4M01A

N terminal fragment(residues 245-575) of binding region of srap
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
321
structure length
321
Chain Sequence
AVTANTITVNKDNLKQYMTTSGNATYDQSTGIVTLTQDAYSQKGAITLGTRIDSNKSFHFSGKVNLGNKYEGHGNGGDGIGFAFSPGVLGETGLNGAAVGIGGLSNAFGFKLDTYHNTSKPNSAAKANADPSNVAGGGAFGAFVTTDSYGVATTYTSSSTADNAAKLNVQPTNNTFQDFDINYNGDTKVMTVKYAGQTWTRNISDWIAKSGTTNFSLSMTASTGGATNLQQVQFGTFEYTESAVTQVRYVDVTTGKDIIPPKTYSGNVDQVVTIDNQQSALTAKGYNYTSVDSSYASTYNDTNKTVKMTNAGQSVTYYFTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Serine-rich adhesin for platelets
publication title Structural Insights into SraP-Mediated Staphylococcus aureus Adhesion to Host Cells
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 92
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18483 Bact_lectin Bacterial lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4m01A01
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 4m01A02
2DU0A 4YGEA 2A3WA 1LULA 4CTEA 1LGCA 4XTPA 4DS0A 1DYKA 2G4IA 2GNDA 4BM8A 1FAYA 1ULFA 5H9RA 2CNAA 1CVNA 2A75A 3T2TA 1AXZA 3WG4A 3UJQA 3N7MA 2WLQA 4P9XA 4XDQA 2R16A 1G9FA 4AWDA 4Q1RA 1FYUA 5T54A 4PCRA 4LBNA 1ULCA 1SLAA 2DUOA 3BODA 4FP3A 2DTWA 4YG3A 2D3RA 1G9DA 3PMEA 2ZGUA 4WV8A 3HMYA 3RMYA 1KRIA 2ZGPA 4ITCA 3OYWA 1VALA 1BXHA 4FOYA 4NOTA 1S0GA 1N1TA 3KQRA 5T5JA 5KXBA 1UZZA 4UW6A 1LODA 1W6QA 1Q8PA 1QDOA 2SBAA 4FOVA 3HN1A 3FLRA 4XYXA 4AGRA 2A6WA 3APBA 3N36A 1PZ9A 3FUQA 5KXCA 2GN3A 3MW4A 4KBBA 4ATEA 2R1DA 1AX2A 1CIWA 1LESA 1SLBA 3ENRA 1J1TA 1FV3A 2A7AA 3N3HA 1LGBA 2JE7A 2ZACA 2ZHLA 1WLCA 4XMAA 3AJZA 2GNMA 2RHPA 1V6JA 4DFSA 1GICA 2CWMA 2A6VA 4Q26A 2GMMA 2P3IA 1SLTA 2KVZA 4AVTA 1Q8VA 1AJOA 1D2SA 1H30A 3LSEA 3OPZA 4TZDA 3WZ1A 2ARBA 1W6NB 4Y24A 4ZKTB 3NV2A 4U36A 4XHXA 1OKQA 3UL2A 2TEPA 1GANA 4XBQA 1URXA 5GZFA 1I3HA 1QKQA 1LOEA 2YZ4A 1YIFA 3IN9A 5JOYA 3KM5A 4YM3A 2ARXA 5DG2A 3WHTA 1UKGA 4ZXKA 2PHTA 4FPKA 1LENA 2ZGLA 3M3CA 2D43A 2ZMLA 4FPEA 3VKMA 3RSJA 3ILFA 1S0FA 1GZWA 1MS4A 1V00A 1F9KA 2EAKA 4IQPA 4SLIA 1HLCA 3DGTA 1G7YA 4PBOA 2FHRA 4JRAA 5E8AA 1GKBA 5LK5A 4M02A 2ZMNA 4Q8LA 4R9AA 4XXAA 2DV9A 1IS3A 5CB7A 2VW1A 1S0BA 3AP9A 2AR6A 2SLIA 2ZGKA 3R05A 3VKFC 5GJ6A 4YZ1A 2KYWA 4Z8BA 4YW2A 1AJKA 3AZYA 5DUUA 5FREA 3WDUA 1ENSA 4M01A 1LJ7A 4P9YA 5EYYA 2OW4A 4HANA 2ZAAA 1AVBA 3POWA 5DUVA 2P3KA 1RIRA 3IPVA 1CJPA 1CR7A 1GNHA 4RA0A 5SV8A 4DQAA 4K1YA 5JDBA 3WG1A 5T5PA 5GM0A 1LHWA 1S0CA 3MPPG 1AXYA 5IT6A 5JOZA 1SBFA 4XOGA 5F9TA 3AP6A 2DWRA 2ZGRA 1SCSA 4RL7A 2EXKA 3AZZA 4YLZA 3MW3A 4BMEA 3NWKA 1DQ5A 1LOAA 4WZFA 3AP4A 3ZSKA 1LU1A 1DIWA 3B01A 4XILA 2ZGQA 5GLZA 2KT7A 4LBKA 2GN7A 4XHBA 2R1BA 2UWCA 4YW5A 4Y1UA 3Q9OA 3O5SA 5IK5A 4ISRA 4K21A 1TEIA 3O0VA 3WOGA 5CBLA 1DLLA 2ZA9A 2H0BA 5T5OA 1WBLA 2AGSA 4GWNA 4BQ1A 3SH5A 2A6YA 1LOCA 2C5DA 1A3KA 2JD4A 3BIWE 2AUYA 1IOAA 3LSDA 4H55A 1JHNA 3ZVXA 4GA9A 3OY8A 1CQ9A 1MS8A 1VAMA 3NV4A 1MACA 1ZM1A 4XJUA 1QDCA 1F5FA 1AXKA 1KITA 1WW6A 2CWSA 5H9PA 4BMBA 1RINA 3WDVA 1LOGA 2VY0A 1GZ9A 3BOPA 2JE9A 5DUWA 3SNMA 4XIKA 1OQ1A 1V6LA 2DVAA 2VH9A 3B69A 3USUA 4XJ8A 3IPVB 1X50A 2D3PA 1MR5A 1LU2A 2YMZA 1UL9A 1YXWA 2ZMKA 3C2UA 4Y20A 1SCRA 2Q5TA 3WV6A 4GWMA 1QU0A 2UWAA 5DUXA 4TYSA 3AYCA 2WT0A 1WUVA 2WT1A 4YG6A 2D6NA 2A71A 1DFQA 3PVNA 1JYIA 2CL2A 4NO4A 1MZ5A 2ZGSA 3MW2A 3N7LA 4GKXA 3UK9A 2UU8A 2GDFA 4FQZA 5IUQA 3SH4A 2ZHNA 3ILRA 3POSA 1U0AA 4JC1A 1W0OA 3M3OA 2V73A 1AX1A 1N3PA 1YI7A 4GXLA 5GZEA 3ZSMA 4FPFA 3INAA 3V0BA 1APNA 1LHVA 2D6LX 4HL0A 1Z0HA 3I4IA 4Y1XA 4FOQA 4C1WA 4YFWA 1CESA 1V6NA 4YM0A 1LHUA 4YGCA 3SH3A 2A3YA 3AFKA 1R1ZA 2A6ZA 1A78A 1BZWA 1N3OA 1QOTA 1W6OA 1WW4A 1CN1A 1GV9A 1LOFC 1Q56A 2GNBA 3AK0A 4FPHA 3IMNA 3OY8B 4K1ZA 4FPYA 4MYEA 4XMIA 5T5LA 3ZSJA 2GMPA 4LBQD 1ONAA 4XZPA 2PHFA 5FRAA 3AP7A 2GALA 4D69A 4DRRA 1WBFA 1QF3A 3B9CA 2NYYA 3AJYA 4P14A 3RRDA 5GZGA 1BYHA 1GSLA 3B3QE 1BQPA 1D0HA 2AYHA 4OZXA 4CRQA 3O0XA 3USUB 1SBDA 2D7FA 1DQ1A 2ZHKA 1H9PA 3ILNA 4XTMA 5E89A 5BYNA 1G86A 2P3JA 2WJSA 1A8DA 2WT2A 4XJAA 4F83A 4LBQA 3WDXA 3WCRA 1GLHA 4Y20B 5H9SA 3UJOA 1LECA 1SLCA 1WD3A 4Y26A 4LBJA 1S0EA 1Z78A 1IS4A 2P37A 2EXIA 3AXDA 3OYWB 1FV2A 2YXSA 4Q27A 3D5OA 2ERFA 3OBRA 1WLDA 1N1SA 2KM2A 1LGNA 1ENQA 1SACA 2D6MA 4P9WA 3T1MA 1W6QB 2DVBA 1Q8QA 1W6MA 2D6PA 4AGGA 1DYPA 1MZ6A 3D4KA 1LEMA 3GALA 2DVDA 4W65A 3JU9A 3ZXJA 1S1AA 2PHXA 2UWBA 2EIGA 3DUIA 4XBNA 4ASMB 1MS5A 1KDKA 3WNXA 1N3QA 4XBLA 4YW3A 3A0KA 2YROA 3RMXA 3SISA 2DUPA 2OUJA 2PHRA 1O4YA 2JDZA 4R9CA 4FVVA 4LBOA 4Y1ZA 4K20A 5HCFA 4UW4A 3LCPA 2GNTA 5JVVA 4WVWA 3MEPA 1H9WA 5L73A 4L8QA 4AVVA 2E53A 1Q8OA 1IKPA 1FX5A 1UMZA 3N7KA 2NN8A 3IM0A 3ZXKA 1QNWA 3FUOA 2A3XA 5DZGA 4Q1PA 1WW7A 3ZXEA 3ZYRA 1EPWA 2ZKNA 4PQ9A 2NZ9A 3PVEA 3U4XA 1NXD1 3RS6A 1UPSA 5E88A 4LBQB 1LHNA 2WQZC 3VKLA 1UZYA 4R9DA 1FATA 1LTEA 3FFZA 2VU9A 1AZDA 1DQ4A 5CA6A 2EF6A 1GZWB 1SLIA 4GALA 2CY6A 2GMEA 3WHUA 4YZ5A 3M2MA 2W52A 4FP2A 4FOWA 4JCKA 5JMCA 2ZGMA 1XQNA 2EXJA 1QOSA 2VUAA 4Q8KA 1YYNA 3NV1A 4GKYA 4M00A 1N1VA 2I2SA 3WDTA 1JN2P 2JECA 2YV8A 3V0AA 4M3CE 4FPJA 1V6MA 1C57A 2XG3A 1SFYA 1PZ7A 1DQ2A 1QNYA 3ZYPA 1AF9A 3SLIA 1VLNA 2FMDA 4R9BA 1UN1A 1W0PA 5GZDA 5GLVA 3AXEA 4BOWA 1C4RA 