4M01A

N terminal fragment(residues 245-575) of binding region of srap
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
321
structure length
321
Chain Sequence
b'AVTANTITVNKDNLKQYMTTSGNATYDQSTGIVTLTQDAYSQKGAITLGTRIDSNKSFHFSGKVNLGNKYEGHGNGGDGIGFAFSPGVLGETGLNGAAVGIGGLSNAFGFKLDTYHNTSKPNSAAKANADPSNVAGGGAFGAFVTTDSYGVATTYTSSSTADNAAKLNVQPTNNTFQDFDINYNGDTKVMTVKYAGQTWTRNISDWIAKSGTTNFSLSMTASTGGATNLQQVQFGTFEYTESAVTQVRYVDVTTGKDIIPPKTYSGNVDQVVTIDNQQSALTAKGYNYTSVDSSYASTYNDTNKTVKMTNAGQSVTYYFTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine-rich adhesin for platelets
publication title Structural Insights into SraP-Mediated Staphylococcus aureus Adhesion to Host Cells
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
total genus 92
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18483 Bact_lectin Bacterial lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4m01A01
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 4m01A02
5GLWA 2DUPA 4M3CA 4U36A 1KQRA 1SLAA 2W68A 2ZHNA 3R4UA 4M01A 3PMEA 4YW5A 3WDVA 1S0DA 3M3QA 3DUIA 2PHXA 1QOOA 2DURA 2DUOA 1DLLA 4DS0A 3WDXA 2LALA 3AP6A 5CNAA 2GNBA 4ATEA 1HQWA 1QGLA 1S0JA 1ULEA 3HMYA 1MS4A 2C9AA 4FOYA 1UAIA 1N1VA 2DUQA 3N7JA 2D6KA 4Y1YA 1QNWA 3M1HA 4HL0A 1ULDA 5GZCA 1GZ9A 1QOSA 2DTYA 1HQLA 3WHTA 1GLHA 2GMMA 3ZXLA 1OFSA 3QCWA 4Y22A 1JUIA 3WNXA 2AUYA 4K20A 1AJOA 4YLZA 2ARBA 3VKOA 1V6MA 2W52A 4ZXKA 4BMBA 3V0AA 1SCRA 3FLPA 4M02A 3FUOA 2OUJA 4BM8A 5IUQA 2NP0A 1MZ5A 1DQ4A 1JHNA 4DQAA 1LESA 3WDTA 4XTMA 5GLVA 1LU2A 3POYA 1MR5A 3POSA 5H9RA 1S0IA 2PHRA 1WBLA 4U2AA 1CR7A 1LECA 2DWRA 3BIWE 4XJUA 5DZFA 5JLVA 5GJ6A 4H55A 2DVBA 3FLTA 1V6NA 1SLIA 2EXIA 3M3EA 4C1XA 2DV9A 1N47A 2ZGSA 3D4KA 3MEPA 4P9YA 1W6PB 4YM0A 5JOYA 4R9AA 5JDBA 3AYEA 5GLUA 1S0EA 1AXKA 1LGCA 1GNZA 5GZDA 1QF3A 1SBEA 2A7AA 3AJYA 1IKQA 1GKBA 4TYSA 1WCSA 4Z8BA 1ULFA 2CNAA 1UL9A 1BJQA 4XMIA 4YW3A 2PHUA 1WLCA 1WW7A 1SBDA 1N1SA 1V6LA 4FPOB 1KJRA 1A3KA 3N36A 3WDUA 1WD3A 1F5FA 2A6WA 3WLUA 2E51A 2DYCA 1AJKA 1LTEA 4LBQA 1GICA 4ISRA 5FRAA 1WBFA 2A5ZA 2EXKA 2R16A 2Z42A 1KITA 4P14A 3RRDA 4AVVA 1CJPA 2CTVA 4FPLA 1MZ6A 4Y20B 2DU0A 4Q8KA 1W6MB 1JYCA 1UMZA 4BLJA 1C57A 4DFSA 3AX4A 2JD4A 2DTWA 1G9DA 1HKDA 1MVEA 4UW3A 3WDYA 4JRAA 2V5YA 3V0BB 2ZGNA 4UW6A 5KXCA 2WKKA 5H9PA 3O0WA 1GANA 1QU0A 5JMCA 1AF9A 4Y24A 4XJAA 3OYWA 3N7MA 4XZPA 4FQZA 2PELA 4ISQA 4YG3A 5CB7A 4K1ZA 3NV3A 1VLNA 2R1DA 1LHWA 1FAYA 1S0BA 3N35A 5T55A 1LGNA 4K21A 4XOGA 2WQZC 1WLWA 3N7LA 3POWA 1CONA 1W6NB 5EYYA 3WUDA 5CA6A 1RITA 2A75A 5HCAA 2D7FA 2ZACA 5IK5A 3T1MA 1LOBA 3V65A 2R49A 1R1ZA 4XIOA 4F83A 2NYYA 1AX0A 2VW2A 1CIWA 2AR6A 2P3JA 3AP7A 3AXDA 3USUA 4YM1A 1H30A 3ZXKA 5KXBA 3TAYA 2I2SA 2GALA 1JYIA 1YIFA 4XYXA 2AENA 2YXSA 4CRQA 1W6QA 2R0HA 4YW2A 1MS3A 3T2TA 1YO8A 5DUXA 1SLBA 3ILRA 1GSLA 1OKQA 1ENQA 3AZXA 1LOAA 1SLTA 4XBLA 1DQ1A 4Q1RA 2ZABA 4YZ5A 1VAVA 1URXA 1YXWA 1DBNA 1RINA 1WW6A 1FYUA 2NM1A 1FX5A 2D43A 1MS5A 3B01A 1ZA4A 4PQ9A 2WSUA 3A0KA 4XBNA 1V6JA 4XXPA 1PZ8A 4FP3A 3O0VA 5T5LA 1KDKA 1IS6A 1GNHA 4UW5A 3AYCA 3ZXFA 1IKPA 1Q56A 5E8AA 3R05A 2A6VA 2P2KA 4LBQD 4YGBA 3IMNA 3RQ0A 4YG6A 3AJZA 1S0CA 5FREA 1FV3A 4XTPA 4YW4A 3WG3A 4LBJA 5F9TA 1BXHA 1FV2A 2ZMNA 1Q8VA 1W0OA 1RIRA 2UURA 1BYHA 2DVGA 2ZGQA 2JE7A 4FVVA 3ZVXA 5IK4A 2JDZA 2ENRA 3FUQA 1DIWA 2D3SA 1MS9A 1H9WA 3SISA 5HCFA 2SBAA 5EXOA 1EPWA 3CNAA 4WVWA 4AYUA 1QOTA 1QNYA 4XXAA 3WVJA 3O5SA 3KM5A 3JU9A 1S1AA 2LTNA 1VALA 3GNEA 2ZMLA 1C1FA 5GM0A 1S0FA 3LSDA 2E53A 1WUVA 2GNMA 3SH4A 3D5OA 1O4ZA 2WSVA 1AZDA 1ENSA 3AP9A 3QLQA 4C1WA 3FFZA 4Q26A 2TEPA 2WNEA 3O12A 4Y1UA 3ZSMA 2YZ4A 1LOCA 2D6LX 1LENA 4AVTA 3OGGA 4R9DA 2JECA 1LCLA 2JE9A 1FNZA 4I30A 1W6OB 2NN8A 4M3CE 4WVVA 5SV8A 4AWDA 4FOWA 3A0NA 3VKMA 3ILNA 1AX2A 4YM2A 4BQ1A 2R1BA 3MW3A 1DQ6A 4GXLA 2NMNA 3WV6A 2WLQA 1LHUA 1LHNA 1JN2P 1D0HA 4K1YA 3W58A 3U4XA 3SH3A 4ITCA 3RMXA 1X50A 3OBTA 5JOZA 2DVFA 3AP4A 4XHXA 3A4UA 3T1LA 4CTEA 4YW1A 1D2SA 1DQ5A 1MVQA 2WT0A 5GALA 3WDWA 3BTAA 4JCKA 2PHWA 3IKWA 1WW4A 3LCPA 5GLTA 4YZ2A 2W39A 4FPCA 2VY0A 1F31A 2DU1A 1LJ7A 3OJBA 3FLRA 3M3OA 1GZCA 1SBFA 2ZGUA 5H9SA 3SNMA 1LHOA 2CWSA 2D3PA 1LU1A 3B00A 4Y1ZA 5F5QA 1DGLA 4M3CF 1C1LA 3SH5A 5IT6A 4MYEA 3ZYRA 3NWKA 2ZGRA 4XE9A 1QDCA 4GALA 4HANA 4AGVA 3LSEA 2DVDA 1DYKA 1APNA 4PBOA 1AXYA 3UK9A 2UWAA 2WJSA 2WT2A 2ZBJA 4GKXA 4XJZA 1GV9A 4Q2FA 1UN1A 4SLIA 3JUUA 3DGTA 2UWBA 1KRIA 2A3YA 2JJ6A 4M00A 5GZFA 1W6MA 1Q8QA 3AYDA 1WW5A 2AH2A 1ULCA 3AZWA 2ZGTA 5T54A 4TZDA 1KJLA 2GMPA 3GALA 1G86A 3HN1A 5GLZA 2NZ9A 1SLLA 2E7QA 3ILFA 1QMJA 1SCSA 2ZHKA 4FP2A 3PVEA 4XILA 1LHVA 4AGGA 3WCSA 2CL2A 3V0BA 2OUHA 2ARXA 1PZ7A 2SLIA 1GZWB 2D6PA 1CVNA 3PJQA 3N3HA 1Z0HA 4D69A 5AVAA 2D44A 5DG2A 5IK7A 3ENRA 2P37A 3OYWB 1N3OA 3AZYA 2ZZJA 1I1EA 2XG3A 5DZEA 3WOGA 2ZGLA 1MS1A 1IOAA 1DYPA 1LULA 1G9BA 1U0AA 3NV1A 2AREA 3IPVA 2A6YA 4FPHA 3WG1A 2OVUA 3N7KA 2R0FA 3APBA 3WG4A 2ZHMA 3RSJA 1G9CA 3OBRA 2ZGMA 3I4IA 4UW4A 1JOJA 4R9CA 4LBMA 3UJOA 4XHBA 3WCRA 4Q8LA 1WD4A 1LEDA 3OY8B 4XJ8A 3RS6A 4BMEA 3WG2A 2ZGOA 2JKBA 4R9BA 1ONAA 4XBQA 1DZQA 1W6QB 5E89A 3AZZA 1AX1A 1DQ2A 3INAA 2KYWA 2VU9A 3D6EA 4M3CB 3I8TA 1B09A 4PCRA 3O0XA 1FNYA 2AGSA 