2FCMA

X-ray crystal structure of a chemically synthesized [d-gln35]ubiquitin with a cubic space group
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
73
structure length
72
Chain Sequence
LQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Ubiquitin
publication title Dissecting the energetics of protein alpha-helix C-cap termination through chemical protein synthesis.
pubmed doi rcsb
total genus 23
structure length 72
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2fcmA00
4JL9A 2JY6A 3QHTA 3WIMA 4FN2A 5DPSA 3HM3A 3A1QA 4I6PA 4NQKE 2KQ7A 2N7DA 3HHMA 3KUDB 4NPNA 2MBOA 4W9JA 1ZGUB 3V60A 2DAFA 2KWUB 3VXWA 3AXCA 1WXSA 4GU2A 2CHXA 2K6DB 3GOEA 2N1VA 2A5UA 4ZDVA 1K8RB 2LI5A 3T8MA 3OLMD 3HM6X 2DYBA 3DBSA 1GG3A 2NCNA 4II2B 3PSEB 2CU1A 3JW0X 2LGXA 5CHVC 1XD3B 4K7UA 4B6WA 2ZVNA 2AL3A 4TQ1A 2N7EA 1P3QU 3PS6A 4PYUA 2BWES 3DVNU 3R3MA 4ICVA 4IWQA 4ZRJA 4HCPB 4MSMB 3C0RB 2DZJA 2L3ZA 5AZGA 3NHEB 1WGRA 1Z2MA 3RCZA 3KVFB 2ZZPB 3ZUNA 4A20A 1XQQA 2G4SA 1UBIA 3JVZX 2O6VB 3VH4B 2BPSA 2KX0A 4HDQA 3JSVB 3L13A 4EZLA 1E8YA 4XC2A 4WWPA 1S1QB 1WX7A 2J0MA 3ZVVA 4DWFA 3Q3FA 2K8HA 2KKCA 3H7PB 4IC7B 3ML9A 1A5RA 2GMIC 2JXXA 4JQWC 3WAMA 4DDGD 1YX5B 1EF1A 2JPHA 3AI5A 3APDA 4LJPB 2NS5A 4BOZB 2DENB 3A4SC 3LDZE 1S3SG 2BYVE 5DPWA 5IA7A 1JRUA 1NBFC 1UGMA 4E71A 4M8NA 2JF5A 3IBEA 5HKHA 2L7RA 1WGYA 3QX1A 3X0WA 4FBJB 2N1WA 3PV1A 1WJNA 2I1KA 4EEWA 2BGFA 2KJ6A 3ZRFA 2M17A 4BFRA 2MRPA 3V6CB 1WX9A 4W9GA 4B95A 5LLIA 4FJVB 4GMVA 4K1RB 4I6NB 2MCNB 3K9PB 1LM8B 2L0FA 4WJQA 1WR6E 5DPRA 4TUUA 3PZDA 2ZPYA 4AJWA 3UQAA 4IUMB 2D3GA 2OJRA 3JYUA 3DQVA 3DBHI 2XK5A 1HE8A 2KJRA 2HTHA 2Z0DB 4MJSB 2O6VD 1WI0A 1X1MA 4GIVA 4JLCA 3U8ZA 4J6IA 3IFWB 3M62B 4W9CA 1KJTA 2KTFA 3QJZA 4PS3A 3DCGA 2KFKA 3UINB 3X23A 4PYZA 1GNUA 1YX6B 3PRPB 4DHJB 3MHSD 2O2VB 2O6VA 3PGEA 2HJ8A 3ZNHB 2C7MB 2KWVB 2V3SA 2KDEB 4KDLB 4CYEA 2NBWB 2LVPA 3H7PA 3CMMB 4FLHA 4HK2A 3PLVA 4W9HA 2JWZA 2ASQA 2NPTB 1YIWA 4X57B 4K81A 1E7VA 4E74A 1P1AA 5JH5C 2D07B 1WGGA 1ZKHA 1Y8RC 3QK0A 3ZRCA 4FHKA 4MM3A 2LRWA 1TBEA 3B08A 1BT0A 4M8MA 5TR5A 2KDIA 2L00B 3NOBA 2PE9A 1WM3A 2M8SA 2MBBB 3P2BA 2R2QA 3L54A 1Z5SB 4GDLB 5KHOA 3ZNGC 2IZVB 4NY0A 3S2AA 1TGZB 5DCNA 2LVOA 3ZO5B 4FHJA 4HWIB 3RZFA 2K1FA 1WXVA 1V2YA 5E6NA 4KV2A 4YL8A 2RPQA 2MLBA 4MJSA 2LXAA 1EO6A 4DHJD 1OGWA 2PPHA 4G50A 2KN5A 2ZCCA 3MJWA 2LGDA 5LXHA 2W9NA 3TCAA 2CR5A 1KLVA 1Q5WB 1ZW7A 2LGYA 2UWQA 3ZNID 2GOWA 2BKRB 4EZJA 1H4RA 1ISNA 4MGZE 1E8ZA 4TV3A 2G3QB 2N9EB 4IM3A 3VVWB 2J0KA 3TBLD 2KNBA 3HK0A 4HDOA 4P7IA 4BKSD 4TQ0A 3K9OB 1C1YB 4LJOB 4M0WB 2NPTA 5JHAA 2KC2A 2KTRB 3VUWA 2FIDA 3TL5A 4TKNA 4W9EA 2WYQA 1IP9A 2D10A 3EFUA 2MP2A 2FCMA 4ZRKA 1Q1OA 2LXCA 4W9IA 1V86A 3SDLC 3TJPA 4KIKB 2WX1A 5J18A 1IPGA 4GDLA 3R7QA 4N9F4 1M94A 3OJ4B 4JGHB 1QZEA 3NY5A 4NAWB 4PS7A 4G0NB 1E8XA 2GBRA 1OEYJ 3QA8A 2GBJA 2WWZA 2D2QA 3WAOA 3OJ3A 2K25A 3SD5A 4DXAB 3R66C 3RUIB 4GXBA 2R2OA 4LCDE 4ZYNA 3ECIA 4BVUC 3UQBA 2ZJDA 3EC8A 3Q3JA 4I6LB 2I1JA 2MA9B 4B9KA 3PHWB 2XEWA 1V81A 3DOWA 3NZUA 2NR2A 4ZRIA 4FULA 3RZWC 5CX3A 4HVBA 2MSED 4K7SA 2AYOB 2BKFA 3B0AA 4GOCA 4W9KA 5BO4B 2AEHA 1V6EA 2KMAA 1I35A 2IO3B 4GGQA 2LASA 4HPMB 2FAZA 1WMHB 2KTRA 3QQ8B 2K8BA 3V6EB 4AOFA 1WF9A 3A33B 3L16A 5JHBA 1WM2A 3DVGY 3PRZA 2YLMA 4F8CB 5L83A 4KSLC 2FCSA 1VCBA 1E7UA 1AARA 2KZRA 3AULA 4KIKA 4WWNA 3B1LX 2C9WB 1E90A 1WY8A 1WX8A 3BINA 3KUZA 5IAAC 2OOBB 3HIZA 1E5WA 3W1SA 1WRDB 3PHXB 4BOSC 4DDID 1EUVB 2KLGA 5D2MB 4NAWA 3M3JA 1GC7A 4WJPA 1SIFA 2MBEA 3ZW3A 4RM9A 1MG8A 3A9KB 3QC8B 2EKEC 3APCA 5E6OA 3W1SC 5C1ZA 2IO0B 2ZNVB 3H1UA 4HCNB 1WGHA 4MDKE 2LRUA 2ZCBA 1T0YA 1TZ1A 1TTNA 1VD2A 2DZIA 1WFYA 2FIFA 3JSVA 2BF8B 3A9JB 3CSFA 1V5TA 4KDIC 5E6PA 3RT3B 5G2NA 4HLEA 4GN1A 1WE7A 3VHTC 3W1YA 2K39A 4FA6A 1LFDA 2JVCA 4AJYB 2UYZB 2L0TA 5D7GA 4ANVA 3EECA 4NJ6A 4DK5A 4A3PA 4HPLB 2LD9A 3VH3B 1WYWB 3MTNB 1C3TA 1V49A 2M4NA 4NJ7A 2ZEQA 1CMXB 2KQSA 5J17A 1UH6A 3PTFC 3O65B 2L76A 4G3XB 1WMHA 4MH0E 2JRHA 2RSUA 2J7QB 3IVFA 1WJ6A 1E8WA 3A1QB 4GDKB 2JUOA 3KH0A 1NDDA 2CKHB 4EUTA 4IW0A 2N4FA 1Q0WB 3UIOB 2A4ZA 2LWPA 2DYOA 3IHPC 2HD5B 2EMSA 2HE7A 4LDTB 4WJOA 1V80A 4DBGA 4WAAA 3R7RA 4WQOB 2WX0A 1SE9A 2NVUI 1LXDA 3WANA 2PJHA 2KVRA 3M63B 3IG3A 2AWTA 2LJ5A 3VTWA 1J0GA 5C23A 4GSWA 1OEYA 1YJ1A 3ZTDA 1SGHA 5JZEB 3D32A 5AZHA 3H6NA 3UF8A 4URKA 5L95C 5LXIB 4RM8A 2O2VA 2Z59B 3VFKA 4MGKE 4EOYA 1WJUA 3A9JA 3L0WB 2PE6B 2IY0B 1UELA 1G6JA 2MBHA 1J19A 1PQSA 2MX2A 3T9LA 4BBNF 3PREA 4MEMA 4A3OA 3ONSA 4OVVA 2KDFB 2KWCA 4EFOA 2C7HA 3VTUA 4JIOU 5AZFA 1YD8U 4MSQB 4F1SA 2K6QA 3PVLA 3QIJA 2LZ6A 2JRIB 4XX5A 2GBMA 1V5OA 2DAJA 1RRBA 3H7SA 4LDTD 4BKTA 4BKSA 3DVGX 2MWSB 5D94A 3WALA 2G4DB 4GDKA 4BKGA 4WWOA 2IO2B 1WZ3A 4IM0A 3ZDMC 2JZ3B 2KLCA 4FJZA 3PT2B 3ENEA 4AUQC 2DZMA 2Y5BB 2LVQA 2FNJB 2G45B 2LUEA 3AU5A 3I3TB 2DZKA 3QARA 4WJNA 5GMVA 1WH3A 1WIAA 2M1MA 1IYFA 2KDBA 2MW5A 2KMCA 1UD7A 2L8JA 4PS8A 2B3AA 3L08A 4IG7B 2NBVB 2BYEA 2KOXA 3TIXA 2CS4A 5FR6A 4E3CA 1YQBA 3PPAA 4DHZE 2XK5B 1J8CA 5D6JB 4MGYE 2K8CA 3U30A 3ZTCA 2IY1B 