1DYQA

Staphylococcal enterotoxin a mutant vaccine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
228
structure length
228
Chain Sequence
EINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFRQHTILFKGFFTDHSWYNDLLVRFDSKDIVDKYKGKKVDLYGAYAGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN A MUTANT
publication title Structural Basis for Abrogated Binding between Staphylococcal Enterotoxin a Superantigen Vaccine and Mhc-II?
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Enterotoxin
total genus 74
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2000-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dyqA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1dyqA02
1UNSA 2J4XA 1BCPF 4RGNA 1UUPA 1KLUD 4DXFA 4BWGB 3DWQA 4RHSA 1JR0D 1JWMD 1EFID 2AQ1B 1TS4A 1PZID 1I4RA 3DWAA 5FK9C 1PTOB 5ELCA 2QEJC 1FNVA 1AW7A 1BXTA 1QILA 1RDPD 3BYYB 1I4QA 3BVZA 3W2DA 1LT4D 2TSSA 2AQ3B 1LT6D 1PRTB 1HTLD 1BCPC 1TY2A 1PTOF 3DWPA 1EEFD 3BYTB 4ZYSA 1SEBD 1RF2D 1LTAD 2RDGA 1LTGD 1CT1D 1I4HA 1KTKA 5TSSA 4K6LA 1PZJD 1KLGD 1V1OA 4L63B 1YN3A 1I4XA 3R8BA 3EFXD 1G8ZD 1PYWD 1S5FD 1TS5A 3MC0B 5ELDA 3CHBD 1PRTF 1FNUA 1F77A 3SEBA 1S5CD 3EA6A 3GP7A 1T5XD 1V1PA 2RDHA 3OWEB 3R2TA 4Z9CB 1D6EC 2O2LD 3R2IA 4OHJA 1B1ZA 2ICIA 1RCVD 1LO5D 1I4PA 1L0YB 4RCOA 3V05A 1PTOC 1M4VA 2XN9C 3BVGA 1JCKB 1L0XB 1YN4A 5ELBA 2QILA 1XTCD 2IJ0A 2WV6D 1BCPD 1SBBB 5I4DA 1DJRD 2IPKD 1D5MC 1HQRD 1D5ZC 1D5XC 2NTSA 3URYA 2SEBD 1JWSD 2XNAC 1PRTC 4NZLB 1LTBD 2XRSD 4RGMA 1B44D 2R61A 4RH6A 1CHQD 1LTRD 4L6TB 1DYQA 1FNWA 3BZDB 4DXGA 1LLRD 4TSSA 1LTSD 1ET9A 2AQ2B 1I4GA 1HA5A 3O13A 1SE4A 1LTTD 1S5ED 4RGOS 2CHBD 1EU4A 1S5DD 1SE2A 1RD9D 1AN8A 2XRQD 1XXGA 1SXTA 1CQVA 1FD7D 1PTOD 1CK1A 1LTID 5D3DA 1FGBD 1SJHD 1ESFA 1YN5A 1PZKD 3KLSX 1LT3D 3BVMA 2G9HD 4RFBA 4RGTA 2Z8LA 5ELEA 1JQYD 1PTOH 5D3IB 1ET6A 1SJED 1BCPB 1CHPD 1LT5D 1PRTD 1TS2A 4RHRA 3TSSA 1HXYD 5FKAC 1EWCA 2NTTA 1EU3A 1GOZA 1TY0A 3MFGA 4UDUC 5ELFA 4C56C 4O1NA 1TS3A 1SE3A 1S5BD 1EEID 1JWUD 1STEA 1V1PB 1MD2D 1ENFA
chains in the Genus database with same CATH superfamily
5C44B 1I3QB 5MPOA 4V190 1QVCA 1DOLA 3OYYA 3HVDA 1MPEA 1UUPA 1KLUD 3EGRA 3HOUB 3KBGA 2M8SA 1H95A 3KF8A 4E6IA 2KTRA 1NAPA 2B8GA 3PUWA 1Q5WB 3S1NB 3K0YA 3NWSA 2L9HA 3W1GA 3I4NG 3IAYA 2WINB 4X66Q 2FAZA 3KUDB 2PEAA 4A20A 2QEJC 2I1KA 3VUWA 1TWAH 3S2DH 4LTUA 4MH8A 2F0PA 2HQLA 2ONQA 5GQOA 4KIKA 1EY8A 2PZWA 4H7BA 4DDID 3HGBA 5F2DA 1QJOA 2FCSA 3CC4A 4A3EB 2AQ3B 3S24A 1GHJA 1N6ZA 3ETRA 3PCOB 4ZQ3A 2DGYA 2D3AA 5BMGA 2K05A 4M01A 3TS0A 3A9JB 2WXMA 4FJZA 4MH0E 3K59A 2HJ8A 3PZDA 2K50A 2NUCA 4EKUA 2XVSA 2IL8A 3A8JE 4HN7A 3GZNB 2KCMA 2F0WA 4OIKA 1ILPA 4W9FA 2JQRB 4BAXA 4JI8L 2C35B 3OIQA 3S15H 2KCCA 1VZ7A 2K6AA 2JRIB 4LJZC 3U50C 4C3JB 3S2DB 3FC4A 4DV3Q 1F9QA 4QJFA 2HUGA 4ALPA 1YITA 2V9HA 4DK0A 4ID6A 5CYUA 4ZK9B 2INPE 3Q3NC 1GG3A 3Q69A 3UQBA 5JEAJ 3DBRI 3HUIA 5D14A 4HJAA 3PO0A 2C7MB 2VS1A 1Q7YC 2JSOA 3S1RH 5I6YA 1NSNS 3OTOQ 3PTFC 4HKQA 2MLBA 5EGTA 1HQRD 2FINB 3M95A 1D5XC 3J80i 2WDRB 1IGCA 2BYEA 2DHZA 3SHQA 4JI4Q 3R66C 2CWPA 4BBNF 2XNAC 2WXHA 2RKSA 4NXMQ 4B95A 5IY0A 1V9JA 3LGJA 1IBLL 2EYFA 4RH6A 2GVBA 1YQ3B 3MC8A 3M4QA 4L5TA 1CTMA 3HOYG 2JF5A 4PT5A 4HIMA 4K3CA 1KL9A 1Y1WB 2MW5A 2A6HD 2F0DA 2WP9B 4HCSA 2LZ6A 2K0PA 5E4WC 3W1SA 1AN8A 5IE8A 2ZXRA 2INDC 4WJNA 3K58A 1WE6A 2C9WB 2DN8A 4XGAB 1EY9A 3MJ5A 1E3PA 4F88A 4LFAL 4DF7A 3S1RB 1CUKA 2XWBB 4LF6L 4MGZE 3KDFB 4CKEA 1FGBD 1UEBA 1OEYA 3J80c 2KWUB 5GAGC 1EY5A 1WTHA 3HS0C 3NWTA 3TDQA 4K3BA 1U9RA 1K0RA 1O7YA 1C79A 2G4SA 4RGTA 5FLXE 1YBYA 2ON8A 5ELEA 1LT5D 4B3RL 4GOPC 1VS0A 2OEOA 3DHGC 3M3YB 1YJIA 4BZAA 5AFWA 4GXBA 1JB7A 5FKAC 1EWCA 4KLKA 4A3LG 2ZJRA 3AE6B 2JU6X 3NBHB 2DZIA 3OSOA 3F2CA 2V4IB 4P1BC 5ISRA 4KHPQ 4DUZL 4IFDH 3FPPA 2L4NA 1IP9A 4C80A 1P7FA 3ZLZA 5IGDA 4A3KH 4WQMA 5BR8Q 2EMTA 4MACA 3FVQA 1TWGH 5LL6S 3PF4A 4IM3A 4P16A 4ZRQA 1B7YB 1QZGA 4DHJB 1J5EL 2B63G 2PMVA 4X65L 1VQCA 5G2NA 4IFDI 2JZPA 1UWVA 4DR2L 5IOCA 4B3TL 1X3FA 4HJ8A 3ZXVA 4FBJB 4OWTB 3WDNA 2LSSA 4KTAA 2VXWA 2K32A 2KDEB 3L9AX 1WIAA 5L37A 2E2JH 1VZ8A 3ZIMA 1EQTA 3NTIA 3NZ3A 3UIPB 4BY7H 2LUEA 5HG2A 2F4VL 1F2RI 3DVNV 3GE8C 1ML0D 3A1QA 1HTLD 3ML8A 4PMBA 1WY8A 1M90C 3A4SC 1EEFD 3GTLH 3QR8A 4S3SA 4YTNB 5FLMH 1SNPA 1XF5L 3U2SC 3WA0A 1J7CA 4UHVA 1YMHE 2MX2A 3A4RA 3R8BA 3B2GA 5CR3A 2WDQB 2N8NA 4P74A 4X62L 1WJ4A 2EYJA 1HFNA 3TP7A 3RN2A 2K22A 5ELOA 2EJFC 1UBIA 4FF2A 1E7VA 1KJTA 5KNCA 5DM63 4HRSA 3S14H 3SEBA 4DFAA 4E3CA 4DUYL 2CJNA 1BBXC 3CAMA 5DAUA 3CW2C 1L7YA 1VRAB 1D6EC 1N62A 2QJLA 2WXLA 1UE7A 3PS6A 2W55A 1VQ4A 1VLBA 1EQRA 3DUZA 1WWTA 4WFN3 2Q2TA 2LHDA 4HPMB 4OVZA 4N6EB 4ME3A 4WWPA 1XTCD 2CW0C 1ICWA 3W1YA 3ZO5B 4LDTD 2IPKD 1RFKA 3K7AB 4M0WA 4FO2A 2L32A 3W5OA 4BXXG 1LABA 2NTSA 3URYA 1AFPA 4L23A 3RNAC 2K9XA 1K0SA 2UUBL 1B9RA 1LTBD 4DV6L 1MHXA 1F0ZA 3AECB 3PIPA 2BH8A 3QARA 4MDKE 4A8XC 1K8MA 2O5IC 3F2DA 3NPPA 4KV6A 1A3UA 4ASWC 4GLVB 1AWDA 3KUPA 4OW0A 4W9CA 4USAA 2Q8TA 2W9NA 1F2MA 1QNKA 4RCNA 1CMXB 4J3OD 4A3PA 1KF6B 3I2ZA 4JPSA 1FO4A 4GLXA 1D7QA 4K8IA 1Y69U 1KH0A 1S3SG 2WX0A 2PYKA 5J22A 3T13A 2K6DB 3T1HL 3QHTA 4HLEA 4JI2L 