1DYQA

Staphylococcal enterotoxin a mutant vaccine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
228
structure length
228
Chain Sequence
b'EINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFRQHTILFKGFFTDHSWYNDLLVRFDSKDIVDKYKGKKVDLYGAYAGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN A MUTANT
publication title Structural Basis for Abrogated Binding between Staphylococcal Enterotoxin a Superantigen Vaccine and Mhc-II?
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Enterotoxin
total genus 74
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2000-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dyqA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1dyqA02
1S5DD 2G9HD 1D5XC 1BCPB 1KLGD 2SEBD 3V05A 2XRSD 1PRTF 1HXYD 1RDPD 4C56C 4DXGA 1XTCD 1I4XA 1PZID 1LTRD 3DWQA 1F77A 1B44D 4RHRA 1JQYD 2XNAC 5ELDA 2NTTA 3BVZA 1ET9A 3BYTB 1V1PB 1LT6D 1SEBD 1TY2A 3BZDB 1SJHD 1EU3A 5ELCA 1UNSA 1DJRD 3MFGA 2TSSA 1CHPD 1BXTA 1TS4A 1JWUD 4RCOA 2NTSA 2XN9C 1PTOH 1SE2A 1CT1D 1FNWA 1LTTD 1D6EC 3BYYB 2IPKD 2RDHA 1I4QA 3R2TA 1D5MC 1YN5A 3BVGA 3R8BA 1TS5A 3EA6A 1BCPC 1ET6A 1ESFA 1DYQA 4TSSA 1M4VA 1LT4D 1AN8A 3EFXD 1PTOB 1RD9D 3O13A 1HQRD 1FNVA 1PZJD 1D5ZC 2Z8LA 4RFBA 1QILA 1BCPD 2AQ3B 3GP7A 1KTKA 3DWAA 1L0XB 4Z9CB 1LO5D 1G8ZD 4OHJA 3R2IA 3TSSA 1CK1A 1FGBD 1SE4A 1HTLD 1HA5A 1SE3A 4RGTA 1LTSD 1PRTB 1RCVD 1KLUD 5FK9C 1LT3D 4RH6A 5D3DA 3BVMA 4RGNA 1EEID 1S5FD 1LTBD 1UUPA 2QEJC 4DXFA 1BCPF 1T5XD 1B1ZA 4ZYSA 5I4DA 3MC0B 1RF2D 4RGMA 5ELEA 1L0YB 1S5CD 5ELFA 1S5BD 1GOZA 4NZLB 1EU4A 1SBBB 2XRQD 3W2DA 1YN4A 1EFID 3KLSX 4L63B 1LLRD 1PTOC 1S5ED 4K6LA 4RGOS 4L6TB 1STEA 1PZKD 1FNUA 1LTGD 1V1PA 2J4XA 1I4RA 1PYWD 1PTOD 1SXTA 1EEFD 2WV6D 2AQ1B 1JCKB 2O2LD 1LTAD 2IJ0A 1JWMD 1PRTC 4O1NA 5TSSA 2RDGA 1MD2D 2ICIA 1V1OA 2AQ2B 1CQVA 4RHSA 1I4GA 1FD7D 1TS3A 1LT5D 1XXGA 1PRTD 3OWEB 1LTID 1I4PA 1YN3A 5ELBA 2QILA 1PTOF 2R61A 5FKAC 3SEBA 3DWPA 1ENFA 1EWCA 4UDUC 3URYA 1I4HA 1JWSD 2CHBD 1JR0D 1TY0A 3CHBD 4BWGB 1CHQD 5D3IB 1TS2A 1SJED 1AW7A
chains in the Genus database with same CATH superfamily
1S5DD 3ZNHB 4BY1G 3J80i 3QHTA 3K58A 5GAHC 2E2JB 4K0KQ 1JOKA 4LFBQ 1P7EA 3RNFC 3NELA 4JGHB 4HKZE 1WE6A 3U7ZA 1Q8IA 3SK4A 2DJGC 5K36G 3CMEA 2GRIA 5AJ3L 2IGDA 1IBML 1QT9A 3NWSA 2EPBA 2PJHA 4OEMB 4FN2A 4M0WA 3I4NG 2D0OA 4DV2Q 4JW0A 2R93G 5HHDG 1ZYRC 4KY5A 1FM0D 3CAMA 2LXCA 4LK1C 4DV3Q 3DVGY 3NQTA 4G4KA 1ILQA 3Q2AC 3ZYYX 2K50A 4Y7NB 5NUCA 1ZKOA 4C3IH 1RM6C 3RMHA 4YTNB 1EWHA 1V80A 1P1AA 2Z0EB 5E6JA 1J5EQ 3DWGC 2HTHA 2BW2A 2VS1A 1PH6A 3HP3A 4WORA 3EA6A 5C4JB 2IL8A 3S24A 3U4VA 1PQSA 3DPDA 1R7SA 4IALA 2UUCL 1XJVA 2JYTA 1S4ZA 4I7ZC 4IW0A 3VA5A 5M5XH 2Z8LA 2RHSB 1KTKA 4AQYQ 3E0JA 4DR5L 2J7ZA 4BY7H 1SIFA 1YQ4B 2MCNB 2SNSA 3RZOH 3VDZA 3NZ3A 4JL9A 3AQQA 1SR3A 5IKCM 1E8XA 1G8ZD 2NVXB 2F3IA 4J8QA 4JI3Q 4HJ9A 4XX5A 2NN6I 4LNFA 2GVAA 3HOUH 1NMFA 1FO4A 1MHXA 1R4MB 1UELA 2L7RA 1RIPA 1VQMA 1AFPA 2L00B 1EL0A 4K3BA 4E6IA 2CHWA 1QZHA 1IP9A 1Q46A 1EY5A 3MC0B 4DR3Q 1OEYJ 3NHEB 4BA1I 2A6HC 1Q82C 4NJ6A 1HA6A 4G7HC 1WX9A 3KQ4A 4KV6A 1GC6A 3TCAA 1S5CD 1YNTE 3QX1A 4WWPA 2K1BA 5M3FG 3S17H 3TRZA 1DOMA 2F0PA 2MA9B 2MBHA 1WF9A 2QCZA 3VTVA 2QC8A 3VRBB 4DDGD 2L0TA 4WAFA 1EFID 2D3BA 1UD7A 2E2JH 3HEJA 3HOWH 4JBWA 1Q81C 4IOAA 2JZ3B 4KGTA 2EELA 4L6TB 4HEA1 1CKNB 1STEA 1EIHA 2KZRA 4BBNC 4OZCA 5K5PA 4NPNA 1PH5A 2HDLA 2SAKA 5J39A 4A3DB 1PYWD 4PNYA 1E90A 1YVCA 4KGSA 4NDXA 2KLGA 5KYIA 3I70A 2WXKA 2LSSA 1L7YA 3I56A 2N9KA 2NVYB 1M1KC 1XO3A 2LMCB 2L0FA 3SK6A 1V1OA 3I72A 4HKQA 2ZTCA 3ZKJC 1E24A 1C76A 1P16A 4C3JG 2VL6A 1XNRQ 2VY3A 1KLVA 4GLAC 1LTID 2M9VA 3VR2A 2KXJA 3M95A 3ZXRA 4OX9L 2E2DC 2M4NA 1NDDA 3DHHC 5CC4A 3ZNID 2N3SA 4DK5A 1YJ1A 1XQQA 3DHGC 2J42A 1XX8A 1WZ3A 2DYOA 2N7DA 2Z0DB 3VTUA 2V0GA 2D5DA 5BYRA 1T0YA 3T51B 2VW9A 1D5XC 2PI2E 4POFA 1OFFA 1BVSA 2G4DB 3P2BA 3KF8B 3E5SA 2LD9A 1B53A 3D6WA 1ISNA 1GAQB 4CDCC 1GG3A 2INNE 4HDOA 1B70B 1RFKA 5E4WC 2HD5B 1Y8PB 5IT9L 2N4FA 4IPHA 4IDIA 3RPFC 2JWZA 4YWGG 4BXXG 2WXFA 1RL2A 2WAQB 4K6DA 2R2QA 2FHTA 3VA7A 2CS4A 2WB1G 1TVXA 4KJOA 4NAWA 1TWFH 2E2IB 3GTOB 4CDFC 2KMMA 2IBIB 2AHOB 1AEXA 4MT5A 2AWOA 1YITA 1SEBD 5KIXA 3ER0A 2N9LA 2W54A 3VR9B 4H13C 5LL6X 3I4MG 4LFCL 1QOGA 2BVCA 4AYBB 3MFGA 1UBQA 2EVBA 2BCOA 3VYUA 4HJAA 1X3QA 5M5WB 4A3BB 1ACCA 2XN9C 3BYYB 1K8MA 2DX5B 3AEBB 2ACZB 2IPKD 5E6PA 3RNGC 2EYMA 5BYSA 3PV1A 4HIMA 2R7ZB 3BVGA 2QHOA 4KKIA 2L4NA 1I6HB 4LW1A 2BE5C 4HIKA 4NXML 4GB9A 1J6QA 3CC4A 1RYJA 1ET6A 2BKRB 2O6VB 2PE6B 4RM9A 1DYQA 1VQ4A 1M4VA 1WM2A 3X23A 4A3DH 1N5XA 2JA8H 1Q1EA 4KKUA 4HJ8A 2RA4A 4PMCA 3I73A 2E5LL 2NVYH 1PH8A 1MHWC 3IVFA 1YOVB 4NKLA 2HJ1A 1K8OA 3HOVB 2EYHA 1YJJA 2KDMA 4IWPA 3PZDA 4LF5L 1HTLD 1ENCA 4DV6L 4JLCA 2HTME 2ZM6L 2R92G 1TT2A 3U4ZA 2PZTA 3GB1A 1PA6A 3G6JB 1AYFA 3M4OH 2A69D 1EQVA 2GB1A 1JMCA 5CMDA 3ZJYC 3IT4B 4ZYSA 3WALA 4X66L 2BB6A 2V4IB 2N0SB 2KUMA 1Y56A 4NAMA 3S1QH 3K80C 2L11A 3G48A 4MHEA 4FXDA 3R3OA 3S2DB 4X65L 2RDBC 1SYCA 2ZJQA 3DM3A 4Q2JA 4DR7Q 4EVOA 1Y8OB 1UEBA 4PT5A 4CKBA 1KF6B 4X3KA 3UDGA 3VYTA 2ZVOA 5DCNA 2RMMA 2SNMA 3TP8A 3JAMc 2N9XA 2NPTA 1JB7A 1V1PA 2D3AA 1EY6A 