1DYQA

Staphylococcal enterotoxin a mutant vaccine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
228
structure length
228
Chain Sequence
EINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFRQHTILFKGFFTDHSWYNDLLVRFDSKDIVDKYKGKKVDLYGAYAGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Abrogated Binding between Staphylococcal Enterotoxin a Superantigen Vaccine and Mhc-II?
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Enterotoxin
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN A MUTANT
total genus 74
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2000-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dyqA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1dyqA02
1ENFA 5ELCA 1GOZA 1CHPD 1LT6D 1JWUD 1SJHD 1LT5D 2IPKD 4UDUC 1PRTD 1G8ZD 5ELDA 2NTSA 1I4QA 3BVGA 3R8BA 1RD9D 1EWCA 3SEBA 1PRTC 3BYYB 4RGTA 1I4GA 5I4DA 1TY2A 1S5BD 1SXTA 1PZJD 1LO5D 2SEBD 4RHRA 1YN3A 4DXGA 1F77A 1SBBB 1V1OA 1ESFA 1PTOF 2XRSD 1LLRD 3MC0B 3TSSA 3R2IA 1LT4D 1CHQD 4ZYSA 1EEID 4RGOS 2XN9C 1BCPF 1TS2A 4RCOA 4TSSA 1SE4A 3EFXD 5FK9C 5ELBA 1DYQA 1JR0D 1KLGD 1B1ZA 1EFID 1LTBD 1LTTD 1HTLD 2QILA 1LTGD 1S5FD 1V1PB 2Z8LA 1L0YB 1XTCD 3O13A 1I4HA 1LTRD 1S5CD 4Z9CB 1LT3D 1SE2A 2AQ3B 1TS4A 4OHJA 3CHBD 2AQ1B 1V1PA 1EEFD 1D6EC 4O1NA 3OWEB 1PRTB 1ET9A 5FKAC 4L6TB 1PZKD 3DWAA 1JCKB 1ET6A 2QEJC 3DWPA 4RFBA 4BWGB 1QILA 1AN8A 1I4XA 1HXYD 2IJ0A 1RF2D 1XXGA 1KLUD 2NTTA 2CHBD 2XRQD 1JQYD 5TSSA 5ELEA 4RHSA 1SEBD 3EA6A 1L0XB 4RGMA 1FD7D 1RCVD 1RDPD 1M4VA 1S5ED 2G9HD 2XNAC 3URYA 2AQ2B 4C56C 1CQVA 1S5DD 1LTAD 1SE3A 3MFGA 1PTOD 3R2TA 4NZLB 3GP7A 4RH6A 1AW7A 2R61A 1B44D 1BCPC 4K6LA 5D3IB 1SJED 1T5XD 3BYTB 1PTOC 1PZID 1LTSD 1EU4A 1BXTA 3BVZA 2TSSA 1FNUA 1YN4A 2O2LD 1CT1D 1I4RA 2RDHA 1FNVA 1PRTF 1I4PA 1PTOB 1LTID 1UNSA 1UUPA 1CK1A 2WV6D 4RGNA 4L63B 1HA5A 1JWMD 1D5ZC 1PTOH 1TY0A 4DXFA 1STEA 1BCPB 1KTKA 3V05A 1FGBD 5ELFA 1D5MC 1PYWD 2J4XA 1DJRD 3W2DA 3BZDB 1D5XC 5D3DA 1EU3A 2RDGA 1TS3A 3BVMA 1TS5A 3KLSX 1FNWA 1MD2D 2ICIA 1YN5A 3DWQA 1JWSD 1BCPD 1HQRD
chains in the Genus database with same CATH superfamily
2L11A 1RODA 3M7NA 4X62Q 2WB1E 3TBLD 2E2JB 3K59A 3KLSA 1YNNC 1UBIA 4HCEA 4X3UA 4JPSA 5LMNL 3APFA 4A3JB 2PZTA 1WOCA 3P63A 4XDDA 4YSZB 2QA4A 2KJHB 4US9A 1HZBA 1I3QB 1GUNA 1UEAB 2KMCA 1SYBA 2N7JA 1SDFA 3FRPB 1SNDA 2KT7A 4G50A 1LM8B 1F2ZA 5EE9A 3W1SC 1IW7C 1SXTA 1LO5D 3ND9A 1GUWA 2FBWB 4HJKA 4KIKB 3ZJTA 4B6WA 4DPGA 4A3EH 1VQJA 3HKSA 2OTJA 2N9XA 3PRMB 4IW0A 3MC0B 1P0RA 4H44C 1UEBA 1J6QA 1EQQA 1CZWA 5KHOA 3CIRB 1TKGA 4IFDH 1YX6B 5ELOA 1JB7A 1DGSA 1SE4A 5FLXL 2NVTH 3L9AX 3GTKB 1MIUA 4F87A 3H15A 3E56A 2K05A 3M3JA 2MJ3A 2K28A 4ZHOA 3I9V1 3MA2B 2VRRB 4DHJB 3A7AB 1XTDA 3PUZA 3K5MA 3K9PB 2NVUI 3GTOB 1V1PA 1VQ6A 5E4WC 1UE7A 2GBJA 3LXFA 1XEEA 4FULA 1YJ1A 1B2TA 4EZLA 3GZNI 3AEFB 3CMMB 2FMCA 4LMQD 3S14H 2WNMA 2LXJA 1L1OC 1K9MC 3HM6X 3TMEA 1M90C 3CQZB 4A3OA 3I70A 5IYCG 1CA5A 4IUTA 1NVID 3U7DA 3G6EA 4ITKA 1ACCA 1WXQA 4EX5A 1UF0A 3LJ3A 2DZIA 3JSVA 1J8IA 4J1MA 3RZDH 4A3MH 2Q2UA 4LJOB 4FF1A 5CBAE 1V86A 4FP5D 3U4ZA 2HE7A 4J6IA 3IFDA 1GD7A 2RPVA 2D5GA 4G7HC 3ZJYC 2C7HA 2WDRB 3T3OA 3W1GA 4MN3A 4HLEA 1AW7A 4C3JH 5IAAC 4HXDA 4RNAA 3MAQA 1GXDC 2PZUA 2BYVE 3Q8FA 1P7FA 2EQSA 3HOWB 1F9QA 4G7OC 3OOCA 1PYBA 1CSQA 1EY9A 5JEAH 2Q5WD 1FO4A 2TSSA 5IP4D 3QA8A 4HK2A 3ZDTA 5FLXE 4QUFA 3H09A 1WMHA 2D0OA 3LWEA 4MTKA 1A0IA 3KDFB 3VH4B 2WV6D 1GUTA 3J9CA 5K5PA 2WXRA 3EC8A 3H94A 4HTHA 3KJOA 3I63C 1XMOL 3M95A 4A9AA 1XCTL 4DXFA 3RD4A 2AMCB 4GKJQ 1HNXL 3EFCA 2NS5A 5J3BA 1E8WA 2LJIA 3FDTA 4LF7L 3QO2A 4GN4B 1YX5B 3PMFA 5EJWA 4B3SQ 4HPPA 2K5WA 2EZVA 1PH8A 1X3EA 1WYDA 2CVRA 2QCPX 3FPPA 4C3HB 5IYDH 1AYFA 3L08A 2F52A 1RFAA 3L13A 1TS5A 2KAJA 4YY3L 5DM73 1SN8A 4BY7H 1JWSD 1FD6A 1FRRA 3KUZA 4AP4C 2A4ZA 4FXCA 2BH8A 3P4QB 2A5UA 2FHTA 2LUMA 1TZOA 4Q0FA 4WFN3 4JQWC 5C0XG 1PGAA 2DNFA 4JCVE 1XMQL 2D3CA 2G9DA 2LVQA 2OEOA 3RZDB 1TXYA 5FOBB 1UE6A 4B3RQ 2ZM6L 1RD9D 3NBIA 4A3FB 2LRUA 1JT8A 2WYQA 2M56B 1J19A 4MSQB 4FHKA 2PNRC 1QZGA 1CSPA 4NXNQ 3L2PA 4FYDA 1BMLC 2SEBD 4A75A 3CD6A 1YD8U 1CKMA 2CHZA 2J53A 2KWUB 3KBXA 3CQZH 1MBYA 1VQAA 2KA7A 3G4SA 1YNTE 4KSKC 2I1JA 2QC8A 1Q3LA 3S24A 2K5NA 4IPCA 2OTLA 1E7PB 3TP8A 2EYHA 5M9OA 4LNIA 4S3SA 2F0MA 4WJPA 1UBQA 2KHWB 3GTOH 3OLMD 1ZE3D 2IO2B 1B3AA 2OQ0A 1MI0A 4AJYB 3NK9A 2GBKA 3R7RA 4NPSA 1LTRD 1N32Q 4MZ9A 4BA1I 2INPE 2KXJA 3DUZA 1HFGA 4JI0Q 1NDDA 2WLBA 5D2MB 3HFZB 2JA5G 1DCZA 3A1QA 3DVGY 3EHVA 2L1BA 5FKAC 2BB5A 2KC1A 1RHPA 1H4RA 3HRDD 2PQAB 2HHHQ 2V0GA 4LF6L 1J5EL 2K03A 3DWMA 1V2YA 1ET6A 3I4NB 3ULPA 4AWJA 1KDAA 2UXCQ 4GMVA 3CP0A 1RF2D 4YCWA 1XXGA 1Q86C 2EELA 2D3GA 3Q2AC 2OOBB 3RCZA 4PS8A 1FXAA 3PO2B 1L5PA 1Y1VH 2FAZA 2JRIB 4X3KA 3SFEB 4A3BH 1YZ6A 4FHJA 2IW3A 2F4VQ 4ANXA 1C3TA 1KDCA 1RDPD 5FO8B 2E2JH 4L1BA 1LUZA 2L76A 1XQQA 1N62A 2MGSA 1XCQL 3B08A 1F9RA 2KC2A 1STNA 2YYZA 2WXNA 3NBHB 1XWEA 4IJHA 5IGFA 2VQFQ 3TUOA 2JA9A 2JVCA 2K8HA 4YWGG 1YNND 3ER0A 4XXEA 1Q1OA 1EOVA 3BVZA 3FP9A 4L5QA 2QDFA 3J7YW 1B7YB 4J6HA 1VQKA 5I9OA 3OMCA 1WJ4A 1B9RA 3H3VI 1I6HB 1IUEA 1WI5A 2Z6KA 1ISNA 2NMQA 2DYOA 5E6JA 3ALBA 3VR4A 1BVSA 4KMUC 