4M01A

N terminal fragment(residues 245-575) of binding region of srap
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
321
structure length
321
Chain Sequence
AVTANTITVNKDNLKQYMTTSGNATYDQSTGIVTLTQDAYSQKGAITLGTRIDSNKSFHFSGKVNLGNKYEGHGNGGDGIGFAFSPGVLGETGLNGAAVGIGGLSNAFGFKLDTYHNTSKPNSAAKANADPSNVAGGGAFGAFVTTDSYGVATTYTSSSTADNAAKLNVQPTNNTFQDFDINYNGDTKVMTVKYAGQTWTRNISDWIAKSGTTNFSLSMTASTGGATNLQQVQFGTFEYTESAVTQVRYVDVTTGKDIIPPKTYSGNVDQVVTIDNQQSALTAKGYNYTSVDSSYASTYNDTNKTVKMTNAGQSVTYYFTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine-rich adhesin for platelets
publication title Structural Insights into SraP-Mediated Staphylococcus aureus Adhesion to Host Cells
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
total genus 92
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18483 Bact_lectin Bacterial lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4m01A01
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 4m01A02
1ULDA 2D7FA 5HCBA 3B9CA 3VKFC 1LGBA 3AYDA 5GLTA 3BIWE 2A75A 1BQPA 1CQ9A 3NWKA 4GALA 4UW3A 2C5DA 3WDYA 2EXHA 2A6XA 3V0BB 2DUOA 1G9BA 1MS4A 3OY8A 4XMIA 1G9DA 4FPJA 1AJKA 4Q8LA 2E6VA 1WW5A 3FLRA 5T5OA 1LEMA 3NV3A 1VLNA 2C9AA 2DV9A 1UZZA 1HDKA 2GNMA 4Q26A 4YGEA 5GALA 4M02A 1HQLA 3AXDA 5DZEA 4ZXKA 5KXDA 1G9FA 5CAZA 3WDVA 3NV4A 4YW1A 3AFKA 4NO4A 1BJQA 4FPYA 1MZ5A 2GMMA 3MW2A 2GNBA 3POWA 4M01A 1ULFA 2AGSA 3H0OA 1WBLA 3OBRA 1AX1A 3IN9A 2WKKA 3MPPG 1FATA 1JN2P 1W6PB 5E88A 2W08A 1D2SA 3OYWA 2CNAA 2DU1A 1MVEA 2JKBA 5KXCA 1V6MA 4YLZA 3KM5A 3SISA 1B09A 3AYCA 3O12A 1DYPA 1N3QA 3WHUA 1VAVA 2VY0A 4U36A 1I3HA 1JUIA 3V65A 3WG2A 3WG4A 4YW5A 3ZVXA 1MR5A 4AGGA 2ZGMA 3M1HA 3M3CA 1KITA 1YXWA 4MYEA 4WVWA 3RG0A 4ZKTB 2A6ZA 2A6YA 1SBEA 3HMYA 2WSUA 1IS4A 2ZKNA 1S0GA 4UW4A 1QKQA 1NLSA 1JHNA 4LBNA 3V0BA 1FNYA 5DUVA 5EWSA 1MS9A 1MS3A 3N3HA 3WCSA 5IK7A 1LU2A 1VALA 2CWSA 1V6LA 2W39A 1BYHA 2WT0A 4PBOA 3FLTA 4Y24A 4C1XA 1UAIA 2UWAA 4FPFA 4FPCA 4XOGA 3B00A 1WCSA 4FOQA 4BLJA 3WDXA 3N7JA 1G86A 1V6IA 2RHPA 3PVEA 5JOYA 4XJZA 2D6NA 4Y1ZA 4ISQA 3ZYRA 1ULGA 2D6KA 2AR6A 2B7YA 5T54A 3JU9A 5DUWA 1MACA 2FHRA 3U4XA 5GZEA 1QDCA 1YYNA 2DWRA 4AVVA 1RIRA 2NP0A 2P3JA 3IPVA 4LBOA 4H55A 3WG1A 1W6MB 2WT1A 2EIGA 3IMNA 3AP5A 2JJ6A 1N1YA 1QOSA 3WDUA 4XJWA 3ZXKA 1GLHA 2PELA 3USUB 2EXKA 2NMOA 2G4IA 1C4RA 2ZGOA 4FQ4A 3L2YA 2A3YA 1LHNA 4XZPA 3HN1A 1Q8OA 3ZSLA 1LU1A 1Q8SA 3MW3A 4RL7A 3VV1A 1HKDA 3GNEA 3OYWB 1Z0HA 1CESA 3SH5A 1AJOA 1N1SA 2AH2A 1UN1A 1W6NB 2NMNA 2A6VA 1ULCA 4GA9A 1LHOA 3AYEA 3SNMA 4YZ1A 2GNDA 5JLVA 2A71A 4LBJA 1WBFA 5E89A 1ENQA 1SACA 4R9BA 4DRRA 4ATFA 4Y20A 2A7AA 2JE9A 3POYA 4WVVA 5EYXA 1FX5A 4GXLA 2ZGSA 5JOZA 1DHKB 1S0CA 1UMZA 3A4UA 3CNAA 4YM3A 2SLIA 2V73A 1LOAA 3OPZA 1WW7A 1YIFA 1WW6A 2NM1A 4DPNA 3T1MA 4CTEA 3RRDA 1GICA 5DUXA 4LBQD 1DQ0A 1ONAA 1DQ1A 1CPMA 1W6PA 3IM0A 4FP3A 4ITCA 2D6OX 2VW2A 2XB6C 2BQPA 4Y22B 3ASIA 1N1VA 4PQ9A 3AP9A 3BOPA 1KJLA 1EPWA 4GKYA 5JMCA 4YZ3A 5GJ6A 4WZFA 2EF6A 5GM0A 2UU8A 1J1TA 2R0HA 1VIWB 3WDTA 2ZHMA 3O0VA 4P14A 1DIWA 3B01A 4FP2A 5DZFA 4YM1A 4Y1YA 1SLLA 4XILA 3OGGA 3T2TA 1N3OA 1SLTA 2ZA9A 3WNXA 2E53A 3PVOA 1DFQA 3FUOA 3ZSMA 1Q8PA 1SBFA 2UWCA 1FNZA 1H30A 3V64A 4Q1RA 2P3KA 5GLVA 3M3OA 4M3CB 1C57A 2GN7A 3VUOA 1AX2A 3GALA 3JUUA 2CYFA 1KQRA 2WT2A 5JOWA 3N36A 2ZGTA 4FVVA 4LBQB 3O0WA 1S0EA 5T5PA 1I1EA 1W6OB 1W0OA 1QOOA 4DRVA 1WD3A 4FPOB 1LOBA 4IQPA 4Y20B 2R0FA 1W6QB 3WCRA 1WW4A 3SH3A 5T52A 1W6MA 4XBQA 1SFYA 4AGVA 1DQ5A 3WLUA 3USUA 2WQZC 1OFSA 4CZSA 1JYIA 2A3WA 3B3QE 1W0PA 3WV6A 5JVVA 1MS8A 1LHVA 3MW4A 4YZ2A 1G9AA 1HQWA 1AVBA 1ENRA 1UX6A 2ZMKA 1SLBA 1QDOA 1ZA4A 2LALA 5GLZA 3VKOA 1W6NA 1DZQA 4YG6A 2YV8A 5KXBA 4FPEA 2KM2A 2DU0A 3WUDA 2AREA 4F83A 5L73A 2D43A 4ATEA 5GZCA 1AXYA 3ZSKA 1LESA 5CA6A 3V0AB 3TAYA 4NOTA 2ZACA 4FPLA 5IT6A 4BOWA 5HCAA 1PZ7A 1JYCA 1LEDA 1PZ9A 5T55A 5T50A 2ZABA 2Q5TA 1IS6A 1APNA 3DGTA 4PF5A 2VW1A 5CBLA 2AYHA 2AUYA 2E51A 1LJ7A 5H9PA 4BLIA 4JRAA 1AXKA 2GMEA 2CTVA 3MEPA 3ZXJA 1SLIA 1LGNA 4Y22A 4YM0A 2ZHLA 4P9WA 5FRAA 3ILRA 1KJRA 3ATGA 1GYKA 1IKPA 4KBBA 4XJAA 4C1WA 2GN3A 2VU9A 4YM2A 2VW0A 1V6NA 1CIWA 4XMAA 1D0HA 1GSLA 3RS6A 1S0BA 1ZM1A 1Q56A 2W52A 2ERFA 2PHUA 2UURA 3AX4A 3WHTA 4CRQA 5IK8A 1SCSA 1C1LA 1ULEA 3ENRA 5CB7A 2ZMLA 1MS5A 3HR9A 2DVBA 1CPNA 3APBA 4YZ5A 4Q2FA 2ZBJA 5F9TA 1QOTA 4W65A 2JD4A 5DG1A 2D6PA 2OW4A 4M3CA 1ENSA 4GKXA 5IUQA 4UW6A 1QU0A 1O4ZA 1OQ1A 3FUQA 4WV8A 4LBQA 4YW2A 2ZGKA 1W6OA 2YZ4A 4XXAA 3FLPA 5EYYA 4OZXA 3FBYA 4RA0A 2PHRA 2AENA 1RITA 1LULA 2JDZA 1BZWA 2NYYA 1LECA 2EXIA 3AP4A 1H9PA 1GZWB 1W6QA 5GZDA 3O0XA 4M00A 1V6JA 3POSA 5GLWA 1DLLA 3ZXFA 1LGCA 4DQAA 2CL2A 2ZGNA 2DUQA 1QF3A 2D3PA 1RINA 2I2SA 1DQ6A 3KQRA 1LOFC 3RMYA 2FMDA 1HLCA 1O4YA 1AF9A 4YG0A 1CVNA 5SV8A 5BYNA 3AZZA 4AVTA 3UK9A 5DXDA 1AX0A 3ZYPA 4XJ8A 3INAA 4HL0A 3UJQA 1Q8VA 1LCLA 3M2MA 2OVUA 1R1ZA 2GMPA 1G9CA 4U2AA 3O5SA 1N3PA 4LBMA 4YGCA 2ZHKA 4L8QA 2P34A 1KDKA 4AVSA 1WLCA 3LCPA 1F31A 3AK0A 5H9RA 4AGRA 3V0AA 3OJBA 3VKMA 4BQ1A 1FAYA 1LENA 1V00A 2A3XA 4K21A 1S0IA 3QLQA 4AYUA 1CJPA 3WDWA 1GV9A 2ZGUA 3B69A 4Y1XA 4DS0A 1QNWA 2VXRA 2E7QA 4BMBA 1KRIA 4XXPA 5FREA 1V6OA 1Y7BA 4TZDA 3AXEA 3NV2A 