1JRUA

Nmr structure of the ubx domain from p47 (energy minimised average)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
89
structure length
89
Chain Sequence
KASSSILINEAEPTTNIQIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFVLMTTFPNKELADENQTLKEANLLNAVIVQRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords p47 protein
publication title Solution structure and interaction surface of the C-terminal domain from p47: a major p97-cofactor involved in SNARE disassembly.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 14
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2001-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00789 UBX UBX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1jruA00
2JPHA 2L0TA 4CHKA 2XK5B 3M3JA 4MGKE 2BKRB 3PPAA 4WJQA 3IHPC 5CHFA 3Q3FA 4JQWC 2BKFA 5CTRC 2UWQA 1L2NA 2MSED 4GB9A 4ANVA 3K9OB 2G4DB 1TTNA 5AZHA 3PREA 3VUXA 1V80A 2KKCA 2J7QB 3PLUA 4YL8A 2J0KA 2ZJDA 3WAMA 1BT0A 3PGEA 2KWUB 2ZPNA 2NPTA 3UINB 2BYVE 3WA0A 1VCBA 2L7RA 4FULA 3KUCB 2KFKA 3WAPA 1UBIA 2G3QB 2ZVNA 2XK5A 1UH6A 2MBEA 1WFYA 1S1QB 3ZTDA 2RD0A 3VFKA 4B6WA 2N9EB 1Q0WB 4JLCA 3RD2A 1YQBA 2KLGA 3KUDB 3DPDA 3PSEB 4CYEA 2ASQA 1V6EA 4KSLC 2JUOA 1P3QU 3DOWA 2DHZA 3GZNI 3HK0A 2JY6A 2HJ8A 2MCNB 2KMAA 3CSTA 2L3ZA 4EZKA 3AI5A 2LGXA 4BKSD 3ZKJC 1UBQA 2NBUA 4F1SA 3H9DA 1NI2A 4HCPB 1J8CA 2NR2A 1ZKHA 2MQJA 3UIPB 2KX0A 4OVUA 3W1SC 3KVFB 1WGYA 1G6JA 2LWPA 3JSVB 2KQ7A 4JIOU 2D3GA 3VVWB 1C3TA 2HE7A 3OAWA 4E3CA 1P0RA 3V62A 2K39A 3R3MA 2DYMA 2JWZA 2MWSB 4GMVA 1V2YA 2KC2A 1YX5B 1X1MA 3EECA 3UGBB 1FXTB 2HTHA 4IM0A 1PQSA 2LXAA 2WX0A 2JXXA 2KWCA 2BWES 3VQIA 1RFAA 3DBSA 1WZ0A 4PS8A 4ASWC 4K81A 3O65B 3PRZA 1JRUA 4WJNA 5E6OA 2JRHA 1WGGA 4N9F4 3JSVA 4W9LA 4W9DA 3PRPB 4ZRIA 2C60A 3SU8X 5DPRA 4DHJD 1YJ1A 4BOSC 2CHXA 3QHTA 4K1RB 2Z0EB 2NBVB 4I6LB 2R2QA 3MHSD 4EZJA 1XQQA 3V6CB 3TIXA 1WXVA 1ZW7A 1H8CA 1E8XA 3RCZA 3DBLI 1QZEA 2ZNVC 1WXSA 3ML8A 3QA8A 2EMTA 3M95A 3HM6X 3I3TB 2DENB 2OJRA 4KDLB 1WI0A 1Q1OA 1V9JA 1WJ4A 2V4LA 5C1ZA 1CMXB 4BKTA 4PYUA 2AL6A 3VH3B 3WALA 3PHWB 2KO3A 3PHXB 2KDFB 4GXBA 3H6NA 3LDZE 5E6NA 2LGYA 2N9PC 2V3SA 4GDLB 4LJPB 2I1JA 4MJSB 1H4RA 2MLBA 4RM9A 5D94A 3RZFA 1M94A 3UF8A 2LI5A 4HCNB 1WIAA 4EEWA 3AU5A 1EO6A 3A33B 2UYZB 3JYUA 3TCAA 4EFOA 5HKHA 2J0MA 1UELA 4E71A 2C9WB 2YVCA 1WJ6A 4MEMA 4W9IA 2GBRA 3ZRCA 4BFRA 4AOFA 4PS3A 2KZRA 3QCAA 4KV2A 2CKHB 4MSMB 2C7MB 1WX7A 5KHOA 3PZDA 2V1YA 2KMCA 1UGMA 3AU4A 3NHEB 5IA7A 2LZ6A 2CHZA 1WYWB 4NAWB 3PS6A 4MGIE 4DHJB 3DVNV 2GBNA 4GDLA 5D7GA 3T8MA 4B9KA 1KOTA 4KIKB 4I6NB 4MJSA 2FCQA 4A3PA 2LRWA 2O6VB 4GIVA 4DWFA 1YD8U 1E8YA 4ANXA 3ZNID 3PTFC 3ZNHB 2KTRB 2KANA 2IBIB 2KC1A 4HXDA 4WAAA 2DZIA 2M1MA 3A9JB 3WAOA 4FA6A 3IVFA 2KWVB 2K8CA 2WX1A 3QC8B 3NOBA 2PE9A 4GSWA 3APCA 5AZFA 2MBQA 3IG3A 1TBEA 3A1QA 2KXJA 4F8CB 4KVGB 1IPGA 4P7IA 4NAWA 1Q5WB 2JF5A 4M8MA 4DHZB 4M8NA 2J0JA 1TGZB 5DPWA 5E6PA 3KW5B 4KIKA 1WGRA 2LD9A 3KYDD 2K8HA 2O6VA 3L16A 3A4RA 1LQBA 2N7DA 3NY5A 4ZDVA 2XEWA 1P98A 1V5OA 3U8ZA 4ICVA 1EUVB 4TUUA 1LM8B 3GOEA 3H7SA 4FJVB 2Z0DB 2KTRA 5LLIA 2ZPYA 1LXDA 3A9JA 4EZLA 1RAXA 1J19A 2GOWA 4G50A 3QWZB 2ZCCA 3RULA 2KJ6A 2O2VB 4W9KA 1MG8A 1GNUA 3AXCA 2FCNA 3ZUNA 3NZSA 4KSKC 4URKA 4TV3A 4WJOA 4X57B 4NQLB 4EUTA 4TQ1A 4WWNA 3KYCD 1WZ3A 1WX9A 4ZYNA 5L83A 3VXWA 5IAAC 2M17A 2PE6B 4NY0A 4IM2A 2KOXA 4F7ZA 3M63B 1WY8A 2WDTB 3R66C 3ZVVA 3OJ4B 2DZJA 2M4NA 3ZTCA 2DZKA 2LJ5A 1WH3A 2QHOA 3EHVA 4DXAB 4FADA 3A4SC 1WM3A 2L76A 2M0XA 3ZRFA 3CMMB 2IO3B 2O2VA 4MDKE 2AYOB 5DPTA 1P1AA 2MRPA 4HVBA 3H1UA 1KLVA 3A9KB 3QK0A 2C5LC 1C1YB 2NCNA 2KNBA 2RR9A 4LJOB 2BGFA 1L7YA 5D2MB 2YLMA 3MTNB 3QARA 4WWPA 3L10B 3RYTA 4AUQC 4ANWA 1XT9B 4GDKB 3KH0A 4MSQB 4RMAA 2N1WA 4GGQA 4GN1A 4ZRJA 2KFJA 4HK2A 4PYZA 2BYFA 2EMSA 2KTFA 2D10A 3JW0X 4LCDE 3S2AA 2I1KA 1VD2A 3X23A 1I42A 3U7DA 2N9XA 2MBOA 1Z5SB 3VH4B 2EKEC 4II3B 1T0YA 2IY0B 1V81A 2JZ3B 4NJ7A 2WYQA 1EF5A 5AEKB 4BBNF 3PV1A 5J2RA 2JT4B 2IZVB 2K1FA 4DHZE 4BKGA 4DK5A 1WM2A 3UQAA 3A9KA 2NS5A 4ICUA 4AP4C 1GC6A 1WF9A 1WR1A 3L13A 3V6EB 1IYFA 3HM3A 2IO1B 4GDKA 3QQ8B 1GUAB 4FHJA 1WGHA 4IWQA 4FLHA 4CO7A 4NQKE 1OTRB 2B3AA 4E74A 3VTUA 5JZEB 3ZW3A 2JZZA 1V49A 3UQBA 5CX3A 3RUIB 3CF6E 4JGHB 5AZGA 2JVCA 2NVUI 5J18A 3KUZA 2FNJB 4BKSA 2KDBA 1EF1A 2KHWB 2A4ZA 1U4AA 2FUHB 1R4MI 2MBHA 4HPLB 1A5RA 4DBGA 4HLEA 1TZ1A 2KDEB 3JVZX 4XX5A 3D32A 3ENEA 4AJWA 2G45B 2IO2B 2CU1A 2N7EA 3M62B 4IWPA 4G0NB 2KJHB 3L17A 2DAFA 4MELA 3WANA 3AULA 1S3SG 2KD0A 3PRMB 2M8SA 5J17A 4K7SA 3QX1A 3R7RA 4TKNA 1OQYA 4TQ0A 3ZDMC 2CS4A 4A3OA 2AEHA 3IBEA 2G4SA 2XBBC 1KJTA 2REXA 2K6DB 4B95A 2KK8A 2KJRA 3TJPA 2D07B 2CHWA 2C7NB 3OJ3A 4WWOA 5DCNA 3BINA 2LRUA 3B0AA 2N1VA 1OEYA 4NPNA 4W9FA 3LJ3A 2IO0B 4JL9A 4BBNC 1KM7A 4KZ0A 5TR5A 2FIFA 3VUYA 5LXHA 4BOZB 2BWFA 2C7HA 2WWZA 3ALBA 3EFUA 4NNJB 3VUWA 3NZUA 4BVUC 4LDTD 3MJWA 3V61A 2K6QA 2KDIA 3SDLC 4RM8A 1SE9A 4EKUA 3ZDTA 2D11A 2BPSA 3X0WA 4I6PA 3TMPB 4HDQA 1WE7A 3H7PB 1Y8RC 4AWJA 1GC7A 1V5TA 3APDA 2ZZPB 2VRRB 2AWTA 1XD3B 1WE6A 3CSFA 2LXCA 3TL5A 2DX5B 4OVVA 1E90A 2NBWB 4GOCA 2OOBB 4EOYA 3PT2B 1YIWA 2MA9B 4DDGD 2LVOA 2MW5A 2IYDB 2ZEQA 3ZO5B 3ZNGC 4HPMB 4FHKA 1WJUA 4AJYB 3N32A 3QAQA 3BY4B 4KDIC 3ZNZB 3K9PB 3RZWC 1J0GA 2W9NA 3N30A 3IFWB 1D3ZA 4KZCA 3DQVA 1WJNA 4XC2A 3PLVA 1NDDA 1OEYJ 3APFA 2ZCBA 4GU2A 3H7PA 1UD7A 1ZGUB 2DYOA 1IP9A 4HDOA 4J6IA 4W9GA 3TBLD 5C23A 3QJZA 2KLCA 3L08A 2CR5A 3NS8A 3U30A 3ZLZA 1UZXB 5GMVA 2RPQA 3SHQA 2GBJA 2PJHA 5JHBA 1WX8A 2FIDA 4II2B 5L95C 5KHQA 3SD5A 4A20A 4K7UA 2PEAA 4W9CA 2JRIB 3DCGA 5CHVC 5LXIB 2LASA 4MGYE 5D6JB 2L0FA 2ZVOA 4FBJB 1HE8A 2KN5A 4LDTB 4WJPA 2LVQA 4ANUA 2KVRA 1V86A 5JHAA 5G2NA 3DDCB 2KX3A 2K8BA 3P2BA 3V60A 1AARA 1WMHB 3VDZA 1SGHA 2FAZA 3W1SA 3UIOB 2DZMA 2BYEA 3ONSA 4PS7A 2GBMA 3DVNU 4XZ4A 4IC7B 3PVLA 1YX6B 2GMIC 1RLFA 2R2OA 1E7VA 3R7QA 4IM3A 2O6VD 3B1LX 3ECIA 3ML9A 3W1YA 2L00B 1E7UA 3DBHI 4DDID 3VTWA 1WXAA 3EC8A 1I35A 2ZNVB 4FN2A 4WQOB 2BF8B 4IWOA 3Q3JA 3VHTC 4IW0A 1R4NI 5EDSA 2IY1B 2LUEA 2Y5BB 2MP2B 2L05A 1WXMA 2LVPA 3HIZA 4MM3A 4W9JA 4FJZA 5BO4B 1WMHA 2FCSA 3VAWA 5JH5C 5FR6A 1F9JA 2MBBB 3DVGX 1ISNA 3C0RB 2AL3A 3HHMA 4ZRKA 1P9DU 2RSUA 4FJYA 4W9EA 1NBFC 3B08A 3T9LA 2FCMA 2DYBA 2K25A 1OGWA 4HJKA 2RGFA 1GJZA 2GBKA 4M0WB 3L54A 1Z2MA 1RRBA 3WIMA 1E5WA 2L8JA 4HWIB 5DPSA 3DVGY 5G55A 3OLMD 1WRDB 3QIJA 3DBRI 2HD5B 4IUMB 4NJ6A 1GG3A 4G3XB 1K8RB 2Z59B 3RT3B 2MP2A 5CHWA 4MH0E 3ZIMA 1WR6E 2KQSA 1WGDA 2DAJA 2NPTB 4W9HA 3VTVA 2A5UA 2D2QA 3A1QB 2PPHA 1SIFA 2MX2A 1E8WA 2N4FA 3L0WB 4MGZE 2LGDA 1E8ZA 4IG7B 3N3KB 1LFDA 2KFKB 4K7WA 4G11A
chains in the Genus database with same CATH superfamily