1XQNA 2CWMA 4YGCA 3WZ1A 4CZSA 4YFZA 3IM0A 4ZKTB 4DRVA 2GN3A 3PVOA 2KT7A 4AVSA 3FBYA 2A3WA 4YZ1A 3M2MA 1OQ1A 2ZGPA 3NV4A 3Q9OA 5IK8A 2H0BA 2CYFA 5DUWA 3ZPYA 4ATFA 3VUOA 5DUUA 2DVAA 5KXEA 2EAKA 2E7TA 4WV8A 2GNDA 1GYKA 1CN1A 2UWCA 1N1YA 1QKQA 1S0GA 4FOVA 5DG1A 3B69A 1JXNA 3UJQA 1YRZA 1UZZA 4WZFA 3VKFC 3RMYA 1CPNA 1J1TA 2VUAA 1W0PA 2EALA 3KQRA 1CESA 1G9FA 2ZGKA 1FATA 4Y22B 1UX6A 4XIKA 1LEMA 1Q8SA 3MPPG 1ULGA 2FMDA 3IN9A 4XDQA 3B9CA 4IQPA 2EXJA 2Q5TA 2EF6A 1ZM1A 1N3QA 2VW1A 1IS4A 1DHKB 4FOQA 3V0AB 2ERFA 2OW4A 5JOWA 4NOTA 1JBCA 2C5DA 1QDOA 5JVVA 1HDKA 2FHRA 4BPZA 4BLIA 1A8DA 5EWSA 4YZ4A 4BOWA 1DQ0A 2A6ZA 1KDMA 1C4RA 2PHFA 3R4SA 2A70A 2AYHA 4PBPA 2G4IA 4P9WA 1UPSA 5GZGA 1V6KA 3AZVA 4FPGA 1LGBA 1I3HA 1V6OA 2D6OX 3NV2A 5DXDA 3M3CA 5T5OA 1JW6A 1LOFC 3MW2A 4Q1PA 5T50A 3AXEA 2VXRA 4L8QA 3RG0A 3AFKA 1MACA 3UL2A 5T52A 2HYKA 5BYNA 1W6OA 4XJWA 1W6PA 1NXD1 4YGEA 2KVZA 1PZ9A 2B7YA 1BQPA 2YY1A 4PF5A 1SFYA 4NO4A 5CBLA 2GNTA 3H0OA 1AVBA 3WUCA 4P9XA 2XB6C 1LOGA 2A3XA 1SACA 3ZSKA 4JC1A 5DUVA 4FPYA 1IS3A 5KXDA 4RL7A 2YROA 4DRRA 4XJ9A 1LOEA 1UKGA 4FPFA 3TB0A 4FPKA 2V73A 3ZXJA 1G7YA 4LBQB 4XMAA 4Y1VA 1Q8OA 3ZSJA 3V64A 5CAZA 3BODA 1Z78A 1HLCA 5L73A 1N1TA 3AYAA 4Y20A 1WLDA 2CY6A 3WHUA 5JOXA 1VAMA 1CQ9A 2EIGA 1CPMA 4YGDA 4FPJA 2BQPA 4FPEA 1AXZA 1DFQA 1TEIA 2P34A 3VKNA 4YG0A 1IS5A 5LK5A 2RHPA 2W08A 2D6NA 2WT1A 2P3IA 2D6MA 2PHTA 1G8WA 5DZGA 3VV1A 2YV8A 2EXHA 2P3KA 1SLCA 3ZYPA 4ASMB 4Y26A 1G9AA 4OZXA 3AK0A 4W65A 5HCBA 1LODA 3VKLA 1V00A 3ASIA 4RA0A 3ZSLA 4LBNA 1GZWA 2D3RA 2E6VA 3B3QE 5GZEA 2ZMKA 1W6NA 5T5PA 4LBLA 1H9PA 2VH9A 2ZAAA 1A78A 2KM2A 3BOPA 4GWMA 1NLSA 1UZYA 4LBKA 1YI7A 2UU8A 1N3PA 3OPZA 4GWNA 3W59A 3AP5A 1V6IA 3HR9A 4DPNA 2YMZA 2ZKNA 3USUB 2VW0A 3IPVB 3L2YA 2A71A 2GMEA 1O4YA 1GBGA 2ZHLA 3ATGA 4LBOA 4YM3A 3ZXEA 4GA9A 5T5JA 1Q8PA 2GN7A 3C2UA 1ENRA 1YYNA 2GDFA 1MS0A 4KBBA 3SLIA 2NMOA 4Y1XA 3PVNA 4FQ4A 1F9KA 5EYXA 3SITA 1Y7BA 2ZA9A 1VIWB 3OY8A 4YZ3A 1MS8A 4YFWA 1BZWA 5H9QA 1BKZA 4Q27A 4AGRA 4GKYA 2A6XA 3MW4A 5E88A 1LOFA 2ES3A
chains in the Genus database with same CATH superfamily
1ISNA 3M3QA 3AV8A 1J3QA 4Y5SA 2KFKB 4HKWA 5KHGA 3HMYA 1ULEA 3LF7A 1C76A 5BV6A 1TZOA 4C0BA 1ULDA 2VUDA 2WS93 4JTNA 3ZXLA 1QXRA 2RR11 1V6MA 1CX1A 2Q30A 4AFDA 1C8M2 1WCKA 3VBOB 2Q5WD 1PYWD 1RC6A 3MJ5A 2MBQA 3K3OA 3VBFC 4M0HA 2FCTA 3D82A 4KNCA 1PGL2 1H2LA 1SLIA 4ZDVA 4P9YA 2ZGSA 4XX5A 2K6QA 1IKQA 3BI3A 1CZVA 2W95A 1N1SA 2WZR3 1A3KA 3CL1A 5BNOC 4B0EA 4R3DA 4JDNA 2B5HA 5FRAA 1F5JA 1WA6X 3B1LX 4WJOA 5L36A 2NCNA 4LLFA 4HPKB 3J8F3 5J09A 4CYEA 4NAWB 5HBAA 5E1RA 4RMAA 1AF9A 1QOFA 1ULPA 2KXLA 1LNSA 3VDDC 2J1RA 2Y34A 5A1FA 1GNUA 1WA4A 1AL23 2R1DA 1FAYA 1ASJ3 4XFIA 4ZY9A 3ZNGC 4WWMA 1SE2A 4IEPA 1BMV2 3RYTA 2IO0B 4XIOA 1RYYA 2RJ2A 3AP7A 1AYFA 2L1AA 3H1WA 2JDUA 2IZWA 2GBMA 2GALA 4M4RA 3ZMOA 3BTXA 1OFFA 2AENA 2LUEA 1NCQC 1R083 4IKGA 3WALA 4PQ9A 1H6XA 1HB3A 3IFWB 3LA3A 2VR4A 1CZSA 4N43B 3H50A 1H0BA 4XVHA 5FPZA 2RV9A 2HWD2 2Y5BB 4WJQA 4F8AA 2ZKLA 4FVVA 2IXLA 2KDBA 3PDQA 5HCFA 4HVBA 5F3IA 1W03A 3ZKUA 1NG0A 3NNMA 3ZLZA 5LXHA 2KDIA 2FAZA 2GNMA 1W06A 1EU4A 5TR5A 3KYDD 3QX1A 5CFCB 2BEOA 3RMKC 4OZOA 5T3NA 3DYOA 2QQUA 5A32A 1ACCA 3HIFA 4B29A 3BVCA 2W9NA 4Q4W1 1QQP1 3EECA 2JD9A 3LCPA 5GLTA 4N8MA 4FBFA 5CFDB 3M3OA 2JB4A 3B00A 1J7AA 4JGYB 5F5QA 2OS2A 5IT6A 3PHXB 1C5HA 4FULA 1APNA 4BDVB 2DYMA 2C5LC 1GV9A 4SLIA 1RUC2 4TZDA 1PGAA 2WZPP 4KGQA 1GZWB 2RS53 1JYTA 3OYWB 1RUD3 2VZ1A 2MEV3 2HWE2 1LULA 1DU3D 2J52A 3WG4A 5JZGA 2KHWB 1G9CA 3N9LA 1D2QA 4LBMA 1F77A 5DPSA 3JVZX 5GMVA 1OMIA 1WGRA 1DQ2A 4BBNC 5FZ1A 1RUI3 4BJ0A 4EFOA 2MBOA 3LD8A 3DF0A 1YQCA 1OQ1A 1NI2A 2H0BA 2QQVA 1A8MA 2YGLA 4MSVA 2EAKA 2BOIA 1NLRA 1J1TA 4QKNA 4S17A 2GP5A 1CESA 1VBD1 4S0RA 3RFRA 3RYRA 3L9JT 3B9CA 3ZSEA 1GMMA 2EF6A 2IVIB 2ERFA 2SEBD 4BPZA 4GDKB 1TNRA 4DY3A 4JTOA 4YZ4A 1VPHA 3MLJA 3FILB 2Q1ZB 3S5AA 3RG0A 4NQKE 3N1YC 2VZ3A 4MADA 1UWWA 5CBLA 3NKTA 5KHOA 4AK3A 1M94A 4AS1A 3FMGA 3M70A 4MSMB 4II3B 4XZ4A 3DBSA 2K1FA 1YQ6A 4IGOA 5LBEA 3CF6E 1Q8OA 1UY0A 3V64A 1NVID 4DHJB 3WF3A 4JKKA 2CY6A 2XNAC 5FOBB 1VAMA 1CQ9A 3TUOA 3DYMA 1AR81 4YG0A 4H2AA 1IGCA 1TS4A 3PURA 3JQXA 1MVKA 4CCJA 5C70A 1K5MC 3ZSLA 1T6BX 1W6NA 1H1IA 1RXGA 2W87A 3MP9A 1V9U1 4I3GA 4ZHPA 3ATGA 4YXDB 5T5JA 5ACA2 4KBBA 3M3IA 2BNOA 3DWGC 1NKGA 3A9KA 2VQUA 3BN6A 4RGTA 5FZ0A 1SEBD 4NJ4A 3RJ2X 2VVEA 4LNIA 2A6XA 5D7GA 1W9SA 2ES3A 2IYDB 2Z2SB 4U36A 1ZVFA 4REZA 1POQA 3MBWA 4W9CA 2DURA 5A33B 4UAPA 2GNBA 1W8OA 3N7JA 3O14A 2ZNVB 4QPWA 3WCQA 2KFJA 1OOPB 1AYM1 5A6XA 3SCHA 1J3RA 2WDRB 5C5UA 1SDWA 2R061 2LGXA 4NWWA 1QOSA 2GH2A 3NNGA 2CAUA 3POGA 2GMMA 3OB8A 1B35A 2AUYA 5FZEA 4RGGA 1SCRA 3ZUNA 4BM8A 1EV11 2VC9A 2W1QA 3WDTA 3AMPA 1PX3A 3DVNU 3O1TA 3HQUA 1MQTA 2CGOA 4ZRKA 1GJZA 1WI0A 5A3OA 4TTGA 2E6XA 4C1XA 1Q0WB 3GS2A 4KG0A 5F3CA 3AE1B 1W8ZA 2XBO1 1YFYA 1POV1 2O14A 5DN2A 2IO3B 1WW7A 1QZEA 2LRPA 1WD3A 3CO2A 2E51A 2WXNA 5CIRA 4RQPC 4AI1A 5DAWA 4BB3A 2ONQA 4BQ5A 4FPLA 4INDA 1MZ6A 2DU0A 1XNKA 5C9AC 2JD4A 1E8YA 4K6BA 2IJ0A 1F9JA 3APDA 5J18A 3S6PA 4XJAA 4LNKA 5HV0A 5IA7A 2OQ6A 3SKJE 2WRAA 1K53A 3ZNZB 3AEBB 3GDBA 2FDHA 4XFAA 5EYYA 5C8CA 3BALA 2D7FA 3HOBA 5IK5A 3RDIA 