1DYQA

Staphylococcal enterotoxin a mutant vaccine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
228
structure length
228
Chain Sequence
EINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFRQHTILFKGFFTDHSWYNDLLVRFDSKDIVDKYKGKKVDLYGAYAGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Abrogated Binding between Staphylococcal Enterotoxin a Superantigen Vaccine and Mhc-II?
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Enterotoxin
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN A MUTANT
total genus 74
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2000-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dyqA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1dyqA02
1S5ED 1ESFA 1PRTC 3BVMA 1YN4A 1CQVA 1LTRD 1EEFD 1I4HA 1LTSD 1PRTD 5ELCA 1PZJD 1ENFA 1SJED 1SE2A 3R2TA 4RGMA 1FNUA 1DYQA 1JCKB 1TS5A 1KLGD 3V05A 1T5XD 1GOZA 4UDUC 1SE3A 1JQYD 2RDGA 1KLUD 1B44D 1D5XC 1TS2A 1EEID 3BYYB 5ELFA 3O13A 5I4DA 2NTTA 1XXGA 1G8ZD 2AQ2B 2CHBD 4O1NA 1EFID 3TSSA 1I4PA 1AW7A 1JWSD 1HTLD 4OHJA 4DXFA 3CHBD 3EFXD 1RF2D 1QILA 2XNAC 2ICIA 5TSSA 1LTGD 2IJ0A 2G9HD 4RHRA 3OWEB 1EU4A 3URYA 3EA6A 4RGOS 2QEJC 4RFBA 2XRSD 1TY0A 1RCVD 1LT5D 1LT4D 1B1ZA 1CHPD 1RDPD 4L6TB 5ELDA 1YN3A 1SE4A 2WV6D 4K6LA 4BWGB 3DWPA 1CK1A 1JR0D 2RDHA 1F77A 1FGBD 3SEBA 1L0XB 1EWCA 1S5CD 1PTOF 1D5MC 1I4GA 1BCPC 1PTOH 1D6EC 4ZYSA 1HQRD 1PTOC 5FK9C 1V1PA 1HA5A 1PTOD 1LO5D 1ET6A 1BCPD 1PZID 1UUPA 4RGNA 1EU3A 4DXGA 1D5ZC 3W2DA 1KTKA 1TY2A 1LTAD 2AQ3B 2SEBD 3MFGA 4L63B 1UNSA 1YN5A 2J4XA 1BXTA 4TSSA 1RD9D 1LTTD 1L0YB 3GP7A 1TS3A 1PRTB 1SJHD 1V1OA 1SEBD 2TSSA 3KLSX 4RH6A 5D3DA 1FNWA 5ELEA 1V1PB 3DWQA 3R2IA 1DJRD 1I4QA 1LTID 1SBBB 2XN9C 1M4VA 1SXTA 1TS4A 1BCPF 1BCPB 4RHSA 2AQ1B 1PTOB 1PYWD 1LT6D 1AN8A 3BYTB 2QILA 1I4RA 1LT3D 1FD7D 2NTSA 2XRQD 4Z9CB 1JWUD 1CT1D 3BZDB 1ET9A 1XTCD 1LTBD 1S5BD 1FNVA 1S5FD 1STEA 2O2LD 5D3IB 3BVGA 3BVZA 3R8BA 1PZKD 1JWMD 4NZLB 1I4XA 2Z8LA 2IPKD 2R61A 3MC0B 1LLRD 4RCOA 1S5DD 3DWAA 5ELBA 1CHQD 4C56C 1HXYD 1PRTF 1MD2D 5FKAC 4RGTA
chains in the Genus database with same CATH superfamily
1WI0A 4BY1B 3ZJYC 2WX1A 2NVYH 2GN5A 3SD5A 5CMDA 1EEFD 3P75A 3DHIC 3PREA 3Q22A 2WHIA 2KFKB 1A15A 1EOTA 3DCGA 1L5PA 4KX6B 2V4IB 4IUVA 4JX1C 4GOPC 5BYRA 1FNUA 2HDLA 4I7ZC 1M1KC 1UGJA 1WZ3A 3VYRA 4A3BB 1WYWB 1TWFH 2VH1A 4EEWA 5J3BA 1UGMA 2F0PA 2HQEA 4A3DH 2D3AA 1U4RA 2XSCA 4K1RB 4YSYB 1R9TH 3N6RA 2CKHB 4ASWC 2GOWA 4YL8A 1EFWA 1NR4A 2N1VA 3PV1A 1HNXL 3S2HB 1TT2A 2C5CA 3HRZC 3OAWA 4KZ0A 4HKQA 1HTLD 4AUQC 3EFXD 4IFDI 3FILA 3DHQA 1UD7A 2DJGC 3I57A 3VH3B 4Y7NH 1WXQA 1IW7D 4NNJB 2L5TA 5C4HA 2OJWA 1FL0A 3OWEB 2KAJA 3NUCA 2K0PA 1ZGUB 5EBDA 1WXAA 4RGOS 3N1ZC 4OZBA 1Y8RC 2Q5WD 4JI4L 2K39A 4IJLA 2Q8TA 2GBMA 3PGZA 4JI6L 5I9PA 4BBSG 4A3GG 2O4XA 5ELDA 4A3GB 1OQQA 2I1JA 2KX3A 3OLMD 4G57A 4XWTA 1KRSA 3DWPA 5C3EH 1N34L 4EVOA 1YITA 4B3ML 4NAWA 5LLIA 4K3BA 3F1ZA 2YLMA 1EWCA 2B2TA 1R4MB 2L3ZA 4CDEC 4EQPA 3GTJB 5CORA 1PA6A 3I7FA 4II3B 3QK0A 1LXDA 1EU3A 5AJ3Q 1ROEA 2J7ZA 1K9MC 2ON8A 5CHVC 3TJPA 2OXPA 4Y52H 3I4MH 2H89B 3VDYA 1UE7A 2MGSA 2K14A 4DR1L 1WE6A 1KC8C 2O2VB 1PFDA 1EF1A 3FVQA 2V9HA 4AJYB 4GN5A 3V60A 3QIJA 4LTUA 2MJ3A 2GMIC 2HE7A 2KWVB 3WOEA 2Z4HA 5A2QE 1GM5A 2W9NA 1PYBA 2SNMA 2KQ3A 2R7ZH 1TT5B 2K5PA 1XMOQ 3NUHB 4FA6A 3ZVVA 1CKOA 3L54A 3Q3FA 2OEOA 4YY3Q 3MC8A 1NUCA 1SNCA 1AZQA 1IZ6A 3M4OH 2CKZB 1OO9B 2RSOA 2PPBC 4JI1L 3B08A 1JWUD 5JOBA 3S16H 2ZEQA 1LTBD 1V97A 4J1MA 3R93A 1C4CA 2RD0A 1E8WA 3KJPA 2N9PC 2ENBA 4KTAA 1FGUA 1PH2A 3N30A 4X64L 3HOXH 3L16A 1HQMC 1NBFC 2MO0A 2JSOA 5HURA 4XQQA 2QIEB 3OW2A 4US8A 1CHQD 4XYCA 1X3QA 3H7SA 3UDXA 1K8RB 4DQOC 4ILWA 4UP8A 3FDTA 1OTRB 3L0OA 1C48A 1NENB 1PRTC 3HFZB 2RHSB 1WRIA 1CM9A 3HVDA 4DUZL 3HKZE 1SJED 1EO6A 1GUTA 4BBNC 3PTFC 2B2YC 1PHJA 4KHPQ 2DAFA 3E0EA 3I4NH 2PPHA 3QWZB 5AEKB 1Y1VH 4B3TL 1WTHA 4KZCA 1GKHA 1G2SA 1HFGA 4OELB 4EQ5A 4A3FH 3GTLB 4KY7A 2HCIA 1WTQA 2JYEA 4JQWC 1V80A 1NYRA 2EZVA 3QJZA 1D5XC 4M01A 3V6EB 2D0OA 3O13A 2K1BA 2BBCA 2WYQA 3CC4A 3R66C 4KHVA 1NMFA 2BB6A 3KH0A 4ANWA 1WXMA 1EFID 3HOWH 1WH3A 4RF0A 1J7BA 2OCEA 4C2MB 4LNIA 4A3CG 1KF6B 1Z47A 2R93B 3P4QB 2WXFA 2EJMA 1DGJA 2H88B 3EN2A 3HP3A 1D7QA 1SB3C 2IWHA 4CDFC 1L1OA 2ZCBA 1L0WA 1SSNA 2EY1A 5C0XG 2XRSD 2JF5A 1AWDA 4A3EG 1EY6A 4W9CA 1TKWB 2OQKA 1GD7A 1PFMA 1TU2B 2BH8A 4A4IA 3S1MH 1GNUA 2OJRA 2WINB 1GUWA 2NVXH 1EL0A 1JR0D 1Z9FA 1F77A 1E24A 1Q81C 1BDOA 2QCZA 1PDQA 4N59A 1SE9A 2DHZA 3UQBA 4A3IB 1J7AA 3UDIA 2PW9A 1PGAA 2X6GA 1PTOC 5FO9B 2XWBB 2Q2UA 4DR4Q 5KGUA 1XMOL 2N49A 1N33Q 4QUFA 2A68D 3CAMA 3NBHA 3RZOB 1EY8A 2LMCA 3UI3A 1QB5D 5EQ0A 5I2YA 5M5WH 4IUNA 1P1AA 2C35B 4APVA 4RNAA 1PRTB 2VZAA 5TR5A 1J6QA 2IY1B 2TSSA 1I50B 3BDLA 1VQ8A 3QJYA 2CHZA 2RGFA 3OWFA 4MNOA 3NWTA 2MW5A 1EYCA 4LUVA 1HFNA 4A76A 2UUBQ 2KHWB 3Q3NC 2K5VA 3KWVA 2V0GA 1KH0A 4POFA 1AP0A 4MGZE 5AZHA 1S72A 2AEHA 4IM2A 1EIFA 3Q8CA 1A8VA 4JBKA 1PH4A 1BMLC 3GDEA 3A33B 4LMQD 2K5WA 1TZOA 2GBNA 3HOVG 4HSPA 3HOXG 4B3RL 3HOXB 4KGRA 1BVSA 2WNMA 4DV5L 2G1EA 2JA5G 3GOEA 5G55A 4ANXA 4E6IA 2PQAA 3DUZA 5EAYA 1UE5A 5L95C 5ELNA 4IOIE 3GTQB 1R4QB 2NN6H 4MSMB 3SU8X 