1WXSA

Solution structure of ufm1, a ubiquitin-fold modifier
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
88
structure length
88
Chain Sequence
GPLGSMSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and dynamics of Ufm1, a ubiquitin-fold modifier 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords Ubiquitin-fold Modifier 1
total genus 11
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03671 Ufm1 Ubiquitin fold modifier 1 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wxsA00
4MGKE 1Q1OA 1XD3B 4A3OA 1Q0WB 2MQJA 2KLCA 2NPTB 2KWCA 3H9DA 4HK2A 4KSLC 1V6EA 2XK5A 2ASQA 4WQOB 2ZEQA 2C9WB 2GBJA 4DK5A 3PRZA 3L0WB 3ZRFA 1Y8RC 3HK0A 4K7UA 3WAPA 3GOEA 2IY0B 1R4NI 2NS5A 3KUDB 4FHKA 1V80A 2KTRA 2YLMA 5DCNA 3GZNI 5CHFA 3KH0A 1GJZA 2MP2B 1E90A 3KUCB 4BKSA 2G4SA 1J0GA 2NBUA 3R3MA 4MDKE 5JHAA 4E3CA 3M3JA 3EFUA 1WGYA 3ENEA 3U7DA 2DENB 2V1YA 1R4MI 1NI2A 2KQSA 1BT0A 2KNBA 3L16A 4LDTB 5AEKB 2K6DB 3QHTA 2KLGA 2FNJB 3UINB 1HE8A 4J6IA 3VHTC 2K39A 3NS8A 2AYOB 3PRMB 4GOCA 3A9JA 3R7QA 4NPNA 3S2AA 5CX3A 2KJHB 2RPQA 4LJOB 1YJ1A 1U4AA 2RSUA 3PV1A 4GDLB 1GG3A 4ICUA 2LVOA 3V61A 2O2VB 4FN2A 2C7HA 2PPHA 5D7GA 3A9KB 1V86A 2FAZA 2BYEA 2G45B 2C7MB 3EECA 1WM3A 4BFRA 2J7QB 3VQIA 3B0AA 3M95A 3W1SC 4G3XB 4HCNB 1I35A 2DX5B 1AARA 5L83A 2KC1A 3P2BA 4KIKB 4LDTD 3QX1A 3A33B 4BBNF 1VD2A 1UBIA 5DPTA 1TBEA 2BWFA 3PGEA 1WI0A 2OOBB 1S3SG 2L3ZA 4W9GA 4EZKA 1KJTA 4YL8A 5G2NA 3R66C 4DHJB 2R2QA 4WJPA 3Q3JA 2DHZA 4XX5A 2BYFA 3KUZA 3M63B 1P1AA 4URKA 1P0RA 2M0XA 4DWFA 4GSWA 3ZDMC 2KWUB 2GBMA 4A20A 4K1RB 4ZRIA 2WX0A 1UELA 2UWQA 4E74A 2MCNB 2ZPNA 3ZNID 2GBRA 4ANVA 3PVLA 4KDLB 3ONSA 3RT3B 3WALA 2FUHB 2WWZA 3MHSD 4GIVA 4MJSA 3TIXA 1E8XA 4DBGA 4JIOU 2EMSA 5JHBA 3MTNB 5IA7A 5JH5C 1WX7A 2LRWA 4KVGB 4MSMB 2AL6A 3RUIB 2WDTB 2BWES 2JUOA 2KHWB 3WIMA 2N9PC 1EF1A 3SHQA 4WAAA 1E8WA 4IM3A 2LVPA 3HIZA 4IUMB 3TCAA 5LLIA 1WMHA 3HHMA 1GNUA 2JZ3B 2YVCA 2BGFA 3ZW3A 2GOWA 2GBKA 3T8MA 1M94A 3ZKJC 4BKSD 2JPHA 1WY8A 4II2B 2PE6B 1WGHA 2LVQA 3L10B 1WJ6A 3C0RB 4RM8A 1TZ1A 1WJ4A 2AEHA 4IWQA 4MSQB 3V6EB 4B6WA 1UH6A 2DYOA 3IHPC 2KDIA 2KN5A 4WWPA 5D6JB 4MJSB 4NAWB 2EMTA 3DDCB 3DBHI 3APCA 2KJ6A 4TV3A 3QA8A 2HD5B 4B9KA 1ZGUB 3KYDD 2MW5A 2IO2B 2Z0DB 1Q5WB 4PS8A 2BKRB 1E5WA 2O6VA 4MEMA 2MSED 4W9EA 4W9KA 4GU2A 1V81A 2M8SA 4MGIE 1WZ0A 2PEAA 2M17A 3VDZA 4DDID 4PS7A 2EKEC 2WX1A 3DVNU 3OJ3A 3APFA 2NPTA 3Q3FA 5G55A 3U30A 4AWJA 2N9EB 1EF5A 3WA0A 3OJ4B 3PS6A 4TQ0A 2CKHB 3VAWA 2HE7A 3ZNZB 3NOBA 3PLUA 3K9OB 4FJVB 2PE9A 1NDDA 2LWPA 3W1SA 4OVUA 3M62B 1J8CA 3ZVVA 5C23A 4MH0E 2M4NA 1WX9A 2L00B 2MBQA 3VUYA 2LASA 4HCPB 3KVFB 1GC6A 1NBFC 3QAQA 3N30A 3PHXB 1UZXB 2L0FA 2MLBA 4RM9A 2GBNA 4GDKA 4DHJD 4TKNA 3WAOA 1WXMA 1G6JA 2BF8B 3AU5A 4JQWC 4N9F4 2LGXA 2REXA 4GN1A 4WJQA 3RZFA 3VXWA 3CMMB 4IC7B 2XBBC 4FADA 2MBEA 1E7VA 4MGZE 5DPRA 3UIPB 1H8CA 3EC8A 3SDLC 5J18A 3D32A 1RFAA 3ZIMA 1SIFA 3TMPB 2ZNVC 4GMVA 4JLCA 5D94A 2L8JA 3B1LX 3SU8X 2KK8A 4E71A 2KXJA 2FCNA 4HXDA 4ANUA 5LXHA 2JF5A 2KZRA 4EFOA 2L76A 2ZJDA 2AWTA 3IG3A 3BINA 1KM7A 2KDBA 3DOWA 3NHEB 4PYZA 4K7WA 1RAXA 1WYWB 4ZRKA 2KO3A 4CYEA 4BOSC 3X0WA 4B95A 1XT9B 2BKFA 2D10A 3AULA 2G3QB 5J17A 2MBHA 4ANXA 1ISNA 4M0WB 2Z59B 1E8YA 3QJZA 3PLVA 4JL9A 2CHWA 2JZZA 2KDEB 4NJ7A 4W9JA 2JWZA 3TJPA 3V6CB 3UIOB 3VTWA 2KFKB 4HPLB 2J0KA 2KDFB 1EO6A 1WGRA 2NVUI 4DHZB 2GMIC 3ZDTA 4NQKE 3OAWA 3PTFC 4DDGD 4FBJB 3VVWB 1ZW7A 1V5TA 3VFKA 2O6VD 3PPAA 1PQSA 4ZDVA 2N1VA 1OEYA 4ICVA 5AZFA 4W9DA 2IBIB 4BKTA 1LM8B 1OGWA 4WJNA 2ZVNA 3DVGX 4LJPB 5C1ZA 2LRUA 2CS4A 3ZLZA 2NR2A 3ML9A 3V62A 4IWOA 4IWPA 2LI5A 2ZCBA 3DBSA 4TUUA 1UD7A 2G4DB 1RRBA 4K81A 4GGQA 2MA9B 3H6NA 3AU4A 2NBVB 3APDA 3N3KB 3WANA 1YQBA 1YX5B 2KMAA 4FULA 4GB9A 4ZYNA 4AUQC 1WJNA 3HM3A 3JSVB 1QZEA 2MWSB 3ZO5B 3DBRI 1P9DU 2LXAA 4GDKB 3TL5A 4F8CB 2D2QA 3IBEA 4W9IA 3RD2A 1WF9A 5LXIB 1KOTA 1WGDA 3UGBB 5J2RA 2O2VA 2JXXA 2FIDA 3T9LA 3CF6E 1WE6A 2XK5B 4ANWA 4AOFA 4AP4C 4NAWA 1S1QB 4NJ6A 1IYFA 1LXDA 3WAMA 4CO7A 2FCQA 3QWZB 4W9HA 3RULA 1TTNA 3L08A 3A4SC 2AL3A 4KV2A 2IY1B 1IP9A 5AZHA 3ZRCA 2O6VB 3ZTCA 1E7UA 2K25A 5EDSA 1D3ZA 3AXCA 3ALBA 4G11A 2LD9A 1OTRB 1C3TA 2L0TA 3TBLD 3H7PA 2KJRA 3DPDA 5FR6A 2BYVE 4EOYA 1YD8U 3KW5B 2NBWB 4EEWA 4WJOA 3I3TB 3RZWC 1ZKHA 2NCNA 3HM6X 2LUEA 4HDQA 2K8CA 3A9JB 2ZZPB 4TQ1A 4HWIB 1RLFA 4EUTA 3H1UA 1YX6B 1WRDB 2DAFA 3QIJA 2OJRA 2UYZB 2J0MA 1OEYJ 1XQQA 3ZTDA 2DAJA 2A4ZA 2VRRB 4EZJA 1J19A 3X23A 4A3PA 3A9KA 3L13A 4WWOA 2IO0B 4M8MA 3AI5A 3PRPB 1SE9A 1GUAB 2DZMA 2FCMA 3EHVA 2Z0EB 3VUWA 2L05A 4AJWA 3O65B 4II3B 1L7YA 4BKGA 1L2NA 3BY4B 2I1JA 1UBQA 1VCBA 3DVNV 4HPMB 3V60A 4I6LB 5L95C 4DXAB 2ZCCA 2M1MA 1EUVB 4FJZA 4KIKA 5IAAC 1V5OA 2DYMA 5E6PA 3CSFA 2D3GA 3JYUA 4HVBA 4P7IA 5D2MB 4K7SA 1H4RA 1LFDA 2DZKA 4BBNC 1IPGA 2KD0A 4FA6A 3RCZA 3PT2B 2K8HA 3DQVA 1LQBA 2CU1A 2LGYA 3UF8A 4XC2A 3JW0X 3SD5A 4EKUA 2PJHA 4W9FA 3N32A 2W9NA 3QARA 2J0JA 3A1QB 4XZ4A 3PSEB 4GXBA 3PHWB 4X57B 2KTRB 3QC8B 2Y5BB 3KYCD 1WFYA 3H7SA 2KFJA 1K8RB 3IVFA 2IO3B 2I1KA 1CMXB 2JRHA 2R2OA 3VTUA 2K1FA 5TR5A 4HJKA 4M8NA 4PYUA 4IM0A 4HLEA 4KZCA 2ZPYA 2KC2A 5GMVA 4GDLA 1F9JA 4KSKC 5E6OA 4EZLA 4G50A 4F1SA 1WJUA 1Z2MA 3U8ZA 4BVUC 2WYQA 3ML8A 1WXSA 1X1MA 2BPSA 1SGHA 2MBBB 4KDIC 3MJWA 2MX2A 3VH3B 1I42A 1OQYA 2K8BA 2HTHA 2KKCA 4I6NB 2K6QA 4IW0A 4NY0A 3NZUA 3ZNGC 3ZUNA 2DYBA 5HKHA 3LJ3A 3QQ8B 5CHWA 2C60A 1WM2A 2A5UA 3QCAA 2KVRA 2KTFA 2LZ6A 4IM2A 4BOZB 4NNJB 2IZVB 1P3QU 4LCDE 2D11A 1UGMA 2CHXA 3RYTA 1YIWA 5DPSA 4WWNA 2LXCA 3VTVA 1WR1A 4FHJA 2CHZA 2KQ7A 3W1YA 5AZGA 1C1YB 1V9JA 2C7NB 3DCGA 3ECIA 3DBLI 3UQBA 2LJ5A 4RMAA 2IO1B 4FJYA 1FXTB 2JY6A 5E6NA 2DZIA 3JVZX 3VUXA 3VH4B 1WGGA 3NY5A 4JGHB 2D07B 5CHVC 4G0NB 2KMCA 5BO4B 1WZ3A 2DZJA 2HJ8A 1WR6E 2LGDA 3A1QA 3OLMD 4NQLB 1WE7A 3L17A 1WH3A 1Z5SB 2N1WA 3QK0A 4OVVA 3ZNHB 1V2YA 3H7PB 2JT4B 2JRIB 2RD0A 1T0YA 3PZDA 2KFKA 1V49A 2N9XA 1WXVA 1E8ZA 3PREA 4AJYB 1JRUA 2FIFA 4I6PA 5JZEB 2KWVB 5DPWA 3L54A 5CTRC 2XEWA 2B3AA 1WIAA 2N7DA 2IYDB 2MRPA 4HDOA 4ASWC 1KLVA 2C5LC 3B08A 2KOXA 3CSTA 3R7RA 1WX8A 3K9PB 2N4FA 3NZSA 4MGYE 2KX0A 3LDZE 2FCSA 2QHOA 2V3SA 1GC7A 1MG8A 4CHKA 3A4RA 4MM3A 4MELA 4IG7B 4ZRJA 2MBOA 3UQAA 2N7EA 1WXAA 3IFWB 2MP2A 5KHOA 4DHZE 2ZNVB 4PS3A 3JSVA 4FLHA 2V4LA 1P98A 2KX3A 4W9LA 5KHQA 2RR9A 1A5RA 3DVGY 4W9CA 4F7ZA 4KZ0A 1WMHB 2L7RA 2RGFA 2CR5A 2JVCA 1TGZB 2KANA 2ZVOA
chains in the Genus database with same CATH superfamily