2ZS6B 2CHZA 5KXBA 1FMD3 4HCNB 1UNBA 4WWOA 3U78A 4CRQA 1NYRA 1GSLA 4TSSA 1WXVA 4WJNA 3RNSA 4Q1RA 3J7NA 4CEYB 3OJ4B 1RINA 3UI3A 1DOYA 1HB4A 2MCNB 2Y6FA 3O0VA 4UW5A 1JOPA 2BTEA 1XEEA 4DUVA 4B3NA 3LIGA 4DHJD 2RSUA 1R4NB 2UYZB 2D3SA 3PMSA 4LK6A 3QD6A 1VRH3 2DZMA 3ZIXA 2Q8CA 3VFKA 3ACGA 2BF8B 3APFA 3NVYA 1WUVA 2HWE3 1HIXA 3PLQA 2RDNA 4X6RB 4JVAA 3P4RB 4R8HA 2M8SA 4QX0A 4UFIA 3I2GA 1XJAA 4CDUA 3NS8A 1LHNA 3KLSA 2VO5A 3SH3A 3AP4A 4B6WA 3T1LA 3DHIC 1HJFA 4LO8A 1E8ZA 1YWKA 4CDXB 5H9SA 4KGSA 2WX1A 4Y1ZA 1C1LA 5L9RA 3W5MA 4BQXA 3RI8A 5A3LA 1AR71 4AGVA 3CJIC 3NJXA 4LHLA 4GKXA 2ZBJA 2BS3B 2UWBA 1HQNA 1K45A 2JJ6A 4M00A 4BHPA 4OW0A 5HPOA 2GMPA 3HNMA 3PVEA 1NXMA 4X8PA 3JB8A 5J98B 4MXVA 5ANQA 4V1PA 1JZ7A 3AKPA 1W2NA 3Q3MC 4X6QB 2IBIB 3VTUA 2KJRA 1WM2A 3I49A 1ZZ6A 4GH4B 2KK8A 4FAHA 4RGAA 4CXXA 3HJRA 1LEDA 3BWUD 1FNWA 4GMP0 2BERA 1W6QB 1KLUD 2HYXA 1Z7S2 3FWEA 1ND2A 1ND3B 1IQAA 5EE1A 4EV0A 3M62B 2GNDA 1XE8A 1GYKA 4E27A 1ODMA 2HWB3 3DPRC 3VRBB 3AB5A 1YRZA 4AHYA 1CPNA 4US8A 1G9FA 4IWOA 1LEMA 2D07B 3LQCA 5JZEB 1YX6B 1W8UA 1H2KA 5LNK1 2FHRA 4N53A 1OD3A 1W2TA 5EWSA 2VNGA 5A7WB 1YFUA 4FAGA 4FFIA 3NV2A 3M3CA 3AH7A 2BVVA 5BYSA 3ECIA 4YGEA 1XCQL 2WFPA 3KWVA 3H0OA 4HWIB 1H6YA 4P9XA 4A6SA 1SIJA 5J17A 1LOEA 2FMYA 1YN4A 1N1TA 2RJLA 5FY1A 2HJ8A 3IG3A 1SPPB 4CUBA 1UMHA 1CPMA 1SJHD 3I3QA 4K81A 3TN92 3IAPA 1TE1B 1H1AA 2D6NA 2LJIA 3ZN6B 3IXSA 1YN3A 3Q14C 1LODA 1VBA2 3ASIA 4GD4A 4AI9A 4NY0A 2RJKA 2BPA2 2GOWA 4WJPA 3USUB 5IVVA 2GMEA 3I3BA 5ISLA 5D6JB 3I3MA 1O7FA 4LXLA 3A9JA 4QPGB 2W46A 3SKVA 4QPIB 3EHKA 4IEUA 1PMJX 2J4XA 2Y5CA 3T4HB 1U4AA 2MH7A 2Q8EA 5DABA 1JRPA 2VUJA 3C0RB 2YFUA 3C7FA 4XZUG 3Q8EA 1FXTB 3EFCA 4H7LA 4D7YA 1YX5B 3AKRA 3M1HA 3GOEA 2PLV3 2KOXA 1D5ZC 2KDFB 5F8PA 2DTYA 1TMF2 3N1XC 2FCUA 1QJY1 1F4HA 3AE9B 5F1RA 3DHHC 1WRDB 1YOVB 2JRIB 2DF7A 3ZNHB 3BIWE 5DZFA 1KD7A 1V6NA 3M3EA 4XAEA 4URKA 2X38A 1RXFA 2WNVA 1VR3A 5FTTC 4OVEA 5FK9C 2QILA 2PMVA 2R041 5D8AA 3C7EA 1W2AX 1SBDA 3NRZA 4GB9A 3J26N 5FJHA 4B7KA 4AI8A 1VBD3 1WBFA 1SFNA 1J83A 2VOTA 4PLMA 3VBOC 5FR6A 1RJ7A 3OGJA 4Q8KA 1HJGA 4FXKB 3N20C 1MVEA 1NA1B 2BPSA 2WWZA 1ZZBA 2DBNA 1KLVA 4PS7A 1RUJ2 2LM3A 2RMU2 4AOCA 1E7PB 4FQZA 1NDDA 1L2NA 3MI8A 1JZ4A 2NPTA 1LB2A 3RZGA 3FE5A 3A7QA 2PE6B 3POWA 3O1MA 2KTFA 1EUTA 1GNYA 1SG3A 4HK8A 1IPGA 1RHI2 2OQ7A 1G6JA 3U4EG 2O2VB 3ZR5A 1V8CA 3M4FA 1DQ1A 3KV5A 3RJRA 5EE0A 1ZRFA 3CMGA 1IS6A 2MHFA 4YW6A 1H8TB 5FP4A 1AR83 1BK0A 4LO6B 5FYUA 1JW9D 3AE3B 5F9TA 1FV2A 3AKSA 1RIRA 2JE7A 3WP4A 3HBZA 4XF3A 3IIIA 4QQLA 4WVWA 4R4XA 2WXMA 3OOXA 1XNTA 3H42B 3WINE 3U1XA 2GH8A 2ZMLA 2LHEA 1L6VA 1WE7A 3ZDMC 2Q8OA 5B2GB 1FOD2 4YTPB 4ITKA 2VZSA 1OD5A 3ZYFA 4FTSA 1PO22 3DOWA 4WQOB 4N43C 2HEVF 3GZEA 4J6GA 3H7PB 5F32A 4BFRA 3ZMNA 2ZJCA 4NJ6A 2JDHA 3K48A 2VQAA 1X8MA 4ARYA 3L54A 3NJZA 5F7UA 1BEV1 4M3CF 3N3KB 1MEC2 1AR61 5ERLA 1XLPA 3Q3NC 4HJKA 3POEA 4XJZA 2ZZQA 1W6MA 3AYDA 5CFCC 4RHV2 1UUPA 2NBVB 1WLTA 2OPKA 1OC1A 3NVWA 4S2GA 3V0BA 2KXJA 2ZEWA 1NQJA 4Y3OA 2W1UA 4ZU4A 4D69A 3BINA 3QACA 1F2RI 2WA4A 4RNAA 1EAH1 2R0FA 4KVGB 1BLZA 4BXFA 5FLIA 3M7AA 3OBRA 5CFDC 3UETA 2JG8B 2XBO3 2INCC 3OY8B 4EQVA 1UIKA 1HRI2 2JKBA 3BIEA 3V61A 3I3DA 2KYWA 3K51A 1PM7A 3I8TA 4YTMB 5KHKA 4QT6A 5FO7B 1YQBA 4DRVA 2CHHA 4YZ1A 4F3JA 3U0ZA 5A3NA 3GB1A 2WNMA 4ASKA 3B5LB 2UWCA 2YFZA 3TN93 3VKFC 1T0RC 2VBPA 1WE6A 3HM3A 1VBA3 1J7CA 1IS4A 1FPN1 2OW4A 3BYTB 3UGBB 3W1YA 3L17A 3VBHA 1QDOA 1PK6A 2HKXA 3JXSA 1HXS1 1REDA 4AQ7A 3WXPA 4H14A 2J1VA 3GP7A 5T5OA 2I2YA 1RUG2 4NUBA 3KF3A 1YIWA 4QQPA 5BYNA 1RJ8A 1XSRA 1LRHA 1PZ9A 5F3EA 3IWZA 4XDPA 1W8TA 3MGUA 2YG0A 3LDBA 5KHJA 2LROA 5FY9A 4I3PA 2QDFA 3W1SC 2JG9A 1X1MA 2QQPA 4W9JA 4P16A 4FPFA 5LB6A 4XCBA 2R072 4IV3B 2VNOA 4QWNA 2YB7A 2Q4SA 1B9RA 1RUE2 1TMF3 3LPFA 3KF5A 4RGMA 1SLCA 4XW3A 5HCBA 2VCMA 4QGMA 4XCAA 5DDJ1 1EP0A 1SE4A 2QSDA 4DXTA 1D4BA 1V86A 5I8SA 4LBKA 2Z0EB 1N3PA 2Y38A 2RDRA 2ZX2A 2ZKNA 4GDLB 4L97A 4S2DA 1ZRDA 4XFCA 2XLGA 2DX5B 2Q1MA 4AAXA 2BT6A 1LOFA 1AR73 4XFBA 3WP5A 2XK5A 4MUVA 3PMEA 1QJX2 1GOHA 3WDXA 1MS4A 2C9AA 3J7HA 2JZZA 1WMFA 3WW4A 5FYVA 1T6GC 1HQLA 1XLNA 2IFRA 3BYYB 3WNXA 4GB33 1QKZA 1WGPA 3AEAB 1VBB2 1WWYA 2ARAA 2VTFA 4PIYA 4QB2A 1ZX5A 2NP0A 2GC2A 4XDOA 4XTMA 3SMHA 5A3UA 4COUA 1VD2A 4RS5B 5T8IA 2WHIA 1RHI3 2XLAA 2OA2A 1RVF2 4TKNA 1U5XA 1W6PB 3SXWA 4QAWA 1S0EA 3U4SA 2G9GA 4CCKA 5KHQA 2ZNVC 4AXOA 3DCQA 1OQEA 1W39A 3PIGA 3ZDVA 1OEYJ 4LBQA 4XUTA 3WF4A 4DXSA 1GWLA 1C57A 5BY5A 3W9AA 2MPFA 2K9XA 3WDYA 4DMIA 4JRAA 2L76A 4DHZB 3MC0B 3NKGA 4UW6A 3RZWC 5I8TA 1WZXA 3N7MA 4ONUA 2OXBA 3ZDSA 1IHMA 1LHWA 5E16A 2WQZC 2Z59B 3IT6B 3ZJVA 3TCAA 2WXJA 2MLBA 3V65A 1I5ZA 1J59A 1Y8RC 5BMGA 5FMOL 3AXDA 4YM1A 3TMPB 4LDTB 3MFGA 2HWF2 4IV1A 1CIYA 5G55A 1Y9MA 3JYUA 5BNPB 1ENQA 1UU6A 1U5YA 1UMIA 1MS5A 5H92C 4BH9A 1Q56A 2FDJA 4OVVA 2F4PA 2RR12 4AHWA 3K4AA 1O4TA 1BXHA 1CAWB 1Q8VA 4NMIA 2DBYA 2KA3A 1ZZ9A 4CSWA 4RHV3 4XDDA 3RT3B 3X23A 2F17A 1UX7A 5LASA 5C4WB 4EOYA 4C91A 3GNEA 4HMZA 1HN0A 2WQ4A 4XC9A 2BWFA 5FYCA 4WM7B 4CEWB 3HNYM 1WMEA 2E33A 4OULA 3EYPA 4CEYC 5CVRA 3PRMB 4R9DA 2YEPF 4CA9A 3VKMA 4HG6B 3VBSC 2QQNA 1BT0A 5K7PA 2IO1B 4ITCA 4KDIC 1DQ5A 1CGPA 4E8CA 1SXTA 