4FF2A 1OTRB 1E24A 2C35B 2JUOA 4H7BA 1OQYA 3K5NA 1VCBA 1WE7A 2JP1A 3BINA 3I5JC 3TEWA 2WFWA 1TVXA 4BBSH 2PVGC 2ZPYA 3BZDB 1D5XC 4DUYQ 1KH0A 3T53B 1PH2A 4PS3A 3KFUA 1S72A 5KEEA 1JMLA 3S2AA 4KHPQ 5CV7A 4A20A 1SYGA 3OPOA 3H9DA 1G6JA 1NAPA 1EQVA 4GN5A 1MHHE 2DBYA 2BKFA 3GTQB 3VYRA 1WJNA 2O2VB 1IGCA 4MGYE 3DMUA 3P4SB 4Q5VA 1ZXTA 1ZXHA 3OAWA 3FVQA 3ECIA 3P75A 3A4RA 4PT5A 3ZIMA 2F0HA 5T8IA 2WHIA 5IKCM 1F1HA 4MELA 1L6VA 1F2MA 1Y1VB 3DHQA 5M5WB 3K7UC 1YITA 3APDA 4MIUA 1X55A 4B9XA 5CHWA 3ZQ4A 2R92G 4K7WA 1IBML 1BDOA 4R4TA 2D11A 1PZJD 2IY1B 4RHRA 2G3QB 4LFAQ 4LFCL 1IBKL 4U673 1ZDXA 3VA5A 2G45B 2GVAA 2NZOA 3TCAA 3S1MH 1MG8A 1FFUA 4RGOS 4P2CB 1FIQA 4WJ4A 4LW1A 4DDGD 2XGTA 2KFKB 4ZAIA 2QDBA 3FAHA 3CXCA 4L5SA 4W9HA 1FCLA 2KUMA 1E3PA 3VAWA 3H7SA 1Y1WB 5HFYA 4ZLTF 2WXIA 2JA7B 4UP8A 1V6EA 1S5CD 4LDTD 4ZRZA 4V190 4EUTA 4GXBA 2EKIA 1YVCA 3WAPA 2AQ1B 2IGGA 2KK8A 4X65Q 4DV1L 3RZWC 2M1MA 1EY4A 4G11A 2ZJPA 3J7A5 3ERQA 1A63A 1VF7A 2KTRA 2C60A 2KCNA 1Q8IA 2QEXA 2ZTCA 4R4IA 1CI3M 1GC6A 3HM3A 4IN3A 4POFA 1HE8A 3D0FA 2WACA 1A70A 3PF5A 3HOZG 3I4NG 1D1KA 1UE5A 4FJZA 2KO3A 4KHZA 1KDBA 1MJCA 2L4NA 1LYLA 2O6VA 1WTOA 2KOLA 3AECB 5IY0A 3KYHC 1NBFC 2UU9Q 5G3LD 1VDVA 2NBUA 3DBSA 3U7ZA 2Q2IA 3ND8A 2B2UA 2BS2B 4XC2A 4C56C 2K52A 1SYFA 4CDCC 4DU9A 5DEHA 1RTOA 1N60A 4BKSD 3KF8A 2M2LA 4BY7B 4ABNA 1TWFH 5M3FG 4POGA 3BYTB 3VUYA 4ILWA 1EY6A 2G4SA 3QCAA 1EYGA 2JSVX 1YOVB 1H95A 2X38A 4IOAA 1NE3A 2AEHA 2JPHA 2KWDA 4NXNL 3H6NA 2O2LD 3ZUNA 1B3QA 2VL6A 3QAQA 4RMAA 3ZTCA 1FNVA 3AE1B 3IAM1 4K81A 3DEOA 3AEBB 1ZYRD 4LK1C 5C4XH 1T6BX 4JGHB 4ZHPA 4OO1I 3A56A 1BF4A 5IO9A 1KFYB 1LFDA 4JE3B 3CCLA 1KNAA 1SYDA 1ESRA 4X66Q 3T1HL 4A3CG 4NKLA 1WX7A 2L52A 4A3PA 1ZOYB 4ARCA 1XLQA 2JE6I 5EAYA 4E6IA 4N9TA 4FF4A 2NVQB 4ODGA 4UPAA 3VR8B 3KWVA 2L15A 4YY3Q 2O6VD 3V2TA 4JWSC 2PE9A 2FCMA 2PTLA 2ICEC 3JSVB 2KTRB 3NWSA 4IFDI 1N36L 1WTQA 4B95A 3QIJA 1KIXA 4PQXA 2IGHA 2CW0C 4D2KA 3CCEA 4C3HG 5F2DA 5FLMG 5JHAA 1MJEA 3H8HA 1PH9A 3HOYG 3TEXA 2IX0A 2LFIA 2A1AA 4NW2A 1SROA 1IPGA 1GAQB 2ON8A 2RPQA 2W55A 2ZJDA 4I7ZC 3MXGA 1WSPA 4PG3A 1XF5L 2B2WA 1E90A 4KGRA 1CMXB 4XIGS 3VR6A 3T3NA 3HOXH 2JN4A 4IUUA 4HIOA 1EF5A 2JYTA 2K5PA 4KHVA 2KMMA 3W3AA 1YI2A 2WWZA 3H0GG 3S14B 1XLNA 3UE1A 5JOBA 4RM8A 2N78A 5M3MG 3V3XA 4TSSA 3N32A 3ZRFA 1GUGA 1Q1EA 4PK1A 1TZ1A 3C46A 2JQOA 5C6AA 2MO0A 1HTLD 4ZCKA 3PGEA 1AFPA 4XDXA 5HGTA 3R66C 2AHOB 3MXNA 2JWZA 3H6MA 4K2LA 2REXA 3KYDD 4HJ9A 3J7ZC 4IOCA 4C3IH 2AQ3B 1VQ4A 2FJ2A 3HUIA 1K73C 2DY8A 1E1TA 1WH3A 2WX0A 2Z59B 2ZW0A 3I2ZA 1ZKHA 1EEFD 1D6EC 5NUCA 4XWTA 3GTKH 2R93G 2IZVB 3ONSA 3RLOA 1HRJA 2F0QA 5A2QL 4HWIB 3IAS1 5IYDG 1RL2A 2JA8H 4MGZE 1PH7A 5E3FA 3O65B 1JC7A 2R92B 3MTNB 3AE9B 3DWGC 1QG7A 1I4XA 2WXPA 1E5WA 1TWHB 1G2SA 1KLUD 3CCVA 1EM7A 4DV2L 1DOXA 5AJ3Q 3RUZA 4OEMB 2F0SA 1Z9FA 1E7UA 3S1RH 1I3QH 2WP9B 4IOIE 4KKJA 2DJFC 3RNBC 3ICEA 1K28A 1Z5SB 4A3DH 1UE1A 4TUUA 3V6CB 3A0JA 2N49A 1CKNA 1EYDA 1FL0A 1JROA 2UYZB 1QUQA 4JG2A 1QZHA 1X1MA 1GJZA 3S16B 1KRHA 3IL8A 4C2MH 4FBJB 1CZPA 3DBHB 1E8ZA 2B39A 4AS1A 1EY5A 2C7NB 2NPTB 1C76A 1HZ5A 1UWXA 1I42A 1G91A 2PNHA 5M5YB 1HR0W 2NBFA 1TBEA 3U9OA 1PV4A 1L0VB 1LV9A 3SK8A 1J7BA 4NNJB 3QARA 3HIZA 4A3LH 1BR9A 4LF5Q 2NBWB 3K5LA 3TBIB 1PTOH 2RDFA 4OGQC 4WJWA 1ZYRC 1GC7A 2UXDQ 2N1WA 4DDID 3QR8A 2KQSA 5BMHA 2R7FA 3X23A 2AUKA 4ZQ3A 2FIDA 2OXPA 2WKDA 2IL8A 1WWTA 5IYBG 2DHZA 5C44H 2UU7A 3HEJA 1WZ3A 3HGBA 2B63G 2JA6G 4JI5L 2D0PA 2N88A 4UDUC 3RD2A 1BCPD 3NG0A 4HCPB 3X3MA 5ELCA 4MEMA 1SJHD 1N6ZA 3GOEA 1STBA 2F0KA 4DR5Q 1M1KC 2W9NA 2E2HH 1W3SA 3NVZA 1I4QA 3S17B 2UUBL 3R8BA 1TKYA 3DVGX 1E7ZA 3CF5A 2BH2A 4DAPA 3NZUA 3AV8A 2XK5B 1Y56A 2JQRB 1RJTA 3KLWA 1TWHH 4QL5A 2G1EA 3FEWX 4CJ1B 4IUVA 2K75A 1VQ7A 2PEAA 1LLRD 2CH4W 3PSIA 2LI5A 2R6GA 3B2FA 3SK6A 1ZEQX 3F8TA 2KANA 2ATWA 2F0PA 2BYEA 3F1ZA 3GS2A 1K52A 1YQ3B 1HZCA 2H4OA 3ABVB 4NP5A 3J81L 1I7HA 3ML9A 1TWAB 1K83H 1ICWA 2MX2A 4OZAA 1I4HA 2PW9A 5GAEC 2IBIB 2UXBL 4YTPB 2JYOA 4J3OD 2PI2E 4JYAQ 3P2BA 2J42A 2LXAA 2F0WA 4FNFA 1HZ9A 4IDIA 4DR1L 3RNUA 2OHFA 4N8X1 2R93B 1DOIA 2KDEB 5AEKB 5MPOA 4W9CA 4HEDA 2J0MA 4MM3A 1DOYA 4UAIA 3AH7A 4RF1A 2B2VC 2EY1A 1K8OA 3CCRA 4OVVA 4FO2A 1Y8NB 3SGIA 5KRUA 2K39A 3DBRI 4HEA1 2EY5A 1AN8A 3X3NA 2D07B 4REZA 2NB0A 4XTCS 1KF6B 3H3VC 1TKWB 1C4AA 1RTNA 1E0BA 4OZBA 3OMGA 2MCNB 2CHBD 2A5HA 4BY1B 3IHPC 3TP7A 4EVOA 2JXMB 3K80C 3PO3H 3AFQA 2SDFA 3P20A 5C0XJ 4XE0A 5BR8L 3A74A 1Q1BA 4YTNB 4LAAA 3I4MB 4Q2JA 5I2YA 1M4VA 2AQ2B 3WAMA 3S15H 1UELA 2IY5B 1LTAD 4DAVA 1XNRL 4P72A 5EQ0A 3A5UA 4DAYA 1GNUA 1WYGA 2MA9B 2YLMA 1ASYA 2R2QA 1VJKA 3RN9C 1YJIA 2NVQH 3U8ZA 1OXSC 3KW5B 1BXTA 2HDLA 4RAUC 2UXBQ 1VD2A 5C44G 2BF8B 1EOTA 1NMFA 2KACA 1E10A 4DV6Q 2N1VA 4DK3C 4JIOU 4LCDE 4DV5Q 2RKSA 4R3DA 2CHWA 3OTOQ 4MT5A 3QK0A 2Z6BA 4UHVA 1EIGA 4M0WB 5EKIA 5C4ZA 2LXCA 3AE6B 3IT6B 1HA5A 3I73A 3V62A 4X57B 1NTGA 4KN7C 1XMOQ 1Q46A 1AARA 1QWYA 5C2TB 4WAAA 1SE9A 3VR2A 1C79A 1WE6A 4ZDVA 1NENB 5J18A 2N7DA 3AI5A 1PYWD 3L54A 4A3GH 3KVFB 3WAOA 4J8QA 4KY5A 3MC8A 1OXTA 2K9XA 2PIAA 3RNAC 4ANWA 2KQ3A 3DM3A 3FKIG 3BVMA 2ICIA 1H9SB 2CKHB 4DR2L 1Y1VG 1JQ4A 4HJ5A 1F9JA 3RNFC 2CQAA 1IKMA 5HHDG 