1DYQA

Staphylococcal enterotoxin a mutant vaccine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
228
structure length
228
Chain Sequence
EINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFRQHTILFKGFFTDHSWYNDLLVRFDSKDIVDKYKGKKVDLYGAYAGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Enterotoxin
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN A MUTANT
publication title Structural Basis for Abrogated Binding between Staphylococcal Enterotoxin a Superantigen Vaccine and Mhc-II?
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 74
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2000-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dyqA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1dyqA02
1JCKB 1SE2A 1EEFD 1B1ZA 4C56C 3R2TA 4K6LA 2XNAC 3EA6A 1HTLD 1M4VA 3V05A 1ESFA 1I4HA 2RDHA 1CT1D 1QILA 4DXFA 1PTOB 1S5DD 1LTTD 1KLGD 2XRQD 1RD9D 1ENFA 1CQVA 1UUPA 1ET6A 1FGBD 1PRTD 5D3IB 3DWPA 2RDGA 1PTOH 3CHBD 1SE3A 3SEBA 1PZJD 1BCPD 1CHQD 1UNSA 2O2LD 1TY0A 4RFBA 1EWCA 3O13A 1HQRD 3BVMA 1JWMD 1FNWA 3W2DA 4O1NA 2G9HD 5ELEA 1PTOD 1AN8A 1F77A 1PZKD 1T5XD 1SXTA 1SJED 1HA5A 1YN5A 4RHRA 1YN4A 1S5ED 1ET9A 1PRTC 1DJRD 1G8ZD 2AQ3B 1JR0D 1BCPC 1TY2A 2Z8LA 1YN3A 1PYWD 1L0XB 1LT6D 3BZDB 3MFGA 1FD7D 1FNUA 5ELCA 1XTCD 2XN9C 1JQYD 5ELFA 4RGTA 4RH6A 3MC0B 1RCVD 1D5XC 2QEJC 1LLRD 3R2IA 1PZID 1CK1A 1CHPD 1S5CD 2XRSD 5I4DA 1LTGD 1S5FD 1GOZA 1PTOC 1TS2A 1EEID 4DXGA 1S5BD 1JWUD 5TSSA 1SE4A 4BWGB 1RDPD 2J4XA 3DWAA 1V1PA 1V1OA 1D5MC 1LTAD 1PRTF 1EU3A 3KLSX 4OHJA 1BXTA 1LTID 2SEBD 5ELDA 1JWSD 3GP7A 1STEA 5ELBA 1BCPF 1LTSD 1SJHD 3BYYB 5D3DA 1I4PA 4RGOS 1I4GA 1HXYD 5FK9C 3TSSA 1D5ZC 1EU4A 3BYTB 3EFXD 1AW7A 1SEBD 3OWEB 4L6TB 2R61A 3BVGA 1KLUD 1LT3D 1LO5D 5FKAC 4TSSA 1I4RA 4RCOA 1PTOF 2NTTA 1RF2D 2IJ0A 1EFID 1LT5D 1LTRD 4NZLB 4ZYSA 1TS5A 4L63B 1L0YB 1TS3A 1SBBB 1I4QA 3R8BA 2TSSA 3BVZA 3DWQA 4RGNA 1TS4A 2AQ2B 4RHSA 4RGMA 1PRTB 2ICIA 4Z9CB 2AQ1B 2IPKD 4UDUC 2CHBD 3URYA 1B44D 1LTBD 1KTKA 1MD2D 1BCPB 1V1PB 1D6EC 2QILA 1FNVA 1LT4D 1I4XA 2NTSA 2WV6D 1XXGA 1DYQA
chains in the Genus database with same CATH superfamily
1NBWA 4RKBA 1JE5A 2CR5A 3M63B 5IOIA 3R2TA 4HIDA 2EQSA 3CCRA 3W9CB 1M4VA 1V8CA 2WFWA 3Q6BA 3U2SC 2IW3A 4A3GB 2ZPNA 4HKZE 1PTOB 2A6HD 1YIJA 4X66L 1TWFH 4FO2A 1CA6A 3HOUB 1ET6A 1Y8PB 1HFNA 3PV1A 1KOTA 1W3SA 1U0LA 2KJ6A 2NBFA 3NP8A 4ZK9B 2B63H 5I9OA 3BY4B 1WXQA 2HDLA 4BBRG 2WWZA 3AE3B 4XGAB 1LM0A 1H4RA 4E6IA 3HM6X 4C4VA 2CKZB 3D6WA 4BA1I 1WYDA 4DAYA 2KHJA 4IPCA 1EWCA 4DK3C 2CCZA 4DUZQ 2EYLA 1SNDA 2Y0SG 4DV2Q 3S16H 2LS01 2JEAI 3GZNB 4KSKC 2EPBA 3A56A 2LXAA 4MELA 2LJ5A 4LFBQ 3S17B 3SK8A 1T6BX 1MIUA 4KD3A 5GAEC 1J7CA 1F1HA 1PZKD 1NBFC 2GB1A 3DVGY 4E3CA 3IT4B 1K83H 2JXMB 4DV0Q 3GDEA 3RNUA 3P4QB 2FUHB 2LGSA 3DVNU 2C7MB 3IKJA 1NMFA 5ISRA 2M19A 3K58A 2B2WA 2B63G 4V0BA 3M62B 3OJ4B 3TRZA 1FD7D 1TWCH 2UUCQ 3AEEB 1MHWC 4BFRA 3G7LA 4R1JA 3J7A5 3A4RA 2XWJB 5KGUA 4IFDI 1PDXA 2N4FA 2BYEA 4KY5A 4BAXA 3NVYA 5GAHC 1QOFA 2NVTB 1WVLA 2BDNA 4A3MB 3H7PB 2AEHA 2JWZA 4R4TA 3H1UA 1JWUD 5TSSA 2HJ1A 5CBEE 2DNEA 1IHZA 2YYZA 4HIOA 4JBMA 4DAYB 1VS0A 2NZOA 3D0FA 3PIPA 4LF6Q 3B1LX 4ZRQA 3WIMA 2M0XA 2KQSA 4A3IB 2UXDL 5HHDG 4GLVB 3G4SA 4LTUA 2PMVA 3T51B 5JVH3 4ARIA 1HZBA 1PH2A 2BE5D 4O2DA 4PS8A 1B2TA 3TSSA 1RIPA 1QE6A 3CCJA 4HN7A 4B95A 2LGXA 1AW7A 5M5YB 4JQWC 3K9OB 1U4PA 1WY8A 2F0TA 3CCEA 3DEOA 1N62A 1YMHE 2OQ0A 5LMUL 2BS2B 3WALA 5IP9H 2WB1G 1PTOF 1OQRA 2MO1A 1XCQL 4US8A 1SLJA 1PH1A 4FF4A 2K5HA 1RM6C 1LT5D 5COYA 3A9JA 3HS0C 3UQBA 4IKGA 1VQAA 2IX0A 2DZKA 1VQHA 1G51A 4TV3A 1IXRA 1YBYA 4GN4B 5M3MH 2WX1A 1GPXA 3JAME 2L55A 4P75A 4DR3L 1G91A 3JVZX 4XDCA 4EZKA 4ANVA 3CMAA 2JT4B 4A3GH 3S14H 2KVMA 3KWLA 1T0QC 4A3LH 3FILA 1GJZA 2V3SA 2D9UA 3NEMA 3SD5A 1V6EA 1B70B 1VQEA 1DM0B 3RD2A 3QIJA 2NVQB 1B3AA 4YWGG 1GM5A 3F8TA 2NVYB 1WSPA 1C3TA 2K6DB 1PMRA 1L1OC 4IPHA 1ESFA 2RDHA 2B3AA 4A3KH 1QF6A 2KVRA 3QR8A 2LVQA 2LY7A 4JWUC 4JPBW 5IT9E 2WXIA 1S3OA 4DBGA 2OTLA 2WP9B 4JI3Q 3MZ5A 3T1YL 3PVLA 4MJSB 3KLWA 4A3GG 1JW9D 2CHXA 4IC7B 3S17H 2KANA 1X3FA 2F0LA 4A3LG 3A9JB 4AJYB 3K80C 2JA7H 1HH2P 3CHBD 3FPPA 2KJRA 3I8ZA 2QKIC 2HTHA 4HMIA 2NVUI 3T3NA 2OTJA 3IFDA 1MI2A 4KIKA 4XQQA 2N78A 2KXJA 3R3OA 4GB9A 5FJ8H 4X66Q 2WQYB 4XDXA 2RCFA 1B50A 1DONA 2D5DA 4KK7A 1MJEA 3CWIA 3W1SA 3FILB 2E2IH 3D4RA 4DV5L 4LFCL 3SXHA 4B3RL 5BN3A 4Y7NB 2BWES 3IT6B 4MTNA 1C9OA 3SK6A 4M8NA 1ET9A 3SGIA 4A3MH 1V1QA 3AE7B 3ALBA 4Q2JA 3J81E 5CV7A 4G7ZC 3N3KB 2ZJQA 4HEA1 1PYWD 2A5HA 3MFGA 3QJYA 1LGRA 1YQ3B 4IM2A 3TUOA 2XN9C 4AQYL 2JYEA 4RGTA 1K3RA 4LUZA 3HOVH 3J7ZC 3EVQA 3NSWA 5FJ8G 2FBWB 3H3VC 2Z0SA 4KLKA 2CHZA 2B2UA 4I6PA 1PH8A 4QCLA 4DFAA 4JI8L 5IGFA 1P7EA 1CUKA 4GDKA 2K5DA 4DXGA 2MP1A 3NE5B 4POFA 2V9HA 2K33A 4PMBA 4BWGB 5J22A 5M5YH 3MJ5A 5C3WA 2OT2A 3DWAA 4DAVA 1KIXA 1LM8B 1EU3A 4A3MG 5EBDA 3AMZA 3ETRA 4QGUA 1LXDA 1EY7A 1B9MA 3EQLC 3ZO5B 2MUYA 1BQQT 1PV4A 1K50A 3Q2AC 5DPSA 4IUPA 4ALPA 4N9PA 3AECB 3LB8C 3NY5A 3HRZC 4ZRKA 1MPEA 3RI7C 5HURA 3HOVG 5CTRC 4A3IG 3CSFA 3TEYA 4AUQC 4R4IA 5CR3A 2WINB 4U68A 1N5XA 3BVGA 4YL8A 2ZW1A 2K05A 4LF9L 2KCNA 4LDTD 2UXDQ 