1EQVA 3C1FA 1JC7A 1FNVA 3IRBA 3N32A 1QNUA 2K5QA 3DVGY 3AEAB 3F2CA 1WF9A 1K8OA 3JAMc 5C23A 1WYDA 1QE6A 1GJZA 4F7XA 3I73A 1Y56A 1VS0A 3BDCA 1L7YA 1PH5A 3TMPB 2ZW1A 2Z1CA 4YHHQ 2XK5B 4BBRG 3KF8B 3SK6A 2XVSA 3L17A 2QCPX 3JSVB 1ENFA 2NBWB 2NUCA 1MVKA 1LQBA 2WKCA 2ATWA 4JG2A 5KIXA 2D9UA 1JCKB 1ZKHA 3NPPA 3OMGA 4YSXB 1M8AA 2EPBA 4FJVB 2PQAB 3LWUA 5BMIA 2L12A 4IUMB 5IGFA 3NJTA 3R3OA 2QEXA 2R93H 2RDGA 1CA5A 5JPNC 1FIQA 1V1QA 2Z9HA 4ULLA 3GTPB 2DY7A 1XXGA 3GO5A 1G8ZD 2A5UA 2I38A 2PJHA 5IAAC 3K5OA 3GQBA 2F1MA 4MTNA 2UXBL 1WM3A 1NE3A 1C4AA 5HG2A 1UE1A 2EY5A 1RF2D 4KN4C 4F88A 5I9OA 5FLXL 4BXXH 1GC6A 2FUG1 4FXCA 3SR6A 2L32A 5D14A 1B2TA 2F0OA 4DHJD 2MSED 1IPGA 2DAJA 4ZRPA 1WYGA 2QJLA 2QEJC 2L0TA 1B9NA 4YY3L 5IY0A 2NBFA 1LT5D 1QCBD 1P9DU 2Q8IB 2FMMA 4LFAL 4L6TB 1SNPA 3ERSX 5J1ZA 5FJ8G 2MBHA 2ZZPB 5DLQE 2BS3B 4KDIC 3HKZB 4PYUA 4XE0A 5D2MB 1Q46A 2R7FA 3K81C 3VA5A 2L1AA 3IAS1 4HTHA 3F8TA 4KKUA 3FC4A 3L7ZC 1PTOF 3OHXC 4POGA 1KRTA 4K0KL 1V8CA 2EDGA 1TWFB 2PI2E 4PV1C 4K14A 5FK9C 1C8CA 1HA5A 1BBXC 1WGGA 3ZKJC 1OXTA 1U4MA 1WR1A 2YU9B 4FLHA 5AJ3L 3I3CA 4DU9A 1TY2A 5C4ZA 1LTAD 1R9TB 4K5XA 5BR8Q 4DR3L 1E5WA 1FVIA 1WJJA 4TSSA 4XC2A 3D6CA 1JWAD 2H4OA 4LJOB 4W9HA 2QKIC 4A3BH 2E5LQ 5FR6A 1YIWA 2KLCA 1CJEA 1WX7A 3M85A 3PRPB 2B39A 1K8GA 4A93G 1NCVA 3ULJA 3TS0A 4A3LH 1SXTA 1H4RA 4DK5A 4GNXB 4TQUS 4K5VA 1ILQA 5D7GA 3ZDTA 5EDSA 1BCPB 4FP5D 3ENEA 4RHSA 2I1KA 3TIXA 1LT6D 1U4PA 4DWFA 2K6DB 2L11A 2UXBQ 1AN8A 2JA5B 2KOLA 4JWUC 2NTSA 2AUKA 5CV6A 1N61A 3GZNI 3ZRCA 2INDC 2D62A 4WWMA 3BZDB 5FLXc 2UYZB 3UIPB 1ET9A 3KF6B 3DBLB 2YTXA 3HOYG 5I6YA 2QHOA 1ONLA 3QC8B 2KQ4X 1F9JA 5JZEB 2JXTA 5HY6A 3PZ8A 3AEEB 1ICWA 3ONAB 1HNXQ 2R7ZG 3NSWA 1YJNA 3M7GA 1FRRA 1ZDXA 3CWIA 4K81A 5AZGA 2M56B 1Y14B 1D1IA 1ZXTA 2L0FA 2XTIA 3JAMi 2V4LA 4E74A 2CQOA 3H0GH 2F4VQ 5BN5A 1HUNA 4KKTA 2EMSA 1WJNA 4CJ1B 2KK8A 4ALPA 2E2JB 2AWTA 1UWVA 2EY6A 4H2AA 2EYPA 2NPTA 4HR7B 3EFUA 5M5XH 1MBYA 4OZAA 2NZ1D 5IT9L 2X38A 1SN8A 3QB3A 3S17B 4LNKA 3D3RA 1WY8A 3IFWB 3HOYB 1A3TA 4C3IG 2VQEL 4JV5L 4M00A 4X65L 3NP8A 2A5HA 4UP9A 1P7EA 4GU2A 4U68A 1H9SB 5ELFA 4F8MA 1B50A 1V5TA 1MPEA 2HT1A 4WAAA 1Y1WB 1W2BA 1KFYB 4WIPA 5G3LF 3APFA 3IAM1 4DV5Q 2WXPA 2BDOA 2BPSA 1BNZA 4OHJA 3AE9B 2VB2X 5EKIA 2BQQA 2MLBA 3ZTCA 4BY1H 2DNFA 4BS9A 4KGSA 2N88A 1NSNS 4N8X1 1LTGD 5A2QL 2Q2IA 3UINB 5FOBB 3G6EA 1F9PA 4C3JH 1GHKA 2IO0B 3HKSA 1EQTA 4RFBA 3KVFB 1IYUA 3TP8A 3K5MA 3DVGX 2F3WA 2FAZA 2ZVNA 1HZCA 1KABA 1U9RA 2L1BA 2RDFA 2MBBB 2UWQA 2N0SB 3STBD 3AV8A 4A3KB 4GN1A 4B0EA 3LB8C 4OVZA 1FYCA 4Q0FA 3CD6A 1UWXA 1PDXA 4G3XB 4HJGE 1FGBD 3S2AA 2OTLA 5KEEA 3V3XA 2QDBA 3D31A 3GTQH 4P75A 1N33L 3SK4A 2JVCA 4JIOU 4DN4M 4G4KA 4J15A 4HWIB 2D2QA 1D6EC 5LMNW 1Z2MA 4WQOB 4YTPB 4ZDVA 1BCPD 5CV8A 4CDDC 1CSQA 4DXGA 1D5ZC 3CQZB 3DBRI 1XLPA 3VH4B 4A3FG 3N1XC 2SEBD 1WX8A 2KVZA 3VDZA 2UU7A 3T4AC 1QZEA 2JQRB 1A6XA 2BB5A 4N9F4 4DPGA 3OTOQ 1LYLA 2JZ3B 1DOIA 3V61A 4Q5VA 2CQAA 1E2ZA 3AEDB 3R2IA 5IP7G 1ZXHA 1I4QA 2JU6X 2YV5A 3FAHA 2D5DA 2UU9L 1V43A 1A63A 3D4DA 2CJNA 4R3DA 2A19A 4M0WB 1TWCH 2M9VA 1TVXA 4R1JA 2F0TA 1VCBA 2ALYB 3Q6BA 1NNXA 4H44C 3J7YW 1NBWA 1YNND 1ZYRC 1SYFA 2L83A 4LFBQ 1DONA 5C0XJ 1LABA 3OPOA 3J7ZC 2KC2A 2ZNVB 2M00A 3EJIA 2LGDA 3RYTA 3STBC 4AIMA 1XTCD 1G6ZA 2KVRA 4Q2JA 3T8MA 3AMZA 3FKIB 3I56A 3KFUA 4XYQA 4B9WA 2L52A 3DWGC 4MM3B 2CU3A 2A6HD 4IKGA 1VQNA 3RN5A 5IGDA 4JI2Q 3CCJA 1IKMA 1KIXA 1AYFA 3TBLD 1GAQB 3OIPA 1K51A 2R61A 3I63C 3ND8A 2F0HA 2WXGA 4LF7Q 3CCRA 4A3IG 3ICEA 1SF0A 4IOAA 1EZ8A 4HCSA 3N20C 1I94L 1B8AA 3E9HA 1XYIA 4DR7Q 2EYLA 2JXXA 3P1HA 3RR5A 2NVTB 1Y8NB 4DV7L 1EWYC 2K8HA 3DBLI 3KLSA 2ZJDA 4LJZC 1VLBA 2KTRB 1IW7C 1CQVA 2MJDA 4AS1A 3AXCA 2AX5A 4W9EA 4RAUC 2CVRA 1Q0WB 1SE2A 4RMAA 5IYCG 2Z6KC 2GRIA 3GTGB 4C3IB 2QMTA 4GDLB 2N7DA 1EUJA 4M02A 1TS5A 3KOJA 1L1OB 3NXWA 2ZM6Q 3CCQA 1YNTE 1EY9A 5ELOA 4JI2L 5IGCA 2NVTH 2DZKA 2J0JA 1YNJD 2KHJA 4X62L 3DDCB 3W9CB 2AWNA 1C9FA 4BA2I 1KAAA 4C3HB 4MGKE 1B44D 1VQ5A 2CS4A 2JRHA 2WDQB 3MAQA 1Q82C 1JJ2A 2RA4A 1XO3A 3RFZB 5C44G 5LMUQ 4YXDB 1VR9A 4DUZQ 4O1NA 1Q8KA 3RNEC 3J81E 2KVMA 5IYBG 5IKCM 1A2TA 4EE2A 2EYMA 2LD9A 2R6GA 3L13A 3IFTA 3SHQA 4LF9Q 1HUMA 5H92C 4ZK9B 3Q23A 4B3RQ 1X32A 2EOTA 2OF1A 3C2PA 1FFUA 3IT6B 2IZVB 2PE6B 2K7VA 1RYJA 1RCVD 2TMPA 1XNQQ 4EUTA 3AU4A 2F4VL 2IHFA 2WDRB 1C0AA 3DEPA 1WXSA 1RFAA 4AJWA 1K53A 2N1WA 3UF8A 4NPSA 2DYBA 2PNHA 3A7AB 3KBXA 1TTNA 1VQ6A 1PLFA 1WFQA 3NVVA 2CH4W 2WXNA 2W3SA 1S5CD 3CRKC 1YZ6A 1R4NB 3NBIA 3M63B 3A1QA 1BUVT 3VR4A 4US9A 3BK2A 1F9RA 2VY3A 1C79A 1X3PA 2QF7A 2MHVA 5GADC 5GAGC 1UNSA 1G291 2FHTA 1YN5A 2JA6H 2YTVA 5JEAG 2N9KA 3PO3H 1HTQA 4XTCS 1I50H 2WP8J 2UUCQ 1UH6A 2WQYB 4A3JB 4A3MG 2N9EB 3K5NA 1STGA 2KMCA 5COYA 1XWEA 4IPDA 4XDCA 1SBBB 1GJXA 2ICEC 2BYTA 2XK5A 1M4VA 1JALA 2MFIA 1F0ZA 2BYEA 3W1SA 2Z6BA 4S3SA 2ZPNA 1C1YB 3CCVA 3T56B 3BZCA 1I4RA 4QF4A 5LL6S 1ILPA 1O80A 2MHJA 4F1SA 1CSPA 4Z9CB 5DNFA 2F0GA 5GQOA 2X8XX 4MM3A 3JAME 4BKGA 1I7HA 5KNDA 1XMQL 1IL2A 2ASQA 4X3SA 3UGBB 5JJLA 2RPVA 4YSZB 3H3VC 3LX0A 5C4XH 1IUEA 5HGTA 4DAMA 3GV3A 2KDEB 1Q5WB 2BA1A 4HJ5A 1I4XA 4A3OA 3WAPA 2Z8LA 4X66L 2LUMA 4A3MB 5C1ZA 2LFNA 1YMHE 