2WLBA

Adrenodoxin-like ferredoxin etp1fd(516-618) of schizosaccharomyces pombe mitochondria
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
GTGIKVFFVTPEGREIMIEGNEGDSILDLAHANNIDLEGACEGSVACSTCHVIVDPEHYELLDPPEEDEEDMLDLAFGLEETSRLGCQVLLRKDLDGIRVRIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Electron transport
molecule keywords ELECTRON TRANSFER PROTEIN 1, MITOCHONDRIAL
publication title Structural and Thermodynamic Characterization of the Adrenodoxin-Like Domain of the Electron-Transfer Protein Etp1 from Schizosaccharomyces Pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 24
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wlbA00
3NVYA 1AYFA 1KRHA 1WYGA 3KWLA 3NVVA 1CZPA 5EE0A 2K22A 3AEFB 3VR9B 3VR8B 2KAJA 5AUKA 1E9MA 2MJ3A 3LB8C 5AUIA 3AMZA 1YJJA 2H89B 2QIEB 3AN1A 1XLOA 1SB3C 4C7ZA 1UWMA 3ABVB 3CWIA 1JRPA 1QLBB 2JQRB 2MH7A 5G5HA 4WWMA 5EE1A 1DOXA 1J7AA 2W3RA 1QOAA 2H88B 5C2TB 2DWQA 3FC4A 1FM0D 3SR6A 1YJIA 3AH7A 2WS3B 3B2FA 2L52A 2BT6A 1WRIA 5H8YE 3DWGC 1FFUA 1RM6C 3ETRA 3HVZA 1XO3A 1IUEA 4A9AA 1V97A 5G5GA 2W3SA 1N5WA 1QOGA 1FXIA 2G1EA 2WDRB 3SFEB 3VRAB 1QOBA 4ZHPA 4N58A 5MPOA 3AEAB 4US9A 2WQYB 2K5PA 3AM9A 2W54A 5H92C 3W5VB 1WWTA 1FXAA 3AE1B 1TJEA 1ZUD2 1TKGA 2PVGC 3AV8A 3HUIA 1L6VA 5GXGB 2JX5A 1NYQA 2BS3B 3BIID 3NVZA 4YT0B 2WU2B 1B9RA 4C7YA 1N63A 3AB5A 2AX5A 1E0ZA 1QF6A 1VDVA 1KF6B 2FBWB 1I7HA 4JWSC 1RYJA 3RPFC 1JWAD 1YQ4B 1E6EB 1PDXA 2LEKA 4HROA 4ZOHC 4YSYB 1FO4A 4IDIA 1FFVA 1QOFA 1DOYA 2M19A 1DOIA 1SIJA 1WXQA 1NENB 3AECB 1FRRA 1N60A 3HRDD 4YTPB 5EE9A 5C3JB 3NVWA 3AE4B 2CU3A 2WDVB 1JWBD 1R7SA 1NEKB 2BS2B 4YSXB 3AE5B 1JROA 2K9XA 3VRBB 3AEEB 1VJKA 4JX1C 4YXDB 1CJEA 2WP9B 3AE9B 1ROEA 1YQ3B 4N59A 1N62A 1JW9D 1NI3A 3NRZA 3LXFA 1JQ4A 1TYGB 2W55A 3P4SB 3FAHA 4HRSA 3P1MA 3W5UB 2L83A 3PO0A 3ZYYX 1FRDA 2PIAA 3CIRB 1N5XA 3W9CB 1AWDA 2Y5CA 4JWUC 1PUTA 3AE3B 2WDQB 3B2GA 1FIQA 2E3TA 3AE8B 2PKOA 4US8A 2ACZB 1V8CA 1NVID 1ZOYB 2CJNA 2QJLA 4P6VF 1WGKA 4FXCA 1OQQA 2MJDA 2PVOD 3AE2B 1F0ZA 1J7BA 3B9JA 4YSZB 2MJEA 1GAQB 2KMMA 1E10A 1GPXA 1A70A 4WQMA 2M56B 1OQRA 5EE3A 4LTUA 2OHFA 1XLNA 1RFKA 1N61A 1ZXIA 2WU5B 3AE7B 1J7CA 2EKIA 1ZP0B 1QT9A 3L4PA 2Q5WD 2CJOA 3P63A 1RWSA 1T3QA 1TKYA 3P4PB 2N0SB 3EUB2 4ITKA 4YTNB 1XLPA 3P4RB 1PFDA 2BS4B 4ZHOA 1OFFA 1L5PA 1NYRA 1EWYC 1VLBA 2WLBA 3AEBB 1E7PB 4N6EB 3NS1A 1XLQA 3AE6B 3AEGB 4KX6B 2B76B 1L6UA 3P4QB 3SFDB 1KFYB 1JALA 3DWMA 3AEDB 4YTMB 1FMAD 4USAA 2DBYA 1DGJA 4C80A 1TKEA 1L0VB 2HTME 3WCQA 1SF0A
chains in the Genus database with same CATH superfamily
1GC6A 1I4HA 2FIFA 4MDKE 3VR9B 2MJ3A 4NAWA 2LZ6A 4KV2A 3OWEB 2ZJDA 2IGDA 1F2RI 2LGIA 3NZUA 2O2VA 4YWGG 3ABVB 3A9KA 4OW0A 3FILA 5GMVA 5LNK1 3AULA 5IN7A 1FEHA 1SE3A 1WRIA 1I4GA 5H8YE 3DVGX 3DWGC 3HVZA 1NDDA 2LHDA 4A9AA 4WAAA 3MJWA 4ZHPA 2KDMA 3EFCA 2D3GA 2K5PA 3W5VB 3ZXVA 1OGWA 2D2QA 3I57A 2WU2B 4MACA 2KX0A 3HIZA 3AB5A 1IGCA 3KYDD 1L4ZB 2O6VD 3PRMB 4HKQA 1JWAD 1C4PA 4A90A 2K6QA 2RDHA 1GOZA 2BS2B 4PS8A 1I4QA 2BWES 1C4AA 4K7UA 2GBRA 1CJEA 2D07B 1NI3A 3LXFA 2AL6A 1IBXB 3ZW3A 4KDIC 4J3OD 2PIAA 1N5XA 4A3PA 2KQ4X 2ICIA 3ZQ4A 1YX5B 3Q3FA 2AYOB 1YQBA 4TKNA 3JVZX 1NVID 4IM0A 2QJLA 1C77A 4PYZA 1SBBB 1HQRD 2MJDA 2PVOD 3AE2B 2WX0A 4RGOS 5LLIA 2OHFA 1XLNA 2K8CA 3AE7B 1LM8B 4LNNA 4A55A 2LHEA 1IP9A 4ARCA 5AZHA 1C79A 4AJYB 2QCZA 2V3PA 1PFDA 3SEBA 1NYRA 1WM2A 2INNE 3QWZB 2VZKD 2WNMA 3ZTCA 1E8WA 2GI9A 2LXCA 3VUYA 1AYFA 2M8SA 2KMAA 4NY0A 3VR8B 2ZNVC 5AUKA 5KHQA 3PRPB 3UI3A 4HWIB 2NR2A 4CQNA 1YN5A 2KC2A 2JQRB 5G5HA 1YX6B 4GB9A 5C2TB 2KDIA 3LDZE 1L0YB 4A6QA 1XO3A 3PVLA 1QOGA 3S2AA 3M62B 4RM9A 1M4VA 5FR3A 3GOEA 5IKCM 4IG7B 2IY0B 2LGDA 4MJSA 1B9RA 2XK5B 2IGHA 3MC0B 2FBWB 4G50A 4IC7B 4MGYE 4PYUA 2N1WA 5LXIB 1PDXA 2WX1A 4H2AA 4RCOA 2KANA 2V4LA 1TS5A 1VR9A 2NTSA 3CF6E 3U52E 2PLPA 3TEWA 3R8BA 1LGRA 2IO3B 3L0WB 3ZDMC 1JCKB 3ML8A 4J6IA 3V6EB 1ZOYB 4P6VF 4FHJA 2YEPF 4LCDE 1Q5WB 1EU4A 2KN5A 3DVGY 3SHQA 5LXHA 5BMHA 4EKUA 4BBNC 5JHAA 2JZ3B 3P4PB 5J17A 5J2RA 2L76A 3H7PA 1T0YA 2Z0DB 2KC1A 2LXAA 4MELA 2EELA 3IAM1 3SD5A 3R2IA 3RT3B 2REXA 4DHJB 2KLGA 1SXTA 5FK9C 1L0VB 1HEZE 2RD0A 2IZVB 4HJKA 4P1CC 1V80A 3TBLD 4JLCA 2C60A 5AZFA 3OJ4B 4GMVA 3OJ3A 2N9LA 3KQ4A 3ZNGC 3NOBA 2UWQA 4GLSC 3M63B 4W9IA 3Q8BA 4X57B 4G0NB 1QOAA 3J9CA 3MJ5A 5CHVC 4ICVA 1B1ZA 2MBHA 2W3SA 5MPOA 1GUAB 1S3SG 1VCBA 1WWTA 2BW2A 1TJEA 2BYVE 3N1YC 2FUHB 5DPSA 3N9YC 1C4CA 3VTWA 5G2NA 1N63A 4ZYNA 2AX5A 4JWSC 1L4DB 3U7ZA 4LNKA 3KUCB 4HROA 2LEKA 2KTRA 4K7WA 4W9GA 1T5XD 2OJRA 4ANXA 2DZKA 1KTKA 4YSXB 3AE5B 2N9PC 3A4RA 4OZCA 4PT5A 1VJKA 3QJZA 3AE9B 5KHOA 2GBMA 3VUWA 1EU3A 3NRZA 1EM7A 5IO9A 1BXTA 5BMGA 4CYEA 2Y5CA 4RGMA 1G6JA 2M0XA 2BVCA 2JRIB 3UGBB 3GE3C 4PS7A 2MJEA 4YL8A 1RFKA 3DBHB 1D5XC 1F2RC 2FUG1 1T3QA 2JRHA 3EUB2 3P4RB 4GU2A 3BY4B 3H8HA 5CHFA 3NS1A 3AE6B 4NQLB 2FE8A 3M3JA 2WXHA 1V5TA 1ZDVA 3RMKC 1TKEA 3WCQA 3KWLA 1CZPA 4HVBA 4ZRJA 2WHIA 4ZRKA 2D11A 2LGYA 2MP2B 3N32A 5HG2A 4OVVA 3OLMD 4WIPA 4ANVA 2BYTA 2H88B 2LD9A 3KH0A 5CX3A 2IO2B 2LRWA 1IUEA 1TS3A 1V97A 3L54A 5G5GA 3OG5A 4M0WA 4XDCA 3WAMA 1NYQA 2J0KA 4M01A 2ZEQA 3ZUNA 4HDQA 1QF6A 3DBRB 1UELA 4DHZB 1YQ4B 1QOFA 2QMTA 1DOIA 5C3JB 2D10A 3PHWB 3URYA 1OEYJ 2KQ7A 2IO0B 2K8HA 2KACA 3AEEB 4XZ4A 1WXSA 5D2MB 5L95C 1P7FA 3TJPA 3DHHC 4B0MA 1WIAA 3ZYYX 3WAPA 1FRDA 3AU4A 3W9CB 1AWDA 5E6JA 2L7RA 2IGGA 3PT2B 4LDTB 1OQQA 3BINA 4RGNA 2YEPB 1KLUD 3N1ZC 1WE6A 3IHPC 1WYWB 2OOBB 1MG4A 3DHIC 1V5OA 1OFFA 4R3DA 2DYBA 4FA6A 5JHBA 4P7IA 4E71A 3QC8B 3KVFB 4USAA 1DGJA 3DBRI 3WANA 1LFDA 2KHWB 5EE0A 3AEFB 4BZAA 2M1MA 1TY0A 2LUMA 1XLOA 1GB1A 3A1QA 1HTQA 1VZ6A 1Y8RC 1J7AA 4PK1A 2BQQA 2KN4A 3IVFA 3NUHB 2JPHA 