4JCKA 5FXXA 4IM2A 2L8JA 2DZKA 2DU1A 2KWUB 2IWGB 3ABZA 1RMU1 2VXJA 1YJLA 3SH5A 2KWCA 1DP0A 3NWKA 1PVC1 4A6QA 1QDCA 2GSYA 4LCDE 3OPTA 4KL1A 4A44A 2UWAA 4X57B 4HDOA 1AUYA 2MJDA 2D11A 1NBFC 4MO3M 1IG0A 3FC0A 1UELA 3IBMA 2ARXA 2DCKA 1Z5SB 2N1WA 3R2TA 4COZA 2D44A 3AE6B 3NL1A 4MACA 1D0GA 4LEJA 4B4PA 2BBVA 4WZCA 4CDXC 1AR91 4O61A 5BYQA 4R9BA 2H0VA 4LPLA 5F5AA 1WMHA 3U52E 1V80A 3IMMA 5JXHA 1IGDA 2NBUA 1F4AA 2R073 4MGQA 5DUUA 4MGKE 4IUMB 1N1YA 3CU7A 4K3CA 2D3BA 4OVZA 2CSGA 2VVFA 1GFF2 2IY1B 3P4PB 2JZPA 4ARCA 3NVVA 3ON7A 1PIV1 3IN9A 4XQ4A 1W9FA 2NPIA 4GH4C 4JE3B 3HD8B 5EHDA 4XUQA 1XB9A 2B76B 3DBHI 2E63A 4Q4W2 4AJYB 1QQP2 2BNNA 3A23A 3PUQA 1XQQA 1ND3C 3UGHA 4LDTD 2WO2A 1WXAA 2OPWA 1IZ3A 3ZR6A 4HDQA 2LXAA 3UNPA 2A3XA 4BCUA 2A4ZA 2VMIA 2WO3A 1HA5A 2VZRA 2DAJA 5C5TA 2LJ5A 3H7JA 5C1ZA 4IOIE 1XYOA 3ZSJA 2Y6KA 3JB4C 1O6UA 3THDA 1KOTA 3IIAA 1WLDA 1XLQA 1W9WA 1VBE1 4FPJA 4K7SA 5I0TA 1K5JA 2PHTA 4FFGA 1OGWA 1YQ4B 1W05A 5HCHA 1FD6A 1CD3G 4PT5A 5L9BA 2YYOA 4D0QA 1V81A 2TSSA 2CAVA 3HEIA 4MM3A 4I6PA 2ZMKA 2VOVA 1VBC1 5A3TA 3ZFFB 1AYN3 3PRPB 2W3SA 3DBHB 3NAPA 5FYSA 1AWDA 2QC8A 3NJTA 4GMP3 5F3GA 4Y1XA 3PVNA 4CPBD 2ZVOA 1DGRN 3AMNA 1BEV3 3BTYA 4AGRA 3ZN5A 1X82A 4IDZA 3MW4A 2GI9A 2KDEB 4AL9A 2DUPA 1AR63 5FLHA 2ACZB 1WJNA 2H88B 3WY6A 2JICA 1OUSA 4DS0A 3OSDA 1ULOA 1ST8A 3PNAA 4G3YC 1PUTA 1PNGA 2KKCA 2JX9A 3GF6A 4NZLB 4P02B 4A45A 5E6OA 5FPAA 2BBCA 4H3WA 2JWZA 1QOGA 3U07A 1ZYBA 3BKZA 4O9EA 4O7XA 4ZXKA 4BMBA 2LVQA 2OUJA 4B4QA 1MZ5A 5D1IA 4QPIC 4DQAA 3X0WA 3VBRA 3W9CB 3TBDA 2XPJA 3DBLI 3O13A 4XJUA 1COV2 4H55A 4YM0A 2G4DB 3POJA 1YUDA 1SBEA 2RM21 4XE0A 4JGYA 4B95A 4YVWB 2GC0A 3N36A 1FRRA 2JVCA 2F4LA 3HNBM 2N7DA 3GZUC 2H89B 5E6PA 1KITA 3HWJA 4ICUA 2KLCA 3KT1A 3O7OA 4ZOHC 1Q43A 2DTWA 4AI3A 5FZLA 1V9U2 3O0WA 1CAVB 1EWCA 4W6WA 3OYWA 4XZPA 4MV2A 3B2GA 3HVZA 1HB1A 1VLNA 5EFUA 5JR7B 2L0FA 2A75A 2RS33 3QJZA 1R1ZA 5EJ1B 3DBLB 2UY8A 4H7MA 2ZX4A 3MIBA 3VBUA 3HN3A 2R0HA 5FY7A 4GOCA 1LOAA 5FBJA 1BVP1 4Q0UA 1AYM2 1EUVB 1ZBA2 2AZ5A 1LR5A 4DUXA 2TBVA 4YZ5A 4L2YA 3AYCA 1NA1C 4E2QA 1NZIA 1Q5WB 4L23A 1GZTA 3WW2A 1K51A 1IPSA 2ZGQA 5IK4A 2HWC1 2BGCA 1EV12 4ZU7A 1TS5A 2JT4B 1QOTA 4JIOU 2D97A 3Q6BA 2LTNA 1OQDA 1SE3A 4GDKA 1UWMA 5C2TB 4LR4A 1X33A 5IHRA 3V6EB 5I8YA 4OHWA 1V6EA 4UOJA 4GSWA 3FILA 4RR3C 4Y1UA 1LOCA 5LEJA 2RS12 1LCLA 1FNZA 4I30A 2ADDA 3RNBC 2R1BA 3NJYA 2F6BA 1H8TC 1K52A 3PPAA 3LWCA 5GALA 3RN9C 1C77A 4WM8B 4NHXA 3RZMA 3PS6A 1IP9A 1EPZA 1LJ7A 2VH2A 5AC92 4RGNA 4LE3A 1DGWA 4IM3A 4NQLB 4IXLA 1AHSA 2KO3A 2JIJA 3I59A 1G86A 3KQ4B 3AMQA 3ZGZA 1DGWX 1BBT1 1GQGA 4JQRA 5IW0A 3AEFB 1AL0G 2GBKA 4A7KA 2AACA 3AZYA 1O5LA 3KGLA 3KV4A 3WOGA 1JWMD 1DYPA 1U0AA 1HRV1 4FPHA 3RCZA 1WGKA 1GB1A 2ZHMA 4XFHA 2GMIC 4GXBA 1CWPA 3I4IA 1JYXA 2WO7A 1JOJA 2PAKA 3FX3A 4AEDB 4MXWB 4HROA 2W47A 4YSYB 3I2FA 3SC7X 3OTFA 4IWPA 2QUOA 3CSTA 5A33A 3V60A 2VVDA 1NENB 4IGQA 2ILMA 3VBFB 5IK8A 4WAAA 1OOPA 4PQQA 4FOVA 4DO0A 2XOMA 3CMMB 2CDOA 5LW9A 1RUOA 4QDSA 2VW1A 1N3QA 3T3NA 1OSGA 2QE3A 2JG8C 4MX3A 4I09A 5FZ9A 1UGJA 2L32A 2IVJA 3R7QA 2G4IA 1F0ZA 2YUEA 1ZBE1 1E7VA 5FV3A 4NPLA 1M06G 3E6BA 2AL6A 2PEAA 2C1FA 4IW0A 4Q4Y1 1QHDA 2KVRA 3CJXA 5CZKA 4BK5A 1TZ1A 2N7JA 4AFAA 5FZ6A 1HLCA 3KVFB 4AJWA 3UQBA 2W9XA 4QX5A 1K8RB 2BQPA 2OZJA 2RHPA 5BPXA 4K40A 3D0JA 3L2HA 4E4SA 1F2RC 1X36A 1WZ3A 2YV8A 2VRRB 1G9AA 2KQ4X 4RGOS 3DVGX 4JZRA 1RFAA 2XGXA 1FCLA 5T5PA 3T2OA 5G2NA 2V1YA 5EDSA 1YMHE 1COV3 4DPNA 3USSA 4BVUC 4RFT0 1REFA 3ZXEA 1TME1 1KEXA 1UNSA 4IV3C 4YYOA 4YFWA 5FZGA 5LBCA 3DYPA 2WXFA 1E0ZA 1BK1A 3BUCA 2E3TA 4HPPA 2QQLA 1PVC3 2OJWA 5JXIA 2PHXA 3RPQA 5E6HA 2CS4A 2K8HA 1WM3A 4O1NA 3VTVA 3NZUA 2KN5A 1O5UA 4IE5A 4BKGA 4K7UA 2Q8DA 3AM2A 2IFWA 3PTRB 2LXCA 3POFA 3QCWA 1EU3A 1YQ8A 1UZVA 4AI2A 3T3YA 4L11A 4L9BA 2RDQA 2QBXA 1CAXB 4LLOA 2PHRA 1R091 1YC61 4M0WA 3R6SA 3W20A 1LECA 3CIRB 1JCKB 5JXGA 4R9AA 1IG3A 5JDBA 3ALQA 1WGDA 5A7NA 3Q3OC 4TYSA 4AFCA 4P5HA 3PVLA 2FDGA 3URYA 4I0WB 4YW3A 4MOAA 2JPHA 5IWFA 1RUF2 2L83A 5D94A 1WYWB 5I0DA 1PNFA 4MGYE 3ZFEB 1PIV3 1E7UA 2BBAA 3K4ZA 1DYQA 3VD9A 1Q1OA 4RS5C 4PS8A 4LLGM 2V5YA 3ZYYX 1H4GA 4KMQA 1GPXA 1YJJA 2K39A 4XDCA 3MIGA 4ZYSA 1UZXB 2WS91 4YNIA 5FUIA 4BKSA 5K4LA 5JR2A 4GH4A 3R2IA 3K77A 3VGIA 4A90A 3RUIB 2J1SA 1W6QA 1GOFA 5A80A 2VMCA 1JYWA 2X5IB 1VAVA 1ROEA 3UGGA 4KDLB 1YN5A 2K8BA 5AC93 3V3XA 2HE7A 3AU5A 2VQ0A 4YGBA 1VBE3 4YVSA 2G4SA 4JRLA 1SZBA 4CQNA 4BQWA 3OLMD 3CNAA 2O6VB 2DYOA 2WZR1 1D4M3 4HK9A 3RPFC 1C1FA 1OTRB 4I02A 3LSDA 1EY2A 3SH4A 1GUAB 1AZDA 2XHKA 5FY8A 3B0AA 1OLRA 2LW8A 3AP9A 4KQ7A 3T30A 5BNPC 3ENEA 3J8F1 1PO12 3J7LA 4AWDA 1QXPA 2MP2A 1GP5A 2R042 2XN9C 4JWSC 4DEVA 1AL21 2Y0OA 3I2KA 2XHNA 1ASJ1 1K5MB 4AHZA 3KT7A 4CP1A 4RFBA 3POBA 2G1EA 2PHWA 2C7HA 3EXUA 1N5WA 3T4VA 3VR9B 4CDWC 5C4WC 1R081 3MV11 1JRUA 4HANA 2VOKA 1H4RA 2BRTA 1C5IA 1GOGA 1IBXB 1XE0A 4WM7C 3GJBA 4CEWC 2A3YA 4EZHA 5LWBA 1ALYA 1SLLA 2CL2A 2WXLA 3WR0A 3A1QB 5DG2A 2RPQA 2DCJA 2P37A 1N3OA 2QEJC 3PZDA 1W3VA 4IEZA 4D7TA 1RL3A 4CO7A 3H9AA 4QPGA 3EC8A 3LPGA 3O1UA 4MG2A 2RPVA 2RM23 3RS6A 1XE7A 2OT7A 4HSJA 3ONSA 2AGSA 1WJUA 2A3WA 2YBPA 3NV4A 3Q9OA 2CYFA 3ZPYA 4J6IA 1JODA 1TY0A 3J9SA 1S0GA 1XC6A 