2WLBA

Adrenodoxin-like ferredoxin etp1fd(516-618) of schizosaccharomyces pombe mitochondria
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
GTGIKVFFVTPEGREIMIEGNEGDSILDLAHANNIDLEGACEGSVACSTCHVIVDPEHYELLDPPEEDEEDMLDLAFGLEETSRLGCQVLLRKDLDGIRVRIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ELECTRON TRANSFER PROTEIN 1, MITOCHONDRIAL
publication title Structural and Thermodynamic Characterization of the Adrenodoxin-Like Domain of the Electron-Transfer Protein Etp1 from Schizosaccharomyces Pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Electron transport
total genus 24
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wlbA00
2H89B 1FXIA 1OQQA 1DGJA 1XLNA 2ACZB 2MH7A 2WDVB 3AE7B 1FIQA 3AEDB 3AEAB 3NVVA 5MPOA 3B2FA 1NYQA 2QJLA 1R7SA 1EWYC 2L52A 3AMZA 2CJOA 3AB5A 1VJKA 2W55A 3AE6B 1XLPA 1ZP0B 1L6VA 2MJ3A 3WCQA 4C7ZA 2AX5A 1CJEA 1ROEA 2H88B 4P6VF 4N59A 2DBYA 2K5PA 3VR9B 1WYGA 1ZXIA 1RM6C 1AWDA 1L0VB 3CWIA 3FAHA 1F0ZA 1JQ4A 1RFKA 1FM0D 4ITKA 1QT9A 1FRDA 3ETRA 2K9XA 3P1MA 1NYRA 2HTME 4YXDB 1QOBA 1L6UA 1WGKA 2MJDA 2PVGC 2WS3B 1SF0A 3NS1A 3P63A 5GXGB 1L5PA 3AE3B 4JX1C 1E6EB 4WQMA 1FO4A 3AE2B 1I7HA 2L83A 3EUB2 3AE1B 4C7YA 5EE9A 4FXCA 2M19A 2G1EA 3AH7A 1KFYB 1N62A 2WLBA 1TKEA 2K22A 3SFDB 4C80A 3SFEB 1N5WA 1UWMA 3NRZA 3W9CB 4JWUC 1VLBA 3KWLA 4N58A 2KAJA 4KX6B 1FMAD 1NI3A 4USAA 1E0ZA 1GAQB 4A9AA 1RYJA 1N61A 3AEGB 3HVZA 1XLOA 2BS2B 1QOAA 3AEEB 2WU5B 1FRRA 1PDXA 3DWGC 1E9MA 4YTNB 1XO3A 1TKYA 1E10A 1OFFA 1XLQA 2MJEA 5EE3A 4YSXB 1DOIA 1QF6A 1ZUD2 4WWMA 1N63A 3BIID 3CIRB 1QLBB 3AE5B 3NVWA 1NVID 1OQRA 4N6EB 1NENB 1JALA 2CJNA 3AE4B 3HUIA 1IUEA 3NVZA 3P4SB 1B9RA 3VR8B 3DWMA 2WDRB 4JWSC 4YSZB 1JROA 1DOYA 2JX5A 1CZPA 3VRBB 3RPFC 4ZHPA 2DWQA 3W5UB 1GPXA 2WDQB 2WU2B 2W3SA 5AUKA 4YT0B 1J7BA 3AM9A 5G5HA 3AE9B 4YTPB 1FFVA 1T3QA 1A70A 3P4PB 2PIAA 2LEKA 2BS4B 3NVYA 5EE0A 1JW9D 3VRAB 2EKIA 4YSYB 3FC4A 3AECB 2W54A 4IDIA 3P4RB 2CU3A 2N0SB 3SR6A 1YQ4B 1YQ3B 1FFUA 3AN1A 1TJEA 1JRPA 1FXAA 2WP9B 3L4PA 1YJJA 3HRDD 1PFDA 3PO0A 5G5GA 1J7CA 1V97A 4LTUA 2FBWB 1ZOYB 4YTMB 3AEBB 1NEKB 1WRIA 1WWTA 1RWSA 2WQYB 4ZOHC 5EE1A 3LB8C 1KRHA 1AYFA 1PUTA 3B2GA 1SIJA 1N5XA 5H8YE 2W3RA 1WXQA 1KF6B 1VDVA 5AUIA 1TYGB 5C2TB 3AV8A 1TKGA 3ZYYX 2BT6A 3LXFA 2Y5CA 4HROA 1QOGA 1SB3C 1JWAD 1YJIA 2Q5WD 4US9A 1E7PB 1J7AA 4HRSA 1N60A 3AE8B 5H92C 3W5VB 1QOFA 1V8CA 1JWBD 2BS3B 2E3TA 3B9JA 3P4QB 4US8A 2B76B 2PKOA 2OHFA 2QIEB 3AEFB 2KMMA 4ZHOA 5C3JB 3ABVB 2JQRB 1DOXA 2PVOD 2M56B
chains in the Genus database with same CATH superfamily
4RF0A 3AEAB 2C7NB 3H9DA 2WX1A 1R7SA 5FKAC 2CJOA 1WXVA 1OTRB 2JXXA 4A8XC 1CJEA 4II2B 4RGMA 3DBHI 2V3PA 3D32A 3SDLC 3EGRA 4XC2A 3ML8A 5BMHA 3ETRA 1VZ7A 2X8XX 4KKJA 1WGKA 2KQ7A 1V1OA 3GZNI 2LGSA 1E6EB 3AE2B 1I7HA 1OEYJ 1YQBA 4GDKA 4EZLA 3UQAA 1C4PA 4K7WA 1YOVB 4FXCA 2M19A 4P1BC 3IFWB 4BZAA 2KAJA 4MT5A 1N61A 1SE3A 1UUPA 2WU5B 1DOIA 1TGZB 4A55A 4CO7A 3QQ8B 4W9HA 1QKZA 2QILA 3H1UA 2LVOA 3W5UB 3U2SC 2JF5A 2KANA 5HHDG 2A5UA 1YX5B 4BFRA 2UWQA 1TIFA 1FPYA 5IN7A 3VTWA 1WE6A 2RDBC 4IW0A 3DBHB 3T3NA 2I1KA 1TS4A 3ECIA 3BK2A 2WQYB 1FEHA 3GZNB 3LB8C 5D94A 2IDYA 1VD2A 3PTFC 1TS2A 3APFA 4AJWA 1V9JA 2AYOB 1SB3C 4ANVA 1E7PB 2RGFA 3PLUA 2KJRA 4GDKB 2QSDA 2MLBA 2BWES 3BVZA 3MHZA 2C9WB 1IGCA 5IAAC 1RRBA 2WXKA 3AE6B 2V4IB 2QHOA 3L0WB 3QARA 3KYCD 2KKCA 3CMMB 1WX7A 3R66C 3PREA 1F0ZA 3PPAA 1L6UA 1WJUA 3U7ZA 1YN5A 2FUG1 2KN4A 3AH7A 3TEWA 1N62A 4EFOA 3IAM1 1N5WA 1YNTE 2LZ6A 2JT4B 2KDBA 2MJEA 3ZO5B 4B9KA 3AXCA 3KQ4A 1GG3A 3BIID 1QLBB 4N6EB 1NENB 2BBCA 5BYRA 2PTLA 4JWSC 2WDRB 1DOYA 2RR9A 4ZHPA 3DBSA 2IPKD 3O13A 5BMIA 1I4PA 1J7BA 3VVWB 1A5RA 1FCLA 3Q3JA 4TQ1A 2KZRA 3VQIA 1R4NI 3ZLZA 1C78A 1V80A 1I4QA 2KWUB 3L54A 2NCNA 3JSVB 1JRPA 1K8RB 4EE2A 1I35A 1WR1A 3BZDB 4PS3A 2N9EB 1TKGA 1MPEA 3K9PB 2RPQA 4US9A 3PGEA 3GS2A 1C79A 4DXAB 3TMPB 1V8CA 4MSQB 5IA7A 1SE4A 1FNVA 1GB1A 2V3NA 2CHWA 3V61A 4RMAA 4LNFA 3A9KA 1MG4A 3ZXVA 3ZIMA 2MH7A 2XK5A 3VH3B 1P7FA 2K6DB 3FILA 3UF8A 1WIAA 3SEBA 2FIDA 4G0NB 2M4NA 1ZXIA 1XCQL 3QHTA 1ZDVA 3RNAC 1RFKA 3AU5A 2BYTA 2K25A 5FR6A 3LYYA 1R4NB 2O2VA 2HTME 1F2RC 2ZCBA 4NQKE 4ANWA 4NQLB 2G1EA 2K22A 1VRAB 2WXGA 2KTRA 3CF6E 1FD6A 3GE8C 4NZLB 4IWQA 1FRRA 1E9MA 3M63B 5EE3A 1Z2MA 2KFJA 2JSVX 4W9DA 3UQBA 4TKNA 4S0RA 4OZBA 3M62B 2KDFB 1IBXA 1CZPA 4FJYA 3TUOA 4ANUA 3TEYA 2JYEA 4BKGA 4M0WA 4GSWA 1JW9D 2MP2B 1E7UA 3TSSA 4IDIA 1VR9A 1Q1OA 2N0SB 3DCGA 3TEXA 1YQ3B 2NPTB 3A1QB 5AZGA 2BYVE 4YWGG 2GRIA 1HXYD 2LRWA 4KGTA 3TEZA 2JPHA 1PUTA 1WGRA 2GBMA 2D11A 2FAZA 4MGIE 2O2VB 4L23A 4ZRJA 5E6PA 5CX3A 4HRSA 1MVKA 4E3CA 1SEBD 2AQ2B 2V9HA 5J18A 5JXVA 3P4QB 1F52A 2K1FA 3VUXA 3ABVB 3MC8A 2PVOD 4AP4C 2KD0A 4DXGA 5D2MB 4F1SA 5LNK1 3EA6A 3L13A 4OVVA 1UGMA 1RFAA 4GB9A 2GB1A 4N59A 2OJRA 4XDCA 4KGSA 1ZDXA 1HZ5A 2KQSA 1WJNA 3KYDD 4JLCA 4HDQA 4IWOA 4NAWB 2MJDA 2WS3B 1FNUA 3UI3A 3PS6A 1LFDA 4WJPA 4RM8A 3RNEC 1GJZA 3NHEB 1C76A 3RI7C 1STEA 2Z8LA 4A9AA 3AEGB 1MHXA 1QOAA 4H2AA 1E10A 2K6QA 1UD7A 4WWMA 3PZ8A 3HUIA 3NVZA 4I6LB 3R3MA 3RPFC 1Y8RC 2RDGA 2ZJDA 4TSSA 2N9PC 4RGOS 4YT0B 1WRDB 4WH4A 2DYMA 2BS4B 4KSKC 4DHJD 1TS3A 2LHDA 2LJIA 3P42A 3I63C 3PO0A 2JRHA 4EOYA 1K51A 1WGHA 4LJPB 3GOEA 1P3QU 1NEKB 3WANA 3TBLD 4P16A 2WXNA 1D5ZC 2GMIC 2LVQA 3LDZE 4RNAA 2Z59B 4HCPB 3DVNV 3V62A 1HZ6A 3H7SA 1J8CA 2DZJA 1ET6A 1TY2A 1T5XD 1C3TA 4RH6A 2FCQA 3KVFB 4DBGA 4TV3A 4MGYE 1E8XA 3DVNU 2K5PA 2KDEB 3HM3A 4KV2A 2HJ8A 4I6PA 2BYEA 1FXTB 4BBNC 3T8MA 1KLVA 3ZNZB 1LQBA 1ZGUB 4F8CB 1PYWD 4GOCA 2J0JA 3R2TA 2Y5PA 4D2KA 3HHMA 5E6OA 1GC6A 2TSSA 1S3SG 2LGXA 4HXDA 4RF1A 4AS1A 5HFYA 1QILA 2OOBB 2MA9B 3DWGC 2MBOA 1C4CA 3UINB 2L1AA 2G3QB 3OWEB 