2FCMA

X-ray crystal structure of a chemically synthesized [d-gln35]ubiquitin with a cubic space group
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
73
structure length
72
Chain Sequence
LQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the energetics of protein alpha-helix C-cap termination through chemical protein synthesis.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Ubiquitin
total genus 23
structure length 72
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2fcmA00
1WJUA 2KDBA 3DCGA 3WAMA 1OEYJ 3O65B 4AJYB 2PPHA 4MGIE 2LVQA 2KNBA 2NBWB 3A9JB 1TGZB 3K9OB 1P98A 4KVGB 5D6JB 1R4NI 2M1MA 3H6NA 1LFDA 4GIVA 3VQIA 2GBJA 4GDKA 4WJNA 2C5LC 1KLVA 3ZRCA 3RZWC 3V6EB 3DVGY 1F9JA 3DVGX 3U7DA 3TIXA 1T0YA 2K6QA 2CKHB 2KANA 2FAZA 4KSKC 3L10B 5AZFA 4W9FA 4WQOB 1P1AA 3A9KB 4AJWA 4AUQC 4G50A 4W9LA 2CS4A 2I1JA 1UBQA 4K81A 5G2NA 4MEMA 4DBGA 4G0NB 3IVFA 1WX7A 2ZCBA 3RULA 4XX5A 2AWTA 3L54A 4W9JA 4WAAA 3VH4B 4BOZB 1I35A 3HM3A 3KYCD 5GMVA 1UGMA 3ZDTA 2M17A 2MCNB 5D2MB 1WRDB 1H4RA 2DHZA 2KFKB 3B0AA 4FHKA 4EZLA 2IYDB 2LRWA 2KQSA 3OJ4B 4TQ1A 3MHSD 4IM3A 1J0GA 2C7MB 4GN1A 2REXA 2NS5A 2Z59B 1WX9A 2KTFA 2M8SA 2DAJA 1OGWA 2JF5A 2KC1A 3DDCB 3DVNV 2XEWA 4EZKA 5TR5A 5EDSA 3KVFB 1L2NA 3W1SA 2K1FA 3VAWA 2AL3A 2G4DB 4RM9A 1E8ZA 2CHXA 2DYOA 3KW5B 4MDKE 1WF9A 1SGHA 3VDZA 1J8CA 2K6DB 1KOTA 3A9KA 4KZ0A 1UELA 3VFKA 3K9PB 2MBHA 3VUWA 4ANVA 1XD3B 4MJSA 2MBBB 3PHWB 3UIOB 2N1VA 5C1ZA 4JGHB 5J18A 1UBIA 5BO4B 2O6VD 2DZJA 2YVCA 2KDEB 3AU5A 4FJVB 4CYEA 1GG3A 1Y8RC 1EUVB 4K1RB 3U30A 5LXIB 1I42A 5CHFA 3DVNU 1YQBA 1V6EA 3JYUA 5JHBA 2D11A 4XC2A 3ZUNA 3HM6X 2WX0A 2KDFB 3KUZA 3HK0A 1IP9A 2KXJA 1E7UA 2RGFA 3ML8A 4XZ4A 1TZ1A 1OEYA 1GUAB 3TL5A 4LJPB 2IZVB 4KIKA 3RYTA 3CF6E 1V9JA 2DYMA 1WH3A 1RRBA 3V61A 1EO6A 1WXMA 2A4ZA 2WX1A 4K7WA 2RR9A 5CTRC 2LASA 1VCBA 1WYWB 3VTVA 3VTUA 1OTRB 2IO3B 3WIMA 4G11A 2LWPA 3APCA 3UF8A 2IO1B 3ENEA 3AXCA 1K8RB 2CHZA 2L00B 3V62A 4FADA 2IY0B 4MGYE 1LM8B 4KSLC 3QQ8B 2EKEC 4I6PA 2N4FA 1NI2A 3ZNID 1WGHA 3M3JA 2C7HA 4MGKE 4GMVA 2V4LA 2ASQA 2MBEA 5KHOA 4A20A 2LUEA 3LDZE 4LCDE 4ZYNA 1KJTA 2DZMA 2KVRA 1V5OA 3NS8A 3TBLD 2BWES 2VRRB 2IO2B 4GDLA 3TCAA 3PRZA 3PLUA 5DCNA 3VH3B 2ZPYA 4GGQA 4MM3A 2MQJA 3AULA 3DBRI 2KN5A 3DPDA 4NJ6A 3W1SC 2NPTA 1V86A 1TBEA 1JRUA 1V80A 2ZVNA 3L08A 3NHEB 3RT3B 1E8WA 2O6VB 3QJZA 4W9EA 4PYZA 4EEWA 2CR5A 2ZJDA 2L05A 1D3ZA 3HIZA 1V49A 2G3QB 1P0RA 2N9PC 4FULA 3DOWA 3EHVA 2C60A 2KFJA 2LGYA 4RM8A 2KLCA 2ZNVC 4OVVA 2DYBA 2ZEQA 2UWQA 2K25A 3VHTC 3OAWA 3WA0A 4KIKB 2AL6A 3DBLI 2GBNA 2LRUA 2L3ZA 4II2B 2D10A 3N30A 1EF5A 3DQVA 1YD8U 2BYFA 2D07B 5JZEB 5D7GA 3EECA 3WALA 2JPHA 3A4RA 4PS8A 1Z2MA 2MBOA 2Z0DB 5CHWA 2GBKA 5CX3A 2XBBC 2K8CA 3PGEA 3A9JA 2JUOA 1YJ1A 4I6LB 2QHOA 4OVUA 4G3XB 2FCMA 4HPMB 1SE9A 2JZ3B 2J0JA 2KKCA 4J6IA 3Q3FA 3U8ZA 3ZLZA 4GDKB 2DENB 1SIFA 3OJ3A 3UQBA 2DZIA 1OQYA 1WGRA 1ZGUB 3DBSA 3IBEA 4EOYA 4E74A 4IC7B 1WGDA 2KX3A 4MH0E 4CHKA 2KLGA 3OLMD 2ZCCA 4B6WA 3A33B 3V6CB 2JXXA 3RCZA 3ALBA 3LJ3A 4KDIC 2A5UA 3KYDD 4NY0A 4EUTA 3UIPB 2KJ6A 4M8MA 1E7VA 1WY8A 3D32A 2O6VA 4KZCA 5E6NA 1FXTB 2NR2A 2WDTB 2MA9B 1G6JA 4GOCA 1GC6A 2BKRB 4HPLB 2EMSA 2N7DA 5DPWA 2KTRB 2RPQA 1S3SG 2LD9A 3I3TB 1WR1A 2MP2A 4PYUA 4LDTB 1EF1A 3ZNZB 3ZVVA 2UYZB 4W9GA 3L0WB 3UGBB 4EKUA 1V5TA 1C1YB 3RUIB 2HE7A 2LI5A 4F8CB 2V1YA 2LJ5A 3JSVB 2J0KA 3ZRFA 5D94A 3QHTA 2BYVE 2L0FA 2O2VB 4FLHA 3NZUA 4ICUA 4W9HA 5HKHA 1GC7A 4URKA 1YIWA 3JW0X 3PLVA 4NPNA 2CU1A 3B08A 4ANWA 1LQBA 1E5WA 1WJNA 3PRPB 1ZW7A 3NZSA 4KV2A 5L95C 3M95A 5E6OA 4TKNA 5JH5C 2FCQA 3EC8A 1YX5B 4WJOA 2LGDA 3L17A 4ZRIA 2N9EB 3SU8X 3H7PA 3T8MA 2OJRA 2I1KA 4LDTD 1WR6E 4W9CA 3ZNHB 4E71A 4PS7A 4X57B 2D3GA 3NOBA 3BY4B 2L7RA 5IAAC 2MBQA 4JL9A 3ZO5B 1WMHA 4DWFA 4E3CA 5KHQA 5AZHA 4WJQA 1YX6B 1S1QB 2AYOB 3PREA 4FJZA 2MX2A 3APFA 3NY5A 3ZW3A 2BF8B 2JT4B 3WANA 4ICVA 3JSVA 2HJ8A 2CHWA 2NBUA 2KTRA 2LVOA 5FR6A 3SD5A 3M63B 4DHZB 4HDQA 4FJYA 4I6NB 5LXHA 3QCAA 4B9KA 1ISNA 2JY6A 5JHAA 2KWVB 1H8CA 3PS6A 4IWPA 4HCPB 1UZXB 3ML9A 4AWJA 4FN2A 1UD7A 4HK2A 1WIAA 4BBNF 2FNJB 1IYFA 2GBMA 4ANXA 3QX1A 1UH6A 1WM2A 2MLBA 3KH0A 2PJHA 2DZKA 3TMPB 2FCNA 4DK5A 2L76A 3ONSA 3QA8A 2J7QB 4GDLB 4BOSC 4FA6A 2O2VA 4ASWC 3QAQA 1R4MI 4BBNC 2M4NA 2LZ6A 5LLIA 1XT9B 4JQWC 2FIDA 4WWOA 1GNUA 3ZDMC 2LXAA 3VUYA 3AI5A 3ZTDA 2NPTB 1WE7A 3BINA 3KUCB 3WAOA 4YL8A 2IO0B 2PEAA 3EFUA 3IFWB 2BKFA 2FCSA 3UINB 1E8YA 1NDDA 3Q3JA 4K7SA 4GXBA 5DPRA 3R7QA 3X23A 2JRHA 1WXAA 2KJHB 3PPAA 3H7PB 4ZRJA 2WWZA 3GOEA 2NBVB 4DXAB 3A1QA 2GBRA 1GJZA 3MTNB 4NQKE 5IA7A 1Q0WB 1WMHB 3A4SC 2IY1B 3QARA 4EFOA 1RAXA 3ZTCA 3VXWA 3VVWB 3CSTA 4HCNB 4P7IA 5DPSA 1BT0A 2HD5B 4LJOB 2KMCA 3T9LA 1AARA 4HLEA 3QWZB 1WZ3A 2LVPA 1E90A 2MW5A 1WI0A 1P3QU 4IM0A 4BKTA 4DHJD 4EZJA 4IUMB 3B1LX 3QC8B 2KX0A 3PZDA 4K7UA 4NJ7A 2KFKA 1WJ6A 2KZRA 1LXDA 2C7NB 4A3PA 2DAFA 4MJSB 4MELA 1ZKHA 2MSED 4ZDVA 2KOXA 4HDOA 4FHJA 1TTNA 1WM3A 1RLFA 3HHMA 1M94A 3QK0A 3TJPA 2BGFA 3R3MA 2N7EA 2FIFA 4IG7B 4MGZE 1VD2A 2KC2A 1U4AA 2KK8A 2D2QA 2IBIB 4HWIB 4PS3A 2JVCA 5AEKB 2KWCA 3VUXA 4JLCA 2BPSA 4IW0A 3H7SA 2AEHA 2EMTA 3W1YA 1WZ0A 4F1SA 3A1QB 3P2BA 1MG8A 3ZKJC 4AP4C 5L83A 2ZPNA 4W9DA 2FUHB 2KJRA 2WYQA 1Q5WB 1IPGA 4NNJB 2YLMA 1WXVA 4GB9A 5AZGA 2KHWB 1RFAA 4WJPA 2ZVOA 3PRMB 2BYEA 4MSMB 3C0RB 4KDLB 1WXSA 4WWPA 3L16A 4DDGD 2MP2B 3L13A 4IWQA 3ZIMA 4IWOA 3MJWA 3M62B 2KD0A 1E8XA 4B95A 2KMAA 1KM7A 4ANUA 1WGGA 3PSEB 3PVLA 3CSFA 2J0MA 3WAPA 2G4SA 1WE6A 4NAWB 4BKSD 1QZEA 2XK5B 4AOFA 3X0WA 4M8NA 3R7RA 3ZNGC 4TUUA 1NBFC 4NQLB 2KWUB 2M0XA 2L8JA 2B3AA 2V3SA 4TV3A 2NVUI 4BVUC 4HVBA 2L0TA 1P9DU 4WWNA 4DDID 1PQSA 2GOWA 2PE6B 3H1UA 3PHXB 3S2AA 2G45B 1X1MA 2OOBB 2Y5BB 4FBJB 2PE9A 3H9DA 2ZZPB 4GU2A 4W9KA 1A5RA 3R66C 2KDIA 1Z5SB 1HE8A 2MWSB 3CMMB 2BWFA 4HXDA 4ZRKA 4DHJB 1WX8A 3UQAA 2KO3A 1CMXB 2C9WB 2R2OA 1C3TA 3PV1A 5CHVC 3PTFC 2RSUA 3JVZX 3V60A 2K8BA 2LGXA 4GSWA 2NCNA 2K39A 4II3B 3SHQA 3ECIA 4NAWA 3KUDB 4N9F4 4BKSA 2XK5A 2LXCA 3SDLC 3IG3A 2W9NA 3GZNI 4JIOU 2GMIC 2JWZA 2HTHA 3QIJA 2KQ7A 3AU4A 4F7ZA 3DBHI 5J17A 4RMAA 2RD0A 2N9XA 4BFRA 4W9IA 2MRPA 5E6PA 3RD2A 3VTWA 2JRIB 4DHZE 1XQQA 2DX5B 3APDA 4CO7A 2Z0EB 1V81A 4M0WB 1J19A 3RZFA 5DPTA 1WJ4A 1V2YA 2K8HA 5G55A 2ZNVB 4IM2A 4A3OA 2JZZA 3N32A 4MSQB 3IHPC 4TQ0A 2R2QA 1WFYA 1Q1OA 2N1WA 3N3KB 4BKGA 5C23A 3PT2B 1WGYA 4HJKA 5J2RA 1L7YA
chains in the Genus database with same CATH superfamily