5EXOA 2WSVA 4FPLA 1I1EA 1QGLA 1OFSA 3WUDA 3N35A 1IS6A 2OUHA 4LBLA 2R0HA 2CYFA 3AYDA 4AGVA 1VIWB 2DYCA 3ZXLA 1GZCA 1B09A 1ZA4A 1MS1A 1N47A 1W6NA 2A6XA 5IK8A 1KJRA 1JW6A 3FLPA 1ULDA 1SBEA 1JOJA 3D6EA 4YZ3A 2DVFA 5GLUA 2D3SA 1CONA 4FQ4A 5HCAA 3NV3A 2ZHMA 4Y1YA 5T55A 3VKNA 5JLVA 1IKQA 2DTYA 3WDWA 2DURA 3ASIA 3VV1A 1DHKB 2P2KA 3WCSA 1CPNA 5DXDA 3B00A 3FLTA 3AYEA 4UW3A 1DZQA 3AP5A 5EWSA 1WD4A 1FNYA 4FPGA 1DQ6A 2E7QA 2ZBJA 3WG2A 3ZXFA 1JYCA 3R4SA 2WSUA 2E7TA 1BKZA 1LHOA 3N7JA 4XE9A 4YW1A 4XJZA 3WVJA 3POYA 5GALA 3V0AB 4FPOB 5H9QA 4BPZA 5GZCA 1G8WA 5EYXA 3AZVA 3TB0A 2PHUA 1SLLA 2ZABA 2VXRA 3OBTA 4U2AA 2VW2A 3R4UA 4DPNA 2P34A 1Q8SA 4XXPA 1G9BA 2ZGNA 1UX6A 2C9AA 1IS5A 1NLSA 2JJ6A 3T1LA 3A0NA 4YG0A 3FBYA 3L2YA 4Y22A 1CPMA 3PVOA 3RQ0A 4ATFA 3OJBA 2AH2A 2EXHA 5CNAA 3AYAA 2B7YA 3AZXA 2EALA 2AENA 1UAIA 2NM1A 3OGGA 3WLUA 4AYUA 4XIOA 3ATGA 4M3CA 1LOBA 1DQ0A 3V65A 1WW5A 1JBCA 1W6PA 3VUOA 5KXEA 1HKDA 3V0BB 2DVGA 4WVVA 2A5ZA 3HR9A 1HQLA 1BJQA 2D6OX 4I30A 1C1LA 4YM1A 2LTNA 3O0WA 1V6OA 2OVUA 2NP0A 3BTAA 3QLQA 5AVAA 2A70A 5DZEA 1RITA 3AZWA 1W6OB 4YZ2A 1JXNA 3V64A 1DGLA 1ULEA 2AREA 2R49A 3H0OA 3M1HA 1V6IA 1WCSA 3GNEA 2ENRA 5F5QA 4BLIA 4C1XA 4AVSA 1WLWA 3WDYA 4PF5A 2PHWA 4YW4A 1PZ8A 4M3CF 1C1FA 2BQPA 2JKBA 1LOFA 3ZPYA 4Y1VA 4BLJA 1S0IA 5CAZA 2ZZJA 5JOWA 1MS0A 1V6KA 5KXDA 1DBNA 1KJLA 1MVQA 2ZGTA 1KQRA 4XJ9A 5GLWA 3CNAA 1QMJA 2ES3A 3SITA 3A4UA 2PELA 2DU1A 3W58A 1ULGA 4XJWA 5IK4A 5DZFA 4Y22B 5DG1A 2D44A 2W39A 1LCLA 1MS9A 2ZGOA 4PBPA 4Q2FA 3WUCA 1HDKA 3M3QA 3QCWA 1YO8A 1MVEA 2VW0A 3VKOA 1G9AA 1YRZA 3PJQA 3M3EA 4M3CB 5GLTA 1N1YA 1GNZA 3WG3A 2DUQA 5T52A 1S0JA 1JUIA 1G9CA 2CTVA 1FNZA 1W6PB 3O12A 2Z42A 1W6MB 5T50A 2W68A 3ZSLA 4YZ4A 2NMNA 1VAVA 1GYKA 3IKWA 1LEDA 4YGDA 1HQWA 3AX4A 2E6VA 4ISQA 2HYKA 4YFZA 1O4ZA 2W08A 2XB6C 1MS3A 2R0FA 3JUUA 2LALA 1Y7BA 3RG0A 3TAYA 5JOXA 4CZSA 2E51A 2NMOA 1GBGA 5IK7A 4UW5A 1AX0A 3I8TA 2WKKA 2V5YA 2YY1A 4DRVA 1ENRA 2UURA 4YM2A 4FPCA 4LBMA 3W59A 1S0DA 5HCBA 1QOOA 4YGBA 1F31A 2D6KA 2WNEA 1KDMA
chains in the Genus database with same CATH superfamily
2WHIA 1LGCA 1L4DB 3B5LB 2QQOA 2CU3A 4QX2A 1OXCA 1FAYA 5TR5A 3FBMA 3N7MA 3QBQA 2X8XX 4AWDA 3H1YA 2JDKA 5D21A 1RHI1 4ZRJA 1LB2A 1H8CA 2ZGUA 1ODMA 1HW5A 1RJ7A 2QQWA 5HCHA 4P00B 3SKJE 1BXHA 1HRV2 1J7CA 5JSPA 1F4HA 1Q1OA 2RDNA 1BLZA 4IEWA 3VHRA 4MDKE 5KXCA 4I3PA 4D7YA 1AX2A 1FO4A 1CIWA 1F0ZA 2Z2SB 2BWAA 3TL5A 1TY0A 2XBO3 4K9SA 2BS3B 1PGXA 1R082 2TEPA 5C71A 3OD0A 5A3UA 5CHFA 2WXJA 2LD9A 1UKGA 2PHTA 1L4ZB 3NVYA 4MGIE 2BNMA 2HKXA 2VTXA 4SLIA 3DGTA 4IEZA 1C77A 3A21A 3IDAA 2D11A 5AFBA 3NJVA 1DOYA 4QU2A 2XUMA 5SV8A 2LW8A 1S0CA 4F8AA 4IUGA 1WGRA 4DDID 4WZFA 4LLOA 2WZR3 1JU4A 3KYCD 2WUHA 1JZ5A 2HLEA 3MC8A 4X6RB 1VAKA 1AHSA 2JD4A 2BDRA 3QH6A 4H55A 4ZZ5A 3AE4B 2HWB1 1QEXA 1WMHA 3GP7A 1V9JA 3OGRA 1SIJA 3QHTA 1VLBA 2ADEA 4KH9A 1RUC3 3B69A 1OD3A 4XDOA 1OURA 5L9VA 3B9IA 2GZWA 4BOSC 3F2ZA 1UL9A 1IHMA 4CP9A 1SCRA 2AZ5A 3DXUA 1DZRA 4TYSA 3VHPA 4IWOA 1UF2C 2PE9A 1GOFA 5BNPC 3MW2A 3UK9A 2Q8OA 1RUC1 3PVLA 1FPYA 2WXOA 3VGIA 1AX1A 1YI7A 5FY7A 3OD4A 3PRPB 1RRBA 2BKRB 2JXAA 4CCOA 3OPZA 3MLLA 1TBEA 3H8OA 2XJPA 2GBNA 4FPYA 4XMIA 2GALA 2TBVA 2IXKA 4P14A 1P8JA 3O0XA 1WJ6A 3DHHC 3VZJA 3L9JT 3VBUB 2KA3A 2TUNA 1AL23 1ZGUB 4XJAA 1VMHA 3NRUA 3LXFA 1Q5OA 1SLCA 5C9AC 1WD3A 4C80A 2IXIA 2EXIA 1D0GA 4QDSA 2PLV3 4PIYA 3GALA 1I4QA 1S1AA 4ASMB 2I74A 3HT2A 4WQMA 3P3PA 3QK0A 4TTGA 2P5BA 4ORFA 1EU4A 2GNTA 4UF0A 4WVWA 1QQP3 1TZ1A 4AVVA 2NBWB 2PLV1 4RH6A 2IGDA 3ZXKA 3AM9A 3T3YA 4R9DA 2V4VA 3W20A 5KHHA 3GBWA 1DQ4A 1X9PA 1J1LA 4NROA 4MG2A 1WJNA 3VFKA 2EA7A 2ZGMA 3I2HA 5FJHA 4IGPA 1NAEA 5FBJA 1QNYA 1E5SA 1W03A 3Q6BA 1RLFA 2WWSA 3UIOB 1JCKB 2DYBA 3GJAA 2YPDA 3VDDC 5FP4A 3ZXLA 1HRV3 1N47A 4AI0A 2RGFA 2FNJB 2K0GA 4Y4RA 2JU6X 1RUNA 4Z1VA 1G6NA 2FCVA 4DXTA 1ZRRA 4FQ4A 3I97A 2HDEA 1HB2A 1NG0A 5IVFA 1GMMA 1XLQA 4FTBA 4XC9A 2QCSB 2BRTA 3ZXFA 1E10A 5EDSA 2FCMA 4RGTA 4HONA 3POYA 4CHKA 4FPOB 4IV3A 1R083 1JZ4A 1PNGA 1UX6A 1RC6A 3L2YA 1RXGA 2G1EA 4OQ8A 2DAJA 3AYAA 3A9JA 4W9IA 3H3ZA 4QPYA 1LOBA 2OQ7A 2JSVX 3Q3JA 4YWAA 2FIFA 4EEWA 2WXHA 3GXUA 1BCXA 5AUIA 5AVAA 3ZX7A 1HJFA 5HPOA 4P1BC 3AZWA 1WX9A 4YZ2A 1JXNA 1OOPA 2R49A 4JGZA 5AEKB 1V6IA 4AVSA 4DNYA 5LBCA 3TWIA 1SXTA 1GNUA 1LRHA 2WNUB 5J2RA 1JYNA 4K3BA 4KGQA 4K81A 5A3WA 2ZS6B 1H2KA 5GLTA 1K5MA 1UF0A 3ZSEA 3O14A 1VBB2 2Y6KA 3AX4A 2GH2A 3T4VA 3Q3OC 4OVEA 3HQRA 1MS3A 2R0FA 4FADA 4PYUA 3WAMA 1GBGA 3GS2A 2FDJA 4OVZA 3VL9A 4FPCA 1EO6A 3LFIA 4XYCA 4RCOA 1PM4A 2JG8A 2CGPA 1YWKA 3AULA 1C76A 2VTFA 4AEDA 3WG4A 1KJTA 4QXCA 3LIGA 2J7QB 2HEVF 3LB8C 5FUIA 5HBAA 1ZZCA 4DUVA 4TLGA 4DHZB 2QVSB 2WYFA 2ADDA 3PRMB 2FCQA 5C8WA 5EV7A 1PZ9A 3UT0A 5A1AA 3P63A 1JW9D 3ZJVA 5FK8A 3U37A 5A33A 2Z79A 2A6VA 5MPOA 4ZYNA 1D2SA 1H30A 4TZDA 4LNKA 3N3KB 2XPJA 2AQ3B 2GP5A 3DN7A 3ROUA 5F2WA 1A34A 2W3JA 3HD8B 3M3CA 3T0BA 1NLRA 3IDCB 1MJDA 4JV4A 1XNTA 2WYQA 3PUAA 3MLJA 3MO4A 3EFCA 3UIPB 3CMMB 2IPKD 1VBA2 2VH1A 3POWA 4CDXC 1IGCA 4WJQA 3VTUA 4BKSD 4MH0E 4QX0A 5GM0A 2WAAA 1MG8A 1V1PB 2W1SA 1CAXB 2D97A 4YLZA 3M3IA 3KUCB 4WM8C 4HRSA 4Y1UA 1TEIA 4ZZ8A 2WXLA 1DLLA 4AJYB 2Q30A 4YW7A 3SH5A 2AUYA 4DXZA 