2C5CA 3SE0A 3VTVA 2B29A 3ZLZA 1VCIA 2LFNA 3MEHA 2QCZA 3A9KA 3A8JE 1LT5D 2IPKD 3GV6A 4YCUA 3KJPA 1XNRQ 1C0AA 1G8ZD 3PO0A 4BKTA 1YNXA 2IWHA 1JMCA 4HCNB 1BQQT 1PRTC 1WTWA 4QIWB 2FUG1 2MW5A 4JOIA 2BE5C 4IM3A 4DR3Q 1E2WA 2QDLA 3NTIA 1I94L 1MJDA 5E6OA 1T3QA 4P16A 5JPMC 4WURA 1RYJA 1F77A 1WJ6A 4M8MA 3TSSA 2F4IA 1P1AA 1V8CA 4KJOA 1J0GA 3HOZB 2Z0SA 2UXDL 1FMAD 3J7AV 2ASBA 4PNYA 2DZKA 5IP7H 4KY7A 1R4NI 2KKCA 3UF8A 3NS1A 2PVOD 4US8A 2DY7A 1VQEA 1YNJD 3AEDB 2EJMA 3TZDA 2JZZA 1A8VA 1L4ZB 2JA7H 2V3NA 4G3XB 3IKJA 4FDBA 4ALPA 3PV1A 5EPLA 2HQEA 4MGIE 2F4VL 3TRZA 5AUIA 4AIMA 1D3ZA 2KCCA 1IBKQ 4LFAL 4LFCQ 2BT6A 2GLSA 2FMMA 4R9WA 4M8NA 4WWMA 3DWAA 1A5RA 2F0IA 1PUTA 5M3MH 1J5EQ 3QWZB 4JOIC 3H0GH 1ZKOA 5IGCA 3R3OA 4BWGB 5FJ8H 4LDTB 3AE7B 3MVVA 4NQLB 1CKNB 4C7YA 4YL8A 3V96A 5CV8A 4MDKE 2OT2A 3EA6A 2E76C 3QB3A 4HN7A 4RGMA 4XT1B 1OGWA 2WXMA 1IYFA 1FVIA 4HKQA 4AJWA 3HRZC 5JEAJ 1S5ED 2BA1A 2KX3A 1T9HA 1WR1A 4JWUC 1Q90A 5IP9H 4HIDA 4BS9A 2M19A 4A3KG 4ICUA 1B44D 1BCPC 3M9BA 5D3IB 1SJED 1XO3A 4CO7A 4EOYA 4JBKA 2I2YA 1QVCA 3CW2C 4DN4M 4B0MA 1K3BC 2EJGC 1O7LA 4WWOA 3TZUA 1N9WA 1BUVT 2LMCB 3PZ8A 1L2FA 3RI7C 1X3FA 4JI3L 5KYIA 3P42A 4MTNA 3J80L 3M85A 2F0FA 3U9SA 1F2RI 2L3ZA 2WDTB 3GE8C 3AB9A 1CT1D 3PQIA 1R9TB 3J80E 1L6UA 4W9DA 1KJTA 4TQ0A 4DR6Q 2MBEA 5D94A 1Q82C 3DBLI 2KHSA 3U58A 4DV5L 4JI7L 4XYCA 5IN7A 3K5OA 2JA7G 2HDMA 3I8ZA 1IGDA 3G71A 3C3LA 1JWMD 2O4XA 3K7AB 4IUNA 4Y52H 1QOBA 2DX5B 3AE2B 2D2QA 4HDQA 4WJNA 3OIPA 3ZYYX 1KTKA 4BBRB 2JY6A 4GU2A 3N52A 2DYBA 5C4XG 3N9YC 4GNXC 3NOBA 3SFDB 4LK0M 1WF9A 1XT9B 2PMVA 3PV0A 1PGXA 4YWMA 4DV0Q 4UY8C 1J8CA 5D3DA 3HOVB 2JU6X 4EQPA 2L00B 4DF7A 4JI4L 2KEEA 3EUB2 2WS3B 1JICA 4HKZE 4EEWA 1YNJC 3RZOH 1BBUA 4BZAA 1P8LA 4HSPA 4M8AA 1I50B 1H9RA 4JYAL 1WGYA 4JI6L 2Q8RE 4IZ8A 4DR5L 3C2PA 4OVZA 3L0WB 1PFDA 5AZGA 4LUVA 5CV4A 5KYLA 5GQOA 2HQLA 1FFVA 2UUCQ 1Q10A 3I56A 4A3BB 1H9MA 3DHHC 5I6YA 3OHXC 3GDEA 2K8BA 3VQIA 2BVCA 3A7LA 2KCMA 1S1QB 3PO2H 1B50A 1C4QA 2NVXH 3EQLC 4GLAC 4EQNA 5E4XA 2UXCL 2MJ8A 5I4DA 3U50C 3NJTA 1TY2A 2WXGA 1VF5C 3OIQA 1WGRA 1BT0A 4FVMA 2MH7A 5JJIA 2HIXA 3S2DH 5IGBA 1WXAA 2ES2A 4GN1A 3I4NH 2NVYB 3FKIH 5M3FB 5IT9E 2QSDA 5JJKA 4DUZL 2CJNA 2M4NA 3DLLA 2K1BA 2LVPA 3GTPB 2BTEA 2EKEC 2MO1A 3MXUA 3R7QA 1SFOB 4CDEC 2VZKB 2IDYA 4BY1G 2EY2A 1PMRA 4OO1G 2E2IH 4K5VA 1V1PB 4TQ1A 3CCUA 5AUKA 4PMWA 2CW0D 1LT3D 5L83A 1NUCA 4QAYA 2NCNA 2A6ED 2INDC 1VQMA 2L5TA 3B0AA 1PRTB 2N4FA 3WWVA 3T16A 3K8AA 3NTKA 1VQGA 4TKNA 1VQIA 5AZFA 2KJXA 3R93A 1WMHB 4B0EA 4C00A 4RFBA 1Q7YC 1U4RA 2K25A 4LTUA 5C5LA 1A2UA 1GUSA 2VW9A 2YEPF 4JI2L 2W3RA 3PUYA 2EPBA 2BDOA 5IWAL 3LX0A 5C4JB 2LGXA 3N1ZC 2KCTA 3L7ZC 4JLCA 3HKZB 4FJVB 4A3FH 5D7GA 3ZDMC 4EE2A 2LY7A 3P1HA 4EQ5A 3CC2A 3PO3G 3HHMA 2WU2B 1LACA 4HMIA 1WCMG 1FXIA 4MH0E 4IWPA 2K5VA 4XQQA 2JA5H 2G9HD 3VDZA 1H9KA 4NQKE 3SDLC 1YJ9A 4A3KH 4QJFA 4IPHA 2R61A 3J7AF 2VH1A 2NUCA 2ZXPA 4X3TA 3KOJA 3VVWB 5JJLA 4FADA 2LRWA 1MI2A 1OXUA 5D6JB 3M4PA 4A3FG 1YIWA 1TYGB 1VQFA 2Q2TA 2ZVOA 1D1IA 2BS3B 2NR2A 3BZKA 4DV6L 4GSWA 1TWGH 1S3OA 4OW0A 2WQYB 4CJ0B 1LTID 1QT9A 2GB1A 2UWQA 3RFZB 3UQBA 1CK1A 5DAUA 1TJEA 1X6OA 1CFMA 1U9RA 1C48A 1WI0A 2LGDA 3GE3C 3V6EB 5I6WA 1UWMA 4PZ6A 3D4DA 1M8AA 5ELFA 1PVOA 1Y8PB 4K8JA 2L0TA 2MJDA 4C4VA 3HOWH 5CTRC 2I0QA 4DR7L 3AE5B 5C0XH 4NAWB 2VUMB 4C3JB 1YN5A 3EJIA 4KKSA 2ID0A 3TN2A 4DK1A 1TQOA 4PZ8A 2ZPNA 3U2SC 4OX9L 5IOCA 1LT6D 2A6HC 4K0KL 4LNKA 1VDZA 3D3RA 1BNZA 1EWYC 3Q8DA 1CM9A 1PDXA 3C1FA 2M0XA 5ELDA 5KIXA 3SU8X 1MSGA 1G291 2HHHL 3FPUB 1YBYA 1QZEA 2IO1B 3N3KB 2I07B 2G4DB 1V8QA 4RCNA 5HURA 1ZGUB 2KVRA 3TS0A 4NAMA 3KUCB 1NNXA 2HD3A 4GGQA 2O2VA 1SIJA 4KVGB 2KQ4X 1F2LA 3MFYA 5JPNC 2JYEA 3P4RB 3NENA 4H2AA 1VZ8A 1KABA 2GOWA 1PFMA 1IBXA 3PZ7A 4S0RA 4RCOA 3JAME 3GTGB 5IGGA 2KFJA 1II3A 5FK9C 1C1YB 2I1KA 2N7EA 3CWIA 2DZMA 3AMZA 4O0AA 4LF4Q 5DPTA 1JB3A 2QILA 1JWAD 2EOTA 4DHZB 1FRDA 3NP8A 4A3CH 3WOEA 1DONA 2INNE 3QC8B 4WJ3M 1WCMB 1L0YB 5IIFA 1TT5B 4QY7A 3OG5A 1TS4A 4IUQA 2F3IA 4FA6A 3F2UA 2NVTB 2HCIA 1WGKA 4WWPA 4A3BG 3Q24A 3BK1A 3HOUG 2H1EA 3GTLH 2K0PA 2Y0SG 5J2RA 2FNJB 2BPSA 3ZXVA 1O80A 2VQEL 2NVYH 3FKIB 3I4OA 2X6LA 4CDFC 5M3FH 2X8XX 3N20C 3S2DB 1DOLA 1CQFA 2ZZPB 1N34L 4A3EB 4DAYB 5C3EB 4GB9A 3JAMi 1KAAA 3PIPA 1ZPSA 4XGAB 3QJZA 3WALA 1RM6C 1K8AC 1EIYB 3DHGC 3HS0C 1BOSA 4O42A 1V49A 2EMTA 2KWCA 4LJPB 3CCQA 2XWBB 2CH4A 2MUYA 2ZXRA 4TVAB 4XYOA 4RHSA 1ENCA 3Q6BA 2DLBA 1PDQA 3T1YL 4A6QA 3F2CA 1FD7D 3PSEB 4AOFA 2YU9B 2OEDA 2RR9A 3AM9A 3ENEA 1O7ZA 2AL3A 1GJXA 3H91A 4WJQA 1IBLL 1AP0A 1WRIA 1PFBA 3NEMA 4A90A 1RIPA 3AE8B 5CYUA 5IE8A 4LF6Q 1X3PA 2JA8G 4KIKA 4BY7G 3NELA 3HOVH 2MWSB 5DPRA 1A2TA 3L10B 4UP7A 3CRLC 3KDFA 1Y69U 3E9HA 4GDLB 1SMYD 1PH1A 2ACZB 4PMCA 1FPYA 1D8LA 1H9SA 3NQTA 2MQJA 5CC4A 2K14A 4II2B 2K01A 5ELNA 1PFSA 1UNSA 3K7AH 4DK0A 2HT1A 1CZGA 4K5WA 1VLBA 3DBLB 2N55A 2EIFA 4M01A 1IKLA 2D5DA 1HJPA 3ZW3A 2HTME 2OQKA 3NY5A 3UDGA 2JRHA 2ZTDA 3HKZE 3LNNA 3MTSA 2KZRA 3L17A 3WOFA 1N5XA 2V3SA 3MZ5A 1EZ6A 4R4CA 4JI8Q 3N30A 4W9GA 3ZKJC 3PUWA 1VQ8A 4DV3Q 2MSED 5K36H 2RDGA 2H88B 3PUVA 3S1QH 2Q2HA 1MD2D 3DWQA 3DXJC 1TU2B 2K6AA 3WIMA 1SNMA 2XTIA 2R7ZH 