2N1VA

Solution structure of human sumo1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human SUMO
rcsb
source organism Homo sapiens
molecule tags Structural genomics
molecule keywords Small ubiquitin-related modifier 1
total genus 16
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2015-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2n1vA00
3PLUA 2PPHA 4IM0A 4GDKA 2A5UA 4JLCA 3RZFA 5CHVC 3QAQA 4WWNA 4FJYA 4JGHB 2KMAA 5CHFA 3UF8A 2DENB 3EHVA 4BOZB 3ZIMA 3SDLC 1WGRA 1RFAA 4GDKB 1WF9A 4HDQA 2FIFA 2ZVOA 2MBHA 1ZW7A 1QZEA 5D94A 2FCNA 2KOXA 5D6JB 1ISNA 4DDID 3QK0A 1WJ6A 4EZJA 4GDLA 4FHKA 1WM2A 3HK0A 2NVUI 3M95A 3TL5A 1S3SG 4GOCA 4K7UA 2LXCA 2MA9B 3C0RB 4WJPA 4CYEA 2OOBB 1GC6A 1XT9B 2G3QB 3V62A 1GC7A 1E7VA 2EKEC 2NPTB 4GDLB 4F1SA 1XQQA 4HXDA 4WWOA 4JQWC 4WJNA 4IWQA 2CU1A 1Q5WB 3DBRI 1WMHA 3VQIA 3VUXA 1X1MA 1S1QB 4W9HA 2I1JA 3V6EB 3TJPA 4XZ4A 4BKSA 4OVVA 2A4ZA 3AU5A 2L00B 4FJVB 2J0MA 3A4SC 3NZUA 2O2VB 2KN5A 2DX5B 2CHZA 3KVFB 2J0JA 4WJQA 3A4RA 5DCNA 4FADA 3HHMA 4BOSC 3DVGY 3QX1A 1ZGUB 4W9KA 3IVFA 4HPMB 1WE7A 3PPAA 3HM6X 2K6DB 1V81A 3ML8A 2HE7A 2K1FA 2CKHB 3KH0A 2R2OA 5KHQA 5DPWA 3EECA 1E8ZA 1RAXA 4XC2A 3U30A 5G55A 1V5OA 3ZDTA 2CR5A 2N9PC 1V6EA 2FIDA 4TKNA 1Z2MA 3DBHI 2QHOA 3WAMA 3NOBA 2RD0A 2DZMA 2KFKA 3MHSD 3DQVA 4P7IA 2JWZA 4W9LA 4FHJA 5BO4B 2I1KA 4BFRA 2JZZA 1NI2A 2C60A 1UBQA 2LRUA 2KDEB 3JYUA 4DDGD 4KVGB 3IHPC 4PYUA 2J7QB 2L0FA 3MJWA 2O6VA 1UD7A 1P3QU 2KFKB 2DZKA 2M0XA 3IG3A 2JPHA 4IWPA 2Y5BB 4KIKB 4YL8A 3ZRCA 4DBGA 3N32A 1KLVA 5IAAC 4II3B 1J0GA 3EC8A 4IM3A 2O6VB 3GOEA 2UYZB 3ZLZA 2Z0EB 2NCNA 5L95C 3L08A 3ML9A 1SGHA 3WA0A 2GBKA 1R4MI 2KDFB 4KSLC 2NBUA 5HKHA 2L8JA 1WY8A 4MGZE 1WXMA 4NJ7A 2KX3A 3SHQA 2OJRA 2N1WA 3OJ4B 4FBJB 3L17A 2D2QA 4MDKE 4A3PA 3N3KB 2MP2A 2LVOA 2REXA 3KYDD 2C7MB 2BYFA 3PRZA 4RM9A 3O65B 2WDTB 2M4NA 4TQ0A 1TTNA 1RLFA 2G4DB 3PVLA 2KX0A 3PTFC 2YVCA 4AWJA 1UZXB 4K7SA 2MWSB 2MP2B 4PS8A 3WAPA 1PQSA 3NZSA 2KXJA 5LLIA 1OGWA 5JHAA 2KKCA 2LUEA 4ZRJA 3ECIA 1D3ZA 4J6IA 3VTVA 4CO7A 1E8WA 5E6OA 3T8MA 3D32A 1WJUA 4MGKE 2DYMA 3A1QB 2BWFA 2LASA 3U8ZA 4BBNC 2ZJDA 2IZVB 4KZCA 1F9JA 4W9JA 2KWCA 3R7QA 3BINA 2KTRA 3ZO5B 2PEAA 5J2RA 1WGHA 3WIMA 4PYZA 2ZCCA 2K25A 1ZKHA 2GOWA 3EFUA 3N30A 3PREA 2LRWA 2JF5A 2KD0A 3QWZB 3DVNV 4KZ0A 3X0WA 3K9PB 4TQ1A 2PE6B 2ZVNA 2CHXA 5D2MB 1LXDA 5GMVA 4ASWC 1M94A 2DYOA 4HK2A 4TUUA 5JZEB 2GBRA 5E6PA 3I3TB 5C1ZA 3RULA 1L7YA 4AJYB 1OEYJ 4NQLB 2KO3A 3A33B 3QHTA 1IP9A 2M17A 2KANA 2N9EB 4G50A 5CX3A 1L2NA 1OTRB 4HJKA 1V2YA 1E90A 1V80A 4HDOA 4MH0E 2D3GA 3ZTCA 4M8NA 3B08A 4URKA 3QJZA 3TIXA 3JVZX 3RUIB 3VVWB 3SD5A 3UINB 3UGBB 4IW0A 4WWPA 3K9OB 1YD8U 2C9WB 3SU8X 1WX9A 4M0WB 4X57B 3VHTC 1H4RA 4ICUA 4MGYE 2DAFA 2JVCA 3PGEA 3R7RA 2D10A 2EMTA 1YIWA 3DPDA 1C1YB 3OAWA 4BKGA 3H6NA 1WGDA 3VH3B 2GBNA 2KLGA 4HCPB 4II2B 3VTWA 2N7DA 3L16A 3PLVA 3RZWC 2FCQA 3QC8B 1UH6A 3LJ3A 2G4SA 2CS4A 2JT4B 1BT0A 4MM3A 2LGYA 3S2AA 1C3TA 3BY4B 3CSFA 2KJ6A 3L54A 4HVBA 1EUVB 1EF1A 3VAWA 3PV1A 2MBBB 2VRRB 2BYEA 2BGFA 3WANA 2WX1A 3CSTA 3V61A 2DZJA 3V6CB 1Y8RC 3PS6A 1YX6B 3DCGA 3A9JA 1WRDB 2AL6A 2NR2A 4MSQB 5AZHA 1J8CA 5C23A 3UIPB 2AEHA 2FCSA 2MLBA 2HTHA 4W9EA 4NQKE 4MJSB 4ZRIA 1WZ3A 2ZCBA 2AWTA 5CHWA 3VUYA 4G3XB 1GUAB 2WX0A 4IUMB 3HM3A 4E71A 2JRIB 5KHOA 1YJ1A 3H7PB 3ENEA 1UGMA 5DPTA 4GU2A 4MJSA 2XEWA 3TMPB 2RGFA 5DPRA 1MG8A 3PHWB 1WZ0A 3Q3JA 2D07B 2K8HA 1R4NI 2MBOA 1WX7A 2K8CA 1VD2A 2KDBA 4GSWA 2HJ8A 3Q3FA 1I42A 2MX2A 3A9KA 5L83A 3AI5A 1WR1A 4KDLB 2C5LC 2AYOB 2LZ6A 3WAOA 4GN1A 5JH5C 3APCA 4BKTA 3VTUA 5LXIB 2KQ7A 2DYBA 3A9KB 4ANVA 3IFWB 2NPTA 2RR9A 2NBWB 3DVGX 4A20A 2JUOA 2KJRA 3PHXB 3X23A 4M8MA 3R3MA 3DVNU 4WQOB 1OEYA 2KQSA 2JZ3B 4DHJB 2IY0B 2K39A 1E7UA 2N1VA 3B1LX 4B95A 2L0TA 1E5WA 1H8CA 4EKUA 4EZKA 2KLCA 3AULA 4G11A 4K1RB 1JRUA 3M62B 3ZKJC 2O2VA 3W1SC 2IYDB 3T9LA 1GG3A 2LD9A 2MCNB 2DZIA 4AOFA 3UQBA 3ONSA 2GBMA 2BPSA 4I6LB 4KV2A 4LCDE 1VCBA 2MBEA 3OLMD 3L10B 4F8CB 2ZPYA 4NAWB 1NDDA 1T0YA 3ZUNA 1TZ1A 1WMHB 2V1YA 3PRPB 2PJHA 2NBVB 4HCNB 2V4LA 1WGYA 1WJNA 2BF8B 3PZDA 4I6PA 4B9KA 3KUCB 1V49A 3ZW3A 2C7NB 4NAWA 4GMVA 1Q0WB 2MRPA 2WWZA 3L0WB 3H9DA 3L13A 2IO3B 4IM2A 1WX8A 4B6WA 2K6QA 3ALBA 3U7DA 1V9JA 2KWUB 2ZNVC 1XD3B 3KUDB 2IO1B 1NBFC 2LXAA 2NS5A 3RD2A 5IA7A 1AARA 3ZNID 3KW5B 1EO6A 5JHBA 4LJPB 4W9IA 2D11A 4MGIE 3ZNGC 4NNJB 4W9CA 1YX5B 4MELA 4A3OA 1OQYA 4EUTA 3ZNZB 2KNBA 1K8RB 2IO2B 4FULA 1LQBA 2FCMA 4ICVA 4GIVA 4FJZA 2FNJB 4WJOA 4PS7A 3QIJA 2LI5A 4ANUA 1GNUA 3ZTDA 2C7HA 5FR6A 1WH3A 3NHEB 3CF6E 4LDTB 2O6VD 1RRBA 4DHZE 4HWIB 3UQAA 4OVUA 1P98A 3H1UA 3QA8A 1WI0A 4GXBA 3KUZA 2LVPA 4KDIC 5G2NA 2YLMA 4LDTD 3LDZE 1UELA 3ZNHB 4IC7B 4KSKC 3PSEB 1WXAA 3AU4A 4TV3A 4KIKA 4EZLA 5AZGA 3ZVVA 2UWQA 1A5RA 2DHZA 3APFA 1WR6E 2GMIC 4AUQC 3QCAA 2RSUA 5AEKB 4PS3A 3VUWA 3VFKA 3DBLI 3W1YA 4LJOB 1KM7A 3ZRFA 3VDZA 1G6JA 2CHWA 2KC1A 2KZRA 4EFOA 2IY1B 3RYTA 4NY0A 3JSVB 2W9NA 3RCZA 2IO0B 3NS8A 1V5TA 2LVQA 3B0AA 3AXCA 2KK8A 4AP4C 2XBBC 4E3CA 1YQBA 2JY6A 2L7RA 2LJ5A 2JXXA 1SIFA 2KHWB 2LWPA 3JSVA 4GGQA 1P1AA 3WALA 4GB9A 4XX5A 3TCAA 2KC2A 2MSED 4W9FA 5E6NA 2LGXA 2ASQA 4HPLB 1LM8B 4JIOU 4BVUC 2J0KA 3A1QA 1CMXB 2KVRA 3R66C 1J19A 1WFYA 2BKRB 4W9DA 2KTRB 2ZZPB 1KOTA 2R2QA 2DAJA 3CMMB 2BYVE 5CTRC 2BWES 4EOYA 2Z0DB 2G45B 3H7SA 2ZNVB 4HLEA 5TR5A 2MQJA 2FUHB 3DOWA 2N4FA 1WM3A 4NPNA 3HIZA 4FLHA 1LFDA 2Z59B 4ZYNA 4FA6A 4G0NB 1GJZA 3TBLD 1EF5A 4BBNF 1P9DU 2KTFA 1Z5SB 1WYWB 4N9F4 2ZEQA 2N7EA 3P2BA 2KJHB 2M1MA 5D7GA 1HE8A 3MTNB 2FAZA 1TGZB 2KMCA 2BKFA 1P0RA 3NY5A 4DXAB 2HD5B 5EDSA 2ZPNA 2B3AA 1U4AA 1TBEA 3APDA 3GZNI 4WAAA 3UIOB 3V60A 2KDIA 4RM8A 2L76A 4ANWA 4K81A 4DWFA 2JRHA 3ZDMC 1E8YA 1WXSA 2GBJA 1FXTB 2KWVB 4ZRKA 4W9GA 1WGGA 4F7ZA 2XK5A 1I35A 3A9JB 4CHKA 1KJTA 4IWOA 2M8SA 3DDCB 4EEWA 3RT3B 3PT2B 3PRMB 1WIAA 2RPQA 1Q1OA 4E74A 1V86A 2XK5B 4DK5A 1IYFA 3JW0X 5AZFA 4ANXA 3M63B 2PE9A 2EMSA 1IPGA 4DHJD 3VH4B 2LGDA 3QQ8B 4DHZB 4BKSD 5LXHA 2MW5A 2WYQA 3QARA 3DBSA 4ZDVA 4NJ6A 5J17A 1WE6A 1UBIA 4IG7B 1E8XA 3W1SA 1SE9A 2K8BA 4K7WA 2V3SA 3VXWA 4MEMA 2L05A 4JL9A 4MSMB 2KFJA 4FN2A 1WXVA 2N9XA 3KYCD 2IBIB 2L3ZA 5J18A 1WJ4A 4I6NB 2MBQA 3M3JA 3OJ3A 4AJWA 5DPSA 4RMAA 2AL3A 3H7PA 3IBEA
chains in the Genus database with same CATH superfamily