2CFMA 2V4DA 4B3TQ 2DAJA 2YTXA 4XYOA 1DXMA 1HHVA 2IY1B 1HTOA 3AFQA 5DEHA 5DLQE 4KIKA 1Y8RC 4HLEA 4MELA 3DHQA 4X3SA 4HIOA 2QA4A 3RZWC 3I90A 2KLCA 4OVUA 4DR1Q 4JI2L 5M5WH 4GLSC 2CU3A 4WH4A 1BT0A 1A2UA 5IOCA 1WCMH 2PI2A 4OW0A 4BBRB 1ML0D 3BS1A 4DV5Q 1YN3A 1SE9A 2L76A 1VQDA 2WLBA 4LF6Q 3M7GA 1I6HH 5FKAC 2Y0SE 4A90A 3L10B 2K4KA 3EIVA 1EWIA 1UE5A 2CHBD 1EWYC 2KMCA 1F9RA 4KVGB 3Q8AA 2KFKB 4UP8A 2B29A 3AEGB 1XEEA 3EJIA 1YI2A 3KYHC 2G9HD 2JYOA 4NNJB 1RHPA 3GZNI 2KFJA 1N5WA 3KLRA 3NPPA 4KY6A 5JPNC 5KGUA 1B3AA 1RDPD 1VQ9A 4YWMA 3B2FA 3IXSA 2WYQA 1VQAA 2A1AA 3O65B 5I2YA 5CTRC 2MUYA 4CDEC 4BY7G 2BBCA 1L5PA 4H0LC 2B2WC 5C0XJ 3AEFB 1H9SA 2MJEA 2C35B 2VXWA 3NK9A 2J0TD 1FJGQ 2JEAI 1DGJA 3F2UA 1S40A 5FLXE 1UGMA 1YNXA 2BYEA 4AWJA 3HOUG 2NWGA 3OIQA 5I9PA 3RN5A 4KKJA 3VQIA 3J81E 1U4MA 1DJRD 1ZUD2 1ZP0B 5JH5C 1V43A 3RD4A 1L1OC 1ZDVA 4JI5L 2RGFA 1E5WA 2K1FA 3Q0AA 4N58A 4O0AA 2NTSA 4JX1C 4A3KB 3B0AA 2JA6H 1QJOA 3L7ZC 1MGSA 2OCEA 1FCLA 2W3SA 4JPBW 1XCTL 2LXJA 3ULPA 1NENB 3F2BA 1DD2A 4W9CA 3UGBB 3ZJTA 3VTWA 1X55A 3HOWG 4FXCA 4C3HH 3GD7A 1UGJA 3WOEA 5I6WA 3MJWA 1SDFA 4B0EA 1XNQQ 1SRUA 5ELNA 1QILA 5HKHA 2NN6H 1BCPD 3W5OA 1YD8U 4BKSA 4DDID 1PV4A 4ALPA 1GB4A 2UXDQ 2I07B 1Q1OA 2WXIA 1RKNA 3DQVA 4HCNB 2OEDA 1Y1VB 4C4VB 3WCQA 4QIWB 3GTMB 3ENEA 1OQYA 1IW7D 2MJDA 1TWAH 1EYCA 2KDEB 4MDKE 1LT3D 2L52A 1HUNA 2KTRB 2BQQA 1QUQB 1STGA 2V1YA 3NHHA 5G5GA 4A3CH 3H8HA 1F2MA 2L55A 2EXDA 1KL9A 3CCEA 1IGDA 2H5XA 1XT9B 3SHLA 3M4YA 1MI2A 3VUXA 4LJZC 1C4PA 3M63B 2OJRA 1B9MA 1X54A 4IUTA 5DM73 4DR6Q 1G291 1E6EB 4HCPB 4FDBA 4DHJD 3ONAB 2VQEL 3W1SA 4AQYL 2K01A 4L23A 1FPYA 1CMXB 1CQFA 3I8ZA 4DKAC 1L2FA 2PEAA 3L3OC 4EQOA 4DK1A 4C2MB 3N30A 4C1NK 4JI3L 1E8YA 1WI5A 5T1GA 3KFUA 1VJKA 1HTQA 3HM6X 4QF4A 1WD0A 2Y0SG 4TVAB 4IFDJ 3HOZH 4JCVE 4DUYL 4LNKA 1WR1A 1WXSA 3VH4B 4K2KA 2EKEC 2Z9HA 1GUTA 2IYDB 2QF7A 4JBMA 1NBFC 1I3QH 3MXUA 4MM3B 3LJ3A 3MFYA 1QQRA 1A63A 3CPWA 4A3KH 2DZMA 3RZDB 2ON8A 3CD6A 5D2MB 2K33A 4UP9A 1Q7YC 3S14B 2CHXA 3AE2B 1XMQL 3NY5A 2QILA 1SMYD 1TQOA 4GS3A 1WTOA 3MEHA 4KK7A 4FF1A 2KC2A 4URKA 1NYRA 2EMTA 2Q2UA 2CWPA 4L2YA 2XSCA 1K0SA 3GTKH 1V8CA 3BZKA 2B8GA 2QW7A 4NXNL 4A3DG 4PMWA 2B2VC 2FIFA 2WXLA 4C56C 4HIDA 2JA8G 1H9KA 3QOLA 2F4VL 1Q3LA 3S1MH 5TR5A 2F0GA 1F9PA 1WVLA 3E9IA 3TL5A 2WXMA 2L5TA 2QIEB 1MFWA 3E9HA 1V1QA 5AJ3Q 1XNRL 1IBMQ 1C79A 2C7MB 2LZ6A 2LVQA 1X9NA 4IQZA 3NUCA 1TY2A 1L0VB 4F8MA 5CV8A 1CJEA 1PFNA 2ICEC 1UNSA 5G3LF 4DV0L 3CCUA 3PF4A 3F2CA 3VXWA 4BS9A 3AE6B 5CBEE 5DNFA 3VRAB 1CHPD 1ESRA 4PYZA 5FO9B 1Z7TA 1TTNA 2I38A 2JY6A 1L6UA 1D6EC 3J80E 1E0BA 3C19A 2RD0A 5IIFA 3FAHA 1QCBD 1VR9A 2K5PA 2WXRA 3R66C 3PGEA 4GXBA 5EPKA 3RT3B 1IL8A 3STBD 5JJZA 3GZNB 4WWMA 5EBCA 4MJSB 1J8CA 3JAML 1SFOB 4DF7A 2I5HA 2UUCQ 2FCNA 4NB3A 3O13A 2JF5A 1HQRD 2IT1A 4J6IA 3HZXA 3PSEB 4DR5Q 2JQRB 2QJLA 1VQKA 4CHKA 2QCPX 2XGTA 1PH9A 5DPWA 3LWEA 1SB3C 3BG3A 1XLPA 2PYKA 2L15A 3S15B 3RZDH 1J7CA 1RCVD 2K8CA 4TQ0A 1DOKA 3QK0A 3S14H 4XQNA 2MBQA 2FAZA 2LGYA 5AEKB 1GB1A 3APFA 3DBLI 3V60A 3MHSD 4GKJQ 3NXWA 3K6OA 1EF5A 1WCMG 4GN5A 1YEZA 4HN7A 4DXFA 3A4SC 2CH4A 3IAYA 3WAPA 4YSYB 5D7GA 4RF0A 2PPHA 2F0EA 2OOBB 3F8TA 3DVNU 4GDLB 3MXNA 4P2CB 2XRQD 4KDIC 2DNEA 1XF5L 4L63B 3T56B 4G0NB 3B9JA 2LUEA 5CHFA 3UI3A 3PUZA 2GBJA 3H3VC 2W55A 4XZ4A 2B2TC 4Y52H 3ND9A 1Y1WB 1I50H 3IKJA 3HOVG 3Q3MC 4IJLA 2K22A 1SSOA 2E76C 1VZ6A 1JJ2A 1XLOA 1PFDA 3P7JA 4ARCA 1V81A 3RNBC 3C3LA 4FA6A 1NE3A 1R4PB 2A68C 5COYA 3Q8CA 1JT8A 4GZYC 1WMHB 2BYVE 3H94A 1BOSA 1CTMA 5GAEC 4WJ3M 2C5LC 2WXQA 4HJGE 5JHBA 4A93B 4DBGA 4ULLA 1BUIC 1L1OB 2PPBC 4PQXA 1PTOF 4OX9Q 2R61A 3AB9A 4CJ1B 4A75A 2JA6G 1SYBA 4LLGM 1VQ5A 4MACA 3J9CA 1IBXA 2IO2B 4F88A 3HOXB 2JYEA 3PRPB 2G3QB 3OOCA 3S2AA 2FCMA 4IURA 4DHZE 1ENAA 4FYDA 1OQQA 4K1RB 3GTGH 2V1CC 5C3XA 1VQOA 1IZ6A 4C3HG 1WR6E 2Q2HA 3DM1A 2BS4B 2IGHA 2IO3B 4HPPA 3SFEB 3JSVB 1HXYD 1TBEA 5C3EB 2NN6G 2BDNA 5BMGA 4WFN3 4A3EB 3DWQA 4PV1C 3H3VI 1C1YB 1TYGB 1B44D 4K8IA 4WRDA 4RCNA 3S15H 5DPTA 3PS6A 3UQAA 3A1QA 3B6YA 2J52A 4K14A 3ETRA 2DGYA 5MPOA 2DENB 3BYTB 1ET9A 2XK5A 1OO9B 1IGCA 3BZDB 3E0EA 1SJHD 3W1BA 4BBRG 2DBYA 4LFCQ 3LDZE 4KZCA 5FLXc 3J81i 1G91A 4A3FB 4IFDI 1X3FA 5M3FH 1ZXTA 4CBVA 4A3CG 4HMJA 4D2KA 1E22A 2KX0A 3J81c 1FL0A 3IL8A 1WTQA 2H88B 2WXGA 1DOYA 1S3SG 2B76B 3P4PB 3W5VB 2M1MA 3K9PB 3ICEA 3H7PA 3KJOA 4GOPC 2A19A 3H91A 2Q8RE 3PREA 3R8BA 2DWQA 2QDFA 2B2UC 1TS5A 2YTYA 4JI4L 3AFPA 4NXMQ 4I6LB 2I1JA 2KHJA 2E3TA 3KBGA 3HOYH 2BF8B 4K81A 3HKZE 4KHPL 3ZJUA 1AN8A 3EROA 1J7AA 4MSMB 4B0MA 1WJJA 4LF4L 1S1QB 2KEEA 4W9GA 3RD2A 5H1SE 5HGTA 3VH3B 2PO4A 2E5LQ 2E2HB 5AZFA 2MP1A 2LFIA 2MWSB 1K52A 5CHVC 3D8GA 3TMEA 1N60A 2GN5A 2ZJRA 5JEAJ 1TKEA 4WJOA 4A8XC 4DV6Q 4WWOA 2ZM6Q 4E74A 4A93H 3TS2A 3IBEA 1TIID 1NY4A 1N63A 3M9BA 1U4AA 5BMIA 1PGXA 1FFVA 3IHPC 4A3KG 3IFWB 2NYZD 1OXTA 3OHXC 2QEJC 4V0BA 1CFMA 1B1ZA 2E8GA 2EXZA 2F0UA 3HRZC 4UY8C 2BDOA 3S1NB 4X66Q 3HOXH 2AL3A 2MFIA 3PO2B 3NBHA 1ZDXA 2Y5CA 5ELFA 4JI8L 4GNXC 4FHJA 5M3MB 3LGJA 1YX6B 4R4OA 2CW0D 2ZPYA 3HIZA 4II3B 2FMMA 4A76A 3QWZB 5LLIA 3PPAA 3I4LA 4L1BA 2D11A 2HD3A 1S5ED 4BXXH 3I55A 4KKSA 3BWUD 5JOBA 3R7QA 2G9DA 2PQAB 