2N1VA

Solution structure of human sumo1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin-related modifier 1
publication title Structures of human SUMO
rcsb
source organism Homo sapiens
molecule tags Structural genomics
total genus 16
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2015-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2n1vA00
2AEHA 4E74A 4AJWA 3VDZA 3EHVA 1KM7A 2IO1B 5AZFA 1LM8B 2GOWA 2LZ6A 3IFWB 5TR5A 4EZJA 4HLEA 2N4FA 2I1JA 2ZPNA 2JVCA 5J18A 2BGFA 3R66C 3RT3B 2REXA 3DCGA 1WX9A 2LXCA 4W9LA 3PVLA 1WH3A 4YL8A 3DBRI 4NJ7A 3VTWA 4IM3A 1IP9A 2G4SA 3KUCB 2GBJA 3UIOB 3B0AA 2KLGA 3OJ3A 5JH5C 4K81A 2LGYA 2JPHA 4BOZB 4AUQC 4PS8A 3VUWA 1P98A 2R2QA 4X57B 3DPDA 3RZFA 2YVCA 4GOCA 1D3ZA 2IBIB 1E5WA 5C1ZA 1T0YA 2LI5A 3AXCA 2AL3A 4FJZA 3VUYA 2Y5BB 2D10A 4MELA 4ZYNA 1WJUA 2JRIB 3SDLC 3VXWA 1WXAA 2V4LA 4RM8A 1TGZB 2MSED 3N30A 2KKCA 3M95A 2QHOA 3OLMD 4M8MA 1J8CA 3PREA 1UD7A 4KVGB 4W9KA 3ZW3A 1LXDA 3B1LX 4HK2A 1XD3B 4DHJD 5J2RA 4GU2A 3WALA 2K25A 4P7IA 5D7GA 2KQSA 4FJVB 2MWSB 1E7UA 2MW5A 3U8ZA 3CMMB 1WI0A 5IAAC 2O6VA 3ZNHB 2KANA 2XK5B 2DX5B 3U30A 2KNBA 3PV1A 4HJKA 4IG7B 3ZVVA 2XBBC 3AU5A 2N7EA 1C1YB 1Q5WB 2N9XA 1E8YA 3VTVA 4EFOA 3KW5B 4HCNB 4XC2A 3WAOA 1E8ZA 1SIFA 1M94A 4ANVA 4FLHA 5DCNA 5D6JB 4HVBA 2M1MA 3VH3B 4HDOA 2CHZA 3ZRCA 1WM2A 1YJ1A 2C9WB 2GBRA 2K6DB 3DBSA 2BYVE 2J0KA 2Z0DB 5CHWA 3H7PA 4IWOA 3HIZA 2HJ8A 1V86A 1V81A 2GBKA 2A5UA 4W9JA 5CTRC 2N1WA 5BO4B 3VQIA 3QIJA 4A20A 1R4MI 1H4RA 1V5OA 2KZRA 3KH0A 2LVQA 2KDIA 2JT4B 3GOEA 3KUDB 2BKFA 3ECIA 2LXAA 1L7YA 4MJSB 2C5LC 4TQ0A 2WX0A 2DAJA 4MGZE 3UIPB 2DYMA 5G2NA 3JSVB 4RMAA 3TCAA 3BINA 4M0WB 2KC2A 2W9NA 1YX5B 2KQ7A 4K7UA 4DDGD 1OEYJ 2WYQA 2XK5A 3VFKA 5CHFA 3NZUA 3PZDA 1FXTB 3N32A 5DPWA 5LXHA 4KIKA 3H1UA 2IO0B 4IC7B 4J6IA 4TQ1A 1WYWB 2L76A 1WFYA 2ZNVB 5D2MB 4DK5A 2KVRA 2BYEA 2ZNVC 1WMHB 3A9KB 2DYOA 4IM0A 2BKRB 1JRUA 2OJRA 2ZVOA 2WWZA 3UINB 2FUHB 2KFJA 4HXDA 4JIOU 4GDLA 1WY8A 2KC1A 2NPTA 5GMVA 2XEWA 3IG3A 3UF8A 4WJQA 4DHJB 3KYDD 2IY1B 2BF8B 2JY6A 4GIVA 1OQYA 2YLMA 3PHXB 3R7QA 4NNJB 1WZ0A 4URKA 1SE9A 2LVPA 4M8NA 2O2VA 3MJWA 3HM6X 1E8WA 4F1SA 4EZKA 4KZCA 1WIAA 3IVFA 2MCNB 3TMPB 2L8JA 4W9HA 4KZ0A 1YX6B 3AU4A 4GDKB 3UQAA 4ASWC 4MGYE 3EC8A 3JSVA 3WA0A 4EEWA 4EOYA 2L0TA 3WAMA 1V6EA 4ICUA 1WRDB 2KK8A 2RGFA 5FR6A 3KYCD 4KSLC 1J19A 2ZVNA 1F9JA 2V3SA 3WIMA 1ZGUB 2DYBA 3GZNI 1X1MA 2CHXA 3AI5A 3I3TB 1YQBA 1GC7A 3L17A 4FULA 2UYZB 3ZUNA 1WMHA 3A9KA 4A3OA 4LDTD 5AZGA 3RYTA 4B9KA 1WF9A 2FCNA 2K8HA 3NY5A 2KDEB 3DVNU 3JVZX 1BT0A 2JUOA 1UZXB 1PQSA 2KXJA 3A9JB 3QCAA 3ZLZA 1WX7A 2ZZPB 3QARA 4ICVA 2L3ZA 4BFRA 2WX1A 5E6OA 2KO3A 3PRZA 2DZKA 3W1SA 1NBFC 1KJTA 3CF6E 4WJPA 4NY0A 4ZRKA 3NZSA 1WGRA 4EUTA 4ZRJA 1EUVB 2JXXA 3V6CB 4HWIB 3QHTA 5KHQA 3ZNID 2NBWB 2WDTB 5JHAA 3QX1A 2M8SA 2Z59B 3W1YA 1P9DU 2K1FA 1E8XA 2OOBB 2G45B 1WGYA 1KLVA 2N1VA 3ZDTA 2C7NB 1S3SG 3QWZB 2D2QA 4WWNA 2CS4A 5J17A 2MBEA 1V49A 1ZW7A 4N9F4 4HPLB 3R3MA 3DOWA 4CYEA 4DWFA 1GJZA 2DENB 4FN2A 3PRMB 1WXVA 1WXMA 1WJ6A 4W9IA 2MBHA 2NS5A 1SGHA 1UELA 2G3QB 3HHMA 2M17A 4G11A 4K7SA 1I42A 4GN1A 4GGQA 2AWTA 3ZRFA 3MHSD 3RD2A 3VUXA 2L00B 1VD2A 2ZCBA 2KJHB 1WGHA 2PE6B 4FJYA 4W9DA 5D94A 3QK0A 2DHZA 1L2NA 3PLVA 3IHPC 4JQWC 4GB9A 1I35A 2AYOB 3QAQA 4LDTB 3SU8X 2J7QB 2IO3B 3V6EB 4ANUA 2NBUA 4MSMB 2M4NA 3LDZE 4TKNA 3PTFC 3ML8A 5AZHA 3ZNZB 2LD9A 4AJYB 3DVGX 2L05A 4KV2A 5CHVC 1XT9B 4OVUA 1R4NI 1WR6E 4GSWA 1YD8U 3L13A 3H9DA 1OGWA 1XQQA 1MG8A 4MGIE 4AWJA 1H8CA 2LASA 2KX0A 2MP2B 2NBVB 1TTNA 3DDCB 4A3PA 2KFKB 4DBGA 2I1KA 1OEYA 3ENEA 2JRHA 3M3JA 1P3QU 1GG3A 2JF5A 2KTRB 2N9PC 4FA6A 3EFUA 1E90A 2MQJA 3NS8A 2LRWA 4PS7A 2FAZA 3ZTCA 4BKTA 3H6NA 3PS6A 3T8MA 2D3GA 3RZWC 4W9FA 2O6VD 3K9OB 1WM3A 3ML9A 3QJZA 2CU1A 1LQBA 2IYDB 3C0RB 3H7SA 1HE8A 3APCA 1Q0WB 2MBOA 2MBQA 3CSTA 4IWPA 4KDLB 2K8BA 4MEMA 5C23A 1WE7A 4LCDE 1ZKHA 1ISNA 1NDDA 1WGDA 2DZIA 2RPQA 5L83A 4B95A 4MJSA 1WXSA 4IWQA 4MSQB 1RLFA 3PGEA 2KWCA 4HPMB 2FCQA 4DDID 3A4RA 5EDSA 4I6LB 2FIDA 1RAXA 3T9LA 3JYUA 1UH6A 2CKHB 1NI2A 2LGDA 3ZO5B 1WZ3A 2HTHA 2KFKA 4JLCA 3RUIB 4GXBA 3PPAA 3VTUA 2DZJA 1GUAB 2KTRA 2LGXA 4WWOA 1V5TA 4NAWB 2NCNA 2KMCA 3M63B 3QC8B 4NJ6A 2MBBB 4K1RB 3X0WA 4BKSD 1K8RB 4FHKA 4PS3A 3ZNGC 1GNUA 2ZJDA 3U7DA 5LLIA 3V61A 4DHZE 2KD0A 2KWUB 4BBNC 4WQOB 1RRBA 3S2AA 3AULA 4MDKE 2FCMA 5IA7A 2ASQA 1E7VA 2MX2A 3JW0X 3SHQA 2ZEQA 2RR9A 1UGMA 4JGHB 3UQBA 3NOBA 2KLCA 3EECA 3DVGY 4I6NB 3TIXA 4AOFA 2BPSA 2KJRA 3L0WB 2G4DB 1A5RA 1TZ1A 4GDKA 2K6QA 4F7ZA 2C7HA 3ZTDA 3O65B 2KJ6A 4NPNA 2K8CA 1OTRB 3DVNV 3HM3A 4BKGA 3B08A 4IW0A 2R2OA 1Z5SB 5CX3A 2O6VB 4TV3A 4II3B 2EMSA 3WANA 4NAWA 1J0GA 1V9JA 2Z0EB 4EKUA 1WJNA 2RD0A 5DPTA 4FBJB 1U4AA 4G0NB 3KVFB 1UBQA 3APDA 1G6JA 2AL6A 2LJ5A 1P1AA 2IO2B 4NQKE 4WWPA 3L16A 3VAWA 1CMXB 2L0FA 1AARA 4BOSC 3Q3JA 3APFA 3H7PB 2MRPA 3A9JA 2MLBA 2ZCCA 3V60A 2GBNA 2GBMA 2KN5A 3OAWA 2BYFA 3TBLD 2BWFA 4ZDVA 1KOTA 2LUEA 4WJOA 4PYUA 4MH0E 1GC6A 3PSEB 4PYZA 3VH4B 3WAPA 4CO7A 4HDQA 4G3XB 3TL5A 5JZEB 2KX3A 4IM2A 3L54A 4XZ4A 3PT2B 2KHWB 4W9GA 4BVUC 4F8CB 1RFAA 2KOXA 3MTNB 2KWVB 3NHEB 3QA8A 4ANWA 4XX5A 2LVOA 2EKEC 3KUZA 3ZIMA 2D07B 2NR2A 4JL9A 2IZVB 4K7WA 2CHWA 3QQ8B 3L08A 2DAFA 3SD5A 3RULA 1QZEA 4LJOB 5DPRA 2ZPYA 1YIWA 2VRRB 3R7RA 2LWPA 4KIKB 3UGBB 5JHBA 3BY4B 4IUMB 2KDBA 3Q3FA 2PE9A 4OVVA 4B6WA 5DPSA 4WJNA 1C3TA 3A1QB 2N7DA 3VVWB 4GDLB 4DXAB 2C60A 2L7RA 3HK0A 2NPTB 5G55A 2A4ZA 2HE7A 2KDFB 4BBNF 3X23A 1VCBA 4EZLA 2CR5A 2J0MA 2V1YA 3A4SC 4FADA 4II2B 4WAAA 3OJ4B 2O2VB 3RCZA 4KDIC 4LJPB 3PRPB 5LXIB 3P2BA 1Y8RC 1WJ4A 3DBLI 1IYFA 1EO6A 4HCPB 2LRUA 2J0JA 2JZZA 4BKSA 2KMAA 1WR1A 2IY0B 4TUUA 2B3AA 5AEKB 1Q1OA 4G50A 3A33B 3TJPA 2PEAA 4AP4C 3DBHI 1V2YA 3V62A 1EF1A 2JZ3B 2FNJB 2NVUI 2UWQA 3L10B 2MA9B 2M0XA 4CHKA 5HKHA 1TBEA 1WGGA 2RSUA 4W9EA 2JWZA 2HD5B 2BWES 3IBEA 2N9EB 3A1QA 4W9CA 5E6PA 3N3KB 3ZKJC 1V80A 2MP2A 2PJHA 4DHZB 4ANXA 2K39A 3LJ3A 2PPHA 1Z2MA 3K9PB 3PLUA 3PHWB 5E6NA 2DZMA 2EMTA 2D11A 1P0RA 2KTFA 5KHOA 4MM3A 5L95C 4E71A 4E3CA 4I6PA 3M62B 2FCSA 3W1SC 1WE6A 4KSKC 2C7MB 4ZRIA 3ZDMC 1UBIA 4FHJA 1EF5A 3CSFA 3DQVA 3ALBA 1LFDA 3D32A 4GMVA 1WX8A 4NQLB 3VHTC 4MGKE 4RM9A 1S1QB 1IPGA 3ONSA 2FIFA 2GMIC
chains in the Genus database with same CATH superfamily