4ASWC 2WDRB 4G11A 2INDC 2MCNB 3O13A 3T9LA 1FXAA 2RR9A 2AQ2B 1T0SC 1E0ZA 2QSDA 1V49A 1V2YA 1RYJA 3UIPB 5JXVA 2QC8A 2I38A 4HPMB 2OJWA 1WXQA 1N60A 2FCQA 3TCAA 3NZSA 2QDFA 4AJWA 1JWUD 2CU3A 4WWOA 4TV3A 3RUIB 1XT9B 4FLHA 4IKGA 1TT5B 2FCSA 2ON8A 1TBEA 2W55A 2L83A 2MSED 2KFKB 1WI0A 2KJ6A 1ISNA 2D3CA 4CO7A 3NG0A 3QA8A 4WQMA 2IO1B 4XWWA 1J7CA 2KDFB 2K6DB 1ZP0B 2D3BA 3ZRCA 1TIFA 4AOFA 2HJ1A 3ZNID 4DDGD 3RNFC 1NBFC 2DAFA 1SE9A 3ALBA 4II2B 3GZNB 4RMAA 2EKEC 1YMHE 3NVVA 1QKZA 1WX9A 3GS2A 2KJHB 3AN1A 4ACFA 1C76A 2Y3AA 1ZPSA 1JRPA 4KZCA 4MT5A 3ZNHB 4WWMA 5BYQA 4REZA 1YJIA 2CHWA 3EFUA 1YD8U 3DHGC 2NPTB 2RSUA 3TEYA 2LVQA 3V3XA 1TS4A 3ZVVA 3I3TB 1N5WA 4GDKA 4N58A 4WH4A 3DOWA 1ET9A 3AV8A 2L3ZA 1WZ3A 4WJOA 5I4DA 1V1OA 4DXFA 4DK5A 4M00A 4C7YA 4LK0M 3ZTDA 2G45B 5HI1A 3JSVB 1Q0WB 2XBBC 4K1RB 2BYFA 3ENEA 3RCZA 3RD2A 3K9PB 3VFKA 3U8ZA 5DPTA 3PV1A 4WWPA 3BWUD 3A9JB 4HEA1 1ROEA 3GZNI 4FULA 3P4SB 1WRDB 4HRSA 2WXOA 1TZOA 2CS4A 4NZLB 2WXFA 2LFIA 3Q8CA 1LXDA 1VRAB 1FIQA 4URKA 2V9HA 3TIXA 3B9JA 2ZW0A 1WX8A 3MC9A 2AWTA 4NQKE 1L2NA 2XN9C 3R7QA 2AEHA 2NBVB 1SGHA 3HM6X 3H7SA 4A20A 4K3CA 1JALA 1FMAD 5G55A 2DBYA 5DPWA 3B0AA 1Z2MA 1J0GA 2KAJA 1SSNA 3LB8C 4DBGA 2BGFA 1AN8A 2KLCA 1QILA 1WXMA 2G4DB 3CWIA 3V60A 2RDGA 1UH6A 2O6VB 2W3RA 2LMCA 3PZ8A 1WGRA 3SR6A 2DYMA 3PLVA 3JW0X 3B2FA 1A5RA 4XC2A 5IP4D 3N1XC 1YJ1A 2QILA 1QOBA 2AQ1B 1C9FA 4KSKC 4WJPA 5TSSA 3PTFC 1QZEA 5D3DA 2DZMA 1TKGA 4CHKA 2WXNA 3BIID 4KZ0A 2LGSA 4MM3B 1F52A 4YT0B 3DCGA 3KLSX 1I7HA 4EEWA 2FNJB 4BOZB 4ZOHC 1E6EB 1RAXA 1NENB 1EF5A 2HD5B 4KIKA 2KK8A 2IYDB 4IWPA 2GLSA 3CSTA 1R4NB 4KSLC 3U4EG 1FXTB 1V1PA 1GG3A 2MP2A 2JF5A 3P42A 4YXDB 3JYUA 2KD0A 1D6EC 3PS6A 5T8IA 4MGZE 3QK0A 1SIFA 4RNAA 5HKHA 2VZKB 4KGSA 4K7SA 4NPNA 1WMHA 2ZVNA 2ACZB 4IOIE 4KKIA 2WXRA 3ZGZA 2NBWB 2D5GA 3NZ3A 5EE3A 4LTUA 4B0EA 1UNSA 2ZCCA 3TMPB 2M4NA 1QT9A 3L4PA 2WXJA 2RMMA 4A3OA 1TS2A 4I6PA 1E7PB 5L83A 2ZPNA 3Q14C 1WJNA 1YN3A 2PTLA 4C00A 4DHJD 3BK2A 4MGKE 4RFBA 1KRHA 2OEDA 1VZ8A 2MLBA 4FADA 2Z0EB 3EECA 2DAJA 1R4MB 4O1NA 2AL3A 2MBEA 1KLGD 1R4NI 2JT4B 3TEZA 2DWQA 3HHMA 2VH1A 2ZPYA 4GDLA 3CMMB 1D4BA 3WALA 2KXJA 2L8JA 2KO3A 3W1SC 3AEAB 4NAMA 5C23A 5H92C 4NAWB 2HTHA 1WSPA 1ZUD2 1SJED 2KQSA 2CR5A 1K52A 3VTUA 2MBQA 1WGYA 2I1JA 4QAYA 2HDEA 3RYTA 2ZCBA 4MSQB 2LI5A 4ZYSA 4HPLB 4JQWC 1WJ6A 3ZRFA 5E6OA 3H1UA 1P0RA 1K53A 3Q8AA 1DOYA 2M19A 1ACCA 1QQRA 1FRRA 2M0AA 2XNAC 2Y5BB 4W9HA 1UZXB 2WDVB 4LJOB 2K8BA 2PPHA 2A5UA 1WX7A 2JZZA 3PO0A 1ZE3D 3ECIA 5AZGA 1R4MI 4C4VB 5IAAC 3BYYB 2M17A 1WGKA 1KLVA 1UUPA 1JWSD 3MHSD 2JXTA 3HK0A 2GBNA 1UBQA 3PSEB 2WDTB 4KVGB 4MEMA 1HZ5A 1L5PA 3AEBB 1JWMD 1XLQA 3AEGB 2GBKA 3Q3JA 4W9FA 2INPE 1GJZA 2LGXA 2G4SA 3UF8A 4YTMB 2L32A 3PRZA 2UU7A 3V61A 1IGDA 2WXGA 5AUIA 1YJJA 5J18A 5IA7A 1QLBB 2MH7A 2CHZA 3BZDB 3U7DA 4EE2A 2RPQA 2KWDA 2BT6A 3L13A 2G1EA 2W9NA 1T0RC 3N20C 2WQYB 1L6VA 1MHXA 1UBIA 1X1MA 4ANWA 4NJ7A 5C1ZA 4OHJA 1MPEA 4JGHB 4WQOB 1I4PA 1NI2A 3L10B 2G3QB 1SE4A 4ARIA 4IDIA 3IBEA 1V6EA 1H4RA 3ZO5B 1F9JA 4HLEA 2KTFA 1FD6A 1DYQA 2K9XA 2E6XA 2BWFA 3R66C 2CU1A 2L00B 4L23A 4N59A 3ZIMA 4HXDA 4MJSB 2PJHA 1RFAA 4E74A 2AQ3B 4IWQA 3CIRB 3EHVA 3PHXB 4JWUC 2NPTA 1I42A 1MJDA 2JY6A 3VQIA 2CJNA 2JYEA 2EMSA 1GAQB 3QIJA 1E10A 2L1AA 1UGJA 1CQVA 3A4SC 1BUIC 2WXKA 4ZDVA 1WH3A 3WAOA 1OQYA 3DVNV 4ITKA 2BS4B 2J0MA 3HVDA 3UQBA 2JU6X 2CHXA 3UQAA 3JSVA 2BF8B 3EA6A 1TZ1A 4RH6A 1HXYD 1PQSA 1L0XB 1YIWA 3NHEB 4WWNA 4W9EA 3Q3MC 3TUOA 2QHOA 2GRIA 3MFGA 4MGIE 1IYFA 3D32A 1OEYA 2H89B 3K9OB 2K1FA 1D5ZC 4KDLB 4DXAB 3H7PB 3BK1A 1I4XA 3FC4A 3ZNZB 1I35A 2NTTA 4TUUA 2KFJA 3TSSA 4TSSA 2WWZA 3ETRA 3ZKJC 3IT4B 1FXIA 2K25A 3VRAB 3AU5A 3VDZA 2G9HD 2J42A 2KWVB 4XYCA 1IBXA 4WJNA 1VDVA 2RDBC 2A4ZA 3V6CB 3RPFC 3NY5A 5BYSA 2JWZA 4M02A 4DHZE 1FO4A 2FIDA 1XD3B 3X0WA 4F7ZA 2PE9A 2X38A 2NVUI 3B08A 4BFRA 5BMIA 1D3ZA 2BB6A 3ZJVA 1L7YA 4KGTA 3PGEA 1N62A 1JW9D 1YN4A 5D3IB 1F77A 3V62A 4A8XC 1HZ6A 4W9DA 4EZKA 4BKGA 2B3AA 2ASQA 1P98A 5DPRA 2PKOA 2KWUB 2KTRB 1C78A 4AWJA 4EOYA 2MQJA 3IG3A 2MRPA 3VH4B 1A70A 2M56B 2WGSA 2N7JA 4XGAB 4ZRPA 2Q5WD 3DBLB 2N9KA 1XLPA 1ET6A 5IOIA 5BYRA 4FBJB 2IJ0A 1WGDA 2FCNA 4RF0A 3BVGA 4W9CA 3IFWB 4N9F4 2N4FA 1STEA 1E9MA 4WAFA 2DX5B 4GGQA 1UWMA 2XK5A 3R7RA 4BOSC 3A33B 2V0GA 3ZXRA 2K0PA 3L08A 1FFUA 4C56C 2BKFA 5HFYA 5E6PA 1IPGA 4OZAA 3AE1B 4B6WA 2PVGC 2IDYA 1E8ZA 2BS3B 3TEXA 1WR6E 1ESFA 1WGGA 3CSFA 2J0JA 2WYQA 2KYWA 3DBLI 2VH2A 2BB5A 3C0RB 1RRBA 2LJIA 1NEKB 2KJRA 4M0WB 2DYOA 2LJ5A 1N6ZA 4II3B 3KW5B 2K3UA 1YQ3B 3B1LX 3Q6BA 3T3NA 3GB1A 3W5UB 2V3NA 4IM3A 3I63C 2C7MB 4OVZA 4HJGE 5E6NA 1BT0A 2GOWA 2ZVOA 1KM7A 2MEKA 3PLUA 4EUTA 2R2QA 4YSZB 1XQQA 2MWSB 1FCCC 3MHZA 2KDEB 1MHHE 2EKIA 1V81A 1P7EA 2MX2A 4TMAB 1P3QU 4NNJB 1HE8A 4AP4C 1WE7A 1MVKA 2NMQA 4MH0E 3WA0A 2LVPA 3APCA 3L16A 2L0FA 1SF0A 3AI5A 3IAS1 4ZRQA 2QEJC 4AQ7A 2INCC 3OAWA 1UF0A 2C9WB 4IWOA 2YVCA 3RNBC 1MG8A 3GE8C 1SEBD 2N7EA 3C8YA 1V86A 4C4VA 1M94A 4I6NB 3IXSA 2JYTA 4JPSA 1ZXHA 2HE7A 4UDUC 3IT6B 3AM9A 2J52A 3SU8X 2WXPA 2DHZA 4P16A 3A1QB 4GOCA 1KJTA 1T6BX 2MW5A 1FNWA 2GBJA 2KZRA 2ZZPB 2YLMA 4F8CB 3RZWC 3AECB 1WJUA 5EE9A 2KVRA 4GSWA 4LNOA 1JWBD 3V05A 4FJYA 1E7VA 1WY8A 2IBIB 1CK1A 2WP9B 2ZW1A 2FAZA 3ONSA 2MBOA 2R2OA 2VRRB 4XDDA 2E3TA 2JUOA 3RNEC 3EGRA 5DCNA 1PYWD 2BPSA 5FKAC 3ZJUA 1JMLA 2KMCA 3UINB 3EC8A 3MTNB 1N61A 3MC8A 3RN9C 4IW0A 1YNTE 3VXWA 2V3SA 1J8CA 1EO6A 1OTRB 3FKYA 2WLBA 4N6EB 1L6UA 1KOTA 4LNIA 1VZ7A 4KKJA 3Q2AC 2JX5A 1C1YB 1BMLC 3X23A 3R2TA 1H8CA 3U30A 2BYEA 5EE1A 2DZJA 2WXQA 4Q2JA 3APFA 4ZRIA 1WZ0A 3VAWA 3T8MA 3NJTA 2PE6B 1WGHA 1XCQL 3LYYA 3SFEB 5TR5A 4BVUC 4US9A 5HHDG 1EF1A 3GP7A 3PZDA 2JVCA 3U2SC 2DZIA 4GIVA 2MHJA 