3ZLZA 4W9FA 2FCNA 3UIPB 2XBBC 2KFKB 3VAWA 1L7YA 4KZCA 4KSKC 2D11A 4K7WA 3VDZA 4CO7A 2C5LC 3V62A 3VTVA 3ALBA 3DDCB 3VQIA 4KVGB 4KZ0A 1EF5A 2MBQA 1XT9B 1UZXB 3RYTA 3APFA 1R4NI 2KHWB 3M95A 1OQYA 1I42A 1WXMA 4RMAA 3DPDA 4W9LA 3ZIMA 3EHVA 4NNJB 2V1YA 3VUYA 3U7DA 4ANWA 2C60A 2RR9A 2JZZA 2PEAA 1P0RA 3N3KB 2GBKA 4GB9A 2KANA 4HXDA 2GBNA 2RGFA 2RD0A 1KM7A 2KO3A 2NBUA 2KC1A 4IM2A 1GUAB 1WR1A 3GZNI 2KX3A 2IBIB 1NI2A 3DBLI 3RULA 4II3B 4EKUA 3PLUA 4XZ4A 2CHWA 1KOTA 2Z0EB 2ZPNA 3SHQA 2YVCA 1RAXA 2DX5B 3DVNV 4AP4C 3ZDTA 2DHZA 1V9JA 3N32A 4DHZB 4IWOA 4HJKA 4MGIE 1WZ0A 5KHQA 1H8CA 4W9DA 2N9XA 1F9JA 3NS8A 2REXA 4ICUA 2C7NB 2KJHB 4MELA 1LQBA 2AL6A 5DPTA 3QAQA 4ASWC 4ANUA 2WDTB 1P98A 2ZVOA 5EDSA 2L05A 1P9DU 1D3ZA 3KUCB 4IWPA 5CHWA 2N9PC 3OAWA 3LJ3A 4FADA 1WXAA 2BYFA 4F7ZA 2IO1B 3SU8X 5G55A 2DYMA 2IYDB 3ZKJC 1UBQA 2QHOA 3AU4A 1RLFA 2MP2B 5CHFA 3TMPB 2FUHB 1WJ4A 3VUXA 1GC6A 2EMTA 3KYCD 5J2RA 3NZSA 2KFJA 3A9KA 3PRMB 3N30A 3DBRI 3H9DA 5AEKB 3L17A 4NQLB 2BWFA 4G11A 4FJYA 1WE6A 3L10B 5CTRC 1R4MI 1L2NA 3QWZB 2M0XA 1WGDA 1OTRB 2J0JA 2JT4B 2KK8A 2VRRB 1RFAA 2ZNVC 3ML8A 3RD2A 3WAPA 2CHZA 2MQJA 1GJZA 3KW5B 3UGBB 1U4AA 3CSTA 3WA0A 3ZNZB 4AWJA 2V4LA 4ANXA 4CHKA 1FXTB 4EZKA 3CF6E 2KD0A 2KXJA 3QCAA 3V61A 3KYDD 4OVUA 3A4RA 4BBNC 2FCQA 3BY4B
chains in the Genus database with same CATH superfamily
4JL9A 5DPSA 2LHDA 4RGMA 4ARCA 2BS2B 4QAYA 4I6PA 1L4DB 3KUDB 2MBOA 4W9JA 2Y5PA 2DAFA 2KWUB 2L83A 4GU2A 2CHXA 1PGBA 2N1VA 2LI5A 3T8MA 5HI1A 4LNOA 1FMAD 1ENFA 4II2B 4PYUA 3DVNU 1D4BA 4HKZE 1Z2MA 3RCZA 2RDBC 2VH2A 2RMMA 1UBIA 5GXGB 2WQYB 4HRSA 2GLSA 2BPSA 2KX0A 4C80A 1E8YA 4XC2A 4WWPA 2Y3AA 3ZVVA 1MPEA 1J7BA 2SEBD 3ML9A 3U52E 4DDGD 3V05A 4LJPB 1ACCA 4BOZB 2K5PA 3LDZE 2BYVE 5DPWA 1UGMA 1NBFC 3SFDB 2PIAA 4M8NA 3Q8CA 2L7RA 4K3CA 5EE1A 4EEWA 1D5MC 2M17A 4B95A 5LLIA 4I6NB 2L0FA 4WJQA 5DPRA 1V1PB 3CIRB 1JQ4A 1XLOA 3UQAA 1HE8A 2KJRA 3CWIA 4GIVA 2BYTA 4W9CA 1KJTA 1MFWA 3QJZA 4PS3A 3DCGA 3LXFA 3UINB 2I2YA 1YX6B 1OQRA 4WH4A 2C7MB 2NBWB 5BMIA 4C00A 2WXHA 1TKEA 4W9HA 2NPTB 4FHKA 1L0XB 1BT0A 1UUPA 1I7HA 4M8MA 4XGAB 5TR5A 1BMLC 3P2BA 3BYYB 3WCQA 4ZHPA 1Z5SB 5KHOA 3NVVA 1N5XA 5IP4D 1DOIA 4NY0A 1C77A 1TGZB 1QILA 2JZPA 2ICIA 4FHJA 4AS1A 3RZFA 4KV2A 2RPQA 2LXAA 2KN5A 3MJWA 2LGDA 1TKGA 3NUHB 1Q5WB 2LGYA 3KWVA 4YTPB 1TJEA 3NVZA 1E8ZA 2G3QB 2WXGA 4IM3A 3SFEB 1PUTA 3VR9B 3K9OB 4ZRQA 1C1YB 2WXKA 2BW2A 1Q10A 2D10A 1LGRA 1SEBD 3B2GA 1ESFA 3UI3A 5BMHA 2KT7A 3SDLC 3TJPA 5H92C 3ZQ4A 2V3PA 4N9F4 1M94A 4IKGA 4B0EA 1XCTL 3NY5A 3NZ3A 4NAWB 2PTLA 4LLGM 1SE2A 3AE2B 1E8XA 2GBRA 2WWZA 3MFGA 2K25A 1CZPA 1F1HA 4LCDE 3ECIA 1KF6B 4I6LB 2I1JA 4B9KA 3DOWA 3NZUA 4FULA 4C7YA 2MSED 3B0AA 4CQNA 4B0MA 2AEHA 2WXMA 2LASA 1WMHB 4M0WA 3VR8B 1K52A 3V6EB 3L16A 5JHBA 2W82A 1K50A 3DVGY 2YLMA 2PLPA 1ET6A 1P7EA 1XF5L 2FCSA 3BWUD 4KIKA 3B1LX 1E90A 1WX8A 1E5WA 1WRDB 2N7JA 2KWDA 1AN8A 3PHXB 4RM9A 4RGTA 3APCA 3KLSX 5E6OA 3W1SC 5IN7A 1WGHA 2LRUA 1TZ1A 1TTNA 1FXIA 3RT3B 1J7AA 3W5VB 4AQ7A 1LFDA 2JVCA 4AJYB 1V8CA 5D7GA 2LD9A 3VH3B 3B2FA 4N6EB 2M4NA 1L4ZB 2ZEQA 1JWUD 3PTFC 2L76A 2J7QB 4RF1A 2QIEB 2H88B 4N59A 4GDKB 2JUOA 1NDDA 3ZJVA 2CKHB 2N4FA 3UIOB 1P7FA 4RF0A 2HD5B 3RFZB 1BUIC 1JWAD 1ZPSA 1SE9A 3P63A 1LXDA 3MC8A 2WXFA 2PJHA 2KDMA 4GSWA 5JZEB 2WDRB 4JPSA 5AUKA 4L23A 1DGJA 2IY0B 1UELA 2MX2A 2V9HA 2WXPA 3PREA 4MEMA 3AE6B 3ONSA 2R61A 4OVVA 3I5JC 2KDFB 3NG0A 5AZFA 2K6QA 4BKSA 2MWSB 1KLGD 3WALA 4MH8A 2G4DB 2K22A 1STEA 1YQ4B 1L0VB 4AUQC 2DZMA 2Y5BB 2LUEA 2DZKA 4KGSA 1FNUA 1UD7A 1JROA 3L08A 5FR6A 4E3CA 3MJ5A 2H89B 4HPPA 5D6JB 3BK1A 3U30A 1QKZA 3AE4B 2FCNA 1L7YA 5T8IA 3VDZA 4CO7A 1NENB 3VQIA 1F52A 4ACFA 1SE4A 2GRIA 2WXRA 4RMAA 4W9LA 2W55A 4P1BC 1OFFA 4NNJB 3RNGC 1GB1A 1XXGA 1I4XA 3U7DA 4ANWA 1Y56A 2RR9A 2JZZA 2GBKA 5D3IB 4YSZB 1JWSD 1FO4A 2GBNA 1TIFA 1KM7A 2CJOA 1GUAB 3GZNI 1RM6C 4A55A 3OWEB 2QDFA 1XO3A 1KOTA 4RGOS 2W3SA 4JX1C 1WYGA 3N1XC 2JSVX 1TZOA 2X38A 5DPTA 2C7NB 2QSDA 1GOZA 2AL6A 3U4EG 3QAQA 4ASWC 2WDTB 1P98A 1SIJA 3IAM1 2L05A 1P9DU 1QF6A 3AEDB 5CHWA 2AQ1B 1WXAA 2LMCA 1WRIA 1C4AA 2IYDB 2WNMA 4J3OD 3VUXA 2ONQA 3NZSA 1YQ3B 3A9KA 4KX6B 3N30A 5AEKB 4LK0M 2BWFA 4G11A 3BVMA 5CTRC 3R2TA 4LNNA 1OTRB 3ML8A 2CHZA 3UGBB 1U4AA 3CSTA 2QCZA 2V4LA 2KD0A 2D3BA 3V61A 1CQVA 3KYDD 1HZ6A 3BY4B 3QHTA 3HM3A 4NQKE 2N7DA 5G5HA 1HEZE 4NPNA 1TS4A 1GPXA 3VXWA 2QILA 2KQ4X 3GOEA 1IGCA 2A5UA 3FKYA 3OLMD 2LGSA 1TT5B 4N58A 2NCNA 3AE5B 3PSEB 4B6WA 2GI9A 2ZVNA 4TQ1A 1P3QU 3PS6A 4IWQA 4MSMB 2DZJA 2L3ZA 5AZGA 2KMMA 3KVFB 2L32A 5E6JA 2O6VB 4ZOHC 5FKAC 3L13A 4EZLA 1S1QB 1WX7A 4DWFA 2K8HA 3BIID 1TY2A 3WAMA 2JPHA 2NS5A 3MC0B 2DENB 1TY0A 1S3SG 1JRUA 4E71A 1SJED 3IBEA 4YTMB 3QX1A 1WGYA 3X0WA 2N1WA 4YWGG 2KJ6A 4YSYB 3ZRFA 2IPKD 1WX9A 4W9GA 4FJVB 4GMVA 1WGKA 3K9PB 3PZDA 2INCC 2OHFA 2ZPYA 1KTKA 2JWUA 4MJSB 2O6VD 1WI0A 1VR9A 3U8ZA 1YMHE 4J6IA 4XWTA 3IFWB 4HROA 3E56A 4DHJB 3PGEA 2LJIA 2KWVB 2QJLA 4KDLB 3H7PA 3CMMB 2M56B 3LB8C 3AE8B 1E7VA 5C2TB 1ZKHA 3QK0A 1XCQL 4MM3A 2LRWA 3B08A 3RNAC 1HTOA 1EWYC 2L00B 1JMLA 