2N1VA

Solution structure of human sumo1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin-related modifier 1
publication title Structures of human SUMO
rcsb
source organism Homo sapiens
molecule tags Structural genomics
total genus 16
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2015-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2n1vA00
1V6EA 2DENB 2HD5B 3AU4A 2KWUB 2AEHA 2LWPA 1FXTB 4ANUA 3NZSA 3VXWA 4LCDE 1IYFA 1P0RA 2JVCA 2KTRB 3WAPA 4K1RB 2KMCA 3VH3B 1WGRA 4MH0E 3TCAA 4X57B 3OJ4B 4EOYA 4ASWC 1RRBA 1V81A 2MP2B 3AULA 2G3QB 4GXBA 4WAAA 1KJTA 2KWCA 3QCAA 5J18A 1JRUA 4EFOA 2OOBB 2K1FA 1P98A 5C1ZA 5AZGA 2K39A 3DBRI 1SGHA 2WYQA 1E8XA 1ZGUB 1J19A 2GMIC 2LGDA 4JGHB 4G11A 1UD7A 2KANA 2ZPNA 3NOBA 4HK2A 2KLCA 3QWZB 4MJSB 2LRUA 3U7DA 2BKRB 5D94A 2LJ5A 4KZCA 5LLIA 2WDTB 1V49A 3L16A 3PS6A 5G55A 1WXVA 3VTWA 4EZKA 3PV1A 3APFA 2DAJA 1NI2A 2DZMA 2KHWB 3A9JB 4W9FA 1P3QU 1NBFC 1YJ1A 2N9PC 3ZNGC 1GC6A 4NJ7A 3A9KA 2IY0B 1IPGA 4BOZB 2ZJDA 3AI5A 3P2BA 3UIOB 4WWPA 3L10B 2O2VA 4AJWA 1V5TA 1RAXA 1KM7A 4I6PA 2C9WB 5JH5C 3A4SC 2NVUI 4TQ1A 4HCPB 2IO3B 1UZXB 1VD2A 2FIFA 2IY1B 3AU5A 4GDLB 3VUYA 1WGDA 2M0XA 4NJ6A 3UF8A 1WMHB 1E90A 4ICVA 2KX0A 3JSVA 1WFYA 4HDQA 4MDKE 1WX9A 4K7WA 5GMVA 4GN1A 2DX5B 3RYTA 4AP4C 2ZEQA 3VVWB 1V86A 4GOCA 2CHZA 1TZ1A 2LVPA 2MW5A 1XD3B 2D07B 2IZVB 3DQVA 2XK5B 1YX6B 3DVNV 4KIKA 1WX7A 2NBUA 3V6EB 4BOSC 4HCNB 5J17A 4M8MA 3NHEB 2RSUA 1EF5A 5DPTA 2D11A 1P9DU 2KDIA 2B3AA 5DPSA 1QZEA 3QAQA 4YL8A 4FHJA 4BKSD 2FCMA 3R3MA 3BINA 2JXXA 3HM6X 1GUAB 5CHVC 1WJUA 1E8ZA 2KKCA 1LQBA 3OJ3A 4P7IA 3VAWA 4A3OA 1F9JA 4DHJD 3VTVA 3UGBB 1P1AA 3EC8A 2CR5A 2N7EA 5IA7A 3W1SA 1YX5B 2RPQA 4BVUC 3ZNZB 1GJZA 1KOTA 3ZIMA 3UINB 2N4FA 2DYMA 5G2NA 2BKFA 2JT4B 3DVGX 4KSKC 2JRIB 2ZNVB 2KTFA 3B1LX 4DDGD 2LASA 2K6QA 3MTNB 1GC7A 2FCSA 4FJVB 4KVGB 4W9KA 2L3ZA 3JVZX 3T8MA 3IBEA 2XBBC 4OVUA 2BYEA 4RMAA 1I42A 2V1YA 4GU2A 3TIXA 3PLUA 4ICUA 2N1WA 5CX3A 4ZDVA 1VCBA 2BYVE 4IWPA 2LGYA 2XK5A 2A5UA 3DBSA 2KMAA 1OEYA 3NZUA 1WF9A 3L54A 4MSMB 3TL5A 4MGYE 3SHQA 3V6CB 3VTUA 2PEAA 3UQAA 4W9LA 4MGIE 3A33B 3B0AA 2O6VA 2BYFA 3C0RB 3A9KB 3PZDA 4IW0A 2K8HA 2BWFA 2AWTA 3GOEA 2CU1A 5BO4B 1WIAA 3VUWA 1TGZB 2O2VB 3ALBA 2K25A 2LVOA 1WXAA 3H6NA 2KFKA 2MBOA 2KK8A 3KUDB 3X23A 4CYEA 3RZWC 4B9KA 1U4AA 2I1KA 2CHWA 4FBJB 3SD5A 3SU8X 2KJHB 3ZTDA 1G6JA 1R4MI 1WM3A 2JRHA 4PYZA 4I6NB 3JSVB 4N9F4 1H8CA 2KQSA 3A1QB 3KYDD 3ECIA 4I6LB 4W9EA 4WJPA 5D7GA 1WI0A 2DHZA 2DAFA 1ISNA 1A5RA 2KZRA 4KIKB 4B95A 2G4DB 3M62B 2NBWB 4HWIB 2ZZPB 3IHPC 2CS4A 3BY4B 4FJZA 2J7QB 5HKHA 2KO3A 3VHTC 1WYWB 3RUIB 2FCQA 4W9GA 2DZIA 2L05A 1Z5SB 3WALA 3ENEA 3A4RA 4DK5A 4ZRJA 2N9XA 3I3TB 3ZLZA 3NY5A 3HHMA 1WJ6A 2PE6B 2J0KA 3EFUA 5DPWA 2GBMA 2L8JA 2MSED 4BBNC 4E71A 1ZW7A 3PRMB 2W9NA 4WWNA 5CHFA 1EO6A 2Y5BB 3U30A 2K8CA 4NNJB 3VFKA 4EZJA 2LZ6A 3PPAA 4AUQC 3R7RA 2KLGA 4NY0A 1WGYA 3ZTCA 2LGXA 3PHWB 4AOFA 2RGFA 4FADA 3KW5B 2MLBA 3WAMA 2KFJA 4BKGA 3OAWA 3WIMA 2IO1B 2KQ7A 5DPRA 1Z2MA 2CHXA 1SIFA 2FAZA 2UWQA 4FLHA 2BGFA 2MCNB 4MGKE 2LXAA 2KXJA 2EMSA 4XX5A 3A1QA 2M4NA 1WZ0A 1V9JA 3IVFA 4GDKA 3WAOA 4E74A 1Q5WB 1LM8B 2DZJA 4FHKA 2VRRB 2Z59B 4PS3A 4AJYB 3UIPB 1H4RA 2FIDA 1Q0WB 4GMVA 3PGEA 4WJNA 3DCGA 5L95C 3PRPB 1BT0A 2WX1A 2PE9A 3JW0X 1YD8U 3KH0A 5JHBA 3S2AA 3HM3A 4II2B 4II3B 2J0JA 3OLMD 4MELA 3SDLC 2JPHA 3MHSD 2O6VB 2V4LA 3PTFC 4IWOA 1S3SG 2GBRA 2NCNA 1NDDA 3N3KB 4BKTA 1CMXB 4ANWA 4PS7A 3RCZA 3DDCB 3WA0A 3LDZE 1GG3A 1WRDB 1MG8A 4FN2A 4G3XB 4W9IA 2KFKB 2PJHA 4IG7B 3ZVVA 4J6IA 2LRWA 1YQBA 2CKHB 2ZVNA 4GB9A 1V2YA 2YVCA 3DBHI 2L76A 3K9OB 3PVLA 2C7MB 4NPNA 4PS8A 1OEYJ 2G45B 2KN5A 2D10A 3Q3JA 2MRPA 3MJWA 1IP9A 4EZLA 2MA9B 3DVNU 5AZHA 1UGMA 3N30A 4EKUA 4FULA 4DHZB 2V3SA 3PRZA 3QA8A 1OGWA 3W1YA 5KHQA 5FR6A 4TKNA 2K6DB 1SE9A 2N7DA 2R2OA 2KDBA 3D32A 4MSQB 4W9JA 2HTHA 3WANA 4G50A 1WH3A 4F7ZA 5E6NA 3ZRCA 4GIVA 2IBIB 4GSWA 1EF1A 1R4NI 2LD9A 4CHKA 1WX8A 3EHVA 1XQQA 1K8RB 2A4ZA 1D3ZA 3DOWA 3ZO5B 2NBVB 1L2NA 3RD2A 4TQ0A 2JUOA 2C7HA 5IAAC 3RULA 3VQIA 4LDTB 3JYUA 3ZUNA 4KDLB 3LJ3A 1WXSA 2C60A 2D3GA 1EUVB 3H1UA 4AWJA 5JHAA 4XC2A 4HPMB 2JY6A 2K8BA 3ZW3A 4RM8A 1HE8A 4BBNF 2WWZA 2NS5A 4HLEA 1E7UA 4BKSA 2G4SA 2BF8B 2MBHA 2MX2A 3QQ8B 2KDEB 2N9EB 2ZVOA 4DHZE 2L00B 2KJRA 3H7PA 4G0NB 2MBBB 5AEKB 2HE7A 3KYCD 4KSLC 3RZFA 2BPSA 1UELA 3QJZA 3TJPA 4M8NA 2BWES 2N1VA 4WQOB 4MEMA 1V80A 2JF5A 3M95A 1E8WA 2EMTA 3L17A 1OTRB 4GDKB 3R7QA 2M8SA 2LUEA 4FJYA 2AL6A 2NPTA 2WX0A 1WJNA 2FNJB 4F8CB 3TMPB 1WGGA 2C7NB 3CSFA 4A3PA 4JQWC 3T9LA 1C1YB 2MBEA 3VH4B 2XEWA 1UBQA 2LVQA 4NQKE 4IM3A 4W9DA 2Z0EB 1PQSA 3ML9A 3QC8B 3CF6E 4NAWA 5LXHA 4HJKA 4IUMB 4WWOA 4BFRA 5AZFA 3L08A 1UH6A 3GZNI 5KHOA 2M1MA 2ZNVC 1WE7A 1UBIA 4KDIC 4LJOB 2M17A 2I1JA 1OQYA 3PHXB 3N32A 4IM2A 5TR5A 1E7VA 2LXCA 4EUTA 2JZZA 2C5LC 4JLCA 2GBJA 2OJRA 3KUCB 4JIOU 2L0TA 4DBGA 4OVVA 5CHWA 4E3CA 2GBKA 3O65B 5LXIB 2KC1A 3V60A 4EEWA 1RFAA 3UQBA 1Y8RC 3M3JA 1TBEA 4RM9A 2R2QA 4CO7A 4DWFA 3M63B 5D6JB 1RLFA 3APDA 4K7SA 2REXA 3L0WB 1T0YA 3QX1A 4URKA 1KLVA 4ZRIA 5J2RA 1TTNA 2KNBA 4F1SA 5JZEB 2GOWA 2QHOA 3R66C 1C3TA 2DZKA 1LFDA 2KOXA 2IO2B 3PSEB 3HK0A 1I35A 2IYDB 3B08A 2KTRA 1J0GA 3K9PB 3KVFB 5E6PA 4DDID 2KDFB 4WJQA 3KUZA 2L7RA 3EECA 2L0FA 2MP2A 2KWVB 4W9HA 3CSTA 3DPDA 4HVBA 5C23A 2UYZB 3AXCA 5L83A 3L13A 3TBLD 1M94A 1YIWA 3CMMB 1WY8A 3ZNHB 1GNUA 2J0MA 4ZYNA 3H7PB 3IG3A 3ONSA 1WR1A 2JWZA 2FUHB 3H7SA 4GGQA 4MJSA 2ASQA 2O6VD 1E5WA 4KZ0A 3V61A 2Z0DB 2KX3A 2MWSB 1WJ4A 1X1MA 4DHJB 4W9CA 2GBNA 3ZRFA 2YLMA 5EDSA 4TV3A 3X0WA 1WXMA 5DCNA 4MM3A 4TUUA 3ZDMC 2PPHA 4B6WA 1Q1OA 4HDOA 2NPTB 4ANXA 2DYBA 4K81A 1WGHA 1WZ3A 1LXDA 4XZ4A 2RR9A 2LI5A 3A9JA 3ZNID 2KC2A 3H9DA 4M0WB 4FA6A 1L7YA 1WM2A 3QK0A 3PLVA 3ML8A 3Q3FA 3QHTA 4DXAB 2RD0A 1ZKHA 4JL9A 1V5OA 4ANVA 2KD0A 2KVRA 2AYOB 4IWQA 4KV2A 3DVGY 4HPLB 2ZCCA 3W1SC 2JZ3B 4NAWB 3RT3B 3NS8A 1XT9B 3QIJA 2AL3A 4K7UA 2ZPYA 4MGZE 1WR6E 2IO0B 1AARA 3ZDTA 5E6OA 2D2QA 2MQJA 4GDLA 4WJOA 2KJ6A 2MBQA 5D2MB 2DYOA 4NQLB 1J8CA 1WMHA 3APCA 1S1QB 3PT2B 3U8ZA 3VUXA 3HIZA 5CTRC 4A20A 4IC7B 3PREA 2FCNA 3DBLI 4IM0A 4LJPB 3ZKJC 3VDZA 2HJ8A 2EKEC 4HXDA 3QARA 2ZCBA 3V62A 4LDTD 1WE6A 4PYUA 3IFWB 2NR2A 1E8YA 4ZRKA
chains in the Genus database with same CATH superfamily
