4WWMA

X-ray crystal structure of sulfolobus solfataricus urm1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
79
structure length
79
Chain Sequence
b'PKVILKGPLISQFNFREIYVNDRELLRVLVKIDSKKHLILNESNQLKSGILILINGKDWRLYRNQLLNDNDIIEIIPIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Involvement of a eukaryotic-like ubiquitin-related modifier in the proteasome pathway of the archaeon Sulfolobus acidocaldarius.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Signaling protein
total genus 16
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4wwmA00
1KRHA 2PVGC 3AE2B 2W3RA 3AB5A 3LXFA 3AEGB 3P1MA 2BT6A 4US9A 4YTPB 5EE9A 1NYRA 4YSYB 1WWTA 1YQ3B 3AN1A 1PUTA 1JRPA 4YXDB 2PIAA 4JX1C 1NENB 5H92C 1N63A 4ZHPA 1DGJA 1YJJA 1ROEA 1V97A 3PO0A 3B2GA 2M56B 1TKYA 3NVZA 1XLOA 3FAHA 1N60A 1E10A 2EKIA 1UWMA 1OFFA 1N5WA 3FC4A 1XLNA 3P4RB 2PKOA 3KWLA 2JQRB 1WGKA 1AYFA 1ZOYB 1FFUA 3B9JA 2B76B 3BIID 4ITKA 1RM6C 2MJDA 1JWBD 3AEDB 3AM9A 3NVVA 4USAA 1FO4A 1IUEA 4ZOHC 3W9CB 2WDQB 1KF6B 3AEEB 2WDVB 4US8A 1QT9A 1I7HA 3AMZA 1EWYC 1V8CA 2QJLA 3EUB2 4WQMA 1NVID 1PDXA 2DWQA 1QLBB 2E3TA 2CJNA 1FRRA 1SF0A 2CU3A 1QOBA 2OHFA 1L5PA 1JW9D 1E6EB 1NI3A 2L83A 5AUIA 3AV8A 1OQRA 2PVOD 3B2FA 3ETRA 3SR6A 2M19A 3RPFC 4ZHOA 2CJOA 1FXIA 2K5PA 2MH7A 3AE5B 2Q5WD 3CIRB 3HRDD 3L4PA 4C80A 1YQ4B 1PFDA 1QOGA 1TKEA 4A9AA 1QF6A 1J7BA 1DOYA 1B9RA 1J7AA 2LEKA 1VLBA 1XLPA 2JX5A 5H8YE 3VRBB 3AE4B 1ZUD2 2W55A 1SIJA 2H88B 2WU5B 1TJEA 4YT0B 5EE1A 1J7CA 3SFDB 3VR8B 2KAJA 1JWAD 3AE1B 3P4QB 1F0ZA 1CZPA 2DBYA 2QIEB 1E7PB 2BS2B 2K9XA 4IDIA 2WDRB 1N5XA 2ACZB 2HTME 3AE7B 1ZXIA 2W3SA 3AE3B 1GAQB 5AUKA 1E0ZA 3AE8B 2G1EA 4LTUA 3AH7A 5G5HA 2W54A 3NVWA 1JQ4A 1ZP0B 1L6VA 1NEKB 3W5VB 4N59A 2N0SB 2L52A 2WLBA 2FBWB 4HRSA 3LB8C 3P4SB 1FFVA 3WCQA 3HVZA 2WP9B 4FXCA 1VDVA 1YJIA 4YSXB 1QOAA 2MJEA 1CJEA 1RWSA 5EE3A 3NRZA 3ABVB 1DOXA 1WXQA 1XO3A 1AWDA 1TYGB 1L6UA 2WQYB 1XLQA 5C3JB 3DWGC 2BS3B 3HUIA 4KX6B 5EE0A 3W5UB 1A70A 2MJ3A 2K22A 1FMAD 1SB3C 5C2TB 4N6EB 1FM0D 3VRAB 3VR9B 4JWSC 4C7ZA 3SFEB 4C7YA 1WYGA 5MPOA 1FRDA 3NVYA 1WRIA 1KFYB 3ZYYX 3P4PB 3P63A 5GXGB 1E9MA 3AEAB 1RYJA 3AECB 5G5GA 1TKGA 3NS1A 2Y5CA 2BS4B 1DOIA 1FXAA 4JWUC 4YSZB 3AEBB 3AEFB 3CWIA 2AX5A 1L0VB 2KMMA 1NYQA 1RFKA 4WWMA 1OQQA 1T3QA 4YTMB 1VJKA 2WU2B 3AE9B 1R7SA 1GPXA 1N62A 1QOFA 3DWMA 4P6VF 1JALA 1JROA 3AE6B 1N61A 4YTNB 1FIQA 2H89B 2WS3B 4N58A 4HROA
chains in the Genus database with same CATH superfamily
1KRHA 2M8SA 3ZRFA 3TSSA 2ZW1A 3FILA 2QDFA 1WWTA 2Z0DB 3A4SC 4YXDB 1D5MC 3N20C 2IY1B 3RI7C 3RUIB 2JWZA 1C9FA 1ZE3D 2XBBC 2V4LA 1H8CA 1WY8A 2X8XX 5JHBA 4IWPA 3Q69A 3FAHA 2VRRB 4LNFA 1AYFA 1WGYA 1T0SC 3RULA 2WXJA 2FCMA 3GE8C 2K39A 3BYYB 1SIFA 1WSPA 3BZDB 3P42A 2OHFA 1FEHA 3MFGA 1LFDA 2I1JA 2PJHA 4A8XC 1WM2A 3Q8FA 4WJOA 3ZDMC 1SGHA 1Y8RC 3W1YA 4DXGA 3OG5A 3NY5A 1CZPA 2WYQA 2J0KA 4HVBA 1LQBA 3RN9C 4XDDA 2B3AA 1TY0A 2PW9A 2LUEA 2GB1A 3RT3B 4MGZE 4FA6A 1YJIA 3L10B 2FCNA 2FNJB 5DPSA 2KQ7A 4JIOU 1DOXA 1ZXHA 1L6UA 2M4NA 1TS3A 3RNEC 2K22A 2TSSA 2JZ3B 3X23A 3PGEA 1WRIA 3R7RA 2DNFA 4NNJB 2KANA 1FXAA 1UNSA 4OZBA 2HTHA 5AEKB 1WM3A 1C4PA 2FIFA 1GPXA 1QOFA 5JHAA 3Q8EA 4W9DA 1UUPA 3M63B 2KLCA 1KOTA 4K7WA 1V81A 2REXA 3IT4B 3PT2B 1JMLA 1UF0A 5EE9A 1V49A 3S2AA 1YOVB 1DGJA 1QKZA 4UDUC 1MVKA 3U4EG 1WGDA 2JWUA 1WXSA 3QQ8B 2ONQA 2KTRB 2N7JA 4KDLB 1D5ZC 3N32A 4ANVA 2B76B 2OJRA 1KJTA 2N9XA 2J53A 3URYA 2BYTA 4IOIE 4WQMA 1FD6A 1QLBB 4KKJA 3ETRA 1OTRB 2C9WB 4X57B 1WXVA 2J0MA 3BINA 4KZCA 1J7BA 1T0QC 2INCC 4TMAB 1P9DU 2MA9B 1J7CA 4XGAB 2D3AA 1E8YA 2G9HD 2K9XA 2MQJA 3UQBA 3ZLZA 2LGDA 1H4RA 3N3KB 2INNE 1PGBA 4E74A 4NQLB 1EU4A 2WXNA 2L52A 2FBWB 3P4SB 3L13A 5FR6A 3VTWA 2KTFA 2NCNA 3VQIA 1K53A 1L0XB 2KMCA 1V9JA 2QHOA 2K8HA 2KMAA 1R4NB 1ET9A 1RYJA 2UU7A 4H2AA 4WAAA 3RNCC 3AEBB 3RCZA 1GOZA 3DWMA 2LVPA 1MG8A 1CMXB 4YTNB 1WX9A 2K1FA 4JQWC 2N9PC 3P1MA 4KGRA 4A90A 3TEZA 3ZRCA 1I42A 1NYRA 1SE3A 1SSNA 2ASQA 3AN1A 4RF1A 1ROEA 2ZPNA 2M17A 3NVZA 1WGGA 1I4QA 2WDTB 3A1QA 4KIKA 3QHTA 4LNNA 2EKIA 4NY0A 2DYOA 1SE9A 2WXLA 3KWVA 3AEDB 2MJDA 2O6VA 2WDQB 2IYDB 1I7HA 3BVGA 3H7PA 2INPE 4II3B 3FILB 1FRRA 3IBEA 4HCPB 3U30A 4HPPA 1TS4A 4N9F4 4EE2A 2PVOD 1P0RA 5J17A 3PLUA 2BBCA 4C4VA 1I4HA 2IDYA 1BXTA 2ZVNA 3AE4B 2LXAA 4IUMB 1TJEA 1P98A 1XQQA 4AWJA 3A9KA 2LFIA 3EFUA 2HTME 1TZOA 1I35A 1HEZE 2RPVA 4LTUA 2FIDA 1WE6A 4ANUA 1TIFA 4AOFA 1WXMA 5EE3A 2JYEA 3Q2AC 4EFOA 4P16A 5C3JB 3DVNV 5D3IB 3C19A 5IAAC 5J2RA 4XWTA 2YVCA 5EDSA 1ZKHA 4PT5A 5D2MB 4FJYA 1TKGA 3NS1A 2ZNVB 3AULA 2WU2B 3AE9B 3SD5A 1N62A 2J42A 2WXIA 2LRWA 3Q14C 5I4DA 3U52E 2L32A 1RRBA 4DDGD 5LXIB 4K7UA 1XEEA 2OJWA 4US9A 4WWOA 1YJ1A 2ZZPB 1TS2A 2L0FA 3PO0A 1WE7A 1P1AA 1E10A 4GN1A 1U4AA 1SE4A 1MI0A 2RMMA 2MW5A 1TT5B 3VDZA 1JWBD 2DAFA 2MX2A 4IWQA 4JPSA 2ZCBA 4FHJA 2CU3A 1JW9D 2AEHA 5AUIA 3UF8A 4ZYSA 2Q5WD 2XK5A 1QOGA 2WXMA 2JX5A 2R2OA 3MC9A 3RNAC 3I57A 2Y3AA 2W54A 4LJOB 3RZWC 4EKUA 4ANWA 4WJNA 5BMGA 1XCQL 1R4MB 4WAFA 1VR9A 1MHXA 1CJEA 1C76A 1XXGA 3V05A 1WMHA 1WXQA 3VRAB 3ZJUA 4N6EB 3AU4A 1GB1A 3SFEB 4HPMB 4K1RB 1YIWA 3ZUNA 2DAJA 3ML9A 4IC7B 1NYQA 1T6BX 3Q3MC 4A20A 1VJKA 3ZNID 4MH8A 4EUTA 2WXGA 3B0AA 3GE3C 4N58A 2FAZA 2KYWA 3PTFC 2NMQA 1WJ4A 3ZTDA 3VAWA 2UWQA 2NR2A 5G55A 2JZZA 5HHDG 2M0XA 4B6WA 3QAQA 1TKYA 5KHQA 4MGYE 2LI5A 1ZGUB 4W9KA 1PQSA 1T0YA 2JXTA 3P4RB 2PKOA 1C79A 1C1YB 1M4VA 2JQRB 2GMIC 3RNGC 4DBGA 4XDCA 1YMHE 4A3OA 4NAMA 1P3QU 3AU5A 2VZKD 1V8CA 5E6JA 1NVID 3TEXA 3A9JB 1D6EC 3EECA 3JYUA 1WZ0A 2LVQA 5HG2A 2FUG1 2BYEA 4K81A 1PGAA 5IO9A 3V62A 4A3PA 3HRDD 2K8BA 1RLFA 3A1QB 3L08A 1QQRA 1XF5L 2KN5A 2LJIA 4KIKB 2LEKA 3B1LX 3MTNB 5H8YE 4DHJD 