4LLGM

Crystal structure analysis of the e.coli holoenzyme/gp2 complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
50
structure length
50
Chain Sequence
b'KFWATVESSEHSFEVPIYAETLDEALELAEWQYVPAGFEVTRVRPCVAPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Phage T7 Gp2 inhibition of Escherichia coli RNA polymerase involves misappropriation of sigma 70 domain 1.1.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 8
structure length 50
sequence length 50
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF16857 RNA_pol_inhib RNA polymerase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.510 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4llgM00
2LMCA 4LK0M 4LLGM 2WNMA
chains in the Genus database with same CATH superfamily
3IAS1 1C9FA 4R3DA 2KJ6A 1SSNA 1A5RA 2IGHA 5E6NA 2HD5B 4YWGG 1EM7A 4RCOA 2LGSA 2NVUI 1X1MA 1FPYA 3PREA 4IDIA 2DAFA 2IY1B 2M0XA 4BVUC 1IBXB 3EGRA 3EA6A 3TMPB 3N20C 1GC6A 2K6DB 3Q3NC 3FKYA 1LQBA 1YD8U 2KYWA 3IG3A 2BB5A 1IUEA 2WGSA 4B6WA 1UGMA 1D5MC 1P7EA 5IOIA 4GIVA 1JROA 3A9KA 5BYSA 2HTHA 1GPXA 5IP4D 1SIFA 2OJRA 3W5VB 3DHIC 1FM0D 2IJ0A 3RUIB 4RM8A 1R4NB 1E8YA 2WNMA 3I5JC 4LNIA 1CZPA 1L5PA 3L08A 2G45B 2MBHA 3A4RA 2WXGA 4A8XC 1R7SA 1B1ZA 2FIDA 1C4CA 4LLGM 2WXLA 1V80A 2QSDA 1TKEA 3V05A 3NY5A 3VH3B 3GB1A 4EKUA 2GMIC 2JSVX 3R2TA 1Z2MA 5TSSA 2ACZB 4XDCA 1WJUA 2BS2B 4HPPA 2MJDA 3VRAB 4HVBA 1FFUA 1ET6A 4JWSC 3WIMA 1EF5A 4YL8A 4C56C 3NS1A 3DWMA 1C77A 4ZRIA 4E3CA 3TUOA 1E90A 4MDKE 2BWFA 2IO1B 3Q8EA 3ZJVA 1PGBA 3B2FA 5E6OA 4URKA 3QARA 3J9CA 4AQ7A 5DCNA 2PEAA 3NS8A 4A3OA 5KHQA 2L0TA 2FCMA 1I7HA 5C1ZA 1K51A 1YQ4B 1OQQA 2FCSA 2J4XA 1MHHE 2C60A 2L05A 2LVPA 3PHXB 4G11A 3B9JA 2PVGC 2KWVB 1WGRA 2WDVB 1LM8B 1WE6A 1NI2A 3DCGA 4S17A 1YNTE 1KFYB 1RLFA 1XQQA 1I4RA 2G9HD 2KVRA 4YXDB 4WIPA 3Q8FA 2LI5A 4MM3A 3A9KB 1WGDA 2N9PC 2WXNA 2OEDA 3PSEB 1FMAD 2MWSB 1P98A 2FNJB 2LZ6A 1FRRA 3DVNV 1J19A 4FA6A 3WALA 3KW5B 2IPKD 3W9CB 1QZEA 4EZLA 2L3ZA 4WJPA 4RGTA 2NPTA 1P3QU 2KACA 3UQAA 2X8XX 4NPNA 4ZDVA 5LXIB 1JCKB 2KC2A 2BYEA 2BWES 1F52A 4W9IA 3Q3FA 4IM2A 3H6NA 4BAXA 3AE5B 3VUXA 3LXFA 3L16A 4A3PA 4X57B 5CX3A 1TS2A 4TQ1A 4HDOA 2ICIA 2ZVOA 4JE3B 1XLPA 3V6CB 4W9KA 4MGIE 2KT7A 3C8YA 2MA9B 3DBSA 1YN4A 3D32A 2B76B 2DYOA 1MG8A 3AE4B 3I3TB 5LXHA 1NENB 1NYQA 2N7DA 2JXXA 4WURA 2PTLA 3GE8C 2LFIA 2AQ1B 3N1ZC 1P7FA 2SEBD 1V1OA 4HJGE 2VRRB 3ZJTA 2BPSA 2XNAC 2MCNB 2JYEA 1JMLA 3IBEA 2K3UA 3BZDB 3PPAA 2N9XA 5D7GA 4W9LA 5BMIA 1WYGA 4US9A 4II3B 3FC4A 4DDID 4TMAB 3EUB2 2WU2B 1TS5A 2KLCA 1ZW7A 2KHWB 4CYEA 5MPOA 4YSYB 3O65B 1D5XC 3FILB 4MM3B 2JPHA 3HK0A 1FNVA 1NDDA 3DVGX 4HWIB 3ZKJC 4IWQA 2B3AA 3KH0A 3DBHB 2BB6A 1RFAA 4A9AA 2KXJA 3X0WA 3MP9A 3JW0X 1IYFA 5BYQA 3Q3JA 1JQ4A 1I4QA 2MQJA 3UGBB 3C19A 4J3OD 1WXMA 1U4AA 5G5GA 2C7HA 4WAAA 3RYTA 3PVLA 1K53A 2WXFA 3AE6B 2BTEA 4YSXB 3AE7B 2KZRA 3DVNU 2I1KA 5G5HA 4ITKA 3A1QB 4MJSB 4QAYA 4LTUA 3W5UB 3CMMB 2WXMA 3VUWA 4A55A 4HK2A 4YTPB 2KJRA 4PT5A 3VQIA 1NVID 2O6VD 5D6JB 2LXCA 1C4AA 2KOXA 2D10A 4WJOA 1NI3A 4BBNF 1Y8RC 2YVCA 3P2BA 1F2RI 2L7RA 4F8CB 3I57A 3ZQ4A 2MSED 2IYDB 4K7UA 3SD5A 2NTSA 2XN9C 1L6VA 1F1HA 2KN5A 2DWQA 1R4NI 4L2YA 1UBQA 4J6IA 1HTOA 2MBBB 2N9EB 3GS2A 1WXVA 1WXSA 2R61A 4KVGB 1L0VB 3JSVB 1RYJA 1RM6C 1L7YA 3AEEB 1WRDB 4KV2A 3AE3B 4I6NB 3DVGY 4DXGA 5CHWA 4GU2A 2EKEC 2IGDA 1FXIA 2INCC 2LEKA 2GOWA 2KDBA 4DXFA 4B9KA 2KFKA 2LHEA 5JH5C 2DZMA 4CHKA 2AL3A 5CHVC 3ZUNA 1J7BA 3NHEB 2I38A 1C79A 4PYZA 1V8CA 1C3TA 3KUCB 1I4XA 2REXA 2FAZA 3TBLD 3DHGC 2XK5A 2PPHA 1HEZE 1XEEA 1MG4A 2JU6X 2O2VB 1M4VA 3SU8X 2CHWA 2I1JA 1P0RA 1LO5D 2WHIA 3APDA 5FR3A 2W54A 1TY0A 1E8XA 2G4SA 3H1UA 4IM0A 3PS6A 4W9EA 1VRAB 2GBMA 4P1BC 3R66C 3ZW3A 1MJDA 1VCBA 3GZNB 3PRPB 2MW5A 2INNE 3QCAA 2RPQA 1WR6E 3PV1A 3ZNID 1QOFA 3PT2B 3ZGZA 3UF8A 3SFEB 2NR2A 3ZNGC 2R2QA 3RNCC 4JGHB 2IBIB 2BKFA 2M1MA 3RNGC 4FHJA 1TBEA 3RULA 4XGAB 2D07B 2NS5A 3UIOB 1SE9A 3AEAB 2KKCA 2A5UA 3R7RA 3L54A 3BVGA 2KTFA 4KKJA 4II2B 4HPMB 1I4HA 1OFFA 3BK2A 4RMAA 2WWZA 3RD2A 2Y5CA 1C78A 4TKNA 1V9JA 2JRHA 2MBOA 4ANVA 4C4VA 3IT4B 5E6JA 3KUDB 1YQBA 1GB4A 1J7AA 1WGKA 1SE2A 2RD0A 2R2OA 2WX0A 1V86A 1PYWD 2INPE 2QMTA 3ETRA 1E7VA 2K1FA 4S0RA 1FD6A 3H9DA 3DWGC 1YOVB 2LMCA 3AULA 3O13A 1GOZA 1VJKA 2W9NA 4MACA 5CHFA 3UQBA 2L32A 1TZOA 4HROA 1BXTA 2DENB 1L4DB 2WQYB 2KMAA 3DBRI 1L0XB 4ZOHC 4YTNB 1MVKA 2HJ8A 3ZNZB 3QAQA 3ZLZA 4MELA 2WP9B 5DPWA 2WXQA 3NRZA 5IAAC 2M4NA 3IXSA 1E0ZA 4MGYE 3NZSA 5IA7A 2QHOA 2JZ3B 2EMSA 1N61A 2BS3B 2N1WA 2MJ3A 1KJTA 2HDEA 4FN2A 2W82A 4EUTA 3ALBA 2ZCCA 2J7QB 3LDZE 2GBNA 2RDHA 3M95A 3W1SC 1FNWA 4HLEA 5LLIA 1VZ7A 1FIQA 1KRHA 2N0SB 4LCDE 2Z0EB 2RDBC 4P6VF 1V97A 3K9PB 2GI9A 1KLGD 4IOIE 5AUIA 3ZYYX 2W3RA 3DBHI 2KWCA 4OW0A 3PZ7A 1DGJA 3L10B 1CQVA 4DHJB 4MSMB 4ASWC 4K3BA 3RMKC 1UNSA 4WJNA 1WJ6A 1EU3A 5HG2A 3NZUA 1SJED 1RAXA 3BWUD 4KX6B 3ZDTA 4KDIC 4HRSA 4C4VB 4MSQB 1SEBD 2D11A 4IUMB 2M8SA 2LWPA 3M62B 1IPGA 1SE4A 4AJWA 3ML9A 4RNAA 4A20A 3Q3OC 2LVOA 4A6QA 3L0WB 3AN1A 1SJHD 1WF9A 1UWMA 1CJEA 3TSSA 1E7UA 4HKZE 1ZE3D 4DBGA 1Q5WB 3PRZA 3V3XA 3B1LX 4XWTA 2C7NB 3M3JA 2SAKA 