4XYCA 4JGHB 5CHFA 3GS2A 2RDBC 1F52A 3AN1A 3SDLC 1WGRA 1UNSA 4C56C 4HDQA 1XEEA 2FIFA 1FEHA 2ZVOA 2MBHA 5D94A 1ZDXA 3AH7A 4IOIE 3RNBC 3W2DA 3TL5A 4GOCA 4CYEA 1E9MA 2EKEC 3GE8C 4GDLB 4HXDA 4WWOA 1ZE3D 1WMHA 3VUXA 2PIAA 3O13A 4BKSA 1JWUD 2L00B 3Q3NC 4LNFA 2KN5A 1CQVA 1D4BA 2J0JA 4L1BA 3QX1A 1ZGUB 4HPMB 1WE7A 3PPAA 4MT5A 5KHQA 2R2OA 1E8ZA 1RAXA 4M02A 1PYWD 1XXGA 1JWAD 1OQQA 2GLSA 4TKNA 1Z2MA 1QKZA 2PTLA 2DZMA 3MHSD 3DQVA 2RDHA 4BFRA 3Q8BA 2C60A 3BVMA 2KDEB 3JYUA 4KVGB 3IHPC 3CWIA 2L0FA 3MJWA 1P3QU 2KVZA 4YL8A 4DBGA 3N32A 4II3B 3W5VB 1CK1A 2UYZB 2Z0EB 2NCNA 2RDGA 1RYJA 1VJKA 2JQRB 1WY8A 3SFEB 4A55A 2N1WA 3U2SC 2BTEA 3N3KB 3RNGC 1ZUD2 4LNOA 4RM9A 3FKYA 3O65B 2WDTB 2M4NA 4S0RA 1RLFA 1FFUA 2YVCA 2MWSB 2HJ1A 3WAPA 1SJED 1PQSA 4MGKE 2BWFA 2IZVB 4KZCA 4W9JA 4KKJA 5E6JA 2KTRA 2PEAA 2KMMA 4WH4A 3CIRB 1R4NB 3FILB 2NTSA 2K25A 4LNIA 2BVCA 3Q14C 3DVNV 3X0WA 3V3XA 1SB3C 2QSDA 4HK2A 4TUUA 4JX1C 3I3TB 1L7YA 3QHTA 3VRAB 2KANA 2N9EB 5CX3A 3T3NA 2VH1A 4HDOA 2D3GA 3MC8A 3EGRA 1HQRD 3JVZX 3UINB 4WWPA 1DOIA 2AQ3B 4FXCA 1H4RA 4ICUA 1DOXA 2JVCA 3PGEA 3H8HA 2KLGA 4II2B 3VTWA 3ETRA 3RZWC 2FCQA 2WDRB 4YTPB 1I4QA 4MM3A 2K9XA 3CSFA 3VAWA 4ACFA 1QOFA 1Y8RC 1WRDB 4MSQB 4N58A 2HTHA 1PDXA 4ZRIA 2ZCBA 3VUYA 4G3XB 2WX0A 3HM3A 1JCKB 3H7PB 2WHIA 2L83A 1SIJA 4GU2A 4MJSA 4KKIA 1VR9A 1L4DB 1MG8A 3PHWB 1WZ0A 5FKAC 3ZYYX 3BYTB 2K8CA 1VD2A 2KDBA 4GSWA 4P6VF 1I42A 2ONQA 4C7ZA 2MX2A 5G5GA 5L83A 3E9SA 2XNAC 2AYOB 3APCA 3IXSA 3VTUA 5LXIB 3N1ZC 2YEPF 4OZBA 2NPTA 2SAKA 2JUOA 3R3MA 2NTTA 4XGAB 2JZ3B 1L5PA 2PVOD 1N61A 1Q10A 1E5WA 1QOAA 2KLCA 4K3BA 1VLBA 4TMAB 1XLOA 2VZKD 2DZIA 2FBWB 4KV2A 1VCBA 3L10B 1NDDA 1T0YA 3PRPB 2MJDA 2NBVB 3PZDA 2E6XA 1FD6A 3KUCB 1RM6C 2C7NB 2KT7A 3L13A 4A90A 2IO3B 4IM2A 1WX8A 4B6WA 2K6QA 1T0SC 1SJHD 2KWUB 2WP9B 2JYTA 1B1ZA 2ZNVC 3KUDB 1F1HA 1NBFC 2QDFA 1AARA 3ZNID 1EO6A 4KGTA 3ZNGC 4KGSA 3Q8CA 2INPE 2KNBA 1LQBA 3AE5B 4GIVA 4WJOA 3QIJA 2LMCA 4C4VA 5FR6A 3NHEB 3CF6E 4DHZE 4HWIB 1FMAD 3QA8A 1WI0A 1SE3A 2QCZA 4RGMA 4KIKA 4EZLA 1A5RA 2L1AA 1WR6E 3DWMA 2JXTA 4AUQC 4PS3A 1YJIA 3OWEB 4XDCA 3PZ7A 2KZRA 1FXIA 4EFOA 1KRHA 5BMGA 3RYTA 3RCZA 1SEBD 2LJ5A 1SIFA 3MFGA 1P1AA 4GB9A 4RGTA 3TCAA 2LGXA 1LM8B 1TS5A 4BVUC 5FR3A 2LGSA 4W9DA 2KTRB 1KOTA 2R61A 2R2QA 5CTRC 2G45B 3SEBA 3H7SA 4DXFA 4RF0A 4FLHA 1LFDA 2Z59B 3Q8EA 4P16A 1ZXIA 2KTFA 5EE1A 3P2BA 2KJHB 2M1MA 5D7GA 1HE8A 1BXTA 1TGZB 1P0RA 5EDSA 1NYRA 2ZPNA 2MJEA 3I57A 1U4AA 3UIOB 4RM8A 1HZ5A 2JRHA 4AQ7A 1E8YA 1WXSA 2MJ3A 1WGGA 3A9JB 4CHKA 1N60A 1KJTA 4YSZB 1C4PA 1Q1OA 4E74A 4DK5A 1IYFA 3JW0X 1DGJA 4ANXA 3M63B 2WGSA 1TZOA 3QQ8B 3P4RB 3QARA 1YOVB 4NJ6A 1WE6A 4BZAA 4IG7B 1DOYA 4K7WA 2D3BA 2V3SA 3VXWA 3B9JA 2D5GA 1BMLC 1RFKA 1HA5A 2L3ZA 3U52E 3M3JA 4AJWA 2AL3A 3VR8B 3IBEA 3PLUA 3J9CA 4GDKA 4JLCA 3RZFA 1BUIC 1PGBA 5CHVC 5BYQA 4WWNA 4FJYA 2KMAA 2K5PA 3UF8A 2DENB 5TSSA 2HDEA 4YWGG 1E10A 4QAYA 4M00A 3PZ8A 5D6JB 3IAM1 3QK0A 1WJ6A 3HK0A 1TIFA 3M95A 4TSSA 1S3SG 3MC0B 4K7UA 2LXCA 2MA9B 2WXKA 3C0RB 1GC6A 3V62A 1GC7A 1E7VA 1LO5D 2NPTB 4US8A 4JQWC 4IWQA 1MFWA 2CU1A 1TS2A 3URYA 3DBRI 3VQIA 1STEA 1S1QB 4W9HA 2I1JA 3V6EB 2LFIA 4OVVA 3AV8A 2A4ZA 3MHZA 1TKGA 3NZUA 1KLUD 3A4RA 3IVFA 1V81A 2HE7A 5DPWA 3P63A 1ZDVA 1MVKA 3ZDTA 1V6EA 2FIDA 2K22A 3NOBA 4J3OD 2G1EA 4ZHPA 4P7IA 4W9LA 2JWZA 5BO4B 2I1KA 1NI2A 4RF1A 2N9LA 1K52A 3MJ5A 1M4VA 4OVZA 2O6VA 1UGJA 2DZKA 5MPOA 3IG3A 3AEFB 5GXGB 4KIKB 3ZRCA 2BW2A 4ZRQA 1J0GA 4IM3A 5L95C 1OFFA 3WA0A 2GBKA 1R4MI 2KDFB 4H2AA 5HKHA 2L8JA 1WXMA 2KX3A 1EU4A 2H88B 2OJRA 3L17A 2LVOA 2C7MB 2BYFA 2V0GA 2LUMA 2RMMA 1I4RA 1TTNA 2G4DB 3PVLA 1UZXB 2MP2B 2KKCA 2LUEA 1D3ZA 4J6IA 3W9CB 1E8WA 2KWCA 3BINA 3RNAC 1WGHA 3WIMA 4PYZA 3TEWA 2GOWA 2N7JA 2WXGA 3EFUA 3N30A 2LRWA 3K9PB 4B0EA 2PE6B 5D2MB 1LXDA 3R2IA 5GMVA 1C4AA 1M94A 2N0SB 3EA6A 1IP9A 2RPVA 4G50A 1OTRB 3P4SB 1E90A 3UI3A 3AE6B 4MH0E 1C77A 4M8NA 3TIXA 1TY2A 3VVWB 3UGBB 4IW0A 1JW9D 1WX9A 4X57B 1F2RC 3R7RA 2EMTA 1YIWA 3DPDA 2V4IB 3DBHB 3H6NA 3ZJUA 3VH3B 1YNTE 1HXYD 2N7DA 2K3UA 2ON8A 1NI3A 1UH6A 2QJLA 2JT4B 1BT0A 2LGYA 1C3TA 2KJ6A 1EUVB 1EF1A 1TY0A 2WX1A 2DZJA 3PS6A 4NZLB 5BMHA 2L32A 3A9JA 4KGRA 3AECB 3FC4A 2AEHA 2FCSA 2MLBA 3KWVA 3NJTA 1FRRA 2WXQA 1V1PA 2AWTA 2W3SA 1L4ZB 1GUAB 2X38A 2BB5A 1YJ1A 2OEDA 1UGMA 2CJOA 2MH7A 2BS2B 3NUHB 2OJWA 2PLPA 2RGFA 1R4NI 2K8HA 1WX7A 1Y56A 1V1OA 1YN5A 2SEBD 5BYRA 3Q3FA 4IKGA 3A9KA 3AI5A 1WR1A 4Q2JA 1PFDA 4KDLB 4N59A 1AW7A 5JH5C 4BKTA 4OW0A 3IFWB 1FIQA 2BS3B 4OZAA 2CJNA 3DVGX 2KJRA 3PHXB 2LJIA 2DNFA 4WQOB 1JROA 1ZPSA 2BB6A 2IY0B 2N1VA 4B95A 2UU7A 1AN8A 3AULA 4D2KA 4DXGA 3ZKJC 2IYDB 2MCNB 2LD9A 3UQBA 1K50A 2INNE 1XF5L 1D6EC 3ZUNA 1CJEA 3Q69A 3RMKC 2V4LA 1WGYA 4WAFA 3SR6A 4GMVA 1Q0WB 2INDC 2WWZA 4BAXA 3ZQ4A 4P1CC 2WXLA 1IBXB 2IO1B 3RD2A 1FNVA 1T3QA 2IDYA 1FNWA 4W9CA 3AE4B 1OQYA 4EUTA 4CQNA 1K8RB 5D3IB 3OG5A 2BBCA 4WQMA 4FJZA 4PS7A 2LI5A 3BZDB 2D3AA 3ZTDA 3IT4B 2X8XX 2LEKA 5HI1A 1P98A 3H1UA 4P1BC 5G2NA 4LDTD 3LYYA 3ZNHB 4KSKC 3AU4A 2WS3B 4RFBA 1F0ZA 3B2FA 1PGXA 1WSPA 2RSUA 3C19A 3KLSX 5AEKB 5FK9C 3VUWA 3ZRFA 3DBLI 4LJOB 1KM7A 2CHWA 2IY1B 1KLGD 5EE9A 4DQOC 1WWTA 2LVQA 2J53A 1WXQA 3B0AA 4RGOS 3DBRB 4UDUC 1YQBA 2L7RA 4AS1A 2DLBA 2B76B 2LWPA 2J52A 1OQRA 5AUKA 5AUIA 4LLGM 2PKOA 4W9FA 5E6NA 1MHXA 2ASQA 4EE2A 4JIOU 1F2RI 3AEAB 3ZJTA 1JALA 3HUIA 2ZZPB 2DAJA 2BYVE 2BWES 4PK1A 4ARCA 1L6UA 5C3JB 1I4PA 5IN7A 3DOWA 2N4FA 3HIZA 1NEKB 2MEKA 4ZYNA 4G0NB 3TBLD 4BBNF 2I2YA 1HZ6A 1P9DU 3RN9C 1WYWB 2JU6X 3L4PA 2N7EA 1LGRA 1J7CA 3MTNB 1TBEA 4ANWA 2KDIA 3ZDMC 3HRDD 3RNFC 4ZRKA 4F7ZA 1I35A 4IWOA 3DDCB 4EEWA 1JRPA 3PT2B 1V1PB 4LTUA 2CU3A 1DYQA 3Q8AA 1L6VA 3VH4B 2IGGA 4PT5A 4DHZB 5LXHA 3DBSA 1E8XA 3KQ4A 1SE9A 2K8BA 2MHJA 2KAJA 1PGAA 3ZXVA 4JL9A 2KFJA 3IT6B 4HKZE 3KYCD 1FFVA 1WJ4A 1ET6A 2WQYB 4IM0A 2A5UA 3NVZA 3EHVA 3ZIMA 1RFAA 1WF9A 1KH0A 1ZW7A 2FCNA 2KOXA 1TT5B 1ISNA 4DDID 4EZJA 4GDLA 1WM2A 2NVUI 1JWMD 3TEZA 1XT9B 1I4GA 1CZPA 1XQQA 1YN4A 4WJNA 1TKEA 3E56A 3AU5A 1L0YB 1B9RA 1GB1A 1P7FA 4L2YA 5EE0A 1A70A 2ZW0A 5DCNA 3W5UB 3DVGY 4XWWA 3HM6X 3ML8A 2CKHB 3AEEB 3EECA 3U30A 5G55A 1V5OA 4XDDA 2N9PC 1J7BA 2QHOA 1IBXA 1NENB 2KFKA 2BT6A 2JZZA 1UBQA 4DDGD 2J7QB 4C80A 1YQ3B 2VZKB 2M0XA 2GB1A 1D5XC 4IWPA 4OZCA 3EFCA 5IAAC 4REZA 3EC8A 3GOEA 1N62A 3L08A 1KTKA 2PVGC 2QIEB 3R8BA 4NJ7A 1MI0A 3SHQA 3N9YC 3OJ4B 1N6ZA 4FBJB 4MDKE 4A3PA 5C2TB 4OHJA 2REXA 3KYDD 2H89B 1L0XB 1T0QC 3AE1B 4AWJA 3BVZA 4WWMA 5IOIA 3NZSA 5LLIA 5JHAA 1OGWA 2WXRA 4ZRJA 3VTVA 5E6OA 3U4EG 1WJUA 2ZJDA 3R7QA 3RPFC 5T8IA 3ZO5B 5J2RA 3N20C 5I4DA 4YSYB 1ZKHA 1J7AA 4RMAA 2JF5A 2KD0A 2ZVNA 2CHXA 1QQRA 1V8CA 1GAQB 2DYOA 4ASWC 5JZEB 3DHHC 3RULA 1OEYJ 4NQLB 2KO3A 3A33B 1L2NA 1UWXA 1XLQA 1V2YA 1V80A 2K0PA 4M0WA 4URKA 3QJZA 1SE2A 3RUIB 4HKQA 2C9WB 1ZOYB 3VHTC 3P4QB 2DAFA 1C1YB 4O1NA 2M0AA 2GBNA 3VRBB 4HCPB 3L16A 2V9HA 3PLVA 3LJ3A 2MBBB 2VRRB 4US9A 5EE3A 3EUB2 4HPPA 4XE0A 2KYWA 1SF0A 2WXMA 3CSTA 1YX6B 1GPXA 4HRSA 2NR2A 2AL6A 2D3CA 1QILA 4HEA1 1HTQA 4W9EA 4ZYSA 2Y3AA 4MJSB 1WZ3A 5CHWA 1XO3A 2KQ4X 4E71A 2JRIB 1RWSA 3NS1A 2XEWA 3TMPB 5DPRA 2D07B 5LNK1 2MBOA 1MJDA 2HJ8A 1UWMA 1C78A 2WXFA 1WRIA 2C5LC 2WDVB 2LZ6A 1R7SA 3WAOA 4GN1A 3N1YC 3AE3B 4NJCA 1QOGA 2KQ7A 2DBYA 3DHIC 5H92C 3A9KB 4ANVA 2RR9A 3BIID 2NBWB 2LHDA 2BS4B 1L0VB 4M8MA 3DVNU 1OEYA 3AEDB 2M56B 2W3RA 3B1LX 1FCLA 1JRUA 4A9AA 1TS3A 3TEYA 3T9LA 3ONSA 2BPSA 4I6LB 4LCDE 2MBEA 1FO4A 4NAWB 3ABVB 1YJJA 2PJHA 4I6PA 3LB8C 2BF8B 3BWUD 1V49A 1EU3A 4MH8A 3ZW3A 2MRPA 3H9DA 3ALBA 2KACA 1C4CA 4MACA 2QMTA 1XD3B 2LXAA 2HTME 1ENFA 3DHGC 3KW5B 3AB5A 2GRIA 4LJPB 5JHBA 1XLNA 4NNJB 1YX5B 3Q2AC 3ZNZB 2IO2B 2FCMA 4A8XC 4ICVA 2WU5B 4YT0B 4YTNB 1F77A 4RCOA 2I38A 2QC8A 4LDTB 2O6VD 1RRBA 2V3PA 4KDIC 2YLMA 4C4VB 3LDZE 2WU2B 1UELA 1WXAA 4TV3A 1NYQA 5AZGA 3ZVVA 4YSXB 2DHZA 2GMIC 3QCAA 1C76A 3VFKA 3I63C 3VDZA 3HVZA 4NY0A 3JSVB 2W9NA 3NG0A 2IO0B 3NS8A 1V5TA 4HJGE 2NMQA 4YTMB 1T5XD 3BYYB 2KK8A 1KF6B 4AP4C 2JY6A 1QLBB 4XX5A 2KC2A 1I7HA 2FUG1 4ZOHC 3AMZA 2PW9A 3A1QA 1CMXB 2KVRA 3R66C 5BYSA 1J19A 2BKRB 4RNAA 4JE3B 3CMMB 2INCC 2Z0DB 3Q3OC 2FUHB 1GJZA 4RGNA 4YXDB 1EWYC 3NVYA 3AE9B 1N5XA 2FAZA 2BYTA 3NY5A 4DXAB 2B3AA 3V60A 3GZNI 1SBBB 2L76A 1K51A 1XCQL 