4ARCA 2BKRB 1WXQA 2CJNA 3Q3FA 2BKFA 5CTRC 1L2NA 2ZW0A 4RGMA 2G4DB 1TTNA 5AZHA 3VUXA 3PLUA 1T0RC 4YL8A 2J0KA 3FILB 2ZJDA 3AE7B 3PZ8A 3P4PB 4KGRA 3UINB 1N62A 2E6XA 2WXKA 1ET9A 3I63C 1BMLC 2XK5A 2G1EA 1C77A 3KUDB 3DPDA 3NJTA 4KSLC 3DOWA 2JY6A 2L3ZA 4BKSD 3ZKJC 1UBQA 1NI2A 4HCPB 1J8CA 2MQJA 2FBWB 3W1SC 3KVFB 4JIOU 3OAWA 3B9JA 2WXMA 2K5PA 4LNNA 1MPEA 4GMVA 1YX5B 1BXTA 2BQQA 4OZBA 2D3AA 2WX0A 3VRAB 1FM0D 3AECB 2BB6A 4REZA 3VQIA 1WZ0A 5IKCM 4ASWC 4K81A 3PRZA 1JRUA 4AS1A 2W54A 1WGGA 3AE6B 3JSVA 4W9LA 5AUKA 4ZRIA 1VZ8A 3NRZA 1YJ1A 2CHXA 2Z0EB 3MHSD 2RDBC 4EZJA 1FRDA 3TIXA 1YN5A 1CQVA 4HPPA 2WXHA 3ML8A 4DQOC 2EMTA 1E7PB 3HM6X 3I3TB 1V9JA 1WJ4A 4BKTA 2PW9A 2AL6A 1AW7A 4OVZA 2YEPF 3WALA 4HEA1 3MFGA 3R2TA 4XWWA 1A70A 3LDZE 5E6NA 2D3CA 1H4RA 1R4NB 2LI5A 1KRHA 1WIAA 4EEWA 3PO0A 1UELA 1FFUA 1QILA 4W9IA 2I2YA 4PS3A 2KZRA 4KV2A 1VZ7A 3PZDA 4YTNB 3AU4A 3I5JC 1KOTA 4KIKB 4DWFA 1E8YA 4ANXA 4QAYA 3ZNHB 2IBIB 2DZIA 4FA6A 2K8CA 1XLOA 2Z8LA 3APCA 1L6VA 3IG3A 3IAS1 4P7IA 1Q5WB 5DPWA 2LD9A 1TKEA 2N7DA 2WU2B 4WWMA 1SXTA 4ICVA 1NVID 4TUUA 3H7SA 3GS2A 2FCNA 4TV3A 4X57B 4TQ1A 1I4XA 1WZ3A 4ZYNA 2B76B 1SEBD 4OZCA 3AE3B 3OJ4B 2M4NA 4DXAB 3EHVA 1I4GA 1QLBB 1QOAA 2O2VA 5DPTA 2AYOB 2WXJA 1P1AA 4XDCA 3AEBB 3MTNB 3KH0A 2N1WA 4GN1A 4HK2A 4PYZA 2KTFA 1RYJA 2EMSA 3X23A 1C9FA 2LUMA 5D3DA 5HFYA 1TKYA 2WYQA 4BKGA 4ICUA 1IYFA 3DBLB 1GPXA 4GDKA 4FHJA 1WGHA 4XDDA 1TYGB 2XNAC 3BIID 3OG5A 4NQKE 3CWIA 5JZEB 1ZP0B 3UQBA 3CF6E 3BVMA 5AZGA 4WURA 4BKSA 2W3SA 1TS4A 5C2TB 2FUHB 4HPLB 1TZ1A 4XX5A 2M19A 4KKJA 3UI3A 4YSYB 4G0NB 2KJHB 3WANA 2AQ1B 1S3SG 1N6ZA 2M8SA 5J17A 3R7RA 4TKNA 2IPKD 4A3OA 3GB1A 2K6DB 1UGJA 4RF0A 1FMAD 3J9CA 2D07B 2K0PA 3GE8C 2N1VA 2G9HD 4BOZB 2BWFA 4ITKA 3NZUA 1DOYA 3BZDB 4EKUA 2D11A 3X0WA 3ZJTA 3TMPB 1I4QA 2BYTA 3AE2B 1Y8RC 1GC7A 5H92C 2LXCA 1KFYB 4GOCA 4EOYA 3PT2B 2MA9B 2LVOA 2MW5A 2ZEQA 1EWCA 3ZO5B 1JALA 2KMMA 3BY4B 5IO9A 1SE3A 3ZNZB 3RZWC 2W9NA 1F2RC 1JRPA 3EGRA 3U4EG 1IUEA 1IBXB 2NMQA 4K3BA 4YT0B 4ZRQA 1NDDA 1OEYJ 1YMHE 1UD7A 1ZGUB 4HDOA 4J6IA 3QJZA 2JXTA 5G5GA 1VDVA 3U30A 2RDHA 3MHZA 2AQ3B 3DCGA 5CHVC 4MGYE 3MC0B 5D6JB 2L0FA 2ZVOA 4FBJB 2KN5A 4ANUA 2KVRA 4MM3B 3VDZA 2QCZA 4LNFA 3DVNU 4XZ4A 1YX6B 2OEDA 5TSSA 1F1HA 2J53A 4IM3A 2O6VD 3ECIA 2WU5B 2QIEB 3EC8A 1SBBB 3VHTC 3Q3JA 1R4NI 2LUEA 1WXMA 3AH7A 4FJZA 2FCSA 5JH5C 1UWMA 3DVGX 4ZRKA 2R61A 1NBFC 4BZAA 1CJEA 1GJZA 4RGTA 5DPSA 3DVGY 5G55A 3OLMD 1WRDB 3QIJA 2N0SB 3DBRI 4NJ6A 1FCCC 4G3XB 3HRDD 2WXPA 3T3OA 2BS2B 1DOIA 1TS5A 1R4MB 1SE4A 4LK0M 2D2QA 3V05A 3L0WB 3B2FA 1YNTE 2IGGA 3IAM1 1E8ZA 4IG7B 5EE0A 2INPE 2JPHA 2XK5B 4MGKE 1CK1A 3IHPC 2NTTA 1PUTA 4C00A 5CHFA 4M0WA 1C4AA 4P1BC 3SEBA 2RPVA 4GB9A 2WS3B 2ICIA 3PREA 2KKCA 2GLSA 3WAMA 2WDVB 1BT0A 2ZPNA 4YSZB 1NYQA 4OZAA 1TJEA 3U7ZA 2WP9B 1V1OA 3EA6A 1C4CA 1VCBA 2L7RA 1CZPA 3ZXVA 2LGSA 1WFYA 2VZKD 2N9LA 2RD0A 3VFKA 1XEEA 2MJDA 1PYWD 1YQBA 2KLGA 2AX5A 2ASQA 4ARIA 1P3QU 2MCNB 2KMAA 2BT6A 4F1SA 3H9DA 1K53A 1XLNA 1WGYA 3JSVB 1I7HA 1V2YA 3EECA 3UGBB 1RFKA 1OQQA 2TSSA 2BWES 2MHJA 4RGNA 1RFAA 3DBSA 4A90A 3TUOA 3O65B 4OW0A 1EU3A 4P1CC 4TSSA 5DPRA 1JWSD 4BOSC 3QHTA 2NBVB 2R2QA 1C4PA 1FNWA 1WXVA 1ZW7A 2VZKB 2M0AA 2KT7A 3N1YC 3DBLI 1QZEA 2ZNVC 1WXSA 3QA8A 4KDLB 2JYEA 4ZHOA 3VH3B 3TEYA 3AEGB 3PHWB 2KO3A 2KACA 3DBHB 2V3SA 1N5XA 4RM9A 3RZFA 3ETRA 1M94A 1FIQA 2BB5A 2PTLA 3TCAA 1YQ3B 2GB1A 2J0MA 1KLGD 4E71A 2YVCA 1WJ6A 1KLUD 3ZRCA 2C7MB 3PS6A 1WGKA 3T8MA 2GBNA 4GDLA 5D7GA 1WSPA 4B9KA 2FCQA 2V3NA 2LRWA 3NZ3A 3ZNID 3PTFC 3P42A 4HXDA 1XCTL 2WX1A 2PE9A 1TZOA 2KAJA 5AZFA 2MBQA 4YWGG 2KXJA 4Q2JA 4A9AA 4F8CB 5E6JA 5GXGB 4DHZB 4M8NA 2J0JA 1MG4A 3V3XA 2K8HA 2O6VA 5HI1A 3A4RA 2BS4B 2XEWA 1P98A 3NVYA 2OHFA 4FJVB 1K52A 2BTEA 2GOWA 2V9HA 2ZCCA 2O2VB 1GOZA 1MG8A 4W9KA 3AXCA 3ZUNA 1EU4A 4URKA 4EUTA 3KYCD 1DOXA 1WX9A 3N20C 2KOXA 4F7ZA 3U52E 1WY8A 5FK9C 3URYA 4RF1A 1P7EA 2QHOA 2BW2A 1FCLA 2L76A 3BVGA 2MRPA 1C1YB 2RR9A 1L7YA 4AUQC 4ANWA 3KLSX 4GDKB 1PGAA 1VZ6A 4ZRJA 4P6VF 1K51A 1TT5B 4N6EB 4LCDE 1JWMD 1VD2A 3MC8A 2BVCA 3VH4B 4II3B 4JWSC 2KYWA 4IKGA 3RPFC 5AEKB 3PV1A 4RCOA 5J2RA 2K1FA 3UQAA 1ZDVA 2LMCA 3P4RB 1FD6A 2NS5A 5HG2A 4AP4C 2BS3B 4XWTA 1GC6A 4C4VA 1GUAB 4FLHA 4DXGA 2JU6X 4E74A 3Q2AC 1GB1A 2JVCA 2NVUI 2RMMA 2FNJB 3KUZA 2KHWB 1R4MI 2GRIA 4HLEA 2INDC 2ZW1A 3AE5B 2CU1A 3M62B 4IWPA 2KN4A 2NTSA 3L17A 4MELA 3MJ5A 3AULA 2KD0A 3QX1A 3DWMA 2L52A 4P16A 1DGJA 1N61A 2G4SA 2KJRA 4HJGE 4WWOA 4LNIA 4M02A 3LJ3A 2IO0B 1DYQA 5LXHA 5TR5A 2C7HA 3AE9B 4C80A 4ZYSA 3ALBA 3EFUA 2WXOA 2PVOD 5MPOA 1D6EC 1XXGA 2KDIA 3SDLC 1FPYA 4RM8A 1SE9A 4A6QA 3ZDTA 4I6PA 4HDQA 3SFDB 1T6BX 1NEKB 1MJDA 3RNCC 3AMZA 3NG0A 4H2AA 1NENB 1ZOYB 4DDGD 2WXFA 2FUG1 4FHKA 4AJYB 3N32A 3QAQA 3BYYB 3K9PB 1J0GA 3W9CB 3AEFB 3IFWB 4KZCA 1TY2A 3PLVA 2ZCBA 5IN7A 1IP9A 2CJOA 2E3TA 5C23A 3L08A 5BYQA 2SAKA 1WX8A 4II2B 3R2IA 4K7UA 4W9CA 2IJ0A 2VH2A 4AQ7A 2IGDA 4YTMB 2LVQA 5G2NA 4HKQA 4JE3B 2K8BA 3P2BA 1LGRA 2FAZA 1L0VB 1FO4A 2BYEA 4PS7A 2GBMA 2N9KA 4L1BA 3RNFC 1E7VA 3W5UB 3KWLA 1TS2A 2L83A 1E7UA 3DBHI 4DDID 2ZNVB 4FN2A 4IW0A 1SF0A 2IY1B 2RDGA 2L05A 3HIZA 4W9JA 2DNFA 1WMHA 1KF6B 3VAWA 5EE9A 3HHMA 1ISNA 1C78A 3C0RB 1HQRD 2L32A 4W9EA 2RSUA 1OGWA 3SR6A 2RGFA 2GBKA 1JWAD 4M0WB 1Z2MA 3WIMA 2L8JA 3EFCA 4HWIB 2H89B 2WXRA 3RT3B 2Z59B 2PIAA 2W55A 4RGOS 5CHWA 3ZIMA 2KQSA 1HTOA 3HVDA 2JQRB 3FKYA 4BAXA 2A5UA 3A1QB 1STEA 2PPHA 2MX2A 1E8WA 4MGZE 1VRAB 3KQ4A 3N3KB 4K7WA 4G11A 3M3JA 3PPAA 2MH7A 3Q6BA 3W2DA 4ANVA 2PMVA 2J7QB 2QSDA 3TEWA 3PGEA 4USAA 3RNAC 2BYVE 3WA0A 1L4ZB 1B9RA 1PFDA 4EE2A 3R8BA 2KFKA 2FE8A 1UBIA 2D3BA 2ZVNA 1UH6A 2MBEA 1SJED 3ZTDA 2QILA 1JROA 2QJLA 4B6WA 2N9EB 1QOGA 3Q14C 3PSEB 4CYEA 1V6EA 3HK0A 1P7FA 1I4RA 4EZKA 3AI5A 2LGXA 2NBUA 2WXNA 2NR2A 2AQ2B 2KX0A 4OVUA 2LWPA 1L4DB 2LJIA 2D3GA 3VVWB 2WXLA 2HE7A 4E3CA 1P0RA 1UF0A 2K39A 1KH0A 2JWZA 2IGHA 5FKAC 3EUB2 2HTHA 4IM0A 2LXAA 3Q8CA 1YQ4B 2JSVX 3GP7A 4PS8A 5E6OA 2JRHA 1I4PA 2SEBD 4YSXB 2C60A 3SU8X 4DHJD 1V1PA 1QQRA 4K1RB 3TEXA 3DWGC 1V97A 4I6LB 1XQQA 3V6CB 1D4BA 2DBYA 2BBCA 4HRSA 1H8CA 3RCZA 2DENB 1XF5L 3RNGC 1CMXB 4PYUA 3BYTB 1TKGA 3PHXB 1VLBA 3RFZB 2KDFB 2N9PC 4GDLB 4LJPB 2MLBA 3ABVB 3UF8A 1T5XD 2INNE 3I57A 2WDRB 2V3PA 1EO6A 2WHIA 4C56C 3I9V1 2KVZA 4EFOA 3Q3MC 4N59A 4JX1C 2N7JA 4HKZE 2C9WB 4MEMA 2GBRA 1TS3A 3QCAA 2CKHB 4MSMB 1T0SC 2JZPA 2LEKA 1UGMA 3NHEB 1YJJA 2LZ6A 4LNOA 4MGIE 4DHJB 4MJSA 4I6NB 2O6VB 4NAMA 3U2SC 1YD8U 3IT4B 2KC1A 4WAAA 2M1MA 3IVFA 1TY0A 1M4VA 1FNUA 1JW9D 3NOBA 4GSWA 4L23A 1TBEA 3A1QA 4WQMA 1XLQA 5BMIA 4WH4A 4NAWA 4M8MA 1TGZB 2YEPB 3RNBC 5E6PA 3NS1A 3NY5A 1J7AA 4ZDVA 1D5ZC 4M00A 3U8ZA 4IOIE 3GOEA 2Z0DB 2KTRA 1HEZE 5LLIA 2ZPYA 4ZRPA 1N63A 3A9JA 4EZLA 1J19A 3QWZB 4DXFA 5HHDG 3NZSA 4KSKC 4NQLB 4WWNA 3O13A 1FXIA 3Q3NC 3VXWA 2PE6B 4IM2A 3GZNB 3P1MA 3M63B 3R66C 3ZVVA 2K3UA 2HTME 2LJ5A 1WH3A 3AEEB 4FADA 1WM3A 2IO3B 4MDKE 4HVBA 3H1UA 3QK0A 3AEDB 3LYYA 4LJOB 2KNBA 2J4XA 2BGFA 2YLMA 4WWPA 3L10B 4C4VB 1XT9B 4MSQB 4RMAA 2LFIA 2MJEA 2BYFA 3JW0X 3S2AA 3NVWA 3ZJVA 1Z5SB 1T0YA 2IY0B 1V81A 3NVZA 2V0GA 4C7ZA 1VR9A 4BBNF 2JT4B 2IZVB 1WM2A 3A9KA 1JWUD 2X8XX 3V6EB 3HM3A 2IO1B 2EELA 3QQ8B 1LO5D 1ZE3D 2M56B 4IWQA 1SB3C 1OTRB 4J3OD 3VTUA 2MJ3A 3MC9A 2JZZA 4B0EA 3RUIB 4JGHB 3LB8C 1E10A 5J18A 5H8YE 4FXCA 2MBHA 4DBGA 2IDYA 4LLGM 3ENEA 5BYSA 2QDFA 4AJWA 1WRIA 4O1NA 2IO2B 4RFBA 4L2YA 3ZXRA 2D5GA 3PRMB 4TQ0A 1OQYA 3ZDMC 3IBEA 4US8A 2XBBC 1IGCA 2PLPA 2KK8A 3TJPA 1L5PA 2MEKA 2OJWA 3NUHB 2C7NB 3OJ3A 3L4PA 3BINA 1IGDA 3Q69A 4NPNA 2LGIA 4BBNC 2WXIA 2FIFA 2J42A 1L0YB 2WWZA 4NNJB 4LDTD 3E9SA 2WDQB 5D3IB 1VJKA 2BPSA 1WE7A 5IOIA 4AWJA 3BWUD 5IP4D 2VRRB 2AWTA 1N60A 1XD3B 1WE6A 2DX5B 4OVVA 2NBWB 1OQRA 1SIJA 2IYDB 2GI9A 4KGTA 3DQVA 1WJNA 1YN4A 3VR9B 3APFA 4GU2A 3H7PA 3GE3C 1MHXA 3AE8B 3NS8A 3W5VB 3ZLZA 4LTUA 1UZXB 2Q5WD 5GMVA 3SHQA 2PJHA 2FIDA 3B2GA 4A20A 2JRIB 3ZYYX 1SE2A 2K22A 1HE8A 4NZLB 4LDTB 