1IGDA 4KMQA 4LO6B 4PDWB 5DDJ2 3E5XA 4P9GA 2G9HD 3VXWA 2R041 5LBFA 2B39A 2HJ8A 2B5HA 4JX0A 1SSNA 5FP9A 3SMHA 3I59A 1U5ZA 3X23A 1PUTA 5FZKA 2WT0A 2YC0A 3JZVA 3BTYA 4CDQC 4HKZE 1QJU2 4C4VA 4YSZB 1VRH2 4DO0A 4NHLA 4R3DA 4FPFA 1HB3A 4N7IA 1NE6A 3WNPA 2WXKA 4LULA 1N6ZA 4KG0A 4W4ZA 2A6ZA 1N3OA 4AVCA 4XPVA 2MBHA 1RVF2 3ZSJA 5IK8A 1HQNA 5FRAA 1AYFA 1GB1A 1I5PA 5JHAA 3PTYA 2O14A 5FMOL 1K42A 4LK6A 1GSLA 2KJRA 4MXVA 3W1SA 3J8F3 3PU8A 3A22A 3ABVB 4FN2A 4HK9A 3WCRA 1GLHA 2HTHA 4KWJA 4M4PA 2KDBA 3BK2A 1DOXA 1O5UA 1SACA 2K6QA 2BBVA 3H6NA 2H0VA 4RGNA 1DYPA 3LDRA 1S4CA 3D4KA 3JU9A 1ROEA 3WNXA 2VNOA 3MIFA 3SISA 2K46A 5JXIA 2P1BA 5HCFA 4I2OA 3VAWA 4GDLB 4BIOA 2I07B 3LCPA 5DAXA 3KV4A 3J7MA 1UMZA 3P42A 1GR3A 3N7KA 4AFDA 1E7UA 1IG0A 3QC8B 3VBRC 2INPE 1WW7A 3ACFA 5A7WB 1VBB3 4PQ9A 3L17A 3VKLA 1UZYA 3KZ4C 2W2IA 1XJAA 4PS7A 2JUOA 2GMEA 2BYFA 2W52A 4EUTA 4FOWA 4PT6A 3D82A 1VBB1 1WGPA 1SGHA 4BB3A 2NPIA 1RUJ2 2KMCA 2NBVB 3CWIA 4J1WA 2FCTA 1QF6A 1IQAA 4NHMA 4FAHA 2AX5A 1W99A 2GSYA 4OUSA 2W1WA 2OUHA 1H6XA 4COVA 5C8CA 1WJUA 4L0PA 1ZA4A 5A70A 3LJ3A 4UBGA 2K0PA 4YZ3A 2DVFA 2FCSA 2D5GA 2D3SA 2WL1A 1OPOA 3R2IA 3S6PA 1BMLC 4LTUA 3UGHA 3WDWA 5FXVA 4UBHA 4FHKA 4EN7B 1FNYA 3WG2A 4ACFA 2KWVB 4QM8A 5FKCA 1QH7A 4LKEA 4MM3A 2PYTA 3ZYFA 1O3SA 1VMFA 4NAMA 3ETQA 1DP0A 1ZE3D 2C9AA 2Y6FA 4E27A 1JUHA 3RQ0A 4QHZA 2B7YA 1ZXIA 2QQKA 4C8DA 3ATGA 1UIJA 2LJIA 1OLQA 2LFIA 5LLIA 3OOXA 1T0SC 3IIAA 4LE4A 4LNNA 2LZ6A 3GGLA 2KJHB 1ZP0B 1J3PA 1VBA3 1MVKA 3RN9C 1DU3D 1HTOA 1UZVA 3HIFA 4YW4A 3WT3A 3HVDA 1VBA1 1W9FA 1KQRA 2OPKA 1KEXA 3NNFA 2CHZA 4MLOA 5JPNB 3IWZA 1V86A 3SD5A 4N53A 2LUEA 4DK5A 3DBLB 4IWPA 2HD5B 5DDJ3 5FQ0B 4XUOA 2R32A 1FNVA 2EMTA 3DVNU 4NRMA 3UGFA 3TNPB 4DRVA 4PI2A 2RVAA 4HJKA 4LBMA 1A8MA 1EAH1 2V72A 1NYWA 2BWES 4YVSA 4GZ9A 2XJRA 4COYA 1D5ZC 3WF2A 1EUVB 1QJU3 2ZKLA 1VRH3 1UY0A 3LEKA 3I2OA 1OLMA 3PTFC 4JGYB 4LBNA 4NWWA 1C28A 4FP3A 2J7MA 3RMYA 3PLUA 1RVF3 2LMCA 3QH7A 3KV6A 1D7PM 1QJU1 4N43B 4S2FA 3AC0A 1KS5A 3GE8C 4AGRA 5EP9A 3MW4A 1NQJA 1Y43B 4LEJA 4LK7A 4JKKA 3AJZA 2ORXA 1RVF1 4QPGC 3PREA 2B3AA 4LIVA 3EQEA 1DDLA 4BZ4A 4IESA 1IQDC 5E1RA 1TZOA 4FPEA 1UH6A 4S0RA 4BQWA 2J52A 5D6JB 4IQPA 1RMU2 3ZFEC 1XEEA 1F4AA 4OZAA 4XQDA 4K7JA 3R05A 1AJKA 4FO9A 2GH8A 5DUVA 1S3SG 3KUZA 1REEA 4RHV2 5FZAA 3ALBA 4DWFA 5K7PA 3AZZA 3RD2A 2JPHA 4EFOA 5BNOC 2GN7A 3OEAA 1RUJ3 5IK5A 2ZX4A 3BIID 3EHVA 4PF1A 2XL7A 3APCA 1VRAB 4GA9A 3EB7A 2INDC 5H9PA 1RINA 4WWPA 1RUJ1 1V5TA 2JE9A 5K8SA 4NWVA 3USUA 1PO21 1X50A 2KLCA 3IZOA 4UT5A 2BB6A 4YVWB 3N7LA 3W2DA 2JB4A 5D2AA 3RULA 2YFUA 3ZSMA 4GXLA 1XSRA 4QXKA 4FJVB 4C1WA 3VTWA 2TSSA 2Y0IA 3SH3A 3W21A 4J1XA 1E8YA 3AK0A 1GV9A 1J59A 2BKFA 4XZPA 3CIRB 1DGWX 5FZOA 3UQBA 4CP9B 4Q5OA 2OXBA 3FFQA 2JZ3B 1YOVB 2KO3A 5BV6A 3P4QB 3B93A 4CA9A 1UZ0A 3ZDTA 2DCTA 1X7NA 2VM9A 2DBYA 1MS5A 5EE0A 3LA2A 5F2SA 1UYZA 2FIDA 4W6WA 1ZNPA 5LY2A 4REZA 1YQ6A 1J84A 3WSOA 4XURA 3H7PA 1TKGA 3QCAA 1ENXA 4CCMA 1ZOYB 5DZGA 2LS6A 2NZ9A 5FJKA 4WBBA 1UPSA 3POIA 3IAS1 3HIZA 2E6XA 2VECA 1XE8A 4Q4W1 1W2AX 1SLIA 4GALA 3T2PA 1UY1A 3ZXGA 1XYOA 4Q8KA 3KVFB 1KD7A 1FPN1 4RF1A 3O1TA 5JZGA 2L9LA 3EC8A 4JQTA 4UF0B 3TNQA 2M17A 3ZJUA 2WSVA 2LGYA 2QJVA 4DUWA 4BK4A 2ZPXA 3PT2B 3V62A 2VMFA 1W6NA 2QBXA 2KWDA 5L7OA 1ALYA 3T2OA 5JXGA 4AQ7A 5HCAA 2ZHMA 3VKNA 5DXDA 1NVID 5LNK1 4ASWC 1JYCA 2E7TA 4Q0SA 4JHZA 2BBCA 1Z2MA 5FPLA 1WYWB 3ZFFC 4QD2A 1PGAA 2O8QA 4Y22A 4AXOA 1B35A 4Y5SA 1UXXX 1RMU3 3WLUA 2P6CA 4M3CA 1C4CA 4GIVA 3ZO5B 2ZCBA 2RS32 3JSVA 2QQIA 1XXNA 2XK5A 3X0WA 1WX8A 2VCBA 4RHV3 1W3VA 3AMMA 2QMTA 4RS5C 5EJZB 1PZ8A 4IV3B 5AUKA 2OZJA 3WNKA 2MX2A 3ZYYX 4MT5A 4EKUA 4RHV1 4A3OA 1L7RA 2WZ8A 3K46A 3WUCA 3A9JB 3OB8A 3RVHA 4UFLA 4DB5A 2CTVA 1E8XA 1YNAA 1L0YB 5IO9A 1LEDA 4B7KA 2W08A 3GZEA 2M4NA 3V61A 3RG0A 2W5FA 4CZSA 2E51A 5F3CA 1FD6A 1RGSA 3AEBB 4QPIB 1OOPB 3VRAB 2FBEA 4L97A 1H4RA 2VZRA 4RMAA 3KB5A 4YGEA 1D3ZA 5BUVA 1LKNA 2N7JA 5FP8A 4AHXA 3AU4A 4XUNA 1UYPA 1GWKA 3PTRB 4NUBA 4Z2WA 4FT8A 1JOPA 1K5MB 1PFDA 4ANWA 4NOTA 3VBSA 2WU5B 2WLPA 1T0QC 1EV12 2G45B 1W6QA 3APBA 2MSED 3PRZA 1F35A 3H42B 4BU2A 1RWSA 1GICA 1GOHA 4B7EA 2WGSA 2JG8B 5JXJA 3THTA 4Y24A 5A6QA 4AEDB 4XUPA 5L9RA 1QKQA 3I3DA 4L11A 2ETEA 2HBTA 2D07B 4FTEA 1TYGB 1YJJA 1LENA 4LKDA 2PW9A 4MEMA 1BK1A 5BO4B 1Q5WB 4E4ZA 5I8TA 1AL0G 2L76A 1QWRA 3LEMA 2KDFB 4ARXA 4XXAA 4Q8LA 1MHXA 4ZOHC 1W8HA 2CV6A 3IPVA 5A33B 1ZRCA 4ZRIA 2VNGA 2XWBB 4BQXA 5CHVC 1WXMA 2DZIA 2KT7A 4LBKA 1W2NA 3GCWA 3DVGY 4KBZA 3LE0A 3DHGC 3MC9A 1OD5A 2AGSA 2BVVA 5EFUA 1A3KA 4IEXA 4JTOA 1JHNA 1YFYA 1P3QU 5LBEA 5FYUA 5A6XA 5FKBA 5HFYA 1KITA 2D5HA 5C3RA 1YQCA 1OVSA 4NY0A 1YQ3B 4C7ZA 4XJ8A 1U4AA 5A1LA 2RMU2 4KU8A 2YMZA 2ZMKA 3VBFA 3NQHA 1W8ZA 3PO0A 2TNFA 1CJEA 3ILRA 1TNRA 1ZREA 3T08A 4BIFA 2XLFA 1BMV2 3VBHA 4DQOC 1A78A 2Z0DB 5T5LA 3ZDVA 3J9CA 1WBFA 3AKRA 3B9CA 3WR0A 4J6IA 2RR11 2W47A 1BYHA 2J4XA 1U5YA 1DQ1A 5BYNA 2P3JA 4A41A 2RS33 2WT2A 4H14A 2W87A 4K1RB 5EE3A 3TEWA 4DZGA 1HE8A 1N5XA 2OKXA 1Z78A 4CPBD 5F5AA 1FV2A 2YXSA 2YPJA 3D5OA 1K45A 3UI3A 4C4VB 1QJX2 2JRHA 3BOWA 4W65A 3RDIA 4WM7C 3NKGA 5J36A 1PMJX 2WC2A 3LEIA 3MTNB 4YW3A 4XETA 3Q3NC 2JDZA 4R9CA 1QH6A 2IGHA 4XUTA 1N5WA 