3NOBA 2R2QA 3P4PB 1N62A 1HTQA 3ZNGC 2IZVB 4BZAA 3AM9A 1GB4A 3ZO5B 4NAMA 5E6NA 4YL8A 2MLBA 4DHJD 2PPHA 2ZCCA 3Q8AA 2J4XA 2W9NA 3TCAA 1JWMD 2UWQA 3ZNID 1H4RA 4MGZE 2CU3A 2QMTA 1I4PA 1FCLA 2JU6X 3VVWB 3TBLD 3HK0A 4BKSD 2DBYA 4TQ0A 3DHGC 5JHAA 2KTRB 4LTUA 3RNEC 3VUWA 2HTME 3EFUA 2WU2B 1ZDVA 2LXCA 1YN5A 5J18A 1IPGA 4GDLA 3R7QA 3OJ4B 1QZEA 1K51A 4G0NB 3GP7A 3I63C 3QA8A 2D2QA 3OJ3A 4M00A 4M01A 4DXAB 2W3RA 3R66C 2MJEA 1MG4A 2ZJDA 3EC8A 3Q3JA 4YXDB 1IBXA 5CX3A 4K7SA 2E6XA 3N9YC 4W9KA 2OEDA 1K53A 1V6EA 3EFCA 4GGQA 3RN9C 2FAZA 3QQ8B 3A33B 2J42A 4KSLC 1T0RC 1E7UA 2KZRA 3BYTB 3BINA 4REZA 1RWSA 4BOSC 2V0GA 1GC7A 4PT5A 2MBEA 1JALA 3A9KB 5C1ZA 5C3JB 3H1UA 3JSVA 2DZIA 2K0PA 3AEEB 1WFYA 2FIFA 2BF8B 3A9JB 1V5TA 3IT4B 4HLEA 1L6UA 1SBBB 1WE7A 4FA6A 2K39A 2UYZB 3IAS1 1FNWA 2L0TA 4NJ6A 1CMXB 1UH6A 4ARIA 3O65B 4MH0E 2JRHA 2RSUA 3IVFA 1CK1A 3V3XA 4IW0A 3FILA 2JQRB 1EWCA 2DYOA 4OZAA 2EMSA 4LDTB 2WX0A 3WANA 3AEFB 1UNSA 3M63B 1MI0A 2AWTA 3U2SC 1V1OA 3VTWA 5C23A 1AW7A 1HXYD 1SGHA 3MHZA 3D32A 5L95C 2ZW0A 2O2VA 4MGKE 1FM0D 3L0WB 2MEKA 1AWDA 3EGRA 3Q8EA 3AE3B 2LGIA 4NZLB 4A3OA 4EFOA 3GE8C 2N9LA 1DOYA 1YD8U 5FK9C 2MH7A 3P4SB 3PVLA 4XX5A 4LDTD 1RRBA 3H7SA 4P1CC 3R2IA 1N63A 4BKGA 3BZDB 3AE9B 4IM0A 1MHXA 3ZYYX 1E0ZA 3ENEA 2JX5A 4A8XC 2G45B 1WH3A 4WWMA 2KDBA 2MW5A 2KMCA 1WXQA 2L8JA 4JWUC 4PS8A 2B3AA 4IG7B 2KOXA 1TS2A 1YQBA 2WXQA 3Q6BA 4DXGA 2JXTA 2MJDA 1J8CA 2BT6A 2X8XX 2IY1B 2IGHA 2XBBC 3AN1A 3VAWA 4K7WA 3IXSA 3V62A 3VTVA 4C4VB 1EF5A 4XWWA 1MHHE 3APFA 1ZXHA 2WLBA 2KHWB 1OQYA 3AE1B 1WXMA 3DPDA 1MVKA 4ZRPA 3EHVA 3VUYA 1VZ7A 1UGJA 2WXNA 4GB9A 4HXDA 1J7CA 2RGFA 2WU5B 2WS3B 2LEKA 3EA6A 2KACA 3RULA 4II3B 4EKUA 1UF0A 5EE3A 4XZ4A 2CHWA 1F2RI 3SHQA 2YVCA 3BK2A 3TEZA 2DX5B 4AP4C 3ZDTA 1FEHA 3N32A 3NJTA 4DHZB 1WZ0A 2EELA 4W9DA 4JE3B 4MELA 4TMAB 2QEJC 1D3ZA 3N1ZC 2N9PC 3LJ3A 4FADA 2BYFA 2JYTA 4F7ZA 3SU8X 1UBQA 2QHOA 5CHFA 5LNK1 3AE7B 1GC6A 3KYCD 4RNAA 5J2RA 4HEA1 2I38A 3RPFC 3H9DA 3L17A 4NQLB 3TEXA 3QWZB 1SSNA 2N9KA 1TS5A 1JWBD 2KK8A 1YOVB 3TUOA 4MT5A 2MQJA 1N6ZA 4KGRA 4ANXA 4CHKA 1FXTB 2KXJA 3DHHC 4OVUA 1T3QA 3RMKC 3W9CB 3WIMA 4FN2A 4A6QA 4H2AA 3A1QA 1I4GA 3P1MA 1ZGUB 1MJDA 2RDHA 2K6DB 4ZDVA 2DYBA 2NTTA 2CU1A 3JW0X 2LGXA 5CHVC 2AX5A 2AL3A 2N7EA 1VZ6A 1C76A 2BWES 3R3MA 4ICVA 2WXIA 1WGRA 3Q14C 1XQQA 2G4SA 3GS2A 1T0SC 1N5WA 1SJHD 2HDEA 3JVZX 3MC9A 3JSVB 1EU3A 2J0MA 3Q3FA 2KKCA 2JXXA 4JQWC 1YX5B 1EF1A 3AI5A 5HFYA 1HA5A 1PYWD 5IA7A 3C19A 3RI7C 2MHJA 3GZNB 1WJNA 2I1KA 1YJJA 2BGFA 4BFRA 2BB6A 1FCCC 1WR6E 4TUUA 3EUB2 4IUMB 3JYUA 3DQVA 1X1MA 2DLBA 4JLCA 3M62B 2KTFA 1L6VA 2KFKA 3X23A 4PYZA 1NEKB 3MHSD 2O2VB 2HJ8A 5IOIA 3ZNHB 2V3SA 2LVPA 2FE8A 3BVZA 2JWZA 3IT6B 4X57B 1YIWA 1TKYA 2D07B 4XYCA 3I9V1 2KN4A 3O13A 1TBEA 2M8SA 2MBBB 3Q8FA 5DCNA 1E6EB 3TSSA 2K1FA 1WXVA 2DWQA 2WP9B 2B76B 1EO6A 4OVZA 1F2RC 3W5UB 4G50A 2WXLA 2W54A 1OQQA 3L4PA 3TEYA 2CR5A 1ZW7A 1E10A 2GOWA 2BKRB 2N9EB 4LNIA 2J0KA 4HDOA 4P7IA 1RYJA 2PW9A 4LJOB 4M0WB 2NPTA 2KC2A 2FIDA 3TL5A 4D2KA 4W9EA 2WYQA 2MP2A 4GLSC 4L1BA 2FCMA 1HZ5A 4HKQA 1V86A 3H8HA 4KIKB 1B1ZA 2WX1A 4JGHB 1IGDA 4PS7A 1OEYJ 2GBJA 3SD5A 1FXAA 3PZ7A 3RUIB 4GXBA 1SF0A 2R2OA 4ZYNA 3FAHA 2MA9B 3PHWB 1V81A 4ZRIA 1EU4A 3RZWC 2D5GA 4GOCA 1I35A 2Y5CA 1PDXA 1M4VA 1I4HA 2QC8A 4FXCA 1WF9A 1AYFA 1WM2A 1IUEA 4F8CB 5L83A 2NMQA 1VCBA 1AARA 3AULA 3N1YC 4WWNA 2C9WB 1WY8A 2XNAC 5IAAC 2OOBB 3Q2AC 1WSPA 4WAFA 4DDID 1A70A 5D2MB 4NAWA 1SIFA 3ZW3A 1MG8A 2IO0B 3DWMA 2ZCBA 1T0YA 2WDQB 1C4PA 5E6PA 3CSFA 3AMZA 2E3TA 4GN1A 3VHTC 3HUIA 1TYGB 4ANVA 3GB1A 4S17A 1WYWB 3MTNB 1C3TA 1V49A 4NJ7A 1I4RA 1F0ZA 2KQSA 4G3XB 1WMHA 1WJ6A 1E8WA 4US9A 1LO5D 3A1QB 4EUTA 1Q0WB 2A4ZA 1XLPA 2HE7A 1V80A 4DBGA 4WAAA 3R7RA 4WQOB 1ET9A 3ZJUA 2KVRA 2ZW1A 4XDDA 2PMVA 3IG3A 2LJ5A 4US8A 1J0GA 4XE0A 2M0AA 1YJ1A 1QQRA 5AZHA 4URKA 3H6NA 5LXIB 4RM8A 3VFKA 2Z59B 3BVGA 1WJUA 3NS1A 3NVYA 4MACA 5AUIA 1G6JA 1PQSA 4BBNF 1GAQB 3HVDA 2IJ0A 2C7HA 3VTUA 4JIOU 3AH7A 1VLBA 4F1SA 3QIJA 2LZ6A 2JRIB 2DAJA 3DVGX 5D94A 2V4IB 4GDKA 5MPOA 1WZ3A 1VDVA 1TS3A 3AEBB 2IDYA 2KLCA 1FRRA 3PT2B 3VRBB 2LVQA 3AU5A 3QARA 4WJNA 5GMVA 1WIAA 2M1MA 1IYFA 2GB1A 2NBVB 2BYEA 3PPAA 1QOAA 4DHZE 4KKIA 4DXFA 2K8CA 4RCOA 1C9FA 5IO9A 2KFKB 4M02A 4KZCA 3ZJTA 2C5LC 3ALBA 3DDCB 4KZ0A 1R4NB 2MBQA 1UZXB 3RYTA 1R4NI 4HJGE 2XN9C 3ZIMA 2BQQA 2V1YA 2C60A 1P0RA 3N3KB 1WWTA 2KANA 2RDGA 2KO3A 2NBUA 1WR1A 2L1AA 3DBLB 2KX3A 3DBLI 1ZDXA 3PLUA 2BS4B 2Z0EB 2Z8LA 1RAXA 1E7PB 2BB5A 5KHQA 1T5XD 4LNKA 2N9XA 3GE3C 1F9JA 2REXA 1LQBA 3RNCC 1FIQA 5EDSA 3KUCB 4IWPA 3OAWA 3NVWA 5I4DA 2IO1B 3ZKJC 2MP2B 2YEPB 2FUHB 3TMPB 4DQOC 2J52A 2EKIA 3DBRB 3HRDD 1BXTA 2KFJA 3PRMB 3AV8A 2J53A 1NI3A 3DBRI 1R4MB 1WE6A 2INDC 1R4MI 3B9JA 2ACZB 1WGDA 4PK1A 3WAPA 2JT4B 4YSXB 1RFAA 3KW5B 1QOFA 3ZNZB 3CF6E 3A4RA 4BBNC 2FCQA 1FRDA 2JY6A 5EE0A 5BYQA 4WIPA 3TEWA 2KQ7A 1EM7A 3HHMA 1ZE3D 2ON8A 3V60A 2AQ2B 3AXCA 3RNFC 1WXSA 1DYQA 3P4QB 5H8YE 1K8RB 2IGDA 2YEPF 4OZBA 3HM6X 3NRZA 3DBSA 1GG3A 1XD3B 4K7UA 1SE3A 1NVID 4ZRJA 4HCPB 3PO0A 