4M01A

N terminal fragment(residues 245-575) of binding region of srap
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
321
structure length
321
Chain Sequence
AVTANTITVNKDNLKQYMTTSGNATYDQSTGIVTLTQDAYSQKGAITLGTRIDSNKSFHFSGKVNLGNKYEGHGNGGDGIGFAFSPGVLGETGLNGAAVGIGGLSNAFGFKLDTYHNTSKPNSAAKANADPSNVAGGGAFGAFVTTDSYGVATTYTSSSTADNAAKLNVQPTNNTFQDFDINYNGDTKVMTVKYAGQTWTRNISDWIAKSGTTNFSLSMTASTGGATNLQQVQFGTFEYTESAVTQVRYVDVTTGKDIIPPKTYSGNVDQVVTIDNQQSALTAKGYNYTSVDSSYASTYNDTNKTVKMTNAGQSVTYYFTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into SraP-Mediated Staphylococcus aureus Adhesion to Host Cells
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
molecule keywords Serine-rich adhesin for platelets
total genus 92
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18483 Bact_lectin Bacterial lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4m01A01
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 4m01A02
2NYYA 3WG3A 4AVTA 2A6WA 1AVBA 2DVAA 4ISQA 1YIFA 1LOAA 4FPKA 2DVDA 2KM2A 3IKWA 5IK7A 1Q8PA 3T1LA 1DLLA 3VKNA 1OKQA 2LTNA 4K21A 2PHFA 1MVQA 4RA0A 3B00A 3RQ0A 5JDBA 4FPOB 3D4KA 1SLIA 2PHUA 3MW4A 1A8DA 3FLTA 2XG3A 1KJLA 1QNYA 3WDWA 2VW2A 1LOFC 3O0WA 4RL7A 4ZXKA 5H9RA 1WCSA 1BKZA 2OUJA 1SCRA 2ENRA 3B01A 2FMDA 2YZ4A 1ZA4A 2EALA 4XJUA 5T55A 5JOZA 4W65A 1S0EA 1V6LA 2VH9A 4SLIA 2G4IA 3NV4A 1WLDA 3AZVA 1A78A 2D3SA 3BODA 1ENQA 1HLCA 4XXPA 1QU0A 1W6QB 3N7MA 5IUQA 4DRVA 3AYEA 1UMZA 1FNZA 1N3QA 1AX1A 3L2YA 3SH5A 4XILA 1H9PA 2DVGA 4YM1A 2D7FA 3VKOA 3PMEA 4F83A 3A0NA 2WJSA 5DXDA 3ZSLA 1PZ7A 2AYHA 3TAYA 1W6NB 1H30A 4PBOA 1G8WA 1X50A 3WV6A 1BYHA 5E89A 4BM8A 3OBRA 3SITA 2DU0A 2A6VA 2CNAA 1GNHA 2A6ZA 1YYNA 1H9WA 1WBLA 3IM0A 5KXEA 2FHRA 4YLZA 2UURA 3O12A 4Y24A 2JDZA 1Q8SA 2NN8A 1AX2A 1JUIA 1ULGA 2E7TA 4LBQA 1GANA 3MW2A 4YZ4A 3WLUA 1APNA 1AXKA 2EIGA 4FPFA 3M3OA 3O0XA 2AR6A 4YFWA 4WV8A 3MEPA 2ZA9A 3BOPA 5IT6A 2ZGPA 3NV1A 4GKYA 3GNEA 4YGEA 1Q56A 4XE9A 5CNAA 1IS5A 3V0BA 3M2MA 4UW6A 1I1EA 5CBLA 2ERFA 4BQ1A 1LHVA 2E53A 4BMEA 2WQZC 4M02A 3WDTA 1DFQA 3KM5A 1CPMA 1TEIA 5HCAA 5KXCA 1JYCA 3ZYRA 4FQ4A 4LBKA 1MR5A 5JOYA 1ENRA 2AREA 1ULCA 3ENRA 2CY6A 1KITA 3WDXA 4YM3A 1SBEA 4YG6A 3CNAA 2ZACA 3RG0A 4AGRA 2ZAAA 1EPWA 3ZXEA 1CJPA 4CTEA 1LGCA 1S0FA 1WW5A 3OGGA 3UJQA 1F9KA 1MS0A 2DURA 3PVEA 4M3CB 5JOXA 1GZWB 4M3CF 5GLWA 4YZ2A 3PVNA 1JHNA 2JD4A 2OVUA 4P9WA 3LSEA 1LHNA 3WVJA 1I3HA 3AP4A 4Y22A 1G9DA 2ZGTA 5DZEA 2GMMA 1DYKA 2DUQA 3FLPA 5JOWA 3IN9A 5EYXA 1LENA 3WG2A 2DUPA 2ZHKA 5DG1A 5IK4A 1IOAA 2ZGUA 1SLLA 2AENA 1IS6A 3IPVA 3ZYPA 4MYEA 4ISRA 4WZFA 2VUAA 2ZHMA 4U36A 3W58A 1QOTA 1BQPA 1UZZA 2ZMLA 4TYSA 3V0AA 3QLQA 2RHPA 1DQ2A 1SLTA 4ITCA 4XHXA 3ZSJA 1SBDA 5DUWA 4AVVA 3B9CA 2R49A 3WHTA 3WZ1A 1GNZA 1LEDA 1QGLA 1FX5A 1LHOA 3FLRA 5GZCA 1Z78A 3ZXLA 2LALA 5KXBA 2NMNA 2W08A 3WCRA 2YMZA 3AJZA 1JOJA 1CONA 4XJWA 3MW3A 3WG1A 4K1ZA 1YRZA 2D3RA 2VW0A 1LHUA 2V5YA 3FBYA 1ULDA 3ILNA 4YW1A 2YROA 4FPLA 5GZDA 5IK5A 3W59A 4BLIA 4KBBA 3DUIA 4XDQA 4UW4A 2D6KA 1QF3A 1S0DA 3OPZA 3FUOA 4YZ3A 3AZWA 3R05A 3AX4A 1SLAA 2ZZJA 2D6OX 2PHWA 1GBGA 1LOCA 2OW4A 2JJ6A 3VUOA 2A71A 4BLJA 1FV3A 3WHUA 1HQLA 2R0HA 2UU8A 2WT1A 5SV8A 4FPJA 3U4XA 4XZPA 1MS1A 3N3HA 2PHTA 4NO4A 5FRAA 3ZPYA 3V0BB 3AYCA 3NV3A 2ES3A 1DYPA 2E7QA 1S0CA 4YGBA 4YGCA 3AFKA 3VV1A 4K1YA 1LCLA 3WNXA 3ZXKA 4XTPA 5T50A 4C1WA 4FPCA 1GSLA 1D0HA 4JC1A 1G86A 1LOEA 1LOBA 1BXHA 2E6VA 4YZ5A 1S0BA 2P3JA 1W6PA 1QOSA 3O5SA 1URXA 1C57A 3INAA 4LBMA 1S0JA 1DZQA 2KVZA 3I4IA 1VAMA 1ONAA 4P9XA 3ZXFA 4AWDA 3OY8A 1IKQA 3N35A 2ARBA 4BMBA 4AGGA 3OY8B 4JRAA 4M3CE 1CVNA 2ZGQA 3NV2A 1WLCA 4P14A 5DUXA 4GXLA 2CWSA 4YG0A 4BPZA 1RITA 3HMYA 4ZKTB 4LBQD 2GN7A 2B7YA 3NWKA 4Y20B 4Y22B 1XQNA 2GDFA 4Q1PA 4UW3A 3N7JA 1MACA 1G7YA 5E8AA 4XBLA 4YM2A 5JVVA 2R1BA 1JYIA 2YY1A 4LBNA 2DUOA 4XMIA 4L8QA 1Z0HA 4XBQA 3Q9OA 1AF9A 2Q5TA 1S0GA 1YI7A 3AZZA 4NOTA 1OQ1A 2ZGOA 1LJ7A 2DTWA 4JCKA 1O4ZA 3HR9A 4Y1UA 1ULFA 4FVVA 4Q26A 1W6MB 3UL2A 3WUDA 1QNWA 5GLTA 2WSUA 2I2SA 1FATA 1BZWA 4FP2A 4WVVA 5GLVA 3POYA 1LESA 3AP9A 2AUYA 1W6OB 2DVBA 1JXNA 4DQAA 5CAZA 1WUVA 1ENSA 1VALA 1V00A 1WBFA 1N1VA 1FYUA 5HCBA 1U0AA 2C9AA 2ZMNA 1CPNA 3FFZA 3GALA 1CN1A 1N1YA 3JU9A 3PJQA 1MVEA 3AXEA 4D69A 2A70A 1JN2P 3T2TA 4LBQB 1J1TA 1QMJA 2JE7A 4R9CA 4XBNA 4YW3A 1KRIA 1LECA 5HCFA 4BOWA 3RRDA 1G9BA 5JMCA 3AXDA 4PCRA 2DVFA 1QKQA 2GNTA 3M3QA 1HQWA 2GALA 3R4UA 2R1DA 2DU1A 1WD4A 2W52A 3ZSKA 2VXRA 3N36A 3LCPA 4YW4A 1LEMA 2CTVA 3VKMA 4Q2FA 4Q1RA 2P34A 4ATEA 5BYNA 3WOGA 1VAVA 2A6XA 1C1FA 2EXJA 3AP5A 3SH4A 3SNMA 1YO8A 4YM0A 3VKLA 1A3KA 1N1SA 4PF5A 2D6PA 2DYCA 5JLVA 1AJKA 1JBCA 3SH3A 4PBPA 1CR7A 1V6NA 4YW5A 2NMOA 2TEPA 2UWCA 4TZDA 1OFSA 4Q27A 3AP7A 2WLQA 4OZXA 4Y1YA 2C5DA 5EYYA 4CRQA 3M3CA 4XMAA 1LOGA 5T5PA 3IPVB 1HKDA 3PVOA 2D6NA 3AZXA 5DUUA 5GALA 2CWMA 3C2UA 1DGLA 4I30A 2JKBA 2WT2A 2A3XA 1W0PA 1ZM1A 1AXZA 1JW6A 4LBOA 4FPYA 2YV8A 1WW6A 5H9PA 2ZKNA 3WDVA 2JECA 5FREA 3SISA 3ILFA 1D2SA 1MS3A 3AP6A 4AGVA 5H9SA 4DS0A 1MS9A 1UL9A 2P2KA 3OBTA 3OJBA 3T1MA 4K20A 3RS6A 2ZHLA 3V65A 1SLCA 2WSVA 1G9CA 1BJQA 1WD3A 5T5LA 4FP3A 2ZGNA 2GNDA 5IK8A 4GA9A 1S1AA 1IS3A 1VLNA 2AGSA 3IMNA 2Z42A 