2N1VA

Solution structure of human sumo1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics
molecule keywords Small ubiquitin-related modifier 1
publication title Structures of human SUMO
rcsb
source organism Homo sapiens
total genus 16
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2015-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2n1vA00
1J19A 4IUMB 4KV2A 3DVGY 4BKGA 3NY5A 2BGFA 4I6NB 3VTWA 3ZNHB 2NR2A 4MSMB 4E71A 2BYVE 5GMVA 3VH3B 1V86A 2MBEA 3UQBA 2NPTA 1IYFA 4ZRJA 5AZHA 2NBVB 2KX3A 3QA8A 3DBSA 4HCNB 4II2B 4MEMA 1WFYA 2CHZA 3A9JB 3L54A 3PRPB 4YL8A 3DVNU 1H8CA 4G0NB 2K6DB 3PHWB 3WAPA 4AUQC 2WWZA 3A1QA 1VD2A 4OVUA 3C0RB 3RZWC 3ML9A 4TQ1A 4FA6A 2EMTA 1V49A 4IM2A 4IM3A 4LDTB 2M0XA 3SD5A 3X0WA 3ENEA 3ZNID 3I3TB 3R66C 4F1SA 4JIOU 3IG3A 3DBRI 1EF1A 2FCQA 4TQ0A 3ZUNA 3CSFA 1UZXB 3KYCD 2KFKB 4F8CB 1WXSA 4MH0E 2KO3A 4PS3A 2WDTB 3Q3JA 2ZCCA 4K1RB 4WJPA 2DZIA 4JL9A 2AL3A 2LGXA 4ZRIA 1KM7A 1WE7A 3S2AA 4HWIB 2G3QB 2KTFA 4ANVA 2J7QB 4ZYNA 1P98A 3KH0A 4M8NA 3HIZA 3QC8B 2KWUB 4KIKB 3ZW3A 3OJ3A 5L95C 1KJTA 3ZO5B 2IO2B 3GOEA 1X1MA 3A33B 2UYZB 1MG8A 1WRDB 3AULA 5D6JB 1BT0A 3IBEA 2L05A 4MGZE 3ZDTA 2M8SA 1Z2MA 2XK5B 1WMHA 4KVGB 2DHZA 1WY8A 4M0WB 4GMVA 1WJUA 4AWJA 2KQSA 1M94A 1ZKHA 3H6NA 4GDKB 1WE6A 2EKEC 1EF5A 2MP2A 5FR6A 4A3PA 4HLEA 2JUOA 1WM3A 1WGRA 1XT9B 2KNBA 4KSLC 1WJNA 3QHTA 4DBGA 5D2MB 1AARA 4N9F4 3ZNZB 2WX0A 4W9GA 2K6QA 2K8BA 3B1LX 5DPSA 2L00B 2KC1A 4WAAA 5C23A 2KDFB 2LUEA 2D11A 2BYEA 1G6JA 2LGDA 3DBLI 4XC2A 2BYFA 1WXVA 4FJYA 2N9PC 3H7PB 2L0TA 2MBBB 3A9JA 3AU4A 2UWQA 2DZKA 2WYQA 5DPWA 2KZRA 4WJOA 4FHKA 2V3SA 4W9CA 3HM3A 1ZW7A 3NS8A 4TUUA 4RM9A 2L7RA 2BWES 3TBLD 1NI2A 3JYUA 3ECIA 4ASWC 2LWPA 3IFWB 4WJNA 5IAAC 1OEYJ 4G3XB 3L16A 2K39A 1OEYA 1UGMA 4IWOA 4W9HA 3RYTA 3ZRCA 3SDLC 2ASQA 2IYDB 1WR1A 3RZFA 1I35A 3EECA 2M1MA 3ZRFA 2KFKA 4HVBA 2ZCBA 2D2QA 3X23A 1WX7A 2PJHA 3UINB 2O6VB 4B6WA 2L76A 3EHVA 2IO1B 3W1SA 2FCMA 1WX9A 3QCAA 2J0MA 3VHTC 1C1YB 4HPLB 1QZEA 4NJ7A 4TV3A 1GC7A 2BKRB 1EO6A 1K8RB 4HCPB 2KQ7A 4KSKC 4HDQA 3A4RA 4KIKA 2LI5A 3RCZA 4W9EA 3UQAA 4NAWB 1V80A 4PYZA 3VXWA 2KLGA 4BBNC 1YX5B 3H9DA 2LD9A 1UH6A 1V6EA 2CS4A 2IBIB 3PRZA 1Q1OA 2NBUA 2LGYA 2C7NB 2RPQA 3V62A 4LCDE 3W1SC 4A20A 3ML8A 4TKNA 3UF8A 1R4MI 2RGFA 2XK5A 4RM8A 4KDIC 1E8WA 2BPSA 2C7MB 4K7WA 2DAJA 4URKA 1YD8U 2MBOA 3L13A 4WWNA 2R2QA 3PTFC 4GDKA 2N1WA 2MA9B 4CHKA 4BKTA 3VH4B 1WXAA 2D07B 2MWSB 1UELA 2K25A 2DYBA 3T9LA 1WIAA 2GMIC 3V61A 1GC6A 4MJSB 3VTUA 2G4DB 4AJYB 1TZ1A 3HM6X 4NQLB 4DK5A 2ZZPB 4IG7B 2MCNB 3M3JA 3QJZA 2FCNA 4FJZA 2C9WB 5CTRC 3VTVA 4E74A 1I42A 2RD0A 1YX6B 1TGZB 3KYDD 4W9LA 4B95A 3PV1A 3P2BA 2JPHA 3H7PA 3JSVB 1WGGA 2C5LC 5L83A 1GNUA 3PLUA 2LXCA 1JRUA 2MW5A 2AYOB 1WGYA 2ZNVB 3PS6A 4WJQA 1WZ3A 2OOBB 4FHJA 1E90A 1XD3B 2DENB 4LDTD 2BWFA 1HE8A 3K9OB 3VQIA 2I1KA 4FBJB 1A5RA 4EUTA 4XX5A 2AWTA 1E8ZA 4FJVB 3TCAA 3V6CB 2MLBA 2D10A 2M4NA 3T8MA 4NJ6A 1GG3A 2NCNA 3V6EB 4IWPA 2L0FA 3ZDMC 4EKUA 1WYWB 4GU2A 2R2OA 3AU5A 3L0WB 3RD2A 3TMPB 2NS5A 4W9IA 3ZNGC 2O6VA 1YQBA 2KVRA 1E8YA 3OAWA 5J18A 2CHXA 3OLMD 2KMCA 2MQJA 4I6PA 3KVFB 1H4RA 2A4ZA 2LASA 5E6NA 2KDBA 4IW0A 1YJ1A 3KUZA 4BKSD 2N1VA 4NAWA 4CYEA 5G2NA 3ZTCA 4DXAB 2DYOA 2KTRB 3EFUA 5HKHA 2KD0A 2ZEQA 2KANA 3ALBA 5AZGA 4AJWA 4K7SA 4EOYA 1C3TA 4ZRKA 3D32A 4I6LB 3WIMA 2EMSA 2KJRA 2N9EB 2A5UA 4DHJB 2NPTB 1EUVB 3MJWA 1F9JA 2HE7A 2XBBC 1GUAB 3DCGA 4MSQB 4MJSA 4DWFA 2HJ8A 3MTNB 3M63B 1TBEA 2FNJB 1NBFC 3H1UA 4MM3A 1WM2A 4IWQA 4GOCA 4JLCA 4MDKE 3SHQA 4B9KA 4LJPB 3QAQA 2MRPA 3VFKA 2DAFA 1UBIA 2RSUA 3TJPA 4HK2A 3UIOB 1LM8B 4IC7B 1FXTB 3DVNV 3JSVA 5LLIA 2D3GA 2KXJA 2NVUI 3QARA 3R7RA 3ZTDA 1WH3A 3KUCB 4K81A 4DDID 2GOWA 2BKFA 3BY4B 1S3SG 5JHBA 4OVVA 1OQYA 4MGIE 3VUXA 2L8JA 3CF6E 4MELA 3ZVVA 1E8XA 2PPHA 4EZJA 3RT3B 1Y8RC 3PZDA 4NPNA 3DVGX 2JY6A 2OJRA 2Z59B 3N30A 2GBNA 2KMAA 3WALA 3QK0A 4MGKE 3A9KB 1XQQA 2V4LA 5DPRA 3DBHI 1V2YA 2IO3B 3AI5A 1P1AA 2O2VB 2N7EA 3VAWA 4DDGD 2K8HA 2O6VD 4HPMB 4PYUA 5JHAA 4X57B 5JH5C 2KC2A 3JVZX 2FCSA 1GJZA 4HDOA 3APDA 1LFDA 3UIPB 4AOFA 4BKSA 4GIVA 4DHZB 3SU8X 4WWOA 2GBKA 1RLFA 3EC8A 1P9DU 2REXA 2KN5A 3PRMB 4EEWA 3UGBB 3U7DA 5E6OA 1WGDA 2LVOA 1OGWA 2IZVB 3CMMB 4ANXA 5KHQA 2KTRA 1V9JA 3KW5B 4J6IA 2KFJA 3B08A 4HJKA 2JT4B 4FULA 3DQVA 4PS8A 5AZFA 4FADA 3QQ8B 5DCNA 3BINA 3VDZA 3NHEB 3AXCA 4JQWC 1U4AA 2KJ6A 4GN1A 3WAMA 4K7UA 1RRBA 3WAOA 2JZ3B 2KWCA 3M95A 5JZEB 3APCA 2J0KA 2ZVNA 2KX0A 5TR5A 2KHWB 3N32A 4FLHA 1LQBA 2ZPYA 4GDLB 1P0RA 1OTRB 3O65B 2N7DA 2BF8B 2N4FA 4NQKE 3DPDA 5CHWA 2FAZA 4BBNF 2KLCA 3B0AA 2IY0B 5D7GA 3NOBA 2DZMA 2KDEB 2DYMA 1WX8A 2G4SA 3LJ3A 3MHSD 1CMXB 4KZCA 3R3MA 3PPAA 2KWVB 4ANWA 4KZ0A 2GBJA 4W9JA 1RAXA 2MX2A 1T0YA 3IVFA 3PVLA 2HD5B 2FIDA 2B3AA 5DPTA 2JWZA 1V5TA 3PHXB 3ONSA 1Z5SB 2LRWA 4CO7A 4A3OA 4KDLB 2PEAA 2IO0B 2C7HA 2YVCA 4BOSC 1IPGA 1WI0A 1V81A 3A9KA 1SIFA 3IHPC 3PGEA 3PREA 4GXBA 4AP4C 5AEKB 3WANA 1WF9A 2Z0EB 3M62B 2JF5A 1NDDA 2O2VA 2YLMA 1E7VA 3NZUA 5LXHA 3JW0X 3QWZB 1YIWA 1S1QB 3H7SA 1PQSA 3N3KB 1WZ0A 3APFA 5EDSA 2GBRA 2CU1A 4P7IA 2Z0DB 2IY1B 1UBQA 3PLVA 2G45B 3TIXA 2KJHB 5J17A 4WQOB 1RFAA 5BO4B 3LDZE 2GBMA 1SE9A 2JRIB 2FUHB 2NBWB 5D94A 1ISNA 1V5OA 3K9PB 2LJ5A 4W9DA 1LXDA 2W9NA 4BOZB 2DZJA 2MSED 4BFRA 2L3ZA 2PE9A 2WX1A 2MBQA 3QX1A 4RMAA 4JGHB 3HK0A 3PSEB 3RULA 3KUDB 1WJ6A 4G11A 2QHOA 3PT2B 5E6PA 3VVWB 1WJ4A 4W9KA 3QIJA 4ICVA 4ANUA 4E3CA 2KKCA 1ZGUB 4GB9A 1P3QU 2PE6B 2V1YA 2LXAA 4DHJD 4IM0A 3R7QA 4FN2A 3VUWA 4WWPA 2KDIA 3GZNI 2ZJDA 4EZLA 2KK8A 1KLVA 3A1QB 2K1FA 1IP9A 5G55A 2JXXA 2CR5A 2CKHB 5KHOA 1WXMA 2ZVOA 3ZKJC 2VRRB 2LVQA 2MBHA 2FIFA 5CHFA 4MGYE 4EFOA 4GSWA 3L08A 1KOTA 2XEWA 3U30A 3U8ZA 4XZ4A 5LXIB 4HXDA 3TL5A 2HTHA 4NNJB 2ZPNA 3DOWA 4GDLA 4PS7A 1VCBA 2DX5B 3NZSA 2C60A 1D3ZA 4W9FA 3RUIB 2LVPA 2I1JA 3V60A 5CHVC 3OJ4B 3DDCB 3HHMA 4ICUA 4II3B 4DHZE 3A4SC 1WR6E 3CSTA 3VUYA 3L10B 3Q3FA 2ZNVC 1UD7A 2CHWA 2J0JA 1L2NA 5IA7A 1SGHA 2N9XA 1R4NI 1WGHA 2K8CA 2JRHA 4GGQA 4G50A 3WA0A 2M17A 4F7ZA 1E5WA 5CX3A 4BVUC 1E7UA 2KOXA 2LRUA 4LJOB 4M8MA 5J2RA 5C1ZA 1WMHB 1J0GA 3W1YA 2Y5BB 4NY0A 4EZKA 4ZDVA 2AL6A 1Q5WB 2RR9A 3ZIMA 3L17A 1J8CA 1TTNA 2JVCA 3ZLZA 1Q0WB 1L7YA 2LZ6A 2MP2B 2JZZA 2AEHA
chains in the Genus database with same CATH superfamily