2BJSA 2P17A 1W0PA 1N63A 3P63A 5M0TA 1GQHA 2EIDA 4HVRA 1Q8SA 3UKTA 1XOYA 2CJNA 3MYXA 5FZMA 3TNPB 4HKZE 4RQPB 3Q69A 4OQ9A 2YPJA 3ELNA 5DXDA 3LZZA 2WDTB 2NLRA 5C9AB 1CJEA 1KFUL 1X7NA 2XJTA 2JDAA 1Q3EA 2XB6C 2BYFA 3AVRA 1YQ2A 1UYXA 3AULA 1LOGA 4AF9A 5A1AA 4FSJA 3BK2A 2R61A 2HWC3 3VZMA 4XMAA 3VLBB 4FTEA 3EA6A 5IAXA 4PS3A 3A21A 2XXZA 4O9GA 4BK4A 2WXKA 4KKIA 2O6VD 3I2HA 2KACA 4JGZC 2WT1A 2FCVA 3ZM8A 4A20A 2LUMA 4MGZE 1TKGA 3LGRA 2OOBB 1R7SA 4NHMA 3AEDB 4LBNA 2ZAAA 3TWIA 4AWJA 3HHMA 2A71A 1CMXB 2EVXA 3JD73 3ZVVA 3VD4A 3ZIMA 4D7SA 2O2VA 5EYXA 3T8MA 4ZZ5A 3I97A 3OBAA 1QT9A 2VE1A 2QQWA 4GKYA 4KX6B 4YWGG 4UWDA 3R4UA 5F39A 4M01A 3PHMA 1RUF3 2ZCBA 4ATEA 1S0JA 3WSOA 5F6LB 2VM9A 2WWJA 4TLGA 4QKDA 1OPOA 3WQBA 5GZCA 1BBT3 4AE2A 3ZFFC 2V4VA 4RYDA 4CCCA 3IAM1 4DWFA 4Y22A 3ZRFA 1AJOA 1HRV3 2D10A 4NHLA 3TRSB 4OFGA 3M95A 3CJIB 1W9TA 2WNUA 3ACFA 3POYA 2PVOD 1H8VA 4ACFA 3R4DB 1C8M1 5A32B 4OYUA 5LLIA 3BZDB 3NNFA 5GJ6A 3KW5B 2PVGC 2EXIA 1N47A 3DBRI 3AYEA 3OGVA 1LGCA 5GZDA 1QJU2 4QM8A 1PGL1 1A70A 1ZRIA 2JIGA 4NIAA 1ZZCA 3I54A 2CR5A 2D98A 3WLUA 1KJRA 4LO4B 1AJKA 4COWA 2LZ6A 2EXKA 2Z42A 5DDJ2 1DF0A 1YJKA 4Y20B 5FXVA 2R32A 4BLJA 3WW1A 1KXGA 3V6CB 1JMUB 4LNVA 1UYZA 1PMHX 5FP3A 5FZDA 4M8NA 2XWBB 1OHFA 4K1ZA 2PXJA 1S0BA 1FFVA 2WU2B 1PO13 5JZGB 3GHMA 2ZACA 1LXDA 3MIDA 1TT5B 1AX0A 1CIWA 1YD8U 3AMZA 3C8XA 1ZRCA 1BMV1 3DBRB 1FM0D 3QAQA 2ZABA 3VDCA 2BUKA 4OQ8A 5FO9B 2KMAA 3P1MA 4DXFA 3A0KA 2IC1A 4QB1A 4Q0SA 1IKPA 3BU7A 1O59A 4CXYA 1K3IA 2WDBA 3RZKA 4XF9A 4XTPA 3WG3A 3MUZ1 4CP9A 5JPNB 3HVDA 1L0VB 4EJRA 1KS4A 1KGYA 4XQDA 2HWD1 4QGLA 4YWAA 1UW8A 3O5SA 1S1AA 2MSED 3VQIA 3BPZA 1UPIA 2E53A 1OKOA 2NQYA 4J1WA 5G04L 3ZYJB 5HFYA 5I0RA 1QWRA 1TME3 1LM8B 4OZAA 4B8EA 4M3CE 3RZFA 5FQ0A 4ZS2A 1MG8A 1RUH3 1ZXIA 1CAUA 2IXIA 4P1CC 4N9HA 5K8SA 4DDGD 2KD0A 4LHNA 3ZXVA 1ZZ8A 2ZEQA 4KU8A 3MHZA 4AQ2A 4EWAA 1W8WA 1Y56A 5JSRA 1QXJA 4QB6A 1YNAA 2LS6A 5K9YA 2ZGTA 4UFKA 5T54A 1KJLA 4EROA 3PJQA 4GN1A 2X53S 4ARXA 1WIAA 5FYZA 5DZEA 3KS7A 4OUMA 3ST7A 4IEOA 1RLFA 2J0JA 3N7KA 4WM8C 1V97A 1VZ6A 4R4ZA 2HWE1 3E9SA 3UJOA 2XWJB 3A9KB 3NHEB 4CDQA 1MPXA 5D21A 4G50A 2RVAA 2FZ2A 1XNCA 5E89A 2NS5A 5TSSA 2JXAA 4MZUA 4MT5A 3PU8A 4N9IA 4I6LB 3PVOA 4OUEA 2REXA 4KU7A 5A7PA 2AWTA 5LZ6A 1SFPA 4K7JA 2E7TA 1CN1A 3R0RA 1V1OA 1QKQA 3MPBA 4CU9A 3RULA 1MHXA 4US9A 1OXCA 3MO4A 1DZRA 2E32A 5DCNA 4J25A 3OEAA 4E9KA 1I4GA 3TJPA 4AEDC 1KM7A 2D5FA 2WDQB 3AZVA 4FPGA 2W5FA 2D6OX 3H1YA 4D3WA 1MQTB 4Q0PA 3AXEA 3ZDTA 3AFKA 1MACA 1MZEA 1W6PA 1RMU2 2RR9A 5JSPA 4PI2A 3WUCA 4TQ0A 4E8DA 1JYVA 1XCTL 4EWDA 3VB9A 4JC1A 4JLCA 1JQ4A 4HT1T 4E2GA 1QJFA 3QH7A 3ZYBA 3FBMA 1WFYA 3DEMA 5JH5C 4Y4RA 2QDRA 2QZ2A 5FP7A 4IDIA 1XYNA 2CKHB 4JAAA 4URAA 2G19A 3ZTCA 3TEYA 2P3IA 2FCMA 4UDUC 1EF1A 2HWB1 1UOFA 4NIGA 1AR92 3E6DA 3AXCA 5C8CB 1NLSA 1YI7A 2WXGA 3SEBA 4ANXA 4IG7B 3H1MA 3O65B 1NYQA 2K0PA 4NE9A 4YSXB 3NZSA 3QH6A 1O4YA 2ZHLA 2IXHA 2NBWB 2NMOA 1VJKA 3HAGA 2JKXA 1NE4A 1BZWA 4Q4X2 3RNFC 3G6JB 5ACA1 2FUG1 4M3CA 1ENXA 2K3UA 4EWEA 1PGBA 1PM4A 2RDBC 1TKYA 5CNAA 5FAXA 5K0UB 4RCOA 1A5RA 3KH0A 1JALA 3ZN4A 4Y1YA 3WQ1A 5ABJB 1GP4A 4JHZA 5CG9A 4AW7A 2J1UA 2PFWA 3FN9A 3HQXA 2NMQA 1V70A 4N90A 3WAPA 3VKOA 4M8MA 3V0AA 3RZJA 2FE8A 5FKAC 2ZX1A 4WBBA 2X10A 4CU7A 1V2YA 1NY72 4CDUB 2VZTA 4LK7A 3X29B 4CPBA 3WQ0A 3A4RA 2MQJA 3HUIA 2V9HA 2GC3A 1H8CA 1GKBA 3N9PA 1XRUA 1BJQA 4TN7A 4W6XA 2R16A 1GG3A 3GBFA 2ORXA 3UV9A 1WMXA 4CUGA 5LBFA 1VBC2 4LITA 1PGW2 3ORJA 1YJIA 2ZVNA 2KTRB 3UIOB 1RWSA 1XF5L 2WGSA 4WVMA 1H4HA 2X09A 5C33A 1L7YA 2QHOA 2OKXA 2PLV1 2MJ3A 5FYYA 4NROA 1LGNA 4CCOA 2AQ2B 2WDVB 1RITA 1HQRD 1SF0A 4BU2A 1T3QA 2I2SA 3SU8X 2HTHA 3ZFEC 1S55A 1URXA 3B93A 1YXWA 1ND2B 2NM1A 1FX5A 3E5XA 1UY1A 3NO8A 4LMFA 2ZEZA 4YW7A 4LOTA 2WIIB 3LA7A 1FNVA 4UF0A 4KH9A 2ZMNA 1JMLA 2OJRA 1W0OA 3WQ7A 5LA9A 5KBFA 2ENRA 3FUQA 4FO9A 1MS9A 2JZ3B 3PT2B 4AYUA 4V2VA 5FZOA 4FN2A 3GZNI 1W8NA 3PRZA 4N53B 2RE9A 5ANNA 4W4ZA 2BWES 3RNAC 2QKDA 2RDSA 4OHJA 5FYIA 4ZRIA 3ZSMA 2YZ4A 2X5IC 5CHVC 3OGGA 1D6EC 2JECA 3Q2AC 2KQSA 4FOWA 3VL9A 5CKNA 5L7OC 2C0ZA 1V1PA 1L3JA 1OLME 5G5HA 3ZXAC 4YZ2A 4Q5OA 1QLBB 1MFWA 2Z79A 1SBFA 2YHJA 1D5XC 2VMFA 1XYPA 3P4QB 4PBOA 2QZ3A 1AXYA 1L5PA 2ZEYA 4HBNA 1LO5D 4KWKA 3JUUA 2WN3A 1KRIA 5GZFA 1W0NA 2BKFA 4MGSA 4DIQA 1WW5A 4PDWA 2XBBC 1S3SG 1S2EA 4JHTA 3EB7A 3ILFA 1YHFA 2N7EA 3WCSA 2OUHA 1ZRRA 3SD5A 1WSPA 2VL4A 3GZNB 2AEZA 3KVBA 3IT8A 1C8M3 3ENRA 2RDGA 2LRWA 4UBGA 2KAJA 1PFDA 4LK0M 2BDRA 3WG1A 4HETA 4JDMA 4M0NA 3H8UA 5CU1A 2PW9A 2I45A 1JWBD 4OI2A 4I0BA 5FPXA 4UFLA 2Y3AA 2VZPA 3I57A 2MEKA 3N9QA 5AZGA 5KHIA 2DHZA 3O0XA 4ZKTB 2GN3A 4AVSA 3BVMA 3PLUA 2J7MA 5IVBA 2ZGPA 1WCQA 3NZ3A 5HKHA 1Z7S1 4LJPB 4N59A 2NTTA 1KJTA 2E9QA 5DG1A 3U37A 5IP4D 4XDQA 2C24A 4FOQA 4A6OA 3ZFGA 1JBCA 3S5QA 1U5IA 5BNNA 2I38A 4N9F4 3RZZA 1YCIA 4DINB 3ZKJC 4BOWA 2VZKB 1KDMA 2PHFA 3U14A 3LA2A 2HEWF 4WQMA 1L0XB 5TSWA 3L4PA 2HDEA 5T52A 4L92A 4QX3A 4XJWA 2MBHA 3Q8BA 2QFEA 3CWIA 1JWSD 4Q4X3 1JWUD 1SEFA 2WNVB 3QK0A 5FZ8A 5CG8A 1F52A 4FPYA 4YVWA 1E8XA 5D8AB 4JL9A 2N9XA 1UO9A 4XJ9A 5CADA 3ZXJA 2VZVA 4C0HA 3QQ8B 3DPDA 1UOJA 2HWD3 3OUJA 3JSVB 4WH4A 1O3TA 4YGDA 2EAAA 1DFQA 3WAOA 2W08A 