1L6UA 3RNEC 4P7IA 2ZJDA 3WAPA 4EZKA 1FEHA 2PKOA 5L83A 5T8IA 3AEFB 4OHJA 2BW2A 2G3QB 1L4ZB 3TEYA 3SDLC 3DQVA 3IAM1 1T6BX 5C3JB 4HEA1 4DXAB 3V61A 1QF6A 1IP9A 4F7ZA 4P1CC 2K8BA 2VH1A 5D94A 1N63A 4BBNC 1KH0A 1UELA 1K50A 3NVYA 4LDTD 1WXAA 1T0RC 2INDC 2K39A 2LJIA 4KGSA 1XF5L 3CIRB 1CK1A 2W55A 3B0AA 2ZEQA 2V3PA 1KOTA 3NVZA 3QWZB 4GDKB 2N7JA 2WYQA 4NAMA 5JXVA 3JVZX 1EWYC 2GBJA 2VZKB 4W9CA 2L76A 4RGNA 1AYFA 3VTUA 4M8NA 2AEHA 1IGDA 4KKIA 5D2MB 4N58A 5EDSA 4GDLA 5JHAA 4M01A 4TV3A 3NZ3A 1QILA 2CS4A 5IN7A 3VXWA 2G4DB 1AWDA 3FILA 3MHZA 4WWMA 3OLMD 1E9MA 3OWEB 4XWWA 3BYTB 2K5PA 4MH8A 1DOIA 3A9JA 5EE1A 3U30A 2QC8A 2MP2A 4ZHOA 4ARCA 1TS3A 1WZ3A 4LNFA 3DDCB 4AOFA 3P42A 4IW0A 5FR6A 1IGCA 5C2TB 2WXJA 4LJOB 4RGMA 3PZ8A 3AI5A 3GZNI 4F1SA 4CQNA 3K9OB 2E3TA 3LYYA 5AUKA 2GLSA 3X23A 5HHDG 2LGIA 3A1QA 3R2IA 4KSLC 1XD3B 4MJSA 2TSSA 1K52A 2KQ4X 1KLUD 4NJ7A 1DOYA 5H92C 1MHXA 2GBKA 3TL5A 4HPLB 3AECB 3IHPC 3AM9A 1B9RA 2PW9A 2QILA 2M19A 1EUVB 3N30A 2NBWB 3KYDD 2DZKA 5HKHA 3ZDMC 2MRPA 3DBRB 2E6XA 1VZ6A 4L1BA 2OJWA 3DHHC 5AZFA 4BKSA 3M63B 3TIXA 1JWBD 1FNUA 3AE9B 3ZXVA 2CJNA 3AB5A 3VHTC 2Z8LA 2ZCBA 3RCZA 3IFWB 1UUPA 3JSVA 1QOAA 4K81A 2K8HA 3VVWB 3AE8B 3NVVA 2KTRA 4GDLB 2PE6B 1OGWA 2AL6A 2JF5A 1JW9D 4JIOU 1WRIA 1XLNA 2L8JA 3Q8BA 1WXQA 3Q3MC 2AWTA 3WCQA 2WXRA 2ONQA 2N1VA 1FCCC 2D5GA 3A9JB 2MP2B 5DPSA 4TSSA 2W3SA 5G55A 1PUTA 2RR9A 3A4SC 2KO3A 4NQKE 4ZRPA 2O2VA 4H2AA 2OHFA 4XDDA 4FJYA 1WIAA 3T3OA 4MGZE 4ZRQA 4GN1A 2JYTA 2Q5WD 3V60A 5L95C 3HRDD 2ZNVC 2CR5A 3ZO5B 1YIWA 1EF1A 2AYOB 2DZJA 2N9KA 4OZBA 1ZXHA 1E6EB 2FE8A 3ONSA 1UD7A 3CSFA 2N7EA 4KIKA 4OZCA 2JVCA 2J53A 1YJ1A 2KX0A 4RF1A 4FJVB 3SFDB 2QCZA 3VAWA 4LNKA 3BINA 3T3NA 1N6ZA 1D5ZC 2ZZPB 1NBFC 3W1YA 5GXGB 2CKHB 1WMHB 2KDEB 1LGRA 3DOWA 2JT4B 2AQ2B 3QX1A 2IGGA 3RZFA 3VR8B 3MFGA 4WQMA 4AP4C 3Q8AA 4N9F4 2IO2B 2WXHA 2DNFA 2CHZA 2ASQA 2K8CA 5KHOA 2V1YA 2KTRB 3RI7C 4N59A 3OG5A 2D2QA 4FADA 3H7PB 3P4RB 4OVZA 1XXGA 5I4DA 1N5WA 4HCNB 4K7SA 2ZW0A 1D6EC 2QJLA 4JL9A 2G1EA 1WYWB 1KLVA 2PIAA 4UDUC 3BK1A 2PMVA 3Q2AC 4ANWA 2NBVB 1FRDA 5JZEB 3UIPB 3KLSX 4E74A 3MC0B 2WXKA 4IKGA 1AW7A 1SXTA 1XT9B 3TEWA 1GNUA 2KMMA 3U52E 4W9FA 1TZ1A 1JWUD 1WGYA 4M8MA 2H89B 1WZ0A 3KQ4A 2N4FA 1WGHA 4EEWA 1WFYA 4GXBA 2DX5B 1BT0A 4BOSC 3Q14C 1MPEA 4KIKB 1ZKHA 4DQOC 1I42A 1MI0A 1YQ3B 2LRWA 4ICUA 1NYRA 4ZHPA 2X38A 3AV8A 2JUOA 1UZXB 3VRBB 1FFVA 4B0MA 3ECIA 3AMZA 4FJZA 1T0YA 2V0GA 3RN9C 2LJ5A 1C4PA 2MBQA 1Q0WB 1V1PB 2MH7A 1SGHA 4MGKE 1KM7A 1G6JA 3ML8A 2WDTB 3KUZA 1WSPA 4NJ6A 1AN8A 4PS3A 1DOXA 4Q2JA 1SE3A 2MLBA 3PZDA 4LK0M 3H7SA 1ISNA 4USAA 1JRPA 4MH0E 2HTME 4RF0A 2CJOA 1M94A 2Y5PA 3PHWB 1HXYD 2KFJA 1BUIC 3AXCA 2L83A 3PLVA 1V49A 2C7MB 5EE3A 2EMTA 1WM3A 4ICVA 2UU7A 1KTKA 3AEBB 4M00A 3JYUA 1HE8A 4XX5A 1C1YB 3AE2B 3OJ3A 1P9DU 3ZTDA 1V81A 1ZDXA 2WDQB 3RPFC 3Q6BA 1EU4A 2KDFB 4FLHA 1GG3A 2ZPNA 1TYGB 2RSUA 1PDXA 1FCLA 1V6EA 4IWPA 3U2SC 4NZLB 2CU1A 3U4EG 1JWAD 3MJWA 2V9HA 3NOBA 4REZA 4B95A 2BGFA 3RNBC 1QKZA 3S2AA 2PJHA 4NQLB 4O1NA 3N1YC 4K7WA 5J2RA 5H8YE 4ANXA 1F9JA 4PS8A 3SHQA 2O6VB 1JALA 2D3CA 2LGXA 4TUUA 3EFUA 1Q1OA 1GUAB 3R3MA 1T0QC 2XBBC 1VDVA 4KGTA 2Z59B 4NY0A 1HTQA 4AJYB 1E8WA 4GDKA 1ESFA 3TEXA 5IKCM 4M0WA 2PE9A 2PLPA 1EO6A 4GB9A 3MC9A 4LNNA 1R4MB 3VH4B 2KWDA 3AEGB 3EC8A 3QJZA 3KWLA 1SF0A 1OQRA 2LXAA 4G3XB 3BYYB 4YTMB 5CTRC 1WGGA 3TCAA 2RDGA 2KNBA 3P4PB 3PRMB 3QQ8B 4PK1A 2IDYA 4KDLB 4B0EA 4JPSA 4OVVA 1F77A 3NG0A 1AARA 1YJJA 3BY4B 2JY6A 4KZ0A 3VTVA 1A70A 1H4RA 2WXPA 2GRIA 1ZDVA 1TY2A 3QHTA 4DHZB 5FKAC 4GOCA 4M02A 4ZRKA 4BKGA 5AZHA 1SBBB 3HM6X 3CF6E 2I2YA 2A4ZA 2JRIB 1TKGA 3P1MA 2FCQA 4WWPA 1S3SG 3RT3B 3QK0A 2LVQA 3AU5A 1YX6B 2ON8A 2BVCA 3TEZA 5BMHA 3B2GA 3DBLI 3OJ4B 4ZYSA 4GGQA 1Q10A 1TIFA 2HE7A 2WS3B 3ZVVA 3DPDA 4BZAA 4JWUC 1V5OA 1L2NA 2BQQA 3V6EB 4XE0A 4BOZB 3GE3C 1GAQB 5FK9C 4WH4A 1ZP0B 2WLBA 5JHBA 2BYTA 2KDIA 2NBUA 3KVFB 2KK8A 1YMHE 1E8ZA 4LJPB 1WM2A 3R8BA 2CU3A 4FXCA 4M0WB 2RMMA 1J0GA 3N3KB 3WAOA 2VH2A 3MTNB 2FUHB 4HJKA 2KLGA 1XLQA 1RWSA 1D3ZA 4BKSD 4EOYA 4DK5A 4DDGD 1TJEA 3QIJA 2JWUA 2DZIA 4DHZE 4US8A 1JWMD 1UH6A 2Y5BB 5HI1A 3T9LA 2PVOD 3MHSD 1GC7A 3R7QA 3OAWA 4P16A 4WWNA 1N5XA 3N32A 2YEPB 2ZNVB 3ZTCA 5J18A 1J8CA 2L1AA 4FULA 3FAHA 2KJHB 2DYBA 3RZWC 3HVDA 3LB8C 2FIFA 3KYCD 1ET9A 5D3DA 3ZXRA 5E6PA 3WANA 1JRUA 1J7CA 2L52A 2RGFA 4AWJA 3VUYA 2JQRB 2KAJA 1F2RC 4A90A 2IZVB 4EFOA 3VDZA 1OTRB 4W9GA 3PLUA 2ZVNA 4EZJA 2V4IB 3EHVA 3HVZA 4K1RB 1N60A 4C7YA 1TKYA 4ANUA 4CO7A 4XZ4A 3SEBA 1OEYA 1XCQL 1K8RB 1WWTA 2J0KA 3L4PA 3ZRCA 3HM3A 4RGOS 2DYMA 1YJIA 1QOBA 2WDRB 3RFZB 3Q8CA 1L0YB 4OZAA 1XO3A 2QEJC 1WMHA 3P4SB 3I9V1 3H8HA 2M0AA 2KANA 3P4QB 4MEMA 3V62A 1UF0A 2V4LA 4GLSC 1YN5A 1T0SC 2UYZB 4BKTA 1FXTB 2BT6A 2DBYA 1UWXA 4GMVA 1Z5SB 3NUHB 3MJ5A 1TS4A 3B08A 2BF8B 3BVMA 1T5XD 1PGAA 1ZUD2 2BBCA 4KGRA 1TGZB 3H7PA 4BFRA 3L17A 2BS4B 2KN4A 1ACCA 2J42A 2JX5A 2CHXA 2LUMA 1GJZA 2GB1A 2JXTA 1ZGUB 3AU4A 1F0ZA 1ROEA 3CWIA 2WU5B 2D3BA 3IVFA 4NJCA 2MX2A 4ZRJA 1JWSD 2DAJA 5AZGA 3URYA 1RRBA 4RM9A 4TQ0A 3WA0A 2M17A 2L00B 2ZW1A 2XEWA 3EFCA 3RNAC 2NPTB 5DPTA 1XCTL 5BO4B 5GMVA 3L13A 3W1SA 