1TT5B 3VDZA 3EHVA 1KM7A 5AZFA 1E0ZA 2N4FA 3AECB 2JVCA 2BGFA 3P1MA 1WX9A 4W9LA 1WH3A 2QDFA 2WU2B 4TMAB 1YN4A 2KLGA 3OJ3A 5JH5C 1P98A 2R2QA 4X57B 1E5WA 5C1ZA 2H89B 3VR9B 2LI5A 4ZHOA 4MACA 4C7ZA 1BUIC 1WJUA 2VH1A 1TGZB 2KKCA 2QHOA 4M8MA 1HA5A 1J8CA 3ZQ4A 1UD7A 2FUG1 3HRDD 3MC8A 3B1LX 4GU2A 3WALA 1DOIA 1A70A 3BWUD 1R4NB 1C79A 3U8ZA 2VZKD 1C4PA 1WI0A 1UWMA 5IAAC 3ZNHB 5BMGA 4AS1A 2DX5B 2KNBA 3PV1A 2XBBC 2D3AA 2N7EA 1Q5WB 3KW5B 1QKZA 4ANVA 2KDMA 2J4XA 2K6DB 1N60A 3DBSA 2BYVE 2Z0DB 3DWMA 2WQYB 3HIZA 2AQ3B 1JW9D 5BO4B 2N1WA 1CQVA 1V5OA 2GI9A 2LVQA 1VLBA 2KDIA 2JT4B 1ZE3D 4ZRPA 1HQRD 1C76A 1NYRA 2WXKA 2LXAA 3N9YC 2C5LC 4TQ0A 4MGZE 2WXPA 2GRIA 3JSVB 1VZ7A 2L1AA 4DDGD 4BAXA 3PZDA 5DPWA 5LXHA 4TQ1A 1WFYA 4DK5A 3A9KB 1EM7A 1JRUA 1F52A 2KFJA 4HXDA 4JIOU 1WY8A 2KC1A 2XEWA 4GIVA 2BF8B 2JY6A 1TS5A 2LVPA 2O2VA 2RDGA 2L8JA 3RNCC 1TKEA 1YX6B 4GDKB 3UQAA 4ASWC 3JSVA 3WA0A 4KGSA 1WRDB 1PGXA 2ZVNA 1TY0A 1F9JA 2V3SA 3WIMA 3Q8EA 5G5HA 4FULA 4A3OA 3A9KA 2EELA 3RYTA 4B9KA 2M0AA 3OWEB 2KDEB 3AEGB 1UNSA 2BBCA 1PQSA 3AE8B 2WXLA 1WX7A 3AH7A 5FR3A 4D2KA 1SEBD 3NZSA 4ZRJA 3QHTA 2GB1A 3ZNID 3CIRB 1WGYA 1KLVA 3ZDTA 4ZYSA 3QWZB 2D2QA 4N9F4 4CYEA 4P6VF 1GJZA 1AN8A 1OQQA 2NS5A 4MT5A 3HHMA 2HDEA 3BVMA 4IKGA 4GGQA 3ZRFA 3AMZA 3FKYA 4YSZB 4XGAB 1I35A 2J7QB 2G1EA 2IO3B 3RNFC 2NBUA 4JWSC 4RGOS 4MSMB 1Q10A 4AJYB 2L05A 4KV2A 1XT9B 1UF0A 4OVUA 1GAQB 1FM0D 1OGWA 1L6UA 4YWGG 2NBVB 3DDCB 1I4PA 2KAJA 1JWSD 3M3JA 5HG2A 3NS8A 4PS7A 4KKIA 3PS6A 3RZWC 3K9OB 1KFYB 2JU6X 2IYDB 3APCA 3CSTA 2MBOA 3PO0A 1GB4A 2HJ1A 3V05A 1WGDA 3FILB 1FFVA 1TZOA 4MJSA 2WXMA 3A4RA 4XWTA 2Z8LA 1RAXA 2NTTA 1NI2A 2LGDA 1WZ3A 4RF0A 3DBRB 2LGXA 4WWOA 4NAWB 3M63B 2QJLA 4K1RB 3X0WA 1K8RB 4FHKA 1E10A 5BMIA 3AEFB 1ENFA 2ZJDA 3U7DA 1YJJA 4NZLB 2KWUB 4WQOB 3S2AA 2N0SB 1E7VA 2KQ4X 2N9LA 2ZEQA 3FILA 1UGMA 2ACZB 1QOBA 2V9HA 1SJHD 1IGDA 2FE8A 1R7SA 1XO3A 4NPNA 1OTRB 3HM3A 3W5VB 2D3BA 2R2OA 2Y5CA 1Z5SB 4LNOA 2O6VB 4II3B 3WANA 1RWSA 3URYA 1V1PB 4NAWA 1WJNA 2LHDA 3APDA 2LMCA 4C4VA 4HRSA 1CMXB 3RNBC 3GP7A 2MEKA 1E7PB 4BOSC 3APFA 3A9JA 2MLBA 2ZCCA 2ICIA 2GBNA 2GBMA 2XNAC 1KLGD 3TBLD 2LUEA 4WJOA 3AEEB 1R4MB 4PYZA 3VH4B 1N61A 4HDQA 3L54A 3PT2B 4F8CB 4BVUC 3QA8A 4ANWA 3T3OA 3MP9A 3ZIMA 2NR2A 2IZVB 4K7WA 1YN3A 3RULA 3TEXA 1V1PA 2ZPYA 5C2TB 3UGBB 2LWPA 1GOZA 4B6WA 2OEDA 3BK1A 3BYTB 4WJNA 2N7DA 3BYYB 2L7RA 1NVID 3IAM1 4KGRA 3NG0A 4BBNF 3X23A 4EZLA 5H92C 1XEEA 2DBYA 2V1YA 4II2B 1EWCA 3PRPB 2WS3B 3P2BA 4R3DA 1Y8RC 2PKOA 2BS3B 2LRUA 5EE3A 4BKSA 5AEKB 1Q1OA 5BYQA 3TJPA 2PEAA 3ZJVA 3WCQA 3DBHI 1BXTA 1SSNA 1EF1A 2JZ3B 2NVUI 3L10B 4YTNB 3GZNB 2RSUA 2JWZA 2BWES 3ZKJC 2MJ3A 3N3KB 2PJHA 2MP2A 3GE8C 2K39A 5FKAC 2PPHA 2B76B 1C4CA 2EMTA 5L95C 3BIID 4E3CA 2FCSA 2JZPA 1UBIA 4NQLB 4RM9A 1WYGA 1T0SC 2FIFA 1MVKA 1B9RA 4DXGA 2IO1B 1LM8B 2GOWA 2LZ6A 3IFWB 5TR5A 2ZPNA 5J18A 3R66C 3RT3B 2REXA 4REZA 2LXCA 3PVLA 2N9KA 2GBJA 2WXIA 2K22A 3P4RB 2WHIA 4K81A 1C78A 3VUWA 3RZFA 3MC9A 3W9CB 4GOCA 3KQ4A 2SAKA 3AXCA 2AL3A 4FJZA 3VUYA 3GS2A 5MPOA 2MSED 3N30A 1T0RC 3AE3B 4KVGB 3TEYA 1SE3A 1RM6C 1GPXA 4DHJD 3Q8FA 2LFIA 4JPSA 4P7IA 2MW5A 1NI3A 4TSSA 3U30A 4HJKA 3AU5A 1F2RI 1C1YB 2N9XA 4JX1C 1STEA 4EFOA 2K3UA 4HCNB 4N6EB 4HVBA 3VH3B 4ZHPA 2CHZA 2C9WB 5CHWA 4IWOA 2W54A 2BB6A 1V81A 2JQRB 5CTRC 4DHZE 1L5PA 2KZRA 2MHJA 3GOEA 1PYWD 1MG4A 3AE9B 2DAJA 5IOIA 3TCAA 2WXQA 2UU7A 3BINA 4M0WB 3P4PB 4XDCA 2WYQA 5CHFA 2L32A 3Q8CA 1ESFA 3AM9A 2LUMA 2IO0B 2QEJC 3O13A 2ZNVB 1ZDXA 2ZNVC 1WMHB 1FXAA 2DYOA 5G5GA 2BKRB 4LTUA 2ZVOA 2AX5A 2OJRA 2JYEA 3B2FA 3CWIA 1D4BA 4GDLA 5GMVA 2NPTA 3BVGA 3ZXVA 3NS1A 2IJ0A 1JROA 3R7QA 1MPEA 1WZ0A 1SE9A 1T0QC 3HM6X 1J7BA 1WIAA 3AU4A 2BB5A 4EOYA 1V6EA 1B1ZA 2KK8A 5FR6A 1IBXA 4KSLC 2NTSA 2ON8A 3C8YA 3I3TB 3L17A 1YQBA 3ZUNA 1D6EC 1WMHA 5T8IA 4OZAA 1WF9A 2E6XA 2K8HA 2WXGA 2KWDA 4RGMA 4ARCA 5E6OA 2KO3A 2DZKA 1SIJA 1NBFC 1KJTA 2JXTA 1KH0A 3MHZA 1HEZE 2V0GA 2JXXA 4USAA 5KHQA 2NBWB 1XF5L 3W1YA 2Z59B 1P9DU 2L83A 2OOBB 1EWYC 4P1CC 3Q3NC 4YTPB 5LNK1 2C7NB 3R2IA 2LHEA 2CU3A 4WWNA 1E9MA 1OQRA 2MBEA 1V49A 3R3MA 3DOWA 1SE2A 3PRMB 2WXNA 4PT5A 3AB5A 4WAFA 4OHJA 1L0XB 4GN1A 4GLSC 2QC8A 2WDQB 2AWTA 2IGDA 3MHSD 2K9XA 1L0VB 2L00B 2KJHB 3TSSA 2PE6B 2QCZA 4FJYA 2MJEA 4W9DA 1L2NA 2BW2A 4JQWC 3AE2B 2J53A 3QAQA 4LDTB 3V6EB 3W2DA 3R2TA 4DQOC 3PTFC 1EU3A 5AZHA 1KTKA 3DVGX 2SEBD 3N20C 4US8A 1YD8U 3ETRA 2HTME 2IPKD 5HFYA 1H8CA 2KMMA 4RF1A 4DBGA 1KF6B 2JRHA 2N9PC 3EFUA 1E90A 2LRWA 4HEA1 3TEZA 1WWTA 2WXFA 1UUPA 3ZTCA 4BKTA 2K0PA 3T8MA 2D3GA 1MJDA 2XN9C 3ML9A 1C4AA 2WDVB 3ZJUA 3LXFA 1HE8A 2MBQA 1TJEA 1ZXHA 1ZKHA 1ISNA 4XYCA 3KLSX 5L83A 4A9AA 5BMHA 1MI0A 1RLFA 2KWCA 2FIDA 4S17A 1T3QA 3T9LA 3JYUA 2CKHB 2DZJA 1GUAB 1TY2A 2NCNA 1I4XA 3EA6A 3IAS1 3IT6B 4NJ6A 1TKYA 1VRAB 2PTLA 1HTOA 1RFKA 1XLNA 3V61A 2KD0A 1RRBA 1UWXA 3JW0X 2RR9A 3L4PA 4JGHB 3NOBA 1SF0A 2KLCA 3DVGY 3PZ7A 2R61A 3BZDB 2G4DB 1A5RA 4GDKA 4F7ZA 1FO4A 2C7HA 3O65B 2K8CA 3DVNV 3KWVA 3N1XC 3B08A 4IW0A 1L4DB 4TV3A 4OZCA 5FK9C 3SR6A 3PZ8A 4G0NB 4IDIA 1E6EB 2LJ5A 1ACCA 2IO2B 1D5MC 3L16A 2Q5WD 3H7PB 3DHHC 2MRPA 1CZPA 3OAWA 1KOTA 5EE1A 3WAPA 4G3XB 4XZ4A 4W9GA 4M00A 2KWVB 4XX5A 2DLBA 2LVOA 3V3XA 1K53A 3KUZA 2WGSA 2CHWA 3L08A 2DAFA 1HZ6A 1RYJA 1Y56A 2QIEB 3E9SA 4A90A 2VRRB 3R7RA 4KIKB 2PE9A 4OVVA 3AE1B 1SBBB 5DPSA 3ABVB 1C3TA 3A1QB 3VVWB 1D5XC 3HK0A 2KDFB 2DNFA 1VCBA 1C77A 2CR5A 3BK2A 1WRIA 3A4SC 4MM3B 4WAAA 3OJ4B 4YT0B 3AEBB 3RNAC 3RCZA 4FXCA 4KDIC 1N5WA 1V1OA 4L23A 3SEBA 4HCPB 2JZZA 2KT7A 2IY0B 2B3AA 4G50A 3FC4A 5IN7A 3V62A 4CHKA 2PMVA 1HZ5A 2WLBA 1WGGA 3A1QA 2WNMA 4OW0A 1V80A 4PK1A 4DHZB 4ANXA 1FXIA 3MC0B 3OG5A 4N58A 1P0RA 4MM3A 1TYGB 3W1SC 1WE6A 4KSKC 1QT9A 3CSFA 4GMVA 3D32A 1LFDA 3P4SB 4NJCA 4MGKE 1S1QB 3ONSA 2BYTA 1OFFA 2RDHA 4NJ7A 2AQ2B 3VTWA 1IP9A 3KUCB 3UIOB 3RNEC 2JPHA 4BOZB 2YVCA 2IBIB 1MFWA 2IGHA 3FAHA 2Y5BB 4MELA 1JWMD 4RM8A 3RFZB 1DYQA 3Q3OC 3EFCA 2RDBC 2JSVX 1JWBD 4W9KA 3ZW3A 1LXDA 1XD3B 4WIPA 4AQ7A 3NVWA 2KQSA 3NJTA 4FJVB 4NAMA 4RNAA 4KGTA 1FNWA 2O6VA 2KANA 2Y5PA 1E8YA 3WAOA 4N59A 4M01A 3NVYA 2W55A 1XXGA 3P42A 2HJ8A 4K3BA 1V86A 1LGRA 3BVZA 2A5UA 4W9JA 5IKCM 3QIJA 1H4RA 3KH0A 2X38A 2BKFA 3ECIA 1I4QA 2Y3AA 2BTEA 2W82A 3UIPB 2OJWA 2KC2A 2JYTA 1YX5B 2KQ7A 4K7UA 1OEYJ 3VFKA 1FXTB 4L2YA 3N32A 3H1UA 4IC7B 4J6IA 3AV8A 5D2MB 4IM0A 3Q8AA 3UINB 3MJ5A 2KACA 2RPVA 2PVOD 3R8BA 4WJQA 2YLMA 3PHXB 3NUHB 4URKA 1PFDA 1V8CA 2VZKB 4EZKA 1YOVB 4KZCA 3TMPB 1MHHE 3IVFA 4LNFA 1J7AA 4W9HA 4MGYE 4EEWA 3WAMA 2FBWB 2LGIA 4ICUA 2MH7A 3KYCD 3ZGZA 1YQ4B 1J19A 2CHXA 1GC7A 4KKJA 2UYZB 1QLBB 5AZGA 2TSSA 3DVNU 3JVZX 1BT0A 2JUOA 1YNTE 3ZLZA 1FRRA 2ZZPB 4BFRA 2WX1A 3PRZA 4XDDA 4WJPA 2WXOA 4NY0A 3EGRA 1WGRA 4LK0M 1EUVB 3V6CB 3RNGC 2L52A 3J9CA 1FMAD 1TKGA 3NZ3A 2K1FA 1TIFA 1JMLA 2G45B 4B0EA 2N1VA 4ZRQA 2D3CA 5J17A 1ZW7A 5H8YE 4C00A 4DWFA 3AN1A 1ET6A 3RI7C 1WXMA 1SE4A 4WWMA 1JWUD 1SGHA 1UELA 4K7SA 1AYFA 2INPE 4LNKA 3RD2A 1WGHA 2BQQA 1NEKB 5D94A 3QK0A 3U4EG 4HPPA 3PLVA 4RH6A 4ANUA 1VR9A 3HVDA 3ZNZB 4YTMB 3C19A 4P16A 1R4NI 4HKQA 3DBHB 2WXRA 4C80A 4P1BC 3H9DA 4MGIE 4AWJA 4Q2JA 2LASA 2KX0A 4A3PA 2KFKB 1CK1A 2I1KA 2OHFA 3ENEA 2JF5A 2M19A 4FA6A 1FCLA 2FAZA 2W3SA 3Q2AC 2O6VD 1WM3A 3QJZA 2IDYA 3NVVA 1Q0WB 4KDLB 3P63A 1WE7A 4LCDE 1XLPA 2DZIA 1JQ4A 2RPQA 2RMMA 4B95A 4YSXB 4DDID 4HPMB 2FCQA 4HJGE 4M0WA 2JWUA 1UH6A 4L1BA 3VRAB 2KFKA 3RUIB 4GXBA 1TS4A 2KMCA 2IGGA 3QC8B 2PW9A 1JWAD 2K5PA 2MBBB 4ITKA 4BKSD 4PS3A 3ZNGC 4LNIA 1GNUA 2NMQA 3GB1A 1WXQA 4RGNA 1JRPA 4BBNC 1I4RA 2FCMA 2MX2A 4WH4A 3I63C 3I9V1 1FPYA 3KWLA 3EECA 4I6NB 2KJRA 1TS3A 3B9JA 4C56C 2K6QA 1ZXIA 4BKGA 3ZTDA 1FEHA 2CJNA 3GE3C 3ZXRA 3I57A 5CX3A 2EMSA 4QAYA 1V9JA 4EKUA 1K51A 4J3OD 4US9A 4FBJB 1F2RC 3DWGC 4HKZE 1G6JA 2AL6A 1P1AA 1XLOA 4NQKE 4WWPA 1AARA 3HUIA 4RCOA 3NVZA 2KN5A 2BYFA 4ZDVA 4ACFA 4MH0E 1GC6A 3TL5A 5BYSA 2KHWB 3MTNB 3NHEB 3E56A 2D07B 1KLUD 3N1ZC 4JL9A 3DBLB 3SD5A 2G9HD 5DPRA 2GLSA 3AEAB 1ROEA 2M56B 2KDBA 1ET9A 3Q3FA 1AW7A 1FD6A 1IGCA 4DXAB 3TUOA 2C60A 5G55A 5IP4D 2A4ZA 2HE7A 4XWWA 4FADA 4JWUC 1P7FA 2O2VB 4LJPB 5LXIB 2YEPF 1WJ4A 1IYFA 2I2YA 1N5XA 1EO6A 4RGTA 1CJEA 2J0JA 1QOFA 2KMAA 1PGAA 2V4IB 1SJED 2UWQA 2MA9B 1N62A 2WXHA 1TBEA 3ZJTA 