4WWMA

X-ray crystal structure of sulfolobus solfataricus urm1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
79
structure length
79
Chain Sequence
PKVILKGPLISQFNFREIYVNDRELLRVLVKIDSKKHLILNESNQLKSGILILINGKDWRLYRNQLLNDNDIIEIIPIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Uncharacterized protein
publication title Involvement of a eukaryotic-like ubiquitin-related modifier in the proteasome pathway of the archaeon Sulfolobus acidocaldarius.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 16
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4wwmA00
2WDQB 2Y5CA 1XLOA 4US8A 2WQYB 1YJJA 3AEAB 3P4QB 1FRDA 2K9XA 2PIAA 1FM0D 1N5WA 3AEEB 2CJOA 1JALA 1WGKA 2L83A 4ZOHC 1L6VA 2WDRB 2E3TA 3AB5A 3ABVB 3L4PA 3P4PB 2WS3B 1OQQA 1NVID 2WDVB 2QJLA 4WWMA 4YSZB 1TKYA 2HTME 1FRRA 1QOBA 1N60A 2N0SB 1KRHA 2MJ3A 2W55A 4ZHPA 1V8CA 3AE4B 1EWYC 1XLPA 2BS4B 3NRZA 3VR9B 1TYGB 3FC4A 1XLQA 2WP9B 4YSYB 1VJKA 2W54A 1NEKB 2EKIA 5H8YE 5H92C 3VR8B 1J7BA 3NS1A 4YXDB 1IUEA 3AEFB 3SFDB 1N5XA 5EE9A 1TKEA 4YTNB 1JROA 3SR6A 5EE1A 1FO4A 3P4SB 4HROA 1GPXA 5G5HA 4JX1C 1RFKA 1ZUD2 1SIJA 1ZP0B 2L52A 4A9AA 1V97A 1OFFA 2BS3B 3P1MA 3WCQA 2B76B 3AE8B 2JQRB 3DWMA 1DOIA 1ROEA 3AEGB 4JWSC 4USAA 5C3JB 4YT0B 3AE7B 3W9CB 3FAHA 2H89B 1NYRA 4JWUC 2DWQA 3AEBB 3P63A 2DBYA 3NVWA 5AUKA 1QF6A 2ACZB 1XLNA 4YSXB 1CJEA 2K22A 1B9RA 1L6UA 1N62A 1FIQA 1FFUA 1JWAD 3HVZA 1QT9A 2KAJA 1I7HA 2CJNA 2KMMA 1JW9D 2M19A 2MJDA 1J7CA 2PVOD 2W3SA 3AE6B 3BIID 3NVVA 5EE3A 5AUIA 2QIEB 1FXIA 1WWTA 3AE3B 4LTUA 3P4RB 1L5PA 1NI3A 4P6VF 3ZYYX 3DWGC 3AE2B 1YQ4B 3RPFC 1ZOYB 4YTPB 1QOAA 1GAQB 1CZPA 2WLBA 4FXCA 1JRPA 1OQRA 1XO3A 5C2TB 4N6EB 3W5UB 2WU5B 1NYQA 1PUTA 1E0ZA 4N58A 1WYGA 3VRAB 1RYJA 4C7YA 1N61A 2CU3A 2FBWB 1E7PB 1JWBD 1QOGA 1ZXIA 3AECB 1JQ4A 1L0VB 3B2GA 3AH7A 4C7ZA 1SB3C 1T3QA 3AE5B 3AEDB 4N59A 1DOYA 2BT6A 2M56B 3EUB2 1TJEA 1DOXA 3PO0A 2PVGC 1KF6B 1R7SA 1PDXA 1KFYB 3AE1B 3HUIA 4WQMA 1RWSA 3LB8C 2LEKA 1WRIA 3AM9A 3LXFA 3NVYA 2Q5WD 4HRSA 5G5GA 1E9MA 1FXAA 3W5VB 1F0ZA 5GXGB 4IDIA 3AMZA 3B9JA 4ZHOA 5MPOA 1DGJA 1WXQA 1YJIA 1FMAD 3AV8A 4KX6B 1VDVA 1FFVA 4C80A 1TKGA 1J7AA 1RM6C 2WU2B 4ITKA 1SF0A 1QLBB 3CWIA 3KWLA 1AWDA 3AN1A 3VRBB 1NENB 5EE0A 2MJEA 1PFDA 1VLBA 3NVZA 1N63A 2JX5A 3ETRA 3SFEB 1AYFA 4YTMB 1E6EB 1QOFA 1UWMA 3B2FA 2OHFA 2AX5A 2G1EA 2K5PA 2H88B 4US9A 1E10A 2BS2B 3AE9B 1A70A 2MH7A 3HRDD 2W3RA 2PKOA 1YQ3B 3CIRB
chains in the Genus database with same CATH superfamily
1PGXA 4FBJB 1E8ZA 4RGOS 3AULA 4TSSA 3A4RA 4L1BA 2IY1B 1D4BA 2BF8B 3RZFA 4NY0A 2HD5B 2MRPA 2IY0B 3RN9C 2OJWA 5H8YE 2LRUA 3KYCD 1NBFC 2BB5A 3GS2A 3SR6A 3Q69A 1WGGA 2K6QA 2KN5A 3JYUA 4BBNF 1YMHE 3IAS1 4XYCA 3PZ8A 4EZJA 3BWUD 2H89B 3ZUNA 2EKEC 1SSNA 2RPVA 2L7RA 3HVZA 3VUYA 3BIID 1RFAA 4IM0A 1WR1A 1FNVA 3N1ZC 2HJ1A 3RNGC 4EZKA 3TJPA 4RCOA 2RGFA 1FCCC 2WXPA 3AH7A 3APCA 4F7ZA 1YN3A 3BK2A 5HG2A 2OOBB 4PT5A 3DPDA 2AQ3B 5FK9C 3DVNU 2PJHA 2JRIB 2RDHA 4IDIA 1MFWA 2N7DA 1DGJA 4B95A 1VZ6A 1D6EC 2A5UA 4KZ0A 2Z0EB 3GE3C 2MH7A 2BTEA 4FJYA 3EECA 2CHXA 4KDIC 4FJZA 4NAWB 4RF0A 2ZCBA 1I4GA 4FHKA 2WDVB 4NQKE 4OZAA 1TBEA 2LHEA 3RMKC 4BKSD 2W55A 3T3NA 4IOIE 3WA0A 2PPHA 3RNFC 2N1WA 4HDOA 3RULA 4PS8A 2L76A 1JROA 4XX5A 2NPTB 1AARA 2B76B 1C3TA 1DOIA 4G3XB 5C3JB 1WE7A 4AJYB 4XGAB 3H7PA 3IT6B 2NS5A 3ECIA 2ONQA 3U7ZA 4E74A 1JW9D 3NVVA 2PVOD 3PTFC 2JPHA 4TQ1A 4LNFA 2FAZA 4FXCA 2FCMA 2DZMA 1JRPA 3J9CA 1UWXA 3GB1A 4PK1A 1H4RA 3CSTA 2YLMA 3Q14C 1SB3C 1V1PB 4BZAA 1HXYD 3N20C 1V6EA 4OVZA 2Z8LA 1WXMA 1P0RA 4LNIA 5GXGB 3AMZA 1D5ZC 1I4HA 1VDVA 4IWQA 1TKGA 1NDDA 5LXIB 2WU2B 3ZTDA 2O2VB 2K8BA 4W9LA 3IVFA 2FUHB 1E10A 2DLBA 3N1XC 2K3UA 1N5WA 3DBSA 1WMHB 1WZ0A 2WXNA 5BYSA 2JY6A 1NVID 2VH2A 4YSZB 4MGYE 3QC8B 1RRBA 3QAQA 4RFBA 2DZJA 3VUWA 3WANA 3UIOB 5J18A 4NJ6A 4A55A 1IBXB 4YSYB 2R2QA 5H92C 2INPE 4P1BC 4MDKE 1TKEA 4AOFA 4YTNB 1STEA 2B3AA 1FO4A 3GOEA 4OHJA 3TEXA 2KQ7A 3AU4A 3OG5A 4K3BA 2V1YA 3CF6E 3I3TB 2ZW0A 5E6NA 2L0FA 3FAHA 2D10A 3U8ZA 2GLSA 4ZDVA 1B9RA 2KN4A 3TSSA 4AQ7A 1JWAD 2KMCA 2MJDA 4YL8A 1P1AA 3Q8AA 3ZQ4A 1UZXB 4K7SA 3AU5A 5LXHA 1EF1A 1XD3B 4EE2A 1XO3A 2M0AA 3NZUA 1WYGA 2D07B 3TCAA 1BUIC 2EMSA 1I4XA 2UYZB 3PREA 4ANXA 4DHZE 1GUAB 2WNMA 3P42A 4K3CA 4W9IA 3FILA 2J42A 3LB8C 4DBGA 4IKGA 2VH1A 3MTNB 4ZHOA 1EU3A 1YJIA 1XF5L 1FFVA 4X57B 4M0WB 4W9GA 3ZRFA 3KWLA 1WJ6A 3NG0A 2EMTA 2GOWA 5C23A 3L0WB 3A9JA 2KYWA 3X0WA 3N32A 1MVKA 3I9V1 1FXTB 3C8YA 3DWGC 4TMAB 3IAM1 4W9HA 3QARA 1TZOA 1LGRA 4A20A 4GDLA 5G2NA 2J4XA 3I5JC 5DPSA 3U30A 2D3AA 3A1QB 1UUPA 3UQBA 4REZA 2LASA 2GI9A 4AP4C 1LQBA 1L0XB 3AEFB 2LRWA 2KHWB 3PZDA 1EM7A 2IO2B 3PRPB 2L52A 4NPNA 2LUMA 1HZ6A 2KC2A 1P9DU 4HVBA 1ROEA 1C1YB 5TSSA 3P63A 1SE4A 3NVWA 3L08A 1ZE3D 1XLNA 4HDQA 2K22A 1D5XC 4KV2A 2C60A 2ZNVC 4DDID 2BQQA 3ZNZB 1J7CA 3QA8A 2OJRA 1WWTA 2XK5A 1E8YA 3JSVA 2ZVNA 4KKIA 3RI7C 4MGZE 2CU3A 1E7PB 2RMMA 5EDSA 1L0VB 1YJ1A 4I6PA 4C7ZA 3DCGA 4GLSC 4GXBA 2BGFA 1F0ZA 3W5VB 1QKZA 3OWEB 3V6CB 4GDKA 3H7PB 4M00A 2G4SA 3ZXRA 1IYFA 2KWVB 3PS6A 1DYQA 1PFDA 1TT5B 3SFEB 4ZYSA 2AL3A 1QOFA 2QHOA 2ZVOA 3Q8BA 4US9A 3RT3B 3EFUA 1A70A 2PKOA 5IA7A 1VR9A 2AL6A 4JLCA 2FIFA 3DBLI 2WDRB 4XDDA 3AB5A 4HK2A 3L4PA 2N1VA 1NI2A 4RGTA 4RM9A 1UBIA 4OVUA 2ON8A 3E56A 2BYTA 1KLUD 5DPWA 1HEZE 4LLGM 2JXTA 2V4LA 4WJQA 4BKSA 1Q5WB 3HM6X 1UGJA 1IUEA 2Z59B 3VTUA 1R4NB 2KTRB 5EE9A 2FCSA 5EE1A 2FE8A 4JX1C 1HTQA 3IBEA 2BYFA 4P1CC 3ZNID 3AE8B 2JQRB 2RSUA 3N9YC 3DHGC 2WHIA 3O65B 5HI1A 2BYVE 3MP9A 3BVZA 3MJ5A 2I38A 3URYA 1UELA 2ACZB 3M63B 1Q10A 2EELA 3H9DA 4NJ7A 3B0AA 2LGXA 4ANVA 4P6VF 3BZDB 1YQ4B 5E6OA 3MC0B 4DK5A 4N6EB 1I35A 3HM3A 2M4NA 1UD7A 2LXAA 3WIMA 1JWBD 