1VRAB 2GBJA 2KWVB 2WNMA 2XK5A 1EM7A 3V05A 3RT3B 2GI9A 1ZP0B 2W82A 2RPQA 5HG2A 5AZFA 2PE9A 3VR9B 4BKSD 2MW5A 5J17A 1UBIA 2Z8LA 2PMVA 2ZW1A 4MEMA 2L05A 4GLSC 4MSMB 1WXVA 2N9XA 2IBIB 5J18A 4I6NB 2MBQA 5DPSA 3ZJVA 1FNUA 2PPHA 3MP9A 3WCQA 1FCCC 3QAQA 3BK1A 2VH2A 4BOZB 3ZXRA 1VZ8A 4GDKB 4K3CA 3AE7B 1QZEA 2J42A 3R2TA 4C7YA 2OHFA 4WIPA 4FHKA 2WXHA 3AE8B 2V3NA 3Q6BA 2L52A 4WJPA 1IGCA 2OOBB 3GE3C 2G3QB 1WGKA 2N9KA 4ARIA 4F1SA 1AYFA 1I4XA 3GB1A 1Q5WB 1YN3A 1X1MA 1C79A 3TJPA 4XZ4A 3NVVA 4FJVB 2J0MA 3A4SC 3GZNB 2O2VB 2DX5B 2CHZA 3KVFB 4WJQA 4FADA 3HHMA 4BOSC 1YQ4B 4W9KA 2K6DB 4A6QA 2K1FA 2AQ2B 3KH0A 3LXFA 4XC2A 2YEPB 1UF0A 1ACCA 2CR5A 1MPEA 3KWLA 1KFYB 3DBHI 3WAMA 4R3DA 2RD0A 4FHJA 2AQ1B 2LRUA 2IJ0A 4PYUA 1TJEA 1SE4A 1UD7A 2KFKB 5JXVA 2JPHA 1KLVA 2Y5BB 2O6VB 1D5ZC 3ZLZA 3BVGA 2KN4A 3ML9A 1SGHA 1VZ7A 4KSLC 2NBUA 4MGZE 2ICIA 2D2QA 2W54A 3RNCC 3TSSA 2MP2A 1MHHE 3PRZA 4ZHOA 2Q5WD 4TQ0A 4C00A 3C8YA 2KX0A 3PTFC 4K7SA 4PS8A 3IAS1 2IGHA 5IKCM 2KXJA 1AWDA 3ECIA 2KWDA 3AEBB 4CO7A 1E0ZA 3T8MA 3D32A 3FILA 4BBNC 2DYMA 3A1QB 3U8ZA 1T6BX 2LASA 1F9JA 3HVDA 1K53A 2LGIA 2ZCCA 1R4MB 3PREA 3QWZB 4KZ0A 4N6EB 4TQ1A 2WXJA 2GBRA 1FRDA 5E6PA 5C1ZA 5H8YE 4AJYB 3ZGZA 2M17A 2WXNA 1JWBD 4HJKA 1E6EB 2WXOA 2JSVX 3ZTCA 3B08A 2QEJC 3SD5A 1TKYA 4JPSA 1SXTA 3K9OB 1YD8U 3SU8X 2WXIA 4M0WB 1GOZA 4MGYE 2TSSA 2D10A 3OAWA 4BKGA 1T0RC 2XN9C 3U7ZA 3AM9A 1WGDA 5IO9A 2IGDA 2JWUA 2ACZB 3QC8B 1N63A 2G4SA 2CS4A 1TYGB 3S2AA 3BY4B 4HVBA 3L54A 2KDMA 3PV1A 2BYEA 2BGFA 3WANA 3V61A 3V6CB 3DCGA 5AZHA 1J8CA 5C23A 2AX5A 1FM0D 3UIPB 5G5HA 4NQKE 4IUMB 1ZXHA 5KHOA 3ENEA 3SFDB 1TS4A 1SSNA 1FPYA 5DPTA 1N5WA 3NZ3A 3Q3JA 1VDVA 1EWCA 1ESFA 1HTOA 3MC9A 3I5JC 2QILA 3N1XC 3AEGB 3NVWA 2J4XA 3P1MA 2DWQA 4S17A 2DYBA 2JYEA 3GP7A 4A20A 3X23A 1V97A 2KQSA 1JQ4A 4KX6B 4DHJB 2K39A 1E7UA 1H8CA 2L0TA 5IP4D 4EKUA 4EZKA 5D3DA 4G11A 4K1RB 3M62B 4ZRPA 2O2VA 3W1SC 4AOFA 1GG3A 3B2GA 2WDQB 2GBMA 5BMIA 1UUPA 3TUOA 2Y5PA 3OLMD 4F8CB 2ZPYA 1TZ1A 3RI7C 3Q8FA 1WMHB 2V1YA 4L23A 4HCNB 1ROEA 1WJNA 4B9KA 4HROA 1C9FA 4NAWA 3L0WB 2Y5CA 3U7DA 1V9JA 1D5MC 2EKIA 1XCTL 2NS5A 1I4HA 5IA7A 4W9IA 2D11A 4MGIE 4WURA 2E3TA 4A3OA 4MELA 1VZ6A 2JX5A 1IUEA 4FULA 5HHDG 4NAMA 2FNJB 4ANUA 1GNUA 2C7HA 1WH3A 3T3OA 3UQAA 4OVUA 1NVID 4GXBA 3KUZA 2LVPA 4IC7B 3PSEB 2FE8A 3I9V1 2JZPA 2UWQA 1XLPA 3APFA 3PO0A 2WXPA 3W1YA 1QF6A 4JWSC 4ITKA 1G6JA 3FAHA 2KC1A 1P7EA 2LHEA 4XWTA 1GB4A 2M19A 1WYGA 3AXCA 2IPKD 4USAA 3Q3MC 2XBBC 4E3CA 2JXXA 2KHWB 3JSVA 1FXAA 4GGQA 2W55A 3WALA 3P4PB 3NRZA 2MSED 1HEZE 1ET9A 4HPLB 4LNNA 2J0KA 1E7PB 1WFYA 2G9HD 3RNEC 4IDIA 4LK0M 2WLBA 1QT9A 4EOYA 2ZNVB 4HLEA 5TR5A 2MQJA 1WM3A 4NPNA 4FA6A 1EF5A 4JWUC 4M01A 4N9F4 2ZEQA 3TEXA 2KMCA 2BKFA 2HD5B 3DWGC 4WAAA 3APDA 1JWSD 4B0MA 1IGDA 1PUTA 1JMLA 4K81A 4DWFA 4LNKA 3DBLB 1FXTB 3BK2A 4W9GA 2M8SA 1YMHE 3PRMB 1WIAA 4MM3B 5HFYA 2BQQA 3AE2B 1V86A 2XK5B 2EMSA 1IPGA 4DHJD 2LGDA 2WYQA 4ZDVA 3RFZB 3W1SA 4RH6A 1MG4A 3P42A 2EELA 1QOBA 4FN2A 3OJ3A 1Z5SB 3H7PA
chains in the Genus database with same CATH topology
3PLUA 2PPHA 4IM0A 4GDKA 2A5UA 4JLCA 3RZFA 5CHVC 3QAQA 4WWNA 4FJYA 4JGHB 2KMAA 5CHFA 3UF8A 2DENB 3EHVA 4BOZB 3ZIMA 3SDLC 1WGRA 1RFAA 4GDKB 1WF9A 4HDQA 2FIFA 2ZVOA 2MBHA 1ZW7A 1QZEA 5D94A 2FCNA 2KOXA 5D6JB 1ISNA 4DDID 3QK0A 1WJ6A 4EZJA 4GDLA 4FHKA 1WM2A 3HK0A 2NVUI 3M95A 3TL5A 1S3SG 4GOCA 4K7UA 2LXCA 2MA9B 3C0RB 4WJPA 4CYEA 2OOBB 1GC6A 1XT9B 2G3QB 3V62A 1GC7A 1E7VA 2EKEC 2NPTB 4GDLB 4F1SA 1XQQA 4HXDA 4WWOA 4JQWC 4WJNA 4IWQA 2CU1A 1Q5WB 3DBRI 1WMHA 3VQIA 3VUXA 1X1MA 1S1QB 4W9HA 2I1JA 3V6EB 3TJPA 4XZ4A 4BKSA 4OVVA 2A4ZA 3AU5A 2L00B 4FJVB 2J0MA 3A4SC 3NZUA 2O2VB 2KN5A 2DX5B 2CHZA 3KVFB 2J0JA 4WJQA 3A4RA 5DCNA 4FADA 3HHMA 4BOSC 3DVGY 3QX1A 1ZGUB 4W9KA 3IVFA 4HPMB 1WE7A 3PPAA 3HM6X 2K6DB 1V81A 3ML8A 2HE7A 2K1FA 2CKHB 3KH0A 2R2OA 5KHQA 5DPWA 3EECA 1E8ZA 1RAXA 4XC2A 3U30A 5G55A 1V5OA 3ZDTA 2CR5A 2N9PC 1V6EA 2FIDA 4TKNA 1Z2MA 3DBHI 2QHOA 3WAMA 3NOBA 2RD0A 2DZMA 2KFKA 3MHSD 3DQVA 4P7IA 2JWZA 4W9LA 4FHJA 5BO4B 2I1KA 4BFRA 2JZZA 1NI2A 2C60A 1UBQA 2LRUA 2KDEB 3JYUA 4DDGD 4KVGB 3IHPC 4PYUA 2J7QB 2L0FA 3MJWA 2O6VA 1UD7A 1P3QU 2KFKB 2DZKA 2M0XA 3IG3A 2JPHA 4IWPA 2Y5BB 4KIKB 4YL8A 3ZRCA 4DBGA 3N32A 1KLVA 5IAAC 4II3B 1J0GA 3EC8A 4IM3A 2O6VB 3GOEA 2UYZB 3ZLZA 2Z0EB 2NCNA 5L95C 3L08A 3ML9A 1SGHA 3WA0A 2GBKA 1R4MI 2KDFB 4KSLC 2NBUA 5HKHA 2L8JA 1WY8A 4MGZE 1WXMA 4NJ7A 2KX3A 3SHQA 2OJRA 2N1WA 3OJ4B 4FBJB 3L17A 2D2QA 4MDKE 4A3PA 3N3KB 2MP2A 2LVOA 2REXA 3KYDD 2C7MB 2BYFA 3PRZA 4RM9A 3O65B 2WDTB 2M4NA 4TQ0A 1TTNA 1RLFA 2G4DB 3PVLA 2KX0A 3PTFC 2YVCA 4AWJA 1UZXB 4K7SA 2MWSB 2MP2B 4PS8A 3WAPA 1PQSA 3NZSA 2KXJA 5LLIA 1OGWA 5JHAA 2KKCA 2LUEA 4ZRJA 3ECIA 1D3ZA 4J6IA 3VTVA 4CO7A 1E8WA 5E6OA 3T8MA 3D32A 1WJUA 4MGKE 2DYMA 3A1QB 2BWFA 2LASA 3U8ZA 4BBNC 2ZJDA 2IZVB 4KZCA 1F9JA 4W9JA 2KWCA 3R7QA 3BINA 2KTRA 3ZO5B 2PEAA 5J2RA 1WGHA 3WIMA 4PYZA 2ZCCA 2K25A 1ZKHA 2GOWA 3EFUA 3N30A 3PREA 2LRWA 2JF5A 2KD0A 3QWZB 3DVNV 4KZ0A 3X0WA 3K9PB 4TQ1A 2PE6B 2ZVNA 2CHXA 5D2MB 1LXDA 5GMVA 4ASWC 1M94A 2DYOA 4HK2A 4TUUA 5JZEB 2GBRA 5E6PA 3I3TB 5C1ZA 3RULA 1L7YA 4AJYB 1OEYJ 4NQLB 2KO3A 3A33B 3QHTA 1IP9A 2M17A 2KANA 2N9EB 4G50A 5CX3A 1L2NA 1OTRB 4HJKA 1V2YA 1E90A 1V80A 4HDOA 4MH0E 2D3GA 3ZTCA 4M8NA 3B08A 4URKA 3QJZA 3TIXA 3JVZX 3RUIB 3VVWB 3SD5A 3UINB 3UGBB 4IW0A 4WWPA 3K9OB 1YD8U 2C9WB 3SU8X 1WX9A 4M0WB 4X57B 3VHTC 1H4RA 4ICUA 4MGYE 2DAFA 2JVCA 3PGEA 3R7RA 2D10A 2EMTA 1YIWA 3DPDA 1C1YB 3OAWA 4BKGA 3H6NA 1WGDA 3VH3B 2GBNA 2KLGA 4HCPB 4II2B 3VTWA 2N7DA 3L16A 3PLVA 3RZWC 2FCQA 3QC8B 1UH6A 3LJ3A 2G4SA 2CS4A 2JT4B 1BT0A 4MM3A 2LGYA 3S2AA 1C3TA 3BY4B 3CSFA 2KJ6A 3L54A 4HVBA 1EUVB 1EF1A 3VAWA 3PV1A 2MBBB 2VRRB 2BYEA 2BGFA 3WANA 2WX1A 3CSTA 3V61A 2DZJA 3V6CB 1Y8RC 3PS6A 1YX6B 3DCGA 3A9JA 1WRDB 2AL6A 2NR2A 4MSQB 5AZHA 1J8CA 5C23A 3UIPB 2AEHA 2FCSA 2MLBA 2HTHA 4W9EA 4NQKE 4MJSB 4ZRIA 1WZ3A 2ZCBA 2AWTA 5CHWA 3VUYA 4G3XB 1GUAB 2WX0A 4IUMB 3HM3A 4E71A 2JRIB 5KHOA 1YJ1A 3H7PB 3ENEA 1UGMA 5DPTA 4GU2A 4MJSA 2XEWA 3TMPB 2RGFA 5DPRA 1MG8A 3PHWB 1WZ0A 3Q3JA 2D07B 2K8HA 1R4NI 2MBOA 1WX7A 2K8CA 1VD2A 2KDBA 4GSWA 2HJ8A 3Q3FA 1I42A 2MX2A 3A9KA 5L83A 3AI5A 1WR1A 4KDLB 2C5LC 2AYOB 2LZ6A 3WAOA 4GN1A 5JH5C 3APCA 4BKTA 3VTUA 5LXIB 2KQ7A 2DYBA 3A9KB 4ANVA 3IFWB 2NPTA 2RR9A 2NBWB 3DVGX 4A20A 2JUOA 2KJRA 3PHXB 3X23A 4M8MA 3R3MA 3DVNU 4WQOB 1OEYA 2KQSA 2JZ3B 4DHJB 2IY0B 2K39A 1E7UA 2N1VA 3B1LX 4B95A 2L0TA 1E5WA 1H8CA 4EKUA 4EZKA 2KLCA 3AULA 4G11A 4K1RB 1JRUA 3M62B 3ZKJC 2O2VA 3W1SC 2IYDB 3T9LA 1GG3A 2LD9A 2MCNB 2DZIA 4AOFA 3UQBA 3ONSA 2GBMA 2BPSA 4I6LB 4KV2A 4LCDE 1VCBA 2MBEA 3OLMD 3L10B 4F8CB 2ZPYA 4NAWB 1NDDA 1T0YA 3ZUNA 1TZ1A 1WMHB 2V1YA 3PRPB 2PJHA 2NBVB 4HCNB 2V4LA 1WGYA 1WJNA 2BF8B 3PZDA 4I6PA 4B9KA 3KUCB 1V49A 3ZW3A 2C7NB 4NAWA 4GMVA 1Q0WB 2MRPA 2WWZA 3L0WB 3H9DA 3L13A 2IO3B 4IM2A 1WX8A 4B6WA 2K6QA 3ALBA 3U7DA 1V9JA 2KWUB 2ZNVC 1XD3B 3KUDB 2IO1B 1NBFC 2LXAA 2NS5A 3RD2A 5IA7A 1AARA 3ZNID 3KW5B 1EO6A 5JHBA 4LJPB 4W9IA 2D11A 4MGIE 3ZNGC 4NNJB 4W9CA 1YX5B 4MELA 4A3OA 1OQYA 4EUTA 3ZNZB 2KNBA 1K8RB 2IO2B 4FULA 1LQBA 2FCMA 4ICVA 4GIVA 4FJZA 2FNJB 4WJOA 4PS7A 3QIJA 2LI5A 4ANUA 1GNUA 3ZTDA 2C7HA 5FR6A 1WH3A 3NHEB 3CF6E 4LDTB 