3HWJA 1PGW2 4GB32 3W5UB 1VR3A 2G9GA 3SCFA 3ML9A 3E6DA 2UY8A 1HX6A 5F6KA 5BNPB 3C19A 4YTMB 3TN92 3S57A 1E7PB 4L99A 2XJUA 1DGJA 3SCHA 5LASA 4MJSA 4PS3A 2EXJA 5DPWA 2CR5A 2KMMA 3BVZA 2I2SA 2N7DA 5K9YA 2V3SA 2WDVB 3VZOA 5HI1A 3BN6A 4D0QA 4QX8A 1DYQA 1C4RA 4FPLA 4JRLA 1CZTA 2IFWA 1UU6A 2PEAA 3B9JA 4AGVA 1PK6C 5EHDA 1GZCA 1MS1A 1WCDJ 3LDKA 2XKOA 1EV13 3ZYBA 1HN0A 4DY5A 2O2VB 2JQRB 5LA9A 3BWUD 3WAOA 2V3PA 4LDTB 3D3AA 2J1RA 2L0FA 3LPGA 3TMPB 3R4SA 3BVGA 4BDVB 1EV11 2BEOA 5TSSA 4DIQA 3I3QA 5J96B 1RXFA 1WE7A 2VW2A 1QKZA 1GWMA 4A8XC 3THCA 1GUIA 4KL1A 1WZXA 2D98A 2WBKA 1YNTE 1C78A 1CJDA 5C8CB 1S2KA 4ZRPA 3AZXA 2Z69A 4GMP0 1UOGA 4YSXB 3KF5A 2A4ZA 2XXZA 3M7AA 1EWYC 2Z5WA 2HTME 3RZHA 1HJGA 3NNJA 3P2BA 2PTMA 3RFRA 3EECA 1ULEA 4O7XA 2M0AA 3DBRI 3WDYA 1WMFA 4MM3B 1R1A2 4QX5A 2N9PC 2ZCCA 1UYXA 1GJZA 3ABZA 3QIJA 2KK8A 3CNAA 1ND3A 3V3XA 4QKNA 1PIV2 5CKQA 1H8VA 2W39A 5FZDA 1HDKA 4YSYB 4R52A 2CKHB 2N9XA 1RTVA 3C7HA 3O1SA 3WG3A 5T52A 1VBC2 3RYKA 2DBIA 2UYAA 3U30A 3O1PA 1R4MB 4ISQA 3RNFC 1AR82 1O4ZA 1KFUL 3LAGA 1MG4A 5FMBA 2WKKA 1EU3A 2RMU3 4D3WA 2DU0A 2JZZA 2YEPB 4ZS3A 2WXRA 3EUB2 4B8EA 2WLQA 4LNVA 4XDQA 2RMU1 4QX3A 1EM7A 3JBG3 1FCCC 1PQSA 5C7GA 4N53B 4E4SA 4JHTA 4UWDA 4KIKA 1RUE1 3ECQA 3DHIC 3VZMA 1POV3 1S0GA 1ZUD2 5FDBA 4E74A 5KXBA 5A32A 2KFJA 1XU2A 4F1SA 2N7EA 4HROA 4RQPA 4EJRA 1PGL2 2R1DA 1BMV1 4QMAA 4MSMB 1POV1 2SAKA 4QDRA 4YVSB 3O65B 2K6DB 2XUEA 2VXJA 3K3NA 1QJX3 2EICA 4CU8A 2JVCA 3AU5A 1XNBA 2ZGLA 2ZMLA 3RSJA 4BWOA 2PKOA 2Y5PA 4AFAA 2X5IC 3BYYB 1HA5A 1CGPA 3OG2A 1KGYA 5E8AA 2QQNA 4IC7B 1QJX1 1WXQA 3IFWB 4GB33 1PX4A 3KLSA 1IS3A 1S0BA 2BB5A 3VKFC 5FP3A 1TIFA 2CHWA 4NAWA 3LOIA 1LJ7A 2MLBA 3TN93 2OPWA 2Q1MA 3AV8A 3HNBM 1PGW1 4GB31 2FE8A 5D1IA 3ZN6A 3LA7A 1L0VB 4OMDA 3N1XC 4JPSA 2LVQA 3K2OA 3WNNA 5LZ6A 1ZZ6A 4K21A 2FCUA 1MQTA 4HVOA 4GWNA 3AE5B 1JZ7A 3H3LA 4X8PA 2JT4B 1I4GA 2V4IB 3ETRA 2ZNVC 4QX7A 4QB1A 5CTRC 5DUWA 4XIKA 5EJ1B 1J8CA 4P9IA 4NJCA 1JWAD 1B35C 1TKYA 1SEBD 4NPRA 2GBKA 2NR2A 3U52E 2CS4A 1QU0A 2DCKA 4CDWA 2WN2A 4TXWA 2ZGSA 2OJWA 5EIYB 1ND2A 5JIAA 1PO12 1NA1A 1LHVA 2GI9A 1Z0HA 2GBMA 2VVDA 4ZHPA 1J0GA 4LUMA 4YGCA 2J22A 5FYYA 4WJOA 1BZWA 1QOTA 1WW4A 2ZXQA 3BCWA 1ONAA 3UGGA 3P4PB 3AJYA 5ABJC 1OGWA 1P7FA 4IGOA 1Y8RC 4EOYA 4CRQA 3CDZB 3USUB 4J6GA 1KLGD 4XTMA 1G86A 4F3JA 4AZZA 4AS1A 1YI9A 3UJOA 3WANA 4OUMA 5C3OA 1R1A3 4XVHA 4TV3A 2K2SA 4BAXA 2JICA 3ZXJA 2OT7A 3BPZA 3LYYA 1JROA 4EYUA 3RMXA 3GHNA 1HN1A 3MEPA 1Y3TA 4GGQA 4L8QA 1R1A1 1I4XA 2ZJDA 1VBC3 3SFEB 5FZOB 3ZN4A 4Q1PA 3BU7A 1O6UA 1PIV1 3VBSC 2A1XA 3USSA 5CA6A 1VDVA 2OIIA 2WS3B 4JCKA 4YPJA 4CCEA 1V81A 1DOIA 2V9HA 3JB8A 1AR81 2JECA 3BALA 2GBJA 1LGRA 2OQ6A 2VZSA 1VLNA 2OS2A 1Q43A 4NR1A 5LEJA 4MH8A 2J1SA 4Y33A 3C7OA 4XAEA 1JMUB 3H7PB 5DPSA 3RPFC 1IS6A 5J48A 3GB1A 4CDUC 2CYFA 3T2QA 3SEEA 5A3PA 4DUXA 3THDA 4HSJA 2JB8A 3H1MA 4CEYA 1P98A 1PNFA 3V6CB 5HXVA 4NNJB 3BINA 4Q0UA 2V4LA 3ZYJB 4KG8A 4CEWC 1LHOA 2XJSA 5G2NA 5JZGB 3QQ8B 1PGL1 2ZABA 4IM2A 3OBTA 4U2AA 2RMMA 2RDSA 3WINE 2BOIA 1J19A 3B2GA 1CWPA 3DBHB 4ATFA 2MJEA 3RI9A 5L7OB 3HM6X 3V0BB 2OEDA 3O7OA 1L5PA 4UAPA 3O0WA 4QX1A 2OVUA 3N4MA 3H1WA 2VUCA 1IPGA 2ENRA 4D6QA 2DCZA 1WLWA 2ZTNA 2YUEA 4II2B 4IWQA 1N60A 3E56A 2VVFA 2AL6A 2DU1A 5F39A 4Y22B 1VP6A 4AP4C 3PNAA 2LVPA 2CJOA 1MVEA 1NT0A 1C5IA 4M3CB 1G9CA 2JF5A 1J7BA 4W9GA 1JUIA 3FZ3A 3O12A 1W6MB 5C4WA 3ZVVA 1HQWA 3JSVB 4OCTA 4O9EA 3U1XA 4OHVA 5FR6A 4AR2A 2XK5B 4NRQA 4YM2A 2YBKA 4QB6A 5I0TA 2J0JA 4CUBA 2JDPA 5CADA 4X8NA 2LRUA 1I4RA 4KKJA 1PO13 4AAPA 2VQUA 1XNKA 3UESA 3VBUA 1R7SA 5T54A 4JQWC 1VBD2 1D5MC 5FPBA 1AR62 4DXSA 3KCCA 1SJED 2RS12 5E6JA 3URFA 1PO11 1STEA 1UY4A 5FYIA 2VQ0A 2GN3A 4KBBA 2UU7A 1ZVFA 3BIEA 2HWC2 1UIKA 3CZUA 3PSEB 1WCUA 1CAUA 4J3OD 4RR3C 1I4HA 5G55A 4NRPA 1L7LA 2MCNB 1QOFA 4XBQA 3RZKA 1NXMA 1GC7A 1LXDA 4KZCA 2INCC 2VPVA 1A6CA 1D4M2 5CIRA 3CQOA 4FCAA 1BEV1 2LHEA 3PU3A 2ZGKA 4ZY9A 4LOTA 2DAFA 4FFGA 5J3UA 5EYYA 2JX9A 4MXWA 1E0ZA 4L2NA 3VRBB 2YBPA 2Q1ZB 1QJFA 5JOZA 2WDTB 1OBNA 3MW3A 2KACA 1LOAA 3WP6A 2VG9A 2WFPA 4YW5A 5D94A 3VB9A 5FZ4A 3H9AA 1E6EB 4KGSA 5T5OA 1O91A 5FR3A 3CJXA 2W9XA 3BIWE 2WO1A 3NNMA 4W9LA 1UELA 4BMBA 3WDVA 5CFCC 1VBE3 4IEVA 3WNMA 1J83A 5FYVA 1P9DU 1WF9A 4LJHA 3IPVB 4LTAA 4AI9A 1VR9A 4X6QB 4IEQA 4I09A 1LU2A 4GQ7A 4I6NB 3KVBA 4EZHA 2EKEC 2XJVA 4NO4A 4DY3A 4TSSA 2UU8A 4FQZA 5IUQA 5KC5A 5FOBB 4Q4V2 3M3OA 3WW4A 4NAOA 2JG9A 4I0BA 1NDDA 2KJ6A 1CESA 3RT3B 1SG3A 2WRAA 3EA6A 4MYEA 1EY2A 2PHFA 1NEKB 2VMIA 5LWBA 5LATA 2ET7A 3BGAA 4M8NA 2R072 1R092 5LRRA 4KDLB 2LGDA 3SFDB 4II3B 2D7FA 4XDDA 3VBFB 3NS1A 1PX3A 2IBIB 4UYBA 1IS4A 4HKLA 4HVRA 3PIJA 4M0WA 1PVXA 3T1MA 1LEMA 5BNNC 2PHXA 4XBNA 2EIGA 2KD7A 3AKSA 3A0KA 3LWCA 3VBHB 5CKNA 1O4YA 4Y1ZA 3AE3B 3WCQA 5APAA 1AR72 2W3SA 4LKSA 4TSVA 5LW9A 5B2GB 1B9RA 4H7LA 1FMD2 1V97A 1YJLA 2CDOA 3ZYRA 2ZKNA 4LDTD 3I2DA 4EV0A 4QT6A 3AEEB 3MIHA 2ASQA 2YU2A 2WO3A 4LHNA 4AF9A 1XLOA 2XGXA 1NCQC 4JDOA 3OBZA 3FX3A 1QOSA 3NZUA 4JTNA 1AN8A 2XH6A 4RM8A 4A4AA 2G3QB 3KT4A 3ZRFA 4IV1B 3WF3A 3DVGX 1VBD3 4A90A 1QGLA 1NOVA 2OZ6A 1AR63 2R0HA 1UW8A 3QAQA 1LAJA 4XACA 1ENFA 1TJEA 3FLPA 5FLJA 2ONQA 5GLUA 2XHNA 4TQ1A 3KW5B 