ5A 2XG3A 2DUPA 5DUVA 1VAMA 1ENSA 2W39A 4FOQA 1N1TA 1QOSA 2DV9A 1UMZA 2V73A 1NLSA 2A3XA 2JJ6A 4FPGA 2JE7A 2OVUA 3HR9A 3BODA 4RA0A 1VLNA 1AF9A 1CVNA 2ZACA 1I1EA 2GMPA 4XIKA 3ZSLA 1LGNA 4JRAA 2FHRA 1G9DA 1TEIA 4XJZA 5EYYA 4FPHA 2C5DA 1LESA 1QOTA 3QLQA 3PMEA 3WUDA 3VKOA 4GXLA 3B00A 1BXHA 5DUUA 4Y20B 1LOBA 3R05A 1GKBA 5H9PA 2A6WA 1IS4A 4Y1XA 5DXDA 1FV2A 1J1TA 4YGBA 4P9XA 1C4RA 2R1BA 3USUA 1ENQA 2NM1A 3KM5A 5GLVA 1Q8PA 2OW4A 3O12A 1DBNA 1LGBA 1APNA 4JCKA 1I3HA 2DWRA 2GMMA 2DUOA 1C1LA 2A71A 3LSEA 1KQRA 2ZGLA 1GV9A 4YGEA 5GLTA 4NOTA 4OZXA 1S0GA 3N7KA 2VW2A 2VW1A 4FPOB 4XXAA 2YMZA 5GZFA 4TZDA 3RMYA 1A8DA 2UWAA 3SH3A 3B01A 2YV8A 4K20A 1LECA 2NN8A 4Y20A 1QU0A 2YXSA 4LBKA 4LBLA 2NMNA 1HDKA 2AH2A 1JN2P 1F31A 2WT2A 4FPFA 4YLZA 4LBJA 2ZGUA 4YW1A 3VKNA 5F9TA 2DURA 2R0FA 1ULDA 5E8AA 4AGVA 1BKZA 2EALA 2W52A 3WDWA 1H9PA 3GALA 4DFSA 2ZGKA 3R4SA 1O4YA 1WW4A 4PBOA 1KJLA 4GA9A 5JMCA 2ZHKA 1WW7A 1UPSA 1DYKA 1IS6A 1X50A 5T5OA 3UK9A 1SLCA 3JUUA 3RRDA 3AXDA 4FOYA 1MZ6A 4Y26A 1Q8QA 4M3CB 1BQPA 4WZFA 1YXWA 4C1XA 1MS5A 2D6KA 2D3SA 5EXOA 1N1YA 4Z8BA 5KXBA 1DQ1A 4LBNA 1BJQA 1OKQA 3C2UA 5GJ6A 2CWSA 1IOAA 2A7AA 2SLIA 5T50A 2C9AA 3RS6A 3AJYA 5EWSA 1MS0A 1FYUA 2LTNA 3T1LA 4Q26A 1Q8OA 1W6QB 5GZCA 2VUAA 1KDKA 2UWCA 5T52A 4UW5A 4YZ1A 3D5OA 1W6OA 4ISQA 3U4XA 3AYEA 1KJRA 1S0JA 2VY0A 4UW3A 2P3IA 4W65A 1DLLA 3N7LA 2ZGSA 1SLBA 1UZYA 5F5QA 1QF3A 3ILFA 4FPYA 1UN1A 1DQ5A 5JOZA 3POWA 5DUXA 3W59A 2KVZA 1G86A 1LCLA 5BYNA 1C57A 1EPWA 4PF5A 3O0WA 3SITA 1LHUA 2A70A 4DRRA 1LODA 5GZEA 3MW4A 1QNWA 1QNYA 1JYCA 3LCPA 3OYWB 3SH5A 2JD4A 1LENA 4Y22B 5E88A 4YW3A 5JLVA 1DFQA 1W6QA 3ATGA 4KBBA 1AXZA 3B69A 1FATA 5H9SA 4YM1A 3V64A 4BM8A 4BMEA 4YM2A 4FOVA 4PQ9A 1V6MA 3FFZA 4DPNA 4XILA 1FX5A 1UAIA 2DU0A 3WG1A 3HN1A 3AP4A 4FVVA 3VUOA 1LGCA 2R49A 1W0PA 2EXKA 4K21A 1SLTA 2ZGTA 1ONAA 3APBA 3M3QA 2A75A 3H0OA 4YW5A 1UX6A 4XMAA 1GNZA 2RHPA 3V0AA 5T5JA 4ASMB 2WLQA 5DUWA 1DQ6A 4YZ3A 1N1SA 1DZQA 3ZXJA 1LHOA 2ZABA 3ILNA 1AJKA 5DZGA 2WSUA 4GWMA 1ENRA 1MS9A 3WUCA 3NV2A 2P34A 3NWKA 2ZGQA 2UURA 1HQLA 3PVOA 5DZFA 1WW5A 1VALA 1Q8SA 4M01A 1W6NB 1S0EA 3A0NA 2A6ZA 1OFSA 2AYHA 2G4IA 1WBLA 1G9FA 2ZHNA 4Y1YA 2GN3A 1FNZA 2YROA 1V00A 2ZMKA 2ZGPA 1QDOA 2GNDA 1UKGA 4BQ1A 3BTAA 4FPJA 4FPLA 2DUQA 4UW4A 1HKDA 1ZA4A 3R4UA 1D0HA 3WG4A 1AX1A 5CA6A 3WV6A 3AZXA 5CNAA 1FV3A 4AGGA 1WW6A 1AVBA 1AXKA 3ZYRA 4XIOA 5HCAA 1RINA 2GNBA 4XDQA 3QCWA 3I8TA 5IK8A 1MACA 5AVAA 1GANA 4F83A 2R16A 3ZSMA 1YIFA 3N7JA 4LBQB 2ZZJA 2E53A 3Q9OA 1SFYA 1FNYA 3POYA 5GM0A 1SBDA 3PVNA 2JKBA 3AP6A 3IN9A 2VW0A 2UU8A 1H30A 5JDBA 5FRAA 2YZ4A 4ZXKA 1VIWB 2EXIA 1SLAA 3MEPA 2E51A 1GICA 1LOAA 3WCRA 3B9CA 2D3PA 4XYXA 1KITA 2ZA9A 1GZWB 3AYCA 3M2MA 4GALA 5JVVA 3WHTA 1JW6A 1V6NA 1N47A 2GNMA 4ITCA 3POSA 4XE9A 4SLIA 3ZSJA 3AP9A 4AVSA 4YZ5A 3M1HA 4XJ9A 3ZSKA 3AP7A 1O4ZA 1H9WA 3O5SA 2P3KA 1JOJA 1MS4A 1WD4A 2P37A 1S0IA 3WG2A 4YGDA 1Y7BA 4XTPA 3V0BB 5DZEA 1SBFA 4XHXA 1DYPA 1U0AA 2CWMA 2GNTA 1W6PB 1YYNA 5DG1A 5GZDA 1BZWA 2E7QA 5LK5A 1SCRA 3IMNA 1QMJA 3VV1A 3ZYPA 3AYAA 4WVWA 4FQZA 4BLJA 1MS1A 4JC1A 4R9CA 1F5FA 4R9AA 1AJOA 3LSDA 4ATEA 1LOFA 1DQ0A 1AX2A 2FMDA 2VU9A 3AZZA 3M3EA 1S0DA 4YGCA 3FLPA 3OGGA 2E6VA 2W08A 1S1AA 2AGSA 1Q56A 4XTMA 2ZMNA 1CIWA 3SH4A 2KYWA 1RITA 2AENA 4Q2FA 4BMBA 1QGLA 5KXEA 3PVEA 2H0BA 4LBMA 5H9RA 1PZ9A 2LALA 3PJQA 4M3CA 2I2SA 1DQ2A 4XHBA 2A5ZA 1W6PA 3OPZA 4ATFA 1KRIA 3JU9A 3AP5A 3ZPYA 2OUJA 1ULGA 1MR5A 1D2SA 4XBLA 4XXPA 1W0OA 1Z78A 1SLLA 3WNXA 1KDMA 5GLWA 4NO4A 1IKQA 1DHKB 2NYYA 2ENRA 4XZPA 1CR7A 2EF6A 3AX4A 2D44A 1VAVA 2TEPA 3TAYA 4K1YA 1JXNA 5IK5A 2GN7A 3V65A 2EIGA 4AVTA 1QOOA 3N35A 2EAKA 2ARXA 4FP2A 3WZ1A 3ZXKA 4WVVA 4ISRA 2OUHA 1MVQA 2ZAAA 5HCFA 5JOYA 1GYKA 1MVEA 3RSJA 3FLTA 4XBNA 5GLUA 3ZXEA 3AZWA 2D43A 3OBTA 5T5PA 3RQ0A 4DRVA 5KXDA 3OYWA 1GZCA 3WDTA 2AUYA 2A6XA 4Y22A 3O0VA 1CPMA 4FP3A 4YG3A 5FREA 1FAYA 1LULA 4HANA 4AGRA 4ZKTB 2PHUA 4C1WA 1GZ9A 4P9YA 1A78A 3IKWA 1LOEA 4TYSA 4P9WA 3M3OA 3A0KA 3NV3A 4DQAA 1Q8VA 4FPKA 2UWBA 2ZGMA 2CNAA 4AYUA 4PCRA 3WDYA 4U2AA 3AJZA 4YZ2A 2ZHLA 3AYDA 2CY6A 4M3CF 1V6OA 3IPVB 2A3WA 3N36A 1CQ9A 2WNEA 3BIWE 2SBAA 1G7YA 1G8WA 4Q27A 1SCSA 3ZVXA 1MS3A 4BLIA 1OQ1A 1A3KA 4CRQA 3AZYA 1RIRA 1GNHA 3ENRA 5L73A 1G9BA 2Q5TA 2HYKA 4U36A 5CB7A 3O0XA 1DQ4A 2PHXA 1CESA 3ILRA 3MW2A 2DYCA 4UW6A 3WDXA 1LOGA 1HQWA 1URXA 1ULEA 1WLWA 1DIWA 4XJWA 3HMYA 5GZGA 3WLUA 2D6PA 1W6NA 2NMOA 3W58A 1GLHA 2CL2A 2ZBJA 4FOWA 4Q8KA 3UL2A 2DVDA 1ZM1A 3GNEA 2D6OX 4M00A 4M3CE 3FUQA 2CTVA 3OBRA 3ZXFA 2WJSA 4Q1PA 1C1FA 4D69A 2XB6C 3IPVA 1LHNA 1N3QA 1PZ7A 2PHTA 2Z42A 3WCSA 2DVFA 2ZGNA 3SLIA 2DVAA 3FLRA 3M3CA 1HLCA 2DTYA 2PHWA 2CYFA 1IS5A 1LHWA 1CPNA 5IK4A 1QKQA 3N3HA 1N3OA 3BOPA 5GALA 4CZSA 1AXYA 1BYHA 4BPZA 1WBFA 1CJPA 4GKYA 4YM0A 1N1VA 4Y1ZA 4XJAA 2AREA 2KT7A 4AWDA 4WV8A 4LBQA 1V6KA 5CAZA 4AVVA 2GMEA 4K1ZA 5IK7A 1AZDA 2JECA 1IS3A 3AZVA 4Y1UA 1UZZA 1WCSA 2D3RA 1UL9A 4XOGA 3OJBA 1WLCA 3VKLA 1NXD1 4YG6A 1W6OB 3MW3A 2YY1A 3UJOA 1IKPA 3AFKA 4L8QA 1GZWA 4GWNA 5HCBA 1QDCA 2P2KA 3WHUA 1V6JA 4Q1RA 4YG0A 1R1ZA 3N7MA 1YO8A 3D6EA 5T55A 1LEDA 1CN1A 5EYXA 3NV1A 1LU1A 2ZKNA 2JDZA 4Q8LA 1LJ7A 3OY8B 1SLIA 4YFWA 2EXJA 4IQPA 4YZ4A 1JHNA 2B7YA 5E89A 1G9CA 3IM0A 3V0BA 2ARBA 1DGLA 3FUOA 3VKMA 2JE9A 4RL7A 2AR6A 4LBQD 5IUQA 2PELA 2VH9A 4LBOA 3UJQA 2D6MA 1SACA 3MPPG 1ULFA 4R9DA 1S0BA 2D6NA 2KM2A 3D4KA 3FBYA 1LOFC 3DGTA 5GLZA 3RG0A 4XJ8A 4Y1VA 1AX0A 3WVJA 1WD3A 4R9BA 4CTEA 4PBPA 3I4IA 4YM3A 2A6VA 1WLDA