1GKBA 2R49A 3I4IA 3IKWA 4XTPA 2DVAA 3D6EA 4P9XA 3PVNA 1LODA 4JCKA 4PBPA 2KYWA 4ASMB 4P9YA 2ZGLA 1NXD1 4AWDA 2P2KA 1DBNA 1UKGA 2D6LX 3N35A 4YGBA 2YY1A 5DG2A 3UL2A 4R9DA 4YW3A 1DQ4A 4Q27A 3QCWA 2P3IA 2EXJA 3AP7A 1DQ2A 1Q8QA 4K1YA 1GBGA 2D6MA 3WOGA 2R1DA 4UW5A 1URXA 5HCFA 2VH9A 2ES3A 4FOYA 2D44A 3A0NA 5H9QA 2EAKA 4LBLA 2EALA 2ENRA 1X50A 1UL9A 1JOJA 3N7MA 2A70A 2SBAA 2ZMNA 2V5YA 1GNZA 1C1FA 2W68A 3AYAA 5GZFA 2UWBA 1S1AA 1XQNA 3AZYA 4LBKA 1GZWA 1CN1A 5IK4A 5LK5A 1IS3A 1DYKA 1H9WA 3AZXA 3N7KA 4BPZA 1SCRA 3ZPYA 1YO8A 3AJYA 5CNAA 3WVJA 1LOGA 1A3KA 1LHWA 3ZSJA 3D5OA 5KXEA 1VAMA 2PHWA 1FYUA 1A78A 2HYKA 3AJZA 1LTEA 1S0FA 1BXHA 2DYCA 4XBNA 4XDQA 1JBCA 3SLIA 3ZXEA 1QNYA 5IK5A 4K20A 1G7YA 3NV1A 2GNTA 3SITA 2ZAAA 2YROA 3D4KA 3VKNA 1SLCA 2GALA 2NN8A 4XBLA 5GZGA 3LSDA 1N47A 1FV2A 2A5ZA 4JC1A 3R4UA 1PZ8A 2PHTA 5T5JA 4FQZA 3ZXLA 2WLQA 1GNHA 1V6KA 1WD4A 2XG3A 1AZDA 1MS0A 4SLIA 1OKQA 3AP6A 4YFZA 1N1TA 4M3CE 2JECA 3I8TA 2DUPA 2WJSA 5F5QA 3W58A 3N7LA 2DVFA 2TEPA 2D3RA 3RSJA 3A0KA 5E8AA 5EXOA 4FPGA 2WNEA 1SLAA 2ZGRA 1JXNA 4YZ4A 3BTAA 3R4SA 2H0BA 4Y1UA 3OY8B 1LOEA 1SBDA 4YFWA 4FOWA 4XE9A 4BM8A 4M3CF 3AZWA 2R1BA 3SH4A 1YRZA 1LHUA 3OBTA 5GLUA 2CWMA 2ZHNA 5AVAA 2PHXA 3M3EA 1DGLA 2P37A 2ZGPA 2ZZJA 4R9CA 4ISRA 4TYSA 4XJ9A 1YI7A 5T5LA 4PCRA 1F9KA 2WSVA 3BODA 4XIKA 2DTWA 1KDMA 3UJOA 5JOXA 4XIOA 1G8WA 1S0JA 1BKZA 3WG3A 2PHFA 4FPKA 4HANA 2ARBA 1GANA 1CR7A 2ZGQA 3TB0A 2OUJA 2YXSA 3ILFA 1CONA 3WUCA 1A8DA 2NZ9A 3DUIA 3PMEA 2KVZA 2ARXA 4Z8BA 2DVGA 3Q9OA 2D3SA 3M3QA 4GWMA 4GWNA 1GZCA 1WUVA 4K1ZA 2JE7A 2VUAA 3R05A 1WLDA 4Y26A 1GZ9A 2E7TA 3C2UA 1FV3A 4FOVA 1QMJA 4BMEA 1IOAA 4Y1VA 2OUHA 2LTNA 4YG3A 3VKLA 1F5FA 1TEIA 4YW4A 2Z42A 1Z78A 5JDBA 5H9SA 4R9AA 4Q8KA 2A6WA 4D69A 2DVDA 1MS1A 1IS5A 2YMZA 2R16A 3W59A 3AZVA 3RMXA 4XJUA 1MVQA 1U0AA 5DUUA 2DURA 4YGDA 3T1LA 3RQ0A 3ILNA 2CY6A 3FFZA 1JW6A 2KT7A 1AXZA 1QGLA 4XHBA 1IKQA 4XHXA 1LOFA 4DFSA 1UZYA 1WLWA 4I30A 2GDFA 4XYXA 1MZ6A 4XTMA 1S0DA 1LOCA 3IPVB 1UPSA 4Q1PA 2DTYA 3LSEA 5DZGA 3WZ1A 3PJQA 4FPHA
chains in the Genus database with same CATH superfamily
4XF3A 3OLMD 2D7FA 1BQPA 5IVFA 3N9YC 5JZGA 1WXQA 2EICA 2OS2A 4EZHA 1AJKA 4D7SA 3LEIA 1RC6A 4QX0A 3M8LA 3FE5A 2J1VA 1UNBA 1S2KA 4W6WA 1PM7A 1T0SC 1JZ4A 2AGSA 3POEA 2Y6HA 1V80A 1YHFA 1D4M2 2YDEA 5BMHA 1XSRA 5FZCA 1K52A 2ZX1A 2IO2B 2ZW0A 4YW5A 4RNAA 2V09A 2XMLA 3KB5A 5EWSA 4YPJA 1MS9A 3N3HA 1EWYC 3WCSA 2OEDA 5EJ1B 1VMHA 3FLTA 4NHYA 3N7JA 3BYWA 1B1ZA 2D6KA 3WXPA 2AR6A 3C8XA 5DUWA 2FHRA 5FZOB 1RIRA 2NP0A 3O1RA 1JMUB 2D5GA 2AQ1B 5CKNA 5LBFA 2PMVA 3GZTB 2VBDA 4OVZA 1SE2A 3PRZA 3JB8A 2BGPA 3SNMA 1LHOA 4D3WA 4MLOA 2A71A 1SJHD 3P63A 4AEDC 2DZJA 3GJAA 3KWLA 3KT4A 4L2NA 1I4GA 1NVID 2VPVA 3H8OA 3NAPC 5A1AA 3RYTA 2BGCA 2D6OX 5F3CA 3BPSA 3ZFEB 1ND2C 1VRH2 5JXGA 4GKYA 4QKBA 4QPGC 1AYM3 4OHXA 1FXTB 4AXOA 2KNBA 2ZEWA 1JODA 3MIFA 4HK2A 3ZTCA 1RUF3 1TYGB 1D5XC 1HV0A 1PHMA 2GU9A 2VNRA 5FXVA 3CZJA 3NRZA 1JI6A 2KN4A 4B9KA 2CYFA 1RXGA 5C4WA 2X5IC 2NR2A 2P5BA 3Q8CA 4AGVA 4CPBA 1BMV1 3USUA 4HKLA 4C4VA 5FLJA 5IO9A 3WQ1A 2A3WA 2BYFA 1EUTA 1JU3A 1VBA2 2JDYA 4IEWA 1GP4A 2P6HA 3LA3A 1F77A 1R4NI 4CCDA 2YU1A 2QKDA 1R1A2 4GZ9A 4HLTA 3DGTA 2JDHA 4ZRKA 2D40A 3MEPA 4KWUA 3KQ4A 1WJ4A 3AEEB 4NE9A 1T6GC 3D0SA 2PHUA 3WNOA 3O14A 4GB32 1SEFA 4AI2A 4WJOA 5BXXA 4Q2FA 4XFBA 2VGDA 2TNFA 4X57B 2FZ1A 4KKIA 2EIEA 4YW2A 1SF0A 1H8TC 1OI6A 1EPZA 1KLGD 4CO7A 2JIGA 1DLLA 3J8F1 3AM9A 2J0MA 4MX3A 4XF9A 1UU5A 4DY3A 2QZ2A 3KGLA 1AX0A 1D6EC 1LRHA 1YN3A 2EKEC 2VE1A 2GMPA 2XJSA 2WBKA 2ZHKA 1ZUD2 3KV4A 4XACA 3K4AA 3OJBA 3VKMA 1QY4A 2K9XA 4D8MA 4YTNB 5GMVA 2B9UA 2AL6A 2ZJDA 4YSXB 3ZFGC 4BMBA 2OOBB 4PDWA 1Y7BA 2JX9A 4B1LA 2R49A 3I2OA 5AFEA 1IHMA 2UU7A 4YGBA 4NHXA 4J1WA 5FYZA 1DQ2A 2LGIA 3URFA 3ML9A 2VOTA 4UFKA 3NVCA 3U4EG 2E9QA 3DBHB 4GH4A 1I42A 3L17A 4JE3B 1AR81 5FZ4A 2YC4A 4HPKA 4RGGA 3ZSEA 2D5FA 4ANUA 3BYYB 4META 4IV1C 1XE8A 4K7SA 3PUQA 5A70A 5FZ6A 5BNNA 4K40A 4QX1A 2WNVB 3MV01 2VRRB 4M3CE 4HKZE 4IDZA 3W58A 3GCWA 1YQ6A 1W28A 5F5IA 5E6HA 1KTKA 2VM9A 1W8NA 1FPN2 1XLQA 1YJJA 4KKJA 3Q2AC 4NIIA 4TYSA 4XJ9A 2EAAA 2HWF1 4PCRA 4XIKA 2JG8A 4INDA 3X23A 3ZXDA 2OUJA 2YXSA 4MELA 3POJA 2L83A 3VRBB 3KVFB 2VCCA 1JOPA 3VDBA 1W9YA 4I0WB 2FDIA 4TSVA 1UXXX 3RZGA 2VZUA 2LTNA 1IZ3A 1NLRA 1TKYA 4R9AA 1DGRN 2BEOA 4AFDA 2KTRA 3ZYFA 2MNGA 3FN9A 4XHBA 2B45X 3OG2A 1RUD3 1S0DA 4FBFA 4QMAA 4FADA 4UFIA 4MM3A 4W9GA 1VBE1 4GALA 1OMIA 1HRI2 2EXHA 2A6XA 1G9DA 3LQCA 2QMTA 4JDNA 1LGRA 2MWSB 3AVRA 3Q8FA 4NO4A 1BJQA 2XQRA 3B5LB 3IIIA 4GMP0 2WP9B 2GNBA 4YNIA 1VBB1 3ZFEC 1VBD1 2OZ6A 3EBRA 1JUIA 1OLME 2XLGA 4CEYC 4DNYA 4JKLA 3JW0X 4WVWA 3OD0A 4ZKTB 4YT0B 2A6ZA 2DCYA 5HHDG 2R2OA 3QWZB 3MFCA 1OT5A 4AUQC 3VHPA 3J9CA 1EWCA 2W1QA 4FPCA 5FYHA 3HAGA 2RHPA 5JOYA 3MLJA 4GB9A 2OXBA 3OUHA 4EFOA 4IERA 1WH3A 1UW8A 1FCLA 4W9JA 2Q5WD 2WS92 2R61A 2BOJA 4ZZ5A 1C4RA 2W0XA 3WINE 2QSDA 1AR83 2J42A 1HKDA 3V0BA 5LRSA 4YTPB 2B4KA 5JLVA 5K0UB 1CQVA 1SACA 3V60A 3Q3MC 2LM3A 1FX5A 4GXLA 1XRUA 1BCXA 1W9SA 4P9LA 1DGWA 5D8AB 4DPNA 3T1MA 1AARA 2DFBA 3MF6A 1W6PA 3L08A 1FO4A 2BQPA 4AAPA 1UIKA 1GUIA 4LDTD 4GSWA 1OVPA 3OUIA 2C9WB 4RM8A 4HCPB 4LNVA 2CHHA 4NIGA 4P9JA 