3U52E 1D4BA 3VTWA 3ZNHB 3AE3B 4A9AA 5GMVA 2MBEA 4XE0A 1BUIC 4C7ZA 2NBVB 3QA8A 2CHZA 1WXQA 3VR9B 2QDFA 2N9KA 4G0NB 4LTUA 3A1QA 4ZHOA 2DWQA 3B9JA 2Q5WD 2AQ2B 2QEJC 4TQ1A 4ARCA 3DHIC 3VRAB 1V49A 3MJ5A 4FA6A 1NEKB 1TKEA 2M0XA 3X0WA 3I3TB 2QILA 4F1SA 1KH0A 4L23A 1C4CA 1YJIA 3ZUNA 3CSFA 3KYCD 2BB5A 3P42A 1WXSA 4PS3A 2WXFA 4WJPA 4ZRIA 3S2AA 5FK9C 1OQQA 2KTFA 2J7QB 3KH0A 4M8NA 1HZ5A 1BXTA 2WXHA 1X1MA 1MG8A 1BT0A 4ITKA 1CZPA 1Z2MA 4KVGB 2DHZA 2K9XA 4GMVA 3SFEB 2J42A 1TS3A 2MP2A 2V0GA 5MPOA 1AARA 4W9GA 3N1ZC 1NVID 2WDVB 2KC1A 4WAAA 1ZDVA 2BS3B 4A6QA 2BTEA 2LUEA 1FCCC 1UGJA 3DBLI 4FJYA 2N9PC 1E6EB 2DZKA 4A90A 1WSPA 1SXTA 1KF6B 2YEPB 2V3SA 4ZYSA 2BB6A 2L7RA 2BWES 1NI2A 2NTSA 3ECIA 2LHEA 4G3XB 3ZRCA 1UGMA 2GI9A 1ENFA 3SDLC 2ASQA 3EECA 4RFBA 3UINB 4B6WA 3R8BA 2IO1B 3R2IA 3N1XC 1C1YB 4TV3A 2FE8A 1EO6A 3A4RA 2LI5A 4RGNA 3BVMA 4NAWB 4PYZA 2KLGA 2HTME 1YX5B 3AE8B 4A20A 4HKZE 3J9CA 3UF8A 1MVKA 2RGFA 3EUB2 4K7WA 4URKA 1YD8U 1V8CA 2MBOA 5BYQA 3L13A 3SR6A 4YSXB 5TSSA 4BKTA 4CHKA 2D07B 5D3DA 2AQ3B 3VTUA 1TT5B 3HM6X 4DK5A 4IG7B 3E9SA 1F0ZA 2KQ4X 3QJZA 2WQYB 4YSZB 1BMLC 1TGZB 3KYDD 3P4SB 1YQ4B 5G5HA 4ZHPA 1GNUA 1N61A 4WJQA 1JRUA 2MW5A 1WGYA 3DBLB 4FHJA 1XD3B 2DENB 4LDTD 1HE8A 3L4PA 5C3JB 4XX5A 1N6ZA 4FJVB 4M02A 3KLSX 3ZDMC 3Q14C 4LNKA 2M19A 3L0WB 3EA6A 4P1CC 2NS5A 2QMTA 2O6VA 1YQBA 2KVRA 5J18A 4AS1A 2CHXA 3OLMD 1MHHE 2MQJA 3KVFB 1EWYC 2A4ZA 2LASA 1PUTA 5E6NA 4IW0A 1YJ1A 3KUZA 5BMGA 1CK1A 4CYEA 2JQRB 2SAKA 1P7EA 3EFUA 2BVCA 1YQ3B 3ALBA 4K7SA 2JYEA 3ZJUA 4ZRKA 2D5GA 2KJRA 4DHJB 2A5UA 1STEA 2NPTB 3NZ3A 1GUAB 4OZCA 3MC0B 4MSQB 3AE1B 4LNNA 3UI3A 3AH7A 2D3AA 1NBFC 3H1UA 4JLCA 2JYTA 1C4AA 1R7SA 2RSUA 1LM8B 1OQRA 3T3NA 2D3GA 2KXJA 3QARA 3ZTDA 1TS4A 1WH3A 3KUCB 4K81A 2GOWA 3NG0A 1S3SG 2KT7A 2L8JA 5BMIA 3PZDA 3RMKC 2JY6A 2OJRA 1SB3C 5FR3A 2KMAA 3WALA 1IUEA 1J7BA 3DBHI 1K51A 2N7EA 3VAWA 1K50A 1GAQB 4HPMB 5JHAA 1C9FA 1E10A 2INPE 3BZDB 5IKCM 3UIPB 1DGJA 4GIVA 1QT9A 4N6EB 3BWUD 2GBKA 1QOBA 4XWWA 1P9DU 2LVOA 4US9A 1FD6A 4FULA 1UWMA 3QQ8B 4NJCA 3BINA 3NHEB 4GN1A 4PT5A 3WAMA 4JWSC 2QJLA 2RDBC 4K7UA 1RRBA 3WAOA 4KX6B 2J0KA 4FLHA 2DLBA 2ZPYA 4XYCA 3ETRA 3BVGA 2BF8B 4KKJA 5E6JA 3KQ4A 2Y3AA 1EU3A 3B0AA 2IY0B 3RNEC 2DYMA 3LJ3A 3R3MA 4WURA 2HJ1A 1JRPA 4WWMA 1GB4A 5HHDG 4BOSC 1WI0A 4GXBA 3PREA 3PGEA 4AP4C 2Z0EB 2KN4A 2YLMA 1NDDA 3NZUA 1E7VA 3DBHB 2LEKA 3H7SA 3RNCC 1TS5A 3PZ7A 1ESFA 1VLBA 1UWXA 2GBMA 2JRIB 1ACCA 2LJ5A 1VZ6A 3AEEB 4BOZB 2MSED 3QX1A 1N5WA 4RMAA 3PSEB 3KUDB 3VVWB 1WJ4A 4W9KA 1FFVA 1P3QU 3R7QA 4FN2A 2KDIA 3GZNI 5EE0A 1IP9A 1FFUA 2CKHB 2INCC 2LVQA 3RNAC 2ZW0A 4YT0B 3TL5A 4NNJB 3DOWA 4PS7A 1N62A 1MHXA 1UUPA 1VCBA 2RPVA 3AE9B 4RCOA 3DDCB 3HHMA 3L10B 2CHWA 2J0JA 5IA7A 2K8CA 2JRHA 4LNFA 1FEHA 1XLQA 1SJED 1MPEA 4F7ZA 4D2KA 4BVUC 2LRUA 5J2RA 4ZDVA 3R2TA 1J8CA 1TTNA 1Q0WB 1L7YA 3P4RB 1J19A 4IUMB 4KV2A 2LFIA 1YN3A 3DVGY 4BKGA 2IGHA 4I6NB 1YN4A 2CJNA 3VH3B 1VR9A 1IYFA 1HTOA 4YTPB 5AZHA 3NVWA 4HCNB 4II2B 1WFYA 4YSYB 3PRPB 4YL8A 3DVNU 1YJJA 2K6DB 4AUQC 3Q3OC 4KGRA 2ZW1A 2V3NA 3C0RB 1JWSD 4S0RA 2WXPA 4IM2A 4LDTB 4IM3A 3ENEA 3AEDB 4JIOU 1XLPA 3DBRI 2FCQA 5HG2A 3AE7B 1UZXB 2I38A 4F8CB 5BMHA 4IOIE 2WDTB 1SJHD 2ZCCA 2PTLA 4K1RB 3Q2AC 2J4XA 1WE7A 4PK1A 2ICIA 4HJGE 2GB1A 1FXIA 2K22A 4ZYNA 1AWDA 3QC8B 4KIKB 3ZW3A 3OJ3A 2KAJA 3AEBB 3A33B 2UYZB 1WRDB 3AULA 4RF1A 3IBEA 2L05A 3ZDTA 4Q2JA 1WMHA 3TUOA 1SEBD 2AX5A 3VRBB 1WJUA 4AWJA 4GDKB 2DNFA 1JWUD 1WE6A 2EKEC 1JWBD 1EF5A 1WM3A 1WGRA 4HRSA 3BIID 3ZNZB 3V05A 1I4PA 1F2RI 5C23A 3AE4B 2BYEA 1G6JA 1WXVA 3Q8AA 3H7PB 2MBBB 1V1PB 3V3XA 2UWQA 5DPWA 2KZRA 2N0SB 4JE3B 1ZW7A 3NS8A 1JALA 4TUUA 1HQRD 3TBLD 3JYUA 2LWPA 3IFWB 2ONQA 1SE4A 4WJNA 1OEYJ 2JSVX 3L16A 5C2TB 3MP9A 5T8IA 1TIFA 2PVOD 2WHIA 3P63A 1IGDA 2ZCBA 2D2QA 3DBRB 4JWUC 1E0ZA 3W1SA 1VJKA 2J0MA 4HPLB 1QZEA 2BKRB 2JWUA 4HCPB 2KQ7A 4W9EA 5EE3A 4ZOHC 1C76A 1C77A 3U30A 2CS4A 2MEKA 3PRZA 4HKQA 3W1SC 3DWMA 2DAJA 4WWNA 2R2QA 3PTFC 1TKYA 1LO5D 2MA9B 3VH4B 3TEXA 2MWSB 2CU3A 3V61A 1GC6A 4AJYB 1TZOA 1TZ1A 2ZZPB 5H92C 3M3JA 4MM3B 2FCNA 4FJZA 1EM7A 2JZPA 2GLSA 1WGGA 2C5LC 2K5PA 2KVZA 2LXCA 3LXFA 2OOBB 3K9OB 2PKOA 1A5RA 3NUHB 3TCAA 2MLBA 3RNGC 2D10A 3CIRB 1GG3A 4USAA 3LB8C 2L0FA 3BK1A 4EKUA 1WYWB 1JMLA 3AN1A 3TMPB 2L32A 1L4DB 2WDRB 2VH1A 3ZNGC 1QKZA 4XGAB 3DWGC 2WXNA 3FC4A 3KWLA 2SEBD 4NAWA 3AE6B 2CJOA 2KD0A 4YTNB 2ZEQA 1VRAB 1VDVA 2EELA 4C56C 5AZGA 4EOYA 3WIMA 4I6LB 2N9EB 1T5XD 3BK2A 1F9JA 2WDQB 1TY0A 2HE7A 3BYYB 1TY2A 3MTNB 4M01A 3M63B 1TBEA 1XXGA 2V3PA 3VFKA 2WP9B 3B2GA 1UBIA 3UIOB 1FXTB 2H88B 3R7RA 2NVUI 3AMZA 2BKFA 3RNFC 4MGIE 3VUXA 3CF6E 4MELA 3ZVVA 4EZJA 1E8XA 4NPNA 3DVGX 3A9KB 1XQQA 1V2YA 1QOFA 3AI5A 1P1AA 2O2VB 4DDGD 2K8HA 3Q3MC 4PYUA 4R3DA 2Y5PA 4X57B 2KC2A 1L5PA 4A55A 1LFDA 4RH6A 4AOFA 4BKSA 4DHZB 1IBXB 3SU8X 2IGDA 3NVYA 2RDHA 1WRIA 1N60A 2REXA 3Q8EA 1TS2A 3NVVA 1OGWA 1I4XA 3PO0A 4ANXA 1V9JA 2KFJA 3B08A 4HJKA 4PS8A 3TEZA 3AXCA 4JQWC 1V1OA 2KJ6A 2WXLA 4RF0A 3APCA 2Y5CA 2I2YA 1I4GA 1LQBA 3RPFC 1B9RA 3OWEB 3O65B 1MG4A 2D3BA 1YN5A 1L4ZB 5CHWA 5D7GA 4KZCA 1WX8A 2UU7A 2W3RA 3RFZB 4W9JA 1ZXHA 2HD5B 2FIDA 2B3AA 5DPTA 3U2SC 3PHXB 1V5TA 1T0RC 1Z5SB 2LRWA 4CO7A 1XCQL 4A3OA 2C7HA 4WH4A 1WF9A 2JF5A 3JW0X 3QWZB 2D3CA 2KYWA 1PQSA 1SSNA 1WZ0A 5HFYA 5EDSA 2CU1A 2IY1B 1I7HA 1UBQA 4LK0M 1RFAA 2NBWB 5D94A 4OW0A 4W9DA 1LXDA 3IAS1 1C79A 4JGHB 3RULA 1WJ6A 4G11A 2QHOA 3AB5A 4HEA1 3HVDA 5E6PA 4B0EA 3SFDB 2V1YA 3Q8FA 2KK8A 2K1FA 1RWSA 5KHOA 1WXMA 2VRRB 5CHFA 4MGYE 2XEWA 3GE8C 3U8ZA 4AQ7A 4XZ4A 5LXIB 2KMMA 3NVZA 4W9FA 3RUIB 2PLPA 2LVPA 3AV8A 2I1JA 3OJ4B 1YNTE 3CSTA 3VUYA 2VZKD 2M56B 4IKGA 3Q3FA 2ZNVC 1UD7A 1R4NI 1WGHA 2RDGA 1IGCA 3EFCA 5EE9A 3WA0A 1F77A 1E5WA 1L0XB 1E7UA 2KOXA 1XO3A 4LJOB 4M8MA 4ZRPA 3W1YA 4A8XC 3ZIMA 2PMVA 1I4HA 2FBWB 2AEHA 4WIPA 3RNBC 3NY5A 4K3BA 2NR2A 3UQBA 2WLBA 1ZDXA 2BBCA 2WS3B 2IDYA 3Q6BA 4ZRJA 1QOGA 1FO4A 3W5VB 2K3UA 1D5ZC 3A9JB 3FILB 3L54A 1M4VA 2XN9C 4LLGM 2WWZA 1VD2A 4OVUA 3N20C 4EE2A 4CQNA 3RZWC 3ML9A 2BYTA 3Q69A 3GB1A 3AM9A 2WXGA 2W55A 4TQ0A 1TKGA 2KFKB 1QLBB 1ZE3D 4JL9A 2LMCA 2LGXA 1KM7A 4HWIB 2G3QB 4ANVA 4OZAA 1P98A 1F1HA 1SE3A 2KWUB 3U7ZA 1KJTA 2IO2B 1R4NB 5D6JB 4MGZE 4DQOC 3U4EG 2BS4B 2M8SA 5IN7A 2E6XA 2XK5B 1WY8A 3N9YC 4M0WB 4GLSC 4C4VA 1M94A 5BYSA 3H6NA 3NJTA 2KWDA 3I9V1 2BW2A 4HLEA 2JUOA 1XT9B 2KNBA 3QHTA 4DBGA 2WXKA 2V9HA 2WX0A 4L2YA 5HI1A 2K6QA 2K8BA 2YEPF 3HUIA 2G9HD 1HEZE 2KDFB 4RGOS 1RFKA 2D11A 1SE2A 2LGDA 4OHJA 3AECB 2L0TA 1Y56A 1XLNA 4WJOA 3C19A 1SIJA 2LJIA 4FHKA 1FPYA 3DHHC 4W9CA 3HM3A 4HPPA 3GS2A 4RGMA 4RM9A 4ASWC 2PIAA 5IAAC 3RYTA 2K39A 1OEYA 1L0VB 3IT6B 1EWCA 3RZFA 1I35A 2M1MA 3ZRFA 1K52A 1VZ8A 3X23A 1WX7A 2PJHA 1FM0D 4IDIA 2MJ3A 2L76A 3EHVA 1E7PB 2FCMA 3QCAA 3VHTC 1GC7A 3Q3NC 1K8RB 1FCLA 4KIKA 3RCZA 3UQAA 3O13A 3IXSA 1V80A 2LD9A 2NBUA 2RPQA 2C7NB 3ML8A 4TKNA 1R4MI 4RM8A 2C7MB 4TMAB 4GDKA 3ZJVA 2VH2A 1HTQA 1WXAA 5AUKA 3AEFB 2K25A 2DYBA 3T9LA 1WIAA 5EE1A 1PDXA 4MJSB 2G4DB 1L6UA 4NQLB 3TEYA 2NTTA 3GZNB 2LGIA 2C9WB 5CTRC 3VTVA 1FIQA 2RD0A 1YX6B 4BZAA 3TEWA 4B95A 3P2BA 3H7PA 3JSVB 1V1PA 3HVZA 5L83A 3PLUA 1TYGB 1J7CA 1E90A 1UNSA 2W54A 2I1KA 4EUTA 2AWTA 1E8ZA 2WU5B 2X8XX 3V6CB 1PFDA 2FUG1 1XLOA 4NJ6A 2EKIA 2NCNA 4S17A 4GU2A 3AU5A 4W9IA 3OAWA 2PW9A 1JWMD 3P1MA 4I6PA 1H4RA 2KDBA 4BKSD 5G2NA 2X38A 4DXAB 2KTRB 5HKHA 4AJWA 2ON8A 1C3TA 3E56A 1R4MB 1EUVB 3AE5B 3MJWA 2XBBC 3ZQ4A 1FRDA 5BYRA 1NI3A 2QSDA 2FNJB 4MM3A 4IWQA 2WNMA 4MDKE 5IO9A 1B1ZA 3SHQA 4B9KA 4LJPB 2MRPA 2DAFA 4M00A 2XNAC 2QCZA 4HK2A 4OVZA 4IC7B 5LLIA 3DVNV 4DDID 4C7YA 3BY4B 1K53A 4OVVA 1OQYA 2VZKB 3C8YA 2PPHA 4KGSA 3RT3B 3N30A 4MGKE 2V4LA 2O6VD 5JH5C 3JVZX 2FCSA 3OG5A 1YMHE 4WWOA 1KLUD 3EC8A 3PRMB 2KN5A 1L6VA 5E6OA 3U7DA 1FNWA 3Q8BA 2IZVB 3CMMB 5IOIA 5IP4D 1C4PA 4J6IA 4FADA 2JT4B 3DQVA 2M0AA 1U4AA 4N59A 2KWCA 1P7FA 4XDDA 1JQ4A 1ZP0B 2KDMA 2KX0A 1NYRA 2KHWB 3N32A 3SEBA 4GDLB 2WXIA 1XF5L 2N7DA 2N4FA 3KWVA 2IJ0A 4REZA 4NQKE 3FAHA 2FAZA 4BBNF 4ARIA 2KLCA 3AEGB 3NOBA 2DZMA 4LNOA 3MHSD 1CMXB 3ZGZA 4XDCA 4ANWA 2LGSA 2GBJA 3ZJTA 1KLGD 1SBBB 3GP7A 4ZRQA 4KDLB 2PEAA 4C00A 1IPGA 3A9KA 1SIFA 3IHPC 2H89B 3M62B 2O2VA 1PGBA 3DHGC 1PGXA 4B0MA 3N3KB 1FNUA 5G5GA 2GBRA 