chains in the Genus database with same CATH superfamily
5JOWA 4LA2A 4QGMA 1C8NA 1HN0A 2ZHMA 3D3AA 4WVZA 3BY4B 1ZBA2 3DPRA 2WABA 4NAOA 2RMU3 3ACHA 1L7YA 2W9NA 1H8CA 1BMLC 5IFTA 3O14A 3O1TA 2ZGOA 2LMCA 1B09A 3ZYBA 5IATA 1SJED 1T0SC 5JR2A 5H92C 3VDAA 1YNTE 1K51A 2V5YA 2WSVA 4D6QA 2ZZQA 3NG0A 5LASA 1QOSA 3GYDA 5FZMA 1NLSA 2A3XA 4EN0A 1TME1 2JE7A 2RJKA 2GMPA 4JRAA 2C0ZA 4GXLA 4Y20B 3POGA 4OI2A 5DAVA 5DXDA 1W2AX 2ZEWA 4JLCA 4YGBA 3CMGA 2BWFA 4JCKA 5BUVA 4RGMA 4GMP1 1EF1A 1DG6A 4OHZA 4NJ4A 5J3UA 3UGGA 2Y6JA 1ASJ1 3H1YA 2KWCA 2YXSA 1UD1A 3QHTA 4I6LB 3GALA 1K45A 4QAWA 4DFSA 1NYWA 2JDUA 1K53A 3HVZA 1DYKA 1IS6A 2OOBB 2QKDA 3LDKA 2J1TA 3CL1A 2EMTA 1MG4A 3AJYA 4OVZA 1LRHA 3AMPA 4EYUA 3EBRA 4Q4Y2 1JYWA 1S0JA 4P9GA 4XC9A 2A5UA 1DLLA 2OPWA 3WQ0A 1DQ5A 3BWUD 3GZNI 1J83A 1AARA 1EPWA 2LRPA 1JYCA 2MEV2 2MSED 5ISLA 1PIV3 2KHWB 3WT3A 2R063 1UYZA 3OAWA 4LNIA 5AFBA 2BW8A 2RS33 3I2GA 2DDUA 5EZWA 3P42A 3MV01 2V72A 1UWXA 2A4ZA 3ZYJB 1V8CA 5FBZA 2IBIB 3DWMA 1EAH1 3ZXJA 2C9KA 2LXAA 1E5SA 4GWMA 4L11A 4HVBA 4XUNA 3HT2A 5LW9A 4OYUA 2M8SA 2OX0A 5FZ6A 3HT1A 3WF2A 4A42A 5FPAA 4WQMA 4YT0B 3PVBB 3AEGB 2BJSA 3N7JA 1LB2A 3I63C 4LNFA 4ZXKA 1WZ3A 2TNFA 1ZRFA 1OLRA 2MHFA 4QPYA 1MZEA 4MV2A 4BQ4A 4P9JA 2VM9A 4ES9A 1POQA 1QEXA 1JUHA 5G05L 3ZSJA 3NNGA 3ROUA 2M56B 4OHWA 3I54A 1QH7A 1OLME 4JX1C 4YGDA 5F5AA 4XHXA 2CWMA 1U0AA 4FBFA 2LASA 4LT5A 1C4AA 3QH7A 4IE6A 3T4HB 4X57B 4IWOA 4HKWA 4QXHA 5A6YA 5FYYA 4Z92B 4XTMA 2GH8A 5LZ6A 1H2NA 2QNKA 4XHBA 4NPLA 4QXKA 3B2FA 3PO0A 3IT8A 2L52A 2XHKA 5LA9A 4NO4A 2D44A 1TS5A 2KKCA 4PDWB 4AVTA 4MJSB 1O8PA 1CAWA 2OIIA 3RUIB 5FXWA 1GQGA 5HCFA 5CFDC 2GBKA 4UFJA 1E5RA 2HWF2 5A3WA 3M3IA 2Q1ZB 5T5PA 4JGHB 3CBNA 4QU1A 3B5LB 4IWQA 4FP3A 4A55A 4P9YA 5FQ0A 2I45A 2XVLA 3A0KA 2NQYA 4N59A 2CNAA 3AE8B 4TSVA 1F4AA 5ACA3 5FPUA 3BIWE 1QJEA 4EV0A 3N20C 2Y34A 1JH5A 4NUBA 4DQOC 5DPRA 4U36A 4IEWA 4CVUA 4GH4C 3AMMA 2JB4A 2RDSA 1GZTA 1C79A 2JWPA 1DIWA 1OF3A 1RUH2 1RM6C 2PJHA 4FOWA 2P17A 4G9SB 2V3NA 2PAKA 5BYSA 5DPTA 1PK6C 2WFPA 3WCSA 2R043 2DVFA 5C4WA 1AR71 4D7SA 1CJPA 1AYFA 3GHNA 4WV8A 5DMYA 4PJYA 4LPLA 2QTWB 5FZFA 4USAA 5AZFA 4CU7A 1AZDA 1XNKA 3AZVA 1Z7S2 2XVGA 3VD5A 3B93A 5FY5A 4XF0A 1CZPA 4ZONA 3PPAA 3MBWA 1EUVB 1PM7A 1W8NA 2O2VB 1ZYBA 1U5XA 3NV1A 1LU1A 4NAMA 2ZKNA 1KLUD 5HG2A 1LJ7A 3HQUA 3PTFC 1DGLA 2PELA 1VBC3 1UZ0A 3IB3A 3LEMA 1O59A 4CDXC 2JPHA 2RMU1 4MM3B 2NTTA 2V3SA 3FHQA 4CTEA 2A6VA 4BQYA 1QF6A 5H9QA 1F9KA 3V0AB 3RFZB 1BLZA 3LZZA 2Y5BB 5C8WA 1JU4A 4YFZA 3KSCA 3UKVA 4RR3A 2R0HA 5FZ4A 3WDVA 4DHZE 2DYOA 3ZXLA 5BV6A 2VQ0A 2W54A 4RNAA 4CCCA 3NNMA 4RGOS 5A6XA 1ENXA 3ACGA 4QX5A 2MEKA 1WYWB 1W6MA 5CA6A 4GKXA 4FHKA 4ANWA 1W9FA 3JD73 5F6KA 3VAWA 4FOQA 2KWUB 4HKLA 3CIHA 4RA0A 1QLBB 2AEZA 4FJZA 4EE2A 4GJZA 4COVA 1AL23 1FMD2 4NHXA 3Q3NC 1Q8PA 3KV5A 1LGBA 4RMAA 3I2KA 2KDIA 2IO0B 1NQJA 3VLBB 2A71A 4YGEA 4FLHA 4RQPB 2VUJA 4COWA 2OPKA 2L0FA 3TEYA 1LECA 3NNJA 3MZHA 4YVSB 2BW2A 2WO1A 2R0FA 4AGVA 1O4YA 2JIGA 1CJEA 2ZHKA 2ZJCA 2YEPB 4HLTA 1RVF3 1VR3A 1WZ0A 3RZLA 5KXBA 4LBNA 3ACFA 1HV0A 1IGOA 2F6BA 5EWSA 2UWCA 3TJPA 1UU4A 4S2FA 1KJRA 2VTFA 1PIV1 4N53B 2R061 3ILFA 4CEYB 1H6YA 2RS31 2LJ5A 2PTMA 1OBNA 2RVAA 4A3ZA 2BTEA 1C77A 1DFQA 1QJX1 2GC2A 4PQ9A 1V6MA 2YG0A 3ACIA 4XF3A 3TN92 3DPDA 2C7NB 3DHIC 3N9LA 2A75A 5I91A 4KWLA 3AFGA 4JGYB 3WF3A 2WLQA 1DQ6A 4IEQA 3I2IA 2WSUA 4DUWA 2Y5CA 3USSA 2BPA2 2UURA 1NZCA 3O1PA 3SFDB 1JWAD 4CDQC 3A0NA 3A21A 2XOMA 3M8LA 4GMVA 4II3B 3GF6A 2DLBA 2BKRB 4FCAA 5CNAA 4K7WA 1WW6A 2H0VA 1JQ4A 3I8TA 3A33B 1ZZ9A 1X7NA 3QAQA 1SFYA 2Y38A 2VW0A 5BO4B 4DIQA 2UU8A 1W9SA 5A33B 5FRAA 3IT4B 1XE8A 2EXIA 1H8VA 1JRPA 3WCRA 1GZWB 1RFKA 4ITCA 1KEXA 5FLJA 2ICIA 5L83A 3HIFA 5DDJ3 1IQAA 1T5XD 2P3YA 4RCOA 2H6BA 2EIEA 4XTPA 5J17A 3AXCA 5CFCC 3W2DA 1W8HA 4ZRJA 2KTRB 3KHCA 3KVAA 2GLSA 1F5FA 4BYYA 3R8BA 5FCCA 1ZVFA 1UH6A 3OGGA 4QGNA 4BVUC 4OVEA 2QQPA 3V05A 3DXTA 5J09A 2WLPA 1GB1A 1X36A 3PJQA 2AQ1B 2A5ZA 3OPZA 2WAOA 1NCQC 1WF9A 1QXPA 1MR5A 4META 4R8HA 3WNXA 1H8TC 1ZRDA 4JDNA 1POV3 2CHHA 1WCUA 2FUG1 2OQ6A 1HTOA 4RFT0 2Z8LA 1D6EC 2P6CA 3AZWA 3CO2A 5ACA1 1Z2MA 2B42B 4CE8A 2JG8A 2HH9A 4ASWC 2WRAA 3ZKYA 4ZRQA 4PLNA 3NL1A 4TYSA 1TIFA 4IUMB 4PLMA 4HN1A 2N9LA 1R1A2 1FPN2 1OTRB 2R6QA 1XT9B 3IPVB 2W3RA 1DOYA 2WU2B 2RJLA 3O0XA 3ZIMA 3IFWB 2WXHA 3ZYGA 4W9JA 3JQXA 3AKRA 3TRSB 3VFKA 1W9YA 1S2KA 2LZ6A 4LNOA 2EAAA 5FFOC 3VBRA 3OBRA 4Q1PA 1N3QA 2Z42A 5JZEB 3TNPB 1F77A 1JWMD 4QX0A 