1DYQA

Staphylococcal enterotoxin a mutant vaccine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
228
structure length
228
Chain Sequence
EINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFRQHTILFKGFFTDHSWYNDLLVRFDSKDIVDKYKGKKVDLYGAYAGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Abrogated Binding between Staphylococcal Enterotoxin a Superantigen Vaccine and Mhc-II?
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Enterotoxin
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN A MUTANT
total genus 74
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2000-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dyqA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1dyqA02
1CK1A 1AN8A 4DXFA 1HXYD 1LTSD 1LTGD 3V05A 2AQ3B 2AQ2B 1TS5A 1PRTD 2IPKD 1TY0A 1UNSA 1D5MC 1PTOH 1BXTA 2XN9C 3SEBA 1RDPD 1LTAD 1EEFD 1RCVD 4L6TB 1PZJD 1S5ED 1GOZA 1PTOD 2AQ1B 2NTSA 2QILA 5FKAC 2RDHA 1JWMD 1V1PA 1YN5A 1XTCD 1B1ZA 1LTTD 1S5FD 1ENFA 1XXGA 1B44D 5ELCA 1SJED 1EFID 5D3DA 3R2IA 5ELFA 1KLUD 5I4DA 3OWEB 4L63B 3W2DA 1SEBD 1FNUA 1I4HA 4DXGA 1MD2D 3MC0B 1RF2D 3R8BA 1ESFA 3R2TA 1JQYD 2J4XA 1BCPB 1L0YB 1ET9A 3DWPA 1G8ZD 4NZLB 1PZKD 1JWUD 1D6EC 1TS2A 1DYQA 4RGOS 1FD7D 1PRTC 1I4GA 1TS4A 3EA6A 3BVMA 1D5ZC 1ET6A 1I4QA 3EFXD 1EU3A 1KTKA 3O13A 2R61A 1RD9D 4RHRA 1F77A 3BYTB 1LO5D 1SXTA 1TY2A 2QEJC 2WV6D 2NTTA 1LTID 1FGBD 2G9HD 1V1PB 1EWCA 1LT4D 2RDGA 1DJRD 4O1NA 1I4RA 3BVGA 5TSSA 4RFBA 4BWGB 1EU4A 1UUPA 5ELBA 1FNVA 5ELDA 2SEBD 4RH6A 1I4XA 4UDUC 1STEA 3BZDB 1LLRD 1CQVA 1CHPD 3URYA 1PRTB 1S5CD 1BCPF 1PTOC 2O2LD 3GP7A 1LT5D 5ELEA 1HQRD 3MFGA 1PRTF 1CHQD 1PYWD 1FNWA 2TSSA 4RCOA 1QILA 1BCPC 1PTOF 4RGNA 2ICIA 1LT6D 1AW7A 1TS3A 4RGMA 3DWAA 1YN4A 1HA5A 1CT1D 2IJ0A 1JWSD 1V1OA 1YN3A 1LTRD 1PTOB 1L0XB 1T5XD 1LTBD 3CHBD 5D3IB 1PZID 3KLSX 4RGTA 5FK9C 1JCKB 2XRQD 3BVZA 1HTLD 3TSSA 1SE2A 2CHBD 4OHJA 1S5BD 2XRSD 4TSSA 4Z9CB 2Z8LA 1LT3D 1D5XC 1KLGD 1EEID 1S5DD 1SE3A 1M4VA 1I4PA 4RHSA 1SBBB 4ZYSA 1JR0D 2XNAC 3BYYB 4C56C 3DWQA 4K6LA 1BCPD 1SJHD 1SE4A
chains in the Genus database with same CATH superfamily
4JI0Q 1TWFB 2KDMA 1DOKA 2N4FA 4A3PA 5IP7H 2DZJA 2AMCB 1J5EQ 1PRTD 2WDRB 3FC4A 1Y8PB 2PE6B 1UNSA 2KJXA 4AH6A 4JI4Q 1KRHA 1E24A 2JN4A 3PUXA 1SIJA 3DBHI 3QAQA 4XZ4A 5E6PA 3BDCA 2B2WA 3GTPH 2KHSA 4K7WA 2VY3A 3OWFA 4QAYA 1VQAA 4K5XA 5C0XH 3IT6B 3Q3JA 1QUQA 1BBUA 5IOIA 3UINB 4YXDB 2C9OA 2M00A 2CQOA 1LGRA 2LRWA 2MLBA 3TUOA 1FL0A 1WXQA 2SOBA 2XGTA 2EJGC 3LYYA 5GMVA 4JV5Q 1H9KA 3F2CA 1PVOA 2OF1A 3FKIH 4WJWA 2WS3B 2EZVA 4K3BA 4WURA 2B2YA 1KQSA 2A6EC 1Q82C 2JF5A 4QY7A 3TREA 3VXWA 1ZP0B 4ZRPA 1GB4A 4B95A 1SROA 5D65A 3A9KA 1PDXA 2B3GA 4LLGM 1S3SG 1PRTC 2WU2B 4W9LA 1UE6A 1N8RC 2PMZE 4P16A 4BA1I 3AE7B 1KJTA 1ET6A 3GTMH 1WF9A 1NNXA 2H5XA 2DYBA 3FILB 3CKIB 4GDKB 1LTLA 1ASZA 4M00A 1JROA 2VNUD 3TEZA 3NSWA 3LNNA 4A3JG 1KXLA 4C3HH 1TTNA 5AZHA 2K6DB 3NBIA 3PO2G 3DQVA 3I3TB 1BT0A 4YY3Q 2IX3A 2DNFA 3Q8EA 2G9HD 1XLQA 4GIVA 5E4WC 2DX5B 2GBKA 2R7ZB 4GDLA 2JZPA 1VQOA 2F1MA 1SNOA 1PV4A 1WGDA 3ZXRA 1TZOA 4C7ZA 1G6PA 4ZYNA 1AP0A 2WU5B 3S1MH 3TZUA 5IOCA 2A6ED 2ZTEA 4DR7L 4A3BB 2PVOD 2Q8IB 4ODGA 2NZHA 5JVH3 1N5WA 2IGDA 4YTMB 1YNXA 2L05A 2VQEL 2GOWA 2K25A 3E0JA 4ZAIA 4L23A 3X23A 2VB3X 3GP7A 1HZAA 4LFAQ 2OEOA 3E9IA 3K8AA 1N62A 1Q46A 5GAHC 1TKWB 3I91A 2B8GA 4QMGA 2J7ZA 4ZQ3A 2EQSA 5M9OA 2BT6A 2FHTA 4L5RC 4LF6Q 2LVQA 5CV6A 2WXMA 3PO2H 3TEYA 3AEVA 2A73B 1II3A 2DY7A 4A3DH 1YJWA 1OTRB 5BYQA 3HOUG 2D3BA 1QCBD 1NBWA 1WH3A 3NVYA 4LNNA 1WE6A 5A2QL 1JJ2A 1PTOB 1KDAA 4RMFA 4YCUA 2JA5H 4P74A 2Q8TA 4BY1B 3HKZB 2Y3AA 4DQOC 4X62Q 4ZHPA 1PZID 3N9YC 2R93B 3OHXC 4K81A 4WAFA 1GM5A 1GPXA 2MFIA 2Z6KA 1MSHA 4RG1A 4KGRA 1WJ4A 1X55A 3RULA 1SN8A 2KCNA 3IXSA 2AEHA 2IY0B 1F9QA 4HCSA 4IUUA 4N8X1 3UE1A 3RZDH 2ZW1A 1IYUA 2O6VD 2MBOA 2UUCL 4KKUA 2PCFB 5JH5C 3ONAB 2O2VB 2RA4A 3ZUNA 1EQRA 1KRTA 3KJPA 1L6UA 2AQ2B 2RGFA 3AE6B 3KDFA 2F4VQ 1V5TA 2EE1A 1N34L 2C7NB 4KSLC 2D5DA 1L5PA 3UIPB 1S5ED 3N30A 3A9JB 3K81C 2LJIA 3A8KE 1C0AA 1TIFA 1EOTA 2KDEB 2Y5PA 2AUKA 3ZXVA 4BKTA 4LNOA 3E9HA 5C1ZA 4DV2Q 2LRUA 1PFBA 4KLKA 2KTRA 5E6NA 3FKIG 4JIOU 5IO9A 1QT9A 1KLUD 2UXBQ 3RZWC 3M4QA 3PSIA 2JZ3B 3CCLA 1S40A 1K53A 5C4JB 2Z9HA 3A0JA 4PMCA 4LCDE 1YHQA 1EM7A 4DWFA 1E10A 4JI0L 4HKQA 4HROA 3HS0C 4IJLA 4K5WA 3RCZA 5LMNQ 1Z5SB 4RGOS 2HQEA 4DV4Q 2D11A 1CZWA 2DAFA 1XJVA 1JOOA 1CM9A 2XEWA 1NE3A 5BYRA 4ZDVA 1Q3LA 2Y0SB 3MA2B 3HKZG 2YU9H 2VRRB 1EY6A 3TBIB 2WXHA 4FXGC 2KBNA 3Q3NC 3WALA 4M02A 3FEWX 3KF8A 4XYQA 4JK1C 3OIQA 1X3PA 4ICVA 3Q3FA 1HFGA 1TZ1A 1FGBD 1YNND 5M3FG 4CKEA 1SYFA 3OTOL 2BGFA 2I1JA 2LVPA 3E56A 5I6WA 1VQJA 1WE7A 1VZ7A 4B3ML 4C3IB 5C3EB 3SU8X 3J80c 3DBRI 3NG0A 4BBRB 2LVOA 3KLRA 2BS3B 5IE8A 1BNZA 1RKNA 3L17A 1STEA 1QOGA 4LF5L 2LFIA 3VDZA 1N36Q 1XQQA 1PRTB 2ONQA 4H2AA 3TEWA 4N59A 5IYCH 2PMZB 4IUTA 1JRUA 1U4LA 1DM0B 1QE6A 3TEHB 4DHZE 1A0IA 4DR6Q 2TSSA 2WLBA 2PE9A 3A1QA 3IFDA 3BINA 5FO8B 1AW7A 2X69A 1XT9B 4ARIA 3JAMi 1G2SA 3S1NH 2B2VC 2EYOA 1V81A 1YNNC 3GTLH 3I4NH 2K04A 1UELA 4BOZB 2L11A 2IL8A 2PI2A 3MEFA 2F3IA 2QCZA 3UI2A 5EAYA 2UUBQ 3PO3H 1L0XB 3M4PA 4TQ0A 3PCOB 4AQ7A 