1DYQA

Staphylococcal enterotoxin a mutant vaccine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
228
structure length
228
Chain Sequence
EINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFRQHTILFKGFFTDHSWYNDLLVRFDSKDIVDKYKGKKVDLYGAYAGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN A MUTANT
publication title Structural Basis for Abrogated Binding between Staphylococcal Enterotoxin a Superantigen Vaccine and Mhc-II?
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Enterotoxin
total genus 74
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2000-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dyqA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1dyqA02
1PTOH 1KTKA 1JR0D 5TSSA 3R8BA 1KLGD 4L63B 3BZDB 1LT6D 1I4HA 1S5DD 1FNVA 1CHQD 3W2DA 4DXFA 1RF2D 1D5XC 1BCPF 1SJHD 5ELBA 1YN4A 1F77A 1S5ED 5ELDA 1PTOB 5ELFA 1ET6A 1EWCA 1JWSD 3BYTB 2IJ0A 1UUPA 3BVGA 1SXTA 1JQYD 3MFGA 1ET9A 1DYQA 1HA5A 3SEBA 1LTRD 1I4XA 1PRTF 1RCVD 1LTSD 2NTTA 2WV6D 2O2LD 4RFBA 2G9HD 1LTAD 4RH6A 3R2IA 5D3IB 1L0XB 1CQVA 1SE2A 1S5CD 4RGNA 2XNAC 1LT4D 1PTOD 1SE3A 1DJRD 1LTBD 3V05A 5I4DA 1HQRD 4DXGA 4NZLB 3DWQA 1BCPD 1EU4A 1QILA 2Z8LA 1FNWA 1PTOC 2R61A 1G8ZD 2SEBD 1PZID 4K6LA 5FK9C 3MC0B 1M4VA 2XN9C 1V1PA 5ELEA 1V1OA 1RD9D 1JWUD 1SBBB 2XRSD 1TS4A 1UNSA 3O13A 1BCPB 4UDUC 1PRTD 2AQ1B 4RGOS 2QEJC 1HTLD 1TS5A 1L0YB 1CT1D 1FD7D 1LTID 3TSSA 1I4RA 3DWPA 1LT5D 4RGTA 1EEID 3EFXD 1CK1A 4L6TB 3BVMA 1FGBD 1YN3A 1PRTB 1SEBD 4TSSA 2RDGA 3EA6A 1PYWD 1YN5A 1PZJD 1D5ZC 1EFID 1LLRD 1TS3A 1BCPC 1D5MC 1LO5D 2QILA 1SJED 3KLSX 2CHBD 2J4XA 4Z9CB 1HXYD 1FNUA 1SE4A 1TY0A 3OWEB 1S5FD 3URYA 1PZKD 5D3DA 2TSSA 3DWAA 1TY2A 3GP7A 1PRTC 3CHBD 4RHSA 1T5XD 1LTTD 1PTOF 2RDHA 1LT3D 5FKAC 1V1PB 1LTGD 1XTCD 1TS2A 1D6EC 1B44D 1EU3A 1XXGA 4RGMA 1BXTA 4RCOA 1I4QA 2AQ3B 2XRQD 3R2TA 1I4GA 1MD2D 3BYYB 4O1NA 1ENFA 4RHRA 1JCKB 4ZYSA 1KLUD 1STEA 1S5BD 1ESFA 2AQ2B 1B1ZA 5ELCA 1GOZA 4BWGB 1AW7A 2ICIA 2IPKD 1CHPD 1RDPD 4C56C 2NTSA 1JWMD 1AN8A 1EEFD 4OHJA 1I4PA 3BVZA
chains in the Genus database with same CATH superfamily
2BH2A 2CH4W 1EOTA 1LACA 5JEAH 1T6BX 4E6IA 1I4HA 1Q90A 2JXMB 1GC6A 1V2YA 1EYDA 3JAME 1OQRA 4DXFA 4CDFC 1RF2D 5I2XA 2WDTB 3KH0A 2R3ZA 1DOYA 1SMYD 2N8NA 2G45B 1YJNA 3QWNA 4K3BA 1LYLA 4A3FG 4ZAIA 1EZ6A 3KLRA 1OQQA 2IO1B 4C3JB 2KFKB 1TWGB 3BYTB 3ULLA 5J3BA 1UUPA 1JQYD 5LNK1 4DNTB 1F9JA 3J9CA 2ZJQA 3SK4A 3ZUNA 2BBCA 2JVCA 3ONSA 4HEA1 5IODA 5MPOA 3HOZG 4JI2L 4FBJB 1LTSD 4JL9A 1HTQA 3JVZX 1MHXA 1EY6A 2JQRB 5I4DA 3WOEA 5JEAG 4NXNL 1WTRA 3AH7A 3RLOA 4IUNA 3BWUD 3WAMA 1YX6B 1SYBA 3KUPA 1G8ZD 5J22A 4XDXA 3STBD 1PH6A 1QOBA 1FXIA 3LXFA 1GD7A 3L7ZC 3W1BA 1X9NA 5KGUA 4DR5Q 4DR6L 1Q5WB 4ZK9B 1SBBB 1L0WA 3ALBA 1ENAA 2PZTA 3NJTA 5C23A 1J8CA 3GD7A 3ND9A 2F0KA 2F3VA 1STNA 3AECB 2AQ1B 1V81A 2JA7B 3LJ3A 3U8ZA 1EIHA 3PZDA 5C3EH 2EELA 1LT5D 4DR3Q 4JGHB 1CSQA 3SK5A 3M9BA 2R93H 1NAPA 1CK1A 1Y8OB 3EFXD 4DV6Q 3S16H 2KTRB 4DAYA 2CJOA 2EOTA 2VNUD 4BA1I 4MM3B 1X3FA 4TSSA 1TT2A 4BBSB 4AJWA 1DXMA 2HIVA 1XMOQ 3VUWA 1YN5A 4IDIA 4P71A 4X65L 2LEKA 3DBRB 3VUYA 4J1MA 1F9SA 1D5MC 3ZRFA 2HDEA 4GLAC 2JA8B 1T0YA 4WJNA 1A2TA 3L0OA 5BMGA 4BY7B 2BYTA 4HCPB 4CDCC 2KFKA 2V3PA 5C5LA 4ICVA 1C79A 1WSPA 3M62B 1RTOA 4IPDA 1WRDB 4GN4B 2WYQA 3VHTC 2EYMA 2O2VB 4HLEA 1VQFA 3L9AX 5C3EG 1Z6HA 3CHBD 3VA5A 4LFAQ 1KD1C 2R93G 3A8IE 3AB9A 3GTQH 1ZPSA 1GUOA 1IPGA 2G3QB 3I5JC 1YEZA 2EYFA 5HGQA 1XNQQ 3DOWA 2KN5A 4XWWA 4YWLA 3KK7A 4LF9L 1EM7A 1XTCD 1E0BA 1H8CA 2BGFA 3DUZA 2MBBB 5BR8L 1MD2D 4DR4Q 3SHLA 1YQBA 1IXRA 1F9PA 4MIUA 1E7VA 1SN8A 3Q6SA 1YBYA 2E2IB 2D0PA 2FUHB 3UQBA 4ZKCB 2PE6B 2LVQA 1VQ9A 1XO3A 4X62L 1WTXA 4LTUA 1HUNA 4YWGG 1PXUA 2R2QA 5HKHA 5CV7A 5A2QL 2KX0A 4GKJL 1XF5L 1K3BC 1I5FA 1VDZA 1XD3B 3NTHA 2E75C 1LFDA 2WP8J 3BDOA 3FPUB 3LWEA 1PH8A 5CYUA 1XPOA 1IBLQ 1O7YA 4GOPB 2F0OA 1DCZA 2KTRA 3WIMA 3TRZA 1F77A 4MM3A 4WJ4A 3KFUA 2PPBC 2RA4A 4A3DB 4A3BB 1WR6E 2L3ZA 3MTNB 4IFDI 1PDXA 5ELFA 3PO3B 2FFKB 2PW5A 1N36Q 2L00B 3BY4B 3QIJA 5IOIA 3JAML 4JBJA 3MHZA 1B9NA 4C2MH 3J80E 4P16A 1WRIA 4G50A 2NBVB 3F2BA 1L7YA 3W1YA 5BYRA 2WV6D 3BIID 1QOGA 2O2LD 1P7EA 1EQVA 4GB9A 2R7DA 1OTCA 5FR6A 1PMRA 1EQTA 3W1SA 4J6HA 4DKAC 4US8A 3KUDB 1E6EB 3DBLB 4XC2A 1PTOD 3Q0AA 1LTBD 1K9MC 3CC7A 2OJWA 2O2VA 2F4VQ 4B3TL 3TEZA 1FNWA 3KJOA 3JC66 4HSPA 2ASQA 1P98A 5IGEA 4IOCA 5FR3A 4RA8A 2MGSA 3M85A 3VAWA 2CQAA 1M90C 2K39A 1K0RA 5CGKA 1V86A 2F0PA 1C8CA 3NVVA 4UDUC 2REXA 3EJIA 5C44H 4JI4Q 4MACA 5LL6X 2PZWA 3A9JA 1L0YB 1NMGA 4PS7A 1B70B 4URKA 1RL2A 3VDYA 3DWPA 3CW2C 3HEJA 5AZHA 4DV3Q 2QSDA 4RGTA 2IBIB 2CW0D 4IUMB 4B3RQ 2BT6A 4REZA 3AFPA 4AQYQ 2YVCA 1I50B 1MJEA 4LF5Q 3J7ZC 3HVDA 2GA4B 2EDGA 1PZJD 3HGBA 3CCEA 4WWNA 1D5ZC 5H1SE 5IA7A 2HQLA 3N1ZC 2WU2B 4R4OA 1E1TA 1BUIC 1B3AA 4GOPA 2KWUB 5IT9c 2KHSA 2JA5H 5M3FH 3OJ4B 4EEWA 2FXQA 5CV4A 2GN5A 1Y56A 2PMVA 4LNOA 1I6VC 3RD4A 2GOWA 3FPPA 3SDLC 4BOZB 1JALA 1AE2A 3QAQA 2CWPA 1PV4A 2F0FA 3DWAA 5FO9B 2C7MB 4PZ6A 2G1EA 2LD9A 3GS2A 4W9FA 4DV4L 1CA5A 5EJWA 1H9MA 2QDLA 3Q8BA 1H9SA 2NR2A 3FILA 4NMZA 1XJVA 1SFOH 3PO0A 1CA6A 1E3PA 1V8QA 4OEMB 4ZQ3A 2GBJA 3IFWB 2FCMA 