4C3JG 4LF8Q 3RZFA 1E2ZA 3DHIC 1I5FA 3T8MA 1PRTD 5LMUQ 2I38A 5IA7A 4ICVA 3T13A 1JJCB 4DFAA 2UUBQ 3SK4A 2D3BA 4RKLA 1J9OA 3BYYB 1SAPA 4JW0A 4RGTA 4HIMA 4A3MG 3S2HB 1I4GA 1Z7TA 2KN4A 3U4EG 2A68C 2NZHA 2JEBI 4JI2Q 2V4IB 3HVZA 4AUQC 3VYUA 2KENA 4IWQA 4KDLB 3VH3B 2A74C 4RA8A 3SK5A 4OIJA 2LHDA 1LT4D 3K81C 5EE1A 5KGUA 4OWWB 5JVG3 2D3AA 2KOXA 4GKJL 2KJRA 3IBEA 5JEAG 2GBNA 1SMXA 2A6EC 1LTBD 1B1ZA 1EFID 4Y7NH 3M4OB 1ICFB 2V1YA 3E9IA 1ZUD2 3Q3MC 2B8GA 1V1QA 2JZ3B 1PHJA 3M63B 4N59A 1K8MA 2KTFA 3RT3B 3A1QB 1SGHA 3SD5A 4MGKE 1BO0A 1C77A 3N1YC 2B63H 1STGA 2JA6H 4A93G 1S40A 3RNEC 2BGFA 4O1NA 4ANVA 1LGRA 4CYEA 4YXDB 1E0ZA 3Q6SA 4DK6C 3SHLA 4KD3A 5LMNQ 1V9JA 5C3XA 4XWWA 3PF4A 2EJFC 3EVQA 3ML8A 2E8GA 3E9SA 4HMJA 2Z4IA 2V4LA 4K14A 3BZCA 3E3XA 1C4PA 3ZNGC 2K6QA 3VXWA 1AH9A 3J81c 2IJ0A 2Z0DB 1SMYC 3M3YH 2E75C 1WTRA 3IFWB 1QCBD 2D62A 3OTOL 1F0ZA 2WXOA 3PIOA 3RN5A 3D6WA 1L0XB 4HVBA 4UP9A 3NHHA 4ZRPA 1V9PA 1R4NB 4LWCA 1N36Q 1A15A 1KNEA 4HRSA 4P1BC 4IUPA 4JBJA 4JI6Q 3KUDB 3ZNID 4HSVA 2JXXA 2BWFA 3I91A 1PTOD 4G4KA 1VQOA 3CAMA 1VQPA 5CMDA 2C7MB 3M4QA 4K6LA 5H1SE 5JVH3 2AUJD 5IYBH 4MJSA 3V60A 2L0CA 1HTQA 4EGVA 4X64Q 1LTSD 1QOFA 3SR6A 4N8FA 4IFDG 3Q22A 1GPXA 1FCCC 2C5LC 2W82A 3KLRA 2RA4A 2L83A 3FMCA 1EO6A 2ZNVB 1N33Q 3ZVVA 5J1ZA 3BIID 2PO4A 4FXKC 4LNFA 2LHEA 2SNMA 4RKBA 4C1NI 1ZDVA 4G57A 2ASQA 3MJWA 4WWNA 1NR4A 3WCQA 2VUMG 1STEA 1WTPA 2KQ7A 1SSNA 3VTWA 3D4RA 2EYFA 3TEHB 1TGZB 1UD7A 1QJOA 3SVMA 2J4XA 3BDLA 1AE3A 4TMAB 4ANUA 4L5TA 2NZ1D 3A5ZB 2R7ZG 4DR7Q 3UDIA 1WZ0A 5E1FA 4B9WA 2L32A 2OJWA 3GTMB 2PZWA 1WTHA 1E8XA 4GKKQ 2ZTEA 4ZUIA 2IY0B 3N6RA 4LNQA 3EROA 5JZEB 5BN4A 1SNQA 1KOTA 3TMPB 2GBMA 4HROA 1ZW7A 3A8KE 3CPFA 3VR3A 4FLHA 3CSFA 1KRTA 2E6XA 4KDIC 1N5WA 2RCFA 3OW2A 3NVYA 1EWCA 4HJAA 1H8CA 3LDZE 4CHKA 5GROA 2XIWA 2A6HD 3KF6A 2UUAQ 2KDFB 2RSNA 2CCZA 1TTNA 4CKBA 3HOUB 1JORA 2M00A 3LB8C 2KLCA 4QUCA 4C7ZA 3Q8BA 5LMNW 1S3SG 1CHQD 4YWLA 3RR5A 2R93H 2RQXA 2K50A 2WP8J 1F2RC 2M9VA 2L1AA 3HOYH 4N58A 1WVLA 1WGDA 1LTTD 2IX1A 3T4AC 3CC4A 4W9LA 2F0TA 2PMZB 5GADC 1JJGA 3ZNHB 1DZ1A 3BWUD 3RLNA 4DHZE 3RMHA 3MXPA 4Z9CB 1SE2A 2KD0A 1QF6A 2EXDA 1IYVA 2JT4B 4YCVA 1EUJA 1GVPA 1NMGA 4KZ0A 2KLGA 5L95C 4Y7NB 3M4OH 2OF1A 2EE1A 2ZT9C 4ZK9B 3CCMA 1WXSA 1WD0A 4B3TQ 4AQYQ 3H1UA 3IG3A 3AEGB 1XLPA 2LKVA 4LNNA 2Y0SE 1L2NA 1IYJB 4M00A 1RKNA 2INCC 1Q81C 4IPDA 5C4HA 2RBMA 1F52A 1Y8OB 2BB6A 4DGZA 4A93H 2QF7A 3J80c 5FLMH 5JH5C 3Q23A 2EMSA 3T1YQ 1YJNA 1JJ2A 1R7SA 3ZJVA 2XNAC 3M4YA 1M94A 4YSYB 2YEPB 3VRAB 3VR9B 5FR3A 3E0EA 2E74C 1IW7D 5JXVA 2HUGA 2HDEA 3EGRA 3R2TA 2LASA 1WR6E 3C8YA 1YMHE 2LXKA 5T1IA 3W9CB 5C5MA 4WQOB 4I7AA 4IKGA 1K51A 2QIEB 2EVBA 1ASZA 5JHBA 1FGUA 4IM0A 2DGYA 5CV9A 4CDDC 1HNZL 1IBMQ 1Y8RC 3QHTA 3GTJH 5KNBA 4HPLB 3PT2B 4KGSA 1K8GA 1WXMA 2RVLA 5EKKA 2NN6G 3MP9A 4JI7Q 2M8SA 3KF6B 5A35A 1QUQB 1SRUA 3FHWA 4XQJA 3K9OB 5DLQE 4YTMB 2YVCA 2KHIA 2VB2X 2VZAA 1FJGL 3RNCC 1JE5A 2MHJA 4P1CC 3RYTA 1FEHA 2WAQB 2ZW1A 4NB3A 2WGSA 4F88A 3DEPA 1HFNA 4BVUC 2K04A 2K5HA 3CC7A 2N0SB 1IL8A 3PHWB 2WX1A 1JOOA 3NVWA 4F7XA 2TMPA 4KZCA 4FXDA 2P5ZX 1BBXC 1VQ5A 5GXGB 3E6ZX 3S16H 1D2BA 4K3CA 1WJUA 4OXPA 1UGMA 2YU9H 4B08A 3VA7A 4ZUJA 4TQUS 2BQQA 3I3TB 1RRBA 4PMBA 4DR4L 3Q14C 3TIXA 3ERSX 2F0DA 1TKEA 4FN2A 3TL5A 4A93B 1AEXA 4IFDJ 1TIFA 1P16A 2IYDB 3BU2A 3MHSD 1MVKA 4HR7B 2QJLA 2AWTA 3NPPA 4BOZB 5C3EH 1XPOA 4DXGA 1ENAA 4JX1C 4JVZA 1SBBB 3B2GA 5EE0A 3AULA 4JK1C 1MKHA 3NUCA 2R92H 3HOVG 1WGHA 4BA2I 2MLBA 4GIVA 1F2YA 3OJ3A 1EEID 3GTLB 4RMFA 2VH2A 4KGTA 5EPKA 3VUWA 5C3WA 5ELBA 1DYQA 5FJ8G 1NSNS 3AXCA 1X3GA 2FFKB 3TP5A 4YWKA 2IHEA 3J81i 4DAMA 4DUYL 2RMMA 1C8CA 3AEEB 4NJCA 3VTUA 1XPRA 2LWPA 4RF0A 4NMZA 4DA2A 2VNUD 3NZSA 4P73A 1KL9A 1W6JA 1WCMH 1OQRA 1EY0A 1V5OA 2DENB 2ZVNA 4GDKB 5IT9c 4QB4A 3I57A 4M0WA 1PH3A 5IOIA 3RPFC 3DM1A 3HOYB 3TS2A 3LWUA 3OWEB 4A3JG 2LZ6A 4L5RC 4AYBG 1PZKD 2F0JA 3S1NB 4ACFA 4W9FA 4A4IA 4ZOHC 4BFRA 3CCSA 1NJIC 1VMCA 2A73B 2AYOB 1K8RB 2QEJC 2JF5A 1SE8A 3HOXB 3A4SC 5IP7G 3CPWA 3HOUH 4X66L 3T1HQ 3P7JA 1NCVA 1WFYA 3P1MA 3RMKC 1NEKB 1ML0D 2NTTA 4ID6A 3JYUA 2ONQA 1GKHA 1AWDA 1QOHA 2NN6H 5ELEA 3A33B 1SEBD 3UIOB 3X0WA 4ZKCB 1LABA 2MP1A 4HAEA 4JC0A 2DNEA 1N8RC 4LF8L 3U30A 2WXLA 1PH6A 4IJLA 1S5DD 4JV5Q 2IHFA 3M62B 3MFGA 3PIO3 3AQQA 4NZLB 5LXIB 1BUIC 5DM63 2C9WB 4JI1Q 4OIKA 1G6ZA 4LLGM 2L12A 1T5XD 4RWSC 3W5VB 2WB1B 3IFTA 5E7NA 3AMUA 3EBEA 4GNXB 2GBRA 2EXZA 2HD5B 2I46A 2FE8A 4JI3Q 1T0YA 4DR3L 1T0RC 5AFWA 1I94Q 1EL0A 5C1ZA 1HNZQ 1X9NA 2J0KA 3J80i 1VQDA 4APVA 4F8MA 2WU5B 2KDBA 2RD0A 2HJ1A 1UUPA 4ZKBB 5I2XA 1S4ZA 2J0JA 3NE5B 4MACA 3UIPB 3AE4B 2EYOA 4KK7A 1N61A 2HTHA 3AB5A 1TY0A 1WM2A 5GAGC 1T0QC 5H92C 4BOSC 4C4VB 3A54A 4MNOA 2NYZD 2O6VB 1MFWA 2PYKA 3NWTA 3V61A 1G2TA 2FINB 3STBC 3C19A 1EU3A 2L0FA 2IX3A 3PLUA 2X69A 4FF3A 1TWFB 3NTHA 5J22A 1FNWA 1JALA 4A3EG 2DYMA 3AU4A 4X65L 4DV1Q 4A3KB 2CKZB 4HJ7A 4OX9Q 1QLBB 3TJPA 1L0WA 3Q69A 3UDFA 1DOKA 2AKWB 2JA5B 4RG1A 2SAKA 1VZ7A 2NTSA 2B3GA 3EFUA 2I5MX 2FCSA 3BVGA 4B3TL 3AE3B 1BKBA 3KH0A 3N1XC 1K0RA 3UDXA 2CFMA 4DV4L 3G6JB 1OXXK 4U68A 2ZEQA 2HCCA 1D7QA 4MHEA 4AYBB 1HNWQ 3NVVA 4GLVB 3DQVA 4LUZA 1GHJA 4KTAA 