4W9EA 2HD5B 3IBEA 2N9EB 4W9CA 1WGKA 1YN5A 1JCKB 1FCCC 2CJOA 1NENB 1WSPA 2DZMA 2N7JA 3IT4B 3RN9C 1ZUD2 2KTFA 1I4GA 4I6PA 3M62B 1FNVA 4JE3B 2C7MB 1EU4A 3ALBA 1DOYA 2AQ1B 3AE5B 3U2SC 1LO5D 2GMIC 2AEHA 4E74A 5AUIA 4AJWA 2MJDA 1N63A 1UGJA 4HLEA 4EZJA 2I1JA 3DCGA 3HVZA 3U52E 2EKIA 1I7HA 4YL8A 3DBRI 4RFBA 4IM3A 2G4SA 2D5GA 3B0AA 1ZPSA 3H8HA 2LGYA 4A55A 4AUQC 4PS8A 3DPDA 1D3ZA 1F1HA 1K52A 1T0YA 2INCC 2D10A 4ZYNA 2JRIB 3SDLC 3VXWA 1WXAA 5D3IB 2V4LA 4OVZA 2QMTA 3M95A 3OLMD 3PREA 2BVCA 1KRHA 3W5UB 4HK2A 5J2RA 1PUTA 2K25A 5D7GA 2MWSB 1E7UA 3CMMB 3Q14C 2XK5B 5GXGB 3ZVVA 4IG7B 3VTVA 1MHXA 4XC2A 1E8ZA 3T3NA 1SIFA 1M94A 3SFEB 4FLHA 5DCNA 5D6JB 2M1MA 3LYYA 3AE4B 4HDOA 2ZW0A 1QOAA 3ZRCA 1WM2A 1YJ1A 2GBRA 2V3NA 2J0KA 4A6QA 3H7PA 3AE6B 2GBKA 3VQIA 1K50A 4A20A 4H2AA 1R4MI 2J52A 2LJIA 3KUDB 1T6BX 1L7YA 4MJSB 3RPFC 2WX0A 3RMKC 2DYMA 1XLQA 5G2NA 4RMAA 4B0MA 2W9NA 1M4VA 2XK5A 3NZUA 4KIKA 1P7EA 1DOXA 1WYWB 2LGSA 1ZDVA 2L76A 2KVRA 2BYEA 5C3JB 1BMLC 2WWZA 2FUHB 1FRDA 5EE0A 1QF6A 1QILA 4BZAA 3IG3A 2PLPA 3UF8A 4DHJB 3KYDD 2IY1B 1OQYA 1J7CA 1D5ZC 1YMHE 4NNJB 5JXVA 4M8NA 3MJWA 4F1SA 1E8WA 2MCNB 4KZ0A 1FIQA 1TS2A 3EC8A 2L0TA 2ZW1A 2RGFA 1F77A 4KX6B 1DGJA 5EE9A 1I4HA 1ZGUB 2DYBA 3GZNI 1X1MA 3AI5A 2BS2B 1YQ3B 4LDTD 4IOIE 2PIAA 4C4VB 2FCNA 3NY5A 1PDXA 1UZXB 2KXJA 3A9JB 3QCAA 4ICVA 3QARA 2L3ZA 3Q3MC 3W1SA 3CF6E 3LB8C 4ZRKA 4EUTA 2YEPB 4HWIB 2WDTB 3SFDB 5JHAA 3QX1A 2M8SA 1E8XA 4YXDB 1FFUA 1S3SG 2CS4A 3Q8BA 4OZBA 4HPLB 4S0RA 2DENB 4FN2A 2WDRB 2ONQA 2INNE 1HTQA 1WXVA 1WJ6A 4W9IA 2MBHA 2G3QB 2M17A 4G11A 1I42A 5E6JA 4ARIA 3VUXA 1VD2A 2ZCBA 1XCQL 4WURA 4LLGM 2DHZA 3IHPC 4GB9A 2AYOB 3SU8X 2VH2A 3AEDB 2M4NA 3LDZE 4TKNA 3ML8A 2LD9A 5CHVC 2J42A 1WR6E 4GSWA 4HROA 2WU5B 3B2GA 1VZ8A 3L13A 1XQQA 3MFGA 1MG8A 5HI1A 2MP2B 1TTNA 1OEYA 1P3QU 1GG3A 2KTRB 2MQJA 1N6ZA 3N1YC 2LEKA 3H6NA 4W9FA 1VDVA 2CU1A 1L6VA 1LQBA 3C0RB 3H7SA 3VRBB 1SB3C 4MEMA 2KVZA 4IWPA 5C23A 2K8BA 1NDDA 1F0ZA 3P4QB 1XCTL 1ZP0B 1WXSA 2KYWA 4IWQA 4MSQB 3PGEA 1YJIA 5EDSA 4CQNA 4I6LB 3Q6BA 3ZO5B 4K3CA 2HTHA 3VR8B 4JLCA 3PPAA 5TSSA 3VTUA 4ZOHC 2KTRA 1IUEA 1V5TA 4A8XC 2BT6A 4C7YA 1ZOYB 4YSYB 5LLIA 4M02A 1HXYD 2V3PA 4O1NA 3AULA 4MDKE 5IA7A 2ASQA 3SHQA 3UQBA 1SXTA 3TIXA 4AOFA 2BPSA 3L0WB 1TZ1A 5BYRA 2INDC 2KJ6A 3IXSA 3AE7B 5AUKA 1J0GA 2Z0EB 2RD0A 2DWQA 2X8XX 1U4AA 3KVFB 1UBQA 2I38A 2WP9B 5HHDG 2H88B 3VAWA 2L0FA 3Q3JA 4EE2A 3V60A 2BWFA 4PYUA 3PSEB 4CO7A 5JZEB 2KX3A 4IM2A 1RFAA 2KOXA 3UI3A 1GB1A 2EKEC 4MH8A 3U7ZA 2JX5A 3QQ8B 1QZEA 4LJOB 1YIWA 5JHBA 2BS4B 3BY4B 2QSDA 4IUMB 2WXJA 4UDUC 1L0YB 4GDLB 2NPTB 4WQMA 1FNUA 3DHIC 3NRZA 5IO9A 1JALA 2J0MA 2QILA 4XE0A 1AWDA 3EUB2 1NYQA 1V97A 3DBLI 5D3DA 2PVGC 4TUUA 1WR1A 1IBXB 3ZYYX 3A33B 1VZ6A 1L4ZB 4AP4C 3I5JC 1V2YA 2FNJB 5HKHA 3Q69A 2M0XA 1VJKA 1T5XD 5E6PA 1QQRA 1QOGA 3LJ3A 2KN4A 1Z2MA 3K9PB 2W3RA 3PLUA 3PHWB 5E6NA 2D11A 1C9FA 5KHOA 4E71A 3TEWA 5I4DA 2E3TA 4ZRIA 3ZDMC 3DHGC 4FHJA 1EF5A 1PGBA 3DQVA 3VHTC 1WX8A 4LNNA 1IPGA 5DPTA 4DXFA
chains in the Genus database with same CATH topology
2AEHA 4E74A 4AJWA 3VDZA 3EHVA 1KM7A 2IO1B 5AZFA 1LM8B 2GOWA 2LZ6A 3IFWB 5TR5A 4EZJA 4HLEA 2N4FA 2I1JA 2ZPNA 2JVCA 5J18A 2BGFA 3R66C 3RT3B 2REXA 3DCGA 1WX9A 2LXCA 4W9LA 3PVLA 1WH3A 4YL8A 3DBRI 4NJ7A 3VTWA 4IM3A 1IP9A 2G4SA 3KUCB 2GBJA 3UIOB 3B0AA 2KLGA 3OJ3A 5JH5C 4K81A 2LGYA 2JPHA 4BOZB 4AUQC 4PS8A 3VUWA 1P98A 2R2QA 4X57B 3DPDA 3RZFA 2YVCA 4GOCA 1D3ZA 2IBIB 1E5WA 5C1ZA 1T0YA 2LI5A 3AXCA 2AL3A 4FJZA 3VUYA 2Y5BB 2D10A 4MELA 4ZYNA 1WJUA 2JRIB 3SDLC 3VXWA 1WXAA 2V4LA 4RM8A 1TGZB 2MSED 3N30A 2KKCA 3M95A 2QHOA 3OLMD 4M8MA 1J8CA 3PREA 1UD7A 4KVGB 4W9KA 3ZW3A 1LXDA 3B1LX 4HK2A 1XD3B 4DHJD 5J2RA 4GU2A 3WALA 2K25A 4P7IA 5D7GA 2KQSA 4FJVB 2MWSB 1E7UA 2MW5A 3U8ZA 3CMMB 1WI0A 5IAAC 2O6VA 3ZNHB 2KANA 2XK5B 2DX5B 3U30A 2KNBA 3PV1A 4HJKA 4IG7B 3ZVVA 2XBBC 3AU5A 2N7EA 1C1YB 1Q5WB 2N9XA 1E8YA 3VTVA 4EFOA 3KW5B 4HCNB 4XC2A 3WAOA 1E8ZA 1SIFA 1M94A 4ANVA 4FLHA 5DCNA 5D6JB 4HVBA 2M1MA 3VH3B 4HDOA 2CHZA 3ZRCA 1WM2A 1YJ1A 2C9WB 2GBRA 2K6DB 3DBSA 2BYVE 2J0KA 2Z0DB 5CHWA 3H7PA 4IWOA 3HIZA 2HJ8A 1V86A 1V81A 2GBKA 2A5UA 4W9JA 5CTRC 2N1WA 5BO4B 3VQIA 3QIJA 4A20A 1R4MI 1H4RA 1V5OA 2KZRA 3KH0A 2LVQA 2KDIA 2JT4B 3GOEA 3KUDB 2BKFA 3ECIA 2LXAA 1L7YA 4MJSB 2C5LC 4TQ0A 2WX0A 2DAJA 4MGZE 3UIPB 2DYMA 5G2NA 3JSVB 4RMAA 3TCAA 3BINA 4M0WB 2KC2A 2W9NA 1YX5B 2KQ7A 4K7UA 4DDGD 1OEYJ 2WYQA 2XK5A 3VFKA 5CHFA 3NZUA 3PZDA 1FXTB 3N32A 5DPWA 5LXHA 4KIKA 3H1UA 2IO0B 4IC7B 4J6IA 4TQ1A 1WYWB 2L76A 1WFYA 2ZNVB 5D2MB 4DK5A 2KVRA 2BYEA 2ZNVC 1WMHB 3A9KB 2DYOA 4IM0A 2BKRB 1JRUA 2OJRA 2ZVOA 2WWZA 3UINB 2FUHB 2KFJA 4HXDA 4JIOU 4GDLA 1WY8A 2KC1A 2NPTA 5GMVA 2XEWA 3IG3A 3UF8A 4WJQA 4DHJB 3KYDD 2IY1B 2BF8B 2JY6A 4GIVA 1OQYA 2YLMA 3PHXB 3R7QA 4NNJB 1WZ0A 4URKA 1SE9A 2LVPA 4M8NA 2O2VA 3MJWA 3HM6X 1E8WA 4F1SA 4EZKA 4KZCA 1WIAA 3IVFA 2MCNB 3TMPB 2L8JA 4W9HA 4KZ0A 1YX6B 3AU4A 4GDKB 3UQAA 4ASWC 4MGYE 3EC8A 3JSVA 3WA0A 4EEWA 4EOYA 2L0TA 3WAMA 1V6EA 4ICUA 1WRDB 2KK8A 2RGFA 5FR6A 3KYCD 4KSLC 1J19A 2ZVNA 1F9JA 2V3SA 3WIMA 1ZGUB 2DYBA 3GZNI 1X1MA 2CHXA 3AI5A 3I3TB 1YQBA 1GC7A 3L17A 4FULA 2UYZB 3ZUNA 1WMHA 3A9KA 4A3OA 4LDTD 5AZGA 3RYTA 4B9KA 1WF9A 2FCNA 2K8HA 3NY5A 2KDEB 3DVNU 3JVZX 1BT0A 2JUOA 1UZXB 1PQSA 2KXJA 3A9JB 3QCAA 3ZLZA 1WX7A 2ZZPB 3QARA 4ICVA 2L3ZA 4BFRA 2WX1A 5E6OA 2KO3A 3PRZA 2DZKA 3W1SA 1NBFC 1KJTA 3CF6E 4WJPA 4NY0A 4ZRKA 3NZSA 1WGRA 4EUTA 4ZRJA 1EUVB 2JXXA 3V6CB 4HWIB 3QHTA 5KHQA 3ZNID 2NBWB 2WDTB 5JHAA 3QX1A 2M8SA 2Z59B 3W1YA 1P9DU 2K1FA 1E8XA 2OOBB 2G45B 1WGYA 1KLVA 2N1VA 3ZDTA 2C7NB 1S3SG 3QWZB 2D2QA 4WWNA 2CS4A 5J17A 2MBEA 1V49A 1ZW7A 4N9F4 4HPLB 3R3MA 3DOWA 4CYEA 4DWFA 1GJZA 2DENB 4FN2A 3PRMB 1WXVA 1WXMA 1WJ6A 4W9IA 2MBHA 2NS5A 1SGHA 1UELA 2G3QB 3HHMA 2M17A 4G11A 4K7SA 1I42A 4GN1A 4GGQA 2AWTA 3ZRFA 3MHSD 3RD2A 3VUXA 2L00B 1VD2A 2ZCBA 2KJHB 1WGHA 2PE6B 4FJYA 4W9DA 5D94A 3QK0A 2DHZA 1L2NA 3PLVA 3IHPC 4JQWC 4GB9A 1I35A 2AYOB 3QAQA 4LDTB 3SU8X 2J7QB 2IO3B 3V6EB 4ANUA 2NBUA 4MSMB 2M4NA 3LDZE 4TKNA 3PTFC 3ML8A 5AZHA 3ZNZB 2LD9A 4AJYB 3DVGX 2L05A 4KV2A 5CHVC 1XT9B 4OVUA 1R4NI 1WR6E 4GSWA 1YD8U 3L13A 3H9DA 1OGWA 1XQQA 1MG8A 4MGIE 4AWJA 1H8CA 2LASA 2KX0A 2MP2B 2NBVB 1TTNA 3DDCB 4A3PA 2KFKB 4DBGA 2I1KA 1OEYA 3ENEA 2JRHA 3M3JA 1P3QU 1GG3A 2JF5A 2KTRB 2N9PC 4FA6A 3EFUA 1E90A 2MQJA 3NS8A 2LRWA 4PS7A 2FAZA 3ZTCA 4BKTA 3H6NA 3PS6A 3T8MA 2D3GA 3RZWC 4W9FA 2O6VD 3K9OB 1WM3A 3ML9A 3QJZA 2CU1A 1LQBA 2IYDB 3C0RB 3H7SA 1HE8A 3APCA 1Q0WB 2MBOA 2MBQA 3CSTA 4IWPA 4KDLB 2K8BA 4MEMA 5C23A 1WE7A 4LCDE 1ZKHA 1ISNA 1NDDA 1WGDA 2DZIA 2RPQA 5L83A 4B95A 4MJSA 1WXSA 4IWQA 4MSQB 1RLFA 3PGEA 2KWCA 4HPMB 2FCQA 4DDID 3A4RA 5EDSA 4I6LB 2FIDA 1RAXA 3T9LA 3JYUA 1UH6A 2CKHB 1NI2A 2LGDA 3ZO5B 1WZ3A 2HTHA 2KFKA 4JLCA 3RUIB 4GXBA 3PPAA 3VTUA 2DZJA 1GUAB 2KTRA 2LGXA 4WWOA 1V5TA 4NAWB 2NCNA 2KMCA 3M63B 3QC8B 4NJ6A 2MBBB 4K1RB 3X0WA 4BKSD 1K8RB 4FHKA 4PS3A 3ZNGC 1GNUA 2ZJDA 3U7DA 5LLIA 3V61A 4DHZE 2KD0A 2KWUB 4BBNC 4WQOB 1RRBA 3S2AA 3AULA 4MDKE 2FCMA 5IA7A 2ASQA 1E7VA 2MX2A 3JW0X 3SHQA 2ZEQA 2RR9A 1UGMA 4JGHB 3UQBA 3NOBA 2KLCA 3EECA 3DVGY 4I6NB 3TIXA 4AOFA 2BPSA 2KJRA 3L0WB 2G4DB 1A5RA 1TZ1A 4GDKA 2K6QA 4F7ZA 2C7HA 3ZTDA 3O65B 2KJ6A 