2F4IA 3CAMA 4LFBQ 2IL8A 1TGZB 2N7DA 3CMEA 3IFDA 4C1NI 5C4XB 4KGSA 5BYSA 3KVFB 1OEYJ 4A55A 1KQSA 4CYEA 1CZGA 2PTLA 2JA5G 1K8RB 2A69D 2BYVE 5BMIA 2LGIA 1GOZA 3AULA 2IGHA 2SOBA 1OXVA 3ZNID 1RDPD 4C56C 4KHPQ 3S2HB 1JWMD 2WAQB 3F8TA 2N3SA 3AYHB 5IGDA 1WXMA 4FF2A 2VB3X 2K14A 3NG0A 4MDKE 1UBIA 4NNJB 3R8BA 4HJ9A 1FRRA 2B2VA 3G4SA 4IUQA 2EXZA 1SIFA 2M56B 4XYCA 1BMLC 1QZHA 4KY6A 1OXSC 3WALA 3GO5A 4QIWE 4ARIA 4DHZB 1UE1A 2C35B 4K14A 3VR9B 4C4VB 1TJEA 2ALYB 3GTMH 1YX5B 3H0GH 4DDID 4E3CA 1ZOYB 3A5ZB 4DR5L 1EY9A 5C0XJ 4LNKA 1FPYA 3NK9A 2EKEC 3DXJC 5T8IA 4KMUC 2Y3AA 2L1BA 3RZOB 4NP5A 5JJIA 1QOAA 1R4NB 3PZ8A 3VDZA 1ET9A 5E6OA 1SYDA 4PQXA 4K8IA 1V1QA 1FM0D 3CXCA 3LYYA 2G4DB 2L4NA 4YSXB 2LRUA 2CJNA 1TBEA 2XWBB 3U4EG 1RTNA 4OO1H 3L17A 5AZFA 1K83B 2PW9A 3ULPA 4DR3L 5LHY1 4ALPA 3UE1A 4DV6L 3OMCA 3L54A 4BY1B 5EPKA 5FLXE 2DAFA 3DVGY 3J80L 1VLBA 4NKLA 2I1KA 4MJSB 1XMOL 1HTOA 1KIXA 4NDXA 3GTLH 4G11A 5G5GA 4QUCA 3F2CA 3T8MA 2AKWB 1CKOA 3UI3A 4QJFA 3H0GG 2KQ7A 1SYGA 4K2KA 2KK8A 1TS4A 4P1BC 4WJWA 3RZDH 2HD5B 2ZNVC 1UBQA 1WCMH 2M9VA 1TS5A 2KJ6A 3W3AA 1AYFA 4ME5A 4BBRH 1V97A 3UIOB 1GXDC 4KN4C 5M3MG 2VQFQ 4GNXC 3AEGB 5G3LD 4OO1G 2JU6X 4JI1L 4RF1A 3V2TA 2QEXA 1M94A 1EY5A 4JI0Q 4K0KL 1P9DU 4HIKA 4LF6Q 4LFAL 4DNIA 1VQNA 1TKWB 4KSLC 3PUVA 1XNQL 1NUCA 2K5QA 4ZUJA 1ZGUB 4QMGA 5M5XB 3H7PA 3HM3A 1RHPA 2ID0A 2V1CC 1E8WA 2JA6B 1C4PA 2V4DA 3QB3A 4MEMA 1LXDA 2INDC 2LGXA 1I3QB 4TKNA 4DR4L 4IM0A 1Y8NB 4KDLB 1VQLA 4KI0A 4YCWA 2F0MA 1EWHA 4BXXH 2GVBA 3C3LA 3SE0A 3ICEA 1V5TA 1KRHA 2H89B 1WCMG 2KXJA 2MSED 2WX0A 3A33B 4ME3A 2K6QA 1WVLA 2PVGC 1K50A 4C3IB 3VR5A 4B6WA 4AS1A 1BUVT 3M4OH 4WAFA 1T5XD 1LTTD 1YQ4B 1LM8B 4MH8A 4ZRQA 4MGIE 2F0DA 4E71A 2G4SA 3IHPC 2JXXA 1V1PB 1EF1A 1IBLL 3NRZA 3OIQA 1TWHH 2LUMA 1WX8A 5EE0A 4XYOA 5H92C 4NJ7A 1WXQA 4MJSA 3AU4A 4NY0A 2K8HA 1T0SC 1XTDA 1WOCA 3NTIA 1A15A 5BN3A 4KJNA 1PH4A 3AU7A 2GVAA 1N36L 2F0VA 4DPGA 4DV7Q 1P16A 3R66C 5IGFA 3ZKJC 1AW7A 3G6EA 1WD1A 4C3HH 4TQUS 4BXXG 4HRSA 3BK1A 3HOWB 1YMHE 3HZXA 2MP1A 4A4IA 3KF8A 1DZ1A 3PSEB 4KGTA 1I4PA 4YCUA 1PTOH 1KTKA 2NVXB 3E56A 1BOSA 2E74C 4KK7A 4YY3Q 4C3JG 2N55A 2I5LX 1DOIA 2F3IA 1L4DB 4JE3B 4ZRPA 4RAUC 1FNVA 3L0WB 4A76A 2NVUI 5T1GA 4DXAB 4X3TA 2ZJPA 1IKMA 2F4VL 3A1QB 1D5XC 3X0WA 2N9KA 2JA7H 2RVLA 3I2ZA 4JV5Q 1X55A 2K03A 2VY3A 4A3MB 3TEHB 3L3OC 3EBEA 1YI2A 1CFMA 3AEEB 4JC0A 4IOAA 2F0JA 4DU9A 4S3SA 2IJ0A 3GTOH 3M95A 4G4KA 1FVIA 4BKGA 1RFAA 1P3QU 5JZEB 1GUTA 3GZNI 5L95C 1PRTF 5DPTA 4RFBA 4RH6A 4YT0B 4ULLA 1L0XB 5KHOA 4N58A 4DV3L 2JA8H 1ZW7A 1K28A 2A1AA 2OXPA 1VQJA 3I70A 5GROA 5C1ZA 1DM0B 3SU8X 4AQYL 4PMCA 4C7YA 2HCIA 1TZOA 4LF5L 2KFJA 3IT6B 3CCUA 2JA7G 1U5KA 4A20A 4WWMA 5FK9C 1QCBD 2EIFA 3TDQA 5CR3A 4B9KA 3DLLA 1V1PA 2VZKB 1RD9D 2KQ3A 1RJTA 2LVOA 3HIZA 1WTWA 5C2TB 5FLXL 2B29A 3I3TB 5IP7H 2KQSA 1SNPA 4EZKA 4BBSG 4RGOS 2OTLA 1WF9A 3EFUA 1E5WA 3CWIA 3S1MB 4MGKE 4WWOA 1UEBA 4DR2Q 2I38A 1T3QA 2JA8G 4YHHQ 1H9RA 3TP6A 1S72A 3I4MH 5JJZA 2E2IH 2JRIB 1IBXB 3V60A 4POFA 2V3SA 2MO0A 2JZZA 1EFID 5DNFA 3I4NB 2DY7A 4LFBL 1N60A 4HJ7A 2DN8A 3ZYYX 1VQ5A 3FRPB 3PHXB 1CKMA 3G71A 1ILPA 4CKCA 2M00A 1NYRA 4POGA 2RSOA 2Q2IA 4UPAA 1NJIC 4G57A 1YNTE 3SK6A 4A3CH 3LDZE 1QE6A 2GB1A 3EN2A 3EIVA 1G2TA 5IP7G 4HJKA 1HH2P 2WS3B 3HK0A 4ZRJA 4E74A 2OQKA 2KWDA 2MNAA 4KHPL 3VVWB 4K81A 4EQNA 4A3BH 2JXTA 1BBXC 4K3CA 3APFA 3PO3H 2OF1A 4CJ1B 3UQAA 2JZ3B 5C4JB 1R7SA 3MEHA 1WYDA 2K8CA 2LGSA 2JSVX 4JLCA 1A6XA 4DBGA 2UXBQ 3CC4A 4JX1C 3NELA 3Q8FA 4KJOA 1D7QA 1E2ZA 5JPMC 3C8YA 3R2TA 5IWAQ 4BA2I 5FO8B 5EKIA 3TP8A 3C2PA 3S17H 3SGIA 4S17A 4A3EB 4A3CG 3AMUA 1XT9B 4GDKB 4OWWB 3ZRCA 5KRUA 2C7HA 1L4ZB 2GBRA 2B63B 3ML8A 4J6IA 4RM9A 3N32A 4NAMA 2E3TA 1VQAA 5I2YA 2DZJA 1AP0A 4A3BG 4A3DG 3PREA 3QK0A 4GSWA 1WTHA 3PO3G 4W9JA 1Y8RC 1DOMA 3VH4B 2K01A 3PIO3 2W82A 3P2BA 4F8CB 2WGSA 1R4MB 4O0AA 1P7FA 2Y5CA 5EAYA 3TS0A 3DEPA 5KNBA 2CHZA 2EYHA 2NZOA 2AWTA 3P4SB 4ZHOA 3BS1A 1PQSA 4X65Q 1NE3A 4RF0A 1DGSA 4YWMA 2BTEA 1WMHB 2Z0SA 3GV6A 2Y0SB 2Z4HA 1I50H 1ASYA 1JRPA 3NY5A 2EMSA 1SRUA 1B9RA 5C3XA 2J53A 3HOXB 2N9PC 4HXDA 3NBIA 2EYJA 1B2TA 1MHHE 5DM73 1WH3A 4NPSA 5EPJA 3SDZA 1T5EA 2ZM6Q 5D6JB 1V43A 3S1NB 2KHJA 3BDCA 1T0RC 1BBUA 4ZRKA 1UE6A 2IX3A 4GLXA 3NP8A 3PMFA 2IX1A 3G7LA 1EFWA 4JI3Q 1F2RI 2MBOA 2M8SA 1HQRD 1GVPA 3TMPB 3H15A 1HNXQ 5FLMH 3PS6A 1LTLA 2CKZB 2Y5PA 4LF9Q 4W9CA 3AE7B 4JPBW 3C46A 5E4XA 3CCVA 1HTPA 5BR8Q 1PH7A 2XN9C 2M0XA 1JWUD 1UNSA 1GB1A 4G7ZC 2K52A 1TYGB 2F3WA 3GTGB 1QWYA 3OTOQ 2Q8RE 1NEKB 3M7GA 4X62Q 5C4XH 3TZUA 2B2WA 2WAQE 1S40A 4PS3A 1N63A 2K5PA 2N0SB 1NI2A 1S3SG 2D3CA 5C3WA 3VYUA 4XQNA 1ASZA 1F2MA 2RDGA 4DK6C 4HMIA 5FLMG 1QVFA 1HPCA 3S2HH 2WU5B 4BKTA 1JE4A 4DHZE 4KX6B 1VQ7A 2W9NA 4XQQA 1U0LA 3OAWA 1E8ZA 3Q23A 1WJUA 5IYCH 2D3BA 1FL0A 2I2YA 4FF1A 3DBSA 3TCAA 1I94Q 1A8VA 1QKZA 1WMHA 1ZXIA 1CTMA 5T1IA 4DV7L 3IAYA 2K22A 3HKZB 5EE9A 3H3VC 4H44C 3CD6A 1XYIA 1B7YB 4IKGA 5IAAC 3IFTA 4AYBB 2WFWA 2F0UA 4Y7NB 5C4XG 1KF6B 3PVLA 1QOHA 4RHSA 4EX5A 2BKFA 4FYDA 3GV3A 3HS0C 4YY3L 4UHVA 3RZOH 2A5UA 3BJUA 1QF6A 1Y1WB 4B3TQ 2LHEA 5FKAC 2A6HD 1XXGA 4JV5L 1FRDA 1ZE3D 4HVBA 2WAQG 1N33Q 2IDYA 4DR7L 1XPRA 