1HNZL 3CMAA 3I9V1 2VL6A 2MP2B 1E8WA 3LB8C 3VR6A 3S9WA 2N0SB 1K0RA 2FMCA 2DN8A 2EMSA 2OQKA 2N9KA 5FJ8G 1KDCA 2YLMA 4R4CA 3L7ZC 1SDFA 4F88A 2OHFA 4ANWA 1LT3D 4V0BA 2KACA 4A90A 4DDID 1KLGD 2CHWA 2KXJA 1XTDA 4DV4L 3VRBB 1AWDA 4LF6L 4PYUA 3NTKA 4PZ8A 2R7ZH 2K1BA 1SFOH 4A3MG 4KKSA 4M8MA 3L2PA 4OWTB 1S3OA 1PH7A 3V05A 3I56A 3NPPA 1YJNA 4JI5Q 3NHEB 5J17A 5D6JB 1A3UA 3H91A 4B3TQ 1VMPA 2J7QB 3RPFC 2HDMA 2I5HA 1E9MA 3F2UA 2XN9C 1HHVA 5C4XH 1XF5L 4IM3A 5IGDA 2XVSA 4UY8C 5EPJA 1FXIA 4QF4A 3TP6A 3FPUB 1Q8KA 3R3MA 4H7BA 2KLCA 2WDTB 1MVKA 2CKHB 4FHJA 1XXGA 2LS01 1I3QB 4PS8A 3GTOB 4H13C 3APDA 2QW7A 2K8HA 4FJZA 3E0EA 3ZTDA 3GDEA 1FO4A 2OOBB 2F0HA 2WXOA 2FXQA 1WGHA 4BY7B 4REZA 5JAVA 3S1NB 1QG7A 2Q8RE 2JA8H 4A6QA 4DGZA 1RF2D 3R2TA 4A75A 4HCNB 2EY2A 1HUMA 4ULLA 4XE0A 1BCPB 3K80C 4J6HA 3DWPA 3DVNU 3HVDA 5DPSA 2PW7A 5EE0A 3ZW3A 3I3CA 4AYBB 5M5XB 5M3FH 4FF3A 3V96A 3M4OH 4GKKQ 1PFNA 4PZ7A 1EIHA 5KNDA 2LFNA 3IRBA 4C3HG 1WTRA 2NMQA 5C4XG 3PUYA 2JVCA 2KVRA 2Z0EB 4M0WA 1Q1OA 4OVVA 4HAEA 1B3QA 4ICUA 1RAXA 1IPGA 2EOTA 4RKBA 5ELNA 2ZEQA 1GUAB 2PZWA 1K3RA 5KNCA 3QX1A 1DZ1A 4BBSG 1F0ZA 2N9PC 3RNGC 1DJRD 4DR4Q 2A8VA 2LXKA 2ZXRA 3NWTA 2F0PA 3P4QB 4KY5A 4MZ9A 4DK0A 2ZZPB 1UUPA 2K52A 2JA7H 3HOYG 1JB3A 3NQTA 4YSYB 2I5LX 2QF7A 1C79A 2RPVA 4JVZA 3HK0A 2F0DA 5IGBA 1D3ZA 1CA6A 5L37A 5ELOA 4DDGD 2OQ0A 1LT5D 1O7ZA 2BYTA 2CCZA 2K4KA 4G7OC 2F0JA 4LDTD 2E2DC 3MC8A 2LHEA 4MM3B 5IP4D 1M90C 3R7QA 1E22A 4KV2A 3CW2C 5LXHA 1EY5A 5KYIA 4IFDJ 3A9KB 4HEDA 4JI1Q 1PH1A 4DHJD 1F9SA 3HOVB 1CT1D 5FLXL 2UU9Q 4JL9A 4JQWC 1A2TA 1JC7A 3CPFA 2A1AA 2BKRB 5D14A 1V97A 1B4OA 2CKZB 4NJCA 1ROEA 3G48A 4MACA 4BA2I 3HHMA 5CTRC 1DOXA 1VQDA 1H9RA 2E8GA 2NBFA 1WGRA 2V9HA 1U4MA 3S2HB 3CPWA 2KA7A 1I3QH 2WXRA 3I2ZA 1F2RC 4Z9CB 4Y7NH 3KK7A 3U52E 1A15A 3AE2B 4ZK9B 2B29A 5E3FA 1PFMA 2WXIA 2Z4HA 2EYPA 4A3FG 3DVNV 3C1EA 4FBJB 3FP9A 5C44G 1JE5A 1JJCB 3NELA 2UUBL 4K7SA 3GTKB 4BFRA 3TEXA 1MPEA 2BVCA 4DXFA 4C2MB 4BAXA 4EOYA 1X3QA 3U4EG 4A3CH 3NXWA 3FPPA 3ZGZA 1V80A 3NENA 1BBXC 1TS5A 4RKLA 1WXAA 3P4RB 5J3BA 1NDDA 4US9A 2Z1CA 3FVQA 5C2TB 4NPNA 5JOBA 1VD2A 2WQYB 4LF4L 3KJOA 4GDLB 5AZFA 1L0WA 1GOZA 2QDLA 4HIMA 2RDHA 1PGAA 5AEKB 3HOXB 4K0KQ 3Q8BA 2KHJA 1IYVA 1N33Q 2ZVOA 5CGKA 5D3DA 5CHWA 3GV3A 1IBLL 3RLOA 4L2YA 1FVIA 2NB0A 3DXJC 4L63B 3Q2AC 5C3JB 4Q2JA 3H0GH 3W2DA 4OIJA 2WDQB 4JI6Q 1RTNA 4DAYB 1YIJA 2B2UC 2EYFA 2Z0SA 1C4QA 3GTKH 1E3PA 3TCAA 3ZNHB 2BS4B 5EBDA 3GTLB 3I4NB 1JWBD 3QARA 4JCVE 1SNPA 2PTLA 1NYRA 1R4PB 3DHIC 4C3JH 3S2HH 1VQGA 2MP1A 4U68A 3IAS1 4P72A 2LGIA 3H7PA 3AEEB 3KUPA 4J15A 1WVLA 4S0RA 4NY0A 2L15A 1RD9D 2UXCL 4G57A 3NVWA 2F0VA 4C1NK 2NVYB 4KHPL 1ZUD2 1RHPA 4DR3L 1SXTA 1T3QA 4G50A 1IYFA 4G4KA 5CV8A 2GBRA 2WP8J 2L1AA 1WTQA 2L3ZA 1NY4A 2BH8A 2ON8A 3HOVH 4KKTA 3C46A 4X66Q 3BVGA 4YL8A 1W2BA 3N1ZC 2NWGA 4AP4C 4A3MH 5J22A 4UDUC 2B63G 3JVZX 3DEPA 4KGSA 1F9JA 3FKYA 5C5LA 3I4OA 3GTGH 1EQVA 1H9JA 2NBWB 2PQAB 2JUOA 2MBQA 3LGJA 3PGEA 3SVMA 2VB2X 3MHZA 2ICIA 1VQHA 1WGYA 4KV6A 3W1SA 1A2UA 3S16B 3RNBC 3Q3MC 4XYCA 3RN9C 4R1JA 1L6VA 1YQBA 2KQ7A 1VJKA 2WDVB 2D3CA 3HOYH 3N1XC 3PF4A 1LTRD 2K50A 2X6LA 4IPHA 2WX0A 1AE3A 4H02A 2XK5A 2K5WA 1MG8A 4F8CB 2N3SA 4JWSC 2PZTA 3KLSX 2VH1A 4RGTA 3M4OB 2MRPA 5FK9C 5BMIA 3AH7A 4MEMA 4DV7L 3IHPC 4PV1C 3U50C 4B3TL 2FCSA 3U7ZA 3T16A 3M4YA 2RSOA 4JYAQ 3EECA 4JPSA 2EDGA 1EYGA 4OHJA 2ES2A 1CTMA 2XRSD 4TSSA 3PZ7A 3FAHA 2O6VB 5G55A 4K2LA 4NQLB 3G6EA 2C35B 3CC4A 4YCWA 5LXIB 5GAEC 4KX6B 5FLMH 4ZYSA 1V9PA 5KRUA 4C00A 4GN3B 1F9PA 3T8MA 2LWPA 4IW0A 5CR3A 1HJPA 4X64L 2JA6G 4IWPA 1LTSD 1OQQA 3Q8AA 1IXRA 2EYJA 1Q8IA 2Z6KC 2VZKB 1QB5D 3BG3A 2GI9A 4UAIA 1HZ6A 1MHHE 2CQAA 2L9HA 2WXKA 1RIPA 3EC8A 4DK3C 4O42A 4DK1A 1LTAD 1HZBA 1FJGQ 1Z47A 1B53A 1E1TA 2UYZB 2MPMA 3AE9B 1S5FD 1V5OA 1X54A 3D6WA 2HHHL 4GMVA 5DAUA 1YX5B 5AUIA 3IFWB 1NYQA 4FNFA 1WM2A 3PVLA 5DCNA 3OW2A 2MWSB 3TIXA 5D2MB 3ZIMA 2L0FA 5ELFA 5C44H 2K01A 1QKZA 3SD5A 2IT1A 2JA9A 2JA8B 3T3OA 3ZYYX 4WJQA 1IHZA 5IGCA 1I4HA 2IO0B 2KDIA 1IBXB 2M19A 1D4BA 3T53B 4IC7B 2F0NA 3ULLA 5IT9c 3P7JA 2J0MA 4MM3A 3VA7A 3FRPB 4LFCL 2BW2A 1WY8A 2WNMA 4W9FA 3VQIA 1ILQA 3J7A5 1ICFB 3IL8A 2HCIA 5AJ3Q 2R92B 2DJFC 4A3EH 1XD3B 2BB5A 2BWFA 3AULA 3KLWA 3L10B 1PH3A 3APFA 3DPDA 2E75C 1D5ZC 4B3RL 2MBEA 3KBXA 1A3VA 4GZYC 5TR5A 1A5RA 1RFAA 2F0TA 4MHEA 2F0LA 2ZM6L 4A3KH 2PPBC 4GLVB 4JI3Q 1XCTL 4W9HA 4YWGG 3PPAA 1KHIA 1GUOA 4C3HB 4KIKB 2I46A 4X57B 1HNWL 2MP2A 3KF6A 5IT9L 1EQQA 4LWCA 3NBHB 1PH4A 4A3GG 3KH0A 1LM0A 3GTJB 3PHWB 1MKHA 3U7DA 2SEBD 3PIPA 2E2HH 4JI1L 1WX8A 4MN3A 5IWAL 3A4RA 3ZTCA 3AEFB 3A33B 1O7IA 1NSNS 2ZJDA 3P2BA 2LD9A 1L2FA 1V8CA 1CZGA 4A3EB 1AZQA 3KDFB 1WTXA 1C78A 1SYEA 3MFGA 4LF8Q 1JJGA 1QLBB 3H94A 1R4MI 1CHQD 2N7EA 4ASWC 4AS1A 3H6MA 4ZKBB 1XWEA 4LF9L 5EKIA 1YOVB 1NI2A 3HP3A 3ND9A 2F4VL 4KHPQ 2HIVA 1GUTA 1N34Q 4A3BG 4YWLA 3RLNA 2PJHA 2KD0A 4HWIB 2K6AA 3DBLI 2F0MA 4MGIE 3H0GG 3QQ8B 1YN3A 2HHHQ 4I6LB 4A55A 1VQ9A 5HG2A 5EE1A 4YCVA 5EE9A 3QB3A 4OO1I 3A8JE 1GUNA 1QF6A 3TDQA 4G0NB 2K5QA 1S72A 2KNBA 1K8GA 4GLXA 2XWBB 1WJNA 2XWJB 2CS4A 2C60A 3Q69A 1UE1A 3CCVA 1GC7A 2KWVB 4KKJA 4XQQA 3D8GA 1E0ZA 1HH2P 3HRZC 5IODA 