4AJYB 2CU3A 3H6NA 4C00A 4GDKA 1KLVA 1T0QC 1XLOA 3RZWC 3V6EB 3N1ZC 3GE3C 4HPPA 1FCLA 1F2RI 3IXSA 2V9HA 2FAZA 2JZPA 4G50A 4MEMA 4DBGA 2D3CA 3L54A 4WAAA 2D3AA 3NVYA 1UGMA 2KWDA 2M17A 2MCNB 2EKIA 4MT5A 1EM7A 3J9CA 2KQSA 4IM3A 1J0GA 3TEZA 2Z59B 1WX9A 2KTFA 2JF5A 2M8SA 2LGIA 4EZKA 3DVNV 4Q2JA 3KVFB 2K1FA 2G4DB 4RM9A 2DYOA 2K6DB 3RPFC 4KZ0A 4N6EB 3VUWA 3K9PB 2MBBB 2R61A 2X8XX 5J18A 5BO4B 2O6VD 4FJVB 4HKZE 1V6EA 5JHBA 3ZUNA 3HM6X 4LLGM 3ML8A 1TKGA 3W9CB 1OEYA 1YQ4B 1FFUA 3GS2A 3RYTA 1V9JA 1RRBA 3EFCA 3TIXA 2RR9A 3VTUA 1MG4A 4LTUA 4YSYB 2EKEC 2L32A 2N4FA 2JYTA 4MGKE 4GMVA 2MBEA 5FK9C 4LCDE 1TZOA 3NS8A 3TBLD 4GDLA 5DCNA 1PUTA 2MQJA 1WSPA 1OFFA 2V4IB 4NJ6A 3BZDB 2NPTA 4LNKA 3L08A 2ZVNA 1E8WA 4W9EA 2ZJDA 3RNBC 2L05A 1V49A 2I38A 2C60A 3EHVA 4RM8A 2DYBA 2SAKA 4RGNA 1R4NB 3P42A 2LRUA 2FBWB 4YT0B 4YXDB 4LNOA 2ON8A 2BYFA 3WALA 3A4RA 4PS8A 1Z2MA 2D5GA 5BYSA 1NVID 2QHOA 4OVUA 4G3XB 2NMQA 2J0JA 1FPYA 4GDKB 2DENB 1QOAA 4E74A 1YOVB 3URYA 1TYGB 3IAS1 3V6CB 2MJ3A 3UIPB 2WXHA 1E7VA 1HQRD 1FXTB 2NR2A 1G6JA 4HPLB 1C78A 2G9HD 5DPWA 2PVGC 2KTRB 2RPQA 4DQOC 3I3TB 3ZJUA 4JX1C 1I7HA 4LDTB 2UYZB 4W9GA 3L0WB 1V5TA 1BMLC 1C1YB 3RUIB 1TS3A 2HE7A 2LJ5A 3SEBA 3JSVB 2J0KA 1TS5A 1N5XA 3T3OA 2O2VB 2PTLA 1PGBA 2I2YA 3JW0X 4NPNA 3B08A 1LQBA 3MFGA 4LNFA 3NZSA 2CJNA 5JH5C 2LGDA 3L17A 5IP4D 1JMLA 4X57B 5IAAC 4DWFA 4E3CA 5AZHA 1XO3A 3NY5A 4YSZB 4ICVA 4OZBA 1FFVA 1L0XB 4O1NA 4HDQA 4I6NB 5LXHA 4IDIA 1H8CA 3ML9A 4FN2A 2K9XA 4M0WA 1IYFA 1E9MA 1YJIA 1UH6A 2LGSA 3I5JC 1TY2A 1RYJA 2LHDA 4GDLB 4BOSC 3N20C 4ASWC 3QAQA 4BBNC 4C7YA 2LXAA 3AI5A 1PYWD 3KUCB 3WAOA 4A9AA 2PMVA 2IO0B 1ROEA 3EFUA 3IFWB 3Q3JA 3R7QA 4ZRJA 4L23A 2LHEA 4N58A 3MTNB 1AWDA 1RAXA 3CSTA 4AQ7A 1ZP0B 5DPSA 1R4MB 2E3TA 3E56A 4IM0A 2LVPA 1E90A 1ZOYB 1HTOA 1P3QU 3AE2B 1KH0A 4DHJD 4IUMB 4EZJA 3B1LX 3RNAC 3QC8B 1YQ3B 3B9JA 1LXDA 2C7NB 2DAFA 4MJSB 1FCCC 1MFWA 5IO9A 2KOXA 4HDOA 4FHJA 1I4HA 1RLFA 1N5WA 2FIFA 2MJDA 3U7ZA 1PDXA 2ZW1A 2IBIB 4HWIB 2AQ3B 3DHIC 1C76A 4CQNA 1GAQB 2JYEA 3W1YA 4F1SA 3A1QB 5IKCM 1L4ZB 3ZKJC 5L83A 2N9LA 3AH7A 3Q8FA 4ZRQA 1IPGA 2YLMA 2INPE 4NAMA 3RNCC 2KHWB 4MACA 2LMCA 3C0RB 4KDLB 3DWGC 3ZIMA 2J53A 3M62B 1E8XA 4KKJA 2KMAA 1WGGA 3CSFA 3WAPA 1F0ZA 1WE6A 4BKSD 1QZEA 2J52A 3X0WA 4M8NA 1L5PA 4NQLB 5H8YE 2B3AA 4TV3A 2NVUI 1P9DU 4C80A 4DDID 3MC8A 2G45B 1FXAA 4DXFA 2GI9A 2OOBB 3P4PB 2Y5BB 2PE9A 3BK2A 5BYQA 3Q2AC 3ZXVA 4GLSC 2ZZPB 3HRDD 4GU2A 4W9KA 1QOBA 3R66C 4US9A 3CMMB 4HXDA 1WX8A 1ACCA 2C9WB 2K0PA 2H88B 2QC8A 2R2OA 2J42A 4J3OD 3BK1A 5CHVC 2JQRB 2LGXA 2K39A 4II3B 3SHQA 3ECIA 2V0GA 4NAWA 2LXCA 1VR9A 2RPVA 2HJ1A 4F7ZA 3DBHI 4RMAA 1F77A 4BFRA 1YMHE 3RD2A 2JRIB 3GB1A 1KRHA 3O13A 2Z0EB 1V81A 4M0WB 2PKOA 1N63A 4A3OA 1WWTA 4TQ0A 3N3KB 5C23A 1WGYA 1XXGA 4LNIA 4IOIE 2KDBA 3EA6A 1OEYJ 2PPHA 2LVQA 1TGZB 3RNGC 2BVCA 1VZ6A 3HVZA 3KLSX 2BB6A 1V97A 3RNFC 1D5XC 3DVGY 3RNEC 3AE9B 2KANA 1NYQA 3L10B 5AZFA 4W9FA 1P1AA 3A9KB 2CS4A 2I1JA 3AB5A 4K81A 4JE3B 5H92C 3RULA 1NENB 4XX5A 3HM3A 3N1YC 3ZDTA 3BYYB 1H4RA 2IYDB 3MHSD 1ZUD2 3R2IA 1SIJA 2C7MB 2NS5A 2K22A 1HEZE 1XCTL 2KC1A 5TR5A 2AL3A 2WXPA 3KW5B 4MDKE 1SGHA 3VDZA 2Y3AA 1I4XA 1UELA 3VFKA 1J7CA 2WU5B 4RFBA 3UIOB 2GRIA 2N1VA 4JGHB 4RGOS 2YVCA 2DZJA 2KDEB 1GG3A 1FEHA 3DVNU 1YQBA 1FM0D 4XC2A 4ARCA 2WX0A 3HK0A 2QEJC 1R7SA 1TZ1A 3TL5A 2KT7A 3V61A 1EO6A 2A4ZA 2WX1A 5CTRC 1XF5L 2LASA 3VTVA 3WIMA 2LWPA 3APCA 3BVGA 3ENEA 3V62A 1ZE3D 2CHZA 4FADA 1CJEA 4HKQA 1LM8B 2FUG1 1NI2A 3ZNID 1F52A 4A20A 3GZNB 2LUEA 3LDZE 5C3JB 4KKIA 1V5OA 5HG2A 1QOGA 2VRRB 2IO2B 3PLUA 4GGQA 1N61A 3W5VB 3NUHB 1V86A 1TBEA 3Q6BA 3AEFB 3AMZA 2BQQA 4PYZA 4EEWA 2CR5A 1ZXHA 3HIZA 3L4PA 2AQ2B 2ZNVC 4OVVA 3WA0A 4KIKB 2AL6A 4XE0A 3B2GA 2L3ZA 1HZ6A 1RM6C 1YD8U 5D7GA 2JPHA 3V3XA 2Z0DB 2GBKA 1GOZA 4HPMB 3Q3FA 3U8ZA 3ZLZA 1E0ZA 2JU6X 3AE5B 3OJ3A 3UQBA 2DZIA 1YNTE 3AEAB 1QQRA 2UU7A 2VZKD 2LJIA 4IC7B 3Q8EA 4MH0E 1TS4A 2BS4B 4CHKA 3OLMD 3A33B 2JXXA 1T0RC 3ALBA 3LJ3A 3KYDD 4NY0A 1IUEA 1YN4A 2KJ6A 1WY8A 1T5XD 2WDTB 3FILA 2BW2A 2EMSA 4LK0M 2W54A 2LD9A 2E6XA 1L4DB 4S0RA 3ZNZB 1AW7A 4EKUA 2XN9C 2KDMA 1PGXA 2LI5A 4F8CB 3AV8A 5EE0A 1V1PA 3P4RB 1SXTA 3N9YC 4FLHA 2IGGA 5BYRA 4W9HA 5HKHA 1GC7A 1JROA 3PLVA 2CU1A 2X38A 1E5WA 3PRPB 1J7AA 5L95C 5E6OA 3SFDB 3NVZA 2M56B 1V8CA 5IOIA 3EC8A 4MH8A 2N9EB 3R2TA 3T8MA 4LDTD 1Q10A 1RFKA 5KHQA 1DOIA 2MBQA 3ZO5B 1WMHA 1CZPA 1YX6B 2BF8B 3WANA 1XEEA 2HJ8A 1K50A 2NBUA 5BMIA 1HZ5A 1UWXA 4DHZB 2L52A 4YWGG 1ISNA 5JHAA 4K3CA 2KWVB 1EU4A 2RDBC 4HK2A 2N7JA 4BAXA 4ANXA 4C4VA 1D5MC 1STEA 2K3UA 2B76B 4OHJA 1VDVA 4WWOA 3VUYA 3ZTDA 1WE7A 4WWMA 5LNK1 1SJHD 1MHHE 2PEAA 2FCSA 3AM9A 2WLBA 1E8YA 4RGTA 3UINB 4L1BA 1TT5B 5DPRA 1C79A 4MM3B 3A1QA 2GBRA 1GJZA 1ZDXA 2LEKA 3A4SC 3PZ7A 5G5GA 3ZTCA 4M02A 2SEBD 3WCQA 1IGDA 3AECB 1AARA 3QWZB 1WZ3A 1WI0A 4K7UA 4NJ7A 2IDYA 2KFKA 4MELA 1ZKHA 4ZDVA 1HTQA 3AE8B 2N7EA 5MPOA 3NG0A 2KK8A 4XDDA 5D3DA 4PS3A 3TEWA 4RF0A 1ESFA 4M00A 1WGKA 1WZ0A 3P2BA 4W9DA 2FUHB 2KJRA 1JCKB 2YEPF 4GB9A 5AZGA 1XLPA 3CIRB 1IGCA 2ZVOA 4AS1A 3PRMB 1TS2A 2BYEA 2MH7A 1WXSA 4WWPA 3RN9C 4B0EA 3L16A 4IWQA 2MEKA 2KD0A 4B95A 4ANUA 3PSEB 2J0MA 1PGAA 1WXQA 1P7EA 4LNNA 3VR8B 2XK5B 4WURA 1V1PB 4JPSA 4TUUA 4YTNB 3BYTB 4PT5A 2BYTA 4ZOHC 1ZXIA 2GOWA 2PE6B 1P7FA 3PHXB 3AE6B 1FRRA 2GLSA 1SB3C 3BVZA 2FE8A 4WAFA 4DHJB 1CMXB 2WXQA 2QIEB 1T3QA 3JVZX 1N6ZA 1T0SC 5JXVA 3BWUD 4XWWA 4N9F4 2W9NA 4JIOU 2HTHA 2KQ7A 4ACFA 2RD0A 2MRPA 3DBRB 1XQQA 3APDA 4REZA 1J19A 1WJ4A 2ZNVB 4IM2A 2JZZA 4MSQB 3IHPC 1WFYA 2N1WA 3IT6B 5J2RA 2DBYA 3WAMA 1FO4A 4MGIE 2KNBA 1P98A 5D6JB 1KFYB 1R4NI 2M1MA 1LFDA 3VQIA 2GBJA 3AE3B 2C5LC 2QDFA 3MP9A 3U2SC 5AUIA 1F9JA 2W82A 1SSNA 1T0YA 1MJDA 2H89B 4AUQC 4TSSA 1UBQA 5G2NA 2KQ4X 1FRDA 3IAM1 1MI0A 1NEKB 3IVFA 4ZHOA 1WX7A 2ZCBA 4NZLB 4BOZB 3PZ8A 5GMVA 5D2MB 1WRDB 2DHZA 2WXFA 2KFKB 3B0AA 4FHKA 4EZLA 3OJ4B 1I4PA 4GN1A 4ZYSA 1CQVA 4P6VF 1OGWA 3DDCB 3MC9A 1L2NA 3VR9B 3W1SA 1JWSD 1KOTA 4ARIA 3ZYYX 2MBHA 1WYGA 2QILA 3W5UB 3AU5A 1Y8RC 1F2RC 3U30A 5LXIB 1I42A 2VZKB 2BS3B 2D11A 3U52E 2M0AA 2KDFB 1GPXA 1IP9A 4KGRA 2KXJA 1E7UA 1TY0A 4XZ4A 5IN7A 1EWCA 2W3RA 4KIKA 1WH3A 3FKYA 1L6VA 1FMAD 1UUPA 3ZGZA 2WDRB 2IO1B 2L00B 3Q69A 2IY0B 4MGYE 4KSLC 3QQ8B 3NVWA 4I6PA 3FC4A 1KTKA 2WXMA 3V05A 2ASQA 5KHOA 1M4VA 1KJTA 2WNMA 4C4VB 4QAYA 3TCAA 3P1MA 3VH3B 2ZPYA 4MM3A 3DBRI 3DPDA 4ZRPA 1GB4A 3W1SC 3RT3B 1JRUA 3NHEB 2G3QB 1P0RA 4FXCA 4YTPB 4D2KA 2N9PC 3DOWA 2Q5WD 2WXJA 2IPKD 2LGYA 3MC0B 2K25A 2VH1A 1JW9D 5BMGA 4OZAA 3N30A 5AUKA 2XNAC 1B9RA 2D07B 2HTME 1FD6A 3VRAB 1TIFA 2MBOA 5CHWA 3ZQ4A 2XBBC 3PGEA 3A9JA 2JUOA 1T6BX 1YJ1A 2FCMA 2M19A 2JZ3B 2KKCA 3LYYA 4BZAA 1RWSA 1OQQA 3IBEA 4EOYA 3HUIA 1SJED 1WGDA 2KX3A 2W55A 3DBLB 2KLGA 3SR6A 2ZCCA 1A70A 2OJWA 3KQ4A 4KDIC 1DGJA 3FAHA 4EUTA 2JWUA 4M8MA 3UI3A 3D32A 2O6VA 1Y56A 5E6NA 4GOCA 2N7DA 1MPEA 2NTTA 5FKAC 3ZVVA 3UGBB 2QSDA 4KX6B 3NJTA 2JXTA 3QHTA 2BYVE 2L0FA 4RNAA 4ICUA 5BMHA 3TEXA 2D3BA 3C8YA 4URKA 1YIWA 1EWYC 2WHIA 1ZW7A 2PW9A 2FCQA 1YX5B 4WJOA 1DOXA 3AEBB 4PS7A 2D3GA 1KLGD 3BY4B 3E9SA 2L7RA 3PO0A 3BVMA 1AYFA 2AYOB 2BT6A 2WXKA 3APFA 2Z8LA 1UF0A 3ZW3A 2JT4B 1QILA 3JSVA 1BUIC 2CHWA 1LO5D 5FR6A 3HVDA 4FJYA 3QCAA 4B9KA 1E6EB 1KF6B 3PS6A 4IWPA 1UZXB 4AWJA 4BBNF 1WIAA 2GBMA 3QX1A 2MLBA 3KH0A 2PJHA 4DK5A 4HROA 3QA8A 3MJ5A 2O2VA 4PK1A 2ZW0A 1WRIA 2LZ6A 4OZCA 1XT9B 2FIDA 2WXRA 3ZDMC 3EGRA 4ZHPA 3AEDB 1VZ8A 2BKFA 1NDDA 4K7SA 4GXBA 3X23A 2INDC 3H7PB 3LXFA 3GOEA 2PVOD 5IA7A 2IY1B 3QARA 4EFOA 3VXWA 2WXOA 4P7IA 4HCNB 3VVWB 3R8BA 2BB5A 1SEBD 2KMCA 3AEEB 4C7ZA 1YN3A 3DWMA 4KGSA 2KX0A 3PZDA 1NYRA 4TMAB 1OQRA 5EE3A 1TTNA 3AE7B 3HHMA 3N1XC 1M94A 3R3MA 4IG7B 1VD2A 2KC2A 4WQMA 1U4AA 2D2QA 5AEKB 2KWCA 3AN1A 4JLCA 2BPSA 3H7SA 2AEHA 2EMTA 1MG8A 2WU2B 2ZPNA 5HFYA 3RFZB 2WYQA 2DLBA 3NS1A 1WXVA 4WJPA 1D4BA 4IKGA 4MSMB 4DDGD 2MP2B 3L13A 3MJWA 4WIPA 3PVLA 2INNE 1K53A 2G4SA 4NAWB 1QKZA 1YJJA 4AOFA 3R7RA 5HHDG 1VJKA 1NBFC 2QCZA 3C19A 3I9V1 2M0XA 1V1OA 2L0TA 3GE8C 1IBXA 1PQSA 1NI3A 3H1UA 2W3SA 3H9DA 4H2AA 4YSXB 3ZJTA 2RDGA 1A5RA 2KDIA 1HE8A 2TSSA 3DHGC 3UQAA 2KO3A 2WXLA 