4MGKE 1Q1OA 1Q0WB 2KLCA 2KWCA 4HK2A 4WQOB 3TEWA 4YSYB 1R4NI 2NS5A 3N1XC 3P4SB 1QF6A 2YLMA 5DCNA 1OFFA 2JX5A 5CHFA 1GJZA 5D3IB 3BVMA 3KUCB 3R3MA 3ENEA 2K9XA 5AEKB 1A70A 1I4GA 3U7ZA 1XCTL 1QOFA 3UINB 5CX3A 4YSXB 1YJ1A 3P42A 2O2VB 2HJ1A 2C7HA 1MPEA 2G45B 3EECA 4HRSA 4BFRA 3VQIA 1QOGA 2J4XA 5EE9A 1XLPA 5L83A 2D3BA 2M19A 4KIKB 4BBNF 1J7AA 1TBEA 1S3SG 3VRBB 1KJTA 2DHZA 4XX5A 1GOZA 2ACZB 3ZDMC 1JCKB 2KWUB 2WX0A 3AH7A 3ZNID 4KDLB 5FR3A 3TSSA 3RT3B 3WALA 3MC9A 1L4ZB 2EMSA 5JHBA 5IA7A 2TSSA 4ARIA 2BWES 1T0QC 3ZYYX 2KHWB 3SHQA 3BVZA 1E8WA 1F52A 4D2KA 3TCAA 1GNUA 5BYRA 2AQ3B 2BGFA 1N6ZA 3ZW3A 2LFIA 4S0RA 2GBKA 2JZPA 1WY8A 4II2B 3L10B 1WJ4A 2AEHA 2DYOA 3IHPC 1ZOYB 3HRDD 3MFGA 3Q8EA 4TV3A 1E6EB 1L6UA 4ARCA 1SEBD 2X8XX 2OHFA 2IO2B 1Q5WB 2BKRB 4MEMA 5H92C 4W9EA 4GU2A 1V81A 3EA6A 2I2YA 1D5ZC 3Q3MC 2N0SB 2WX1A 4REZA 3APFA 2NPTA 1EF5A 2INPE 3KQ4A 4TQ0A 2HE7A 3N9YC 2W3SA 1NDDA 3ZVVA 4XYCA 5C23A 1RYJA 1TS3A 2M4NA 1WX9A 3RNBC 3RI7C 1WYGA 2GB1A 3ABVB 2BQQA 1NBFC 4C7ZA 3QAQA 4YSZB 4B0MA 4RM9A 4P16A 4GDKA 4DHJD 3HVZA 3TUOA 4WURA 1GPXA 1G6JA 4WJQA 3VXWA 2L83A 3CMMB 2XBBC 3P4PB 5GXGB 2FUG1 2YEPB 3EC8A 1CJEA 2H89B 5D94A 4E71A 3AE3B 2FCNA 1D6EC 2LGIA 3B2FA 2KZRA 2L76A 4JX1C 4K7WA 1RAXA 2WNMA 4XWTA 2KO3A 4BOSC 1BXTA 4B95A 4ANXA 4ACFA 2L32A 1ISNA 2PW9A 1OQRA 4M0WB 1T6BX 1CQVA 3UIOB 2KFKB 4HPLB 2KDFB 2HDEA 1FM0D 3AE2B 1HQRD 2WXFA 3PTFC 5HG2A 2RDGA 1ZW7A 1E7PB 4ZDVA 1SJED 4LJPB 2CS4A 3ZLZA 2NR2A 3V62A 4IWOA 4YTPB 3DBSA 1KTKA 1ZXHA 2WU2B 1SJHD 2MA9B 3N3KB 1YQBA 1YX5B 4ZYNA 3DWGC 3JSVB 1QZEA 3TEXA 1P9DU 3LB8C 3TEYA 3IBEA 2WLBA 2JYTA 3UGBB 2O2VA 3CIRB 2L1AA 3RPFC 3WAMA 1FFUA 4W9HA 1QLBB 1QOAA 2AL3A 5G5GA 3KLSX 4BAXA 1D3ZA 5HHDG 1C3TA 3N1ZC 1YOVB 3TBLD 3DPDA 5FR6A 2JWUA 3RZWC 2CJNA 4FXCA 4YWGG 1HTOA 2LUEA 4HDQA 3NZ3A 1RLFA 1YX6B 1WRDB 3QIJA 2UYZB 1OEYJ 1XQQA 2DAJA 3X23A 2LHEA 3A9KA 3L13A 2IO0B 1SE9A 2DZMA 3VUWA 3EHVA 2L05A 4MT5A 2DNFA 1L7YA 2M56B 4OHJA 1MFWA 5IAAC 3CSFA 3JYUA 4K3BA 1QQRA 1ESFA 3Q14C 1L6VA 1GAQB 4BBNC 1IPGA 3DQVA 4IDIA 3UF8A 2LGYA 3SFEB 4W9FA 4DQOC 2W9NA 3PSEB 4PT5A 3QC8B 5BMIA 1SBBB 3H7SA 1R4NB 1BUIC 3Q8CA 2KFJA 4EE2A 2IO3B 2BT6A 1CMXB 4M8NA 4IM0A 4UDUC 3DHGC 3GE8C 4HROA 5TSSA 5E6OA 4KSKC 2PTLA 5FK9C 4JWSC 1Z2MA 5EE0A 1WXSA 3NVYA 4LNNA 4ZHOA 1LO5D 3MJWA 3BK2A 3VH3B 2K8BA 4I6NB 3R2IA 4IW0A 1SSNA 5CHWA 4RGTA 1TS2A 1VR9A 1NENB 3IT4B 2KVRA 2LZ6A 3AEAB 1P3QU 5DPSA 4Q2JA 4WWNA 3R8BA 3IAM1 3IT6B 3W1YA 3ECIA 1I4HA 2ON8A 3UQBA 4RFBA 4WAFA 4ITKA 3Q69A 2BB5A 3NY5A 2LHDA 4JGHB 2D07B 4WH4A 3C19A 1WZ3A 1WR6E 2LGDA 1WE7A 1WH3A 1RFKA 2LUMA 3ZNHB 3FILA 2JRIB 2RD0A 2KFKA 1V49A 1DYQA 1E8ZA 4AJYB 2LMCA 1KF6B 5JZEB 3L54A 2B3AA 4LNKA 2IYDB 2MRPA 4HDOA 1KLVA 3CSTA 2KX0A 4MM3A 4ZRJA 3UQAA 2N7EA 3RFZB 2MP2A 2WXNA 3IXSA 1FFVA 3JSVA 2V4LA 4CQNA 5H8YE 2RR9A 4KKJA 1A5RA 3DVGY 4F7ZA 1WWTA 1WMHB 2L7RA 1VZ8A 4GGQA 2JVCA 2KANA 1VD2A 3WANA 3Q8AA 2H88B 1XD3B 4A3OA 2NPTB 1WXQA 3H9DA 2CU3A 3BYTB 2KACA 2ASQA 2ZEQA 2C9WB 1T3QA 2GBJA 2GI9A 3HK0A 2IY0B 2KTRA 1ACCA 4DXGA 2MP2B 2SEBD 1E90A 2WGSA 4BKSA 2G4SA 1N61A 1KRHA 4MDKE 4E3CA 1T0SC 1F2RI 3EFUA 3BIID 2DENB 2ONQA 3DHIC 3BK1A 1NI2A 2WDVB 3L16A 4LDTB 1XXGA 3QHTA 1YN3A 2KYWA 1V8CA 4J6IA 2K39A 3LXFA 4KX6B 3NS8A 2QDFA 2INDC 3S2AA 2WXIA 2D3CA 2RPQA 4LJOB 3V61A 4ICUA 2L52A 1PFDA 2LVOA 2KDMA 2BYEA 2BS4B 3M95A 4K3CA 4MH8A 3W1SC 4G3XB 4HCNB 2MEKA 2V4IB 1WRIA 2WHIA 1XLOA 4LDTD 1UUPA 2BWFA 3PGEA 1WI0A 4DHJB 2R2QA 3VR9B 2BYFA 2M0XA 1UGJA 3GB1A 1JWAD 4QAYA 1UELA 2UWQA 3MC8A 2MCNB 3PVLA 2WWZA 3MHSD 4GIVA 4MJSA 1E8XA 3BYYB 4JIOU 2WXGA 5JH5C 2LRWA 2G1EA 2WDTB 1V97A 1EF1A 4WAAA 4M00A 4IM3A 5IO9A 3HHMA 3T8MA 1M94A 1VZ6A 3DBRB 1WGHA 1WJ6A 4RM8A 4IWQA 2E6XA 3V6EB 3NS1A 4MSQB 1UH6A 1YQ3B 2KN5A 4MJSB 4NAWB 2EMTA 2HD5B 2D3AA 2WXKA 3ZXVA 4PS8A 2V3NA 3ZJVA 2KN4A 1MVKA 1WZ0A 1JQ4A 2KVZA 2EKEC 3DVNU 3Q8FA 5G55A 3U30A 1JROA 3OJ4B 3ZNZB 3O13A 3K9OB 2HTME 1B1ZA 2MJDA 3W2DA 2BVCA 2WXHA 1R7SA 1AW7A 3EGRA 4MH0E 4NAMA 2MBQA 2LASA 4HCPB 5IN7A 1JWMD 1STEA 3DWMA 1UZXB 2MLBA 3AE1B 1XO3A 3AEGB 4LNOA 4GN1A 4DXFA 3NG0A 4FADA 1B9RA 2MBEA 4MGZE 3UIPB 2FBWB 2QJLA 1RFAA 1SIFA 1L0XB 4C4VB 2ZNVC 4JLCA 1C4AA 3B1LX 4ANUA 4HXDA 4L2YA 1KM7A 4ZRKA 4CYEA 3X0WA 1XT9B 3OWEB 2G3QB 2K0PA 1YN5A 5IOIA 2CHWA 2KDEB 1D5XC 1N60A 2J0KA 1EO6A 1L4DB 5HFYA 4DDGD 4KGTA 1V5TA 3PPAA 5FKAC 1PQSA 3R2TA 1JWBD 4ICVA 4WJNA 2ZVNA 3DVGX 3EFCA 3ML9A 2LI5A 2ZCBA 4WQMA 3SEBA 1Y56A 1WJNA 3HM3A 2EELA 1IBXB 1C79A 1FNUA 2D2QA 3LYYA 1TT5B 5LXIB 2JXXA 2FIDA 4AP4C 1QOBA 3KWLA 1TJEA 4CO7A 4C00A 3SR6A 1SF0A 1XLQA 2IY1B 1IP9A 1ZE3D 2K25A 2WXRA 3H7PA 1FCCC 2BYVE 4EOYA 1NVID 2NBWB 3KW5B 4EEWA 3RNCC 3I3TB 1ZKHA 2NCNA 3HM6X 4TQ1A 1PUTA 2J52A 2QCZA 2VRRB 4YXDB 4EZJA 4A3PA 4WWOA 4M8MA 1GUAB 2Z0EB 4AJWA 1C77A 2INCC 2K3UA 1L2NA 1FRRA 4OZCA 4M0WA 2QSDA 3V60A 4DXAB 2WXJA 1QILA 2M1MA 1EUVB 2ZCCA 4FJZA 1ET9A 1IGDA 1N5WA 4TMAB 5E6PA 3TEZA 5T8IA 4P7IA 5D2MB 4LNFA 1LFDA 2DZKA 4FA6A 3RCZA 3PT2B 2W3RA 2QMTA 4XC2A 3N32A 3QARA 1F1HA 2J0JA 1XEEA 4H2AA 4X57B 1FCLA 2KTRB 4OW0A 2Y5BB 3KYCD 1K8RB 3AMZA 3VTUA 1Q10A 4HJGE 4KZCA 1YQ4B 2ZPYA 5GMVA 3V3XA 3U8ZA 4BVUC 1X1MA 1J7BA 2HTHA 3Q8BA 3NZUA 5EE1A 1MHHE 4M02A 2A5UA 3GZNB 4N6EB 2NTSA 4NNJB 2IZVB 2CHXA 3AECB 3RYTA 1QKZA 1YN4A 2CHZA 1C9FA 1C1YB 1WSPA 2RDHA 1DOXA 4RMAA 2IO1B 3VUXA 2KWDA 5CHVC 4G0NB 2KMCA 3I9V1 1PGXA 1P7FA 4P1CC 2BBCA 1FD6A 2HJ8A 4NQLB 3AE8B 5E6JA 1Z5SB 2N1WA 3QK0A 3Q3NC 2JT4B 1JMLA 2V0GA 1F0ZA 2N9XA 1WXVA 3PREA 3NRZA 4I6PA 2KWVB 1MI0A 2VH2A 2N7DA 4IKGA 2C5LC 2KOXA 3V05A 2FCSA 2QHOA 2V3SA 1GC7A 1MG8A 4CHKA 3NUHB 4XDCA 3A4RA 4IG7B 3IFWB 3GS2A 3BZDB 4DHZE 2CJOA 1P98A 2KX3A 4S17A 5BMHA 1K51A 2UU7A 1C4PA 1GB1A 4ZRIA 5HI1A 1TKGA 1KH0A 4KSLC 1V6EA 4A90A 3PRZA 3L0WB 2JSVX 3L4PA 1Y8RC 4ZRQA 4FHKA 3GZNI 3KH0A 1N5XA 2B76B 2NBUA 5JHAA 1NYQA 3M3JA 1WGYA 2V1YA 2JXTA 1BT0A 2ZW0A 4WIPA 5IKCM 2FNJB 1HE8A 2AYOB 1HZ5A 1I4PA 3R7QA 2IGDA 1GG3A 4FN2A 3W5UB 3OG5A 5D7GA 1V86A 4RCOA 1CZPA 2IJ0A 1I35A 2DX5B 1EM7A 4O1NA 3QX1A 1UBIA 5DPTA 2XN9C 4YL8A 3R66C 4WJPA 3KUZA 3NJTA 1E0ZA 1P0RA 1UWMA 1FO4A 4ANVA 2GBRA 3ONSA 4C56C 4DBGA 1D5MC 1FNWA 3MTNB 1E10A 4C80A 4KVGB 1ZUD2 4MSMB 1SXTA 2AL6A 3DBHB 2JUOA 3RN9C 3WIMA 2N9PC 1FXAA 2LVPA 5LLIA 1WMHA 2OJWA 2JZ3B 4ZRPA 1CK1A 2PE6B 2E3TA 2LVQA 2LGSA 1TZ1A 5D6JB 2KDIA 4WWPA 3DDCB 2NMQA 2KJ6A 3N20C 1N62A 1E5WA 1WGKA 2O6VA 1FPYA 4W9KA 2KQ4X 2M0AA 2M8SA 4MGIE 2PEAA 3VDZA 3P4QB 2W54A 4DDID 5C2TB 3Q3FA 4RNAA 2N9EB 1ZP0B 2KAJA 3NOBA 2PE9A 3W1SA 3B9JA 4OVUA 1J8CA 4HEA1 3UI3A 2L00B 3AEDB 3KVFB 2BYTA 1PGAA 2Q5WD 3VR8B 3PHXB 4TKNA 3HUIA 3WAOA 1WXMA 2BF8B 2LGXA 2REXA 3P1MA 3RZFA 4IC7B 4HKZE 1E7VA 1TY2A 2DWQA 3BVGA 3SDLC 3D32A 3ZIMA 4GMVA 2L8JA 2KK8A 5LXHA 2KXJA 4EFOA 2QC8A 2AWTA 3IG3A 4OZBA 3BINA 1TS4A 2KDBA 1WYWB 2BKFA 1XCQL 3MJ5A 4RGNA 2Z59B 3QJZA 3PLVA 4JL9A 3RNGC 3U52E 4W9JA 3V6CB 3VTWA 4ZHPA 3IAS1 4DHZB 3ZDTA 4NQKE 2D5GA 2LJIA 4FBJB 3ZJTA 2O6VD 5C3JB 4USAA 1OEYA 5AZFA 1LM8B 1OGWA 2LRUA 1JRPA 3B2GA 4IWPA 2MJ3A 4TUUA 1UD7A 3AU4A 3APDA 4AUQC 1MG4A 4GB9A 3I5JC 2LXAA 4L23A 2AQ1B 2SAKA 2WDRB 3TL5A 4ZYSA 1WF9A 2ICIA 1I7HA 1TZOA 3T9LA 3CF6E 1WE6A 2XK5B 4ANWA 3NVWA 4AOFA 4NAWA 4NJ6A 1IYFA 1FRDA 1FMAD 4KV2A 3ZRCA 3ZTCA 5EDSA 3ALBA 4LLGM 1JWUD 4A8XC 3W5VB 3MC0B 5JXVA 2FE8A 1P7EA 2KJRA 4YT0B 5LNK1 1YD8U 2AX5A 4TSSA 4P6VF 4EUTA 3A9JB 2ZZPB 2INNE 3I63C 4A55A 2OJRA 1YJIA 3ZTDA 1FIQA 2YEPF 4II3B 1OQQA 2I1JA 4C7YA 1VCBA 1FXIA 4I6LB 5L95C 1V5OA 2DYMA 3U2SC 2D3GA 4HVBA 4K7SA 2N7JA 1H4RA 4LTUA 3SD5A 3JW0X 4EKUA 2PJHA 1J7CA 3A1QB 4XZ4A 3PHWB 2GRIA 3Q2AC 4P1BC 1XF5L 3MHZA 5BMGA 3N1YC 1JWSD 2R2OA 2K1FA 2EKIA 3ETRA 4PYUA 3RMKC 1HEZE 2KC2A 4GDLA 1F9JA 2WXQA 1EU3A 1MJDA 3RNEC 4F1SA 2KT7A 1LGRA 3ML8A 1ZPSA 1SGHA 2MBBB 3Q6BA 3GP7A 4RGMA 2WU5B 1V1PA 1OQYA 1YJJA 2KKCA 3ZNGC 3ZUNA 1F2RC 4LNIA 3QQ8B 1NI3A 2C60A 1WM2A 2QEJC 3ZJUA 2KTFA 4BOZB 2N9KA 1UGMA 2LEKA 1I4QA 3VTVA 1VJKA 4FHJA 2KQ7A 1TKYA 4HPPA 3ZGZA 3DCGA 1HTQA 2IPKD 2DZIA 3JVZX 1F77A 3VH4B 1WGGA 2VZKB 1RWSA 4M01A 1VZ7A 1VLBA 1TIFA 1KLGD 3OLMD 3L17A 4OVVA 3H7PB 1AN8A 4KKIA 