3WDTA 3BOWA 2VH1A 1VRAB 3UGGA 2L8JA 2WLBA 4L11A 1KFXL 5GLVA 2RM23 2VVDA 5DPTA 5FO9B 2ZNVB 1HV1A 1HQRD 1LOBA 1ZGUB 2VCAA 4FXGB 4XBQA 2AEHA 2A5UA 4CZSA 1W0PA 3WNMA 4KI5M 4KWLA 2ARAA 1REDA 2CU5A 2AREA 4F83A 3WNKA 2R041 1PGL2 2PFWA 1COV1 3URYA 2ID4A 1YN5A 2LJ5A 1APNA 3NVZA 3EHKA 1ZVFA 1C4AA 2BNNA 1ZRCA 5DPRA 4AL9A 1C76A 4C8DA 3GJBA 2I1JA 4I0AA 4KBBA 2GN3A 3A1QB 2JDKA 3GHMA 3B9JA 2C6SA 3I3TB 2VQUA 4FJZA 1VBD3 2BS3B 2ZXQA 2BJSA 1O3QA 2BOIA 1W6OA 2BS4B 5EYYA 5JI7A 4IGPA 5IVYA 4AI1A 1QQP2 4BK5A 2DUQA 1UU4A 2JDMA 4RF1A 3CIHA 2GLSA 3OUJA 2W9XA 5KHHA 4LHKA 4C00A 1X8EA 3J7HA 3NW4A 5FMDA 5LA9A 4LBMA 3P42A 5AZFA 3TJPA 4CEWA 1DF0A 1L4ZB 3DCGA 3AK0A 4AGRA 1F2NA 4XFCA 1NT0A 1ZRIA 2BWFA 3NJTA 4URKA 1AR71 4ZRIA 5L7OA 3O1MA 2MBQA 4P9XA 5FY7A 5FK7A 2KYWA 2XLAA 3PZDA 2N7EA 4AI9A 5L9RA 5A1LA 3AU4A 3ALBA 4AVCA 2GI9A 1Q8QA 3G6JB 1X7NA 3AL5A 4M0HA 5FYSA 5B4XA 3OGVA 3ZN6A 4OI0A 5F7UA 1WM2A 2SBAA 2YC0A 2ZMNA 5I8SA 5AZGA 1WGPA 3EQEA 4DXRA 3TBDA 2C24A 3HQUA 3S6PA 4XWTA 4OQ9A 3TUOA 1IUEA 3AJYA 3ACIA 5KXEA 3ZYYX 1VAMA 2PHWA 4QPIA 3NV1A 1M4WA 2VMHA 5FY1A 5I0UA 2MBBB 3EGRA 1GNHA 4D94A 3DBHI 1L0YB 1WXAA 2BNMA 5EJZB 3R4SA 2H0BA 5C6CA 4AHYA 1W2TA 4HXCA 1LHUA 2YEPF 2ZZJA 3BODA 1V0AA 4QX5A 2K9ZA 2R043 3ILFA 4LJPB 2Y0OA 1WMXA 2KVZA 2ARXA 3T0BA 2YUEA 2XN9C 1HE8A 2H6CA 4A3OA 5MPOA 4MACA 1IOAA 1W8ZA 3VKLA 5FQ0B 2CR5A 1YJ1A 4FFGA 5CEHA 2BDRA 2LASA 5DUUA 1WGDA 4X6RB 3LIGA 4XZ4A 1Y9GA 2KT7A 4D2KA 2IFWA 3H3UA 3PIJA 4N8MA 3HT1A 3LSEA 4FPHA 3QBQA 1Y4WA 5I4DA 2XL7A 3AYDA 1HX6A 5K0UC 2FUG1 2MHJA 4XMIA 5HG2A 2RJ2A 2K6QA 2HJ8A 5ACA1 3UQAA 4LKEA 3S30A 2JU6X 2MLBA 2WXJA 3PL0A 4K3BA 5D8AC 1G9FA 1RJ8A 1RUJ2 1O8SA 3OBRA 4JX1C 2DU1A 3ZN5A 4YLZA 3HOBA 1NCQC 3OF1A 1CZSA 4IEUA 4O65A 2ZGMA 1AR73 4MOAA 4MYEA 1REFA 2RR12 2LRWA 2BRTA 4WWNA 4IEOA 4Y24A 5JSPA 1XT9B 2ZNVC 1OOPB 1WCSA 4RYDA 1MZEA 3TN92 1ULGA 5FYIA 2KFJA 4URTA 3KYCD 1RUNA 4LJOB 2DWQA 3HQRA 1IP9A 5J18A 4OVUA 2H0VA 4WJNA 3BN6A 4FSJA 3HN1A 1Q8OA 1A5RA 4RL7A 2KDFB 3NNGA 4COVA 3SFDB 4BHPA 1LB2A 3ZJTA 2MJDA 1UU6A 5IAXA 2B8MA 4IOIE 3LDKA 2LVOA 5EYXA 5JOZA 3ZMNA 1CAVA 5A3TA 1NCRA 3LE0A 2PHDA 4RGAA 3SCGA 4WZFA 1QJX1 3P5BA 3FFQA 3BTXA 3IBEA 1TNFA 1SBFA 2UWCA 2VUCA 1YEWA 3PRPB 1AYN2 1Y9MA 1QIQA 2HJIA 2WNMA 3I2IA 2MSED 2AQ2B 2CDPA 2M0AA 1SDDB 1JHJA 2LMCA 2UWQA 2I38A 2Y60A 1W6MA 3A33B 3C3VA 4BWOA 4EZLA 2WO2A 3QAQA 3B3QE 1MEC2 2JKXA 3DQVA 1HQWA 1XYOA 1U5ZA 3NMBA 1SLBA 1PX4A 4KGGA 5GLZA 2CV6A 1C8NA 2CAVA 3U4SA 4OZAA 2Y6KA 3GE3C 1DOIA 5EJ3A 1W9WA 3T3YA 2KFKB 1BEV1 3DWGC 5T55A 4LO6B 5C71A 1RUH2 2MH7A 3J4UH 4WWPA 4XFAA 3PSEB 2DYBA 1H6XA 2AZ5A 3RZZA 3VBOA 2OQ6A 3MYXA 4W9LA 2DENB 3JYUA 1SIJA 3O1SA 4US9A 4MEMA 2GC3A 3FJSA 2JD4A 1MG4A 3E9SA 5I0TA 5FZBA 5CFCB 3NS1A 2VMDA 1IPJA 3N32A 3E6CC 5AVPA 3MC9A 1BZWA 1WCUA 4FXKB 5EDSA 3O0XA 1UWWA 4YSFA 1LGCA 4ANXA 4BBNF 1F0ZA 4RHV1 3R4DB 1I4RA 1T5XD 5C3SA 5G5HA 3J7MA 2L0FA 1DP0A 5J1XA 2WWUA 4GWIA 2XJVA 1D0GA 1V00A 3VDCA 2Q0AA 4DB5A 2FZ2A 2XWBB 2LRUA 2JB4A 3OBZA 3PV1A 2VXRA 4HONA 2WAOA 4X8NA 2VAUA 4ZYSA 2BBAA 4PT6A 2E33A 1VLBA 5FYTA 1WSPA 3UL2A 3RN9C 2J4XA 3VTWA 4IESA 1GBGA 4ZDVA 4PLNA 3J7LA 4FOYA 3Q8AA 1JZ5A 1GPXA 1RHI2 2GZWA 5FZ1A 1S1AA 3U11A 2Y38A 1H9WA 2INCC 3ZSJA 1A3KA 1LHWA 3D5OA 3POBA 3AJZA 2OQ7A 2LD9A 4K20A 4L1BA 5EIYB 4GQ7A 1QJY1 2W3SA 5FR6A 2Z8LA 4XUNA 4GIVA 2PMWB 2N7GA 1RMU1 4IW3A 3IT6B 5FYCA 5FYMA 4FPGA 2J7QB 4Y1UA 5CADA 1HB1A 5EE1A 5FZDA 1E5WA 2WXPA 1RFAA 5A7WB 4M0WA 4A55A 1EO6A 1BEV3 4Q5OA 3ZKYA 2KLGA 4Z8BA 5DDJ2 2KJ6A 5AUKA 4S2GA 2VUAA 2PVOD 5TSWA 3W9CB 3AE2B 3VFKA 5A1FA 2OPKA 3AULA 2MJEA 3VB9A 4ACFA 2A6WA 2L32A 1OOPC 1IS5A 2R32A 2N9LA 3J7NA 2YMZA 3TEYA 3KCCA 3DECA 4QDRA 3X0WA 2PTMA 2RD0A 5F3GA 3ZDMC 2LJIA 3NAPA 3M95A 2J53A 1TMF1 1PIV2 4ARXA 2MW5A 2DBYA 1ND2A 4J25A 1ULDA 3POGA 2REXA 3B9CA 4QB2A 2ORZA 5BY5A 4PS3A 1UY3A 1H2MA 4LJHA 3Q8EA 4PS8A 5A7PA 5FP7A 4Z92B 1AN8A 1AR91 2LROA 4QD2A 3MZHA 1DGJA 4XGAB 2X05A 1FATA 1JN2P 1OA2A 1Q1OA 1WR1A 1I3HA 4AW7A 5C7GA 1X82A 5FTTC 4CP9B 4MXWA 3AE3B 4M0NA 4IV3C 1C8M2 2M4NA 1FNYA 4ZU4A 5J37A 1WY8A 5A33A 3WDXA 3AKQA 2QBXA 1R093 4AVVA 3AE9B 3H7YA 2KX0A 1CMXB 3GDBA 3WG1A 4CDQC 4N58A 4RFBA 1EAH2 2N4FA 3H1UA 1PO22 4FAHA 4EWAA 5DAPA 2XJQA 2PLV3 1AW7A 4C0HA 3HVDA 1TY2A 2WNOA 2FBWB 4QM9A 4EZJA 1QJY3 4XEZA 2EA7A 4KH9A 4I02A 3RRDA 4HROA 1TS4A 1GWKA 1RMU3 4QXKA 3BVGA 3ASIA 1N1VA 2XVLA 4XABA 4OUMA 2DYOA 1JYXA 2VNGA 5K4LA 2WXHA 3B01A 1DYOA 1F1HA 1UX7A 1UD1A 3USSA 4MGIE 4NWWA 4Q29A 2VQTA 4IM2A 3MP9A 2WT2A 2OIIA 2TBVA 2K39A 2H89B 1F4AA 1C3HA 3BK1A 1IG3A 1VRH1 4NJ6A 1Z7S2 4QKNA 4KSLC 1N62A 1F15A 1ZA4A 4WM7B 2X09A 2ASQA 5KXBA 3POIA 2WXNA 2DU0A 1OLQA 2KA3A 3ZXGA 3IWZA 1NDDA 3I2GA 4BKGA 1RRBA 5IT6A 3EC8A 4RH6A 3P6BA 3H42B 4NMIA 5EP9A 3A7QA 2D3AA 2P3YA 3WNLA 2IY1B 5H9PA 3ZXJA 4EN8B 2FAZA 3ATGA 1VBA1 3MDPA 4CQNA 2WO7A 1CIWA 5M0TA 3PLUA 1GSLA 2D2QA 1D4VB 2GBRA 2W52A 5IK8A 1AR93 4YW7A 4YZ5A 5F9TA 1N6ZA 4OVVA 2XKPA 5J09A 2RG4A 3FUQA 3OJ4B 2XUEA 4WV8A 4XETA 2YZ4A 4OZXA 3FBYA 4N9HA 4TLFA 1LECA 1H9PA 2YG0A 1W6QA 3WAPA 3KVAA 5KHJA 5CU1A 4FTEA 1K45A 1WZXA 3MHZA 4GB31 2KKCA 2NBWB 3M62B 1SMVA 3M70A 2KWUB 1JYNA 2SAKA 2J1SA 2IGGA 1SXTA 5C70A 1H4RA 