1YMHE 2ZPNA 3TL5A 1KLVA 4LDTB 2LY7A 4I7AA 2V3PA 1KIXA 4P75A 3A7LA 1VCIA 1NVID 5IYDH 4KHZA 1MG4A 2F0EA 4TMAB 3C2PA 1NBFC 3S14B 2F0IA 3CCUA 3N6RA 1S1QB 4BKGA 4W9DA 1ZYRC 2IGHA 4YIJA 3ZVVA 2NTSA 4LJOB 4HJAA 2JYOA 3TZDA 3TP8A 1YN5A 1V1PA 3KUDB 2RDBC 3H7SA 4APVA 5M5YB 2D3AA 4EEWA 4TKOB 4WJ4A 4IWOA 1B44D 5AUKA 3P4SB 2CU3A 2NPTB 3UGBB 1C8CA 1GD7A 1K51A 2DZKA 4PT5A 4EQPA 5M3MH 4TRDA 3HGBA 3G71A 3I4MG 4IN3A 3DVGY 3HIZA 3S16H 3Q23A 1OXVA 3M7GA 4BBRG 1I6HB 1WJJA 4A3OA 3I8ZA 3R8BA 1ESFA 1TWFH 2DNCA 2EYHA 3SK4A 4XQNA 2C7MB 3E9SA 1ICWA 4GS3A 1RWSA 1V43A 2KT7A 4I6PA 1L0YB 1VQNA 2A74C 4C4VB 1UZXB 1EUVB 4DR2L 3SXHA 4LF9Q 1TGZB 5M5WB 3F2DA 3CD6A 3HOWB 4CJ1B 1MBYA 4A3IG 3IBEA 1PDQA 1DCZA 3S15H 1N6ZA 3V3XA 4USAA 2KOLA 1ZYRD 4GNXA 3KLSA 4A3GH 4MELA 1VF7A 4OWWB 2IGGA 3PT2B 4X66L 2F0UA 5FO7B 4NAMA 3B6YA 3VUXA 3EIVA 4B3SL 2B2YC 2LMCB 1GHKA 4NW2A 3SK6A 2KEEA 2OXPA 5KIXA 1WGGA 2DY8A 2PI2E 1K8OA 4LJPB 1OEYA 2HUGA 1QNUA 2BYEA 2MO0A 2L12A 3A7AB 3ZLZA 5ELBA 3Q0AA 1X3EA 3P1HA 5DEHA 3KWVA 1I50B 2N78A 4PS3A 3AI5A 4A3EG 4KZCA 1LXDA 4OEMB 1J19A 4JX1C 2GMIC 3TMPB 3DVGX 3D0FA 4IG7B 4PG3A 4IFDH 2RF4A 1BCPF 5E1FA 3U4VA 1BMLC 2C5LC 2EKIA 1TVXA 3GV6A 3EUB2 4DAMA 1X32A 3QOLA 5F2DA 5I9OA 3QC8B 1EWIA 4DF7A 4B08A 1BCPC 5CHVC 2M0XA 4RGNA 4L5QA 2R6GA 2HJ1A 1K83H 1XX8A 3NK9A 2MA9B 3GB1A 3VTVA 2LKVA 2HTME 3DDCB 3M62B 1VMCA 3GD7A 2DUDA 3EBEA 4B3MQ 3HM3A 1WCMG 2KTRB 4C7YA 5M5WH 4RM8A 1G51A 3S2DH 1G91A 4JOIC 2KCMA 1J8CA 5IWAQ 1P98A 3GOEA 1J7BA 2V0GA 2XRQD 5BR8Q 5LNK1 1D1KA 1KC8C 2M2LA 2VXWA 1WJ6A 1SE2A 2LGSA 2X38A 1AEXA 2N8NA 1NMFA 1X6OA 3QIAA 3SR1A 2QMTA 1GJZA 3GTGB 4KN4C 2F0GA 3N3KB 1FRRA 1SE3A 1S5DD 1SNCA 1EYAA 1P1AA 4RHSA 4GKKL 4RF0A 1BCPD 3EN2A 3TP5A 4DV6Q 4RF1A 4C80A 4FYDA 2PIAA 4DHJB 3M3JA 4MH0E 2K5NA 3VAWA 1I5FA 1YNTE 4MTKA 3MAQA 2WXQA 1N32L 5E7NA 4AOFA 2ZJQA 1JW9D 4B9KA 1VQPA 2YU9B 3QIJA 3S14H 1EEFD 1RCVD 2D07B 2MQJA 3PGZA 3Q8DA 2K39A 1PTOD 2OTJA 2UXBL 1TKEA 1XCQL 2JQOA 3AU5A 4WJOA 3CMEA 3WOEA 3GTPB 4MGYE 4ABNA 1IYJB 3DM3A 1SB3C 2M56B 4R4OA 4K14A 1G291 4S3SA 2MNAA 1ACCA 2KECA 4OL7A 1N61A 2L32A 2KQSA 3W1GA 4YWMA 1HA6A 1TWHH 2A69D 1EWHA 1SEBD 3PUWA 5CV4A 1STNA 2BOSA 2D2CC 1WXSA 5DM63 1WYDA 3WANA 1GUSA 2AKWB 3K5NA 2LASA 5H8YE 1G8ZD 1JWUD 1ML0D 3HOZG 1Y8NB 2KOXA 2J0TD 3EHVA 1U4PA 3TS2A 1PH2A 3HRDD 3VUWA 4X3KA 1HR0L 2JA5G 5A2QE 5JJKA 3PHXB 3PV0A 1P16A 5JJZA 2G4SA 3L16A 3NY5A 3G4SA 4R4IA 3KYHC 4KJOA 2KN5A 1M8AA 2L55A 1YJ1A 4ZCKA 3BIID 4W9GA 4K8IA 3ICEA 1RLFA 1SMYC 3HOXH 1TU2B 4IUNA 2KWUB 2EPBA 1K52A 1XNRQ 2JEBI 3AFQA 2BDNA 2GN5A 4FXDA 4WQMA 3CC2A 3BZKA 3MXNA 2LEKA 5FR6A 3EJIA 5EKLA 4RM9A 3VFKA 1H9SA 3K58A 3ZKJC 3N20C 5E4XA 4CDFC 4BKSD 1XPOA 1EU4A 2JXXA 3B2GA 4A4IA 1TWCB 4JI7Q 3K0YA 2WYQA 4DV1L 3I90A 3LJ3A 1R4NI 4DR2Q 2CH4A 1H4RA 4WWMA 1LLRD 3RD4A 2B63H 4DUZQ 2KANA 2M8SA 1VS0A 2O2LD 4GN4B 3MEHA 1AARA 1HQRD 3C19A 2SDFA 3A55A 4DNTB 5HGQA 2V1YA 1QZHA 1PMRA 1YZ6A 3DEOA 2NBUA 3MWYW 3RNAC 1K83B 4DV5L 4XDXA 3CCEA 1R4QB 1BDOA 1VQ6A 1SMYD 5LMUQ 1SAPA 4DR7Q 1CA5A 3PREA 2LGXA 1WCMH 1QOFA 4HIDA 1VLBA 4KHVA 4HJKA 3NZ3A 1Z9FA 4ANUA 4TUUA 3I57A 3GTQH 3D4WA 4RWSC 2Z0DB 4KSKC 1C48A 3PIO3 1KDBA 3NP8A 1T0QC 4DAYA 1LTBD 4GB9A 1FMAD 5I9PA 2QDBA 4Y52H 2FCQA 3N32A 4ZRIA 2RCNA 2O5JC 2WIIB 1J5EL 4UP9A 1YI2A 2EVBA 3PMFA 1IBKL 1N33L 4A3IH 2GVBA 3H3VC 3T3NA 2AWOA 1FEHA 1MHXA 3Q8FA 1BQQT 4MDKE 3BS1A 1TT5B 1WRDB 4Y7NB 4W9KA 4HJ8A 1MSGA 2DAJA 3V60A 5K36H 4UP8A 5HI1A 1C9FA 3W1BA 1PH8A 1KH0A 1CSQA 2HD3A 2NVTH 1QOAA 4YWKA 1GG3A 3F1ZA 1F2LA 4E6IA 4IUPA 3Q6SA 1I42A 4DR3Q 1XNRL 4R4TA 2CHXA 2E74C 3PTFC 2AQ1B 3ETRA 4KJNA 1WMHA 5IGEA 3HUIA 3RNFC 2JA6B 3SGIA 2V1CC 1RYJA 1SGHA 4U673 3SE0A 1SMXA 5J1ZA 1XMOL 2WXJA 3C8YA 1OXXK 4WJPA 1PFSA 1A6XA 1SRUA 4A9AA 1HEZE 2ZXOA 3PZ8A 1V86A 2HD5B 3Q8CA 2EJMA 4K6DA 4A3FH 4PK1A 5L83A 5K5PA 1J6QA 3J80L 2MW5A 5IN7A 4IPCA 1ET9A 1VQIA 3L9AX 3OMCA 3CAMA 5CV9A 2C7HA 1TS2A 1I6VC 2FIFA 3AECB 1UE5A 1ESRA 5IIFA 4ZKCB 3M3YH 4LW1A 1TS4A 4B0MA 2KVMA 2EMTA 1IKMA 3H9DA 4LMQD 2NVQH 5C4HA 3RI7C 2F0SA 1KRSA 3A74A 3EFCA 3IVFA 4HJGE 2J53A 3GTOH 2G45B 3AE5B 3EROA 3NS8A 4BBSH 3PV1A 2ASQA 2K22A 2LUEA 1HQMC 2QEJC 1TY2A 3IKJA 4M1UB 4EZLA 4JBKA 1ZOYB 2ACZB 1EY8A 3S1QB 4FXCA 2JSVX 1W6JA 1LT4D 1XLPA 4AUQC 3Q3OC 1QUQB 3CIRB 2PW5A 1EY0A 1PGBA 3J81E 4BWGB 3RD2A 2JPHA 1FNVA 2PMVA 1YNJD 3TN2A 2PZUA 2KFJA 3BWUD 4IDIA 3I73A 3RUZA 1JOKA 3NVVA 1MIUA 1HZCA 3BZDB 2KJ6A 3H3VH 1CQVA 5BO4B 1HPCA 2JP1A 2BDOA 1QJOA 2K28A 3AB9A 1KNEA 4ZRQA 2BTEA 5BMGA 5IKCM 4KY6A 5EPKA 2B3AA 1F2ZA 1R9TB 5CBEE 4PNYA 5BR8L 2QA4A 1PTOF 3JAME 2V4DA 1TWHB 3MHBA 4BBSB 2IW3A 3T56B 1PYBA 1NJIC 1UAPA 2EY1A 1LM8B 1PQSA 1CI3M 3U9OA 4LF8L 2KKCA 2WXFA 1E6EB 4OGQC 2VQFL 3RR5A 1U0LA 2VW9A 1KFYB 4AIMA 3CQZH 3LDZE 4LUVA 4KD4A 3TRZA 4F87A 1YNJC 3OPOA 3I4NG 3HOZH 1H9SB 1TYGB 3MXNB 4EQ5A 4LTUA 2KK8A 5EGTA 3D3RA 2DYMA 1K73C 3BJUA 3N52A 5FOBB 1EIFA 4O2DA 3J7AV 1U4RA 2MX2A 1WTHA 3AE1B 1MJDA 4OONA 1JR0D 1SR3A 2L52A 1N32Q 5HFYA 2JWUA 2NCNA 1CK1A 3DCGA 4HIOA 4F7ZA 1DOMA 4NAWB 1Q0WB 4K1RB 1K50A 2NN6I 3A5ZB 1DGSA 1WJUA 2N9EB 5AJ3L 1JRPA 4J3OD 1D5MC 3WDNA 3TBLD 5J18A 4BY1H 1H95A 2QC8A 1JOQA 1B7YB 