2IGDA 1C4CA 3T3NA 1C3TA 3PTFC 2MHJA 2RSUA 4USAA 3V60A 3Q3NC 2K8BA 4GSWA 2NCNA 4BKSA 1L6UA 3IG3A 2GMIC 2JWZA 4OVZA 5J17A 2N9XA 1JQ4A 1ENFA 5E6PA 3RMKC 2RMMA 4DHZE 2OHFA 3RZFA 5DPTA 5G55A 4RH6A 3N32A 3TUOA 3P4SB 3PT2B 3T9LA 1WJUA 1HA5A 3DCGA 3O65B 2NBWB 3A9JB 4A6QA 1PFDA 3K9OB 3P4QB 4KVGB 1FNWA 4GIVA 4WJNA 2RDHA 3ZRCA 2K5PA 1L0VB 3FILB 3DVGX 3U7DA 2K6QA 2CKHB 4KSKC 4WQOB 1CK1A 4AJWA 2J4XA 4XYCA 4NJCA 4W9LA 4G0NB 4HRSA 1AN8A 2AWTA 4W9JA 3VH4B 1I35A 3KYCD 1F1HA 2LUMA 4P1CC 4A55A 2ONQA 4XDCA 2YEPB 2LRWA 4TQ1A 2ACZB 3H8HA 2REXA 2DAJA 1EU3A 4JWUC 5EDSA 2XEWA 3U4EG 3VAWA 1FIQA 1E8ZA 2CHXA 3B2FA 1WF9A 1J8CA 1K52A 3A9KA 5HI1A 4ANVA 1XD3B 4MJSA 3PHWB 4P16A 5C1ZA 1UBIA 4CYEA 1VRAB 1EUVB 4K1RB 5CHFA 4S17A 4XWTA 3JYUA 1JWAD 2KYWA 3KUZA 1JRPA 1DOYA 2RGFA 3Q3MC 1GUAB 4LJPB 2IZVB 3CF6E 3ABVB 2DYMA 3VRBB 1WXMA 4K7WA 3KWVA 1VCBA 1WYWB 1TKEA 1OTRB 2IO3B 4G11A 1KLUD 1TJEA 2ICIA 3UF8A 4DXGA 1MHXA 1XLNA 3SFEB 3AXCA 1K8RB 2BS2B 1JALA 3RI7C 2L83A 3TEYA 2KN4A 4RF1A 1WGHA 3M3JA 2C7HA 2V4LA 3NZ3A 1HXYD 2AX5A 2AQ1B 2DZMA 2JSVX 4P1BC 4ZYNA 2KVRA 4HJGE 2BWES 3PRZA 3AULA 2KN5A 1UGJA 1V80A 1B1ZA 2INCC 2O6VB 3QJZA 1D3ZA 1C4PA 2BBCA 2G1EA 3ZJVA 4FULA 2GB1A 4XGAB 2KFJA 2KLCA 2ZEQA 2UWQA 3VHTC 5FR3A 1UNSA 3OAWA 3DBLI 2GBNA 4II2B 1I4RA 2D10A 1EF5A 3Q8AA 3DQVA 5JZEB 1JWUD 2IGHA 2PLPA 5EE1A 3EECA 2N0SB 2WQYB 2NTSA 1FXIA 2WDQB 5CX3A 2K8CA 5C2TB 1D6EC 4I6LB 1ZPSA 1SE9A 4J6IA 2L1AA 1SIFA 2QMTA 1OQYA 1WGRA 1ZGUB 3DBSA 4L2YA 3AE4B 1FNUA 1N62A 2VH2A 1QOFA 4RGMA 4B6WA 3RCZA 4ITKA 1VZ7A 2KVZA 2A5UA 2OEDA 1ET9A 4KZCA 1C4AA 2MA9B 1ET6A 1GC6A 2BKRB 4A90A 1QT9A 1S3SG 1WR1A 2MP2A 4PYUA 1EF1A 3LB8C 2V3PA 2KACA 3IT4B 1UWMA 4A8XC 5EE9A 1E7PB 3OG5A 2V1YA 3DBHB 4EE2A 2IJ0A 3ZRFA 5D94A 3I57A 3NZUA 1IBXB 3KWLA 4ANWA 1XLQA 2WS3B 1FNVA 3CWIA 1WJNA 1SE4A 4KV2A 1QLBB 3M95A 4TKNA 1GB1A 3P63A 5GXGB 2WXIA 4ZRIA 3SU8X 3H7PA 3ZNHB 2OJRA 2I1KA 4E71A 1WR6E 4W9CA 4OW0A 3EUB2 3I63C 3NOBA 1I4GA 3OWEB 5E6JA 1MVKA 4JL9A 4WJQA 1S1QB 3PREA 4FJZA 2MX2A 3MHZA 1TKYA 2DNFA 3Q14C 1ZDVA 2WXGA 2KTRA 2LVOA 3SD5A 2BTEA 3M63B 2WGSA 1JWBD 1JWMD 2JY6A 1N60A 4M01A 4HCPB 1UD7A 2FNJB 4JWSC 4US8A 1WM2A 2DZKA 3TMPB 2FCNA 2L76A 3ONSA 2J7QB 4FA6A 1SE2A 2V3NA 1R4MI 2M4NA 5LLIA 2Y5CA 4JQWC 2PIAA 1GNUA 5I4DA 2NPTB 3BINA 2Y5PA 4YL8A 1YN5A 3NRZA 1BXTA 2JRHA 1WXAA 2KJHB 3PPAA 2WWZA 2NBVB 4DXAB 3W2DA 4NQKE 1Q0WB 1WMHB 3ZXRA 1BT0A 2HD5B 4LJOB 4RCOA 5TSSA 2JX5A 4HLEA 2MW5A 3GP7A 1J7BA 1L0YB 1SF0A 4BKTA 4WH4A 1C9FA 4K3BA 1WJ6A 2KZRA 4A3PA 2MSED 2EELA 1WM3A 3QK0A 3TJPA 2BGFA 1I4QA 2HDEA 4MGZE 5T8IA 2DWQA 3AE1B 5G5HA 4R3DA 3DHHC 2JVCA 4N59A 3VUXA 3AEGB 4IW0A 2KAJA 4AP4C 1Q5WB 3Q3OC 1VLBA 2WDVB 4NNJB 2QJLA 1RFAA 2WXNA 4IWOA 1KM7A 2KMMA 1E10A 2WP9B 4KGTA 2N9KA 1DYQA 5D3IB 1QF6A 1XCQL 3ZNGC 1LGRA 1SBBB 3Q8CA 2KWUB 2L8JA 2V3SA 2CJOA 4BVUC 4HVBA 3NVVA 4WWNA 4YTMB 4B0MA 4HEA1 3S2AA 1X1MA 4FBJB 4UDUC 1Z5SB 2MWSB 2BWFA 4ZRKA 2LFIA 1SE3A 3PV1A 3ETRA 3Q8BA 3KUDB 2XK5A 3SDLC 3GZNI 1D5ZC 3QIJA 3AU4A 2MJEA 3TSSA 4W9IA 3VTWA 3BIID 2DX5B 4CO7A 1K51A 1V2YA 1C77A 2K8HA 4C56C 2R2QA 1Q1OA 4BKGA 4HJKA 1L7YA
chains in the Genus database with same CATH topology
1WJUA 2KDBA 3DCGA 3WAMA 1OEYJ 3O65B 4AJYB 2PPHA 4MGIE 2LVQA 2KNBA 2NBWB 3A9JB 1TGZB 3K9OB 1P98A 4KVGB 5D6JB 1R4NI 2M1MA 3H6NA 1LFDA 4GIVA 3VQIA 2GBJA 4GDKA 4WJNA 2C5LC 1KLVA 3ZRCA 3RZWC 3V6EB 3DVGY 1F9JA 3DVGX 3U7DA 3TIXA 1T0YA 2K6QA 2CKHB 2KANA 2FAZA 4KSKC 3L10B 5AZFA 4W9FA 4WQOB 1P1AA 3A9KB 4AJWA 4AUQC 4G50A 4W9LA 2CS4A 2I1JA 1UBQA 4K81A 5G2NA 4MEMA 4DBGA 4G0NB 3IVFA 1WX7A 2ZCBA 3RULA 4XX5A 2AWTA 3L54A 4W9JA 4WAAA 3VH4B 4BOZB 1I35A 3HM3A 3KYCD 5GMVA 1UGMA 3ZDTA 2M17A 2MCNB 5D2MB 1WRDB 1H4RA 2DHZA 2KFKB 3B0AA 4FHKA 4EZLA 2IYDB 2LRWA 2KQSA 3OJ4B 4TQ1A 3MHSD 4IM3A 1J0GA 2C7MB 4GN1A 2REXA 2NS5A 2Z59B 1WX9A 2KTFA 2M8SA 2DAJA 1OGWA 2JF5A 2KC1A 3DDCB 3DVNV 2XEWA 4EZKA 5TR5A 5EDSA 3KVFB 1L2NA 3W1SA 2K1FA 3VAWA 2AL3A 2G4DB 4RM9A 1E8ZA 2CHXA 2DYOA 3KW5B 4MDKE 1WF9A 1SGHA 3VDZA 1J8CA 2K6DB 1KOTA 3A9KA 4KZ0A 1UELA 3VFKA 3K9PB 2MBHA 3VUWA 4ANVA 1XD3B 4MJSA 2MBBB 3PHWB 3UIOB 2N1VA 5C1ZA 4JGHB 5J18A 1UBIA 5BO4B 2O6VD 2DZJA 2YVCA 2KDEB 3AU5A 4FJVB 4CYEA 1GG3A 1Y8RC 1EUVB 4K1RB 3U30A 5LXIB 1I42A 5CHFA 3DVNU 1YQBA 1V6EA 3JYUA 5JHBA 2D11A 4XC2A 3ZUNA 3HM6X 2WX0A 2KDFB 3KUZA 3HK0A 1IP9A 2KXJA 1E7UA 2RGFA 3ML8A 4XZ4A 1TZ1A 1OEYA 1GUAB 3TL5A 4LJPB 2IZVB 4KIKA 3RYTA 3CF6E 1V9JA 2DYMA 1WH3A 1RRBA 3V61A 1EO6A 1WXMA 2A4ZA 2WX1A 4K7WA 2RR9A 5CTRC 2LASA 1VCBA 1WYWB 3VTVA 3VTUA 1OTRB 2IO3B 3WIMA 4G11A 2LWPA 3APCA 3UF8A 2IO1B 3ENEA 3AXCA 1K8RB 2CHZA 2L00B 3V62A 4FADA 2IY0B 4MGYE 1LM8B 4KSLC 3QQ8B 2EKEC 4I6PA 2N4FA 1NI2A 3ZNID 1WGHA 3M3JA 2C7HA 4MGKE 4GMVA 2V4LA 2ASQA 2MBEA 5KHOA 4A20A 2LUEA 3LDZE 4LCDE 4ZYNA 1KJTA 2DZMA 2KVRA 1V5OA 3NS8A 3TBLD 2BWES 2VRRB 2IO2B 4GDLA 3TCAA 3PRZA 3PLUA 5DCNA 3VH3B 2ZPYA 4GGQA 4MM3A 2MQJA 3AULA 3DBRI 2KN5A 3DPDA 4NJ6A 3W1SC 2NPTA 1V86A 1TBEA 1JRUA 1V80A 2ZVNA 3L08A 3NHEB 3RT3B 1E8WA 2O6VB 3QJZA 4W9EA 4PYZA 4EEWA 2CR5A 2ZJDA 2L05A 1D3ZA 3HIZA 1V49A 2G3QB 1P0RA 2N9PC 4FULA 3DOWA 3EHVA 2C60A 2KFJA 2LGYA 4RM8A 2KLCA 2ZNVC 4OVVA 2DYBA 2ZEQA 2UWQA 2K25A 3VHTC 3OAWA 3WA0A 4KIKB 2AL6A 3DBLI 2GBNA 2LRUA 2L3ZA 4II2B 2D10A 3N30A 1EF5A 3DQVA 1YD8U 2BYFA 2D07B 5JZEB 5D7GA 3EECA 3WALA 2JPHA 3A4RA 4PS8A 1Z2MA 2MBOA 2Z0DB 5CHWA 2GBKA 5CX3A 2XBBC 2K8CA 3PGEA 3A9JA 2JUOA 1YJ1A 4I6LB 2QHOA 4OVUA 4G3XB 2FCMA 4HPMB 1SE9A 2JZ3B 2J0JA 2KKCA 4J6IA 3Q3FA 3U8ZA 3ZLZA 4GDKB 2DENB 1SIFA 3OJ3A 3UQBA 2DZIA 1OQYA 1WGRA 1ZGUB 3DBSA 3IBEA 4EOYA 4E74A 4IC7B 1WGDA 2KX3A 4MH0E 4CHKA 2KLGA 3OLMD 2ZCCA 4B6WA 3A33B 3V6CB 2JXXA 3RCZA 3ALBA 3LJ3A 4KDIC 2A5UA 3KYDD 4NY0A 4EUTA 3UIPB 2KJ6A 4M8MA 1E7VA 1WY8A 3D32A 2O6VA 4KZCA 5E6NA 1FXTB 2NR2A 2WDTB 2MA9B 1G6JA 4GOCA 1GC6A 2BKRB 4HPLB 2EMSA 2N7DA 5DPWA 2KTRB 2RPQA 1S3SG 2LD9A 3I3TB 1WR1A 2MP2A 4PYUA 4LDTB 1EF1A 3ZNZB 3ZVVA 2UYZB 4W9GA 3L0WB 3UGBB 4EKUA 1V5TA 1C1YB 3RUIB 2HE7A 2LI5A 4F8CB 2V1YA 2LJ5A 3JSVB 2J0KA 3ZRFA 5D94A 3QHTA 2BYVE 2L0FA 2O2VB 4FLHA 3NZUA 4ICUA 4W9HA 5HKHA 1GC7A 4URKA 1YIWA 3JW0X 3PLVA 4NPNA 2CU1A 3B08A 4ANWA 1LQBA 1E5WA 1WJNA 3PRPB 1ZW7A 3NZSA 4KV2A 5L95C 3M95A 5E6OA 4TKNA 5JH5C 2FCQA 3EC8A 1YX5B 4WJOA 2LGDA 3L17A 4ZRIA 2N9EB 3SU8X 3H7PA 3T8MA 2OJRA 2I1KA 4LDTD 1WR6E 4W9CA 3ZNHB 4E71A 4PS7A 4X57B 2D3GA 3NOBA 3BY4B 2L7RA 5IAAC 2MBQA 4JL9A 3ZO5B 1WMHA 4DWFA 4E3CA 5KHQA 5AZHA 4WJQA 1YX6B 1S1QB 2AYOB 3PREA 4FJZA 2MX2A 3APFA 3NY5A 3ZW3A 2BF8B 2JT4B 3WANA 4ICVA 3JSVA 2HJ8A 2CHWA 2NBUA 2KTRA 2LVOA 5FR6A 3SD5A 3M63B 4DHZB 4HDQA 4FJYA 4I6NB 5LXHA 3QCAA 4B9KA 1ISNA 2JY6A 5JHAA 2KWVB 1H8CA 3PS6A 4IWPA 4HCPB 1UZXB 3ML9A 4AWJA 4FN2A 1UD7A 4HK2A 1WIAA 4BBNF 2FNJB 1IYFA 2GBMA 4ANXA 3QX1A 1UH6A 1WM2A 2MLBA 3KH0A 2PJHA 2DZKA 3TMPB 2FCNA 4DK5A 2L76A 3ONSA 3QA8A 2J7QB 4GDLB 4BOSC 4FA6A 2O2VA 4ASWC 3QAQA 1R4MI 4BBNC 2M4NA 2LZ6A 5LLIA 1XT9B 4JQWC 2FIDA 4WWOA 1GNUA 3ZDMC 2LXAA 3VUYA 3AI5A 3ZTDA 2NPTB 1WE7A 3BINA 3KUCB 3WAOA 4YL8A 2IO0B 2PEAA 3EFUA 3IFWB 2BKFA 2FCSA 3UINB 1E8YA 1NDDA 3Q3JA 4K7SA 4GXBA 5DPRA 3R7QA 3X23A 2JRHA 1WXAA 2KJHB 3PPAA 3H7PB 4ZRJA 2WWZA 3GOEA 2NBVB 4DXAB 3A1QA 2GBRA 1GJZA 3MTNB 4NQKE 5IA7A 1Q0WB 1WMHB 3A4SC 2IY1B 