1FAYA 4COWA 5KC5A 1H6YA 2VZ3A 3H3LA 2B76B 1ZBA1 4XTPA 3S5AA 3LKJA 4W6XA 2FDJA 3UYJA 3WT3A 4RR3C 1K5MB 2QEJC 4TV3A 1HZ6A 4LK0M 5I0DA 4DHZB 4CDXB 4F3JA 2D44A 3A0NA 3KCXA 3BPZA 2WDRB 4B0EA 2O1QA 1J83A 5A7WA 4A3PA 3AMNA 5LK5A 3ZPYA 4V2VA 1YO8A 2VULA 1LOGA 3DDCB 1JZ6A 1A78A 5B2GB 2VVEA 4XDQA 1P98A 1HA5A 2ZX4A 1ND3A 4CU6A 4W9DA 1PZ8A 5CKMA 1P7FA 4P00B 2WLQA 3I59A 4AOCA 1OKQA 4YFZA 2O6VB 1VRH3 4QX2A 4CEYA 3W5UB 2O0OA 1JXNA 2WZPP 1SBDA 4YFWA 4XE9A 1WKYA 1TKEA 4ARYA 2DDUA 2R1BA 1NAEA 3FHQA 5I8YA 1LXDA 1PMHX 3OEBA 3WG3A 1QOFA 4QPWA 3O1OA 1VB2A 4C0BA 4LT5A 1A8DA 2NZ9A 4JGYB 3DUIA 5JHAA 2W3JA 1RWSA 3M3QA 4LNFA 2E7TA 3BU7A 1QMJA 4Y1VA 1S3SG 4CXYA 4RQPA 2Z42A 1QEXA 1FPN1 4AVBA 5H9SA 1TS2A 4MGYE 4FA6A 1VBA3 1UOJA 2LS6A 4P9IA 3ITQA 3FL7A 2QILA 2NQYA 1R1A3 4JQTA 1UPSA 2VQAA 4I6NB 1NZIA 4YSZB 3WP6A 5FWEA 2WR9A 1LFDA 4HXDA 2BYVE 4L92A 1VE0A 4COZA 4EN6B 2PEAA 4GB33 4N53A 3UKNA 4KWKA 4A7YA 4LO8A 1XE0A 2GMMA 3AXCA 1ZRRA 1QJEA 1DGRA 2FE8A 2F4PA 4AP4C 5CFDC 3ZN4A 4RS5B 3NSTA 2JKBA 2VMCA 3WHUA 2FUHB 4O1NA 4OUEA 2WU2B 4UF0B 5LBEA 1ZBA3 2AL3A 3WAMA 1UWXA 2DAFA 1W8TA 4L23A 3VBHA 4C91A 4RN5A 4NRPA 3DYMA 4XE0A 2Y8KA 1A70A 1EYBA 3A4RA 1OQYA 5FPAA 3CSFA 2GH8A 1CZVA 1E5SA 2WN3A 4FFHA 3QK0A 3FILA 2ZGOA 4WM7C 4AI0A 1OA4A 2K8CA 1ENFA 2ETEA 3TIXA 2WIIB 2AEYA 4R9BA 5A6QA 1UIJA 1JWAD 1REEA 2HJ1A 3A9KB 5C8CC 2X29A 4WVVA 4G11A 1S0CA 2OPWA 1IGDA 1WJ6A 2BW8A 3E5XA 2NM1A 4A8XC 4LBQD 1DQ1A 1GB4A 4KGQA 3K3NA 3DOWA 1KS5A 5JMCA 2CS4A 5IKCM 4F8CB 5GM0A 3LAGA 4XC9A 1F5JA 3O0VA 4P14A 3R6SA 3FHIB 3KHBA 3EUB2 3CMMB 1SLLA 5LZ6A 3LFIA 3WNXA 4GXBA 3IAS1 3OCPA 3V64A 5K7PA 3JUUA 4EQVA 1W0OA 4DO0A 3PUHA 4IQPA 3MIDA 1QKZA 1UBIA 1FPN3 3ZIWA 2XK5B 3BINA 3JD71 1GNYA 4XYCA 3HM3A 2VZRA 3U07A 2RDHA 2WINB 3ES1A 2C5LC 3D82A 3WQ7A 4FPEA 2EIBA 3VBFB 3PDQA 3N9OA 2VZTA 2DNFA 3HNMA 4IGOA 5JH5C 4BOWA 3PTYA 2QVSB 4QDSA 4N90A 1NUKA 5KHQA 4Q0VA 2RDQA 4IUMB 3U37A 1K5MC 3H7PB 3ZTDA 1SJED 4CUAA 5LK7B 2ILMA 4NHMA 5ABJB 3C7EA 1IGCA 1V6NA 1Q56A 4URAA 2UURA 4COYA 2JG9B 3IDCB 3ENRA 2ZMLA 3KWVA 1GC7A 3ETQA 1QJU2 2XUMA 4AR2A 5FPLA 2ACZB 1I4XA 3MJ5A 4ICVA 3KLSA 4QX3A 4JIOU 2FCUA 2LUEA 2E6XA 1C4PA 1PGW2 1HRI3 2KLCA 1AR62 2KX3A 3A9JA 4CDWB 3HBZA 3UT0A 3R66C 2FMDA 3S5QA 4AFBA 4H7MA 4RSUA 5A32B 4HETA 2XPJA 5I93A 3INAA 2IO1B 1OQQA 4B6WA 3O5SA 4E4ZA 2LHEA 3I63C 2P34A 3TMPB 3WR0A 3U10A 1LENA 2LXCA 5TR5A 3N9NA 4BOZB 3FZ3A 4S2DA 3VDAA 4II3B 2ZGUA 3V62A 1DYQA 2ZEXA 2RMU1 2QQIA 2KJHB 1UOFA 3AMMA 2XJTA 2YBSA 4WM8A 3EB7A 4A3XA 1ZREA 1JWUD 4G3YC 4J6IA 4OMCA 1JMLA 4QQLA 1DBNA 4JGYC 2LI5A 5D94A 2RGFA 4FTBA 2V5DA 2O8QA 3AC0A 5FZAA 5BNOA 1P9DU 1S2BA 3IG3A 4PI2A 1XBFA 3K77A 3S7IA 1PDXA 2HWB1 3Q3JA 4K81A 4E9KA 3RWNA 3VBUC 4TXWA 2IC1A 1HJFA 4WVMA 1YI9A 5CNAA 4CCNA 1FYUA 1SIFA 4LOTA 5EE3A 4S2FA 2DYCA 1RUE2 3ME2A 3DVNU 3SLIA 2W46A 2W91A 3PO0A 2QJLA 4GAZA 2K46A 3H50A 4US8A 4AEJA 4Q2JA 3R7QA 1V1PA 3PS6A 5AZHA 1P8JA 4P1CC 1WD4A 1NCQA 1MS0A 3MV11 3QD6A 1GQPA 3I8TA 2WJSA 2FCTA 3JCIA 2QZ3A 2LHDA 4BU2A 1MQTB 2ORXA 2JQRB 4PHZA 2ZEYA 2AWTA 5FOBB 2J0KA 1STMA 1OH3A 2VMIA 1GANA 1TGZB 3AKTA 4RS5C 4QXCA 3TB0A 1OLRA 1YNTE 2RR9A 3LFMA 3LB8C 1CIYA 2KN5A 4OQ8A 3APCA 1Q5OA 3BIEA 4PJYA 1XYNA 4DXAB 2BVCA 4G9SB 2D5HA 3AKRA 1J84A 5C3RA 3RNEC 5FYYA 1E7PB 2NCNA 4GDLB 4HG6B 2N9KA 3AFGA 3ILNA 1FOD1 2GDFA 4EEWA 4CU7A 4Q1PA 5FZFA 2C7MB 3BI3A 1D2QA 3WP4A 2ZPXA 2E7AA 1HEZE 1SQ4A 3CU7A 1L7LA 4LLOA 4OHVA 4BA6A 2G4SA 3NWKA 1L6UA 1NX9A 4WZCA 2QDNA 2GC1A 1X36A 2Z4FA 1H2KA 1VLNA 2KQ4X 4YW1A 1ZRFA 2LGXA 3MW2A 4M01A 2D3GA 1RUG2 3OPWA 1AX1A 3FWEA 1QQP3 1QWRA 3H9DA 4LTUA 2IJ0A 2DLBA 1N3QA 5EQUA 1VAVA 3DF0A 4I3GA 4U36A 5DQ0A 1YXWA 5AC92 4FHJA 1D5ZC 2QHOA 3WF4A 2UWAA 1RUJ1 2WFF2 4HCNB 5FMOS 5T54A 2N1WA 2UYAA 3IPVA 2EIDA 1EV12 1EUUA 2VTXJ 1N1YA 1J8CA 2EXKA 3KW5B 1T0RC 3L0WB 4NZLB 1X9TA 3VVWB 4JKKA 2RR11 3VBFC 2N9XA 4BQYA 2WFPA 2QUOA 2W92A 1WBFA 4AFMA 4BQ4A 1UO9A 2ATFA 3TN91 5AUIA 2WDVB 1W39A 1RVF1 2V73A 3LGRA 4FXCA 5EE9A 3OPZA 3LIHA 3E5UA 4R4ZA 2W82A 1SBBB 4Y22B 5ABJC 4XF0A 4ZU7A 5FPVA 1NXMA 1TIFA 5GJ6A 3VDDB 1NA1A 2W55A 3OGGA 3T2TA 1N3OA 2ZA9A 2E53A 4YW6A 1POQA 4B95A 1ZXIA 4M3CB 1RUI1 4KL1A 4YWAA 5T5PA 3D0JA 4CDWC 1YLLA 5IVCA 3ZPOA 3P3NA 2RS52 2D3BA 2BT6A 1K53A 3EMRA 2VMFA 3KUZA 3WV6A 5C5TA 4LO4B 4HEA1 1AVBA 4KVGB 2G9ZA 1AYN1 1BBT2 2NMQA 2VOXA 3DN7A 1MPEA 2G4DB 2N9PC 4XFGA 5JIUA 5C5UA 1OUSA 1TY0A 2D93A 4OHJA 5LASA 2O8OA 3FC4A 1D7PM 3CBNA 4BYYA 1O5UA 1FNVA 4JZRA 4JRAA 1AXKA 3CF6E 3OWEB 4ZU5A 3PZ8A 1ZBE2 5E16A 4XUPA 1PO12 2PHLA 2G9GA 5HFYA 3UQBA 3RS6A 5BNPB 2G1EA 3WHTA 3AX4A 4LHLA 5I0SA 2XBO2 4N7IA 1SCSA 2DCJA 1OKOA 3GBFA 2OW4A 2C4XA 1QU0A 1YFYA 4EWDA 4DXTA 4IE4A 4W4ZA 3DVNV 3AP4A 1NQJA 2GBMA 3I5JC 1FMD2 3SCFA 4A6QA 2HWC2 3VBRB 1O4YA 4MHRA 4L99A 5G05L 2HWD2 3B1LX 4CP2A 1I7HA 1RUJ3 3H6NA 4E8DA 1XD3B 1FXZA 2OVUA 5FZEA 3FAHA 4O9EA 1FMAD 4AVSA 4BQ1A 1MQTC 4CCLA 2JDUA 3M63B 5F37A 4HKWA 4Y1XA 4DS0A 1XLNA 2WQ8A 4XXPA 1V6OA 3ZXVA 3AXEA 2RR13 3WEZA 1TJEA 3ZLIA 2JVCA 4MJSA 1W06A 1STEA 2ZGLA 1FFVA 2D6LX 3VR8B 5JZEB 2LUWA 4JRLA 4Q27A 1US2A 3TN93 4FO9A 4K8RB 4LIUA 4KMQA 2INPE 3O13A 4ZRJA 2KXLA 1NQDA 3VBSA 1XQNA 3PT2B 4CDUB 1F52A 4CYEA 