2WLBA

Adrenodoxin-like ferredoxin etp1fd(516-618) of schizosaccharomyces pombe mitochondria
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
GTGIKVFFVTPEGREIMIEGNEGDSILDLAHANNIDLEGACEGSVACSTCHVIVDPEHYELLDPPEEDEEDMLDLAFGLEETSRLGCQVLLRKDLDGIRVRIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ELECTRON TRANSFER PROTEIN 1, MITOCHONDRIAL
publication title Structural and Thermodynamic Characterization of the Adrenodoxin-Like Domain of the Electron-Transfer Protein Etp1 from Schizosaccharomyces Pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Electron transport
total genus 24
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wlbA00
1KFYB 5AUIA 4YXDB 1N60A 2PKOA 2QJLA 3AE1B 3AE6B 3AE3B 1XO3A 3AE5B 2PIAA 3NRZA 2DBYA 2JQRB 2BS3B 1YQ3B 1JALA 2CJNA 2MJ3A 4C80A 1JQ4A 1JWBD 1F0ZA 1E9MA 1FMAD 3AV8A 3W5UB 2PVGC 1RYJA 2AX5A 3AEFB 4JX1C 1RWSA 1FXAA 3SR6A 3AEBB 1QT9A 3CIRB 1TJEA 4LTUA 3VRAB 4N58A 5AUKA 1YJJA 4ITKA 2E3TA 1JROA 1NENB 4ZHOA 2WU2B 3HUIA 2BS2B 3LB8C 3AEGB 1CZPA 2M56B 2HTME 1QLBB 4YTPB 1YJIA 3FAHA 1IUEA 3P4PB 1AYFA 1QOBA 1CJEA 3AE8B 4JWSC 4YT0B 4YSZB 2Q5WD 3AB5A 4IDIA 2MH7A 1VLBA 3VRBB 1N5XA 3ABVB 4HROA 1B9RA 1L0VB 4ZOHC 3W9CB 3PO0A 2N0SB 5C2TB 3NS1A 1JRPA 1FFUA 1J7AA 2MJDA 1WWTA 2W3RA 3AN1A 2WDRB 3AE7B 2WQYB 1DOYA 3P63A 2PVOD 2L52A 1FRRA 2K22A 1QOGA 1R7SA 3P1MA 1E6EB 5EE1A 2MJEA 1DGJA 1XLQA 3AMZA 1WRIA 1NEKB 1VDVA 2W55A 3VR8B 1L5PA 1RM6C 2BT6A 2LEKA 2L83A 3B2FA 4WQMA 5EE9A 2K9XA 2G1EA 3SFDB 4YTMB 1TYGB 4N59A 3B2GA 1FO4A 1T3QA 4US9A 3CWIA 2EKIA 3HVZA 1YQ4B 1I7HA 2WU5B 3AEEB 1PDXA 1L6VA 3ZYYX 1OQRA 3NVWA 5GXGB 1E0ZA 1E10A 1QF6A 2WLBA 3AE9B 4JWUC 3P4QB 1AWDA 1XLNA 2WDVB 2K5PA 3P4SB 1ZUD2 2KAJA 3B9JA 1VJKA 3EUB2 3AEAB 1PFDA 2QIEB 2B76B 2M19A 3AH7A 1RFKA 1NI3A 3LXFA 4WWMA 2JX5A 1EWYC 3BIID 1UWMA 1L6UA 1XLOA 1V97A 1E7PB 2WP9B 3SFEB 1WGKA 2CU3A 3P4RB 1FXIA 5MPOA 1TKEA 1V8CA 4N6EB 5EE0A 5C3JB 4YTNB 1TKGA 2BS4B 4US8A 3AEDB 1SB3C 2WS3B 2CJOA 1KF6B 1XLPA 1TKYA 2H89B 1PUTA 2Y5CA 3HRDD 4FXCA 3NVVA 1DOIA 2H88B 1JW9D 1QOFA 1ZXIA 4USAA 1NYQA 2ACZB 4KX6B 4YSXB 1GAQB 1SIJA 4C7ZA 2W3SA 4ZHPA 1SF0A 1ZP0B 3DWGC 3L4PA 2KMMA 1GPXA 3ETRA 1FRDA 1N61A 1OQQA 1N62A 3KWLA 4YSYB 1OFFA 3WCQA 1QOAA 4C7YA 3W5VB 1DOXA 1ROEA 1FFVA 1N63A 1NYRA 2W54A 3NVYA 1FIQA 1FM0D 1N5WA 2OHFA 3AE4B 5G5HA 4P6VF 1NVID 4HRSA 3NVZA 3AM9A 2WDQB 1KRHA 5H92C 3RPFC 3AE2B 2DWQA 3AECB 5H8YE 1J7BA 1WYGA 3DWMA 1A70A 1WXQA 5EE3A 1J7CA 3VR9B 1JWAD 1ZOYB 3FC4A 2FBWB 5G5GA 4A9AA
chains in the Genus database with same CATH superfamily
3DQVA 1ISNA 1TS5A 3ZLZA 1M94A 3PSEB 2JQRB 1T0SC 1JCKB 3V6CB 3NY5A 3W5UB 3ZIMA 1JRUA 4JL9A 2FIDA 3Q3MC 2RDHA 1TIFA 5J18A 2K1FA 2MQJA 4YTPB 1KM7A 3ZVVA 1G6JA 1GB4A 1TS3A 4K81A 4IDIA 3DBLI 4I6PA 1SJHD 3K9OB 2BYTA 4P7IA 5EDSA 3QK0A 3P63A 1FRRA 2KDMA 3KYCD 1P0RA 3VQIA 2IGHA 2ICIA 1XT9B 1K52A 2KMCA 3PT2B 2K6QA 2IY0B 3AU5A 1MI0A 3HVZA 2EKIA 1WE7A 3QHTA 2JU6X 3U7DA 4PYZA 3B9JA 3TUOA 5KHQA 2HJ8A 2N9XA 3JW0X 4N9F4 3VTWA 2JX5A 1E90A 4A55A 1WJNA 1XLOA 3TEZA 3GZNB 2BS4B 3ZTCA 3AEDB 2JY6A 4B9KA 4US8A 2CJOA 1KF6B 1Z2MA 4IUMB 3SU8X 3ZO5B 3MJ5A 4FXCA 2HD5B 3MFGA 1ZXIA 2INNE 4ASWC 1SIJA 4M02A 3U8ZA 1FXTB 1ZDVA 4HVBA 1SF0A 2RD0A 2Z8LA 3QC8B 1OFFA 4ZRKA 3OLMD 3E9SA 2K3UA 3EECA 5H92C 3PTFC 2ON8A 3Q3FA 2KVRA 2V0GA 2YEPB 3SDLC 5BYQA 2KN5A 1I4QA 2PPHA 2NTTA 2DBYA 3U30A 3RNEC 2LGDA 1C4PA 4ZDVA 4KDIC 2XEWA 2D2QA 3AEBB 1CQVA 4GLSC 4ITKA 1BXTA 1OGWA 4MJSB 4IC7B 2MW5A 4ANUA 4PS3A 3A9KB 1K8RB 1FD6A 4K3CA 2KJ6A 4JIOU 3R8BA 3MTNB 4WAAA 1N5XA 2CU1A 1B9RA 1L0VB 3VH3B 3JSVB 1R4MB 4LJOB 1V5OA 1J7AA 2ZW0A 2RSUA 2INDC 4WJPA 4LJPB 4JE3B 1WX7A 5BMHA 3A4RA 2VH2A 3R7RA 3V3XA 4BOZB 1T3QA 4IWOA 2D10A 2CKHB 4M00A 4KKJA 1E0ZA 4HDQA 4D2KA 2DYMA 2JZ3B 2EMSA 3P4SB 1ZUD2 5GMVA 3U7ZA 2ZEQA 1GG3A 5D3IB 1P1AA 1S3SG 2O2VA 1V97A 1K50A 4HJKA 3APCA 5C3JB 3Q8BA 4REZA 1D6EC 1ZW7A 2QMTA 4XX5A 2PE6B 3NVVA 5CX3A 4PK1A 4OVUA 1NYQA 2TSSA 1ZE3D 2PEAA 2UYZB 1DOXA 3H8HA 2FNJB 1XCTL 2JF5A 4ARIA 3LYYA 3H7PB 3DBSA 5BMIA 1T0YA 2YLMA 4HPPA 4LLGM 4MJSA 4FULA 3C8YA 3A9KA 1JWSD 3O13A 4G0NB 1EF5A 2R2QA 1TJEA 1SIFA 5G55A 2D11A 1YX6B 2GI9A 1AYFA 2KX3A 3QAQA 4LNNA 2N9KA 3N1ZC 4CO7A 4HROA 3NS1A 2GBNA 1EWCA 1DOYA 1MG8A 2WDRB 4E3CA 2KHWB 2L52A 3KVFB 2KD0A 2WXQA 1WZ3A 1XLQA 2JRIB 1VDVA 1X1MA 2GRIA 2WX1A 4ZRQA 4TV3A 3CWIA 3ONSA 4I6NB 1WYWB 1WR1A 1L6VA 4DQOC 2WLBA 1J8CA 3PHXB 1RAXA 5E6PA 1YQBA 4NNJB 2KNBA 2I2YA 1UWMA 2D3AA 2MRPA 3APDA 2CHWA 2L0FA 1PGBA 3DVNV 2CS4A 2IO1B 5HHDG 3A1QA 1T6BX 1ZGUB 4GDKB 5TR5A 1I35A 2EELA 3L4PA 2KMMA 1WXMA 3H7PA 3U2SC 4ICVA 1MHHE 2J0JA 4HJGE 4GXBA 2RDGA 1YX5B 1I42A 1WIAA 2DAFA 2JT4B 3EA6A 4KDLB 1FNUA 2WHIA 1V49A 1D3ZA 1Q1OA 2KTRB 4NPNA 2KVZA 3I5JC 1E9MA 2BB6A 2NBUA 4BKTA 5E6OA 1QT9A 4MH8A 1YJJA 1JROA 3CMMB 4GU2A 2M56B 3N30A 2DX5B 2DZIA 4DBGA 2CHZA 4C00A 3FKYA 3VRBB 1WXSA 1UWXA 2MP2B 5CHVC 3RYTA 2DZKA 2I38A 1IP9A 2K22A 4FHKA 2KANA 3PVLA 2GB1A 4DHJD 3CSTA 1EF1A 3R3MA 3B0AA 4N59A 1K53A 1OTRB 2IDYA 4NQKE 4KZ0A 2M0AA 3KH0A 2IGGA 5E6NA 3WAMA 2FIFA 2NMQA 2OJRA 5J2RA 2GBJA 2K5PA 1SGHA 2R2OA 2KLGA 4WWMA 4W9HA 2WNMA 4E71A 3DBRI 1XXGA 2CU3A 3A33B 3TBLD 2M1MA 2MWSB 5EE0A 3EFCA 5D6JB 5D3DA 1SB3C 2RMMA 3R2TA 4M0WA 4BKSA 1PUTA 1HA5A 3JVZX 1YD8U 2MSED 1UH6A 3ZW3A 4M8NA 1YOVB 3DVGY 1ESFA 2KDFB 1N61A 3WCQA 4FJYA 3SD5A 2BF8B 3PGEA 2ASQA 3KYDD 3AE4B 4RF0A 1KRHA 2LI5A 3IVFA 4PS7A 2N9EB 3URYA 1KTKA 5EE3A 1MHXA 4BVUC 3HHMA 3OJ3A 1PGXA 4K7SA 3AE6B 4PYUA 1SE2A 3IAS1 1MJDA 1HE8A 3H1UA 4II2B 3SR6A 2ZNVC 2L32A 2G45B 4N58A 4TQ1A 1UNSA 2C7HA 4C4VB 3DVGX 2MP2A 3ZRFA 1C9FA 3NS8A 1EU3A 4IM2A 3U52E 3J9CA 2JZPA 5KHOA 3T9LA 2MH7A 2QCZA 1L4DB 