1I4XA 1SE3A 3DBLB 1N63A 1JRUA 2FIFA 5DPWA 5CTRC 1WIAA 3NZSA 2Y5PA 3LDZE 1VRAB 4MELA 4L1BA 2MBOA 3AM9A 5MPOA 3E56A 2ZNVB 4AS1A 4PS3A 3EUB2 4W9LA 3SFDB 4W9CA 1K52A 4KZ0A 3VRAB 1PYWD 1ZXIA 2VZKD 4RF0A 1IUEA 2MQJA 2N9LA 2XK5A 3GE3C 1SE4A 4DK5A 3ZRFA 4K7UA 3WAPA 3GOEA 3ZQ4A 3KUDB 2ZW1A 1V80A 1C78A 2DLBA 5D3DA 1J0GA 2BW2A 3U7DA 1R4MI 2KQSA 2KNBA 2PIAA 2K6DB 2KLGA 2R61A 3VHTC 3PRMB 4GOCA 3A9JA 3Q3OC 4NPNA 3AV8A 2KJHB 2WQYB 3PV1A 1U4AA 2RSUA 4GDLB 2K22A 1PGBA 1QT9A 2PVGC 2PPHA 2G9HD 3A9KB 1TS5A 2FAZA 2C7MB 1WM3A 2J7QB 3B0AA 1FEHA 1UWXA 1AARA 2KC1A 3P2BA 3A33B 2NTTA 2GLSA 4W9GA 2OOBB 2L3ZA 4EZKA 1C76A 4NJCA 4XGAB 1L0VB 5G2NA 1L5PA 4NZLB 1AWDA 3Q3JA 4OVZA 1VDVA 4R3DA 4XWWA 3I57A 4RGOS 3M63B 1P1AA 1UF0A 4URKA 2KMMA 4DWFA 4N59A 4GSWA 2GBMA 4A20A 4K1RB 4E74A 3P63A 2ZPNA 2FUHB 3P4RB 3TIXA 1JW9D 1ROEA 1WX7A 1D4BA 3RUIB 1GB4A 1I4RA 3RNAC 3HIZA 4IUMB 5BYSA 2YVCA 4JPSA 2GOWA 3ZKJC 4BKSD 2JPHA 3PZ7A 3AE5B 2J42A 3T3OA 3J9CA 3C0RB 1TKEA 4B6WA 1R4MB 3W9CB 2WXMA 3DBHI 3APCA 3QA8A 2WXPA 4B9KA 1ZGUB 2W55A 3KYDD 2MW5A 2Z0DB 2MSED 1SIJA 3URYA 2OEDA 1EWYC 2M17A 2PLPA 4PS7A 3OJ3A 1IGCA 1KLUD 2VH1A 4AWJA 3WA0A 2MJEA 3PS6A 2CKHB 3VAWA 3PLUA 4FJVB 2LWPA 1YMHE 5AUIA 3M62B 4RF1A 3PZ8A 3WCQA 3NVZA 2QIEB 3VUYA 5G5HA 4US9A 1GC6A 2PKOA 3N30A 2L0FA 2GBNA 3MP9A 4JQWC 3AU5A 4N9F4 3HVDA 1DGJA 4J3OD 3DHHC 5DPRA 1H8CA 5J18A 3TMPB 3SU8X 2I38A 4BZAA 1V1OA 2JF5A 1EWCA 4MM3B 2ZJDA 2Y3AA 1T5XD 3NHEB 3DOWA 4PYZA 2BTEA 4JWUC 2D10A 3AULA 5J17A 2MBHA 2X38A 1JALA 2J53A 2PVOD 1M4VA 1E8YA 5EE3A 2JZZA 4NJ7A 2WXLA 2JWZA 3TJPA 1ENFA 1WGRA 2NVUI 4MACA 2GMIC 3OAWA 3VVWB 3VFKA 3AE7B 3C8YA 2N1VA 1HZ6A 4W9DA 2V3PA 2JQRB 2IBIB 4BKTA 1C4CA 2RMMA 5C1ZA 3H8HA 1MHXA 4N58A 3E9SA 1SE2A 2G4DB 1RRBA 4K81A 3H6NA 2NBVB 3AE6B 2KMAA 4FULA 3AEFB 2MWSB 3ZO5B 3DBRI 1FNVA 4GDKB 4F8CB 4W9IA 3RD2A 3ZXRA 1KOTA 1WGDA 5J2RA 1S1QB 1LXDA 2JU6X 4RH6A 2FCQA 3QWZB 3RULA 1TTNA 3L08A 3A4SC 2PMVA 3FAHA 5AZHA 1HA5A 2O6VB 1E7UA 3FKYA 3AXCA 4G11A 2LD9A 1OTRB 2W82A 4PK1A 2L0TA 3T3NA 2V9HA 4WJOA 5BYQA 4IOIE 2K8CA 4HWIB 3H1UA 2DAFA 2Z8LA 2J0MA 1DOIA 2A4ZA 1J19A 1HXYD 3AE9B 3AI5A 3PRPB 2FCMA 3O65B 3AB5A 3FILB 4BKGA 3BY4B 1UBQA 3DVNV 4HPMB 4KIKA 1UNSA 2BB6A 3PO0A 4US8A 1ZDXA 2KD0A 5AUKA 2K8HA 1LQBA 2CU1A 2MHJA 4GXBA 4YTNB 1E9MA 1WFYA 1K50A 3IVFA 3CWIA 2I1KA 2JRHA 5TR5A 4HJKA 4XE0A 1NYRA 3AN1A 4GLSC 4HLEA 2WXOA 4EZLA 2BS3B 4G50A 1WJUA 2WYQA 2Y5CA 2BPSA 2JYEA 4KDIC 1YNTE 1PDXA 4WWMA 2MX2A 5IP4D 2K5PA 1I42A 4AQ7A 2K6QA 4NY0A 1EU4A 3KWVA 5HKHA 2DYBA 1TY0A 3LJ3A 2AQ2B 3QCAA 1ET6A 4IM2A 2BS2B 3BWUD 4LCDE 2D11A 2IGHA 1YIWA 1ZDVA 2LXCA 2DBYA 1SB3C 1WR1A 4A9AA 4B0EA 5AZGA 1V9JA 2C7NB 4C4VA 4OZAA 2IGGA 3DBLI 2LJ5A 4A6QA 4FJYA 1FXTB 2JY6A 5E6NA 1BMLC 1KFYB 1TYGB 2IDYA 5BO4B 2WDQB 2DZJA 2QILA 3A1QA 3RNFC 1V2YA 4KGRA 4LK0M 1T0RC 3U4EG 1T0YA 1L0YB 3PZDA 4JE3B 4ZOHC 4YTMB 2XNAC 4KGSA 1XLNA 2XEWA 4ASWC 3B08A 3R7RA 1WX8A 3K9PB 2N4FA 4MGYE 4XDDA 2WP9B 1DOYA 3AE4B 3FC4A 1NEKB 1WXAA 3AEBB 1V1PB 5KHOA 4HKQA 2MH7A 3NVVA 4FLHA 5I4DA 1IBXA 3AEEB 5KHQA 1RM6C 2WS3B 2RDBC 2RPVA 2RGFA 1K53A 2CR5A 1TGZB 1AYFA 2ZVOA
chains in the Genus database with same CATH topology
4MGKE 1Q1OA 1XD3B 4A3OA 1Q0WB 2MQJA 2KLCA 2NPTB 2KWCA 3H9DA 4HK2A 4KSLC 1V6EA 2XK5A 2ASQA 4WQOB 2ZEQA 2C9WB 2GBJA 4DK5A 3PRZA 3L0WB 3ZRFA 1Y8RC 3HK0A 4K7UA 3WAPA 3GOEA 2IY0B 1R4NI 2NS5A 3KUDB 4FHKA 1V80A 2KTRA 2YLMA 5DCNA 3GZNI 5CHFA 3KH0A 1GJZA 2MP2B 1E90A 3KUCB 4BKSA 2G4SA 1J0GA 2NBUA 3R3MA 4MDKE 5JHAA 4E3CA 3M3JA 3EFUA 1WGYA 3ENEA 3U7DA 2DENB 2V1YA 1R4MI 1NI2A 2KQSA 1BT0A 2KNBA 3L16A 4LDTB 5AEKB 2K6DB 3QHTA 2KLGA 2FNJB 3UINB 1HE8A 4J6IA 3VHTC 2K39A 3NS8A 2AYOB 3PRMB 4GOCA 3A9JA 3R7QA 4NPNA 3S2AA 5CX3A 2KJHB 2RPQA 4LJOB 1YJ1A 1U4AA 2RSUA 3PV1A 4GDLB 1GG3A 4ICUA 2LVOA 3V61A 2O2VB 4FN2A 2C7HA 2PPHA 5D7GA 3A9KB 1V86A 2FAZA 2BYEA 2G45B 2C7MB 3EECA 1WM3A 4BFRA 2J7QB 3VQIA 3B0AA 3M95A 3W1SC 4G3XB 4HCNB 1I35A 2DX5B 1AARA 5L83A 2KC1A 3P2BA 4KIKB 4LDTD 3QX1A 3A33B 4BBNF 1VD2A 1UBIA 5DPTA 1TBEA 2BWFA 3PGEA 1WI0A 2OOBB 1S3SG 2L3ZA 4W9GA 4EZKA 1KJTA 4YL8A 5G2NA 3R66C 4DHJB 2R2QA 4WJPA 3Q3JA 2DHZA 4XX5A 2BYFA 3KUZA 3M63B 1P1AA 4URKA 1P0RA 2M0XA 4DWFA 4GSWA 3ZDMC 2KWUB 2GBMA 4A20A 4K1RB 4ZRIA 2WX0A 1UELA 2UWQA 4E74A 2MCNB 2ZPNA 3ZNID 2GBRA 4ANVA 3PVLA 4KDLB 3ONSA 3RT3B 3WALA 2FUHB 2WWZA 3MHSD 4GIVA 4MJSA 3TIXA 1E8XA 4DBGA 4JIOU 2EMSA 5JHBA 3MTNB 5IA7A 5JH5C 1WX7A 2LRWA 4KVGB 4MSMB 2AL6A 3RUIB 2WDTB 2BWES 2JUOA 2KHWB 3WIMA 2N9PC 1EF1A 3SHQA 4WAAA 1E8WA 4IM3A 2LVPA 3HIZA 4IUMB 3TCAA 5LLIA 1WMHA 3HHMA 1GNUA 2JZ3B 2YVCA 2BGFA 3ZW3A 2GOWA 2GBKA 3T8MA 1M94A 3ZKJC 4BKSD 2JPHA 1WY8A 4II2B 2PE6B 1WGHA 2LVQA 3L10B 1WJ6A 3C0RB 4RM8A 1TZ1A 1WJ4A 2AEHA 4IWQA 4MSQB 3V6EB 4B6WA 1UH6A 2DYOA 3IHPC 2KDIA 2KN5A 4WWPA 5D6JB 4MJSB 4NAWB 2EMTA 3DDCB 3DBHI 3APCA 2KJ6A 4TV3A 3QA8A 2HD5B 4B9KA 1ZGUB 3KYDD 2MW5A 2IO2B 2Z0DB 1Q5WB 4PS8A 2BKRB 1E5WA 2O6VA 4MEMA 2MSED 4W9EA 4W9KA 4GU2A 1V81A 2M8SA 4MGIE 1WZ0A 2PEAA 2M17A 3VDZA 4DDID 4PS7A 2EKEC 2WX1A 3DVNU 3OJ3A 3APFA 2NPTA 3Q3FA 5G55A 3U30A 4AWJA 2N9EB 1EF5A 3WA0A 3OJ4B 3PS6A 4TQ0A 2CKHB 3VAWA 2HE7A 3ZNZB 3NOBA 3PLUA 3K9OB 4FJVB 2PE9A 1NDDA 2LWPA 3W1SA 4OVUA 3M62B 1J8CA 3ZVVA 5C23A 4MH0E 2M4NA 1WX9A 2L00B 2MBQA 3VUYA 2LASA 4HCPB 3KVFB 1GC6A 1NBFC 3QAQA 3N30A 3PHXB 1UZXB 2L0FA 2MLBA 4RM9A 2GBNA 4GDKA 4DHJD 4TKNA 3WAOA 1WXMA 1G6JA 2BF8B 3AU5A 4JQWC 4N9F4 2LGXA 2REXA 4GN1A 4WJQA 3RZFA 3VXWA 3CMMB 4IC7B 2XBBC 4FADA 2MBEA 1E7VA 4MGZE 5DPRA 3UIPB 1H8CA 3EC8A 3SDLC 5J18A 3D32A 1RFAA 3ZIMA 1SIFA 3TMPB 2ZNVC 4GMVA 4JLCA 5D94A 2L8JA 3B1LX 3SU8X 2KK8A 4E71A 2KXJA 2FCNA 4HXDA 4ANUA 5LXHA 2JF5A 2KZRA 4EFOA 2L76A 2ZJDA 2AWTA 3IG3A 3BINA 1KM7A 2KDBA 3DOWA 3NHEB 4PYZA 4K7WA 1RAXA 1WYWB 4ZRKA 2KO3A 4CYEA 4BOSC 3X0WA 4B95A 1XT9B 2BKFA 2D10A 3AULA 2G3QB 5J17A 2MBHA 4ANXA 1ISNA 4M0WB 2Z59B 1E8YA 3QJZA 3PLVA 4JL9A 2CHWA 2JZZA 2KDEB 4NJ7A 4W9JA 2JWZA 3TJPA 3V6CB 3UIOB 3VTWA 2KFKB 4HPLB 2J0KA 2KDFB 1EO6A 1WGRA 2NVUI 4DHZB 2GMIC 3ZDTA 4NQKE 3OAWA 3PTFC 4DDGD 4FBJB 3VVWB 1ZW7A 1V5TA 3VFKA 2O6VD 3PPAA 1PQSA 4ZDVA 2N1VA 1OEYA 4ICVA 5AZFA 4W9DA 2IBIB 4BKTA 1LM8B 1OGWA 4WJNA 2ZVNA 3DVGX 4LJPB 5C1ZA 2LRUA 2CS4A 3ZLZA 2NR2A 3ML9A 3V62A 4IWOA 4IWPA 2LI5A 2ZCBA 3DBSA 4TUUA 1UD7A 2G4DB 1RRBA 4K81A 4GGQA 2MA9B 3H6NA 3AU4A 2NBVB 3APDA 3N3KB 3WANA 1YQBA 1YX5B 2KMAA 4FULA 4GB9A 4ZYNA 4AUQC 1WJNA 3HM3A 3JSVB 1QZEA 2MWSB 3ZO5B 3DBRI 1P9DU 2LXAA 4GDKB 3TL5A 4F8CB 2D2QA 3IBEA 4W9IA 3RD2A 1WF9A 5LXIB 1KOTA 1WGDA 3UGBB 5J2RA 2O2VA 2JXXA 2FIDA 3T9LA 3CF6E 1WE6A 2XK5B 4ANWA 4AOFA 4AP4C 4NAWA 1S1QB 4NJ6A 1IYFA 1LXDA 3WAMA 4CO7A 2FCQA 3QWZB 4W9HA 3RULA 1TTNA 3L08A 3A4SC 2AL3A 4KV2A 2IY1B 1IP9A 5AZHA 3ZRCA 2O6VB 3ZTCA 1E7UA 2K25A 5EDSA 1D3ZA 3AXCA 3ALBA 4G11A 2LD9A 1OTRB 1C3TA 2L0TA 3TBLD 3H7PA 2KJRA 3DPDA 5FR6A 2BYVE 4EOYA 1YD8U 3KW5B 2NBWB 4EEWA 4WJOA 3I3TB 3RZWC 1ZKHA 2NCNA 3HM6X 2LUEA 4HDQA 2K8CA 3A9JB 2ZZPB 4TQ1A 4HWIB 1RLFA 4EUTA 3H1UA 1YX6B 1WRDB 2DAFA 3QIJA 2OJRA 2UYZB 2J0MA 1OEYJ 1XQQA 3ZTDA 2DAJA 2A4ZA 2VRRB 4EZJA 1J19A 3X23A 4A3PA 3A9KA 3L13A 4WWOA 2IO0B 4M8MA 3AI5A 3PRPB 1SE9A 1GUAB 2DZMA 2FCMA 3EHVA 2Z0EB 3VUWA 2L05A 4AJWA 3O65B 4II3B 1L7YA 4BKGA 1L2NA 3BY4B 2I1JA 