1MG8A 3AEAB 4P1BC 4WBBA 1HN1A 2IFRA 5HKHA 3RDIA 5FBZA 3KV5A 2GALA 4JC1A 2KK8A 1RUC1 3GYDA 4C7YA 2F4LA 4OZBA 1RHI1 4UOJA 1YX6B 2R7EB 3AP6A 2HKXA 4QPYA 4WAFA 3RULA 2CHXA 4HJGE 3G7DA 5JZGB 4IV3A 3BTAA 1V1OA 4FOWA 1K5JA 4BM8A 2M17A 2B42B 3NJZA 2BTEA 1AYN3 4DHZE 4MXVA 5LY1A 4KX6B 3V3XA 3EFCA 2WZ8A 2Z5WA 4XDPA 1Q5WB 1K51A 4R52A 4CDQA 2XVGA 3LF7A 3T4VA 2OUHA 1MEC3 3CJIA 4DEQA 5C23A 1UZXB 3ZXAC 3W59A 1PVXA 2OHFA 4GOCA 3RQ0A 3CWIA 1AL22 4LE4A 4HPMB 3HVZA 3H8HA 4XTMA 3K2OA 2E31A 2W1UA 1GOFA 5LW9A 1CAWA 3LYYA 1XNKA 4EYUA 5GLTA 2FDFA 5D21A 4P16A 1O7FA 1TE1B 3WDYA 1MS4A 2B39A 1GMMA 1JW9D 1YQ5A 3SFEB 2K25A 2KWVB 4FLHA 5DPWA 1WW5A 5SV5A 2X38A 4N43C 1HDKA 1QOAA 1U12A 2BGFA 2FCSA 1EP0A 4NR1A 4HOOA 2FBEA 1WBLA 4XFIA 1PIV1 1ZXHA 3IN9A 4AF9A 5FPZA 3ZVVA 3ZFFC 2BQQA 3MF9A 4PIYA 1XLOA 2VY0A 3WG4A 4AGGA 3ROUA 5BUVA 4QQOA 3ZX7A 3K75B 3IFWB 2JZPA 1SZBA 1F4HA 1JU4A 4JPSA 5DUVA 5IK7A 1RL3A 5L19A 4GJYA 2XKOA 4E4DX 1UAIA 4XOGA 1YQ3B 5A3PA 4FBJB 4S17A 5C4WB 3ZYRA 3AEFB 3GZNB 3DL3A 4JGZC 2EIGA 3USUB 2PELA 4C4VB 1WMFA 5D7GA 3ST7A 4YRDA 1AL0G 5FY0A 2KAJA 1C8M1 1N1SA 4OHWA 2G9FA 2Y64A 4GA9A 2GNDA 4HK9A 4ASKA 2WAAA 3KUDB 4KDLB 1J58A 2WO1A 2CU3A 4QQHA 3VRAB 3GZEA 2L00B 2YHJA 5IOIA 1RHI3 4M8MA 2HTME 1GICA 1EF5A 2O2VA 3I2DA 1SE9A 4PS7A 2VW2A 3KQ4B 1EAH1 3KT1A 3BOPA 1VZ7A 5BNPC 1KGYA 1O8PA 1VP6A 2AX5A 1KD7A 5ERLA 5DZFA 4DDID 2M19A 5JXHA 4N59A 1K12A 3L2HA 2ONQA 5HI1A 1MHHE 3N36A 1KS4A 4IEXA 1WLTA 4ZPIA 3W5NA 3VBRC 1TQ5A 1L3JA 5DAXA 4OVEA 2VNOA 4KNCA 4RR3A 4HDQA 4JTNA 1UX6A 2ZMKA 1NLQA 1W6NA 4YG6A 1OBNA 5FMBA 3NHEB 2Z59B 4HRSA 1PNGA 4XF4A 5DDJ3 3E6BA 1PGSA 2JB8A 3HHMA 3OTFA 4Z07A 3RPQA 2MQJA 2BFUS 1IS6A 4PQQA 4PDWB 1XEEA 4BLIA 1E5RA 4GD4A 2HWE2 5C33A 4ZS3A 4IE6A 3I2FA 4R3DA 5A7NA 1B35C 2KWCA 5DAQA 1V5OA 1ZZ7A 1LR5A 2PLPA 2Z79A 2ERFA 1C1LA 4AOFA 1IQDC 1CPNA 4W9KA 4ZRQA 4O9GA 3RZFA 3JVZX 2K5PA 2KHWB 4AQ7A 5LA2A 1PIV3 4UW6A 4A7KA 4GULA 1ZZ6A 1I6XA 4BIOA 4NJ4A 4GH4B 5BMIA 4MADA 4NAMA 1RITA 4CDUC 4WJPA 5A3NA 5L95C 4XFHA 4NUBA 1TME2 4HPKB 3BUCA 3RMYA 1LOFC 1HN0A 1HLCA 1IPKA 5BYNA 2ET7A 3UK9A 1D5MC 2W87A 1T3QA 4KV2A 4F7ZA 5BNNB 4U2AA 2PAKA 3PVLA 3I2HA 4EUTA 3LCPA 1D3ZA 4K21A 1RGSA 5FKBA 1S0IA 3WQ0A 4HMZA 3WDWA 4DBGA 3NNMA 5IVVA 5F8PA 4TUUA 1XXNA 1XF5L 1FM0D 2ZEZA 1C8M3 2ZVOA 3ETRA 4BDVB 2RS12 1RAXA 2P2KA 5EV7A 1C77A 2R062 3AECB 4NQLB 5EE0A 4AI3A 1W8FA 4UW5A 1URXA 3T9LA 3SEBA 1WE7A 1IBXA 3CMGA 4DUXA 1GR3A 2RMMA 4JVAA 1JOJA 2QQVA 1EAH3 2RDBC 1PO23 3PUSA 4EWEA 1GP5A 1GZWA 3N9PA 2KTRB 3AZXA 4SBVA 1T2XA 3VL9A 3DWMA 5BV6A 3N20C 3HN3A 3ZXEA 1CAXA 2IVJA 1L0VB 4JX0A 1UGJA 4YWGG 3LSDA 4HBNA 3J8F2 1ENXA 4E71A 3NKTA 4FQZA 2VCBA 1V6KA 4SLIA 4IETA 4MM3B 5DAVA 2JECA 4DIQA 1E8WA 4JKMA 2D3RA 1OFNA 3DKQA 2K2SA 3I9V1 4HT1T 3AZWA 5GLUA 1ZP0B 4R9CA 2MP2A 2SEBD 5H8YE 3LPGA 2GP3A 1S0JA 2GBNA 2E32A 4BIFA 4CP0A 1ASJ2 4CUGA 3IDAA 1CONA 4ORFA 1QZEA 1GOZA 3LDRA 3K9PB 3W1YA 3UKTA 1Z7S3 4QKDA 1WUVA 2EKIA 3I7DA 3K9OB 1OXCA 4BMEA 4CU8A 1W2NA 1YOVB 5HXVA 4G3XB 4HJKA 2K6DB 4CCKA 3KYDD 5C8CA 1MVQA 3DKWA 3RNSA 1ESFA 4DFSA 3TWIA 1PK6A 1W99A 4XYXA 3WW3A 2DZKA 4NPMA 4OHZA 2R072 4BKSA 1UKRA 3ZR6A 1R082 2QC8A 4FFFA 3BIWE 2KO3A 3V0BB 2DUOA 1G9BA 2Y0IA 1IG0A 4NWVA 5FK8A 4J3OD 3SU8X 4K1RB 1LEMA 3T2OA 4M02A 3CIRB 2WNUB 3CHXA 3KV9A 4I6LB 4S0RA 3ZNHB 4A42A 4OI4A 3V61A 1UYXA 3H0OA 1NKGA 3J26N 3NZUA 2CGNA 1GP6A 1W6PB 4ZHPA 1RXFA 2HWF2 3SMHA 4CCMA 1PGXA 2Y34A 1HQNA 3DV8A 1C79A 1VAKA 2WUHA 1GZTA 1SBEA 1I4QA 4K7UA 4W9EA 4UW4A 4BQXA 4UFMA 1VALA 3K4DA 4JHZA 4KQ7A 3MPBA 1V6IA 1WMHA 4A44A 4XJZA 2XJRA 1SGHA 2PPHA 3U4XA 2PN5A 3NUHB 2P3JA 1NY72 3B94A 3R0RA 3AP5A 5CIRA 3ABVB 4GIQA 1VD2A 1E8XA 1RUD1 1CESA 3RZWC 3L10B 1FNUA 4Q4V2 1U4AA 4ATFA 1Q43A 2L0TA 1VBE2 1DHKB 4LNNA 3A4UA 2FDGA 4IM0A 4PDWC 3GZNI 2XEWA 1YIFA 3H7JA 3AE4B 5FMCA 3ZO5B 4AEMA 4QHBA 2UU8A 1VBB2 2ZHMA 4R4XA 1T0YA 2EELA 3NNJA 1SLTA 4CE8A 1A6CA 4Q1RA 5A6YA 2DAJA 2GN7A 4YVSB 2BZDA 3WY6A 3AE1B 2WDBA 3Q3OC 1S0EA 2J1AA 1W6OB 3TNPB 4D6QA 1VCBA 2PVGC 2IWGB 1W9TA 3SH3A 3VUYA 3BALA 5IHRA 4JTOA 2C9KA 1LO5D 4UFHA 5BNNC 4XZUG 1G9AA 2WRAA 2VZKB 2LALA 1SDWA 1EY2A 4CEWB 1JZ3A 3I97A 4NOTA 5L83A 3MFAA 3ENEA 1PZ7A 4LHSA 3VBUA 4P02B 4K3CA 1PMIA 4DQOC 4H3WA 1LJ7A 4RMAA 1SLIA 5L7OB 2JG8C 1HB2A 3W1SA 5DPSA 5FRAA 1NEKB 1O5LA 2XJPA 4XJAA 2KD7A 5F5AA 3AEGB 4XMAA 2YFUA 4TTGA 3AI5A 1ZOYB 3M3IA 5C9AA 2HE7A 3ZN6B 2BVVA 1O4ZA 1IGOA 3GP7A 2PHRA 5IFTA 4I0BA 1NYQA 4IKGA 3LDZE 3ZXFA 1CJEA 5GLWA 4LO5B 5LB6A 4XUOA 4QPIB 2RM21 2AYOB 3AZZA 1P3QU 2L76A 3ZYPA 3BVZA 1Q8VA 3EHVA 1N5WA 2VZPA 1QJU1 3M2MA 3HM6X 1VMFA 4ZHNA 1KDKA 1X33A 1DLCA 4M4PA 1I35A 4DY5A 1YJIA 1AR61 1K42A 5FZMA 5CKQA 1N61A 3CJXA 3C0RB 3NV2A 1GKBA 2KC2A 2R042 4UBHA 4CCJA 3ZDSA 4ASMB 1YQ4B 1COV2 4XW3A 1WIAA 1UKGA 4HFSA 2QQMA 3MC0B 2VZOA 1W0NA 2JD9A 2EAKA 2DHZA 3AB5A 5D6JB 4PLMA 4K7JA 2IDYA 5G55A 2KR2A 2V9HA 1C1FA 2IXIA 4RGKA 5GZFA 4C7ZA 4G50A 4D0QA 1ZZ9A 5D3IB 4AHXA 3TRSB 4A3ZA 2LXAA 3SCHA 1PVC2 1S0FA 4BH9A 1JBCA 3SITA 2MRPA 2ZAAA 1UH6A 3AU5A 5IN7A 2NN8A 2OA2A 1U5XA 2WXMA 5T5JA 1AZDA 2YVCA 1XNDA 2WQYB 2DUPA 2KZRA 1WCDJ 4E3CA 4YXDB 1OEYJ 1CAUA 3E5QA 2Y6JA 3F2ZA 2VTFA 1RUE1 3LEGA 3ORJA 1KDMA 4DHJD 