2Z0DB 1DYQA 2G45B 3TIXA 2KJHB 4WQOB 5BO4B 1IBXA 3AE2B 1V5OA 3K9PB 4TSSA 4MH8A 2W9NA 3CWIA 2L3ZA 2PE9A 2WX1A 2MBQA 2GRIA 3HK0A 1YOVB 3PT2B 4ICVA 4JPSA 4E3CA 3I57A 1ZGUB 4GB9A 2PE6B 5I4DA 3A1QB 3IT4B 5G55A 2CR5A 1OFFA 3ZKJC 2FIFA 1EU4A 2L52A 4GSWA 1KOTA 4XWTA 4MT5A 2HTHA 1T0SC 2DX5B 3NZSA 1T6BX 1ROEA 5CHVC 3PZ8A 1I4QA 1WR6E 3ZXRA 1L2NA 5LNK1 1ZOYB 1SGHA 1E9MA 2N9XA 4GGQA 2WXMA 1DOYA 5CX3A 3RI7C 2RMMA 4NY0A 4EZKA 3L17A 4O1NA 2JVCA 2LZ6A 2MP2B 2JZZA 1WYGA 1VZ7A 2BGFA 4MSMB 4E71A 2BYVE 1V86A 2NPTA 1QILA 3Q8CA 1ZXIA 2KX3A 2LHDA 3DBSA 3VR8B 2K0PA 2MH7A 4MEMA 3ABVB 4N58A 1H8CA 1HA5A 3PHWB 3WAPA 1AYFA 2W82A 1KRHA 1MFWA 2EMTA 3SD5A 3ZNID 3R66C 1MJDA 3IG3A 1EF1A 3BVZA 1D5MC 1GPXA 2IGGA 4MH0E 2KO3A 3Q3JA 1NYQA 2DZIA 2AL3A 3LYYA 3HIZA 1FRRA 1PYWD 1QF6A 5L95C 3ZO5B 1T3QA 3GOEA 1HZ6A 4HROA 1TJEA 1JCKB 4UDUC 4P16A 2N7JA 2KQSA 1ZKHA 1N5XA 2MHJA 3FKYA 5FR6A 4A3PA 4KSLC 1UF0A 4C80A 1WJNA 2INNE 2WXQA 5D2MB 3I63C 4N9F4 3B1LX 5DPSA 2L00B 1MI0A 5H8YE 4WAFA 4XC2A 2BYFA 1FNVA 3A9JA 1AN8A 3AU4A 3FILA 4RNAA 5JXVA 3MC8A 2WYQA 3BYTB 1XEEA 3MFGA 1JROA 2L1AA 4LNIA 4IWOA 4W9HA 3AEAB 2BQQA 2IYDB 1WR1A 2TSSA 2WGSA 3IAM1 2KFKA 4HVBA 2O6VB 1WX9A 4NJ7A 1FMAD 2BT6A 4FXCA 4KSKC 4HDQA 4WQMA 1V97A 4RGTA 1KTKA 3VXWA 1CQVA 4BBNC 3H9DA 1UH6A 1V6EA 2IBIB 1Q1OA 3V62A 2LGYA 3T3OA 4P6VF 4LCDE 2XK5A 4KDIC 1E8WA 2BPSA 4M0WA 1Q10A 2N1WA 1I4RA 1DOXA 1UELA 1N63A 3MC9A 2GMIC 1DOIA 1QOAA 4DXFA 2MCNB 3MHZA 1AW7A 4E74A 1I42A 4W9LA 3PV1A 2MJDA 2WXJA 2JPHA 1ET9A 2AYOB 2ZNVB 3PS6A 4QAYA 1WZ3A 2AQ1B 2BWFA 3VQIA 4DXGA 4FBJB 3I5JC 2N9LA 1NENB 2M4NA 3T8MA 3V6EB 1GB1A 4IWPA 5GXGB 2R2OA 3RD2A 1A70A 4YTMB 1E8YA 1F52A 3H8HA 3W2DA 3W5UB 4YXDB 2KMCA 1GOZA 2R61A 2E3TA 2MJEA 2N1VA 2DBYA 3B2FA 1ZPSA 3ZTCA 2DYOA 4ACFA 1ET6A 1WWTA 2KANA 2Z8LA 4H2AA 3D32A 1RYJA 2HDEA 1JW9D 2EMSA 3DCGA 2JXTA 4MJSA 4DWFA 2QIEB 2HJ8A 3ZYYX 1WM2A 3WCQA 4GOCA 4OZBA 3QAQA 4NAMA 2LUMA 3TJPA 3JSVA 5JHBA 2KACA 1Y8RC 2Z59B 2GBNA 3QK0A 5DPRA 2IO3B 5D3IB 1XCTL 4MACA 4L1BA 1SF0A 1GJZA 1QQRA 4HDOA 3APDA 1PGAA 2B76B 2ACZB 4K3CA 1RLFA 4YWGG 4EEWA 3UGBB 4P1BC 2BS2B 1WGDA 4C4VB 2J53A 1D5XC 5KHQA 2KTRA 3KW5B 3P4PB 3GE3C 5AZFA 2JU6X 5DCNA 3VDZA 3HRDD 1J7AA 2JZ3B 3M95A 5JZEB 2ZVNA 5TR5A 3P4QB 1FXAA 3NRZA 1P0RA 1OTRB 3DPDA 1D6EC 1WGKA 2KDEB 2G4SA 3PPAA 2KWVB 3TSSA 4KZ0A 1RAXA 2MX2A 1KFYB 1T0YA 3IVFA 3PVLA 4US8A 1LGRA 2JWZA 3ONSA 2IPKD 2IO0B 2YVCA 1V81A 5AEKB 3WANA 3URYA 5LXHA 2OJWA 4J3OD 2W3SA 1YIWA 1S1QB 2OEDA 4JX1C 3APFA 4P7IA 3PLVA 2G1EA 1RM6C 5J17A 4KGTA 3LDZE 1SE9A 2FUHB 1ISNA 2V4IB 2DZJA 4BFRA 2WU2B 2WXOA 1T0QC 1ZUD2 2QC8A 3QIJA 4ANUA 2KKCA 2L83A 2LXAA 4DHJD 4IM0A 3VUWA 4WWPA 2ZJDA 4EZLA 1KLVA 2J52A 2JXXA 2ZVOA 2MBHA 5FKAC 4EFOA 2NMQA 3L08A 3N1YC 1JWAD 3W9CB 5AUIA 4HXDA 4GDLA 2ZPNA 1D3ZA 2OHFA 2C60A 3V60A 4BAXA 4ICUA 4II3B 1HXYD 4DHZE 1F2RC 3A4SC 2JX5A 4KKIA 3ZXVA 1C78A 1L0YB 3EGRA 4G50A 2M17A 2INDC 4NZLB 1CJEA 1J0GA 5C1ZA 1WMHB 2Y5BB 2AL6A 1Q5WB 2RR9A 3NS1A 3ZLZA 2PVGC 3RN9C 2WXRA
chains in the Genus database with same CATH topology
1J19A 4IUMB 4KV2A 3DVGY 4BKGA 3NY5A 2BGFA 4I6NB 3VTWA 3ZNHB 2NR2A 4MSMB 4E71A 2BYVE 5GMVA 3VH3B 1V86A 2MBEA 3UQBA 2NPTA 1IYFA 4ZRJA 5AZHA 2NBVB 2KX3A 3QA8A 3DBSA 4HCNB 4II2B 4MEMA 1WFYA 2CHZA 3A9JB 3L54A 3PRPB 4YL8A 3DVNU 1H8CA 4G0NB 2K6DB 3PHWB 3WAPA 4AUQC 2WWZA 3A1QA 1VD2A 4OVUA 3C0RB 3RZWC 3ML9A 4TQ1A 4FA6A 2EMTA 1V49A 4IM2A 4IM3A 4LDTB 2M0XA 3SD5A 3X0WA 3ENEA 3ZNID 3I3TB 3R66C 4F1SA 4JIOU 3IG3A 3DBRI 1EF1A 2FCQA 4TQ0A 3ZUNA 3CSFA 1UZXB 3KYCD 2KFKB 4F8CB 1WXSA 4MH0E 2KO3A 4PS3A 2WDTB 3Q3JA 2ZCCA 4K1RB 4WJPA 2DZIA 4JL9A 2AL3A 2LGXA 4ZRIA 1KM7A 1WE7A 3S2AA 4HWIB 2G3QB 2KTFA 4ANVA 2J7QB 4ZYNA 1P98A 3KH0A 4M8NA 3HIZA 3QC8B 2KWUB 4KIKB 3ZW3A 3OJ3A 5L95C 1KJTA 3ZO5B 2IO2B 3GOEA 1X1MA 3A33B 2UYZB 1MG8A 1WRDB 3AULA 5D6JB 1BT0A 3IBEA 2L05A 4MGZE 3ZDTA 2M8SA 1Z2MA 2XK5B 1WMHA 4KVGB 2DHZA 1WY8A 4M0WB 4GMVA 1WJUA 4AWJA 2KQSA 1M94A 1ZKHA 3H6NA 4GDKB 1WE6A 2EKEC 1EF5A 2MP2A 5FR6A 4A3PA 4HLEA 2JUOA 1WM3A 1WGRA 1XT9B 2KNBA 4KSLC 1WJNA 3QHTA 4DBGA 5D2MB 1AARA 4N9F4 3ZNZB 2WX0A 4W9GA 2K6QA 2K8BA 3B1LX 5DPSA 2L00B 2KC1A 4WAAA 5C23A 2KDFB 2LUEA 2D11A 2BYEA 1G6JA 2LGDA 3DBLI 4XC2A 2BYFA 1WXVA 4FJYA 2N9PC 3H7PB 2L0TA 2MBBB 3A9JA 3AU4A 2UWQA 2DZKA 2WYQA 5DPWA 2KZRA 4WJOA 4FHKA 2V3SA 4W9CA 3HM3A 1ZW7A 3NS8A 4TUUA 4RM9A 2L7RA 2BWES 3TBLD 1NI2A 3JYUA 3ECIA 4ASWC 2LWPA 3IFWB 4WJNA 5IAAC 1OEYJ 4G3XB 3L16A 2K39A 1OEYA 1UGMA 4IWOA 4W9HA 3RYTA 3ZRCA 3SDLC 2ASQA 2IYDB 1WR1A 3RZFA 1I35A 3EECA 2M1MA 3ZRFA 2KFKA 4HVBA 2ZCBA 2D2QA 3X23A 1WX7A 2PJHA 3UINB 2O6VB 4B6WA 2L76A 3EHVA 2IO1B 3W1SA 2FCMA 1WX9A 3QCAA 2J0MA 3VHTC 1C1YB 4HPLB 1QZEA 4NJ7A 4TV3A 1GC7A 2BKRB 1EO6A 1K8RB 4HCPB 2KQ7A 4KSKC 4HDQA 3A4RA 4KIKA 2LI5A 3RCZA 4W9EA 3UQAA 4NAWB 1V80A 4PYZA 3VXWA 2KLGA 4BBNC 1YX5B 3H9DA 2LD9A 1UH6A 1V6EA 2CS4A 2IBIB 3PRZA 1Q1OA 2NBUA 2LGYA 2C7NB 2RPQA 3V62A 4LCDE 3W1SC 4A20A 3ML8A 4TKNA 3UF8A 1R4MI 2RGFA 2XK5A 4RM8A 4KDIC 1E8WA 2BPSA 2C7MB 4K7WA 2DAJA 4URKA 1YD8U 2MBOA 3L13A 4WWNA 2R2QA 3PTFC 4GDKA 2N1WA 2MA9B 4CHKA 4BKTA 3VH4B 1WXAA 2D07B 2MWSB 1UELA 2K25A 2DYBA 3T9LA 1WIAA 2GMIC 3V61A 1GC6A 4MJSB 3VTUA 2G4DB 4AJYB 1TZ1A 3HM6X 4NQLB 4DK5A 2ZZPB 4IG7B 2MCNB 3M3JA 3QJZA 2FCNA 4FJZA 2C9WB 5CTRC 3VTVA 4E74A 1I42A 2RD0A 1YX6B 1TGZB 3KYDD 4W9LA 4B95A 3PV1A 3P2BA 2JPHA 3H7PA 3JSVB 1WGGA 2C5LC 5L83A 1GNUA 3PLUA 2LXCA 1JRUA 2MW5A 2AYOB 1WGYA 2ZNVB 3PS6A 4WJQA 1WZ3A 2OOBB 4FHJA 1E90A 1XD3B 2DENB 4LDTD 2BWFA 1HE8A 3K9OB 3VQIA 2I1KA 4FBJB 1A5RA 4EUTA 4XX5A 2AWTA 1E8ZA 4FJVB 3TCAA 3V6CB 2MLBA 2D10A 2M4NA 3T8MA 4NJ6A 1GG3A 2NCNA 3V6EB 4IWPA 2L0FA 3ZDMC 4EKUA 1WYWB 4GU2A 2R2OA 3AU5A 3L0WB 3RD2A 3TMPB 2NS5A 4W9IA 3ZNGC 2O6VA 1YQBA 2KVRA 1E8YA 3OAWA 5J18A 2CHXA 3OLMD 2KMCA 2MQJA 4I6PA 3KVFB 1H4RA 2A4ZA 2LASA 5E6NA 2KDBA 4IW0A 1YJ1A 3KUZA 4BKSD 2N1VA 4NAWA 4CYEA 5G2NA 3ZTCA 4DXAB 2DYOA 2KTRB 3EFUA 5HKHA 2KD0A 2ZEQA 2KANA 3ALBA 5AZGA 4AJWA 4K7SA 4EOYA 1C3TA 4ZRKA 3D32A 4I6LB 3WIMA 2EMSA 2KJRA 2N9EB 2A5UA 4DHJB 2NPTB 1EUVB 3MJWA 1F9JA 2HE7A 2XBBC 1GUAB 3DCGA 4MSQB 4MJSA 4DWFA 2HJ8A 3MTNB 3M63B 1TBEA 2FNJB 1NBFC 3H1UA 4MM3A 1WM2A 4IWQA 4GOCA 4JLCA 4MDKE 3SHQA 4B9KA 4LJPB 3QAQA 2MRPA 3VFKA 2DAFA 1UBIA 2RSUA 3TJPA 4HK2A 3UIOB 1LM8B 4IC7B 1FXTB 3DVNV 3JSVA 5LLIA 2D3GA 2KXJA 2NVUI 3QARA 3R7RA 3ZTDA 1WH3A 3KUCB 4K81A 4DDID 2GOWA 2BKFA 3BY4B 1S3SG 5JHBA 4OVVA 1OQYA 4MGIE 3VUXA 2L8JA 3CF6E 4MELA 3ZVVA 1E8XA 2PPHA 4EZJA 3RT3B 1Y8RC 3PZDA 4NPNA 3DVGX 2JY6A 2OJRA 2Z59B 3N30A 2GBNA 2KMAA 3WALA 3QK0A 4MGKE 3A9KB 1XQQA 2V4LA 5DPRA 3DBHI 1V2YA 2IO3B 3AI5A 1P1AA 2O2VB 2N7EA 3VAWA 4DDGD 2K8HA 2O6VD 4HPMB 4PYUA 5JHAA 4X57B 5JH5C 2KC2A 3JVZX 2FCSA 1GJZA 4HDOA 3APDA 1LFDA 3UIPB 4AOFA 4BKSA 4GIVA 4DHZB 3SU8X 4WWOA 2GBKA 1RLFA 3EC8A 1P9DU 2REXA 2KN5A 3PRMB 4EEWA 3UGBB 3U7DA 5E6OA 1WGDA 2LVOA 1OGWA 2IZVB 3CMMB 4ANXA 5KHQA 2KTRA 1V9JA 3KW5B 4J6IA 2KFJA 3B08A 4HJKA 2JT4B 4FULA 3DQVA 4PS8A 5AZFA 4FADA 3QQ8B 5DCNA 3BINA 3VDZA 3NHEB 3AXCA 4JQWC 1U4AA 2KJ6A 4GN1A 3WAMA 4K7UA 1RRBA 3WAOA 2JZ3B 2KWCA 3M95A 5JZEB 3APCA 2J0KA 2ZVNA 2KX0A 5TR5A 2KHWB 3N32A 4FLHA 1LQBA 2ZPYA 4GDLB 1P0RA 1OTRB 3O65B 2N7DA 2BF8B 2N4FA 4NQKE 3DPDA 