1BYHA 2K0PA 1MVKA 1UO9A 4OZAA 4IDZA 3M62B 4AVVA 5K4LA 1IS3A 3QC8B 5TR5A 4Q0VA 4HCNB 1WLCA 1W2TA 3AC0A 2HTME 3RNSA 2N9KA 1VBC1 2EIDA 1KGYA 4Q1RA 4YG0A 4ZRPA 5ABJC 5C5TA 1FEHA 2UWQA 1UMIA 3C3VA 2KD7A 4FHJA 5A7NA 3J9CA 2OS2A 2CHXA 5IUQA 2XJPA 1D5ZC 2YBKA 4YNIA 3DYPA 4KV2A 3KCCA 2HWB3 3K4DA 1QY4A 1JZ5A 1FRRA 2DU1A 4KNCA 4AL9A 1S0FA 3C7OA 4TV3A 1C4CA 2QZ3A 2HJ1A 5SV8A 2XBO3 5F32A 2L00B 1N6ZA 2L76A 5E16A 3JD71 5BNOC 3SISA 2G9FA 3C19A 2CHWA 3J4UH 3H8OA 2VZ3A 1YI7A 4P5YA 4FULA 4PDWA 5HV4A 2O6VA 4MJSA 3ASIA 3KQRA 1JI6A 3E5QA 1JBCA 1OA3A 3T3YA 2J52A 3UQBA 1AL21 3NJVA 2DTWA 1MZ5A 2JDNA 3MF9A 4LO4B 3Q8BA 5CEHA 4FADA 3KWVA 2OVUA 3BODA 1VLNA 4QDSA 1PX4A 4XIKA 2CDPA 1G9DA 1I6XA 1R4NB 5K0UA 3C7FA 3WUDA 4RN5A 5EJ1B 3EA6A 1J7CA 2RR13 1EUTA 5FV3A 2KJHB 1NCRC 1RJ8A 2DFBA 1CZSA 2NM1A 4LHNA 3NAPC 2RPQA 2GAUA 2G4DB 3W1YA 4NOTA 5SV5A 3U30A 1VCBA 3IDAA 3VDDB 3VTWA 1RVF1 4X8NA 3D0SA 2YGMA 2HEVF 1HDKA 2JT4B 1D2QA 2DURA 2WDRB 3JUUA 3AXDA 4M3CB 3UF8A 3VD9A 2V5DA 1IG3A 2JD9A 2VMGA 1BJQA 2ZAHA 3VH3B 2W95A 5T50A 3R7QA 3KMHA 1W99A 4Q26A 3AE5B 2KMCA 2O2VA 4KDIC 1G86A 4M4RA 5LWBA 3VBHC 1JTZX 3SITA 5EIYB 2BBVA 1J58A 4AHYA 3TSSA 2XR4A 5AEKB 3KB5A 2GC3A 4RS5B 2VCMA 2L1AA 2FDIA 1WH3A 4HROA 4MM3A 3LFIA 1HQRD 2J1RA 4IE4A 4LKDA 4B7KA 2K1FA 4YYOA 3V0AA 2OXBA 5TSWA 1FMAD 4YTNB 4YZ3A 2BYVE 4NN0A 3ILNA 1YIWA 4LJPB 4LEJA 4WAFA 2HBTA 1OFSA 1NYQA 1VJ2A 3DN7A 1ACCA 1WJNA 3PUQA 4HZFA 1UKGA 2L9LA 2FDHA 3R4DB 5A7WA 4AFCA 1L5PA 3WV6A 3WP4A 2JRHA 4DWFA 3ZYRA 1W8ZA 3OOXA 1W9TA 1XYOA 5FWJA 1K5MB 5DDJ1 3HRDD 4WM7B 2BTVC 3UIOB 2ZX2A 2FDJA 1T0YA 3AYCA 3BUCA 2DCZA 4UFMA 5C3QA 1RUH1 3H7YA 4JE3B 4QQ2A 2PVOD 4RH6A 2VZOA 1O4ZA 2QDFA 1XLNA 4KWJA 3GZEA 3BTYA 1VBD2 4P7IA 4CCMA 3W5UB 2E7QA 4M0WB 1XE0A 4BIFA 4P9LA 3KF5A 1N62A 4YVSA 1AX2A 2VZQA 4YGCA 2WHIA 1POV1 2HWD2 3BALA 3PLVA 3L13A 3B1LX 1Z7S1 2IWGB 1OVPA 2AENA 2FUHB 5C23A 1DQ2A 3BTZA 1D4VB 1XE7A 1W3VA 2KK8A 4XBLA 1F35A 3PU8A 3ZVVA 4BOSC 3BB6A 3O7OA 1V0AA 3AX4A 4KIKB 5C8CB 1WMDA 4IEVA 5FJKA 3URYA 1X8EA 1ALYA 1CAXA 4DINB 3RSJA 1GP5A 3CU7A 2G1EA 2B4KA 4NHMA 3ZNID 2VUDA 2WDVB 1UGJA 4KX6B 2D43A 3OBTA 2ZPNA 1DF0A 3TEWA 3PZ7A 2AUYA 1NI3A 3AKQA 4IEYA 1ROEA 4LOTA 3ONSA 3WD5A 4EEWA 2MW5A 4U2AA 4YZ2A 4LNKA 2PEAA 4WM8A 3EQEA 4XZ4A 4GOCA 3ZKJC 4JGYA 2KJ6A 5EHDA 3W9CB 4P1BC 5EJ3A 3D82A 4UW6A 5LBFA 3N9QA 5LY1A 5L9RA 3DCGA 2W55A 3WF4A 5FYTA 3PLUA 2K46A 2VOWA 3ZO5B 1PX3A 4QM8A 5E6NA 1HRI2 1DYQA 4CXYA 3NKTA 2DX5B 4NIIA 1QKQA 2W1SA 4YW7A 3OGSA 4UAPA 5LXHA 4AEMA 2JVCA 1NX9A 4HKQA 3P4PB 5JXJA 2N7EA 1NXD1 2BYEA 1IKPA 1GZWA 2HWB1 1FFVA 1AUYA 3U75A 3D6EA 1EPZA 5EYXA 2VC9A 3RZJA 3S5AA 1SLIA 3U8ZA 1KD7A 2VOTA 4QPIC 4A8XC 4AQ2A 4IW0A 1SIJA 1YQ6A 2XBO1 4DO0A 1HJGA 2MBEA 4GDLB 1G6JA 3WVJA 4QX2A 3ZJVA 3I4IA 3GZNB 2PMWB 4AI0A 1LHVA 3WNNA 3RZFA 3SCGA 3DUIA 2JX9A 4BOZB 4KQ7A 3BYYB 4LK6A 1I4XA 3S5QA 4RHV3 2W1UA 4FQ4A 4W6WA 1GWMA 3NQHA 4MH8A 1EV13 2RR11 2NZ9A 3OGVA 4CUCA 5FR6A 2XQRA 1UY0A 2A1XA 2E32A 2KANA 3U7ZA 1QQP3 5CTRC 1GKBA 3ML8A 4MELA 5CHFA 2Y3AA 5FO8B 1OH3A 3CQOA 4BHPA 1H0BA 5I8YA 5D94A 3LA2A 2YV8A 2BYTA 3WEZA 2KTFA 2Y64A 1YD8U 1D4M2 4FPFA 4AEDC 3ZFGB 3VKNA 1MEC3 1MPXA 4LIUA 1BKZA 1SPPB 1YUDA 3HN3A 2L7RA 1SEFA 4PBOA 2LVPA 1W8FA 4YVWB 2Q1MA 1ZZCA 1UX7A 1EU4A 2JSVX 4B8EA 1REFA 2E9QA 1QOBA 2IO2B 1HXS3 4W9HA 2N7GA 2WXNA 5KHQA 3HM3A 2WS93 3N7LA 2WNVB 2I2YA 1XB9A 4NWVA 4HXCA 1RJ7A 3POWA 5DUXA 1SE9A 1K52A 1FPYA 4TQ0A 4NWWA 3OF1A 2BWCA 3LCPA 3BPZA 2JD4A 1LAJA 5EE3A 2KDBA 3POIA 4PQQA 4YW3A 2JRIB 4AEJA 3FFQA 2VQUA 2R32A 4CPBD 4HPKB 5KBFA 3O1VA 3T4VA 3GCWA 1G6NA 2P1BA 3T0DA 1LHOA 3ZYHA 2D97A 2FCMA 4AAXA 2BVBA 4J25A 4ARCA 3VTVA 1HQLA 3MYXA 1WW5A 2AC1A 2JZZA 5FBJA 2LI5A 2LFIA 3N32A 2G4IA 3RZGA 1WBLA 2J7QB 5I0UA 1AYN3 1Q5OA 2QC8A 4S0RA 1QDOA 5DPSA 3R4UA 3NVYA 1VRH2 1RFAA 5IVCA 4ZPIA 3M4FA 2GNBA 2C5LC 4Y5Z0 3LEIA 1MACA 5FZ7A 2O1QA 1PO22 5J1XA 1OH4A 1UYPA 5FZHA 2ZZPB 4Q4X2 3MEPA 4OLLA 3PRMB 2WIIB 2Q8DA 3E5XA 4AW7A 1SF0A 1TZOA 3O1UA 2C9WB 4WWPA 4GXBA 4B1MA 1O8SA 1W6PB 3IG3A 3ZFEB 5L7OA 3EFUA 1QMJA 5F3IA 4BJ0A 2XN9C 2G9HD 3UT0A 3U11A 3OPTA 3TNQA 2HJ8A 2LRUA 3LEGA 4A3OA 4CU8A 4WJOA 2PXJA 1QGLA 4AI1A 4RQPC 4M3CA 1C1YB 1T6BX 2R073 5C9AA 4LR4A 4KVGB 5FP8A 1UOJA 3IBEA 5CHWA 4JGZA 2QSDA 4WZCA 4K1YA 5C3PA 1QOOA 3GBWA 4FP2A 4EN9B 3T3OA 5LATA 2BBCA 2NPTB 5FZ9A 1LFDA 1H1MA 1UU5A 3WDTA 4WH4A 3OJ3A 5FREA 1JZ3A 4K6BA 1UWWA 2PHUA 2B9VA 4N53C 1W03A 3NV3A 2RE9A 2IDYA 3UGBB 4BU2A 4CEYC 2VVFA 3AYDA 4H7LA 3QACA 2QQIA 2G19A 1BT0A 3DHGC 2WZPP 3MW2A 2PHXA 4IG7B 2INNE 4AS1A 4BXSV 4CXXA 3H1WA 3UL2A 1UNBA 1H1AA 3B9IA 1O5UA 4JWSC 1KH0A 4D69A 4JGYC 3R2TA 2CJNA 3P4RB 5FPLA 2KD0A 1KS4A 4NJ6A 2VCAA 3SQOA 3TMPB 1PGXA 1OQYA 4WM7A 2KXLA 3VBSC 5JHBA 2VJXA 3DYOA 2HKXA 3UJOA 5FK9C 2W2IA 1YO8A 5E6JA 2XJQA 3O13A 5I4DA 4MH0E 1WGRA 1WM2A 3L54A 4FBJB 5A1FA 2JE8A 5F3CA 1SE3A 1B35B 4LBQD 2OEDA 2FDFA 2IZWA 3SD5A 1ULFA 3WANA 2IFWA 4LJHA 4RYDA 1AX0A 4R9BA 2YU2A 4RHV1 3RDIA 