4MH8A 4XIOA 2PHFA 4HANA 4CVUA 4ICUA 1CR7A 4FTSA 3PNAA 3PMEA 3SD5A 1HJGA 3P3PA 3D3AA 1KXGA 3RNFC 4BVUC 3PVBB 4AQSA 2WNUA 4A45A 3RMKC 5E6NA 3K46A 4XJUA 2J0JA 3CLPA 5IWFA 3RGBA 5IA7A 5LEJA 1UZYA 4I30A 1E57A 4EV0A 1LOCA 2M8SA 3NVYA 2DTYA 3DVGX 3WZ1A 2KWDA 4AHZA 3VKFC 2CSGA 3VGIA 1TT5B 2MA9B 2XONA 3DYPA 2LZ6A 1CZTA 4Q8LA 4WAAA 4A2UA 4AQTA 3WW4A 3ZNGC 2D97A 2X8KA 3WDVA 1YJLA 1QJU3 1FI2A 2JWZA 2W47A 1CAVB 3L13A 5FP4A 5APAA 1XOYA 2NPTA 1WGHA 1H2NA 2BU9A 2BS2B 5A7QA 1D2SA 1NCRB 1MVEA 1N5XA 1V6MA 3SISA 2LGYA 2DFCA 1AR63 3UESA 2QQLA 1OQRA 2A6YA 1JYWA 1IS4A 3MI8A 1JWSD 1RYYA 2VUDA 4XC2A 3N1XC 4QQ2A 4FPFA 4B0MA 4DK5A 1RUG1 1G86A 2QE3A 3JU9A 1X1MA 3IT4B 4Z82A 4AQ2A 1W6MB 1CD3G 2JT4B 4NRQA 5FLHA 2VTXA 5JMOA 4FQ4A 3DBRB 3KMHA 3CKHA 4YVSA 3CL1A 2GOWA 2NMNA 4CEWC 2RDSA 1E8YA 4HSJA 2WFF1 5L9VA 4DRRA 3C7GA 3T09A 1JYVA 3GZAA 2KMMA 1UMZA 2JF5A 5L7OC 4EZ4A 2I45A 5ACA2 1H8CA 4FP3A 2L9LA 1W90A 1QOBA 2PJHA 2WNVC 3VBOB 4DXSA 4PQ9A 1EPWA 3NVVA 3L9JT 3DHIC 3THPA 1JTZX 4LORA 1RUE3 1ZKHA 3GXUA 3ZSMA 4KGTA 1XO3A 5T8IA 1Q8PA 2BWCA 4RGTA 3VUOA 3JXSA 1FXIA 1R4MB 1WWTA 3LEMA 2YPDA 1JYTA 3DPRA 4B4QA 1WXMA 3ZRFA 2Q8OA 3ZKUA 1A34A 1S4CA 4JLCA 2DCTA 4XQ4A 5B4NA 5FXZA 1CX4A 4BKSD 2VD7A 5FY4A 1H4HA 4NRMA 4MSVA 3WIMA 3H3ZA 4PF5A 5IAAC 2VW1A 2RS51 4NNJB 2AYHA 2GMEA 3TEZA 1XNTA 2G45B 2XJUA 1KJRA 1L6VA 3ZNID 1ISNA 3W21A 1BBT1 1UY1A 4RFRB 3WA0A 4BCUA 3APBA 1E5IA 4W65A 2KACA 2ZCCA 1XNAA 1QJX2 5EPAA 1J1LA 4J6GA 4XPVA 1WZ3A 4RA0A 2WZEA 3MHSD 4R8HA 1Y56A 4HK8A 4NPRA 3FX3A 1ZBE1 4Y4RA 1JCKB 2WC2A 1PO11 2OT7A 2WA3A 2OJRA 2VJXA 4YG0A 4I3PA 1EUVB 3P4RB 3UJQA 4OW0A 1RUG3 2XR4A 3SKJE 1V6EA 1YUDA 3V0AA 2IYDB 3B7MA 4M8NA 4CA9A 1CJPA 4FAGA 3RFZB 3OGRA 4RCOA 4B1MA 5AC93 2HWC1 4Q0QA 1ET6A 3D6EA 1R4NB 4PBPA 4M0WB 4Q4Y1 4YVWA 1NXD1 3UINB 3KV6A 5GKAC 2WFF3 4NAWA 3GB1A 2Z69A 2E3TA 2EXJA 3E6DA 4CCOA 1UELA 2BP6A 3H1YA 5H9QA 1EV13 1WGYA 2HTHA 2ZZQA 2BUKA 1X50A 1UL9A 4P6VF 1KEXA 3N7MA 4XF1A 2O6VD 5F3EA 4JDMA 4GDKA 3RT3B 1EM7A 4A9AA 4N43A 4E8CA 4ZONA 3N9QA 2JXAA 2K1FA 1G7YA 2GNTA 5E1RA 3AE8B 2E26A 4KIKA 1N47A 3HD8B 3VHOA 3K51A 3NAPB 3ZFFA 5H92C 2RS32 3RNAC 2F6BA 3IXSA 1ND2B 4RHV2 3B0AA 5J48A 4CP1A 4XAEA 3DXUA 2KQ7A 1H4GA 5E8AA 2YGLA 2IVIB 3IBMA 2FCNA 2I74A 4M3CF 4W9HA 4O7XA 3SH4A 4PT5A 3OBTA 3RZJA 3ZO0B 4OCTA 4XUTA 1LQBA 1ZA7A 5C2TB 1UGMA 2ARBA 3TEXA 1E8ZA 1NCRC 2DX5B 1ZE3D 3ZKJC 3BTYA 3BTZA 2WXLA 3QHTA 2W1SA 2WWZA 4JGZA 2RS53 2VOKA 4MXWB 1AUYA 4RGMA 5A3LA 3WNNA 4QWNA 1MS1A 1BBT3 2DF7A 5A33B 1GB1A 4NROA 3PIGA 4GGQA 4Q4W1 1CK1A 2QQNA 1C5HA 1ZBE3 5F32A 4QM8A 2NBVB 3IT8A 3T0AA 1PO13 4A41A 4EE2A 4LEJA 1UY4A 5T5OA 3NV3A 2XBO3 3ALQA 3AXDA 3U1XA 5KXDA 1S1QB 3NV4A 3V05A 4YSYB 3VBOC 4MO3M 3U30A 4XCAA 5CISA 3O12A 5A6ZA 1FMD3 4OFGA 4ONUA 2HWC3 4EJRA 5J3UA 4W6YA 1E90A 1FXAA 4LITA 2HWD3 4Q4Y3 1PYWD 4CSWA 4CCCA 1BYHA 2W3RA 5IJRA 2FDKA 4XDOA 1PQSA 3PVEA 2D6NA 2INDC 2P4EA 1YQBA 5FY9A 5CG9A 1YYNA 2DWRA 4LTAA 4JDOA 2FMYA 2D07B 3DCQA 1EU3A 5FWJA 1MVKA 4C80A 2ZVNA 3L2YA 2C7NB 3WP3A 1SG3A 4ZXEA 1AJOA 1UN1A 1TMF2 4BXFA 1L0XB 5FP8A 5E89A 3Q8BA 2KMAA 4LKFA 1JWMD 2QFEA 1J59A 3LOBA 3E56A 2A7AA 3POYA 2BBCA 4YM3A 2SLIA 3JQXA 1UPIA 1M4VA 4IDIA 4NN0A 2HEVF 1DQ0A 4ITCA 3N4MA 4MSMB 3DBRI 4QGMA 1KJLA 3UIOB 1UD7A 4AQ6A 3VH4B 5JHBA 2X8XX 1SB3C 3RZMA 1V8CA 3I2JA 4XILA 2IXKA 3AMQA 1A8MA 4LUMA 4UWDA 2Q8DA 4JGHB 3VZLA 3NZ3A 1QOOA 3O1VA 1V70A 5KWRA 1W6QB 4Z1VA 3DYOA 2IXHA 3NL1A 2NTTA 1OFSA 4CUCA 1Z5SB 3AE7B 1MS8A 1LHVA 1R091 4YZ2A 3VZOA 4DEVA 1QQRA 1RFKA 2RSUA 2R6QA 1LESA 2RJLA 1R4MI 3A22A 4KWJA 2YLMA 2LEKA 1H1MA 2PLV1 2IPKD 4ZYNA 3VN4A 4Q4W3 2FCMA 4MUVA 2E63A 2V3PA 1W03A 1KOTA 4HPPA 4YM0A 2CGOA 2WXGA 2W2IA 1ZPSA 3B9IA 1GYKA 2GSYA 2VW0A 3OGJA 2HYXA 4ASWC 1AL23 1QILA 2DZMA 1XU2A 2PE9A 5DG1A 3MTNB 2WX0A 1S2EA 3LDBA 2TSSA 4Q4X2 4LBQA 5F2SA 3OD4A 4KU8A 4KZ0A 3JSVA 2HWE1 5GZDA 3POSA 1R64A 2CL2A 2D3PA 5FYVA 2X10A 3IAQA 2Y33A 3Q69A 3T2PA 5SV8A 4MGTA 1WJNA 4XDCA 1ND3B 1UY2A 1YNAA 1H1IA 4GJZA 5IFPA 5FOJB 3SHQA 5DCNA 3LEKA 4X6QB 3I59B 1WLCA 5H9RA 4LCDE 2LVQA 1UF0A 2VBBA 2Z0DB 1UUPA 4CEYB 1WYWB 1QXJA 2WWSA 3B69A 4AEDA 4AK3A 1UF2C 4Q0SA 1W3VA 1TME1 2YB7A 3IKWA 4A6SA 1WE6A 3QH7A 5IVJA 1OPMA 3RJRA 4QPGA 4YW3A 2VECA 1Y3TA 2V0GA 1PFDA 4D6SA 3PUAA 3QH6A 3PTFC 2GP5A 3MIGA 3AVSA 2LWPA 4MH0E 4NHKA 4BKTA 5FY8A 4MGQA 2VH2A 3THCA 1SEBD 4F1SA 1GNZA 4RQPB 1MPXA 3SHRA 5A3WA 3O1UA 1Y8RC 4E2QA 2X5IA 4BPZA 3E97A 3W5VB 4COUA 4EN0A 2RS11 1K8RB 2HYKA 1LTEA 1BXHA 3MLKA 5IK5A 2R061 3QOPA 3P2BA 5C3PA 2WXRA 3D4KA 3HIFA 5GZGA 4GMP1 3W20A 3D32A 4YYOA 2PHTA 3PLVA 3AMZA 4K9SA 5FBJA 2Q1ZB 2JYTA 2K0PA 4QX8A 1E6EB 2J1RA 2VOWA 3P4QB 2A4ZA 4RFT0 3IDEA 5LNK1 1UXZA 4QX7A 5IYYA 1D4M1 4N53B 3U14A 2PHXA 2IXJA 3MIHA 2NBUA 4OMDA 5EFUA 3UJOA 5JOXA 5FZ0A 4A90A 4GU2A 4QAYA 4S2HA 1BHGA 1ZBA2 3A4SC 2ZTNA 2C7HA 4A7ZA 1GZ9A 5JXIA 4E2GA 2H6BA 4UFLA 3MIEA 4RD7A 4YTMB 4ANVA 5DPNA 3WW1A 5FZIA 1QLBB 4E2SA 3VBHB 1UWMA 1H8TA 3FBMA 3HWJA 1U0AA 1KM7A 4ZZ8A 2J1TA 1ASJ1 2ET1A 3FFZA 1QGLA 2MBEA 5HI0A 2IZVB 5D3DA 2KOXA 1Y9QA 3ZMOA 1RUOA 2WHIA 2WXKA 2WXIA 1DZRA 4C56C 5DZGA 2WYSA 5CFCC 1WCQA 3IAM1 3FILB 2HWE3 1WX8A 2A75A 2PQSA 4CHKA 2L1AA 3OY8A 1K50A 5CHWA 