2XN9C 2JZZA 2AL3A 3VRBB 2C7HA 1Q0WB 3GB1A 3NZ3A 3DBRI 5KHOA 5J2RA 2DLBA 4II3B 4CYEA 3AE9B 4IM3A 2N7EA 2KDMA 1EF5A 2DENB 1JWUD 1KLUD 4GXBA 4K81A 3CSFA 1P9DU 1AW7A 1ISNA 1YJ1A 2IGGA 4W9GA 4BBNF 3W1SC 3U52E 1FFUA 3IT6B 2W82A 2RMMA 2EKEC 4RGNA 4HVBA 2NBUA 1P7EA 3P2BA 4GIVA 1AYFA 2QCZA 4LNKA 1WY8A 5AUIA 1C77A 2KDIA 2MBEA 2WXHA 4BKSD 3VTVA 2J0KA 1JWSD 1J7AA 2KQ4X 4MM3A 3OAWA 2DZKA 5T8IA 1DOXA 3DDCB 3FC4A 2MX2A 1NYQA 3ONSA 2CU1A 4K3BA 5HKHA 3R7RA 3DBRB 3N1XC 3U8ZA 2I1JA 1XXGA 1V5TA 2DYOA 2BKRB 4XZ4A 4J6IA 1UELA 1L5PA 1M94A 1KJTA 4IG7B 4GLSC 3U4EG 1TKEA 3SFDB 3EFCA 2KFKB 2NVUI 2K8HA 3V6CB 4A90A 1T0SC 3OG5A 3PV1A 3Q8CA 2MW5A 2YVCA 2MHJA 4JQWC 2FCSA 1XLQA 1EM7A 2LFIA 4G3XB 1WE7A 4XE0A 4KIKA 2ZVOA 1WXSA 4NPNA 4FHKA 4R3DA 2JUOA 2IJ0A 3N30A 1CK1A 4KZ0A 1Q5WB 3KLSX 4CHKA 4W9CA 2ZNVB 2N1WA 2ZPNA 1MFWA 2M0XA 4K7SA 4WJQA 5AEKB 3BYYB 4UDUC 3HRDD 4LTUA 1ZOYB 2FNJB 2XBBC 3R8BA 2D07B 1B1ZA 3QA8A 4ZOHC 4HJKA 3HM6X 3BY4B 1WXQA 3WAMA 4B0EA 2WNMA 4FJVB 2KMCA 2CKHB 3V05A 1IPGA 4K3CA 1JWBD 4L1BA 2NR2A 4MEMA 4LNIA 1EU4A 1GUAB 1I4RA 3OJ4B 4EZJA 3ML9A 3J9CA 3ZTDA 4TMAB 2WDVB 1DGJA 2R61A 1YD8U 1OEYA 1EWYC 3AB5A 2FE8A 4ZYNA 1L6VA 3WCQA 4IOIE 3SD5A 3ZNHB 3EECA 1EUVB 3ZUNA 4I6NB 5DCNA 2V0GA 4LCDE 1E5WA 5TR5A 1MJDA 2LXCA 4HEA1 3P1MA 4OHJA 2D3BA 1EU3A 3HIZA 4WQMA 1N6ZA 1KLGD 3Q3FA 4WIPA 3L17A 4LDTD 4NJ6A 4JGHB 1WM3A 1E0ZA 1GAQB 3DPDA 3E56A 1LGRA 3NUHB 3L08A 3Q3NC 3WALA 4MDKE 4NAMA 2CJNA 3ZNID 3IAS1 4HWIB 2L32A 4P7IA 1GB4A 3UGBB 4FULA 2W3SA 3JVZX 4M8MA 5G5HA 4YTPB 1P0RA 4B95A 4JIOU 3NVYA 4RGTA 4E71A 1WI0A 2J52A 1YIWA 4OZCA 4GGQA 5JHBA 4BKSA 3L4PA 1L4ZB 3AU4A 3N9YC 3K9OB 3QIJA 1I4HA 5H8YE 2NS5A 2W3RA 1XD3B 2J42A 1D5MC 4XYCA 4HPMB 5HG2A 2VZKD 4WJOA 2IY1B 2KK8A 4A3OA 1J0GA 2I2YA 3B2FA 3HK0A 4ARCA 3B08A 1NI2A 4KGRA 5DPSA 1TS5A 3VUYA 1WMHA 3DVGY 3NG0A 2XNAC 3V60A 3ZNGC 3U7DA 1V81A 1WH3A 3RYTA 4ZDVA 3NS1A 2WXMA 4C4VA 3QC8B 3AE1B 2N1VA 1KH0A 3UIOB 5I4DA 5D3DA 3NRZA 3QX1A 3OJ3A 3VFKA 5JH5C 4USAA 1RYJA 1OQYA 5DPRA 4HPPA 1LXDA 2IZVB 2WDTB 3IHPC 3JW0X 4M01A 1UBIA 4PYUA 1NVID 4HLEA 4JE3B 2DWQA 4PS8A 3DBLI 4M02A 1WX9A 3BVGA 2QC8A 1A70A 3B0AA 2KC2A 1K52A 4A6QA 4WWPA 4URKA 1PFDA 5G5GA 2AQ1B 3ZGZA 2O6VD 1EWCA 4ANXA 1WWTA 1WMHB 1HQRD 3I3TB 3B2GA 1N5XA 2HJ1A 1WGGA 3R7QA 3PZ7A 3ZYYX 2INDC 3ZTCA 3ENEA 4AUQC 3PSEB 4DHZE 3W5VB 3Q6BA 3A9KB 5BYSA 1HA5A 2KACA 1TZOA 2WX0A 2XK5B 1V86A 3FILB 2WXJA 1XLNA 3EUB2 3AE7B 1FIQA 1ZE3D 2KC1A 3MTNB 1H4RA 3X0WA 3DBLB 4W9KA 2LVPA 1DYQA 2WXRA 4WAFA 2DNFA 4S17A 4DWFA 3ZRFA 3PHXB 2PVGC 1SF0A 3KUDB 1E8WA 3HVDA 1HEZE 1FO4A 2KTRB 1V1PA 4FLHA 3Q8FA 2K0PA 4AJYB 4JWUC 2Z0DB 2D3AA 4K7UA 1ET9A 4EZKA 4YTNB 2GBRA 2LGIA 4LJOB 2LMCA 1IBXB 1SXTA 2R2QA 3AE4B 3VR8B 3DWMA 4RFBA 5E6NA 4RCOA 2GI9A 3IBEA 4M0WB 1YN3A 4MGKE 5CTRC 1IYFA 1UWXA 2WGSA 3C8YA 2R2OA 2AWTA 2LGDA 1TJEA 1J7CA 1V49A 2V1YA 1F2RI 3KWVA 3A9JA 5EE1A 2N4FA 1KRHA 4FA6A 2YEPB 1KF6B 3BINA 3ALBA 1L0YB 4HROA 2LUMA 4LNNA 2E6XA 3AULA 4ZRIA 3EFUA 2NTTA 1YX6B 3ZRCA 3VXWA 1UNSA 2QIEB 2KMMA 2KJ6A 2M56B 1V2YA 1FXIA 3RUIB 3RULA 2QJLA 2L52A 1EF1A 3W1YA 1ZP0B 2MJ3A 1ENFA 2JZ3B 2LASA 2IO0B 4IKGA 4XGAB 4DDID 4LLGM 3PHWB 2L0FA 1WYGA 3VR9B 1WF9A 4AOFA 2LHEA 2D3CA 1PGXA 3EHVA 3MP9A 4IM0A 3IXSA 4JX1C 3OLMD 2MBHA 2RSUA 4BOSC 3Q14C 2L83A 1T6BX 4KZCA 2N9KA 4M00A 3Q2AC 2KVRA 2BGFA 4MELA 4YL8A 1YMHE 5BYQA 3SFEB 3R2IA 3C19A 2DHZA 2FUHB 4OVZA 4XDDA 1C9FA 1XLOA 2GBKA 4GDLA 1TZ1A 4OVUA 1GOZA 1WXAA 1TKYA 5G55A 3CSTA 2VZKB 1ZUD2 1Q10A 3A9JB 3URYA 1B9RA 4NY0A 1R4MI 1JROA 2CHXA 2HD5B 1UGJA 2JX5A 3S2AA 3Q8AA 3PRPB 2C5LC 1KTKA 5AUKA 2JVCA 2JRIB 2PW9A 3P4PB 4KDLB 2O6VA 4MH8A 3H8HA 1X1MA 2JY6A 3E9SA 1FXAA 1KOTA 5G2NA 3RZWC 1V97A 2FBWB 2RDHA 5IOIA 2C7MB 2WWZA 1F9JA 1KM7A 2L76A 1MHHE 1TYGB 3RMKC 2M17A 4MJSA 3V6EB 5L83A 1JWAD 2KMAA 3Q3MC 1PQSA 1QOFA 1TTNA 3ZDTA 1L2NA 4TUUA 3AEFB 2PE6B 3W2DA 4ZRQA 5L95C 3N1ZC 4HCNB 2J7QB 1VJKA 2W55A 4GDLB 3X23A 1R4MB 3I9V1 5CHFA 2INNE 2AX5A 2GLSA 2LGYA 3APDA 4PT5A 2KOXA 1FRDA 5BMGA 3H6NA 1QOBA 3RNBC 1WJ6A 3RZFA 1UH6A 3MHSD 3VDZA 3WIMA 3L10B 1VZ8A 1VLBA 4ICVA 2BVCA 3UIPB 3HVZA 3IVFA 3PZDA 2BS2B 3QCAA 2KJHB 1PDXA 3PLVA 4BOZB 1E8ZA 4DK5A 4HPLB 2BWFA 4YSZB 1G6JA 2AL6A 1SE2A 2WYQA 2PMVA 5FR3A 2KLGA 2WDQB 2UU7A 1AARA 3TCAA 4BVUC 1IGDA 3IG3A 5EE0A 4K1RB 2KLCA 3Q8BA 2CU3A 3PRMB 4QAYA 1HE8A 2AQ3B 2L0TA 1JMLA 1I42A 5C23A 2BB5A 3ZW3A 4CQNA 2W9NA 1Y56A 1VCBA 2A4ZA 4FBJB 1VDVA 5C2TB 4B0MA 3BK1A 4MM3B 1QOGA 1YJIA 2Q5WD 4OZAA 2N7DA 3AE8B 2IY0B 3VUWA 1WFYA 1WZ3A 1E90A 4RM9A 5D7GA 2MCNB 2ACZB 4WQOB 2BW2A 2DZMA 2ZZPB 4AQ7A 3AMZA 3SHQA 3V3XA 2HE7A 2IO2B 3KH0A 2ON8A 4FADA 2IO1B 1V5OA 3ZQ4A 2MEKA 4P6VF 2NBWB 3FAHA 5IO9A 3W1SA 2MQJA 3PT2B 4HKQA 4ITKA 4P1CC 1JWMD 2K9XA 4XX5A 1YN4A 4LK0M 4O1NA 2WXOA 1WX8A 1J19A 2LJ5A 1UWMA 2ZW0A 2QEJC 2NTSA 3AEEB 4KIKB 1M4VA 1XO3A 3RNGC 4B6WA 4DHJB 3H7PA 1GC7A 1F77A 1N63A 4W9IA 1OQRA 2WXFA 1UBQA 2KX0A 2M8SA 2MBQA 3L16A 4EUTA 2FCMA 4NNJB 3SU8X 1UZXB 3DHHC 2UYZB 3DVGX 3GE3C 3RD2A 2QMTA 2D5GA 4WWOA 3VRAB 5E6JA 4YSYB 3P4RB 4HK2A 4WJNA 2PEAA 3AN1A 2SEBD 2KWCA 1YJJA 5GMVA 4HDOA 2DAJA 1LM8B 1T0RC 3JSVA 2X38A 2RD0A 3FKYA 2JWUA 3RT3B 1D5XC 4X57B 1QZEA 3RCZA 2L00B 3N1YC 5J17A 4GN1A 2KVZA 2KWVB 3QWZB 4F7ZA 2IGDA 3M3JA 5D6JB 3PRZA 2ZVNA 4ZHOA 2N9XA 2H89B 4EKUA 2EMTA 3ZXRA 3APCA 3ZVVA 2LRUA 2L7RA 5AZHA 1XLPA 1S1QB 2DAFA 2IGHA 1NBFC 2INPE 4TQ0A 3H7PB 2DBYA 1C1YB 1RLFA 1AWDA 3CWIA 4G50A 3T3OA 1FM0D 4W9JA 1MG8A 1JCKB 2CS4A 4WWNA 1NYRA 3JYUA 1LO5D 1IP9A 2BQQA 3VH4B 2INCC 3A4SC 4PS7A 4C80A 1D3ZA 3BVMA 1SJHD 3A33B 2MSED 1GNUA 4IM2A 4DDGD 1CMXB 1PGBA 4DQOC 1L4DB 2LI5A 3NVWA 3TL5A 1OGWA 2LWPA 1D6EC 3P4SB 2DX5B 5HI1A 4WAAA 2ONQA 2K3UA 