4AVCA 4PBPA 3N9YC 4B0MA 3JQWA 1PGW1 4MGTA 3VZLA 5KXCA 4UFLA 1EV11 1HEZE 1F9JA 2DHZA 2ZS6B 2J7MA 4HN0A 2VVEA 5LY2A 2FBWB 3VR8B 4J6IA 4F8CB 1DLCA 4LK7A 1MS8A 4YW2A 5G04L 3A4UA 5C8CA 3C8XA 4HKZE 1I9RA 3QARA 1QQP1 1OQEA 3U78A 1LOCA 2BS2B 2XDVA 1FOD2 2DUPA 1M4VA 1P98A 3AB0A 4QQLA 4LLFA 1PGAA 4CYDA 3LB9A 2W1WA 2RDBC 2WYQA 2HE7A 1E8XA 4XJZA 2DF7A 4QHOA 4IEUA 4GB33 5JXHA 3QH6A 2OA2A 1VMHA 4OQ8A 3MHSD 4Q4W3 1RUF2 1JHJA 1MEC1 1YQ2A 2DWRA 1S55A 1ESFA 2PAEA 1TKYA 3HVDA 3R6SA 2XLGA 5BMHA 3JBG2 3IT6B 2GU9A 1JN2P 1F31A 5A1LA 1RB8G 2Q4SA 3MJWA 3H7PB 4AVAA 1HXS1 2DZKA 1OPOA 1YN5A 5LA2A 1WW7A 3SFEB 2WS91 1JZ7A 1HRV3 2YU1A 2HEYF 3VDBA 1YXWA 1UOGA 2DYMA 5FO7B 1Y56A 2C9AA 1AR93 1Q8OA 5F8PA 3DBRI 1LKNA 1DDLA 1Q1OA 1L6VA 2LUWA 2QQKA 3WW1A 5C3OA 4LJOB 4KGQA 1VDVA 3HPNA 4RGAA 3B69A 3V64A 1XLOA 5HI0A 4FOVA 1YC61 4KKJA 3SXWA 2ZNVB 3WG1A 2L3ZA 1ONAA 4DB5A 1AYN1 1OI6A 2IUWA 3J7NA 1QZEA 4LKFA 5IVVA 2QVSB 2OQ7A 1V1PA 4EN7B 1AJKA 1DGRA 3DHHC 3I59B 4IV3A 4MG2A 2J1UA 4O7XA 3DYMA 1ULOA 4Q2JA 4EROA 1VBB2 3BTAA 3UV9A 3W9AA 4UW4A 1ZA4A 3KS7A 4WJQA 1YN3A 1NUKA 1O7FA 2IO1B 3QK0A 1F2NA 3VTUA 5JR7B 5ANQA 3UGHA 2FIFA 3POYA 3J8F3 1NKGA 2JXAA 1LOAA 4ZRKA 3M2MA 5F6LB 1A6CA 5KC6A 1HRI1 4XJ9A 3AP7A 1WD4A 3EJKA 1S0IA 4FXGB 3U7DA 5HKHA 4UFHA 5J2RA 1RUI2 1WIAA 3V0BB 5IW0A 1BBT2 4LLGM 1N5XA 3MLJA 5LK5A 3OTFA 4N7IA 2R071 4A7YA 4NAWA 2ORXA 4I0WB 4ACFA 2TSSA 4AHXA 4COZA 1DQ0A 1V6EA 1SPPA 1O4TA 1QJU3 2AGSA 1WCQA 1CIWA 1RITA 3L08A 4YVWA 3PVEA 4XWTA 1PZ9A 2IGDA 3VDDC 4AFMA 3ZGZA 4RSUA 2PYTA 5AFEA 5C3RA 2XBBC 2OUJA 3ZX7A 3P3PA 3QJZA 4AP4C 1WFYA 1OUSA 2WGSA 4BCUA 2NTSA 3K9PB 1VAVA 1J7BA 3PTYA 5IK5A 1X82A 2QBXA 1WMEA 3ZXKA 2XNAC 4Y33A 5FZAA 2O8QA 2DCYA 2ZCWA 1WGPA 2KDFB 4MACA 3VBOB 2RDNA 4QQPA 1LM8B 1FAYA 4TUUA 2KZRA 1HV1A 3MGUA 4KGGA 4NJ7A 5L95C 2CR5A 4BDVB 3WDYA 1YX5B 2L05A 1R092 4BXFA 1CWPA 1G7YA 4E71A 1GP4A 2XVKA 3WR0A 3K75B 4RS5C 4DXSA 3IIIA 3AE1B 5C71A 4ARIA 1KOTA 4M3CE 4AAPA 1C1FA 2XB6C 5IKCM 3KYDD 2BOJA 3SLIA 2DTYA 4JX0A 1S2EA 1WBFA 4PIYA 2SEBD 4OULA 2B5HA 1UOFA 1AR62 1WCSA 2JDHA 3MI8A 4GWNA 4IM0A 1R1ZA 2KX3A 1K5MC 5CFDB 3A22A 2EXJA 2HWE3 2RS52 1VB4A 5JIAA 4YSYB 4ONUA 1BEV3 2XJRA 1AYM3 5FK8A 2D6MA 1GUAB 2WXQA 3HAGA 3VN4A 1US2A 1S2BA 3JBG3 2WXJA 3RPFC 4Y1VA 5FWEA 4AQSA 1WY8A 3PT2B 2BDRA 3NW4A 2GALA 4P14A 5LLIA 1NLRA 3BYWA 4FFFA 3BYTB 1KM7A 2ZMLA 2A6YA 4I0AA 3WNKA 4GH4B 1WWYA 4FTSA 3OG2A 2MP2A 1VJKA 4XE0A 2M19A 4HK8A 2G9GA 3SKJE 5LRSA 3G7DA 3WALA 1LTEA 1DGRN 5FDBA 1SEBD 2D40A 2LGYA 1PK6B 3AEDB 3LE0A 3UI3A 2NPTA 5DG2A 3USUB 4GB31 3D8CA 1UU6A 4Q4W1 4WVMB 5A3PA 1UMHA 3JSVB 4DXGA 2LVQA 3TL5A 3AL6A 2YPJA 2KA3A 4O9EA 4UDUC 2ONQA 3TIXA 3VB9A 1WCDJ 5CHVC 5DN2A 4AOFA 3AEAB 2K8HA 3QWZB 1C1LA 1E8WA 3ZXRA 4MX3A 1XCQL 5GLTA 5D7GA 1OT5A 2XUEA 1JWBD 2AH2A 2D5HA 2WN2A 1AR91 1ZZ7A 4Q4X1 3AV8A 4I09A 1UZVA 1KJLA 1J3PA 3DBSA 1SLCA 4LTAA 3H3LA 4C1XA 4OI4A 2R2QA 3TUOA 3SEBA 1IHMA 3AL5A 3WP3A 3U4XA 1E8ZA 1JMUB 3GBGA 1A70A 2JDAA 3H8XA 5JPNB 1HXYD 2ZGSA 1RYJA 3KCXA 1WX7A 1LCLA 3KF3A 1WI0A 4W50A 3CJIB 5APAA 3B94A 2V9HA 1U5YA 2WXFA 2VMFA 1STEA 3E6DA 3KGLA 4QDQA 2DU0A 1D5XC 2TBVA 1WA4A 3HN1A 3RI7C 4EFOA 2GOWA 3A1QA 4BZ4A 4LOSA 5EE9A 4XMAA 1PO13 4G50A 1T2XA 3MIFA 4NRPA 4HK9A 5D2AA 4XFCA 1J19A 4L9BA 2XWBB 3T2OA 2DFCA 2WWJA 3WINE 3DXUA 4S2HA 4BQ1A 3J8F1 5JXGA 1YQ8A 3OUIA 2GBNA 4KSLC 1H4GA 2Q5WD 4IEOA 5LA0A 1FO4A 1AX1A 3FZ3A 5A1AA 4AGGA 3VUYA 3ZW3A 1AVBA 4W9LA 1TKGA 5DAQA 5IK8A 2X09A 5AVAA 2DZIA 4PYZA 4WJNA 4B9KA 3EFCA 2ZZJA 4A7KA 5FYHA 2JKBA 4DDID 3VHRA 3AB5A 2YZ4A 3V6EB 3WSOA 4QT6A 4UBGA 1BVP1 3CIRB 3WHTA 2JICA 1UUPA 4XCAA 2JZ3B 4PLOA 3RULA 1CJDA 4K7JA 1QJU1 2B46X 2OHFA 2GNTA 3VBUC 2VQAA 1SCRA 3DF0A 1QJFA 4ATEA 2W5FA 2XUMA 3Q2AC 1JOPA 2JG9B 3H7PA 2E6VA 2GC1A 2GH2A 2O0OA 4MDKE 3JU9A 3KUCB 3WCQA 1GOHA 1E57A 5GLWA 3ZFGC 2NYYA 4J6GA 4JV4A 1PGL2 4HPPA 2WNOA 3O1RA 1W05A 4ISRA 3AE2B 4BKTA 4W9IA 2DBYA 1WRDB 2FQPA 2IXCA 2Q8EA 3RZWC 2XKOA 4LUKA 3ZFFB 4XF4A 4L2NA 4CCKA 2WNVC 2YPDA 2DENB 2K0GA 3T09A 2I74A 1DOIA 1STMA 4HBNA 2Y60A 1Y43B 1RIRA 3KT1A 4HCPB 1PDXA 3L2HA 2MBOA 2HJIA 5FZOB 5CFCB 3I59A 1FOD1 2ZBJA 5FMCA 3M95A 2DVDA 2CTVA 3ZKUA 3U10A 3ZXFA 5JPMB 4KKIA 2JDYA 5AZGA 1S3SG 1PZ7A 2PQSA 3RCZA 2DVAA 1ZRIA 1RUC3 5KWRA 1IS5A 3F2ZA 2FMYA 1ZXHA 5J36A 2WP9B 4DDGD 2GMEA 1SBBB 5IK7A 3RNGC 3MIBA 4BQXA 3ZJUA 3WAOA 1NCQB 3AECB 3LJ3A 1C9FA 2HWE1 1UYXA 3ZN4A 4AOCA 1BEV1 1AYM1 3AFKA 4UXAA 3HBKA 4BIOA 3JBG1 3X23A 4Y5SA 2RJ2A 3WAMA 4FJVB 4YZ4A 2W3JA 1Y8RC 3IM0A 3V0BA 2J0KA 3VKMA 1J1LA 3UJQA 5JMOA 1XEEA 1V5TA 3LOBA 2VBPA 1Y3TA 4TWTA 3OCPA 3K3OA 4XFHA 4AQ6A 5M0TA 1ULPA 1F8VA 2W68A 3OY8A 3ETRA 5A80A 4EWEA 3ZFEC 1TTNA 4E4HA 4YW4A 4FSJA 1F4HA 2XEWA 4QHZA 4B6WA 3CNAA 1R083 2YDEA 1W8TA 1TQ5A 3S7IA 4H55A 4O61A 1GBGA 2I1KA 1UF2C 1ENSA 2DV9A 1PFDA 2D11A 1RWSA 3J7MA 2EMSA 1I1EA 3P4SB 5G5HA 2V4IB 2H6CA 4YWGG 3KV6A 4HETA 1MG8A 4B3NA 1LESA 3QLQA 1YLLA 1VBE3 1NY72 5DUUA 3AMHA 2FZ1A 1AHSA 1OURA 