1V9U2 4DXFA 4X8PA 3GOEA 3ZFGA 5LBCA 3EJKA 5JXVA 4WWOA 4IC7B 3K48A 4GWJA 5JUVA 3DVGY 3UV9A 5J98B 1UYYA 2XXZA 1ZDXA 2ZX0A 2R071 2LW8A 1NI2A 1R081 2CNAA 2XQXA 1P1AA 3KM5A 1XC6A 4QKFA 4CU9A 3V65A 5KHGA 1TME3 3M1HA 3CDZB 1PM4A 2XBBC 3Q6BA 2ZKNA 1ZX5A 1NLSA 1W04A 1SPPA 3VL8A 1LU2A 3VHTC 5FP9A 1E0ZA 4C1XA 5HCHA 5E6OA 3BVCA 2KTFA 3W5MA 1I4PA 3HIZA 1ST8A 4ES8A 5FZGA 4IV1A 3ZXKA 1QOSA 2P1BA 1DU3D 4XZPA 2IGHA 1XYPA 1R1A1 5FO7B 2ON8A 2RS13 1ZRDA 4JWSC 4HKQA 2R063 2RE9A 3U2SC 4TQ1A 1YD8U 2BTVC 1TTNA 1BXTA 2JE9A 5E6JA 4GMP3 3H1WA 3CNAA 4NQKE 1W8WA 1LOAA 2HLEA 1NY71 1TS3A 1CGPA 1ONAA 2VUJA 3NNFA 3KUCB 2XB6C 1TZ1A 2IO0B 1NG0A 2EF6A 3OPTA 2R0HA 1D4M3 3CZUA 4Q4V1 3NOBA 2BGOA 2OX0A 3PTRB 4FCAA 4CXWA 3N3KB 3UGBB 2QTWB 1WFYA 3TCAA 3J8F3 3MICA 2WN2A 2J1EA 1C1YB 3O0WA 3I57A 1OSGA 5FZOA 2F17A 4HPLB 4DOUA 2XGXA 3A9JB 1FNWA 1RM6C 1SSNA 3MBWA 1ND3C 2Y6LA 3VZJA 4H14A 3VXWA 3MW4A 4N7UA 1K3IA 3WF3A 4ZS2A 3GS2A 1ASJ3 3TL5A 2W9NA 1DOYA 4G0NB 3RYKA 4QU2A 2ZACA 4ARCA 1LEDA 5T50A 2ZABA 4UYBA 5CBLA 2E51A 3B02A 2KDMA 5FJHA 4PIXA 1LGNA 4WM8B 3LB9A 4NIAA 3ZFEA 1KRHA 3GE8C 4LLGM 3O65B 4YM2A 3N9LA 1TKGA 4XX5A 5BNOB 1QOTA 2Y3AA 5CTRC 2JY6A 1ENSA 4RQPC 1OQ1A 2R073 3ZR5A 3BK2A 4FN2A 3P1MA 2CJOA 1R083 2ZGKA 4XXAA 4BQWA 3OG5A 4AE2A 1JZ8A 4WVMB 1LNSA 1V6JA 1SFNA 2ZGNA 3DHGC 4L97A 1QF3A 4IE7A 1RYJA 3RVHA 2HBTA 4HVOA 2C26A 2WL1A 5FUNA 4AVTA 3HRDD 4OLLA 4XJ8A 1LCLA 1V1PB 1G9CA 4DXZA 3VD5A 1N3PA 4P5YA 1QOGA 1JH5A 1NCQB 3JD72 3A23A 1FT9A 2Q4SA 2A3XA 3RZLA 5IATA 1SHWB 4AYUA 2HWF3 4MGKE 3CSTA 3MO4A 1J7BA 1R7SA 4N53C 4HSLA 2K8HA 4TZDA 4BZ4A 4BXSV 2N9EB 3GCXA 1GUAB 2TUNA 4M4RA 2RDRA 4JCKA 4DUWA 1C78A 1YMHE 2VQ0A 1C5IA 1GWMA 4AAXA 1JRUA 2HH9A 3QARA 2UYBA 5BO4B 2D6MA 5HCFA 2B9VA 2CKHB 4LBLA 3RNCC 2A70A 1HXS2 3VBHC 5C3QA 2W68A 2UWBA 3AZYA 3H1MA 1IS3A 1U5IA 3C7FA 4Q4V3 4AEKA 2WABA 5FPUA 3ACGA 3GM8A 4XDDA 2JDNA 1O3RA 1VBE3 1U5YA 5ANQA 1HRI1 2HDEA 1DOXA 4ASLA 3H7SA 2CU1A 2D10A 1YQ8A 4LLFA 4BAXA 1GJZA 1JS9A 3QA8A 1OEYA 1VBB3 4DMIA 5IP4D 1PVC1 2Y26A 1GOGA 4XQDA 3S57A 3T3NA 1DGLA 2P37A 1XQQA 3R8BA 2N1VA 2W94A 1F2RC 5T5LA 2ZOEB 1F9KA 3N1ZC 4PIZA 3RZHA 1VJ2A 1M06G 1G8WA 3EO6A 2RMU2 2WZR2 2LVPA 3RPFC 1WMEA 4GWMA 5JR2A 1TEIA 1Z78A 4H2AA 2N0SB 1O3TA 5FPXA 2WS91 2HWB2 2R30A 2VC9A 4XCBA 1NE4A 3H8RA 2M56B 3ZRCA 2RPVA 3HQXA 1WLWA 4NIDA 2JPHA 5FZHA 1FCCC 1WCKA 3IPVB 4LE3A 2WNVA 1HRV2 3MGUA 5HV4A 2JXXA 4P7IA 3U7DA 4O61A 3B93A 4UW3A 2G1MA 5A3UA 1ODNA 2QNKA 3RNBC 2JZZA 3WW2A 4ARIA 2E6VA 3T30A 4V2WA 3FLRA 4Q26A 2C9AA 1SE3A 4ZXKA 3UGHA 3P1IA 1CZPA 1O59A 4IM3A 3IAPA 2WQ4A 2WKKA 3MPPG 1J0GA 2JDAA 3K3OA 1E7VA 1MI0A 1F8VA 1C4CA 2AACA 4TSSA 4CPBD 2ZJCA 3IB3A 1NA1B 2BVBA 3RWKX 3RG0A 4MHUA 2I1KA 4I6PA 3GBGA 2GB1A 3ZDTA 1YX5B 3S0MA 1BK0A 2PE6B 5DMYA 2KXJA 3B00A 1F2RI 2ZZPB 3APDA 4LMFA 2B7YA 5LXHA 1RLFA 4CDXC 1YCIA 2JJ6A 3F95A 4MT5A 3R7RA 4AS1A 1PGL1 5FZ8A 1Q8SA 3MW3A 1FOD2 3GNEA 1GQHA 1COV3 5IVBA 2AH2A 4YZ1A 3ZYHA 1WZ0A 1BUIC 4NVPA 1H1AA 4WM8C 3TYJA 1S55A 1GOHA 4YZ3A 3QQ8B 4TQ0A 4J1XA 4USAA 5F3IA 1PVC3 3JBG2 4RM9A 4L9BA 5BNOC 1DIWA 2W1WA 4FP2A 4ATEA 2VMEA 3PVOA 1QQP1 1DCSA 2JENA 4AHWA 3M3OA 4LXLA 2UYZB 5A7SA 1BVP1 2ZGTA 4FVVA 5FUIA 4Y3OA 4FPOB 2PTLA 3GGLA 5JSOA 4QDQA 4JAAA 3PHWB 1SFYA 3T08A 5C3JB 3B2FA 1PX3A 1OPOA 4AWJA 4W50A 1F35A 5BPXA 1AHSA 2VZQA 5JSRA 4LNOA 3TOJA 2W54A 1WRDB 1HZ5A 4MSQB 2WS93 3VKOA 2YV8A 2BWAA 4OUSA 5K0UA 3U52E 3ZSKA 3Q3FA 3PURA 5DABA 1L5PA 5HCAA 4IEVA 1GC6A 5D8AA 4NHLA 3EXUA 3GBWA 2IGDA 4MJSB 1RVF2 1GWLA 3OSDA 1S0BA 4EZKA 1DGWX 2MX2A 5IAVA 2PQQA 4W8JA 1MS5A 2PAEA 2DVBA 4B4PA 2ZBJA 1TZOA 2I07B 3MJWA 2XOMA 3C7HA 3NS8A 1FEHA 1Q10A 3VBSB 2NYYA 4L2YA 3DBLB 1RUI2 2CDOA 3ACHA 2ZCWA 3KQRA 4BISA 2Y6FA 1I9RA 3ML8A 1XU1A 4Z2AA 4WJQA 3VUXA 3KHCA 4AJYB 2Y5CA 1YWKA 3VD9A 2PA7A 1GV9A 4IV3B 1Y43B 4N9IA 2VNVA 2WGSA 2MEV2 2LGDA 4QGNA 2BW2A 4IEPA 4CUBA 1UZWA 2CHZA 4IG7B 4B8EA 3A1QA 3AEBB 3VTVA 4KG8A 2R1DA 5AEKB 5LY2A 4QT6A 5I91A 3PLQA 4CDQB 2L05A 4Z2WA 3ZW3A 5AFBA 3CJIB 1VR9A 3AE5B 1VBC2 1XNBA 1EU4A 2J52A 1SCRA 1UMHA 5LA1A 1VJKA 4FULA 2MHFA 4UBGA 1QNYA 5JIAA 2W95A 1W8UA 1CAWB 1OURA 3PMSA 1J3PA 4PLOA 5ACA3 1XNCA 5EZWA 5KHKA 5J96B 3I3EA 3LPFA 4P9GA 5EXOA 4WWMA 1WGRA 5G5GA 1T0QC 3ZUNA 4IEQA 3U78A 2Y5BB 2KANA 1OQEA 4FPKA 4I09A 2RS31 2YPJA 4B29A 2FDHA 2DVGA 1NA1C 5BMGA 1GZCA 4K1ZA 1J7CA 3PREA 4PYUA 1F5FA 1M94A 1ZZBA 2ZAHA 1JOBA 5F6LB 1H0BA 2MJ3A 1TS5A 1YJKA 2LRPA 2IXLA 3L4PA 4XURA 4QB1A 4DZGA 1BK1A 4IL7A 4C90A 2JG9C 1YFUA 2XH6A 2WWJA 1ZDVA 2MEKA 4Y33A 3OAWA 3TNQA 3Q3NC 3UKVA 5F2WA 4E4SA 2JDPA 4XFFA 2BPSA 4KU7A 1RUC2 3GF6A 2QIEB 4B4RA 1RTVA 4FPJA 1Q0WB 3EECA 4YGEA 5GALA 1POV1 3MIBA 1QJX3 4RGOS 4QU1A 2A1XA 1I5PA 5L36A 2O2VB 2FCVA 5FV3A 2N7JA 3WF1A 2W08A 2Q1MA 5I8TA 2Q30A 3VZMA 3WF0A 1DYPA 3U75A 3BKZA 2K0GA 2MPFA 3M3CA 2IZWA 5FQ0A 1E7UA 4LK7A 4IE0A 1IYFA 1S0GA 4LBNA 1JHNA 1VPHA 1ACCA 3AKPA 3T2QA 4AZZA 2CWSA 3ETPA 4PBOA 3MUZ1 3L16A 3VD4A 1UYPA 4FOQA 4BLJA 4Y1ZA 1MEC1 3ABZA 1MACA 2ADEA 5CZKA 2DBIA 5FXWA 3K4ZA 4H55A 2NVUI 2WT1A 5FZKA 4A20A 3AE6B 1WR6E 3VTUA 1EF1A 4RR3B 1LHNA 2L7RA 3I3MA 3VV1A 5FPBA 1W6NB 4RGNA 1ULCA 1RUH1 3SQOA 4ES9A 4LBJA 4YL8A 1HXYD 3TBLD 5L9BA 3EA6A 