1Z2MA 2KVRA 3PRPB 5GMVA 3ZNZB 3EHVA 3TMPB 2YLMA 2LWPA 2O6VB 1EF5A 3LJ3A 1STEA 3QWZB 1WJUA 3R7QA 2W3SA 2W82A 5G5HA 3H7PB 1XD3B 5KHOA 1C4AA 2IGGA 4L2YA 4HKZE 1VZ8A 4HK2A 1IYFA 2ZVOA 3MHZA 2BVCA 4EEWA 4II2B 2KWUB 4C4VB 5IN7A 2GBKA 3HUIA 2JVCA 4TSSA 3T3OA 4BAXA 1MPEA 4F8CB 2BKRB 4A6QA 4PK1A 2VH1A 3A9KB 2LXCA 2BS4B 2MBHA 4GXBA 1Q10A 3ZIMA 2FCQA 2L00B 1VZ7A 4IW0A 3HVDA 1YN4A 5BYQA 1BT0A 4MJSB 5D6JB 4HWIB 4WJPA 4RFBA 2DZJA 2Z0EB 2WXOA 4C56C 2V3SA 3UQAA 2PIAA 2ZCCA 4GDLA 3QX1A 4P1BC 4HLEA 5FKAC 3PS6A 4ZDVA 2MEKA 4I6NB 3KQ4A 5LLIA 1GB4A 3H9DA 5DPTA 3FC4A 2CHXA 3B9JA 4YWGG 3NVVA 3Q8AA 3DOWA 4HDOA 2L0TA 4XE0A 4F1SA 1KF6B 3IG3A 1XCTL 4US8A 1L7YA 3JSVA 4NJ7A 4ZRPA 4BOZB 1PDXA 1WZ3A 2C7NB 2OEDA 4A55A 4ZHOA 5AZHA 3RNFC 4KZ0A 2IO0B 2WU5B 3W1SC 2G45B 3AE1B 2A5UA 4HPLB 5E6PA 3GB1A 2FE8A 2MCNB 3NS8A 1L0YB 4M0WA 3DBLB 2KO3A 1C78A 2JZPA 1KLGD 5BYRA 1JWUD 4D2KA 4FXCA 5L83A 1TY2A 2XK5B 3CSFA 5AZFA 4K3BA 3ALBA 4NJCA 1IBXA 3P4PB 2IPKD 3AEAB 2L8JA 4AUQC 4RF0A 1UZXB 2AX5A 2KMMA 4ANXA 4PS8A 3DBRI 2AWTA 4MEMA 1V80A 3WIMA 4HJKA 1JALA 2PE9A 2LASA 1C4CA 3AE2B 3LXFA 3L17A 1CK1A 4G0NB 1WMHB 3ZVVA 3QC8B 4YTPB 2LJ5A 1FCCC 1KM7A 1YJJA 1F2RI 3VXWA 4URKA 2MBQA 4CO7A 4W9GA 1OFFA 2L3ZA 2N1VA 4LNKA 2WHIA 1ZOYB 1FFUA 3PZDA 4ICUA 1N6ZA 1FCLA 4IM0A 4WH4A 5D7GA 5JXVA 3DHIC 4O1NA 4W9FA 2KJHB 4GSWA 2VZKB 1OQRA 3RPFC 4C80A 3N1XC 4TV3A 4B0MA 1FNUA 1JWAD 1E7VA 4W9LA 3TBLD 2G1EA 2LD9A 1IPGA 3BK2A 3KVFB 2G4SA 4HJGE 1F52A 5T8IA 1FFVA 4G50A 3WCQA 4LCDE 1T0RC 2MJEA 1GNUA 2GI9A 4ICVA 2I38A 1Z5SB 5D3DA 2BS3B 3ZGZA 5C2TB 3N30A 2RGFA 1HXYD 1R4NI 3ECIA 2WX1A 5G5GA 1DOIA 1SBBB 4ZRKA 3CWIA 3EFCA 1KTKA 3R8BA 4NAWA 1EUVB 3CMMB 3QARA 2D2QA 3ZQ4A 1TTNA 2PE6B 2KQ4X 1JCKB 4PYZA 5CX3A 4TQ1A 1F77A 4BBNF 2V9HA 3L54A 3V60A 3U7DA 2KWDA 1VCBA 3DHHC 4M8MA 3WA0A 2KJRA 2BYFA 2QMTA 2MHJA 1PUTA 5H92C 2M56B 4ZRJA 3R2TA 3ZW3A 4FLHA 2HDEA 2IY0B 1IGDA 2JYTA 3VUXA 2LGXA 1DYQA 2ICIA 3K9OB 2D3CA 4RCOA 2JRHA 2JF5A 2QJLA 3J9CA 1B1ZA 2KXJA 2E3TA 4KV2A 1SF0A 4GDLB 2JY6A 1FXIA 1YQBA 2K5PA 3DBHB 2IZVB 2QSDA 3KW5B 3Q3JA 1GUAB 2KN4A 2DHZA 4LNIA 2V0GA 3VVWB 1QZEA 2I2YA 1RAXA 3AE7B 2YEPB 3I5JC 3JSVB 1V1OA 4YL8A 3DQVA 3ONSA 4MGKE 4DHZB 3H8HA 4XX5A 1V5TA 3ZXRA 3PPAA 1TYGB 1MG4A 3PHXB 5BMHA 3GZNB 3MJWA 1GJZA 3SDLC 3WALA 2EMTA 2C7HA 2HJ1A 4JWUC 4S17A 1UBQA 4YSZB 3SHQA 3AEFB 3ZNHB 2CU1A 4M0WB 4L23A 4RGMA 4W9CA 3PHWB 2LUMA 1J0GA 1SJHD 5TR5A 3U7ZA 4FBJB 2INDC 1S3SG 4HXDA 2WXHA 5DPWA 4CYEA 2KKCA 3RMKC 1IBXB 2XNAC 1KLVA 1UWMA 1V86A 3KWLA 1D3ZA 3IT6B 4Q2JA 2J4XA 2BPSA 4GOCA 5HFYA 3CSTA 2WDVB 4WWPA 4AP4C 1J19A 2IO1B 2DWQA 2SAKA 2X38A 3PV1A 2AYOB 3AV8A 3MC0B 4AJYB 2M19A 3SU8X 4I6LB 1UGMA 1YQ4B 2ON8A 1S1QB 5C1ZA 4TKNA 1WXAA 3FKYA 2AL6A 2H88B 1YNTE 3D32A 3U8ZA 2C7MB 4R3DA 2N7EA 1E8XA 2QIEB 3RFZB 4EZKA 4IDIA 1N5XA 2IJ0A 3OJ4B 3AE8B 4QAYA 1L6VA 1VRAB 4IKGA 3PZ8A 4FJVB 2KC2A 1R4MI 3NRZA 2JXXA 5EE0A 2PMVA 1FM0D 4C7YA 1FRDA 3NVYA 2CKHB 4AJWA 1QILA 3DCGA 1WH3A 2DENB 1RFKA 1T3QA 2K8CA 4FJZA 4F7ZA 3WAMA 2N9KA 2JUOA 1ISNA 2LMCA 2W3RA 2D11A 3R66C 2KC1A 2MBEA 2NS5A 4K7SA 3E56A 1EM7A 3HM3A 4ZRIA 4EZLA 2RSUA 2PEAA 1FXTB 3PSEB 3QIJA 4MM3A 1K8RB 2DLBA 2WXRA 3C8YA 2ZPYA 4XYCA 1M94A 2EELA 3UI3A 4NAWB 2Y5BB 1C77A 5BO4B 2RR9A 3E9SA 4KVGB 2NBWB 4MACA 2Z8LA 4C00A 3W9CB 4MH0E 2DYMA 3NZUA 3KH0A 2V1YA 2JRIB 1EU3A 3EUB2 2RPQA 1E90A 1V2YA 1UD7A 2UYZB 3SR6A 1HA5A 1ENFA 2VH2A 3L4PA 4JGHB 4GDKA 4GMVA 2GLSA 4RM8A 1I4XA 5C23A 1J7AA 1VLBA 1T5XD 1Q1OA 2ZEQA 3PLVA 2W55A 1GC7A 2GOWA 5EE1A 2KACA 2Z59B 3PVLA 2K0PA 1D5XC 1ZW7A 3W1SA 2BQQA 4BKSD 2PLPA 3AE3B 2LGIA 1I4PA 1SXTA 3RZFA 2L05A 3AH7A 4N59A 2KVZA 3TJPA 2LHDA 3OAWA 4DQOC 2JSVX 1VDVA 4YSXB 1QOAA 3PRZA 3Q3OC 1V5OA 3NG0A 3ZJTA 4KX6B 4S0RA 1A70A 2MJ3A 4C7ZA 5MPOA 1KLUD 2CS4A 4KSKC 4LK0M 3ZYYX 4K3CA 4MSMB 3VTVA 2Y5CA 2N9LA 1NDDA 2BTEA 1F9JA 4KKIA 2FCSA 4ZRQA 1P7FA 1MHHE 1JROA 2R2QA 3PRMB 3T8MA 2L1AA 3SEBA 3N9YC 2PVGC 2D3BA 3JW0X 3NOBA 4AS1A 1WX8A 3WAOA 2WWZA 1UWXA 3B2GA 4IWOA 1ET6A 3M62B 5CHVC 2IGDA 2D07B 3ZNGC 2BW2A 4HKQA 4FADA 4ITKA 2V3NA 3MJ5A 1TGZB 2IGHA 3AMZA 3KUDB 3KYDD 4GLSC 1ZDVA 1E6EB 1UH6A 3N1ZC 1YX6B 1MJDA 2GRIA 1WI0A 3AE5B 3CIRB 1L4DB 3ZO5B 3AXCA 4WQOB 1QF6A 3HM6X 3KYCD 4TUUA 1YX5B 1Q5WB 3P4QB 4KDIC 1GAQB 3TIXA 3DDCB 3M95A 2GBNA 4MGIE 1WFYA 3WAPA 1NEKB 3BWUD 4FN2A 3DBLI 2N4FA 4MDKE 1FPYA 4LNOA 2WP9B 4W9HA 4REZA 1RWSA 1F2RC 2KWVB 2MP2A 1SB3C 4NPNA 4JWSC 4HEA1 5JZEB 5FK9C 3QA8A 2N1WA 2R61A 4CQNA 1OQQA 5BYSA 2N7DA 4P6VF 4TQ0A 4DK5A 3X0WA 1I4GA 1ZPSA 2KWCA 1YN3A 1YQ3B 2NPTA 2KX0A 1JRPA 3C0RB 2QILA 1WF9A 2LVOA 4JL9A 4ASWC 4B9KA 2IO3B 1FNWA 1N5WA 3BVMA 1XLNA 2CHZA 1V1PA 3A4RA 4B95A 2MRPA 3KUZA 4ZOHC 1L4ZB 2WXKA 3IXSA 3UIOB 2WXQA 3GS2A 1C3TA 4OVUA 2CJNA 1E8WA 2C60A 2MSED 2CR5A 1P7EA 1SJED 4MM3B 2M1MA 1DOYA 4J3OD 4BBNC 4E71A 5JH5C 2K6DB 1SIJA 1SEBD 3QJZA 3LDZE 4OVZA 4XC2A 4OZCA 2DBYA 4IM2A 2KDBA 4BZAA 5AUKA 1ZXIA 4RGNA 3HHMA 3DBRB 3V3XA 4DXFA 2IO2B 2GBRA 4GDKB 2EMSA 4RH6A 3ML8A 4JE3B 4DDID 3VR9B 4DHJB 4W9JA 5J18A 1WR6E 1HQRD 2SEBD 3T3NA 3TEWA 3DPDA 3APDA 4W9IA 2KFKA 3DHGC 3VTUA 2H89B 3VUWA 2BB5A 3ZKJC 1HZ6A 4I6PA 2PPHA 1WX7A 3AB5A 3AEGB 4HDQA 2BT6A 1EWCA 4YSYB 3NHEB 4OW0A 1HZ5A 2FUHB 1N63A 1E8ZA 4NZLB 1V97A 4LDTD 3VH4B 2QCZA 1XLOA 1TBEA 2KNBA 3Q6BA 2WNMA 3VHTC 1WGKA 1WJNA 3EA6A 3I63C 4RGOS 3R3MA 3AEEB 4XWWA 1WYWB 1QT9A 3R2IA 4DXAB 1K50A 2O2VA 1VZ6A 5IOIA 1QOBA 1L5PA 1SE2A 4RMAA 2KD0A 3IHPC 4IM3A 1PGXA 1F0ZA 2AQ2B 2A4ZA 3DBHI 1LM8B 3KUCB 4A9AA 4FULA 1B9RA 1Q0WB 2NTSA 1YD8U 3ZTCA 2ZNVC 1E7PB 1EO6A 2AQ3B 3Q3NC 4EZJA 4P7IA 1JQ4A 2IBIB 1ZP0B 3GOEA 3APFA 3VFKA 1YN5A 3HIZA 2XEWA 4W9EA 3HVZA 3BYTB 3Q8CA 1FNVA 1WJ6A 1XO3A 