5CORA 5T8IA 4B0EA 1STBA 1IBLQ 2QILA 2E2IH 3RZOB 1PYSB 2A68C 4HSPA 1SSNA 4G3XB 4HR7B 1LTTD 4GOCA 2NVXB 3A8IE 4TQ1A 4JYAL 5C44B 1YQ4B 2ZJPA 1WD0A 4XT1B 5JHBA 2K5HA 1E2ZA 1F9RA 3ONSA 5DPTA 3VUYA 4A8XC 4A20A 5I4DA 4ZLTF 5D7GA 4HPPA 3CCRA 2XTIA 1B3AA 5CC4A 4L8JA 2Q5WD 2M17A 1GNUA 1NAPA 4LNIA 1FFUA 4L5TA 1VDZA 2E2JH 2WAQE 2JYEA 3PSEB 4JWUC 2RDFA 1L1OA 3HKSA 5G3LF 4GOPB 2HDEA 2INCC 2YTXA 2R2OA 4NZLB 3KW5B 2EXZA 4LF5Q 4XGAB 3MC9A 4OW0A 1WIAA 1WTOA 2WXPA 4OZCA 5BN3A 4US8A 3VH3B 3RMHA 1R7SA 1KAWA 3G6JB 2W9NA 1SSOA 2K75A 2KCTA 1V2YA 2MH7A 5G3LD 3AE3B 5KYLA 2PVGC 2ZNVC 4RHRA 1HNXL 4IM0A 1DOLA 4QCLA 2D5GA 3BYTB 3K57A 4DV3Q 1LO5D 4BVUC 3S17H 1KL9A 3J80E 4DV1Q 1X9NA 2D9UA 4EX5A 4PMWA 4QUFA 1TJEA 1NTGA 1WMHB 4LJZC 3B0AA 3H0GB 4OWXB 2AWTA 3GZNB 4HSVA 3VTWA 4EZJA 4RH6A 2KX0A 2B2VA 3W5OA 2VH2A 2OWOA 2PW9A 2ZTCA 4MT5A 1ILPA 3BZCA 2LXJA 4KK7A 1XO3A 1S5CD 2K14A 2RQXA 4X65L 3I4MH 3U58A 3B08A 1PHJA 4WJNA 3RYTA 4IWQA 4M8NA 3EFUA 1PYWD 2V4LA 1E90A 3MXPA 2WB1B 2SNMA 1X1MA 4P1CC 1PH5A 4JI4L 1UWXA 4DUYL 2FUHB 3AU4A 4LUOA 3CRLC 3CXCA 2JJQA 3DWAA 3OMGA 1YN4A 1HA5A 4HPLB 4K7UA 4JI5L 2IJ0A 3STBD 4MJSA 3R66C 1OGWA 3VTUA 3L3OC 1VQMA 2JEAI 3PRMB 2V4IB 1LABA 1MJEA 4MH8A 3T1YL 4FJYA 3A56A 2JA7B 3JW0X 3ZJUA 4IPDA 3BY4B 4OVZA 5GAGC 1JT8A 3K0XA 2JSOA 3CSTA 3TQYA 4CJ2C 3DWMA 4R3DA 1VQBA 1FXTB 2NR2A 2NVQB 2EXDA 1UGMA 4HK2A 3CC7A 4CKCA 2FE8A 1I35A 3BDLA 5EPLA 3HKZE 2FINB 2R92G 4MSQB 1I4PA 3S1QH 4JI2L 3OW7A 2MQHA 3DWQA 2WFWA 1GB1A 1F2MA 2G5DA 1UF0A 4RNAA 2RKSA 3AB5A 2K5DA 3D4RA 5LHY1 4KKIA 2Q2TA 1GAQB 3WWVA 3P4PB 2I1KA 2AQ3B 2GVAA 3N1YC 5EJWA 2JK8A 3STBC 5C4XB 3OSOA 1PTOH 1TBEA 3JSVA 4IALA 4TVAB 2WB1E 2PQAA 3SEBA 4YY3L 1VQ7A 3J81i 1PZJD 1VQ5A 1OEYJ 5IP9G 1K0SA 4TKNA 5IGFA 2DNEA 2WAQB 4H44C 2AX5A 2PQEA 4KVGB 2OT2A 4A3KB 1JMCA 5GQOA 4A3IB 1YX6B 2KWCA 3V61A 2F0QA 1HE8A 3AQQA 3MHSD 4N8FA 4NJ6A 2UXDQ 2WKCA 3J81L 3M63B 4JI8L 4LNQA 3NQIA 2B2TC 3J7AF 3DUZA 3QG1A 2GRIA 2KHWB 4P7IA 4FA6A 1WXMA 4PMBA 3H3VI 1CZPA 1Q10A 4KZ0A 4QGUA 1PLFA 4LFAL 1B2TA 3H15A 4B3RQ 2C9WB 4JE3B 3VR8B 5CMDA 4ME5A 4R8NA 2KDFB 2H89B 2PKOA 5DPRA 3D4DA 3CCSA 4NP5A 3LX0A 3U30A 1FD7D 3PUZA 2I07B 2R93H 4X6AH 4DUYQ 3A1QB 1I4GA 4ID6A 2KJHB 1EY4A 4A3JH 2OCEA 1R9TH 3WIMA 3RN2A 2KJRA 2R7ZG 4JI6L 1SNDA 4IQZA 4HCEA 3WOFA 2ASBA 3NVZA 4IOAA 1LTID 2V3NA 2L00B 1HFNA 1OXTA 3PQIA 3KQ4A 1CQFA 5M3MG 4HJ5A 4YTPB 1N9WA 1I4RA 4O1NA 1A63A 4J1MA 2FFKB 4GLAC 2KHIA 4NKLA 2EKEC 1I4XA 2QSDA 2W3RA 3DBLB 3OJ4B 1I50H 2R92H 2KCCA 2D0OA 4AYBE 2LGDA 1HNXQ 1I94L 2JX5A 2JYTA 4TQUS 4XXEA 5FJ8H 5KEEA 1FYCA 1WX9A 4AWJA 2D0PA 4L5SA 1BR9A 3NZUA 3JSVB 1PRTF 4MNOA 2XIWA 5C0XG 3I5JC 1XNQQ 2X6GA 1AYFA 3E3XA 2MJ8A 4IURA 1HZ5A 1WXVA 2MHVA 1TXYA 1WFYA 3KYDD 3FHWA 1TS3A 3FDTA 4OX9Q 5IYBH 3PO2B 1E5WA 1STAA 2DLBA 4I6NB 2HJ8A 1KM7A 5LMUL 1G2TA 1TKGA 4NXNQ 1IL8A 3RZOH 3WAMA 3PIP3 3ABVB 3P63A 3VYRA 4BOSC 2REXA 4LNKA 3R3OA 1T0SC 5FR3A 1MGSA 2IO3B 5BN4A 1O7YA 4ALPA 1OFFA 3LXFA 3M95A 5HKHA 2NS5A 2Q2HA 2CU1A 4YSXB 2CW0C 4X65Q 2NZ1D 3QR8A 4X3TA 1U9RA 4RCNA 2CJNA 5C5MA 5M3MB 2MHJA 2PPHA 3FKIB 5ISRA 4MGZE 1M4VA 5CX3A 1SNMA 5C0XI 2KUMA 1VR9A 2EELA 1SLJA 3QHTA 1CKMA 2FCNA 1Q12A 3S2AA 2KZRA 4K3CA 3MXUA 5LLIA 2F03A 2Y0SG 1J0GA 2PLPA 2RHQB 5I2XA 1B9RA 1RDPD 4FF2A 2Z6BA 3GTMB 4L6TB 3VR3A 3A4SC 4X62L 3OJ3A 2MCNB 4YSZB 3ZJTA 4NMZA 1Q1BA 1TIID 3UQAA 2OTLA 3KF6B 5EKKA 1P7EA 1TWGH 3VYTA 2VUMG 3GZNI 1BBWA 4ITKA 4WQOB 3B1LX 1KF6B 1IUEA 1Z7TA 4RAUC 1C9OA 2RSNA 4QQBX 2CW0D 4HPMB 3OWEB 4JLCA 2Z59B 1QVGA 5D94A 4WH4A 2UXCQ 5DM73 1MD2D 1IBML 1QNKA 4FF4A 3U2SC 2I0QA 5A35A 2QEXA 2IX0A 3Q14C 1SYBA 1H8CA 3ITPA 5GADC 2R93G 4G7HC 1E8XA 3CMMB 1CKNB 2E2HB 3HM6X 3T13A 2QGQA 3PO0A 3QK0A 4EFOA 1C3TA 4XYOA 1WYWB 1Y1VG 3W9CB 1G6ZA 2DZIA 5CYUA 3SK8A 2N1VA 1UE7A 4FP5D 2E2IB 3ZRFA 2YTYA 5JVG3 1PA6A 1D2BA 3AN1A 2FJ2A 1NEKB 1STGA 3UDIA 4HDQA 2IY5B 1L1OB 1E2VA 5J2RA 2D62A 4II3B 1VRAB 4CO7A 2UXDL 1EYDA 2CFMA 1ZPSA 2NYZD 1Y14B 3QJYA 5TSSA 1I6HH 3HZXA 3EVQA 3EQLC 2EYLA 1B9MA 1BVSA 3PO3B 4NNJB 2MO1A 5HHDG 1QZGA 3EGRA 1Q5WB 4DN4M 2BKFA 3MFYA 2L8JA 1UWVA 1CHPD 4ILWA 2R7FA 1XPRA 3AEGB 3HOWH 2KWDA 3RMKC 4HEA1 4FADA 3K5OA 2XBBC 1FNWA 2RCFA 1ISNA 2AWNA 5IYBG 1Y1WB 2M1MA 3GQBA 3VHTC 2WB1G 3CCMA 3GTQB 2N7JA 1OTCA 2DENB 1V1OA 3X3MA 1EL0A 1N36L 1UWMA 2YEPB 1BF4A 3RNEC 3VDYA 2Q2IA 5I6YA 1NCVA 1I94Q 1J9OA 1LQBA 4A3BH 2LHDA 2WKDA 3ENEA 3K9PB 2JRIB 4HJ7A 3G7LA 1WZ3A 3MTNB 3GE8C 1XNQL 4KGTA 4HVBA 5KHQA 1HTLD 3OIPA 3TSSA 1YQ3B 5HURA 1CKNA 2DZMA 3P1MA 1IBMQ 3DHGC 1TWGB 1WX7A 4OXPA 4URKA 4CQNA 2B2WC 2B8FA 4HIKA 1FJGL 4N58A 4GOPA 1UBIA 4A93G 2MEKA 2K8BA 4MIUA 1SBBB 4I65A 3DOWA 3H7PB 4E71A 4DV5Q 4UP7A 3DWGC 1A70A 1HXYD 1NR4A 4A3LH 2ZJRA 1EIGA 4HMJA 2KLGA 3PS6A 5NUCA 5IP9H 4LFBL 1EZ6A 4N9PA 1VDVA 1N60A 3VA5A 2LUMA 1D1IA 1SNQA 1WOCA 5JJLA 1MI0A 3NBHA 4QJFA 4JGHB 1WFQA 1JWMD 4HKZE 2IHFA 4OO1G 3ZDTA 1NUCA 1ZGUB 3H1UA 3V6EB 4FJVB 2OJWA 3H6NA 3R2IA 1NENB 3PZDA 1V8QA 2KQ3A 2Y5CA 3Q22A 1ONLA 1Y8RC 2KVZA 4XDCA 4F8MA 4DBGA 1PGXA 3OAWA 2KC2A 3K6OA 4CJ0B 4D2KA 2AHOB 1J7CA 3DBHB 2JRHA 3KYCD 1C4PA 4P71A 2PNHA 1V49A 2K9XA 4DPGA 1Q86C 3C0RB 1KABA 2K32A 1HNWQ 4BBNC 3IT4B 