1JRUA

Nmr structure of the ubx domain from p47 (energy minimised average)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
89
structure length
89
Chain Sequence
KASSSILINEAEPTTNIQIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFVLMTTFPNKELADENQTLKEANLLNAVIVQRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords p47 protein
publication title Solution structure and interaction surface of the C-terminal domain from p47: a major p97-cofactor involved in SNARE disassembly.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Unknown function
total genus 14
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2001-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00789 UBX UBX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1jruA00
3ZVVA 1GC6A 4BOZB 3ZIMA 1UZXB 3PS6A 3VFKA 2LUEA 3VUYA 2A4ZA 3GOEA 2WYQA 5JHBA 1D3ZA 4KSKC 1Z2MA 3V6EB 2L7RA 5E6OA 3VH3B 2MWSB 2G45B 4PS8A 3A9JA 3A9KA 2DZKA 2FCSA 3D32A 3PRMB 4JQWC 5HKHA 4KIKA 4P7IA 4EZLA 3HIZA 1L7YA 1J0GA 4TUUA 1IPGA 5AEKB 4FJVB 3VH4B 4BKTA 1IYFA 1G6JA 4FLHA 1WY8A 5DPTA 1KJTA 2IO1B 2IO3B 4GSWA 2LASA 4TQ1A 2RPQA 3KYDD 4AWJA 5J18A 5C1ZA 2UYZB 3RZFA 3DBHI 2JF5A 2FUHB 2MP2B 2Y5BB 3DBLI 4MEMA 1WR6E 4IWOA 3ONSA 2DHZA 3NY5A 4BKSA 2I1KA 2Z0EB 4GN1A 3JYUA 4MGZE 3NZUA 4HWIB 3VXWA 3UQBA 2RD0A 1R4NI 2BWFA 2ZPNA 3VTWA 1WGYA 2AYOB 2IZVB 1XD3B 3R66C 2NBWB 2JY6A 5JH5C 2MBQA 1Z5SB 5CHWA 1XT9B 2L0TA 2KFJA 1KM7A 3IVFA 2KQSA 2V1YA 4K7WA 3V62A 1H4RA 2J7QB 4ZRJA 5TR5A 1WGRA 4DHZB 3PTFC 4ZYNA 2BF8B 2EKEC 3JSVA 3MJWA 2Z59B 1KLVA 2IO2B 4HCPB 4PYZA 3A1QA 4TKNA 4EEWA 2G3QB 1WJ6A 3PREA 3WA0A 4ANUA 4F7ZA 4PS3A 2NPTA 4HDQA 3DBSA 3QQ8B 3HK0A 3PHXB 4ANWA 4FA6A 1WFYA 3UQAA 2LRUA 4FJZA 1WE6A 1ZKHA 2MLBA 1WIAA 4ZRKA 2L8JA 2GMIC 1TGZB 1OEYJ 2JVCA 2FCQA 4CHKA 1Q0WB 3UIOB 4BKGA 5E6PA 3C0RB 1EO6A 2L3ZA 4OVVA 4F1SA 4K81A 5G55A 4K7UA 1WJUA 3CSTA 4GXBA 1UD7A 2DYOA 4FULA 1V80A 2KWUB 1E5WA 2K8CA 1E8YA 2O6VB 4WQOB 3VTUA 3A4RA 2KHWB 5E6NA 3VQIA 2KLGA 4URKA 1NI2A 4W9KA 1T0YA 2MBBB 1UELA 4X57B 3X23A 2PPHA 4MH0E 1WX9A 1OTRB 2R2QA 2KFKA 2D2QA 3CSFA 4GDLA 3RULA 4LDTB 4I6PA 3NOBA 3APDA 4W9EA 4IM3A 2RR9A 4HXDA 1V81A 3ZDMC 4EZKA 1WXAA 3TL5A 3UINB 1NDDA 2C9WB 2K6DB 3ZTDA 3BY4B 5DPSA 1IP9A 2J0JA 2N1WA 2NS5A 4TV3A 3W1SA 2WDTB 3R7RA 2IYDB 4IW0A 1E8XA 3L54A 4EUTA 2M1MA 2WWZA 4BKSD 5CHFA 4G11A 2C7HA 2J0KA 2KOXA 1BT0A 1KOTA 3IG3A 2KTRB 2KWVB 4GB9A 4IM0A 4HDOA 3ZRFA 4A3PA 2A5UA 1WZ0A 3MHSD 1TTNA 3QX1A 4DDID 3U30A 2LXCA 2ZEQA 2KANA 2B3AA 2LVPA 1E8ZA 3H6NA 3V60A 1V6EA 1EF5A 2MRPA 3L10B 1P1AA 2EMTA 5LLIA 2L0FA 2LVOA 2HTHA 3A9JB 3MTNB 2OOBB 4WJNA 4WJOA 5FR6A 2MBHA 3A9KB 4NQKE 1WX8A 3ZKJC 3QJZA 4KIKB 4XC2A 2MBOA 3ZDTA 5AZHA 3PVLA 3OJ4B 4MM3A 5D6JB 4G0NB 4B9KA 3PLUA 2IBIB 1F9JA 4HPLB 1WZ3A 1YX5B 2AL3A 5C23A 4MGIE 4JIOU 4W9DA 3TCAA 2KKCA 1WMHA 2O2VA 4GU2A 4KZCA 3WANA 2MQJA 3NZSA 4GDKA 3IBEA 3QCAA 1WE7A 4I6LB 4WWNA 1A5RA 5J17A 3L13A 3CMMB 1SIFA 2G4SA 3LDZE 4RM9A 2CHXA 3KW5B 2GOWA 2XK5A 4E74A 3VVWB 1WJNA 1ZGUB 5CTRC 4MDKE 3ZRCA 4PYUA 1GG3A 3DCGA 1TBEA 5LXIB 4I6NB 2KO3A 2W9NA 1RRBA 4W9HA 1GUAB 2M17A 1X1MA 2IY1B 4NPNA 4AP4C 1V86A 4M0WB 4ANVA 4ICVA 2KWCA 3T8MA 4YL8A 1E8WA 5IA7A 5D7GA 1CMXB 1E7VA 2BKRB 4W9CA 3SU8X 3JSVB 2DZIA 4PS7A 4J6IA 2LZ6A 2O6VD 3QIJA 3A1QB 4KDIC 4FN2A 1S1QB 4A20A 3EC8A 4IUMB 2NPTB 4RMAA 1RLFA 4G3XB 4ZRIA 3RUIB 3VDZA 2MSED 2DYMA 2KQ7A 1WF9A 4ANXA 3QHTA 2KMAA 3WAOA 4LDTD 2FAZA 4MSMB 4E71A 2JRHA 4OVUA 3WIMA 4NJ6A 1V49A 1P9DU 4KDLB 4NAWA 1JRUA 2JT4B 3RZWC 4CYEA 1C3TA 1WH3A 2DX5B 4II2B 3R7QA 4M8MA 3PV1A 1V5TA 3Q3JA 4JLCA 2KVRA 3S2AA 1EUVB 3DVNU 1WR1A 2MX2A 3L16A 2DYBA 2HD5B 3ENEA 2GBKA 4MJSA 3WAMA 2N1VA 3DBRI 2IO0B 2N7DA 2ZVNA 1LQBA 1QZEA 2BKFA 3L0WB 2K39A 3QARA 1J19A 1WGGA 1YJ1A 2JPHA 3M62B 5L83A 3KH0A 4DDGD 3KUZA 2JRIB 1WM3A 4W9GA 2PJHA 4MELA 2V4LA 2KN5A 2LI5A 3PHWB 1E90A 2KFKB 2LVQA 2ZNVB 2L05A 4GDLB 3U8ZA 2C7MB 2M0XA 4W9JA 5IAAC 4IM2A 2K8HA 5DPRA 5G2NA 2NVUI 4KVGB 3H7PB 3VUWA 2Z0DB 3N30A 3AU5A 2KC2A 2LXAA 3OAWA 4AUQC 3OLMD 4IWQA 3AU4A 3ZNZB 2R2OA 4NQLB 1R4MI 1NBFC 4IWPA 1WGHA 3BINA 3APCA 4HVBA 3A33B 2D07B 4DHZE 3QWZB 4KZ0A 4F8CB 1I35A 3N3KB 5JHAA 2LGDA 4M8NA 2CS4A 3QAQA 4ICUA 2NR2A 3V6CB 2K1FA 2ZVOA 5L95C 3W1YA 3L17A 4N9F4 1GNUA 3H7SA 4JL9A 4II3B 5LXHA 2N7EA 1P0RA 2KDEB 2N4FA 2ZCBA 4EZJA 1XQQA 3K9OB 1OEYA 2GBJA 4TQ0A 1C1YB 2KDIA 2ZCCA 4WWPA 1K8RB 3UF8A 2KNBA 4E3CA 2J0MA 4B95A 2DZMA 4AOFA 4BOSC 3AXCA 2MA9B 1YD8U 4W9LA 2C7NB 4KV2A 3DQVA 5JZEB 3DPDA 1WMHB 2O2VB 4GGQA 4WWOA 4GDKB 4LJPB 3P2BA 3SDLC 3SHQA 2ZNVC 3SD5A 3AULA 1V2YA 4IG7B 2XK5B 3KYCD 2IY0B 1UH6A 3VAWA 3ZW3A 1ISNA 2FIDA 3V61A 2PE6B 3H9DA 3QA8A 4BBNC 1WYWB 4LCDE 2G4DB 2QHOA 2DZJA 1H8CA 4K7SA 3H1UA 3Q3FA 3RD2A 3WALA 3IFWB 3PRZA 2PEAA 3U7DA 5D94A 3NHEB 2BWES 4FHKA 2ZPYA 3GZNI 4JGHB 2BYVE 1EF1A 4HCNB 4AJWA 2GBMA 2NBVB 4EFOA 1P98A 3RT3B 3TIXA 1AARA 3A4SC 4ASWC 4HLEA 3DVGY 1FXTB 3AI5A 2KDBA 2KZRA 3QC8B 4FBJB 3HM3A 3VTVA 4GOCA 2KTFA 2VRRB 3ZNGC 4FJYA 2NCNA 3M95A 4CO7A 1SE9A 3UGBB 1LFDA 3DVGX 2D11A 2FIFA 2NBUA 4G50A 4DHJD 1OQYA 4NAWB 4XX5A 1WRDB 1WXVA 1WX7A 3TJPA 2KK8A 3B1LX 3ZUNA 3PSEB 2KLCA 3HM6X 3ML8A 1TZ1A 4MJSB 5DCNA 2XEWA 1L2NA 2BYEA 2KJHB 2LWPA 3KUCB 2FNJB 2EMSA 4RM8A 5EDSA 3KUDB 4GIVA 2CU1A 3TMPB 1I42A 5AZGA 3RCZA 1U4AA 4DBGA 2WX1A 2RGFA 4LJOB 1J8CA 3M63B 3O65B 1RFAA 2WX0A 1Q1OA 2GBNA 1WM2A 1GC7A 5BO4B 2ZJDA 2OJRA 3N32A 4DK5A 4WAAA 4WJQA 3CF6E 3PPAA 4HPMB 2L00B 4EKUA 2HJ8A 3VHTC 2K25A 2MP2A 2JXXA 4EOYA 2BPSA 3PGEA 2MCNB 1UBQA 2JZZA 3RYTA 3DOWA 4A3OA 5J2RA 5KHOA 2KDFB 1UGMA 4IC7B 4DHJB 3HHMA 2RSUA 2AEHA 1VCBA 2CR5A 3T9LA 4BBNF 4HK2A 1YQBA 2DAJA 4W9FA 2JZ3B 3VUXA 2AL6A 2BYFA 1RAXA 1V9JA 2C60A 2REXA 2CKHB 2L76A 4HJKA 1WXSA 4MSQB 2N9PC 2LD9A 1HE8A 3ZNID 3EFUA 1YIWA 5DPWA 2PE9A 3DDCB 4NJ7A 3B0AA 3LJ3A 2M8SA 4DWFA 2I1JA 2DAFA 3PLVA 3ML9A 1V5OA 5GMVA 2M4NA 3EHVA 4NNJB 1GJZA 4MGYE 2MBEA 3I3TB 4MGKE 2FCNA 4WJPA 3EECA 2N9XA 2KJ6A 1OGWA 1SGHA 1P3QU 3ECIA 3QK0A 2KX0A 3JVZX 4KSLC 4ZDVA 2D3GA 2YLMA 3IHPC 2V3SA 3ZLZA 2N9EB 4FADA 2HE7A 4BFRA 3PZDA 4W9IA 4BVUC 2UWQA 3ZTCA 2JUOA 2CHZA 2CHWA 3TBLD 2KD0A 3KVFB 3H7PA 1E7UA 5KHQA 3DVNV 2O6VA 3OJ3A 3K9PB 3APFA 2KJRA 2XBBC 3WAPA 4B6WA 1UBIA 1MG8A 1PQSA 1ZW7A 3L08A 3M3JA 4FHJA 2KC1A 1LXDA 3PRPB 3B08A 4DXAB 1VD2A 2LGYA 1Y8RC 2K6QA 4AJYB 2LGXA 2LJ5A 1S3SG 1Q5WB 2YVCA 2AWTA 3W1SC 1M94A 2LRWA 2FCMA 2KMCA 2KX3A 3JW0X 1WXMA 1YX6B 1LM8B 5CHVC 5AZFA 2ZZPB 5D2MB 2K8BA 3UIPB 2C5LC 3PT2B 1WGDA 2KXJA 2MW5A 3ALBA 3X0WA 3ZNHB 3ZO5B 4XZ4A 2KTRA 2ASQA 2JWZA 2BGFA 1WJ4A 2D10A 2DENB 3R3MA 1WI0A 4GMVA 4K1RB 4NY0A 5CX3A 2GBRA 3NS8A
chains in the Genus database with same CATH superfamily