3P1IA 2PE9A 3VV1A 2EXHA 1RAXA 3ZYHA 3WANA 4QDRA 2ETEA 3CDZB 4RGKA 4W65A 3TN91 2NPTB 4QDQA 3IT4B 5CKMA 2AEHA 3TEZA 4CYDA 2FUHB 2BYVE 2KM2A 2UU8A 3EQEA 3T3OA 2E26A 1VBA1 3HR9A 1TJEA 5FXZA 3ME2A 2Y60A 4K8RB 1HZ5A 2L0TA 2GDFA 1KH0A 3AL5A 2DZIA 2VULA 4IUGA 3ZYIB 3I9V1 4LT5A 4FT8A 4Q27A 4JKMA 1OT5A 4IEXA 3VZJA 2IGDA 1QOOA 1C28A 3VBSB 2DCTA 2MBEA 2M4NA 4LTUA 5J48A 1OLMA 4A9AA 1RUC3 5JHAA 1GZ9A 2XKPA 3LOBA 1OFSA 2ARBA 1I4PA 4WWNA 2KC1A 3T0BA 2CJOA 1TMF1 2WS3B 4QXKA 2Z5WA 2LHDA 2IPKD 1ZOYB 2DYBA 3U2SC 2CU3A 3AC0A 3FLTA 3B94A 3D4KA 2WWUA 3RWNA 1GNZA 5CHWA 1W3XA 2Y5PA 3I3EA 5FZHA 4JKLA 2V4LA 3K46A 4Z1VA 3KCCA 2WR9A 5A3WA 1KFXL 2AQ3B 4PIZA 2WX0A 1YFWA 2CTVA 3KLSX 3BIID 1W6MB 1C8NA 3KQ4A 1G9DA 3BGAA 4UW3A 3RD2A 3BTZA 3JW0X 3V0BB 4A2UA 2PQQA 3OUHA 2Z4FA 2LGSA 4FFFA 4P00B 2VZKD 4IM0A 2JEMA 1RUJ1 2RMU1 3T1MA 3ETQA 1R1A2 1QOAA 4GB31 3R7RA 4AEDA 2NYYA 1ODNA 3C3VA 2AR6A 4MXWA 3ZYGA 3TAYA 5APAA 2W91A 1YIFA 4XYXA 2YC2A 4I6NB 1SIFA 2B4KA 2H6CA 2WFF2 4GULA 2GU9A 3LEKA 1RHI1 2D43A 3VBFA 4FXCA 1DLCA 1V6JA 1KDKA 3ZXFA 3R05A 3MF9A 2A6VA 4YG6A 2LUWA 2FNJB 4YW4A 1UD7A 2BGFA 4RFRB 2IY0B 5EXOA 1EPWA 2N1VA 3C7GA 1QNYA 3WVJA 5JZGC 5FYTA 1WXSA 5FP8A 5BNOA 1E9MA 2XJQA 1S0FA 1PK6B 5CKQA 4EZKA 3QLQA 4IERA 2WNEA 1XBFA 5FY4A 3ZO0B 2D6LX 2QNKA 2P6HA 4WVVA 2VPVA 1AX2A 3WF2A 5ACA3 4K1YA 3VDDA 1QOBA 2P6CA 4QX8A 5DAXA 3RNEC 2J0KA 3BTAA 2JG9B 2FDFA 2GBJA 1F31A 5FZKA 1LU1A 1NCQA 2JY6A 1A34A 2BB6A 2JB8A 4Q2FA 4ANUA 5A6YA 3PL0A 3RYKA 1YNTE 2JDYA 4D6RA 1IPKA 3BU0A 1NX9A 2VBBA 1CVNA 1YIPA 1Z0HA 2M17A 4RHV1 5IK7A 2I07B 2CU1A 2DFCA 1UXZA 2OX0A 1F35A 2QJVA 3EO6A 3R3MA 5FLJA 4UW4A 4G4FA 4YPJA 5FZCA 5JXVA 1WD4A 4QXCA 1DG6A 2D5HA 2FBWB 4W9LA 3MIHA 3EHVA 1X9TA 3CEWA 4PCRA 2XK5B 4MEMA 2CWMA 4CZSA 1HRI1 1E5HA 4KIKA 2L52A 2C4XA 4BOZB 3PU3A 2MHJA 3RMYA 2OIIA 3J8F2 4KGGA 2X8XX 1DHKB 4MHRA 3HPNA 3D32A 2Y6JA 2BYTA 1PHMA 2C7MB 5JMOA 4WAFA 4PBPA 1CAXA 4W9GA 2UYAA 1ASJ2 1UPSA 3P3NA 1V6KA 1LGBA 1V6OA 1HX6A 1YJ1A 2PMWB 1K12A 1Y43B 1MG4A 3D8CA 1HV0A 2M0AA 1HTOA 4PJYA 3AM9A 3LE0A 2JXXA 2LWPA 3ZSKA 4UT5A 1QEXA 4WVZA 3NW4A 4DOUA 1RTVA 3I2JA 1FXZA 1UZWA 2C26A 2V73A 4Y1VA 4LBQB 4PT6A 2QIEB 1XNBA 3ZFEA 1W28A 3BODA 4FCAA 1XO3A 2ARCA 3WHUA 1U5ZA 2EIGA 3NNLA 3S2AA 5BO4B 5AEKB 2R071 2K9ZA 2XR4A 2KR2A 3ZXRA 1MQTC 2R7EB 3ZYPA 4YL8A 1CK1A 1RUE1 3W5UB 2PLPA 1O3RA 1XXNA 2WXPA 2IGGA 1SSNA 2OHFA 1A78A 2AQ1B 4BOSC 1TS2A 5BNQA 2BOJA 2H6BA 2XJUA 4RF1A 3C2UA 4IV1B 4UFMA 3DXTA 5FOJB 1ZDVA 1LGRA 3EFUA 3ZX7A 3T09A 2VZOA 2HJ1A 4RR3B 4P7IA 2ZHNA 1XU1A 1STEA 1UAIA 3PJYA 2XKOA 1LFDA 1F1HA 1UF2C 2NVUI 4C56C 5C8CC 3VD3A 1ZDXA 1GLHA 4XPVA 5F5IA 4CP2A 1LQBA 5HHDG 2RS52 4LNFA 1RUD2 2ZPNA 1EF5A 4MGTA 2MEV2 4JWUC 1J3PA 4A7YA 2VZUA 3PHWB 1VBB1 3V56A 1TQ5A 2RDHA 4UYBA 4ARIA 4LORA 2XVKA 2LD9A 1K5MA 2DDUA 1CX4A 4G11A 2ID4A 1AYN1 5K0UC 2LGIA 1RUI2 1RVF1 2A7AA 4IE4A 5ABJC 2JE8A 1WCSA 4GMP1 1ULFA 1Z7S3 2XJPA 4D6SA 4QHOA 4F8CB 2WA3A 3P3PA 1T2XA 4IW3A 1P7FA 2KX0A 4NIDA 4AVVA 3U8ZA 1IBXA 1WGYA 5FXWA 3UKVA 3I3TB 4DXAB 4A3ZA 5JAXA 1DZTA 5LCWL 2V4IB 5I0SA 3VXWA 2LGYA 3A1QA 2EA7A 4CDUC 4Y24A 4GJYA 4BAXA 5IN7A 3N35A 1W2UA 3VHNA 1WLWA 5CA6A 4KWLA 1B1ZA 3HT1A 4Q4V2 1LOBA 2G3QB 2W94A 2LI5A 4B1LA 2YBKA 3BB6A 2YU1A 1IUEA 5JI7A 1FCCC 2ATFA 3QHTA 5DUXA 5DAVA 1UYYA 3VHOA 1DBNA 2HWF1 3RMXA 2X8KA 4QX7A 4XBNA 1XT9B 1UIJA 1BCXA 2PHDA 5LY2A 3LEGA 3H6NA 4LBQD 3HBKA 4MJSB 3DKQA 3RQ0A 4AVAA 3QWZB 4W9HA 2UURA 1OI6A 2DVGA 1HZ6A 3FC4A 3WT3A 4AG4A 3OG5A 3VDAA 2OYZA 2FCNA 4XXAA 2WQYB 3U75A 1DYOA 1OVPA 3WP6A 3FFQA 2DNFA 4CCDA 5GXGB 1JOBA 4RQPA 5H8YE 3Q8AA 4JV4A 5E6NA 4KZCA 1HV1A 3RGBA 3JBG2 5C9AA 1AW7A 2ON8A 3C7HA 2KANA 5FPLA 2M19A 5IYYA 2NN8A 1ND2C 1QY4A 3FHIB 3ZW3A 4YM2A 4LO7A 4BQ1A 1YQ5A 2SAKA 1CJDA 2V3PA 4GXLA 3BCWA 2VQTA 2FDKA 2PIAA 3A4UA 2L00B 5FZBA 1TKEA 2ZXQA 3GJAA 2WT0A 2RS31 3EBRA 3DVGY 5FUNA 1WX9A 4HKOA 3SNMA 5J7MA 1LHOA 2D3PA 4QPYA 1RFKA 1JZ3A 1MZFA 2B46X 4N53C 4A55A 3VN4A 3JZVA 2CV6A 1UN1A 5LBBA 1ULCA 3ETRA 2NZ9A 4BXSV 1QMJA 5HI1A 1WWTA 1LHVA 2JDKA 1GP6A 4MM3B 2WWSA 1WR1A 2WQ8A 5AVAA 4W9EA 1WJ4A 1MS1A 4LKSA 3NV1A 1E8WA 3NAPB 1D5MC 3IDCB 1KRHA 3RSJA 2ZGMA 4QM9A 4N7IA 2X05A 4ZXEA 4XJ8A 2C60A 1POV0 1YI9A 3AZZA 1C9FA 2O8OA 1F15A 2VU9A 3D6EA 3IDAA 3QBQA 3WZ1A 3VZOA 3GZTB 3K4DA 4TSVA 3M2MA 2DVAA 5KXEA 4NR1A 5F37A 2ZPXA 4QXBA 3H7YA 4F1SA 2AYOB 2ZTNA 3GXUA 4TUUA 1BMLC 2FCSA 2QQIA 3P42A 2ZJDA 1J19A 2EXJA 1YEWA 1DGJA 1N5XA 1RUJ3 2C5DA 4LTAA 5FIXA 2RMU3 3CJIA 2BS2B 1DQ0A 2PKOA 1V5OA 1GR3A 3TYJA 3VBRB 1AARA 3WF0A 3ML9A 2CHXA 4L2NA 4Q1PA 3IHPC 2GZWA 4LA3A 1FMD2 1W6OA 3VHPA 1ET6A 2BWAA 1J1LA 1SFYA 4NO4A 1V49A 3VH3B 4E4ZA 3B08A 3E56A 3WEZA 5AZFA 3S30A 5C3SA 1V9JA 1P0RA 3QARA 3CQOA 1EM7A 2BYEA 2NTSA 5CAZA 4Y20A 1Y4WA 2BS4B 5FZ4A 1VRH2 2CGNA 1G8WA 1C4PA 4L1BA 4HPLB 4JPSA 5AVPA 4E4DX 3SCGA 4KSLC 4EZ4A 3DPRA 1MHHE 2M0XA 5FMCA 1H9PA 1P1AA 4HJGE 2WNVC 4GWMA 1FOD3 3OPZA 3O1RA 4IGPA 2QQOA 3IPVB 5D8AC 4K1RB 1PO23 4PLNA 4Z07A 3SLIA 2XDVA 3VBUB 4Z82A 3B9IA 1VIWB 4QXHA 5CEHA 2BGPA 4Y4YA 3WIMA 1KQRA 2W68A 2JXTA 3DUIA 5DPRA 2JU6X 4WWPA 3AP6A 1MEC3 2UWQA 4FOYA 1TY2A 4LJHA 3WHTA 3GZAA 4R52A 2W52A 1LAJA 3AE2B 4CDWB 4E74A 4JDOA 5IUQA 