1V86A 1WMHB 5T8IA 4IC7B 4UDUC 1RLFA 3R7QA 3PZ7A 3B1LX 3W1YA 1E9MA 2L00B 4WQOB 5EDSA 5BYRA 4WAFA 2LVPA 2WLBA 1D5XC 5BO4B 2WXGA 5FR6A 2MBBB 3ZJUA 1P9DU 2FCMA 2DYBA 2JX5A 4HJKA 1J7BA 1RRBA 1E5WA 1Y56A 3ZGZA 4TMAB 1N5WA 2HD5B 4IUMB 1GG3A 1K8RB 2ONQA 2MP2A 4MH0E 2QMTA 1WGDA 1EWYC 2WGSA 3VTVA 1SIFA 1ACCA 2J52A 2KFKB 4CO7A 2L0TA 4CHKA 4WJQA 3DBRB 1HTQA 4JQWC 2UWQA 2MSED 3K9OB 1HZ5A 1V80A 1FEHA 3CIRB 2KWUB 1SJHD 2NPTA 4OHJA 1MI0A 3AEAB 3E56A 1XO3A 1RM6C 3KUCB 4FULA 4N58A 3WAPA 2G3QB 1S1QB 5I4DA 1Q0WB 4JLCA 3RD2A 2Y5CA 2JUOA 3GZNI 2DHZA 2HJ8A 3CSTA 1JWBD 2V4IB 3FILA 1ZKHA 2UU7A 3P4QB 4KGSA 3UIPB 1G6JA 4ZHPA 1J7CA 1GAQB 1PGBA 2KQ7A 1C3TA 3RN9C 4LNKA 3V62A 3T3NA 1V1PB 2JYTA 3Q8BA 3R3MA 2DYMA 2MWSB 2KC2A 4YTPB 1X1MA 1FXTB 2JWUA 1PQSA 2LHEA 2JXXA 1YJIA 2KWCA 1RWSA 1V8CA 3N1XC 4WJNA 4XE0A 4N9F4 4W9DA 3PRPB 4XYCA 4C7YA 1K50A 1UNSA 4RH6A 1E8XA 2PKOA 3OWEB 3BK1A 3M95A 3N9YC 2OJRA 1WI0A 2W3RA 1Q1OA 1ZUD2 1L0XB 2V4LA 5C1ZA 2DLBA 1FNVA 3AV8A 4GXBA 3H6NA 2LGYA 2I1JA 4MJSB 2WQYB 5D94A 4IDIA 4HCNB 4US9A 1JQ4A 1GB4A 3AU5A 3A33B 2UYZB 3JYUA 5HKHA 1PDXA 2K9XA 1QT9A 3SFEB 4BFRA 4AOFA 3DHHC 2KQ4X 1WX7A 3IXSA 5KHOA 2V1YA 1AWDA 2KMCA 5IA7A 4NAWB 2CHZA 1WYWB 2PVGC 3DVNV 4R3DA 1T0QC 4A3PA 4GIVA 4ZOHC 2KTRB 2KANA 3WAOA 3A9JB 1ZXHA 2KWVB 3N1ZC 4S17A 1YOVB 3QC8B 2ON8A 4WIPA 4ACFA 2I38A 2KWDA 4KVGB 1IPGA 1YN3A 2JF5A 2INCC 3Q3OC 3KW5B 4KIKA 1WGRA 4A55A 1AN8A 3KYDD 3L16A 1LQBA 1V5OA 1EUVB 1LM8B 4JWUC 1F2RI 1LXDA 1RAXA 1NI3A 1C76A 4G50A 1T3QA 3RULA 2KJ6A 1GNUA 3WCQA 2HDEA 4WJOA 3TEZA 1XCQL 3HUIA 5L83A 5IAAC 2M17A 4NY0A 4CQNA 2WDTB 4S0RA 1WWTA 2DZJA 5EE1A 3ZTCA 2DZKA 2HJ1A 3TSSA 3A4SC 3NVVA 2M0XA 3ZRFA 3CMMB 1R7SA 1KLVA 3A9KB 2C5LC 1AYFA 2NCNA 5D2MB 2WNMA 1FRRA 3QARA 3RYTA 4GGQA 2KFJA 2L1AA 2D10A 1L6UA 2I1KA 1I42A 3U7DA 2N9XA 2MBOA 4NJCA 2EKEC 2JZ3B 4KKIA 4NJ7A 1EF5A 4DK5A 4DHZE 1SSNA 5BMGA 1WF9A 1WR1A 1HA5A 3L13A 5FR3A 1QOFA 4GLSC 1E0ZA 2H88B 2B3AA 2CU3A 1B1ZA 3ZW3A 1V49A 5CX3A 1PGXA 4MH8A 2KDBA 1EF1A 2ACZB 2A4ZA 1U4AA 1A5RA 2KDEB 3JVZX 3D32A 3ZQ4A 1MVKA 3H8HA 2G45B 2N7EA 4K3CA 4YXDB 1Q10A 2DAFA 4RNAA 1WYGA 4K7SA 5AUIA 2CS4A 1HZ6A 2AEHA 5JXVA 4PT5A 1KJTA 2REXA 4B95A 2W82A 3DHGC 5C3JB 4KX6B 1XLPA 2CHWA 3C8YA 1HXYD 3AB5A 5DCNA 2LRUA 3B0AA 1OEYA 4W9FA 4JL9A 1KM7A 4KZ0A 3VUYA 5LNK1 2QEJC 1FXAA 3VUWA 1JMLA 4BVUC 3MJWA 3V61A 2K6QA 3AE1B 3KWVA 1ZPSA 1MFWA 3H7PB 2EKIA 3VRBB 1E6EB 1V5TA 3APDA 2ZZPB 1OFFA 1UWXA 3CSFA 3TL5A 1ZDXA 1E90A 5BMHA 2OOBB 1TIFA 5G5HA 1YIWA 3Q8EA 5EE3A 3MP9A 1QF6A 3ZNGC 4HPMB 4XGAB 1QKZA 1WJUA 4KDIC 3RMKC 3N30A 1D3ZA 3LXFA 4XC2A 1EM7A 2X38A 2DYOA 3DHIC 4W9GA 3TBLD 2KLCA 2CR5A 2RPQA 2WXQA 2GBJA 3Q8AA 2Y3AA 3P63A 5JHBA 3VR8B 5L95C 5KHQA 3P4SB 3SD5A 1FFVA 3AN1A 2PEAA 4MACA 5LXIB 2LASA 1C79A 1QOBA 4WJPA 1IBXA 1NYRA 3RI7C 5JHAA 4D2KA 3DDCB 2KX3A 2LHDA 3V60A 1AARA 1SGHA 2XN9C 3UIOB 3W1SA 2DZMA 4MT5A 3ONSA 3BK2A 3PVLA 2GMIC 3FC4A 2R2OA 3IT6B 3ML9A 1ZXIA 1F77A 4JPSA 3VTWA 1WXAA 3AE4B 1I35A 4M01A 4HROA 2BF8B 4IWOA 3HVZA 2Y5BB 1MHHE 2MP2B 1ROEA 3Q8FA 4MM3A 1D5MC 1ENFA 1F9JA 2VH1A 2AL3A 3BVZA 3AM9A 4FJYA 3B08A 2QC8A 3T9LA 1F0ZA 1F52A 1ESFA 2K25A 2Y5PA 3L54A 1I4HA 1ET6A 1BUIC 3RNEC 3FAHA 1JCKB 4PK1A 1UUPA 4B0MA 1KTKA 1WR6E 2DAJA 2DWQA 2NPTB 4W9HA 2KDMA 2N4FA 2LGDA 3C19A 4A8XC 1LFDA
chains in the Genus database with same CATH topology
2JPHA 2L0TA 4CHKA 2XK5B 3M3JA 4MGKE 2BKRB 3PPAA 4WJQA 3IHPC 5CHFA 3Q3FA 4JQWC 2BKFA 5CTRC 2UWQA 1L2NA 2MSED 4GB9A 4ANVA 3K9OB 2G4DB 1TTNA 5AZHA 3PREA 3VUXA 1V80A 2KKCA 2J7QB 3PLUA 4YL8A 2J0KA 2ZJDA 3WAMA 1BT0A 3PGEA 2KWUB 2ZPNA 2NPTA 3UINB 2BYVE 3WA0A 1VCBA 2L7RA 4FULA 3KUCB 2KFKA 3WAPA 1UBIA 2G3QB 2ZVNA 2XK5A 1UH6A 2MBEA 1WFYA 1S1QB 3ZTDA 2RD0A 3VFKA 4B6WA 2N9EB 1Q0WB 4JLCA 3RD2A 1YQBA 2KLGA 3KUDB 3DPDA 3PSEB 4CYEA 2ASQA 1V6EA 4KSLC 2JUOA 1P3QU 3DOWA 2DHZA 3GZNI 3HK0A 2JY6A 2HJ8A 2MCNB 2KMAA 3CSTA 2L3ZA 4EZKA 3AI5A 2LGXA 4BKSD 3ZKJC 1UBQA 2NBUA 4F1SA 3H9DA 1NI2A 4HCPB 1J8CA 2NR2A 1ZKHA 2MQJA 3UIPB 2KX0A 4OVUA 3W1SC 3KVFB 1WGYA 1G6JA 2LWPA 3JSVB 2KQ7A 4JIOU 2D3GA 3VVWB 1C3TA 2HE7A 3OAWA 4E3CA 1P0RA 3V62A 2K39A 3R3MA 2DYMA 2JWZA 2MWSB 4GMVA 1V2YA 2KC2A 1YX5B 1X1MA 3EECA 3UGBB 1FXTB 2HTHA 4IM0A 1PQSA 2LXAA 2WX0A 2JXXA 2KWCA 2BWES 3VQIA 1RFAA 3DBSA 1WZ0A 4PS8A 4ASWC 4K81A 3O65B 3PRZA 1JRUA 4WJNA 5E6OA 2JRHA 1WGGA 4N9F4 3JSVA 4W9LA 4W9DA 3PRPB 4ZRIA 2C60A 3SU8X 5DPRA 4DHJD 1YJ1A 4BOSC 2CHXA 3QHTA 4K1RB 2Z0EB 2NBVB 4I6LB 2R2QA 3MHSD 4EZJA 1XQQA 3V6CB 3TIXA 1WXVA 1ZW7A 1H8CA 1E8XA 3RCZA 3DBLI 1QZEA 2ZNVC 1WXSA 3ML8A 3QA8A 2EMTA 3M95A 3HM6X 3I3TB 2DENB 2OJRA 4KDLB 1WI0A 1Q1OA 1V9JA 1WJ4A 2V4LA 5C1ZA 1CMXB 4BKTA 4PYUA 2AL6A 3VH3B 3WALA 3PHWB 2KO3A 3PHXB 2KDFB 4GXBA 3H6NA 3LDZE 5E6NA 2LGYA 2N9PC 2V3SA 4GDLB 4LJPB 2I1JA 4MJSB 1H4RA 2MLBA 4RM9A 5D94A 3RZFA 1M94A 3UF8A 2LI5A 4HCNB 1WIAA 4EEWA 3AU5A 1EO6A 3A33B 2UYZB 3JYUA 3TCAA 4EFOA 5HKHA 2J0MA 1UELA 4E71A 2C9WB 2YVCA 1WJ6A 4MEMA 4W9IA 2GBRA 3ZRCA 4BFRA 4AOFA 4PS3A 2KZRA 3QCAA 4KV2A 2CKHB 4MSMB 2C7MB 1WX7A 5KHOA 3PZDA 2V1YA 2KMCA 1UGMA 3AU4A 3NHEB 5IA7A 2LZ6A 2CHZA 1WYWB 4NAWB 3PS6A 4MGIE 4DHJB 3DVNV 2GBNA 4GDLA 5D7GA 3T8MA 4B9KA 1KOTA 4KIKB 4I6NB 4MJSA 2FCQA 4A3PA 2LRWA 2O6VB 4GIVA 4DWFA 1YD8U 1E8YA 4ANXA 3ZNID 3PTFC 3ZNHB 2KTRB 2KANA 2IBIB 2KC1A 4HXDA 4WAAA 2DZIA 2M1MA 3A9JB 3WAOA 4FA6A 3IVFA 2KWVB 2K8CA 2WX1A 3QC8B 3NOBA 2PE9A 4GSWA 3APCA 5AZFA 2MBQA 3IG3A 1TBEA 3A1QA 2KXJA 4F8CB 4KVGB 1IPGA 4P7IA 4NAWA 1Q5WB 2JF5A 4M8MA 4DHZB 4M8NA 2J0JA 1TGZB 5DPWA 5E6PA 3KW5B 4KIKA 1WGRA 2LD9A 3KYDD 2K8HA 2O6VA 3L16A 3A4RA 1LQBA 2N7DA 3NY5A 4ZDVA 2XEWA 1P98A 1V5OA 3U8ZA 4ICVA 1EUVB 4TUUA 1LM8B 3GOEA 3H7SA 4FJVB 2Z0DB 2KTRA 5LLIA 2ZPYA 1LXDA 3A9JA 4EZLA 1RAXA 1J19A 2GOWA 4G50A 3QWZB 2ZCCA 3RULA 2KJ6A 2O2VB 4W9KA 1MG8A 1GNUA 3AXCA 2FCNA 3ZUNA 3NZSA 4KSKC 4URKA 4TV3A 4WJOA 4X57B 4NQLB 4EUTA 4TQ1A 4WWNA 3KYCD 1WZ3A 1WX9A 4ZYNA 5L83A 3VXWA 5IAAC 2M17A 2PE6B 4NY0A 4IM2A 2KOXA 4F7ZA 3M63B 1WY8A 2WDTB 3R66C 3ZVVA 3OJ4B 2DZJA 2M4NA 3ZTCA 2DZKA 2LJ5A 1WH3A 2QHOA 3EHVA 4DXAB 4FADA 3A4SC 1WM3A 2L76A 2M0XA 3ZRFA 3CMMB 2IO3B 2O2VA 4MDKE 2AYOB 5DPTA 1P1AA 2MRPA 4HVBA 3H1UA 1KLVA 3A9KB 3QK0A 2C5LC 1C1YB 2NCNA 2KNBA 2RR9A 4LJOB 2BGFA 1L7YA 5D2MB 2YLMA 3MTNB 3QARA 4WWPA 3L10B 3RYTA 4AUQC 4ANWA 1XT9B 4GDKB 3KH0A 4MSQB 4RMAA 2N1WA 4GGQA 4GN1A 4ZRJA 2KFJA 4HK2A 4PYZA 2BYFA 2EMSA 2KTFA 2D10A 3JW0X 4LCDE 3S2AA 2I1KA 1VD2A 3X23A 1I42A 3U7DA 2N9XA 2MBOA 1Z5SB 3VH4B 2EKEC 4II3B 1T0YA 2IY0B 1V81A 2JZ3B 4NJ7A 2WYQA 1EF5A 5AEKB 4BBNF 3PV1A 5J2RA 2JT4B 2IZVB 2K1FA 4DHZE 4BKGA 4DK5A 1WM2A 3UQAA 3A9KA 2NS5A 4ICUA 4AP4C 1GC6A 1WF9A 1WR1A 3L13A 3V6EB 1IYFA 3HM3A 2IO1B 4GDKA 3QQ8B 1GUAB 4FHJA 1WGHA 4IWQA 4FLHA 4CO7A 4NQKE 1OTRB 2B3AA 4E74A 3VTUA 5JZEB 3ZW3A 2JZZA 1V49A 3UQBA 5CX3A 3RUIB 3CF6E 4JGHB 5AZGA 2JVCA 2NVUI 5J18A 3KUZA 2FNJB 4BKSA 2KDBA 1EF1A 2KHWB 2A4ZA 1U4AA 2FUHB 1R4MI 2MBHA 4HPLB 1A5RA 4DBGA 4HLEA 1TZ1A 2KDEB 3JVZX 4XX5A 3D32A 3ENEA 4AJWA 2G45B 2IO2B 2CU1A 2N7EA 3M62B 4IWPA 4G0NB 2KJHB 3L17A 2DAFA 4MELA 3WANA 3AULA 1S3SG 2KD0A 3PRMB 2M8SA 5J17A 4K7SA 3QX1A 3R7RA 4TKNA 1OQYA 4TQ0A 3ZDMC 2CS4A 4A3OA 2AEHA 3IBEA 2G4SA 2XBBC 1KJTA 2REXA 2K6DB 4B95A 2KK8A 2KJRA 3TJPA 2D07B 2CHWA 2C7NB 3OJ3A 4WWOA 5DCNA 3BINA 