3PS6A 2JZPA 3VUYA 1AW7A 5JHBA 3V6EB 3SR6A 2L7RA 2MWSB 2G45B 1J7CA 3A9JA 3BVMA 2DZKA 3P4RB 4P7IA 1IPGA 1N60A 1IYFA 1G6JA 5DPTA 2Y5CA 4RGNA 2WXHA 1HEZE 4AWJA 5J18A 4RGTA 3N1ZC 3RZFA 2Y5BB 4MEMA 3ONSA 4YTMB 4HWIB 5AUIA 1R4NI 2BWFA 1UUPA 3R66C 2L83A 5JH5C 1T5XD 4WWMA 3VR9B 2V1YA 4P16A 1SIJA 2I38A 4UDUC 3MJWA 1KLVA 2Z59B 3Q8CA 3RPFC 3WA0A 4ANUA 1D5MC 3HK0A 1WFYA 2W3RA 3UQAA 2BS3B 1TS3A 2MLBA 4ZHOA 4OHJA 3ZQ4A 1TGZB 2JVCA 2VZKB 2AQ1B 4OVZA 1Q0WB 4BKGA 1EO6A 4K81A 4K7UA 4A8XC 4GXBA 4HPPA 2DYOA 4L2YA 3A4RA 1TKEA 5E6NA 3VQIA 5LNK1 1NI2A 1UELA 1WX9A 2D2QA 1VRAB 3EFCA 4LDTB 4W9EA 1E9MA 4HXDA 3MJ5A 3TL5A 2C9WB 2K6DB 3ZTDA 5DPSA 2IGHA 1K50A 3R7RA 4IW0A 1XCTL 3L54A 5T8IA 5CHFA 1BT0A 3DHHC 3DWGC 3IG3A 2KTRB 3ZRFA 3KLSX 4YSYB 2A5UA 2M56B 2LVPA 1I4HA 2WXRA 5LLIA 4J3OD 2L0FA 3P1MA 5BYRA 3A9JB 3ZKJC 2Y5PA 3ZDTA 1P7EA 1QOGA 1JMLA 2IBIB 4OW0A 2KDMA 3WANA 2MQJA 3NZSA 1ZXHA 5J17A 1SIFA 3NG0A 1F77A 1RYJA 2XK5A 3MHZA 1F2RI 1WJNA 4XDDA 2Y3AA 2DNFA 1TBEA 5LXIB 1EU4A 2KO3A 1K52A 1X1MA 4ICVA 3I57A 1CQVA 2KWCA 2ICIA 2KWDA 4YL8A 5EE9A 3T8MA 5IA7A 4KGSA 5FR3A 4J6IA 2O6VD 2QILA 3QIJA 1NI3A 4AQ7A 1E7PB 1VZ8A 3RUIB 2MSED 1FFUA 3P42A 4OVUA 3WIMA 4NJ6A 4RGMA 4KDLB 4NAWA 3RZWC 1WH3A 3R7QA 4M8MA 1EUVB 2HD5B 4MJSA 3WAMA 3DBRI 1XLNA 2IO0B 4WWNA 3P4SB 1LQBA 3L0WB 5L83A 3KH0A 1JW9D 2WLBA 2JRIB 1WM3A 2Q5WD 4LNIA 4MELA 1N61A 2V4LA 2LI5A 3PHWB 1E90A 2M0XA 4W9JA 5IAAC 2K8HA 5G2NA 3H7PB 1V1PA 2Z0DB 3AU5A 1CK1A 2BT6A 4IWQA 4ZYSA 2R2OA 1WGHA 1TIFA 5D3DA 2GRIA 3N3KB 4M8NA 2CS4A 1PUTA 1JWAD 3P63A 1VDVA 3H7SA 4JL9A 5LXHA 2N7EA 1ENFA 2MH7A 1C1YB 2KDIA 3O13A 3UF8A 1VJKA 2KNBA 4E3CA 2J0MA 4B95A 2DZMA 1XCQL 4YSZB 3AXCA 2MA9B 2WDRB 1YD8U 4W9LA 4WQMA 1R7SA 4KV2A 4L1BA 4WWOA 2JYTA 3C19A 3P2BA 4LJPB 3SHQA 2ZNVC 1FNVA 1ESFA 3AULA 4TMAB 4IG7B 2XK5B 1TKYA 2IY0B 1WRIA 2IDYA 3VAWA 4B0EA 3HUIA 1T0RC 2FIDA 2RPVA 3V61A 4C4VA 3QA8A 2DZJA 1H8CA 3WALA 2IPKD 1SE2A 3PRZA 4FHKA 2N7JA 5EE3A 1F2RC 3AEFB 4CQNA 1EF1A 4HCNB 2GBMA 2E6XA 1I4XA 1AARA 1E6EB 2KTFA 4CO7A 1HZ6A 1GPXA 2FIFA 4G50A 1OQYA 4NAWB 1D5ZC 1C4CA 3ZUNA 3J9CA 3ML8A 2K22A 1SE4A 4MJSB 1HTOA 1N6ZA 2LUMA 2FNJB 4RM8A 3VR8B 3TMPB 5AZGA 1J7BA 3RCZA 1JROA 3O65B 1V1PB 2GBNA 3LYYA 1GC7A 3SEBA 1K51A 3CF6E 3CWIA 4QAYA 4EKUA 4EOYA 1HXYD 1FNWA 1UBQA 5HI1A 5KHOA 4IC7B 1VCBA 3T9LA 1YQBA 2AX5A 2JZ3B 1STEA 2BYFA 2H88B 4XDCA 1TJEA 1V9JA 2L76A 4HJKA 2N9PC 2LD9A 1YIWA 5DPWA 3B0AA 4DWFA 2M8SA 3GP7A 2I1JA 3BK1A 4MT5A 3GZNB 3EHVA 2MBEA 4MGKE 4WJPA 3EECA 2N9XA 5GXGB 1I4GA 1L6UA 3JVZX 1ET6A 4ZDVA 2D3GA 1HZ5A 3ZLZA 2HE7A 4W9IA 2UWQA 3ZTCA 2CHZA 2KD0A 4C4VB 2O6VA 3WAPA 3AB5A 2PIAA 1ZW7A 4FHJA 1KTKA 5D3IB 1MJDA 1S3SG 1Q5WB 2AWTA 5HHDG 1ET9A 1HQRD 3ABVB 1M94A 4OZBA 2MHJA 2J52A 5IKCM 1C79A 1ZOYB 3X0WA 1WJ4A 2D10A 2GBRA 2D3CA 3ZIMA 1UZXB 1EU3A 5HFYA 3GOEA 1T3QA 3Q6BA 4KSKC 1Z2MA 5E6OA 3VH3B 2LEKA 4PS8A 3BIID 3A9KA 5HKHA 2WXIA 1VZ6A 4JWSC 5AEKB 3VH4B 4BKTA 4FXCA 1YNTE 3LXFA 2YEPB 1KJTA 3R2IA 2IO3B 4TQ1A 1FD6A 2JF5A 1EWCA 4BKSA 2I1KA 4GN1A 3JYUA 4MGZE 3NZUA 4ZRPA 2RD0A 3MC8A 2V9HA 2ZPNA 3VTWA 1FO4A 2AYOB 3DWMA 2JY6A 1SF0A 3AE7B 1XT9B 5HG2A 3AE5B 3IVFA 5H8YE 5BYSA 1BUIC 1WGRA 4DHZB 4ZYNA 2EKEC 1L0XB 4HCPB 4PYZA 3A1QA 3TSSA 4TKNA 1N62A 3PO0A 4F7ZA 2NPTA 4ANWA 2BW2A 1N5WA 2I2YA 1L0YB 2L8JA 2GMIC 3TEYA 1NYRA 2FCQA 1TS2A 4CHKA 3BVZA 2QDFA 4OVVA 4F1SA 2N9LA 1CJEA 1WJUA 4ZOHC 1UD7A 4FULA 1V80A 2O6VB 2KN4A 2AQ2B 4URKA 4W9KA 4TSSA 4BZAA 1KRHA 5G5GA 4X57B 3AM9A 4I6PA 4IM3A 4KKJA 1V81A 2CU3A 4EZKA 1FXIA 2N1WA 2WDTB 3GE3C 2IYDB 1E8XA 4G11A 2C7HA 2KOXA 1KOTA 5BYQA 3DBHB 1V8CA 4JX1C 3DBLB 4IM0A 4A3PA 1XF5L 1WZ0A 3MHSD 3QX1A 4DDID 3U30A 2LXCA 2ZEQA 2KANA 1EF5A 1BMLC 2HJ1A 3PZ7A 2E3TA 4WH4A 2HTHA 4WJNA 2MBHA 3A9KB 2L52A 3QJZA 1JCKB 2MBOA 1WYGA 1UWXA 5AZHA 3U4EG 1FEHA 5TSSA 1FPYA 2WGSA 1WZ3A 2AL3A 4MGIE 4W9DA 4B0MA 4KZCA 2O2VA 4GU2A 4JE3B 2MEKA 1WE7A 2G4SA 3LDZE 4RM9A 2KMMA 1ZGUB 1V97A 4N6EB 2YEPF 2BQQA 1GG3A 4PYUA 1YN5A 1RRBA 4W9HA 1GUAB 2M17A 3OG5A 4NPNA 1IBXA 1E8WA 1AYFA 3EUB2 1CMXB 4YTPB 2LZ6A 2BTEA 3A1QB 4S0RA 4A20A 2D3AA 4A6QA 4RMAA 2NPTB 2L32A 2DYMA 1WF9A 3QHTA 1GAQB 2KMAA 1V49A 2V3PA 3W5VB 4CYEA 2DX5B 4II2B 1FIQA 3PV1A 4JLCA 1WR1A 2G9HD 2MX2A 2GBKA 2N7DA 2BKFA 1MI0A 1J19A 1YJ1A 3M62B 4USAA 4PT5A 1YMHE 3KUZA 4W9GA 2OJWA 4LNFA 2KN5A 3U8ZA 2NVUI 2K0PA 1L4ZB 2LXAA 3ETRA 1NBFC 1ZUD2 1KF6B 4XGAB 3A33B 1SE3A 3ZJTA 2V4IB 4YTNB 1T6BX 2FUG1 4M00A 3V6CB 3KQ4A 2LJIA 1UWMA 2BS2B 1GNUA 2M0AA 4II3B 3ZYYX 4JPSA 2N4FA 1LGRA 3K9OB 3N1YC 4TQ0A 3BZDB 2WXLA 1KH0A 4BOSC 3IAS1 5JZEB 3DQVA 3DPDA 2O2VB 4GGQA 4C56C 3SDLC 3ZXVA 2RDHA 1V2YA 3IAM1 4RNAA 1WXQA 3ZW3A 4US9A 5FK9C 2PE6B 3H9DA 2CJNA 2G4DB 3AH7A 3NS1A 3H1UA 1UNSA 4C80A 3SFDB 2PEAA 4KGTA 1RFKA 3AV8A 1IBXB 2BWES 2UU7A 2ZPYA 3GZNI 3BYYB 1DGJA 2X8XX 3NVYA 4R3DA 4EFOA 1P98A 2N9KA 4ASWC 4HLEA 3DVGY 3RNEC 3HM3A 2WXOA 3ZNGC 1LFDA 2ON8A 3W2DA 2NBUA 1R4MB 1TY2A 4DQOC 4XX5A 1QQRA 1WX7A 2KK8A 2PKOA 2BVCA 1QOFA 1YOVB 2KJHB 2JSVX 2LWPA 3KUCB 1AN8A 5EDSA 3KUDB 1I42A 4XWTA 3EGRA 2WX1A 1J8CA 1Q1OA 3IXSA 1NYQA 2ZJDA 1JALA 2INPE 3PPAA 4HPMB 2MP2A 2JXXA 2BPSA 3PGEA 4LNOA 3RYTA 4MACA 2KDFB 1UGMA 4DHJB 2RSUA 4MH8A 2AEHA 1B9RA 1Q10A 4HK2A 2DAJA 4W9FA 2C60A 1WXSA 4MSQB 2LMCA 3ZNID 1PGBA 2V0GA 3DDCB 4NJ7A 3LJ3A 2DAFA 2LFIA 1XXGA 3BWUD 3TEXA 4NNJB 1GJZA 3ZGZA 1T0SC 3TUOA 5I4DA 2KJ6A 3Q8FA 3QK0A 4KSLC 3IHPC 4XYCA 2N9EB 1MVKA 4AS1A 1Y56A 2CHWA 4HKQA 2L1AA 4YXDB 1HA5A 3OJ3A 1RM6C 4C7ZA 3APFA 1FFVA 1UBIA 4LTUA 4OZAA 3L08A 3M3JA 1C9FA 2KC1A 2LGYA 1Y8RC 2K6QA 4O1NA 3MP9A 2LHDA 3W1SC 3JW0X 2FCMA 1WXMA 1MHXA 1LM8B 5CHVC 1DOXA 1D6EC 3UIPB 3BK2A 1FNUA 3ALBA 4K1RB 2LGSA 4GMVA 5CX3A 1JWMD 1UF0A 4NQKE 3ZVVA 1GC6A 3VFKA 2WYQA 4K3BA 1IUEA 4NZLB 2DWQA 3E9SA 1T0QC 2FCSA 3D32A 3NVZA 3PRMB 4JQWC 1XLOA 1ZXIA 4EZLA 1N63A 1J0GA 2K5PA 1TS5A 3AEAB 1WY8A 2IO1B 2MJEA 2LASA 1TT5B 1I4PA 5C1ZA 2UYZB 1XLPA 3AECB 3DBHI 1I4RA 2MP2B 3MC9A 3DBLI 1WR6E 4IWOA 2DHZA 2Z0EB 3RMKC 4RF0A 1ZDXA 1XD3B 1Z5SB 5EE1A 1MPEA 2KFJA 4ARIA 4K7WA 1QOAA 3V62A 5TR5A 2FBWB 3PTFC 1GB4A 2WXGA 3JSVA 3W5UB 2IO2B 2ZW1A 4EEWA 3W9CB 1VZ7A 2G3QB 3PREA 4PS3A 4RH6A 3DBSA 3PHXB 4FA6A 2TSSA 2GLSA 2KT7A 4YWGG 4FJZA 1ZKHA 2K9XA 4ZRKA 1WIAA 4H2AA 2XN9C 1OEYJ 3UIOB 1MG4A 1TS4A 3C0RB 2L3ZA 2PVOD 4XWWA 5G55A 2WXQA 1E5WA 1YQ4B 3VTUA 3NRZA 2KHWB 4DXFA 2SAKA 1T0YA 2PPHA 2QEJC 1J7AA 3DHGC 1OTRB 1TKGA 2KFKA 3CSFA 3RULA 3NOBA 3APDA 3ZJVA 3ZDMC 2QSDA 1NDDA 1IP9A 2DBYA 2J0JA 4TV3A 4EUTA 2M1MA 2WWZA 3UI3A 2J0KA 4GB9A 2JWUA 2WXPA 2N0SB 2B3AA 3H6NA 1E8ZA 3V60A 2MRPA 3L10B 1P1AA 2EMTA 1PFDA 4WJOA 5FR6A 4MM3A 2HDEA 4G0NB 4HPLB 1YX5B 5C23A 1B1ZA 4JIOU 1DOYA 2KKCA 2SEBD 4GDKA 4I6LB 3CMMB 3FAHA 5G5HA 2CHXA 2DLBA 3RNCC 3VVWB 1V1OA 3B9JA 4MDKE 3ZRCA 4I6NB 2W9NA 3WCQA 3GS2A 1IGCA 3PZ8A 2IY1B 1V86A 4P6VF 4ANVA 1QF6A 4A9AA 4W9CA 3JSVB 2DZIA 4PS7A 1YJJA 1FRDA 4KDIC 4FN2A 3EC8A 1RLFA 5IO9A 3VDZA 2WQYB 2K3UA 2KQ7A 3N20C 3ZJUA 3DHIC 1QKZA 3WAOA 2FAZA 2IJ0A 4P1BC 1VLBA 1EWYC 3C8YA 3AEEB 1JRUA 4HRSA 1C3TA 2BS4B 3Q3JA 3SFEB 3AEGB 1KFYB 4C00A 2ZVNA 1QZEA 1WGGA 3NZ3A 1AWDA 2OHFA 4DDGD 2INNE 4YSXB 4BOZB 2KFKB 2L05A 3Q3NC 2C7MB 4IM2A 5DPRA 1D4BA 3N30A 2PVGC 1NVID 2KC2A 2JX5A 2R61A 3AU4A 4JWUC 4US8A 4NQLB 2GI9A 1R4MI 3BINA 3APCA 4NAMA 1SBBB 2D07B 5C2TB 3QWZB 5JHAA 2IGDA 3QAQA 2WHIA 4ICUA 4EE2A 2ZVOA 5L95C 1K53A 3L17A 1ZDVA 2CJOA 2ZCBA 4EZJA 1PYWD 1XQQA 2M19A 3V3XA 1OEYA 2GBJA 4WWPA 2JYEA 1YN4A 1MHHE 4MM3B 2C7NB 1SB3C 2WXJA 1C76A 4GDKB 4IKGA 3U2SC 2FE8A 4A55A 4PK1A 1WYWB 3GB1A 4LCDE 2QHOA 4K7SA 3Q3FA 3RD2A 2NTSA 1ZE3D 2Z8LA 5D94A 3NHEB 3NJTA 2ZW0A 2J4XA 3B2FA 1M4VA 2LGIA 4C7YA 3RT3B 3TIXA 1FXAA 3AI5A 2KDBA 3QC8B 3VTVA 3KWVA 3M95A 1SE9A 5IN7A 1WRDB 1WXVA 3Q3OC 1L0VB 4L23A 3N9YC 1FCLA 1I7HA 2KLCA 3HM6X 1TZ1A 3NVWA 4M01A 2H89B 3H8HA 4GIVA 1NENB 1U4AA 4DBGA 2RGFA 3AE3B 3NUHB 3U7ZA 1HTQA 4LJOB 3M63B 1RFAA 1WM2A 2OJRA 