4P6VF 4BK5A 2QJVA 3VZJA 3NUHB 2RSUA 4S2DA 5ABJB 1YFWA 2DUOA 2JX5A 4OUEA 2K9ZA 4OZXA 2VW1A 3P2BA 2BERA 3VRBB 1YQ4B 3WNLA 1E7UA 2W52A 2WFF3 1COV2 1RAXA 1X50A 4C0HA 1Q8QA 4QPGB 1BQPA 4Q4V2 5EXOA 4URAA 5FLIA 1F2RI 3IAQA 4BQ2A 2M17A 5J7MA 3MICA 3CWIA 2LROA 2Q0AA 1W6QB 4HRSA 5BNOB 1PVXA 4UW5A 2J0MA 1RMU2 1UXXX 2FIDA 4RF0A 4FPYA 1X33A 2KVZA 2IXHA 5CFDA 4CP9A 3OYWB 1PO11 4AJWA 4Y22B 3ATGA 3RI8A 1RHI3 1XNTA 4QKFA 5CU1A 5AC92 3AP4A 3DQVA 2QCSB 1UIJA 1W0PA 4UF0B 4DOUA 1NCRB 2AEHA 2DNFA 1B35C 4IESA 3W20A 1XPWA 3T08A 4DXZA 3MIGA 3UETA 1QJY3 2VZTA 3PVOA 4GH4A 5T8IA 3LIGA 4OHYA 2XJTA 3E6CC 2X8XX 5A3NA 1PK6A 4K8FA 1B9RA 2WUHA 2BNOA 4X6RB 3KZ4C 2C24A 4I6NB 2B39A 4WVMA 5L9VA 2NS5A 1SLAA 4N43C 1KITA 3JW0X 1TVGA 2QHOA 5F39A 1JROA 3GP7A 5JZGC 2PTLA 4MGKE 3ZSKA 1OVSA 3PZDA 1JOJA 1MS4A 1RUNA 4GAZA 4KBZA 1L7LA 2WXIA 2QQLA 2RM23 1SBFA 2WR9A 3P3NA 4TLFA 1ZNPA 1YYNA 5GZDA 2G45B 3V61A 4O9GA 3PURA 3POJA 4DK5A 4LO5B 3ZDTA 2LGDA 4CDXA 1RUG3 1XBFA 2K6QA 1JYTA 2KQ7A 4LBMA 4XPVA 3I3QA 2WO7A 2I2SA 2VXJA 3PIJA 5H8YE 5DQ0A 3VQIA 1ULGA 1Z78A 1XNCA 2XLFA 4K3BA 2FZ2A 2M1MA 1I7HA 5IA7A 2EAKA 3SDLC 1BXTA 1K50A 1C4PA 3HJRA 1EWCA 2MA9B 5KXDA 2P4EA 3CMMB 5J18A 3EGRA 4GULA 3J9SA 1ZRCA 5FXVA 3B0AA 3ZTCA 1O3QA 3WQ7A 2UWBA 2W1QA 4J3OD 3J26N 1CAVA 2IC1A 1OC1A 2WNEA 1SSNA 1MQTC 2BWES 3POBA 3VBFB 1OQ1A 1F52A 5CB7A 1DCSA 1HX6A 4JDOA 1RUC1 4C80A 5IWFA 5GZGA 2ZNVC 1GLHA 2GBRA 1GP6A 4NIAA 5BNQA 5JWPA 3PIGA 4DXTA 4XYCA 3ZDMC 4Q0UA 5I0TA 1LHWA 4M0HA 1QILA 2HLEA 2VR4A 5GALA 5B4XA 1V80A 1AXYA 3ZIWA 2HWC3 2D3GA 1RUJ3 2AREA 5DAXA 1QOGA 1BMV2 1UZZA 2D3RA 4CP1A 4NHLA 5FTTC 1W6OB 1TMF3 5F3EA 3DKWA 1ND3B 4RGKA 2C7HA 2FCUA 2ZCBA 3VXWA 1V9U3 3AE6B 5EDSA 1PVC2 4ZOHC 1I4HA 4XWWA 1JU3A 2K6DB 2MJ3A 3DBRB 4X8PA 2D93A 4SBVA 4G0NB 2DCTA 1LOFC 4GDKB 4YL8A 2WT0A 5E6HA 3T8MA 1R081 2LUMA 2I07B 4OHXA 1XSQA 4XQDA 2N7JA 5GKAC 1JYIA 1NDDA 1NYRA 3LA7A 4AHZA 2B45X 4CDQA 2PN5A 2WXKA 4HSJA 3LYYA 1S0CA 3L9JT 2WYSA 3P63A 2D7FA 4MYEA 4K3CA 3W1SC 5T54A 3A23A 5EE0A 1Q0WB 2B8MA 3NV4A 1VBE1 4CYEA 1QJX3 4XBQA 4CHKA 4L23A 2V73A 2KC1A 4JHTA 2FDGA 2VZRA 2Q30A 4YTPB 3THPA 1LGNA 2IFRA 4FFGA 1ZKHA 3B00A 1WA6X 1LOBA 3T30A 2KDMA 2O6VD 4AE2A 3J7HA 5BNPB 1GNUA 1AW7A 3VBOC 3AMQA 2GMMA 5EE1A 2EIBA 2WFF1 5FOJB 2UYBA 5FMOL 4CDUB 5JH5C 5LBEA 1AWDA 5I93A 5CFCA 4QPIB 1GWKA 3FC0A 2BUKA 3RMYA 1A8DA 5FPXA 2YC4A 1QU0A 1VB2A 2B3AA 1NAEA 2K8BA 2RDHA 1ZDVA 4DBGA 1WW4A 1OQDA 3PZ8A 2Z4FA 1UPSA 1KFXL 4W4ZA 1VBA3 1MZFA 1XNDA 1N1YA 1NCQA 4PK1A 2FCTA 1FYUA 2LTNA 3VHNA 1D4BA 2WN3A 4W9FA 1H8TA 4HJKA 2AACA 3FX3A 3B9JA 1RHI1 1PYWD 4IGQA 3OBAA 3W5MA 4JQTA 1QF3A 2D98A 2ACZB 5LEKA 2JB8A 1DGWX 4XF9A 2MX2A 1LODA 3B08A 4MLOA 3AMZA 2CU5A 1VD2A 5A7SA 4LE3A 5E88A 1KFUL 5FXXA 4JDMA 4BM8A 4YM1A 4GZ9A 1F1HA 2KMAA 2XH6A 1QJY1 2KWVB 2IGHA 1YJJA 3MJ5A 4LE4A 2VOXA 1GOGA 4KZCA 5FZ3A 2RHPA 3Q8CA 5T5JA 2N4FA 1AR82 3FBMA 2BNMA 1EU3A 4HEA1 4V1PA 1YMHE 1WYGA 2P34A 2ZGQA 5FZIA 1VALA 1WX8A 3CSTA 4DNYA 3H3UA 1V00A 2GNDA 2WO2A 2KWDA 4AEDB 5IVEA 5FIXA 5K7PA 4Z2WA 2KO3A 2CU3A 1ZBA3 1EYBA 3CDZB 1FNYA 1L3JA 5IAAC 2WZR2 3IN9A 3TYJA 2RM21 5IHRA 4AI9A 4XYXA 2BFUS 2GNMA 3K3NA 3VD3A 5AUIA 3ZNZB 5FP7A 3RMKC 1H9WA 2KACA 2BV4A 1RUG1 5ABJA 1NA1B 3MLKA 4A3PA 4W9EA 4LA3A 2Z2SB 1YWKA 3THCA 3GHMA 5B2GB 3IMNA 3VV1A 4JC1A 3R2IA 2ID4A 2EKIA 4ARYA 1SDWA 2W08A 2XL9A 2H0BA 4NVPA 4LHLA 2WNUB 1RUD2 3PJYA 3MIEA 1REDA 2ET1A 1JALA 3I49A 2Y33A 4JRLA 5FPBA 3JXSA 1WSPA 5BNOA 2X29A 2WWUA 4CCDA 3V65A 5BNNC 1XOYA 3D0JA 3H3ZA 3N35A 4K3UA 1FFUA 3WZ1A 4EZKA 1MVQA 2ZAAA 3VH4B 3U4SA 1TME2 3DECA 1NLQA 3OYWA 2VMCA 4KU7A 4XW3A 4Y22A 5FY0A 3OJ4B 4E4SA 4AK3A 3GCXA 1V5OA 2GI9A 3WP6A 4URKA 4F3JA 2NR2A 4Q0SA 4Q4Y3 2VQTA 4FPKA 1JZ8A 4ZU7A 4AWJA 4KWUA 3SCHA 5D2MB 2YEPF 2WQ8A 1NCRA 5DAPA 2VNVA 2VGDA 3HNMA 3CJIC 3NAPA 1GNHA 2Q5TA 1ASJ2 4ITKA 2MEV3 4XJWA 3P4QB 4JZRA 2X53S 2HWC1 3RWNA 1RUJ1 3NVVA 2DBNA 3GNEA 2QQOA 4W6YA 1SB3C 4ET7A 3DCQA 2PHTA 2ZGNA 5FZBA 4CSWA 1TMF1 3R66C 1UY4A 5A3MA 1NEKB 2YFUA 1AL0G 4XAEA 3VUWA 1H2LA 4K1ZA 4YSZB 5D8AB 1V9U1 4ASLA 3VKLA 4LQRA 5A7OA 3H8RA 1QDCA 1TS3A 3ABZA 2YFZA 4OQ9A 2D07B 5EQUA 3A4SC 3DVGX 3VBHA 4ZYSA 1COV1 4AF9A 4HDOA 4I0BA 1W28A 3DPRB 3BPSA 3QBQA 3KT7A 3AEBB 4LIVA 3H8HA 2ZXQA 1EAH2 3B3QE 5IJRA 4ZHNA 4DMIA 2PLPA 3ZO0B 5T5LA 4NMIA 5FY9A 1KTKA 1WGHA 1GSLA 4PHZA 4HL0A 4AFBA 2GDFA 4LMFA 5JSRA 4WBBA 2JG9C 3IDBB 3I2FA 3ORJA 3X29B 1FNVA 3INAA 2NP0A 1XQNA 4AUQC 3U0ZA 1VR9A 3UIPB 3ZYYX 1IBXB 3AKTA 4A6OA 3IBMA 4CCJA 3CF6E 5DUVA 3VHTC 4DY3A 1GWLA 2XLAA 2FBEA 1TEIA 2X5IC 5EYYA 4FPHA 5FYCA 1XJAA 1YOVB 3VBSB 4L2YA 2XHNA 2KN4A 4IGOA 3R05A 2XKPA 1J1TA 4BQ5A 4H14A 1ODMA 5GLVA 2DCJA 3KV4A 3O12A 4YRDA 4AI2A 4A6QA 2HWF3 1APNA 1I3HA 1L4DB 4XC2A 5CYYA 3LSEA 3ZFFC 2Z59B 1GV9A 3IZOA 4UFKA 1VBA1 3E56A 2MCNB 3WA0A 5KHHA 4K20A 3DKQA 4Y20A 3FAHA 4LBKA 3C7GA 3JYUA 3N4MA 4K81A 4DHJB 2VO5A 2RG4A 1TYGB 2YVCA 2YYOA 1IYFA 1ZPSA 3UK9A 1MPEA 3NJTA 5HCHA 3PL0A 1YQBA 3ELNA 