5IA7A 2K1FA 3GS2A 3WCQA 2K1BA 1EFID 4ZYSA 1SNOA 1E2WA 2RVLA 3ZNZB 1T0SC 1XD3B 4QAYA 3M85A 2NVYH 2CH4A 4LAAA 5IODA 4JCVE 3A8JE 1DOIA 2BWFA 3I9V1 1RLFA 2D0PA 2IHFA 3PUWA 5FLXL 4DR2L 5LMUQ 2RA4A 5GROA 2BYVE 4GDKB 4KGTA 5LHY1 4XTCS 1MD2D 3GTQB 3W5UB 2VL6A 3HKZE 3NTHA 4XT1B 3I7FA 2Q2UA 2YLMA 3PTFC 4HXDA 4K6DA 4DGZA 4IO9A 3MHBA 2MFIA 4EQOA 2JA8B 4QF4A 2WX0A 4KN4C 3ZJTA 1XCTL 5LMNL 1NR4A 3BK1A 4KKJA 4ZRIA 4P16A 2IWHA 3N30A 4KZCA 3T1HL 4DNIA 4FXDA 2BB6A 4NQLB 3X0WA 1EYCA 4WAAA 1KLGD 1PH3A 1W6JA 1C79A 4A4IA 2G3QB 3S24A 3U52E 1BT0A 5FO9B 4P72A 4HRSA 4ZOHC 1P16A 4JI0L 1ZKHA 2FUG1 1H9SB 3U4ZA 2ZJRA 2NMQA 5IO9A 5D6JB 3VR9B 4BBNF 3KK7A 1VZ7A 1XMOL 1GUGA 2A6EC 2Z6KC 4OX9L 1JRPA 1Z7TA 2SOBA 1XMQL 2FCMA 5EGTA 3VR3A 2GA4B 2K6AA 5CMDA 2LVPA 4CKBA 2LGDA 5J39A 1L4DB 4NB3A 2SAKA 3T8MA 2UXCL 2QGQA 4L5SA 4KMUC 3T1YQ 2Z6BA 4B0EA 5BMIA 2I5LX 1V49A 2KFKA 1SMYC 3D4WA 5T1IA 1I94L 2WXNA 1WX7A 2J7QB 3V2TA 1YN5A 1N36L 1HR0W 4QL5A 4YCWA 4YCVA 3AE6B 4WJOA 3ZDTA 2L0TA 3B2GA 5BYRA 1G8ZD 4KTAA 2LXJA 3ZNGC 2LWPA 2SNMA 4LCDE 1WXVA 2EJFC 1V9PA 4PQXA 4DR4Q 2MBEA 4DV5Q 4LFCQ 4YIJA 4TKNA 4B3RQ 4CDCC 1TWGB 5IWAL 4MN3A 2K14A 2JA5B 2QEJC 4JLCA 4HJ9A 5JH5C 4XC2A 5NUCA 4DR7L 2L7RA 4AQ7A 3NHHA 2L4NA 3KVFB 2FXQA 4KKUA 3QA8A 1E2VA 4ZLTF 4YWMA 1AP0A 2VZKD 4UP9A 3OW7A 3SVMA 4AQYQ 1O7IA 3WDNA 2KDMA 5EPKA 3GTMH 1J8CA 4ANUA 1BXTA 1HNXL 2Z0EB 4IUNA 4BS9A 3IG3A 3S1NB 2FAZA 1HZ5A 3BYYB 2KFKB 5C0XJ 5JEAH 5LNK1 3SK4A 2FFKB 3AEAB 1YJWA 1I4GA 2AWNA 2KTFA 1MI0A 2BA1A 4ABNA 3CRLC 4P74A 1Q46A 1UE6A 2KEDA 5EE3A 2H5XA 3WANA 2RSUA 3C1FA 2IO0B 5E6PA 5LLIA 1XLPA 2C9WB 1Q12A 1DZ1A 2WDQB 4NP5A 5AZHA 3L2PA 2BPSA 1EIYB 2X8XX 5E3FA 3WAOA 3TP6A 1ILPA 3S1RB 2OJWA 3B08A 3NHEB 3G6JB 2JA8H 2KWDA 1RL2A 2DZJA 3NJTA 2OF1A 3M7GA 2K28A 2V4LA 2NWGA 3RN9C 4MACA 1SR3A 2PCFB 1IGDA 4EEWA 1TT5B 4AYBB 3CKIB 4RGMA 5JEAG 2N9XA 1Z47A 3DBRB 4W9DA 4I7ZC 4CKEA 4LF9Q 2RR9A 3SR6A 1T9HA 2GVAA 2EYJA 3A5UA 1T0YA 2LFIA 3BIID 4DQOC 1L2FA 1D6EC 1VCIA 4ID6A 5M3FH 3HOWB 1DOMA 3EROA 4OIKA 4C3HB 1EY6A 1WGDA 1OTRB 5EE1A 2J53A 2MSED 3OG5A 3G6EA 4DR2Q 2A19A 1I4HA 2JA8G 1UWXA 3KQ4A 4K3CA 2PO4A 1GB4A 2IY0B 4K14A 4FHJA 1ICWA 1PYSB 1G2TA 2LI5A 2XK5A 5A35A 4LNQA 4OONA 4DR6L 3HVZA 4IWPA 2PW5A 1YJNA 5C0XH 4I7AA 5FLXc 5LMNQ 1RJTA 3W1BA 1STNA 3NRZA 3A5ZB 4DPGA 3IL8A 1IBLQ 2IO3B 3T1HQ 1J19A 3ZNHB 4WWNA 2R93B 5BN5A 4R4CA 3BINA 4E71A 1CZPA 1WGHA 3I55A 3U4EG 2FINB 4GN1A 1BUIC 3HP3A 3MWYW 2CQOA 4JI0Q 3FKYA 1RTOA 4PMWA 2VQEL 1V8QA 1YQBA 3GTGB 4GXBA 2JA5H 1XMOQ 3CQZH 3UQAA 4TQUS 4OX9Q 4NQKE 3M7NA 1XMQQ 4BKGA 1QCBD 4JC0A 1UGJA 2EMSA 1EY0A 2F0IA 1JB3A 1V2YA 4UP7A 2X6GA 5DM63 2WS3B 4KSLC 2AUJD 2UXCQ 1KJTA 4CHKA 4GOCA 3MAQA 3F2DA 2UUBL 3TMPB 4BY7B 3J7YW 2M8SA 3NS1A 2G4DB 1I94Q 3K0XA 5J3BA 2WU5B 1TZOA 4ZRZA 2DBYA 3BK2A 5MPOA 1MJDA 3S1NH 3TEHB 2D10A 1QVFA 2JZ3B 3TEZA 1K8RB 2VS1A 3RZDH 4XE0A 2IY5B 1PTOC 4IW0A 4AIMA 2XWBB 3S15B 1UE5A 2JA5G 2K8CA 4RG1A 2F0EA 2JK8A 1FXAA 2X69A 5IN7A 1A2UA 3U9OA 5IWAQ 2R7ZH 1YNJD 2MEKA 1VQMA 4M0WA 1STBA 4GDLA 2Z6KA 4DV7L 5EDSA 4DR7Q 4DAPA 4XQNA 3E0JA 3KBXA 2K5VA 4ZRPA 5CX3A 3LGJA 2EY1A 3PGZA 2AKWB 4G57A 3L7ZC 3CCSA 1WMHA 2O6VD 2PTLA 3BYTB 1Q1EA 5G3LD 1AZPA 5M9OA 4WORA 3HOZB 3OWEB 2LEKA 4W9LA 3ZRCA 5CV6A 4HLEA 1HNXQ 2KDEB 3GE3C 4X3UA 4RCOA 4G50A 4NAWB 2NTTA 4KDIC 1QT9A 3JAML 1WXMA 3Q3FA 1LTRD 4C1NK 4QQBX 3HOWH 3U8ZA 2PQAA 3M4YA 2LKVA 4C3HH 4IDIA 3TZUA 3K0YA 3PPAA 4KX6B 1YJIA 1WJ6A 2L12A 4X3KA 4NJ7A 1A2TA 5LL6X 1BO0A 3PSIA 3KBGA 2MGSA 2WXMA 1EQRA 2XBBC 1R4NB 4M02A 2F0QA 4UPAA 1BCPB 2H4OA 2PNHA 2MP2A 2WXFA 4C7ZA 2QILA 1FR3A 2IX3A 4AYBG 2WV6D 3EIVA 2LRWA 4RKLA 2WXPA 4M0WB 2ZTEA 2QCPX 4GDLB 5DPRA 2F0SA 5IT9L 1EEFD 2A68C 3GTKB 5G5HA 2KKCA 3P1MA 2M9VA 4DR1L 3H6MA 3HOWG 3A1QB 3QK0A 4W9EA 2R93H 4C3HG 2RSOA 3BDLA 1OGWA 4CJ0B 1AE3A 1M8AA 2MHVA 3I4MH 3H3VH 3I72A 1B9NA 4MIUA 3M4QA 1PH9A 1R4MB 2YEPF 5IYDH 3I5JC 3HOYH 4FNFA 2YTXA 4LFAL 4A3DB 1WYWB 1C4QA 4J6IA 5E4WC 4A3FB 1FL0A 2B2WC 2JZZA 1XNQL 2D62A 4MTKA 5C2TB 1FXTB 1HZAA 5DPWA 4IURA 3J81L 2I07B 1JRUA 2DUDA 3FPUB 4JBJA 4N9TA 2R93G 2MP2B 4EZJA 2Z0DB 3E3XA 5DAUA 4YWKA 2VH2A 2LUMA 1S5ED 3A74A 3LXFA 2RCNA 4HROA 2JU6X 1F2ZA 2D2CC 3RZWC 2M17A 4FXCA 2RDFA 3K57A 3DM1A 1BKBA 2MBBB 5IYDG 3EFCA 2L3ZA 2M00A 3BZDB 1LT6D 3A0JA 2K39A 5ELCA 2YTVA 2VQEQ 3AULA 2CH4W 3HM3A 2O5IC 3RYTA 2L52A 3N9YC 2E74C 3Q0AA 2O2VA 1W6KA 2XEWA 2J0JA 4DUYL 4DNRB 3R2IA 2PI2A 4BY7G 1FCLA 1OEYJ 4JV5L 3APFA 2IGHA 4IJHA 4JBWA 4MZ9A 2Y0SE 2UUBQ 1HCZA 4OWWB 1WJUA 2WXRA 3QQ8B 3ZTDA 4KKTA 4W9CA 2EELA 1KDCA 2PZTA 5C23A 1Z5SB 1EM7A 3DM3A 4L8JA 1BBUA 1BCPF 1XTDA 4ZQ3A 4DAMA 4DNTB 2W3RA 1D1IA 1F9PA 3P4RB 4RGOS 2JSOA 2XSCA 3MEHA 2Q2HA 4OXPA 1EYAA 1CKNA 5FO8B 2EKEC 1WGGA 1SFOH 2OCEA 1FMAD 1TU2B 4XYOA 1R7SA 4X62L 1B7YB 2JP1A 2LGIA 4PYZA 3RNEC 2ENBA 1KAWA 3PUYA 4LWCA 5IIFA 4WIPA 3TZDA 3TEXA 1T3QA 2NR2A 4TSSA 2HT1A 1SNQA 1PYBA 1JOQA 4DV7Q 1WWTA 4DWFA 4I6NB 4L1BA 3RLOA 1NR2A 2PVGC 3HOZG 2NCNA 1KQSA 3WOFA 3EC8A 1FVIA 2JSVX 3IAM1 3RZOH 1TS3A 4DK0A 4DHZE 2O2VB 1XT9B 3QC8B 2RBMA 4QJFA 1QNUA 1TKWB 2K04A 2LUEA 3DWQA 4RGNA 1I50H 3UDGA 3Q3MC 2EJGC 2JRIB 3B0AA 1P0RA 2CKHB 4WRDA 1QVCA 1XLOA 