1WW6A 1ODMA 4DHJB 1WJUA 4G4FA 5DUXA 3IM0A 2LFIA 3ES4A 3VHNA 3AP9A 4B7EA 3DBSA 2KD0A 1VIWB 5LA0A 2XNAC 4OI2A 1QJFA 1VB4A 1DFQA 4HVQA 1FNZA 2VZKD 3A21A 2P3KA 4BQ3A 1C57A 3M3JA 2RS33 1OOPA 3GALA 3SKVA 1G6NA 3M7AA 3VBSC 1FRRA 3WANA 4RHV3 3X29B 1I1EA 4JQRA 4LDTB 4CCEA 2IBIB 5T52A 1OHFA 1DQ5A 4IWOA 5C8WA 3KT7A 2XHNA 1E5HA 5DN2A 2V3NA 1V5TA 4ZRPA 1KFYB 1QDOA 4FI9A 5K9YA 1ZW7A 2KM2A 5L73A 4AVAA 4F8AA 5BYQA 3TAYA 1WA6X 3ELNA 1E9MA 1O4TA 2AUYA 3KVBA 4LPLA 2ZHLA 3E1F1 3IVFA 4A6OA 2VU9A 5FZ3A 1N63A 1POV3 4CRQA 1IBXB 5IUQA 3CJIC 4OULA 5HXMA 1JZ2A 3HT2A 3LD8A 3FLPA 5JCTA 2JDZA 1GZWB 5LCWL 2JUOA 4M00A 1RINA 3HPNA 2I2SA 4RF0A 1OQDA 1V2YA 4JV4A 1CAXB 1X8MA 3BY4B 4Y4YA 5DXDA 2HEWF 2RDNA 2X53S 5CFDB 2QDRA 4Q4X1 3UF8A 2KFKA 1J3QA 1POV0 4UAPA 3QIJA 5J36A 2E7QA 5ANNA 3DBLI 4FJVB 5ISLA 5FREA 1KF6B 3ECQA 5DDJ1 2QCZA 2MP2B 2WXQA 1RUH3 4AWDA 1DQ4A 2VO5A 1CX1A 4K1YA 3WOGA 3ZJVA 4WH4A 3LOIA 2J1UA 5CFCA 2YGMA 5LEKA 2G19A 1FIQA 2B46X 4TKNA 2V5YA 4MDKE 4CXXA 3O7OA 4LBKA 4QHZA 5IK4A 3RI7C 1AYM2 1TMF3 5C8CB 3AH7A 4XBNA 3VDDC 1JWBD 1RUF2 3CEWA 1PK6B 2GC0A 1UOGA 3R4UA 2JIJA 1W9FA 3ZYIB 3RI9A 3BIID 3MC8A 1Q3EA 2BF8B 1I5ZA 2XVKA 1N1TA 4H7LA 5F5QA 3N7LA 3NJVA 3NG0A 4KGSA 2WYQA 2HBUA 1GAQB 1O6UA 1V97A 2ZHNA 4LA3A 2ZGPA 2GMIC 4ISRA 4UFJA 2DTWA 3BVMA 5BYSA 3O1TA 3AN1A 1KLUD 3LWCA 1HTQA 1DDLA 2JYEA 4HZFA 1H8VA 1QT9A 4DUVA 1BVVA 5D2AA 1QH7A 4KDIC 5FP3A 2YC2A 3KS7A 2BKRB 1JQ4A 4YW4A 5JDBA 3ZIXA 4D69A 5A3MA 2DVDA 3VZKA 3V6EB 1LM8B 3RMXA 1KFUL 5LBBA 3IZOA 5A7OA 1WMHB 4YGDA 1XE7A 1LAJA 2CY6A 1HB3A 1PO21 1AXZA 1V49A 3BGAA 4AJWA 2NTSA 3DHHC 3OEAA 3PJQA 4BFRA 3VZNA 2WLPA 3C7OA 5HCBA 2AC1A 1LGBA 4MV2A 1J3RA 2LUMA 1CQ9A 2EMSA 1OGWA 1PMJX 3O1PA 5CHVC 3H8XA 3THDA 2GNMA 1V86A 3WD5A 1J7AA 1W2AX 4Q4X3 1YIWA 2Z0EB 5E88A 2PIAA 3EFUA 3OJ3A 3NNLA 1B09A 3WG2A 4BE3A 3ZVXA 1MR5A 4MVTA 1UOBA 1BLZA 3HMYA 1OUXA 1V9U1 1XCTL 2HD5B 1O91A 1MS3A 3HJRA 1Z7S1 2W39A 3NY5A 2D98A 5FO8B 4BZAA 1NYWA 1VR3A 5GZEA 5J17A 4TLGA 3R2IA 3DPDA 5LLIA 1NZCA 3PZ7A 4TN7A 2BYEA 2ZX2A 2RDGA 1ULOA 4EN7B 4LNKA 2FCQA 5J7MA 2RPQA 1Z0HA 1IQAA 3SH5A 1NI3A 3AYEA 3WAOA 4Q0PA 3RJ2X 3WNPA 3NVWA 2BPA2 2GRIA 3AEDB 1UQXA 1X9PA 1CWPA 2JEMA 4ZHOA 3VBUB 3THTA 2VBPA 3UETA 3BWUD 1CPMA 1IPSA 3S7EA 1WWYA 4FT8A 3HNYM 1BMV2 2GBJA 4CP9A 3VDZA 5JZGC 2L52A 4YM1A 4Y1YA 2V4VA 1OFFA 3FUOA 2ZCBA 1NBFC 4E4HA 1H30A 2WDQB 4WIPA 5C9AB 2JRIB 1KQRA 1YQCA 3KSCA 3UGFA 2NS5A 1MZFA 2C60A 4DRVA 2XLFA 2GAUA 4WVZA 4Y20B 1YN4A 3VD7A 4I01A 1UY0A 2VCMA 4DXGA 3VUWA 5C1ZA 3ACFA 1AXYA 1HTOA 3V56A 3I2KA 3BZDB 2PKOA 1W8OA 5CVRA 1RUD2 1JYCA 3I54A 1C9FA 3OB8A 3LA2A 1HIXA 4QXHA 2WX1A 5T3NA 3ILRA 4DWFA 4HWIB 5CFDA 4K8FA 4C1WA 3T3OA 2BYTA 3MUY1 1ZM1A 5BNQA 3M4FA 1PNFA 2ZW1A 3HR9A 4ZY9A 4DDGD 3I3BA 5HV0A 2KJRA 2N7DA 4GKXA 3PUIA 3NKGA 3U0ZA 1ZNPA 3ON7A 3KH0A 4IEZA 4UDUC 1YC61 1V9U3 1DQ6A 1PK6C 1ET9A 1AF9A 4LNIA 1QJZA 5IW0A 3AMHA 5KBFA 2M1MA 4HL0A 4WM7A 2YBKA 3IIAA 4BK4A 1WX7A 3AB0A 2WU5B 5JXJA 5C4WC 3PHXB 5JI9A 1XJAA 1QXPA 2RVAA 3OOXA 4D7TA 1CAUB 3SC7X 4K7WA 1KRIA 4LK6A 1AR82 3GZUC 3ZYGA 4P9YA 2QQWA 3N35A 3ZOIA 4LKSA 5JPMB 3QCWA 4MG2A 1FRDA 5FDBA 2VH9A 2ES3A 4NIHA 3VLBB 3QCAA 2CAUA 3ZNZB 1AYFA 2IY0B 2B3AA 3WVJA 1W2UA 4XBLA 1FV2A 3FMGA 1T6BX 2KQSA 2XG3A 4EN9B 1XXGA 1OF3A 2RM22 1L7RA 2DYMA 1RJ7A 3PU3A 1BT0A 1HXS1 3TSSA 1OVSA 3S2AA 2TEPA 3T0DA 2VOVA 1RB8G 3UI3A 1PUTA 1LOEA 2V4IB 4W9FA 1YIPA 1MHXA 2ZS6B 1K5MA 4TWTA 2WSVA 2ARCA 5KR7A 2PW9A 4P5HA 3Q14C 2ZGQA 5I0RA 2NPTB 3WUCA 5JPNB 2ZPNA 4CDXA 3LA7A 3J9SA 2JE7A 1XB9A 3C2UA 1FV3A 4BOSC 3CQOA 4YG3A 2XDVA 3AL6A 2MBHA 3OGSA 4NY0A 3BB6A 1OD3A 3NJXA 4JHTA 5FY5A 2WZR1 1OD5A 4BQ2A 1WF9A 2EMTA 4E27A 1VBD2 4UT5A 4BQ5A 3QC8B 2O6VA 3IMMA 4QB6A 4GH4C 2BV4A 5FK9C 4LUKA 3GHNA 1UCXA 5FLIA 3CO2A 4ANWA 1UZZA 3AKSA 3WCQA 1HQLA 5DZEA 4TMAB 5CAZA 3PGEA 4FPYA 1MZ5A 3POWA 3N9MA 4XWWA 3W1SC 4Y5Z0 1HRV1 4JGYA 4OZCA 1OA3A 1OC1A 1UBQA 3AYCA 3ZM8A 3UNPA 2YYOA 1KITA 2DCKA 4GMVA 4D7YA 2I2YA 2BERA 5C9AC 3ZGZA 3AMPA 3TEWA 4NJ7A 2WT0A 4MGSA 1QXRA 1W05A 4ISQA 3ZJUA 1JUHA 3JD73 3RZKA 2DZIA 3DPRB 2P6CA 3U8ZA 4QGLA 3IMNA 5CG8A 1GLHA 2G4IA 2JXTA 4QQPA 3ZSLA 1LU1A 3OYWB 2BNOA 3KF3A 5K8SA 2A6VA 3W2DA 1UNSA 1B9RA 1TBEA 3KD4A 3KGZA 1XCQL 4Y20A 4OYUA 4L0PA 3WQBA 2ZGSA 4HKOA 1MJDA 1WW7A 3FC0A 4EROA 5FYUA 5A80A 4CTEA 1L7QA 2C1FA 1WGGA 1HXS3 4P08A 1HB4A 2G9HD 4RS5A 2XHKA 1KJTA 4UF0A 3SEEA 3VR9B 3RFRA 3V6CB 4LO7A 2W5FA 1PGW1 1AX2A 2BKFA 5JOWA 2YEPB 2PYTA 5FUPA 1WD3A 3BCWA 2R0FA 5FIXA 3WCRA 1WW4A 5FR3A 2WQZC 3JBG1 5FMOL 3HNBM 5JVVA 4WURA 5IVEA 1GG3A 4IWPA 2QQKA 1YFXA 2RMU3 3WUDA 1E10A 2WZR3 5JR7B 2D43A 1VMJA 1NOVA 3P4PB 3W9AA 3A9KA 1WI0A 5CA6A 3V0AB 5A6XA 4FPLA 5F39A 2V4LA 4JL9A 1PZ9A 1TG7A 2Q5TA 4IE5A 1WA4A 4IXLA 2GBKA 3DXTA 3JB4C 2CTVA 3NZSA 4YVWB 2QDFA 5E6PA 1IKPA 1C28A 2HWB3 4NAWB 1Z2MA 2DBNA 4KZCA 5GXGB 4AI8A 5CB7A 4IEYA 1UZVA 3WSOA 2D6PA 2XL9A 2WNUC 2HEYF 1HRV3 3I3DA 2QQOA 1F9JA 2OKXA 1TVGA 4LQRA 2Z2SB 1H2LA 2QCSB 2AENA 4HLEA 2EXIA 4KG0A 4GDKB 4N43B 1AR72 2XK5A 1CVNA 2WXFA 1W8HA 4IGQA 4AG4A 4KIKB 5TSSA 4MGZE 3QJZA 2WYFA 3ZFFB 1J19A 4BB3A 3VBFA 1IPGA 1SE4A 3ZDVA 1F31A 1TNRA 2H88B 2YBPA 3APFA 3QLQA 1QNWA 4I2OA 3FKYA 3I4IA