1WXSA

Solution structure of ufm1, a ubiquitin-fold modifier
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
88
structure length
88
Chain Sequence
GPLGSMSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Ubiquitin-fold Modifier 1
publication title Solution structure and dynamics of Ufm1, a ubiquitin-fold modifier 1
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03671 Ufm1 Ubiquitin fold modifier 1 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wxsA00
2ASQA 2FCNA 4YL8A 1K8RB 1LM8B 1GG3A 4AUQC 3ML9A 2MBEA 5G2NA 1YIWA 4KZ0A 3U30A 2MA9B 4LDTB 5DPWA 4DHZB 5AEKB 1L2NA 4IM2A 1WR6E 1S1QB 3R3MA 1U4AA 4FADA 1PQSA 3L54A 4ZRKA 4EEWA 1WJ4A 1TGZB 2C7HA 4IC7B 4MELA 3VUWA 2NCNA 3VFKA 2BYFA 3MJWA 3O65B 4CO7A 4X57B 4P7IA 4FJZA 2MWSB 4RM9A 2KTFA 3IBEA 3PSEB 2LI5A 1SE9A 2BGFA 2NS5A 4ZDVA 4W9CA 3ZLZA 2DZIA 1H4RA 4BOSC 2ZCCA 2GBKA 3HM3A 2HD5B 2DAJA 4KSLC 1C1YB 1WMHB 2LXAA 2LVOA 1RLFA 2YVCA 3PREA 3A9KA 2WDTB 4KIKA 4EKUA 3A9JB 4JL9A 4OVVA 1G6JA 1E90A 1WGHA 3DBHI 2IYDB 4XX5A 2XK5B 3ZW3A 2L3ZA 2DENB 2CHWA 2GBJA 4K81A 3ONSA 4XC2A 3W1SC 4NQKE 2C9WB 2DZJA 4NAWA 4DHJB 3R7QA 1WMHA 4G50A 2LVPA 4JGHB 1I35A 1WGRA 3PV1A 2AL6A 3A9JA 3AU5A 2KDIA 4HPLB 2V4LA 2ZPYA 3X23A 3VUXA 3ZTDA 4ANVA 2JRIB 1UBQA 2LD9A 3UQAA 2DHZA 4A3OA 1WJ6A 2L05A 1IP9A 2M17A 4GU2A 1V86A 2GBRA 4KDLB 2Z59B 4KV2A 3JVZX 4FHJA 4I6PA 3NS8A 5DPTA 1QZEA 3WIMA 2KTRB 2CKHB 3B08A 4LJPB 2MP2B 3DVGY 1WRDB 4W9EA 2KD0A 4XZ4A 3ZRCA 2KJRA 2KLGA 3SD5A 4LJOB 4EFOA 4DHJD 2WWZA 3PRPB 2B3AA 2YLMA 3TIXA 1KLVA 4WJQA 3UF8A 3VH4B 2KFJA 4FHKA 4F1SA 3AULA 3KUCB 1TBEA 3BY4B 2J7QB 2DYMA 3KUDB 3C0RB 3CSTA 3U8ZA 3V6CB 3NOBA 4F8CB 3K9OB 4MGYE 1V49A 4M8MA 3V60A 4IG7B 2MRPA 2ZJDA 2FIDA 2UYZB 4TQ0A 1V80A 4BKTA 2NPTA 3DBSA 3AU4A 4DWFA 4W9DA 3JW0X 2RPQA 4EOYA 4ANUA 1UZXB 1AARA 1YX6B 5DPRA 1VD2A 1Z5SB 3SU8X 2MSED 3EFUA 4GSWA 4HCPB 2MBHA 2IO0B 5EDSA 2K6DB 2IZVB 1WF9A 2UWQA 4TV3A 3HK0A 2MBQA 3HIZA 2J0MA 3NHEB 3QK0A 3DBLI 4B9KA 3APCA 1UGMA 1WGYA 3EHVA 2KC2A 1OQYA 1UH6A 1V5TA 3VTUA 3ZIMA 3U7DA 2PE9A 2QHOA 3D32A 1HE8A 2GBMA 4HDOA 3KYDD 3PRZA 3RZWC 3S2AA 1WIAA 5LXIB 2JVCA 4PYUA 3SDLC 2LRWA 3VHTC 2BKFA 2GOWA 1R4MI 2JY6A 4M0WB 4II2B 1A5RA 2MCNB 3ZNHB 2JZ3B 3IG3A 2OOBB 3ZO5B 2N1VA 4URKA 4IW0A 1KOTA 4NNJB 2KMCA 2BWFA 1J8CA 2KXJA 3A4RA 2JT4B 2M0XA 5D2MB 5IAAC 1V81A 4W9IA 3QC8B 2N9EB 4FULA 1WE7A 2DAFA 2WX1A 1WX8A 1WY8A 2CHZA 2K25A 4HCNB 2M4NA 5JHBA 1WM3A 1WR1A 3AI5A 3GZNI 2G3QB 5JHAA 1S3SG 1LFDA 4CHKA 2L8JA 2DZKA 2RSUA 3A9KB 3ZNID 2V3SA 1R4NI 1NBFC 4JIOU 4KIKB 5DPSA 1OTRB 1UBIA 3M63B 3R7RA 3WAPA 3KW5B 1WI0A 5LXHA 1OEYA 4RM8A 5CHWA 2MLBA 4K1RB 3Q3JA 4GB9A 5GMVA 1TTNA 4NY0A 4ZRIA 2KJ6A 2KN5A 2OJRA 2KDBA 3L08A 4FJYA 4NAWB 4IWPA 5IA7A 2JF5A 3OJ3A 3PT2B 1LXDA 2WX0A 3T8MA 3KUZA 3RYTA 3VUYA 1V2YA 1M94A 4B6WA 4DHZE 3OAWA 1Q1OA 2XEWA 2NBUA 3LJ3A 2KK8A 4GDLA 3VXWA 2I1KA 3APDA 1Z2MA 2LGXA 3QCAA 5DCNA 4NJ6A 2LXCA 2KANA 1J19A 3L17A 4HDQA 1Y8RC 1P98A 4G3XB 1KJTA 1Q5WB 3SHQA 5CX3A 2KFKA 3PRMB 2KC1A 4GDKA 2MBBB 3A33B 5CTRC 3ZKJC 1TZ1A 2L0TA 2N7EA 3NY5A 4PS7A 2BYEA 2K6QA 3WA0A 4DBGA 4GMVA 3VVWB 1OGWA 4N9F4 1E7VA 1IPGA 4HPMB 1WXSA 3RD2A 4BBNF 4BKGA 3VTWA 2Y5BB 2R2OA 2ZCBA 2IBIB 3L10B 5CHVC 2Z0EB 2LASA 4M8NA 3ZDTA 4NPNA 3PGEA 4WAAA 1Q0WB 1D3ZA 2PJHA 2KOXA 2G4SA 4I6LB 3HM6X 4AJWA 3ZNGC 2DYBA 4DDGD 5J18A 2HJ8A 3PVLA 1YX5B 1GC7A 2LUEA 3DVNU 1EUVB 2J0KA 2K8CA 1XT9B 3OJ4B 3P2BA 4IUMB 4MSQB 2O6VB 1BT0A 4MJSA 1UD7A 2KVRA 2KLCA 4BFRA 2NPTB 2MBOA 4BVUC 4ZYNA 1XQQA 2I1JA 2L76A 4W9JA 1F9JA 3L0WB 3PPAA 3PS6A 2DX5B 3QIJA 4GN1A 4WWNA 3IHPC 3V62A 5E6PA 1P9DU 4HVBA 1WZ3A 2LGYA 2JZZA 4BOZB 2KZRA 2ZVNA 2AYOB 2L00B 2IO1B 1P0RA 3VQIA 3EC8A 2O6VA 4PS3A 3IFWB 4BKSA 3QJZA 2RGFA 1FXTB 4FJVB 3B1LX 4IWOA 2G4DB 3DPDA 3H9DA 4GOCA 4ICUA 2FCMA 2ZZPB 3V61A 1E5WA 1C3TA 3QARA 2MW5A 4IM3A 4MGIE 2FCSA 2NVUI 3RZFA 4AP4C 2EMTA 3DQVA 4PS8A 2O6VD 2IO3B 4MEMA 3RULA 2JPHA 4BKSD 1ZGUB 1E8WA 5CHFA 2KO3A 1WE6A 5JZEB 3TMPB 3VTVA 3HHMA 3CF6E 4DDID 4JLCA 3UINB 2RD0A 2KHWB 2M1MA 2KWVB 2BKRB 5HKHA 1E8ZA 2C60A 3A1QB 5J17A 2D3GA 5L95C 2KX0A 4EZKA 3WAMA 3QX1A 3W1YA 1V6EA 1WM2A 2AEHA 3LDZE 2JWZA 3L16A 3IVFA 4E71A 3ML8A 2MQJA 4IM0A 3TL5A 4IWQA 3ZTCA 1WZ0A 4HXDA 4W9KA 2JRHA 2V1YA 1ISNA 3H6NA 1ZW7A 4WJPA 3A1QA 1RFAA 1WJNA 1WXAA 3VDZA 3NZSA 3H7SA 3WAOA 2J0JA 3DVNV 3QHTA 5BO4B 4GGQA 5JH5C 1P3QU 4W9GA 2ZNVB 1X1MA 2LRUA 2NR2A 4A3PA 4GDLB 3DCGA 4TQ1A 4G11A 2PPHA 5AZHA 2KQ7A 3BINA 4EZJA 4W9LA 2IY1B 5KHOA 4LCDE 3ZRFA 3ENEA 4MDKE 2KWUB 4GIVA 2BPSA 2KMAA 4E74A 4K7WA 3ZDMC 1GUAB 2KFKB 4GDKB 2L7RA 3KYCD 2FIFA 4F7ZA 2A4ZA 2L0FA 2JUOA 2K39A 3OLMD 4G0NB 4AJYB 1IYFA 3PHWB 2MX2A 4KVGB 1NDDA 3UIPB 5J2RA 1I42A 1WGGA 2N9PC 4CYEA 2FUHB 2IY0B 3I3TB 4MGZE 2G45B 3RCZA 2CHXA 1NI2A 2AL3A 3B0AA 2LGDA 2M8SA 3N3KB 1GC6A 2KNBA 2NBVB 3KVFB 4MM3A 1SGHA 4AOFA 3R66C 2HE7A 2W9NA 5AZFA 3UQBA 1J0GA 2C7MB 2CR5A 2K8BA 1E8XA 4OVUA 5D7GA 3WANA 3L13A 5L83A 2C5LC 2BF8B 3KH0A 4DK5A 3N30A 4LDTD 3ZVVA 1VCBA 1YJ1A 4E3CA 4TKNA 2CU1A 1JRUA 3T9LA 2EMSA 3PTFC 2FAZA 2N4FA 4WJOA 2LZ6A 5G55A 4JQWC 4NQLB 2PEAA 2O2VB 2NBWB 4B95A 2ZPNA 4ZRJA 2D10A 4BBNC 4HJKA 4MJSB 4RMAA 3X0WA 3TBLD 3EECA 2BWES 3JYUA 2KX3A 4ANWA 2K8HA 1GJZA 1LQBA 1XD3B 1WXMA 2GBNA 1V9JA 1WFYA 2DYOA 3ZUNA 2N7DA 4GXBA 1WJUA 3PLVA 2KQSA 3Q3FA 4ANXA 1UELA 3MTNB 1P1AA 3K9PB 1CMXB 3PZDA 3QA8A 1WYWB 1RAXA 3JSVB 4FN2A 4WQOB 1MG8A 2KJHB 3NZUA 2XK5A 2FNJB 1EF5A 3PHXB 1WXVA 2O2VA 2N1WA 4I6NB 1YQBA 5D6JB 4WWOA 2BYVE 2WYQA 3VAWA 3UIOB 2DZMA 3H7PB 2EKEC 4J6IA 4EUTA 1T0YA 2C7NB 3CMMB 4MSMB 3A4SC 4KSKC 3H1UA 4MH0E 2HTHA 4K7UA 1KM7A 3W1SA 3DBRI 3N32A 1RRBA 2PE6B 2ZVOA 3JSVA 1E8YA 2LWPA 3DVGX 2AWTA 4W9HA 3GOEA 3AXCA 3ECIA 3ZNZB 3CSFA 2KKCA 3H7PA 3ALBA 2IO2B 4NJ7A 2D07B 4WJNA 4ICVA 1YD8U 5AZGA 4TUUA 4K7SA 2REXA 3RT3B 2D2QA 2KTRA 2VRRB 2D11A 1WX7A 2N9XA 4DXAB 2MP2A 4KZCA 5C1ZA 1EF1A 3TJPA 4ASWC 1WGDA 1WH3A 4FLHA 2FCQA 2JXXA 5LLIA 2KDFB 3APFA 1OEYJ 4HLEA 3QQ8B 4W9FA 2KDEB 2CS4A 3M95A 4HWIB 2Z0DB 2KWCA 2XBBC 3M62B 2GMIC 3UGBB 1SIFA 3WALA 1GNUA 2LJ5A 1EO6A 4WWPA 1WX9A 4HK2A 3DDCB 3QAQA 2A5UA 1E7UA 4MGKE 1H8CA 4PYZA 1ZKHA 2R2QA 3TCAA 2LVQA 1V5OA 5E6OA 3VH3B 5KHQA 3MHSD 5TR5A 3RUIB 4EZLA 4A20A 4II3B 3QWZB 4KDIC 4FA6A 3DOWA 3M3JA 5FR6A 2K1FA 2RR9A 3V6EB 4AWJA 5D94A 4FBJB 2ZEQA 2ZNVC 3PLUA 5E6NA 5C23A 1L7YA
chains in the Genus database with same CATH superfamily