3C0RB 1NYQA 3NHEB 2ZZPB 3ZUNA 4A20A 3E9SA 3VH4B 4HDQA 1C79A 1KLUD 1ROEA 4P6VF 3H7PB 4IC7B 1A5RA 2GMIC 4WURA 3APDA 2VZKB 4Q2JA 3A4SC 2FBWB 1VZ8A 1QOBA 1XEEA 2JF5A 4IOIE 4MM3B 5HKHA 2LHEA 3LYYA 2N0SB 4LNFA 4FBJB 2SAKA 3PV1A 3R8BA 3AECB 1VRAB 2MRPA 3V6CB 2D3AA 4K1RB 2MCNB 1LM8B 2OJWA 1JW9D 1E9MA 2FUG1 3DBHB 4AJWA 1HQRD 2D3GA 2OJRA 5BYSA 2BVCA 2XK5A 2Z0DB 3DBHI 2HTHA 3I57A 3OG5A 4P16A 3Q8BA 3RNBC 4ITKA 1UWMA 2D3CA 4OZCA 2VZKD 3Q3OC 1GNUA 4KGTA 5JXVA 3PRPB 1DOXA 2O6VA 1RFKA 2KDEB 4CYEA 1R7SA 2VH1A 4FLHA 4HK2A 3PLVA 2ASQA 3HVZA 4K81A 4E74A 1P1AA 5JH5C 1PFDA 1WGGA 1Y8RC 3ZRCA 3ZXVA 1YN4A 2KDIA 2PE9A 1WM3A 4YTNB 3L54A 4GDLB 2KYWA 1F77A 3S2AA 2LVOA 5IKCM 2K3UA 4HWIB 1XLQA 1V2YA 4MJSA 1OGWA 1FFUA 4YT0B 3ZXRA 5LXHA 1KLVA 1KFYB 1IBXB 2LFIA 4EZJA 1JRPA 2WGSA 1ISNA 2CJNA 4TV3A 1L0YB 2KNBA 2KAJA 4TKNA 1IP9A 3VRAB 2M19A 2LUMA 1ZUD2 1N60A 4ZRKA 1Q1OA 4W9IA 3DWGC 2JYEA 1FFVA 5EE9A 1PGXA 1CJEA 2V3NA 5TSSA 3AEGB 3WAOA 4USAA 4BVUC 3UQBA 3ETRA 4IDIA 4JWSC 1D5XC 3FC4A 2XEWA 2NR2A 4HVBA 2AYOB 2BKFA 5BO4B 2KMAA 1VJKA 2IO3B 4HPMB 4UDUC 2WDVB 3P4RB 2KTRA 2HJ1A 2K8BA 2BTEA 4AOFA 3SR6A 1L5PA 3DHIC 3PRZA 3FILB 1FD6A 4OW0A 1ZP0B 5BYRA 1D6EC 2K9XA 3KUZA 2BBCA 2Q5WD 3HIZA 3W1SA 4S0RA 4ZYSA 1EUVB 2KLGA 1FNVA 3M3JA 4WJPA 2PVGC 4ZHOA 3QC8B 2EKEC 4RFBA 2ZNVB 4HCNB 4MDKE 1GJZA 1VD2A 4OHJA 4KDIC 5G2NA 3W1YA 3EECA 4DK5A 1XLNA 4HPLB 4A3PA 1YNTE 5G5GA 3URYA 3PZ8A 5J17A 1SB3C 4TSSA 4C56C 2PKOA 4XDCA 2TSSA 1N61A 3KH0A 5D3DA 1V1PA 2LWPA 2RPVA 3IHPC 4WJOA 3AEAB 1KRHA 4O1NA 4BAXA 2NVUI 3SEBA 2IGGA 3ZGZA 1B9RA 3AB5A 2L52A 1OEYA 3ZTDA 3UF8A 1C78A 4L2YA 4EOYA 1SXTA 3A9JA 3Q69A 2PE6B 2MJ3A 2G1EA 1J19A 2MBHA 3T9LA 2DNFA 1QT9A 2KWCA 5HHDG 1YJIA 3J9CA 4MSQB 2GBMA 1V5OA 4BKTA 4WWOA 2IO2B 4EE2A 3ZDMC 2JZ3B 4FJZA 2NTSA 3U7ZA 2FNJB 3I3TB 3Q3MC 3TIXA 2CS4A 3KWLA 2XK5B 4MGYE 5BMGA 4RGNA 1C4CA 3ZTCA 3ZLZA 4W9FA 3UIPB 1PGAA 2WXJA 4KSKC 2D11A 2AQ3B 4R3DA 4KVGB 1XT9B 2INNE 3M95A 1I42A 3KQ4A 1FPYA 3P42A 3T3NA 2WXOA 4K3BA 1KH0A 4RH6A 2PEAA 4NJCA 2RD0A 1JCKB 4IM2A 2KC1A 2IBIB 1NI2A 1ZOYB 4A90A 1UWXA 2PVOD 2ZPNA 2BS3B 1T0QC 3DVNV 2G9HD 2DHZA 4A9AA 4C7ZA 1V9JA 3N20C 4IWOA 4HJKA 4MGIE 5HG2A 3Q3NC 1H8CA 3C8YA 2INPE 4WQMA 3NS8A 4ICUA 2KJHB 4ANUA 4C4VA 2ZVOA 3T3OA 1D5ZC 1NYRA 3ABVB 1T6BX 4KKJA 2DYMA 5G55A 3AU4A 1RLFA 1QOGA 1WJ4A 2KVZA 2EMTA 1QLBB 5FR3A 1ZXIA 4FJYA 3L10B 1L2NA 2M0XA 3MP9A 2J0JA 2VRRB 2ZNVC 3RD2A 3W2DA 1YN3A 1V97A 2UU7A 3WA0A 4AWJA 2WHIA 4EZKA 3QCAA 1I4QA
chains in the Genus database with same CATH topology
4JL9A 2JY6A 3QHTA 3WIMA 4FN2A 5DPSA 3HM3A 3A1QA 4I6PA 4NQKE 2KQ7A 2N7DA 3HHMA 3KUDB 4NPNA 2MBOA 4W9JA 1ZGUB 3V60A 2DAFA 2KWUB 3VXWA 3AXCA 1WXSA 4GU2A 2CHXA 2K6DB 3GOEA 2N1VA 2A5UA 4ZDVA 1K8RB 2LI5A 3T8MA 3OLMD 3HM6X 2DYBA 3DBSA 1GG3A 2NCNA 4II2B 3PSEB 2CU1A 3JW0X 2LGXA 5CHVC 1XD3B 4K7UA 4B6WA 2ZVNA 2AL3A 4TQ1A 2N7EA 1P3QU 3PS6A 4PYUA 2BWES 3DVNU 3R3MA 4ICVA 4IWQA 4ZRJA 4HCPB 4MSMB 3C0RB 2DZJA 2L3ZA 5AZGA 3NHEB 1WGRA 1Z2MA 3RCZA 3KVFB 2ZZPB 3ZUNA 4A20A 1XQQA 2G4SA 1UBIA 3JVZX 2O6VB 3VH4B 2BPSA 2KX0A 4HDQA 3JSVB 3L13A 4EZLA 1E8YA 4XC2A 4WWPA 1S1QB 1WX7A 2J0MA 3ZVVA 4DWFA 3Q3FA 2K8HA 2KKCA 3H7PB 4IC7B 3ML9A 1A5RA 2GMIC 2JXXA 4JQWC 3WAMA 4DDGD 1YX5B 1EF1A 2JPHA 3AI5A 3APDA 4LJPB 2NS5A 4BOZB 2DENB 3A4SC 3LDZE 1S3SG 2BYVE 5DPWA 5IA7A 1JRUA 1NBFC 1UGMA 4E71A 4M8NA 2JF5A 3IBEA 5HKHA 2L7RA 1WGYA 3QX1A 3X0WA 4FBJB 2N1WA 3PV1A 1WJNA 2I1KA 4EEWA 2BGFA 2KJ6A 3ZRFA 2M17A 4BFRA 2MRPA 3V6CB 1WX9A 4W9GA 4B95A 5LLIA 4FJVB 4GMVA 4K1RB 4I6NB 2MCNB 3K9PB 1LM8B 2L0FA 4WJQA 1WR6E 5DPRA 4TUUA 3PZDA 2ZPYA 4AJWA 3UQAA 4IUMB 2D3GA 2OJRA 3JYUA 3DQVA 3DBHI 2XK5A 1HE8A 2KJRA 2HTHA 2Z0DB 4MJSB 2O6VD 1WI0A 1X1MA 4GIVA 4JLCA 3U8ZA 4J6IA 3IFWB 3M62B 4W9CA 1KJTA 2KTFA 3QJZA 4PS3A 3DCGA 2KFKA 3UINB 3X23A 4PYZA 1GNUA 1YX6B 3PRPB 4DHJB 3MHSD 2O2VB 2O6VA 3PGEA 2HJ8A 3ZNHB 2C7MB 2KWVB 2V3SA 2KDEB 4KDLB 4CYEA 2NBWB 2LVPA 3H7PA 3CMMB 4FLHA 4HK2A 3PLVA 4W9HA 2JWZA 2ASQA 2NPTB 1YIWA 4X57B 4K81A 1E7VA 4E74A 1P1AA 5JH5C 2D07B 1WGGA 1ZKHA 1Y8RC 3QK0A 3ZRCA 4FHKA 4MM3A 2LRWA 1TBEA 3B08A 1BT0A 4M8MA 5TR5A 2KDIA 2L00B 3NOBA 2PE9A 1WM3A 2M8SA 2MBBB 3P2BA 2R2QA 3L54A 1Z5SB 4GDLB 5KHOA 3ZNGC 2IZVB 4NY0A 3S2AA 1TGZB 5DCNA 2LVOA 3ZO5B 4FHJA 4HWIB 3RZFA 2K1FA 1WXVA 1V2YA 5E6NA 4KV2A 4YL8A 2RPQA 2MLBA 4MJSA 2LXAA 1EO6A 4DHJD 1OGWA 2PPHA 4G50A 2KN5A 2ZCCA 3MJWA 2LGDA 5LXHA 2W9NA 3TCAA 2CR5A 1KLVA 1Q5WB 1ZW7A 2LGYA 2UWQA 3ZNID 2GOWA 2BKRB 4EZJA 1H4RA 1ISNA 4MGZE 1E8ZA 4TV3A 2G3QB 2N9EB 4IM3A 3VVWB 2J0KA 3TBLD 2KNBA 3HK0A 4HDOA 4P7IA 4BKSD 4TQ0A 3K9OB 1C1YB 4LJOB 4M0WB 2NPTA 5JHAA 2KC2A 2KTRB 3VUWA 2FIDA 3TL5A 4TKNA 4W9EA 2WYQA 1IP9A 2D10A 3EFUA 2MP2A 2FCMA 4ZRKA 1Q1OA 2LXCA 4W9IA 1V86A 3SDLC 3TJPA 4KIKB 2WX1A 5J18A 1IPGA 4GDLA 3R7QA 4N9F4 1M94A 3OJ4B 4JGHB 1QZEA 3NY5A 4NAWB 4PS7A 4G0NB 1E8XA 2GBRA 1OEYJ 3QA8A 2GBJA 2WWZA 2D2QA 3WAOA 3OJ3A 2K25A 3SD5A 4DXAB 3R66C 3RUIB 4GXBA 2R2OA 4LCDE 4ZYNA 3ECIA 4BVUC 3UQBA 2ZJDA 3EC8A 3Q3JA 4I6LB 2I1JA 2MA9B 4B9KA 3PHWB 2XEWA 1V81A 3DOWA 3NZUA 2NR2A 4ZRIA 4FULA 3RZWC 5CX3A 4HVBA 2MSED 4K7SA 2AYOB 2BKFA 3B0AA 4GOCA 4W9KA 5BO4B 2AEHA 1V6EA 2KMAA 1I35A 2IO3B 4GGQA 2LASA 4HPMB 2FAZA 1WMHB 2KTRA 3QQ8B 2K8BA 3V6EB 4AOFA 1WF9A 3A33B 3L16A 5JHBA 1WM2A 3DVGY 3PRZA 2YLMA 4F8CB 5L83A 4KSLC 2FCSA 1VCBA 1E7UA 1AARA 2KZRA 3AULA 4KIKA 4WWNA 3B1LX 2C9WB 1E90A 1WY8A 1WX8A 3BINA 3KUZA 5IAAC 2OOBB 3HIZA 1E5WA 3W1SA 1WRDB 3PHXB 4BOSC 4DDID 1EUVB 2KLGA 5D2MB 4NAWA 3M3JA 1GC7A 4WJPA 1SIFA 2MBEA 3ZW3A 4RM9A 1MG8A 3A9KB 3QC8B 2EKEC 3APCA 5E6OA 3W1SC 5C1ZA 2IO0B 2ZNVB 3H1UA 4HCNB 1WGHA 4MDKE 2LRUA 2ZCBA 1T0YA 1TZ1A 1TTNA 1VD2A 2DZIA 1WFYA 2FIFA 3JSVA 2BF8B 3A9JB 3CSFA 1V5TA 4KDIC 5E6PA 3RT3B 5G2NA 4HLEA 4GN1A 1WE7A 3VHTC 3W1YA 2K39A 4FA6A 1LFDA 2JVCA 4AJYB 2UYZB 2L0TA 5D7GA 4ANVA 3EECA 4NJ6A 4DK5A 4A3PA 4HPLB 2LD9A 3VH3B 1WYWB 3MTNB 1C3TA 1V49A 2M4NA 4NJ7A 2ZEQA 1CMXB 2KQSA 5J17A 1UH6A 3PTFC 3O65B 2L76A 4G3XB 1WMHA 4MH0E 2JRHA 2RSUA 2J7QB 3IVFA 1WJ6A 1E8WA 3A1QB 4GDKB 2JUOA 3KH0A 1NDDA 2CKHB 4EUTA 4IW0A 2N4FA 1Q0WB 3UIOB 2A4ZA 2LWPA 2DYOA 3IHPC 2HD5B 2EMSA 2HE7A 4LDTB 4WJOA 1V80A 4DBGA 4WAAA 3R7RA 4WQOB 2WX0A 1SE9A 2NVUI 1LXDA 3WANA 2PJHA 2KVRA 3M63B 3IG3A 2AWTA 2LJ5A 3VTWA 1J0GA 5C23A 4GSWA 1OEYA 1YJ1A 3ZTDA 1SGHA 5JZEB 3D32A 5AZHA 3H6NA 3UF8A 4URKA 5L95C 5LXIB 4RM8A 2O2VA 2Z59B 3VFKA 4MGKE 4EOYA 1WJUA 3A9JA 3L0WB 2PE6B 2IY0B 1UELA 1G6JA 2MBHA 1J19A 1PQSA 2MX2A 3T9LA 4BBNF 3PREA 4MEMA 4A3OA 3ONSA 4OVVA 2KDFB 2KWCA 4EFOA 2C7HA 3VTUA 4JIOU 5AZFA 1YD8U 4MSQB 4F1SA 2K6QA 3PVLA 3QIJA 2LZ6A 2JRIB 4XX5A 2GBMA 1V5OA 2DAJA 1RRBA 3H7SA 4LDTD 4BKTA 4BKSA 3DVGX 2MWSB 5D94A 3WALA 2G4DB 4GDKA 4BKGA 4WWOA 2IO2B 1WZ3A 4IM0A 3ZDMC 2JZ3B 2KLCA 4FJZA 3PT2B 3ENEA 4AUQC 2DZMA 2Y5BB 2LVQA 2FNJB 2G45B 2LUEA 3AU5A 3I3TB 2DZKA 3QARA 4WJNA 5GMVA 1WH3A 1WIAA 2M1MA 1IYFA 2KDBA 2MW5A 2KMCA 1UD7A 2L8JA 4PS8A 2B3AA 3L08A 4IG7B 2NBVB 2BYEA 2KOXA 3TIXA 2CS4A 5FR6A 4E3CA 1YQBA 3PPAA 4DHZE 2XK5B 1J8CA 5D6JB 4MGYE 2K8CA 3U30A 3ZTCA 2IY1B 3ZLZA 4W9FA 2FCNA 3UIPB 2XBBC 2KFKB 3VAWA 1L7YA 4KZCA 4KSKC 2D11A 4K7WA 3VDZA 4CO7A 2C5LC 3V62A 3VTVA 3ALBA 3DDCB 3VQIA 4KVGB 4KZ0A 1EF5A 2MBQA 1XT9B 1UZXB 3RYTA 3APFA 1R4NI 2KHWB 3M95A 1OQYA 1I42A 1WXMA 4RMAA 3DPDA 4W9LA 3ZIMA 3EHVA 4NNJB 2V1YA 3VUYA 3U7DA 4ANWA 2C60A 2RR9A 2JZZA 2PEAA 1P0RA 3N3KB 2GBKA 4GB9A 2KANA 4HXDA 2GBNA 2RGFA 2RD0A 1KM7A 2KO3A 2NBUA 2KC1A 4IM2A 1GUAB 1WR1A 3GZNI 2KX3A 2IBIB 1NI2A 3DBLI 3RULA 4II3B 4EKUA 3PLUA 4XZ4A 2CHWA 1KOTA 2Z0EB 2ZPNA 3SHQA 2YVCA 1RAXA 2DX5B 3DVNV 4AP4C 3ZDTA 2DHZA 1V9JA 3N32A 4DHZB 4IWOA 4HJKA 4MGIE 1WZ0A 5KHQA 1H8CA 4W9DA 2N9XA 1F9JA 3NS8A 2REXA 4ICUA 2C7NB 2KJHB 4MELA 1LQBA 2AL6A 5DPTA 3QAQA 4ASWC 4ANUA 2WDTB 1P98A 2ZVOA 5EDSA 2L05A 1P9DU 1D3ZA 3KUCB 4IWPA 5CHWA 2N9PC 3OAWA 3LJ3A 4FADA 1WXAA 2BYFA 4F7ZA 2IO1B 3SU8X 5G55A 2DYMA 2IYDB 3ZKJC 1UBQA 2QHOA 3AU4A 1RLFA 2MP2B 5CHFA 3TMPB 2FUHB 1WJ4A 3VUXA 1GC6A 2EMTA 3KYCD 5J2RA 3NZSA 2KFJA 3A9KA 3PRMB 3N30A 3DBRI 3H9DA 5AEKB 3L17A 4NQLB 2BWFA 4G11A 4FJYA 1WE6A 3L10B 5CTRC 1R4MI 1L2NA 3QWZB 2M0XA 1WGDA 1OTRB 2J0JA 2JT4B 2KK8A 2VRRB 1RFAA 2ZNVC 3ML8A 3RD2A 3WAPA 2CHZA 2MQJA 1GJZA 3KW5B 3UGBB 1U4AA 3CSTA 3WA0A 3ZNZB 4AWJA 2V4LA 4ANXA 4CHKA 1FXTB 4EZKA 3CF6E 2KD0A 2KXJA 3QCAA 3V61A 3KYDD 4OVUA 3A4RA 4BBNC 2FCQA 3BY4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JL9 A;  2JY6 A;  3QHT A;  3WIM A;  4FN2 A;  5DPS A;  3HM3 A;  3A1Q A;  4I6P A;  4NQK E;  2KQ7 A;  2N7D A;  3HHM A;  3KUD B;  4NPN A;  2MBO A;  4W9J A;  1ZGU B;  3V60 A;  2DAF A;  2KWU B;  3VXW A;  3AXC A;  1WXS A;  4GU2 A;  2CHX A;  2K6D B;  3GOE A;  2N1V A;  2A5U A;  4ZDV A;  1K8R B;  2LI5 A;  3T8M A;  3OLM D;  3HM6 X;  2DYB A;  3DBS A;  1GG3 A;  2NCN A;  4II2 B;  3PSE B;  2CU1 A;  3JW0 X;  2LGX A;  5CHV C;  1XD3 B;  4K7U A;  4B6W A;  2ZVN A;  2AL3 A;  4TQ1 A;  2N7E A;  1P3Q U;  3PS6 A;  4PYU A;  2BWE S;  3DVN U;  3R3M A;  4ICV A;  4IWQ A;  4ZRJ A;  4HCP B;  4MSM B;  3C0R B;  2DZJ A;  2L3Z A;  5AZG A;  3NHE B;  1WGR A;  1Z2M A;  3RCZ A;  3KVF B;  2ZZP B;  3ZUN A;  4A20 A;  1XQQ A;  2G4S A;  1UBI A;  3JVZ X;  2O6V B;  3VH4 B;  2BPS A;  2KX0 A;  4HDQ A;  3JSV B;  3L13 A;  4EZL A;  1E8Y A;  4XC2 A;  4WWP A;  1S1Q B;  1WX7 A;  2J0M A;  3ZVV A;  4DWF A;  3Q3F A;  2K8H A;  2KKC A;  3H7P B;  4IC7 B;  3ML9 A;  1A5R A;  2GMI C;  2JXX A;  4JQW C;  3WAM A;  4DDG D;  1YX5 B;  1EF1 A;  2JPH A;  3AI5 A;  3APD A;  4LJP B;  2NS5 A;  4BOZ B;  2DEN B;  3A4S C;  3LDZ E;  1S3S G;  2BYV E;  5DPW A;  5IA7 A;  1JRU A;  1NBF C;  1UGM A;  4E71 A;  4M8N A;  2JF5 A;  3IBE A;  5HKH A;  2L7R A;  1WGY A;  3QX1 A;  3X0W A;  4FBJ B;  2N1W A;  3PV1 A;  1WJN A;  2I1K A;  4EEW A;  2BGF A;  2KJ6 A;  3ZRF A;  2M17 A;  4BFR A;  2MRP A;  3V6C B;  1WX9 A;  4W9G A;  4B95 A;  5LLI A;  4FJV B;  4GMV A;  4K1R B;  4I6N B;  2MCN B;  3K9P B;  1LM8 B;  2L0F A;  4WJQ A;  1WR6 E;  5DPR A;  4TUU A;  3PZD A;  2ZPY A;  4AJW A;  3UQA A;  4IUM B;  2D3G A;  2OJR A;  3JYU A;  3DQV A;  3DBH