3QARA 4EFOA 1RAXA 3ZTCA 3VXWA 3VVWB 3CSTA 4HCNB 4P7IA 5DPSA 1BT0A 2HD5B 4LJOB 2KMCA 3T9LA 1AARA 4HLEA 3QWZB 1WZ3A 2LVPA 1E90A 2MW5A 1WI0A 1P3QU 4IM0A 4BKTA 4DHJD 4EZJA 4IUMB 3B1LX 3QC8B 2KX0A 3PZDA 4K7UA 4NJ7A 2KFKA 1WJ6A 2KZRA 1LXDA 2C7NB 4A3PA 2DAFA 4MJSB 4MELA 1ZKHA 2MSED 4ZDVA 2KOXA 4HDOA 4FHJA 1TTNA 1WM3A 1RLFA 3HHMA 1M94A 3QK0A 3TJPA 2BGFA 3R3MA 2N7EA 2FIFA 4IG7B 4MGZE 1VD2A 2KC2A 1U4AA 2KK8A 2D2QA 2IBIB 4HWIB 4PS3A 2JVCA 5AEKB 2KWCA 3VUXA 4JLCA 2BPSA 4IW0A 3H7SA 2AEHA 2EMTA 3W1YA 1WZ0A 4F1SA 3A1QB 3P2BA 1MG8A 3ZKJC 4AP4C 5L83A 2ZPNA 4W9DA 2FUHB 2KJRA 2WYQA 1Q5WB 1IPGA 4NNJB 2YLMA 1WXVA 4GB9A 5AZGA 2KHWB 1RFAA 4WJPA 2ZVOA 3PRMB 2BYEA 4MSMB 3C0RB 4KDLB 1WXSA 4WWPA 3L16A 4DDGD 2MP2B 3L13A 4IWQA 3ZIMA 4IWOA 3MJWA 3M62B 2KD0A 1E8XA 4B95A 2KMAA 1KM7A 4ANUA 1WGGA 3PSEB 3PVLA 3CSFA 2J0MA 3WAPA 2G4SA 1WE6A 4NAWB 4BKSD 1QZEA 2XK5B 4AOFA 3X0WA 4M8NA 3R7RA 3ZNGC 4TUUA 1NBFC 4NQLB 2KWUB 2M0XA 2L8JA 2B3AA 2V3SA 4TV3A 2NVUI 4BVUC 4HVBA 2L0TA 1P9DU 4WWNA 4DDID 1PQSA 2GOWA 2PE6B 3H1UA 3PHXB 3S2AA 2G45B 1X1MA 2OOBB 2Y5BB 4FBJB 2PE9A 3H9DA 2ZZPB 4GU2A 4W9KA 1A5RA 3R66C 2KDIA 1Z5SB 1HE8A 2MWSB 3CMMB 2BWFA 4HXDA 4ZRKA 4DHJB 1WX8A 3UQAA 2KO3A 1CMXB 2C9WB 2R2OA 1C3TA 3PV1A 5CHVC 3PTFC 2RSUA 3JVZX 3V60A 2K8BA 2LGXA 4GSWA 2NCNA 2K39A 4II3B 3SHQA 3ECIA 4NAWA 3KUDB 4N9F4 4BKSA 2XK5A 2LXCA 3SDLC 3IG3A 2W9NA 3GZNI 4JIOU 2GMIC 2JWZA 2HTHA 3QIJA 2KQ7A 3AU4A 4F7ZA 3DBHI 5J17A 4RMAA 2RD0A 2N9XA 4BFRA 4W9IA 2MRPA 5E6PA 3RD2A 3VTWA 2JRIB 4DHZE 1XQQA 2DX5B 3APDA 4CO7A 2Z0EB 1V81A 4M0WB 1J19A 3RZFA 5DPTA 1WJ4A 1V2YA 2K8HA 5G55A 2ZNVB 4IM2A 4A3OA 2JZZA 3N32A 4MSQB 3IHPC 4TQ0A 2R2QA 1WFYA 1Q1OA 2N1WA 3N3KB 4BKGA 5C23A 3PT2B 1WGYA 4HJKA 5J2RA 1L7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJU A;  2KDB A;  3DCG A;  3WAM A;  1OEY J;  3O65 B;  4AJY B;  2PPH A;  4MGI E;  2LVQ A;  2KNB A;  2NBW B;  3A9J B;  1TGZ B;  3K9O B;  1P98 A;  4KVG B;  5D6J B;  1R4N I;  2M1M A;  3H6N A;  1LFD A;  4GIV A;  3VQI A;  2GBJ A;  4GDK A;  4WJN A;  2C5L C;  1KLV A;  3ZRC A;  3RZW C;  3V6E B;  3DVG Y;  1F9J A;  3DVG X;  3U7D A;  3TIX A;  1T0Y A;  2K6Q A;  2CKH B;  2KAN A;  2FAZ A;  4KSK C;  3L10 B;  5AZF A;  4W9F A;  4WQO B;  1P1A A;  3A9K B;  4AJW A;  4AUQ C;  4G50 A;  4W9L A;  2CS4 A;  2I1J A;  1UBQ A;  4K81 A;  5G2N A;  4MEM A;  4DBG A;  4G0N B;  3IVF A;  1WX7 A;  2ZCB A;  3RUL A;  4XX5 A;  2AWT A;  3L54 A;  4W9J A;  4WAA A;  3VH4 B;  4BOZ B;  1I35 A;  3HM3 A;  3KYC D;  5GMV A;  1UGM A;  3ZDT A;  2M17 A;  2MCN B;  5D2M B;  1WRD B;  1H4R A;  2DHZ A;  2KFK B;  3B0A A;  4FHK A;  4EZL A;  2IYD B;  2LRW A;  2KQS A;  3OJ4 B;  4TQ1 A;  3MHS D;  4IM3 A;  1J0G A;  2C7M B;  4GN1 A;  2REX A;  2NS5 A;  2Z59 B;  1WX9 A;  2KTF A;  2M8S A;  2DAJ A;  1OGW A;  2JF5 A;  2KC1 A;  3DDC B;  3DVN V;  2XEW A;  4EZK A;  5TR5 A;  5EDS A;  3KVF B;  1L2N A;  3W1S A;  2K1F A;  3VAW A;  2AL3 A;  2G4D B;  4RM9 A;  1E8Z A;  2CHX A;  2DYO A;  3KW5 B;  4MDK E;  1WF9 A;  1SGH A;  3VDZ A;  1J8C A;  2K6D B;  1KOT A;  3A9K A;  4KZ0 A;  1UEL A;  3VFK A;  3K9P B;  2MBH A;  3VUW A;  4ANV A;  1XD3 B;  4MJS A;  2MBB B;  3PHW B;  3UIO B;  2N1V A;  5C1Z A;  4JGH B;  5J18 A;  1UBI A;  5BO4 B;  2O6V D;  2DZJ A;  2YVC A;  2KDE B;  3AU5 A;  4FJV B;  4CYE A;  1GG3 A;  1Y8R C;  1EUV B;  4K1R B;  3U30 A;  5LXI B;  1I42 A;  5CHF A;  3DVN U;  1YQB A;  1V6E A;  3JYU A;  5JHB A;  2D11 A;  4XC2 A;  3ZUN A;  3HM6 X;  2WX0 A;  2KDF B;  3KUZ A;  3HK0 A;  1IP9 A;  2KXJ A;  1E7U A;  2RGF A;  3ML8 A;  4XZ4 A;  1TZ1 A;  1OEY A;  1GUA B;  3TL5 A;  4LJP B;  2IZV B;  4KIK A;  3RYT A;  3CF6 E;  1V9J A;  2DYM A;  1WH3 A;  1RRB A;  3V61 A;  1EO6 A;  1WXM A;  2A4Z A;  2WX1 A;  4K7W A;  2RR9 A;  5CTR C;  2LAS A;  1VCB A;  1WYW B;  3VTV A;  3VTU A;  1OTR B;  2IO3 B;  3WIM A;  4G11 A;  2LWP A;  3APC A;  3UF8 A;  2IO1 B;  3ENE A;  3AXC A;  1K8R B;  2CHZ A;  2L00 B;  3V62 A;  4FAD A;  2IY0 B;  4MGY E;  1LM8 B;  4KSL C;  3QQ8 B;  2EKE C;  4I6P A;  2N4F A;  1NI2 A;  3ZNI D;  1WGH A;  3M3J A;  2C7H A;  4MGK E;  4GMV A;  2V4L A;  2ASQ A;  2MBE A;  5KHO A;  4A20 A;  2LUE A;  3LDZ E;  4LCD E;  4ZYN A;  1KJT A;  2DZM A;  2KVR A;  1V5O A;  3NS8 A;  3TBL D;  2BWE S;  2VRR B;  2IO2 B;  4GDL A;  3TCA A;  3PRZ A;  3PLU A;  5DCN A;  3VH3 B;  2ZPY A;  4GGQ A;  4MM3 A;  2MQJ A;  3AUL A;  3DBR I;  2KN5 A;  3DPD A;  4NJ6 A;  3W1S C;  2NPT A;  1V86 A;  1TBE A;  1JRU A;  1V80 A;  2ZVN A;  3L08 A;  3NHE B;  3RT3 B;  1E8W A;  2O6V B;  3QJZ A;  4W9E A;  4PYZ A;  4EEW A;  2CR5 A;  2ZJD A;  2L05 A;  1D3Z A;  3HIZ A;  1V49 A;  2G3Q B;  1P0R A;  2N9P C;  4FUL A;  3DOW A;  3EHV A;  2C60 A;  2KFJ A;  2LGY A;  4RM8 A;  2KLC A;  2ZNV C;  4OVV A;  2DYB A;  2ZEQ A;  2UWQ A;  2K25 A;  3VHT C;  3OAW A;  3WA0 A;  4KIK B;  2AL6 A;  3DBL I;  2GBN A;  2LRU A;  2L3Z A;  4II2 B;  2D10 A;  3N30 A;  1EF5 A;  3DQV A;  1YD8 U;  2BYF A;  2D07 B;  5JZE B;  5D7G A;  3EEC A;  3WAL A;  2JPH A;  3A4R A;  4PS8 A;  1Z2M A;  2MBO A;  2Z0D B;  5CHW A;  2GBK A;  5CX3 A;  2XBB C;  2K8C A;  3PGE A;  3A9J A;  2JUO A;  1YJ1 A;  4I6L B;  2QHO A;  4OVU A;  4G3X B;  2FCM A;  4HPM B;  1SE9 A;  2JZ3 B;  2J0J A;  2KKC A;  4J6I A;  3Q3F A;  3U8Z A;  3ZLZ A;  4GDK B;  2DEN B;  1SIF A;  3OJ3 A;  3UQB A;  2DZI A;  1OQY A;  1WGR A;  1ZGU B;  3DBS A;  3IBE A;  4EOY A;  4E74 A;  4IC7 B;  1WGD A;  2KX3 A;  4MH0 E;  4CHK A;  2KLG A;  3OLM D;  2ZCC A;  4B6W A;  3A33 B;  3V6C B;  2JXX A;  3RCZ A;  3ALB A;  3LJ3 A;  4KDI C;  2A5U A;  3KYD D;  4NY0 A;  4EUT A;  3UIP B;  2KJ6 A;  4M8M A;  1E7V A;  1WY8 A;  3D32 A;  2O6V A;  4KZC A;  5E6N A;  1FXT B;  2NR2 A;  2WDT B;  2MA9 B;  1G6J A;  4GOC A;  1GC6 A;  2BKR B;  4HPL B;  2EMS A;  2N7D A;  5DPW A;  2KTR B;  2RPQ A;  1S3S G;  2LD9 A;  3I3T B;  1WR1 A;  2MP2 A;  4PYU A;  4LDT B;  1EF1 A;  3ZNZ B;  3ZVV A;  2UYZ B;  4W9G A;  3L0W B;  3UGB B;  4EKU A;  1V5T A;  1C1Y B;  3RUI B;  2HE7 A;  2LI5 A;  4F8C B;  2V1Y A;  2LJ5 A;  3JSV B;  2J0K A;  3ZRF A;  5D94 A;  3QHT A;  2BYV E;  2L0F A;  2O2V B;  4FLH A;  3NZU A;  4ICU A;  4W9H A;  5HKH A;  1GC7 A;  4URK A;  1YIW A;  3JW0 X;  3PLV A;  4NPN A;  2CU1 A;  3B08 A;  4ANW A;  1LQB A;  1E5W A;  1WJN A;  3PRP B;  1ZW7 A;  3NZS A;  4KV2 A;  5L95 C;  3M95 A;  5E6O A;  4TKN A;  5JH5 C;  2FCQ A;  3EC8 A;  1YX5 B;  4WJO A;  2LGD A;  3L17 A;  4ZRI A;  2N9E B;  3SU8 X;  3H7P A;  3T8M A;  2OJR A;  2I1K A;  4LDT D;  1WR6 E;  4W9C A;  3ZNH B;  4E71 A;  4PS7 A;  4X57 B;  2D3G A;  3NOB A;  3BY4 B;  2L7R A;  5IAA C;  2MBQ A;  4JL9 A;  3ZO5 B;  1WMH A;  4DWF A;  4E3C A;  5KHQ A;  5AZH A;  4WJQ A;  1YX6 B;  1S1Q B;  2AYO B;  3PRE A;  4FJZ A;  2MX2 A;  3APF A;  3NY5 A;  3ZW3 A;  2BF8 B;  2JT4 B;  3WAN A;  4ICV A;  3JSV A;  2HJ8 A;  2CHW A;  2NBU A;  2KTR A;  2LVO A;  5FR6 A;  3SD5 A;  3M63 B;  4DHZ B;  4HDQ A;  4FJY A;  4I6N B;  5LXH A;  3QCA A;  4B9K A;  1ISN A;  2JY6 A;  5JHA A;  2KWV B;  1H8C A;  3PS6 A;  4IWP A;  4HCP B;  1UZX B;  3ML9 A;  4AWJ A;  4FN2 A;  1UD7 A;  4HK2 A;  1WIA A;  4BBN F;  2FNJ B;  1IYF A;  2GBM A;  4ANX A;  3QX1 A;  1UH6 A;  1WM2 A;  2MLB A;  3KH0 A;  2PJH A;  2DZK A;  3TMP B;  