1KTKA 2EOTA 4LJZC 3C3LA 2N7JA 1N32L 1CKMA 4YCUA 2WACA 5LXIB 3N1YC 1UZXB 2KENA 2K52A 4MSQB 2VB2X 1ENCA 3VH3B 1DYQA 2F0WA 2F0HA 2QF7A 2L0FA 2W3SA 3IAS1 4FJZA 4HPMB 4UAIA 1CSPA 3EA6A 5E7NA 3GD7A 2F0UA 3JAMc 4DXFA 1E24A 4A3FH 5HGQA 4IN3A 4LNOA 5KIXA 2D3GA 2NS5A 2K5NA 2N9PC 3EUB2 3PGEA 3W1SC 4NDXA 1QZHA 4Y52H 4BKSA 3DCGA 1V5OA 1IZ6A 4KN7C 4MH0E 1WTVA 1VQFA 1WXSA 3HEJA 1HUNA 4BOSC 5D3IB 4QMGA 3RLFA 4LJOB 2CW0D 3HOXB 2J42A 4M00A 1B4OA 2I46A 4DR1Q 2JRHA 2NN6I 2ZNVB 4MH8A 1EQTA 4BBRH 5JHBA 1HEZE 3QARA 4IM3A 5CHWA 5IT9c 1TZ1A 2QHOA 3PO2B 1UE7A 3Q6SA 4A3DG 4ICVA 5GQOA 3ZYYX 4ZKCB 4O1NA 4A3FG 1EF1A 2B2UC 3F1ZA 1C4CA 4LFAQ 4TKOB 3AMUA 2JYTA 1E22A 2ZXPA 2E5LL 3MC9A 5FR3A 3J80E 2F0KA 3I4OA 4KY6A 3V6EB 1XNQQ 1IBMQ 2MLBA 4LMQD 2J52A 1SIJA 1J7AA 2JY6A 1TY2A 5KYIA 2B2VA 2MBOA 2JVCA 2QMTA 3DBSA 3OYYA 1GUWA 3WWVA 1YITA 2K25A 2NZ1D 4L5TA 3H7PA 1JICA 3MC0B 1IBXA 4FJVB 1N8RC 5C44B 3JYUA 2M1MA 4OO1G 4N59A 1EY4A 2BDOA 1QKZA 1TWHB 2AYOB 4N9F4 2L1BA 1TVXA 3VTVA 3PO3B 3M4OB 1SIFA 2CVRA 3A7AB 5I6WA 3J81c 3L10B 1BNZA 2Y5BB 1C78A 4L5QA 1VZ6A 2KDFB 3P4SB 4YTMB 3H09A 2G5DA 1K8GA 1D5MC 2C35B 2ASBA 1XPUA 4JWSC 4CYEA 3M3YB 4C7YA 4JG2A 1C9FA 2BCOA 1I7HA 1JALA 4DUYQ 1STEA 3D4DA 4NXMQ 1K53A 2BH2A 5L95C 3J7AF 3FAHA 1X3GA 3AYHB 3S1MH 1K73C 4JV5Q 4C00A 1FPYA 4DV3L 2V0GA 1J9OA 3Q8CA 5AJ3L 2OEDA 4W9JA 5CORA 1AFPA 1MG8A 3B2FA 1VQGA 3AE5B 1I3QB 3E56A 4BVUC 2JUOA 1I4RA 2VRRB 2DYMA 2GVBA 4K8JA 2ONQA 4NZLB 2NPTA 1CI3M 1ZKOA 4ZCKA 3QJZA 4XX5A 3B9JA 1IBXB 3R66C 3R8BA 4FN2A 1QNKA 1HTQA 4X62Q 4MEMA 4DHJD 4WWPA 2ICIA 1RODA 3MXNA 2VQFL 1IUEA 1CFMA 4AH6A 2GMIC 4UDUC 3NBIA 1LTBD 2IZVB 4BBSB 2Z59B 4W9IA 1VLBA 4ILWA 2WDTB 3PIOA 2JPHA 3MC8A 3RN5A 2C60A 3S2DH 2MQHA 3IFWB 1HNZL 3KDFA 1LQBA 1XEEA 3OIQA 3HOXH 1JB7A 1G6PA 4AJWA 2KQ7A 1B1ZA 4PT5A 2PLPA 4ODGA 2F0DA 4HJ8A 1YNND 4HCNB 4MJSA 2FHTA 4JPSA 4EUTA 2EDGA 1P7FA 2K5PA 1SRUA 5EPLA 2WDRB 3PLUA 3VDYA 4LNFA 1IYJB 1HFGA 2PW7A 4RMAA 5FO7B 2UU9L 2YVCA 2Y5PA 1FGBD 1XX8A 2CU1A 1PRTD 3Q24A 5HFYA 1STGA 2NPTB 3ULJA 2F0PA 3A9KB 1PTOH 3K5OA 2G4SA 1UWMA 1PZJD 4K7WA 2N1WA 3PREA 5I6YA 2V4DA 2K75A 5FLMG 3HOUH 4B9KA 3HOXG 1FFVA 2KCCA 5HY6A 1XNRL 4KGSA 3W5VB 3MXNB 4WWOA 3JC66 2INNE 1WCMB 2ZM6L 2MNAA 3NQTA 5C44H 2JF5A 2MW5A 4IFDH 1M90C 1SJED 1STYA 3KDFB 2L15A 2EIFA 3OMCA 1QZEA 1E10A 3PO2G 1A5RA 3CXCA 1E8XA 2EYHA 2XVSA 4GN3B 3PO3H 1I5FA 4US9A 3M4OH 1F2RI 2OXPA 3NVWA 5D94A 5D7GA 5K5PA 2NZHA 1R4PB 4OW0A 1HE8A 3HKSA 3MEFA 4MDKE 4F8CB 1II3A 4TQ1A 4RCNA 1Q1OA 4DK5A 4AOFA 1F2YA 3N32A 3HOUG 4A93B 1BF4A 1WI0A 1S40A 2MO0A 4EQPA 2E5LQ 1WFYA 2KC1A 3NBHB 2WXJA 4GMVA 3T16A 5HG2A 3IBEA 1CHPD 2KJXA 2XRSD 4LDTB 3RZFA 2HJ8A 1ZYRD 5C44G 1YNJC 4IFDG 4LF8L 2RHQB 1GB1A 4FDBA 1UF0A 4DA2A 2ES2A 1I3QH 5IGGA 3TREA 3PO3G 2Q5WD 4DN4M 1FD6A 1WI5A 5ELDA 3NELA 4K5XA 1YVCA 2NVTH 4TRDA 1UH6A 2MA9B 3AE4B 4H2AA 4BZAA 3L0OA 1EIGA 3SK5A 2ZTCA 4CDFC 2NVXB 3QO2A 2K5QA 4AWJA 5HI1A 2N9KA 1IW7C 3EFUA 3H6NA 2E8GA 4PK1A 4HCEA 1GUNA 3Q8AA 4H13C 4A9AA 4CQNA 3LNNA 1HNWL 1QOAA 4II3B 5JAVA 4A3IH 2YV5A 5JVG3 1YIWA 4WJQA 2A69C 1BDOA 3JAMi 3ZTCA 5C3JB 1YOVB 4IQZA 4JI7L 2V1CC 2BGFA 3AV8A 4N58A 3W3AA 1QOBA 1E9MA 3N20C 2KQ4X 2L1AA 1EYDA 4B3ML 2B29A 4L63B 5KNDA 4GN5A 4DV3Q 4OVVA 1I4QA 1GXDC 3APDA 5AJ3Q 4A3JB 1V5TA 2HE7A 1VQLA 2WP8J 3L4PA 5CBAE 4WWMA 3KOJA 1LV9A 3D31A 2AL3A 4PZ8A 4E74A 1ASYA 1NMGA 5DNFA 2IL8A 3URYA 5IYCG 3KYCD 3PO0A 1VJKA 5DM73 3K9PB 3AEDB 3AU4A 1LT4D 2BA0A 1E0BA 1D2BA 4PMCA 1Y8OB 1GKHA 3A8IE 1VQPA 1I6VC 1XXGA 2BKFA 1JCKB 2F0JA 2NBWB 2REXA 4MM3A 5IGCA 3FMCA 1FEHA 1F2LA 3V05A 2VQFQ 1OXXK 1SYFA 1QILA 1OFFA 2AX5A 3L16A 1H9SA 2SNSA 2NVQH 2AUKA 3FRPB 4A76A 5JZEB 1PQSA 1D4BA 5IAAC 1RD9D 1C1YB 3EHVA 4EFOA 1UUPA 3ZLZA 1B53A 4O0AA 2INDC 5H8YE 1VQDA 1WTRA 3RMKC 2ZVOA 3OAWA 1WZ3A 4EE2A 1YJ1A 3U7DA 3RFZB 1QVGA 2LJIA 3IFTA 4HWIB 4JI4L 1TWAB 1HTOA 2H88B 2NBVB 3APCA 2KOXA 4DXAB 2FCSA 1ONLA 2F3VA 1C4AA 2UU9Q 3HIZA 3Q8FA 2V1YA 2JEBI 4DR3Q 4FVMA 2M0AA 4K0KL 2RDBC 4IWQA 4ZYNA 1UEAB 3HKZB 2KDBA 1TXYA 2G9HD 4A93H 1TKYA 1Q0WB 2IYDB 3CMEA 2LRUA 3OPOA 4MGIE 1E1OA 3G48A 1WRDB 4F1SA 1PH7A 4MM3B 3F2UA 3W5OA 1T0RC 3RN2A 1WCMG 2JJQA 1XNRQ 4CKCA 2ASQA 1BCPC 2KTRA 5C4XB 4JI6L 5JEAJ 1L0XB 4Y7NH 3NUHB 1QB5D 2C9OA 3E9HA 1WTQA 1VQ9A 2KC2A 1JQYD 2ZM6Q 3CC7A 3PMFA 1VCBA 2KMAA 3ITPA 1A8VA 4M8MA 1QQRA 4EX5A 2I38A 2NVXH 3L17A 1H95A 1OQYA 3X3NA 5IE8A 4IOIE 2EYOA 1LTGD 4H02A 4GNXA 1RYJA 2FNJB 1UGMA 4A93G 1J0GA 1S5BD 3STBC 1SE4A 4GKJL 3PV0A 2J4XA 4B3TL 2L9HA 3NXWA 3Q3NC 2A8VA 1XLQA 5CV8A 4NJCA 2KWVB 3M9BA 1HJPA 1VMPA 3A8KE 4W9HA 1GUSA 1E2ZA 1A3TA 4ME5A 5CHVC 5E6NA 2D3AA 4LK1C 2D2QA 2HIXA 3VA7A 1FRDA 2ZPYA 3MJWA 4LF8Q 5IYBH 3E5SA 2BT6A 5IP7G 5CV9A 2NYZD 3A54A 1LT3D 1SYBA 2E6XA 4ANWA 1IGCA 3CP0A 2KTRB 5AZGA 1PA6A 4OVZA 3I91A 2R7FA 3ICEA 3L0WB 1MFWA 2E2JB 2MH7A 1VMCA 1OXVA 2WLBA 3CSTA 2QDBA 3CIRB 2L83A 1C8CA 2BYFA 3P4PB 1HNWQ 1TS4A 1NY4A 4GNXB 2BYTA 1BR9A 1BOSA 1N9WA 4EGVA 1HHVA 3DWMA 4JI7Q 4A3JG 4JI8Q 5M5XB 3HZXA 2I5HA 2QEXA 2LD9A 3AE8B 5CYUA 3UDFA 2F0VA 1Q8IA 4LF7L 1P98A 5IYBG 4B3MQ 2E3TA 4LNNA 4ZRJA 3M4PA 4KHPL 1XJVA 4LNIA 1YEZA 1F9QA 1SE2A 3PIO3 3QWZB 1ZXIA 2PMZE 