4ZYNA 3I63C 4KSKC 1E7PB 3PO0A 4WAFA 2AQ3B 4LNOA 2Z0DB 3Q69A 5BMGA 3W2DA 5LNK1 1R4MI 3GOEA 2LUEA 4ARIA 5G2NA 4AUQC 1VD2A 2MHJA 4LDTB 2LHDA 2DLBA 3NJTA 2UWQA 3DBLB 4DWFA 2WXOA 4HXDA 1OQYA 3KWVA 1VR9A 3NVWA 4N6EB 1DYQA 1FXAA 2BYVE 1D4BA 1RFKA 1WX8A 3ZJUA 3VFKA 3ENEA 4IWOA 1T3QA 2WXIA 2IO0B 1N62A 4AS1A 1UBIA 1NEKB 3PGEA 3PTFC 4K3CA 1WH3A 5BYRA 4XYCA 1I35A 1V1PA 1WE7A 2NCNA 3QA8A 3U7ZA 3APFA 1ZXIA 4JLCA 1ZPSA 2N9LA 3U8ZA 2ZPYA 4W9DA 3ZIMA 1GB1A 3UINB 2K22A 2KX3A 1P1AA 4NAWA 1QLBB 1CMXB 3A33B 2OOBB 4JX1C 4OVUA 4DHJD 2L0FA 2FBWB 2KQ7A 5DPRA 2MJEA 2KD0A 2NMQA 4G0NB 1I4GA 2WX1A 4C7ZA 1VZ8A 1YX5B 1WX9A 4WWOA 1PFDA 2BYFA 3IT6B 1TTNA 2JZPA 1WY8A 4KZCA 4MT5A 4WQOB 4C80A 4IM3A 4ACFA 1E5WA 5AEKB 3EECA 1ZOYB 1TT5B 4XC2A 2JWZA 4E71A 1ENFA 1EWCA 1WR1A 2FUG1 3APCA 2K9XA 3AEDB 4NNJB 1V2YA 4I6PA 1WJNA 2MBEA 2JZZA 2O6VA 3VR9B 1QOGA 2Y3AA 3WAMA 2LD9A 2DHZA 2D3AA 4W9HA 1FO4A 3GP7A 2LRUA 1E10A 2KQSA 2NTTA 2V3SA 4D2KA 5IO9A 1XLOA 5J17A 2KWUB 1LXDA 2K6QA 1VLBA 3N1XC 3AH7A 2J0MA 4EE2A 4C00A 2GBRA 3E56A 3RNFC 2HJ1A 2K0PA 4G50A 1WJ4A 3HHMA 1SIJA 4YT0B 1V5TA 2KMCA 1PGXA 2KC1A 1IBXA 2RPVA 5C23A 3QC8B 4HDQA 2AX5A 2LGYA 3BVZA 4HCPB 4NAWB 2C5LC 2VZKD 1C76A 4W9JA 4GSWA 4FHKA 4PS7A 1S1QB 2K25A 5D3IB 2J52A 3ZRFA 3LJ3A 2FCNA 1HZ6A 2KVZA 2YLMA 4PYUA 3UI3A 1YN3A 4I6LB 4RH6A 4WJQA 3N9YC 4RFBA 1HQRD 4L23A 3ABVB 3E9SA 2IY0B 4IC7B 4YSZB 2D3GA 2V3NA 3BIID 2C9WB 2LASA 2KFKB 1STEA 1PQSA 2LGDA 1OEYJ 1WX7A 3U7DA 1BMLC 1Y56A 2QIEB 2M56B 2BKRB 3P63A 1HA5A 2IO3B 3T8MA 4FBJB 4JQWC 1QQRA 1I4PA 1MFWA 2QDFA 1KF6B 3HIZA 2XK5B 2J0JA 3SR6A 1WI0A 5EE0A 4IG7B 1HZ5A 3AE1B 1UGJA 1LFDA 3HUIA 5HFYA 4HKQA 2EKIA 3MC8A 2H88B 3CSTA 3ZNHB 2YEPF 5EE9A 1QT9A 3C0RB 3TJPA 5TR5A 2MEKA 2EELA 1H8CA 1SB3C 3VTWA 2KDMA
chains in the Genus database with same CATH topology
4TSSA 3IAS1 1C9FA 4R3DA 4US8A 1JWMD 2W3SA 2W54A 1SSNA 1TY0A 5HI1A 2IGHA 2PVOD 4YWGG 1PUTA 1EM7A 4RCOA 1VRAB 4ZRPA 4H2AA 4IDIA 2OHFA 4XDDA 3T3OA 2INNE 1IBXB 4P16A 1QOFA 3ZGZA 1N5XA 4ZRQA 2YEPB 3EGRA 2JYTA 3EA6A 2Q5WD 3HRDD 3SFEB 2L1AA 3FAHA 2N9KA 4OZBA 3HVDA 2BB5A 1IUEA 3LB8C 1ZXHA 1E6EB 2FE8A 1ET9A 5D3DA 1D5MC 1P7EA 1J7CA 2L52A 2JQRB 1JROA 2KAJA 1F2RC 5BYSA 1GPXA 4OZCA 4A90A 3AEAB 2J53A 3W5VB 4RF1A 1FM0D 2IJ0A 3SFDB 3BVGA 2V4IB 2WNMA 3T3NA 3HVZA 4KKJA 1D5ZC 1N60A 1I4HA 1OFFA 4C7YA 1TKYA 1CZPA 3BK2A 5GXGB 1L5PA 2Y5CA 1C78A 3SEBA 1XCQL 2AQ2B 2IGGA 3IT4B 5E6JA 1WWTA 2WXGA 4A8XC 3L4PA 1R7SA 1GB4A 1B1ZA 1J7AA 1C4CA 1WGKA 4RGOS 2DYMA 1SE2A 4LLGM 1YJIA 3VR8B 3MFGA 1QOBA 2WDRB 2WXLA 3Q8AA 4WQMA 2QSDA 1TKEA 3Q8CA 3V05A 3RFZB 2WXHA 3GB1A 1L0YB 4OZAA 1PYWD 2JSVX 3R2TA 1XO3A 2INPE 2QMTA 2QEJC 3ETRA 2ACZB 5TSSA 3P4SB 3I9V1 4XDCA 3H8HA 4N59A 2M0AA 2BS2B 3P4QB 2MJDA 3VRAB 1FD6A 1FFUA 3DWGC 1ET6A 2LMCA 4JWSC 4GLSC 3O13A 1YN5A 3P4RB 1GOZA 4OVZA 1VJKA 4MACA 1XXGA 4C56C 3NS1A 3DWMA 1C77A 2L32A 3TUOA 5I4DA 1N5WA 1TZOA 2ZW0A 2DBYA 2BT6A 1UWXA 4HROA 1BXTA 1D6EC 3NUHB 3Q8EA 2QJLA 3ZJVA 2G1EA 3MJ5A 1PGBA 3B2FA 1L4DB 2WQYB 4ZOHC 1L0XB 1TS4A 3J9CA 1MVKA 4YTNB 4AQ7A 2PIAA 3BVMA 1T5XD 1PGAA 1ZUD2 2BBCA 4KGRA 2WP9B 4UDUC 1I7HA 2BS4B 2PMVA 3BK1A 2WXQA 3NRZA 2KN4A 1K51A 1YQ4B 3IXSA 1OQQA 1E0ZA 1ACCA 2J42A 2JX5A 1FRDA 2LUMA 2J4XA 1MHHE 1N61A 2GB1A 3KLSX 2JXTA 2BS3B 2MJ3A 2HDEA 1F0ZA 1ROEA 3MC0B 3B9JA 2W82A 2WXKA 2PVGC 2WU5B 1AW7A 3CWIA 1SXTA 2WDVB 4IKGA 4NJCA 3TEWA 1JWSD 3URYA 2KMMA 2RDHA 4TQ0A 1YNTE 1KFYB 1FNWA 3U52E 1JWUD 1VZ7A 1FIQA 2H89B 1I4RA 1KRHA 2G9HD 4YXDB 4WIPA 3KQ4A 2ZW1A 2N0SB 3Q8FA 4P6VF 1XCTL 1MPEA 1V97A 2GI9A 1KLGD 4IOIE 4DQOC 2WXNA 3W1SA 2OEDA 5AUIA 3ZYYX 1MI0A 2W3RA 1FMAD 4OW0A 1E7PB 1YQ3B 3PO0A 1DGJA 1NYRA 3PZ7A 1FRRA 1CQVA 2X38A 3AV8A 4ZHPA 4WAFA 2AQ3B 2IPKD 3W9CB 3VRBB 3Q69A 1UNSA 1FFVA 5BMGA 3W2DA 5LNK1 4B0MA 1EU3A 4RGTA 5HG2A 1SJED 4ARIA 3BWUD 3AMZA 4KX6B 2KACA 2LHDA 2V0GA 4HRSA 2DLBA 1SEBD 1C4PA 2WXOA 1JCKB 1V1PB 2MH7A 3KWVA 3NVWA 1VR9A 4N6EB 1DYQA 1FXAA 1SE4A 1D4BA 1RFKA 3ZJUA 1T3QA 1WSPA 2WXIA 1AN8A 4RNAA 1N62A 4Q2JA 3AE5B 1DOXA 4A6QA 4AS1A 1SE3A 3LXFA 1NEKB 5BYRA 3AN1A 1SJHD 4LK0M 1TS2A 1UWMA 1V1PA 1CJEA 1JRPA 4TQ1A 4USAA 4HKZE 1ZE3D 3TSSA 2ICIA 2HTME 4RF0A 2CJOA 4JE3B 2Y5PA 1XLPA 3U7ZA 3V3XA 1ZXIA 1HXYD 4XWTA 1ZPSA 1BUIC 2N9LA 3C8YA 2SAKA 1L6UA 1YN4A 2B76B 2L83A 2DYOA 3AE4B 1GB1A 1FEHA 2PKOA 5T8IA 3AEFB 5EE3A 2K22A 4OHJA 2BW2A 1NENB 1NYQA 1QLBB 1L4ZB 3TEYA 3IAM1 1KTKA 3AEBB 4JX1C 1T6BX 5C3JB 4HEA1 4WURA 3AE2B 2FBWB 1QF6A 2PTLA 2LFIA 2AQ1B 1P7FA 1ZDXA 1V1OA 2SEBD 2WDQB 4HJGE 3RPFC 2MJEA 3ZJTA 2NMQA 2XNAC 1EU4A 1N63A 1KH0A 2JYEA 1JMLA 1K50A 3NVYA 1TYGB 1I4GA 2K3UA 1PDXA 4C7ZA 1VZ8A 3BZDB 1PFDA 1FCLA 3IT6B 5D7GA 2LJIA 4KGSA 1XF5L 3CIRB 1CK1A 2JZPA 1WYGA 4US9A 3U2SC 3FC4A 4NZLB 5BMIA 4MT5A 4TMAB 3U4EG 1JWAD 2W55A 3EUB2 4C80A 2V3PA 2WU2B 1TS5A 4REZA 1QKZA 3NVZA 4GDKB 1ZOYB 4O1NA 2N7JA 4NAMA 5JXVA 5H8YE 5MPOA 4YSYB 1D5XC 3FILB 4MM3B 1JALA 1ENFA 1EWCA 1EWYC 2VZKB 1FNVA 2FUG1 2K9XA 4RGNA 1AYFA 1VDVA 3AEDB 4KGTA 1IGDA 4KKIA 2BB6A 4N58A 4A9AA 1ESFA 3TEXA 4M0WA 3MP9A 3NZ3A 1QILA 2PLPA 5BYQA 1JQ4A 1AWDA 3FILA 1I4QA 3VR9B 1QOGA 2Y3AA 3MHZA 