1JOQA 1J0GA 4F1SA 1J8IA 2K8HA 3BZCA 1EYGA 3WIMA 1FYCA 1WZ0A 4GU2A 3W5UB 5IP7H 3DOWA 2K03A 2KCMA 3I91A 1I4RA 4QCLA 2F3VA 4LTUA 5IOIA 1B2TA 2HUGA 2NVTB 1YJIA 4NJCA 4R4CA 4HXDA 4IUPA 1HTPA 3UI2A 2KCNA 3HVDA 3TP5A 2BYTA 1KNEA 4XIGS 1WSPA 4FADA 4RMAA 2YV5A 2K9XA 3DBLB 4IUNA 1F9JA 2GLSA 2OT2A 1PH4A 4JI2Q 2QMTA 3MC9A 3VHTC 2KQ3A 2RSNA 3ZDTA 2K14A 3ZLZA 3HUIA 5IWAL 2W3RA 3M4QA 1MJDA 2X69A 1CZPA 1ZE3D 2LEKA 2PNHA 2QEXA 5ELBA 1KIXA 2JRIB 4HPMB 4W9JA 3OTOL 2LHEA 1ZGUB 2MNAA 2CKZB 2Y5BB 2WACA 4X57B 4B9KA 4KIKB 4I65A 1VQBA 3BU2A 1STHA 3PSIA 4NY0A 3CMAA 2MRPA 4AH6A 3A4RA 3N1YC 1QF6A 2V4LA 4YCVA 1GKHA 4H02A 2PW9A 4TUUA 1VQCA 1TXYA 4ZCKA 2PE9A 1GUSA 2C9OA 2JA9A 1LTRD 2K28A 3PUYA 2KJHB 3D4RA 1Y69U 2Y5PA 5G2NA 3OWFA 4EE2A 2RF4A 2NTTA 3QARA 4LNOA 3FRPB 2W82A 1HPCA 3S1NH 3T1YL 1VQIA 3VR5A 5L37A 2CH4W 5EQ0A 3PO2H 2A5UA 3HKZG 2ZJPA 1N6ZA 2A6ED 3QB3A 4H44C 5JVG3 2K5VA 4JI5Q 2MSED 4A3MB 2BS3B 3ITPA 3IAM1 4DXAB 1H8CA 4TKNA 1LTTD 4XXEA 1N32L 1MJCA 3R2TA 4AUQC 1HJPA 3QJZA 2NS5A 2F0IA 4UPAA 3AU4A 1GJXA 2I2YA 1L2NA 4PG3A 3KW5B 1FGUA 3J80c 4IM2A 1O7IA 4JOIC 1E1OA 4LFAL 3PTFC 1VQEA 2HE7A 3QQ8B 1GVPA 1NR2A 3H0GB 4NMZA 4MGKE 5CV9A 1Z5SB 2KMAA 1FNVA 1PZJD 3NRZA 2KDBA 2B39A 2L1BA 2EE1A 1TKGA 5DPRA 2FIDA 1E0ZA 3AECB 4OELB 5T8IA 2NBUA 3S16B 4OHJA 4R9WA 3BINA 2NBVB 3PIOA 5AUIA 2HDMA 5J17A 4FNFA 2IDYA 3AI5A 5C44H 3HG9A 5D65A 5JJKA 1S72A 2JVCA 1A5RA 2BPSA 2WB1E 4RWSC 4XT1B 1XD3B 3Q14C 1UUPA 5CV4A 5A2QE 2HQEA 3CMMB 5IAAC 1LFDA 3NE5B 4AP4C 5ELOA 3JVZX 3BDOA 4FXKC 4NZLB 2Z0SA 1EU4A 5IGCA 1UF0A 3ABVB 1I42A 1LQBA 1L4ZB 4DV4L 2MX2A 2WP9B 1VQFA 2VQEQ 4BA2I 1QLBB 1JQ4A 4A3IB 4MTNA 3C1FA 4WJQA 1I35A 4GIVA 1QZEA 4KY7A 4KD4A 4X3TA 2O6VD 2LGXA 3PRZA 4OL7A 3NS1A 3KBXA 4OZBA 1BO0A 2VUMB 4IN3A 3BK2A 4HVBA 2UU9L 2ZT9C 4PZ8A 5EKLA 2CJOA 2KN5A 2EYLA 4HJKA 3FEWX 1JCKB 4A3GH 1TJEA 4DNTB 3U9OA 3AMZA 1UZXB 4GKJL 3L4PA 4IM3A 4J1MA 4DUYQ 2EY5A 1L6VA 2RDGA 4HCEA 5FLXL 3PO3B 3D6CA 4L5QA 4XGAB 2AX5A 2D3GA 1GO3E 3A0JA 4A3MH 5IYDH 3V6EB 1G2TA 2JSOA 2I5LX 3J81L 1PMRA 3A9JA 5LXIB 3OWEB 1HR0L 3GOEA 1CA5A 3GV6A 3U9SA 1XMQQ 3I9V1 1PGBA 3QC8B 1V86A 3N1XC 1WE7A 3T53B 5FR3A 2NZHA 4AJYB 4HMIA 4ZRPA 5EAYA 1A3UA 4GOPB 2WKDA 1XWEA 1Y1WG 3HOYG 4RA8A 4BBSB 3BY4B 5G5HA 3TS0A 2M2LA 1QVGA 4NXNQ 1SAPA 4K5VA 4FLHA 4OGQC 1WFQA 3VR8B 3W1YA 2F4VQ 3M3YB 1WGGA 2JRHA 4KJNA 1JW9D 2KDFB 1GUNA 2LGIA 4RHRA 1AWDA 3H7SA 4Y7NH 1FMAD 3AEAB 1GUAB 2Z4IA 4RMFA 1AE2A 2M8SA 2KTFA 1RLFA 2PMZE 3PUVA 4ANVA 2JT4B 1JORA 4LWCA 2XBBC 3CCJA 1C9OA 4A93G 1H9JA 2KCCA 1KABA 5ELCA 2HIVA 4LAAA 1YJ9A 4U673 5C4JH 4DV0Q 2RCNA 3LWUA 2R3ZA 4YSXB 2MQHA 1XPUA 4PYUA 2K32A 3V3XA 2JP1A 3FPPA 3HOXG 1YZ6A 3GTJB 1ZYRD 1J7BA 3KF6B 4A3IH 4FJYA 4GNXB 3AE5B 4HDQA 2KWDA 1G51A 1O78A 2L0CA 3PT2B 2LXKA 4XT3B 2NVXH 3SFDB 3SR6A 1UWMA 2AWTA 3NOBA 1MG4A 4A3EG 2YEPF 4DPGA 3D31A 1KQSA 3MHBA 1X3PA 5IP7G 2UXBL 1N36Q 2JPHA 2WDVB 4BVUC 1D4BA 3K5NA 3J7AF 4I6NB 3ERSX 1JWAD 2L1AA 3K5MA 3PIO3 4ME3A 2TMPA 1B9RA 3U8ZA 2DZJA 5CV5A 1LM0A 3CC7A 2MBOA 2B2YC 2IO0B 3FVQA 3RR5A 1I6VC 5IGEA 3GV3A 2B63B 1PVOA 3MA2B 5G55A 2FJ2A 2PZUA 2W9NA 3NUHB 4R4IA 2KENA 1WGHA 4RGMA 5CR3A 3KDFA 1PLFA 3L54A 3NENA 4HWIB 1VMPA 5EKIA 3GE3C 1WYDA 3A54A 4BBSH 2N55A 2WDRB 4K7WA 2A6HD 1WTHA 2J53A 5JHAA 1PTOC 1HZ6A 4G3XB 2QSDA 2RBMA 1EQQA 1PZKD 1FNUA 4JI6L 2N9EB 1PUTA 3A9KB 4E3CA 2K7VA 5HGQA 3DLLA 3C46A 3DBSA 4DK3C 4F7ZA 1TIFA 1EEFD 1TWHB 5LXHA 2JXTA 4JE3B 3MXNB 1VQHA 1IXRA 4FF3A 1WI0A 4IG7B 3CCLA 2EOTA 1N33Q 1WRIA 4FP5D 3AV8A 3Q69A 4X64Q 4RHSA 1YJWA 2MW5A 2KKCA 1IHZA 3PO2G 4YHHQ 2JA7B 3ZO5B 1LT5D 3K0XA 3I63C 1EIFA 1ONLA 4XWWA 2JEBI 3KYCD 5GMVA 1KNAA 3T1HL 2O5JC 1X6OA 2DUDA 3P63A 4DQOC 2UXCL 5FOBB 1Z2MA 1IBKL 3J80L 1F1HA 4IUVA 2IX3A 2BA1A 2IX0A 5JAVA 2E2IH 3RCZA 3GTOH 2CJNA 2L9HA 1HFNA 3S2HB 2WS3B 3TQYA 5CBAE 2N7EA 1PRTF 3IAS1 3PO0A 1TZ1A 2UUBL 1XTCD 1I4XA 1BDOA 1D2BA 2F03A 3DHIC 2PCFB 4LDTD 4DAYB 4JK1C 1KDAA 3IT6B 1JQYD 2X6GA 2MJ8A 1A0IA 4A3BH 1EUVB 3T13A 4GDKB 5C44G 2R7DA 3NVWA 3HK0A 2K5HA 3OIPA 2WXNA 2F0KA 4X3UA 2R7ZH 3A74A 1YHBA 4W9DA 3ZJVA 1YX5B 3UDIA 2TSSA 4MNOA 1KOTA 1TS4A 4P74A 4RCOA 2WXJA 4M1UB 4CJ0B 1RTNA 3L0WB 3I7FA 1GXDC 3L13A 3G4SA 4WIPA 3N9YC 1KC8C 4P71A 1LABA 1ZW7A 2O2VA 4F8CB 4EZJA 1STYA 4JI4Q 3EFCA 2D62A 2XK5B 3HOVH 4X62L 2KVMA 4KSKC 1ESFA 1DZ1A 3MAQA 4KHPQ 2G4SA 2WXPA 1C7YA 4LF4Q 3CSTA 2K05A 4G11A 2BE5D 2F0TA 1WXVA 2MQJA 2A74C 3JYUA 3GP7A 3K57A 2A8VA 2LY7A 2ENBA 2EKIA 3TN2A 3H09A 4A3GG 2UWQA 5LMUL 5HG2A 2JA5B 2KN4A 2JA7H 3S2DH 4OZAA 3C1EA 4RGTA 3RMKC 1KLUD 5FK9C 2EYJA 2KQSA 1HQMC 4A3MG 5IYDG 1HNZQ 2OTLA 3MEFA 3GTPB 3ERQA 1CUKA 1T5XD 5IY0A 4Q5VA 4NW2A 4HSPA 1D3ZA 1G6PA 1E7PB 1WGYA 3NWTA 5I2XA 4JI8Q 3HRDD 1GOZA 4LJPB 4K2LA 3MTNB 4LNNA 4CGYB 3PLVA 5D14A 1YQ3B 4JPSA 2D0PA 1YMHE 3S2HH 1OTRB 1K83B 1EYAA 3E6ZX 4A3JB 5L83A 2MHVA 3MZ5A 4LF7L 3KK7A 5CV7A 1VRAB 2KACA 4W9LA 1TR5A 4ZRIA 5GADC 2WKCA 3ZTCA 2MP2B 2Z6BA 3FKYA 2VRRB 1SXTA 3S9WA 4BBRH 2KWUB 3AN1A 5KEEA 2IJ0A 3AE1B 4ASWC 3VR6A 2BH2A 1EIYB 2LJIA 4GN3B 2ICIA 4B3ML 2AQ2B 2LASA 4EKUA 2YYZA 3NTKA 3VR4A 1CQVA 1AP0A 1F2YA 1AH9A 3CSFA 1VQPA 4ZK9B 5IWAQ 1U5KA 5J1ZA 2NR2A 3ML9A 3I3CA 