5CHWA 2FAZA 4BBNF 2KLCA 3B0AA 2IY0B 5D7GA 3NOBA 2DZMA 2KDEB 2DYMA 1WX8A 2G4SA 3LJ3A 3MHSD 1CMXB 4KZCA 3R3MA 3PPAA 2KWVB 4ANWA 4KZ0A 2GBJA 4W9JA 1RAXA 2MX2A 1T0YA 3IVFA 3PVLA 2HD5B 2FIDA 2B3AA 5DPTA 2JWZA 1V5TA 3PHXB 3ONSA 1Z5SB 2LRWA 4CO7A 4A3OA 4KDLB 2PEAA 2IO0B 2C7HA 2YVCA 4BOSC 1IPGA 1WI0A 1V81A 3A9KA 1SIFA 3IHPC 3PGEA 3PREA 4GXBA 4AP4C 5AEKB 3WANA 1WF9A 2Z0EB 3M62B 2JF5A 1NDDA 2O2VA 2YLMA 1E7VA 3NZUA 5LXHA 3JW0X 3QWZB 1YIWA 1S1QB 3H7SA 1PQSA 3N3KB 1WZ0A 3APFA 5EDSA 2GBRA 2CU1A 4P7IA 2Z0DB 2IY1B 1UBQA 3PLVA 2G45B 3TIXA 2KJHB 5J17A 4WQOB 1RFAA 5BO4B 3LDZE 2GBMA 1SE9A 2JRIB 2FUHB 2NBWB 5D94A 1ISNA 1V5OA 3K9PB 2LJ5A 4W9DA 1LXDA 2W9NA 4BOZB 2DZJA 2MSED 4BFRA 2L3ZA 2PE9A 2WX1A 2MBQA 3QX1A 4RMAA 4JGHB 3HK0A 3PSEB 3RULA 3KUDB 1WJ6A 4G11A 2QHOA 3PT2B 5E6PA 3VVWB 1WJ4A 4W9KA 3QIJA 4ICVA 4ANUA 4E3CA 2KKCA 1ZGUB 4GB9A 1P3QU 2PE6B 2V1YA 2LXAA 4DHJD 4IM0A 3R7QA 4FN2A 3VUWA 4WWPA 2KDIA 3GZNI 2ZJDA 4EZLA 2KK8A 1KLVA 3A1QB 2K1FA 1IP9A 5G55A 2JXXA 2CR5A 2CKHB 5KHOA 1WXMA 2ZVOA 3ZKJC 2VRRB 2LVQA 2MBHA 2FIFA 5CHFA 4MGYE 4EFOA 4GSWA 3L08A 1KOTA 2XEWA 3U30A 3U8ZA 4XZ4A 5LXIB 4HXDA 3TL5A 2HTHA 4NNJB 2ZPNA 3DOWA 4GDLA 4PS7A 1VCBA 2DX5B 3NZSA 2C60A 1D3ZA 4W9FA 3RUIB 2LVPA 2I1JA 3V60A 5CHVC 3OJ4B 3DDCB 3HHMA 4ICUA 4II3B 4DHZE 3A4SC 1WR6E 3CSTA 3VUYA 3L10B 3Q3FA 2ZNVC 1UD7A 2CHWA 2J0JA 1L2NA 5IA7A 1SGHA 2N9XA 1R4NI 1WGHA 2K8CA 2JRHA 4GGQA 4G50A 3WA0A 2M17A 4F7ZA 1E5WA 5CX3A 4BVUC 1E7UA 2KOXA 2LRUA 4LJOB 4M8MA 5J2RA 5C1ZA 1WMHB 1J0GA 3W1YA 2Y5BB 4NY0A 4EZKA 4ZDVA 2AL6A 1Q5WB 2RR9A 3ZIMA 3L17A 1J8CA 1TTNA 2JVCA 3ZLZA 1Q0WB 1L7YA 2LZ6A 2MP2B 2JZZA 2AEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J19 A;  4IUM B;  4KV2 A;  3DVG Y;  4BKG A;  3NY5 A;  2BGF A;  4I6N B;  3VTW A;  3ZNH B;  2NR2 A;  4MSM B;  4E71 A;  2BYV E;  5GMV A;  3VH3 B;  1V86 A;  2MBE A;  3UQB A;  2NPT A;  1IYF A;  4ZRJ A;  5AZH A;  2NBV B;  2KX3 A;  3QA8 A;  3DBS A;  4HCN B;  4II2 B;  4MEM A;  1WFY A;  2CHZ A;  3A9J B;  3L54 A;  3PRP B;  4YL8 A;  3DVN U;  1H8C A;  4G0N B;  2K6D B;  3PHW B;  3WAP A;  4AUQ C;  2WWZ A;  3A1Q A;  1VD2 A;  4OVU A;  3C0R B;  3RZW C;  3ML9 A;  4TQ1 A;  4FA6 A;  2EMT A;  1V49 A;  4IM2 A;  4IM3 A;  4LDT B;  2M0X A;  3SD5 A;  3X0W A;  3ENE A;  3ZNI D;  3I3T B;  3R66 C;  4F1S A;  4JIO U;  3IG3 A;  3DBR I;  1EF1 A;  2FCQ A;  4TQ0 A;  3ZUN A;  3CSF A;  1UZX B;  3KYC D;  2KFK B;  4F8C B;  1WXS A;  4MH0 E;  2KO3 A;  4PS3 A;  2WDT B;  3Q3J A;  2ZCC A;  4K1R B;  4WJP A;  2DZI A;  4JL9 A;  2AL3 A;  2LGX A;  4ZRI A;  1KM7 A;  1WE7 A;  3S2A A;  4HWI B;  2G3Q B;  2KTF A;  4ANV A;  2J7Q B;  4ZYN A;  1P98 A;  3KH0 A;  4M8N A;  3HIZ A;  3QC8 B;  2KWU B;  4KIK B;  3ZW3 A;  3OJ3 A;  5L95 C;  1KJT A;  3ZO5 B;  2IO2 B;  3GOE A;  1X1M A;  3A33 B;  2UYZ B;  1MG8 A;  1WRD B;  3AUL A;  5D6J B;  1BT0 A;  3IBE A;  2L05 A;  4MGZ E;  3ZDT A;  2M8S A;  1Z2M A;  2XK5 B;  1WMH A;  4KVG B;  2DHZ A;  1WY8 A;  4M0W B;  4GMV A;  1WJU A;  4AWJ A;  2KQS A;  1M94 A;  1ZKH A;  3H6N A;  4GDK B;  1WE6 A;  2EKE C;  1EF5 A;  2MP2 A;  5FR6 A;  4A3P A;  4HLE A;  2JUO A;  1WM3 A;  1WGR A;  1XT9 B;  2KNB A;  4KSL C;  1WJN A;  3QHT A;  4DBG A;  5D2M B;  1AAR A;  4N9F 4;  3ZNZ B;  2WX0 A;  4W9G A;  2K6Q A;  2K8B A;  3B1L X;  5DPS A;  2L00 B;  2KC1 A;  4WAA A;  5C23 A;  2KDF B;  2LUE A;  2D11 A;  2BYE A;  1G6J A;  2LGD A;  3DBL I;  4XC2 A;  2BYF A;  1WXV A;  4FJY A;  2N9P C;  3H7P B;  2L0T A;  2MBB B;  3A9J A;  3AU4 A;  2UWQ A;  2DZK A;  2WYQ A;  5DPW A;  2KZR A;  4WJO A;  4FHK A;  2V3S A;  4W9C A;  3HM3 A;  1ZW7 A;  3NS8 A;  4TUU A;  4RM9 A;  2L7R A;  2BWE S;  3TBL D;  1NI2 A;  3JYU A;  3ECI A;  4ASW C;  2LWP A;  3IFW B;  4WJN A;  5IAA C;  1OEY J;  4G3X B;  3L16 A;  2K39 A;  1OEY A;  1UGM A;  4IWO A;  4W9H A;  3RYT A;  3ZRC A;  3SDL C;  2ASQ A;  2IYD B;  1WR1 A;  3RZF A;  1I35 A;  3EEC A;  2M1M A;  3ZRF A;  2KFK A;  4HVB A;  2ZCB A;  2D2Q A;  3X23 A;  1WX7 A;  2PJH A;  3UIN B;  2O6V B;  4B6W A;  2L76 A;  3EHV A;  2IO1 B;  3W1S A;  2FCM A;  1WX9 A;  3QCA A;  2J0M A;  3VHT C;  1C1Y B;  4HPL B;  1QZE A;  4NJ7 A;  4TV3 A;  1GC7 A;  2BKR B;  1EO6 A;  1K8R B;  4HCP B;  2KQ7 A;  4KSK C;  4HDQ A;  3A4R A;  4KIK A;  2LI5 A;  3RCZ A;  4W9E A;  3UQA A;  4NAW B;  1V80 A;  4PYZ A;  3VXW A;  2KLG A;  4BBN C;  1YX5 B;  3H9D A;  2LD9 A;  1UH6 A;  1V6E A;  2CS4 A;  2IBI B;  3PRZ A;  1Q1O A;  2NBU A;  2LGY A;  2C7N B;  2RPQ A;  3V62 A;  4LCD E;  3W1S C;  4A20 A;  3ML8 A;  4TKN A;  3UF8 A;  1R4M I;  2RGF A;  2XK5 A;  4RM8 A;  4KDI C;  1E8W A;  2BPS A;  2C7M B;  4K7W A;  2DAJ A;  4URK A;  1YD8 U;  2MBO A;  3L13 A;  4WWN A;  2R2Q A;  3PTF C;  4GDK A;  2N1W A;  2MA9 B;  4CHK A;  4BKT A;  3VH4 B;  1WXA A;  2D07 B;  2MWS B;  1UEL A;  2K25 A;  2DYB A;  3T9L A;  1WIA A;  2GMI C;  3V61 A;  1GC6 A;  4MJS B;  3VTU A;  2G4D B;  4AJY B;  1TZ1 A;  3HM6 X;  4NQL B;  4DK5 A;  2ZZP B;  4IG7 B;  2MCN B;  3M3J A;  3QJZ A;  2FCN A;  4FJZ A;  2C9W B;  5CTR C;  3VTV A;  4E74 A;  1I42 A;  2RD0 A;  1YX6 B;  1TGZ B;  3KYD D;  4W9L A;  4B95 A;  3PV1 A;  3P2B A;  2JPH A;  3H7P A;  3JSV B;  1WGG A;  2C5L C;  5L83 A;  1GNU A;  3PLU A;  2LXC A;  1JRU A;  2MW5 A;  2AYO B;  1WGY A;  2ZNV B;  3PS6 A;  4WJQ A;  1WZ3 A;  2OOB B;  4FHJ A;  1E90 A;  1XD3 B;  2DEN B;  4LDT D;  2BWF A;  1HE8 A;  3K9O B;  3VQI A;  2I1K A;  4FBJ B;  1A5R A;  4EUT A;  4XX5 A;  2AWT A;  1E8Z A;  4FJV B;  3TCA A;  3V6C B;  2MLB A;  2D10 A;  2M4N A;  3T8M A;  4NJ6 A;  1GG3 A;  2NCN A;  3V6E B;  4IWP A;  2L0F A;  3ZDM C;  4EKU A;  1WYW B;  4GU2 A;  2R2O A;  3AU5 A;  3L0W B;  3RD2 A;  3TMP B;  2NS5 A;  4W9I A;  3ZNG C;  2O6V A;  1YQB A;  2KVR A;  1E8Y A;  3OAW A;  5J18 A;  2CHX A;  3OLM D;  2KMC A;  2MQJ A;  4I6P A;  3KVF B;  1H4R A;  2A4Z A;  2LAS A;  5E6N A;  2KDB A;  4IW0 A;  1YJ1 A;  3KUZ A;  4BKS D;  2N1V A;  4NAW A;  4CYE A;  5G2N A;  3ZTC A;  4DXA B;  2DYO A;  2KTR B;  3EFU A;  5HKH A;  2KD0 A;  2ZEQ A;  2KAN A;  3ALB A;  5AZG A;  4AJW A;  4K7S A;  4EOY A;  1C3T A;  4ZRK A;  3D32 A;  4I6L B;  3WIM A;  2EMS A;  2KJR A;  2N9E B;  2A5U A;  4DHJ B;  2NPT B;  1EUV B;  3MJW A;  1F9J A;  2HE7 A;  2XBB C;  1GUA B;  3DCG A;  4MSQ B;  4MJS A;  4DWF A;  2HJ8 A;  3MTN B;  3M63 B;  1TBE A;  2FNJ B;  1NBF C;  3H1U A;  4MM3 A;  1WM2 A;  4IWQ A;  4GOC A;  4JLC A;  4MDK E;  3SHQ A;  4B9K A;  4LJP B;  3QAQ A;  2MRP A;  3VFK A;  2DAF A;  1UBI A;  2RSU A;  3TJP A;  4HK2 A;  3UIO B;  1LM8 B;  4IC7 B;  1FXT B;  3DVN V;  3JSV A;  5LLI A;  2D3G A;  2KXJ A;  2NVU I;  3QAR A;  3R7R A;  3ZTD A;  1WH3 A;  3KUC B;  4K81 A;  4DDI D;  2GOW A;  2BKF A;  3BY4 B;  1S3S G;  5JHB A;  4OVV A;  1OQY A;  4MGI E;  3VUX A;  2L8J A;  3CF6 E;  4MEL A;  3ZVV A;  1E8X A;  2PPH A;  4EZJ A;  3RT3 B;  1Y8R C;  3PZD A;  4NPN A;  3DVG X;  2JY6 A;  2OJR A;  2Z59 B;  3N30 A;  2GBN A;  2KMA A;  3WAL A;  3QK0 A;  4MGK E;  3A9K B;  1XQQ A;  2V4L A;  5DPR A;  3DBH I;  1V2Y A;  2IO3 B;  3AI5 A;  1P1A A;  2O2V B;  2N7E A;  3VAW A;  4DDG D;  2K8H A;  2O6V D;  4HPM B;  4PYU A;  5JHA A;  4X57 B;  5JH5 C;  2KC2 A;  3JVZ X;  2FCS A;  1GJZ A;  4HDO A;  3APD A;  1LFD