2LRUA 3B0AA 2N1VA 1OEYA 4NPNA 4W9FA 3LJ3A 2IO0B 4JL9A 4BBNC 1KM7A 4KZ0A 5TR5A 2FIFA 3VUYA 5LXHA 4BOZB 2BWFA 2C7HA 2WWZA 3ALBA 3EFUA 4NNJB 3VUWA 3NZUA 4BVUC 4LDTD 3MJWA 3V61A 2K6QA 2KDIA 3SDLC 4RM8A 1SE9A 4EKUA 3ZDTA 2D11A 2BPSA 3X0WA 4I6PA 3TMPB 4HDQA 1WE7A 3H7PB 1Y8RC 4AWJA 1GC7A 1V5TA 3APDA 2ZZPB 2VRRB 2AWTA 1XD3B 1WE6A 3CSFA 2LXCA 3TL5A 2DX5B 4OVVA 1E90A 2NBWB 4GOCA 2OOBB 4EOYA 3PT2B 1YIWA 2MA9B 4DDGD 2LVOA 2MW5A 2IYDB 2ZEQA 3ZO5B 3ZNGC 4HPMB 4FHKA 1WJUA 4AJYB 3N32A 3QAQA 3BY4B 4KDIC 3ZNZB 3K9PB 3RZWC 1J0GA 2W9NA 3N30A 3IFWB 1D3ZA 4KZCA 3DQVA 1WJNA 4XC2A 3PLVA 1NDDA 1OEYJ 3APFA 2ZCBA 4GU2A 3H7PA 1UD7A 1ZGUB 2DYOA 1IP9A 4HDOA 4J6IA 4W9GA 3TBLD 5C23A 3QJZA 2KLCA 3L08A 2CR5A 3NS8A 3U30A 3ZLZA 1UZXB 5GMVA 2RPQA 3SHQA 2GBJA 2PJHA 5JHBA 1WX8A 2FIDA 4II2B 5L95C 5KHQA 3SD5A 4A20A 4K7UA 2PEAA 4W9CA 2JRIB 3DCGA 5CHVC 5LXIB 2LASA 4MGYE 5D6JB 2L0FA 2ZVOA 4FBJB 1HE8A 2KN5A 4LDTB 4WJPA 2LVQA 4ANUA 2KVRA 1V86A 5JHAA 5G2NA 3DDCB 2KX3A 2K8BA 3P2BA 3V60A 1AARA 1WMHB 3VDZA 1SGHA 2FAZA 3W1SA 3UIOB 2DZMA 2BYEA 3ONSA 4PS7A 2GBMA 3DVNU 4XZ4A 4IC7B 3PVLA 1YX6B 2GMIC 1RLFA 2R2OA 1E7VA 3R7QA 4IM3A 2O6VD 3B1LX 3ECIA 3ML9A 3W1YA 2L00B 1E7UA 3DBHI 4DDID 3VTWA 1WXAA 3EC8A 1I35A 2ZNVB 4FN2A 4WQOB 2BF8B 4IWOA 3Q3JA 3VHTC 4IW0A 1R4NI 5EDSA 2IY1B 2LUEA 2Y5BB 2MP2B 2L05A 1WXMA 2LVPA 3HIZA 4MM3A 4W9JA 4FJZA 5BO4B 1WMHA 2FCSA 3VAWA 5JH5C 5FR6A 1F9JA 2MBBB 3DVGX 1ISNA 3C0RB 2AL3A 3HHMA 4ZRKA 1P9DU 2RSUA 4FJYA 4W9EA 1NBFC 3B08A 3T9LA 2FCMA 2DYBA 2K25A 1OGWA 4HJKA 2RGFA 1GJZA 2GBKA 4M0WB 3L54A 1Z2MA 1RRBA 3WIMA 1E5WA 2L8JA 4HWIB 5DPSA 3DVGY 5G55A 3OLMD 1WRDB 3QIJA 3DBRI 2HD5B 4IUMB 4NJ6A 1GG3A 4G3XB 1K8RB 2Z59B 3RT3B 2MP2A 5CHWA 4MH0E 3ZIMA 1WR6E 2KQSA 1WGDA 2DAJA 2NPTB 4W9HA 3VTVA 2A5UA 2D2QA 3A1QB 2PPHA 1SIFA 2MX2A 1E8WA 2N4FA 3L0WB 4MGZE 2LGDA 1E8ZA 4IG7B 3N3KB 1LFDA 2KFKB 4K7WA 4G11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JPH A;  2L0T A;  4CHK A;  2XK5 B;  3M3J A;  4MGK E;  2BKR B;  3PPA A;  4WJQ A;  3IHP C;  5CHF A;  3Q3F A;  4JQW C;  2BKF A;  5CTR C;  2UWQ A;  1L2N A;  2MSE D;  4GB9 A;  4ANV A;  3K9O B;  2G4D B;  1TTN A;  5AZH A;  3PRE A;  3VUX A;  1V80 A;  2KKC A;  2J7Q B;  3PLU A;  4YL8 A;  2J0K A;  2ZJD A;  3WAM A;  1BT0 A;  3PGE A;  2KWU B;  2ZPN A;  2NPT A;  3UIN B;  2BYV E;  3WA0 A;  1VCB A;  2L7R A;  4FUL A;  3KUC B;  2KFK A;  3WAP A;  1UBI A;  2G3Q B;  2ZVN A;  2XK5 A;  1UH6 A;  2MBE A;  1WFY A;  1S1Q B;  3ZTD A;  2RD0 A;  3VFK A;  4B6W A;  2N9E B;  1Q0W B;  4JLC A;  3RD2 A;  1YQB A;  2KLG A;  3KUD B;  3DPD A;  3PSE B;  4CYE A;  2ASQ A;  1V6E A;  4KSL C;  2JUO A;  1P3Q U;  3DOW A;  2DHZ A;  3GZN I;  3HK0 A;  2JY6 A;  2HJ8 A;  2MCN B;  2KMA A;  3CST A;  2L3Z A;  4EZK A;  3AI5 A;  2LGX A;  4BKS D;  3ZKJ C;  1UBQ A;  2NBU A;  4F1S A;  3H9D A;  1NI2 A;  4HCP B;  1J8C A;  2NR2 A;  1ZKH A;  2MQJ A;  3UIP B;  2KX0 A;  4OVU A;  3W1S C;  3KVF B;  1WGY A;  1G6J A;  2LWP A;  3JSV B;  2KQ7 A;  4JIO U;  2D3G A;  3VVW B;  1C3T A;  2HE7 A;  3OAW A;  4E3C A;  1P0R A;  3V62 A;  2K39 A;  3R3M A;  2DYM A;  2JWZ A;  2MWS B;  4GMV A;  1V2Y A;  2KC2 A;  1YX5 B;  1X1M A;  3EEC A;  3UGB B;  1FXT B;  2HTH A;  4IM0 A;  1PQS A;  2LXA A;  2WX0 A;  2JXX A;  2KWC A;  2BWE S;  3VQI A;  1RFA A;  3DBS A;  1WZ0 A;  4PS8 A;  4ASW C;  4K81 A;  3O65 B;  3PRZ A;  1JRU A;  4WJN A;  5E6O A;  2JRH A;  1WGG A;  4N9F 4;  3JSV A;  4W9L A;  4W9D A;  3PRP B;  4ZRI A;  2C60 A;  3SU8 X;  5DPR A;  4DHJ D;  1YJ1 A;  4BOS C;  2CHX A;  3QHT A;  4K1R B;  2Z0E B;  2NBV B;  4I6L B;  2R2Q A;  3MHS D;  4EZJ A;  1XQQ A;  3V6C B;  3TIX A;  1WXV A;  1ZW7 A;  1H8C A;  1E8X A;  3RCZ A;  3DBL I;  1QZE A;  2ZNV C;  1WXS A;  3ML8 A;  3QA8 A;  2EMT A;  3M95 A;  3HM6 X;  3I3T B;  2DEN B;  2OJR A;  4KDL B;  1WI0 A;  1Q1O A;  1V9J A;  1WJ4 A;  2V4L A;  5C1Z A;  1CMX B;  4BKT A;  4PYU A;  2AL6 A;  3VH3 B;  3WAL A;  3PHW B;  2KO3 A;  3PHX B;  2KDF B;  4GXB A;  3H6N A;  3LDZ E;  5E6N A;  2LGY A;  2N9P C;  2V3S A;  4GDL B;  4LJP B;  2I1J A;  4MJS B;  1H4R A;  2MLB A;  4RM9 A;  5D94 A;  3RZF A;  1M94 A;  3UF8 A;  2LI5 A;  4HCN B;  1WIA A;  4EEW A;  3AU5 A;  1EO6 A;  3A33 B;  2UYZ B;  3JYU A;  3TCA A;  4EFO A;  5HKH A;  2J0M A;  1UEL A;  4E71 A;  2C9W B;  2YVC A;  1WJ6 A;  4MEM A;  4W9I A;  2GBR A;  3ZRC A;  4BFR A;  4AOF A;  4PS3 A;  2KZR A;  3QCA A;  4KV2 A;  2CKH B;  4MSM B;  2C7M B;  1WX7 A;  5KHO A;  3PZD A;  2V1Y A;  2KMC A;  1UGM A;  3AU4 A;  3NHE B;  5IA7 A;  2LZ6 A;  2CHZ A;  1WYW B;  4NAW B;  3PS6 A;  4MGI E;  4DHJ B;  3DVN V;  2GBN A;  4GDL A;  5D7G A;  3T8M A;  4B9K A;  1KOT A;  4KIK B;  4I6N B;  4MJS A;  2FCQ A;  4A3P A;  2LRW A;  2O6V B;  4GIV A;  4DWF A;  1YD8 U;  1E8Y A;  4ANX A;  3ZNI D;  3PTF C;  3ZNH B;  2KTR B;  2KAN A;  2IBI B;  2KC1 A;  4HXD A;  4WAA A;  2DZI A;  2M1M A;  3A9J B;  3WAO A;  4FA6 A;  3IVF A;  2KWV B;  2K8C A;  2WX1 A;  3QC8 B;  3NOB A;  2PE9 A;  4GSW A;  3APC A;  5AZF A;  2MBQ A;  3IG3 A;  1TBE A;  3A1Q A;  2KXJ A;  4F8C B;  4KVG B;  1IPG A;  4P7I A;  4NAW A;  1Q5W B;  2JF5 A;  4M8M A;  4DHZ B;  4M8N A;  2J0J A;  1TGZ B;  5DPW A;  5E6P A;  3KW5 B;  4KIK A;  1WGR A;  2LD9 A;  3KYD D;  2K8H A;  2O6V A;  3L16 A;  3A4R A;  1LQB A;  2N7D A;  3NY5 A;  4ZDV A;  2XEW A;  1P98 A;  1V5O A;  3U8Z A;  4ICV A;  1EUV B;  4TUU A;  1LM8 B;  3GOE A;  3H7S A;  4FJV B;  2Z0D B;  2KTR A;  5LLI A;  2ZPY A;  1LXD A;  3A9J A;  4EZL A;  1RAX A;  1J19 A;  2GOW A;  4G50 A;  3QWZ B;  2ZCC A;  3RUL A;  2KJ6 A;  2O2V B;  4W9K A;  1MG8 A;  1GNU A;  3AXC A;  2FCN A;  3ZUN A;  3NZS A;  4KSK C;  4URK A;  4TV3 A;  4WJO A;  4X57 B;  4NQL B;  4EUT A;  4TQ1 A;  4WWN A;  3KYC D;  1WZ3 A;  1WX9 A;  4ZYN A;  5L83 A;  3VXW A;  5IAA C;  2M17 A;  2PE6 B;  4NY0 A;  4IM2 A;  2KOX A;  4F7Z A;  3M63 B;  1WY8 A;  2WDT B;  3R66 C;  3ZVV A;  3OJ4 B;  2DZJ A;  2M4N A;  3ZTC A;  2DZK A;  2LJ5 A;  1WH3 A;  2QHO A;  3EHV A;  4DXA B;  4FAD A;  3A4S C;  1WM3 A;  2L76 A;  2M0X A;  3ZRF A;  3CMM B;  2IO3 B;  2O2V A;  4MDK E;  2AYO B;  5DPT A;  1P1A A;  2MRP A;  4HVB A;  3H1U A;  1KLV A;  3A9K B;  3QK0 A;  2C5L C;  1C1Y B;  2NCN A;  2KNB A;  2RR9 A;  4LJO B;  2BGF A;  1L7Y A;  5D2M B;  2YLM A;  3MTN B;  3QAR A;  4WWP A;  3L10 B;  3RYT A;  4AUQ C;  4ANW A;  1XT9 B;  4GDK B;  3KH0 A;  4MSQ B;  4RMA A;  2N1W A;  4GGQ A;  4GN1 A;  4ZRJ A;  2KFJ A;  4HK2 A;  4PYZ A;  2BYF A;  2EMS A;  2KTF A;  2D10 A;  3JW0 X;  4LCD E;  3S2A A;  2I1K A;  1VD2 A;  3X23 A;  1I42 A;  3U7D A;  2N9X A;  2MBO A;  1Z5S B;  3VH4 B;  2EKE C;  4II3 B;  1T0Y A;  2IY0 B;  1V81 A;  2JZ3 B;  4NJ7 A;  2WYQ A;  1EF5 A;  5AEK B;  4BBN F;  3PV1 A;  5J2R A;  2JT4 B;  2IZV B;  2K1F A;  4DHZ E;  4BKG A;  4DK5 A;  1WM2 A;  3UQA A;  3A9K A;  2NS5 A;  4ICU A;  4AP4 C;  1GC6 A;  1WF9 A;  1WR1 A;  3L13 A;  3V6E B;  1IYF A;  3HM3 A;  2IO1 B;  4GDK A;  3QQ8 B;  1GUA B;  4FHJ A;  1WGH A;  4IWQ A;  4FLH A;  4CO7 A;  4NQK E;  1OTR B;  2B3A A;  4E74 A;  3VTU A;  5JZE B;  3ZW3 A;  2JZZ A;  1V49 A;  3UQB A;  5CX3 A;  3RUI B;  3CF6 E;  4JGH B;  5AZG A;  2JVC A;  2NVU I;  5J18 A;  3KUZ A;  2FNJ B;  4BKS A;  2KDB A;  1EF1 A;  2KHW B;  2A4Z A;  1U4A A;  2FUH B;  