4WWMA

X-ray crystal structure of sulfolobus solfataricus urm1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
79
structure length
79
Chain Sequence
PKVILKGPLISQFNFREIYVNDRELLRVLVKIDSKKHLILNESNQLKSGILILINGKDWRLYRNQLLNDNDIIEIIPIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Involvement of a eukaryotic-like ubiquitin-related modifier in the proteasome pathway of the archaeon Sulfolobus acidocaldarius.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Signaling protein
molecule keywords Uncharacterized protein
total genus 16
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4wwmA00
1NI3A 1XLOA 1WRIA 2MJ3A 1FFUA 2L52A 3B2FA 5EE3A 2MJEA 1EWYC 3BIID 2W55A 3AEDB 3FC4A 4USAA 1YJJA 1GAQB 1NYQA 5GXGB 2DBYA 1FFVA 3DWGC 5EE0A 1L6UA 3HUIA 3AE2B 4US8A 4HRSA 1RFKA 1KFYB 1KF6B 1TJEA 1ZP0B 2WU5B 4ZHOA 1TKGA 1V8CA 1JQ4A 1RM6C 1FMAD 3EUB2 1QOGA 1YJIA 4YT0B 5AUKA 4C7ZA 2Y5CA 1F0ZA 2WDVB 4FXCA 4IDIA 3AEGB 4US9A 5C2TB 4LTUA 1FXAA 3AE5B 4P6VF 1CJEA 4WQMA 1JROA 1PUTA 2LEKA 4A9AA 1NENB 2KAJA 2OHFA 1YQ3B 5MPOA 2DWQA 3AH7A 3NVYA 3L4PA 4KX6B 1QOFA 1IUEA 1FIQA 4N6EB 3RPFC 1RWSA 2B76B 1DOXA 3SR6A 1XLNA 1ZXIA 1WWTA 1JWBD 3VRBB 1QLBB 2Q5WD 4JWUC 4N58A 1DGJA 1FRDA 3NS1A 1GPXA 1XLPA 1JW9D 3P4PB 1PFDA 1I7HA 1L0VB 1N60A 3AECB 1WYGA 3AE8B 4JX1C 1VDVA 1UWMA 3VR8B 3AEBB 2PVGC 3AE1B 3HVZA 3ZYYX 1B9RA 3W5UB 4YSXB 2BS3B 5H8YE 1ZUD2 1AWDA 1E10A 2H88B 2JX5A 5H92C 5G5HA 2WP9B 1N5XA 4YSYB 3NVZA 3VRAB 2BT6A 3ETRA 1SIJA 1E9MA 3AE3B 3AEAB 3AE9B 3VR9B 3SFDB 1DOIA 1SF0A 2K22A 1WGKA 3P1MA 1FM0D 2CJNA 1N63A 1VLBA 3AV8A 3B2GA 5C3JB 1J7CA 2K9XA 3NVWA 3HRDD 3LXFA 5G5GA 2PIAA 1XO3A 2L83A 4HROA 1JRPA 2G1EA 1KRHA 3WCQA 4YXDB 1A70A 1ZOYB 2BS2B 4C80A 1PDXA 1XLQA 2AX5A 3P4RB 3AE7B 4C7YA 1WXQA 3AMZA 2BS4B 2JQRB 1J7AA 3NRZA 4ZHPA 3AEFB 2FBWB 3AN1A 1E7PB 4YTMB 1OFFA 1FXIA 2PVOD 2WU2B 3CWIA 4YTNB 1JWAD 3B9JA 5EE1A 1DOYA 2WLBA 1CZPA 3W9CB 2HTME 3CIRB 5AUIA 1FRRA 2CJOA 2W54A 2WQYB 3KWLA 4ZOHC 3DWMA 1L5PA 2W3SA 2W3RA 2PKOA 2K5PA 3P4SB 4N59A 1QF6A 1YQ4B 1V97A 1TKYA 1FO4A 2ACZB 2M19A 3LB8C 1OQQA 3NVVA 1JALA 1QT9A 3PO0A 2E3TA 3AM9A 1ROEA 3AE4B 3AEEB 2QJLA 3AE6B 1NYRA 3W5VB 1L6VA 1N62A 1QOAA 2M56B 2WDRB 4WWMA 4YTPB 4ITKA 1E0ZA 1J7BA 3P63A 1R7SA 1T3QA 2N0SB 5EE9A 4JWSC 1NEKB 2WS3B 1SB3C 2MH7A 2MJDA 2EKIA 1TYGB 1TKEA 2H89B 2QIEB 3ABVB 3FAHA 1E6EB 1NVID 1VJKA 1N5WA 3SFEB 1OQRA 2WDQB 1QOBA 1N61A 2CU3A 2KMMA 1AYFA 3P4QB 4YSZB 1RYJA 3AB5A
chains in the Genus database with same CATH superfamily
4IM0A 1V80A 2W55A 3RULA 3ZDTA 3Q2AC 3PVLA 2RR9A 2Y5PA 4HRSA 5CHVC 3ZNHB 1KFYB 2G4DB 2WU5B 2NPTB 2PPHA 1YJIA 1WXSA 2BYEA 4B9KA 5KHOA 2D2QA 2QDFA 3AEGB 3CSTA 2DYOA 3L08A 4RGMA 1WYWB 3SHQA 1PUTA 2LEKA 1ET6A 1WZ0A 5JHAA 2HDEA 3L4PA 5T8IA 1WR6E 1UELA 4CO7A 1FRDA 2DZIA 2DZMA 2V4IB 2C7MB 3P4PB 4PT5A 4DK5A 2QSDA 3AECB 1VDVA 1D6EC 2MEKA 2GBNA 1NBFC 1HE8A 4DXAB 1L7YA 4CQNA 2QILA 4URKA 2WXMA 4YSYB 3KH0A 1LO5D 4ANWA 4G50A 1N63A 1GG3A 2D3CA 3Q3OC 2L83A 1SE9A 3WCQA 1XLQA 1UNSA 1SXTA 5DPTA 3AMZA 4NPNA 1TBEA 4M8NA 1UBQA 1KOTA 2PVOD 2IDYA 2GOWA 4MH8A 3CIRB 2KDBA 3U4EG 5LNK1 1V1PB 2LVPA 3IT6B 4ARCA 2ACZB 3DHHC 3WA0A 4PK1A 4JIOU 4TSSA 2WDRB 4WWMA 4FHJA 3QWZB 2D5GA 3KWVA 3VFKA 1E6EB 3R8BA 2QCZA 3R2TA 4YSZB 1FNWA 2C5LC 3APCA 2CHXA 4TUUA 3O65B 3PRZA 4S0RA 4DHZB 3QC8B 2BPSA 1L6UA 3QIJA 1V86A 4GMVA 4DWFA 1M4VA 4YT0B 3FILA 4KDLB 1E7VA 2WXLA 3BK1A 1S3SG 5E6PA 1TS4A 4LTUA 1FXAA 2CR5A 3AE5B 3V62A 5AZGA 1BT0A 3BVZA 3V6EB 4EOYA 1FCLA 1QOFA 3QJZA 1D5ZC 2JRHA 4P7IA 4NQLB 3DBLB 3ALBA 3T9LA 3W1SC 1F52A 1P1AA 4EKUA 2PTLA 1RAXA 2JX5A 5H92C 1WXAA 4KVGB 3AEAB 3Q3NC 3VR9B 1YQBA 2JRIB 1CMXB 1K53A 3AV8A 3NZSA 2K9XA 1YX5B 2ON8A 2A5UA 2WXHA 2KK8A 3M95A 3I3TB 2INPE 2MRPA 1OQYA 2KYWA 2K39A 1WX7A 3URYA 1WXQA 2JQRB 1OFFA 4E74A 2KTRB 2BYVE 4HKZE 1AW7A 4RCOA 1RFAA 1FEHA 1F9JA 1WIAA 2W3RA 1VZ8A 4A20A 1TKYA 3IXSA 2LUEA 2KWCA 3APDA 2JPHA 2OJRA 1SGHA 2AL6A 5CTRC 1J7BA 5CX3A 1R7SA 5HKHA 2BTEA 4LNNA 1VJKA 1N5WA 3PPAA 4M01A 2WDQB 3T8MA 4AWJA 2C60A 2LRUA 2ZVOA 5BYRA 3Q3FA 2KXJA 1ZW7A 1WZ3A 3MTNB 4HXDA 4USAA 3P2BA 1FFVA 1L4ZB 1I4HA 3CSFA 4EZKA 2K6DB 2ZW1A 1TKGA 2INDC 2KWDA 3AU5A 4C7ZA 2KJHB 5C2TB 2LZ6A 2R2OA 1WMHA 2IGDA 5D94A 1C78A 3ZKJC 2FUG1 3V61A 3FILB 3VTUA 2SEBD 4II2B 2WXNA 1ZXIA 2V4LA 4TKNA 2LD9A 5JHBA 4ICUA 2JZPA 1WJUA 1JW9D 3ZTDA 2PE9A 1PGXA 3UQBA 4K3BA 2O2VB 1XCQL 2WXJA 4I6NB 3ZLZA 4KIKA 1SBBB 4GB9A 5G5HA 1N5XA 3NVZA 1PYWD 1YN4A 3BYTB 2FUHB 2V3SA 2K22A 1C76A 2CKHB 3M3JA 4M02A 1EWCA 1FNUA 3RNAC 4W9IA 2MCNB 1HXYD 2J52A 4KV2A 1SE2A 1XD3B 1WGHA 4YTMB 4XX5A 3L17A 1UBIA 2BWFA 4NJ6A 1CZPA 1YN3A 5AUIA 3UI3A 1FRRA 2W54A 2PMVA 3KWLA 1HA5A 4RH6A 3VRAB 2W3SA 1TS3A 3LDZE 4NJ7A 3DVGY 4B0MA 4XGAB 1F2RC 4DXFA 3A9JA 3HM3A 3AXCA 4WWNA 3P63A 2JVCA 2H89B 3EFUA 4MM3A 4BKSD 1R4MI 2JF5A 3ZXRA 2Z8LA 4EZJA 1NI3A 2I1KA 2L52A 4ZRIA 4XWWA 2QMTA 3TEYA 3VUWA 3Q3MC 4MACA 5E6OA 1OEYA 4JL9A 3NZUA 3C0RB 4I6PA 4FXCA 3UINB 3VDZA 2C7NB 3DCGA 3UGBB 2L00B 1Q0WB 3B0AA 2PLPA 1H4RA 3SDLC 3P42A 4Q2JA 1DOXA 2VRRB 2IY0B 2LFIA 2IO3B 2K8CA 1GPXA 4L2YA 4N58A 1KLVA 1X1MA 2KD0A 5KHQA 3AE1B 1E8ZA 4F1SA 3GS2A 2LVQA 4HPMB 3U52E 1JWUD 1SIJA 1Q5WB 3ZO5B 1VZ7A 3SEBA 3Q8CA 1E90A 1SSNA 4L23A 1LQBA 2Z59B 1BUIC 2KJRA 4YXDB 2JWUA 3H8HA 3N1YC 4MJSA 3ECIA 3B9JA 4ARIA 2WLBA 4FN2A 4IW0A 1EU4A 3GOEA 4ZOHC 4N59A 1KLUD 3BY4B 1UF0A 2KQSA 3TEZA 1F2RI 3PO0A 4ITKA 1KH0A 1LFDA 1DYQA 1QOBA 1N61A 2JXXA 2J42A 4HVBA 1E8WA 4IM2A 1WRIA 1V5TA 4LDTB 3DOWA 3A4SC 2KFJA 2MBQA 1K8RB 3KYCD 3R2IA 3Q8AA 1IP9A 4ZHOA 1FMAD 3EUB2 4GDLA 4GXBA 4FULA 2Y5CA 2IO2B 1JRUA 3IVFA 1JROA 2OHFA 4KSKC 1IUEA 1Q10A 5CHWA 3RPFC 1SE3A 2JU6X 5IO9A 3E9SA 