2FCMA

X-ray crystal structure of a chemically synthesized [d-gln35]ubiquitin with a cubic space group
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
73
structure length
72
Chain Sequence
LQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Dissecting the energetics of protein alpha-helix C-cap termination through chemical protein synthesis.
pubmed doi rcsb
molecule tags Structural protein
total genus 23
structure length 72
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2fcmA00
2KJRA 3ZDMC 2O6VD 2L05A 4MJSB 2CKHB 3ZW3A 2ZNVB 4W9DA 1J0GA 1XT9B 2PJHA 3R7QA 2AL6A 4FN2A 4ANUA 1J8CA 2IO2B 4A20A 1Q1OA 4TV3A 2ZVNA 2K39A 5DPWA 4BFRA 4WJPA 1WGDA 2KKCA 3DVGX 4I6PA 3QHTA 1R4MI 3ZRCA 4DHZE 2JF5A 3ZTDA 3DOWA 4HPMB 1IYFA 5AZGA 1Z5SB 2GBRA 5JZEB 2MBBB 2NBVB 1P9DU 4KSLC 5CX3A 2W9NA 2RD0A 5HKHA 2K8HA 2LRWA 3NS8A 2RR9A 2WX1A 1AARA 3OJ4B 3LDZE 2KNBA 2A4ZA 1RFAA 5TR5A 1WM2A 4OVUA 2LI5A 2Z0EB 1OTRB 1Y8RC 4W9KA 4WWPA 3VFKA 3VUYA 2G4DB 3A1QB 5EDSA 2DENB 3TJPA 2R2OA 4CHKA 2IBIB 4KVGB 4GIVA 5CHFA 3M63B 1WJNA 3QWZB 5FR6A 3ZO5B 2N4FA 3UF8A 5DPTA 1WJUA 3WAOA 4KSKC 2MLBA 2LASA 4IC7B 2MSED 4KZCA 1S1QB 2HJ8A 2KWUB 3ONSA 1WJ6A 1VCBA 3SD5A 4MM3A 1TGZB 1V5TA 4EEWA 2IO3B 3EHVA 2K8CA 5KHQA 3PZDA 2KC1A 4BBNF 4ZRJA 4HCNB 2XEWA 4EOYA 2KJHB 2AL3A 1E90A 3L17A 2IZVB 1NI2A 2EKEC 1OGWA 2G3QB 4IWQA 2KVRA 2KMCA 3A4SC 4EFOA 1GG3A 1WX7A 4IWOA 3WAPA 3QARA 3UQAA 4B9KA 2KFJA 2Z59B 3CSTA 3DVNV 4GN1A 4IM2A 2KWCA 3WALA 2AYOB 3W1SC 4KZ0A 3P2BA 3EECA 3VTWA 2LZ6A 1V5OA 3GOEA 3AXCA 5IA7A 2BF8B 4G11A 2AWTA 3DBSA 2ZCBA 1IP9A 3KYDD 1K8RB 1ZKHA 2KX3A 4MELA 1L2NA 1EO6A 1X1MA 3OLMD 2NR2A 1EF5A 4LCDE 2J0KA 2ZPNA 1PQSA 5IAAC 3OAWA 3Q3FA 5L95C 1XQQA 4W9EA 3ML8A 4JL9A 1YD8U 3AU5A 2PEAA 2ZNVC 3TBLD 2FUHB 2IO0B 2DAFA 1KOTA 2JWZA 4HDQA 2ZVOA 3BINA 1YJ1A 3KW5B 4AP4C 3V61A 3WA0A 1GJZA 2HD5B 2DYBA 3DPDA 4HCPB 3K9PB 3A4RA 2FIFA 1WX8A 3L08A 3V6CB 3ZNHB 3ENEA 1P0RA 1UH6A 3IHPC 4BKSD 1P1AA 2WDTB 1TBEA 3PVLA 2JRHA 3H7PA 1YQBA 4BBNC 2D07B 4FJVB 5JHBA 3PHWB 3N32A 4E3CA 1D3ZA 1J19A 1G6JA 1GC6A 2PE9A 1SE9A 4ANWA 2K6QA 2LGXA 1XD3B 2K6DB 3ECIA 4BOSC 1WGHA 4DBGA 4ZRIA 4X57B 4WJNA 4FADA 5AEKB 2GBKA 3H7PB 3PSEB 2BPSA 3QA8A 2MW5A 4NAWA 4NJ7A 2MX2A 5GMVA 3RULA 2LGDA 4WWNA 3ZIMA 2IY1B 2L8JA 2L0FA 2KMAA 3APFA 3DDCB 4P7IA 2O2VA 3TMPB 2OJRA 4AUQC 2KFKA 3ZTCA 3I3TB 3W1YA 1WE6A 4CO7A 3VUWA 3PREA 4NAWB 4LJPB 3APCA 3VHTC 4FULA 2J7QB 3LJ3A 4E71A 2KQ7A 1V49A 2PE6B 4ANXA 2O2VB 3ZNZB 2KFKB 1V86A 1EF1A 1BT0A 3Q3JA 4NPNA 3V6EB 2R2QA 4GSWA 3AI5A 4E74A 2DZIA 4EZLA 1C3TA 1QZEA 4KDIC 2KLGA 2LWPA 4XX5A 4KIKA 2DZMA 2NBWB 1JRUA 2FIDA 1ISNA 4JIOU 3X23A 2NBUA 3GZNI 2L0TA 2D3GA 2MRPA 3A1QA 4K7WA 4ZYNA 3VUXA 4DDGD 5C1ZA 4MGZE 3DVNU 1KJTA 4KIKB 1P98A 2C60A 3VTUA 3QX1A 5E6PA 2KC2A 3A9KA 1UBIA 4PS7A 4FHJA 3ZNGC 1VD2A 2OOBB 1E5WA 4F1SA 5AZHA 3RZWC 3VXWA 2KO3A 3WANA 4LDTB 3A9KB 2LVQA 2K25A 1WGGA 3KUDB 2L76A 4BKSA 4MSQB 1RAXA 4B6WA 4HVBA 4AWJA 2NCNA 2EMTA 2FCNA 2KHWB 4GDKA 5J2RA 2Y5BB 3O65B 4AJYB 1MG8A 2K1FA 4J6IA 3H9DA 2LUEA 2BWES 3WAMA 2G45B 2FCSA 5L83A 2WWZA 3DVGY 1GC7A 2D2QA 2KN5A 3PTFC 2V3SA 4GDKB 2JZ3B 1T0YA 4NJ6A 1WM3A 3NZSA 4ZDVA 1GUAB 4HK2A 4FLHA 4IM0A 4ICVA 2NPTA 4MH0E 4JGHB 4W9IA 3AULA 1WZ3A 3RCZA 4F8CB 1NDDA 2CHZA 1WIAA 3VVWB 4A3PA 2J0MA 1E8XA 1WGRA 2NPTB 2ZCCA 2N7EA 2C9WB 3PT2B 4GDLA 2IYDB 2L00B 2XBBC 3RYTA 3HHMA 3VH4B 2MBOA 5DPRA 4W9HA 2MWSB 4DHJB 1S3SG 2MQJA 2D11A 2A5UA 3PLUA 3U30A 1H4RA 3KUCB 1WI0A 3PRZA 4GDLB 1GNUA 3ZUNA 5JH5C 4WJQA 2KTRA 2K8BA 1LQBA 3PV1A 3NOBA 2KDEB 4DWFA 3QIJA 2MP2A 3B0AA 1WRDB 4MGYE 4LDTD 2AEHA 4W9CA 4EZJA 1WMHA 3RZFA 5JHAA 1WXSA 2DYMA 3ML9A 2KK8A 2KANA 2KTRB 3BY4B 4HLEA 2MP2B 2QHOA 1UZXB 2C7NB 2CU1A 4HDOA 2ZJDA 2CHXA 4B95A 2M4NA 1KM7A 2CHWA 2L3ZA 1F9JA 5DPSA 2VRRB 4HWIB 2YVCA 1WMHB 2CS4A 1C1YB 4OVVA 4G3XB 1WYWB 4KV2A 2ZZPB 1Q5WB 4GOCA 2ZEQA 4MGKE 4W9GA 3RUIB 1Z2MA 3SDLC 4FJYA 3D32A 3UINB 2LRUA 3JSVA 2WYQA 3MJWA 2FCQA 2JRIB 2GBNA 2JUOA 1Q0WB 1OEYA 5G55A 2EMSA 2MBQA 1UBQA 3W1SA 4K7SA 2BKRB 4DXAB 3TCAA 1WR1A 4RMAA 2L7RA 1V81A 2XK5A 5E6NA 5LLIA 2KWVB 4BKTA 3JSVB 1WR6E 5E6OA 1WFYA 3VH3B 3V62A 2HTHA 2RGFA 3CMMB 2UYZB 2MBEA 3HIZA 4HJKA 3K9OB 3N30A 1E8YA 3CSFA 1RLFA 1UGMA 1WF9A 1IPGA 2CR5A 2JT4B 3V60A 2M0XA 2XK5B 3PRPB 5DCNA 1I35A 3HM3A 4DHJD 4NQKE 3X0WA 2GOWA 2N9XA 4GXBA 2N7DA 4TQ0A 3EC8A 3NHEB 2NVUI 4F7ZA 3KVFB 4G50A 3VTVA 3WIMA 4AJWA 3PLVA 3QCAA 3DBRI 1UD7A 1E8ZA 2BYEA 1WJ4A 2DX5B 4M8NA 1E7VA 3M3JA 4IG7B 5LXIB 1V80A 2KQSA 1WZ0A 4IUMB 5J17A 3ZLZA 1WE7A 3B1LX 4EUTA 2PPHA 2BGFA 2LXCA 4G0NB 5D6JB 1FXTB 1SGHA 2Z0DB 1M94A 4RM8A 1KLVA 3H1UA 2DZKA 2MCNB 4WJOA 4A3OA 1H8CA 2KZRA 3NZUA 2RPQA 3IG3A 2M17A 3M95A 3PHXB 3R7RA 4DHZB 1WX9A 4IW0A 3UIPB 1ZGUB 1P3QU 1ZW7A 3PRMB 5AZFA 3A9JA 4JLCA 3U8ZA 2G4SA 3JYUA 2LVOA 3ZVVA 2KOXA 2LJ5A 3TL5A 4GU2A 4ASWC 2KLCA 3APDA 1A5RA 4NQLB 2KJ6A 2JZZA 3AU4A 2JVCA 3JVZX 4W9FA 4MEMA 2UWQA 1WXMA 3A9JB 3VQIA 1WXAA 4WQOB 1RRBA 2KDFB 4N9F4 1TTNA 2KDIA 2J0JA 4GGQA 4K7UA 3MTNB 3A33B 4IWPA 3QJZA 4MSMB 3SU8X 3PS6A 2FNJB 2LXAA 3IBEA 1WGYA 4PYUA 4PS8A 2LGYA 2GMIC 1R4NI 3DBLI 4I6NB 4M8MA 1WH3A 2BWFA 1WXVA 2ASQA 3L54A 4GMVA 3C0RB 3DCGA 3PPAA 2I1JA 5G2NA 4FA6A 4I6LB 4BOZB 3CF6E 3HM6X 4II3B 2FCMA 2DZJA 2BKFA 1YX6B 3DBHI 4LJOB 1U4AA 3JW0X 3M62B 2KD0A 4GB9A 1V2YA 1OEYJ 2GBJA 3N3KB 4FHKA 4W9JA 2RSUA 4HPLB 2WX0A 2MA9B 3QQ8B 4BVUC 1L7YA 2M8SA 2N1WA 3UIOB 1LFDA 1OQYA 2JY6A 2MBHA 2O6VA 4K1RB 4MDKE 4TKNA 4EZKA 1E7UA 5LXHA 3QC8B 4DK5A 4ICUA 2C7HA 3TIXA 4FBJB 3IFWB 4WWOA 2DHZA 4YL8A 1YX5B 2M1MA 1WY8A 4HXDA 4TUUA 4IM3A 3R66C 3OJ3A 1UELA 3KH0A 3H6NA 5CTRC 3L0WB 4KDLB 2O6VB 4NY0A 5KHOA 3L10B 4EKUA 2I1KA 3S2AA 4BKGA 4DDID 3R3MA 2C7MB 2N9PC 5C23A 3HK0A 2DYOA 1TZ1A 2JPHA 3IVFA 4NNJB 1CMXB 3ZNID 3ALBA 4AOFA 3PGEA 5CHWA 1V6EA 3UQBA 3ZDTA 4MGIE 1E8WA 4W9LA 4WAAA 5CHVC 2BYVE 1EUVB 3VAWA 4RM9A 5J18A 4TQ1A 2YLMA 4XC2A 2BYFA 4K81A 2KDBA 2N9EB 3EFUA 3NY5A 4JQWC 5D2MB 1I42A 2NS5A 2LVPA 3T8MA 4M0WB 1LM8B 2D10A 1HE8A 5D7GA 1V9JA 3B08A 3VDZA 4ANVA 3QAQA 4PYZA 3L13A 3RT3B 3T9LA 3MHSD 3QK0A 5BO4B 2ZPYA 2HE7A 3RD2A 2C5LC 3SHQA 3ZKJC 2GBMA 2KTFA 2LD9A 2V4LA 2B3AA 2KX0A 4II2B 4XZ4A 3U7DA 4PS3A 3ZRFA 2IY0B 3DQVA 2KXJA 1SIFA 4ZRKA 4FJZA 1LXDA 4MJSA 1NBFC 4CYEA 3H7SA 2V1YA 2REXA 5D94A 3KYCD 4URKA 1YIWA 2DAJA 2JXXA 2FAZA 3KUZA 2N1VA 3UGBB 2IO1B 3L16A
chains in the Genus database with same CATH superfamily