1I7HA 1LU2A 4Q4V3 5EQUA 2P3YA 1OF4A 3HQRA 5H9RA 3GHNA 1ZW7A 1ZUD2 3NVCA 2W2IA 3UINB 1PGXA 5JLVA 4QQOA 3VRAB 1HEZE 4XETA 3MEPA 4NWVA 3DHGC 4KGTA 1COV1 1HRI3 3AJYA 3A4SC 1US2A 1XNAA 4PYUA 5FMDA 3WDUA 2DYCA 2MA9B 1NOVA 5L95C 2HWB2 4D6QA 3OCPA 2N4FA 1JU4A 4DK5A 5DAPA 4DFSA 3I59B 2QJLA 4P9IA 5KXCA 5H9PA 1S4CA 1UU4A 3L13A 4B9KA 4YG3A 3JBG3 4QKBA 3U7ZA 1OH3A 5HCAA 3TL5A 2C7NB 4KWJA 1RUG3 4MH8A 1UOGA 5IATA 2D3GA 2PAEA 3MIFA 4E71A 2BVCA 2VECA 4NPMA 1FXIA 3VD7A 3T2TA 1T0QC 3DL3A 2ZZPB 4XWWA 3PV1A 2PQSA 5T5LA 2VBDA 1VRAB 2HLEA 4J1XA 2KFKA 1ZBA1 5JHBA 4LJOB 5HG2A 4LBJA 4FA6A 4AI0A 5FFOC 1DIWA 4RD7A 4HLEA 2B3AA 1RUE3 3EJKA 3W21A 3VD5A 3KM5A 3CZJA 1VALA 4YARA 2KN4A 1OPMA 2UY9A 3FHAA 3D5OA 3ACHA 3VBOA 2ASQA 3IVFA 1Y9GA 4JGZB 3MW3A 3CLPA 1E57A 3WV6A 4MSQB 1ZXHA 1D0HA 1UOBA 2DCYA 2RS11 5IO9A 3PIJA 5JOZA 4W9IA 3H3UA 1D2SA 4NJCA 4NAOA 4RM8A 4QMAA 3APCA 1J0GA 4EYUA 4HKLA 3DECA 2G9HD 2CWSA 1R4NI 1QJX3 1C79A 2E31A 3LDRA 3VBHC 2XL7A 1PK6C 2I1KA 3PSEB 2PLV2 3DGTA 5AC91 1VAKA 1Q8QA 1W8FA 2Y64A 4HPKA 1SCSA 4PHZA 5AZHA 4NAWA 2SLIA 3FJSA 1VBB3 1I1EA 2DFBA 2XG3A 1D4M1 4HPMB 2JG9C 1O91A 3SDLC 4R9CA 4OHZA 1RVF3 2MW5A 2XJSA 4A41A 3ACIA 1XSQA 4NJ7A 1B09A 1ET9A 1IQDC 3C7OA 4ZS3A 4KKJA 3QOPA 5K0UA 1W90A 4N43A 1VBD2 5HXMA 5ABJA 3AE4B 3MHSD 2WXHA 2XVGA 4P9GA 3RWKX 4J3OD 1JROA 3M8LA 4W50A 2JRHA 5I93A 2ZGKA 3RZLA 3N9NA 4XIKA 3AN1A 4IWQA 2ZW1A 1JHJA 2Q5TA 1WXQA 2I74A 3TBLD 4BLIA 4YT0B 2A6ZA 4NPNA 3R4SA 2LVOA 4P9WA 2WZEA 4XGAB 4EN6B 1F8VA 5JI9A 5KC5A 1RUNA 4M0WB 4AUQC 2EKIA 1LOFC 5CFCA 5T50A 4PI0A 3N9MA 3KCXA 1NEKB 3MDPA 2HWF3 4IE7A 4XFGA 1E5RA 4TV3A 2ZX0A 1YLLA 1G6NA 3CBNA 4Y33A 4P5YA 1JS9A 2D2QA 1N62A 5BMHA 3LB8C 4RL7A 5CFDA 1BUIC 4FPKA 1C4AA 1AR82 4XUNA 2RR13 4XEZA 5L73A 4NRPA 3GCWA 1O8SA 1OLQA 4EN8B 2KTRA 1EYBA 5LK5A 3O1PA 2GAUA 1SBBB 3AI5A 2D6MA 1WX7A 4BE3A 1XNDA 3UF8A 1NT0A 4FJZA 3S7EA 2BU9A 2W92A 1GZWA 4QKFA 2E6VA 3B3QE 2IXCA 1V0AA 4LBLA 1TGZB 1Q5OA 3FZ3A 4GWNA 4A42A 3AVSA 4XACA 1I4QA 1GBGA 5A6QA 3AMMA 3THCA 4FQ4A 1F9KA 1P3QU 2KZRA 2XLFA 2KQ7A 5J1XA 4ZZ8A 4A4AA 4ASWC 3B7MA 1SLAA 2JWUA 2ET7A 4YVSB 3B9JA 4LIUA 2R062 3LAGA 2DUQA 1L7LA 5FWEA 2IDYA 3K75B 4HL0A 3VZKA 3W1SA 4COYA 2V3NA 3T9LA 4TQ1A 4BBNF 4K20A 4FHKA 5EPAA 4IV1C 1TBEA 2N9PC 5FWJA 3T0DA 1GWMA 1WMDA 3ZIWA 2ZX3A 2JUOA 1WBLA 4E2SA 2Z8LA 2MP2B 1PVXA 4W9FA 2XBO2 2KLGA 2OEDA 4L0PA 2DV9A 4AP4C 3AEGB 2GP3A 3NSTA 1AXKA 1QF3A 4TXWA 3JQWA 2PTMA 3VUYA 3ZKYA 1UU5A 3JD71 4XMIA 3MICA 5FR3A 3V05A 2ZEXA 3LFMA 3Q8CA 3HM6X 3AKQA 3AX4A 1RUF1 1HKDA 4CP0A 4YRDA 4DDID 5JXJA 1TIFA 2ZGNA 3GGLA 5HI0A 5JMCA 1QU0A 2A1XA 1WR6E 5L19A 3A22A 1I5PA 1VMHA 5C3RA 1ESFA 4Q4W3 2XONA 5JIAA 2B9VA 1QQP3 1ZP0B 2EICA 1VCBA 1H30A 1E10A 5F2SA 1VMFA 4B1MA 3P5BA 1OKQA 3AZXA 3H1UA 1FYUA 1WJ6A 1EUUA 3Q3FA 2Z0DB 3L16A 1P8JA 1RGSA 3OD4A 3LEMA 3IMNA 4EE2A 1S0CA 4ZONA 2VOXA 5FREA 1FV3A 3OEBA 3KHBA 3K9PB 2JDZA 1T5XD 1OF3A 3SISA 2SBAA 2V5DA 1Y9QA 4OHYA 5LRRA 2YDEA 3JU9A 3AL6A 4JX0A 3F2ZA 3N32A 1HN1A 5EE3A 3LOIA 3UYJA 4OI0A 4FJYA 3VUXA 4BKSD 2QTWB 4AVBA 5IJRA 5I4DA 3O12A 3NS1A 4C4VB 4HSLA 3VAWA 4AVTA 3I7DA 1Z2MA 1I6XA 5SV8A 1WGGA 2NMNA 1LHUA 2LMCA 1VRBA 4C8DA 1PO11 1J58A 2BZDA 4KWUA 4XHXA 3M3JA 3LFIA 3U10A 2YC0A 1AR72 5FO8B 1WW4A 3VHTC 2KJ6A 5BMIA 2LGDA 2Y26A 1PMIA 4K9SA 2FIFA 2HBUA 4KBZA 1REEA 1SGHA 4N58A 1CQVA 3JSVA 3H8OA 1DYKA 3HT2A 4KG8A 1SMVA 3UIPB 4AEJA 3UK9A 4MHUA 1R64A 4NHYA 3GALA 4NRQA 5GLZA 4AQSA 4EUTA 4GB32 3O1SA 1LKNA 2LFIA 5KWRA 5C8WA 1PZ7A 4TWTA 3N3HA 4V2WA 4DUWA 1WF9A 3FL7A 5DPNA 2W3RA 2N9KA 4NIHA 1G9BA 3ZO5B 3NVZA 3EMRA 1NLQA 1CZPA 2GRIA 4B4RA 3PZ7A 1JUHA 3WCRA 3T2QA 4DB5A 4L99A 1DZQA 2R2QA 3ZJUA 4CEYA 4I2OA 1OH4A 4NHKA 1RUH1 3VBSA 1UZ0A 4MH0E 1C78A 4JQTA 5F2WA 5EJ3A 2W82A 1O8PA 4OCTA 3C8YA 3KQRA 3WNMA 3FKYA 1N6ZA 2VCAA 4Y22B 1UX6A 3NAPC 4K3UA 3FHQA 2A5UA 1ZM1A 2WINB 4HEA1 1V9U3 1HDKA 4D94A 1C4RA 2WNUB 1SQ4A 2LVPA 2JYEA 2XMLA 5FUPA 5C3JB 3MW2A 4L8QA 5DMYA 3THPA 4OLLA 5FBZA 1PQSA 2B7YA 2QVSB 2YY1A 1SHWB 2GNTA 5L83A 4HXCA 2Q0AA 5DUVA 1AYM3 1ZBA3 5KXDA 5IAVA 2R063 1VZ8A 1I4XA 4CDXA 2KC2A 2MX2A 5JIUA 2BFUS 2HH9A 3AMHA 1UY3A 4Z2AA 1L4ZB 2FQPA 3RZHA 2JSVX 1EV13 3VBRC 1NUKA 4AFBA 2BNMA 3T2PA 3SFDB 3KVAA 3BY4B 1SDDB 1V00A 2WLPA 1YQ3B 5D3IB 3K9OB 4QAYA 2VH9A 2WXOA 2JDNA 1UZYA 5LA2A 1V6IA 3ABVB 4JGYC 3L2YA 1POV3 2RS13 1GWKA 4P1BC 2XQRA 4LIVA 1YYNA 1JH5A 2PN5A 4HCPB 1MS8A 2IXKA 3RI7C 3RI9A 1TYGB 3WDVA 1GB4A 1ND3A 3DWMA 2O1QA 3AFGA 2G1MA 4OMCA 5L7OB 2O0OA 4CP9B 2QQKA 1QJY2 1YFXA 5C7GA 4XQWA 2INNE 2VUCA 5A3PA 5LA1A 2VMGA 1X9PA 4I01A 3QA8A 5J37A 4O65A 4QU2A 2LRUA 1C1YB 4AQTA 3RFZB 2CU5A 3VBUC 1OQRA 2X29A 2HD5B 1NZCA 5A7WA 1LESA 4IEQA 3H7SA 2RG4A 4HLTA 2IGHA 1I4RA 1UBQA 3WA0A 5FQ0B 5FJKA 1DGRA 3SHQA 2DVBA 1CAUB 4UFJA 5JOYA 5EV7A 4EN7B 4OZCA 4IE6A 3ETPA 3N30A 1OQYA 2CDPA 1GUIA 2Z69A 1XXGA 1WLCA 3N9OA 3CKHA 1QJU1 4Q0VA 4ES8A 1GICA 4ISRA 2R6QA 4P14A 5DQ0A 2FCQA 4FJVB 5FMOS 1UF0A 3C19A 1SPPA 1JYCA 4Q0QA 2D5GA 3IDEA 2K0GA 3ZN6A 1C4CA 5C3OA 3ECQA 4LKFA 5LY1A 2BFUL 2VJXA 4XURA 1NCRB 3NV3A 2KX3A 4XOGA 3EGRA 3N7LA 4NPRA 3AECB 4LUKA 2V09A 5IFTA 2DZJA 3DQVA 4GLSC 1I9RA 3USUA 1FI2A 5A7SA 2BWCA 1I35A 1J8CA 4ANVA 5HV4A 