1R4M I;  2MBH A;  4HPL B;  1A5R A;  4DBG A;  4HLE A;  1TZ1 A;  2KDE B;  3JVZ X;  4XX5 A;  3D32 A;  3ENE A;  4AJW A;  2G45 B;  2IO2 B;  2CU1 A;  2N7E A;  3M62 B;  4IWP A;  4G0N B;  2KJH B;  3L17 A;  2DAF A;  4MEL A;  3WAN A;  3AUL A;  1S3S G;  2KD0 A;  3PRM B;  2M8S A;  5J17 A;  4K7S A;  3QX1 A;  3R7R A;  4TKN A;  1OQY A;  4TQ0 A;  3ZDM C;  2CS4 A;  4A3O A;  2AEH A;  3IBE A;  2G4S A;  2XBB C;  1KJT A;  2REX A;  2K6D B;  4B95 A;  2KK8 A;  2KJR A;  3TJP A;  2D07 B;  2CHW A;  2C7N B;  3OJ3 A;  4WWO A;  5DCN A;  3BIN A;  2LRU A;  3B0A A;  2N1V A;  1OEY A;  4NPN A;  4W9F A;  3LJ3 A;  2IO0 B;  4JL9 A;  4BBN C;  1KM7 A;  4KZ0 A;  5TR5 A;  2FIF A;  3VUY A;  5LXH A;  4BOZ B;  2BWF A;  2C7H A;  2WWZ A;  3ALB A;  3EFU A;  4NNJ B;  3VUW A;  3NZU A;  4BVU C;  4LDT D;  3MJW A;  3V61 A;  2K6Q A;  2KDI A;  3SDL C;  4RM8 A;  1SE9 A;  4EKU A;  3ZDT A;  2D11 A;  2BPS A;  3X0W A;  4I6P A;  3TMP B;  4HDQ A;  1WE7 A;  3H7P B;  1Y8R C;  4AWJ A;  1GC7 A;  1V5T A;  3APD A;  2ZZP B;  2VRR B;  2AWT A;  1XD3 B;  1WE6 A;  3CSF A;  2LXC A;  3TL5 A;  2DX5 B;  4OVV A;  1E90 A;  2NBW B;  4GOC A;  2OOB B;  4EOY A;  3PT2 B;  1YIW A;  2MA9 B;  4DDG D;  2LVO A;  2MW5 A;  2IYD B;  2ZEQ A;  3ZO5 B;  3ZNG C;  4HPM B;  4FHK A;  1WJU A;  4AJY B;  3N32 A;  3QAQ A;  3BY4 B;  4KDI C;  3ZNZ B;  3K9P B;  3RZW C;  1J0G A;  2W9N A;  3N30 A;  3IFW B;  1D3Z A;  4KZC A;  3DQV A;  1WJN A;  4XC2 A;  3PLV A;  1NDD A;  1OEY J;  3APF A;  2ZCB A;  4GU2 A;  3H7P A;  1UD7 A;  1ZGU B;  2DYO A;  1IP9 A;  4HDO A;  4J6I A;  4W9G A;  3TBL D;  5C23 A;  3QJZ A;  2KLC A;  3L08 A;  2CR5 A;  3NS8 A;  3U30 A;  3ZLZ A;  1UZX B;  5GMV A;  2RPQ A;  3SHQ A;  2GBJ A;  2PJH A;  5JHB A;  1WX8 A;  2FID A;  4II2 B;  5L95 C;  5KHQ A;  3SD5 A;  4A20 A;  4K7U A;  2PEA A;  4W9C A;  2JRI B;  3DCG A;  5CHV C;  5LXI B;  2LAS A;  4MGY E;  5D6J B;  2L0F A;  2ZVO A;  4FBJ B;  1HE8 A;  2KN5 A;  4LDT B;  4WJP A;  2LVQ A;  4ANU A;  2KVR A;  1V86 A;  5JHA A;  5G2N A;  3DDC B;  2KX3 A;  2K8B A;  3P2B A;  3V60 A;  1AAR A;  1WMH B;  3VDZ A;  1SGH A;  2FAZ A;  3W1S A;  3UIO B;  2DZM A;  2BYE A;  3ONS A;  4PS7 A;  2GBM A;  3DVN U;  4XZ4 A;  4IC7 B;  3PVL A;  1YX6 B;  2GMI C;  1RLF A;  2R2O A;  1E7V A;  3R7Q A;  4IM3 A;  2O6V D;  3B1L X;  3ECI A;  3ML9 A;  3W1Y A;  2L00 B;  1E7U A;  3DBH I;  4DDI D;  3VTW A;  1WXA A;  3EC8 A;  1I35 A;  2ZNV B;  4FN2 A;  4WQO B;  2BF8 B;  4IWO A;  3Q3J A;  3VHT C;  4IW0 A;  1R4N I;  5EDS A;  2IY1 B;  2LUE A;  2Y5B B;  2MP2 B;  2L05 A;  1WXM A;  2LVP A;  3HIZ A;  4MM3 A;  4W9J A;  4FJZ A;  5BO4 B;  1WMH A;  2FCS A;  3VAW A;  5JH5 C;  5FR6 A;  1F9J A;  2MBB B;  3DVG X;  1ISN A;  3C0R B;  2AL3 A;  3HHM A;  4ZRK A;  1P9D U;  2RSU A;  4FJY A;  4W9E A;  1NBF C;  3B08 A;  3T9L A;  2FCM A;  2DYB A;  2K25 A;  1OGW A;  4HJK A;  2RGF A;  1GJZ A;  2GBK A;  4M0W B;  3L54 A;  1Z2M A;  1RRB A;  3WIM A;  1E5W A;  2L8J A;  4HWI B;  5DPS A;  3DVG Y;  5G55 A;  3OLM D;  1WRD B;  3QIJ A;  3DBR I;  2HD5 B;  4IUM B;  4NJ6 A;  1GG3 A;  4G3X B;  1K8R B;  2Z59 B;  3RT3 B;  2MP2 A;  5CHW A;  4MH0 E;  3ZIM A;  1WR6 E;  2KQS A;  1WGD A;  2DAJ A;  2NPT B;  4W9H A;  3VTV A;  2A5U A;  2D2Q A;  3A1Q B;  2PPH A;  1SIF A;  2MX2 A;  1E8W A;  2N4F A;  3L0W B;  4MGZ E;  2LGD A;  1E8Z A;  4IG7 B;  3N3K B;  1LFD A;  2KFK B;  4K7W A;  4G11 A; 
#chains in the Genus database with same CATH topology
 4ARC A;  2BKR B;  1WXQ A;  2CJN A;  3Q3F A;  2BKF A;  5CTR C;  1L2N A;  2ZW0 A;  4RGM A;  2G4D B;  1TTN A;  5AZH A;  3VUX A;  3PLU A;  1T0R C;  4YL8 A;  2J0K A;  3FIL B;  2ZJD A;  3AE7 B;  3PZ8 A;  3P4P B;  4KGR A;  3UIN B;  1N62 A;  2E6X A;  2WXK A;  1ET9 A;  3I63 C;  1BML C;  2XK5 A;  2G1E A;  1C77 A;  3KUD B;  3DPD A;  3NJT A;  4KSL C;  3DOW A;  2JY6 A;  2L3Z A;  4BKS D;  3ZKJ C;  1UBQ A;  1NI2 A;  4HCP B;  1J8C A;  2MQJ A;  2FBW B;  3W1S C;  3KVF B;  4JIO U;  3OAW A;  3B9J A;  2WXM A;  2K5P A;  4LNN A;  1MPE A;  4GMV A;  1YX5 B;  1BXT A;  2BQQ A;  4OZB A;  2D3A A;  2WX0 A;  3VRA B;  1FM0 D;  3AEC B;  2BB6 A;  4REZ A;  3VQI A;  1WZ0 A;  5IKC M;  4ASW C;  4K81 A;  3PRZ A;  1JRU A;  4AS1 A;  2W54 A;  1WGG A;  3AE6 B;  3JSV A;  4W9L A;  5AUK A;  4ZRI A;  1VZ8 A;  3NRZ A;  1YJ1 A;  2CHX A;  2Z0E B;  3MHS D;  2RDB C;  4EZJ A;  1FRD A;  3TIX A;  1YN5 A;  1CQV A;  4HPP A;  2WXH A;  3ML8 A;  4DQO C;  2EMT A;  1E7P B;  3HM6 X;  3I3T B;  1V9J A;  1WJ4 A;  4BKT A;  2PW9 A;  2AL6 A;  1AW7 A;  4OVZ A;  2YEP F;  3WAL A;  4HEA 1;  3MFG A;  3R2T A;  4XWW A;  1A70 A;  3LDZ E;  5E6N A;  2D3C A;  1H4R A;  1R4N B;  2LI5 A;  1KRH A;  1WIA A;  4EEW A;  3PO0 A;  1UEL A;  1FFU A;  1QIL A;  4W9I A;  2I2Y A;  4PS3 A;  2KZR A;  4KV2 A;  1VZ7 A;  3PZD A;  4YTN B;  3AU4 A;  3I5J C;  1KOT A;  4KIK B;  4DWF A;  1E8Y A;  4ANX A;  4QAY A;  3ZNH B;  2IBI B;  2DZI A;  4FA6 A;  2K8C A;  1XLO A;  2Z8L A;  3APC A;  1L6V A;  3IG3 A;  3IAS 1;  4P7I A;  1Q5W B;  5DPW A;  2LD9 A;  1TKE A;  2N7D A;  2WU2 B;  4WWM A;  1SXT A;  4ICV A;  1NVI D;  4TUU A;  3H7S A;  3GS2 A;  2FCN A;  4TV3 A;  4X57 B;  4TQ1 A;  1I4X A;  1WZ3 A;  4ZYN A;  2B76 B;  1SEB D;  4OZC A;  3AE3 B;  3OJ4 B;  2M4N A;  4DXA B;  3EHV A;  1I4G A;  1QLB B;  1QOA A;  2O2V A;  5DPT A;  2AYO B;  2WXJ A;  1P1A A;  4XDC A;  3AEB B;  3MTN B;  3KH0 A;  2N1W A;  4GN1 A;  4HK2 A;  4PYZ A;  2KTF A;  1RYJ A;  2EMS A;  3X23 A;  1C9F A;  2LUM A;  5D3D A;  5HFY A;  1TKY A;  2WYQ A;  4BKG A;  4ICU A;  1IYF A;  3DBL B;  1GPX A;  4GDK A;  4FHJ A;  1WGH A;  4XDD A;  1TYG B;  2XNA C;  3BII D;  3OG5 A;  4NQK E;  3CWI A;  5JZE B;  1ZP0 B;  3UQB A;  3CF6 E;  3BVM A;  5AZG A;  4WUR A;  4BKS A;  2W3S A;  1TS4 A;  5C2T B;  2FUH B;  4HPL B;  1TZ1 A;  4XX5 A;  2M19 A;  4KKJ A;  3UI3 A;  4YSY B;  4G0N B;  2KJH B;  3WAN A;  2AQ1 B;  1S3S G;  1N6Z A;  2M8S A;  5J17 A;  3R7R A;  4TKN A;  2IPK D;  4A3O A;  3GB1 A;  2K6D B;  1UGJ A;  4RF0 A;  1FMA D;  3J9C A;  2D07 B;  2K0P A;  3GE8 C;  2N1V A;  2G9H D;  4BOZ B;  2BWF A;  4ITK A;  3NZU A;  1DOY A;  3BZD B;  4EKU A;  2D11 A;  3X0W A;  3ZJT A;  3TMP B;  1I4Q A;  2BYT A;  3AE2 B;  1Y8R C;  1GC7 A;  5H92 C;  2LXC A;  1KFY B;  4GOC A;  4EOY A;  3PT2 B;  2MA9 B;  2LVO A;  2MW5 A;  2ZEQ A;  1EWC A;  3ZO5 B;  1JAL A;  2KMM A;  3BY4 B;  5IO9 A;  1SE3 A;  3ZNZ B;  3RZW C;  2W9N A;  1F2R C;  1JRP A;  3EGR A;  3U4E G;  1IUE A;  1IBX B;  2NMQ A;  4K3B A;  4YT0 B;  4ZRQ A;  1NDD A;  1OEY J;  1YMH E;  1UD7 A;  1ZGU B;  4HDO A;  4J6I A;  3QJZ A;  2JXT A;  5G5G A;  1VDV A;  3U30 A;  2RDH A;  3MHZ A;  2AQ3 B;  3DCG A;  5CHV C;  4MGY E;  3MC0 B;  5D6J B;  2L0F A;  2ZVO A;  4FBJ B;  2KN5 A;  4ANU A;  2KVR A;  4MM3 B;  3VDZ A;  2QCZ A;  4LNF A;  3DVN U;  4XZ4 A;  1YX6 B;  2OED A;  5TSS A;  1F1H A;  2J53 A;  4IM3 A;  2O6V D;  3ECI A;  2WU5 B;  2QIE B;  3EC8 A;  1SBB B;  3VHT C;  3Q3J A;  1R4N I;  2LUE A;  1WXM A;  3AH7 A;  4FJZ A;  2FCS A;  5JH5 C;  1UWM A;  3DVG X;  4ZRK A;  2R61 A;  1NBF C;  4BZA A;  1CJE A;  1GJZ A;  4RGT A;  5DPS A;  3DVG Y;  5G55 A;  3OLM D;  1WRD B;  3QIJ A;  2N0S B;  3DBR I;  4NJ6 A;  1FCC C;  4G3X B;  3HRD D;  2WXP A;  3T3O A;  2BS2 B;  1DOI A;  1TS5 A;  1R4M B;  1SE4 A;  4LK0 