4NPNA 2K8CA 1OTRB 3DVNV 3HM3A 4BKGA 3B08A 4IW0A 2R2OA 1Z5SB 5CX3A 2O6VB 4TV3A 4II3B 2EMSA 3WANA 4NAWA 1J0GA 1V9JA 2Z0EB 4EKUA 1WJNA 2RD0A 5DPTA 4FBJB 1U4AA 4G0NB 3KVFB 1UBQA 3APDA 1G6JA 2AL6A 2LJ5A 1P1AA 2IO2B 4NQKE 4WWPA 3L16A 3VAWA 1CMXB 2L0FA 1AARA 4BOSC 3Q3JA 3APFA 3H7PB 2MRPA 3A9JA 2MLBA 2ZCCA 3V60A 2GBNA 2GBMA 2KN5A 3OAWA 2BYFA 3TBLD 2BWFA 4ZDVA 1KOTA 2LUEA 4WJOA 4PYUA 4MH0E 1GC6A 3PSEB 4PYZA 3VH4B 3WAPA 4CO7A 4HDQA 4G3XB 3TL5A 5JZEB 2KX3A 4IM2A 3L54A 4XZ4A 3PT2B 2KHWB 4W9GA 4BVUC 4F8CB 1RFAA 2KOXA 3MTNB 2KWVB 3NHEB 3QA8A 4ANWA 4XX5A 2LVOA 2EKEC 3KUZA 3ZIMA 2D07B 2NR2A 4JL9A 2IZVB 4K7WA 2CHWA 3QQ8B 3L08A 2DAFA 3SD5A 3RULA 1QZEA 4LJOB 5DPRA 2ZPYA 1YIWA 2VRRB 3R7RA 2LWPA 4KIKB 3UGBB 5JHBA 3BY4B 4IUMB 2KDBA 3Q3FA 2PE9A 4OVVA 4B6WA 5DPSA 4WJNA 1C3TA 3A1QB 2N7DA 3VVWB 4GDLB 4DXAB 2C60A 2L7RA 3HK0A 2NPTB 5G55A 2A4ZA 2HE7A 2KDFB 4BBNF 3X23A 1VCBA 4EZLA 2CR5A 2J0MA 2V1YA 3A4SC 4FADA 4II2B 4WAAA 3OJ4B 2O2VB 3RCZA 4KDIC 4LJPB 3PRPB 5LXIB 3P2BA 1Y8RC 1WJ4A 3DBLI 1IYFA 1EO6A 4HCPB 2LRUA 2J0JA 2JZZA 4BKSA 2KMAA 1WR1A 2IY0B 4TUUA 2B3AA 5AEKB 1Q1OA 4G50A 3A33B 3TJPA 2PEAA 4AP4C 3DBHI 1V2YA 3V62A 1EF1A 2JZ3B 2FNJB 2NVUI 2UWQA 3L10B 2MA9B 2M0XA 4CHKA 5HKHA 1TBEA 1WGGA 2RSUA 4W9EA 2JWZA 2HD5B 2BWES 3IBEA 2N9EB 3A1QA 4W9CA 5E6PA 3N3KB 3ZKJC 1V80A 2MP2A 2PJHA 4DHZB 4ANXA 2K39A 3LJ3A 2PPHA 1Z2MA 3K9PB 3PLUA 3PHWB 5E6NA 2DZMA 2EMTA 2D11A 1P0RA 2KTFA 5KHOA 4MM3A 5L95C 4E71A 4E3CA 4I6PA 3M62B 2FCSA 3W1SC 1WE6A 4KSKC 2C7MB 4ZRIA 3ZDMC 1UBIA 4FHJA 1EF5A 3CSFA 3DQVA 3ALBA 1LFDA 3D32A 4GMVA 1WX8A 4NQLB 3VHTC 4MGKE 4RM9A 1S1QB 1IPGA 3ONSA 2FIFA 2GMIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AEH A;  4E74 A;  4AJW A;  3VDZ A;  3EHV A;  1KM7 A;  2IO1 B;  5AZF A;  1LM8 B;  2GOW A;  2LZ6 A;  3IFW B;  5TR5 A;  4EZJ A;  4HLE A;  2N4F A;  2I1J A;  2ZPN A;  2JVC A;  5J18 A;  2BGF A;  3R66 C;  3RT3 B;  2REX A;  3DCG A;  1WX9 A;  2LXC A;  4W9L A;  3PVL A;  1WH3 A;  4YL8 A;  3DBR I;  4NJ7 A;  3VTW A;  4IM3 A;  1IP9 A;  2G4S A;  3KUC B;  2GBJ A;  3UIO B;  3B0A A;  2KLG A;  3OJ3 A;  5JH5 C;  4K81 A;  2LGY A;  2JPH A;  4BOZ B;  4AUQ C;  4PS8 A;  3VUW A;  1P98 A;  2R2Q A;  4X57 B;  3DPD A;  3RZF A;  2YVC A;  4GOC A;  1D3Z A;  2IBI B;  1E5W A;  5C1Z A;  1T0Y A;  2LI5 A;  3AXC A;  2AL3 A;  4FJZ A;  3VUY A;  2Y5B B;  2D10 A;  4MEL A;  4ZYN A;  1WJU A;  2JRI B;  3SDL C;  3VXW A;  1WXA A;  2V4L A;  4RM8 A;  1TGZ B;  2MSE D;  3N30 A;  2KKC A;  3M95 A;  2QHO A;  3OLM D;  4M8M A;  1J8C A;  3PRE A;  1UD7 A;  4KVG B;  4W9K A;  3ZW3 A;  1LXD A;  3B1L X;  4HK2 A;  1XD3 B;  4DHJ D;  5J2R A;  4GU2 A;  3WAL A;  2K25 A;  4P7I A;  5D7G A;  2KQS A;  4FJV B;  2MWS B;  1E7U A;  2MW5 A;  3U8Z A;  3CMM B;  1WI0 A;  5IAA C;  2O6V A;  3ZNH B;  2KAN A;  2XK5 B;  2DX5 B;  3U30 A;  2KNB A;  3PV1 A;  4HJK A;  4IG7 B;  3ZVV A;  2XBB C;  3AU5 A;  2N7E A;  1C1Y B;  1Q5W B;  2N9X A;  1E8Y A;  3VTV A;  4EFO A;  3KW5 B;  4HCN B;  4XC2 A;  3WAO A;  1E8Z A;  1SIF A;  1M94 A;  4ANV A;  4FLH A;  5DCN A;  5D6J B;  4HVB A;  2M1M A;  3VH3 B;  4HDO A;  2CHZ A;  3ZRC A;  1WM2 A;  1YJ1 A;  2C9W B;  2GBR A;  2K6D B;  3DBS A;  2BYV E;  2J0K A;  2Z0D B;  5CHW A;  3H7P A;  4IWO A;  3HIZ A;  2HJ8 A;  1V86 A;  1V81 A;  2GBK A;  2A5U A;  4W9J A;  5CTR C;  2N1W A;  5BO4 B;  3VQI A;  3QIJ A;  4A20 A;  1R4M I;  1H4R A;  1V5O A;  2KZR A;  3KH0 A;  2LVQ A;  2KDI A;  2JT4 B;  3GOE A;  3KUD B;  2BKF A;  3ECI A;  2LXA A;  1L7Y A;  4MJS B;  2C5L C;  4TQ0 A;  2WX0 A;  2DAJ A;  4MGZ E;  3UIP B;  2DYM A;  5G2N A;  3JSV B;  4RMA A;  3TCA A;  3BIN A;  4M0W B;  2KC2 A;  2W9N A;  1YX5 B;  2KQ7 A;  4K7U A;  4DDG D;  1OEY J;  2WYQ A;  2XK5 A;  3VFK A;  5CHF A;  3NZU A;  3PZD A;  1FXT B;  3N32 A;  5DPW A;  5LXH A;  4KIK A;  3H1U A;  2IO0 B;  4IC7 B;  4J6I A;  4TQ1 A;  1WYW B;  2L76 A;  1WFY A;  2ZNV B;  5D2M B;  4DK5 A;  2KVR A;  2BYE A;  2ZNV C;  1WMH B;  3A9K B;  2DYO A;  4IM0 A;  2BKR B;  1JRU A;  2OJR A;  2ZVO A;  2WWZ A;  3UIN B;  2FUH B;  2KFJ A;  4HXD A;  4JIO U;  4GDL A;  1WY8 A;  2KC1 A;  2NPT A;  5GMV A;  2XEW A;  3IG3 A;  3UF8 A;  4WJQ A;  4DHJ B;  3KYD D;  2IY1 B;  2BF8 B;  2JY6 A;  4GIV A;  1OQY A;  2YLM A;  3PHX B;  3R7Q A;  4NNJ B;  1WZ0 A;  4URK A;  1SE9 A;  2LVP A;  4M8N A;  2O2V A;  3MJW A;  3HM6 X;  1E8W A;  4F1S A;  4EZK A;  4KZC A;  1WIA A;  3IVF A;  2MCN B;  3TMP B;  2L8J A;  4W9H A;  4KZ0 A;  1YX6 B;  3AU4 A;  4GDK B;  3UQA A;  4ASW C;  4MGY E;  3EC8 A;  3JSV A;  3WA0 A;  4EEW A;  4EOY A;  2L0T A;  3WAM A;  1V6E A;  4ICU A;  1WRD B;  2KK8 A;  2RGF A;  5FR6 A;  3KYC D;  4KSL C;  1J19 A;  2ZVN A;  1F9J A;  2V3S A;  3WIM A;  1ZGU B;  2DYB A;  3GZN I;  1X1M A;  2CHX A;  3AI5 A;  3I3T B;  1YQB A;  1GC7 A;  3L17 A;  4FUL A;  2UYZ B;  3ZUN A;  1WMH A;  3A9K A;  4A3O A;  4LDT D;  5AZG A;  3RYT A;  4B9K A;  1WF9 A;  2FCN A;  2K8H A;  3NY5 A;  2KDE B;  3DVN U;  3JVZ X;  1BT0 A;  2JUO A;  1UZX B;  1PQS A;  2KXJ A;  3A9J B;  3QCA A;  3ZLZ A;  1WX7 A;  2ZZP B;  3QAR A;  4ICV A;  2L3Z A;  4BFR A;  2WX1 A;  5E6O A;  2KO3 A;  3PRZ A;  2DZK A;  3W1S A;  1NBF C;  1KJT A;  3CF6 E;  4WJP A;  4NY0 A;  4ZRK A;  3NZS A;  1WGR A;  4EUT A;  4ZRJ A;  1EUV B;  2JXX A;  3V6C B;  4HWI B;  3QHT A;  5KHQ A;  3ZNI D;  2NBW B;  2WDT B;  5JHA A;  3QX1 A;  2M8S A;  2Z59 B;  3W1Y A;  1P9D U;  2K1F A;  1E8X A;  2OOB B;  2G45 B;  1WGY A;  1KLV A;  2N1V A;  3ZDT A;  2C7N B;  1S3S G;  3QWZ B;  2D2Q A;  4WWN A;  2CS4 A;  5J17 A;  2MBE A;  1V49 A;  1ZW7 A;  4N9F 4;  4HPL B;  3R3M A;  3DOW A;  4CYE A;  4DWF A;  1GJZ A;  2DEN B;  4FN2 A;  3PRM B;  1WXV A;  1WXM A;  1WJ6 A;  4W9I A;  2MBH A;  2NS5 A;  1SGH A;  1UEL A;  2G3Q B;  3HHM A;  2M17 A;  4G11 A;  4K7S A;  1I42 A;  4GN1 A;  4GGQ A;  2AWT A;  3ZRF A;  3MHS D;  3RD2 A;  3VUX A;  2L00 B;  1VD2 A;  2ZCB A;  2KJH B;  1WGH A;  2PE6 B;  4FJY A;  4W9D A;  5D94 A;  3QK0 A;  2DHZ A;  1L2N A;  3PLV A;  3IHP C;  4JQW C;  4GB9 A;  1I35 A;  2AYO B;  3QAQ A;  4LDT B;  3SU8 X;  2J7Q B;  2IO3 B;  3V6E B;  4ANU A;  2NBU A;  4MSM B;  2M4N A;  3LDZ E;  4TKN A;  3PTF C;  3ML8 A;  5AZH A;  3ZNZ B;  2LD9 A;  4AJY B;  3DVG X;  2L05 A;  4KV2 A;  5CHV C;  1XT9 B;  4OVU A;  1R4N I;  1WR6 E;  4GSW A;  1YD8 U;  3L13 A;  3H9D A;  1OGW A;  1XQQ A;  1MG8 A;  4MGI E;  4AWJ A;  1H8C A;  2LAS A;  2KX0 A;  2MP2 B;  2NBV B;  1TTN A;  3DDC B;  4A3P A;  2KFK B;  4DBG A;  2I1K A;  1OEY A;  3ENE A;  2JRH A;  3M3J A;  1P3Q U;  1GG3 A;  2JF5 A;  2KTR B;  2N9P C;  4FA6 A;  3EFU A;  1E90 A;  2MQJ A;  3NS8 A;  2LRW A;  4PS7 A;  2FAZ A;  3ZTC A;  4BKT A;  3H6N A;  3PS6 A;  3T8M A;  2D3G A;  3RZW C;  4W9F A;  2O6V D;  3K9O B;  1WM3 A;  3ML9 A;  3QJZ A;  2CU1 A;  1LQB A;  2IYD B;  3C0R B;  3H7S A;  1HE8 A;  3APC A;  1Q0W B;  2MBO A;  2MBQ A;  3CST A;  4IWP A;  4KDL B;  2K8B A;  4MEM A;  5C23 A;  1WE7 A;  4LCD E;  1ZKH A;  1ISN A;  1NDD A;  1WGD A;  2DZI A;  2RPQ A;  5L83 A;  4B95 A;  4MJS A;  1WXS A;  4IWQ A;  4MSQ B;  1RLF A;  3PGE A;  2KWC A;  4HPM B;  2FCQ A;  4DDI D;  3A4R A;  5EDS A;  4I6L B;  2FID A;  1RAX A;  3T9L A;  3JYU A;  1UH6 A;  2CKH B;  1NI2 A;  2LGD