2FCN A;  4DK5 A;  2L76 A;  3ONS A;  3QA8 A;  2J7Q B;  4GDL B;  4BOS C;  4FA6 A;  2O2V A;  4ASW C;  3QAQ A;  1R4M I;  4BBN C;  2M4N A;  2LZ6 A;  5LLI A;  1XT9 B;  4JQW C;  2FID A;  4WWO A;  1GNU A;  3ZDM C;  2LXA A;  3VUY A;  3AI5 A;  3ZTD A;  2NPT B;  1WE7 A;  3BIN A;  3KUC B;  3WAO A;  4YL8 A;  2IO0 B;  2PEA A;  3EFU A;  3IFW B;  2BKF A;  2FCS A;  3UIN B;  1E8Y A;  1NDD A;  3Q3J A;  4K7S A;  4GXB A;  5DPR A;  3R7Q A;  3X23 A;  2JRH A;  1WXA A;  2KJH B;  3PPA A;  3H7P B;  4ZRJ A;  2WWZ A;  3GOE A;  2NBV B;  4DXA B;  3A1Q A;  2GBR A;  1GJZ A;  3MTN B;  4NQK E;  5IA7 A;  1Q0W B;  1WMH B;  3A4S C;  2IY1 B;  3QAR A;  4EFO A;  1RAX A;  3ZTC A;  3VXW A;  3VVW B;  3CST A;  4HCN B;  4P7I A;  5DPS A;  1BT0 A;  2HD5 B;  4LJO B;  2KMC A;  3T9L A;  1AAR A;  4HLE A;  3QWZ B;  1WZ3 A;  2LVP A;  1E90 A;  2MW5 A;  1WI0 A;  1P3Q U;  4IM0 A;  4BKT A;  4DHJ D;  4EZJ A;  4IUM B;  3B1L X;  3QC8 B;  2KX0 A;  3PZD A;  4K7U A;  4NJ7 A;  2KFK A;  1WJ6 A;  2KZR A;  1LXD A;  2C7N B;  4A3P A;  2DAF A;  4MJS B;  4MEL A;  1ZKH A;  2MSE D;  4ZDV A;  2KOX A;  4HDO A;  4FHJ A;  1TTN A;  1WM3 A;  1RLF A;  3HHM A;  1M94 A;  3QK0 A;  3TJP A;  2BGF A;  3R3M A;  2N7E A;  2FIF A;  4IG7 B;  4MGZ E;  1VD2 A;  2KC2 A;  1U4A A;  2KK8 A;  2D2Q A;  2IBI B;  4HWI B;  4PS3 A;  2JVC A;  5AEK B;  2KWC A;  3VUX A;  4JLC A;  2BPS A;  4IW0 A;  3H7S A;  2AEH A;  2EMT A;  3W1Y A;  1WZ0 A;  4F1S A;  3A1Q B;  3P2B A;  1MG8 A;  3ZKJ C;  4AP4 C;  5L83 A;  2ZPN A;  4W9D A;  2FUH B;  2KJR A;  2WYQ A;  1Q5W B;  1IPG A;  4NNJ B;  2YLM A;  1WXV A;  4GB9 A;  5AZG A;  2KHW B;  1RFA A;  4WJP A;  2ZVO A;  3PRM B;  2BYE A;  4MSM B;  3C0R B;  4KDL B;  1WXS A;  4WWP A;  3L16 A;  4DDG D;  2MP2 B;  3L13 A;  4IWQ A;  3ZIM A;  4IWO A;  3MJW A;  3M62 B;  2KD0 A;  1E8X A;  4B95 A;  2KMA A;  1KM7 A;  4ANU A;  1WGG A;  3PSE B;  3PVL A;  3CSF A;  2J0M A;  3WAP A;  2G4S A;  1WE6 A;  4NAW B;  4BKS D;  1QZE A;  2XK5 B;  4AOF A;  3X0W A;  4M8N A;  3R7R A;  3ZNG C;  4TUU A;  1NBF C;  4NQL B;  2KWU B;  2M0X A;  2L8J A;  2B3A A;  2V3S A;  4TV3 A;  2NVU I;  4BVU C;  4HVB A;  2L0T A;  1P9D U;  4WWN A;  4DDI D;  1PQS A;  2GOW A;  2PE6 B;  3H1U A;  3PHX B;  3S2A A;  2G45 B;  1X1M A;  2OOB B;  2Y5B B;  4FBJ B;  2PE9 A;  3H9D A;  2ZZP B;  4GU2 A;  4W9K A;  1A5R A;  3R66 C;  2KDI A;  1Z5S B;  1HE8 A;  2MWS B;  3CMM B;  2BWF A;  4HXD A;  4ZRK A;  4DHJ B;  1WX8 A;  3UQA A;  2KO3 A;  1CMX B;  2C9W B;  2R2O A;  1C3T A;  3PV1 A;  5CHV C;  3PTF C;  2RSU A;  3JVZ X;  3V60 A;  2K8B A;  2LGX A;  4GSW A;  2NCN A;  2K39 A;  4II3 B;  3SHQ A;  3ECI A;  4NAW A;  3KUD B;  4N9F 4;  4BKS A;  2XK5 A;  2LXC A;  3SDL C;  3IG3 A;  2W9N A;  3GZN I;  4JIO U;  2GMI C;  2JWZ A;  2HTH A;  3QIJ A;  2KQ7 A;  3AU4 A;  4F7Z A;  3DBH I;  5J17 A;  4RMA A;  2RD0 A;  2N9X A;  4BFR A;  4W9I A;  2MRP A;  5E6P A;  3RD2 A;  3VTW A;  2JRI B;  4DHZ E;  1XQQ A;  2DX5 B;  3APD A;  4CO7 A;  2Z0E B;  1V81 A;  4M0W B;  1J19 A;  3RZF A;  5DPT A;  1WJ4 A;  1V2Y A;  2K8H A;  5G55 A;  2ZNV B;  4IM2 A;  4A3O A;  2JZZ A;  3N32 A;  4MSQ B;  3IHP C;  4TQ0 A;  2R2Q A;  1WFY A;  1Q1O A;  2N1W A;  3N3K B;  4BKG A;  5C23 A;  3PT2 B;  1WGY A;  4HJK A;  5J2R A;  1L7Y A; 
#chains in the Genus database with same CATH topology
 4AJY B;  2CU3 A;  3H6N A;  4C00 A;  4GDK A;  1KLV A;  1T0Q C;  1XLO A;  3RZW C;  3V6E B;  3N1Z C;  3GE3 C;  4HPP A;  1FCL A;  1F2R I;  3IXS A;  2V9H A;  2FAZ A;  2JZP A;  4G50 A;  4MEM A;  4DBG A;  2D3C A;  3L54 A;  4WAA A;  2D3A A;  3NVY A;  1UGM A;  2KWD A;  2M17 A;  2MCN B;  2EKI A;  4MT5 A;  1EM7 A;  3J9C A;  2KQS A;  4IM3 A;  1J0G A;  3TEZ A;  2Z59 B;  1WX9 A;  2KTF A;  2JF5 A;  2M8S A;  2LGI A;  4EZK A;  3DVN V;  4Q2J A;  3KVF B;  2K1F A;  2G4D B;  4RM9 A;  2DYO A;  2K6D B;  3RPF C;  4KZ0 A;  4N6E B;  3VUW A;  3K9P B;  2MBB B;  2R61 A;  2X8X X;  5J18 A;  5BO4 B;  2O6V D;  4FJV B;  4HKZ E;  1V6E A;  5JHB A;  3ZUN A;  3HM6 X;  4LLG M;  3ML8 A;  1TKG A;  3W9C B;  1OEY A;  1YQ4 B;  1FFU A;  3GS2 A;  3RYT A;  1V9J A;  1RRB A;  3EFC A;  3TIX A;  2RR9 A;  3VTU A;  1MG4 A;  4LTU A;  4YSY B;  2EKE C;  2L32 A;  2N4F A;  2JYT A;  4MGK E;  4GMV A;  2MBE A;  5FK9 C;  4LCD E;  1TZO A;  3NS8 A;  3TBL D;  4GDL A;  5DCN A;  1PUT A;  2MQJ A;  1WSP A;  1OFF A;  2V4I B;  4NJ6 A;  3BZD B;  2NPT A;  4LNK A;  3L08 A;  2ZVN A;  1E8W A;  4W9E A;  2ZJD A;  3RNB C;  2L05 A;  1V49 A;  2I38 A;  2C60 A;  3EHV A;  4RM8 A;  2DYB A;  2SAK A;  4RGN A;  1R4N B;  3P42 A;  2LRU A;  2FBW B;  4YT0 B;  4YXD B;  4LNO A;  2ON8 A;  2BYF A;  3WAL A;  3A4R A;  4PS8 A;  1Z2M A;  2D5G A;  5BYS A;  1NVI D;  2QHO A;  4OVU A;  4G3X B;  2NMQ A;  2J0J A;  1FPY A;  4GDK B;  2DEN B;  1QOA A;  4E74 A;  1YOV B;  3URY A;  1TYG B;  3IAS 1;  3V6C B;  2MJ3 A;  3UIP B;  2WXH A;  1E7V A;  1HQR D;  1FXT B;  2NR2 A;  1G6J A;  4HPL B;  1C78 A;  2G9H D;  5DPW A;  2PVG C;  2KTR B;  2RPQ A;  4DQO C;  3I3T B;  3ZJU A;  4JX1 C;  1I7H A;  4LDT B;  2UYZ B;  4W9G A;  3L0W B;  1V5T A;  1BML C;  1C1Y B;  3RUI B;  1TS3 A;  2HE7 A;  2LJ5 A;  3SEB A;  3JSV B;  2J0K A;  1TS5 A;  1N5X A;  3T3O A;  2O2V B;  2PTL A;  1PGB A;  2I2Y A;  3JW0 X;  4NPN A;  3B08 A;  1LQB A;  3MFG A;  4LNF A;  3NZS A;  2CJN A;  5JH5 C;  2LGD A;  3L17 A;  5IP4 D;  1JML A;  4X57 B;  5IAA C;  4DWF A;  4E3C A;  5AZH A;  1XO3 A;  3NY5 A;  4YSZ B;  4ICV A;  4OZB A;  1FFV A;  1L0X B;  4O1N A;  4HDQ A;  4I6N B;  5LXH A;  4IDI A;  1H8C A;  3ML9 A;  4FN2 A;  2K9X A;  4M0W A;  1IYF A;  1E9M A;  1YJI A;  1UH6 A;  2LGS A;  3I5J C;  1TY2 A;  1RYJ A;  2LHD A;  4GDL B;  4BOS C;  3N20 C;  4ASW C;  3QAQ A;  4BBN C;  4C7Y A;  2LXA A;  3AI5 A;  1PYW D;  3KUC B;  3WAO A;  4A9A A;  2PMV A;  2IO0 B;  1ROE A;  3EFU A;  3IFW B;  3Q3J A;  3R7Q A;  4ZRJ A;  4L23 A;  2LHE A;  4N58 A;  3MTN B;  1AWD A;  1RAX A;  3CST A;  4AQ7 A;  1ZP0 B;  5DPS A;  1R4M B;  2E3T A;  3E56 A;  4IM0 A;  2LVP A;  1E90 A;  1ZOY B;  1HTO A;  1P3Q U;  3AE2 B;  1KH0 A;  4DHJ D;  4IUM B;  4EZJ A;  3B1L X;  3RNA C;  3QC8 B;  1YQ3 B;  3B9J A;  1LXD A;  2C7N B;  2DAF A;  4MJS B;  1FCC C;  1MFW A;  5IO9 A;  2KOX A;  4HDO A;  4FHJ A;  1I4H A;  1RLF A;  1N5W A;  2FIF A;  2MJD A;  3U7Z A;  1PDX A;  2ZW1 A;  2IBI B;  4HWI B;  2AQ3 B;  3DHI C;  1C76 A;  4CQN A;  1GAQ B;  2JYE A;  3W1Y A;  4F1S A;  3A1Q B;  5IKC M;  1L4Z B;  3ZKJ C;  5L83 A;  2N9L A;  3AH7 A;  3Q8F A;  4ZRQ A;  1IPG A;  2YLM A;  2INP E;  4NAM A;  3RNC C;  2KHW B;  4MAC A;  2LMC A;  3C0R B;  4KDL B;  3DWG C;  3ZIM A;  2J53 A;  3M62 B;  1E8X A;  4KKJ A;  2KMA A;  1WGG A;  3CSF A;  3WAP A;  1F0Z A;  1WE6 A;  4BKS D;  1QZE A;  2J52 A;  3X0W A;  4M8N A;  1L5P A;  4NQL B;  5H8Y E;  2B3A A;  4TV3 A;  2NVU I;  1P9D U;  4C80 A;  4DDI D;  3MC8 A;  2G45 B;  1FXA A;  4DXF A;  2GI9 A;  2OOB B;  3P4P B;  2Y5B B;  2PE9 A;  3BK2 A;  5BYQ A;  3Q2A C;  3ZXV A;  4GLS C;  2ZZP B;  3HRD D;  4GU2 A;  4W9K A;  1QOB A;  3R66 C;  4US9 A;  3CMM B;  4HXD A;  1WX8 A;  1ACC A;  2C9W B;  2K0P A;  2H88 B;  2QC8 A;  2R2O A;  2J42 A;  4J3O D;  3BK1 A;  5CHV C;  2JQR B;  2LGX A;  2K39 A;  4II3 B;  3SHQ A;  3ECI A;  2V0G A;  4NAW A;  