3M95A 1PGBA 1WFYA 4BBNF 3KUZA 1E5WA 4YSYB 3E9SA 1FFVA 3RI7C 1KH0A 1XXGA 4GDKB 4WURA 2UYZB 4EFOA 4GXBA 1R7SA 1JROA 1FCLA 1EUVB 4L1BA 2O2VB 3A9KB 3FAHA 1K8RB 3FILB 1EWCA 3W1SA 2NBUA 3VTVA 1UD7A 3L17A 3DPDA 4AS1A 3QHTA 3LJ3A 5EDSA 4IUMB 1F0ZA 1OQRA 2K39A 1XF5L 3QCAA 1J19A 1HTOA 4W9LA 4JIOU 2CJOA 4RM8A 3P63A 4XE0A 1TKYA 2N0SB 4ZHOA 1SJHD 4JE3B 3C19A 2KKCA 3RZFA 3R3MA 3SDLC 2B76B 3P4QB 1F1HA 2BKRB 3DWMA 4C80A 3MP9A 4JL9A 2Z8LA 2HTME 1JRUA 1WYGA 3RNGC 2NCNA 3PZ7A 2HJ8A 2Z59B 3DVNU 4DWFA 3QAQA 4XX5A 4K81A 1XEEA 2Y5PA 1DOXA 3ML9A 1FM0D 1AARA 3AH7A 2WS3B 2L52A 1Q10A 4RF1A 1MFWA 3UIOB 5D6JB 2PW9A 2SEBD 4DQOC 3QX1A 2W54A 3QARA 1SE2A 1LO5D 5CHWA 5GXGB 4WJQA 2PMVA 2KFKA 2KVZA 1ZGUB 5BO4B 3H9DA 4YTPB 2LRUA 4PS3A 2DNFA 1V9JA 2KDBA 1K50A 3AE4B 3N3KB 3PREA 3VRBB 4P1BC 1ZKHA 4W9KA 2KNBA 3RULA 1TYGB 2WXMA 1WXAA 3P1MA 3H6NA 3VVWB 1PGXA 2ZNVB 3B2GA 1E8XA 3AXCA 4B95A 3T3OA 2R61A 4IM2A 1E7UA 1V8CA 4ANUA 4LNFA 4KIKB 2XEWA 4FXCA 2KWCA 1GPXA 4FN2A 1WR1A 2KMMA 2N9EB 2MBBB 1V1PB 2WU5B 1K51A 4OZBA 1Q1OA 2KT7A 4OVUA 3ZLZA 1RWSA 4XWTA 3E56A 4I6LB 4HCPB 4HDOA 3APDA 4ICUA 1FNVA 2N7DA 2IPKD 2NS5A 4KX6B 1WMHB 4S0RA 3N30A 4L2YA 2L05A 2V4IB 2LUEA 3KWVA 3VUXA 1WXVA 3NVYA 3P2BA 4LDTD 1FPYA 2K22A 2QIEB 4HPPA 1SB3C 5CTRC 2LASA 3DBHI 2LWPA 4DXGA 4BKSA 3BVMA 4TQ1A 4K3BA 2JXXA 1TGZB 4KGRA 4NJCA 3VHTC 3A9JA 3NVZA 3Q3NC 2RGFA 3I9V1 1KF6B 1HA5A 1YOVB 2I2YA 4NJ6A 2SAKA 3Q3OC 4GDLB 1SIJA 3HRDD 4D2KA 2ONQA 4HK2A 4TQ0A 2D3AA 4FHKA 3DQVA 4DDID 1CMXB 4S17A 4JX1C 1U4AA 1WM3A 1P1AA 1TTNA 3BYTB 1PGAA 3AE3B 2GMIC 3O65B 3AE8B 4LLGM 2J53A 3Q8FA 4FJVB 4MH8A 4AUQC 3TL5A 3W2DA 1J7BA 3DBSA 2C5LC 2W82A 1ZXIA 2KOXA 4HKZE 2BBCA 5JZEB 1FNUA 4YTNB 2O6VA 1EWYC 1VLBA 1RLFA 2C7HA 1T0QC 4B9KA 3Q69A 3PPAA 1WJ4A 3AEDB 2EMTA 2V1YA 1P9DU 3AMZA 4BKTA 1GB4A 2WXLA 2I1KA 2GB1A 1XCTL 4C7ZA 3QQ8B 4MM3A 1GNUA 3VH3B 2DENB 1I4RA 4M8NA 4LJPB 2J4XA 4RGTA 2JSVX 3ZJTA 2LVOA 1RM6C 1Y56A 3RNCC 3DDCB 4M8MA 1D5MC 1VD2A 3HM3A 1TY2A 2IY1B 1WF9A 3HUIA 2N9XA 3KUDB 2C7NB 1E8YA 3KYCD 1MI0A 1C3TA 2DLBA 3RNAC 3NS8A 2FCMA 1UWXA 5FR6A 5D94A 1S1QB 4E3CA 3WIMA 3BVZA 4GN1A 2WXIA 4FJZA 1Z5SB 2J7QB 2KX3A 5JH5C 2L0TA 4EZLA 1JQ4A 3I5JC 1UGMA 2X8XX 4F1SA 1PUTA 4EZJA 2WDQB 5AEKB 2JWUA 4BKSD 2BTEA 1E90A 2MA9B 4US8A 2N1VA 2JZPA 2RPVA 1GC7A 3ZDTA 2PEAA 4G3XB 3RFZB 1ZDXA 1LQBA 5D7GA 4W9JA 2TSSA 3Q8EA 1ENFA 4HCNB 4MSMB 1ZW7A 4BAXA 3SFDB 1KFYB 3W1YA 2CKHB 1AW7A 3NVWA
chains in the Genus database with same CATH topology
1I4HA 5EE0A 1BMLC 3AEFB 3VR9B 2MJ3A 1IGDA 2WXGA 5AUIA 3R2TA 1YJJA 3OWEB 1TY0A 2LUMA 2IGDA 1F2RI 1XLOA 1GB1A 2LGIA 4YWGG 3ABVB 4OW0A 1QLBB 2MH7A 3FILA 3BZDB 5EE1A 2WXQA 1VZ6A 4Q2JA 1J7AA 4EE2A 5LNK1 1FEHA 1SE3A 2KWDA 2KN4A 2BT6A 1WRIA 1I4GA 5H8YE 3DWGC 3HVZA 2LHDA 3NUHB 4A9AA 1XCQL 2G1EA 2WDRB 3LYYA 3SFEB 4ZHPA 2KDMA 3O13A 4US9A 2WQYB 2K5PA 5HHDG 3W5VB 1FXAA 1L6VA 1MHXA 2AQ2B 3GP7A 3U2SC 3I57A 2WU2B 1MPEA 4MACA 4OHJA 1E0ZA 3AB5A 1IGCA 1I4PA 2QSDA 1L4ZB 1PGBA 1RYJA 4HKQA 5JXVA 1JWAD 4YSYB 1SE4A 4ARIA 3E9SA 4IDIA 1FFVA 2I38A 1C4PA 1KH0A 1WXQA 4A90A 1XXGA 1N60A 4GDKB 2RDHA 4WURA 1GOZA 1JWUD 2CU3A 1FD6A 1DYQA 1R7SA 2BS2B 1JROA 2K9XA 1FCLA 1I4QA 1C4AA 2E6XA 4IKGA 1CJEA 4L1BA 4N59A 4L23A 1NI3A 2ON8A 3LXFA 2W55A 1IBXB 3FAHA 2AQ3B 2L83A 4J3OD 3FILB 3CIRB 2PIAA 1N5XA 1EWCA 3W1SA 4JWUC 2KQ4X 2ICIA 3ZQ4A 4AS1A 1NVID 3VQIA 2CJNA 2QJLA 1C77A 1SBBB 1HQRD 2MJDA 2JYEA 2PVOD 3AE2B 4RGOS 1F0ZA 1GAQB 1E10A 4WQMA 2L1AA 1OQRA 1UGJA 1CQVA 1XF5L 1XLNA 2OHFA 4XWWA 3AE7B 1J7CA 1BUIC 2WXKA 4A55A 1ZP0B 2LHEA 4ARCA 2CJOA 3P63A 4XE0A 1C79A 1TKYA 2N0SB 4ITKA 1SJHD 2V3PA 4JE3B 4ZHOA 1PFDA 2BS4B 3HVDA 3SEBA 1NYRA 2JU6X 3EA6A 4RH6A 2INNE 1HXYD 2B76B 2VZKD 2WNMA 3P4QB 1L0XB 3DWMA 4C80A 3MP9A 2GI9A 3TUOA 2Z8LA 2HTME 1YMHE 2GRIA 3MFGA 1AYFA 1WYGA 3NVVA 3VR8B 1QKZA 5AUKA 3UI3A 3GS2A 3PZ7A 2H89B 3AN1A 1C76A 4CQNA 1D5ZC 2Y3AA 1ZPSA 1JRPA 1YN5A 2JQRB 1XEEA 2Y5PA 4MT5A 5G5HA 4WWMA 1DOXA 5BYQA 4REZA 3BK1A 5C2TB 1I4XA 3FC4A 1FM0D 1YJIA 3AH7A 2NTTA 2WS3B 2L52A 1L0YB 3TSSA 1Q10A 3TEYA 4TSSA 1TS4A 3V3XA 3ETRA 4A6QA 1XO3A 4RF1A 3IT4B 1FXIA 1N5WA 1QOGA 3VRAB 4N58A 2PW9A 4WH4A 2SEBD 4DQOC 1M4VA 2W54A 5FR3A 2G9HD 1SE2A 1ET9A 2J42A 3AV8A 1LO5D 5GXGB 5I4DA 1V1OA 4DXFA 1IBXA 1B9RA 4C7YA 2IGHA 4LK0M 3MC0B 1VDVA 2FBWB 2PMVA 5HI1A 3RPFC 5BYSA 1PDXA 1FO4A 4H2AA 4YTPB 2X38A 4RCOA 1K50A 3AE4B 5BMIA 3VRBB 1TS5A 1VR9A 2BB6A 3BWUD 4HEA1 3ZJVA 4KGTA 1ROEA 2NTSA 1N62A 1JW9D 1YN4A 5D3IB 1F77A 3U52E 2PLPA 1TYGB 4A8XC 3TEWA 3P4SB 2WXMA 1HZ6A 4HRSA 3P1MA 3R8BA 2WXOA 1TZOA 4NZLB 2WXFA 2LFIA 1PGXA 3Q8CA 1JCKB 3B2GA 1VRAB 3T3OA 1FIQA 2PKOA 2R61A 1C78A 1V8CA 1ZOYB 4P6VF 2YEPF 4FXCA 1GPXA 3B9JA 2ZW0A 2KMMA 1A70A 2M56B 1EU4A 1V1PB 2WU5B 1K51A 4OZBA 2N7JA 2XN9C 5BMHA 4ZRPA 2Q5WD 1RWSA 4XWTA 3E56A 2N9KA 3P4PB 1XLPA 1ET6A 1FNVA 5BYRA 2EELA 2IPKD 2IJ0A 3IAM1 4KX6B 3R2IA 4RF0A 1JALA 1SXTA 3BVGA 4L2YA 1FMAD 5FK9C 2DBYA 2V4IB 1L0VB 3KWVA 1HEZE 3NVYA 2K22A 1STEA 2KAJA 1E9MA 1SSNA 3LB8C 4WAFA 1AN8A 2QIEB 1QILA 2N9LA 3KQ4A 1SB3C 1UWMA 4GLSC 3CWIA 3Q8BA 2RDGA 2W3RA 2V0GA 1QOAA 2LMCA 3PZ8A 3J9CA 3MJ5A 2K0PA 2DYMA 3SR6A 4DXGA 3BVMA 4TQ1A 3B2FA 1B1ZA 1FFUA 4C56C 5HFYA 2W3SA 2QILA 1QOBA 5MPOA 4OZAA 2AQ1B 4KGRA 1C9FA 4NJCA 1WWTA 3AE1B 2BW2A 5TSSA 5D3DA 1TJEA 1TKGA 2PVGC 2IDYA 2WXNA 3NVZA 2BS3B 3BIID 3N9YC 3TEXA 4MM3B 1C4CA 4YT0B 1ESFA 1N63A 3I9V1 2AX5A 3KLSX 1KF6B 1I7HA 4JWSC 1HA5A 1L4DB 3U7ZA 4ZOHC 1E6EB 4HROA 2LEKA 2I2YA 2SAKA 4GDLB 1SIJA 1NENB 3HRDD 4D2KA 1T5XD 2BB5A 2ONQA 4TQ0A 2LJIA 1KTKA 4YSXB 3U4EG 1NEKB 1V1PA 3AE5B 2DYOA 4OZCA 4PT5A 1VJKA 4JX1C 3P42A 4YXDB 3AE9B 2K3UA 1YQ3B 1D6EC 1EU3A 3NRZA 5T8IA 3T3NA 1EM7A 