5CHWA 5BMIA 2D3GA 2XN9C 1A5RA 3W5UB 2YEPF 5HKHA 3VH3B 2KDEB 3A9JA 3GZNI 3EGRA 2G3QB 1E9MA 4KGSA 2RD0A 1LGRA 1L0VB 1VD2A 4JLCA 2W9NA 3OJ3A 2AQ1B 2ZJDA 3IAM1 1BMLC 3IVFA 4ARIA 2MP2B 1HTQA 4ZHPA 2KJ6A 2JPHA 2ZW0A 2LRUA 4WIPA 4M02A 4PYUA 5D94A 1IP9A 3TCAA 3NUHB 3I3TB 5AZGA 2DZKA 2O6VD 1WR1A 4BVUC 4CHKA 1JRUA 4USAA 1K51A 3NZSA 2M0AA 1UGJA 1EWYC 1E5WA 4NJ6A 1IGCA 1NI3A 2NPTB 2EKEC 3ZJVA 3B2FA 4GU2A 4MJSA 1ACCA 3VUYA 5IP4D 2HJ8A 1RFAA 4L1BA 5LNK1 1ZUD2 2BKFA 1V1PB 2HE7A 2KAJA 4ARCA 5DPRA 2RDGA 1WGRA 4GIVA 5G2NA 4RM9A 2ACZB 1E0ZA 2LHEA 3Q3FA 3PREA 2KOXA 3LYYA 2L7RA 3RD2A 3AI5A 3LB8C 2BF8B 4J6IA 1BUIC 4WURA 1HTOA 2BB6A 2G4DB 3ABVB 4BFRA 4RNAA 3KLSX 2DYBA 2WQYB 1XLQA 2JU6X 3O13A 5L95C 3DVNU 2KDMA 3NJTA 5GXGB 3P63A 3RYTA 2JT4B 1CQVA 3BK1A 2CHWA 2KQSA 4WWMA 2NTTA 3I9V1 4OHJA 2WX0A 5CTRC 3NZ3A 4BOSC 3TL5A 3AE6B 3OLMD 4MSQB 1OEYA 3K9PB 1NI2A 2N9EB 5E6NA 3OWEB 3RNBC 1X1MA 1GC6A 1MFWA 2K3UA 4P1CC 3ENEA 2J0JA 2PTLA 1TS5A 1NENB 4M01A 4WWNA 1AN8A 1J8CA 2MWSB 3ZXVA 3CF6E 3EC8A 3PZ7A 2KDFB 4LDTB 1V6EA 4BKTA 2L76A 4MELA 3U2SC 4M8NA 3MC8A 3BVZA 2KFKB 1KH0A 3BIID 1RM6C 3AM9A 1FO4A 1OEYJ 1IUEA 1AW7A 3DBSA 1D4BA 2KDIA 4EOYA 5FR3A 2OOBB 2AL3A 2CJOA 3UIPB 1WIAA 1TZ1A 1NBFC 4FHKA 2I1KA 3MHSD 4YT0B 2KT7A 2WXPA 1L2NA 3SFDB 3VR8B 3ZDTA 2V3PA 4E3CA 2KHWB 1E7UA 3V6EB 2K25A 1EF1A 4BKSA 2BWES 4BKGA 2O2VB 2NBUA 5LXHA 3H7SA 2BYVE 2LZ6A 4HRSA 3IAS1 1ZDXA 2MBOA 1ESFA 1LO5D 4XZ4A 3L16A 3TEYA 4LLGM 5TSSA 1UELA 2RDBC 2LGSA 2WGSA 1WYGA 3O65B 2WXFA 2KFJA 2KTRA 4YTMB 2KZRA 1R7SA 5CHFA 2NVUI 2DX5B 1LXDA 1N61A 2WS3B 1K52A 2KX3A 5IA7A 1OGWA 4NQKE 4PS3A 3BY4B 4KSLC 4GGQA 4PS7A 3B08A 2K6QA 4JX1C 2KLGA 3MP9A 1F1HA 5DCNA 2D10A 1N60A 3IFWB 2C5LC 3Q8BA 3DVGY 2MBBB 3QK0A 1XT9B 2DZIA 4AQ7A 3H6NA 1G6JA 1GG3A 4DWFA 2HD5B 2E6XA 2LGYA 4RGTA 3P2BA 3WANA 5HI1A 4OZAA 1Y56A 2L83A 4G3XB 2BWFA 3V61A 1AARA 2DZMA 2GBJA 2MH7A 2GBMA 2J52A 3UINB 1PFDA 1TKEA 3N1YC 1XLPA 3VRBB 1WGHA 2NBVB 3H1UA 3APCA 3M3JA 3W2DA 2BS2B 4MT5A 4ACFA 3T9LA 1PYWD 2WDRB 4M00A 2KK8A 5IKCM 4HCNB 3NVWA 3QCAA 3W5VB 2N0SB 4B0EA 2WLBA 3L0WB 3HK0A 4KGTA 1I4RA 4LJPB 3V6CB 3DVGX 1HE8A 4DHZE 4G11A 1AWDA 2RDHA 1JWMD 2Y5PA 3DWGC 3A33B 1FMAD 2QEJC 2V4IB 4ZYNA 3JVZX 1KFYB 3UGBB 3AECB 2D5GA 2BGFA 2MLBA 2QC8A 3GP7A 5E6OA 4GB9A 2J7QB 1WRDB 4OVVA 4WJQA 3TUOA 1OQYA 1FIQA 1JWSD 4IG7B 4HROA 1UBIA
chains in the Genus database with same CATH topology
1SJHD 1KRHA 2BB5A 1HZ6A 2NMQA 3U7ZA 3AB5A 3AEGB 3TSSA 2BT6A 2ZW1A 2WXHA 1EWCA 3FILA 4YSYB 1WWTA 4OW0A 5HHDG 4YXDB 1D5MC 1HZ5A 1N63A 1C9FA 1IBXB 1ZE3D 2XNAC 4NZLB 1V97A 1TKYA 3Q69A 1XLOA 3FAHA 2WNMA 1UWMA 2JXTA 3P4RB 2PKOA 1C79A 3KWLA 2JQRB 1M4VA 1WGKA 3IT6B 4Q2JA 1AYFA 2J4XA 5HFYA 4XDCA 3EA6A 1YMHE 4RGOS 2WXJA 4NAMA 3AEEB 4XWWA 2WDVB 3BYYB 1QT9A 3R2IA 2VZKD 1V8CA 5E6JA 1NVID 1K50A 1WSPA 2DWQA 2SAKA 1VZ6A 3BZDB 3P42A 3TEXA 2OHFA 1QOBA 2X38A 1L5PA 1D6EC 1SE2A 3AV8A 3MC0B 1FEHA 5HG2A 2FUG1 3MFGA 1PGAA 1PGXA 2M19A 4A8XC 1F0ZA 3HRDD 2AQ2B 1YQ4B 2ON8A 3Q8FA 4A9AA 1QQRA 1XF5L 2LJIA 1B9RA 2LEKA 5H8YE 2NTSA 2H88B 1YNTE 4R3DA 4DXGA 1CZPA 2QIEB 3RFZB 1E7PB 1STEA 2AQ3B 4IDIA 1N5XA 2IJ0A 2W3SA 3AE8B 2W82A 5G5HA 4XDDA 1JQ4A 1ZP0B 1C4AA 1TY0A 2IGGA 1L6VA 4L2YA 4HKZE 1YN5A 1VRAB 1VZ8A 4IKGA 2PW9A 3MHZA 2GB1A 3HVZA 3PZ8A 1YJIA 3BYTB 3Q8CA 3NRZA 1FNVA 1DOXA 1XO3A 5BMIA 1ZXHA 1L6UA 2XN9C 1TS3A 3HUIA 5EE0A 3W5UB 2YEPF 4TSSA 3T3OA 2K22A 2PMVA 2TSSA 1FM0D 4C7YA 1MPEA 1FRDA 3EGRA 3NVYA 1WRIA 4A6QA 1QILA 1E9MA 4KGSA 2BS4B 1FXAA 1UNSA 4OZBA 1Q10A 1L0VB 1RFKA 1T3QA 1C4PA 1GPXA 1QOFA 1VZ7A 3HVDA 2N9KA 1YN4A 5BYQA 3Q8EA 1UUPA 2LMCA 4RFBA 2W3RA 2WXOA 4C56C 3IT4B 2AQ1B 3IAM1 3E56A 1BMLC 1JMLA 5EE9A 4ARIA 1EM7A 2PIAA 4ZHPA 1DGJA 1QKZA 4UDUC 1MVKA 2ZW0A 3U4EG 4WIPA 5FKAC 2DLBA 2JWUA 2WXRA 3C8YA 2MEKA 2ONQA 2EELA 3KQ4A 3UI3A 2N7JA 4NAWB 1GB4A 1C77A 1D5ZC 3FC4A 3NUHB 3E9SA 3B9JA 2B76B 4YWGG 3NVVA 3Q8AA 4MACA 4USAA 1K51A 2Z8LA 4XE0A 3W9CB 2DYMA 1KF6B 1XCTL 2M0AA 2J53A 4US8A 3URYA 1UGJA 2BYTA 1EU3A 1EWYC 3EUB2 4IOIE 4ZRPA 4WQMA 1PDXA 1FD6A 1QLBB 1IGCA 1NI3A 4KKJA 3ZJVA 3ETRA 3B2FA 1HA5A 2OEDA 3SR6A 4A55A 4ZHOA 1ENFA 3L4PA 1ACCA 1I4XA 1J7BA 4L1BA 1J7AA 1VLBA 1T5XD 5LNK1 1ZUD2 2W55A 4TMAB 2WU5B 1V1PB 5EE1A 1J7CA 2KACA 2KAJA 3AE1B 4ARCA 2RDGA 2K0PA 1D5XC 3W1SA 2G9HD 2K9XA 2PLPA 3AE3B 2ACZB 3GB1A 1E0ZA 2LGIA 1I4PA 1SXTA 2FE8A 2LHEA 3AH7A 2INNE 1PGBA 1L0YB 3LYYA 4M0WA 4N59A 1C78A 1EU4A 2WXNA 2L52A 2FBWB 2JZPA 3LB8C 1KLGD 2LHDA 3P4SB 1BUIC 1JWUD 4WURA 5BYRA 4D2KA 4FXCA 4DQOC 2JSVX 1VDVA 2BB6A 1TY2A 1QOAA 4YSXB 3ABVB 3VQIA 4RNAA 1K53A 3KLSX 2WQYB 1XLQA 2JU6X 3ZJTA 4KX6B 1L0XB 3O13A 1A70A 2MJ3A 4C7ZA 4NJCA 5MPOA 1KLUD 1IBXA 4LK0M 2KDMA 1ET9A 3P4PB 3P63A 5GXGB 2IPKD 3AEAB 1RYJA 3ZYYX 1CQVA 3BK1A 2Y5CA 4H2AA 2N9LA 4RF0A 2BTEA 3AEBB 2AX5A 2KMMA 2NTTA 3I9V1 4KKIA 4OHJA 4WWMA 1GOZA 3NZ3A 4ZRQA 3DWMA 1P7FA 1JALA 1MHHE 1JROA 3AE6B 4YTNB 1C4CA 2L1AA 3SEBA 3N9YC 2PVGC 3AE2B 3LXFA 3P1MA 1CK1A 3OWEB 4KGRA 2K3UA 4A90A 4YTPB 3TEZA 1NYRA 1SE3A 4AS1A 1SSNA 1FCCC 3AN1A 2PTLA 1TS5A 1NENB 4RF1A 1YJJA 1F2RI 1ROEA 1UWXA 1AN8A 3B2GA 1ET6A 3NVZA 1I4QA 3PZ7A 2IGDA 2EKIA 3U2SC 1OFFA 2DYOA 3BVZA 2BW2A 2WXLA 4HKQA 1ZOYB 3KWVA 1FFUA 1KH0A 4ITKA 3BIID 2V3NA 1RM6C 2MJDA 3AEDB 3AM9A 3MJ5A 1FO4A 1FCLA 1IUEA 4WH4A 1AW7A 2IGHA 2WDQB 5D7GA 5JXVA 1I7HA 3BVGA 3AMZA 2INPE 1D4BA 4O1NA 4GLSC 3FILB 1FRRA 1ZDVA 1E6EB 2VZKB 5FR3A 1OQRA 1TS4A 4EE2A 2PVOD 3RPFC 2CJOA 2GRIA 3AE5B 3CIRB 4C80A 1L4DB 2BBCA 1QF6A 4B0MA 1I4HA 1FNUA 2IDYA 1BXTA 3AE4B 4YT0B 1TJEA 2WXPA 3SFDB 3VR8B 2V3PA 1JWAD 3P4QB 2LFIA 2HTME 1TZOA 1GAQB 1HEZE 2G1EA 2RPVA 4LTUA 3BK2A 4HJGE 1NEKB 3BWUD 5T8IA 4HRSA 3IAS1 