1K8RB 3ML9A 1YIWA 1NEKB 2MA9B 5DPWA 4DHZB 1PQSA 4EEWA 1TGZB 2C7HA 2W3RA 2FBWB 2NCNA 3VFKA 1VLBA 4RM9A 2KTFA 4XDCA 4EE2A 3PSEB 1EWCA 2BGFA 1V8CA 1JWMD 2DZIA 1JWAD 4MACA 1H4RA 2ZCCA 4GLSC 1C78A 1P7FA 2LXAA 2IGHA 2YVCA 3PREA 2WDTB 4XX5A 2IYDB 3ZW3A 2L3ZA 2DENB 3W1SC 4NQKE 2LVPA 2XN9C 2PW9A 3PZ8A 3PV1A 2AL6A 3I9V1 2KDIA 4HPLB 2V4LA 1ZP0B 1FCCC 2MH7A 1FRRA 1DYQA 5E6JA 3BZDB 3ETRA 4GU2A 1V86A 3JVZX 1SSNA 1MVKA 3B08A 5HG2A 4C56C 1T0RC 2WWZA 3PRPB 4WH4A 2YLMA 3TIXA 2WU5B 3SR6A 4YSZB 1EM7A 3P42A 4F1SA 3AE7B 1SJHD 3RNEC 2MEKA 2IJ0A 3BYYB 4M8MA 4IG7B 2ZJDA 2FIDA 3DBSA 1XLPA 3AU4A 5BMHA 4W9DA 1TJEA 4EOYA 3N1YC 3NVZA 5DPRA 1E0ZA 1Z5SB 3SU8X 1C4PA 4GSWA 4HCPB 5EDSA 2IZVB 1YJJA 3QK0A 3APCA 4OZBA 1WGYA 3VTUA 2D3BA 3S2AA 3KYDD 3PRZA 1SE3A 2KWDA 3SDLC 4M0WB 3IT6B 1JWSD 3AE6B 1YN4A 3ZO5B 2BW2A 2KXJA 3A4RA 2M0XA 1V81A 3QC8B 1B1ZA 3FC4A 4D2KA 2CHZA 4C00A 5JHBA 3AE5B 1ZDXA 3R2TA 1WR1A 2WXKA 1D4BA 1F2RC 3ZNID 5AUIA 1NBFC 1UBIA 3WAPA 2LMCA 3KW5B 1JMLA 1FMAD 1JWBD 5LXHA 1HTQA 4RM8A 2KJ6A 3L08A 5FK9C 4FJYA 1WXQA 3URYA 3PT2B 3OJ3A 3RYTA 4DHZE 3VXWA 2KK8A 1F0ZA 2JWUA 1PGAA 1Z2MA 4TSSA 1F2RI 4OW0A 2LXCA 3UI3A 1J19A 4M02A 1EU4A 3SHQA 5CX3A 5CTRC 2WGSA 3NY5A 4PS7A 2BYEA 4ZOHC 3P4RB 4HPMB 4C7YA 3GE3C 4YSXB 2QDFA 3LXFA 2L83A 3L10B 3RNGC 1QOFA 2EELA 2Z0EB 2LASA 1VRAB 1XEEA 4NPNA 3PGEA 2AQ1B 1YJIA 1C77A 4AJWA 4DDGD 3ZYYX 2G9HD 2DWQA 3PVLA 4XE0A 3P2BA 4MSQB 2BB5A 4ZYNA 1VDVA 3GP7A 1FEHA 4C7ZA 2L76A 1F9JA 4OHJA 3V62A 1WZ3A 2LGYA 4BOZB 2ZVNA 4ZHOA 1P0RA 2D5GA 5BMIA 3IFWB 4BKSA 2LJIA 1FXTB 5IOIA 2DLBA 3KQ4A 2FCMA 2ZZPB 4P6VF 3QARA 4IM3A 4AP4C 4IDIA 2ZW0A 3ZJTA 1BXTA 3MC8A 2W82A 2IO3B 3RULA 3DBLB 4BKSD 2BBCA 1WE6A 1J7AA 1STEA 3NS1A 3HHMA 2KHWB 1R4MB 1E8ZA 2C60A 2D3GA 2WXJA 5L95C 4EZKA 3WAMA 4HKZE 4E71A 4XWWA 1FNWA 3AECB 2V1YA 2Y3AA 3H6NA 1I4HA 4WJPA 2OEDA 3NZSA 1QOBA 2J0JA 3DVNV 3QHTA 5BO4B 4GGQA 1P3QU 1X1MA 1V1OA 2LRUA 4TQ1A 2V4IB 2KWUB 4ARCA 2N7JA 2E3TA 4K7WA 2W54A 2XNAC 1T0SC 2V9HA 4AJYB 1IYFA 3AE4B 4KVGB 1NDDA 3UIPB 2IPKD 1WGGA 1FD6A 2FUHB 2VZKB 3I3TB 4N6EB 2AL3A 1MPEA 2FE8A 2M8SA 4MM3A 3N20C 4AOFA 1UNSA 2L52A 2HE7A 2W9NA 5AZFA 3UQBA 2C7MB 1T0QC 4OVUA 2BYTA 2B76B 4DK5A 3J9CA 2J52A 1VCBA 1YJ1A 2PIAA 4DXFA 1JRUA 3T9LA 1ET9A 3OG5A 4WJOA 2LZ6A 4JQWC 3AEAB 5G5GA 4BBNC 2BWES 1WWTA 3JYUA 4MH8A 4P1BC 1GJZA 1XD3B 2LGIA 2DYOA 1WJUA 3PLVA 2NTTA 2SAKA 3MTNB 1P1AA 1RAXA 1ACCA 1MG8A 2XK5A 2WXQA 2O2VA 2BYVE 2EKEC 4J6IA 4KSKC 4MH0E 3W1SA 3NVYA 3AE9B 1SXTA 3JSVA 5BMGA 3DVGX 2IDYA 4CQNA 3AXCA 3ECIA 3BVMA 3KWVA 3ALBA 4NJ7A 4ICVA 4TUUA 3Q3OC 4WAFA 4YXDB 2KTRA 1A70A 2N9XA 2MP2A 2QC8A 3ZXVA 1UWMA 2KDFB 3APFA 1OEYJ 1PYWD 2Q5WD 1XCTL 2CS4A 3M95A 2RMMA 2I2YA 1ZUD2 1SIFA 2LJ5A 4LNKA 4YTPB 2A5UA 1ZKHA 2LVQA 4WIPA 1BUIC 4HKQA 4KDIC 1TKGA 1VZ8A 2X38A 2KMMA 3EUB2 4OZCA 1ESFA 5C23A 1GPXA 1L7YA 3GZNB 1LM8B 3TUOA 5G2NA 3U30A 5AEKB 1WR6E 4MM3B 1I7HA 4ZRKA 1ZE3D 1WJ4A 4YSYB 4MELA 4CO7A 2WXHA 4X57B 4P7IA 4FJZA 2HDEA 4ZDVA 3HRDD 3HM3A 4KSLC 2DAJA 3HUIA 3RNCC 3DWGC 4KIKA 2N9LA 4EKUA 4OVVA 1WGHA 3DBHI 2M0AA 2XK5B 1E9MA 2KACA 2BTEA 3ONSA 2G1EA 2N0SB 2C9WB 2K0PA 1M4VA 1PFDA 2RDHA 3R7QA 3VRBB 2WS3B 1WGRA 1Q10A 3AU5A 3X23A 3Q8AA 2ZPYA 1NYRA 1ENFA 2LD9A 3UQAA 4PK1A 4KDLB 4O1NA 4FHJA 4TMAB 1QZEA 4DQOC 2KTRB 2CKHB 1QT9A 5EE3A 2LHEA 4LJPB 2MP2B 4XZ4A 3ZRCA 1RM6C 2KLGA 3I63C 4WJQA 3UF8A 3VH4B 3AULA 3AEBB 5AUKA 3MHZA 3C0RB 3CSTA 3U8ZA 3EFCA 1C9FA 3K9OB 4HROA 4MGYE 1TS4A 1V49A 3I57A 3V60A 2UYZB 4TQ0A 4BKTA 4DWFA 1N6ZA 2RPQA 3V05A 1KH0A 2KQ4X 1AARA 1K52A 3EFUA 2IO0B 5HFYA 4B9KA 2J0MA 1N63A 3DWMA 1UGMA 1UH6A 1V5TA 2PE9A 4HDOA 4J3OD 1E10A 2BKFA 4II2B 1A5RA 1MHXA 2MCNB 4IW0A 4NNJB 5HHDG 4FULA 2WX1A 2PLPA 4HCNB 4M0WA 3SFDB 3IXSA 3GZNI 2G3QB 4LNNA 1LFDA 4CHKA 1SIJA 2V3SA 1R4NI 4KIKB 2QMTA 2TSSA 2IGDA 3Q14C 1OEYA 2MLBA 4K1RB 4GB9A 4ZRIA 2WDRB 5IA7A 2Z8LA 1QQRA 2JF5A 1V2YA 4B6WA 2XEWA 3DHGC 5T8IA 5DCNA 2KANA 2J42A 3IAM1 4HDQA 4ZRQA 1AW7A 1KJTA 1Q5WB 1FM0D 1KFYB 4GDKA 2KC1A 2MBBB 3A33B 5G5HA 1KLGD 1TZ1A 3N9YC 2ACZB 4C4VB 1TS5A 5EE0A 2ZCBA 3P1MA 2OHFA 2PVOD 3Q2AC 3ZDTA 4WAAA 2JSVX 1Q0WB 2QILA 1K53A 2I38A 1IBXB 2DNFA 1ZOYB 3DVNU 1EUVB 2K8CA 4B0MA 2O6VB 2WNMA 4ITKA 4BFRA 2KLCA 2MBOA 1FNUA 1XQQA 1VR9A 3PPAA 1FPYA 3QIJA 4GN1A 4LNIA 4WWNA 3IHPC 4HVBA 5E6PA 2EKIA 3VQIA 4L2YA 4FJVB 2SEBD 2G4DB 3H9DA 1GOZA 2FCSA 2NVUI 3W9CB 4RGOS 1D5ZC 3CIRB 3P63A 1FXIA 1FFVA 1SE4A 3AM9A 1E8WA 5JZEB 3TMPB 2RD0A 2M1MA 4KKJA 5HKHA 5J17A 3LDZE 2JWZA 2GB1A 3ML8A 4IM0A 4IWQA 4W9KA 1ISNA 2OJWA 4B0EA 1RFAA 1WJNA 3WAOA 5FR3A 2NR2A 2D3AA 5AZHA 2QSDA 2V0GA 3ZRFA 1D5XC 3U52E 2KMAA 4N59A 3ZDMC 4GDKB 2FIFA 2JUOA 1KF6B 3OLMD 4G0NB 1KTKA 1RFKA 1I42A 4S17A 4MGZE 2IY0B 1JWUD 1PUTA 2HTME 3RCZA 2WXGA 2LGDA 3N3KB 2KNBA 2NBVB 4LK0M 3AH7A 1ZPSA 3L13A 2C5LC 1OQQA 2BF8B 3N30A 1FXAA 1YQ3B 4KGSA 1YQ4B 5I4DA 2EMSA 3PTFC 2N4FA 3NVVA 3ZGZA 4NQLB 4M01A 4RCOA 3VR8B 2WDQB 2ZPNA 3KWLA 4HJKA 4RMAA 3EECA 4ANWA 1GB4A 1WXMA 2VZKD 2IGGA 2MJ3A 4GXBA 2WXFA 1YN3A 4ANXA 1UELA 1AN8A 2WHIA 3NZUA 3PHXB 1MFWA 1HTOA 1WXVA 1YQBA 3PO0A 3VAWA 2WYQA 3UIOB 3CMMB 4KGRA 4MSMB 3A4SC 1KM7A 1RRBA 2PE6B 2ZVOA 1E8YA 2AWTA 1HEZE 4W9HA 3GOEA 3CSFA 3MJ5A 4RH6A 2UU7A 1YD8U 2QIEB 5BYQA 3RT3B 2V3NA 2VRRB 2D11A 3NJTA 3DHIC 5C1ZA 1EF1A 1QOGA 1NI3A 2MJDA 3C8YA 2KDEB 2Z0DB 4L23A 4RNAA 2KWCA 2XBBC 3HVDA 1EO6A 3BWUD 3DDCB 1XO3A 3QAQA 1H8CA 5KHQA 5E6OA 1AWDA 3Q8EA 2M19A 3MHSD 3RNAC 1I4GA 4WWMA 4A20A 4II3B 2WDVB 1C79A 4JWUC 5IP4D 2YEPF 4AWJA 5D94A 3FAHA 2INPE 2ASQA 2FCNA 4R3DA 4ARIA 4S0RA 2KAJA 2QCZA 1DGJA 2AX5A 1L2NA 1ZXIA 1DOXA 1S1QB 3R3MA 2BS2B 3AEFB 2BYFA 1IGDA 2W3SA 2MWSB 3NVWA 3IBEA 1SE9A 2VH2A 5IO9A 3ABVB 4W9CA 2NMQA 4H2AA 1WMHB 1RLFA 3BIID 3A9JB 4REZA 4UDUC 1G6JA 2L32A 3E9SA 1NVID 2GI9A 4M00A 4XC2A 1ROEA 5H8YE 1PGBA 4DHJB 5EE1A 3AB5A 4FXCA 3ZTDA 3VUXA 4ANVA 2JRIB 3GB1A 2GBRA 4I6PA 3H8HA 4YTNB 3DBRB 1WRDB 3RNBC 4ZYSA 2KD0A 3SD5A 4EFOA 1F77A 4LJOB 1YN5A 1GAQB 1BMLC 2B3AA 1KLVA 1E7PB 2JYEA 1MI0A 3AE1B 4FHKA 1QF6A 1QILA 3KUCB 1TBEA 1SEBD 3BY4B 2ICIA 2J7QB 4N58A 1N61A 2DYMA 1RYJA 2K22A 5LNK1 4KGTA 2PTLA 1NENB 2WP9B 4A8XC 2MRPA 1YNTE 4A55A 2LUMA 2NPTA 3ZQ4A 4ANUA 1UZXB 3U2SC 4TV3A 1WF9A 2UWQA 3RMKC 3HK0A 2MBQA 3DBLI 1FCLA 2KC2A 2BS4B 1OQYA 3Q3NC 3O13A 3ZIMA 3WIMA 1K50A 3RZWC 2JVCA 1YOVB 2LRWA 1R4MI 1I4PA 3R2IA 2LFIA 2JZ3B 2L1AA 3IG3A 2OOBB 2PKOA 4URKA 3AE8B 1D6EC 2KMCA 2BWFA 1J8CA 2K9XA 1JCKB 2JT4B 5D2MB 5IAAC 2N9EB 1CQVA 1VZ7A 1WE7A 3P4SB 3VR9B 1WX8A 1WY8A 2K25A 1WM3A 1SBBB 5JHAA 1S3SG 5TSSA 2L8JA 2DZKA 2RSUA 4JIOU 5DPSA 1HZ5A 1OTRB 3T3OA 1TTNA 2W55A 4NY0A 2OJRA 1UF0A 1XLOA 1L0YB 3SFEB 1LXDA 2WX0A 1JALA 3VUYA 4AS1A 3OAWA 2NBUA 3LJ3A 4GDLA 2I1KA 3APDA 2LGXA 3QCAA 1L0XB 1C76A 3L17A 3P4PB 2JXTA 2KFKA 3ZJUA 3AE3B 3ZKJC 1N60A 2K6QA 1C4AA 3VVWB 1E7VA 1IPGA 1WXSA 3RD2A 3VTWA 3U4EG 1QOAA 2RDBC 2IBIB 1MHHE 2CU3A 5MPOA 4RF1A 5EE9A 1C4CA 4C4VA 1D3ZA 5IKCM 2KOXA 1HQRD 1TS2A 2G4SA 3GE8C 2MJEA 4I6LB 3HM6X 4PT5A 4BZAA 2D3CA 2DYBA 1GB1A 2HJ8A 2LUEA 3OJ4B 2J0KA 4IUMB 3ZJVA 1V97A 2LEKA 1BT0A 1HXYD 4MJSA 4A9AA 2NPTB 1KRHA 1FRDA 2J4XA 1SB3C 2J53A 4W9JA 3L0WB 3PS6A 2JU6X 1IBXA 1P9DU 3N1ZC 4USAA 1PGXA 2AYOB 2L00B 1L5PA 2IO1B 2BS3B 2HJ1A 2O6VA 3EC8A 4PS3A 2LHDA 3AMZA 3B1LX 4ICUA 1E5WA 1C3TA 4RGMA 4LLGM 2EMTA 3DQVA 4PS8A 1TS3A 2O6VD 4MEMA 2JPHA 1ZGUB 2KO3A 3VTVA 3CF6E 4DDID 3UINB 2BKRB 1XCQL 3A1QB 3N1XC 2KX0A 3QX1A 3R8BA 2ZW1A 1WM2A 1JROA 2AEHA 3L16A 3IVFA 2JZPA 2MQJA 3TL5A 3FILB 3ZTCA 1WZ0A 2PMVA 1ZW7A 4US8A 1R7SA 3EA6A 2BVCA 5JH5C 2KDMA 2ZNVB 3CWIA 4A3PA 4GDLB 2PPHA 4KKIA 4US9A 4EZJA 3KLSX 4W9LA 4LCDE 4MDKE 4RFBA 2BPSA 2KFKB 2L7RA 3KYCD 2A4ZA 1CJEA 1OFFA 1Y56A 3GS2A 2KYWA 5J2RA 2BQQA 4NZLB 2G45B 2CHXA 3B0AA 1XF5L 3NZ3A 1IUEA 3R66C 4YT0B 2CJOA 1J0GA 2CR5A 2K8BA 1T5XD 3RPFC 4LDTD 3ZVVA 2M56B 4TKNA 3C19A 5G55A 2PEAA 5GXGB 4B95A 4MJSB 3TBLD 2KX3A 1V9JA 1WFYA 2KQSA 3Q3FA 5C3JB 4XDDA 3QA8A 3K9PB 1CMXB 3IAS1 4FN2A 2E6XA 2KJHB 1EF5A 4I6NB 3AEGB 1SJED 3H7PB 2WXRA 1T0YA 3BVZA 2INCC 3AE2B 3H1UA 2PVGC 1KLUD 2HTHA 4K7UA 3N32A 3Q8BA 3P4QB 2K5PA 2KKCA 1WYGA 1F1HA 2Y5PA 1B9RA 2RDGA 4WJNA 