4FOVA 5LK5A 4YZ1A 1QDOA 1N3PA 1GYKA 2VW1A 3N7KA 3M1HA 2ZGSA 2A7AA 4FPEA 3VKFC 2A5ZA 3DGTA 3D5OA 5GZFA 2XB6C 1DQ4A 1GKBA 1KDMA 1Q8OA 2P37A 1FNYA 1W6NA 4AYUA 4R9BA 3D6EA 4FOYA 5DZFA 1IKPA 1WLWA 5AVAA 1V6KA 4U2AA 3OYWB 1LTEA 3RMXA 5GM0A 5DUVA 2JE9A 1SBFA 3OYWA 2ZHNA 4XIKA 4YFZA 4DRRA 3WG4A 1SACA 4XTMA 2SBAA 2V73A 5L73A 4R9AA 3BIWE 4XJ9A 5F9TA 1SLBA 1W6QA 2ZGMA 1LGNA 1B09A 1V6MA 1CIWA 1DQ0A 1R1ZA 1ULEA 2A3WA 4XXAA 1RINA 2AH2A 2NP0A 2NM1A 2WKKA 3ILRA 1LHWA 2H0BA 5GJ6A 2D6MA 2W39A 4Y26A 1MS8A 5GZEA 3UK9A 4AVSA 4Y20A 3APBA 1LU2A 2BQPA 3I8TA 3ZXJA 3TB0A 1W6OA 2ZBJA 2R16A 2DV9A 3V0AB 1LGBA 5DG2A 3WUCA 1LULA 1FAYA 3FUQA 5E88A 1Q8QA 1DQ5A 1CQ9A 1MS4A 3HN1A 2GMEA 5GZGA 1UKGA 1SFYA 2PELA 4XJZA 1LODA 3AZYA 3UJOA 2W68A 2ZABA 1Q8VA 2SLIA 1UN1A 4GALA 2WT0A 1W6MA 1PZ8A 4XHBA 2GNMA 2ZMKA 4XYXA 1GZWA 2NZ9A 4GKXA 4Y1XA 3MPPG 4FPGA 1KDKA 1VIWB 1UX6A 2D44A 3POSA 4H55A 4M3CA 1WW4A 4GWMA 2YXSA 4WVWA 2KT7A 1WW7A 3WDYA 2CL2A 3AYDA 3ZVXA 3AK0A 1MZ6A 1QOOA 1UZYA 2DTYA 2UWAA 4Q8KA 2UWBA 1KQRA 2EF6A 1HDKA 1N47A 4FOWA 4XIOA 1UAIA 2D6LX 5CB7A 4CZSA 4DPNA 3O0VA 4HANA 4Z8BA 4IQPA 3R4SA 4C1XA 1UPSA 3A4UA 4FPHA 2CYFA 4YGDA 1AXYA 2ZGLA 2EAKA 3SLIA 1DQ6A 4DFSA 2GMPA 1DIWA 1NXD1 1G9AA 4LBLA 2ARXA 2DWRA 2PHXA 5CA6A 3WCSA 1YXWA 2ZGRA 4UW5A 1F31A 4YG3A 3AJYA 3B69A 4R9DA 2KYWA 4M01A 1F5FA 1LOFA 1GLHA 1V6OA 1G9FA 3ATGA 1GV9A 1KJRA 2EXHA 4Q8LA 1V6JA 5EWSA 4XOGA 3WDUA 5T52A 2VU9A 3LSDA 5T5OA 4LBJA 1NLSA 1MZ5A 1W6PB 2VY0A 4PQ9A 2GNBA 1PZ9A 3KQRA 2GN3A 2A75A 1RIRA 4YW2A 4Y1ZA 5T54A 3RSJA 1AX0A 5DZGA 3AYAA 3POWA 5GLUA 5T5JA 2EXKA 2HYKA 5H9QA 1O4YA 3B3QE 4FQZA 2PHRA 4HL0A 1Y7BA 2D43A 3V64A 1AJOA 1SCSA 1FV2A 4XJ8A 1AZDA 3USUA 1MS5A 2P3IA 2WNEA 3N7LA 3QCWA 3JUUA 3USUB 4XJAA 5KXDA 1CESA 2A3YA 4GWNA 1DHKB 2R0FA 5EXOA 2D3PA 1GICA 1LU1A 2OUHA 4ASMB 1IS4A 1S0IA 3ASIA 3BTAA 3ZSMA 1GZ9A 4ATFA 5F5QA 3RMYA 2P3KA 2A6YA 1N1TA 1C1LA 1DQ1A 2E51A 4FOQA 1N3OA 3H0OA 4P9YA 2ZGKA 1DBNA 1V6IA 3M3EA 4Y1VA 2EXIA 5GLZA 1GZCA 3A0KA 1C4RA 4M00A 1W0OA 1QDCA
chains in the Genus database with same CATH superfamily
3MJWA 5FPAA 4A20A 1YJKA 2XK5B 1CMXB 3PLVA 3IKWA 3U7DA 2WXKA 1OOPC 4WJPA 3RQ0A 3RNBC 4RCOA 1A8DA 2XG3A 2WXRA 3WDWA 1TS2A 4RL7A 5LA9A 2Z69A 2XBO1 3J4UH 4Z1VA 3MV01 5BYSA 5T55A 2JZPA 1V6LA 4AI2A 3AZVA 3AL5A 2JDHA 3AYEA 1XNDA 3RNFC 3MO4A 2XL7A 1PX4A 3VKOA 2WJSA 4Y3OA 4GLSC 2DBNA 5E1RA 2QQJA 4CDWC 2VMHA 1BBT1 1WBLA 1FOD1 2VD7A 2UURA 2XUMA 1UNSA 1ULGA 4US9A 2KANA 1C5HA 3MHZA 3O0XA 4YFWA 2VNGA 2KMCA 5DAXA 3V0BA 2YBPA 4WIPA 3WDTA 1CPMA 4QKDA 3NNFA 3VBSC 3KUCB 1QQP2 4YG6A 1O7FA 2WXHA 1PGSA 4E8CA 2KZRA 3S7EA 5FY5A 5JZGB 4NZLB 5JI7A 5I0TA 4M3CB 5FZDA 4ASLA 1SJHD 5BO4B 1XNAA 4IM3A 2OPWA 4LULA 1DYKA 2QJVA 3AVRA 3BTXA 3DF0A 2GRIA 2DX5B 5F3GA 4P9JA 2B8MA 4S2DA 2W1QA 2RS31 4OLLA 1W05A 2MBEA 1CJEA 4W9CA 3POEA 4CEWB 1AR63 4OUSA 4PLNA 4Q29A 3AJZA 2LVPA 3O14A 5AC91 2VW0A 2V5YA 5FKBA 4BWOA 4DOUA 2YGMA 3B2FA 3VD5A 3R05A 3AX4A 5F3IA 5SV8A 2E63A 2UU7A 4PDWA 2WDBA 1LGRA 4J6IA 3RVHA 4MUVA 2VQAA 1S0JA 3S0MA 1L0VB 3N35A 1AYM2 1KGYA 2GI9A 2P5BA 4OMCA 4G3XB 4HMZA 3WSOA 4URAA 2W3RA 3GCWA 1ESFA 1XJAA 4ARYA 2JXTA 3EB7A 3DECA 3LPGA 2WA4A 1S0GA 2IDYA 3BVZA 2XLGA 1QJU1 1D4VB 2KDEB 3KSCA 3URYA 3POYA 1LESA 1XRUA 3UYJA 1BMV1 3EA6A 3SDLC 4JX0A 2BQQA 5DDJ2 5AVPA 2WN2A 1WGGA 1MVEA 4D69A 2BWFA 4Z07A 2VNVA 2HJ1A 4CPBA 1JHJA 4LEJA 3WF1A 3H8OA 2WHIA 3CZUA 2G4SA 2JF5A 1R092 3ZN6A 3UNPA 2DYMA 3SQOA 5LK7B 5FYHA 5FUNA 4MM3B 5F32A 4HPMB 2BNOA 1L4ZB 3VB9A 4ANXA 5BYNA 3SH4A 1R4NB 1HJGA 1QQP1 1AJKA 5FZ8A 2EMSA 3RZJA 2VCMA 5EYYA 4OUMA 5IWFA 5FPVA 3Q3MC 1MQTC 2WDVB 1DGLA 1KM7A 1W0PA 3ES1A 1AXZA 1QEXA 2YV8A 2GBMA 3GZTB 3GB1A 3T1MA 1RUD3 4K20A 1CZVA 4DY3A 4KG8A 1KD7A 1SDDB 5LEKA 4HKLA 5B2GB 2HBTA 2H89B 2JG8C 1GKBA 2K5PA 3D6EA 3OGJA 4LHSA 4CDUB 4YWAA 3HT2A 3OYWB 3N9PA 2BYEA 3OYWA 1PGBA 1K5JA 4MM3A 2I74A 1V6MA 1DQ0A 4L99A 4NMIA 3ZOIA 2WIIB 2KQSA 2H0BA 5GZEA 4YVWA 3BU7A 5EPAA 1D5ZC 2ZVOA 4K8RB 4MHUA 2ZKLA 2JUOA 1FCCC 1MS4A 2GMEA 4W6XA 4N9F4 1CJDA 4TMAB 1LODA 3AZYA 2PXJA 2VECA 2WT0A 1W6MA 5BNNC 4PS7A 2NZ9A 1OH3A 5BY5A 4FAGA 1J0GA 2ZEYA 2B45X 4GWMA 3WDYA 2CL2A 2KWCA 1HDKA 3O0VA 4Z8BA 3VBRA 2CYFA 3PZ8A 2X05A 4IE4A 4HOOA 1NCRB 1W8WA 2X09A 4J6GA 3ZTCA 3K3NA 1FXAA 2RS13 4EE2A 4M01A 3FAHA 4E4HA 1JW9D 5L7OA 1OEYA 2RM21 2G9GA 4XWWA 2JX5A 5EE3A 2VMDA 4NIAA 3BIEA 2H6CA 3NNJA 3POWA 2B42B 1CX4A 2WNVB 1CAVA 3ZSEA 3ZJVA 1B9RA 1W9YA 3AE8B 3JUUA 2D3PA 2YGLA 2ZXQA 4ASMB 1I4PA 5F5QA 3M4FA 2C7NB 5F5AA 5EE1A 1B35A 4UFIA 1HQNA 3E6CC 1KFUL 3U2SC 2VQTA 4CP0A 4BIFA 1VE0A 4FPKA 5IVYA 1DZTA 2W5FA 3S6PA 3OPTA 4FXCA 3ALQA 1UH6A 4HPPA 1RWSA 3UGGA 1YFXA 1OFNA 1Y9QA 5EE0A 4DXFA 2CS4A 3P5BA 2KX0A 4UF0B 1YFWA 3VZKA 3NZSA 1RVF3 3U1XA 5FZIA 3I49A 2JDKA 3W20A 1H30A 1G8WA 1R1A2 1HRV3 2ARAA 1RUD1 2ZCCA 5BMIA 4NN0A 4Q5OA 2FHRA 4XCBA 4AHZA 4EV0A 4Z2WA 1RUNA 2MPFA 1EF5A 4I0BA 2O2VB 4D3WA 1NT0A 4O65A 5I8TA 1MR5A 2M0AA 1ENRA 1ULCA 3PZDA 1KITA 4G9SB 1AYN2 4YVSA 4L1BA 2JDPA 1LGCA 1UZWA 4RR3B 3PIJA 3QJZA 2GP5A 3EECA 3FMGA 3C7FA 1W28A 5GLWA 2LRWA 3VQIA 4A6SA 3MIDA 1W03A 4CYEA 1QOGA 3P1MA 1HXS2 3OG5A 5I4DA 1MHHE 4N8MA 4WURA 4ITCA 2G9ZA 2MJDA 2ZNVC 