4MGZE 1T0RC 3VH3B 3DBSA 3V05A 1E8XA 2KACA 4H2AA 3TEXA 1WYGA 2JXTA 2JSVX 4P1BC 4PS3A 4B6WA 2NVUI 5LLIA 5L95C 2ZCCA 2VH2A 1DOIA 2KMCA 4MGYE 4IWQA 4MSMB 2G45B 3RUIB 2IO1B 2DAFA 5LXHA 3LXFA 4BOSC 2L05A 2ASQA 5C23A 2KHWB 2LVOA 3DHGC 4ASWC 1ZOYB 1VCBA 4LNFA 3ZJTA 4IWPA 2BYFA 1R4MB 2KNBA 4YTNB 5IA7A 3KW5B 2A4ZA 2CJOA 2LHEA 2PKOA 1WRDB 5EDSA 2M19A 4HPLB 4GSWA 2D10A 4IKGA 1E7UA 3BVMA 2I38A 4KZCA 5EE9A 3QA8A 2LGIA 4JWSC 4D2KA 2MJDA 1TYGB 2DZKA 1OQRA 4XDCA 2JUOA 3IFWB 1XF5L 2MJEA 2KWUB 4XDDA 3AEDB 2M8SA 3X0WA 3TMPB 5GXGB 3R3MA 5J2RA 1RFKA 4LJOB 1KF6B 5AUKA 4WAAA 3WAPA 2I1JA 2WDVB 2N9EB 4EUTA 3ONSA 1FCCC 4WJOA 2EELA 2L0FA 1I4XA 2KAJA 2DWQA 3H7PB 4MM3B 2B76B 1D5XC 4ZRQA 2ZPYA 3RI7C 2O2VA 4QAYA 2KMAA 4WAFA 1PFDA 1Z5SB 4RGTA 3ZYYX 1EUVB 2EMSA 2BS3B 3OJ3A 1UZXB 1TS2A 2ZNVB 1BXTA 2KWVB 3PLUA 2O6VD 3L13A 1P7EA 4BVUC 4AP4C 4RGOS 1WJ6A 2NR2A 2RSUA 4AOFA 4RF0A 4REZA 4HJGE 2MBOA 3OAWA 3S2AA 2M1MA 5BYSA 3U2SC 3Q14C 3AU4A 2N7EA 1V49A 1I4GA 2OEDA 2FBWB 5IAAC 3VAWA 3W9CB 1GOZA 3DWMA 2IBIB 4DQOC 5J17A 2FIDA 3ZDMC 3JYUA 3NVVA 1QT9A 2BB6A 2XEWA 5AZFA 2N0SB 2AQ3B 2KTRA 3DQVA 1NVID 3H7PA 4WWOA 4A55A 2DAJA 2V9HA 2Z0EB 3B2FA 2MBBB 3RZWC 2DBYA 3HUIA 3PZ8A 1T0YA 2WXIA 2RGFA 4XYCA 4JE3B 1RM6C 4JLCA 2X38A 1FNVA 3QX1A 2ZEQA 1WGYA 4G0NB 4GN1A 1I4RA 3RNCC 2BGFA 1H8CA 3NVYA 1UD7A 2DX5B 1I35A 1MVKA 1FIQA 1YN5A 2WDTB 4HEA1 3PREA 3PS6A 1D5MC 3ZVVA 3U7DA 1DGJA 3NS1A 3AI5A 2YEPB 2AYOB 3ML9A 3MC0B 4WH4A 1P98A 3EC8A 4ZYSA 2KQ4X 4W9LA 5D3DA 1ZUD2 4BBNC 1VR9A 2WP9B 5HFYA 1C3TA 1V1OA 4GDLB 2RD0A 3QHTA 3BK2A 5D2MB 1VLBA 3NVWA 3PZ7A 3TSSA 3TBLD 1J8CA 2NBVB 3GE8C 1A70A 2E6XA 3QCAA 2GBKA 2WXQA 4GU2A 4NAWA 4M00A 4ZRPA 1J7AA 5D6JB 4B95A 4GOCA 5FR6A 2EKEC 1DOYA 1M94A 2JZ3B 4NAMA 4XZ4A 3A4RA 3H9DA 4RNAA 5C1ZA 2L8JA 1J0GA 2WXOA 4K81A 4BKGA 3Q6BA 3IHPC 1C4CA 1L6VA 1R4NB 2EMTA 2DNFA 4F7ZA 1K52A 4HCPB 3FAHA 3NG0A 4MJSB 2MBEA 4AUQC 2MW5A 1RYJA 2UYZB 1SEBD 4ZYNA 4BFRA 4HK2A 2K6QA 4M8MA 2K8HA 2NPTA 2BWES 3I9V1 3K9OB 4KKIA 5EE0A 1IBXA 4AQ7A 1TS5A 5IKCM 1QOGA 4W9DA 1OGWA 2J0JA 2GBJA 2MQJA 3CMMB 2WHIA 1IGCA 4N6EB 3N9YC 2GRIA 4HJKA 3KYDD 1WJ4A 4KKJA 1N60A 4JX1C 4W9FA 1UWMA 3HVZA 3W5UB 1WX8A 2LXCA 3QQ8B 1STEA 1UWXA 2MLBA 2PJHA 4GDKB 3AE3B 4A8XC 5GMVA 5C3JB 3A9KB 2GLSA 2I2YA 3PHWB 4FHKA 1ZGUB 3I57A 3WAOA 4DHJB 1EF5A 3A1QA 2KN5A 2ZNVC 3B08A 3ZXVA 2AQ1B 4JGHB 2FIFA 1L2NA 2N9XA 5JH5C 2NBUA 5EE1A 3SU8X 1ENFA 3NY5A 1QQRA 1TGZB 3BZDB 1K50A 2M17A 3NZ3A 4OVVA 4R3DA 2KLCA 2KX0A 2HD5B 1GB4A 5J18A 1QZEA 5BMHA 2LXAA 2ZVNA 4WWPA 3ZJVA 4YTPB 1IBXB 3VUYA 1VZ6A 1T0SC 1L0XB 3D32A 2MHJA 3P4QB 1SJED 3DBLI 2LRWA 4YL8A 2BVCA 2KO3A 3U8ZA 1ZKHA 2FCNA 5FK9C 1EWYC 2N9PC 1UGJA 4JPSA 3H1UA 2V3NA 4K7SA 4PS7A 1AN8A 2R2QA 4S17A 1WXMA 1MHHE 4IM3A 2M0XA 3DHIC 4IDIA 4US9A 2DYBA 4K7UA 2GBMA 1EO6A 3N30A 1ISNA 3SR6A 1XLNA 4NAWB 2WX0A 4WJQA 3K9PB 2Q5WD 4NZLB 3PV1A 2OOBB 3AE8B 1GC6A 3R7RA 4MT5A 5BMIA 1ET9A 1WMHB 2D3AA 2BT6A 1N6ZA 2K8BA 4EEWA 3P1MA 3KUCB 4RM9A 3DBHI 3HRDD 4LNIA 4WJPA 3VXWA 3W1SA 3PZDA 3H7SA 1MFWA 2BS2B 3MFGA 3ZNZB 3AEFB 3JW0X 3HIZA 1ACCA 2NTSA 2WU2B 4E3CA 3N3KB 1XEEA 1P7FA 2RDHA 1WR1A 2KANA 2HE7A 3TJPA 2KQ7A 2L3ZA 3OWEB 1HTOA 2QJLA 3AE6B 3N1ZC 1E0ZA 4EZLA 2RPQA 1YJ1A 2N1WA 2LGYA 2KDMA 1T3QA 5TSSA 2LASA 2ZJDA 3RNEC 3SFEB 1ZPSA 3H6NA 2RDBC 2HJ1A 3RCZA 1XLOA 3FKYA 5D3IB 5EE3A 4ANXA 3IT4B 5BO4B 3RNGC 1HTQA 3IAS1 3A9JB 3PRMB 3GE3C 1TY2A 4TMAB 4LK0M 1CJEA 1UGMA 1V2YA 1TY0A 4KX6B 1KM7A 3MHZA 3Q3JA 4NQKE 4JWUC 5HG2A 3VTVA 4IWOA 1MHXA 4K1RB 3V6CB 1EM7A 2O6VB 4CHKA 1B9RA 5G55A 1AWDA 5JXVA 4OVUA 4EFOA 4GLSC 2LHDA 2LMCA 1FM0D 4E71A 3RD2A 2DHZA 2V1YA 4XE0A 1UUPA 3DBRB 1JRPA 1YD8U 2IO0B 2QHOA 2Y3AA 2AX5A 2KDIA 2BS4B 2BF8B 3WANA 3I5JC 4ZHPA 1KTKA 1FXIA 2W9NA 3CWIA 1JWAD 2QC8A 3W1YA 1VRAB 2HTME 2WXGA 4RFBA 1PGAA 3UIOB 1MG4A 2BYTA 2KDEB 4F8CB 1OQQA 3T3OA 2REXA 1NYRA 2L32A 1S1QB 2RMMA 1WF9A 2BB5A 1VD2A 3KVFB 3PGEA 4ANVA 1XXGA 2LGXA 2KOXA 2KC1A 2KTFA 4AJWA 3GZNB 1FD6A 4NNJB 1MI0A 1WGGA 4IC7B 1FFUA 4PYUA 3JSVB 1TT5B 3FC4A 2WXRA 1WE7A 1GAQB 5FR3A 1YNTE 3N1XC 4LJPB 3U30A 3N20C 3HHMA 2PEAA 3ZNGC 4J3OD 4WQMA 2WGSA 2JYTA 4MH0E 1CK1A 2ZZPB 4ZDVA 1KLGD 1XLPA 3EA6A 5BMGA 2WYQA 1ESFA 1WX9A 2M4NA 3AEBB 2PVGC 1V1PA 1TZOA 2INCC 3RNBC 3Q8FA 1WSPA 1ZDVA 4KZ0A 3WAMA 2SAKA 3AE9B 2IGHA 4TV3A 3OG5A 4DHJD 4LNKA 2V0GA 1C1YB 3E56A 3NS8A 1PDXA 4OW0A 4KGSA 3P4RB 4C7YA 4NJCA 1XCTL 3QK0A 3NRZA 5HHDG 4PYZA 4G3XB 2J0MA 2BW2A 3L54A 2L76A 3VH4B 3VVWB 1A5RA 5L83A 2E3TA 4TQ0A 3AEEB 1Z2MA 2LWPA 1N62A 2M56B 3M62B 2EKIA 1WI0A 3KUDB 4J6IA 2YEPF 2G9HD 2LI5A 1B1ZA 2KVRA 4JQWC 2FCQA 3AULA 2XBBC 5FKAC 3DWGC 3AE2B 1C9FA 2NTTA 3RMKC 2WX1A 4LLGM 2UWQA 4UDUC 4RM8A 4BKSA 3HK0A 4C4VB 3RT3B 5LXIB 2K3UA 5AZHA 2CU1A 1SIFA 4HDQA 1YQ3B 3ZRCA 1WFYA 3I63C 1I42A 2OJWA 2Y5BB 2LJIA 2GBRA 1WH3A 4BAXA 1JWBD 1I7HA 2QEJC 2FCMA 5E6NA 2D11A 2K0PA 3DVNU 4RGNA 3RZFA 3GB1A 4ACFA 4HCNB 1WJNA 1E10A 1WXVA 4KGRA 1C77A 3ZQ4A 1I4QA 2LJ5A 2KDFB 5I4DA 3L16A 2CJNA 3UF8A 3N32A 2D07B 1J7CA 2NMQA 3KQ4A 4KSLC 1EU3A 2FE8A 1IPGA 3AE7B 2N4FA 3BWUD 4M0WB 2XK5B 1TIFA 4KIKB 2FNJB 4ICVA 3IAM1 3C8YA 2AEHA 3MC8A 4AJYB 1QF6A 3ML8A 4FJZA 1FO4A 2LGSA 2BBCA 2L1AA 3WIMA 1BMLC 2JYEA 1QOAA 1I4PA 2ICIA 4W9EA 3ENEA 4FBJB 3QARA 1RLFA 1SB3C 3J9CA 1NDDA 3GZNI 2INNE 2CU3A 3R66C 1G6JA 3PSEB 2MJ3A 3DDCB 3APFA 4I6LB 3TUOA 4A6QA 4B0EA 4C00A 2ZPNA 1IYFA 1GB1A 3PRPB 4DDGD 1C4AA 1NYQA 4US8A 1UH6A 4A3PA 2N1VA 2AQ2B 2HTHA 2N7JA 1JCKB 5MPOA 3OJ4B 4C4VA 1CQVA 4MDKE 2NS5A 5AEKB 1TZ1A 1EF1A 1PQSA 2BKRB 1NI2A 1HZ6A 1LGRA 4W9JA 1YMHE 4YSXB 2CS4A 4BBNF 4N9F4 2CHZA 3RN9C 2XK5A 1AARA 3ZW3A 1E9MA 4HPPA 1OEYJ 1WY8A 1SF0A 2M0AA 3MP9A 1RRBA 2MBHA 3NHEB 