I;  2XK5 A;  1HE8 A;  2KJR A;  2HTH A;  2Z0D B;  4MJS B;  2O6V D;  1WI0 A;  1X1M A;  4GIV A;  4JLC A;  3U8Z A;  4J6I A;  3IFW B;  3M62 B;  4W9C A;  1KJT A;  2KTF A;  3QJZ A;  4PS3 A;  3DCG A;  2KFK A;  3UIN B;  3X23 A;  4PYZ A;  1GNU A;  1YX6 B;  3PRP B;  4DHJ B;  3MHS D;  2O2V B;  2O6V A;  3PGE A;  2HJ8 A;  3ZNH B;  2C7M B;  2KWV B;  2V3S A;  2KDE B;  4KDL B;  4CYE A;  2NBW B;  2LVP A;  3H7P A;  3CMM B;  4FLH A;  4HK2 A;  3PLV A;  4W9H A;  2JWZ A;  2ASQ A;  2NPT B;  1YIW A;  4X57 B;  4K81 A;  1E7V A;  4E74 A;  1P1A A;  5JH5 C;  2D07 B;  1WGG A;  1ZKH A;  1Y8R C;  3QK0 A;  3ZRC A;  4FHK A;  4MM3 A;  2LRW A;  1TBE A;  3B08 A;  1BT0 A;  4M8M A;  5TR5 A;  2KDI A;  2L00 B;  3NOB A;  2PE9 A;  1WM3 A;  2M8S A;  2MBB B;  3P2B A;  2R2Q A;  3L54 A;  1Z5S B;  4GDL B;  5KHO A;  3ZNG C;  2IZV B;  4NY0 A;  3S2A A;  1TGZ B;  5DCN A;  2LVO A;  3ZO5 B;  4FHJ A;  4HWI B;  3RZF A;  2K1F A;  1WXV A;  1V2Y A;  5E6N A;  4KV2 A;  4YL8 A;  2RPQ A;  2MLB A;  4MJS A;  2LXA A;  1EO6 A;  4DHJ D;  1OGW A;  2PPH A;  4G50 A;  2KN5 A;  2ZCC A;  3MJW A;  2LGD A;  5LXH A;  2W9N A;  3TCA A;  2CR5 A;  1KLV A;  1Q5W B;  1ZW7 A;  2LGY A;  2UWQ A;  3ZNI D;  2GOW A;  2BKR B;  4EZJ A;  1H4R A;  1ISN A;  4MGZ E;  1E8Z A;  4TV3 A;  2G3Q B;  2N9E B;  4IM3 A;  3VVW B;  2J0K A;  3TBL D;  2KNB A;  3HK0 A;  4HDO A;  4P7I A;  4BKS D;  4TQ0 A;  3K9O B;  1C1Y B;  4LJO B;  4M0W B;  2NPT A;  5JHA A;  2KC2 A;  2KTR B;  3VUW A;  2FID A;  3TL5 A;  4TKN A;  4W9E A;  2WYQ A;  1IP9 A;  2D10 A;  3EFU A;  2MP2 A;  2FCM A;  4ZRK A;  1Q1O A;  2LXC A;  4W9I A;  1V86 A;  3SDL C;  3TJP A;  4KIK B;  2WX1 A;  5J18 A;  1IPG A;  4GDL A;  3R7Q A;  4N9F 4;  1M94 A;  3OJ4 B;  4JGH B;  1QZE A;  3NY5 A;  4NAW B;  4PS7 A;  4G0N B;  1E8X A;  2GBR A;  1OEY J;  3QA8 A;  2GBJ A;  2WWZ A;  2D2Q A;  3WAO A;  3OJ3 A;  2K25 A;  3SD5 A;  4DXA B;  3R66 C;  3RUI B;  4GXB A;  2R2O A;  4LCD E;  4ZYN A;  3ECI A;  4BVU C;  3UQB A;  2ZJD A;  3EC8 A;  3Q3J A;  4I6L B;  2I1J A;  2MA9 B;  4B9K A;  3PHW B;  2XEW A;  1V81 A;  3DOW A;  3NZU A;  2NR2 A;  4ZRI A;  4FUL A;  3RZW C;  5CX3 A;  4HVB A;  2MSE D;  4K7S A;  2AYO B;  2BKF A;  3B0A A;  4GOC A;  4W9K A;  5BO4 B;  2AEH A;  1V6E A;  2KMA A;  1I35 A;  2IO3 B;  4GGQ A;  2LAS A;  4HPM B;  2FAZ A;  1WMH B;  2KTR A;  3QQ8 B;  2K8B A;  3V6E B;  4AOF A;  1WF9 A;  3A33 B;  3L16 A;  5JHB A;  1WM2 A;  3DVG Y;  3PRZ A;  2YLM A;  4F8C B;  5L83 A;  4KSL C;  2FCS A;  1VCB A;  1E7U A;  1AAR A;  2KZR A;  3AUL A;  4KIK A;  4WWN A;  3B1L X;  2C9W B;  1E90 A;  1WY8 A;  1WX8 A;  3BIN A;  3KUZ A;  5IAA C;  2OOB B;  3HIZ A;  1E5W A;  3W1S A;  1WRD B;  3PHX B;  4BOS C;  4DDI D;  1EUV B;  2KLG A;  5D2M B;  4NAW A;  3M3J A;  1GC7 A;  4WJP A;  1SIF A;  2MBE A;  3ZW3 A;  4RM9 A;  1MG8 A;  3A9K B;  3QC8 B;  2EKE C;  3APC A;  5E6O A;  3W1S C;  5C1Z A;  2IO0 B;  2ZNV B;  3H1U A;  4HCN B;  1WGH A;  4MDK E;  2LRU A;  2ZCB A;  1T0Y A;  1TZ1 A;  1TTN A;  1VD2 A;  2DZI A;  1WFY A;  2FIF A;  3JSV A;  2BF8 B;  3A9J B;  3CSF A;  1V5T A;  4KDI C;  5E6P A;  3RT3 B;  5G2N A;  4HLE A;  4GN1 A;  1WE7 A;  3VHT C;  3W1Y A;  2K39 A;  4FA6 A;  1LFD A;  2JVC A;  4AJY B;  2UYZ B;  2L0T A;  5D7G A;  4ANV A;  3EEC A;  4NJ6 A;  4DK5 A;  4A3P A;  4HPL B;  2LD9 A;  3VH3 B;  1WYW B;  3MTN B;  1C3T A;  1V49 A;  2M4N A;  4NJ7 A;  2ZEQ A;  1CMX B;  2KQS A;  5J17 A;  1UH6 A;  3PTF C;  3O65 B;  2L76 A;  4G3X B;  1WMH A;  4MH0 E;  2JRH A;  2RSU A;  2J7Q B;  3IVF A;  1WJ6 A;  1E8W A;  3A1Q B;  4GDK B;  2JUO A;  3KH0 A;  1NDD A;  2CKH B;  4EUT A;  4IW0 A;  2N4F A;  1Q0W B;  3UIO B;  2A4Z A;  2LWP A;  2DYO A;  3IHP C;  2HD5 B;  2EMS A;  2HE7 A;  4LDT B;  4WJO A;  1V80 A;  4DBG A;  4WAA A;  3R7R A;  4WQO B;  2WX0 A;  1SE9 A;  2NVU I;  1LXD A;  3WAN A;  2PJH A;  2KVR A;  3M63 B;  3IG3 A;  2AWT A;  2LJ5 A;  3VTW A;  1J0G A;  5C23 A;  4GSW A;  1OEY A;  1YJ1 A;  3ZTD A;  1SGH A;  5JZE B;  3D32 A;  5AZH A;  3H6N A;  3UF8 A;  4URK A;  5L95 C;  5LXI B;  4RM8 A;  2O2V A;  2Z59 B;  3VFK A;  4MGK E;  4EOY A;  1WJU A;  3A9J A;  3L0W B;  2PE6 B;  2IY0 B;  1UEL A;  1G6J A;  2MBH A;  1J19 A;  1PQS A;  2MX2 A;  3T9L A;  4BBN F;  3PRE A;  4MEM A;  4A3O A;  3ONS A;  4OVV A;  2KDF B;  2KWC A;  4EFO A;  2C7H A;  3VTU A;  4JIO U;  5AZF A;  1YD8 U;  4MSQ B;  4F1S A;  2K6Q A;  3PVL A;  3QIJ A;  2LZ6 A;  2JRI B;  4XX5 A;  2GBM A;  1V5O A;  2DAJ A;  1RRB A;  3H7S A;  4LDT D;  4BKT A;  4BKS A;  3DVG X;  2MWS B;  5D94 A;  3WAL A;  2G4D B;  4GDK A;  4BKG A;  4WWO A;  2IO2 B;  1WZ3 A;  4IM0 A;  3ZDM C;  2JZ3 B;  2KLC A;  4FJZ A;  3PT2 B;  3ENE A;  4AUQ C;  2DZM A;  2Y5B B;  2LVQ A;  2FNJ B;  2G45 B;  2LUE A;  3AU5 A;  3I3T B;  2DZK A;  3QAR A;  4WJN A;  5GMV A;  1WH3 A;  1WIA A;  2M1M A;  1IYF A;  2KDB A;  2MW5 A;  2KMC A;  1UD7 A;  2L8J A;  4PS8 A;  2B3A A;  3L08 A;  4IG7 B;  2NBV B;  2BYE A;  2KOX A;  3TIX A;  2CS4 A;  5FR6 A;  4E3C A;  1YQB A;  3PPA A;  4DHZ E;  2XK5 B;  