4JBKA 1K83H 1XEEA 3TQYA 1YIWA 5IYCG 5HY6A 1JCKB 5LL6S 3Q24A 1QT9A 4PG3A 4BY1H 1SGHA 1LUZA 2ZW1A 2N88A 2K1FA 3RZWC 3ZTCA 2K5WA 1QOFA 2KD0A 1CM9A 2KENA 4HPMB 2WXKA 5HHDG 2UU9Q 3FKIB 4PYZA 2RSNA 3MVVA 1DOLA 1K0SA 3A9KB 4X57B 4IOIE 1HQMC 1JR0D 4A9AA 4ANWA 5KHQA 1KLGD 3KLSA 2K5HA 2L0FA 1SYCA 3DM3A 2ZT9C 1OXXK 2EY6A 1J19A 1SNOA 1NYQA 4L1BA 3NBHA 3P4QB 4NJCA 4DHJB 4B95A 2Q8TA 2MJEA 5ELBA 3PUWA 3MHSD 1Q82C 1CMXB 5ELDA 4HK2A 2PMZB 1WTQA 1M1KC 4HWIB 1PYBA 3ZDTA 1JWSD 1KAAA 1KH0A 3H6MA 4BY1G 2E8GA 1MSHA 3CF6E 4YTPB 2K5DA 5M5XH 2XK5A 3QO2A 1C4QA 2C9OA 4IZ8A 1MSGA 2EJGC 2PNHA 2ZNVB 1VQCA 2JA6H 3S15B 4DQOC 3S14H 3CC2A 1I3QH 3H94A 5CMDA 3E5SA 4WFN3 5IT9E 1IUEA 3E9SA 3ZLZA 4MGZE 2H5XA 1CZWA 1GUNA 2K4KA 3ERSX 3ULJA 4YHHL 4GNXB 1PA6A 1G6PA 3B08A 3K9PB 1QG7A 2K9XA 1RM6C 4HSVA 3Q2AC 1QILA 2JYOA 1D1IA 3BDLA 2XGTA 3M63B 4K7UA 4OELB 3PV1A 4EE2A 1G6JA 1V1OA 3RCZA 4R4QA 2XRSD 3VR6A 2ZJDA 3RMHA 2GRIA 4EOYA 2TMPA 2MW5A 2RF4A 4FJYA 4DR2L 3DBLI 5IGCA 4FLHA 4C1NK 2HCCA 3ML9A 4L23A 2KDEB 1G51A 4FXGC 4NW2A 2NMQA 3NVYA 1X65A 1FD7D 2PCFB 1HCZA 2K25A 2L11A 2JA6G 4GN1A 1OFFA 3HKSA 5DPSA 3BZKA 3EECA 4FO2A 1ZP0B 1VQ4A 2KEDA 1YD8U 3A9KA 3UI2A 1OQYA 3QQ8B 3P42A 5FJ8G 2A73B 1UWXA 3OMGA 1TT5B 2UXBL 4W9HA 1LLRD 2MJ3A 1ZDVA 3K0XA 2CHXA 4P1CC 2NVXH 4C3IG 5M5YH 2B2YA 3KLSX 4OONA 5IWAL 1J8IA 2CCZA 3HRZC 2Q2UA 3V6CB 4G7HC 2KCNA 1N32L 5ISRA 2N49A 4TMAB 4MT5A 4GLVB 5L37A 4EQ5A 3R7QA 3DMUA 4KKUA 2LJIA 2MQJA 2X6GA 3RYTA 3HFZB 4R8NA 1PRTC 3ZNZB 1L2NA 3NQIA 2KVMA 2HJ1A 1JOKA 4WWPA 3TL5A 4NAWB 1VQ6A 1UZXB 1PTOF 1TKEA 5DLQE 3AE2B 5AJ3Q 3CKIB 4R4CA 1OEYA 1VR9A 4H13C 3P4PB 2YU9B 2KOLA 3U9SA 4CHKA 2GBMA 4GNXA 1B8AA 3HOWG 4MTKA 1I7HA 2MO1A 2EVBA 3GQBA 4A3KB 4O1NA 3P75A 4DV5L 5J2RA 1V9PA 1LV9A 4XWTA 5CX3A 4L5RC 1STEA 1E1OA 2PNRC 3BG3A 2H1EA 2YEPB 3UINB 2Z6KC 1NTGA 2WWZA 3DEOA 3K7AB 5HGTA 4KZ0A 5JPNC 1MG4A 1C76A 2EY1A 1F52A 4A93B 2WQYB 3OSOA 4A3MG 1ZUD2 4DHJD 2B8GA 1HZ9A 1ICWA 1K3RA 3DM1A 2ZM6L 5TSSA 1EYGA 2OEDA 2V1YA 4CJ2C 4PK1A 4JI1Q 1O78A 3K7UC 4K0KQ 3NZ3A 2A5HA 3RNGC 3K58A 4JI3L 1IW7C 4KD3A 2WDQB 2RSUA 3IXSA 1YITA 1TZ1A 1HNXL 2BDNA 2L0CA 3TP7A 5E1FA 3PRZA 1OXTA 1SJHD 3S1MH 1YN4A 3QC8B 1PH9A 4GXBA 4ZYNA 1VQHA 1C0AA 3AEFB 4M02A 1X32A 2ES2A 4ZUIA 3SXHA 1MI2A 1XCTL 4L5QA 4LJOB 1NSNS 1FCLA 3MFGA 1A70A 3A55A 1O80A 1E2WA 4H0LC 4U673 1GAQB 2RD0A 3ECIA 4LNNA 2D3AA 3OTOL 2QDFA 2VXWA 2ZVOA 2YLMA 3VYSA 2K5NA 2PYKA 4BZAA 4RKBA 2KDIA 2DAJA 3D31A 2ACZB 1PLFA 1L6VA 1EY8A 2LFNA 4RKLA 2RCFA 1P8LA 2CKHB 2R92B 3B6YA 1ISNA 2JK8A 4NAWA 2KMCA 3HG9A 2RR9A 4FHJA 1XQQA 2WXHA 1BO0A 4JQWC 2YTXA 3W1GA 4WURA 4LW1A 2IGGA 2IYDB 5IT9L 3CIRB 4FDBA 2JY6A 1SNMA 3J7AV 1I94L 1HR0Q 2UXDQ 1Q10A 2SNSA 4CBVA 4PV1C 1TKYA 3ZGZA 1WE6A 3EROA 1GUWA 1SMXA 1NBFC 1R4PB 2DWQA 2INPE 1I6HH 3I4NG 2J0JA 1I4RA 5CORA 1YIJA 3ZO5B 4HR7B 1JWBD 5IYDH 1PFDA 1JC7A 2A6EC 3OHXC 4AIMA 3S1RH 1AWDA 3MJ5A 1JB7A 1KC8C 3DVNV 1SB3C 4JYAQ 4JIOU 2LRWA 1NVID 1M8AA 3MP9A 2B63H 1WE7A 1WX7A 5CV8A 3DHHC 3Q3NC 3VYRA 1HNWQ 2QGQA 1N33L 3GOEA 3PUYA 5KYLA 3IT4B 4KY5A 5EKKA 1HNZL 1JOQA 2WXRA 3Q8CA 1K8MA 5EE3A 4ABNA 3RLFA 5G2NA 2Y0SE 3A4RA 2LZ6A 2F0QA 1VQIA 4O2DA 1FNUA 4XTCS 2IHFA 1WJJA 1LABA 4LUOA 3MC8A 3P1MA 4RWSC 1SNDA 2WXNA 1CQFA 4QL5A 3QOJA 2NB0A 5D3DA 2UU9L 1HRJA 1YNJC 1TY2A 1ZKOA 4JVZA 3SK8A 4NXMQ 3GE8C 4QQBX 2IW3A 2M1MA 5IYDG 1VDVA 2EPBA 3ZNGC 2DJFC 2RBMA 2OEOA 4IALA 3GTJB 5E3FA 3W5OA 1PYSB 3T1HL 1NBWA 1W6JA 1ZYRC 3P1HA 3HOXH 4TVAB 4A3EG 1VF5C 2I0QA 3D6WA 1WJ6A 3MWYW 4XX5A 1VMPA 1JJCB 1NI3A 4R1JA 2BB5A 1TS2A 4LJZC 2BCOA 1PH2A 2B63G 1V6EA 1BXTA 2WX1A 1E2VA 3K8AA 3L10B 3ZW3A 2AUKA 4XT3B 3ND8A 1W3SA 3LB8C 4RG1A 3AN1A 2Z4IA 4RHRA 3E9IA 4PYUA 3KWLA 2KDBA 1S5BD 1ESFA 1EF5A 1YNNC 2FNJB 4DK1A 2BA0A 4FXCA 2UXCQ 1CHPD 1FEHA 1BNZA 1VQKA 3NXWA 4JG2A 4I6PA 1VCBA 1KDBA 3AQQA 2Y0SG 3E9HA 1Q7YC 4WH4A 2MQHA 3PF5A 4ZKBB 3GTGH 3OWFA 2NPTB 3HOXG 3HOVB 1WGHA 1K8AC 1BCPF 1A63A 5M5WH 4X66Q 1VQPA 1UWMA 2JEBI 2MJ8A 2NBFA 1SMYC 2B2UC 3PV0A 1ACCA 2K32A 2R7ZB 1UF0A 2AWOA 3RR5A 4BFRA 2SDFA 1LTRD 2KZRA 5IO9A 3HKZE 3GTKH 2MBEA 1C9OA 3W5UB 2XVSA 4DA2A 1LTAD 3SR6A 4AYBE 3N1YC 1SE2A 1S5CD 1TQOA 4YTMB 1T0QC 4DUZQ 4YTNB 4DXGA 2MWSB 3DWQA 2EYOA 2F0EA 2E6XA 2KC1A 2C5CA 4B9XA 1JWAD 1SNCA 3X3NA 2MCNB 2NN6H 1JE5A 3STBC 1FYCA 2V4IB 5I6WA 2RPQA 4OZCA 2WACA 3CP0A 1Y1WH 1HFGA 1L1OC 1JQ4A 3UDXA 3HOUB 4A3JH 3KDFB 1TU2B 4XGAB 2YTYA 1AE3A 1CT1D 3FMCA 2AYOB 1K8OA 3E6ZX 2RKSA 4H2AA 3M7NA 5M3MH 1IBKQ 2PEAA 2N78A 4KKSA 3U50C 2AWNA 2CS4A 1YJIA 2MP2B 2BF8B 3DQVA 3VTUA 4HMJA 3VR4A 5AJ3L 2I5MX 3HKZG 1VQEA 3IG3A 1NY4A 2NN6G 4AYBG 2BYFA 2NPTA 5IY0A 1SE9A 2NVTB 2V0GA 4OZBA 2PMZE 3IRBA 4NB3A 4M1UB 1F2ZA 2JYEA 4A3GB 1PVOA 1NR2A 1BF4A 4GZYC 2D10A 3BK2A 4KDIC 5LLIA 5KYIA 2MPMA 1Y1WG 1JT8A 1VQGA 4A3JG 1XLQA 4OVUA 4Q0FA 3ZQ4A 3S2DB 1ZDXA 3Q8DA 1GUSA 5D94A 4B3SQ 4FF4A 2D2CC 3T56B 2LI5A 1N5WA 4PZ8A 3E0JA 3FKIG 3QJYA 3QWZB 4IW0A 1WR1A 1EY4A 3S15H 5GXGB 1KNEA 4A3LH 4F87A 3K6OA 4IURA 4U68A 4OZAA 2XIWA 1Q1EA 1G6ZA 2KX3A 4ZYSA 4ITKA 1KDAA 1EOVA 4C4VA 4NJ6A 4OVZA 3KUZA 1WZ0A 3AEDB 4BWGB 3U7DA 3CQZB 2JYTA 1CUKA 4AQ7A 2A19A 5EBDA 1WXAA 1E7ZA 2NTSA 3DHGC 4HKQA 