1YOVB 2BPSA 4J6IA 4Q2JA 3TIXA 4RH6A 2FIDA 4OW0A 4UDUC 5D3DA 2C7NB 4HWIB 4CO7A 1Y56A 2KNBA 2Z0DB 3AM9A 2KWCA 1V5OA 5IKCM 4RNAA 1WGDA 1RAXA 2QSDA 1WXQA 4GGQA 3ZJTA 5TR5A 2VRRB 4N9F4 1JMLA 2MJEA 1KOTA 1UH6A 1ISNA 2AX5A 2KACA 2K5PA 2ZW1A 2MWSB 2WDQB 1XLOA 2L1AA 2QILA 3TEYA 1YJJA 4DXFA 2D3BA 4DXGA 4LDTB 1WF9A 3RUIB 5IAAC 4OZBA 4BOZB 2MBOA 3KUZA 2TSSA 4E3CA 5GMVA 1ZXHA 3V62A 1WGHA 1SGHA 2KVZA 3NHEB 1WSPA 4LJOB 5KHQA 3A9JB 3ZJUA 4GN1A 4W9KA 1RFKA 1ZP0B 3BVMA 2BS3B 2ZJDA 2XEWA 2SAKA 4FJVB 4GDLB 2KJHB 2YVCA 1OEYJ 1N62A 3ML8A 4ARIA 4LJPB 3OJ4B 4BVUC 1AW7A 2QIEB 4LTUA 2RDBC 3W2DA 1GAQB 4K7UA 4IC7B 3PZ7A 1F2RC 4N58A 2NVUI 3KWVA 3N30A 4K1RB 4NZLB 4HXDA 2LGSA 3VFKA 2LMCA 1WRIA 1KTKA 3LXFA 3NVYA 4G0NB 2AWTA 5AEKB 2BKFA 1L4ZB 4XC2A 3ZNGC 1Z5SB 4KX6B 3TEWA 3V60A 3VXWA 1WXAA 4LNOA 1ZW7A 1AWDA 4JPSA 3V3XA 4MM3A 3NVZA 3QIJA 2XK5B 1SJHD 4R3DA 1FNUA 3JSVB 3UINB 2K39A 4KZCA 2PMVA 3Q3FA 2JU6X 2CJOA 3D32A 2QC8A 4CHKA 1MHHE 4WJNA 3PV1A 4HEA1 1FPYA 1T0YA 4KGSA 1H8CA 3VTWA 4HPPA 3TL5A 4B0EA 2WP9B 3A4SC 1P7FA 5CHWA 2KDEB 1GPXA 1YN4A 3ZTCA 4WQOB 3R66C 3QHTA 4WWPA 3BINA 3MC9A 3DWMA 2DNFA 3ENEA 2X8XX 2FCNA 2DBYA 3DBRI 4HCPB 1ET6A 2JWZA 2M19A 4KKJA 2W3SA 3ALBA 3I63C 3AE6B 4ZRIA 3U52E 5L95C 1IPGA 4B9KA 3ZYYX 1GC7A 2MP2A 3ZO5B 3W5UB 4LCDE 1MG8A 1L7YA 3NJTA 3NUHB 1HE8A 4RGMA 2CU1A 3M62B 2ZCCA 3U7DA 4KIKB 4QAYA 1EWCA 1Q0WB 2NTTA 1L4DB 1D3ZA 2WWZA 5D7GA 3U4EG 2FNJB 3VQIA 1TZ1A 1WRDB 1ZPSA 4WWNA 3N1YC 1VLBA 2KJ6A 2BS2B 3UQAA 5J17A 4JL9A 3SDLC 1FRDA 1WM3A 3OJ3A 3TBLD 1WY8A 3B08A 3ABVB 1P98A 3BVGA 3AI5A 3ZXVA 1MHXA 2L32A 2QJLA 3KUCB 2DAFA 3V61A 2IGDA 2NCNA 3S2AA 4CYEA 2BB6A 2D3CA 2JYTA 2KDBA 1IP9A 1PYWD 3RNAC 1EWYC 2CHWA 1PQSA 1V5TA 2GBKA 3MJWA 2L00B 2GRIA 4MJSA 3NS1A 4IM3A 3Q3OC 4FLHA 2ZEQA 4TKNA 4A3OA 3P4SB 1Z2MA 2BVCA 2G4DB 3P1MA 4FHJA 2DYOA 4RGNA 4YSXB 3GP7A 1U4AA 3SD5A 4E71A 2KMMA 1I7HA 1F77A 3OLMD 2D11A 3AE3B 5CTRC 1CQVA 2J0KA 5IN7A 1YQBA 4DHJD 2ICIA 1TS2A 2AQ1B 2LWPA 2GB1A 2ZPNA 1IGCA 4PS3A 4WWOA 2L05A 3AE5B 4FADA 3AEDB 2MX2A 2KANA 2M56B 4WIPA 4EKUA 4EEWA 2PVGC 2REXA 2RR9A 2FUG1 4BKGA 3L54A 2Q5WD 1E9MA 3C19A 2KFKA 2IZVB 2BWES 2L0TA 3AV8A 2QMTA 4HJGE 1KJTA 3WAMA 1JWMD 3K9OB 4PS7A 2N7JA 3ETRA 1HQRD 4DXAB 3UGBB 3AE9B 3QX1A 2RPQA 2J53A 5CHFA 3R2IA 4A6QA 4S0RA 4WJPA 1WJNA 2NBUA 3RZWC 1XCQL 2O6VD 4HPMB 1N60A 2LJ5A 1PGBA 4MGKE 1QILA 3IXSA 5D2MB 3T8MA 4P7IA 2BWFA 4MGIE 1ACCA 1WXSA 1C4AA 3RD2A 3NZ3A 2W9NA 4MM3B 2IDYA 3BYYB 1N5XA 4NNJB 4ANWA 4DWFA 2MBHA 1Q1OA 3UI3A 1R4MB 3L16A 1F1HA 5IO9A 2SEBD 2GMIC 2KJRA 3AE7B 2V3PA 5IP4D 1J19A 3W1SC 3EGRA 2JZ3B 1KLGD 3RNCC 1WXVA 3IFWB 1EO6A 1XEEA 3NZSA 3RNEC 2X38A 1C4CA 2WDTB 2XN9C 1L5PA 2ZZPB 4PYZA 3EA6A 1VZ8A 3MHZA 3TEZA 1RYJA 1WFYA 1WGYA 3DVGY 4DHZB 1EU4A 1F52A 1WX7A 1QZEA 1R4MI 1TJEA 1KF6B 5G5GA 1YNTE 2J0MA 3B9JA 5E6JA 1KM7A 3AXCA 1RLFA 2HDEA 3QWZB 5CHVC 4NJCA 3CWIA 3C0RB 3VRBB 2KKCA 2N9KA 3CSFA 3L10B 3DBLB 3Q3JA 2MP2B 3DOWA 4ZRQA 1K52A 2PLPA 4XZ4A 1YQ3B 4KDLB 2VZKD 2PIAA 1BXTA 4ZRJA 2N9LA 2N9EB 3Q8CA 2IGHA 3SHQA 3PRMB 1EF5A 2LJIA 2DZKA 1E7VA 2HTME 4AS1A 4TV3A 5E6PA 4A90A 2JZPA 2IBIB 2IJ0A 3OAWA 1Y8RC 4S17A 4KVGB 2W54A 1OTRB 1UBQA 2WXGA 2KK8A 3Q8FA 4DDGD 2WXHA 4RM8A 2PE6B 5BMIA 1SIFA 4II3B 3GZNI 2R2OA 4NAWA 2UU7A 3A33B 3EHVA 4OZCA 3MFGA 5JH5C 1WZ3A 4TUUA 3DQVA 1V86A 4TQ0A 1OEYA 1CK1A 3ML9A 2MBBB 2AEHA 2MHJA 1J8CA 2WLBA 4MELA 2WU5B 2WXKA 5BYRA 4MJSB 3R3MA 3AECB 2DZIA 1N6ZA 2WX1A 4I6LB 1T3QA 1XXGA 2NPTA 1WE6A 4L23A 2BT6A 2DX5B 1FD6A 1DOXA 3ZVVA 2NMQA 4HRSA 4XDCA 2C7HA 2IGGA 5L83A 1LXDA 3L17A 4HKZE 1SJED 3KH0A 1J7AA 2GBJA 4CQNA 1JWSD 3AN1A 1HTOA 2JRHA 5EE0A 1SE3A 1MPEA 5D94A 4M8MA 1E8WA 4K7WA 2C5LC 2LGYA 5LNK1 1TY2A 2MW5A 1WM2A 1T6BX 2FCQA 2WQYB 2M0XA 4D2KA 2D3GA 4JGHB 2L83A 3VHTC 1V1PA 4JIOU 3CMMB 4WH4A 4BFRA 4C00A 2MLBA 2WS3B 2XNAC 1V9JA 4WWMA 4NQLB 2YEPF 3DBHI 4FULA 2KO3A 5C1ZA 1I4RA 2MBQA 1T0QC 2HJ8A 1B1ZA 2I1KA 5KHOA 2JSVX 2O2VA 2UWQA 2EKIA 1J7BA 2CR5A 1P7EA 4LDTD 2IO3B 3DVNV 1ZUD2 3DVGX 3VAWA 1C4PA 1OFFA 4EUTA 2MBEA 3FILB 1WMHA 2NBWB 3W9CB 4HKQA 2G45B 1QF6A 2K25A 3SEBA 3P2BA 1S3SG 3ZGZA 1I42A 3JW0X 3VDZA 1WJUA 3BY4B 3PGEA 1QOAA 4JE3B 5C2TB 1VZ7A 4ARCA 1IBXA 1NYQA 3RFZB 2JWUA 4AJWA 1ZXIA 3WAPA 3R2TA 1WH3A 4EOYA 3PLVA 3PT2B 3ONSA 3RCZA 1PDXA 3KQ4A 1BMLC 4H2AA 3FKYA 5HHDG 1FCLA 2BYEA 1QLBB 2WXOA 3VUXA 4YTMB 2K8CA 4MH8A 1I4PA 3PPAA 1UWMA 2OHFA 4GOCA 2G1EA 3BYTB 1IGDA 2KXJA 2WXFA 4US8A 3AEEB 2INNE 2LHDA 1E5WA 2NTSA 3PLUA 3EFCA 1TKYA 2N7EA 1GG3A 2N0SB 2KVRA 4FN2A 1V8CA 4WAAA 4M0WA 3QCAA 4ICVA 3NOBA 2O6VA 1LO5D 3UIPB 3DDCB 1VRAB 2DAJA 2M8SA 4WAFA 1HA5A 3DBRB 1SE9A 3GE8C 2CS4A 2J7QB 1XCTL 2INDC 1T0SC 1NYRA 2JVCA 2DWQA 2OEDA 2DENB 4GDKB 3QK0A 4HCNB 3A1QA 1SEBD 5BYQA 2HE7A 2K0PA 1QT9A 2KAJA 4YT0B 3VTVA 5AUIA 1GOZA 1JWUD 3ZIMA 4XWWA 3N3KB 1ZOYB 2KQ4X 4YTPB 3B1LX 1N61A 3B2GA 2KQSA 2MQJA 1HZ5A 3APFA 2KC1A 3ZDMC 1FXAA 3KYDD 3Q2AC 1VCBA 3Q8EA 4MACA 4P16A 1FMAD 5LLIA 3V05A 4EFOA 4C4VA 1V80A 5J2RA 5D3IB 3HVDA 3ZNHB 3I57A 4LK0M 4EZLA 4FA6A 2WXMA 4ASWC 3ZLZA 4A9AA 1FEHA 5DPRA 3AEAB 1GB4A 2IO0B 4ZOHC 4ZRKA 2E3TA 1M4VA 2KDFB 1KLVA 1FRRA 3WALA 4HLEA 1XT9B 3ZDTA 4ZHPA 1D5MC 2KX3A 4YWGG 3AE4B 3NRZA 3T3OA 1TGZB 3IT4B 1F2RI 1XLQA 3PRZA 1VJKA 3W1SA 4RMAA 5G5HA 2LGDA 1SIJA 2XBBC 1G6JA 2QEJC 1C79A 1K50A 4JWSC 4USAA 4BAXA 2IYDB 4J3OD 1AN8A 1M94A 2AYOB 1FFUA 2V3SA 4GMVA 2E6XA 4JWUC 1WI0A 1ZKHA 2CJNA 3HIZA 1E90A 4M02A 2DYBA 5T8IA 3A9KA 2Y5PA 5AZFA 2V0GA 3QQ8B 3HK0A 1MI0A 2D2QA 2IPKD 4AWJA 1YD8U 2KTRA 2MEKA 2M17A 1JRUA 5BO4B 2RDGA 2LFIA 4GB9A 4LNKA 4O1NA 1V49A 4WJOA 1KFYB 1PGAA 1RWSA 1WIAA 5AZGA 5IOIA 1ZGUB 2CHZA 1LFDA 2N9XA 1LM8B 3H7SA 2QDFA 3SU8X 1K8RB 