1FFVA 3WCQA 1ZDXA 1ESFA 2WP9B 1LO5D 4REZA 2MJEA 2GI9A 1RWSA 5EE3A 2I38A 3TEYA 4LLGM 5TSSA 2JYEA 5D3DA 1F2RC 4P16A 5C3JB 2BS3B 5D3IB 1SB3C 5C2TB 3ZGZA 4JWSC 4XWTA 4HEA1 1WYGA 1HXYD 4PT5A 5FK9C 2WXFA 5G5GA 1TKGA 3NS1A 1DOIA 1SBBB 3CWIA 2R61A 1KTKA 3R8BA 4CQNA 1OQQA 3ZQ4A 5BYSA 4YTMB 2WU2B 3AE9B 1R7SA 1N62A 2KQ4X 4P6VF 2J42A 2WXIA 1JCKB 1N61A 2WS3B 1K52A 5I4DA 4TQ0A 3U52E 2L32A 4TQ1A 1F77A 1I4GA 1XEEA 1ZPSA 4US9A 2KWDA 1YN3A 1YQ3B 2QMTA 1PUTA 1JRPA 4JX1C 1TS2A 5H92C 2QILA 3PO0A 2M56B 3MP9A 3R2TA 1N60A 1E10A 3Q8BA 3BVMA 1FNWA 1N5WA 1XLNA 1SE4A 1V1PA 2HDEA 1MI0A 2RMMA 4AQ7A 1IGDA 2JYTA 1DYQA 1JWBD 2ICIA 4RCOA 4ZOHC 1L4ZB 2WXKA 3IXSA 2E6XA 4RGTA 2WXQA 3GS2A 2QJLA 3J9CA 5HI1A 1B1ZA 4JPSA 4OZAA 2E3TA 2CJNA 1SF0A 2CU3A 1Y56A 1JW9D 2L83A 5AUIA 4GDLB 4ZYSA 1P7EA 1FXIA 1SJED 2K5PA 2MH7A 2Q5WD 4MM3B 2J52A 1PFDA 1QOGA 1TKEA 2QSDA 2WXMA 1DOYA 4J3OD 1XLPA 2JX5A 3VRBB 1SIJA 2KN4A 1SEBD 4OVZA 4OZCA 2DBYA 2V0GA 3W2DA 2BS2B 4MT5A 2I2YA 1PYWD 2WDRB 3I57A 5AUKA 3AE7B 1ZXIA 2YEPB 4RGNA 1V1OA 2Y3AA 2W54A 3NVWA 3W5VB 2N0SB 3V3XA 4B0EA 2WLBA 4DXFA 4KGTA 3H8HA 5BMGA 1I4RA 1XCQL 4WAFA 1VR9A 1MHXA 1CJEA 1C76A 1XXGA 3V05A 4GDKB 1WXQA 1AWDA 2RDHA 1TYGB 1JWMD 2Y5PA 4RH6A 3DWGC 5BMHA 4JE3B 1FMAD 3VRAB 3VR9B 4N6EB 3ZJUA 1GB1A 2QEJC 3SFEB 2V4IB 1HQRD 1KFYB 3AECB 2SEBD 3T3NA 2D5GA 3TEWA 4JWUC 4YSZB 3GP7A 3AEFB 1NYQA 1T6BX 1VJKA 4MH8A 4L23A 4RGMA 3TUOA 1FIQA 2H89B 2WXGA 1JWSD 4N58A 2LUMA 4HROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KRH A;  2PVG C;  3AE2 B;  2W3R A;  3AB5 A;  3LXF A;  3AEG B;  3P1M A;  2BT6 A;  4US9 A;  4YTP B;  5EE9 A;  1NYR A;  4YSY B;  1WWT A;  1YQ3 B;  3AN1 A;  1PUT A;  1JRP A;  4YXD B;  2PIA A;  4JX1 C;  1NEN B;  5H92 C;  1N63 A;  4ZHP A;  1DGJ A;  1YJJ A;  1ROE A;  1V97 A;  3PO0 A;  3B2G A;  2M56 B;  1TKY A;  3NVZ A;  1XLO A;  3FAH A;  1N60 A;  1E10 A;  2EKI A;  1UWM A;  1OFF A;  1N5W A;  3FC4 A;  1XLN A;  3P4R B;  2PKO A;  3KWL A;  2JQR B;  1WGK A;  1AYF A;  1ZOY B;  1FFU A;  3B9J A;  2B76 B;  3BII D;  4ITK A;  1RM6 C;  2MJD A;  1JWB D;  3AED B;  3AM9 A;  3NVV A;  4USA A;  1FO4 A;  1IUE A;  4ZOH C;  3W9C B;  2WDQ B;  1KF6 B;  3AEE B;  2WDV B;  4US8 A;  1QT9 A;  1I7H A;  3AMZ A;  1EWY C;  1V8C A;  2QJL A;  3EUB 2;  4WQM A;  1NVI D;  1PDX A;  2DWQ A;  1QLB B;  2E3T A;  2CJN A;  1FRR A;  1SF0 A;  2CU3 A;  1QOB A;  2OHF A;  1L5P A;  1JW9 D;  1E6E B;  1NI3 A;  2L83 A;  5AUI A;  3AV8 A;  1OQR A;  2PVO D;  3B2F A;  3ETR A;  3SR6 A;  2M19 A;  3RPF C;  4ZHO A;  2CJO A;  1FXI A;  2K5P A;  2MH7 A;  3AE5 B;  2Q5W D;  3CIR B;  3HRD D;  3L4P A;  4C80 A;  1YQ4 B;  1PFD A;  1QOG A;  1TKE A;  4A9A A;  1QF6 A;  1J7B A;  1DOY A;  1B9R A;  1J7A A;  2LEK A;  1VLB A;  1XLP A;  2JX5 A;  5H8Y E;  3VRB B;  3AE4 B;  1ZUD 2;  2W55 A;  1SIJ A;  2H88 B;  2WU5 B;  1TJE A;  4YT0 B;  5EE1 A;  1J7C A;  3SFD B;  3VR8 B;  2KAJ A;  1JWA D;  3AE1 B;  3P4Q B;  1F0Z A;  1CZP A;  2DBY A;  2QIE B;  1E7P B;  2BS2 B;  2K9X A;  4IDI A;  2WDR B;  1N5X A;  2ACZ B;  2HTM E;  3AE7 B;  1ZXI A;  2W3S A;  3AE3 B;  1GAQ B;  5AUK A;  1E0Z A;  3AE8 B;  2G1E A;  4LTU A;  3AH7 A;  5G5H A;  2W54 A;  3NVW A;  1JQ4 A;  1ZP0 B;  1L6V A;  1NEK B;  3W5V B;  4N59 A;  2N0S B;  2L52 A;  2WLB A;  2FBW B;  4HRS A;  3LB8 C;  3P4S B;  1FFV A;  3WCQ A;  3HVZ A;  2WP9 B;  4FXC A;  1VDV A;  1YJI A;  4YSX B;  1QOA A;  2MJE A;  1CJE A;  1RWS A;  5EE3 A;  3NRZ A;  3ABV B;  1DOX A;  1WXQ A;  1XO3 A;  1AWD A;  1TYG B;  1L6U A;  2WQY B;  1XLQ A;  5C3J B;  3DWG C;  2BS3 B;  3HUI A;  4KX6 B;  5EE0 A;  3W5U B;  1A70 A;  2MJ3 A;  2K22 A;  1FMA D;  1SB3 C;  5C2T B;  4N6E B;  1FM0 D;  3VRA B;  3VR9 B;  4JWS C;  4C7Z A;  3SFE B;  4C7Y A;  1WYG A;  5MPO A;  1FRD A;  3NVY A;  1WRI A;  1KFY B;  3ZYY X;  3P4P B;  3P63 A;  5GXG B;  1E9M A;  3AEA B;  1RYJ A;  3AEC B;  5G5G A;  1TKG A;  3NS1 A;  2Y5C A;  2BS4 B;  1DOI A;  1FXA A;  4JWU C;  4YSZ B;  3AEB B;  3AEF B;  3CWI A;  2AX5 A;  1L0V B;  2KMM A;  1NYQ A;  1RFK A;  4WWM A;  1OQQ A;  1T3Q A;  4YTM B;  1VJK A;  2WU2 B;  3AE9 B;  1R7S A;  1GPX A;  1N62 A;  1QOF A;  3DWM A;  4P6V F;  1JAL A;  1JRO A;  3AE6 B;  1N61 A;  4YTN B;  1FIQ A;  2H89 B;  2WS3 B;  4N58 A;  4HRO A; 
#chains in the Genus database with same CATH topology
 1KRH A;  2M8S A;  3ZRF A;  3TSS A;  2ZW1 A;  3FIL A;  2QDF A;  1WWT A;  2Z0D B;  3A4S C;  4YXD B;  1D5M C;  3N20 C;  2IY1 B;  3RI7 C;  3RUI B;  2JWZ A;  1C9F A;  1ZE3 D;  2XBB C;  2V4L A;  1H8C A;  1WY8 A;  2X8X X;  5JHB A;  4IWP A;  3Q69 A;  3FAH A;  2VRR B;  4LNF A;  1AYF A;  1WGY A;  1T0S C;  3RUL A;  2WXJ A;  2FCM A;  3GE8 C;  2K39 A;  3BYY B;  1SIF A;  1WSP A;  3BZD B;  3P42 A;  2OHF A;  1FEH A;  3MFG A;  1LFD A;  2I1J A;  2PJH A;  4A8X C;  1WM2 A;  3Q8F A;  4WJO A;  3ZDM C;  1SGH A;  1Y8R C;  3W1Y A;  4DXG A;  3OG5 A;  3NY5 A;  1CZP A;  2WYQ A;  2J0K A;  4HVB A;  1LQB A;  3RN9 C;  4XDD A;  2B3A A;  1TY0 A;  2PW9 A;  2LUE A;  2GB1 A;  3RT3 B;  4MGZ E;  4FA6 A;  1YJI A;  3L10 B;  2FCN A;  2FNJ B;  5DPS A;  2KQ7 A;  4JIO U;  1DOX A;  1ZXH A;  1L6U A;  2M4N A;  1TS3 A;  3RNE C;  2K22 A;  2TSS A;  2JZ3 B;  3X23 A;  3PGE A;  1WRI A;  3R7R A;  2DNF A;  4NNJ B;  2KAN A;  1FXA A;  1UNS A;  4OZB A;  2HTH A;  5AEK B;  1WM3 A;  1C4P A;  2FIF A;  1GPX A;  1QOF A;  5JHA A;  3Q8E A;  4W9D A;  1UUP A;  3M63 B;  2KLC A;  1KOT A;  4K7W A;  1V81 A;  2REX A;  3IT4 B;  3PT2 B;  1JML A;  1UF0 A;  5EE9 A;  1V49 A;  3S2A A;  1YOV B;  1DGJ A;  1QKZ A;  4UDU C;  1MVK A;  3U4E G;  1WGD A;  2JWU A;  1WXS A;  3QQ8 B;  2ONQ A;  2KTR B;  2N7J A;  4KDL B;  1D5Z