2QF7A 3KDFA 2E2HB 3TBIB 1X3EA 4YXDB 4MELA 4C3JH 1TWGH 2BB6A 2BE5C 2F0WA 4B9WA 3U2SC 2HD3A 2C5LC 1B3QA 1F2RC 2LVPA 1B9MA 3I72A 2J0KA 2KJHB 3TEXA 2JN4A 2DNEA 2MP2A 1UAPA 1U9RA 3NVZA 2KHIA 3K59A 1BT0A 1EYAA 5I9OA 4A3LG 3V96A 3TS2A 2UYZB 3PSIA 3QCAA 2N7EA 3Q3OC 1XNRQ 3M3YB 4NQKE 3R7RA 4CDEC 1SXTA 5D2MB 2KYWA 2VS1A 2UXDL 1HR0L 4TQ1A 2UWQA 5GAGC 3H9DA 3NOBA 1IKLA 4YSZB 1C3TA 1R4MI 4LJPB 1EUVB 4HAEA 5D3IB 2FJ2A 1DOKA 2D62A 3KJPA 5CHVC 2D2QA 1S4ZA 5HI1A 4KHVA 3V05A 3R3MA 4RNAA 3J80c 4GDLB 4DK0A 1WZ3A 4JYAL 1E8YA 4J8QA 4ASWC 1PTOC 1JB3A 2R61A 3K5NA 2KHWB 1CZPA 4DR7Q 1HNWL 2E76C 3PIOA 3KF6B 2RDBC 3A7LA 5C0XG 4WQMA 3AFQA 4DV2L 5IGGA 4HCEA 3OOCA 1VJKA 1U4LA 2YU9H 5AFWA 4BBSH 2ZPYA 3Q6BA 1VQMA 2MRPA 4GLSC 3NVWA 4QAYA 1SAPA 4OL7A 2JPHA 4DV1Q 5LMNQ 4A3KH 5AUIA 4NXML 2B8FA 1E9MA 2WXQA 4W9IA 1Z5SB 4F88A 2KJRA 3ERQA 1I35A 5JJKA 4EZJA 1HUMA 4BY7H 4A3IB 1PRTB 2EYPA 1KOTA 3K7AH 4AOFA 2EE1A 5EKLA 2HT1A 2XBBC 3T1YL 5NUCA 2V4LA 4DUYQ 1J9OA 4QB4A 1C48A 3CU7A 3AM9A 4J15A 1QVGA 2KACA 3U4VA 2MHJA 3S16B 2W3RA 3UGBB 3NE5B 3D6CA 3I90A 1H9KA 3CSFA 2E2DC 1TY0A 2WB1B 3S2AA 1N8RC 4MH0E 3URYA 1RWSA 2IY1B 2B3GA 4ILWA 2UXCL 2F0IA 4HPLB 2E2JB 2WXFA 2TSSA 3HVZA 4IO9A 1Q1OA 4DAPA 2B2TC 3AE8B 4A3KG 3K57A 4LF4Q 3QA8A 2EYLA 1MKHA 4DWFA 3PPAA 2FIFA 1BBWA 3F2DA 4M0WB 4BY7G 1PGXA 2Z0DB 5HG2A 1KAWA 4KKTA 5KEEA 3AE1B 2K33A 3NWSA 4A93G 1Q12A 2LY7A 5D14A 1X56A 4X66L 2QCPX 5JVH3 3TREA 1WJ4A 3BYYB 3A1QA 4XT1B 2NN6I 1HHVA 3CMMB 3GE3C 3SD5A 1X3PA 3D0FA 5K36H 4OXPA 3PGZA 1JMLA 1ZXHA 3D4DA 1RODA 4I7AA 1PFNA 2JEAI 3T3NA 2ZTDA 1L5PA 1U4PA 2A69C 4K2LA 4APVA 3RN5A 2QHOA 2KCCA 4K7SA 4B08A 3PF4A 1HFNA 1TWCB 4A3DH 3K80C 1SSOA 3DBHI 2UUAQ 4BAXA 3APDA 2AL3A 4W9GA 2VUMB 2LXAA 4HCSA 1VF7A 4DUZL 2ZXOA 1CHQD 4W9EA 2KC2A 1MI0A 2BKRB 4OO1I 2PQAB 5M9OA 3W9CB 1XLNA 4AUQC 3KOJA 1N34Q 5AUKA 2JF5A 3C19A 2FUG1 1Q3LA 2AUJD 2JJQA 4OGQC 4IG7B 3VQIA 1KHIA 1EWCA 1WGRA 4IUUA 2INCC 1J7CA 3ZNHB 5K36G 3NQTA 3MC9A 5KNDA 1PFSA 5C4HA 2R92G 1WM2A 1N32Q 2WDVB 3VH3B 3TEWA 1RCVD 2SNMA 1OGWA 3PT2B 2KMMA 4KV2A 2IWHA 3PO2B 1K73C 2P5ZX 2HTHA 2EJFC 1LT4D 4UAIA 1IBKL 4NZLB 4ZDVA 3NENA 3WAPA 1V9JA 2OQ0A 4R8IA 5F2DA 2DYOA 4K6LA 4CHTB 4M0WA 1C77A 1VMCA 1IBXA 4IUVA 4GN5A 4AH6A 3NUHB 4DV5Q 4F1SA 3GTJH 4IWOA 4MHEA 1FIQA 3W5VB 2B2VC 1Z2MA 1A0IA 5LMUL 1C7YA 3IVFA 2EQSA 1PRTD 2OT2A 4LUVA 1XLOA 2RGFA 1HTLD 1W2BA 3ZTDA 1QZGA 3VRBB 1EZ8A 3KLWA 4A6QA 1BVSA 1V5OA 2I46A 1E8XA 1GJZA 2ENBA 2VZKD 2FHTA 5IGBA 4B3SL 1TWAB 5C44B 2ZTCA 3AEBB 1Z9FA 2L15A 2RDFA 1WM3A 2VB2X 1BKBA 4F7XA 3A54A 1NMFA 2CWAA 2LMCB 4IPCA 4CJ0B 4IFDJ 2WXPA 2HQEA 2QKIC 1VCIA 1BCPC 1MIUA 4X3SA 2OTJA 4JI7Q 2L0TA 2LXKA 3MFYA 2A68C 3FHWA 4QUFA 3UDGA 4XDCA 1AZPA 2J4XA 2PIAA 3PIP3 1UGMA 3CSTA 3VTVA 3KQ4A 1KM7A 4KIKB 1GUAB 2Q5WD 4C7ZA 2XEWA 3I4LA 1TIFA 1IW7D 4GDKA 2L32A 2WXGA 2R7ZH 4HJ5A 5M3FB 4JK1C 5I9PA 1MPEA 2DHZA 3GZNB 1XMQL 1SIJA 3PZ7A 4IUTA 5JHAA 4CQNA 3X3MA 1VS0A 1IYJB 5A35A 2Q2HA 2VL6A 3VYTA 3A74A 1XLPA 2Q2TA 4GMVA 1ZXTA 4RCOA 2KN4A 4KKIA 4N8X1 1VZ6A 1ESRA 1GO3E 2K05A 1O7ZA 4MZ9A 1YJWA 2L5TA 1XNRL 2KQ4X 1A62A 3D4WA 3G48A 4M01A 4P73A 4HIMA 5ELCA 1JORA 3IKJA 3Q8AA 4WRDA 3HOVG 2IPKD 3KYHC 4IJLA 2R7FA 3HP3A 2MA9B 4R3DA 5CBAE 2DZKA 1F2LA 3CPFA 5TR5A 2NZHA 5GADC 1UGJA 5E6JA 2UUCL 3L4PA 3JYUA 2MLBA 4IQZA 1H4RA 2C7NB 1LQBA 4JW0A 4EGVA 2R7ZG 2J42A 3DBRI 1S5DD 5JEAJ 3CCSA 1GM5A 1AARA 2NS5A 1T9HA 1B53A 3M4PA 3TP5A 1FFUA 1FCCC 1S5ED 3MXPA 1STBA 2MX2A 3H3VH 1WI0A 1HNZQ 3M4QA 2N9XA 3QX1A 4N9F4 4H7BA 2J0MA 2LMCA 2KT7A 4IC7B 1E0ZA 2Z59B 5IYBH 1NENB 3NS1A 4OW0A 1UH6A 1VD2A 1L1OB 1IL8A 1I4XA 2NWGA 3DWGC 4RMAA 1N5XA 3RI7C 3U52E 4WJQA 4DV1L 5LMNL 1HZ5A 4A3GH 1UD7A 3KYCD 4RMFA 3N20C 3T1HQ 4DR1Q 3RFZB 1NNXA 4ODGA 3HOUG 3OW2A 1VQ8A 2K5VA 4YL8A 4LF7L 3J81c 4BVUC 1NR4A 4JI5L 3AE4B 2BS4B 4DUYL 2W3SA 1P1AA 1YJ1A 3OIPA 1VZ7A 3ZXVA 3HOYB 3TMEA 4LDTB 3H09A 1J6QA 3L2PA 2WKDA 2LFIA 1KABA 1SROA 2CH4A 5IYBG 1XWEA 2QEJC 3A7AB 4IM3A 1YZ6A 2DNCA 3TSSA 1VQOA 4PMWA 4EVOA 4JI6L 2BWES 4KY7A 4B3MQ 3L08A 2PVOD 4IM2A 3D4RA 3PRMB 5KIXA 3UIPB 4LF4L 4A3GG 3RZDB 4LAAA 4IPGA 1A5RA 1SEBD 5IOCA 2KTFA 5FJ8H 1YJ9A 3CQZH 3EA6A 3Q69A 1D2BA 3CCQA 1OO9B 4OVVA 1IBMQ 4BBRB 3PQIA 2BW2A 2E2HH 2NBWB 3OLMD 4C3IH 2KAJA 3ZJTA 2X6LA 4KHZA 1KDCA 2BQQA 1EYCA 1YHBA 4AWJA 2YV5A 2X69A 1RIPA 4Z9CB 3CRKC 4CGYB 1SE4A 1HR0W 3OPOA 2KLCA 4L8JA 4XYQA 2M19A 1PZKD 4DAYB 3PLUA 2CU1A 4BBNF 3AEVA 1GUGA 2OHFA 3M3YH 3NZUA 3HRDD 1L1OA 4L5TA 4N59A 2UUAL 2L76A 2SAKA 2KUMA 4DGZA 1JW9D 1E7PB 1DOXA 1NCVA 3BINA 1WX9A 3RNFC 3E0EA 1LTGD 3HM6X 1N34L 1B44D 1HE8A 3VUXA 3HOWH 4L2YA 3PUXA 1RFKA 4XIGS 3QJZA 3RZFA 4AJYB 5JH5C 3QR8A 2M2LA 2L83A 5IE8A 3CF5A 1I4GA 5COYA 2B3AA 3M4OB 4FJVB 1U4MA 1SLJA 1U4AA 2BS2B 2INNE 3DWMA 1KLUD 1HZBA 4WJPA 2RHSB 2FMCA 1F9RA 1W6KA 2EY2A 4TRDA 3AB5A 3K5OA 4M8AA 4OWXB 4A3MH 4OHJA 1ONLA 4JCVE 1TWHB 1JJGA 2VH1A 3UF8A 4WIPA 3CCRA 2RCNA 2I07B 3I56A 2JX5A 3N52A 2FIDA 3K0YA 4L63B 2NVYB 3J7AF 2NVQB 4LK1C 1SF0A 2N7JA 1YOVB 1WXSA 5FO7B 1MHWC 3AXCA 3T4AC 3PUZA 2JQOA 4UP9A 4K6DA 4KN7C 5CV9A 4C3HB 4HIOA 2LHDA 3ER0A 2PE9A 2B76B 3EQLC 1AFPA 2D5GA 4LNQA 1SNQA 2EJMA 1CJEA 1PTOB 