3RVHA 3C2UA 1GR3A 1IOAA 2A7AA 2SLIA 4NHKA 5T3NA 2Z79A 2ZEZA 1RUH3 5TSSA 3T1LA 1WMHB 4AI3A 1W6OA 1YJ1A 4XEZA 4FI9A 2P3IA 1IP9A 3RFRA 2BOIA 4A3XA 4W9CA 3PTRB 2NVUI 2A70A 2W47A 3AKPA 3E97A 1TBEA 3SH5A 4UT5A 1I4RA 4L97A 2ZX0A 4JQRA 4FAGA 4BMEA 2YBPA 2JYEA 1Z7S3 2BZDA 4GDKA 1XNAA 4NJCA 2IXJA 2QDNA 1GPXA 3APBA 4C91A 4YW5A 1UOBA 5IAXA 3POFA 5DZGA 4ES8A 2LXCA 4I3PA 3NV2A 2C1FA 3K9OB 3PSEB 4A7ZA 3PDQA 3LKJA 4H2AA 1IUEA 1ZBA1 2AYHA 2LS6A 2ZPXA 2QMTA 4JKKA 4M0NA 4X6QB 2LRWA 4OCTA 1AXKA 2K5PA 1GANA 3VGIA 2RDGA 4F83A 3ZSMA 2UYAA 4COYA 3PVNA 1GU3A 5LEJA 1H30A 2G3QB 2IXLA 5C3SA 2WZ8A 2E51A 2WL1A 5JXIA 3PHXB 5FYBA 4A90A 4E3CA 4OMCA 2P37A 4AI8A 4I6PA 3WG2A 1QJZA 1LO5D 1NBFC 2WLBA 4QPIA 3S6PA 4AHWA 4BLJA 3WW4A 4AXOA 1Y9GA 3T9LA 1P8JA 1FMD3 1DZTA 1Q56A 3RNAC 3SH4A 3PREA 2B76B 1IPJA 3UINB 3BINA 1KRIA 4YARA 3ME2A 3EO6A 5CKMA 1EWYC 2JUOA 1DHKB 1UZWA 3BK1A 2JKXA 1CR7A 2VBDA 4ZXEA 3O1SA 5FLHA 2ZEQA 1C3HA 3SC7X 3KH0A 2OZ6A 2MJDA 4FT8A 3VVWB 4Q4Y1 4IDIA 4QPGC 4NROA 1A8MA 3ZXEA 4L99A 3RQ0A 4GD4A 4FJYA 1XQQA 1IG0A 2C4XA 4HANA 3IKWA 5HFYA 2MEV1 3M3OA 1TT5B 3I2HA 4CUAA 2ZGMA 1CZTA 4MUVA 2CY6A 5EV7A 4M3CF 3ZRCA 3K2OA 2KJRA 5FMDA 2SBAA 1RTVA 5C4WB 3TOJA 2VL4A 2YB7A 3AVSA 4REZA 1JOBA 2N9PC 2CL2A 4KH9A 3SMHA 2N7DA 5L36A 2D6OX 3TN93 2NPIA 4N7UA 4AEDA 1WMFA 4TLGA 2OKXA 4F8AA 3PGEA 1W9WA 1E0ZA 4YM0A 4Y1ZA 3FE5A 1VZ6A 4YTMB 3QIJA 4Y1UA 3I2OA 1PIV2 3OJBA 1U5IA 5FP3A 4YG6A 2RDQA 2YY1A 4HMZA 2R062 1PMIA 3V62A 3QD6A 3IXSA 2M0AA 2RS32 2MBBB 2QIEB 4DXRA 5KR7A 3N1YC 1C28A 5K8SA 4PS3A 1Y9MA 2J53A 1PMJX 4CDWC 2WQYB 4LBOA 1ZREA 4RR3B 1CAUB 1K5JA 1TS4A 1LR5A 1D3ZA 3NS1A 1DGWA 3N3KB 3MHZA 4BQ3A 4KGTA 5FOBB 1X9TA 3WW2A 4GMP0 1XD3B 1KLGD 1OLQA 4L92A 4FPCA 1W6MB 3NJZA 2A3YA 5IP4D 4MO3M 4B1LA 4CEWB 2W46A 1XLPA 5LRRA 2WKKA 1CX1A 1YX6B 3UNPA 2P3JA 1WGYA 5LK7B 1CQVA 1IZ3A 3KLSA 4D7YA 3N9MA 2Y6GA 4CQNA 4HPMB 3VKFC 5D21A 1UZXB 1KF6B 2IY1B 4QKNA 3SNMA 2GBMA 3RMXA 5IFPA 4ZHOA 3KD4A 4JL9A 1W2OA 2HWF1 1SQ4A 4IETA 1FNUA 1PNFA 1AR81 4ZZ8A 1TGZB 4HK2A 2C5DA 4EWAA 3VKOA 2DYBA 4P1CC 4LULA 2R1BA 2MQJA 3EECA 2R7EB 4FXCA 3R7RA 4YSFA 4CCEA 4UI9L 4XXAA 2JDPA 4R4XA 3ZN6B 2WT2A 1GC6A 1NE4A 2I38A 1V1OA 3U37A 1R1A3 1FPN3 3IDEA 3K4ZA 3VBFC 2IXKA 3WDWA 2KVRA 4B4QA 3CKHA 1FI2A 5FZKA 1UGMA 3RRDA 4RQPA 2D6KA 2VULA 3U4EG 2PLV2 5FK7A 2VUAA 5FUPA 3AYEA 2CGOA 3LPFA 2VY0A 5F5QA 4NHYA 2QQVA 5ACA2 5KHGA 1V9JA 4BE3A 2YGLA 3EHKA 3LF7A 2XL7A 3AE7B 1PQSA 4HG6B 1HN1A 4KBBA 1XRUA 3HD8B 3VZOA 3PRPB 4YM2A 1RUD1 3VUXA 1TNRA 2MH7A 1ND3C 4N53A 3MP9A 2EXKA 3I57A 2ZGTA 2WXMA 4CEYA 3M3QA 2XK5B 2R042 4ASMB 3H7JA 5GMVA 1W6NB 4BBNF 1G9FA 2YROA 5HXMA 2CGNA 5ANNA 4FPLA 1GUIA 1IBXA 3AZXA 4GJYA 2LGXA 2BVVA 1XU1A 3C7HA 4XIOA 4K9SA 1OFNA 4IERA 4E4ZA 1I4QA 1WM3A 3OB8A 4DZGA 1FXTB 4QGLA 4L1BA 1SBDA 4A41A 1OOPC 1Q5WB 5LCWL 1VBC2 4XZUG 1CMXB 3VBSA 3SEPA 4J1XA 2D3PA 4GALA 1S1QB 1GC7A 4SLIA 3GS2A 1VMJA 3ES1A 4C56C 4JQWC 1FMD1 2P3KA 2VRRB 1W8WA 2QQMA 3SEEA 4AEKA 5A33A 2GP3A 1DGJA 4HJGE 4D7TA 3RYTA 1ND2C 3M3EA 1S0DA 5BNPC 4CUBA 5KHIA 3OEAA 3FJSA 4CDUC 5E1RA 3JD72 3MLLA 3SHRA 2F4LA 2XQXA 3ZPYA 2KTRA 2MNGA 3MC0B 2LUEA 2JG8B 1UWMA 3TAYA 1WMHA 2VVDA 1XNBA 2GZWA 5FUNA 1AL22 3KVBA 3I3TB 2ARXA 3RNFC 2OUHA 3ZXDA 2HDEA 1Z5SB 1IPGA 1X9PA 4OVUA 5FPZA 3RYPA 3FILB 4G11A 1GZ9A 3BU0A 4P9WA 4O65A 2R61A 1BK0A 3VBRB 1ZW7A 3ZSEA 3AI5A 1V6OA 4RM9A 5CX3A 3TN91 4Q27A 3ZVXA 1SCSA 4HKOA 3LIHA 4ZS3A 1RVF2 2CGPA 3WDXA 2IZVB 1HZ5A 5B4NA 3KT4A 1XF5L 3VBUB 3C7EA 3LPGA 4GB9A 4M00A 4A4AA 1F0ZA 4DUXA 1V86A 4XVHA 2W87A 3IPVA 2W91A 4ANXA 4CO7A 4P5HA 4CZSA 3L10B 1SFNA 3T2PA 1PMHX 4AFAA 3BK2A 1DU3D 3CHXA 5HV0A 4OHJA 4IV1C 2E3TA 3WHUA 2H89B 4HSLA 3FHAA 3U52E 1EUUA 1X8MA 1HJFA 4JAAA 4P02B 4TQ1A 1ZA7A 4XFIA 1VLBA 2ORZA 3BU7A 2MJEA 2D6NA 2IPKD 3RYKA 2ZPYA 2WQ4A 2FCNA 3NNLA 2O6VB 2VZKD 1NA1C 5CBLA 5A3TA 2X38A 1PUTA 3UKNA 3KGZA 4YWAA 4TTGA 2CKHB 4DS0A 5FY8A 3AXEA 2VMEA 2MPFA 5FY7A 4I30A 1VBD3 1LU2A 2PHLA 3TCAA 3GZUC 1FXIA 2PLV3 1LEMA 3ZM8A 3ETPA 1XYNA 3T2TA 5K0UB 4XUOA 1XSRA 1FT9A 2IY0B 2HWD3 3R3MA 3HIZA 2WNUC 1WXMA 5DDJ2 3MO4A 2XG3A 3RGBA 2RMMA 1VAMA 1N1TA 1HTQA 1IPSA 3RYRA 2ARAA 3ZSLA 3ZN5A 2JQRB 3ZLIA 3DV8A 1C4RA 3CEWA 1WGDA 1R1A1 1FPN1 1VZ8A 2VE1A 3OD4A 2VUCA 3NNFA 4C8DA 1UBQA 1IQDC 5C6CA 2DZMA 1J3QA 1UY1A 4QQOA 1WZXA 1XU2A 5GZFA 4CU9A 3RD2A 1J3RA 2NN8A 1C8M2 3E9SA 2LHDA 1U12A 2EALA 1QIQA 4V2VA 1JYVA 2QQNA 3J7LA 1SHWB 4P9IA 1GAQB 3I9V1 4RGNA 2BWAA 3DVNV 4HPLB 3VDDA 4NRMA 1DQ1A 4G3YC 5GJ6A 1A5RA 4PT6A 1MS0A 4FFHA 1HRI3 3VZMA 5E6OA 4C0BA 3OSDA 4UW3A 2KR2A 1SLBA 4HDQA 1OKOA 2XONA 4LORA 4IEPA 3NS8A 1KXGA 1UKRA 3FHIB 1H2KA 3LWCA 4CA9A 2NLRA 5D8AC 4HWIB 5HXVA 2V0GA 2Z0DB 2VMDA 1CAUA 1FXAA 5LNK1 3WQ1A 1FX5A 1W2UA 2KX0A 4FVVA 2R49A 4N9IA 1SFPA 4QB2A 5A7WB 4PS7A 4D8MA 3EUB2 3I2JA 4EOYA 1JYXA 1NE6A 4CEWA 3DPRC 4G4FA 3N9NA 3NKGA 5D6JB 4RS5A 1NOVA 4N58A 2QCZA 4ARXA 2WZEA 2ZMKA 4FTEA 1HKDA 1E7VA 3WAPA 2A73B 3ZIXA 5HCAA 3QCWA 2K8CA 2R16A 