2OCEA 1GHKA 1HZAA 1Y1WG 1XPUA 3DBRB 4XQNA 2KX0A 1E6EB 2JJQA 3W5OA 2YTXA 3J81j 2KFKA 2XK5A 1A62A 1C9FA 1PFNA 4DR2Q 1STYA 1SNPA 3BY4B 4I6PA 1AZQA 4E71A 4A3IB 3EFXD 5CHFA 2R7DA 2KWVB 1R4MB 1JR0D 2CS4A 3K0XA 4KN4C 3VFKA 4CKCA 1C7YA 3TEZA 1RFKA 1YJJA 3L0OA 2DAFA 3D32A 1XD3B 2KHJA 4C1NK 3DOWA 3L4PA 3ZO5B 1XTCD 3O13A 5FO9B 3AN1A 4NDXA 5M5XH 1Y1WH 4DNIA 2JWUA 4O2DA 4USAA 2F0VA 4KV6A 5BYRA 1Y14B 2KYWA 1EWHA 2FXQA 1SFOH 4BBSG 4NAWA 3KQ4A 1N33L 2F0NA 1SSOA 3GTPH 4LNOA 4A55A 2BE5D 1OTCA 3ITPA 3KBGA 5A2QE 5K36G 1J7AA 4DV7Q 1YJWA 5JJZA 2VQFL 1SF0A 2J7ZA 1CUKA 2SNSA 2VQEQ 1ILQA 3APCA 2Y5CA 5E6NA 4BAXA 2I5HA 4E3CA 5EPJA 3NZ3A 2WXQA 4MH8A 1UGJA 2EYPA 2GA4B 3KWLA 3S2HH 5CV6A 2HIVA 5M5WH 3F2DA 3ULJA 3ZRCA 2L05A 3I4LA 3HKZG 3HK0A 3Q3OC 4IURA 3URYA 3D4WA 1VRAB 2AL6A 4OO1H 2NPTA 4BKSA 1UAPA 1I50H 2ZCBA 2QHOA 2CU1A 2MBOA 1P3QU 1T0SC 4EZKA 1OEYJ 3PHXB 4FJYA 4W9IA 2UUCL 3CF6E 4A76A 3S1QB 1I35A 2V1CC 2BBCA 1HR0L 2VB3X 4DNTB 2Z9HA 4PV1C 1HZ6A 5I9PA 4ZRQA 4KKIA 1FNUA 1YN4A 3LGJA 3BDOA 5EBCA 1PXUA 1I6VC 1LQBA 1KXLA 1TWCH 2AWOA 1QQRA 2Y5BB 4QIWE 1I4PA 5COYA 5DNFA 5KNCA 4GN3B 4OWXB 2K8CA 2KNBA 3BS1A 2YTYA 4N9PA 5IYCH 1IXRA 2D9UA 1MHXA 2JZPA 4PYUA 5TR5A 3DDCB 2JX5A 1HUMA 2V4DA 2RHSB 1QKZA 1TWCB 2JEAI 1NYRA 1D5MC 1R9TH 4LF7Q 4KLKA 3W5UB 3CKIB 5T1GA 3W2DA 3NSWA 2KVZA 2KMAA 2VS1A 1JE4A 4NXML 4KJNA 3QOJA 1VR9A 2ZCCA 4ARIA 3KLSX 1YQBA 1HA6A 3KF8B 3UGBB 4RGNA 1HQRD 1RWSA 5LHY1 3SHQA 2WXHA 2PQAA 3OWFA 1DXMA 1OXVA 3FC4A 4M02A 2MHVA 2LMCA 4DR1Q 2WKCA 4GS3A 2LS01 1MGSA 2MEKA 2N9EB 3PRPB 4GOCA 3AFPA 4W9KA 3RUIB 4K7SA 3AU5A 1N34Q 4KSLC 4MJSB 1IL2A 4MSMB 1R4QB 1E8YA 2E2DC 2LUEA 3KYCD 1YN3A 1Q12A 1EIFA 1EF1A 4WIPA 3C1EA 3H0GB 1ESFA 1PTOF 1PA6A 2RSOA 2KDMA 3VYSA 3FKYA 4K2KA 4HPMB 3IT4B 3GZNB 2F0GA 3TDQA 4LF9L 2B2UC 4F1SA 3R3MA 2DN8A 4P71A 1HNXQ 3A9JA 2AX5A 1NBWA 2QW7A 2O5IC 4NPNA 4BBNC 1KRSA 2YV5A 5CORA 1KC8C 4JV5L 3NXWA 1LM0A 4DK5A 4AQ7A 5M5XB 1A3TA 5BMIA 3RLFA 1QOGA 2Z8LA 2B3AA 2LGYA 1HQMC 1HTOA 3FILB 4H13C 3PS6A 2Z1CA 3F2BA 2K4KA 3W1BA 3CHBD 2UU9L 4LFBL 1EQRA 4WH4A 3GB1A 2QMTA 1HUNA 1LXDA 1X65A 2RF4A 3A8IE 2FCNA 4A3IH 2H5XA 3GTGH 1IBXB 4ME5A 1ET9A 3K58A 3DPDA 4CBVA 3DCGA 4EKUA 1BBWA 5FLXc 1PH5A 2GVBA 4JBWA 4DUZQ 3HOWG 3RNGC 1U5KA 1JRPA 2BOSA 2F0OA 4JL9A 4KX6B 1WD1A 1FJGQ 1QNUA 4LJZC 1Z6HA 4R4OA 3VYTA 3TREA 1QVFA 3MWYW 2N8NA 4GLXA 1WIAA 2BKRB 2Z6KC 3EN2A 1WM3A 2XRQD 1JQYD 5BO4B 2F3WA 2NWGA 4DV3L 3I7FA 4A3IG 1ILPA 1GUAB 1OFFA 5EE3A 3QOLA 3HOXG 3CMEA 2WXFA 2KBNA 5ISRA 3NQIA 4MM3B 5KHQA 4KY6A 2K5QA 1SE3A 3A55A 4GZYC 2MRPA 2MJEA 3GP7A 1SNCA 2B2TA 3HVDA 2VUMH 2ZJQA 4BBNF 1X56A 4C3HH 4X64L 3IAYA 2L8JA 2CR5A 4ZRKA 3PZDA 4LFBQ 5J39A 4A3GB 3AEAB 1WTXA 3CCJA 2N3SA 4WQMA 1I4RA 3UI2A 1VQLA 1HNWL 1PRTF 2JK8A 1QVGA 1PYSB 2BYFA 4DQOC 2E5LQ 1D5ZC 1B53A 2VY3A 4K3BA 2JSOA 1F9PA 1BCPB 3CRKC 1OQQA 1HH2P 1TWGB 1D4BA 1FGBD 4ME3A 4LF4L 2K1FA 2A19A 3SDZA 1YIJA 1DD2A 3SXHA 3E0JA 2IO0B 3RN2A 1ZP0B 2BS4B 2MFIA 1EWIA 1B9NA 1CKOA 2CJOA 1UH6A 1XNQQ 5AZHA 3IRBA 1SB3C 3DBHI 3UINB 4YHHQ 4BXXG 1ENFA 4IC7B 1SR3A 1GOZA 4WORA 1FM0D 3S15B 1JWUD 3MHBA 3PUXA 5CR3A 5C23A 4F7ZA 4J15A 3H3VH 4OELB 3VUXA 4GOPA 4A3MB 4GDLA 1QE6A 1E9MA 3B9JA 3AU7A 2XBBC 3RULA 2B2YA 3PO3B 4DV4Q 3JW0X 3OW7A 4BY1H 5C4JH 3T51B 4R8IA 3JVZX 1S5BD 4GNXA 1EYCA 4TKOB 4B3SL 2EYLA 4BXXH 2OWOA 1V1OA 4I6LB 2QGQA 5EKLA 1STHA 1U0LA 2WDQB 2CWAA 4AQYL 2LGIA 1Q0WB 4CJ2C 2IO3B 4ZYSA 3OJ4B 2E5LL 1YHAA 3I55A 1OO9B 1EQTA 3S1NH 3STBD 2CWPA 1TS2A 4GOPB 3ZTDA 3B1LX 1EIHA 4V0BA 1Q8KA 3H7PA 1LTGD 3L3OC 4S17A 2HJ8A 3ZXRA 2BWES 1VQBA 1PH4A 2A69C 2DNCA 3SR1A 1K3RA 1TWAH 3OYYA 2N9KA 2Z0EB 3A9KB 4ASWC 3OSOA 4YIJA 2E2IB 4YHHL 4IG7B 4DBGA 1V5TA 4DNRB 1WJJA 1E22A 4L2YA 1PLFA 2RDBC 2CQOA 4WJOA 3ZNZB 4WRDA 2J0TD 2CHXA 4BKGA 3CMAA 1PQSA 4N9F4 4C80A 1VS0A 2B2YC 1T5EA 4IUMB 1O7YA 2DWQA 1R4PB 2CU3A 1ZXIA 2O5JC 1V97A 4E74A 1B70B 5DCNA 4DKAC 5BN3A 2PCFB 1XYIA 4WAFA 1B9MA 3I72A 2K7VA 5HGQA 2NVXB 1XX8A 1U4LA 1NY4A 3I4MG 1P7EA 2XEWA 1Z47A 4C3IG 2ZXOA 2F1MA 4AYBE 4A3JH 1N32L 2E2HB 3IXSA 3WANA 2H89B 1RCVD 2K22A 2FIFA 3NBHA 1K50A 2M0AA 3PCOB 2EYMA 3RZOB 1KQSA 4RH6A 2V9HA 3VDYA 3UI3A 2DUDA 4K6DA 5LL6X 2Y5PA 3ETRA 1GB1A 3MJ5A 3QG1A 1JW9D 1E2VA 1NYQA 2LVOA 1PTOC 3LYYA 3H7PB 2PQEA 5C44B 1YQ4B 5IP9G 4P6VF 5J17A 2ZJRA 4EZJA 3MXNB 4QF4A 4ZRIA 1VQHA 5CX3A 1W6KA 2RDHA 4BBRH 3Q3FA 5JAVA 4K1RB 1PTOB 3AEVA 3PREA 1FXTB 3Q8CA 4LF9Q 3ULLA 4YT0B 2XSCA 1NI2A 5G3LF 2K3UA 1TIID 1WGGA 2B2VA 2B2WC 4B3ML 3GTJB 2FUHB 3Q3JA 4DV2Q 5AJ3L 2MP2B 3HP3A 3WDNA 2KEDA 1SYCA 1EYAA 2PJHA 3MC9A 5M5YH 4KHPL 1WX8A 4P7IA 5FO7B 2F3VA 1UWVA 3Q8AA 1TS3A 2WINB 1V80A 1XNQL 2J7QB 1DOMA 4JPBW 4L8JA 5DPWA 4W9EA 4HJ8A 1DGJA 4ULLA 4C2MB 1CHPD 3UE0A 2EY6A 1WYWB 1HCZA 2MNAA 1EUVB 4XX5A 2D10A 1L1OB 2E3TA 4PYZA 3A9JB 4A3DB 4DR4Q 3SEBA 2KVMA 1JOKA 2ENBA 5KNDA 3S1RB 5G5HA 2KECA 1JRUA 4N6EB 4X3SA 1PGBA 1L1OA 1W2BA 2PW5A 3BJUA 2J52A 4KV2A 1EY7A 1A3UA 1MSHA 4DR6L 5HG2A 4TRDA 5IT9L 2B2TC 4R8NA 3QIAA 2XRSD 1A3VA 3PIP3 2LJ5A 5M3MB 2WB1G 2PPHA 2VZKD 4IM2A 4B9KA 1VQNA 1E7VA 2JA8B 4II3B 4URKA 3U52E 3DVNU 4CHTB 2MBQA 1GG3A 3VRBB 5LLIA 4AH6A 1G51A 4EQOA 2A68D 5BN5A 1GB4A 