4I6LB 3WAOA 1D3ZA 5CHFA 2HJ8A 4X3KA 2OOBB 4LWCA 4YWKA 4N8FA 4FF3A 2MUYA 4A3IH 2VW9A 3BZCA 1GB4A 1N61A 3MXUA 1YQ3B 2AX5A 2D3GA 2K6AA 1PFBA 2WB1E 2KDMA 3B1LX 4EZLA 3DVGX 2G9DA 4K5WA 3R2IA 1MVKA 1IGDA 2HHHQ 1J0GA 3KBGA 1JICA 4KLKA 1H9JA 5CC4A 4GKKQ 1II3A 2DNFA 4ZRZA 3VFKA 1QLBB 2DZMA 4LDTD 1ILQA 3E3XA 3GTOB 3AE6B 4FP5D 1ZEQX 2NUCA 4YSYB 1EY0A 1K8GA 3C1FA 3X23A 5L83A 2YEPF 2E2JH 3HHMA 3F1ZA 2SEBD 3AE5B 4V190 3PTFC 4IJHA 1OXUA 4MSMB 2BVCA 4JI7L 1N62A 1IHZA 4KZCA 3GTPB 2AHOB 4A3IG 1IYUA 4OWTB 2O5IC 2JA9A 2FCSA 4X64Q 4KSKC 1GG3A 2D9UA 3K5MA 3I4NH 2AEHA 1XPUA 4W9KA 3RNBC 1G291 1SYEA 3APCA 4CKEA 3A56A 4LNFA 3I57A 2V3NA 4ARCA 1YN3A 1UE7A 1R9TB 2WB1G 4II3B 5CV6A 1IZ6A 2BWFA 3J80i 5E6PA 3ZDMC 1R4NI 1TWCH 2O4XA 1L2FA 5EQ0A 5JOBA 2QILA 2VZAA 2VQEQ 3A9JB 5C4JH 2VUMH 1NDDA 1BDOA 3H3VI 2IT1A 3AEAB 3I4MB 3NHEB 1STGA 1E22A 3H1UA 2QMTA 4PMBA 4FXKC 2IY5B 2YYZA 4A3PA 3B2FA 3CRLC 4XXEA 2BE5D 2ZCCA 3VRAB 1X3QA 4HJ8A 2MEKA 4TKOB 3ZJUA 3PGEA 3Q3JA 2QDBA 4OIKA 2ZZPB 1N6ZA 4B0EA 3OW7A 3R3OA 1EIYB 4A3EH 2FE8A 2LGDA 5JHBA 1SSNA 1ICFB 2WXLA 2RDHA 1VZ8A 1RAXA 2IZVB 3M3JA 4JOIC 3WWVA 1D6EC 1U4RA 1YNXA 4J3OD 3T53B 4DFAA 4A3OA 1Z7TA 3PO2H 4MGYE 3J7YW 4JI8Q 2KMAA 1WTPA 4GGQA 2B2WC 2A6HC 2F0HA 3NHHA 4USAA 3RNEC 1A3VA 2VUMG 4DV2Q 2R2OA 2UUBQ 1B4OA 2LXCA 2ICIA 1H9SB 1JRUA 4G0NB 3I73A 3FILB 2G5DA 3K9OB 2GI9A 3NZSA 2M17A 3S17B 2L05A 3MHBA 3K81C 1Q1BA 4R9WA 4BKSA 2FBWB 4HPPA 4C80A 2ZW0A 2ZPNA 4DR1L 1GHJA 4A8XC 2DGYA 1AH9A 3T1YQ 2L8JA 3ONAB 2JUOA 2N9EB 3NS8A 2B2TA 1VRAB 3S1QB 2ICEC 2I1JA 3B0AA 3S1NH 1Z47A 4LFCQ 3PO2G 2WXMA 4TV3A 4KTAA 3SFEB 4K5VA 4MN3A 2KCTA 3VR2A 3BVGA 3MXGA 2J52A 1TWAH 3WDNA 1ML0D 5LXHA 1HA5A 3RLNA 3ITPA 3L16A 4WJOA 4FULA 1MJDA 2NTTA 1SYFA 4CKBA 3QG1A 3T51B 2ASBA 3QARA 1IYFA 1C9FA 2ONQA 4DAMA 4B3ML 3FDTA 1CQVA 1O7LA 2XNAC 3DHIC 3J81j 1UEAB 2DBYA 1DJRD 1D1KA 1D8LA 5G3LF 4IWPA 1FXAA 2N1WA 3LX0A 5HURA 2GMIC 4GU2A 1SR3A 4WORA 1EU4A 2D07B 3AMZA 4DF7A 3Q8EA 3LNNA 3VXWA 2KNBA 3BU2A 3LGJA 1IYVA 1EL0A 4P75A 1MFWA 4G7OC 3M4YA 5C6AA 1FGUA 1IBML 5DPWA 3FAHA 3N30A 4BKSD 3EC8A 2F0TA 3KW5B 2MBQA 4ID6A 2BDOA 4ZRIA 5AEKB 1DONA 1BCPB 3J7A5 3JAMc 1AEXA 3T9LA 5C44G 5JJLA 2HE7A 1EIFA 4IPHA 3P63A 2WXIA 3OG5A 4ICUA 1JOOA 1F9QA 4K8JA 2LUEA 2L52A 1EEID 3NWTA 2KCMA 1IL2A 4KV6A 4DAVA 2BOSA 3OYYA 4M00A 2PKOA 3TBLD 2C60A 2F03A 1E10A 4TQ0A 2KOXA 1Y1VB 2HUGA 1BR9A 3N3KB 4XE0A 4DV0Q 5EBCA 4Y7NH 3I9V1 2J0TD 3CCLA 1TXYA 1A2UA 1TWFB 1DD2A 1RKNA 3CPWA 2RPVA 2MBHA 3D3RA 5M3FG 4LLGM 2NYZD 5G5HA 5KNCA 3U7ZA 2HDLA 2JE6I 2W54A 1ROEA 4ZLTF 1MGSA 2LASA 3QOLA 2K6DB 5EDSA 1WTVA 3G6JB 3RNUA 1YJJA 1QVCA 2X8XX 5LMNW 3GP7A 3P4RB 3TZDA 3H7PB 2X38A 3OJ3A 2B39A 1Q86C 3R93A 4LMQD 4GS3A 2JP1A 1H95A 1WGDA 4JPSA 3U58A 5FOBB 1Q0WB 1EWYC 3IBEA 1QZEA 1V8CA 3ABVB 4LNIA 3JSVB 1UWVA 3FKIH 4KKJA 4LF8Q 4CO7A 1E7UA 2AQ3B 2XRQD 3TUOA 3A8JE 2A4ZA 1EY7A 2GBNA 4F8MA 1KL9A 4OIJA 2AQ2B 1C4CA 4KGRA 2PQEA 5LMUQ 4WJ3M 2BPSA 2ATWA 2NCNA 1L0VB 2W55A 3EFCA 2GBKA 2FMMA 3CMAA 2K7VA 3MA2B 2F0NA 2M0AA 1WIAA 2FINB 2HDMA 2Q8IB 1GJXA 4WQOB 5C3JB 4N9PA 4N6EB 4N9TA 3HOYH 1LM0A 4UP8A 2HHHL 1XCQL 3N6RA 1LT6D 2B2YC 2IO2B 1AZQA 4GKKL 5EE1A 2EKIA 3GDEA 3EVQA 4L5SA 2E5LQ 3Q3MC 4DDGD 2NBUA 2HIXA 1K53A 1PFMA 4GN3B 4ZCKA 1P0RA 1PUTA 4NPNA 3FEWX 3AV8A 4XZ4A 3ENEA 4G3XB 5C4ZA 3N9YC 5IP4D 3KF8B 5E4WC 3S9WA 2PPHA 3AU5A 1JMCA 1YVCA 1G91A 4LCDE 1HA6A 4X64L 3A4SC 3MXNB 4II2B 2G9HD 5IP9H 1F1HA 2GLSA 2DUDA 2KKCA 4A3FB 3ETRA 2PI2A 3SR1A 5D65A 2EZVA 3HOYG 4BBNC 2ZVNA 1XMQQ 3PHWB 1BCPD 3MEFA 2A68D 3A8KE 4PT5A 3HOZB 2OWOA 1PZID 2F0SA 2WXOA 1HZ6A 3MC0B 1TVXA 3S14B 3MAQA 4C00A 3UE0A 3AE3B 3P20A 2XTIA 2BA1A 5ELEA 3Q22A 5C0XH 1WD0A 2ON8A 3JSVA 2QA4A 4HJGE 4K7WA 2VQEL 2WNMA 3WOFA 4HCNB 1C4AA 1HEZE 1IP9A 2IO0B 4BBRG 1X6OA 1PGBA 2UUCQ 2WIIB 5IP9G 2L55A 1PH3A 1WWTA 3I7FA 3WANA 4HROA 2WLBA 4ZOHC 3LWUA 2DX5B 1FGBD 4KIKA 1QNKA 1CKNB 2IHEA 2K0PA 3NSWA 2EY5A 1PYWD 3ZXRA 2H88B 3RUIB 4BOSC 2DLBA 3EGRA 1F0ZA 2PZUA 2WXJA 3JW0X 3RN9C 4HN7A 4CDDC 4B0MA 1LO5D 2NVYH 3J81i 4JI8L 2NVQH 1OTRB 1XX8A 5D7GA 3KBXA 3ZJVA 1WXVA 2DYBA 4FN2A 2IY0B 4K1RB 2UUBL 3OWEB 5J39A 3TJPA 3FP9A 1IGCA 3RUZA 1QUQB 1GHKA 4EFOA 4P72A 1VQBA 1WTOA 1EUJA 2KANA 2C9WB 2M4NA 1CSPA 4OX9Q 5M5YB 3EUB2 4JBWA 3I63C 1WYGA 2KECA 3MXNA 1J5EQ 4PS8A 4X3UA 5CV5A 4P6VF 2BS3B 4FHKA 2KA7A 1S1QB 4I6NB 4AP4C 2CW0C 3PCOB 4YIJA 4M8MA 4LF7Q 4IN3A 1N9WA 3ZJYC 4A93H 4JI5Q 3DPDA 3DDCB 3RNCC 4FA6A 1ENCA 2N9LA 4EKUA 4TUUA 2JRHA 3P7JA 5C3EB 3D32A 4RM8A 4LFCL 1MJCA 3I91A 1Q81C 2R93B 4FADA 3W1SC 3NUCA 3MZ5A 1B1ZA 2Y5BB 4JI4L 3VA7A 4M8NA 1FXTB 2KVZA 3C0RB 3RPFC 1Y69U 1PH1A 4HDOA 5AZGA 3FKYA 4C3HG 4Q5VA 1KXLA 4JWUC 3J81E 4W9DA 1RYJA 2CVRA 3IAS1 1V80A 1AN8A 4ANUA 4JI6Q 4F7ZA 4IUPA 2QIEB 1STAA 3C1EA 5GMVA 4W9LA 1S3OA 3PIPA 3RN2A 4B3RL 1TKGA 2UU7A 2F0LA 1E24A 2JZPA 4JWSC 3GTPH 4ZHPA 3H91A 5K5PA 1Q8KA 3W2DA 4RCNA 1EQRA 1LGRA 3HUIA 1O7IA 3GB1A 2YTVA 1KLVA 2CHWA 1FJGQ 1CKNA 1WYWB 1PGAA 1Y14B 3D8GA 2VH2A 4GDLA 5GQOA 1J7BA 2FCQA 3PRPB 1MBYA 2KLGA 1ET6A 4ANXA 2ZXPA 3L13A 2WDRB 1A3UA 3T13A 3TN2A 1EQQA 3GTQB 2WHIA 1R9TH 2K04A 2L9HA 5J17A 1DYQA 3TIXA 3KF6A 5I6YA 2R92H 3SEBA 