3ZXVA 1STNA 4OL7A 1OXSC 3Q24A 4JPBW 1CI3M 3H8HA 2MCNB 1YEZA 4LFAQ 3WA0A 4MZ9A 4X62Q 2WU5B 2VQFL 4DBGA 1PVOA 1ESFA 4DHZB 3NHHA 4A3CH 1L0VB 1D1KA 4DV4Q 4G7OC 1XTDA 4DK6C 4FHJA 2GBKA 2IX3A 4CKBA 1WGRA 4TKOB 1FRDA 4RGMA 3LYYA 1NYQA 2Z0DB 4KVGB 1T0QC 4ZKCB 3EQLC 2PE9A 3S1QB 4A93H 4LAAA 1SRUA 1VQFA 2BE5C 5JAVA 1PUTA 1V9PA 3L9AX 3K7UC 3CF6E 2P5ZX 3IKJA 3VFKA 1KLUD 1TS2A 4P6VF 2E2DC 3BYYB 2ZCCA 4DF7A 1VQCA 2JA8B 3CQZH 2WXRA 4EZJA 2D07B 5IE8A 4NY0A 2F0UA 1JOKA 1QVCA 1G51A 2M8SA 1RHPA 2I5LX 2LXKA 4LF6L 3VUWA 4ARIA 1KDCA 2M0AA 4AYBG 3R7QA 5CBEE 5IWAQ 3L10B 5EE1A 4WURA 3V6CB 1KHIA 2ICIA 5TSSA 1RWSA 4RKLA 5G5HA 1IL8A 5C3EB 3T1HQ 3I4MB 4QMGA 1C3TA 4JPSA 1QJOA 1VQIA 2AWOA 2WAQB 2SAKA 5D6JB 4DV1Q 3K58A 2KO3A 4MELA 5BMHA 4XX5A 1GB1A 2BGFA 2MX2A 2MQHA 1OFFA 3TQYA 2K75A 1IBLL 3TEYA 4DHZE 3KYHC 4RMFA 1UBQA 4IJHA 2R92H 3ZNID 1YQ3B 3ZIMA 4M1UB 3MFYA 3OW7A 1GXDC 2UXCQ 4GS3A 1SNMA 2K50A 4UY8C 1OQRA 2Y0SB 1S4ZA 4P2CB 3KYCD 2R2OA 3QCAA 1HZ6A 3C46A 2K01A 4C3IH 1EUVB 4DDID 3VTWA 4PMWA 3APCA 3ML8A 4S0RA 4W9LA 4NXMQ 4H0LC 3A9JA 3H09A 2DYMA 3C19A 1S3OA 3QO2A 3ULPA 4A3LG 2VH2A 5JH5C 4NQKE 1IBLQ 4HSVA 1L4DB 1CUKA 2GVBA 3UDGA 2M0XA 4RH6A 5ELEA 1E6EB 1NY4A 2NVYB 4KI0A 3A9KA 4H13C 2MUYA 1LV9A 1K3RA 2V3NA 4FDBA 2M2LA 3MXUA 1K8AC 3K59A 3UI2A 4BZAA 3QWNA 1N9WA 1YHQA 2E2HH 2JN4A 2CFMA 1K28A 3I2ZA 1XJVA 2JA6G 3UE1A 1H95A 1P0RA 1YJ1A 3ZUNA 1JE5A 1HJPA 4BBSH 2WB1B 1HNZL 1E8YA 3CW2C 2HTHA 2RKSA 4TV3A 4LF5Q 4W9DA 4JI8Q 5FO8B 2O5JC 1YVCA 1MKHA 2K5DA 4JI0Q 3OOCA 2GVAA 3NQTA 1U5KA 1H9KA 1MJCA 3GTKH 4HLEA 2EMTA 1AFPA 2IDYA 3K6OA 1XQQA 1SYBA 1JWMD 4DV3L 4IUPA 4A3JG 1T6BX 1ESRA 2K6AA 2MPMA 2JYTA 4MJSA 3TEZA 4KJOA 4OIJA 4DAPA 3W5UB 1YD8U 3DWAA 4CDCC 2MNAA 4W9GA 3RLNA 2LRUA 2DBYA 1EIGA 1S5ED 2LS01 1FXAA 1VZ7A 2IO3B 3F2UA 3UQAA 1Z6HA 5GAEC 3CC2A 3U9OA 1GUOA 4N9TA 2B76B 3CCSA 2CU1A 1JE4A 3LJ3A 2VUMH 3ZRFA 4EZLA 4C4VA 3T16A 1SYEA 3HVZA 4W9FA 4P71A 1NI2A 2O2VA 2A69D 4XIGS 4BBNF 3SHLA 1I3QH 3G6JB 3VA7A 4BAXA 5G3LD 5ISRA 1JRUA 3OJ3A 2AL6A 4HPPA 4PK1A 4UPAA 1AH9A 4JOIA 3ECIA 3AE5B 4MIUA 1TGZB 3A74A 2LVOA 4LFCQ 4FXGC 4ITKA 5DM63 2FCMA 2A69C 1X65A 1RM6C 1YBYA 1GUNA 5IYDH 3HOZB 1PGBA 4A8XC 3BINA 4X6AH 2D2CC 5JXVA 1VQ7A 5HFYA 3HK0A 1T5EA 1VCIA 1E10A 2JJQA 3TBIB 3CMMB 3RUIB 3PT2B 4QGUA 3SFDB 2JZPA 3N52A 5J22A 1FXIA 1KNAA 1ZOYB 3TP5A 2Y5PA 1NMGA 3K5LA 4DV3Q 1TKEA 1JMLA 4HPLB 3OYYA 1RKNA 5IA7A 4BY7B 4LF8L 1A0IA 2KJHB 3W1GA 4B08A 2WV6D 1UBIA 1PQSA 3FILB 1DOYA 4GKKQ 4EGVA 1TWAB 2LJIA 4IURA 4J3OD 2FCNA 2ZJRA 5C3WA 4JI5L 2R92B 2WDVB 1XEEA 3CIRB 1UELA 1K52A 3A5UA 3I4MG 2EELA 4IFDJ 3RNFC 1X54A 2MO1A 1C77A 1PTOH 4DA2A 4QAYA 3DM3A 1OGWA 2BT6A 5DPSA 1K50A 3PF5A 2WXKA 3RMKC 4AYBB 2IGDA 4K3CA 1HNWQ 1XCQL 3A5ZB 4YWGG 2E74C 2HIVA 4N8FA 4PZ8A 3VR8B 4E3CA 3J80L 3WIMA 3EC8A 3AE8B 2A73B 1T0SC 2BKFA 4B0MA 2QDLA 1L0YB 4RG1A 3GP7A 2RDBC 4OVVA 2J52A 2FINB 2OT2A 5AUIA 3MXGA 2RVLA 2EYFA 4HJ9A 4EZKA 2JA8H 3RZDH 3WOFA 1BQQT 4NXML 2RCFA 1V5OA 1XX8A 4HDOA 1SR3A 2E2HB 2R92G 2ZT9C 3S1RH 1HCZA 3HOUG 3S1QH 2FIFA 1IP9A 2WXQA 1IBXA 3VXWA 3Q8DA 2GA4B 1KQSA 4KGTA 1PFNA 3P42A 4HPMB 4ZRKA 4G0NB 3P2BA 2A74C 3NVWA 3MHBA 1CT1D 3KK7A 4A3EB 2WXHA 5C0XH 4RM8A 2EJFC 1F1HA 1G6JA 4GN4B 4AQYQ 1S5BD 3RMHA 4DAVA 1JT8A 4A55A 5D3IB 4K2KA 4TQ1A 1VQBA 2JA5H 3HOWB 1VQHA 3D32A 2G5DA 4ME5A 2SOBA 5CV9A 1KD1C 4LUZA 2OEDA 3P4RB 3RZFA 4I6LB 3RN2A 4GKKL 4C00A 4AYBE 4DHJB 3M95A 4JCVE 1JJGA 4DNIA 1C76A 5JHBA 1KOTA 2R3ZA 1I6VC 3KW5B 3PPAA 2CW0D 1E7VA 2W55A 3AN1A 5IWAL 4DR5Q 2LJ5A 4M8NA 4RGTA 3U9SA 2RR9A 4ACFA 1WE7A 4XDDA 5DM73 1LTSD 1EIYB 3TS2A 2GLSA 1PZJD 2KNBA 3NOBA 3HM6X 3JC66 2WWZA 3KDFB 1T0RC 2AHOB 2HIXA 4K8JA 5M3FG 2JZZA 3Q6SA 2NYZD 1OXUA 3KDFA 3NVYA 3TRZA 4A3KG 1WGHA 1CZPA 1EQRA 2RF4A 1Z7TA 2MP1A 4RWSC 2KHIA 1EEID 2O5IC 4XYOA 2LKVA 4U673 1JOQA 2NTTA 3FPPA 2G45B 3D4RA 2VW9A 4FYDA 2ZNVC 4IPHA 1B7YB 1Q7YC 4HMJA 4HMIA 2N3SA 1IKLA 2VQEQ 4JV5Q 4OO1G 2PTLA 4A3IH 5EGTA 1UE6A 2KDBA 3J80c 2G4DB 3CSFA 2VQFQ 2RCNA 1BO0A 3KUPA 3X3NA 4PMBA 1XNRQ 2A4ZA 4YIJA 1VQ4A 1BUIC 2RMMA 1C78A 1HTOA 2I5MX 5IP9G 1AZPA 2PMVA 4AP4C 3RZOH 1JRPA 5HKHA 1YNXA 4ABNA 2MA9B 4REZA 4ZYNA 1TJEA 1LT4D 2DNEA 5E4XA 4PS7A 3K57A 4ICUA 3ZXRA 3ZJTA 4KV6A 2DLBA 4WFN3 1YN3A 2B3AA 2DYOA 1ZUD2 3L4PA 4K6LA 2G4SA 1B70B 4GSWA 3E0JA 4BWGB 4IALA 3RT3B 1KJTA 4I7AA 3NG0A 2NBUA 3VUYA 3TEWA 4ZRIA 3TDQA 1F2RI 4C2MH 1I4GA 3BS1A 1ENAA 1JROA 3ZO5B 1L4ZB 3I72A 4HN7A 1QOFA 4QJFA 3SGIA 4O2DA 4LNQA 4JI0L 2M17A 1MSGA 4HDQA 3OIQA 3J80i 1KDBA 4QY7A 2DZJA 2J0MA 3H6NA 4KDLB 2LEKA 4BBRB 3HOUH 1WR6E 3MFGA 3VRAB 4RKBA 2ZJQA 3TCAA 1Y1VG 1SDFA 2PW5A 3RNUA 2LY7A 4ZCKA 5LHY1 5GAHC 1SJHD 2D5GA 5J17A 2ZXPA 2UUCL 3B2FA 1IYVA 1D8LA 4MGIE 1EY4A 4FVMA 1LUZA 3NZ3A 3MWYW 3U58A 2K03A 2EXDA 1YJJA 2LUEA 2NBVB 5CTRC 3JW0X 3N9YC 3M3JA 4HJKA 3EBEA 4IUUA 2EKEC 2J0KA 3U7DA 3DOWA 4NW2A 5EE0A 2KJ6A 1RRBA 4B3SL 1U0LA 5NUCA 4A20A 3T9LA 1FD7D 2KJXA 3SDZA 3CU7A 3M7NA 4PS8A 1KLVA 1AARA 3KBGA 5JJKA 3TEHB 2GBJA 4C7YA 4WJWA 4C80A 3A7LA 4X65Q 2KHSA 3MXPA 3PIO3 2L15A 4WORA 2J7QB 3VAWA 5M3MG 4RCOA 4OGQC 4R8IA 1B3AA 3H91A 2KCNA 4C56C 1K83H 3PGEA 4EOYA 1E2VA 1EWIA 1YJ9A 3V62A 5IIFA 