1J8C A;  5D6J B;  4MGY E;  2K8C A;  3U30 A;  3ZTC A;  2IY1 B;  3ZLZ A;  4W9F A;  2FCN A;  3UIP B;  2XBB C;  2KFK B;  3VAW A;  1L7Y A;  4KZC A;  4KSK C;  2D11 A;  4K7W A;  3VDZ A;  4CO7 A;  2C5L C;  3V62 A;  3VTV A;  3ALB A;  3DDC B;  3VQI A;  4KVG B;  4KZ0 A;  1EF5 A;  2MBQ A;  1XT9 B;  1UZX B;  3RYT A;  3APF A;  1R4N I;  2KHW B;  3M95 A;  1OQY A;  1I42 A;  1WXM A;  4RMA A;  3DPD A;  4W9L A;  3ZIM A;  3EHV A;  4NNJ B;  2V1Y A;  3VUY A;  3U7D A;  4ANW A;  2C60 A;  2RR9 A;  2JZZ A;  2PEA A;  1P0R A;  3N3K B;  2GBK A;  4GB9 A;  2KAN A;  4HXD A;  2GBN A;  2RGF A;  2RD0 A;  1KM7 A;  2KO3 A;  2NBU A;  2KC1 A;  4IM2 A;  1GUA B;  1WR1 A;  3GZN I;  2KX3 A;  2IBI B;  1NI2 A;  3DBL I;  3RUL A;  4II3 B;  4EKU A;  3PLU A;  4XZ4 A;  2CHW A;  1KOT A;  2Z0E B;  2ZPN A;  3SHQ A;  2YVC A;  1RAX A;  2DX5 B;  3DVN V;  4AP4 C;  3ZDT A;  2DHZ A;  1V9J A;  3N32 A;  4DHZ B;  4IWO A;  4HJK A;  4MGI E;  1WZ0 A;  5KHQ A;  1H8C A;  4W9D A;  2N9X A;  1F9J A;  3NS8 A;  2REX A;  4ICU A;  2C7N B;  2KJH B;  4MEL A;  1LQB A;  2AL6 A;  5DPT A;  3QAQ A;  4ASW C;  4ANU A;  2WDT B;  1P98 A;  2ZVO A;  5EDS A;  2L05 A;  1P9D U;  1D3Z A;  3KUC B;  4IWP A;  5CHW A;  2N9P C;  3OAW A;  3LJ3 A;  4FAD A;  1WXA A;  2BYF A;  4F7Z A;  2IO1 B;  3SU8 X;  5G55 A;  2DYM A;  2IYD B;  3ZKJ C;  1UBQ A;  2QHO A;  3AU4 A;  1RLF A;  2MP2 B;  5CHF A;  3TMP B;  2FUH B;  1WJ4 A;  3VUX A;  1GC6 A;  2EMT A;  3KYC D;  5J2R A;  3NZS A;  2KFJ A;  3A9K A;  3PRM B;  3N30 A;  3DBR I;  3H9D A;  5AEK B;  3L17 A;  4NQL B;  2BWF A;  4G11 A;  4FJY A;  1WE6 A;  3L10 B;  5CTR C;  1R4M I;  1L2N A;  3QWZ B;  2M0X A;  1WGD A;  1OTR B;  2J0J A;  2JT4 B;  2KK8 A;  2VRR B;  1RFA A;  2ZNV C;  3ML8 A;  3RD2 A;  3WAP A;  2CHZ A;  2MQJ A;  1GJZ A;  3KW5 B;  3UGB B;  1U4A A;  3CST A;  3WA0 A;  3ZNZ B;  4AWJ A;  2V4L A;  4ANX A;  4CHK A;  1FXT B;  4EZK A;  3CF6 E;  2KD0 A;  2KXJ A;  3QCA A;  3V61 A;  3KYD D;  4OVU A;  3A4R A;  4BBN C;  2FCQ A;  3BY4 B; 
#chains in the Genus database with same CATH topology
 4JL9 A;  5DPS A;  2LHD A;  4RGM A;  4ARC A;  2BS2 B;  4QAY A;  4I6P A;  1L4D B;  3KUD B;  2MBO A;  4W9J A;  2Y5P A;  2DAF A;  2KWU B;  2L83 A;  4GU2 A;  2CHX A;  1PGB A;  2N1V A;  2LI5 A;  3T8M A;  5HI1 A;  4LNO A;  1FMA D;  1ENF A;  4II2 B;  4PYU A;  3DVN U;  1D4B A;  4HKZ E;  1Z2M A;  3RCZ A;  2RDB C;  2VH2 A;  2RMM A;  1UBI A;  5GXG B;  2WQY B;  4HRS A;  2GLS A;  2BPS A;  2KX0 A;  4C80 A;  1E8Y A;  4XC2 A;  4WWP A;  2Y3A A;  3ZVV A;  1MPE A;  1J7B A;  2SEB D;  3ML9 A;  3U52 E;  4DDG D;  3V05 A;  4LJP B;  1ACC A;  4BOZ B;  2K5P A;  3LDZ E;  2BYV E;  5DPW A;  1UGM A;  1NBF C;  3SFD B;  2PIA A;  4M8N A;  3Q8C A;  2L7R A;  4K3C A;  5EE1 A;  4EEW A;  1D5M C;  2M17 A;  4B95 A;  5LLI A;  4I6N B;  2L0F A;  4WJQ A;  5DPR A;  1V1P B;  3CIR B;  1JQ4 A;  1XLO A;  3UQA A;  1HE8 A;  2KJR A;  3CWI A;  4GIV A;  2BYT A;  4W9C A;  1KJT A;  1MFW A;  3QJZ A;  4PS3 A;  3DCG A;  3LXF A;  3UIN B;  2I2Y A;  1YX6 B;  1OQR A;  4WH4 A;  2C7M B;  2NBW B;  5BMI A;  4C00 A;  2WXH A;  1TKE A;  4W9H A;  2NPT B;  4FHK A;  1L0X B;  1BT0 A;  1UUP A;  1I7H A;  4M8M A;  4XGA B;  5TR5 A;  1BML C;  3P2B A;  3BYY B;  3WCQ A;  4ZHP A;  1Z5S B;  5KHO A;  3NVV A;  1N5X A;  5IP4 D;  1DOI A;  4NY0 A;  1C77 A;  1TGZ B;  1QIL A;  2JZP A;  2ICI A;  4FHJ A;  4AS1 A;  3RZF A;  4KV2 A;  2RPQ A;  2LXA A;  2KN5 A;  3MJW A;  2LGD A;  1TKG A;  3NUH B;  1Q5W B;  2LGY A;  3KWV A;  4YTP B;  1TJE A;  3NVZ A;  1E8Z A;  2G3Q B;  2WXG A;  4IM3 A;  3SFE B;  1PUT A;  3VR9 B;  3K9O B;  4ZRQ A;  1C1Y B;  2WXK A;  2BW2 A;  1Q10 A;  2D10 A;  1LGR A;  1SEB D;  3B2G A;  1ESF A;  3UI3 A;  5BMH A;  2KT7 A;  3SDL C;  3TJP A;  5H92 C;  3ZQ4 A;  2V3P A;  4N9F 4;  1M94 A;  4IKG A;  4B0E A;  1XCT L;  3NY5 A;  3NZ3 A;  4NAW B;  2PTL A;  4LLG M;  1SE2 A;  3AE2 B;  1E8X A;  2GBR A;  2WWZ A;  3MFG A;  2K25 A;  1CZP A;  1F1H A;  4LCD E;  3ECI A;  1KF6 B;  4I6L B;  2I1J A;  4B9K A;  3DOW A;  3NZU A;  4FUL A;  4C7Y A;  2MSE D;  3B0A A;  4CQN A;  4B0M A;  2AEH A;  2WXM A;  2LAS A;  1WMH B;  4M0W A;  3VR8 B;  1K52 A;  3V6E B;  3L16 A;  5JHB A;  2W82 A;  1K50 A;  3DVG Y;  2YLM A;  2PLP A;  1ET6 A;  1P7E A;  1XF5 L;  2FCS A;  3BWU D;  4KIK A;  3B1L X;  1E90 A;  1WX8 A;  1E5W A;  1WRD B;  2N7J A;  2KWD A;  1AN8 A;  3PHX B;  4RM9 A;  4RGT A;  3APC A;  3KLS X;  5E6O A;  3W1S C;  5IN7 A;  1WGH A;  2LRU A;  1TZ1 A;  1TTN A;  1FXI A;  3RT3 B;  1J7A A;  3W5V B;  4AQ7 A;  1LFD A;  2JVC A;  4AJY B;  1V8C A;  5D7G A;  2LD9 A;  3VH3 B;  3B2F A;  4N6E B;  2M4N A;  1L4Z B;  2ZEQ A;  1JWU D;  3PTF C;  2L76 A;  2J7Q B;  4RF1 A;  2QIE B;  2H88 B;  4N59 A;  4GDK B;  2JUO A;  1NDD A;  3ZJV A;  2CKH B;  2N4F A;  3UIO B;  1P7F A;  4RF0 A;  2HD5 B;  3RFZ B;  1BUI C;  1JWA D;  1ZPS A;  1SE9 A;  3P63 A;  1LXD A;  3MC8 A;  2WXF A;  2PJH A;  2KDM A;  4GSW A;  5JZE B;  2WDR B;  4JPS A;  5AUK A;  4L23 A;  1DGJ A;  2IY0 B;  1UEL A;  2MX2 A;  