1UBQA 1VCBA 3DVNV 4HPMB 3V60A 4I6LB 5L95C 4DXAB 2ZCCA 2M1MA 1EUVB 4FJZA 4KIKA 5IAAC 1V5OA 2DYMA 5E6PA 3CSFA 2D3GA 3JYUA 4HVBA 4P7IA 5D2MB 4K7SA 1H4RA 1LFDA 2DZKA 4BBNC 1IPGA 2KD0A 4FA6A 3RCZA 3PT2B 2K8HA 3DQVA 1LQBA 2CU1A 2LGYA 3UF8A 4XC2A 3JW0X 3SD5A 4EKUA 2PJHA 4W9FA 3N32A 2W9NA 3QARA 2J0JA 3A1QB 4XZ4A 3PSEB 4GXBA 3PHWB 4X57B 2KTRB 3QC8B 2Y5BB 3KYCD 1WFYA 3H7SA 2KFJA 1K8RB 3IVFA 2IO3B 2I1KA 1CMXB 2JRHA 2R2OA 3VTUA 2K1FA 5TR5A 4HJKA 4M8NA 4PYUA 4IM0A 4HLEA 4KZCA 2ZPYA 2KC2A 5GMVA 4GDLA 1F9JA 4KSKC 5E6OA 4EZLA 4G50A 4F1SA 1WJUA 1Z2MA 3U8ZA 4BVUC 2WYQA 3ML8A 1WXSA 1X1MA 2BPSA 1SGHA 2MBBB 4KDIC 3MJWA 2MX2A 3VH3B 1I42A 1OQYA 2K8BA 2HTHA 2KKCA 4I6NB 2K6QA 4IW0A 4NY0A 3NZUA 3ZNGC 3ZUNA 2DYBA 5HKHA 3LJ3A 3QQ8B 5CHWA 2C60A 1WM2A 2A5UA 3QCAA 2KVRA 2KTFA 2LZ6A 4IM2A 4BOZB 4NNJB 2IZVB 1P3QU 4LCDE 2D11A 1UGMA 2CHXA 3RYTA 1YIWA 5DPSA 4WWNA 2LXCA 3VTVA 1WR1A 4FHJA 2CHZA 2KQ7A 3W1YA 5AZGA 1C1YB 1V9JA 2C7NB 3DCGA 3ECIA 3DBLI 3UQBA 2LJ5A 4RMAA 2IO1B 4FJYA 1FXTB 2JY6A 5E6NA 2DZIA 3JVZX 3VUXA 3VH4B 1WGGA 3NY5A 4JGHB 2D07B 5CHVC 4G0NB 2KMCA 5BO4B 1WZ3A 2DZJA 2HJ8A 1WR6E 2LGDA 3A1QA 3OLMD 4NQLB 1WE7A 3L17A 1WH3A 1Z5SB 2N1WA 3QK0A 4OVVA 3ZNHB 1V2YA 3H7PB 2JT4B 2JRIB 2RD0A 1T0YA 3PZDA 2KFKA 1V49A 2N9XA 1WXVA 1E8ZA 3PREA 4AJYB 1JRUA 2FIFA 4I6PA 5JZEB 2KWVB 5DPWA 3L54A 5CTRC 2XEWA 2B3AA 1WIAA 2N7DA 2IYDB 2MRPA 4HDOA 4ASWC 1KLVA 2C5LC 3B08A 2KOXA 3CSTA 3R7RA 1WX8A 3K9PB 2N4FA 3NZSA 4MGYE 2KX0A 3LDZE 2FCSA 2QHOA 2V3SA 1GC7A 1MG8A 4CHKA 3A4RA 4MM3A 4MELA 4IG7B 4ZRJA 2MBOA 3UQAA 2N7EA 1WXAA 3IFWB 2MP2A 5KHOA 4DHZE 2ZNVB 4PS3A 3JSVA 4FLHA 2V4LA 1P98A 2KX3A 4W9LA 5KHQA 2RR9A 1A5RA 3DVGY 4W9CA 4F7ZA 4KZ0A 1WMHB 2L7RA 2RGFA 2CR5A 2JVCA 1TGZB 2KANA 2ZVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MGK E;  1Q1O A;  1XD3 B;  4A3O A;  1Q0W B;  2MQJ A;  2KLC A;  2NPT B;  2KWC A;  3H9D A;  4HK2 A;  4KSL C;  1V6E A;  2XK5 A;  2ASQ A;  4WQO B;  2ZEQ A;  2C9W B;  2GBJ A;  4DK5 A;  3PRZ A;  3L0W B;  3ZRF A;  1Y8R C;  3HK0 A;  4K7U A;  3WAP A;  3GOE A;  2IY0 B;  1R4N I;  2NS5 A;  3KUD B;  4FHK A;  1V80 A;  2KTR A;  2YLM A;  5DCN A;  3GZN I;  5CHF A;  3KH0 A;  1GJZ A;  2MP2 B;  1E90 A;  3KUC B;  4BKS A;  2G4S A;  1J0G A;  2NBU A;  3R3M A;  4MDK E;  5JHA A;  4E3C A;  3M3J A;  3EFU A;  1WGY A;  3ENE A;  3U7D A;  2DEN B;  2V1Y A;  1R4M I;  1NI2 A;  2KQS A;  1BT0 A;  2KNB A;  3L16 A;  4LDT B;  5AEK B;  2K6D B;  3QHT A;  2KLG A;  2FNJ B;  3UIN B;  1HE8 A;  4J6I A;  3VHT C;  2K39 A;  3NS8 A;  2AYO B;  3PRM B;  4GOC A;  3A9J A;  3R7Q A;  4NPN A;  3S2A A;  5CX3 A;  2KJH B;  2RPQ A;  4LJO B;  1YJ1 A;  1U4A A;  2RSU A;  3PV1 A;  4GDL B;  1GG3 A;  4ICU A;  2LVO A;  3V61 A;  2O2V B;  4FN2 A;  2C7H A;  2PPH A;  5D7G A;  3A9K B;  1V86 A;  2FAZ A;  2BYE A;  2G45 B;  2C7M B;  3EEC A;  1WM3 A;  4BFR A;  2J7Q B;  3VQI A;  3B0A A;  3M95 A;  3W1S C;  4G3X B;  4HCN B;  1I35 A;  2DX5 B;  1AAR A;  5L83 A;  2KC1 A;  3P2B A;  4KIK B;  4LDT D;  3QX1 A;  3A33 B;  4BBN F;  1VD2 A;  1UBI A;  5DPT A;  1TBE A;  2BWF A;  3PGE A;  1WI0 A;  2OOB B;  1S3S G;  2L3Z A;  4W9G A;  4EZK A;  1KJT A;  4YL8 A;  5G2N A;  3R66 C;  4DHJ B;  2R2Q A;  4WJP A;  3Q3J A;  2DHZ A;  4XX5 A;  2BYF A;  3KUZ A;  3M63 B;  1P1A A;  4URK A;  1P0R A;  2M0X A;  4DWF A;  4GSW A;  3ZDM C;  2KWU B;  2GBM A;  4A20 A;  4K1R B;  4ZRI A;  2WX0 A;  1UEL A;  2UWQ A;  4E74 A;  2MCN B;  2ZPN A;  3ZNI D;  2GBR A;  4ANV A;  3PVL A;  4KDL B;  3ONS A;  3RT3 B;  3WAL A;  2FUH B;  2WWZ A;  3MHS D;  4GIV A;  4MJS A;  3TIX A;  1E8X A;  4DBG A;  4JIO U;  2EMS A;  5JHB A;  3MTN B;  5IA7 A;  5JH5 C;  1WX7 A;  2LRW A;  4KVG B;  4MSM B;  2AL6 A;  3RUI B;  2WDT B;  2BWE S;  2JUO A;  2KHW B;  3WIM A;  2N9P C;  1EF1 A;  3SHQ A;  4WAA A;  1E8W A;  4IM3 A;  2LVP A;  3HIZ A;  4IUM B;  3TCA A;  5LLI A;  1WMH A;  3HHM A;  1GNU A;  2JZ3 B;  2YVC A;  2BGF A;  3ZW3 A;  2GOW A;  2GBK A;  3T8M A;  1M94 A;  3ZKJ C;  4BKS D;  2JPH A;  1WY8 A;  4II2 B;  2PE6 B;  1WGH A;  2LVQ A;  3L10 B;  1WJ6 A;  3C0R B;  4RM8 A;  1TZ1 A;  1WJ4 A;  2AEH A;  4IWQ A;  4MSQ B;  3V6E B;  4B6W A;  1UH6 A;  2DYO A;  3IHP C;  2KDI A;  2KN5 A;  4WWP A;  5D6J B;  4MJS B;  4NAW B;  2EMT A;  3DDC B;  3DBH I;  3APC A;  2KJ6 A;  4TV3 A;  3QA8 A;  2HD5 B;  4B9K A;  1ZGU B;  3KYD D;  2MW5 A;  2IO2 B;  2Z0D B;  1Q5W B;  4PS8 A;  2BKR B;  1E5W A;  2O6V A;  4MEM A;  2MSE D;  4W9E A;  4W9K A;  4GU2 A;  1V81 A;  2M8S A;  4MGI E;  1WZ0 A;  2PEA A;  2M17 A;  3VDZ A;  4DDI D;  4PS7 A;  2EKE C;  2WX1 A;  3DVN U;  3OJ3 A;  3APF A;  2NPT A;  3Q3F A;  5G55 A;  3U30 A;  4AWJ A;  2N9E B;  1EF5 A;  3WA0 A;  3OJ4 B;  3PS6 A;  4TQ0 A;  2CKH B;  3VAW A;  2HE7 A;  3ZNZ B;  3NOB A;  3PLU A;  3K9O B;  4FJV B;  2PE9 A;  1NDD A;  2LWP A;  3W1S A;  4OVU A;  3M62 B;  1J8C A;  3ZVV A;  5C23 A;  4MH0 E;  2M4N A;  1WX9 A;  2L00 B;  2MBQ A;  3VUY A;  2LAS A;  4HCP B;  3KVF B;  1GC6 A;  1NBF C;  3QAQ A;  3N30 A;  3PHX B;  1UZX B;  2L0F A;  2MLB A;  4RM9 A;  2GBN A;  4GDK A;  4DHJ D;  4TKN A;  3WAO A;  1WXM A;  1G6J A;  2BF8 B;  3AU5 A;  4JQW C;  4N9F 4;  2LGX A;  2REX A;  4GN1 A;  4WJQ A;  3RZF A;  3VXW A;  3CMM B;  4IC7 B;  2XBB C;  4FAD A;  2MBE A;  1E7V A;  4MGZ E;  5DPR A;  3UIP B;  1H8C A;  3EC8 A;  3SDL C;  5J18 A;  3D32 A;  1RFA A;  3ZIM A;  1SIF A;  3TMP B;  2ZNV C;  4GMV A;  4JLC A;  5D94 A;  2L8J A;  3B1L X;  3SU8 X;  2KK8 A;  4E71 A;  2KXJ A;  2FCN A;  4HXD A;  4ANU A;  5LXH A;  2JF5 A;  2KZR A;  4EFO A;  2L76 A;  2ZJD A;  2AWT A;  3IG3 A;  3BIN A;  1KM7 A;  2KDB A;  3DOW A;  3NHE B;  4PYZ A;  4K7W A;  1RAX A;  1WYW B;  4ZRK A;  2KO3 A;  4CYE A;  4BOS C;  3X0W A;  4B95 A;  1XT9 B;  2BKF A;  2D10 A;  3AUL A;  2G3Q B;  5J17 A;  2MBH A;  4ANX A;  1ISN A;  4M0W B;  2Z59 B;  1E8Y A;  3QJZ A;  3PLV A;  4JL9 A;  2CHW A;  2JZZ A;  2KDE B;  4NJ7 A;  4W9J A;  2JWZ A;  3TJP A;  3V6C B;  3UIO B;  3VTW A;  2KFK B;  4HPL B;  2J0K A;  2KDF B;  1EO6 A;  1WGR A;  2NVU I;  4DHZ B;  2GMI C;  3ZDT A;  4NQK E;  3OAW A;  3PTF C;  4DDG D;  4FBJ B;  3VVW B;  1ZW7 A;  1V5T A;  3VFK A;  2O6V D;  3PPA A;  1PQS A;  4ZDV A;  2N1V A;  1OEY A;  4ICV A;  5AZF A;  4W9D A;  2IBI B;  4BKT A;  1LM8 B;  1OGW A;  4WJN A;  2ZVN A;  3DVG X;  4LJP B;  5C1Z A;  2LRU A;  2CS4 A;  3ZLZ A;  2NR2 A;  3ML9 A;  3V62 A;  4IWO A;  4IWP A;  2LI5 A;  2ZCB A;  3DBS A;  4TUU A;  1UD7 A;  2G4D B;  1RRB A;  4K81 A;  4GGQ A;  2MA9 B;  3H6N A;  3AU4 A;  2NBV B;  3APD A;  3N3K B;  3WAN A;  1YQB A;  1YX5 B;  2KMA A;  4FUL A;  4GB9 A;  4ZYN A;  4AUQ C;  1WJN A;  3HM3 A;  3JSV B;  1QZE A;  2MWS B;  3ZO5 B;  3DBR I;  1P9D U;  2LXA A;  4GDK B;  3TL5 A;  4F8C B;  2D2Q A;  3IBE A;  4W9I A;  3RD2 A;  1WF9 A;  5LXI B;  1KOT A;  1WGD A;  3UGB B;  5J2R A;  2O2V A;  2JXX A;  2FID A;  3T9L A;  3CF6 E;  1WE6 A;  2XK5 B;  4ANW A;  4AOF A;  4AP4 C;  4NAW A;  1S1Q B;  4NJ6 A;  1IYF A;  1LXD A;  3WAM A;  4CO7 A;  2FCQ A;  3QWZ B;  4W9H A;  3RUL A;  1TTN A;  3L08 A;  3A4S C;  2AL3 A;  4KV2 A;  2IY1 B;  1IP9 A;  5AZH A;  3ZRC A;  2O6V B;  3ZTC A;  1E7U A;  2K25 A;  5EDS A;  1D3Z A;  3AXC A;  3ALB A;  4G11 A;  2LD9 A;  1OTR B;  1C3T A;  2L0T