2KJRA 2ZNVB 4W9DA 3N1ZC 3UI3A 1TYGB 2LGSA 2AL6A 4ANUA 4DXFA 3ZJUA 2K39A 4BFRA 2IPKD 4I6PA 4HPMB 2FUG1 5JZEB 1MHHE 1P9DU 1UGJA 3KWVA 5CX3A 1FD6A 1QLBB 2K8HA 1AW7A 5T8IA 1YJIA 2V9HA 2KNBA 3Q3NC 1YN5A 2DWQA 2LI5A 1Y8RC 3ZGZA 1XF5L 3A1QB 1WRIA 2DENB 1XCQL 4GIVA 3AE7B 5FR6A 3UF8A 1C79A 2MSED 4KZCA 2KWUB 2HJ8A 4YTPB 5C2TB 1E0ZA 2BQQA 3GP7A 3EHVA 2K8CA 2KC1A 3W2DA 2AL3A 1OQRA 1NI2A 2G3QB 2KVRA 1GG3A 4IWOA 2INDC 2Z59B 4OVZA 4IM2A 2K3UA 1R7SA 1E6EB 4G11A 2ZCBA 1SEBD 2KX3A 1L2NA 4LCDE 3OLMD 1EF5A 1D4BA 1XQQA 4W9EA 2FUHB 1KOTA 2D3BA 1GPXA 1GJZA 3V61A 2HD5B 1YQ3B 4HCPB 2JX5A 2K0PA 1FM0D 3DBLB 2FIFA 3ZNHB 3ENEA 4HROA 2WDTB 1TBEA 3H7PA 4BBNC 2D07B 4FJVB 5JHBA 1J19A 2D3AA 1SE9A 2LGXA 4HJGE 3QA8A 4NAWA 2MX2A 2BYTA 4WWNA 3ZIMA 3APFA 3ZTCA 3I3TB 5HI1A 3W1YA 5BYQA 1XO3A 4LJPB 5H8YE 3APCA 3VHTC 4FULA 4US8A 2J7QB 2J52A 1V49A 2O2VB 3I63C 2WXFA 1V86A 3AMZA 4NPNA 3V6EB 4E74A 2L32A 4XX5A 2KDMA 4A9AA 5HHDG 4JIOU 3X23A 4XWWA 3AH7A 2L0TA 3A1QA 3ZJTA 2NMQA 1SJHD 2C60A 3VTUA 1HEZE 3A9KA 3OWEB 3P1MA 5FK9C 1Y56A 2OOBB 4WAFA 2BVCA 2K25A 2WXKA 4MSQB 1VZ8A 1VZ7A 3IT4B 3O65B 5G5GA 1F2RC 2K1FA 4J6IA 4WH4A 2INNE 2LUEA 1T0RC 4L23A 2BWES 4ZOHC 3DVGY 4N59A 2LHEA 2JZ3B 1T0YA 3NZSA 2V3PA 1GUAB 3AE2B 1ZP0B 4S0RA 1XLNA 4LTUA 4MH0E 4JGHB 3AULA 1XLPA 1MVKA 3RCZA 4F8CB 1NDDA 1KH0A 1WIAA 4ZHOA 4XGAB 2NPTB 2ZCCA 2N7EA 1XCTL 1C4AA 2XBBC 4M01A 3RNAC 3RYTA 1R4MB 2MBOA 3DHIC 4XWTA 1DGJA 1S3SG 2KVZA 2A5UA 3PLUA 1T3QA 1GNUA 2KTRA 2K8BA 1LQBA 3PV1A 1FEHA 1PYWD 3B0AA 4UDUC 4LDTD 2AEHA 1JWBD 4TMAB 3AV8A 3ML9A 2KK8A 2KANA 2C7NB 2CHXA 4B95A 2M4NA 2VRRB 4HWIB 4OVVA 1WMHB 2CS4A 3SEBA 1C4PA 4KV2A 2BBCA 4W9GA 3RUIB 3SDLC 3D32A 3JSVA 1CJEA 2JUOA 1WWTA 2KN4A 5G55A 1SF0A 3VR8B 4RMAA 4BKTA 2WXOA 5E6OA 3AEAB 2GI9A 4WIPA 3CMMB 3R2IA 2KMMA 3K9OB 1RLFA 1UGMA 1IPGA 2WDQB 3V60A 2XK5B 4DHJD 4NQKE 4P1CC 2JYTA 2NVUI 1QOBA 1SBBB 1UD7A 1E8ZA 2BYEA 3TEXA 4IG7B 4IUMB 3LXFA 5J17A 1F52A 3I9V1 2PPHA 1XLOA 2BB6A 1FXTB 4BZAA 2Z0DB 1KLVA 2X38A 1H8CA 3M95A 1ZDXA 1IUEA 3MC8A 1P3QU 1ZW7A 5HFYA 5EE9A 2J4XA 1B1ZA 4XYCA 4ASWC 4RNAA 3BVGA 4NQLB 2KJ6A 4W9FA 1JRPA 3EFCA 3VQIA 3A9JB 2KYWA 1WXAA 1TTNA 4GGQA 3MTNB 4MSMB 3QJZA 3SU8X 3PS6A 4PYUA 2WP9B 4A90A 2LGYA 3DBLI 2BWFA 1WXVA 2ASQA 1KFYB 4BOZB 3EA6A 2GRIA 4KKIA 2DZJA 1YX6B 4YWGG 4MH8A 3M62B 2GBJA 3N3KB 4W9JA 3VRAB 1LFDA 1OQYA 2MBHA 5LXHA 2L52A 1L5PA 3TIXA 3IFWB 2DHZA 1YN3A 1YX5B 1PDXA 3DHGC 3OJ3A 4JWUC 4EKUA 4BKGA 2LFIA 2DYOA 1TZ1A 1CMXB 1LGRA 4AOFA 2IDYA 3ZDTA 1E8WA 3RNFC 5BYRA 1ZOYB 1EWYC 5IO9A 3ZQ4A 4KGSA 1OQQA 5D2MB 2JU6X 2M19A 2D10A 1T6BX 3B08A 3HVZA 1MFWA 3QAQA 3RT3B 1HQRD 2WXGA 3MHSD 5BO4B 1FNVA 2ZPYA 2JYEA 4C7ZA 3SHQA 1K50A 4ACFA 4PS3A 2KXJA 4YXDB 1QQRA 4MJSA 1NBFC 3IT6B 2I38A 3RPFC 2FAZA 1FXAA 2N1VA 3Q6BA 3L16A 3E56A 3ZW3A 1J0GA 4ZYSA 1QT9A 4FN2A 2IO2B 4A20A 2QIEB 1F0ZA 2ZVNA 5DPWA 4WJPA 2KKCA 2BS3B 4DXGA 1A70A 1R4MI 3BVZA 2JF5A 2DNFA 5D3DA 4DHZE 3ZTDA 5AZGA 3RI7C 2LRWA 5I4DA 1RFAA 4M02A 4A6QA 1OTRB 4W9KA 3VUYA 2WU5B 4WWPA 3VFKA 1TIFA 3W5UB 1MPEA 5EDSA 3NVZA 5CHFA 3ZO5B 1GOZA 2NTSA 2MLBA 4IC7B 4LNKA 1L4DB 1S1QB 3ONSA 4XDDA 1TGZB 1V5TA 1N63A 2IO3B 1UNSA 2V3NA 3RNBC 2IGHA 4EOYA 2M0AA 1E90A 1N61A 3L17A 4LLGM 1L0XB 3MFGA 3BYYB 3A4SC 3RN9C 3WAPA 3QARA 2KFJA 3DVNV 2AYOB 3GOEA 3V05A 5IN7A 5IA7A 1TKEA 1M4VA 1UWXA 3DBSA 1IP9A 1ZKHA 2E6XA 1X1MA 2J0KA 5IAAC 3OAWA 4JL9A 4RH6A 3B2GA 3ZXRA 2JWZA 4HDQA 2L1AA 5BMHA 3AE8B 3BK1A 2DYBA 5TSSA 3DPDA 1AYFA 3V6CB 4WWMA 1CQVA 4NAMA 4BKSD 2OHFA 3ZJVA 2IJ0A 1MI0A 3PHWB 3N32A 4L2YA 1GC6A 3BIID 4ANWA 1XD3B 3ECIA 4DBGA 4ZRIA 3N9YC 3PSEB 3H7PB 5GMVA 3RULA 1TS4A 2WXPA 1SE4A 2KMAA 4P7IA 1L0YB 2KFKA 1WE6A 1I4GA 4EE2A 1SXTA 4NAWB 2D3CA 2KQ7A 3MHZA 1BT0A 1C3TA 4EZLA 2KLGA 4KIKA 1ISNA 3GZNI 4DDGD 3BWUD 2JXTA 4YT0B 1KJTA 1P98A 2RDBC 1UBIA 4PS7A 2L83A 1SE3A 4FHJA 3U7ZA 1VD2A 4F1SA 4OZAA 3VXWA 2KO3A 3AN1A 4LDTB 1VLBA 2RDHA 3A9KB 1FNWA 1WGGA 2L76A 4B6WA 2FCNA 2NTTA 5J2RA 2Y5BB 1V8CA 1MG8A 4OZCA 4RGNA 4TSSA 3IXSA 4NJ6A 1CK1A 4IM0A 1F1HA 5E6JA 3IAS1 2WHIA 1YJJA 1HTQA 1KLUD 1C78A 5C3JB 3H8HA 4K3BA 2JSVX 2WXIA 4WQMA 1I4PA 3VH4B 4YSZB 2MWSB 4DHJB 2D11A 3BK2A 3FC4A 3KUCB 1WI0A 2G9HD 3ZUNA 4DWFA 2MP2A 2QILA 4HRSA 3ETRA 3RZFA 5JHAA 1JWAD 2DYMA 2W82A 1CZPA 2KTRB 1LO5D 4DQOC 1I4HA 1C1YB 2ZZPB 1Q5WB 4GOCA 1Z2MA 3Q2AC 2GBNA 1MJDA 1OEYA 1D5XC 2EMSA 2MBQA 2ZW0A 3W1SA 2BKRB 4A55A 3MC9A 1ZXIA 5E6NA 3L4PA 3JSVB 3HRDD 4H2AA 4J3OD 2RGFA 2UYZB 1E10A 2MBEA 3WCQA 3HIZA 1E8YA 1WF9A 4AQ7A 2KAJA 3HM3A 4FXCA 4ARCA 1I35A 2GOWA 4RCOA 1TS3A 2N7DA 3NHEB 4G50A 3PLVA 3AECB 2DX5B 1TY0A 4M8NA 3FAHA 4USAA 3ZLZA 4LNNA 2OEDA 3TSSA 2LXCA 1TZOA 1L6VA 4RM8A 4N6EB 3H1UA 4WJOA 1ZPSA 4A3OA 1YOVB 1I7HA 2KZRA 3AE4B 3NZUA 3R7RA 3PHXB 5H92C 3U52E 4DHZB 2N9KA 5AZFA 3U8ZA 3JYUA 2LJ5A 4OHJA 5EE1A 4JE3B 4NJCA 3LB8C 4YSYB 2M56B 4MEMA 1RRBA 4N9F4 3MC0B 2W3SA 4IWPA 3IBEA 1RWSA 1WGYA 2DLBA 4PS8A 3Q14C 2SAKA 3C0RB 2WDRB 2BS4B 3DCGA 2WS3B 1L0VB 2I1JA 4YSXB 2FCMA 3DBHI 3AEBB 3SFDB 1PGBA 2KD0A 4GB9A 1V2YA 1OEYJ 2RSUA 4HPLB 2MA9B 3DBRB 1ZDVA 2N1WA 5FR3A 3NRZA 2CJNA 4K1RB 4TKNA 3QC8B 4DK5A 4L1BA 1K51A 4FBJB 3AEDB 1ESFA 1WY8A 1FCLA 4TUUA 2X8XX 3R66C 3KH0A 5MPOA 3L0WB 3AE1B 4KDLB 3PZ8A 4NY0A 5KHOA 4REZA 3S2AA 1JWUD 3C8YA 2H88B 3HK0A 4NNJB 3ALBA 5CHWA 4LNFA 4WAAA 5LNK1 3E9SA 1EUVB 4TQ1A 3EFUA 3NY5A 4JQWC 1WYGA 2NS5A 4HPPA 3T8MA 4M0WB 1PUTA 2YEPF 1R4NB 1L4ZB 3L13A 3TUOA 2Q5WD 3VR9B 3PO0A 2GBMA 2KTFA 2V4LA 3ZRFA 2KX0A 4II2B 2N0SB 2ICIA 2IY0B 3DQVA 4CYEA 1HTOA 1RYJA 2REXA 3KUZA 3ZDMC 2L05A 1AWDA 4MJSB 2CKHB 1XT9B 2PJHA 5BMGA 1UF0A 3B9JA 1J8CA 2AQ1B 4TV3A 1N60A 1V97A 1WGDA 3DVGX 3ZRCA 1EWCA 1IYFA 1Z5SB 1FIQA 2RPVA 3R2TA 4HKQA 2RD0A 5HKHA 3NS8A 1C76A 1EU3A 2RR9A 1AARA 1ET9A 1NI3A 3OJ4B 3LDZE 4WURA 2A4ZA 3AE3B 4OVUA 2Z0EB 2WXJA 3TJPA 2IBIB 4KVGB 3GE3C 2WXRA 3M63B 3FILA 3QWZB 1I4QA 2N4FA 5DPTA 4KSKC 2LASA 1RFKA 4C56C 1DOIA 4MM3A 2VH2A 2WXQA 5KHQA 4ZRJA 2GB1A 3GB1A 4HCNB 1BXTA 1QKZA 2IZVB 2EKEC 4JPSA 3P4PB 1JWMD 2VZKD 1TKYA 5GXGB 3CSTA 3WALA 3W1SC 4KZ0A 3EECA 1V5OA 2R61A 3AXCA 5G5HA 2BF8B 1EO6A 1KF6B 2ZPNA 1PQSA 1E7PB 5L95C 1YD8U 1J7CA 2PEAA 1SE2A 4M0WA 2ZNVC 3TBLD 4YTMB 2IO0B 3BINA 1STEA 1YJ1A 3WA0A 3URYA 3RNEC 3TEYA 1WX8A 1TS2A 1NENB 1P0RA 3IHPC 1P1AA 4US9A 4E3CA 1G6JA 2K6DB 4BOSC 4X57B 4WJNA 2AQ2B 2PVGC 1ROEA 2IY1B 2L8JA 3DHHC 3DDCB 2WXMA 4AUQC 3NVVA 2MJDA 4CO7A 3PREA 3DWGC 2BW2A 4RFBA 1L6UA 1NYRA 2KT7A 3Q69A 3SFEB 4E71A 2N9LA 3ZNZB 2KFKB 1EF1A 2GLSA 3AI5A 1K53A 1XEEA 4KDIC 1N6ZA 2FIDA 3TEZA 1FFVA 3NZ3A 1OFFA 4ZYNA 2D3GA 3VUXA 4MGZE 2MJ3A 2K22A 3DVNU 4KIKB 1P7FA 3QX1A 5E6PA 2KC2A 2PTLA 2LGIA 4MACA 2LVQA 3KUDB 4BKSA 1RAXA 4HVBA 4AWJA 4IKGA 2KHWB 4GDKA 4AJYB 2Y5PA 1C4CA 2WWZA 1GC7A 2D2QA 3PTFC 3CIRB 2BS2B 2V3SA 1T0SC 4ZDVA 4LNIA 3T3OA 4ICVA 1GB1A 4W9IA 2RMMA 4ARIA 2PMVA 4A3PA 2J0MA 1E8XA 1WGRA 5IKCM 3PT2B 4GDLA 2WLBA 2L00B 3HHMA 4W9HA 4C80A 1EM7A 2V0GA 3BZDB 2RDGA 4RF0A 4WJQA 2KDEB 2XNAC 4RF1A 2KACA 1WRDB 2PIAA 4MGYE 2FBWB 1SB3C 5FKAC 1WXSA 1GB4A 2PLPA 3P63A 4HEA1 2MP2B 2CU1A 2ZJDA 3RNCC 1KM7A 2CHWA 1IGCA 4IOIE 2L3ZA 1F9JA 5DPSA 4G3XB 1V1PB 2ZEQA 4FJYA 3UINB 2LRUA 2WYQA 3MJWA 2JRIB 1UBQA 2UU7A 4DXAB 1WR1A 3R8BA 5IOIA 5LLIA 3VH3B 1WFYA 3V62A 1QOFA 1N5WA 3IAM1 3P4QB 5DCNA 2N9XA 4HKZE 3BVMA 4TQ0A 3EC8A 1DOXA 2MJEA 3KVFB 3VTVA 3WIMA 4AJWA 1AN8A 1WJ4A 3M3JA 1V80A 2LHDA 5BYSA 1WE7A 3B1LX 2BGFA 2AX5A 1ET6A 1M94A 2J53A 2ONQA 3HVDA 2RPQA 3ABVB 4R3DA 1ZGUB 1NEKB 1F2RI 4RGTA 4PK1A 2LVOA 2I2YA 3TL5A 4Q2JA 2KLCA 1Q10A 2JZZA 3AU4A 3J9CA 1P7EA 4C4VB 4B0EA 2UWQA 4WQOB 1WSPA 2KWDA 4K7UA 1SJED 1D5MC 4BAXA 2FNJB 1B9RA 4I6NB 4M8MA 1XXGA 2CU3A 4FA6A 4I6LB 4OZBA 2K5PA 2OJWA 3HM6X 1HZ6A 4P6VF 2BKFA 4NZLB 1QOGA 1C9FA 1JQ4A 2WX0A 3QQ8B 1L7YA 4YTNB 2MH7A 2JY6A 4MDKE 2O6VA 3P4RB 4EZKA 1E7UA 2FE8A 4ICUA 1E9MA 1D6EC 1UELA 5CTRC 3Q8EA 1HA5A 2G1EA 3L10B 3ZYYX 2I1KA 1DOYA 1V1OA 1VRAB 3R3MA 1V1PA 2N9PC 5C23A 2JPHA 3IVFA 3KWLA 2BTEA 1V6EA 3GE8C 2INCC 4W9LA 3VAWA 4RM9A 1XLQA 1J7AA 4K81A 2PW9A 2EELA 2MEKA 4O1NA 3B2FA 4S17A 3U4EG 1I42A 2LVPA 1HXYD 1HE8A 3EUB2 3VDZA 4PYZA 1EU4A 