2MWSB 2K8CA 1CQVA 2I38A 1ZKHA 5JZEB 2D3GA 1T3QA 2WXIA 2GBJA 3DHGC 1ZW7A 2LEKA 2HDEA 2MBBB 3EC8A 4ZYSA 1I4XA 2WXQA 1PGAA 4DXFA 2CR5A 4FHJA 1BMLC 1E8YA 3SR6A 2PLPA 2MP2A 2Y5BB 5IP4D 1JRUA 2NPTA 3MJWA 4G11A 1WRIA 3A1QA 2V4LA 2KT7A 4JL9A 3M95A 4AWJA 2Y3AA 2DZIA 5CHVC 1RAXA 1XQQA 2YLMA 1K50A 1NDDA 5LLIA 2JZPA 1QF6A 1WZ0A 2MRPA 5CHWA 4XWWA 5BO4B 2YEPF 2K39A 3B9JA 4BKTA 2ZCCA 3AEDB 5H92C 2SAKA 3MC0B 3RN9C 1SSNA 4JPSA 4KVGB 2V3SA 4MH0E 1ROEA 2H88B 1L0XB 1BT0A 4C4VB 2JXTA 1I4GA 1QT9A 2BB6A 4YXDB 4KKIA 5GXGB 3N3KB 3P63A 2J0MA 2BF8B 5D3IB 4W9LA 4NAWA 4C7YA 1SGHA 3TJPA 2KXJA 1KFYB 4EEWA 2WLBA 2KO3A 3RNCC 2B3AA 2M0AA 4N58A 4KX6B 2BPSA 2BYFA 3N20C 3I5JC 2D2QA 4IUMB 4C00A 2LXAA 3ZJVA 3NZSA 2K8BA 3NJTA 3AE5B 1EO6A 2KN5A 2G4DB 1XCTL 3A4RA 3T9LA 1F1HA 1SIFA 1GPXA 1E7VA 2GBNA 3AM9A 1FFVA 4FN2A 2REXA 1WM2A 4REZA 2PE9A 3MC9A 3PVLA 2PIAA 2FIFA 4W9FA 2EKIA 4GMVA 3AECB 2BTEA 1YQ4B 2M1MA 3DOWA 4A20A 4NJCA 2JYTA 4OW0A 3RNFC 3QJZA 4MSMB 1SE9A 1HTQA 1WXMA 1WJ4A 4FJZA 1K53A 3AV8A 5TSSA 1WGDA 1P1AA 2ASQA 2BT6A 2J4XA 2J53A 1TY0A 3I57A 3LJ3A 1QQRA 4J3OD 3U30A 1WGYA 2VRRB 5LXHA 2BS3B 2E3TA 4HKZE 4US8A 2B76B 2PKOA 5C3JB 2PJHA 2AEHA 1OQQA 1XEEA 3MJ5A 2N7JA 3RFZB 4LDTB 4C7ZA 2IBIB 2ZPYA 4PK1A 1ACCA 1L0VB 3B1LX 2N9LA 1T0YA 2CHZA 2EELA 4LNOA 1SBBB 3KW5B 1V1PB 3AE3B 3Q8EA 2GOWA 3IT4B 4XWTA 1XF5L 2IO3B 3MFGA 1AN8A 4WURA 4ZRPA 4DHZB 3VHTC 2ICIA 3W9CB 5FK9C 3KWLA 1FMAD 1ZPSA 1OFFA 2WXPA 4YSXB 4E74A 1VZ6A 3CIRB 1C4AA 2JWZA 1FCCC 2KWDA 1JALA 2G9HD 1IUEA 3DHIC 2KTFA 1TT5B 3AI5A 1BUIC 2ZNVC 4W9EA 3N32A 5DPTA 2WU2B 3O65B 2VH1A 1MI0A 3ZDMC 4NJ7A 2VH2A 3BWUD 2LD9A 3KUZA 2KX3A 1TBEA 2IYDB 4ASWC 3QK0A 2WP9B 4IWPA 4PYZA 3WA0A 2KNBA 1H8CA 3AEBB 1RWSA 2LUEA 4BAXA 1SIJA 1WSPA 1HTOA 1FNWA 3NZUA 2FCNA 3NOBA 4KSLC 2ZW1A 2Y5CA 2JU6X 4ACFA 2BKFA 1N60A 2C60A 3Q3OC 2QDFA 2OJWA 3Q69A 2EMSA 4ZRKA 1SJED 2JQRB 4A3PA 3NVVA 1BXTA 5MPOA 2L3ZA 2Z0EB 3VTUA 2NBVB 1U4AA 2L05A 2G4SA 1L7YA 4GU2A 5IKCM 4C56C 1RM6C 3TIXA 2OEDA 3ZJTA 1JQ4A 2PPHA 4L2YA 4M8NA 1P98A 3BYTB 2RPVA 5EE9A 2DYBA 4IC7B 3ZKJC 3KUCB 1NI3A 3NY5A 2G45B 2L8JA 2XEWA 3C0RB 2KFKA 4N9F4 1T0QC 2KHWB 3QAQA 5EDSA 5C1ZA 4MACA 3NS8A 1Z5SB 4Q2JA 5KHQA 3ZJUA 1ZXHA 1D4BA 3WAPA 4KDIC 2O6VB 2D10A 1V6EA 1WR6E 4MGZE 3DQVA 2W54A 2NMQA 4HJGE 4YTMB 2HTHA 5JHAA 3VAWA 3GP7A 4MJSB 5AZFA 1UF0A 4ICUA 5DPWA 2WXLA 3LXFA 3WAOA 2ZEQA 1WYWB 5LXIB 2WHIA 4ARIA 1ESFA 2KYWA 1XT9B 2OHFA
chains in the Genus database with same CATH topology
2H89B 2WXJA 1XLNA 1ET6A 1TY2A 3AEAB 3AE7B 3EUB2 4RF0A 1FIQA 1ZE3D 1T5XD 4RH6A 1R7SA 5FKAC 2CJOA 1XLPA 2IGHA 2INPE 4A8XC 1CJEA 4TQ0A 2DBYA 2K5PA 4RGMA 2V3PA 1DYQA 1AWDA 3CWIA 2WXRA 3T3OA 3EGRA 5BMHA 1FM0D 4WAFA 3ETRA 1JCKB 1VZ7A 4KKJA 1NYRA 1WGKA 2PVGC 1LO5D 1SF0A 1V1OA 3HVDA 1E6EB 1HEZE 1FO4A 3AE2B 1I7HA 1C4PA 1PYWD 1V1PA 4FXCA 2M19A 3R2TA 2Y5PA 3Q8FA 4C80A 2K0PA 3BVMA 1SJHD 4D2KA 4JWUC 2TSSA 2KAJA 4RF1A 4MT5A 4AS1A 1N61A 1SE3A 1ET9A 1UUPA 1QILA 5HFYA 3DWGC 2WU5B 4YTNB 2LGIA 1DOIA 1C4CA 1PGBA 2LMCA 2L1AA 1L4DB 4A55A 4DQOC 3NVWA 1IBXB 1SXTA 3OWEB 1D6EC 3P4SB 3AE4B 1QKZA 5HI1A 3VR8B 2QILA 3DWMA 2XN9C 4RFBA 3VRBB 2ONQA 2K3UA 3W5UB 4RCOA 3GB1A 3NZ3A 2GI9A 3U2SC 1CQVA 1YN3A 2DLBA 2I38A 5HHDG 3AE9B 1T3QA 2WXIA 2KDMA 2LEKA 2HDEA 1JWUD 1I4XA 1KLUD 4ZYSA 2WXQA 1PGAA 1UWXA 4DXFA 1AW7A 3C8YA 2IGGA 1BMLC 3SR6A 2PLPA 3U52E 1FFUA 3IT6B 2W82A 1TJEA 2RMMA 3T3NA 1TS4A 1J7CA 4RGNA 1F2RI 3KWVA 1WRIA 3BK2A 5EE1A 2WQYB 1P7EA 1FEHA 3LB8C 1KRHA 1AYFA 2IDYA 2Y3AA 2YEPB 1TS2A 5AUIA 1KF6B 1C77A 2WXHA 1K50A 1L0YB 4HROA 2JZPA 1JWSD 1SB3C 1QF6A 2LUMA 1E7PB 1J7AA 2E6XA 2KQ4X 4XWWA 2NTTA 4GDKB 2YEPF 3B9JA 2QSDA 1UNSA 5T8IA 2QIEB 1DOXA 2KMMA 3BVZA 2M56B 3FC4A 1FXIA 3AEDB 2SAKA 5H92C 3MC0B 1NYQA 2QJLA 3MHZA 1IGCA 2L52A 2WXKA 3AE6B 1SSNA 4JPSA 2V4IB 1ZP0B 2MJ3A 1ENFA 4IKGA 1ROEA 2H88B 1L0XB 4LLGM 3VR9B 1WYGA 1XXGA 2LHEA 1F0ZA 2DYOA 1PGXA 2JXTA 1I4GA 1QT9A 3MP9A 2BB6A 4YXDB 4KKIA 1L6UA 5GXGB 3U7ZA 3P63A 3IXSA 5D3IB 1L5PA 4JX1C 1YN5A 2L83A 1T6BX 4C7YA 2FUG1 4GLSC 2KN4A 3AH7A 1KFYB 3U4EG 1N62A 3TEWA 2WLBA 2N9KA 1TKEA 3SFDB 3IAM1 3SFEB 1N5WA 1YMHE 5BYQA 2M0AA 4N58A 4A90A 4KX6B 3R2IA 1YNTE 3Q8CA 4OVZA 4XDDA 1C9FA 1XLOA 1GOZA 3ZJVA 1TKYA 1XLQA 1EM7A 2LFIA 2MJEA 2VZKB 1ZUD2 3KQ4A 3BIID 1Q10A 1QLBB 3AE5B 4XE0A 4N6EB 3URYA 1NENB 2BBCA 1B9RA 5BYRA 1XCTL 2PTLA 2WDRB 4JWSC 1DOYA 1JROA 2JX5A 1UGJA 4ZHPA 4R3DA 2IPKD 3Q8AA 1GPXA 5AUKA 1KTKA 2IJ0A 3O13A 5BMIA 1I4PA 1J7BA 3AM9A 1CK1A 1FFVA 1FCLA 2PW9A 4REZA 4TQ1A 3P4PB 4MH8A 3VQIA 2PIAA 3KLSX 2EKIA 1C78A 3AECB 3H8HA 1I4QA 2BTEA 1YQ4B 3E9SA 1JRPA 1FXAA 3BYYB 4UDUC 3HRDD 1V97A 4LTUA 2FBWB 4NJCA 2JYTA 1ZOYB 4OW0A 3R8BA 4EE2A 1B1ZA 2RDHA 4ZOHC 3BZDB 1WXQA 1K53A 1MHHE 1TYGB 4B0EA 3AV8A 5TSSA 2WNMA 1TKGA 1MPEA 2BT6A 2J4XA 2J53A 1JWAD 1TY0A 3GS2A 1QQRA 3I57A 4J3OD 4US9A 3V05A 1C79A 1QOFA 1V8CA 1JWBD 2BS3B 2E3TA 4L1BA 4HKZE 4US8A 2B76B 1SE4A 1FNVA 2PKOA 1EU4A 1I4RA 2V3NA 1GB1A 3AEFB 5C3JB 3J9CA 4TMAB 1OQQA 1DGJA 2MH7A 2R61A 2WDVB 4ZRQA 3W2DA 1P7FA 1XEEA 3FILA 3MJ5A 1EWYC 3AB5A 2FE8A 1VJKA 2W55A 2N7JA 4GDLB 3RFZB 3I9V1 1L6VA 3WCQA 4C7ZA 3SEBA 4IOIE 2INNE 2AX5A 4PT5A 1ACCA 1ZXIA 1XCQL 1L0VB 1ZDVA 2V0GA 1RFKA 2BYTA 2N9LA 1FRDA 3LYYA 5BMGA 2EELA 4HEA1 3P1MA 1SBBB 2HTME 4OHJA 1F2RC 1QOBA 1V1PB 3AE3B 1EU3A 3Q8EA 4WQMA 3IT4B 4XWTA 1XF5L 1KLGD 3MFGA 1AN8A 2G1EA 4WIPA 4WURA 4ZRPA 2K22A 2ICIA 1VRAB 2WXGA 1VZ8A 3W9CB 5FK9C 1VLBA 3KWLA 1FMAD 1E0ZA 1GAQB 3E56A 1FD6A 3HVZA 3NUHB 4NZLB 1ZPSA 2BS2B 1FRRA 1PDXA 1E9MA 1OFFA 2WXPA 5EE3A 4YSXB 4NAMA 1VZ6A 3CIRB 1C4AA 1FCCC 2JSVX 2KWDA 1JALA 2CJNA 2G9HD 1IUEA 3IAS1 4OZBA 4YSZB 2L32A 1IBXA 1BUIC 1CZPA 3TUOA 1SE2A 