2DENB 2IDYA 2AEHA 2LWPA 3NZSA 3VXWA 4A55A 2N9KA 2RDHA 2LHEA 1TIFA 3VH3B 1AYFA 2XN9C 4GXBA 5FK9C 1KJTA 5J18A 3AEBB 1I4HA 5FKAC 2LGSA 1P98A 3PO0A 1SGHA 2WYQA 2WXGA 3AECB 1ZGUB 2UU7A 4JGHB 4G11A 3NOBA 3W5VB 4MJSB 2VH2A 5D94A 4KZCA 3L16A 1WXVA 4PK1A 4EZKA 1Y56A 4MM3B 2DAJA 4XDDA 2W82A 2KHWB 1XO3A 4W9FA 2WDRB 2N9PC 1GC6A 1RYJA 2KT7A 3EGRA 1SE4A 1KM7A 1AW7A 1L0YB 3A4SC 2NVUI 4HCPB 2WDVB 1UZXB 1K50A 2QCZA 2FIFA 4CQNA 2N9LA 1WGDA 3UF8A 4NJ6A 3AE1B 1E90A 4AP4C 3VVWB 1ZDVA 1TZ1A 4ZOHC 2BBCA 2XK5B 4M8MA 2WXMA 3NHEB 5DPTA 1EF5A 3QAQA 4BKSD 1TS3A 2JXXA 3MP9A 3HM6X 4XGAB 2VZKD 4A3OA 4ZRQA 4L1BA 5E6JA 4WQMA 3EC8A 2RPQA 4BVUC 3UINB 2V0GA 5IOIA 2BKFA 2JRIB 2ZNVB 4DDGD 3BK1A 1JMLA 4W9KA 3DHIC 3JVZX 1V1OA 1UGJA 1RFKA 4US9A 3IBEA 4RMAA 1RWSA 4ICUA 1HTOA 4C7YA 4WAFA 2KMAA 1PGXA 1L0XB 4N59A 3R8BA 3BYTB 3VRBB 4UDUC 3AM9A 2AWTA 2RDGA 2LVOA 3GE8C 1U4AA 2CHWA 1SJED 2KJHB 3ZJTA 3W9CB 3TUOA 3ECIA 5D7GA 1PYWD 3AE4B 2DHZA 1ISNA 1EM7A 1C79A 1YN3A 3GE3C 1FD6A 3IHPC 1FNWA 2J7QB 2KO3A 3AE2B 2W3SA 2DZIA 1T0SC 1I4QA 1UUPA 3ENEA 4NAMA 4DK5A 1C78A 4US8A 5EE0A 1GB1A 2JZPA 3EFUA 3KWVA 2L8JA 1ZW7A 4NNJB 3VFKA 1JALA 4EZJA 3AE5B 3R7RA 2KLGA 1WGYA 3FC4A 4AOFA 4WWMA 3WAMA 1DOIA 2RMMA 3OAWA 2IO1B 2Y5PA 4OW0A 5DPRA 2UWQA 3AN1A 4FLHA 3A1QA 2M4NA 3I5JC 4J3OD 2GRIA 2LHDA 2PE9A 3KH0A 2WXKA 5JHBA 3T3NA 3HM3A 1GB4A 2JPHA 2V9HA 4IWOA 1S3SG 2GBRA 2NCNA 1NDDA 1CMXB 2PIAA 3HVDA 3WA0A 4G3XB 2BT6A 2PW9A 1D4BA 1C76A 1JW9D 4TSSA 3DBHI 2OJWA 4PS8A 1A70A 1M4VA 2J42A 1I7HA 5AZHA 3N30A 2WXLA 1ET9A 3QA8A 2R2OA 1SE9A 4W9JA 2KDBA 4F7ZA 4LNKA 2LD9A 4H2AA 3I9V1 3DOWA 2NBVB 1UF0A 1L5PA 5IAAC 4RGOS 4LDTB 2SEBD 1WXSA 1EUVB 1NI3A 4AWJA 5JHAA 5BYSA 1WWTA 5EDSA 3GZNB 4RM8A 1HE8A 4HLEA 1MFWA 3AEGB 2G4SA 2MBHA 2KDEB 2L00B 4G0NB 5EE9A 2SAKA 2HE7A 1K52A 3NVYA 1HZ5A 2HTME 3IXSA 2BWES 4WQOB 1V80A 1E8WA 2LEKA 3MC0B 2FNJB 2C7NB 1QOGA 3VH4B 2XEWA 2D3BA 5BMIA 1JRPA 4ZHOA 2Z0EB 3ML9A 3CF6E 3I63C 3GZNI 4KKIA 2M1MA 3IAS1 1WE7A 2M17A 3RNFC 4JLCA 2GBJA 4JIOU 4KGTA 4DBGA 3ABVB 1N63A 4LNIA 5CHWA 3O65B 4EE2A 3V60A 4K3CA 3UQBA 3FAHA 2X38A 4CO7A 4DWFA 3M63B 4RF1A 2IPKD 2VH1A 4ZRIA 2KNBA 4F1SA 1C3TA 2DZKA 1TS2A 3P1MA 3K9PB 1T3QA 2KDFB 1OQQA 1YN4A 1UWMA 1FNUA 1XLNA 3DPDA 3IT6B 2LFIA 5C23A 4KGRA 2KWDA 4ARIA 1M94A 4OZCA 1TKEA 1WY8A 3ZNHB 1EU3A 2J0MA 2JX5A 3ONSA 1FXAA 2QDFA 2FUHB 2ASQA 1E5WA 3V61A 2QIEB 1X1MA 2QJLA 2MHJA 4TV3A 4QAYA 1KH0A 4K81A 1WGHA 1WZ3A 4XZ4A 2MH7A 2RR9A 3A9JA 3ZNID 2KC2A 4FA6A 1WSPA 3BWUD 3PLVA 4WH4A 2G9HD 3Q3FA 2M0AA 3NUHB 2WLBA 4DXAB 2RD0A 2ZW0A 2WNMA 2KVRA 2JZ3B 5LNK1 1MG4A 4K7UA 3Q8BA 1AARA 3ZVVA 5E6OA 2D2QA 4GDLA 1DGJA 2KJ6A 2MBQA 2WU5B 2DYOA 1WMHA 3APCA 3MFGA 3PREA 3E56A 4LLGM 1TYGB 2EKEC 3QARA 2ZCBA 4LDTD 1YQ4B 2KAJA 3HVZA 1V6EA 2HD5B 3NZ3A 4RNAA 4ANUA 3PZ7A 2HJ1A 4K1RB 4MH0E 3OJ4B 1CK1A 1VZ8A 2DNFA 1JRUA 4MH8A 2OOBB 2WXPA 1E8XA 1OQRA 2LGDA 3O13A 1UD7A 2KANA 1E6EB 1FNVA 2GB1A 4HK2A 2BKRB 1SIJA 2WDTB 5LLIA 3APFA 1V97A 1NI2A 2DZMA 3BIID 1P7EA 4L23A 3A9JB 3Q2AC 4HKZE 1P3QU 1FCCC 4O1NA 2XNAC 3ZNGC 2N0SB 4BOZB 4YTNB 2MEKA 4AJWA 3L10B 1V5TA 1RAXA 5JH5C 5HFYA 1GAQB 3AU5A 4GDLB 1WMHB 4ICVA 1J7CA 3JSVA 1WFYA 4HDQA 4MDKE 2WDQB 5H92C 3PZ8A 4KIKA 3DVNV 1D6EC 1YX6B 1WX7A 2NBUA 1HTQA 2HDEA 2KDIA 2KVZA 2GLSA 1QZEA 1I4XA 2ICIA 4DXGA 5CHVC 3NVWA 1WJUA 1E8ZA 3NRZA 1LQBA 3OJ3A 3VAWA 4K3BA 1P7FA 3VTVA 3UGBB 2CR5A 2QC8A 1YX5B 3W1SA 3EUB2 3ZIMA 2N4FA 2DYMA 4C00A 2KTFA 1J7BA 3LXFA 2LASA 3MTNB 3T8MA 2DBYA 4OVUA 2XBBC 3P4PB 1I42A 2V1YA 1YJIA 3PLUA 5CX3A 1VCBA 4RFBA 4IWPA 2LGYA 2XK5A 3DBSA 1WF9A 1PUTA 1JCKB 3B0AA 2YEPF 2BYFA 3C0RB 3PZDA 4IW0A 3I57A 2K8HA 3GOEA 5IKCM 5BO4B 2OHFA 2K25A 2ON8A 1WXAA 2LUMA 3H6NA 2KFKA 1JWSD 3RZWC 3AB5A 4FBJB 3BVGA 4PYZA 3JSVB 4N9F4 1H8CA 2KQSA 3BZDB 1FEHA 3KYDD 3MJ5A 4OZAA 4W9EA 3RFZB 3Q3OC 2K9XA 4KIKB 4ARCA 4N6EB 3M62B 2ZZPB 2CS4A 5HKHA 1WYWB 3WALA 2TSSA 3A4RA 5EE1A 3CIRB 3NY5A 3HHMA 1C9FA 2PE6B 2J0KA 3TEXA 5DPWA 2K0PA 3N1YC 4BBNC 3VR8B 2W9NA 3NG0A 1EO6A 2K8CA 3B2FA 3PPAA 4AUQC 4NY0A 1T6BX 1T0QC 1V1PA 1WRIA 1Z2MA 4BZAA 4JX1C 3U52E 1WZ0A 1I4RA 4XE0A 2H88B 1Q5WB 4AJYB 1H4RA 3FILB 4WJNA 4B0MA 1SB3C 2R61A 3JW0X 1R4NB 3SDLC 3MHSD 1L0VB 3RMKC 1F52A 4PS7A 3DDCB 1WRDB 4FN2A 1MG8A 1FCLA 1N62A 2KFKB 2CKHB 2Y3AA 2ZVNA 3C8YA 1FMAD 4NPNA 2G45B 2KN5A 2D10A 2ZW1A 3MJWA 1IP9A 3P42A 4EZLA 2MA9B 3AV8A 1FIQA 2LGIA 1JWUD 1WYGA 4FULA 1YNTE 3PRZA 5FR6A 2N7DA 3D32A 4MSQB 1WH3A 2IBIB 1R4NI 2KN4A 4YTPB 2ONQA 1WX8A 3V05A 1FRRA 2FBWB 1K8RB 3EHVA 1D3ZA 5IO9A 3ZO5B 1L2NA 4KDLB 3LJ3A 3H1UA 3P4RB 4XC2A 4BBNF 2WWZA 2BF8B 1V1PB 3LYYA 2KJRA 3H7PA 4KSLC 3RZFA 3MC9A 2PKOA 1XCTL 2N1VA 1TKGA 4KGSA 3R7QA 4F8CB 1WGGA 4JQWC 3URYA 1UBQA 4IM3A 1PQSA 3QC8B 3RNGC 2KACA 1XXGA 4BFRA 1KLUD 5AZFA 3L08A 3VR9B 4KDIC 2I1JA 1E7VA 1LO5D 2L0TA 2V4IB 4OVVA 1F2RC 1TT5B 2INCC 1RFAA 3DBHB 4EEWA 2IGGA 3M3JA 1TBEA 1FFVA 1GPXA 2W3RA 4K7SA 1I4PA 1ZP0B 3BVMA 5JZEB 2QHOA 2WXRA 1CJEA 3HK0A 2ACZB 1J0GA 3IAM1 2Q5WD 1N60A 3MHZA 3TSSA 4WJQA 3EECA 2MP2A 4W9HA 1XF5L 3L4PA 2UYZB 5L83A 4S0RA 4XWWA 2INPE 1STEA 1SSNA 2K22A 3H7PB 3IG3A 1SF0A 4GGQA 4KZ0A 2E3TA 2Z0DB 3Q3MC 2MWSB 1WJ4A 4DHJB 3ZRFA 2GBNA 3ZDMC 4HDOA 3VRAB 2DYBA 1LXDA 3H9DA 1WM2A 1NENB 2K3UA 4Q2JA 2L83A 2KD0A 2AYOB 4IWQA 4NZLB 3SEBA 1QOAA 3RT3B 4DQOC 2INDC 4MGZE 1JWBD 2IO0B 2QEJC 3Q14C 4HPPA 3U8ZA 2NMQA 3HIZA 4IC7B 3KLSX 5IP4D 3ZKJC 1C4PA 2HJ8A 5D3IB 1WE6A 2MJ3A 3IFWB 1E8YA 3AU4A 1IBXA 3BVZA 1FXTB 4LCDE 3DHGC 4OVZA 3V3XA 2LMCA 2KMCA 1J7AA 4EOYA 4D2KA 1V81A 2MP2B 3EA6A 4WAAA 3P4SB 3N1XC 2KWCA 3QCAA 4EFOA 1SE3A 2K1FA 5AZGA 2K39A 4M02A 1J19A 4ZHPA 1VLBA 2QILA 1UWXA 1XEEA 3QWZB 2WXJA 3U7DA 5FR3A 2LJ5A 1V49A 3PS6A 2D5GA 5G55A 3AE7B 3PV1A 1ZE3D 2X8XX 1T0RC 1QF6A 3A9KA 2IY0B 2CJNA 2DLBA 2ZJDA 1ROEA 3AI5A 3P2BA 3UIOB 2O2VA 1WXQA 4I6PA 4TQ1A 1VD2A 4LK0M 3KQ4A 2DX5B 3RYTA 1V86A 1F0ZA 2CHZA 1SE2A 1XD3B 1JROA 3V6EB 5J17A 3U4EG 1YQ3B 2RSUA 2BB6A 1IBXB 4RH6A 5H8YE 1ACCA 2FCMA 3R3MA 3BINA 3DWGC 2KKCA 4LNOA 2BS4B 4DHJD 1P1AA 3ZXRA 5G5HA 4C56C 4USAA 3Q8EA 5G2NA 1B9RA 3B1LX 2JQRB 2K6QA 4XWTA 1GC7A 2FCSA 4FJVB 4KVGB 1C4AA 4FXCA 3TIXA 2M56B 4ZDVA 2NTTA 2BYVE 1AWDA 3NZUA 3L54A 3V6CB 2EELA 1FRDA 4MGIE 3A33B 1PDXA 1QLBB 3A9KB 2BWFA 4HEA1 1WIAA 3VUWA 1ESFA 2O2VB 3X23A 2MBOA 3KUDB 3SD5A 3SU8X 3AE3B 1G6JA 1WM3A 2JRHA 4I6NB 3AE6B 4WJPA 2DAFA 4GLSC 1I4GA 3N1ZC 1A5RA 1HXYD 3RUIB 2FCQA 4W9GA 2L05A 1Z5SB 1E9MA 3I3TB 4RCOA 1CZPA 3N20C 3SFDB 3SFEB 1FFUA 4YXDB 2Y5BB 4YTMB 3ZTCA 4DXFA 4C4VA 3KW5B 2E6XA 3WIMA 1RM6C 2KQ7A 3P63A 2CHXA 3NVVA 2BGFA 2MCNB 4MGKE 4XX5A 2KXJA 2EMSA 1V9JA 1IGDA 3DWMA 4FHKA 1JQ4A 4PS3A 2Z59B 1Q0WB 2PVGC 3PGEA 3PRPB 3ZQ4A 1F1HA 5IN7A 1YD8U 3S2AA 3P4QB 2J0JA 3OLMD 2CJOA 1XLQA 3PTFC 2AQ2B 4ANWA 1PGBA 2PTLA 1GG3A 4W9IA 2PJHA 4J6IA 2LRWA 1L4DB 1V2YA 2YVCA 1QILA 2L76A 3K9OB 2C7MB 1OEYJ 3FKYA 3Q3JA 4ACFA 1DYQA 2JYEA 1XLOA 1EWCA 4RGMA 2WXNA 4EKUA 3W1YA 3WANA 2HTHA 4G50A 5E6NA 3ZRCA 4GIVA 3GB1A 3LB8C 4GSWA 2KYWA 5HI1A 1EF1A 4CHKA 2DWQA 4NJCA 1XQQA 2A4ZA 3FILA 2YEPB 2W54A 3RD2A 2C7HA 1NYQA 3VQIA 2JSVX 3RULA 3ZUNA 3JYUA 2D3GA 4XYCA 1HEZE 3ZW3A 4HPMB 3B9JA 2NS5A 1E7UA 5AUIA 1F77A 4C4VB 2MX2A 3QQ8B 1QT9A 1N5WA 4KKJA 3KYCD 2BPSA 1UELA 3NVZA 3QJZA 3TJPA 4M8NA 5HHDG 2BB5A 2JF5A 3M95A 2EMTA 4PT5A 5G5GA 2LUEA 1WJNA 4BAXA 3TMPB 4MT5A 3CSFA 4B0EA 3T9LA 1C1YB 1VJKA 2MBEA 2KQ4X 4NQKE 4HRSA 1FXIA 4W9DA 4NAWA 5LXHA 4ITKA 4ZRPA 4WWOA 1MPEA 5KHOA 2ZNVC 4LJOB 5TR5A 1ZOYB 3PHXB 4IM2A 2LXCA 3SR6A 2OJRA 3KUCB 1WGKA 5LXIB 2KC1A 1IGCA 4RM9A 1CQVA 5D6JB 4A90A 1RLFA 3Q8CA 3APDA 2BS3B 2REXA 1T0YA 4URKA 1KLVA 3H8HA 4OZBA 2W55A 3U2SC 1TTNA 3R66C 1E7PB 1LFDA 3PSEB 2IO2B 2IYDB 3B08A 2KTRA 1KTKA 3NJTA 3KUZA 1K53A 4HROA 2LJIA 2L0FA 2BQQA 1K51A 3AXCA 3L13A 3TBLD 1YIWA 3IT4B 3CMMB 1SJHD 3DBLB 2JWZA 3H7SA 1FO4A 1LGRA 5EE3A 1ENFA 1VRAB 4W9CA 3N9YC 4TUUA 3RN9C 4B6WA 2INNE 1Q1OA 1MVKA 2LI5A 1E10A 3ZJUA 1L7YA 3ML8A 1V5OA 4YWGG 4KV2A 2ZCCA 4NAWB 1OFFA 5T8IA 1XT9B 3QIJA 2ZPYA 5D2MB 4NQLB 1J8CA 3VUXA 1S1QB 3DBRB 5CTRC 4A20A 1KFYB 2FCNA 3DBLI 3Q8AA 4IM0A 4LNNA 1YJJA 2I2YA 4HXDA 4TMAB 3RI7C 4S17A 2BYTA 2K5PA 3RNCC 2KWUB 1UNSA 1IYFA 5MPOA 1SBBB 1D5XC 1P0RA 2JVCA 2KTRB 3WAPA 1WGRA 2FUG1 3TCAA 1YN5A 