3GB1A 3W5UB 2V3NA 3BYTB 1BXTA 1PGAA 4OVZA 4HJGE 2VZKB 2Y5CA 3AE3B 4RNAA 4RGMA 5BMGA 3AE8B 4LLGM 2J53A 4KGSA 3Q8FA 2ACZB 4MH8A 4IOIE 2MEKA 4KKIA 2WXRA 3ZGZA 3W2DA 1J7BA 4YSZB 2MJEA 2D5GA 3NZ3A 1FCCC 4LTUA 5EE3A 2W82A 1RFKA 1ZXIA 3MHZA 4B0EA 1D5XC 1MHHE 1UNSA 2EKIA 1P7EA 4HKZE 1QT9A 3L4PA 4TMAB 2BBCA 2WXJA 1F2RC 2FUG1 1T3QA 2RMMA 1FNUA 3EUB2 4YTNB 3P4RB 1TS2A 1EWYC 1VLBA 1E7PB 3H8HA 3NS1A 3Q69A 3AE6B 2FE8A 1MVKA 1YN3A 2NMQA 2PTLA 2WXHA 5C3JB 3AEDB 1ZDVA 3BK2A 1TKEA 4RFBA 3WCQA 1SF0A 3IAS1 4ZRQA 1KRHA 2OEDA 2QEJC 3KWLA 4AQ7A 1CZPA 1VZ8A 3AMZA 5HG2A 1GB4A 4O1NA 2WXLA 2GB1A 1XCTL 4C7ZA 1KLGD 1SEBD 4WIPA 3TEZA 2BYTA 2H88B 2DWQA 3C8YA 1I4RA 3IXSA 2J4XA 4RGTA 2JYTA 2JSVX 3ZJTA 1RM6C 1D4BA 1Y56A 1IUEA 4JPSA 1TS3A 1ZXHA 1V97A 5G5GA 1D5MC 4UDUC 3AEAB 4NAMA 3IT6B 3AM9A 4M0WA 5H92C 1TY2A 4NAWB 1WSPA 2J52A 1ZUD2 1SJED 3HUIA 1K52A 4XDCA 1NYQA 2WXPA 2HDEA 4P16A 1MI0A 1QF6A 2DLBA 1T6BX 4ZYSA 1UWXA 1FNWA 1YQ4B 1K53A 1QOFA 3Q8AA 1DOYA 2QMTA 2M19A 1DOIA 1ACCA 3AECB 1QQRA 1FRRA 2M0AA 2XNAC 3BVZA 2WXIA 5EE9A 3URYA 2WDVB 1JWBD 3V05A 2KACA 3AEEB 1CK1A 2WP9B 2ZW1A 1P7FA 4B0MA 1JQ4A 3PO0A 1ZE3D 3ZYYX 1FRDA 3W9CB 1AWDA 1PUTA 4XDDA 2WDQB 2JWUA 2E3TA 5E6JA 3EGRA 1PYWD 2BTEA 4US8A 2IGGA 3BYYB 5FKAC 1WGKA 1OQQA 3ZJUA 1JMLA 2JZPA 4RGNA 1UUPA 2RPVA 1JWSD 2YEPB 1N61A 2JXTA 1KLUD 3RFZB 1ZDXA 5D7GA 1YNTE 2TSSA 3Q8EA 1ENFA 1HZ5A 1OFFA 1L5PA 4R3DA 2WLBA 3AEBB 4N6EB 1JWMD 1XLQA 3AEGB 2INPE 1L6UA 3SFDB 1KFYB 4YTMB 1VZ7A 2L32A 4USAA 1DGJA 1AW7A 4KKJA 2JX5A 3NVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVY A;  1AYF A;  1KRH A;  1WYG A;  3KWL A;  3NVV A;  1CZP A;  5EE0 A;  2K22 A;  3AEF B;  3VR9 B;  3VR8 B;  2KAJ A;  5AUK A;  1E9M A;  2MJ3 A;  3LB8 C;  5AUI A;  3AMZ A;  1YJJ A;  2H89 B;  2QIE B;  3AN1 A;  1XLO A;  1SB3 C;  4C7Z A;  1UWM A;  3ABV B;  3CWI A;  1JRP A;  1QLB B;  2JQR B;  2MH7 A;  5G5H A;  4WWM A;  5EE1 A;  1DOX A;  1J7A A;  2W3R A;  1QOA A;  2H88 B;  5C2T B;  2DWQ A;  3FC4 A;  1FM0 D;  3SR6 A;  1YJI A;  3AH7 A;  2WS3 B;  3B2F A;  2L52 A;  2BT6 A;  1WRI A;  5H8Y E;  3DWG C;  1FFU A;  1RM6 C;  3ETR A;  3HVZ A;  1XO3 A;  1IUE A;  4A9A A;  1V97 A;  5G5G A;  2W3S A;  1N5W A;  1QOG A;  1FXI A;  2G1E A;  2WDR B;  3SFE B;  3VRA B;  1QOB A;  4ZHP A;  4N58 A;  5MPO A;  3AEA B;  4US9 A;  2WQY B;  2K5P A;  3AM9 A;  2W54 A;  5H92 C;  3W5V B;  1WWT A;  1FXA A;  3AE1 B;  1TJE A;  1ZUD 2;  1TKG A;  2PVG C;  3AV8 A;  3HUI A;  1L6V A;  5GXG B;  2JX5 A;  1NYQ A;  2BS3 B;  3BII D;  3NVZ A;  4YT0 B;  2WU2 B;  1B9R A;  4C7Y A;  1N63 A;  3AB5 A;  2AX5 A;  1E0Z A;  1QF6 A;  1VDV A;  1KF6 B;  2FBW B;  1I7H A;  4JWS C;  1RYJ A;  3RPF C;  1JWA D;  1YQ4 B;  1E6E B;  1PDX A;  2LEK A;  4HRO A;  4ZOH C;  4YSY B;  1FO4 A;  4IDI A;  1FFV A;  1QOF A;  1DOY A;  2M19 A;  1DOI A;  1SIJ A;  1WXQ A;  1NEN B;  3AEC B;  1FRR A;  1N60 A;  3HRD D;  4YTP B;  5EE9 A;  5C3J B;  3NVW A;  3AE4 B;  2CU3 A;  2WDV B;  1JWB D;  1R7S A;  1NEK B;  2BS2 B;  4YSX B;  3AE5 B;  1JRO A;  2K9X A;  3VRB B;  3AEE B;  1VJK A;  4JX1 C;  4YXD B;  1CJE A;  2WP9 B;  3AE9 B;  1ROE A;  1YQ3 B;  4N59 A;  1N62 A;  1JW9 D;  1NI3 A;  3NRZ A;  3LXF A;  1JQ4 A;  1TYG B;  2W55 A;  3P4S B;  3FAH A;  4HRS A;  3P1M A;  3W5U B;  2L83 A;  3PO0 A;  3ZYY X;  1FRD A;  2PIA A;  3CIR B;  1N5X A;  3W9C B;  1AWD A;  2Y5C A;  4JWU C;  1PUT A;  3AE3 B;  2WDQ B;  3B2G A;  1FIQ A;  2E3T A;  3AE8 B;  2PKO A;  4US8 A;  2ACZ B;  1V8C A;  1NVI D;  1ZOY B;  2CJN A;  2QJL A;  4P6V F;  1WGK A;  4FXC A;  1OQQ A;  2MJD A;  2PVO D;  3AE2 B;  1F0Z A;  1J7B A;  3B9J A;  4YSZ B;  2MJE A;  1GAQ B;  2KMM A;  1E10 A;  1GPX A;  1A70 A;  4WQM A;  2M56 B;  1OQR A;  5EE3 A;  4LTU A;  2OHF A;  1XLN A;  1RFK A;  1N61 A;  1ZXI A;  2WU5 B;  3AE7 B;  1J7C A;  2EKI A;  1ZP0 B;  1QT9 A;  3L4P A;  2Q5W D;  2CJO A;  3P63 A;  1RWS A;  1T3Q A;  1TKY A;  3P4P B;  2N0S B;  3EUB 2;  4ITK A;  4YTN B;  1XLP A;  3P4R B;  1PFD A;  2BS4 B;  4ZHO A;  1OFF A;  1L5P A;  1NYR A;  1EWY C;  1VLB A;  2WLB A;  3AEB B;  1E7P B;  4N6E B;  3NS1 A;  1XLQ A;  3AE6 B;  3AEG B;  4KX6 B;  2B76 B;  1L6U A;  3P4Q B;  3SFD B;  1KFY B;  1JAL A;  3DWM A;  3AED B;  4YTM B;  1FMA D;  4USA A;  2DBY A;  1DGJ A;  4C80 A;  1TKE A;  1L0V B;  2HTM E;  3WCQ A;  1SF0 A; 
#chains in the Genus database with same CATH topology
 1GC6 A;  1I4H A;  2FIF A;  4MDK E;  3VR9 B;  2MJ3 A;  4NAW A;  2LZ6 A;  4KV2 A;  3OWE B;  2ZJD A;  2IGD A;  1F2R I;  2LGI A;  3NZU A;  2O2V A;  4YWG G;  3ABV B;  3A9K A;  4OW0 A;  3FIL A;  5GMV A;  5LNK 1;  3AUL A;  5IN7 A;  1FEH A;  1SE3 A;  1WRI A;  1I4G A;  5H8Y E;  3DVG X;  3DWG C;  3HVZ A;  1NDD A;  2LHD A;  4A9A A;  4WAA A;  3MJW A;  4ZHP A;  2KDM A;  3EFC A;  2D3G A;  2K5P A;  3W5V B;  3ZXV A;  1OGW A;  2D2Q A;  3I57 A;  2WU2 B;  4MAC A;  2KX0 A;  3HIZ A;  3AB5 A;  1IGC A;  3KYD D;  1L4Z B;  2O6V D;  3PRM B;  4HKQ A;  1JWA D;  1C4P A;  4A90 A;  2K6Q A;  2RDH A;  1GOZ A;  2BS2 B;  4PS8 A;  1I4Q A;  2BWE S;  1C4A A;  4K7U A;  2GBR A;  1CJE A;  2D07 B;  1NI3 A;  3LXF A;  2AL6 A;  1IBX B;  3ZW3 A;  4KDI C;  4J3O D;  2PIA A;  1N5X A;  4A3P A;  2KQ4 X;  2ICI A;  3ZQ4 A;  1YX5 B;  3Q3F A;  2AYO B;  1YQB A;  4TKN A;  3JVZ X;  1NVI D;  4IM0 A;  2QJL A;  1C77 A;  4PYZ A;  1SBB B;  1HQR D;  2MJD A;  2PVO D;  3AE2 B;  2WX0 A;  4RGO S;  5LLI A;  2OHF A;  1XLN A;  2K8C A;  3AE7 B;  1LM8 B;  4LNN A;  4A55 A;  2LHE A;  1IP9 A;  4ARC A;  5AZH A;  1C79 A;  4AJY B;  2QCZ A;  2V3P A;  1PFD A;  3SEB A;  1NYR A;  1WM2 A;  2INN E;  3QWZ B;  2VZK D;  2WNM A;  3ZTC A;  1E8W A;  2GI9 A;  2LXC A;  3VUY A;  1AYF