A;  3TBL D;  3H7P A;  2KJR A;  3DPD A;  5FR6 A;  2BYV E;  4EOY A;  1YD8 U;  3KW5 B;  2NBW B;  4EEW A;  4WJO A;  3I3T B;  3RZW C;  1ZKH A;  2NCN A;  3HM6 X;  2LUE A;  4HDQ A;  2K8C A;  3A9J B;  2ZZP B;  4TQ1 A;  4HWI B;  1RLF A;  4EUT A;  3H1U A;  1YX6 B;  1WRD B;  2DAF A;  3QIJ A;  2OJR A;  2UYZ B;  2J0M A;  1OEY J;  1XQQ A;  3ZTD A;  2DAJ A;  2A4Z A;  2VRR B;  4EZJ A;  1J19 A;  3X23 A;  4A3P A;  3A9K A;  3L13 A;  4WWO A;  2IO0 B;  4M8M A;  3AI5 A;  3PRP B;  1SE9 A;  1GUA B;  2DZM A;  2FCM A;  3EHV A;  2Z0E B;  3VUW A;  2L05 A;  4AJW A;  3O65 B;  4II3 B;  1L7Y A;  4BKG A;  1L2N A;  3BY4 B;  2I1J A;  1UBQ A;  1VCB A;  3DVN V;  4HPM B;  3V60 A;  4I6L B;  5L95 C;  4DXA B;  2ZCC A;  2M1M A;  1EUV B;  4FJZ A;  4KIK A;  5IAA C;  1V5O A;  2DYM A;  5E6P A;  3CSF A;  2D3G A;  3JYU A;  4HVB A;  4P7I A;  5D2M B;  4K7S A;  1H4R A;  1LFD A;  2DZK A;  4BBN C;  1IPG A;  2KD0 A;  4FA6 A;  3RCZ A;  3PT2 B;  2K8H A;  3DQV A;  1LQB A;  2CU1 A;  2LGY A;  3UF8 A;  4XC2 A;  3JW0 X;  3SD5 A;  4EKU A;  2PJH A;  4W9F A;  3N32 A;  2W9N A;  3QAR A;  2J0J A;  3A1Q B;  4XZ4 A;  3PSE B;  4GXB A;  3PHW B;  4X57 B;  2KTR B;  3QC8 B;  2Y5B B;  3KYC D;  1WFY A;  3H7S A;  2KFJ A;  1K8R B;  3IVF A;  2IO3 B;  2I1K A;  1CMX B;  2JRH A;  2R2O A;  3VTU A;  2K1F A;  5TR5 A;  4HJK A;  4M8N A;  4PYU A;  4IM0 A;  4HLE A;  4KZC A;  2ZPY A;  2KC2 A;  5GMV A;  4GDL A;  1F9J A;  4KSK C;  5E6O A;  4EZL A;  4G50 A;  4F1S A;  1WJU A;  1Z2M A;  3U8Z A;  4BVU C;  2WYQ A;  3ML8 A;  1WXS A;  1X1M A;  2BPS A;  1SGH A;  2MBB B;  4KDI C;  3MJW A;  2MX2 A;  3VH3 B;  1I42 A;  1OQY A;  2K8B A;  2HTH A;  2KKC A;  4I6N B;  2K6Q A;  4IW0 A;  4NY0 A;  3NZU A;  3ZNG C;  3ZUN A;  2DYB A;  5HKH A;  3LJ3 A;  3QQ8 B;  5CHW A;  2C60 A;  1WM2 A;  2A5U A;  3QCA A;  2KVR A;  2KTF A;  2LZ6 A;  4IM2 A;  4BOZ B;  4NNJ B;  2IZV B;  1P3Q U;  4LCD E;  2D11 A;  1UGM A;  2CHX A;  3RYT A;  1YIW A;  5DPS A;  4WWN A;  2LXC A;  3VTV A;  1WR1 A;  4FHJ A;  2CHZ A;  2KQ7 A;  3W1Y A;  5AZG A;  1C1Y B;  1V9J A;  2C7N B;  3DCG A;  3ECI A;  3DBL I;  3UQB A;  2LJ5 A;  4RMA A;  2IO1 B;  4FJY A;  1FXT B;  2JY6 A;  5E6N A;  2DZI A;  3JVZ X;  3VUX A;  3VH4 B;  1WGG A;  3NY5 A;  4JGH B;  2D07 B;  5CHV C;  4G0N B;  2KMC A;  5BO4 B;  1WZ3 A;  2DZJ A;  2HJ8 A;  1WR6 E;  2LGD A;  3A1Q A;  3OLM D;  4NQL B;  1WE7 A;  3L17 A;  1WH3 A;  1Z5S B;  2N1W A;  3QK0 A;  4OVV A;  3ZNH B;  1V2Y A;  3H7P B;  2JT4 B;  2JRI B;  2RD0 A;  1T0Y A;  3PZD A;  2KFK A;  1V49 A;  2N9X A;  1WXV A;  1E8Z A;  3PRE A;  4AJY B;  1JRU A;  2FIF A;  4I6P A;  5JZE B;  2KWV B;  5DPW A;  3L54 A;  5CTR C;  2XEW A;  2B3A A;  1WIA A;  2N7D A;  2IYD B;  2MRP A;  4HDO A;  4ASW C;  1KLV A;  2C5L C;  3B08 A;  2KOX A;  3CST A;  3R7R A;  1WX8 A;  3K9P B;  2N4F A;  3NZS A;  4MGY E;  2KX0 A;  3LDZ E;  2FCS A;  2QHO A;  2V3S A;  1GC7 A;  1MG8 A;  4CHK A;  3A4R A;  4MM3 A;  4MEL A;  4IG7 B;  4ZRJ A;  2MBO A;  3UQA A;  2N7E A;  1WXA A;  3IFW B;  2MP2 A;  5KHO A;  4DHZ E;  2ZNV B;  4PS3 A;  3JSV A;  4FLH A;  2V4L A;  1P98 A;  2KX3 A;  4W9L A;  5KHQ A;  2RR9 A;  1A5R A;  3DVG Y;  4W9C A;  4F7Z A;  4KZ0 A;  1WMH B;  2L7R A;  2RGF A;  2CR5 A;  2JVC A;  1TGZ B;  2KAN A;  2ZVO A; 
#chains in the Genus database with same CATH topology
 4MGK E;  1Q1O A;  1Q0W B;  2KLC A;  2KWC A;  4HK2 A;  4WQO B;  3TEW A;  4YSY B;  1R4N I;  2NS5 A;  3N1X C;  3P4S B;  1QF6 A;  2YLM A;  5DCN A;  1OFF A;  2JX5 A;  5CHF A;  1GJZ A;  5D3I B;  3BVM A;  3KUC B;  3R3M A;  3ENE A;  2K9X A;  5AEK B;  1A70 A;  1I4G A;  3U7Z A;  1XCT L;  1QOF A;  3UIN B;  5CX3 A;  4YSX B;  1YJ1 A;  3P42 A;  2O2V B;  2HJ1 A;  2C7H A;  1MPE A;  2G45 B;  3EEC A;  4HRS A;  4BFR A;  3VQI A;  1QOG A;  2J4X A;  5EE9 A;  1XLP A;  5L83 A;  2D3B A;  2M19 A;  4KIK B;  4BBN F;  1J7A A;  1TBE A;  1S3S G;  3VRB B;  1KJT A;  2DHZ A;  4XX5 A;  1GOZ A;  2ACZ B;  3ZDM C;  1JCK B;  2KWU B;  2WX0 A;  3AH7 A;  3ZNI D;  4KDL B;  5FR3 A;  3TSS A;  3RT3 B;  3WAL A;  3MC9 A;  1L4Z B;  2EMS A;  5JHB A;  5IA7 A;  2TSS A;  4ARI A;  2BWE S;  1T0Q C;  3ZYY X;  2KHW B;  3SHQ A;  3BVZ A;  1E8W A;  1F52 A;  4D2K A;  3TCA A;  1GNU A;  5BYR A;  2AQ3 B;  2BGF A;  1N6Z A;  3ZW3 A;  2LFI A;  4S0R A;  2GBK A;  2JZP A;  1WY8 A;  4II2 B;  3L10 B;  1WJ4 A;  2AEH A;  2DYO A;  3IHP C;  1ZOY B;  3HRD D;  3MFG A;  3Q8E A;  4TV3 A;  1E6E B;  1L6U A;  4ARC A;  1SEB D;  2X8X X;  2OHF A;  2IO2 B;  1Q5W B;  2BKR B;  4MEM A;  5H92 C;  4W9E A;  4GU2 A;  1V81 A;  3EA6 A;  2I2Y A;  1D5Z C;  3Q3M C;  2N0S B;  2WX1 A;  4REZ A;  3APF A;  2NPT A;  1EF5 A;  2INP E;  3KQ4 A;  4TQ0 A;  2HE7 A;  3N9Y C;  2W3S A;  1NDD A;  3ZVV A;  4XYC A;  5C23 A;  1RYJ A;  1TS3 A;  2M4N A;  1WX9 A;  3RNB C;  3RI7 C;  1WYG A;  2GB1 A;  3ABV B;  2BQQ A;  1NBF C;  4C7Z A;  3QAQ A;  4YSZ B;  4B0M A;  4RM9 A;  4P16 A;  4GDK A;  4DHJ D;  3HVZ A;  3TUO A;  4WUR A;  1GPX A;  1G6J A;  4WJQ A;  3VXW A;  2L83 A;  3CMM B;  2XBB C;  3P4P B;  5GXG B;  2FUG 1;  2YEP B;  3EC8 A;  1CJE A;  2H89 B;  5D94 A;  4E71 A;  3AE3 B;  2FCN A;  1D6E C;  2LGI A;  3B2F A;  2KZR A;  2L76 A;  4JX1 C;  4K7W A;  1RAX A;  2WNM A;  4XWT A;  2KO3 A;  4BOS C;  1BXT A;  4B95 A;  4ANX A;  4ACF A;  2L32 A;  1ISN A;  2PW9 A;  1OQR A;  4M0W B;  1T6B X;  1CQV A;  3UIO B;  2KFK B;  4HPL B;  2KDF B;  2HDE A;  1FM0 D;  3AE2 B;  1HQR D;  2WXF A;  3PTF C;  5HG2 A;  2RDG A;  1ZW7 A;  1E7P B;  4ZDV A;  1SJE D;  4LJP B;  2CS4 A;  3ZLZ A;  2NR2 A;  3V62 A;  4IWO A;  4YTP B;  3DBS A;  1KTK A;  1ZXH A;  2WU2 B;  1SJH D;  2MA9 B;  3N3K B;  1YQB A;  1YX5 B;  4ZYN A;  3DWG C;  3JSV B;  1QZE A;  3TEX A;  1P9D U;  3LB8 C;  3TEY A;  3IBE A;  2WLB A;  2JYT A;  3UGB B;  2O2V A;  3CIR B;  2L1A A;  3RPF C;  3WAM A;  1FFU A;  4W9H A;  1QLB B;  1QOA A;  2AL3 A;  5G5G A;  3KLS X;  4BAX A;  1D3Z A;  5HHD G;  1C3T A;  3N1Z C;  1YOV B;  3TBL D;  3DPD A;  5FR6 A;  2JWU A;  3RZW C;  2CJN A;  4FXC A;  4YWG G;  1HTO A;  2LUE A;  4HDQ A;  3NZ3 A;  1RLF A;  1YX6 B;  1WRD B;  3QIJ A;  2UYZ B;  1OEY J;  1XQQ A;  2DAJ A;  3X23 A;  2LHE A;  3A9K A;  3L13 A;  2IO0 B;  1SE9 A;  2DZM A;  3VUW A;  3EHV A;  2L05 A;  4MT5 A;  2DNF A;  1L7Y A;  2M56 B;  4OHJ A;  1MFW A;  5IAA C;  3CSF A;  3JYU A;  4K3B A;  1QQR A;  1ESF A;  3Q14 C;  1L6V A;  1GAQ B;  4BBN C;  1IPG A;  3DQV A;  4IDI A;  3UF8 A;  2LGY A;  3SFE B;  4W9F A;  4DQO C;  2W9N A;  3PSE B;  4PT5 A;  3QC8 B;  5BMI A;  1SBB B;  3H7S A;  1R4N B;  1BUI C;  3Q8C A;  2KFJ A;  4EE2 A;  2IO3 B;  2BT6 A;  1CMX B;  4M8N A;  4IM0 A;  4UDU C;  3DHG C;  3GE8 C;  4HRO A;  5TSS A;  5E6O A;  4KSK C;  2PTL A;  5FK9 C;  4JWS C;  1Z2M A;  5EE0 A;  1WXS A;  3NVY A;  4LNN A;  4ZHO A;  1LO5 D;  3MJW A;  3BK2 A;  3VH3 B;  2K8B A;  4I6N B;  3R2I A;  4IW0 A;  1SSN A;  5CHW A;  4RGT A;  1TS2 A;  1VR9 A;  1NEN B;  3IT4 B;  2KVR A;  2LZ6 A;  3AEA B;  1P3Q U;  5DPS A;  4Q2J A;  4WWN A;  3R8B A;  3IAM 1;  3IT6 B;  3W1Y A;  3ECI A;  1I4H A;  2ON8 A;  3UQB A;  4RFB A;  4WAF A;  4ITK A;  3Q69 A;  2BB5 A;  3NY5 A;  2LHD A;  4JGH B;  2D07 B;  4WH4 A;  3C19 A;  1WZ3 A;  1WR6 E;  2LGD A;  1WE7 A;  1WH3 A;  1RFK A;  2LUM