2LXC A;  1VR9 A;  2RPV A;  2HJ1 A;  4F7Z A;  3DBH I;  4RMA A;  1F77 A;  4BFR A;  1YMH E;  3RD2 A;  2JRI B;  3GB1 A;  1KRH A;  3O13 A;  2Z0E B;  1V81 A;  4M0W B;  2PKO A;  1N63 A;  4A3O A;  1WWT A;  4TQ0 A;  3N3K B;  5C23 A;  1WGY A;  1XXG A;  4LNI A;  4IOI E;  2KDB A;  3EA6 A;  1OEY J;  2PPH A;  2LVQ A;  1TGZ B;  3RNG C;  2BVC A;  1VZ6 A;  3HVZ A;  3KLS X;  2BB6 A;  1V97 A;  3RNF C;  1D5X C;  3DVG Y;  3RNE C;  3AE9 B;  2KAN A;  1NYQ A;  3L10 B;  5AZF A;  4W9F A;  1P1A A;  3A9K B;  2CS4 A;  2I1J A;  3AB5 A;  4K81 A;  4JE3 B;  5H92 C;  3RUL A;  1NEN B;  4XX5 A;  3HM3 A;  3N1Y C;  3ZDT A;  3BYY B;  1H4R A;  2IYD B;  3MHS D;  1ZUD 2;  3R2I A;  1SIJ A;  2C7M B;  2NS5 A;  2K22 A;  1HEZ E;  1XCT L;  2KC1 A;  5TR5 A;  2AL3 A;  2WXP A;  3KW5 B;  4MDK E;  1SGH A;  3VDZ A;  2Y3A A;  1I4X A;  1UEL A;  3VFK A;  1J7C A;  2WU5 B;  4RFB A;  3UIO B;  2GRI A;  2N1V A;  4JGH B;  4RGO S;  2YVC A;  2DZJ A;  2KDE B;  1GG3 A;  1FEH A;  3DVN U;  1YQB A;  1FM0 D;  4XC2 A;  4ARC A;  2WX0 A;  3HK0 A;  2QEJ C;  1R7S A;  1TZ1 A;  3TL5 A;  2KT7 A;  3V61 A;  1EO6 A;  2A4Z A;  2WX1 A;  5CTR C;  1XF5 L;  2LAS A;  3VTV A;  3WIM A;  2LWP A;  3APC A;  3BVG A;  3ENE A;  3V62 A;  1ZE3 D;  2CHZ A;  4FAD A;  1CJE A;  4HKQ A;  1LM8 B;  2FUG 1;  1NI2 A;  3ZNI D;  1F52 A;  4A20 A;  3GZN B;  2LUE A;  3LDZ E;  5C3J B;  4KKI A;  1V5O A;  5HG2 A;  1QOG A;  2VRR B;  2IO2 B;  3PLU A;  4GGQ A;  1N61 A;  3W5V B;  3NUH B;  1V86 A;  1TBE A;  3Q6B A;  3AEF B;  3AMZ A;  2BQQ A;  4PYZ A;  4EEW A;  2CR5 A;  1ZXH A;  3HIZ A;  3L4P A;  2AQ2 B;  2ZNV C;  4OVV A;  3WA0 A;  4KIK B;  2AL6 A;  4XE0 A;  3B2G A;  2L3Z A;  1HZ6 A;  1RM6 C;  1YD8 U;  5D7G A;  2JPH A;  3V3X A;  2Z0D B;  2GBK A;  1GOZ A;  4HPM B;  3Q3F A;  3U8Z A;  3ZLZ A;  1E0Z A;  2JU6 X;  3AE5 B;  3OJ3 A;  3UQB A;  2DZI A;  1YNT E;  3AEA B;  1QQR A;  2UU7 A;  2VZK D;  2LJI A;  4IC7 B;  3Q8E A;  4MH0 E;  1TS4 A;  2BS4 B;  4CHK A;  3OLM D;  3A33 B;  2JXX A;  1T0R C;  3ALB A;  3LJ3 A;  3KYD D;  4NY0 A;  1IUE A;  1YN4 A;  2KJ6 A;  1WY8 A;  1T5X D;  2WDT B;  3FIL A;  2BW2 A;  2EMS A;  4LK0 M;  2W54 A;  2LD9 A;  2E6X A;  1L4D B;  4S0R A;  3ZNZ B;  1AW7 A;  4EKU A;  2XN9 C;  2KDM A;  1PGX A;  2LI5 A;  4F8C B;  3AV8 A;  5EE0 A;  1V1P A;  3P4R B;  1SXT A;  3N9Y C;  4FLH A;  2IGG A;  5BYR A;  4W9H A;  5HKH A;  1GC7 A;  1JRO A;  3PLV A;  2CU1 A;  2X38 A;  1E5W A;  3PRP B;  1J7A A;  5L95 C;  5E6O A;  3SFD B;  3NVZ A;  2M56 B;  1V8C A;  5IOI A;  3EC8 A;  4MH8 A;  2N9E B;  3R2T A;  3T8M A;  4LDT D;  1Q10 A;  1RFK A;  5KHQ A;  1DOI A;  2MBQ A;  3ZO5 B;  1WMH A;  1CZP A;  1YX6 B;  2BF8 B;  3WAN A;  1XEE A;  2HJ8 A;  1K50 A;  2NBU A;  5BMI A;  1HZ5 A;  1UWX A;  4DHZ B;  2L52 A;  4YWG G;  1ISN A;  5JHA A;  4K3C A;  2KWV B;  1EU4 A;  2RDB C;  4HK2 A;  2N7J A;  4BAX A;  4ANX A;  4C4V A;  1D5M C;  1STE A;  2K3U A;  2B76 B;  4OHJ A;  1VDV A;  4WWO A;  3VUY A;  3ZTD A;  1WE7 A;  4WWM A;  5LNK 1;  1SJH D;  1MHH E;  2PEA A;  2FCS A;  3AM9 A;  2WLB A;  1E8Y A;  4RGT A;  3UIN B;  4L1B A;  1TT5 B;  5DPR A;  1C79 A;  4MM3 B;  3A1Q A;  2GBR A;  1GJZ A;  1ZDX A;  2LEK A;  3A4S C;  3PZ7 A;  5G5G A;  3ZTC A;  4M02 A;  2SEB D;  3WCQ A;  1IGD A;  3AEC B;  1AAR A;  3QWZ B;  1WZ3 A;  1WI0 A;  4K7U A;  4NJ7 A;  2IDY A;  2KFK A;  4MEL A;  1ZKH A;  4ZDV A;  1HTQ A;  3AE8 B;  2N7E A;  5MPO A;  3NG0 A;  2KK8 A;  4XDD A;  5D3D A;  4PS3 A;  3TEW A;  4RF0 A;  1ESF A;  4M00 A;  1WGK A;  1WZ0 A;  3P2B A;  4W9D A;  2FUH B;  2KJR A;  1JCK B;  2YEP F;  4GB9 A;  5AZG A;  1XLP A;  3CIR B;  1IGC A;  2ZVO A;  4AS1 A;  3PRM B;  1TS2 A;  2BYE A;  2MH7 A;  1WXS A;  4WWP A;  3RN9 C;  4B0E A;  3L16 A;  4IWQ A;  2MEK A;  2KD0 A;  4B95 A;  4ANU A;  3PSE B;  2J0M A;  1PGA A;  1WXQ A;  1P7E A;  4LNN A;  3VR8 B;  2XK5 B;  4WUR A;  1V1P B;  4JPS A;  4TUU A;  4YTN B;  3BYT B;  4PT5 A;  2BYT A;  4ZOH C;  1ZXI A;  2GOW A;  2PE6 B;  1P7F A;  3PHX B;  3AE6 B;  1FRR A;  2GLS A;  1SB3 C;  3BVZ A;  2FE8 A;  4WAF A;  4DHJ B;  1CMX B;  2WXQ A;  2QIE B;  1T3Q A;  3JVZ X;  1N6Z A;  1T0S C;  5JXV A;  3BWU D;  4XWW A;  4N9F 4;  2W9N A;  4JIO U;  2HTH A;  2KQ7 A;  4ACF A;  2RD0 A;  2MRP A;  3DBR B;  1XQQ A;  3APD A;  4REZ A;  1J19 A;  1WJ4 A;  2ZNV B;  4IM2 A;  2JZZ A;  4MSQ B;  3IHP C;  1WFY A;  2N1W A;  3IT6 B;  5J2R A;  2DBY A;  3WAM A;  1FO4 A;  4MGI E;  2KNB A;  1P98 A;  5D6J B;  1KFY B;  1R4N I;  2M1M A;  1LFD A;  3VQI A;  2GBJ A;  3AE3 B;  2C5L C;  2QDF A;  3MP9 A;  3U2S C;  5AUI A;  1F9J A;  2W82 A;  1SSN A;  1T0Y A;  1MJD A;  2H89 B;  4AUQ C;  4TSS A;  1UBQ A;  5G2N A;  2KQ4 X;  1FRD A;  3IAM 1;  1MI0 A;  1NEK B;  3IVF A;  4ZHO A;  1WX7 A;  2ZCB A;  4NZL B;  4BOZ B;  3PZ8 A;  5GMV A;  5D2M B;  1WRD B;  2DHZ A;  2WXF A;  2KFK B;  3B0A A;  4FHK A;  4EZL A;  3OJ4 B;  1I4P A;  4GN1 A;  4ZYS A;  1CQV A;  4P6V F;  1OGW A;  3DDC B;  3MC9 A;  1L2N A;  3VR9 B;  3W1S A;  1JWS D;  1KOT A;  4ARI A;  3ZYY X;  2MBH A;  1WYG A;  2QIL A;  3W5U B;  3AU5 A;  1Y8R C;  1F2R C;  3U30 A;  5LXI B;  1I42 A;  2VZK B;  2BS3 B;  2D11 A;  3U52 E;  2M0A A;  2KDF B;  1GPX A;  1IP9 A;  4KGR A;  2KXJ A;  1E7U A;  1TY0 A;  4XZ4 A;  5IN7 A;  1EWC A;  2W3R A;  4KIK A;  1WH3 A;  3FKY A;  1L6V A;  1FMA D;  1UUP A;  3ZGZ A;  2WDR B;  2IO1 B;  2L00 B;  3Q69 A;  2IY0 B;  4MGY E;  4KSL C;  3QQ8 B;  3NVW A;  4I6P A;  3FC4 A;  1KTK A;  2WXM A;  3V05 A;  2ASQ A;  5KHO A;  1M4V A;  1KJT A;  2WNM A;  4C4V B;  4QAY A;  3TCA A;  3P1M A;  3VH3 B;  2ZPY A;  4MM3 A;  3DBR I;  3DPD A;  4ZRP A;  1GB4 A;  3W1S C;  3RT3 B;  1JRU A;  3NHE B;  2G3Q B;  1P0R A;  4FXC A;  4YTP B;  4D2K A;  2N9P C;  3DOW A;  2Q5W D;  2WXJ A;  2IPK D;  2LGY A;  3MC0 B;  2K25 A;  2VH1 A;  1JW9 D;  5BMG A;  4OZA A;  3N30 A;  5AUK A;  2XNA C;  1B9R A;  2D07 B;  2HTM E;  1FD6 A;  3VRA B;  1TIF A;  2MBO A;  5CHW A;  3ZQ4 A;  2XBB C;  3PGE A;  3A9J A;  2JUO A;  1T6B X;  1YJ1 A;  2FCM A;  2M19 A;  2JZ3 B;  2KKC A;  3LYY A;  4BZA A;  1RWS A;  1OQQ A;  3IBE A;  4EOY A;  3HUI A;  1SJE D;  1WGD A;  2KX3 A;  2W55 A;  3DBL B;  2KLG A;  3SR6 A;  2ZCC A;  1A70 A;  2OJW A;  3KQ4 A;  4KDI C;  1DGJ A;  3FAH A;  4EUT A;  2JWU A;  4M8M A;  3UI3 A;  3D32 A;  2O6V A;  1Y56 A;  5E6N A;  4GOC A;  2N7D A;  1MPE A;  2NTT A;  5FKA C;  3ZVV A;  3UGB B;  2QSD A;  4KX6 B;  3NJT A;  2JXT A;  3QHT A;  2BYV E;  2L0F A;  4RNA A;  4ICU A;  5BMH A;  3TEX A;  2D3B A;  3C8Y A;  4URK A;  1YIW A;  1EWY C;  2WHI A;  1ZW7 A;  2PW9 A;  2FCQ A;  1YX5 B;  4WJO A;  1DOX A;  3AEB B;  4PS7 A;  2D3G A;  1KLG D;  3BY4 B;  3E9S A;  2L7R A;  3PO0 A;  3BVM A;  1AYF A;  2AYO B;  2BT6 A;  2WXK A;  3APF A;  2Z8L A;  1UF0 A;  3ZW3 A;  2JT4 B;  1QIL A;  3JSV A;  1BUI C;  2CHW A;  1LO5 D;  5FR6 A;  3HVD A;  4FJY A;  3QCA A;  4B9K A;  1E6E B;  1KF6 B;  3PS6 A;  4IWP A;  1UZX B;  4AWJ A;  4BBN F;  1WIA A;  2GBM A;  3QX1 A;  2MLB A;  3KH0 A;  2PJH A;  4DK5 A;  4HRO A;  3QA8 A;  3MJ5 A;  2O2V A;  4PK1 A;  2ZW0 A;  1WRI A;  2LZ6 A;  4OZC A;  1XT9 B;  2FID A;  2WXR A;  3ZDM C;  3EGR A;  4ZHP A;  3AED B;  1VZ8 A;  2BKF A;  1NDD A;  4K7S A;  4GXB A;  3X23 A;  2IND C;  3H7P B;  3LXF A;  