A;  2M8S A;  2KMA A;  4NY0 A;  3VR8 B;  2ZNV C;  5AUK A;  5KHQ A;  3PRP B;  3UI3 A;  4HWI B;  2NR2 A;  4CQN A;  1YN5 A;  2KC2 A;  2JQR B;  5G5H A;  1YX6 B;  4GB9 A;  5C2T B;  2KDI A;  3LDZ E;  1L0Y B;  4A6Q A;  1XO3 A;  3PVL A;  1QOG A;  3S2A A;  3M62 B;  4RM9 A;  1M4V A;  5FR3 A;  3GOE A;  5IKC M;  4IG7 B;  2IY0 B;  2LGD A;  4MJS A;  1B9R A;  2XK5 B;  2IGH A;  3MC0 B;  2FBW B;  4G50 A;  4IC7 B;  4MGY E;  4PYU A;  2N1W A;  5LXI B;  1PDX A;  2WX1 A;  4H2A A;  4RCO A;  2KAN A;  2V4L A;  1TS5 A;  1VR9 A;  2NTS A;  3CF6 E;  3U52 E;  2PLP A;  3TEW A;  3R8B A;  1LGR A;  2IO3 B;  3L0W B;  3ZDM C;  1JCK B;  3ML8 A;  4J6I A;  3V6E B;  1ZOY B;  4P6V F;  4FHJ A;  2YEP F;  4LCD E;  1Q5W B;  1EU4 A;  2KN5 A;  3DVG Y;  3SHQ A;  5LXH A;  5BMH A;  4EKU A;  4BBN C;  5JHA A;  2JZ3 B;  3P4P B;  5J17 A;  5J2R A;  2L76 A;  3H7P A;  1T0Y A;  2Z0D B;  2KC1 A;  2LXA A;  4MEL A;  2EEL A;  3IAM 1;  3SD5 A;  3R2I A;  3RT3 B;  2REX A;  4DHJ B;  2KLG A;  1SXT A;  5FK9 C;  1L0V B;  1HEZ E;  2RD0 A;  2IZV B;  4HJK A;  4P1C C;  1V80 A;  3TBL D;  4JLC A;  2C60 A;  5AZF A;  3OJ4 B;  4GMV A;  3OJ3 A;  2N9L A;  3KQ4 A;  3ZNG C;  3NOB A;  2UWQ A;  4GLS C;  3M63 B;  4W9I A;  3Q8B A;  4X57 B;  4G0N B;  1QOA A;  3J9C A;  3MJ5 A;  5CHV C;  4ICV A;  1B1Z A;  2MBH A;  2W3S A;  5MPO A;  1GUA B;  1S3S G;  1VCB A;  1WWT A;  2BW2 A;  1TJE A;  2BYV E;  3N1Y C;  2FUH B;  5DPS A;  3N9Y C;  1C4C A;  3VTW A;  5G2N A;  1N63 A;  4ZYN A;  2AX5 A;  4JWS C;  1L4D B;  3U7Z A;  4LNK A;  3KUC B;  4HRO A;  2LEK A;  2KTR A;  4K7W A;  4W9G A;  1T5X D;  2OJR A;  4ANX A;  2DZK A;  1KTK A;  4YSX B;  3AE5 B;  2N9P C;  3A4R A;  4OZC A;  4PT5 A;  1VJK A;  3QJZ A;  3AE9 B;  5KHO A;  2GBM A;  3VUW A;  1EU3 A;  3NRZ A;  1EM7 A;  5IO9 A;  1BXT A;  5BMG A;  4CYE A;  2Y5C A;  4RGM A;  1G6J A;  2M0X A;  2BVC A;  2JRI B;  3UGB B;  3GE3 C;  4PS7 A;  2MJE A;  4YL8 A;  1RFK A;  3DBH B;  1D5X C;  1F2R C;  2FUG 1;  1T3Q A;  2JRH A;  3EUB 2;  3P4R B;  4GU2 A;  3BY4 B;  3H8H A;  5CHF A;  3NS1 A;  3AE6 B;  4NQL B;  2FE8 A;  3M3J A;  2WXH A;  1V5T A;  1ZDV A;  3RMK C;  1TKE A;  3WCQ A;  3KWL A;  1CZP A;  4HVB A;  4ZRJ A;  2WHI A;  4ZRK A;  2D11 A;  2LGY A;  2MP2 B;  3N32 A;  5HG2 A;  4OVV A;  3OLM D;  4WIP A;  4ANV A;  2BYT A;  2H88 B;  2LD9 A;  3KH0 A;  5CX3 A;  2IO2 B;  2LRW A;  1IUE A;  1TS3 A;  1V97 A;  3L54 A;  5G5G A;  3OG5 A;  4M0W A;  4XDC A;  3WAM A;  1NYQ A;  2J0K A;  4M01 A;  2ZEQ A;  3ZUN A;  4HDQ A;  1QF6 A;  3DBR B;  1UEL A;  4DHZ B;  1YQ4 B;  1QOF A;  2QMT A;  1DOI A;  5C3J B;  2D10 A;  3PHW B;  3URY A;  1OEY J;  2KQ7 A;  2IO0 B;  2K8H A;  2KAC A;  3AEE B;  4XZ4 A;  1WXS A;  5D2M B;  5L95 C;  1P7F A;  3TJP A;  3DHH C;  4B0M A;  1WIA A;  3ZYY X;  3WAP A;  1FRD A;  3AU4 A;  3W9C B;  1AWD A;  5E6J A;  2L7R A;  2IGG A;  3PT2 B;  4LDT B;  1OQQ A;  3BIN A;  4RGN A;  2YEP B;  1KLU D;  3N1Z C;  1WE6 A;  3IHP C;  1WYW B;  2OOB B;  1MG4 A;  3DHI C;  1V5O A;  1OFF A;  4R3D A;  2DYB A;  4FA6 A;  5JHB A;  4P7I A;  4E71 A;  3QC8 B;  3KVF B;  4USA A;  1DGJ A;  3DBR I;  3WAN A;  1LFD A;  2KHW B;  5EE0 A;  3AEF B;  4BZA A;  2M1M A;  1TY0 A;  2LUM A;  1XLO A;  1GB1 A;  3A1Q A;  1HTQ A;  1VZ6 A;  1Y8R C;  1J7A A;  4PK1 A;  2BQQ A;  2KN4 A;  3IVF A;  3NUH B;  2JPH A;  4ASW C;  2WDR B;  4G11 A;  2IND C;  2MCN B;  3O13 A;  3T9L A;  1FXA A;  2RR9 A;  2AQ2 B;  1T0S C;  1E0Z A;  2QSD A;  1V49 A;  1V2Y A;  1RYJ A;  3UIP B;  5JXV A;  2QC8 A;  2I38 A;  4HPM B;  2OJW A;  1WXQ A;  1N60 A;  2FCQ A;  3TCA A;  3NZS A;  2QDF A;  4AJW A;  1JWU D;  2CU3 A;  4WWO A;  4TV3 A;  3RUI B;  1XT9 B;  4FLH A;  4IKG A;  1TT5 B;  2FCS A;  2ON8 A;  1TBE A;  2W55 A;  2L83 A;  2MSE D;  2KFK B;  1WI0 A;  2KJ6 A;  1ISN A;  2D3C A;  4CO7 A;  3NG0 A;  3QA8 A;  4WQM A;  2IO1 B;  4XWW A;  1J7C A;  2KDF B;  2K6D B;  1ZP0 B;  2D3B A;  3ZRC A;  1TIF A;  4AOF A;  2HJ1 A;  3ZNI D;  4DDG D;  3RNF C;  1NBF C;  2DAF A;  1SE9 A;  3ALB A;  4II2 B;  3GZN B;  4RMA A;  2EKE C;  1YMH E;  3NVV A;  1QKZ A;  1WX9 A;  3GS2 A;  2KJH B;  3AN1 A;  4ACF A;  1C76 A;  2Y3A A;  1ZPS A;  1JRP A;  4KZC A;  4MT5 A;  3ZNH B;  4WWM A;  5BYQ A;  4REZ A;  1YJI A;  2CHW A;  3EFU A;  1YD8 U;  3DHG C;  2NPT B;  2RSU A;  3TEY A;  2LVQ A;  3V3X A;  1TS4 A;  3ZVV A;  3I3T B;  1N5W A;  4GDK A;  4N58 A;  4WH4 A;  3DOW A;  1ET9 A;  3AV8 A;  2L3Z A;  1WZ3 A;  4WJO A;  5I4D A;  1V1O A;  4DXF A;  4DK5 A;  4M00 A;  4C7Y A;  4LK0 M;  3ZTD A;  2G45 B;  5HI1 A;  3JSV B;  1Q0W B;  2XBB C;  4K1R B;  2BYF A;  3ENE A;  3RCZ A;  3RD2 A;  3K9P B;  3VFK A;  3U8Z A;  5DPT A;  3PV1 A;  4WWP A;  3BWU D;  3A9J B;  4HEA 1;  1ROE A;  3GZN I;  4FUL A;  3P4S B;  1WRD B;  4HRS A;  2WXO A;  1TZO A;  2CS4 A;  4NZL B;  2WXF A;  2LFI A;  3Q8C A;  1LXD A;  1VRA B;  1FIQ A;  4URK A;  2V9H A;  3TIX A;  3B9J A;  2ZW0 A;  1WX8 A;  3MC9 A;  2AWT A;  4NQK E;  1L2N A;  2XN9 C;  3R7Q A;  2AEH A;  2NBV B;  1SGH A;  3HM6 X;  3H7S A;  4A20 A;  4K3C A;  1JAL A;  1FMA D;  5G55 A;  2DBY A;  5DPW A;  3B0A A;  1Z2M A;  1J0G A;  2KAJ A;  1SSN A;  3LB8 C;  4DBG A;  2BGF A;  1AN8 A;  2KLC A;  1QIL A;  1WXM A;  2G4D B;  3CWI A;  3V60 A;  2RDG A;  1UH6 A;  2O6V B;  2W3R A;  2LMC A;  3PZ8 A;  1WGR A;  3SR6 A;  2DYM A;  3PLV A;  3JW0 X;  3B2F A;  1A5R A;  4XC2 A;  5IP4 D;  3N1X C;  1YJ1 A;  2QIL A;  1QOB A;  2AQ1 B;  1C9F A;  4KSK C;  4WJP A;  5TSS A;  3PTF C;  1QZE A;  5D3D A;  2DZM A;  1TKG A;  4CHK A;  2WXN A;  3BII D;  4KZ0 A;  2LGS A;  4MM3 B;  1F52 A;  4YT0 B;  3DCG A;  3KLS X;  1I7H A;  4EEW A;  2FNJ B;  4BOZ B;  4ZOH C;  1E6E B;  1RAX A;  