5CHFA 3ZIMA 2FCSA 1T5XD 1HQRD 1XO3A 2IY1B 1D4BA 1KJTA 1D3ZA 2G1EA 1KRHA 3PHXB 1PGBA 4ZRKA 3ZGZA 4ANUA 5TR5A 2IJ0A 4MEMA 2KLGA 2LGDA 5IN7A 2JY6A 1ZXHA 4YWGG 2K25A 3P4SB 4HKQA 3T3NA 1IGDA 1YQ4B 2KT7A 1JALA 1WGRA 1WM2A 2BQQA 3AM9A 1ROEA 3AE4B 2WWZA 4WIPA 3VTWA 1QILA 2JT4B 4BZAA 1NEKB 2KN4A 3RFZB 1GUAB 2W82A 3WALA 2KMMA 1FPYA 3RYTA 3TCAA 1LXDA 1P3QU 4A3OA 3EFCA 5E6JA 3BIID 2KZRA 1YJJA 2CHWA 2L0TA 1JQ4A 1TTNA 1YIWA 1F0ZA 2WXFA 2KX3A 1MPEA 1P9DU 4A9AA 1NENB 5HI1A 3NOBA 4W9KA 1Y8RC 3RNFC 3ZNID 4FJVB 3UQAA 2RDGA 3VRBB 2BKFA 4DHZE 3A1QB 1SJHD 2GI9A 4EE2A 2DLBA 3NJTA 5H8YE 3EGRA 4LCDE 2WNMA 4X57B 4NY0A 3ETRA 4MSQB 3A33B 3R7QA 3SFDB 4XWTA 1WGKA 2R61A 1YOVB 4WURA 4HWIB 3TL5A 1C79A 1MG8A 2WXKA 2IGGA 2VH1A 1HEZE 1F1HA 1T0QC 3L0WB 3PLVA 4C80A 2MWSB 4M0WA 3IG3A 4DBGA 1E7PB 4GDKA 2D3GA 3ZRFA 2IPKD 3QAQA 5BYQA 1YX6B 3EECA 2X8XX 3OLMD 2D3BA 4K7WA 2WQYB 4FADA 1L5PA 1V6EA 1WM3A 3DVGX 2JZZA 4FLHA 4A90A 1JWMD 5DPSA 2XN9C 3HVDA 2TSSA 2DZJA 3Q8EA 2DYMA 2G4SA 5D7GA 4W9HA 2WS3B 4W9CA 4FA6A 1Y56A 1L4DB 3KLSX 2KVZA 1AYFA 2YLMA 3AB5A 2ONQA 4TQ1A 2J0KA 1GJZA 1XQQA 4IUMB 2FAZA 3MHSD 3KUZA 1TJEA 1ZP0B 4GIVA 4LDTD 4MGIE 5IP4D 2VZKB 4P1CC 1OTRB 4P6VF 1Q1OA 3TIXA 3JVZX 1L0YB 3AH7A 2J4XA 3LJ3A 2AWTA 2N9LA 1WWTA 1ZDXA 2PW9A 3U7ZA 1L0VB 3HM6X 3Q8BA 5DPWA 3VR8B 1K51A 3VUXA 4DDID 2J53A 2H88B 4II3B 2MA9B 2YVCA 3M63B 4MELA 3UIPB 4HDOA 4C56C 3V60A 2J7QB 1WGDA 4G11A 1P0RA 3B2GA 3VHTC 4CYEA 2PE6B 4K3CA 4OZCA 4ZRJA 2IYDB 5G5GA 2RPVA 1V9JA 2HJ8A 1T6BX 2V3PA 1F77A 4FJYA 3ZUNA 1SE4A 3AN1A 4OVZA 3X23A 3BVGA 5IOIA 3BINA 1JMLA 4MGKE 5JZEB 2MSED 4KGTA 4O1NA 2O6VA 4XC2A 4BKTA 1V81A 4RF1A 3LB8C 2MP2B 3W5VB 4GGQA 5DPRA 3L10B 4WQOB 1LM8B 1C4PA 4LNOA 4OHJA 4PS8A 1FXTB 1V5OA 2QIEB 3C19A 3ABVB 1J19A 3GP7A 4IG7B 1E5WA 2LUMA 2DENB 2KFKA 2VZKD 3SD5A 1GC7A 2IZVB 1V8CA 2NBWB 2KFKB 2ZW0A 3TEWA 2N7DA 2NCNA 4W9GA 2L7RA 2MX2A 4RMAA 3DBHB 3DPDA 3CF6E 2XNAC 1RWSA 2KKCA 3ZJUA 4IOIE 4WJNA 3NUHB 1QLBB 1GNUA 2Z0DB 5DCNA 2MP2A 2KJ6A 3MJ5A 3JSVA 4OZBA 3PT2B 3A9KA 1MJDA 1R4NI 4OZAA 3Q69A 3PTFC 3DVNV 3VQIA 3V3XA 2KC2A 3ZTCA 1WE6A 4L1BA 1QKZA 2AL3A 2C7HA 2JWZA 3O13A 2PIAA 1ZE3D 2ZCBA 4HROA 2K1FA 3EHVA 2GMIC 2GB1A 2C9WB 3LYYA 4KDIC 3DBRI 3BYYB 2N9KA 1JWSD 3W2DA 4DXGA 3MJWA 3MC9A 4AS1A 1E8YA 2K5PA 3IBEA 1V97A 3B1LX 4HLEA 1HZ5A 4BOZB 2B3AA 2MH7A 1TKEA 2UU7A 1XT9B 4P16A 2WXPA 5G2NA 2G3QB 1U4AA
chains in the Genus database with same CATH topology
1WRIA 2MJ3A 3TUOA 5FK9C 1EWYC 4A6QA 2W55A 4B0EA 1UGJA 1GB1A 4JPSA 1C4AA 1NYQA 3R2IA 3Q8AA 2Y5PA 2V3NA 4US8A 4HRSA 1KFYB 4ZHOA 2WU5B 1AN8A 1FMAD 3EUB2 1YJIA 1MHHE 2Y5CA 4IDIA 3AEGB 4US9A 2DYOA 4RGMA 2AQ2B 1JROA 2N7JA 2LEKA 1PUTA 1ET6A 2OHFA 2HDEA 1JCKB 5MPOA 3L4PA 5T8IA 1IUEA 1Q10A 3RPFC 1SE3A 2JU6X 3E9SA 3SR6A 1CQVA 1XLNA 4NAWB 2Q5WD 4NZLB 1FRDA 2V4IB 3V05A 3P4PB 4PT5A 1HZ6A 2KACA 2QSDA 4H2AA 3TEXA 3AECB 1WYGA 3AE8B 1VDVA 1D6EC 2JXTA 2MEKA 4MT5A 2JSVX 5BMIA 4CQNA 2QILA 1YMHE 4YSXB 2WXMA 1ET9A 4YSYB 2BT6A 1E9MA 1LO5D 1DOIA 1SF0A 3P1MA 2M0AA 3MP9A 1N63A 3HRDD 3LXFA 1T5XD 1HQRD 1XO3A 2L83A 3W1SA 1D4BA 2G1EA 1KRHA 3WCQA 1ZOYB 2BS2B 3MFGA 1PGBA 1XLQA 3ZJTA 1UNSA 3ZGZA 1SXTA 3AMZA 2IJ0A 3AEFB 1ACCA 2NTSA 2PVOD 2WU2B 4YTNB 2IDYA 4MH8A 1XEEA 1P7FA 2RDHA 3CIRB 3U4EG 1ZXHA 2CJOA 4YWGG 2LHEA 1V1PB 5LNK1 3P4SB 2PKOA 3IT6B 3T3NA 4HKQA 1IGDA 1YQ4B 3OWEB 4ARCA 2ACZB 2M19A 1JALA 4IKGA 3BVMA 3AM9A 1ROEA 2I38A 3AE4B 2QJLA 3AE6B 4TSSA 2WDRB 4WIPA 4WWMA 1E0ZA 1QILA 2KDMA 5EE9A 1T3QA 5TSSA 2LGIA 1NEKB 2D5GA 2KN4A 4JWSC 4D2KA 2MJDA 3KWVA 1TYGB 2W82A 3RFZB 1E6EB 3SFEB 1ZPSA 1OQRA 3R2TA 3R8BA 2KMMA 4XDCA 4YSZB 1FNWA 1XLOA 1XF5L 5D3IB 5E6JA 5EE3A 2MJEA 4XDDA 3BIID 3AEDB 1YJJA 3IT4B 5GXGB 1L6UA 3IAS1 1RFKA 1KF6B 1JQ4A 1M4VA 4YT0B 5AUKA 3FILA 1TY2A 1F0ZA 2WXFA 2WXLA 2WDVB 3BK1A 4TMAB 1TS4A 4LTUA 1FXAA 3AE5B 1MPEA 1CJEA 4LK0M 1FCCC 2EELA 3BVZA 4A9AA 1I4XA 1NENB 2KAJA 5HI1A 2DWQA 1FCLA 1TY0A 4KX6B 1QOFA 4MM3B 1D5ZC 2B76B 3MHZA 1D5XC 4ZRQA 2RDGA 3VRBB 4JWUC 5HG2A 1SJHD 1PFDA 2GI9A 4WAFA 1MHXA 4EE2A 4RGTA 1EM7A 3ZYYX 1B9RA 2PTLA 2BS3B 2DLBA 5H8YE 3EGRA 1AWDA 1TS2A 5JXVA 2WNMA 2JX5A 5H92C 1BXTA 3ETRA 3AEAB 4GLSC 3VR9B 1P7EA 2LHDA 3SFDB 2LMCA 4XWTA 1WGKA 2R61A 1FM0D 4RGOS 1K53A 3AV8A 4WURA 2K9XA 1C79A 2ON8A 4RF0A 4XE0A 4REZA 1UUPA 4HJGE 2WXKA 2IGGA 2WXHA 1JRPA 2INPE 1HEZE 4C80A 2Y3AA 2AX5A 3URYA 3U2SC 5BYSA 1WXQA 2BS4B 2JQRB 4ZHPA 1I4GA 2OEDA 4M0WA 2FBWB 1E7PB 1KTKA 1OFFA 1FXIA 3CWIA 2IPKD 1JWAD 1VRAB 4HKZE 1AW7A 4RCOA 5BYQA 3W9CB 1FEHA 2HTME 1GOZA 2WXGA 2WQYB 3DWMA 1L5PA 1PGAA 2W3RA 4RFBA 4DQOC 1VZ8A 2BYTA 1TKYA 3IXSA 1OQQA 1JWMD 4A90A 3T3OA 3NVVA 1QT9A 2XN9C 2BB6A 3HVDA 2TSSA 3Q8EA 1NYRA 2L32A 2DYMA 2RMMA 2BB5A 1J7BA 1R7SA 2N0SB 5D7GA 2AQ3B 2WS3B 2BTEA 1Y56A 1NVID 1L4DB 1N5WA 1VJKA 1XXGA 2WDQB 3KLSX 4A55A 1AYFA 1FD6A 5BYRA 3AB5A 1MI0A 1FFUA 2ONQA 3B2FA 4TQ1A 3FC4A 2WXRA 4USAA 1GAQB 2DBYA 1FFVA 1L4ZB 1I4HA 3HUIA 3PZ8A 2WXIA 2ZW1A 5FR3A 1TJEA 1ZP0B 1YNTE 1TKGA 4JE3B 1RM6C 2KWDA 2X38A 2VZKB 1FNVA 4C7ZA 5C2TB 4P6VF 1I4RA 4J3OD 4WQMA 2IGDA 1L0YB 2JYTA 3AH7A 1C78A 3NVYA 2FUG1 2J4XA 3FILB 1MVKA 1FIQA 1YN5A 2SEBD 2N9LA 2WXNA 4HEA1 1ZXIA 1WWTA 1D5MC 1ZDXA 1CK1A 1DGJA 2PW9A 2JZPA 3NS1A 1KLGD 1XLPA 1JW9D 3U7ZA 1L0VB 3EA6A 2YEPB 3MC0B 5BMGA 1ESFA 1PGXA 3Q8BA 4WH4A 3VR8B 3AEBB 1K51A 2PVGC 1V1PA 1XCQL 2KQ4X 2WXJA 1TZOA 5D3DA 4ZYSA 1ZUD2 2J53A 2H88B 1SBBB 1VR9A 2WP9B 5G5HA 5HFYA 1N5XA 3Q8FA 3NVZA 1PYWD 1WSPA 1YN4A 1ZDVA 4C56C 2SAKA 3AE9B 1V1OA 3BYTB 2IGHA 4GDLB 2K22A 1C76A 3BK2A 3B2GA 1VLBA 2V0GA 3NVWA 3PZ7A 3TSSA 1EWCA 1FNUA 4OZCA 5G5GA 3E56A 2RPVA 1T6BX 1HXYD 2V3PA 1F77A 1A70A 2E6XA 2J52A 1PDXA 4OW0A 4KGSA 