2PMVA 1GB4A 5FR3A 2WDQB 2WU2B 2W3SA 3TEYA 2JYEA 1MI0A 5G5HA 4YTPB 3BWUD 1IGDA 4M0WA 3NVYA 5EE0A 1JW9D 4RGTA 2J52A 3Q8BA 3TSSA 4IDIA 1VR9A 4OZCA 2CU3A 2N0SB 3TEXA 1YQ3B 2WP9B 3L4PA 2AQ3B 1L4ZB 1JMLA 4YWGG 3N9YC 2GRIA 1HXYD 4KGTA 3AEBB 3TEZA 1RWSA 2BB5A 1I4HA 4CQNA 1Y56A 1PUTA 1SIJA 5H8YE 2W3RA 1VDVA 5C2TB 1WSPA 4B0MA 1FNWA 2J42A 3BK1A 1D5MC 4L23A 2ZW1A 4MM3B 2Y5CA 2JU6X 1YJIA 1QOGA 2Q5WD 4OZAA 5HG2A 2VZKD 4HRSA 1MVKA 1N60A 3AE8B 1SEBD 2AQ2B 5JXVA 3P4QB 3Q69A 1SJED 5D7GA 3ABVB 2JQRB 2I2YA 2PVOD 2ACZB 3NVVA 1BXTA 4DXGA 2BW2A 5MPOA 3B2FA 4ARCA 4AQ7A 3AMZA 3V3XA 5LNK1 3EA6A 4KGRA 2ON8A 3ZQ4A 2MEKA 4P6VF 2GB1A 1TS5A 4N59A 4C56C 4XDCA 1RM6C 1JQ4A 2OEDA 3FAHA 3ZJTA 2XNAC 4KGSA 1ZDXA 4L2YA 3W1SA 1HZ5A 4HKQA 4ITKA 1JWMD 2K9XA 4NAWB 3BYTB 2MJDA 2RPVA 2WS3B 3NS1A 2WXMA 1FNUA 3UI3A 3AE1B 1YN4A 4LK0M 5EE9A 4O1NA 1KH0A 2WXOA 5I4DA 5D3DA 1UWMA 3NRZA 2ZW0A 2QEJC 1C76A 2NTSA 1NI3A 1STEA 4USAA 2Z8LA 4A9AA 1RYJA 3AEGB 1MHXA 1QOAA 3AEEB 4H2AA 1E10A 1M4VA 1XO3A 4WWMA 1F77A 1N63A 4MACA 1NVID 1OQRA 4Q2JA 2WXFA 3HUIA 3NVZA 3PZ8A 3ZJUA 1ZXHA 1D4BA 4JE3B 3RPFC 2DWQA 2RDGA 4TSSA 4RGOS 4YT0B 4WH4A 3BVGA 1A70A 2DYMA 2QMTA 2D5GA 2BS4B 3VRAB 1K52A 5E6JA 4YSYB 4A6QA 1TS3A 2LHDA 2LJIA 3P42A 2W54A 3P4RB 2NMQA 3AN1A 2SEBD 3PO0A 1YJJA 1PFDA 5G5GA 2AQ1B 1K51A 4HJGE 3ZGZA 4YTMB 1EWCA 1NEKB 1WWTA 2X38A 1HQRD 4P16A 3GP7A 3B2GA 1N5XA 2JWUA 2WXNA 1D5ZC 1D5XC 2WXLA 3PZ7A 4RNAA 3ZYYX 3LXFA 3W5VB 2IGDA 1HZ6A 5BYSA 4ARIA 1ESFA 1HA5A 2KACA 1TZOA 3FILB 2OHFA 4ZHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H89 B;  1FXI A;  1OQQ A;  1DGJ A;  1XLN A;  2ACZ B;  2MH7 A;  2WDV B;  3AE7 B;  1FIQ A;  3AED B;  3AEA B;  3NVV A;  5MPO A;  3B2F A;  1NYQ A;  2QJL A;  1R7S A;  1EWY C;  2L52 A;  3AMZ A;  2CJO A;  3AB5 A;  1VJK A;  2W55 A;  3AE6 B;  1XLP A;  1ZP0 B;  1L6V A;  2MJ3 A;  3WCQ A;  4C7Z A;  2AX5 A;  1CJE A;  1ROE A;  2H88 B;  4P6V F;  4N59 A;  2DBY A;  2K5P A;  3VR9 B;  1WYG A;  1ZXI A;  1RM6 C;  1AWD A;  1L0V B;  3CWI A;  3FAH A;  1F0Z A;  1JQ4 A;  1RFK A;  1FM0 D;  4ITK A;  1QT9 A;  1FRD A;  3ETR A;  2K9X A;  3P1M A;  1NYR A;  2HTM E;  4YXD B;  1QOB A;  1L6U A;  1WGK A;  2MJD A;  2PVG C;  2WS3 B;  1SF0 A;  3NS1 A;  3P63 A;  5GXG B;  1L5P A;  3AE3 B;  4JX1 C;  1E6E B;  4WQM A;  1FO4 A;  3AE2 B;  1I7H A;  2L83 A;  3EUB 2;  3AE1 B;  4C7Y A;  5EE9 A;  4FXC A;  2M19 A;  2G1E A;  3AH7 A;  1KFY B;  1N62 A;  2WLB A;  1TKE A;  2K22 A;  3SFD B;  4C80 A;  3SFE B;  1N5W A;  1UWM A;  3NRZ A;  3W9C B;  4JWU C;  1VLB A;  3KWL A;  4N58 A;  2KAJ A;  4KX6 B;  1FMA D;  1NI3 A;  4USA A;  1E0Z A;  1GAQ B;  4A9A A;  1RYJ A;  1N61 A;  3AEG B;  3HVZ A;  1XLO A;  2BS2 B;  1QOA A;  3AEE B;  2WU5 B;  1FRR A;  1PDX A;  3DWG C;  1E9M A;  4YTN B;  1XO3 A;  1TKY A;  1E10 A;  1OFF A;  1XLQ A;  2MJE A;  5EE3 A;  4YSX B;  1DOI A;  1QF6 A;  1ZUD 2;  4WWM A;  1N63 A;  3BII D;  3CIR B;  1QLB B;  3AE5 B;  3NVW A;  1NVI D;  1OQR A;  4N6E B;  1NEN B;  1JAL A;  2CJN A;  3AE4 B;  3HUI A;  1IUE A;  3NVZ A;  3P4S B;  1B9R A;  3VR8 B;  3DWM A;  2WDR B;  4JWS C;  4YSZ B;  1JRO A;  1DOY A;  2JX5 A;  1CZP A;  3VRB B;  3RPF C;  4ZHP A;  2DWQ A;  3W5U B;  1GPX A;  2WDQ B;  2WU2 B;  2W3S A;  5AUK A;  4YT0 B;  1J7B A;  3AM9 A;  5G5H A;  3AE9 B;  4YTP B;  1FFV A;  1T3Q A;  1A70 A;  3P4P B;  2PIA A;  2LEK A;  2BS4 B;  3NVY A;  5EE0 A;  1JW9 D;  3VRA B;  2EKI A;  4YSY B;  3FC4 A;  3AEC B;  2W54 A;  4IDI A;  3P4R B;  2CU3 A;  2N0S B;  3SR6 A;  1YQ4 B;  1YQ3 B;  1FFU A;  3AN1 A;  1TJE A;  1JRP A;  1FXA A;  2WP9 B;  3L4P A;  1YJJ A;  3HRD D;  1PFD A;  3PO0 A;  5G5G A;  1J7C A;  1V97 A;  4LTU A;  2FBW B;  1ZOY B;  4YTM B;  3AEB B;  1NEK B;  1WRI A;  1WWT A;  1RWS A;  2WQY B;  4ZOH C;  5EE1 A;  3LB8 C;  1KRH A;  1AYF A;  1PUT A;  3B2G A;  1SIJ A;  1N5X A;  5H8Y E;  2W3R A;  1WXQ A;  1KF6 B;  1VDV A;  5AUI A;  1TYG B;  5C2T B;  3AV8 A;  1TKG A;  3ZYY X;  2BT6 A;  3LXF A;  2Y5C A;  4HRO A;  1QOG A;  1SB3 C;  1JWA D;  1YJI A;  2Q5W D;  4US9 A;  1E7P B;  1J7A A;  4HRS A;  1N60 A;  3AE8 B;  5H92 C;  3W5V B;  1QOF A;  1V8C A;  1JWB D;  2BS3 B;  2E3T A;  3B9J A;  3P4Q B;  4US8 A;  2B76 B;  2PKO A;  2OHF A;  2QIE B;  3AEF B;  2KMM A;  4ZHO A;  5C3J B;  3ABV B;  2JQR B;  1DOX A;  2PVO D;  2M56 B; 
#chains in the Genus database with same CATH topology
 4RF0 A;  3AEA B;  2C7N B;  3H9D A;  2WX1 A;  1R7S A;  5FKA C;  2CJO A;  1WXV A;  1OTR B;  2JXX A;  4A8X C;  1CJE A;  4II2 B;  4RGM A;  3DBH I;  2V3P A;  3D32 A;  3SDL C;  3EGR A;  4XC2 A;  3ML8 A;  5BMH A;  3ETR A;  1VZ7 A;  2X8X X;  4KKJ A;  1WGK A;  2KQ7 A;  1V1O A;  3GZN I;  2LGS A;  1E6E B;  3AE2 B;  1I7H A;  1OEY J;  1YQB A;  4GDK A;  4EZL A;  3UQA A;  1C4P A;  4K7W A;  1YOV B;  4FXC A;  2M19 A;  4P1B C;  3IFW B;  4BZA A;  2KAJ A;  4MT5 A;  1N61 A;  1SE3 A;  1UUP A;  2WU5 B;  1DOI A;  1TGZ B;  4A55 A;  4CO7 A;  3QQ8 B;  4W9H A;  1QKZ A;  2QIL A;  3H1U A;  2LVO A;  3W5U B;  3U2S C;  2JF5 A;  2KAN A;  5HHD G;  2A5U A;  1YX5 B;  4BFR A;  2UWQ A;  1TIF A;  1FPY A;  5IN7 A;  3VTW A;  1WE6 A;  2RDB C;  4IW0 A;  3DBH B;  3T3N A;  2I1K A;  1TS4 A;  3ECI A;  3BK2 A;  2WQY B;  1FEH A;  3GZN B;  3LB8 C;  5D94 A;  2IDY A;  1VD2 A;  3PTF C;  1TS2 A;  3APF A;  4AJW A;  1V9J A;  2AYO B;  1SB3 C;  4ANV A;  1E7P B;  2RGF A;  3PLU A;  2KJR A;  4GDK B;  2QSD A;  2MLB A;  2BWE S;  3BVZ A;  3MHZ A;  2C9W B;  1IGC A;  5IAA C;  1RRB A;  2WXK A;  3AE6 B;  2V4I B;  2QHO A;  3L0W B;  3QAR A;  3KYC D;  2KKC A;  3CMM B;  1WX7 A;  3R66 C;  3PRE A;  1F0Z A;  3PPA A;  1L6U A;  1WJU A;  3U7Z A;  1YN5 A;  2FUG 1;  2KN4 A;  