4K6LA 1WGKA 3H9DA 4LK0M 3CPFA 3GTQH 3C2PA 1SMXA 1QJOA 5C0XI 4POGA 1TWAH 4HR7B 4N8FA 1JJGA 1EIFA 3AXCA 3L13A 3VQIA 4ZHPA 4ANXA 3GO5A 3IRBA 3PQIA 2A1AA 1MHHE 2KAJA 1J7BA 3FEWX 1HZCA 2HCIA 3GQBA 3OTOL 1FJGL 4MT5A 2HDMA 1R9TB 2K8BA 1GG3A 3ERSX 3QCAA 4LJPB 1HZ9A 5L83A 1JQ4A 1N63A 1SNPA 4IPGA 1OTCA 3GTLB 3RNBC 1RWSA 2KWUB 3I90A 1K51A 1GNUA 3KYDD 5EBCA 4M8AA 2PZWA 2O2LD 3CCVA 1MG4A 1O80A 1JT8A 4JI1L 3GTJB 2F4IA 1E8WA 2J0MA 3LX0A 1EO6A 4HDOA 3IHPC 4JBKA 3J80L 4AYBE 1N6ZA 1G6JA 3ERQA 3EGRA 1KDAA 3DBLB 2A6HC 3UIOB 1GJXA 4K2KA 2BH8A 1V43A 3S1QB 5D65A 4JI4Q 1YN4A 1RFAA 4XDDA 2XGTA 1G291 3HKZG 3AE2B 4DDID 1JR0D 1HR0L 2ID0A 2K03A 2MJEA 5E6OA 1WX9A 1YNTE 1J8IA 2KD0A 2KX3A 1UEBA 4RF1A 5M5WB 1RTNA 1XTCD 2O6VB 2INPE 4W9KA 4A55A 1RCVD 1H9RA 1EZ6A 1H9JA 1NI3A 4URKA 3I73A 4GGQA 5C4XG 4IALA 4KJOA 2OWOA 3L54A 3KUDB 4N8X1 2JYOA 5C5MA 4R8NA 3MHSD 1VQNA 3PSEB 2N7EA 1GUAB 1PGXA 3MP9A 3BU2A 1GC7A 4JI6Q 1TWGH 2AL6A 3Q3OC 3VAWA 3OW2A 1WR1A 4YSZB 1V1OA 3KLSX 2ZCCA 3PUVA 3AN1A 3E9SA 2KACA 4L2YA 3K7AB 5CV4A 2E2JH 3ZNID 1TKEA 2FCNA 3F2CA 5D3DA 3VRBB 2ZNVC 4P2CB 4X3SA 5JJKA 5KEEA 4NAWA 5FOBB 1YJJA 4FYDA 2KLCA 2Y3AA 3MTNB 3AFQA 4JI5L 4HJGE 5C6AA 3UF8A 1SEBD 4QIWB 3PF4A 2A74C 2LSSA 3O65B 2D3CA 1N36Q 2YU9B 4LLGM 3KUPA 5M5XH 3QOLA 4OELB 2IJ0A 1X32A 5KYLA 2NUCA 4Q5VA 4F7ZA 1Q8KA 4KVGB 3ECIA 2F0FA 1WD0A 4PS3A 1ZUD2 3DBHI 1TS5A 2PNRC 1PGAA 2KWCA 1PLFA 3VR4A 2LHDA 3BG3A 1BBXC 3SDZA 1ZGUB 3RMHA 3AM9A 2IGGA 3LDZE 3ENEA 2BE5C 2RD0A 2Q2TA 3S1RH 2ATWA 2C5CA 2EZVA 2FE8A 1A6XA 1SE9A 2K0PA 4KJNA 1YX6B 3S2HB 3P2BA 5J1ZA 1Q7YC 2WIIB 3CAMA 3A1QA 2PEAA 2MBQA 3PZ7A 2G1EA 4IPDA 2KHIA 1X54A 2O5JC 3CC2A 1A63A 3H3VI 3DXJC 1A15A 1IKMA 2I1JA 4UY8C 3ULPA 1C76A 1I6HB 3JW0X 3VR6A 4IOCA 5GXGB 3DHIC 2EVBA 1BUVT 4WQMA 1XPRA 5F2DA 4C2MB 4KGRA 2C7HA 1FCCC 4A3CH 4KHPQ 1ENFA 3VUWA 3KLRA 4LUVA 3NVZA 4NKLA 4KKSA 1XF5L 2L5TA 3E9IA 3VYSA 3WOEA 2H89B 1JMCA 2JXTA 3QWNA 3S1QH 3SEBA 4JI2L 3ER0A 1TIID 2JQOA 2JA9A 1N5WA 2N9LA 2B2TA 2WXGA 4NAMA 1M94A 4BY1B 1D1KA 2B2VC 2WAQE 1EQVA 3OTOQ 1FJGQ 3ZJUA 3SU8X 1PHJA 2BB5A 3Q3JA 4DK1A 5IGDA 2RMMA 1VD2A 2AWTA 1RKNA 1SSNA 3PCOB 1WYGA 4A75A 4DU9A 1PVOA 1AN8A 4YWLA 1X55A 1HA5A 2AHOB 4UHVA 2IHEA 4A3CG 4ASWC 1DJRD 2RQXA 5E6JA 4JI1Q 4PV1C 2N55A 2WKDA 3GTGH 3H94A 2K32A 1DD2A 4QB4A 3GE8C 3TN2A 2HD3A 3FHWA 1QZGA 1FM0D 4KDLB 1A3VA 1ESRA 2LXKA 2HHHL 5EPJA 5T1GA 3RUZA 1LLRD 4CGYB 1NSNS 1ISNA 2LVOA 1KC8C 3J80c 3KFUA 3H7SA 4BY7H 1HR0Q 4DR6Q 2B8FA 1C4PA 1U5KA 4JE3B 3HFZB 2R2QA 4R4QA 5DPTA 4YTNB 2L00B 4X6AH 1J5EL 3ONSA 4CDDC 1KH0A 1Q81C 2ZTDA 3VR2A 4OHJA 3SFEB 4BXXH 1ZDXA 2A73B 2DNCA 2PW9A 4EQ5A 1WGRA 3NQIA 2KJHB 3E6ZX 4HVBA 5J17A 3HGBA 3S15H 4IG7B 3J9CA 4MNOA 4JOIA 3DQVA 5FK9C 3I4NB 3NUCA 2PZUA 1SNMA 3EN2A 2D5GA 2MQJA 2F4VL 2KNBA 3Q23A 5FLXE 1GD7A 4C3IB 2W54A 1JC7A 4A20A 5A2QE 1F52A 2LASA 4WJPA 2B3GA 1KF6B 1Y14B 3CCMA 5EAYA 1KDBA 1IBKL 3S2HH 1E0ZA 1MKHA 3IVFA 3H0GB 3HOZH 2QCZA 2RGFA 2OOBB 1ZDVA 5JJZA 1S1QB 4DUZL 4JI5Q 1WTHA 2TSSA 4BXXG 2E2HB 3I3TB 3HHMA 5BO4B 1SYEA 2B8GA 1X1MA 1K8AC 2BBCA 1I6HH 1GC6A 1R4MI 1JWBD 2FIDA 2VXWA 4K3BA 2IO1B 5HGTA 3MFYA 3T4AC 4C2MH 3VR8B 4IM0A 2DENB 4MHEA 1KABA 4DV0L 4WQOB 3LWEA 2M4NA 3PRPB 1HZ6A 1NENB 2KBNA 5JPMC 3C19A 1SDFA 2R92B 4C56C 4P1CC 3MHZA 4C80A 2UUCL 1RHPA 1VQ6A 2DJFC 1HA6A 3NWSA 3RULA 2AWOA 1EY5A 4BY1H 2B63B 2ZEQA 1E6EB 1SMYD 4LNKA 1MSHA 1AEXA 1K9MC 4OWXB 3GTKH 2W9NA 1KAAA 2DYBA 2F52A 2SDFA 4KHVA 1SAPA 3RNFC 3OLMD 1KXLA 3S16B 1VQ4A 3UGBB 3QIAA 3DLLA 3AFPA 4JGHB 1YJ9A 1SYGA 4D2KA 1WX8A 1STHA 4RFBA 3OMGA 1VF7A 3O13A 1WIAA 2KMCA 1JJ2A 4HAEA 3BVMA 1U4AA 1OXTA 1V9JA 4C3JB 1FNWA 2KCMA 4GOPB 1GVPA 2GBRA 3OJ3A 3TCAA 2ZJPA 2N0SB 1X3PA 3TIXA 4A3DH 4BY1G 2KCTA 2PJHA 1VF5C 4HTHA 1XPOA 2EYMA 1F77A 4XYQA 2K9XA 2L05A 2K5WA 2WB1E 1Y8RC 4WAFA 3PUXA 1XLNA 4NPNA 2PPBC 3TP8A 3LJ3A 3R93A 4B9XA 3K5MA 2QA4A 3N1ZC 3V62A 4JL9A 1AE2A 1WTXA 3NZ3A 3PZDA 2N1VA 3D3RA 1YD8U 3HUIA 4V190 2KDIA 3LYYA 2B39A 3D6CA 5ELFA 2Y5CA 3NVVA 2RPQA 3DUZA 3Q14C 1A3UA 1EY9A 4HSPA 1EFWA 2FJ2A 3HG9A 3W1YA 1PZID 3SE0A 4X65L 2WHIA 4OO1H 1LFDA 4K5VA 3KW5B 2TMPA 1P9DU 2KECA 3I4LA 4TVAB 5DLQE 3NZUA 5AEKB 1ACCA 3K59A 4C3IH 4EQNA 3MVVA 2MHJA 4HMJA 2F3IA 2CJNA 1LTAD 2Z4IA 3VFKA 2N3SA 3MXPA 2D3BA 3RLNA 2HHHQ 1AWDA 3GP7A 4DHJB 4B9WA 1Z6HA 2K01A 3H0GH 4OZBA 3QHTA 3DEPA 3DMUA 3N52A 3T53B 3U58A 2KMMA 3A33B 2JZPA 3ND8A 3H91A 2RF4A 1EU4A 5JOBA 2QJLA 5FR6A 2JA6B 1J5EQ 1E8YA 4BOZB 4L6TB 4B3SL 2HDEA 4NXNL 1SNCA 4C1NI 3UDXA 5M3MB 1S3SG 3I4NG 2NBUA 4CO7A 4NJ6A 1PH6A 2CFMA 4F87A 1F9RA 2L76A 3S14B 3CRKC 2AMCB 4C3IG 1L0YB 3OIPA 5L37A 2Q2IA 2F0GA 1PH5A 2R92H 3PUZA 4RAUC 2F4VQ 4HJAA 1V81A 2KFJA 4ZHOA 2R6GA 4K7SA 4GIVA 1PRTB 3H0GG 3SHQA 4C4VB 5C1ZA 3OWFA 3H15A 2ZJDA 1LUZA 4IUQA 3PRZA 3ZXRA 1IBKQ 1B44D 4DF7A 3VTWA 1TR5A 2MJ8A 3PF5A 4A3KB 5E4XA 4YXDB 1IL8A 1TGZB 2NTSA 3TJPA 4ZUIA 3C8YA 1HPCA 5G55A 4H44C 4TUUA 1HTLD 2NN6H 1IPGA 1UBQA 2K3UA 3BDOA 5DCNA 2DY7A 1NCVA 4J8QA 2JA7B 1ROEA 3A9KA 4LUOA 4ZUJA 2R92G 4IFDJ 2JXXA 3KUCB 2D07B 2VY3A 4C3JH 4IZ8A 3SHLA 5C4HA 5JJIA 2GRIA 1NNXA 1UBIA 2RPVA 1WTWA 3ML9A 1WOCA 5EKIA 1Y69U 2EYPA 2N8NA 4OGQC 1ZE3D 2KLGA 2UWQA 