3P4RB 4C7YA 4NJCA 1XCTL 2WXQA 1SE2A 4ZRPA 1J7AA 3NRZA 1SE4A 4YTMB 3AN1A 4OVZA 5HHDG 3BVGA 1DOYA 1CZPA 1JMLA 1YN3A 4NAMA 5AUIA 3UI3A 2BW2A 4KGTA 1FRRA 2W54A 2PMVA 3KWLA 1HA5A 4O1NA 4RNAA 4RH6A 2W3SA 3VRAB 1TS3A 4RF1A 2WXOA 3LB8C 4B0MA 1F2RC 2E3TA 4TQ0A 1C4CA 3AEEB 4DXFA 3W5VB 1L6VA 1N62A 2M56B 3P63A 1C4PA 4OHJA 1K52A 2EKIA 2H89B 2QIEB 3ABVB 3FAHA 2Z8LA 3GP7A 1RYJA 2G9HD 2YEPF 1SEBD 1B1ZA 1NI3A 2LUMA 2L52A 4XWWA 2QMTA 2VZKD 5FKAC 3TEYA 3I9V1 4KKIA 3DWGC 5EE0A 1IBXA 3AE2B 1C9FA 4MACA 4AQ7A 2NTTA 1V8CA 1TS5A 1QOGA 4LLGM 4UDUC 2ZW0A 4FXCA 3TEWA 2K3UA 1YQ3B 2PLPA 1IGCA 4N6EB 3N9YC 2XNAC 3P42A 1RWSA 4Q2JA 2LJIA 1DOXA 2GRIA 3ZJUA 2LFIA 4IOIE 1JWBD 3NUHB 1QLBB 4L2YA 4N58A 1GPXA 4KKJA 1I7HA 1N60A 2QEJC 3MJ5A 4JX1C 4OZBA 2K0PA 1UWMA 4RGNA 3AE1B 3HVZA 3GB1A 3W5UB 4OZAA 3Q69A 1E10A 3GS2A 3VQIA 1STEA 3V3XA 1UWXA 3U52E 1JWUD 1C77A 1SIJA 4GDKB 4KGRA 1I4QA 4L1BA 1QKZA 3AE3B 3ZQ4A 4A8XC 5I4DA 2CJNA 5C3JB 1J7CA 1VZ7A 2NMQA 3KQ4A 3O13A 3SEBA 2PIAA 1ZE3D 3Q8CA 2I2YA 1EU3A 1SSNA 3I57A 4HROA 4L23A 1BUIC 4YXDB 2JWUA 2FE8A 3H8HA 2GB1A 3AE7B 3BWUD 2AQ1B 3LYYA 3BYYB 3B9JA 4ARIA 5EE1A 1ENFA 2N9KA 2WLBA 3IAM1 1QQRA 1EU4A 1K50A 1JWSD 3BZDB 3NZ3A 3C8YA 3W2DA 4ZOHC 4DXGA 4AS1A 4N59A 2K5PA 4R3DA 1QF6A 1KLUD 1V97A 1GB4A 1FO4A 3TEZA 2BBCA 1F2RI 3PO0A 2L1AA 1BMLC 5BMHA 2JYEA 3ZJVA 1QOAA 1HZ5A 4YTPB 1IBXB 1I4PA 2ICIA 4ITKA 1SB3C 2MH7A 1VZ6A 1KH0A 1TKEA 3J9CA 1L0XB 1DYQA 1QOBA 1N61A 2INNE 2CU3A 3P4QB 2J42A 4P16A 1SJED 2WXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI3 A;  1XLO A;  1WRI A;  2MJ3 A;  1FFU A;  2L52 A;  3B2F A;  5EE3 A;  2MJE A;  1EWY C;  3BII D;  2W55 A;  3AED B;  3FC4 A;  4USA A;  1YJJ A;  1GAQ B;  1NYQ A;  5GXG B;  2DBY A;  1FFV A;  3DWG C;  5EE0 A;  1L6U A;  3HUI A;  3AE2 B;  4US8 A;  4HRS A;  1RFK A;  1KFY B;  1KF6 B;  1TJE A;  1ZP0 B;  2WU5 B;  4ZHO A;  1TKG A;  1V8C A;  1JQ4 A;  1RM6 C;  1FMA D;  3EUB 2;  1QOG A;  1YJI A;  4YT0 B;  5AUK A;  4C7Z A;  2Y5C A;  1F0Z A;  2WDV B;  4FXC A;  4IDI A;  3AEG B;  4US9 A;  5C2T B;  4LTU A;  1FXA A;  3AE5 B;  4P6V F;  1CJE A;  4WQM A;  1JRO A;  1PUT A;  2LEK A;  4A9A A;  1NEN B;  2KAJ A;  2OHF A;  1YQ3 B;  5MPO A;  2DWQ A;  3AH7 A;  3NVY A;  3L4P A;  4KX6 B;  1QOF A;  1IUE A;  1FIQ A;  4N6E B;  3RPF C;  1RWS A;  2B76 B;  1DOX A;  3SR6 A;  1XLN A;  1ZXI A;  1WWT A;  1JWB D;  3VRB B;  1QLB B;  2Q5W D;  4JWU C;  4N58 A;  1DGJ A;  1FRD A;  3NS1 A;  1GPX A;  1XLP A;  1JW9 D;  3P4P B;  1PFD A;  1I7H A;  1L0V B;  1N60 A;  3AEC B;  1WYG A;  3AE8 B;  4JX1 C;  1VDV A;  1UWM A;  3VR8 B;  3AEB B;  2PVG C;  3AE1 B;  3HVZ A;  3ZYY X;  1B9R A;  3W5U B;  4YSX B;  2BS3 B;  5H8Y E;  1ZUD 2;  1AWD A;  1E10 A;  2H88 B;  2JX5 A;  5H92 C;  5G5H A;  2WP9 B;  1N5X A;  4YSY B;  3NVZ A;  3VRA B;  2BT6 A;  3ETR A;  1SIJ A;  1E9M A;  3AE3 B;  3AEA B;  3AE9 B;  3VR9 B;  3SFD B;  1DOI A;  1SF0 A;  2K22 A;  1WGK A;  3P1M A;  1FM0 D;  2CJN A;  1N63 A;  1VLB A;  3AV8 A;  3B2G A;  5C3J B;  1J7C A;  2K9X A;  3NVW A;  3HRD D;  3LXF A;  5G5G A;  2PIA A;  1XO3 A;  2L83 A;  4HRO A;  1JRP A;  2G1E A;  1KRH A;  3WCQ A;  4YXD B;  1A70 A;  1ZOY B;  2BS2 B;  4C80 A;  1PDX A;  1XLQ A;  2AX5 A;  3P4R B;  3AE7 B;  4C7Y A;  1WXQ A;  3AMZ A;  2BS4 B;  2JQR B;  1J7A A;  3NRZ A;  4ZHP A;  3AEF B;  2FBW B;  3AN1 A;  1E7P B;  4YTM B;  1OFF A;  1FXI A;  2PVO D;  2WU2 B;  3CWI A;  4YTN B;  1JWA D;  3B9J A;  5EE1 A;  1DOY A;  2WLB A;  1CZP A;  3W9C B;  2HTM E;  3CIR B;  5AUI A;  1FRR A;  2CJO A;  2W54 A;  2WQY B;  3KWL A;  4ZOH C;  3DWM A;  1L5P A;  2W3S A;  2W3R A;  2PKO A;  2K5P A;  3P4S B;  4N59 A;  1QF6 A;  1YQ4 B;  1V97 A;  1TKY A;  1FO4 A;  2ACZ B;  2M19 A;  3LB8 C;  1OQQ A;  3NVV A;  1JAL A;  1QT9 A;  3PO0 A;  2E3T A;  3AM9 A;  1ROE A;  3AE4 B;  3AEE B;  2QJL A;  3AE6 B;  1NYR A;  3W5V B;  1L6V A;  1N62 A;  1QOA A;  2M56 B;  2WDR B;  4WWM A;  4YTP B;  4ITK A;  1E0Z A;  1J7B A;  3P63 A;  1R7S A;  1T3Q A;  2N0S B;  5EE9 A;  4JWS C;  1NEK B;  2WS3 B;  1SB3 C;  2MH7 A;  2MJD A;  2EKI A;  1TYG B;  1TKE A;  2H89 B;  2QIE B;  3ABV B;  3FAH A;  1E6E B;  1NVI D;  1VJK A;  1N5W A;  3SFE B;  1OQR A;  2WDQ B;  1QOB A;  1N61 A;  2CU3 A;  2KMM A;  1AYF A;  3P4Q B;  4YSZ B;  1RYJ A;  3AB5 A; 
#chains in the Genus database with same CATH topology
 4IM0 A;  1V80 A;  2W55 A;  3RUL A;  3ZDT A;  3Q2A C;  3PVL A;  2RR9 A;  2Y5P A;  4HRS A;  5CHV C;  3ZNH B;  1KFY B;  2G4D B;  2WU5 B;  2NPT B;  2PPH A;  1YJI A;  1WXS A;  2BYE A;  4B9K A;  5KHO A;  2D2Q A;  2QDF A;  3AEG B;  3CST A;  2DYO A;  3L08 A;  4RGM A;  1WYW B;  3SHQ A;  1PUT A;  2LEK A;  1ET6 A;  1WZ0 A;  5JHA A;  2HDE A;  3L4P A;  5T8I A;  1WR6 E;  1UEL A;  4CO7 A;  1FRD A;  2DZI A;  2DZM A;  2V4I B;  2C7M B;  3P4P B;  4PT5 A;  4DK5 A;  2QSD A;  3AEC B;  1VDV A;  1D6E C;  2MEK A;  2GBN A;  1NBF C;  1HE8 A;  4DXA B;  1L7Y A;  4CQN A;  2QIL A;  4URK A;  2WXM A;  4YSY B;  3KH0 A;  1LO5 D;  4ANW A;  4G50 A;  1N63 A;  1GG3 A;  2D3C A;  3Q3O C;  2L83 A;  1SE9 A;  3WCQ A;  1XLQ A;  1UNS A;  1SXT A;  5DPT A;  3AMZ A;  4NPN A;  1TBE A;  4M8N A;  1UBQ A;  1KOT A;  2PVO D;  2IDY A;  2GOW A;  4MH8 A;  3CIR B;  2KDB A;  3U4E G;  5LNK 1;  1V1P B;  2LVP A;  3IT6 B;  4ARC A;  2ACZ B;  3DHH C;  3WA0 A;  4PK1 A;  4JIO U;  4TSS A;  2WDR B;  4WWM A;  4FHJ A;  3QWZ B;  2D5G A;  3KWV A;  3VFK A;  1E6E B;  3R8B A;  2QCZ A;  3R2T A;  4YSZ B;  1FNW A;  2C5L C;  3APC A;  2CHX A;  4TUU A;  3O65 B;  3PRZ A;  4S0R A;  4DHZ B;  3QC8 B;  2BPS A;  1L6U A;  3QIJ A;  1V86 A;  4GMV A;  4DWF A;  1M4V A;  4YT0 B;  3FIL A;  4KDL B;  1E7V A;  2WXL