2O6VD 1RRBA 4DHZE 4HWIB 3UQAA 4OVUA 1P98A 3H1UA 3QA8A 1WI0A 4GXBA 3KUZA 2LVPA 4KDIC 5G2NA 2YLMA 4LDTD 3LDZE 1UELA 3ZNHB 4IC7B 4KSKC 3PSEB 1WXAA 3AU4A 4TV3A 4KIKA 4EZLA 5AZGA 3ZVVA 2UWQA 1A5RA 2DHZA 3APFA 1WR6E 2GMIC 4AUQC 3QCAA 2RSUA 5AEKB 4PS3A 3VUWA 3VFKA 3DBLI 3W1YA 4LJOB 1KM7A 3ZRFA 3VDZA 1G6JA 2CHWA 2KC1A 2KZRA 4EFOA 2IY1B 3RYTA 4NY0A 3JSVB 2W9NA 3RCZA 2IO0B 3NS8A 1V5TA 2LVQA 3B0AA 3AXCA 2KK8A 4AP4C 2XBBC 4E3CA 1YQBA 2JY6A 2L7RA 2LJ5A 2JXXA 1SIFA 2KHWB 2LWPA 3JSVA 4GGQA 1P1AA 3WALA 4GB9A 4XX5A 3TCAA 2KC2A 2MSED 4W9FA 5E6NA 2LGXA 2ASQA 4HPLB 1LM8B 4JIOU 4BVUC 2J0KA 3A1QA 1CMXB 2KVRA 3R66C 1J19A 1WFYA 2BKRB 4W9DA 2KTRB 2ZZPB 1KOTA 2R2QA 2DAJA 3CMMB 2BYVE 5CTRC 2BWES 4EOYA 2Z0DB 2G45B 3H7SA 2ZNVB 4HLEA 5TR5A 2MQJA 2FUHB 3DOWA 2N4FA 1WM3A 4NPNA 3HIZA 4FLHA 1LFDA 2Z59B 4ZYNA 4FA6A 4G0NB 1GJZA 3TBLD 1EF5A 4BBNF 1P9DU 2KTFA 1Z5SB 1WYWB 4N9F4 2ZEQA 2N7EA 3P2BA 2KJHB 2M1MA 5D7GA 1HE8A 3MTNB 2FAZA 1TGZB 2KMCA 2BKFA 1P0RA 3NY5A 4DXAB 2HD5B 5EDSA 2ZPNA 2B3AA 1U4AA 1TBEA 3APDA 3GZNI 4WAAA 3UIOB 3V60A 2KDIA 4RM8A 2L76A 4ANWA 4K81A 4DWFA 2JRHA 3ZDMC 1E8YA 1WXSA 2GBJA 1FXTB 2KWVB 4ZRKA 4W9GA 1WGGA 4F7ZA 2XK5A 1I35A 3A9JB 4CHKA 1KJTA 4IWOA 2M8SA 3DDCB 4EEWA 3RT3B 3PT2B 3PRMB 1WIAA 2RPQA 1Q1OA 4E74A 1V86A 2XK5B 4DK5A 1IYFA 3JW0X 5AZFA 4ANXA 3M63B 2PE9A 2EMSA 1IPGA 4DHJD 3VH4B 2LGDA 3QQ8B 4DHZB 4BKSD 5LXHA 2MW5A 2WYQA 3QARA 3DBSA 4ZDVA 4NJ6A 5J17A 1WE6A 1UBIA 4IG7B 1E8XA 3W1SA 1SE9A 2K8BA 4K7WA 2V3SA 3VXWA 4MEMA 2L05A 4JL9A 4MSMB 2KFJA 4FN2A 1WXVA 2N9XA 3KYCD 2IBIB 2L3ZA 5J18A 1WJ4A 4I6NB 2MBQA 3M3JA 3OJ3A 4AJWA 5DPSA 4RMAA 2AL3A 3H7PA 3IBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PLU A;  2PPH A;  4IM0 A;  4GDK A;  2A5U A;  4JLC A;  3RZF A;  5CHV C;  3QAQ A;  4WWN A;  4FJY A;  4JGH B;  2KMA A;  5CHF A;  3UF8 A;  2DEN B;  3EHV A;  4BOZ B;  3ZIM A;  3SDL C;  1WGR A;  1RFA A;  4GDK B;  1WF9 A;  4HDQ A;  2FIF A;  2ZVO A;  2MBH A;  1ZW7 A;  1QZE A;  5D94 A;  2FCN A;  2KOX A;  5D6J B;  1ISN A;  4DDI D;  3QK0 A;  1WJ6 A;  4EZJ A;  4GDL A;  4FHK A;  1WM2 A;  3HK0 A;  2NVU I;  3M95 A;  3TL5 A;  1S3S G;  4GOC A;  4K7U A;  2LXC A;  2MA9 B;  3C0R B;  4WJP A;  4CYE A;  2OOB B;  1GC6 A;  1XT9 B;  2G3Q B;  3V62 A;  1GC7 A;  1E7V A;  2EKE C;  2NPT B;  4GDL B;  4F1S A;  1XQQ A;  4HXD A;  4WWO A;  4JQW C;  4WJN A;  4IWQ A;  2CU1 A;  1Q5W B;  3DBR I;  1WMH A;  3VQI A;  3VUX A;  1X1M A;  1S1Q B;  4W9H A;  2I1J A;  3V6E B;  3TJP A;  4XZ4 A;  4BKS A;  4OVV A;  2A4Z A;  3AU5 A;  2L00 B;  4FJV B;  2J0M A;  3A4S C;  3NZU A;  2O2V B;  2KN5 A;  2DX5 B;  2CHZ A;  3KVF B;  2J0J A;  4WJQ A;  3A4R A;  5DCN A;  4FAD A;  3HHM A;  4BOS C;  3DVG Y;  3QX1 A;  1ZGU B;  4W9K A;  3IVF A;  4HPM B;  1WE7 A;  3PPA A;  3HM6 X;  2K6D B;  1V81 A;  3ML8 A;  2HE7 A;  2K1F A;  2CKH B;  3KH0 A;  2R2O A;  5KHQ A;  5DPW A;  3EEC A;  1E8Z A;  1RAX A;  4XC2 A;  3U30 A;  5G55 A;  1V5O A;  3ZDT A;  2CR5 A;  2N9P C;  1V6E A;  2FID A;  4TKN A;  1Z2M A;  3DBH I;  2QHO A;  3WAM A;  3NOB A;  2RD0 A;  2DZM A;  2KFK A;  3MHS D;  3DQV A;  4P7I A;  2JWZ A;  4W9L A;  4FHJ A;  5BO4 B;  2I1K A;  4BFR A;  2JZZ A;  1NI2 A;  2C60 A;  1UBQ A;  2LRU A;  2KDE B;  3JYU A;  4DDG D;  4KVG B;  3IHP C;  4PYU A;  2J7Q B;  2L0F A;  3MJW A;  2O6V A;  1UD7 A;  1P3Q U;  2KFK B;  2DZK A;  2M0X A;  3IG3 A;  2JPH A;  4IWP A;  2Y5B B;  4KIK B;  4YL8 A;  3ZRC A;  4DBG A;  3N32 A;  1KLV A;  5IAA C;  4II3 B;  1J0G A;  3EC8 A;  4IM3 A;  2O6V B;  3GOE A;  2UYZ B;  3ZLZ A;  2Z0E B;  2NCN A;  5L95 C;  3L08 A;  3ML9 A;  1SGH A;  3WA0 A;  2GBK A;  1R4M I;  2KDF B;  4KSL C;  2NBU A;  5HKH A;  2L8J A;  1WY8 A;  4MGZ E;  1WXM A;  4NJ7 A;  2KX3 A;  3SHQ A;  2OJR A;  2N1W A;  3OJ4 B;  4FBJ B;  3L17 A;  2D2Q A;  4MDK E;  4A3P A;  3N3K B;  2MP2 A;  2LVO A;  2REX A;  3KYD D;  2C7M B;  2BYF A;  3PRZ A;  4RM9 A;  3O65 B;  2WDT B;  2M4N A;  4TQ0 A;  1TTN A;  1RLF A;  2G4D B;  3PVL A;  2KX0 A;  3PTF C;  2YVC A;  4AWJ A;  1UZX B;  4K7S A;  2MWS B;  2MP2 B;  4PS8 A;  3WAP A;  1PQS A;  3NZS A;  2KXJ A;  5LLI A;  1OGW A;  5JHA A;  2KKC A;  2LUE A;  4ZRJ A;  3ECI A;  1D3Z A;  4J6I A;  3VTV A;  4CO7 A;  1E8W A;  5E6O A;  3T8M A;  3D32 A;  1WJU A;  4MGK E;  2DYM A;  3A1Q B;  2BWF A;  2LAS A;  3U8Z A;  4BBN C;  2ZJD A;  2IZV B;  4KZC A;  1F9J A;  4W9J A;  2KWC A;  3R7Q A;  3BIN A;  2KTR A;  3ZO5 B;  2PEA A;  5J2R A;  1WGH A;  3WIM A;  4PYZ A;  2ZCC A;  2K25 A;  1ZKH A;  2GOW A;  3EFU A;  3N30 A;  3PRE A;  2LRW A;  2JF5 A;  2KD0 A;  3QWZ B;  3DVN V;  4KZ0 A;  3X0W A;  3K9P B;  4TQ1 A;  2PE6 B;  2ZVN A;  2CHX A;  5D2M B;  1LXD A;  5GMV A;  4ASW C;  1M94 A;  2DYO A;  4HK2 A;  4TUU A;  5JZE B;  2GBR A;  5E6P A;  3I3T B;  5C1Z A;  3RUL A;  1L7Y A;  4AJY B;  1OEY J;  4NQL B;  2KO3 A;  3A33 B;  3QHT A;  1IP9 A;  2M17 A;  2KAN A;  2N9E B;  4G50 A;  5CX3 A;  1L2N A;  1OTR B;  4HJK A;  1V2Y A;  1E90 A;  1V80 A;  4HDO A;  4MH0 E;  2D3G A;  3ZTC A;  4M8N A;  3B08 A;  4URK A;  3QJZ A;  3TIX A;  3JVZ X;  3RUI B;  3VVW B;  3SD5 A;  3UIN B;  3UGB B;  4IW0 A;  4WWP A;  3K9O B;  1YD8 U;  2C9W B;  3SU8 X;  1WX9 A;  4M0W B;  4X57 B;  3VHT C;  1H4R A;  4ICU A;  4MGY E;  2DAF A;  2JVC A;  3PGE A;  3R7R A;  2D10 A;  2EMT A;  1YIW A;  3DPD A;  1C1Y B;  3OAW A;  4BKG A;  3H6N A;  1WGD A;  3VH3 B;  2GBN A;  2KLG A;  4HCP B;  4II2 B;  3VTW A;  2N7D A;  3L16 A;  3PLV A;  3RZW C;  2FCQ A;  3QC8 B;  1UH6 A;  3LJ3 A;  2G4S A;  2CS4 A;  2JT4 B;  1BT0 A;  4MM3 A;  2LGY A;  3S2A A;  1C3T A;  3BY4 B;  3CSF A;  2KJ6 A;  3L54 A;  4HVB A;  1EUV B;  1EF1 A;  3VAW A;  3PV1 A;  2MBB B;  2VRR B;  2BYE A;  2BGF A;  3WAN A;  2WX1 A;  3CST A;  3V61 A;  2DZJ A;  3V6C B;  1Y8R C;  3PS6 A;  1YX6 B;  3DCG A;  3A9J A;  1WRD B;  2AL6 A;  2NR2 A;  4MSQ B;  5AZH A;  1J8C A;  5C23 A;  3UIP B;  2AEH A;  2FCS A;  2MLB A;  2HTH A;  4W9E A;  4NQK E;  4MJS B;  4ZRI A;  1WZ3 A;  2ZCB A;  2AWT A;  5CHW A;  3VUY A;  4G3X B;  1GUA B;  2WX0 A;  4IUM B;  3HM3 A;  4E71 A;  2JRI B;  5KHO A;  1YJ1 A;  3H7P B;  3ENE A;  1UGM A;  5DPT A;  4GU2 A;  4MJS A;  2XEW A;  3TMP B;  2RGF A;  5DPR A;  1MG8 A;  3PHW B;  1WZ0 A;  3Q3J A;  2D07 B;  2K8H A;  1R4N I;  2MBO A;  1WX7 A;  2K8C A;  1VD2 A;  2KDB A;  4GSW A;  2HJ8 A;  3Q3F A;  1I42 A;  2MX2 A;  3A9K A;  5L83 A;  3AI5 A;  1WR1 A;  4KDL B;  2C5L C;  2AYO B;  2LZ6 A;  3WAO A;  4GN1 A;  5JH5 C;  3APC A;  4BKT A;  3VTU A;  5LXI B;  2KQ7 A;  2DYB A;  3A9K B;  4ANV A;  3IFW B;  2NPT A;  2RR9 A;  2NBW B;  3DVG X;  4A20 A;  2JUO A;  2KJR A;  3PHX B;  3X23 A;  4M8M A;  3R3M A;  3DVN U;  4WQO B;  1OEY A;  2KQS A;  2JZ3 B;  4DHJ B;  2IY0 B;  2K39 A;  1E7U A;  2N1V A;  3B1L X;  4B95 A;  2L0T A;  1E5W A;  1H8C A;  4EKU A;  4EZK A;  2KLC A;  3AUL A;  4G11 A;  4K1R B;  1JRU A;  3M62 B;  3ZKJ C;  2O2V A;  3W1S C;  2IYD B;  3T9L A;  1GG3 A;  2LD9 A;  2MCN B;  2DZI A;  4AOF A;  3UQB A;  3ONS A;  2GBM A;  2BPS A;  4I6L B;  4KV2 A;  4LCD E;  1VCB A;  2MBE A;  3OLM D;  3L10 B;  4F8C B;  2ZPY A;  4NAW B;  1NDD A;  1T0Y A;  3ZUN A;  1TZ1 A;  1WMH B;  2V1Y A;  3PRP B;  2PJH A;  2NBV B;  4HCN B;  2V4L A;  1WGY A;  1WJN A;  