5AZGA 4K7SA 2REXA 3AV8A 4HPPA 3TJPA 4ASWC 1WGDA 1WH3A 4AQ7A 1SE2A 4P1CC 5LLIA 2WXOA 1JRPA 4HLEA 3QQ8B 3M62B 2GMIC 1GNUA 1QLBB 1EWYC 1WX9A 4HK2A 1UGJA 1MJDA 4MGKE 3EGRA 4PYZA 2R2QA 1TT5B 4NAMA 3VH3B 5TR5A 3NG0A 1XLQA 2JQRB 2R61A 3TEYA 4FA6A 3DOWA 2K1FA 2RR9A 3V6EB 2DBYA 2ZEQA 2ZNVC 4BAXA 3PRMB 3PLUA 2KN4A 4YL8A 2WXMA 1GG3A 4AUQC 2MBEA 4KZ0A 4LDTB 1J7CA 4IM2A 2YEPB 1U4AA 4FADA 3L54A 4A90A 4K3CA 4IC7B 1XXGA 3VUWA 3MJWA 3O65B 1NYQA 3VRAB 3E56A 5D3DA 4LNFA 2WU2B 2LI5A 2ON8A 2NS5A 4P16A 5BYRA 3ZLZA 2H89B 4BOSC 2GBKA 1DOYA 2HD5B 1C1YB 3W5UB 2LVOA 3DHHC 3A9KA 1L6UA 1TY0A 4JL9A 1E90A 5D3IB 3TEZA 1I4XA 2CHWA 2GBJA 4K81A 2DZJA 4NAWA 1WMHA 4G50A 3IT4B 4JGHB 1IGCA 1I35A 3AN1A 3A9JA 2X8XX 1QKZA 2GRIA 1UBQA 2DHZA 4A3OA 1CK1A 1WJ6A 2L05A 1IP9A 2M17A 4XWTA 3TEXA 2WQYB 2Z59B 4KV2A 5BYSA 4Q2JA 3MC9A 3NS8A 5DPTA 3TSSA 2N9KA 3MFGA 2JYTA 1LGRA 3DVGY 1P7EA 1T3QA 4W9EA 3SEBA 1D5MC 2KJRA 4DHJD 2Y5CA 4JE3B 2KFJA 3LYYA 3L4PA 3KUDB 3V6CB 3NOBA 1FO4A 4F8CB 4QAYA 1V80A 5IN7A 3TEWA 3JW0X 1YX6B 1V1PA 2AQ2B 1VD2A 2MSED 2FUG1 3RN9C 1F52A 2MBHA 2K6DB 4XYCA 1ZXHA 3HIZA 3NHEB 4YWGG 2CJNA 3EHVA 4JWSC 3U7DA 2QHOA 3D32A 1HE8A 1FFUA 2GBMA 5LXIB 1WIAA 1OQRA 4PYUA 3VHTC 2GOWA 2H88B 2JY6A 1I4QA 4HRSA 1JW9D 1VZ6A 4XGAB 3ZNHB 2N1VA 2VH1A 1TYGB 3W2DA 1KOTA 4RGTA 1HA5A 3RI7C 3B2GA 4WURA 4HEA1 4W9IA 2DAFA 3AEEB 3W5VB 2M4NA 2BT6A 3NUHB 3AI5A 2INNE 3A9KB 4C80A 3M63B 3R7RA 1WI0A 5CHWA 1L0VB 3Q3JA 5GMVA 2WLBA 2KN5A 2KVZA 1N62A 2KDBA 4NAWB 4IWPA 1N5WA 3MC0B 1TIFA 1I4RA 1K51A 1TZOA 1RWSA 4K3BA 3T8MA 3KUZA 1M94A 3Q8FA 1LO5D 1Q1OA 1HZ6A 3Q6BA 4NJ6A 3DBHB 1Y8RC 1P98A 4G3XB 5C2TB 2WXIA 3BYTB 2L0TA 2N7EA 4WQMA 3WA0A 4DBGA 4GMVA 1OGWA 4N9F4 4BKGA 4BBNF 2Y5BB 4JX1C 2R2OA 2INDC 5CHVC 4RF0A 2WXNA 4M8NA 1CZPA 1L6VA 1ZDVA 4ACFA 2PJHA 3ZNGC 4RGNA 5J18A 1YX5B 1GC7A 1XT9B 1L4ZB 3LB8C 1UD7A 2KVRA 4BVUC 1V1PB 4ZHPA 2I1JA 4A6QA 4ZRPA 2DX5B 3B9JA 2JZZA 2KZRA 3QJZA 2RGFA 4IWOA 3DPDA 3V61A 4GOCA 2MW5A 3BK1A 4MGIE 1UWXA 3BVGA 3RZFA 1DOIA 5CHFA 4JLCA 3ZXRA 5H92C 3Q8CA 2KWVB 1TKYA 4KX6B 3FKYA 3W1YA 1V6EA 5FKAC 3PZ7A 3RNFC 5JXVA 4HXDA 1TY2A 2JRHA 2QEJC 1TKEA 1WRIA 3A1QA 1WXAA 3Q69A 3VDZA 3H7SA 4NJCA 3BK2A 4W9GA 1R4NB 3FILA 3DCGA 1UUPA 4G11A 2KT7A 3OWEB 2KQ7A 3BINA 5KHOA 2IY1B 1MG4A 3ENEA 4GIVA 1WSPA 4OZAA 4E74A 1GUAB 4F7ZA 2L0FA 1E6EB 2K39A 3PHWB 2MX2A 3HVZA 2N9PC 4CYEA 1NI2A 4YTMB 1EU3A 1GC6A 3KVFB 1SGHA 1PDXA 4HJGE 2ONQA 1E8XA 5D7GA 3WANA 5L83A 3KH0A 4E3CA 2WXPA 2CU1A 1SF0A 2FAZA 4OVZA 1JQ4A 1FNVA 2O2VB 2JX5A 2NBWB 3WCQA 4ZRJA 2D10A 3RFZB 3X0WA 1ET6A 2K8HA 1LQBA 2GBNA 4MT5A 3ZUNA 2N7DA 3PZDA 1WYWB 4WQOB 3JSVB 2FNJB 3MP9A 2N1WA 5D6JB 4WWOA 4JPSA 4EUTA 2DZMA 1J7BA 3NRZA 2C7NB 5HI1A 3B2FA 2QJLA 2LGSA 3DBRI 3V3XA 2LWPA 2AQ3B 4LTUA 4DXGA 3ZNZB 3H7PA 3T3NA 1N5XA 1L4DB 4L1BA 2IO2B 2D07B 2MHJA 4IKGA 2D2QA 1WGKA 1WX7A 4DXAB 4KZCA 1AYFA 3U7ZA 4FLHA 1VJKA 2WXLA 2FCQA 2JXXA 4W9FA 4HWIB 4LNOA 2RPVA 3UGBB 3WALA 2NTSA 4WWPA 2GLSA 2K3UA 4IOIE 1E7UA 3TCAA 1V5OA 3Q3MC 3RUIB 1FIQA 4EZLA 3AEDB 3QWZB 3M3JA 2BB6A 5FR6A 2V3PA 1XLNA 1YMHE 4FBJB 3I5JC 1T6BX 5E6NA
chains in the Genus database with same CATH topology
2ASQA 2FCNA 4YL8A 1K8RB 1LM8B 1GG3A 4AUQC 3ML9A 2MBEA 5G2NA 1YIWA 4KZ0A 3U30A 2MA9B 4LDTB 5DPWA 4DHZB 5AEKB 1L2NA 4IM2A 1WR6E 1S1QB 3R3MA 1U4AA 4FADA 1PQSA 3L54A 4ZRKA 4EEWA 1WJ4A 1TGZB 2C7HA 4IC7B 4MELA 3VUWA 2NCNA 3VFKA 2BYFA 3MJWA 3O65B 4CO7A 4X57B 4P7IA 4FJZA 2MWSB 4RM9A 2KTFA 3IBEA 3PSEB 2LI5A 1SE9A 2BGFA 2NS5A 4ZDVA 4W9CA 3ZLZA 2DZIA 1H4RA 4BOSC 2ZCCA 2GBKA 3HM3A 2HD5B 2DAJA 4KSLC 1C1YB 1WMHB 2LXAA 2LVOA 1RLFA 2YVCA 3PREA 3A9KA 2WDTB 4KIKA 4EKUA 3A9JB 4JL9A 4OVVA 1G6JA 1E90A 1WGHA 3DBHI 2IYDB 4XX5A 2XK5B 3ZW3A 2L3ZA 2DENB 2CHWA 2GBJA 4K81A 3ONSA 4XC2A 3W1SC 4NQKE 2C9WB 2DZJA 4NAWA 4DHJB 3R7QA 1WMHA 4G50A 2LVPA 4JGHB 1I35A 1WGRA 3PV1A 2AL6A 3A9JA 3AU5A 2KDIA 4HPLB 2V4LA 2ZPYA 3X23A 3VUXA 3ZTDA 4ANVA 2JRIB 1UBQA 2LD9A 3UQAA 2DHZA 4A3OA 1WJ6A 2L05A 1IP9A 2M17A 4GU2A 1V86A 2GBRA 4KDLB 2Z59B 4KV2A 3JVZX 4FHJA 4I6PA 3NS8A 5DPTA 1QZEA 3WIMA 2KTRB 2CKHB 3B08A 4LJPB 2MP2B 3DVGY 1WRDB 4W9EA 2KD0A 4XZ4A 3ZRCA 2KJRA 2KLGA 3SD5A 4LJOB 4EFOA 4DHJD 2WWZA 3PRPB 2B3AA 2YLMA 3TIXA 1KLVA 4WJQA 3UF8A 3VH4B 2KFJA 4FHKA 4F1SA 3AULA 3KUCB 1TBEA 3BY4B 2J7QB 2DYMA 3KUDB 3C0RB 3CSTA 3U8ZA 3V6CB 3NOBA 4F8CB 3K9OB 4MGYE 1V49A 4M8MA 3V60A 4IG7B 2MRPA 2ZJDA 2FIDA 2UYZB 4TQ0A 1V80A 4BKTA 2NPTA 3DBSA 3AU4A 4DWFA 4W9DA 3JW0X 2RPQA 4EOYA 4ANUA 1UZXB 1AARA 1YX6B 5DPRA 1VD2A 1Z5SB 3SU8X 2MSED 3EFUA 4GSWA 4HCPB 2MBHA 2IO0B 5EDSA 2K6DB 2IZVB 1WF9A 2UWQA 4TV3A 3HK0A 2MBQA 3HIZA 2J0MA 3NHEB 3QK0A 3DBLI 4B9KA 3APCA 1UGMA 1WGYA 3EHVA 2KC2A 1OQYA 1UH6A 1V5TA 3VTUA 3ZIMA 3U7DA 2PE9A 2QHOA 3D32A 1HE8A 2GBMA 4HDOA 3KYDD 3PRZA 3RZWC 3S2AA 1WIAA 5LXIB 2JVCA 4PYUA 3SDLC 2LRWA 3VHTC 2BKFA 2GOWA 1R4MI 2JY6A 4M0WB 4II2B 1A5RA 2MCNB 3ZNHB 2JZ3B 3IG3A 2OOBB 3ZO5B 2N1VA 4URKA 4IW0A 1KOTA 4NNJB 2KMCA 2BWFA 1J8CA 2KXJA 3A4RA 2JT4B 2M0XA 5D2MB 5IAAC 1V81A 4W9IA 3QC8B 2N9EB 4FULA 1WE7A 2DAFA 2WX1A 1WX8A 1WY8A 2CHZA 2K25A 4HCNB 2M4NA 5JHBA 1WM3A 1WR1A 3AI5A 3GZNI 2G3QB 5JHAA 1S3SG 1LFDA 4CHKA 2L8JA 2DZKA 2RSUA 3A9KB 3ZNID 2V3SA 1R4NI 1NBFC 4JIOU 4KIKB 5DPSA 1OTRB 1UBIA 3M63B 3R7RA 3WAPA 3KW5B 1WI0A 5LXHA 1OEYA 4RM8A 5CHWA 2MLBA 4K1RB 3Q3JA 4GB9A 5GMVA 1TTNA 4NY0A 4ZRIA 2KJ6A 2KN5A 2OJRA 2KDBA 3L08A 4FJYA 4NAWB 4IWPA 5IA7A 2JF5A 3OJ3A 3PT2B 1LXDA 2WX0A 3T8MA 3KUZA 3RYTA 3VUYA 1V2YA 1M94A 4B6WA 4DHZE 3OAWA 1Q1OA 2XEWA 2NBUA 3LJ3A 2KK8A 4GDLA 3VXWA 2I1KA 3APDA 1Z2MA 2LGXA 3QCAA 5DCNA 4NJ6A 2LXCA 2KANA 1J19A 3L17A 4HDQA 1Y8RC 1P98A 4G3XB 1KJTA 1Q5WB 3SHQA 5CX3A 2KFKA 3PRMB 2KC1A 4GDKA 2MBBB 3A33B 5CTRC 3ZKJC 1TZ1A 2L0TA 2N7EA 3NY5A 4PS7A 2BYEA 2K6QA 3WA0A 4DBGA 4GMVA 3VVWB 1OGWA 4N9F4 1E7VA 1IPGA 4HPMB 1WXSA 3RD2A 4BBNF 4BKGA 3VTWA 2Y5BB 2R2OA 2ZCBA 2IBIB 3L10B 5CHVC 2Z0EB 2LASA 4M8NA 3ZDTA 4NPNA 3PGEA 4WAAA 1Q0WB 1D3ZA 2PJHA 2KOXA 2G4SA 4I6LB 3HM6X 4AJWA 3ZNGC 2DYBA 4DDGD 5J18A 2HJ8A 3PVLA 1YX5B 1GC7A 2LUEA 3DVNU 1EUVB 2J0KA 2K8CA 1XT9B 3OJ4B 3P2BA 4IUMB 4MSQB 2O6VB 1BT0A 4MJSA 1UD7A 2KVRA 2KLCA 4BFRA 2NPTB 2MBOA 4BVUC 4ZYNA 1XQQA 2I1JA 2L76A 4W9JA 1F9JA 3L0WB 3PPAA 3PS6A 2DX5B 3QIJA 4GN1A 4WWNA 3IHPC 3V62A 5E6PA 1P9DU 4HVBA 1WZ3A 2LGYA 2JZZA 4BOZB 2KZRA 2ZVNA 2AYOB 2L00B 2IO1B 1P0RA 3VQIA 3EC8A 2O6VA 4PS3A 3IFWB 4BKSA 3QJZA 2RGFA 1FXTB 4FJVB 3B1LX 4IWOA 2G4DB 3DPDA 3H9DA 4GOCA 4ICUA 2FCMA 2ZZPB 3V61A 1E5WA 1C3TA 3QARA 2MW5A 4IM3A 4MGIE 2FCSA 2NVUI 3RZFA 4AP4C 2EMTA 3DQVA 4PS8A 2O6VD 2IO3B 4MEMA 3RULA 2JPHA 4BKSD 1ZGUB 1E8WA 5CHFA 2KO3A 1WE6A 5JZEB 3TMPB 3VTVA 3HHMA 3CF6E 4DDID 4JLCA 3UINB 2RD0A 2KHWB 2M1MA 2KWVB 2BKRB 5HKHA 1E8ZA 2C60A 3A1QB 5J17A 2D3GA 5L95C 2KX0A 4EZKA 3WAMA 3QX1A 3W1YA 1V6EA 1WM2A 2AEHA 3LDZE 2JWZA 3L16A 3IVFA 4E71A 3ML8A 2MQJA 4IM0A 3TL5A 4IWQA 3ZTCA 1WZ0A 4HXDA 4W9KA 2JRHA 2V1YA 1ISNA 3H6NA 1ZW7A 4WJPA 3A1QA 1RFAA 1WJNA 1WXAA 3VDZA 3NZSA 3H7SA 3WAOA 2J0JA 3DVNV 3QHTA 5BO4B 4GGQA 5JH5C 1P3QU 4W9GA 2ZNVB 1X1MA 2LRUA 2NR2A 4A3PA 4GDLB 3DCGA 4TQ1A 4G11A 2PPHA 5AZHA 2KQ7A 3BINA 4EZJA 4W9LA 2IY1B 5KHOA 4LCDE 3ZRFA 3ENEA 4MDKE 2KWUB 4GIVA 2BPSA 2KMAA 4E74A 4K7WA 3ZDMC 1GUAB 2KFKB 4GDKB 2L7RA 3KYCD 2FIFA 