3AH7 A;  3TEW A;  1N62 A;  4EFO A;  3IAM 1;  1N5W A;  1YNT E;  2LZ6 A;  2JT4 B;  2KDB A;  2MJE A;  3ZO5 B;  4B9K A;  3AXC A;  3KQ4 A;  1GG3 A;  3BII D;  1QLB B;  4N6E B;  1NEN B;  2BBC A;  5BYR A;  2PTL A;  4JWS C;  2WDR B;  1DOY A;  2RR9 A;  4ZHP A;  3DBS A;  2IPK D;  3O13 A;  5BMI A;  1I4P A;  1J7B A;  3VVW B;  1A5R A;  1FCL A;  3Q3J A;  4TQ1 A;  2KZR A;  3VQI A;  1R4N I;  3ZLZ A;  1C78 A;  1V80 A;  1I4Q A;  2KWU B;  3L54 A;  2NCN A;  3JSV B;  1JRP A;  1K8R B;  4EE2 A;  1I35 A;  1WR1 A;  3BZD B;  4PS3 A;  2N9E B;  1TKG A;  1MPE A;  3K9P B;  2RPQ A;  4US9 A;  3PGE A;  3GS2 A;  1C79 A;  4DXA B;  3TMP B;  1V8C A;  4MSQ B;  5IA7 A;  1SE4 A;  1FNV A;  1GB1 A;  2V3N A;  2CHW A;  3V61 A;  4RMA A;  4LNF A;  3A9K A;  1MG4 A;  3ZXV A;  3ZIM A;  2MH7 A;  2XK5 A;  3VH3 B;  1P7F A;  2K6D B;  3FIL A;  3UF8 A;  1WIA A;  3SEB A;  2FID A;  4G0N B;  2M4N A;  1ZXI A;  1XCQ L;  3QHT A;  1ZDV A;  3RNA C;  1RFK A;  3AU5 A;  2BYT A;  2K25 A;  5FR6 A;  3LYY A;  1R4N B;  2O2V A;  2HTM E;  1F2R C;  2ZCB A;  4NQK E;  4ANW A;  4NQL B;  2G1E A;  2K22 A;  1VRA B;  2WXG A;  2KTR A;  3CF6 E;  1FD6 A;  3GE8 C;  4NZL B;  4IWQ A;  1FRR A;  1E9M A;  3M63 B;  5EE3 A;  1Z2M A;  2KFJ A;  2JSV X;  4W9D A;  3UQB A;  4TKN A;  4S0R A;  4OZB A;  3M62 B;  2KDF B;  1IBX A;  1CZP A;  4FJY A;  3TUO A;  4ANU A;  3TEY A;  2JYE A;  4BKG A;  4M0W A;  4GSW A;  1JW9 D;  2MP2 B;  1E7U A;  3TSS A;  4IDI A;  1VR9 A;  1Q1O A;  2N0S B;  3DCG A;  3TEX A;  1YQ3 B;  2NPT B;  3A1Q B;  5AZG A;  2BYV E;  4YWG G;  2GRI A;  1HXY D;  2LRW A;  4KGT A;  3TEZ A;  2JPH A;  1PUT A;  1WGR A;  2GBM A;  2D11 A;  2FAZ A;  4MGI E;  2O2V B;  4L23 A;  4ZRJ A;  5E6P A;  5CX3 A;  4HRS A;  1MVK A;  4E3C A;  1SEB D;  2AQ2 B;  2V9H A;  5J18 A;  5JXV A;  3P4Q B;  1F52 A;  2K1F A;  3VUX A;  3ABV B;  3MC8 A;  2PVO D;  4AP4 C;  2KD0 A;  4DXG A;  5D2M B;  4F1S A;  5LNK 1;  3EA6 A;  3L13 A;  4OVV A;  1UGM A;  1RFA A;  4GB9 A;  2GB1 A;  4N59 A;  2OJR A;  4XDC A;  4KGS A;  1ZDX A;  1HZ5 A;  2KQS A;  1WJN A;  3KYD D;  4JLC A;  4HDQ A;  4IWO A;  4NAW B;  2MJD A;  2WS3 B;  1FNU A;  3UI3 A;  3PS6 A;  1LFD A;  4WJP A;  4RM8 A;  3RNE C;  1GJZ A;  3NHE B;  1C76 A;  3RI7 C;  1STE A;  2Z8L A;  4A9A A;  3AEG B;  1MHX A;  1QOA A;  4H2A A;  1E10 A;  2K6Q A;  1UD7 A;  4WWM A;  3PZ8 A;  3HUI A;  3NVZ A;  4I6L B;  3R3M A;  3RPF C;  1Y8R C;  2RDG A;  2ZJD A;  4TSS A;  2N9P C;  4RGO S;  4YT0 B;  1WRD B;  4WH4 A;  2DYM A;  2BS4 B;  4KSK C;  4DHJ D;  1TS3 A;  2LHD A;  2LJI A;  3P42 A;  3I63 C;  3PO0 A;  2JRH A;  4EOY A;  1K51 A;  1WGH A;  4LJP B;  3GOE A;  1P3Q U;  1NEK B;  3WAN A;  3TBL D;  4P16 A;  2WXN A;  1D5Z C;  2GMI C;  2LVQ A;  3LDZ E;  4RNA A;  2Z59 B;  4HCP B;  3DVN V;  3V62 A;  1HZ6 A;  3H7S A;  1J8C A;  2DZJ A;  1ET6 A;  1TY2 A;  1T5X D;  1C3T A;  4RH6 A;  2FCQ A;  3KVF B;  4DBG A;  4TV3 A;  4MGY E;  1E8X A;  3DVN U;  2K5P A;  2KDE B;  3HM3 A;  4KV2 A;  2HJ8 A;  4I6P A;  2BYE A;  1FXT B;  4BBN C;  3T8M A;  1KLV A;  3ZNZ B;  1LQB A;  1ZGU B;  4F8C B;  1PYW D;  4GOC A;  2J0J A;  3R2T A;  2Y5P A;  4D2K A;  3HHM A;  5E6O A;  1GC6 A;  2TSS A;  1S3S G;  2LGX A;  4HXD A;  4RF1 A;  4AS1 A;  5HFY A;  1QIL A;  2OOB B;  2MA9 B;  3DWG C;  2MBO A;  1C4C A;  3UIN B;  2L1A A;  2G3Q B;  3OWE B;  2XN9 C;  2JZZ A;  2AL3 A;  3VRB B;  2C7H A;  1Q0W B;  3GB1 A;  3NZ3 A;  3DBR I;  5KHO A;  5J2R A;  2DLB A;  4II3 B;  4CYE A;  3AE9 B;  4IM3 A;  2N7E A;  2KDM A;  1EF5 A;  2DEN B;  1JWU D;  1KLU D;  4GXB A;  4K81 A;  3CSF A;  1P9D U;  1AW7 A;  1ISN A;  1YJ1 A;  2IGG A;  4W9G A;  4BBN F;  3W1S C;  3U52 E;  1FFU A;  3IT6 B;  2W82 A;  2RMM A;  2EKE C;  4RGN A;  4HVB A;  2NBU A;  1P7E A;  3P2B A;  4GIV A;  1AYF A;  2QCZ A;  4LNK A;  1WY8 A;  5AUI A;  1C77 A;  2KDI A;  2MBE A;  2WXH A;  4BKS D;  3VTV A;  2J0K A;  1JWS D;  1J7A A;  2KQ4 X;  4MM3 A;  3OAW A;  2DZK A;  5T8I A;  1DOX A;  3DDC B;  3FC4 A;  2MX2 A;  1NYQ A;  3ONS A;  2CU1 A;  4K3B A;  5HKH A;  3R7R A;  3DBR B;  3N1X C;  3U8Z A;  2I1J A;  1XXG A;  1V5T A;  2DYO A;  2BKR B;  4XZ4 A;  4J6I A;  1UEL A;  1L5P A;  1M94 A;  1KJT A;  4IG7 B;  4GLS C;  3U4E G;  1TKE A;  3SFD B;  3EFC A;  2KFK B;  2NVU I;  2K8H A;  3V6C B;  4A90 A;  1T0S C;  3OG5 A;  3PV1 A;  3Q8C A;  2MW5 A;  2YVC A;  2MHJ A;  4JQW C;  2FCS A;  1XLQ A;  1EM7 A;  2LFI A;  4G3X B;  1WE7 A;  4XE0 A;  4KIK A;  2ZVO A;  1WXS A;  4NPN A;  4FHK A;  4R3D A;  2JUO A;  2IJ0 A;  3N30 A;  1CK1 A;  4KZ0 A;  1Q5W B;  3KLS X;  4CHK A;  4W9C A;  2ZNV B;  2N1W A;  2ZPN A;  1MFW A;  2M0X A;  4K7S A;  4WJQ A;  5AEK B;  3BYY B;  4UDU C;  3HRD D;  4LTU A;  1ZOY B;  2FNJ B;  2XBB C;  3R8B A;  2D07 B;  1B1Z A;  3QA8 A;  4ZOH C;  4HJK A;  3HM6 X;  3BY4 B;  1WXQ A;  3WAM A;  4B0E A;  2WNM A;  4FJV B;  2KMC A;  2CKH B;  3V05 A;  1IPG A;  4K3C A;  1JWB D;  4L1B A;  2NR2 A;  4MEM A;  4LNI A;  1EU4 A;  1GUA B;  1I4R A;  3OJ4 B;  4EZJ A;  3ML9 A;  3J9C A;  3ZTD A;  4TMA B;  2WDV B;  1DGJ A;  2R61 A;  1YD8 U;  1OEY A;  1EWY C;  3AB5 A;  2FE8 A;  4ZYN A;  1L6V A;  3WCQ A;  4IOI E;  3SD5 A;  3ZNH B;  3EEC A;  1EUV B;  3ZUN A;  4I6N B;  5DCN A;  2V0G A;  4LCD E;  1E5W A;  5TR5 A;  1MJD A;  2LXC A;  4HEA 1;  3P1M A;  4OHJ A;  2D3B A;  1EU3 A;  3HIZ A;  4WQM A;  1N6Z A;  1KLG D;  3Q3F A;  4WIP A;  3L17 A;  4LDT D;  4NJ6 A;  4JGH B;  1WM3 A;  1E0Z A;  1GAQ B;  3DPD A;  3E56 A;  1LGR A;  3NUH B;  3L08 A;  3Q3N C;  3WAL A;  4MDK E;  4NAM A;  2CJN A;  3ZNI D;  3IAS 1;  4HWI B;  2L32 A;  4P7I A;  1GB4 A;  3UGB B;  4FUL A;  2W3S A;  3JVZ X;  4M8M A;  5G5H A;  4YTP B;  1P0R A;  