2BF8 B;  3PZD A;  4I6P A;  4B9K A;  3KUC B;  1V49 A;  3ZW3 A;  2C7N B;  4NAW A;  4GMV A;  1Q0W B;  2MRP A;  2WWZ A;  3L0W B;  3H9D A;  3L13 A;  2IO3 B;  4IM2 A;  1WX8 A;  4B6W A;  2K6Q A;  3ALB A;  3U7D A;  1V9J A;  2KWU B;  2ZNV C;  1XD3 B;  3KUD B;  2IO1 B;  1NBF C;  2LXA A;  2NS5 A;  3RD2 A;  5IA7 A;  1AAR A;  3ZNI D;  3KW5 B;  1EO6 A;  5JHB A;  4LJP B;  4W9I A;  2D11 A;  4MGI E;  3ZNG C;  4NNJ B;  4W9C A;  1YX5 B;  4MEL A;  4A3O A;  1OQY A;  4EUT A;  3ZNZ B;  2KNB A;  1K8R B;  2IO2 B;  4FUL A;  1LQB A;  2FCM A;  4ICV A;  4GIV A;  4FJZ A;  2FNJ B;  4WJO A;  4PS7 A;  3QIJ A;  2LI5 A;  4ANU A;  1GNU A;  3ZTD A;  2C7H A;  5FR6 A;  1WH3 A;  3NHE B;  3CF6 E;  4LDT B;  2O6V D;  1RRB A;  4DHZ E;  4HWI B;  3UQA A;  4OVU A;  1P98 A;  3H1U A;  3QA8 A;  1WI0 A;  4GXB A;  3KUZ A;  2LVP A;  4KDI C;  5G2N A;  2YLM A;  4LDT D;  3LDZ E;  1UEL A;  3ZNH B;  4IC7 B;  4KSK C;  3PSE B;  1WXA A;  3AU4 A;  4TV3 A;  4KIK A;  4EZL A;  5AZG A;  3ZVV A;  2UWQ A;  1A5R A;  2DHZ A;  3APF A;  1WR6 E;  2GMI C;  4AUQ C;  3QCA A;  2RSU A;  5AEK B;  4PS3 A;  3VUW A;  3VFK A;  3DBL I;  3W1Y A;  4LJO B;  1KM7 A;  3ZRF A;  3VDZ A;  1G6J A;  2CHW A;  2KC1 A;  2KZR A;  4EFO A;  2IY1 B;  3RYT A;  4NY0 A;  3JSV B;  2W9N A;  3RCZ A;  2IO0 B;  3NS8 A;  1V5T A;  2LVQ A;  3B0A A;  3AXC A;  2KK8 A;  4AP4 C;  2XBB C;  4E3C A;  1YQB A;  2JY6 A;  2L7R A;  2LJ5 A;  2JXX A;  1SIF A;  2KHW B;  2LWP A;  3JSV A;  4GGQ A;  1P1A A;  3WAL A;  4GB9 A;  4XX5 A;  3TCA A;  2KC2 A;  2MSE D;  4W9F A;  5E6N A;  2LGX A;  2ASQ A;  4HPL B;  1LM8 B;  4JIO U;  4BVU C;  2J0K A;  3A1Q A;  1CMX B;  2KVR A;  3R66 C;  1J19 A;  1WFY A;  2BKR B;  4W9D A;  2KTR B;  2ZZP B;  1KOT A;  2R2Q A;  2DAJ A;  3CMM B;  2BYV E;  5CTR C;  2BWE S;  4EOY A;  2Z0D B;  2G45 B;  3H7S A;  2ZNV B;  4HLE A;  5TR5 A;  2MQJ A;  2FUH B;  3DOW A;  2N4F A;  1WM3 A;  4NPN A;  3HIZ A;  4FLH A;  1LFD A;  2Z59 B;  4ZYN A;  4FA6 A;  4G0N B;  1GJZ A;  3TBL D;  1EF5 A;  4BBN F;  1P9D U;  2KTF A;  1Z5S B;  1WYW B;  4N9F 4;  2ZEQ A;  2N7E A;  3P2B A;  2KJH B;  2M1M A;  5D7G A;  1HE8 A;  3MTN B;  2FAZ A;  1TGZ B;  2KMC A;  2BKF A;  1P0R A;  3NY5 A;  4DXA B;  2HD5 B;  5EDS A;  2ZPN A;  2B3A A;  1U4A A;  1TBE A;  3APD A;  3GZN I;  4WAA A;  3UIO B;  3V60 A;  2KDI A;  4RM8 A;  2L76 A;  4ANW A;  4K81 A;  4DWF A;  2JRH A;  3ZDM C;  1E8Y A;  1WXS A;  2GBJ A;  1FXT B;  2KWV B;  4ZRK A;  4W9G A;  1WGG A;  4F7Z A;  2XK5 A;  1I35 A;  3A9J B;  4CHK A;  1KJT A;  4IWO A;  2M8S A;  3DDC B;  4EEW A;  3RT3 B;  3PT2 B;  3PRM B;  1WIA A;  2RPQ A;  1Q1O A;  4E74 A;  1V86 A;  2XK5 B;  4DK5 A;  1IYF A;  3JW0 X;  5AZF A;  4ANX A;  3M63 B;  2PE9 A;  2EMS A;  1IPG A;  4DHJ D;  3VH4 B;  2LGD A;  3QQ8 B;  4DHZ B;  4BKS D;  5LXH A;  2MW5 A;  2WYQ A;  3QAR A;  3DBS A;  4ZDV A;  4NJ6 A;  5J17 A;  1WE6 A;  1UBI A;  4IG7 B;  1E8X A;  3W1S A;  1SE9 A;  2K8B A;  4K7W A;  2V3S A;  3VXW A;  4MEM A;  2L05 A;  4JL9 A;  4MSM B;  2KFJ A;  4FN2 A;  1WXV A;  2N9X A;  3KYC D;  2IBI B;  2L3Z A;  5J18 A;  1WJ4 A;  4I6N B;  2MBQ A;  3M3J A;  3OJ3 A;  4AJW A;  5DPS A;  4RMA A;  2AL3 A;  3H7P A;  3IBE A; 
#chains in the Genus database with same CATH topology
 4XYC A;  4JGH B;  5CHF A;  3GS2 A;  2RDB C;  1F52 A;  3AN1 A;  3SDL C;  1WGR A;  1UNS A;  4C56 C;  4HDQ A;  1XEE A;  2FIF A;  1FEH A;  2ZVO A;  2MBH A;  5D94 A;  1ZDX A;  3AH7 A;  4IOI E;  3RNB C;  3W2D A;  3TL5 A;  4GOC A;  4CYE A;  1E9M A;  2EKE C;  3GE8 C;  4GDL B;  4HXD A;  4WWO A;  1ZE3 D;  1WMH A;  3VUX A;  2PIA A;  3O13 A;  4BKS A;  1JWU D;  2L00 B;  3Q3N C;  4LNF A;  2KN5 A;  1CQV A;  1D4B A;  2J0J A;  4L1B A;  3QX1 A;  1ZGU B;  4HPM B;  1WE7 A;  3PPA A;  4MT5 A;  5KHQ A;  2R2O A;  1E8Z A;  1RAX A;  4M02 A;  1PYW D;  1XXG A;  1JWA D;  1OQQ A;  2GLS A;  4TKN A;  1Z2M A;  1QKZ A;  2PTL A;  2DZM A;  3MHS D;  3DQV A;  2RDH A;  4BFR A;  3Q8B A;  2C60 A;  3BVM A;  2KDE B;  3JYU A;  4KVG B;  3IHP C;  3CWI A;  2L0F A;  3MJW A;  1P3Q U;  2KVZ A;  4YL8 A;  4DBG A;  3N32 A;  4II3 B;  3W5V B;  1CK1 A;  2UYZ B;  2Z0E B;  2NCN A;  2RDG A;  1RYJ A;  1VJK A;  2JQR B;  1WY8 A;  3SFE B;  4A55 A;  2N1W A;  3U2S C;  2BTE A;  3N3K B;  3RNG C;  1ZUD 2;  4LNO A;  4RM9 A;  3FKY A;  3O65 B;  2WDT B;  2M4N A;  4S0R A;  1RLF A;  1FFU A;  2YVC A;  2MWS B;  2HJ1 A;  3WAP A;  1SJE D;  1PQS A;  4MGK E;  2BWF A;  2IZV B;  4KZC A;  4W9J A;  4KKJ A;  5E6J A;  2KTR A;  2PEA A;  2KMM A;  4WH4 A;  3CIR B;  1R4N B;  3FIL B;  2NTS A;  2K25 A;  4LNI A;  2BVC A;  3Q14 C;  3DVN V;  3X0W A;  3V3X A;  1SB3 C;  2QSD A;  4HK2 A;  4TUU A;  4JX1 C;  3I3T B;  1L7Y A;  3QHT A;  3VRA B;  2KAN A;  2N9E B;  5CX3 A;  3T3N A;  2VH1 A;  4HDO A;  2D3G A;  3MC8 A;  3EGR A;  1HQR D;  3JVZ X;  3UIN B;  4WWP A;  1DOI A;  2AQ3 B;  4FXC A;  1H4R A;  4ICU A;  1DOX A;  2JVC A;  3PGE A;  3H8H A;  2KLG A;  4II2 B;  3VTW A;  3ETR A;  3RZW C;  2FCQ A;  2WDR B;  4YTP B;  1I4Q A;  4MM3 A;  2K9X A;  3CSF A;  3VAW A;  4ACF A;  1QOF A;  1Y8R C;  1WRD B;  4MSQ B;  4N58 A;  2HTH A;  1PDX A;  4ZRI A;  2ZCB A;  3VUY A;  4G3X B;  2WX0 A;  3HM3 A;  1JCK B;  3H7P B;  2WHI A;  2L83 A;  1SIJ A;  4GU2 A;  4MJS A;  4KKI A;  1VR9 A;  1L4D B;  1MG8 A;  3PHW B;  1WZ0 A;  5FKA C;  3ZYY X;  3BYT B;  2K8C A;  1VD2 A;  2KDB A;  4GSW A;  4P6V F;  1I42 A;  2ONQ A;  4C7Z A;  2MX2 A;  5G5G A;  5L83 A;  3E9S A;  2XNA C;  2AYO B;  3APC A;  3IXS A;  3VTU A;  5LXI B;  3N1Z C;  2YEP F;  4OZB A;  2NPT A;  2SAK A;  2JUO A;  3R3M A;  2NTT A;  4XGA B;  2JZ3 B;  1L5P A;  2PVO D;  1N61 A;  1Q10 A;  1E5W A;  1QOA A;  2KLC A;  4K3B A;  1VLB A;  4TMA B;  1XLO A;  2VZK D;  2DZI A;  2FBW B;  4KV2 A;  1VCB A;  3L10 B;  1NDD A;  1T0Y A;  3PRP B;  2MJD A;  2NBV B;  3PZD A;  2E6X A;  1FD6 A;  3KUC B;  1RM6 C;  2C7N B;  2KT7 A;  3L13 A;  4A90 A;  2IO3 B;  4IM2 A;  1WX8 A;  4B6W A;  2K6Q A;  1T0S C;  1SJH D;  2KWU B;  2WP9 B;  2JYT A;  1B1Z A;  2ZNV C;  3KUD B;  1F1H A;  1NBF C;  2QDF A;  1AAR A;  3ZNI D;  1EO6 A;  4KGT A;  3ZNG C;  4KGS A;  3Q8C A;  2INP E;  2KNB A;  1LQB A;  3AE5 B;  4GIV A;  4WJO A;  3QIJ A;  2LMC A;  4C4V A;  5FR6 A;  3NHE B;  3CF6 E;  4DHZ E;  4HWI B;  1FMA D;  3QA8 A;  1WI0 A;  1SE3 A;  2QCZ A;  4RGM A;  4KIK A;  4EZL A;  1A5R A;  2L1A A;  1WR6 E;  3DWM A;  2JXT A;  4AUQ C;  4PS3 A;  1YJI A;  3OWE B;  4XDC A;  3PZ7 A;  2KZR A;  1FXI A;  4EFO A;  1KRH A;  5BMG A;  3RYT A;  3RCZ A;  1SEB D;  2LJ5 A;  1SIF A;  3MFG A;  1P1A A;  4GB9 A;  4RGT A;  3TCA A;  2LGX A;  1LM8 B;  1TS5 A;  4BVU C;  5FR3 A;  2LGS A;  4W9D A;  2KTR B;  1KOT A;  2R61 A;  2R2Q A;  5CTR C;  2G45 B;  3SEB A;  3H7S A;  4DXF A;  4RF0 A;  4FLH A;  1LFD A;  2Z59 B;  3Q8E A;  4P16 A;  1ZXI A;  2KTF A;  5EE1 A;  3P2B A;  2KJH B;  2M1M A;  5D7G A;  1HE8 A;  1BXT A;  1TGZ B;  1P0R A;  5EDS A;  1NYR A;  2ZPN A;  2MJE A;  3I57 A;  1U4A A;  3UIO B;  4RM8 A;  1HZ5 A;  2JRH A;  4AQ7 A;  1E8Y A;  1WXS A;  2MJ3 A;  1WGG A;  3A9J B;  4CHK A;  1N60 A;  1KJT A;  4YSZ B;  1C4P A;  1Q1O A;  4E74 A;  4DK5 A;  1IYF A;  3JW0 X;  1DGJ A;  4ANX A;  3M63 B;  2WGS A;  1TZO A;  3QQ8 B;  3P4R B;  3QAR