1WM3A 3ML8A 3BU2A 1NI3A 1SYDA 4FDBA 4DV0Q 4IKGA 2B2UA 1C76A 3SFDB 4DK5A 4UHVA 2VUMH 2FIDA 2WGSA 2KDBA 4YTNB 4A76A 3DHHC 1WWTA 2WWZA 3R7RA 2HT1A 2MUYA 4B6WA 4CDDC 5JHAA 1E2WA 1T9HA 3DLLA 2IDYA 4F7XA 2DBYA 4HRSA 2ENBA 1EF5A 1EO6A 1YJJA 2AYOB 2AUJD 3SDZA 1XMOQ 2CHZA 3SHQA 3OOCA 4XX5A 5JXVA 2F0OA 2CWPA 2JA5B 1WD1A 2W54A 4OX9L 5FO9B 4A93B 4XDDA 1E8ZA 3S24A 2J52A 1Y8OB 2NVXH 1Q90A 1KOTA 1RTOA 4K8JA 3OG5A 2ALYB 2QIEB 2UUAQ 2QCPX 2ZT9C 4NQKE 4EUTA 2PO4A 3MJ5A 3O65B 1X65A 3RZDB 3P20A 1UGJA 2WACA 2KMAA 1TT2A 4BY7H 2MSED 1XLNA 2E2JB 1BUVT 1RRBA 2NVTB 1D8LA 2FCMA 4NJ7A 4P1BC 4AJWA 3HOVG 3KF8B 1QVCA 1QQRA 2WXLA 4GU2A 1E7UA 1RODA 2X8XX 1LYLA 1Z2MA 2BS2B 2K3UA 4BKSA 1FGUA 3FILA 5C6AA 3CHBD 2E5LL 3CCJA 1RJTA 5IY0A 2K05A 4ZRJA 1Y56A 2FBWB 4BS9A 1T6BX 3RNUA 3K5LA 3K59A 3M9BA 1XMQQ 1GUWA 1S5BD 1IBXA 1E1OA 1V6EA 5G5GA 4LNFA 4B9WA 3X3NA 1GXDC 2KEDA 5C4ZA 4FULA 4IOIE 1FIQA 2JWZA 4YT0B 3SFEB 1E0BA 1K8RB 2HCCA 2J42A 3QWZB 4PYZA 2BF8B 1VF5C 3J9CA 4IJHA 1ZEQX 2Y0SE 4RA8A 1DOIA 3AEBB 3QJZA 2NZOA 2VQFQ 1Y69U 2IPKD 4H0LC 1HRJA 1ZKHA 2V3SA 1TY0A 1NMGA 1WGKA 4HXDA 2MJDA 2LXCA 4DV3L 4IFDG 1L0VB 2KAJA 1Y1WG 2L5TA 4NXML 4IUVA 4FXKC 3UQBA 2N1WA 1EWYC 1BUIC 1AFPA 2O4XA 3VYUA 1EFWA 2CVRA 2MBHA 1YBYA 4AJYB 4GSWA 3U9SA 2N55A 5EDSA 2PNRC 4ZOHC 4CDEC 2F52A 4N9F4 3V2TA 2ATWA 4LFBQ 3UDFA 2DJGC 1J7AA 3NHHA 4I7ZC 5KGUA 5H1SE 4YHHQ 2L76A 4XIGS 4ZRZA 2G9DA 1IL2A 1JALA 4IM2A 3ERQA 4BY7G 2IBIB 1BKBA 1C7YA 1AZPA 3WA0A 1LV9A 2J0JA 2G1EA 1N63A 3SK5A 2W3SA 4FF1A 2GBJA 1DXMA 2VUMB 3TS0A 1B9NA 4P2CB 1XEEA 2JZZA 4POFA 3EFXD 2N88A 4HN7A 1OQYA 2VZKD 3ND8A 3CP0A 3M85A 1F77A 5IYDG 1Q7YC 1RFKA 2LSSA 3CF6E 5T1IA 3L0OA 2GLSA 2N49A 4KI0A 2NBVB 2JA7G 2E5LQ 4OZBA 4C4VA 4EZKA 4QIWB 4BXXH 2I38A 4II2B 3ERSX 2QDFA 5G5HA 5GXGB 4A3MB 4JBMA 4RFBA 1XMQL 5I2YA 1HZ9A 1FR3A 1EIYB 3OTOQ 4OELB 1EOVA 4JV5L 1ZW7A 2LXAA 1ZDXA 1MHWC 2EIFA 2JQRB 1EQTA 4XWTA 1I7HA 1YHBA 1VZ6A 2B76B 3L54A 1K8MA 1VQKA 3NRZA 2BCOA 4JI7L 2A6HC 4KIKA 3M3YB 2K8CA 2HDLA 3J81j 2KC1A 4ME3A 4DU9A 2K33A 4PS7A 1Y1WH 4ZHOA 3F2BA 3U8ZA 1RM6C 4DR1Q 2N7DA 2A69C 1IW7D 3T1HQ 3DBRB 5JEAJ 1V9JA 3SHLA 1QOBA 2N9LA 2QHOA 3AE4B 3RZFA 4GN1A 5C3WA 2H4OA 2IZVB 2ZNVB 5EQ0A 3PRPB 2QJLA 4WAAA 1WRIA 3HEJA 4NPSA 3X0WA 5CBAE 5KNBA 1R4MB 2GBMA 1C4CA 5C0XJ 2JA6H 4A3JB 1P7FA 4QL5A 3KVFB 3ZDMC 1ZXHA 3FMCA 3HOXG 3RUIB 1M1KC 2TMPA 3R93A 3I72A 2YVCA 3KWLA 1P8LA 2CWAA 1JICA 2Z8LA 2A6HD 4ANVA 3ZNGC 1KD1C 1EEID 1SIFA 3W1SC 1DOYA 2INDC 4K6LA 2L4NA 1K8AC 3L13A 3AU7A 4JPBW 1AN8A 1IW7C 3ML9A 2RR9A 3QA8A 3KOJA 3S1RH 3GTJH 1LTGD 4G7ZC 2HE7A 1DGJA 3KUZA 2ZPYA 5M3FB 3ER0A 4POGA 3S1MB 3WAPA 4JC0A 1YITA 1EF1A 2EYMA 1HR0Q 3DMUA 4DAVA 2KN4A 3NZSA 4W9EA 1STYA 3H09A 4KMUC 3HOZB 1K28A 2A4ZA 3I7FA 2BE5C 1WTPA 1B1ZA 4WWPA 1WI0A 3RNCC 3J80i 4WWOA 4V190 3MTSA 2CJOA 5ELCA 1B50A 1FXAA 2ZTDA 4DV0L 4EE2A 4HJ9A 1ZDVA 3KUCB 2R7DA 4DA2A 1F1HA 2GB1A 3U4ZA 1QZEA 1FM0D 3F8TA 3JAML 2JXTA 4N6EB 4ZUJA 1VQFA 3QO2A 1JB7A 1HCZA 4X3UA 1D7QA 2YYZA 1ZXIA 2WXGA 3K7UC 1EUJA 4C2MH 1WTVA 4ZUIA 2LMCA 2K03A 5EE3A 3V62A 2PYKA 1WI5A 1OQRA 4JBWA 4DNIA 4C3JB 4W9JA 1D6EC 4P73A 2L0CA 3PIOA 1VQ8A 1WR1A 4IOCA 4DR1L 2RBMA 4JI2Q 3AEAB 3L4PA 2CH4W 3T1HL 2I5MX 2KMMA 3AXCA 3ALBA 4MJSB 2A5HA 5IYCG 2EY5A 2WAQG 2OEDA 4WIPA 5FLXc 2K0PA 1VCBA 3CWIA 4K2KA 1XYIA 1A62A 2F4IA 1M94A 1T0RC 1Q1EA 2BE5D 3UDXA 3I70A 2BPSA 4BXXG 2L0TA 2SAKA 3BK2A 1B8AA 1LFDA 2RHSB 3JC66 4GN5A 1ZXTA 2WV6D 3NEMA 1GJXA 2FUG1 2M4NA 2B2TA 3KBGA 1V1PB 4EVOA 4LFCQ 4CYEA 1HTQA 1GKHA 3HOYB 5T1GA 4HCPB 4DNRB 5FLMG 2IYDB 3TJPA 1CJEA 1SF0A 4DV2L 2BBCA 4BBRH 4HDOA 3Q24A 3UDGA 4QIWE 3CQZB 4FO2A 1GHJA 4YHHL 2FMMA 1FCCC 3DHQA 5IGGA 2IWHA 4C3IH 2WINB 5C3EH 1P0RA 3S2DB 1HNZQ 1L7YA 2IX1A 1YIWA 4JI8Q 3CF5A 3ZNID 4W9CA 4HLEA 1HTOA 1N5XA 5HY6A 3IAM1 3NOBA 5C3XA 2ZM6Q 2DWQA 3W5UB 1X3FA 4GNXC 5ELEA 3ZRCA 1TR5A 5HGTA 2I2YA 2FAZA 1A3TA 2JXMB 4XT3B 4FN2A 1GUGA 5EBCA 1QILA 1PH6A 2BB6A 3AE8B 3OLMD 4CKBA 3VR9B 2NN6H 3W3AA 4JI3L 3S17B 1NR2A 5IT9E 2FNJB 4NDXA 2RD0A 3VVWB 3DBSA 2YV5A 1K9MC 2KMCA 3PUVA 2D2QA 2GBNA 4M0WB 2Z4IA 5JPMC 4DV7Q 3HOWG 3CSFA 3LWUA 5JEAG 3T4AC 4EQOA 1O7LA 1ENCA 1Z6HA 2KFKA 1MI2A 2MJEA 2UWQA 2DGYA 4R8IA 4UPAA 3MXGA 3P42A 4F1SA 1E7ZA 1YEZA 3BVZA 1OXSC 5L95C 4B9XA 1ASYA 3D6CA 4IZ8A 4XQJA 3I4MB 1PH9A 1HTPA 3AMZA 1L2NA 4P6VF 3K7AB 4NXMQ 1D5XC 4Q5VA 3WCQA 4OIKA 3NTIA 4X3SA 3ULPA 4GDKA 5CV7A 1B70B 3HG9A 1SE4A 4DXAB 4BY1G 4C1NI 4LF7Q 1XLOA 2LI5A 4OVUA 3NUCA 5K36G 1J8IA 1AE2A 4FVMA 4E74A 3QOJA 1F52A 3S1RB 4A3LG 1V1QA 2G4DB 1BXTA 3IFTA 4WFN3 3D32A 3PRZA 4EKUA 3L0WB 3J7ZC 1VZ8A 4C3JG 1E7PB 3V6CB 4IUMB 3JAMc 1XTCD 1ENFA 4WORA 2EJFC 5CV5A 3I55A 3AMUA 2L7RA 1RL2A 1KNAA 1L4ZB 1SYCA 4LF4Q 3RFZB 4DR5L 4GKJQ 4Q0FA 2KQ4X 1U4AA 3IAYA 2F0WA 5LMNL 2KO3A 1IGDA 2RMMA 3NJTA 3WAOA 4DXGA 2SNSA 3MC0B 1JMLA 3RLFA 4O0AA 2J4XA 1QVFA 4FHKA 1UD7A 2DYOA 2UU7A 4JG2A 1PZKD 3HOUH 4PQXA 1HR0W 4A93H 5H92C 3VRAB 4WWNA 3ZJYC 4ANXA 4EQNA 3HFZB 3ZJVA 3C1FA 2XSCA 2K5VA 2NN6G 3BVMA 4HMIA 1Q81C 1YJIA 4XC2A 1CUKA 1BO0A 2N9XA 2B39A 2LZ6A 3DM1A 1I4QA 1O80A 2KFKB 2ZXPA 4DKAC 1UH6A 2UU9L 3O13A 3S15B 3B2FA 2R61A 5BYSA 1VQ4A 2BYFA 4K5VA 5LMNW 