3I55A 2WAQE 1GUWA 2ZNVC 3KUCB 1YN5A 3A5ZB 2LY7A 1ZXTA 3NHEB 3QJZA 1PVOA 1TIFA 2VB2X 3BY4B 4Q0FA 4RFBA 3IHPC 4JE3B 4DHZB 1BCPB 1B70B 3KBXA 3JSVB 4IUMB 3S1QB 4XTCS 1JT8A 1X1MA 1R4MB 1Z5SB 1PRTD 1G2TA 3H6NA 2E2DC 2NZOA 1VQ8A 4R1JA 3IKJA 4C56C 3MFGA 4QUCA 4UDUC 4ZOHC 1JJ2A 3VR8B 3HOXB 1JJGA 4I65A 1TS3A 1Y1VG 1UEAB 1MSGA 4PQXA 4X3KA 4JV5L 4DR3Q 4II3B 4Q2JA 1RM6C 1O80A 2EY2A 3GTKH 3LXFA 5M3MB 1FRRA 2K5PA 1A6XA 1FXIA 4A3FB 1HNXQ 4B3SL 1GC6A 2K8BA 3IT6B 1E8ZA 1N5XA 1L1OA 2FCMA 1PH8A 2K39A 2Z0SA 4ZRIA 2L0CA 3I3TB 1BR9A 3AM9A 3PVLA 5DPRA 4J6IA 3AYHB 2Q2HA 5IWAQ 5D2MB 4ZLTF 4DR5Q 2N1VA 3MXGA 1ZDXA 4FADA 4G7OC 4GU2A 2NVTH 3DM1A 3H7PA 1N5WA 2PW5A 1R4PB 1HZBA 1TKWB 5ELNA 1BT0A 2IZVB 1S4ZA 1E90A 1I4QA 3I4NH 2JA8G 1LT4D 3L13A 3ND9A 2UUCL 2E6XA 3MXNB 1LT6D 1VQFA 1R7SA 1STAA 4PMCA 3RNUA 4DNRB 1TT2A 3UI2A 4YCVA 1CT1D 3ONSA 3AEDB 2R93G 4IWOA 4WRDA 4YCUA 3D31A 3PRMB 4R3DA 1KNAA 2ZM6L 3RNFC 4LNIA 1KM7A 1S5FD 1VCIA 4YY3Q 2ZXPA 2NPTA 3I4MB 1FD6A 1HZCA 2I38A 2F0FA 1I6HH 5EE3A 1ZEQX 4FXDA 3EN2A 4QB4A 3RZOH 3KJOA 1I94Q 1IL2A 1P3QU 3KYCD 4GNXC 3R2IA 4C3HH 4A3MB 2EQSA 1WD0A 2ENBA 1EQQA 1Q46A 2X69A 2E75C 4JVZA 1PH5A 2GBJA 4KMUC 5FJ8G 5JH5C 2VL6A 3A7LA 3SK6A 1WXSA 4ICVA 1NR2A 1EY4A 2QILA 2NBVB 2IJ0A 3EVQA 1L2NA 4CHTB 2NZHA 3Q14C 2B2WC 2E2IH 3L54A 3SR6A 1OXTA 1XEEA 4BKSA 1IKLA 4NDXA 2XK5B 4JW0A 5HGTA 2HHHL 2RMMA 2JJQA 1EYDA 1WGGA 1WCMB 1KXLA 1XLPA 1A63A 2W3SA 2DNCA 2JT4B 3T53B 4QMGA 1V5OA 5KNDA 1KQSA 3RZOB 1WX9A 1YI2A 1MHHE 2N7EA 1LLRD 1SNDA 4LWCA 2JK8A 5C2TB 4HXDA 2KLCA 3UF8A 1V43A 3JAML 2MJEA 1R4QB 1F2RC 2IDYA 1WJJA 1XXGA 4OZCA 4LFCL 4RF0A 3HOYH 2Q5WD 3CIRB 3H3VC 4P6VF 3CKIB 3Q2AC 4LJPB 2L52A 3Q8CA 1C77A 4MTKA 2AWTA 4PS8A 2LKVA 5LMNQ 4QIWE 1G51A 1SFOH 1VQ7A 4BBRG 3TBLD 2Y0SB 1IZ6A 5CV9A 4KKJA 4F7XA 4DR6Q 1S1QB 3WANA 1LXDA 2JWZA 5C44G 2CWAA 4IM0A 4FULA 1KDAA 1EFWA 4EQ5A 2YEPB 3WIMA 5L83A 3HOUG 3HEJA 1BF4A 1YZ6A 1DGJA 2F0VA 4NAWA 4P2CB 1FXAA 3WCQA 2MRPA 3Q8FA 2K7VA 1RKNA 4KD4A 3M9BA 5IGGA 3H0GB 1Q12A 3TBIB 4KVGB 4N9TA 3SGIA 4C3IH 2LXKA 3AE5B 1RTOA 3M4YA 1B2TA 1PA6A 4FJVB 2AEHA 3AU4A 1MIUA 2HCCA 5FK9C 2GBKA 4MSQB 2RBMA 4EVOA 1K53A 1WTRA 1AW7A 3AH7A 4A3EG 2E74C 2KECA 2BVCA 3QCAA 4MJSA 4J1MA 1LUZA 2PZUA 1HTPA 4ZCKA 4C00A 1DOMA 4OIJA 2RSUA 2Z6KC 1G6JA 1EO6A 4LF7Q 2PW9A 4DV1L 1BCPC 2KN5A 2BW2A 2WXFA 5EKKA 1XNRL 4ITKA 1EYCA 1LTGD 4C3IB 4WJ4A 1CJEA 1HNZQ 4K6LA 4WJWA 4JI5L 2JA6B 2EZVA 1F9PA 4BY1H 2AHOB 4C3JG 1MVKA 2PLPA 4H2AA 4I6NB 4MGIE 2WX1A 5EE9A 2VQEL 1EWIA 2K28A 4XE0A 2V4LA 3TCAA 3GTPB 4MEMA 4YXDB 3VA7A 4MTNA 1CA5A 1PMRA 3Q6SA 1WR1A 4WWNA 3C1FA 2L15A 2G45B 1BVSA 5JXVA 1IBKL 1SYCA 3ULLA 3EFCA 3GTMB 4JI1L 4X57B 3MZ5A 1CQFA 1GD7A 3UE1A 2ID0A 1JCKB 3T1YQ 2NVXH 3NJTA 4I6LB 3P63A 4PK1A 2QDLA 5DLQE 4QQBX 3HM3A 2D07B 1GXDC 2WV6D 3T16A 1WM2A 2CHWA 1DJRD 1A2UA 4YCWA 3QJYA 4HVBA 1ZKHA 4L5RC 1ACCA 4FNFA 4CJ2C 1FFVA 2JA5H 4BY1B 2HDEA 4JG2A 3VR5A 5C4XB 3C1EA 4OX9Q 2AX5A 2BS3B 1XPRA 3PO3B 2F0GA 3KWVA 4B08A 2EYPA 1HQMC 4NZLB 1ENAA 1IBMQ 2G5DA 1UD7A 1HZAA 2DWQA 1YX6B 2YTXA 1RRBA 5LXHA 1G291 4K8JA 1FNWA 2R3ZA 3SDZA 1Z9FA 2D2CC 3G7LA 3TS2A 4BXXH 2KO3A 3GV3A 4C7YA 1PH1A 1I4GA 2DUDA 4FP5D 3TIXA 2CHBD 5HI1A 4GLSC 3W3AA 2KOLA 1RD9D 3F1ZA 3MP9A 3T8MA 2NVXB 2WXQA 3HZXA 3BU2A 2B2TC 3NZSA 2OF1A 4CO7A 4FF3A 1EF5A 5DCNA 4URKA 3SE0A 2JP1A 2Z59B 5I9OA 2L00B 2CW0D 2ZJDA 3QOJA 3NQIA 2KMAA 5TR5A 1PTOH 1ET6A 2O6VB 4C1NK 3X23A 1K8AC 4DV4L 2FBWB 3OMGA 4TRDA 1V86A 2NCNA 1KRSA 1TY0A 4JI7Q 1A5RA 3OAWA 2QDFA 2KMMA 3M62B 4TKNA 2D62A 4F7ZA 2WLBA 4CYEA 1JWUD 1XJVA 1KRTA 2E3TA 4NY0A 4LFBL 2PZTA 4GIVA 2B3AA 3M4PA 5JVG3 1XMQQ 5E7NA 1E24A 4QGUA 1QB5D 3DBSA 3QWZB 4LF5Q 3SXHA 3HOVB 1HH2P 2XSCA 3RUIB 3A54A 3A9KA 1HR0L 1PTOB 4AQ7A 2QSDA 2A69C 1WM3A 3HKZB 3SFEB 4GMVA 1YNXA 4A3JH 4GKKQ 1GUAB 2N9PC 4CHKA 1YQBA 1YQ4B 5CV8A 1MGSA 4J8QA 2PQAB 3BG3A 3LB8C 4W9IA 4WIPA 1PFDA 3CCEA 4G7ZC 3VYSA 1F9RA 1WTXA 1YJ1A 3C46A 2D2QA 1SYDA 2J0TD 2FNJB 1LTAD 2F3VA 2RDGA 2KYWA 1KTKA 4HK2A 2PI2A 4YWKA 3V2TA 5JJIA 1V97A 4X64Q 3HRDD 4POFA 1K73C 1TKGA 3R3MA 5KYIA 4JI6Q 1DD2A 2G3QB 1GJZA 5J39A 1OTCA 3Q8DA 4P72A 1CI3M 1KC8C 2R93H 4FA6A 5LXIB 1Q3LA 4A3JB 2WAQG 4DV2Q 5KHQA 1PYSB 4A75A 2KTFA 1E8YA 3A74A 3CMAA 1LTLA 3A33B 2VQFL 3JAMc 2E2HH 4K2LA 4OELB 1L0YB 1P8LA 4EQNA 3M85A 1J7BA 2WKCA 4GDLA 4A3GB 4CDDC 1F2LA 1IHZA 1OEYJ 1WRDB 4G50A 3NUCA 5I4DA 1GUNA 1XTDA 1FL0A 4MIUA 2J7QB 5CHVC 3RD2A 3PGZA 2KHSA 5HURA 3CCRA 2IY0B 5E6PA 4IKGA 4G0NB 2PTLA 1K9MC 1TQOA 1GUTA 1E7ZA 3MVVA 1KFYB 2PIAA 3Q3OC 2JVCA 2WU2B 3SU8X 2ZTDA 3UDFA 4KGRA 4L6TB 4BFRA 4F8CB 3RFZB 2BYFA 3NENA 3PUYA 2WU5B 2RSNA 2DZMA 5I2YA 2DZKA 3J81L 1ZE3D 1VQDA 4DR7L 2BF8B 1S5ED 2D11A 2JSVX 5H92C 1VCBA 4DXAB 1SE2A 1Z47A 4PMWA 3MEFA 5GAEC 1BUIC 1Q8IA 2KOXA 3VAWA 2JRHA 3DWMA 4JI3L 2RA4A 1C76A 3N9YC 2UXDL 2WHIA 5JZEB 2BBCA 4W9HA 1KHIA 3GTJB 4LK0M 2CH4A 4WURA 3CSTA 2FUG1 1E10A 1P1AA 4NJCA 2KZRA 2OCEA 3GO5A 4DDGD 3M7GA 2HDMA 3X3NA 2F0HA 5LMNW 1GJXA 3L0WB 5I2XA 2BB5A 3HOWH 1WX7A 3HOXG 2BYTA 3OMCA 2AUJD 1RTNA 4RHRA 3AB9A 4XYOA 4GN5A 2MSED 3H9DA 2PKOA 3Q8EA 4N9F4 5C0XJ 3ZNHB 1A8VA 5M3MG 4HIKA 4RNAA 1SF0A 2WDTB 3I57A 5EDSA 