A;  3ZNH B;  3FIL A;  2JRI B;  2RD0 A;  2KFK A;  1V49 A;  1DYQ A;  1E8Z A;  4AJY B;  2LMC A;  1KF6 B;  5JZE B;  3L54 A;  2B3A A;  4LNK A;  2IYD B;  2MRP A;  4HDO A;  1KLV A;  3CST A;  2KX0 A;  4MM3 A;  4ZRJ A;  3UQA A;  2N7E A;  3RFZ B;  2MP2 A;  2WXN A;  3IXS A;  1FFV A;  3JSV A;  2V4L A;  4CQN A;  5H8Y E;  2RR9 A;  4KKJ A;  1A5R A;  3DVG Y;  4F7Z A;  1WWT A;  1WMH B;  2L7R A;  1VZ8 A;  4GGQ A;  2JVC A;  2KAN A;  1VD2 A;  3WAN A;  3Q8A A;  2H88 B;  1XD3 B;  4A3O A;  2NPT B;  1WXQ A;  3H9D A;  2CU3 A;  3BYT B;  2KAC A;  2ASQ A;  2ZEQ A;  2C9W B;  1T3Q A;  2GBJ A;  2GI9 A;  3HK0 A;  2IY0 B;  2KTR A;  1ACC A;  4DXG A;  2MP2 B;  2SEB D;  1E90 A;  2WGS A;  4BKS A;  2G4S A;  1N61 A;  1KRH A;  4MDK E;  4E3C A;  1T0S C;  1F2R I;  3EFU A;  3BII D;  2DEN B;  2ONQ A;  3DHI C;  3BK1 A;  1NI2 A;  2WDV B;  3L16 A;  4LDT B;  1XXG A;  3QHT A;  1YN3 A;  2KYW A;  1V8C A;  4J6I A;  2K39 A;  3LXF A;  4KX6 B;  3NS8 A;  2QDF A;  2IND C;  3S2A A;  2WXI A;  2D3C A;  2RPQ A;  4LJO B;  3V61 A;  4ICU A;  2L52 A;  1PFD A;  2LVO A;  2KDM A;  2BYE A;  2BS4 B;  3M95 A;  4K3C A;  4MH8 A;  3W1S C;  4G3X B;  4HCN B;  2MEK A;  2V4I B;  1WRI A;  2WHI A;  1XLO A;  4LDT D;  1UUP A;  2BWF A;  3PGE A;  1WI0 A;  4DHJ B;  2R2Q A;  3VR9 B;  2BYF A;  2M0X A;  1UGJ A;  3GB1 A;  1JWA D;  4QAY A;  1UEL A;  2UWQ A;  3MC8 A;  2MCN B;  3PVL A;  2WWZ A;  3MHS D;  4GIV A;  4MJS A;  1E8X A;  3BYY B;  4JIO U;  2WXG A;  5JH5 C;  2LRW A;  2G1E A;  2WDT B;  1V97 A;  1EF1 A;  4WAA A;  4M00 A;  4IM3 A;  5IO9 A;  3HHM A;  3T8M A;  1M94 A;  1VZ6 A;  3DBR B;  1WGH A;  1WJ6 A;  4RM8 A;  4IWQ A;  2E6X A;  3V6E B;  3NS1 A;  4MSQ B;  1UH6 A;  1YQ3 B;  2KN5 A;  4MJS B;  4NAW B;  2EMT A;  2HD5 B;  2D3A A;  2WXK A;  3ZXV A;  4PS8 A;  2V3N A;  3ZJV A;  2KN4 A;  1MVK A;  1WZ0 A;  1JQ4 A;  2KVZ A;  2EKE C;  3DVN U;  3Q8F A;  5G55 A;  3U30 A;  1JRO A;  3OJ4 B;  3ZNZ B;  3O13 A;  3K9O B;  2HTM E;  1B1Z A;  2MJD A;  3W2D A;  2BVC A;  2WXH A;  1R7S A;  1AW7 A;  3EGR A;  4MH0 E;  4NAM A;  2MBQ A;  2LAS A;  4HCP B;  5IN7 A;  1JWM D;  1STE A;  3DWM A;  1UZX B;  2MLB A;  3AE1 B;  1XO3 A;  3AEG B;  4LNO A;  4GN1 A;  4DXF A;  3NG0 A;  4FAD A;  1B9R A;  2MBE A;  4MGZ E;  3UIP B;  2FBW B;  2QJL A;  1RFA A;  1SIF A;  1L0X B;  4C4V B;  2ZNV C;  4JLC A;  1C4A A;  3B1L X;  4ANU A;  4HXD A;  4L2Y A;  1KM7 A;  4ZRK A;  4CYE A;  3X0W A;  1XT9 B;  3OWE B;  2G3Q B;  2K0P A;  1YN5 A;  5IOI A;  2CHW A;  2KDE B;  1D5X C;  1N60 A;  2J0K A;  1EO6 A;  1L4D B;  5HFY A;  4DDG D;  4KGT A;  1V5T A;  3PPA A;  5FKA C;  1PQS A;  3R2T A;  1JWB D;  4ICV A;  4WJN A;  2ZVN A;  3DVG X;  3EFC A;  3ML9 A;  2LI5 A;  2ZCB A;  4WQM A;  3SEB A;  1Y56 A;  1WJN A;  3HM3 A;  2EEL A;  1IBX B;  1C79 A;  1FNU A;  2D2Q A;  3LYY A;  1TT5 B;  5LXI B;  2JXX A;  2FID A;  4AP4 C;  1QOB A;  3KWL A;  1TJE A;  4CO7 A;  4C00 A;  3SR6 A;  1SF0 A;  1XLQ A;  2IY1 B;  1IP9 A;  1ZE3 D;  2K25 A;  2WXR A;  3H7P A;  1FCC C;  2BYV E;  4EOY A;  1NVI D;  2NBW B;  3KW5 B;  4EEW A;  3RNC C;  3I3T B;  1ZKH A;  2NCN A;  3HM6 X;  4TQ1 A;  1PUT A;  2J52 A;  2QCZ A;  2VRR B;  4YXD B;  4EZJ A;  4A3P A;  4WWO A;  4M8M A;  1GUA B;  2Z0E B;  4AJW A;  1C77 A;  2INC C;  2K3U A;  1L2N A;  1FRR A;  4OZC A;  4M0W A;  2QSD A;  3V60 A;  4DXA B;  2WXJ A;  1QIL A;  2M1M A;  1EUV B;  2ZCC A;  4FJZ A;  1ET9 A;  1IGD A;  1N5W A;  4TMA B;  5E6P A;  3TEZ A;  5T8I A;  4P7I A;  5D2M B;  4LNF A;  1LFD A;  2DZK A;  4FA6 A;  3RCZ A;  3PT2 B;  2W3R A;  2QMT A;  4XC2 A;  3N32 A;  3QAR A;  1F1H A;  2J0J A;  1XEE A;  4H2A A;  4X57 B;  1FCL A;  2KTR B;  4OW0 A;  2Y5B B;  3KYC D;  1K8R B;  3AMZ A;  3VTU A;  1Q10 A;  4HJG E;  4KZC A;  1YQ4 B;  2ZPY A;  5GMV A;  3V3X A;  3U8Z A;  4BVU C;  1X1M A;  1J7B A;  2HTH A;  3Q8B A;  3NZU A;  5EE1 A;  1MHH E;  4M02 A;  2A5U A;  3GZN B;  4N6E B;  2NTS A;  4NNJ B;  2IZV B;  2CHX A;  3AEC B;  3RYT A;  1QKZ A;  1YN4 A;  2CHZ A;  1C9F A;  1C1Y B;  1WSP A;  2RDH A;  1DOX A;  4RMA A;  2IO1 B;  3VUX A;  2KWD A;  5CHV C;  4G0N B;  2KMC A;  3I9V 1;  1PGX A;  1P7F A;  4P1C C;  2BBC A;  1FD6 A;  2HJ8 A;  4NQL B;  3AE8 B;  5E6J A;  1Z5S B;  2N1W A;  3QK0 A;  3Q3N C;  2JT4 B;  1JML A;  2V0G A;  1F0Z A;  2N9X A;  1WXV A;  3PRE A;  3NRZ A;  4I6P A;  2KWV B;  1MI0 A;  2VH2 A;  2N7D A;  4IKG A;  2C5L C;  2KOX A;  3V05 A;  2FCS A;  2QHO A;  2V3S A;  1GC7 A;  1MG8 A;  4CHK A;  3NUH B;  4XDC A;  3A4R A;  4IG7 B;  3IFW B;  3GS2 A;  3BZD B;  4DHZ E;  2CJO A;  1P98 A;  2KX3 A;  4S17 A;  5BMH A;  1K51 A;  2UU7 A;  1C4P A;  1GB1 A;  4ZRI A;  5HI1 A;  1TKG A;  1KH0 A;  4KSL C;  1V6E A;  4A90 A;  3PRZ A;  3L0W B;  2JSV X;  3L4P A;  1Y8R C;  4ZRQ A;  4FHK A;  3GZN I;  3KH0 A;  1N5X A;  2B76 B;  2NBU A;  5JHA A;  1NYQ A;  3M3J A;  1WGY A;  2V1Y A;  2JXT A;  1BT0 A;  2ZW0 A;  4WIP A;  5IKC M;  2FNJ B;  1HE8 A;  2AYO B;  1HZ5 A;  1I4P A;  3R7Q A;  2IGD A;  1GG3 A;  4FN2 A;  3W5U B;  3OG5 A;  5D7G A;  1V86 A;  4RCO A;  1CZP A;  2IJ0 A;  1I35 A;  2DX5 B;  1EM7 A;  4O1N A;  3QX1 A;  1UBI A;  5DPT A;  2XN9 C;  4YL8 A;  3R66 C;  4WJP A;  3KUZ A;  3NJT A;  1E0Z A;  1P0R A;  1UWM A;  1FO4 A;  4ANV A;  2GBR A;  3ONS A;  4C56 C;  4DBG A;  1D5M C;  1FNW A;  3MTN B;  1E10 A;  4C80 A;  4KVG B;  1ZUD 2;  4MSM B;  1SXT A;  2AL6 A;  3DBH B;  2JUO A;  3RN9 C;  3WIM A;  2N9P C;  1FXA A;  2LVP A;  5LLI A;  1WMH A;  2OJW A;  2JZ3 B;  4ZRP A;  1CK1 A;  2PE6 B;  2E3T A;  2LVQ A;  2LGS A;  1TZ1 A;  5D6J B;  2KDI A;  4WWP A;  3DDC B;  2NMQ A;  2KJ6 A;  3N20 C;  1N62 A;  1E5W A;  1WGK A;  2O6V A;  1FPY A;  4W9K A;  2KQ4 X;  2M0A A;  2M8S A;  4MGI E;  2PEA A;  3VDZ A;  3P4Q B;  2W54 A;  4DDI D;  5C2T B;  3Q3F A;  4RNA A;  2N9E B;  1ZP0 B;  2KAJ A;  3NOB A;  2PE9 A;  3W1S A;  3B9J A;  4OVU A;  1J8C A;  4HEA 1;  3UI3 A;  2L00 B;  3AED B;  3KVF B;  2BYT A;  1PGA A;  2Q5W D;  3VR8 B;  3PHX B;  4TKN A;  3HUI A;  3WAO A;  1WXM A;  2BF8 B;  2LGX A;  2REX A;  3P1M A;  3RZF A;  4IC7 B;  4HKZ E;  1E7V A;  1TY2 A;  2DWQ A;  3BVG A;  3SDL C;  3D32 A;  3ZIM A;  4GMV A;  2L8J A;  2KK8 A;  5LXH A;  2KXJ A;  4EFO A;  2QC8 A;  2AWT A;  3IG3 A;  4OZB A;  3BIN A;  1TS4 A;  2KDB A;  1WYW B;  2BKF A;  1XCQ L;  3MJ5 A;  4RGN A;  2Z59 B;  3QJZ A;  3PLV A;  4JL9 A;  3RNG C;  3U52 E;  4W9J A;  3V6C B;  3VTW A;  4ZHP A;  3IAS 1;  4DHZ B;  3ZDT A;  4NQK E;  2D5G A;  2LJI A;  4FBJ B;  3ZJT A;  2O6V D;  5C3J B;  4USA A;  1OEY A;  5AZF A;  1LM8 B;  1OGW A;  2LRU A;  1JRP A;  3B2G A;  4IWP A;  2MJ3 A;  4TUU A;  1UD7 A;  3AU4 A;  3APD A;  4AUQ C;  1MG4 A;  4GB9 A;  3I5J C;  2LXA A;  4L23 A;  2AQ1 B;  2SAK A;  2WDR B;  3TL5 A;  4ZYS A;  1WF9 A;  2ICI A;  1I7H A;  1TZO A;  3T9L A;  3CF6 E;  1WE6 A;  2XK5 B;  4ANW A;  3NVW A;  4AOF A;  4NAW A;  4NJ6 A;  1IYF A;  1FRD A;  1FMA D;  4KV2 A;  3ZRC A;  3ZTC A;  5EDS A;  3ALB A;  4LLG M;  1JWU D;  4A8X C;  3W5V B;  3MC0 B;  5JXV A;  2FE8 A;  1P7E A;  2KJR A;  4YT0 B;  5LNK 1;  1YD8 U;  2AX5 A;  4TSS A;  4P6V F;  4EUT A;  3A9J B;  2ZZP B;  2INN E;  3I63 C;  4A55 A;  2OJR A;  1YJI A;  3ZTD A;  1FIQ A;  2YEP F;  4II3 B;  1OQQ A;  2I1J A;  4C7Y A;  1VCB A;  1FXI