4A3CG 2R2QA 4CHKA 3MJWA 1TWAB 3LWEA 1W6KA 4GXBA 4KDLB 4LAAA 3ZQ4A 1X3GA 4KY7A 4OO1H 4AQYL 5IP7G 4CBVA 3RN5A 4DAPA 2INPE 5JZEB 3BK1A 3A9JA 2KYWA 2ICEC 4N9TA 4C3IG 5C3EG 2D3GA 4IFDI 2A5UA 2Y5BB 5C4JH 4G11A 3NTHA 1C1YB 4OZAA 1UEAB 1WSPA 2BYVE 1KAAA 3I63C 1SE9A 4JW0A 1YD8U 1H9MA 3TMEA 2BA0A 2A68D 2O2VA 4BZAA 5BN5A 3M7NA 4GLSC 3MZ5A 2HQLA 4TV3A 4IUQA 1PXUA 1YHAA 2K1FA 3I4LA 5LL6X 3NS1A 2IY1B 3K9OB 4RCOA 2JT4B 5MPOA 1G6JA 1U5KA 3APCA 5E6JA 2INNE 2ID0A 3BDOA 1WTWA 2P5ZX 5J39A 1C77A 4NXNL 2UUAL 2H1EA 4CGYB 2HIXA 5JEAH 1R4NB 5CHFA 1E8YA 1JWSD 2BQQA 2VQEQ 1TWCH 2YEPF 4GNXB 1SE8A 2R3ZA 1WR6E 4A3DG 4KDIC 2GA4B 1T5XD 5D3IB 1VQLA 4DR5Q 3IG3A 5M5YH 5LL6S 2E6XA 3QCAA 3L08A 2KENA 3J7YW 1TQOA 2CHBD 4A3KG 2C5CA 1S4ZA 4A3GB 1DONA 4BBNF 1LUZA 5E6OA 1BOSA 1PFDA 3GS2A 1FRDA 1STHA 4MGKE 5DNFA 2L83A 4ACFA 2RVLA 5DLQE 5G2NA 2W82A 4A3FB 2HTHA 3VH4B 1IP9A 2MJ3A 3W1YA 2XNAC 3BYYB 4C56C 3UF8A 3QWNA 4JBJA 1AH9A 3VR5A 1FPYA 2QKIC 4KD3A 1GVPA 1YVCA 4R4QA 4GGQA 2IHEA 2NUCA 4CDCC 4LK0M 4MSMB 3T51B 2M9VA 3A5UA 3CU7A 2WHIA 5JPNC 4GOPC 2F0FA 4CHTB 1F2YA 1XPUA 4JOIA 5AZGA 1VQCA 1X56A 2D10A 4J8QA 5FKAC 4WJ3M 4QB4A 1C4AA 5DPWA 2WP9B 3UE0A 4WRDA 3AM9A 2ZCBA 3ECIA 4KN7C 2BA1A 2VZAA 2G3QB 3D31A 1SJED 2KTFA 4LK1C 2K7VA 1EFID 2K6QA 3ZNZB 5C23A 1CFMA 4PZ6A 4NAWA 2WXNA 2IO2B 5FLXE 2JA8G 4W9IA 3MVVA 2AL6A 3NUHB 1FNUA 3A54A 4HTHA 1IZ6A 3ULJA 4IO9A 1F2RI 4XTCS 1SFOB 4R9WA 1HUNA 2CR5A 2Q2UA 1JQYD 3HOUB 4LF7L 1Y1VH 2JY6A 5JJIA 2J0KA 1OXUA 2KX3A 3ZO5B 1DYQA 2W55A 2O6VA 4KTAA 1CSPA 3TP7A 2DHZA 2IO1B 1L1OC 4S17A 4B3SQ 1QWYA 2YTVA 3EA6A 3PO3G 2JU6X 1A8VA 1JWAD 3E5SA 2M0AA 3K5MA 2F3VA 2O5IC 1OO9B 2EY6A 1EU3A 3VR4A 2AL3A 1WYGA 1KTKA 5COYA 4DR4L 1PUTA 1CKOA 3MP9A 1TWAH 3HVZA 4DK6C 1P3QU 3NE5B 1SYGA 2XK5B 2NTTA 4MTNA 4M01A 4GKJL 1EWCA 1T5EA 1FCLA 2BWES 1UEBA 2RDGA 1WCMB 2RPQA 2H88B 1IBKQ 4K0KL 5AFWA 1FFVA 4DFAA 4IPGA 2F3WA 4J6IA 2JE6I 5ELDA 3AV8A 3T9LA 1EYCA 3Q6BA 4ARCA 2ZVNA 1ENAA 3KFUA 4NB3A 2B63B 5IA7A 1Y1VB 2NPTA 4AYBG 3J81c 1YJ9A 4FLHA 1MFWA 3PF5A 3URYA 5M5XH 2F0KA 3T1YQ 1K3BC 3RT3B 1PTOC 3H8HA 1DD2A 2A19A 3NWSA 4X64Q 1L4DB 2NVUI 3K7AH 1ZKOA 3VR2A 5BMHA 1WZ0A 3GO5A 1JE4A 1P9DU 4AQYQ 3CCQA 4XWWA 2E76C 2VS1A 3SDLC 1UBQA 4A3DB 3W5VB 1O78A 4ZRKA 1EZ8A 1LACA 3P75A 4E3CA 1LT6D 1IGCA 1CMXB 4DHZB 4RGMA 1GC6A 2ZCCA 5KHOA 2BH2A 2MBBB 3JYUA 2LJ5A 3PLVA 3B9JA 4RMAA 3VYSA 1EY7A 1IKLA 1W3SA 2PEAA 1ZE3D 4L1BA 3AYHB 4DUZL 3C3LA 3UI3A 1VQEA 2L1BA 2OJRA 2UUCQ 4QUCA 2LGYA 4DV6L 3SR6A 1QOHA 3CRKC 1GO3E 2MGSA 3OYYA 1MJCA 1EY9A 4DR6L 2K5PA 1JCKB 3PLUA 4M8AA 3GE3C 2RSUA 5IAAC 3AFPA 1E7VA 1JORA 1T0YA 5GROA 4LUZA 4EGVA 2E3TA 1JQ4A 1TKYA 3AEDB 3E6ZX 2NVYH 2WX1A 3UIOB 2ZW0A 1SJHD 1FD6A
chains in the Genus database with same CATH topology
1TWFB 2KDMA 1DOKA 1PRTD 2WDRB 3FC4A 1Y8PB 1UNSA 2KJXA 1KRHA 3PUXA 1SIJA 3BDCA 2B2WA 2KHSA 3OWFA 4K5XA 5C0XH 3IT6B 4YXDB 2C9OA 2M00A 3TUOA 1WXQA 2SOBA 2EJGC 3LYYA 1H9KA 2OF1A 4WJWA 2WS3B 2EZVA 4WURA 2B2YA 2A6EC 1ZP0B 4ZRPA 1GB4A 5D65A 1PDXA 4LLGM 1PRTC 2WU2B 4P16A 4BA1I 3AE7B 1ET6A 4GDKB 3FILB 3CKIB 1JROA 2VNUD 3TEZA 3NSWA 3LNNA 3NBIA 2IX3A 3Q8EA 2G9HD 1XLQA 5E4WC 2R7ZB 2JZPA 2F1MA 1SNOA 4C7ZA 1TZOA 1AP0A 2WU5B 3TZUA 5IOCA 2A6ED 4A3BB 2PVOD 2Q8IB 4ODGA 5JVH3 1N5WA 2IGDA 4YTMB 3E0JA 4ZAIA 4L23A 2VB3X 3GP7A 2OEOA 1N62A 1TKWB 3I91A 2B8GA 4QMGA 2J7ZA 4ZQ3A 5M9OA 2BT6A 2FHTA 5CV6A 2WXMA 3TEYA 2A73B 1II3A 2DY7A 5BYQA 1QCBD 3NVYA 5A2QL 3S1MB 1PTOB 1KDAA 2Y3AA 2Q8TA 4BY1B 3HKZB 4DQOC 4ZHPA 1PZID 3N9YC 2R93B 3OHXC 4WAFA 1GPXA 1MSHA 4KGRA 2KCNA 3IXSA 1F9QA 4HCSA 4IUUA 2ZW1A 1IYUA 4KKUA 2PCFB 3ONAB 2RA4A 1L6UA 2AQ2B 3AE6B 2EE1A 2D5DA 1L5PA 1S5ED 2LJIA 3A8KE 2Y5PA 1EOTA 2AUKA 1PFBA 1QT9A 1KLUD 1K53A 5C4JB 4PMCA 1EM7A 1E10A 4HKQA 4HROA 3HS0C 4K5WA 4RGOS 2HQEA 1CZWA 1JOOA 1CM9A 5BYRA 1Q3LA 2Y0SB 3MA2B 2WXHA 1EY6A 3TBIB 4FXGC 3FEWX 3KF8A 4XYQA 4JK1C 3OIQA 1X3PA 1HFGA 1FGBD 1YNND 4CKEA 1SYFA 3E56A 5I6WA 1VZ7A 4C3IB 5C3EB 4BBRB 3KLRA 2BS3B 1BNZA 1RKNA 1STEA 1QOGA 2LFIA 1PRTB 2ONQA 4H2AA 3TEWA 4N59A 2PMZB 4IUTA 1U4LA 1DM0B 1QE6A 2TSSA 2WLBA 3IFDA 5FO8B 1AW7A 2X69A 4ARIA 1G2SA 2B2VC 2EYOA 1YNNC 2K04A 2L11A 2IL8A 3UI2A 1L0XB 4TQ0A 4AQ7A 3I9V1 3LB8C 3VR6A 3S9WA 2N0SB 2FMCA 2DN8A 2N9KA 1KDCA 3L7ZC 1SDFA 4F88A 2OHFA 1LT3D 4V0BA 2KACA 4A90A 1KLGD 3VRBB 1AWDA 3NTKA 2K1BA 4KKSA 3V05A 3NPPA 1A3UA 3H91A 1VMPA 3RPFC 2HDMA 1E9MA 3F2UA 2XN9C 1HHVA 1XF5L 5IGDA 2XVSA 5EPJA 1FXIA 4QF4A 3TP6A 3FPUB 4H7BA 1MVKA 1XXGA 2LS01 1I3QB 3GTOB 4H13C 1FO4A 2F0HA 2WXOA 4BY7B 4REZA 5JAVA 3S1NB 1QG7A 2Q8RE 4A6QA 4DGZA 1RF2D 3R2TA 2EY2A 1HUMA 4ULLA 4XE0A 1BCPB 4J6HA 3DWPA 3HVDA 5EE0A 2PW7A 3I3CA 4AYBB 5M5XB 4FF3A 3V96A 1EIHA 1PFNA 1WTRA 5KNDA 2LFNA 4C3HG 2NMQA 3PUYA 4M0WA 4HAEA 2EOTA 4RKBA 2PZWA 5KNCA 1DZ1A 1F0ZA 1DJRD 2ZXRA 3NWTA 2F0PA 3P4QB 4KY5A 4DK0A 1UUPA 1JB3A 3NQTA 4YSYB 2QF7A 1C79A 2RPVA 2F0DA 5IGBA 1CA6A 1LT5D 1O7ZA 2BYTA 4G7OC 2F0JA 2E2DC 4MM3B 2LHEA 1EY5A 5KYIA 4IFDJ 4HEDA 1F9SA 3HOVB 1CT1D 5FLXL 1A2TA 1JC7A 1V97A 5D14A 1B4OA 4NJCA 1ROEA 4MACA 4BA2I 1DOXA 1H9RA 2NBFA 1U4MA 3S2HB 2KA7A 2WXRA 1F2RC 4Z9CB 3KK7A 1A15A 3AE2B 4ZK9B 5E3FA 1PFMA 