M;  2D2Q A;  3V05 A;  3L0W B;  3B2F A;  1YNT E;  2IGG A;  3IAM 1;  1E8Z A;  4IG7 B;  5EE0 A;  2INP E;  2JPH A;  2XK5 B;  4MGK E;  1CK1 A;  3IHP C;  2NTT A;  1PUT A;  4C00 A;  5CHF A;  4M0W A;  1C4A A;  4P1B C;  3SEB A;  2RPV A;  4GB9 A;  2WS3 B;  2ICI A;  3PRE A;  2KKC A;  2GLS A;  3WAM A;  2WDV B;  1BT0 A;  2ZPN A;  4YSZ B;  1NYQ A;  4OZA A;  1TJE A;  3U7Z A;  2WP9 B;  1V1O A;  3EA6 A;  1C4C A;  1VCB A;  2L7R A;  1CZP A;  3ZXV A;  2LGS A;  1WFY A;  2VZK D;  2N9L A;  2RD0 A;  3VFK A;  1XEE A;  2MJD A;  1PYW D;  1YQB A;  2KLG A;  2AX5 A;  2ASQ A;  4ARI A;  1P3Q U;  2MCN B;  2KMA A;  2BT6 A;  4F1S A;  3H9D A;  1K53 A;  1XLN A;  1WGY A;  3JSV B;  1I7H A;  1V2Y A;  3EEC A;  3UGB B;  1RFK A;  1OQQ A;  2TSS A;  2BWE S;  2MHJ A;  4RGN A;  1RFA A;  3DBS A;  4A90 A;  3TUO A;  3O65 B;  4OW0 A;  1EU3 A;  4P1C C;  4TSS A;  5DPR A;  1JWS D;  4BOS C;  3QHT A;  2NBV B;  2R2Q A;  1C4P A;  1FNW A;  1WXV A;  1ZW7 A;  2VZK B;  2M0A A;  2KT7 A;  3N1Y C;  3DBL I;  1QZE A;  2ZNV C;  1WXS A;  3QA8 A;  4KDL B;  2JYE A;  4ZHO A;  3VH3 B;  3TEY A;  3AEG B;  3PHW B;  2KO3 A;  2KAC A;  3DBH B;  2V3S A;  1N5X A;  4RM9 A;  3RZF A;  3ETR A;  1M94 A;  1FIQ A;  2BB5 A;  2PTL A;  3TCA A;  1YQ3 B;  2GB1 A;  2J0M A;  1KLG D;  4E71 A;  2YVC A;  1WJ6 A;  1KLU D;  3ZRC A;  2C7M B;  3PS6 A;  1WGK A;  3T8M A;  2GBN A;  4GDL A;  5D7G A;  1WSP A;  4B9K A;  2FCQ A;  2V3N A;  2LRW A;  3NZ3 A;  3ZNI D;  3PTF C;  3P42 A;  4HXD A;  1XCT L;  2WX1 A;  2PE9 A;  1TZO A;  2KAJ A;  5AZF A;  2MBQ A;  4YWG G;  2KXJ A;  4Q2J A;  4A9A A;  4F8C B;  5E6J A;  5GXG B;  4DHZ B;  4M8N A;  2J0J A;  1MG4 A;  3V3X A;  2K8H A;  2O6V A;  5HI1 A;  3A4R A;  2BS4 B;  2XEW A;  1P98 A;  3NVY A;  2OHF A;  4FJV B;  1K52 A;  2BTE A;  2GOW A;  2V9H A;  2ZCC A;  2O2V B;  1GOZ A;  1MG8 A;  4W9K A;  3AXC A;  3ZUN A;  1EU4 A;  4URK A;  4EUT A;  3KYC D;  1DOX A;  1WX9 A;  3N20 C;  2KOX A;  4F7Z A;  3U52 E;  1WY8 A;  5FK9 C;  3URY A;  4RF1 A;  1P7E A;  2QHO A;  2BW2 A;  1FCL A;  2L76 A;  3BVG A;  2MRP A;  1C1Y B;  2RR9 A;  1L7Y A;  4AUQ C;  4ANW A;  3KLS X;  4GDK B;  1PGA A;  1VZ6 A;  4ZRJ A;  4P6V F;  1K51 A;  1TT5 B;  4N6E B;  4LCD E;  1JWM D;  1VD2 A;  3MC8 A;  2BVC A;  3VH4 B;  4II3 B;  4JWS C;  2KYW A;  4IKG A;  3RPF C;  5AEK B;  3PV1 A;  4RCO A;  5J2R A;  2K1F A;  3UQA A;  1ZDV A;  2LMC A;  3P4R B;  1FD6 A;  2NS5 A;  5HG2 A;  4AP4 C;  2BS3 B;  4XWT A;  1GC6 A;  4C4V A;  1GUA B;  4FLH A;  4DXG A;  2JU6 X;  4E74 A;  3Q2A C;  1GB1 A;  2JVC A;  2NVU I;  2RMM A;  2FNJ B;  3KUZ A;  2KHW B;  1R4M I;  2GRI A;  4HLE A;  2IND C;  2ZW1 A;  3AE5 B;  2CU1 A;  3M62 B;  4IWP A;  2KN4 A;  2NTS A;  3L17 A;  4MEL A;  3MJ5 A;  3AUL A;  2KD0 A;  3QX1 A;  3DWM A;  2L52 A;  4P16 A;  1DGJ A;  1N61 A;  2G4S A;  2KJR A;  4HJG E;  4WWO A;  4LNI A;  4M02 A;  3LJ3 A;  2IO0 B;  1DYQ A;  5LXH A;  5TR5 A;  2C7H A;  3AE9 B;  4C80 A;  4ZYS A;  3ALB A;  3EFU A;  2WXO A;  2PVO D;  5MPO A;  1D6E C;  1XXG A;  2KDI A;  3SDL C;  1FPY A;  4RM8 A;  1SE9 A;  4A6Q A;  3ZDT A;  4I6P A;  4HDQ A;  3SFD B;  1T6B X;  1NEK B;  1MJD A;  3RNC C;  3AMZ A;  3NG0 A;  4H2A A;  1NEN B;  1ZOY B;  4DDG D;  2WXF A;  2FUG 1;  4FHK A;  4AJY B;  3N32 A;  3QAQ A;  3BYY B;  3K9P B;  1J0G A;  3W9C B;  3AEF B;  3IFW B;  4KZC A;  1TY2 A;  3PLV A;  2ZCB A;  5IN7 A;  1IP9 A;  2CJO A;  2E3T A;  5C23 A;  3L08 A;  5BYQ A;  2SAK A;  1WX8 A;  4II2 B;  3R2I A;  4K7U A;  4W9C A;  2IJ0 A;  2VH2 A;  4AQ7 A;  2IGD A;  4YTM B;  2LVQ A;  5G2N A;  4HKQ A;  4JE3 B;  2K8B A;  3P2B A;  1LGR A;  2FAZ A;  1L0V B;  1FO4 A;  2BYE A;  4PS7 A;  2GBM A;  2N9K A;  4L1B A;  3RNF C;  1E7V A;  3W5U B;  3KWL A;  1TS2 A;  2L83 A;  1E7U A;  3DBH I;  4DDI D;  2ZNV B;  4FN2 A;  4IW0 A;  1SF0 A;  2IY1 B;  2RDG A;  2L05 A;  3HIZ A;  4W9J A;  2DNF A;  1WMH A;  1KF6 B;  3VAW A;  5EE9 A;  3HHM A;  1ISN A;  1C78 A;  3C0R B;  1HQR D;  2L32 A;  4W9E A;  2RSU A;  1OGW A;  3SR6 A;  2RGF A;  2GBK A;  1JWA D;  4M0W B;  1Z2M A;  3WIM A;  2L8J A;  3EFC A;  4HWI B;  2H89 B;  2WXR A;  3RT3 B;  2Z59 B;  2PIA A;  2W55 A;  4RGO S;  5CHW A;  3ZIM A;  2KQS A;  1HTO A;  3HVD A;  2JQR B;  3FKY A;  4BAX A;  2A5U A;  3A1Q B;  1STE A;  2PPH A;  2MX2 A;  1E8W A;  4MGZ E;  1VRA B;  3KQ4 A;  3N3K B;  4K7W A;  4G11 A;  3M3J A;  3PPA A;  2MH7 A;  3Q6B A;  3W2D A;  4ANV A;  2PMV A;  2J7Q B;  2QSD A;  3TEW A;  3PGE A;  4USA A;  3RNA C;  2BYV E;  3WA0 A;  1L4Z B;  1B9R A;  1PFD A;  4EE2 A;  3R8B A;  2KFK A;  2FE8 A;  1UBI A;  2D3B A;  2ZVN A;  1UH6 A;  2MBE A;  1SJE D;  3ZTD A;  2QIL A;  1JRO A;  2QJL A;  4B6W A;  2N9E B;  1QOG A;  3Q14 C;  3PSE B;  4CYE A;  1V6E A;  3HK0 A;  1P7F A;  1I4R A;  4EZK A;  3AI5 A;  2LGX A;  2NBU A;  2WXN A;  2NR2 A;  2AQ2 B;  2KX0 A;  4OVU A;  2LWP A;  1L4D B;  2LJI A;  2D3G A;  3VVW B;  2WXL A;  2HE7 A;  4E3C A;  1P0R A;  1UF0 A;  2K39 A;  1KH0 A;  2JWZ A;  2IGH A;  5FKA C;  3EUB 2;  2HTH A;  4IM0 A;  2LXA A;  3Q8C A;  1YQ4 B;  2JSV X;  3GP7 A;  4PS8 A;  5E6O A;  2JRH A;  1I4P A;  2SEB D;  4YSX B;  2C60 A;  3SU8 X;  4DHJ D;  1V1P A;  1QQR A;  4K1R B;  3TEX A;  3DWG C;  1V97 A;  4I6L B;  1XQQ A;  3V6C B;  1D4B A;  2DBY A;  2BBC A;  4HRS A;  1H8C A;  3RCZ A;  2DEN B;  1XF5 L;  3RNG C;  1CMX B;  4PYU A;  3BYT B;  1TKG A;  3PHX B;  1VLB A;  3RFZ B;  2KDF B;  2N9P C;  4GDL B;  4LJP B;  2MLB A;  3ABV B;  3UF8 A;  1T5X D;  2INN E;  3I57 A;  2WDR B;  2V3P A;  1EO6 A;  2WHI A;  4C56 C;  3I9V 1;  2KVZ A;  4EFO A;  3Q3M C;  4N59 A;  4JX1 C;  2N7J A;  4HKZ E;  2C9W B;  4MEM A;  2GBR A;  1TS3 A;  3QCA A;  2CKH B;  4MSM B;  1T0S C;  2JZP A;  2LEK A;  1UGM A;  3NHE B;  1YJJ A;  2LZ6 A;  4LNO A;  4MGI E;  4DHJ B;  4MJS A;  4I6N B;  2O6V B;  4NAM A;  3U2S C;  1YD8 U;  3IT4 B;  2KC1 A;  4WAA A;  2M1M A;  3IVF A;  1TY0 A;  1M4V A;  1FNU A;  1JW9 D;  3NOB A;  4GSW A;  4L23 A;  1TBE A;  3A1Q A;  4WQM A;  1XLQ A;  5BMI A;  4WH4 A;  4NAW A;  4M8M A;  1TGZ B;  2YEP B;  3RNB C;  5E6P A;  3NS1 A;  3NY5 A;  1J7A A;  4ZDV A;  1D5Z C;  4M00 A;  3U8Z A;  4IOI E;  3GOE A;  2Z0D B;  2KTR A;  1HEZ E;  5LLI A;  2ZPY A;  4ZRP A;  1N63 A;  3A9J A;  4EZL A;  1J19 A;  3QWZ B;  4DXF A;  5HHD G;  3NZS A;  4KSK C;  4NQL B;  4WWN A;  3O13 A;  1FXI A;  3Q3N C;  3VXW A;  2PE6 B;  4IM2 A;  3GZN B;  3P1M A;  3M63 B;  3R66 C;  3ZVV A;  2K3U A;  2HTM E;  2LJ5 A;  1WH3 A;  3AEE B;  4FAD A;  1WM3 A;  2IO3 B;  4MDK E;  4HVB A;  3H1U A;  3QK0 A;  3AED B;  3LYY A;  4LJO B;  2KNB A;  2J4X A;  2BGF A;  2YLM A;  4WWP A;  3L10 B;  4C4V B;  1XT9 B;  4MSQ B;  4RMA A;  2LFI A;  2MJE A;  2BYF A;  3JW0 X;  3S2A A;  3NVW A;  3ZJV A;  1Z5S B;  1T0Y A;  2IY0 B;  1V81 A;  3NVZ A;  2V0G A;  4C7Z A;  1VR9 A;  4BBN F;  2JT4 B;  2IZV B;  1WM2 A;  3A9K A;  1JWU D;  2X8X X;  3V6E B;  3HM3 A;  2IO1 B;  2EEL A;  3QQ8 B;  1LO5 D;  1ZE3 D;  2M56 B;  4IWQ A;  1SB3 C;  1OTR B;  4J3O D;  3VTU A;  2MJ3 A;  3MC9 A;  2JZZ A;  4B0E A;  3RUI B;  4JGH B;  3LB8 C;  1E10 A;  5J18 A;  5H8Y E;  4FXC A;  2MBH A;  4DBG A;  2IDY A;  4LLG M;  3ENE A;  5BYS A;  2QDF A;  4AJW A;  1WRI A;  4O1N A;  2IO2 B;  4RFB A;  4L2Y A;  3ZXR A;  2D5G A;  3PRM B;  4TQ0 A;  1OQY A;  3ZDM