3ASIA 1AR61 2HWC3 1CPNA 4MJSB 3FLTA 3AH7A 2E31A 4E8DA 5AFEA 2RS11 3A7QA 1ZW7A 5A3OA 2PHDA 4YYOA 1HZ6A 2XR4A 5L9BA 1NENB 2PA7A 3GDBA 3R6SA 2HWC1 2Z4FA 3AVSA 1Y56A 5ISLA 4F7ZA 5CNAA 1V1PA 4AYUA 3HQXA 5FY9A 3VH3B 3H8RA 1UGJA 5E6HA 5C23A 3ZDMC 4MGKE 5CFDA 3P5BA 3EO6A 5FMOS 1W6OB 3V64A 1D4M1 4S2GA 1CK1A 2DYOA 4N6EB 3U4EG 4AL9A 4OULA 4AQ6A 4S2HA 2WO2A 4PIXA 2JKBA 3I2IA 2ZEZA 1PVC2 1S0IA 3PV1A 5FPAA 4MX3A 1V6KA 4FBFA 1MVQA 2ZGTA 1QMJA 4DOUA 2VZUA 4BKGA 5IK4A 1X9TA 1MPXA 2XVGA 1GQHA 2RSUA 2VW0A 3NJYA 3HM3A 1YRZA 1NA1C 3RGBA 2WDBA 3WAPA 3CEWA 4FBJB 1GNZA 2DUQA 2L00B 1ZBE1 3HPNA 2Z42A 3ZSLA 2EMSA 3MPBA 2ACZB 1CAWA 3JUUA 1AUYA 3G7DA 4V2WA 3MFGA 2OJRA 3N9OA 2EVXA 2PFWA 2KHWB 3J7HA 2LVOA 2KN4A 3RZMA 2O6VB 3U7DA 5JCTA 1L6UA 4W9DA 1DYKA 2G9ZA 1ULFA 5FZCA 1ZKHA 2NMQA 3UJQA 1ND3B 2L0TA 2KC1A 3ZXAC 1SLAA 1OHFA 2HJIA 3VD7A 2CHHA 2EIEA 4MHUA 1IP9A 4AI8A 2ZX3A 3KQRA 4Q4V1 5FY4A 1YD8U 5C5UA 3RNBC 1R093 2KVRA 1E9MA 2MBEA 1FV3A 1RUD2 5C2TB 2C6SA 2DLBA 2YGLA 2ZEXA 1BK0A 3U78A 1PYWD 1HRI1 2R071 4U36A 1I3HA 1ZRIA 3AKPA 5DG2A 4NPNA 1OUXA 4IE5A 2VCMA 4GIQA 4HXDA 4KIKB 1MS4A 3CO2A 3ACGA 2PHLA 3TSSA 2K39A 1AR73 2D3CA 2FD8A 1OEYJ 2IVJA 4LJPB 4RQPB 2P3YA 4YZ1A 1FMD3 1OQRA 3L4PA 3E6BA 1X8MA 1GNHA 4E2SA 1K50A 3GZAA 4CO7A 4XOGA 1XLPA 3AP6A 3KSCA 2YVCA 5EE9A 5G05L 1FMD1 3AP4A 3L10B 4FXKB 4WWMA 2XLGA 3CMGA 4EN8B 1F2NA 5DABA 2G4DB 3RNAC 2CU1A 1WRDB 4HFSA 2ZA9A 3VBOB 3OUJA 3GJBA 1W9SA 3HT1A 3LSDA 2NLRA 2DBNA 3L2HA 1HTQA 2VZTA 3E5UA 1F5FA 3KV9A 3RNCC 1XE7A 2HWB2 4NAWB 3SNMA 4KGGA 2KTRA 3DF0A 2HBUA 3KCYA 3HOBA 2JEMA 3V56A 4Y20A 1BVVA 4QAYA 1W2OA 3AYCA 3ZN6B 1WUVA 3LDZE 4AI1A 2CL2A 1F15A 2JX5A 4A44A 2FQPA 3VHNA 3IT6B 2DHZA 3INAA 1LR5A 4FXGB 3KHBA 1MQTB 2Y60A 1LHUA 2PMWB 4ZDVA 4TN7A 1HXS2 3ZQ4A 1KM7A 3K3OA 4FPHA 4PS8A 1Q56A 2EIBA 3NNGA 3AP7A 1W2TA 2QFEA 5FWEA 4HPKA 3CIHA 3KD4A 3ZXVA 1EF1A 4EWDA 2SEBD 4AQ2A 3MJ5A 2H88B 1I35A 4CDWB 4MGZE 1X82A 1PM7A 5AC92 1LGNA 3O1OA 4NIDA 4XCBA 4JLCA 3TIXA 3CJIA 2P17A 2R61A 3IBEA 3FE5A 1H6YA 3NVWA 4HCNB 3VBUC 1PVC1 2WNOA 4S2DA 2M1MA 3ACLA 4WVZA 4L2YA 2BYTA 3CSFA 2WQZC 5F6LB 5FY0A 3ZMOA 2RDHA 2GC2A 1V1OA 5A6ZA 2B76B 4AAXA 2EF6A 5FOJB 1FOD2 4J25A 3NL1A 1RL3A 1QJY2 5JMCA 1XQNA 2H6BA 4A2UA 2VUAA 3HBKA 1BVP1 1YFUA 4UFJA 3VTVA 3LOBA 1A5RA 4LJOB 4HCPB 2KMAA 4FPJA 2WQYB 1DQ2A 1CZVA 3HBZA 1TGZB 1JRPA 4R9BA 4FHJA 1AW7A 4GB9A 4NHXA 2KD0A 3APFA 2A73B 1UBQA 4HKWA 4KQ7A 2BPSA 1V49A 3M95A 1FFUA 1GPXA 4I01A 1CX1A 3NV3A 4KV2A 3VV1A 1RUD3 2H89B 3H50A 4HBNA 3AYEA 1DZQA 3EBRA 3RZLA 3HUIA 3RNEC 3CSTA 3A33B 4XJZA 3DBSA 4RGKA 5GZCA 5IHRA 1G8WA 4JL9A 3RI7C 1GQGA 1TG7A 4HT1T 1S55A 4FJYA 3Q69A 1RUD1 2F4LA 2BOJA 3T1LA 1V2YA 1CZSA 5DPTA 2CGNA 5G04L 4GLSC 3VUOA 1QILA 1OH3A 3CL1A 4CEYB 4YM1A 4DXRA 3PDQA 1RITA 4XDCA 3BVCA 4V2VA 4PF5A 2QCZA 4WVMA 4KZ0A 1SMVA 3U07A 4OZBA 2WQ4A 5KXDA 3NNLA 1KJLA 2ES3A 3DYPA 3A4UA 1W06A 4IEYA 2N4FA 1H8TA 1PMIA 3AB0A 3O13A 3FMGA 4YARA 5DZFA 3BYWA 1EF5A 4NJ4A 1JWBD 2QDFA 4YVWA 4BISA 3JW0X 5T50A 5HV0A 2FBWB 1GYKA 2HWB3 4EWEA 3GYDA 2HYKA 2XB6C 5CZKA 5IK7A 2XOMA 1ENRA 3NOBA 2WNVA 4XCAA 4MACA 1F31A 2D6KA 3Q8CA 1WR1A 2WNUC 5IA7A 4XF0A 1C3HA 4NHYA 4DS0A 4P1CC 2LUWA 3RFZB 3MIGA 1UY3A 4NMIA 1SPPB 2DUOA 3WALA 2AEYA 4WV8A 3WF4A 2VBDA 3D0JA 5FXWA 4Q4Y2 1N1TA 2FZ2A 5C4WB 1LODA 4ZRQA 1OTRB 1HXS1 2IWGB 2GMMA 2VRRB 1SLTA 4ARIA 1J7AA 5FZ3A 3DXTA 4FLHA 5AC93 5C3QA 5JXVA 1T0YA 1POQA 4C91A 3KV5A 3VUYA 1OFFA 1JZ8A 4E8CA 3IAQA 3HHMA 1FNWA 5FUPA 5AC91 4PBOA 1O3TA 5CVRA 2FUG1 4M02A 3OAWA 3ZUNA 5GJ6A 1QXJA 2E3TA 2J1UA 3VZKA 5C3SA 2YGMA 4HPPA 1QOBA 2I1KA 1M4WA 1RIRA 4IM3A 1CAUB 5JDBA 1LHWA 1UNSA 5IN7A 1FOD3 2VZ1A 1SBFA 1QJY3 2WFF1 1CD3G 5F5IA 5GLZA 2R1BA 5AZHA 4WAFA 1FOD1 1JI6A 2A6YA 1QJY1 2ZEQA 2JWUA 1CQ9A 1WGHA 1QDCA 5I0DA 2R042 1NBFC 1FRDA 2ZX2A 3I57A 4XE0A 2VH9A 3DBLI 1Y4WA 4MXWB 3I7DA 2LRWA 1YXWA 3PHWB 1H4GA 4LMFA 2WT1A 4YG6A 4MELA 2D6NA 1DFQA 4RNAA 5BMIA 1TVGA 2Y64A 1K5JA 4CU6A 3KWLA 3MLKA 2QUOA 5D8AB 2AC1A 3RI8A 4PDWC 3S5AA 2NP0A 3A4RA 2J0KA 2JYEA 2KC2A 2KQSA 3U4SA 1QF3A 4IETA 2NYYA 4RGMA 2WR9A 1EYBA 2FAZA 1V80A 5E89A 3ZFGA 3RYPA 4GH4C 4C0HA 2XL9A 1NLQA 5FYZA 4OUEA 3R0RA 1ZPSA 1GFF2 2DVDA 1NY72 2JG9B 2QQMA 1N3QA 3HQUA 2YROA 2DUPA 3PZDA 2PHRA 5C6CA 1L0XB 2BTEA 3UKTA 4QPIA 5JVVA 3T3NA 1YX6B 5KHGA 2BVCA 2MEKA 3U8ZA 5E88A 3POBA 1PGBA 3OJ3A 3FAHA 3C7FA 3B0AA 5K0UA 4M0WB 2E9QA 1D5XC 2M19A 4GKYA 2BF8B 1N1VA 4BHPA 1TTNA 2FMDA 2FDKA 1OI6A 1GUAB 5IFTA 1C3TA 3WUDA 2J53A 3M4FA 2VTXJ 4NN0A 1VIWB 2X8KA 2N7GA 2PAMA 3N30A 2PIAA 1WGDA 3H8HA 1E8WA 1UY2A 1JOJA 2X38A 3DPRA 3GZUC 4HLTA 5DQ0A 2AQ1B 5GKAC 3HEIA 3S2AA 2P2KA 4FI9A 5IVVA 4Q4Y1 1ZX5A 1WLTA 4YXDB 2VMEA 4A20A 3S0MA 4A6QA 2WXNA 3NAPA 1NI3A 3TB0A 1JYXA 4CP0A 4DPNA 4W9HA 3DBRB 4XXPA 2MHJA 3P1MA 1UOFA 2K9ZA 3A0NA 3K4DA 4XX5A 3FBYA 4KNCA 1OQEA 2YU1A 4IM0A 2EXHA 1NCRB 1WKYA 2AENA 3I63C 2CGOA 4PLMA 2B45X 1W6PA 4DHJB 2O6VD 3QJZA 2N1WA 1ASJ1 2LTNA 3MICA 1UBIA 1REDA 2LEKA 5F5QA 4A7YA 4HN1A 2MJ3A 1C1FA 2Z59B 1XF5L 2CJNA 4XJWA 2DWQA 5DG1A 1QXRA 2WXMA 3M3QA 4LHKA 3M3EA 2BV4A 5HI0A 1WGGA 1O4TA 4D7SA 5ACA1 3IKWA 1DLCA 5KBFA 2R043 2JDAA 2DFCA 5CFDB 2XONA 2YY1A 2KX0A 4Q4X2 1OA3A 1BHGA 