3QX1A 2E2IB 3R3MA 5HKHA 4HSVA 1MHXA 2EY2A 3T9LA 2ZZPB 3OSOA 4QUCA 2KQ3A 2JQRB 4A3BB 2X38A 3PHXB 3FKIB 5FLMH 5KRUA 3J80i 2E76C 2R7DA 3I70A 4RM8A 1JROA 2NN6G 1H9MA 2EXZA 4HJ5A 3GZNI 3UDIA 4I65A 4FJYA 2E75C 5G5GA 1DOLA 4U673 1F0ZA 1PTOD 4GKKL 1GHKA 3LWUA 3PZ8A 4GNXC 1MSGA 1X3QA 3M95A 4C3JG 1N32Q 3HOVB 4GLAC 2GBJA 3DOWA 3JSVA 1M1KC 2KEEA 2DNFA 1SYCA 2EY5A 3PO2H 2CS4A 1ZEQX 5EE0A 4RWSC 1SSOA 1ZOYB 3NBHA 1YN3A 1S4ZA 1EZ8A 1H9KA 3TL5A 2IDYA 4FULA 3RT3B 2F0NA 2H1EA 3Q8BA 3N6RA 4NPSA 4BKSD 1C7YA 1XYIA 1EWYC 3AEFB 3DWGC 1ZPSA 1HQMC 4PZ7A 2PQEA 1HRJA 1L2NA 4DK6C 1D8LA 1E7PB 1ENAA 3IXSA 1S5FD 1CTMA 3ZVVA 1TS2A 1O78A 4HKQA 2EE1A 2JA6H 3S2AA 2WXQA 1IYFA 1KRSA 4XT3B 1RDPD 3ZQ4A 2D0OA 2I0QA 3OOCA 1C48A 1SYDA 1CZWA 2HD5B 2N7DA 1PRTF 2KOLA 1K8OA 2CJOA 2K50A 3PRMB 1TWHH 4P6VF 1PFNA 1EUJA 5G2NA 4II2B 1GO3E 1QG7A 2Q8RE 4B6WA 2IO2B 3GTOB 4X65Q 4K8IA 2X6LA 3PLVA 2BQQA 2R2OA 3L3OC 4MSMB 1K0RA 2G9DA 3GV6A 5C5LA 2MX2A 3M3YH 3BZKA 3JSVB 3VH4B 5EQ0A 3VYTA 2VUMB 2PE6B 1FGUA 4DKAC 2P5ZX 3PS6A 3ZKJC 1KLUD 5IP9G 3C0RB 2W55A 3CC4A 1STAA 4MGYE 1I35A 1EIHA 4IUUA 2YTYA 2JA6G 1LTLA 2A68D 4X3TA 1AYFA 4HK2A 1PFBA 2FIFA 5M3MG 2UUAL 3BVZA 3QG1A 1AH9A 1TYGB 3N1XC 4B3SQ 4XQJA 4A3EB 2ZVNA 2OEOA 4Z9CB 4NXNQ 5IY0A 3FC4A 1Y1VB 4XIGS 2DAFA 4NNJB 1SN8A 2CHBD 1CMXB 1E8ZA 1NYRA 5BYQA 3ZUNA 5IYCH 5GADC 4ICUA 5LMNW 1I4XA 3AI5A 3T13A 4NY0A 1OQQA 2V3PA 4HDQA 2F1MA 5D14A 4EKUA 1Q82C 2I5MX 2XNAC 1YNXA 4A3KG 1Q5WB 2UYZB 4DR4L 1E3PA 1GUTA 4BBSH 5I9PA 1PFMA 1ASZA 3KWVA 4A3BH 2ZXRA 2QDLA 3FKIH 1E7ZA 4AS1A 1LTTD 2JX5A 2XRQD 5C4ZA 2QW7A 4HPPA 3CCLA 1A70A 4USAA 3TBLD 2KVZA 2JA7G 1Y56A 2ACZB 3CMMB 4JW0A 1NEKB 1PDQA 1U4LA 1UAPA 1SE3A 4NW2A 3NENA 2LHEA 2RKSA 1UD7A 5H1SE 2GBNA 4MGKE 5CC4A 1JMLA 4DR5L 1HQRD 2VZAA 3NK9A 4FXKC 1GHJA 3CU7A 1JE4A 4BBSG 4R8IA 1TTNA 1N34L 4KIKB 4J3OD 2LFNA 1EWHA 4QY7A 4A3BG 5ELEA 1CM9A 3FKIG 5JHAA 1T5XD 1SXTA 4X64L 3RNGC 4RHRA 1DGJA 3GB1A 4P1BC 3EBEA 4GLSC 5I2XA 5EKKA 2WU2B 2INCC 4ZKBB 4HJ7A 1HNZQ 3AB5A 4OWTB 3FDTA 3ZIMA 1WM3A 1WCMH 1TJEA 2Z8LA 3TBIB 4JYAL 1VQBA 3C46A 5TR5A 5BMHA 1SF0A 4L5RC 4PZ6A 5K36H 5BMGA 2BS4B 4LF4L 2M2LA 4HEDA 4GKKQ 4O42A 4CJ1B 3F2BA 3GTOH 1N60A 4BKTA 3GTMB 1EWIA 1D3ZA 1S5CD 5I4DA 1WD1A 1GUOA 1AZQA 2KZRA 1DOYA 4G7HC 1GOZA 4ULLA 1TBEA 3J81i 1JOKA 3DHQA 2OQKA 3GOEA 3KF6A 2VUMH 2B76B 2VZKB 2Z4HA 1E7UA 1LTID 2SEBD 3U4VA 2M56B 1V86A 2K8HA 3DDCB 4JVZA 5JXVA 1WF9A 2J0TD 4ARCA 1N33L 5A2QL 1Y1WB 5CGKA 3J81j 2KHSA 2K4KA 5K36G 1N61A 3ZJYC 5D2MB 3TDQA 4FF3A 2MBHA 3WAPA 4A3EH 2F3WA 4BA2I 3SR1A 2ZW0A 1IKLA 5IP7H 1Y1VH 4H0LC 1TIFA 1Q90A 1K0SA 1IBLL 3KH0A 5KHOA 2F03A 1UELA 1F9SA 1VQIA 2GBKA 1PFDA 2VUMG 3P7JA 3TS2A 1SBBB 4HPLB 1W2BA 1G6ZA 1Y8NB 4F7XA 1PFSA 3MXGA 5M3FB 2KK8A 2PPHA 3RCZA 4KV2A 2KT7A 1H8CA 4RHSA 4PS7A 2KX0A 2QC8A 3IAYA 1DOXA 3KF6B 2IPKD 2W82A 4IUTA 2HTME 4XWWA 3W1GA 5C3XA 1KM7A 1ZXTA 3CPWA 4A3JH 1E5WA 2ALYB 1KL9A 4A3EG 1P8LA 2DX5B 3PT2B 1TT2A 2UUAQ 1Y1VG 1V97A 4FA6A 4YSXB 1LACA 1NTGA 2B2TC 2MJDA 4P7IA 3OHXC 1DXMA 5BR8L 2IY1B 3RPFC 5AUKA 4G3XB 1B3QA 3SDLC 1QUQA 3A4SC 1CQVA 4K5WA 2IX1A 2IBIB 3DWPA 1VDZA 5EKLA 3K7UC 1QOHA 2D11A 2RDGA 3VTUA 2F0OA 3Q8EA 2QIEB 4HIKA 2EXDA 1VQ5A 2KN5A 4F8MA 3QAQA 4REZA 1L1OA 3FP9A 3CQZB 3D8GA 2DWQA 2JWUA 3P1HA 4APVA 3R7QA 4S3SA 3VYRA 1JWMD 4M1UB 2DAJA 5J18A 5C4JB 4P71A 2F0MA 4K2LA 4ITKA 5IOCA 1KD1C 1VZ8A 2FCQA 2I2YA 2O6VA 3QOJA 2DGYA 2CW0C 3PHWB 2PMZB 3PIP3 3U7ZA 3J7AV 4TQ0A 1Z2MA 4YY3L 3KYHC 4DR5Q 4DV1L 4S0RA 3UE0A 2N49A 4YHHL 1CJEA 2K6QA 1X6OA 3RR5A 3RZDB 3AE1B 3GV3A 1N34Q 2EKIA 1FNUA 3KLSA 1C0AA 3UE1A 1EQQA 1TKGA 4RH6A 1FFUA 3VR5A 4CBVA 1QUQB 4X64Q 1D5XC 1Q1BA 2G45B 4JOIC 3MA2B 2C7NB 3T3OA 3TP5A 2R7ZB 1CK1A 5C4XH 1Y1WH 1KNAA 2R3ZA 4R9WA 1PXUA 3ZXVA 4OL7A 3DVNV 4XWTA 3E0EA 4F88A 3VRAB 4FHKA 1Q3LA 1DCZA 1A0IA 4GLXA 4JYAQ 3D32A 3M3JA 1NI2A 1L1OB 2EJMA 3BDCA 1NYQA 4WH4A 1O7YA 3QB3A 1VR9A 2WNMA 5IGEA 1MJCA 4LF4Q 1K3BC 2OJRA 1F9JA 4GS3A 4IOAA 3ZRFA 1JWSD 1IL2A 1B9RA 4G7OC 3ZDMC 5CHFA 1YQ4B 3B6YA 1VQCA 3H8HA 2EYFA 3DHHC 2GN5A 1CQFA 4K0KQ 3KJOA 4RNAA 1KNEA 2WXHA 3TS0A 1WRIA 2LGYA 2PVOD 2R61A 5DEHA 4GOPC 1Y1WG 1CZGA 4Q0FA 1D7QA 2LXCA 4JX1C 1WTOA 1N33Q 3NTIA 3VUXA 3AQQA 3Q22A 3DBHB 1YHQA 1VQKA 3SFDB 1A62A 3KF8A 2BS3B 2O4XA 1E90A 1L0WA 1ML0D 3T56B 3DBRI 3EECA 1FXIA 1WR6E 1EOVA 2AQ1B 5C3EB 2UXBL 1J6QA 1Q10A 2L32A 1RFKA 5BYSA 4H7BA 4ZAIA 4W9FA 5M3FG 2WYQA 5GMVA 4XZ4A 3Q8DA 3P20A 1E1TA 5LL6S 4LF5L 5IKCM 2ZXOA 1OXUA 4GKJQ 1FNVA 1XQQA 4I6LB 4XXEA 1DOKA 4B3TQ 3CCUA 1U4RA 4QUFA 2FMCA 3I4MB 4K1RB 4A8XC 3DBLI 1WJJA 1CT1D 3AH7A 4DV6L 1X9NA 3HOYB 3I2ZA 1EL0A 3NZSA 1JWAD 1S5DD 5JJLA 3ZW3A 4ME3A 4QIWE 3AB9A 4DV4L 4K81A 1CKOA 1RAXA 5C0XG 3VVWB 4KI0A 3Q69A 3I63C 2KHWB 1IYVA 5C4JH 4K7UA 2XIWA 2Q8IB 1ZXHA 3V3XA 1FRRA 1XWEA 2YEPB 5BN4A 2XK5B 1X65A 4KZ0A 3K6OA 4A3OA 2BKRB 5EE9A 1R9TH 3R7RA 1PH4A 3KF8B 5BR8Q 1TY0A 1WH3A 4UP8A 1JJCB 1HUMA 2A5UA 2CHWA 4RA8A 4KHZA 1YNNC 4MGZE 1YI2A 4OZCA 3BS1A 4FLHA 3GTLH 3GTPB 3W2DA 3A55A 4YT0B 4G11A 3V61A 3TEWA 1WE7A 3K5NA 5T8IA 5LXHA 1CSQA 3RD4A 1NVID 3HRDD 5KNCA 4WFN3 4PG3A 2HUGA 3S9WA 2GI9A 2JN4A 2WKCA 2KUMA 3AEBB 2I1KA 2WXKA 3GTJH 2N9EB 