4X57B 4ASWC 1JWMD 1RRBA 1BUIC 1XCQL 2G3QB 3AULA 3ZYYX 1PFDA 3E9SA 1MI0A 5C1ZA 4P16A 3DBRI 2GMIC 1N5XA 2RDBC 2IGHA 3Q69A 2ZPNA 2KLCA 2B76B 2LRUA 1EWYC 3RNBC 1NEKB 1VDVA 1QKZA 1D5ZC 3VTWA 2AQ3B 2PMVA 4WURA 5C2TB 2RPVA 1NBFC 3TEWA 1YJ1A 2BW2A 4HKQA 4NJ7A 4P1BC 1IPGA 3RNEC 2QSDA 5D3DA 4WWPA 2WQYB 3BK2A 2H89B 3R2IA 2C9WB 3AEAB 4IOIE 2WGSA 2IO3B 2D3AA 2IY1B 3VUYA 2M0XA 1JWAD 2KX0A 1WX9A 4K7WA 4P1CC 5HG2A 5GMVA 4GN1A 4N58A 2ZEQA 4GOCA 2LVPA 2MW5A 2CU3A 4JWSC 2D07B 2IZVB 3DQVA 3WCQA 4BOSC 4IDIA 3AE8B 4HCNB 4ZYSA 2FE8A 2EKIA 2PLPA 2D11A 1T5XD 1P9DU 1C4CA 2B3AA 2JXTA 5DPSA 4YL8A 4FHJA 4LNFA 1MJDA 1GUAB 1YOVB 4L2YA 3ETRA 2Z8LA 2M19A 4P7IA 1F9JA 3AEDB 4YSZB 2N7EA 5IA7A 2MJDA 2WU2B 1GJZA 3ZNZB 1KOTA 4MACA 2JT4B 4OHJA 3DVGX 4KSKC 1R4MB 1FM0D 2L3ZA 2IGDA 2WXIA 5GXGB 1QQRA 2BYEA 1L6UA 2KDMA 2QMTA 2NTSA 1NVID 4GU2A 2N1WA 2A5UA 4YSYB 1OEYA 4MSMB 3TL5A 4MGYE 3SHQA 3VTUA 2PEAA 3UQAA 4W9LA 4YT0B 4RF0A 2O6VA 3MC8A 4REZA 2CU1A 1GOZA 1TGZB 3ALBA 2KK8A 4CYEA 1TS4A 4B9KA 2I1KA 1C77A 3ZTDA 1R4MI 2WXOA 5BYQA 4R3DA 1KF6B 3TEZA 3A1QB 4I6LB 1WI0A 2WS3B 1F2RI 3J9CA 1TY2A 2KZRA 4B95A 2G4DB 2NBWB 4JPSA 4HWIB 1BXTA 3BY4B 4FJZA 1KLGD 3VHTC 2G1EA 3W5UB 1IUEA 1N61A 1VZ6A 4ZRJA 1NYRA 2N9XA 3ZLZA 3T3OA 3AE9B 1WJ6A 4XDCA 2GBMA 2MSED 4E71A 3PRMB 5CHFA 1ZXHA 4WWNA 1QOBA 3U30A 4C7ZA 2J53A 2LZ6A 1PGAA 2LGXA 3PHWB 2RGFA 4FADA 3ZJVA 2MLBA 2KFJA 3ZXVA 4BKGA 1QOFA 1DOXA 4HJGE 1SIFA 2FAZA 1L6VA 2LXAA 1ZUD2 3RPFC 4M00A 2V3PA 4GDKA 2JWUA 3WAOA 4E74A 1LM8B 2BTEA 2DZJA 2WHIA 2VRRB 3UIPB 4C80A 2FIDA 4GMVA 5L95C 3DCGA 1BT0A 3AMZA 2WX1A 2J52A 3W2DA 5AUKA 4II2B 4II3B 4MELA 2O6VB 2V4LA 3N3KB 4BKTA 3R2TA 2V3NA 3RCZA 1HA5A 3LDZE 3C19A 1ZXIA 3AEFB 1DOYA 4IG7B 2N7JA 3GP7A 3Q8FA 1TKYA 1YQBA 2Y5CA 1E0ZA 4GB9A 3PVLA 1Q10A 4KX6B 2MRPA 3AH7A 4IKGA 3DVNU 3HRDD 1UGMA 4A6QA 3UI3A 3Q3NC 4DHZB 5I4DA 2V3SA 1OGWA 2GI9A 5KHQA 4TKNA 2K6DB 4RGNA 3NS1A 1TS5A 1B1ZA 4TQ0A 2JUOA 1XLPA 4A9AA 2C60A 2WXHA 2JY6A 2K8BA 4BKSA 4DHZE 2N9EB 2ZVOA 4WIPA 3BYYB 3RNAC 3HUIA 2MBBB 3OG5A 5AEKB 3TEYA 5BMHA 1V8CA 2AQ1B 2D3CA 1MHHE 2WP9B 4MEMA 1VZ7A 3L17A 1YMHE 1OTRB 4GDKB 2L32A 2M8SA 4FJYA 2AL6A 2NPTA 1SXTA 2WX0A 4A3PA 2PVOD 3Q6BA 4M0WA 2LVQA 1ZDXA 4YSXB 3DHHC 5C3JB 1MHXA 3CWIA 4LTUA 5BYRA 4HJKA 4IUMB 2BVCA 1UH6A 1EU4A 4P6VF 1UBIA 1HZ6A 4EUTA 1OQYA 3N32A 2JZZA 2C5LC 3OWEB 4JWUC 4E3CA 2GBKA 2WXQA 1KRHA 1Y8RC 2R2QA 1AN8A 1SEBD 1N6ZA 3L0WB 3QX1A 5J2RA 1ZPSA 2GOWA 2JU6X 2KOXA 1I35A 4M01A 3KVFB 4AQ7A 5E6PA 4DDID 2L7RA 2OEDA 2KWVB 2MJEA 5JXVA 3B2GA 3CSTA 4HVBA 3GS2A 2IJ0A 2L1AA 3AEEB 2L52A 1TZOA 1GNUA 2VZKB 4ZYNA 1WR1A 4MJSA 2O6VD 1HQRD 5TSSA 2KX3A 2YLMA 4A8XC 3X0WA 2KMMA 1WXMA 5DCNA 4MM3A 2PPHA 2JYTA 4ANXA 2NPTB 1ET6A 5BMGA 4M0WB 3U7ZA 3QK0A 1L4ZB 4JE3B 3QHTA 4ANVA 1ZKHA 4JL9A 3DVGY 4HPLB 3W1SC 2WXFA 2J4XA 3NS8A 2AL3A 3EFCA 1WR6E 2AX5A 4AS1A 3ZDTA 2MQJA 4WJOA 1TJEA 1R7SA 4RGTA 2I38A 3PT2B 1BMLC 1FPYA 1VR9A 4LJPB 3ZGZA 3KWLA 2BS2B 3VDZA 1TY0A 1D5MC 3V62A 4PYUA 2NR2A 3IVFA 4ZRKA
chains in the Genus database with same CATH topology
1V6EA 2DENB 2HD5B 3AU4A 2KWUB 2AEHA 2LWPA 1FXTB 4ANUA 3NZSA 3VXWA 4LCDE 1IYFA 1P0RA 2JVCA 2KTRB 3WAPA 4K1RB 2KMCA 3VH3B 1WGRA 4MH0E 3TCAA 4X57B 3OJ4B 4EOYA 4ASWC 1RRBA 1V81A 2MP2B 3AULA 2G3QB 4GXBA 4WAAA 1KJTA 2KWCA 3QCAA 5J18A 1JRUA 4EFOA 2OOBB 2K1FA 1P98A 5C1ZA 5AZGA 2K39A 3DBRI 1SGHA 2WYQA 1E8XA 1ZGUB 1J19A 2GMIC 2LGDA 4JGHB 4G11A 1UD7A 2KANA 2ZPNA 3NOBA 4HK2A 2KLCA 3QWZB 4MJSB 2LRUA 3U7DA 2BKRB 5D94A 2LJ5A 4KZCA 5LLIA 2WDTB 1V49A 3L16A 3PS6A 5G55A 1WXVA 3VTWA 4EZKA 3PV1A 3APFA 2DAJA 1NI2A 2DZMA 2KHWB 3A9JB 4W9FA 1P3QU 1NBFC 1YJ1A 2N9PC 3ZNGC 1GC6A 4NJ7A 3A9KA 2IY0B 1IPGA 4BOZB 2ZJDA 3AI5A 3P2BA 3UIOB 4WWPA 3L10B 2O2VA 4AJWA 1V5TA 1RAXA 1KM7A 4I6PA 2C9WB 5JH5C 3A4SC 2NVUI 4TQ1A 4HCPB 2IO3B 1UZXB 1VD2A 2FIFA 2IY1B 3AU5A 4GDLB 3VUYA 1WGDA 2M0XA 4NJ6A 3UF8A 1WMHB 1E90A 4ICVA 2KX0A 3JSVA 1WFYA 4HDQA 4MDKE 1WX9A 4K7WA 5GMVA 4GN1A 2DX5B 3RYTA 4AP4C 2ZEQA 3VVWB 1V86A 4GOCA 2CHZA 1TZ1A 2LVPA 2MW5A 1XD3B 2D07B 2IZVB 3DQVA 2XK5B 1YX6B 3DVNV 4KIKA 1WX7A 2NBUA 3V6EB 4BOSC 4HCNB 5J17A 4M8MA 3NHEB 2RSUA 1EF5A 5DPTA 2D11A 1P9DU 2KDIA 2B3AA 5DPSA 1QZEA 3QAQA 4YL8A 4FHJA 4BKSD 2FCMA 3R3MA 3BINA 2JXXA 3HM6X 1GUAB 5CHVC 1WJUA 1E8ZA 2KKCA 1LQBA 3OJ3A 4P7IA 3VAWA 4A3OA 1F9JA 4DHJD 3VTVA 3UGBB 1P1AA 3EC8A 2CR5A 2N7EA 5IA7A 3W1SA 1YX5B 2RPQA 4BVUC 3ZNZB 1GJZA 1KOTA 3ZIMA 3UINB 2N4FA 2DYMA 5G2NA 2BKFA 2JT4B 3DVGX 4KSKC 2JRIB 2ZNVB 2KTFA 3B1LX 4DDGD 2LASA 2K6QA 3MTNB 1GC7A 2FCSA 4FJVB 4KVGB 4W9KA 2L3ZA 3JVZX 3T8MA 3IBEA 2XBBC 4OVUA 2BYEA 4RMAA 1I42A 2V1YA 4GU2A 3TIXA 3PLUA 4ICUA 2N1WA 5CX3A 4ZDVA 1VCBA 2BYVE 4IWPA 2LGYA 2XK5A 2A5UA 3DBSA 2KMAA 1OEYA 3NZUA 1WF9A 3L54A 4MSMB 3TL5A 4MGYE 3SHQA 3V6CB 3VTUA 2PEAA 3UQAA 4W9LA 4MGIE 3A33B 3B0AA 2O6VA 2BYFA 3C0RB 3A9KB 3PZDA 4IW0A 2K8HA 2BWFA 2AWTA 3GOEA 2CU1A 5BO4B 1WIAA 3VUWA 1TGZB 2O2VB 3ALBA 2K25A 2LVOA 1WXAA 3H6NA 2KFKA 2MBOA 2KK8A 3KUDB 3X23A 4CYEA 3RZWC 4B9KA 1U4AA 2I1KA 2CHWA 4FBJB 3SD5A 3SU8X 2KJHB 3ZTDA 1G6JA 1R4MI 1WM3A 2JRHA 4PYZA 4I6NB 3JSVB 4N9F4 1H8CA 2KQSA 3A1QB 3KYDD 3ECIA 4I6LB 4W9EA 4WJPA 5D7GA 1WI0A 2DHZA 2DAFA 1ISNA 1A5RA 2KZRA 4KIKB 4B95A 2G4DB 3M62B 2NBWB 4HWIB 2ZZPB 3IHPC 2CS4A 3BY4B 4FJZA 2J7QB 5HKHA 2KO3A 3VHTC 1WYWB 3RUIB 2FCQA 4W9GA 2DZIA 2L05A 1Z5SB 3WALA 3ENEA 3A4RA 4DK5A 4ZRJA 2N9XA 3I3TB 3ZLZA 3NY5A 3HHMA 1WJ6A 2PE6B 2J0KA 3EFUA 5DPWA 2GBMA 2L8JA 2MSED 4BBNC 4E71A 1ZW7A 3PRMB 2W9NA 4WWNA 5CHFA 1EO6A 2Y5BB 3U30A 2K8CA 4NNJB 3VFKA 4EZJA 2LZ6A 3PPAA 4AUQC 3R7RA 2KLGA 4NY0A 1WGYA 3ZTCA 2LGXA 3PHWB 4AOFA 2RGFA 4FADA 3KW5B 2MLBA 3WAMA 2KFJA 4BKGA 3OAWA 3WIMA 2IO1B 2KQ7A 5DPRA 1Z2MA 2CHXA 1SIFA 2FAZA 2UWQA 4FLHA 2BGFA 2MCNB 4MGKE 2LXAA 2KXJA 2EMSA 4XX5A 3A1QA 2M4NA 1WZ0A 1V9JA 3IVFA 4GDKA 3WAOA 4E74A 1Q5WB 1LM8B 2DZJA 4FHKA 2VRRB 2Z59B 4PS3A 4AJYB 3UIPB 1H4RA 2FIDA 1Q0WB 4GMVA 3PGEA 4WJNA 3DCGA 5L95C 3PRPB 1BT0A 2WX1A 2PE9A 3JW0X 1YD8U 3KH0A 5JHBA 3S2AA 3HM3A 4II2B 4II3B 2J0JA 3OLMD 4MELA 3SDLC 2JPHA 3MHSD 2O6VB 2V4LA 3PTFC 4IWOA 1S3SG 2GBRA 2NCNA 1NDDA 3N3KB 4BKTA 1CMXB 4ANWA 4PS7A 3RCZA 3DDCB 3WA0A 3LDZE 1GG3A 1WRDB 1MG8A 4FN2A 4G3XB 4W9IA 2KFKB 2PJHA 4IG7B 3ZVVA 4J6IA 2LRWA 1YQBA 2CKHB 2ZVNA 4GB9A 1V2YA 2YVCA 3DBHI 2L76A 3K9OB 3PVLA 2C7MB 4NPNA 4PS8A 1OEYJ 2G45B 2KN5A 2D10A 3Q3JA 2MRPA 3MJWA 1IP9A 4EZLA 2MA9B 3DVNU 5AZHA 1UGMA 3N30A 4EKUA 4FULA 4DHZB 2V3SA 3PRZA 3QA8A 1OGWA 3W1YA 5KHQA 5FR6A 4TKNA 2K6DB 1SE9A 2N7DA 2R2OA 2KDBA 3D32A 4MSQB 4W9JA 2HTHA 3WANA 4G50A 1WH3A 4F7ZA 5E6NA 3ZRCA 4GIVA 2IBIB 4GSWA 1EF1A 1R4NI 2LD9A 4CHKA 1WX8A 3EHVA 1XQQA 1K8RB 2A4ZA 1D3ZA 3DOWA 3ZO5B 2NBVB 1L2NA 3RD2A 4TQ0A 2JUOA 2C7HA 5IAAC 3RULA 3VQIA 4LDTB 3JYUA 3ZUNA 4KDLB 3LJ3A 1WXSA 2C60A 2D3GA 1EUVB 3H1UA 4AWJA 5JHAA 4XC2A 4HPMB 2JY6A 2K8BA 3ZW3A 4RM8A 1HE8A 4BBNF 2WWZA 2NS5A 4HLEA 1E7UA 4BKSA 2G4SA 2BF8B 2MBHA 2MX2A 3QQ8B 2KDEB 2N9EB 2ZVOA 4DHZE 2L00B 2KJRA 3H7PA 4G0NB 2MBBB 5AEKB 2HE7A 3KYCD 4KSLC 3RZFA 2BPSA 1UELA 3QJZA 3TJPA 4M8NA 2BWES 2N1VA 4WQOB 4MEMA 1V80A 2JF5A 3M95A 1E8WA 2EMTA 3L17A 1OTRB 4GDKB 3R7QA 2M8SA 2LUEA 4FJYA 2AL6A 2NPTA 2WX0A 1WJNA 2FNJB 4F8CB 3TMPB 1WGGA 2C7NB 3CSFA 4A3PA 4JQWC 3T9LA 