A;  3UIP B;  4AOF A;  4BKS A;  4GIV A;  4DHZ B;  3SU8 X;  4WWO A;  2GBK A;  1RLF A;  3EC8 A;  1P9D U;  2REX A;  2KN5 A;  3PRM B;  4EEW A;  3UGB B;  3U7D A;  5E6O A;  1WGD A;  2LVO A;  1OGW A;  2IZV B;  3CMM B;  4ANX A;  5KHQ A;  2KTR A;  1V9J A;  3KW5 B;  4J6I A;  2KFJ A;  3B08 A;  4HJK A;  2JT4 B;  4FUL A;  3DQV A;  4PS8 A;  5AZF A;  4FAD A;  3QQ8 B;  5DCN A;  3BIN A;  3VDZ A;  3NHE B;  3AXC A;  4JQW C;  1U4A A;  2KJ6 A;  4GN1 A;  3WAM A;  4K7U A;  1RRB A;  3WAO A;  2JZ3 B;  2KWC A;  3M95 A;  5JZE B;  3APC A;  2J0K A;  2ZVN A;  2KX0 A;  5TR5 A;  2KHW B;  3N32 A;  4FLH A;  1LQB A;  2ZPY A;  4GDL B;  1P0R A;  1OTR B;  3O65 B;  2N7D A;  2BF8 B;  2N4F A;  4NQK E;  3DPD A;  5CHW A;  2FAZ A;  4BBN F;  2KLC A;  3B0A A;  2IY0 B;  5D7G A;  3NOB A;  2DZM A;  2KDE B;  2DYM A;  1WX8 A;  2G4S A;  3LJ3 A;  3MHS D;  1CMX B;  4KZC A;  3R3M A;  3PPA A;  2KWV B;  4ANW A;  4KZ0 A;  2GBJ A;  4W9J A;  1RAX A;  2MX2 A;  1T0Y A;  3IVF A;  3PVL A;  2HD5 B;  2FID A;  2B3A A;  5DPT A;  2JWZ A;  1V5T A;  3PHX B;  3ONS A;  1Z5S B;  2LRW A;  4CO7 A;  4A3O A;  4KDL B;  2PEA A;  2IO0 B;  2C7H A;  2YVC A;  4BOS C;  1IPG A;  1WI0 A;  1V81 A;  3A9K A;  1SIF A;  3IHP C;  3PGE A;  3PRE A;  4GXB A;  4AP4 C;  5AEK B;  3WAN A;  1WF9 A;  2Z0E B;  3M62 B;  2JF5 A;  1NDD A;  2O2V A;  2YLM A;  1E7V A;  3NZU A;  5LXH A;  3JW0 X;  3QWZ B;  1YIW A;  1S1Q B;  3H7S A;  1PQS A;  3N3K B;  1WZ0 A;  3APF A;  5EDS A;  2GBR A;  2CU1 A;  4P7I A;  2Z0D B;  2IY1 B;  1UBQ A;  3PLV A;  2G45 B;  3TIX A;  2KJH B;  5J17 A;  4WQO B;  1RFA A;  5BO4 B;  3LDZ E;  2GBM A;  1SE9 A;  2JRI B;  2FUH B;  2NBW B;  5D94 A;  1ISN A;  1V5O A;  3K9P B;  2LJ5 A;  4W9D A;  1LXD A;  2W9N A;  4BOZ B;  2DZJ A;  2MSE D;  4BFR A;  2L3Z A;  2PE9 A;  2WX1 A;  2MBQ A;  3QX1 A;  4RMA A;  4JGH B;  3HK0 A;  3PSE B;  3RUL A;  3KUD B;  1WJ6 A;  4G11 A;  2QHO A;  3PT2 B;  5E6P A;  3VVW B;  1WJ4 A;  4W9K A;  3QIJ A;  4ICV A;  4ANU A;  4E3C A;  2KKC A;  1ZGU B;  4GB9 A;  1P3Q U;  2PE6 B;  2V1Y A;  2LXA A;  4DHJ D;  4IM0 A;  3R7Q A;  4FN2 A;  3VUW A;  4WWP A;  2KDI A;  3GZN I;  2ZJD A;  4EZL A;  2KK8 A;  1KLV A;  3A1Q B;  2K1F A;  1IP9 A;  5G55 A;  2JXX A;  2CR5 A;  2CKH B;  5KHO A;  1WXM A;  2ZVO A;  3ZKJ C;  2VRR B;  2LVQ A;  2MBH A;  2FIF A;  5CHF A;  4MGY E;  4EFO A;  4GSW A;  3L08 A;  1KOT A;  2XEW A;  3U30 A;  3U8Z A;  4XZ4 A;  5LXI B;  4HXD A;  3TL5 A;  2HTH A;  4NNJ B;  2ZPN A;  3DOW A;  4GDL A;  4PS7 A;  1VCB A;  2DX5 B;  3NZS A;  2C60 A;  1D3Z A;  4W9F A;  3RUI B;  2LVP A;  2I1J A;  3V60 A;  5CHV C;  3OJ4 B;  3DDC B;  3HHM A;  4ICU A;  4II3 B;  4DHZ E;  3A4S C;  1WR6 E;  3CST A;  3VUY A;  3L10 B;  3Q3F A;  2ZNV C;  1UD7 A;  2CHW A;  2J0J A;  1L2N A;  5IA7 A;  1SGH A;  2N9X A;  1R4N I;  1WGH A;  2K8C A;  2JRH A;  4GGQ A;  4G50 A;  3WA0 A;  2M17 A;  4F7Z A;  1E5W A;  5CX3 A;  4BVU C;  1E7U A;  2KOX A;  2LRU A;  4LJO B;  4M8M A;  5J2R A;  5C1Z A;  1WMH B;  1J0G A;  3W1Y A;  2Y5B B;  4NY0 A;  4EZK A;  4ZDV A;  2AL6 A;  1Q5W B;  2RR9 A;  3ZIM A;  3L17 A;  1J8C A;  1TTN A;  2JVC A;  3ZLZ A;  1Q0W B;  1L7Y A;  2LZ6 A;  2MP2 B;  2JZZ A;  2AEH A; 
#chains in the Genus database with same CATH topology
 3U52 E;  1D4B A;  3VTW A;  3ZNH B;  3AE3 B;  4A9A A;  5GMV A;  2MBE A;  4XE0 A;  1BUI C;  4C7Z A;  2NBV B;  3QA8 A;  2CHZ A;  1WXQ A;  3VR9 B;  2QDF A;  2N9K A;  4G0N B;  4LTU A;  3A1Q A;  4ZHO A;  2DWQ A;  3B9J A;  2Q5W D;  2AQ2 B;  2QEJ C;  4TQ1 A;  4ARC A;  3DHI C;  3VRA B;  1V49 A;  3MJ5 A;  4FA6 A;  1NEK B;  1TKE A;  2M0X A;  3X0W A;  3I3T B;  2QIL A;  4F1S A;  1KH0 A;  4L23 A;  1C4C A;  1YJI A;  3ZUN A;  3CSF A;  3KYC D;  2BB5 A;  3P42 A;  1WXS A;  4PS3 A;  2WXF A;  4WJP A;  4ZRI A;  3S2A A;  5FK9 C;  1OQQ A;  2KTF A;  2J7Q B;  3KH0 A;  4M8N A;  1HZ5 A;  1BXT A;  2WXH A;  1X1M A;  1MG8 A;  1BT0 A;  4ITK A;  1CZP A;  1Z2M A;  4KVG B;  2DHZ A;  2K9X A;  4GMV A;  3SFE B;  2J42 A;  1TS3 A;  2MP2 A;  2V0G A;  5MPO A;  1AAR A;  4W9G A;  3N1Z C;  1NVI D;  2WDV B;  2KC1 A;  4WAA A;  1ZDV A;  2BS3 B;  4A6Q A;  2BTE A;  2LUE A;  1FCC C;  1UGJ A;  3DBL I;  4FJY A;  2N9P C;  1E6E B;  2DZK A;  4A90 A;  1WSP A;  1SXT A;  1KF6 B;  2YEP B;  2V3S A;  4ZYS A;  2BB6 A;  2L7R A;  2BWE S;  1NI2 A;  2NTS A;  3ECI A;  2LHE A;  4G3X B;  3ZRC A;  1UGM A;  2GI9 A;  1ENF A;  3SDL C;  2ASQ A;  3EEC A;  4RFB A;  3UIN B;  4B6W A;  3R8B A;  2IO1 B;  3R2I A;  3N1X C;  1C1Y B;  4TV3 A;  2FE8 A;  1EO6 A;  3A4R A;  2LI5 A;  4RGN A;  3BVM A;  4NAW B;  4PYZ A;  2KLG A;  2HTM E;  1YX5 B;  3AE8 B;  4A20 A;  4HKZ E;  3J9C A;  3UF8 A;  1MVK A;  2RGF A;  3EUB 2;  4K7W A;  4URK A;  1YD8 U;  1V8C A;  2MBO A;  5BYQ A;  3L13 A;  3SR6 A;  4YSX B;  5TSS A;  4BKT A;  4CHK A;  2D07 B;  5D3D A;  2AQ3 B;  3VTU A;  1TT5 B;  3HM6 X;  4DK5 A;  4IG7 B;  3E9S A;  1F0Z A;  2KQ4 X;  3QJZ A;  2WQY B;  4YSZ B;  1BML C;  1TGZ B;  3KYD D;  3P4S B;  1YQ4 B;  5G5H A;  4ZHP A;  1GNU A;  1N61 A;  4WJQ A;  1JRU A;  2MW5 A;  1WGY A;  3DBL B;  4FHJ A;  1XD3 B;  2DEN B;  4LDT D;  1HE8 A;  3L4P A;  5C3J B;  4XX5 A;  1N6Z A;  4FJV B;  4M02 A;  3KLS X;  3ZDM C;  3Q14 C;  4LNK A;  2M19 A;  3L0W B;  3EA6 A;  4P1C C;  2NS5 A;  2QMT A;  2O6V A;  1YQB A;  2KVR A;  5J18 A;  4AS1 A;  2CHX A;  3OLM D;  1MHH E;  2MQJ A;  3KVF B;  1EWY C;  2A4Z A;  2LAS A;  1PUT A;  5E6N A;  4IW0 A;  1YJ1 A;  3KUZ A;  5BMG A;  1CK1 A;  4CYE A;  2JQR B;  2SAK A;  1P7E A;  3EFU A;  2BVC A;  1YQ3 B;  3ALB A;  4K7S A;  2JYE A;  3ZJU A;  4ZRK A;  2D5G A;  2KJR A;  4DHJ B;  2A5U A;  1STE A;  2NPT B;  3NZ3 A;  1GUA B;  4OZC A;  3MC0 B;  4MSQ B;  3AE1 B;  4LNN A;  3UI3 A;  3AH7 A;  2D3A A;  1NBF C;  3H1U A;  4JLC A;  2JYT A;  1C4A A;  1R7S A;  2RSU A;  1LM8 B;  1OQR A;  3T3N A;  2D3G A;  2KXJ A;  3QAR A;  3ZTD A;  1TS4 A;  1WH3 A;  3KUC B;  4K81 A;  2GOW A;  3NG0 A;  1S3S G;  2KT7 A;  2L8J A;  5BMI A;  3PZD A;  3RMK C;  2JY6 A;  2OJR A;  1SB3 C;  5FR3 A;  2KMA A;  3WAL A;  1IUE A;  1J7B A;  3DBH I;  1K51 A;  2N7E A;  3VAW A;  1K50 A;  1GAQ B;  4HPM B;  5JHA A;  1C9F A;  1E10 A;  2INP E;  3BZD B;  5IKC M;  3UIP B;  1DGJ A;  4GIV A;  1QT9 A;  4N6E B;  3BWU D;  2GBK A;  1QOB A;  4XWW A;  1P9D U;  2LVO A;  4US9 A;  1FD6 A;  4FUL A;  1UWM A;  3QQ8 B;  4NJC A;  3BIN A;  3NHE B;  4GN1 A;  4PT5 A;  3WAM A;  4JWS C;  2QJL A;  2RDB C;  4K7U A;  1RRB A;  3WAO A;  4KX6 B;  2J0K A;  4FLH A;  2DLB A;  2ZPY A;  4XYC A;  3ETR A;  3BVG A;  2BF8 B;  4KKJ A;  5E6J A;  3KQ4 A;  2Y3A A;  1EU3 A;  3B0A A;  2IY0 B;  3RNE C;  2DYM A;  3LJ3 A;  3R3M A;  4WUR A;  2HJ1 A;  1JRP A;  4WWM A;  1GB4 A;  5HHD G;  4BOS C;  1WI0 A;  4GXB A;  3PRE A;  3PGE A;  4AP4 C;  2Z0E B;  2KN4 A;  2YLM A;  1NDD A;  3NZU A;  1E7V A;  3DBH B;  2LEK A;  3H7S A;  3RNC C;  1TS5 A;  3PZ7 A;  1ESF A;  1VLB A;  1UWX A;  2GBM A;  2JRI B;  1ACC A;  2LJ5 A;  1VZ6 A;  3AEE B;  4BOZ B;  2MSE D;  3QX1 A;  1N5W A;  4RMA A;  3PSE B;  3KUD B;  3VVW B;  1WJ4 A;  4W9K A;  1FFV A;  1P3Q U;  3R7Q A;  4FN2 A;  2KDI A;  3GZN I;  5EE0 A;  1IP9 A;  1FFU A;  2CKH B;  2INC C;  2LVQ A;  3RNA C;  2ZW0 A;  4YT0 B;  3TL5 A;  4NNJ B;  3DOW A;  4PS7 A;  1N62 A;  1MHX A;  1UUP A;  1VCB A;  2RPV A;  3AE9 B;  4RCO A;  3DDC B;  3HHM A;  3L10 B;  2CHW A;  2J0J A;  5IA7 A;  2K8C A;  2JRH A;  4LNF A;  1FEH A;  1XLQ A;  1SJE D;  1MPE A;  4F7Z A;  4D2K A;  4BVU C;  2LRU A;  5J2R A;  4ZDV A;  3R2T A;  1J8C A;  1TTN A;  1Q0W B;  1L7Y A;  3P4R B;  1J19 A;  4IUM B;  4KV2 A;  2LFI A;  1YN3 A;  3DVG Y;  4BKG A;  2IGH A;  4I6N B;  1YN4 A;  2CJN A;  3VH3 B;  1VR9 A;  1IYF A;  1HTO A;  4YTP B;  5AZH A;  3NVW A;  4HCN B;  4II2 B;  1WFY A;  4YSY B;  3PRP B;  4YL8 A;  3DVN U;  1YJJ A;  2K6D B;  4AUQ C;  3Q3O C;  4KGR A;  2ZW1 A;  2V3N A;  3C0R B;  1JWS D;  4S0R A;  2WXP A;  4IM2 A;  4LDT B;  4IM3 A;  3ENE A;  3AED B;  4JIO U;  1XLP A;  3DBR I;  2FCQ A;  5HG2 A;  3AE7 B;  1UZX B;  2I38 A;  4F8C B;  5BMH A;  4IOI E;  2WDT B;  1SJH D;  2ZCC A;  2PTL A;  4K1R B;  3Q2A C;  2J4X A;  1WE7 A;  4PK1 A;  2ICI A;  4HJG E;  2GB1 A;  1FXI A;  2K22 A;  4ZYN A;  1AWD A;  3QC8 B;  4KIK B;  3ZW3 A;  3OJ3 A;  2KAJ A;  3AEB B;  3A33 B;  2UYZ B;  1WRD B;  3AUL A;  4RF1 A;  3IBE A;  2L05 A;  3ZDT A;  4Q2J A;  1WMH A;  3TUO A;  1SEB D;  2AX5 A;  3VRB B;  1WJU A;  4AWJ A;  4GDK B;  2DNF A;  1JWU D;  1WE6 A;  2EKE C;  1JWB D;  1EF5 A;  1WM3 A;  1WGR A;  4HRS A;  3BII D;  3ZNZ B;  3V05 A;  1I4P A;  1F2R I;  5C23 A;  3AE4 B;  2BYE A;  1G6J A;  1WXV A;  3Q8A A;  3H7P B;  2MBB B;  1V1P B;  3V3X A;  2UWQ A;  5DPW A;  2KZR A;  2N0S B;  4JE3 B;  1ZW7 A;  3NS8 A;  1JAL A;  4TUU A;  1HQR D;  3TBL D;  3JYU A;  2LWP A;  3IFW B;  2ONQ A;  1SE4 A;  4WJN A;  1OEY J;  2JSV X;  3L16 A;  5C2T B;  3MP9 A;  5T8I A;  1TIF A;  2PVO D;  2WHI A;  3P63 A;  1IGD A;  2ZCB A;  2D2Q A;  3DBR B;  4JWU C;  1E0Z A;  3W1S A;  1VJK A;  2J0M A;  4HPL B;  1QZE A;  2BKR B;  2JWU A;  4HCP B;  2KQ7 A;  4W9E A;  5EE3 A;  4ZOH C;  1C76 A;  1C77 A;  3U30 A;  2CS4 A;  2MEK A;  3PRZ A;  4HKQ A;  3W1S C;  3DWM A;  2DAJ A;  4WWN A;  2R2Q A;  3PTF C;  1TKY A;  1LO5 D;  2MA9 B;  3VH4 B;  3TEX A;  2MWS B;  2CU3 A;  3V61 A;  1GC6 A;  4AJY B;  1TZO A;  1TZ1 A;  2ZZP B;  5H92 C;  3M3J A;  4MM3 B;  2FCN A;  4FJZ A;  1EM7 A;  2JZP A;  2GLS A;  1WGG A;  2C5L C;  2K5P A;  2KVZ A;  2LXC A;  3LXF A;  2OOB B;  3K9O B;  2PKO A;  1A5R A;  3NUH B;  3TCA A;  2MLB A;  3RNG C;  2D10 A;  3CIR B;  1GG3 A;  4USA A;  3LB8 C;  2L0F A;  3BK1 A;  4EKU A;  1WYW B;  1JML A;  3AN1 A;  3TMP B;  2L32 A;  1L4D B;  2WDR B;  2VH1 A;  3ZNG C;  1QKZ A;  4XGA B;  3DWG C;  2WXN A;  3FC4 A;  3KWL A;  2SEB D;  4NAW A;  3AE6 B;  2CJO A;  2KD0 A;  4YTN B;  2ZEQ A;  1VRA B;  1VDV A;  2EEL A;  4C56 C;  5AZG A;  4EOY A;  3WIM A;  4I6L B;  2N9E B;  1T5X D;  3BK2 A;  1F9J A;  2WDQ B;  1TY0 A;  2HE7 A;  3BYY B;  1TY2 A;  3MTN B;  4M01 A;  3M63 B;  1TBE A;  1XXG A;  2V3P A;  3VFK A;  2WP9 B;  3B2G A;  1UBI A;  3UIO B;  1FXT B;  2H88 B;  3R7R A;  2NVU I;  3AMZ A;  2BKF A;  3RNF C;  4MGI E;  3VUX A;  3CF6 E;  4MEL A;  3ZVV A;  4EZJ A;  1E8X A;  4NPN A;  3DVG X;  3A9K B;  1XQQ A;  1V2Y A;  1QOF A;  3AI5 A;  1P1A A;  2O2V B;  4DDG D;  2K8H A;  3Q3M C;  4PYU A;  4R3D A;  2Y5P A;  4X57 B;  2KC2 A;  1L5P A;  4A55 A;  1LFD A;  4RH6 A;  4AOF A;  4BKS A;  4DHZ B;  1IBX B;  3SU8 X;  2IGD A;  3NVY A;  2RDH A;  1WRI A;  1N60 A;  2REX A;  3Q8E A;  1TS2 A;  3NVV A;  1OGW A;  1I4X A;  3PO0 A;  4ANX A;  1V9J A;  2KFJ A;  3B08 A;  4HJK A;  4PS8 A;  3TEZ A;  3AXC A;  4JQW C;  1V1O A;  2KJ6 A;  2WXL A;  4RF0 A;  3APC A;  2Y5C A;  2I2Y A;  1I4G A;  1LQB A;  3RPF C;  1B9R A;  3OWE B;  3O65 B;  1MG4 A;  2D3B A;  1YN5 A;  1L4Z B;  5CHW A;  5D7G A;  4KZC A;  1WX8 A;  2UU7 A;  2W3R A;  3RFZ B;  4W9J A;  1ZXH A;  2HD5 B;  2FID A;  2B3A A;  5DPT A;  3U2S C;  3PHX B;  1V5T A;  1T0R C;  1Z5S B;  2LRW A;  4CO7 A;  1XCQ L;  4A3O A;  2C7H A;  4WH4 A;  1WF9 A;  2JF5 A;  3JW0 X;  3QWZ B;  2D3C A;  2KYW A;  1PQS A;  1SSN A;  1WZ0 A;  5HFY A;  5EDS A;  2CU1 A;  2IY1 B;  1I7H A;  1UBQ A;  4LK0 M;  1RFA A;  2NBW B;  5D94 A;  4OW0 A;  4W9D A;  1LXD A;  3IAS 1;  1C79 A;  4JGH B;  3RUL A;  1WJ6 A;  4G11 A;  2QHO A;  3AB5 A;  4HEA 1;  3HVD A;  5E6P A;  4B0E A;  3SFD B;  2V1Y A;  3Q8F A;  2KK8 A;  2K1F A;  1RWS A;  5KHO A;  1WXM A;  2VRR B;  5CHF A;  4MGY E;  2XEW A;  3GE8 C;  3U8Z A;  4AQ7 A;  4XZ4 A;  5LXI B;  2KMM A;  3NVZ A;  4W9F A;  3RUI B;  2PLP A;  2LVP A;  3AV8 A;  2I1J A;  3OJ4 B;  1YNT E;  3CST A;  3VUY A;  2VZK D;  2M56 B;  4IKG A;  3Q3F A;  2ZNV C;  1UD7 A;  1R4N I;  1WGH A;  2RDG A;  1IGC A;  3EFC A;  5EE9 A;  3WA0 A;  1F77 A;  1E5W A;  1L0X B;  1E7U A;  2KOX A;  1XO3 A;  4LJO B;  4M8M A;  4ZRP A;  3W1Y A;  4A8X C;  3ZIM A;  2PMV A;  1I4H A;  2FBW B;  2AEH A;  4WIP A;  3RNB C;  3NY5 A;  4K3B A;  2NR2 A;  3UQB A;  2WLB A;  1ZDX A;  2BBC A;  2WS3 B;  2IDY A;  3Q6B A;  4ZRJ A;  1QOG A;  1FO4 A;  3W5V B;  2K3U A;  1D5Z C;  3A9J B;  3FIL B;  3L54 A;  1M4V A;  2XN9 C;  4LLG M;  2WWZ A;  1VD2 A;  4OVU A;  3N20 C;  4EE2 A;  4CQN A;  3RZW C;  3ML9 A;  2BYT A;  3Q69 A;  3GB1 A;  3AM9 A;  2WXG A;  2W55 A;  4TQ0 A;  1TKG A;  2KFK B;  1QLB B;  1ZE3 D;  4JL9 A;  2LMC A;  2LGX A;  1KM7 A;  4HWI B;  2G3Q B;  4ANV A;  4OZA A;  1P98 A;  1F1H A;  1SE3 A;  2KWU B;  3U7Z A;  1KJT A;  2IO2 B;  1R4N B;  5D6J B;  4MGZ E;  4DQO C;  3U4E G;  2BS4 B;  2M8S A;  5IN7 A;  2E6X A;  2XK5 B;  1WY8 A;  3N9Y C;  4M0W B;  4GLS C;  4C4V A;  1M94 A;  5BYS A;  3H6N A;  3NJT A;  2KWD A;  3I9V 1;  2BW2 A;  4HLE A;  2JUO A;  1XT9 B;  2KNB A;  3QHT A;  4DBG A;  2WXK A;  2V9H A;  2WX0 A;  4L2Y A;  5HI1 A;  2K6Q A;  2K8B A;  2YEP F;  3HUI A;  2G9H D;  1HEZ E;  2KDF B;  4RGO S;  1RFK A;  2D11 A;  1SE2 A;  2LGD A;  4OHJ A;  3AEC B;  2L0T A;  1Y56 A;  1XLN A;  4WJO A;  3C19 A;  1SIJ A;  2LJI A;  4FHK A;  1FPY A;  3DHH C;  4W9C A;  3HM3 A;  4HPP A;  3GS2 A;  4RGM A;  4RM9 A;  4ASW C;  2PIA A;  5IAA C;  3RYT A;  2K39 A;  1OEY A;  1L0V B;  3IT6 B;  1EWC A;  3RZF A;  1I35 A;  2M1M A;  3ZRF A;  1K52 A;  1VZ8 A;  3X23 A;  1WX7 A;  2PJH A;  1FM0 D;  4IDI A;  2MJ3 A;  2L76 A;  3EHV A;  1E7P B;  2FCM A;  3QCA A;  3VHT C;  1GC7 A;  3Q3N C;  1K8R B;  1FCL A;  4KIK A;  3RCZ A;  3UQA A;  3O13 A;  3IXS A;  1V80 A;  2LD9 A;  2NBU A;  2RPQ A;  2C7N B;  3ML8 A;  4TKN A;  1R4M I;  4RM8 A;  2C7M B;  4TMA B;  4GDK A;  3ZJV A;  2VH2 A;  1HTQ A;  1WXA A;  5AUK A;  3AEF B;  2K25 A;  2DYB A;  3T9L A;  1WIA A;  5EE1 A;  1PDX A;  4MJS B;  2G4D B;  1L6U A;  4NQL B;  3TEY A;  2NTT A;  3GZN B;  2LGI A;  2C9W B;  5CTR C;  3VTV A;  1FIQ A;  2RD0 A;  1YX6 B;  4BZA A;  3TEW A;  4B95 A;  3P2B A;  3H7P A;  3JSV B;  1V1P A;  3HVZ A;  5L83 A;  3PLU A;  1TYG B;  1J7C A;  1E90 A;  1UNS A;  2W54 A;  2I1K A;  4EUT A;  2AWT A;  1E8Z A;  2WU5 B;  2X8X X;  3V6C B;  1PFD A;  2FUG 1;  1XLO A;  4NJ6 A;  2EKI A;  2NCN A;  4S17 A;  4GU2 A;  3AU5 A;  4W9I A;  3OAW A;  2PW9 A;  1JWM D;  3P1M A;  4I6P A;  1H4R A;  2KDB A;  4BKS D;  5G2N A;  2X38 A;  4DXA B;  2KTR B;  5HKH A;  4AJW A;  2ON8 A;  1C3T A;  3E56 A;  1R4M B;  1EUV B;  3AE5 B;  3MJW A;  2XBB C;  3ZQ4 A;  1FRD A;  5BYR A;  1NI3 A;  2QSD A;  2FNJ B;  4MM3 A;  4IWQ A;  2WNM A;  4MDK E;  5IO9 