4A3FG 4O0AA 4EX5A 3ZVVA 3LX0A 4O1NA 4OZBA 4R4TA 4BBRH 3A56A 3CRKC 1XLNA 4NJ6A 3HVZA 3BZKA 4DK1A 5JJZA 5DPWA 5C44H 1I3QH 5BYQA 4HEDA 2N9LA 3W5VB 5LHY1 4DR1Q 1HNWQ 2WXNA 4APVA 3CCQA 3HOUH 1QG7A 2PPBC 1G91A 2FUHB 5EKLA 3K9OB 3DWAA 3RLNA 4DR4Q 3S1NH 2O5JC 3RN9C 4IW0A 4EOYA 5E6NA 1AEXA 2H88B 3CWIA 3V62A 1P98A 4L1BA 4C1NI 1RIPA 1X65A 5G3LD 3BWUD 3E56A 3P42A 2QW7A 1WH3A 4BKGA 1WZ3A 5FO7B 1WJUA 1T9HA 5FR6A 4DA2A 1K3BC 4KV2A 4B9WA 5J3BA 2LRUA 1WE7A 2ES2A 5JEAG 4JCVE 3D4WA 4A3EH 3D8GA 2L83A 4HAEA 4EGVA 2O2VB 5EBDA 3NVYA 4KI0A 3BYTB 4Y7NH 3J9CA 4B6WA 1JMLA 2M17A 1RF2D 2UU9L 2WXRA 4ZAIA 3L4PA 4HDOA 1J0GA 4LJOB 3I4OA 4FHKA 5T1IA 3NVWA 1AE2A 1UF0A 2Z1CA 4A3DB 4IOCA 2HIVA 2KCNA 4A3IB 2QDBA 1YJNA 3HHMA 1L0WA 1SNCA 4LF4Q 1JRPA 4US8A 3E0EA 1T0SC 3QA8A 5HY6A 2N3SA 4HIOA 4C3JH 3KF6B 1T5XD 1SNQA 3ERSX 4X3UA 1UGMA 1GAQB 3GZNI 1AYFA 3APDA 1I4PA 3RUZA 1PTOC 2IX0A 4YWMA 2VRRB 2Y5PA 1NENB 3G71A 1KIXA 3D32A 4Y7NB 1F2ZA 2BQQA 3U30A 5ELBA 1IKMA 1BCPD 4ZKBB 2FXQA 1HEZE 1KRHA 1D5MC 3TP5A 1QVFA 3AEBB 4UPAA 3I5JC 4A55A 2C5CA 3VUXA 4RWSC 1HUMA 1T5EA 2MP1A 2MHVA 3SFDB 4KN4C 1IBXA 4C3HG 3ZGZA 3KF8B 5M5WB 2KTRB 1MI0A 1VQBA 4YWLA 3BS1A 1SYGA 5C23A 2NVYB 4KDLB 2ALYB 3NSWA 1ILQA 1L0VB 4LW1A 1KLVA 3O13A 1VQGA 1EUVB 2LS01 1QWYA 2B39A 3ZKJC 2NN6G 1Y1WH 1WR6E 2MCNB 3I8ZA 3NOBA 4EE2A 1TKYA 4X3SA 4KIKB 1E2ZA 1STGA 1X9NA 1PH4A 2UXBL 2V3NA 5C3WA 1O7ZA 4HIDA 2IHEA 3JC66 1B3AA 2F0TA 1LACA 2SNSA 4DAYA 3L08A 2K33A 2Y0SG 3T56B 1B9NA 3BDLA 3ULPA 3RMKC 5J17A 5IKCM 3CCSA 2B2YA 1OGWA 3N1ZC 2Z4HA 1LGRA 3MC9A 4ILWA 2AKWB 1EIGA 3EJIA 3PT2B 1JALA 1C48A 1PFNA 3FMCA 3M3YH 1K28A 2MJ3A 4HKZE 1CZPA 5AZFA 4TQ0A 2K75A 4DV0Q 4LNKA 1BO0A 2M19A 3H0GG 2M00A 2BKRB 2M1MA 4EZKA 5FLXc 1SE3A 3PGEA 2QC8A 2KJHB 3VHTC 2A5UA 1HTQA 1BKBA 2DNEA 1IPGA 4GDKB 1JOKA 4K6DA 4ZUIA 2L0TA 5IP9H 4IOAA 4K7SA 4JWSC 4NXNQ 1XNQQ 2RDFA 1RJTA 4CGYB 2M9VA 4TVAB 4JPBW 1D1IA 1C78A 5L95C 2I46A 1VDVA 2LVQA 4FF4A 2JXMB 1SIFA 2BE5C 4Y52H 1FNVA 1PQSA 2G9DA 3VQIA 2JX5A 3HG9A 4HDQA 2EY6A 5CV5A 2I2YA 4ARIA 2K1FA 4DR4L 4IQZA 5BYRA 2BOSA 4OL7A 2WQYB 4AS1A 4C3IG 1SIJA 2DX5B 3LWEA 2Y5BB 2JA6G 4FXGC 4DV5L 1HFGA 4GNXA 1VQMA 3QQ8B 5BYSA 2EE1A 3FHWA 5CBEE 3NUHB 1SEBD 1Q86C 1EY6A 3AU7A 3JW0X 2AWOA 3M7NA 3J81j 1SMYC 1KLGD 4AQYQ 2OT2A 4L63B 4N9PA 5LMUQ 2FMMA 3SVMA 3TMEA 1YN3A 2MBOA 3Q23A 3U4VA 1AE3A 2B2WA 3ZNZB 1EZ8A 3VR9B 1CZGA 3FKIB 1JC7A 4S17A 1KAAA 1DZ1A 3ECIA 4KKIA 5HGQA 2M0AA 3H3VH 3TN2A 3S2HH 3AEEB 5HHDG 2A69D 3J81c 2LGSA 3AULA 3KJPA 4OHJA 4TQ1A 2KJXA 4X66L 2YU9B 4NAMA 1U4PA 3Q0AA 1ASYA 2L3ZA 1YEZA 5EBCA 2HE7A 1EIFA 4BY1G 4MGKE 5C4XG 2DNFA 4P71A 3APCA 3H3VI 2JEBI 3K5OA 4XC2A 2H4OA 3GV6A 4TV3A 1CM9A 4OWXB 1ISNA 2DYBA 1X32A 1YX5B 2JZ3B 3LNNA 3J81E 3K7AH 4XT1B 3RNGC 5DNFA 4FVMA 1QUQA 2K5DA 2ASQA 4JIOU 2EIFA 2PNHA 2QEXA 5M5YB 2K3UA 1E8WA 3S2HB 3IVFA 3E9SA 4ZHPA 1B8AA 2X38A 2MO0A 1SE4A 1IYUA 1LTTD 1QOHA 1BBUA 2L11A 2KD0A 2B8FA 2R2OA 1JORA 3AE9B 1S5DD 4NPNA 5IAAC 1SYFA 4CJ1B 2R92B 4HCPB 2CU1A 1KOTA 2JA5G 4YWGG 3IG3A 4DV3L 1N32Q 4H44C 2D3GA 4MM3B 2MJDA 4K5VA 5K36G 3SDLC 1LTID 1UE6A 1VF5C 2GI9A 1WOCA 3K5MA 1GVPA 1HPCA 1LT3D 3Q22A 1Y56A 2CFMA 1N36Q 1PUTA 4IUPA 4FJYA 4DV7Q 3KVFB 2C9OA 2L1AA 2A19A 4WJOA 5IGFA 3OTOL 2UXCQ 4C4VB 4LMQD 3DOWA 4UP7A 3S1QH 4M8MA 3UQAA 1CZWA 1E6EB 1PGBA 5DPSA 2NTTA 5CV4A 1S3OA 4JI4L 4FXKC 4DAMA 1ZP0B 2JYEA 3KLWA 5KYLA 4NXML 1MFWA 4KKUA 5C5LA 3HOXH 3CPWA 1VQNA 1QKZA 1NYQA 5NUCA 3IFDA 3E9IA 4AWJA 4H13C 3PHWB 3I91A 3VA5A 5M3MH 1TR5A 1VQHA 4IPCA 1QOAA 1R4MI 1J9OA 4A3FH 1C0AA 3VH4B 1XX8A 3JSVA 2WB1B 2HTHA 2JWUA 3HKZG 1OXXK 2K03A 1PDXA 1HZ5A 4G3XB 3K81C 4G57A 5IODA 1QVGA 1C4AA 4A3CH 2VZKD 3ZW3A 3NVVA 3HOZH 1UE1A 3VUYA 2RDBC 4NQKE 2EVBA 1FYCA 4A3BB 2WXGA 1RHPA 5D94A 3VTVA 3I72A 5IGCA 1KDCA 1U4AA 4L5QA 2W82A 1NBFC 2ASBA 1E0ZA 1R4NB 5JJKA 3S2AA 1ZYRC 1YHQA 3FILA 3KWLA 4HCEA 3FP9A 3ZRCA 3CF5A 4C7ZA 1WX8A 5G5GA 1W3SA 1AP0A 4A93H 3NP8A 2KLGA 3L16A 3RI7C 3EHVA 5EPJA 5TSSA 3VR2A 2K04A 2MA9B 5KHOA 4KHPL 5KEEA 5JEAH 4FXCA 4GB9A 4YHHQ 2KACA 1HCZA 1TS5A 2EYOA 4XDXA 4A3JG 1RAXA 4DNTB 1UBQA 3EECA 3KW5B 1N34Q 3J7A5 3ITPA 5BR8L 3HOZB 3I4MH 5HFYA 3U4EG 3PZ8A 2WB1E 2F3WA 4ZUJA 1WFYA 2KWVB 1F77A 4KY6A 3H1UA 3I9V1 4N8X1 3MXNA 5IYBH 1WFQA 4A3GG 5IN7A 1Z6HA 2A4ZA 2MWSB 1SN8A 4ANXA 5AEKB 1UZXB 3S17B 2B29A 1TVXA 3ND8A 5CV6A 4US9A 3P1HA 4DHZE 1K8OA 2F3IA 2HCIA 4A3MH 4IPHA 2J0MA 1PLFA 3EIVA 4CJ0B 4JC0A 3P1MA 3BDOA 3APFA 4A93B 3H7SA 1L0XB 4YT0B 3WAPA 1YN4A 2RCFA 1C9FA 3VYTA 4W9DA 1JQ4A 1SBBB 1L6UA 2O6VD 2JA7B 2KKCA 4HJ9A 4K5XA 4BKTA 4BBSB 1RYJA 5M9OA 5EPKA 2B2TA 1XCQL 1FR3A 1L1OB 2SEBD 3D4DA 3S1MB 2J0JA 3E0JA 1K3RA 1TTNA 3NRZA 1GUGA 4FHJA 1WCMH 3SK4A 3JVZX 3KYHC 5C3XA 1GPXA 3KYDD 2C7NB 4BKSD 2UYZB 3DVGY 3QK0A 2AQ2B 3H7PB 2BYVE 5CC4A 1HZ9A 2KHJA 2XRQD 1NDDA 3Q3MC 2XK5A 4IG7B 3B9JA 3ULJA 1PTOD 3PHXB 4M02A 4BA1I 2NN6H 1HE8A 5C4JB 5JHBA 3AI5A 2FMCA 1FJGQ 4NP5A 2IO1B 4K1RB 1DCZA 2YV5A 2LGIA 3PIP3 2K5QA 1OFFA 2NPTB 1HXYD 1XT9B 3ONAB 4ME5A 2EY1A 4J15A 4E74A 2NN6I 1H9SB 4UAIA 4OZAA 3DHQA 4DK3C 4UY8C 3TRZA 3MJWA 3SR1A 1EEID 4K0KQ 2CU3A 2V4DA 2L7RA 2D0PA 3QG1A 4W9GA 4EUTA 2PO4A 4WQOB 2M0XA 