2HE7A 1UWMA 4HLEA 2QSDA 1ENFA 4ZRKA 4FJZA 1LXDA 3H7SA 2V1YA 5D94A 3KYCD 4URKA 2JXXA 1VR9A 1JWSD 1UUPA 3MP9A 2O6VD 2QEJC 2LMCA 3R7QA 1Q1OA 1ZE3D 3AE6B 4JX1C 1KTKA 4LNOA 2VZKB 3QHTA 1ZUD2 3DOWA 2GBRA 4C4VA 2Z8LA 2MBBB 2NBVB 4KSLC 2W9NA 4OW0A 3BYTB 1SSNA 2JQRB 2WX1A 3AE5B 1FFUA 2J42A 5TR5A 1WM2A 3HUIA 3NJTA 2G4DB 2QJLA 2R2OA 4CHKA 4P16A 2LEKA 4KKJA 1WJNA 1DYQA 2PKOA 1WJUA 3WAOA 3KQ4A 3AEGB 1JALA 3FKYA 2LUMA 2IGGA 2W54A 1WJ6A 1VCBA 2K9XA 2CJOA 3SD5A 3OG5A 3FILB 4EEWA 2XN9C 3PZDA 4BBNF 5EE0A 2XEWA 2MHJA 2KJHB 4MM3B 1OGWA 4IWQA 2KMCA 2HJ1A 1WXQA 1WX7A 4EFOA 1FXIA 3UQAA 4B9KA 1N5XA 1YMHE 4GN1A 2QDFA 2KWCA 3W5VB 3P4SB 2QCZA 3P2BA 3VRBB 1GAQB 3VTWA 2LZ6A 1FNUA 1F77A 2BB5A 2AWTA 1PGAA 3KYDD 1K8RB 4MELA 1BUIC 2NR2A 3Q3OC 3NS1A 3CWIA 4XDCA 3NVWA 3Q3FA 2QC8A 1JMLA 4JWSC 3ML8A 4N58A 3AU5A 2DAFA 4CQNA 2ZVOA 3KW5B 4AP4C 1MG4A 3K9PB 1IBXB 3A4RA 3L08A 1UH6A 3SR6A 2HTME 3AB5A 3PVLA 2JRHA 2JZPA 1YQBA 1TY2A 1D3ZA 2PE9A 5HG2A 2K6QA 1WGHA 2W3RA 4FADA 5AEKB 2GBKA 2BPSA 1QF6A 2MW5A 4NJ7A 2LGDA 2WXNA 2L0FA 4XE0A 1HZ5A 2WXLA 2O2VA 3TMPB 2OJRA 3VUWA 3RFZB 2E3TA 3NVYA 3LJ3A 1TKGA 4ANXA 2PE6B 1K52A 4A8XC 3Q3JA 2R2QA 4GSWA 2DZIA 3NG0A 1QZEA 2LWPA 2DZMA 2NBWB 1JRUA 2VH1A 3V3XA 4C00A 2NBUA 2MRPA 5C1ZA 4K7WA 2SEBD 3LYYA 1T5XD 4ZRPA 2PVOD 3ZNGC 1E5WA 2ON8A 1RM6C 5AZHA 3RZWC 5JXVA 3WANA 2DBYA 3I57A 2NCNA 2EMTA 1VJKA 3H9DA 1FRDA 3Q8FA 1TJEA 3WAMA 2G45B 2FCSA 5L83A 5D3IB 2KN5A 4ZRQA 4GDKB 1WM3A 3NUHB 4HK2A 1VDVA 2Y5CA 4FLHA 2NPTA 3O13A 4D2KA 1WZ3A 2CHZA 2ZW1A 4M00A 5AUKA 3Q3MC 1I4XA 3VVWB 1FRRA 2V4IB 2EKIA 2BT6A 1MHXA 2C9WB 2IYDB 2D5GA 1YN4A 2N7JA 5DPRA 2WQYB 2MQJA 2INPE 2WNMA 3U30A 4AS1A 1H4RA 3PRZA 3GZNB 4GDLB 3AEFB 5JH5C 3NOBA 3QIJA 1IBXA 2YEPB 4W9CA 4EZJA 1JROA 1WMHA 3W9CB 3BY4B 3N1YC 2QHOA 1UZXB 4HDOA 1PFDA 1PGXA 3GS2A 2YVCA 3DWMA 4ITKA 1NYQA 1WYWB 4MGKE 2H89B 1KLGD 2FCQA 1I4RA 1JW9D 2WXHA 1Q0WB 4P1BC 1QOAA 4K7SA 3TCAA 3C19A 2L7RA 1V81A 2XK5A 3Q8BA 2KWVB 1KRHA 1WR6E 5BMIA 2WU2B 1TS5A 2HTHA 1TT5B 4HJKA 3N30A 3CSFA 2CR5A 2JT4B 3P42A 2M0XA 1IGDA 3AM9A 3PRPB 3PZ7A 3X0WA 4GXBA 4GLSC 4RGMA 1NVID 4F7ZA 4KGRA 3QCAA 3DBRI 4LK0M 1E7VA 3EGRA 5LXIB 2KQSA 1WZ0A 3AE9B 4K3CA 4EUTA 4G0NB 5D6JB 1SGHA 2DZKA 2MCNB 3N1XC 1D5ZC 3IG3A 3Q8AA 2M17A 3Q8CA 1WX9A 4IW0A 3UIPB 3I5JC 2B76B 3PRMB 3A9JA 4JLCA 2G4SA 3ZVVA 2KOXA 2KQ4X 4GU2A 3APDA 5EE3A 1A5RA 3JVZX 2JVCA 3ZXVA 2HDEA 2IGDA 2LJIA 1WXMA 2KDFB 2KDIA 4IDIA 2J0JA 3A33B 2LXAA 1YQ4B 2GMIC 1R4NI 1WH3A 3L54A 4GMVA 3AEEB 1C77A 3PPAA 2W55A 5G2NA 1FMAD 1N62A 3CF6E 4KGTA 4II3B 1T0QC 4LJOB 1U4AA 1ZXHA 3JW0X 1FPYA 4QAYA 4FHKA 1JCKB 2QMTA 1FO4A 1FCCC 3TEWA 4BVUC 3KLSX 2M8SA 3UIOB 1SIJA 1VZ6A 2C7HA 3RMKC 1J7BA 4WWOA 4YL8A 2M1MA 4HXDA 3RNGC 4B0MA 4IM3A 1QILA 3H6NA 2O6VB 5IP4D 3T3NA 4RGOS 4DDID 4ZHPA 2C7MB 5AUIA 2JWUA 3ZNID 2WDVB 3PGEA 3UQBA 2ACZB 1YNTE 4MGIE 5CHVC 3N20C 2BYVE 4C7YA 5J18A 4KX6B 4MT5A 2YLMA 4XC2A 2Y3AA 2BYFA 2TSSA 2KDBA 2N9EB 1LM8B 3MJ5A 5D7GA 1V9JA 4ANVA 4PT5A 1BMLC 3T9LA 1ACCA 1WGKA 3QK0A 3RD2A 2C5LC 3ZKJC 2LD9A 2B3AA 3U7DA 4XZ4A 3DBHB 2WGSA 1SIFA 3U2SC 2AQ3B 1YIWA 2DAJA 3UGBB 2IO1B
chains in the Genus database with same CATH topology
2KJRA 3ZDMC 2O6VD 2L05A 4MJSB 2CKHB 3ZW3A 2ZNVB 4W9DA 1J0GA 1XT9B 2PJHA 3R7QA 2AL6A 4FN2A 4ANUA 1J8CA 2IO2B 4A20A 1Q1OA 4TV3A 2ZVNA 2K39A 5DPWA 4BFRA 4WJPA 1WGDA 2KKCA 3DVGX 4I6PA 3QHTA 1R4MI 3ZRCA 4DHZE 2JF5A 3ZTDA 3DOWA 4HPMB 1IYFA 5AZGA 1Z5SB 2GBRA 5JZEB 2MBBB 2NBVB 1P9DU 4KSLC 5CX3A 2W9NA 2RD0A 5HKHA 2K8HA 2LRWA 3NS8A 2RR9A 2WX1A 1AARA 3OJ4B 3LDZE 2KNBA 2A4ZA 1RFAA 5TR5A 1WM2A 4OVUA 2LI5A 2Z0EB 1OTRB 1Y8RC 4W9KA 4WWPA 3VFKA 3VUYA 2G4DB 3A1QB 5EDSA 2DENB 3TJPA 2R2OA 4CHKA 2IBIB 4KVGB 4GIVA 5CHFA 3M63B 1WJNA 3QWZB 5FR6A 3ZO5B 2N4FA 3UF8A 5DPTA 1WJUA 3WAOA 4KSKC 2MLBA 2LASA 4IC7B 2MSED 4KZCA 1S1QB 2HJ8A 2KWUB 3ONSA 1WJ6A 1VCBA 3SD5A 4MM3A 1TGZB 1V5TA 4EEWA 2IO3B 3EHVA 2K8CA 5KHQA 3PZDA 2KC1A 4BBNF 4ZRJA 4HCNB 2XEWA 4EOYA 2KJHB 2AL3A 1E90A 3L17A 2IZVB 1NI2A 2EKEC 1OGWA 2G3QB 4IWQA 2KVRA 2KMCA 3A4SC 4EFOA 1GG3A 1WX7A 4IWOA 3WAPA 3QARA 3UQAA 4B9KA 2KFJA 2Z59B 3CSTA 3DVNV 4GN1A 4IM2A 2KWCA 3WALA 2AYOB 3W1SC 4KZ0A 3P2BA 3EECA 3VTWA 2LZ6A 1V5OA 3GOEA 3AXCA 5IA7A 2BF8B 4G11A 2AWTA 3DBSA 2ZCBA 1IP9A 3KYDD 1K8RB 1ZKHA 2KX3A 4MELA 1L2NA 1EO6A 1X1MA 3OLMD 2NR2A 1EF5A 4LCDE 2J0KA 2ZPNA 1PQSA 5IAAC 3OAWA 3Q3FA 5L95C 1XQQA 4W9EA 3ML8A 4JL9A 1YD8U 3AU5A 2PEAA 2ZNVC 3TBLD 2FUHB 2IO0B 2DAFA 1KOTA 2JWZA 4HDQA 2ZVOA 3BINA 1YJ1A 3KW5B 4AP4C 3V61A 3WA0A 1GJZA 2HD5B 2DYBA 3DPDA 4HCPB 3K9PB 3A4RA 2FIFA 1WX8A 3L08A 3V6CB 3ZNHB 3ENEA 1P0RA 1UH6A 3IHPC 4BKSD 1P1AA 2WDTB 1TBEA 3PVLA 2JRHA 3H7PA 1YQBA 4BBNC 2D07B 4FJVB 5JHBA 3PHWB 3N32A 4E3CA 1D3ZA 1J19A 1G6JA 1GC6A 2PE9A 1SE9A 4ANWA 2K6QA 2LGXA 1XD3B 2K6DB 3ECIA 4BOSC 1WGHA 4DBGA 4ZRIA 4X57B 4WJNA 4FADA 5AEKB 2GBKA 3H7PB 3PSEB 2BPSA 3QA8A 2MW5A 4NAWA 4NJ7A 2MX2A 5GMVA 3RULA 2LGDA 4WWNA 3ZIMA 2IY1B 2L8JA 2L0FA 2KMAA 3APFA 3DDCB 4P7IA 2O2VA 3TMPB 2OJRA 4AUQC 2KFKA 3ZTCA 3I3TB 3W1YA 1WE6A 4CO7A 3VUWA 3PREA 4NAWB 4LJPB 3APCA 3VHTC 4FULA 2J7QB 3LJ3A 4E71A 2KQ7A 1V49A 2PE6B 4ANXA 2O2VB 3ZNZB 2KFKB 1V86A 1EF1A 1BT0A 3Q3JA 4NPNA 3V6EB 2R2QA 4GSWA 3AI5A 4E74A 2DZIA 4EZLA 1C3TA 1QZEA 4KDIC 2KLGA 2LWPA 4XX5A 4KIKA 2DZMA 2NBWB 1JRUA 2FIDA 1ISNA 4JIOU 3X23A 2NBUA 3GZNI 2L0TA 2D3GA 2MRPA 3A1QA 4K7WA 4ZYNA 3VUXA 4DDGD 5C1ZA 4MGZE 3DVNU 1KJTA 4KIKB 1P98A 2C60A 3VTUA 3QX1A 5E6PA 2KC2A 3A9KA 1UBIA 4PS7A 4FHJA 3ZNGC 1VD2A 2OOBB 1E5WA 4F1SA 5AZHA 3RZWC 3VXWA 2KO3A 3WANA 4LDTB 3A9KB 2LVQA 2K25A 1WGGA 3KUDB 2L76A 4BKSA 4MSQB 1RAXA 4B6WA 4HVBA 4AWJA 2NCNA 2EMTA 2FCNA 2KHWB 4GDKA 5J2RA 2Y5BB 3O65B 4AJYB 1MG8A 2K1FA 4J6IA 3H9DA 2LUEA 2BWES 3WAMA 2G45B 2FCSA 5L83A 2WWZA 3DVGY 1GC7A 2D2QA 2KN5A 3PTFC 2V3SA 4GDKB 2JZ3B 1T0YA 4NJ6A 1WM3A 3NZSA 4ZDVA 1GUAB 4HK2A 4FLHA 4IM0A 4ICVA 2NPTA 4MH0E 4JGHB 4W9IA 3AULA 1WZ3A 3RCZA 4F8CB 1NDDA 2CHZA 1WIAA 3VVWB 4A3PA 2J0MA 1E8XA 1WGRA 2NPTB 2ZCCA 2N7EA 2C9WB 3PT2B 4GDLA 2IYDB 2L00B 2XBBC 3RYTA 3HHMA 3VH4B 2MBOA 5DPRA 4W9HA 2MWSB 4DHJB 1S3SG 2MQJA 2D11A 2A5UA 3PLUA 3U30A 1H4RA 3KUCB 1WI0A 3PRZA 4GDLB 1GNUA 3ZUNA 5JH5C 4WJQA 2KTRA 2K8BA 1LQBA 3PV1A 3NOBA 2KDEB 4DWFA 3QIJA 2MP2A 3B0AA 1WRDB 4MGYE 4LDTD 2AEHA 4W9CA 4EZJA 1WMHA 3RZFA 5JHAA 1WXSA 2DYMA 3ML9A 2KK8A 2KANA 2KTRB 3BY4B 4HLEA 2MP2B 2QHOA 1UZXB 2C7NB 2CU1A 4HDOA 2ZJDA 2CHXA 4B95A 2M4NA 1KM7A 2CHWA 2L3ZA 1F9JA 5DPSA 2VRRB 4HWIB 2YVCA 1WMHB 2CS4A 1C1YB 4OVVA 4G3XB 1WYWB 4KV2A 2ZZPB 1Q5WB 4GOCA 2ZEQA 4MGKE 4W9GA 3RUIB 1Z2MA 3SDLC 4FJYA 3D32A 3UINB 2LRUA 3JSVA 2WYQA 3MJWA 2FCQA 2JRIB 2GBNA 2JUOA 1Q0WB 1OEYA 5G55A 2EMSA 2MBQA 1UBQA 3W1SA 4K7SA 2BKRB 4DXAB 3TCAA 1WR1A 4RMAA 2L7RA 1V81A 2XK5A 5E6NA 5LLIA 2KWVB 4BKTA 3JSVB 1WR6E 5E6OA 1WFYA 3VH3B 3V62A 2HTHA 2RGFA 3CMMB 2UYZB 2MBEA 3HIZA 4HJKA 3K9OB 3N30A 1E8YA 3CSFA 1RLFA 1UGMA 1WF9A 1IPGA 2CR5A 2JT4B 3V60A 2M0XA 2XK5B 3PRPB 5DCNA 1I35A 3HM3A 4DHJD 4NQKE 3X0WA 2GOWA 2N9XA 4GXBA 2N7DA 4TQ0A 3EC8A 3NHEB 2NVUI 4F7ZA 3KVFB 4G50A 3VTVA 3WIMA 4AJWA 3PLVA 3QCAA 3DBRI 1UD7A 1E8ZA 2BYEA 1WJ4A 2DX5B 4M8NA 1E7VA 3M3JA 4IG7B 5LXIB 1V80A 2KQSA 1WZ0A 4IUMB 5J17A 3ZLZA 1WE7A 3B1LX 4EUTA 2PPHA 2BGFA 2LXCA 4G0NB 5D6JB 1FXTB 1SGHA 2Z0DB 