2ZXRA 1SDFA 2L12A 3ZVVA 1JJ2A 3IAM1 3TEYA 3MJWA 2KEEA 4XQJA 1EIGA 5JXVA 1J7AA 1K51A 2K1BA 2KJXA 4RGNA 2JT4B 1QUQA 2VRRB 5J18A 1SE3A 1C78A 4D2KA 4GOPC 1X1MA 1PH5A 5BO4B 3V3XA 1X54A 2K50A 2DZIA 2LGYA 1B50A 4P7IA 1Q8IA 1ZKHA 5CHWA 5DPRA 4JBMA 3FVQA 4DV0L 4HIDA 1M4VA 4QCLA 3O13A 4DK3C 1FFVA 3QHTA 2L1AA 3U30A 4BS9A 2HTME 1PDQA 3I8ZA 1A3TA 1CI3M 4JI2Q 5DM63 4Y52H 1WJNA 2LS01 2N4FA 2ZCBA 3S24A 3KWVA 4I7ZC 1FO4A 3O65B 3A0JA 3RT3B 4A90A 1RRBA 4H02A 2D11A 4NXNQ 3BVMA 1WGGA 2LWPA 2Z6KA 4LUZA 3I4MG 2QJLA 4GOCA 1HJPA 1F2YA 2A74C 4K5XA 4C2MB 2OJRA 1KRSA 3DVNU 1I6HB 2DJGC 2LXJA 2BH8A 1TS3A 2KDFB 4P2CB 3WA0A 4LF8L 2F0GA 3N1XC 3SVMA 4DR6Q 2PJHA 2Z1CA 5GAHC 3ZIMA 3S1RB 1GKHA 2CHBD 2PW7A 4QF4A 3VTWA 3NPPA 5FLXc 1TTNA 1HXYD 1S5FD 2AMCB 3AE9B 4HKZE 4WAAA 5GAEC 3S1QH 4EUTA 2MFIA 4YCVA 4HJAA 5EGTA 1R4QB 4MNOA 3CCMA 2PO4A 3RULA 2FCNA 3Q3FA 1HZCA 4X6AH 5HFYA 2PLPA 1G2SA 2E5LL 2CU3A 3EHVA 1QJOA 2KVRA 4MSQB 4UP7A 2PQAA 2OCEA 1ENFA 2MHVA 1WGYA 1KFYB 2XSCA 1FR3A 4FVMA 2I5HA 2DENB 1PHJA 5C0XI 3HOVH 2RHQB 2H4OA 1GPXA 3H8HA 3H7SA 4R4IA 3B9JA 5BN5A 3PLVA 4HEDA 3B2GA 2VQFL 2J7ZA 2V9HA 3Q14C 3SFDB 3AI5A 2AL6A 3BZDB 4JI0L 2O6VB 4LK0M 4LF6L 1TR5A 2JA5B 1X3GA 5BMHA 4DK5A 3CCJA 3V61A 3NTKA 1EO6A 4US9A 5IIFA 1VQDA 3J81L 4FXDA 3VR3A 5CTRC 4KD4A 2CR5A 4EQOA 4R4TA 5IN7A 2K28A 2QCZA 3MTSA 2EXDA 2LKVA 1UELA 3NEMA 2RQXA 1GNUA 2KWCA 4JOIA 1QB5D 4A75A 2F1MA 4XDDA 5IKCM 1SFOB 2D5DA 1Y1VH 5E7NA 1KJTA 4O42A 2PI2E 2MH7A 5M5WB 1JROA 1SE8A 4I65A 1TWFH 2DY8A 3NBHB 2LJ5A 1STHA 4UY8C 4GKJQ 2ZEQA 3RNAC 1UE5A 2RMMA 3HOUH 2Z8LA 2WINB 1WI5A 3U9OA 5DAUA 2ZTEA 4QY7A 3KUCB 3GTKB 3WCQA 5BYQA 5CBEE 2XK5B 3FC4A 5BN4A 5G55A 1D4BA 1Y8PB 2Z6BA 2JWUA 2JSOA 2FAZA 2K8BA 1GC7A 2KO3A 3KYDD 3DHQA 5H8YE 2CFMA 2IO3B 4PNYA 1WGKA 4ACFA 4PZ7A 1Y1VG 2A6ED 3UDFA 2XWJB 1LTID 4HDQA 3U4ZA 2KBNA 5ELNA 1YHAA 2ZJRA 4V0BA 3GTMB 2IX0A 2NVTH 1E90A 3H0GB 2QW7A 3I3CA 1K52A 2KWVB 3DCGA 2EMTA 4DNRB 4L6TB 4OX9L 2N1VA 2QC8A 4GIVA 4NQLB 5DEHA 2IGDA 4S0RA 5DCNA 1J5EL 5E6NA 4QIWB 1QQRA 4A3JB 3A5UA 2O6VA 3I4OA 3DBHB 4IFDH 4FNFA 2K75A 2JWZA 2BYEA 5LXIB 5M3MB 5JVG3 2Z0EB 1C1YB 3S2DH 4DN4M 1SJED 4HTHA 1WFQA 4MTNA 2O5JC 2Z9HA 3F2UA 3QIAA 2CQOA 1YNJD 5C5MA 5EPLA 5ELOA 3T3OA 2NZ1D 4Q2JA 3JAMi 1FD6A 1KRTA 1STYA 3GTLB 1BQQT 4QGUA 3H6NA 3RD2A 3IL8A 2B2UA 1ZYRD 1Q46A 1TIID 3RMKC 2DYMA 2WKCA 2R6GA 3V62A 3K5LA 1YHQA 3T16A 1LT3D 1WFYA 1WCMB 2LSSA 1EU3A 1WY8A 4RGMA 4IFDG 1FMAD 1MG8A 1I4QA 1KNAA 4A3FH 1FJGL 4ANVA 3UDIA 1V49A 1YNND 2A8VA 5J1ZA 4IWQA 2D0OA 2L7RA 5A2QE 4EQPA 4P74A 1L6UA 2F52A 4KVGB 2O6VD 3SHQA 1EWIA 3VR8B 1I42A 1DGJA 1RLFA 2WP9B 2K3UA 1QNUA 3HOZH 2MJDA 1EEFD 5JAVA 4FJZA 1HZAA 2J7QB 3I55A 4DV4Q 3V6EB 3BVZA
chains in the Genus database with same CATH topology
1EOTA 1LACA 5JEAH 1T6BX 4E6IA 1I4HA 1Q90A 2JXMB 1EYDA 3JAME 1OQRA 4DXFA 1RF2D 5I2XA 2R3ZA 1DOYA 1SMYD 3QWNA 4ZAIA 1EZ6A 3KLRA 1OQQA 4C3JB 1TWGB 3BYTB 1UUPA 1JQYD 5LNK1 4DNTB 3J9CA 3SK4A 2BBCA 4HEA1 5IODA 5MPOA 1LTSD 1MHXA 1EY6A 2JQRB 5I4DA 3WOEA 5JEAG 1WTRA 3AH7A 4IUNA 3BWUD 1SYBA 3KUPA 1G8ZD 5J22A 4XDXA 1QOBA 1FXIA 3LXFA 3L7ZC 5KGUA 4ZK9B 1SBBB 1ENAA 2PZTA 3GD7A 3ND9A 2F0KA 2F3VA 1STNA 3AECB 2AQ1B 2JA7B 1EIHA 2EELA 1LT5D 3SK5A 1NAPA 1CK1A 1Y8OB 3EFXD 4DAYA 2CJOA 2EOTA 2VNUD 4BA1I 4MM3B 4TSSA 1TT2A 4BBSB 1DXMA 1YN5A 4IDIA 2LEKA 4J1MA 1F9SA 1D5MC 2HDEA 2JA8B 1A2TA 5BMGA 4BY7B 2BYTA 2V3PA 5C5LA 1C79A 1WSPA 1RTOA 2EYMA 3L9AX 1Z6HA 3CHBD 3VA5A 1ZPSA 3A8IE 3AB9A 1GUOA 2EYFA 4XWWA 3KK7A 1EM7A 1XTCD 1E0BA 3DUZA 1MD2D 3SHLA 1F9PA 4MIUA 3Q6SA 2E2IB 4ZKCB 1XO3A 1WTXA 4LTUA 1HUNA 4YWGG 1PXUA 5CV7A 5A2QL 1XF5L 1VDZA 3NTHA 2E75C 2WP8J 3BDOA 3FPUB 3LWEA 5CYUA 1O7YA 2F0OA 1DCZA 1F77A 2PPBC 2RA4A 4A3DB 4A3BB 4IFDI 1PDXA 5ELFA 3PO3B 2FFKB 2PW5A 3JAML 3MHZA 1B9NA 3J80E 4P16A 1WRIA 5BYRA 2WV6D 3BIID 1QOGA 2O2LD 1P7EA 1EQVA 3W1SA 1PMRA 1EQTA 4J6HA 4US8A 1E6EB 1PTOD 3Q0AA 1LTBD 3TEZA 1FNWA 4HSPA 5IGEA 5FR3A 4RA8A 2MGSA 3M85A 2CQAA 5CGKA 2F0PA 1C8CA 3NVVA 4UDUC 4MACA 3EJIA 5LL6X 2PZWA 1L0YB 3DWPA 3HEJA 2QSDA 4RGTA 2CW0D 2BT6A 4REZA 1I50B 3HVDA 2GA4B 2EDGA 1PZJD 3HGBA 1D5ZC 2WU2B 1BUIC 1B3AA 2KHSA 5CV4A 1Y56A 2PMVA 1I6VC 3RD4A 3FPPA 1JALA 2F0FA 3DWAA 5FO9B 2G1EA 3GS2A 1CA5A 5EJWA 1H9MA 3Q8BA 1H9SA 3FILA 4NMZA 3PO0A 1CA6A 1V8QA 4ZQ3A 2F4IA 2IL8A 3IFDA 4C1NI 5C4XB 4KGSA 5BYSA 4A55A 1CZGA 2PTLA 2A69D 5BMIA 2LGIA 1GOZA 2IGHA 2SOBA 1OXVA 1RDPD 4C56C 3S2HB 1JWMD 2WAQB 5IGDA 4FF2A 2VB3X 3R8BA 1FRRA 2B2VA 4IUQA 2EXZA 2M56B 1BMLC 4KY6A 1OXSC 3GO5A 4ARIA 4K14A 3VR9B 1TJEA 1ZOYB 1EY9A 5C0XJ 3NK9A 3DXJC 5T8IA 4KMUC 2Y3AA 2L1BA 3RZOB 4NP5A 1QOAA 3PZ8A 1ET9A 1SYDA 4PQXA 4K8IA 1FM0D 3LYYA 2L4NA 4YSXB 2CJNA 2XWBB 3U4EG 1RTNA 4OO1H 1K83B 2PW9A 5LHY1 3OMCA 4BY1B 5EPKA 5FLXE 3J80L 1VLBA 4NKLA 4NDXA 5G5GA 4QUCA 3UI3A 1SYGA 4K2KA 1TS4A 4WJWA 2M9VA 1TS5A 3W3AA 1AYFA 4ME5A 1V97A 1GXDC 4KN4C 3AEGB 5G3LD 4OO1G 2JU6X 4RF1A 3V2TA 1EY5A 1TKWB 3PUVA 1NUCA 2K5QA 4ZUJA 4QMGA 5M5XB 1RHPA 2ID0A 2JA6B 1C4PA 2V4DA 3QB3A 1I3QB 1Y8NB 4KI0A 2F0MA 1EWHA 3C3LA 3SE0A 2H89B 1KRHA 1WVLA 2PVGC 1K50A 4C3IB 3VR5A 4AS1A 1BUVT 4WAFA 1T5XD 1LTTD 1YQ4B 4MH8A 4ZRQA 2F0DA 