3PUXA 3E6ZX 5KRUA 4B3TQ 1Q1EA 2QGQA 3MEFA 2JA8G 4J8QA 2C5LC 3PLVA 3NY5A 1PRTD 3I8ZA 3HOZH 2DX5B 5KHQA 3K8AA 4ZRQA 4A3BG 2O6VB 1TXYA 1E3PA 3LWEA 2NVQB 3HHMA 4KMUC 3PO0A 4NPNA 3PO3G 3R3MA 1KLGD 3V05A 4EFOA 3AE6B 1N6ZA 3NS1A 1QOBA 3E9IA 4XT1B 3EUB2 3CXCA 3TL5A 3PSIA 4J6HA 2VNUD 3AB9A 1HHVA 2KEEA 2QDFA 3A1QB 2NB0A 3I4NB 1VJKA 4P74A 4ZUJA 3PO2G 4KIKA 2LASA 4NAWB 1WMHB 4V0BA 3DM1A 3I55A 1I6HB 4FN2A 3AFQA 3LNNA 4DK0A 3CHBD 2K5HA 4DNRB 2ZW0A 3ZJVA 1YX6B 2K4KA 4A3GH 1F9SA 4O42A 2PVOD 2JQOA 2F0JA 4JI1Q 2IT1A 4I65A 5LXHA 1MI0A 1HR0W 1E90A 1PH3A 1EM7A 3VYUA 3VYTA 4OEMB 2KWCA 2LHEA 3QQ8B 3A9JB 5IOIA 3QARA 1CMXB 2LGYA 1Q3LA 4P73A 3MHZA 1RDPD 4CKEA 1XPRA 2MP2B 4Y7NB 2BH2A 2K8BA 3UIOB 2BTEA 1KRHA 2KXJA 1NR2A 1CK1A 5E4WC 2KANA 2MH7A 2JA6B 2WFWA 1V9JA 3ZQ4A 3AEVA 4WWOA 1XCTL 4TRDA 1TWHB 1V1PA 1KL9A 3WAMA 4RGNA 1PZID 2E2IB 4OO1H 4WJOA 4FF2A 1X56A 1MHWC 2DWQA 4DNTB 4BKTA 4MH8A 2ZTCA 1IGCA 2PVGC 4OONA 5JVH3 4HIMA 1VF5C 3OSOA 4C4VB 4H7BA 4R4CA 1LTTD 1R7SA 1EZ6A 4W9KA 3T51B 3A8KE 1QUQA 2INNE 2B2WC 5C3XA 2K8CA 4IWQA 4B3MQ 3S1MB 2F0KA 2L00B 3TUOA 5E6PA 5M5XB 2UXDL 3BU2A 1ZPSA 4P1BC 4IO9A 2I0QA 4DV0L 3SK8A 1HR0L 1TS4A 3WDNA 2N8NA 3CRLC 4XT3B 2H5XA 2KENA 1WJUA 2AQ1B 3P63A 3PSEB 4IC7B 4XZ4A 2WIIB 2SDFA 1FR3A 2AUJD 2B2VC 3TMEA 4JI4Q 4JI7L 2JWUA 4WQMA 5EPLA 2XRQD 4BXXG 3MJ5A 2K1FA 1XT9B 1WCMH 1A70A 4FF1A 4BVUC 1VQOA 1J7CA 4LDTD 3Q3OC 4MACA 1WM2A 2PZTA 2Y5BB 1S5FD 5M3MB 3A8JE 1QZHA 2KZRA 1YI2A 3BVZA 4X3KA 4BOZB 2K22A 4ZRJA 4OO1I 1SYGA 1O7ZA 3RUZA 3WWVA 2ES2A 1PH9A 1IBMQ 4MDKE 1RL2A 1XLQA 1K0RA 1S5DD 3S1RB 3B6YA 3PO2H 1MD2D 1PH8A 3FPUB 5FKAC 2X6LA 2X69A 3HG9A 2BE5D 2WACA 2J0TD 4A3KH 3CKIB 5IP7H 3PCOB 2F0VA 3RZDB 3S24A 4WWNA 2VUMB 1SNDA 1WX9A 5EE3A 4CYEA 2MEKA 3AM9A 3CP0A 4D2KA 3K0XA 2DY8A 1PFBA 2Q2HA 2QW7A 3EFCA 1T5XD 1XF5L 2MRPA 2F0WA 4CJ0B 1SROA 4WRDA 2PKOA 4KIKB 3E3XA 3PF4A 4F8CB 3D8GA 2A1AA 1STAA 2KDIA 2NVUI 3TEXA 4G7HC 2BYFA 1VMCA 3H94A 3AE3B 3S2HH 2I07B 3D0FA 4GOPA 4PYZA 3D6WA 2RQXA 1QKZA 1STYA 1GUGA 1VQJA 4FULA 1ASYA 2JA7B 3T53B 4ME3A 3AMUA 1EU4A 3HOYH 3AU7A 3FKIG 1N63A 4DV7Q 2WXMA 1CZWA 1TY0A 2IX0A 4KN7C 3AH7A 4PS3A 2HUGA 2AYOB 4K6DA 1I3QB 4ZAIA 1VQKA 3X23A 3OJ4B 2NS5A 3WANA 4IUQA 3VRBB 5JPMC 4IM3A 1B9RA 2RDHA 1MGSA 1PH6A 2IW3A 3SEBA 1IBKQ 5BN3A 1E1TA 2KUMA 2WS3B 3Q3MC 2NWGA 1A2UA 2F0LA 1CQFA 4A90A 4N9PA 4XQNA 1PTOD 1NEKB 5IYDG 3KUCB 4OWXB 1H9SA 3MJWA 1E9MA 4CGYB 3W2DA 4B9XA 5K5PA 3IHPC 2EIFA 5C44H 1QVGA 1RIPA 2VS1A 1QOHA 2CCZA 1S1QB 1WTXA 2WU2B 3VHTC 1IBKL 1D4BA 4A3DG 3I3TB 4A3JH 3VTVA 1SAPA 1RLFA 2REXA 3PQIA 1BKBA 5E1FA 3C3LA 2PZUA 1VRAB 2D3GA 3ONSA 5HGQA 1FXTB 3H1UA 1V86A 1A5RA 4GDKA 4KY6A 2YEPF 1YOVB 2RBMA 5KYIA 3ULLA 1U4LA 1O7YA 3RLOA 3W5OA 4WJ4A 5KHOA 4DV6L 4FBJB 4JLCA 1I42A 5CV5A 4L2YA 4TKNA 5MPOA 3APDA 2NVQH 3SE0A 2F4IA 1HZ5A 1TIID 1I6HH 2KCCA 1SMXA 1YJWA 1T0YA 3NTHA 1V6EA 3I90A 1QQRA 4A3DB 2B2UA 1GVPA 4DKAC 2B2VA 3GZNB 5CX3A 1C9OA 1CFMA 2NN6G 1E1OA 4RF1A 3A55A 1MG8A 2VRRB 1WGKA 4OWTB 5M3FH 4DFAA 2D0PA 1VQ9A 1DM0B 4WJ3M 1N32L 1PGXA 2V1YA 3T3NA 1IYFA 2N9LA 4C3HG 1WTOA 3QAQA 5DPWA 2LZ6A 2HDMA 1OEYJ 3K9OB 3AE7B 3BJUA 5JEAH 3EHVA 2FE8A 4PG3A 3W5VB 2FNJB 1H9RA 3S15H 3PV0A 4KKIA 3H0GB 4GLSC 5M5YH 1A3VA 1H9MA 2N7EA 1EY7A 4UDUC 2ZTEA 1M94A 1TWHH 2JSVX 4CHTB 2F0NA 4NB3A 2BVCA 2KTRA 4KD3A 4KD4A 2FBWB 2Z0EB 5I4DA 3HS0C 2PW7A 2VXWA 3FRPB 1QWYA 4QUCA 1DGSA 1PXUA 3QIAA 5C5LA 2MBEA 3ZNZB 3TSSA 1L2FA 1VQMA 3L3OC 3C8YA 3R7RA 3RPFC 2JEAI 1ACCA 3K9PB 3P4SB 4JWSC 5GXGB 4JC0A 2AL3A 2N78A 2IJ0A 1YQBA 1VQPA 4L5SA 2K05A 3G7LA 3G4SA 1EYGA 2EE1A 2E2IH 2DZIA 3ETRA 4WH4A 1F52A 4FXKC 2R2QA 2CR5A 5CHWA 1ZXIA 2BCOA 1MJEA 1Q86C 3AYHB 1WJ4A 2LGIA 2L0CA 2KDFB 2IO1B 5T8IA 1SE4A 2UXDQ 2KFJA 4BY7G 5G5GA 4ZUIA 3SVMA 2NVXB 3Q8AA 4LNOA 1AE2A 4GNXA 2CHWA 1JQ4A 1D5MC 2EYOA 4YTMB 1KM7A 4FJZA 1OXVA 3MVVA 2R93G 4HIKA 1ICFB 4DK1A 1QT9A 1W6KA 3MA2B 4K8IA 1Z5SB 4I6PA 1FJGQ 4A3MH 4LF5L 4R4QA 2AQ3B 5C5MA 1HEZE 3A4SC 2WAQG 1HNZQ 2DGYA 2IBIB 2CHXA 3UE0A 4GDLA 3HEJA 4GLAC 1VDZA 4G7ZC 4A3FB 3M3YH 2B29A 3EGRA 1J5EL 3H3VH 2N4FA 2W82A 2YVCA 4IN3A 5C4XB 3PZDA 1WRDB 5I6WA 3JSVA 3CMEA 1KAWA 3KF8A 2ZTDA 3ERQA 3MZ5A 3DMUA 1II3A 3TP7A 2LXCA 3JYUA 1TWGH 1WFYA 1SYCA 3M4YA 1X6OA 4ZKBB 3TREA 2YYZA 2SNSA 2B2UC 4DV1L 1WD0A 1NJIC 3J81i 3BYTB 2QILA 1MJDA 2INPE 3NELA 2C9OA 3EIVA 3FP9A 1H9JA 3MEHA 3CCUA 1SIFA 3KLWA 2K28A 5C4JH 3Q8EA 1FO4A 1HRJA 1G2TA 4LK1C 1QLBB 1EF5A 2B8FA 2KLGA 5IP9H 2JP1A 2JUOA 1YQ4B 1FD6A 3NENA 2O2LD 4LF6Q 3J7A5 5E6NA 4TVAB 4R8NA 2B3GA 4PNYA 3ZDMC 2QC8A 3ND9A 4NZLB 4OVUA 2PEAA 1B4OA 3SXHA 3T13A 1MG4A 5LL6X 3HOWG 3PHXB 3MC0B 2PCFB 1YIJA 1JJCB 5DCNA 4LF9L 1V8QA 3RNBC 2AKWB 2FFKB 4YCVA 4HRSA 4NMZA 5M5YB 3CPFA 2BS4B 3PUWA 5DPTA 1F2MA 1YHBA 1M90C 1NI3A 2WGSA 4NQLB 4WAFA 3LGJA 2PNRC 1N32Q 4IM0A 1LTRD 3P7JA 3ZNGC 1I4HA 1Y8OB 3MTNB 2EYHA 5ELCA 3S16B 3IVFA 3MXNB 2WB1G 3Q69A 5KNBA 3X3MA 3B0AA 2IGHA 4GN3B 4JYAQ 2KKCA 2XBBC 1YNJC 2F03A 4IW0A 4OWWB 3NTKA 3CPWA 4EQOA 1E7UA 4MH0E 5G2NA 1GOZA 3CMAA 1WJ6A 1SE3A 3A0JA 1Q1BA 2J42A 1NTGA 2ZJPA 3IT4B 2YTYA 3MTSA 3P4PB 3BIID 2JA9A 4X66Q 2WXLA 4RA8A 1V49A 1EYAA 1JORA 1YX5B 3S17H 3OMCA 1WOCA 4QIWE 2WDTB 2Z6KA 1TIFA 1JWSD 4LF4Q 1U4AA 3DQVA 3RD4A 2DZMA 3DBRB 3GE8C 1PV4A 1EQQA 1QOAA 3QG1A 3AFPA 1HA6A 3MHSD 2LVQA 2H1EA 3IG3A 1F9QA 4S17A 3H0GG 3M4QA 3W3AA 3U4ZA 4M8MA 2F52A 5BO4B 5DAUA 3URYA 1WXVA 2D10A 4ANVA 1Q10A 2A6HC 2YEPB 4JOIC 3CF5A 1WIAA 1RJTA 2J53A 2L76A 1CHPD 3DEOA 4XGAB 1D3ZA 5IP4D 3HUIA 2ZVOA 4YT0B 5BR8L 2GB1A 5EJWA 2L9HA 4CQNA 2F0MA 1XLOA 2B63G 4GB9A 3VR3A 3S14B 3VR9B 1C4QA 3Q8BA 1VDVA 5FLMH 4GLXA 2VUMG 4ANUA 3W1SC 1NAPA 1VQLA 3E5SA 2XWJB 1UUPA 3HOZG 3S2DH 4ARCA 3S15B 3ABVB 4IG7B 2B8GA 1KDAA 3S14H 2J4XA 1LACA 3VR6A 4AWJA 1VQAA 1TZ1A 4FJYA 1F2RC 3M3YB 2NPTB 1UEAB 2MBOA 4OW0A 3MXNA 1DJRD 5C4JB 1LFDA 2VZKB 2B2TC 2EVBA 1LTID 2XN9C 3EVQA 3ZYYX 1ZP0B 2M19A 5IT9c 2OHFA 1WTWA 1XLNA 1TWGB 2C9WB 3M9BA 3NZSA 4R9WA 1X1MA 4I6NB 4M0WA 3RNGC 4KKJA 1SSOA 1W3SA 5C6AA 4II2B 4PZ6A 1JWBD 1E7ZA 3AE1B 4ZHPA 4LCDE 4L5TA 1TKGA 4YWKA 4JI5Q 2RHQB 5IOCA 4MSQB 3X0WA 4EX5A 3T1YL 2B2WA 4GGQA 4PT5A 2D3CA 2BDNA 2Y3AA 1N36Q 1CKMA 3NEMA 2DN8A 3FKYA 1E8ZA 2IX1A 5LMNL 3M4OB 5I2XA 3EROA 2IPKD 4X3UA 1IXRA 1Y1WH 1FPYA 4L23A 4ICVA 1C7YA 1A62A 2JWZA 1STHA 2W54A 5ELBA 1PRTF 1XNQL 3DBHI 1C4PA 2ZM6L 3F2DA 3S1NH 3TN2A 1HPCA 1N60A 1YN4A 1SFOB 1Y69U 5DEHA 4MN3A 1VQEA 2ACZB 2E6XA 4W9JA 5CGKA 3J7AV 3QOLA 4J6IA 2BYVE 2EY2A 3RD2A 1FEHA 2KCMA 3J80E 1QG7A 3KUDB 5H8YE 4E71A 4WJQA 2Q2TA 4WWPA 5HI1A 3GTLH 1CA6A 1Q1OA 3CCLA 4X57B 1WTPA 3BWUD 4MHEA 4YWLA 4IZ8A 3E56A 2DUDA 1RTNA 4C3JB 2BS2B 1T9HA 3I9V1 1S3SG 1NVID 2KYWA 5CHFA 2L7RA 2JX5A 5JVG3 1P16A 1DZ1A 2KOXA 1X3FA 4JI7Q 1PMRA 5CV7A 1UEBA 4YCWA 2KMMA 2KT7A 2K32A 5GROA 2KTFA 2KWUB 2Y0SG 4PQXA 2ZXRA 2K5NA 1SIJA 2UUBL 1AEXA 1B3QA 1OXXK 3C1EA 1ML0D 4XQJA 1EIHA 4A3PA 4F87A 4TUUA 4CO7A 4AH6A 4HJ7A 2LMCB 2NN6I 2FCSA 3DBHB 3PRMB 3RZWC 4HXDA 2LVPA 4LUOA 1JB3A 3PUYA 4HCPB 2IYDB 3M4PA 2F0SA 3N3KB 1K8MA 4LF7L 1K0SA 3FHWA 1BBWA 3DPDA 3NVZA 1ZE3D 1RODA 4P72A 2HJ1A 2IO2B 2MWSB 2ID0A 2IY5B 4KSLC 2HQLA 4DR4L 1MHXA 4HCNB 5L83A 2I5HA 2UUAL 4IWOA 4NXNQ 3VR2A 4P1CC 4ZYSA 3U7ZA 5F2DA 1HQRD 4HVBA 1GUSA 3K7AH 1EY0A 2BA0A 1R4MI 3E9SA 1HNWL 3BDOA 1N8RC 5JHAA 5C2TB 4L63B 1TWCB 1X55A 4PZ7A 3TZUA 2GBRA 1DOKA 5CBAE 4HCEA 4HIOA 4GZYC 1UWMA 2D11A 2JPHA 2K33A 1ZKOA 2E5LL 2JA7G 1ZW7A 1SEBD 2N55A 1X9NA 2N7JA 2PLPA 1FNWA 5CV4A 3GS2A 4GXBA 2CWPA 2KFKA 2JXMB 3NE5B 2CJOA 4OX9Q 2WP9B 4HJAA 1J8IA 4ID6A 3GTMH 2NZHA 1IHZA 1B53A 4X3TA 3PIPA 4BOSC 5IO9A 2IHEA 4JBJA 4ZRZA 3NZUA 1PTOB 2WXIA 1O7IA 1Y1WG 1ENCA 1MI2A 1SNQA 4K0KQ 2BWFA 3U8ZA 2HCCA 1G91A 2LXJA 5KNCA 4YCUA 5CC4A 2KCTA 3M62B 2LFIA 4A9AA 4IFDG 5KYLA 2LGXA 1Y8PB 3GTOB 5EBCA 2LXAA 1E22A 1HZ9A 1FMAD 4ZLTF 1SYDA 1LM8B 2K25A 1SE8A 2D3BA 3CC7A 3AI5A 3T3OA 2IY0B 1SFOH 3BVGA 4L8JA 2LRWA 1WGDA 4JBMA 3W1YA 1D2BA 4H02A 1WCMB 2YU9H 5K36G 2HHHL 4EKUA 3SR1A 5IODA 2A6EC 2LGSA 3HRDD 3IFDA 2Q8RE 2M4NA 3QHTA 3Q2AC 4LJPB 4MTKA 3GTKB 2JEBI 3ZLZA 4FNFA 2F3VA 1L6UA 2IGGA 3BVMA 3N1YC 2FIDA 3IXSA 5GMVA 3NTIA 4HK2A 1FFVA 3B1LX 2I46A 4OIKA 3QX1A 4N58A 4XXEA 4HROA 1I5FA 2KX0A 3P20A 3NK9A 4X64Q 2R7DA 1JB7A 1GO3E 1E7PB 2RSNA 2HD3A 5FO7B 3KYDD 2XEWA 2A8VA 1RAXA 4USAA 5C3JB 3Q8FA 3ZGZA 4HIDA 3RULA 1FM0D 1J19A 4WJPA 4B9KA 4DR6Q 1IYJB 1F2YA 3ML9A 4IPGA 2E76C 4C7ZA 1K3BC 2E75C 3DLLA 5FLMG 3Q14C 1P7FA 2DENB 4KLKA 1TR5A 3I4NG 2NR2A 5E6OA 2KEDA 2FMCA 2L05A 3VTUA 2E2JH 5T1GA 4P7IA 5IN7A 4DR2L 2OOBB 3ALBA 4HEDA 3Q0AA 2GI9A 4KV2A 4NJ7A 5BMGA 4IQZA 2K04A 3T1YQ 1MFWA 1QILA 2V4DA 4ODGA 1CZGA 3BZKA 3LXFA 3PO3B 4C1NI 1DOMA 2CW0C 3EA6A 1TBEA 4FO2A 4O0AA 4BA1I 4ZHOA 2F0DA 1F2LA 3DXJC 2K3UA 3K0YA 2A6ED 3I4LA 4C3JG 2WB1E 5A35A 3H3VI 1L6VA 1GG3A 5FR3A 3WAOA 2QA4A 2OWOA 5AZFA 1ZDVA 4JI3L 4LNNA 2L4NA 3I4OA 2BKRB 2LWPA 2F0QA 4TQ0A 1TYGB 4OZCA 1FJGL 3GTPH 4IOCA 1HZAA 2HTME 3S1NB 1B9MA 5H1SE 3VQIA 1JOOA 4URKA 1BCPC 4DR3Q 4QCLA 2JK8A 2MP2A 2V3PA 1X3GA 3HGBA 4JE3B 4GLVB 5LNK1 3S9WA 1N5WA 4FHKA 2C7HA 4IPCA 4JI3Q 1JW9D 1VZ8A 4DV2L 1BXTA 1LGRA 4IWPA 4NKLA 1TS3A 4W9IA 1WGYA 2ONQA 3U30A 4M8AA 5D3DA 2INCC 3CCEA 3QR8A 1RFKA 2A68C 4GDKB 3PHWB 2RPQA 3BK1A 5M9OA 3PLUA 4DGZA 2LI5A 1S40A 1LTLA 2EJGC 4UP7A 4K7UA 4AQ7A 3RCZA 4DR2Q 1WTVA 2OTJA 4C3HH 1QF6A 1G6PA 4ZOHC 2DJFC 2PYKA 1P3QU 3T1HL 1GHJA 3H6MA 3KQ4A 1TQOA 3Q3JA 1HZBA 1T3QA 1Y1VB 3RNCC 3KLRA 3JVZX 3U50C 3GD7A 1BT0A 1BR9A 4NXNL 2O6VA 2Y5CA 4L5QA 2EYJA 1QOGA 2KQ7A 3NBHB 2B2YA 3AB5A 1WCMG 3L0WB 3S2DB 4A6QA 5BYQA 5FLXE 2WX0A 4CBVA 4CJ2C 1PFSA 1TKYA 4R4TA 2F0EA 2LHDA 5BN4A 3DHHC 2L55A 1VQGA 1W6JA 3VR5A 2VZKD 1FCLA 3HZXA 3O65B 5LXIB 3NRZA 4MJSB 2LSSA 2KDMA 3PRZA 4K5WA 3HOVH 1DD2A 3FEWX 1JMCA 4UHVA 4L1BA 1BF4A 1WTRA 3NS8A 2XGTA 5AUKA 3BY4B 3RN9C 2Z0SA 2CH4A 1DYQA 4K7SA 2ZPYA 5IYCH 4YHHL 1WD1A 1DXMA 4V190 4LWCA 4MGYE 4A93B 2MJ8A 1CTMA 2PMZB 4QL5A 2KJRA 5IGGA 4GKJL 3LDZE 3PS6A 5J18A 3A8IE 3I5JC 3B2GA 3SDLC 3PIP3 1STBA 1YJIA 3U2SC 4DAYA 2ASBA 5C0XI 2O6VD 1SMYC 1FCCC 1PYSB 3K80C 4YWMA 3CCMA 4DV6Q 1JICA 4QIWB 3H15A 1QZGA 4DXFA 3QOJA 5C3EG 2C7NB 1E0ZA 2KC1A 4DXAB 1XMQQ 4DR7L 2XNAC 5CR3A 4FXDA 2F0IA 3L2PA 4JL9A 2G9HD 1NDDA 4RHRA 2C60A 2V3SA 4BKSA 1F2ZA 3ITPA 5IT9E 2IL8A 4ZQ3A 3I70A 5IGEA 4DUYQ 1ASZA 2G3QB 3H7PB 4QQBX 2PZWA 3A4RA 5T1IA 3BG3A 1IBML 1EY5A 