1M94A 4RM8A 1KLVA 3H1UA 2DZKA 2MCNB 4WJOA 4A3OA 1H8CA 2KZRA 3NZUA 2RPQA 3IG3A 2M17A 3M95A 3PHXB 3R7RA 4DHZB 1WX9A 4IW0A 3UIPB 1ZGUB 1P3QU 1ZW7A 3PRMB 5AZFA 3A9JA 4JLCA 3U8ZA 2G4SA 3JYUA 2LVOA 3ZVVA 2KOXA 2LJ5A 3TL5A 4GU2A 4ASWC 2KLCA 3APDA 1A5RA 4NQLB 2KJ6A 2JZZA 3AU4A 2JVCA 3JVZX 4W9FA 4MEMA 2UWQA 1WXMA 3A9JB 3VQIA 1WXAA 4WQOB 1RRBA 2KDFB 4N9F4 1TTNA 2KDIA 2J0JA 4GGQA 4K7UA 3MTNB 3A33B 4IWPA 3QJZA 4MSMB 3SU8X 3PS6A 2FNJB 2LXAA 3IBEA 1WGYA 4PYUA 4PS8A 2LGYA 2GMIC 1R4NI 3DBLI 4I6NB 4M8MA 1WH3A 2BWFA 1WXVA 2ASQA 3L54A 4GMVA 3C0RB 3DCGA 3PPAA 2I1JA 5G2NA 4FA6A 4I6LB 4BOZB 3CF6E 3HM6X 4II3B 2FCMA 2DZJA 2BKFA 1YX6B 3DBHI 4LJOB 1U4AA 3JW0X 3M62B 2KD0A 4GB9A 1V2YA 1OEYJ 2GBJA 3N3KB 4FHKA 4W9JA 2RSUA 4HPLB 2WX0A 2MA9B 3QQ8B 4BVUC 1L7YA 2M8SA 2N1WA 3UIOB 1LFDA 1OQYA 2JY6A 2MBHA 2O6VA 4K1RB 4MDKE 4TKNA 4EZKA 1E7UA 5LXHA 3QC8B 4DK5A 4ICUA 2C7HA 3TIXA 4FBJB 3IFWB 4WWOA 2DHZA 4YL8A 1YX5B 2M1MA 1WY8A 4HXDA 4TUUA 4IM3A 3R66C 3OJ3A 1UELA 3KH0A 3H6NA 5CTRC 3L0WB 4KDLB 2O6VB 4NY0A 5KHOA 3L10B 4EKUA 2I1KA 3S2AA 4BKGA 4DDID 3R3MA 2C7MB 2N9PC 5C23A 3HK0A 2DYOA 1TZ1A 2JPHA 3IVFA 4NNJB 1CMXB 3ZNID 3ALBA 4AOFA 3PGEA 5CHWA 1V6EA 3UQBA 3ZDTA 4MGIE 1E8WA 4W9LA 4WAAA 5CHVC 2BYVE 1EUVB 3VAWA 4RM9A 5J18A 4TQ1A 2YLMA 4XC2A 2BYFA 4K81A 2KDBA 2N9EB 3EFUA 3NY5A 4JQWC 5D2MB 1I42A 2NS5A 2LVPA 3T8MA 4M0WB 1LM8B 2D10A 1HE8A 5D7GA 1V9JA 3B08A 3VDZA 4ANVA 3QAQA 4PYZA 3L13A 3RT3B 3T9LA 3MHSD 3QK0A 5BO4B 2ZPYA 2HE7A 3RD2A 2C5LC 3SHQA 3ZKJC 2GBMA 2KTFA 2LD9A 2V4LA 2B3AA 2KX0A 4II2B 4XZ4A 3U7DA 4PS3A 3ZRFA 2IY0B 3DQVA 2KXJA 1SIFA 4ZRKA 4FJZA 1LXDA 4MJSA 1NBFC 4CYEA 3H7SA 2V1YA 2REXA 5D94A 3KYCD 4URKA 1YIWA 2DAJA 2JXXA 2FAZA 3KUZA 2N1VA 3UGBB 2IO1B 3L16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KJR A;  3ZDM C;  2O6V D;  2L05 A;  4MJS B;  2CKH B;  3ZW3 A;  2ZNV B;  4W9D A;  1J0G A;  1XT9 B;  2PJH A;  3R7Q A;  2AL6 A;  4FN2 A;  4ANU A;  1J8C A;  2IO2 B;  4A20 A;  1Q1O A;  4TV3 A;  2ZVN A;  2K39 A;  5DPW A;  4BFR A;  4WJP A;  1WGD A;  2KKC A;  3DVG X;  4I6P A;  3QHT A;  1R4M I;  3ZRC A;  4DHZ E;  2JF5 A;  3ZTD A;  3DOW A;  4HPM B;  1IYF A;  5AZG A;  1Z5S B;  2GBR A;  5JZE B;  2MBB B;  2NBV B;  1P9D U;  4KSL C;  5CX3 A;  2W9N A;  2RD0 A;  5HKH A;  2K8H A;  2LRW A;  3NS8 A;  2RR9 A;  2WX1 A;  1AAR A;  3OJ4 B;  3LDZ E;  2KNB A;  2A4Z A;  1RFA A;  5TR5 A;  1WM2 A;  4OVU A;  2LI5 A;  2Z0E B;  1OTR B;  1Y8R C;  4W9K A;  4WWP A;  3VFK A;  3VUY A;  2G4D B;  3A1Q B;  5EDS A;  2DEN B;  3TJP A;  2R2O A;  4CHK A;  2IBI B;  4KVG B;  4GIV A;  5CHF A;  3M63 B;  1WJN A;  3QWZ B;  5FR6 A;  3ZO5 B;  2N4F A;  3UF8 A;  5DPT A;  1WJU A;  3WAO A;  4KSK C;  2MLB A;  2LAS A;  4IC7 B;  2MSE D;  4KZC A;  1S1Q B;  2HJ8 A;  2KWU B;  3ONS A;  1WJ6 A;  1VCB A;  3SD5 A;  4MM3 A;  1TGZ B;  1V5T A;  4EEW A;  2IO3 B;  3EHV A;  2K8C A;  5KHQ A;  3PZD A;  2KC1 A;  4BBN F;  4ZRJ A;  4HCN B;  2XEW A;  4EOY A;  2KJH B;  2AL3 A;  1E90 A;  3L17 A;  2IZV B;  1NI2 A;  2EKE C;  1OGW A;  2G3Q B;  4IWQ A;  2KVR A;  2KMC A;  3A4S C;  4EFO A;  1GG3 A;  1WX7 A;  4IWO A;  3WAP A;  3QAR A;  3UQA A;  4B9K A;  2KFJ A;  2Z59 B;  3CST A;  3DVN V;  4GN1 A;  4IM2 A;  2KWC A;  3WAL A;  2AYO B;  3W1S C;  4KZ0 A;  3P2B A;  3EEC A;  3VTW A;  2LZ6 A;  1V5O A;  3GOE A;  3AXC A;  5IA7 A;  2BF8 B;  4G11 A;  2AWT A;  3DBS A;  2ZCB A;  1IP9 A;  3KYD D;  1K8R B;  1ZKH A;  2KX3 A;  4MEL A;  1L2N A;  1EO6 A;  1X1M A;  3OLM D;  2NR2 A;  1EF5 A;  4LCD E;  2J0K A;  2ZPN A;  1PQS A;  5IAA C;  3OAW A;  3Q3F A;  5L95 C;  1XQQ A;  4W9E A;  3ML8 A;  4JL9 A;  1YD8 U;  3AU5 A;  2PEA A;  2ZNV C;  3TBL D;  2FUH B;  2IO0 B;  2DAF A;  1KOT A;  2JWZ A;  4HDQ A;  2ZVO A;  3BIN A;  1YJ1 A;  3KW5 B;  4AP4 C;  3V61 A;  3WA0 A;  1GJZ A;  2HD5 B;  2DYB A;  3DPD A;  4HCP B;  3K9P B;  3A4R A;  2FIF A;  1WX8 A;  3L08 A;  3V6C B;  3ZNH B;  3ENE A;  1P0R A;  1UH6 A;  3IHP C;  4BKS D;  1P1A A;  2WDT B;  1TBE A;  3PVL A;  2JRH A;  3H7P A;  1YQB A;  4BBN C;  2D07 B;  4FJV B;  5JHB A;  3PHW B;  3N32 A;  4E3C A;  1D3Z A;  1J19 A;  1G6J A;  1GC6 A;  2PE9 A;  1SE9 A;  4ANW A;  2K6Q A;  2LGX A;  1XD3 B;  2K6D B;  3ECI A;  4BOS C;  1WGH A;  4DBG A;  4ZRI A;  4X57 B;  4WJN A;  4FAD A;  5AEK B;  2GBK A;  3H7P B;  3PSE B;  2BPS A;  3QA8 A;  2MW5 A;  4NAW A;  4NJ7 A;  2MX2 A;  5GMV A;  3RUL A;  2LGD A;  4WWN A;  3ZIM A;  2IY1 B;  2L8J A;  2L0F A;  2KMA A;  3APF A;  3DDC B;  4P7I A;  2O2V A;  3TMP B;  2OJR A;  4AUQ C;  2KFK A;  3ZTC A;  3I3T B;  3W1Y A;  1WE6 A;  4CO7 A;  3VUW A;  3PRE A;  4NAW B;  4LJP B;  3APC A;  3VHT C;  4FUL A;  2J7Q B;  3LJ3 A;  4E71 A;  2KQ7 A;  1V49 A;  2PE6 B;  4ANX A;  2O2V B;  3ZNZ B;  2KFK B;  1V86 A;  1EF1 A;  1BT0 A;  3Q3J A;  4NPN A;  3V6E B;  2R2Q A;  4GSW A;  3AI5 A;  4E74 A;  2DZI A;  4EZL A;  1C3T A;  1QZE A;  4KDI C;  2KLG A;  2LWP A;  4XX5 A;  4KIK A;  2DZM A;  2NBW B;  1JRU A;  2FID A;  1ISN A;  4JIO U;  3X23 A;  2NBU A;  3GZN I;  2L0T A;  2D3G A;  2MRP A;  3A1Q A;  4K7W A;  4ZYN A;  3VUX A;  4DDG D;  5C1Z A;  4MGZ E;  3DVN U;  1KJT A;  4KIK B;  1P98 A;  2C60 A;  3VTU A;  3QX1 A;  5E6P A;  2KC2 A;  3A9K A;  1UBI A;  4PS7 A;  4FHJ A;  3ZNG C;  1VD2 A;  2OOB B;  1E5W A;  4F1S A;  5AZH A;  3RZW C;  3VXW A;  2KO3 A;  3WAN A;  4LDT B;  3A9K B;  2LVQ A;  2K25 A;  1WGG A;  3KUD B;  2L76 A;  4BKS A;  4MSQ B;  1RAX A;  4B6W A;  4HVB A;  4AWJ A;  2NCN A;  2EMT A;  2FCN A;  2KHW B;  4GDK A;  5J2R A;  2Y5B B;  3O65 B;  4AJY B;  1MG8 A;  2K1F A;  4J6I A;  3H9D A;  2LUE A;  2BWE S;  3WAM A;  2G45 B;  2FCS A;  5L83 A;  2WWZ A;  3DVG Y;  1GC7 A;  2D2Q A;  2KN5 A;  3PTF C;  2V3S A;  4GDK B;  2JZ3 B;  1T0Y A;  4NJ6 A;  1WM3 A;  3NZS A;  4ZDV A;  1GUA B;  4HK2 A;  4FLH A;  4IM0 A;  4ICV A;  2NPT A;  4MH0 E;  4JGH B;  4W9I A;  3AUL A;  1WZ3 A;  3RCZ A;  4F8C B;  1NDD A;  2CHZ A;  1WIA A;  3VVW B;  4A3P A;  2J0M A;  1E8X A;  1WGR A;  2NPT B;  2ZCC A;  2N7E A;  2C9W B;  3PT2 B;  4GDL A;  2IYD B;  2L00 B;  2XBB C;  3RYT A;  3HHM A;  3VH4 B;  2MBO A;  5DPR A;  4W9H A;  2MWS B;  4DHJ B;  1S3S G;  2MQJ A;  2D11 A;  2A5U A;  3PLU A;  3U30 A;  1H4R A;  3KUC B;  1WI0 A;  3PRZ A;  4GDL B;  1GNU A;  3ZUN A;  5JH5 C;  4WJQ A;  2KTR A;  2K8B A;  1LQB A;  3PV1 A;  3NOB A;  2KDE B;  4DWF A;  3QIJ A;  2MP2 A;  3B0A A;  1WRD B;  4MGY E;  4LDT D;  2AEH A;  4W9C A;  4EZJ A;  1WMH A;  3RZF A;  5JHA A;  1WXS A;  2DYM A;  3ML9 A;  2KK8 A;  2KAN A;  2KTR B;  3BY4 B;  4HLE A;  2MP2 B;  2QHO A;  1UZX B;  2C7N B;  2CU1 A;  4HDO A;  2ZJD A;  2CHX A;  4B95 A;  2M4N A;  1KM7 A;  2CHW A;  2L3Z A;  1F9J A;  5DPS A;  2VRR B;  4HWI B;  2YVC A;  1WMH B;  2CS4 A;  1C1Y B;  4OVV A;  4G3X B;  1WYW B;  4KV2 A;  2ZZP B;  1Q5W B;  4GOC A;  2ZEQ A;  4MGK E;  4W9G A;  3RUI B;  1Z2M A;  3SDL C;  4FJY A;  3D32 A;  3UIN B;  2LRU A;  3JSV A;  2WYQ A;  3MJW A;  2FCQ A;  2JRI B;  2GBN A;  2JUO A;  1Q0W B;  1OEY A;  5G55 A;  2EMS A;  2MBQ A;  1UBQ A;  3W1S A;  4K7S A;  2BKR B;  4DXA B;  3TCA A;  1WR1 A;  4RMA A;  2L7R A;  1V81 A;  2XK5 A;  5E6N A;  5LLI A;  2KWV B;  4BKT A;  3JSV B;  1WR6 E;  5E6O A;  1WFY A;  3VH3 B;  3V62 A;  2HTH A;  2RGF A;  