4A4IA 3VUWA 3OMCA 2RQXA 1IBLL 4OO1I 4GN4B 5LL6S 2CQOA 3OTOQ 4QJFA 1ENFA 4A3IG 1V6EA 5CHWA 2AWNA 1Z6HA 4XDXA 2DHZA 3STBC 3ML8A 3V61A 4ITKA 1UE6A 1KLGD 3AMUA 4A3LH 4DV7L 1SLJA 4P73A 1EYDA 3CXCA 1OXVA 4LNIA 1ASZA 3A5ZB 2Z6KC 2K5QA 2O4XA 1X1MA 2HJ8A 2XWBB 2FBWB 4MSQB 2WQYB 4OWTB 1WJ4A 2WDQB 3U7DA 4OVZA 1WXMA 1WTVA 1JRPA 4GLXA 2JK8A 4N8FA 4B9WA 2C5CA 4L8JA 2WGSA 4N9F4 4CO7A 3T1YQ 1SE8A 1K28A 3DMUA 2PZWA 3PVLA 4FVMA 5C6AA 5HY6A 5J3BA 4KN4C 3AE4B 3P20A 1GUWA 2JXXA 2WNMA 4FJZA 1NNXA 1N32Q 3VFKA 1LUZA 4J15A 4BBSG 1GUGA 5FLMH 2BKFA 2M19A 2PIAA 2V3SA 5HI1A 1Y1VH 4JIOU 4LFAQ 2EMSA 3F2DA 3HGBA 2ATWA 1PTOB 4XYQA 4ZLTF 3GTMH 4TQUS 2VQFL 1KM7A 2N8NA 2KANA 2LMCA 4XYCA 2ZTDA 1K3BC 2MHJA 4YTPB 4J3OD 3MXPA 3TDQA 2OWOA 2DYMA 2LVPA 2EY2A 2ZCBA 2J7QB 4M8NA 5CGKA 4MGZE 4KD3A 1LO5D 3PHWB 2CU1A 2ALYB 5AUKA 5CYUA 1QG7A 4BY1B 3W3AA 2DJFC 1TWGB 2KJXA 3DVNV 1WXAA 2BGFA 5T1IA 1WOCA 2X8XX 3UINB 1EY7A 4JI7Q 2KQ4X 3P1MA 1EEID 5EE0A 3UQBA 3TEXA 2WINB 4GOCA 4C2MH 2BT6A 3KF8A 2IX1A 1IKMA 3A55A 4EQ5A 3QA8A 3S1RB 2BWES 4M0WB 2R93B 1XPOA 4B3RQ 4S0RA 2WAQG 1OTCA 5AFWA 3VYSA 2EYFA 4DV4Q 3Q3JA 3N32A 1N36L 5IGBA 2PLPA 1DOIA 1F52A 1YBYA 2F0QA 1STNA 3IRBA 4EUTA 1RODA 1LTGD 1C4QA 1SNOA 1N61A 1C77A 1PDQA 4AYBG 1C8CA 3PF5A 1KFYB 3K8AA 2WXOA 5IP4D 5JZEB 2UU9Q 4GGQA 1B9NA 2F0SA 1JRUA 1NMGA 1TU2B 2DY7A 2V3PA 5C0XI 2AQ1B 1HZ5A 3J7AV 2L3ZA 4MN3A 2NCNA 4A3BG 3ALBA 4PK1A 4LK0M 3NVZA 2EY6A 5IN7A 4IO9A 1RTOA 1T5EA 5KNDA 1FVIA 4DV1L 2AEHA 2HDEA 3LB8C 3WAMA 2R7ZG 4LF9Q 2PW7A 4O2DA 5C4XB 1JB3A 1PYBA 1FRRA 5FJ8H 1TS3A 2O6VA 3ECIA 5H8YE 4YCUA 1H95A 1HR0Q 4NQLB 4JG2A 3DCGA 1EFWA 2KWVB 2NVUI 1DOXA 4PZ6A 5E3FA 1PH7A 1IYFA 4DAPA 4BKGA 3MXGA 2K6AA 2NZOA 1UAPA 3KWVA 3CHBD 2AYOB 2WIIB 2Z1CA 1WTPA 1VLBA 2C60A 2AL6A 2EYPA 3FDTA 1RFAA 4PS7A 3IFDA 4EEWA 1VMCA 2K04A 4ZRKA 2VZAA 1PFMA 3U50C 4YY3L 2GA4B 3OW7A 1JOOA 1TKWB 1WWTA 2D3CA 2H1EA 3NTHA 1N33L 1G6JA 4R4QA 4X64L 2F0VA 1X3EA 1D7QA 3D32A 4IZ8A 4YHHL 4H2AA 4WJPA 3VYRA 1GM5A 2JA7G 2ZTEA 1LT6D 2KNBA 2FCSA 4QIWE 1IL2A 4ZAIA 4BOSC 5BN5A 3QJYA 2XIWA 3CCVA 1SFOH 4KX6B 1BR9A 2X38A 2G1EA 1SNMA 1SE2A 1FNWA 3AB5A 3CRLC 3T3OA 1I4QA 1SMXA 5E6NA 1PXUA 3U52E 3GTLB 1DGSA 2ZZPB 1HE8A 1MVKA 4W9IA 2N1WA 4C3JB 4GKKL 4G50A 4N6EB 3KLWA 1MKHA 3M62B 1KAWA 3CCQA 3LNNA 4DUZL 2E6XA 4HAEA 3KUDB 4ANXA 2F0JA 2F0HA 3W1SC 2AQ3B 4A20A 2UXBQ 3LYYA 3GS2A 2OEOA 1UEAB 2VZKB 5IA7A 1VF7A 2ZXRA 4AS1A 5IGDA 1E9MA 1E7UA 1RRBA 5I9OA 4JI0L 3U2SC 3VUYA 2KVZA 1EY4A 5C4XH 4LF8Q 1T0RC 1HA5A 1YNJC 3EUB2 3RNEC 4ZHPA 3EECA 2N88A 4S17A 4CQNA 2PMVA 4RH6A 2HIXA 5D3DA 4C7YA 3M85A 4IJHA 2KFKA 4A9AA 1MI0A 2L32A 3TEYA 1XMOL 4NAWB 1BCPF 3N52A 1C78A 3B08A 2Q8IB 1TZOA 5ELEA 5HURA 4DNRB 1B4OA 1Y1WH 1Q86C 2KEDA 2BWFA 2H4OA 2NUCA 1P0RA 1V2YA 2MEKA 3B2GA 1HRJA 4IC7B 1K3RA 2I1KA 2GBMA 5M5YB 4TMAB 5JPMC 1C9FA 4ZUIA 4OIKA 3K7AB 2JUOA 4ACFA 4A3LG 1C0AA 3RLNA 2BB5A 4JI6Q 4Q0FA 1MSHA 4MZ9A 2HCIA 5IYBH 2QKIC 1FFUA 2LXAA 1ILPA 2B3GA 2B3AA 1HNZL 2O5IC 2O2LD 1K50A 2ZW0A 1PRTC 2ZCCA 5TSSA 1WGRA 1C4AA 3ZGZA 1F9QA 2JSVX 4R4TA 1BBXC 5CV6A 4OO1H 1YIJA 1MSGA 2REXA 1X65A 1VDZA 2WU5B 1I4GA 2KX3A 3CW2C 3KUPA 1FD7D 4XWTA 2G45B 3RNUA 3D3RA 2WHIA 2A68D 4YIJA 4EQPA 3GTLH 1YNND 1WD1A 2J0MA 3T1HQ 5C3EH 3URYA 4A3JG 2IO1B 1R9TB 2K3UA 2R2OA 1VQ7A 2UXCQ 1PH2A 3JC66 4B08A 4A3EH 1IBKQ 2L83A 1HR0W 3PLUA 1TWCB 1TT5B 5FLMG 2INCC 1E2VA 5IYCH 1WRDB 2RDFA 3BK1A 3C8YA 1Y1VG 3GE8C 1QNKA 4C4VA 1FR3A 4HJ5A 4JBJA 5GROA 4QQBX 2YVCA 4MGYE 3U4EG 4QL5A 4JWSC 4DXGA 2UUBQ 4R3DA 2INDC 2M17A 2Z59B 3FPUB 4A3FH 2KTRA 4QUFA 1QUQA 4HRSA 2OQKA 4DR2L 2LWPA 2D07B 3TBIB 3UIOB 2NPTB 3QIJA 1V1PB 2M00A 1BQQT 3M7NA 1FEHA 3PZ7A 1EU3A 1XTDA 4HROA 2PMZB 5IO9A 3AYHB 5KNCA 3Q24A 4CJ2C 3AULA 3OJ4B 1K8AC 1BXTA 1V9JA 1JWUD 2JZPA 1BBWA 5M5YH 4WAAA 1D5MC 1VQ8A 1HUMA 4JYAL 4ME5A 1SGHA 5C2TB 4XQQA 2R7FA 1JJGA 4DGZA 2E2HH 4MTKA 4CDDC 3U58A 4PZ7A 4EQNA 4TRDA 1QVCA 5M9OA 4X62Q 3CWIA 1WJUA 5HFYA 1B3QA 1LT4D 4C3IB 1U9RA 3NS8A 4JBKA 5IE8A 1D5ZC 3JAME 2NBFA 3M4PA 4LUVA 1NI2A 3K9OB 2MO0A 3DWAA 4MM3A 1G6ZA 1E8WA 4Z9CB 5KNBA 4RF1A 4DR4L 5C5LA 5EGTA 4MH0E 4P6VF 1SE4A 5LMUQ 3FILA 2OF1A 2ZJDA 1B7YB 4R1JA 3UE0A 5M5XB 5EE1A 5M3MH 4XDDA 4ZDVA 5JVH3 3NZSA 3RZFA 4HTHA 4RGNA 1H9SB 5FJ8G 3RZOB 2CCZA 4B3SQ 4ANUA 2K0PA 1I94L 3EVQA 3IFTA 2ES2A 4AQ7A 4IUUA 3NQIA 2IW3A 3BIID 1VQLA 1UE1A 2HHHQ 2D10A 2PVGC 3RN9C 1B50A 2NVTH 3EC8A 1IPGA 3D4DA 1ROEA 4LF7Q 4II2B 5EBDA 1V8QA 5IP9H 3CF5A 2WX0A 4KV2A 1MPEA 5C0XH 3KYDD 2KO3A 2KQ7A 4B9XA 4QGUA 2CHZA 4US8A 4JI7L 1UWVA 2XVSA 5E6OA 2AMCB 1QVFA 4CHTB 3HOWB 3QCAA 1U0LA 2YEPB 4ZRJA 4B3MQ 1Q0WB 1OXUA 3RLFA 1NCVA 1JICA 1LXDA 3GQBA 5DPSA 1OEYA 2LJ5A 3RYTA 1A3VA 1BF4A 4B3RL 1QB5D 4MJSA 3FP9A 5J2RA 2ZEQA 4DK6C 5BN3A 1IBLQ 3Q6SA 4MH8A 1LTLA 2GVBA 3UF8A 1KXLA 3CKIB 3ONSA 5EDSA 1EUJA 2I46A 1FXTB 4FO2A 3AU5A 4KDLB 2K6DB 1HNXL 1BMLC 4WJWA 4W9EA 4LUOA 2FFKB 4HCSA 5GQOA 1TKYA 2K75A 2DYBA 5E7NA 4JWUC 4M01A 5LMNL 3ZXVA 5IODA 1Q8KA 3WWVA 3J7ZC 2XRSD 4ZQ3A 4DV7Q 3RULA 2FCQA 1PYSB 3WDNA 4DFAA 1J9OA 1RJTA 4IUQA 4LMQD 4ID6A 2KYWA 1F77A 3TEHB 4A55A 1WTXA 1KHIA 1WYGA 4LF9L 1F9SA 2MJ3A 2EQSA 5C4XG 2KJ6A 4LUZA 3FC4A 