4B95 A;  4JIO U;  3NVY A;  4RGT A;  4E71 A;  1WI0 A;  2J52 A;  1YIW A;  4OZC A;  4GGQ A;  5JHB A;  4BKS A;  3L4P A;  1L4Z B;  3AU4 A;  3N9Y C;  3K9O B;  3QIJ A;  1I4H A;  5H8Y E;  2NS5 A;  2W3R A;  1XD3 B;  2J42 A;  1D5M C;  4XYC A;  4HPM B;  5HG2 A;  2VZK D;  4WJO A;  2IY1 B;  2KK8 A;  4A3O A;  1J0G A;  2I2Y A;  3B2F A;  3HK0 A;  4ARC A;  3B08 A;  1NI2 A;  4KGR A;  5DPS A;  1TS5 A;  3VUY A;  1WMH A;  3DVG Y;  3NG0 A;  2XNA C;  3V60 A;  3ZNG C;  3U7D A;  1V81 A;  1WH3 A;  3RYT A;  4ZDV A;  3NS1 A;  2WXM A;  4C4V A;  3QC8 B;  3AE1 B;  2N1V A;  1KH0 A;  3UIO B;  5I4D A;  5D3D A;  3NRZ A;  3QX1 A;  3OJ3 A;  3VFK A;  5JH5 C;  4USA A;  1RYJ A;  1OQY A;  5DPR A;  4HPP A;  1LXD A;  2IZV B;  2WDT B;  3IHP C;  3JW0 X;  4M01 A;  1UBI A;  4PYU A;  1NVI D;  4HLE A;  4JE3 B;  2DWQ A;  4PS8 A;  3DBL I;  4M02 A;  1WX9 A;  3BVG A;  2QC8 A;  1A70 A;  3B0A A;  2KC2 A;  1K52 A;  4A6Q A;  4WWP A;  4URK A;  1PFD A;  5G5G A;  2AQ1 B;  3ZGZ A;  2O6V D;  1EWC A;  4ANX A;  1WWT A;  1WMH B;  1HQR D;  3I3T B;  3B2G A;  1N5X A;  2HJ1 A;  1WGG A;  3R7Q A;  3PZ7 A;  3ZYY X;  2IND C;  3ZTC A;  3ENE A;  4AUQ C;  3PSE B;  4DHZ E;  3W5V B;  3Q6B A;  3A9K B;  5BYS A;  1HA5 A;  2KAC A;  1TZO A;  2WX0 A;  2XK5 B;  1V86 A;  3FIL B;  2WXJ A;  1XLN A;  3EUB 2;  3AE7 B;  1FIQ A;  1ZE3 D;  2KC1 A;  3MTN B;  1H4R A;  3X0W A;  3DBL B;  4W9K A;  2LVP A;  1DYQ A;  2WXR A;  4WAF A;  2DNF A;  4S17 A;  4DWF A;  3ZRF A;  3PHX B;  2PVG C;  1SF0 A;  3KUD B;  1E8W A;  3HVD A;  1HEZ E;  1FO4 A;  2KTR B;  1V1P A;  4FLH A;  3Q8F A;  2K0P A;  4AJY B;  4JWU C;  2Z0D B;  2D3A A;  4K7U A;  1ET9 A;  4EZK A;  4YTN B;  2GBR A;  2LGI A;  4LJO B;  2LMC A;  1IBX B;  1SXT A;  2R2Q A;  3AE4 B;  3VR8 B;  3DWM A;  4RFB A;  5E6N A;  4RCO A;  2GI9 A;  3IBE A;  4M0W B;  1YN3 A;  4MGK E;  5CTR C;  1IYF A;  1UWX A;  2WGS A;  3C8Y A;  2R2O A;  2AWT A;  2LGD A;  1TJE A;  1J7C A;  1V49 A;  2V1Y A;  1F2R I;  3KWV A;  3A9J A;  5EE1 A;  2N4F A;  1KRH A;  4FA6 A;  2YEP B;  1KF6 B;  3BIN A;  3ALB A;  1L0Y B;  4HRO A;  2LUM A;  4LNN A;  2E6X A;  3AUL A;  4ZRI A;  3EFU A;  2NTT A;  1YX6 B;  3ZRC A;  3VXW A;  1UNS A;  2QIE B;  2KMM A;  2KJ6 A;  2M56 B;  1V2Y A;  1FXI A;  3RUI B;  3RUL A;  2QJL A;  2L52 A;  1EF1 A;  3W1Y A;  1ZP0 B;  2MJ3 A;  1ENF A;  2JZ3 B;  2LAS A;  2IO0 B;  4IKG A;  4XGA B;  4DDI D;  4LLG M;  3PHW B;  2L0F A;  1WYG A;  3VR9 B;  1WF9 A;  4AOF A;  2LHE A;  2D3C A;  1PGX A;  3EHV A;  3MP9 A;  4IM0 A;  3IXS A;  4JX1 C;  3OLM D;  2MBH A;  2RSU A;  4BOS C;  3Q14 C;  2L83 A;  1T6B X;  4KZC A;  2N9K A;  4M00 A;  3Q2A C;  2KVR A;  2BGF A;  4MEL A;  4YL8 A;  1YMH E;  5BYQ A;  3SFE B;  3R2I A;  3C19 A;  2DHZ A;  2FUH B;  4OVZ A;  4XDD A;  1C9F A;  1XLO A;  2GBK A;  4GDL A;  1TZ1 A;  4OVU A;  1GOZ A;  1WXA A;  1TKY A;  5G55 A;  3CST A;  2VZK B;  1ZUD 2;  1Q10 A;  3A9J B;  3URY A;  1B9R A;  4NY0 A;  1R4M I;  1JRO A;  2CHX A;  2HD5 B;  1UGJ A;  2JX5 A;  3S2A A;  3Q8A A;  3PRP B;  2C5L C;  1KTK A;  5AUK A;  2JVC A;  2JRI B;  2PW9 A;  3P4P B;  4KDL B;  2O6V A;  4MH8 A;  3H8H A;  1X1M A;  2JY6 A;  3E9S A;  1FXA A;  1KOT A;  5G2N A;  3RZW C;  1V97 A;  2FBW B;  2RDH A;  5IOI A;  2C7M B;  2WWZ A;  1F9J A;  1KM7 A;  2L76 A;  1MHH E;  1TYG B;  3RMK C;  2M17 A;  4MJS A;  3V6E B;  5L83 A;  1JWA D;  2KMA A;  3Q3M C;  1PQS A;  1QOF A;  1TTN A;  3ZDT A;  1L2N A;  4TUU A;  3AEF B;  2PE6 B;  3W2D A;  4ZRQ A;  5L95 C;  3N1Z C;  4HCN B;  2J7Q B;  1VJK A;  2W55 A;  4GDL B;  3X23 A;  1R4M B;  3I9V 1;  5CHF A;  2INN E;  2AX5 A;  2GLS A;  2LGY A;  3APD A;  4PT5 A;  2KOX A;  1FRD A;  5BMG A;  3H6N A;  1QOB A;  3RNB C;  1WJ6 A;  3RZF A;  1UH6 A;  3MHS D;  3VDZ A;  3WIM A;  3L10 B;  1VZ8 A;  1VLB A;  4ICV A;  2BVC A;  3UIP B;  3HVZ A;  3IVF A;  3PZD A;  2BS2 B;  3QCA A;  2KJH B;  1PDX A;  3PLV A;  4BOZ B;  1E8Z A;  4DK5 A;  4HPL B;  2BWF A;  4YSZ B;  1G6J A;  2AL6 A;  1SE2 A;  2WYQ A;  2PMV A;  5FR3 A;  2KLG A;  2WDQ B;  2UU7 A;  1AAR A;  3TCA A;  4BVU C;  1IGD A;  3IG3 A;  5EE0 A;  4K1R B;  2KLC A;  3Q8B A;  2CU3 A;  3PRM B;  4QAY A;  1HE8 A;  2AQ3 B;  2L0T A;  1JML A;  1I42 A;  5C23 A;  2BB5 A;  3ZW3 A;  4CQN A;  2W9N A;  1Y56 A;  1VCB A;  2A4Z A;  4FBJ B;  1VDV A;  5C2T B;  4B0M A;  3BK1 A;  4MM3 B;  1QOG A;  1YJI A;  2Q5W D;  4OZA A;  2N7D A;  3AE8 B;  2IY0 B;  3VUW A;  1WFY A;  1WZ3 A;  1E90 A;  4RM9 A;  5D7G A;  2MCN B;  2ACZ B;  4WQO B;  2BW2 A;  2DZM A;  2ZZP B;  4AQ7 A;  3AMZ A;  3SHQ A;  3V3X A;  2HE7 A;  2IO2 B;  3KH0 A;  2ON8 A;  4FAD A;  2IO1 B;  1V5O A;  3ZQ4 A;  2MEK A;  4P6V F;  2NBW B;  3FAH A;  5IO9 A;  3W1S A;  2MQJ A;  3PT2 B;  4HKQ A;  4ITK A;  4P1C C;  1JWM D;  2K9X A;  4XX5 A;  1YN4 A;  4LK0 M;  4O1N A;  2WXO A;  1WX8 A;  1J19 A;  2LJ5 A;  1UWM A;  2ZW0 A;  2QEJ C;  2NTS A;  3AEE B;  4KIK B;  1M4V A;  1XO3 A;  3RNG C;  4B6W A;  4DHJ B;  3H7P A;  1GC7 A;  1F77 A;  1N63 A;  4W9I A;  1OQR A;  2WXF A;  1UBQ A;  2KX0 A;  2M8S A;  2MBQ A;  3L16 A;  4EUT A;  2FCM A;  4NNJ B;  3SU8 X;  1UZX B;  3DHH C;  2UYZ B;  3DVG X;  3GE3 C;  3RD2 A;  2QMT A;  2D5G A;  4WWO A;  3VRA B;  5E6J A;  4YSY B;  3P4R B;  4HK2 A;  4WJN A;  2PEA A;  3AN1 A;  2SEB D;  2KWC A;  1YJJ A;  5GMV A;  4HDO A;  2DAJ A;  1LM8 B;  1T0R C;  3JSV A;  2X38 A;  2RD0 A;  3FKY A;  2JWU A;  3RT3 B;  1D5X C;  4X57 B;  1QZE A;  3RCZ A;  2L00 B;  3N1Y C;  5J17 A;  4GN1 A;  2KVZ A;  2KWV B;  3QWZ B;  4F7Z A;  2IGD A;  3M3J A;  5D6J B;  3PRZ A;  2ZVN A;  4ZHO A;  2N9X A;  2H89 B;  4EKU A;  2EMT A;  3ZXR A;  3APC A;  3ZVV A;  2LRU A;  2L7R A;  5AZH A;  1XLP A;  