1C1YB 2MBEA 3VH4B 2XEWA 1UBQA 2LVQA 4NQKE 4IM3A 4W9DA 2Z0EB 1PQSA 3ML9A 3QC8B 3CF6E 4NAWA 5LXHA 4HJKA 4IUMB 4WWOA 4BFRA 5AZFA 3L08A 1UH6A 3GZNI 5KHOA 2M1MA 2ZNVC 1WE7A 1UBIA 4KDIC 4LJOB 2M17A 2I1JA 1OQYA 3PHXB 3N32A 4IM2A 5TR5A 1E7VA 2LXCA 4EUTA 2JZZA 2C5LC 4JLCA 2GBJA 2OJRA 3KUCB 4JIOU 2L0TA 4DBGA 4OVVA 5CHWA 4E3CA 2GBKA 3O65B 5LXIB 2KC1A 3V60A 4EEWA 1RFAA 3UQBA 1Y8RC 3M3JA 1TBEA 4RM9A 2R2QA 4CO7A 4DWFA 3M63B 5D6JB 1RLFA 3APDA 4K7SA 2REXA 3L0WB 1T0YA 3QX1A 4URKA 1KLVA 4ZRIA 5J2RA 1TTNA 2KNBA 4F1SA 5JZEB 2GOWA 2QHOA 3R66C 1C3TA 2DZKA 1LFDA 2KOXA 2IO2B 3PSEB 3HK0A 1I35A 2IYDB 3B08A 2KTRA 1J0GA 3K9PB 3KVFB 5E6PA 4DDID 2KDFB 4WJQA 3KUZA 2L7RA 3EECA 2L0FA 2MP2A 2KWVB 4W9HA 3CSTA 3DPDA 4HVBA 5C23A 2UYZB 3AXCA 5L83A 3L13A 3TBLD 1M94A 1YIWA 3CMMB 1WY8A 3ZNHB 1GNUA 2J0MA 4ZYNA 3H7PB 3IG3A 3ONSA 1WR1A 2JWZA 2FUHB 3H7SA 4GGQA 4MJSA 2ASQA 2O6VD 1E5WA 4KZ0A 3V61A 2Z0DB 2KX3A 2MWSB 1WJ4A 1X1MA 4DHJB 4W9CA 2GBNA 3ZRFA 2YLMA 5EDSA 4TV3A 3X0WA 1WXMA 5DCNA 4MM3A 4TUUA 3ZDMC 2PPHA 4B6WA 1Q1OA 4HDOA 2NPTB 4ANXA 2DYBA 4K81A 1WGHA 1WZ3A 1LXDA 4XZ4A 2RR9A 2LI5A 3A9JA 3ZNID 2KC2A 3H9DA 4M0WB 4FA6A 1L7YA 1WM2A 3QK0A 3PLVA 3ML8A 3Q3FA 3QHTA 4DXAB 2RD0A 1ZKHA 4JL9A 1V5OA 4ANVA 2KD0A 2KVRA 2AYOB 4IWQA 4KV2A 3DVGY 4HPLB 2ZCCA 3W1SC 2JZ3B 4NAWB 3RT3B 3NS8A 1XT9B 3QIJA 2AL3A 4K7UA 2ZPYA 4MGZE 1WR6E 2IO0B 1AARA 3ZDTA 5E6OA 2D2QA 2MQJA 4GDLA 4WJOA 2KJ6A 2MBQA 5D2MB 2DYOA 4NQLB 1J8CA 1WMHA 3APCA 1S1QB 3PT2B 3U8ZA 3VUXA 3HIZA 5CTRC 4A20A 4IC7B 3PREA 2FCNA 3DBLI 4IM0A 4LJPB 3ZKJC 3VDZA 2HJ8A 2EKEC 4HXDA 3QARA 2ZCBA 3V62A 4LDTD 1WE6A 4PYUA 3IFWB 2NR2A 1E8YA 4ZRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V6E A;  2DEN B;  2HD5 B;  3AU4 A;  2KWU B;  2AEH A;  2LWP A;  1FXT B;  4ANU A;  3NZS A;  3VXW A;  4LCD E;  1IYF A;  1P0R A;  2JVC A;  2KTR B;  3WAP A;  4K1R B;  2KMC A;  3VH3 B;  1WGR A;  4MH0 E;  3TCA A;  4X57 B;  3OJ4 B;  4EOY A;  4ASW C;  1RRB A;  1V81 A;  2MP2 B;  3AUL A;  2G3Q B;  4GXB A;  4WAA A;  1KJT A;  2KWC A;  3QCA A;  5J18 A;  1JRU A;  4EFO A;  2OOB B;  2K1F A;  1P98 A;  5C1Z A;  5AZG A;  2K39 A;  3DBR I;  1SGH A;  2WYQ A;  1E8X A;  1ZGU B;  1J19 A;  2GMI C;  2LGD A;  4JGH B;  4G11 A;  1UD7 A;  2KAN A;  2ZPN A;  3NOB A;  4HK2 A;  2KLC A;  3QWZ B;  4MJS B;  2LRU A;  3U7D A;  2BKR B;  5D94 A;  2LJ5 A;  4KZC A;  5LLI A;  2WDT B;  1V49 A;  3L16 A;  3PS6 A;  5G55 A;  1WXV A;  3VTW A;  4EZK A;  3PV1 A;  3APF A;  2DAJ A;  1NI2 A;  2DZM A;  2KHW B;  3A9J B;  4W9F A;  1P3Q U;  1NBF C;  1YJ1 A;  2N9P C;  3ZNG C;  1GC6 A;  4NJ7 A;  3A9K A;  2IY0 B;  1IPG A;  4BOZ B;  2ZJD A;  3AI5 A;  3P2B A;  3UIO B;  4WWP A;  3L10 B;  2O2V A;  4AJW A;  1V5T A;  1RAX A;  1KM7 A;  4I6P A;  2C9W B;  5JH5 C;  3A4S C;  2NVU I;  4TQ1 A;  4HCP B;  2IO3 B;  1UZX B;  1VD2 A;  2FIF A;  2IY1 B;  3AU5 A;  4GDL B;  3VUY A;  1WGD A;  2M0X A;  4NJ6 A;  3UF8 A;  1WMH B;  1E90 A;  4ICV A;  2KX0 A;  3JSV A;  1WFY A;  4HDQ A;  4MDK E;  1WX9 A;  4K7W A;  5GMV A;  4GN1 A;  2DX5 B;  3RYT A;  4AP4 C;  2ZEQ A;  3VVW B;  1V86 A;  4GOC A;  2CHZ A;  1TZ1 A;  2LVP A;  2MW5 A;  1XD3 B;  2D07 B;  2IZV B;  3DQV A;  2XK5 B;  1YX6 B;  3DVN V;  4KIK A;  1WX7 A;  2NBU A;  3V6E B;  4BOS C;  4HCN B;  5J17 A;  4M8M A;  3NHE B;  2RSU A;  1EF5 A;  5DPT A;  2D11 A;  1P9D U;  2KDI A;  2B3A A;  5DPS A;  1QZE A;  3QAQ A;  4YL8 A;  4FHJ A;  4BKS D;  2FCM A;  3R3M A;  3BIN A;  2JXX A;  3HM6 X;  1GUA B;  5CHV C;  1WJU A;  1E8Z A;  2KKC A;  1LQB A;  3OJ3 A;  4P7I A;  3VAW A;  4A3O A;  1F9J A;  4DHJ D;  3VTV A;  3UGB B;  1P1A A;  3EC8 A;  2CR5 A;  2N7E A;  5IA7 A;  3W1S A;  1YX5 B;  2RPQ A;  4BVU C;  3ZNZ B;  1GJZ A;  1KOT A;  3ZIM A;  3UIN B;  2N4F A;  2DYM A;  5G2N A;  2BKF A;  2JT4 B;  3DVG X;  4KSK C;  2JRI B;  2ZNV B;  2KTF A;  3B1L X;  4DDG D;  2LAS A;  2K6Q A;  3MTN B;  1GC7 A;  2FCS A;  4FJV B;  4KVG B;  4W9K A;  2L3Z A;  3JVZ X;  3T8M A;  3IBE A;  2XBB C;  4OVU A;  2BYE A;  4RMA A;  1I42 A;  2V1Y A;  4GU2 A;  3TIX A;  3PLU A;  4ICU A;  2N1W A;  5CX3 A;  4ZDV A;  1VCB A;  2BYV E;  4IWP A;  2LGY A;  2XK5 A;  2A5U A;  3DBS A;  2KMA A;  1OEY A;  3NZU A;  1WF9 A;  3L54 A;  4MSM B;  3TL5 A;  4MGY E;  3SHQ A;  3V6C B;  3VTU A;  2PEA A;  3UQA A;  4W9L A;  4MGI E;  3A33 B;  3B0A A;  2O6V A;  2BYF A;  3C0R B;  3A9K B;  3PZD A;  4IW0 A;  2K8H A;  2BWF A;  2AWT A;  3GOE A;  2CU1 A;  5BO4 B;  1WIA A;  3VUW A;  1TGZ B;  2O2V B;  3ALB A;  2K25 A;  2LVO A;  1WXA A;  3H6N A;  2KFK A;  2MBO A;  2KK8 A;  3KUD B;  3X23 A;  4CYE A;  3RZW C;  4B9K A;  1U4A A;  2I1K A;  2CHW A;  4FBJ B;  3SD5 A;  3SU8 X;  2KJH B;  3ZTD A;  1G6J A;  1R4M I;  1WM3 A;  2JRH A;  4PYZ A;  4I6N B;  3JSV B;  4N9F 4;  1H8C A;  2KQS A;  3A1Q B;  3KYD D;  3ECI A;  4I6L B;  4W9E A;  4WJP A;  5D7G A;  1WI0 A;  2DHZ A;  2DAF A;  1ISN A;  1A5R A;  2KZR A;  4KIK B;  4B95 A;  2G4D B;  3M62 B;  2NBW B;  4HWI B;  2ZZP B;  3IHP C;  2CS4 A;  3BY4 B;  4FJZ A;  2J7Q B;  5HKH A;  2KO3 A;  3VHT C;  1WYW B;  3RUI B;  2FCQ A;  4W9G A;  2DZI A;  2L05 A;  1Z5S B;  3WAL A;  3ENE A;  3A4R A;  4DK5 A;  4ZRJ A;  2N9X A;  3I3T B;  3ZLZ A;  3NY5 A;  3HHM A;  1WJ6 A;  2PE6 B;  2J0K A;  3EFU A;  5DPW A;  2GBM A;  2L8J A;  2MSE D;  4BBN C;  4E71 A;  1ZW7 A;  3PRM B;  2W9N A;  4WWN A;  5CHF A;  1EO6 A;  2Y5B B;  3U30 A;  2K8C A;  4NNJ B;  3VFK A;  4EZJ A;  2LZ6 A;  3PPA A;  4AUQ C;  3R7R A;  2KLG A;  4NY0 A;  1WGY A;  3ZTC A;  2LGX A;  3PHW B;  4AOF A;  2RGF A;  4FAD A;  3KW5 B;  2MLB A;  3WAM A;  2KFJ A;  4BKG A;  3OAW A;  3WIM A;  2IO1 B;  2KQ7 A;  5DPR A;  1Z2M A;  2CHX A;  1SIF A;  2FAZ A;  2UWQ A;  4FLH A;  2BGF A;  2MCN B;  4MGK E;  2LXA A;  2KXJ A;  2EMS A;  4XX5 A;  3A1Q A;  2M4N A;  1WZ0 A;  1V9J A;  3IVF A;  4GDK A;  3WAO A;  4E74 A;  1Q5W B;  1LM8 B;  2DZJ A;  4FHK A;  2VRR B;  2Z59 B;  4PS3 A;  4AJY B;  3UIP B;  1H4R A;  2FID A;  1Q0W B;  4GMV A;  3PGE A;  4WJN A;  3DCG A;  5L95 C;  3PRP B;  1BT0 A;  2WX1 A;  2PE9 A;  3JW0 X;  1YD8 U;  3KH0 A;  5JHB A;  3S2A A;  3HM3 A;  4II2 B;  4II3 B;  2J0J A;  3OLM D;  4MEL A;  3SDL C;  2JPH A;  3MHS D;  2O6V B;  2V4L A;  3PTF C;  4IWO A;  1S3S G;  2GBR A;  2NCN A;  1NDD A;  3N3K B;  4BKT A;  1CMX B;  4ANW A;  4PS7 A;  3RCZ A;  3DDC B;  3WA0 A;  3LDZ E;  1GG3 A;  1WRD B;  1MG8 A;  4FN2 A;  4G3X B;  4W9I A;  2KFK B;  2PJH A;  4IG7 B;  3ZVV A;  4J6I A;  2LRW A;  1YQB A;  2CKH B;  2ZVN A;  4GB9 A;  1V2Y A;  2YVC A;  3DBH I;  2L76 A;  3K9O B;  3PVL A;  2C7M B;  4NPN A;  4PS8 A;  1OEY J;  2G45 B;  2KN5 A;  2D10 A;  3Q3J A;  2MRP A;  3MJW A;  1IP9 A;  4EZL A;  2MA9 B;  3DVN U;  5AZH A;  1UGM A;  3N30 A;  4EKU A;  4FUL A;  4DHZ B;  2V3S A;  3PRZ A;  3QA8 A;  1OGW A;  3W1Y A;  5KHQ A;  5FR6 A;  4TKN A;  2K6D B;  1SE9 A;  2N7D A;  2R2O A;  2KDB A;  3D32 A;  4MSQ B;  4W9J A;  2HTH A;  3WAN A;  4G50 A;  1WH3 A;  4F7Z A;  5E6N A;  3ZRC A;  4GIV A;  2IBI B;  4GSW A;  1EF1 A;  1R4N I;  2LD9 A;  4CHK A;  1WX8 A;  3EHV A;  1XQQ A;  1K8R B;  2A4Z A;  1D3Z A;  3DOW A;  3ZO5 B;  2NBV B;  1L2N A;  3RD2 A;  4TQ0 A;  2JUO A;  2C7H A;  5IAA C;  3RUL A;  3VQI A;  4LDT B;  3JYU A;  3ZUN