3BK1A 4CDQB 2PPHA 3M63B 4QPIA 4RM9A 2N9LA 2NR2A 3LXFA 1WW6A 2VMEA 1OA3A 3MLLA 3B01A 2PAMA 3JCIA 3MV01 4NAMA 1GNHA 3SHRA 4E4HA 3CHXA 2VTXJ 4LA2A 3ZVXA 2PA7A 5GKAC 3G7DA 2XJRA 1L7QA 5CISA 3B2FA 4HZFA 5IVCA 4HN0A 3THTA 4K8FA 3N1ZC 5FYBA 1ENSA 4Q26A 1S2KA 1AYN2 2TEPA 4B7EA 2Y6GA 1LENA 1D7PM 1U12A 5EE9A 3A0NA 1WH3A 1VR9A 1M4WA 4ASLA 1DQ6A 4NIIA 1FO4A 1OOPC 1BEV2 3OBTA 2M56B 4USAA 1MVQA 3WDWA 2QCZA 1AR62 1P98A 4GMVA 3OJBA 4MLOA 2ZGUA 2HJIA 3BPSA 5L9VA 1VE0A 3OGRA 2ZGRA 1STMA 4XE9A 3ZJTA 4IC7B 5J2RA 2WT2A 3NOBA 3MZHA 5IKCM 2WBKA 2YPDA 2J0MA 3ML8A 3AZWA 3UESA 3N9YC 3LKJA 1NA1A 4JX1C 5JOWA 1TTNA 1FXAA 1NYWA 1EAH2 2DBIA 4ZPIA 5J3UA 4OZBA 2ZGLA 2A6YA 1GC6A 3OPWA 4CXWA 3A33B 4EEWA 4XHBA 3VDZA 4YSZB 1FPYA 2ZGOA 4HXDA 1ONAA 2YLMA 4RR3A 4ZRPA 4M3CB 4ZRQA 4F7ZA 5BUVA 2Q1FA 4YGCA 4YFZA 3GE3C 2M1MA 4D8MA 3FBYA 1O3QA 3OAWA 1H8TA 2B9UA 5DUWA 4ATFA 1C3TA 1TS3A 1WGHA 2V72A 4P9JA 2QQJA 4HOOA 1FPN2 2VUAA 1ZNPA 1GQPA 3RNCC 4BQ2A 3LIHA 1BVVA 2FMDA 3V0AB 1HXS2 3SR6A 2BKRB 3KZ4C 3PLVA 1ZKHA 2J53A 2Y0IA 5GZGA 1FEHA 4HVQA 3KHCA 4EZJA 2RS32 2VXRA 1QILA 4A7ZA 1KF6B 3OJ3A 1UY2A 1VB2A 2WLBA 4G0NB 2Y6HA 1E5WA 4GWIA 2GLSA 4PYZA 3GYDA 1E5SA 4FHJA 3VDBA 5F6KA 3H7PA 4D2KA 3OBZA 4XUOA 3UQAA 1SACA 3NJVA 2WO1A 1FNUA 4DRRA 2BP6A 4CE8A 4JQWC 4CCMA 1G7YA 1UH6A 1QJY3 4ORFA 3WD5A 2GBNA 1Z78A 3BVZA 2B8MA 3ZRCA 2Y6LA 2P34A 5FYMA 3KWLA 4WVMB 3WW3A 5A7QA 5FZIA 3VKLA 2WZ8A 2IUWA 2QCSB 2ICIA 4NN0A 3AP5A 2VW0A 4JGHB 2AX5A 3TSSA 1L0YB 2GN7A 1ENRA 2R043 1MS0A 2JG8A 4HN1A 2QQMA 1Y7BA 3OY8A 4YZ3A 3IBEA 5H9QA 1IYFA 2KMMA 4AEKA 5JWPA 2FZ1A 4KSKC 1E90A 5E88A 3E5QA 5GLWA 5SV5A 3LJ3A 4TMAB 4OI4A 4MJSA 3WNNA 4Q4X1 4DHZE 2JF5A 3MFCA 5IVEA 4UF0B 3KB5A 4URTA 3LB9A 3VUWA 2JDPA 5E6JA 5FZOB 5CX3A 2WUHA 4YLZA 3TOJA 2KD7A 4ZHOA 3H9DA 1SB3C 1JHNA 4RN5A 3UGFA 3KGZA 1OA4A 4Q2JA 1S0IA 5IVFA 3ROUA 1WRIA 4EZLA 1BHGA 2VNVA 1CZTA 1TNFA 4BIOA 4YVSC 5FY0A 4OMDA 4W9KA 5C3QA 1V1PB 2QMTA 1NY71 2UU7A 4A8XC 1PDXA 3N4MA 4BWOA 4Z8BA 4Z2WA 1OA2A 2CNAA 1UL9A 3VVWB 2PHUA 4OUSA 4P08A 3GCXA 2DWQA 3NRUA 1JWAD 3OD0A 5FZFA 4EN0A 4IV3A 2A5ZA 3RRDA 4G9SB 1H2MA 1UMZA 3L08A 4PDWB 1HB2A 4M4PA 1I42A 3E5UA 1N60A 2WKKA 3PO0A 3ZXGA 1PGW1 4B0MA 1FMAD 5CB7A 2INDC 1RUC1 5BYRA 4K21A 1WX8A 1CONA 2AEYA 1W6NB 3KT4A 2DAFA 4N7UA 4C7YA 2R49A 1JZ5A 2XJVA 2VW2A 2P3JA 4GDLA 4RH6A 5CYYA 5LA0A 4S2HA 2WU5B 2YXSA 2CHWA 4QHZA 3DN7A 5J96B 1YO8A 5AFBA 1SLBA 1W2OA 1ZA4A 2WSUA 3OF1A 4XXPA 4DZGA 3U30A 1M4VA 2KWDA 1FIQA 2IXJA 1XD3B 4EKUA 2KWVB 1BYHA 1N61A 3TEXA 4HVOA 5EZWA 1VMJA 4LQRA 1EAH3 4FXGB 3ZFGB 4FADA 4QPGC 1XPWA 5BNNB 2WXQA 1B35B 1HW5A 1RM6C 4G3XB 1O4ZA 2WSVA 5A7OA 3H8HA 4X8NA 4PLOA 4C1WA 1US3A 3W5VB 4PIXA 2WYSA 3KD4A 4AVCA 4E3CA 4RS5A 5DPWA 2JE9A 3AE7B 3ILNA 1HTQA 4KZ0A 4LNNA 3W58A 3K3NA 2VMHA 1EWYC 4YW1A 1PVC2 2RD0A 2W39A 1GZCA 4IEWA 2XEWA 3NY5A 4UXAA 3ZYRA 4AZZA 2VD7A 1MI0A 1FPN3 4SBVA 1JI6A 3VL8A 4RSUA 3VZLA 4LHSA 3J7MA 1HXS3 1GOZA 2VNRA 5G5GA 4FP2A 4AGGA 2ZHKA 3U11A 4FBJB 3WNLA 2N0SB 5JPMB 2YEPB 2BV4A 3I5JC 3IPVA 3L10B 3APBA 4N6EB 1UGMA 3TEWA 1KLGD 3KUZA 2K25A 2BVBA 1ZPSA 4CUCA 4META 3ZPOA 4UFHA 3ALBA 2P4EA 3KSCA 3B02A 3GE8C 5BNPA 4A3XA 1QJU3 2AC1A 3INAA 2IO2B 2YVCA 3AEEB 1FNYA 1XQNA 4QX1A 3K2OA 2VTXA 1PIV2 1CAWA 5DDJ3 2HTME 2VAUA 4DEQA 3ZOIA 3MPPG 2D3AA 4CDWA 5C4WA 1RB8G 1WYGA 5F5CA 5EJZB 5JVVA 1W04A 4ZYNA 2EELA 1A8DA 4OVUA 4CHKA 2A70A 3BOWA 2D40A 4WM7A 2KMCA 4CEWA 2UYBA 2R30A 2R2OA 3IAS1 2JWPA 1JW6A 3OWEB 4FLHA 5FCCA 3IZOA 2W54A 1VP6A 4BQ3A 1JZ8A 1NXD1 4AAPA 3AB0A 2L05A 2G9ZA 1L6UA 2W3JA 2IZVB 1OEYA 2G9FA 4CVUA 1QIQA 3D3AA 1VBE2 3TB0A 1IGOA 1J7BA 1V5TA 3QIJA 3KUDB 5JOXA 1ZE3D 4K3BA 3CZUA 1UBIA 4CUAA 2WNUC 5FPVA 2RMMA 1TEIA 3VKNA 2C9KA 5IFPA 1D4M2 1H2NA 1S2BA 4BQ4A 1UWXA 3PUIA 4OZXA 2DCZA 2AL3A 3KCYA 3I2DA 1K50A 4Y5Z0 5GZEA 2HEYF 3MLKA 2KJHB 1NI3A 5FKCA 4AFMA 2MWSB 2V0GA 3HRDD 2FD8A 5C6CA 5J36A 2K46A 3V62A 3QCAA 3IDBB 2VZQA 3SITA 5B4XA 5CHFA 3WF1A 4KGRA 2WP9B 2ZCWA 2BGOA 4II2B 1BKZA 4LUMA 2YBSA 2FBEA 4YW5A 1S0DA 3NMBA 1HXYD 2LALA 4GJZA 1QGLA 2FDIA 1N1VA 4GWJA 2D6KA 4LE4A 2ZOEB 1BXTA 5I0UA 2XVLA 4I0AA 5G05L 5BNOB 3SCFA 3TNQA 2XQXA 3KMHA 3FLPA 3FUOA 1DQ4A 1IPJA 1W8HA 1K42A 3POSA 4JGZA 3ZTDA 1XLOA 2P1BA 2DWRA 1DOIA 3VH4B 5FYHA 3R66C 4HKQA 2RM22 1WXMA 3VDDB 3T08A 2K5PA 4GU2A 2Y33A 5AFEA 5DPTA 2N9EB 3IB3A 4WIPA 2D93A 4ZRJA 2JX5A 4NRMA 4LKEA 4XAAA 4MGIE 1NE6A 2DENB 5C71A 1LTEA 1NCQB 4QQ2A 5FKBA 3OG2A 4YSFA 1FFUA 2YC4A 3DV8A 5KC6A 2N7GA 3S57A 1WY8A 4IL7A 4IEYA 1GANA 2PELA 4ISQA 4P9LA 3Q3JA 3PZ8A 3H8RA 5T55A 1T0SC 4XYCA 4XF1A 3WUDA 3ZFFA 4CU8A 2VMDA 2QDNA 4MVTA 1H1MA 4F83A 3W5NA 1JU3A 1KTKA 1RMU3 2W55A 4YW2A 1R1A1 3A9JB 3EUB2 3ILRA 4DBGA 1SLTA 3PTFC 3J9CA 4NNJB 4KIKB 5BXXA 5LXIB 2HWC2 1T0YA 5E8AA 2P2KA 2WFF1 3DDCB 1P7EA 1WCUA 5I91A 3GBWA 1NCRC 1S1QB 5LEKA 4KI5M 3QC8B 3AE5B 4DY5A 1OQQA 2W1SA 4UI9L 4DNYA 1HE8A 1E6EB 2J7QB 1AR93 4CDQC 3GM8A 4XF4A 3FFZA 2WC2A 4QU1A 3MIEA 3URFA 2ET1A 3JD72 1OFNA 1W99A 2WLQA 3ES1A 3BVGA 4GIVA 4QHBA 3U4XA 3CSFA 2DVFA 3SFEB 3POIA 5A70A 5D2AA 3IKWA 4FPCA 3FLRA 4LULA 2EIBA 3U7DA 4XFFA 4COVA 1L7RA 2DVDA 2VCCA 1R4MI 1QF6A 1DDLA 1BBT2 2GC1A 3KV9A 2ZCCA 1QJEA 2ZW0A 1UQXA 1HRV2