1S1Q B;  2DAF A;  2IGH A;  1NBF C;  2INP E;  4TQ0 A;  3H7P B;  2DBY A;  1C1Y B;  1RLF A;  1AWD A;  3CWI A;  4G50 A;  3T3O A;  1FM0 D;  4W9J A;  1MG8 A;  1JCK B;  2CS4 A;  4WWN A;  1NYR A;  3JYU A;  1LO5 D;  1IP9 A;  2BQQ A;  3VH4 B;  2INC C;  3A4S C;  4PS7 A;  4C80 A;  1D3Z A;  3BVM A;  1SJH D;  3A33 B;  2MSE D;  1GNU A;  4IM2 A;  4DDG D;  1CMX B;  1PGB A;  4DQO C;  1L4D B;  2LI5 A;  3NVW A;  3TL5 A;  1OGW A;  2LWP A;  1D6E C;  3P4S B;  2DX5 B;  5HI1 A;  4WAA A;  2ONQ A;  2K3U A;  2MWS B;  2K8C A;  1CQV A;  2I38 A;  1ZKH A;  5JZE B;  2D3G A;  1T3Q A;  2WXI A;  2GBJ A;  3DHG C;  1ZW7 A;  2LEK A;  2HDE A;  2MBB B;  3EC8 A;  4ZYS A;  1I4X A;  2WXQ A;  1PGA A;  4DXF A;  2CR5 A;  4FHJ A;  1BML C;  1E8Y A;  3SR6 A;  2PLP A;  2MP2 A;  2Y5B B;  5IP4 D;  1JRU A;  2NPT A;  3MJW A;  4G11 A;  1WRI A;  3A1Q A;  2V4L A;  2KT7 A;  4JL9 A;  3M95 A;  4AWJ A;  2Y3A A;  2DZI A;  5CHV C;  1RAX A;  1XQQ A;  2YLM A;  1K50 A;  1NDD A;  5LLI A;  2JZP A;  1QF6 A;  1WZ0 A;  2MRP A;  5CHW A;  4XWW A;  5BO4 B;  2YEP F;  2K39 A;  3B9J A;  4BKT A;  2ZCC A;  3AED B;  5H92 C;  2SAK A;  3MC0 B;  3RN9 C;  1SSN A;  4JPS A;  4KVG B;  2V3S A;  4MH0 E;  1ROE A;  2H88 B;  1L0X B;  1BT0 A;  4C4V B;  2JXT A;  1I4G A;  1QT9 A;  2BB6 A;  4YXD B;  4KKI A;  5GXG B;  3N3K B;  3P63 A;  2J0M A;  2BF8 B;  5D3I B;  4W9L A;  4NAW A;  4C7Y A;  1SGH A;  3TJP A;  2KXJ A;  1KFY B;  4EEW A;  2WLB A;  2KO3 A;  3RNC C;  2B3A A;  2M0A A;  4N58 A;  4KX6 B;  2BPS A;  2BYF A;  3N20 C;  3I5J C;  2D2Q A;  4IUM B;  4C00 A;  2LXA A;  3ZJV A;  3NZS A;  2K8B A;  3NJT A;  3AE5 B;  1EO6 A;  2KN5 A;  2G4D B;  1XCT L;  3A4R A;  3T9L A;  1F1H A;  1SIF A;  1GPX A;  1E7V A;  2GBN A;  3AM9 A;  1FFV A;  4FN2 A;  2REX A;  1WM2 A;  4REZ A;  2PE9 A;  3MC9 A;  3PVL A;  2PIA A;  2FIF A;  4W9F A;  2EKI A;  4GMV A;  3AEC B;  2BTE A;  1YQ4 B;  2M1M A;  3DOW A;  4A20 A;  4NJC A;  2JYT A;  4OW0 A;  3RNF C;  3QJZ A;  4MSM B;  1SE9 A;  1HTQ A;  1WXM A;  1WJ4 A;  4FJZ A;  1K53 A;  3AV8 A;  5TSS A;  1WGD A;  1P1A A;  2ASQ A;  2BT6 A;  2J4X A;  2J53 A;  1TY0 A;  3I57 A;  3LJ3 A;  1QQR A;  4J3O D;  3U30 A;  1WGY A;  2VRR B;  5LXH A;  2BS3 B;  2E3T A;  4HKZ E;  4US8 A;  2B76 B;  2PKO A;  5C3J B;  2PJH A;  2AEH A;  1OQQ A;  1XEE A;  3MJ5 A;  2N7J A;  3RFZ B;  4LDT B;  4C7Z A;  2IBI B;  2ZPY A;  4PK1 A;  1ACC A;  1L0V B;  3B1L X;  2N9L A;  1T0Y A;  2CHZ A;  2EEL A;  4LNO A;  1SBB B;  3KW5 B;  1V1P B;  3AE3 B;  3Q8E A;  2GOW A;  3IT4 B;  4XWT A;  1XF5 L;  2IO3 B;  3MFG A;  1AN8 A;  4WUR A;  4ZRP A;  4DHZ B;  3VHT C;  2ICI A;  3W9C B;  5FK9 C;  3KWL A;  1FMA D;  1ZPS A;  1OFF A;  2WXP A;  4YSX B;  4E74 A;  1VZ6 A;  3CIR B;  1C4A A;  2JWZ A;  1FCC C;  2KWD A;  1JAL A;  2G9H D;  1IUE A;  3DHI C;  2KTF A;  1TT5 B;  3AI5 A;  1BUI C;  2ZNV C;  4W9E A;  3N32 A;  5DPT A;  2WU2 B;  3O65 B;  2VH1 A;  1MI0 A;  3ZDM C;  4NJ7 A;  2VH2 A;  3BWU D;  2LD9 A;  3KUZ A;  2KX3 A;  1TBE A;  2IYD B;  4ASW C;  3QK0 A;  2WP9 B;  4IWP A;  4PYZ A;  3WA0 A;  2KNB A;  1H8C A;  3AEB B;  1RWS A;  2LUE A;  4BAX A;  1SIJ A;  1WSP A;  1HTO A;  1FNW A;  3NZU A;  2FCN A;  3NOB A;  4KSL C;  2ZW1 A;  2Y5C A;  2JU6 X;  4ACF A;  2BKF A;  1N60 A;  2C60 A;  3Q3O C;  2QDF A;  2OJW A;  3Q69 A;  2EMS A;  4ZRK A;  1SJE D;  2JQR B;  4A3P A;  3NVV A;  1BXT A;  5MPO A;  2L3Z A;  2Z0E B;  3VTU A;  2NBV B;  1U4A A;  2L05 A;  2G4S A;  1L7Y A;  4GU2 A;  5IKC M;  4C56 C;  1RM6 C;  3TIX A;  2OED A;  3ZJT A;  1JQ4 A;  2PPH A;  4L2Y A;  4M8N A;  1P98 A;  3BYT B;  2RPV A;  5EE9 A;  2DYB A;  4IC7 B;  3ZKJ C;  3KUC B;  1NI3 A;  3NY5 A;  2G45 B;  2L8J A;  2XEW A;  3C0R B;  2KFK A;  4N9F 4;  1T0Q C;  2KHW B;  3QAQ A;  5EDS A;  5C1Z A;  4MAC A;  3NS8 A;  1Z5S B;  4Q2J A;  5KHQ A;  3ZJU A;  1ZXH A;  1D4B A;  3WAP A;  4KDI C;  2O6V B;  2D10 A;  1V6E A;  1WR6 E;  4MGZ E;  3DQV A;  2W54 A;  2NMQ A;  4HJG E;  4YTM B;  2HTH A;  5JHA A;  3VAW A;  3GP7 A;  4MJS B;  5AZF A;  1UF0 A;  4ICU A;  5DPW A;  2WXL A;  3LXF A;  3WAO A;  2ZEQ A;  1WYW B;  5LXI B;  2WHI A;  4ARI A;  1ESF A;  2KYW A;  1XT9 B;  2OHF A; 
#chains in the Genus database with same CATH homology
 2H89 B;  2WXJ A;  1XLN A;  1ET6 A;  1TY2 A;  3AEA B;  3AE7 B;  3EUB 2;  4RF0 A;  1FIQ A;  1ZE3 D;  1T5X D;  4RH6 A;  1R7S A;  5FKA C;  2CJO A;  1XLP A;  2IGH A;  2INP E;  4A8X C;  1CJE A;  4TQ0 A;  2DBY A;  2K5P A;  4RGM A;  2V3P A;  1DYQ A;  1AWD A;  3CWI A;  2WXR A;  3T3O A;  3EGR A;  5BMH A;  1FM0 D;  4WAF A;  3ETR A;  1JCK B;  1VZ7 A;  4KKJ A;  1NYR A;  1WGK A;  2PVG C;  1LO5 D;  1SF0 A;  1V1O A;  3HVD A;  1E6E B;  1HEZ E;  1FO4 A;  3AE2 B;  1I7H A;  1C4P A;  1PYW D;  1V1P A;  4FXC A;  2M19 A;  3R2T A;  2Y5P A;  3Q8F A;  4C80 A;  2K0P A;  3BVM A;  1SJH D;  4D2K A;  4JWU C;  2TSS A;  2KAJ A;  4RF1 A;  4MT5 A;  4AS1 A;  1N61 A;  1SE3 A;  1ET9 A;  1UUP A;  1QIL A;  5HFY A;  3DWG C;  2WU5 B;  4YTN B;  2LGI A;  1DOI A;  1C4C A;  1PGB A;  2LMC A;  2L1A A;  1L4D B;  4A55 A;  4DQO C;  3NVW A;  1IBX B;  1SXT A;  3OWE B;  1D6E C;  3P4S B;  3AE4 B;  1QKZ A;  5HI1 A;  3VR8 B;  2QIL A;  3DWM A;  2XN9 C;  4RFB A;  3VRB B;  2ONQ A;  2K3U A;  3W5U B;  4RCO A;  3GB1 A;  3NZ3 A;  2GI9 A;  3U2S C;  1CQV A;  1YN3 A;  2DLB A;  2I38 A;  5HHD G;  3AE9 B;  1T3Q A;  2WXI A;  2KDM A;  2LEK A;  2HDE A;  1JWU D;  1I4X A;  1KLU D;  4ZYS A;  2WXQ A;  1PGA A;  1UWX A;  4DXF A;  1AW7 A;  3C8Y A;  2IGG A;  1BML C;  3SR6 A;  2PLP A;  3U52 E;  1FFU A;  3IT6 B;  2W82 A;  1TJE A;  2RMM A;  3T3N A;  1TS4 A;  1J7C A;  4RGN A;  1F2R I;  3KWV A;  1WRI A;  3BK2 A;  5EE1 A;  2WQY