C;  3N32 A;  4ANV A;  2B76 B;  2OJR A;  1KJT A;  2N9X A;  2J53 A;  3URY A;  2BYT A;  4IOI E;  4WQM A;  1FD6 A;  1QLB B;  4KKJ A;  3ETR A;  1OTR B;  2C9W B;  4X57 B;  1WXV A;  2J0M A;  3BIN A;  4KZC A;  1J7B A;  1T0Q C;  2INC C;  4TMA B;  1P9D U;  2MA9 B;  1J7C A;  4XGA B;  2D3A A;  1E8Y A;  2G9H D;  2K9X A;  2MQJ A;  3UQB A;  3ZLZ A;  2LGD A;  1H4R A;  3N3K B;  2INN E;  1PGB A;  4E74 A;  4NQL B;  1EU4 A;  2WXN A;  2L52 A;  2FBW B;  3P4S B;  3L13 A;  5FR6 A;  3VTW A;  2KTF A;  2NCN A;  3VQI A;  1K53 A;  1L0X B;  2KMC A;  1V9J A;  2QHO A;  2K8H A;  2KMA A;  1R4N B;  1ET9 A;  1RYJ A;  2UU7 A;  4H2A A;  4WAA A;  3RNC C;  3AEB B;  3RCZ A;  1GOZ A;  3DWM A;  2LVP A;  1MG8 A;  1CMX B;  4YTN B;  1WX9 A;  2K1F A;  4JQW C;  2N9P C;  3P1M A;  4KGR A;  4A90 A;  3TEZ A;  3ZRC A;  1I42 A;  1NYR A;  1SE3 A;  1SSN A;  2ASQ A;  3AN1 A;  4RF1 A;  1ROE A;  2ZPN A;  2M17 A;  3NVZ A;  1WGG A;  1I4Q A;  2WDT B;  3A1Q A;  4KIK A;  3QHT A;  4LNN A;  2EKI A;  4NY0 A;  2DYO A;  1SE9 A;  2WXL A;  3KWV A;  3AED B;  2MJD A;  2O6V A;  2WDQ B;  2IYD B;  1I7H A;  3BVG A;  3H7P A;  2INP E;  4II3 B;  3FIL B;  1FRR A;  3IBE A;  4HCP B;  3U30 A;  4HPP A;  1TS4 A;  4N9F 4;  4EE2 A;  2PVO D;  1P0R A;  5J17 A;  3PLU A;  2BBC A;  4C4V A;  1I4H A;  2IDY A;  1BXT A;  2ZVN A;  3AE4 B;  2LXA A;  4IUM B;  1TJE A;  1P98 A;  1XQQ A;  4AWJ A;  3A9K A;  2LFI A;  3EFU A;  2HTM E;  1TZO A;  1I35 A;  1HEZ E;  2RPV A;  4LTU A;  2FID A;  1WE6 A;  4ANU A;  1TIF A;  4AOF A;  1WXM A;  5EE3 A;  2JYE A;  3Q2A C;  4EFO A;  4P16 A;  5C3J B;  3DVN V;  5D3I B;  3C19 A;  5IAA C;  5J2R A;  4XWT A;  2YVC A;  5EDS A;  1ZKH A;  4PT5 A;  5D2M B;  4FJY A;  1TKG A;  3NS1 A;  2ZNV B;  3AUL A;  2WU2 B;  3AE9 B;  3SD5 A;  1N62 A;  2J42 A;  2WXI A;  2LRW A;  3Q14 C;  5I4D A;  3U52 E;  2L32 A;  1RRB A;  4DDG D;  5LXI B;  4K7U A;  1XEE A;  2OJW A;  4US9 A;  4WWO A;  1YJ1 A;  2ZZP B;  1TS2 A;  2L0F A;  3PO0 A;  1WE7 A;  1P1A A;  1E10 A;  4GN1 A;  1U4A A;  1SE4 A;  1MI0 A;  2RMM A;  2MW5 A;  1TT5 B;  3VDZ A;  1JWB D;  2DAF A;  2MX2 A;  4IWQ A;  4JPS A;  2ZCB A;  4FHJ A;  2CU3 A;  1JW9 D;  2AEH A;  5AUI A;  3UF8 A;  4ZYS A;  2Q5W D;  2XK5 A;  1QOG A;  2WXM A;  2JX5 A;  2R2O A;  3MC9 A;  3RNA C;  3I57 A;  2Y3A A;  2W54 A;  4LJO B;  3RZW C;  4EKU A;  4ANW A;  4WJN A;  5BMG A;  1XCQ L;  1R4M B;  4WAF A;  1VR9 A;  1MHX A;  1CJE A;  1C76 A;  1XXG A;  3V05 A;  1WMH A;  1WXQ A;  3VRA B;  3ZJU A;  4N6E B;  3AU4 A;  1GB1 A;  3SFE B;  4HPM B;  4K1R B;  1YIW A;  3ZUN A;  2DAJ A;  3ML9 A;  4IC7 B;  1NYQ A;  1T6B X;  3Q3M C;  4A20 A;  1VJK A;  3ZNI D;  4MH8 A;  4EUT A;  2WXG A;  3B0A A;  3GE3 C;  4N58 A;  2FAZ A;  2KYW A;  3PTF C;  2NMQ A;  1WJ4 A;  3ZTD A;  3VAW A;  2UWQ A;  2NR2 A;  5G55 A;  2JZZ A;  5HHD G;  2M0X A;  4B6W A;  3QAQ A;  1TKY A;  5KHQ A;  4MGY E;  2LI5 A;  1ZGU B;  4W9K A;  1PQS A;  1T0Y A;  2JXT A;  3P4R B;  2PKO A;  1C79 A;  1C1Y B;  1M4V A;  2JQR B;  2GMI C;  3RNG C;  4DBG A;  4XDC A;  1YMH E;  4A3O A;  4NAM A;  1P3Q U;  3AU5 A;  2VZK D;  1V8C A;  5E6J A;  1NVI D;  3TEX A;  3A9J B;  1D6E C;  3EEC A;  3JYU A;  1WZ0 A;  2LVQ A;  5HG2 A;  2FUG 1;  2BYE A;  4K81 A;  1PGA A;  5IO9 A;  3V62 A;  4A3P A;  3HRD D;  2K8B A;  1RLF A;  3A1Q B;  3L08 A;  1QQR A;  1XF5 L;  2KN5 A;  2LJI A;  4KIK B;  2LEK A;  3B1L X;  3MTN B;  5H8Y E;  4DHJ D;  1Z2M A;  2KVR A;  3PRP B;  5GMV A;  3ZNZ B;  3EHV A;  3TMP B;  2YLM A;  2LWP A;  2O6V B;  1EF5 A;  3LJ3 A;  1STE A;  3QWZ B;  1WJU A;  3R7Q A;  2W3S A;  2W82 A;  5G5H A;  3H7P B;  1XD3 B;  5KHO A;  1C4A A;  2IGG A;  4L2Y A;  4HKZ E;  1VZ8 A;  4HK2 A;  1IYF A;  2ZVO A;  3MHZ A;  2BVC A;  4EEW A;  4II2 B;  2KWU B;  4C4V B;  5IN7 A;  2GBK A;  3HUI A;  2JVC A;  4TSS A;  3T3O A;  4BAX A;  1MPE A;  4F8C B;  2BKR B;  4A6Q A;  4PK1 A;  2VH1 A;  3A9K B;  2LXC A;  2BS4 B;  2MBH A;  4GXB A;  1Q10 A;  3ZIM A;  2FCQ A;  2L00 B;  1VZ7 A;  4IW0 A;  3HVD A;  1YN4 A;  5BYQ A;  1BT0 A;  4MJS B;  5D6J B;  4HWI B;  4WJP A;  4RFB A;  2DZJ A;  2Z0E B;  2WXO A;  4C56 C;  2V3S A;  3UQA A;  2PIA A;  2ZCC A;  4GDL A;  3QX1 A;  4P1B C;  4HLE A;  5FKA C;  3PS6 A;  4ZDV A;  2MEK A;  4I6N B;  3KQ4 A;  5LLI A;  1GB4 A;  3H9D A;  5DPT A;  3FC4 A;  2CHX A;  3B9J A;  4YWG G;  3NVV A;  3Q8A A;  3DOW A;  4HDO A;  2L0T A;  4XE0 A;  4F1S A;  1KF6 B;  3IG3 A;  1XCT L;  4US8 A;  1L7Y A;  3JSV A;  4NJ7 A;  4ZRP A;  4BOZ B;  1PDX A;  1WZ3 A;  2C7N B;  2OED A;  4A55 A;  4ZHO A;  5AZH A;  3RNF C;  4KZ0 A;  2IO0 B;  2WU5 B;  3W1S C;  2G45 B;  3AE1 B;  2A5U A;  4HPL B;  5E6P A;  3GB1 A;  2FE8 A;  2MCN B;  3NS8 A;  1L0Y B;  4M0W A;  3DBL B;  2KO3 A;  1C78 A;  2JZP A;  1KLG D;  5BYR A;  1JWU D;  4D2K A;  4FXC A;  5L83 A;  1TY2 A;  2XK5 B;  3CSF A;  5AZF A;  4K3B A;  3ALB A;  4NJC A;  1IBX A;  3P4P B;  2IPK D;  3AEA B;  2L8J A;  4AUQ C;  4RF0 A;  1UZX B;  2AX5 A;  2KMM A;  4ANX A;  4PS8 A;  3DBR I;  2AWT A;  4MEM A;  1V80 A;  3WIM A;  4HJK A;  1JAL A;  2PE9 A;  2LAS A;  1C4C A;  3AE2 B;  3LXF A;  3L17 A;  1CK1 A;  4G0N B;  1WMH B;  3ZVV A;  3QC8 B;  4YTP B;  2LJ5 A;  1FCC C;  1KM7 A;  1YJJ A;  1F2R I;  3VXW A;  4URK A;  2MBQ A;  4CO7 A;  4W9G A;  1OFF A;  2L3Z A;  2N1V A;  4LNK A;  2WHI A;  1ZOY B;  1FFU A;  3PZD A;  4ICU A;  1N6Z A;  1FCL A;  4IM0 A;  4WH4 A;  5D7G A;  5JXV A;  3DHI C;  4O1N A;  4W9F A;  2KJH B;  4GSW A;  2VZK B;  1OQR A;  3RPF C;  4C80 A;  3N1X C;  4TV3 A;  4B0M A;  1FNU A;  1JWA D;  1E7V A;  4W9L A;  3TBL D;  2G1E A;  2LD9 A;  1IPG A;  3BK2 A;  3KVF B;  2G4S A;  4HJG E;  1F52 A;  5T8I A;  1FFV