2WXIA 2Z4HA 2EYPA 3C1EA 3GTKB 3TEXA 1MPEA 4DXFA 4C2MB 1X3QA 3U4EG 3NXWA 3FPPA 3ZGZA 3P4RB 1BBXC 1TS5A 4RKLA 4US9A 2Z1CA 3FVQA 5C2TB 5JOBA 2WQYB 4GDLB 1GOZA 2RDHA 1PGAA 3HOXB 3Q8BA 1IYVA 5CGKA 5D3DA 3GV3A 4L2YA 2NB0A 3DXJC 4L63B 5C3JB 4Q2JA 3W2DA 2WDQB 4OIJA 1RTNA 2B2UC 2EYFA 1C4QA 2BS4B 5EBDA 3GTLB 3I4NB 1JWBD 1SNPA 2PTLA 1NYRA 1R4PB 4U68A 2MP1A 3IAS1 2LGIA 3AEEB 3KUPA 1WVLA 1RD9D 4G57A 3NVWA 2F0VA 4C1NK 2NVYB 1ZUD2 1RHPA 1SXTA 1T3QA 4G4KA 5CV8A 2ON8A 2WP8J 2L1AA 1WTQA 4KKTA 3C46A 3BVGA 2NWGA 5J22A 4UDUC 3DEPA 4KGSA 5C5LA 1EQVA 1H9JA 3SVMA 2VB2X 3MHZA 2ICIA 4KV6A 3W1SA 1A2UA 3S16B 1L6VA 4FXCA 1VJKA 2WDVB 1LTRD 2X6LA 2K5WA 4JWSC 2PZTA 3KLSX 4RGTA 3M4OB 5FK9C 5BMIA 3AH7A 4PV1C 3U7ZA 3T16A 3M4YA 2RSOA 4JPSA 2EDGA 4OHJA 1CTMA 2XRSD 4TSSA 3PZ7A 3FAHA 4K2LA 4KX6B 4ZYSA 5KRUA 1F9PA 5CR3A 1LTSD 1OQQA 3Q8AA 2EYJA 1Q8IA 2VZKB 1QB5D 3BG3A 2GI9A 4UAIA 1HZ6A 1MHHE 2CQAA 2L9HA 2WXKA 4O42A 4DK1A 1LTAD 1Z47A 1B53A 2MPMA 3AE9B 1S5FD 3D6WA 5AUIA 5DAUA 1NYQA 4FNFA 5ELFA 2K01A 1QKZA 2IT1A 2JA8B 3T3OA 3ZYYX 1IHZA 5IGCA 1I4HA 1IBXB 2M19A 1D4BA 3T53B 2F0NA 3P7JA 3VA7A 3FRPB 2BW2A 2WNMA 3VQIA 1ILQA 3IL8A 2HCIA 2R92B 2BB5A 2E75C 1D5ZC 3KBXA 1A3VA 4GZYC 2F0TA 4MHEA 2F0LA 2PPBC 1XCTL 4YWGG 1GUOA 4C3HB 1SJHD 2I46A 5IT9L 3GTJB 2SEBD 4MN3A 3AEFB 1NSNS 1V8CA 1CZGA 4A3EB 1AZQA 1WTXA 1C78A 1QLBB 1SYEA 3MFGA 3H94A 1CHQD 4AS1A 3H6MA 4ZKBB 1XWEA 5EKIA 3HP3A 3ND9A 1GUTA 2K6AA 2F0MA 1YN3A 4A55A 5HG2A 5EE1A 5EE9A 3QB3A 4OO1I 3A8JE 1GUNA 1QF6A 3TDQA 2K5QA 2XWBB 2XWJB 3Q69A 4KKJA 4XQQA 3D8GA 1E0ZA 3HRZC 5IODA 1YMHE 2LY7A 2V3PA 3A7LA 1VCIA 1NVID 4KHZA 2F0EA 4TMAB 3C2PA 3S14B 2F0IA 3N6RA 1ZYRC 2IGHA 4YIJA 2NTSA 2JYOA 3TZDA 3TP8A 1YN5A 1V1PA 5M5YB 4TKOB 1B44D 5AUKA 3P4SB 2CU3A 1C8CA 1K51A 4PT5A 4EQPA 4TRDA 3HGBA 4IN3A 3Q23A 1OXVA 3M7GA 1I6HB 4XQNA 3I8ZA 1ESFA 2DNCA 3R8BA 2EYHA 3SK4A 3E9SA 1ICWA 1RWSA 1V43A 1L0YB 2A74C 3SXHA 5M5WB 3HOWB 4CJ1B 1MBYA 1PDQA 1DCZA 3V3XA 4USAA 2KOLA 1ZYRD 3KLSA 1VF7A 2IGGA 2F0UA 5FO7B 4NAMA 2B2YC 2LMCB 1GHKA 4NW2A 3SK6A 2KEEA 2OXPA 5KIXA 2DY8A 1K8OA 2HUGA 1QNUA 3A7AB 2L12A 5ELBA 3Q0AA 5DEHA 3P1HA 3KWVA 1I50B 4JX1C 4IFDH 1BMLC 1BCPF 5E1FA 2EKIA 3EUB2 1TVXA 3GV6A 1X32A 5F2DA 5I9OA 3QOLA 4DF7A 4B08A 1BCPC 4RGNA 2R6GA 1XX8A 3NK9A 3GB1A 2LKVA 2HTME 1VMCA 3GD7A 4C7YA 1G91A 1J7BA 2V0GA 2XRQD 5LNK1 1D1KA 2M2LA 2VXWA 1SE2A 2X38A 1AEXA 3QIAA 3SR1A 2QMTA 3GTGB 4KN4C 2F0GA 1FRRA 1SE3A 1S5DD 1SNCA 1EYAA 4RHSA 4RF0A 1BCPD 3TP5A 4RF1A 4C80A 4FYDA 2PIAA 1YNTE 3MAQA 2WXQA 1JW9D 2YU9B 1EEFD 1RCVD 1PTOD 1TKEA 1XCQL 3WOEA 3GTPB 4ABNA 1SB3C 2M56B 4S3SA 4K14A 1G291 1ACCA 2L32A 2KECA 4OL7A 1N61A 1HA6A 2A69D 1EWHA 1SEBD 3PUWA 5CV4A 1STNA 2BOSA 2D2CC 5DM63 1GUSA 3K5NA 5H8YE 1G8ZD 1JWUD 1ML0D 1Y8NB 2J0TD 1U4PA 3HRDD 4X3KA 5A2QE 3PV0A 5JJZA 4KJOA 1M8AA 2L55A 3BIID 4K8IA 1SMYC 1TU2B 4IUNA 2EPBA 1K52A 2JEBI 2BDNA 4FXDA 4WQMA 3MXNA 2LEKA 3EJIA 5EKLA 3K58A 1H9SA 5E4XA 1EU4A 3B2GA 1TWCB 3K0YA 3I90A 4WWMA 1LLRD 3RD4A 2O2LD 3MEHA 1HQRD 2SDFA 3A55A 4DNTB 1PMRA 3DEOA 3MWYW 1K83B 4XDXA 1R4QB 1BDOA 1SMYD 1SAPA 1CA5A 1QOFA 1VLBA 4KHVA 3NZ3A 3I57A 3D4WA 4RWSC 1C48A 3PIO3 1KDBA 3NP8A 4DAYA 1LTBD 1FMAD 5I9PA 2QDBA 2O5JC 2WIIB 2EVBA 3PMFA 3H3VC 3T3NA 2AWOA 1FEHA 1MHXA 3Q8FA 1BQQT 3BS1A 4Y7NB 1MSGA 5K36H 5HI1A 1C9FA 1KH0A 1QOAA 4E6IA 1F2LA 4IUPA 3Q6SA 2E74C 2AQ1B 3ETRA 4KJNA 5IGEA 3HUIA 2JA6B 1RYJA 4U673 3SE0A 5J1ZA 2WXJA 3C8YA 1OXXK 1A6XA 4A9AA 1HEZE 2ZXOA 3PZ8A 3Q8CA 2EJMA 4K6DA 5K5PA 3J80L 1ET9A 3L9AX 3OMCA 5CV9A 1TS2A 1I6VC 3AECB 1ESRA 5IIFA 4ZKCB 1TS4A 4B0MA 2KVMA 1IKMA 4LMQD 5C4HA 2F0SA 4HJGE 2J53A 3AE5B 3EROA 2K22A 1HQMC 2QEJC 1TY2A 3IKJA 4M1UB 1ZOYB 2ACZB 1EY8A 3S1QB 2JSVX 1W6JA 1LT4D 1XLPA 3CIRB 2PW5A 1EY0A 1PGBA 3J81E 4BWGB 1FNVA 2PMVA 1YNJD 3TN2A 2PZUA 3BWUD 4IDIA 3I73A 3RUZA 1JOKA 3NVVA 3BZDB 1CQVA 1HPCA 2JP1A 2BDOA 1QJOA 2K28A 3AB9A 1KNEA 4ZRQA 2BTEA 5BMGA 4KY6A 5EPKA 1F2ZA 1R9TB 5CBEE 4PNYA 1PTOF 3JAME 2V4DA 1TWHB 3MHBA 4BBSB 2IW3A 3T56B 2WXFA 1UAPA 2EY1A 1CI3M 3U9OA 1E6EB 4OGQC 1KFYB 4KD4A 4F87A 1YNJC 3OPOA 1H9SB 1TYGB 4LTUA 5EGTA 3D3RA 2DYMA 5FOBB 3N52A 3J7AV 1U4RA 3AE1B 1JR0D 2L52A 5HFYA 2JWUA 1CK1A 1DOMA 4NAWB 1K50A 2NN6I 1JRPA 4J3OD 1D5MC 3WDNA 1JOQA 5CORA 5T8IA 4B0EA 1STBA 3RZOB 2QILA 2A68C 4HSPA 1SSNA 4HR7B 1LTTD 2NVXB 3A8IE 4TQ1A 5C44B 1YQ4B 1WD0A 4XT1B 1E2ZA 1F9RA 4A8XC 5I4DA 4ZLTF 5D7GA 1B3AA 5CC4A 4L8JA 2Q5WD 1NAPA 1FFUA 1VDZA 2JYEA 4JWUC 2RDFA 5G3LF 2HDEA 4NZLB 2EXZA 4OW0A 1WTOA 2WXPA 4OZCA 5BN3A 4US8A 3RMHA 1R7SA 3G6JB 1SSOA 2MH7A 5G3LD 3AE3B 5KYLA 2PVGC 4RHRA 1DOLA 4QCLA 2D5GA 3BYTB 3K57A 1LO5D 3J80E 2D9UA 4PMWA 4QUFA 1TJEA 4LJZC 3H0GB 4HSVA 4RH6A 2B2VA 2PW9A 4MT5A 1ILPA 4KK7A 1XO3A 1S5CD 2RQXA 1PYWD 3MXPA 2WB1B 2SNMA 1UWXA 3CRLC 3OMGA 3DWAA 1YN4A 1HA5A 2IJ0A 3L3OC 2JEAI 2V4IB 1LABA 4MH8A 3A56A 2JA7B 3ZJUA 4OVZA 2JSOA 4CJ2C 3DWMA 4R3DA 2NVQB 4CKCA 2FE8A 3BDLA 5EPLA 2FINB 1I4PA 3OW7A 3DWQA 1GB1A 1F2MA 4RNAA 2RKSA 3AB5A 2K5DA 3D4RA 5LHY1 4KKIA 1GAQB 3P4PB 2AQ3B 5EJWA 5C4XB 3OSOA 1PTOH 4IALA 3SEBA 1PZJD 5IGFA 2DNEA 2WAQB 4H44C 2AX5A 2PQEA 2OT2A 4A3KB 4A3IB 2F0QA 2WKCA 3J81L 3NQIA 2B2TC 