4WJQA 2L00B 5JXVA 2HJ8A 3V05A 2K25A 1KLGD 2JZZA 2EELA 4WIPA 4A3OA 1JWBD 3HHMA 4BBNF 1PDXA 4OZCA 2AL6A 4NJCA 4LNNA 3OWEB 1MFWA 2CKHB 3RNGC 1HE8A 3EFUA 1NEKB 1RWSA 1V5OA 2JXTA 2WDVB 1IGDA 4ACFA 2LHEA 4MGYE 3I3TB 2FCNA 4IDIA 3ECIA 4BAXA 2AQ3B 1YQ3B 2WNMA 4N58A 3PZDA 4REZA 1DOIA 4LLGM 2JUOA 3H7PA 1E7UA 5KHQA 3DVNV 2KJRA 2XBBC 4B6WA 1E10A 1MG8A 1ZPSA 3AE8B 5E6JA 3FC4A 1LXDA 4DXAB 4AJYB 2LGXA 2LJ5A 3AE2B 3AE9B 2KMCA 1YX6B 5D2MB 2BB6A 3PT2B 2KXJA 1L4DB 3GE8C 5BMGA 3RFZB 2RDBC 2ASQA 2JWZA 2BGFA 3R3MA 1TY0A 1WI0A 4NY0A 2PMVA 3NS8A 2LUEA 2A4ZA 4ZRQA 1D3ZA 3I63C 2B76B 4KIKA 1E0ZA 3HIZA 1L7YA 5AUKA 4TUUA 2WXFA 4IOIE 3FKYA 4FJVB 1OQQA 3AE4B 4FLHA 2OEDA 4GSWA 3URYA 2RPQA 3KYDD 2JQRB 2XNAC 2FUHB 2W82A 1L5PA 3NY5A 3VXWA 3UQBA 1ACCA 1WGYA 2IZVB 4KX6B 3L4PA 2NBWB 2MBQA 3B2GA 5CHWA 2L0TA 1KM7A 2KQSA 4M0WA 1H4RA 2J7QB 1XO3A 4ZRJA 2BF8B 2WDQB 4ARCA 2INCC 3TEWA 3Q8AA 1WJ6A 4HDQA 3QQ8B 3AE6B 3Q14C 2LRUA 1JQ4A 5IP4D 1WE6A 2PW9A 4LK0M 1SEBD 2VH1A 1WGKA 3BVGA 2D5GA 1OQRA 5E6PA 5C3JB 3CSTA 2KWUB 2K8CA 1E8YA 4WQOB 2BB5A 4HEA1 2KLGA 2INDC 2MBBB 3X23A 3RN9C 4MH0E 2R2QA 4GDLA 4A90A 2RR9A 2QC8A 1WXAA 3UINB 1JWUD 4P1CC 3BY4B 1VR9A 1A70A 2NS5A 3W1SA 5MPOA 4BKSD 3RI7C 2KVZA 1C77A 2KWVB 3HVDA 4HDOA 3RNBC 2J42A 1JRPA 1TTNA 1R4NB 1V6EA 3MC0B 1PGAA 3FILA 3HVZA 4M02A 2LVOA 1LO5D 3MTNB 2OOBB 1WX8A 1FMAD 4KIKB 5FKAC 4XC2A 1PGXA 3OJ4B 3PVLA 5D6JB 4B9KA 3PLUA 1BXTA 1F9JA 1I4QA 1FM0D 4WAFA 2KYWA 3TCAA 1WMHA 2PTLA 4WURA 5BMIA 4GLSC 1F0ZA 3IBEA 3Q8BA 3QCAA 3RNAC 1A5RA 2X38A 3L13A 4DXGA 3KW5B 2GOWA 4E74A 2WU5B 5CTRC 3LB8C 3DCGA 3T3OA 4AP4C 2VZKD 4M0WB 1QLBB 1EM7A 3VRAB 1KLUD 5D7GA 4N59A 1SXTA 1E7VA 2BKRB 3P4PB 4S17A 3SU8X 1QOBA 1GOZA 4RF1A 2QCZA 3CIRB 1S1QB 1F1HA 4IUMB 4G3XB 4ZRIA 4ANXA 1ROEA 3HRDD 4LDTD 4MSMB 4E71A 2GB1A 2JRHA 1P9DU 2JT4B 1P7FA 1V5TA 3TEZA 4LNKA 2KVRA 3S2AA 1N5XA 3DVNU 3U52E 3L16A 2DYBA 3ENEA 2EKIA 2N1VA 2K39A 3QARA 2JPHA 2KQ4X 3VRBB 2BBCA 2PJHA 2LVQA 2ZNVB 4GDLB 2W54A 1WWTA 4KVGB 3VUWA 1SJHD 3OAWA 4AUQC 3OLMD 2G1EA 3MFGA 3ZNZB 4ITKA 4IWPA 2VH2A 2D3BA 2HTME 1C4AA 4HVBA 3Q3MC 4DHZE 2NMQA 3BYTB 4KZ0A 4F8CB 5EE0A 1I35A 2LGDA 3I5JC 4YT0B 2JU6X 2NR2A 2BYTA 2K1FA 3W1YA 2V3NA 4N9F4 3FILB 1ZP0B 3ZXRA 1P0RA 2KDEB 4KKIA 2ZCCA 3KWLA 1K8RB 1F52A 4AOFA 1WMHB 2RMMA 3R2TA 4RCOA 3R8BA 1UGJA 1YJIA 1QILA 1XLQA 3IT6B 3SD5A 3NVVA 4D2KA 1C78A 3KYCD 3Q2AC 1UH6A 2KACA 1ISNA 4XE0A 4BBNC 4RGOS 3AMZA 4HROA 3IFWB 3DBRB 3U7DA 4JGHB 2BYVE 4AJWA 2NBVB 4RFBA 4ZHPA 3A4SC 1FXTB 2KZRA 4FBJB 1TZOA 1C4PA 4GOCA 2VRRB 4FJYA 2NCNA 3I9V1 3UGBB 2PLPA 3DVGX 2D11A 2WXNA 4DHJD 3TJPA 3B1LX 2NTTA 3PSEB 5DCNA 3EA6A 1L2NA 2XEWA 2BYEA 2RDGA 2EMSA 1GB1A 2CU1A 1D5XC 2MJDA 3Q8EA 2KAJA 2WX0A 3T3NA 5BO4B 1SJED 3N1XC 4DK5A 3N32A 2W3SA 4WAAA 1XEEA 2QIEB 5BMHA 3VHTC 1TYGB 2MCNB 3DOWA 2WS3B 5J2RA 1SSNA 2CR5A 2MJ3A 3IT4B 3VUXA 3RNFC 1OFFA 1RAXA 4Q2JA 3AN1A 2WXKA 2REXA 2PE9A 1JWSD 3PLVA 1QT9A 2WXMA 3ML9A 5GMVA 2M4NA 2IGGA 1FRRA 3AEBB 1OGWA 1SGHA 1P3QU 2KX0A 2YLMA 2V3SA 1DYQA 4FADA 3Q69A 4BFRA 4BVUC 2QMTA 4HJGE 2WU2B 3TBLD 3KVFB 3K9PB 2QJLA 5IOIA 1FCCC 1PQSA 3PRPB 3B08A 1VD2A 2YVCA 2LRWA 2KX3A 3P4QB 1YN3A 4K3CA 5AZFA 2ZZPB 2J53A 2K8BA 4KGRA 2C5LC 3AEDB 3AE1B 1WGDA 2ACZB 2MW5A 1WSPA 1CZPA 2WP9B 3ZNHB 3ZO5B 4XZ4A 1L6VA 2KTRA 5H92C 3E56A 2DENB 4HKZE 2W55A 2ONQA
chains in the Genus database with same CATH topology
3ZVVA 1GC6A 4BOZB 3ZIMA 1UZXB 3PS6A 3VFKA 2LUEA 3VUYA 2A4ZA 3GOEA 2WYQA 5JHBA 1D3ZA 4KSKC 1Z2MA 3V6EB 2L7RA 5E6OA 3VH3B 2MWSB 2G45B 4PS8A 3A9JA 3A9KA 2DZKA 2FCSA 3D32A 3PRMB 4JQWC 5HKHA 4KIKA 4P7IA 4EZLA 3HIZA 1L7YA 1J0GA 4TUUA 1IPGA 5AEKB 4FJVB 3VH4B 4BKTA 1IYFA 1G6JA 4FLHA 1WY8A 5DPTA 1KJTA 2IO1B 2IO3B 4GSWA 2LASA 4TQ1A 2RPQA 3KYDD 4AWJA 5J18A 5C1ZA 2UYZB 3RZFA 3DBHI 2JF5A 2FUHB 2MP2B 2Y5BB 3DBLI 4MEMA 1WR6E 4IWOA 3ONSA 2DHZA 3NY5A 4BKSA 2I1KA 2Z0EB 4GN1A 3JYUA 4MGZE 3NZUA 4HWIB 3VXWA 3UQBA 2RD0A 1R4NI 2BWFA 2ZPNA 3VTWA 1WGYA 2AYOB 2IZVB 1XD3B 3R66C 2NBWB 2JY6A 5JH5C 2MBQA 1Z5SB 5CHWA 1XT9B 2L0TA 2KFJA 1KM7A 3IVFA 2KQSA 2V1YA 4K7WA 3V62A 1H4RA 2J7QB 4ZRJA 5TR5A 1WGRA 4DHZB 3PTFC 4ZYNA 2BF8B 2EKEC 3JSVA 3MJWA 2Z59B 1KLVA 2IO2B 4HCPB 4PYZA 3A1QA 4TKNA 4EEWA 2G3QB 1WJ6A 3PREA 3WA0A 4ANUA 4F7ZA 4PS3A 2NPTA 4HDQA 3DBSA 3QQ8B 3HK0A 3PHXB 4ANWA 4FA6A 1WFYA 3UQAA 2LRUA 4FJZA 1WE6A 1ZKHA 2MLBA 1WIAA 4ZRKA 2L8JA 2GMIC 1TGZB 1OEYJ 2JVCA 2FCQA 4CHKA 1Q0WB 3UIOB 4BKGA 5E6PA 3C0RB 1EO6A 2L3ZA 4OVVA 4F1SA 4K81A 5G55A 4K7UA 1WJUA 3CSTA 4GXBA 1UD7A 2DYOA 4FULA 1V80A 2KWUB 1E5WA 2K8CA 1E8YA 2O6VB 4WQOB 3VTUA 3A4RA 2KHWB 5E6NA 3VQIA 2KLGA 4URKA 1NI2A 4W9KA 1T0YA 2MBBB 1UELA 4X57B 3X23A 2PPHA 4MH0E 1WX9A 1OTRB 2R2QA 2KFKA 2D2QA 3CSFA 4GDLA 3RULA 4LDTB 4I6PA 3NOBA 3APDA 4W9EA 4IM3A 2RR9A 4HXDA 1V81A 3ZDMC 4EZKA 1WXAA 3TL5A 3UINB 1NDDA 2C9WB 2K6DB 3ZTDA 3BY4B 5DPSA 1IP9A 2J0JA 2N1WA 2NS5A 4TV3A 3W1SA 2WDTB 3R7RA 2IYDB 4IW0A 1E8XA 3L54A 4EUTA 2M1MA 2WWZA 4BKSD 5CHFA 4G11A 2C7HA 2J0KA 2KOXA 1BT0A 1KOTA 3IG3A 2KTRB 2KWVB 4GB9A 4IM0A 4HDOA 3ZRFA 4A3PA 2A5UA 1WZ0A 3MHSD 1TTNA 3QX1A 4DDID 3U30A 2LXCA 2ZEQA 2KANA 2B3AA 2LVPA 1E8ZA 3H6NA 3V60A 1V6EA 1EF5A 2MRPA 3L10B 1P1AA 2EMTA 5LLIA 2L0FA 2LVOA 2HTHA 3A9JB 3MTNB 2OOBB 4WJNA 4WJOA 5FR6A 2MBHA 3A9KB 4NQKE 1WX8A 3ZKJC 3QJZA 4KIKB 4XC2A 2MBOA 3ZDTA 5AZHA 3PVLA 3OJ4B 4MM3A 5D6JB 4G0NB 4B9KA 3PLUA 2IBIB 1F9JA 4HPLB 1WZ3A 1YX5B 2AL3A 5C23A 4MGIE 4JIOU 4W9DA 3TCAA 2KKCA 1WMHA 2O2VA 4GU2A 4KZCA 3WANA 2MQJA 3NZSA 4GDKA 3IBEA 3QCAA 1WE7A 4I6LB 4WWNA 1A5RA 5J17A 3L13A 3CMMB 1SIFA 2G4SA 3LDZE 4RM9A 2CHXA 3KW5B 2GOWA 2XK5A 4E74A 3VVWB 1WJNA 1ZGUB 5CTRC 4MDKE 3ZRCA 4PYUA 1GG3A 3DCGA 1TBEA 5LXIB 4I6NB 2KO3A 2W9NA 1RRBA 4W9HA 1GUAB 2M17A 1X1MA 2IY1B 4NPNA 4AP4C 1V86A 4M0WB 4ANVA 4ICVA 2KWCA 3T8MA 4YL8A 1E8WA 5IA7A 5D7GA 1CMXB 1E7VA 2BKRB 4W9CA 3SU8X 3JSVB 2DZIA 4PS7A 4J6IA 2LZ6A 2O6VD 3QIJA 3A1QB 4KDIC 4FN2A 1S1QB 4A20A 3EC8A 4IUMB 2NPTB 4RMAA 1RLFA 4G3XB 4ZRIA 3RUIB 3VDZA 2MSED 2DYMA 2KQ7A 1WF9A 4ANXA 3QHTA 2KMAA 3WAOA 4LDTD 2FAZA 4MSMB 4E71A 2JRHA 4OVUA 3WIMA 4NJ6A 1V49A 1P9DU 4KDLB 4NAWA 1JRUA 2JT4B 3RZWC 4CYEA 1C3TA 1WH3A 2DX5B 4II2B 3R7QA 4M8MA 3PV1A 1V5TA 3Q3JA 4JLCA 2KVRA 3S2AA 1EUVB 3DVNU 1WR1A 2MX2A 3L16A 2DYBA 2HD5B 3ENEA 2GBKA 4MJSA 3WAMA 2N1VA 3DBRI 2IO0B 2N7DA 2ZVNA 1LQBA 1QZEA 2BKFA 3L0WB 2K39A 3QARA 1J19A 1WGGA 1YJ1A 2JPHA 3M62B 5L83A 3KH0A 4DDGD 3KUZA 2JRIB 1WM3A 4W9GA 2PJHA 4MELA 2V4LA 2KN5A 2LI5A 3PHWB 1E90A 2KFKB 2LVQA 2ZNVB 2L05A 4GDLB 3U8ZA 2C7MB 2M0XA 4W9JA 5IAAC 4IM2A 2K8HA 5DPRA 5G2NA 2NVUI 4KVGB 3H7PB 3VUWA 2Z0DB 3N30A 3AU5A 2KC2A 2LXAA 3OAWA 4AUQC 3OLMD 4IWQA 3AU4A 3ZNZB 2R2OA 4NQLB 1R4MI 1NBFC 4IWPA 1WGHA 3BINA 3APCA 4HVBA 3A33B 2D07B 4DHZE 3QWZB 4KZ0A 4F8CB 1I35A 3N3KB 5JHAA 2LGDA 4M8NA 2CS4A 3QAQA 4ICUA 2NR2A 3V6CB 2K1FA 2ZVOA 5L95C 3W1YA 3L17A 4N9F4 1GNUA 3H7SA 4JL9A 4II3B 5LXHA 2N7EA 1P0RA 2KDEB 2N4FA 2ZCBA 4EZJA 1XQQA 3K9OB 1OEYA 2GBJA 4TQ0A 1C1YB 2KDIA 2ZCCA 4WWPA 1K8RB 3UF8A 2KNBA 4E3CA 2J0MA 4B95A 2DZMA 4AOFA 4BOSC 3AXCA 2MA9B 1YD8U 4W9LA 2C7NB 4KV2A 3DQVA 5JZEB 3DPDA 1WMHB 2O2VB 4GGQA 4WWOA 4GDKB 4LJPB 3P2BA 3SDLC 3SHQA 2ZNVC 3SD5A 3AULA 1V2YA 4IG7B 2XK5B 3KYCD 2IY0B 1UH6A 3VAWA 3ZW3A 1ISNA 2FIDA 3V61A 2PE6B 3H9DA 3QA8A 4BBNC 1WYWB 4LCDE 2G4DB 