2PEAA 2LZ6A 4ICUA 4LNNA 1J0GA 2INCC 4W9CA 3TUOA 1N63A 2JX5A 1C77A 4PYUA 2LVQA 4MT5A 2W82A 3HRDD 1WR6E 4IUMB 2C9WB 3WAOA 2JYEA 5DPTA 4OVVA 1YIWA 3ZRCA 3P4QB 4IG7B 2K9XA 1WGKA 4M01A 1ZDVA 1L6VA 4L2YA 2L3ZA 1S1QB 4MH0E 2KWDA 4RF1A 4DHJB 1I4QA 2CKHB 1ZDXA 4MEMA 3X23A 1TS5A 2MJ3A 2K6DB 2LXCA 5BMHA 2BS4B 2KMAA 2JZZA 2WXLA 3VR9B 1SXTA 2WXRA 3FC4A 2C7MB 5FR6A 2D5GA 1NEKB 4YXDB 3VR8B 3V6EB 3VVWB 3SFDB 2N9PC 4B0MA 4HPLB 3PVLA 1A5RA 1V1OA 3Q3MC 2ZPYA 2L8JA 3AEGB 2KZRA 1K53A 1C76A 1WX9A 1SBBB 1CJEA 3Q3NC 1FIQA 1ESFA 1C78A 1GJZA 2KLGA 2LVPA 2J0JA 1FXIA 1V2YA 3P4RB 1NI3A 4F1SA 1YN5A 5JHAA 2I2YA 2LD9A 3AE2B 1WGRA 2BW2A 4C56C 2O6VB 2NR2A 2WGSA 2KLCA 4A3PA 2N4FA 4C7YA 3JVZX 4URKA 4ZYNA 2KWUB 1UNSA 4ACFA 2KTFA 3Q6BA 3KLSX 1MG4A 2JF5A 2K8HA 1QQRA 3MC8A 3PO0A 1R7SA 3HUIA 4WQMA 1ENFA 5HFYA 3HHMA 1WX8A 2WXQA 4GU2A 4II2B 1C9FA 4BKTA 1T0RC 4I6NB 1TTNA 1P3QU 1SF0A 2PTLA 1NENB 1MJDA 2LUEA 2MCNB 2KT7A 1WJ4A 4IWOA 3VH3B 2IO1B 1TS4A 1X1MA 2W3RA 3T9LA 3U2SC 3TMPB 3CIRB 3MHSD 3NS8A 2Y5CA 3W1YA 1FM0D 5JXVA 1JALA 1TIFA 3VH4B 3M95A 1OQQA 5DCNA 3O13A 2KFJA 2V3NA 1KRHA 2V9HA 1KH0A 2G9HD 1L0YB 1TYGB 3R7RA 2WXJA 4C4VB 2KX0A 2QCZA 3GZNB 2NBVB 4DQOC 1GNUA 2KOXA 1T5XD 4W9DA 3WCQA 5JZEB 4MSQB 1CMXB 1GC6A 2PE9A 1YX6B 4A8XC 2JUOA 1L6UA 2RD0A 5EE3A 1L2NA 2VZKB 3ZJVA 3R8BA 1TY0A 1OQYA 3H6NA 4IWPA 3RPFC 4IM2A 3RNBC 1CZPA 5FKAC 4ZRPA 1E0ZA 2GBNA 3VRAB 3PHXB 1JQ4A 3DHHC 2G3QB 1UF0A 5G55A 5JHBA 2KDIA 4JQWC 3EUB2 5FR3A 2BKRB 3DHIC 3E9SA 3QJZA 3ZKJC 4K81A 2AQ2B 4KGRA 2HTHA 4C80A 1RM6C 2PW9A 2DHZA 2LI5A 4G50A 3K9PB 3KW5B 3A9KB 1AYFA 2I1JA 1E6EB 2H88B 2MSED 2ZNVB 2R61A 3L13A 2LGIA 3DBHB 4KSLC 2MA9B 4WURA 1JCKB 3PHWB 2WXIA 4XE0A 3KUDB 3P4PB 4KIKA 1FNWA 5CX3A 1QOBA 5AZHA 3R7QA 1EUVB 3ZW3A 3IHPC 4F8CB 4B6WA 4IW0A 1GB1A 4AUQC 1ET9A 1K51A 1XLPA 3RYTA 3H8HA 4W9EA 5D6JB 2YEPB 1YX5B 1E8XA 4BBNC 4W9JA 2Y3AA 2M1MA 4ANUA 4HROA 2WX0A 2BBCA 3LJ3A 1V97A 4KSKC 2K1FA 4BOSC 5I4DA 1E7UA 3PSEB 1R4NI 2WYQA 2KFKB 3NY5A 3AEBB 2ASQA 5AUKA 1F9JA 3UF8A 1VD2A 2JXXA 2Y5BB 5BMGA 3IG3A 1SE2A 1OGWA 3LDZE 1UGMA 3H1UA 1OQRA 2LVOA 1BT0A 1PUTA 4M8NA 2FBWB 1QOGA 2KD0A 4MSMB 3EC8A 4KGTA 2J52A 3M3JA 5HKHA 4N59A 1DOYA 4HJKA 4NAMA 1TS3A 2JT4B 3AE1B 2LEKA 3BK1A 2A4ZA 1V81A 2GBMA 2GBRA 1WYWB 1XQQA 2V4IB 5MPOA 3KVFB 4ITKA 4GIVA 4GSWA 2KDMA 4W9FA 4G11A 2DYMA 3LYYA 3APDA 4XWTA 3B2FA
chains in the Genus database with same CATH topology
1VR9A 1PGXA 3R2IA 1FEHA 3AEAB 1GB4A 4A6QA 4ZOHC 2WDRB 4XDDA 2E3TA 3AB5A 1M4VA 4RGOS 3L4PA 1XCQL 4RGTA 1FRRA 4TSSA 1N60A 4L1BA 2ON8A 3E56A 4ZHPA 1D4BA 1D5MC 1PGBA 4YWGG 1QILA 2BYTA 1KLUD 3AE4B 3IXSA 3NRZA 3T3OA 1HEZE 4LLGM 3IT4B 1F2RI 1ACCA 2JXTA 1XLQA 1VJKA 1C4AA 5H8YE 3NZ3A 1UGJA 4MM3B 1IUEA 2IDYA 3W1SA 3BYYB 1N5XA 2BB5A 5EE9A 3GS2A 3SR6A 5EE1A 5G5HA 3UI3A 2FE8A 4JX1C 1SIJA 3Q69A 2QEJC 2SEBD 1C79A 3AE8B 2JQRB 3N9YC 1YMHE 1K50A 4JWSC 4USAA 3IAS1 3PZ8A 5HI1A 3AE7B 2V3PA 3BWUD 2H89B 3MP9A 3BVZA 3MJ5A 2I38A 4J3OD 3EGRA 3URYA 2ACZB 1SSNA 1AN8A 1KLGD 1Q10A 1FFUA 2EELA 2RPVA 3HVZA 2E6XA 4JWUC 2CJNA 1XEEA 2X38A 3BIID 1C4CA 5T8IA 2Y5PA 2XN9C 1L5PA 4P6VF 3BZDB 2V0GA 1YQ4B 1MI0A 1FNVA 3EA6A 3MC0B 4N6EB 1VZ8A 3MHZA 3TEZA 1RYJA 2IPKD 4RCOA 1JWBD 2MEKA 4Q2JA 1FCCC 4RH6A 2WXPA 3AH7A 1EU4A 4OW0A 2RDGA 4UDUC 1YN3A 2LFIA 3BK2A 5HG2A 5D3DA 1TJEA 4PT5A 4O1NA 1KF6B 1Y56A 1KFYB 1PGAA 1RWSA 2AQ3B 3AM9A 5FK9C 1YNTE 5G5GA 4RNAA 2RDHA 4IDIA 3B9JA 1DGJA 2QSDA 1WXQA 5E6JA 3ZJTA 1VZ6A 2HDEA 4NJCA 3CWIA 3VRBB 1JMLA 1D6EC 2N9KA 2MJEA 3TUOA 1N63A 2JX5A 1C77A 2AX5A 2KACA 2K5PA 2ZW1A 4MT5A 4ZRQA 1K52A 2PLPA 2W82A 2MH7A 3HRDD 2BTEA 1YQ3B 2JYEA 2WDQB 1XLOA 2L1AA 2QILA 3TEYA 1YJJA 2VZKD 3P4QB 4DXFA 2K9XA 1BXTA 2PIAA 2N9LA 4DXGA 1WGKA 1ZDVA 4NAWB 4RF0A 1L6VA 4L2YA 3Q8CA 1I4GA 2IGHA 2KWDA 2LJIA 2WDVB 4OZAA 4RF1A 1I4QA 2HTME 2LHEA 4OZBA 1ZDXA 4AS1A 1TS5A 2MJ3A 2TSSA 2W55A 4A90A 1ZXHA 3T3NA 5BMHA 2BS4B 2JZPA 2WXLA 2IJ0A 3VR9B 4IOIE 1SXTA 2WXRA 3FC4A 2D5GA 2W54A 1WSPA 1NEKB 4YXDB 3VR8B 2WXGA 3Q8FA 3SFDB 1JROA 3ZJUA 4B0MA 2WXHA 1RFKA 1ZP0B 1V1OA 3BVMA 5BMIA 2BS3B 2B76B 1DOIA 2SAKA 3AEGB 5C3JB 1K53A 4GDLB 1C76A 3IT6B 4OZCA 1SBBB 1CJEA 3MFGA 1N62A 1FIQA 4ARIA 1ESFA 1C78A 2ONQA 3U7ZA 1JW9D 3NVVA 2PVOD 1AW7A 4TQ0A 2QIEB 1FXIA 4LTUA 1CK1A 3P4RB 1NI3A 4TQ1A 1YN5A 2I2YA 3AE2B 3W2DA 2BW2A 1GAQB 4C56C 4FXCA 2WLBA 1JRPA 3J9CA 1UWXA 2WU5B 3GB1A 2WXKA 3PZ7A 1F2RC 4N58A 5BYRA 4C7YA 3AECB 3KWVA 1UNSA 3KLSX 1SB3C 1T3QA 1V1PB 1XXGA 1HXYD 4NZLB 4L23A 1QQRA 2BT6A 4OVZA 1FD6A 1DOXA 2Z8LA 3PO0A 1R7SA 3HUIA 2NMQA 4WQMA 2LMCA 1WRIA 4HRSA 1KTKA 3LXFA 1ENFA 3NVYA 4XDCA 5HFYA 2WXQA 1L4ZB 5GXGB 2IGGA 3AMZA 1D5ZC 1C9FA 1I4HA 4HKZE 1VDVA 4KX6B 1SJED 3TEWA 1TKGA 1J7AA 2WU2B 2PTLA 1SF0A 4CQNA 1AWDA 1JWSD 3AN1A 1NENB 4JPSA 3V3XA 5EE0A 1SE3A 1MPEA 3NVZA 1SJHD 4R3DA 5LNK1 1E10A 1FNUA 1TY2A 2DLBA 1TS4A 1T6BX 2W3RA 3U2SC 3CIRB 2Y5CA 2WQYB 2PMVA 4D2KA 2K3UA 1FM0D 1N5WA 2JU6X 5JXVA 2CJOA 1JALA 2L83A 1V1PA 2WXNA 1MHHE 5BYSA 4WH4A 2WS3B 2XNAC 1OQQA 1NVID 4WWMA 4YSZB 4HEA1 3O13A 2YEPF 2V3NA 4RFBA 1KRHA 1I4RA 1KH0A 4KGSA 2G9HD 1B1ZA 1L0YB 1TYGB 2WXJA 2JSVX 4B0EA 4A55A 2WP9B 1IBXB 4YSYB 2EKIA 5H92C 2INPE 1J7BA 1P7EA 1P7FA 1TKEA 4DQOC 4YTNB 1STEA 1FO4A 1GPXA 1YN4A 1ZUD2 4OHJA 1C4PA 1OFFA 1T5XD 3TEXA 3WCQA 3FILB 3DWMA 3W9CB 2ZW0A 3FAHA 4HKQA 4A8XC 1QF6A 2DBYA 3SEBA 1B9RA 1L6UA 2KN4A 3TSSA 4AQ7A 1JWAD 3ZGZA 1ET6A 2M19A 4KKJA 2MJDA 2W3SA 5EE3A 2VZKB 3AE6B 3U52E 3ZJVA 3ZQ4A 3Q8AA 3R8BA 1TY0A 3ZYYX 3RPFC 1QOAA 4JE3B 1CZPA 5FKAC 4EE2A 1XO3A 5C2TB 2M0AA 1VZ7A 3W5UB 4ZRPA 4ARCA 1IBXA 1NYQA 1E0ZA 1WYGA 3VRAB 3RFZB 2JWUA 3NUHB 1ZXIA 1JQ4A 1BUIC 4RGMA 1I4XA 3R2TA 2WNMA 3P42A 3EUB2 