4B3MQ 2C9OA 1F9SA 3PO2G 4QCLA 2PW7A 4DV0L 4HDOA 5LMUL 2OJRA 4KKTA 3AYHB 1S5FD 4K5XA 1VZ6A 4C3IB 3QJYA 3NS8A 1UZXB 2LGSA 5HI1A 2EYJA 4A3DG 4OHJA 2R3ZA 2GN5A 3GV3A 5IGEA 2DJGC 3G7LA 4X62L 2DAJA 2ZNVC 3G48A 3P4PB 2VXWA 4CKEA 3T9LA 1SNOA 1X32A 4QGUA 2MBHA 5H8YE 4K0KQ 4I65A 3C0RB 1E1OA 3HOZH 4JI1L 4IO9A 2RHQB 1U4MA 3TQYA 1EY8A 2D2CC 2F0EA 2GMIC 3QWNA 5IGDA 3DWPA 3ZJUA 1TT2A 1B4OA 2BDNA 4A3GG 1MG4A 1C4CA 1QILA 3D6CA 2F03A 1Q5WB 1WXVA 2LEKA 1HXYD 1L4DB 1QOAA 5C0XI 2L55A 3KUPA 4XYQA 4BBRG 1IP9A 1SIFA 4QMGA 1X3QA 3CSTA 4GKKL 1R4MI 2A8VA 2RSUA 4OVUA 3ZGZA 5L37A 4HJGE 1SYEA 2PKOA 2I5LX 1G6PA 3NRZA 3BDCA 2RGFA 4JI8L 2BA0A 3E5SA 3PTFC 3PRZA 3GTMH 5GMVA 2V3PA 5EDSA 1PZID 3K0YA 3VHTC 2Q8IB 3DVNV 2QKIC 2UUAL 2WXJA 3ONAB 4IWOA 3PGZA 2W3SA 2K32A 1V81A 4W9JA 4GDKA 2FCQA 4HIKA 3NHEB 1IZ6A 3K6OA 5GAHC 4ZRJA 5HY6A 5C3EG 4LF5L 3Q8EA 5C4XB 2MP2A 2KJ6A 3CU7A 3V05A 2JXTA 1AE2A 2PI2A 2BW2A 2WDVB 5LL6S 1N63A 4KI0A 1EZ8A 1DJRD 1U4PA 2W54A 3B6YA 2GI9A 3JC66 1L7YA 1HTPA 3BK2A 3PVLA 4EFOA 5LNK1 1IHZA 3I3CA 5FR6A 4H0LC 2SOBA 1HR0Q 1CA6A 4JI5Q 3T56B 5C3JB 3PLVA 1VQCA 1JOQA 4KKUA 1O78A 4XT3B 5BYQA 4OZCA 2PLPA 2N9PC 2G5DA 4IQZA 1AZPA 1WFQA 1U4AA 3JAMc 3EECA 4R1JA 4HCSA 3I4MH 3I90A 1HHVA 2RCNA 1J7CA 2PE6B 3W1YA 4A8XC 1MPEA 3KK7A 5D65A 1QB5D 2L7RA 3L16A 1RLFA 3GD7A 4PS7A 3Q0AA 4G7ZC 3QQ8B 5IODA 4FXGC 2NN6I 4XZ4A 3M3YB 4NJ6A 4K8IA 4LUOA 4IALA 1H9JA 3Q3NC 3GO5A 4OWTB 1YEZA 1K0SA 3EIVA 2K33A 5DPSA 2K5DA 1RAXA 4CQNA 2MPMA 3R2IA 1WRDB 4IPGA 4JI4Q 4DV7L 4YSXB 4QQBX 3JAML 4P75A 2LD9A 2XN9C 1BCPF 1FR3A 2PMZE 3QX1A 1NI3A 1P98A 2KN5A 1WY8A 2IGDA 3GQBA 1KLGD 2WXKA 3FILA 3IVFA 4ZYNA 1HEZE 2EDGA 2B63B 2JA6B 1KM7A 3J81E 1P9DU 3WA0A 4DXAB 2IT1A 1IBLQ 5E6PA 1C78A 1VMPA 4K7UA 2WIIB 4NJ7A 1K83B 1STAA 4GOPC 3M7GA 1CJEA 1WX9A 4I6NB 2ALYB 5D14A 2K6DB 1XJVA 1A6XA 1VQ9A 4R4QA 5G5GA 1WTVA 1QNKA 1SLJA 1XLOA 4RM9A 1XMQQ 4L6TB 2BYTA 1KHIA 4B3RL 5EBDA 2A69D 1K53A 3PPAA 1JCKB 3S1MB 2X6GA 1JWBD 2XVSA 1TR5A 3MHZA 5CHVC 4G0NB 4CGYB 4XDCA 4GLSC 4DHJD 2BCOA 1MHWC 2WAQG 2Z4HA 2M17A 2Y0SB 2B76B 5G2NA 3HG9A 5TSSA 4NY0A 2DZJA 4H02A 3D8GA 4A3LG 4KD4A 3MEFA 3S17H 2NBVB 1GUOA 1X54A 1CTMA 5BR8Q 5G55A 1YHQA 1FYCA 5CGKA 2F0UA 2KDIA 4OL7A 4OONA 1CQVA 2R7ZB 4M1UB 2Y3AA 5BMGA 4DWFA 5BYSA 5CV5A 2Q8TA 3GTQH 1OEYA 3U4VA 3BG3A 1B8AA 1C9OA 2MBBB 4TV3A 2ZM6Q 1NR2A 3VR5A 1EU4A 1HPCA 4JI0L 4BBSB 2B8FA 2LSSA 3TP6A 3K57A 3W1SA 1Z2MA 1ROEA 1YHBA 4F8CB 1IYUA 5IWAQ 2R2OA 5HKHA 1ONLA 2MQHA 3TEYA 4JBMA 2L9HA 4L63B 3S9WA 1LTLA 2GRIA 1V43A 2AWNA 4P74A 3UQAA 1KLVA 2XWJB 1I6HH 3D31A 4L23A 1KD1C 1EFWA 5LXHA 3HZXA 2YTVA 4PZ7A 1GM5A 3NUHB 1GO3E 2N9LA 2PPBC 4NXMQ 5CBEE 1DM0B 2F0LA 2WAQE 1KAWA 1O7IA 5EGTA 4X6AH
chains in the Genus database with same CATH topology
2L11A 1RODA 3M7NA 2E2JB 3K59A 3KLSA 1YNNC 4HCEA 4X3UA 4JPSA 4A3JB 2PZTA 3P63A 4YSZB 4US9A 1I3QB 1GUNA 1UEAB 2N7JA 1SYBA 1SDFA 3FRPB 1SNDA 5EE9A 1F2ZA 1IW7C 1SXTA 1LO5D 3ND9A 1GUWA 2FBWB 3ZJTA 3MC0B 4H44C 1CZWA 3CIRB 1TKGA 4IFDH 1SE4A 5FLXL 3L9AX 3GTKB 4F87A 3E56A 2K05A 2MJ3A 2K28A 4ZHOA 3I9V1 3MA2B 3A7AB 3K5MA 3PUZA 3GTOB 1V1PA 5E4WC 3LXFA 1XEEA 1B2TA 3AEFB 2FMCA 4LMQD 2WNMA 3TMEA 3CQZB 3I70A 1CA5A 1NVID 4IUTA 4ITKA 1ACCA 1WXQA 1J8IA 4J1MA 4FF1A 5CBAE 4FP5D 3IFDA 2RPVA 2D5GA 4G7HC 2WDRB 3T3OA 4MN3A 1AW7A 4RNAA 3MAQA 1GXDC 2PZUA 3Q8FA 1P7FA 3HOWB 4G7OC 1F9QA 3OOCA 1EY9A 5JEAH 2Q5WD 1FO4A 2TSSA 5FLXE 4QUFA 3H09A 3LWEA 2WV6D 1GUTA 3J9CA 5K5PA 2WXRA 3H94A 4HTHA 4A9AA 1XCTL 4DXFA 3RD4A 2LJIA 3FDTA 3QO2A 3PMFA 5EJWA 2K5WA 2EZVA 3FPPA 2CVRA 2QCPX 4C3HB 1AYFA 1TS5A 2KAJA 5DM73 1JWSD 1FD6A 1FRRA 4FXCA 3P4QB 2FHTA 2LUMA 1TZOA 4Q0FA 4WFN3 5C0XG 1PGAA 2G9DA 2OEOA 3RZDB 5FOBB 1RD9D 3NBIA 4A3FB 2M56B 2PNRC 4FYDA 1BMLC 2SEBD 2J53A 3KBXA 1MBYA 2KA7A 1YNTE 1Q3LA 1E7PB 3TP8A 2EYHA 5M9OA 4S3SA 2F0MA 1ZE3D 1B3AA 1MI0A 3NK9A 1LTRD 4BA1I 2INPE 3DUZA 1HFGA 2WLBA 1DCZA 2L1BA 5FKAC 2BB5A 1RHPA 3HRDD 2V0GA 2K03A 3DWMA 1ET6A 3I4NB 1KDAA 1RF2D 1XXGA 2EELA 1FXAA 3PO2B 1L5PA 4X3KA 3SFEB 2IW3A 1KDCA 1RDPD 5FO8B 4L1BA 1N62A 2MGSA 1XCQL 1F9RA 1STNA 2YYZA 2WXNA 1XWEA 5IGFA 3TUOA 4YWGG 1YNND 4XXEA 3BVZA 3J7YW 4J6HA 5I9OA 3OMCA 1B9RA 1I6HB 1IUEA 2NMQA 5E6JA 2DYOA 3VR4A 4KMUC 4FF2A 4H7BA 3K5NA 2JP1A 3TEWA 1TVXA 2PVGC 4WURA 3BZDB 1D5XC 1KH0A 3T53B 5KEEA 1JMLA 5CV7A 1SYGA 3OPOA 1NAPA 1EQVA 1MHHE 2DBYA 3GTQB 3VYRA 1IGCA 3DMUA 3P4SB 4Q5VA 1ZXTA 1ZXHA 3FVQA 3P75A 4PT5A 2F0HA 5T8IA 1L6VA 1F2MA 1Y1VB 3DHQA 5M5WB 4MIUA 4B9XA 3ZQ4A 1BDOA 1PZJD 4RHRA 1ZDXA 4U673 3VA5A 1FFUA 4RGOS 4P2CB 1FIQA 4ZAIA 2QDBA 3FAHA 1FCLA 2KUMA 1Y1WB 5HFYA 4ZLTF 2WXIA 2JA7B 1S5CD 4ZRZA 4V190 2EKIA 2AQ1B 2IGGA 1EY4A 3ERQA 1VF7A 2KCNA 1Q8IA 1CI3M 4IN3A 2WACA 1A70A 1D1KA 4KHZA 1KDBA 2L4NA 1WTOA 2KOLA 3AECB 1VDVA 5G3LD 3U7ZA 3ND8A 2B2UA 2BS2B 4C56C 1SYFA 4DU9A 1N60A 5DEHA 1RTOA 3KF8A 2M2LA 4BY7B 4ABNA 3BYTB 4ILWA 1EY6A 2JSVX 2X38A 2KWDA 2O2LD 1FNVA 3AE1B 3IAM1 3DEOA 3AEBB 1ZYRD 4LK1C 1T6BX 4ZHPA 4OO1I 3A56A 1BF4A 1KFYB 4JE3B 1KNAA 1SYDA 1ESRA 2L52A 4NKLA 1ZOYB 4ARCA 1XLQA 2JE6I 4E6IA 4N9TA 4FF4A 2NVQB 4ODGA 3VR8B 3KWVA 3V2TA 4JWSC 2PTLA 2ICEC 3NWSA 4IFDI 1WTQA 4PQXA 2IGHA 