3A56A 4AQYL 4DK3C 3U4EG 2EQSA 3NHEB 1Q8IA 2AMCB 3RI7C 2PIAA 4NJCA 4KK7A 1SLJA 1WMHA 5M5WB 1V81A 4RM9A 4KSKC 1J5EQ 1L2NA 1V2YA 1QNKA 1N36L 1GB4A 4PMCA 3J81j 3P1MA 1K83B 4WJNA 2KMAA 4R4IA 4N6EB 4CKCA 4DAYB 3AECB 1P98A 1L1OC 1LO5D 3J7AF 3IAYA 2PMZE 1I35A 1HH2P 4LW1A 3MP9A 1YNNC 1ZYRD 3WCQA 4XWWA 1KTKA 1CKNA 4R4OA 2UU9Q 4JGHB 3DHGC 2C7MB 3AEFB 1KNEA 3KF6A 3GTGH 1CKNB 1RD9D 2JRIB 3PZ7A 4LF8Q 3WALA 1V1OA 3SFEB 2MQJA 2WLBA 1X3EA 4DV0Q 3AEGB 1V1PB 3PVLA 3DWQA 4NDXA 2NZOA 3FMCA 5FJ8H 2PI2A 4DV2Q 1PH1A 5IGBA 2KACA 1XPOA 4BBRH 3HOUB 1ZEQX 4K7WA 1UF0A 1IBXB 4KHZA 4JVZA 1PYWD 3B9JA 5D65A 3A54A 3CSTA 4HEA1 3K7AB 3GV6A 2BF8B 1EWHA 1QUQB 1OQYA 5EKLA 5EKKA 1XNRL 3RLFA 5J39A 3H9DA 5IYBH 3FKIH 1N34Q 4L5RC 2OQ0A 2JE6I 3VUXA 2F3IA 1OEYA 4AOFA 4K2LA 3J81c 1STEA 4C1NK 3IL8A 2EXZA 5M3FB 1WWTA 3G48A 3R8BA 5LMUL 1WSPA 4FF4A 1VMPA 1GC7A 4NAMA 3U4VA 5C4XG 1GUAB 2R7ZB 4A3EH 1IGDA 3ZW3A 1N62A 5AFWA 2N9XA 4B6WA 1XPUA 1VD2A 5EPKA 2DNCA 3G71A 1HXYD 4IFDH 5JJIA 4LLGM 2KBNA 1BOSA 4JK1C 3NWSA 3J81L 5EPJA 3PUZA 4GIVA 4BKSD 2KWDA 1LM0A 4KHPL 3QA8A 5JEAJ 3HOVB 4OXPA 1VF7A 4LFCL 4HKZE 3PUVA 1J8CA 1K73C 1A3UA 3GB1A 4FADA 1EOVA 3R2TA 2WXOA 2RSUA 2B63B 4DR6L 1KXLA 3TZDA 4DR5L 4EQNA 1QVFA 1DOXA 5LMNQ 2Y0SE 1I94Q 2KECA 1VZ6A 4NJ6A 3VVWB 2K9XA 3NQIA 1JQYD 1EYDA 3DBSA 3AQQA 3W1BA 2E3TA 2NCNA 2HDEA 3DVNU 2L8JA 4MEMA 3JAML 1J9OA 4RCNA 2BOSA 2G9DA 1O78A 3VYSA 3GTMB 2B63H 2K52A 1Q12A 2F0FA 3SK5A 1R4NI 3KJOA 3GE3C 1SNOA 2AQ2B 2CHBD 4G50A 5DPRA 2K6QA 1AW7A 1I4PA 1H8CA 5J2RA 4F7ZA 2KA7A 3AEBB 4GNXC 1E8XA 1HR0Q 1DOLA 2JT4B 2JYOA 1OTCA 2FUHB 3EECA 1HE8A 3ZTDA 3DWMA 2I2YA 4LFBL 2HHHQ 4A75A 1J0GA 3MC9A 4HAEA 5C44B 3ZJUA 2WAQE 5K36H 3AULA 2HD5B 2VB3X 3HKZG 1MHHE 4GOCA 1B1ZA 1WI5A 2PO4A 4P16A 3V2TA 4GOPB 2PQEA 4IUTA 4JW0A 1WZ0A 3KUZA 4BY1G 5EE9A 5E3FA 4JBWA 3I91A 4FF3A 4UAIA 2WXJA 1TWAH 4JI8L 1ISNA 4YTNB 1L0XB 5E6JA 3OG5A 3ER0A 2Z59B 3OTOL 2FCQA 5D94A 1UZXB 4DDGD 1ET6A 4BBSB 2JA7H 2UXCL 1E0BA 3D4WA 2JY6A 2KN5A 5BYSA 2EKIA 3DVNV 3IBEA 4G11A 4B95A 4KY5A 1YHAA 4OX9L 3AU5A 2Z4IA 4B3SQ 3V96A 1MIUA 4CHKA 1MSHA 1AE3A 2MBQA 2ZXOA 3KLSX 5HHDG 3HIZA 1GPXA 2M1MA 1DCZA 4DUYL 1Q90A 5E7NA 2VL6A 3J9CA 4TMAB 4XDXA 2FJ2A 2BWES 1BCPF 1P8LA 4LF4L 4LK0M 4DR1Q 1HTPA 2UUAQ 2FXQA 3L08A 1LT3D 2NMQA 1R4PB 4QB4A 3GTJH 1N5XA 3A9KB 2WKDA 2CWAA 3UDFA 3GTOH 3U52E 3TP6A 1BBUA 2V1CC 3PIOA 3ZNHB 1VQDA 5M3MH 2BW2A 4KKSA 3H7PA 3F2BA 1WVLA 4GKJQ 1O7LA 4KJNA 4BY7H 2KD0A 2KN4A 2XIWA 5L37A 1SGHA 4LDTB 4MT5A 1PZKD 3AE4B 5JJZA 4LNFA 1PH7A 3PMFA 3AE2B 2W3RA 4NP5A 4JYAL 4IDIA 3HM3A 1SMYD 3KWLA 2E8GA 1RTOA 3C0RB 4GMVA 3PO2B 1XD3B 1E2WA 1LLRD 4JI6Q 2HJ8A 2MJEA 2QSDA 4HJ8A 5CYUA 3RNAC 4DV4L 4BFRA 1UAPA 2KQSA
chains in the Genus database with same CATH topology
4BY1B 5CMDA 1EEFD 3P75A 3Q22A 1A15A 1EOTA 1L5PA 4KX6B 2V4IB 4IUVA 4JX1C 5BYRA 1FNUA 2HDLA 4I7ZC 1UGJA 3VYRA 4A3BB 2F0PA 2HQEA 1U4RA 2XSCA 4YSYB 3N6RA 1NR4A 3S2HB 1TT2A 2C5CA 3HRZC 4HKQA 1HTLD 3EFXD 4IFDI 3FILA 3DHQA 3I57A 1WXQA 1IW7D 2L5TA 5C4HA 3OWEB 2KAJA 3NUCA 2K0PA 5EBDA 4RGOS 4OZBA 2Q5WD 2Q8TA 5I9PA 2O4XA 5ELDA 4A3GB 1OQQA 4G57A 4XWTA 3DWPA 4EVOA 1EWCA 2B2TA 4EQPA 3GTJB 5CORA 1EU3A 1ROEA 2J7ZA 2ON8A 2OXPA 2H89B 2MGSA 1PFDA 3FVQA 4LTUA 2MJ3A 3WOEA 2Z4HA 5A2QE 2SNMA 2KQ3A 2K5PA 3NUHB 2OEOA 1NUCA 1SNCA 1AZQA 1OO9B 2RSOA 2PPBC 1JWUD 5JOBA 1LTBD 1V97A 4J1MA 3R93A 1C4CA 2ENBA 4KTAA 1HQMC 5HURA 2JSOA 4XQQA 2QIEB 4US8A 1CHQD 1X3QA 4DQOC 4ILWA 3FDTA 1C48A 1NENB 1PRTC 1WRIA 1CM9A 3HVDA 1SJED 1GUTA 2B2YC 1G2SA 1HFGA 3GTLB 2JYEA 4KY7A 2HCIA 1WTQA 1NYRA 2EZVA 1D5XC 3O13A 2K1BA 2BBCA 4KHVA 2BB6A 1EFID 4RF0A 1J7BA 4C2MB 1KF6B 1Z47A 2R93B 3P4QB 2WXFA 2EJMA 1DGJA 2H88B 3HP3A 1SB3C 2IWHA 1SSNA 5C0XG 2EY1A 2XRSD 1AWDA 1EY6A 1TKWB 1PFMA 1TU2B 2WINB 1GUWA 1EL0A 1JR0D 1F77A 1BDOA 4N59A 1PDQA 4A3IB 1J7AA 2PW9A 1PGAA 2X6GA 1PTOC 5FO9B 2XWBB 5KGUA 4QUFA 2A68D 3NBHA 3RZOB 1EY8A 2LMCA 3UI3A 1QB5D 5EQ0A 5I2YA 4IUNA 4RNAA 1PRTB 2TSSA 1I50B 3BDLA 3QJYA 3OWFA 3NWTA 1EYCA 1HFNA 2V0GA 3KWVA 1KH0A 1AP0A 3Q8CA 1BMLC 4LMQD 2K5WA 1TZOA 4HSPA 3HOXB 4KGRA 2WNMA 2G1EA 4E6IA 3DUZA 4IOIE 3GTQB 1R4QB 2NN6H 1EQVA 1JC7A 3C1FA 1FNVA 1QNUA 2K5QA 3AEAB 1K8OA 1QE6A 4F7XA 3I73A 1Y56A 3BDCA 2ZW1A 2Z1CA 3SK6A 2XVSA 2QCPX 1ENFA 2NUCA 1MVKA 2WKCA 5KIXA 2D9UA 1JCKB 3NPPA 3OMGA 4YSXB 1M8AA 2EPBA 3LWUA 5BMIA 2L12A 5IGFA 3R3OA 2RDGA 1CA5A 5JPNC 1FIQA 4ULLA 3GTPB 2DY7A 1XXGA 3GO5A 1G8ZD 2I38A 3K5OA 3GQBA 2F1MA 5HG2A 1C4AA 2EY5A 1RF2D 4KN4C 4F88A 5I9OA 5FLXL 2FUG1 4FXCA 3SR6A 2L32A 5D14A 1B2TA 2F0OA 4ZRPA 1WYGA 2QJLA 2QEJC 1B9NA 2NBFA 1LT5D 1QCBD 2Q8IB 2FMMA 4L6TB 1SNPA 5J1ZA 2BS3B 3HKZB 4XE0A 3VA5A 2L1AA 3IAS1 4HTHA 4KKUA 3FC4A 3L7ZC 1PTOF 3OHXC 1V8CA 2EDGA 1TWFB 4PV1C 4K14A 1C8CA 5FK9C 1HA5A 1BBXC 1OXTA 1U4MA 2YU9B 3I3CA 4DU9A 1TY2A 5C4ZA 1LTAD 1R9TB 4K5XA 4TSSA 3D6CA 1JWAD 2H4OA 2QKIC 1CJEA 3M85A 2B39A 1NCVA 1SXTA 4TQUS 4K5VA 1ILQA 1BCPB 4FP5D 4RHSA 1LT6D 1U4PA 2L11A 2JA5B 1AN8A 2KOLA 4JWUC 2NTSA 2AUKA 5CV6A 1N61A 2D62A 4WWMA 3BZDB 1ET9A 5I6YA 1ONLA 2KQ4X 2JXTA 3PZ8A 3AEEB 1ICWA 3ONAB 3NSWA 3M7GA 1FRRA 1ZDXA 3CWIA 2M56B 1ZXTA 1D1IA 5BN5A 1HUNA 4KKTA 