4J3OD 2KWDA 4WWMA 5G5GA 1E9MA 3OWEB 3AEGB 4XWWA 1FO4A 3GP7A 3BYTB 1K53A 1E10A 2K5PA 2WXFA 1DOIA 3AE6B 4MH8A 3KWLA 1SF0A 2NTTA 5EE1A 2BTEA 1OQRA 4D2KA 4YSXB 3BYYB 3AE7B 4ZHOA 4YTMB 1XLOA 4ARCA 1TS3A 2RDGA 3P4PB 1VLBA 5G5HA 3AH7A 2IDYA 3P42A 4B0EA 4ITKA 4JPSA 1IGCA 1F77A 5C2TB 4EE2A 2WXJA 4RGMA 1YJJA 3PZ8A 3E56A 2K0PA 4CQNA 4LTUA 3W5UB 1A70A 1SIJA 2E3TA 4YT0B 2WXPA 1PGXA 2GRIA 3LYYA 5AUKA 1ZDVA 1IBXA 2WXMA 2RPVA 1TY2A 4A55A 5HHDG 5FKAC 4YTPB 4PT5A 3VQIA 1NVID 2AX5A 3BVZA 2LGIA 4NAWB 3R2IA 1SBBB 1C76A 2VZKD 1C4AA 2TSSA 1NI3A 1K52A 2I2YA 2KQ4X 1TKGA 3P1MA 1KLUD 1DOYA 5H92C 1F2RI 3I57A 5D3IB 3ZQ4A 2J52A 1MHXA 2ON8A 3TEZA 3AECB 1HZ6A 5BMHA 3B2GA 3AM9A 1B9RA 2PW9A 2QILA 2M19A 2NTSA 4ZYSA 2XN9C 1YN3A 3UI3A 1L6VA 4RH6A 1Q10A 2DWQA 3N9YC 4L2YA 4RFBA 1HQRD 4L23A 3ABVB 3E9SA 2WS3B 4YSZB 2V3NA 3GS2A 4JWUC 2E6XA 1VZ6A 3BIID 4L1BA 2R61A 1L0VB 4XE0A 1RYJA 1RM6C 1STEA 3AEEB 1GAQB 1JWBD 1BMLC 5FK9C 1Y56A 2QIEB 3AE3B 1FNUA 2M56B 3AE9B 2CJNA 3P63A 4WH4A 4DXGA 1HA5A 3AB5A 1ZP0B 2WLBA 2BYTA 2IGDA 1FXIA 2Z8LA 1QQRA 1I4PA 2LEKA 1UUPA 4DXFA 1KF6B 1YMHE 1QOAA 3SR6A 2LHEA 5EE0A 3R8BA 3AE8B 3NVVA 2CU3A 4GDLB 4FXCA 2RMMA 1HZ5A 3AE1B 1UGJA 1J7BA 2I38A 1C79A 1JW9D 3HUIA 1V8CA 5HFYA 1WRIA 1XLNA 3Q8BA 4HKQA 1WXQA 1I4XA 3WCQA 2EKIA 2WXRA 2H88B 2ONQA 1HEZE 1XEEA 2YEPF 1FCCC 2D5GA 5EE9A 1QT9A 2JU6X 1M4VA 1XLQA 1RWSA 2MEKA 2EELA 1LO5D 1SB3C 2KDMA 1TJEA 2JWUA 5FR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LMC A;  4LK0 M;  4LLG M;  2WNM A; 
#chains in the Genus database with same CATH topology
 3IAS 1;  1C9F A;  4R3D A;  2KJ6 A;  1SSN A;  1A5R A;  2IGH A;  5E6N A;  2HD5 B;  4YWG G;  1EM7 A;  4RCO A;  2LGS A;  2NVU I;  1X1M A;  1FPY A;  3PRE A;  4IDI A;  2DAF A;  2IY1 B;  2M0X A;  4BVU C;  1IBX B;  3EGR A;  3EA6 A;  3TMP B;  3N20 C;  1GC6 A;  2K6D B;  3Q3N C;  3FKY A;  1LQB A;  1YD8 U;  2KYW A;  3IG3 A;  2BB5 A;  1IUE A;  2WGS A;  4B6W A;  1UGM A;  1D5M C;  1P7E A;  5IOI A;  4GIV A;  1JRO A;  3A9K A;  5BYS A;  2HTH A;  1GPX A;  5IP4 D;  1SIF A;  2OJR A;  3W5V B;  3DHI C;  1FM0 D;  2IJ0 A;  3RUI B;  4RM8 A;  1R4N B;  1E8Y A;  2WNM A;  3I5J C;  4LNI A;  1CZP A;  1L5P A;  3L08 A;  2G45 B;  2MBH A;  3A4R A;  2WXG A;  4A8X C;  1R7S A;  1B1Z A;  2FID A;  1C4C A;  4LLG M;  2WXL A;  1V80 A;  2QSD A;  1TKE A;  3V05 A;  3NY5 A;  3VH3 B;  3GB1 A;  4EKU A;  2GMI C;  2JSV X;  3R2T A;  1Z2M A;  5TSS A;  2ACZ B;  4XDC A;  1WJU A;  2BS2 B;  4HPP A;  2MJD A;  3VRA B;  4HVB A;  1FFU A;  1ET6 A;  4JWS C;  3WIM A;  1EF5 A;  4YL8 A;  4C56 C;  3NS1 A;  3DWM A;  1C77 A;  4ZRI A;  4E3C A;  3TUO A;  1E90 A;  4MDK E;  2BWF A;  2IO1 B;  3Q8E A;  3ZJV A;  1PGB A;  3B2F A;  5E6O A;  4URK A;  3QAR A;  3J9C A;  4AQ7 A;  5DCN A;  2PEA A;  3NS8 A;  4A3O A;  5KHQ A;  2L0T A;  2FCM A;  1I7H A;  5C1Z A;  1K51 A;  1YQ4 B;  1OQQ A;  2FCS A;  2J4X A;  1MHH E;  2C60 A;  2L05 A;  2LVP A;  3PHX B;  4G11 A;  3B9J A;  2PVG C;  2KWV B;  1WGR A;  2WDV B;  1LM8 B;  1WE6 A;  1NI2 A;  3DCG A;  4S17 A;  1YNT E;  1KFY B;  1RLF A;  1XQQ A;  1I4R A;  2G9H D;  2KVR A;  4YXD B;  4WIP A;  3Q8F A;  2LI5 A;  4MM3 A;  3A9K B;  1WGD A;  2N9P C;  2WXN A;  2OED A;  3PSE B;  1FMA D;  2MWS B;  1P98 A;  2FNJ B;  2LZ6 A;  1FRR A;  3DVN V;  1J19 A;  4FA6 A;  3WAL A;  3KW5 B;  2IPK D;  3W9C B;  1QZE A;  4EZL A;  2L3Z A;  4WJP A;  4RGT A;  2NPT A;  1P3Q U;  2KAC A;  3UQA A;  2X8X X;  4NPN A;  4ZDV A;  5LXI B;  1JCK B;  2KC2 A;  2BYE A;  2BWE S;  1F52 A;  4W9I A;  3Q3F A;  4IM2 A;  3H6N A;  4BAX A;  3AE5 B;  3VUX A;  3LXF A;  3L16 A;  4A3P A;  4X57 B;  5CX3 A;  1TS2 A;  4TQ1 A;  4HDO A;  2ICI A;  2ZVO A;  4JE3 B;  1XLP A;  3V6C B;  4W9K A;  4MGI E;  2KT7 A;  3C8Y A;  2MA9 B;  3DBS A;  1YN4 A;  3D32 A;  2B76 B;  2DYO A;  1MG8 A;  3AE4 B;  3I3T B;  5LXH A;  1NEN B;  1NYQ A;  2N7D A;  2JXX A;  4WUR A;  2PTL A;  3GE8 C;  2LFI A;  2AQ1 B;  3N1Z C;  1P7F A;  2SEB D;  1V1O A;  4HJG E;  2VRR B;  3ZJT A;  2BPS A;  2XNA C;  2MCN B;  2JYE A;  1JML A;  3IBE A;  2K3U A;  3BZD B;  3PPA A;  2N9X A;  5D7G A;  4W9L A;  5BMI A;  1WYG A;  4US9 A;  4II3 B;  3FC4 A;  4DDI D;  4TMA B;  3EUB 2;  2WU2 B;  1TS5 A;  2KLC A;  1ZW7 A;  2KHW B;  4CYE A;  5MPO A;  4YSY B;  3O65 B;  1D5X C;  3FIL B;  4MM3 B;  2JPH A;  3HK0 A;  1FNV A;  1NDD A;  3DVG X;  4HWI B;  3ZKJ C;  4IWQ A;  2B3A A;  3KH0 A;  3DBH B;  2BB6 A;  1RFA A;  4A9A A;  2KXJ A;  3X0W A;  3MP9 A;  3JW0 X;  1IYF A;  5BYQ A;  3Q3J A;  1JQ4 A;  1I4Q A;  2MQJ A;  3UGB B;  3C19 A;  4J3O D;  1WXM A;  1U4A A;  5G5G A;  2C7H A;  4WAA A;  3RYT A;  3PVL A;  1K53 A;  2WXF A;  3AE6 B;  2BTE A;  4YSX B;  3AE7 B;  2KZR A;  3DVN U;  2I1K A;  5G5H A;  4ITK A;  3A1Q B;  4MJS B;  4QAY A;  4LTU A;  3W5U B;  3CMM B;  2WXM A;  3VUW A;  4A55 A;  4HK2 A;  4YTP B;  2KJR A;  4PT5 A;  3VQI A;  1NVI D;  2O6V D;  5D6J B;  2LXC A;  1C4A A;  2KOX A;  2D10 A;  4WJO A;  1NI3 A;  4BBN F;  1Y8R C;  2YVC A;  3P2B A;  1F2R I;  2L7R A;  4F8C B;  3I57 A;  3ZQ4 A;  2MSE D;  2IYD B;  4K7U A;  3SD5 A;  2NTS A;  2XN9 C;  1L6V