A;  4KDL B;  3LJ3 A;  1WXS A;  2C60 A;  2D3G A;  1EUV B;  3H1U A;  4AWJ A;  5JHA A;  4XC2 A;  4HPM B;  2JY6 A;  2K8B A;  3ZW3 A;  4RM8 A;  1HE8 A;  4BBN F;  2WWZ A;  2NS5 A;  4HLE A;  1E7U A;  4BKS A;  2G4S A;  2BF8 B;  2MBH A;  2MX2 A;  3QQ8 B;  2KDE B;  2N9E B;  2ZVO A;  4DHZ E;  2L00 B;  2KJR A;  3H7P A;  4G0N B;  2MBB B;  5AEK B;  2HE7 A;  3KYC D;  4KSL C;  3RZF A;  2BPS A;  1UEL A;  3QJZ A;  3TJP A;  4M8N A;  2BWE S;  2N1V A;  4WQO B;  4MEM A;  1V80 A;  2JF5 A;  3M95 A;  1E8W A;  2EMT A;  3L17 A;  1OTR B;  4GDK B;  3R7Q A;  2M8S A;  2LUE A;  4FJY A;  2AL6 A;  2NPT A;  2WX0 A;  1WJN A;  2FNJ B;  4F8C B;  3TMP B;  1WGG A;  2C7N B;  3CSF A;  4A3P A;  4JQW C;  3T9L A;  1C1Y B;  2MBE A;  3VH4 B;  2XEW A;  1UBQ A;  2LVQ A;  4NQK E;  4IM3 A;  4W9D A;  2Z0E B;  1PQS A;  3ML9 A;  3QC8 B;  3CF6 E;  4NAW A;  5LXH A;  4HJK A;  4IUM B;  4WWO A;  4BFR A;  5AZF A;  3L08 A;  1UH6 A;  3GZN I;  5KHO A;  2M1M A;  2ZNV C;  1WE7 A;  1UBI A;  4KDI C;  4LJO B;  2M17 A;  2I1J A;  1OQY A;  3PHX B;  3N32 A;  4IM2 A;  5TR5 A;  1E7V A;  2LXC A;  4EUT A;  2JZZ A;  2C5L C;  4JLC A;  2GBJ A;  2OJR A;  3KUC B;  4JIO U;  2L0T A;  4DBG A;  4OVV A;  5CHW A;  4E3C A;  2GBK A;  3O65 B;  5LXI B;  2KC1 A;  3V60 A;  4EEW A;  1RFA A;  3UQB A;  1Y8R C;  3M3J A;  1TBE A;  4RM9 A;  2R2Q A;  4CO7 A;  4DWF A;  3M63 B;  5D6J B;  1RLF A;  3APD A;  4K7S A;  2REX A;  3L0W B;  1T0Y A;  3QX1 A;  4URK A;  1KLV A;  4ZRI A;  5J2R A;  1TTN A;  2KNB A;  4F1S A;  5JZE B;  2GOW A;  2QHO A;  3R66 C;  1C3T A;  2DZK A;  1LFD A;  2KOX A;  2IO2 B;  3PSE B;  3HK0 A;  1I35 A;  2IYD B;  3B08 A;  2KTR A;  1J0G A;  3K9P B;  3KVF B;  5E6P A;  4DDI D;  2KDF B;  4WJQ A;  3KUZ A;  2L7R A;  3EEC A;  2L0F A;  2MP2 A;  2KWV B;  4W9H A;  3CST A;  3DPD A;  4HVB A;  5C23 A;  2UYZ B;  3AXC A;  5L83 A;  3L13 A;  3TBL D;  1M94 A;  1YIW A;  3CMM B;  1WY8 A;  3ZNH B;  1GNU A;  2J0M A;  4ZYN A;  3H7P B;  3IG3 A;  3ONS A;  1WR1 A;  2JWZ A;  2FUH B;  3H7S A;  4GGQ A;  4MJS A;  2ASQ A;  2O6V D;  1E5W A;  4KZ0 A;  3V61 A;  2Z0D B;  2KX3 A;  2MWS B;  1WJ4 A;  1X1M A;  4DHJ B;  4W9C A;  2GBN A;  3ZRF A;  2YLM A;  5EDS A;  4TV3 A;  3X0W A;  1WXM A;  5DCN A;  4MM3 A;  4TUU A;  3ZDM C;  2PPH A;  4B6W A;  1Q1O A;  4HDO A;  2NPT B;  4ANX A;  2DYB A;  4K81 A;  1WGH A;  1WZ3 A;  1LXD A;  4XZ4 A;  2RR9 A;  2LI5 A;  3A9J A;  3ZNI D;  2KC2 A;  3H9D A;  4M0W B;  4FA6 A;  1L7Y A;  1WM2 A;  3QK0 A;  3PLV A;  3ML8 A;  3Q3F A;  3QHT A;  4DXA B;  2RD0 A;  1ZKH A;  4JL9 A;  1V5O A;  4ANV A;  2KD0 A;  2KVR A;  2AYO B;  4IWQ A;  4KV2 A;  3DVG Y;  4HPL B;  2ZCC A;  3W1S C;  2JZ3 B;  4NAW B;  3RT3 B;  3NS8 A;  1XT9 B;  3QIJ A;  2AL3 A;  4K7U A;  2ZPY A;  4MGZ E;  1WR6 E;  2IO0 B;  1AAR A;  3ZDT A;  5E6O A;  2D2Q A;  2MQJ A;  4GDL A;  4WJO A;  2KJ6 A;  2MBQ A;  5D2M B;  2DYO A;  4NQL B;  1J8C A;  1WMH A;  3APC A;  1S1Q B;  3PT2 B;  3U8Z A;  3VUX A;  3HIZ A;  5CTR C;  4A20 A;  4IC7 B;  3PRE A;  2FCN A;  3DBL I;  4IM0 A;  4LJP B;  3ZKJ C;  3VDZ A;  2HJ8 A;  2EKE C;  4HXD A;  3QAR A;  2ZCB A;  3V62 A;  4LDT D;  1WE6 A;  4PYU A;  3IFW B;  2NR2 A;  1E8Y A;  4ZRK A; 
#chains in the Genus database with same CATH topology
 2DEN B;  2IDY A;  2AEH A;  2LWP A;  3NZS A;  3VXW A;  4A55 A;  2N9K A;  2RDH A;  2LHE A;  1TIF A;  3VH3 B;  1AYF A;  2XN9 C;  4GXB A;  5FK9 C;  1KJT A;  5J18 A;  3AEB B;  1I4H A;  5FKA C;  2LGS A;  1P98 A;  3PO0 A;  1SGH A;  2WYQ A;  2WXG A;  3AEC B;  1ZGU B;  2UU7 A;  4JGH B;  4G11 A;  3NOB A;  3W5V B;  4MJS B;  2VH2 A;  5D94 A;  4KZC A;  3L16 A;  1WXV A;  4PK1 A;  4EZK A;  1Y56 A;  4MM3 B;  2DAJ A;  4XDD A;  2W82 A;  2KHW B;  1XO3 A;  4W9F A;  2WDR B;  2N9P C;  1GC6 A;  1RYJ A;  2KT7 A;  3EGR A;  1SE4 A;  1KM7 A;  1AW7 A;  1L0Y B;  3A4S C;  2NVU I;  4HCP B;  2WDV B;  1UZX B;  1K50 A;  2QCZ A;  2FIF A;  4CQN A;  2N9L A;  1WGD A;  3UF8 A;  4NJ6 A;  3AE1 B;  1E90 A;  4AP4 C;  3VVW B;  1ZDV A;  1TZ1 A;  4ZOH C;  2BBC A;  2XK5 B;  4M8M A;  2WXM A;  3NHE B;  5DPT A;  1EF5 A;  3QAQ A;  4BKS D;  1TS3 A;  2JXX A;  3MP9 A;  3HM6 X;  4XGA B;  2VZK D;  4A3O A;  4ZRQ A;  4L1B A;  5E6J A;  4WQM A;  3EC8 A;  2RPQ A;  4BVU C;  3UIN B;  2V0G A;  5IOI A;  2BKF A;  2JRI B;  2ZNV B;  4DDG D;  3BK1 A;  1JML A;  4W9K A;  3DHI C;  3JVZ X;  1V1O A;  1UGJ A;  1RFK A;  4US9 A;  3IBE A;  4RMA A;  1RWS A;  4ICU A;  1HTO A;  4C7Y A;  4WAF A;  2KMA A;  1PGX A;  1L0X B;  4N59 A;  3R8B A;  3BYT B;  3VRB B;  4UDU C;  3AM9 A;  2AWT A;  2RDG A;  2LVO A;  3GE8 C;  1U4A A;  2CHW A;  1SJE D;  2KJH B;  3ZJT A;  3W9C B;  3TUO A;  3ECI A;  5D7G A;  1PYW D;  3AE4 B;  2DHZ A;  1ISN A;  1EM7 A;  1C79 A;  1YN3 A;  3GE3 C;  1FD6 A;  3IHP C;  1FNW A;  2J7Q B;  2KO3 A;  3AE2 B;  2W3S A;  2DZI A;  1T0S C;  1I4Q A;  1UUP A;  3ENE A;  4NAM A;  4DK5 A;  1C78 A;  4US8 A;  5EE0 A;  1GB1 A;  2JZP A;  3EFU A;  3KWV A;  2L8J A;  1ZW7 A;  4NNJ B;  3VFK A;  1JAL A;  4EZJ A;  3AE5 B;  3R7R A;  2KLG A;  1WGY A;  3FC4 A;  4AOF A;  4WWM A;  3WAM A;  1DOI A;  2RMM A;  3OAW A;  2IO1 B;  2Y5P A;  4OW0 A;  5DPR A;  2UWQ A;  3AN1 A;  4FLH A;  3A1Q A;  2M4N A;  3I5J C;  4J3O D;  2GRI A;  2LHD A;  2PE9 A;  3KH0 A;  2WXK A;  5JHB A;  3T3N A;  3HM3 A;  1GB4 A;  2JPH A;  2V9H A;  4IWO A;  1S3S G;  2GBR A;  2NCN A;  1NDD A;  1CMX B;  2PIA A;  3HVD A;  3WA0 A;  4G3X B;  2BT6 A;  2PW9 A;  1D4B A;  1C76 A;  1JW9 D;  4TSS A;  3DBH I;  2OJW A;  4PS8 A;  1A70 A;  1M4V A;  2J42 A;  1I7H A;  5AZH A;  3N30 A;  2WXL A;  1ET9 A;  3QA8 A;  2R2O A;  1SE9 A;  4W9J A;  2KDB A;  4F7Z A;  4LNK A;  2LD9 A;  4H2A A;  3I9V 1;  3DOW A;  2NBV B;  1UF0 A;  1L5P A;  5IAA C;  4RGO S;  4LDT B;  2SEB D;  1WXS A;  1EUV B;  1NI3 A;  4AWJ A;  5JHA A;  5BYS A;  1WWT A;  5EDS A;  3GZN B;  4RM8 A;  1HE8 A;  4HLE A;  1MFW A;  3AEG B;  2G4S A;  2MBH A;  2KDE B;  2L00 B;  4G0N B;  5EE9 A;  2SAK A;  2HE7 A;  1K52 A;  3NVY A;  1HZ5 A;  2HTM E;  3IXS A;  2BWE S;  4WQO B;  1V80 A;  1E8W A;  2LEK A;  3MC0 B;  2FNJ B;  2C7N B;  1QOG A;  3VH4 B;  2XEW A;  2D3B A;  5BMI A;  1JRP A;  4ZHO A;  2Z0E B;  3ML9 A;  3CF6 E;  3I63 C;  3GZN I;  4KKI A;  2M1M A;  3IAS 1;  1WE7 A;  2M17 A;  3RNF C;  4JLC A;  2GBJ A;  4JIO U;  4KGT A;  4DBG A;  3ABV B;  1N63 A;  4LNI A;  5CHW A;  3O65 B;  4EE2 A;  3V60 A;  4K3C A;  3UQB A;  3FAH A;  2X38 A;  4CO7 A;  4DWF A;  3M63 B;  4RF1 A;  2IPK D;  2VH1 A;  4ZRI A;  2KNB A;  4F1S A;  1C3T A;  2DZK A;  1TS2 A;  3P1M A;  3K9P B;  1T3Q A;  2KDF B;  1OQQ A;  1YN4 A;  1UWM A;  1FNU A;  1XLN A;  3DPD A;  3IT6 B;  2LFI A;  5C23 A;  4KGR A;  2KWD A;  4ARI A;  1M94 A;  4OZC A;  1TKE A;  1WY8 A;  3ZNH B;  1EU3 A;  2J0M A;  2JX5 A;  3ONS A;  1FXA A;  2QDF A;  2FUH B;  2ASQ A;  1E5W A;  3V61 A;  2QIE B;  1X1M A;  2QJL A;  2MHJ A;  4TV3 A;  4QAY A;  1KH0 A;  4K81 A;  1WGH A;  1WZ3 A;  4XZ4 A;  2MH7 A;  2RR9 A;  3A9J A;  3ZNI D;  2KC2 A;  4FA6 A;  1WSP A;  3BWU D;  3PLV A;  4WH4 A;  2G9H D;  3Q3F A;  2M0A A;  3NUH B;  2WLB A;  4DXA B;  2RD0 A;  2ZW0 A;  2WNM A;  2KVR A;  2JZ3 B;  5LNK 1;  1MG4 A;  4K7U A;  3Q8B A;  1AAR A;  3ZVV A;  5E6O A;  2D2Q A;  4GDL