3J7AF 3DUZA 3QG1A 2GRIA 4PMBA 1Q10A 1CZPA 4JE3B 1PLFA 1B2TA 3VR8B 5CMDA 4ME5A 4R8NA 2H89B 2PKOA 3D4DA 3U52E 4NP5A 3LX0A 1FD7D 3PUZA 2I07B 1I4GA 4ID6A 1EY4A 1SNDA 4IQZA 4HCEA 3WOFA 3NVZA 1LTID 2V3NA 1HFNA 1OXTA 3KQ4A 1CQFA 4YTPB 4O1NA 1I4RA 4J1MA 2FFKB 4NKLA 1I4XA 2QSDA 2W3RA 2KCCA 2JX5A 2JYTA 4TQUS 4XXEA 5KEEA 1FYCA 1BR9A 1PRTF 2XIWA 5C0XG 2X6GA 1AYFA 2MJ8A 4IURA 1HZ5A 2MHVA 1TS3A 3FDTA 3PO2B 1STAA 2DLBA 1G2TA 1TKGA 1IL8A 3PIP3 3ABVB 3P63A 3VYRA 3R3OA 5FR3A 1MGSA 5BN4A 1O7YA 1OFFA 3LXFA 4YSXB 2CW0C 2NZ1D 4X3TA 1U9RA 4RCNA 2CJNA 5M3MB 5C5MA 3FKIB 5ISRA 1M4VA 1SNMA 5C0XI 2KUMA 1VR9A 2EELA 1Q12A 3MXUA 2F03A 2PLPA 5I2XA 1B9RA 1RDPD 4FF2A 3GTMB 4YSZB 4L6TB 3VR3A 3ZJTA 4NMZA 1Q1BA 1TIID 5EKKA 1P7EA 3VYTA 4ITKA 1KF6B 1IUEA 1Z7TA 4RAUC 2RSNA 2CW0D 3OWEB 4WH4A 5DM73 1MD2D 1QNKA 4FF4A 3U2SC 5A35A 2IX0A 1SYBA 3ITPA 4G7HC 2E2HB 3PO0A 3T13A 4XYOA 3W9CB 1G6ZA 5CYUA 3SK8A 4FP5D 2E2IB 5JVG3 1D2BA 3AN1A 2FJ2A 1NEKB 1STGA 1E2VA 2D62A 1VRAB 1EYDA 1ZPSA 2NYZD 3QJYA 5TSSA 3HZXA 3EVQA 3EQLC 2EYLA 1B9MA 3PO3B 5HHDG 3EGRA 4DN4M 3MFYA 1CHPD 4ILWA 3AEGB 2KWDA 4HEA1 3K5OA 1FNWA 2AWNA 1Y1WB 3GQBA 3GTQB 2N7JA 1V1OA 3X3MA 1EL0A 2YEPB 1UWMA 1BF4A 5I6YA 1NCVA 1J9OA 2LHDA 2WKDA 3G7LA 4KGTA 1HTLD 3OIPA 3TSSA 1YQ3B 5HURA 3P1MA 1TWGB 4CQNA 2B2WC 2B8FA 4N58A 2MEKA 4MIUA 1SBBB 4I65A 3DWGC 1A70A 1HXYD 1NR4A 1EIGA 4HMJA 5NUCA 1EZ6A 4N9PA 1VDVA 1N60A 3VA5A 2LUMA 1D1IA 1SNQA 1MI0A 3NBHA 1JWMD 4HKZE 4OO1G 1NUCA 3R2IA 1NENB 1V8QA 2KQ3A 2Y5CA 3Q22A 1ONLA 4XDCA 4F8MA 1PGXA 3K6OA 4CJ0B 4D2KA 1J7CA 1C4PA 2K9XA 1KABA 2K32A 3IT4B 1NI3A 1SYDA 4IKGA 2B2UA 1C76A 3SFDB 4YTNB 1WWTA 2MUYA 1E2WA 2IDYA 4F7XA 2DBYA 4HRSA 2ENBA 1YJJA 2AUJD 3SDZA 3OOCA 5JXVA 2F0OA 2JA5B 1WD1A 2W54A 5FO9B 4A93B 4XDDA 2J52A 1Y8OB 1Q90A 1RTOA 4K8JA 2QIEB 2QCPX 2ZT9C 2PO4A 3MJ5A 3RZDB 3P20A 1UGJA 2WACA 1TT2A 1XLNA 2E2JB 1BUVT 2NVTB 1QQRA 2WXLA 1RODA 2BS2B 2K3UA 3FILA 5C6AA 3CHBD 1RJTA 2K05A 1Y56A 2FBWB 4BS9A 1T6BX 3K59A 3K5LA 1GUWA 1IBXA 1S5BD 5G5GA 4B9WA 3X3NA 1GXDC 2KEDA 5C4ZA 4IOIE 1FIQA 4YT0B 3SFEB 2HCCA 2J42A 1VF5C 3J9CA 1ZEQX 3AEBB 4RA8A 1DOIA 1Y69U 2IPKD 4H0LC 1HRJA 1TY0A 1WGKA 2MJDA 4IFDG 1L0VB 2KAJA 2L5TA 4IUVA 4FXKC 1EWYC 1BUIC 1AFPA 2O4XA 3VYUA 2CVRA 3U9SA 2N55A 2PNRC 4ZOHC 3V2TA 1J7AA 3NHHA 4I7ZC 5KGUA 4XIGS 4ZRZA 2G9DA 1JALA 3ERQA 1AZPA 1LV9A 2G1EA 1N63A 3SK5A 2W3SA 4FF1A 1DXMA 2VUMB 1B9NA 4P2CB 1XEEA 3EFXD 2N88A 4HN7A 2VZKD 3ND8A 3M85A 1F77A 1RFKA 5T1IA 4OZBA 4KI0A 4QIWB 2I38A 5G5HA 5GXGB 4A3MB 4RFBA 5I2YA 1FR3A 1ZDXA 2JQRB 4XWTA 1EQTA 1I7HA 1VZ6A 2B76B 1K8MA 3NRZA 2BCOA 2A6HC 3M3YB 2HDLA 4DU9A 2K33A 4ZHOA 1RM6C 2A69C 1IW7D 5JEAJ 3SHLA 1QOBA 2N9LA 3AE4B 5C3WA 2H4OA 5EQ0A 2QJLA 1WRIA 3HEJA 5CBAE 5KNBA 1C4CA 5C0XJ 4A3JB 1P7FA 1ZXHA 3FMCA 2TMPA 3R93A 3I72A 3KWLA 1JICA 2Z8LA 2A6HD 1EEID 1DOYA 4K6LA 2L4NA 3AU7A 1AN8A 1IW7C 1LTGD 4G7ZC 1DGJA 5M3FB 2EYMA 3DMUA 4DAVA 2KN4A 1STYA 3H09A 4KMUC 3HOZB 2BE5C 1WTPA 1B1ZA 4V190 3MTSA 2CJOA 5ELCA 1B50A 1FXAA 4EE2A 1ZDVA 4DA2A 2GB1A 1FM0D 3JAML 2JXTA 4N6EB 4ZUJA 1ZXIA 3QO2A 1HCZA 4X3UA 2YYZA 2WXGA 1WTVA 4ZUIA 2LMCA 2K03A 5EE3A 2PYKA 1OQRA 4JBWA 4C3JB 1D6EC 2L0CA 3L4PA 2RBMA 3AEAB 2KMMA 2A5HA 2EY5A 2OEDA 4WIPA 2K0PA 3CWIA 4K2KA 1XYIA 2F4IA 1Q1EA 2BE5D 3BK2A 3I70A 2SAKA 2FUG1 1ZXTA 2WV6D 1GJXA 2B2TA 3KBGA 1V1PB 4EVOA 3HOYB 5T1GA 4DNRB 1CJEA 1SF0A 2BBCA 3Q24A 3CQZB 4FO2A 1GHJA 1FCCC 2FMMA 3DHQA 5IGGA 2IWHA 2WINB 3S2DB 2IX1A 1N5XA 3IAM1 3W5UB 5C3XA 2DWQA 5ELEA 1TR5A 5HGTA 2I2YA 1A3TA 2JXMB 4XT3B 1GUGA 5EBCA 1QILA 2BB6A 3AE8B 4CKBA 3VR9B 2NN6H 3W3AA 3S17B 1NR2A 5IT9E 4NDXA 3PUVA 2Z4IA 5JPMC 3LWUA 5JEAG 3T4AC 4EQOA 1O7LA 1ENCA 1Z6HA 1MI2A 2MJEA 4R8IA 3MXGA 3P42A 3BVZA 1OXSC 4B9XA 3D6CA 4IZ8A 4XQJA 3I4MB 1HTPA 3AMZA 4P6VF 3K7AB 4Q5VA 1D5XC 3WCQA 4OIKA 3NTIA 4X3SA 5CV7A 3HG9A 1SE4A 4C1NI 1XLOA 3NUCA 5K36G 1J8IA 4FVMA 3QOJA 3S1RB 1BXTA 3IFTA 4WFN3 1VZ8A 4C3JG 1E7PB 1XTCD 1ENFA 4WORA 2EJFC 5CV5A 3AMUA 1KNAA 1L4ZB 1SYCA 3RFZB 4Q0FA 2KQ4X 3IAYA 2F0WA 1IGDA 2RMMA 4DXGA 2SNSA 3MC0B 1JMLA 3RLFA 2J4XA 2DYOA 1PZKD 5H92C 4PQXA 3VRAB 4EQNA 3ZJVA 3C1FA 2XSCA 2NN6G 3BVMA 4HMIA 1YJIA 1BO0A 2B39A 3DM1A 1I4QA 1O80A 2ZXPA 3S15B 3O13A 3B2FA 2R61A 5BYSA 4K5VA 1TWAB 3LWEA 1W6KA 4LAAA 3ZQ4A 4KY7A 4OO1H 2INPE 4CBVA 4DAPA 3BK1A 2ICEC 4N9TA 4C3IG 4IFDI 3NTHA 4OZAA 1UEAB 1WSPA 1KAAA 1H9MA 3TMEA 2BA0A 2A68D 5BN5A 3M7NA 4GLSC 3MZ5A 4IUQA 1PXUA 3I4LA 5LL6X 3NS1A 4RCOA 5MPOA 5E6JA 2INNE 2ID0A 3BDOA 1WTWA 1C77A 5J39A 2H1EA 4CGYB 5JEAH 1JWSD 2R3ZA 2GA4B 1T5XD 5D3IB 5LL6S 2E6XA 3J7YW 1TQOA 2CHBD 2C5CA 1S4ZA 4A3GB 1DONA 1BOSA 1PFDA 3GS2A 1FRDA 1STHA 5DNFA 2L83A 2RVLA 2W82A 4A3FB 2MJ3A 2XNAC 3BYYB 4C56C 3QWNA 3VR5A 2QKIC 4KD3A 2NUCA 4LK0M 3T51B 2M9VA 3CU7A 5JPNC 2F0FA 4CHTB 1F2YA 4J8QA 5FKAC 4QB4A 1C4AA 2WP9B 4WRDA 3AM9A 4KN7C 2BA1A 3D31A 1SJED 4LK1C 2K7VA 1EFID 1CFMA 2WXNA 5FLXE 3MVVA 3NUHB 1FNUA 3A54A 4HTHA 1F2RI 2YEPF 4XTCS 1SFOB 4R9WA 1HUNA 3HOUB 1JQYD 1OXUA 1DYQA 2W55A 4KTAA 3TP7A 1QWYA 3EA6A 2JU6X 1JWAD 3E5SA 2M0AA 3K5MA 2F3VA 2O5IC 1OO9B 2EY6A 1EU3A 3VR4A 1WYGA 1KTKA 5COYA 1PUTA 3MP9A 3HVZA 3NE5B 1SYGA 2NTTA 1FCLA 1EWCA