A;  4I6L B;  5L95 C;  1V5O A;  2DYM A;  3U2S C;  2D3G A;  4HVB A;  4K7S A;  2N7J A;  1H4R A;  4LTU A;  3SD5 A;  3JW0 X;  4EKU A;  2PJH A;  1J7C A;  3A1Q B;  4XZ4 A;  3PHW B;  2GRI A;  3Q2A C;  4P1B C;  1XF5 L;  3MHZ A;  5BMG A;  3N1Y C;  1JWS D;  2R2O A;  2K1F A;  2EKI A;  3ETR A;  4PYU A;  3RMK C;  1HEZ E;  2KC2 A;  4GDL A;  1F9J A;  2WXQ A;  1EU3 A;  1MJD A;  3RNE C;  4F1S A;  2KT7 A;  1LGR A;  3ML8 A;  1ZPS A;  1SGH A;  2MBB B;  3Q6B A;  3GP7 A;  4RGM A;  2WU5 B;  1V1P A;  1OQY A;  1YJJ A;  2KKC A;  3ZNG C;  3ZUN A;  1F2R C;  4LNI A;  3QQ8 B;  1NI3 A;  2C60 A;  1WM2 A;  2QEJ C;  3ZJU A;  2KTF A;  4BOZ B;  2N9K A;  1UGM A;  2LEK A;  1I4Q A;  3VTV A;  1VJK A;  4FHJ A;  2KQ7 A;  1TKY A;  4HPP A;  3ZGZ A;  3DCG A;  1HTQ A;  2IPK D;  2DZI A;  3JVZ X;  1F77 A;  3VH4 B;  1WGG A;  2VZK B;  1RWS A;  4M01 A;  1VZ7 A;  1VLB A;  1TIF A;  1KLG D;  3OLM D;  3L17 A;  4OVV A;  3H7P B;  1AN8 A;  4KKI A;  1I4X A;  1SE3 A;  3DBL B;  1N63 A;  1JRU A;  2FIF A;  5DPW A;  5CTR C;  1WIA A;  3NZS A;  2Y5P A;  3LDZ E;  1VRA B;  4MEL A;  4L1B A;  2MBO A;  3AM9 A;  5MPO A;  3E56 A;  2ZNV B;  4AS1 A;  4PS3 A;  3EUB 2;  4W9L A;  3SFD B;  4W9C A;  1K52 A;  4KZ0 A;  3VRA B;  1PYW D;  1ZXI A;  2VZK D;  4RF0 A;  1IUE A;  2MQJ A;  2N9L A;  2XK5 A;  3GE3 C;  1SE4 A;  4DK5 A;  3ZRF A;  4K7U A;  3WAP A;  3GOE A;  3ZQ4 A;  3KUD B;  2ZW1 A;  1V80 A;  1C78 A;  2DLB A;  5D3D A;  1J0G A;  2BW2 A;  3U7D A;  1R4M I;  2KQS A;  2KNB A;  2PIA A;  2K6D B;  2KLG A;  2R61 A;  3VHT C;  3PRM B;  4GOC A;  3A9J A;  3Q3O C;  4NPN A;  3AV8 A;  2KJH B;  2WQY B;  3PV1 A;  1U4A A;  2RSU A;  4GDL B;  2K22 A;  1PGB A;  1QT9 A;  2PVG C;  2PPH A;  2G9H D;  3A9K B;  1TS5 A;  2FAZ A;  2C7M B;  1WM3 A;  2J7Q B;  3B0A A;  1FEH A;  1UWX A;  1AAR A;  2KC1 A;  3P2B A;  3A33 B;  2NTT A;  2GLS A;  4W9G A;  2OOB B;  2L3Z A;  4EZK A;  1C76 A;  4NJC A;  4XGA B;  1L0V B;  5G2N A;  1L5P A;  4NZL B;  1AWD A;  3Q3J A;  4OVZ A;  1VDV A;  4R3D A;  4XWW A;  3I57 A;  4RGO S;  3M63 B;  1P1A A;  1UF0 A;  4URK A;  2KMM A;  4DWF A;  4N59 A;  4GSW A;  2GBM A;  4A20 A;  4K1R B;  4E74 A;  3P63 A;  2ZPN A;  2FUH B;  3P4R B;  3TIX A;  1JW9 D;  1ROE A;  1WX7 A;  1D4B A;  3RUI B;  1GB4 A;  1I4R A;  3RNA C;  3HIZ A;  4IUM B;  5BYS A;  2YVC A;  4JPS A;  2GOW A;  3ZKJ C;  4BKS D;  2JPH A;  3PZ7 A;  3AE5 B;  2J42 A;  3T3O A;  3J9C A;  3C0R B;  1TKE A;  4B6W A;  1R4M B;  3W9C B;  2WXM A;  3DBH I;  3APC A;  3QA8 A;  2WXP A;  4B9K A;  1ZGU B;  2W55 A;  3KYD D;  2MW5 A;  2Z0D B;  2MSE D;  1SIJ A;  3URY A;  2OED A;  1EWY C;  2M17 A;  2PLP A;  4PS7 A;  3OJ3 A;  1IGC A;  1KLU D;  2VH1 A;  4AWJ A;  3WA0 A;  2MJE A;  3PS6 A;  2CKH B;  3VAW A;  3PLU A;  4FJV B;  2LWP A;  1YMH E;  5AUI A;  3M62 B;  4RF1 A;  3PZ8 A;  3WCQ A;  3NVZ A;  2QIE B;  3VUY A;  5G5H A;  4US9 A;  1GC6 A;  2PKO A;  3N30 A;  2L0F A;  2GBN A;  3MP9 A;  4JQW C;  3AU5 A;  4N9F 4;  3HVD A;  1DGJ A;  4J3O D;  3DHH C;  5DPR A;  1H8C A;  5J18 A;  3TMP B;  3SU8 X;  2I38 A;  4BZA A;  1V1O A;  2JF5 A;  1EWC A;  4MM3 B;  2ZJD A;  2Y3A A;  1T5X D;  3NHE B;  3DOW A;  4PYZ A;  2BTE A;  4JWU C;  2D10 A;  3AUL A;  5J17 A;  2MBH A;  2X38 A;  1JAL A;  2J53 A;  2PVO D;  1M4V A;  1E8Y A;  5EE3 A;  2JZZ A;  4NJ7 A;  2WXL A;  2JWZ A;  3TJP A;  1ENF A;  1WGR A;  2NVU I;  4MAC A;  2GMI C;  3OAW A;  3VVW B;  3VFK A;  3AE7 B;  3C8Y A;  2N1V A;  1HZ6 A;  4W9D A;  2V3P A;  2JQR B;  2IBI B;  4BKT A;  1C4C A;  2RMM A;  5C1Z A;  3H8H A;  1MHX A;  4N58 A;  3E9S A;  1SE2 A;  2G4D B;  1RRB A;  4K81 A;  3H6N A;  2NBV B;  3AE6 B;  2KMA A;  4FUL A;  3AEF B;  2MWS B;  3ZO5 B;  3DBR I;  1FNV A;  4GDK B;  4F8C B;  4W9I A;  3RD2 A;  3ZXR A;  1KOT A;  1WGD A;  5J2R A;  1S1Q B;  1LXD A;  2JU6 X;  4RH6 A;  2FCQ A;  3QWZ B;  3RUL A;  1TTN A;  3L08 A;  3A4S C;  2PMV A;  3FAH A;  5AZH A;  1HA5 A;  2O6V B;  1E7U A;  3FKY A;  3AXC A;  4G11 A;  2LD9 A;  1OTR B;  2W82 A;  4PK1 A;  2L0T A;  3T3N A;  2V9H A;  4WJO A;  5BYQ A;  4IOI E;  2K8C A;  4HWI B;  3H1U A;  2DAF A;  2Z8L A;  2J0M A;  1DOI A;  2A4Z A;  1J19 A;  1HXY D;  3AE9 B;  3AI5 A;  3PRP B;  2FCM A;  3O65 B;  3AB5 A;  3FIL B;  4BKG A;  3BY4 B;  1UBQ A;  3DVN V;  4HPM B;  4KIK A;  1UNS A;  2BB6 A;  3PO0 A;  4US8 A;  1ZDX A;  2KD0 A;  5AUK A;  2K8H A;  1LQB A;  2CU1 A;  2MHJ A;  4GXB A;  4YTN B;  1E9M A;  1WFY A;  1K50 A;  3IVF A;  3CWI A;  2I1K A;  2JRH A;  5TR5 A;  4HJK A;  4XE0 A;  1NYR A;  3AN1 A;  4GLS C;  4HLE A;  2WXO A;  4EZL A;  2BS3 B;  4G50 A;  1WJU A;  2WYQ A;  2Y5C A;  2BPS A;  2JYE A;  4KDI C;  1YNT E;  1PDX A;  4WWM A;  2MX2 A;  5IP4 D;  2K5P A;  1I42 A;  4AQ7 A;  2K6Q A;  4NY0 A;  1EU4 A;  3KWV A;  5HKH A;  2DYB A;  1TY0 A;  3LJ3 A;  2AQ2 B;  3QCA A;  1ET6 A;  4IM2 A;  2BS2 B;  3BWU D;  4LCD E;  2D11 A;  2IGH A;  1YIW A;  1ZDV A;  2LXC A;  2DBY A;  1SB3 C;  1WR1 A;  4A9A A;  4B0E A;  5AZG A;  1V9J A;  2C7N B;  4C4V A;  4OZA A;  2IGG A;  3DBL I;  2LJ5 A;  4A6Q A;  4FJY A;  1FXT B;  2JY6 A;  5E6N A;  1BML C;  1KFY B;  1TYG B;  2IDY A;  5BO4 B;  2WDQ B;  2DZJ A;  2QIL A;  3A1Q A;  3RNF C;  1V2Y A;  4KGR A;  4LK0 M;  1T0R C;  3U4E G;  1T0Y A;  1L0Y B;  3PZD A;  4JE3 B;  4ZOH C;  4YTM B;  2XNA C;  4KGS A;  1XLN A;  2XEW A;  4ASW C;  3B08 A;  3R7R A;  1WX8 A;  3K9P B;  2N4F A;  4MGY E;  4XDD A;  2WP9 B;  1DOY A;  3AE4 B;  3FC4 A;  1NEK B;  1WXA A;  3AEB B;  1V1P B;  5KHO A;  4HKQ A;  2MH7 A;  3NVV A;  4FLH A;  5I4D A;  1IBX A;  3AEE B;  5KHQ A;  1RM6 C;  2WS3 B;  2RDB C;  2RPV A;  2RGF A;  1K53 A;  2CR5 A;  1TGZ B;  1AYF A;  2ZVO A; 
#chains in the Genus database with same CATH homology
 4MGK E;  1Q1O A;  1XD3 B;  4A3O A;  1Q0W B;  2MQJ A;  2KLC A;  2NPT B;  2KWC A;  3H9D A;  4HK2 A;  4KSL C;  1V6E A;  2XK5 A;  2ASQ A;  4WQO B;  2ZEQ A;  2C9W B;  2GBJ A;  4DK5 A;  3PRZ A;  3L0W B;  3ZRF A;  1Y8R C;  3HK0 A;  4K7U A;  3WAP A;  3GOE A;  2IY0 B;  1R4N I;  2NS5 A;  3KUD B;  4FHK A;  1V80 A;  2KTR A;  2YLM A;  5DCN A;  3GZN I;  5CHF A;  3KH0 A;  1GJZ A;  2MP2 B;  1E90 A;  3KUC B;  4BKS A;  2G4S A;  1J0G A;  2NBU A;  3R3M A;  4MDK E;  5JHA A;  4E3C A;  3M3J A;  3EFU A;  1WGY A;  3ENE A;  3U7D A;  2DEN B;  2V1Y A;  1R4M I;  1NI2 A;  2KQS A;  1BT0 A;  2KNB A;  3L16 A;  4LDT B;  5AEK B;  2K6D B;  3QHT A;  2KLG A;  2FNJ B;  3UIN B;  1HE8 A;  4J6I A;  3VHT C;  2K39 A;  3NS8 A;  2AYO B;  3PRM B;  4GOC A;  3A9J A;  3R7Q A;  4NPN A;  3S2A A;  5CX3 A;  2KJH B;  2RPQ A;  4LJO B;  1YJ1 A;  1U4A A;  2RSU A;  3PV1 A;  4GDL B;  1GG3 A;  4ICU A;  2LVO A;  3V61 A;  2O2V B;  4FN2 A;  2C7H A;  2PPH A;  5D7G A;  3A9K B;  1V86 A;  2FAZ A;  2BYE A;  2G45 B;  2C7M B;  3EEC A;  1WM3 A;  4BFR A;  2J7Q B;  3VQI A;  3B0A A;  3M95 A;  3W1S C;  4G3X B;  4HCN B;  1I35 A;  2DX5 B;  1AAR A;  5L83 A;  2KC1 A;  3P2B A;  4KIK B;  4LDT D;  3QX1 A;  3A33 B;  4BBN F;  1VD2 A;  1UBI A;  5DPT A;  1TBE A;  2BWF A;  3PGE A;  1WI0 A;  2OOB B;  1S3S G;  2L3Z A;  4W9G A;  4EZK A;  1KJT A;  4YL8 A;  5G2N A;  3R66 C;  4DHJ B;  2R2Q A;  4WJP A;  3Q3J A;  2DHZ A;  4XX5 A;  2BYF A;  3KUZ A;  3M63 B;  1P1A A;  4URK A;  1P0R A;  2M0X A;  4DWF A;  4GSW