4F7ZA 2A4ZA 2L0FA 2JUOA 2K39A 3OLMD 4G0NB 4AJYB 1IYFA 3PHWB 2MX2A 4KVGB 1NDDA 3UIPB 5J2RA 1I42A 1WGGA 2N9PC 4CYEA 2FUHB 2IY0B 3I3TB 4MGZE 2G45B 3RCZA 2CHXA 1NI2A 2AL3A 3B0AA 2LGDA 2M8SA 3N3KB 1GC6A 2KNBA 2NBVB 3KVFB 4MM3A 1SGHA 4AOFA 3R66C 2HE7A 2W9NA 5AZFA 3UQBA 1J0GA 2C7MB 2CR5A 2K8BA 1E8XA 4OVUA 5D7GA 3WANA 3L13A 5L83A 2C5LC 2BF8B 3KH0A 4DK5A 3N30A 4LDTD 3ZVVA 1VCBA 1YJ1A 4E3CA 4TKNA 2CU1A 1JRUA 3T9LA 2EMSA 3PTFC 2FAZA 2N4FA 4WJOA 2LZ6A 5G55A 4JQWC 4NQLB 2PEAA 2O2VB 2NBWB 4B95A 2ZPNA 4ZRJA 2D10A 4BBNC 4HJKA 4MJSB 4RMAA 3X0WA 3TBLD 3EECA 2BWES 3JYUA 2KX3A 4ANWA 2K8HA 1GJZA 1LQBA 1XD3B 1WXMA 2GBNA 1V9JA 1WFYA 2DYOA 3ZUNA 2N7DA 4GXBA 1WJUA 3PLVA 2KQSA 3Q3FA 4ANXA 1UELA 3MTNB 1P1AA 3K9PB 1CMXB 3PZDA 3QA8A 1WYWB 1RAXA 3JSVB 4FN2A 4WQOB 1MG8A 2KJHB 3NZUA 2XK5A 2FNJB 1EF5A 3PHXB 1WXVA 2O2VA 2N1WA 4I6NB 1YQBA 5D6JB 4WWOA 2BYVE 2WYQA 3VAWA 3UIOB 2DZMA 3H7PB 2EKEC 4J6IA 4EUTA 1T0YA 2C7NB 3CMMB 4MSMB 3A4SC 4KSKC 3H1UA 4MH0E 2HTHA 4K7UA 1KM7A 3W1SA 3DBRI 3N32A 1RRBA 2PE6B 2ZVOA 3JSVA 1E8YA 2LWPA 3DVGX 2AWTA 4W9HA 3GOEA 3AXCA 3ECIA 3ZNZB 3CSFA 2KKCA 3H7PA 3ALBA 2IO2B 4NJ7A 2D07B 4WJNA 4ICVA 1YD8U 5AZGA 4TUUA 4K7SA 2REXA 3RT3B 2D2QA 2KTRA 2VRRB 2D11A 1WX7A 2N9XA 4DXAB 2MP2A 4KZCA 5C1ZA 1EF1A 3TJPA 4ASWC 1WGDA 1WH3A 4FLHA 2FCQA 2JXXA 5LLIA 2KDFB 3APFA 1OEYJ 4HLEA 3QQ8B 4W9FA 2KDEB 2CS4A 3M95A 4HWIB 2Z0DB 2KWCA 2XBBC 3M62B 2GMIC 3UGBB 1SIFA 3WALA 1GNUA 2LJ5A 1EO6A 4WWPA 1WX9A 4HK2A 3DDCB 3QAQA 2A5UA 1E7UA 4MGKE 1H8CA 4PYZA 1ZKHA 2R2QA 3TCAA 2LVQA 1V5OA 5E6OA 3VH3B 5KHQA 3MHSD 5TR5A 3RUIB 4EZLA 4A20A 4II3B 3QWZB 4KDIC 4FA6A 3DOWA 3M3JA 5FR6A 2K1FA 2RR9A 3V6EB 4AWJA 5D94A 4FBJB 2ZEQA 2ZNVC 3PLUA 5E6NA 5C23A 1L7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ASQ A;  2FCN A;  4YL8 A;  1K8R B;  1LM8 B;  1GG3 A;  4AUQ C;  3ML9 A;  2MBE A;  5G2N A;  1YIW A;  4KZ0 A;  3U30 A;  2MA9 B;  4LDT B;  5DPW A;  4DHZ B;  5AEK B;  1L2N A;  4IM2 A;  1WR6 E;  1S1Q B;  3R3M A;  1U4A A;  4FAD A;  1PQS A;  3L54 A;  4ZRK A;  4EEW A;  1WJ4 A;  1TGZ B;  2C7H A;  4IC7 B;  4MEL A;  3VUW A;  2NCN A;  3VFK A;  2BYF A;  3MJW A;  3O65 B;  4CO7 A;  4X57 B;  4P7I A;  4FJZ A;  2MWS B;  4RM9 A;  2KTF A;  3IBE A;  3PSE B;  2LI5 A;  1SE9 A;  2BGF A;  2NS5 A;  4ZDV A;  4W9C A;  3ZLZ A;  2DZI A;  1H4R A;  4BOS C;  2ZCC A;  2GBK A;  3HM3 A;  2HD5 B;  2DAJ A;  4KSL C;  1C1Y B;  1WMH B;  2LXA A;  2LVO A;  1RLF A;  2YVC A;  3PRE A;  3A9K A;  2WDT B;  4KIK A;  4EKU A;  3A9J B;  4JL9 A;  4OVV A;  1G6J A;  1E90 A;  1WGH A;  3DBH I;  2IYD B;  4XX5 A;  2XK5 B;  3ZW3 A;  2L3Z A;  2DEN B;  2CHW A;  2GBJ A;  4K81 A;  3ONS A;  4XC2 A;  3W1S C;  4NQK E;  2C9W B;  2DZJ A;  4NAW A;  4DHJ B;  3R7Q A;  1WMH A;  4G50 A;  2LVP A;  4JGH B;  1I35 A;  1WGR A;  3PV1 A;  2AL6 A;  3A9J A;  3AU5 A;  2KDI A;  4HPL B;  2V4L A;  2ZPY A;  3X23 A;  3VUX A;  3ZTD A;  4ANV A;  2JRI B;  1UBQ A;  2LD9 A;  3UQA A;  2DHZ A;  4A3O A;  1WJ6 A;  2L05 A;  1IP9 A;  2M17 A;  4GU2 A;  1V86 A;  2GBR A;  4KDL B;  2Z59 B;  4KV2 A;  3JVZ X;  4FHJ A;  4I6P A;  3NS8 A;  5DPT A;  1QZE A;  3WIM A;  2KTR B;  2CKH B;  3B08 A;  4LJP B;  2MP2 B;  3DVG Y;  1WRD B;  4W9E A;  2KD0 A;  4XZ4 A;  3ZRC A;  2KJR A;  2KLG A;  3SD5 A;  4LJO B;  4EFO A;  4DHJ D;  2WWZ A;  3PRP B;  2B3A A;  2YLM A;  3TIX A;  1KLV A;  4WJQ A;  3UF8 A;  3VH4 B;  2KFJ A;  4FHK A;  4F1S A;  3AUL A;  3KUC B;  1TBE A;  3BY4 B;  2J7Q B;  2DYM A;  3KUD B;  3C0R B;  3CST A;  3U8Z A;  3V6C B;  3NOB A;  4F8C B;  3K9O B;  4MGY E;  1V49 A;  4M8M A;  3V60 A;  4IG7 B;  2MRP A;  2ZJD A;  2FID A;  2UYZ B;  4TQ0 A;  1V80 A;  4BKT A;  2NPT A;  3DBS A;  3AU4 A;  4DWF A;  4W9D A;  3JW0 X;  2RPQ A;  4EOY A;  4ANU A;  1UZX B;  1AAR A;  1YX6 B;  5DPR A;  1VD2 A;  1Z5S B;  3SU8 X;  2MSE D;  3EFU A;  4GSW A;  4HCP B;  2MBH A;  2IO0 B;  5EDS A;  2K6D B;  2IZV B;  1WF9 A;  2UWQ A;  4TV3 A;  3HK0 A;  2MBQ A;  3HIZ A;  2J0M A;  3NHE B;  3QK0 A;  3DBL I;  4B9K A;  3APC A;  1UGM A;  1WGY A;  3EHV A;  2KC2 A;  1OQY A;  1UH6 A;  1V5T A;  3VTU A;  3ZIM A;  3U7D A;  2PE9 A;  2QHO A;  3D32 A;  1HE8 A;  2GBM A;  4HDO A;  3KYD D;  3PRZ A;  3RZW C;  3S2A A;  1WIA A;  5LXI B;  2JVC A;  4PYU A;  3SDL C;  2LRW A;  3VHT C;  2BKF A;  2GOW A;  1R4M I;  2JY6 A;  4M0W B;  4II2 B;  1A5R A;  2MCN B;  3ZNH B;  2JZ3 B;  3IG3 A;  2OOB B;  3ZO5 B;  2N1V A;  4URK A;  4IW0 A;  1KOT A;  4NNJ B;  2KMC A;  2BWF A;  1J8C A;  2KXJ A;  3A4R A;  2JT4 B;  2M0X A;  5D2M B;  5IAA C;  1V81 A;  4W9I A;  3QC8 B;  2N9E B;  4FUL A;  1WE7 A;  2DAF A;  2WX1 A;  1WX8 A;  1WY8 A;  2CHZ A;  2K25 A;  4HCN B;  2M4N A;  5JHB A;  1WM3 A;  1WR1 A;  3AI5 A;  3GZN I;  2G3Q B;  5JHA A;  1S3S G;  1LFD A;  4CHK A;  2L8J A;  2DZK A;  2RSU A;  3A9K B;  3ZNI D;  2V3S A;  1R4N I;  1NBF C;  4JIO U;  4KIK B;  5DPS A;  1OTR B;  1UBI A;  3M63 B;  3R7R A;  3WAP A;  3KW5 B;  1WI0 A;  5LXH A;  1OEY A;  4RM8 A;  5CHW A;  2MLB A;  4K1R B;  3Q3J A;  4GB9 A;  5GMV A;  1TTN A;  4NY0 A;  4ZRI A;  2KJ6 A;  2KN5 A;  2OJR A;  2KDB A;  3L08 A;  4FJY A;  4NAW B;  4IWP A;  5IA7 A;  2JF5 A;  3OJ3 A;  3PT2 B;  1LXD A;  2WX0 A;  3T8M A;  3KUZ A;  3RYT A;  3VUY A;  1V2Y A;  1M94 A;  4B6W A;  4DHZ E;  3OAW A;  1Q1O A;  2XEW A;  2NBU A;  3LJ3 A;  2KK8 A;  4GDL A;  3VXW A;  2I1K A;  3APD A;  1Z2M A;  2LGX A;  3QCA A;  5DCN A;  4NJ6 A;  2LXC A;  2KAN A;  1J19 A;  3L17 A;  4HDQ A;  1Y8R C;  1P98 A;  4G3X B;  1KJT A;  1Q5W B;  3SHQ A;  5CX3 A;  2KFK A;  3PRM B;  2KC1 A;  4GDK A;  2MBB B;  3A33 B;  5CTR C;  3ZKJ C;  1TZ1 A;  2L0T A;  2N7E A;  3NY5 A;  4PS7 A;  2BYE A;  2K6Q A;  3WA0 A;  4DBG A;  4GMV A;  3VVW B;  1OGW A;  4N9F 4;  1E7V A;  1IPG A;  4HPM B;  1WXS A;  3RD2 A;  4BBN F;  4BKG A;  3VTW A;  2Y5B B;  2R2O A;  2ZCB A;  2IBI B;  3L10 B;  5CHV C;  2Z0E B;  2LAS A;  4M8N A;  3ZDT A;  4NPN A;  3PGE A;  4WAA A;  1Q0W B;  1D3Z A;  2PJH A;  2KOX A;  2G4S A;  4I6L B;  3HM6 X;  4AJW A;  3ZNG C;  2DYB A;  4DDG D;  5J18 A;  2HJ8 A;  3PVL A;  1YX5 B;  1GC7 A;  2LUE A;  3DVN U;  1EUV B;  2J0K A;  2K8C A;  1XT9 B;  3OJ4 B;  3P2B A;  4IUM B;  4MSQ B;  2O6V B;  1BT0 A;  4MJS A;  1UD7 A;  2KVR A;  2KLC A;  4BFR A;  2NPT B;  2MBO A;  4BVU C;  4ZYN A;  1XQQ A;  2I1J A;  2L76 A;  4W9J A;  1F9J A;  3L0W B;  3PPA A;  3PS6 A;  2DX5 B;  3QIJ A;  4GN1 A;  4WWN A;  3IHP C;  3V62 A;  5E6P A;  1P9D U;  4HVB A;  1WZ3 A;  2LGY A;  2JZZ A;  4BOZ B;  2KZR A;  2ZVN A;  2AYO B;  2L00 B;  2IO1 B;  1P0R A;  3VQI A;  3EC8 A;  2O6V A;  4PS3 A;  3IFW B;  4BKS A;  3QJZ A;  2RGF A;  1FXT B;  4FJV B;  3B1L X;  4IWO A;  2G4D B;  3DPD A;  3H9D A;  4GOC A;  4ICU A;  2FCM A;  2ZZP B;  3V61 A;  1E5W A;  1C3T A;  3QAR A;  2MW5 A;  4IM3 A;  4MGI E;  2FCS A;  2NVU I;  3RZF A;  4AP4 C;  2EMT A;  3DQV A;  4PS8 A;  2O6V D;  2IO3 B;  4MEM A;  3RUL A;  2JPH A;  4BKS D;  1ZGU B;  1E8W A;  5CHF A;  2KO3 A;  1WE6 A;  5JZE B;  3TMP B;  3VTV A;  3HHM A;  3CF6 E;  4DDI D;  4JLC A;  3UIN B;  2RD0 A;  2KHW B;  2M1M A;  2KWV B;  2BKR B;  5HKH A;  1E8Z A;  2C60 A;  3A1Q B;  5J17 A;  2D3G A;  5L95 C;  2KX0 A;  4EZK A;  3WAM A;  3QX1 A;  3W1Y A;  1V6E A;  1WM2 A;  2AEH A;  3LDZ E;  2JWZ A;  3L16 A;  3IVF A;  4E71 A;  3ML8 A;  2MQJ A;  4IM0 A;  3TL5 A;  4IWQ A;  3ZTC A;  1WZ0 A;  4HXD A;  4W9K A;  2JRH A;  2V1Y A;  1ISN A;  3H6N A;  1ZW7 A;  4WJP A;  3A1Q A;  1RFA A;  1WJN A;  1WXA A;  3VDZ A;  3NZS A;  3H7S A;  3WAO A;  2J0J A;  3DVN V;  3QHT A;  5BO4 B;  4GGQ A;  5JH5 C;  1P3Q U;  4W9G A;  2ZNV B;  1X1M A;  2LRU A;  2NR2 A;  4A3P A;  4GDL B;  3DCG A;  4TQ1 A;  4G11 A;  2PPH A;  5AZH A;  2KQ7 A;  3BIN A;  4EZJ A;  4W9L A;  2IY1 B;  5KHO A;  4LCD E;  3ZRF A;  3ENE A;  4MDK E;  2KWU B;  4GIV A;  2BPS A;  2KMA A;  4E74 A;  4K7W A;  3ZDM C;  1GUA B;  2KFK B;  4GDK B;  2L7R A;  3KYC D;  2FIF A;  4F7Z A;  2A4Z A;  2L0F A;  2JUO A;  2K39 A;  3OLM D;  4G0N B;  4AJY B;  1IYF A;  3PHW B;  2MX2 A;  4KVG B;  1NDD A;  3UIP B;  5J2R A;  1I42 A;  1WGG A;  2N9P C;  4CYE A;  2FUH B;  2IY0 B;  3I3T B;  4MGZ E;  2G45 B;  3RCZ A;  2CHX A;  1NI2 A;  2AL3 A;  3B0A A;  2LGD A;  2M8S A;  3N3K B;  1GC6 A;  2KNB A;  2NBV B;  3KVF B;  4MM3 A;  1SGH A;  4AOF A;  3R66 C;  2HE7 A;  2W9N A;  5AZF A;  3UQB A;  1J0G A;  2C7M B;  2CR5 A;  2K8B A;  1E8X A;  4OVU A;  5D7G A;  3WAN A;  3L13 A;  5L83 A;  2C5L C;  2BF8 B;  3KH0 A;  4DK5 A;  3N30 A;  4LDT D;  3ZVV A;  1VCB A;  1YJ1 A;  4E3C A;  4TKN A;  2CU1 A;  1JRU A;  3T9L A;  2EMS A;  3PTF C;  2FAZ A;  2N4F A;  4WJO A;  2LZ6 A;  5G55 A;  4JQW C;  4NQL B;  2PEA A;  2O2V B;  2NBW B;  4B95 A;  2ZPN A;  4ZRJ A;  2D10 A;  4BBN C;  4HJK A;  4MJS B;  4RMA A;  3X0W A;  3TBL D;  3EEC A;  2BWE S;  3JYU A;  2KX3 A;  4ANW A;  2K8H A;  1GJZ A;  1LQB A;  1XD3 B;  1WXM A;  2GBN A;  1V9J A;  1WFY A;  2DYO A;  3ZUN A;  2N7D A;  4GXB A;  1WJU A;  3PLV A;  2KQS A;  3Q3F A;  4ANX A;  1UEL A;  3MTN B;  1P1A A;  3K9P B;  1CMX B;  3PZD A;  3QA8 A;  1WYW B;  1RAX A;  3JSV B;  4FN2 A;  4WQO B;  1MG8 A;  2KJH B;  3NZU A;  2XK5 A;  2FNJ B;  1EF5 A;  3PHX B;  1WXV A;  2O2V A;  2N1W A;  4I6N B;  1YQB A;  5D6J B;  4WWO A;  2BYV E;  2WYQ A;  3VAW A;  3UIO B;  2DZM A;  3H7P B;  2EKE C;  4J6I A;  4EUT A;  1T0Y A;  2C7N B;  3CMM B;  4MSM B;  3A4S C;  4KSK C;  3H1U A;  4MH0 E;  2HTH A;  4K7U A;  1KM7 A;  3W1S A;  3DBR I;  3N32 A;  1RRB A;  2PE6 B;  2ZVO A;  3JSV A;  1E8Y A;  2LWP A;  3DVG X;  2AWT A;  4W9H A;  3GOE A;  3AXC A;  3ECI A;  3ZNZ B;  3CSF A;  2KKC A;  3H7P A;  3ALB A;  2IO2 B;  4NJ7 A;  2D07 B;  4WJN A;  4ICV A;  1YD8 U;  5AZG A;  4TUU A;  4K7S A;  2REX A;  3RT3 B;  2D2Q A;  2KTR A;  2VRR B;  2D11 A;  1WX7 A;  2N9X A;  4DXA B;  2MP2 A;  4KZC A;  5C1Z A;  1EF1 A;  3TJP A;  4ASW C;  1WGD A;  1WH3 A;  4FLH A;  2FCQ A;  2JXX A;  5LLI A;  2KDF B;  3APF A;  1OEY J;  4HLE A;  3QQ8 B;  4W9F A;  2KDE B;  2CS4 A;  3M95 A;  4HWI B;  2Z0D B;  2KWC A;  2XBB C;  3M62 B;  2GMI C;  3UGB B;  1SIF A;  3WAL A;  1GNU A;  2LJ5 A;  1EO6 A;  4WWP A;  1WX9 A;  4HK2 A;  3DDC B;  3QAQ A;  2A5U A;  1E7U A;  4MGK E;  1H8C A;  4PYZ A;  1ZKH A;  2R2Q A;  3TCA A;  2LVQ A;  1V5O A;  5E6O A;  3VH3 B;  5KHQ A;  3MHS D;  5TR5 A;  3RUI B;  4EZL A;  4A20 A;  4II3 B;  3QWZ B;  4KDI C;  4FA6 A;  3DOW A;  3M3J A;  5FR6 A;  2K1F A;  2RR9 A;  3V6E B;  4AWJ A;  5D94 A;  4FBJ B;  2ZEQ A;  2ZNV C;  3PLU A;  5E6N A;  5C23 A;  1L7Y A; 
#chains in the Genus database with same CATH topology
 1K8R B;  3ML9 A;  1YIW A;  1NEK B;  2MA9 B;  5DPW A;  4DHZ B;  1PQS A;  4EEW A;  1TGZ B;  2C7H A;  2W3R A;  2FBW B;  2NCN A;  3VFK A;  1VLB A;  4RM9 A;  2KTF A;  4XDC A;  4EE2 A;  3PSE B;  1EWC A;  2BGF A;  1V8C A;  1JWM D;  2DZI A;  1JWA D;  4MAC A;  1H4R A;  2ZCC A;  4GLS C;  1C78 A;  1P7F A;  2LXA A;  2IGH A;  2YVC A;  3PRE A;  2WDT B;  4XX5 A;  2IYD B;  3ZW3 A;  2L3Z A;  2DEN B;  3W1S C;  4NQK E;  2LVP A;  2XN9 C;  2PW9 A;  3PZ8 A;  3PV1 A;  2AL6 A;  3I9V 1;  2KDI A;  4HPL B;  2V4L A;  1ZP0 B;  1FCC C;  2MH7 A;  1FRR A;  1DYQ A;  5E6J A;  3BZD B;  3ETR A;  4GU2 A;  1V86 A;  3JVZ X;  1SSN A;  1MVK A;  3B08 A;  5HG2 A;  4C56 C;  1T0R C;  2WWZ A;  3PRP B;  4WH4 A;  2YLM A;  3TIX A;  2WU5 B;  3SR6 A;  4YSZ B;  1EM7 A;  3P42 A;  4F1S A;  3AE7 B;  1SJH D;  3RNE C;  2MEK A;  2IJ0 A;  3BYY B;  4M8M A;  4IG7 B;  2ZJD A;  2FID A;  3DBS A;  1XLP A;  3AU4 A;  5BMH A;  4W9D A;  1TJE A;  4EOY A;  3N1Y C;  3NVZ A;  5DPR A;  1E0Z A;  1Z5S B;  3SU8 X;  1C4P A;  4GSW A;  4HCP B;  5EDS A;  2IZV B;  1YJJ A;  3QK0 A;  3APC A;  4OZB A;  1WGY A;  3VTU A;  2D3B A;  3S2A A;  3KYD D;  3PRZ A;  1SE3 A;  2KWD A;  3SDL C;  4M0W B;  3IT6 B;  1JWS D;  3AE6 B;  1YN4 A;  3ZO5 B;  2BW2 A;  2KXJ A;  3A4R A;  2M0X A;  1V81 A;  3QC8 B;  1B1Z A;  3FC4 A;  4D2K A;  2CHZ A;  4C00 A;  5JHB A;  3AE5 B;  1ZDX A;  3R2T A;  1WR1 A;  2WXK A;  1D4B A;  1F2R C;  3ZNI D;  5AUI A;  1NBF C;  1UBI A;  3WAP A;  2LMC A;  3KW5 B;  1JML A;  1FMA D;  1JWB D;  5LXH A;  1HTQ A;  4RM8 A;  2KJ6 A;  3L08 A;  5FK9 C;  4FJY A;  1WXQ A;  3URY A;  3PT2 B;  3OJ3 A;  3RYT A;  4DHZ E;  3VXW A;  2KK8 A;  1F0Z A;  2JWU A;  1PGA A;  1Z2M A;  4TSS A;  1F2R I;  4OW0 A;  2LXC A;  3UI3 A;  1J19 A;  4M02 A;  1EU4 A;  3SHQ A;  5CX3 A;  5CTR C;  2WGS A;  3NY5 A;  4PS7 A;  2BYE A;  4ZOH C;  3P4R B;  4HPM B;  4C7Y A;  3GE3 C;  4YSX B;  2QDF A;  3LXF A;  2L83 A;  3L10 B;  3RNG C;  1QOF A;  2EEL A;  2Z0E B;  2LAS A;  1VRA B;  1XEE A;  4NPN A;  3PGE A;  2AQ1 B;  1YJI A;  1C77 A;  4AJW A;  4DDG D;  3ZYY X;  2G9H D;  2DWQ A;  3PVL A;  4XE0 A;  3P2B A;  4MSQ B;  2BB5 A;  4ZYN A;  1VDV A;  3GP7 A;  1FEH A;  4C7Z A;  2L76 A;  1F9J A;  4OHJ A;  3V62 A;  1WZ3 A;  2LGY A;  4BOZ B;  2ZVN A;  4ZHO A;  1P0R A;  2D5G A;  5BMI A;  3IFW B;  4BKS A;  2LJI A;  1FXT B;  5IOI A;  2DLB A;  3KQ4 A;  2FCM A;  2ZZP B;  4P6V F;  3QAR A;  4IM3 A;  4AP4 C;  4IDI A;  2ZW0 A;  3ZJT A;  1BXT A;  3MC8 A;  2W82 A;  2IO3 B;  3RUL A;  3DBL B;  4BKS D;  2BBC A;  1WE6 A;  1J7A A;  1STE A;  3NS1 A;  3HHM A;  2KHW B;  1R4M B;  1E8Z A;  2C60 A;  2D3G A;  2WXJ A;  5L95 C;  4EZK A;  3WAM A;  4HKZ E;  4E71 A;  4XWW A;  1FNW A;  3AEC B;  2V1Y A;  2Y3A A;  3H6N A;  1I4H A;  4WJP A;  2OED A;  3NZS A;  1QOB A;  2J0J A;  3DVN V;  3QHT A;  5BO4 B;  4GGQ A;  1P3Q U;  1X1M A;  1V1O A;  2LRU A;  4TQ1 A;  2V4I B;  2KWU B;  4ARC A;  2N7J A;  2E3T A;  4K7W A;  2W54 A;  2XNA C;  1T0S C;  2V9H A;  4AJY B;  1IYF A;  3AE4 B;  4KVG B;  1NDD A;  3UIP B;  2IPK D;  1WGG A;  1FD6 A;  2FUH B;  2VZK B;  3I3T B;  4N6E B;  2AL3 A;  1MPE A;  2FE8 A;  2M8S A;  4MM3 A;  3N20 C;  4AOF A;  1UNS A;  2L52 A;  2HE7 A;  2W9N A;  5AZF A;  3UQB A;  2C7M B;  1T0Q C;  4OVU A;  2BYT A;  2B76 B;  4DK5 A;  3J9C A;  2J52 A;  1VCB A;  1YJ1 A;  2PIA A;  4DXF A;  1JRU A;  3T9L A;  1ET9 A;  3OG5 A;  4WJO A;  2LZ6 A;  4JQW C;  3AEA B;  5G5G A;  4BBN C;  2BWE S;  1WWT A;  3JYU A;  4MH8 A;  4P1B C;  1GJZ A;  1XD3 B;  2LGI A;  2DYO A;  1WJU A;  3PLV A;  2NTT A;  2SAK A;  3MTN B;  1P1A A;  1RAX A;  1ACC A;  1MG8 A;  2XK5 A;  2WXQ A;  2O2V A;  2BYV E;  2EKE C;  4J6I A;  4KSK C;  4MH0 E;  3W1S A;  3NVY A;  3AE9 B;  1SXT A;  3JSV A;  5BMG A;  3DVG X;  2IDY A;  4CQN A;  3AXC A;  3ECI A;  3BVM A;  3KWV A;  3ALB A;  4NJ7 A;  4ICV A;  4TUU A;  3Q3O C;  4WAF A;  4YXD B;  2KTR A;  1A70 A;  