1V1PB 3NRZA 3OIQA 2LUMA 5EE0A 5H92C 4XYOA 1WXQA 3NTIA 5BN3A 1A15A 4KJNA 3AU7A 2F0VA 5IGFA 1AW7A 1WD1A 4TQUS 4HRSA 3BK1A 3HOWB 1YMHE 3HZXA 2MP1A 1DZ1A 3KF8A 4KGTA 1I4PA 1PTOH 1KTKA 2NVXB 3E56A 1BOSA 2E74C 4KK7A 1L4DB 4C3JG 2N55A 1DOIA 4JE3B 4ZRPA 4RAUC 1FNVA 5T1GA 4X3TA 1IKMA 1D5XC 2N9KA 2RVLA 2K03A 4A3MB 3L3OC 1CFMA 3AEEB 2F0JA 4DU9A 4S3SA 2IJ0A 4G4KA 1GUTA 1PRTF 4RFBA 4RH6A 4YT0B 4ULLA 1L0XB 4N58A 2OXPA 3I70A 1DM0B 4PMCA 4C7YA 2HCIA 1TZOA 3IT6B 4WWMA 5FK9C 1QCBD 3TDQA 5CR3A 2VZKB 1V1PA 1RD9D 2KQ3A 1RJTA 1WTWA 5C2TB 5FLXL 1SNPA 4RGOS 3CWIA 3S1MB 2I38A 1T3QA 1H9RA 3TP6A 5JJZA 1IBXB 1EFID 5DNFA 3I4NB 2DY7A 1N60A 2DN8A 3ZYYX 3FRPB 1ILPA 4CKCA 2M00A 1NYRA 2RSOA 1YNTE 4G57A 3SK6A 1QE6A 2GB1A 1G2TA 2WS3B 2KWDA 4EQNA 2JXTA 1BBXC 2OF1A 4CJ1B 5C4JB 1R7SA 3MEHA 2JSVX 1A6XA 4JX1C 3Q8FA 4KJOA 1E2ZA 5JPMC 3C8YA 3R2TA 4BA2I 5FO8B 5EKIA 3TP8A 3C2PA 4A3EB 3AMUA 4GDKB 5KRUA 1L4ZB 2B63B 4NAMA 2E3TA 5I2YA 1AP0A 1DOMA 2K01A 3PIO3 2W82A 1P7FA 2Y5CA 3DEPA 5KNBA 2EYHA 3P4SB 4ZHOA 3BS1A 4RF0A 2BTEA 3GV6A 2Y0SB 2Z4HA 1B9RA 5C3XA 2J53A 3HOXB 3NBIA 2EYJA 1B2TA 1MHHE 5DM73 5EPJA 3SDZA 1T5EA 1V43A 3S1NB 3BDCA 2IX3A 2IX1A 3NP8A 3PMFA 3G7LA 1F2RI 1HQRD 2Y5PA 3AE7B 3C46A 5E4XA 1HTPA 2XN9C 1JWUD 1UNSA 4G7ZC 1TYGB 2F3WA 3GTGB 1QWYA 2Q8RE 1NEKB 3M7GA 3TZUA 2B2WA 1N63A 2K5PA 2N0SB 5C3WA 3VYUA 4XQNA 1F2MA 2RDGA 4HMIA 1HPCA 2WU5B 1JE4A 4KX6B 4XQQA 3Q23A 2I2YA 4FF1A 1QKZA 1ZXIA 1CTMA 5T1IA 3IAYA 2K22A 3HKZB 5EE9A 3H3VC 4H44C 1XYIA 4IKGA 3IFTA 4AYBB 2F0UA 4Y7NB 1KF6B 1QOHA 4RHSA 4FYDA 3GV3A 3HS0C 1QF6A 1Y1WB 2LHEA 5FKAC 2A6HD 1XXGA 1FRDA 1ZE3D 2IDYA 1XEEA 3Q24A 1JCKB 5LL6S 1QT9A 2ZW1A 2N88A 2K5WA 1QOFA 1CM9A 2WXKA 5HHDG 3FKIB 2RSNA 3MVVA 1DOLA 4IOIE 1HQMC 1JR0D 4A9AA 1KLGD 3KLSA 1SYCA 2ZT9C 1OXXK 2EY6A 1NYQA 1SNOA 4L1BA 3NBHA 3P4QB 4NJCA 2Q8TA 2MJEA 5ELBA 3PUWA 5ELDA 2PMZB 1WTQA 1JWSD 1KAAA 1KH0A 3H6MA 1MSHA 4YTPB 2K5DA 3QO2A 1C4QA 2C9OA 4IZ8A 1MSGA 2EJGC 3S15B 4DQOC 3H94A 5CMDA 3E5SA 4WFN3 5IT9E 1IUEA 3E9SA 1CZWA 1GUNA 1F0ZA 1QG7A 2K9XA 1RM6C 4HSVA 1QILA 2JYOA 1D1IA 3BDLA 4EE2A 1V1OA 2XRSD 3VR6A 3RMHA 2GRIA 2TMPA 5IGCA 4C1NK 2HCCA 4L23A 3NVYA 4FXGC 4NW2A 2NMQA 1FD7D 2PCFB 1HCZA 2L11A 1OFFA 4FO2A 1ZP0B 2KEDA 3UI2A 3P42A 2A73B 1UWXA 3OMGA 1LLRD 2MJ3A 1ZDVA 4C3IG 2B2YA 3KLSX 1J8IA 3HRZC 4G7HC 2KCNA 5ISRA 4TMAB 4MT5A 3DMUA 4KKUA 2LJIA 2X6GA 4R8NA 1PRTC 3NQIA 2KVMA 1JOKA 4NAWB 1PTOF 1TKEA 3AE2B 3CKIB 3P4PB 1VR9A 4H13C 2YU9B 2KOLA 3U9SA 1I7HA 2EVBA 3GQBA 4A3KB 4O1NA 3P75A 1LV9A 4XWTA 2YEPB 1STEA 3BG3A 2PNRC 2H1EA 3DEOA 3K7AB 5HGTA 5JPNC 2WQYB 1C76A 2EY1A 4A93B 3OSOA 1ZUD2 2B8GA 1ICWA 3DM1A 2OEDA 5TSSA 4CJ2C 1O78A 3NZ3A 2A5HA 3K58A 1IW7C 4KD3A 2WDQB 3IXSA 2BDNA 2L0CA 3TP7A 5E1FA 1OXTA 1SJHD 1YN4A 3AEFB 1X32A 4ZUIA 3SXHA 1MI2A 1XCTL 1NSNS 1FCLA 3MFGA 1A70A 3A55A 1O80A 1E2WA 4H0LC 4U673 1GAQB 2VXWA 3VYSA 2PYKA 4RKBA 3D31A 2ACZB 1PLFA 1L6VA 1EY8A 2LFNA 4RKLA 2R92B 3HG9A 2WXHA 1BO0A 4WURA 2IGGA 5IT9L 3CIRB 1SNMA 3J7AV 1Q10A 3ZGZA 2SNSA 4CBVA 4PV1C 1TKYA 3EROA 1GUWA 1R4PB 2DWQA 2INPE 1I4RA 5CORA 4HR7B 1JWBD 1PFDA 1JC7A 2A6EC 3OHXC 1AWDA 3MJ5A 1SB3C 1NVID 1M8AA 3MP9A 5CV8A 3VYRA 3IT4B 3PUYA 5KYLA 4KY5A 5EKKA 1JOQA 2WXRA 3Q8CA 5EE3A 1K8MA 4ABNA 3RLFA 2F0QA 1FNUA 4XTCS 1LABA 3P1MA 4RWSC 1SNDA 2WXNA 1CQFA 3QOJA 2NB0A 5D3DA 1HRJA 1YNJC 1TY2A 1ZKOA 3SK8A 2IW3A 1VDVA 2EPBA 2RBMA 2OEOA 4IALA 3GTJB 5E3FA 1JRPA 3P1HA 1W6JA 1ZYRC 1VF5C 3D6WA 3MWYW 1VMPA 1NI3A 2BB5A 1TS2A 4LJZC 2BCOA 1BXTA 1E2VA 2AUKA 4XT3B 3ND8A 3LB8C 3AN1A 2Z4IA 4RHRA 3KWLA 1S5BD 1ESFA 1YNNC 4DK1A 2BA0A 4FXCA 1FEHA 1CHPD 1BNZA 3NXWA 1KDBA 4WH4A 4ZKBB 3OWFA 3HOVB 1BCPF 1UWMA 2JEBI 2MJ8A 2NBFA 1SMYC 2B2UC 3PV0A 1ACCA 2K32A 2R7ZB 2AWOA 2SDFA 1LTRD 3W5UB 2XVSA 4DA2A 1LTAD 3SR6A 1SE2A 1S5CD 1TQOA 4YTMB 4YTNB 4DXGA 3DWQA 2EYOA 2F0EA 2E6XA 2C5CA 4B9XA 1JWAD 1SNCA 3X3NA 2NN6H 2V4IB 1FYCA 5I6WA 4OZCA 2WACA 1HFGA 1JQ4A 3HOUB 1TU2B 1CT1D 3FMCA 1K8OA 3E6ZX 2RKSA 4H2AA 3M7NA 4KKSA 2AWNA 1YJIA 4HMJA 3VR4A 2NN6G 2NVTB 2V0GA 4OZBA 2JYEA 4M1UB 1F2ZA 4A3GB 1NR2A 1BF4A 4GZYC 3BK2A 5KYIA 2MPMA 1XLQA 4Q0FA 3ZQ4A 3S2DB 1ZDXA 1GUSA 4FF4A 2D2CC 3T56B 1N5WA 3E0JA 3QJYA 1EY4A 5GXGB 1KNEA 4F87A 3K6OA 4IURA 4U68A 4OZAA 2XIWA 1Q1EA 1G6ZA 4ZYSA 4ITKA 1KDAA 4OVZA 3AEDB 4BWGB 3CQZB 2JYTA 4AQ7A 5EBDA 2NTSA 4HKQA 2QF7A 2E2HB 3TBIB 2BB6A 2BE5C 2F0WA 4B9WA 3U2SC 1F2RC 1B9MA 3I72A 3TEXA 2DNEA 1UAPA 1U9RA 3NVZA 3K59A 1EYAA 5I9OA 3V96A 3M3YB 1SXTA 4TQ1A 4YSZB 1IKLA 4HAEA 5D3IB 2FJ2A 1DOKA 2D62A 1S4ZA 5HI1A 4KHVA 3V05A 4RNAA 4GDLB 4DK0A 4J8QA 1PTOC 1JB3A 2R61A 3K5NA 1CZPA 2E76C 3A7LA 5C0XG 4WQMA 5IGGA 4HCEA 3OOCA 1VJKA 1U4LA 5AFWA 4GLSC 3NVWA 1SAPA 4OL7A 5AUIA 1E9MA 2B8FA 2WXQA 4F88A 3ERQA 1HUMA 4A3IB 1PRTB 2EYPA 2EE1A 5EKLA 5NUCA 1J9OA 4QB4A 1C48A 3CU7A 3AM9A 2KACA 3S16B 2W3RA 3NE5B 3D6CA 3I90A 1H9KA 2E2DC 1TY0A 2WB1B 3URYA 1RWSA 4ILWA 2F0IA 2E2JB 2WXFA 2TSSA 3HVZA 4DAPA 2B2TC 3AE8B 3K57A 2EYLA 1PGXA 5HG2A 4KKTA 5KEEA 3AE1B 2K33A 3NWSA 1Q12A 2LY7A 5D14A 2QCPX 5JVH3 3BYYB 4XT1B 2NN6I 1HHVA 1X3PA 5K36H 1JMLA 1ZXHA 3D4DA 1RODA 1PFNA 2JEAI 3T3NA 1L5PA 1U4PA 2A69C 4K2LA 2KCCA 4B08A 