5FR3A 1EWCA 3FILA 1PDXA 2J42A 2NTTA 1L4DB 3LB8C 3E9SA 3KQ4A 1BMLC 4IKGA 4H2AA 2AQ2B 4KGRA 5D7GA 5HHDG 3U4EG 1EU3A 4ZHOA 3VQIA 1YJIA 1FCLA 1XF5L 4C80A 1FFVA 1RM6C 2PW9A 1ZPSA 1QLBB 3KWLA 2WXOA 1VLBA 4YTMB 4MH8A 1AYFA 1I4PA 1E6EB 1UWMA 2OHFA 2G1EA 3BYTB 2H88B 1IGDA 2BS2B 1MVKA 2R61A 3I9V1 3C8YA 3DWGC 4TMAB 2LGIA 2WXFA 4US8A 3IAM1 4WURA 1FRDA 1TZOA 3AEEB 2INNE 1JCKB 2LHDA 2WXIA 4XE0A 2J4XA 2NTSA 3ABVB 3P4PB 3BVGA 1MHXA 1FNWA 2L32A 2QJLA 1TKYA 1QOBA 2IGDA 2BB6A 2N0SB 1UUPA 2JYTA 1V8CA 4REZA 1GB1A 1PYWD 2GI9A 1ET9A 1K51A 1EWYC 1XLPA 4M0WA 3H8HA 1LO5D 1L0XB 2GRIA 1VRAB 2YEPB 3NS1A 3AEFB 4WAFA 1HA5A 2Y3AA 1EM7A 3P4SB 4HROA 2BBCA 2L52A 2LUMA 1HZ6A 1V97A 3P1MA 1XCTL 2DYOA 1ROEA 5I4DA 5TSSA 1NYRA 2DWQA 3AEBB 3P63A 2OEDA 1SE4A 3NVWA 4GDKB 1ZE3D 4RGNA 1XLNA 5AUKA 4YSXB 2K22A 1D5XC 3GP7A 5BMGA 1SEBD 5BYQA 2K0PA 1SE2A 1QT9A 2KAJA 1I7HA 2KMMA 1F77A 4YT0B 1J7CA 5AUIA 1GOZA 1JWUD 1WWTA 3AE3B 4XWWA 1CQVA 1ZOYB 2KQ4X 4YTPB 1OQRA 2ICIA 4KKIA 1PUTA 1TS2A 2AQ1B 1N61A 2CU3A 2FBWB 1E7PB 2RMMA 1QOGA 2GB1A 1IGCA 1L0VB 3B2GA 4KGTA 4C7ZA 3AE5B 2J52A 3AEDB 4N59A 1DOYA 4GLSC 2M56B 4NAMA 1HZ5A 1TS3A 4WIPA 2PVGC 3AE1B 2FUG1 2LEKA 3BK1A 2Q5WD 1E9MA 1FXAA 3W5VB 4MACA 1QKZA 3OWEB 3Q8EA 1F0ZA 4P16A 5MPOA 2V4IB 1FMAD 3AV8A 3V05A 2QMTA 4HJGE 4ITKA 1JWMD 1DYQA 5D3IB 1PFDA 2N7JA 3ETRA 3HVDA 3SFEB 3I57A 4ZYSA 2KDMA 1QOFA 4LK0M 2DYMA 1HQRD 3Q8BA 4US9A 3LYYA 2WXMA 3AE9B 1A70A 4XWTA 3B2FA 2PKOA 4A9AA 2J53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WDQ B;  2Y5C A;  1XLO A;  4US8 A;  2WQY B;  1YJJ A;  3AEA B;  3P4Q B;  1FRD A;  2K9X A;  2PIA A;  1FM0 D;  1N5W A;  3AEE B;  2CJO A;  1JAL A;  1WGK A;  2L83 A;  4ZOH C;  1L6V A;  2WDR B;  2E3T A;  3AB5 A;  3ABV B;  3L4P A;  3P4P B;  2WS3 B;  1OQQ A;  1NVI D;  2WDV B;  2QJL A;  4WWM A;  4YSZ B;  1TKY A;  2HTM E;  1FRR A;  1QOB A;  1N60 A;  2N0S B;  1KRH A;  2MJ3 A;  2W55 A;  4ZHP A;  1V8C A;  3AE4 B;  1EWY C;  1XLP A;  2BS4 B;  3NRZ A;  3VR9 B;  1TYG B;  3FC4 A;  1XLQ A;  2WP9 B;  4YSY B;  1VJK A;  2W54 A;  1NEK B;  2EKI A;  5H8Y E;  5H92 C;  3VR8 B;  1J7B A;  3NS1 A;  4YXD B;  1IUE A;  3AEF B;  3SFD B;  1N5X A;  5EE9 A;  1TKE A;  4YTN B;  1JRO A;  3SR6 A;  5EE1 A;  1FO4 A;  3P4S B;  4HRO A;  1GPX A;  5G5H A;  4JX1 C;  1RFK A;  1ZUD 2;  1SIJ A;  1ZP0 B;  2L52 A;  4A9A A;  1V97 A;  1OFF A;  2BS3 B;  3P1M A;  3WCQ A;  2B76 B;  3AE8 B;  2JQR B;  3DWM A;  1DOI A;  1ROE A;  3AEG B;  4JWS C;  4USA A;  5C3J B;  4YT0 B;  3AE7 B;  3W9C B;  3FAH A;  2H89 B;  1NYR A;  4JWU C;  2DWQ A;  3AEB B;  3P63 A;  2DBY A;  3NVW A;  5AUK A;  1QF6 A;  2ACZ B;  1XLN A;  4YSX B;  1CJE A;  2K22 A;  1B9R A;  1L6U A;  1N62 A;  1FIQ A;  1FFU A;  1JWA D;  3HVZ A;  1QT9 A;  2KAJ A;  1I7H A;  2CJN A;  2KMM A;  1JW9 D;  2M19 A;  2MJD A;  1J7C A;  2PVO D;  2W3S A;  3AE6 B;  3BII D;  3NVV A;  5EE3 A;  5AUI A;  2QIE B;  1FXI A;  1WWT A;  3AE3 B;  4LTU A;  3P4R B;  1L5P A;  1NI3 A;  4P6V F;  3ZYY X;  3DWG C;  3AE2 B;  1YQ4 B;  3RPF C;  1ZOY B;  4YTP B;  1QOA A;  1GAQ B;  1CZP A;  2WLB A;  4FXC A;  1JRP A;  1OQR A;  1XO3 A;  5C2T B;  4N6E B;  3W5U B;  2WU5 B;  1NYQ A;  1PUT A;  1E0Z A;  4N58 A;  1WYG A;  3VRA B;  1RYJ A;  4C7Y A;  1N61 A;  2CU3 A;  2FBW B;  1E7P B;  1JWB D;  1QOG A;  1ZXI A;  3AEC B;  1JQ4 A;  1L0V B;  3B2G A;  3AH7 A;  4C7Z A;  1SB3 C;  1T3Q A;  3AE5 B;  3AED B;  4N59 A;  1DOY A;  2BT6 A;  2M56 B;  3EUB 2;  1TJE A;  1DOX A;  3PO0 A;  2PVG C;  1KF6 B;  1R7S A;  1PDX A;  1KFY B;  3AE1 B;  3HUI A;  4WQM A;  1RWS A;  3LB8 C;  2LEK A;  1WRI A;  3AM9 A;  3LXF A;  3NVY A;  2Q5W D;  4HRS A;  5G5G A;  1E9M A;  1FXA A;  3W5V B;  1F0Z A;  5GXG B;  4IDI A;  3AMZ A;  3B9J A;  4ZHO A;  5MPO A;  1DGJ A;  1WXQ A;  1YJI A;  1FMA D;  3AV8 A;  4KX6 B;  1VDV A;  1FFV A;  4C80 A;  1TKG A;  1J7A A;  1RM6 C;  2WU2 B;  4ITK A;  1SF0 A;  1QLB B;  3CWI A;  3KWL A;  1AWD A;  3AN1 A;  3VRB B;  1NEN B;  5EE0 A;  2MJE A;  1PFD A;  1VLB A;  3NVZ A;  1N63 A;  2JX5 A;  3ETR A;  3SFE B;  1AYF A;  4YTM B;  1E6E B;  1QOF A;  1UWM A;  3B2F A;  2OHF A;  2AX5 A;  2G1E A;  2K5P A;  2H88 B;  4US9 A;  1E10 A;  2BS2 B;  3AE9 B;  1A70 A;  2MH7 A;  3HRD D;  2W3R A;  2PKO A;  1YQ3 B;  3CIR B; 
#chains in the Genus database with same CATH topology
 1PGX A;  4FBJ B;  1E8Z A;  4RGO S;  3AUL A;  4TSS A;  3A4R A;  4L1B A;  2IY1 B;  1D4B A;  2BF8 B;  3RZF A;  4NY0 A;  2HD5 B;  2MRP A;  2IY0 B;  3RN9 C;  2OJW A;  5H8Y E;  2LRU A;  3KYC D;  1NBF C;  2BB5 A;  3GS2 A;  3SR6 A;  3Q69 A;  1WGG A;  2K6Q A;  2KN5 A;  3JYU A;  4BBN F;  1YMH E;  3IAS 1;  4XYC A;  3PZ8 A;  4EZJ A;  3BWU D;  2H89 B;  3ZUN A;  2EKE C;  1SSN A;  2RPV A;  2L7R A;  3HVZ A;  3VUY A;  3BII D;  1RFA A;  4IM0 A;  1WR1 A;  1FNV A;  3N1Z C;  2HJ1 A;  3RNG C;  4EZK A;  3TJP A;  4RCO A;  2RGF A;  1FCC C;  2WXP A;  3AH7 A;  3APC A;  4F7Z A;  1YN3 A;  3BK2 A;  5HG2 A;  2OOB B;  4PT5 A;  3DPD A;  2AQ3 B;  5FK9 C;  3DVN U;  2PJH A;  2JRI B;  2RDH A;  4IDI A;  1MFW A;  2N7D A;  1DGJ A;  4B95 A;  1VZ6 A;  1D6E C;  2A5U A;  4KZ0 A;  2Z0E B;  3GE3 C;  2MH7 A;  2BTE A;  4FJY A;  3EEC A;  2CHX A;  4KDI C;  4FJZ A;  4NAW B;  4RF0 A;  2ZCB A;  1I4G A;  4FHK A;  2WDV B;  4NQK E;  4OZA A;  1TBE A;  2LHE A;  3RMK C;  4BKS D;  2W55 A;  3T3N A;  4IOI E;  3WA0 A;  2PPH A;  3RNF C;  2N1W A;  4HDO A;  3RUL A;  4PS8 A;  2L76 A;  1JRO A;  4XX5 A;  2NPT B;  1AAR A;  2B76 B;  1C3T A;  1DOI A;  4G3X B;  5C3J B;  1WE7 A;  4AJY B;  4XGA B;  3H7P A;  3IT6 B;  2NS5 A;  3ECI A;  2ONQ A;  3U7Z A;  4E74 A;  1JW9 D;  3NVV A;  2PVO D;  3PTF C;  2JPH A;  