A;  3ZO5 B;  1WZ3 A;  2HTH A;  2KFK A;  4JLC A;  3RUI B;  4GXB A;  3PPA A;  3VTU A;  2DZJ A;  1GUA B;  2KTR A;  2LGX A;  4WWO A;  1V5T A;  4NAW B;  2NCN A;  2KMC A;  3M63 B;  3QC8 B;  4NJ6 A;  2MBB B;  4K1R B;  3X0W A;  4BKS D;  1K8R B;  4FHK A;  4PS3 A;  3ZNG C;  1GNU A;  2ZJD A;  3U7D A;  5LLI A;  3V61 A;  4DHZ E;  2KD0 A;  2KWU B;  4BBN C;  4WQO B;  1RRB A;  3S2A A;  3AUL A;  4MDK E;  2FCM A;  5IA7 A;  2ASQ A;  1E7V A;  2MX2 A;  3JW0 X;  3SHQ A;  2ZEQ A;  2RR9 A;  1UGM A;  4JGH B;  3UQB A;  3NOB A;  2KLC A;  3EEC A;  3DVG Y;  4I6N B;  3TIX A;  4AOF A;  2BPS A;  2KJR A;  3L0W B;  2G4D B;  1A5R A;  1TZ1 A;  4GDK A;  2K6Q A;  4F7Z A;  2C7H A;  3ZTD A;  3O65 B;  2KJ6 A;  4NPN A;  2K8C A;  1OTR B;  3DVN V;  3HM3 A;  4BKG A;  3B08 A;  4IW0 A;  2R2O A;  1Z5S B;  5CX3 A;  2O6V B;  4TV3 A;  4II3 B;  2EMS A;  3WAN A;  4NAW A;  1J0G A;  1V9J A;  2Z0E B;  4EKU A;  1WJN A;  2RD0 A;  5DPT A;  4FBJ B;  1U4A A;  4G0N B;  3KVF B;  1UBQ A;  3APD A;  1G6J A;  2AL6 A;  2LJ5 A;  1P1A A;  2IO2 B;  4NQK E;  4WWP A;  3L16 A;  3VAW A;  1CMX B;  2L0F A;  1AAR A;  4BOS C;  3Q3J A;  3APF A;  3H7P B;  2MRP A;  3A9J A;  2MLB A;  2ZCC A;  3V60 A;  2GBN A;  2GBM A;  2KN5 A;  3OAW A;  2BYF A;  3TBL D;  2BWF A;  4ZDV A;  1KOT A;  2LUE A;  4WJO A;  4PYU A;  4MH0 E;  1GC6 A;  3PSE B;  4PYZ A;  3VH4 B;  3WAP A;  4CO7 A;  4HDQ A;  4G3X B;  3TL5 A;  5JZE B;  2KX3 A;  4IM2 A;  3L54 A;  4XZ4 A;  3PT2 B;  2KHW B;  4W9G A;  4BVU C;  4F8C B;  1RFA A;  2KOX A;  3MTN B;  2KWV B;  3NHE B;  3QA8 A;  4ANW A;  4XX5 A;  2LVO A;  2EKE C;  3KUZ A;  3ZIM A;  2D07 B;  2NR2 A;  4JL9 A;  2IZV B;  4K7W A;  2CHW A;  3QQ8 B;  3L08 A;  2DAF A;  3SD5 A;  3RUL A;  1QZE A;  4LJO B;  5DPR A;  2ZPY A;  1YIW A;  2VRR B;  3R7R A;  2LWP A;  4KIK B;  3UGB B;  5JHB A;  3BY4 B;  4IUM B;  2KDB A;  3Q3F A;  2PE9 A;  4OVV A;  4B6W A;  5DPS A;  4WJN A;  1C3T A;  3A1Q B;  2N7D A;  3VVW B;  4GDL B;  4DXA B;  2C60 A;  2L7R A;  3HK0 A;  2NPT B;  5G55 A;  2A4Z A;  2HE7 A;  2KDF B;  4BBN F;  3X23 A;  1VCB A;  4EZL A;  2CR5 A;  2J0M A;  2V1Y A;  3A4S C;  4FAD A;  4II2 B;  4WAA A;  3OJ4 B;  2O2V B;  3RCZ A;  4KDI C;  4LJP B;  3PRP B;  5LXI B;  3P2B A;  1Y8R C;  1WJ4 A;  3DBL I;  1IYF A;  1EO6 A;  4HCP B;  2LRU A;  2J0J A;  2JZZ A;  4BKS A;  2KMA A;  1WR1 A;  2IY0 B;  4TUU A;  2B3A A;  5AEK B;  1Q1O A;  4G50 A;  3A33 B;  3TJP A;  2PEA A;  4AP4 C;  3DBH I;  1V2Y A;  3V62 A;  1EF1 A;  2JZ3 B;  2FNJ B;  2NVU I;  2UWQ A;  3L10 B;  2MA9 B;  2M0X A;  4CHK A;  5HKH A;  1TBE A;  1WGG A;  2RSU A;  4W9E A;  2JWZ A;  2HD5 B;  2BWE S;  3IBE A;  2N9E B;  3A1Q A;  4W9C A;  5E6P A;  3N3K B;  3ZKJ C;  1V80 A;  2MP2 A;  2PJH A;  4DHZ B;  4ANX A;  2K39 A;  3LJ3 A;  2PPH A;  1Z2M A;  3K9P B;  3PLU A;  3PHW B;  5E6N A;  2DZM A;  2EMT A;  2D11 A;  1P0R A;  2KTF A;  5KHO A;  4MM3 A;  5L95 C;  4E71 A;  4E3C A;  4I6P A;  3M62 B;  2FCS A;  3W1S C;  1WE6 A;  4KSK C;  2C7M B;  4ZRI A;  3ZDM C;  1UBI A;  4FHJ A;  1EF5 A;  3CSF A;  3DQV A;  3ALB A;  1LFD A;  3D32 A;  4GMV A;  1WX8 A;  4NQL B;  3VHT C;  4MGK E;  4RM9 A;  1S1Q B;  1IPG A;  3ONS A;  2FIF A;  2GMI C; 
#chains in the Genus database with same CATH topology
 1TT5 B;  3VDZ A;  3EHV A;  1KM7 A;  5AZF A;  1E0Z A;  2N4F A;  3AEC B;  2JVC A;  2BGF A;  3P1M A;  1WX9 A;  4W9L A;  1WH3 A;  2QDF A;  2WU2 B;  4TMA B;  1YN4 A;  2KLG A;  3OJ3 A;  5JH5 C;  1P98 A;  2R2Q A;  4X57 B;  1E5W A;  5C1Z A;  2H89 B;  3VR9 B;  2LI5 A;  4ZHO A;  4MAC A;  4C7Z A;  1BUI C;  1WJU A;  2VH1 A;  1TGZ B;  2KKC A;  2QHO A;  4M8M A;  1HA5 A;  1J8C A;  3ZQ4 A;  1UD7 A;  2FUG 1;  3HRD D;  3MC8 A;  3B1L X;  4GU2 A;  3WAL A;  1DOI A;  1A70 A;  3BWU D;  1R4N B;  1C79 A;  3U8Z A;  2VZK D;  1C4P A;  1WI0 A;  1UWM A;  5IAA C;  3ZNH B;  5BMG A;  4AS1 A;  2DX5 B;  2KNB A;  3PV1 A;  2XBB C;  2D3A A;  2N7E A;  1Q5W B;  3KW5 B;  1QKZ A;  4ANV A;  2KDM A;  2J4X A;  2K6D B;  1N60 A;  3DBS A;  2BYV E;  2Z0D B;  3DWM A;  2WQY B;  3HIZ A;  2AQ3 B;  1JW9 D;  5BO4 B;  2N1W A;  1CQV A;  1V5O A;  2GI9 A;  2LVQ A;  1VLB A;  2KDI A;  2JT4 B;  1ZE3 D;  4ZRP A;  1HQR D;  1C76 A;  1NYR A;  2WXK A;  2LXA A;  3N9Y C;  2C5L C;  4TQ0 A;  4MGZ E;  2WXP A;  2GRI A;  3JSV B;  1VZ7 A;  2L1A A;  4DDG D;  4BAX A;  3PZD A;  5DPW A;  5LXH A;  4TQ1 A;  1WFY A;  4DK5 A;  3A9K B;  1EM7 A;  1JRU A;  1F52 A;  2KFJ A;  4HXD A;  4JIO U;  1WY8 A;  2KC1 A;  2XEW A;  4GIV A;  2BF8 B;  2JY6 A;  1TS5 A;  2LVP A;  2O2V A;  2RDG A;  2L8J A;  3RNC C;  1TKE A;  1YX6 B;  4GDK B;  3UQA A;  4ASW C;  3JSV A;  3WA0 A;  4KGS A;  1WRD B;  1PGX A;  2ZVN A;  1TY0 A;  1F9J A;  2V3S A;  3WIM A;  3Q8E A;  5G5H A;  4FUL A;  4A3O A;  3A9K A;  2EEL A;  3RYT A;  4B9K A;  2M0A A;  3OWE B;  2KDE B;  3AEG B;  1UNS A;  2BBC A;  1PQS A;  3AE8 B;  2WXL A;  1WX7 A;  3AH7 A;  5FR3 A;  4D2K A;  1SEB D;  3NZS A;  4ZRJ A;  3QHT A;  2GB1 A;  3ZNI D;  3CIR B;  1WGY A;  1KLV A;  3ZDT A;  4ZYS A;  3QWZ B;  2D2Q A;  4N9F 4;  4CYE A;  4P6V F;  1GJZ A;  1AN8 A;  1OQQ A;  2NS5 A;  4MT5 A;  3HHM A;  2HDE A;  3BVM A;  4IKG A;  4GGQ A;  3ZRF A;  3AMZ A;  3FKY A;  4YSZ B;  4XGA B;  1I35 A;  2J7Q B;  2G1E A;  2IO3 B;  3RNF C;  2NBU A;  4JWS C;  4RGO S;  4MSM B;  1Q10 A;  4AJY B;  2L05 A;  4KV2 A;  1XT9 B;  1UF0 A;  4OVU A;  1GAQ B;  1FM0 D;  1OGW A;  1L6U A;  4YWG G;  2NBV B;  3DDC B;  1I4P A;  2KAJ A;  1JWS D;  3M3J A;  5HG2 A;  3NS8 A;  4PS7 A;  4KKI A;  3PS6 A;  3RZW C;  3K9O B;  1KFY B;  2JU6 X;  2IYD B;  3APC A;  3CST A;  2MBO A;  3PO0 A;  1GB4 A;  2HJ1 A;  3V05 A;  1WGD A;  3FIL B;  1FFV A;  1TZO A;  4MJS A;  2WXM A;  3A4R A;  4XWT A;  2Z8L A;  1RAX A;  2NTT A;  1NI2 A;  2LGD A;  1WZ3 A;  4RF0 A;  3DBR B;  2LGX A;  4WWO A;  4NAW B;  3M63 B;  2QJL A;  4K1R B;  3X0W A;  1K8R B;  4FHK A;  1E10 A;  5BMI A;  3AEF B;  1ENF A;  2ZJD A;  3U7D A;  1YJJ A;  4NZL B;  2KWU B;  4WQO B;  3S2A A;  2N0S B;  1E7V A;  2KQ4 X;  2N9L A;  2ZEQ A;  3FIL A;  1UGM A;  2ACZ B;  1QOB A;  2V9H A;  1SJH D;  1IGD A;  2FE8 A;  1R7S A;  1XO3 A;  4NPN A;  1OTR B;  3HM3 A;  3W5V B;  2D3B A;  2R2O A;  2Y5C A;  1Z5S B;  4LNO A;  2O6V B;  4II3 B;  3WAN A;  1RWS A;  3URY A;  1V1P B;  4NAW A;  1WJN A;  2LHD A;  3APD A;  2LMC A;  4C4V A;  4HRS A;  1CMX B;  3RNB C;  3GP7 A;  2MEK A;  1E7P B;  4BOS C;  3APF A;  3A9J A;  2MLB A;  2ZCC A;  2ICI A;  2GBN A;  2GBM A;  2XNA C;  1KLG D;  3TBL D;  2LUE A;  4WJO A;  3AEE B;  1R4M B;  4PYZ A;  3VH4 B;  1N61 A;  4HDQ A;  3L54 A;  3PT2 B;  4F8C B;  4BVU C;  3QA8 A;  4ANW A;  3T3O A;  3MP9 A;  3ZIM A;  2NR2 A;  2IZV B;  4K7W A;  1YN3 A;  3RUL A;  3TEX A;  1V1P A;  2ZPY A;  5C2T B;  3UGB B;  2LWP A;  1GOZ A;  4B6W A;  2OED A;  3BK1 A;  3BYT B;  4WJN A;  2N7D A;  3BYY B;  2L7R A;  1NVI D;  3IAM 1;  4KGR A;  3NG0 A;  4BBN F;  3X23 A;  4EZL A;  5H92 C;  1XEE A;  2DBY A;  2V1Y A;  4II2 B;  1EWC A;  3PRP B;  2WS3 B;  3P2B A;  4R3D A;  1Y8R C;  2PKO A;  2BS3 B;  2LRU A;  5EE3 A;  4BKS A;  5AEK B;  1Q1O A;  5BYQ A;  3TJP A;  2PEA A;  3ZJV A;  3WCQ A;  3DBH I;  1BXT A;  1SSN A;  1EF1 A;  2JZ3 B;  2NVU I;  3L10 B;  4YTN B;  3GZN B;  2RSU