1FM0D 1N33Q 1JJCB 2I5LX 3E9HA 3H0GH 1R9TB 2ZPNA 3HOWG 1ROEA 1NNXA 3P4RB 3RLFA 3DM3A 5IOIA 3CMEA 4ZYNA 1V2YA 3CPFA 5IYCH 2REXA 3CF6E 2NZ1D 1GNUA 2WYQA 1L4DB 3T4AC 3S16B 1VMPA 3TREA 1OO9B 3KFUA 3L10B 1OXUA 3RULA 3Q8AA 1Z2MA 5C3JB 1TWFB 2EDGA 4AP4C 4IC7B 2J52A 1WI0A 4IJHA 2EELA 1X54A 1SNMA 1LQBA 1WXMA 4A3DG 2F03A 1A3TA 4A3IG 2IY5B 3VTWA 2PVOD 3TEZA 1EUJA 2JXXA 2JA6H 4DR3L 2N1WA 3EFXD 1WYGA 2RPVA 4TKOB 2NBUA 3JYUA 1L6VA 2FCNA 1HNXL 2PE9A 1ZXHA 3IFTA 4IUNA 3E6ZX 4DPGA 3GTPH 2SOBA 3NS8A 1RODA 5G55A 4PNYA 3NK9A 3N1XC 2ZJPA 3OW7A 2BE5D 1NJIC 5IWAL 4MHEA 4B0EA 4DR5L 1WTPA 4ZHOA 2ICIA 2K6QA 2FJ2A 3I56A 4IALA 1RCVD 3C0RB 3GTMH 3B6YA 3RR5A 2Y0SE 5EE0A 5IYDH 4IUUA 4ODGA 5KGUA 1PH3A 1TJEA 2LI5A 2MP2A 4BOZB 5JJLA 3PREA 4NAWB 5EJWA 2FIFA 4XX5A 3VRBB 5CORA 4JBJA 3UDIA 3ZNGC 2KVMA 4QUFA 2LXCA 2Q2UA 3TEYA 5C4XH 1SMYD 1JWSD 1X3QA 4LUZA 3PO3H 4LDTB 3DBHB 3PPAA 1MKHA 4HEA1 1YJJA 2KQ3A 2J42A 4KY5A 4RA8A 1YHAA 3HM6X 4YY3L 1IW7C 2R7FA 1ZPSA 5AJ3Q 3GD7A 2K25A 4MJSB 2XEWA 4ACFA 1RWSA 4OEMB 1XQQA 1QQRA 3M63B 4L5SA 1WTVA 1I94L 1CQVA 4LNNA 2EYLA 3G6EA 3BIID 2H1EA 2BWES 2KK8A 5I6WA 2CKZB 3GE3C 1RFAA 1SJED 5K36H 5E6JA 1B50A 1PH9A 2BPSA 1Y1WG 3KLSA 1BNZA 1WXQA 5JHAA 5GMVA 2Z0EB 2DJFC 3B0AA 1T0RC 1NBWA 2JYOA 1QLBB 1F52A 2X6GA 4AUQC 1YNJC 4GKJQ 3W5UB 3CCLA 2AYOB 4EZLA 2KHIA 3TP6A 2D3CA 5AZHA 2ZXOA 2VNUD 1GUOA 2J7ZA 4X6AH 2KEEA 4A76A 3DWQA 1C4QA 4RHSA 1SSNA 2O6VA 1JR0D 1LYLA 1NR4A 3GTGB 4F8MA 3HOVH 1PGXA 1PZID 4A4IA 3P4PB 1E7UA 1TWCB 2MO1A 2QF7A 1MG8A 3HIZA 2WKDA 4CDFC 1YNNC 3DBLB 2W3RA 5IIFA 5IP4D 2BA0A 1BXTA 2CR5A 1FCLA 1K51A 1WYWB 2EY5A 3J7AF 3V6EB 3MXUA 3BYYB 4GN1A 2L5TA 2RHSB 3MHBA 1A0IA 5LMNL 1DXMA 4OXPA 5IP9G 3GTOB 3IL8A 2E76C 3EQLC 2INCC 1X3EA 4DK6C 1ZOYB 2LXAA 4DR6L 2OOBB 1B4OA 2ZW0A 2CJOA 1QT9A 1QF6A 2FHTA 3FKIG 1PZJD 4AYBB 1UGJA 4QY7A 1KNEA 1I4XA 1XMOQ 4DBGA 1A3VA 2SAKA 2PW7A 4KGSA 1Q1BA 2KFKB 1PRTF 1EL0A 1SB3C 2V0GA 1YVCA 1S40A 2LMCA 1PV4A 1V1PA 2NVQH 4IJLA 3RZDH 3PO2B 1NVID 3N32A 2Q8RE 1H9JA 5D7GA 4AJWA 2ZCCA 2PNRC 3JAMi 1ZYRD 1C4CA 1NYRA 4C2MB 5C3EH 3VXWA 4A3GH 4N58A 1STNA 3GQBA 3PV1A 1BQQT 2KWCA 2ZTEA 2MBBB 4NQLB 2LFNA 4M8AA 5IGEA 2MJ8A 2RCNA 4JI0Q 4B3MQ 3AEAB 1D5ZC 3I73A 1E9MA 4J6HA 4LF7L 1ZXIA 2C60A 4YTMB 3OJ4B 3P7JA 4LNFA 3DHHC 3ZJUA 4RGMA 1X3PA 1B44D 4AYBE 3TQYA 3A9KB 2QMTA 1HNZL 3B1LX 2ZT9C 3GOEA 1X3GA 4NMZA 2R92G 4OO1G 3D4RA 2NVQB 3ZUNA 3RZDB 4CQNA 2NS5A 4M00A 2NVUI 5C0XG 3ALBA 3I90A 2A6EC 4W9JA 4UP9A 1EU4A 2CH4W 3H91A 3HKZE 5C3EB 1SXTA 3U7ZA 1SRUA 1E1OA 4KY7A 1GKHA 4EQPA 1SE9A 3AEFB 4YSYB 1Y1VB 3WOEA 3NTHA 3AU5A 2V1YA 3PZ7A 1DOIA 4IOIE 4JBKA 3PSEB 1VQ9A 3J80L 1C1YB 1NCVA 2DY7A 3R93A 3GTJH 1I42A 4PZ8A 2F0JA 1WVLA 1WD1A 3UE0A 2JXTA 3T1YL 4GSWA 2P5ZX 2KDBA 1SROA 3A8IE 5J1ZA 1ONLA 1Y14B 2NR2A 3VRAB 3TSSA 2K4KA 2PMZB 1TYGB 2HTME 2A68C 2GLSA 4OX9L 2KANA 4XDCA 3UINB 5ELFA 1GOZA 2OTLA 4GOPA 4X3TA 2KBNA 3ICEA 1UWXA 3HKSA 3MXPA 1IBML 2L0FA 2XIWA 4DHJD 4LNOA 2VH1A 2N9KA 2WB1G 4LUVA 2F0SA 3GTQB 2JA8B 1UNSA 4JI8Q 2KDMA 4PG3A 4GDLB 4IUVA 1SAPA 1VJKA 3L0OA 5GXGB 1FEHA 4P73A 2EXZA 4HWIB 2WXJA 3W9CB 4G7HC 2IY1B 1B9MA 2DY8A 4K81A 2PCFB 3K0XA 3PF5A 4IFDJ 5AUIA 2OXPA 3CC2A 3AE3B 1CKMA 1U0LA 5D6JB 2AMCB 3PIO3 5BMIA 3PUXA 1JWAD 3AMZA 3U8ZA 1UH6A 1ZDVA 3GS2A 2ZTCA 2BA1A 1CKOA 1PFSA 2EYHA 5BN3A 1HTOA 2TSSA 2CQAA 3A7AB 4HJGE 1WTOA 3N30A 4RM8A 2V1CC 1TY2A 1EIYB 2N9XA 2RD0A 2INNE 2WXPA 5KNBA 4DNIA 1K52A 3HRZC 1X6OA 1IBLQ 2Q2IA 4KGTA 4JI7L 1I4HA 4A3CG 4FYDA 3DPDA 3HOZG 2KENA 3CMMB 1ENCA 5K5PA 2M4NA 2PE6B 1Y8NB 2C5LC 4KX6B 3ZJTA 2LVOA 1G8ZD 2E8GA 3DMUA 4KHVA 3HFZB 5ELDA 4A3DH 5COYA 1FRDA 1E0BA 1NMGA 5M3FB 4OWWB 2QCPX 1P7EA 4GN4B 1CKNB 3ZJYC 5JPMC 4A3IH 1XMQL 4KJNA 2HD3A 1FNUA 3NE5B 3Q24A 4LF5L 1VQ6A 4I6PA 4I7ZC 2VUMB 1SGHA 1VMCA 4LFAQ 5T8IA 2CHZA 2K5NA 4A93G 4DKAC 4LF6Q 2QGQA 1BUVT 2O2LD 2KXJA 1T0YA 2GN5A 2JE6I 2KUMA 2JA7G 1FMAD 3V05A 3NTKA 3MHZA 2R7ZB 4BBSG 3D6CA 5GROA 4GKKL 3Q3JA 1WMHB 2N49A 4FLHA 4ANWA 2BCOA 2EXDA 4AH6A 4B3RQ 1JE4A 3S9WA 3DEPA 3I4MG 3UDXA 1M1KC 4U673 2A5HA 4B0MA 3IT4B 4KJOA 2K8CA 3SK8A 3KF6A 3L17A 1WYDA 1D4BA 4LF9Q 1WXAA 1V80A 4DUZQ 3U7DA 5M5WH 2YVCA 3ZXRA 4A3MG 3K8AA 3FKYA 3F2UA 2R7DA 4X64L 1GHKA 2NVYH 3CXCA 1ET9A 3DQVA 3TZUA 1MBYA 2GA4B 4JI6L 2J53A 4RM9A 2JPHA 5IO9A 3KOJA 3KLRA 3A9JA 3B08A 1J5EQ 3OPOA 2EKIA 4ARCA 3MTSA 4M8NA 4X65Q 2MNAA 4DK5A 5FR3A 3DWGC 4DV2L 2IO0B 5C4ZA 4DR2Q 4B3TQ 2DBYA 1PH7A 1WCMG 3FDTA 2LGDA 1TWHB 1ESFA 1SE8A 1HZ6A 4WWMA 1JRUA 1V9PA 3K5LA 3N20C 2LJIA 2VW9A 3QIAA 1D3ZA 2SDFA 5D3IB 2D10A 1EYGA 3DEOA 1CHPD 4JWUC 2K8HA 1GB4A 2F4VQ 4GGQA 2JUOA 3WAMA 4EZJA 3NEMA 1WGYA 1LFDA 2MHJA 3VVWB 2CKHB 1S5BD 3B2FA 1STEA 2K5WA 1V1QA 1ESRA 1IW7D 3MFYA 1O78A 2A1AA 3E5SA 3DDCB 5CHWA 1DOYA 1DOKA 4X62Q 2MEKA 2IYDB 3PMFA 3T3OA 5FO9B 3KUZA 1XPOA 3BZCA 3IXSA 4DUYQ 3ZNID 3G4SA 2AQ1B 1TS4A 2B3GA 2YYZA 2KQ7A 2BDNA 2N88A 1V8CA 2LD9A 3P75A 3UGBB 4IUTA 1YIWA 1TWAB 2B2VC 2IHFA 4YL8A 1IBXB 5CV7A 2ZNVB 5J18A 3D6WA 3VFKA 4KK7A 4GDKA 4XQNA 1BBWA 4AJYB 4DGZA 3DVNU 4R4IA 1PFBA 3N52A 5IP7G 3KDFA 1UAPA 1I35A 4A90A 2UUBQ 3MTNB 3EUB2 1IYJB 2F0OA 4WJPA 1N60A 1YNJD 1VQKA 2I0QA 4TQUS 1WGKA 