3CMM B;  2UYZ B;  2MBE A;  3HIZ A;  4HJK A;  3K9O B;  3N30 A;  1E8Y A;  3CSF A;  1RLF A;  1UGM A;  1WF9 A;  1IPG A;  2CR5 A;  2JT4 B;  3V60 A;  2M0X A;  2XK5 B;  3PRP B;  5DCN A;  1I35 A;  3HM3 A;  4DHJ D;  4NQK E;  3X0W A;  2GOW A;  2N9X A;  4GXB A;  2N7D A;  4TQ0 A;  3EC8 A;  3NHE B;  2NVU I;  4F7Z A;  3KVF B;  4G50 A;  3VTV A;  3WIM A;  4AJW A;  3PLV A;  3QCA A;  3DBR I;  1UD7 A;  1E8Z A;  2BYE A;  1WJ4 A;  2DX5 B;  4M8N A;  1E7V A;  3M3J A;  4IG7 B;  5LXI B;  1V80 A;  2KQS A;  1WZ0 A;  4IUM B;  5J17 A;  3ZLZ A;  1WE7 A;  3B1L X;  4EUT A;  2PPH A;  2BGF A;  2LXC A;  4G0N B;  5D6J B;  1FXT B;  1SGH A;  2Z0D B;  1M94 A;  4RM8 A;  1KLV A;  3H1U A;  2DZK A;  2MCN B;  4WJO A;  4A3O A;  1H8C A;  2KZR A;  3NZU A;  2RPQ A;  3IG3 A;  2M17 A;  3M95 A;  3PHX B;  3R7R A;  4DHZ B;  1WX9 A;  4IW0 A;  3UIP B;  1ZGU B;  1P3Q U;  1ZW7 A;  3PRM B;  5AZF A;  3A9J A;  4JLC A;  3U8Z A;  2G4S A;  3JYU A;  2LVO A;  3ZVV A;  2KOX A;  2LJ5 A;  3TL5 A;  4GU2 A;  4ASW C;  2KLC A;  3APD A;  1A5R A;  4NQL B;  2KJ6 A;  2JZZ A;  3AU4 A;  2JVC A;  3JVZ X;  4W9F A;  4MEM A;  2UWQ A;  1WXM A;  3A9J B;  3VQI A;  1WXA A;  4WQO B;  1RRB A;  2KDF B;  4N9F 4;  1TTN A;  2KDI A;  2J0J A;  4GGQ A;  4K7U A;  3MTN B;  3A33 B;  4IWP A;  3QJZ A;  4MSM B;  3SU8 X;  3PS6 A;  2FNJ B;  2LXA A;  3IBE A;  1WGY A;  4PYU A;  4PS8 A;  2LGY A;  2GMI C;  1R4N I;  3DBL I;  4I6N B;  4M8M A;  1WH3 A;  2BWF A;  1WXV A;  2ASQ A;  3L54 A;  4GMV A;  3C0R B;  3DCG A;  3PPA A;  2I1J A;  5G2N A;  4FA6 A;  4I6L B;  4BOZ B;  3CF6 E;  3HM6 X;  4II3 B;  2FCM A;  2DZJ A;  2BKF A;  1YX6 B;  3DBH I;  4LJO B;  1U4A A;  3JW0 X;  3M62 B;  2KD0 A;  4GB9 A;  1V2Y A;  1OEY J;  2GBJ A;  3N3K B;  4FHK A;  4W9J A;  2RSU A;  4HPL B;  2WX0 A;  2MA9 B;  3QQ8 B;  4BVU C;  1L7Y A;  2M8S A;  2N1W A;  3UIO B;  1LFD A;  1OQY A;  2JY6 A;  2MBH A;  2O6V A;  4K1R B;  4MDK E;  4TKN A;  4EZK A;  1E7U A;  5LXH A;  3QC8 B;  4DK5 A;  4ICU A;  2C7H A;  3TIX A;  4FBJ B;  3IFW B;  4WWO A;  2DHZ A;  4YL8 A;  1YX5 B;  2M1M A;  1WY8 A;  4HXD A;  4TUU A;  4IM3 A;  3R66 C;  3OJ3 A;  1UEL A;  3KH0 A;  3H6N A;  5CTR C;  3L0W B;  4KDL B;  2O6V B;  4NY0 A;  5KHO A;  3L10 B;  4EKU A;  2I1K A;  3S2A A;  4BKG A;  4DDI D;  3R3M A;  2C7M B;  2N9P C;  5C23 A;  3HK0 A;  2DYO A;  1TZ1 A;  2JPH A;  3IVF A;  4NNJ B;  1CMX B;  3ZNI D;  3ALB A;  4AOF A;  3PGE A;  5CHW A;  1V6E A;  3UQB A;  3ZDT A;  4MGI E;  1E8W A;  4W9L A;  4WAA A;  5CHV C;  2BYV E;  1EUV B;  3VAW A;  4RM9 A;  5J18 A;  4TQ1 A;  2YLM A;  4XC2 A;  2BYF A;  4K81 A;  2KDB A;  2N9E B;  3EFU A;  3NY5 A;  4JQW C;  5D2M B;  1I42 A;  2NS5 A;  2LVP A;  3T8M A;  4M0W B;  1LM8 B;  2D10 A;  1HE8 A;  5D7G A;  1V9J A;  3B08 A;  3VDZ A;  4ANV A;  3QAQ A;  4PYZ A;  3L13 A;  3RT3 B;  3T9L A;  3MHS D;  3QK0 A;  5BO4 B;  2ZPY A;  2HE7 A;  3RD2 A;  2C5L C;  3SHQ A;  3ZKJ C;  2GBM A;  2KTF A;  2LD9 A;  2V4L A;  2B3A A;  2KX0 A;  4II2 B;  4XZ4 A;  3U7D A;  4PS3 A;  3ZRF A;  2IY0 B;  3DQV A;  2KXJ A;  1SIF A;  4ZRK A;  4FJZ A;  1LXD A;  4MJS A;  1NBF C;  4CYE A;  3H7S A;  2V1Y A;  2REX A;  5D94 A;  3KYC D;  4URK A;  1YIW A;  2DAJ A;  2JXX A;  2FAZ A;  3KUZ A;  2N1V A;  3UGB B;  2IO1 B;  3L16 A; 
#chains in the Genus database with same CATH topology
 2KJR A;  2ZNV B;  4W9D A;  3N1Z C;  3UI3 A;  1TYG B;  2LGS A;  2AL6 A;  4ANU A;  4DXF A;  3ZJU A;  2K39 A;  4BFR A;  2IPK D;  4I6P A;  4HPM B;  2FUG 1;  5JZE B;  1MHH E;  1P9D U;  1UGJ A;  3KWV A;  5CX3 A;  1FD6 A;  1QLB B;  2K8H A;  1AW7 A;  5T8I A;  1YJI A;  2V9H A;  2KNB A;  3Q3N C;  1YN5 A;  2DWQ A;  2LI5 A;  1Y8R C;  3ZGZ A;  1XF5 L;  3A1Q B;  1WRI A;  2DEN B;  1XCQ L;  4GIV A;  3AE7 B;  5FR6 A;  3UF8 A;  1C79 A;  2MSE D;  4KZC A;  2KWU B;  2HJ8 A;  4YTP B;  5C2T B;  1E0Z A;  2BQQ A;  3GP7 A;  3EHV A;  2K8C A;  2KC1 A;  3W2D A;  2AL3 A;  1OQR A;  1NI2 A;  2G3Q B;  2KVR A;  1GG3 A;  4IWO A;  2IND C;  2Z59 B;  4OVZ A;  4IM2 A;  2K3U A;  1R7S A;  1E6E B;  4G11 A;  2ZCB A;  1SEB D;  2KX3 A;  1L2N A;  4LCD E;  3OLM D;  1EF5 A;  1D4B A;  1XQQ A;  4W9E A;  2FUH B;  1KOT A;  2D3B A;  1GPX A;  1GJZ A;  3V61 A;  2HD5 B;  1YQ3 B;  4HCP B;  2JX5 A;  2K0P A;  1FM0 D;  3DBL B;  2FIF A;  3ZNH B;  3ENE A;  4HRO A;  2WDT B;  1TBE A;  3H7P A;  4BBN C;  2D07 B;  4FJV B;  5JHB A;  1J19 A;  2D3A A;  1SE9 A;  2LGX A;  4HJG E;  3QA8 A;  4NAW A;  2MX2 A;  2BYT A;  4WWN A;  3ZIM A;  3APF A;  3ZTC A;  3I3T B;  5HI1 A;  3W1Y A;  5BYQ A;  1XO3 A;  4LJP B;  5H8Y E;  3APC A;  3VHT C;  4FUL A;  4US8 A;  2J7Q B;  2J52 A;  1V49 A;  2O2V B;  3I63 C;  2WXF A;  1V86 A;  3AMZ A;  4NPN A;  3V6E B;  4E74 A;  2L32 A;  4XX5 A;  2KDM A;  4A9A A;  5HHD G;  4JIO U;  3X23 A;  4XWW A;  3AH7 A;  2L0T A;  3A1Q A;  3ZJT A;  2NMQ A;  1SJH D;  2C60 A;  3VTU A;  1HEZ E;  3A9K A;  3OWE B;  3P1M A;  5FK9 C;  1Y56 A;  2OOB B;  4WAF A;  2BVC A;  2K25 A;  2WXK A;  4MSQ B;  1VZ8 A;  1VZ7 A;  3IT4 B;  3O65 B;  5G5G A;  1F2R C;  2K1F A;  4J6I A;  4WH4 A;  2INN E;  2LUE A;  1T0R C;  4L23 A;  2BWE S;  4ZOH C;  3DVG Y;  4N59 A;  2LHE A;  2JZ3 B;  1T0Y A;  3NZS A;  2V3P A;  1GUA B;  3AE2 B;  1ZP0 B;  4S0R A;  1XLN A;  4LTU A;  4MH0 E;  4JGH B;  3AUL A;  1XLP A;  1MVK A;  3RCZ A;  4F8C B;  1NDD A;  1KH0 A;  1WIA A;  4ZHO A;  4XGA B;  2NPT B;  2ZCC A;  2N7E A;  1XCT L;  1C4A A;  2XBB C;  4M01 A;  3RNA C;  3RYT A;  1R4M B;  2MBO A;  3DHI C;  4XWT A;  1DGJ A;  1S3S G;  2KVZ A;  2A5U A;  3PLU A;  1T3Q A;  1GNU A;  2KTR A;  2K8B A;  1LQB A;  3PV1 A;  1FEH A;  1PYW D;  3B0A A;  4UDU C;  4LDT D;  2AEH A;  1JWB D;  4TMA B;  3AV8 A;  3ML9 A;  2KK8 A;  2KAN A;  2C7N B;  2CHX A;  4B95 A;  2M4N A;  2VRR B;  4HWI B;  4OVV A;  1WMH B;  2CS4 A;  3SEB A;  1C4P A;  4KV2 A;  2BBC A;  4W9G A;  3RUI B;  3SDL C;  3D32 A;  3JSV A;  1CJE A;  2JUO A;  1WWT A;  2KN4 A;  5G55 A;  1SF0 A;  3VR8 B;  4RMA A;  4BKT A;  2WXO A;  5E6O A;  3AEA B;  2GI9 A;  4WIP A;  3CMM B;  3R2I A;  2KMM A;  3K9O B;  1RLF A;  1UGM A;  1IPG A;  2WDQ B;  3V60 A;  2XK5 B;  4DHJ D;  4NQK E;  4P1C C;  2JYT A;  2NVU I;  1QOB A;  1SBB B;  1UD7 A;  1E8Z A;  2BYE A;  3TEX A;  4IG7 B;  4IUM B;  3LXF A;  5J17 A;  1F52 A;  3I9V 1;  2PPH A;  1XLO A;  2BB6 A;  1FXT B;  4BZA A;  2Z0D B;  1KLV A;  2X38 A;  1H8C A;  3M95 A;  1ZDX A;  1IUE A;  3MC8 A;  1P3Q U;  1ZW7 A;  5HFY A;  5EE9 A;  2J4X A;  1B1Z A;  4XYC A;  4ASW C;  4RNA A;  3BVG A;  4NQL B;  2KJ6 A;  4W9F A;  1JRP A;  3EFC A;  3VQI A;  3A9J B;  2KYW A;  1WXA A;  1TTN A;  4GGQ A;  3MTN B;  4MSM B;  3QJZ A;  3SU8 X;  3PS6 A;  4PYU A;  2WP9 B;  4A90 A;  2LGY A;  3DBL I;  2BWF A;  1WXV A;  2ASQ A;  1KFY B;  4BOZ B;  3EA6 A;  2GRI A;  4KKI A;  2DZJ A;  1YX6 B;  4YWG G;  4MH8 A;  3M62 B;  2GBJ A;  3N3K B;  4W9J A;  3VRA B;  1LFD A;  1OQY A;  2MBH A;  5LXH A;  2L52 A;  1L5P A;  3TIX A;  3IFW B;  2DHZ A;  1YN3 A;  1YX5 B;  1PDX A;  3DHG C;  3OJ3 A;  4JWU C;  4EKU A;  4BKG A;  2LFI A;  2DYO A;  1TZ1 A;  1CMX B;  1LGR A;  4AOF A;  2IDY A;  3ZDT A;  1E8W A;  3RNF C;  5BYR A;  1ZOY B;  1EWY C;  5IO9 A;  3ZQ4 A;  4KGS A;  1OQQ A;  5D2M B;  2JU6 X;  2M19 A;  2D10 A;  1T6B X;  3B08 A;  