2QHOA 2DZJA 1H8CA 4K7SA 3H1UA 3Q3FA 3RD2A 3WALA 3IFWB 3PRZA 2PEAA 3U7DA 5D94A 3NHEB 2BWES 4FHKA 2ZPYA 3GZNI 4JGHB 2BYVE 1EF1A 4HCNB 4AJWA 2GBMA 2NBVB 4EFOA 1P98A 3RT3B 3TIXA 1AARA 3A4SC 4ASWC 4HLEA 3DVGY 1FXTB 3AI5A 2KDBA 2KZRA 3QC8B 4FBJB 3HM3A 3VTVA 4GOCA 2KTFA 2VRRB 3ZNGC 4FJYA 2NCNA 3M95A 4CO7A 1SE9A 3UGBB 1LFDA 3DVGX 2D11A 2FIFA 2NBUA 4G50A 4DHJD 1OQYA 4NAWB 4XX5A 1WRDB 1WXVA 1WX7A 3TJPA 2KK8A 3B1LX 3ZUNA 3PSEB 2KLCA 3HM6X 3ML8A 1TZ1A 4MJSB 5DCNA 2XEWA 1L2NA 2BYEA 2KJHB 2LWPA 3KUCB 2FNJB 2EMSA 4RM8A 5EDSA 3KUDB 4GIVA 2CU1A 3TMPB 1I42A 5AZGA 3RCZA 1U4AA 4DBGA 2WX1A 2RGFA 4LJOB 1J8CA 3M63B 3O65B 1RFAA 2WX0A 1Q1OA 2GBNA 1WM2A 1GC7A 5BO4B 2ZJDA 2OJRA 3N32A 4DK5A 4WAAA 4WJQA 3CF6E 3PPAA 4HPMB 2L00B 4EKUA 2HJ8A 3VHTC 2K25A 2MP2A 2JXXA 4EOYA 2BPSA 3PGEA 2MCNB 1UBQA 2JZZA 3RYTA 3DOWA 4A3OA 5J2RA 5KHOA 2KDFB 1UGMA 4IC7B 4DHJB 3HHMA 2RSUA 2AEHA 1VCBA 2CR5A 3T9LA 4BBNF 4HK2A 1YQBA 2DAJA 4W9FA 2JZ3B 3VUXA 2AL6A 2BYFA 1RAXA 1V9JA 2C60A 2REXA 2CKHB 2L76A 4HJKA 1WXSA 4MSQB 2N9PC 2LD9A 1HE8A 3ZNID 3EFUA 1YIWA 5DPWA 2PE9A 3DDCB 4NJ7A 3B0AA 3LJ3A 2M8SA 4DWFA 2I1JA 2DAFA 3PLVA 3ML9A 1V5OA 5GMVA 2M4NA 3EHVA 4NNJB 1GJZA 4MGYE 2MBEA 3I3TB 4MGKE 2FCNA 4WJPA 3EECA 2N9XA 2KJ6A 1OGWA 1SGHA 1P3QU 3ECIA 3QK0A 2KX0A 3JVZX 4KSLC 4ZDVA 2D3GA 2YLMA 3IHPC 2V3SA 3ZLZA 2N9EB 4FADA 2HE7A 4BFRA 3PZDA 4W9IA 4BVUC 2UWQA 3ZTCA 2JUOA 2CHZA 2CHWA 3TBLD 2KD0A 3KVFB 3H7PA 1E7UA 5KHQA 3DVNV 2O6VA 3OJ3A 3K9PB 3APFA 2KJRA 2XBBC 3WAPA 4B6WA 1UBIA 1MG8A 1PQSA 1ZW7A 3L08A 3M3JA 4FHJA 2KC1A 1LXDA 3PRPB 3B08A 4DXAB 1VD2A 2LGYA 1Y8RC 2K6QA 4AJYB 2LGXA 2LJ5A 1S3SG 1Q5WB 2YVCA 2AWTA 3W1SC 1M94A 2LRWA 2FCMA 2KMCA 2KX3A 3JW0X 1WXMA 1YX6B 1LM8B 5CHVC 5AZFA 2ZZPB 5D2MB 2K8BA 3UIPB 2C5LC 3PT2B 1WGDA 2KXJA 2MW5A 3ALBA 3X0WA 3ZNHB 3ZO5B 4XZ4A 2KTRA 2ASQA 2JWZA 2BGFA 1WJ4A 2D10A 2DENB 3R3MA 1WI0A 4GMVA 4K1RB 4NY0A 5CX3A 2GBRA 3NS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZVV A;  1GC6 A;  4BOZ B;  3ZIM A;  1UZX B;  3PS6 A;  3VFK A;  2LUE A;  3VUY A;  2A4Z A;  3GOE A;  2WYQ A;  5JHB A;  1D3Z A;  4KSK C;  1Z2M A;  3V6E B;  2L7R A;  5E6O A;  3VH3 B;  2MWS B;  2G45 B;  4PS8 A;  3A9J A;  3A9K A;  2DZK A;  2FCS A;  3D32 A;  3PRM B;  4JQW C;  5HKH A;  4KIK A;  4P7I A;  4EZL A;  3HIZ A;  1L7Y A;  1J0G A;  4TUU A;  1IPG A;  5AEK B;  4FJV B;  3VH4 B;  4BKT A;  1IYF A;  1G6J A;  4FLH A;  1WY8 A;  5DPT A;  1KJT A;  2IO1 B;  2IO3 B;  4GSW A;  2LAS A;  4TQ1 A;  2RPQ A;  3KYD D;  4AWJ A;  5J18 A;  5C1Z A;  2UYZ B;  3RZF A;  3DBH I;  2JF5 A;  2FUH B;  2MP2 B;  2Y5B B;  3DBL I;  4MEM A;  1WR6 E;  4IWO A;  3ONS A;  2DHZ A;  3NY5 A;  4BKS A;  2I1K A;  2Z0E B;  4GN1 A;  3JYU A;  4MGZ E;  3NZU A;  4HWI B;  3VXW A;  3UQB A;  2RD0 A;  1R4N I;  2BWF A;  2ZPN A;  3VTW A;  1WGY A;  2AYO B;  2IZV B;  1XD3 B;  3R66 C;  2NBW B;  2JY6 A;  5JH5 C;  2MBQ A;  1Z5S B;  5CHW A;  1XT9 B;  2L0T A;  2KFJ A;  1KM7 A;  3IVF A;  2KQS A;  2V1Y A;  4K7W A;  3V62 A;  1H4R A;  2J7Q B;  4ZRJ A;  5TR5 A;  1WGR A;  4DHZ B;  3PTF C;  4ZYN A;  2BF8 B;  2EKE C;  3JSV A;  3MJW A;  2Z59 B;  1KLV A;  2IO2 B;  4HCP B;  4PYZ A;  3A1Q A;  4TKN A;  4EEW A;  2G3Q B;  1WJ6 A;  3PRE A;  3WA0 A;  4ANU A;  4F7Z A;  4PS3 A;  2NPT A;  4HDQ A;  3DBS A;  3QQ8 B;  3HK0 A;  3PHX B;  4ANW A;  4FA6 A;  1WFY A;  3UQA A;  2LRU A;  4FJZ A;  1WE6 A;  1ZKH A;  2MLB A;  1WIA A;  4ZRK A;  2L8J A;  2GMI C;  1TGZ B;  1OEY J;  2JVC A;  2FCQ A;  4CHK A;  1Q0W B;  3UIO B;  4BKG A;  5E6P A;  3C0R B;  1EO6 A;  2L3Z A;  4OVV A;  4F1S A;  4K81 A;  5G55 A;  4K7U A;  1WJU A;  3CST A;  4GXB A;  1UD7 A;  2DYO A;  4FUL A;  1V80 A;  2KWU B;  1E5W A;  2K8C A;  1E8Y A;  2O6V B;  4WQO B;  3VTU A;  3A4R A;  2KHW B;  5E6N A;  3VQI A;  2KLG A;  4URK A;  1NI2 A;  4W9K A;  1T0Y A;  2MBB B;  1UEL A;  4X57 B;  3X23 A;  2PPH A;  4MH0 E;  1WX9 A;  1OTR B;  2R2Q A;  2KFK A;  2D2Q A;  3CSF A;  4GDL A;  3RUL A;  4LDT B;  4I6P A;  3NOB A;  3APD A;  4W9E A;  4IM3 A;  2RR9 A;  4HXD A;  1V81 A;  3ZDM C;  4EZK A;  1WXA A;  3TL5 A;  3UIN B;  1NDD A;  2C9W B;  2K6D B;  3ZTD A;  3BY4 B;  5DPS A;  1IP9 A;  2J0J A;  2N1W A;  2NS5 A;  4TV3 A;  3W1S A;  2WDT B;  3R7R A;  2IYD B;  4IW0 A;  1E8X A;  3L54 A;  4EUT A;  2M1M A;  2WWZ A;  4BKS D;  5CHF A;  4G11 A;  2C7H A;  2J0K A;  2KOX A;  1BT0 A;  1KOT A;  3IG3 A;  2KTR B;  2KWV B;  4GB9 A;  4IM0 A;  4HDO A;  3ZRF A;  4A3P A;  2A5U A;  1WZ0 A;  3MHS D;  1TTN A;  3QX1 A;  4DDI D;  3U30 A;  2LXC A;  2ZEQ A;  2KAN A;  2B3A A;  2LVP A;  1E8Z A;  3H6N A;  3V60 A;  1V6E A;  1EF5 A;  2MRP A;  3L10 B;  1P1A A;  2EMT A;  5LLI A;  2L0F A;  2LVO A;  2HTH A;  3A9J B;  3MTN B;  2OOB B;  4WJN A;  4WJO A;  5FR6 A;  2MBH A;  3A9K B;  4NQK E;  1WX8 A;  3ZKJ C;  3QJZ A;  4KIK B;  4XC2 A;  2MBO A;  3ZDT A;  5AZH A;  3PVL A;  3OJ4 B;  4MM3 A;  5D6J B;  4G0N B;  4B9K A;  3PLU A;  2IBI B;  1F9J A;  4HPL B;  1WZ3 A;  1YX5 B;  2AL3 A;  5C23 A;  4MGI E;  4JIO U;  4W9D A;  3TCA A;  2KKC A;  1WMH A;  2O2V A;  4GU2 A;  4KZC A;  3WAN A;  2MQJ A;  3NZS A;  4GDK A;  3IBE A;  3QCA A;  1WE7 A;  4I6L B;  4WWN A;  1A5R A;  5J17 A;  3L13 A;  3CMM B;  1SIF A;  2G4S A;  3LDZ E;  4RM9 A;  2CHX A;  3KW5 B;  2GOW A;  2XK5 A;  4E74 A;  3VVW B;  1WJN A;  1ZGU B;  5CTR C;  4MDK E;  3ZRC A;  4PYU A;  1GG3 A;  3DCG A;  1TBE A;  5LXI B;  4I6N B;  2KO3 A;  2W9N A;  1RRB A;  4W9H A;  1GUA B;  2M17 A;  1X1M A;  2IY1 B;  4NPN A;  4AP4 C;  1V86 A;  4M0W B;  4ANV A;  4ICV A;  2KWC A;  3T8M A;  4YL8 A;  1E8W A;  5IA7 A;  5D7G A;  1CMX B;  1E7V A;  2BKR B;  4W9C A;  3SU8 X;  3JSV B;  2DZI A;  4PS7 A;  4J6I A;  2LZ6 A;  2O6V D;  3QIJ A;  3A1Q B;  4KDI C;  4FN2 A;  1S1Q B;  4A20 A;  3EC8 A;  4IUM B;  2NPT B;  4RMA A;  1RLF A;  4G3X B;  4ZRI A;  3RUI B;  3VDZ A;  2MSE D;  2DYM A;  2KQ7 A;  1WF9 A;  4ANX A;  3QHT A;  2KMA A;  3WAO A;  4LDT D;  2FAZ A;  4MSM B;  4E71 A;  2JRH A;  4OVU A;  3WIM A;  4NJ6 A;  1V49 A;  1P9D U;  4KDL B;  4NAW A;  1JRU A;  2JT4 B;  3RZW C;  4CYE A;  1C3T A;  1WH3 A;  2DX5 B;  4II2 B;  3R7Q A;  4M8M A;  3PV1 A;  1V5T A;  3Q3J A;  4JLC A;  2KVR A;  3S2A A;  1EUV B;  3DVN U;  1WR1 A;  2MX2 A;  3L16 A;  2DYB A;  2HD5 B;  3ENE A;  2GBK A;  4MJS A;  3WAM A;  2N1V A;  3DBR I;  2IO0 B;  2N7D A;  2ZVN A;  1LQB A;  1QZE A;  2BKF A;  3L0W B;  2K39 A;  3QAR A;  1J19 A;  1WGG A;  1YJ1 A;  2JPH A;  3M62 B;  5L83 A;  3KH0 A;  4DDG D;  3KUZ A;  2JRI B;  1WM3 A;  4W9G A;  2PJH A;  4MEL A;  2V4L A;  2KN5 A;  2LI5 A;  3PHW B;  1E90 A;  2KFK B;  2LVQ A;  2ZNV B;  2L05 A;  4GDL B;  3U8Z A;  2C7M B;  2M0X A;  4W9J A;  5IAA C;  4IM2 A;  2K8H A;  5DPR A;  5G2N A;  2NVU I;  4KVG B;  3H7P B;  3VUW A;  2Z0D B;  3N30 A;  3AU5 A;  2KC2 A;  2LXA A;  3OAW A;  4AUQ C;  3OLM D;  4IWQ A;  3AU4 A;  3ZNZ B;  2R2O A;  4NQL B;  1R4M I;  1NBF C;  4IWP A;  1WGH A;  3BIN A;  3APC A;  4HVB A;  3A33 B;  2D07 B;  4DHZ E;  3QWZ B;  4KZ0 A;  4F8C B;  1I35 A;  3N3K B;  5JHA A;  2LGD A;  4M8N A;  2CS4 A;  3QAQ A;  4ICU A;  2NR2 A;  3V6C B;  2K1F A;  2ZVO A;  5L95 C;  3W1Y A;  3L17 A;  4N9F 4;  1GNU A;  3H7S A;  4JL9 A;  4II3 B;  5LXH A;  2N7E A;  1P0R A;  2KDE B;  2N4F A;  2ZCB A;  4EZJ A;  1XQQ A;  3K9O