5FP4A 1ZX5A 4IE5A 2BU9A 4N9HA 2RDRA 4AZZA 2P5BA 2GMIC 2BGOA 2JEMA 4QB1A 2HWB2 4BFRA 3BZDB 2ETEA 1JW6A 1IGCA 4JTOA 3EB7A 3AP9A 4OVVA 2XJUA 3AKSA 1E9MA 4D2KA 4Z1VA 4CUGA 3D32A 3ETQA 1K5MA 4MSMB 2ILMA 2CS4A 1OMIA 1YJKA 5IVFA 2XBO2 1OHFA 1DYPA 2ATFA 4HT1T 2QEJC 5DCNA 4QM9A 1BHGA 3VR9B 3PMSA 3RZZA 3ZYPA 3AYAA 4WVWA 4FQZA 4R9CA 2KFJA 3ZN6A 2ZW0A 3PLQA 1TZ1A 1DZRA 1L4ZB 2OYZA 4C00A 2ZOEB 4BMBA 5KXEA 1CAXB 2QJLA 2LALA 4P00B 3TEZA 5FZCA 1B1ZA 4M0WA 3LDZE 4XXPA 4D3WA 2D3BA 3PUSA 1JZ4A 4XZPA 1D4M3 2ZX1A 2BPSA 1KFYB 4HVOA 2RR12 5FY1A 1UF0A 1M06G 2C7MB 4WM8B 3UKTA 1RGSA 1ET6A 3BI3A 3CLPA 2K9XA 1V81A 2WS3B 2ZTNA 2OZJA 3L0WB 4RM8A 5J37A 2X05A 1N61A 3CJXA 4KIKA 1LULA 3WNMA 2DAJA 2X10A 4QKDA 3LDRA 1F5JA 5IVBA 5FZLA 3T0AA 1VAKA 4DQAA 2QE3A 4Q0PA 1VPHA 4PCRA 2ZHLA 4N43B 3E1F1 2Q1FA 4JWUC 2VZ1A 2XK5A 3A4RA 2D5FA 2F4PA 4EZLA 4Z07A 3Q3JA 5JZGB 1G8WA 1HB4A 1A3KA 4QDRA 3RZHA 3S2AA 2VTXJ 4ZU5A 3ILRA 1CESA 3UQAA 1LOGA 2BFUL 4NIGA 1W6NA 1TY2A 2RD0A 1VRBA 5J96B 4O1NA 1QT9A 3NO8A 1WXVA 3FLRA 1HLCA 4A20A 2CYFA 5IN7A 5BYRA 3OBZA 3Q69A 3DEMA 4R4ZA 5LXIB 1V6KA 3VL9A 5LB6A 5HI1A 1P7FA 1NT0A 2FNJB 5EPAA 1SE4A 1XXGA 1VRH3 2KOXA 2G9ZA 2J0JA 3RWKX 5T55A 1LEDA 3DDCB 2JDMA 1I4PA 1PO23 2H88B 2PPHA 4B0EA 1O3TA 4Q4X3 4HVRA 3MPPG 1VBD1 2KM2A 3D4KA 3DGTA 2FCVA 2ON8A 5AUKA 1C8M3 2PLV1 1XO3A 1FCCC 4LKEA 5A3UA 3PS6A 2VZUA 3AK0A 2HWD1 3KYCD 1MQTB 4NY0A 3N9OA 4P16A 4E27A 3WOGA 3B02A 4XDPA 5BMIA 3AH7A 4LXLA 4XJUA 2Z69A 4NR1A 1O3SA 4GDLA 1RC6A 2VBBA 5F5IA 2W92A 1EM7A 3H9DA 1WUVA 1G9AA 3NJYA 3E6BA 1OXCA 1GFF2 2UY8A 2R041 1UMZA 4FPGA 3FILA 2LHEA 4GLSC 4YPJA 2ZCCA 2FHRA 4D6SA 2V1YA 3WX5A 5D1IA 3VD4A 4Y1XA 1H4HA 1XC6A 4ZS2A 4K7UA 1DBNA 3FN9A 1KS5A 2N1WA 4OMDA 3LDBA 4AQ7A 2ZVNA 2WXLA 3BVGA 4FPOB 5FKAC 3VBUA 1SMVA 1W2NA 2VTXA 2WNMA 2NMNA 3DBHI 4Y4RA 4BB3A 4K40A 4ASKA 5C4WC 2FE8A 2OT7A 2C60A 3MC9A 1T0RC 4DEVA 1YHFA 1RUOA 2AZ5A 1MZ6A 1WJ6A 2XPJA 2KAJA 3RS6A 5JI9A 2YBSA 4HONA 2W3SA 1K3IA 3ZFGA 1KDKA 3P6BA 3LGRA 2INCC 4I02A 1AN8A 5I0RA 1RUE2 2V3PA 3MIHA 3NY5A 2BYFA 4NE9A 1OEYJ 3RPQA 4TN7A 1LHUA 2VZSA 4MHUA 1LENA 1C3TA 5H9SA 4IKGA 5I8SA 2ZEXA 1UAIA 3NVWA 2XJVA 3VUOA 1LGCA 1R4MI 2K22A 1SLTA 2WNVA 1O91A 3QQ8B 4KGRA 2V4AA 1UX6A 2VH2A 1GNZA 3MV11 1RXGA 1F2RC 3OWEB 2VZVA 4MADA 4QAYA 1N1SA 2ZABA 4RR3C 4IGPA 3KWLA 2G1MA 3CZUA 1VMFA 1CZVA 3PUIA 4Y1YA 2GN3A 3ITQA 1ISNA 4HPKA 1EY2A 4D94A 1POV0 1L7RA 4GIVA 4NPNA 3ZPOA 2BB5A 3F95A 4AQTA 4CEWC 3PHWB 4XQWA 3LA3A 3BTXA 3ZR6A 4OW0A 5HPOA 4XUTA 2KFKB 2E53A 1E7PB 1RXFA 1I42A 4BA6A 4OZBA 4EN8B 1CX4A 1ZUD2 4S2GA 1UPIA 5L7OB 2HBUA 1GICA 4IM2A 1V49A 2ZA9A 3ENEA 3POSA 4XE9A 5KC5A 1SDDB 4KZ0A 2R30A 4YZ5A 1FOD3 3ZDSA 3LXFA 1R7SA 3S0MA 4EKUA 4CCLA 1RL3A 2WC2A 5C9AB 4QB6A 4RHV2 1MS1A 2W94A 2VMHA 3ZQ4A 5G5GA 1AJOA 4JGZB 5CVRA 1PGW2 1JCKB 1EV12 3OLMD 2BGCA 1D4M1 3H9AA 1RUF3 2M4NA 2ZJDA 1RRBA 2L0TA 3NOBA 3A9KB 1W6PA 4ATFA 3ZFEA 3E5UA 5F2WA 3U07A 1LQBA 1T3QA 1W0OA 1W04A 1UY2A 1QQP2 4ZDVA 1NVID 2FCQA 4ZHPA 2EIGA 1ZGUB 2IJ0A 3LQCA 3NVZA 1VZ7A 4XCBA 4D0QA 1GYKA 4MSVA 4W9DA 4QMAA 5F2SA 2PFWA 5FXZA 4LDTD 1OEYA 2JWZA 4C1WA 1UELA 3OD0A 4P08A 1Q8VA 3APFA 4AYUA 1QXJA 2Y6KA 3VL8A 4QU2A 1MEC2 4KG8A 5C7GA 3GGLA 1L0YB 1U4AA 3ZMOA 2DYCA 3WLUA 3W58A 1OGWA 4WAAA 2JENA 4KG0A 1P0RA 4Q8KA 1ZM1A 2LVOA 1HXS2 2E6XA 3TEXA 1Q10A 2WS92 4IEZA 2WXGA 3PNAA 2HTHA 2PHWA 4E74A 5IK4A 1YFUA 3AVRA 1N3OA 4BPZA 4LTUA 1VRH1 4GSWA 3LD8A 1C5IA 3AN1A 4XJAA 4XQ4A 1ZP0B 4AWDA 4EN6B 5CAZA 3V6CB 2JECA 3EC8A 1PO21 1W3XA 1MJDA 3RT3B 1VBB3 2E33A 2YHJA 1XXNA 1W90A 5C5UA 3S57A 1V6JA 2FAZA 5BNNB 1FNWA 5CG8A 2BT6A 5F1RA 1C8M1 3ZUNA 3KW5B 2BGFA 1G9CA 1EO6A 2QQJA 3IWZA 1ZE3D 5I0SA 4R9DA 3W5NA 1O3RA 1AYN2 3DVNU 4YM3A 2PQQA 3K77A 3L2YA 4C90A 1B35A 1RUI3 4R3DA 5IOIA 1BBT3 3WG3A 2C26A 4HFSA 4WIPA 2Y6LA 3RNEC 3AMNA 3N1XC 5IT6A 4M02A 1FCLA 1ULCA 2PVGC 1O6UA 2ERFA 3NZSA 2DCKA 5FZ1A 1L0VB 1V6IA 2D6LX 1HA5A 4XDCA 2BKFA 1RUE3 5JOXA 2E7TA 3ZXGA 2KQ4X 1GOFA 3T3NA 2JG8C 3DOWA 3A9JB 1AF9A 4PI0A 3PMEA 3HOBA 1TNFA 2VPVA 4N43A 2QUOA 2GC0A 2A6WA 1BUIC 3KM5A 5FZDA 2OW4A 5JZGA 4BKSD 3ZXAC 1PNGA 1WJ4A 2ZW1A 4EZJA 4M4PA 4CU6A 2AYOB 2DWQA 1KQRA 1XLQA 2R072 4AG4A 1ZRRA 3RNBC 3RI9A 1TJEA 5BYQA 3VBRC 1SJHD 2W9XA 4LBLA 3UYJA 2JZPA 4YLZA 5FYSA 5JCTA 1R093 5E8AA 3MUZ1 1C76A 3NVCA 3M3JA 3S7EA 4GA9A 5LBBA 5T5OA 4CCNA 5FR3A 1Q3EA 4E2QA 2D3SA 2PIAA 2VG9A 1V97A 1MI0A 2WA3A 1QWRA 2JY6A 3TBDA 2K2SA 5FO9B 4YZ1A 4FO9A 3ZTDA 3H1UA 1U5ZA 1UZYA 1GNYA 1UN1A 3W59A 4IXLA 5JIUA 2EKEC 4XDDA 3BKZA 4ZZ5A 3MW4A 1V1PB 2XMLA 1V2YA 5CKQA 4XF1A 1EF5A 1AR63 4QHBA 1YQ5A 3H1MA 5CKNA 4IV3B 1W06A 1JMLA 2OJRA 3RNCC 2X5IB 1MHXA 5IVYA 4AJYB 4LK0M 3DBLI 1I4GA 2OJWA 4Y5TA 3LOIA 3AM9A 1MQTA 3IDCB 4CP2A 2RS53 3NWKA 3FWEA 2E63A 1S0EA 4FTBA 4MT5A 4GU2A 1H2MA 1C5HA 2ZHNA 1FNZA 4PDWC 3ZR5A 3WF0A 4KDLB 2E26A 4KU8A 3EMRA 2JIJA 3GOEA 1FV3A 2FCSA 4XFGA 1RINA 3ACLA 4PIXA 3N1ZC 5FYMA 1PHMA 3EHVA 4E8DA 5G2NA 2CU1A 5JDBA 5K0UC 1VIWB 5F5CA 3KUZA 