1BUVT 1KRSA 1CKOA 3V2TA 2K5WA 4GDLA 1KDBA 2L8JA 4KZ0A 2Q5WD 1GC7A 4E71A 5JJLA 2KA7A 1TWFB 2K5NA 2Y0SB 3H0GH 2F52A 2K8BA 3VVWB 1LACA 3Q8BA 1CT1D 2KHSA 2MO1A 2Z4HA 1MHHE 2DZKA 2VH1A 4ICUA 3E56A 3H3VH 5E4XA 2KDIA 4NJ7A 1K9MC 2XTIA 3S16H 3T4AC 1HZCA 4MGIE 4KI0A 3APCA 4TSSA 3J7A5 5FR6A 2B2WA 1XLQA 1JE4A 3ZQ4A 2VQFQ 1T6BX 3VR3A 4DAVA 4FJVB 5AZHA 4IFDH 4BZAA 3H1UA 1WMHA 2DY8A 4S3SA 1ASYA 1WM3A 2V3NA 5IYBG 3PIP3 2DN8A 3PQIA 3ZIMA 4GSWA 3J81j 1M8AA 2BS2B 2A69C 1HNWL 1CK1A 3SDLC 1P98A 1L1OA 4IM0A 2PNRC 1AW7A 1PRTB 2EYOA 4QB4A 2JA8B 4OO1G 1N8RC 2Q8TA 4GMVA 1A2TA 1DM0B 4KMUC 2F0LA 2WDTB 4DA2A 3AEEB 3BDLA 4PMBA 5LHY1 3MJ5A 1EF1A 2KAJA 5EE9A 1XPRA 2LUMA 4JV5L 3OLMD 2LGDA 1RF2D 3Q3NC 2JE6I 3FKIB 5C3EG 3JSVA 2KBNA 5BR8L 1JE5A 4M02A 2VUMH 4CKCA 3RFZB 3I57A 4OWXB 3QOJA 1A8VA 1QOFA 3M4OB 1GJZA 5IYCG 2VNUD 2KD0A 4CYEA 2INPE 1WJ6A 4B95A 1E3PA 3MHZA 2WWZA 3KWLA 3QAQA 4BAXA 4ARIA 3PO3H 3S1QB 4W9FA 1AARA 4C80A 4K8JA 4LF8L 4C00A 4BKTA 4A3FG 4N9PA 2JN4A 3T16A 2FNJB 3EBEA 2K25A 2WV6D 3PRMB 2A4ZA 1NJIC 1X3GA 2JXMB 1Q1BA 4O1NA 2OTJA 3EFUA 1MD2D 1T9HA 4DV1Q 1FCCC 1DCZA 3A56A 2WP8J 4ZKBB 1WTWA 1LM8B 2BOSA 2UYZB 1XXGA 1Q5WB 1F2RC 1W6JA 3GTQB 2HQLA 4JC0A 1VQ6A 4CKEA 2GBNA 2BH8A 2PKOA 4RM8A 2BTEA 1EZ8A 4UDUC 1OQRA 1K0RA 1VQGA 1JWSD 3A8KE 3M3YH 1PH3A 3NEMA 4NQKE 1SYDA 1CHQD 1SJED 2NBWB 1WCMB 3DUZA 2F4IA 1CZGA 1TGZB 3GDEA 3EQLC 4XDCA 4TV3A 2QGQA 4OONA 5G3LD 1KRHA 3U30A 3Q3OC 1UH6A 4YY3Q 5D6JB 5DM63 2CKHB 1PZID 2Z6KA 1I5FA 4APVA 5BMHA 3TEWA 3DEOA 4K7SA 3X3MA 3TMPB 1WJNA 1K8GA 1XCQL 2XNAC 5ELDA 1WGKA 3P75A 3HHMA 3UDXA 3GTJH 2I0QA 3DWMA 2L05A 3M3JA 3CC2A 1VCIA 2OQ0A 3AXCA 5M3MG 2FINB 4M8AA 2D2QA 4RKLA 1CKMA 3L0OA 2JQOA 3FKIH 3PUWA 3G71A 1P7FA 1SSNA 1V97A 2ZNVC 3J7YW 3Q8DA 2KK8A 4KSLC 4ZRQA 3PHXB 2MBBB 1PDXA 2PQAA 2RDHA 5EKKA 1F2RI 1YN5A 1Z9FA 4XTCS 2B2VA 1QE6A 4AIMA 3RNAC 1BCPC 4GKKQ 3QWNA 3MC8A 5IP9G 1K73C 3CU7A 4G57A 3KVFB 5CX3A 5C3JB 4PS3A 4DUZQ 5C0XG 1KD1C 3KLSA 1UBIA 4P16A 1ICFB 2JA6B 3ND8A 1CSQA 1IBXB 3EGRA 5KRUA 3JAMi 2B63H 1Q90A 1H9MA 1VS0A 1JWBD 1K8RB 1IW7C 1WGDA 3Q23A 4HJ7A 3OJ3A 1KH0A 1VZ7A 3R2IA 2LFNA 2UUAL 1QOHA 1T3QA 4C7ZA 1EIGA 4JI0Q 4C3HB 3HM3A 1WXQA 1SNCA 1N34L 3LXFA 2KC1A 1OXSC 4QUCA 5CORA 3VDYA 3GTQH 3NBIA 1XLNA 1S5FD 3HVZA 1C3TA 1W3SA 1ZEQX 3A1QB 3NTIA 3TZUA 1XMOQ 2CR5A 4G7OC 3DBRI 3AEDB 3MVVA 4YTMB 2NVQB 1SNPA 4KGRA 1VZ8A 2CVRA 2E75C 1M94A 3Q8FA 1E1TA 1TWAB 3DBHI 2GI9A 3QG1A 4C3IG 1E8ZA 3W2DA 1YHQA 4HSVA 5EPLA 1TWHH 3KLSX 3R93A 3TIXA 1S3OA 4K6LA 3SD5A 3C2PA 3UE1A 1CI3M 3H7PB 1W6KA 5IGFA 3ZW3A 3A7AB 3SGIA 2V9HA 3H6NA 2J4XA 4FF4A 1PTOD 2JX5A 4RG1A 2DZIA 3QR8A 2DNFA 2NZ1D 4GN1A 2YLMA 3CPFA 1LTAD 1KRTA 3SR1A 1JWMD 1EOVA 2EY1A 2ONQA 4B3SL 2P5ZX 2M56B 4JI1Q 3CIRB 2HCCA 1HEZE 5KHQA 1SMYC 3H15A 1G2SA 4IPDA 4RKBA 3SK8A 2YTVA 1EZ6A 4U68A 1M90C 4REZA 2HHHL 1I4PA 2FXQA 3WOFA 3H0GG 3HOZB 1WX8A 4ILWA 1JJCB 5H92C 5BYQA 4PS8A 1EWCA 4A3PA 3P42A 1I3QB 2B2TA 4IUMB 4JQWC 1EY8A 1HZBA 3N1ZC 4IOCA 4P75A 1EO6A 3NBHB 1ZOYB 2IZVB 4X6AH 2F0OA 2WAQE 1YQBA 3SVMA 4K0KL 3LX0A 4LFBL 4IFDG 5AZGA 1EY9A 3DXJC 3OSOA 5JEAH 4K5WA 4KTAA 4DR2Q 5KHOA 3D0FA 2JWUA 2ZW1A 3GTKB 3SHQA 3V62A 4AYBE 4AJWA 3BVZA 2Q2TA 2AUKA 4DV2L 4ZYNA 5C1ZA 1B8AA 1LV9A 4B6WA 3S1MB 4IPGA 2NVQH 4DV3L 3TEZA 2PVOD 3NG0A 1FD6A 4KHVA 4NPSA 3NP8A 1J5EL 1K53A 4ANWA 3E3XA 2DAFA 4IWQA 4A3OA 4JVZA 2VUMG 1GD7A 1O80A 4DHZB 3T8MA 4JYAQ 3K59A 1SYGA 1QOAA 4DNIA 1V49A 2KWCA 2EJFC 4USAA 3ULLA 3TBLD 1CSPA 1A70A 2JA5H 3EFXD 1LYLA 5IT9E 1ICWA 3MWYW 2FUHB 3PO3G 2RKSA 1A6XA 4RFBA 3K0YA 1E2ZA 2RCFA 5BO4B 3GTPH 1LGRA 2D5GA 1NUCA 1U4PA 2QDLA 4DR4Q 3DEPA 1K51A 1HZAA 2A73B 2C9WB 1GUOA 4ICVA 4LDTB 1PFBA 1FGBD 2N9PC 3AE3B 3VAWA 1WYWB 3I4OA 2ASBA 2WX1A 1DONA 1OXXK 2LGSA 3RNCC 5EPJA 4POGA 2K52A 3APDA 4N59A 1CKNA 3BVMA 1K83H 2RVLA 2JJQA 3GO5A 4A3JH 4GLVB 4GOPA 4N8X1 3N20C 4DR3L 1Z47A 2B2UA 1P3QU 3R7RA 1I94Q 2GMIC 3SK5A 1L0YB 4F87A 1EY0A 1S5BD 5C4HA 1WY8A 3RUIB 2C7HA 5JXVA 2R6GA 2VB3X 1C48A 1SBBB 3FILB 1YN4A 1VDVA 3HKZB 4R8IA 1LLRD 3HFZB 2LVOA 4XC2A 2EJGC 1QZGA 5KYLA 4ODGA 1NR4A 2D2CC 1U4LA 3I2ZA 4QAYA 2F0WA 3TP6A 3PZ8A 2D9UA 2G5DA 4M00A 3ZDMC 4YWLA 3SU8X 4G7ZC 2PTLA 2DNCA 3HS0C 3AM9A 3ZUNA 1BNZA 1NVID 3AU7A 4UHVA 1PFSA 5FO8B 2VZKD 3A33B 3TJPA 1A15A 3CP0A 3K7UC 1T0QC 4BFRA 3A7LA 4FF2A 3L17A 4XE0A 1I50B 4DU9A 1NEKB 2IWHA 1CA6A 3KF6A 3T9LA 3DBRB 4GNXA 1I7HA 3ZRFA 5ISRA 5C5MA 3I4NB 1OGWA 3FKIG 2PW5A 3TUOA 4YXDB 2JZZA 1FRDA 3IG3A 1E10A 1II3A 1F2ZA 4RAUC 1V5OA 3Q6BA 2JU6X 2RSUA 3DBHB 2ZNVB 2YU9B 4HPLB 2XWJB 4BBNF 1PGAA 3HKSA 1HNXQ 4OIJA 1FXAA 2IY0B 3ZNGC 3T3NA 2XEWA 2ASQA 1BCPB 1GPXA 4BOZB 3G6EA 5LMNQ 2GBRA 5L95C 3X3NA 1QOBA 4K5XA 4UAIA 2OXPA 2B63G 3UIPB 3OMGA 2MH7A 4C1NI 4YSZB 1SROA 3Q8EA 4W9HA 1R4NI 1JC7A 4L5RC 1Y8NB 1XYIA 3GTGB 4YT0B 5EE3A 3W9CB 3AE9B 3L08A 3WANA 1EQTA 4HEDA 1IUEA 2BA0A 1SF0A 3KOJA 4KLKA 3ULJA 5J18A 1SIJA 3I3TB 2M0AA 3W1GA 1ZKHA 2FMCA 4ZRZA 5J22A 1R4QB 5DAUA 2QDBA 1PH1A 1RWSA 1PTOH 1SN8A 4ZUJA 2KJRA 2KOXA 4DHJB 1O7YA 2A5HA 3A9KA 1KAAA 1SNQA 1QNUA 2ZXPA 3A9JB 5E1FA 4P72A 5M3FB 4OWWB 1H4RA 4KHZA 1N9WA 5F2DA 4BY1H 2MLBA 1TWGH 4QMGA 2F0NA 3KH0A 1RD9D 3CRKC 