A;  1F1H A;  2KN5 A;  2DWQ A;  1R4N I;  4L2Y A;  1UBQ A;  4J6I A;  1HTO A;  2MBB B;  2N9E B;  3GS2 A;  1WXV A;  1WXS A;  2R61 A;  4KVG B;  1L0V B;  3JSV B;  1RYJ A;  1RM6 C;  1L7Y A;  3AEE B;  1WRD B;  4KV2 A;  3AE3 B;  4I6N B;  3DVG Y;  4DXG A;  5CHW A;  4GU2 A;  2EKE C;  2IGD A;  1FXI A;  2INC C;  2LEK A;  2GOW A;  2KDB A;  4DXF A;  4B9K A;  2KFK A;  2LHE A;  5JH5 C;  2DZM A;  4CHK A;  2AL3 A;  5CHV C;  3ZUN A;  1J7B A;  3NHE B;  2I38 A;  1C79 A;  4PYZ A;  1V8C A;  1C3T A;  3KUC B;  1I4X A;  2REX A;  2FAZ A;  3TBL D;  3DHG C;  2XK5 A;  2PPH A;  1HEZ E;  1XEE A;  1MG4 A;  2JU6 X;  2O2V B;  1M4V A;  3SU8 X;  2CHW A;  2I1J A;  1P0R A;  1LO5 D;  2WHI A;  3APD A;  5FR3 A;  2W54 A;  1TY0 A;  1E8X A;  2G4S A;  3H1U A;  4IM0 A;  3PS6 A;  4W9E A;  1VRA B;  2GBM A;  4P1B C;  3R66 C;  3ZW3 A;  1MJD A;  1VCB A;  3GZN B;  3PRP B;  2MW5 A;  2INN E;  3QCA A;  2RPQ A;  1WR6 E;  3PV1 A;  3ZNI D;  1QOF A;  3PT2 B;  3ZGZ A;  3UF8 A;  3SFE B;  2NR2 A;  3ZNG C;  2R2Q A;  3RNC C;  4JGH B;  2IBI B;  2BKF A;  2M1M A;  3RNG C;  4FHJ A;  1TBE A;  3RUL A;  4XGA B;  2D07 B;  2NS5 A;  3UIO B;  1SE9 A;  3AEA B;  2KKC A;  2A5U A;  3R7R A;  3L54 A;  3BVG A;  2KTF A;  4KKJ A;  4II2 B;  4HPM B;  1I4H A;  1OFF A;  3BK2 A;  4RMA A;  2WWZ A;  3RD2 A;  2Y5C A;  1C78 A;  4TKN A;  1V9J A;  2JRH A;  2MBO A;  4ANV A;  4C4V A;  3IT4 B;  5E6J A;  3KUD B;  1YQB A;  1GB4 A;  1J7A A;  1WGK A;  1SE2 A;  2RD0 A;  2R2O A;  2WX0 A;  1V86 A;  1PYW D;  2INP E;  2QMT A;  3ETR A;  1E7V A;  2K1F A;  4S0R A;  1FD6 A;  3H9D A;  3DWG C;  1YOV B;  2LMC A;  3AUL A;  3O13 A;  1GOZ A;  1VJK A;  2W9N A;  4MAC A;  5CHF A;  3UQB A;  2L32 A;  1TZO A;  4HRO A;  1BXT A;  2DEN B;  1L4D B;  2WQY B;  2KMA A;  3DBR I;  1L0X B;  4ZOH C;  4YTN B;  1MVK A;  2HJ8 A;  3ZNZ B;  3QAQ A;  3ZLZ A;  4MEL A;  2WP9 B;  5DPW A;  2WXQ A;  3NRZ A;  5IAA C;  2M4N A;  3IXS A;  1E0Z A;  4MGY E;  3NZS A;  5IA7 A;  2QHO A;  2JZ3 B;  2EMS A;  1N61 A;  2BS3 B;  2N1W A;  2MJ3 A;  1KJT A;  2HDE A;  4FN2 A;  2W82 A;  4EUT A;  3ALB A;  2ZCC A;  2J7Q B;  3LDZ E;  2GBN A;  2RDH A;  3M95 A;  3W1S C;  1FNW A;  4HLE A;  5LLI A;  1VZ7 A;  1FIQ A;  1KRH A;  2N0S B;  4LCD E;  2Z0E B;  2RDB C;  4P6V F;  1V97 A;  3K9P B;  2GI9 A;  1KLG D;  4IOI E;  5AUI A;  3ZYY X;  2W3R A;  3DBH I;  2KWC A;  4OW0 A;  3PZ7 A;  1DGJ A;  3L10 B;  1CQV A;  4DHJ B;  4MSM B;  4ASW C;  4K3B A;  3RMK C;  1UNS A;  4WJN A;  1WJ6 A;  1EU3 A;  5HG2 A;  3NZU A;  1SJE D;  1RAX A;  3BWU D;  4KX6 B;  3ZDT A;  4KDI C;  4HRS A;  4C4V B;  4MSQ B;  1SEB D;  2D11 A;  4IUM B;  2M8S A;  2LWP A;  3M62 B;  1IPG A;  1SE4 A;  4AJW A;  3ML9 A;  4RNA A;  4A20 A;  3Q3O C;  2LVO A;  4A6Q A;  3L0W B;  3AN1 A;  1SJH D;  1WF9 A;  1UWM A;  1CJE A;  3TSS A;  1E7U A;  4HKZ E;  1ZE3 D;  4DBG A;  1Q5W B;  3PRZ A;  3V3X A;  3B1L X;  4XWT A;  2C7N B;  3M3J A;  2SAK A;  1L6U A;  3RNE C;  4P7I A;  2ZJD A;  3WAP A;  4EZK A;  1FEH A;  2PKO A;  5L83 A;  5T8I A;  3AEF B;  4OHJ A;  2BW2 A;  2G3Q B;  1L4Z B;  3TEY A;  3SDL C;  3DQV A;  3IAM 1;  1T6B X;  5C3J B;  4HEA 1;  4DXA B;  3V61 A;  1QF6 A;  1IP9 A;  4F7Z A;  4P1C C;  2K8B A;  2VH1 A;  5D94 A;  1N63 A;  4BBN C;  1KH0 A;  1UEL A;  1K50 A;  3NVY A;  4LDT D;  1WXA A;  1T0R C;  2IND C;  2K39 A;  2LJI A;  4KGS A;  1XF5 L;  3CIR B;  1CK1 A;  2W55 A;  3B0A A;  2ZEQ A;  2V3P A;  1KOT A;  3NVZ A;  3QWZ B;  4GDK B;  2N7J A;  2WYQ A;  4NAM A;  5JXV A;  3JVZ X;  1EWY C;  2GBJ A;  2VZK B;  4W9C A;  2L76 A;  4RGN A;  1AYF A;  3VTU A;  4M8N A;  2AEH A;  1IGD A;  4KKI A;  5D2M B;  4N58 A;  5EDS A;  4GDL A;  5JHA A;  4M01 A;  4TV3 A;  3NZ3 A;  1QIL A;  2CS4 A;  5IN7 A;  3VXW A;  2G4D B;  1AWD A;  3FIL A;  3MHZ A;  4WWM A;  3OLM D;  1E9M A;  3OWE B;  4XWW A;  3BYT B;  2K5P A;  4MH8 A;  1DOI A;  3A9J A;  5EE1 A;  3U30 A;  2QC8 A;  2MP2 A;  4ZHO A;  4ARC A;  1TS3 A;  1WZ3 A;  4LNF A;  3DDC B;  4AOF A;  3P42 A;  4IW0 A;  5FR6 A;  1IGC A;  5C2T B;  2WXJ A;  4LJO B;  4RGM A;  3PZ8 A;  3AI5 A;  3GZN I;  4F1S A;  4CQN A;  3K9O B;  2E3T A;  3LYY A;  5AUK A;  2GLS A;  3X23 A;  5HHD G;  2LGI A;  3A1Q A;  3R2I A;  4KSL C;  1XD3 B;  4MJS A;  2TSS A;  1K52 A;  2KQ4 X;  1KLU D;  4NJ7 A;  1DOY A;  5H92 C;  1MHX A;  2GBK A;  3TL5 A;  4HPL B;  3AEC B;  3IHP C;  3AM9 A;  1B9R A;  2PW9 A;  2QIL A;  2M19 A;  1EUV B;  3N30 A;  2NBW B;  3KYD D;  2DZK A;  5HKH A;  3ZDM C;  2MRP A;  3DBR B;  2E6X A;  1VZ6 A;  4L1B A;  2OJW A;  3DHH C;  5AZF A;  4BKS A;  3M63 B;  3TIX A;  1JWB D;  1FNU A;  3AE9 B;  3ZXV A;  2CJN A;  3AB5 A;  3VHT C;  2Z8L A;  2ZCB A;  3RCZ A;  3IFW B;  1UUP A;  3JSV A;  1QOA A;  4K81 A;  2K8H A;  3VVW B;  3AE8 B;  3NVV A;  2KTR A;  4GDL B;  2PE6 B;  1OGW A;  2AL6 A;  2JF5 A;  1JW9 D;  4JIO U;  1WRI A;  1XLN A;  2L8J A;  3Q8B A;  1WXQ A;  3Q3M C;  2AWT A;  3WCQ A;  2WXR A;  2ONQ A;  2N1V A;  1FCC C;  2D5G A;  3A9J B;  2MP2 B;  5DPS A;  4TSS A;  2W3S A;  5G55 A;  1PUT A;  2RR9 A;  3A4S C;  2KO3 A;  4NQK E;  4ZRP A;  2O2V A;  4H2A A;  2OHF A;  4XDD A;  4FJY