A;  1DGJ A;  2KJ6 A;  2MBQ A;  2WU5 B;  2DYO A;  1WMH A;  3APC A;  3MFG A;  3PRE A;  3E56 A;  4LLG M;  1TYG B;  2EKE C;  3QAR A;  2ZCB A;  4LDT D;  1YQ4 B;  2KAJ A;  3HVZ A;  1V6E A;  2HD5 B;  3NZ3 A;  4RNA A;  4ANU A;  3PZ7 A;  2HJ1 A;  4K1R B;  4MH0 E;  3OJ4 B;  1CK1 A;  1VZ8 A;  2DNF A;  1JRU A;  4MH8 A;  2OOB B;  2WXP A;  1E8X A;  1OQR A;  2LGD A;  3O13 A;  1UD7 A;  2KAN A;  1E6E B;  1FNV A;  2GB1 A;  4HK2 A;  2BKR B;  1SIJ A;  2WDT B;  5LLI A;  3APF A;  1V97 A;  1NI2 A;  2DZM A;  3BII D;  1P7E A;  4L23 A;  3A9J B;  3Q2A C;  4HKZ E;  1P3Q U;  1FCC C;  4O1N A;  2XNA C;  3ZNG C;  2N0S B;  4BOZ B;  4YTN B;  2MEK A;  4AJW A;  3L10 B;  1V5T A;  1RAX A;  5JH5 C;  5HFY A;  1GAQ B;  3AU5 A;  4GDL B;  1WMH B;  4ICV A;  1J7C A;  3JSV A;  1WFY A;  4HDQ A;  4MDK E;  2WDQ B;  5H92 C;  3PZ8 A;  4KIK A;  3DVN V;  1D6E C;  1YX6 B;  1WX7 A;  2NBU A;  1HTQ A;  2HDE A;  2KDI A;  2KVZ A;  2GLS A;  1QZE A;  1I4X A;  2ICI A;  4DXG A;  5CHV C;  3NVW A;  1WJU A;  1E8Z A;  3NRZ A;  1LQB A;  3OJ3 A;  3VAW A;  4K3B A;  1P7F A;  3VTV A;  3UGB B;  2CR5 A;  2QC8 A;  1YX5 B;  3W1S A;  3EUB 2;  3ZIM A;  2N4F A;  2DYM A;  4C00 A;  2KTF A;  1J7B A;  3LXF A;  2LAS A;  3MTN B;  3T8M A;  2DBY A;  4OVU A;  2XBB C;  3P4P B;  1I42 A;  2V1Y A;  1YJI A;  3PLU A;  5CX3 A;  1VCB A;  4RFB A;  4IWP A;  2LGY A;  2XK5 A;  3DBS A;  1WF9 A;  1PUT A;  1JCK B;  3B0A A;  2YEP F;  2BYF A;  3C0R B;  3PZD A;  4IW0 A;  3I57 A;  2K8H A;  3GOE A;  5IKC M;  5BO4 B;  2OHF A;  2K25 A;  2ON8 A;  1WXA A;  2LUM A;  3H6N A;  2KFK A;  1JWS D;  3RZW C;  3AB5 A;  4FBJ B;  3BVG A;  4PYZ A;  3JSV B;  4N9F 4;  1H8C A;  2KQS A;  3BZD B;  1FEH A;  3KYD D;  3MJ5 A;  4OZA A;  4W9E A;  3RFZ B;  3Q3O C;  2K9X A;  4KIK B;  4ARC A;  4N6E B;  3M62 B;  2ZZP B;  2CS4 A;  5HKH A;  1WYW B;  3WAL A;  2TSS A;  3A4R A;  5EE1 A;  3CIR B;  3NY5 A;  3HHM A;  1C9F A;  2PE6 B;  2J0K A;  3TEX A;  5DPW A;  2K0P A;  3N1Y C;  4BBN C;  3VR8 B;  2W9N A;  3NG0 A;  1EO6 A;  2K8C A;  3B2F A;  3PPA A;  4AUQ C;  4NY0 A;  1T6B X;  1T0Q C;  1V1P A;  1WRI A;  1Z2M A;  4BZA A;  4JX1 C;  3U52 E;  1WZ0 A;  1I4R A;  4XE0 A;  2H88 B;  1Q5W B;  4AJY B;  1H4R A;  3FIL B;  4WJN A;  4B0M A;  1SB3 C;  2R61 A;  3JW0 X;  1R4N B;  3SDL C;  3MHS D;  1L0V B;  3RMK C;  1F52 A;  4PS7 A;  3DDC B;  1WRD B;  4FN2 A;  1MG8 A;  1FCL A;  1N62 A;  2KFK B;  2CKH B;  2Y3A A;  2ZVN A;  3C8Y A;  1FMA D;  4NPN A;  2G45 B;  2KN5 A;  2D10 A;  2ZW1 A;  3MJW A;  1IP9 A;  3P42 A;  4EZL A;  2MA9 B;  3AV8 A;  1FIQ A;  2LGI A;  1JWU D;  1WYG A;  4FUL A;  1YNT E;  3PRZ A;  5FR6 A;  2N7D A;  3D32 A;  4MSQ B;  1WH3 A;  2IBI B;  1R4N I;  2KN4 A;  4YTP B;  2ONQ A;  1WX8 A;  3V05 A;  1FRR A;  2FBW B;  1K8R B;  3EHV A;  1D3Z A;  5IO9 A;  3ZO5 B;  1L2N A;  4KDL B;  3LJ3 A;  3H1U A;  3P4R B;  4XC2 A;  4BBN F;  2WWZ A;  2BF8 B;  1V1P B;  3LYY A;  2KJR A;  3H7P A;  4KSL C;  3RZF A;  3MC9 A;  2PKO A;  1XCT L;  2N1V A;  1TKG A;  4KGS A;  3R7Q A;  4F8C B;  1WGG A;  4JQW C;  3URY A;  1UBQ A;  4IM3 A;  1PQS A;  3QC8 B;  3RNG C;  2KAC A;  1XXG A;  4BFR A;  1KLU D;  5AZF A;  3L08 A;  3VR9 B;  4KDI C;  2I1J A;  1E7V A;  1LO5 D;  2L0T A;  2V4I B;  4OVV A;  1F2R C;  1TT5 B;  2INC C;  1RFA A;  3DBH B;  4EEW A;  2IGG A;  3M3J A;  1TBE A;  1FFV A;  1GPX A;  2W3R A;  4K7S A;  1I4P A;  1ZP0 B;  3BVM A;  5JZE B;  2QHO A;  2WXR A;  1CJE A;  3HK0 A;  2ACZ B;  1J0G A;  3IAM 1;  2Q5W D;  1N60 A;  3MHZ A;  3TSS A;  4WJQ A;  3EEC A;  2MP2 A;  4W9H A;  1XF5 L;  3L4P A;  2UYZ B;  5L83 A;  4S0R A;  4XWW A;  2INP E;  1STE A;  1SSN A;  2K22 A;  3H7P B;  3IG3 A;  1SF0 A;  4GGQ A;  4KZ0 A;  2E3T A;  2Z0D B;  3Q3M C;  2MWS B;  1WJ4 A;  4DHJ B;  3ZRF A;  2GBN A;  3ZDM C;  4HDO A;  3VRA B;  2DYB A;  1LXD A;  3H9D A;  1WM2 A;  1NEN B;  2K3U A;  4Q2J A;  2L83 A;  2KD0 A;  2AYO B;  4IWQ A;  4NZL B;  3SEB A;  1QOA A;  3RT3 B;  4DQO C;  2IND C;  4MGZ E;  1JWB D;  2IO0 B;  2QEJ C;  3Q14 C;  4HPP A;  3U8Z A;  2NMQ A;  3HIZ A;  4IC7 B;  3KLS X;  5IP4 D;  3ZKJ C;  1C4P A;  2HJ8 A;  5D3I B;  1WE6 A;  2MJ3 A;  3IFW B;  1E8Y A;  3AU4 A;  1IBX A;  3BVZ A;  1FXT B;  4LCD E;  3DHG C;  4OVZ A;  3V3X A;  2LMC A;  2KMC A;  1J7A A;  4EOY A;  4D2K A;  1V81 A;  2MP2 B;  3EA6 A;  4WAA A;  3P4S B;  3N1X C;  2KWC A;  3QCA A;  4EFO A;  1SE3 A;  2K1F A;  5AZG A;  2K39 A;  4M02 A;  1J19 A;  4ZHP A;  1VLB A;  2QIL A;  1UWX A;  1XEE A;  3QWZ B;  2WXJ A;  3U7D A;  5FR3 A;  2LJ5 A;  1V49 A;  3PS6 A;  2D5G A;  5G55 A;  3AE7 B;  3PV1 A;  1ZE3 D;  2X8X X;  1T0R C;  1QF6 A;  3A9K A;  2IY0 B;  2CJN A;  2DLB A;  2ZJD A;  1ROE A;  3AI5 A;  3P2B A;  3UIO B;  2O2V A;  1WXQ A;  4I6P A;  4TQ1 A;  1VD2 A;  4LK0 M;  3KQ4 A;  2DX5 B;  3RYT A;  1V86 A;  1F0Z A;  2CHZ A;  1SE2 A;  1XD3 B;  1JRO A;  3V6E B;  5J17 A;  3U4E G;  1YQ3 B;  2RSU A;  2BB6 A;  1IBX B;  4RH6 A;  5H8Y E;  1ACC A;  2FCM A;  3R3M A;  3BIN A;  3DWG C;  2KKC A;  4LNO A;  2BS4 B;  4DHJ D;  1P1A A;  3ZXR A;  5G5H A;  4C56 C;  4USA A;  3Q8E A;  5G2N A;  1B9R A;  3B1L X;  2JQR B;  2K6Q A;  4XWT A;  1GC7 A;  2FCS A;  4FJV B;  4KVG B;  1C4A A;  4FXC A;  3TIX A;  2M56 B;  4ZDV A;  2NTT A;  2BYV E;  1AWD A;  3NZU A;  3L54 A;  3V6C B;  2EEL A;  1FRD A;  4MGI E;  3A33 B;  1PDX A;  1QLB B;  3A9K B;  2BWF A;  4HEA 1;  1WIA A;  3VUW A;  1ESF A;  2O2V B;  3X23 A;  2MBO A;  3KUD B;  3SD5 A;  3SU8 X;  3AE3 B;  1G6J A;  1WM3 A;  2JRH A;  4I6N B;  3AE6 B;  4WJP A;  2DAF A;  4GLS C;  1I4G A;  3N1Z C;  1A5R A;  1HXY D;  3RUI B;  2FCQ A;  4W9G A;  2L05 A;  1Z5S B;  1E9M A;  3I3T B;  4RCO A;  1CZP A;  3N20 C;  3SFD B;  3SFE B;  1FFU A;  4YXD B;  2Y5B B;  4YTM B;  3ZTC A;  4DXF A;  4C4V A;  3KW5 B;  2E6X A;  3WIM A;  1RM6 C;  2KQ7 A;  3P63 A;  2CHX A;  3NVV A;  2BGF A;  2MCN B;  4MGK E;  4XX5 A;  2KXJ A;  2EMS A;  1V9J A;  1IGD A;  3DWM A;  4FHK A;  1JQ4 A;  4PS3 A;  2Z59 B;  1Q0W B;  2PVG C;  3PGE A;  3PRP B;  3ZQ4 A;  1F1H A;  5IN7 A;  1YD8 U;  3S2A A;  3P4Q B;  2J0J A;  3OLM D;  2CJO A;  1XLQ A;  3PTF C;  2AQ2 B;  4ANW A;  1PGB A;  2PTL A;  1GG3 A;  4W9I A;  2PJH A;  4J6I A;  2LRW A;  1L4D B;  1V2Y A;  2YVC A;  1QIL A;  2L76 A;  3K9O B;  2C7M B;  1OEY J;  3FKY A;  3Q3J A;  4ACF A;  1DYQ A;  2JYE A;  1XLO A;  1EWC A;  4RGM A;  2WXN A;  4EKU A;  3W1Y A;  3WAN A;  2HTH A;  4G50 A;  5E6N A;  3ZRC A;  4GIV A;  3GB1 A;  3LB8 C;  4GSW A;  2KYW A;  5HI1 A;  1EF1 A;  4CHK A;  2DWQ A;  4NJC A;  1XQQ A;  2A4Z A;  3FIL A;  2YEP B;  2W54 A;  3RD2 A;  2C7H A;  1NYQ A;  3VQI A;  2JSV X;  3RUL A;  3ZUN A;  3JYU A;  2D3G A;  4XYC A;  1HEZ E;  3ZW3 A;  4HPM B;  3B9J A;  2NS5 A;  1E7U A;  5AUI A;  1F77 A;  4C4V B;  2MX2 A;  3QQ8 B;  1QT9 A;  1N5W A;  4KKJ A;  3KYC D;  2BPS A;  1UEL A;  3NVZ A;  3QJZ A;  3TJP A;  4M8N A;  5HHD G;  2BB5 A;  2JF5 A;  3M95 A;  2EMT A;  4PT5 A;  5G5G A;  2LUE A;  1WJN A;  4BAX A;  3TMP B;  4MT5 A;  3CSF A;  4B0E A;  3T9L A;  1C1Y B;  1VJK A;  2MBE A;  2KQ4 X;  4NQK E;  4HRS A;  1FXI A;  4W9D A;  4NAW A;  5LXH A;  4ITK A;  4ZRP A;  4WWO A;  1MPE A;  5KHO A;  2ZNV C;  4LJO B;  5TR5 A;  1ZOY B;  3PHX B;  4IM2 A;  2LXC A;  3SR6 