A;  4G50 A;  3WCQ A;  4LCD E;  1T0R C;  2MJE A;  1GNU A;  2GI9 A;  4ICV A;  2I38 A;  1Z5S B;  5D3D A;  2BS3 B;  3ZGZ A;  5C2T B;  3N30 A;  2RGF A;  1HXY D;  1R4N I;  3ECI A;  2WX1 A;  5G5G A;  1DOI A;  1SBB B;  4ZRK A;  3CWI A;  3EFC A;  1KTK A;  3R8B A;  4NAW A;  1EUV B;  3CMM B;  3QAR A;  2D2Q A;  3ZQ4 A;  1TTN A;  2PE6 B;  2KQ4 X;  1JCK B;  4PYZ A;  5CX3 A;  4TQ1 A;  1F77 A;  4BBN F;  2V9H A;  3L54 A;  3V60 A;  3U7D A;  2KWD A;  1VCB A;  3DHH C;  4M8M A;  3WA0 A;  2KJR A;  2BYF A;  2QMT A;  2MHJ A;  1PUT A;  5H92 C;  2M56 B;  4ZRJ A;  3R2T A;  3ZW3 A;  4FLH A;  2HDE A;  2IY0 B;  1IGD A;  2JYT A;  3VUX A;  2LGX A;  1DYQ A;  2ICI A;  3K9O B;  2D3C A;  4RCO A;  2JRH A;  2JF5 A;  2QJL A;  3J9C A;  1B1Z A;  2KXJ A;  2E3T A;  4KV2 A;  1SF0 A;  4GDL B;  2JY6 A;  1FXI A;  1YQB A;  2K5P A;  3DBH B;  2IZV B;  2QSD A;  3KW5 B;  3Q3J A;  1GUA B;  2KN4 A;  2DHZ A;  4LNI A;  2V0G A;  3VVW B;  1QZE A;  2I2Y A;  1RAX A;  3AE7 B;  2YEP B;  3I5J C;  3JSV B;  1V1O A;  4YL8 A;  3DQV A;  3ONS A;  4MGK E;  4DHZ B;  3H8H A;  4XX5 A;  1V5T A;  3ZXR A;  3PPA A;  1TYG B;  1MG4 A;  3PHX B;  5BMH A;  3GZN B;  3MJW A;  1GJZ A;  3SDL C;  3WAL A;  2EMT A;  2C7H A;  2HJ1 A;  4JWU C;  4S17 A;  1UBQ A;  4YSZ B;  3SHQ A;  3AEF B;  3ZNH B;  2CU1 A;  4M0W B;  4L23 A;  4RGM A;  4W9C A;  3PHW B;  2LUM A;  1J0G A;  1SJH D;  5TR5 A;  3U7Z A;  4FBJ B;  2IND C;  1S3S G;  4HXD A;  2WXH A;  5DPW A;  4CYE A;  2KKC A;  3RMK C;  1IBX B;  2XNA C;  1KLV A;  1UWM A;  1V86 A;  3KWL A;  1D3Z A;  3IT6 B;  4Q2J A;  2J4X A;  2BPS A;  4GOC A;  5HFY A;  3CST A;  2WDV B;  4WWP A;  4AP4 C;  1J19 A;  2IO1 B;  2DWQ A;  2SAK A;  2X38 A;  3PV1 A;  2AYO B;  3AV8 A;  3MC0 B;  4AJY B;  2M19 A;  3SU8 X;  4I6L B;  1UGM A;  1YQ4 B;  2ON8 A;  1S1Q B;  5C1Z A;  4TKN A;  1WXA A;  3FKY A;  2AL6 A;  2H88 B;  1YNT E;  3D32 A;  3U8Z A;  2C7M B;  4R3D A;  2N7E A;  1E8X A;  2QIE B;  3RFZ B;  4EZK A;  4IDI A;  1N5X A;  2IJ0 A;  3OJ4 B;  3AE8 B;  4QAY A;  1L6V A;  1VRA B;  4IKG A;  3PZ8 A;  4FJV B;  2KC2 A;  1R4M I;  3NRZ A;  2JXX A;  5EE0 A;  2PMV A;  1FM0 D;  4C7Y A;  1FRD A;  3NVY A;  2CKH B;  4AJW A;  1QIL A;  3DCG A;  1WH3 A;  2DEN B;  1RFK A;  1T3Q A;  2K8C A;  4FJZ A;  4F7Z A;  3WAM A;  2N9K A;  2JUO A;  1ISN A;  2LMC A;  2W3R A;  2D11 A;  3R66 C;  2KC1 A;  2MBE A;  2NS5 A;  4K7S A;  3E56 A;  1EM7 A;  3HM3 A;  4ZRI A;  4EZL A;  2RSU A;  2PEA A;  1FXT B;  3PSE B;  3QIJ A;  4MM3 A;  1K8R B;  2DLB A;  2WXR A;  3C8Y A;  2ZPY A;  4XYC A;  1M94 A;  2EEL A;  3UI3 A;  4NAW B;  2Y5B B;  1C77 A;  5BO4 B;  2RR9 A;  3E9S A;  4KVG B;  2NBW B;  4MAC A;  2Z8L A;  4C00 A;  3W9C B;  4MH0 E;  2DYM A;  3NZU A;  3KH0 A;  2V1Y A;  2JRI B;  1EU3 A;  3EUB 2;  2RPQ A;  1E90 A;  1V2Y A;  1UD7 A;  2UYZ B;  3SR6 A;  1HA5 A;  1ENF A;  2VH2 A;  3L4P A;  4JGH B;  4GDK A;  4GMV A;  2GLS A;  4RM8 A;  1I4X A;  5C23 A;  1J7A A;  1VLB A;  1T5X D;  1Q1O A;  2ZEQ A;  3PLV A;  2W55 A;  1GC7 A;  2GOW A;  5EE1 A;  2KAC A;  2Z59 B;  3PVL A;  2K0P A;  1D5X C;  1ZW7 A;  3W1S A;  2BQQ A;  4BKS D;  2PLP A;  3AE3 B;  2LGI A;  1I4P A;  1SXT A;  3RZF A;  2L05 A;  3AH7 A;  4N59 A;  2KVZ A;  3TJP A;  2LHD A;  3OAW A;  4DQO C;  2JSV X;  1VDV A;  4YSX B;  1QOA A;  3PRZ A;  3Q3O C;  1V5O A;  3NG0 A;  3ZJT A;  4KX6 B;  4S0R A;  1A70 A;  2MJ3 A;  4C7Z A;  5MPO A;  1KLU D;  2CS4 A;  4KSK C;  4LK0 M;  3ZYY X;  4K3C A;  4MSM B;  3VTV A;  2Y5C A;  2N9L A;  1NDD A;  2BTE A;  1F9J A;  4KKI A;  2FCS A;  4ZRQ A;  1P7F A;  1MHH E;  1JRO A;  2R2Q A;  3PRM B;  3T8M A;  2L1A A;  3SEB A;  3N9Y C;  2PVG C;  2D3B A;  3JW0 X;  3NOB A;  4AS1 A;  1WX8 A;  3WAO A;  2WWZ A;  1UWX A;  3B2G A;  4IWO A;  1ET6 A;  3M62 B;  5CHV C;  2IGD A;  2D07 B;  3ZNG C;  2BW2 A;  4HKQ A;  4FAD A;  4ITK A;  2V3N A;  3MJ5 A;  1TGZ B;  2IGH A;  3AMZ A;  3KUD B;  3KYD D;  4GLS C;  1ZDV A;  1E6E B;  1UH6 A;  3N1Z C;  1YX6 B;  1MJD A;  2GRI A;  1WI0 A;  3AE5 B;  3CIR B;  1L4D B;  3ZO5 B;  3AXC A;  4WQO B;  1QF6 A;  3HM6 X;  3KYC D;  4TUU A;  1YX5 B;  1Q5W B;  3P4Q B;  4KDI C;  1GAQ B;  3TIX A;  3DDC B;  3M95 A;  2GBN A;  4MGI E;  1WFY A;  3WAP A;  1NEK B;  3BWU D;  4FN2 A;  3DBL I;  2N4F A;  4MDK E;  1FPY A;  4LNO A;  2WP9 B;  4W9H A;  4REZ A;  1RWS A;  1F2R C;  2KWV B;  2MP2 A;  1SB3 C;  4NPN A;  4JWS C;  4HEA 1;  5JZE B;  5FK9 C;  3QA8 A;  2N1W A;  2R61 A;  4CQN A;  1OQQ A;  5BYS A;  2N7D A;  4P6V F;  4TQ0 A;  4DK5 A;  3X0W A;  1I4G A;  1ZPS A;  2KWC A;  1YN3 A;  1YQ3 B;  2NPT A;  2KX0 A;  1JRP A;  3C0R B;  2QIL A;  1WF9 A;  2LVO A;  4JL9 A;  4ASW C;  4B9K A;  2IO3 B;  1FNW A;  1N5W A;  3BVM A;  1XLN A;  2CHZ A;  1V1P A;  3A4R A;  4B95 A;  2MRP A;  3KUZ A;  4ZOH C;  1L4Z B;  2WXK A;  3IXS A;  3UIO B;  2WXQ A;  3GS2 A;  1C3T A;  4OVU A;  2CJN A;  1E8W A;  2C60 A;  2MSE D;  2CR5 A;  1P7E A;  1SJE D;  4MM3 B;  2M1M A;  1DOY A;  4J3O D;  4BBN C;  4E71 A;  5JH5 C;  2K6D B;  1SIJ A;  1SEB D;  3QJZ A;  3LDZ E;  4OVZ A;  4XC2 A;  4OZC A;  2DBY A;  4IM2 A;  2KDB A;  4BZA A;  5AUK A;  1ZXI A;  4RGN A;  3HHM A;  3DBR B;  3V3X A;  4DXF A;  2IO2 B;  2GBR A;  4GDK B;  2EMS A;  4RH6 A;  3ML8 A;  4JE3 B;  4DDI D;  3VR9 B;  4DHJ B;  4W9J A;  5J18 A;  1WR6 E;  1HQR D;  2SEB D;  3T3N A;  3TEW A;  3DPD A;  3APD A;  4W9I A;  2KFK A;  3DHG C;  3VTU A;  2H89 B;  3VUW A;  2BB5 A;  3ZKJ C;  1HZ6 A;  4I6P A;  2PPH A;  1WX7 A;  3AB5 A;  3AEG B;  4HDQ A;  2BT6 A;  1EWC A;  4YSY B;  3NHE B;  4OW0 A;  1HZ5 A;  2FUH B;  1N63 A;  1E8Z A;  4NZL B;  1V97 A;  4LDT D;  3VH4 B;  2QCZ A;  1XLO A;  1TBE A;  2KNB A;  3Q6B