4LF7Q 2HIVA 1PRTC 1UE1A 1NJIC 5AFWA 2A4ZA 1YHAA 2AQ3B 2HQLA 3FVQA 4OIJA 4OEMB 4OVUA 4IWOA 2HQEA 5G3LF 5IGBA 3P75A 1YX5B 4X57B 1I42A 1VRAB 4G4KA 3U50C 2HCCA 2PIAA 3K8AA 3KJPA 1O7ZA 1AARA 1IW7D 1WM2A 1JOOA 3L9AX 4OZAA 4YTPB 2XTIA 2NB0A 2B2YC 3UI3A 1KHIA 4ACFA 2VH1A 1K52A 4YY3Q 5AZFA 3K5LA 4DV1Q 2EMTA 5M5WH 3MXUA 1EEID 4YHHQ 2A69D 1E7VA 1P3QU 3P42A 4EZLA 1OEYA 4KV6A 3I3CA 1X56A 2DY8A 1VQ7A 2R7ZG 2WAQB 4WJWA 1WXAA 1SFOB 1EUVB 3L08A 2JE6I 2DZMA 4PYUA 2KN4A 4TMAB 5H92C 3BZCA 2E2DC 1XO3A 2EY6A 5ELBA 1EOTA 2BW2A 4KKIA 1Q86C 3V6CB 1I4PA 4B0MA 5ELOA 4J6HA 4IJLA 4L23A 3ABVB 5ELNA 1HTPA 2DYOA 3ML8A 3ZJVA 1ZW7A 3EFXD 1T5EA 3RZOB 1VQOA 1S72A 2VB3X 3TMEA 1L5PA 3K7AH 1PUTA 5C3EH 3VUYA 3MTSA 1ZYRC 2PKOA 5FKAC 4RM9A 1I50B 5KNBA 4KD4A 3UIPB 1WMHB 2KO3A 4LW1A 3V60A 2MRPA 1YHBA 1EY8A 5CV5A 1R4QB 2RHSB 4WJNA 5AUIA 4EOYA 1MBYA 1F2RC 2GBMA 3X23A 2IT1A 2YU9H 1Z9FA 1TQOA 1L6VA 2AQ2B 2ZT9C 2ZCBA 2PQAB 4PNYA 3AEVA 4B08A 4FF1A 2Q8TA 1R4NI 2CU3A 2WXLA 5J2RA 3DPDA 1VQJA 2ICEC 2DN8A 3UINB 2VNUD 2L8JA 4WJ4A 3P63A 1IBML 1BMLC 5C3EG 1LABA 4J15A 3X3MA 3NPPA 3G71A 3A7LA 3CD6A 3NG0A 1JORA 2CWAA 4A6QA 1B8AA 1L0VB 4RF0A 2BOSA 4R4OA 2UXBQ 2L0CA 1U4MA 3CCQA 2K7VA 1OXSC 1X3EA 2VW9A 4KY7A 1RRBA 3I4MG 4LF5Q 1WGYA 1WJ4A 3GTPH 4BBRB 3HVDA 4HJKA 1L6UA 4GZYC 4DV2L 4FF2A 3ND9A 2DLBA 3HOYG 5GAGC 3WA0A 2FMMA 4LFBL 2MPMA 3C1EA 4GSWA 2Z9HA 2Y0SB 4GOPA 3CF6E 4YSYB 1BCPD 4HIMA 3NS8A 4DV6Q 1K28A 1SB3C 1BVSA 1CHQD 1UNSA 2KA7A 3BJUA 3BWUD 3VDZA 1FO4A 2PYKA 1WFQA 3AU7A 1EYGA 2A6ED 3UI2A 4DV4Q 4NXML 3VYUA 1TWFB 4HCPB 4DDGD 1FYCA 2MCNB 4IUVA 4W9GA 1WJNA 1U9RA 1P1AA 4CHTB 1EF5A 2IGDA 4CDEC 3RNAC 1F2MA 1SE8A 3I56A 2PE9A 4S17A 2BVCA 4XYCA 3STBD 1VQ8A 3RUIB 1LYLA 1ZP0B 1ILQA 3ZGZA 2C5LC 2DZIA 2WDVB 1QLBB 4G0NB 2RSNA 3EJIA 2QDFA 1ICFB 1WZ0A 3V96A 3CF5A 4OO1I 1OO9B 3NTKA 2J7ZA 5JPNC 1PGBA 1NUCA 3VXWA 2BF8B 4DHZB 3TQYA 4LF6L 2MJ3A 3AU5A 1MVKA 2GLSA 1QWYA 1V80A 3DVGX 4JIOU 4WURA 2LMCA 4AP4C 1G2SA 4M01A 4HCSA 3NOBA 3RNCC 2CWPA 2PI2E 1K83B 2WGSA 2BTEA 3ONAB 3AE9B 4RMFA 3S1MB 4FBJB 5IP4D 1FIQA 1NE3A 1V1PA 4JI2Q 1C77A 2MWSB 1TWCB 1SROA 3VA5A 3U9SA 1IYUA 4FADA 1NAPA 4FP5D 1O7LA 2GOWA 1IP9A 4NMZA 2K22A 2UU7A 1LTSD 1SJHD 1YZ6A 1KRHA 2QSDA 2N88A 4JK1C 3TP7A 2WAQG 4BBNC 2WXOA 4ZDVA 1HXYD 2OHFA 2WB1B 5E1FA 3U30A 1D5ZC 1KLVA 1DGSA 4WJ3M 4J1MA 2ON8A 3I57A 2KYWA 2Z1CA 2DHZA 2CQAA 4CJ2C 1QOGA 5KHQA 1K8MA 4GU2A 4A3PA 1LO5D 5I2YA 4A90A 3KUZA 3CW2C 1RF2D 1CKNB 3K81C 4EVOA 3I4NH 1NDDA 4P73A 3HK0A 1GAQB 3ULLA 3AEGB 2DJGC 2V4IB 1MGSA 2LMCB 2J0KA 4N6EB 3VHTC 1BBWA 2L11A 3S2DB 1WE6A 3DHGC 2LZ6A 1WTPA 2V3NA 1UWVA 3NWTA 5EJWA 1KFYB 1V1PB 2B2YA 2E2HH 4IUMB 4FXGC 1CA5A 1L7YA 4R3DA 4JI3L 1SGHA 1L4ZB 1KRTA 3WAMA 1VDVA
chains in the Genus database with same CATH topology
4RKBA 3R2TA 3W9CB 1M4VA 1V8CA 3U2SC 2IW3A 4A3GB 4HKZE 1PTOB 2A6HD 4FO2A 1CA6A 3HOUB 1ET6A 1Y8PB 1HFNA 2NBFA 3NP8A 4ZK9B 5I9OA 1WXQA 2HDLA 3AE3B 4E6IA 3D6WA 4DAYA 4BA1I 1EWCA 2EYLA 1SNDA 2LS01 2JEAI 2EPBA 3A56A 3S17B 3SK8A 1T6BX 4KD3A 1J7CA 2GB1A 1PZKD 3IT4B 3P4QB 2JXMB 3IKJA 5ISRA 2M19A 3K58A 2B2WA 4V0BA 1FD7D 3AEEB 3G7LA 2XWJB 5KGUA 4IFDI 1PDXA 4KY5A 3NVYA 1QOFA 2NVTB 1WVLA 2BDNA 4A3MB 1JWUD 5TSSA 5CBEE 2DNEA 1IHZA 2YYZA 4ZRQA 4A3IB 5HHDG 4LTUA 2PMVA 3T51B 5JVH3 4ARIA 2BE5D 1B2TA 3TSSA 1QE6A 4HN7A 1AW7A 5M5YB 1U4PA 2F0TA 3DEOA 1N62A 1YMHE 2BS2B 1PTOF 1OQRA 1XCQL 4US8A 4FF4A 1RM6C 1LT5D 5COYA 3HS0C 4IKGA 2IX0A 1GPXA 3JAME 2L55A 1G91A 4XDCA 2KVMA 3KWLA 3FILA 2D9UA 1DM0B 2NVQB 1B3AA 4YWGG 2NVYB 1WSPA 1PMRA 1ESFA 2RDHA 1QF6A 4JWUC 2LY7A 5IT9E 2WXIA 2WP9B 3MZ5A 1JW9D 2F0LA 3CHBD 3FPPA 3I8ZA 2QKIC 4HMIA 3T3NA 3IFDA 1MI2A 4XQQA 3R3OA 2WQYB 4XDXA 1B50A 1DONA 2D5DA 4KK7A 3CWIA 3W1SA 3FILB 3D4RA 3SXHA 3IT6B 5BN3A 4Y7NB 3SK6A 1ET9A 3AE7B 4Q2JA 3J81E 5CV7A 4G7ZC 4HEA1 1PYWD 2A5HA 3MFGA 3QJYA 1YQ3B 3TUOA 2XN9C 2JYEA 4RGTA 3EVQA 3NSWA 2FBWB 3H3VC 2B2UA 4QCLA 4DFAA 1P7EA 5IGFA 2K5DA 4DXGA 2MP1A 3NE5B 2K33A 4PMBA 4BWGB 5J22A 3MJ5A 5C3WA 2OT2A 3DWAA 4DAVA 1EU3A 5EBDA 3AMZA 3ETRA 1EY7A 1B9MA 3EQLC 2MUYA 1BQQT 1K50A 4IUPA 4N9PA 3AECB 3LB8C 3HRZC 1MPEA 5HURA 3TEYA 1N5XA 5CR3A 2WINB 4U68A 3BVGA 2ZW1A 2K05A 2KCNA 3GS2A 3WCQA 2K1BA 1EFID 4ZYSA 1SNOA 1E2WA 2RVLA 3M85A 4LAAA 5IODA 3A8JE 1DOIA 3I9V1 4GDKB 3PUWA 5FLXL 2RA4A 4KGTA 5LHY1 4XTCS 1MD2D 3GTQB 3W5UB 3NTHA 4XT1B 4K6DA 4DGZA 2JA8B 3MHBA 4EQOA 4QF4A 4KN4C 3ZJTA 1XCTL 4KKJA 1NR4A 3BK1A 4P16A 2IWHA 4FXDA 2BB6A 1EYCA 1KLGD 1W6JA 1C79A 3U52E 4ZOHC 5FO9B 4HRSA 2FUG1 1H9SB 2NMQA 3VR9B 3KK7A 1VZ7A 1GUGA 2A6EC 1JRPA 1Z7TA 2SOBA 5EGTA 3VR3A 2GA4B 2K6AA 5CMDA 4CKBA 2SAKA 5J39A 1L4DB 4KMUC 4B0EA 5BMIA 1SMYC 3D4WA 5T1IA 2WXNA 3V2TA 1YN5A 3AE6B 3B2GA 5BYRA 1G8ZD 4KTAA 2SNMA 2EJFC 4PQXA 4YIJA 1TWGB 4MN3A 2JA5B 2QEJC 5NUCA 4AQ7A 3NHHA 2L4NA 4KKUA 1E2VA 4ZLTF 1AP0A 2VZKD 3OW7A 3SVMA 3WDNA 2KDMA 5EPKA 1BXTA 4IUNA 4BS9A 3S1NB 1HZ5A 3BYYB 5C0XJ 5JEAH 5LNK1 3SK4A 2FFKB 3AEAB 1I4GA 2AWNA 1MI0A 2BA1A 4ABNA 3CRLC 2KEDA 5EE3A 3C1FA 1XLPA 1Q12A 1DZ1A 2WDQB 4NP5A 5E3FA 3TP6A 1ILPA 3S1RB 3G6JB 2KWDA 2OF1A 3M7GA 2K28A 2NWGA 4MACA 2PCFB 1IGDA 4AYBB 3CKIB 4RGMA 5JEAG 1Z47A 4I7ZC 4CKEA 