3LYYA 5LRSA 1GNZA 2XBBC 1LHOA 2RV9A 2N7DA 5GZCA 4J1WA 3MW3A 2LZ6A 4JGYA 3FBYA 4MV2A 1N60A 3ILNA 2W1UA 2VVFA 5FOJB 4QDQA 1EV11 3IIAA 2HWB1 1S0CA 4XTPA 2L3ZA 1HQRD 1GB1A 3GBFA 4CUAA 3PVBB 4FFGA 4NPLA 1QOSA 4LBMA 1PGL1 1G6JA 1ZW7A 5D8AC 5FIXA 5FWJA 1VBA1 2ARBA 3LFIA 5A3TA 1XYNA 4AGGA 2FDGA 3NV2A 1W2NA 1EF1A 1C76A 4NWVA 3FILA 4JKLA 3ZN5A 2JE8A 1QIQA 4WM8A 2FQPA 1JZ3A 3AE5B 3A9KA 3I3DA 4L2YA 1JYIA 3K4ZA 2Y6FA 1ULPA 1JALA 4CYDA 3I3EA 2A5UA 4JCKA 4XE0A 4Q26A 3WUDA 4E3CA 1ZE3D 2DCTA 1T0RC 4Y5SA 1TY0A 2UY8A 4HXCA 3BPSA 1X8MA 1U0AA 2QDRA 3EFCA 3WP4A 4MSVA 5LW9A 4F7ZA 1P7EA 3PNAA 2QZ3A 3MICA 4V2VA 4K40A 5JMCA 4IKGA 3K2OA 2VH2A 2K3UA 3BYTB 1OXCA 4MH0E 1E90A 4YW4A 2K22A 2KO3A 5HFYA 1FMAD 1XE8A 4I09A 1F5JA 1F2RC 4C7YA 3JQXA 1ND2A 3I63C 3CQOA 4QB1A 4DY5A 4IDIA 4Y1YA 2J1RA 2QBXA 3LZZA 1F9JA 3L16A 4LORA 3KQ4A 1DYQA 3W21A 3WDVA 4PIYA 2CU3A 3IIIA 2WNUC 4LT5A 1UOJA 3RJ2X 2HE7A 5H9SA 4GDKA 1JCKB 1DOYA 4B95A 2WSVA 4PK1A 3DYOA 2AGSA 2D11A 1ZGUB 3N7KA 3KW5B 3DGTA 5D8AA 1XQQA 2QDFA 2HBUA 4CEYB 1PUTA 1YQ5A 4NJCA 1NQDA 4XEZA 5DZFA 3BB6A 1LRHA 5FPBA 2LJIA 5FDBA 2PMVA 5CKMA 5F9TA 1V49A 1BK1A 3SCGA 3AE6B 2Q0AA 1JMUB 2WGSA 2NM1A 4GN1A 1N6ZA 3MC0B 4WM7B 5FYVA 1YOVB 1PVC1 1FPN3 4XACA 2RJ2A 3VBRC 3I8TA 2QQLA 2J1AA 3TB0A 2Y33A 2VE1A 3WUCA 2KWDA 3CF6E 5ABJC 3I2GA 1D5MC 1Q8VA 1NI2A 4ANVA 3A9JA 3RULA 2JZ3B 1POV3 2D44A 1SDWA 4HANA 4KSKC 3TRSB 2XVKA 2ZGLA 2DWQA 3DVGX 4LBLA 4ICUA 2ARXA 5CA6A 2BPSA 1WRDB 2G9HD 1LXDA 3T9LA 4CUGA 4K6BA 1JQ4A 3P4PB 1RGSA 4QPWA 5FZBA 5CEHA 2KVRA 4C91A 2PN5A 5GLUA 2EXKA 2BGFA 2W91A 4DXTA 1W0NA 4TQ1A 2D43A 5F1RA 3HRDD 3KD4A 1LU1A 5DPSA 2E6XA 5HCHA 3ZYJB 1COV1 4K7UA 2EXIA 1XBFA 4GSWA 2KFKB 4CE8A 3UQAA 4RFT0 1OI6A 1HV1A 4QXBA 3A33B 1UMHA 4IEYA 5IN7A 2B3AA 1FFVA 4RQPA 4ZXKA 1VMHA 2RR12 3LEMA 3IB3A 1Z7S3 4BQYA 1YFYA 2PTMA 5CYYA 1ZA4A 2EALA 4ZRQA 4W9HA 3NNLA 2HEYF 3AE7B 3H9DA 4AVBA 2BYTA 4QD2A 2XJSA 1WE7A 3LDRA 5CFCC 2Q8CA 4F83A 2OZ6A 4XAEA 3I59A 3VZNA 2DBYA 3MI8A 3IM0A 1F1HA 3O65B 5EIYB 3KV5A 1NCQA 5KC6A 3PJYA 3DXTA 2ZX1A 1PGW1 1WI0A 4NAWB 1HZ6A 4NROA 3RNCC 3LJ3A 5A7OA 1LKNA 1WMHA 2JWPA 3ACLA 4E2QA 4AGRA 4BZ4A 1TME3 2O14A 1ET9A 2L52A 3TUOA 4KI5M 1OA4A 2KJHB 3OTFA 4B1LA 5HI0A 2KDBA 3ZNGC 4Q4X1 1UW8A 1E8XA 4IUGA 3D0JA 4BHPA 5CFDA 1GMMA 3FFQA 1SE2A 1HB4A 1X7NA 1WCDJ 3P4QB 4WZFA 4U36A 3KH0A 2ZMLA 1DGWX 2JG9C 2R49A 4OHXA 3ZM8A 3J7HA 1LEDA 1HXYD 1WMFA 2IUWA 3WAOA 4BVUC 1XLOA 2DAFA 2VAUA 1N5WA 2C24A 2W9XA 3ZR6A 4YSFA 2KLGA 3VD9A 3LEIA 4UW4A 2BBCA 5K9YA 1S0DA 4HEA1 4ZHPA 3T4VA 1E5RA 3X29B 4KSLC 5E6NA 4V1PA 1SLAA 3DBLB 2WT1A 3WT3A 3CO2A 5FRAA 5FYMA 2UYBA 4CP9B 2RDHA 2ZZPB 1WMXA 5FMCA 3NJZA 1ASJ2 4ARIA 2W0XA 1OQDA 3N4MA 1P9DU 1WLCA 5DUXA 4YG0A 4BPZA 3APCA 4XAAA 3UGBB 5DAVA 5JAXA 2ZNVB 4XMIA 2KLCA 1QJY1 2N4FA 1HB3A 5HG2A 1RUJ2 3EHVA 3NVWA 5GLTA 2WSUA 3DHHC 1VALA 4JIOU 5FZAA 3DPRA 5LRRA 1L0XB 1ND2C 1WCQA 1N1YA 4GAZA 1LQBA 2INCC 2R063 4KQ7A 2DDUA 4Q4X3 3BUCA 4B29A 3AULA 2GNTA 5GXGB 3R4UA 3ECIA 1DOXA 1WMDA 2WQYB 2V5DA 5JCTA 4GB31 1UXZA 3I2OA 4MADA 4EZKA 4II2B 3ROUA 2QHOA 1RYYA 1V6NA 2FCMA 2JRHA 1ENFA 1R4MB 3HWJA 1IPJA 4XMAA 1CK1A 1NEKB 4CDQB 1HKDA 5DUUA 3VDDC 3HBZA 4YRDA 4NHMA 3FBMA 5C33A 4FPYA 4QQLA 1CAUB 4W9DA 2C60A 5T5LA 4NHXA 4DNYA 5JZEB 5HPOA 1JI6A 5JHBA 4FBFA 4YTMB 2Y38A 1AYN3 4EJRA 1HW5A 1WLWA 1O3QA 2PAKA 2QCZA 4K1RB 4LKFA 2JB8A 1POQA 3HQRA 4QGLA 3VUWA 1CIWA 1JZ6A 4TSVA 1CAXB 1ZZ8A 3WNKA 4WJQA 3WW2A 2W3JA 4X57B 3TEYA 2BQPA 2PW9A 1ZZ6A 2HDEA 1W6OA 1AL22 1D7PM 1X1MA 2WYFA 4EN9B 4XJZA 4ES8A 2R7EB 3GZUC 2GNMA 3K51A 3NW4A 3RI7C 1KDKA 1VIWB 2O6VA 1UGJA 1R093 4KIKA 1WW4A 3AL6A 4S2GA 3B9IA 4CXXA 1HRI1 2MBOA 3KCYA 3EHKA 4XIOA 4CZSA 5CADA 2AQ1B 4ONUA 3B69A 4JRLA 3CJIA 5K0UB 1P98A 2KDIA 2WXOA 2VOXA 3X23A 1V6JA 1JROA 4CCOA 1PGW2 1SE9A 3O1TA 1OF3A 3LEKA 3KQRA 4NRMA 1GP5A 1WXAA 1AX0A 2B5HA 4N90A 1HTOA 5HKHA 2JIJA 4Z2AA 1KLUD 1NA1C 4HPKB 2WNEA 1CESA 2A3YA 3N1ZC 3CMGA 3HQUA 2D3GA 4JGZC 3H8HA 3GZAA 1GZ9A 1STEA 3IT6B 2ZGKA 1BVVA 4ICVA 1YQ6A 4CCMA 2V4VA 4RS5A 3VHNA 1R4MI 2VMGA 4ISQA 4XX5A 5HXVA 1GQGA 4J1XA 4WWNA 1PVC3 1U12A 2ASQA 2QFEA 5JDBA 4A2UA 3DBRI 1OQQA 3PZ7A 2RGFA 2C4XA 2JG8B 1V70A 2EIEA 2XXZA 3VLBB 3B01A 4AE2A 2D10A 4I01A 2D3SA 3BODA 3LA2A 4YTPB 3ZIMA 2GU9A 1CQVA 2WQ4A 5LATA 2EA7A 4WBBA 2WAAA 1PVXA 1XNBA 4PBOA 3DYMA 1E5SA 4LO7A 1MQTB 2N0SB 1XNTA 2CNAA 2ZX0A 1JWBD 5F5CA 2KFJA 1APNA 5J48A 4K7SA 1V9U2 4ANUA 4HZFA 3NV1A 3AEBB 1NY71 1Q5OA 2RMU3 4BQ1A 1FNUA 2JSVX 2BTVC 4XDDA 5JOYA 1XYOA 3D3AA 3LA7A 2F4LA 3BIID 4L2NA 3QBQA 4Y5TA 3EUB2 2NR2A 2XONA 3PVEA 3KV4A 4KZ0A 5DAWA 1TMF1 4CCCA 1RMU2 5JOWA 3JB4C 1UZXB 2W3SA 4MYEA 1JZ2A 3VHOA 3W5VB 2O1QA 3ZDVA 2BGPA 1I4XA 2IXJA 2ZEXA 2IZWA 4H2AA 3ZXLA 4ASKA 3H8RA 3BZDB 1JZ8A 1FXZA 5FP8A 3ZMOA 4HK8A 4OVUA 2YC2A 1JYTA 3OCPA 2MH7A 1C79A 3KT1A 3AZWA 3T3OA 1V86A 4MGSA 4MACA 3AU5A 3ZN4A 4GULA 2ATFA 1FV3A 4JVAA 3WX5A 5LA0A 3CZJA 2ES3A 2LHDA 3ZXKA 1VBA3 2Z4FA 3FZ3A 3K3OA 1Q10A 3DDCB 4KH9A 5CISA 4WAFA 1F77A 4DHJB 3ORJA 4WVMA 3AV8A 2W2IA 1TNFA 3OY8B 2TNFA 2JG9A 2WR9A 2HWB3 1WXQA 1EV13 2WXJA 5KHKA 4NPMA 4JE3B 1PMHX 2GSYA 2VG9A 4A42A 2DUOA 1GP4A 4AHXA 2R2OA 2YVCA 4EEWA 4IV1A 4Y1UA 2XDVA 