A;  2OJR A;  3KUC B;  1WGK A;  5LXI B;  2KC1 A;  1IGC A;  4RM9 A;  1CQV A;  5D6J B;  4A90 A;  1RLF A;  3Q8C A;  3APD A;  2BS3 B;  2REX A;  1T0Y A;  4URK A;  1KLV A;  3H8H A;  4OZB A;  2W55 A;  3U2S C;  1TTN A;  3R66 C;  1E7P B;  1LFD A;  3PSE B;  2IO2 B;  2IYD B;  3B08 A;  2KTR A;  1KTK A;  3NJT A;  3KUZ A;  1K53 A;  4HRO A;  2LJI A;  2L0F A;  2BQQ A;  1K51 A;  3AXC A;  3L13 A;  3TBL D;  1YIW A;  3IT4 B;  3CMM B;  1SJH D;  3DBL B;  2JWZ A;  3H7S A;  1FO4 A;  1LGR A;  5EE3 A;  1ENF A;  1VRA B;  4W9C A;  3N9Y C;  4TUU A;  3RN9 C;  4B6W A;  2INN E;  1Q1O A;  1MVK A;  2LI5 A;  1E10 A;  3ZJU A;  1L7Y A;  3ML8 A;  1V5O A;  4YWG G;  4KV2 A;  2ZCC A;  4NAW B;  1OFF A;  5T8I A;  1XT9 B;  3QIJ A;  2ZPY A;  5D2M B;  4NQL B;  1J8C A;  3VUX A;  1S1Q B;  3DBR B;  5CTR C;  4A20 A;  1KFY B;  2FCN A;  3DBL I;  3Q8A A;  4IM0 A;  4LNN A;  1YJJ A;  2I2Y A;  4HXD A;  4TMA B;  3RI7 C;  4S17 A;  2BYT A;  2K5P A;  3RNC C;  2KWU B;  1UNS A;  1IYF A;  5MPO A;  1SBB B;  1D5X C;  1P0R A;  2JVC A;  2KTR B;  3WAP A;  1WGR A;  2FUG 1;  3TCA A;  1YN5 A;  4X57 B;  4ASW C;  1JWM D;  1RRB A;  1BUI C;  1XCQ L;  2G3Q B;  3AUL A;  3ZYY X;  1PFD A;  3E9S A;  1MI0 A;  5C1Z A;  4P16 A;  3DBR I;  2GMI C;  1N5X A;  2RDB C;  2IGH A;  3Q69 A;  2ZPN A;  2KLC A;  2B76 B;  2LRU A;  1EWY C;  3RNB C;  1NEK B;  1VDV A;  1QKZ A;  1D5Z C;  3VTW A;  2AQ3 B;  2PMV A;  4WUR A;  5C2T B;  2RPV A;  1NBF C;  3TEW A;  1YJ1 A;  2BW2 A;  4HKQ A;  4NJ7 A;  4P1B C;  1IPG A;  3RNE C;  2QSD A;  5D3D A;  4WWP A;  2WQY B;  3BK2 A;  2H89 B;  3R2I A;  2C9W B;  3AEA B;  4IOI E;  2WGS A;  2IO3 B;  2D3A A;  2IY1 B;  3VUY A;  2M0X A;  1JWA D;  2KX0 A;  1WX9 A;  4K7W A;  4P1C C;  5HG2 A;  5GMV A;  4GN1 A;  4N58 A;  2ZEQ A;  4GOC A;  2LVP A;  2MW5 A;  2CU3 A;  4JWS C;  2D07 B;  2IZV B;  3DQV A;  3WCQ A;  4BOS C;  4IDI A;  3AE8 B;  4HCN B;  4ZYS A;  2FE8 A;  2EKI A;  2PLP A;  2D11 A;  1T5X D;  1P9D U;  1C4C A;  2B3A A;  2JXT A;  5DPS A;  4YL8 A;  4FHJ A;  4LNF A;  1MJD A;  1GUA B;  1YOV B;  4L2Y A;  3ETR A;  2Z8L A;  2M19 A;  4P7I A;  1F9J A;  3AED B;  4YSZ B;  2N7E A;  5IA7 A;  2MJD A;  2WU2 B;  1GJZ A;  3ZNZ B;  1KOT A;  4MAC A;  2JT4 B;  4OHJ A;  3DVG X;  4KSK C;  1R4M B;  1FM0 D;  2L3Z A;  2IGD A;  2WXI A;  5GXG B;  1QQR A;  2BYE A;  1L6U A;  2KDM A;  2QMT A;  2NTS A;  1NVI D;  4GU2 A;  2N1W A;  2A5U A;  4YSY B;  1OEY A;  4MSM B;  3TL5 A;  4MGY E;  3SHQ A;  3VTU A;  2PEA A;  3UQA A;  4W9L A;  4YT0 B;  4RF0 A;  2O6V A;  3MC8 A;  4REZ A;  2CU1 A;  1GOZ A;  1TGZ B;  3ALB A;  2KK8 A;  4CYE A;  1TS4 A;  4B9K A;  2I1K A;  1C77 A;  3ZTD A;  1R4M I;  2WXO A;  5BYQ A;  4R3D A;  1KF6 B;  3TEZ A;  3A1Q B;  4I6L B;  1WI0 A;  2WS3 B;  1F2R I;  3J9C A;  1TY2 A;  2KZR A;  4B95 A;  2G4D B;  2NBW B;  4JPS A;  4HWI B;  1BXT A;  3BY4 B;  4FJZ A;  1KLG D;  3VHT C;  2G1E A;  3W5U B;  1IUE A;  1N61 A;  1VZ6 A;  4ZRJ A;  1NYR A;  2N9X A;  3ZLZ A;  3T3O A;  3AE9 B;  1WJ6 A;  4XDC A;  2GBM A;  2MSE D;  4E71 A;  3PRM B;  5CHF A;  1ZXH A;  4WWN A;  1QOB A;  3U30 A;  4C7Z A;  2J53 A;  2LZ6 A;  1PGA A;  2LGX A;  3PHW B;  2RGF A;  4FAD A;  3ZJV A;  2MLB A;  2KFJ A;  3ZXV A;  4BKG A;  1QOF A;  1DOX A;  4HJG E;  1SIF A;  2FAZ A;  1L6V A;  2LXA A;  1ZUD 2;  3RPF C;  4M00 A;  2V3P A;  4GDK A;  2JWU A;  3WAO A;  4E74 A;  1LM8 B;  2BTE A;  2DZJ A;  2WHI A;  2VRR B;  3UIP B;  4C80 A;  2FID A;  4GMV A;  5L95 C;  3DCG A;  1BT0 A;  3AMZ A;  2WX1 A;  2J52 A;  3W2D A;  5AUK A;  4II2 B;  4II3 B;  4MEL A;  2O6V B;  2V4L A;  3N3K B;  4BKT A;  3R2T A;  2V3N A;  3RCZ A;  1HA5 A;  3LDZ E;  3C19 A;  1ZXI A;  3AEF B;  1DOY A;  4IG7 B;  2N7J A;  3GP7 A;  3Q8F A;  1TKY A;  1YQB A;  2Y5C A;  1E0Z A;  4GB9 A;  3PVL A;  1Q10 A;  4KX6 B;  2MRP A;  3AH7 A;  4IKG A;  3DVN U;  3HRD D;  1UGM A;  4A6Q A;  3UI3 A;  3Q3N C;  4DHZ B;  5I4D A;  2V3S A;  1OGW A;  2GI9 A;  5KHQ A;  4TKN A;  2K6D B;  4RGN A;  3NS1 A;  1TS5 A;  1B1Z A;  4TQ0 A;  2JUO A;  1XLP A;  4A9A A;  2C60 A;  2WXH A;  2JY6 A;  2K8B A;  4BKS A;  4DHZ E;  2N9E B;  2ZVO A;  4WIP A;  3BYY B;  3RNA C;  3HUI A;  2MBB B;  3OG5 A;  5AEK B;  3TEY A;  5BMH A;  1V8C A;  2AQ1 B;  2D3C A;  1MHH E;  2WP9 B;  4MEM A;  1VZ7 A;  3L17 A;  1YMH E;  1OTR B;  4GDK B;  2L32 A;  2M8S A;  4FJY A;  2AL6 A;  2NPT A;  1SXT A;  2WX0 A;  4A3P A;  2PVO D;  3Q6B A;  4M0W A;  2LVQ A;  1ZDX A;  4YSX B;  3DHH C;  5C3J B;  1MHX A;  3CWI A;  4LTU A;  5BYR A;  4HJK A;  4IUM B;  2BVC A;  1UH6 A;  1EU4 A;  4P6V F;  1UBI A;  1HZ6 A;  4EUT A;  1OQY A;  3N32 A;  2JZZ A;  2C5L C;  3OWE B;  4JWU C;  4E3C A;  2GBK A;  2WXQ A;  1KRH A;  1Y8R C;  2R2Q A;  1AN8 A;  1SEB D;  1N6Z A;  3L0W B;  3QX1 A;  5J2R A;  1ZPS A;  2GOW A;  2JU6 X;  2KOX A;  1I35 A;  4M01 A;  3KVF B;  4AQ7 A;  5E6P A;  4DDI D;  2L7R A;  2OED A;  2KWV B;  2MJE A;  5JXV A;  3B2G A;  3CST A;  4HVB A;  3GS2 A;  2IJ0 A;  2L1A A;  3AEE B;  2L52 A;  1TZO A;  1GNU A;  2VZK B;  4ZYN A;  1WR1 A;  4MJS A;  2O6V D;  1HQR D;  5TSS A;  2KX3 A;  2YLM A;  4A8X C;  3X0W A;  2KMM A;  1WXM A;  5DCN A;  4MM3 A;  2PPH A;  2JYT A;  4ANX A;  2NPT B;  1ET6 A;  5BMG A;  4M0W B;  3U7Z A;  3QK0 A;  1L4Z B;  4JE3 B;  3QHT A;  4ANV A;  1ZKH A;  4JL9 A;  3DVG Y;  4HPL B;  3W1S C;  2WXF A;  2J4X A;  3NS8 A;  2AL3 A;  3EFC A;  1WR6 E;  2AX5 A;  4AS1 A;  3ZDT A;  2MQJ A;  4WJO A;  1TJE A;  1R7S A;  4RGT A;  2I38 A;  3PT2 B;  1BML C;  1FPY A;  1VR9 A;  4LJP B;  3ZGZ A;  3KWL A;  2BS2 B;  3VDZ A;  1TY0 A;  1D5M C;  3V62 A;  4PYU A;  2NR2 A;  3IVF A;  4ZRK A; 
#chains in the Genus database with same CATH homology
 1V6E A;  2DEN B;  2HD5 B;  3AU4 A;  2KWU B;  2AEH A;  2LWP A;  1FXT B;  4ANU A;  3NZS A;  3VXW A;  4LCD E;  1IYF A;  1P0R A;  2JVC A;  2KTR B;  3WAP A;  4K1R B;  2KMC A;  3VH3 B;  1WGR A;  4MH0 E;  3TCA A;  4X57 B;  3OJ4 B;  4EOY A;  4ASW C;  1RRB A;  1V81 A;  2MP2 B;  3AUL A;  2G3Q B;  4GXB A;  4WAA A;  1KJT A;  2KWC A;  3QCA A;  5J18 A;  1JRU A;  4EFO A;  2OOB B;  2K1F A;  1P98 A;  5C1Z A;  5AZG A;  2K39 A;  3DBR I;  1SGH A;  2WYQ A;  1E8X A;  1ZGU B;  1J19 A;  2GMI C;  2LGD A;  4JGH B;  4G11 A;  1UD7 A;  2KAN A;  2ZPN A;  3NOB A;  4HK2 A;  2KLC A;  3QWZ B;  4MJS B;  2LRU A;  3U7D A;  2BKR B;  5D94 A;  2LJ5 A;  4KZC A;  5LLI A;  2WDT B;  1V49 A;  3L16 A;  3PS6 A;  5G55 A;  1WXV A;  3VTW A;  4EZK A;  3PV1 A;  3APF A;  2DAJ A;  1NI2 A;  2DZM A;  2KHW B;  3A9J B;  4W9F A;  1P3Q U;  1NBF C;  1YJ1 A;  2N9P C;  3ZNG C;  1GC6 A;  4NJ7 A;  3A9K A;  2IY0 B;  1IPG A;  4BOZ B;  2ZJD A;  3AI5 A;  3P2B A;  3UIO B;  4WWP A;  3L10 B;  2O2V A;  4AJW A;  1V5T A;  1RAX A;  1KM7 A;  4I6P A;  2C9W B;  5JH5 C;  3A4S C;  2NVU I;  4TQ1 A;  4HCP B;  2IO3 B;  1UZX B;  1VD2 A;  2FIF A;  2IY1 B;  3AU5 A;  4GDL B;  3VUY A;  1WGD A;  2M0X A;  4NJ6 A;  3UF8 A;  1WMH B;  1E90 A;  4ICV A;  2KX0 A;  3JSV A;  1WFY A;  4HDQ A;  4MDK E;  1WX9 A;  4K7W A;  5GMV A;  4GN1 A;  2DX5 B;  3RYT A;  4AP4 C;  2ZEQ A;  3VVW B;  1V86 A;  4GOC A;  2CHZ A;  1TZ1 A;  2LVP A;  2MW5 A;  1XD3 B;  2D07 B;  2IZV B;  3DQV A;  2XK5 B;  1YX6 B;  3DVN V;  4KIK A;  1WX7 A;  2NBU A;  3V6E