4CJ1B 2E2JB 2EY6A 4H2AA 2EYPA 4HR7B 1MBYA 4OZAA 2NZ1D 5IT9L 2X38A 3QB3A 3S17B 3D3RA 3HOYB 1A3TA 4C3IG 3NP8A 2A5HA 1P7EA 4U68A 1H9SB 5ELFA 4F8MA 1B50A 1MPEA 1Y1WB 1KFYB 4WIPA 5G3LF 3IAM1 2WXPA 2BDOA 1BNZA 4OHJA 3AE9B 2VB2X 5EKIA 4KGSA 4BS9A 2N88A 1NSNS 1LTGD 5A2QL 5FOBB 1F9PA 1GHKA 1EQTA 4RFBA 1IYUA 3TP8A 3K5MA 2F3WA 1U9RA 1KABA 2L1BA 2RDFA 3AV8A 4B0EA 2N0SB 4A3KB 3LB8C 4OVZA 1FYCA 4Q0FA 1UWXA 1PDXA 4HJGE 1FGBD 5KEEA 2QDBA 3D31A 3SK4A 4DN4M 4G4KA 1D6EC 4YTPB 1BCPD 5CV8A 4DXGA 1D5ZC 3CQZB 1XLPA 2SEBD 3T4AC 2JQRB 1A6XA 2BB5A 1DOIA 4Q5VA 2CQAA 1E2ZA 3AEDB 3R2IA 2JU6X 1ZXHA 1I4QA 3FAHA 2D5DA 1V43A 3D4DA 2CJNA 4R3DA 2M9VA 1TVXA 2F0TA 4H44C 3J7YW 1YNND 1ZYRC 1SYFA 2L83A 1DONA 5C0XJ 1LABA 3OPOA 2M00A 3EJIA 1G6ZA 1XTCD 4Q2JA 3AMZA 3FKIB 2L52A 4XYQA 4B9WA 3DWGC 4MM3B 2CU3A 2A6HD 4IKGA 5IGDA 1IKMA 1AYFA 1GAQB 3OIPA 1K51A 2R61A 3ND8A 2F0HA 2WXGA 1SF0A 1EZ8A 4HCSA 1XYIA 2EYLA 3P1HA 2NVTB 1Y8NB 1EWYC 3KLSA 4LJZC 1VLBA 4AS1A 1IW7C 1CQVA 2MJDA 2AX5A 4RAUC 2CVRA 1SE2A 2GRIA 3GTGB 4C3IB 2QMTA 4GDLB 1TS5A 1YNTE 3NXWA 1EY9A 3W9CB 5IGCA 1YNJD 1C9FA 2AWNA 4BA2I 1KAAA 4C3HB 1B44D 2WDQB 3MAQA 2RA4A 1XO3A 3RFZB 4YXDB 1VR9A 4O1NA 3J81E 2KVMA 1A2TA 4EE2A 2EYMA 2R6GA 3IFTA 1HUMA 5H92C 4ZK9B 3Q23A 1X32A 2EOTA 2OF1A 3C2PA 1FFUA 3IT6B 2K7VA 1RYJA 1RCVD 2TMPA 2WDRB 3DEPA 1K53A 3A7AB 3KBXA 1PLFA 3NVVA 2WXNA 2W3SA 1S5CD 3CRKC 3NBIA 1BUVT 3VR4A 4US9A 3BK2A 1F9RA 1C79A 1X3PA 2QF7A 2MHVA 1UNSA 1G291 2FHTA 1YN5A 5JEAG 2N9KA 4XTCS 2WP8J 2WQYB 4A3JB 3K5NA 1STGA 5COYA 1XWEA 4XDCA 1SBBB 1GJXA 2ICEC 2BYTA 1F0ZA 1M4VA 1JALA 3W1SA 4S3SA 3T56B 1I4RA 4QF4A 5LL6S 1ILPA 1O80A 4Z9CB 5DNFA 2F0GA 3JAME 1I7HA 5KNDA 4X3SA 2RPVA 4YSZB 3H3VC 3LX0A 1IUEA 5HGTA 3GV3A 2BA1A 1I4XA 2Z8LA 2LUMA 4A3MB 2LFNA 1YMHE 1STNA 4OL7A 1OXSC 3Q24A 3H8HA 1CI3M 2WU5B 1ESFA 3NHHA 1L0VB 1D1KA 4G7OC 2IX3A 4CKBA 4TKOB 1FRDA 4RGMA 3LYYA 1NYQA 4ZKCB 3EQLC 3S1QB 4LAAA 2BE5C 5JAVA 1PUTA 3L9AX 3IKJA 1KLUD 1TS2A 4P6VF 2E2DC 3BYYB 4DF7A 2JA8B 2WXRA 2F0UA 1JOKA 1RHPA 4ARIA 1KDCA 2M0AA 5CBEE 5EE1A 4WURA 2ICIA 5TSSA 1RWSA 4RKLA 5G5HA 1IL8A 5C3EB 3I4MB 4QMGA 4JPSA 1QJOA 2AWOA 2WAQB 2SAKA 5BMHA 3K58A 1GB1A 1OFFA 3TEYA 1YQ3B 4M1UB 3MFYA 3OW7A 1GXDC 1SNMA 1OQRA 2Y0SB 1S4ZA 4P2CB 1HZ6A 3C46A 2K01A 4PMWA 4H0LC 3H09A 2DYMA 3QO2A 4HSVA 1L4DB 4RH6A 5ELEA 1E6EB 2NVYB 4KI0A 4H13C 2MUYA 1LV9A 2V3NA 2M2LA 3MXUA 3K59A 3UI2A 3QWNA 2WB1B 2RKSA 5FO8B 2O5JC 2K5DA 3NQTA 3OOCA 1H9KA 1AFPA 2IDYA 3K6OA 1SYBA 1JWMD 4IUPA 1T6BX 1ESRA 2K6AA 2MPMA 2JYTA 3TEZA 4KJOA 4OIJA 4DAPA 3W5UB 3DWAA 2DBYA 1EIGA 1S5ED 2LS01 1FXAA 1VZ7A 3F2UA 1Z6HA 3U9OA 1GUOA 4N9TA 2B76B 1JE4A 3T16A 1SYEA 3HVZA 2A69D 4XIGS 3SHLA 3G6JB 3VA7A 5G3LD 5ISRA 3AE5B 4MIUA 4ITKA 4FXGC 5DM63 2A69C 1RM6C 1GUNA 3HOZB 1PGBA 4A8XC 5JXVA 2D2CC 5HFYA 1T5EA 1VCIA 1E10A 3TBIB 3SFDB 2JZPA 3N52A 5J22A 1FXIA 1KNAA 1ZOYB 3TP5A 2Y5PA 3K5LA 1TKEA 1JMLA 1RKNA 4BY7B 4B08A 2WV6D 3FILB 4EGVA 1TWAB 2LJIA 4IURA 4J3OD 5C3WA 2R92B 2WDVB 1XEEA 3CIRB 1K52A 2EELA 4IFDJ 1C77A 1PTOH 4DA2A 2BT6A 1K50A 2WXKA 4AYBB 2IGDA 1XCQL 4YWGG 2E74C 3VR8B 3J80L 3AE8B 2A73B 4B0MA 1L0YB 3GP7A 2J52A 2FINB 2OT2A 5AUIA 3MXGA 2RVLA 2EYFA 3WOFA 1BQQT 1XX8A 2E2HB 2ZT9C 1HCZA 1IBXA 2WXQA 2GA4B 4KGTA 1PFNA 3P42A 2A74C 3NVWA 3MHBA 1CT1D 3KK7A 4A3EB 2WXHA 5C0XH 2EJFC 1S5BD 3RMHA 4DAVA 5D3IB 4K2KA 4TQ1A 3HOWB 2OEDA 4ME5A 2SOBA 5CV9A 3P4RB 1C76A 2R3ZA 1I6VC 2CW0D 2W55A 3AN1A 4RGTA 3U9SA 4XDDA 5DM73 1LTSD 1PZJD 4K8JA 3Q6SA 2NYZD 1OXUA 3NVYA 1CZPA 1Z7TA 2MP1A 4RWSC 1EEID 2O5IC 4XYOA 2LKVA 4U673 1JOQA 2NTTA 3FPPA 3D4RA 4FYDA 4HMJA 4HMIA 1IKLA 2PTLA 4OO1G 5EGTA 3KUPA 1BO0A 3X3NA 4PMBA 4YIJA 1BUIC 2RMMA 1C78A 1AZPA 2PMVA 1JRPA 4ABNA 4REZA 1TJEA 5E4XA 1LT4D 2DNEA 3K57A 3ZJTA 4KV6A 2DLBA 4WFN3 1YN3A 2DYOA 1ZUD2 3L4PA 4K6LA 3E0JA 4BWGB 4IALA 3TEWA 3TDQA 1F2RI 1I4GA 3BS1A 1ENAA 1JROA 1L4ZB 3I72A 4HN7A 1QOFA 4A55A 1MSGA 3OIQA 1KDBA 2LEKA 4BBRB 3MFGA 3VRAB 4RKBA 2PW5A 1SDFA 2LY7A 5LHY1 1SJHD 2D5GA 2ZXPA 3B2FA 1IYVA 1EY4A 4FVMA 3NZ3A 3MWYW 2K03A 1YJJA 3N9YC 4IUUA 4NW2A 5EE0A 5NUCA 1FD7D 2KJXA 3SDZA 3CU7A 3M7NA 3KBGA 4C7YA 4WJWA 4C80A 3A7LA 2KHSA 3MXPA 3PIO3 4WORA 4RCOA 4OGQC 4R8IA 1B3AA 3H91A 2KCNA 4C56C 1E2VA 5IIFA 5KRUA 3E6ZX 3PUXA 5D7GA 1Q1EA 4J8QA 1PRTD 3I8ZA 4ZRQA 3LWEA 2NVQB 4KMUC 3PO0A 1KLGD 3V05A 3AE6B 3NS1A 1QOBA 4XT1B 3EUB2 4J6HA 2VNUD 1HHVA 3AB9A 2KEEA 2NB0A 3I4NB 1VJKA 4ZUJA 4NAWB 4V0BA 3DM1A 1I6HB 3LNNA 4DK0A 3CHBD 4DNRB 2ZW0A 3ZJVA 1F9SA 4O42A 2PVOD 2F0JA 2IT1A 4I65A 1MI0A 1EM7A 3VYUA 3VYTA 2LHEA 1Q3LA 3MHZA 1RDPD 4CKEA 4Y7NB 2BTEA 1KRHA 1NR2A 1CK1A 5E4WC 2MH7A 2JA6B 3ZQ4A 1XCTL 4TRDA 1TWHB 1V1PA 4RGNA 1PZID 2E2IB 4OO1H 4FF2A 2DWQA 4DNTB 4MH8A 1IGCA 2PVGC 5JVH3 1VF5C 3OSOA 4H7BA 1LTTD 1R7SA 1EZ6A 3T51B 3A8KE 2INNE 2B2WC 5C3XA 3S1MB 2F0KA 3TUOA 5M5XB 1ZPSA 3SK8A 1TS4A 3WDNA 3CRLC 4XT3B 2AQ1B 3P63A 3V3XA 2WIIB 1FR3A 2AUJD 2B2VC 2SDFA 3TMEA 2JWUA 4WQMA 5EPLA 2XRQD 3MJ5A 1A70A 4FF1A 1J7CA 4MACA 2PZTA 1S5FD 5M3MB 3A8JE 3BVZA 4X3KA 2K22A 4OO1I 1SYGA 1O7ZA 3RUZA 1XLQA 1S5DD 3S1RB 1MD2D 3FPUB 5FKAC 2X6LA 2X69A 3HG9A 2BE5D 2WACA 2J0TD 3CKIB 3RZDB 2F0VA 2VUMB 1SNDA 