2N9X A;  2MP2 A;  2QC8 A;  3ZXV A;  1UWM A;  2KDF B;  3APF A;  1OEY J;  1PYW D;  2Q5W D;  1XCT L;  2CS4 A;  3M95 A;  2RMM A;  2I2Y A;  1ZUD 2;  1SIF A;  2LJ5 A;  4LNK A;  4YTP B;  2A5U A;  1ZKH A;  2LVQ A;  4WIP A;  1BUI C;  4HKQ A;  4KDI C;  1TKG A;  1VZ8 A;  2X38 A;  2KMM A;  3EUB 2;  4OZC A;  1ESF A;  5C23 A;  1GPX A;  1L7Y A;  3GZN B;  1LM8 B;  3TUO A;  5G2N A;  3U30 A;  5AEK B;  1WR6 E;  4MM3 B;  1I7H A;  4ZRK A;  1ZE3 D;  1WJ4 A;  4YSY B;  4MEL A;  4CO7 A;  2WXH A;  4X57 B;  4P7I A;  4FJZ A;  2HDE A;  4ZDV A;  3HRD D;  3HM3 A;  4KSL C;  2DAJ A;  3HUI A;  3RNC C;  3DWG C;  4KIK A;  2N9L A;  4EKU A;  4OVV A;  1WGH A;  3DBH I;  2M0A A;  2XK5 B;  1E9M A;  2KAC A;  2BTE A;  3ONS A;  2G1E A;  2N0S B;  2C9W B;  2K0P A;  1M4V A;  1PFD A;  2RDH A;  3R7Q A;  3VRB B;  2WS3 B;  1WGR A;  1Q10 A;  3AU5 A;  3X23 A;  3Q8A A;  2ZPY A;  1NYR A;  1ENF A;  2LD9 A;  3UQA A;  4PK1 A;  4KDL B;  4O1N A;  4FHJ A;  4TMA B;  1QZE A;  4DQO C;  2KTR B;  2CKH B;  1QT9 A;  5EE3 A;  2LHE A;  4LJP B;  2MP2 B;  4XZ4 A;  3ZRC A;  1RM6 C;  2KLG A;  3I63 C;  4WJQ A;  3UF8 A;  3VH4 B;  3AUL A;  3AEB B;  5AUK A;  3MHZ A;  3C0R B;  3CST A;  3U8Z A;  3EFC A;  1C9F A;  3K9O B;  4HRO A;  4MGY E;  1TS4 A;  1V49 A;  3I57 A;  3V60 A;  2UYZ B;  4TQ0 A;  4BKT A;  4DWF A;  1N6Z A;  2RPQ A;  3V05 A;  1KH0 A;  2KQ4 X;  1AAR A;  1K52 A;  3EFU A;  2IO0 B;  5HFY A;  4B9K A;  2J0M A;  1N63 A;  3DWM A;  1UGM A;  1UH6 A;  1V5T A;  2PE9 A;  4HDO A;  4J3O D;  1E10 A;  2BKF A;  4II2 B;  1A5R A;  1MHX A;  2MCN B;  4IW0 A;  4NNJ B;  5HHD G;  4FUL A;  2WX1 A;  2PLP A;  4HCN B;  4M0W A;  3SFD B;  3IXS A;  3GZN I;  2G3Q B;  4LNN A;  1LFD A;  4CHK A;  1SIJ A;  2V3S A;  1R4N I;  4KIK B;  2QMT A;  2TSS A;  2IGD A;  3Q14 C;  1OEY A;  2MLB A;  4K1R B;  4GB9 A;  4ZRI A;  2WDR B;  5IA7 A;  2Z8L A;  1QQR A;  2JF5 A;  1V2Y A;  4B6W A;  2XEW A;  3DHG C;  5T8I A;  5DCN A;  2KAN A;  2J42 A;  3IAM 1;  4HDQ A;  4ZRQ A;  1AW7 A;  1KJT A;  1Q5W B;  1FM0 D;  1KFY B;  4GDK A;  2KC1 A;  2MBB B;  3A33 B;  5G5H A;  1KLG D;  1TZ1 A;  3N9Y C;  2ACZ B;  4C4V B;  1TS5 A;  5EE0 A;  2ZCB A;  3P1M A;  2OHF A;  2PVO D;  3Q2A C;  3ZDT A;  4WAA A;  2JSV X;  1Q0W B;  2QIL A;  1K53 A;  2I38 A;  1IBX B;  2DNF A;  1ZOY B;  3DVN U;  1EUV B;  2K8C A;  4B0M A;  2O6V B;  2WNM A;  4ITK A;  4BFR A;  2KLC A;  2MBO A;  1FNU A;  1XQQ A;  1VR9 A;  3PPA A;  1FPY A;  3QIJ A;  4GN1 A;  4LNI A;  4WWN A;  3IHP C;  4HVB A;  5E6P A;  2EKI A;  3VQI A;  4L2Y A;  4FJV B;  2SEB D;  2G4D B;  3H9D A;  1GOZ A;  2FCS A;  2NVU I;  3W9C B;  4RGO S;  1D5Z C;  3CIR B;  3P63 A;  1FXI A;  1FFV A;  1SE4 A;  3AM9 A;  1E8W A;  5JZE B;  3TMP B;  2RD0 A;  2M1M A;  4KKJ A;  5HKH A;  5J17 A;  3LDZ E;  2JWZ A;  2GB1 A;  3ML8 A;  4IM0 A;  4IWQ A;  4W9K A;  1ISN A;  2OJW A;  4B0E A;  1RFA A;  1WJN A;  3WAO A;  5FR3 A;  2NR2 A;  2D3A A;  5AZH A;  2QSD A;  2V0G A;  3ZRF A;  1D5X C;  3U52 E;  2KMA A;  4N59 A;  3ZDM C;  4GDK B;  2FIF A;  2JUO A;  1KF6 B;  3OLM D;  4G0N B;  1KTK A;  1RFK A;  1I42 A;  4S17 A;  4MGZ E;  2IY0 B;  1JWU D;  1PUT A;  2HTM E;  3RCZ A;  2WXG A;  2LGD A;  3N3K B;  2KNB A;  2NBV B;  4LK0 M;  3AH7 A;  1ZPS A;  3L13 A;  2C5L C;  1OQQ A;  2BF8 B;  3N30 A;  1FXA A;  1YQ3 B;  4KGS A;  1YQ4 B;  5I4D A;  2EMS A;  3PTF C;  2N4F A;  3NVV A;  3ZGZ A;  4NQL B;  4M01 A;  4RCO A;  3VR8 B;  2WDQ B;  2ZPN A;  3KWL A;  4HJK A;  4RMA A;  3EEC A;  4ANW A;  1GB4 A;  1WXM A;  2VZK D;  2IGG A;  2MJ3 A;  4GXB A;  2WXF A;  1YN3 A;  4ANX A;  1UEL A;  1AN8 A;  2WHI A;  3NZU A;  3PHX B;  1MFW A;  1HTO A;  1WXV A;  1YQB A;  3PO0 A;  3VAW A;  2WYQ A;  3UIO B;  3CMM B;  4KGR A;  4MSM B;  3A4S C;  1KM7 A;  1RRB A;  2PE6 B;  2ZVO A;  1E8Y A;  2AWT A;  1HEZ E;  4W9H A;  3GOE A;  3CSF A;  3MJ5 A;  4RH6 A;  2UU7 A;  1YD8 U;  2QIE B;  5BYQ A;  3RT3 B;  2V3N A;  2VRR B;  2D11 A;  3NJT A;  3DHI C;  5C1Z A;  1EF1 A;  1QOG A;  1NI3 A;  2MJD A;  3C8Y A;  2KDE B;  2Z0D B;  4L23 A;  4RNA A;  2KWC A;  2XBB C;  3HVD A;  1EO6 A;  3BWU D;  3DDC B;  1XO3 A;  3QAQ A;  1H8C A;  5KHQ A;  5E6O A;  1AWD A;  3Q8E A;  2M19 A;  3MHS D;  3RNA C;  1I4G A;  4WWM A;  4A20 A;  4II3 B;  2WDV B;  1C79 A;  4JWU C;  5IP4 D;  2YEP F;  4AWJ A;  5D94 A;  3FAH A;  2INP E;  2ASQ A;  2FCN A;  4R3D A;  4ARI A;  4S0R A;  2KAJ A;  2QCZ A;  1DGJ A;  2AX5 A;  1L2N A;  1ZXI A;  1DOX A;  1S1Q B;  3R3M A;  2BS2 B;  3AEF B;  2BYF A;  1IGD A;  2W3S A;  2MWS B;  3NVW A;  3IBE A;  1SE9 A;  2VH2 A;  5IO9 A;  3ABV B;  4W9C A;  2NMQ A;  4H2A A;  1WMH B;  1RLF A;  3BII D;  3A9J B;  4REZ A;  4UDU C;  1G6J A;  2L32 A;  3E9S A;  1NVI D;  2GI9 A;  4M00 A;  4XC2 A;  1ROE A;  5H8Y E;  1PGB A;  4DHJ B;  5EE1 A;  3AB5 A;  4FXC A;  3ZTD A;  3VUX A;  4ANV A;  2JRI B;  3GB1 A;  2GBR A;  4I6P A;  3H8H A;  4YTN B;  3DBR B;  1WRD B;  3RNB C;  4ZYS A;  2KD0 A;  3SD5 A;  4EFO A;  1F77 A;  4LJO B;  1YN5 A;  1GAQ B;  1BML C;  2B3A A;  1KLV A;  1E7P B;  2JYE A;  1MI0 A;  3AE1 B;  4FHK A;  1QF6 A;  1QIL A;  3KUC B;  1TBE A;  1SEB D;  3BY4 B;  2ICI A;  2J7Q B;  4N58 A;  1N61 A;  2DYM A;  1RYJ A;  2K22 A;  5LNK 1;  4KGT A;  2PTL A;  1NEN B;  2WP9 B;  4A8X C;  2MRP A;  1YNT E;  4A55 A;  2LUM A;  2NPT A;  3ZQ4 A;  4ANU A;  1UZX B;  3U2S C;  4TV3 A;  1WF9 A;  2UWQ A;  3RMK C;  3HK0 A;  2MBQ A;  3DBL I;  1FCL A;  2KC2 A;  2BS4 B;  1OQY A;  3Q3N C;  3O13 A;  3ZIM A;  3WIM A;  1K50 A;  3RZW C;  2JVC A;  1YOV B;  2LRW A;  1R4M I;  1I4P A;  3R2I A;  2LFI A;  2JZ3 B;  2L1A A;  3IG3 A;  2OOB B;  2PKO A;  4URK A;  3AE8 B;  1D6E C;  2KMC A;  2BWF A;  1J8C A;  2K9X A;  1JCK B;  2JT4 B;  5D2M B;  5IAA C;  2N9E B;  1CQV A;  1VZ7 A;  1WE7 A;  3P4S B;  3VR9 B;  1WX8 A;  1WY8 A;  2K25 A;  1WM3 A;  1SBB B;  5JHA A;  1S3S G;  5TSS A;  2L8J A;  2DZK A;  2RSU A;  4JIO U;  5DPS A;  1HZ5 A;  1OTR B;  3T3O A;  1TTN A;  2W55 A;  4NY0 A;  2OJR A;  1UF0 A;  1XLO A;  1L0Y B;  3SFE B;  1LXD A;  2WX0 A;  1JAL A;  3VUY A;  4AS1 A;  3OAW A;  2NBU A;  3LJ3 A;  4GDL A;  2I1K A;  3APD A;  2LGX A;  3QCA A;  1L0X B;  1C76 A;  3L17 A;  3P4P B;  2JXT A;  2KFK A;  3ZJU A;  3AE3 B;  3ZKJ C;  1N60 A;  2K6Q A;  1C4A A;  3VVW B;  1E7V A;  1IPG A;  1WXS A;  3RD2 A;  3VTW A;  3U4E G;  1QOA A;  2RDB C;  2IBI B;  1MHH E;  2CU3 A;  5MPO A;  4RF1 A;  5EE9 A;  1C4C A;  4C4V A;  1D3Z A;  5IKC M;  2KOX A;  1HQR D;  1TS2 A;  2G4S A;  3GE8 C;  2MJE A;  4I6L B;  3HM6 X;  4PT5 A;  4BZA A;  2D3C A;  2DYB A;  1GB1 A;  2HJ8 A;  2LUE A;  3OJ4 B;  2J0K A;  4IUM B;  3ZJV A;  1V97 A;  2LEK A;  1BT0 A;  1HXY D;  4MJS A;  4A9A A;  2NPT B;  1KRH A;  1FRD A;  2J4X A;  1SB3 C;  2J53 A;  4W9J A;  3L0W B;  3PS6 A;  2JU6 X;  1IBX A;  1P9D U;  3N1Z C;  4USA A;  1PGX A;  2AYO B;  2L00 B;  1L5P A;  2IO1 B;  2BS3 B;  2HJ1 A;  2O6V A;  3EC8 A;  4PS3 A;  2LHD A;  3AMZ A;  3B1L X;  4ICU A;  1E5W A;  1C3T A;  4RGM A;  4LLG M;  2EMT A;  3DQV A;  4PS8 A;  1TS3 A;  2O6V D;  4MEM A;  2JPH A;  1ZGU B;  2KO3 A;  3VTV A;  3CF6 E;  4DDI D;  3UIN B;  2BKR B;  1XCQ L;  3A1Q B;  3N1X C;  2KX0 A;  3QX1 A;  3R8B A;  2ZW1 A;  1WM2 A;  1JRO A;  2AEH A;  3L16 A;  3IVF A;  2JZP A;  2MQJ A;  3TL5 A;  3FIL B;  3ZTC A;  1WZ0 A;  2PMV A;  1ZW7 A;  4US8 A;  1R7S A;  3EA6 A;  2BVC A;  5JH5 C;  2KDM A;  2ZNV B;  3CWI A;  4A3P A;  4GDL B;  2PPH A;  4KKI A;  4US9 A;  4EZJ A;  3KLS X;  4W9L A;  4LCD E;  4MDK E;  4RFB A;  2BPS A;  2KFK B;  2L7R A;  3KYC D;  2A4Z A;  1CJE A;  1OFF A;  1Y56 A;  3GS2 A;  2KYW A;  5J2R A;  2BQQ A;  4NZL B;  2G45 B;  2CHX A;  3B0A A;  1XF5 L;  3NZ3 A;  1IUE A;  3R66 C;  4YT0 B;  2CJO A;  1J0G A;  2CR5 A;  2K8B A;  1T5X D;  3RPF C;  4LDT D;  3ZVV A;  2M56 B;  4TKN A;  3C19 A;  5G55 A;  2PEA A;  5GXG B;  4B95 A;  4MJS B;  3TBL D;  2KX3 A;  1V9J A;  1WFY A;  2KQS A;  3Q3F A;  5C3J B;  4XDD A;  3QA8 A;  3K9P B;  1CMX B;  3IAS 1;  4FN2 A;  2E6X A;  2KJH B;  1EF5 A;  4I6N B;  3AEG B;  1SJE D;  3H7P B;  2WXR A;  1T0Y A;  3BVZ A;  2INC C;  3AE2 B;  3H1U A;  2PVG C;  1KLU D;  2HTH A;  4K7U A;  3N32 A;  3Q8B A;  3P4Q B;  2K5P A;  2KKC A;  1WYG A;  1F1H A;  2Y5P A;  1B9R A;  2RDG A;  4WJN A;  5AZG A;  4K7S A;  2REX A;  3AV8 A;  4HPP A;  3TJP A;  4ASW C;  1WGD A;  1WH3 A;  4AQ7 A;  1SE2 A;  4P1C C;  5LLI A;  2WXO A;  1JRP A;  4HLE A;  3QQ8 B;  3M62 B;  2GMI C;  1GNU A;  1QLB B;  1EWY C;  1WX9 A;  4HK2 A;  1UGJ A;  1MJD A;  4MGK E;  3EGR A;  4PYZ A;  2R2Q A;  1TT5 B;  4NAM A;  3VH3 B;  5TR5 A;  3NG0 A;  1XLQ A;  2JQR B;  2R61 A;  3TEY A;  4FA6 A;  3DOW A;  2K1F A;  2RR9 A;  3V6E B;  2DBY A;  2ZEQ A;  2ZNV C;  4BAX A;  3PRM B;  3PLU A;  2KN4 A;  4YL8 A;  2WXM A;  1GG3 A;  4AUQ C;  2MBE A;  4KZ0 A;  4LDT B;  1J7C A;  4IM2 A;  2YEP B;  1U4A A;  4FAD A;  3L54 A;  4A90 A;  4K3C A;  4IC7 B;  1XXG A;  3VUW A;  3MJW A;  3O65 B;  1NYQ A;  3VRA B;  3E56 A;  5D3D A;  4LNF A;  2WU2 B;  2LI5 A;  2ON8 A;  2NS5 A;  4P16 A;  5BYR A;  3ZLZ A;  2H89 B;  4BOS C;  2GBK A;  1DOY A;  2HD5 B;  1C1Y B;  3W5U B;  2LVO A;  3DHH C;  3A9K A;  1L6U A;  1TY0 A;  4JL9 A;  1E90 A;  5D3I B;  3TEZ A;  1I4X A;  2CHW A;  2GBJ A;  4K81 A;  2DZJ A;  4NAW A;  1WMH A;  4G50 A;  3IT4 B;  4JGH B;  1IGC A;  1I35 A;  3AN1 A;  3A9J A;  2X8X X;  1QKZ A;  2GRI A;  1UBQ A;  2DHZ A;  4A3O A;  1CK1 A;  1WJ6 A;  2L05 A;  1IP9 A;  2M17 A;  4XWT A;  3TEX A;  2WQY B;  2Z59 B;  4KV2 A;  5BYS A;  4Q2J A;  3MC9 A;  3NS8 A;  5DPT A;  3TSS A;  2N9K A;  3MFG A;  2JYT A;  1LGR A;  3DVG Y;  1P7E A;  1T3Q A;  4W9E A;  3SEB A;  1D5M C;  2KJR A;  4DHJ D;  2Y5C A;  4JE3 B;  2KFJ A;  3LYY A;  3L4P A;  3KUD B;  3V6C B;  3NOB A;  1FO4 A;  4F8C B;  4QAY A;  1V80 A;  5IN7 A;  3TEW A;  3JW0 X;  1YX6 B;  1V1P A;  2AQ2 B;  1VD2 A;  2MSE D;  2FUG 1;  3RN9 C;  1F52 A;  2MBH A;  2K6D B;  4XYC A;  1ZXH A;  3HIZ A;  3NHE B;  4YWG G;  2CJN A;  3EHV A;  4JWS C;  3U7D A;  2QHO A;  3D32 A;  1HE8 A;  1FFU A;  2GBM A;  5LXI B;  1WIA A;  1OQR A;  4PYU A;  3VHT C;  2GOW A;  2H88 B;  2JY6 A;  1I4Q A;  4HRS A;  1JW9 D;  1VZ6 A;  4XGA B;  3ZNH B;  2N1V A;  2VH1 A;  1TYG B;  3W2D A;  1KOT A;  4RGT A;  1HA5 A;  3RI7 C;  3B2G A;  4WUR A;  4HEA 1;  4W9I A;  2DAF A;  3AEE B;  3W5V B;  2M4N A;  2BT6 A;  3NUH B;  3AI5 A;  2INN E;  3A9K B;  4C80 A;  3M63 B;  3R7R A;  1WI0 A;  5CHW A;  1L0V B;  3Q3J A;  5GMV A;  2WLB A;  2KN5 A;  2KVZ A;  1N62 A;  2KDB A;  4NAW B;  4IWP A;  1N5W A;  3MC0 B;  1TIF A;  1I4R A;  1K51 A;  1TZO A;  1RWS A;  4K3B A;  3T8M A;  3KUZ A;  1M94 A;  3Q8F A;  1LO5 D;  1Q1O A;  1HZ6 A;  3Q6B A;  4NJ6 A;  3DBH B;  1Y8R C;  1P98 A;  4G3X B;  5C2T B;  2WXI A;  3BYT B;  2L0T A;  2N7E A;  4WQM A;  3WA0 A;  4DBG A;  4GMV A;  1OGW A;  4N9F 4;  4BKG A;  4BBN F;  2Y5B B;  4JX1 C;  2R2O A;  2IND C;  5CHV C;  4RF0 A;  2WXN A;  4M8N A;  1CZP A;  1L6V A;  1ZDV A;  4ACF A;  2PJH A;  3ZNG C;  4RGN A;  5J18 A;  1YX5 B;  1GC7 A;  1XT9 B;  1L4Z B;  3LB8 C;  1UD7 A;  2KVR A;  4BVU C;  1V1P B;  4ZHP A;  2I1J A;  4A6Q A;  4ZRP A;  2DX5 B;  3B9J A;  2JZZ A;  2KZR A;  3QJZ A;  2RGF A;  4IWO A;  3DPD A;  3V61 A;  4GOC A;  2MW5 A;  3BK1 A;  4MGI E;  1UWX A;  3BVG A;  3RZF A;  1DOI A;  5CHF A;  4JLC A;  3ZXR A;  5H92 C;  3Q8C A;  2KWV B;  1TKY A;  4KX6 B;  3FKY A;  3W1Y A;  1V6E A;  5FKA C;  3PZ7 A;  3RNF C;  5JXV A;  4HXD A;  1TY2 A;  2JRH A;  2QEJ C;  1TKE A;  1WRI A;  3A1Q A;  1WXA A;  3Q69 A;  3VDZ A;  3H7S A;  4NJC A;  3BK2 A;  4W9G A;  1R4N B;  3FIL A;  3DCG A;  1UUP A;  4G11 A;  2KT7 A;  3OWE B;  2KQ7 A;  3BIN A;  5KHO A;  2IY1 B;  1MG4 A;  3ENE A;  4GIV A;  1WSP A;  4OZA A;  4E74 A;  1GUA B;  4F7Z A;  2L0F A;  1E6E B;  2K39 A;  3PHW B;  2MX2 A;  3HVZ A;  2N9P C;  4CYE A;  1NI2 A;  4YTM B;  1EU3 A;  1GC6 A;  3KVF B;  1SGH A;  1PDX A;  4HJG E;  2ONQ A;  1E8X A;  5D7G A;  3WAN A;  5L83 A;  3KH0 A;  4E3C A;  2WXP A;  2CU1 A;  1SF0 A;  2FAZ A;  4OVZ A;  1JQ4 A;  1FNV A;  2O2V B;  2JX5 A;  2NBW B;  3WCQ A;  4ZRJ A;  2D10 A;  3RFZ B;  3X0W A;  1ET6 A;  2K8H A;  1LQB A;  2GBN A;  4MT5 A;  3ZUN A;  2N7D A;  3PZD A;  1WYW B;  4WQO B;  3JSV B;  2FNJ B;  3MP9 A;  2N1W A;  5D6J B;  4WWO A;  4JPS A;  4EUT A;  2DZM A;  1J7B A;  3NRZ A;  2C7N B;  5HI1 A;  3B2F A;  2QJL A;  2LGS A;  3DBR I;  3V3X A;  2LWP A;  2AQ3 B;  4LTU A;  4DXG A;  3ZNZ B;  3H7P A;  3T3N A;  1N5X A;  1L4D B;  4L1B A;  2IO2 B;  2D07 B;  2MHJ A;  4IKG A;  2D2Q A;  1WGK A;  1WX7 A;  4DXA B;  4KZC A;  1AYF A;  3U7Z A;  4FLH A;  1VJK A;  2WXL A;  2FCQ A;  2JXX A;  4W9F A;  4HWI B;  4LNO A;  2RPV A;  3UGB B;  3WAL A;  2NTS A;  4WWP A;  2GLS A;  2K3U A;  4IOI E;  1E7U A;  3TCA A;  1V5O A;  3Q3M C;  3RUI B;  1FIQ A;  4EZL A;  3AED B;  3QWZ B;  3M3J A;  2BB6 A;  5FR6 A;  2V3P A;  1XLN A;  1YMH E;  4FBJ B;  3I5J C;  1T6B X;  5E6N A; 
#chains in the Genus database with same CATH homology
 2ASQ A;  2FCN A;  4YL8 A;  1K8R B;  1LM8 B;  1GG3 A;  4AUQ C;  3ML9 A;  2MBE A;  5G2N A;  1YIW A;  4KZ0 A;  3U30 A;  2MA9 B;  4LDT B;  5DPW A;  4DHZ B;  5AEK B;  1L2N A;  4IM2 A;  1WR6 E;  1S1Q B;  3R3M A;  1U4A A;  4FAD A;  1PQS A;  3L54 A;  4ZRK A;  4EEW A;  1WJ4 A;  1TGZ B;  2C7H A;  4IC7 B;  4MEL A;  3VUW A;  2NCN A;  3VFK A;  2BYF A;  3MJW A;  3O65 B;  4CO7 A;  4X57 B;  4P7I A;  4FJZ A;  2MWS B;  4RM9 A;  2KTF A;  3IBE A;  3PSE B;  2LI5 A;  1SE9 A;  2BGF A;  2NS5 A;  4ZDV A;  4W9C A;  3ZLZ A;  2DZI A;  1H4R A;  4BOS C;  2ZCC A;  2GBK A;  3HM3 A;  2HD5 B;  2DAJ A;  4KSL C;  1C1Y B;  1WMH B;  2LXA A;  2LVO A;  1RLF A;  2YVC A;  3PRE A;  3A9K A;  2WDT B;  4KIK A;  4EKU A;  3A9J B;  4JL9 A;  4OVV A;  1G6J A;  1E90 A;  1WGH A;  3DBH I;  2IYD B;  4XX5 A;  2XK5 B;  3ZW3 A;  2L3Z A;  2DEN B;  2CHW A;  2GBJ A;  4K81 A;  3ONS A;  4XC2 A;  3W1S C;  4NQK E;  2C9W B;  2DZJ A;  4NAW A;  4DHJ B;  3R7Q A;  1WMH A;  4G50 A;  2LVP A;  4JGH B;  1I35 A;  1WGR A;  3PV1 A;  2AL6 A;  3A9J A;  3AU5 A;  2KDI A;  4HPL B;  2V4L A;  2ZPY A;  3X23 A;  3VUX A;  3ZTD A;  4ANV A;  2JRI B;  1UBQ A;  2LD9 A;  3UQA A;  2DHZ A;  4A3O A;  1WJ6 A;  2L05 A;  1IP9 A;  2M17 A;  4GU2 A;  1V86 A;  2GBR A;  4KDL B;  2Z59 B;  4KV2 A;  3JVZ X;  4FHJ A;  4I6P A;  3NS8 A;  5DPT A;  1QZE A;  3WIM A;  2KTR B;  2CKH B;  3B08 A;  4LJP B;  2MP2 B;  3DVG Y;  1WRD B;  4W9E A;  2KD0 A;  4XZ4 A;  3ZRC A;  2KJR A;  2KLG A;  3SD5 A;  4LJO B;  4EFO A;  4DHJ D;  2WWZ A;  