3GOE A;  2PVO D;  5IA7 A;  2IY1 B;  3QAR A;  4EFO A;  3VXW A;  2WXO A;  4P7I A;  4HCN B;  3VVW B;  3R8B A;  2BB5 A;  1SEB D;  2KMC A;  3AEE B;  4C7Z A;  1YN3 A;  3DWM A;  4KGS A;  2KX0 A;  3PZD A;  1NYR A;  4TMA B;  1OQR A;  5EE3 A;  1TTN A;  3AE7 B;  3HHM A;  3N1X C;  1M94 A;  3R3M A;  4IG7 B;  1VD2 A;  2KC2 A;  4WQM A;  1U4A A;  2D2Q A;  5AEK B;  2KWC A;  3AN1 A;  4JLC A;  2BPS A;  3H7S A;  2AEH A;  2EMT A;  1MG8 A;  2WU2 B;  2ZPN A;  5HFY A;  3RFZ B;  2WYQ A;  2DLB A;  3NS1 A;  1WXV A;  4WJP A;  1D4B A;  4IKG A;  4MSM B;  4DDG D;  2MP2 B;  3L13 A;  3MJW A;  4WIP A;  3PVL A;  2INN E;  1K53 A;  2G4S A;  4NAW B;  1QKZ A;  1YJJ A;  4AOF A;  3R7R A;  5HHD G;  1VJK A;  1NBF C;  2QCZ A;  3C19 A;  3I9V 1;  2M0X A;  1V1O A;  2L0T A;  3GE8 C;  1IBX A;  1PQS A;  1NI3 A;  3H1U A;  2W3S A;  3H9D A;  4H2A A;  4YSX B;  3ZJT A;  2RDG A;  1A5R A;  2KDI A;  1HE8 A;  2TSS A;  3DHG C;  3UQA A;  2KO3 A;  2WXL A;  2IGD A;  1C4C A;  3T3N A;  1C3T A;  3PTF C;  2MHJ A;  2RSU A;  4USA A;  3V60 A;  3Q3N C;  2K8B A;  4GSW A;  2NCN A;  4BKS A;  1L6U A;  3IG3 A;  2GMI C;  2JWZ A;  4OVZ A;  5J17 A;  2N9X A;  1JQ4 A;  1ENF A;  5E6P A;  3RMK C;  2RMM A;  4DHZ E;  2OHF A;  3RZF A;  5DPT A;  5G55 A;  4RH6 A;  3N32 A;  3TUO A;  3P4S B;  3PT2 B;  3T9L A;  1WJU A;  1HA5 A;  3DCG A;  3O65 B;  2NBW B;  3A9J B;  4A6Q A;  1PFD A;  3K9O B;  3P4Q B;  4KVG B;  1FNW A;  4GIV A;  4WJN A;  2RDH A;  3ZRC A;  2K5P A;  1L0V B;  3FIL B;  3DVG X;  3U7D A;  2K6Q A;  2CKH B;  4KSK C;  4WQO B;  1CK1 A;  4AJW A;  2J4X A;  4XYC A;  4NJC A;  4W9L A;  4G0N B;  4HRS A;  1AN8 A;  2AWT A;  4W9J A;  3VH4 B;  1I35 A;  3KYC D;  1F1H A;  2LUM A;  4P1C C;  4A55 A;  2ONQ A;  4XDC A;  2YEP B;  2LRW A;  4TQ1 A;  2ACZ B;  3H8H A;  2REX A;  2DAJ A;  1EU3 A;  4JWU C;  5EDS A;  2XEW A;  3U4E G;  3VAW A;  1FIQ A;  1E8Z A;  2CHX A;  3B2F A;  1WF9 A;  1J8C A;  1K52 A;  3A9K A;  5HI1 A;  4ANV A;  1XD3 B;  4MJS A;  3PHW B;  4P16 A;  5C1Z A;  1UBI A;  4CYE A;  1VRA B;  1EUV B;  4K1R B;  5CHF A;  4S17 A;  4XWT A;  3JYU A;  1JWA D;  2KYW A;  3KUZ A;  1JRP A;  1DOY A;  2RGF A;  3Q3M C;  1GUA B;  4LJP B;  2IZV B;  3CF6 E;  3ABV B;  2DYM A;  3VRB B;  1WXM A;  4K7W A;  3KWV A;  1VCB A;  1WYW B;  1TKE A;  1OTR B;  2IO3 B;  4G11 A;  1KLU D;  1TJE A;  2ICI A;  3UF8 A;  4DXG A;  1MHX A;  1XLN A;  3SFE B;  3AXC A;  1K8R B;  2BS2 B;  1JAL A;  3RI7 C;  2L83 A;  3TEY A;  2KN4 A;  4RF1 A;  1WGH A;  3M3J A;  2C7H A;  2V4L A;  3NZ3 A;  1HXY D;  2AX5 A;  2AQ1 B;  2DZM A;  2JSV X;  4P1B C;  4ZYN A;  2KVR A;  4HJG E;  2BWE S;  3PRZ A;  3AUL A;  2KN5 A;  1UGJ A;  1V80 A;  1B1Z A;  2INC C;  2O6V B;  3QJZ A;  1D3Z A;  1C4P A;  2BBC A;  2G1E A;  3ZJV A;  4FUL A;  2GB1 A;  4XGA B;  2KFJ A;  2KLC A;  2ZEQ A;  2UWQ A;  3VHT C;  5FR3 A;  1UNS A;  3OAW A;  3DBL I;  2GBN A;  4II2 B;  1I4R A;  2D10 A;  1EF5 A;  3Q8A A;  3DQV A;  5JZE B;  1JWU D;  2IGH A;  2PLP A;  5EE1 A;  3EEC A;  2N0S B;  2WQY B;  2NTS A;  1FXI A;  2WDQ B;  5CX3 A;  2K8C A;  5C2T B;  1D6E C;  4I6L B;  1ZPS A;  1SE9 A;  4J6I A;  2L1A A;  1SIF A;  2QMT A;  1OQY A;  1WGR A;  1ZGU B;  3DBS A;  4L2Y A;  3AE4 B;  1FNU A;  1N62 A;  2VH2 A;  1QOF A;  4RGM A;  4B6W A;  3RCZ A;  4ITK A;  1VZ7 A;  2KVZ A;  2A5U A;  2OED A;  1ET9 A;  4KZC A;  1C4A A;  2MA9 B;  1ET6 A;  1GC6 A;  2BKR B;  4A90 A;  1QT9 A;  1S3S G;  1WR1 A;  2MP2 A;  4PYU A;  1EF1 A;  3LB8 C;  2V3P A;  2KAC A;  3IT4 B;  1UWM A;  4A8X C;  5EE9 A;  1E7P B;  3OG5 A;  2V1Y A;  3DBH B;  4EE2 A;  2IJ0 A;  3ZRF A;  5D94 A;  3I57 A;  3NZU A;  1IBX B;  3KWL A;  4ANW A;  1XLQ A;  2WS3 B;  1FNV A;  3CWI A;  1WJN A;  1SE4 A;  4KV2 A;  1QLB B;  3M95 A;  4TKN A;  1GB1 A;  3P63 A;  5GXG B;  2WXI A;  4ZRI A;  3SU8 X;  3H7P A;  3ZNH B;  2OJR A;  2I1K A;  4E71 A;  1WR6 E;  4W9C A;  4OW0 A;  3EUB 2;  3I63 C;  3NOB A;  1I4G A;  3OWE B;  5E6J A;  1MVK A;  4JL9 A;  4WJQ A;  1S1Q B;  3PRE A;  4FJZ A;  2MX2 A;  3MHZ A;  1TKY A;  2DNF A;  3Q14 C;  1ZDV A;  2WXG A;  2KTR A;  2LVO A;  3SD5 A;  2BTE A;  3M63 B;  2WGS A;  1JWB D;  1JWM D;  2JY6 A;  1N60 A;  4M01 A;  4HCP B;  1UD7 A;  2FNJ B;  4JWS C;  4US8 A;  1WM2 A;  2DZK A;  3TMP B;  2FCN A;  2L76 A;  3ONS A;  2J7Q B;  4FA6 A;  1SE2 A;  2V3N A;  1R4M I;  2M4N A;  5LLI A;  2Y5C A;  4JQW C;  2PIA A;  1GNU A;  5I4D A;  2NPT B;  3BIN A;  2Y5P A;  4YL8 A;  1YN5 A;  3NRZ A;  1BXT A;  2JRH A;  1WXA A;  2KJH B;  3PPA A;  2WWZ A;  2NBV B;  4DXA B;  3W2D A;  4NQK E;  1Q0W B;  1WMH B;  3ZXR A;  1BT0 A;  2HD5 B;  4LJO B;  4RCO A;  5TSS A;  2JX5 A;  4HLE A;  2MW5 A;  3GP7 A;  1J7B A;  1L0Y B;  1SF0 A;  4BKT A;  4WH4 A;  1C9F A;  4K3B A;  1WJ6 A;  2KZR A;  4A3P A;  2MSE D;  2EEL A;  1WM3 A;  3QK0 A;  3TJP A;  2BGF A;  1I4Q A;  2HDE A;  4MGZ E;  5T8I A;  2DWQ A;  3AE1 B;  5G5H A;  4R3D A;  3DHH C;  2JVC A;  4N59 A;  3VUX A;  3AEG B;  4IW0 A;  2KAJ A;  4AP4 C;  1Q5W B;  3Q3O C;  1VLB A;  2WDV B;  4NNJ B;  2QJL A;  1RFA A;  2WXN A;  4IWO A;  1KM7 A;  2KMM A;  1E10 A;  2WP9 B;  4KGT A;  2N9K A;  1DYQ A;  5D3I B;  1QF6 A;  1XCQ L;  3ZNG C;  1LGR A;  1SBB B;  3Q8C A;  2KWU B;  2L8J A;  2V3S A;  2CJO A;  4BVU C;  4HVB A;  3NVV A;  4WWN A;  4YTM B;  4B0M A;  4HEA 1;  3S2A A;  1X1M A;  4FBJ B;  4UDU C;  1Z5S B;  2MWS B;  2BWF A;  4ZRK A;  2LFI A;  1SE3 A;  3PV1 A;  3ETR A;  3Q8B A;  3KUD B;  2XK5 A;  3SDL C;  3GZN I;  1D5Z C;  3QIJ A;  3AU4 A;  2MJE A;  3TSS A;  4W9I A;  3VTW A;  3BII D;  2DX5 B;  4CO7 A;  1K51 A;  1V2Y A;  1C77 A;  2K8H A;  4C56 C;  2R2Q A;  1Q1O A;  4BKG A;  4HJK A;  1L7Y A; 
#chains in the Genus database with same CATH homology
 1WJU A;  2KDB A;  3DCG A;  3WAM A;  1OEY J;  3O65 B;  4AJY B;  2PPH A;  4MGI E;  2LVQ A;  2KNB A;  2NBW B;  3A9J B;  1TGZ B;  3K9O B;  1P98 A;  4KVG B;  5D6J B;  1R4N I;  2M1M A;  3H6N A;  1LFD A;  4GIV A;  3VQI A;  2GBJ A;  4GDK A;  4WJN A;  2C5L C;  1KLV A;  3ZRC A;  3RZW C;  3V6E B;  3DVG Y;  1F9J A;  3DVG X;  3U7D A;  3TIX A;  1T0Y A;  2K6Q A;  2CKH B;  2KAN A;  2FAZ A;  4KSK C;  3L10 B;  5AZF A;  4W9F A;  4WQO B;  1P1A A;  3A9K B;  4AJW A;  4AUQ C;  4G50 A;  4W9L A;  2CS4 A;  2I1J A;  1UBQ A;  4K81 A;  5G2N A;  4MEM A;  4DBG A;  4G0N B;  3IVF A;  1WX7 A;  2ZCB A;  3RUL A;  4XX5 A;  2AWT A;  3L54 A;  4W9J A;  4WAA A;  3VH4 B;  4BOZ B;  1I35 A;  3HM3 A;  3KYC D;  5GMV A;  1UGM A;  3ZDT A;  2M17 A;  2MCN B;  5D2M B;  1WRD B;  1H4R A;  2DHZ A;  2KFK B;  3B0A A;  4FHK A;  4EZL A;  2IYD B;  2LRW A;  2KQS A;  3OJ4 B;  4TQ1 A;  3MHS D;  4IM3 A;  1J0G A;  2C7M B;  4GN1 A;  2REX A;  2NS5 A;  2Z59 B;  1WX9 A;  2KTF A;  2M8S A;  2DAJ A;  1OGW A;  2JF5 A;  2KC1 A;  3DDC B;  3DVN V;  2XEW A;  4EZK A;  5TR5 A;  5EDS A;  3KVF B;  1L2N A;  3W1S A;  2K1F A;  3VAW A;  2AL3 A;  2G4D B;  4RM9 A;  1E8Z A;  2CHX A;  2DYO A;  3KW5 B;  4MDK E;  1WF9 A;  1SGH A;  3VDZ A;  1J8C A;  2K6D B;  1KOT A;  3A9K A;  4KZ0 A;  1UEL A;  3VFK A;  3K9P B;  2MBH A;  3VUW A;  4ANV A;  1XD3 B;  4MJS A;  2MBB B;  3PHW B;  3UIO B;  2N1V A;  5C1Z A;  4JGH B;  5J18 A;  1UBI A;  5BO4 B;  2O6V D;  2DZJ A;  2YVC A;  2KDE B;  3AU5 A;  4FJV B;  4CYE A;  1GG3 