A;  2WNM A;  3VHT C;  1WGK A;  1WJN A;  3EA6 A;  3I63 C;  4RGO S;  3R3M A;  3AEE B;  4XWW A;  1WYW B;  1QT9 A;  3R2I A;  4DXA B;  1K50 A;  2O2V A;  1VZ6 A;  5IOI A;  1QOB A;  1L5P A;  1SE2 A;  4RMA A;  2KD0 A;  3IHP C;  4IM3 A;  1PGX A;  1F0Z A;  2AQ2 B;  2A4Z A;  3DBH I;  1LM8 B;  3KUC B;  4A9A A;  4FUL A;  1B9R A;  1Q0W B;  2NTS A;  1YD8 U;  3ZTC A;  2ZNV C;  1E7P B;  1EO6 A;  2AQ3 B;  3Q3N C;  4EZJ A;  4P7I A;  1JQ4 A;  2IBI B;  1ZP0 B;  3GOE A;  3APF A;  3VFK A;  1YN5 A;  3HIZ A;  2XEW A;  4W9E A;  3HVZ A;  3BYT B;  3Q8C A;  1FNV A;  1WJ6 A;  1XO3 A;  5CHW A;  5BMI A;  2D3G A;  2XN9 C;  1A5R A;  3W5U B;  2YEP F;  5HKH A;  3VH3 B;  2KDE B;  3A9J A;  3GZN I;  3EGR A;  2G3Q B;  1E9M A;  4KGS A;  2RD0 A;  1LGR A;  1L0V B;  1VD2 A;  4JLC A;  2W9N A;  3OJ3 A;  2AQ1 B;  2ZJD A;  3IAM 1;  1BML C;  3IVF A;  4ARI A;  2MP2 B;  1HTQ A;  4ZHP A;  2KJ6 A;  2JPH A;  2ZW0 A;  2LRU A;  4WIP A;  4M02 A;  4PYU A;  5D94 A;  1IP9 A;  3TCA A;  3NUH B;  3I3T B;  5AZG A;  2DZK A;  2O6V D;  1WR1 A;  4BVU C;  4CHK A;  1JRU A;  4USA A;  1K51 A;  3NZS A;  2M0A A;  1UGJ A;  1EWY C;  1E5W A;  4NJ6 A;  1IGC A;  1NI3 A;  2NPT B;  2EKE C;  3ZJV A;  3B2F A;  4GU2 A;  4MJS A;  1ACC A;  3VUY A;  5IP4 D;  2HJ8 A;  1RFA A;  4L1B A;  5LNK 1;  1ZUD 2;  2BKF A;  1V1P B;  2HE7 A;  2KAJ A;  4ARC A;  5DPR A;  2RDG A;  1WGR A;  4GIV A;  5G2N A;  4RM9 A;  2ACZ B;  1E0Z A;  2LHE A;  3Q3F A;  3PRE A;  2KOX A;  3LYY A;  2L7R A;  3RD2 A;  3AI5 A;  3LB8 C;  2BF8 B;  4J6I A;  1BUI C;  4WUR A;  1HTO A;  2BB6 A;  2G4D B;  3ABV B;  4BFR A;  4RNA A;  3KLS X;  2DYB A;  2WQY B;  1XLQ A;  2JU6 X;  3O13 A;  5L95 C;  3DVN U;  2KDM A;  3NJT A;  5GXG B;  3P63 A;  3RYT A;  2JT4 B;  1CQV A;  3BK1 A;  2CHW A;  2KQS A;  4WWM A;  2NTT A;  3I9V 1;  4OHJ A;  2WX0 A;  5CTR C;  3NZ3 A;  4BOS C;  3TL5 A;  3AE6 B;  3OLM D;  4MSQ B;  1OEY A;  3K9P B;  1NI2 A;  2N9E B;  5E6N A;  3OWE B;  3RNB C;  1X1M A;  1GC6 A;  1MFW A;  2K3U A;  4P1C C;  3ENE A;  2J0J A;  2PTL A;  1TS5 A;  1NEN B;  4M01 A;  4WWN A;  1AN8 A;  1J8C A;  2MWS B;  3ZXV A;  3CF6 E;  3EC8 A;  3PZ7 A;  2KDF B;  4LDT B;  1V6E A;  4BKT A;  2L76 A;  4MEL A;  3U2S C;  4M8N A;  3MC8 A;  3BVZ A;  2KFK B;  1KH0 A;  3BII D;  1RM6 C;  3AM9 A;  1FO4 A;  1OEY J;  1IUE A;  1AW7 A;  3DBS A;  1D4B A;  2KDI A;  4EOY A;  5FR3 A;  2OOB B;  2AL3 A;  2CJO A;  3UIP B;  1WIA A;  1TZ1 A;  1NBF C;  4FHK A;  2I1K A;  3MHS D;  4YT0 B;  2KT7 A;  2WXP A;  1L2N A;  3SFD B;  3VR8 B;  3ZDT A;  2V3P A;  4E3C A;  2KHW B;  1E7U A;  3V6E B;  2K25 A;  1EF1 A;  4BKS A;  2BWE S;  4BKG A;  2O2V B;  2NBU A;  5LXH A;  3H7S A;  2BYV E;  2LZ6 A;  4HRS A;  3IAS 1;  1ZDX A;  2MBO A;  1ESF A;  1LO5 D;  4XZ4 A;  3L16 A;  3TEY A;  4LLG M;  5TSS A;  1UEL A;  2RDB C;  2LGS A;  2WGS A;  1WYG A;  3O65 B;  2WXF A;  2KFJ A;  2KTR A;  4YTM B;  2KZR A;  1R7S A;  5CHF A;  2NVU I;  2DX5 B;  1LXD A;  1N61 A;  2WS3 B;  1K52 A;  2KX3 A;  5IA7 A;  1OGW A;  4NQK E;  4PS3 A;  3BY4 B;  4KSL C;  4GGQ A;  4PS7 A;  3B08 A;  2K6Q A;  4JX1 C;  2KLG A;  3MP9 A;  1F1H A;  5DCN A;  2D10 A;  1N60 A;  3IFW B;  2C5L C;  3Q8B A;  3DVG Y;  2MBB B;  3QK0 A;  1XT9 B;  2DZI A;  4AQ7 A;  3H6N A;  1G6J A;  1GG3 A;  4DWF A;  2HD5 B;  2E6X A;  2LGY A;  4RGT A;  3P2B A;  3WAN A;  5HI1 A;  4OZA A;  1Y56 A;  2L83 A;  4G3X B;  2BWF A;  3V61 A;  1AAR A;  2DZM A;  2GBJ A;  2MH7 A;  2GBM A;  2J52 A;  3UIN B;  1PFD A;  1TKE A;  3N1Y C;  1XLP A;  3VRB B;  1WGH A;  2NBV B;  3H1U A;  3APC A;  3M3J A;  3W2D A;  2BS2 B;  4MT5 A;  4ACF A;  3T9L A;  1PYW D;  2WDR B;  4M00 A;  2KK8 A;  5IKC M;  4HCN B;  3NVW A;  3QCA A;  3W5V B;  2N0S B;  4B0E A;  2WLB A;  3L0W B;  3HK0 A;  4KGT A;  1I4R A;  4LJP B;  3V6C B;  3DVG X;  1HE8 A;  4DHZ E;  4G11 A;  1AWD A;  2RDH A;  1JWM D;  2Y5P A;  3DWG C;  3A33 B;  1FMA D;  2QEJ C;  2V4I B;  4ZYN A;  3JVZ X;  1KFY B;  3UGB B;  3AEC B;  2D5G A;  2BGF A;  2MLB A;  2QC8 A;  3GP7 A;  5E6O A;  4GB9 A;  2J7Q B;  1WRD B;  4OVV A;  4WJQ A;  3TUO A;  1OQY A;  1FIQ A;  1JWS D;  4IG7 B;  4HRO A;  1UBI A; 
#chains in the Genus database with same CATH homology
 1SJH D;  1KRH A;  2BB5 A;  1HZ6 A;  2NMQ A;  3U7Z A;  3AB5 A;  3AEG B;  3TSS A;  2BT6 A;  2ZW1 A;  2WXH A;  1EWC A;  3FIL A;  4YSY B;  1WWT A;  4OW0 A;  5HHD G;  4YXD B;  1D5M C;  1HZ5 A;  1N63 A;  1C9F A;  1IBX B;  1ZE3 D;  2XNA C;  4NZL B;  1V97 A;  1TKY A;  3Q69 A;  1XLO A;  3FAH A;  2WNM A;  1UWM A;  2JXT A;  3P4R B;  2PKO A;  1C79 A;  3KWL A;  2JQR B;  1M4V A;  1WGK A;  3IT6 B;  4Q2J A;  1AYF A;  2J4X A;  5HFY A;  4XDC A;  3EA6 A;  1YMH E;  4RGO S;  2WXJ A;  4NAM A;  3AEE B;  4XWW A;  2WDV B;  3BYY B;  1QT9 A;  3R2I A;  2VZK D;  1V8C A;  5E6J A;  1NVI D;  1K50 A;  1WSP A;  2DWQ A;  2SAK A;  1VZ6 A;  3BZD B;  3P42 A;  3TEX A;  2OHF A;  1QOB A;  2X38 A;  1L5P A;  1D6E C;  1SE2 A;  3AV8 A;  3MC0 B;  1FEH A;  5HG2 A;  2FUG 1;  3MFG A;  1PGA A;  1PGX A;  2M19 A;  4A8X C;  1F0Z A;  3HRD D;  2AQ2 B;  1YQ4 B;  2ON8 A;  3Q8F A;  4A9A A;  1QQR A;  1XF5 L;  2LJI A;  1B9R A;  2LEK A;  5H8Y E;  2NTS A;  2H88 B;  1YNT E;  4R3D A;  4DXG A;  1CZP A;  2QIE B;  3RFZ B;  1E7P B;  1STE A;  2AQ3 B;  4IDI A;  1N5X A;  2IJ0 A;  2W3S A;  3AE8 B;  2W82 A;  5G5H A;  4XDD A;  1JQ4 A;  1ZP0 B;  1C4A A;  1TY0 A;  2IGG A;  1L6V A;  4L2Y A;  4HKZ E;  1YN5 A;  1VRA B;  1VZ8 A;  4IKG A;  2PW9 A;  3MHZ A;  2GB1 A;  3HVZ A;  3PZ8 A;  1YJI A;  3BYT B;  3Q8C A;  3NRZ A;  1FNV A;  1DOX A;  1XO3 A;  5BMI A;  1ZXH A;  1L6U A;  2XN9 C;  1TS3 A;  3HUI A;  5EE0 A;  3W5U B;  2YEP F;  4TSS