3JW0X 2RHQB 1STAA 4FULA 1D8LA 1SYFA 4KN7C 5K36H 2J0JA 3HOYB 1HNWQ 1MBYA 4OVVA 4I6PA 1V9PA 1IYVA 2VB2X 2AKWB 3A8IE 1SE3A 3F1ZA 3L9AX 3KUCB 4O42A 3S1RH 2WXHA 1LTSD 3I4NH 2R93H 2EZVA 5A2QL 1X32A 3NZUA 3WA0A 1QKZA 5BN4A 4LCDE 1VF5C 2GOWA 3AEVA 1O7LA 4JV5Q 2YU9H 2CW0C 4P1BC 2EJMA 1D1KA 1YNNC 2N49A 4JOIA 3CCMA 5BR8Q 4DK0A 1W2BA 2ZVNA 4EFOA 1A62A 4DR7L 2N1VA 4ZOHC 2EIFA 3X0WA 1EM7A 1WFYA 5LNK1 5C23A 3NVVA 4DAYA 4DN4M 1CZWA 4RGOS 2RPQA 2J0KA 2RSOA 4GDKA 3A5UA 2X6LA 4EX5A 3NSWA 1MJEA 2KT7A 1T0SC 1D1IA 3SE0A 4B3TL 3E9SA 2F0DA 5JEAG 3WAOA 5C4ZA 2OHFA 2ZXOA 3RLOA 2IY5B 1VCBA 3L16A 1FXIA 3DVGX 2SOBA 3BDCA 3BJUA 1E2WA 2RPVA 1NBWA 1GHJA 3NVYA 1F0ZA 2WB1B 3PMFA 4FXGC 3OG5A 4DR1L 4I7AA 4J6HA 1NI3A 2CQAA 3N3KB 1NYQA 4UP7A 1HH2P 3I4MB 4DV5L 1EQRA 2CWAA 2VH2A 4LF6L 4R8NA 5D94A 1KJTA 3DWPA 1EOTA 1VQJA 3G7LA 1J19A 1GNUA 2BYFA 4H7BA 5A35A 3Q22A 1JR0D 4BWGB 1H9RA 1JALA 4IWOA 1N62A 3K5OA 2IHEA 3OPOA 3AE7B 5D3IB 1TS2A 4DWFA 2LI5A 3UDFA 3TP7A 3KDFB 4EGVA 3TZDA 4RNAA 4MEMA 2SEBD 1F2LA 2JA5G 4LJOB 4WQOB 3V05A 3AH7A 5GXGB 3P1HA 3CQZB 3L2PA 4YWKA 2FUG1 2KVRA 3NJTA 4AOFA 3KUZA 1BBUA 1E7ZA 3OYYA 4JI1L 4ZKCB 3PCOB 1A3TA 3H9DA 2C7NB 5LMNW 1FJGL 1MG8A 1CM9A 1Q10A 2B8FA 2A6EC 2Y3AA 1NSNS 2N78A 2LRWA 4N9TA 1UWXA 3PGZA 3TREA 2WU2B 3ZRCA 2K39A 4YL8A 4C3JH 2NB0A 3HOZG 4LF5Q 2R92B 1R4MI 1Y14B 4FHKA 1P9DU 4BKSD 2LRUA 1FIQA 1AZPA 5IGGA 1ZXHA 2H89B 2K6QA 1HFGA 4IPCA 3P4RB 2F0FA 3C0RB 2MP2A 1VQNA 3RI7C 4OXPA 2RR9A 2WFWA 1U4RA 4K7UA 2KHWB 4QY7A 4L5SA 2HT1A 4X65Q 2MGSA 4KKTA 1SNDA 1SYEA 3SXHA 3V96A 3EHVA 2F3WA 1XNQL 3MP9A 3FMCA 1VD2A 1ZXIA 1R4NB 1IKLA 1L0XB 5EJWA 2UXDL 5IT9c 2M0XA 3ZVVA 4FBJB 1V5TA 4HR7B 3TSSA 1AZQA 2UUAQ 2FE8A 1AE3A 2PQEA 4P7IA 1GHKA 4EOYA 1N34Q 1WH3A 4EZLA 3QO2A 1Q12A 3N6RA 1L0WA 3OW2A 1QWYA 3D4WA 3I4MH 3B1LX 3ZTDA 3SDZA 3K5LA 3PUXA 4WURA 2F0MA 2ID0A 2GBKA 1LTBD 2F1MA 2LHDA 4WJNA 1YNJD 2LS01 3K7AH 5I4DA 4F7XA 1E7VA 2N7JA 4P1CC 4LNQA 1L4DB 5C44B 3A8JE 2LKVA 4XQJA 2AUJD 4WQMA 5I6YA 1WX7A 4IKGA 1P8LA 1IYJB 1O7ZA 1UE7A 4DR6L 4WWNA 2E74C 2KECA 4A6QA 3CQZH 5FO7B 1NAPA 3V6CB 3RUZA 3KJPA 4W9KA 4ABNA 2SDFA 2KHIA 3PIPA 3CCRA 1WTRA 4HK2A 3H6MA 4ZHOA 5JJIA 1NTGA 2K5DA 3P4SB 1YJNA 4DAMA 4YCWA 2O2VB 5C3WA 4US9A 3QIAA 2B2YA 1YIWA 1X56A 4MIUA 2MBEA 1BKBA 4NP5A 2UU7A 2I5MX 2IGGA 1PHJA 1MIUA 2OJWA 4TKOB 1DOLA 3PV0A 4BY7B 2KCTA 1C4CA 1HZ9A 2EDGA 1ZPSA 2R92H 1R9TH 4L5TA 4IOIE 2DLBA 1HCZA 1IYUA 1TWCH 3AE8B 1JMLA 3I5JC 3HOUB 1JROA 1PRTD 1RAXA 1STBA 2MPMA 2L12A 1KDCA 4A3GB 3CCSA 3MTSA 2NMQA 4TQ1A 3DDCB 4K3CA 1WIAA 4M8MA 3SEBA 3R3MA 4WJ4A 1I4HA 3Q3FA 1TY0A 3EN2A 1YHAA 3S17B 4EZKA 4V190 2KOLA 3K81C 3FHWA 5GAGC 3RN2A 2ZPNA 3P4QB 3ZNZB 3OAWA 3CF6E 2Q2IA 2IHFA
chains in the Genus database with same CATH topology
1S5DD 3K58A 2E2JB 1JOKA 1P7EA 4HKZE 3U7ZA 1Q8IA 3SK4A 5K36G 2GRIA 2IGDA 1QT9A 3NWSA 2EPBA 4M0WA 5HHDG 1ZYRC 4KY5A 1FM0D 4LK1C 3NQTA 4G4KA 1ILQA 3ZYYX 4Y7NB 5NUCA 1ZKOA 4YTNB 1RM6C 3RMHA 1EWHA 5E6JA 3DWGC 2BW2A 3HP3A 4WORA 3EA6A 5C4JB 2IL8A 1R7SA 4IALA 2JYTA 1S4ZA 4I7ZC 3VA5A 2Z8LA 1KTKA 3E0JA 2J7ZA 1YQ4B 2SNSA 3NZ3A 1G8ZD 2NVXB 4J8QA 2NN6I 1FO4A 1MHXA 1AFPA 1EL0A 4E6IA 1EY5A 3MC0B 4BA1I 2A6HC 1HA6A 4G7HC 3KQ4A 4KV6A 1S5CD 1YNTE 2K1BA 1DOMA 2F0PA 3VRBB 4WAFA 1EFID 3HEJA 4JBWA 4KGTA 2EELA 4L6TB 4HEA1 1STEA 1EIHA 4OZCA 5K5PA 2HDLA 2SAKA 5J39A 4A3DB 1PYWD 4PNYA 4KGSA 4NDXA 2WXKA 5KYIA 3I70A 2N9KA 2NVYB 1XO3A 2LMCB 3SK6A 1V1OA 3I72A 4HKQA 1C76A 4C3JG 1LTID 2M9VA 3VR2A 2E2DC 5CC4A 2J42A 1XX8A 2DYOA 2V0GA 2D5DA 5BYRA 3T51B 1D5XC 1OFFA 3E5SA 1B53A 3D6WA 1GAQB 2INNE 1RFKA 5E4WC 1Y8PB 5IT9L 4IDIA 3RPFC 4YWGG 2WXFA 2WAQB 4K6DA 2FHTA 3VA7A 4KJOA 1TVXA 2E2IB 3GTOB 2KMMA 1AEXA 4MT5A 2AWOA 2W54A 1SEBD 5KIXA 2N9LA 3VR9B 4H13C 5LL6X 1QOGA 4AYBB 3MFGA 2EVBA 2BCOA 3VYUA 1X3QA 5M5WB 4A3BB 1ACCA 2XN9C 3BYYB 1K8MA 3AEBB 2ACZB 2IPKD 2EYMA 5BYSA 2R7ZB 3BVGA 4KKIA 2L4NA 1I6HB 2BE5C 1RYJA 1ET6A 1DYQA 1M4VA 1N5XA 1Q1EA 4KKUA 2RA4A 4PMCA 3I73A 4NKLA 2KDMA 1K8OA 3HOVB 2EYHA 1YJJA 1HTLD 1ENCA 2HTME 1TT2A 2PZTA 3GB1A 3G6JB 1AYFA 2A69D 1EQVA 2GB1A 5CMDA 3IT4B 4ZYSA 2BB6A 2V4IB 2N0SB 2KUMA 1Y56A 4NAMA 4FXDA 2L11A 4MHEA 3S2DB 3R3OA 4Q2JA 1SYCA 4EVOA 1Y8OB 4PT5A 4CKBA 1KF6B 4X3KA 3VYTA 2RMMA 2SNMA 3TP8A 1V1PA 1EY6A 2V4DA 4XYOA 1DXMA 1HHVA 5DEHA 3DHQA 4X3SA 3I90A 4GLSC 4WH4A 2CU3A 1A2UA 5IOCA 4OW0A 4BBRB 1ML0D 3BS1A 1YN3A 2WLBA 3M7GA 5FKAC 4A90A 2CHBD 1EWYC 1F9RA 3Q8AA 3AEGB 1XEEA 3EJIA 2G9HD 2JYOA 1RHPA 1N5WA 3KLRA 3NPPA 5KGUA 4KY6A 5JPNC 1B3AA 1RDPD 3B2FA 3IXSA 5I2YA 2MUYA 2BBCA 1L5PA 4H0LC 2B2WC 5C0XJ 3AEFB 1H9SA 2MJEA 2VXWA 3NK9A 1DGJA 2J0TD 2JEAI 3F2UA 5FLXE 2NWGA 5I9PA 3OIQA 4KKJA 3VQIA 3J81E 1U4MA 1DJRD 1ZUD2 1ZP0B 1V43A 3RD4A 1ZDVA 3Q0AA 4N58A 2NTSA 4JX1C 4A3KB 1QJOA 3L7ZC 1MGSA 1FCLA 2W3SA 1XCTL 1NENB 1DD2A 3ZJTA 4FXCA 3GD7A 1UGJA 3WOEA 5I6WA 4B0EA 1SDFA 1QILA 2NN6H 1BCPD 1GB4A 2I07B 2WXIA 1RKNA 2OEDA 1Y1VB 3WCQA 4QIWB 3GTMB 1IW7D 2MJDA 1EYCA 1LT3D 2L52A 1HUNA 1STGA 3NHHA 5G5GA 3H8HA 1F2MA 2L55A 1IGDA 3SHLA 3M4YA 1MI2A 4LJZC 1C4PA 1B9MA 5DM73 4IUTA 1G291 1E6EB 3ONAB 3W1SA 2K01A 4L23A 1CQFA 3I8ZA 3L3OC 4EQOA 4DK1A 4C2MB 4C1NK 