1NEN B;  1EF5 A;  2HD5 B;  4KIK A;  2KK8 A;  2IYD B;  4IWP A;  2GLS A;  3CST A;  1R4N B;  4KSL C;  3U4E G;  1FXT B;  1V1P A;  1GG3 A;  2MP2 A;  2JF5 A;  3P42 A;  4YXD B;  3JYU A;  2KD0 A;  1D6E C;  3PS6 A;  5T8I A;  4MGZ E;  3QK0 A;  1SIF A;  4RNA A;  5HKH A;  2VZK B;  4KGS A;  4K7S A;  4NPN A;  1WMH A;  2ZVN A;  2ACZ B;  4IOI E;  4KKI A;  2WXR A;  3ZGZ A;  2NBW B;  2D5G A;  3NZ3 A;  5EE3 A;  4LTU A;  4B0E A;  1UNS A;  2ZCC A;  3TMP B;  2M4N A;  1QT9 A;  3L4P A;  2WXJ A;  2RMM A;  4A3O A;  1TS2 A;  4I6P A;  1E7P B;  5L83 A;  2ZPN A;  3Q14 C;  1WJN A;  1YN3 A;  2PTL A;  4C00 A;  4DHJ D;  3BK2 A;  4MGK E;  4RFB A;  1KRH A;  2OED A;  1VZ8 A;  2MLB A;  4FAD A;  2Z0E B;  3EEC A;  2DAJ A;  1R4M B;  4O1N A;  2AL3 A;  2MBE A;  1KLG D;  1R4N I;  2JT4 B;  3TEZ A;  2DWQ A;  3HHM A;  2VH1 A;  2ZPY A;  4GDL A;  3CMM B;  1D4B A;  3WAL A;  2KXJ A;  2L8J A;  2KO3 A;  3W1S C;  3AEA B;  4NAM A;  5C23 A;  5H92 C;  4NAW B;  2HTH A;  1WSP A;  1ZUD 2;  1SJE D;  2KQS A;  2CR5 A;  1K52 A;  3VTU A;  2MBQ A;  1WGY A;  2I1J A;  4QAY A;  2HDE A;  3RYT A;  2ZCB A;  4MSQ B;  2LI5 A;  4ZYS A;  4HPL B;  4JQW C;  1WJ6 A;  3ZRF A;  5E6O A;  3H1U A;  1P0R A;  1K53 A;  3Q8A A;  1DOY A;  2M19 A;  1ACC A;  1QQR A;  1FRR A;  2M0A A;  2XNA C;  2Y5B B;  4W9H A;  1UZX B;  2WDV B;  4LJO B;  2K8B A;  2PPH A;  2A5U A;  1WX7 A;  2JZZ A;  3PO0 A;  1ZE3 D;  3ECI A;  5AZG A;  1R4M I;  4C4V B;  5IAA C;  3BYY B;  2M17 A;  1WGK A;  1KLV A;  1UUP A;  1JWS D;  3MHS D;  2JXT A;  3HK0 A;  2GBN A;  1UBQ A;  3PSE B;  2WDT B;  4KVG B;  4MEM A;  1HZ5 A;  1L5P A;  3AEB B;  1JWM D;  1XLQ A;  3AEG B;  2GBK A;  3Q3J A;  4W9F A;  2INP E;  1GJZ A;  2LGX A;  2G4S A;  3UF8 A;  4YTM B;  2L32 A;  3PRZ A;  2UU7 A;  3V61 A;  1IGD A;  2WXG A;  5AUI A;  1YJJ A;  5J18 A;  5IA7 A;  1QLB B;  2MH7 A;  2CHZ A;  3BZD B;  3U7D A;  4EE2 A;  2RPQ A;  2KWD A;  2BT6 A;  3L13 A;  2G1E A;  2W9N A;  1T0R C;  3N20 C;  2WQY B;  1L6V A;  1MHX A;  1UBI A;  1X1M A;  4ANW A;  4NJ7 A;  5C1Z A;  4OHJ A;  1MPE A;  4JGH B;  4WQO B;  1I4P A;  1NI2 A;  3L10 B;  2G3Q B;  1SE4 A;  4ARI A;  4IDI A;  3IBE A;  1V6E A;  1H4R A;  3ZO5 B;  1F9J A;  4HLE A;  2KTF A;  1FD6 A;  1DYQ A;  2K9X A;  2E6X A;  2BWF A;  3R66 C;  2CU1 A;  2L00 B;  4L23 A;  4N59 A;  3ZIM A;  4HXD A;  4MJS B;  2PJH A;  1RFA A;  4E74 A;  2AQ3 B;  4IWQ A;  3CIR B;  3EHV A;  3PHX B;  4JWU C;  2NPT A;  1I42 A;  1MJD A;  2JY6 A;  3VQI A;  2CJN A;  2JYE A;  2EMS A;  1GAQ B;  3QIJ A;  1E10 A;  2L1A A;  1UGJ A;  1CQV A;  3A4S C;  1BUI C;  2WXK A;  4ZDV A;  1WH3 A;  3WAO A;  1OQY A;  3DVN V;  4ITK A;  2BS4 B;  2J0M A;  3HVD A;  3UQB A;  2JU6 X;  2CHX A;  3UQA A;  3JSV A;  2BF8 B;  3EA6 A;  1TZ1 A;  4RH6 A;  1HXY D;  1PQS A;  1L0X B;  1YIW A;  3NHE B;  4WWN A;  4W9E A;  3Q3M C;  3TUO A;  2QHO A;  2GRI A;  3MFG A;  4MGI E;  1IYF A;  3D32 A;  1OEY A;  2H89 B;  3K9O B;  2K1F A;  1D5Z C;  4KDL B;  4DXA B;  3H7P B;  3BK1 A;  1I4X A;  3FC4 A;  3ZNZ B;  1I35 A;  2NTT A;  4TUU A;  2KFJ A;  3TSS A;  4TSS A;  2WWZ A;  3ETR A;  3ZKJ C;  3IT4 B;  1FXI A;  2K25 A;  3VRA B;  3AU5 A;  3VDZ A;  2G9H D;  2J42 A;  2KWV B;  4XYC A;  1IBX A;  4WJN A;  1VDV A;  2RDB C;  2A4Z A;  3V6C B;  3RPF C;  3NY5 A;  5BYS A;  2JWZ A;  4M02 A;  4DHZ E;  1FO4 A;  2FID A;  1XD3 B;  3X0W A;  4F7Z A;  2PE9 A;  2X38 A;  2NVU I;  3B08 A;  4BFR A;  5BMI A;  1D3Z A;  2BB6 A;  3ZJV A;  1L7Y A;  4KGT A;  3PGE A;  1N62 A;  1JW9 D;  1YN4 A;  5D3I B;  1F77 A;  3V62 A;  4A8X C;  1HZ6 A;  4W9D A;  4EZK A;  4BKG A;  2B3A A;  2ASQ A;  1P98 A;  5DPR A;  2PKO A;  2KWU B;  2KTR B;  1C78 A;  4AWJ A;  4EOY A;  2MQJ A;  3IG3 A;  2MRP A;  3VH4 B;  1A70 A;  2M56 B;  2WGS A;  2N7J A;  4XGA B;  4ZRP A;  2Q5W D;  3DBL B;  2N9K A;  1XLP A;  1ET6 A;  5IOI A;  5BYR A;  4FBJ B;  2IJ0 A;  1WGD A;  2FCN A;  4RF0 A;  3BVG A;  4W9C A;  3IFW B;  4N9F 4;  2N4F A;  1STE A;  1E9M A;  4WAF A;  2DX5 B;  4GGQ A;  1UWM A;  2XK5 A;  3R7R A;  4BOS C;  3A33 B;  2V0G A;  3ZXR A;  2K0P A;  3L08 A;  1FFU A;  4C56 C;  2BKF A;  5HFY A;  5E6P A;  1IPG A;  4OZA A;  3AE1 B;  4B6W A;  2PVG C;  2IDY A;  1E8Z A;  2BS3 B;  3TEX A;  1WR6 E;  1ESF A;  1WGG A;  3CSF A;  2J0J A;  2WYQ A;  2KYW A;  3DBL I;  2VH2 A;  2BB5 A;  3C0R B;  1RRB A;  2LJI A;  1NEK B;  2KJR A;  4M0W B;  2DYO A;  2LJ5 A;  1N6Z A;  4II3 B;  3KW5 B;  2K3U A;  1YQ3 B;  3B1L X;  3Q6B A;  3T3N A;  3GB1 A;  3W5U B;  2V3N A;  4IM3 A;  3I63 C;  2C7M B;  4OVZ A;  4HJG E;  5E6N A;  1BT0 A;  2GOW A;  2ZVO A;  1KM7 A;  2MEK A;  3PLU A;  4EUT A;  2R2Q A;  4YSZ B;  1XQQ A;  2MWS B;  1FCC C;  3MHZ A;  2KDE B;  1MHH E;  2EKI A;  1V81 A;  1P7E A;  2MX2 A;  4TMA B;  1P3Q U;  4NNJ B;  1HE8 A;  4AP4 C;  1WE7 A;  1MVK A;  2NMQ A;  4MH0 E;  3WA0 A;  2LVP A;  3APC A;  3L16 A;  2L0F A;  1SF0 A;  3AI5 A;  3IAS 1;  4ZRQ A;  2QEJ C;  4AQ7 A;  2INC C;  3OAW A;  1UF0 A;  2C9W B;  4IWO A;  2YVC A;  3RNB C;  1MG8 A;  3GE8 C;  1SEB D;  2N7E A;  3C8Y A;  1V86 A;  4C4V A;  1M94 A;  4I6N B;  3IXS A;  2JYT A;  4JPS A;  1ZXH A;  2HE7 A;  4UDU C;  3IT6 B;  3AM9 A;  2J52 A;  3SU8 X;  2WXP A;  2DHZ A;  4P16 A;  3A1Q B;  4GOC A;  1KJT A;  1T6B X;  2MW5 A;  1FNW A;  2GBJ A;  2KZR A;  2ZZP B;  2YLM A;  4F8C B;  3RZW C;  3AEC B;  1WJU A;  5EE9 A;  2KVR A;  4GSW A;  4LNO A;  1JWB D;  3V05 A;  4FJY A;  1E7V A;  1WY8 A;  2IBI B;  1CK1 A;  2WP9 B;  2ZW1 A;  2FAZ A;  3ONS A;  2MBO A;  2R2O A;  2VRR B;  4XDD A;  2E3T A;  2JUO A;  3RNE C;  3EGR A;  5DCN A;  1PYW D;  2BPS A;  5FKA C;  3ZJU A;  1JML A;  2KMC A;  3UIN B;  3EC8 A;  3MTN B;  1N61 A;  