4DV6Q 5IYCG 1E7PB 2KQSA 2N9EB 2QCZA 2XBBC 1Q8KA 1V1OA 1VQEA 3P20A 1L2FA 1STYA 4G4KA 1PH2A 1XLOA 2WXIA 3DBRB 3AN1A 2A74C 2KJ6A 1DM0B 1SSOA 3S15B 4DAYB 2J0KA 2L55A 1G2SA 5H8YE 1SYBA 3NBHA 4IZ8A 3FKIH 4DR1L 1HNWL 4NNJB 4HMJA 1S5CD 4HSPA 1YNND 3GP7A 3R2TA 1QZHA 5E1FA 4JBMA 3KQ4A 1EOTA 4A9AA 3BK1A 1B1ZA 5IGBA 3T1HQ 3J81i 4JI2Q 5LNK1 2F0QA 2YU9H 2LWPA 5CHFA 1YOVB 5LLIA 3RZWC 2X6LA 2M2LA 4YIJA 4BS9A 2F0NA 3ZDTA 3VYUA 2O4XA 4JQWC 4PS3A 3ER0A 5C4HA 5BO4B 1WI5A 4RAUC 5C5MA 4KKTA 1NMFA 1NUCA 4XT3B 1WTWA 2H89B 2LJ5A 2ZZPB 1J8IA 4K7UA 3VR6A 3LYYA 4N8FA 1RL2A 2WIIB 4JV5Q 2XGTA 2ZVNA 2KDFB 4JX1C 3QOLA 4HROA 1J7AA 4N59A 1CHQD 4KZCA 2FE8A 2AL3A 1JW9D 5M5YH 5IYDG 2YLMA 2KCTA 3CD6A 4QAYA 1P16A 1TXYA 4B3SQ 2MH7A 2E5LQ 3J80E 4EQOA 4LF9L 2PJHA 4LF4L 3PLVA 4PZ6A 3QC8B 3NZUA 5GADC 1GM5A 2R92H 4OO1H 1Q10A 1A62A 2UU7A 1HUNA 4GLAC 3TJPA 2LUMA 1CK1A 1U4LA 2B2UC 5C0XH 3PO3G 3FAHA 4GNXB 5DEHA 3DVGX 5D3DA 2JY6A 3AEGB 1D2BA 4MSMB 2KN4A 1CSPA 4OVVA 4XYCA 4DN4M 4YSXB 3OIPA 3RYTA 4IUQA 3K6OA 4PYUA 4OO1I 3WAOA 1EWHA 2UUCQ 2WXOA 3KK7A 4ZRZA 4JOIC 3X3MA 1STHA 1TS2A 3V61A 3MWYW 2KVZA 3MEHA 5M5XH 5C0XI 1TZ1A 1V5TA 3CRLC 3PUVA 1MJEA 1EU3A 3NHHA 2IX3A 3E3XA 1WGRA 3LDZE 4MM3A 4NKLA 2ZM6Q 1DONA 4H02A 2BTEA 4F87A 1Z7TA 3RCZA 3EROA 3IAM1 1UELA 1MD2D 4JBWA 2A6ED 3CP0A 4A3KB 3STBD 2EMSA 1Q90A 1TWGB 3RLOA 1E22A 2K01A 2EOTA 4BWGB 1ASZA 4POGA 2KWDA 4YSZB 2C7HA 5HKHA 3A1QB 2KFJA 1EFID 2OWOA 3TZDA 2F0EA 2W54A 3NVZA 4PS7A 4JK1C 4V0BA 1GB1A 4MELA 1PDQA 1I4RA 1STBA 3LJ3A 3QX1A 4BBNC 3QAQA 4W9EA 2RVLA 2AUKA 1QILA 5E3FA 5M5XB 1EF1A 1QUQB 2F0LA 3U9OA 4A3BH 1K8GA 1XPUA 2E2JB 2KHWB 1H8CA 3M4OH 3T9LA 4BY7B 3W2DA 1OTRB 2N55A 3K5NA 2A68D 3I70A 2WAQB 2I5HA 1SR3A 2ZCBA 2HHHQ 3CC7A 1H9KA 4AYBG 3GTLB 2MGSA 1AZQA 3DWPA 3HOVG 1XWEA 4PV1C 2IGGA 4IPDA 1J6QA 3PUZA 1KABA 1XYIA 4OONA 4DV0L 4P75A 2IO2B 3DCGA 2Z6KA 3IAS1 2KAJA 4Q5VA 3ML9A 3G6JB 2JEAI 1H4RA 3AQQA 3EC8A 5JAVA 2BS4B 4LLGM 1R4NI 2YTYA 5IT9L 1H9MA 3VR4A 3MC0B 1H9RA 4MT5A 2F1MA 4M1UB 3PO2G 3CHBD 3D3RA 1HRJA 3R7QA 2F4IA 3A55A 1SYEA 3S14B 4M0WB 3WWVA 3RPFC 5E4XA 4ULLA 4XXEA 3PSIA 2IW3A 4LFCQ 3UI3A 2DAFA 4RMFA 4C4VA 4NXNL 1XNQL 3L7ZC 3C3LA 3M4OB 2N4FA 2RSOA 2RHQB 4RG1A 2TMPA 3GDEA 4HCNB 2HT1A 3S17H 2BWFA 4KHZA 4R4QA 4RCOA 3TMPB 3NQTA 4MN3A 3I4LA 5EPLA 2KDIA 4XZ4A 1RLFA 1PHJA 1XLQA 2LRWA 3K80C 4XDDA 1A15A 2JA7H 1X55A 1SNOA 4CDEC 3V3XA 2QHOA 1W6KA 4O42A 1M94A 1MG4A 4BBSH 1MI2A 3DHIC 2D3BA 4ANUA 5EE1A 2N0SB 3S1MH 2SNMA 1Q81C 4P1CC 2LASA 1VQOA 2KA7A 3TEWA 5G3LF 3KH0A 1G6PA 2FCQA 1F2YA 4GZYC 3OOCA 4AQYL 4MGYE 5LMUL 2L1BA 5C3EG 3C8YA 3P2BA 1LTSD 1DGSA 1TIID 1HA5A 4IWPA 4ZRJA 4RGOS 1E1TA 3PLUA 1EY0A 2N78A 3FPUB 1FXTB 1NE3A 3OW2A 2MQHA 4K5WA 2WNMA 3FILB 2E5LL 1X56A 2KC2A 5CBAE 2B2YC 1I50H 1SDFA 4HSVA 2X8XX 2LGXA 1SJHD 2RPQA 4KSKC 2OQKA 3T51B 4LF8Q 4JL9A 3H8HA 1ICFB 4B9KA 2G9HD 2CVRA 5C4JH 2Z0DB 2MBHA 2WGSA 4IWQA 2JN4A 2Z9HA 3D0FA 2NBFA 1TGZB 4DV1Q 5IA7A 2MUYA 4L8JA 2VH2A 3NY5A 3IRBA 3W1SC 1NEKB 1XNRQ 4JYAQ 5AZGA 1TBEA 3OG5A 1O7IA 4QL5A 4JI5Q 2KQ4X 3GTKB 3T3NA 2GBMA 2HIXA 4R8NA 2VQEQ 4NW2A 1V49A 1BCPF 3RMHA 4CKBA 1YHBA 3NXWA 4NPSA 4DAPA 5DM73 1I50B 1N9WA 3W1BA 2UWQA 2LGYA 1JWMD 1R9TH 3G48A 4FF1A 1XO3A 2KEDA 1IBKQ 1K83H 1MJCA 1N32L 3BK2A 1NY4A 4R8IA 5JPNC 1H9SA 4JI1Q 2GB1A 4DQOC 3WOFA 2NVTB 2F52A 3NELA 1Q82C 1TU2B 1NI3A 1E5WA 4LK1C 3S16H 1VQLA 4TUUA 3ZYYX 2DYMA 2MBEA 3PRZA 3I4NB 4LAAA 3AE7B 1PYBA 5G5HA 1TWFH 5I9PA 2GBNA 5CMDA 1N36L 1YJWA 4DV7L 2D5GA 3AMUA 4KDIC 1IGDA 1WRIA 2UXCL 3V6CB 3FRPB 3SD5A 2QKIC 3AFPA 1U4RA 4PYZA 4HJ7A 2I1JA 1JMCA 1WF9A 1A2TA 1IYVA 1BOSA 3N6RA 4QIWB 5M3FG 3VH3B 1D1KA 1QOBA 5KIXA 3HK0A 3RNCC 2D9UA 2WFWA 5IP7H 4R9WA 1YJ9A 2KC1A 1U4MA 1K83B 3L3OC 2VUMG 1VZ6A 4WH4A 3RD4A 3H15A 4U68A 1I6HB 4MNOA 1WJ6A 2R6GA 1YIJA 1OXSC 2V3SA 1YNTE 2CQOA 2OJRA 3EA6A 4HPPA 4KZ0A 2R7ZG 5BMHA 2RDHA 4C3HB 1L5PA 3GB1A 1OXVA 3R3OA 2LFIA 3QB3A 3AE4B 2CHXA 4ICUA 2A73B 3IBEA 5BN5A 5GAHC 2JA9A 3F8TA 3N3KB 2E2IB 4OGQC 4ABNA 2A8VA 4GS3A 1Y8OB 2K52A 4EFOA 4DV4Q 4LCDE 2F0KA 2IX1A 1XD3B 1W6JA 2HDLA 2L05A 2NYZD 2LVPA 3TEXA 4K7WA 4W9LA 2MQJA 5DPTA 3J7AV 4DWFA 4LFBQ 1DYQA 4GOCA 2FFKB 5J2RA 4DXGA 3AB5A 3CCVA 4UP8A 3BJUA 1TT5B 3RT3B 4YHHL 4TSSA 1C8CA 1F9JA 4OVUA 1HJPA 1N61A 2VB3X 1N34L 3WALA 3QO2A 1WGDA 5JVH3 4QF4A 3DXJC 2GRIA 3HOYB 2DZJA 1L4ZB 4RKBA 4A3LH 4KD3A 1HR0Q 1WZ0A 3DBHI 1MJDA 1FD7D 5LL6X 4REZA 1VQIA 5H1SE 4E71A 2Z4IA 5CX3A 5EAYA 3KLSX 2KNBA 4ZRPA 4IURA 4EEWA 4HMIA 2NWGA 1Y8RC 1VR9A 1SFOB 2LXJA 5C6AA 1B3QA 1UWMA 2MPMA 1JB3A 3A0JA 2B63H 3TEHB 3CCUA 4LF8L 5IYBG 2PPHA 2ZEQA 1F9SA 2H5XA 2KJRA 4ZKCB 3U58A 4HJKA 1JOOA 3U4ZA 1VQPA 1FPYA 5T1GA 3VYRA 1IYFA 1J8CA 4AIMA 1JICA 4P7IA 1P0RA 4HJ5A 3SK5A 5KRUA 5A35A 3P4SB 5BN4A 1VDZA 2Q8IB 1GO3E 2J4XA 4JYAL 2AL6A 2BKFA 2WWZA 2ZJQA 3C2PA 1C9OA 2UUAQ 1C7YA 5IT9c 1AARA 5E6OA 2MP2B 3GTGH 4WJ3M 1ZW7A 2YEPF 3A5UA 5A2QL 5ELCA 1TWCH 2VQFQ 1JOQA 2G4DB 1MHWC 1CA6A 2EPBA 3AFQA 2B63B 4BOSC 2G1EA 1VF7A 1QOGA 1WJNA 1VQJA 3CSFA 3ZQ4A 3OHXC 1FJGL 2VZKB 1EYAA 1F1HA 3UDGA 2JYTA 1E8XA 5IT9E 2IGDA 2HJ1A 2F0IA 3EBEA 4GN3B 1L1OC 1PRTB 4R4CA 1IXRA 1I5FA 4XYQA 3GTOH 2RF4A 4ZRKA 