5T1GA 1VJKA 4QF4A 1WD0A 4IFDJ 4K2KA 1GUTA 2QF7A 3MXUA 4MM3B 3MFYA 1QQRA 3RZDB 2ON8A 2K33A 3S14B 3AE2B 2QILA 1SMYD 1TQOA 1WTOA 3MEHA 4KK7A 4FF1A 1NYRA 4L2YA 2XSCA 1V8CA 2B8GA 4PMWA 2B2VC 2WXLA 4C56C 1H9KA 3QOLA 1Q3LA 2F0GA 1F9PA 1WVLA 2WXMA 2L5TA 2QIEB 1C79A 4IQZA 3NUCA 1TY2A 1L0VB 4F8MA 5CV8A 1CJEA 1PFNA 2ICEC 1UNSA 5G3LF 4BS9A 3AE6B 5CBEE 5DNFA 3VRAB 1CHPD 1ESRA 5FO9B 1Z7TA 2I38A 1L6UA 1D6EC 3J80E 1E0BA 5IIFA 3FAHA 1QCBD 1VR9A 2K5PA 2WXRA 5EPKA 1IL8A 5JJZA 4WWMA 5EBCA 3JAML 1SFOB 4DF7A 3O13A 1HQRD 2IT1A 3HZXA 2JQRB 2QJLA 2QCPX 3LWEA 1SB3C 3BG3A 1XLPA 2PYKA 3S15B 1J7CA 1RCVD 1DOKA 4XQNA 1GB1A 3NXWA 3K6OA 4HN7A 4DXFA 3IAYA 5D7GA 4RF0A 2F0EA 4GDLB 3MXNA 4P2CB 2XRQD 2DNEA 1XF5L 4L63B 3T56B 3B9JA 3UI3A 3PUZA 2W55A 3H3VC 2B2TC 3ND9A 1Y1WB 3IKJA 2K22A 1SSOA 2E76C 1VZ6A 1XLOA 1PFDA 3P7JA 4ARCA 3C3LA 1R4PB 2A68C 5COYA 3Q8CA 4GZYC 3H94A 1BOSA 1CTMA 2WXQA 4HJGE 4A93B 4ULLA 1BUIC 2PPBC 4PQXA 1PTOF 2R61A 3AB9A 4CJ1B 4LLGM 4MACA 1SYBA 3J9CA 1IBXA 4F88A 3HOXB 2JYEA 3OOCA 4IURA 1ENAA 4FYDA 1OQQA 5C3XA 4C3HG 2IGHA 3SFEB 3DM1A 2BS4B 1HXYD 5C3EB 2NN6G 2BDNA 5BMGA 4WFN3 4A3EB 3DWQA 4PV1C 1TYGB 1B44D 4K8IA 4WRDA 4RCNA 2J52A 4K14A 3ETRA 5MPOA 3BYTB 1ET9A 1OO9B 1IGCA 3BZDB 1SJHD 2DBYA 1G91A 4A3FB 4IFDI 1ZXTA 4CBVA 4D2KA 4HMJA 3IL8A 2H88B 1WTQA 2WXGA 1DOYA 2B76B 3P4PB 3W5VB 3H91A 2Q8RE 3R8BA 2DWQA 2B2UC 1TS5A 2E3TA 3KBGA 3ZJUA 1AN8A 3EROA 1J7AA 4B0MA 2KEEA 5HGTA 2PO4A 2E2HB 2MP1A 2LFIA 1K52A 3D8GA 3TMEA 1N60A 5JEAJ 1TKEA 4A8XC 1TIID 1N63A 5BMIA 1PGXA 1FFVA 2NYZD 1OXTA 3OHXC 2QEJC 4V0BA 1CFMA 1B1ZA 2EXZA 2F0UA 3HRZC 3S1NB 2BDOA 2Y5CA 3PO2B 1ZDXA 3NBHA 5ELFA 5M3MB 2CW0D 2FMMA 4L1BA 3I4LA 1S5ED 4KKSA 3BWUD 5JOBA 2G9DA 1JOQA 1J8IA 1FYCA 3W5UB 2K03A 3I91A 4QCLA 1I4RA 2F3VA 4LTUA 1B2TA 2HUGA 2NVTB 1YJIA 4NJCA 4IUPA 1HTPA 3UI2A 2KCNA 3HVDA 3TP5A 2BYTA 1KNEA 4XIGS 1WSPA 2K9XA 4IUNA 2OT2A 2QMTA 2KQ3A 2RSNA 3HUIA 2W3RA 2X69A 1CZPA 1ZE3D 2LEKA 5ELBA 2LHEA 2WACA 4I65A 1STHA 1QF6A 2PW9A 1GUSA 2C9OA 1LTRD 2K28A 3PUYA 3D4RA 1Y69U 2Y5PA 3OWFA 4EE2A 2NTTA 3FRPB 2W82A 1HPCA 3VR5A 5EQ0A 2A6ED 3QB3A 4H44C 5JVG3 3IAM1 4A3MB 2BS3B 3ITPA 1LTTD 4XXEA 3R2TA 2F0IA 1GJXA 2I2YA 3H0GB 1NR2A 4NMZA 5CV9A 1FNVA 1PZJD 3NRZA 2B39A 2L1BA 2EE1A 1TKGA 1E0ZA 3AECB 5T8IA 3S16B 4OHJA 4R9WA 5AUIA 2HDMA 4FNFA 2IDYA 3HG9A 5D65A 4RWSC 4XT1B 1UUPA 5CV4A 5A2QE 2HQEA 3NE5B 3BDOA 4FXKC 4NZLB 1EU4A 5IGCA 3ABVB 1L4ZB 1JQ4A 2WP9B 1QLBB 4BA2I 4A3IB 3C1FA 4KY7A 4KD4A 4X3TA 4OL7A 3NS1A 3KBXA 4OZBA 1BO0A 2VUMB 4IN3A 3BK2A 2ZT9C 5EKLA 2CJOA 2EYLA 3FEWX 1JCKB 1TJEA 4DNTB 3U9OA 3AMZA 3L4PA 4J1MA 2EY5A 1L6VA 2RDGA 4HCEA 5FLXL 3PO3B 3D6CA 2AX5A 1G2TA 2JSOA 3J81L 1PMRA 3OWEB 1CA5A 3GV6A 3U9SA 3I9V1 1PGBA 5FR3A 3T53B 4HMIA 4ZRPA 1A3UA 2WKDA 1XWEA 4RA8A 4BBSB 5G5HA 2M2LA 1SAPA 4K5VA 4OGQC 3VR8B 3M3YB 4KJNA 1JW9D 2LGIA 1GUNA 4RHRA 1AWDA 3AEAB 1FMAD 2Z4IA 3PUVA 1JORA 1H9JA 2KCCA 1KABA 5ELCA 4LAAA 4U673 3LWUA 2R3ZA 4YSXB 2K32A 3V3XA 2JP1A 3FPPA 3GTJB 1ZYRD 1J7BA 3AE5B 2KWDA 1O78A 2L0CA 3SFDB 4XT3B 3SR6A 1UWMA 2YEPF 3D31A 3MHBA 1X3PA 1D4BA 2WDVB 3K5NA 3J7AF 1JWAD 2L1AA 3K5MA 3PIO3 2TMPA 1B9RA 5CV5A 2B2YC 3FVQA 1I6VC 5IGEA 3GV3A 2B63B 3MA2B 2FJ2A 2PZUA 3NUHB 4RGMA 5CR3A 1PLFA 1VMPA 5EKIA 3A54A 2N55A 2WDRB 2A6HD 2J53A 1PTOC 1HZ6A 2QSDA 2RBMA 1PZKD 1FNUA 1PUTA 2K7VA 3C46A 1EEFD 1TWHB 2JXTA 4JE3B 4FF3A 2EOTA 1WRIA 3Q69A 4FP5D 3AV8A 4RHSA 1IHZA 2JA7B 1LT5D 1ONLA 4XWWA 2JEBI 1KNAA 2O5JC 3P63A 4DQOC 5FOBB 3J80L 4IUVA 2IX3A 2BA1A 2IX0A 5JAVA 2CJNA 2L9HA 1HFNA 3S2HB 2WS3B 5CBAE 1PRTF 3IAS1 3PO0A 1XTCD 1I4XA 1BDOA 1D2BA 2F03A 2PCFB 4JK1C 1KDAA 3IT6B 1JQYD 2X6GA 2MJ8A 3T13A 4GDKB 3NVWA 2WXNA 3OIPA 2F0KA 4X3UA 3ZJVA 2TSSA 1TS4A 4RCOA 2WXJA 4M1UB 4CJ0B 1RTNA 1GXDC 4WIPA 3N9YC 1LABA 1STYA 2D62A 2KVMA 1ESFA 1DZ1A 3MAQA 2WXPA 2K05A 2BE5D 2F0TA 2A74C 3GP7A 3K57A 2LY7A 2ENBA 2EKIA 3TN2A 3H09A 5HG2A 2JA5B 2KN4A 4OZAA 3C1EA 4RGTA 1KLUD 5FK9C 2EYJA 1HQMC 3GTPB 3ERQA 1T5XD 4Q5VA 4NW2A 4HSPA 1E7PB 3NWTA 5I2XA 3HRDD 1GOZA 4K2LA 4CGYB 5D14A 1YQ3B 4JPSA 1YMHE 1K83B 1EYAA 3E6ZX 4A3JB 2MHVA 3MZ5A 1VRAB 3KK7A 5CV7A 2KACA 1TR5A 2WKCA 1SXTA 3S9WA 3AN1A 5KEEA 2IJ0A 3AE1B 3VR6A 2LJIA 2ICIA 2AQ2B 2YYZA 3NTKA 3VR4A 1CQVA 1AP0A 1F2YA 4ZK9B 5J1ZA 3I3CA 3OMCA 2RQXA 4OO1I 5LL6S 1ENFA 2AWNA 1Z6HA 4XDXA 4ITKA 1KLGD 3AMUA 1EYDA 1OXVA 2K5QA 2O4XA 2XWBB 2FBWB 2WQYB 2WDQB 4OVZA 1WTVA 1JRPA 4B9WA 2C5CA 4L8JA 3DMUA 2PZWA 4FVMA 5C6AA 4KN4C 3AE4B 3P20A 1GUWA 2WNMA 1GUGA 2M19A 2PIAA 5HI1A 3HGBA 4YSYB 1PTOB 4XYQA 4ZLTF 4TQUS 2LMCA 4YTPB 4J3OD 3MXPA 3TDQA 2DYMA 2EY2A 5CGKA 4KD3A 1LO5D 5AUKA 5CYUA 4BY1B 3W3AA 1TWGB 2KJXA 5T1IA 1EY7A 2KQ4X 3P1MA 1EEID 5EE0A 3TEXA 2WINB 2BT6A 3KF8A 2IX1A 1IKMA 3A55A 3S1RB 2R93B 5AFWA 3VYSA 2EYFA 5IGBA 2PLPA 1DOIA 2F0QA 1STNA 1RODA 1LTGD 1C4QA 1SNOA 1N61A 1C77A 1PDQA 1C8CA 1KFYB 2WXOA 1B9NA 2F0SA 1TU2B 2DY7A 2V3PA 5C0XI 2AQ1B 1HZ5A 3J7AV 4MN3A 4LK0M 3NVZA 2EY6A 1RTOA 1T5EA 5KNDA 2HDEA 3LB8C 5C4XB 2PW7A 1JB3A 1FRRA 1TS3A 5H8YE 1DOXA 5E3FA 4DAPA 3MXGA 2K6AA 1UAPA 3KWVA 3CHBD 2WIIB 2Z1CA 1WTPA 1VLBA 2EYPA 3FDTA 3IFDA 1VMCA 2K04A 1PFMA 2GA4B 3OW7A 1JOOA 1TKWB 