A;  1WIA A;  3T3O A;  4MGZ E;  4ZRQ A;  4GN1 A;  2JYT A;  2Q5W D;  3V60 A;  5L95 C;  3HRD D;  2ZNV C;  2CR5 A;  3ZO5 B;  1YIW A;  1EF1 A;  2AYO B;  2DZJ A;  2N9K A;  4OZB A;  1ZXH A;  1E6E B;  2FE8 A;  3ONS A;  1UD7 A;  3CSF A;  2N7E A;  4KIK A;  4OZC A;  2JVC A;  2J53 A;  1YJ1 A;  2KX0 A;  4RF1 A;  4FJV B;  3SFD B;  2QCZ A;  3VAW A;  4LNK A;  3BIN A;  3T3N A;  1N6Z A;  1D5Z C;  2ZZP B;  1NBF C;  3W1Y A;  5GXG B;  2CKH B;  1WMH B;  2KDE B;  1LGR A;  3DOW A;  2JT4 B;  2AQ2 B;  3QX1 A;  2IGG A;  3RZF A;  3VR8 B;  3MFG A;  4WQM A;  4AP4 C;  3Q8A A;  4N9F 4;  2IO2 B;  2WXH A;  2DNF A;  2CHZ A;  2ASQ A;  2K8C A;  5KHO A;  2V1Y A;  2KTR B;  3RI7 C;  4N59 A;  3OG5 A;  2D2Q A;  4FAD A;  3H7P B;  3P4R B;  4OVZ A;  1XXG A;  5I4D A;  1N5W A;  4HCN B;  4K7S A;  2ZW0 A;  1D6E C;  2QJL A;  4JL9 A;  2G1E A;  1WYW B;  1KLV A;  2PIA A;  4UDU C;  3BK1 A;  2PMV A;  3Q2A C;  4ANW A;  2NBV B;  1FRD A;  5JZE B;  3UIP B;  3KLS X;  4E74 A;  3MC0 B;  2WXK A;  4IKG A;  1AW7 A;  1SXT A;  1XT9 B;  3TEW A;  1GNU A;  2KMM A;  3U52 E;  4W9F A;  1TZ1 A;  1JWU D;  1WGY A;  4M8M A;  2H89 B;  1WZ0 A;  3KQ4 A;  2N4F A;  1WGH A;  4EEW A;  1WFY A;  4GXB A;  2DX5 B;  1BT0 A;  4BOS C;  3Q14 C;  1MPE A;  4KIK B;  1ZKH A;  4DQO C;  1I42 A;  1MI0 A;  1YQ3 B;  2LRW A;  4ICU A;  1NYR A;  4ZHP A;  2X38 A;  3AV8 A;  2JUO A;  1UZX B;  3VRB B;  1FFV A;  4B0M A;  3ECI A;  3AMZ A;  4FJZ A;  1T0Y A;  2V0G A;  3RN9 C;  2LJ5 A;  1C4P A;  2MBQ A;  1Q0W B;  1V1P B;  2MH7 A;  1SGH A;  4MGK E;  1KM7 A;  1G6J A;  3ML8 A;  2WDT B;  3KUZ A;  1WSP A;  4NJ6 A;  1AN8 A;  4PS3 A;  1DOX A;  4Q2J A;  1SE3 A;  2MLB A;  3PZD A;  4LK0 M;  3H7S A;  1ISN A;  4USA A;  1JRP A;  4MH0 E;  2HTM E;  4RF0 A;  2CJO A;  1M94 A;  2Y5P A;  3PHW B;  1HXY D;  2KFJ A;  1BUI C;  3AXC A;  2L83 A;  3PLV A;  1V49 A;  2C7M B;  5EE3 A;  2EMT A;  1WM3 A;  4ICV A;  2UU7 A;  1KTK A;  3AEB B;  4M00 A;  3JYU A;  1HE8 A;  4XX5 A;  1C1Y B;  3AE2 B;  3OJ3 A;  1P9D U;  3ZTD A;  1V81 A;  1ZDX A;  2WDQ B;  3RPF C;  3Q6B A;  1EU4 A;  2KDF B;  4FLH A;  1GG3 A;  2ZPN A;  1TYG B;  2RSU A;  1PDX A;  1FCL A;  1V6E A;  4IWP A;  3U2S C;  4NZL B;  2CU1 A;  3U4E G;  1JWA D;  3MJW A;  2V9H A;  3NOB A;  4REZ A;  4B95 A;  2BGF A;  3RNB C;  1QKZ A;  3S2A A;  2PJH A;  4NQL B;  4O1N A;  3N1Y C;  4K7W A;  5J2R A;  5H8Y E;  4ANX A;  1F9J A;  4PS8 A;  3SHQ A;  2O6V B;  1JAL A;  2D3C A;  2LGX A;  4TUU A;  3EFU A;  1Q1O A;  1GUA B;  3R3M A;  1T0Q C;  2XBB C;  1VDV A;  4KGT A;  2Z59 B;  4NY0 A;  1HTQ A;  4AJY B;  1E8W A;  4GDK A;  1ESF A;  3TEX A;  5IKC M;  4M0W A;  2PE9 A;  2PLP A;  1EO6 A;  4GB9 A;  3MC9 A;  4LNN A;  1R4M B;  3VH4 B;  2KWD A;  3AEG B;  3EC8 A;  3QJZ A;  3KWL A;  1SF0 A;  1OQR A;  2LXA A;  4G3X B;  3BYY B;  4YTM B;  5CTR C;  1WGG A;  3TCA A;  2RDG A;  2KNB A;  3P4P B;  3PRM B;  3QQ8 B;  4PK1 A;  2IDY A;  4KDL B;  4B0E A;  4JPS A;  4OVV A;  1F77 A;  3NG0 A;  1AAR A;  1YJJ A;  3BY4 B;  2JY6 A;  4KZ0 A;  3VTV A;  1A70 A;  1H4R A;  2WXP A;  2GRI A;  1ZDV A;  1TY2 A;  3QHT A;  4DHZ B;  5FKA C;  4GOC A;  4M02 A;  4ZRK A;  4BKG A;  5AZH A;  1SBB B;  3HM6 X;  3CF6 E;  2I2Y A;  2A4Z A;  2JRI B;  1TKG A;  3P1M A;  2FCQ A;  4WWP A;  1S3S G;  3RT3 B;  3QK0 A;  2LVQ A;  3AU5 A;  1YX6 B;  2ON8 A;  2BVC A;  3TEZ A;  5BMH A;  3B2G A;  3DBL I;  3OJ4 B;  4ZYS A;  4GGQ A;  1Q10 A;  1TIF A;  2HE7 A;  2WS3 B;  3ZVV A;  3DPD A;  4BZA A;  4JWU C;  1V5O A;  1L2N A;  2BQQ A;  3V6E B;  4XE0 A;  4BOZ B;  3GE3 C;  1GAQ B;  5FK9 C;  4WH4 A;  1ZP0 B;  2WLB A;  5JHB A;  2BYT A;  2KDI A;  2NBU A;  3KVF B;  2KK8 A;  1YMH E;  1E8Z A;  4LJP B;  1WM2 A;  3R8B A;  2CU3 A;  4FXC A;  4M0W B;  2RMM A;  1J0G A;  3N3K B;  3WAO A;  2VH2 A;  3MTN B;  2FUH B;  4HJK A;  2KLG A;  1XLQ A;  1RWS A;  1D3Z A;  4BKS D;  4EOY A;  4DK5 A;  4DDG D;  1TJE A;  3QIJ A;  2JWU A;  2DZI A;  4DHZ E;  4US8 A;  1JWM D;  1UH6 A;  2Y5B B;  5HI1 A;  3T9L A;  2PVO D;  3MHS D;  1GC7 A;  3R7Q A;  3OAW A;  4P16 A;  4WWN A;  1N5X A;  3N32 A;  2YEP B;  2ZNV B;  3ZTC A;  5J18 A;  1J8C A;  2L1A A;  4FUL A;  3FAH A;  2KJH B;  2DYB A;  3RZW C;  3HVD A;  3LB8 C;  2FIF A;  3KYC D;  1ET9 A;  5D3D A;  3ZXR A;  5E6P A;  3WAN A;  1JRU A;  1J7C A;  2L52 A;  2RGF A;  4AWJ A;  3VUY A;  2JQR B;  2KAJ A;  1F2R C;  4A90 A;  2IZV B;  4EFO A;  3VDZ A;  1OTR B;  4W9G A;  3PLU A;  2ZVN A;  4EZJ A;  2V4I B;  3EHV A;  3HVZ A;  4K1R B;  1N60 A;  4C7Y A;  1TKY A;  4ANU A;  4CO7 A;  4XZ4 A;  3SEB A;  1OEY A;  1XCQ L;  1K8R B;  1WWT A;  2J0K A;  3L4P A;  3ZRC A;  3HM3 A;  4RGO S;  2DYM A;  1YJI A;  1QOB A;  2WDR B;  3RFZ B;  3Q8C A;  1L0Y B;  4OZA A;  1XO3 A;  2QEJ C;  1WMH A;  3P4S B;  3I9V 1;  3H8H A;  2M0A A;  2KAN A;  3P4Q B;  4MEM A;  3V62 A;  1UF0 A;  2V4L A;  4GLS C;  1YN5 A;  1T0S C;  2UYZ B;  4BKT A;  1FXT B;  2BT6 A;  2DBY A;  1UWX A;  4GMV A;  1Z5S B;  3NUH B;  3MJ5 A;  1TS4 A;  3B08 A;  2BF8 B;  3BVM A;  1T5X D;  1PGA A;  1ZUD 2;  2BBC A;  4KGR A;  1TGZ B;  3H7P A;  4BFR A;  3L17 A;  2BS4 B;  2KN4 A;  