B;  1OEY A;  2GBJ A;  4TQ0 A;  1C1Y B;  2KDI A;  2ZCC A;  4WWP A;  1K8R B;  3UF8 A;  2KNB A;  4E3C A;  2J0M A;  4B95 A;  2DZM A;  4AOF A;  4BOS C;  3AXC A;  2MA9 B;  1YD8 U;  4W9L A;  2C7N B;  4KV2 A;  3DQV A;  5JZE B;  3DPD A;  1WMH B;  2O2V B;  4GGQ A;  4WWO A;  4GDK B;  4LJP B;  3P2B A;  3SDL C;  3SHQ A;  2ZNV C;  3SD5 A;  3AUL A;  1V2Y A;  4IG7 B;  2XK5 B;  3KYC D;  2IY0 B;  1UH6 A;  3VAW A;  3ZW3 A;  1ISN A;  2FID A;  3V61 A;  2PE6 B;  3H9D A;  3QA8 A;  4BBN C;  1WYW B;  4LCD E;  2G4D B;  2QHO A;  2DZJ A;  1H8C A;  4K7S A;  3H1U A;  3Q3F A;  3RD2 A;  3WAL A;  3IFW B;  3PRZ A;  2PEA A;  3U7D A;  5D94 A;  3NHE B;  2BWE S;  4FHK A;  2ZPY A;  3GZN I;  4JGH B;  2BYV E;  1EF1 A;  4HCN B;  4AJW A;  2GBM A;  2NBV B;  4EFO A;  1P98 A;  3RT3 B;  3TIX A;  1AAR A;  3A4S C;  4ASW C;  4HLE A;  3DVG Y;  1FXT B;  3AI5 A;  2KDB A;  2KZR A;  3QC8 B;  4FBJ B;  3HM3 A;  3VTV A;  4GOC A;  2KTF A;  2VRR B;  3ZNG C;  4FJY A;  2NCN A;  3M95 A;  4CO7 A;  1SE9 A;  3UGB B;  1LFD A;  3DVG X;  2D11 A;  2FIF A;  2NBU A;  4G50 A;  4DHJ D;  1OQY A;  4NAW B;  4XX5 A;  1WRD B;  1WXV A;  1WX7 A;  3TJP A;  2KK8 A;  3B1L X;  3ZUN A;  3PSE B;  2KLC A;  3HM6 X;  3ML8 A;  1TZ1 A;  4MJS B;  5DCN A;  2XEW A;  1L2N A;  2BYE A;  2KJH B;  2LWP A;  3KUC B;  2FNJ B;  2EMS A;  4RM8 A;  5EDS A;  3KUD B;  4GIV A;  2CU1 A;  3TMP B;  1I42 A;  5AZG A;  3RCZ A;  1U4A A;  4DBG A;  2WX1 A;  2RGF A;  4LJO B;  1J8C A;  3M63 B;  3O65 B;  1RFA A;  2WX0 A;  1Q1O A;  2GBN A;  1WM2 A;  1GC7 A;  5BO4 B;  2ZJD A;  2OJR A;  3N32 A;  4DK5 A;  4WAA A;  4WJQ A;  3CF6 E;  3PPA A;  4HPM B;  2L00 B;  4EKU A;  2HJ8 A;  3VHT C;  2K25 A;  2MP2 A;  2JXX A;  4EOY A;  2BPS A;  3PGE A;  2MCN B;  1UBQ A;  2JZZ A;  3RYT A;  3DOW A;  4A3O A;  5J2R A;  5KHO A;  2KDF B;  1UGM A;  4IC7 B;  4DHJ B;  3HHM A;  2RSU A;  2AEH A;  1VCB A;  2CR5 A;  3T9L A;  4BBN F;  4HK2 A;  1YQB A;  2DAJ A;  4W9F A;  2JZ3 B;  3VUX A;  2AL6 A;  2BYF A;  1RAX A;  1V9J A;  2C60 A;  2REX A;  2CKH B;  2L76 A;  4HJK A;  1WXS A;  4MSQ B;  2N9P C;  2LD9 A;  1HE8 A;  3ZNI D;  3EFU A;  1YIW A;  5DPW A;  2PE9 A;  3DDC B;  4NJ7 A;  3B0A A;  3LJ3 A;  2M8S A;  4DWF A;  2I1J A;  2DAF A;  3PLV A;  3ML9 A;  1V5O A;  5GMV A;  2M4N A;  3EHV A;  4NNJ B;  1GJZ A;  4MGY E;  2MBE A;  3I3T B;  4MGK E;  2FCN A;  4WJP A;  3EEC A;  2N9X A;  2KJ6 A;  1OGW A;  1SGH A;  1P3Q U;  3ECI A;  3QK0 A;  2KX0 A;  3JVZ X;  4KSL C;  4ZDV A;  2D3G A;  2YLM A;  3IHP C;  2V3S A;  3ZLZ A;  2N9E B;  4FAD A;  2HE7 A;  4BFR A;  3PZD A;  4W9I A;  4BVU C;  2UWQ A;  3ZTC A;  2JUO A;  2CHZ A;  2CHW A;  3TBL D;  2KD0 A;  3KVF B;  3H7P A;  1E7U A;  5KHQ A;  3DVN V;  2O6V A;  3OJ3 A;  3K9P B;  3APF A;  2KJR A;  2XBB C;  3WAP A;  4B6W A;  1UBI A;  1MG8 A;  1PQS A;  1ZW7 A;  3L08 A;  3M3J A;  4FHJ A;  2KC1 A;  1LXD A;  3PRP B;  3B08 A;  4DXA B;  1VD2 A;  2LGY A;  1Y8R C;  2K6Q A;  4AJY B;  2LGX A;  2LJ5 A;  1S3S G;  1Q5W B;  2YVC A;  2AWT A;  3W1S C;  1M94 A;  2LRW A;  2FCM A;  2KMC A;  2KX3 A;  3JW0 X;  1WXM A;  1YX6 B;  1LM8 B;  5CHV C;  5AZF A;  2ZZP B;  5D2M B;  2K8B A;  3UIP B;  2C5L C;  3PT2 B;  1WGD A;  2KXJ A;  2MW5 A;  3ALB A;  3X0W A;  3ZNH B;  3ZO5 B;  4XZ4 A;  2KTR A;  2ASQ A;  2JWZ A;  2BGF A;  1WJ4 A;  2D10 A;  2DEN B;  3R3M A;  1WI0 A;  4GMV A;  4K1R B;  4NY0 A;  5CX3 A;  2GBR A;  3NS8 A; 
#chains in the Genus database with same CATH topology
 3PS6 A;  2JZP A;  3VUY A;  1AW7 A;  5JHB A;  3V6E B;  3SR6 A;  2L7R A;  2MWS B;  2G45 B;  1J7C A;  3A9J A;  3BVM A;  2DZK A;  3P4R B;  4P7I A;  1IPG A;  1N60 A;  1IYF A;  1G6J A;  5DPT A;  2Y5C A;  4RGN A;  2WXH A;  1HEZ E;  4AWJ A;  5J18 A;  4RGT A;  3N1Z C;  3RZF A;  2Y5B B;  4MEM A;  3ONS A;  4YTM B;  4HWI B;  5AUI A;  1R4N I;  2BWF A;  1UUP A;  3R66 C;  2L83 A;  5JH5 C;  1T5X D;  4WWM A;  3VR9 B;  2V1Y A;  4P16 A;  1SIJ A;  2I38 A;  4UDU C;  3MJW A;  1KLV A;  2Z59 B;  3Q8C A;  3RPF C;  3WA0 A;  4ANU A;  1D5M C;  3HK0 A;  1WFY A;  2W3R A;  3UQA A;  2BS3 B;  1TS3 A;  2MLB A;  4ZHO A;  4OHJ A;  3ZQ4 A;  1TGZ B;  2JVC A;  2VZK B;  2AQ1 B;  4OVZ A;  1Q0W B;  4BKG A;  1EO6 A;  4K81 A;  4K7U A;  4A8X C;  4GXB A;  4HPP A;  2DYO A;  4L2Y A;  3A4R A;  1TKE A;  5E6N A;  3VQI A;  5LNK 1;  1NI2 A;  1UEL A;  1WX9 A;  2D2Q A;  1VRA B;  3EFC A;  4LDT B;  4W9E A;  1E9M A;  4HXD A;  3MJ5 A;  3TL5 A;  2C9W B;  2K6D B;  3ZTD A;  5DPS A;  2IGH A;  1K50 A;  3R7R A;  4IW0 A;  1XCT L;  3L54 A;  5T8I A;  5CHF A;  1BT0 A;  3DHH C;  3DWG C;  3IG3 A;  2KTR B;  3ZRF A;  3KLS X;  4YSY B;  2A5U A;  2M56 B;  2LVP A;  1I4H A;  2WXR A;  5LLI A;  4J3O D;  2L0F A;  3P1M A;  5BYR A;  3A9J B;  3ZKJ C;  2Y5P A;  3ZDT A;  1P7E A;  1QOG A;  1JML A;  2IBI B;  4OW0 A;  2KDM A;  3WAN A;  2MQJ A;  3NZS A;  1ZXH A;  5J17 A;  1SIF A;  3NG0 A;  1F77 A;  1RYJ A;  2XK5 A;  3MHZ A;  1F2R I;  1WJN A;  4XDD A;  2Y3A A;  2DNF A;  1TBE A;  5LXI B;  1EU4 A;  2KO3 A;  1K52 A;  1X1M A;  4ICV A;  3I57 A;  1CQV A;  2KWC A;  2ICI A;  2KWD A;  4YL8 A;  5EE9 A;  3T8M A;  5IA7 A;  4KGS A;  5FR3 A;  4J6I A;  2O6V D;  2QIL A;  3QIJ A;  1NI3 A;  4AQ7 A;  1E7P B;  1VZ8 A;  3RUI B;  2MSE D;  1FFU A;  3P42 A;  4OVU A;  3WIM A;  4NJ6 A;  4RGM A;  4KDL B;  4NAW A;  3RZW C;  1WH3 A;  3R7Q A;  4M8M A;  1EUV B;  2HD5 B;  4MJS A;  3WAM A;  3DBR I;  1XLN A;  2IO0 B;  4WWN A;  3P4S B;  1LQB A;  3L0W B;  5L83 A;  3KH0 A;  1JW9 D;  2WLB A;  2JRI B;  1WM3 A;  2Q5W D;  4LNI A;  4MEL A;  1N61 A;  2V4L A;  2LI5 A;  3PHW B;  1E90 A;  2M0X A;  4W9J A;  5IAA C;  2K8H A;  5G2N A;  3H7P B;  1V1P A;  2Z0D B;  3AU5 A;  1CK1 A;  2BT6 A;  4IWQ A;  4ZYS A;  2R2O A;  1WGH A;  1TIF A;  5D3D A;  2GRI A;  3N3K B;  4M8N A;  2CS4 A;  1PUT A;  1JWA D;  3P63 A;  1VDV A;  3H7S A;  4JL9 A;  5LXH A;  2N7E A;  1ENF A;  2MH7 A;  1C1Y B;  2KDI A;  3O13 A;  3UF8 A;  1VJK A;  2KNB A;  4E3C A;  2J0M A;  4B95 A;  2DZM A;  1XCQ L;  4YSZ B;  3AXC A;  2MA9 B;  2WDR B;  1YD8 U;  4W9L A;  4WQM A;  1R7S A;  4KV2 A;  4L1B A;  4WWO A;  2JYT A;  3C19 A;  3P2B A;  4LJP B;  3SHQ A;  2ZNV C;  1FNV A;  1ESF A;  3AUL A;  4TMA B;  4IG7 B;  2XK5 B;  1TKY A;  2IY0 B;  1WRI A;  2IDY A;  3VAW A;  4B0E A;  3HUI A;  1T0R C;  2FID A;  2RPV A;  3V61 A;  4C4V A;  3QA8 A;  2DZJ A;  1H8C A;  3WAL A;  2IPK D;  1SE2 A;  3PRZ A;  4FHK A;  2N7J A;  5EE3 A;  1F2R C;  3AEF B;  4CQN A;  1EF1 A;  4HCN B;  2GBM A;  2E6X A;  1I4X A;  1AAR A;  1E6E B;  2KTF A;  4CO7 A;  1HZ6 A;  1GPX A;  2FIF A;  4G50 A;  1OQY A;  4NAW B;  1D5Z C;  1C4C A;  3ZUN A;  3J9C A;  3ML8 A;  2K22 A;  1SE4 A;  4MJS B;  1HTO A;  1N6Z A;  2LUM A;  2FNJ B;  4RM8 A;  3VR8 B;  3TMP B;  5AZG A;  1J7B A;  3RCZ A;  1JRO A;  3O65 B;  1V1P B;  2GBN A;  3LYY A;  1GC7 A;  3SEB A;  1K51 A;  3CF6 E;  3CWI A;  4QAY A;  4EKU A;  4EOY A;  1HXY D;  1FNW A;  1UBQ A;  5HI1 A;  5KHO A;  4IC7 B;  1VCB A;  3T9L A;  1YQB A;  2AX5 A;  2JZ3 B;  1STE A;  2BYF A;  2H88 B;  4XDC A;  1TJE A;  1V9J A;  2L76 A;  4HJK A;  2N9P C;  2LD9 A;  1YIW A;  5DPW A;  3B0A A;  4DWF A;  2M8S A;  3GP7 A;  2I1J A;  3BK1 A;  4MT5 A;  3GZN B;  3EHV A;  2MBE A;  4MGK E;  4WJP A;  3EEC A;  2N9X A;  5GXG B;  1I4G A;  1L6U A;  