1JROA 2OHFA 3DBLI 2WDVB 4ZYSA 1K50A 3AE2B 2BGFA 3Q8BA 2WP8J 2L8JA 1LM0A 4S0RA 2YTVA 3R7RA 3I63C 4K0KL 2EJGC 3ZTDA 4DR7Q 2WACA 2D0OA 3RNBC 4R4OA 3C19A 2BT6A 1N33L 1A70A 1C3TA 5FOBB 1EQVA 2ICEC 1PGAA 2BDOA 1PH6A 2F0MA 3BDCA 3AE1B 4JI3Q 2A6HC 3OWEB 1V81A 3RNEC 4ZDVA 2UXDQ 1FIQA 4A3OA 3PO2H 3V96A 2ATWA 4JLCA 3BINA 5AUKA 1CFMA 1LO5D 2OTJA 2KX3A 1XCTL 3IFWB 3VTUA 1M4VA 4WJQA 2GMIC 1EZ6A 4HTHA 2LHEA 1TZOA 3X0WA 4C2MH 2V3PA 4FDBA 3SHLA 2JA5B 2KFKA 2BS2B 2L12A 1II3A 1NI2A 1P9DU 1FVIA 3M3JA 1NTGA 1T0QC 1VQAA 2K14A 3VDZA 3H09A 3DLLA 2XRSD 2DAJA 3H94A 1WTQA 2PQAA 2RGFA 3PIOA 1N8RC 2IGHA 1FFUA 3BZDB 3QIJA 3PQIA 1IL8A 1G6ZA 2VZAA 4XQQA 1VD2A 2XTIA 2ZPYA 4KN7C 1T3QA 3RZFA 3U9SA 3A8KE 3QWNA 2HD5B 2L76A 4DAVA 1N63A 2EYMA 1ZGUB 1B53A 4MZ9A 2BH2A 1Y1VH 1W2BA 2NMQA 1S72A 4WWOA 2BB6A 4XWTA 1U5KA 2DLBA 1TKEA 1I7HA 3BVMA 4LUOA 2Z8LA 3PV0A 1VQ5A 1JQYD 3RN5A 3TUOA 3ERQA 1HHVA 4JGHB 2Z6BA 1EWYC 1HA6A 2IO3B 4IFDG 1GUSA 3ENEA 1OQYA 4A3KG 4W9KA 2UU9Q 4NJ7A 2B2VA 1GC7A 1OQQA 1V6EA 3TL5A 5FLXL 2LMCB 2HQEA 1V1PB 2ZW1A 3STBC 2F0UA 1ENFA 3ZDMC 1KD1C 2KX0A 1WSPA 4RGNA 3GTQH 2NBWB 2JA8H 4WORA 4DXFA 4CDCC 2OJWA 2QIEB 2WXKA 3ZTCA 4WAFA 5AJ3L 1LV9A 1PXUA 2I07B 1ZKOA 2JQOA 4BA2I 3ABVB 3J7YW 1Y8PB 1DOXA 3F2BA 3MA2B 4BY7G 1JWBD 4L2YA 2UUAL 3N1YC 4A6QA 2K5VA 5CGKA 1JE5A 1QNUA 1MSHA 1SLJA 2KMCA 1RDPD 4IDIA 5FLMG 2OQ0A 3BVZA 1YD8U 1FGUA 4CBVA 4AOFA 3I3CA 1BMLC 2M56B 4F1SA 1EY7A 5C1ZA 2EJMA 2GBRA 3ZRFA 1QZEA 4ANVA 2GVAA 1PTOF 3Q6BA 4K14A 2IWHA 1K8RB 3EFUA 1QCBD 3U52E 1J19A 3LWUA 5FJ8H 2CCZA 4GKJL 4IM2A 3JAME 4A3BG 1PYWD 2DJGC 3HP3A 2KT7A 1OQRA 2OEDA 3CCJA 2FIDA 3VR3A 4HR7B 2R93B 1ZUD2 3OLMD 1SMXA 3TP8A 5M3FH 3H6MA 3AE8B 3PRPB 2DENB 4RKLA 4XIGS 1E2VA 2N7DA 3UIOB 2VUMH 2UXBQ 2E2HB 1EOVA 4Z9CB 5EKIA 2PI2E 5JOBA 2MFIA 2B76B 2RQXA 1AH9A 1V8QA 4IN3A 2Y3AA 2XN9C 3BVGA 3CQZH 3VDYA 1QOFA 2ACZB 2PMZE 3AV8A 3V60A 2IT1A 1O7LA 2K1BA 4GOPB 2R7ZH 4HPLB 1CSQA 3NS1A 1PFMA 3J7ZC 5FO8B 3K57A 2WS3B 3CU7A 4O2DA 3AEVA 1CKNA 4WAAA 4IO9A 5CTRC 2K5HA 2R2QA 4H0LC 2B2UA 2QA4A 1EM7A 3FEWX 4YTPB 1T6BX 1PRTC 2PQEA 4K2KA 2AWNA 3MHSD 2GOWA 4PZ7A 3Q3FA 1WGHA 2R61A 1KAWA 4RMAA 1LTRD 3P4QB 2LEKA 2JZZA 4G11A 4B9XA 2IBIB 3AXCA 4D2KA 1XMOL 4LNQA 2O2VA 1WMHA 3ZJVA 4KKSA 2XWJB 3OWFA 4JOIA 4XWWA 2KVRA 3OJ3A 1BDOA 4IPGA 3I7FA 1Q1OA 3CQZB 2ZVOA 1C4PA 3K9PB 3K7UC 1HR0W 4DU9A 4II2B 4RF1A 1QE6A 1UE5A 2CS4A 3CCMA 5D65A 1EIHA 4KSLC 1PZKD 1TWHH 4CKCA 3MAQA 2NB0A 1IUEA 2Y5CA 3NG0A 1I6VC 1LM8B 2VY3A 2PVGC 4FN2A 3HOWB 1Q1EA 1FCCC 2RR9A 4DV5Q 1E2WA 2N7JA 1KDBA 4JI0L 4B3ML 3O65B 3NBIA 4BVUC 3L2PA 1M8AA 1D8LA 5EQ0A 4I7AA 1WXVA 2DYOA 4NB3A 2MBQA 2I5MX 4QCLA 4BBRB 2EKEC 4TMAB 1Q0WB 1AZPA 2D5DA 4XQJA 5A2QE
chains in the Genus database with same CATH topology
5C44B 1I3QB 5MPOA 4V190 1DOLA 3HVDA 1MPEA 1UUPA 1KLUD 3EGRA 3HOUB 3KBGA 3KF8A 4E6IA 1NAPA 2B8GA 3PUWA 3S1NB 3K0YA 3NWSA 2L9HA 3IAYA 2WINB 2QEJC 4LTUA 4MH8A 2F0PA 2ONQA 1EY8A 2PZWA 4H7BA 3HGBA 5F2DA 1QJOA 4A3EB 2AQ3B 1GHJA 3ETRA 4ZQ3A 5BMGA 2K05A 2WXMA 3K59A 2NUCA 2XVSA 2IL8A 3A8JE 4HN7A 2F0WA 4OIKA 1ILPA 2JQRB 3OIQA 2KCCA 1VZ7A 2K6AA 4LJZC 4C3JB 3FC4A 3S2DB 1F9QA 2HUGA 3Q69A 4DK0A 4ID6A 5CYUA 4ZK9B 2INPE 5JEAJ 3HUIA 5D14A 3PO0A 2JSOA 5I6YA 1NSNS 4HKQA 5EGTA 1HQRD 2FINB 1D5XC 2WDRB 1IGCA 2XNAC 2WXHA 2RKSA 2EYFA 4RH6A 1YQ3B 1CTMA 4PT5A 1Y1WB 2WP9B 2A6HD 2F0DA 4HCSA 2K0PA 5E4WC 3W1SA 1AN8A 2ZXRA 3K58A 2DN8A 1EY9A 3MJ5A 4F88A 4DF7A 3S1RB 2XWBB 4CKEA 1FGBD 1EY5A 3HS0C 3NWTA 3TDQA 1U9RA 1O7YA 1C79A 2ON8A 4RGTA 5FLXE 5ELEA 1LT5D 2OEOA 3M3YB 1YJIA 5AFWA 5FKAC 1EWCA 3AE6B 2JU6X 3OSOA 2V4IB 5ISRA 4IFDH 3FPPA 2L4NA 4C80A 1P7FA 5IGDA 4WQMA 4MACA 3FVQA 5LL6S 4P16A 2PMVA 4IFDI 2JZPA 5IOCA 3WDNA 4KTAA 2VXWA 2K32A 3L9AX 1VZ8A 1EQTA 3NTIA 3NZ3A 5HG2A 1F2RI 1ML0D 1HTLD 4PMBA 1EEFD 4S3SA 4YTNB 1XF5L 1SNPA 3U2SC 1J7CA 1YMHE 3R8BA 3B2GA 5CR3A 2WDQB 2EYJA 1HFNA 3TP7A 2K22A 2EJFC 4B0EA 4FF2A 5KNCA 5DM63 4HRSA 3SEBA 4DFAA 2CJNA 1BBXC 5DAUA 1VRAB 1D6EC 1N62A 2QJLA 2WXLA 2W55A 1VLBA 3DUZA 1WWTA 4WFN3 2LHDA 4OVZA 4N6EB 1XTCD 2CW0C 1ICWA 2IPKD 1RFKA 3K7AB 4M0WA 4FO2A 2L32A 4L23A 1LABA 2NTSA 3URYA 1AFPA 2K9XA 1B9RA 1LTBD 1MHXA 1F0ZA 3AECB 4A8XC 1K8MA 2O5IC 3NPPA 4KV6A 1A3UA 1AWDA 3KUPA 4OW0A 4USAA 2Q8TA 1F2MA 1QNKA 4RCNA 4J3OD 1FO4A 1KF6B 4JPSA 4K8IA 1Y69U 1KH0A 2PYKA 5J22A 3T13A 1GUWA 1YN5A 2LY7A 1ZXTA 2VB2X 4Q0FA 4RFBA 4JE3B 1BCPB 3KBXA 3S1QB 4XTCS 1PRTD 1G2TA 2E2DC 3IKJA 4C56C 3MFGA 4QUCA 4UDUC 4ZOHC 3VR8B 3HOXB 4MT5A 4I65A 1TS3A 4X3KA 1UEAB 1MSGA 4PQXA 4Q2JA 1RM6C 1O80A 2EY2A 3LXFA 5M3MB 1FRRA 2K5PA 1A6XA 1FXIA 4A3FB 3IT6B 1N5XA 2L0CA 1BR9A 3AM9A 4ZLTF 3MXGA 1ZDXA 4G7OC 3DM1A 1N5WA 2PW5A 1R4PB 1TKWB 1S4ZA 1I4QA 1LT4D 3ND9A 2E6XA 1LT6D 1R7SA 1STAA 4PMCA 4DNRB 1TT2A 3UI2A 1CT1D 3AEDB 4WRDA 3D31A 4R3DA 1KNAA 1S5FD 1VCIA 1FD6A 2ZXPA 3I4MB 2I38A 2F0FA 5EE3A 1ZEQX 4FXDA 4QB4A 3R2IA 4A3MB 1WD0A 2ENBA 2X69A 2E75C 4KMUC 3A7LA 3SK6A 1NR2A 1EY4A 2QILA 2IJ0A 3EVQA 4CHTB 2B2WC 3SR6A 1OXTA 1XEEA 1IKLA 4NDXA 5HGTA 2RMMA 1EYDA 1WCMB 1XLPA 2W3SA 2DNCA 3T53B 4QMGA 5KNDA 3RZOB 1MHHE 1LLRD 1SNDA 5C2TB 1V43A 3JAML 2MJEA 1R4QB 1F2RC 2IDYA 1XXGA 