4TQ1 A;  4LNF A;  2FAZ A;  4FXC A;  2FCM A;  2DZM A;  1JRP A;  3J9C A;  1UWX A;  3GB1 A;  4PK1 A;  1H4R A;  3CST A;  2YLM A;  3Q14 C;  1SB3 C;  1V1P B;  4BZA A;  1HXY D;  3N20 C;  1V6E A;  4OVZ A;  2Z8L A;  1WXM A;  1P0R A;  4LNI A;  5GXG B;  3AMZ A;  1D5Z C;  1I4H A;  1VDV A;  4IWQ A;  1TKG A;  1NDD A;  5LXI B;  2WU2 B;  3ZTD A;  2O2V B;  2K8B A;  4W9L A;  3IVF A;  2FUH B;  1E10 A;  2DLB A;  3N1X C;  2K3U A;  1N5W A;  3DBS A;  1WMH B;  1WZ0 A;  2WXN A;  5BYS A;  2JY6 A;  1NVI D;  2VH2 A;  4YSZ B;  4MGY E;  3QC8 B;  1RRB A;  3QAQ A;  4RFB A;  2DZJ A;  3VUW A;  3WAN A;  3UIO B;  5J18 A;  4NJ6 A;  4A55 A;  1IBX B;  4YSY B;  2R2Q A;  5H92 C;  2INP E;  4P1B C;  4MDK E;  1TKE A;  4AOF A;  4YTN B;  1STE A;  2B3A A;  1FO4 A;  3GOE A;  4OHJ A;  3TEX A;  2KQ7 A;  3AU4 A;  3OG5 A;  4K3B A;  2V1Y A;  3CF6 E;  3I3T B;  2ZW0 A;  5E6N A;  2L0F A;  3FAH A;  2D10 A;  3U8Z A;  2GLS A;  4ZDV A;  1B9R A;  2KN4 A;  3TSS A;  4AQ7 A;  1JWA D;  2KMC A;  2MJD A;  4YL8 A;  1P1A A;  3Q8A A;  3ZQ4 A;  1UZX B;  4K7S A;  3AU5 A;  5LXH A;  1EF1 A;  1XD3 B;  4EE2 A;  1XO3 A;  2M0A A;  3NZU A;  1WYG A;  2D07 B;  3TCA A;  1BUI C;  2EMS A;  1I4X A;  2UYZ B;  3PRE A;  4ANX A;  4DHZ E;  1GUA B;  2WNM A;  3P42 A;  4K3C A;  4W9I A;  3FIL A;  2J42 A;  3LB8 C;  4DBG A;  4IKG A;  2VH1 A;  3MTN B;  4ZHO A;  1EU3 A;  1YJI A;  1XF5 L;  1FFV A;  4X57 B;  4M0W B;  4W9G A;  3ZRF A;  3KWL A;  1WJ6 A;  3NG0 A;  2EMT A;  2GOW A;  5C23 A;  3L0W B;  3A9J A;  2KYW A;  3X0W A;  3N32 A;  1MVK A;  3I9V 1;  1FXT B;  3C8Y A;  3DWG C;  4TMA B;  3IAM 1;  4W9H A;  3QAR A;  1TZO A;  1LGR A;  4A20 A;  4GDL A;  5G2N A;  2J4X A;  3I5J C;  5DPS A;  3U30 A;  2D3A A;  3A1Q B;  1UUP A;  3UQB A;  4REZ A;  2LAS A;  2GI9 A;  4AP4 C;  1LQB A;  1L0X B;  3AEF B;  2LRW A;  2KHW B;  3PZD A;  1EM7 A;  2IO2 B;  3PRP B;  2L52 A;  4NPN A;  2LUM A;  1HZ6 A;  2KC2 A;  1P9D U;  4HVB A;  1ROE A;  1C1Y B;  5TSS A;  3P63 A;  1SE4 A;  3NVW A;  3L08 A;  1ZE3 D;  1XLN A;  4HDQ A;  2K22 A;  1D5X C;  4KV2 A;  2C60 A;  2ZNV C;  4DDI D;  2BQQ A;  3ZNZ B;  1J7C A;  3QA8 A;  2OJR A;  1WWT A;  2XK5 A;  1E8Y A;  3JSV A;  2ZVN A;  4KKI A;  3RI7 C;  4MGZ E;  2CU3 A;  1E7P B;  2RMM A;  5EDS A;  1L0V B;  1YJ1 A;  4I6P A;  4C7Z A;  3DCG A;  4GLS C;  4GXB A;  2BGF A;  1F0Z A;  3W5V B;  1QKZ A;  3OWE B;  3V6C B;  4GDK A;  3H7P B;  4M00 A;  2G4S A;  3ZXR A;  1IYF A;  2KWV B;  3PS6 A;  1DYQ A;  1PFD A;  1TT5 B;  3SFE B;  4ZYS A;  2AL3 A;  1QOF A;  2QHO A;  2ZVO A;  3Q8B A;  4US9 A;  3RT3 B;  3EFU A;  1A70 A;  2PKO A;  5IA7 A;  1VR9 A;  2AL6 A;  4JLC A;  2FIF A;  3DBL I;  2WDR B;  4XDD A;  3AB5 A;  4HK2 A;  3L4P A;  2N1V A;  1NI2 A;  4RGT A;  4RM9 A;  1UBI A;  4OVU A;  2ON8 A;  3E56 A;  2BYT A;  1KLU D;  5DPW A;  1HEZ E;  4LLG M;  2JXT A;  2V4L A;  4WJQ A;  4BKS A;  1Q5W B;  3HM6 X;  1UGJ A;  1IUE A;  2Z59 B;  3VTU A;  1R4N B;  2KTR B;  5EE9 A;  2FCS A;  5EE1 A;  2FE8 A;  4JX1 C;  1HTQ A;  3IBE A;  2BYF A;  4P1C C;  3ZNI D;  3AE8 B;  2JQR B;  2RSU A;  3N9Y C;  3DHG C;  2WHI A;  3O65 B;  5HI1 A;  2BYV E;  3MP9 A;  3BVZ A;  3MJ5 A;  2I38 A;  3URY A;  1UEL A;  2ACZ B;  3M63 B;  1Q10 A;  2EEL A;  3H9D A;  4NJ7 A;  3B0A A;  2LGX A;  4ANV A;  4P6V F;  3BZD B;  1YQ4 B;  5E6O A;  3MC0 B;  4DK5 A;  4N6E B;  1I35 A;  3HM3 A;  2M4N A;  1UD7 A;  2LXA A;  3WIM A;  1JWB D;  1YOV B;  2BPS A;  4J6I A;  4Q2J A;  3TIX A;  4RH6 A;  2FID A;  4OW0 A;  4UDU C;  5D3D A;  2C7N B;  4HWI B;  4CO7 A;  1Y56 A;  2KNB A;  2Z0D B;  3AM9 A;  2KWC A;  1V5O A;  5IKC M;  4RNA A;  1WGD A;  1RAX A;  2QSD A;  1WXQ A;  4GGQ A;  3ZJT A;  5TR5 A;  2VRR B;  4N9F 4;  1JML A;  2MJE A;  1KOT A;  1UH6 A;  1ISN A;  2AX5 A;  2KAC A;  2K5P A;  2ZW1 A;  2MWS B;  2WDQ B;  1XLO A;  2L1A A;  2QIL A;  3TEY A;  1YJJ A;  4DXF A;  2D3B A;  4DXG A;  4LDT B;  1WF9 A;  3RUI B;  5IAA C;  4OZB A;  4BOZ B;  2MBO A;  3KUZ A;  2TSS A;  4E3C A;  5GMV A;  1ZXH A;  3V62 A;  1WGH A;  1SGH A;  2KVZ A;  3NHE B;  1WSP A;  4LJO B;  5KHQ A;  3A9J B;  3ZJU A;  4GN1 A;  4W9K A;  1RFK A;  1ZP0 B;  3BVM A;  2BS3 B;  2ZJD A;  2XEW A;  2SAK A;  4FJV B;  4GDL B;  2KJH B;  2YVC A;  1OEY J;  1N62 A;  3ML8 A;  4ARI A;  4LJP B;  3OJ4 B;  4BVU C;  1AW7 A;  2QIE B;  4LTU A;  2RDB C;  3W2D A;  1GAQ B;  4K7U A;  4IC7 B;  3PZ7 A;  1F2R C;  4N58 A;  2NVU I;  3KWV A;  3N30 A;  4K1R B;  4NZL B;  4HXD A;  2LGS A;  3VFK A;  2LMC A;  1WRI A;  1KTK A;  3LXF A;  3NVY A;  4G0N B;  2AWT A;  5AEK B;  2BKF A;  1L4Z B;  4XC2 A;  3ZNG C;  1Z5S B;  4KX6 B;  3TEW A;  3V60 A;  3VXW A;  1WXA A;  4LNO A;  1ZW7 A;  1AWD A;  4JPS A;  3V3X A;  4MM3 A;  3NVZ A;  3QIJ A;  2XK5 B;  1SJH D;  4R3D A;  1FNU A;  3JSV B;  3UIN B;  2K39 A;  4KZC A;  2PMV A;  3Q3F A;  2JU6 X;  2CJO A;  3D32 A;  2QC8 A;  4CHK A;  1MHH E;  4WJN A;  3PV1 A;  4HEA 1;  1FPY A;  1T0Y A;  4KGS A;  1H8C A;  3VTW A;  4HPP A;  3TL5 A;  4B0E A;  2WP9 B;  3A4S C;  1P7F A;  5CHW A;  2KDE B;  1GPX A;  1YN4 A;  3ZTC A;  4WQO B;  3R66 C;  3QHT A;  4WWP A;  3BIN A;  3MC9 A;  3DWM A;  2DNF A;  3ENE A;  2X8X X;  2FCN A;  2DBY A;  3DBR I;  4HCP B;  1ET6 A;  2JWZ A;  2M19 A;  4KKJ A;  2W3S A;  3ALB A;  3I63 C;  3AE6 B;  4ZRI A;  3U52 E;  5L95 C;  1IPG A;  4B9K A;  3ZYY X;  1GC7 A;  2MP2 A;  3ZO5 B;  3W5U B;  4LCD E;  1MG8 A;  1L7Y A;  3NJT A;  3NUH B;  1HE8 A;  4RGM A;  2CU1 A;  3M62 B;  2ZCC A;  3U7D A;  4KIK B;  4QAY A;  1EWC A;  1Q0W B;  2NTT A;  1L4D B;  1D3Z A;  2WWZ A;  5D7G A;  3U4E G;  2FNJ B;  3VQI A;  1TZ1 A;  1WRD B;  1ZPS A;  4WWN A;  3N1Y C;  1VLB A;  2KJ6 A;  2BS2 B;  3UQA