4S0RA 3ABVB 2ZPYA 2VZKB 3CF6E 2MJDA 3BY4B 1WY8A 1YN3A 1V2YA 3I9V1 3RI7C 2DLBA 3AMZA 4MGZE 4XE0A 2L83A 4YTMB 2BB5A 3UQAA 4EKUA 2KJRA 2O6VA 1FO4A 4IOIE 3MHZA 4F1SA 1IGDA 2KDIA 5HKHA 2MBHA 1PDXA 2L8JA 2ZJDA 3UIPB 3P42A 2LRWA 1SEBD 3PPAA 4EZLA 1WGHA 1GC7A 2EMTA 3W1SA 3APFA 3ZDMC 1L2NA 4W9JA 3P4RB 4RNAA 1F9JA 2L7RA 5DPTA 2PLPA 1OQYA 4WWOA 2M8SA 5D94A 2D3BA 3ZXVA 1R4NB 4URKA 4C7ZA 1OEYJ 1N6ZA 2Z0DB 3DDCB 1GPXA 4RGOS 2KXJA 4KGRA 1FIQA 2KLCA 5G5HA 3NVZA 1HZ5A 2UWQA 4P1CC 1J7BA 1VD2A 5JHBA 3VR9B 1SXTA 2ONQA 3ZNHB 4EFOA 3IBEA 2M4NA 3KUZA 3AE5B 3RT3B 2LXCA 3SHQA 1YQ3B 5D7GA 1GC6A 3ECIA 3PRZA 2N4FA 3U4EG 2X38A 3VHTC 2BYVE 3I63C 3PZDA 3L0WB 2DYBA 3QQ8B 2BGFA 2WU2B 2BS2B 3B1LX 2HTME 4WH4A 4AWJA 5T8IA 3RNGC 2PMVA 3GB1A 1XEEA 1IBXB 2K8CA 1TZOA 2WXLA 3RCZA 3RN9C 2KDBA 3DCGA 1L5PA 1RM6C 2LEKA 4IW0A 1E7UA 3B2GA 2KO3A 3TEYA 1FPYA 1QILA 2J4XA 1WM3A 1OQRA 4O1NA 1M4VA 1XLNA 2WDVB 2MBOA 1PQSA 3O65B 2M19A 2KWDA 3V62A 3I57A 4KSKC 1TBEA 3X23A 2KACA 1WE6A 3N9YC 3R7QA 1FXIA 4N6EB 3T3NA 4YTNB 2AL3A 1LFDA 3N1YC 4GDLB 4HEA1 3OWEB 4W9EA 4XGAB 3Q8EA 4RM8A 2C5LC 4USAA 1SE4A 4HPLB 2FE8A 4H2AA 3ML8A 1TTNA 3FILB 4OVVA 1TS2A 4PT5A 2A5UA 3OG5A 1NVID 5J17A 4P1BC 1WYGA 3Q2AC 3DWMA 1GNUA 4A9AA 1N60A 2PKOA 4A8XC 4GN1A 3NRZA 1KLUD 3RNCC 1P3QU 4K1RB 2XK5A 1Q5WB 2C7NB 2N9PC 1WJUA 1PYWD 5AUKA 1FEHA 3RNAC 4MGKE 2LASA 3LB8C 3KLSX 2GOWA 1WXAA 1SSNA 3FAHA 4AS1A 2KN4A 1WX8A 3IFWB 4NAMA 4KZCA 4NJ6A 4HXDA 1STEA 1VLBA 2DAJA 2KQ4X 5C2TB 1FFUA 2W3RA 2PVOD 1I4XA 2MBBB 2C9WB 1WH3A 3DBRB 2MJEA 4BBNF 4IWQA 4ANWA 4MGIE 2Z0EB 1TYGB 4A3OA 2ZVOA 1EM7A 5JH5C 3L13A 3WALA 1UD7A 2DZMA 2KMAA 3QCAA 4A6QA 2NCNA 4HWIB 2IBIB 4DXFA 4GDLA 3UQBA 3OAWA 4CQNA 2LHDA 1ZXHA 3OJ4B 1RFKA 2LJIA 1TT5B 2PW9A 2WXNA 3BIID 5CHFA 3V6EB 1YIWA 5MPOA 1V8CA 3GE3C 4ICUA 4JGHB 3ZNID 5IA7A 2BYFA 4WURA 1F52A 4K7WA 4LK0M 5AZFA 5I4DA 2W3SA 1S1QB 1RLFA 1KOTA 5AZGA 3AI5A 3WIMA 2OOBB 4ZYNA 3EC8A 3N1XC 2L76A 2J53A 2W54A 2OHFA 1V80A 2MBEA 3GS2A 4ZYSA 2PTLA 1KFYB 4BAXA 3PLVA 4OHJA 2BS3B 2FUG1 4MSMB 4G50A 3ZKJC 3PV1A 1FXAA 2X8XX 2SAKA 2KQ7A 2KFKB 3ZJTA 5AZHA 1L7YA 4HK2A 1NENB 1XCQL 4MH0E 1MPEA 3IAM1 2UU7A 5C23A 4FADA 2N1WA 4L23A 4UDUC 4NY0A 5HFYA 2WXRA 3RD2A 4WAFA 2IO0B 2ZCBA 3AE7B 1D5ZC 1FCCC 4HCNB 1NEKB 2W55A 4X57B 4DXGA 5EE9A 3MP9A 3JSVA 3Q8CA 2LD9A 2NS5A 4EEWA 3HM3A 3NHEB 1FCLA 2NPTB 3AEEB 4RMAA 2ZVNA 1ZPSA 1UGJA 2M17A 5IP4D 4JWUC 1KLGD 2KAJA 5FKAC 1PFDA 1C78A 1UZXB 3I3TB 5CHWA 1E7PB 2JZZA 2GLSA 2GBMA 1WZ0A 1HEZE 2MEKA 2K25A 2AQ1B 2GBKA 2V4LA 3C19A 2INPE 3IT4B 2RR9A 4KSLC 2LHEA 2MHJA 1FNWA 3DBHI 3DVNU 1OEYA 2BBCA 4OVZA 1SJED 1WFYA 1GAQB 4OZBA 2JYEA 2IY1B 1UELA 3RZFA 2MA9B 4DHJB 4FA6A 5AEKB 2M0XA 3PREA 3NVYA 3B08A 5FR6A 3NZ3A 1VZ7A 3NZUA 3MJWA 4EUTA 4KGSA 4GSWA 2XBBC 4IG7B 1E5WA 3V61A 4GOCA 4RGTA 2LGSA 1WMHB 2N1VA 3AV8A 4WJQA 2JUOA 2JPHA 1WGYA 5TSSA 2DZJA 2KWVB 4DDID 4F7ZA 3P4PB 3RMKC 2Q5WD 2WXFA 3DBLB 3RFZB 2LJ5A 2KOXA 1WR6E 1I4GA 2KJHB 3VH4B 5HG2A 3IHPC 2BQQA 3VXWA 5EE1A 1WRIA 5IAAC 5IN7A 4L2YA 2W82A 2K9XA 2G1EA 4DWFA 1XQQA 2LWPA 2WGSA 3R2IA 2N7DA 3ALBA 4LNIA 3V60A 2AL6A 2HTHA 4W9KA 5DCNA 4G3XB 4P16A 4ANXA 4GMVA 1V1PB 1JWMD 2V3SA 2QSDA 1L0XB 1RFAA 1WRDB 2I1JA 4DXAB 1YNTE 3QWZB 4FN2A 4KVGB 4S17A 2WS3B 4HKQA 4K3BA 2PE9A 2NR2A 1TKYA 3N3KB 3HRDD 2JSVX 4KIKB 2FCNA 2JYTA 4PS8A 2ZNVB 2PJHA 4FJZA 1MVKA 2BTEA 1FRDA 4HDOA 1KH0A 1N62A 1P7EA 2J7QB 1NYRA 4OZAA 1C76A 2YEPF 4GDKA 1WMHA 3AE2B 3AECB 2RPQA 2VH1A 1QQRA 1JMLA 1VRAB 4LNOA 2ZCCA 1F0ZA 1HTQA 2PVGC 1YN5A 4RF1A 3Q69A 2KZRA 1VR9A 2KTRA 2WXPA 2E3TA 4K7UA 4Q2JA 3HUIA 4BKSD 4XZ4A 1CZPA 3BVMA 2G3QB 1YJIA 4B0MA 1IUEA 1ZKHA 4AUQC 4JWSC 2AYOB 4YT0B 4AP4C 3MHSD 1T0RC 2C60A 4A3PA 3LJ3A 2JWZA 1R4MI 3AN1A 2XNAC 4J3OD 4TMAB 1F2RI 4ARCA 3M63B 3QIJA 1P7FA 1D5XC 2DHZA 4J6IA 4QAYA 4NQLB 1XD3B 1ZDXA 2WXKA 1V86A 2ZW1A 1QZEA 4AQ7A 2WDTB 2NBWB 2DENB 4WQOB 3AH7A 4ZRIA 1HTOA 3PZ7A 2KC2A 2FAZA 4RH6A 2OEDA 5CTRC 1B1ZA 2K8BA 4BBNC 3TMPB 2K8HA 2KFJA 4EOYA 1EUVB 4W9LA 1ZP0B 3RULA 1TGZB 3ETRA 4XWTA 2NTSA 2BWES 2J0KA 2O6VD 1ROEA 3TL5A 4A90A 2IPKD 2WXIA 4ANVA 4RGNA 1J7CA 3WANA 1JWAD 4TSSA 1VCBA 3TJPA 5JHAA 4YXDB 1KLVA 1ET6A 5DPSA 3AE3B 4F8CB 4FHJA 1RWSA 4LDTD 5D2MB 2KC1A 1BT0A 4ZRJA 1WXVA 2LGYA 1F77A 2D3CA 1QLBB 4BKGA 2WYQA 1CJEA 3VTUA 2Y5PA 4KKIA 4LCDE 1NDDA 4B95A 4C4VA 2Y3AA 2WXHA 2LVPA 3TEWA 4HLEA 2R61A 1E7VA 2JWUA 5DPRA 2BKRB 3SEBA 1I4RA 4RFBA 3IT6B 3PLUA 1Y8RC 2KTFA 3GOEA 2HE7A 2REXA 3RUIB 3HK0A 2G9HD 3VUXA 1LM8B 3MC0B 2WU5B 1Q0WB 3PRMB 3DBHB 3HVDA 1WX9A 3ZYYX 1LQBA 4CHKA 3AE9B 2KYWA 2KX0A 1F1HA 4XYCA 2LZ6A 1EWYC 1YJ1A 4NZLB 2QHOA 5LLIA 2FCQA 4XDCA 1C4AA 1D5MC 4AOFA 3ENEA 1HQRD 2BWFA 2MX2A 1JW9D 3H9DA 2IO3B 2CR5A 3ZRCA 4YSXB 3MC8A 4AJWA 1WSPA 1CK1A 5BYRA 3W5VB 4FLHA 4M8MA 1FM0D 4RM9A 5LXIB 4JQWC 1MG4A 1WXQA 2A4ZA 2JVCA 2LUEA 2D07B 2V3NA 3AE1B 4ZRPA 3P2BA 1XO3A 3KUDB 1JQ4A 1J0GA 3EGRA 5G2NA 1MFWA 3AEFB 2MLBA 3AU4A 3PHWB 4AJYB 3LDZE 3Q14C 4LTUA 1ET9A 4ZHOA 2GBRA 4HCPB 2RDBC 3BYYB 1CMXB 3BVGA 1I4PA 4HPMB 3AE8B 4YSZB 2CHXA 1U4AA 4KGTA 4IKGA 3WAOA 4IWPA 3W9CB 2J0MA 1JRPA 2HJ1A 1WWTA 2B3AA 1EO6A 1R7SA 1VZ8A 3EFUA 2QC8A 1DGJA 1V6EA 3VR8B 2LGIA 1IBXA 4XC2A 3SFDB 4WJNA 4MACA 2L3ZA 3QA8A 1I7HA 3VVWB 3PZ8A 2O2VB 2I1KA 3HM6X 1LO5D 2JRHA 1C77A 4W9DA 3L08A 3AEAB 2IGDA 4A20A 4B0EA 3HIZA 2LMCA 3DHGC 1NI3A 3ZUNA 1K51A 4LNFA 2C7MB 1E8ZA 3VDZA 1WGKA 3ZDTA 2J52A 5FK9C 4NAWB 2W9NA 1PGAA 2KK8A 4MGYE 2N9LA 3NOBA 1E8YA 4YSYB 1TY0A 1QOAA 1UBIA 4MDKE 2BVCA 2N7JA 3RPFC 5H8YE 3WAPA 3BWUD 4EZJA 1ZOYB 1IGCA 4FJVB 3FILA 5AUIA 2IYDB 2NBVB 3W1YA 3K9PB 2E6XA 1T5XD 1UGMA 4EE2A 4DDGD 3UINB 2G4DB 3H7SA 3EHVA 1QOBA 4TKNA 1P98A 2KDEB 4W9CA 1SE9A 3X0WA 4TQ0A 3M3JA 2L05A 1WGDA 1L0YB 3W2DA 4MELA 3B2FA 2LVQA 2KWUB 1KJTA 3DOWA 4US9A 3T8MA 2V1YA 2HDEA 3NVWA 5GXGB 1WJ6A 4W9GA 3VFKA 4M01A 4I6LB 1AN8A 2QIEB 3ZJUA 4NAWA 3A1QB 3DHHC 1SBBB 1F2RC 4IM3A 2G4SA 2WWZA 3RZWC 2IZVB 1XLPA 4LNKA 2H88B 3TCAA 1R4NI 1WGGA 4KX6B 2KKCA 3RNBC 1V5TA 1OQQA 2MCNB 4C7YA 3KQ4A 4MM3B 2LGXA 1TZ1A 1N5WA 1H4RA 5LNK1 1A5RA 1C79A 3Q3OC 2DYOA 1Q10A 2QJLA 2FCSA 3ZTDA 2CJNA 3V05A 1VZ6A 2RGFA 1YN4A 1RYJA 4JX1C 3M95A 3Q3NC 4OZCA 3AULA 3WA0A 1DYQA 3TSSA 3H6NA 3BYTB 3UI3A 2QEJC 4GIVA 3AEGB 2INCC 3GE8C 1AW7A 3PS6A 5FR3A 3S2AA 2LUMA 5JXVA 3AB5A 4BZAA 2KFKA 2N0SB 4G11A 3QX1A 4GB9A 2YVCA 3IG3A 1E6EB 3A9JB 2WX0A 4RGMA 4YWGG 2KQSA 3NJTA 4WWNA 2FCMA 1UF0A 2N7EA 3DPDA 3L16A 2QILA 2WXMA 5BMGA 3IXSA 1LGRA 5L95C 3D32A 1E10A 1QF6A 2DNFA 1L4ZB 3EUB2 4BOSC 2NPTA 4XWWA 4M0WB 4R3DA 2KWCA 1FNVA 1L6UA 3DHIC 1IYFA 3R66C 1UBQA 2BYEA 2L1AA 4WJOA 4MSQB 1Y56A 5C1ZA 2V3PA 3BZDB 4MM3A 2Y5CA 1DOIA 3QARA 1UUPA 2AEHA 3N20C 3L54A 5BO4B 4ZHPA 3DWGC 1ENFA 1Z5SB 2OJWA 1RRBA 4P6VF 4DK5A 3AM9A 1TS4A 2ZPNA 5E6JA 3UIOB 2DWQA 3ZNGC 3GZNI 4TUUA 3FC4A 3Q8FA 3BVZA 3NG0A 3ZJVA 2PIAA 1BUIC 1JALA 2RPVA 2MJ3A 4C80A 1JWBD 1C3TA 1T0QC 2AX5A 3VTVA 5IO9A 3GP7A 2D3GA 2K6DB 3CIRB 2AWTA 3KW5B 4KV2A 1TY2A 1HXYD 3A9JA 1C4CA 1WI0A 4NJ7A 3N32A 3PO0A 5HI1A 1IPGA 3VUWA 4FBJB 2O6VB 1BMLC 4JPSA 3P1MA 3NZSA 2LXAA 5L83A 3L10B 4WQMA 3KUCB 2K0PA 4C56C 3TIXA 4NJCA 1GJZA 1YMHE 3C0RB 2Y5BB 3ZQ4A 2L0TA 3JYUA 5BYSA 4LDTB 1GUAB 1AWDA 4EZKA 2MBQA 4MEMA 4XDDA 3VUYA 1LXDA 3LXFA 1E8XA 1NBFC 1NI2A 3BK2A 4W9FA 2L00B 2ZZPB 1H8CA 4ACFA 1TKEA 2IJ0A 3E56A 1V1PA 3L17A 1V81A 3M62B 1SE3A 3UF8A 4WIPA 2H89B 1GOZA 3VAWA 1JWUD 3BK1A 1QOFA 2ACZB 2XN9C 3ZXRA 3KWLA 2IO2B 4JLCA 1N63A 3QJZA 4KIKA 2QDFA 4HRSA 3ZGZA 1E8WA 1A70A 4GGQA 1I4HA 3UGBB 2BW2A 5JZEB 2AQ2B 2SEBD 4OW0A 1ACCA 4W9IA 1FMAD 3W1SC 2EKEC 2BPSA 1XF5L 3CSFA 1GB1A 3VRAB 2LVOA 2WXOA 3ZNZB 2J42A 1C1YB 3RNFC 4BFRA 3PRPB 4DHZE 2GMIC 1HZ6A 4L1BA 3Q6BA 3NUHB 2KT7A 4ZOHC 3TEXA 2AQ3B 2WQYB 3AXCA 1V1OA 1QOGA 1J19A 1V9JA 1WJ4A 3KWVA 3ML9A 2NVUI 3Q8AA 2BT6A 5LXHA 3T3OA 4HKZE 4RCOA 4CYEA 1YQ4B 1QKZA 3MC9A 2D5GA 2JXXA 4II3B 4DHZB 3Q3JA 3P4QB 3A4SC 1VJKA 2VRRB 2B76B 2FUHB 2K39A 2V4IB 1WM2A 4B6WA 2LRUA 2WP9B 3SFEB 4YL8A 1TKGA 5IKCM 1EU4A 4IM0A 5IOIA 2JXTA 1WGRA 2BKFA 5DPWA 2LFIA 2Z59B 2VZKD 2V9HA 2WXGA 1FFVA 1AARA 4WWPA 1P9DU 2WDQB 4E74A 3BINA 2XK5B 1D4BA 1WF9A 4MT5A 2WXJA 2FBWB 5G5GA
chains in the Genus database with same CATH topology
5AUIA 1TS5A 1PGXA 3AE6B 1SE2A 2JQRB 3IAS1 4RGTA 1JCKB 2E6XA 1T5XD 3AV8A 3W5UB 4EE2A 3SR6A 2L32A 5TSSA 4N58A 4TQ1A 1UNSA 2RDHA 1C9FA 1EU3A 4YTPB 3U52E 3J9CA 2JZPA 3P4PB 1QOBA 1GB4A 1TS3A 2Q5WD 2WXFA 4IDIA 2MH7A 3RFZB 1L4DB 3ABVB 2VZKB 1SJHD 2BYTA 2MJDA 1I4GA 4TQ0A 1YN3A 5HG2A 3P63A 3I9V1 1FRRA 5EE1A 2DLBA 3AMZA 1WRIA 2KDMA 3VQIA 1L0YB 2IGHA 3W2DA 2ICIA 4XE0A 4L2YA 2L83A 3B2FA 1K52A 2BB5A 2K9XA 2G1EA 2W82A 4YTMB 1MI0A 4IOIE 1FO4A 3MHZA 4US9A 3HVZA 2EKIA 1IGDA 3R2IA 1PDXA 2HDEA 3NVWA 5GXGB 2JU6X 4P16A 3P42A 1V1PB 1AN8A 1SEBD 3B9JA 1JWMD 3TUOA 2QIEB 3ZJUA 2QSDA 2JX5A 3W1SA 4A55A 1L0XB 1XLOA 1SBBB 3TEZA 1YNTE 1F2RC 3P4RB 4RNAA 2BS4B 4US8A 3AEDB 2WS3B 2PLPA 2CJOA 1KF6B 4HKQA 1XLPA 1TKYA 3HRDD 3MJ5A 4FXCA 2JSVX 2H88B 2JYTA 3MFGA 1ZXIA 2INNE 4KX6B 1SIJA 4C7ZA 1ZDVA 1SF0A 1GPXA 1MVKA 2BTEA 2Z8LA 1FRDA 4RGOS 1KH0A 1N62A 1OQQA 1P7EA 1OFFA 4C7YA 4KGRA 3KQ4A 4MM3B 1NYRA 3E9SA 2K3UA 1FIQA 5G5HA 1N5WA 4OZAA 5H92C 1C76A 2YEPF 3NVZA 1HZ5A 3AE2B 5LNK1 3AECB 2ON8A 1J7BA 2V0GA 1C79A 3VR9B 2YEPB 2DYOA 1SXTA 2ONQA 1Q10A 1QQRA 5BYQA 2QJLA 1I4QA 1JMLA 2NTTA 3AE5B 1VRAB 2DBYA 1YQ3B 2CJNA 3V05A 1VZ6A 5D7GA 1F0ZA 1C4PA 1YN4A 2PVGC 1RYJA 3U4EG 2X38A 4JX1C 1YN5A 4OZCA 3AEBB 4RF1A 3Q69A 1DYQA 1CQVA 3TSSA 1VR9A 3BYTB 4GLSC 2WXPA 4ITKA 2E3TA 4Q2JA 1BXTA 3UI3A 2QEJC 2WU2B 3HUIA 2BS2B 3AEGB 1CZPA 2HTME 4WH4A 1AW7A 3BVMA 5FR3A 1YJIA 2LUMA 4B0MA 1IUEA 5T8IA 4JWSC 4YT0B 5JXVA 2PMVA 3AB5A 3GB1A 1FD6A 3R8BA 1N5XA 1B9RA 1L0VB 1XEEA 1IBXB 2N0SB 1J7AA 2ZW0A 2XNAC 3AN1A 4J3OD 1TZOA 2WXLA 4TMAB 1F2RI 1E6EB 4JE3B 5BMHA 4RGMA 1L5PA 1RM6C 2LEKA 4YWGG 4ARCA 3V3XA 3B2GA 1P7FA 1D5XC 1T3QA 3TEYA 1QILA 2J4XA 2QILA 2WXMA 5BMGA 1ZDXA 2WXKA 3IXSA 1OQRA 4O1NA 4KKJA 1E0ZA 1E10A 4D2KA 1QF6A 2DYMA 2ZW1A 1M4VA 4AQ7A 1XLNA 2WDVB 1L4ZB 3P4SB 1ZUD2 3EUB2 2M19A 2KWDA 3U7ZA 3AH7A 5D3IB 4XWWA 3I57A 4R3DA 1FNVA 1L6UA 1V97A 2KACA 1K50A 3PZ7A 3N9YC 1FXIA 4N6EB 5C3JB 3T3NA 4RH6A 4YTNB 2L1AA 3Q8BA 4REZA 1Y56A 2OEDA 1D6EC 2V3PA 4GDLB 4HEA1 2QMTA 3BZDB 1B1ZA 3OWEB 3Q8EA 2Y5CA 3NVVA 1DOIA 1UUPA 4USAA 1NYQA 1SE4A 2FE8A 4ZHPA 4H2AA 1ZP0B 3DWGC 2TSSA 1ENFA 1ZE3D 3ETRA 3FILB 4XWTA 2NTSA 1DOXA 3H8HA 1TS2A 4PT5A 1ROEA 4A90A 4P6VF 1NVID 1XCTL 2IPKD 3AM9A 1TS4A 5E6JA 2WXIA 2DWQA 1WYGA 4ARIA 3DWMA 4RGNA 1J7CA 3LYYA 1JWAD 4TSSA 3FC4A 4A9AA 3Q8FA 4YXDB 1N60A 2PKOA 3BVZA 1ET6A 3ZJVA 4A8XC 3AE3B 5BMIA 3NRZA 1KLUD 2PIAA 1BUIC 1JALA 4LLGM 2RPVA 2MJ3A 4C80A 1JWBD 3C8YA 2AX5A 1JWSD 1RWSA 3O13A 3GP7A 1PYWD 3CIRB 1TJEA 5AUKA 1FEHA 3LB8C 1F77A 3KLSX 1TY2A 1QLBB 2GI9A 1SSNA 3FAHA 4AS1A 1HXYD 1AYFA 2KN4A 1CJEA 1C4CA 4NAMA 2Y5PA 4KKIA 2N9KA 1STEA 1VLBA 4HROA 2Y3AA 2WXHA 3PO0A 5HI1A 2KQ4X 5C2TB 3NS1A 3TEWA 1FFUA 1EWCA 2W3RA 1DOYA 2R61A 2WDRB 1BMLC 3FILA 2JWUA 2PVOD 2L52A 1I4XA 3P1MA 4JPSA 2WXQA 2MJEA 1I4RA 1XLQA 4RFBA 3SEBA 1VDVA 3IT6B 2GRIA 4WQMA 4C56C 1TYGB 2K0PA 4ZRQA 1EM7A 2G9HD 4NJCA 3CWIA 3MC0B 2WU5B 1YMHE 4A6QA 1L6VA 3HVDA 3ZYYX 3ZQ4A 4DQOC 2WLBA 3AE9B 5BYSA 1AWDA 4DXFA 4XDDA 4CQNA 2LHDA 1ZXHA 1RFKA 3LXFA 2LJIA 2I2YA 2PW9A 1EWYC 2WXNA 3BIID 1UWMA 3BK2A 4NZLB 5MPOA 1TKEA 1V8CA 2IJ0A 3E56A 1PGBA 1V1PA 4XDCA 1C4AA 1D5MC 5HHDG 