1WWTA 2H1EA 3NTHA 2F0VA 4IZ8A 4H2AA 3VYRA 1LT6D 4ZAIA 5BN5A 3QJYA 2XIWA 4KX6B 1BR9A 2X38A 2G1EA 1SNMA 1SE2A 1FNWA 3AB5A 3CRLC 3T3OA 1I4QA 1PXUA 3U52E 3GTLB 1MVKA 4C3JB 4N6EB 3LNNA 2E6XA 4HAEA 2F0JA 2F0HA 2AQ3B 3LYYA 3GS2A 2OEOA 1UEAB 2VZKB 1VF7A 2ZXRA 4AS1A 5IGDA 1E9MA 5I9OA 3U2SC 1EY4A 1HA5A 1YNJC 3EUB2 4ZHPA 2N88A 4CQNA 2PMVA 4RH6A 5D3DA 4C7YA 3M85A 3TEYA 4A9AA 1MI0A 2L32A 4NAWB 1BCPF 3N52A 1C78A 2Q8IB 1TZOA 5ELEA 5HURA 4DNRB 1B4OA 2KEDA 2H4OA 2NUCA 3B2GA 2MEKA 1HRJA 5M5YB 4TMAB 5JPMC 1C9FA 4ZUIA 4OIKA 3K7AB 2BB5A 4Q0FA 1MSHA 2HCIA 2QKIC 1FFUA 1ILPA 2O5IC 1K50A 2O2LD 2ZW0A 1PRTC 5TSSA 3ZGZA 1C4AA 1F9QA 2JSVX 1BBXC 5CV6A 4OO1H 1MSGA 2WU5B 1VDZA 1I4GA 3KUPA 1FD7D 4XWTA 3D3RA 2A68D 4YIJA 4EQPA 1YNND 1WD1A 3URYA 1R9TB 2K3UA 4B08A 2L83A 1TWCB 1E2VA 3BK1A 2RDFA 3C8YA 1QNKA 1FR3A 3U4EG 4JWSC 4DXGA 4R3DA 3FPUB 4QUFA 4HRSA 3TBIB 1V1PB 2M00A 1BQQT 3M7NA 1FEHA 3PZ7A 1EU3A 4HROA 2PMZB 5KNCA 3Q24A 4CJ2C 1BXTA 1JWUD 2JZPA 1D5MC 5C2TB 1HUMA 4ME5A 4XQQA 4DGZA 5M9OA 4EQNA 4TRDA 3CWIA 5HFYA 1LT4D 4C3IB 1U9RA 3JAME 1D5ZC 2NBFA 3DWAA 1G6ZA 4Z9CB 5KNBA 4RF1A 5C5LA 5EGTA 4P6VF 1SE4A 3FILA 2OF1A 5M5XB 5EE1A 4XDDA 5JVH3 4HTHA 4RGNA 1H9SB 3RZOB 2K0PA 3EVQA 3IFTA 4AQ7A 4IUUA 3NQIA 2IW3A 3BIID 2PVGC 1B50A 3D4DA 1ROEA 5EBDA 1V8QA 1MPEA 5C0XH 4B9XA 4US8A 2XVSA 4CHTB 3HOWB 2YEPB 3RLFA 1OXUA 1NCVA 1JICA 3GQBA 1A3VA 1BF4A 1QB5D 5BN3A 3Q6SA 4MH8A 3CKIB 2I46A 4FO2A 1BMLC 4WJWA 2FFKB 4HCSA 1TKYA 4JWUC 5IODA 2XRSD 4ZQ3A 3WDNA 4DFAA 4LMQD 1J9OA 1RJTA 4IUQA 4ID6A 1F77A 4A55A 1WTXA 1WYGA 1F9SA 2MJ3A 3FC4A 1BUVT 3V2TA 2K5WA 1KDBA 2Q5WD 2KA7A 1TWFB 2Y0SB 1LACA 3Q8BA 1CT1D 2KHSA 2Z4HA 1MHHE 3E56A 5E4XA 3T4AC 4KI0A 4TSSA 2B2WA 1XLQA 1JE4A 3ZQ4A 1T6BX 3VR3A 4DAVA 4IFDH 2DY8A 4S3SA 2V3NA 3PIP3 2DN8A 1M8AA 2BS2B 2A69C 1CK1A 2PNRC 1PRTB 2EYOA 4QB4A 2JA8B 4OO1G 2Q8TA 1A2TA 1DM0B 4KMUC 2F0LA 3MJ5A 4DA2A 3AEEB 4PMBA 3BDLA 5LHY1 5EE9A 2KAJA 2LUMA 1RF2D 2JE6I 3FKIB 4CKCA 3RFZB 3I57A 3QOJA 1QOFA 3M4OB 2VNUD 2INPE 3MHZA 3KWLA 4ARIA 3S1QB 4C80A 4K8JA 4N9PA 3T16A 2WV6D 2JXMB 1Q1BA 4O1NA 1MD2D 1FCCC 1DCZA 3A56A 2WP8J 4ZKBB 1WTWA 2BOSA 1XXGA 1F2RC 1W6JA 3GTQB 4CKEA 2PKOA 2BTEA 1EZ8A 4UDUC 1OQRA 1JWSD 3A8KE 1SYDA 1CHQD 1SJED 1WCMB 3DUZA 2F4IA 1CZGA 3EQLC 4XDCA 5G3LD 1KRHA 5DM63 1PZID 5BMHA 3TEWA 3DEOA 3X3MA 1XCQL 2XNAC 5ELDA 1WGKA 3P75A 3DWMA 1VCIA 2FINB 4M8AA 4RKLA 3PUWA 1P7FA 1SSNA 1V97A 3J7YW 4ZRQA 1PDXA 2RDHA 5EKKA 1F2RI 1YN5A 4XTCS 2B2VA 1QE6A 1BCPC 3QWNA 3CU7A 4G57A 5C3JB 5C0XG 3KLSA 4P16A 2JA6B 3ND8A 1IBXB 3EGRA 5KRUA 1Q90A 1H9MA 1JWBD 1IW7C 3Q23A 1KH0A 1VZ7A 3R2IA 2LFNA 1T3QA 1QOHA 4C7ZA 1EIGA 4C3HB 1WXQA 1SNCA 3LXFA 1OXSC 4QUCA 5CORA 3NBIA 1XLNA 1S5FD 3HVZA 1ZEQX 3NTIA 3TZUA 4G7OC 3AEDB 3MVVA 4YTMB 2NVQB 1SNPA 4KGRA 1VZ8A 2CVRA 2E75C 3Q8FA 1TWAB 2GI9A 3QG1A 4C3IG 3W2DA 4HSVA 5EPLA 3KLSX 3R93A 4K6LA 3C2PA 1CI3M 1W6KA 5IGFA 3A7AB 2J4XA 4FF4A 1PTOD 2JX5A 2NZ1D 1LTAD 3SR1A 1JWMD 2EY1A 2ONQA 2M56B 3CIRB 2HCCA 1HEZE 1SMYC 1G2SA 4RKBA 3SK8A 1EZ6A 4U68A 4REZA 1I4PA 3WOFA 3HOZB 4ILWA 5H92C 5BYQA 1EWCA 3P42A 1I3QB 2B2TA 1EY8A 1ZOYB 2F0OA 3SVMA 3LX0A 4IFDG 1EY9A 3DXJC 3OSOA 5JEAH 4K5WA 4KTAA 2ZW1A 2JWUA 3GTKB 3BVZA 2AUKA 1LV9A 3S1MB 3TEZA 2PVOD 1FD6A 4KHVA 3NP8A 1K53A 1O80A 3K59A 1SYGA 1QOAA 2EJFC 4USAA 1A70A 3EFXD 5IT9E 1ICWA 3MWYW 2RKSA 1A6XA 4RFBA 3K0YA 1E2ZA 2D5GA 1NUCA 1U4PA 1K51A 3DEPA 2A73B 1GUOA 1PFBA 1FGBD 3AE3B 1DONA 1OXXK 5EPJA 4N59A 3BVMA 2RVLA 3GO5A 1Z47A 2B2UA 3SK5A 4F87A 1L0YB 1EY0A 1S5BD 5C4HA 5JXVA 2R6GA 2VB3X 1C48A 1SBBB 3FILB 1YN4A 1VDVA 3HKZB 4R8IA 1LLRD 2EJGC 5KYLA 4ODGA 1NR4A 2D2CC 1U4LA 2F0WA 3TP6A 3PZ8A 2D9UA 4G7ZC 2PTLA 2DNCA 3HS0C 3AM9A 1BNZA 1NVID 3AU7A 5FO8B 2VZKD 1A15A 3A7LA 4FF2A 4XE0A 1I50B 4DU9A 1NEKB 2IWHA 1CA6A 1I7HA 5ISRA 5C5MA 3I4NB 3TUOA 2PW5A 4YXDB 1FRDA 1E10A 1II3A 1F2ZA 4RAUC 2JU6X 2YU9B 2XWJB 1PGAA 4OIJA 1FXAA 3T3NA 1BCPB 1GPXA 3X3NA 1QOBA 4K5XA 4UAIA 2OXPA 3OMGA 2MH7A 4C1NI 4YSZB 3Q8EA 1JC7A 1Y8NB 1XYIA 3GTGB 4YT0B 5EE3A 3W9CB 3AE9B 1EQTA 4HEDA 1IUEA 2BA0A 1SF0A 1SIJA 2M0AA 2FMCA 4ZRZA 5J22A 1R4QB 5DAUA 2QDBA 1RWSA 1PTOH 4ZUJA 1O7YA 2A5HA 1KAAA 1SNQA 1QNUA 2ZXPA 5E1FA 5M3FB 4KHZA 5F2DA 4QMGA 2F0NA 1RD9D 3CRKC 1STAA 1SYFA 4KN7C 5K36H 3HOYB 1MBYA 1IYVA 2VB2X 3A8IE 1SE3A 3L9AX 4O42A 2WXHA 1LTSD 2EZVA 5A2QL 1X32A 1QKZA 5BN4A 1VF5C 1O7LA 2CW0C 2EJMA 1D1KA 1YNNC 4DK0A 4ZOHC 1EM7A 5LNK1 3NVVA 4DAYA 4DN4M 1CZWA 4RGOS 2RSOA 2X6LA 3NSWA 1D1IA 3SE0A 3E9SA 2F0DA 5JEAG 5C4ZA 2OHFA 2ZXOA 1FXIA 2SOBA 3BDCA 1E2WA 2RPVA 1GHJA 3NVYA 1F0ZA 2WB1B 3PMFA 4FXGC 4J6HA 1NI3A 2CQAA 1NYQA 3I4MB 4R8NA 3DWPA 1EOTA 3G7LA 4H7BA 5A35A 3Q22A 1JR0D 4BWGB 1H9RA 1JALA 1N62A 3K5OA 3OPOA 3AE7B 5D3IB 1TS2A 3TP7A 4EGVA 4RNAA 3TZDA 2SEBD 1F2LA 3V05A 3AH7A 5GXGB 3P1HA 3CQZB 2FUG1 4ZKCB 1A3TA 1Q10A 1CM9A 2B8FA 2A6EC 2Y3AA 1NSNS 4N9TA 1UWXA 2WU2B 2NB0A 2R92B 1FIQA 1AZPA 5IGGA 1ZXHA 2H89B 1HFGA 3P4RB 2F0FA 1U4RA 2MGSA 4KKTA 1SNDA 1SYEA 3SXHA 3V96A 2F3WA 3MP9A 3FMCA 1ZXIA 1IKLA 1L0XB 5EJWA 4HR7B 3TSSA 1AZQA 2FE8A 2PQEA 1GHKA 3QO2A 1Q12A 3N6RA 1QWYA 3D4WA 3SDZA 3K5LA 3PUXA 4WURA 2F0MA 2ID0A 1LTBD 2F1MA 2LHDA 1YNJD