A;  2JWZ A;  2BWE S;  3ZKJ C;  2MJ3 A;  3N3K B;  2PJH A;  2MP2 A;  3GE8 C;  2K39 A;  5FKA C;  2PPH A;  2B76 B;  1C4C A;  2EMT A;  5L95 C;  3BII D;  4E3C A;  2FCS A;  2JZP A;  1UBI A;  4NQL B;  4RM9 A;  1WYG A;  1T0S C;  2FIF A;  1MVK A;  1B9R A;  4DXG A;  2IO1 B;  1LM8 B;  2GOW A;  2LZ6 A;  3IFW B;  5TR5 A;  2ZPN A;  5J18 A;  3R66 C;  3RT3 B;  2REX A;  4REZ A;  2LXC A;  3PVL A;  2N9K A;  2GBJ A;  2WXI A;  2K22 A;  3P4R B;  2WHI A;  4K81 A;  1C78 A;  3VUW A;  3RZF A;  3MC9 A;  3W9C B;  4GOC A;  3KQ4 A;  2SAK A;  3AXC A;  2AL3 A;  4FJZ A;  3VUY A;  3GS2 A;  5MPO A;  2MSE D;  3N30 A;  1T0R C;  3AE3 B;  4KVG B;  3TEY A;  1SE3 A;  1RM6 C;  1GPX A;  4DHJ D;  3Q8F A;  2LFI A;  4JPS A;  4P7I A;  2MW5 A;  1NI3 A;  4TSS A;  3U30 A;  4HJK A;  3AU5 A;  1F2R I;  1C1Y B;  2N9X A;  4JX1 C;  1STE A;  4EFO A;  2K3U A;  4HCN B;  4N6E B;  4HVB A;  3VH3 B;  4ZHP A;  2CHZ A;  2C9W B;  5CHW A;  4IWO A;  2W54 A;  2BB6 A;  1V81 A;  2JQR B;  5CTR C;  4DHZ E;  1L5P A;  2KZR A;  2MHJ A;  3GOE A;  1PYW D;  1MG4 A;  3AE9 B;  2DAJ A;  5IOI A;  3TCA A;  2WXQ A;  2UU7 A;  3BIN A;  4M0W B;  3P4P B;  4XDC A;  2WYQ A;  5CHF A;  2L32 A;  3Q8C A;  1ESF A;  3AM9 A;  2LUM A;  2IO0 B;  2QEJ C;  3O13 A;  2ZNV B;  1ZDX A;  2ZNV C;  1WMH B;  1FXA A;  2DYO A;  5G5G A;  2BKR B;  4LTU A;  2ZVO A;  2AX5 A;  2OJR A;  2JYE A;  3B2F A;  3CWI A;  1D4B A;  4GDL A;  5GMV A;  2NPT A;  3BVG A;  3ZXV A;  3NS1 A;  2IJ0 A;  1JRO A;  3R7Q A;  1MPE A;  1WZ0 A;  1SE9 A;  1T0Q C;  3HM6 X;  1J7B A;  1WIA A;  3AU4 A;  2BB5 A;  4EOY A;  1V6E A;  1B1Z A;  2KK8 A;  5FR6 A;  1IBX A;  4KSL C;  2NTS A;  2ON8 A;  3C8Y A;  3I3T B;  3L17 A;  1YQB A;  3ZUN A;  1D6E C;  1WMH A;  5T8I A;  4OZA A;  1WF9 A;  2E6X A;  2K8H A;  2WXG A;  2KWD A;  4RGM A;  4ARC A;  5E6O A;  2KO3 A;  2DZK A;  1SIJ A;  1NBF C;  1KJT A;  2JXT A;  1KH0 A;  3MHZ A;  1HEZ E;  2V0G A;  2JXX A;  4USA A;  5KHQ A;  2NBW B;  1XF5 L;  3W1Y A;  2Z59 B;  1P9D U;  2L83 A;  2OOB B;  1EWY C;  4P1C C;  3Q3N C;  4YTP B;  5LNK 1;  2C7N B;  3R2I A;  2LHE A;  2CU3 A;  4WWN A;  1E9M A;  1OQR A;  2MBE A;  1V49 A;  3R3M A;  3DOW A;  1SE2 A;  3PRM B;  2WXN A;  4PT5 A;  3AB5 A;  4WAF A;  4OHJ A;  1L0X B;  4GN1 A;  4GLS C;  2QC8 A;  2WDQ B;  2AWT A;  2IGD A;  3MHS D;  2K9X A;  1L0V B;  2L00 B;  2KJH B;  3TSS A;  2PE6 B;  2QCZ A;  4FJY A;  2MJE A;  4W9D A;  1L2N A;  2BW2 A;  4JQW C;  3AE2 B;  2J53 A;  3QAQ A;  4LDT B;  3V6E B;  3W2D A;  3R2T A;  4DQO C;  3PTF C;  1EU3 A;  5AZH A;  1KTK A;  3DVG X;  2SEB D;  3N20 C;  4US8 A;  1YD8 U;  3ETR A;  2HTM E;  2IPK D;  5HFY A;  1H8C A;  2KMM A;  4RF1 A;  4DBG A;  1KF6 B;  2JRH A;  2N9P C;  3EFU A;  1E90 A;  2LRW A;  4HEA 1;  3TEZ A;  1WWT A;  2WXF A;  1UUP A;  3ZTC A;  4BKT A;  2K0P A;  3T8M A;  2D3G A;  1MJD A;  2XN9 C;  3ML9 A;  1C4A A;  2WDV B;  3ZJU A;  3LXF A;  1HE8 A;  2MBQ A;  1TJE A;  1ZXH A;  1ZKH A;  1ISN A;  4XYC A;  3KLS X;  5L83 A;  4A9A A;  5BMH A;  1MI0 A;  1RLF A;  2KWC A;  2FID A;  4S17 A;  1T3Q A;  3T9L A;  3JYU A;  2CKH B;  2DZJ A;  1GUA B;  1TY2 A;  2NCN A;  1I4X A;  3EA6 A;  3IAS 1;  3IT6 B;  4NJ6 A;  1TKY A;  1VRA B;  2PTL A;  1HTO A;  1RFK A;  1XLN A;  3V61 A;  2KD0 A;  1RRB A;  1UWX A;  3JW0 X;  2RR9 A;  3L4P A;  4JGH B;  3NOB A;  1SF0 A;  2KLC A;  3DVG Y;  3PZ7 A;  2R61 A;  3BZD B;  2G4D B;  1A5R A;  4GDK A;  4F7Z A;  1FO4 A;  2C7H A;  3O65 B;  2K8C A;  3DVN V;  3KWV A;  3N1X C;  3B08 A;  4IW0 A;  1L4D B;  4TV3 A;  4OZC A;  5FK9 C;  3SR6 A;  3PZ8 A;  4G0N B;  4IDI A;  1E6E B;  2LJ5 A;  1ACC A;  2IO2 B;  1D5M C;  3L16 A;  2Q5W D;  3H7P B;  3DHH C;  2MRP A;  1CZP A;  3OAW A;  1KOT A;  5EE1 A;  3WAP A;  4G3X B;  4XZ4 A;  4W9G A;  4M00 A;  2KWV B;  4XX5 A;  2DLB A;  2LVO A;  3V3X A;  1K53 A;  3KUZ A;  2WGS A;  2CHW A;  3L08 A;  2DAF A;  1HZ6 A;  1RYJ A;  1Y56 A;  2QIE B;  3E9S A;  4A90 A;  2VRR B;  3R7R A;  4KIK B;  2PE9 A;  4OVV A;  3AE1 B;  1SBB B;  5DPS A;  3ABV B;  1C3T A;  3A1Q B;  3VVW B;  1D5X C;  3HK0 A;  2KDF B;  2DNF A;  1VCB A;  1C77 A;  2CR5 A;  3BK2 A;  1WRI A;  3A4S C;  4MM3 B;  4WAA A;  3OJ4 B;  4YT0 B;  3AEB B;  3RNA C;  3RCZ A;  4FXC A;  4KDI C;  1N5W A;  1V1O A;  4L23 A;  3SEB A;  4HCP B;  2JZZ A;  2KT7 A;  2IY0 B;  2B3A A;  4G50 A;  3FC4 A;  5IN7 A;  3V62 A;  4CHK A;  2PMV A;  1HZ5 A;  2WLB A;  1WGG A;  3A1Q A;  2WNM A;  4OW0 A;  1V80 A;  4PK1 A;  4DHZ B;  4ANX A;  1FXI A;  3MC0 B;  3OG5 A;  4N58 A;  1P0R A;  4MM3 A;  1TYG B;  3W1S C;  1WE6 A;  4KSK C;  1QT9 A;  3CSF A;  4GMV A;  3D32 A;  1LFD A;  3P4S B;  4NJC A;  4MGK E;  1S1Q B;  3ONS A;  2BYT A;  1OFF A;  2RDH A;  4NJ7 A;  2AQ2 B;  3VTW A;  1IP9 A;  3KUC B;  3UIO B;  3RNE C;  2JPH A;  4BOZ B;  2YVC A;  2IBI B;  1MFW A;  2IGH A;  3FAH A;  2Y5B B;  4MEL A;  1JWM D;  4RM8 A;  3RFZ B;  1DYQ A;  3Q3O C;  3EFC A;  2RDB C;  2JSV X;  1JWB D;  4W9K A;  3ZW3 A;  1LXD A;  1XD3 B;  4WIP A;  4AQ7 A;  3NVW A;  2KQS A;  3NJT A;  4FJV B;  4NAM A;  4RNA A;  4KGT A;  1FNW A;  2O6V A;  2KAN A;  2Y5P A;  1E8Y A;  3WAO A;  4N59 A;  4M01 A;  3NVY A;  2W55 A;  1XXG A;  3P42 A;  2HJ8 A;  4K3B A;  1V86 A;  1LGR A;  3BVZ A;  2A5U A;  4W9J A;  5IKC M;  3QIJ A;  1H4R A;  3KH0 A;  2X38 A;  2BKF A;  3ECI A;  1I4Q A;  2Y3A A;  2BTE A;  2W82 A;  3UIP B;  2OJW A;  2KC2 A;  2JYT A;  1YX5 B;  2KQ7 A;  4K7U A;  1OEY J;  3VFK A;  1FXT B;  4L2Y A;  3N32 A;  3H1U A;  4IC7 B;  4J6I A;  3AV8 A;  5D2M B;  4IM0 A;  3Q8A A;  3UIN B;  3MJ5 A;  2KAC A;  2RPV A;  2PVO D;  3R8B A;  4WJQ A;  2YLM A;  3PHX B;  3NUH B;  4URK A;  1PFD A;  1V8C A;  2VZK B;  4EZK A;  1YOV B;  4KZC A;  3TMP B;  1MHH E;  3IVF A;  4LNF A;  1J7A A;  4W9H A;  4MGY E;  4EEW A;  3WAM A;  2FBW B;  2LGI A;  4ICU A;  2MH7 A;  3KYC D;  3ZGZ A;  1YQ4 B;  1J19 A;  2CHX A;  1GC7 A;  4KKJ A;  2UYZ B;  1QLB B;  5AZG A;  2TSS A;  3DVN U;  3JVZ X;  1BT0 A;  2JUO A;  1YNT E;  3ZLZ A;  1FRR A;  2ZZP B;  4BFR A;  2WX1 A;  3PRZ A;  4XDD A;  4WJP A;  2WXO A;  4NY0 A;  3EGR A;  1WGR A;  4LK0 M;  1EUV B;  3V6C B;  3RNG C;  2L52 A;  3J9C A;  1FMA D;  1TKG A;  3NZ3 A;  2K1F A;  1TIF A;  1JML A;  2G45 B;  4B0E A;  2N1V A;  4ZRQ A;  2D3C A;  5J17 A;  1ZW7 A;  5H8Y E;  4C00 A;  4DWF A;  3AN1 A;  1ET6 A;  3RI7 C;  1WXM A;  1SE4 A;  4WWM A;  1JWU D;  1SGH A;  1UEL A;  4K7S A;  1AYF A;  2INP E;  4LNK A;  3RD2 A;  1WGH A;  2BQQ A;  1NEK B;  5D94 A;  3QK0 A;  3U4E G;  4HPP A;  3PLV A;  4RH6 A;  4ANU A;  1VR9 A;  3HVD A;  3ZNZ B;  4YTM B;  3C19 A;  4P16 A;  1R4N I;  4HKQ A;  3DBH B;  2WXR A;  4C80 A;  4P1B C;  3H9D A;  4MGI E;  4AWJ A;  4Q2J A;  2LAS A;  2KX0 A;  4A3P A;  2KFK B;  1CK1 A;  2I1K A;  2OHF A;  3ENE A;  2JF5 A;  2M19 A;  4FA6 A;  1FCL A;  2FAZ A;  2W3S A;  3Q2A C;  2O6V D;  1WM3 A;  3QJZ A;  2IDY A;  3NVV A;  1Q0W B;  4KDL B;  3P63 A;  1WE7 A;  4LCD E;  1XLP A;  2DZI A;  1JQ4 A;  2RPQ A;  2RMM A;  4B95 A;  4YSX B;  4DDI D;  4HPM B;  2FCQ A;  4HJG E;  4M0W A;  2JWU A;  1UH6 A;  4L1B A;  3VRA B;  2KFK A;  3RUI B;  4GXB A;  1TS4 A;  2KMC A;  2IGG A;  3QC8 B;  2PW9 A;  1JWA D;  2K5P A;  2MBB B;  4ITK A;  4BKS D;  4PS3 A;  3ZNG C;  4LNI A;  1GNU