4OZCA 4RF0A 2Q5WD 3CIRB 3H3VC 4P6VF 3CKIB 2L52A 3Q8CA 1C77A 2LKVA 2Y0SB 5CV9A 4KKJA 4F7XA 1KDAA 2YEPB 3HEJA 1BF4A 1DGJA 2F0VA 4P2CB 1FXAA 3WCQA 3Q8FA 2K7VA 1RKNA 4KD4A 5IGGA 3H0GB 1Q12A 3TBIB 4N9TA 3AE5B 1RTOA 3M4YA 1B2TA 2HCCA 5FK9C 2RBMA 4EVOA 1K53A 1WTRA 1AW7A 3AH7A 2E74C 2KECA 4J1MA 2PZUA 1HTPA 1DOMA 4OIJA 2PW9A 1BCPC 2BW2A 2WXFA 5EKKA 4ITKA 1EYCA 1LTGD 4C3IB 1CJEA 2JA6B 4K6LA 4WJWA 2EZVA 1F9PA 1MVKA 2PLPA 4C3JG 4H2AA 5EE9A 2K28A 4XE0A 3GTPB 4YXDB 3VA7A 1CA5A 1PMRA 3Q6SA 3C1FA 5JXVA 1SYCA 3GTMB 1CQFA 3MZ5A 2ID0A 1JCKB 3P63A 1GXDC 2WV6D 3T16A 1DJRD 1A2UA 3QJYA 1ACCA 1FFVA 4FNFA 4CJ2C 2HDEA 4BY1B 3VR5A 5C4XB 3C1EA 2AX5A 2BS3B 3PO3B 2F0GA 3KWVA 4B08A 2EYPA 1HQMC 4NZLB 1ENAA 2DWQA 1G291 4K8JA 1FNWA 2R3ZA 3SDZA 2D2CC 3G7LA 3GV3A 4C7YA 1I4GA 4FP5D 2CHBD 5HI1A 4GLSC 3W3AA 2KOLA 1RD9D 3MP9A 2NVXB 2WXQA 3HZXA 2B2TC 2OF1A 4FF3A 3SE0A 2JP1A 5I9OA 2CW0D 3QOJA 3NQIA 1PTOH 1ET6A 4C1NK 2FBWB 3OMGA 4TRDA 1TY0A 2KMMA 2D62A 2WLBA 1JWUD 2E3TA 2PZTA 5JVG3 1QB5D 3SXHA 3HOVB 2XSCA 3A54A 1PTOB 4AQ7A 2QSDA 2A69C 3HKZB 3SFEB 1YQ4B 5CV8A 1MGSA 4J8QA 3LB8C 3BG3A 4WIPA 1PFDA 4G7ZC 3VYSA 1F9RA 1WTXA 3C46A 1SYDA 2J0TD 1LTAD 2F3VA 2RDGA 1KTKA 3V2TA 1V97A 3HRDD 1TKGA 5KYIA 1DD2A 5J39A 1CI3M 1Q3LA 4A3JB 4K2LA 3M85A 1L0YB 4EQNA 1J7BA 2WKCA 4A3GB 1F2LA 1IHZA 3NUCA 5I4DA 1GUNA 4MIUA 2KHSA 5HURA 4IKGA 2PTLA 1TQOA 1GUTA 3MVVA 1KFYB 2PIAA 2WU2B 4KGRA 4L6TB 3RFZB 3PUYA 2WU5B 2RSNA 5I2YA 3J81L 1ZE3D 2JSVX 1S5ED 5H92C 1SE2A 1Z47A 4PMWA 1BUIC 1Q8IA 3DWMA 1C76A 2RA4A 3N9YC 2BBCA 3GTJB 4LK0M 4WURA 2FUG1 1E10A 4NJCA 3GO5A 3M7GA 2HDMA 3X3NA 2F0HA 1GJXA 5I2XA 2BB5A 2BYTA 3OMCA 2AUJD 1RTNA 4RHRA 3AB9A 4XYOA 3Q8EA 2PKOA 5C0XJ 4RNAA 1SF0A 3I57A 3LX0A 4O1NA 4OZBA 3A56A 3CRKC 1XLNA 3HVZA 4DK1A 5JJZA 5BYQA 4HEDA 2N9LA 3W5VB 5LHY1 2WXNA 1QG7A 2PPBC 1G91A 5EKLA 3DWAA 2O5JC 1AEXA 2H88B 3CWIA 4L1BA 4C1NI 3E56A 5G3LD 3BWUD 3P42A 5FO7B 4DA2A 4B9WA 5JEAG 3D4WA 3D8GA 2L83A 4HAEA 4EGVA 5EBDA 3NVYA 4KI0A 3BYTB 3J9CA 1JMLA 1RF2D 3L4PA 2WXRA 4ZAIA 5T1IA 3NVWA 2Z1CA 4A3DB 2KCNA 4A3IB 2QDBA 1JRPA 1SNCA 4US8A 1T5XD 1SNQA 4X3UA 1GAQB 1AYFA 1I4PA 3RUZA 1PTOC 2IX0A 2Y5PA 1NENB 4Y7NB 1F2ZA 5ELBA 1IKMA 1BCPD 4ZKBB 1HEZE 1KRHA 1D5MC 3TP5A 3AEBB 4A55A 2C5CA 4RWSC 1HUMA 1T5EA 2MP1A 2MHVA 3SFDB 4KN4C 1IBXA 4C3HG 3ZGZA 5M5WB 1MI0A 3BS1A 1SYGA 2NVYB 3NSWA 1ILQA 1L0VB 3O13A 2LS01 1QWYA 2B39A 2NN6G 3I8ZA 4EE2A 1TKYA 4X3SA 1E2ZA 1STGA 2V3NA 5C3WA 1O7ZA 1B3AA 2F0TA 1LACA 4DAYA 2SNSA 2K33A 3T56B 1B9NA 3BDLA 2B2YA 2Z4HA 4ILWA 1EIGA 3EJIA 1JALA 1C48A 1PFNA 3FMCA 2MJ3A 4HKZE 1CZPA 4TQ0A 1BO0A 2M19A 2M00A 1SE3A 2DNEA 4GDKB 1JOKA 4K6DA 4ZUIA 4JWSC 2RDFA 1RJTA 4CGYB 2M9VA 1D1IA 1C78A 2I46A 1VDVA 4FF4A 2JXMB 2BE5C 1FNVA 3VQIA 2G9DA 2JX5A 3HG9A 2EY6A 5CV5A 2I2YA 4ARIA 4IQZA 5BYRA 2BOSA 4OL7A 2WQYB 4AS1A 4C3IG 1SIJA 3LWEA 4FXGC 1HFGA 5BYSA 2EE1A 5CBEE 3NUHB 1SEBD 1EY6A 3AU7A 2AWOA 3M7NA 1SMYC 1KLGD 2OT2A 4L63B 4N9PA 1YN3A 2FMMA 3SVMA 3TMEA 3Q23A 2B2WA 1EZ8A 3VR9B 1CZGA 3FKIB 1JC7A 1KAAA 1DZ1A 4KKIA 2M0AA 3TN2A 3AEEB 5HHDG 2A69D 4OHJA 4TQ1A 2KJXA 2YU9B 4NAMA 1U4PA 3Q0AA 5EBCA 2JEBI 3K5OA 2H4OA 3GV6A 1CM9A 1X32A 3LNNA 3J81E 4XT1B 5DNFA 4FVMA 2K5DA 5M5YB 2K3UA 3S2HB 3E9SA 4ZHPA 2X38A 1SE4A 1IYUA 1LTTD 1QOHA 2L11A 4HJGE 3U7ZA 2B8FA 1JORA 3AE9B 1S5DD 1SYFA 4CJ1B 2R92B 4YWGG 4H44C 4MM3B 2MJDA 4K5VA 5K36G 1LTID 1VF5C 2GI9A 3K5MA 1HPCA 1LT3D 3Q22A 1Y56A 1PUTA 4IUPA 2C9OA 2L1AA 5IGFA 4LMQD 1CZWA 1E6EB 1PGBA 2NTTA 5CV4A 4FXKC 2JYEA 1ZP0B 5KYLA 4KKUA 5C5LA 1QKZA 1NYQA 5NUCA 3IFDA 4H13C 3I91A 3VA5A 1TR5A 1QOAA 1J9OA 1XX8A 2WB1B 2JWUA 1OXXK 2K03A 1PDXA 1HZ5A 5IODA 4G57A 1C4AA 2VZKD 3NVVA 2EVBA 1FYCA 4A3BB 2WXGA 1RHPA 3I72A 5IGCA 1KDCA 2W82A 1E0ZA 1ZYRC 3FILA 3KWLA 4HCEA 4C7ZA 5G5GA 1AP0A 3NP8A 5EPJA 5TSSA 3VR2A 2K04A 5KEEA 5JEAH 4FXCA 2KACA 1HCZA 1TS5A 2EYOA 4XDXA 4DNTB 3ITPA 3HOZB 5HFYA 3U4EG 3PZ8A 4ZUJA 2F3WA 1F77A 4KY6A 3I9V1 3MXNA 1Z6HA 3S17B 1TVXA 3ND8A 5CV6A 4US9A 3P1HA 1K8OA 2HCIA 3P1MA 1PLFA 4CJ0B 3BDOA 4A93B 1L0XB 4YT0B 1C9FA 1YN4A 3VYTA 1JQ4A 1SBBB 1L6UA 2JA7B 4K5XA 4BBSB 1RYJA 5M9OA 5EPKA 2B2TA 1XCQL 1FR3A 2SEBD 3D4DA 3S1MB 3E0JA 3NRZA 1GUGA 3SK4A 5C3XA 1GPXA 2AQ2B 5CC4A 2XRQD 3B9JA 1PTOD 4BA1I 2NN6H 5C4JB 2FMCA 4NP5A 1DCZA 2LGIA 3PIP3 2K5QA 1OFFA 1HXYD 3ONAB 4ME5A 2EY1A 2NN6I 1H9SB 4UAIA 4OZAA 3DHQA 3SR1A 1EEID 2CU3A 2V4DA 3QG1A 2PO4A 1FM0D 1R9TB 1ROEA 3P4RB 3RLFA 2NZ1D 1L4DB 3T4AC 3S16B 1VMPA 1OO9B 1OXUA 3Q8AA 5C3JB 1TWFB 2EDGA 2J52A 2EELA 1SNMA 2F03A 1A3TA 2PVOD 3TEZA 3EFXD 1WYGA 2RPVA 4TKOB 1L6VA 1ZXHA 3IFTA 4IUNA 3E6ZX 2SOBA 1RODA 4PNYA 3NK9A 3OW7A 2BE5D 4MHEA 1WTPA 4ZHOA 2ICIA 2FJ2A 4IALA 1RCVD 5EE0A 4IUUA 4ODGA 5KGUA 1TJEA 4NAWB 5EJWA 3VRBB 5CORA 2KVMA 4QUFA 3TEYA 1SMYD 1JWSD 1X3QA 4HEA1 1YJJA 2KQ3A 2J42A 4KY5A 4RA8A 1IW7C 1ZPSA 3GD7A 1RWSA 1QQRA 1WTVA 1CQVA 2EYLA 3BIID 2H1EA 5I6WA 1SJED 5K36H 5E6JA 1B50A 1BNZA 3KLSA 1WXQA 2JYOA 1QLBB 2X6GA 1YNJC 3W5UB 3TP6A 2ZXOA 2VNUD 1GUOA 2J7ZA 2KEEA 3DWQA 1C4QA 4RHSA 1SSNA 1JR0D 1NR4A 3GTGB 4F8MA 1PGXA 3P4PB 1PZID 1TWCB 2QF7A 2WKDA 1YNNC 2W3RA 5IIFA 2BA0A 1BXTA 1FCLA 1K51A 2EY5A 3J7AF 3MXUA 