4FVVA 1W6MB 4FP2A 4WVVA 3H1UA 3E5XA 4UFKA 4PLOA 4JGHB 2O6VD 3UETA 2C9AA 2LGDA 4UT5A 3E9SA 2L0TA 5IHRA 4E2SA 2JPHA 4A7KA 4MG2A 3U78A 4PCRA 2OYZA 1WJUA 3E97A 1OEYJ 4DHJD 1XE0A 1UOGA 2UY9A 4AJWA 2A6XA 4GJYA 4YPJA 4IE7A 3NKTA 2WLQA 5C8CB 4EROA 4DDGD 3TMPB 3KGLA 4XFBA 2K6DB 4B7EA 3KS7A 1WW6A 2JECA 4DS0A 3U7ZA 3ME2A 1ZPSA 3EJKA 3V65A 3P4SB 2PFWA 4GA9A 4Z82A 5LK5A 3RYRA 2K2SA 4L92A 1GC6A 2RSUA 1SIJA 1KJTA 1HB2A 3R3MA 3AKTA 2FCTA 3WW1A 4HKWA 3WG4A 2DZKA 1OOPB 5JH5C 1SMVA 2VQ0A 3HM6X 5A6YA 3U4EG 3PREA 3HD8B 2I1JA 2OT7A 1Y8RC 4WQOB 4DB5A 1RUI1 2AL3A 5DDJ1 1XC6A 2E3TA 4GIQA 4DXSA 1DQ5A 5CFDB 4XFIA 5GZGA 1FNVA 4KGSA 4XETA 3AE1B 3T0DA 2Q8OA 4UBHA 4GKXA 5DQ0A 2KT7A 3DN7A 3GYDA 4FN2A 1MZ6A 2VNOA 1W90A 4YYOA 1YN4A 4FPHA 1WGPA 3SLIA 1Q3EA 3K75B 2D3AA 1G9AA 1H6XA 2DWRA 3WCSA 3JZVA 3IAM1 3QC8B 4HN0A 2WYSA 4QMAA 2RS53 5IAAC 1RFAA 3I5JC 4N7UA 1W3XA 1IPSA 4DHZB 3RSJA 1DGRN 3ACFA 4Y1ZA 5FP4A 3DKWA 4PYUA 4ZU5A 2JQRB 2RDQA 1R1A3 4MZUA 1Y7BA 1FV2A 2BEOA 3LD8A 3B1LX 3NHEB 4GH4B 2DCZA 4QU1A 3DVNU 1N1TA 4IEZA 2IO0B 2XHKA 5J18A 4BQ3A 2BJSA 3VHPA 5A3UA 5HI1A 3WNOA 1W0OA 2OJWA 3H3UA 4QKBA 2DVAA 3H1YA 4A3OA 4GB32 3T1LA 1DLLA 2PHFA 1MVQA 5DABA 4H7LA 2ZPXA 4A3XA 1W8OA 1KJLA 4KWLA 1XXNA 2FMYA 4BAXA 1NDDA 5HBAA 3ZYFA 2YZ4A 2LRUA 4ZU4A 2RD0A 2G4IA 1WLDA 3L2YA 3TWIA 4MVTA 2G19A 1BK0A 4X6RB 2JKXA 3VXWA 1UYZA 5FKAC 5KHIA 3ETQA 3ZIXA 4PHZA 2FCQA 3AH7A 1K51A 2GAUA 5KXEA 2W47A 4RYDA 5JSPA 2VZKD 1AXKA 1J8CA 4MHRA 4ZYSA 4P9GA 1W8UA 1N5XA 2P1BA 4UFMA 2C9WB 5KXCA 2BNMA 1ND3B 2DCYA 1WM2A 3Q3OC 3H50A 4DO0A 4LDTB 1BMLC 2V3NA 1D4BA 2VZSA 2ZAAA 5A1LA 1XCTL 1EPWA 1CX1A 1MS0A 2WWJA 2ADEA 1XT9B 1JHNA 2ZPNA 1VJ2A 2K6QA 1I3HA 1GWLA 1I35A 4TQ0A 3WG2A 1NUKA 3LFMA 4IGOA 3VRBB 4AFBA 1IQDC 5G2NA 4I0WB 2ON8A 3DVNV 1QJZA 1DQ2A 4JTNA 5DUWA 4B0EA 4IEPA 3MGUA 2N9PC 1YJ1A 1EUVB 4M8MA 2KFKA 1QJU3 1KRHA 4XJWA 4Q4Y1 2MJ3A 3VD4A 4YW1A 5GZDA 3DBRB 3OPZA 2B9UA 1UNBA 3HAGA 2PHWA 1TT5B 1GBGA 2GBKA 3WQ7A 1MS1A 2VZRA 4LNKA 3C7HA 3KV6A 5LXHA 3EO6A 1LCLA 3VBOA 1QLBB 2E6VA 5CG9A 1W6PA 3ZKUA 2VZ1A 4BMBA 1KOTA 4EZHA 1WJNA 2BBVA 3V6EB 1HN1A 2W1SA 3HMYA 4E27A 2KWVB 1FPN2 1DP0A 3BU0A 2LS6A 1MPEA 1FMD1 1ZREA 3PIGA 5AC93 3VTWA 3ZO0B 1JU4A 2Q5TA 1VRH3 2LJ5A 3RPFC 3Q8CA 2WXGA 4HPKA 5JSOA 3T0BA 1N1VA 2WXFA 5EJ3A 1UIKA 3LEGA 4OYUA 1JN2P 3VBOB 3V3XA 4IG7B 4R8HA 5JWPA 3DPRB 3M3QA 4WJNA 4QAYA 2W52A 3ZYBA 3B93A 3VKMA 4Q2FA 4LJHA 1SB3C 3WOGA 3AP5A 3GM8A 1L4DB 1N1SA 3SEBA 4D2KA 1NYWA 3JW0X 4UXAA 4P9IA 4NQKE 3C2UA 4IC7B 2WT2A 2PVGC 4HWIB 2ZKNA 5JMOA 1VCBA 1D2SA 1W2UA 3AP6A 1FOD3 2ZHLA 5IAVA 4RGOS 3C0RB 2CGPA 2GNDA 3ACGA 5IK8A 2WX0A 1TGZB 5FZCA 1H2MA 4FPEA 2X10A 1HJFA 5IA7A 4R9BA 5F6LB 2X8KA 3ZYHA 1FIQA 4W9IA 5CZKA 4B0MA 5A7WB 3O1PA 3R6SA 3RMXA 2QQUA 4XIKA 3UT0A 4IE0A 4UF0A 5BPXA 3D0SA 4XJ9A 1KTKA 2QQNA 5C6CA 4KNCA 5LBFA 1VP6A 2NVUI 2A3WA 4GJZA 4XXAA 3I2HA 2J1EA 4WM8C 3APBA 4HN1A 5LCWL 5J98B 3LF7A 2D2QA 2Y6LA 2BFUS 1UF0A 4Q4W3 3V0AB 3LDZE 3MJ5A 3GJAA 3K46A 1PGAA 1RUI3 2HWF3 3V60A 1KS5A 1J84A 3UJOA 2B9VA 4CDWA 3PL0A 4XHBA 3JSVB 2AL6A 2GC2A 4NNJB 3AC0A 1KXGA 4AZZA 2HWC1 3PMSA 3SC7X 4CCNA 1X82A 3KMHA 3VBHB 4XC2A 3WF0A 2QQWA 1C8M2 4R9DA 1GV9A 2EXHA 4CQNA 3PHXB 5JPMB 1WGDA 3S2AA 3KV9A 1PZ9A 4Q4V3 1RIRA 2ZX3A 2RG4A 1XEEA 2BWAA 4KG0A 1ZXHA 1RUC3 5KXDA 1WH3A 3AVSA 1ZZCA 3WNLA 1S0IA 2WS92 2CGOA 4LIUA 3ACIA 2P3KA 4PDWC 4P9YA 4Y1VA 1L7QA 1NAEA 1F4HA 3VBUA 3NS8A 2A6WA 1HB1A 4DMIA 3W1SC 4LNVA 5F37A 1QNYA 5B4XA 4I3PA 2KQ7A 3B9JA 1LOFC 2MBQA 2VOTA 2XL9A 4J25A 2R041 1XLPA 2CR5A 2OQ7A 2HEVF 3HNMA 4M0HA 4OULA 2IPKD 4M8NA 2RPVA 1WJ6A 4OUEA 5BNOB 1YQ8A 3KVBA 3TAYA 1W6NB 3EXUA 2XEWA 2DU0A 4W9EA 1YYNA 2XJPA 5FPZA 3MBWA 1US3A 3TBDA 1F2RI 1I6XA 3GNEA 5FZ4A 1RUD2 4ZZ8A 4UW6A 4TSSA 3DBHB 2BWES 1Y9MA 3UGHA 2QQPA 4LBKA 2FDHA 4KGQA 5DAPA 1YCIA 3HM3A 2BNNA 2P17A 1NX9A 1TQ5A 3HNBM 2K39A 2K25A 1LHNA 4Y22A 3MUY1 1J3PA 4A7YA 3FN9A 5CX3A 1SLLA 3IPVA 3ZYPA 4COZA 3V0AA 3IT4B 1UZZA 2XLAA 1WZ0A 4O9EA 3M70A 3QLQA 2RHPA 2KWUB 2QQMA 2L05A 4OHJA 3T4HB 4AI9A 3HOBA 3IBEA 3H7PB 1LAJA 3I54A 2EKIA 3ELNA 4QU2A 2NMNA 1RMU1 1AR83 5BYQA 3VBUC 3O1UA 1JOJA 3Q8BA 1OOPA 2IY1B 3VH3B 3PURA 1UY1A 3GS2A 2LI5A 3ZLZA 4XDQA 3RUIB 1QF3A 5FBZA 2ID4A 3B5LB 1LOCA 2JJ6A 5L9BA 2D40A 3HN3A 4FSJA 2BW2A 4FPJA 4HKQA 3HJRA 1SQ4A 4IETA 3NV3A 1DYPA 2XHNA 3WNXA 5FZ0A 2XPJA 3ABZA 1Y3TA 3S5AA 3INAA 4BK4A 2CU1A 1WA4A 2G1MA 2LGXA 2IGHA 2V3SA 4URKA 5BMGA 5GKAC 2WXIA 2NLRA 2D3CA 1OD5A 2VZQA 2V1YA 1TME2 3N32A 4UW3A 1G7YA 4YSXB 3PTFC 1VBE2 2AQ2B 4ZRIA 3J26N 4B4RA 4NOTA 3T30A 2Z79A 3HR9A 5A3PA 5GLVA 4N53C 2R042 1JXNA 1S3SG 3ZW3A 3NUHB 2FUG1 1UPIA 5HCBA 3M8LA 1C4PA 1E9MA 4NVPA 3GALA 1CN1A 2L83A 1AR62 3R2TA 1GZTA 1XPWA 1I4QA 2R32A 2VZ3A 4SBVA 2GALA 3WNPA 1K45A 4BKGA 1VRAB 4LITA 4IXLA 3GHMA 5D3DA 1IP9A 1X9PA 2DYCA 2VMFA 2A4ZA 1H2LA 2Q4SA 3BI3A 4P6VF 1AUYA 1RXFA 5I8YA 2JKBA 4ACFA 1ZM1A 2MHJA 3WNNA 1TG7A 1NXMA 1MS9A 2VPVA 3RZKA 4L9BA 4XFAA 2G9FA 5IFPA 2ZPYA 1IGOA 4AXOA 1NLRA 4LO6B 3KHCA 1U5YA 4NIIA 3RD2A 1XO3A 1E6EB 5A7WA 2N9KA 2NBVB 1R091 5SV5A 2ZGMA 5D8AB 1R1ZA 3U11A 4D8MA 2UYZB 1UGMA 2WKKA 3ILRA 5FLJA 3JXSA 2R062 4Y20A 1NI3A 2R16A 4LNNA 2ZAHA 1UY3A 2QDNA 4QPYA 