A;  3ZDM C;  2KWU B;  2GBM A;  4A20 A;  4K1R B;  4ZRI A;  2WX0 A;  1UEL A;  2UWQ A;  4E74 A;  2MCN B;  2ZPN A;  3ZNI D;  2GBR A;  4ANV A;  3PVL A;  4KDL B;  3ONS A;  3RT3 B;  3WAL A;  2FUH B;  2WWZ A;  3MHS D;  4GIV A;  4MJS A;  3TIX A;  1E8X A;  4DBG A;  4JIO U;  2EMS A;  5JHB A;  3MTN B;  5IA7 A;  5JH5 C;  1WX7 A;  2LRW A;  4KVG B;  4MSM B;  2AL6 A;  3RUI B;  2WDT B;  2BWE S;  2JUO A;  2KHW B;  3WIM A;  2N9P C;  1EF1 A;  3SHQ A;  4WAA A;  1E8W A;  4IM3 A;  2LVP A;  3HIZ A;  4IUM B;  3TCA A;  5LLI A;  1WMH A;  3HHM A;  1GNU A;  2JZ3 B;  2YVC A;  2BGF A;  3ZW3 A;  2GOW A;  2GBK A;  3T8M A;  1M94 A;  3ZKJ C;  4BKS D;  2JPH A;  1WY8 A;  4II2 B;  2PE6 B;  1WGH A;  2LVQ A;  3L10 B;  1WJ6 A;  3C0R B;  4RM8 A;  1TZ1 A;  1WJ4 A;  2AEH A;  4IWQ A;  4MSQ B;  3V6E B;  4B6W A;  1UH6 A;  2DYO A;  3IHP C;  2KDI A;  2KN5 A;  4WWP A;  5D6J B;  4MJS B;  4NAW B;  2EMT A;  3DDC B;  3DBH I;  3APC A;  2KJ6 A;  4TV3 A;  3QA8 A;  2HD5 B;  4B9K A;  1ZGU B;  3KYD D;  2MW5 A;  2IO2 B;  2Z0D B;  1Q5W B;  4PS8 A;  2BKR B;  1E5W A;  2O6V A;  4MEM A;  2MSE D;  4W9E A;  4W9K A;  4GU2 A;  1V81 A;  2M8S A;  4MGI E;  1WZ0 A;  2PEA A;  2M17 A;  3VDZ A;  4DDI D;  4PS7 A;  2EKE C;  2WX1 A;  3DVN U;  3OJ3 A;  3APF A;  2NPT A;  3Q3F A;  5G55 A;  3U30 A;  4AWJ A;  2N9E B;  1EF5 A;  3WA0 A;  3OJ4 B;  3PS6 A;  4TQ0 A;  2CKH B;  3VAW A;  2HE7 A;  3ZNZ B;  3NOB A;  3PLU A;  3K9O B;  4FJV B;  2PE9 A;  1NDD A;  2LWP A;  3W1S A;  4OVU A;  3M62 B;  1J8C A;  3ZVV A;  5C23 A;  4MH0 E;  2M4N A;  1WX9 A;  2L00 B;  2MBQ A;  3VUY A;  2LAS A;  4HCP B;  3KVF B;  1GC6 A;  1NBF C;  3QAQ A;  3N30 A;  3PHX B;  1UZX B;  2L0F A;  2MLB A;  4RM9 A;  2GBN A;  4GDK A;  4DHJ D;  4TKN A;  3WAO A;  1WXM A;  1G6J A;  2BF8 B;  3AU5 A;  4JQW C;  4N9F 4;  2LGX A;  2REX A;  4GN1 A;  4WJQ A;  3RZF A;  3VXW A;  3CMM B;  4IC7 B;  2XBB C;  4FAD A;  2MBE A;  1E7V A;  4MGZ E;  5DPR A;  3UIP B;  1H8C A;  3EC8 A;  3SDL C;  5J18 A;  3D32 A;  1RFA A;  3ZIM A;  1SIF A;  3TMP B;  2ZNV C;  4GMV A;  4JLC A;  5D94 A;  2L8J A;  3B1L X;  3SU8 X;  2KK8 A;  4E71 A;  2KXJ A;  2FCN A;  4HXD A;  4ANU A;  5LXH A;  2JF5 A;  2KZR A;  4EFO A;  2L76 A;  2ZJD A;  2AWT A;  3IG3 A;  3BIN A;  1KM7 A;  2KDB A;  3DOW A;  3NHE B;  4PYZ A;  4K7W A;  1RAX A;  1WYW B;  4ZRK A;  2KO3 A;  4CYE A;  4BOS C;  3X0W A;  4B95 A;  1XT9 B;  2BKF A;  2D10 A;  3AUL A;  2G3Q B;  5J17 A;  2MBH A;  4ANX A;  1ISN A;  4M0W B;  2Z59 B;  1E8Y A;  3QJZ A;  3PLV A;  4JL9 A;  2CHW A;  2JZZ A;  2KDE B;  4NJ7 A;  4W9J A;  2JWZ A;  3TJP A;  3V6C B;  3UIO B;  3VTW A;  2KFK B;  4HPL B;  2J0K A;  2KDF B;  1EO6 A;  1WGR A;  2NVU I;  4DHZ B;  2GMI C;  3ZDT A;  4NQK E;  3OAW A;  3PTF C;  4DDG D;  4FBJ B;  3VVW B;  1ZW7 A;  1V5T A;  3VFK A;  2O6V D;  3PPA A;  1PQS A;  4ZDV A;  2N1V A;  1OEY A;  4ICV A;  5AZF A;  4W9D A;  2IBI B;  4BKT A;  1LM8 B;  1OGW A;  4WJN A;  2ZVN A;  3DVG X;  4LJP B;  5C1Z A;  2LRU A;  2CS4 A;  3ZLZ A;  2NR2 A;  3ML9 A;  3V62 A;  4IWO A;  4IWP A;  2LI5 A;  2ZCB A;  3DBS A;  4TUU A;  1UD7 A;  2G4D B;  1RRB A;  4K81 A;  4GGQ A;  2MA9 B;  3H6N A;  3AU4 A;  2NBV B;  3APD A;  3N3K B;  3WAN A;  1YQB A;  1YX5 B;  2KMA A;  4FUL A;  4GB9 A;  4ZYN A;  4AUQ C;  1WJN A;  3HM3 A;  3JSV B;  1QZE A;  2MWS B;  3ZO5 B;  3DBR I;  1P9D U;  2LXA A;  4GDK B;  3TL5 A;  4F8C B;  2D2Q A;  3IBE A;  4W9I A;  3RD2 A;  1WF9 A;  5LXI B;  1KOT A;  1WGD A;  3UGB B;  5J2R A;  2O2V A;  2JXX A;  2FID A;  3T9L A;  3CF6 E;  1WE6 A;  2XK5 B;  4ANW A;  4AOF A;  4AP4 C;  4NAW A;  1S1Q B;  4NJ6 A;  1IYF A;  1LXD A;  3WAM A;  4CO7 A;  2FCQ A;  3QWZ B;  4W9H A;  3RUL A;  1TTN A;  3L08 A;  3A4S C;  2AL3 A;  4KV2 A;  2IY1 B;  1IP9 A;  5AZH A;  3ZRC A;  2O6V B;  3ZTC A;  1E7U A;  2K25 A;  5EDS A;  1D3Z A;  3AXC A;  3ALB A;  4G11 A;  2LD9 A;  1OTR B;  1C3T A;  2L0T A;  3TBL D;  3H7P A;  2KJR A;  3DPD A;  5FR6 A;  2BYV E;  4EOY A;  1YD8 U;  3KW5 B;  2NBW B;  4EEW A;  4WJO A;  3I3T B;  3RZW C;  1ZKH A;  2NCN A;  3HM6 X;  2LUE A;  4HDQ A;  2K8C A;  3A9J B;  2ZZP B;  4TQ1 A;  4HWI B;  1RLF A;  4EUT A;  3H1U A;  1YX6 B;  1WRD B;  2DAF A;  3QIJ A;  2OJR A;  2UYZ B;  2J0M A;  1OEY J;  1XQQ A;  3ZTD A;  2DAJ A;  2A4Z A;  2VRR B;  4EZJ A;  1J19 A;  3X23 A;  4A3P A;  3A9K A;  3L13 A;  4WWO A;  2IO0 B;  4M8M A;  3AI5 A;  3PRP B;  1SE9 A;  1GUA B;  2DZM A;  2FCM A;  3EHV A;  2Z0E B;  3VUW A;  2L05 A;  4AJW A;  3O65 B;  4II3 B;  1L7Y A;  4BKG A;  1L2N A;  3BY4 B;  2I1J A;  1UBQ A;  1VCB A;  3DVN V;  4HPM B;  3V60 A;  4I6L B;  5L95 C;  4DXA B;  2ZCC A;  2M1M A;  1EUV B;  4FJZ A;  4KIK A;  5IAA C;  1V5O A;  2DYM A;  5E6P A;  3CSF A;  2D3G A;  3JYU A;  4HVB A;  4P7I A;  5D2M B;  4K7S A;  1H4R A;  1LFD A;  2DZK A;  4BBN C;  1IPG A;  2KD0 A;  4FA6 A;  3RCZ A;  3PT2 B;  2K8H A;  3DQV A;  1LQB A;  2CU1 A;  2LGY A;  3UF8 A;  4XC2 A;  3JW0 X;  3SD5 A;  4EKU A;  2PJH A;  4W9F A;  3N32 A;  2W9N A;  3QAR A;  2J0J A;  3A1Q B;  4XZ4 A;  3PSE B;  4GXB A;  3PHW B;  4X57 B;  2KTR B;  3QC8 B;  2Y5B B;  3KYC D;  1WFY A;  3H7S A;  2KFJ A;  1K8R B;  3IVF A;  2IO3 B;  2I1K A;  1CMX B;  2JRH A;  2R2O A;  3VTU A;  2K1F A;  5TR5 A;  4HJK A;  4M8N A;  4PYU A;  4IM0 A;  4HLE A;  4KZC A;  2ZPY A;  2KC2 A;  5GMV A;  4GDL A;  1F9J A;  4KSK C;  5E6O A;  4EZL A;  4G50 A;  4F1S A;  1WJU A;  1Z2M A;  3U8Z A;  4BVU C;  2WYQ A;  3ML8 A;  1WXS A;  1X1M A;  2BPS A;  1SGH A;  2MBB B;  4KDI C;  3MJW A;  2MX2 A;  3VH3 B;  1I42 A;  1OQY A;  2K8B A;  2HTH A;  2KKC A;  4I6N B;  2K6Q A;  4IW0 A;  4NY0 A;  3NZU A;  3ZNG C;  3ZUN A;  2DYB A;  5HKH A;  3LJ3 A;  3QQ8 B;  5CHW A;  2C60 A;  1WM2 A;  2A5U A;  3QCA A;  2KVR A;  2KTF A;  2LZ6 A;  4IM2 A;  4BOZ B;  4NNJ B;  2IZV B;  1P3Q U;  4LCD E;  2D11 A;  1UGM A;  2CHX A;  3RYT A;  1YIW A;  5DPS A;  4WWN A;  2LXC A;  3VTV A;  1WR1 A;  4FHJ A;  2CHZ A;  2KQ7 A;  3W1Y A;  5AZG A;  1C1Y B;  1V9J A;  2C7N B;  3DCG A;  3ECI A;  3DBL I;  3UQB A;  2LJ5 A;  4RMA A;  2IO1 B;  4FJY A;  1FXT B;  2JY6 A;  5E6N A;  2DZI A;  3JVZ X;  3VUX A;  3VH4 B;  1WGG A;  3NY5 A;  4JGH B;  2D07 B;  5CHV C;  4G0N B;  2KMC A;  5BO4 B;  1WZ3 A;  2DZJ A;  2HJ8 A;  1WR6 E;  2LGD A;  3A1Q A;  3OLM D;  4NQL B;  1WE7 A;  3L17 A;  1WH3 A;  1Z5S B;  2N1W A;  3QK0 A;  4OVV A;  3ZNH B;  1V2Y A;  3H7P B;  2JT4 B;  2JRI B;  2RD0 A;  1T0Y A;  3PZD A;  2KFK A;  1V49 A;  2N9X A;  1WXV A;  1E8Z A;  3PRE A;  4AJY B;  1JRU A;  2FIF A;  4I6P A;  5JZE B;  2KWV B;  5DPW A;  3L54 A;  5CTR C;  2XEW A;  2B3A A;  1WIA A;  2N7D A;  2IYD B;  2MRP A;  4HDO A;  4ASW C;  1KLV A;  2C5L C;  3B08 A;  2KOX A;  3CST A;  3R7R A;  1WX8 A;  3K9P B;  2N4F A;  3NZS A;  4MGY E;  2KX0 A;  3LDZ E;  2FCS A;  2QHO A;  2V3S A;  1GC7 A;  1MG8 A;  4CHK A;  3A4R A;  4MM3 A;  4MEL A;  4IG7 B;  4ZRJ A;  2MBO A;  3UQA A;  2N7E A;  1WXA A;  3IFW B;  2MP2 A;  5KHO A;  4DHZ E;  2ZNV B;  4PS3 A;  3JSV A;  4FLH A;  2V4L A;  1P98 A;  2KX3 A;  4W9L A;  5KHQ A;  2RR9 A;  1A5R A;  3DVG Y;  4W9C A;  4F7Z A;  4KZ0 A;  1WMH B;  2L7R A;  2RGF A;  2CR5 A;  2JVC A;  1TGZ B;  2KAN A;  2ZVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...