3SR6A 2EYJA 2LFIA 3BIID 1D6EC 1VCIA 4ID6A 3HOWB 1DOMA 3EROA 4OIKA 4C3HB 1EY6A 5EE1A 2J53A 1I4HA 1UWXA 3KQ4A 2PO4A 1GB4A 4K14A 1ICWA 1G2TA 5A35A 3HVZA 2PW5A 5C0XH 1RJTA 3NRZA 1STNA 3IL8A 2R93B 5BN5A 1CZPA 3U4EG 2FINB 1BUIC 3HP3A 3MWYW 1RTOA 4PMWA 1V8QA 3GTGB 4TQUS 3M7NA 1QCBD 1UGJA 1EY0A 2F0IA 1JB3A 2X6GA 5DM63 2WS3B 2AUJD 3MAQA 4BY7B 3J7YW 3NS1A 2WU5B 1TZOA 4ZRZA 2DBYA 3BK2A 5MPOA 3TEZA 4XE0A 1PTOC 2XWBB 3S15B 2F0EA 1FXAA 2X69A 1A2UA 3U9OA 2MEKA 1YNJD 4M0WA 1STBA 4DAPA 4XQNA 3E0JA 3KBXA 4ZRPA 2EY1A 4G57A 3L7ZC 2PTLA 3BYTB 1Q1EA 5G3LD 1AZPA 5M9OA 4WORA 3HOZB 3OWEB 2LEKA 5CV6A 4X3UA 4RCOA 4NAWB 2NTTA 1QT9A 3JAML 1LTRD 4C1NK 3M4YA 2LKVA 4IDIA 3TZUA 3K0YA 4KX6B 1YJIA 2L12A 4X3KA 1A2TA 5LL6X 1BO0A 3KBGA 2MGSA 2WXMA 2F0QA 1BCPB 2H4OA 4C7ZA 2WXFA 2QILA 1FR3A 2IX3A 2WV6D 2WXPA 4RKLA 4GDLB 2QCPX 2F0SA 5IT9L 1EEFD 2A68C 3GTKB 5G5HA 3P1MA 2M9VA 3H6MA 4C3HG 2RSOA 3BDLA 4CJ0B 1M8AA 2MHVA 3I72A 1B9NA 4MIUA 2YEPF 4FNFA 4A3DB 1C4QA 5E4WC 4A3FB 2B2WC 2D62A 5C2TB 4IURA 3J81L 2I07B 4N9TA 3FPUB 5DAUA 2LUMA 1S5ED 3LXFA 4HROA 2JU6X 1F2ZA 2D2CC 4FXCA 2RDFA 3K57A 3DM1A 2M00A 3BZDB 1LT6D 5ELCA 2O5IC 2L52A 3N9YC 2E74C 3Q0AA 1W6KA 4DNRB 3R2IA 1FCLA 2IGHA 4JBWA 1HCZA 2WXRA 4KKTA 2EELA 1KDCA 2PZTA 1EM7A 4L8JA 4ZQ3A 1BCPF 4DNTB 2W3RA 1D1IA 1F9PA 3P4RB 4RGOS 2JSOA 2XSCA 3MEHA 1EYAA 5FO8B 1FMAD 1TU2B 4XYOA 1R7SA 2JP1A 2LGIA 2ENBA 3PUYA 5IIFA 4WIPA 3TEXA 3TZDA 1T3QA 4TSSA 1SNQA 1JOQA 1WWTA 4L1BA 1NR2A 2PVGC 3WOFA 2JSVX 3IAM1 1TS3A 4DK0A 2RBMA 1QNUA 1TKWB 2K04A 3DWQA 4RGNA 2EJGC 4WRDA 1XLOA 1KTKA 2EOTA 4LJZC 3C3LA 2N7JA 2WACA 2VB2X 1ENCA 1DYQA 2F0WA 2F0HA 2QF7A 2W3SA 3IAS1 4UAIA 3EA6A 3GD7A 2F0UA 4DXFA 4IN3A 5KIXA 3EUB2 4NDXA 4KN7C 1WTVA 3HEJA 1HUNA 5D3IB 4QMGA 3RLFA 2CW0D 3HOXB 2J42A 1B4OA 2I46A 2NN6I 4MH8A 1EQTA 1HEZE 3PO2B 3Q6SA 3ZYYX 4ZKCB 4O1NA 2B2UC 1C4CA 3AMUA 4TKOB 2JYTA 2ZXPA 5FR3A 3J80E 2F0KA 4KY6A 4LMQD 2J52A 1SIJA 1J7AA 1TY2A 5KYIA 2B2VA 2QMTA 1GUWA 2NZ1D 1JICA 3MC0B 1IBXA 5C44B 4OO1G 4N59A 1EY4A 2BDOA 1QKZA 1TWHB 2L1BA 1TVXA 3PO3B 3M4OB 2CVRA 3A7AB 5I6WA 1BNZA 1C78A 1VZ6A 3P4SB 4YTMB 3H09A 4JWSC 1D5MC 3M3YB 4C7YA 1C9FA 2BCOA 1I7HA 1JALA 1STEA 3D4DA 1K53A 3J7AF 3FAHA 2V0GA 1J9OA 3Q8CA 2OEDA 5CORA 1AFPA 3B2FA 3AE5B 1I3QB 3E56A 1I4RA 2DYMA 4K8JA 2ONQA 4NZLB 1CI3M 1ZKOA 3B9JA 1IBXB 3R8BA 1QNKA 2ICIA 1RODA 3MXNA 1IUEA 1CFMA 4UDUC 3NBIA 1LTBD 4BBSB 1VLBA 4ILWA 1XEEA 3OIQA 1B1ZA 4PT5A 2PLPA 4ODGA 2F0DA 1YNND 2FHTA 4JPSA 2EDGA 1P7FA 2K5PA 5EPLA 2WDRB 2PW7A 1HFGA 5FO7B 2Y5PA 1FGBD 1XX8A 5HFYA 1PRTD 3Q24A 1STGA 2F0PA 1PTOH 3K5OA 1UWMA 1PZJD 5I6YA 2V4DA 1FFVA 2KCCA 3W5VB 4KGSA 2INNE 1WCMB 3NQTA 4IFDH 1SJED 1STYA 3OMCA 1E10A 2EYHA 2XVSA 4US9A 1F2RI 2OXPA 3NVWA 5D7GA 5K5PA 1R4PB 4OW0A 1II3A 4TQ1A 4RCNA 1F2YA 4A93B 1BF4A 4EQPA 2WXJA 5HG2A 3T16A 1CHPD 2KJXA 2XRSD 1ZYRD 1YNJC 4IFDG 1GB1A 4DA2A 5IGGA 1FD6A 2Q5WD 4DN4M 5ELDA 4K5XA 4TRDA 3AE4B 4H2AA 1EIGA 3SK5A 2NVXB 3QO2A 2K5QA 5HI1A 2N9KA 1IW7C 4HCEA 1GUNA 3Q8AA 4H13C 4A9AA 4CQNA 3LNNA 1QOAA 5JAVA 5JVG3 2A69C 1BDOA 5C3JB 4IQZA 3AV8A 4N58A 3W3AA 1QOBA 1E9MA 2KQ4X 2L1AA 1EYDA 4L63B 5KNDA 1I4QA 1GXDC 4A3JB 2WP8J 3L4PA 5CBAE 4WWMA 1LV9A 3D31A 5DNFA 2IL8A 3URYA 3PO0A 1VJKA 5DM73 3AEDB 1LT4D 2BA0A 1E0BA 1D2BA 4PMCA 1Y8OB 3A8IE 1I6VC 1XXGA 1JCKB 2F0JA 5IGCA 3FMCA 1FEHA 1F2LA 3V05A 1OXXK 1SYFA 1QILA 1OFFA 2AX5A 1H9SA 2SNSA 2AUKA 3FRPB 1D4BA 1RD9D 1UUPA 1B53A 5H8YE 1WTRA 4EE2A 3RFZB 2LJIA 3IFTA 1TWAB 2H88B 1ONLA 2F3VA 1C4AA 3Q8FA 2JEBI 4FVMA 2M0AA 1UEAB 3HKZB 1TKYA 2G9HD 3OPOA 4MM3B 3F2UA 4CKCA 1BCPC 5C4XB 5JEAJ 1L0XB 3NUHB 1QB5D 2C9OA 1WTQA 1JQYD 3PMFA 3ITPA 1QQRA 2I38A 3X3NA 4IOIE 2EYOA 1LTGD 1RYJA 1S5BD 1SE4A 3PV0A 2J4XA 2L9HA 3NXWA 1XLQA 5CV8A 4NJCA 1VMPA 3A8KE 1GUSA 1E2ZA 1A3TA 4ME5A 4LK1C 3VA7A 1FRDA 3E5SA 2BT6A 5CV9A 2NYZD 3A54A 1LT3D 1SYBA 2E6XA 1IGCA 4OVZA 3I91A 2E2JB 2MH7A 1VMCA 1OXVA 2WLBA 2QDBA 3CIRB 2L83A 1C8CA 3P4PB 1TS4A 2BYTA 1BR9A 1BOSA 4EGVA 1HHVA 3DWMA 5M5XB 3HZXA 3AE8B 5CYUA 2F0VA 1Q8IA 2E3TA 1F9QA 1SE2A 3PIO3 1ZXIA 4K6LA 1WGKA 4LK0M 3C2PA 5C0XI 1QJOA 4HR7B 3VQIA 4ZHPA 3GO5A 2KAJA 1MHHE 1J7BA 3FEWX 2HCIA 3GQBA 4MT5A 2HDMA 1R9TB 1N63A 1SNPA 3GTLB 1RWSA 3I90A 1K51A 5EBCA 4M8AA 2PZWA 2O2LD 1O80A 3GTJB 2F4IA 3LX0A 3J80L 3ERQA 3EGRA 1KDAA 2A6HC 1GJXA 4K2KA 1V43A 3S1QB 5D65A 1YN4A 4XDDA 1G291 3AE2B 1JR0D 2ID0A 2K03A 2MJEA 1YNTE 1J8IA 4RF1A 5M5WB 1RTNA 1XTCD 2INPE 4A55A 1RCVD 1H9RA 1EZ6A 1H9JA 1NI3A 3I73A 4IALA 4KJOA 2JYOA 5C5MA 4R8NA 3MP9A 1PGXA 4YSZB 1V1OA 3KLSX 3PUVA 3AN1A 3E9SA 2KACA 4L2YA 3K7AB 5CV4A 1TKEA 5D3DA 3VRBB 4P2CB 4X3SA 5KEEA 5FOBB 1YJJA 4FYDA 2Y3AA 4HJGE 5C6AA 1SEBD 4QIWB 2A74C 2YU9B 4LLGM 3KUPA 3QOLA 2IJ0A 1X32A 5KYLA 2NUCA 4Q5VA 2F0FA 1WD0A 1ZUD2 1TS5A 2PNRC 1PGAA 1PLFA 3VR4A 2LHDA 3BG3A 1BBXC 3SDZA 3RMHA 3AM9A 2IGGA 2BE5C 2C5CA 2EZVA 2FE8A 1A6XA 2K0PA 4KJNA 3S2HB 5J1ZA 2WIIB 3PZ7A 2G1EA 2O5JC 3DXJC 1A15A 1IKMA 1C76A 1I6HB 3VR6A 5GXGB 2EVBA 1BUVT 4WQMA 5F2DA 4C2MB 4KGRA 1FCCC 1ENFA 3KLRA 3NVZA 4NKLA 4KKSA 1XF5L 2L5TA 2H89B 3WOEA 3VYSA 2JXTA 3QWNA 3SEBA 1N5WA 2N9LA 1TIID 2B2TA 2WXGA 4NAMA 4BY1B 1D1KA 2B2VC 1EQVA 3ZJUA 