A;  1YOV B;  4NJ6 A;  1WE6 A;  4BZA A;  4IG7 B;  1DOY A;  4K7W A;  2D3B A;  2V3S A;  3VXW A;  3B9J A;  2D5G A;  1BML C;  1RFK A;  1HA5 A;  2L3Z A;  3U52 E;  3M3J A;  4AJW A;  2AL3 A;  3VR8 B;  3IBE A;  3PLU A;  3J9C A;  4GDK A;  4JLC A;  3RZF A;  1BUI C;  1PGB A;  5CHV C;  5BYQ A;  4WWN A;  4FJY A;  2KMA A;  2K5P A;  3UF8 A;  2DEN B;  5TSS A;  2HDE A;  4YWG G;  1E10 A;  4QAY A;  4M00 A;  3PZ8 A;  5D6J B;  3IAM 1;  3QK0 A;  1WJ6 A;  3HK0 A;  1TIF A;  3M95 A;  4TSS A;  1S3S G;  3MC0 B;  4K7U A;  2LXC A;  2MA9 B;  2WXK A;  3C0R B;  1GC6 A;  3V62 A;  1GC7 A;  1E7V A;  1LO5 D;  2NPT B;  4US8 A;  4JQW C;  4IWQ A;  1MFW A;  2CU1 A;  1TS2 A;  3URY A;  3DBR I;  3VQI A;  1STE A;  1S1Q B;  4W9H A;  2I1J A;  3V6E B;  2LFI A;  4OVV A;  3AV8 A;  2A4Z A;  3MHZ A;  1TKG A;  3NZU A;  1KLU D;  3A4R A;  3IVF A;  1V81 A;  2HE7 A;  5DPW A;  3P63 A;  1ZDV A;  1MVK A;  3ZDT A;  1V6E A;  2FID A;  2K22 A;  3NOB A;  4J3O D;  2G1E A;  4ZHP A;  4P7I A;  4W9L A;  2JWZ A;  5BO4 B;  2I1K A;  1NI2 A;  4RF1 A;  2N9L A;  1K52 A;  3MJ5 A;  1M4V A;  4OVZ A;  2O6V A;  1UGJ A;  2DZK A;  5MPO A;  3IG3 A;  3AEF B;  5GXG B;  4KIK B;  3ZRC A;  2BW2 A;  4ZRQ A;  1J0G A;  4IM3 A;  5L95 C;  1OFF A;  3WA0 A;  2GBK A;  1R4M I;  2KDF B;  4H2A A;  5HKH A;  2L8J A;  1WXM A;  2KX3 A;  1EU4 A;  2H88 B;  2OJR A;  3L17 A;  2LVO A;  2C7M B;  2BYF A;  2V0G A;  2LUM A;  2RMM A;  1I4R A;  1TTN A;  2G4D B;  3PVL A;  1UZX B;  2MP2 B;  2KKC A;  2LUE A;  1D3Z A;  4J6I A;  3W9C B;  1E8W A;  2KWC A;  3BIN A;  3RNA C;  1WGH A;  3WIM A;  4PYZ A;  3TEW A;  2GOW A;  2N7J A;  2WXG A;  3EFU A;  3N30 A;  2LRW A;  3K9P B;  4B0E A;  2PE6 B;  5D2M B;  1LXD A;  3R2I A;  5GMV A;  1C4A A;  1M94 A;  2N0S B;  3EA6 A;  1IP9 A;  2RPV A;  4G50 A;  1OTR B;  3P4S B;  1E90 A;  3UI3 A;  3AE6 B;  4MH0 E;  1C77 A;  4M8N A;  3TIX A;  1TY2 A;  3VVW B;  3UGB B;  4IW0 A;  1JW9 D;  1WX9 A;  4X57 B;  1F2R C;  3R7R A;  2EMT A;  1YIW A;  3DPD A;  2V4I B;  3DBH B;  3H6N A;  3ZJU A;  3VH3 B;  1YNT E;  1HXY D;  2N7D A;  2K3U A;  2ON8 A;  1NI3 A;  1UH6 A;  2QJL A;  2JT4 B;  1BT0 A;  2LGY A;  1C3T A;  2KJ6 A;  1EUV B;  1EF1 A;  1TY0 A;  2WX1 A;  2DZJ A;  3PS6 A;  4NZL B;  5BMH A;  2L32 A;  3A9J A;  4KGR A;  3AEC B;  3FC4 A;  2AEH A;  2FCS A;  2MLB A;  3KWV A;  3NJT A;  1FRR A;  2WXQ A;  1V1P A;  2AWT A;  2W3S A;  1L4Z B;  1GUA B;  2X38 A;  2BB5 A;  1YJ1 A;  2OED A;  1UGM A;  2CJO A;  2MH7 A;  2BS2 B;  3NUH B;  2OJW A;  2PLP A;  2RGF A;  1R4N I;  2K8H A;  1WX7 A;  1Y56 A;  1V1O A;  1YN5 A;  2SEB D;  5BYR A;  3Q3F A;  4IKG A;  3A9K A;  3AI5 A;  1WR1 A;  4Q2J A;  1PFD A;  4KDL B;  4N59 A;  1AW7 A;  5JH5 C;  4BKT A;  4OW0 A;  3IFW B;  1FIQ A;  2BS3 B;  4OZA A;  2CJN A;  3DVG X;  2KJR A;  3PHX B;  2LJI A;  2DNF A;  4WQO B;  1JRO A;  1ZPS A;  2BB6 A;  2IY0 B;  2N1V A;  4B95 A;  2UU7 A;  1AN8 A;  3AUL A;  4D2K A;  4DXG A;  3ZKJ C;  2IYD B;  2MCN B;  2LD9 A;  3UQB A;  1K50 A;  2INN E;  1XF5 L;  1D6E C;  3ZUN A;  1CJE A;  3Q69 A;  3RMK C;  2V4L A;  1WGY A;  4WAF A;  3SR6 A;  4GMV A;  1Q0W B;  2IND C;  2WWZ A;  4BAX A;  3ZQ4 A;  4P1C C;  2WXL A;  1IBX B;  2IO1 B;  3RD2 A;  1FNV A;  1T3Q A;  2IDY A;  1FNW A;  4W9C A;  3AE4 B;  1OQY A;  4EUT A;  4CQN A;  1K8R B;  5D3I B;  3OG5 A;  2BBC A;  4WQM A;  4FJZ A;  4PS7 A;  2LI5 A;  3BZD B;  2D3A A;  3ZTD A;  3IT4 B;  2X8X X;  2LEK A;  5HI1 A;  1P98 A;  3H1U A;  4P1B C;  5G2N A;  4LDT D;  3LYY A;  3ZNH B;  4KSK C;  3AU4 A;  2WS3 B;  4RFB A;  1F0Z A;  3B2F A;  1PGX A;  1WSP A;  2RSU A;  3C19 A;  3KLS X;  5AEK B;  5FK9 C;  3VUW A;  3ZRF A;  3DBL I;  4LJO B;  1KM7 A;  2CHW A;  2IY1 B;  1KLG D;  5EE9 A;  4DQO C;  1WWT A;  2LVQ A;  2J53 A;  1WXQ A;  3B0A A;  4RGO S;  3DBR B;  4UDU C;  1YQB A;  2L7R A;  4AS1 A;  2DLB A;  2B76 B;  2LWP A;  2J52 A;  1OQR A;  5AUK A;  5AUI A;  4LLG M;  2PKO A;  4W9F A;  5E6N A;  1MHX A;  2ASQ A;  4EE2 A;  4JIO U;  1F2R I;  3AEA B;  3ZJT A;  1JAL A;  3HUI A;  2ZZP B;  2DAJ A;  2BYV E;  2BWE S;  4PK1 A;  4ARC A;  1L6U A;  5C3J B;  1I4P A;  5IN7 A;  3DOW A;  2N4F A;  3HIZ A;  1NEK B;  2MEK A;  4ZYN A;  4G0N B;  3TBL D;  4BBN F;  2I2Y A;  1HZ6 A;  1P9D U;  3RN9 C;  1WYW B;  2JU6 X;  3L4P A;  2N7E A;  1LGR A;  1J7C A;  3MTN B;  1TBE A;  4ANW A;  2KDI A;  3ZDM C;  3HRD D;  3RNF C;  4ZRK A;  4F7Z A;  1I35 A;  4IWO A;  3DDC B;  4EEW A;  1JRP A;  3PT2 B;  1V1P B;  4LTU A;  2CU3 A;  1DYQ A;  3Q8A A;  1L6V A;  3VH4 B;  2IGG A;  4PT5 A;  4DHZ B;  5LXH A;  3DBS A;  1E8X A;  3KQ4 A;  1SE9 A;  2K8B A;  2MHJ A;  2KAJ A;  1PGA A;  3ZXV A;  4JL9 A;  2KFJ A;  3IT6 B;  4HKZ E;  3KYC D;  1FFV A;  1WJ4 A;  1ET6 A;  2WQY B;  4IM0 A;  2A5U A;  3NVZ A;  3EHV A;  3ZIM A;  1RFA A;  1WF9 A;  1KH0 A;  1ZW7 A;  2FCN A;  2KOX A;  1TT5 B;  1ISN A;  4DDI D;  4EZJ A;  4GDL A;  1WM2 A;  2NVU I;  1JWM D;  3TEZ A;  1XT9 B;  1I4G A;  1CZP A;  1XQQ A;  1YN4 A;  4WJN A;  1TKE A;  3E56 A;  3AU5 A;  1L0Y B;  1B9R A;  1GB1 A;  1P7F A;  4L2Y A;  5EE0 A;  1A70 A;  2ZW0 A;  5DCN A;  3W5U B;  3DVG Y;  4XWW A;  3HM6 X;  3ML8 A;  2CKH B;  3AEE B;  3EEC A;  3U30 A;  5G55 A;  1V5O A;  4XDD A;  2N9P C;  1J7B A;  2QHO A;  1IBX A;  1NEN B;  2KFK A;  2BT6 A;  2JZZ A;  1UBQ A;  4DDG D;  2J7Q B;  4C80 A;  1YQ3 B;  2VZK B;  2M0X A;  2GB1 A;  1D5X C;  4IWP A;  4OZC A;  3EFC A;  5IAA C;  4REZ A;  3EC8 A;  3GOE A;  1N62 A;  3L08 A;  1KTK A;  2PVG C;  2QIE B;  3R8B A;  4NJ7 A;  1MI0 A;  3SHQ A;  3N9Y C;  3OJ4 B;  1N6Z A;  4FBJ B;  4MDK E;  4A3P A;  5C2T B;  4OHJ A;  2REX A;  3KYD D;  2H89 B;  1L0X B;  1T0Q C;  3AE1 B;  4AWJ A;  3BVZ A;  4WWM A;  5IOI A;  3NZS A;  5LLI A;  5JHA A;  1OGW A;  2WXR A;  4ZRJ A;  3VTV A;  5E6O A;  3U4E G;  1WJU A;  2ZJD A;  3R7Q A;  3RPF C;  5T8I A;  3ZO5 B;  5J2R A;  3N20 C;  5I4D A;  4YSY B;  1ZKH A;  1J7A A;  4RMA A;  2JF5 A;  2KD0 A;  2ZVN A;  2CHX A;  1QQR A;  1V8C A;  1GAQ B;  2DYO A;  4ASW C;  5JZE B;  3DHH C;  3RUL A;  1OEY J;  4NQL B;  2KO3 A;  3A33 B;  1L2N A;  1UWX A;  1XLQ A;  1V2Y A;  1V80 A;  2K0P A;  4M0W A;  4URK A;  3QJZ A;  1SE2 A;  3RUI B;  4HKQ A;  2C9W B;  1ZOY B;  3VHT C;  3P4Q B;  2DAF A;  1C1Y B;  4O1N A;  2M0A A;  2GBN A;  3VRB B;  4HCP B;  3L16 A;  2V9H A;  3PLV A;  3LJ3 A;  2MBB B;  2VRR B;  4US9 A;  5EE3 A;  3EUB 2;  4HPP A;  4XE0 A;  2KYW A;  1SF0 A;  2WXM A;  3CST A;  1YX6 B;  1GPX A;  4HRS A;  2NR2 A;  2AL6 A;  2D3C A;  1QIL A;  4HEA 1;  1HTQ A;  4W9E A;  4ZYS A;  2Y3A A;  4MJS B;  1WZ3 A;  5CHW A;  1XO3 A;  2KQ4 X;  4E71 A;  2JRI B;  1RWS A;  3NS1 A;  2XEW A;  3TMP B;  5DPR A;  2D07 B;  5LNK 1;  2MBO A;  1MJD A;  2HJ8 A;  1UWM A;  1C78 A;  2WXF A;  1WRI A;  2C5L C;  2WDV B;  2LZ6 A;  1R7S A;  3WAO A;  4GN1 A;  3N1Y C;  3AE3 B;  4NJC A;  1QOG A;  2KQ7 A;  2DBY A;  3DHI C;  5H92 C;  3A9K B;  4ANV A;  2RR9 A;  3BII D;  2NBW B;  2LHD A;  2BS4 B;  1L0V B;  4M8M A;  3DVN U;  1OEY A;  3AED B;  2M56 B;  2W3R A;  3B1L X;  1FCL A;  1JRU A;  4A9A A;  1TS3 A;  3TEY A;  3T9L A;  3ONS A;  2BPS A;  4I6L B;  4LCD E;  2MBE A;  1FO4 A;  4NAW B;  3ABV B;  1YJJ A;  2PJH A;  4I6P A;  3LB8 C;  2BF8 B;  3BWU D;  1V49 A;  1EU3 