3PRP B;  2B3A A;  2YLM A;  3TIX A;  1KLV A;  4WJQ A;  3UF8 A;  3VH4 B;  2KFJ A;  4FHK A;  4F1S A;  3AUL A;  3KUC B;  1TBE A;  3BY4 B;  2J7Q B;  2DYM A;  3KUD B;  3C0R B;  3CST A;  3U8Z A;  3V6C B;  3NOB A;  4F8C B;  3K9O B;  4MGY E;  1V49 A;  4M8M A;  3V60 A;  4IG7 B;  2MRP A;  2ZJD A;  2FID A;  2UYZ B;  4TQ0 A;  1V80 A;  4BKT A;  2NPT A;  3DBS A;  3AU4 A;  4DWF A;  4W9D A;  3JW0 X;  2RPQ A;  4EOY A;  4ANU A;  1UZX B;  1AAR A;  1YX6 B;  5DPR A;  1VD2 A;  1Z5S B;  3SU8 X;  2MSE D;  3EFU A;  4GSW A;  4HCP B;  2MBH A;  2IO0 B;  5EDS A;  2K6D B;  2IZV B;  1WF9 A;  2UWQ A;  4TV3 A;  3HK0 A;  2MBQ A;  3HIZ A;  2J0M A;  3NHE B;  3QK0 A;  3DBL I;  4B9K A;  3APC A;  1UGM A;  1WGY A;  3EHV A;  2KC2 A;  1OQY A;  1UH6 A;  1V5T A;  3VTU A;  3ZIM A;  3U7D A;  2PE9 A;  2QHO A;  3D32 A;  1HE8 A;  2GBM A;  4HDO A;  3KYD D;  3PRZ A;  3RZW C;  3S2A A;  1WIA A;  5LXI B;  2JVC A;  4PYU A;  3SDL C;  2LRW A;  3VHT C;  2BKF A;  2GOW A;  1R4M I;  2JY6 A;  4M0W B;  4II2 B;  1A5R A;  2MCN B;  3ZNH B;  2JZ3 B;  3IG3 A;  2OOB B;  3ZO5 B;  2N1V A;  4URK A;  4IW0 A;  1KOT A;  4NNJ B;  2KMC A;  2BWF A;  1J8C A;  2KXJ A;  3A4R A;  2JT4 B;  2M0X A;  5D2M B;  5IAA C;  1V81 A;  4W9I A;  3QC8 B;  2N9E B;  4FUL A;  1WE7 A;  2DAF A;  2WX1 A;  1WX8 A;  1WY8 A;  2CHZ A;  2K25 A;  4HCN B;  2M4N A;  5JHB A;  1WM3 A;  1WR1 A;  3AI5 A;  3GZN I;  2G3Q B;  5JHA A;  1S3S G;  1LFD A;  4CHK A;  2L8J A;  2DZK A;  2RSU A;  3A9K B;  3ZNI D;  2V3S A;  1R4N I;  1NBF C;  4JIO U;  4KIK B;  5DPS A;  1OTR B;  1UBI A;  3M63 B;  3R7R A;  3WAP A;  3KW5 B;  1WI0 A;  5LXH A;  1OEY A;  4RM8 A;  5CHW A;  2MLB A;  4K1R B;  3Q3J A;  4GB9 A;  5GMV A;  1TTN A;  4NY0 A;  4ZRI A;  2KJ6 A;  2KN5 A;  2OJR A;  2KDB A;  3L08 A;  4FJY A;  4NAW B;  4IWP A;  5IA7 A;  2JF5 A;  3OJ3 A;  3PT2 B;  1LXD A;  2WX0 A;  3T8M A;  3KUZ A;  3RYT A;  3VUY A;  1V2Y A;  1M94 A;  4B6W A;  4DHZ E;  3OAW A;  1Q1O A;  2XEW A;  2NBU A;  3LJ3 A;  2KK8 A;  4GDL A;  3VXW A;  2I1K A;  3APD A;  1Z2M A;  2LGX A;  3QCA A;  5DCN A;  4NJ6 A;  2LXC A;  2KAN A;  1J19 A;  3L17 A;  4HDQ A;  1Y8R C;  1P98 A;  4G3X B;  1KJT A;  1Q5W B;  3SHQ A;  5CX3 A;  2KFK A;  3PRM B;  2KC1 A;  4GDK A;  2MBB B;  3A33 B;  5CTR C;  3ZKJ C;  1TZ1 A;  2L0T A;  2N7E A;  3NY5 A;  4PS7 A;  2BYE A;  2K6Q A;  3WA0 A;  4DBG A;  4GMV A;  3VVW B;  1OGW A;  4N9F 4;  1E7V A;  1IPG A;  4HPM B;  1WXS A;  3RD2 A;  4BBN F;  4BKG A;  3VTW A;  2Y5B B;  2R2O A;  2ZCB A;  2IBI B;  3L10 B;  5CHV C;  2Z0E B;  2LAS A;  4M8N A;  3ZDT A;  4NPN A;  3PGE A;  4WAA A;  1Q0W B;  1D3Z A;  2PJH A;  2KOX A;  2G4S A;  4I6L B;  3HM6 X;  4AJW A;  3ZNG C;  2DYB A;  4DDG D;  5J18 A;  2HJ8 A;  3PVL A;  1YX5 B;  1GC7 A;  2LUE A;  3DVN U;  1EUV B;  2J0K A;  2K8C A;  1XT9 B;  3OJ4 B;  3P2B A;  4IUM B;  4MSQ B;  2O6V B;  1BT0 A;  4MJS A;  1UD7 A;  2KVR A;  2KLC A;  4BFR A;  2NPT B;  2MBO A;  4BVU C;  4ZYN A;  1XQQ A;  2I1J A;  2L76 A;  4W9J A;  1F9J A;  3L0W B;  3PPA A;  3PS6 A;  2DX5 B;  3QIJ A;  4GN1 A;  4WWN A;  3IHP C;  3V62 A;  5E6P A;  1P9D U;  4HVB A;  1WZ3 A;  2LGY A;  2JZZ A;  4BOZ B;  2KZR A;  2ZVN A;  2AYO B;  2L00 B;  2IO1 B;  1P0R A;  3VQI A;  3EC8 A;  2O6V A;  4PS3 A;  3IFW B;  4BKS A;  3QJZ A;  2RGF A;  1FXT B;  4FJV B;  3B1L X;  4IWO A;  2G4D B;  3DPD A;  3H9D A;  4GOC A;  4ICU A;  2FCM A;  2ZZP B;  3V61 A;  1E5W A;  1C3T A;  3QAR A;  2MW5 A;  4IM3 A;  4MGI E;  2FCS A;  2NVU I;  3RZF A;  4AP4 C;  2EMT A;  3DQV A;  4PS8 A;  2O6V D;  2IO3 B;  4MEM A;  3RUL A;  2JPH A;  4BKS D;  1ZGU B;  1E8W A;  5CHF A;  2KO3 A;  1WE6 A;  5JZE B;  3TMP B;  3VTV A;  3HHM A;  3CF6 E;  4DDI D;  4JLC A;  3UIN B;  2RD0 A;  2KHW B;  2M1M A;  2KWV B;  2BKR B;  5HKH A;  1E8Z A;  2C60 A;  3A1Q B;  5J17 A;  2D3G A;  5L95 C;  2KX0 A;  4EZK A;  3WAM A;  3QX1 A;  3W1Y A;  1V6E A;  1WM2 A;  2AEH A;  3LDZ E;  2JWZ A;  3L16 A;  3IVF A;  4E71 A;  3ML8 A;  2MQJ A;  4IM0 A;  3TL5 A;  4IWQ A;  3ZTC A;  1WZ0 A;  4HXD A;  4W9K A;  2JRH A;  2V1Y A;  1ISN A;  3H6N A;  1ZW7 A;  4WJP A;  3A1Q A;  1RFA A;  1WJN A;  1WXA A;  3VDZ A;  3NZS A;  3H7S A;  3WAO A;  2J0J A;  3DVN V;  3QHT A;  5BO4 B;  4GGQ A;  5JH5 C;  1P3Q U;  4W9G A;  2ZNV B;  1X1M A;  2LRU A;  2NR2 A;  4A3P A;  4GDL B;  3DCG A;  4TQ1 A;  4G11 A;  2PPH A;  5AZH A;  2KQ7 A;  3BIN A;  4EZJ A;  4W9L A;  2IY1 B;  5KHO A;  4LCD E;  3ZRF A;  3ENE A;  4MDK E;  2KWU B;  4GIV A;  2BPS A;  2KMA A;  4E74 A;  4K7W A;  3ZDM C;  1GUA B;  2KFK B;  4GDK B;  2L7R A;  3KYC D;  2FIF A;  4F7Z A;  2A4Z A;  2L0F A;  2JUO A;  2K39 A;  3OLM D;  4G0N B;  4AJY B;  1IYF A;  3PHW B;  2MX2 A;  4KVG B;  1NDD A;  3UIP B;  5J2R A;  1I42 A;  1WGG A;  2N9P C;  4CYE A;  2FUH B;  2IY0 B;  3I3T B;  4MGZ E;  2G45 B;  3RCZ A;  2CHX A;  1NI2 A;  2AL3 A;  3B0A A;  2LGD A;  2M8S A;  3N3K B;  1GC6 A;  2KNB A;  2NBV B;  3KVF B;  4MM3 A;  1SGH A;  4AOF A;  3R66 C;  2HE7 A;  2W9N A;  5AZF A;  3UQB A;  1J0G A;  2C7M B;  2CR5 A;  2K8B A;  1E8X A;  4OVU A;  5D7G A;  3WAN A;  3L13 A;  5L83 A;  2C5L C;  2BF8 B;  3KH0 A;  4DK5 A;  3N30 A;  4LDT D;  3ZVV A;  1VCB A;  1YJ1 A;  4E3C A;  4TKN A;  2CU1 A;  1JRU A;  3T9L A;  2EMS A;  3PTF C;  2FAZ A;  2N4F A;  4WJO A;  2LZ6 A;  5G55 A;  4JQW C;  4NQL B;  2PEA A;  2O2V B;  2NBW B;  4B95 A;  2ZPN A;  4ZRJ A;  2D10 A;  4BBN C;  4HJK A;  4MJS B;  4RMA A;  3X0W A;  3TBL D;  3EEC A;  2BWE S;  3JYU A;  2KX3 A;  4ANW A;  2K8H A;  1GJZ A;  1LQB A;  1XD3 B;  1WXM A;  2GBN A;  1V9J A;  1WFY A;  2DYO A;  3ZUN A;  2N7D A;  4GXB A;  1WJU A;  3PLV A;  2KQS A;  3Q3F A;  4ANX A;  1UEL A;  3MTN B;  1P1A A;  3K9P B;  1CMX B;  3PZD A;  3QA8 A;  1WYW B;  1RAX A;  3JSV B;  4FN2 A;  4WQO B;  1MG8 A;  2KJH B;  3NZU A;  2XK5 A;  2FNJ B;  1EF5 A;  3PHX B;  1WXV A;  2O2V A;  2N1W A;  4I6N B;  1YQB A;  5D6J B;  4WWO A;  2BYV E;  2WYQ A;  3VAW A;  3UIO B;  2DZM A;  3H7P B;  2EKE C;  4J6I A;  4EUT A;  1T0Y A;  2C7N B;  3CMM B;  4MSM B;  3A4S C;  4KSK C;  3H1U A;  4MH0 E;  2HTH A;  4K7U A;  1KM7 A;  3W1S A;  3DBR I;  3N32 A;  1RRB A;  2PE6 B;  2ZVO A;  3JSV A;  1E8Y A;  2LWP A;  3DVG X;  2AWT A;  4W9H A;  3GOE A;  3AXC A;  3ECI A;  3ZNZ B;  3CSF A;  2KKC A;  3H7P A;  3ALB A;  2IO2 B;  4NJ7 A;  2D07 B;  4WJN A;  4ICV A;  1YD8 U;  5AZG A;  4TUU A;  4K7S A;  2REX A;  3RT3 B;  2D2Q A;  2KTR A;  2VRR B;  2D11 A;  1WX7 A;  2N9X A;  4DXA B;  2MP2 A;  4KZC A;  5C1Z A;  1EF1 A;  3TJP A;  4ASW C;  1WGD A;  1WH3 A;  4FLH A;  2FCQ A;  2JXX A;  5LLI A;  2KDF B;  3APF A;  1OEY J;  4HLE A;  3QQ8 B;  4W9F A;  2KDE B;  2CS4 A;  3M95 A;  4HWI B;  2Z0D B;  2KWC A;  2XBB C;  3M62 B;  2GMI C;  3UGB B;  1SIF A;  3WAL A;  1GNU A;  2LJ5 A;  1EO6 A;  4WWP A;  1WX9 A;  4HK2 A;  3DDC B;  3QAQ A;  2A5U A;  1E7U A;  4MGK E;  1H8C A;  4PYZ A;  1ZKH A;  2R2Q A;  3TCA A;  2LVQ A;  1V5O A;  5E6O A;  3VH3 B;  5KHQ A;  3MHS D;  5TR5 A;  3RUI B;  4EZL A;  4A20 A;  4II3 B;  3QWZ B;  4KDI C;  4FA6 A;  3DOW A;  3M3J A;  5FR6 A;  2K1F A;  2RR9 A;  3V6E B;  4AWJ A;  5D94 A;  4FBJ B;  2ZEQ A;  2ZNV C;  3PLU A;  5E6N A;  5C23 A;  1L7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...