2CW0C 4D2KA 4C3HG 5F2DA 3H8HA 3TEXA 2IX0A 2LFIA 4NW2A 1GAQB 2ON8A 2W55A 4I7ZC 3MXGA 1WSPA 1XF5L 2B2WA 4KGRA 3T3NA 4XIGS 3VR6A 4IUUA 2K5PA 2JYTA 4KHVA 2KMMA 3W3AA 3S14B 1XLNA 5JOBA 3V3XA 4TSSA 1GUGA 1Q1EA 3C46A 5C6AA 1HTLD 1AFPA 4XDXA 5HGTA 3MXNA 3H6MA 4K2LA 2AQ3B 3HUIA 2FJ2A 2DY8A 2ZW0A 1EEFD 1D6EC 5NUCA 4XWTA 1HRJA 2F0QA 5A2QL 3IAS1 5E3FA 1JC7A 2R92B 3AE9B 3DWGC 1QG7A 1I4XA 2WXPA 1TWHB 1G2SA 1KLUD 1EM7A 1DOXA 3RUZA 2F0SA 4IOIE 2WP9B 4KKJA 1EYDA 1JROA 3S16B 1KRHA 3IL8A 1CZPA 2B39A 4AS1A 1EY5A 1C76A 1HZ5A 1UWXA 1G91A 5M5YB 2NBFA 3U9OA 1L0VB 1LV9A 3SK8A 1J7BA 1BR9A 3K5LA 3TBIB 1PTOH 2RDFA 4OGQC 4WJWA 1ZYRC 5BMHA 2AUKA 4ZQ3A 2OXPA 2WKDA 2IL8A 1WWTA 3HEJA 3HGBA 2N88A 4UDUC 1BCPD 3X3MA 5ELCA 1SJHD 1STBA 2F0KA 3NVZA 1I4QA 3S17B 3R8BA 1TKYA 4DAPA 3AV8A 1Y56A 2JQRB 1RJTA 2G1EA 3FEWX 4CJ1B 4IUVA 1LLRD 2R6GA 3B2FA 3SK6A 1ZEQX 2F0PA 3GS2A 1K52A 1YQ3B 2H4OA 3ABVB 4NP5A 3J81L 1I7HA 1TWAB 1ICWA 4OZAA 1I4HA 2PW9A 4YTPB 2JYOA 4J3OD 2J42A 2F0WA 4FNFA 4IDIA 2OHFA 2R93B 1DOIA 5MPOA 4HEDA 1DOYA 4UAIA 3AH7A 4RF1A 2B2VC 2EY1A 1K8OA 4FO2A 1Y8NB 5KRUA 4HEA1 2EY5A 1AN8A 3X3NA 4REZA 2NB0A 4XTCS 1KF6B 3H3VC 1TKWB 1C4AA 1RTNA 1E0BA 4OZBA 3OMGA 2CHBD 2A5HA 4BY1B 3TP7A 4EVOA 2JXMB 2SDFA 3P20A 5C0XJ 4XE0A 1Q1BA 4YTNB 4LAAA 3I4MB 4Q2JA 5I2YA 1M4VA 2AQ2B 1LTAD 4DAVA 5EQ0A 4DAYA 1WYGA 1VJKA 1YJIA 1OXSC 1BXTA 2HDLA 4RAUC 1EOTA 2KACA 4R3DA 2RKSA 4MT5A 1EIGA 5EKIA 5C4ZA 3AE6B 3IT6B 1HA5A 3I73A 4KN7C 1QWYA 5C2TB 3VR2A 1C79A 1NENB 1PYWD 4J8QA 4KY5A 1OXTA 2K9XA 2PIAA 2KQ3A 3BVMA 2ICIA 1H9SB 1JQ4A 2CQAA 1IKMA 5HHDG 2C5CA 3SE0A 1VCIA 2LFNA 3MEHA 3A8JE 1LT5D 2IPKD 3GV6A 1G8ZD 3PO0A 2IWHA 1BQQT 1PRTC 1WTWA 4QIWB 2FUG1 2BE5C 1E2WA 3NTIA 1T3QA 4P16A 5JPMC 1RYJA 1F77A 3TSSA 2F4IA 1V8CA 4KJOA 3HOZB 1FMAD 3J7AV 4PNYA 4KY7A 3NS1A 2PVOD 4US8A 2DY7A 1YNJD 3AEDB 2EJMA 3TZDA 1L4ZB 2V3NA 3IKJA 5EPLA 2HQEA 5AUIA 2KCCA 2BT6A 2FMMA 4R9WA 4WWMA 3DWAA 2F0IA 1PUTA 1ZKOA 5IGCA 3R3OA 4BWGB 3AE7B 3MVVA 4C7YA 3V96A 5CV8A 2OT2A 3EA6A 2E76C 3QB3A 4HN7A 4RGMA 4XT1B 2WXMA 4HKQA 3HRZC 5JEAJ 1S5ED 2BA1A 4JWUC 1Q90A 4BS9A 2M19A 1B44D 1BCPC 5D3IB 1XO3A 1SJED 2I2YA 4DN4M 4B0MA 2EJGC 1O7LA 3TZUA 1BUVT 2LMCB 3PZ8A 5KYIA 3P42A 3J80L 3M85A 2F0FA 3U9SA 1F2RI 3AB9A 1CT1D 1R9TB 1L6UA 3J80E 4TQ0A 2KHSA 3K5OA 2HDMA 3I8ZA 1IGDA 3C3LA 1JWMD 2O4XA 3K7AB 4IUNA 1QOBA 3AE2B 3OIPA 3ZYYX 1KTKA 4BBRB 3N52A 3N9YC 3SFDB 4LK0M 2PMVA 3PV0A 1PGXA 5D3DA 3HOVB 2JU6X 4EQPA 4DF7A 3EUB2 2KEEA 2WS3B 1JICA 4HKZE 1YNJC 4HSPA 4M8AA 1I50B 1H9RA 2Q8RE 4IZ8A 3C2PA 4OVZA 1PFDA 5CV4A 5KYLA 1FFVA 1Q10A 4A3BB 1H9MA 5I6YA 3OHXC 3VQIA 3A7LA 1B50A 1C4QA 3EQLC 4EQNA 5E4XA 2MJ8A 5I4DA 1TY2A 2WXGA 1VF5C 3OIQA 4FVMA 2MH7A 5IGBA 2NVYB 5M3FB 5IT9E 2QSDA 2CJNA 2K1BA 3GTPB 2BTEA 3MXUA 1SFOB 2VZKB 2IDYA 2EY2A 1PMRA 4OO1G 4K5VA 1V1PB 4TQ1A 5AUKA 4PMWA 2CW0D 1LT3D 1NUCA 2A6ED 2L5TA 1PRTB 3T16A 3NTKA 4B0EA 2KJXA 3R93A 4RFBA 1U4RA 4LTUA 5C5LA 1A2UA 1GUSA 2YEPF 2W3RA 3PUYA 2EPBA 2BDOA 5C4JB 3LX0A 3L7ZC 3HKZB 4EE2A 5D7GA 2LY7A 3P1HA 2WU2B 1LACA 4HMIA 1FXIA 4XQQA 2G9HD 1H9KA 3J7AF 2R61A 2NUCA 2ZXPA 4X3TA 1MI2A 1OXUA 1TYGB 1D1IA 2BS3B 4OW0A 2WQYB 4CJ0B 1LTID 1QT9A 2GB1A 3RFZB 1CK1A 5DAUA 1TJEA 1CFMA 1U9RA 1C48A 5I6WA 1UWMA 3D4DA 1M8AA 5ELFA 1Y8PB 4K8JA 2MJDA 3AE5B 5C0XH 4NAWB 2VUMB 4C3JB 1YN5A 3EJIA 4KKSA 2ID0A 3TN2A 4DK1A 1TQOA 3U2SC 5IOCA 1LT6D 2A6HC 1VDZA 3D3RA 1BNZA 1EWYC 1CM9A 1PDXA 3C1FA 5ELDA 5KIXA 1MSGA 1G291 3FPUB 2I07B 1V8QA 4RCNA 5HURA 4NAMA 1SIJA 2KQ4X 1F2LA 3MFYA 5JPNC 2JYEA 3P4RB 4H2AA 1VZ8A 1KABA 1PFMA 1IBXA 3PZ7A 4RCOA 3JAME 3GTGB 5IGGA 3CWIA 1II3A 5FK9C 3AMZA 1JB3A 2QILA 1JWAD 2EOTA 1FRDA 3NP8A 3WOEA 1DONA 2INNE 1WCMB 1L0YB 5IIFA 1TS4A 4IUQA 3F2UA 2NVTB 2HCIA 1WGKA 3Q24A 3BK1A 2H1EA 2K0PA 1O80A 3FKIB 2X6LA 3S2DB 1CQFA 1DOLA 4A3EB 5C3EB 1KAAA 1ZPSA 1RM6C 3HS0C 1BOSA 4O42A 2XWBB 2ZXRA 2MUYA 4XYOA 4RHSA 1ENCA 2DLBA 1PDQA 4A6QA 1FD7D 2YU9B 2OEDA 3AM9A 1O7ZA 1GJXA 3H91A 1AP0A 1WRIA 1PFBA 4A90A 3AE8B 5CYUA 1X3PA 1A2TA 3CRLC 1Y69U 4GDLB 1SMYD 2ACZB 4PMCA 1H9SA 3NQTA 1E10A 5CC4A 2K01A 1UNSA 4DK0A 1CZGA 4K5WA 1VLBA 2N55A 1IKLA 2D5DA 2HTME 3LNNA 3MTSA 3WOFA 1N5XA 3MZ5A 1EZ6A 3PUWA 5K36H 2RDGA 2H88B 3PUVA 1MD2D 3DWQA 3DXJC 1TU2B 2K6AA 1SNMA 4C3JG 1E2ZA 1PRTD 2I38A 3T13A 4DFAA 3SK4A 4RKLA 1J9OA 3BYYB 1SAPA 4RGTA 3S2HB 3U4EG 1I4GA 1Z7TA 2KN4A 2A68C 2JEBI 3HVZA 2V4IB 3VYUA 2A74C 4RA8A 3SK5A 4OIJA 2LHDA 1LT4D 5EE1A 5KGUA 5JVG3 5JEAG 2A6EC 3M4OB 1LTBD 1B1ZA 1EFID 1ZUD2 2B8GA 4N59A 1K8MA 1BO0A 1C77A 1STGA 4O1NA 4YXDB 1E0ZA 3Q6SA 3SHLA 4KD3A 5C3XA 4XWWA 2EJFC 3EVQA 3E9SA 4HMJA 2Z4IA 4K14A 1C4PA 2IJ0A 1SMYC 2E75C 1WTRA 1QCBD 2D62A 1F0ZA 2WXOA 3D6WA 1L0XB 4ZRPA 3NHHA 1A15A 1KNEA 4HRSA 4IUPA 4HSVA 3I91A 1PTOD 4G4KA 5CMDA 4K6LA 5JVH3 2AUJD 2L0CA 4EGVA 1LTSD 1QOFA 3SR6A 1GPXA 4IFDG 3Q22A 1FCCC 2W82A 3KLRA 2RA4A 2L83A 3FMCA 5J1ZA 3BIID 2PO4A 4FXKC 2LHEA 2SNMA 4RKBA 4C1NI 1ZDVA 4G57A 3WCQA 1NR4A 1STEA 1WTPA 1SSNA 3D4RA 2EYFA 1QJOA 3SVMA 2J4XA 3BDLA 4TMAB 2NZ1D 2L32A 5E1FA 4B9WA 3GTMB 2PZWA 4ZUIA 3N6RA 3EROA 5BN4A 1SNQA 4HROA 3A8KE 3VR3A 2E6XA 1N5WA 3NVYA 1EWCA 2XIWA 2A6HD 2RSNA 4CKBA 3HOUB 