3JVZ X;  1ET6 A;  4ZDV A;  2D3G A;  1HZ5 A;  3ZLZ A;  2HE7 A;  4W9I A;  2UWQ A;  3ZTC A;  2CHZ A;  2KD0 A;  4C4V B;  2O6V A;  3WAP A;  3AB5 A;  2PIA A;  1ZW7 A;  4FHJ A;  1KTK A;  5D3I B;  1MJD A;  1S3S G;  1Q5W B;  2AWT A;  5HHD G;  1ET9 A;  1HQR D;  3ABV B;  1M94 A;  4OZB A;  2MHJ A;  2J52 A;  5IKC M;  1C79 A;  1ZOY B;  3X0W A;  1WJ4 A;  2D10 A;  2GBR A;  2D3C A;  3ZIM A;  1UZX B;  1EU3 A;  5HFY A;  3GOE A;  1T3Q A;  3Q6B A;  4KSK C;  1Z2M A;  5E6O A;  3VH3 B;  2LEK A;  4PS8 A;  3BII D;  3A9K A;  5HKH A;  2WXI A;  1VZ6 A;  4JWS C;  5AEK B;  3VH4 B;  4BKT A;  4FXC A;  1YNT E;  3LXF A;  2YEP B;  1KJT A;  3R2I A;  2IO3 B;  4TQ1 A;  1FD6 A;  2JF5 A;  1EWC A;  4BKS A;  2I1K A;  4GN1 A;  3JYU A;  4MGZ E;  3NZU A;  4ZRP A;  2RD0 A;  3MC8 A;  2V9H A;  2ZPN A;  3VTW A;  1FO4 A;  2AYO B;  3DWM A;  2JY6 A;  1SF0 A;  3AE7 B;  1XT9 B;  5HG2 A;  3AE5 B;  3IVF A;  5H8Y E;  5BYS A;  1BUI C;  1WGR A;  4DHZ B;  4ZYN A;  2EKE C;  1L0X B;  4HCP B;  4PYZ A;  3A1Q A;  3TSS A;  4TKN A;  1N62 A;  3PO0 A;  4F7Z A;  2NPT A;  4ANW A;  2BW2 A;  1N5W A;  2I2Y A;  1L0Y B;  2L8J A;  2GMI C;  3TEY A;  1NYR A;  2FCQ A;  1TS2 A;  4CHK A;  3BVZ A;  2QDF A;  4OVV A;  4F1S A;  2N9L A;  1CJE A;  1WJU A;  4ZOH C;  1UD7 A;  4FUL A;  1V80 A;  2O6V B;  2KN4 A;  2AQ2 B;  4URK A;  4W9K A;  4TSS A;  4BZA A;  1KRH A;  5G5G A;  4X57 B;  3AM9 A;  4I6P A;  4IM3 A;  4KKJ A;  1V81 A;  2CU3 A;  4EZK A;  1FXI A;  2N1W A;  2WDT B;  3GE3 C;  2IYD B;  1E8X A;  4G11 A;  2C7H A;  2KOX A;  1KOT A;  5BYQ A;  3DBH B;  1V8C A;  4JX1 C;  3DBL B;  4IM0 A;  4A3P A;  1XF5 L;  1WZ0 A;  3MHS D;  3QX1 A;  4DDI D;  3U30 A;  2LXC A;  2ZEQ A;  2KAN A;  1EF5 A;  1BML C;  2HJ1 A;  3PZ7 A;  2E3T A;  4WH4 A;  2HTH A;  4WJN A;  2MBH A;  3A9K B;  2L52 A;  3QJZ A;  1JCK B;  2MBO A;  1WYG A;  1UWX A;  5AZH A;  3U4E G;  1FEH A;  5TSS A;  1FPY A;  2WGS A;  1WZ3 A;  2AL3 A;  4MGI E;  4W9D A;  4B0M A;  4KZC A;  2O2V A;  4GU2 A;  4JE3 B;  2MEK A;  1WE7 A;  2G4S A;  3LDZ E;  4RM9 A;  2KMM A;  1ZGU B;  1V97 A;  4N6E B;  2YEP F;  2BQQ A;  1GG3 A;  4PYU A;  1YN5 A;  1RRB A;  4W9H A;  1GUA B;  2M17 A;  3OG5 A;  4NPN A;  1IBX A;  1E8W A;  1AYF A;  3EUB 2;  1CMX B;  4YTP B;  2LZ6 A;  2BTE A;  3A1Q B;  4S0R A;  4A20 A;  2D3A A;  4A6Q A;  4RMA A;  2NPT B;  2L32 A;  2DYM A;  1WF9 A;  3QHT A;  1GAQ B;  2KMA A;  1V49 A;  2V3P A;  3W5V B;  4CYE A;  2DX5 B;  4II2 B;  1FIQ A;  3PV1 A;  4JLC A;  1WR1 A;  2G9H D;  2MX2 A;  2GBK A;  2N7D A;  2BKF A;  1MI0 A;  1J19 A;  1YJ1 A;  3M62 B;  4USA A;  4PT5 A;  1YMH E;  3KUZ A;  4W9G A;  2OJW A;  4LNF A;  2KN5 A;  3U8Z A;  2NVU I;  2K0P A;  1L4Z B;  2LXA A;  3ETR A;  1NBF C;  1ZUD 2;  1KF6 B;  4XGA B;  3A33 B;  1SE3 A;  3ZJT A;  2V4I B;  4YTN B;  1T6B X;  2FUG 1;  4M00 A;  3V6C B;  3KQ4 A;  2LJI A;  1UWM A;  2BS2 B;  1GNU A;  2M0A A;  4II3 B;  3ZYY X;  4JPS A;  2N4F A;  1LGR A;  3K9O B;  3N1Y C;  4TQ0 A;  3BZD B;  2WXL A;  1KH0 A;  4BOS C;  3IAS 1;  5JZE B;  3DQV A;  3DPD A;  2O2V B;  4GGQ A;  4C56 C;  3SDL C;  3ZXV A;  2RDH A;  1V2Y A;  3IAM 1;  4RNA A;  1WXQ A;  3ZW3 A;  4US9 A;  5FK9 C;  2PE6 B;  3H9D A;  2CJN A;  2G4D B;  3AH7 A;  3NS1 A;  3H1U A;  1UNS A;  4C80 A;  3SFD B;  2PEA A;  4KGT A;  1RFK A;  3AV8 A;  1IBX B;  2BWE S;  2UU7 A;  2ZPY A;  3GZN I;  3BYY B;  1DGJ A;  2X8X X;  3NVY A;  4R3D A;  4EFO A;  1P98 A;  2N9K A;  4ASW C;  4HLE A;  3DVG Y;  3RNE C;  3HM3 A;  2WXO A;  3ZNG C;  1LFD A;  2ON8 A;  3W2D A;  2NBU A;  1R4M B;  1TY2 A;  4DQO C;  4XX5 A;  1QQR A;  1WX7 A;  2KK8 A;  2PKO A;  2BVC A;  1QOF A;  1YOV B;  2KJH B;  2JSV X;  2LWP A;  3KUC B;  1AN8 A;  5EDS A;  3KUD B;  1I42 A;  4XWT A;  3EGR A;  2WX1 A;  1J8C A;  1Q1O A;  3IXS A;  1NYQ A;  2ZJD A;  1JAL A;  2INP E;  3PPA A;  4HPM B;  2MP2 A;  2JXX A;  2BPS A;  3PGE A;  4LNO A;  3RYT A;  4MAC A;  2KDF B;  1UGM A;  4DHJ B;  2RSU A;  4MH8 A;  2AEH A;  1B9R A;  1Q10 A;  4HK2 A;  2DAJ A;  4W9F A;  2C60 A;  1WXS A;  4MSQ B;  2LMC A;  3ZNI D;  1PGB A;  2V0G A;  3DDC B;  4NJ7 A;  3LJ3 A;  2DAF A;  2LFI A;  1XXG A;  3BWU D;  3TEX A;  4NNJ B;  1GJZ A;  3ZGZ A;  1T0S C;  3TUO A;  5I4D A;  2KJ6 A;  3Q8F A;  3QK0 A;  4KSL C;  3IHP C;  4XYC A;  2N9E B;  1MVK A;  4AS1 A;  1Y56 A;  2CHW A;  4HKQ A;  2L1A A;  4YXD B;  1HA5 A;  3OJ3 A;  1RM6 C;  4C7Z A;  3APF A;  1FFV A;  1UBI A;  4LTU A;  4OZA A;  3L08 A;  3M3J A;  1C9F A;  2KC1 A;  2LGY A;  1Y8R C;  2K6Q A;  4O1N A;  3MP9 A;  2LHD A;  3W1S C;  3JW0 X;  2FCM A;  1WXM A;  1MHX A;  1LM8 B;  5CHV C;  1DOX A;  1D6E C;  3UIP B;  3BK2 A;  1FNU A;  3ALB A;  4K1R B;  2LGS A;  4GMV A;  5CX3 A;  1JWM D;  1UF0 A;  4NQK E;  3ZVV A;  1GC6 A;  3VFK A;  2WYQ A;  4K3B A;  1IUE A;  4NZL B;  2DWQ A;  3E9S A;  1T0Q C;  2FCS A;  3D32 A;  3NVZ A;  3PRM B;  4JQW C;  1XLO A;  1ZXI A;  4EZL A;  1N63 A;  1J0G A;  2K5P A;  1TS5 A;  3AEA B;  1WY8 A;  2IO1 B;  2MJE A;  2LAS A;  1TT5 B;  1I4P A;  5C1Z A;  2UYZ B;  1XLP A;  3AEC B;  3DBH I;  1I4R A;  2MP2 B;  3MC9 A;  3DBL I;  1WR6 E;  4IWO A;  2DHZ A;  2Z0E B;  3RMK C;  4RF0 A;  1ZDX A;  1XD3 B;  1Z5S B;  5EE1 A;  1MPE A;  2KFJ A;  4ARI A;  4K7W A;  1QOA A;  3V62 A;  5TR5 A;  2FBW B;  3PTF C;  1GB4 A;  2WXG A;  3JSV A;  3W5U B;  2IO2 B;  2ZW1 A;  4EEW A;  3W9C B;  1VZ7 A;  2G3Q B;  3PRE A;  4PS3 A;  4RH6 A;  3DBS A;  3PHX B;  4FA6 A;  2TSS A;  2GLS A;  2KT7 A;  4YWG G;  4FJZ A;  1ZKH A;  2K9X A;  4ZRK A;  1WIA A;  4H2A A;  2XN9 C;  1OEY J;  3UIO B;  1MG4 A;  1TS4 A;  3C0R B;  2L3Z A;  2PVO D;  4XWW A;  5G55 A;  2WXQ A;  1E5W A;  1YQ4 B;  3VTU A;  3NRZ A;  2KHW B;  4DXF A;  2SAK A;  1T0Y A;  2PPH A;  2QEJ C;  1J7A A;  3DHG C;  1OTR B;  1TKG A;  2KFK A;  3CSF A;  3RUL A;  3NOB A;  3APD A;  3ZJV A;  3ZDM C;  2QSD A;  1NDD A;  1IP9 A;  2DBY A;  2J0J A;  4TV3 A;  4EUT A;  2M1M A;  2WWZ A;  3UI3 A;  2J0K A;  4GB9 A;  2JWU A;  2WXP A;  2N0S B;  2B3A A;  3H6N A;  1E8Z A;  3V60 A;  2MRP A;  3L10 B;  1P1A A;  2EMT A;  1PFD A;  4WJO A;  5FR6 A;  4MM3 A;  2HDE A;  4G0N B;  4HPL B;  1YX5 B;  5C23 A;  1B1Z A;  4JIO U;  1DOY A;  2KKC A;  2SEB D;  4GDK A;  4I6L B;  3CMM B;  3FAH A;  5G5H A;  2CHX A;  2DLB A;  3RNC C;  3VVW B;  1V1O A;  3B9J A;  4MDK E;  3ZRC A;  4I6N B;  2W9N A;  3WCQ A;  3GS2 A;  1IGC A;  3PZ8 A;  2IY1 B;  1V86 A;  4P6V F;  4ANV A;  1QF6 A;  4A9A A;  4W9C A;  3JSV B;  2DZI A;  4PS7 A;  1YJJ A;  1FRD A;  4KDI C;  4FN2 A;  3EC8 A;  1RLF A;  5IO9 A;  3VDZ A;  2WQY B;  2K3U A;  2KQ7 A;  3N20 C;  3ZJU A;  3DHI C;  1QKZ A;  3WAO A;  2FAZ A;  2IJ0 A;  4P1B C;  1VLB A;  1EWY C;  3C8Y A;  3AEE B;  1JRU A;  4HRS A;  1C3T A;  2BS4 B;  3Q3J A;  3SFE B;  3AEG B;  1KFY B;  4C00 A;  2ZVN A;  1QZE A;  1WGG A;  3NZ3 A;  1AWD A;  2OHF A;  4DDG D;  2INN E;  4YSX B;  4BOZ B;  2KFK B;  2L05 A;  3Q3N C;  2C7M B;  4IM2 A;  5DPR A;  1D4B A;  3N30 A;  2PVG C;  1NVI D;  2KC2 A;  2JX5 A;  2R61 A;  3AU4 A;  4JWU C;  4US8 A;  4NQL B;  2GI9 A;  1R4M I;  3BIN A;  3APC A;  4NAM A;  1SBB B;  2D07 B;  5C2T B;  3QWZ B;  5JHA A;  2IGD A;  3QAQ A;  2WHI A;  4ICU A;  4EE2 A;  2ZVO A;  5L95 C;  1K53 A;  3L17 A;  1ZDV A;  2CJO A;  2ZCB A;  4EZJ A;  1PYW D;  1XQQ A;  2M19 A;  3V3X