1WRIA 3HN1A 3AKQA 4XFFA 4AFDA 1WFYA 2JICA 2EIBA 2YB7A 1PNGA 1BUIC 3ECQA 1H2KA 4KKIA 3ZVXA 3EBRA 4IWPA 3SMHA 1DCSA 3T2PA 4WWOA 2GB1A 1KQRA 2IYDB 3J8F2 1UAIA 2GH8A 4OI2A 1HRV2 3AMHA 4XFCA 4O9GA 1AYN1 3VFKA 1UZ0A 3MPBA 2DCKA 2OXBA 1UF2C 4NHKA 2XKPA 1V6OA 2GH2A 1OD3A 4LBJA 2GNBA 2WZ8A 3N30A 2IXKA 1WE6A 3RNSA 2VZTA 3WINE 1REDA 5H9QA 4KBZA 2BVVA 4XJ8A 1D4M3 2BOJA 3RZMA 2VL4A 3DL3A 3JCIA 2L00B 2FCVA 2A6YA 4GB33 3VHRA 2BP6A 4OZBA 5GLZA 1C4RA 3IAPA 2Y6JA 4JZRA 2P4EA 2OHFA 2G3QB 5FZOB 5H8YE 5J7MA 4O61A 3K48A 1AVBA 5FJKA 3W2DA 5D6JB 4FTEA 5CKQA 5AZFA 4K21A 4QGMA 4FPOB 4D7YA 1SLIA 2PVOD 1ZKHA 3IZOA 1L7YA 1W9WA 1MZEA 5H92C 5DPRA 5A3LA 1CIYA 1UQXA 1W04A 4NJ7A 3RNGC 1PM4A 4SLIA 4D6RA 1A78A 4CDWB 5IUQA 1QJY3 2XH6A 3C8YA 2MP2A 2YC4A 1E8WA 2DVGA 3VL8A 4W6YA 3LXFA 2GMIC 5LBEA 4Z92B 1PM7A 4II3B 3E5QA 3AMQA 1YQ3B 3RZZA 2VR4A 4KWJA 2BWCA 3OD0A 4QQPA 2WS93 3BOPA 2ZGPA 1C3HA 2ERFA 3FWEA 4XVHA 3WA0A 2XKOA 5KHQA 1JOBA 2BDRA 3CLPA 1MG4A 3C3VA 2BS3B 2GBRA 3RG0A 3LGRA 5APAA 4QPGA 1ZBA3 2VH1A 4CTEA 3BVCA 3VVWB 3OUJA 3AE4B 1WF9A 1GZWB 4YZ2A 1E7UA 4CDXC 2OVUA 4N58A 3SCHA 2RR13 4QXHA 5EYXA 3T09A 3VUYA 3WY6A 3U4SA 2JX9A 2AENA 4AHYA 2FUHB 4GMP1 1KS4A 4D6SA 1YJLA 4AJYB 1DLCA 4AVAA 5FMOL 1PK6C 4A4AA 3WHTA 2VM9A 2TSSA 3CHXA 3FLRA 2QQVA 2N9EB 4DQOC 5EFUA 1NKGA 2RDSA 4CPBD 3NRZA 4OFGA 1QZEA 3OUHA 2YROA 3KZ4C 3DUIA 1FPYA 2FNJB 1UU4A 2FZ1A 3MLJA 5L83A 3VUOA 2A71A 2LHEA 3UV9A 2WNUA 3VTVA 4AQTA 4NO4A 3ZXRA 2JYEA 4JQRA 4Q4V2 2WNVA 3AFKA 5A7PA 3SHRA 4C1WA 1GSLA 5FY4A 4BBNC 1SHWB 4OZAA 4HCPB 2MCNB 5LA2A 1SG3A 5A70A 5ABJA 3JQWA 1P7FA 4FTSA 4FI9A 2IO3B 2WZR3 4FHKA 4XYCA 5FY7A 4K3UA 4MGQA 1AN8A 2Q1FA 3NJVA 3NWKA 4LNFA 4AFMA 4MEMA 5E8AA 3PTYA 2K8CA 4Y4YA 5IVEA 3H3ZA 3UQBA 2FDKA 1OVPA 2DTWA 2K0GA 1J19A 1BZWA 1KLVA 3AP9A 4GMP0 4ZU7A 2FIDA 1CAXA 4EWAA 3U52E 1OGWA 5F8PA 2E9QA 1QMJA 4XBNA 3CBNA 2YLMA 1X36A 1FFUA 1HTQA 4S17A 2DU1A 3ZFFA 2VOVA 4RH6A 2QCSB 4ATEA 1MZFA 4QPGC 2BF8B 1RUC1 3GZNI 3R2IA 4RNAA 2CWMA 5I8SA 1K53A 2CHXA 1L5PA 2M4NA 1ENXA 5DN2A 1F52A 2M0XA 2JEMA 2Y0OA 3NOBA 2BGCA 2W87A 4GOCA 1EU3A 1YN5A 4W4ZA 1JH5A 3RMKC 4K9SA 4M4PA 4QQHA 2ZGSA 2A7AA 2XB6C 2HWC3 2NQYA 4ITKA 1TY2A 4BZAA 2RS52 1XSRA 1PQSA 1BCXA 4YFZA 2L7RA 2KTRA 3JBG3 1POV1 1OA2A 1QJFA 3A23A 1MFWA 4RGGA 1P8JA 3C7OA 5L7OC 4Y26A 5C5UA 2VUJA 4BU2A 3G7DA 3ZDMC 4Q4W1 3AE2B 5KWRA 1TS3A 3GF6A 1CQ9A 1W8HA 4ZYNA 3RFRA 1FPN1 5BUVA 5EDSA 1K52A 2INNE 2Y5BB 3H7JA 1UD1A 1E10A 2MBBB 4M3CA 3B94A 2DTYA 4L11A 4GGQA 2XWBB 3GCXA 3NAPB 4IQPA 3A4UA 2HWD3 2GLSA 4E74A 2XJRA 2WXPA 4IEOA 4UW5A 4YG3A 1ZP0B 1TE1B 2XJUA 3WDUA 3ZYGA 2VU9A 5T5OA 3PSEB 2WFPA 3MC9A 1RUE3 4LHKA 2GN3A 3AB0A 4RGKA 1H1IA 3AYAA 2ARCA 3L08A 5C4WA 2P3YA 3PHMA 5K8SA 3QX1A 3DCQA 4IV1C 5HV4A 3RT3B 1AYM3 1D2QA 3W9AA 1RHI3 1KH0A 3O1OA 1GJZA 1UY2A 3RMYA 1E5WA 1MVKA 4CEYA 1K50A 2YUEA 5F3CA 5IVJA 3M3EA 1TKYA 4PQQA 3HHMA 4JQWC 4MO3M 2CDOA 1WX8A 2W82A 5CU1A 2XJVA 4HDQA 4LKDA 3HIZA 2YC0A 4QDSA 3MV11 1NVID 2AEHA 3WF2A 3ZXAC 5KBFA 4AG4A 2OS2A 2QVSB 2K8HA 5FOBB 5E6HA 1CAWA 3AMPA 5CG8A 1K5MA 1ENQA 1VRH1 2GC3A 1ROEA 3ONSA 1J7BA 1N62A 2W55A 2R073 4OI0A 2AQ3B 3Q3JA 3Q6BA 2Y0IA 2VOWA 3SITA 4XF4A 1GNHA 1RYJA 4Y24A 5C70A 4HVRA 3MEPA 2ZA9A 1Q56A 3Q3FA 5CNAA 1YQ4B 1IS5A 4QDRA 1AR92 3IG3A 4BMEA 3FC4A 4PT5A 3KM5A 1JYCA 4FQ4A 4MGIE 1WWYA 4EZLA 4A6OA 3P1IA 4JX1C 1UMIA 2WXLA 3AXCA 2DURA 4N6EB 2L32A 1QH7A 4EN8B 2JD4A 3GHNA 1ZRIA 2NBUA 4N43A 4Q4Y3 2WU5B 2ZGTA 4E4ZA 3I3QA 1LENA 1HXS3 1IS6A 1QXPA 1V2YA 1BHGA 5FLHA 4AQ2A 4TYSA 1S55A 5EHDA 1SLTA 2VZOA 1GWKA 3BY4B 4MGKE 1UXXX 4OI4A 2J0KA 5FPUA 4HFSA 3QA8A 2VMIA 2WWUA 4KVGB 2BV4A 2NTTA 4D7SA 5C3JB 3ZX7A 5AFEA 4C4VA 3N1XC 5FKCA 5JUVA 4C0BA 3FUOA 2YFZA 1F4AA 2K46A 3IMMA 2VULA 3C7GA 3V0BB 4HXDA 4E4DX 2JT4B 3VV1A 2VZKB 3HIFA 5T50A 4QX8A 2C5LC 1EV12 3O5SA 1WMEA 1F0ZA 3BVGA 2KVZA 5I0RA 1O59A 4IWOA 5LEJA 4MX3A 1JODA 2Q8EA 2M1MA 1C8M3 2Y60A 3L2HA 2CWSA 3ENEA 2Y26A 1RITA 2E31A 2KOXA 2JDUA 4LHLA 1RFKA 3OD4A 4XCAA 1L7LA 4QQ2A 3TSSA 4L8QA 2G1EA 2WN3A 3AMZA 1OKOA 1MG8A 4AEMA 2YU1A 2VCCA 4DQAA 1H2NA 5FPLA 2HH9A 1AL21 3OEBA 2EIDA 4RF0A 1ZX5A 5T3NA 3AEAB 1FO4A 2OIIA 4FAHA 1AR73 3RZGA 2IY0B 3T2TA 4LBQB 5D7GA 1IZ3A 3OPWA 3LWCA 1PIV1 4BOWA 1G9BA 2IZVB 4A8XC 1HQWA 1WYWB 1YNTE 3NVVA 3N36A 1IG0A 2X8XX 1YNAA 1IPGA 1ASJ3 1UZVA 2JXXA 4YNIA 4HG6B 2UWCA 3U37A 5F5IA 3AP7A 2J0JA 4LIVA 1RUH1 1LOGA 1R1A1 1V1PB 3ZFFB 1WWTA 4RM8A 4OHVA 3DWMA 2RM23 3RS6A 1VRH2 1QJX2 1G9CA 2PLPA 1VJKA 1IS3A 1VLNA 2ZCBA 2XGXA 5IO9A 3OLMD 2DZJA 3N9MA 1YQBA 1DQ4A 1EY2A 4N9IA 3O1RA 3R7QA 1V6KA 1VZ7A 5GM0A 1XNCA 4DRRA 5IKCM 5FXXA 3DQVA 2HWC2 2FAZA 1N63A 3VDCA 1RINA 3H7PA 4KWUA 1WSPA 4HDOA 3H6NA 1U5IA 1RHI2 1E5IA 1CAUA 3N9NA 5DDJ3 2MNGA 2WO3A 1V9JA 4QHOA 5ANNA 4EOYA 5FY9A 4CVUA 4NPRA 5ABJB 4HSLA 4AL9A 2VOKA 2SLIA 1FXTB 5FMBA 1D6EC 3MPPG 4FPGA 4BQ5A 1VPHA 1UX6A 5FJHA 2JB4A 3DHIC 3AYDA 3AK0A 1OVSA 5ACA1 4JAAA 3I3TB 1MJDA 5EP9A 3AM9A 4WAAA 5C3RA 2GMPA 1RUE2 4GMVA 4EKUA 4KV2A 2DFBA 3NNGA 4WWPA 3C7EA 2KYWA 3ATGA 5CKNA 5EWSA 4XOGA 1NY72 3LSDA 3GGLA 2J7MA 1NLSA 1MZ5A 4CDQA 3AKSA 2IC1A 5ERLA 2O8OA 1NCQB 3ZLIA 1EAH1 3W5NA 3LQCA 2RJKA 4BOZB 4KWKA 2JYTA 3CL1A 2PHRA 