1HFNA 1TWCB 1SSOA 2VUMB 4HCSA 1VF7A 2ZXOA 1CHQD 1MI0A 4OO1I 5M9OA 3W9CB 1XLNA 5AUKA 2FUG1 1Q3LA 2AUJD 4OGQC 3VQIA 1EWCA 4IUUA 1J7CA 5K36G 3NQTA 5KNDA 5C4HA 3TEWA 2WDVB 1RCVD 2SNMA 2KMMA 2IWHA 3PO2B 2EJFC 1LT4D 4UAIA 4NZLB 4R8IA 5F2DA 2DYOA 4K6LA 4CHTB 4M0WA 1C77A 1VMCA 1IBXA 4IUVA 3NUHB 4MHEA 1FIQA 3W5VB 2B2VC 1PRTD 2OT2A 1XLOA 1HTLD 3VRBB 1EZ8A 4A6QA 2I46A 2ENBA 2VZKD 2FHTA 5IGBA 1TWAB 5C44B 3AEBB 2RDFA 2VB2X 4F7XA 3A54A 2LMCB 4CJ0B 4IFDJ 2WXPA 2HQEA 2QKIC 1VCIA 1BCPC 4X3SA 3MFYA 2A68C 4QUFA 4XDCA 1AZPA 2J4XA 2PIAA 3PIP3 3KQ4A 2Q5WD 4C7ZA 3I4LA 1IW7D 2L32A 2WXGA 5M3FB 4JK1C 5I9PA 1MPEA 3PZ7A 4CQNA 1SIJA 4IUTA 3X3MA 5A35A 3VYTA 1XLPA 1ZXTA 4RCOA 2KN4A 4KKIA 1WYGA 1VZ6A 1ESRA 2KQ4X 2K05A 1O7ZA 3AV8A 2L5TA 3D4WA 5ELCA 1JORA 3IKJA 3Q8AA 4WRDA 2IPKD 4R3DA 3HP3A 5CBAE 1F2LA 5E6JA 1UGJA 3L4PA 4IQZA 4EGVA 2J42A 1S5DD 5JEAJ 1B53A 3TP5A 1FFUA 1FCCC 1S5ED 3MXPA 1STBA 4H7BA 2LMCA 1E0ZA 1NENB 3NS1A 4OW0A 1IL8A 1I4XA 2NWGA 3U52E 3DWGC 1N5XA 1HZ5A 3RFZB 4ODGA 1NR4A 3AE4B 2BS4B 2W3SA 3OIPA 1VZ7A 3HOYB 3TMEA 3H09A 2WKDA 2LFIA 1KABA 1XWEA 2QEJC 3A7AB 2DNCA 3TSSA 4PMWA 4EVOA 4KY7A 2PVOD 3D4RA 5KIXA 3RZDB 4LAAA 1SEBD 5IOCA 3EA6A 3Q69A 1D2BA 1OO9B 4BBRB 2BW2A 2KAJA 3ZJTA 2X6LA 4KHZA 1KDCA 1EYCA 2X69A 4Z9CB 3CRKC 4CGYB 1SE4A 3OPOA 4L8JA 4XYQA 2M19A 1PZKD 1GUGA 2OHFA 3HRDD 4N59A 2SAKA 2KUMA 4DGZA 1JW9D 1E7PB 1DOXA 1NCVA 1LTGD 1B44D 4L2YA 3PUXA 1RFKA 4XIGS 2M2LA 2L83A 1I4GA 5COYA 3M4OB 1U4MA 2BS2B 2INNE 3DWMA 1KLUD 2FMCA 1F9RA 1W6KA 2EY2A 4TRDA 3AB5A 3K5OA 4M8AA 4OHJA 1ONLA 1TWHB 4WIPA 2JX5A 2I07B 3N52A 3K0YA 4L63B 2NVYB 3J7AF 2NVQB 4LK1C 1SF0A 2N7JA 5FO7B 3T4AC 3PUZA 4K6DA 4KN7C 5CV9A 4C3HB 2LHDA 2B76B 3EQLC 1AFPA 2D5GA 1SNQA 2EJMA 1CJEA 1PTOB 4X3KA 4FF3A 2MUYA 1GB4A 1N61A 3MXUA 1YQ3B 2AX5A 2K6AA 1PFBA 2KDMA 2G9DA 4K5WA 3R2IA 1MVKA 1IGDA 3KBGA 1JICA 5CC4A 1H9JA 1II3A 4ZRZA 1QLBB 1ILQA 3GTOB 3AE6B 4YSYB 4FP5D 1ZEQX 2NUCA 1EY0A 3C1FA 2YEPF 2SEBD 3AE5B 4V190 1OXUA 1N62A 1IHZA 3GTPB 1IYUA 2O5IC 2D9UA 3K5MA 1G291 1SYEA 4CKEA 3A56A 4ARCA 3I57A 2V3NA 1YN3A 1R9TB 5CV6A 2O4XA 5EQ0A 5JOBA 2QILA 1BDOA 3AEAB 2IT1A 3I4MB 1STGA 2QMTA 4PMBA 4FXKC 2YYZA 3B2FA 3CRLC 4XXEA 2BE5D 3VRAB 1X3QA 2MEKA 4TKOB 3ZJUA 2QDBA 4OIKA 4B0EA 3OW7A 3R3OA 2FE8A 1SSNA 2WXLA 2RDHA 1VZ8A 1D6EC 1U4RA 4J3OD 3T53B 4DFAA 1Z7TA 3J7YW 1WTPA 2B2WC 2A6HC 2F0HA 3NHHA 4USAA 1A3VA 1B4OA 2ICIA 1H9SB 3I73A 3FILB 2GI9A 3S17B 3MHBA 1Q1BA 4R9WA 2FBWB 4C80A 2ZW0A 1GHJA 4A8XC 3ONAB 2B2TA 1VRAB 3S1QB 2ICEC 1Z47A 2WXMA 4KTAA 3SFEB 4K5VA 4MN3A 3VR2A 3BVGA 3MXGA 2J52A 3WDNA 1ML0D 1HA5A 3ITPA 2NTTA 1SYFA 4CKBA 3QG1A 3T51B 1C9FA 2ONQA 3FDTA 1CQVA 1O7LA 2XNAC 1UEAB 2DBYA 1DJRD 1D1KA 5G3LF 1FXAA 3LX0A 5HURA 4WORA 1EU4A 3AMZA 3Q8EA 4DF7A 3LNNA 1IYVA 1EL0A 4G7OC 3M4YA 5C6AA 3FAHA 2F0TA 4ID6A 2BDOA 1DONA 1BCPB 1AEXA 3P63A 2WXIA 1JOOA 1F9QA 4K8JA 2L52A 1EEID 3NWTA 4KV6A 4DAVA 2BOSA 2PKOA 2F03A 1E10A 4TQ0A 1Y1VB 2HUGA 1BR9A 4XE0A 5EBCA 3I9V1 2J0TD 1A2UA 1TWFB 1DD2A 1RKNA 2RPVA 5G5HA 3D3RA 4LLGM 2NYZD 3U7ZA 5KNCA 2HDLA 2JE6I 2W54A 1ROEA 4ZLTF 1MGSA 3QOLA 1WTVA 3G6JB 1YJJA 3GP7A 3P4RB 3TZDA 2X38A 2B39A 3R93A 4LMQD 2JP1A 4JPSA 5FOBB 1EWYC 1V8CA 3ABVB 4KKJA 2AQ3B 2XRQD 3TUOA 3A8JE 1EY7A 4F8MA 4OIJA 2AQ2B 1C4CA 4KGRA 2PQEA 1L0VB 2W55A 2FMMA 2K7VA 3MA2B 2F0NA 2M0AA 2FINB 2HDMA 2Q8IB 1GJXA 5C3JB 4N9PA 4N6EB 4N9TA 1XCQL 3N6RA 1LT6D 2B2YC 1AZQA 5EE1A 2EKIA 3EVQA 1K53A 1PFMA 1PUTA 3FEWX 5C4ZA 3N9YC 5E4WC 3S9WA 1G91A 1HA6A 2G9HD 4A3FB 3ETRA 3SR1A 5D65A 2EZVA 1BCPD 2A68D 3A8KE 4PT5A 3HOZB 1PZID 2F0SA 2WXOA 1HZ6A 3MC0B 1TVXA 3S14B 3MAQA 3AE3B 3P20A 3Q22A 2BA1A 5ELEA 2ON8A 5C0XH 1WD0A 4HJGE 2WNMA 3WOFA 1C4AA 1HEZE 1PGBA 1WWTA 2WIIB 2L55A 4HROA 2WLBA 4ZOHC 3LWUA 1FGBD 1QNKA 2K0PA 3NSWA 2EY5A 1PYWD 2H88B 2DLBA 3EGRA 2PZUA 2WXJA 4HN7A 4B0MA 1LO5D 5D7GA 1XX8A 3KBXA 3ZJVA 3OWEB 5J39A 1IGCA 3RUZA 1GHKA 1WTOA 3EUB2 5M5YB 4JBWA 2KECA 3MXNA 4X3UA 5CV5A 4P6VF 2BS3B 2KA7A 2CW0C 4YIJA 4IN3A 1ENCA 2N9LA 3P7JA 5C3EB 3I91A 2R93B 3NUCA 3MZ5A 1B1ZA 3VA7A 3RPFC 1Y69U 4C3HG 4Q5VA 4JWUC 3J81E 1RYJA 2CVRA 3IAS1 1AN8A 4IUPA 2QIEB 1STAA 3C1EA 1TKGA 2F0LA 2JZPA 4JWSC 4ZHPA 3H91A 5K5PA 3W2DA 4RCNA 3HUIA 3GB1A 1PGAA 3D8GA 1J7BA 1MBYA 1ET6A 2ZXPA 2WDRB 1A3UA 3T13A 3TN2A 3GTQB 2K04A 2L9HA 1DYQA 5I6YA 3SEBA 2ZXRA 1SDFA 2L12A 3IAM1 3TEYA 2KEEA 4XQJA 1EIGA 5JXVA 1J7AA 1K51A 2K1BA 2KJXA 4RGNA 1SE3A 1C78A 4D2KA 3V3XA 1B50A 1Q8IA 3FVQA 1M4VA 4QCLA 3O13A 1FFVA 2L1AA 4BS9A 2HTME 1PDQA 3I8ZA 1A3TA 1CI3M 5DM63 3KWVA 2LS01 4I7ZC 1FO4A 4A90A 3BVMA 2QJLA 4C2MB 1F2YA 2A74C 4K5XA 1I6HB 1TS3A 4P2CB 2F0GA 3SVMA 2Z1CA 3S1RB 2CHBD 2PW7A 4QF4A 3NPPA 1HXYD 1S5FD 3AE9B 4HKZE 5EGTA 1R4QB 2PO4A 5HFYA 2PLPA 1G2SA 2CU3A 1QJOA 1ENFA 2MHVA 1KFYB 2XSCA 1FR3A 4FVMA 5C0XI 2H4OA 1GPXA 3H8HA 3B9JA 5BN5A 4HEDA 3B2GA 2J7ZA 3SFDB 3BZDB 4LK0M 2JA5B 1TR5A 5BMHA 3NTKA 4US9A 5IIFA 3J81L 4FXDA 3VR3A 4KD4A 4EQOA 2K28A 3MTSA 2LKVA 2RQXA 1QB5D 2F1MA 4XDDA 1SFOB 2D5DA 4O42A 2MH7A 5M5WB 1JROA 4I65A 2DY8A 1STHA 2RMMA 2Z8LA 2WINB 3U9OA 5DAUA 3GTKB 3WCQA 5BYQA 5CBEE 3FC4A 5BN4A 1D4BA 1Y8PB 2JWUA 2JSOA 5H8YE 3DHQA 4PNYA 1WGKA 2A6ED