A;  4MH8 A;  3ZW3 A;  2MRP A;  3H9D A;  3ALB A;  2KAC A;  1C4C A;  4MAC A;  2QMT A;  1XD3 B;  2LXA A;  2HTM E;  1ENF A;  3DHG C;  3KW5 B;  3AB5 A;  2GRI A;  4LJP B;  5JHB A;  1XLN A;  4NNJ B;  1YX5 B;  3Q2A C;  3ZNZ B;  2IO2 B;  2FCM A;  4A8X C;  4ICV A;  2WU5 B;  4YT0 B;  4YTN B;  1F77 A;  4RCO A;  2I38 A;  2QC8 A;  4LDT B;  2O6V D;  1RRB A;  2V3P A;  4KDI C;  2YLM A;  4C4V B;  3LDZ E;  2WU2 B;  1UEL A;  1WXA A;  4TV3 A;  1NYQ A;  5AZG A;  3ZVV A;  4YSX B;  2DHZ A;  2GMI C;  3QCA A;  1C76 A;  3VFK A;  3I63 C;  3VDZ A;  3HVZ A;  4NY0 A;  3JSV B;  2W9N A;  3NG0 A;  2IO0 B;  3NS8 A;  1V5T A;  4HJG E;  2NMQ A;  4YTM B;  1T5X D;  3BYY B;  2KK8 A;  1KF6 B;  4AP4 C;  2JY6 A;  1QLB B;  4XX5 A;  2KC2 A;  1I7H A;  2FUG 1;  4ZOH C;  3AMZ A;  2PW9 A;  3A1Q A;  1CMX B;  2KVR A;  3R66 C;  5BYS A;  1J19 A;  2BKR B;  4RNA A;  4JE3 B;  3CMM B;  2INC C;  2Z0D B;  3Q3O C;  2FUH B;  1GJZ A;  4RGN A;  4YXD B;  1EWY C;  3NVY A;  3AE9 B;  1N5X A;  2FAZ A;  2BYT A;  3NY5 A;  4DXA B;  2B3A A;  3V60 A;  3GZN I;  1SBB B;  2L76 A;  1K51 A;  1XCQ L;  1VRA B;  2GBJ A;  2KWV B;  2WNM A;  2XK5 A;  1EM7 A;  3V05 A;  3RT3 B;  2GI9 A;  1ZP0 B;  2W82 A;  2RPQ A;  5HG2 A;  5AZF A;  2PE9 A;  3VR9 B;  4BKS D;  2MW5 A;  5J17 A;  1UBI A;  2Z8L A;  2PMV A;  2ZW1 A;  4MEM A;  2L05 A;  4GLS C;  4MSM B;  1WXV A;  2N9X A;  2IBI B;  5J18 A;  4I6N B;  2MBQ A;  5DPS A;  3ZJV A;  1FNU A;  2PPH A;  3MP9 A;  3WCQ A;  1FCC C;  3QAQ A;  3BK1 A;  2VH2 A;  4BOZ B;  3ZXR A;  1VZ8 A;  4GDK B;  4K3C A;  3AE7 B;  1QZE A;  2J42 A;  3R2T A;  4C7Y A;  2OHF A;  4WIP A;  4FHK A;  2WXH A;  3AE8 B;  2V3N A;  3Q6B A;  2L52 A;  4WJP A;  1IGC A;  2OOB B;  3GE3 C;  2G3Q B;  1WGK A;  2N9K A;  4ARI A;  4F1S A;  1AYF A;  1I4X A;  3GB1 A;  1Q5W B;  1YN3 A;  1X1M A;  1C79 A;  3TJP A;  4XZ4 A;  3NVV A;  4FJV B;  2J0M A;  3A4S C;  3GZN B;  2O2V B;  2DX5 B;  2CHZ A;  3KVF B;  4WJQ A;  4FAD A;  3HHM A;  4BOS C;  1YQ4 B;  4W9K A;  2K6D B;  4A6Q A;  2K1F A;  2AQ2 B;  3KH0 A;  3LXF A;  4XC2 A;  2YEP B;  1UF0 A;  1ACC A;  2CR5 A;  1MPE A;  3KWL A;  1KFY B;  3DBH I;  3WAM A;  4R3D A;  2RD0 A;  4FHJ A;  2AQ1 B;  2LRU A;  2IJ0 A;  4PYU A;  1TJE A;  1SE4 A;  1UD7 A;  2KFK B;  5JXV A;  2JPH A;  1KLV A;  2Y5B B;  2O6V B;  1D5Z C;  3ZLZ A;  3BVG A;  2KN4 A;  3ML9 A;  1SGH A;  1VZ7 A;  4KSL C;  2NBU A;  4MGZ E;  2ICI A;  2D2Q A;  2W54 A;  3RNC C;  3TSS A;  2MP2 A;  1MHH E;  3PRZ A;  4ZHO A;  2Q5W D;  4TQ0 A;  4C00 A;  3C8Y A;  2KX0 A;  3PTF C;  4K7S A;  4PS8 A;  3IAS 1;  2IGH A;  5IKC M;  2KXJ A;  1AWD A;  3ECI A;  2KWD A;  3AEB B;  4CO7 A;  1E0Z A;  3T8M A;  3D32 A;  3FIL A;  4BBN C;  2DYM A;  3A1Q B;  3U8Z A;  1T6B X;  2LAS A;  1F9J A;  3HVD A;  1K53 A;  2LGI A;  2ZCC A;  1R4M B;  3PRE A;  3QWZ B;  4KZ0 A;  4N6E B;  4TQ1 A;  2WXJ A;  2GBR A;  1FRD A;  5E6P A;  5C1Z A;  5H8Y E;  4AJY B;  3ZGZ A;  2M17 A;  2WXN A;  1JWB D;  4HJK A;  1E6E B;  2WXO A;  2JSV X;  3ZTC A;  3B08 A;  2QEJ C;  3SD5 A;  1TKY A;  4JPS A;  1SXT A;  3K9O B;  1YD8 U;  3SU8 X;  2WXI A;  4M0W B;  1GOZ A;  4MGY E;  2TSS A;  2D10 A;  3OAW A;  4BKG A;  1T0R C;  2XN9 C;  3U7Z A;  3AM9 A;  1WGD A;  5IO9 A;  2IGD A;  2JWU A;  2ACZ B;  3QC8 B;  1N63 A;  2G4S A;  2CS4 A;  1TYG B;  3S2A A;  3BY4 B;  4HVB A;  3L54 A;  2KDM A;  3PV1 A;  2BYE A;  2BGF A;  3WAN A;  3V61 A;  3V6C B;  3DCG A;  5AZH A;  1J8C A;  5C23 A;  2AX5 A;  1FM0 D;  3UIP B;  5G5H A;  4NQK E;  4IUM B;  1ZXH A;  5KHO A;  3ENE A;  3SFD B;  1TS4 A;  1SSN A;  1FPY A;  5DPT A;  1N5W A;  3NZ3 A;  3Q3J A;  1VDV A;  1EWC A;  1ESF A;  1HTO A;  3MC9 A;  3I5J C;  2QIL A;  3N1X C;  3AEG B;  3NVW A;  2J4X A;  3P1M A;  2DWQ A;  4S17 A;  2DYB A;  2JYE A;  3GP7 A;  4A20 A;  3X23 A;  1V97 A;  2KQS A;  1JQ4 A;  4KX6 B;  4DHJ B;  2K39 A;  1E7U A;  1H8C A;  2L0T A;  5IP4 D;  4EKU A;  4EZK A;  5D3D A;  4G11 A;  4K1R B;  3M62 B;  4ZRP A;  2O2V A;  3W1S C;  4AOF A;  1GG3 A;  3B2G A;  2WDQ B;  2GBM A;  5BMI A;  1UUP A;  3TUO A;  2Y5P A;  3OLM D;  4F8C B;  2ZPY A;  1TZ1 A;  3RI7 C;  3Q8F A;  1WMH B;  2V1Y A;  4L23 A;  4HCN B;  1ROE A;  1WJN A;  4B9K A;  4HRO A;  1C9F A;  4NAW A;  3L0W B;  2Y5C A;  3U7D A;  1V9J A;  1D5M C;  2EKI A;  1XCT L;  2NS5 A;  1I4H A;  5IA7 A;  4W9I A;  2D11 A;  4MGI E;  4WUR A;  2E3T A;  4A3O A;  4MEL A;  1VZ6 A;  2JX5 A;  1IUE A;  4FUL A;  5HHD G;  4NAM A;  2FNJ B;  4ANU A;  1GNU A;  2C7H A;  1WH3 A;  3T3O A;  3UQA A;  4OVU A;  1NVI D;  4GXB A;  3KUZ A;  2LVP A;  4IC7 B;  3PSE B;  2FE8 A;  3I9V 1;  2JZP A;  2UWQ A;  1XLP A;  3APF A;  3PO0 A;  2WXP A;  3W1Y A;  1QF6 A;  4JWS C;  4ITK A;  1G6J A;  3FAH A;  2KC1 A;  1P7E A;  2LHE A;  4XWT A;  1GB4 A;  2M19 A;  1WYG A;  3AXC A;  2IPK D;  4USA A;  3Q3M C;  2XBB C;  4E3C A;  2JXX A;  2KHW B;  3JSV A;  1FXA A;  4GGQ A;  2W55 A;  3WAL A;  3P4P B;  3NRZ A;  2MSE D;  1HEZ E;  1ET9 A;  4HPL B;  4LNN A;  2J0K A;  1E7P B;  1WFY A;  2G9H D;  3RNE C;  4IDI A;  4LK0 M;  2WLB A;  1QT9 A;  4EOY A;  2ZNV B;  4HLE A;  5TR5 A;  2MQJ A;  1WM3 A;  4NPN A;  4FA6 A;  1EF5 A;  4JWU C;  4M01 A;  4N9F 4;  2ZEQ A;  3TEX A;  2KMC A;  2BKF A;  2HD5 B;  3DWG C;  4WAA A;  3APD A;  1JWS D;  4B0M A;  1IGD A;  1PUT A;  1JML A;  4K81 A;  4DWF A;  4LNK A;  3DBL B;  1FXT B;  3BK2 A;  4W9G A;  2M8S A;  1YMH E;  3PRM B;  1WIA A;  4MM3 B;  5HFY A;  2BQQ A;  3AE2 B;  1V86 A;  2XK5 B;  2EMS A;  1IPG A;  4DHJ D;  2LGD A;  2WYQ A;  4ZDV A;  3RFZ B;  3W1S A;  4RH6 A;  1MG4 A;  3P42 A;  2EEL A;  1QOB A;  4FN2 A;  3OJ3 A;  1Z5S B;  3H7P A; 
#chains in the Genus database with same CATH homology
 3PLU A;  2PPH A;  4IM0 A;  4GDK A;  2A5U A;  4JLC A;  3RZF A;  5CHV C;  3QAQ A;  4WWN A;  4FJY A;  4JGH B;  2KMA A;  5CHF A;  3UF8 A;  2DEN B;  3EHV A;  4BOZ B;  3ZIM A;  3SDL C;  1WGR A;  1RFA A;  4GDK B;  1WF9 A;  4HDQ A;  2FIF A;  2ZVO A;  2MBH A;  1ZW7 A;  1QZE A;  5D94 A;  2FCN A;  2KOX A;  5D6J B;  1ISN A;  4DDI D;  3QK0 A;  1WJ6 A;  4EZJ A;  4GDL A;  4FHK A;  1WM2 A;  3HK0 A;  2NVU I;  3M95 A;  3TL5 A;  1S3S G;  4GOC A;  4K7U A;  2LXC A;  2MA9 B;  3C0R B;  4WJP A;  4CYE A;  2OOB B;  1GC6 A;  1XT9 B;  2G3Q B;  3V62 A;  1GC7 A;  1E7V A;  2EKE C;  2NPT B;  4GDL B;  4F1S A;  1XQQ A;  4HXD A;  4WWO A;  4JQW C;  4WJN A;  4IWQ A;  2CU1 A;  1Q5W B;  3DBR I;  1WMH A;  3VQI A;  3VUX A;  1X1M A;  1S1Q B;  4W9H A;  2I1J A;  3V6E B;  3TJP A;  4XZ4 A;  4BKS A;  4OVV A;  2A4Z A;  3AU5 A;  2L00 B;  4FJV B;  2J0M A;  3A4S C;  3NZU A;  2O2V B;  2KN5 A;  2DX5 B;  2CHZ A;  3KVF B;  2J0J A;  4WJQ A;  3A4R A;  5DCN A;  4FAD A;  3HHM A;  4BOS C;  3DVG Y;  3QX1 A;  1ZGU B;  4W9K A;  3IVF A;  4HPM B;  1WE7 A;  3PPA A;  3HM6 X;  2K6D B;  1V81 A;  3ML8 A;  2HE7 A;  2K1F A;  2CKH B;  3KH0 A;  2R2O A;  5KHQ A;  5DPW A;  3EEC A;  1E8Z A;  1RAX A;  4XC2 A;  3U30 A;  5G55 A;  1V5O A;  3ZDT A;  2CR5 A;  2N9P C;  1V6E A;  2FID A;  4TKN A;  1Z2M A;  3DBH I;  2QHO A;  3WAM A;  3NOB A;  2RD0 A;  2DZM A;  2KFK A;  3MHS D;  3DQV A;  4P7I A;  2JWZ A;  4W9L A;  4FHJ A;  5BO4 B;  2I1K A;  4BFR A;  2JZZ A;  1NI2 A;  2C60 A;  1UBQ A;  2LRU A;  2KDE B;  3JYU A;  4DDG