3HVZ A;  1MFW A;  3QAQ A;  3RT3 B;  1HQR D;  2WXG A;  3MHS D;  5BO4 B;  1FNV A;  2ZPY A;  2JYE A;  4C7Z A;  3SHQ A;  1K50 A;  4ACF A;  4PS3 A;  2KXJ A;  4YXD B;  1QQR A;  4MJS A;  1NBF C;  3IT6 B;  2I38 A;  3RPF C;  2FAZ A;  1FXA A;  2N1V A;  3Q6B A;  3L16 A;  3E56 A;  3ZW3 A;  1J0G A;  4ZYS A;  1QT9 A;  4FN2 A;  2IO2 B;  4A20 A;  2QIE B;  1F0Z A;  2ZVN A;  5DPW A;  4WJP A;  2KKC A;  2BS3 B;  4DXG A;  1A70 A;  1R4M I;  3BVZ A;  2JF5 A;  2DNF A;  5D3D A;  4DHZ E;  3ZTD A;  5AZG A;  3RI7 C;  2LRW A;  5I4D A;  1RFA A;  4M02 A;  4A6Q A;  1OTR B;  4W9K A;  3VUY A;  2WU5 B;  4WWP A;  3VFK A;  1TIF A;  3W5U B;  1MPE A;  5EDS A;  3NVZ A;  5CHF A;  3ZO5 B;  1GOZ A;  2NTS A;  2MLB A;  4IC7 B;  4LNK A;  1L4D B;  1S1Q B;  3ONS A;  4XDD A;  1TGZ B;  1V5T A;  1N63 A;  2IO3 B;  1UNS A;  2V3N A;  3RNB C;  2IGH A;  4EOY A;  2M0A A;  1E90 A;  1N61 A;  3L17 A;  4LLG M;  1L0X B;  3MFG A;  3BYY B;  3A4S C;  3RN9 C;  3WAP A;  3QAR A;  2KFJ A;  3DVN V;  2AYO B;  3GOE A;  3V05 A;  5IN7 A;  5IA7 A;  1TKE A;  1M4V A;  1UWX A;  3DBS A;  1IP9 A;  1ZKH A;  2E6X A;  1X1M A;  2J0K A;  5IAA C;  3OAW A;  4JL9 A;  4RH6 A;  3B2G A;  3ZXR A;  2JWZ A;  4HDQ A;  2L1A A;  5BMH A;  3AE8 B;  3BK1 A;  2DYB A;  5TSS A;  3DPD A;  1AYF A;  3V6C B;  4WWM A;  1CQV A;  4NAM A;  4BKS D;  2OHF A;  3ZJV A;  2IJ0 A;  1MI0 A;  3PHW B;  3N32 A;  4L2Y A;  1GC6 A;  3BII D;  4ANW A;  1XD3 B;  3ECI A;  4DBG A;  4ZRI A;  3N9Y C;  3PSE B;  3H7P B;  5GMV A;  3RUL A;  1TS4 A;  2WXP A;  1SE4 A;  2KMA A;  4P7I A;  1L0Y B;  2KFK A;  1WE6 A;  1I4G A;  4EE2 A;  1SXT A;  4NAW B;  2D3C A;  2KQ7 A;  3MHZ A;  1BT0 A;  1C3T A;  4EZL A;  2KLG A;  4KIK A;  1ISN A;  3GZN I;  4DDG D;  3BWU D;  2JXT A;  4YT0 B;  1KJT A;  1P98 A;  2RDB C;  1UBI A;  4PS7 A;  2L83 A;  1SE3 A;  4FHJ A;  3U7Z A;  1VD2 A;  4F1S A;  4OZA A;  3VXW A;  2KO3 A;  3AN1 A;  4LDT B;  1VLB A;  2RDH A;  3A9K B;  1FNW A;  1WGG A;  2L76 A;  4B6W A;  2FCN A;  2NTT A;  5J2R A;  2Y5B B;  1V8C A;  1MG8 A;  4OZC A;  4RGN A;  4TSS A;  3IXS A;  4NJ6 A;  1CK1 A;  4IM0 A;  1F1H A;  5E6J A;  3IAS 1;  2WHI A;  1YJJ A;  1HTQ A;  1KLU D;  1C78 A;  5C3J B;  3H8H A;  4K3B A;  2JSV X;  2WXI A;  4WQM A;  1I4P A;  3VH4 B;  4YSZ B;  2MWS B;  4DHJ B;  2D11 A;  3BK2 A;  3FC4 A;  3KUC B;  1WI0 A;  2G9H D;  3ZUN A;  4DWF A;  2MP2 A;  2QIL A;  4HRS A;  3ETR A;  3RZF A;  5JHA A;  1JWA D;  2DYM A;  2W82 A;  1CZP A;  2KTR B;  1LO5 D;  4DQO C;  1I4H A;  1C1Y B;  2ZZP B;  1Q5W B;  4GOC A;  1Z2M A;  3Q2A C;  2GBN A;  1MJD A;  1OEY A;  1D5X C;  2EMS A;  2MBQ A;  2ZW0 A;  3W1S A;  2BKR B;  4A55 A;  3MC9 A;  1ZXI A;  5E6N A;  3L4P A;  3JSV B;  3HRD D;  4H2A A;  4J3O D;  2RGF A;  2UYZ B;  1E10 A;  2MBE A;  3WCQ A;  3HIZ A;  1E8Y A;  1WF9 A;  4AQ7 A;  2KAJ A;  3HM3 A;  4FXC A;  4ARC A;  1I35 A;  2GOW A;  4RCO A;  1TS3 A;  2N7D A;  3NHE B;  4G50 A;  3PLV A;  3AEC B;  2DX5 B;  1TY0 A;  4M8N A;  3FAH A;  4USA A;  3ZLZ A;  4LNN A;  2OED A;  3TSS A;  2LXC A;  1TZO A;  1L6V A;  4RM8 A;  4N6E B;  3H1U A;  4WJO A;  1ZPS A;  4A3O A;  1YOV B;  1I7H A;  2KZR A;  3AE4 B;  3NZU A;  3R7R A;  3PHX B;  5H92 C;  3U52 E;  4DHZ B;  2N9K A;  5AZF A;  3U8Z A;  3JYU A;  2LJ5 A;  4OHJ A;  5EE1 A;  4JE3 B;  4NJC A;  3LB8 C;  4YSY B;  2M56 B;  4MEM A;  1RRB A;  4N9F 4;  3MC0 B;  2W3S A;  4IWP A;  3IBE A;  1RWS A;  1WGY A;  2DLB A;  4PS8 A;  3Q14 C;  2SAK A;  3C0R B;  2WDR B;  2BS4 B;  3DCG A;  2WS3 B;  1L0V B;  2I1J A;  4YSX B;  2FCM A;  3DBH I;  3AEB B;  3SFD B;  1PGB A;  2KD0 A;  4GB9 A;  1V2Y A;  1OEY J;  2RSU A;  4HPL B;  2MA9 B;  3DBR B;  1ZDV A;  2N1W A;  5FR3 A;  3NRZ A;  2CJN A;  4K1R B;  4TKN A;  3QC8 B;  4DK5 A;  4L1B A;  1K51 A;  4FBJ B;  3AED B;  1ESF A;  1WY8 A;  1FCL A;  4TUU A;  2X8X X;  3R66 C;  3KH0 A;  5MPO A;  3L0W B;  3AE1 B;  4KDL B;  3PZ8 A;  4NY0 A;  5KHO A;  4REZ A;  3S2A A;  1JWU D;  3C8Y A;  2H88 B;  3HK0 A;  4NNJ B;  3ALB A;  5CHW A;  4LNF A;  4WAA A;  5LNK 1;  3E9S A;  1EUV B;  4TQ1 A;  3EFU A;  3NY5 A;  4JQW C;  1WYG A;  2NS5 A;  4HPP A;  3T8M A;  4M0W B;  1PUT A;  2YEP F;  1R4N B;  1L4Z B;  3L13 A;  3TUO A;  2Q5W D;  3VR9 B;  3PO0 A;  2GBM A;  2KTF A;  2V4L A;  3ZRF A;  2KX0 A;  4II2 B;  2N0S B;  2ICI A;  2IY0 B;  3DQV A;  4CYE A;  1HTO A;  1RYJ A;  2REX A;  3KUZ A;  3ZDM C;  2L05 A;  1AWD A;  4MJS B;  2CKH B;  1XT9 B;  2PJH A;  5BMG A;  1UF0 A;  3B9J A;  1J8C A;  2AQ1 B;  4TV3 A;  1N60 A;  1V97 A;  1WGD A;  3DVG X;  3ZRC A;  1EWC A;  1IYF A;  1Z5S B;  1FIQ A;  2RPV A;  3R2T A;  4HKQ A;  2RD0 A;  5HKH A;  3NS8 A;  1C76 A;  1EU3 A;  2RR9 A;  1AAR A;  1ET9 A;  1NI3 A;  3OJ4 B;  3LDZ E;  4WUR A;  2A4Z A;  3AE3 B;  4OVU A;  2Z0E B;  2WXJ A;  3TJP A;  2IBI B;  4KVG B;  3GE3 C;  2WXR A;  3M63 B;  3FIL A;  3QWZ B;  1I4Q A;  2N4F A;  5DPT A;  4KSK C;  2LAS A;  1RFK A;  4C56 C;  1DOI A;  4MM3 A;  2VH2 A;  2WXQ A;  5KHQ A;  4ZRJ A;  2GB1 A;  3GB1 A;  4HCN B;  1BXT A;  1QKZ A;  2IZV B;  2EKE C;  4JPS A;  3P4P B;  1JWM D;  2VZK D;  1TKY A;  5GXG B;  3CST A;  3WAL A;  3W1S C;  4KZ0 A;  3EEC A;  1V5O A;  2R61 A;  3AXC A;  5G5H A;  2BF8 B;  1EO6 A;  1KF6 B;  2ZPN A;  1PQS A;  1E7P B;  5L95 C;  1YD8 U;  1J7C A;  2PEA A;  1SE2 A;  4M0W A;  2ZNV C;  3TBL D;  4YTM B;  2IO0 B;  3BIN A;  1STE A;  1YJ1 A;  3WA0 A;  3URY A;  3RNE C;  3TEY A;  1WX8 A;  1TS2 A;  1NEN B;  1P0R A;  3IHP C;  1P1A A;  4US9 A;  4E3C A;  1G6J A;  2K6D B;  4BOS C;  4X57 B;  4WJN A;  2AQ2 B;  2PVG C;  1ROE A;  2IY1 B;  2L8J A;  3DHH C;  3DDC B;  2WXM A;  4AUQ C;  3NVV A;  2MJD A;  4CO7 A;  3PRE A;  3DWG C;  2BW2 A;  4RFB A;  1L6U A;  1NYR A;  2KT7 A;  3Q69 A;  3SFE B;  4E71 A;  2N9L A;  3ZNZ B;  2KFK B;  1EF1 A;  2GLS A;  3AI5 A;  1K53 A;  1XEE A;  4KDI C;  1N6Z A;  2FID A;  3TEZ A;  1FFV A;  3NZ3 A;  1OFF A;  4ZYN A;  2D3G A;  3VUX A;  4MGZ E;  2MJ3 A;  2K22 A;  3DVN U;  4KIK B;  1P7F A;  3QX1 A;  5E6P A;  2KC2 A;  2PTL A;  2LGI A;  4MAC A;  2LVQ A;  3KUD B;  4BKS A;  1RAX A;  4HVB A;  4AWJ A;  4IKG A;  2KHW B;  4GDK A;  4AJY B;  2Y5P A;  1C4C A;  2WWZ A;  1GC7 A;  2D2Q A;  3PTF C;  3CIR B;  2BS2 B;  2V3S A;  1T0S C;  4ZDV A;  4LNI A;  3T3O A;  4ICV A;  1GB1 A;  4W9I A;  2RMM A;  4ARI A;  2PMV A;  4A3P A;  2J0M A;  1E8X A;  1WGR A;  5IKC M;  3PT2 B;  4GDL A;  2WLB A;  2L00 B;  3HHM A;  4W9H A;  4C80 A;  1EM7 A;  2V0G A;  3BZD B;  2RDG A;  4RF0 A;  4WJQ A;  2KDE B;  2XNA C;  4RF1 A;  2KAC A;  1WRD B;  2PIA A;  4MGY E;  2FBW B;  1SB3 C;  5FKA C;  1WXS A;  1GB4 A;  2PLP A;  3P63 A;  4HEA 1;  2MP2 B;  2CU1 A;  2ZJD A;  3RNC C;  1KM7 A;  2CHW A;  1IGC A;  4IOI E;  2L3Z A;  1F9J A;  5DPS A;  4G3X B;  1V1P B;  2ZEQ A;  4FJY A;  3UIN B;  2LRU A;  2WYQ A;  3MJW A;  2JRI B;  1UBQ A;  2UU7 A;  4DXA B;  1WR1 A;  3R8B A;  5IOI A;  5LLI A;  3VH3 B;  1WFY A;  3V62 A;  1QOF A;  1N5W A;  3IAM 1;  3P4Q B;  5DCN A;  2N9X A;  4HKZ E;  3BVM A;  4TQ0 A;  3EC8 A;  1DOX A;  2MJE A;  3KVF B;  3VTV A;  3WIM A;  4AJW A;  1AN8 A;  1WJ4 A;  3M3J A;  1V80 A;  2LHD A;  5BYS A;  1WE7 A;  3B1L X;  2BGF A;  2AX5 A;  1ET6 A;  1M94 A;  2J53 A;  2ONQ A;  3HVD A;  2RPQ A;  3ABV B;  4R3D A;  1ZGU B;  