1SE3A 1T6BX 4WIPA 4WURA 2H89B 1GOZA 4LK0M 1HQRD 1JW9D 1JWUD 3BK1A 4GDKB 1QOFA 2ACZB 4YSXB 5I4DA 2XN9C 2W3SA 2EELA 1WSPA 3L4PA 2KMMA 3U2SC 3KWLA 1CK1A 5BYRA 1MHHE 3W5VB 1N63A 2J53A 2W54A 2OHFA 1FM0D 4HJGE 4HRSA 2RDGA 3ZGZA 1A70A 1WXQA 3GS2A 1I4HA 2BW2A 4ZYSA 2PTLA 1KFYB 2V3NA 3EA6A 1FNUA 3AE1B 4ZRPA 2AQ2B 2SEBD 1XO3A 4OHJA 4OW0A 2BS3B 1JQ4A 2FUG1 1ACCA 1E9MA 1FMAD 3EGRA 3AEFB 2BB6A 1XF5L 1FXAA 2SAKA 1QT9A 4MH8A 1GB1A 4LTUA 3VRAB 2WXOA 1YJJA 3ZJTA 1ET9A 1JROA 1NENB 2J42A 1XCQL 4ZHOA 1MPEA 3IAM1 2M56B 3BYYB 3BVGA 1I4PA 3AE8B 4YSZB 4L23A 4UDUC 5HFYA 1HZ6A 4KGTA 4L1BA 4IKGA 3VRBB 2WXRA 3NUHB 4ZOHC 3W9CB 1UWXA 3TEXA 4WAFA 2AQ3B 1JRPA 1WWTA 2I38A 2WQYB 3AE7B 1D5ZC 1FCCC 1V1OA 2K22A 1QOGA 1R7SA 1VZ8A 1DGJA 3KWVA 1NEKB 3Q8AA 2W55A 3VR8B 2GB1A 2BT6A 2LGIA 1IBXA 4DXGA 2WXJA 3T3OA 5EE9A 3MP9A 3Q8CA 4HKZE 3SFDB 4N59A 4MACA 4RCOA 1FCLA 1YQ4B 1I7HA 1K53A 1QKZA 3PZ8A 2IDYA 3AEEB 2D5GA 2M0AA 1LO5D 1ZPSA 1UGJA 2IGGA 4JWUC 1C77A 3P4QB 1KLGD 2NMQA 2K5PA 2KAJA 5FKAC 1VJKA 3AEAB 1PFDA 2IGDA 2B76B 4B0EA 1C78A 2LMCA 1NI3A 4WWMA 2WNMA 1K51A 2V4IB 1XXGA 1E7PB 2WP9B 3SFEB 1WGKA 2CU3A 2J52A 1HEZE 5EE0A 1TKGA 2MEKA 2AQ1B 5D3DA 1EU4A 1SB3C 2RMMA 2INPE 3IT4B 5FK9C 3R2TA 2JXTA 4NAWB 4M0WA 2LHEA 1PGAA 1PUTA 1FNWA 1HA5A 2BBCA 4OVZA 1IGCA 2N9LA 2LFIA 1SJED 1GAQB 4OZBA 2JYEA 2VZKD 1ESFA 4YSYB 1N61A 3WCQA 1TY0A 1QOAA 2WXGA 1FFVA 3NVYA 3AE4B 2N7JA 3RPFC 4RF0A 2WDQB 1KRHA 1VZ7A 3NZ3A 5H8YE 3URYA 1KTKA 1D4BA 3BWUD 4MT5A 5EE3A 1MHXA 1ZOYB 4KGSA 2FBWB 5G5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFY B;  5AUI A;  4YXD B;  1N60 A;  2PKO A;  2QJL A;  3AE1 B;  3AE6 B;  3AE3 B;  1XO3 A;  3AE5 B;  2PIA A;  3NRZ A;  2DBY A;  2JQR B;  2BS3 B;  1YQ3 B;  1JAL A;  2CJN A;  2MJ3 A;  4C80 A;  1JQ4 A;  1JWB D;  1F0Z A;  1E9M A;  1FMA D;  3AV8 A;  3W5U B;  2PVG C;  1RYJ A;  2AX5 A;  3AEF B;  4JX1 C;  1RWS A;  1FXA A;  3SR6 A;  3AEB B;  1QT9 A;  3CIR B;  1TJE A;  4LTU A;  3VRA B;  4N58 A;  5AUK A;  1YJJ A;  4ITK A;  2E3T A;  1JRO A;  1NEN B;  4ZHO A;  2WU2 B;  3HUI A;  2BS2 B;  3LB8 C;  3AEG B;  1CZP A;  2M56 B;  2HTM E;  1QLB B;  4YTP B;  1YJI A;  3FAH A;  1IUE A;  3P4P B;  1AYF A;  1QOB A;  1CJE A;  3AE8 B;  4JWS C;  4YT0 B;  4YSZ B;  2Q5W D;  3AB5 A;  4IDI A;  2MH7 A;  1VLB A;  3VRB B;  1N5X A;  3ABV B;  4HRO A;  1B9R A;  1L0V B;  4ZOH C;  3W9C B;  3PO0 A;  2N0S B;  5C2T B;  3NS1 A;  1JRP A;  1FFU A;  1J7A A;  2MJD A;  1WWT A;  2W3R A;  3AN1 A;  2WDR B;  3AE7 B;  2WQY B;  1DOY A;  3P63 A;  2PVO D;  2L52 A;  1FRR A;  2K22 A;  1QOG A;  1R7S A;  3P1M A;  1E6E B;  5EE1 A;  2MJE A;  1DGJ A;  1XLQ A;  3AMZ A;  1WRI A;  1NEK B;  1VDV A;  2W55 A;  3VR8 B;  1L5P A;  1RM6 C;  2BT6 A;  2LEK A;  2L83 A;  3B2F A;  4WQM A;  5EE9 A;  2K9X A;  2G1E A;  3SFD B;  4YTM B;  1TYG B;  4N59 A;  3B2G A;  1FO4 A;  1T3Q A;  4US9 A;  3CWI A;  2EKI A;  3HVZ A;  1YQ4 B;  1I7H A;  2WU5 B;  3AEE B;  1PDX A;  1L6V A;  3ZYY X;  1OQR A;  3NVW A;  5GXG B;  1E0Z A;  1E10 A;  1QF6 A;  2WLB A;  3AE9 B;  4JWU C;  3P4Q B;  1AWD A;  1XLN A;  2WDV B;  2K5P A;  3P4S B;  1ZUD 2;  2KAJ A;  3B9J A;  1VJK A;  3EUB 2;  3AEA B;  1PFD A;  2QIE B;  2B76 B;  2M19 A;  3AH7 A;  1RFK A;  1NI3 A;  3LXF A;  4WWM A;  2JX5 A;  1EWY C;  3BII D;  1UWM A;  1L6U A;  1XLO A;  1V97 A;  1E7P B;  2WP9 B;  3SFE B;  1WGK A;  2CU3 A;  3P4R B;  1FXI A;  5MPO A;  1TKE A;  1V8C A;  4N6E B;  5EE0 A;  5C3J B;  4YTN B;  1TKG A;  2BS4 B;  4US8 A;  3AED B;  1SB3 C;  2WS3 B;  2CJO A;  1KF6 B;  1XLP A;  1TKY A;  2H89 B;  1PUT A;  2Y5C A;  3HRD D;  4FXC A;  3NVV A;  1DOI A;  2H88 B;  1JW9 D;  1QOF A;  1ZXI A;  4USA A;  1NYQ A;  2ACZ B;  4KX6 B;  4YSX B;  1GAQ B;  1SIJ A;  4C7Z A;  2W3S A;  4ZHP A;  1SF0 A;  1ZP0 B;  3DWG C;  3L4P A;  2KMM A;  1GPX A;  3ETR A;  1FRD A;  1N61 A;  1OQQ A;  1N62 A;  3KWL A;  4YSY B;  1OFF A;  3WCQ A;  1QOA A;  4C7Y A;  3W5V B;  1DOX A;  1ROE A;  1FFV A;  1N63 A;  1NYR A;  2W54 A;  3NVY A;  1FIQ A;  1FM0 D;  1N5W A;  2OHF A;  3AE4 B;  5G5H A;  4P6V F;  1NVI D;  4HRS A;  3NVZ A;  3AM9 A;  2WDQ B;  1KRH A;  5H92 C;  3RPF C;  3AE2 B;  2DWQ A;  3AEC B;  5H8Y E;  1J7B A;  1WYG A;  3DWM A;  1A70 A;  1WXQ A;  5EE3 A;  1J7C A;  3VR9 B;  1JWA D;  1ZOY B;  3FC4 A;  2FBW B;  5G5G A;  4A9A A; 
#chains in the Genus database with same CATH topology
 3DQV A;  1ISN A;  1TS5 A;  3ZLZ A;  1M94 A;  3PSE B;  2JQR B;  1T0S C;  1JCK B;  3V6C B;  3NY5 A;  3W5U B;  3ZIM A;  1JRU A;  4JL9 A;  2FID A;  3Q3M C;  2RDH A;  1TIF A;  5J18 A;  2K1F A;  2MQJ A;  4YTP B;  1KM7 A;  3ZVV A;  1G6J A;  1GB4 A;  1TS3 A;  4K81 A;  4IDI A;  3DBL I;  4I6P A;  1SJH D;  3K9O B;  2BYT A;  4P7I A;  5EDS A;  3QK0 A;  3P63 A;  1FRR A;  2KDM A;  3KYC D;  1P0R A;  3VQI A;  2IGH A;  2ICI A;  1XT9 B;  1K52 A;  2KMC A;  3PT2 B;  2K6Q A;  2IY0 B;  3AU5 A;  1MI0 A;  3HVZ A;  2EKI A;  1WE7 A;  3QHT A;  2JU6 X;  3U7D A;  4PYZ A;  3B9J A;  3TUO A;  5KHQ A;  2HJ8 A;  2N9X A;  3JW0 X;  4N9F 4;  3VTW A;  2JX5 A;  1E90 A;  4A55 A;  1WJN A;  1XLO A;  3TEZ A;  3GZN B;  2BS4 B;  3ZTC A;  3AED B;  2JY6 A;  4B9K A;  4US8 A;  2CJO A;  1KF6 B;  1Z2M A;  4IUM B;  3SU8 X;  3ZO5 B;  3MJ5 A;  4FXC A;  2HD5 B;  3MFG A;  1ZXI A;  2INN E;  4ASW C;  1SIJ A;  4M02 A;  3U8Z A;  1FXT B;  1ZDV A;  4HVB A;  1SF0 A;  2RD0 A;  2Z8L A;  3QC8 B;  1OFF A;  4ZRK A;  3OLM D;  3E9S A;  2K3U A;  3EEC A;  5H92 C;  3PTF C;  2ON8 A;  3Q3F A;  2KVR A;  2V0G A;  2YEP B;  3SDL C;  5BYQ A;  2KN5 A;  1I4Q A;  2PPH A;  2NTT A;  2DBY A;  3U30 A;  3RNE C;  2LGD A;  1C4P A;  4ZDV A;  4KDI C;  2XEW A;  2D2Q A;  3AEB B;  1CQV A;  