A;  1Y8R C;  1EUV B;  4K1R B;  3U30 A;  5LXI B;  1I42 A;  5CHF A;  3DVN U;  1YQB A;  1V6E A;  3JYU A;  5JHB A;  2D11 A;  4XC2 A;  3ZUN A;  3HM6 X;  2WX0 A;  2KDF B;  3KUZ A;  3HK0 A;  1IP9 A;  2KXJ A;  1E7U A;  2RGF A;  3ML8 A;  4XZ4 A;  1TZ1 A;  1OEY A;  1GUA B;  3TL5 A;  4LJP B;  2IZV B;  4KIK A;  3RYT A;  3CF6 E;  1V9J A;  2DYM A;  1WH3 A;  1RRB A;  3V61 A;  1EO6 A;  1WXM A;  2A4Z A;  2WX1 A;  4K7W A;  2RR9 A;  5CTR C;  2LAS A;  1VCB A;  1WYW B;  3VTV A;  3VTU A;  1OTR B;  2IO3 B;  3WIM A;  4G11 A;  2LWP A;  3APC A;  3UF8 A;  2IO1 B;  3ENE A;  3AXC A;  1K8R B;  2CHZ A;  2L00 B;  3V62 A;  4FAD A;  2IY0 B;  4MGY E;  1LM8 B;  4KSL C;  3QQ8 B;  2EKE C;  4I6P A;  2N4F A;  1NI2 A;  3ZNI D;  1WGH A;  3M3J A;  2C7H A;  4MGK E;  4GMV A;  2V4L A;  2ASQ A;  2MBE A;  5KHO A;  4A20 A;  2LUE A;  3LDZ E;  4LCD E;  4ZYN A;  1KJT A;  2DZM A;  2KVR A;  1V5O A;  3NS8 A;  3TBL D;  2BWE S;  2VRR B;  2IO2 B;  4GDL A;  3TCA A;  3PRZ A;  3PLU A;  5DCN A;  3VH3 B;  2ZPY A;  4GGQ A;  4MM3 A;  2MQJ A;  3AUL A;  3DBR I;  2KN5 A;  3DPD A;  4NJ6 A;  3W1S C;  2NPT A;  1V86 A;  1TBE A;  1JRU A;  1V80 A;  2ZVN A;  3L08 A;  3NHE B;  3RT3 B;  1E8W A;  2O6V B;  3QJZ A;  4W9E A;  4PYZ A;  4EEW A;  2CR5 A;  2ZJD A;  2L05 A;  1D3Z A;  3HIZ A;  1V49 A;  2G3Q B;  1P0R A;  2N9P C;  4FUL A;  3DOW A;  3EHV A;  2C60 A;  2KFJ A;  2LGY A;  4RM8 A;  2KLC A;  2ZNV C;  4OVV A;  2DYB A;  2ZEQ A;  2UWQ A;  2K25 A;  3VHT C;  3OAW A;  3WA0 A;  4KIK B;  2AL6 A;  3DBL I;  2GBN A;  2LRU A;  2L3Z A;  4II2 B;  2D10 A;  3N30 A;  1EF5 A;  3DQV A;  1YD8 U;  2BYF A;  2D07 B;  5JZE B;  5D7G A;  3EEC A;  3WAL A;  2JPH A;  3A4R A;  4PS8 A;  1Z2M A;  2MBO A;  2Z0D B;  5CHW A;  2GBK A;  5CX3 A;  2XBB C;  2K8C A;  3PGE A;  3A9J A;  2JUO A;  1YJ1 A;  4I6L B;  2QHO A;  4OVU A;  4G3X B;  2FCM A;  4HPM B;  1SE9 A;  2JZ3 B;  2J0J A;  2KKC A;  4J6I A;  3Q3F A;  3U8Z A;  3ZLZ A;  4GDK B;  2DEN B;  1SIF A;  3OJ3 A;  3UQB A;  2DZI A;  1OQY A;  1WGR A;  1ZGU B;  3DBS A;  3IBE A;  4EOY A;  4E74 A;  4IC7 B;  1WGD A;  2KX3 A;  4MH0 E;  4CHK A;  2KLG A;  3OLM D;  2ZCC A;  4B6W A;  3A33 B;  3V6C B;  2JXX A;  3RCZ A;  3ALB A;  3LJ3 A;  4KDI C;  2A5U A;  3KYD D;  4NY0 A;  4EUT A;  3UIP B;  2KJ6 A;  4M8M A;  1E7V A;  1WY8 A;  3D32 A;  2O6V A;  4KZC A;  5E6N A;  1FXT B;  2NR2 A;  2WDT B;  2MA9 B;  1G6J A;  4GOC A;  1GC6 A;  2BKR B;  4HPL B;  2EMS A;  2N7D A;  5DPW A;  2KTR B;  2RPQ A;  1S3S G;  2LD9 A;  3I3T B;  1WR1 A;  2MP2 A;  4PYU A;  4LDT B;  1EF1 A;  3ZNZ B;  3ZVV A;  2UYZ B;  4W9G A;  3L0W B;  3UGB B;  4EKU A;  1V5T A;  1C1Y B;  3RUI B;  2HE7 A;  2LI5 A;  4F8C B;  2V1Y A;  2LJ5 A;  3JSV B;  2J0K A;  3ZRF A;  5D94 A;  3QHT A;  2BYV E;  2L0F A;  2O2V B;  4FLH A;  3NZU A;  4ICU A;  4W9H A;  5HKH A;  1GC7 A;  4URK A;  1YIW A;  3JW0 X;  3PLV A;  4NPN A;  2CU1 A;  3B08 A;  4ANW A;  1LQB A;  1E5W A;  1WJN A;  3PRP B;  1ZW7 A;  3NZS A;  4KV2 A;  5L95 C;  3M95 A;  5E6O A;  4TKN A;  5JH5 C;  2FCQ A;  3EC8 A;  1YX5 B;  4WJO A;  2LGD A;  3L17 A;  4ZRI A;  2N9E B;  3SU8 X;  3H7P A;  3T8M A;  2OJR A;  2I1K A;  4LDT D;  1WR6 E;  4W9C A;  3ZNH B;  4E71 A;  4PS7 A;  4X57 B;  2D3G A;  3NOB A;  3BY4 B;  2L7R A;  5IAA C;  2MBQ A;  4JL9 A;  3ZO5 B;  1WMH A;  4DWF A;  4E3C A;  5KHQ A;  5AZH A;  4WJQ A;  1YX6 B;  1S1Q B;  2AYO B;  3PRE A;  4FJZ A;  2MX2 A;  3APF A;  3NY5 A;  3ZW3 A;  2BF8 B;  2JT4 B;  3WAN A;  4ICV A;  3JSV A;  2HJ8 A;  2CHW A;  2NBU A;  2KTR A;  2LVO A;  5FR6 A;  3SD5 A;  3M63 B;  4DHZ B;  4HDQ A;  4FJY A;  4I6N B;  5LXH A;  3QCA A;  4B9K A;  1ISN A;  2JY6 A;  5JHA A;  2KWV B;  1H8C A;  3PS6 A;  4IWP A;  4HCP B;  1UZX B;  3ML9 A;  4AWJ A;  4FN2 A;  1UD7 A;  4HK2 A;  1WIA A;  4BBN F;  2FNJ B;  1IYF A;  2GBM A;  4ANX A;  3QX1 A;  1UH6 A;  1WM2 A;  2MLB A;  3KH0 A;  2PJH A;  2DZK A;  3TMP B;  2FCN A;  4DK5 A;  2L76 A;  3ONS A;  3QA8 A;  2J7Q B;  4GDL B;  4BOS C;  4FA6 A;  2O2V A;  4ASW C;  3QAQ A;  1R4M I;  4BBN C;  2M4N A;  2LZ6 A;  5LLI A;  1XT9 B;  4JQW C;  2FID A;  4WWO A;  1GNU A;  3ZDM C;  2LXA A;  3VUY A;  3AI5 A;  3ZTD A;  2NPT B;  1WE7 A;  3BIN A;  3KUC B;  3WAO A;  4YL8 A;  2IO0 B;  2PEA A;  3EFU A;  3IFW B;  2BKF A;  2FCS A;  3UIN B;  1E8Y A;  1NDD A;  3Q3J A;  4K7S A;  4GXB A;  5DPR A;  3R7Q A;  3X23 A;  2JRH A;  1WXA A;  2KJH B;  3PPA A;  3H7P B;  4ZRJ A;  2WWZ A;  3GOE A;  2NBV B;  4DXA B;  3A1Q A;  2GBR A;  1GJZ A;  3MTN B;  4NQK E;  5IA7 A;  1Q0W B;  1WMH B;  3A4S C;  2IY1 B;  3QAR A;  4EFO A;  1RAX A;  3ZTC A;  3VXW A;  3VVW B;  3CST A;  4HCN B;  4P7I A;  5DPS A;  1BT0 A;  2HD5 B;  4LJO B;  2KMC A;  3T9L A;  1AAR A;  4HLE A;  3QWZ B;  1WZ3 A;  2LVP A;  1E90 A;  2MW5 A;  1WI0 A;  1P3Q U;  4IM0 A;  4BKT A;  4DHJ D;  4EZJ A;  4IUM B;  3B1L X;  3QC8 B;  2KX0 A;  3PZD A;  4K7U A;  4NJ7 A;  2KFK A;  1WJ6 A;  2KZR A;  1LXD A;  2C7N B;  4A3P A;  2DAF A;  4MJS B;  4MEL A;  1ZKH A;  2MSE D;  4ZDV A;  2KOX A;  4HDO A;  4FHJ A;  1TTN A;  1WM3 A;  1RLF A;  3HHM A;  1M94 A;  3QK0 A;  3TJP A;  2BGF A;  3R3M A;  2N7E A;  2FIF A;  4IG7 B;  4MGZ E;  1VD2 A;  2KC2 A;  1U4A A;  2KK8 A;  2D2Q A;  2IBI B;  4HWI B;  4PS3 A;  2JVC A;  5AEK B;  2KWC A;  3VUX A;  4JLC A;  2BPS A;  4IW0 A;  3H7S A;  2AEH A;  2EMT A;  3W1Y A;  1WZ0 A;  4F1S A;  3A1Q B;  3P2B A;  1MG8 A;  3ZKJ C;  4AP4 C;  5L83 A;  2ZPN A;  4W9D A;  2FUH B;  2KJR A;  2WYQ A;  1Q5W B;  1IPG A;  4NNJ B;  2YLM A;  1WXV A;  4GB9 A;  5AZG A;  2KHW B;  1RFA A;  4WJP A;  2ZVO A;  3PRM B;  2BYE A;  4MSM B;  3C0R B;  4KDL B;  1WXS A;  4WWP A;  3L16 A;  4DDG D;  2MP2 B;  3L13 A;  4IWQ A;  3ZIM A;  4IWO A;  3MJW A;  3M62 B;  2KD0 A;  1E8X A;  4B95 A;  2KMA A;  1KM7 A;  4ANU A;  1WGG A;  3PSE B;  3PVL A;  3CSF A;  2J0M A;  3WAP A;  2G4S A;  1WE6 A;  4NAW B;  4BKS D;  1QZE A;  2XK5 B;  4AOF A;  3X0W A;  4M8N A;  3R7R A;  3ZNG C;  4TUU A;  1NBF C;  4NQL B;  2KWU B;  2M0X A;  2L8J A;  2B3A A;  2V3S A;  4TV3 A;  2NVU I;  4BVU C;  4HVB A;  2L0T A;  1P9D U;  4WWN A;  4DDI D;  1PQS A;  2GOW A;  2PE6 B;  3H1U A;  3PHX B;  3S2A A;  2G45 B;  1X1M A;  2OOB B;  2Y5B B;  4FBJ B;  2PE9 A;  3H9D A;  2ZZP B;  4GU2 A;  4W9K A;  1A5R A;  3R66 C;  2KDI A;  1Z5S B;  1HE8 A;  2MWS B;  3CMM B;  2BWF A;  4HXD A;  4ZRK A;  4DHJ B;  1WX8 A;  3UQA A;  2KO3 A;  1CMX B;  2C9W B;  2R2O A;  1C3T A;  3PV1 A;  5CHV C;  3PTF C;  2RSU A;  3JVZ X;  3V60 A;  2K8B A;  2LGX A;  4GSW A;  2NCN A;  2K39 A;  4II3 B;  3SHQ A;  3ECI A;  4NAW A;  3KUD B;  4N9F 4;  4BKS A;  2XK5 A;  2LXC A;  3SDL C;  3IG3 A;  2W9N A;  3GZN I;  4JIO U;  2GMI C;  2JWZ A;  2HTH A;  3QIJ A;  2KQ7 A;  3AU4 A;  4F7Z A;  3DBH I;  5J17 A;  4RMA A;  2RD0 A;  2N9X A;  4BFR A;  4W9I A;  2MRP A;  5E6P A;  3RD2 A;  3VTW A;  2JRI B;  4DHZ E;  1XQQ A;  2DX5 B;  3APD A;  4CO7 A;  2Z0E B;  1V81 A;  4M0W B;  1J19 A;  3RZF A;  5DPT A;  1WJ4 A;  1V2Y A;  2K8H A;  5G55 A;  2ZNV B;  4IM2 A;  4A3O A;  2JZZ A;  3N32 A;  4MSQ B;  3IHP C;  4TQ0 A;  2R2Q A;  1WFY A;  1Q1O A;  2N1W A;  3N3K B;  4BKG A;  5C23 A;  3PT2 B;  1WGY A;  4HJK A;  5J2R A;  1L7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...