1JORA 2M00A 3LB8C 4QUCA 4C7ZA 3Q8BA 1CHQD 2RQXA 2WP8J 1F2RC 2M9VA 2L1AA 4N58A 1WVLA 1LTTD 2IX1A 3T4AC 2F0TA 2PMZB 1DZ1A 3BWUD 3RMHA 3MXPA 4Z9CB 1SE2A 1QF6A 1IYVA 4Y7NB 2OF1A 2EE1A 2ZT9C 4ZK9B 1WD0A 3AEGB 1XLPA 2LKVA 1RKNA 5C4HA 2RBMA 1Y8OB 2BB6A 4DGZA 2QF7A 3Q23A 1R7SA 3ZJVA 2XNAC 3M4YA 4YSYB 3VRAB 2YEPB 3VR9B 5FR3A 2E74C 1IW7D 5JXVA 2HUGA 2HDEA 3EGRA 3R2TA 3C8YA 1YMHE 5T1IA 3W9CB 5C5MA 4IKGA 1K51A 2QIEB 2EVBA 5CV9A 5KNBA 4KGSA 2RVLA 5EKKA 2NN6G 3MP9A 5A35A 4XQJA 4YTMB 2VB2X 1FEHA 2WAQB 2ZW1A 4F88A 3DEPA 1HFNA 2K04A 2N0SB 1IL8A 1JOOA 3NVWA 4F7XA 2TMPA 4FXDA 1BBXC 5GXGB 3E6ZX 1D2BA 4B08A 3VA7A 4ZUJA 4TQUS 4PMBA 2F0DA 1TKEA 4A93B 1AEXA 4IFDJ 1MVKA 4HR7B 2QJLA 3NPPA 4DXGA 1ENAA 4JX1C 1SBBB 3B2GA 5EE0A 4JK1C 3NUCA 4BA2I 1F2YA 1EEID 3GTLB 4KGTA 5EPKA 5C3WA 5ELBA 1DYQA 1NSNS 2FFKB 3TP5A 2RMMA 4NJCA 1C8CA 3AEEB 4RF0A 4NMZA 4DA2A 2VNUD 1W6JA 1OQRA 1EY0A 4GDKB 4QB4A 3I57A 4M0WA 3RPFC 3DM1A 3HOYB 3LWUA 3OWEB 1PZKD 2F0JA 3S1NB 4ZOHC 1VMCA 2A73B 2QEJC 3HOXB 3P7JA 1NCVA 3P1MA 1NEKB 1ML0D 2NTTA 4ID6A 2ONQA 1AWDA 1QOHA 2NN6H 5ELEA 1SEBD 4ZKCB 1LABA 2MP1A 4HAEA 2DNEA 2WXLA 1S5DD 3MFGA 3PIO3 4NZLB 1BUIC 5DM63 4LLGM 4OIKA 1G6ZA 2L12A 1T5XD 4RWSC 3W5VB 2WB1B 3IFTA 3AMUA 2EXZA 2I46A 2FE8A 5AFWA 1EL0A 2WU5B 4F8MA 1UUPA 4ZKBB 5I2XA 1S4ZA 4MACA 3NE5B 3AE4B 2EYOA 4KK7A 1N61A 3AB5A 5H92C 1TY0A 3A54A 2NYZD 2PYKA 3NWTA 1G2TA 2FINB 1EU3A 2IX3A 2X69A 4FF3A 1TWFB 3NTHA 5J22A 1FNWA 1JALA 2DYMA 4A3KB 1QLBB 3Q69A 1DOKA 2JA5B 2SAKA 1VZ7A 2NTSA 3BVGA 3AE3B 3G6JB 1OXXK 4U68A 2HCCA 4MHEA 4AYBB 3NVVA 1GHJA 4KTAA 1GHKA 4XQNA 1E6EB 1C9FA 1PFNA 1STYA 1SNPA 1AZQA 4A3IB 3EFXD 1JR0D 4KN4C 4CKCA 3TEZA 1RFKA 1YJJA 4C1NK 3L4PA 1XTCD 3O13A 5FO9B 3AN1A 4NDXA 4USAA 2JWUA 2F0VA 4KV6A 5BYRA 1EWHA 3KQ4A 2F0NA 1SSOA 4A55A 2BE5D 3ITPA 3KBGA 5A2QE 5K36G 1J7AA 5JJZA 1SF0A 2J7ZA 2SNSA 1ILQA 2Y5CA 5EPJA 3NZ3A 2WXQA 4MH8A 1UGJA 2EYPA 2GA4B 3KWLA 5CV6A 3I4LA 4IURA 3URYA 3D4WA 1VRAB 4OO1H 1UAPA 3S1QB 2BBCA 2VB3X 4DNTB 4PV1C 1HZ6A 4ZRQA 5I9PA 4KKIA 1FNUA 1YN4A 3BDOA 5EBCA 1PXUA 1I6VC 2AWOA 1QQRA 1I4PA 5COYA 5DNFA 5KNCA 3BS1A 4N9PA 2D9UA 1MHXA 2JZPA 2JX5A 1HUMA 2V4DA 1QKZA 1TWCB 2JEAI 1NYRA 1D5MC 3W5UB 3CKIB 5T1GA 3W2DA 3NSWA 1JE4A 4KJNA 3QOJA 1VR9A 4ARIA 3KLSX 1HA6A 4RGNA 1HQRD 1RWSA 5LHY1 2WXHA 3OWFA 1DXMA 1OXVA 3FC4A 2MHVA 2LMCA 2WKCA 2MEKA 2LS01 1MGSA 1R4QB 2E2DC 1YN3A 1Q12A 4WIPA 3C1EA 3H0GB 1ESFA 1PTOF 2RSOA 2KDMA 3VYSA 4K2KA 3IT4B 2F0GA 3TDQA 2B2UC 2DN8A 2AX5A 2O5IC 5CORA 3NXWA 4AQ7A 5M5XB 1A3TA 5BMIA 3RLFA 1QOGA 2Z8LA 1HQMC 3FILB 4H13C 2Z1CA 3CHBD 4WH4A 3GB1A 2QMTA 1HUNA 3A8IE 1IBXB 4ME5A 1ET9A 3K58A 4CBVA 4JBWA 1JRPA 2BOSA 2F0OA 4KX6B 1WD1A 1QNUA 4LJZC 1Z6HA 3VYTA 3MWYW 2XRQD 1JQYD 2F3WA 2NWGA 5EE3A 1ILPA 1OFFA 3QOLA 2WXFA 5ISRA 3NQIA 4MM3B 4KY6A 2K5QA 1SE3A 3A55A 4GZYC 2MJEA 3GP7A 1SNCA 2B2TA 3HVDA 3IAYA 5J39A 4A3GB 3AEAB 1WTXA 4WQMA 1I4RA 3UI2A 1PRTF 4DQOC 1D5ZC 1B53A 2JSOA 1F9PA 1BCPB 3CRKC 1OQQA 1D4BA 1TWGB 1FGBD 3SDZA 1DD2A 3SXHA 3E0JA 1ZP0B 2BS4B 1B9NA 2CJOA 1SB3C 1ENFA 4WORA 1GOZA 1FM0D 3S15B 1JWUD 3MHBA 5CR3A 3PUXA 4A3MB 1QE6A 1E9MA 3B9JA 3AU7A 2B2YA 3PO3B 3OW7A 3T51B 4R8IA 1S5BD 1EYCA 4TKOB 2EYLA 1V1OA 5EKLA 1STHA 2WDQB 2LGIA 4CJ2C 4ZYSA 1OO9B 1EQTA 1TS2A 1EIHA 4V0BA 1LTGD 3L3OC 2A69C 2DNCA 3SR1A 2N9KA 3OSOA 4YIJA 2E2IB 4DNRB 4L2YA 1PLFA 4WRDA 2J0TD 2B2YC 1T5EA 1O7YA 2DWQA 1R4PB 2CU3A 1ZXIA 2O5JC 1V97A 5BN3A 2PCFB 1XYIA 4WAFA 1B9MA 3I72A 2K7VA 2NVXB 1XX8A 1U4LA 1P7EA 1Z47A 4C3IG 2ZXOA 2F1MA 2E2HB 3IXSA 2H89B 1RCVD 2K22A 3NBHA 1K50A 2M0AA 2EYMA 3RZOB 4RH6A 3UI3A 4K6DA 5LL6X 2Y5PA 3ETRA 1GB1A 3MJ5A 3QG1A 1JW9D 1E2VA 1NYQA 3LYYA 1PTOC 2PQEA 5C44B 1YQ4B 4P6VF 4QF4A 1W6KA 2RDHA 5JAVA 1PTOB 3Q8CA 4YT0B 2XSCA 5G3LF 2K3UA 1TIID 2B2VA 2B2WC 3GTJB 3HP3A 3WDNA 2KEDA 1SYCA 1EYAA 5FO7B 2F3VA 3Q8AA 1TS3A 2WINB 1DOMA 4L8JA 1DGJA 4ULLA 4C2MB 1CHPD 2EY6A 1HCZA 2E3TA 4A3DB 3SEBA 2KVMA 1JOKA 2ENBA 5KNDA 3S1RB 5G5HA 2KECA 4N6EB 4X3SA 1PGBA 2J52A 2PW5A 1EY7A 1A3UA 1MSHA 5HG2A 4TRDA 5IT9L 2B2TC 4R8NA 3QIAA 2XRSD 1A3VA 3PIP3 5M3MB 2VZKD 2JA8B 3U52E 4CHTB 3VRBB 4EQOA 2A68D 5BN5A 1GB4A 2C9OA 1F9SA 4QCLA 2PW7A 4KKTA 1S5FD 4K5XA 1VZ6A 4C3IB 3QJYA 5HI1A 2EYJA 4OHJA 2R3ZA 3GV3A 5IGEA 3P4PB 3G7LA 2VXWA 4CKEA 1SNOA 1X32A 5H8YE 4I65A 1U4MA 1EY8A 2D2CC 2F0EA 3QWNA 5IGDA 3DWPA 3ZJUA 1TT2A 1B4OA 2BDNA 4C80A 1C4CA 1QILA 3D6CA 2F03A 2LEKA 1HXYD 1L4DB 1QOAA 5C0XI 2L55A 3KUPA 4XYQA 4QMGA 1X3QA 3ZGZA 4HJGE 1SYEA 2PKOA 3NRZA 3BDCA 2BA0A 3E5SA 2V3PA 1PZID 3K0YA 2Q8IB 2QKIC 2WXJA 3ONAB 2W3SA 2K32A 3K6OA 3Q8EA 5C4XB 3CU7A 3V05A 2JXTA 2BW2A 2WDVB 5LL6S 1N63A 4KI0A 1EZ8A 1DJRD 1U4PA 2W54A 2GI9A 3BK2A 4XDDA 5LNK1 1HTPA 1IHZA 3I3CA 4H0LC 2SOBA 1CA6A 5C3JB 3T56B 1JOQA 4KKUA 1O78A 4XT3B 5BYQA 4OZCA 2PLPA 4IQZA 1AZPA 4HCSA 4A8XC 3I90A 1HHVA 1J7CA 1MPEA 3KK7A 5D65A 1QB5D 3GD7A 3Q0AA 4G7ZC 5IODA 4FXGC 2NN6I 3M3YB 4K8IA 4IALA 1H9JA 3GO5A 2K33A 2K5DA 4CQNA 2MPMA 3R2IA 4YSXB 3JAML 2XN9C 1BCPF 1FR3A 1NI3A 3FILA 2IGDA 3GQBA 1KLGD 2WXKA 1HEZE 2EDGA 2B63B 2JA6B 3J81E 2IT1A 1C78A 1VMPA 2WIIB 1K83B 1STAA 3M7GA 1CJEA 5D14A 1A6XA 5G5GA 1WTVA 1QNKA 1XLOA 4L6TB