4GLS C;  4ITK A;  1BXT A;  1OGW A;  4MJS B;  4IC7 B;  2MW5 A;  4ANU A;  4PS3 A;  3A9K B;  1K8R B;  1FD6 A;  4K3C A;  2KJ6 A;  4JIO U;  3R8B A;  3MTN B;  4WAA A;  1N5X A;  2CU1 A;  1B9R A;  1L0V B;  3VH3 B;  3JSV B;  1R4M B;  4LJO B;  1V5O A;  1J7A A;  2ZW0 A;  2RSU A;  2IND C;  4WJP A;  4LJP B;  4JE3 B;  1WX7 A;  5BMH A;  3A4R A;  2VH2 A;  3R7R A;  3V3X A;  4BOZ B;  1T3Q A;  4IWO A;  2D10 A;  2CKH B;  4M00 A;  4KKJ A;  1E0Z A;  4HDQ A;  4D2K A;  2DYM A;  2JZ3 B;  2EMS A;  3P4S B;  1ZUD 2;  5GMV A;  3U7Z A;  2ZEQ A;  1GG3 A;  5D3I B;  1P1A A;  1S3S G;  2O2V A;  1V97 A;  1K50 A;  4HJK A;  3APC A;  5C3J B;  3Q8B A;  4REZ A;  1D6E C;  1ZW7 A;  2QMT A;  4XX5 A;  2PE6 B;  3NVV A;  5CX3 A;  4PK1 A;  4OVU A;  1NYQ A;  2TSS A;  1ZE3 D;  2PEA A;  2UYZ B;  1DOX A;  3H8H A;  2FNJ B;  1XCT L;  2JF5 A;  4ARI A;  3LYY A;  3H7P B;  3DBS A;  5BMI A;  1T0Y A;  2YLM A;  4HPP A;  4LLG M;  4MJS A;  4FUL A;  3C8Y A;  3A9K A;  1JWS D;  3O13 A;  4G0N B;  1EF5 A;  2R2Q A;  1TJE A;  1SIF A;  5G55 A;  2D11 A;  1YX6 B;  2GI9 A;  1AYF A;  2KX3 A;  3QAQ A;  4LNN A;  2N9K A;  3N1Z C;  4CO7 A;  4HRO A;  3NS1 A;  2GBN A;  1EWC A;  1DOY A;  1MG8 A;  2WDR B;  4E3C A;  2KHW B;  2L52 A;  3KVF B;  2KD0 A;  2WXQ A;  1WZ3 A;  1XLQ A;  2JRI B;  1VDV A;  1X1M A;  2GRI A;  2WX1 A;  4ZRQ A;  4TV3 A;  3CWI A;  3ONS A;  4I6N B;  1WYW B;  1WR1 A;  1L6V A;  4DQO C;  2WLB A;  1J8C A;  3PHX B;  1RAX A;  5E6P A;  1YQB A;  4NNJ B;  2KNB A;  2I2Y A;  1UWM A;  2D3A A;  2MRP A;  3APD A;  2CHW A;  2L0F A;  1PGB A;  3DVN V;  2CS4 A;  2IO1 B;  5HHD G;  3A1Q A;  1T6B X;  1ZGU B;  4GDK B;  5TR5 A;  1I35 A;  2EEL A;  3L4P A;  2KMM A;  1WXM A;  3H7P A;  3U2S C;  4ICV A;  1MHH E;  2J0J A;  4HJG E;  4GXB A;  2RDG A;  1YX5 B;  1I42 A;  1WIA A;  2DAF A;  2JT4 B;  3EA6 A;  4KDL B;  1FNU A;  2WHI A;  1V49 A;  1D3Z A;  1Q1O A;  2KTR B;  4NPN A;  2KVZ A;  3I5J C;  1E9M A;  2BB6 A;  2NBU A;  4BKT A;  5E6O A;  1QT9 A;  4MH8 A;  1YJJ A;  1JRO A;  3CMM B;  4GU2 A;  2M56 B;  3N30 A;  2DX5 B;  2DZI A;  4DBG A;  2CHZ A;  4C00 A;  3FKY A;  3VRB B;  1WXS A;  1UWX A;  2MP2 B;  5CHV C;  3RYT A;  2DZK A;  2I38 A;  1IP9 A;  2K22 A;  4FHK A;  2KAN A;  3PVL A;  2GB1 A;  4DHJ D;  3CST A;  1EF1 A;  3R3M A;  3B0A A;  4N59 A;  1K53 A;  1OTR B;  2IDY A;  4NQK E;  4KZ0 A;  2M0A A;  3KH0 A;  2IGG A;  5E6N A;  3WAM A;  2FIF A;  2NMQ A;  2OJR A;  5J2R A;  2GBJ A;  2K5P A;  1SGH A;  2R2O A;  2KLG A;  4WWM A;  4W9H A;  2WNM A;  4E71 A;  3DBR I;  1XXG A;  2CU3 A;  3A33 B;  3TBL D;  2M1M A;  2MWS B;  5EE0 A;  3EFC A;  5D6J B;  5D3D A;  1SB3 C;  2RMM A;  3R2T A;  4M0W A;  4BKS A;  1PUT A;  1HA5 A;  3JVZ X;  1YD8 U;  2MSE D;  1UH6 A;  3ZW3 A;  4M8N A;  1YOV B;  3DVG Y;  1ESF A;  2KDF B;  1N61 A;  3WCQ A;  4FJY A;  3SD5 A;  2BF8 B;  3PGE A;  2ASQ A;  3KYD D;  3AE4 B;  4RF0 A;  1KRH A;  2LI5 A;  3IVF A;  4PS7 A;  2N9E B;  3URY A;  1KTK A;  5EE3 A;  1MHX A;  4BVU C;  3HHM A;  3OJ3 A;  1PGX A;  4K7S A;  3AE6 B;  4PYU A;  1SE2 A;  3IAS 1;  1MJD A;  1HE8 A;  3H1U A;  4II2 B;  3SR6 A;  2ZNV C;  2L32 A;  2G45 B;  4N58 A;  4TQ1 A;  1UNS A;  2C7H A;  4C4V B;  3DVG X;  2MP2 A;  3ZRF A;  1C9F A;  3NS8 A;  1EU3 A;  4IM2 A;  3U52 E;  3J9C A;  2JZP A;  5KHO A;  3T9L A;  2MH7 A;  2QCZ A;  1L4D B;  4S0R A;  3ABV B;  2ZPY A;  2VZK B;  3CF6 E;  2MJD A;  3BY4 B;  1WY8 A;  1YN3 A;  1V2Y A;  3I9V 1;  3RI7 C;  2DLB A;  3AMZ A;  4MGZ E;  4XE0 A;  2L83 A;  4YTM B;  2BB5 A;  3UQA A;  4EKU A;  2KJR A;  2O6V A;  1FO4 A;  4IOI E;  3MHZ A;  4F1S A;  1IGD A;  2KDI A;  5HKH A;  2MBH A;  1PDX A;  2L8J A;  2ZJD A;  3UIP B;  3P42 A;  2LRW A;  1SEB D;  3PPA A;  4EZL A;  1WGH A;  1GC7 A;  2EMT A;  3W1S A;  3APF A;  3ZDM C;  1L2N A;  4W9J A;  3P4R B;  4RNA A;  1F9J A;  2L7R A;  5DPT A;  2PLP A;  1OQY A;  4WWO A;  2M8S A;  5D94 A;  2D3B A;  3ZXV A;  1R4N B;  4URK A;  4C7Z A;  1OEY J;  1N6Z A;  2Z0D B;  3DDC B;  1GPX A;  4RGO S;  2KXJ A;  4KGR A;  1FIQ A;  2KLC A;  5G5H A;  3NVZ A;  1HZ5 A;  2UWQ A;  4P1C C;  1J7B A;  1VD2 A;  5JHB A;  3VR9 B;  1SXT A;  2ONQ A;  3ZNH B;  4EFO A;  3IBE A;  2M4N A;  3KUZ A;  3AE5 B;  3RT3 B;  2LXC A;  3SHQ A;  1YQ3 B;  5D7G A;  1GC6 A;  3ECI A;  3PRZ A;  2N4F A;  3U4E G;  2X38 A;  3VHT C;  2BYV E;  3I63 C;  3PZD A;  3L0W B;  2DYB A;  3QQ8 B;  2BGF A;  2WU2 B;  2BS2 B;  3B1L X;  2HTM E;  4WH4 A;  4AWJ A;  5T8I A;  3RNG C;  2PMV A;  3GB1 A;  1XEE A;  1IBX B;  2K8C A;  1TZO A;  2WXL A;  3RCZ A;  3RN9 C;  2KDB A;  3DCG A;  1L5P A;  1RM6 C;  2LEK A;  4IW0 A;  1E7U A;  3B2G A;  2KO3 A;  3TEY A;  1FPY A;  1QIL A;  2J4X A;  1WM3 A;  1OQR A;  4O1N A;  1M4V A;  1XLN A;  2WDV B;  2MBO A;  1PQS A;  3O65 B;  2M19 A;  2KWD A;  3V62 A;  3I57 A;  4KSK C;  1TBE A;  3X23 A;  2KAC A;  1WE6 A;  3N9Y C;  3R7Q A;  1FXI A;  4N6E B;  3T3N A;  4YTN B;  2AL3 A;  1LFD A;  3N1Y C;  4GDL B;  4HEA 1;  3OWE B;  4W9E A;  4XGA B;  3Q8E A;  4RM8 A;  2C5L C;  4USA A;  1SE4 A;  4HPL B;  2FE8 A;  4H2A A;  3ML8 A;  1TTN A;  3FIL B;  4OVV A;  1TS2 A;  4PT5 A;  2A5U A;  3OG5 A;  1NVI D;  5J17 A;  4P1B C;  1WYG A;  3Q2A C;  3DWM A;  1GNU A;  4A9A A;  1N60 A;  2PKO A;  4A8X C;  4GN1 A;  3NRZ A;  1KLU D;  3RNC C;  1P3Q U;  4K1R B;  2XK5 A;  1Q5W B;  2C7N B;  2N9P C;  1WJU A;  1PYW D;  5AUK A;  1FEH A;  3RNA C;  4MGK E;  2LAS A;  3LB8 C;  3KLS X;  2GOW A;  1WXA A;  1SSN A;  3FAH A;  4AS1 A;  2KN4 A;  1WX8 A;  3IFW B;  4NAM A;  4KZC A;  4NJ6 A;  4HXD A;  1STE A;  1VLB A;  2DAJ A;  2KQ4 X;  5C2T B;  1FFU A;  2W3R A;  2PVO D;  1I4X A;  2MBB B;  2C9W B;  1WH3 A;  3DBR B;  2MJE A;  