D;  4KVG B;  3IHP C;  4PYU A;  2J7Q B;  2L0F A;  3MJW A;  2O6V A;  1UD7 A;  1P3Q U;  2KFK B;  2DZK A;  2M0X A;  3IG3 A;  2JPH A;  4IWP A;  2Y5B B;  4KIK B;  4YL8 A;  3ZRC A;  4DBG A;  3N32 A;  1KLV A;  5IAA C;  4II3 B;  1J0G A;  3EC8 A;  4IM3 A;  2O6V B;  3GOE A;  2UYZ B;  3ZLZ A;  2Z0E B;  2NCN A;  5L95 C;  3L08 A;  3ML9 A;  1SGH A;  3WA0 A;  2GBK A;  1R4M I;  2KDF B;  4KSL C;  2NBU A;  5HKH A;  2L8J A;  1WY8 A;  4MGZ E;  1WXM A;  4NJ7 A;  2KX3 A;  3SHQ A;  2OJR A;  2N1W A;  3OJ4 B;  4FBJ B;  3L17 A;  2D2Q A;  4MDK E;  4A3P A;  3N3K B;  2MP2 A;  2LVO A;  2REX A;  3KYD D;  2C7M B;  2BYF A;  3PRZ A;  4RM9 A;  3O65 B;  2WDT B;  2M4N A;  4TQ0 A;  1TTN A;  1RLF A;  2G4D B;  3PVL A;  2KX0 A;  3PTF C;  2YVC A;  4AWJ A;  1UZX B;  4K7S A;  2MWS B;  2MP2 B;  4PS8 A;  3WAP A;  1PQS A;  3NZS A;  2KXJ A;  5LLI A;  1OGW A;  5JHA A;  2KKC A;  2LUE A;  4ZRJ A;  3ECI A;  1D3Z A;  4J6I A;  3VTV A;  4CO7 A;  1E8W A;  5E6O A;  3T8M A;  3D32 A;  1WJU A;  4MGK E;  2DYM A;  3A1Q B;  2BWF A;  2LAS A;  3U8Z A;  4BBN C;  2ZJD A;  2IZV B;  4KZC A;  1F9J A;  4W9J A;  2KWC A;  3R7Q A;  3BIN A;  2KTR A;  3ZO5 B;  2PEA A;  5J2R A;  1WGH A;  3WIM A;  4PYZ A;  2ZCC A;  2K25 A;  1ZKH A;  2GOW A;  3EFU A;  3N30 A;  3PRE A;  2LRW A;  2JF5 A;  2KD0 A;  3QWZ B;  3DVN V;  4KZ0 A;  3X0W A;  3K9P B;  4TQ1 A;  2PE6 B;  2ZVN A;  2CHX A;  5D2M B;  1LXD A;  5GMV A;  4ASW C;  1M94 A;  2DYO A;  4HK2 A;  4TUU A;  5JZE B;  2GBR A;  5E6P A;  3I3T B;  5C1Z A;  3RUL A;  1L7Y A;  4AJY B;  1OEY J;  4NQL B;  2KO3 A;  3A33 B;  3QHT A;  1IP9 A;  2M17 A;  2KAN A;  2N9E B;  4G50 A;  5CX3 A;  1L2N A;  1OTR B;  4HJK A;  1V2Y A;  1E90 A;  1V80 A;  4HDO A;  4MH0 E;  2D3G A;  3ZTC A;  4M8N A;  3B08 A;  4URK A;  3QJZ A;  3TIX A;  3JVZ X;  3RUI B;  3VVW B;  3SD5 A;  3UIN B;  3UGB B;  4IW0 A;  4WWP A;  3K9O B;  1YD8 U;  2C9W B;  3SU8 X;  1WX9 A;  4M0W B;  4X57 B;  3VHT C;  1H4R A;  4ICU A;  4MGY E;  2DAF A;  2JVC A;  3PGE A;  3R7R A;  2D10 A;  2EMT A;  1YIW A;  3DPD A;  1C1Y B;  3OAW A;  4BKG A;  3H6N A;  1WGD A;  3VH3 B;  2GBN A;  2KLG A;  4HCP B;  4II2 B;  3VTW A;  2N7D A;  3L16 A;  3PLV A;  3RZW C;  2FCQ A;  3QC8 B;  1UH6 A;  3LJ3 A;  2G4S A;  2CS4 A;  2JT4 B;  1BT0 A;  4MM3 A;  2LGY A;  3S2A A;  1C3T A;  3BY4 B;  3CSF A;  2KJ6 A;  3L54 A;  4HVB A;  1EUV B;  1EF1 A;  3VAW A;  3PV1 A;  2MBB B;  2VRR B;  2BYE A;  2BGF A;  3WAN A;  2WX1 A;  3CST A;  3V61 A;  2DZJ A;  3V6C B;  1Y8R C;  3PS6 A;  1YX6 B;  3DCG A;  3A9J A;  1WRD B;  2AL6 A;  2NR2 A;  4MSQ B;  5AZH A;  1J8C A;  5C23 A;  3UIP B;  2AEH A;  2FCS A;  2MLB A;  2HTH A;  4W9E A;  4NQK E;  4MJS B;  4ZRI A;  1WZ3 A;  2ZCB A;  2AWT A;  5CHW A;  3VUY A;  4G3X B;  1GUA B;  2WX0 A;  4IUM B;  3HM3 A;  4E71 A;  2JRI B;  5KHO A;  1YJ1 A;  3H7P B;  3ENE A;  1UGM A;  5DPT A;  4GU2 A;  4MJS A;  2XEW A;  3TMP B;  2RGF A;  5DPR A;  1MG8 A;  3PHW B;  1WZ0 A;  3Q3J A;  2D07 B;  2K8H A;  1R4N I;  2MBO A;  1WX7 A;  2K8C A;  1VD2 A;  2KDB A;  4GSW A;  2HJ8 A;  3Q3F A;  1I42 A;  2MX2 A;  3A9K A;  5L83 A;  3AI5 A;  1WR1 A;  4KDL B;  2C5L C;  2AYO B;  2LZ6 A;  3WAO A;  4GN1 A;  5JH5 C;  3APC A;  4BKT A;  3VTU A;  5LXI B;  2KQ7 A;  2DYB A;  3A9K B;  4ANV A;  3IFW B;  2NPT A;  2RR9 A;  2NBW B;  3DVG X;  4A20 A;  2JUO A;  2KJR A;  3PHX B;  3X23 A;  4M8M A;  3R3M A;  3DVN U;  4WQO B;  1OEY A;  2KQS A;  2JZ3 B;  4DHJ B;  2IY0 B;  2K39 A;  1E7U A;  2N1V A;  3B1L X;  4B95 A;  2L0T A;  1E5W A;  1H8C A;  4EKU A;  4EZK A;  2KLC A;  3AUL A;  4G11 A;  4K1R B;  1JRU A;  3M62 B;  3ZKJ C;  2O2V A;  3W1S C;  2IYD B;  3T9L A;  1GG3 A;  2LD9 A;  2MCN B;  2DZI A;  4AOF A;  3UQB A;  3ONS A;  2GBM A;  2BPS A;  4I6L B;  4KV2 A;  4LCD E;  1VCB A;  2MBE A;  3OLM D;  3L10 B;  4F8C B;  2ZPY A;  4NAW B;  1NDD A;  1T0Y A;  3ZUN A;  1TZ1 A;  1WMH B;  2V1Y A;  3PRP B;  2PJH A;  2NBV B;  4HCN B;  2V4L A;  1WGY A;  1WJN A;  2BF8 B;  3PZD A;  4I6P A;  4B9K A;  3KUC B;  1V49 A;  3ZW3 A;  2C7N B;  4NAW A;  4GMV A;  1Q0W B;  2MRP A;  2WWZ A;  3L0W B;  3H9D A;  3L13 A;  2IO3 B;  4IM2 A;  1WX8 A;  4B6W A;  2K6Q A;  3ALB A;  3U7D A;  1V9J A;  2KWU B;  2ZNV C;  1XD3 B;  3KUD B;  2IO1 B;  1NBF C;  2LXA A;  2NS5 A;  3RD2 A;  5IA7 A;  1AAR A;  3ZNI D;  3KW5 B;  1EO6 A;  5JHB A;  4LJP B;  4W9I A;  2D11 A;  4MGI E;  3ZNG C;  4NNJ B;  4W9C A;  1YX5 B;  4MEL A;  4A3O A;  1OQY A;  4EUT A;  3ZNZ B;  2KNB A;  1K8R B;  2IO2 B;  4FUL A;  1LQB A;  2FCM A;  4ICV A;  4GIV A;  4FJZ A;  2FNJ B;  4WJO A;  4PS7 A;  3QIJ A;  2LI5 A;  4ANU A;  1GNU A;  3ZTD A;  2C7H A;  5FR6 A;  1WH3 A;  3NHE B;  3CF6 E;  4LDT B;  2O6V D;  1RRB A;  4DHZ E;  4HWI B;  3UQA A;  4OVU A;  1P98 A;  3H1U A;  3QA8 A;  1WI0 A;  4GXB A;  3KUZ A;  2LVP A;  4KDI C;  5G2N A;  2YLM A;  4LDT D;  3LDZ E;  1UEL A;  3ZNH B;  4IC7 B;  4KSK C;  3PSE B;  1WXA A;  3AU4 A;  4TV3 A;  4KIK A;  4EZL A;  5AZG A;  3ZVV A;  2UWQ A;  1A5R A;  2DHZ A;  3APF A;  1WR6 E;  2GMI C;  4AUQ C;  3QCA A;  2RSU A;  5AEK B;  4PS3 A;  3VUW A;  3VFK A;  3DBL I;  3W1Y A;  4LJO B;  1KM7 A;  3ZRF A;  3VDZ A;  1G6J A;  2CHW A;  2KC1 A;  2KZR A;  4EFO A;  2IY1 B;  3RYT A;  4NY0 A;  3JSV B;  2W9N A;  3RCZ A;  2IO0 B;  3NS8 A;  1V5T A;  2LVQ A;  3B0A A;  3AXC A;  2KK8 A;  4AP4 C;  2XBB C;  4E3C A;  1YQB A;  2JY6 A;  2L7R A;  2LJ5 A;  2JXX A;  1SIF A;  2KHW B;  2LWP A;  3JSV A;  4GGQ A;  1P1A A;  3WAL A;  4GB9 A;  4XX5 A;  3TCA A;  2KC2 A;  2MSE D;  4W9F A;  5E6N A;  2LGX A;  2ASQ A;  4HPL B;  1LM8 B;  4JIO U;  4BVU C;  2J0K A;  3A1Q A;  1CMX B;  2KVR A;  3R66 C;  1J19 A;  1WFY A;  2BKR B;  4W9D A;  2KTR B;  2ZZP B;  1KOT A;  2R2Q A;  2DAJ A;  3CMM B;  2BYV E;  5CTR C;  2BWE S;  4EOY A;  2Z0D B;  2G45 B;  3H7S A;  2ZNV B;  4HLE A;  5TR5 A;  2MQJ A;  2FUH B;  3DOW A;  2N4F A;  1WM3 A;  4NPN A;  3HIZ A;  4FLH A;  1LFD A;  2Z59 B;  4ZYN A;  4FA6 A;  4G0N B;  1GJZ A;  3TBL D;  1EF5 A;  4BBN F;  1P9D U;  2KTF A;  1Z5S B;  1WYW B;  4N9F 4;  2ZEQ A;  2N7E A;  3P2B A;  2KJH B;  2M1M A;  5D7G A;  1HE8 A;  3MTN B;  2FAZ A;  1TGZ B;  2KMC A;  2BKF A;  1P0R A;  3NY5 A;  4DXA B;  2HD5 B;  5EDS A;  2ZPN A;  2B3A A;  1U4A A;  1TBE A;  3APD A;  3GZN I;  4WAA A;  3UIO B;  3V60 A;  2KDI A;  4RM8 A;  2L76 A;  4ANW A;  4K81 A;  4DWF A;  2JRH A;  3ZDM C;  1E8Y A;  1WXS A;  2GBJ A;  1FXT B;  2KWV B;  4ZRK A;  4W9G A;  1WGG A;  4F7Z A;  2XK5 A;  1I35 A;  3A9J B;  4CHK A;  1KJT A;  4IWO A;  2M8S A;  3DDC B;  4EEW A;  3RT3 B;  3PT2 B;  3PRM B;  1WIA A;  2RPQ A;  1Q1O A;  4E74 A;  1V86 A;  2XK5 B;  4DK5 A;  1IYF A;  3JW0 X;  5AZF A;  4ANX A;  3M63 B;  2PE9 A;  2EMS A;  1IPG A;  4DHJ D;  3VH4 B;  2LGD A;  3QQ8 B;  4DHZ B;  4BKS D;  5LXH A;  2MW5 A;  2WYQ A;  3QAR A;  3DBS A;  4ZDV A;  4NJ6 A;  5J17 A;  1WE6 A;  1UBI A;  4IG7 B;  1E8X A;  3W1S A;  1SE9 A;  2K8B A;  4K7W A;  2V3S A;  3VXW A;  4MEM A;  2L05 A;  4JL9 A;  4MSM B;  2KFJ A;  4FN2 A;  1WXV A;  2N9X A;  3KYC D;  2IBI B;  2L3Z A;  5J18 A;  1WJ4 A;  4I6N B;  2MBQ A;  3M3J A;  3OJ3 A;  4AJW A;  5DPS A;  4RMA A;  2AL3 A;  3H7P A;  3IBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...