1ACC A;  2J42 A;  2JX5 A;  2CHX A;  2LUM A;  1GJZ A;  2GB1 A;  2JXT A;  1ZGU B;  3AU4 A;  1F0Z A;  1ROE A;  3CWI A;  2WU5 B;  2D3B A;  3IVF A;  4NJC A;  2MX2 A;  4ZRJ A;  1JWS D;  2DAJ A;  5AZG A;  3URY A;  1RRB A;  4RM9 A;  4TQ0 A;  3WA0 A;  2M17 A;  2L00 B;  2ZW1 A;  2XEW A;  3EFC A;  3RNA C;  2NPT B;  5DPT A;  1XCT L;  5BO4 B;  5GMV A;  3L13 A;  3W1S A;  4ZYN A;  3I63 C;  4KSK C;  1E7P B;  3PO0 A;  4WAF A;  2AQ3 B;  4LNO A;  2Z0D B;  3Q69 A;  5BMG A;  3W2D A;  5LNK 1;  1R4M I;  3GOE A;  2LUE A;  4ARI A;  5G2N A;  4AUQ C;  1VD2 A;  2MHJ A;  4LDT B;  2LHD A;  2DLB A;  3NJT A;  2UWQ A;  3DBL B;  4DWF A;  2WXO A;  4HXD A;  1OQY A;  3KWV A;  1VR9 A;  3NVW A;  4N6E B;  1DYQ A;  1FXA A;  2BYV E;  1D4B A;  1RFK A;  1WX8 A;  3ZJU A;  3VFK A;  3ENE A;  4IWO A;  1T3Q A;  2WXI A;  2IO0 B;  1N62 A;  4AS1 A;  1UBI A;  1NEK B;  3PGE A;  3PTF C;  4K3C A;  1WH3 A;  5BYR A;  4XYC A;  1I35 A;  1V1P A;  1WE7 A;  2NCN A;  3QA8 A;  3U7Z A;  3APF A;  1ZXI A;  4JLC A;  1ZPS A;  2N9L A;  3U8Z A;  2ZPY A;  4W9D A;  3ZIM A;  1GB1 A;  3UIN B;  2K22 A;  2KX3 A;  1P1A A;  4NAW A;  1QLB B;  1CMX B;  3A33 B;  2OOB B;  4JX1 C;  4OVU A;  4DHJ D;  2L0F A;  2FBW B;  2KQ7 A;  5DPR A;  2MJE A;  2KD0 A;  2NMQ A;  4G0N B;  1I4G A;  2WX1 A;  4C7Z A;  1VZ8 A;  1YX5 B;  1WX9 A;  4WWO A;  1PFD A;  2BYF A;  3IT6 B;  1TTN A;  2JZP A;  1WY8 A;  4KZC A;  4MT5 A;  4WQO B;  4C80 A;  4IM3 A;  4ACF A;  1E5W A;  5AEK B;  3EEC A;  1ZOY B;  1TT5 B;  4XC2 A;  2JWZ A;  4E71 A;  1ENF A;  1EWC A;  1WR1 A;  2FUG 1;  3APC A;  2K9X A;  3AED B;  4NNJ B;  1V2Y A;  4I6P A;  1WJN A;  2MBE A;  2JZZ A;  2O6V A;  3VR9 B;  1QOG A;  2Y3A A;  3WAM A;  2LD9 A;  2DHZ A;  2D3A A;  4W9H A;  1FO4 A;  3GP7 A;  2LRU A;  1E10 A;  2KQS A;  2NTT A;  2V3S A;  4D2K A;  5IO9 A;  1XLO A;  5J17 A;  2KWU B;  1LXD A;  2K6Q A;  1VLB A;  3N1X C;  3AH7 A;  2J0M A;  4EE2 A;  4C00 A;  2GBR A;  3E56 A;  3RNF C;  2HJ1 A;  2K0P A;  4G50 A;  1WJ4 A;  3HHM A;  1SIJ A;  4YT0 B;  1V5T A;  2KMC A;  1PGX A;  2KC1 A;  1IBX A;  2RPV A;  5C23 A;  3QC8 B;  4HDQ A;  2AX5 A;  2LGY A;  3BVZ A;  4HCP B;  4NAW B;  2C5L C;  2VZK D;  1C76 A;  4W9J A;  4GSW A;  4FHK A;  4PS7 A;  1S1Q B;  2K25 A;  5D3I B;  2J52 A;  3ZRF A;  3LJ3 A;  2FCN A;  1HZ6 A;  2KVZ A;  2YLM A;  4PYU A;  3UI3 A;  1YN3 A;  4I6L B;  4RH6 A;  4WJQ A;  3N9Y C;  4RFB A;  1HQR D;  4L23 A;  3ABV B;  3E9S A;  2IY0 B;  4IC7 B;  4YSZ B;  2D3G A;  2V3N A;  3BII D;  2C9W B;  2LAS A;  2KFK B;  1STE A;  1PQS A;  2LGD A;  1OEY J;  1WX7 A;  3U7D A;  1BML C;  1Y56 A;  2QIE B;  2M56 B;  2BKR B;  3P63 A;  1HA5 A;  2IO3 B;  3T8M A;  4FBJ B;  4JQW C;  1QQR A;  1I4P A;  1MFW A;  2QDF A;  1KF6 B;  3HIZ A;  2XK5 B;  2J0J A;  3SR6 A;  1WI0 A;  5EE0 A;  4IG7 B;  1HZ5 A;  3AE1 B;  1UGJ A;  1LFD A;  3HUI A;  5HFY A;  4HKQ A;  2EKI A;  3MC8 A;  2H88 B;  3CST A;  3ZNH B;  2YEP F;  5EE9 A;  1QT9 A;  3C0R B;  3TJP A;  5TR5 A;  2MEK A;  2EEL A;  1H8C A;  1SB3 C;  3VTW A;  2KDM A; 
#chains in the Genus database with same CATH homology
 4TSS A;  3IAS 1;  1C9F A;  4R3D A;  4US8 A;  1JWM D;  2W3S A;  2W54 A;  1SSN A;  1TY0 A;  5HI1 A;  2IGH A;  2PVO D;  4YWG G;  1PUT A;  1EM7 A;  4RCO A;  1VRA B;  4ZRP A;  4H2A A;  4IDI A;  2OHF A;  4XDD A;  3T3O A;  2INN E;  1IBX B;  4P16 A;  1QOF A;  3ZGZ A;  1N5X A;  4ZRQ A;  2YEP B;  3EGR A;  2JYT A;  3EA6 A;  2Q5W D;  3HRD D;  3SFE B;  2L1A A;  3FAH A;  2N9K A;  4OZB A;  3HVD A;  2BB5 A;  1IUE A;  3LB8 C;  1ZXH A;  1E6E B;  2FE8 A;  1ET9 A;  5D3D A;  1D5M C;  1P7E A;  1J7C A;  2L52 A;  2JQR B;  1JRO A;  2KAJ A;  1F2R C;  5BYS A;  1GPX A;  4OZC A;  4A90 A;  3AEA B;  2J53 A;  3W5V B;  4RF1 A;  1FM0 D;  2IJ0 A;  3SFD B;  3BVG A;  2V4I B;  2WNM A;  3T3N A;  3HVZ A;  4KKJ A;  1D5Z C;  1N60 A;  1I4H A;  1OFF A;  4C7Y A;  1TKY A;  1CZP A;  3BK2 A;  5GXG B;  1L5P A;  2Y5C A;  1C78 A;  3SEB A;  1XCQ L;  2AQ2 B;  2IGG A;  3IT4 B;  5E6J A;  1WWT A;  2WXG A;  4A8X C;  3L4P A;  1R7S A;  1GB4 A;  1B1Z A;  1J7A A;  1C4C A;  1WGK A;  4RGO S;  2DYM A;  1SE2 A;  4LLG M;  1YJI A;  3VR8 B;  3MFG A;  1QOB A;  2WDR B;  2WXL A;  3Q8A A;  4WQM A;  2QSD A;  1TKE A;  3Q8C A;  3V05 A;  3RFZ B;  2WXH A;  3GB1 A;  1L0Y B;  4OZA A;  1PYW D;  2JSV X;  3R2T A;  1XO3 A;  2INP E;  2QMT A;  2QEJ C;  3ETR A;  2ACZ B;  5TSS A;  3P4S B;  3I9V 1;  4XDC A;  3H8H A;  4N59 A;  2M0A A;  2BS2 B;  3P4Q B;  2MJD A;  3VRA B;  1FD6 A;  1FFU A;  3DWG C;  1ET6 A;  2LMC A;  4JWS C;  4GLS C;  3O13 A;  1YN5 A;  3P4R B;  1GOZ A;  4OVZ A;  1VJK A;  4MAC A;  1XXG A;  4C56 C;  3NS1 A;  3DWM A;  1C77 A;  2L32 A;  3TUO A;  5I4D A;  1N5W A;  1TZO A;  2ZW0 A;  2DBY A;  2BT6 A;  1UWX A;  4HRO A;  1BXT A;  1D6E C;  3NUH B;  3Q8E A;  2QJL A;  3ZJV A;  2G1E A;  3MJ5 A;  1PGB A;  3B2F A;  1L4D B;  2WQY B;  4ZOH C;  1L0X B;  1TS4 A;  3J9C A;  1MVK A;  4YTN B;  4AQ7 A;  2PIA A;  3BVM A;  1T5X D;  1PGA A;  1ZUD 2;  2BBC A;  4KGR A;  2WP9 B;  4UDU C;  1I7H A;  2BS4 B;  2PMV A;  3BK1 A;  2WXQ A;  3NRZ A;  2KN4 A;  1K51 