C;  3IBE A;  4US8 A;  2XBB C;  1IGC A;  2PLP A;  2KK8 A;  3TJP A;  1L5P A;  2MEK A;  2OJW A;  3NUH B;  2C7N B;  3OJ3 A;  3L4P A;  3BIN A;  1IGD A;  3Q69 A;  4NPN A;  2LGI A;  4BBN C;  2WXI A;  2FIF A;  2J42 A;  1L0Y B;  2WWZ A;  4NNJ B;  4LDT D;  3E9S A;  2WDQ B;  5D3I B;  1VJK A;  2BPS A;  1WE7 A;  5IOI A;  4AWJ A;  3BWU D;  5IP4 D;  2VRR B;  2AWT A;  1N60 A;  1XD3 B;  1WE6 A;  2DX5 B;  4OVV A;  2NBW B;  1OQR A;  1SIJ A;  2IYD B;  2GI9 A;  4KGT A;  3DQV A;  1WJN A;  1YN4 A;  3VR9 B;  3APF A;  4GU2 A;  3H7P A;  3GE3 C;  1MHX A;  3AE8 B;  3NS8 A;  3W5V B;  3ZLZ A;  4LTU A;  1UZX B;  2Q5W D;  5GMV A;  3SHQ A;  2PJH A;  2FID A;  3B2G A;  4A20 A;  2JRI B;  3ZYY X;  1SE2 A;  2K22 A;  1HE8 A;  4NZL B;  4LDT B;  1V86 A;  1WMH B;  5T8I A;  4IC7 B;  4UDU C;  1RLF A;  3R7Q A;  3PZ7 A;  3B1L X;  3W1Y A;  1E9M A;  2L00 B;  4WQO B;  5EDS A;  5BYR A;  4WAF A;  2LVP A;  2WLB A;  1D5X C;  5BO4 B;  2WXG A;  5FR6 A;  2MBB B;  3ZJU A;  1P9D U;  2FCM A;  2DYB A;  2JX5 A;  4HJK A;  1J7B A;  1RRB A;  1E5W A;  1Y56 A;  3ZGZ A;  4TMA B;  1N5W A;  2HD5 B;  4IUM B;  1GG3 A;  1K8R B;  2ONQ A;  2MP2 A;  4MH0 E;  2QMT A;  1WGD A;  1EWY C;  2WGS A;  3VTV A;  1SIF A;  1ACC A;  2J52 A;  2KFK B;  4CO7 A;  2L0T A;  4CHK A;  4WJQ A;  3DBR B;  1HTQ A;  4JQW C;  2UWQ A;  2MSE D;  3K9O B;  1HZ5 A;  1V80 A;  1FEH A;  3CIR B;  2KWU B;  1SJH D;  2NPT A;  4OHJ A;  1MI0 A;  3AEA B;  3E56 A;  1XO3 A;  1RM6 C;  3KUC B;  4FUL A;  4N58 A;  3WAP A;  2G3Q B;  1S1Q B;  5I4D A;  1Q0W B;  4JLC A;  3RD2 A;  2Y5C A;  2JUO A;  3GZN I;  2DHZ A;  2HJ8 A;  3CST A;  1JWB D;  2V4I B;  3FIL A;  1ZKH A;  2UU7 A;  3P4Q B;  4KGS A;  3UIP B;  1G6J A;  4ZHP A;  1J7C A;  1GAQ B;  1PGB A;  2KQ7 A;  1C3T A;  3RN9 C;  4LNK A;  3V62 A;  3T3N A;  1V1P B;  2JYT A;  3Q8B A;  3R3M A;  2DYM A;  2MWS B;  2KC2 A;  4YTP B;  1X1M A;  1FXT B;  2JWU A;  1PQS A;  2LHE A;  2JXX A;  1YJI A;  2KWC A;  1RWS A;  1V8C A;  3N1X C;  4WJN A;  4XE0 A;  4N9F 4;  4W9D A;  3PRP B;  4XYC A;  4C7Y A;  1K50 A;  1UNS A;  4RH6 A;  1E8X A;  2PKO A;  3OWE B;  3BK1 A;  3M95 A;  3N9Y C;  2OJR A;  1WI0 A;  2W3R A;  1Q1O A;  1ZUD 2;  1L0X B;  2V4L A;  5C1Z A;  2DLB A;  1FNV A;  3AV8 A;  4GXB A;  3H6N A;  2LGY A;  2I1J A;  4MJS B;  2WQY B;  5D94 A;  4IDI A;  4HCN B;  4US9 A;  1JQ4 A;  1GB4 A;  3AU5 A;  3A33 B;  2UYZ B;  3JYU A;  5HKH A;  1PDX A;  2K9X A;  1QT9 A;  3SFE B;  4BFR A;  4AOF A;  3DHH C;  2KQ4 X;  1WX7 A;  3IXS A;  5KHO A;  2V1Y A;  1AWD A;  2KMC A;  5IA7 A;  4NAW B;  2CHZ A;  1WYW B;  2PVG C;  3DVN V;  4R3D A;  1T0Q C;  4A3P A;  4GIV A;  4ZOH C;  2KTR B;  2KAN A;  3WAO A;  3A9J B;  1ZXH A;  2KWV B;  3N1Z C;  4S17 A;  1YOV B;  3QC8 B;  2ON8 A;  4WIP A;  4ACF A;  2I38 A;  2KWD A;  4KVG B;  1IPG A;  1YN3 A;  2JF5 A;  2INC C;  3Q3O C;  3KW5 B;  4KIK A;  1WGR A;  4A55 A;  1AN8 A;  3KYD D;  3L16 A;  1LQB A;  1V5O A;  1EUV B;  1LM8 B;  4JWU C;  1F2R I;  1LXD A;  1RAX A;  1NI3 A;  1C76 A;  4G50 A;  1T3Q A;  3RUL A;  2KJ6 A;  1GNU A;  3WCQ A;  2HDE A;  4WJO A;  3TEZ A;  1XCQ L;  3HUI A;  5L83 A;  5IAA C;  2M17 A;  4NY0 A;  4CQN A;  2WDT B;  4S0R A;  1WWT A;  2DZJ A;  5EE1 A;  3ZTC A;  2DZK A;  2HJ1 A;  3TSS A;  3A4S C;  3NVV A;  2M0X A;  3ZRF A;  3CMM B;  1R7S A;  1KLV A;  3A9K B;  2C5L C;  1AYF A;  2NCN A;  5D2M B;  2WNM A;  1FRR A;  3QAR A;  3RYT A;  4GGQ A;  2KFJ A;  2L1A A;  2D10 A;  1L6U A;  2I1K A;  1I42 A;  3U7D A;  2N9X A;  2MBO A;  4NJC A;  2EKE C;  2JZ3 B;  4KKI A;  4NJ7 A;  1EF5 A;  4DK5 A;  4DHZ E;  1SSN A;  5BMG A;  1WF9 A;  1WR1 A;  1HA5 A;  3L13 A;  5FR3 A;  1QOF A;  4GLS C;  1E0Z A;  2H88 B;  2B3A A;  2CU3 A;  1B1Z A;  3ZW3 A;  1V49 A;  5CX3 A;  1PGX A;  4MH8 A;  2KDB A;  1EF1 A;  2ACZ B;  2A4Z A;  1U4A A;  1A5R A;  2KDE B;  3JVZ X;  3D32 A;  3ZQ4 A;  1MVK A;  3H8H A;  2G45 B;  2N7E A;  4K3C A;  4YXD B;  1Q10 A;  2DAF A;  4RNA A;  1WYG A;  4K7S A;  5AUI A;  2CS4 A;  1HZ6 A;  2AEH A;  5JXV A;  4PT5 A;  1KJT A;  2REX A;  4B95 A;  2W82 A;  3DHG C;  5C3J B;  4KX6 B;  1XLP A;  2CHW A;  3C8Y A;  1HXY D;  3AB5 A;  5DCN A;  2LRU A;  3B0A A;  1OEY A;  4W9F A;  4JL9 A;  1KM7 A;  4KZ0 A;  3VUY A;  5LNK 1;  2QEJ C;  1FXA A;  3VUW A;  1JML A;  4BVU C;  3MJW A;  3V61 A;  2K6Q A;  3AE1 B;  3KWV A;  1ZPS A;  1MFW A;  3H7P B;  2EKI A;  3VRB B;  1E6E B;  1V5T A;  3APD A;  2ZZP B;  1OFF A;  1UWX A;  3CSF A;  3TL5 A;  1ZDX A;  1E90 A;  5BMH A;  2OOB B;  1TIF A;  5G5H A;  1YIW A;  3Q8E A;  5EE3 A;  3MP9 A;  1QF6 A;  3ZNG C;  4HPM B;  4XGA B;  1QKZ A;  1WJU A;  4KDI C;  3RMK C;  3N30 A;  1D3Z A;  3LXF A;  4XC2 A;  1EM7 A;  2X38 A;  2DYO A;  3DHI C;  4W9G A;  3TBL D;  2KLC A;  2CR5 A;  2RPQ A;  2WXQ A;  2GBJ A;  3Q8A A;  2Y3A A;  3P63 A;  5JHB A;  3VR8 B;  5L95 C;  5KHQ A;  3P4S B;  3SD5 A;  1FFV A;  3AN1 A;  2PEA A;  4MAC A;  5LXI B;  2LAS A;  1C79 A;  1QOB A;  4WJP A;  1IBX A;  1NYR A;  3RI7 C;  5JHA A;  4D2K A;  3DDC B;  2KX3 A;  2LHD A;  3V60 A;  1AAR A;  1SGH A;  2XN9 C;  3UIO B;  3W1S A;  2DZM A;  4MT5 A;  3ONS A;  3BK2 A;  3PVL A;  2GMI C;  3FC4 A;  2R2O A;  3IT6 B;  3ML9 A;  1ZXI A;  1F77 A;  4JPS A;  3VTW A;  1WXA A;  3AE4 B;  1I35 A;  4M01 A;  4HRO A;  2BF8 B;  4IWO A;  3HVZ A;  2Y5B B;  1MHH E;  2MP2 B;  1ROE A;  3Q8F A;  4MM3 A;  1D5M C;  1ENF A;  1F9J A;  2VH1 A;  2AL3 A;  3BVZ A;  3AM9 A;  4FJY A;  3B08 A;  2QC8 A;  3T9L A;  1F0Z A;  1F52 A;  1ESF A;  2K25 A;  2Y5P A;  3L54 A;  1I4H A;  1ET6 A;  1BUI C;  3RNE C;  3FAH A;  1JCK B;  4PK1 A;  1UUP A;  4B0M A;  1KTK A;  1WR6 E;  2DAJ A;  2DWQ A;  2NPT B;  4W9H A;  2KDM A;  2N4F A;  2LGD A;  3C19 A;  4A8X C;  1LFD A; 
#chains in the Genus database with same CATH homology
 2JPH A;  2L0T A;  4CHK A;  2XK5 B;  3M3J A;  4MGK E;  2BKR B;  3PPA A;  4WJQ A;  3IHP C;  5CHF A;  3Q3F A;  4JQW C;  2BKF A;  5CTR C;  2UWQ A;  1L2N A;  2MSE D;  4GB9 A;  4ANV A;  3K9O B;  2G4D B;  1TTN A;  5AZH A;  3PRE A;  3VUX A;  1V80 A;  2KKC A;  2J7Q B;  3PLU A;  4YL8 A;  2J0K A;  2ZJD A;  3WAM A;  1BT0 A;  3PGE A;  2KWU B;  2ZPN A;  2NPT A;  3UIN B;  2BYV E;  3WA0 A;  1VCB A;  2L7R A;  4FUL A;  3KUC B;  2KFK A;  3WAP A;  1UBI A;  2G3Q B;  2ZVN A;  2XK5 A;  1UH6 A;  2MBE A;  1WFY A;  1S1Q B;  3ZTD A;  2RD0 A;  3VFK A;  4B6W A;  2N9E B;  1Q0W B;  4JLC A;  3RD2 A;  1YQB A;  2KLG A;  3KUD B;  3DPD A;  3PSE B;  4CYE A;  2ASQ A;  1V6E A;  4KSL C;  2JUO A;  1P3Q U;  3DOW A;  2DHZ A;  3GZN I;  3HK0 A;  2JY6 A;  2HJ8 A;  2MCN B;  2KMA A;  3CST A;  2L3Z A;  4EZK A;  3AI5 A;  2LGX A;  4BKS D;  3ZKJ C;  1UBQ A;  2NBU A;  4F1S A;  3H9D A;  1NI2 A;  4HCP B;  1J8C A;  2NR2 A;  1ZKH A;  2MQJ A;  3UIP B;  2KX0 A;  4OVU A;  3W1S C;  3KVF B;  1WGY A;  1G6J A;  2LWP A;  3JSV B;  2KQ7 A;  4JIO U;  2D3G A;  3VVW B;  1C3T A;  2HE7 A;  3OAW A;  4E3C A;  1P0R A;  3V62 A;  2K39 A;  3R3M A;  2DYM A;  2JWZ A;  2MWS B;  4GMV A;  1V2Y A;  2KC2 A;  1YX5 B;  1X1M A;  3EEC A;  3UGB B;  1FXT B;  2HTH A;  4IM0 A;  1PQS A;  2LXA A;  2WX0 A;  2JXX A;  2KWC A;  2BWE S;  3VQI A;  1RFA A;  3DBS A;  1WZ0 A;  4PS8 A;  4ASW C;  4K81 A;  3O65 B;  3PRZ A;  1JRU A;  4WJN A;  5E6O A;  2JRH A;  1WGG A;  4N9F 4;  3JSV A;  4W9L