1O3TA 2WNUB 2FDFA 2FIFA 3AEGB 5L19A 3I3MA 4GWNA 1ND3A 5CFDC 4AHWA 1KFYB 1C1LA 3H0OA 3RWKX 1ZRCA 4MXWB 1DBNA 2J1UA 1QXJA 1QDCA 4RGAA 1G6NA 1YIWA 1LOAA 2DVDA 4AI0A 3THDA 3B00A 4KDLB 3D4KA 3ZNZB 4Q0VA 1OFFA 1NOVA 4PIXA 4Q4X2 2WC2A 4BOSC 3HK0A 5JOZA 1TZ1A 1Q5WB 1SJED 3WEZA 1IBXA 1Q43A 1S0EA 3T08A 2YFUA 4WH4A 4LK6A 1W6QB 5IVCA 4DDID 2J1SA 1AX1A 2D7FA 4DHZE 2BW8A 3IWZA 1UKRA 2CHHA 2MSED 1NZIA 5E89A 1UCXA 3BOWA 2A6VA 3IFWB 2A6ZA 1DZRA 2LUWA 4OHZA 2JDZA 5A32A 3FHQA 3NRUA 4RHV3 5IVFA 4CUCA 2LMCA 3JD71 3DWGC 1WM3A 1R082 1DFQA 4IV3B 1VBB2 1PO22 3KT7A 2ZTNA 2CY6A 1C4AA 5JXGA 4Q0QA 4BYYA 1QHDA 1WW5A 1JU3A 5DMYA 2L8JA 2XQRA 4D94A 3H7SA 3WVJA 4P9WA 3P42A 1GFF2 1ALYA 1C8NA 5F3EA 2DUPA 3KB5A 4ZPIA 2XQXA 5C3PA 2WA3A 4GDLA 3WAPA 3Q14C 3QH7A 4TV3A 1PHMA 2W92A 2WXNA 2W08A 3AM2A 4LOSA 3JVZX 2C9KA 5FYCA 3NG0A 1XLQA 4HJKA 5E16A 1ZOYB 2DCJA 1RVF2 2F17A 1R4NI 3C19A 5EQUA 1U4AA 3MZHA 2H6BA 2MEV3 4E71A 2VCBA 4MOAA 1JYXA 3ZKJC 4RQPB 4YZ5A 1QJX3 1URXA 5LB6A 4IW0A 5D21A 2HJIA 3ZUNA 1OLRA 1XNKA 4P9XA 4O1NA 4BQWA 3BTZA 1HRI2 2QILA 5C1ZA 1JWMD 2DFCA 2JDNA 3L4PA 2B46X 1BBT3 4GXLA 1X9TA 2W54A 4Y20B 4UAPA 5FLIA 3N7JA 5JVVA 4QKNA 3PLUA 2ET7A 2YY1A 3WIMA 4BH9A 1J3QA 4FTBA 4XBQA 1H1AA 3AZZA 4XUPA 4IE6A 2ZGOA 3AI5A 4ES9A 1GPXA 2J42A 3OF1A 4E8DA 4ZRKA 2IFWA 2K1FA 4S2FA 2ZMNA 1CPNA 1XYPA 4YSZB 4NRQA 3VDBA 4DBGA 1SFPA 1F35A 4WZCA 1M94A 2NMQA 3I97A 1VBC1 5C3QA 2RS12 3H9AA 4AQ6A 3HEIA 5IFTA 3I7DA 4EZJA 2MP2B 1REEA 2QE3A 3EQEA 5TSSA 4D6QA 4PF5A 1FEHA 2JXAA 3P63A 3MUZ1 4EWDA 1UWMA 1BBT2 5A1AA 3IDBB 3IPVB 1OUSA 3AZXA 4QXCA 1Y43B 4LBOA 4G4FA 4UFHA 3P3PA 3VBHA 4HLTA 4IEWA 5K4LA 4KGRA 4UWDA 1CD3G 5I91A 2WNVC 1RUJ3 4FP3A 4JGZA 2ZGNA 1GC7A 2IO1B 5A33A 1RUF2 2W94A 2KXLA 4FOVA 3POBA 3F95A 1GYKA 4JQTA 3IBMA 2AEYA 2LM3A 4OVZA 2YG0A 1UWWA 1Q8OA 3NVYA 4N53B 1IKPA 5J36A 4P08A 2FDIA 1SACA 5KHGA 2JIGA 1C1YB 1TJEA 1GOHA 1ULEA 2ZEWA 3WCQA 3RFZB 1LU2A 2HWE2 3UESA 3FX3A 4MGTA 2Z5WA 4EZ4A 4Q2JA 1D0GA 1WX9A 1UBQA 2PELA 1NA1A 2ZABA 3ZPOA 4C7ZA 3WQ0A 1GUAB 4XYXA 3POSA 4H55A 1RUI2 5LA1A 3PTRB 3GE3C 2DZMA 4DPNA 1PK6B 4YSYB 3URFA 4BIOA 1DQ6A 1VBB3 3VGIA 1OA3A 2PHXA 2FCSA 1EAH2 1R081 4CDUC 2BOIA 3U07A 4W9GA 4CCKA 2RR9A 5C4WB 3QD6A 3VBUB 1QH6A 2YHJA 4LNIA 4KGGA 2O2VA 4V2WA 1R083 2X5IA 3FJSA 4YW2A 2GC0A 3AMNA 1A8MA 5DAQA 3TN93 3CEWA 1OF4A 1TVGA 2BTEA 3N7LA 5A3WA 4Y5Z0 2QQKA 3WALA 4PS8A 4XF0A 1DHKB 3KVAA 1SE3A 1E57A 1WKYA 3N3KB 1C78A 4CCLA 5FYYA 4XUOA 5IVVA 4US8A 4PI2A 2I1KA 4AVTA 4JHZA 4LHNA 3ZIWA 4I6PA 2A73B 5JI9A 4JDMA 3POIA 5CFCA 5GMVA 2R061 1QJEA 4DUVA 4F8AA 3APDA 2AEZA 5T8IA 3E6DA 1Z7S2 4N43B 1V97A 2V4AA 1UOBA 3KUZA 2ENRA 3EMRA 4NUBA 1NE6A 2D5HA 3AKRA 4W65A 1DDLA 2VH9A 4M0NA 2ZJCA 1FNZA 4YM1A 3ZFGA 3N9LA 3A0NA 2Y5CA 3WP6A 1V9U3 3VDDB 1I9RA 2KR2A 3NMBA 1H9WA 1N61A 4YLZA 4JTOA 1Q8SA 3P4RB 4AI1A 3MW2A 3WLUA 5CHFA 2W9NA 4XDCA 1K5MC 2OPKA 2KMAA 1GOFA 2ZCWA 3BKZA 4YWGG 2PLV1 3ENRA 3ZMNA 1C5IA 4A6QA 3NAPA 1STMA 2WX1A 4B9KA 4HVOA 1UY4A 1WJ4A 3QK0A 3OGGA 1H1MA 2PYTA 4C0HA 3HT1A 3VZLA 2JY6A 3PVNA 1IG3A 3RNAC 1UWXA 3FLPA 3TCAA 3IN9A 5FP3A 2M8SA 5IK4A 1YC61 1IOAA 4I2OA 5D2MB 2ZHMA 1VBE3 1VBD2 1W9TA 1GU3A 2L76A 2DHZA 2LALA 3RZWC 2KKCA 4AS1A 2O6VB 4R52A 4ORFA 4YZ3A 2FBWB 2AACA 1YN3A 4RGMA 1MEC1 2NCNA 2DAJA 1TME1 1BVP1 3M7AA 3FHIB 3BYWA 4BISA 1F15A 4META 3DCGA 4CHKA 1NYQA 1XU1A 4XPVA 4FPCA 1WCUA 4L23A 1J7CA 4QM8A 1QJX1 2XJTA 3I4IA 5ACA2 3ZXFA 4ASWC 1XU2A 4UOJA 5K7PA 1W8TA 4IV3C 1QXRA 2MEV1 3J7LA 3PU3A 4BQXA 3MC8A 1TKEA 3TN92 3A21A 3PUAA 2DYBA 2IXCA 4WM8B 3RI8A 1RC6A 4YM2A 1WXMA 2DYOA 3ZXDA 1KFXL 1VB4A 1A70A 3WW3A 3SFDB 1U5XA 1Z0HA 4B8EA 4R3DA 2VZPA 4PLMA 3PDQA 1LJ7A 3MIGA 4LUMA 1M4VA 2XNAC 3OBZA 2FBEA 3P2BA 3NJTA 1ZA7A 3SKJE 1Z7S1 4IV3A 4NHYA 2WYQA 4EWEA 3W9CB 5FTTC 1Y56A 1W9FA 5JXHA 2PE9A 4GDKB 4EQVA 3L17A 2WFF3 4MT5A 2ETEA 3I59B 5FY0A 5FYZA 1COV3 2P34A 3QHTA 2LW8A 4N9HA 5JIUA 1S2BA 1I4GA 1JBCA 2NMOA 1OPOA 3M3CA 4KX6B 3JD73 2FCUA 4NHLA 2P2KA 2VUDA 1JS9A 4YVWB 3VBOC 1H8TA 4QPIA 1NCQC 5FZGA 4YVSB 3OBAA 2A5ZA 5GZFA 2B76B 4XWTA 5F6KA 2P37A 1FNYA 4AYUA 2LFIA 1V5TA 4RM9A 1OH4A 1ZBA2 2D97A 3AE9B 2KN5A 3BIWE 1SLBA 4C00A 2I2YA 4W9LA 2LASA 2EKEC 3CMMB 4RMAA 4MSMB 1SFNA 4LDTD 4AK3A 3CSFA 2DNFA 2WFF2 2OKXA 2I38A 4G0NB 4DEVA 2VBDA 1SIFA 3VDDA 3RGBA 1P0RA 2XMLA 2DZIA 2ZMKA 1BLZA 2MEV2 1OT5A 2VC9A 1POV0 5CB7A 2N1WA 3R4SA 2D93A 3ES4A 2KDFB 3VTUA 1WZ3A 1RL3A 5FYUA 1EAH3 5IW0A 3VBSA 1F31A 2G45B 5BV6A 4BFRA 2J0MA 1GB4A 1AR91 1ZXIA 5T52A 5FAXA 2BRTA 4WM7A 2A75A 2Z0DB 4RHV2 4MSQB 3N9QA 5T5JA 3J9CA 1O4YA 3B3QE 5KHJA 5FO9B 4AOCA 4HL0A 3V64A 3P6BA 4QWNA 5ACA3 4XJAA 3MF6A 2JRIB 3ZFFC 3L13A 2GZWA 1MHXA 3ZSMA 4Q4Y2 5AC92 5D3IB 1UIJA 1VZ8A 2PIAA 1J7AA 2JZZA 3A0KA 4Y33A 1Y9GA 1VBC2 4WM7C 4ARXA 1MI0A 4HT1T 1T0QC 2PQSA 1K42A 1HV0A 2INDC 1XCQL 4AAXA 3FLTA 2L0FA 4FJVB 1BKZA 2OUJA 3NJXA 4IWQA 1S1QB 1HIXA 2BYFA 1JRUA 1ZNPA 4OHWA 4A90A 2C7HA 1UMZA 1N3QA 3SH5A 4NAOA 1RUG3 2WDQB 3PMEA 4FLHA 2AYHA 2R072 2HWF2 4LOTA 1X50A 1L3JA 3WV6A 2M17A 2RMU2 5JR7B 1B35C 1YJIA 4GD4A 3VN4A 2C26A 3LPFA 2LGIA 3O7OA 1AX2A 4LBQA 5DCNA 1GANA 2VTXJ 4FPFA 3M3OA 4WV8A 4D0QA 3L9JT 1RUH3 5CBLA 2WL1A 2WWSA 1LHVA 5HXMA 4BDVB 