B;  1P7E A;  1FEH A;  3LB8 C;  1KRH A;  1AYF A;  2IDY A;  2Y3A A;  2YEP B;  1TS2 A;  5AUI A;  1KF6 B;  1C77 A;  2WXH A;  1K50 A;  1L0Y B;  4HRO A;  2JZP A;  1JWS D;  1SB3 C;  1QF6 A;  2LUM A;  1E7P B;  1J7A A;  2E6X A;  2KQ4 X;  4XWW A;  2NTT A;  4GDK B;  2YEP F;  3B9J A;  2QSD A;  1UNS A;  5T8I A;  2QIE B;  1DOX A;  2KMM A;  3BVZ A;  2M56 B;  3FC4 A;  1FXI A;  3AED B;  2SAK A;  5H92 C;  3MC0 B;  1NYQ A;  2QJL A;  3MHZ A;  1IGC A;  2L52 A;  2WXK A;  3AE6 B;  1SSN A;  4JPS A;  2V4I B;  1ZP0 B;  2MJ3 A;  1ENF A;  4IKG A;  1ROE A;  2H88 B;  1L0X B;  4LLG M;  3VR9 B;  1WYG A;  1XXG A;  2LHE A;  1F0Z A;  2DYO A;  1PGX A;  2JXT A;  1I4G A;  1QT9 A;  3MP9 A;  2BB6 A;  4YXD B;  4KKI A;  1L6U A;  5GXG B;  3U7Z A;  3P63 A;  3IXS A;  5D3I B;  1L5P A;  4JX1 C;  1YN5 A;  2L83 A;  1T6B X;  4C7Y A;  2FUG 1;  4GLS C;  2KN4 A;  3AH7 A;  1KFY B;  3U4E G;  1N62 A;  3TEW A;  2WLB A;  2N9K A;  1TKE A;  3SFD B;  3IAM 1;  3SFE B;  1N5W A;  1YMH E;  5BYQ A;  2M0A A;  4N58 A;  4A90 A;  4KX6 B;  3R2I A;  1YNT E;  3Q8C A;  4OVZ A;  4XDD A;  1C9F A;  1XLO A;  1GOZ A;  3ZJV A;  1TKY A;  1XLQ A;  1EM7 A;  2LFI A;  2MJE A;  2VZK B;  1ZUD 2;  3KQ4 A;  3BII D;  1Q10 A;  1QLB B;  3AE5 B;  4XE0 A;  4N6E B;  3URY A;  1NEN B;  2BBC A;  1B9R A;  5BYR A;  1XCT L;  2PTL A;  2WDR B;  4JWS C;  1DOY A;  1JRO A;  2JX5 A;  1UGJ A;  4ZHP A;  4R3D A;  2IPK D;  3Q8A A;  1GPX A;  5AUK A;  1KTK A;  2IJ0 A;  3O13 A;  5BMI A;  1I4P A;  1J7B A;  3AM9 A;  1CK1 A;  1FFV A;  1FCL A;  2PW9 A;  4REZ A;  4TQ1 A;  3P4P B;  4MH8 A;  3VQI A;  2PIA A;  3KLS X;  2EKI A;  1C78 A;  3AEC B;  3H8H A;  1I4Q A;  2BTE A;  1YQ4 B;  3E9S A;  1JRP A;  1FXA A;  3BYY B;  4UDU C;  3HRD D;  1V97 A;  4LTU A;  2FBW B;  4NJC A;  2JYT A;  1ZOY B;  4OW0 A;  3R8B A;  4EE2 A;  1B1Z A;  2RDH A;  4ZOH C;  3BZD B;  1WXQ A;  1K53 A;  1MHH E;  1TYG B;  4B0E A;  3AV8 A;  5TSS A;  2WNM A;  1TKG A;  1MPE A;  2BT6 A;  2J4X A;  2J53 A;  1JWA D;  1TY0 A;  3GS2 A;  1QQR A;  3I57 A;  4J3O D;  4US9 A;  3V05 A;  1C79 A;  1QOF A;  1V8C A;  1JWB D;  2BS3 B;  2E3T A;  4L1B A;  4HKZ E;  4US8 A;  2B76 B;  1SE4 A;  1FNV A;  2PKO A;  1EU4 A;  1I4R A;  2V3N A;  1GB1 A;  3AEF B;  5C3J B;  3J9C A;  4TMA B;  1OQQ A;  1DGJ A;  2MH7 A;  2R61 A;  2WDV B;  4ZRQ A;  3W2D A;  1P7F A;  1XEE A;  3FIL A;  3MJ5 A;  1EWY C;  3AB5 A;  2FE8 A;  1VJK A;  2W55 A;  2N7J A;  4GDL B;  3RFZ B;  3I9V 1;  1L6V A;  3WCQ A;  4C7Z A;  3SEB A;  4IOI E;  2INN E;  2AX5 A;  4PT5 A;  1ACC A;  1ZXI A;  1XCQ L;  1L0V B;  1ZDV A;  2V0G A;  1RFK A;  2BYT A;  2N9L A;  1FRD A;  3LYY A;  5BMG A;  2EEL A;  4HEA 1;  3P1M A;  1SBB B;  2HTM E;  4OHJ A;  1F2R C;  1QOB A;  1V1P B;  3AE3 B;  1EU3 A;  3Q8E A;  4WQM A;  3IT4 B;  4XWT A;  1XF5 L;  1KLG D;  3MFG A;  1AN8 A;  2G1E A;  4WIP A;  4WUR A;  4ZRP A;  2K22 A;  2ICI A;  1VRA B;  2WXG A;  1VZ8 A;  3W9C B;  5FK9 C;  1VLB A;  3KWL A;  1FMA D;  1E0Z A;  1GAQ B;  3E56 A;  1FD6 A;  3HVZ A;  3NUH B;  4NZL B;  1ZPS A;  2BS2 B;  1FRR A;  1PDX A;  1E9M A;  1OFF A;  2WXP A;  5EE3 A;  4YSX B;  4NAM A;  1VZ6 A;  3CIR B;  1C4A A;  1FCC C;  2JSV X;  2KWD A;  1JAL A;  2CJN A;  2G9H D;  1IUE A;  3IAS 1;  4OZB A;  4YSZ B;  2L32 A;  1IBX A;  1BUI C;  1CZP A;  3TUO A;  1SE2 A;  2PMV A;  1GB4 A;  5FR3 A;  2WDQ B;  2WU2 B;  2W3S A;  3TEY A;  2JYE A;  1MI0 A;  5G5H A;  4YTP B;  3BWU D;  1IGD A;  4M0W A;  3NVY A;  5EE0 A;  1JW9 D;  4RGT A;  2J52 A;  3Q8B A;  3TSS A;  4IDI A;  1VR9 A;  4OZC A;  2CU3 A;  2N0S B;  3TEX A;  1YQ3 B;  2WP9 B;  3L4P A;  2AQ3 B;  1L4Z B;  1JML A;  4YWG G;  3N9Y C;  2GRI A;  1HXY D;  4KGT A;  3AEB B;  3TEZ A;  1RWS A;  2BB5 A;  1I4H A;  4CQN A;  1Y56 A;  1PUT A;  1SIJ A;  5H8Y E;  2W3R A;  1VDV A;  5C2T B;  1WSP A;  4B0M A;  1FNW A;  2J42 A;  3BK1 A;  1D5M C;  4L23 A;  2ZW1 A;  4MM3 B;  2Y5C A;  2JU6 X;  1YJI A;  1QOG A;  2Q5W D;  4OZA A;  5HG2 A;  2VZK D;  4HRS A;  1MVK A;  1N60 A;  3AE8 B;  1SEB D;  2AQ2 B;  5JXV A;  3P4Q B;  3Q69 A;  1SJE D;  5D7G A;  3ABV B;  2JQR B;  2I2Y A;  2PVO D;  2ACZ B;  3NVV A;  1BXT A;  4DXG A;  2BW2 A;  5MPO A;  3B2F A;  4ARC A;  4AQ7 A;  3AMZ A;  3V3X A;  5LNK 1;  3EA6 A;  4KGR A;  2ON8 A;  3ZQ4 A;  2MEK A;  4P6V F;  2GB1 A;  1TS5 A;  4N59 A;  4C56 C;  4XDC A;  1RM6 C;  1JQ4 A;  2OED A;  3FAH A;  3ZJT A;  2XNA C;  4KGS A;  1ZDX A;  4L2Y A;  3W1S A;  1HZ5 A;  4HKQ A;  4ITK A;  1JWM D;  2K9X A;  4NAW B;  3BYT B;  2MJD A;  2RPV A;  2WS3 B;  3NS1 A;  2WXM A;  1FNU A;  3UI3 A;  3AE1 B;  1YN4 A;  4LK0 M;  5EE9 A;  4O1N A;  1KH0 A;  2WXO A;  5I4D A;  5D3D A;  1UWM A;  3NRZ A;  2ZW0 A;  2QEJ C;  1C76 A;  2NTS A;  1NI3 A;  1STE A;  4USA A;  2Z8L A;  4A9A A;  1RYJ A;  3AEG B;  1MHX A;  1QOA A;  3AEE B;  4H2A A;  1E10 A;  1M4V A;  1XO3 A;  4WWM A;  1F77 A;  1N63 A;  4MAC A;  1NVI D;  1OQR A;  4Q2J A;  2WXF A;  3HUI A;  3NVZ A;  3PZ8 A;  3ZJU A;  1ZXH A;  1D4B A;  4JE3 B;  3RPF C;  2DWQ A;  2RDG A;  4TSS A;  4RGO S;  4YT0 B;  4WH4 A;  3BVG A;  1A70 A;  2DYM A;  2QMT A;  2D5G A;  2BS4 B;  3VRA B;  1K52 A;  5E6J A;  4YSY B;  4A6Q A;  1TS3 A;  2LHD A;  2LJI A;  3P42 A;  2W54 A;  3P4R B;  2NMQ A;  3AN1 A;  2SEB D;  3PO0 A;  1YJJ A;  1PFD A;  5G5G A;  2AQ1 B;  1K51 A;  4HJG E;  3ZGZ A;  4YTM B;  1EWC A;  1NEK B;  1WWT A;  2X38 A;  1HQR D;  4P16 A;  3GP7 A;  3B2G A;  1N5X A;  2JWU A;  2WXN A;  1D5Z C;  1D5X C;  2WXL A;  3PZ7 A;  4RNA A;  3ZYY X;  3LXF A;  3W5V B;  2IGD A;  1HZ6 A;  5BYS A;  4ARI A;  1ESF A;  1HA5 A;  2KAC A;  1TZO A;  3FIL B;  2OHF A;  4ZHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...