A;  3T3O A;  2K22 A;  2PMV A;  2TSS A;  1FM0 D;  4C7Y A;  1MPE A;  1FRD A;  3EGR A;  3NVY A;  1WRI A;  4A6Q A;  1QIL A;  1E9M A;  4KGS A;  2BS4 B;  1FXA A;  1UNS A;  4OZB A;  1Q10 A;  1L0V B;  1RFK A;  1T3Q A;  1C4P A;  1GPX A;  1QOF A;  1VZ7 A;  3HVD A;  2N9K A;  1YN4 A;  5BYQ A;  3Q8E A;  1UUP A;  2LMC A;  4RFB A;  2W3R A;  2WXO A;  4C56 C;  3IT4 B;  2AQ1 B;  3IAM 1;  3E56 A;  1BML C;  1JML A;  5EE9 A;  4ARI A;  1EM7 A;  2PIA A;  4ZHP A;  1DGJ A;  1QKZ A;  4UDU C;  1MVK A;  2ZW0 A;  3U4E G;  4WIP A;  5FKA C;  2DLB A;  2JWU A;  2WXR A;  3C8Y A;  2MEK A;  2ONQ A;  2EEL A;  3KQ4 A;  3UI3 A;  2N7J A;  4NAW B;  1GB4 A;  1C77 A;  1D5Z C;  3FC4 A;  3NUH B;  3E9S A;  3B9J A;  2B76 B;  4YWG G;  3NVV A;  3Q8A A;  4MAC A;  4USA A;  1K51 A;  2Z8L A;  4XE0 A;  3W9C B;  2DYM A;  1KF6 B;  1XCT L;  2M0A A;  2J53 A;  4US8 A;  3URY A;  1UGJ A;  2BYT A;  1EU3 A;  1EWY C;  3EUB 2;  4IOI E;  4ZRP A;  4WQM A;  1PDX A;  1FD6 A;  1QLB B;  1IGC A;  1NI3 A;  4KKJ A;  3ZJV A;  3ETR A;  3B2F A;  1HA5 A;  2OED A;  3SR6 A;  4A55 A;  4ZHO A;  1ENF A;  3L4P A;  1ACC A;  1I4X A;  1J7B A;  4L1B A;  1J7A A;  1VLB A;  1T5X D;  5LNK 1;  1ZUD 2;  2W55 A;  4TMA B;  2WU5 B;  1V1P B;  5EE1 A;  1J7C A;  2KAC A;  2KAJ A;  3AE1 B;  4ARC A;  2RDG A;  2K0P A;  1D5X C;  3W1S A;  2G9H D;  2K9X A;  2PLP A;  3AE3 B;  2ACZ B;  3GB1 A;  1E0Z A;  2LGI A;  1I4P A;  1SXT A;  2FE8 A;  2LHE A;  3AH7 A;  2INN E;  1PGB A;  1L0Y B;  3LYY A;  4M0W A;  4N59 A;  1C78 A;  1EU4 A;  2WXN A;  2L52 A;  2FBW B;  2JZP A;  3LB8 C;  1KLG D;  2LHD A;  3P4S B;  1BUI C;  1JWU D;  4WUR A;  5BYR A;  4D2K A;  4FXC A;  4DQO C;  2JSV X;  1VDV A;  2BB6 A;  1TY2 A;  1QOA A;  4YSX B;  3ABV B;  3VQI A;  4RNA A;  1K53 A;  3KLS X;  2WQY B;  1XLQ A;  2JU6 X;  3ZJT A;  4KX6 B;  1L0X B;  3O13 A;  1A70 A;  2MJ3 A;  4C7Z A;  4NJC A;  5MPO A;  1KLU D;  1IBX A;  4LK0 M;  2KDM A;  1ET9 A;  3P4P B;  3P63 A;  5GXG B;  2IPK D;  3AEA B;  1RYJ A;  3ZYY X;  1CQV A;  3BK1 A;  2Y5C A;  4H2A A;  2N9L A;  4RF0 A;  2BTE A;  3AEB B;  2AX5 A;  2KMM A;  2NTT A;  3I9V 1;  4KKI A;  4OHJ A;  4WWM A;  1GOZ A;  3NZ3 A;  4ZRQ A;  3DWM A;  1P7F A;  1JAL A;  1MHH E;  1JRO A;  3AE6 B;  4YTN B;  1C4C A;  2L1A A;  3SEB A;  3N9Y C;  2PVG C;  3AE2 B;  3LXF A;  3P1M A;  1CK1 A;  3OWE B;  4KGR A;  2K3U A;  4A90 A;  4YTP B;  3TEZ A;  1NYR A;  1SE3 A;  4AS1 A;  1SSN A;  1FCC C;  3AN1 A;  2PTL A;  1TS5 A;  1NEN B;  4RF1 A;  1YJJ A;  1F2R I;  1ROE A;  1UWX A;  1AN8 A;  3B2G A;  1ET6 A;  3NVZ A;  1I4Q A;  3PZ7 A;  2IGD A;  2EKI A;  3U2S C;  1OFF A;  2DYO A;  3BVZ A;  2BW2 A;  2WXL A;  4HKQ A;  1ZOY B;  3KWV A;  1FFU A;  1KH0 A;  4ITK A;  3BII D;  2V3N A;  1RM6 C;  2MJD A;  3AED B;  3AM9 A;  3MJ5 A;  1FO4 A;  1FCL A;  1IUE A;  4WH4 A;  1AW7 A;  2IGH A;  2WDQ B;  5D7G A;  5JXV A;  1I7H A;  3BVG A;  3AMZ A;  2INP E;  1D4B A;  4O1N A;  4GLS C;  3FIL B;  1FRR A;  1ZDV A;  1E6E B;  2VZK B;  5FR3 A;  1OQR A;  1TS4 A;  4EE2 A;  2PVO D;  3RPF C;  2CJO A;  2GRI A;  3AE5 B;  3CIR B;  4C80 A;  1L4D B;  2BBC A;  1QF6 A;  4B0M A;  1I4H A;  1FNU A;  2IDY A;  1BXT A;  3AE4 B;  4YT0 B;  1TJE A;  2WXP A;  3SFD B;  3VR8 B;  2V3P A;  1JWA D;  3P4Q B;  2LFI A;  2HTM E;  1TZO A;  1GAQ B;  1HEZ E;  2G1E A;  2RPV A;  4LTU A;  3BK2 A;  4HJG E;  1NEK B;  3BWU D;  5T8I A;  4HRS A;  3IAS 1;  1FFV A;  3WCQ A;  1ZDX A;  1ESF A;  2WP9 B;  1LO5 D;  4REZ A;  2MJE A;  2GI9 A;  1RWS A;  5EE3 A;  2I38 A;  3TEY A;  4LLG M;  5TSS A;  2JYE A;  5D3D A;  1F2R C;  4P16 A;  5C3J B;  2BS3 B;  5D3I B;  1SB3 C;  5C2T B;  3ZGZ A;  4JWS C;  4XWT A;  4HEA 1;  1WYG A;  1HXY D;  4PT5 A;  5FK9 C;  2WXF A;  5G5G A;  1TKG A;  3NS1 A;  1DOI A;  1SBB B;  3CWI A;  2R61 A;  1KTK A;  3R8B A;  4CQN A;  1OQQ A;  3ZQ4 A;  5BYS A;  4YTM B;  2WU2 B;  3AE9 B;  1R7S A;  1N62 A;  2KQ4 X;  4P6V F;  2J42 A;  2WXI A;  1JCK B;  1N61 A;  2WS3 B;  1K52 A;  5I4D A;  4TQ0 A;  3U52 E;  2L32 A;  4TQ1 A;  1F77 A;  1I4G A;  1XEE A;  1ZPS A;  4US9 A;  2KWD A;  1YN3 A;  1YQ3 B;  2QMT A;  1PUT A;  1JRP A;  4JX1 C;  1TS2 A;  5H92 C;  2QIL A;  3PO0 A;  2M56 B;  3MP9 A;  3R2T A;  1N60 A;  1E10 A;  3Q8B A;  3BVM A;  1FNW A;  1N5W A;  1XLN A;  1SE4 A;  1V1P A;  2HDE A;  1MI0 A;  2RMM A;  4AQ7 A;  1IGD A;  2JYT A;  1DYQ A;  1JWB D;  2ICI A;  4RCO A;  4ZOH C;  1L4Z B;  2WXK A;  3IXS A;  2E6X A;  4RGT A;  2WXQ A;  3GS2 A;  2QJL A;  3J9C A;  5HI1 A;  1B1Z A;  4JPS A;  4OZA A;  2E3T A;  2CJN A;  1SF0 A;  2CU3 A;  1Y56 A;  1JW9 D;  2L83 A;  5AUI A;  4GDL B;  4ZYS A;  1P7E A;  1FXI A;  1SJE D;  2K5P A;  2MH7 A;  2Q5W D;  4MM3 B;  2J52 A;  1PFD A;  1QOG A;  1TKE A;  2QSD A;  2WXM A;  1DOY A;  4J3O D;  1XLP A;  2JX5 A;  3VRB B;  1SIJ A;  2KN4 A;  1SEB D;  4OVZ A;  4OZC A;  2DBY A;  2V0G A;  3W2D A;  2BS2 B;  4MT5 A;  2I2Y A;  1PYW D;  2WDR B;  3I57 A;  5AUK A;  3AE7 B;  1ZXI A;  2YEP B;  4RGN A;  1V1O A;  2Y3A A;  2W54 A;  3NVW A;  3W5V B;  2N0S B;  3V3X A;  4B0E A;  2WLB A;  4DXF A;  4KGT A;  3H8H A;  5BMG A;  1I4R A;  1XCQ L;  4WAF A;  1VR9 A;  1MHX A;  1CJE A;  1C76 A;  1XXG A;  3V05 A;  4GDK B;  1WXQ A;  1AWD A;  2RDH A;  1TYG B;  1JWM D;  2Y5P A;  4RH6 A;  3DWG C;  5BMH A;  4JE3 B;  1FMA D;  3VRA B;  3VR9 B;  4N6E B;  3ZJU A;  1GB1 A;  2QEJ C;  3SFE B;  2V4I B;  1HQR D;  1KFY B;  3AEC B;  2SEB D;  3T3N A;  2D5G A;  3TEW A;  4JWU C;  4YSZ B;  3GP7 A;  3AEF B;  1NYQ A;  1T6B X;  1VJK A;  4MH8 A;  4L23 A;  4RGM A;  3TUO A;  1FIQ A;  2H89 B;  2WXG A;  1JWS D;  4N58 A;  2LUM A;  4HRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...