4BBN F;  4IWQ A;  4ANW A;  4MGI E;  2Z0E B;  1TYG B;  4A3O A;  2ZVO A;  1EM7 A;  5JH5 C;  3L13 A;  3WAL A;  1UD7 A;  2DZM A;  2KMA A;  3QCA A;  4A6Q A;  2NCN A;  4HWI B;  2IBI B;  4DXF A;  4GDL A;  3UQB A;  3OAW A;  4CQN A;  2LHD A;  1ZXH A;  3OJ4 B;  1RFK A;  2LJI A;  1TT5 B;  2PW9 A;  2WXN A;  3BII D;  5CHF A;  3V6E B;  1YIW A;  5MPO A;  1V8C A;  3GE3 C;  4ICU A;  4JGH B;  3ZNI D;  5IA7 A;  2BYF A;  4WUR A;  1F52 A;  4K7W A;  4LK0 M;  5AZF A;  5I4D A;  2W3S A;  1S1Q B;  1RLF A;  1KOT A;  5AZG A;  3AI5 A;  3WIM A;  2OOB B;  4ZYN A;  3EC8 A;  3N1X C;  2L76 A;  2J53 A;  2W54 A;  2OHF A;  1V80 A;  2MBE A;  3GS2 A;  4ZYS A;  2PTL A;  1KFY B;  4BAX A;  3PLV A;  4OHJ A;  2BS3 B;  2FUG 1;  4MSM B;  4G50 A;  3ZKJ C;  3PV1 A;  1FXA A;  2X8X X;  2SAK A;  2KQ7 A;  2KFK B;  3ZJT A;  5AZH A;  1L7Y A;  4HK2 A;  1NEN B;  1XCQ L;  4MH0 E;  1MPE A;  3IAM 1;  2UU7 A;  5C23 A;  4FAD A;  2N1W A;  4L23 A;  4UDU C;  4NY0 A;  5HFY A;  2WXR A;  3RD2 A;  4WAF A;  2IO0 B;  2ZCB A;  3AE7 B;  1D5Z C;  1FCC C;  4HCN B;  1NEK B;  2W55 A;  4X57 B;  4DXG A;  5EE9 A;  3MP9 A;  3JSV A;  3Q8C A;  2LD9 A;  2NS5 A;  4EEW A;  3HM3 A;  3NHE B;  1FCL A;  2NPT B;  3AEE B;  4RMA A;  2ZVN A;  1ZPS A;  1UGJ A;  2M17 A;  5IP4 D;  4JWU C;  1KLG D;  2KAJ A;  5FKA C;  1PFD A;  1C78 A;  1UZX B;  3I3T B;  5CHW A;  1E7P B;  2JZZ A;  2GLS A;  2GBM A;  1WZ0 A;  1HEZ E;  2MEK A;  2K25 A;  2AQ1 B;  2GBK A;  2V4L A;  3C19 A;  2INP E;  3IT4 B;  2RR9 A;  4KSL C;  2LHE A;  2MHJ A;  1FNW A;  3DBH I;  3DVN U;  1OEY A;  2BBC A;  4OVZ A;  1SJE D;  1WFY A;  1GAQ B;  4OZB A;  2JYE A;  2IY1 B;  1UEL A;  3RZF A;  2MA9 B;  4DHJ B;  4FA6 A;  5AEK B;  2M0X A;  3PRE A;  3NVY A;  3B08 A;  5FR6 A;  3NZ3 A;  1VZ7 A;  3NZU A;  3MJW A;  4EUT A;  4KGS A;  4GSW A;  2XBB C;  4IG7 B;  1E5W A;  3V61 A;  4GOC A;  4RGT A;  2LGS A;  1WMH B;  2N1V A;  3AV8 A;  4WJQ A;  2JUO A;  2JPH A;  1WGY A;  5TSS A;  2DZJ A;  2KWV B;  4DDI D;  4F7Z A;  3P4P B;  3RMK C;  2Q5W D;  2WXF A;  3DBL B;  3RFZ B;  2LJ5 A;  2KOX A;  1WR6 E;  1I4G A;  2KJH B;  3VH4 B;  5HG2 A;  3IHP C;  2BQQ A;  3VXW A;  5EE1 A;  1WRI A;  5IAA C;  5IN7 A;  4L2Y A;  2W82 A;  2K9X A;  2G1E A;  4DWF A;  1XQQ A;  2LWP A;  2WGS A;  3R2I A;  2N7D A;  3ALB A;  4LNI A;  3V60 A;  2AL6 A;  2HTH A;  4W9K A;  5DCN A;  4G3X B;  4P16 A;  4ANX A;  4GMV A;  1V1P B;  1JWM D;  2V3S A;  2QSD A;  1L0X B;  1RFA A;  1WRD B;  2I1J A;  4DXA B;  1YNT E;  3QWZ B;  4FN2 A;  4KVG B;  4S17 A;  2WS3 B;  4HKQ A;  4K3B A;  2PE9 A;  2NR2 A;  1TKY A;  3N3K B;  3HRD D;  2JSV X;  4KIK B;  2FCN A;  2JYT A;  4PS8 A;  2ZNV B;  2PJH A;  4FJZ A;  1MVK A;  2BTE A;  1FRD A;  4HDO A;  1KH0 A;  1N62 A;  1P7E A;  2J7Q B;  1NYR A;  4OZA A;  1C76 A;  2YEP F;  4GDK A;  1WMH A;  3AE2 B;  3AEC B;  2RPQ A;  2VH1 A;  1QQR A;  1JML A;  1VRA B;  4LNO A;  2ZCC A;  1F0Z A;  1HTQ A;  2PVG C;  1YN5 A;  4RF1 A;  3Q69 A;  2KZR A;  1VR9 A;  2KTR A;  2WXP A;  2E3T A;  4K7U A;  4Q2J A;  3HUI A;  4BKS D;  4XZ4 A;  1CZP A;  3BVM A;  2G3Q B;  1YJI A;  4B0M A;  1IUE A;  1ZKH A;  4AUQ C;  4JWS C;  2AYO B;  4YT0 B;  4AP4 C;  3MHS D;  1T0R C;  2C60 A;  4A3P A;  3LJ3 A;  2JWZ A;  1R4M I;  3AN1 A;  2XNA C;  4J3O D;  4TMA B;  1F2R I;  4ARC A;  3M63 B;  3QIJ A;  1P7F A;  1D5X C;  2DHZ A;  4J6I A;  4QAY A;  4NQL B;  1XD3 B;  1ZDX A;  2WXK A;  1V86 A;  2ZW1 A;  1QZE A;  4AQ7 A;  2WDT B;  2NBW B;  2DEN B;  4WQO B;  3AH7 A;  4ZRI A;  1HTO A;  3PZ7 A;  2KC2 A;  2FAZ A;  4RH6 A;  2OED A;  5CTR C;  1B1Z A;  2K8B A;  4BBN C;  3TMP B;  2K8H A;  2KFJ A;  4EOY A;  1EUV B;  4W9L A;  1ZP0 B;  3RUL A;  1TGZ B;  3ETR A;  4XWT A;  2NTS A;  2BWE S;  2J0K A;  2O6V D;  1ROE A;  3TL5 A;  4A90 A;  2IPK D;  2WXI A;  4ANV A;  4RGN A;  1J7C A;  3WAN A;  1JWA D;  4TSS A;  1VCB A;  3TJP A;  5JHA A;  4YXD B;  1KLV A;  1ET6 A;  5DPS A;  3AE3 B;  4F8C B;  4FHJ A;  1RWS A;  4LDT D;  5D2M B;  2KC1 A;  1BT0 A;  4ZRJ A;  1WXV A;  2LGY A;  1F77 A;  2D3C A;  1QLB B;  4BKG A;  2WYQ A;  1CJE A;  3VTU A;  2Y5P A;  4KKI A;  4LCD E;  1NDD A;  4B95 A;  4C4V A;  2Y3A A;  2WXH A;  2LVP A;  3TEW A;  4HLE A;  2R61 A;  1E7V A;  2JWU A;  5DPR A;  2BKR B;  3SEB A;  1I4R A;  4RFB A;  3IT6 B;  3PLU A;  1Y8R C;  2KTF A;  3GOE A;  2HE7 A;  2REX A;  3RUI B;  3HK0 A;  2G9H D;  3VUX A;  1LM8 B;  3MC0 B;  2WU5 B;  1Q0W B;  3PRM B;  3DBH B;  3HVD A;  1WX9 A;  3ZYY X;  1LQB A;  4CHK A;  3AE9 B;  2KYW A;  2KX0 A;  1F1H A;  4XYC A;  2LZ6 A;  1EWY C;  1YJ1 A;  4NZL B;  2QHO A;  5LLI A;  2FCQ A;  4XDC A;  1C4A A;  1D5M C;  4AOF A;  3ENE A;  1HQR D;  2BWF A;  2MX2 A;  1JW9 D;  3H9D A;  2IO3 B;  2CR5 A;  3ZRC A;  4YSX B;  3MC8 A;  4AJW A;  1WSP A;  1CK1 A;  5BYR A;  3W5V B;  4FLH A;  4M8M A;  1FM0 D;  4RM9 A;  5LXI B;  4JQW C;  1MG4 A;  1WXQ A;  2A4Z A;  2JVC A;  2LUE A;  2D07 B;  2V3N A;  3AE1 B;  4ZRP A;  3P2B A;  1XO3 A;  3KUD B;  1JQ4 A;  1J0G A;  3EGR A;  5G2N A;  1MFW A;  3AEF B;  2MLB A;  3AU4 A;  3PHW B;  4AJY B;  3LDZ E;  3Q14 C;  4LTU A;  1ET9 A;  4ZHO A;  2GBR A;  4HCP B;  2RDB C;  3BYY B;  1CMX B;  3BVG A;  1I4P A;  4HPM B;  3AE8 B;  4YSZ B;  2CHX A;  1U4A A;  4KGT A;  4IKG A;  3WAO A;  4IWP A;  3W9C B;  2J0M A;  1JRP A;  2HJ1 A;  1WWT A;  2B3A A;  1EO6 A;  1R7S A;  1VZ8 A;  3EFU A;  2QC8 A;  1DGJ A;  1V6E A;  3VR8 B;  2LGI A;  1IBX A;  4XC2 A;  3SFD B;  4WJN A;  4MAC A;  2L3Z A;  3QA8 A;  1I7H A;  3VVW B;  3PZ8 A;  2O2V B;  2I1K A;  3HM6 X;  1LO5 D;  2JRH A;  1C77 A;  4W9D A;  3L08 A;  3AEA B;  2IGD A;  4A20 A;  4B0E A;  3HIZ A;  2LMC A;  3DHG C;  1NI3 A;  3ZUN A;  1K51 A;  