4P00B 4JKMA 2AREA 4FJZA 3POFA 1ASJ1 4KU7A 3AECB 1V8CA 4XF1A 3RN9C 5ISLA 5A6XA 1OTRB 4QHBA 2XR4A 2GBJA 2HEWF 5FY1A 4CU8A 3VDZA 2DUQA 1GG3A 5LASA 1QOBA 3B7MA 3R8BA 3GOEA 2ZHKA 4YL8A 3HVZA 3VBHC 3ML9A 4AEDB 3R4DB 3ZSJA 1SBDA 3UIPB 1QGLA 4E2GA 1QJU2 1VLBA 2PTLA 2V4LA 1COV2 1CONA 3UINB 1C9FA 2PKOA 4I6NB 1FMD2 5IK5A 4KBBA 3RYKA 2QC8A 2E26A 3CJXA 1H0BA 5LY2A 1C8M1 3PRZA 2RVAA 3VUXA 1VMJA 4K1YA 1NBFC 4LE3A 4JC1A 1LOBA 2R30A 1C57A 1DZQA 1HX6A 5D94A 1VAMA 1I5ZA 3U75A 2ZGQA 3NSTA 2P6HA 3THCA 2N7GA 4TXWA 1HRV1 5I0UA 5M0TA 4P02B 3M62B 1RVF1 4XBLA 2BERA 1YUDA 1XE7A 1SBBB 4ET7A 1W9SA 3AEFB 5FUIA 2BS2B 3KQ4B 2KJRA 4A55A 2ZZQA 5LWBA 1NYRA 1QF6A 2YDEA 2XK5A 2VVEA 2V0GA 2WRAA 2VVDA 4K81A 3UI3A 3RZFA 2XLFA 3RRDA 3VBFB 2LXAA 4COVA 2Q5WD 3O1SA 1CZSA 2PHLA 2OA2A 4G11A 5FQ0A 2OOBB 3O13A 2VXRA 2KTRB 1YX6B 4HVQA 3DHGC 1K5MB 1RAXA 4W9KA 2CU5A 3VBFA 3KVFB 4WWMA 3SNMA 1YO8A 5G04L 1OQRA 4PBPA 1EYBA 3RYTA 1C3TA 2GC1A 4P1CC 3BINA 3K9OB 4HPLB 5T5PA 3WF4A 3M3IA 1SZBA 3A4SC 3WQ1A 3A1QB 1QT9A 5BNQA 1JW6A 3TIXA 3MFCA 2Z59B 3PU8A 2C0ZA 3ILFA 1UL9A 2RE9A 2HKXA 3OJBA 3DYPA 3TJPA 1SLCA 4XQ4A 1RUH2 1S1AA 4XC9A 1H4GA 1RUF3 3IMNA 1UU6A 2RS11 2R071 3NKGA 1RUG1 4TLFA 1J83A 4N43C 4AUQC 1W6NA 4IM0A 3FILB 4N59A 3IT8A 3O1MA 5A6ZA 5IAXA 2UWQA 1Y4WA 3NAPC 1IBXB 1WCKA 3A7QA 1S2KA 5JXJA 5LBBA 3LB8C 4AVSA 2PMWB 2XOMA 3RZLA 1LULA 4HKZE 1GOZA 4JHTA 2MQJA 2JDMA 1OC1A 3AU4A 5KHHA 2W68A 4A9AA 3PT2B 2KD7A 1RHI1 1YX5B 1LFDA 4A45A 3BN6A 2JG8A 1AYM1 4I3GA 2UWBA 3KWLA 1WXVA 1UPSA 4YGDA 1O4TA 4NJ6A 2J4XA 2ILMA 4RGTA 4XZUG 1RUE1 4OVEA 4AP4C 2KN4A 1NCRC 5B4NA 1G9FA 4JKKA 2ONQA 4TN7A 1AR93 1E8YA 1YQ2A 1PX3A 4CP9A 1O3SA 1DYOA 4MH8A 1EWYC 4OHYA 2QNKA 4M0WA 1FCLA 2R0FA 3ZJTA 1QQP3 4BQ4A 3VD3A 3BTAA 3SD5A 4ATFA 2J1TA 1DQ1A 2XUEA 1OMIA 4CSWA 4DINB 5J09A 3ZDSA 3V6CB 1GZCA 4C90A 3T0AA 3KF3A 5FWEA 4RGNA 3A4RA 5FZ6A 4CXYA 1YIFA 3H1MA 1UELA 3ZYYX 4PI0A 3OUIA 1OKQA 2LTNA 1IQAA 1K3IA 2J53A 4IEQA 2VW2A 2V09A 2E32A 3O0WA 4PIZA 4XF3A 3JBG1 1PIV2 1WCSA 2FMDA 1CAWB 2ZX2A 3I2DA 4IERA 4K8FA 4IEUA 3TYJA 1ZZ7A 1QQRA 4TUUA 1WY8A 2IXLA 3ZSLA 1PGXA 1PZ7A 2BKRB 4A41A 4AW7A 2Q1MA 2LRPA 3VD7A 1YMHE 4C56C 3KHBA 3POJA 4INDA 2KNBA 4HSJA 2W46A 5C23A 2PEAA 4B3NA 1BEV3 2IJ0A 5IT6A 4NIGA 1C28A 4KKJA 3LIGA 2INPE 1WIAA 4UDUC 1TEIA 2VMEA 4GH4C 4AEDA 4J3OD 5FP9A 5BNOA 2HWB2 3H1WA 2Y3AA 5FO7B 4LKEA 1VBA2 1QOFA 3WR0A 1OQYA 1X33A 3E6BA 2H0VA 3PS6A 4LKSA 1ST8A 1CJPA 4QX1A 3PUQA 5JOXA 4B6WA 4IL7A 3OEAA 4LPLA 5J96B 5C71A 1G9DA 3QACA 3D8CA 1GR3A 5DG1A 1ZRRA 4GWIA 2ZGUA 1R64A 1NA1B 1AR61 5J37A 3W58A 2VBPA 3AEDB 3RDIA 5JIAA 1RTVA 2ZOEB 3OJ4B 3TOJA 2RS33 4AVVA 4REZA 4X6QB 2ZJDA 1TS5A 4GXBA 5KXBA 4YXDB 4IGPA 1UBIA 4AAPA 4HJGE 3V61A 2D98A 1LHUA 4JV4A 4WJOA 3DKQA 2KXJA 4GZ9A 1HN0A 2ZZJA 5G5HA 1ZBE2 2UU8A 1VAKA 3ZFEB 4XUQA 2V3PA 3BPZA 5A7SA 2RPQA 1VZ6A 2KQ4X 1ZBE1 1T5XD 3B2GA 1I5PA 1JZ5A 3LOBA 3DXUA 4JGYC 4AFCA 4NIDA 3P3NA 1CVNA 3LE0A 5LBCA 3CJIB 5K0UA 1H8VA 3ZR5A 3AEEB 2VZVA 4RD7A 3S5QA 4XUNA 3WANA 4ZOHC 3ZRFA 3CSTA 4FT8A 4XGAB 1RLFA 2KX3A 1H8CA 4XABA 1LO5D 1YI7A 2N1VA 4XQDA 4XFGA 4ZRJA 3VH4B 4LA3A 2WZEA 5FZEA 1UOFA 3ZGZA 2I2SA 1TIFA 1PO23 2XBO3 2DVBA 3JBG2 5C9AC 5CAZA 4CP1A 1WUVA 1TKGA 5KHOA 4MXVA 5C8CC 2KA3A 2JVCA 1E7PB 3D32A 2A70A 1Q0WB 1XLNA 2RDGA 2JE7A 4LO5B 4R9CA 1W39A 3AXDA 3FE5A 4LUKA 1E7VA 2R1DA 3W5MA 3JYUA 4Q1RA 2L1AA 2CV6A 3PRMB 2HD5B 1RUG2 2D6PA 1BMV2 1CR7A 4LQRA 4TZDA 1H4RA 4CP2A 2C5DA 2EICA 2KJ6A 1YI9A 5BXXA 1OLQA 2A3XA 2WS91 2LGSA 4BBNF 4B1MA 3SFEB 3VBFC 1PGL2 2QQOA 1FM0D 1SPPB 5EE9A 1BJQA 5JHAA 1ET6A 5FCCA 4YZ1A 5FZKA 3NL1A 4OZOA 4ZRPA 5E6OA 1ND2B 2Q8DA 3DOWA 4ZS3A 4AI3A 3D5OA 2NS5A 1T0SC 2IBIB 2JDYA 3W1SA 5DUVA 5G05L 2Y34A 3UGFA 3HBKA 1EUTA 3CJIC 3G6JB 2MBHA 3GZEA 3USSA 4JGYB 1LGNA 2BB6A 4R4ZA 5FZHA 2QTWB 2KACA 3U14A 3UKVA 1SPPA 1GNUA 5JR2A 3LA3A 4N7IA 2L9LA 3H3LA 4JDNA 3ZFEC 2C1FA 3CIHA 3RPQA 3QARA 1L7RA 1UKGA 3VR9B 1SFYA 1T2XA 1UN1A 1W3VA 4W9JA 1E0ZA 5D2AA 5C8WA 3M95A 3PUHA 4LK7A 1RXGA 1LR5A 1D4M1 3EFUA 5A7QA 3SU8X 3WQBA 4W6WA 1D5XC 4Q0SA 2M56B 5EJZB 4H14A 1XSQA 1YXWA 3AJYA 4ZZ5A 3T2OA 3V56A 3FC0A 1KJRA 4KU8A 4AI8A 2O0OA 4GQ7A 1PMIA 1W6PB 5L95C 3AMMA 4BA6A 2VCAA 5DZGA 1E8ZA 2Y8KA 1VBB1 1MQTA 1K12A 3NNMA 5LXIB 2YU2A 4FFHA 1ODMA 4FQZA 1IGDA 2ZX4A 2NBWB 3VR8B 2VUCA 1AZDA 4QM9A 1AARA 4UFJA 1N3OA 2JDAA 3UKTA 1PNFA 4EN0A 2IVJA 5L9VA 4DUWA 1DGWA 3NZ3A 2YPJA 1TYGB 4HK2A 4RA0A 3ETRA 1M4WA 2J22A 5BNPB 3MF9A 3BCWA 3U10A 2QQIA 1T3QA 1WR6E 5LNK1 4DZGA 1GAQB 1B35B 4L0PA 4ZONA 1CWPA 3HNYM 3AKPA 1W8FA 1W99A 3WNMA 2OQ6A 4ARCA 1WMHB 4BCUA 1ZRDA 3ZXGA 1DF0A 5CFCB 4LJPB 1IUEA 1RUJ1 2NPTA 2RDNA 2BPA2 1JWAD 1RUC2 4QAWA 3KWVA 5G55A 2Z8LA 2EIGA 2W1WA 5BNPA 3J7NA 1JZ7A 1NQJA 3V05A 2BVBA 5D1IA 4M4RA 4MDKE 4XW3A 2CJOA 2VBBA 1I7HA 2BT6A 3RWNA 4CXWA 5G5GA 4IUMB 2Y6HA 3WDXA 1JOPA 4YM3A 2VMCA 3LDBA 2ZACA 5A3OA 3BVMA 2C7MB 1EUUA 3WD5A 4P9LA 1F9KA 4LCDE 3H42B 1ACCA 3AP4A 2DF7A 5FYIA 1GNYA 4FFFA 3ZXVA 2VXJA 1WGRA 3M63B 3MIHA 4ISRA 5KR7A 1QOTA 1QJY2 4G3YC 2HWE3 2OX0A 4XHXA 4PS3A 2HWE1 1D3ZA 1ZDXA 2VTXA 3WZ1A 3FL7A 5A32B 1HE8A 1ISNA 2E33A 4UYBA 5J1XA 2WAOA 3PV1A 2SEBD 4CA9A 3NS1A 5A80A 3SEEA 3RNEC 4FPLA 