2BB5A 4DK1A 5IGDA 2RMMA 1RKNA 1SSNA 1WYGA 4DU9A 1AN8A 1HA5A 1DJRD 2RQXA 5E6JA 4PV1C 2N55A 2WKDA 3H94A 2K32A 1DD2A 4QB4A 3TN2A 1FM0D 1A3VA 1ESRA 5EPJA 5T1GA 3RUZA 1LLRD 4CGYB 1NSNS 2B8FA 1C4PA 4JE3B 4YTNB 1KH0A 3VR2A 4OHJA 3SFEB 1ZDXA 2A73B 2DNCA 2PW9A 3NQIA 3E6ZX 3HGBA 3J9CA 5FK9C 3I4NB 3NUCA 2PZUA 1SNMA 2D5GA 3Q23A 5FLXE 4C3IB 2W54A 1JC7A 5A2QE 1KF6B 1KDBA 1E0ZA 3H0GB 1ZDVA 5JJZA 2E2HB 2TSSA 1SYEA 2B8GA 2BBCA 1JWBD 2VXWA 5HGTA 3MFYA 3T4AC 3VR8B 4MHEA 1KABA 3LWEA 1HZ6A 1NENB 5JPMC 1SDFA 2R92B 4C56C 3MHZA 4C80A 1RHPA 1HA6A 3NWSA 2AWOA 1EY5A 2B63B 1E6EB 1SMYD 1MSHA 1AEXA 1KAAA 2SDFA 4KHVA 1SAPA 3S16B 3QIAA 1SYGA 4D2KA 1STHA 4RFBA 3OMGA 1VF7A 3O13A 4HAEA 3BVMA 1OXTA 4C3JB 1FNWA 2N0SB 1X3PA 1VF5C 4HTHA 2EYMA 1F77A 4XYQA 2K9XA 4WAFA 2K5WA 3PUXA 1XLNA 2PPBC 3TP8A 3R93A 4B9XA 3K5MA 1WTXA 3NZ3A 3D3RA 3HUIA 4V190 3LYYA 2B39A 3D6CA 5ELFA 2Y5CA 3NVVA 3DUZA 1A3UA 1EY9A 4HSPA 2FJ2A 3HG9A 1PZID 3SE0A 4OO1H 4K5VA 2TMPA 2KECA 3I4LA 1ACCA 3K59A 4EQNA 3MVVA 4HMJA 2CJNA 1LTAD 2Z4IA 3MXPA 1AWDA 3GP7A 4B9WA 1Z6HA 2K01A 4OZBA 3DEPA 3DMUA 3N52A 3T53B 2KMMA 2JZPA 3ND8A 3H91A 5JOBA 1EU4A 2QJLA 2JA6B 4L6TB 2HDEA 1SNCA 4C1NI 5M3MB 4F87A 1F9RA 3S14B 3CRKC 4C3IG 1L0YB 3OIPA 2F0GA 3PUZA 4RAUC 4ZHOA 2R6GA 1PRTB 3OWFA 4IUQA 1B44D 4DF7A 1TR5A 2MJ8A 4A3KB 5E4XA 4YXDB 1IL8A 2NTSA 4ZUIA 3C8YA 1HPCA 4H44C 1HTLD 2NN6H 2K3UA 3BDOA 2DY7A 1NCVA 4J8QA 2JA7B 1ROEA 4ZUJA 4IFDJ 4IZ8A 3SHLA 5C4HA 2GRIA 2RPVA 1WTWA 5EKIA 1Y69U 2EYPA 4OGQC 1ZE3D 2E2IB 4HSVA 1MHXA 2EY2A 3OSOA 4QUCA 2KQ3A 2JQRB 4A3BB 2X38A 3FKIB 5KRUA 2E76C 3I70A 1JROA 2NN6G 1H9MA 2EXZA 4I65A 5G5GA 2E75C 1DOLA 4U673 1F0ZA 1PTOD 1GHKA 3LWUA 3PZ8A 1MSGA 1X3QA 4C3JG 3HOVB 2KEEA 1SYCA 2EY5A 5EE0A 1ZEQX 4RWSC 1SSOA 1ZOYB 3NBHA 1YN3A 1S4ZA 1EZ8A 1H9KA 2IDYA 2F0NA 2H1EA 3Q8BA 3N6RA 1XYIA 1EWYC 3AEFB 3DWGC 1ZPSA 1HQMC 1HRJA 2PQEA 1E7PB 1ENAA 3IXSA 1S5FD 1CTMA 1TS2A 1O78A 4HKQA 2EE1A 2WXQA 4XT3B 1RDPD 3ZQ4A 3OOCA 1C48A 1SYDA 1CZWA 1PRTF 2KOLA 1K8OA 2CJOA 4P6VF 1PFNA 2Q8RE 1QG7A 3GTOB 4K8IA 2X6LA 3L3OC 2G9DA 3GV6A 5C5LA 5EQ0A 3VYTA 2VUMB 1KLUD 2W55A 1STAA 1EIHA 4IUUA 2A68D 4X3TA 1AYFA 1PFBA 3BVZA 3QG1A 1TYGB 4XQJA 4A3EB 2OEOA 4Z9CB 3FC4A 1Y1VB 4XIGS 2CHBD 5BYQA 1NYRA 1I4XA 3T13A 1OQQA 2V3PA 2F1MA 5D14A 2XNAC 1GUTA 5I9PA 1PFMA 3KWVA 2ZXRA 4AS1A 1LTTD 2JX5A 2XRQD 5C4ZA 1A70A 4USAA 1Y56A 2ACZB 1NEKB 1PDQA 1U4LA 1UAPA 1SE3A 4NW2A 2LHEA 2RKSA 5CC4A 1JMLA 1HQRD 3NK9A 4FXKC 1GHJA 3CU7A 1JE4A 4R8IA 4J3OD 2LFNA 1EWHA 5ELEA 1CM9A 1T5XD 1SXTA 4RHRA 1DGJA 3GB1A 4GLSC 5I2XA 5EKKA 2WU2B 4ZKBB 3AB5A 3FDTA 1TJEA 2Z8LA 3TBIB 3C46A 5BMHA 1SF0A 5K36H 5BMGA 2BS4B 2M2LA 4HEDA 4O42A 4CJ1B 1N60A 3GTMB 1S5CD 5I4DA 1WD1A 1GUOA 1AZQA 1DOYA 4G7HC 1GOZA 4ULLA 1JOKA 3DHQA 2B76B 2VZKB 2Z4HA 1LTID 2SEBD 2M56B 5JXVA 4ARCA 2J0TD 5A2QL 1Y1WB 5CGKA 2KHSA 5K36G 1N61A 3TDQA 4FF3A 2F3WA 4BA2I 3SR1A 2ZW0A 1IKLA 4H0LC 1Q90A 2F03A 1F9SA 1PFDA 3P7JA 1SBBB 1G6ZA 1Y8NB 4F7XA 3MXGA 5M3FB 4RHSA 3IAYA 1DOXA 2IPKD 2W82A 4IUTA 2HTME 4XWWA 5C3XA 1ZXTA 1TT2A 1V97A 4YSXB 1LACA 2B2TC 2MJDA 3OHXC 1DXMA 3RPFC 5AUKA 1CQVA 4K5WA 2IX1A 3DWPA 1VDZA 5EKLA 1QOHA 2RDGA 2F0OA 3Q8EA 2QIEB 4F8MA 4REZA 3CQZB 3D8GA 2DWQA 2JWUA 3P1HA 4S3SA 3VYRA 1JWMD 4M1UB 5C4JB 2F0MA 4K2LA 4ITKA 5IOCA 1VZ8A 2I2YA 3QOJA 2CW0C 3U7ZA 2PMZB 3PIP3 4TQ0A 3J7AV 1CJEA 3RZDB 3AE1B 3GV3A 2EKIA 1FNUA 3KLSA 1TKGA 4RH6A 1FFUA 3VR5A 4CBVA 1D5XC 1Q1BA 3MA2B 3T3OA 3TP5A 2R7ZB 1CK1A 1KNAA 2R3ZA 4R9WA 1PXUA 4OL7A 4XWTA 4F88A 3VRAB 1Q3LA 1DCZA 4WH4A 1NYQA 2EJMA 3BDCA 1O7YA 3QB3A 1VR9A 2WNMA 5IGEA 1JWSD 1B9RA 4G7OC 1YQ4B 3H8HA 2EYFA 1CQFA 4RNAA 1KNEA 2WXHA 1WRIA 2PVOD 2R61A 5DEHA 1CZGA 4Q0FA 4JX1C 1WTOA 3NTIA 3Q22A 3SFDB 3KF8A 2BS3B 2O4XA 1ML0D 3T56B 1FXIA 2AQ1B 5C3EB 1Q10A 2L32A 1RFKA 5BYSA 4H7BA 4ZAIA 3P20A 5LL6S 2ZXOA 1OXUA 1FNVA 4XXEA 1DOKA 1U4RA 4QUFA 2FMCA 3I4MB 4A8XC 1CT1D 3AH7A 3HOYB 1EL0A 1JWAD 1S5DD 3AB9A 5C0XG 4KI0A 3Q69A 1IYVA 2XIWA 2Q8IB 1ZXHA 3V3XA 1FRRA 1XWEA 2YEPB 5BN4A 3K6OA 5EE9A 1TY0A 1HUMA 4RA8A 4KHZA 1YNNC 4OZCA 3BS1A 3GTPB 3W2DA 3A55A 4YT0B 3TEWA 5T8IA 3K5NA 1NVID 3RD4A 3HRDD 5KNCA 4WFN3 2HUGA 3S9WA 2GI9A 2WKCA 2KUMA 3AEBB 2WXKA 1PRTC 5AFWA 2AQ3B 3FVQA 4OIJA 2HQEA 5IGBA 5G3LF 3P75A 1VRAB 4G4KA 2HCCA 2PIAA 1O7ZA 1IW7D 1JOOA 3L9AX 4OZAA 4YTPB 2NB0A 2B2YC 3UI3A 1K52A 3K5LA 3MXUA 1EEID 3P42A 2A69D 4KV6A 3I3CA 2DY8A 2WAQB 4WJWA 1SFOB 2JE6I 2KN4A 4TMAB 5H92C 1JQ4A 2E2DC 1XO3A 2EY6A 5ELBA 1EOTA 2BW2A 4KKIA 1I4PA 4B0MA 4J6HA 4L23A 3ABVB 2DYOA 1HTPA 3ZJVA 3EFXD 1T5EA 3RZOB 2VB3X 3TMEA 1L5PA 1PUTA 3MTSA 1ZYRC 2PKOA 5FKAC 1I50B 5KNBA 4KD4A 1EY8A 5CV5A 1R4QB 5AUIA 1MBYA 1F2RC 2IT1A 1TQOA 1L6VA 2AQ2B 2ZT9C 4PNYA 4B08A 4FF1A 2Q8TA 2CU3A 2WXLA 2ICEC 2DN8A 2VNUD 3P63A 1BMLC 1LABA 3X3MA 3NPPA 3A7LA 1JORA 4A6QA 1L0VB 4RF0A 2BOSA 2L0CA 1U4MA 2K7VA 1OXSC 4KY7A 4BBRB 3HVDA 1L6UA 4GZYC 4FF2A 3ND9A 2DLBA 2FMMA 2MPMA 3C1EA 2Y0SB 4YSYB 1BCPD 1SB3C 1CHQD 1UNSA 2KA7A 3BWUD 1FO4A 2PYKA 3AU7A 2A6ED 3UI2A 3VYUA 1TWFB 1FYCA 4IUVA 1U9RA 4CHTB 2IGDA 1F2MA 1ZP0B 1ILQA 3ZGZA 2WDVB 1QLBB 2RSNA 3EJIA 3V96A 4OO1I 1OO9B 5JPNC 2J7ZA 3NTKA 1PGBA 1NUCA 2MJ3A 1MVKA 4WURA