2O8OA 2VZ3A 4USAA 1EAH2 1FXAA 2BVBA 2ICIA 2JKXA 1YJKA 4PHZA 4NJ7A 4OHZA 2PJHA 2VH2A 4W9JA 3B2FA 3AVRA 2X53S 4OZOA 3BODA 1VZ8A 4XQWA 2BP6A 5DAVA 2ZGPA 1E57A 3HJRA 2INNE 2VOWA 3LZZA 3HN1A 3FLRA 1CAWB 4XYXA 1S2EA 3SU8X 3N36A 2QE3A 1ZA7A 2VVEA 2WYSA 2ZACA 3V05A 2P3IA 2VZQA 2Y6GA 4AVTA 3T3OA 1Q8VA 2D3GA 4ZKTB 3IXSA 4JGYC 4OI1A 3GOEA 4EZJA 3CZJA 1LOEA 2QZ3A 5BNPA 4FPKA 1VZ6A 4AQSA 4N43C 2C1FA 4G3YC 1F9KA 4IL7A 4GDKB 2EAKA 3BK1A 2VUJA 2L3ZA 4G0NB 1SE3A 1YJ1A 2ZMNA 2FUHB 3W5MA 1NY71 2AR6A 3HK0A 4YW2A 3I5JC 2A5UA 2F17A 4M8MA 2OW4A 2IC1A 5BPXA 4E9KA 2ZGRA 4N9HA 3QWZB 2EXKA 5B4XA 5C9AA 4QGLA 1K12A 4P7IA 3Q9OA 3K48A 3O5SA 2O2VA 1H1MA 4MGQA 3SHQA 4BBNF 2BQQA 3D0SA 1WE6A 2YG0A 1MS8A 4XJUA 3ZNZB 4OYUA 2JE8A 4HDQA 4RSUA 5FK9C 1OQ1A 1T2XA 4BXFA 4B1LA 3DVNV 1PO22 3V60A 5IWFA 3VZLA 3ZO0B 1RUG2 1KTKA 4I02A 1JYIA 2IVIB 3SEPA 1X33A 3MFCA 5IYYA 1HXYD 2BWFA 3KLSX 2GC0A 5GZEA 3SDLC 2P6HA 2L05A 3HNMA 3I2JA 4Y1XA 2Y34A 2JD9A 1P7EA 1ZYBA 4FSJA 4Y3OA 2WWZA 1K52A 1Y9QA 2WABA 4V1PA 2RG4A 1J3RA 1JU3A 1BQPA 3TEYA 4BBNC 2KTRB 5CG9A 4OFGA 2D3AA 3AEGB 3DEMA 3ILNA 3VDDA 1W8OA 4LBQA 3PUIA 4YVWC 4Y20B 2FDFA 2W3RA 1ZBA2 3OYWB 5H8YE 1WLDA 3ZMNA 2Y3AA 2NVUI 1TMF1 3VDAA 1KDKA 1MEC1 1OT5A 3I3EA 4WZCA 4LBOA 4UW4A 5FYMA 4ES8A 4D6SA 5BYQA 5L73A 1RUH2 3UGBB 1N62A 2WO7A 4HPKB 3VUXA 3N9PA 1XD3B 1O3QA 2GU9A 5FMCA 4LT5A 2VZOA 4B95A 3NY5A 1RYJA 1A70A 1QHDA 1ZZ8A 1GZWB 4Q4W2 4Q4X3 1YQ2A 4HLEA 2IJ0A 2DDUA 1EAH3 2MWSB 1YYNA 1YQ5A 4M00A 4COUA 4PYZA 1FPN2 3CJIB 5BYSA 3MIDA 5A7OA 4B0MA 4JZRA 3VD3A 2CAVA 4PK1A 4Q4X1 4IDZA 1OLRA 3N1ZC 3URYA 3PL0A 2WX0A 1I7HA 5EXOA 4LR4A 3NZSA 1W8WA 2BUKA 1AYM1 3AYDA 4MGSA 1CQVA 3WNLA 3RUIB 4RFRB 1OQYA 3L08A 1JYWA 1ULDA 1SB3C 2XMLA 3THPA 1V9U2 2PMVA 5A7NA 1SFPA 3OLMD 2DURA 2VOVA 5A3NA 5IVEA 5C5TA 1F1HA 3ZXRA 3ZYIB 2V3NA 3UYJA 1WWYA 5G5GA 2PHUA 4S17A 3R4UA 4JVAA 1C4PA 3PZ7A 2ON8A 3K77A 4YG0A 4X57B 3PVOA 2XBO2 2Q8CA 2WU2B 1ZZBA 2PVGC 3NG0A 2NM1A 3MV11 1DQ0A 2Q5WD 2PVOD 4E71A 4OLLA 1W8TA 1NCQB 2A5ZA 2D6OX 3SQOA 5A6YA 2JDYA 5DZEA 1UWWA 5A7PA 1OVPA 4QXBA 3GNEA 3WXPA 2N1VA 3D32A 4LE3A 5B4NA 2VC9A 2O1QA 3ZNID 1MS0A 4XJ9A 4Z82A 1Y9MA 3N9LA 4BKTA 4HWIB 1LCLA 4ZU4A 3PJQA 2VULA 1SE2A 4XF9A 1N1YA 2WZR2 1RAXA 3L16A 1XNAA 1VAVA 4H2AA 1MPEA 4HJGE 3ZLIA 2HH9A 5EQUA 2M56B 4YTPB 5JUVA 4Q0PA 1HV1A 1PO23 3S5QA 4IV3C 2VAUA 4YGBA 3KT7A 4CDXA 3KQ4A 4WVMB 1RUG3 1QT9A 1LULA 2JDUA 3ZTDA 4XTPA 4FXCA 1ZRDA 4LHSA 2B9VA 2CNAA 3OG5A 1CVNA 5JI9A 4DEVA 3MUZ1 3C3VA 1H8TB 1KRHA 4IE0A 1O8PA 3DL3A 3GF6A 1G9DA 1RUG1 3NO8A 4WM8A 4FA6A 1VALA 1S1QB 4FOYA 1N63A 2C7HA 3NJTA 4W9CA 1QDOA 1XC6A 4QPIC 1OOPC 4JGZC 1H1AA 2RS52 1JTZX 3TOJA 5JR2A 3B08A 3ALQA 2A7AA 2H6CA 2WNVB 1IGOA 4WIPA 3EXUA 2W1QA 1ZBA3 2FCNA 2VQTA 5A3TA 3OEBA 4CSWA 3IN9A 2KN5A 4YM3A 2VL4A 4CDQA 5A3LA 3WHTA 1K5MC 1ZBA1 1XCTL 4C7YA 2ORZA 2I45A 2WZPP 3ES4A 1XRUA 4G3XB 4A3PA 1G7YA 1US3A 5LK5A 1RUH3 3M63B 4ICUA 4IKGA 1FM0D 3N1YC 4Z8BA 4G11A 3WDUA 5DUUA 5FREA 1ENSA 4AI3A 3NVZA 2XJTA 2JG8C 4CU7A 4AHZA 3S30A 3WG1A 5T5PA 1BT0A 4CYDA 1QQP2 4ANUA 3AKTA 4A3ZA 1RUH1 2AEZA 4Q4W3 4CE8A 4O9GA 5I4DA 4AEDC 3MIBA 3VD9A 3ZRCA 2W1UA 2WDQB 3ZSKA 1X36A 1FPN3 4XHBA 4ZU7A 2UWCA 4HK2A 4HK8A 5FZMA 3BU0A 4PLNA 1E5RA 1O8SA 1UU4A 3NW4A 2IO0B 1SFNA 2PE6B 5HKHA 4GD4A 1HQRD 1TS4A 3ZVXA 3RZZA 1VAMA 1YQ8A 5FZ7A 2JENA 4MOAA 2Y0OA 3BYTB 3AMHA 2BERA 4HPMB 1V9U3 1R4MI 2JWPA 3VBRA 1ISNA 2Q5TA 4GWMA 2UWAA 2BWCA 4HKQA 2IXCA 1MZ5A 2C4XA 4CU9A 3FN9A 1H2MA 3OBAA 4LKFA 3DKWA 3V0BA 1G6JA 1V9U1 1APNA 2HEWF 2D6LX 1QOGA 3Q8BA 4BCUA 4B1MA 2GP3A 2M0XA 1JYTA 3ACIA 2RD0A 4AWJA 4W9EA 1L2NA 4GAZA 2GMPA 4N9IA 4DRRA 3VVWB 2X05A 1P1AA 2RR12 2B42B 2KXJA 3UKNA 4EZKA 4UFKA 1B1ZA 2XBO1 2W46A 1TME2 3AXDA 5J37A 2DF7A 4Q27A 2D6MA 1W6MA 2D6PA 4QQLA 3L0WB 4AGGA 4CUCA 5LCWL 3PMSA 3DWGC 2WNMA 3OGVA 2OUJA 2IZWA 2R6QA 3KHCA 4E4DX 3LF7A 4Z92B 1Q8OA 2Y38A 4OHWA 3ST7A 4HEA1 4CCNA 3MIEA 4KU7A 2NN8A 1ZZ7A 3P4RB 3ZXEA 4NQKE 3ZFGB 1Y9GA 3VUWA 3I3MA 4H7MA 2NS5A 4IEPA 4QGMA 2UY9A 3E97A 2IUWA 2RDQA 2WZR1 2BS4B 1PDXA 3R7RA 3WDTA 3R3MA 4FJZA 2QQVA 1WGKA 2LGXA 3ZYPA 3AXCA 4DHJD 5C1ZA 3MFAA 4FTSA 3W1SC 4IOIE 3OJ4B 3RZGA 4US9A 1HZ5A 1IBXB 2KTFA 1WSPA 5BYRA 5FYHA 3J4UH 1WXVA 1J3QA 4CCKA 2RS53 3R8BA 3JD72 1GP5A 3PUHA 5CEHA 5EPAA 1ODNA 5K0UB 3POGA 1V5OA 1R4NI 3LDBA 4D8MA 1OF3A 2E7QA 2WSUA 2AEHA 2XQRA 2RS51 3AZVA 3C7GA 3ZJTA 2MBQA 4OI2A 4ZXEA 3S7EA 1VPHA 5CG8A 3Q14C 3WP4A 4XIOA 3LFMA 4ES9A 3FHQA 1E90A 3IG3A 5ERLA 2NPTA 3SC7X 3DPRB 3WF0A 1AL21 3AL6A 2DZJA 1EUTA 4JIOU 3GZNB 4ZRKA 1RB8G 2ZCWA 2WDRB 1DGLA 1VMJA 1YLLA 4ASKA 1WCQA 1W9YA 3PGEA 2GMIC 1DG6A 2Y33A 1H0BA 4TLFA 3ZPYA 3NAPB 4BLJA 4QDQA 4A3XA 3PLVA 3UNPA 3SITA 4QPGA 3W58A 5C8CC 2D44A 2VZVA 3KYDD 1QQP1 5FZLA 2D3BA 2Z8LA 1KF6B 3N9YC 4SBVA 1OF4A 3VR8B 2GC1A 3W1YA 5ANQA 2BPA2 3BZDB 4M4RA 1W6PB 5LB6A 2LRPA 2Y6HA 1KLUD 4TQ0A 1MI0A 4META 2NBUA 3ZFEA 2YEPF 4K6BA 1GWLA 1AX0A 3NRZA 5FYSA 5FO7B 5FZEA 4IE7A 3Q3FA 1QJZA 3W59A 4WH4A 3I3BA 1UD7A 1QOOA 1KDMA 2A3WA 3JYUA 4C0BA 2GNDA 3BPSA 2W54A 1NKGA 2A75A 1DCSA 3N9MA 4K40A 4P9XA 1WMXA 2PAEA 1FYUA 4PCRA 5J18A 5BNOA 2ZVOA 1MHHE 4AK3A 1KRIA 1RUE2 5LXHA 3O1RA 1HRV1 1WMDA 1KS4A 4QKBA 3KT1A 