5EE3A 2MEKA 3AM9A 4D2KA 2DY8A 1PFBA 1T5XD 1XF5L 2F0WA 4CJ0B 4WRDA 2PKOA 3D8GA 1STAA 3TEXA 4G7HC 1VMCA 3H94A 3AE3B 2I07B 3D6WA 2RQXA 1QKZA 1STYA 1GUGA 2JA7B 3T53B 3AMUA 1EU4A 3AU7A 1N63A 2WXMA 1CZWA 1TY0A 2IX0A 4KN7C 3AH7A 2HUGA 4K6DA 1I3QB 4ZAIA 4IUQA 3VRBB 5JPMC 1B9RA 2RDHA 1MGSA 2IW3A 3SEBA 5BN3A 2KUMA 2WS3B 2NWGA 1A2UA 2F0LA 1CQFA 4A90A 4N9PA 4XQNA 1PTOD 1NEKB 1H9SA 1E9MA 4CGYB 3W2DA 4B9XA 5K5PA 1QOHA 1WTXA 2WU2B 1D4BA 1SAPA 5E1FA 3C3LA 2PZUA 1VRAB 4KY6A 2YEPF 2RBMA 5KYIA 1U4LA 1O7YA 5CV5A 4L2YA 5MPOA 3SE0A 2F4IA 1HZ5A 1TIID 2KCCA 3NTHA 3I90A 1QQRA 4A3DB 2B2UA 2B2VA 1CFMA 2NN6G 4RF1A 3A55A 1WGKA 4DFAA 1DM0B 3T3NA 1PGXA 2N9LA 4C3HG 1WTOA 2HDMA 3AE7B 5JEAH 2FE8A 3W5VB 1H9RA 3PV0A 4KKIA 3H0GB 4GLSC 1A3VA 1H9MA 1EY7A 4UDUC 2JSVX 4CHTB 2F0NA 4KD3A 4KD4A 2FBWB 5I4DA 3HS0C 2PW7A 2VXWA 3FRPB 1QWYA 4QUCA 1PXUA 3QIAA 5C5LA 3TSSA 3L3OC 3C8YA 3RPFC 2JEAI 1ACCA 3P4SB 4JWSC 5GXGB 2IJ0A 2K05A 3G7LA 3ETRA 2EE1A 4WH4A 4FXKC 1ZXIA 2BCOA 2LGIA 2L0CA 5T8IA 1SE4A 5G5GA 4ZUIA 3SVMA 2NVXB 3Q8AA 1JQ4A 1D5MC 2EYOA 4YTMB 1OXVA 3MVVA 1QT9A 4DK1A 1W6KA 3MA2B 4K8IA 2AQ3B 5C5MA 1HEZE 3HEJA 1VDZA 4G7ZC 4A3FB 3EGRA 2W82A 4IN3A 5C4XB 5I6WA 3KF8A 3ERQA 3MZ5A 3DMUA 1II3A 3TP7A 1SYCA 3M4YA 4ZKBB 2YYZA 2SNSA 2B2UC 1WD0A 3BYTB 2QILA 2INPE 2C9OA 3MEHA 1H9JA 2K28A 3Q8EA 1FO4A 1HRJA 1G2TA 4LK1C 1QLBB 2B8FA 2JP1A 1YQ4B 1FD6A 2O2LD 4R8NA 4PNYA 3ND9A 4NZLB 1B4OA 3SXHA 3T13A 1DOYA 5LL6X 3MC0B 2PCFB 1V8QA 2FFKB 4HRSA 4NMZA 5M5YB 2BS4B 3PUWA 1F2MA 1NI3A 4WAFA 2PNRC 1LTRD 3P7JA 1I4HA 1Y8OB 3Q69A 2EYHA 5ELCA 3S16B 5KNBA 3X3MA 2IGHA 1YNJC 2F03A 3NTKA 4EQOA 1GOZA 1SE3A 1Q1BA 2J42A 3P4PB 3IT4B 3MTSA 3BIID 2WXLA 4RA8A 1EYAA 1JORA 3OMCA 1JWSD 3RD4A 1QOAA 3QG1A 1HA6A 2H1EA 1F9QA 3W3AA 5DAUA 3URYA 1Q10A 2A6HC 2YEPB 1RJTA 2J53A 1CHPD 3DEOA 3HUIA 4YT0B 2GB1A 5EJWA 2L9HA 4CQNA 2F0MA 1XLOA 3VR3A 3S14B 3VR9B 1C4QA 3Q8BA 1VDVA 1NAPA 3E5SA 2XWJB 1UUPA 4ARCA 3S15B 3ABVB 2B8GA 1KDAA 2J4XA 1LACA 3VR6A 1F2RC 3M3YB 1UEAB 4OW0A 3MXNA 1DJRD 5C4JB 2VZKB 2B2TC 2EVBA 1LTID 2XN9C 3EVQA 3ZYYX 1ZP0B 2M19A 2OHFA 1WTWA 1XLNA 1TWGB 4M0WA 4R9WA 4KKJA 1SSOA 5C6AA 1JWBD 3AE1B 4ZHPA 1TKGA 5IOCA 2B2WA 4PT5A 2BDNA 2Y3AA 2DN8A 2IX1A 3M4OB 5I2XA 3EROA 2IPKD 4X3UA 4L23A 1STHA 2W54A 5ELBA 1PRTF 1C4PA 3TN2A 1HPCA 1N60A 1YN4A 1SFOB 1Y69U 5DEHA 4MN3A 2ACZB 2E6XA 5CGKA 3J7AV 3QOLA 2EY2A 1FEHA 3J80E 1QG7A 5H8YE 5HI1A 1CA6A 1WTPA 3BWUD 4MHEA 4IZ8A 3E56A 1RTNA 4C3JB 2BS2B 3I9V1 1NVID 2JX5A 5JVG3 1DZ1A 1PMRA 5CV7A 2KMMA 2K32A 4PQXA 2ZXRA 1SIJA 1AEXA 1OXXK 3C1EA 1ML0D 4XQJA 1EIHA 4F87A 2LMCB 2NN6I 1JB3A 3PUYA 2F0SA 1K8MA 3NVZA 1ZE3D 1RODA 2ID0A 1MHXA 3VR2A 4ZYSA 3U7ZA 5F2DA 1HQRD 1GUSA 1EY0A 2BA0A 3E9SA 3BDOA 5C2TB 4L63B 1TWCB 3TZUA 1DOKA 5CBAE 4HCEA 4GZYC 1UWMA 2K33A 1ZKOA 2PLPA 3GS2A 1SEBD 2N55A 2N7JA 1FNWA 5CV4A 2JXMB 3NE5B 2CJOA 2WP9B 1J8IA 4ID6A 1IHZA 1B53A 4X3TA 4ZRZA 1PTOB 2WXIA 1ENCA 1MI2A 1SNQA 2HCCA 1G91A 5KNCA 5CC4A 2LFIA 4A9AA 4IFDG 5KYLA 1Y8PB 3GTOB 5EBCA 1FMAD 4ZLTF 1SYDA 3T3OA 3BVGA 4L8JA 1D2BA 1WCMB 5K36G 3SR1A 5IODA 2A6EC 3HRDD 3IFDA 2Q8RE 3GTKB 2JEBI 4FNFA 2F3VA 1L6UA 2IGGA 3BVMA 3IXSA 3NTIA 1FFVA 2I46A 4OIKA 4N58A 4XXEA 4HROA 3P20A 3NK9A 1E7PB 2RSNA 5FO7B 4USAA 5C3JB 3Q8FA 3ZGZA 1FM0D 1F2YA 2E76C 4C7ZA 2E75C 1P7FA 1TR5A 2KEDA 2FMCA 5T1GA 5BMGA 4HEDA 3Q0AA 2GI9A 4IQZA 2K04A 1QILA 2V4DA 4ODGA 1CZGA 3LXFA 3PO3B 4C1NI 1DOMA 2CW0C 3EA6A 4FO2A 4BA1I 4ZHOA 2F0DA 1F2LA 3DXJC 2K3UA 3K0YA 2A6ED 3I4LA 4C3JG 5A35A 5FR3A 1L6VA 1ZDVA 2L4NA 2F0QA 4TQ0A 1TYGB 4OZCA 2HTME 3S1NB 1B9MA 3VQIA 1JOOA 1BCPC 4QCLA 2V3PA 3HGBA 4JE3B 5LNK1 3S9WA 1N5WA 1JW9D 1VZ8A 1BXTA 4NKLA 1TS3A 2ONQA 4M8AA 5D3DA 1RFKA 2A68C 4GDKB 3BK1A 5M9OA 4DGZA 2EJGC 4AQ7A 1WTVA 1QF6A 4ZOHC 2PYKA 1GHJA 3H6MA 3KQ4A 1TQOA 1T3QA 1Y1VB 3KLRA 3GD7A 1BR9A 2Y5CA 2EYJA 1QOGA 2B2YA 3AB5A 3S2DB 4A6QA 5BYQA 5FLXE 4CBVA 4CJ2C 1TKYA 2F0EA 2LHDA 5BN4A 2L55A 1FCLA 1W6JA 3VR5A 2VZKD 3HZXA 3NRZA 2KDMA 4K5WA 1DD2A 3FEWX 4L1BA 1BF4A 1WTRA 5AUKA 1DYQA 1WD1A 1DXMA 4V190 4A93B 2MJ8A 1CTMA 2PMZB 5IGGA 3A8IE 3B2GA 3PIP3 1STBA 1YJIA 3U2SC 4DAYA 5C0XI 1SMYC 1FCCC 1JICA 4QIWB 4DXFA 3QOJA 1E0ZA 2XNAC 5CR3A 4FXDA 2F0IA 2G9HD 4RHRA 1F2ZA 3ITPA 5IT9E 2IL8A 4ZQ3A 3I70A 5IGEA 2PZWA 5T1IA 3BG3A 1EY5A 3A56A 3U4EG 1Q8IA 2PIAA 4NJCA 4KK7A 5M5WB 1QNKA 1GB4A 4PMCA 3P1MA 1K83B 4N6EB 4CKCA 3AECB 1LO5D 3J7AF 3IAYA 3MP9A 3WCQA 1YNNC 1ZYRD 4XWWA 1KTKA 3AEFB 1KNEA 1RD9D 3PZ7A 1V1OA 3SFEB 2WLBA 3AEGB 1V1PB 3DWQA 4NDXA 3FMCA 5IGBA 2KACA 3HOUB 1ZEQX 1IBXB 4KHZA 1PYWD 3B9JA 5D65A 3A54A 4HEA1 3K7AB 3GV6A 1EWHA 5EKLA 5EKKA 3RLFA 5J39A 2JE6I 4K2LA 5M3FB 1STEA 4C1NK 3IL8A 2EXZA 1WWTA 3R8BA 1WSPA 4FF4A 1VMPA 4NAMA 2R7ZB 1IGDA 1N62A 5AFWA 5EPKA 2DNCA 1HXYD 4IFDH 4LLGM 1BOSA 4JK1C 3NWSA 3J81L 5EPJA 3PUZA 2KWDA 5JEAJ 3HOVB 1VF7A 4HKZE 3PUVA 1A3UA 3GB1A 3R2TA 2WXOA 2B63B 3TZDA 1DOXA 4EQNA 2KECA 1VZ6A 2K9XA 1JQYD 3NQIA 1EYDA 2E3TA 2HDEA 3JAML 1J9OA 4RCNA 2BOSA 2G9DA 1O78A 3VYSA 3GTMB 1Q12A 2F0FA 3SK5A 1SNOA 2AQ2B 2CHBD 1AW7A 1I4PA 2KA7A 3AEBB 1DOLA 2JYOA 2I2YA 3DWMA 4HAEA 5C44B 3ZJUA 5K36H 2VB3X 1MHHE 1B1ZA 2PO4A 4P16A 3V2TA 2PQEA 4IUTA