A;  2NMQ A;  3GB1 A;  1WXQ A;  4RGN A;  1JRP A;  4BBN C;  1I4R A;  2FCM A;  2MX2 A;  4WH4 A;  3I63 C;  3I9V 1;  1FPY A;  3KWL A;  3EEC A;  4I6N B;  2KJR A;  1TS3 A;  3B9J A;  4C56 C;  2K6Q A;  1ZXI A;  4BKG A;  3ZTD A;  1FEH A;  2CJN A;  3GE3 C;  3ZXR A;  3I57 A;  5CX3 A;  2EMS A;  4QAY A;  1V9J A;  4EKU A;  1K51 A;  4J3O D;  4US9 A;  4FBJ B;  1F2R C;  3DWG C;  4HKZ E;  1G6J A;  2AL6 A;  1P1A A;  1XLO A;  4NQK E;  4WWP A;  1AAR A;  3HUI A;  4RCO A;  3NVZ A;  2KN5 A;  2BYF A;  4ZDV A;  4ACF A;  4MH0 E;  1GC6 A;  3TL5 A;  5BYS A;  2KHW B;  3MTN B;  3NHE B;  3E56 A;  2D07 B;  1KLU D;  3N1Z C;  4JL9 A;  3DBL B;  3SD5 A;  2G9H D;  5DPR A;  2GLS A;  3AEA B;  1ROE A;  2M56 B;  2KDB A;  1ET9 A;  3Q3F A;  1AW7 A;  1FD6 A;  1IGC A;  4DXA B;  3TUO A;  2C60 A;  5G55 A;  5IP4 D;  2A4Z A;  2HE7 A;  4XWW A;  4FAD A;  4JWU C;  1P7F A;  2O2V B;  4LJP B;  5LXI B;  2YEP F;  1WJ4 A;  1IYF A;  2I2Y A;  1N5X A;  1EO6 A;  4RGT A;  1CJE A;  2J0J A;  1QOF A;  2KMA A;  1PGA A;  2V4I B;  1SJE D;  2UWQ A;  2MA9 B;  1N62 A;  2WXH A;  1TBE A;  3ZJT A;  4W9E A;  2HD5 B;  3IBE A;  2N9E B;  4W9C A;  1WGK A;  1YN5 A;  1JCK B;  1FCC C;  2CJO A;  1NEN B;  1WSP A;  2DZM A;  2N7J A;  3IT4 B;  3RN9 C;  1ZUD 2;  2KTF A;  1I4G A;  4I6P A;  3M62 B;  1FNV A;  4JE3 B;  2C7M B;  1EU4 A;  3ALB A;  1DOY A;  2AQ1 B;  3AE5 B;  3U2S C;  1LO5 D;  2GMI C;  2AEH A;  4E74 A;  5AUI A;  4AJW A;  2MJD A;  1N63 A;  1UGJ A;  4HLE A;  4EZJ A;  2I1J A;  3DCG A;  3HVZ A;  3U52 E;  2EKI A;  1I7H A;  4YL8 A;  3DBR I;  4RFB A;  4IM3 A;  2G4S A;  2D5G A;  3B0A A;  1ZPS A;  3H8H A;  2LGY A;  4A55 A;  4AUQ C;  4PS8 A;  3DPD A;  1D3Z A;  1F1H A;  1K52 A;  1T0Y A;  2INC C;  2D10 A;  4ZYN A;  2JRI B;  3SDL C;  3VXW A;  1WXA A;  5D3I B;  2V4L A;  4OVZ A;  2QMT A;  3M95 A;  3OLM D;  3PRE A;  2BVC A;  1KRH A;  3W5U B;  4HK2 A;  5J2R A;  1PUT A;  2K25 A;  5D7G A;  2MWS B;  1E7U A;  3CMM B;  3Q14 C;  2XK5 B;  5GXG B;  3ZVV A;  4IG7 B;  3VTV A;  1MHX A;  4XC2 A;  1E8Z A;  3T3N A;  1SIF A;  1M94 A;  3SFE B;  4FLH A;  5DCN A;  5D6J B;  2M1M A;  3LYY A;  3AE4 B;  4HDO A;  2ZW0 A;  1QOA A;  3ZRC A;  1WM2 A;  1YJ1 A;  2GBR A;  2V3N A;  2J0K A;  4A6Q A;  3H7P A;  3AE6 B;  2GBK A;  3VQI A;  1K50 A;  4A20 A;  4H2A A;  1R4M I;  2J52 A;  2LJI A;  3KUD B;  1T6B X;  1L7Y A;  4MJS B;  3RPF C;  2WX0 A;  3RMK C;  2DYM A;  1XLQ A;  5G2N A;  4RMA A;  4B0M A;  2W9N A;  1M4V A;  2XK5 A;  3NZU A;  4KIK A;  1P7E A;  1DOX A;  1WYW B;  2LGS A;  1ZDV A;  2L76 A;  2KVR A;  2BYE A;  5C3J B;  1BML C;  2WWZ A;  2FUH B;  1FRD A;  5EE0 A;  1QF6 A;  1QIL A;  4BZA A;  3IG3 A;  2PLP A;  3UF8 A;  4DHJ B;  3KYD D;  2IY1 B;  1OQY A;  1J7C A;  1D5Z C;  1YMH E;  4NNJ B;  5JXV A;  4M8N A;  3MJW A;  4F1S A;  1E8W A;  2MCN B;  4KZ0 A;  1FIQ A;  1TS2 A;  3EC8 A;  2L0T A;  2ZW1 A;  2RGF A;  1F77 A;  4KX6 B;  1DGJ A;  5EE9 A;  1I4H A;  1ZGU B;  2DYB A;  3GZN I;  1X1M A;  3AI5 A;  2BS2 B;  1YQ3 B;  4LDT D;  4IOI E;  2PIA A;  4C4V B;  2FCN A;  3NY5 A;  1PDX A;  1UZX B;  2KXJ A;  3A9J B;  3QCA A;  4ICV A;  3QAR A;  2L3Z A;  3Q3M C;  3W1S A;  3CF6 E;  3LB8 C;  4ZRK A;  4EUT A;  2YEP B;  4HWI B;  2WDT B;  3SFD B;  5JHA A;  3QX1 A;  2M8S A;  1E8X A;  4YXD B;  1FFU A;  1S3S G;  2CS4 A;  3Q8B A;  4OZB A;  4HPL B;  4S0R A;  2DEN B;  4FN2 A;  2WDR B;  2ONQ A;  2INN E;  1HTQ A;  1WXV A;  1WJ6 A;  4W9I A;  2MBH A;  2G3Q B;  2M17 A;  4G11 A;  1I42 A;  5E6J A;  4ARI A;  3VUX A;  1VD2 A;  2ZCB A;  1XCQ L;  4WUR A;  4LLG M;  2DHZ A;  3IHP C;  4GB9 A;  2AYO B;  3SU8 X;  2VH2 A;  3AED B;  2M4N A;  3LDZ E;  4TKN A;  3ML8 A;  2LD9 A;  5CHV C;  2J42 A;  1WR6 E;  4GSW A;  4HRO A;  2WU5 B;  3B2G A;  1VZ8 A;  3L13 A;  1XQQ A;  3MFG A;  1MG8 A;  5HI1 A;  2MP2 B;  1TTN A;  1OEY A;  1P3Q U;  1GG3 A;  2KTR B;  2MQJ A;  1N6Z A;  3N1Y C;  2LEK A;  3H6N A;  4W9F A;  1VDV A;  2CU1 A;  1L6V A;  1LQB A;  3C0R B;  3H7S A;  3VRB B;  1SB3 C;  4MEM A;  2KVZ A;  4IWP A;  5C23 A;  2K8B A;  1NDD A;  1F0Z A;  3P4Q B;  1XCT L;  1ZP0 B;  1WXS A;  2KYW A;  4IWQ A;  4MSQ B;  3PGE A;  1YJI A;  5EDS A;  4CQN A;  4I6L B;  3Q6B A;  3ZO5 B;  4K3C A;  2HTH A;  3VR8 B;  4JLC A;  3PPA A;  5TSS A;  3VTU A;  4ZOH C;  2KTR A;  1IUE A;  1V5T A;  4A8X C;  2BT6 A;  4C7Y A;  1ZOY B;  4YSY B;  5LLI A;  4M02 A;  1HXY D;  2V3P A;  4O1N A;  3AUL A;  4MDK E;  5IA7 A;  2ASQ A;  3SHQ A;  3UQB A;  1SXT A;  3TIX A;  4AOF A;  2BPS A;  3L0W B;  1TZ1 A;  5BYR A;  2IND C;  2KJ6 A;  3IXS A;  3AE7 B;  5AUK A;  1J0G A;  2Z0E B;  2RD0 A;  2DWQ A;  2X8X X;  1U4A A;  3KVF B;  1UBQ A;  2I38 A;  2WP9 B;  5HHD G;  2H88 B;  3VAW A;  2L0F A;  3Q3J A;  4EE2 A;  3V60 A;  2BWF A;  4PYU A;  3PSE B;  4CO7 A;  5JZE B;  2KX3 A;  4IM2 A;  1RFA A;  2KOX A;  3UI3 A;  1GB1 A;  2EKE C;  4MH8 A;  3U7Z A;  2JX5 A;  3QQ8 B;  1QZE A;  4LJO B;  1YIW A;  5JHB A;  2BS4 B;  3BY4 B;  2QSD A;  4IUM B;  2WXJ A;  4UDU C;  1L0Y B;  4GDL B;  2NPT B;  4WQM A;  1FNU A;  3DHI C;  3NRZ A;  5IO9 A;  1JAL A;  2J0M A;  2QIL A;  4XE0 A;  1AWD A;  3EUB 2;  1NYQ A;  1V97 A;  3DBL I;  5D3D A;  2PVG C;  4TUU A;  1WR1 A;  1IBX B;  3ZYY X;  3A33 B;  1VZ6 A;  1L4Z B;  4AP4 C;  3I5J C;  1V2Y A;  2FNJ B;  5HKH A;  3Q69 A;  2M0X A;  1VJK A;  1T5X D;  5E6P A;  1QQR A;  1QOG A;  3LJ3 A;  2KN4 A;  1Z2M A;  3K9P B;  2W3R A;  3PLU A;  3PHW B;  5E6N A;  2D11 A;  1C9F A;  5KHO A;  4E71 A;  3TEW A;  5I4D A;  2E3T A;  4ZRI A;  3ZDM C;  3DHG C;  4FHJ A;  1EF5 A;  1PGB A;  3DQV A;  3VHT C;  1WX8 A;  4LNN A;  1IPG A;  5DPT A;  4DXF A; 
#chains in the Genus database with same CATH homology
 2AEH A;  4E74 A;  4AJW A;  3VDZ A;  3EHV A;  1KM7 A;  2IO1 B;  5AZF A;  1LM8 B;  2GOW A;  2LZ6 A;  3IFW B;  5TR5 A;  4EZJ A;  4HLE A;  2N4F A;  2I1J A;  2ZPN A;  2JVC A;  5J18 A;  2BGF A;  3R66 C;  3RT3 B;  2REX A;  3DCG A;  1WX9 A;  2LXC A;  4W9L A;  3PVL A;  1WH3 A;  4YL8 A;  3DBR I;  4NJ7 A;  3VTW A;  4IM3 A;  1IP9 A;  2G4S A;  3KUC B;  2GBJ A;  3UIO B;  3B0A A;  2KLG A;  3OJ3 A;  5JH5 C;  4K81 A;  2LGY A;  2JPH A;  4BOZ B;  4AUQ C;  4PS8 A;  3VUW A;  1P98 A;  2R2Q A;  4X57 B;  3DPD A;  3RZF A;  2YVC A;  4GOC A;  1D3Z A;  2IBI B;  1E5W A;  5C1Z A;  1T0Y A;  2LI5 A;  3AXC A;  2AL3 A;  4FJZ A;  3VUY A;  2Y5B B;  2D10 A;  4MEL A;  4ZYN A;  1WJU A;  2JRI B;  3SDL C;  3VXW A;  1WXA A;  2V4L A;  4RM8 A;  1TGZ B;  2MSE D;  3N30 A;  2KKC A;  3M95 A;  2QHO A;  3OLM D;  4M8M A;  1J8C A;  3PRE A;  1UD7 A;  4KVG B;  4W9K A;  3ZW3 A;  1LXD A;  3B1L X;  4HK2 A;  1XD3 B;  4DHJ D;  5J2R A;  4GU2 A;  3WAL A;  2K25 A;  4P7I A;  5D7G A;  2KQS A;  4FJV B;  2MWS B;  1E7U A;  2MW5 A;  3U8Z A;  3CMM B;  1WI0 A;  5IAA C;  2O6V A;  3ZNH B;  2KAN A;  2XK5 B;  2DX5 B;  3U30 A;  2KNB A;  3PV1 A;  4HJK A;  4IG7 B;  3ZVV A;  2XBB C;  3AU5 A;  2N7E A;  1C1Y B;  1Q5W B;  2N9X A;  1E8Y A;  3VTV A;  4EFO A;  3KW5 B;  4HCN B;  4XC2 A;  3WAO A;  1E8Z A;  1SIF A;  1M94 A;  4ANV A;  4FLH A;  5DCN A;  5D6J B;  4HVB A;  2M1M A;  3VH3 B;  4HDO A;  2CHZ A;  3ZRC A;  1WM2 A;  1YJ1 A;  2C9W B;  2GBR A;  2K6D B;  3DBS A;  2BYV E;  2J0K A;  2Z0D B;  5CHW A;  3H7P A;  4IWO