A;  1OEY A;  2GBJ A;  4WWP A;  2JYE A;  1YN4 A;  1MHH E;  4MM3 B;  2C7N B;  1SB3 C;  2WXJ A;  1C76 A;  4GDK B;  4IKG A;  3U2S C;  2FE8 A;  4A55 A;  4PK1 A;  1WYW B;  3GB1 A;  4LCD E;  2QHO A;  4K7S A;  3Q3F A;  3RD2 A;  2NTS A;  1ZE3 D;  2Z8L A;  5D94 A;  3NHE B;  3NJT A;  2ZW0 A;  2J4X A;  3B2F A;  1M4V A;  2LGI A;  4C7Y A;  3RT3 B;  3TIX A;  1FXA A;  3AI5 A;  2KDB A;  3QC8 B;  3VTV A;  3KWV A;  3M95 A;  1SE9 A;  5IN7 A;  1WRD B;  1WXV A;  3Q3O C;  1L0V B;  4L23 A;  3N9Y C;  1FCL A;  1I7H A;  2KLC A;  3HM6 X;  1TZ1 A;  3NVW A;  4M01 A;  2H89 B;  3H8H A;  4GIV A;  1NEN B;  1U4A A;  4DBG A;  2RGF A;  3AE3 B;  3NUH B;  3U7Z A;  1HTQ A;  4LJO B;  3M63 B;  1RFA A;  1WM2 A;  2OJR A;  4WJQ A;  2L00 B;  5JXV A;  2HJ8 A;  3V05 A;  2K25 A;  1KLG D;  2JZZ A;  2EEL A;  4WIP A;  4A3O A;  1JWB D;  3HHM A;  4BBN F;  1PDX A;  4OZC A;  2AL6 A;  4NJC A;  4LNN A;  3OWE B;  1MFW A;  2CKH B;  3RNG C;  1HE8 A;  3EFU A;  1NEK B;  1RWS A;  1V5O A;  2JXT A;  2WDV B;  1IGD A;  4ACF A;  2LHE A;  4MGY E;  3I3T B;  2FCN A;  4IDI A;  3ECI A;  4BAX A;  2AQ3 B;  1YQ3 B;  2WNM A;  4N58 A;  3PZD A;  4REZ A;  1DOI A;  4LLG M;  2JUO A;  3H7P A;  1E7U A;  5KHQ A;  3DVN V;  2KJR A;  2XBB C;  4B6W A;  1E10 A;  1MG8 A;  1ZPS A;  3AE8 B;  5E6J A;  3FC4 A;  1LXD A;  4DXA B;  4AJY B;  2LGX A;  2LJ5 A;  3AE2 B;  3AE9 B;  2KMC A;  1YX6 B;  5D2M B;  2BB6 A;  3PT2 B;  2KXJ A;  1L4D B;  3GE8 C;  5BMG A;  3RFZ B;  2RDB C;  2ASQ A;  2JWZ A;  2BGF A;  3R3M A;  1TY0 A;  1WI0 A;  4NY0 A;  2PMV A;  3NS8 A;  2LUE A;  2A4Z A;  4ZRQ A;  1D3Z A;  3I63 C;  2B76 B;  4KIK A;  1E0Z A;  3HIZ A;  1L7Y A;  5AUK A;  4TUU A;  2WXF A;  4IOI E;  3FKY A;  4FJV B;  1OQQ A;  3AE4 B;  4FLH A;  2OED A;  4GSW A;  3URY A;  2RPQ A;  3KYD D;  2JQR B;  2XNA C;  2FUH B;  2W82 A;  1L5P A;  3NY5 A;  3VXW A;  3UQB A;  1ACC A;  1WGY A;  2IZV B;  4KX6 B;  3L4P A;  2NBW B;  2MBQ A;  3B2G A;  5CHW A;  2L0T A;  1KM7 A;  2KQS A;  4M0W A;  1H4R A;  2J7Q B;  1XO3 A;  4ZRJ A;  2BF8 B;  2WDQ B;  4ARC A;  2INC C;  3TEW A;  3Q8A A;  1WJ6 A;  4HDQ A;  3QQ8 B;  3AE6 B;  3Q14 C;  2LRU A;  1JQ4 A;  5IP4 D;  1WE6 A;  2PW9 A;  4LK0 M;  1SEB D;  2VH1 A;  1WGK A;  3BVG A;  2D5G A;  1OQR A;  5E6P A;  5C3J B;  3CST A;  2KWU B;  2K8C A;  1E8Y A;  4WQO B;  2BB5 A;  4HEA 1;  2KLG A;  2IND C;  2MBB B;  3X23 A;  3RN9 C;  4MH0 E;  2R2Q A;  4GDL A;  4A90 A;  2RR9 A;  2QC8 A;  1WXA A;  3UIN B;  1JWU D;  4P1C C;  3BY4 B;  1VR9 A;  1A70 A;  2NS5 A;  3W1S A;  5MPO A;  4BKS D;  3RI7 C;  2KVZ A;  1C77 A;  2KWV B;  3HVD A;  4HDO A;  3RNB C;  2J42 A;  1JRP A;  1TTN A;  1R4N B;  1V6E A;  3MC0 B;  1PGA A;  3FIL A;  3HVZ A;  4M02 A;  2LVO A;  1LO5 D;  3MTN B;  2OOB B;  1WX8 A;  1FMA D;  4KIK B;  5FKA C;  4XC2 A;  1PGX A;  3OJ4 B;  3PVL A;  5D6J B;  4B9K A;  3PLU A;  1BXT A;  1F9J A;  1I4Q A;  1FM0 D;  4WAF A;  2KYW A;  3TCA A;  1WMH A;  2PTL A;  4WUR A;  5BMI A;  4GLS C;  1F0Z A;  3IBE A;  3Q8B A;  3QCA A;  3RNA C;  1A5R A;  2X38 A;  3L13 A;  4DXG A;  3KW5 B;  2GOW A;  4E74 A;  2WU5 B;  5CTR C;  3LB8 C;  3DCG A;  3T3O A;  4AP4 C;  2VZK D;  4M0W B;  1QLB B;  1EM7 A;  3VRA B;  1KLU D;  5D7G A;  4N59 A;  1SXT A;  1E7V A;  2BKR B;  3P4P B;  4S17 A;  3SU8 X;  1QOB A;  1GOZ A;  4RF1 A;  2QCZ A;  3CIR B;  1S1Q B;  1F1H A;  4IUM B;  4G3X B;  4ZRI A;  4ANX A;  1ROE A;  3HRD D;  4LDT D;  4MSM B;  4E71 A;  2GB1 A;  2JRH A;  1P9D U;  2JT4 B;  1P7F A;  1V5T A;  3TEZ A;  4LNK A;  2KVR A;  3S2A A;  1N5X A;  3DVN U;  3U52 E;  3L16 A;  2DYB A;  3ENE A;  2EKI A;  2N1V A;  2K39 A;  3QAR A;  2JPH A;  2KQ4 X;  3VRB B;  2BBC A;  2PJH A;  2LVQ A;  2ZNV B;  4GDL B;  2W54 A;  1WWT A;  4KVG B;  3VUW A;  1SJH D;  3OAW A;  4AUQ C;  3OLM D;  2G1E A;  3MFG A;  3ZNZ B;  4ITK A;  4IWP A;  2VH2 A;  2D3B A;  2HTM E;  1C4A A;  4HVB A;  3Q3M C;  4DHZ E;  2NMQ A;  3BYT B;  4KZ0 A;  4F8C B;  5EE0 A;  1I35 A;  2LGD A;  3I5J C;  4YT0 B;  2JU6 X;  2NR2 A;  2BYT A;  2K1F A;  3W1Y A;  2V3N A;  4N9F 4;  3FIL B;  1ZP0 B;  3ZXR A;  1P0R A;  2KDE B;  4KKI A;  2ZCC A;  3KWL A;  1K8R B;  1F52 A;  4AOF A;  1WMH B;  2RMM A;  3R2T A;  4RCO A;  3R8B A;  1UGJ A;  1YJI A;  1QIL A;  1XLQ A;  3IT6 B;  3SD5 A;  3NVV A;  4D2K A;  1C78 A;  3KYC D;  3Q2A C;  1UH6 A;  2KAC A;  1ISN A;  4XE0 A;  4BBN C;  4RGO S;  3AMZ A;  4HRO A;  3IFW B;  3DBR B;  3U7D A;  4JGH B;  2BYV E;  4AJW A;  2NBV B;  4RFB A;  4ZHP A;  3A4S C;  1FXT B;  2KZR A;  4FBJ B;  1TZO A;  1C4P A;  4GOC A;  2VRR B;  4FJY A;  2NCN A;  3I9V 1;  3UGB B;  2PLP A;  3DVG X;  2D11 A;  2WXN A;  4DHJ D;  3TJP A;  3B1L X;  2NTT A;  3PSE B;  5DCN A;  3EA6 A;  1L2N A;  2XEW A;  2BYE A;  2RDG A;  2EMS A;  1GB1 A;  2CU1 A;  1D5X C;  2MJD A;  3Q8E A;  2KAJ A;  2WX0 A;  3T3N A;  5BO4 B;  1SJE D;  3N1X C;  4DK5 A;  3N32 A;  2W3S A;  4WAA A;  1XEE A;  2QIE B;  5BMH A;  3VHT C;  1TYG B;  2MCN B;  3DOW A;  2WS3 B;  5J2R A;  1SSN A;  2CR5 A;  2MJ3 A;  3IT4 B;  3VUX A;  3RNF C;  1OFF A;  1RAX A;  4Q2J A;  3AN1 A;  2WXK A;  2REX A;  2PE9 A;  1JWS D;  3PLV A;  1QT9 A;  2WXM A;  3ML9 A;  5GMV A;  2M4N A;  2IGG A;  1FRR A;  3AEB B;  1OGW A;  1SGH A;  1P3Q U;  2KX0 A;  2YLM A;  2V3S A;  1DYQ A;  4FAD A;  3Q69 A;  4BFR A;  4BVU C;  2QMT A;  4HJG E;  2WU2 B;  3TBL D;  3KVF B;  3K9P B;  2QJL A;  5IOI A;  1FCC C;  1PQS A;  3PRP B;  3B08 A;  1VD2 A;  2YVC A;  2LRW A;  2KX3 A;  3P4Q B;  1YN3 A;  4K3C A;  5AZF A;  2ZZP B;  2J53 A;  2K8B A;  4KGR A;  2C5L C;  3AED B;  3AE1 B;  1WGD A;  2ACZ B;  2MW5 A;  1WSP A;  1CZP A;  2WP9 B;  3ZNH B;  3ZO5 B;  4XZ4 A;  1L6V A;  2KTR A;  5H92 C;  3E56 A;  2DEN B;  4HKZ E;  2W55 A;  2ONQ A; 
#chains in the Genus database with same CATH homology
 3ZVV A;  1GC6 A;  4BOZ B;  3ZIM A;  1UZX B;  3PS6 A;  3VFK A;  2LUE A;  3VUY A;  2A4Z A;  3GOE A;  2WYQ A;  5JHB A;  1D3Z A;  4KSK C;  1Z2M A;  3V6E B;  2L7R A;  5E6O A;  3VH3 B;  2MWS B;  2G45 B;  4PS8 A;  3A9J A;  3A9K A;  2DZK A;  2FCS A;  3D32 A;  3PRM B;  4JQW C;  5HKH A;  4KIK A;  4P7I A;  4EZL A;  3HIZ A;  1L7Y A;  1J0G A;  4TUU A;  1IPG A;  5AEK B;  4FJV B;  3VH4 B;  4BKT A;  1IYF A;  1G6J A;  4FLH A;  1WY8 A;  5DPT A;  1KJT A;  2IO1 B;  2IO3 B;  4GSW A;  2LAS A;  4TQ1 A;  2RPQ A;  3KYD D;  4AWJ A;  5J18 A;  5C1Z A;  2UYZ B;  3RZF A;  3DBH I;  2JF5 A;  2FUH B;  2MP2 B;  2Y5B B;  3DBL I;  4MEM A;  1WR6 E;  4IWO A;  3ONS A;  2DHZ A;  3NY5 A;  4BKS A;  2I1K A;  2Z0E B;  4GN1 A;  3JYU A;  4MGZ E;  3NZU A;  4HWI B;  3VXW A;  3UQB A;  2RD0 A;  1R4N I;  2BWF A;  2ZPN A;  3VTW A;  1WGY A;  2AYO B;  2IZV B;  1XD3 B;  3R66 C;  2NBW B;  2JY6 A;  5JH5 C;  2MBQ A;  1Z5S B;  5CHW A;  1XT9 B;  2L0T A;  2KFJ A;  1KM7 A;  3IVF A;  2KQS A;  2V1Y A;  4K7W A;  3V62 A;  1H4R A;  2J7Q B;  4ZRJ A;  5TR5 A;  1WGR A;  4DHZ B;  3PTF C;  4ZYN A;  2BF8 B;  2EKE C;  3JSV A;  3MJW A;  2Z59 B;  1KLV A;  2IO2 B;  4HCP B;  4PYZ A;  3A1Q A;  4TKN A;  4EEW A;  2G3Q B;  1WJ6 A;  3PRE A;  3WA0 A;  4ANU A;  4F7Z A;  4PS3 A;  2NPT A;  4HDQ A;  3DBS A;  3QQ8 B;  3HK0 A;  3PHX B;  4ANW A;  4FA6 A;  1WFY A;  3UQA A;  2LRU A;  4FJZ A;  1WE6 A;  1ZKH A;  2MLB A;  1WIA A;  4ZRK A;  2L8J A;  2GMI C;  1TGZ B;  1OEY J;  