A;  3BK1 A;  1S3S G;  5E6P A;  1TS4 A;  4LTU A;  1FXA A;  2CR5 A;  3AE5 B;  3V62 A;  5AZG A;  1BT0 A;  3BVZ A;  3V6E B;  4EOY A;  1FCL A;  1QOF A;  3QJZ A;  1D5Z C;  2JRH A;  4P7I A;  4NQL B;  3DBL B;  3ALB A;  3T9L A;  3W1S C;  1F52 A;  1P1A A;  4EKU A;  2PTL A;  1RAX A;  2JX5 A;  5H92 C;  1WXA A;  4KVG B;  3AEA B;  3Q3N C;  3VR9 B;  1YQB A;  2JRI B;  1CMX B;  1K53 A;  3AV8 A;  3NZS A;  2K9X A;  1YX5 B;  2ON8 A;  2A5U A;  2WXH A;  2KK8 A;  3M95 A;  3I3T B;  2INP E;  2MRP A;  1OQY A;  2KYW A;  2K39 A;  1WX7 A;  3URY A;  1WXQ A;  2JQR B;  1OFF A;  4E74 A;  2KTR B;  2BYV E;  4HKZ E;  1AW7 A;  4RCO A;  1RFA A;  1FEH A;  1F9J A;  1WIA A;  2W3R A;  1VZ8 A;  4A20 A;  1TKY A;  3IXS A;  2LUE A;  2KWC A;  3APD A;  2JPH A;  2OJR A;  1SGH A;  2AL6 A;  5CTR C;  1J7B A;  5CX3 A;  1R7S A;  5HKH A;  2BTE A;  4LNN A;  1VJK A;  1N5W A;  3PPA A;  4M01 A;  2WDQ B;  3T8M A;  4AWJ A;  2C60 A;  2LRU A;  2ZVO A;  5BYR A;  3Q3F A;  2KXJ A;  1ZW7 A;  1WZ3 A;  3MTN B;  4HXD A;  4USA A;  3P2B A;  1FFV A;  1L4Z B;  1I4H A;  3CSF A;  4EZK A;  2K6D B;  2ZW1 A;  1TKG A;  2IND C;  2KWD A;  3AU5 A;  4C7Z A;  2KJH B;  5C2T B;  2LZ6 A;  2R2O A;  1WMH A;  2IGD A;  5D94 A;  1C78 A;  3ZKJ C;  2FUG 1;  3V61 A;  3FIL B;  3VTU A;  2SEB D;  4II2 B;  2WXN A;  1ZXI A;  2V4L A;  4TKN A;  2LD9 A;  5JHB A;  4ICU A;  2JZP A;  1WJU A;  1JW9 D;  3ZTD A;  2PE9 A;  1PGX A;  3UQB A;  4K3B A;  2O2V B;  1XCQ L;  2WXJ A;  4I6N B;  3ZLZ A;  4KIK A;  1SBB B;  4GB9 A;  5G5H A;  1N5X A;  3NVZ A;  1PYW D;  1YN4 A;  3BYT B;  2FUH B;  2V3S A;  2K22 A;  1C76 A;  2CKH B;  3M3J A;  4M02 A;  1EWC A;  1FNU A;  3RNA C;  4W9I A;  2MCN B;  1HXY D;  2J52 A;  4KV2 A;  1SE2 A;  1XD3 B;  1WGH A;  4YTM B;  4XX5 A;  3L17 A;  1UBI A;  2BWF A;  4NJ6 A;  1CZP A;  1YN3 A;  5AUI A;  3UI3 A;  1FRR A;  2W54 A;  2PMV A;  3KWL A;  1HA5 A;  4RH6 A;  3VRA B;  2W3S A;  1TS3 A;  3LDZ E;  4NJ7 A;  3DVG Y;  4B0M A;  4XGA B;  1F2R C;  4DXF A;  3A9J A;  3HM3 A;  3AXC A;  4WWN A;  3P63 A;  2JVC A;  2H89 B;  3EFU A;  4MM3 A;  4BKS D;  1R4M I;  2JF5 A;  3ZXR A;  2Z8L A;  4EZJ A;  1NI3 A;  2I1K A;  2L52 A;  4ZRI A;  4XWW A;  2QMT A;  3TEY A;  3VUW A;  3Q3M C;  4MAC A;  5E6O A;  1OEY A;  4JL9 A;  3NZU A;  3C0R B;  4I6P A;  4FXC A;  3UIN B;  3VDZ A;  2C7N B;  3DCG A;  3UGB B;  2L00 B;  1Q0W B;  3B0A A;  2PLP A;  1H4R A;  3SDL C;  3P42 A;  4Q2J A;  1DOX A;  2VRR B;  2IY0 B;  2LFI A;  2IO3 B;  2K8C A;  1GPX A;  4L2Y A;  4N58 A;  1KLV A;  1X1M A;  2KD0 A;  5KHQ A;  3AE1 B;  1E8Z A;  4F1S A;  3GS2 A;  2LVQ A;  4HPM B;  3U52 E;  1JWU D;  1SIJ A;  1Q5W B;  3ZO5 B;  1VZ7 A;  3SEB A;  3Q8C A;  1E90 A;  1SSN A;  4L23 A;  1LQB A;  2Z59 B;  1BUI C;  2KJR A;  4YXD B;  2JWU A;  3H8H A;  3N1Y C;  4MJS A;  3ECI A;  3B9J A;  4ARI A;  2WLB A;  4FN2 A;  4IW0 A;  1EU4 A;  3GOE A;  4ZOH C;  4N59 A;  1KLU D;  3BY4 B;  1UF0 A;  2KQS A;  3TEZ A;  1F2R I;  3PO0 A;  4ITK A;  1KH0 A;  1LFD A;  1DYQ A;  1QOB A;  1N61 A;  2JXX A;  2J42 A;  4HVB A;  1E8W A;  4IM2 A;  1WRI A;  1V5T A;  4LDT B;  3DOW A;  3A4S C;  2KFJ A;  2MBQ A;  1K8R B;  3KYC D;  3R2I A;  3Q8A A;  1IP9 A;  4ZHO A;  1FMA D;  3EUB 2;  4GDL A;  4GXB A;  4FUL A;  2Y5C A;  2IO2 B;  1JRU A;  3IVF A;  1JRO A;  2OHF A;  4KSK C;  1IUE A;  1Q10 A;  5CHW A;  3RPF C;  1SE3 A;  2JU6 X;  5IO9 A;  3E9S A;  4MGZ E;  1T0R C;  3VH3 B;  3DBS A;  3V05 A;  1E8X A;  2KAC A;  4H2A A;  3TEX A;  1WYG A;  2JXT A;  2JSV X;  4P1B C;  4PS3 A;  4B6W A;  2NVU I;  5LLI A;  5L95 C;  2ZCC A;  2VH2 A;  1DOI A;  2KMC A;  4MGY E;  4IWQ A;  4MSM B;  2G45 B;  3RUI B;  2IO1 B;  2DAF A;  5LXH A;  3LXF A;  4BOS C;  2L05 A;  2ASQ A;  5C23 A;  2KHW B;  2LVO A;  3DHG C;  4ASW C;  1ZOY B;  1VCB A;  4LNF A;  3ZJT A;  4IWP A;  2BYF A;  1R4M B;  2KNB A;  4YTN B;  5IA7 A;  3KW5 B;  2A4Z A;  2CJO A;  2LHE A;  2PKO A;  1WRD B;  5EDS A;  2M19 A;  4HPL B;  4GSW A;  2D10 A;  4IKG A;  1E7U A;  3BVM A;  2I38 A;  4KZC A;  5EE9 A;  3QA8 A;  2LGI A;  4JWS C;  4D2K A;  2MJD A;  1TYG B;  2DZK A;  1OQR A;  4XDC A;  2JUO A;  3IFW B;  1XF5 L;  2MJE A;  2KWU B;  4XDD A;  3AED B;  2M8S A;  3X0W A;  3TMP B;  5GXG B;  3R3M A;  5J2R A;  1RFK A;  4LJO B;  1KF6 B;  5AUK A;  4WAA A;  3WAP A;  2I1J A;  2WDV B;  2N9E B;  4EUT A;  3ONS A;  1FCC C;  4WJO A;  2EEL A;  2L0F A;  1I4X A;  2KAJ A;  2DWQ A;  3H7P B;  4MM3 B;  2B76 B;  1D5X C;  4ZRQ A;  2ZPY A;  3RI7 C;  2O2V A;  4QAY A;  2KMA A;  4WAF A;  1PFD A;  1Z5S B;  4RGT A;  3ZYY X;  1EUV B;  2EMS A;  2BS3 B;  3OJ3 A;  1UZX B;  1TS2 A;  2ZNV B;  1BXT A;  2KWV B;  3PLU A;  2O6V D;  3L13 A;  1P7E A;  4BVU C;  4AP4 C;  4RGO S;  1WJ6 A;  2NR2 A;  2RSU A;  4AOF A;  4RF0 A;  4REZ A;  4HJG E;  2MBO A;  3OAW A;  3S2A A;  2M1M A;  5BYS A;  3U2S C;  3Q14 C;  3AU4 A;  2N7E A;  1V49 A;  1I4G A;  2OED A;  2FBW B;  5IAA C;  3VAW A;  3W9C B;  1GOZ A;  3DWM A;  2IBI B;  4DQO C;  5J17 A;  2FID A;  3ZDM C;  3JYU A;  3NVV A;  1QT9 A;  2BB6 A;  2XEW A;  5AZF A;  2N0S B;  2AQ3 B;  2KTR A;  3DQV A;  1NVI D;  3H7P A;  4WWO A;  4A55 A;  2DAJ A;  2V9H A;  2Z0E B;  3B2F A;  2MBB B;  3RZW C;  2DBY A;  3HUI A;  3PZ8 A;  1T0Y A;  2WXI A;  2RGF A;  4XYC A;  4JE3 B;  1RM6 C;  4JLC A;  2X38 A;  1FNV A;  3QX1 A;  2ZEQ A;  1WGY A;  4G0N B;  4GN1 A;  1I4R A;  3RNC C;  2BGF A;  1H8C A;  3NVY A;  1UD7 A;  2DX5 B;  1I35 A;  1MVK A;  1FIQ A;  1YN5 A;  2WDT B;  4HEA 1;  3PRE A;  3PS6 A;  1D5M C;  3ZVV A;  3U7D A;  1DGJ A;  3NS1 A;  3AI5 A;  2YEP B;  2AYO B;  3ML9 A;  3MC0 B;  4WH4 A;  1P98 A;  3EC8 A;  4ZYS A;  2KQ4 X;  4W9L A;  5D3D A;  1ZUD 2;  