1NEK B;  1F2R I;  4RGT A;  4PK1 A;  2LVO A;  2I2Y A;  3TL5 A;  4Q2J A;  2KLC A;  1Q10 A;  2JZZ A;  3AU4 A;  3J9C A;  1P7E A;  4C4V B;  4B0E A;  2UWQ A;  4WQO B;  1WSP A;  2KWD A;  4K7U A;  1SJE D;  1D5M C;  4BAX A;  2FNJ B;  1B9R A;  4I6N B;  4M8M A;  1XXG A;  2CU3 A;  4FA6 A;  4I6L B;  4OZB A;  2K5P A;  2OJW A;  3HM6 X;  1HZ6 A;  4P6V F;  2BKF A;  4NZL B;  1QOG A;  1C9F A;  1JQ4 A;  2WX0 A;  3QQ8 B;  1L7Y A;  4YTN B;  2MH7 A;  2JY6 A;  4MDK E;  2O6V A;  3P4R B;  4EZK A;  1E7U A;  2FE8 A;  4ICU A;  1E9M A;  1D6E C;  1UEL A;  5CTR C;  3Q8E A;  1HA5 A;  2G1E A;  3L10 B;  3ZYY X;  2I1K A;  1DOY A;  1V1O A;  1VRA B;  3R3M A;  1V1P A;  2N9P C;  5C23 A;  2JPH A;  3IVF A;  3KWL A;  2BTE A;  1V6E A;  3GE8 C;  2INC C;  4W9L A;  3VAW A;  4RM9 A;  1XLQ A;  1J7A A;  4K81 A;  2PW9 A;  2EEL A;  2MEK A;  4O1N A;  3B2F A;  4S17 A;  3U4E G;  1I42 A;  2LVP A;  1HXY D;  1HE8 A;  3EUB 2;  3VDZ A;  4PYZ A;  1EU4 A;  2HE7 A;  1UWM A;  4HLE A;  2QSD A;  1ENF A;  4ZRK A;  4FJZ A;  1LXD A;  3H7S A;  2V1Y A;  5D94 A;  3KYC D;  4URK A;  2JXX A;  1VR9 A;  1JWS D;  1UUP A;  3MP9 A;  2O6V D;  2QEJ C;  2LMC A;  3R7Q A;  1Q1O A;  1ZE3 D;  3AE6 B;  4JX1 C;  1KTK A;  4LNO A;  2VZK B;  3QHT A;  1ZUD 2;  3DOW A;  2GBR A;  4C4V A;  2Z8L A;  2MBB B;  2NBV B;  4KSL C;  2W9N A;  4OW0 A;  3BYT B;  1SSN A;  2JQR B;  2WX1 A;  3AE5 B;  1FFU A;  2J42 A;  5TR5 A;  1WM2 A;  3HUI A;  3NJT A;  2G4D B;  2QJL A;  2R2O A;  4CHK A;  4P16 A;  2LEK A;  4KKJ A;  1WJN A;  1DYQ A;  2PKO A;  1WJU A;  3WAO A;  3KQ4 A;  3AEG B;  1JAL A;  3FKY A;  2LUM A;  2IGG A;  2W54 A;  1WJ6 A;  1VCB A;  2K9X A;  2CJO A;  3SD5 A;  3OG5 A;  3FIL B;  4EEW A;  2XN9 C;  3PZD A;  4BBN F;  5EE0 A;  2XEW A;  2MHJ A;  2KJH B;  4MM3 B;  1OGW A;  4IWQ A;  2KMC A;  2HJ1 A;  1WXQ A;  1WX7 A;  4EFO A;  1FXI A;  3UQA A;  4B9K A;  1N5X A;  1YMH E;  4GN1 A;  2QDF A;  2KWC A;  3W5V B;  3P4S B;  2QCZ A;  3P2B A;  3VRB B;  1GAQ B;  3VTW A;  2LZ6 A;  1FNU A;  1F77 A;  2BB5 A;  2AWT A;  1PGA A;  3KYD D;  1K8R B;  4MEL A;  1BUI C;  2NR2 A;  3Q3O C;  3NS1 A;  3CWI A;  4XDC A;  3NVW A;  3Q3F A;  2QC8 A;  1JML A;  4JWS C;  3ML8 A;  4N58 A;  3AU5 A;  2DAF A;  4CQN A;  2ZVO A;  3KW5 B;  4AP4 C;  1MG4 A;  3K9P B;  1IBX B;  3A4R A;  3L08 A;  1UH6 A;  3SR6 A;  2HTM E;  3AB5 A;  3PVL A;  2JRH A;  2JZP A;  1YQB A;  1TY2 A;  1D3Z A;  2PE9 A;  5HG2 A;  2K6Q A;  1WGH A;  2W3R A;  4FAD A;  5AEK B;  2GBK A;  2BPS A;  1QF6 A;  2MW5 A;  4NJ7 A;  2LGD A;  2WXN A;  2L0F A;  4XE0 A;  1HZ5 A;  2WXL A;  2O2V A;  3TMP B;  2OJR A;  3VUW A;  3RFZ B;  2E3T A;  3NVY A;  3LJ3 A;  1TKG A;  4ANX A;  2PE6 B;  1K52 A;  4A8X C;  3Q3J A;  2R2Q A;  4GSW A;  2DZI A;  3NG0 A;  1QZE A;  2LWP A;  2DZM A;  2NBW B;  1JRU A;  2VH1 A;  3V3X A;  4C00 A;  2NBU A;  2MRP A;  5C1Z A;  4K7W A;  2SEB D;  3LYY A;  1T5X D;  4ZRP A;  2PVO D;  3ZNG C;  1E5W A;  2ON8 A;  1RM6 C;  5AZH A;  3RZW C;  5JXV A;  3WAN A;  2DBY A;  3I57 A;  2NCN A;  2EMT A;  1VJK A;  3H9D A;  1FRD A;  3Q8F A;  1TJE A;  3WAM A;  2G45 B;  2FCS A;  5L83 A;  5D3I B;  2KN5 A;  4ZRQ A;  4GDK B;  1WM3 A;  3NUH B;  4HK2 A;  1VDV A;  2Y5C A;  4FLH A;  2NPT A;  3O13 A;  4D2K A;  1WZ3 A;  2CHZ A;  2ZW1 A;  4M00 A;  5AUK A;  3Q3M C;  1I4X A;  3VVW B;  1FRR A;  2V4I B;  2EKI A;  2BT6 A;  1MHX A;  2C9W B;  2IYD B;  2D5G A;  1YN4 A;  2N7J A;  5DPR A;  2WQY B;  2MQJ A;  2INP E;  2WNM A;  3U30 A;  4AS1 A;  1H4R A;  3PRZ A;  3GZN B;  4GDL B;  3AEF B;  5JH5 C;  3NOB A;  3QIJ A;  1IBX A;  2YEP B;  4W9C A;  4EZJ A;  1JRO A;  1WMH A;  3W9C B;  3BY4 B;  3N1Y C;  2QHO A;  1UZX B;  4HDO A;  1PFD A;  1PGX A;  3GS2 A;  2YVC A;  3DWM A;  4ITK A;  1NYQ A;  1WYW B;  4MGK E;  2H89 B;  1KLG D;  2FCQ A;  1I4R A;  1JW9 D;  2WXH A;  1Q0W B;  4P1B C;  1QOA A;  4K7S A;  3TCA A;  3C19 A;  2L7R A;  1V81 A;  2XK5 A;  3Q8B A;  2KWV B;  1KRH A;  1WR6 E;  5BMI A;  2WU2 B;  1TS5 A;  2HTH A;  1TT5 B;  4HJK A;  3N30 A;  3CSF A;  2CR5 A;  2JT4 B;  3P42 A;  2M0X A;  1IGD A;  3AM9 A;  3PRP B;  3PZ7 A;  3X0W A;  4GXB A;  4GLS C;  4RGM A;  1NVI D;  4F7Z A;  4KGR A;  3QCA A;  3DBR I;  4LK0 M;  1E7V A;  3EGR A;  5LXI B;  2KQS A;  1WZ0 A;  3AE9 B;  4K3C A;  4EUT A;  4G0N B;  5D6J B;  1SGH A;  2DZK A;  2MCN B;  3N1X C;  1D5Z C;  3IG3 A;  3Q8A A;  2M17 A;  3Q8C A;  1WX9 A;  4IW0 A;  3UIP B;  3I5J C;  2B76 B;  3PRM B;  3A9J A;  4JLC A;  2G4S A;  3ZVV A;  2KOX A;  2KQ4 X;  4GU2 A;  3APD A;  5EE3 A;  1A5R A;  3JVZ X;  2JVC A;  3ZXV A;  2HDE A;  2IGD A;  2LJI A;  1WXM A;  2KDF B;  2KDI A;  4IDI A;  2J0J A;  3A33 B;  2LXA A;  1YQ4 B;  2GMI C;  1R4N I;  1WH3 A;  3L54 A;  4GMV A;  3AEE B;  1C77 A;  3PPA A;  2W55 A;  5G2N A;  1FMA D;  1N62 A;  3CF6 E;  4KGT A;  4II3 B;  1T0Q C;  4LJO B;  1U4A A;  1ZXH A;  3JW0 X;  1FPY A;  4QAY A;  4FHK A;  1JCK B;  2QMT A;  1FO4 A;  1FCC C;  3TEW A;  4BVU C;  3KLS X;  2M8S A;  3UIO B;  1SIJ A;  1VZ6 A;  2C7H A;  3RMK C;  1J7B A;  4WWO A;  4YL8 A;  2M1M A;  4HXD A;  3RNG C;  4B0M A;  4IM3 A;  1QIL A;  3H6N A;  2O6V B;  5IP4 D;  3T3N A;  4RGO S;  4DDI D;  4ZHP A;  2C7M B;  5AUI A;  2JWU A;  3ZNI D;  2WDV B;  3PGE A;  3UQB A;  2ACZ B;  1YNT E;  4MGI E;  5CHV C;  3N20 C;  2BYV E;  4C7Y A;  5J18 A;  4KX6 B;  4MT5 A;  2YLM A;  4XC2 A;  2Y3A A;  2BYF A;  2TSS A;  2KDB A;  2N9E B;  1LM8 B;  3MJ5 A;  5D7G A;  1V9J A;  4ANV A;  4PT5 A;  1BML C;  3T9L A;  1ACC A;  1WGK A;  3QK0 A;  3RD2 A;  2C5L C;  3ZKJ C;  2LD9 A;  2B3A A;  3U7D A;  4XZ4 A;  3DBH B;  2WGS A;  1SIF A;  3U2S C;  2AQ3 B;  1YIW A;  2DAJ A;  3UGB B;  2IO1 B; 
#chains in the Genus database with same CATH homology
 2KJR A;  3ZDM C;  2O6V D;  2L05 A;  4MJS B;  2CKH B;  3ZW3 A;  2ZNV B;  4W9D A;  1J0G A;  1XT9 B;  2PJH A;  3R7Q A;  2AL6 A;  4FN2 A;  4ANU A;  1J8C A;  2IO2 B;  4A20 A;  1Q1O A;  4TV3 A;  2ZVN A;  2K39 A;  5DPW A;  4BFR A;  4WJP A;  1WGD A;  2KKC A;  3DVG X;  4I6P A;  3QHT A;  1R4M I;  3ZRC A;  4DHZ E;  2JF5 A;  3ZTD A;  3DOW A;  4HPM B;  1IYF A;  5AZG A;  1Z5S B;  2GBR A;  5JZE B;  2MBB B;  2NBV B;  1P9D U;  4KSL C;  5CX3 A;  2W9N A;  2RD0 A;  5HKH A;  2K8H A;  2LRW A;  3NS8 A;  2RR9 A;  2WX1 A;  1AAR A;  3OJ4 B;  3LDZ E;  2KNB A;  2A4Z A;  1RFA A;  5TR5 A;  1WM2 A;  4OVU A;  2LI5 A;  2Z0E B;  1OTR B;  1Y8R C;  4W9K A;  4WWP A;  3VFK A;  3VUY A;  2G4D B;  3A1Q B;  5EDS A;  2DEN B;  3TJP A;  2R2O A;  4CHK A;  2IBI B;  4KVG B;  4GIV A;  5CHF A;  3M63 B;  1WJN A;  3QWZ B;  5FR6 A;  3ZO5 B;  2N4F A;  3UF8 A;  5DPT A;  1WJU A;  3WAO A;  4KSK C;  2MLB A;  2LAS A;  4IC7 B;  2MSE D;  4KZC A;  1S1Q B;  2HJ8 A;  2KWU B;  3ONS A;  1WJ6 A;  1VCB A;  3SD5 A;  4MM3 A;  1TGZ B;  1V5T A;  4EEW A;  2IO3 B;  3EHV A;  2K8C A;  5KHQ A;  3PZD A;  2KC1 A;  4BBN F;  4ZRJ A;  4HCN B;  2XEW A;  4EOY A;  2KJH B;  2AL3 A;  1E90 A;  3L17 A;  2IZV B;  1NI2 A;  2EKE C;  1OGW A;  2G3Q B;  4IWQ A;  2KVR A;  2KMC A;  3A4S C;  4EFO A;  1GG3 A;  1WX7 A;  4IWO A;  3WAP A;  3QAR A;  3UQA A;  4B9K A;  2KFJ A;  2Z59 B;  3CST A;  3DVN V;  4GN1 A;  4IM2 A;  2KWC A;  3WAL A;  2AYO B;  3W1S C;  4KZ0 A;  3P2B A;  3EEC A;  3VTW A;  2LZ6 A;  1V5O A;  3GOE A;  3AXC A;  5IA7 A;  2BF8 B;  4G11 A;  2AWT A;  3DBS A;  2ZCB A;  1IP9 A;  3KYD D;  1K8R B;  1ZKH A;  2KX3 A;  4MEL A;  1L2N A;  1EO6 A;  1X1M A;  3OLM D;  2NR2 A;  1EF5 A;  4LCD E;  2J0K A;  2ZPN A;  1PQS A;  5IAA C;  3OAW A;  3Q3F A;  5L95 C;  1XQQ A;  4W9E A;  3ML8 A;  4JL9 A;  1YD8 U;  3AU5 A;  2PEA A;  2ZNV C;  3TBL D;  2FUH B;  2IO0 B;  2DAF A;  1KOT A;  2JWZ A;  4HDQ A;  2ZVO A;  3BIN A;  1YJ1 A;  3KW5 B;  4AP4 C;  3V61 A;  3WA0 A;  1GJZ A;  2HD5 B;  2DYB A;  3DPD A;  4HCP B;  3K9P B;  3A4R A;  2FIF A;  1WX8 A;  3L08 A;  3V6C B;  3ZNH B;  3ENE A;  1P0R A;  1UH6 A;  3IHP C;  4BKS D;  1P1A A;  2WDT B;  1TBE A;  3PVL A;  2JRH A;  3H7P A;  1YQB A;  4BBN C;  2D07 B;  4FJV B;  5JHB A;  3PHW B;  3N32 A;  4E3C A;  1D3Z A;  1J19 A;  1G6J A;  1GC6 A;  2PE9 A;  1SE9 A;  4ANW A;  2K6Q A;  2LGX A;  1XD3 B;  2K6D B;  3ECI A;  4BOS C;  1WGH A;  4DBG A;  4ZRI A;  4X57 B;  4WJN A;  4FAD A;  5AEK B;  2GBK A;  3H7P B;  3PSE B;  2BPS A;  3QA8 A;  2MW5 A;  4NAW A;  4NJ7 A;  2MX2 A;  5GMV A;  3RUL A;  2LGD A;  4WWN A;  3ZIM A;  2IY1 B;  2L8J A;  2L0F A;  2KMA A;  3APF A;  3DDC B;  4P7I A;  2O2V A;  3TMP B;  2OJR A;  4AUQ C;  2KFK A;  3ZTC A;  3I3T B;  3W1Y A;  1WE6 A;  4CO7 A;  3VUW A;  3PRE A;  4NAW B;  4LJP B;  3APC A;  3VHT C;  4FUL A;  2J7Q B;  3LJ3 A;  4E71 A;  2KQ7 A;  1V49 A;  2PE6 B;  4ANX A;  2O2V B;  3ZNZ B;  2KFK B;  1V86 A;  1EF1 A;  1BT0 A;  3Q3J A;  4NPN A;  3V6E B;  2R2Q A;  4GSW A;  3AI5 A;  4E74 A;  2DZI A;  4EZL A;  1C3T A;  1QZE A;  4KDI C;  2KLG A;  2LWP A;  4XX5 A;  4KIK A;  2DZM A;  2NBW B;  1JRU A;  2FID A;  1ISN A;  4JIO U;  3X23 A;  2NBU A;  3GZN I;  2L0T A;  2D3G A;  2MRP A;  3A1Q A;  4K7W A;  4ZYN A;  3VUX A;  4DDG D;  5C1Z A;  4MGZ E;  3DVN U;  1KJT A;  4KIK B;  1P98 A;  2C60 A;  3VTU A;  3QX1 A;  5E6P A;  2KC2 A;  3A9K A;  1UBI A;  4PS7 A;  4FHJ A;  3ZNG C;  1VD2 A;  2OOB B;  1E5W A;  4F1S A;  5AZH A;  3RZW C;  3VXW A;  2KO3 A;  3WAN A;  4LDT B;  3A9K B;  2LVQ A;  2K25 A;  1WGG A;  3KUD B;  2L76 A;  4BKS A;  4MSQ B;  1RAX A;  4B6W A;  4HVB A;  4AWJ A;  2NCN A;  2EMT A;  2FCN A;  2KHW B;  4GDK A;  5J2R A;  2Y5B B;  3O65 B;  4AJY B;  1MG8 A;  2K1F A;  4J6I A;  3H9D A;  2LUE A;  2BWE S;  3WAM A;  2G45 B;  2FCS A;  5L83 A;  2WWZ A;  3DVG Y;  1GC7 A;  2D2Q A;  2KN5 A;  3PTF C;  2V3S A;  4GDK B;  2JZ3 B;  1T0Y A;  4NJ6 A;  1WM3 A;  3NZS A;  4ZDV A;  1GUA B;  4HK2 A;  4FLH A;  4IM0 A;  4ICV A;  2NPT A;  4MH0 E;  4JGH B;  4W9I A;  3AUL A;  1WZ3 A;  3RCZ A;  4F8C B;  1NDD A;  2CHZ A;  1WIA A;  3VVW B;  4A3P A;  2J0M A;  1E8X A;  1WGR A;  2NPT B;  2ZCC A;  2N7E A;  2C9W B;  3PT2 B;  4GDL A;  2IYD B;  2L00 B;  2XBB C;  3RYT A;  3HHM A;  3VH4 B;  2MBO A;  5DPR A;  4W9H A;  2MWS B;  4DHJ B;  1S3S G;  2MQJ A;  2D11 A;  2A5U A;  3PLU A;  3U30 A;  1H4R A;  3KUC B;  1WI0 A;  3PRZ A;  4GDL B;  1GNU A;  3ZUN A;  5JH5 C;  4WJQ A;  2KTR A;  2K8B A;  1LQB A;  3PV1 A;  3NOB A;  2KDE B;  4DWF A;  3QIJ A;  2MP2 A;  3B0A A;  1WRD B;  4MGY E;  4LDT D;  2AEH A;  4W9C A;  4EZJ A;  1WMH A;  3RZF A;  5JHA A;  1WXS A;  2DYM A;  3ML9 A;  2KK8 A;  2KAN A;  2KTR B;  3BY4 B;  4HLE A;  2MP2 B;  2QHO A;  1UZX B;  2C7N B;  2CU1 A;  4HDO A;  2ZJD A;  2CHX A;  4B95 A;  2M4N A;  1KM7 A;  2CHW A;  2L3Z A;  1F9J A;  5DPS A;  2VRR B;  4HWI B;  2YVC A;  1WMH B;  2CS4 A;  1C1Y B;  4OVV A;  4G3X B;  1WYW B;  4KV2 A;  2ZZP B;  1Q5W B;  4GOC A;  2ZEQ A;  4MGK E;  4W9G A;  3RUI B;  1Z2M A;  3SDL C;  4FJY A;  3D32 A;  3UIN B;  2LRU A;  3JSV A;  2WYQ A;  3MJW A;  2FCQ A;  2JRI B;  2GBN A;  2JUO A;  1Q0W B;  1OEY A;  5G55 A;  2EMS A;  2MBQ A;  1UBQ A;  3W1S A;  4K7S A;  2BKR B;  4DXA B;  3TCA A;  1WR1 A;  4RMA A;  2L7R A;  1V81 A;  2XK5 A;  5E6N A;  5LLI A;  2KWV B;  4BKT A;  3JSV B;  1WR6 E;  5E6O A;  1WFY A;  3VH3 B;  3V62 A;  2HTH A;  2RGF A;  3CMM B;  2UYZ B;  2MBE A;  3HIZ A;  4HJK A;  3K9O B;  3N30 A;  1E8Y A;  3CSF A;  1RLF A;  1UGM A;  1WF9 A;  1IPG A;  2CR5 A;  2JT4 B;  3V60 A;  2M0X A;  2XK5 B;  3PRP B;  5DCN A;  1I35 A;  3HM3 A;  4DHJ D;  4NQK E;  3X0W A;  2GOW A;  2N9X A;  4GXB A;  2N7D A;  4TQ0 A;  3EC8 A;  3NHE B;  2NVU I;  4F7Z A;  3KVF B;  4G50 A;  3VTV A;  3WIM A;  4AJW A;  3PLV A;  3QCA A;  3DBR I;  1UD7 A;  1E8Z A;  2BYE A;  1WJ4 A;  2DX5 B;  4M8N A;  1E7V A;  3M3J A;  4IG7 B;  5LXI B;  1V80 A;  2KQS A;  1WZ0 A;  4IUM B;  5J17 A;  3ZLZ A;  1WE7 A;  3B1L X;  4EUT A;  2PPH A;  2BGF A;  2LXC A;  4G0N B;  5D6J B;  1FXT B;  1SGH A;  2Z0D B;  1M94 A;  4RM8 A;  1KLV A;  3H1U A;  2DZK A;  2MCN B;  4WJO A;  4A3O A;  1H8C A;  2KZR A;  3NZU A;  2RPQ A;  3IG3 A;  2M17 A;  3M95 A;  3PHX B;  3R7R A;  4DHZ B;  1WX9 A;  4IW0 A;  3UIP B;  1ZGU B;  1P3Q U;  1ZW7 A;  3PRM B;  5AZF A;  3A9J A;  4JLC A;  3U8Z A;  2G4S A;  3JYU A;  2LVO A;  3ZVV A;  2KOX A;  2LJ5 A;  3TL5 A;  4GU2 A;  4ASW C;  2KLC A;  3APD A;  1A5R A;  4NQL B;  2KJ6 A;  2JZZ A;  3AU4 A;  2JVC A;  3JVZ X;  4W9F A;  4MEM A;  2UWQ A;  1WXM A;  3A9J B;  3VQI A;  1WXA A;  4WQO B;  1RRB A;  2KDF B;  4N9F 4;  1TTN A;  2KDI A;  2J0J A;  4GGQ A;  4K7U A;  3MTN B;  3A33 B;  4IWP A;  3QJZ A;  4MSM B;  3SU8 X;  3PS6 A;  2FNJ B;  2LXA A;  3IBE A;  1WGY A;  4PYU A;  4PS8 A;  2LGY A;  2GMI C;  1R4N I;  3DBL I;  4I6N B;  4M8M A;  1WH3 A;  2BWF A;  1WXV A;  2ASQ A;  3L54 A;  4GMV A;  3C0R B;  3DCG A;  3PPA A;  2I1J A;  5G2N A;  4FA6 A;  4I6L B;  4BOZ B;  3CF6 E;  3HM6 X;  4II3 B;  2FCM A;  2DZJ A;  2BKF A;  1YX6 B;  3DBH I;  4LJO B;  1U4A A;  3JW0 X;  3M62 B;  2KD0 A;  4GB9 A;  1V2Y A;  1OEY J;  2GBJ A;  3N3K B;  4FHK A;  4W9J A;  2RSU A;  4HPL B;  2WX0 A;  2MA9 B;  3QQ8 B;  4BVU C;  1L7Y A;  2M8S A;  2N1W A;  3UIO B;  1LFD A;  1OQY A;  2JY6 A;  2MBH A;  2O6V A;  4K1R B;  4MDK E;  4TKN A;  4EZK A;  1E7U A;  5LXH A;  3QC8 B;  4DK5 A;  4ICU A;  2C7H A;  3TIX A;  4FBJ B;  3IFW B;  4WWO A;  2DHZ A;  4YL8 A;  1YX5 B;  2M1M A;  1WY8 A;  4HXD A;  4TUU A;  4IM3 A;  3R66 C;  3OJ3 A;  1UEL A;  3KH0 A;  3H6N A;  5CTR C;  3L0W B;  4KDL B;  2O6V B;  4NY0 A;  5KHO A;  3L10 B;  4EKU A;  2I1K A;  3S2A A;  4BKG A;  4DDI D;  3R3M A;  2C7M B;  2N9P C;  5C23 A;  3HK0 A;  2DYO A;  1TZ1 A;  2JPH A;  3IVF A;  4NNJ B;  1CMX B;  3ZNI D;  3ALB A;  4AOF A;  3PGE A;  5CHW A;  1V6E A;  3UQB A;  3ZDT A;  4MGI E;  1E8W A;  4W9L A;  4WAA A;  5CHV C;  2BYV E;  1EUV B;  3VAW A;  4RM9 A;  5J18 A;  4TQ1 A;  2YLM A;  4XC2 A;  2BYF A;  4K81 A;  2KDB A;  2N9E B;  3EFU A;  3NY5 A;  4JQW C;  5D2M B;  1I42 A;  2NS5 A;  2LVP A;  3T8M A;  4M0W B;  1LM8 B;  2D10 A;  1HE8 A;  5D7G A;  1V9J A;  3B08 A;  3VDZ A;  4ANV A;  3QAQ A;  4PYZ A;  3L13 A;  3RT3 B;  3T9L A;  3MHS D;  3QK0 A;  5BO4 B;  2ZPY A;  2HE7 A;  3RD2 A;  2C5L C;  3SHQ A;  3ZKJ C;  2GBM A;  2KTF A;  2LD9 A;  2V4L A;  2B3A A;  2KX0 A;  4II2 B;  4XZ4 A;  3U7D A;  4PS3 A;  3ZRF A;  2IY0 B;  3DQV A;  2KXJ A;  1SIF A;  4ZRK A;  4FJZ A;  1LXD A;  4MJS A;  1NBF C;  4CYE A;  3H7S A;  2V1Y A;  2REX A;  5D94 A;  3KYC D;  4URK A;  1YIW A;  2DAJ A;  2JXX A;  2FAZ A;  3KUZ A;  2N1V A;  3UGB B;  2IO1 B;  3L16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...