4LNF A;  2C7M B;  1E8Z A;  3VDZ A;  1WGK A;  3ZDT A;  2J52 A;  5FK9 C;  4NAW B;  2W9N A;  1PGA A;  2KK8 A;  4MGY E;  2N9L A;  3NOB A;  1E8Y A;  4YSY B;  1TY0 A;  1QOA A;  1UBI A;  4MDK E;  2BVC A;  2N7J A;  3RPF C;  5H8Y E;  3WAP A;  3BWU D;  4EZJ A;  1ZOY B;  1IGC A;  4FJV B;  3FIL A;  5AUI A;  2IYD B;  2NBV B;  3W1Y A;  3K9P B;  2E6X A;  1T5X D;  1UGM A;  4EE2 A;  4DDG D;  3UIN B;  2G4D B;  3H7S A;  3EHV A;  1QOB A;  4TKN A;  1P98 A;  2KDE B;  4W9C A;  1SE9 A;  3X0W A;  4TQ0 A;  3M3J A;  2L05 A;  1WGD A;  1L0Y B;  3W2D A;  4MEL A;  3B2F A;  2LVQ A;  2KWU B;  1KJT A;  3DOW A;  4US9 A;  3T8M A;  2V1Y A;  2HDE A;  3NVW A;  5GXG B;  1WJ6 A;  4W9G A;  3VFK A;  4M01 A;  4I6L B;  1AN8 A;  2QIE B;  3ZJU A;  4NAW A;  3A1Q B;  3DHH C;  1SBB B;  1F2R C;  4IM3 A;  2G4S A;  2WWZ A;  3RZW C;  2IZV B;  1XLP A;  4LNK A;  2H88 B;  3TCA A;  1R4N I;  1WGG A;  4KX6 B;  2KKC A;  3RNB C;  1V5T A;  1OQQ A;  2MCN B;  4C7Y A;  3KQ4 A;  4MM3 B;  2LGX A;  1TZ1 A;  1N5W A;  1H4R A;  5LNK 1;  1A5R A;  1C79 A;  3Q3O C;  2DYO A;  1Q10 A;  2QJL A;  2FCS A;  3ZTD A;  2CJN A;  3V05 A;  1VZ6 A;  2RGF A;  1YN4 A;  1RYJ A;  4JX1 C;  3M95 A;  3Q3N C;  4OZC A;  3AUL A;  3WA0 A;  1DYQ A;  3TSS A;  3H6N A;  3BYT B;  3UI3 A;  2QEJ C;  4GIV A;  3AEG B;  2INC C;  3GE8 C;  1AW7 A;  3PS6 A;  5FR3 A;  3S2A A;  2LUM A;  5JXV A;  3AB5 A;  4BZA A;  2KFK A;  2N0S B;  4G11 A;  3QX1 A;  4GB9 A;  2YVC A;  3IG3 A;  1E6E B;  3A9J B;  2WX0 A;  4RGM A;  4YWG G;  2KQS A;  3NJT A;  4WWN A;  2FCM A;  1UF0 A;  2N7E A;  3DPD A;  3L16 A;  2QIL A;  2WXM A;  5BMG A;  3IXS A;  1LGR A;  5L95 C;  3D32 A;  1E10 A;  1QF6 A;  2DNF A;  1L4Z B;  3EUB 2;  4BOS C;  2NPT A;  4XWW A;  4M0W B;  4R3D A;  2KWC A;  1FNV A;  1L6U A;  3DHI C;  1IYF A;  3R66 C;  1UBQ A;  2BYE A;  2L1A A;  4WJO A;  4MSQ B;  1Y56 A;  5C1Z A;  2V3P A;  3BZD B;  4MM3 A;  2Y5C A;  1DOI A;  3QAR A;  1UUP A;  2AEH A;  3N20 C;  3L54 A;  5BO4 B;  4ZHP A;  3DWG C;  1ENF A;  1Z5S B;  2OJW A;  1RRB A;  4P6V F;  4DK5 A;  3AM9 A;  1TS4 A;  2ZPN A;  5E6J A;  3UIO B;  2DWQ A;  3ZNG C;  3GZN I;  4TUU A;  3FC4 A;  3Q8F A;  3BVZ A;  3NG0 A;  3ZJV A;  2PIA A;  1BUI C;  1JAL A;  2RPV A;  2MJ3 A;  4C80 A;  1JWB D;  1C3T A;  1T0Q C;  2AX5 A;  3VTV A;  5IO9 A;  3GP7 A;  2D3G A;  2K6D B;  3CIR B;  2AWT A;  3KW5 B;  4KV2 A;  1TY2 A;  1HXY D;  3A9J A;  1C4C A;  1WI0 A;  4NJ7 A;  3N32 A;  3PO0 A;  5HI1 A;  1IPG A;  3VUW A;  4FBJ B;  2O6V B;  1BML C;  4JPS A;  3P1M A;  3NZS A;  2LXA A;  5L83 A;  3L10 B;  4WQM A;  3KUC B;  2K0P A;  4C56 C;  3TIX A;  4NJC A;  1GJZ A;  1YMH E;  3C0R B;  2Y5B B;  3ZQ4 A;  2L0T A;  3JYU A;  5BYS A;  4LDT B;  1GUA B;  1AWD A;  4EZK A;  2MBQ A;  4MEM A;  4XDD A;  3VUY A;  1LXD A;  3LXF A;  1E8X A;  1NBF C;  1NI2 A;  3BK2 A;  4W9F A;  2L00 B;  2ZZP B;  1H8C A;  4ACF A;  1TKE A;  2IJ0 A;  3E56 A;  1V1P A;  3L17 A;  1V81 A;  3M62 B;  1SE3 A;  3UF8 A;  4WIP A;  2H89 B;  1GOZ A;  3VAW A;  1JWU D;  3BK1 A;  1QOF A;  2ACZ B;  2XN9 C;  3ZXR A;  3KWL A;  2IO2 B;  4JLC A;  1N63 A;  3QJZ A;  4KIK A;  2QDF A;  4HRS A;  3ZGZ A;  1E8W A;  1A70 A;  4GGQ A;  1I4H A;  3UGB B;  2BW2 A;  5JZE B;  2AQ2 B;  2SEB D;  4OW0 A;  1ACC A;  4W9I A;  1FMA D;  3W1S C;  2EKE C;  2BPS A;  1XF5 L;  3CSF A;  1GB1 A;  3VRA B;  2LVO A;  2WXO A;  3ZNZ B;  2J42 A;  1C1Y B;  3RNF C;  4BFR A;  3PRP B;  4DHZ E;  2GMI C;  1HZ6 A;  4L1B A;  3Q6B A;  3NUH B;  2KT7 A;  4ZOH C;  3TEX A;  2AQ3 B;  2WQY B;  3AXC A;  1V1O A;  1QOG A;  1J19 A;  1V9J A;  1WJ4 A;  3KWV A;  3ML9 A;  2NVU I;  3Q8A A;  2BT6 A;  5LXH A;  3T3O A;  4HKZ E;  4RCO A;  4CYE A;  1YQ4 B;  1QKZ A;  3MC9 A;  2D5G A;  2JXX A;  4II3 B;  4DHZ B;  3Q3J A;  3P4Q B;  3A4S C;  1VJK A;  2VRR B;  2B76 B;  2FUH B;  2K39 A;  2V4I B;  1WM2 A;  4B6W A;  2LRU A;  2WP9 B;  3SFE B;  4YL8 A;  1TKG A;  5IKC M;  1EU4 A;  4IM0 A;  5IOI A;  2JXT A;  1WGR A;  2BKF A;  5DPW A;  2LFI A;  2Z59 B;  2VZK D;  2V9H A;  2WXG A;  1FFV A;  1AAR A;  4WWP A;  1P9D U;  2WDQ B;  4E74 A;  3BIN A;  2XK5 B;  1D4B A;  1WF9 A;  4MT5 A;  2WXJ A;  2FBW B;  5G5G A; 
#chains in the Genus database with same CATH homology
 5AUI A;  1TS5 A;  1PGX A;  3AE6 B;  1SE2 A;  2JQR B;  3IAS 1;  4RGT A;  1JCK B;  2E6X A;  1T5X D;  3AV8 A;  3W5U B;  4EE2 A;  3SR6 A;  2L32 A;  5TSS A;  4N58 A;  4TQ1 A;  1UNS A;  2RDH A;  1C9F A;  1EU3 A;  4YTP B;  3U52 E;  3J9C A;  2JZP A;  3P4P B;  1QOB A;  1GB4 A;  1TS3 A;  2Q5W D;  2WXF A;  4IDI A;  2MH7 A;  3RFZ B;  1L4D B;  3ABV B;  2VZK B;  1SJH D;  2BYT A;  2MJD A;  1I4G A;  4TQ0 A;  1YN3 A;  5HG2 A;  3P63 A;  3I9V 1;  1FRR A;  5EE1 A;  2DLB A;  3AMZ A;  1WRI A;  2KDM A;  3VQI A;  1L0Y B;  2IGH A;  3W2D A;  2ICI A;  4XE0 A;  4L2Y A;  2L83 A;  3B2F A;  1K52 A;  2BB5 A;  2K9X A;  2G1E A;  2W82 A;  4YTM B;  1MI0 A;  4IOI E;  1FO4 A;  3MHZ A;  4US9 A;  3HVZ A;  2EKI A;  1IGD A;  3R2I A;  1PDX A;  2HDE A;  3NVW A;  5GXG B;  2JU6 X;  4P16 A;  3P42 A;  1V1P B;  1AN8 A;  1SEB D;  3B9J A;  1JWM D;  3TUO A;  2QIE B;  3ZJU A;  2QSD A;  2JX5 A;  3W1S A;  4A55 A;  1L0X B;  1XLO A;  1SBB B;  3TEZ A;  1YNT E;  1F2R C;  3P4R B;  4RNA A;  2BS4 B;  4US8 A;  3AED B;  2WS3 B;  2PLP A;  2CJO A;  1KF6 B;  4HKQ A;  1XLP A;  1TKY A;  3HRD D;  3MJ5 A;  4FXC A;  2JSV X;  2H88 B;  2JYT A;  3MFG A;  1ZXI A;  2INN E;  4KX6 B;  1SIJ A;  4C7Z A;  1ZDV A;  1SF0 A;  1GPX A;  1MVK A;  2BTE A;  2Z8L A;  1FRD A;  4RGO S;  1KH0 A;  1N62 A;  1OQQ A;  1P7E A;  1OFF A;  4C7Y A;  4KGR A;  3KQ4 A;  4MM3 B;  1NYR A;  3E9S A;  2K3U A;  1FIQ A;  5G5H A;  1N5W A;  4OZA A;  5H92 