B;  4BOS C;  4HCN B;  5J17 A;  4M8M A;  3NHE B;  2RSU A;  1EF5 A;  5DPT A;  2D11 A;  1P9D U;  2KDI A;  2B3A A;  5DPS A;  1QZE A;  3QAQ A;  4YL8 A;  4FHJ A;  4BKS D;  2FCM A;  3R3M A;  3BIN A;  2JXX A;  3HM6 X;  1GUA B;  5CHV C;  1WJU A;  1E8Z A;  2KKC A;  1LQB A;  3OJ3 A;  4P7I A;  3VAW A;  4A3O A;  1F9J A;  4DHJ D;  3VTV A;  3UGB B;  1P1A A;  3EC8 A;  2CR5 A;  2N7E A;  5IA7 A;  3W1S A;  1YX5 B;  2RPQ A;  4BVU C;  3ZNZ B;  1GJZ A;  1KOT A;  3ZIM A;  3UIN B;  2N4F A;  2DYM A;  5G2N A;  2BKF A;  2JT4 B;  3DVG X;  4KSK C;  2JRI B;  2ZNV B;  2KTF A;  3B1L X;  4DDG D;  2LAS A;  2K6Q A;  3MTN B;  1GC7 A;  2FCS A;  4FJV B;  4KVG B;  4W9K A;  2L3Z A;  3JVZ X;  3T8M A;  3IBE A;  2XBB C;  4OVU A;  2BYE A;  4RMA A;  1I42 A;  2V1Y A;  4GU2 A;  3TIX A;  3PLU A;  4ICU A;  2N1W A;  5CX3 A;  4ZDV A;  1VCB A;  2BYV E;  4IWP A;  2LGY A;  2XK5 A;  2A5U A;  3DBS A;  2KMA A;  1OEY A;  3NZU A;  1WF9 A;  3L54 A;  4MSM B;  3TL5 A;  4MGY E;  3SHQ A;  3V6C B;  3VTU A;  2PEA A;  3UQA A;  4W9L A;  4MGI E;  3A33 B;  3B0A A;  2O6V A;  2BYF A;  3C0R B;  3A9K B;  3PZD A;  4IW0 A;  2K8H A;  2BWF A;  2AWT A;  3GOE A;  2CU1 A;  5BO4 B;  1WIA A;  3VUW A;  1TGZ B;  2O2V B;  3ALB A;  2K25 A;  2LVO A;  1WXA A;  3H6N A;  2KFK A;  2MBO A;  2KK8 A;  3KUD B;  3X23 A;  4CYE A;  3RZW C;  4B9K A;  1U4A A;  2I1K A;  2CHW A;  4FBJ B;  3SD5 A;  3SU8 X;  2KJH B;  3ZTD A;  1G6J A;  1R4M I;  1WM3 A;  2JRH A;  4PYZ A;  4I6N B;  3JSV B;  4N9F 4;  1H8C A;  2KQS A;  3A1Q B;  3KYD D;  3ECI A;  4I6L B;  4W9E A;  4WJP A;  5D7G A;  1WI0 A;  2DHZ A;  2DAF A;  1ISN A;  1A5R A;  2KZR A;  4KIK B;  4B95 A;  2G4D B;  3M62 B;  2NBW B;  4HWI B;  2ZZP B;  3IHP C;  2CS4 A;  3BY4 B;  4FJZ A;  2J7Q B;  5HKH A;  2KO3 A;  3VHT C;  1WYW B;  3RUI B;  2FCQ A;  4W9G A;  2DZI A;  2L05 A;  1Z5S B;  3WAL A;  3ENE A;  3A4R A;  4DK5 A;  4ZRJ A;  2N9X A;  3I3T B;  3ZLZ A;  3NY5 A;  3HHM A;  1WJ6 A;  2PE6 B;  2J0K A;  3EFU A;  5DPW A;  2GBM A;  2L8J A;  2MSE D;  4BBN C;  4E71 A;  1ZW7 A;  3PRM B;  2W9N A;  4WWN A;  5CHF A;  1EO6 A;  2Y5B B;  3U30 A;  2K8C A;  4NNJ B;  3VFK A;  4EZJ A;  2LZ6 A;  3PPA A;  4AUQ C;  3R7R A;  2KLG A;  4NY0 A;  1WGY A;  3ZTC A;  2LGX A;  3PHW B;  4AOF A;  2RGF A;  4FAD A;  3KW5 B;  2MLB A;  3WAM A;  2KFJ A;  4BKG A;  3OAW A;  3WIM A;  2IO1 B;  2KQ7 A;  5DPR A;  1Z2M A;  2CHX A;  1SIF A;  2FAZ A;  2UWQ A;  4FLH A;  2BGF A;  2MCN B;  4MGK E;  2LXA A;  2KXJ A;  2EMS A;  4XX5 A;  3A1Q A;  2M4N A;  1WZ0 A;  1V9J A;  3IVF A;  4GDK A;  3WAO A;  4E74 A;  1Q5W B;  1LM8 B;  2DZJ A;  4FHK A;  2VRR B;  2Z59 B;  4PS3 A;  4AJY B;  3UIP B;  1H4R A;  2FID A;  1Q0W B;  4GMV A;  3PGE A;  4WJN A;  3DCG A;  5L95 C;  3PRP B;  1BT0 A;  2WX1 A;  2PE9 A;  3JW0 X;  1YD8 U;  3KH0 A;  5JHB A;  3S2A A;  3HM3 A;  4II2 B;  4II3 B;  2J0J A;  3OLM D;  4MEL A;  3SDL C;  2JPH A;  3MHS D;  2O6V B;  2V4L A;  3PTF C;  4IWO A;  1S3S G;  2GBR A;  2NCN A;  1NDD A;  3N3K B;  4BKT A;  1CMX B;  4ANW A;  4PS7 A;  3RCZ A;  3DDC B;  3WA0 A;  3LDZ E;  1GG3 A;  1WRD B;  1MG8 A;  4FN2 A;  4G3X B;  4W9I A;  2KFK B;  2PJH A;  4IG7 B;  3ZVV A;  4J6I A;  2LRW A;  1YQB A;  2CKH B;  2ZVN A;  4GB9 A;  1V2Y A;  2YVC A;  3DBH I;  2L76 A;  3K9O B;  3PVL A;  2C7M B;  4NPN A;  4PS8 A;  1OEY J;  2G45 B;  2KN5 A;  2D10 A;  3Q3J A;  2MRP A;  3MJW A;  1IP9 A;  4EZL A;  2MA9 B;  3DVN U;  5AZH A;  1UGM A;  3N30 A;  4EKU A;  4FUL A;  4DHZ B;  2V3S A;  3PRZ A;  3QA8 A;  1OGW A;  3W1Y A;  5KHQ A;  5FR6 A;  4TKN A;  2K6D B;  1SE9 A;  2N7D A;  2R2O A;  2KDB A;  3D32 A;  4MSQ B;  4W9J A;  2HTH A;  3WAN A;  4G50 A;  1WH3 A;  4F7Z A;  5E6N A;  3ZRC A;  4GIV A;  2IBI B;  4GSW A;  1EF1 A;  1R4N I;  2LD9 A;  4CHK A;  1WX8 A;  3EHV A;  1XQQ A;  1K8R B;  2A4Z A;  1D3Z A;  3DOW A;  3ZO5 B;  2NBV B;  1L2N A;  3RD2 A;  4TQ0 A;  2JUO A;  2C7H A;  5IAA C;  3RUL A;  3VQI A;  4LDT B;  3JYU A;  3ZUN A;  4KDL B;  3LJ3 A;  1WXS A;  2C60 A;  2D3G A;  1EUV B;  3H1U A;  4AWJ A;  5JHA A;  4XC2 A;  4HPM B;  2JY6 A;  2K8B A;  3ZW3 A;  4RM8 A;  1HE8 A;  4BBN F;  2WWZ A;  2NS5 A;  4HLE A;  1E7U A;  4BKS A;  2G4S A;  2BF8 B;  2MBH A;  2MX2 A;  3QQ8 B;  2KDE B;  2N9E B;  2ZVO A;  4DHZ E;  2L00 B;  2KJR A;  3H7P A;  4G0N B;  2MBB B;  5AEK B;  2HE7 A;  3KYC D;  4KSL C;  3RZF A;  2BPS A;  1UEL A;  3QJZ A;  3TJP A;  4M8N A;  2BWE S;  2N1V A;  4WQO B;  4MEM A;  1V80 A;  2JF5 A;  3M95 A;  1E8W A;  2EMT A;  3L17 A;  1OTR B;  4GDK B;  3R7Q A;  2M8S A;  2LUE A;  4FJY A;  2AL6 A;  2NPT A;  2WX0 A;  1WJN A;  2FNJ B;  4F8C B;  3TMP B;  1WGG A;  2C7N B;  3CSF A;  4A3P A;  4JQW C;  3T9L A;  1C1Y B;  2MBE A;  3VH4 B;  2XEW A;  1UBQ A;  2LVQ A;  4NQK E;  4IM3 A;  4W9D A;  2Z0E B;  1PQS A;  3ML9 A;  3QC8 B;  3CF6 E;  4NAW A;  5LXH A;  4HJK A;  4IUM B;  4WWO A;  4BFR A;  5AZF A;  3L08 A;  1UH6 A;  3GZN I;  5KHO A;  2M1M A;  2ZNV C;  1WE7 A;  1UBI A;  4KDI C;  4LJO B;  2M17 A;  2I1J A;  1OQY A;  3PHX B;  3N32 A;  4IM2 A;  5TR5 A;  1E7V A;  2LXC A;  4EUT A;  2JZZ A;  2C5L C;  4JLC A;  2GBJ A;  2OJR A;  3KUC B;  4JIO U;  2L0T A;  4DBG A;  4OVV A;  5CHW A;  4E3C A;  2GBK A;  3O65 B;  5LXI B;  2KC1 A;  3V60 A;  4EEW A;  1RFA A;  3UQB A;  1Y8R C;  3M3J A;  1TBE A;  4RM9 A;  2R2Q A;  4CO7 A;  4DWF A;  3M63 B;  5D6J B;  1RLF A;  3APD A;  4K7S A;  2REX A;  3L0W B;  1T0Y A;  3QX1 A;  4URK A;  1KLV A;  4ZRI A;  5J2R A;  1TTN A;  2KNB A;  4F1S A;  5JZE B;  2GOW A;  2QHO A;  3R66 C;  1C3T A;  2DZK A;  1LFD A;  2KOX A;  2IO2 B;  3PSE B;  3HK0 A;  1I35 A;  2IYD B;  3B08 A;  2KTR A;  1J0G A;  3K9P B;  3KVF B;  5E6P A;  4DDI D;  2KDF B;  4WJQ A;  3KUZ A;  2L7R A;  3EEC A;  2L0F A;  2MP2 A;  2KWV B;  4W9H A;  3CST A;  3DPD A;  4HVB A;  5C23 A;  2UYZ B;  3AXC A;  5L83 A;  3L13 A;  3TBL D;  1M94 A;  1YIW A;  3CMM B;  1WY8 A;  3ZNH B;  1GNU A;  2J0M A;  4ZYN A;  3H7P B;  3IG3 A;  3ONS A;  1WR1 A;  2JWZ A;  2FUH B;  3H7S A;  4GGQ A;  4MJS A;  2ASQ A;  2O6V D;  1E5W A;  4KZ0 A;  3V61 A;  2Z0D B;  2KX3 A;  2MWS B;  1WJ4 A;  1X1M A;  4DHJ B;  4W9C A;  2GBN A;  3ZRF A;  2YLM A;  5EDS A;  4TV3 A;  3X0W A;  1WXM A;  5DCN A;  4MM3 A;  4TUU A;  3ZDM C;  2PPH A;  4B6W A;  1Q1O A;  4HDO A;  2NPT B;  4ANX A;  2DYB A;  4K81 A;  1WGH A;  1WZ3 A;  1LXD A;  4XZ4 A;  2RR9 A;  2LI5 A;  3A9J A;  3ZNI D;  2KC2 A;  3H9D A;  4M0W B;  4FA6 A;  1L7Y A;  1WM2 A;  3QK0 A;  3PLV A;  3ML8 A;  3Q3F A;  3QHT A;  4DXA B;  2RD0 A;  1ZKH A;  4JL9 A;  1V5O A;  4ANV A;  2KD0 A;  2KVR A;  2AYO B;  4IWQ A;  4KV2 A;  3DVG Y;  4HPL B;  2ZCC A;  3W1S C;  2JZ3 B;  4NAW B;  3RT3 B;  3NS8 A;  1XT9 B;  3QIJ A;  2AL3 A;  4K7U A;  2ZPY A;  4MGZ E;  1WR6 E;  2IO0 B;  1AAR A;  3ZDT A;  5E6O A;  2D2Q A;  2MQJ A;  4GDL A;  4WJO A;  2KJ6 A;  2MBQ A;  5D2M B;  2DYO A;  4NQL B;  1J8C A;  1WMH A;  3APC A;  1S1Q B;  3PT2 B;  3U8Z A;  3VUX A;  3HIZ A;  5CTR C;  4A20 A;  4IC7 B;  3PRE A;  2FCN A;  3DBL I;  4IM0 A;  4LJP B;  3ZKJ C;  3VDZ A;  2HJ8 A;  2EKE C;  4HXD A;  3QAR A;  2ZCB A;  3V62 A;  4LDT D;  1WE6 A;  4PYU A;  3IFW B;  2NR2 A;  1E8Y A;  4ZRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...