4LXLA 2SBAA 1C8NA 2RR13 3ENEA 1XOYA 1IYFA 3WNOA 4RGAA 3A1QB 1RFAA 3U2SC 5FTTC 2D10A 2RHPA 4DFSA 3MI8A 2BZDA 3B7MA 1TME3 3LSEA 1NZIA 2MP2A 5KHIA 1UYYA 1R081 1OKQA 3QA8A 4KDIC 3J8F2 2X29A 2KX3A 3TRSB 2YZ4A 3IT4B 4N53C 5JHBA 3E5QA 2QQUA 4ZXKA 5F32A 1TME1 1F52A 1V00A 3TYJA 1F2RI 4QB2A 4IEUA 4KVGB 2Y5CA 3H7JA 3AI5A 3DBHI 1VB4A 2KYWA 3AE8B 3EJKA 3ZGZA 2ZAAA 1AVBA 3CF6E 4IV1A 4RD7A 4YVSC 4XFFA 4HDOA 2MHFA 1AXYA 1HIXA 4K7WA 2WXIA 4BMEA 4B4RA 3E1F1 2G19A 3WOGA 4B29A 5IJRA 2WXPA 2NTSA 2DCJA 5A7QA 1ZM1A 1STMA 3FWEA 5HG2A 4BK5A 3N9QA 3ZN5A 1V6LA 2VGDA 3AB5A 1VB2A 2W95A 4LCDE 5A1FA 3JD73 4FULA 1W0NA 2KFKB 1OA2A 5DUXA 4HVBA 3FC0A 1W05A 5C9AB 3LGRA 4QHOA 3POSA 1YC61 1U0AA 4JC1A 1W0OA 4R4XA 5E6NA 3JD71 3EHKA 1RFKA 1MZFA 5DPNA 2KOXA 1W6OA 1YJIA 4YGDA 1GOGA 3OWEB 3LPFA 2MQJA 1RYYA 2ZEWA 3OGJA 2V5DA 3RRDA 4LNIA 1LO5D 2AYHA 4KI5M 1POV0 2FZ1A 1A8DA 4QAWA 1FMAD 3WW1A 2OYZA 4Y26A 1F77A 5DAWA 1W8NA 1MZEA 2DVBA 1MZ6A 4URAA 2UWBA 3TBDA 3WY6A 1C5HA 1KH0A 2W91A 4WJPA 3ZFFA 2O6VA 3C7EA 5IVJA 3RZFA 1ST8A 3IM0A 2FDGA 5AZGA 1WRIA 5JAXA 5DCNA 2K3UA 1KOTA 3SKVA 3VQIA 5CU1A 5I91A 3VDDB 4LBQB 2N9KA 3ZKJC 2VU9A 5FXZA 5E16A 4EN9B 3K51A 2FDHA 3U7ZA 1JN2P 3M8LA 3V0AA 1V6MA 2QNKA 3I3TB 1PZ7A 4RS5A 4BFRA 4OHJA 4HXCA 4CP1A 4G50A 4BOWA 3IMMA 2ZX0A 2BFUL 4GH4B 1RUE3 5F3GA 2MJDA 1XLNA 1D4BA 4CXYA 4IERA 2QTWB 4BYYA 4PI0A 4AFCA 2ZAHA 1CONA 1L7YA 4N58A 3OTFA 2ET1A 5EWSA 2GB1A 3PUSA 2WA4A 4OHYA 3JCIA 3H1UA 1BKZA 3NKTA 3PIGA 5GALA 1C1YB 4DXAB 1YIPA 1GNYA 4QHBA 4DHZE 1UNBA 1XU1A 2ARCA 1UWXA 1Q8SA 4TWTA 5FCCA 2EALA 3J8F1 3J9SA 4RGOS 1IUEA 4LA2A 5ANNA 2IXHA 3BTAA 2WWJA 5FZBA 2EKIA 2UYZB 2BNOA 2QQPA 3VBOA 3M1HA 1O59A 2AL3A 5JZGC 5FPZA 2CAUA 1F2RC 2HYXA 4M3CF 1ET6A 1LOFA 3JQXA 1JH5A 4LPLA 4YNIA 1DYOA 4PQQA 1ULGA 4N8MA 4PBPA 3WF1A 4IXLA 2PPHA 4QQPA 5L7OC 1YO8A 3VKOA 3ZOIA 2OA2A 2LUMA 1IG3A 3PVBB 3OGSA 1H1IA 4JWSC 3VLBB 4CCDA 3N9NA 1WA4A 5SV5A 3AFGA 2ILMA 4B6WA 2XVLA 4PLOA 5FLHA 2MBBB 5KXEA 2B8MA 1KXGA 2WNEA 4FFFA 4NJ6A 4ARCA 3CKHA 4B3NA 3UKVA 4LNOA 4BQ4A 2YC2A 4DXFA 4P6VF 1ULCA 2OX0A 2IO2B 3HMYA 4ITCA 4KSLC 1ZZ9A 4YWGG 4OMCA 3AE1B 2WWUA 2OHFA 2A6WA 2BGOA 1NYRA 4TKNA 3POJA 3R7QA 2IXJA 3VZNA 2RR9A 1GAQB 1V6JA 4DXGA 3DKQA 4W9FA 3MHSD 4CDXB 3KQ4B 4D7TA 4E2QA 3IIIA 2K5PA 2GLSA 4E3CA 1GANA 5KC6A 2HWD2 4GULA 4EE2A 2K25A 1BXTA 4WM8B 1WMEA 1QQRA 1FNUA 1SIFA 4HOOA 1BEV2 1I42A 5L95C 4R9AA 4QKDA 5JSRA 5CB7A 4QKFA 2SLIA 4F8CB 4L1BA 2XDVA 5AVPA 2P3KA 1CJPA 4RA0A 1PIV3 3KWVA 5IT6A 4NE9A 5E6OA 2BW8A 1YFWA 4CQNA 2MRPA 1LU1A 3AEAB 3WP5A 5GXGB 3B01A 1OSGA 1V0AA 3PJYA 1AR83 4CDQB 4HETA 1WXSA 1UXZA 4CP2A 2QILA 5LA1A 4IW0A 5CBLA 4HMZA 2H0BA 1WBLA 4WM7A 2ZPNA 1YEWA 4GWJA 5DDJ1 3PHXB 3OY8A 2ZEYA 2VMDA 4AW7A 3T8MA 4P08A 4FAGA 1COV2 3K4AA 2JIJA 4KSKC 1MR5A 3C2UA 2QQLA 3JVZX 3GE3C 3BVMA 2QJLA 5L19A 1VRH1 1N3PA 4Z2AA 2RDRA 4K8FA 1K51A 2EELA 4YFWA 4W9KA 3J26N 3R2TA 1CMXB 3GZTB 5FZGA 3HRDD 2A3YA 2BJSA 1FRRA 1X1MA 4R8HA 5IATA 5J98B 3H8XA 2WN3A 5GZGA 3B3QE 1YQBA 1D0HA 1MFWA 1WZ0A 5FKAC 1PK6A 3VBRB 3KCXA 1OC1A 2NTTA 4YSFA 2R2QA 2P37A 4N7UA 3OBRA 5CHWA 1N1SA 4BJ0A 1TS2A 4QPWA 1CIYA 4RM9A 5FZ9A 1LQBA 4JE3B 3F95A 1NX9A 1XXGA 5DAPA 3UF8A 3B1LX 2IGGA 4OI4A 1FX5A 2LXCA 2K8CA 3POEA 3WD5A 1RUF2 4LK0M 3VBFC 3U14A 4JAAA 2VJXA 4ZYSA 5FWJA 4XABA 1SPPA 2VZKB 1Q3EA 2L32A 4JWUC 3FC4A 4FP2A 4QQOA 3IT8A 3RYTA 4CVUA 3G6JB 4RN5A 4YT0B 3VBHC 3O1MA 4MHRA 5KHJA 4LITA 3UINB 3QD6A 2XG3A 2RJ2A 3KVAA 4HZFA 1AF9A 2QEJC 5GZDA 5GLVA 1VJ2A 5LA2A 1J58A 1T0RC 2G9FA 1YN5A 2L7RA 4B0EA 4GN1A 2QQJA 4MGYE 1JW6A 4EN6B 1W8FA 1GZTA 3DDCB 4Y1YA 4NIHA 4H3WA 4KWUA 1IKQA 2DTYA 2FDIA 3B00A 1SQ4A 5BMHA 4UW3A 5FBZA 4OVUA 2MH7A 2ZBJA 4K7UA 3EYPA 1WMHB 3N7JA 5LXIB 4IV1C 4IDIA 4JDMA 1SLLA 2HWD3 1U5IA 2P34A 1RUI2 4QGNA 1TKEA 2JJ6A 3Q3MC 3OJBA 2VO5A 3VR9B 1BEV3 4WVVA 2HWD1 4XWWA 1TNFA 3VDBA 2AREA 4AVAA 2JY6A 5FPXA 5D7GA 2Y8KA 2K9XA 1T6GC 2GBRA 2BQPA 3DPDA 1E8ZA 4BE3A 4UOJA 1GG3A 1KLVA 5FY1A 3MYXA 1XYNA 5JXHA 1YCIA 4TUUA 3O1VA 1M94A 2ZZPB 1ZBE2 4BQYA 1UUPA 2NPTB 2NMNA 2X5IA 1K8RB 2AWTA 3KGLA 3AN1A 5D8AA 4UW5A 3I8TA 3M70A 1COV3 2GRIA 1SEFA 1YIWA 1SHWB 3ZW3A 1S0DA 2JDNA 5BY5A 1UZXB 3HN3A 2WX1A 3A23A 2XJQA 3C8YA 1JZ6A 4I0WB 3VDCA 1C79A 2G4IA 1D4VB 5H9RA 4QPGB 1COV1 2HEYF 1V6EA 1DGRN 4YG3A 1FIQA 3H3UA 1M4VA 4XQ4A 4UW6A 3FHAA 2F4PA 3ZDSA 3ZFEB 2MW5A 3DQVA 5LBBA 4CUAA 1LESA 1X8EA 4OHXA 3N3HA 3TUOA 1WLCA 3MHZA 2DNFA 4A55A 2KVZA 1TS5A 3MF9A 5KHKA 3TEZA 3GHMA 1ND3C 1HRI2 3E6CC 3ELNA 2WP9B 2YFZA 4GOCA 1YIFA 4HPLB 5JOYA 5BNOB 2KKCA 3VKMA 4COWA 4XFIA 3ILFA 4LQRA 4AE2A 2BGPA 1HB4A 1RMU1 2R7EB 2RV9A 4Y5Z0 3U75A 4BXSV 2FHRA 4XEZA 2BTVC 3IAPA 5JPMB 3WQ0A 4EQVA 3AE6B 1U5XA 1EP0A 3AZYA 4N9F4 5IVCA 1RUF3 3JQWA 4LA3A 4P9YA 1RM6C 5ABJA 4AEKA 3IBMA 3OUIA 4XW3A 1KFXL 2MP2B 1SCSA 2QDRA 5TSWA 3NWKA 4GXBA 1RUF1 2C24A 1NI2A 1TY2A 1AR92 4ISRA 3Q2AC 4IE6A 2IZVB 3P6BA 1T5XD 2C5DA 1YN4A 3HNYM 4JGZB 4RQPC 3NMBA 2IYDB 5FZ1A 2IY0B 2K1FA 4DINB 1IZ3A 4CXXA 2ZOEB 2YC4A 3BB6A 3Q8FA 1GB4A 2XNAC 3WW2A 1YX5B 1WGYA 1YN3A 3W9CB 2A71A 1NCRA 3PVNA 1TS3A 3R4DB 2E7AA 2HE7A 2RS13 4L92A 2GDFA 5JZEB 2IDYA 2ZHNA 4MV2A 3VBOC 4YTNB 5EZWA 2LJ5A 2IO1B 1V6NA 1Q0WB 