4FJYA 3BWUD 3U30A 2D6OX 3J8F3 1HQLA 3U4XA 1ZYBA 5CVRA 3ABVB 2E7QA 4JWUC 4LJOB 1LOEA 4PF1A 4MGZE 3E5UA 2KD0A 4XZ4A 3I57A 1ONAA 4AWDA 1F2NA 4M3CE 4IDZA 3KT4A 1FOD2 5MPOA 2ORZA 1WGKA 4N53A 5C9AA 3VBRB 4Y22B 4LA2A 1XQNA 5DPTA 1MACA 4IGQA 3VZJA 2YEPF 1GQHA 2WO7A 1AR81 1RMU3 2CAVA 1ZZBA 1O4ZA 1QNWA 4IESA 1FATA 2AX5A 3MLLA 1FRRA 4BJ0A 4W8JA 3IXSA 4CDQC 4YVSC 4NIHA 4XURA 1WA6X 2O8QA 4A3PA 3JU9A 3AXEA 1W2TA 1JRPA 1JWUD 1OQEA 4A7ZA 3OSDA 5FYTA 5FY8A 5FO8B 3LB9A 3NVCA 3PHWB 3ZSKA 2CTVA 1IGCA 5DPWA 3ZJUA 2MJEA 3JD72 2RDRA 4TTGA 3VKLA 2FCNA 3SH3A 4YW5A 1O6UA 2P6CA 1GUIA 2K0PA 2PQQA 1H8TB 4CCDA 5GALA 2D6NA 4RHV1 2RDBC 5JXIA 4GB9A 2WNMA 5TSWA 2JWZA 5FREA 1KF6B 1MS3A 3OBTA 4K3CA 2PE6B 3TEZA 3MYXA 4QXKA 2WNOA 1JUHA 3M1HA 4Y4RA 4MLOA 3N1YC 1KDMA 4B7KA 1TTNA 2C6SA 1SBFA 4XTMA 2SBAA 4OVVA 1O91A 2BUKA 2R043 2IWGB 1REFA 4OW0A 4FA6A 4FHJA 1MS8A 2WLPA 4OQ8A 3QWZB 1H4HA 3U8ZA 2ZBJA 1V81A 2DV9A 4B4QA 2IXHA 1C77A 1I42A 3FUQA 4QQOA 1Q8QA 5C3SA 5F2WA 1SGHA 1V1PA 4OI1A 2D5FA 4IV1B 3DBHI 1PZ8A 2AYOB 2WABA 4CDUA 4LNOA 4RS5B 1WYGA 1EWCA 1WW7A 3B08A 1UZYA 2UWAA 4JDOA 2EF6A 4FOWA 2LVQA 4YARA 2X29A 3W1YA 2JG9B 3T2QA 5FR6A 2ZGRA 3N20C 3IAQA 4Q4V1 3OGSA 4DXGA 1F5FA 1GLHA 3EC8A 1Z2MA 5J17A 2XVGA 3GE8C 2ICIA 5BMHA 4PQ9A 1W2OA 2X5IB 3NJYA 1HEZE 1NG0A 5C2TB 4CO7A 3GBGA 2BU9A 1AJOA 2P3IA 3ZFGB 4S0RA 3MFGA 2WDTB 1YEWA 2OUHA 1IS4A 4K7JA 2Q1ZB 1YIPA 3J7MA 4HONA 4WQMA 2V72A 1H6YA 1V6IA 4NAWA 4RR3C 2CGNA 4M00A 5L7OB 1PO11 3C8XA 3IDCB 3HUIA 2WO2A 1YWKA 1EO6A 5AUKA 4AQ7A 3VKNA 1PVC2 4GIVA 1WGHA 2PHUA 4LLOA 4XQWA 2HLEA 1SCRA 1PO21 3PO0A 3NV4A 1QU0A 5A6QA 2J52A 3VHTC 4DRVA 4GU2A 3QOPA 4C4VB 5DXDA 3PPAA 1FD6A 1A6CA 3V62A 1QOAA 2NTSA 2XN9C 4BM8A 1VRBA 2BBAA 1VMFA 1AW7A 3O12A 1YFUA 5FMDA 1ZUD2 2BZDA 4EN6B 3PLQA 1HZ5A 5IVBA 1JYNA 2QSDA 2TUNA 4GKYA 3Q69A 4NY0A 4XE9A 1ZBE3 1I1EA 2E53A 5JPNB 2WQZC 2R2QA 4Q0UA 5HCAA 2N9LA 3B0AA 4DXAB 1ODNA 3HPNA 1QWRA 3CNAA 5I0SA 3IVFA 3RI9A 2YBKA 5EJ1B 4QX2A 4YT0B 4FULA 3ZXEA 3BYYB 2GP3A 3SCFA 3KYCD 1PIV3 1JTZX 5DZEA 1KLGD 1V6EA 2YEPB 1AR71 1UY0A 2ZW1A 5F7UA 3NZUA 1AL23 3RZHA 2VRRB 4URTA 3ML8A 1FX5A 1ULOA 3WCRA 3KUDB 3OOXA 2B39A 1JMLA 1DGRA 5C4WC 1VBD1 2D3RA 2KHWB 3ZFEA 4KL1A 4ANWA 1FMD3 1ULDA 5F39A 4H3WA 4HK9A 5FZ3A 1V0AA 3AFGA 4FBJB 3ZVVA 2HYXA 2OW4A 2R0HA 4WVZA 4NPNA 3ETPA 1DG6A 3AB5A 3ZTDA 2BFUL 2D3BA 1BXHA 3T8MA 2VGDA 5BNNB 2JD9A 4E4SA 1QKZA 4JWSC 1D4M2 1BEV1 1XB9A 1J1LA 2CHZA 4P14A 1Q1OA 4CEYC 1OHFA 2GDFA 4RR3A 2XVLA 3T3NA 4YVWC 2G4DB 4BKSD 1AF9A 2J1VA 1XXGA 4FXKB 4COUA 1ULFA 3K77A 4E9KA 3MIEA 1V80A 3PUIA 1W6OB 4RN5A 2ORXA 2EVXA 2VTFA 5FYSA 1FI2A 3PJQA 1HXS1 5FZMA 5BNPC 4YW3A 5HCFA 2YBSA 4ZY9A 3TEXA 2CHWA 1WGYA 2FE8A 2XWJB 4O7XA 3GBWA 3VAWA 1E5HA 5FK8A 5C8CA 1OPMA 1YLLA 1C1FA 2EXJA 1VD2A 2CJNA 2N7JA 5J3UA 1J59A 5I93A 3L0WB 5AZGA 1OFSA 1ZRFA 4OZXA 2M19A 3ACHA 2H88B 4LTUA 2ZS6B 5J2RA 4BE3A 5FUPA 3E56A 4AVCA 1VB2A 4I30A 3MIFA 5FV3A 5H9PA 2SAKA 3VDAA 1BEV2 1IHMA 3NQHA 4QKFA 2EMTA 2ET1A 1GWMA 5A1FA 4IEXA 2Z42A 3H7YA 1WXSA 4KIKB 1OBNA 3CDZB 5A3NA 4KMQA 3MTNB 4U2AA 2F6BA 5E6PA 2JE9A 5FK7A 2ZHNA 1RUOA 5FZLA 4LLGM 4NR1A 2LVOA 2V73A 5L73A 3OAWA 3HQXA 1W6QA 5BYRA 1PO12 5IOIA 3A22A 4B4PA 1J58A 1US2A 3DEMA 5GJ6A 3UK9A 3BTYA 4I02A 3IHPC 3ZXJA 1DOIA 2N9XA 1LGBA 5DG2A 1NE4A 5E88A 3KLSX 4HBNA 4CU7A 3ZNID 2BVCA 3I2KA 4ZDVA 4Y1XA 2WUHA 5AUIA 3SHQA 1O5LA 3I2FA 4JPSA 1QOOA 4Q8KA 2EAAA 1V1OA 1WLTA 3TNPB 2BB5A 3OGVA 2EAKA 4DFSA 4F1SA 1DIWA 4P1BC 1Z5SB 3DPDA 1RUF1 5FQ0B 2RS51 2CDPA 1S4CA 1QY4A 2WZPP 4RFBA 4QB2A 4IE5A 3ON7A 5T54A 5FZ9A 4P5YA 3WW4A 2HYKA 3I3BA 2HWD1 1L0YB 2WBKA 1XF5L 1PDXA 1DU3D 3KGZA 4KDIC 3QCWA 4DK5A 3CU7A 4KZCA 1GP6A 4Q4W2 5DPNA 2LD9A 3THTA 4FOQA 1UYPA 4OZCA 1P3QU 5JZGA 3VRAB 5FMOS 4LR4A 2ADDA 2DENB 1NLQA 4CU6A 2KAJA 2IGGA 5AZHA 3VBSB 2RJLA 2QEJC 4HLEA 2MEKA 2PJHA 4NAMA 3BGAA 5E6JA 5FPXA 4NJ4A 5H9RA 3RYPA 3S57A 4XJUA 3MIBA 2IVIB 4NQLB 4QHZA 1AR82 1FXIA 5LLIA 1B1ZA 5C9AB 4HVBA 1L6VA 4USAA 3JSVA 4YW6A 2GOWA 3ZN6B 4AF9A 1EM7A 5JXVA 2YPDA 4FCAA 4AEJA 1RM6C 5FFOC 2PAEA 1JUIA 2E7TA 3WF3A 4HETA 1OURA 4JLCA 3X0WA 2B4KA 4AFAA 2KTFA 1J3RA 2W95A 4M02A 3S30A 4EN7B 2F4PA 3K9PB 4FADA 1TNRA 1XD3B 2ZEQA 1CAVB 2BGOA 3Q3NC 2YYOA 3UJQA 2XJQA 3T3YA 4I0AA 4W50A 4BB3A 3LSEA 1OLMA 1VBD3 3S7IA 3UIOB 2IFRA 4EYUA 2R61A 2MRPA 4LTAA 2K9ZA 4LE4A 1UO9A 2UYAA 1BQPA 3HVDA 2ZW0A 4IEVA 3B9CA 3VZMA 2Y6GA 4AQSA 5FXZA 1TZOA 1T6BX 1WZXA 3ITQA 2NPIA 3JB8A 3LKJA 4GWJA 2NPTB 2PAMA 2YMZA 5IP4D 1T6GC 1YRZA 2LEKA 4A3ZA 3VZOA 4D7TA 5CIRA 4BLIA 1EPZA 3UF8A 1IPKA 4OQ9A 4BLJA 5JSRA 3OWEB 3H8UA 3A9KB 2E7AA 4YGBA 2WZR1 4YGCA 2WS3B 1LM8B 5FK9C 1OSGA 1D0HA 5FYBA 1G86A 2FZ2A 2VO5A 3GXUA 4A44A 4K3BA 4QB6A 4DXRA 3A1QA 3GDBA 4JRAA 3U0ZA 3KCXA 2MX2A 2WZR2 3FKYA 2CSGA 5C5TA 4XDOA 5EZWA 5ANQA 2GBNA 4MJSB 2AC1A 2R1BA 4HKOA 3IDAA 2OZJA 4LBNA 4NE9A 3Q9OA 2X38A 4PYZA 1OQ1A 4PT6A 4CCJA 2MWSB 5A3MA 3PRPB 3UL2A 4QGNA 2HTME 2XBO2 4AWJA 5C7GA 1ENSA 4LO8A 3MP9A 1V00A 4X8NA 3ZO5B 2VQUA 1JWSD 4GMP3 3FFZA 2WLBA 4DIQA 1J1TA 5IATA 1KRIA 1AL0G 1LECA 2RR11 4IOIE 1TMF3 3WXPA 1YQCA 2DVFA 1QKQA 4CCEA 5FZ7A 1PO13 1U5ZA 1M06G 5L36A 1AHSA 1WD4A 1ZBA1 2IO2B 5A7NA 2JU6X 3VL9A 1VAVA