4BBN C;  1VR9 A;  2WP9 B;  5HFY A;  1C3T A;  1V1O A;  4GDL B;  2RD0 A;  3QHT A;  3BK2 A;  5D2M B;  1VLB A;  3NVW A;  3PZ7 A;  3TSS A;  3TBL D;  1J8C A;  2NBV B;  3GE8 C;  1A70 A;  2E6X A;  3QCA A;  2GBK A;  2WXQ A;  4GU2 A;  4NAW A;  4M00 A;  4ZRP A;  1J7A A;  5D6J B;  4B95 A;  4GOC A;  5FR6 A;  2EKE C;  1DOY A;  1M94 A;  2JZ3 B;  4NAM A;  4XZ4 A;  3A4R A;  3H9D A;  4RNA A;  5C1Z A;  2L8J A;  1J0G A;  2WXO A;  4K81 A;  4BKG A;  3Q6B A;  3IHP C;  1C4C A;  1L6V A;  1R4N B;  2EMT A;  2DNF A;  4F7Z A;  1K52 A;  4HCP B;  3FAH A;  3NG0 A;  4MJS B;  2MBE A;  4AUQ C;  2MW5 A;  1RYJ A;  2UYZ B;  1SEB D;  4ZYN A;  4BFR A;  4HK2 A;  2K6Q A;  4M8M A;  2K8H A;  2NPT A;  2BWE S;  3I9V 1;  3K9O B;  4KKI A;  5EE0 A;  1IBX A;  4AQ7 A;  1TS5 A;  5IKC M;  1QOG A;  4W9D A;  1OGW A;  2J0J A;  2GBJ A;  2MQJ A;  3CMM B;  2WHI A;  1IGC A;  4N6E B;  3N9Y C;  2GRI A;  4HJK A;  3KYD D;  1WJ4 A;  4KKJ A;  1N60 A;  4JX1 C;  4W9F A;  1UWM A;  3HVZ A;  3W5U B;  1WX8 A;  2LXC A;  3QQ8 B;  1STE A;  1UWX A;  2MLB A;  2PJH A;  4GDK B;  3AE3 B;  4A8X C;  5GMV A;  5C3J B;  3A9K B;  2GLS A;  2I2Y A;  3PHW B;  4FHK A;  1ZGU B;  3I57 A;  3WAO A;  4DHJ B;  1EF5 A;  3A1Q A;  2KN5 A;  2ZNV C;  3B08 A;  3ZXV A;  2AQ1 B;  4JGH B;  2FIF A;  1L2N A;  2N9X A;  5JH5 C;  2NBU A;  5EE1 A;  3SU8 X;  1ENF A;  3NY5 A;  1QQR A;  1TGZ B;  3BZD B;  1K50 A;  2M17 A;  3NZ3 A;  4OVV A;  4R3D A;  2KLC A;  2KX0 A;  2HD5 B;  1GB4 A;  5J18 A;  1QZE A;  5BMH A;  2LXA A;  2ZVN A;  4WWP A;  3ZJV A;  4YTP B;  1IBX B;  3VUY A;  1VZ6 A;  1T0S C;  1L0X B;  3D32 A;  2MHJ A;  3P4Q B;  1SJE D;  3DBL I;  2LRW A;  4YL8 A;  2BVC A;  2KO3 A;  3U8Z A;  1ZKH A;  2FCN A;  5FK9 C;  1EWY C;  2N9P C;  1UGJ A;  4JPS A;  3H1U A;  2V3N A;  4K7S A;  4PS7 A;  1AN8 A;  2R2Q A;  4S17 A;  1WXM A;  1MHH E;  4IM3 A;  2M0X A;  3DHI C;  4IDI A;  4US9 A;  2DYB A;  4K7U A;  2GBM A;  1EO6 A;  3N30 A;  1ISN A;  3SR6 A;  1XLN A;  4NAW B;  2WX0 A;  4WJQ A;  3K9P B;  2Q5W D;  4NZL B;  3PV1 A;  2OOB B;  3AE8 B;  1GC6 A;  3R7R A;  4MT5 A;  5BMI A;  1ET9 A;  1WMH B;  2D3A A;  2BT6 A;  1N6Z A;  2K8B A;  4EEW A;  3P1M A;  3KUC B;  4RM9 A;  3DBH I;  3HRD D;  4LNI A;  4WJP A;  3VXW A;  3W1S A;  3PZD A;  3H7S A;  1MFW A;  2BS2 B;  3MFG A;  3ZNZ B;  3AEF B;  3JW0 X;  3HIZ A;  1ACC A;  2NTS A;  2WU2 B;  4E3C A;  3N3K B;  1XEE A;  1P7F A;  2RDH A;  1WR1 A;  2KAN A;  2HE7 A;  3TJP A;  2KQ7 A;  2L3Z A;  3OWE B;  1HTO A;  2QJL A;  3AE6 B;  3N1Z C;  1E0Z A;  4EZL A;  2RPQ A;  1YJ1 A;  2N1W A;  2LGY A;  2KDM A;  1T3Q A;  5TSS A;  2LAS A;  2ZJD A;  3RNE C;  3SFE B;  1ZPS A;  3H6N A;  2RDB C;  2HJ1 A;  3RCZ A;  1XLO A;  3FKY A;  5D3I B;  5EE3 A;  4ANX A;  3IT4 B;  5BO4 B;  3RNG C;  1HTQ A;  3IAS 1;  3A9J B;  3PRM B;  3GE3 C;  1TY2 A;  4TMA B;  4LK0 M;  1CJE A;  1UGM A;  1V2Y A;  1TY0 A;  4KX6 B;  1KM7 A;  3MHZ A;  3Q3J A;  4NQK E;  4JWU C;  5HG2 A;  3VTV A;  4IWO A;  1MHX A;  4K1R B;  3V6C B;  1EM7 A;  2O6V B;  4CHK A;  1B9R A;  5G55 A;  1AWD A;  5JXV A;  4OVU A;  4EFO A;  4GLS C;  2LHD A;  2LMC A;  1FM0 D;  4E71 A;  3RD2 A;  2DHZ A;  2V1Y A;  4XE0 A;  1UUP A;  3DBR B;  1JRP A;  1YD8 U;  2IO0 B;  2QHO A;  2Y3A A;  2AX5 A;  2KDI A;  2BS4 B;  2BF8 B;  3WAN A;  3I5J C;  4ZHP A;  1KTK A;  1FXI A;  2W9N A;  3CWI A;  1JWA D;  2QC8 A;  3W1Y A;  1VRA B;  2HTM E;  2WXG A;  4RFB A;  1PGA A;  3UIO B;  1MG4 A;  2BYT A;  2KDE B;  4F8C B;  1OQQ A;  3T3O A;  2REX A;  1NYR A;  2L32 A;  1S1Q B;  2RMM A;  1WF9 A;  2BB5 A;  1VD2 A;  3KVF B;  3PGE A;  4ANV A;  1XXG A;  2LGX A;  2KOX A;  2KC1 A;  2KTF A;  4AJW A;  3GZN B;  1FD6 A;  4NNJ B;  1MI0 A;  1WGG A;  4IC7 B;  1FFU A;  4PYU A;  3JSV B;  1TT5 B;  3FC4 A;  2WXR A;  1WE7 A;  1GAQ B;  5FR3 A;  1YNT E;  3N1X C;  4LJP B;  3U30 A;  3N20 C;  3HHM A;  2PEA A;  3ZNG C;  4J3O D;  4WQM A;  2WGS A;  2JYT A;  4MH0 E;  1CK1 A;  2ZZP B;  4ZDV A;  1KLG D;  1XLP A;  3EA6 A;  5BMG A;  2WYQ A;  1ESF A;  1WX9 A;  2M4N A;  3AEB B;  2PVG C;  1V1P A;  1TZO A;  2INC C;  3RNB C;  3Q8F A;  1WSP A;  1ZDV A;  4KZ0 A;  3WAM A;  2SAK A;  3AE9 B;  2IGH A;  4TV3 A;  3OG5 A;  4DHJ D;  4LNK A;  2V0G A;  1C1Y B;  3E56 A;  3NS8 A;  1PDX A;  4OW0 A;  4KGS A;  3P4R B;  4C7Y A;  4NJC A;  1XCT L;  3QK0 A;  3NRZ A;  5HHD G;  4PYZ A;  4G3X B;  2J0M A;  2BW2 A;  3L54 A;  2L76 A;  3VH4 B;  3VVW B;  1A5R A;  5L83 A;  2E3T A;  4TQ0 A;  3AEE B;  1Z2M A;  2LWP A;  1N62 A;  2M56 B;  3M62 B;  2EKI A;  1WI0 A;  3KUD B;  4J6I A;  2YEP F;  2G9H D;  2LI5 A;  1B1Z A;  2KVR A;  4JQW C;  2FCQ A;  3AUL A;  2XBB C;  5FKA C;  3DWG C;  3AE2 B;  1C9F A;  2NTT A;  3RMK C;  2WX1 A;  4LLG M;  2UWQ A;  4UDU C;  4RM8 A;  4BKS A;  3HK0 A;  4C4V B;  3RT3 B;  5LXI B;  2K3U A;  5AZH A;  2CU1 A;  1SIF A;  4HDQ A;  1YQ3 B;  3ZRC A;  1WFY A;  3I63 C;  1I42 A;  2OJW A;  2Y5B B;  2LJI A;  2GBR A;  1WH3 A;  4BAX A;  1JWB D;  1I7H A;  2QEJ C;  2FCM A;  5E6N A;  2D11 A;  2K0P A;  3DVN U;  4RGN A;  3RZF A;  3GB1 A;  4ACF A;  4HCN B;  1WJN A;  1E10 A;  1WXV A;  4KGR A;  1C77 A;  3ZQ4 A;  1I4Q A;  2LJ5 A;  2KDF B;  5I4D A;  3L16 A;  2CJN A;  3UF8 A;  3N32 A;  2D07 B;  1J7C A;  2NMQ A;  3KQ4 A;  4KSL C;  1EU3 A;  2FE8 A;  1IPG A;  3AE7 B;  2N4F A;  3BWU D;  4M0W B;  2XK5 B;  1TIF A;  4KIK B;  2FNJ B;  4ICV A;  3IAM 1;  3C8Y A;  2AEH A;  3MC8 A;  4AJY B;  1QF6 A;  3ML8 A;  4FJZ A;  1FO4 A;  2LGS A;  2BBC A;  2L1A A;  3WIM A;  1BML C;  2JYE A;  1QOA A;  1I4P A;  2ICI A;  4W9E A;  3ENE A;  4FBJ B;  3QAR A;  1RLF A;  1SB3 C;  3J9C A;  1NDD A;  3GZN I;  2INN E;  2CU3 A;  3R66 C;  1G6J A;  3PSE