A;  1YQ4 B;  3IXS A;  1OQQ A;  1E0Z A;  1ACC A;  2J42 A;  2JX5 A;  1FRD A;  2LUM A;  2J4X A;  1MHH E;  1N61 A;  2GB1 A;  3KLS X;  2JXT A;  2BS3 B;  2MJ3 A;  2HDE A;  1F0Z A;  1ROE A;  3MC0 B;  3B9J A;  2W82 A;  2WXK A;  2PVG C;  2WU5 B;  1AW7 A;  3CWI A;  1SXT A;  2WDV B;  4IKG A;  4NJC A;  3TEW A;  1JWS D;  3URY A;  2KMM A;  2RDH A;  4TQ0 A;  1YNT E;  1KFY B;  1FNW A;  3U52 E;  1JWU D;  1VZ7 A;  1FIQ A;  2H89 B;  1I4R A;  1KRH A;  2G9H D;  4YXD B;  4WIP A;  3KQ4 A;  2ZW1 A;  2N0S B;  3Q8F A;  4P6V F;  1XCT L;  1MPE A;  1V97 A;  2GI9 A;  1KLG D;  4IOI E;  4DQO C;  2WXN A;  3W1S A;  2OED A;  5AUI A;  3ZYY X;  1MI0 A;  2W3R A;  1FMA D;  4OW0 A;  1E7P B;  1YQ3 B;  3PO0 A;  1DGJ A;  1NYR A;  3PZ7 A;  1FRR A;  1CQV A;  2X38 A;  3AV8 A;  4ZHP A;  4WAF A;  2AQ3 B;  2IPK D;  3W9C B;  3VRB B;  3Q69 A;  1UNS A;  1FFV A;  5BMG A;  3W2D A;  5LNK 1;  4B0M A;  1EU3 A;  4RGT A;  5HG2 A;  1SJE D;  4ARI A;  3BWU D;  3AMZ A;  4KX6 B;  2KAC A;  2LHD A;  2V0G A;  4HRS A;  2DLB A;  1SEB D;  1C4P A;  2WXO A;  1JCK B;  1V1P B;  2MH7 A;  3KWV A;  3NVW A;  1VR9 A;  4N6E B;  1DYQ A;  1FXA A;  1SE4 A;  1D4B A;  1RFK A;  3ZJU A;  1T3Q A;  1WSP A;  2WXI A;  1AN8 A;  4RNA A;  1N62 A;  4Q2J A;  3AE5 B;  1DOX A;  4A6Q A;  4AS1 A;  1SE3 A;  3LXF A;  1NEK B;  5BYR A;  3AN1 A;  1SJH D;  4LK0 M;  1TS2 A;  1UWM A;  1V1P A;  1CJE A;  1JRP A;  4TQ1 A;  4USA A;  4HKZ E;  1ZE3 D;  3TSS A;  2ICI A;  2HTM E;  4RF0 A;  2CJO A;  4JE3 B;  2Y5P A;  1XLP A;  3U7Z A;  3V3X A;  1ZXI A;  1HXY D;  4XWT A;  1ZPS A;  1BUI C;  2N9L A;  3C8Y A;  2SAK A;  1L6U A;  1YN4 A;  2B76 B;  2L83 A;  2DYO A;  3AE4 B;  1GB1 A;  1FEH A;  2PKO A;  5T8I A;  3AEF B;  5EE3 A;  2K22 A;  4OHJ A;  2BW2 A;  1NEN B;  1NYQ A;  1QLB B;  1L4Z B;  3TEY A;  3IAM 1;  1KTK A;  3AEB B;  4JX1 C;  1T6B X;  5C3J B;  4HEA 1;  4WUR A;  3AE2 B;  2FBW B;  1QF6 A;  2PTL A;  2LFI A;  2AQ1 B;  1P7F A;  1ZDX A;  1V1O A;  2SEB D;  2WDQ B;  4HJG E;  3RPF C;  2MJE A;  3ZJT A;  2NMQ A;  2XNA C;  1EU4 A;  1N63 A;  1KH0 A;  2JYE A;  1JML A;  1K50 A;  3NVY A;  1TYG B;  1I4G A;  2K3U A;  1PDX A;  4C7Z A;  1VZ8 A;  3BZD B;  1PFD A;  1FCL A;  3IT6 B;  5D7G A;  2LJI A;  4KGS A;  1XF5 L;  3CIR B;  1CK1 A;  2JZP A;  1WYG A;  4US9 A;  3U2S C;  3FC4 A;  4NZL B;  5BMI A;  4MT5 A;  4TMA B;  3U4E G;  1JWA D;  2W55 A;  3EUB 2;  4C80 A;  2V3P A;  2WU2 B;  1TS5 A;  4REZ A;  1QKZ A;  3NVZ A;  4GDK B;  1ZOY B;  4O1N A;  2N7J A;  4NAM A;  5JXV A;  5H8Y E;  5MPO A;  4YSY B;  1D5X C;  3FIL B;  4MM3 B;  1JAL A;  1ENF A;  1EWC A;  1EWY C;  2VZK B;  1FNV A;  2FUG 1;  2K9X A;  4RGN A;  1AYF A;  1VDV A;  3AED B;  4KGT A;  1IGD A;  4KKI A;  2BB6 A;  4N58 A;  4A9A A;  1ESF A;  3TEX A;  4M0W A;  3MP9 A;  3NZ3 A;  1QIL A;  2PLP A;  5BYQ A;  1JQ4 A;  1AWD A;  3FIL A;  1I4Q A;  3VR9 B;  1QOG A;  2Y3A A;  3MHZ A;  4J3O D;  2KWD A;  4WWM A;  5G5G A;  1E9M A;  3OWE B;  3AEG B;  4XWW A;  1FO4 A;  3GP7 A;  3BYT B;  1K53 A;  1E10 A;  2K5P A;  2WXF A;  1DOI A;  3AE6 B;  4MH8 A;  3KWL A;  1SF0 A;  2NTT A;  5EE1 A;  2BTE A;  1OQR A;  4D2K A;  4YSX B;  3BYY B;  3AE7 B;  4ZHO A;  4YTM B;  1XLO A;  4ARC A;  1TS3 A;  2RDG A;  3P4P B;  1VLB A;  5G5H A;  3AH7 A;  2IDY A;  3P42 A;  4B0E A;  4ITK A;  4JPS A;  1IGC A;  1F77 A;  5C2T B;  4EE2 A;  2WXJ A;  4RGM A;  1YJJ A;  3PZ8 A;  3E56 A;  2K0P A;  4CQN A;  4LTU A;  3W5U B;  1A70 A;  1SIJ A;  2E3T A;  4YT0 B;  2WXP A;  1PGX A;  2GRI A;  3LYY A;  5AUK A;  1ZDV A;  1IBX A;  2WXM A;  2RPV A;  1TY2 A;  4A55 A;  5HHD G;  5FKA C;  4YTP B;  4PT5 A;  3VQI A;  1NVI D;  2AX5 A;  3BVZ A;  2LGI A;  4NAW B;  3R2I A;  1SBB B;  1C76 A;  2VZK D;  1C4A A;  2TSS A;  1NI3 A;  1K52 A;  2I2Y A;  2KQ4 X;  1TKG A;  3P1M A;  1KLU D;  1DOY A;  5H92 C;  1F2R I;  3I57 A;  5D3I B;  3ZQ4 A;  2J52 A;  1MHX A;  2ON8 A;  3TEZ A;  3AEC B;  1HZ6 A;  5BMH A;  3B2G A;  3AM9 A;  1B9R A;  2PW9 A;  2QIL A;  2M19 A;  2NTS A;  4ZYS A;  2XN9 C;  1YN3 A;  3UI3 A;  1L6V A;  4RH6 A;  1Q10 A;  2DWQ A;  3N9Y C;  4L2Y A;  4RFB A;  1HQR D;  4L23 A;  3ABV B;  3E9S A;  2WS3 B;  4YSZ B;  2V3N A;  3GS2 A;  4JWU C;  2E6X A;  1VZ6 A;  3BII D;  4L1B A;  2R61 A;  1L0V B;  4XE0 A;  1RYJ A;  1RM6 C;  1STE A;  3AEE B;  1GAQ B;  1JWB D;  1BML C;  5FK9 C;  1Y56 A;  2QIE B;  3AE3 B;  1FNU A;  2M56 B;  3AE9 B;  2CJN A;  3P63 A;  4WH4 A;  4DXG A;  1HA5 A;  3AB5 A;  1ZP0 B;  2WLB A;  2BYT A;  2IGD A;  1FXI A;  2Z8L A;  1QQR A;  1I4P A;  2LEK A;  1UUP A;  4DXF A;  1KF6 B;  1YMH E;  1QOA A;  3SR6 A;  2LHE A;  5EE0 A;  3R8B A;  3AE8 B;  3NVV A;  2CU3 A;  4GDL B;  4FXC A;  2RMM A;  1HZ5 A;  3AE1 B;  1UGJ A;  1J7B A;  2I38 A;  1C79 A;  1JW9 D;  3HUI A;  1V8C A;  5HFY A;  1WRI A;  1XLN A;  3Q8B A;  4HKQ A;  1WXQ A;  1I4X A;  3WCQ A;  2EKI A;  2WXR A;  2H88 B;  2ONQ A;  1HEZ E;  1XEE A;  2YEP F;  1FCC C;  2D5G A;  5EE9 A;  1QT9 A;  2JU6 X;  1M4V A;  1XLQ A;  1RWS A;  2MEK A;  2EEL A;  1LO5 D;  1SB3 C;  2KDM A;  1TJE A;  2JWU A;  5FR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...