C;  1C76 A;  2YEP F;  3NVZ A;  1HZ5 A;  3AE2 B;  5LNK 1;  3AEC B;  2ON8 A;  1J7B A;  2V0G A;  1C79 A;  3VR9 B;  2YEP B;  2DYO A;  1SXT A;  2ONQ A;  1Q10 A;  1QQR A;  5BYQ A;  2QJL A;  1I4Q A;  1JML A;  2NTT A;  3AE5 B;  1VRA B;  2DBY A;  1YQ3 B;  2CJN A;  3V05 A;  1VZ6 A;  5D7G A;  1F0Z A;  1C4P A;  1YN4 A;  2PVG C;  1RYJ A;  3U4E G;  2X38 A;  4JX1 C;  1YN5 A;  4OZC A;  3AEB B;  4RF1 A;  3Q69 A;  1DYQ A;  1CQV A;  3TSS A;  1VR9 A;  3BYT B;  4GLS C;  2WXP A;  4ITK A;  2E3T A;  4Q2J A;  1BXT A;  3UI3 A;  2QEJ C;  2WU2 B;  3HUI A;  2BS2 B;  3AEG B;  1CZP A;  2HTM E;  4WH4 A;  1AW7 A;  3BVM A;  5FR3 A;  1YJI A;  2LUM A;  4B0M A;  1IUE A;  5T8I A;  4JWS C;  4YT0 B;  5JXV A;  2PMV A;  3AB5 A;  3GB1 A;  1FD6 A;  3R8B A;  1N5X A;  1B9R A;  1L0V B;  1XEE A;  1IBX B;  2N0S B;  1J7A A;  2ZW0 A;  2XNA C;  3AN1 A;  4J3O D;  1TZO A;  2WXL A;  4TMA B;  1F2R I;  1E6E B;  4JE3 B;  5BMH A;  4RGM A;  1L5P A;  1RM6 C;  2LEK A;  4YWG G;  4ARC A;  3V3X A;  3B2G A;  1P7F A;  1D5X C;  1T3Q A;  3TEY A;  1QIL A;  2J4X A;  2QIL A;  2WXM A;  5BMG A;  1ZDX A;  2WXK A;  3IXS A;  1OQR A;  4O1N A;  4KKJ A;  1E0Z A;  1E10 A;  4D2K A;  1QF6 A;  2DYM A;  2ZW1 A;  1M4V A;  4AQ7 A;  1XLN A;  2WDV B;  1L4Z B;  3P4S B;  1ZUD 2;  3EUB 2;  2M19 A;  2KWD A;  3U7Z A;  3AH7 A;  5D3I B;  4XWW A;  3I57 A;  4R3D A;  1FNV A;  1L6U A;  1V97 A;  2KAC A;  1K50 A;  3PZ7 A;  3N9Y C;  1FXI A;  4N6E B;  5C3J B;  3T3N A;  4RH6 A;  4YTN B;  2L1A A;  3Q8B A;  4REZ A;  1Y56 A;  2OED A;  1D6E C;  2V3P A;  4GDL B;  4HEA 1;  2QMT A;  3BZD B;  1B1Z A;  3OWE B;  3Q8E A;  2Y5C A;  3NVV A;  1DOI A;  1UUP A;  4USA A;  1NYQ A;  1SE4 A;  2FE8 A;  4ZHP A;  4H2A A;  1ZP0 B;  3DWG C;  2TSS A;  1ENF A;  1ZE3 D;  3ETR A;  3FIL B;  4XWT A;  2NTS A;  1DOX A;  3H8H A;  1TS2 A;  4PT5 A;  1ROE A;  4A90 A;  4P6V F;  1NVI D;  1XCT L;  2IPK D;  3AM9 A;  1TS4 A;  5E6J A;  2WXI A;  2DWQ A;  1WYG A;  4ARI A;  3DWM A;  4RGN A;  1J7C A;  3LYY A;  1JWA D;  4TSS A;  3FC4 A;  4A9A A;  3Q8F A;  4YXD B;  1N60 A;  2PKO A;  3BVZ A;  1ET6 A;  3ZJV A;  4A8X C;  3AE3 B;  5BMI A;  3NRZ A;  1KLU D;  2PIA A;  1BUI C;  1JAL A;  4LLG M;  2RPV A;  2MJ3 A;  4C80 A;  1JWB D;  3C8Y A;  2AX5 A;  1JWS D;  1RWS A;  3O13 A;  3GP7 A;  1PYW D;  3CIR B;  1TJE A;  5AUK A;  1FEH A;  3LB8 C;  1F77 A;  3KLS X;  1TY2 A;  1QLB B;  2GI9 A;  1SSN A;  3FAH A;  4AS1 A;  1HXY D;  1AYF A;  2KN4 A;  1CJE A;  1C4C A;  4NAM A;  2Y5P A;  4KKI A;  2N9K A;  1STE A;  1VLB A;  4HRO A;  2Y3A A;  2WXH A;  3PO0 A;  5HI1 A;  2KQ4 X;  5C2T B;  3NS1 A;  3TEW A;  1FFU A;  1EWC A;  2W3R A;  1DOY A;  2R61 A;  2WDR B;  1BML C;  3FIL A;  2JWU A;  2PVO D;  2L52 A;  1I4X A;  3P1M A;  4JPS A;  2WXQ A;  2MJE A;  1I4R A;  1XLQ A;  4RFB A;  3SEB A;  1VDV A;  3IT6 B;  2GRI A;  4WQM A;  4C56 C;  1TYG B;  2K0P A;  4ZRQ A;  1EM7 A;  2G9H D;  4NJC A;  3CWI A;  3MC0 B;  2WU5 B;  1YMH E;  4A6Q A;  1L6V A;  3HVD A;  3ZYY X;  3ZQ4 A;  4DQO C;  2WLB A;  3AE9 B;  5BYS A;  1AWD A;  4DXF A;  4XDD A;  4CQN A;  2LHD A;  1ZXH A;  1RFK A;  3LXF A;  2LJI A;  2I2Y A;  2PW9 A;  1EWY C;  2WXN A;  3BII D;  1UWM A;  3BK2 A;  4NZL B;  5MPO A;  1TKE A;  1V8C A;  2IJ0 A;  3E56 A;  1PGB A;  1V1P A;  4XDC A;  1C4A A;  1D5M C;  5HHD G;  1SE3 A;  1T6B X;  4WIP A;  4WUR A;  2H89 B;  1GOZ A;  4LK0 M;  1HQR D;  1JW9 D;  1JWU D;  3BK1 A;  4GDK B;  1QOF A;  2ACZ B;  4YSX B;  5I4D A;  2XN9 C;  2W3S A;  2EEL A;  1WSP A;  3L4P A;  2KMM A;  3U2S C;  3KWL A;  1CK1 A;  5BYR A;  1MHH E;  3W5V B;  1N63 A;  2J53 A;  2W54 A;  2OHF A;  1FM0 D;  4HJG E;  4HRS A;  2RDG A;  3ZGZ A;  1A70 A;  1WXQ A;  3GS2 A;  1I4H A;  2BW2 A;  4ZYS A;  2PTL A;  1KFY B;  2V3N A;  3EA6 A;  1FNU A;  3AE1 B;  4ZRP A;  2AQ2 B;  2SEB D;  1XO3 A;  4OHJ A;  4OW0 A;  2BS3 B;  1JQ4 A;  2FUG 1;  1ACC A;  1E9M A;  1FMA D;  3EGR A;  3AEF B;  2BB6 A;  1XF5 L;  1FXA A;  2SAK A;  1QT9 A;  4MH8 A;  1GB1 A;  4LTU A;  3VRA B;  2WXO A;  1YJJ A;  3ZJT A;  1ET9 A;  1JRO A;  1NEN B;  2J42 A;  1XCQ L;  4ZHO A;  1MPE A;  3IAM 1;  2M56 B;  3BYY B;  3BVG A;  1I4P A;  3AE8 B;  4YSZ B;  4L23 A;  4UDU C;  5HFY A;  1HZ6 A;  4KGT A;  4L1B A;  4IKG A;  3VRB B;  2WXR A;  3NUH B;  4ZOH C;  3W9C B;  1UWX A;  3TEX A;  4WAF A;  2AQ3 B;  1JRP A;  1WWT A;  2I38 A;  2WQY B;  3AE7 B;  1D5Z C;  1FCC C;  1V1O A;  2K22 A;  1QOG A;  1R7S A;  1VZ8 A;  1DGJ A;  3KWV A;  1NEK B;  3Q8A A;  2W55 A;  3VR8 B;  2GB1 A;  2BT6 A;  2LGI A;  1IBX A;  4DXG A;  2WXJ A;  3T3O A;  5EE9 A;  3MP9 A;  3Q8C A;  4HKZ E;  3SFD B;  4N59 A;  4MAC A;  4RCO A;  1FCL A;  1YQ4 B;  1I7H A;  1K53 A;  1QKZ A;  3PZ8 A;  2IDY A;  3AEE B;  2D5G A;  2M0A A;  1LO5 D;  1ZPS A;  1UGJ A;  2IGG A;  4JWU C;  1C77 A;  3P4Q B;  1KLG D;  2NMQ A;  2K5P A;  2KAJ A;  5FKA C;  1VJK A;  3AEA B;  1PFD A;  2IGD A;  2B76 B;  4B0E A;  1C78 A;  2LMC A;  1NI3 A;  4WWM A;  2WNM A;  1K51 A;  2V4I B;  1XXG A;  1E7P B;  2WP9 B;  3SFE B;  1WGK A;  2CU3 A;  2J52 A;  1HEZ E;  5EE0 A;  1TKG A;  2MEK A;  2AQ1 B;  5D3D A;  1EU4 A;  1SB3 C;  2RMM A;  2INP E;  3IT4 B;  5FK9 C;  3R2T A;  2JXT A;  4NAW B;  4M0W A;  2LHE A;  1PGA A;  1PUT A;  1FNW A;  1HA5 A;  2BBC A;  4OVZ A;  1IGC A;  2N9L A;  2LFI A;  1SJE D;  1GAQ B;  4OZB A;  2JYE A;  2VZK D;  1ESF A;  4YSY B;  1N61 A;  3WCQ A;  1TY0 A;  1QOA A;  2WXG A;  1FFV A;  3NVY A;  3AE4 B;  2N7J A;  3RPF C;  4RF0 A;  2WDQ B;  1KRH A;  1VZ7 A;  3NZ3 A;  5H8Y E;  3URY A;  1KTK A;  1D4B A;  3BWU D;  4MT5 A;  5EE3 A;  1MHX A;  1ZOY B;  4KGS A;  2FBW B;  5G5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...