2YC2A 3B9CA 4NAWB 3KQ4B 3CZJA 3HBZA 3MDPA 1WLTA 1FD6A 2WWZA 3M1HA 2CDOA 4IUGA 2PA7A 1RUF1 1SE2A 2ZVOA 1Y4WA 5DG1A 3I3MA 2XJSA 4Y4YA 3Q3FA 4CXWA 4R9AA 1LOFA 4GN1A 3SR6A 3ON7A 2VU9A 4W8JA 3ABVB 3NSTA 2B9UA 3PRZA 1S1AA 3T2QA 1P7EA 2KYWA 1HZ6A 2WINB 1KDMA 4PI2A 5HBAA 4XGAB 2EF6A 2TEPA 4DY5A 1JXNA 4XX5A 2GN7A 2BS4B 2QQWA 3OGJA 4GB32 4WVVA 3W1SA 5FYIA 4DXFA 2HEWF 5JOYA 3W21A 1MVEA 3FLTA 2INPE 4Q4W2 4XBNA 2VH1A 1DOXA 3WF1A 2Y8KA 5C1ZA 2A6XA 3UGFA 2K39A 1N63A 5K9YA 2WAAA 3A7QA 1I35A 1LOEA 2REXA 4OI0A 3WQBA 4KL1A 1NXMA 4PF1A 4J1WA 4FN2A 1CQ9A 1MS3A 3JB8A 2JXTA 3ENRA 5L73A 4RD7A 3VDCA 1G9BA 3VBOA 5DPWA 1HRV2 1DQ4A 3BVZA 4W9KA 1HQWA 4NQKE 1ULEA 2D6PA 2NMOA 5FZ0A 4LO8A 1AR92 1LNSA 3CSFA 4IE0A 3APDA 3MUY1 1YJIA 3U1XA 1LHNA 1VBB1 4RF1A 3NRUA 3MPBA 2VZKB 2EVXA 1CPNA 1MHHE 4KI5M 3BOPA 4NIHA 2V4LA 4N9F4 1WXAA 4GKYA 4IEXA 3AE3B 4WURA 2KFKA 4UYBA 5A6QA 3ZDVA 4XOGA 5FPVA 2GB1A 4A2UA 1WJUA 2GBJA 5J98B 1CN1A 5FZ8A 4GQ7A 2WXPA 2JDZA 2LEKA 2Z5WA 1UXZA 4MVTA 4KMQA 5KHKA 2CAVA 3OUJA 1RUI1 5FZEA 1SACA 4K8RB 5FYVA 3KHBA 1BBT1 3V56A 1S0BA 2MP2B 3FBYA 5C33A 4YVSC 3T0BA 1WD3A 4JPSA 2ET7A 2ZGRA 4FPEA 4MSQB 1P1AA 2PHRA 1N60A 2QQUA 3OGRA 3GM8A 1WCKA 3A9KA 2PE6B 4BOWA 2I1JA 3DWGC 1L2NA 1RUE1 5ERLA 1FIQA 3GZTB 5L19A 3PUAA 2VXRA 2WT1A 3J8F2 3T1MA 2SAKA 4XFFA 1P9DU 4MGZE 2WQZC 3BGAA 4MXWB 4JKLA 1N3PA 3C0RB 2C6SA 1ZBE2 4JVAA 3SKVA 1SBEA 2AL3A 3HWJA 2PHFA 1WXSA 4URTA 2W39A 3AU5A 1WR6E 2JJ6A 4JHZA 3HR9A 2NMQA 1CVNA 2BF8B 4IOIE 2ZEYA 4WJPA 1QOTA 4KWKA 4WM8C 1IS4A 3ZNGC 1UBIA 2K25A 3PU3A 1QJU2 4P9XA 3USUA 1PM4A 1H4RA 1FM0D 4I3GA 1R091 1YN4A 4JKMA 3DVGY 1ZZ8A 2VECA 3JSVA 2ZGLA 2J1EA 4QX3A 2D5GA 4CDWB 1I5ZA 3B01A 1JYNA 3ST7A 3LAGA 4YW1A 5FMOS 4MGYE 5F9TA 1OFFA 3ZOIA 4OI1A 4FFIA 1JS9A 5JMCA 1S4CA 4Y26A 4HOOA 4WZFA 1MS5A 2ARCA 4K1RB 5LBCA 2WU5B 1ENFA 4INDA 1OF4A 4Q0QA 2AEYA 4ISQA 3ALBA 1AR61 5GXGB 2PMVA 3AE4B 1VRAB 4ZRIA 4W65A 2E31A 3HUIA 5BNNA 4XDOA 2PE9A 1GG3A 3A1QB 3O0WA 5GZEA 1QNWA 1ZDXA 1QNYA 4Z82A 1J0GA 3AEEB 3JVZX 5C3JB 5JLVA 1AXZA 3POEA 1FATA 1JWSD 4BWOA 4B95A 2RS51 4I01A 1HW5A 1ODNA 2WYFA 2KXJA 1UY3A 4K21A 2N9EB 4OZOA 3H0OA 3K4AA 2IXIA 3CJIA 2Z0EB 1JODA 1MS9A 3Q6BA 4UWDA 1OSGA 3OEBA 2RV9A 3PV1A 4KGSA 5A6ZA 4M8MA 1QKZA 1D0HA 3AULA 4PYUA 3B7MA 1T0QC 2EELA 1YQCA 5I8TA 4LBQB 3Q9OA 2HWE2 3A9JA 3PVLA 5JAXA 3AP6A 1BEV2 1AYM2 3M63B 3UESA 4MEMA 3WXPA 5EP9A 4B7EA 3FKYA 1MFWA 1O5LA 3I5JC 2DZJA 1IGDA 2QZ2A 3APCA 1Y7BA 1YNAA 1BZWA 4DXAB 3ZYIB 1KLVA 3URFA 2RPVA 2FMDA 3AZZA 1WXQA 5IO9A 3KV9A 1D5MC 3TWIA 4Q2FA 3V3XA 3AP5A 1D2SA 4AVBA 3GJAA 1SGHA 2GRIA 2JG9A 3QOPA 3THDA 2CAUA 4TSSA 1COV3 1E5WA 2KDEB 1UW8A 2TUNA 1PGSA 3NZ3A 4ZU4A 2NBWB 5GLUA 1A34A 1NI2A 3RZKA 4ORFA 4Q4V3 5G55A 1WMXA 1Y9QA 2LM3A 2CSGA 4YG3A 5EFUA 4LHSA 4GWJA 1TE1B 1OOPB 1JWUD 1QOAA 4NPMA 3LFMA 2X5IA 1RMU3 2RS12 3AJZA 1ZXIA 4EZHA 1CGPA 1CK1A 4BKSA 2A3WA 2ASQA 3WNPA 5JHAA 3AZYA 4LCDE 4NNJB 1E5HA 4EQVA 3ZFFA 5CIRA 3AEFB 4RFRB 5EJZB 5AC93 2WJSA 1SXTA 1ND2B 4ANUA 1HB3A 4C4VB 2YC0A 2Y6HA 1ZBE3 4US9A 3N30A 3N3HA 4JIOU 3VRAB 5AVPA 1SZBA 2BEOA 5FZOA 4OUSA 3WP5A 1JW9D 4A44A 1CD3G 1QQRA 3DBHB 2ZX4A 3BOWA 1JZ6A 4QQHA 2AL6A 1NZIA 2KN5A 3KQ4A 5FYUA 5DPNA 5FMBA 1WRIA 1YFYA 3N7MA 2GP5A 1UNSA 4MGIE 1PO12 2WXOA 3OY8B 4YFWA 2B7YA 5FZGA 4B4RA 4IC7B 2VOVA 2AR6A 5L7OC 1YFXA 4W6XA 5FAXA 3ZNHB 3ZXVA 4IL7A 4XJ8A 2WDBA 1E8YA 3M7AA 2VAUA 3O65B 2DVGA 3R0RA 4HVQA 2N9XA 4Y24A 1YQ3B 5C9AC 4COUA 2VZPA 1CONA 1XCTL 4JGZC 3GXUA 2Y0OA 3I2DA 1R4MB 2QDRA 4MHRA 2R1DA 1CIYA 3KLSX 2BQPA 2DAFA 4ICUA 2KC2A 1V6LA 4GGQA 1JRUA 2WX0A 1K42A 1PGL1 3WW3A 1W8UA 3VHPA 2BB6A 1Z0HA 3HEIA 5A32B 4IWPA 1W39A 3GB1A 4LITA 2JF5A 2BGPA 2ZACA 2WXRA 2D3AA 4A45A 1YJLA 3IAM1 3K51A 4YXDB 2KMMA 4IV1B 3QX1A 5H9PA 1FV2A 3H7SA 4C7ZA 1ENQA 4LKSA 5CADA 4D6RA 2KLCA 4GIQA 3N7KA 2VW2A 2YMZA 4TZDA 4IM3A 4EZ4A 2J1SA 2ZGUA 3RJRA 3SCFA 1H9PA 5DAWA 4NQLB 5D3DA 3O1MA 2LGSA 4FOYA 1PGBA 3BIEA 5A7PA 4BK4A 2CHZA 1YI9A 2P6HA 4CP9B 3I3BA 1OKQA 4WM7C 1N5WA 3ZMNA 4YW6A 5GZCA 4HLEA 4CPBA 3D5OA 3WNOA 1HIXA 2PW9A 2BQQA 1BCXA 5D3IB 1TY0A 1REEA 4PS8A 1ST8A 4XURA 1E90A 3JZVA 4QPGA 1C57A 4PF5A 4DRRA 4XFBA 3GDBA 2UY9A 2JWUA 1W6QA 4OFGA 3N9PA 2JYTA 1VP6A 3FFZA 4DPNA 3H42B 4XILA 5BXXA 5BMGA 1K8RB 1E6EB 2Y26A 4XABA 1WX9A 4QXCA 5A7QA 3LEKA 4XAAA 1RUC2 4CP0A 5F37A 4XETA 1PVC3 1H1IA 1I5PA 1K12A 5DZFA 1HE8A 1Q8SA 4M01A 3Q3OC 1L7QA 5C8CC 2WBKA 3TBLD 2YUEA 4UF0A 3KVFB 4FPJA 4MXWA 2W0XA 4RGGA 2O8OA 4QPWA 4DEQA 4DHZB 4E8CA 3WG4A 1RLFA 3H50A 2LJIA 1YIFA 2JXXA 1QOFA 2W82A 3Q14C 2D10A 1HRV1 4ZY9A 2LGIA 1ET9A 4WWNA 4UFIA 3VHOA 4C7YA 4BQWA 2RS13 1DYOA 1GQPA 4XFAA 5A70A 4CDXB 1NY71 4BZAA 3O5SA 5FKCA 1ZZ6A 1YCIA 3VD7A 3NZUA 3QCAA 4LDTB 4CDWA 1HB2A 1C78A 3WIMA 5JXVA 2BBAA 3FL7A 3KCYA 3LSDA 3L4PA 4WQOB 1R082 4BAXA 3ML9A 2INDC 3QA8A 3I3EA 5F3GA 2KQSA 5JSPA 4QD2A 2WWSA 2L32A 2N0SB 4EUTA 5KHOA 1IPKA 4Q4V1 1SLLA 5C70A 1IKQA 4BBNC 3EXUA 1VBE2 4DHJD 3PUHA 4Q29A 1RMU1 1CAVB 4GWIA