A;  3HIZ A;  2HJ8 A;  1V86 A;  1V81 A;  2GBK A;  2A5U A;  4W9J A;  5CTR C;  2N1W A;  5BO4 B;  3VQI A;  3QIJ A;  4A20 A;  1R4M I;  1H4R A;  1V5O A;  2KZR A;  3KH0 A;  2LVQ A;  2KDI A;  2JT4 B;  3GOE A;  3KUD B;  2BKF A;  3ECI A;  2LXA A;  1L7Y A;  4MJS B;  2C5L C;  4TQ0 A;  2WX0 A;  2DAJ A;  4MGZ E;  3UIP B;  2DYM A;  5G2N A;  3JSV B;  4RMA A;  3TCA A;  3BIN A;  4M0W B;  2KC2 A;  2W9N A;  1YX5 B;  2KQ7 A;  4K7U A;  4DDG D;  1OEY J;  2WYQ A;  2XK5 A;  3VFK A;  5CHF A;  3NZU A;  3PZD A;  1FXT B;  3N32 A;  5DPW A;  5LXH A;  4KIK A;  3H1U A;  2IO0 B;  4IC7 B;  4J6I A;  4TQ1 A;  1WYW B;  2L76 A;  1WFY A;  2ZNV B;  5D2M B;  4DK5 A;  2KVR A;  2BYE A;  2ZNV C;  1WMH B;  3A9K B;  2DYO A;  4IM0 A;  2BKR B;  1JRU A;  2OJR A;  2ZVO A;  2WWZ A;  3UIN B;  2FUH B;  2KFJ A;  4HXD A;  4JIO U;  4GDL A;  1WY8 A;  2KC1 A;  2NPT A;  5GMV A;  2XEW A;  3IG3 A;  3UF8 A;  4WJQ A;  4DHJ B;  3KYD D;  2IY1 B;  2BF8 B;  2JY6 A;  4GIV A;  1OQY A;  2YLM A;  3PHX B;  3R7Q A;  4NNJ B;  1WZ0 A;  4URK A;  1SE9 A;  2LVP A;  4M8N A;  2O2V A;  3MJW A;  3HM6 X;  1E8W A;  4F1S A;  4EZK A;  4KZC A;  1WIA A;  3IVF A;  2MCN B;  3TMP B;  2L8J A;  4W9H A;  4KZ0 A;  1YX6 B;  3AU4 A;  4GDK B;  3UQA A;  4ASW C;  4MGY E;  3EC8 A;  3JSV A;  3WA0 A;  4EEW A;  4EOY A;  2L0T A;  3WAM A;  1V6E A;  4ICU A;  1WRD B;  2KK8 A;  2RGF A;  5FR6 A;  3KYC D;  4KSL C;  1J19 A;  2ZVN A;  1F9J A;  2V3S A;  3WIM A;  1ZGU B;  2DYB A;  3GZN I;  1X1M A;  2CHX A;  3AI5 A;  3I3T B;  1YQB A;  1GC7 A;  3L17 A;  4FUL A;  2UYZ B;  3ZUN A;  1WMH A;  3A9K A;  4A3O A;  4LDT D;  5AZG A;  3RYT A;  4B9K A;  1WF9 A;  2FCN A;  2K8H A;  3NY5 A;  2KDE B;  3DVN U;  3JVZ X;  1BT0 A;  2JUO A;  1UZX B;  1PQS A;  2KXJ A;  3A9J B;  3QCA A;  3ZLZ A;  1WX7 A;  2ZZP B;  3QAR A;  4ICV A;  2L3Z A;  4BFR A;  2WX1 A;  5E6O A;  2KO3 A;  3PRZ A;  2DZK A;  3W1S A;  1NBF C;  1KJT A;  3CF6 E;  4WJP A;  4NY0 A;  4ZRK A;  3NZS A;  1WGR A;  4EUT A;  4ZRJ A;  1EUV B;  2JXX A;  3V6C B;  4HWI B;  3QHT A;  5KHQ A;  3ZNI D;  2NBW B;  2WDT B;  5JHA A;  3QX1 A;  2M8S A;  2Z59 B;  3W1Y A;  1P9D U;  2K1F A;  1E8X A;  2OOB B;  2G45 B;  1WGY A;  1KLV A;  2N1V A;  3ZDT A;  2C7N B;  1S3S G;  3QWZ B;  2D2Q A;  4WWN A;  2CS4 A;  5J17 A;  2MBE A;  1V49 A;  1ZW7 A;  4N9F 4;  4HPL B;  3R3M A;  3DOW A;  4CYE A;  4DWF A;  1GJZ A;  2DEN B;  4FN2 A;  3PRM B;  1WXV A;  1WXM A;  1WJ6 A;  4W9I A;  2MBH A;  2NS5 A;  1SGH A;  1UEL A;  2G3Q B;  3HHM A;  2M17 A;  4G11 A;  4K7S A;  1I42 A;  4GN1 A;  4GGQ A;  2AWT A;  3ZRF A;  3MHS D;  3RD2 A;  3VUX A;  2L00 B;  1VD2 A;  2ZCB A;  2KJH B;  1WGH A;  2PE6 B;  4FJY A;  4W9D A;  5D94 A;  3QK0 A;  2DHZ A;  1L2N A;  3PLV A;  3IHP C;  4JQW C;  4GB9 A;  1I35 A;  2AYO B;  3QAQ A;  4LDT B;  3SU8 X;  2J7Q B;  2IO3 B;  3V6E B;  4ANU A;  2NBU A;  4MSM B;  2M4N A;  3LDZ E;  4TKN A;  3PTF C;  3ML8 A;  5AZH A;  3ZNZ B;  2LD9 A;  4AJY B;  3DVG X;  2L05 A;  4KV2 A;  5CHV C;  1XT9 B;  4OVU A;  1R4N I;  1WR6 E;  4GSW A;  1YD8 U;  3L13 A;  3H9D A;  1OGW A;  1XQQ A;  1MG8 A;  4MGI E;  4AWJ A;  1H8C A;  2LAS A;  2KX0 A;  2MP2 B;  2NBV B;  1TTN A;  3DDC B;  4A3P A;  2KFK B;  4DBG A;  2I1K A;  1OEY A;  3ENE A;  2JRH A;  3M3J A;  1P3Q U;  1GG3 A;  2JF5 A;  2KTR B;  2N9P C;  4FA6 A;  3EFU A;  1E90 A;  2MQJ A;  3NS8 A;  2LRW A;  4PS7 A;  2FAZ A;  3ZTC A;  4BKT A;  3H6N A;  3PS6 A;  3T8M A;  2D3G A;  3RZW C;  4W9F A;  2O6V D;  3K9O B;  1WM3 A;  3ML9 A;  3QJZ A;  2CU1 A;  1LQB A;  2IYD B;  3C0R B;  3H7S A;  1HE8 A;  3APC A;  1Q0W B;  2MBO A;  2MBQ A;  3CST A;  4IWP A;  4KDL B;  2K8B A;  4MEM A;  5C23 A;  1WE7 A;  4LCD E;  1ZKH A;  1ISN A;  1NDD A;  1WGD A;  2DZI A;  2RPQ A;  5L83 A;  4B95 A;  4MJS A;  1WXS A;  4IWQ A;  4MSQ B;  1RLF A;  3PGE A;  2KWC A;  4HPM B;  2FCQ A;  4DDI D;  3A4R A;  5EDS A;  4I6L B;  2FID A;  1RAX A;  3T9L A;  3JYU A;  1UH6 A;  2CKH B;  1NI2 A;  2LGD A;  3ZO5 B;  1WZ3 A;  2HTH A;  2KFK A;  4JLC A;  3RUI B;  4GXB A;  3PPA A;  3VTU A;  2DZJ A;  1GUA B;  2KTR A;  2LGX A;  4WWO A;  1V5T A;  4NAW B;  2NCN A;  2KMC A;  3M63 B;  3QC8 B;  4NJ6 A;  2MBB B;  4K1R B;  3X0W A;  4BKS D;  1K8R B;  4FHK A;  4PS3 A;  3ZNG C;  1GNU A;  2ZJD A;  3U7D A;  5LLI A;  3V61 A;  4DHZ E;  2KD0 A;  2KWU B;  4BBN C;  4WQO B;  1RRB A;  3S2A A;  3AUL A;  4MDK E;  2FCM A;  5IA7 A;  2ASQ A;  1E7V A;  2MX2 A;  3JW0 X;  3SHQ A;  2ZEQ A;  2RR9 A;  1UGM A;  4JGH B;  3UQB A;  3NOB A;  2KLC A;  3EEC A;  3DVG Y;  4I6N B;  3TIX A;  4AOF A;  2BPS A;  2KJR A;  3L0W B;  2G4D B;  1A5R A;  1TZ1 A;  4GDK A;  2K6Q A;  4F7Z A;  2C7H A;  3ZTD A;  3O65 B;  2KJ6 A;  4NPN A;  2K8C A;  1OTR B;  3DVN V;  3HM3 A;  4BKG A;  3B08 A;  4IW0 A;  2R2O A;  1Z5S B;  5CX3 A;  2O6V B;  4TV3 A;  4II3 B;  2EMS A;  3WAN A;  4NAW A;  1J0G A;  1V9J A;  2Z0E B;  4EKU A;  1WJN A;  2RD0 A;  5DPT A;  4FBJ B;  1U4A A;  4G0N B;  3KVF B;  1UBQ A;  3APD A;  1G6J A;  2AL6 A;  2LJ5 A;  1P1A A;  2IO2 B;  4NQK E;  4WWP A;  3L16 A;  3VAW A;  1CMX B;  2L0F A;  1AAR A;  4BOS C;  3Q3J A;  3APF A;  3H7P B;  2MRP A;  3A9J A;  2MLB A;  2ZCC A;  3V60 A;  2GBN A;  2GBM A;  2KN5 A;  3OAW A;  2BYF A;  3TBL D;  2BWF A;  4ZDV A;  1KOT A;  2LUE A;  4WJO A;  4PYU A;  4MH0 E;  1GC6 A;  3PSE B;  4PYZ A;  3VH4 B;  3WAP A;  4CO7 A;  4HDQ A;  4G3X B;  3TL5 A;  5JZE B;  2KX3 A;  4IM2 A;  3L54 A;  4XZ4 A;  3PT2 B;  2KHW B;  4W9G A;  4BVU C;  4F8C B;  1RFA A;  2KOX A;  3MTN B;  2KWV B;  3NHE B;  3QA8 A;  4ANW A;  4XX5 A;  2LVO A;  2EKE C;  3KUZ A;  3ZIM A;  2D07 B;  2NR2 A;  4JL9 A;  2IZV B;  4K7W A;  2CHW A;  3QQ8 B;  3L08 A;  2DAF A;  3SD5 A;  3RUL A;  1QZE A;  4LJO B;  5DPR A;  2ZPY A;  1YIW A;  2VRR B;  3R7R A;  2LWP A;  4KIK B;  3UGB B;  5JHB A;  3BY4 B;  4IUM B;  2KDB A;  3Q3F A;  2PE9 A;  4OVV A;  4B6W A;  5DPS A;  4WJN A;  1C3T A;  3A1Q B;  2N7D A;  3VVW B;  4GDL B;  4DXA B;  2C60 A;  2L7R A;  3HK0 A;  2NPT B;  5G55 A;  2A4Z A;  2HE7 A;  2KDF B;  4BBN F;  3X23 A;  1VCB A;  4EZL A;  2CR5 A;  2J0M A;  2V1Y A;  3A4S C;  4FAD A;  4II2 B;  4WAA A;  3OJ4 B;  2O2V B;  3RCZ A;  4KDI C;  4LJP B;  3PRP B;  5LXI B;  3P2B A;  1Y8R C;  1WJ4 A;  3DBL I;  1IYF A;  1EO6 A;  4HCP B;  2LRU A;  2J0J A;  2JZZ A;  4BKS A;  2KMA A;  1WR1 A;  2IY0 B;  4TUU A;  2B3A A;  5AEK B;  1Q1O A;  4G50 A;  3A33 B;  3TJP A;  2PEA A;  4AP4 C;  3DBH I;  1V2Y A;  3V62 A;  1EF1 A;  2JZ3 B;  2FNJ B;  2NVU I;  2UWQ A;  3L10 B;  2MA9 B;  2M0X A;  4CHK A;  5HKH A;  1TBE A;  1WGG A;  2RSU A;  4W9E A;  2JWZ A;  2HD5 B;  2BWE S;  3IBE A;  2N9E B;  3A1Q A;  4W9C A;  5E6P A;  3N3K B;  3ZKJ C;  1V80 A;  2MP2 A;  2PJH A;  4DHZ B;  4ANX A;  2K39 A;  3LJ3 A;  2PPH A;  1Z2M A;  3K9P B;  3PLU A;  3PHW B;  5E6N A;  2DZM A;  2EMT A;  2D11 A;  1P0R A;  2KTF A;  5KHO A;  4MM3 A;  5L95 C;  4E71 A;  4E3C A;  4I6P A;  3M62 B;  2FCS A;  3W1S C;  1WE6 A;  4KSK C;  2C7M B;  4ZRI A;  3ZDM C;  1UBI A;  4FHJ A;  1EF5 A;  3CSF A;  3DQV A;  3ALB A;  1LFD A;  3D32 A;  4GMV A;  1WX8 A;  4NQL B;  3VHT C;  4MGK E;  4RM9 A;  1S1Q B;  1IPG A;  3ONS A;  2FIF A;  2GMI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...