A;  5J17 A;  4JL9 A;  3SDL C;  1FRD A;  1WM3 A;  3OJ3 A;  3TBL D;  1WY8 A;  3B08 A;  3ABV B;  1P98 A;  3BVG A;  3AI5 A;  3ZXV A;  1MHX A;  2L32 A;  2QJL A;  3KUC B;  2DAF A;  3V61 A;  2IGD A;  2NCN A;  3S2A A;  4CYE A;  2BB6 A;  2D3C A;  2JYT A;  2KDB A;  1IP9 A;  1PYW D;  3RNA C;  1EWY C;  2CHW A;  1PQS A;  1V5T A;  2GBK A;  3MJW A;  2L00 B;  2GRI A;  4MJS A;  3NS1 A;  4IM3 A;  3Q3O C;  4FLH A;  2ZEQ A;  4TKN A;  4A3O A;  3P4S B;  1Z2M A;  2BVC A;  2G4D B;  3P1M A;  4FHJ A;  2DYO A;  4RGN A;  4YSX B;  3GP7 A;  1U4A A;  3SD5 A;  4E71 A;  2KMM A;  1I7H A;  1F77 A;  3OLM D;  2D11 A;  3AE3 B;  5CTR C;  1CQV A;  2J0K A;  5IN7 A;  1YQB A;  4DHJ D;  2ICI A;  1TS2 A;  2AQ1 B;  2LWP A;  2GB1 A;  2ZPN A;  1IGC A;  4PS3 A;  4WWO A;  2L05 A;  3AE5 B;  4FAD A;  3AED B;  2MX2 A;  2KAN A;  2M56 B;  4WIP A;  4EKU A;  4EEW A;  2PVG C;  2REX A;  2RR9 A;  2FUG 1;  4BKG A;  3L54 A;  2Q5W D;  1E9M A;  3C19 A;  2KFK A;  2IZV B;  2BWE S;  2L0T A;  3AV8 A;  2QMT A;  4HJG E;  1KJT A;  3WAM A;  1JWM D;  3K9O B;  4PS7 A;  2N7J A;  3ETR A;  1HQR D;  4DXA B;  3UGB B;  3AE9 B;  3QX1 A;  2RPQ A;  2J53 A;  5CHF A;  3R2I A;  4A6Q A;  4S0R A;  4WJP A;  1WJN A;  2NBU A;  3RZW C;  1XCQ L;  2O6V D;  4HPM B;  1N60 A;  2LJ5 A;  1PGB A;  4MGK E;  1QIL A;  3IXS A;  5D2M B;  3T8M A;  4P7I A;  2BWF A;  4MGI E;  1ACC A;  1WXS A;  1C4A A;  3RD2 A;  3NZ3 A;  2W9N A;  4MM3 B;  2IDY A;  3BYY B;  1N5X A;  4NNJ B;  4ANW A;  4DWF A;  2MBH A;  1Q1O A;  3UI3 A;  1R4M B;  3L16 A;  1F1H A;  5IO9 A;  2SEB D;  2GMI C;  2KJR A;  3AE7 B;  2V3P A;  5IP4 D;  1J19 A;  3W1S C;  3EGR A;  2JZ3 B;  1KLG D;  3RNC C;  1WXV A;  3IFW B;  1EO6 A;  1XEE A;  3NZS A;  3RNE C;  2X38 A;  1C4C A;  2WDT B;  2XN9 C;  1L5P A;  2ZZP B;  4PYZ A;  3EA6 A;  1VZ8 A;  3MHZ A;  3TEZ A;  1RYJ A;  1WFY A;  1WGY A;  3DVG Y;  4DHZ B;  1EU4 A;  1F52 A;  1WX7 A;  1QZE A;  1R4M I;  1TJE A;  1KF6 B;  5G5G A;  1YNT E;  2J0M A;  3B9J A;  5E6J A;  1KM7 A;  3AXC A;  1RLF A;  2HDE A;  3QWZ B;  5CHV C;  4NJC A;  3CWI A;  3C0R B;  3VRB B;  2KKC A;  2N9K A;  3CSF A;  3L10 B;  3DBL B;  3Q3J A;  2MP2 B;  3DOW A;  4ZRQ A;  1K52 A;  2PLP A;  4XZ4 A;  1YQ3 B;  4KDL B;  2VZK D;  2PIA A;  1BXT A;  4ZRJ A;  2N9L A;  2N9E B;  3Q8C A;  2IGH A;  3SHQ A;  3PRM B;  1EF5 A;  2LJI A;  2DZK A;  1E7V A;  2HTM E;  4AS1 A;  4TV3 A;  5E6P A;  4A90 A;  2JZP A;  2IBI B;  2IJ0 A;  3OAW A;  1Y8R C;  4S17 A;  4KVG B;  2W54 A;  1OTR B;  1UBQ A;  2WXG A;  2KK8 A;  3Q8F A;  4DDG D;  2WXH A;  4RM8 A;  2PE6 B;  5BMI A;  1SIF A;  4II3 B;  3GZN I;  2R2O A;  4NAW A;  2UU7 A;  3A33 B;  3EHV A;  4OZC A;  3MFG A;  5JH5 C;  1WZ3 A;  4TUU A;  3DQV A;  1V86 A;  4TQ0 A;  1OEY A;  1CK1 A;  3ML9 A;  2MBB B;  2AEH A;  2MHJ A;  1J8C A;  2WLB A;  4MEL A;  2WU5 B;  2WXK A;  5BYR A;  4MJS B;  3R3M A;  3AEC B;  2DZI A;  1N6Z A;  2WX1 A;  4I6L B;  1T3Q A;  1XXG A;  2NPT A;  1WE6 A;  4L23 A;  2BT6 A;  2DX5 B;  1FD6 A;  1DOX A;  3ZVV A;  2NMQ A;  4HRS A;  4XDC A;  2C7H A;  2IGG A;  5L83 A;  1LXD A;  3L17 A;  4HKZ E;  1SJE D;  3KH0 A;  1J7A A;  2GBJ A;  4CQN A;  1JWS D;  3AN1 A;  1HTO A;  2JRH A;  5EE0 A;  1SE3 A;  1MPE A;  5D94 A;  4M8M A;  1E8W A;  4K7W A;  2C5L C;  2LGY A;  5LNK 1;  1TY2 A;  2MW5 A;  1WM2 A;  1T6B X;  2FCQ A;  2WQY B;  2M0X A;  4D2K A;  2D3G A;  4JGH B;  2L83 A;  3VHT C;  1V1P A;  4JIO U;  3CMM B;  4WH4 A;  4BFR A;  4C00 A;  2MLB A;  2WS3 B;  2XNA C;  1V9J A;  4WWM A;  4NQL B;  2YEP F;  3DBH I;  4FUL A;  2KO3 A;  5C1Z A;  1I4R A;  2MBQ A;  1T0Q C;  2HJ8 A;  1B1Z A;  2I1K A;  5KHO A;  2JSV X;  2O2V A;  2UWQ A;  2EKI A;  1J7B A;  2CR5 A;  1P7E A;  4LDT D;  2IO3 B;  3DVN V;  1ZUD 2;  3DVG X;  3VAW A;  1C4P A;  1OFF A;  4EUT A;  2MBE A;  3FIL B;  1WMH A;  2NBW B;  3W9C B;  4HKQ A;  2G45 B;  1QF6 A;  2K25 A;  3SEB A;  3P2B A;  1S3S G;  3ZGZ A;  1I42 A;  3JW0 X;  3VDZ A;  1WJU A;  3BY4 B;  3PGE A;  1QOA A;  4JE3 B;  5C2T B;  1VZ7 A;  4ARC A;  1IBX A;  1NYQ A;  3RFZ B;  2JWU A;  4AJW A;  1ZXI A;  3WAP A;  3R2T A;  1WH3 A;  4EOY A;  3PLV A;  3PT2 B;  3ONS A;  3RCZ A;  1PDX A;  3KQ4 A;  1BML C;  4H2A A;  3FKY A;  5HHD G;  1FCL A;  2BYE A;  1QLB B;  2WXO A;  3VUX A;  4YTM B;  2K8C A;  4MH8 A;  1I4P A;  3PPA A;  1UWM A;  2OHF A;  4GOC A;  2G1E A;  3BYT B;  1IGD A;  2KXJ A;  2WXF A;  4US8 A;  3AEE B;  2INN E;  2LHD A;  1E5W A;  2NTS A;  3PLU A;  3EFC A;  1TKY A;  2N7E A;  1GG3 A;  2N0S B;  2KVR A;  4FN2 A;  1V8C A;  4WAA A;  4M0W A;  3QCA A;  4ICV A;  3NOB A;  2O6V A;  1LO5 D;  3UIP B;  3DDC B;  1VRA B;  2DAJ A;  2M8S A;  4WAF A;  1HA5 A;  3DBR B;  1SE9 A;  3GE8 C;  2CS4 A;  2J7Q B;  1XCT L;  2IND C;  1T0S C;  1NYR A;  2JVC A;  2DWQ A;  2OED A;  2DEN B;  4GDK B;  3QK0 A;  4HCN B;  3A1Q A;  1SEB D;  5BYQ A;  2HE7 A;  2K0P A;  1QT9 A;  2KAJ A;  4YT0 B;  3VTV A;  5AUI A;  1GOZ A;  1JWU D;  3ZIM A;  4XWW A;  3N3K B;  1ZOY B;  2KQ4 X;  4YTP B;  3B1L X;  1N61 A;  3B2G A;  2KQS A;  2MQJ A;  1HZ5 A;  3APF A;  2KC1 A;  3ZDM C;  1FXA A;  3KYD D;  3Q2A C;  1VCB A;  3Q8E A;  4MAC A;  4P16 A;  1FMA D;  5LLI A;  3V05 A;  4EFO A;  4C4V A;  1V80 A;  5J2R A;  5D3I B;  3HVD A;  3ZNH B;  3I57 A;  4LK0 M;  4EZL A;  4FA6 A;  2WXM A;  4ASW C;  3ZLZ A;  4A9A A;  1FEH A;  5DPR A;  3AEA B;  1GB4 A;  2IO0 B;  4ZOH C;  4ZRK A;  2E3T A;  1M4V A;  2KDF B;  1KLV A;  1FRR A;  3WAL A;  4HLE A;  1XT9 B;  3ZDT A;  4ZHP A;  1D5M C;  2KX3 A;  4YWG G;  3AE4 B;  3NRZ A;  3T3O A;  1TGZ B;  3IT4 B;  1F2R I;  1XLQ A;  3PRZ A;  1VJK A;  3W1S A;  4RMA A;  5G5H A;  2LGD A;  1SIJ A;  2XBB C;  1G6J A;  2QEJ C;  1C79 A;  1K50 A;  4JWS C;  4USA A;  4BAX A;  2IYD B;  4J3O D;  1AN8 A;  1M94 A;  2AYO B;  1FFU A;  2V3S A;  4GMV A;  2E6X A;  4JWU C;  1WI0 A;  1ZKH A;  2CJN A;  3HIZ A;  1E90 A;  4M02 A;  2DYB A;  5T8I A;  3A9K A;  2Y5P A;  5AZF A;  2V0G A;  3QQ8 B;  3HK0 A;  1MI0 A;  2D2Q A;  2IPK D;  4AWJ A;  1YD8 U;  2KTR A;  2MEK A;  2M17 A;  1JRU A;  5BO4 B;  2RDG A;  2LFI A;  4GB9 A;  4LNK A;  4O1N A;  1V49 A;  4WJO A;  1KFY B;  1PGA A;  1RWS A;  1WIA A;  5AZG A;  5IOI A;  1ZGU B;  2CHZ A;  1LFD A;  2N9X A;  1LM8 B;  3H7S A;  2QDF A;  3SU8 X;  1K8R B;  2PEA A;  2LZ6 A;  4ICU A;  4LNN A;  1J0G A;  2INC C;  4W9C A;  3TUO A;  1N63 A;  2JX5 A;  1C77 A;  4PYU A;  2LVQ A;  4MT5 A;  2W82 A;  3HRD D;  1WR6 E;  4IUM B;  2C9W B;  3WAO A;  2JYE A;  5DPT A;  4OVV A;  1YIW A;  3ZRC A;  3P4Q B;  4IG7 B;  2K9X A;  1WGK A;  4M01 A;  1ZDV A;  1L6V A;  4L2Y A;  2L3Z A;  1S1Q B;  4MH0 E;  2KWD A;  4RF1 A;  4DHJ B;  1I4Q A;  2CKH B;  1ZDX A;  4MEM A;  3X23 A;  1TS5 A;  2MJ3 A;  2K6D B;  2LXC A;  5BMH A;  2BS4 B;  2KMA A;  2JZZ A;  2WXL A;  3VR9 B;  1SXT A;  2WXR A;  3FC4 A;  2C7M B;  5FR6 A;  2D5G A;  1NEK B;  4YXD B;  3VR8 B;  3V6E B;  3VVW B;  3SFD B;  2N9P C;  4B0M A;  4HPL B;  3PVL A;  1A5R A;  1V1O A;  3Q3M C;  2ZPY A;  2L8J A;  3AEG B;  2KZR A;  1K53 A;  1C76 A;  1WX9 A;  1SBB B;  1CJE A;  3Q3N C;  1FIQ A;  1ESF A;  1C78 A;  1GJZ A;  2KLG A;  2LVP A;  2J0J A;  1FXI A;  1V2Y A;  3P4R B;  1NI3 A;  4F1S A;  1YN5 A;  5JHA A;  2I2Y A;  2LD9 A;  3AE2 B;  1WGR A;  2BW2 A;  4C56 C;  2O6V B;  2NR2 A;  2WGS A;  2KLC A;  4A3P A;  2N4F A;  4C7Y A;  3JVZ X;  4URK A;  4ZYN A;  2KWU B;  1UNS A;  4ACF A;  2KTF A;  3Q6B A;  3KLS X;  1MG4 A;  2JF5 A;  2K8H A;  1QQR A;  3MC8 A;  3PO0 A;  1R7S A;  3HUI A;  4WQM A;  1ENF A;  5HFY A;  3HHM A;  1WX8 A;  2WXQ A;  4GU2 A;  4II2 B;  1C9F A;  4BKT A;  1T0R C;  4I6N B;  1TTN A;  1P3Q U;  1SF0 A;  2PTL A;  1NEN B;  1MJD A;  2LUE A;  2MCN B;  2KT7 A;  1WJ4 A;  4IWO A;  3VH3 B;  2IO1 B;  1TS4 A;  1X1M A;  2W3R A;  3T9L A;  3U2S C;  3TMP B;  3CIR B;  3MHS D;  3NS8 A;  2Y5C A;  3W1Y A;  1FM0 D;  5JXV A;  1JAL A;  1TIF A;  3VH4 B;  3M95 A;  1OQQ A;  5DCN A;  3O13 A;  2KFJ A;  2V3N A;  1KRH A;  2V9H A;  1KH0 A;  2G9H D;  1L0Y B;  1TYG B;  3R7R A;  2WXJ A;  4C4V B;  2KX0 A;  2QCZ A;  3GZN B;  2NBV B;  4DQO C;  1GNU A;  2KOX A;  1T5X D;  4W9D A;  3WCQ A;  5JZE B;  4MSQ B;  1CMX B;  1GC6 A;  2PE9 A;  1YX6 B;  4A8X C;  2JUO A;  1L6U A;  2RD0 A;  5EE3 A;  1L2N A;  2VZK B;  3ZJV A;  3R8B A;  1TY0 A;  1OQY A;  3H6N A;  4IWP A;  3RPF C;  4IM2 A;  3RNB C;  1CZP A;  5FKA C;  4ZRP A;  1E0Z A;  2GBN A;  3VRA B;  3PHX B;  1JQ4 A;  3DHH C;  2G3Q B;  1UF0 A;  5G55 A;  5JHB A;  2KDI A;  4JQW C;  3EUB 2;  5FR3 A;  2BKR B;  3DHI C;  3E9S A;  3QJZ A;  3ZKJ C;  4K81 A;  2AQ2 B;  4KGR A;  2HTH A;  4C80 A;  1RM6 C;  2PW9 A;  2DHZ A;  2LI5 A;  4G50 A;  3K9P B;  3KW5 B;  3A9K B;  1AYF A;  2I1J A;  1E6E B;  2H88 B;  2MSE D;  2ZNV B;  2R61 A;  3L13 A;  2LGI A;  3DBH B;  4KSL C;  2MA9 B;  4WUR A;  1JCK B;  3PHW B;  2WXI A;  4XE0 A;  3KUD B;  3P4P B;  4KIK A;  1FNW A;  5CX3 A;  1QOB A;  5AZH A;  3R7Q A;  1EUV B;  3ZW3 A;  3IHP C;  4F8C B;  4B6W A;  4IW0 A;  1GB1 A;  4AUQ C;  1ET9 A;  1K51 A;  1XLP A;  3RYT A;  3H8H A;  4W9E A;  5D6J B;  2YEP B;  1YX5 B;  1E8X A;  4BBN C;  4W9J A;  2Y3A A;  2M1M A;  4ANU A;  4HRO A;  2WX0 A;  2BBC A;  3LJ3 A;  1V97 A;  4KSK C;  2K1F A;  4BOS C;  5I4D A;  1E7U A;  3PSE B;  1R4N I;  2WYQ A;  2KFK B;  3NY5 A;  3AEB B;  2ASQ A;  5AUK A;  1F9J A;  3UF8 A;  1VD2 A;  2JXX A;  2Y5B B;  5BMG A;  3IG3 A;  1SE2 A;  1OGW A;  3LDZ E;  1UGM A;  3H1U A;  1OQR A;  2LVO A;  1BT0 A;  1PUT A;  4M8N A;  2FBW B;  1QOG A;  2KD0 A;  4MSM B;  3EC8 A;  4KGT A;  2J52 A;  3M3J A;  5HKH A;  4N59 A;  1DOY A;  4HJK A;  4NAM A;  1TS3 A;  2JT4 B;  3AE1 B;  2LEK A;  3BK1 A;  2A4Z A;  1V81 A;  2GBM A;  2GBR A;  1WYW B;  1XQQ A;  2V4I B;  5MPO A;  3KVF B;  4ITK A;  4GIV A;  4GSW A;  2KDM A;  4W9F A;  4G11 A;  2DYM A;  3LYY A;  3APD A;  4XWT A;  3B2F A; 
#chains in the Genus database with same CATH homology
 1VR9 A;  1PGX A;  3R2I A;  1FEH A;  3AEA B;  1GB4 A;  4A6Q A;  4ZOH C;  2WDR B;  4XDD A;  2E3T A;  3AB5 A;  1M4V A;  4RGO S;  3L4P A;  1XCQ L;  4RGT A;  1FRR A;  4TSS A;  1N60 A;  4L1B A;  2ON8 A;  3E56 A;  4ZHP A;  1D4B A;  1D5M C;  1PGB A;  4YWG G;  1QIL A;  2BYT A;  1KLU D;  3AE4 B;  3IXS A;  3NRZ A;  3T3O A;  1HEZ E;  4LLG M;  3IT4 B;  1F2R I;  1ACC A;  2JXT A;  1XLQ A;  1VJK A;  1C4A A;  5H8Y E;  3NZ3 A;  1UGJ A;  4MM3 B;  1IUE A;  2IDY A;  3W1S A;  3BYY B;  1N5X A;  2BB5 A;  5EE9 A;  3GS2 A;  3SR6 A;  5EE1 A;  5G5H A;  3UI3 A;  2FE8 A;  4JX1 C;  1SIJ A;  3Q69 A;  2QEJ C;  2SEB D;  1C79 A;  3AE8 B;  2JQR B;  3N9Y C;  1YMH E;  1K50 A;  4JWS C;  4USA A;  3IAS 1;  3PZ8 A;  5HI1 A;  3AE7 B;  2V3P A;  3BWU D;  2H89 B;  3MP9 A;  3BVZ A;  3MJ5 A;  2I38 A;  4J3O D;  3EGR A;  3URY A;  2ACZ B;  1SSN A;  1AN8 A;  1KLG D;  1Q10 A;  1FFU A;  2EEL A;  2RPV A;  3HVZ A;  2E6X A;  4JWU C;  2CJN A;  1XEE A;  2X38 A;  3BII D;  1C4C A;  5T8I A;  2Y5P A;  2XN9 C;  1L5P A;  4P6V F;  3BZD B;  2V0G A;  1YQ4 B;  1MI0 A;  1FNV A;  3EA6 A;  3MC0 B;  4N6E B;  1VZ8 A;  3MHZ A;  3TEZ A;  1RYJ A;  2IPK D;  4RCO A;  1JWB D;  2MEK A;  4Q2J A;  1FCC C;  4RH6 A;  2WXP A;  3AH7 A;  1EU4 A;  4OW0 A;  2RDG A;  4UDU C;  1YN3 A;  2LFI A;  3BK2 A;  5HG2 A;  5D3D A;  1TJE A;  4PT5 A;  4O1N A;  1KF6 B;  1Y56 A;  1KFY B;  1PGA A;  1RWS A;  2AQ3 B;  3AM9 A;  5FK9 C;  1YNT E;  5G5G A;  4RNA