B;  2MJ3 A;  3DDC B;  3APF A;  4I6L B;  3TUO A;  4A6Q A;  4B0E A;  4C00 A;  2ZPN A;  1IYF A;  1GB1 A;  3PRP B;  4DDG D;  1C4A A;  1NYQ A;  4US8 A;  1UH6 A;  4A3P A;  2N1V A;  2AQ2 B;  2HTH A;  2N7J A;  1JCK B;  5MPO A;  3OJ4 B;  4C4V A;  1CQV A;  4MDK E;  2NS5 A;  5AEK B;  1TZ1 A;  1EF1 A;  1PQS A;  2BKR B;  1NI2 A;  1HZ6 A;  1LGR A;  4W9J A;  1YMH E;  4YSX B;  2CS4 A;  4BBN F;  4N9F 4;  2CHZ A;  3RN9 C;  2XK5 A;  1AAR A;  3ZW3 A;  1E9M A;  4HPP A;  1OEY J;  1WY8 A;  1SF0 A;  2M0A A;  3MP9 A;  1RRB A;  2MBH A;  3NHE B;  5CHF A;  3ZIM A;  2FCS A;  1T5X D;  1HQR D;  1XO3 A;  2IY1 B;  1D4B A;  1KJT A;  1D3Z A;  2G1E A;  1KRH A;  3PHX B;  1PGB A;  4ZRK A;  3ZGZ A;  4ANU A;  5TR5 A;  2IJ0 A;  4MEM A;  2KLG A;  2LGD A;  5IN7 A;  2JY6 A;  1ZXH A;  4YWG G;  2K25 A;  3P4S B;  4HKQ A;  3T3N A;  1IGD A;  1YQ4 B;  2KT7 A;  1JAL A;  1WGR A;  1WM2 A;  2BQQ A;  3AM9 A;  1ROE A;  3AE4 B;  2WWZ A;  4WIP A;  3VTW A;  1QIL A;  2JT4 B;  4BZA A;  1NEK B;  2KN4 A;  3RFZ B;  1GUA B;  2W82 A;  3WAL A;  2KMM A;  1FPY A;  3RYT A;  3TCA A;  1LXD A;  1P3Q U;  4A3O A;  3EFC A;  5E6J A;  3BII D;  2KZR A;  1YJJ A;  2CHW A;  2L0T A;  1JQ4 A;  1TTN A;  1YIW A;  1F0Z A;  2WXF A;  2KX3 A;  1MPE A;  1P9D U;  4A9A A;  1NEN B;  5HI1 A;  3NOB A;  4W9K A;  1Y8R C;  3RNF C;  3ZNI D;  4FJV B;  3UQA A;  2RDG A;  3VRB B;  2BKF A;  4DHZ E;  3A1Q B;  1SJH D;  2GI9 A;  4EE2 A;  2DLB A;  3NJT A;  5H8Y E;  3EGR A;  4LCD E;  2WNM A;  4X57 B;  4NY0 A;  3ETR A;  4MSQ B;  3A33 B;  3R7Q A;  3SFD B;  4XWT A;  1WGK A;  2R61 A;  1YOV B;  4WUR A;  4HWI B;  3TL5 A;  1C79 A;  1MG8 A;  2WXK A;  2IGG A;  2VH1 A;  1HEZ E;  1F1H A;  1T0Q C;  3L0W B;  3PLV A;  4C80 A;  2MWS B;  4M0W A;  3IG3 A;  4DBG A;  1E7P B;  4GDK A;  2D3G A;  3ZRF A;  2IPK D;  3QAQ A;  5BYQ A;  1YX6 B;  3EEC A;  2X8X X;  3OLM D;  2D3B A;  4K7W A;  2WQY B;  4FAD A;  1L5P A;  1V6E A;  1WM3 A;  3DVG X;  2JZZ A;  4FLH A;  4A90 A;  1JWM D;  5DPS A;  2XN9 C;  3HVD A;  2TSS A;  2DZJ A;  3Q8E A;  2DYM A;  2G4S A;  5D7G A;  4W9H A;  2WS3 B;  4W9C A;  4FA6 A;  1Y56 A;  1L4D B;  3KLS X;  2KVZ A;  1AYF A;  2YLM A;  3AB5 A;  2ONQ A;  4TQ1 A;  2J0K A;  1GJZ A;  1XQQ A;  4IUM B;  2FAZ A;  3MHS D;  3KUZ A;  1TJE A;  1ZP0 B;  4GIV A;  4LDT D;  4MGI E;  5IP4 D;  2VZK B;  4P1C C;  1OTR B;  4P6V F;  1Q1O A;  3TIX A;  3JVZ X;  1L0Y B;  3AH7 A;  2J4X A;  3LJ3 A;  2AWT A;  2N9L A;  1WWT A;  1ZDX A;  2PW9 A;  3U7Z A;  1L0V B;  3HM6 X;  3Q8B A;  5DPW A;  3VR8 B;  1K51 A;  3VUX A;  4DDI D;  2J53 A;  2H88 B;  4II3 B;  2MA9 B;  2YVC A;  3M63 B;  4MEL A;  3UIP B;  4HDO A;  4C56 C;  3V60 A;  2J7Q B;  1WGD A;  4G11 A;  1P0R A;  3B2G A;  3VHT C;  4CYE A;  2PE6 B;  4K3C A;  4OZC A;  4ZRJ A;  2IYD B;  5G5G A;  2RPV A;  1V9J A;  2HJ8 A;  1T6B X;  2V3P A;  1F77 A;  4FJY A;  3ZUN A;  1SE4 A;  3AN1 A;  4OVZ A;  3X23 A;  3BVG A;  5IOI A;  3BIN A;  1JML A;  4MGK E;  5JZE B;  2MSE D;  4KGT A;  4O1N A;  2O6V A;  4XC2 A;  4BKT A;  1V81 A;  4RF1 A;  3LB8 C;  2MP2 B;  3W5V B;  4GGQ A;  5DPR A;  3L10 B;  4WQO B;  1LM8 B;  1C4P A;  4LNO A;  4OHJ A;  4PS8 A;  1FXT B;  1V5O A;  2QIE B;  3C19 A;  3ABV B;  1J19 A;  3GP7 A;  4IG7 B;  1E5W A;  2LUM A;  2DEN B;  2KFK A;  2VZK D;  3SD5 A;  1GC7 A;  2IZV B;  1V8C A;  2NBW B;  2KFK B;  2ZW0 A;  3TEW A;  2N7D A;  2NCN A;  4W9G A;  2L7R A;  2MX2 A;  4RMA A;  3DBH B;  3DPD A;  3CF6 E;  2XNA C;  1RWS A;  2KKC A;  3ZJU A;  4IOI E;  4WJN A;  3NUH B;  1QLB B;  1GNU A;  2Z0D B;  5DCN A;  2MP2 A;  2KJ6 A;  3MJ5 A;  3JSV A;  4OZB A;  3PT2 B;  3A9K A;  1MJD A;  1R4N I;  4OZA A;  3Q69 A;  3PTF C;  3DVN V;  3VQI A;  3V3X A;  2KC2 A;  3ZTC A;  1WE6 A;  4L1B A;  1QKZ A;  2AL3 A;  2C7H A;  2JWZ A;  3O13 A;  2PIA A;  1ZE3 D;  2ZCB A;  4HRO A;  2K1F A;  3EHV A;  2GMI C;  2GB1 A;  2C9W B;  3LYY A;  4KDI C;  3DBR I;  3BYY B;  2N9K A;  1JWS D;  3W2D A;  4DXG A;  3MJW A;  3MC9 A;  4AS1 A;  1E8Y A;  2K5P A;  3IBE A;  1V97 A;  3B1L X;  4HLE A;  1HZ5 A;  4BOZ B;  2B3A A;  2MH7 A;  1TKE A;  2UU7 A;  1XT9 B;  4P16 A;  2WXP A;  5G2N A;  2G3Q B;  1U4A A; 
#chains in the Genus database with same CATH homology
 1WRI A;  2MJ3 A;  3TUO A;  5FK9 C;  1EWY C;  4A6Q A;  2W55 A;  4B0E A;  1UGJ A;  1GB1 A;  4JPS A;  1C4A A;  1NYQ A;  3R2I A;  3Q8A A;  2Y5P A;  2V3N A;  4US8 A;  4HRS A;  1KFY B;  4ZHO A;  2WU5 B;  1AN8 A;  1FMA D;  3EUB 2;  1YJI A;  1MHH E;  2Y5C A;  4IDI A;  3AEG B;  4US9 A;  2DYO A;  4RGM A;  2AQ2 B;  1JRO A;  2N7J A;  2LEK A;  1PUT A;  1ET6 A;  2OHF A;  2HDE A;  1JCK B;  5MPO A;  3L4P A;  5T8I A;  1IUE A;  1Q10 A;  3RPF C;  1SE3 A;  2JU6 X;  3E9S A;  3SR6 A;  1CQV A;  1XLN A;  4NAW B;  2Q5W D;  4NZL B;  1FRD A;  2V4I B;  3V05 A;  3P4P B;  4PT5 A;  1HZ6 A;  2KAC A;  2QSD A;  4H2A A;  3TEX A;  3AEC B;  1WYG A;  3AE8 B;  1VDV A;  1D6E C;  2JXT A;  2MEK A;  4MT5 A;  2JSV X;  5BMI A;  4CQN A;  2QIL A;  1YMH E;  4YSX B;  2WXM A;  1ET9 A;  4YSY B;  2BT6 A;  1E9M A;  1LO5 D;  1DOI A;  1SF0 A;  3P1M A;  2M0A A;  3MP9 A;  1N63 A;  3HRD D;  3LXF A;  1T5X D;  1HQR D;  1XO3 A;  2L83 A;  3W1S A;  1D4B A;  2G1E A;  1KRH A;  3WCQ A;  1ZOY B;  2BS2 B;  3MFG A;  1PGB A;  1XLQ A;  3ZJT A;  1UNS A;  3ZGZ A;  1SXT A;  3AMZ A;  2IJ0 A;  3AEF B;  1ACC A;  2NTS A;  2PVO D;  2WU2 B;  4YTN B;  2IDY A;  4MH8 A;  1XEE A;  1P7F A;  2RDH A;  3CIR B;  3U4E G;  1ZXH A;  2CJO A;  4YWG G;  2LHE A;  1V1P B;  5LNK 1;  3P4S B;  2PKO A;  3IT6 B;  3T3N A;  4HKQ A;  1IGD A;  1YQ4 B;  3OWE B;  4ARC A;  2ACZ B;  2M19 A;  1JAL A;  4IKG A;  3BVM A;  3AM9 A;  1ROE A;  2I38 A;  3AE4 B;  