3RJRA 4QU1A 4K3CA 5KHQA 3O1UA 1LOFC 1RUI3 2E32A 2GC3A 4LBQD 4IEOA 1DZTA 2ATFA 1HB1A 1ZDVA 5CYYA 4WWOA 2J1EA 5A80A 1VRBA 5C3PA 4JX1C 4CDUA 2ZHKA 4Z07A 4F83A 2J1AA 1RUI1 2VBPA 5H9SA 2VR4A 3W9AA 2QSDA 4NVPA 1OFNA 1D4M3 4W50A 1UOJA 2JIGA 5IVBA 3K75B 4P9WA 5FZIA 1MQTC 1ZDXA 2E26A 1M06G 4CEWA 3E9SA 4JKMA 1BBT2 4K20A 3NUHB 1V8CA 1V70A 1H9WA 4ANXA 4EZ4A 1W3XA 1SE9A 3QACA 5F3IA 3NVCA 1ZBE3 1EPWA 3MDPA 4NHKA 4CDWC 4A9AA 3FFZA 2MA9B 1AZDA 1ND2C 4HG6B 5FZHA 3M2MA 4CCLA 4UXAA 1CAVA 2PAKA 1JWMD 2YV8A 4QQHA 2ARAA 2QDNA 5BNQA 3SLIA 1AARA 3CLPA 4RFBA 4HSLA 3DOWA 1W0PA 3AXEA 3ZFFB 1YMHE 1OFSA 4LBLA 2C5LC 4Q4V3 2LI5A 3RCZA 3JBG2 5T55A 5IKCM 3OSDA 3A4SC 2C9KA 3N32A 4LIUA 4GDKA 4OI0A 2W0XA 3AP5A 1WD4A 4FPGA 3ZNGC 3FJSA 2DZMA 1H2LA 4CUGA 1GC6A 3WVJA 1HRI3 2R073 3V0AB 2C7MB 5EE1A 4IUMB 4AUQC 2Y6JA 4RS5B 2Q8DA 4R4ZA 3I59B 4MGTA 2Z0EB 5FPUA 4UI9L 1NLSA 3ORJA 4UFIA 4EWAA 2N9LA 4RF0A 1JQ4A 3AMQA 1UAIA 1JBCA 4AHWA 4NIGA 1UMIA 2RS31 5IAVA 2L1AA 2ZVNA 4I30A 2K8HA 2LWPA 2D40A 2XKPA 4P9LA 2GAUA 1JZ3A 1W2UA 1EPZA 4CCJA 2V0GA 1LNSA 1WCSA 5KR7A 4BLIA 4EZLA 4LHLA 5LEKA 4DMIA 2ZZJA 3AE7B 4RR3A 1AR93 2BBAA 4AVBA 5J7MA 1GP4A 4LOSA 1G9AA 4G9SB 4RYDA 1UQXA 3TBLD 1S0JA 4P02B 4CEYC 5LY1A 2MEV2 4YZ4A 2YDEA 2E6VA 3SXWA 4O1NA 4OVVA 5H92C 1AR91 4NQLB 1H2NA 2RDGA 3TAYA 2J1TA 2V5YA 4XZ4A 4JKLA 5FPVA 5F7UA 3GCXA 4CTEA 2VNRA 2XLAA 4ANVA 2KANA 4XFBA 2GOWA 3W5VB 3T2TA 1AXZA 2AACA 2QIEB 1FXZA 2R16A 4BA6A 4ZHNA 1UWMA 2WAOA 1F9JA 2DENB 2DTWA 1I9RA 4M0NA 1UOBA 1WZ3A 3MUY1 3GM8A 3OYWA 2DX5B 5FUNA 5EJ3A 1Q8PA 2QZ2A 3MJWA 4WQOB 5AZFA 5CFCA 1AWDA 4XMAA 3DWMA 1KFYB 3OPWA 5HHDG 3NSTA 1WJ4A 2V1YA 1WYGA 1U12A 2LM3A 1XPWA 4XHXA 2I2YA 3D8CA 3KM5A 1XNDA 5F1RA 2ZW0A 2ARXA 3WEZA 3S7IA 5J17A 1JHJA 1BBT3 4W6XA 2VCAA 5IAXA 3BTXA 2D43A 3B94A 1S0FA 1GZWA 2M8SA 5C4WC 4IGQA 1HV0A 4OQ9A 3LKJA 1FFVA 3AEDB 1PVC3 3NVVA 1BBT1 1WCKA 4PT5A 3X29B 4N90A 1K53A 5IP4D 5A7SA 4K1YA 1CX4A 2JZPA 2L8JA 2DWRA 3FILA 3IB3A 2WFF2 1D2QA 2RJLA 1DIWA 4AOFA 4XILA 1LM8B 4B9KA 4BKSA 1YFXA 1C8M2 3APDA 3OUHA 1OA4A 5BNNA 5JI7A 4B4PA 3B02A 1AXKA 2Y6LA 3WA0A 4I3GA 3AE2B 5KWRA 3P4SB 5FLIA 2D3PA 2G4SA 3IDBB 3J7LA 4IG7B 4B4QA 3MF6A 1FEHA 4A42A 4XC2A 2I38A 2IO3B 1NCQA 4LORA 2D5FA 4QXHA 3I4IA 2VZPA 3JBG1 2JXTA 5CKMA 1XCQL 4GMP3 5L36A 4WM7B 3AFKA 3ZM8A 1R1ZA 2DZKA 1CN1A 2PLPA 1OQDA 2GNBA 3OY8B 1GOZA 1UKRA 4EROA 2V4AA 5JR7B 1HEZE 2VZKD 2CDPA 4A7KA 3I49A 4MZUA 2IY1B 4GMP1 5I93A 3CBNA 4LUKA 1NUKA 4US8A 3WDXA 2YB7A 1S0EA 2AQ2B 4MVTA 3I2FA 1P0RA 4QQ2A 5IOIA 1ENQA 5D8AC 3T09A 2AYOB 1GQPA 3DUIA 1UCXA 4XBLA 3PLQA 3ZKYA 2KAJA 3M3JA 1VCBA 3VL8A 3RPQA 4M0HA 2BT6A 3MBWA 4P5HA 4Q2JA 5M0TA 3UV9A 4BVUC 4FFIA 1OUSA 5T8IA 3T0DA 1QNWA 3FUOA 2MEV3 1FXTB 1NZCA 3ON7A 1PK6B 2YYOA 3TN91 1LTEA 2WXQA 2W82A 1JOBA 4XFCA 5KHOA 4KGRA 5FK7A 3WHUA 3SHRA 2MEV1 2JG9C 2PTLA 4KGTA 4ZPIA 2CSGA 1R4NB 1CZPA 4XUQA 3H9DA 3RZJA 1I1EA 4BOZB 3PURA 3HVZA 2WXGA 1XSQA 3V6EB 3A9KA 4NIAA 1VE0A 1UMHA 3BI3A 1L3JA 1SBEA 1E7VA 4GMVA 2PQSA 2C0ZA 3ME2A 1HXS3 5HV4A 3T4HB 3ETPA 5FMDA 1ESFA 3WX5A 2Q1FA 4YL8A 3J7NA 4C90A 5EYXA 4GWIA 2Q4SA 3NJXA 3T30A 1IS5A 3MC0B 1SZBA 3KS7A 5F37A 3OGGA 1L6VA 1VJKA 4KKIA 1WW5A 3I54A 1JWSD 1JALA 4IE4A 1BJQA 1OQQA 1ASJ2 1C9FA 2XEWA 4JDNA 3L54A 3AKQA 5IVYA 3C0RB 4C56C 3ZLZA 3UQAA 1OLME 3H0OA 3ML8A 3ZXDA 5C33A 2PHWA 1XYPA 1NQDA 3NS8A 4Y1VA 2WFF3 1XT9B 2CHXA 4BH9A 4JGHB 1FCLA 1DBNA 1E5IA 5GLWA 1YHFA 1C8M3 1QLBB 1NCRC 1XBFA 1MS9A 2ZGOA 3ITQA 3QCWA 3RZWC 4O65A 5FY8A 1GP6A 4NIIA 2XVKA 1WM2A 1VBC1 3TCAA 1FNZA 2LHDA 3DV8A 3KMHA 5ACA2 4URKA 3ZIMA 2RDBC 1W8UA 1C8M1 1Y7BA 5JOXA 4MSQB 3H7SA 1L7QA 4AJWA 4XAAA 1YUDA 5I8YA 5E6PA 3RYRA 4Y4YA 1D6EC 1VBE2 4K3UA 1PHMA 4LLFA 2VNVA 4GJZA 1E5WA 2B4KA 1SF0A 5FZ0A 1WFYA 1ULPA 2VCCA 2D3RA 2X09A 1ET9A 3IDEA 2VMCA 4ARYA 5LK7B 1XE0A 3DCQA 1FT9A 5T5JA 3AE9B 2X5IB 3PHMA 5CFDC 3I9V1 4FOVA 4XFGA 3TEXA 2WIIB 2WA3A 2KDEB 2JDHA 3FUQA 1Z7S2 4D6RA 3FHIB 4ATEA 2N9EB 1SLBA 1J1TA 5IFPA 4XDPA 1LGBA 2JE7A 3I2KA 2KDIA 2JXXA 2VQAA 2DYMA 1AJOA 3WZ1A 2ARBA 1W6NB 3KF3A 4P5YA 1TE1B 1URXA 4I6LB 2E63A 1N61A 2NQYA 1R64A 2YBSA 3ZIXA 5A3MA 1T3QA 3QOPA 4Q29A 3WP3A 2RM22 3EMRA 2KQ4X 1SBBB 4BQ5A 3BTZA 2B46X 4JRAA 1GKBA 1US2A 3PUQA 3MP9A 4ASLA 1PGSA 4ZS2A 2VW1A 1W39A 5GMVA 3AP9A 1OPMA 1ACCA 3AMPA 1DF0A 4M01A 1OKOA 3GBFA 4DBGA 2ZNVB 1CR7A 4DQAA 3GBGA 4CCCA 4WWNA 3MPPG 1NYQA 3VHTC 1B35B 5F9TA 2PXJA 4HKOA 1DGWA 1IBXA 4E4HA 2ZGQA 2MNGA 5FYCA 5FYBA 4UFMA 4AQTA 1NE4A 1W9TA 5FIXA 3LA3A 1MACA 4A6OA 2FMYA 5BXXA 2CWSA 2C26A 5FZ6A 4E2GA 1LOGA 2VY0A 3VN4A 3BOPA 2DVAA 2ZX1A 5ABJB 4G4FA 4GJYA 2K22A 2KZRA 3U10A 3ONSA 2WXFA 5JWPA 3WV6A 3Q8AA 2Q0AA 2W55A 2DFBA 2RPQA 3ZPOA 4Q4Y3 2ZPYA 1RJ8A 2HWF2 1UPIA 1QY4A 4YM0A 2KDMA 3PZ8A 3PS6A 1Z5SB 4PJYA 4URTA 4K1ZA 4D69A 3ZYGA 3WW3A 4YRDA 4OZXA 1SBDA 4ITKA 2WJSA 1ASJ3 2UWQA 3AECB 1LECA 2Y26A 4OW0A 4LBJA 2CU5A 1WI0A 3VBSB 3NJZA 2D93A 2ERFA 2OOBB 1QIQA 1W6QB 1Q8QA 1WM3A 5FAXA 2KR2A 1TMF2 2BNNA 4NZLB 5F5CA 1MEC2 4AEJA 1UD1A 2B9UA 4FVVA 4AFBA 5J1XA 2W9NA 5D2MB 3H7YA 4I0AA 2E53A 1IKPA 2R30A 1AYN2 2ZZQA 5C3JB 2JYTA 5JMOA 5ACA3 4CDUB 1S2BA 3PVEA 2EAAA 1TT5B 3NZ3A 3DCGA 2VD7A 1NXD1 3RS6A 1LHNA 4FFHA 2N0SB