2JVC A;  2FCQ A;  4CHK A;  1Q0W B;  3UIO B;  4BKG A;  5E6P A;  3C0R B;  1EO6 A;  2L3Z A;  4OVV A;  4F1S A;  4K81 A;  5G55 A;  4K7U A;  1WJU A;  3CST A;  4GXB A;  1UD7 A;  2DYO A;  4FUL A;  1V80 A;  2KWU B;  1E5W A;  2K8C A;  1E8Y A;  2O6V B;  4WQO B;  3VTU A;  3A4R A;  2KHW B;  5E6N A;  3VQI A;  2KLG A;  4URK A;  1NI2 A;  4W9K A;  1T0Y A;  2MBB B;  1UEL A;  4X57 B;  3X23 A;  2PPH A;  4MH0 E;  1WX9 A;  1OTR B;  2R2Q A;  2KFK A;  2D2Q A;  3CSF A;  4GDL A;  3RUL A;  4LDT B;  4I6P A;  3NOB A;  3APD A;  4W9E A;  4IM3 A;  2RR9 A;  4HXD A;  1V81 A;  3ZDM C;  4EZK A;  1WXA A;  3TL5 A;  3UIN B;  1NDD A;  2C9W B;  2K6D B;  3ZTD A;  3BY4 B;  5DPS A;  1IP9 A;  2J0J A;  2N1W A;  2NS5 A;  4TV3 A;  3W1S A;  2WDT B;  3R7R A;  2IYD B;  4IW0 A;  1E8X A;  3L54 A;  4EUT A;  2M1M A;  2WWZ A;  4BKS D;  5CHF A;  4G11 A;  2C7H A;  2J0K A;  2KOX A;  1BT0 A;  1KOT A;  3IG3 A;  2KTR B;  2KWV B;  4GB9 A;  4IM0 A;  4HDO A;  3ZRF A;  4A3P A;  2A5U A;  1WZ0 A;  3MHS D;  1TTN A;  3QX1 A;  4DDI D;  3U30 A;  2LXC A;  2ZEQ A;  2KAN A;  2B3A A;  2LVP A;  1E8Z A;  3H6N A;  3V60 A;  1V6E A;  1EF5 A;  2MRP A;  3L10 B;  1P1A A;  2EMT A;  5LLI A;  2L0F A;  2LVO A;  2HTH A;  3A9J B;  3MTN B;  2OOB B;  4WJN A;  4WJO A;  5FR6 A;  2MBH A;  3A9K B;  4NQK E;  1WX8 A;  3ZKJ C;  3QJZ A;  4KIK B;  4XC2 A;  2MBO A;  3ZDT A;  5AZH A;  3PVL A;  3OJ4 B;  4MM3 A;  5D6J B;  4G0N B;  4B9K A;  3PLU A;  2IBI B;  1F9J A;  4HPL B;  1WZ3 A;  1YX5 B;  2AL3 A;  5C23 A;  4MGI E;  4JIO U;  4W9D A;  3TCA A;  2KKC A;  1WMH A;  2O2V A;  4GU2 A;  4KZC A;  3WAN A;  2MQJ A;  3NZS A;  4GDK A;  3IBE A;  3QCA A;  1WE7 A;  4I6L B;  4WWN A;  1A5R A;  5J17 A;  3L13 A;  3CMM B;  1SIF A;  2G4S A;  3LDZ E;  4RM9 A;  2CHX A;  3KW5 B;  2GOW A;  2XK5 A;  4E74 A;  3VVW B;  1WJN A;  1ZGU B;  5CTR C;  4MDK E;  3ZRC A;  4PYU A;  1GG3 A;  3DCG A;  1TBE A;  5LXI B;  4I6N B;  2KO3 A;  2W9N A;  1RRB A;  4W9H A;  1GUA B;  2M17 A;  1X1M A;  2IY1 B;  4NPN A;  4AP4 C;  1V86 A;  4M0W B;  4ANV A;  4ICV A;  2KWC A;  3T8M A;  4YL8 A;  1E8W A;  5IA7 A;  5D7G A;  1CMX B;  1E7V A;  2BKR B;  4W9C A;  3SU8 X;  3JSV B;  2DZI A;  4PS7 A;  4J6I A;  2LZ6 A;  2O6V D;  3QIJ A;  3A1Q B;  4KDI C;  4FN2 A;  1S1Q B;  4A20 A;  3EC8 A;  4IUM B;  2NPT B;  4RMA A;  1RLF A;  4G3X B;  4ZRI A;  3RUI B;  3VDZ A;  2MSE D;  2DYM A;  2KQ7 A;  1WF9 A;  4ANX A;  3QHT A;  2KMA A;  3WAO A;  4LDT D;  2FAZ A;  4MSM B;  4E71 A;  2JRH A;  4OVU A;  3WIM A;  4NJ6 A;  1V49 A;  1P9D U;  4KDL B;  4NAW A;  1JRU A;  2JT4 B;  3RZW C;  4CYE A;  1C3T A;  1WH3 A;  2DX5 B;  4II2 B;  3R7Q A;  4M8M A;  3PV1 A;  1V5T A;  3Q3J A;  4JLC A;  2KVR A;  3S2A A;  1EUV B;  3DVN U;  1WR1 A;  2MX2 A;  3L16 A;  2DYB A;  2HD5 B;  3ENE A;  2GBK A;  4MJS A;  3WAM A;  2N1V A;  3DBR I;  2IO0 B;  2N7D A;  2ZVN A;  1LQB A;  1QZE A;  2BKF A;  3L0W B;  2K39 A;  3QAR A;  1J19 A;  1WGG A;  1YJ1 A;  2JPH A;  3M62 B;  5L83 A;  3KH0 A;  4DDG D;  3KUZ A;  2JRI B;  1WM3 A;  4W9G A;  2PJH A;  4MEL A;  2V4L A;  2KN5 A;  2LI5 A;  3PHW B;  1E90 A;  2KFK B;  2LVQ A;  2ZNV B;  2L05 A;  4GDL B;  3U8Z A;  2C7M B;  2M0X A;  4W9J A;  5IAA C;  4IM2 A;  2K8H A;  5DPR A;  5G2N A;  2NVU I;  4KVG B;  3H7P B;  3VUW A;  2Z0D B;  3N30 A;  3AU5 A;  2KC2 A;  2LXA A;  3OAW A;  4AUQ C;  3OLM D;  4IWQ A;  3AU4 A;  3ZNZ B;  2R2O A;  4NQL B;  1R4M I;  1NBF C;  4IWP A;  1WGH A;  3BIN A;  3APC A;  4HVB A;  3A33 B;  2D07 B;  4DHZ E;  3QWZ B;  4KZ0 A;  4F8C B;  1I35 A;  3N3K B;  5JHA A;  2LGD A;  4M8N A;  2CS4 A;  3QAQ A;  4ICU A;  2NR2 A;  3V6C B;  2K1F A;  2ZVO A;  5L95 C;  3W1Y A;  3L17 A;  4N9F 4;  1GNU A;  3H7S A;  4JL9 A;  4II3 B;  5LXH A;  2N7E A;  1P0R A;  2KDE B;  2N4F A;  2ZCB A;  4EZJ A;  1XQQ A;  3K9O B;  1OEY A;  2GBJ A;  4TQ0 A;  1C1Y B;  2KDI A;  2ZCC A;  4WWP A;  1K8R B;  3UF8 A;  2KNB A;  4E3C A;  2J0M A;  4B95 A;  2DZM A;  4AOF A;  4BOS C;  3AXC A;  2MA9 B;  1YD8 U;  4W9L A;  2C7N B;  4KV2 A;  3DQV A;  5JZE B;  3DPD A;  1WMH B;  2O2V B;  4GGQ A;  4WWO A;  4GDK B;  4LJP B;  3P2B A;  3SDL C;  3SHQ A;  2ZNV C;  3SD5 A;  3AUL A;  1V2Y A;  4IG7 B;  2XK5 B;  3KYC D;  2IY0 B;  1UH6 A;  3VAW A;  3ZW3 A;  1ISN A;  2FID A;  3V61 A;  2PE6 B;  3H9D A;  3QA8 A;  4BBN C;  1WYW B;  4LCD E;  2G4D B;  2QHO A;  2DZJ A;  1H8C A;  4K7S A;  3H1U A;  3Q3F A;  3RD2 A;  3WAL A;  3IFW B;  3PRZ A;  2PEA A;  3U7D A;  5D94 A;  3NHE B;  2BWE S;  4FHK A;  2ZPY A;  3GZN I;  4JGH B;  2BYV E;  1EF1 A;  4HCN B;  4AJW A;  2GBM A;  2NBV B;  4EFO A;  1P98 A;  3RT3 B;  3TIX A;  1AAR A;  3A4S C;  4ASW C;  4HLE A;  3DVG Y;  1FXT B;  3AI5 A;  2KDB A;  2KZR A;  3QC8 B;  4FBJ B;  3HM3 A;  3VTV A;  4GOC A;  2KTF A;  2VRR B;  3ZNG C;  4FJY A;  2NCN A;  3M95 A;  4CO7 A;  1SE9 A;  3UGB B;  1LFD A;  3DVG X;  2D11 A;  2FIF A;  2NBU A;  4G50 A;  4DHJ D;  1OQY A;  4NAW B;  4XX5 A;  1WRD B;  1WXV A;  1WX7 A;  3TJP A;  2KK8 A;  3B1L X;  3ZUN A;  3PSE B;  2KLC A;  3HM6 X;  3ML8 A;  1TZ1 A;  4MJS B;  5DCN A;  2XEW A;  1L2N A;  2BYE A;  2KJH B;  2LWP A;  3KUC B;  2FNJ B;  2EMS A;  4RM8 A;  5EDS A;  3KUD B;  4GIV A;  2CU1 A;  3TMP B;  1I42 A;  5AZG A;  3RCZ A;  1U4A A;  4DBG A;  2WX1 A;  2RGF A;  4LJO B;  1J8C A;  3M63 B;  3O65 B;  1RFA A;  2WX0 A;  1Q1O A;  2GBN A;  1WM2 A;  1GC7 A;  5BO4 B;  2ZJD A;  2OJR A;  3N32 A;  4DK5 A;  4WAA A;  4WJQ A;  3CF6 E;  3PPA A;  4HPM B;  2L00 B;  4EKU A;  2HJ8 A;  3VHT C;  2K25 A;  2MP2 A;  2JXX A;  4EOY A;  2BPS A;  3PGE A;  2MCN B;  1UBQ A;  2JZZ A;  3RYT A;  3DOW A;  4A3O A;  5J2R A;  5KHO A;  2KDF B;  1UGM A;  4IC7 B;  4DHJ B;  3HHM A;  2RSU A;  2AEH A;  1VCB A;  2CR5 A;  3T9L A;  4BBN F;  4HK2 A;  1YQB A;  2DAJ A;  4W9F A;  2JZ3 B;  3VUX A;  2AL6 A;  2BYF A;  1RAX A;  1V9J A;  2C60 A;  2REX A;  2CKH B;  2L76 A;  4HJK A;  1WXS A;  4MSQ B;  2N9P C;  2LD9 A;  1HE8 A;  3ZNI D;  3EFU A;  1YIW A;  5DPW A;  2PE9 A;  3DDC B;  4NJ7 A;  3B0A A;  3LJ3 A;  2M8S A;  4DWF A;  2I1J A;  2DAF A;  3PLV A;  3ML9 A;  1V5O A;  5GMV A;  2M4N A;  3EHV A;  4NNJ B;  1GJZ A;  4MGY E;  2MBE A;  3I3T B;  4MGK E;  2FCN A;  4WJP A;  3EEC A;  2N9X A;  2KJ6 A;  1OGW A;  1SGH A;  1P3Q U;  3ECI A;  3QK0 A;  2KX0 A;  3JVZ X;  4KSL C;  4ZDV A;  2D3G A;  2YLM A;  3IHP C;  2V3S A;  3ZLZ A;  2N9E B;  4FAD A;  2HE7 A;  4BFR A;  3PZD A;  4W9I A;  4BVU C;  2UWQ A;  3ZTC A;  2JUO A;  2CHZ A;  2CHW A;  3TBL D;  2KD0 A;  3KVF B;  3H7P A;  1E7U A;  5KHQ A;  3DVN V;  2O6V A;  3OJ3 A;  3K9P B;  3APF A;  2KJR A;  2XBB C;  3WAP A;  4B6W A;  1UBI A;  1MG8 A;  1PQS A;  1ZW7 A;  3L08 A;  3M3J A;  4FHJ A;  2KC1 A;  1LXD A;  3PRP B;  3B08 A;  4DXA B;  1VD2 A;  2LGY A;  1Y8R C;  2K6Q A;  4AJY B;  2LGX A;  2LJ5 A;  1S3S G;  1Q5W B;  2YVC A;  2AWT A;  3W1S C;  1M94 A;  2LRW A;  2FCM A;  2KMC A;  2KX3 A;  3JW0 X;  1WXM A;  1YX6 B;  1LM8 B;  5CHV C;  5AZF A;  2ZZP B;  5D2M B;  2K8B A;  3UIP B;  2C5L C;  3PT2 B;  1WGD A;  2KXJ A;  2MW5 A;  3ALB A;  3X0W A;  3ZNH B;  3ZO5 B;  4XZ4 A;  2KTR A;  2ASQ A;  2JWZ A;  2BGF A;  1WJ4 A;  2D10 A;  2DEN B;  3R3M A;  1WI0 A;  4GMV A;  4K1R B;  4NY0 A;  5CX3 A;  2GBR A;  3NS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...