2QJL A;  3AE6 B;  4TSS A;  2WDR B;  4WIP A;  4WWM A;  1E0Z A;  1QIL A;  2KDM A;  5EE9 A;  1T3Q A;  5TSS A;  2LGI A;  1NEK B;  2D5G A;  2KN4 A;  4JWS C;  4D2K A;  2MJD A;  3KWV A;  1TYG B;  2W82 A;  3RFZ B;  1E6E B;  3SFE B;  1ZPS A;  1OQR A;  3R2T A;  3R8B A;  2KMM A;  4XDC A;  4YSZ B;  1FNW A;  1XLO A;  1XF5 L;  5D3I B;  5E6J A;  5EE3 A;  2MJE A;  4XDD A;  3BII D;  3AED B;  1YJJ A;  3IT4 B;  5GXG B;  1L6U A;  3IAS 1;  1RFK A;  1KF6 B;  1JQ4 A;  1M4V A;  4YT0 B;  5AUK A;  3FIL A;  1TY2 A;  1F0Z A;  2WXF A;  2WXL A;  2WDV B;  3BK1 A;  4TMA B;  1TS4 A;  4LTU A;  1FXA A;  3AE5 B;  1MPE A;  1CJE A;  4LK0 M;  1FCC C;  2EEL A;  3BVZ A;  4A9A A;  1I4X A;  1NEN B;  2KAJ A;  5HI1 A;  2DWQ A;  1FCL A;  1TY0 A;  4KX6 B;  1QOF A;  4MM3 B;  1D5Z C;  2B76 B;  3MHZ A;  1D5X C;  4ZRQ A;  2RDG A;  3VRB B;  4JWU C;  5HG2 A;  1SJH D;  1PFD A;  2GI9 A;  4WAF A;  1MHX A;  4EE2 A;  4RGT A;  1EM7 A;  3ZYY X;  1B9R A;  2PTL A;  2BS3 B;  2DLB A;  5H8Y E;  3EGR A;  1AWD A;  1TS2 A;  5JXV A;  2WNM A;  2JX5 A;  5H92 C;  1BXT A;  3ETR A;  3AEA B;  4GLS C;  3VR9 B;  1P7E A;  2LHD A;  3SFD B;  2LMC A;  4XWT A;  1WGK A;  2R61 A;  1FM0 D;  4RGO S;  1K53 A;  3AV8 A;  4WUR A;  2K9X A;  1C79 A;  2ON8 A;  4RF0 A;  4XE0 A;  4REZ A;  1UUP A;  4HJG E;  2WXK A;  2IGG A;  2WXH A;  1JRP A;  2INP E;  1HEZ E;  4C80 A;  2Y3A A;  2AX5 A;  3URY A;  3U2S C;  5BYS A;  1WXQ A;  2BS4 B;  2JQR B;  4ZHP A;  1I4G A;  2OED A;  4M0W A;  2FBW B;  1E7P B;  1KTK A;  1OFF A;  1FXI A;  3CWI A;  2IPK D;  1JWA D;  1VRA B;  4HKZ E;  1AW7 A;  4RCO A;  5BYQ A;  3W9C B;  1FEH A;  2HTM E;  1GOZ A;  2WXG A;  2WQY B;  3DWM A;  1L5P A;  1PGA A;  2W3R A;  4RFB A;  4DQO C;  1VZ8 A;  2BYT A;  1TKY A;  3IXS A;  1OQQ A;  1JWM D;  4A90 A;  3T3O A;  3NVV A;  1QT9 A;  2XN9 C;  2BB6 A;  3HVD A;  2TSS A;  3Q8E A;  1NYR A;  2L32 A;  2DYM A;  2RMM A;  2BB5 A;  1J7B A;  1R7S A;  2N0S B;  5D7G A;  2AQ3 B;  2WS3 B;  2BTE A;  1Y56 A;  1NVI D;  1L4D B;  1N5W A;  1VJK A;  1XXG A;  2WDQ B;  3KLS X;  4A55 A;  1AYF A;  1FD6 A;  5BYR A;  3AB5 A;  1MI0 A;  1FFU A;  2ONQ A;  3B2F A;  4TQ1 A;  3FC4 A;  2WXR A;  4USA A;  1GAQ B;  2DBY A;  1FFV A;  1L4Z B;  1I4H A;  3HUI A;  3PZ8 A;  2WXI A;  2ZW1 A;  5FR3 A;  1TJE A;  1ZP0 B;  1YNT E;  1TKG A;  4JE3 B;  1RM6 C;  2KWD A;  2X38 A;  2VZK B;  1FNV A;  4C7Z A;  5C2T B;  4P6V F;  1I4R A;  4J3O D;  4WQM A;  2IGD A;  1L0Y B;  2JYT A;  3AH7 A;  1C78 A;  3NVY A;  2FUG 1;  2J4X A;  3FIL B;  1MVK A;  1FIQ A;  1YN5 A;  2SEB D;  2N9L A;  2WXN A;  4HEA 1;  1ZXI A;  1WWT A;  1D5M C;  1ZDX A;  1CK1 A;  1DGJ A;  2PW9 A;  2JZP A;  3NS1 A;  1KLG D;  1XLP A;  1JW9 D;  3U7Z A;  1L0V B;  3EA6 A;  2YEP B;  3MC0 B;  5BMG A;  1ESF A;  1PGX A;  3Q8B A;  4WH4 A;  3VR8 B;  3AEB B;  1K51 A;  2PVG C;  1V1P A;  1XCQ L;  2KQ4 X;  2WXJ A;  1TZO A;  5D3D A;  4ZYS A;  1ZUD 2;  2J53 A;  2H88 B;  1SBB B;  1VR9 A;  2WP9 B;  5G5H A;  5HFY A;  1N5X A;  3Q8F A;  3NVZ A;  1PYW D;  1WSP A;  1YN4 A;  1ZDV A;  4C56 C;  2SAK A;  3AE9 B;  1V1O A;  3BYT B;  2IGH A;  4GDL B;  2K22 A;  1C76 A;  3BK2 A;  3B2G A;  1VLB A;  2V0G A;  3NVW A;  3PZ7 A;  3TSS A;  1EWC A;  1FNU A;  4OZC A;  5G5G A;  3E56 A;  2RPV A;  1T6B X;  1HXY D;  2V3P A;  1F77 A;  1A70 A;  2E6X A;  2J52 A;  1PDX A;  4OW0 A;  4KGS A;  3P4R B;  4C7Y A;  4NJC A;  1XCT L;  2WXQ A;  1SE2 A;  4ZRP A;  1J7A A;  3NRZ A;  1SE4 A;  4YTM B;  3AN1 A;  4OVZ A;  5HHD G;  3BVG A;  1DOY A;  1CZP A;  1JML A;  1YN3 A;  4NAM A;  5AUI A;  3UI3 A;  2BW2 A;  4KGT A;  1FRR A;  2W54 A;  2PMV A;  3KWL A;  1HA5 A;  4O1N A;  4RNA A;  4RH6 A;  2W3S A;  3VRA B;  1TS3 A;  4RF1 A;  2WXO A;  3LB8 C;  4B0M A;  1F2R C;  2E3T A;  4TQ0 A;  1C4C A;  3AEE B;  4DXF A;  3W5V B;  1L6V A;  1N62 A;  2M56 B;  3P63 A;  1C4P A;  4OHJ A;  1K52 A;  2EKI A;  2H89 B;  2QIE B;  3ABV B;  3FAH A;  2Z8L A;  3GP7 A;  1RYJ A;  2G9H D;  2YEP F;  1SEB D;  1B1Z A;  1NI3 A;  2LUM A;  2L52 A;  4XWW A;  2QMT A;  2VZK D;  5FKA C;  3TEY A;  3I9V 1;  4KKI A;  3DWG C;  5EE0 A;  1IBX A;  3AE2 B;  1C9F A;  4MAC A;  4AQ7 A;  2NTT A;  1V8C A;  1TS5 A;  1QOG A;  4LLG M;  4UDU C;  2ZW0 A;  4FXC A;  3TEW A;  2K3U A;  1YQ3 B;  2PLP A;  1IGC A;  4N6E B;  3N9Y C;  2XNA C;  3P42 A;  1RWS A;  4Q2J A;  2LJI A;  1DOX A;  2GRI A;  3ZJU A;  2LFI A;  4IOI E;  1JWB D;  3NUH B;  1QLB B;  4L2Y A;  4N58 A;  1GPX A;  4KKJ A;  1I7H A;  1N60 A;  2QEJ C;  3MJ5 A;  4JX1 C;  4OZB A;  2K0P A;  1UWM A;  4RGN A;  3AE1 B;  3HVZ A;  3GB1 A;  3W5U B;  4OZA A;  3Q69 A;  1E10 A;  3GS2 A;  3VQI A;  1STE A;  3V3X A;  1UWX A;  3U52 E;  1JWU D;  1C77 A;  1SIJ A;  4GDK B;  4KGR A;  1I4Q A;  4L1B A;  1QKZ A;  3AE3 B;  3ZQ4 A;  4A8X C;  5I4D A;  2CJN A;  5C3J B;  1J7C A;  1VZ7 A;  2NMQ A;  3KQ4 A;  3O13 A;  3SEB A;  2PIA A;  1ZE3 D;  3Q8C A;  2I2Y A;  1EU3 A;  1SSN A;  3I57 A;  4HRO A;  4L23 A;  1BUI C;  4YXD B;  2JWU A;  2FE8 A;  3H8H A;  2GB1 A;  3AE7 B;  3BWU D;  2AQ1 B;  3LYY A;  3BYY B;  3B9J A;  4ARI A;  5EE1 A;  1ENF A;  2N9K A;  2WLB A;  3IAM 1;  1QQR A;  1EU4 A;  1K50 A;  1JWS D;  3BZD B;  3NZ3 A;  3C8Y A;  3W2D A;  4ZOH C;  4DXG A;  4AS1 A;  4N59 A;  2K5P A;  4R3D A;  1QF6 A;  1KLU D;  1V97 A;  1GB4 A;  1FO4 A;  3TEZ A;  2BBC A;  1F2R I;  3PO0 A;  2L1A A;  1BML C;  5BMH A;  2JYE A;  3ZJV A;  1QOA A;  1HZ5 A;  4YTP B;  1IBX B;  1I4P A;  2ICI A;  4ITK A;  1SB3 C;  2MH7 A;  1VZ6 A;  1KH0 A;  1TKE A;  3J9C A;  1L0X B;  1DYQ A;  1QOB A;  1N61 A;  2INN E;  2CU3 A;  3P4Q B;  2J42 A;  4P16 A;  1SJE D;  2WXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...