A;  4W9D A;  3PRP B;  4ZRI A;  2C60 A;  3SU8 X;  5DPR A;  4DHJ D;  1YJ1 A;  4BOS C;  2CHX A;  3QHT A;  4K1R B;  2Z0E B;  2NBV B;  4I6L B;  2R2Q A;  3MHS D;  4EZJ A;  1XQQ A;  3V6C B;  3TIX A;  1WXV A;  1ZW7 A;  1H8C A;  1E8X A;  3RCZ A;  3DBL I;  1QZE A;  2ZNV C;  1WXS A;  3ML8 A;  3QA8 A;  2EMT A;  3M95 A;  3HM6 X;  3I3T B;  2DEN B;  2OJR A;  4KDL B;  1WI0 A;  1Q1O A;  1V9J A;  1WJ4 A;  2V4L A;  5C1Z A;  1CMX B;  4BKT A;  4PYU A;  2AL6 A;  3VH3 B;  3WAL A;  3PHW B;  2KO3 A;  3PHX B;  2KDF B;  4GXB A;  3H6N A;  3LDZ E;  5E6N A;  2LGY A;  2N9P C;  2V3S A;  4GDL B;  4LJP B;  2I1J A;  4MJS B;  1H4R A;  2MLB A;  4RM9 A;  5D94 A;  3RZF A;  1M94 A;  3UF8 A;  2LI5 A;  4HCN B;  1WIA A;  4EEW A;  3AU5 A;  1EO6 A;  3A33 B;  2UYZ B;  3JYU A;  3TCA A;  4EFO A;  5HKH A;  2J0M A;  1UEL A;  4E71 A;  2C9W B;  2YVC A;  1WJ6 A;  4MEM A;  4W9I A;  2GBR A;  3ZRC A;  4BFR A;  4AOF A;  4PS3 A;  2KZR A;  3QCA A;  4KV2 A;  2CKH B;  4MSM B;  2C7M B;  1WX7 A;  5KHO A;  3PZD A;  2V1Y A;  2KMC A;  1UGM A;  3AU4 A;  3NHE B;  5IA7 A;  2LZ6 A;  2CHZ A;  1WYW B;  4NAW B;  3PS6 A;  4MGI E;  4DHJ B;  3DVN V;  2GBN A;  4GDL A;  5D7G A;  3T8M A;  4B9K A;  1KOT A;  4KIK B;  4I6N B;  4MJS A;  2FCQ A;  4A3P A;  2LRW A;  2O6V B;  4GIV A;  4DWF A;  1YD8 U;  1E8Y A;  4ANX A;  3ZNI D;  3PTF C;  3ZNH B;  2KTR B;  2KAN A;  2IBI B;  2KC1 A;  4HXD A;  4WAA A;  2DZI A;  2M1M A;  3A9J B;  3WAO A;  4FA6 A;  3IVF A;  2KWV B;  2K8C A;  2WX1 A;  3QC8 B;  3NOB A;  2PE9 A;  4GSW A;  3APC A;  5AZF A;  2MBQ A;  3IG3 A;  1TBE A;  3A1Q A;  2KXJ A;  4F8C B;  4KVG B;  1IPG A;  4P7I A;  4NAW A;  1Q5W B;  2JF5 A;  4M8M A;  4DHZ B;  4M8N A;  2J0J A;  1TGZ B;  5DPW A;  5E6P A;  3KW5 B;  4KIK A;  1WGR A;  2LD9 A;  3KYD D;  2K8H A;  2O6V A;  3L16 A;  3A4R A;  1LQB A;  2N7D A;  3NY5 A;  4ZDV A;  2XEW A;  1P98 A;  1V5O A;  3U8Z A;  4ICV A;  1EUV B;  4TUU A;  1LM8 B;  3GOE A;  3H7S A;  4FJV B;  2Z0D B;  2KTR A;  5LLI A;  2ZPY A;  1LXD A;  3A9J A;  4EZL A;  1RAX A;  1J19 A;  2GOW A;  4G50 A;  3QWZ B;  2ZCC A;  3RUL A;  2KJ6 A;  2O2V B;  4W9K A;  1MG8 A;  1GNU A;  3AXC A;  2FCN A;  3ZUN A;  3NZS A;  4KSK C;  4URK A;  4TV3 A;  4WJO A;  4X57 B;  4NQL B;  4EUT A;  4TQ1 A;  4WWN A;  3KYC D;  1WZ3 A;  1WX9 A;  4ZYN A;  5L83 A;  3VXW A;  5IAA C;  2M17 A;  2PE6 B;  4NY0 A;  4IM2 A;  2KOX A;  4F7Z A;  3M63 B;  1WY8 A;  2WDT B;  3R66 C;  3ZVV A;  3OJ4 B;  2DZJ A;  2M4N A;  3ZTC A;  2DZK A;  2LJ5 A;  1WH3 A;  2QHO A;  3EHV A;  4DXA B;  4FAD A;  3A4S C;  1WM3 A;  2L76 A;  2M0X A;  3ZRF A;  3CMM B;  2IO3 B;  2O2V A;  4MDK E;  2AYO B;  5DPT A;  1P1A A;  2MRP A;  4HVB A;  3H1U A;  1KLV A;  3A9K B;  3QK0 A;  2C5L C;  1C1Y B;  2NCN A;  2KNB A;  2RR9 A;  4LJO B;  2BGF A;  1L7Y A;  5D2M B;  2YLM A;  3MTN B;  3QAR A;  4WWP A;  3L10 B;  3RYT A;  4AUQ C;  4ANW A;  1XT9 B;  4GDK B;  3KH0 A;  4MSQ B;  4RMA A;  2N1W A;  4GGQ A;  4GN1 A;  4ZRJ A;  2KFJ A;  4HK2 A;  4PYZ A;  2BYF A;  2EMS A;  2KTF A;  2D10 A;  3JW0 X;  4LCD E;  3S2A A;  2I1K A;  1VD2 A;  3X23 A;  1I42 A;  3U7D A;  2N9X A;  2MBO A;  1Z5S B;  3VH4 B;  2EKE C;  4II3 B;  1T0Y A;  2IY0 B;  1V81 A;  2JZ3 B;  4NJ7 A;  2WYQ A;  1EF5 A;  5AEK B;  4BBN F;  3PV1 A;  5J2R A;  2JT4 B;  2IZV B;  2K1F A;  4DHZ E;  4BKG A;  4DK5 A;  1WM2 A;  3UQA A;  3A9K A;  2NS5 A;  4ICU A;  4AP4 C;  1GC6 A;  1WF9 A;  1WR1 A;  3L13 A;  3V6E B;  1IYF A;  3HM3 A;  2IO1 B;  4GDK A;  3QQ8 B;  1GUA B;  4FHJ A;  1WGH A;  4IWQ A;  4FLH A;  4CO7 A;  4NQK E;  1OTR B;  2B3A A;  4E74 A;  3VTU A;  5JZE B;  3ZW3 A;  2JZZ A;  1V49 A;  3UQB A;  5CX3 A;  3RUI B;  3CF6 E;  4JGH B;  5AZG A;  2JVC A;  2NVU I;  5J18 A;  3KUZ A;  2FNJ B;  4BKS A;  2KDB A;  1EF1 A;  2KHW B;  2A4Z A;  1U4A A;  2FUH B;  1R4M I;  2MBH A;  4HPL B;  1A5R A;  4DBG A;  4HLE A;  1TZ1 A;  2KDE B;  3JVZ X;  4XX5 A;  3D32 A;  3ENE A;  4AJW A;  2G45 B;  2IO2 B;  2CU1 A;  2N7E A;  3M62 B;  4IWP A;  4G0N B;  2KJH B;  3L17 A;  2DAF A;  4MEL A;  3WAN A;  3AUL A;  1S3S G;  2KD0 A;  3PRM B;  2M8S A;  5J17 A;  4K7S A;  3QX1 A;  3R7R A;  4TKN A;  1OQY A;  4TQ0 A;  3ZDM C;  2CS4 A;  4A3O A;  2AEH A;  3IBE A;  2G4S A;  2XBB C;  1KJT A;  2REX A;  2K6D B;  4B95 A;  2KK8 A;  2KJR A;  3TJP A;  2D07 B;  2CHW A;  2C7N B;  3OJ3 A;  4WWO A;  5DCN A;  3BIN A;  2LRU A;  3B0A A;  2N1V A;  1OEY A;  4NPN A;  4W9F A;  3LJ3 A;  2IO0 B;  4JL9 A;  4BBN C;  1KM7 A;  4KZ0 A;  5TR5 A;  2FIF A;  3VUY A;  5LXH A;  4BOZ B;  2BWF A;  2C7H A;  2WWZ A;  3ALB A;  3EFU A;  4NNJ B;  3VUW A;  3NZU A;  4BVU C;  4LDT D;  3MJW A;  3V61 A;  2K6Q A;  2KDI A;  3SDL C;  4RM8 A;  1SE9 A;  4EKU A;  3ZDT A;  2D11 A;  2BPS A;  3X0W A;  4I6P A;  3TMP B;  4HDQ A;  1WE7 A;  3H7P B;  1Y8R C;  4AWJ A;  1GC7 A;  1V5T A;  3APD A;  2ZZP B;  2VRR B;  2AWT A;  1XD3 B;  1WE6 A;  3CSF A;  2LXC A;  3TL5 A;  2DX5 B;  4OVV A;  1E90 A;  2NBW B;  4GOC A;  2OOB B;  4EOY A;  3PT2 B;  1YIW A;  2MA9 B;  4DDG D;  2LVO A;  2MW5 A;  2IYD B;  2ZEQ A;  3ZO5 B;  3ZNG C;  4HPM B;  4FHK A;  1WJU A;  4AJY B;  3N32 A;  3QAQ A;  3BY4 B;  4KDI C;  3ZNZ B;  3K9P B;  3RZW C;  1J0G A;  2W9N A;  3N30 A;  3IFW B;  1D3Z A;  4KZC A;  3DQV A;  1WJN A;  4XC2 A;  3PLV A;  1NDD A;  1OEY J;  3APF A;  2ZCB A;  4GU2 A;  3H7P A;  1UD7 A;  1ZGU B;  2DYO A;  1IP9 A;  4HDO A;  4J6I A;  4W9G A;  3TBL D;  5C23 A;  3QJZ A;  2KLC A;  3L08 A;  2CR5 A;  3NS8 A;  3U30 A;  3ZLZ A;  1UZX B;  5GMV A;  2RPQ A;  3SHQ A;  2GBJ A;  2PJH A;  5JHB A;  1WX8 A;  2FID A;  4II2 B;  5L95 C;  5KHQ A;  3SD5 A;  4A20 A;  4K7U A;  2PEA A;  4W9C A;  2JRI B;  3DCG A;  5CHV C;  5LXI B;  2LAS A;  4MGY E;  5D6J B;  2L0F A;  2ZVO A;  4FBJ B;  1HE8 A;  2KN5 A;  4LDT B;  4WJP A;  2LVQ A;  4ANU A;  2KVR A;  1V86 A;  5JHA A;  5G2N A;  3DDC B;  2KX3 A;  2K8B A;  3P2B A;  3V60 A;  1AAR A;  1WMH B;  3VDZ A;  1SGH A;  2FAZ A;  3W1S A;  3UIO B;  2DZM A;  2BYE A;  3ONS A;  4PS7 A;  2GBM A;  3DVN U;  4XZ4 A;  4IC7 B;  3PVL A;  1YX6 B;  2GMI C;  1RLF A;  2R2O A;  1E7V A;  3R7Q A;  4IM3 A;  2O6V D;  3B1L X;  3ECI A;  3ML9 A;  3W1Y A;  2L00 B;  1E7U A;  3DBH I;  4DDI D;  3VTW A;  1WXA A;  3EC8 A;  1I35 A;  2ZNV B;  4FN2 A;  4WQO B;  2BF8 B;  4IWO A;  3Q3J A;  3VHT C;  4IW0 A;  1R4N I;  5EDS A;  2IY1 B;  2LUE A;  2Y5B B;  2MP2 B;  2L05 A;  1WXM A;  2LVP A;  3HIZ A;  4MM3 A;  4W9J A;  4FJZ A;  5BO4 B;  1WMH A;  2FCS A;  3VAW A;  5JH5 C;  5FR6 A;  1F9J A;  2MBB B;  3DVG X;  1ISN A;  3C0R B;  2AL3 A;  3HHM A;  4ZRK A;  1P9D U;  2RSU A;  4FJY A;  4W9E A;  1NBF C;  3B08 A;  3T9L A;  2FCM A;  2DYB A;  2K25 A;  1OGW A;  4HJK A;  2RGF A;  1GJZ A;  2GBK A;  4M0W B;  3L54 A;  1Z2M A;  1RRB A;  3WIM A;  1E5W A;  2L8J A;  4HWI B;  5DPS A;  3DVG Y;  5G55 A;  3OLM D;  1WRD B;  3QIJ A;  3DBR I;  2HD5 B;  4IUM B;  4NJ6 A;  1GG3 A;  4G3X B;  1K8R B;  2Z59 B;  3RT3 B;  2MP2 A;  5CHW A;  4MH0 E;  3ZIM A;  1WR6 E;  2KQS A;  1WGD A;  2DAJ A;  2NPT B;  4W9H A;  3VTV A;  2A5U A;  2D2Q A;  3A1Q B;  2PPH A;  1SIF A;  2MX2 A;  1E8W A;  2N4F A;  3L0W B;  4MGZ E;  2LGD A;  1E8Z A;  4IG7 B;  3N3K B;  1LFD A;  2KFK B;  4K7W A;  4G11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...