3MC8 A;  3RN9 C;  4IW0 A;  1YNT E;  3VXW A;  2V3S A;  1J8C A;  1EO6 A;  1OTR B;  3FKY A;  2WLB A;  4N6E B;  1L6U A;  1KOT A;  4LNI A;  1VZ7 A;  4KKJ A;  3Q2A C;  2JX5 A;  1C1Y B;  1BML C;  3X23 A;  3R2T A;  1H8C A;  3U30 A;  2BYE A;  5EE1 A;  2DZJ A;  2WXQ A;  4Q2J A;  3APF A;  4ZRI A;  1WZ0 A;  3VAW A;  3T8M A;  3NJT A;  2PE6 B;  1WGH A;  1XCQ L;  3LYY A;  3SFE B;  5TR5 A;  4BVU C;  4US9 A;  5HHD G;  1EF1 A;  3GP7 A;  3PZD A;  2JVC A;  3U2S C;  2DZI A;  4GIV A;  2MHJ A;  3M95 A;  1PGB A;  1WFY A;  4BBN F;  3KUZ A;  1E5W A;  4YSY B;  3E9S A;  1FFV A;  3RI7 C;  1KH0 A;  1XXG A;  4GDK B;  4WUR A;  2UYZ B;  4EFO A;  4GXB A;  1R7S A;  1JRO A;  1FCL A;  1EUV B;  4L1B A;  2O2V B;  3A9K B;  3FAH A;  1K8R B;  3FIL B;  1EWC A;  3W1S A;  2NBU A;  3VTV A;  1UD7 A;  3L17 A;  3DPD A;  4AS1 A;  3QHT A;  3LJ3 A;  5EDS A;  4IUM B;  1F0Z A;  1OQR A;  2K39 A;  1XF5 L;  3QCA A;  1J19 A;  1HTO A;  4W9L A;  4JIO U;  2CJO A;  4RM8 A;  3P63 A;  4XE0 A;  1TKY A;  2N0S B;  4ZHO A;  1SJH D;  4JE3 B;  3C19 A;  2KKC A;  3RZF A;  3R3M A;  3SDL C;  2B76 B;  3P4Q B;  1F1H A;  2BKR B;  3DWM A;  4C80 A;  3MP9 A;  4JL9 A;  2Z8L A;  2HTM E;  1JRU A;  1WYG A;  3RNG C;  2NCN A;  3PZ7 A;  2HJ8 A;  2Z59 B;  3DVN U;  4DWF A;  3QAQ A;  4XX5 A;  4K81 A;  1XEE A;  2Y5P A;  1DOX A;  3ML9 A;  1FM0 D;  1AAR A;  3AH7 A;  2WS3 B;  2L52 A;  1Q10 A;  4RF1 A;  1MFW A;  3UIO B;  5D6J B;  2PW9 A;  2SEB D;  4DQO C;  3QX1 A;  2W54 A;  3QAR A;  1SE2 A;  1LO5 D;  5CHW A;  5GXG B;  4WJQ A;  2PMV A;  2KFK A;  2KVZ A;  1ZGU B;  5BO4 B;  3H9D A;  4YTP B;  2LRU A;  4PS3 A;  2DNF A;  1V9J A;  2KDB A;  1K50 A;  3AE4 B;  3N3K B;  3PRE A;  3VRB B;  4P1B C;  1ZKH A;  4W9K A;  2KNB A;  3RUL A;  1TYG B;  2WXM A;  1WXA A;  3P1M A;  3H6N A;  3VVW B;  1PGX A;  2ZNV B;  3B2G A;  1E8X A;  3AXC A;  4B95 A;  3T3O A;  2R61 A;  4IM2 A;  1E7U A;  1V8C A;  4ANU A;  4LNF A;  4KIK B;  2XEW A;  4FXC A;  2KWC A;  1GPX A;  4FN2 A;  1WR1 A;  2KMM A;  2N9E B;  2MBB B;  1V1P B;  2WU5 B;  1K51 A;  4OZB A;  1Q1O A;  2KT7 A;  4OVU A;  3ZLZ A;  1RWS A;  4XWT A;  3E56 A;  4I6L B;  4HCP B;  4HDO A;  3APD A;  4ICU A;  1FNV A;  2N7D A;  2IPK D;  2NS5 A;  4KX6 B;  1WMH B;  4S0R A;  3N30 A;  4L2Y A;  2L05 A;  2V4I B;  2LUE A;  3KWV A;  3VUX A;  1WXV A;  3NVY A;  3P2B A;  4LDT D;  1FPY A;  2K22 A;  2QIE B;  4HPP A;  1SB3 C;  5CTR C;  2LAS A;  3DBH I;  2LWP A;  4DXG A;  4BKS A;  3BVM A;  4TQ1 A;  4K3B A;  2JXX A;  1TGZ B;  4KGR A;  4NJC A;  3VHT C;  3A9J A;  3NVZ A;  3Q3N C;  2RGF A;  3I9V 1;  1KF6 B;  1HA5 A;  1YOV B;  2I2Y A;  4NJ6 A;  2SAK A;  3Q3O C;  4GDL B;  1SIJ A;  3HRD D;  4D2K A;  2ONQ A;  4HK2 A;  4TQ0 A;  2D3A A;  4FHK A;  3DQV A;  4DDI D;  1CMX B;  4S17 A;  4JX1 C;  1U4A A;  1WM3 A;  1P1A A;  1TTN A;  3BYT B;  1PGA A;  3AE3 B;  2GMI C;  3O65 B;  3AE8 B;  4LLG M;  2J53 A;  3Q8F A;  4FJV B;  4MH8 A;  4AUQ C;  3TL5 A;  3W2D A;  1J7B A;  3DBS A;  2C5L C;  2W82 A;  1ZXI A;  2KOX A;  4HKZ E;  2BBC A;  5JZE B;  1FNU A;  4YTN B;  2O6V A;  1EWY C;  1VLB A;  1RLF A;  2C7H A;  1T0Q C;  4B9K A;  3Q69 A;  3PPA A;  1WJ4 A;  3AED B;  2EMT A;  2V1Y A;  1P9D U;  3AMZ A;  4BKT A;  1GB4 A;  2WXL A;  2I1K A;  2GB1 A;  1XCT L;  4C7Z A;  3QQ8 B;  4MM3 A;  1GNU A;  3VH3 B;  2DEN B;  1I4R A;  4M8N A;  4LJP B;  2J4X A;  4RGT A;  2JSV X;  3ZJT A;  2LVO A;  1RM6 C;  1Y56 A;  3RNC C;  3DDC B;  4M8M A;  1D5M C;  1VD2 A;  3HM3 A;  1TY2 A;  2IY1 B;  1WF9 A;  3HUI A;  2N9X A;  3KUD B;  2C7N B;  1E8Y A;  3KYC D;  1MI0 A;  1C3T A;  2DLB A;  3RNA C;  3NS8 A;  2FCM A;  1UWX A;  5FR6 A;  5D94 A;  1S1Q B;  4E3C A;  3WIM A;  3BVZ A;  4GN1 A;  2WXI A;  4FJZ A;  1Z5S B;  2J7Q B;  2KX3 A;  5JH5 C;  2L0T A;  4EZL A;  1JQ4 A;  3I5J C;  1UGM A;  2X8X X;  4F1S A;  1PUT A;  4EZJ A;  2WDQ B;  5AEK B;  2JWU A;  4BKS D;  2BTE A;  1E90 A;  2MA9 B;  4US8 A;  2N1V A;  2JZP A;  2RPV A;  1GC7 A;  3ZDT A;  2PEA A;  4G3X B;  3RFZ B;  1ZDX A;  1LQB A;  5D7G A;  4W9J A;  2TSS A;  3Q8E A;  1ENF A;  4HCN B;  4MSM B;  1ZW7 A;  4BAX A;  3SFD B;  1KFY B;  3W1Y A;  2CKH B;  1AW7 A;  3NVW A; 
#chains in the Genus database with same CATH homology
 1I4H A;  5EE0 A;  1BML C;  3AEF B;  3VR9 B;  2MJ3 A;  1IGD A;  2WXG A;  5AUI A;  3R2T A;  1YJJ A;  3OWE B;  1TY0 A;  2LUM A;  2IGD A;  1F2R I;  1XLO A;  1GB1 A;  2LGI A;  4YWG G;  3ABV B;  4OW0 A;  1QLB B;  2MH7 A;  3FIL A;  3BZD B;  5EE1 A;  2WXQ A;  1VZ6 A;  4Q2J A;  1J7A A;  4EE2 A;  5LNK 1;  1FEH A;  1SE3 A;  2KWD A;  2KN4 A;  2BT6 A;  1WRI A;  1I4G A;  5H8Y E;  3DWG C;  3HVZ A;  2LHD A;  3NUH B;  4A9A A;  1XCQ L;  2G1E A;  2WDR B;  3LYY A;  3SFE B;  4ZHP A;  2KDM A;  3O13 A;  4US9 A;  2WQY B;  2K5P A;  5HHD G;  3W5V B;  1FXA A;  1L6V A;  1MHX A;  2AQ2 B;  3GP7 A;  3U2S C;  3I57 A;  2WU2 B;  1MPE A;  4MAC A;  4OHJ A;  1E0Z A;  3AB5 A;  1IGC A;  1I4P A;  2QSD A;  1L4Z B;  1PGB A;  1RYJ A;  4HKQ A;  5JXV A;  1JWA D;  4YSY B;  1SE4 A;  4ARI A;  3E9S A;  4IDI A;  1FFV A;  2I38 A;  1C4P A;  1KH0 A;  1WXQ A;  4A90 A;  1XXG A;  1N60 A;  4GDK B;  2RDH A;  4WUR A;  1GOZ A;  1JWU D;  2CU3 A;  1FD6 A;  1DYQ A;  1R7S A;  2BS2 B;  1JRO A;  2K9X A;  1FCL A;  1I4Q A;  1C4A A;  2E6X A;  4IKG A;  1CJE A;  4L1B A;  4N59 A;  4L23 A;  1NI3 A;  2ON8 A;  3LXF A;  2W55 A;  1IBX B;  3FAH A;  2AQ3 B;  2L83 A;  4J3O D;  3FIL B;  3CIR B;  2PIA A;  1N5X A;  1EWC A;  3W1S A;  4JWU C;  2KQ4 X;  2ICI A;  3ZQ4 A;  4AS1 A;  1NVI D;  3VQI A;  2CJN A;  2QJL A;  1C77 A;  1SBB B;  1HQR D;  2MJD A;  2JYE A;  2PVO D;  3AE2 B;  4RGO S;  1F0Z A;  1GAQ B;  1E10 A;  4WQM A;  