A;  2RDH A;  4IDI A;  3B9J A;  1DGJ A;  2QSD A;  1WXQ A;  5E6J A;  3ZJT A;  1VZ6 A;  2HDE A;  4NJC A;  3CWI A;  3VRB B;  1JML A;  1D6E C;  2N9K A;  2MJE A;  3TUO A;  1N63 A;  2JX5 A;  1C77 A;  2AX5 A;  2KAC A;  2K5P A;  2ZW1 A;  4MT5 A;  4ZRQ A;  1K52 A;  2PLP A;  2W82 A;  2MH7 A;  3HRD D;  2BTE A;  1YQ3 B;  2JYE A;  2WDQ B;  1XLO A;  2L1A A;  2QIL A;  3TEY A;  1YJJ A;  2VZK D;  3P4Q B;  4DXF A;  2K9X A;  1BXT A;  2PIA A;  2N9L A;  4DXG A;  1WGK A;  1ZDV A;  4NAW B;  4RF0 A;  1L6V A;  4L2Y A;  3Q8C A;  1I4G A;  2IGH A;  2KWD A;  2LJI A;  2WDV B;  4OZA A;  4RF1 A;  1I4Q A;  2HTM E;  2LHE A;  4OZB A;  1ZDX A;  4AS1 A;  1TS5 A;  2MJ3 A;  2TSS A;  2W55 A;  4A90 A;  1ZXH A;  3T3N A;  5BMH A;  2BS4 B;  2JZP A;  2WXL A;  2IJ0 A;  3VR9 B;  4IOI E;  1SXT A;  2WXR A;  3FC4 A;  2D5G A;  2W54 A;  1WSP A;  1NEK B;  4YXD B;  3VR8 B;  2WXG A;  3Q8F A;  3SFD B;  1JRO A;  3ZJU A;  4B0M A;  2WXH A;  1RFK A;  1ZP0 B;  1V1O A;  3BVM A;  5BMI A;  2BS3 B;  2B76 B;  1DOI A;  2SAK A;  3AEG B;  5C3J B;  1K53 A;  4GDL B;  1C76 A;  3IT6 B;  4OZC A;  1SBB B;  1CJE A;  3MFG A;  1N62 A;  1FIQ A;  4ARI A;  1ESF A;  1C78 A;  2ONQ A;  3U7Z A;  1JW9 D;  3NVV A;  2PVO D;  1AW7 A;  4TQ0 A;  2QIE B;  1FXI A;  4LTU A;  1CK1 A;  3P4R B;  1NI3 A;  4TQ1 A;  1YN5 A;  2I2Y A;  3AE2 B;  3W2D A;  2BW2 A;  1GAQ B;  4C56 C;  4FXC A;  2WLB A;  1JRP A;  3J9C A;  1UWX A;  2WU5 B;  3GB1 A;  2WXK A;  3PZ7 A;  1F2R C;  4N58 A;  5BYR A;  4C7Y A;  3AEC B;  3KWV A;  1UNS A;  3KLS X;  1SB3 C;  1T3Q A;  1V1P B;  1XXG A;  1HXY D;  4NZL B;  4L23 A;  1QQR A;  2BT6 A;  4OVZ A;  1FD6 A;  1DOX A;  2Z8L A;  3PO0 A;  1R7S A;  3HUI A;  2NMQ A;  4WQM A;  2LMC A;  1WRI A;  4HRS A;  1KTK A;  3LXF A;  1ENF A;  3NVY A;  4XDC A;  5HFY A;  2WXQ A;  1L4Z B;  5GXG B;  2IGG A;  3AMZ A;  1D5Z C;  1C9F A;  1I4H A;  4HKZ E;  1VDV A;  4KX6 B;  1SJE D;  3TEW A;  1TKG A;  1J7A A;  2WU2 B;  2PTL A;  1SF0 A;  4CQN A;  1AWD A;  1JWS D;  3AN1 A;  1NEN B;  4JPS A;  3V3X A;  5EE0 A;  1SE3 A;  1MPE A;  3NVZ A;  1SJH D;  4R3D A;  5LNK 1;  1E10 A;  1FNU A;  1TY2 A;  2DLB A;  1TS4 A;  1T6B X;  2W3R A;  3U2S C;  3CIR B;  2Y5C A;  2WQY B;  2PMV A;  4D2K A;  2K3U A;  1FM0 D;  1N5W A;  2JU6 X;  5JXV A;  2CJO A;  1JAL A;  2L83 A;  1V1P A;  2WXN A;  1MHH E;  5BYS A;  4WH4 A;  2WS3 B;  2XNA C;  1OQQ A;  1NVI D;  4WWM A;  4YSZ B;  4HEA 1;  3O13 A;  2YEP F;  2V3N A;  4RFB A;  1KRH A;  1I4R A;  1KH0 A;  4KGS A;  2G9H D;  1B1Z A;  1L0Y B;  1TYG B;  2WXJ A;  2JSV X;  4B0E A;  4A55 A;  2WP9 B;  1IBX B;  4YSY B;  2EKI A;  5H92 C;  2INP E;  1J7B A;  1P7E A;  1P7F A;  1TKE A;  4DQO C;  4YTN B;  1STE A;  1FO4 A;  1GPX A;  1YN4 A;  1ZUD 2;  4OHJ A;  1C4P A;  1OFF A;  1T5X D;  3TEX A;  3WCQ A;  3FIL B;  3DWM A;  3W9C B;  2ZW0 A;  3FAH A;  4HKQ A;  4A8X C;  1QF6 A;  2DBY A;  3SEB A;  1B9R A;  1L6U A;  2KN4 A;  3TSS A;  4AQ7 A;  1JWA D;  3ZGZ A;  1ET6 A;  2M19 A;  4KKJ A;  2MJD A;  2W3S A;  5EE3 A;  2VZK B;  3AE6 B;  3U52 E;  3ZJV A;  3ZQ4 A;  3Q8A A;  3R8B A;  1TY0 A;  3ZYY X;  3RPF C;  1QOA A;  4JE3 B;  1CZP A;  5FKA C;  4EE2 A;  1XO3 A;  5C2T B;  2M0A A;  1VZ7 A;  3W5U B;  4ZRP A;  4ARC A;  1IBX A;  1NYQ A;  1E0Z A;  1WYG A;  3VRA B;  3RFZ B;  2JWU A;  3NUH B;  1ZXI A;  1JQ4 A;  1BUI C;  4RGM A;  1I4X A;  3R2T A;  2WNM A;  3P42 A;  3EUB 2;  5FR3 A;  1EWC A;  3FIL A;  1PDX A;  2J42 A;  2NTT A;  1L4D B;  3LB8 C;  3E9S A;  3KQ4 A;  1BML C;  4IKG A;  4H2A A;  2AQ2 B;  4KGR A;  5D7G A;  5HHD G;  3U4E G;  1EU3 A;  4ZHO A;  3VQI A;  1YJI A;  1FCL A;  1XF5 L;  4C80 A;  1FFV A;  1RM6 C;  2PW9 A;  1ZPS A;  1QLB B;  3KWL A;  2WXO A;  1VLB A;  4YTM B;  4MH8 A;  1AYF A;  1I4P A;  1E6E B;  1UWM A;  2OHF A;  2G1E A;  3BYT B;  2H88 B;  1IGD A;  2BS2 B;  1MVK A;  2R61 A;  3I9V 1;  3C8Y A;  3DWG C;  4TMA B;  2LGI A;  2WXF A;  4US8 A;  3IAM 1;  4WUR A;  1FRD A;  1TZO A;  3AEE B;  2INN E;  1JCK B;  2LHD A;  2WXI A;  4XE0 A;  2J4X A;  2NTS A;  3ABV B;  3P4P B;  3BVG A;  1MHX A;  1FNW A;  2L32 A;  2QJL A;  1TKY A;  1QOB A;  2IGD A;  2BB6 A;  2N0S B;  1UUP A;  2JYT A;  1V8C A;  4REZ A;  1GB1 A;  1PYW D;  2GI9 A;  1ET9 A;  1K51 A;  1EWY C;  1XLP A;  4M0W A;  3H8H A;  1LO5 D;  1L0X B;  2GRI A;  1VRA B;  2YEP B;  3NS1 A;  3AEF B;  4WAF A;  1HA5 A;  2Y3A A;  1EM7 A;  3P4S B;  4HRO A;  2BBC A;  2L52 A;  2LUM A;  1HZ6 A;  1V97 A;  3P1M A;  1XCT L;  2DYO A;  1ROE A;  5I4D A;  5TSS A;  1NYR A;  2DWQ A;  3AEB B;  3P63 A;  2OED A;  1SE4 A;  3NVW A;  4GDK B;  1ZE3 D;  4RGN A;  1XLN A;  5AUK A;  4YSX B;  2K22 A;  1D5X C;  3GP7 A;  5BMG A;  1SEB D;  5BYQ A;  2K0P A;  1SE2 A;  1QT9 A;  2KAJ A;  1I7H A;  2KMM A;  1F77 A;  4YT0 B;  1J7C A;  5AUI A;  1GOZ A;  1JWU D;  1WWT A;  3AE3 B;  4XWW A;  1CQV A;  1ZOY B;  2KQ4 X;  4YTP B;  1OQR A;  2ICI A;  4KKI A;  1PUT A;  1TS2 A;  2AQ1 B;  1N61 A;  2CU3 A;  2FBW B;  1E7P B;  2RMM A;  1QOG A;  2GB1 A;  1IGC A;  1L0V B;  3B2G A;  4KGT A;  4C7Z A;  3AE5 B;  2J52 A;  3AED B;  4N59 A;  1DOY A;  4GLS C;  2M56 B;  4NAM A;  1HZ5 A;  1TS3 A;  4WIP A;  2PVG C;  3AE1 B;  2FUG 1;  2LEK A;  3BK1 A;  2Q5W D;  1E9M A;  1FXA A;  3W5V B;  4MAC A;  1QKZ A;  3OWE B;  3Q8E A;  1F0Z A;  4P16 A;  5MPO A;  2V4I B;  1FMA D;  3AV8 A;  3V05 A;  2QMT A;  4HJG E;  4ITK A;  1JWM D;  1DYQ A;  5D3I B;  1PFD A;  2N7J A;  3ETR A;  3HVD A;  3SFE B;  3I57 A;  4ZYS A;  2KDM A;  1QOF A;  4LK0 M;  2DYM A;  1HQR D;  3Q8B A;  4US9 A;  3LYY A;  2WXM A;  3AE9 B;  1A70 A;  4XWT A;  3B2F A;  2PKO A;  4A9A A;  2J53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...