3BYYB 2L5TA 3MHBA 1DXMA 3GTOB 3IL8A 2E76C 3EQLC 1ZOYB 1B4OA 2ZW0A 2CJOA 1QT9A 1QF6A 2FHTA 1PZJD 4AYBB 1UGJA 1KNEA 1I4XA 1A3VA 2SAKA 2PW7A 4KGSA 1Q1BA 1PRTF 1EL0A 1SB3C 2V0GA 2LMCA 1V1PA 3PO2B 1NVID 2Q8RE 1H9JA 5D7GA 2PNRC 1ZYRD 1C4CA 1NYRA 4C2MB 4N58A 1STNA 3GQBA 1BQQT 2LFNA 4M8AA 5IGEA 2MJ8A 3AEAB 1D5ZC 3I73A 1E9MA 4J6HA 1ZXIA 4YTMB 3P7JA 3ZJUA 4RGMA 1X3PA 1B44D 2QMTA 2ZT9C 4NMZA 4OO1G 3D4RA 2NVQB 4CQNA 3RZDB 5C0XG 3I90A 2A6EC 1EU4A 3H91A 5C3EB 1SXTA 4KY7A 4EQPA 4YSYB 3AEFB 1Y1VB 3WOEA 3NTHA 3PZ7A 1DOIA 4IOIE 3J80L 1NCVA 2DY7A 3R93A 2F0JA 1WVLA 1WD1A 2JXTA 3A8IE 5J1ZA 1ONLA 3VRAB 3TSSA 2PMZB 1TYGB 2HTME 2A68C 4XDCA 5ELFA 1GOZA 4X3TA 1UWXA 3MXPA 2XIWA 2N9KA 2F0SA 3GTQB 2JA8B 1UNSA 2KDMA 4GDLB 4IUVA 1SAPA 1VJKA 5GXGB 1FEHA 2EXZA 2WXJA 3W9CB 4G7HC 1B9MA 2DY8A 2PCFB 5AUIA 4IFDJ 2OXPA 3AE3B 3PIO3 5BMIA 3PUXA 1JWAD 3AMZA 1ZDVA 3GS2A 2BA1A 2EYHA 5BN3A 2TSSA 2CQAA 3A7AB 1WTOA 1TY2A 2WXPA 2INNE 5KNBA 1K52A 3HRZC 4KGTA 1I4HA 4FYDA 1ENCA 5K5PA 4KX6B 1Y8NB 3ZJTA 1G8ZD 4KHVA 3DMUA 5ELDA 1FRDA 5COYA 1P7EA 1E0BA 5M3FB 2QCPX 5JPMC 4KJNA 1FNUA 3NE5B 3Q24A 4I7ZC 2VUMB 1VMCA 5T8IA 1BUVT 2O2LD 2JE6I 2KUMA 1FMAD 3V05A 3NTKA 3MHZA 2R7ZB 3D6CA 2BCOA 1JE4A 3S9WA 3DEPA 4U673 2A5HA 4B0MA 3IT4B 4KJOA 3SK8A 1D4BA 3F2UA 1GHKA 1ET9A 3TZUA 1MBYA 2GA4B 2J53A 3KLRA 3OPOA 2EKIA 4ARCA 3MTSA 5FR3A 3DWGC 5C4ZA 2DBYA 3FDTA 1TWHB 1ESFA 1HZ6A 4WWMA 3K5LA 2LJIA 3QIAA 2SDFA 5D3IB 3DEOA 1CHPD 4JWUC 1GB4A 1S5BD 3B2FA 1STEA 2K5WA 3MFYA 1ESRA 1IW7D 1O78A 3E5SA 1DOYA 1DOKA 2MEKA 3PMFA 3T3OA 5FO9B 3IXSA 2AQ1B 1TS4A 2YYZA 2BDNA 2N88A 1V8CA 3P75A 4IUTA 1TWAB 2B2VC 1IBXB 5CV7A 3D6WA 4KK7A 4XQNA 4DGZA 1PFBA 3N52A 1UAPA 4A90A 3EUB2 2F0OA 1N60A 1YNJD 4TQUS 1WGKA 1E7PB 1V1OA 3P20A 3AN1A 1STYA 4G4KA 1XLOA 2WXIA 2A74C 1DM0B 1SSOA 3S15B 2L55A 1G2SA 5H8YE 1SYBA 3NBHA 4IZ8A 4HMJA 1S5CD 4HSPA 1YNND 3GP7A 3R2TA 5E1FA 3KQ4A 4A9AA 1EOTA 3BK1A 1B1ZA 5IGBA 5LNK1 2F0QA 2X6LA 2M2LA 4YIJA 4BS9A 2F0NA 3VYUA 2O4XA 5C4HA 4RAUC 5C5MA 4KKTA 1NUCA 4XT3B 1WTWA 2H89B 1J8IA 3VR6A 3LYYA 2WIIB 4N59A 4JX1C 3QOLA 4HROA 1J7AA 1CHQD 2FE8A 1JW9D 2MH7A 3J80E 4EQOA 1Q10A 4OO1H 1HUNA 2LUMA 1CK1A 1U4LA 2B2UC 5C0XH 3FAHA 5DEHA 5D3DA 3AEGB 1D2BA 2KN4A 4DN4M 4YSXB 3OIPA 4IUQA 3K6OA 4OO1I 1EWHA 2WXOA 3KK7A 4ZRZA 3X3MA 1STHA 1TS2A 3MWYW 3MEHA 5C0XI 3CRLC 3PUVA 1EU3A 3NHHA 2IX3A 4NKLA 1DONA 2BTEA 4F87A 1Z7TA 3EROA 3IAM1 1MD2D 4JBWA 2A6ED 4A3KB 1Q90A 1TWGB 2KWDA 2K01A 2EOTA 4BWGB 4YSZB 1EFID 3TZDA 2F0EA 2W54A 3NVZA 4JK1C 4V0BA 1GB1A 1PDQA 1I4RA 1STBA 2RVLA 2AUKA 1QILA 5E3FA 5M5XB 2F0LA 3U9OA 2E2JB 4BY7B 3W2DA 2N55A 3K5NA 2A68D 3I70A 2WAQB 1H9KA 3GTLB 2MGSA 1AZQA 3DWPA 2IGGA 1XWEA 4PV1C 3PUZA 1KABA 1XYIA 3IAS1 2KAJA 4Q5VA 3G6JB 2JEAI 4LLGM 5JAVA 2BS4B 5IT9L 1H9MA 3VR4A 3MC0B 1H9RA 2F1MA 4M1UB 3CHBD 3D3RA 1HRJA 2F4IA 3A55A 1SYEA 3S14B 3RPFC 5E4XA 4ULLA 4XXEA 2IW3A 3UI3A 3L7ZC 3C3LA 3M4OB 2RSOA 2TMPA 4KHZA 4RCOA 3NQTA 4MN3A 3I4LA 5EPLA 1XLQA 4XDDA 1A15A 1SNOA 3V3XA 1W6KA 4O42A 1MI2A 5EE1A 2N0SB 2SNMA 3TEWA 2KA7A 5G3LF 1F2YA 4GZYC 3OOCA 3C8YA 2L1BA 1LTSD 1TIID 1HA5A 4RGOS 1EY0A 3FPUB 4K5WA 2WNMA 3FILB 5CBAE 2B2YC 1SDFA 4HSVA 1SJHD 3T51B 3H8HA 2G9HD 2CVRA 2NBFA 2MUYA 4L8JA 1NEKB 2KQ4X 3GTKB 3T3NA 4R8NA 4NW2A 1BCPF 3RMHA 4CKBA 3NXWA 4DAPA 5DM73 1I50B 1JWMD 4FF1A 1XO3A 2KEDA 3BK2A 4R8IA 5JPNC 1H9SA 2GB1A 4DQOC 3WOFA 2NVTB 1TU2B 1NI3A 4LK1C 3ZYYX 2DYMA 3I4NB 4LAAA 3AE7B 5G5HA 5I9PA 5CMDA 2D5GA 3AMUA 1IGDA 1WRIA 3FRPB 2QKIC 1U4RA 1A2TA 1IYVA 1BOSA 3N6RA 4QIWB 1D1KA 1QOBA 5KIXA 2D9UA 4ZRQA 4R9WA 1U4MA 1K83B 3L3OC 1VZ6A 4WH4A 3RD4A 4U68A 1I6HB 2R6GA 1OXSC 1YNTE 3EA6A 5BMHA 2RDHA 4C3HB 1L5PA 3GB1A 1OXVA 3R3OA 2LFIA 3QB3A 3AE4B 2A73B 5BN5A 2E2IB 4OGQC 4ABNA 1Y8OB 2F0KA 2IX1A 1W6JA 2HDLA 3TEXA 2NYZD 3J7AV 1DYQA 2FFKB 4DXGA 3AB5A 4TSSA 1C8CA 1N61A 2VB3X 3QO2A 5JVH3 4QF4A 3DXJC 2GRIA 3HOYB 1L4ZB 4RKBA 4KD3A 1FD7D 5LL6X 4REZA 2Z4IA 3KLSX 4ZRPA 4IURA 4HMIA 2NWGA 1VR9A 1SFOB 5C6AA 1UWMA 2MPMA 1JB3A 1F9SA 4ZKCB 1JOOA 5T1GA 3VYRA 1JICA 3SK5A 5KRUA 5A35A 3P4SB 5BN4A 1VDZA 2Q8IB 2J4XA 3C2PA 2YEPF 5A2QL 5ELCA 1JOQA 1CA6A 2EPBA 2B63B 2G1EA 1VF7A 1QOGA 3ZQ4A 3OHXC 2VZKB 1EYAA 2JYTA 5IT9E 2IGDA 2F0IA 1PRTB 4XYQA 1JROA 2OHFA 2WDVB 4ZYSA 1K50A 3AE2B 3Q8BA 2WP8J 2EJGC 2WACA 2BT6A 1A70A 5FOBB 1EQVA 2ICEC 1PGAA 2BDOA 2F0MA 3BDCA 3AE1B 2A6HC 3OWEB 1FIQA 3V96A 5AUKA 1CFMA 1LO5D 1XCTL 1M4VA 1EZ6A 4HTHA 2LHEA 1TZOA 2V3PA 3SHLA 2JA5B 2BS2B 2L12A 1II3A 3H09A 2XRSD 3H94A 1WTQA 2IGHA 1FFUA 3BZDB 1IL8A 1G6ZA 4XQQA 4KN7C 1T3QA 3U9SA 3A8KE 3QWNA 4DAVA 1N63A 2EYMA 1B53A 2NMQA 2BB6A 4XWTA 2DLBA 1TKEA 1I7HA 3BVMA 2Z8LA 3PV0A 3TUOA 1JQYD 3ERQA 1HHVA 1EWYC 1HA6A 4IFDG 1GUSA 2B2VA 1OQQA 5FLXL 2HQEA 2LMCB 1V1PB 2ZW1A 2F0UA 1ENFA 1WSPA 4RGNA 4WORA 4DXFA 2QIEB 2WXKA 4WAFA 1LV9A 1PXUA 2I07B 1ZKOA 4BA2I 3ABVB 3J7YW 1Y8PB 1DOXA 3MA2B 1JWBD 4L2YA 4A6QA 5CGKA 1QNUA 1MSHA 4IDIA 1RDPD 3BVZA 4CBVA 3I3CA 1BMLC 2M56B 1EY7A 2EJMA 1PTOF 4K14A 2IWHA 1QCBD 3U52E 3LWUA 3JAME 1PYWD 3HP3A 1OQRA 2OEDA 3VR3A 4HR7B 2R93B 1ZUD2 3TP8A 3AE8B 3H6MA 4RKLA 4XIGS 1E2VA 2E2HB 4Z9CB 5EKIA 5JOBA 2B76B 2RQXA 2Y3AA 1V8QA 4IN3A