A;  1B1Z A;  3SHQ A;  4B9K A;  4LJP B;  2MRP A;  2DAF A;  4M00 A;  2XNA C;  2QCZ A;  4HK2 A;  4OVZ A;  4IC7 B;  5LLI A;  3DVN V;  4DDI D;  4C7Y A;  3BY4 B;  1K53 A;  4OVV A;  1OQY A;  2VZK B;  3C8Y A;  2PPH A;  4KGS A;  3RT3 B;  3N30 A;  4MGK E;  2V4L A;  2O6V D;  5JH5 C;  3JVZ X;  2FCS A;  3OG5 A;  1YMH E;  4WWO A;  1KLU D;  3EC8 A;  3PRM B;  2KN5 A;  1L6V A;  5E6O A;  3U7D A;  1FNW A;  3Q8B A;  2IZV B;  3CMM B;  5IOI A;  5IP4 D;  1C4P A;  4J6I A;  4FAD A;  2JT4 B;  3DQV A;  2M0A A;  1U4A A;  4N59 A;  2KWC A;  1P7F A;  4XDD A;  1JQ4 A;  1ZP0 B;  2KDM A;  2KX0 A;  1NYR A;  2KHW B;  3N32 A;  3SEB A;  4GDL B;  2WXI A;  1XF5 L;  2N7D A;  2N4F A;  3KWV A;  2IJ0 A;  4REZ A;  4NQK E;  3FAH A;  2FAZ A;  4BBN F;  4ARI A;  2KLC A;  3AEG B;  3NOB A;  2DZM A;  4LNO A;  3MHS D;  1CMX B;  3ZGZ A;  4XDC A;  4ANW A;  2LGS A;  2GBJ A;  3ZJT A;  1KLG D;  1SBB B;  3GP7 A;  4ZRQ A;  4KDL B;  2PEA A;  4C00 A;  1IPG A;  3A9K A;  1SIF A;  3IHP C;  2H89 B;  3M62 B;  2O2V A;  1PGB A;  3DHG C;  1PGX A;  4B0M A;  3N3K B;  1FNU A;  5G5G A;  2GBR A;  2Z0D B;  1DYQ A;  2G45 B;  3TIX A;  2KJH B;  4WQO B;  5BO4 B;  1IBX A;  3AE2 B;  1V5O A;  3K9P B;  4TSS A;  4MH8 A;  2W9N A;  3CWI A;  2L3Z A;  2PE9 A;  2WX1 A;  2MBQ A;  2GRI A;  3HK0 A;  1YOV B;  3PT2 B;  4ICV A;  4JPS A;  4E3C A;  3I57 A;  1ZGU B;  4GB9 A;  2PE6 B;  5I4D A;  3A1Q B;  3IT4 B;  5G55 A;  2CR5 A;  1OFF A;  3ZKJ C;  2FIF A;  1EU4 A;  2L52 A;  4GSW A;  1KOT A;  4XWT A;  4MT5 A;  2HTH A;  1T0S C;  2DX5 B;  3NZS A;  1T6B X;  1ROE A;  5CHV C;  3PZ8 A;  1I4Q A;  1WR6 E;  3ZXR A;  1L2N A;  5LNK 1;  1ZOY B;  1SGH A;  1E9M A;  2N9X A;  4GGQ A;  2WXM A;  1DOY A;  5CX3 A;  3RI7 C;  2RMM A;  4NY0 A;  4EZK A;  3L17 A;  4O1N A;  2JVC A;  2LZ6 A;  2MP2 B;  2JZZ A;  1WYG A;  1VZ7 A;  2BGF A;  4MSM B;  4E71 A;  2BYV E;  1V86 A;  2NPT A;  1QIL A;  3Q8C A;  1ZXI A;  2KX3 A;  2LHD A;  3DBS A;  3VR8 B;  2K0P A;  2MH7 A;  4MEM A;  3ABV B;  4N58 A;  1H8C A;  1HA5 A;  3PHW B;  3WAP A;  1AYF A;  2W82 A;  1KRH A;  1MFW A;  2EMT A;  3SD5 A;  3ZNI D;  3R66 C;  1MJD A;  3IG3 A;  1EF1 A;  3BVZ A;  1D5M C;  1GPX A;  2IGG A;  4MH0 E;  2KO3 A;  3Q3J A;  1NYQ A;  2DZI A;  2AL3 A;  3LYY A;  3HIZ A;  1FRR A;  1PYW D;  1QF6 A;  5L95 C;  3ZO5 B;  1T3Q A;  3GOE A;  1HZ6 A;  4HRO A;  1TJE A;  1JCK B;  4UDU C;  4P16 A;  2N7J A;  2KQS A;  1ZKH A;  1N5X A;  2MHJ A;  3FKY A;  5FR6 A;  4A3P A;  4KSL C;  1UF0 A;  4C80 A;  1WJN A;  2INN E;  2WXQ A;  5D2M B;  3I63 C;  4N9F 4;  3B1L X;  5DPS A;  2L00 B;  1MI0 A;  5H8Y E;  4WAF A;  4XC2 A;  2BYF A;  1FNV A;  3A9J A;  1AN8 A;  3AU4 A;  3FIL A;  4RNA A;  5JXV A;  3MC8 A;  2WYQ A;  3BYT B;  1XEE A;  3MFG A;  1JRO A;  2L1A A;  4LNI A;  4IWO A;  4W9H A;  3AEA B;  2BQQ A;  2IYD B;  1WR1 A;  2TSS A;  2WGS A;  3IAM 1;  2KFK A;  4HVB A;  2O6V B;  1WX9 A;  4NJ7 A;  1FMA D;  2BT6 A;  4FXC A;  4KSK C;  4HDQ A;  4WQM A;  1V97 A;  4RGT A;  1KTK A;  3VXW A;  1CQV A;  4BBN C;  3H9D A;  1UH6 A;  1V6E A;  2IBI B;  1Q1O A;  3V62 A;  2LGY A;  3T3O A;  4P6V F;  4LCD E;  2XK5 A;  4KDI C;  1E8W A;  2BPS A;  4M0W A;  1Q10 A;  2N1W A;  1I4R A;  1DOX A;  1UEL A;  1N63 A;  3MC9 A;  2GMI C;  1DOI A;  1QOA A;  4DXF A;  2MCN B;  3MHZ A;  1AW7 A;  4E74 A;  1I42 A;  4W9L A;  3PV1 A;  2MJD A;  2WXJ A;  2JPH A;  1ET9 A;  2AYO B;  2ZNV B;  3PS6 A;  4QAY A;  1WZ3 A;  2AQ1 B;  2BWF A;  3VQI A;  4DXG A;  4FBJ B;  3I5J C;  2N9L A;  1NEN B;  2M4N A;  3T8M A;  3V6E B;  1GB1 A;  4IWP A;  5GXG B;  2R2O A;  3RD2 A;  1A70 A;  4YTM B;  1E8Y A;  1F52 A;  3H8H A;  3W2D A;  3W5U B;  4YXD B;  2KMC A;  1GOZ A;  2R61 A;  2E3T A;  2MJE A;  2N1V A;  2DBY A;  3B2F A;  1ZPS A;  3ZTC A;  2DYO A;  4ACF A;  1ET6 A;  1WWT A;  2KAN A;  2Z8L A;  4H2A A;  3D32 A;  1RYJ A;  2HDE A;  1JW9 D;  2EMS A;  3DCG A;  2JXT A;  4MJS A;  4DWF A;  2QIE B;  2HJ8 A;  3ZYY X;  1WM2 A;  3WCQ A;  4GOC A;  4OZB A;  3QAQ A;  4NAM A;  2LUM A;  3TJP A;  3JSV A;  5JHB A;  2KAC A;  1Y8R C;  2Z59 B;  2GBN A;  3QK0 A;  5DPR A;  2IO3 B;  5D3I B;  1XCT L;  4MAC A;  4L1B A;  1SF0 A;  1GJZ A;  1QQR A;  4HDO A;  3APD A;  1PGA A;  2B76 B;  2ACZ B;  4K3C A;  1RLF A;  4YWG G;  4EEW A;  3UGB B;  4P1B C;  2BS2 B;  1WGD A;  4C4V B;  2J53 A;  1D5X C;  5KHQ A;  2KTR A;  3KW5 B;  3P4P B;  3GE3 C;  5AZF A;  2JU6 X;  5DCN A;  3VDZ A;  3HRD D;  1J7A A;  2JZ3 B;  3M95 A;  5JZE B;  2ZVN A;  5TR5 A;  3P4Q B;  1FXA A;  3NRZ A;  1P0R A;  1OTR B;  3DPD A;  1D6E C;  1WGK A;  2KDE B;  2G4S A;  3PPA A;  2KWV B;  3TSS A;  4KZ0 A;  1RAX A;  2MX2 A;  1KFY B;  1T0Y A;  3IVF A;  3PVL A;  4US8 A;  1LGR A;  2JWZ A;  3ONS A;  2IPK D;  2IO0 B;  2YVC A;  1V81 A;  5AEK B;  3WAN A;  3URY A;  5LXH A;  2OJW A;  4J3O D;  2W3S A;  1YIW A;  1S1Q B;  2OED A;  4JX1 C;  3APF A;  4P7I A;  3PLV A;  2G1E A;  1RM6 C;  5J17 A;  4KGT A;  3LDZ E;  1SE9 A;  2FUH B;  1ISN A;  2V4I B;  2DZJ A;  4BFR A;  2WU2 B;  2WXO A;  1T0Q C;  1ZUD 2;  2QC8 A;  3QIJ A;  4ANU A;  2KKC A;  2L83 A;  2LXA A;  4DHJ D;  4IM0 A;  3VUW A;  4WWP A;  2ZJD A;  4EZL A;  1KLV A;  2J52 A;  2JXX A;  2ZVO A;  2MBH A;  5FKA C;  4EFO A;  2NMQ A;  3L08 A;  3N1Y C;  1JWA D;  3W9C B;  5AUI A;  4HXD A;  4GDL A;  2ZPN A;  1D3Z A;  2OHF A;  2C60 A;  3V60 A;  4BAX A;  4ICU A;  4II3 B;  1HXY D;  4DHZ E;  1F2R C;  3A4S C;  2JX5 A;  4KKI A;  3ZXV A;  1C78 A;  1L0Y B;  3EGR A;  4G50 A;  2M17 A;  2IND C;  4NZL B;  1CJE A;  1J0G A;  5C1Z A;  1WMH B;  2Y5B B;  2AL6 A;  1Q5W B;  2RR9 A;  3NS1 A;  3ZLZ A;  2PVG C;  3RN9 C;  2WXR A; 
#chains in the Genus database with same CATH homology
 1J19 A;  4IUM B;  4KV2 A;  3DVG Y;  4BKG A;  3NY5 A;  2BGF A;  4I6N B;  3VTW A;  3ZNH B;  2NR2 A;  4MSM B;  4E71 A;  2BYV E;  5GMV A;  3VH3 B;  1V86 A;  2MBE A;  3UQB A;  2NPT A;  1IYF A;  4ZRJ A;  5AZH A;  2NBV B;  2KX3 A;  3QA8 A;  3DBS A;  4HCN B;  4II2 B;  4MEM A;  1WFY A;  2CHZ A;  3A9J B;  3L54 A;  3PRP B;  4YL8 A;  3DVN U;  1H8C A;  4G0N B;  2K6D B;  3PHW B;  3WAP A;  4AUQ C;  2WWZ A;  3A1Q A;  1VD2 A;  4OVU A;  3C0R B;  3RZW C;  3ML9 A;  4TQ1 A;  4FA6 A;  2EMT A;  1V49 A;  4IM2 A;  4IM3 A;  4LDT B;  2M0X A;  3SD5 A;  3X0W A;  3ENE A;  3ZNI D;  3I3T B;  3R66 C;  4F1S A;  4JIO U;  3IG3 A;  3DBR I;  1EF1 A;  2FCQ A;  4TQ0 A;  3ZUN A;  3CSF A;  1UZX B;  3KYC D;  2KFK B;  4F8C B;  1WXS A;  4MH0 E;  2KO3 A;  4PS3 A;  2WDT B;  3Q3J A;  2ZCC A;  4K1R B;  4WJP A;  2DZI A;  4JL9 A;  2AL3 A;  2LGX A;  4ZRI A;  1KM7 A;  1WE7 A;  3S2A A;  4HWI B;  2G3Q B;  2KTF A;  4ANV A;  2J7Q B;  4ZYN A;  1P98 A;  3KH0 A;  4M8N A;  3HIZ A;  3QC8 B;  2KWU B;  4KIK B;  3ZW3 A;  3OJ3 A;  5L95 C;  1KJT A;  3ZO5 B;  2IO2 B;  3GOE A;  1X1M A;  3A33 B;  2UYZ B;  1MG8 A;  1WRD B;  3AUL A;  5D6J B;  1BT0 A;  3IBE A;  2L05 A;  4MGZ E;  3ZDT A;  2M8S A;  1Z2M A;  2XK5 B;  1WMH A;  4KVG B;  2DHZ A;  1WY8 A;  4M0W B;  4GMV A;  1WJU A;  4AWJ A;  2KQS A;  1M94 A;  1ZKH A;  3H6N A;  4GDK B;  1WE6 A;  2EKE C;  1EF5 A;  2MP2 A;  5FR6 A;  4A3P A;  4HLE A;  2JUO A;  1WM3 A;  1WGR A;  1XT9 B;  2KNB A;  4KSL C;  1WJN A;  3QHT A;  4DBG A;  5D2M B;  1AAR A;  4N9F 4;  3ZNZ B;  2WX0 A;  4W9G A;  2K6Q A;  2K8B A;  3B1L X;  5DPS A;  2L00 B;  2KC1 A;  4WAA A;  5C23 A;  2KDF B;  2LUE A;  2D11 A;  2BYE A;  1G6J A;  2LGD A;  3DBL I;  4XC2 A;  2BYF A;  1WXV A;  4FJY A;  2N9P C;  3H7P B;  2L0T A;  2MBB B;  3A9J A;  3AU4 A;  2UWQ A;  2DZK A;  2WYQ A;  5DPW A;  2KZR A;  4WJO A;  4FHK A;  2V3S A;  4W9C A;  3HM3 A;  1ZW7 A;  3NS8 A;  4TUU A;  4RM9 A;  2L7R A;  2BWE S;  3TBL D;  1NI2 A;  3JYU A;  3ECI A;  4ASW C;  2LWP A;  3IFW B;  4WJN A;  5IAA C;  1OEY J;  4G3X B;  3L16 A;  2K39 A;  1OEY A;  1UGM A;  4IWO A;  4W9H A;  3RYT A;  3ZRC A;  3SDL C;  2ASQ A;  2IYD B;  1WR1 A;  3RZF A;  1I35 A;  3EEC A;  2M1M A;  3ZRF A;  2KFK A;  4HVB A;  2ZCB A;  2D2Q A;  3X23 A;  1WX7 A;  2PJH A;  3UIN B;  2O6V B;  4B6W A;  2L76 A;  3EHV A;  2IO1 B;  3W1S A;  2FCM A;  1WX9 A;  3QCA A;  2J0M A;  3VHT C;  1C1Y B;  4HPL B;  1QZE A;  4NJ7 A;  4TV3 A;  1GC7 A;  2BKR B;  1EO6 A;  1K8R B;  4HCP B;  2KQ7 A;  4KSK C;  4HDQ A;  3A4R A;  4KIK A;  2LI5 A;  3RCZ A;  4W9E A;  3UQA A;  4NAW B;  1V80 A;  4PYZ A;  3VXW A;  2KLG A;  4BBN C;  1YX5 B;  3H9D A;  2LD9 A;  1UH6 A;  1V6E A;  2CS4 A;  2IBI B;  3PRZ A;  1Q1O A;  2NBU A;  2LGY A;  2C7N B;  2RPQ A;  3V62 A;  4LCD E;  3W1S C;  4A20 A;  3ML8 A;  4TKN A;  3UF8 A;  1R4M I;  2RGF A;  2XK5 A;  4RM8 A;  4KDI C;  1E8W A;  2BPS A;  2C7M B;  4K7W A;  2DAJ A;  4URK A;  1YD8 U;  2MBO A;  3L13 A;  4WWN A;  2R2Q A;  3PTF C;  4GDK A;  2N1W A;  2MA9 B;  4CHK A;  4BKT A;  3VH4 B;  1WXA A;  2D07 B;  2MWS B;  1UEL A;  2K25 A;  2DYB A;  3T9L A;  1WIA A;  2GMI C;  3V61 A;  1GC6 A;  4MJS B;  3VTU A;  2G4D B;  4AJY B;  1TZ1 A;  3HM6 X;  4NQL B;  4DK5 A;  2ZZP B;  4IG7 B;  2MCN B;  3M3J A;  3QJZ A;  2FCN A;  4FJZ A;  2C9W B;  5CTR C;  3VTV A;  4E74 A;  1I42 A;  2RD0 A;  1YX6 B;  1TGZ B;  3KYD D;  4W9L A;  4B95 A;  3PV1 A;  3P2B A;  2JPH A;  3H7P A;  3JSV B;  1WGG A;  2C5L C;  5L83 A;  1GNU A;  3PLU A;  2LXC A;  1JRU A;  2MW5 A;  2AYO B;  1WGY A;  2ZNV B;  3PS6 A;  4WJQ A;  1WZ3 A;  2OOB B;  4FHJ A;  1E90 A;  1XD3 B;  2DEN B;  4LDT D;  2BWF A;  1HE8 A;  3K9O B;  3VQI A;  2I1K A;  4FBJ B;  1A5R A;  4EUT A;  4XX5 A;  2AWT A;  1E8Z A;  4FJV B;  3TCA A;  3V6C B;  2MLB A;  2D10 A;  2M4N A;  3T8M A;  4NJ6 A;  1GG3 A;  2NCN A;  3V6E B;  4IWP A;  2L0F A;  3ZDM C;  4EKU A;  1WYW B;  4GU2 A;  2R2O A;  3AU5 A;  3L0W B;  3RD2 A;  3TMP B;  2NS5 A;  4W9I A;  3ZNG C;  2O6V A;  1YQB A;  2KVR A;  1E8Y A;  3OAW A;  5J18 A;  2CHX A;  3OLM D;  2KMC A;  2MQJ A;  4I6P A;  3KVF B;  1H4R A;  2A4Z A;  2LAS A;  5E6N A;  2KDB A;  4IW0 A;  1YJ1 A;  3KUZ A;  4BKS D;  2N1V A;  4NAW A;  4CYE A;  5G2N A;  3ZTC A;  4DXA B;  2DYO A;  2KTR B;  3EFU A;  5HKH A;  2KD0 A;  2ZEQ A;  2KAN A;  3ALB A;  5AZG A;  4AJW A;  4K7S A;  4EOY A;  1C3T A;  4ZRK A;  3D32 A;  4I6L B;  3WIM A;  2EMS A;  2KJR A;  2N9E B;  2A5U A;  4DHJ B;  2NPT B;  1EUV B;  3MJW A;  1F9J A;  2HE7 A;  2XBB C;  1GUA B;  3DCG A;  4MSQ B;  4MJS A;  4DWF A;  2HJ8 A;  3MTN B;  3M63 B;  1TBE A;  2FNJ B;  1NBF C;  3H1U A;  4MM3 A;  1WM2 A;  4IWQ A;  4GOC A;  4JLC A;  4MDK E;  3SHQ A;  4B9K A;  4LJP B;  3QAQ A;  2MRP A;  3VFK A;  2DAF A;  1UBI A;  2RSU A;  3TJP A;  4HK2 A;  3UIO B;  1LM8 B;  4IC7 B;  1FXT B;  3DVN V;  3JSV A;  5LLI A;  2D3G A;  2KXJ A;  2NVU I;  3QAR A;  3R7R A;  3ZTD A;  1WH3 A;  3KUC B;  4K81 A;  4DDI D;  2GOW A;  2BKF A;  3BY4 B;  1S3S G;  5JHB A;  4OVV A;  1OQY A;  4MGI E;  3VUX A;  2L8J A;  3CF6 E;  4MEL A;  3ZVV A;  1E8X A;  2PPH A;  4EZJ A;  3RT3 B;  1Y8R C;  3PZD A;  4NPN A;  3DVG X;  2JY6 A;  2OJR A;  2Z59 B;  3N30 A;  2GBN A;  2KMA A;  3WAL A;  3QK0 A;  4MGK E;  3A9K B;  1XQQ A;  2V4L A;  5DPR A;  3DBH I;  1V2Y A;  2IO3 B;  3AI5 A;  1P1A A;  2O2V B;  2N7E A;  3VAW A;  4DDG D;  2K8H A;  2O6V D;  4HPM B;  4PYU A;  5JHA A;  4X57 B;  5JH5 C;  2KC2 A;  3JVZ X;  2FCS A;  1GJZ A;  4HDO A;  3APD A;  1LFD A;  3UIP B;  4AOF A;  4BKS A;  4GIV A;  4DHZ B;  3SU8 X;  4WWO A;  2GBK A;  1RLF A;  3EC8 A;  1P9D U;  2REX A;  2KN5 A;  3PRM B;  4EEW A;  3UGB B;  3U7D A;  5E6O A;  1WGD A;  2LVO A;  1OGW A;  2IZV B;  3CMM B;  4ANX A;  5KHQ A;  2KTR A;  1V9J A;  3KW5 B;  4J6I A;  2KFJ A;  3B08 A;  4HJK A;  2JT4 B;  4FUL A;  3DQV A;  4PS8 A;  5AZF A;  4FAD A;  3QQ8 B;  5DCN A;  3BIN A;  3VDZ A;  3NHE B;  3AXC A;  4JQW C;  1U4A A;  2KJ6 A;  4GN1 A;  3WAM A;  4K7U A;  1RRB A;  3WAO A;  2JZ3 B;  2KWC A;  3M95 A;  5JZE B;  3APC A;  2J0K A;  2ZVN A;  2KX0 A;  5TR5 A;  2KHW B;  3N32 A;  4FLH A;  1LQB A;  2ZPY A;  4GDL B;  1P0R A;  1OTR B;  3O65 B;  2N7D A;  2BF8 B;  2N4F A;  4NQK E;  3DPD A;  5CHW A;  2FAZ A;  4BBN F;  2KLC A;  3B0A A;  2IY0 B;  5D7G A;  3NOB A;  2DZM A;  2KDE B;  2DYM A;  1WX8 A;  2G4S A;  3LJ3 A;  3MHS D;  1CMX B;  4KZC A;  3R3M A;  3PPA A;  2KWV B;  4ANW A;  4KZ0 A;  2GBJ A;  4W9J A;  1RAX A;  2MX2 A;  1T0Y A;  3IVF A;  3PVL A;  2HD5 B;  2FID A;  2B3A A;  5DPT A;  2JWZ A;  1V5T A;  3PHX B;  3ONS A;  1Z5S B;  2LRW A;  4CO7 A;  4A3O A;  4KDL B;  2PEA A;  2IO0 B;  2C7H A;  2YVC A;  4BOS C;  1IPG A;  1WI0 A;  1V81 A;  3A9K A;  1SIF A;  3IHP C;  3PGE A;  3PRE A;  4GXB A;  4AP4 C;  5AEK B;  3WAN A;  1WF9 A;  2Z0E B;  3M62 B;  2JF5 A;  1NDD A;  2O2V A;  2YLM A;  1E7V A;  3NZU A;  5LXH A;  3JW0 X;  3QWZ B;  1YIW A;  1S1Q B;  3H7S A;  1PQS A;  3N3K B;  1WZ0 A;  3APF A;  5EDS A;  2GBR A;  2CU1 A;  4P7I A;  2Z0D B;  2IY1 B;  1UBQ A;  3PLV A;  2G45 B;  3TIX A;  2KJH B;  5J17 A;  4WQO B;  1RFA A;  5BO4 B;  3LDZ E;  2GBM A;  1SE9 A;  2JRI B;  2FUH B;  2NBW B;  5D94 A;  1ISN A;  1V5O A;  3K9P B;  2LJ5 A;  4W9D A;  1LXD A;  2W9N A;  4BOZ B;  2DZJ A;  2MSE D;  4BFR A;  2L3Z A;  2PE9 A;  2WX1 A;  2MBQ A;  3QX1 A;  4RMA A;  4JGH B;  3HK0 A;  3PSE B;  3RUL A;  3KUD B;  1WJ6 A;  4G11 A;  2QHO A;  3PT2 B;  5E6P A;  3VVW B;  1WJ4 A;  4W9K A;  3QIJ A;  4ICV A;  4ANU A;  4E3C A;  2KKC A;  1ZGU B;  4GB9 A;  1P3Q U;  2PE6 B;  2V1Y A;  2LXA A;  4DHJ D;  4IM0 A;  3R7Q A;  4FN2 A;  3VUW A;  4WWP A;  2KDI A;  3GZN I;  2ZJD A;  4EZL A;  2KK8 A;  1KLV A;  3A1Q B;  2K1F A;  1IP9 A;  5G55 A;  2JXX A;  2CR5 A;  2CKH B;  5KHO A;  1WXM A;  2ZVO A;  3ZKJ C;  2VRR B;  2LVQ A;  2MBH A;  2FIF A;  5CHF A;  4MGY E;  4EFO A;  4GSW A;  3L08 A;  1KOT A;  2XEW A;  3U30 A;  3U8Z A;  4XZ4 A;  5LXI B;  4HXD A;  3TL5 A;  2HTH A;  4NNJ B;  2ZPN A;  3DOW A;  4GDL A;  4PS7 A;  1VCB A;  2DX5 B;  3NZS A;  2C60 A;  1D3Z A;  4W9F A;  3RUI B;  2LVP A;  2I1J A;  3V60 A;  5CHV C;  3OJ4 B;  3DDC B;  3HHM A;  4ICU A;  4II3 B;  4DHZ E;  3A4S C;  1WR6 E;  3CST A;  3VUY A;  3L10 B;  3Q3F A;  2ZNV C;  1UD7 A;  2CHW A;  2J0J A;  1L2N A;  5IA7 A;  1SGH A;  2N9X A;  1R4N I;  1WGH A;  2K8C A;  2JRH A;  4GGQ A;  4G50 A;  3WA0 A;  2M17 A;  4F7Z A;  1E5W A;  5CX3 A;  4BVU C;  1E7U A;  2KOX A;  2LRU A;  4LJO B;  4M8M A;  5J2R A;  5C1Z A;  1WMH B;  1J0G A;  3W1Y A;  2Y5B B;  4NY0 A;  4EZK A;  4ZDV A;  2AL6 A;  1Q5W B;  2RR9 A;  3ZIM A;  3L17 A;  1J8C A;  1TTN A;  2JVC A;  3ZLZ A;  1Q0W B;  1L7Y A;  2LZ6 A;  2MP2 B;  2JZZ A;  2AEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...