2L1A A;  1OQR A;  1UGJ A;  1CQV A;  1XF5 L;  1XLN A;  2OHF A;  4XWW A;  3AE7 B;  1J7C A;  1BUI C;  2WXK A;  4A55 A;  1ZP0 B;  2LHE A;  4ARC A;  2CJO A;  3P63 A;  4XE0 A;  1C79 A;  1TKY A;  2N0S B;  4ITK A;  1SJH D;  2V3P A;  4JE3 B;  4ZHO A;  1PFD A;  2BS4 B;  3HVD A;  3SEB A;  1NYR A;  2JU6 X;  3EA6 A;  4RH6 A;  2INN E;  1HXY D;  2B76 B;  2VZK D;  2WNM A;  3P4Q B;  1L0X B;  3DWM A;  4C80 A;  3MP9 A;  2GI9 A;  3TUO A;  2Z8L A;  2HTM E;  1YMH E;  2GRI A;  3MFG A;  1AYF A;  1WYG A;  3NVV A;  3VR8 B;  1QKZ A;  5AUK A;  3UI3 A;  3GS2 A;  3PZ7 A;  2H89 B;  3AN1 A;  1C76 A;  4CQN A;  1D5Z C;  2Y3A A;  1ZPS A;  1JRP A;  1YN5 A;  2JQR B;  1XEE A;  2Y5P A;  4MT5 A;  5G5H A;  4WWM A;  1DOX A;  5BYQ A;  4REZ A;  3BK1 A;  5C2T B;  1I4X A;  3FC4 A;  1FM0 D;  1YJI A;  3AH7 A;  2NTT A;  2WS3 B;  2L52 A;  1L0Y B;  3TSS A;  1Q10 A;  3TEY A;  4TSS A;  1TS4 A;  3V3X A;  3ETR A;  4A6Q A;  1XO3 A;  4RF1 A;  3IT4 B;  1FXI A;  1N5W A;  1QOG A;  3VRA B;  4N58 A;  2PW9 A;  4WH4 A;  2SEB D;  4DQO C;  1M4V A;  2W54 A;  5FR3 A;  2G9H D;  1SE2 A;  1ET9 A;  2J42 A;  3AV8 A;  1LO5 D;  5GXG B;  5I4D A;  1V1O A;  4DXF A;  1IBX A;  1B9R A;  4C7Y A;  2IGH A;  4LK0 M;  3MC0 B;  1VDV A;  2FBW B;  2PMV A;  5HI1 A;  3RPF C;  5BYS A;  1PDX A;  1FO4 A;  4H2A A;  4YTP B;  2X38 A;  4RCO A;  1K50 A;  3AE4 B;  5BMI A;  3VRB B;  1TS5 A;  1VR9 A;  2BB6 A;  3BWU D;  4HEA 1;  3ZJV A;  4KGT A;  1ROE A;  2NTS A;  1N62 A;  1JW9 D;  1YN4 A;  5D3I B;  1F77 A;  3U52 E;  2PLP A;  1TYG B;  4A8X C;  3TEW A;  3P4S B;  2WXM A;  1HZ6 A;  4HRS A;  3P1M A;  3R8B A;  2WXO A;  1TZO A;  4NZL B;  2WXF A;  2LFI A;  1PGX A;  3Q8C A;  1JCK B;  3B2G A;  1VRA B;  3T3O A;  1FIQ A;  2PKO A;  2R61 A;  1C78 A;  1V8C A;  1ZOY B;  4P6V F;  2YEP F;  4FXC A;  1GPX A;  3B9J A;  2ZW0 A;  2KMM A;  1A70 A;  2M56 B;  1EU4 A;  1V1P B;  2WU5 B;  1K51 A;  4OZB A;  2N7J A;  2XN9 C;  5BMH A;  4ZRP A;  2Q5W D;  1RWS A;  4XWT A;  3E56 A;  2N9K A;  3P4P B;  1XLP A;  1ET6 A;  1FNV A;  5BYR A;  2EEL A;  2IPK D;  2IJ0 A;  3IAM 1;  4KX6 B;  3R2I A;  4RF0 A;  1JAL A;  1SXT A;  3BVG A;  4L2Y A;  1FMA D;  5FK9 C;  2DBY A;  2V4I B;  1L0V B;  3KWV A;  1HEZ E;  3NVY A;  2K22 A;  1STE A;  2KAJ A;  1E9M A;  1SSN A;  3LB8 C;  4WAF A;  1AN8 A;  2QIE B;  1QIL A;  2N9L A;  3KQ4 A;  1SB3 C;  1UWM A;  4GLS C;  3CWI A;  3Q8B A;  2RDG A;  2W3R A;  2V0G A;  1QOA A;  2LMC A;  3PZ8 A;  3J9C A;  3MJ5 A;  2K0P A;  2DYM A;  3SR6 A;  4DXG A;  3BVM A;  4TQ1 A;  3B2F A;  1B1Z A;  1FFU A;  4C56 C;  5HFY A;  2W3S A;  2QIL A;  1QOB A;  5MPO A;  4OZA A;  2AQ1 B;  4KGR A;  1C9F A;  4NJC A;  1WWT A;  3AE1 B;  2BW2 A;  5TSS A;  5D3D A;  1TJE A;  1TKG A;  2PVG C;  2IDY A;  2WXN A;  3NVZ A;  2BS3 B;  3BII D;  3N9Y C;  3TEX A;  4MM3 B;  1C4C A;  4YT0 B;  1ESF A;  1N63 A;  3I9V 1;  2AX5 A;  3KLS X;  1KF6 B;  1I7H A;  4JWS C;  1HA5 A;  1L4D B;  3U7Z A;  4ZOH C;  1E6E B;  4HRO A;  2LEK A;  2I2Y A;  2SAK A;  4GDL B;  1SIJ A;  1NEN B;  3HRD D;  4D2K A;  1T5X D;  2BB5 A;  2ONQ A;  4TQ0 A;  2LJI A;  1KTK A;  4YSX B;  3U4E G;  1NEK B;  1V1P A;  3AE5 B;  2DYO A;  4OZC A;  4PT5 A;  1VJK A;  4JX1 C;  3P42 A;  4YXD B;  3AE9 B;  2K3U A;  1YQ3 B;  1D6E C;  1EU3 A;  3NRZ A;  5T8I A;  3T3N A;  1EM7 A;  3GB1 A;  3W5U B;  2V3N A;  3BYT B;  1BXT A;  1PGA A;  4OVZ A;  4HJG E;  2VZK B;  2Y5C A;  3AE3 B;  4RNA A;  4RGM A;  5BMG A;  3AE8 B;  4LLG M;  2J53 A;  4KGS A;  3Q8F A;  2ACZ B;  4MH8 A;  4IOI E;  2MEK A;  4KKI A;  2WXR A;  3ZGZ A;  3W2D A;  1J7B A;  4YSZ B;  2MJE A;  2D5G A;  3NZ3 A;  1FCC C;  4LTU A;  5EE3 A;  2W82 A;  1RFK A;  1ZXI A;  3MHZ A;  4B0E A;  1D5X C;  1MHH E;  1UNS A;  2EKI A;  1P7E A;  4HKZ E;  1QT9 A;  3L4P A;  4TMA B;  2BBC A;  2WXJ A;  1F2R C;  2FUG 1;  1T3Q A;  2RMM A;  1FNU A;  3EUB 2;  4YTN B;  3P4R B;  1TS2 A;  1EWY C;  1VLB A;  1E7P B;  3H8H A;  3NS1 A;  3Q69 A;  3AE6 B;  2FE8 A;  1MVK A;  1YN3 A;  2NMQ A;  2PTL A;  2WXH A;  5C3J B;  3AED B;  1ZDV A;  3BK2 A;  1TKE A;  4RFB A;  3WCQ A;  1SF0 A;  3IAS 1;  4ZRQ A;  1KRH A;  2OED A;  2QEJ C;  3KWL A;  4AQ7 A;  1CZP A;  1VZ8 A;  3AMZ A;  5HG2 A;  1GB4 A;  4O1N A;  2WXL A;  2GB1 A;  1XCT L;  4C7Z A;  1KLG D;  1SEB D;  4WIP A;  3TEZ A;  2BYT A;  2H88 B;  2DWQ A;  3C8Y A;  1I4R A;  3IXS A;  2J4X A;  4RGT A;  2JYT A;  2JSV X;  3ZJT A;  1RM6 C;  1D4B A;  1Y56 A;  1IUE A;  4JPS A;  1TS3 A;  1ZXH A;  1V97 A;  5G5G A;  1D5M C;  4UDU C;  3AEA B;  4NAM A;  3IT6 B;  3AM9 A;  4M0W A;  5H92 C;  1TY2 A;  4NAW B;  1WSP A;  2J52 A;  1ZUD 2;  1SJE D;  3HUI A;  1K52 A;  4XDC A;  1NYQ A;  2WXP A;  2HDE A;  4P16 A;  1MI0 A;  1QF6 A;  2DLB A;  1T6B X;  4ZYS A;  1UWX A;  1FNW A;  1YQ4 B;  1K53 A;  1QOF A;  3Q8A A;  1DOY A;  2QMT A;  2M19 A;  1DOI A;  1ACC A;  3AEC B;  1QQR A;  1FRR A;  2M0A A;  2XNA C;  3BVZ A;  2WXI A;  5EE9 A;  3URY A;  2WDV B;  1JWB D;  3V05 A;  2KAC A;  3AEE B;  1CK1 A;  2WP9 B;  2ZW1 A;  1P7F A;  4B0M A;  1JQ4 A;  3PO0 A;  1ZE3 D;  3ZYY X;  1FRD A;  3W9C B;  1AWD A;  1PUT A;  4XDD A;  2WDQ B;  2JWU A;  2E3T A;  5E6J A;  3EGR A;  1PYW D;  2BTE A;  4US8 A;  2IGG A;  3BYY B;  5FKA C;  1WGK A;  1OQQ A;  3ZJU A;  1JML A;  2JZP A;  4RGN A;  1UUP A;  2RPV A;  1JWS D;  2YEP B;  1N61 A;  2JXT A;  1KLU D;  3RFZ B;  1ZDX A;  5D7G A;  1YNT E;  2TSS A;  3Q8E A;  1ENF A;  1HZ5 A;  1OFF A;  1L5P A;  4R3D A;  2WLB A;  3AEB B;  4N6E B;  1JWM D;  1XLQ A;  3AEG B;  2INP E;  1L6U A;  3SFD B;  1KFY B;  4YTM B;  1VZ7 A;  2L32 A;  4USA A;  1DGJ A;  1AW7 A;  4KKJ A;  2JX5 A;  3NVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...