2V9H A;  2WXP A;  3PRE A;  4MEM A;  3AE6 B;  3ONS A;  2R61 A;  4OVV A;  3I5J C;  2KDF B;  3NG0 A;  5AZF A;  2K6Q A;  4BKS A;  2MWS B;  1KLG D;  3WAL A;  4MH8 A;  2G4D B;  2K22 A;  1STE A;  1YQ4 B;  1L0V B;  4AUQ C;  2DZM A;  2Y5B B;  2LUE A;  2DZK A;  4KGS A;  1FNU A;  1UD7 A;  1JRO A;  3L08 A;  5FR6 A;  4E3C A;  3MJ5 A;  2H89 B;  4HPP A;  5D6J B;  3BK1 A;  3U30 A;  1QKZ A;  3AE4 B;  2FCN A;  1L7Y A;  5T8I A;  3VDZ A;  4CO7 A;  1NEN B;  3VQI A;  1F52 A;  4ACF A;  1SE4 A;  2GRI A;  2WXR A;  4RMA A;  4W9L A;  2W55 A;  4P1B C;  1OFF A;  4NNJ B;  3RNG C;  1GB1 A;  1XXG A;  1I4X A;  3U7D A;  4ANW A;  1Y56 A;  2RR9 A;  2JZZ A;  2GBK A;  5D3I B;  4YSZ B;  1JWS D;  1FO4 A;  2GBN A;  1TIF A;  1KM7 A;  2CJO A;  1GUA B;  3GZN I;  1RM6 C;  4A55 A;  3OWE B;  2QDF A;  1XO3 A;  1KOT A;  4RGO S;  2W3S A;  4JX1 C;  1WYG A;  3N1X C;  2JSV X;  1TZO A;  2X38 A;  5DPT A;  2C7N B;  2QSD A;  1GOZ A;  2AL6 A;  3U4E G;  3QAQ A;  4ASW C;  2WDT B;  1P98 A;  1SIJ A;  3IAM 1;  2L05 A;  1P9D U;  1QF6 A;  3AED B;  5CHW A;  2AQ1 B;  1WXA A;  2LMC A;  1WRI A;  1C4A A;  2IYD B;  2WNM A;  4J3O D;  3VUX A;  2ONQ A;  3NZS A;  1YQ3 B;  3A9K A;  4KX6 B;  3N30 A;  5AEK B;  4LK0 M;  2BWF A;  4G11 A;  3BVM A;  5CTR C;  3R2T A;  4LNN A;  1OTR B;  3ML8 A;  2CHZ A;  3UGB B;  1U4A A;  3CST A;  2QCZ A;  2V4L A;  2KD0 A;  2D3B A;  3V61 A;  1CQV A;  3KYD D;  1HZ6 A;  3BY4 B;  3QHT A;  3HM3 A;  4NQK E;  2N7D A;  5G5H A;  1HEZ E;  4NPN A;  1TS4 A;  1GPX A;  3VXW A;  2QIL A;  2KQ4 X;  3GOE A;  1IGC A;  2A5U A;  3FKY A;  3OLM D;  2LGS A;  1TT5 B;  4N58 A;  2NCN A;  3AE5 B;  3PSE B;  4B6W A;  2GI9 A;  2ZVN A;  4TQ1 A;  1P3Q U;  3PS6 A;  4IWQ A;  4MSM B;  2DZJ A;  2L3Z A;  5AZG A;  2KMM A;  3KVF B;  2L32 A;  5E6J A;  2O6V B;  4ZOH C;  5FKA C;  3L13 A;  4EZL A;  1S1Q B;  1WX7 A;  4DWF A;  2K8H A;  3BII D;  1TY2 A;  3WAM A;  2JPH A;  2NS5 A;  3MC0 B;  2DEN B;  1TY0 A;  1S3S G;  1JRU A;  4E71 A;  1SJE D;  3IBE A;  4YTM B;  3QX1 A;  1WGY A;  3X0W A;  2N1W A;  4YWG G;  2KJ6 A;  4YSY B;  3ZRF A;  2IPK D;  1WX9 A;  4W9G A;  4FJV B;  4GMV A;  1WGK A;  3K9P B;  3PZD A;  2INC C;  2OHF A;  2ZPY A;  1KTK A;  2JWU A;  4MJS B;  2O6V D;  1WI0 A;  1VR9 A;  3U8Z A;  1YMH E;  4J6I A;  4XWT A;  3IFW B;  4HRO A;  3E56 A;  4DHJ B;  3PGE A;  2LJI A;  2KWV B;  2QJL A;  4KDL B;  3H7P A;  3CMM B;  2M56 B;  3LB8 C;  3AE8 B;  1E7V A;  5C2T B;  1ZKH A;  3QK0 A;  1XCQ L;  4MM3 A;  2LRW A;  3B08 A;  3RNA C;  1HTO A;  1EWY C;  2L00 B;  1JML A;  3NOB A;  2R2Q A;  3P4P B;  1N62 A;  1HTQ A;  3ZNG C;  2IZV B;  4BZA A;  3AM9 A;  1GB4 A;  3ZO5 B;  4NAM A;  5E6N A;  4YL8 A;  2MLB A;  4DHJ D;  2PPH A;  2ZCC A;  3Q8A A;  2J4X A;  2W9N A;  3TCA A;  1JWM D;  2UWQ A;  3ZNI D;  1H4R A;  4MGZ E;  2CU3 A;  2QMT A;  1I4P A;  1FCL A;  2JU6 X;  3VVW B;  3TBL D;  3HK0 A;  4BKS D;  2DBY A;  4TQ0 A;  3DHG C;  5JHA A;  2KTR B;  4LTU A;  3RNE C;  3VUW A;  2HTM E;  3EFU A;  2WU2 B;  1ZDV A;  2LXC A;  1YN5 A;  5J18 A;  1IPG A;  4GDL A;  3R7Q A;  3OJ4 B;  1QZE A;  1K51 A;  4G0N B;  3GP7 A;  3I63 C;  3QA8 A;  2D2Q A;  3OJ3 A;  4M00 A;  4M01 A;  4DXA B;  2W3R A;  3R66 C;  2MJE A;  1MG4 A;  2ZJD A;  3EC8 A;  3Q3J A;  4YXD B;  1IBX A;  5CX3 A;  4K7S A;  2E6X A;  3N9Y C;  4W9K A;  2OED A;  1K53 A;  1V6E A;  3EFC A;  4GGQ A;  3RN9 C;  2FAZ A;  3QQ8 B;  3A33 B;  2J42 A;  4KSL C;  1T0R C;  1E7U A;  2KZR A;  3BYT B;  3BIN A;  4REZ A;  1RWS A;  4BOS C;  2V0G A;  1GC7 A;  4PT5 A;  2MBE A;  1JAL A;  3A9K B;  5C1Z A;  5C3J B;  3H1U A;  3JSV A;  2DZI A;  2K0P A;  3AEE B;  1WFY A;  2FIF A;  2BF8 B;  3A9J B;  1V5T A;  3IT4 B;  4HLE A;  1L6U A;  1SBB B;  1WE7 A;  4FA6 A;  2K39 A;  2UYZ B;  3IAS 1;  1FNW A;  2L0T A;  4NJ6 A;  1CMX B;  1UH6 A;  4ARI A;  3O65 B;  4MH0 E;  2JRH A;  2RSU A;  3IVF A;  1CK1 A;  3V3X A;  4IW0 A;  3FIL A;  2JQR B;  1EWC A;  2DYO A;  4OZA A;  2EMS A;  4LDT B;  2WX0 A;  3WAN A;  3AEF B;  1UNS A;  3M63 B;  1MI0 A;  2AWT A;  3U2S C;  1V1O A;  3VTW A;  5C23 A;  1AW7 A;  1HXY D;  1SGH A;  3MHZ A;  3D32 A;  5L95 C;  2ZW0 A;  2O2V A;  4MGK E;  1FM0 D;  3L0W B;  2MEK A;  1AWD A;  3EGR A;  3Q8E A;  3AE3 B;  2LGI A;  4NZL B;  4A3O A;  4EFO A;  3GE8 C;  2N9L A;  1DOY A;  1YD8 U;  5FK9 C;  2MH7 A;  3P4S B;  3PVL A;  4XX5 A;  4LDT D;  1RRB A;  3H7S A;  4P1C C;  3R2I A;  1N63 A;  4BKG A;  3BZD B;  3AE9 B;  4IM0 A;  1MHX A;  3ZYY X;  1E0Z A;  3ENE A;  2JX5 A;  4A8X C;  2G45 B;  1WH3 A;  4WWM A;  2KDB A;  2MW5 A;  2KMC A;  1WXQ A;  2L8J A;  4JWU C;  4PS8 A;  2B3A A;  4IG7 B;  2KOX A;  1TS2 A;  1YQB A;  2WXQ A;  3Q6B A;  4DXG A;  2JXT A;  2MJD A;  1J8C A;  2BT6 A;  2X8X X;  2IY1 B;  2IGH A;  2XBB C;  3AN1 A;  3VAW A;  4K7W A;  3IXS A;  3V62 A;  3VTV A;  4C4V B;  1EF5 A;  4XWW A;  1MHH E;  3APF A;  1ZXH A;  2WLB A;  2KHW B;  1OQY A;  3AE1 B;  1WXM A;  3DPD A;  1MVK A;  4ZRP A;  3EHV A;  3VUY A;  1VZ7 A;  1UGJ A;  2WXN A;  4GB9 A;  4HXD A;  1J7C A;  2RGF A;  2WU5 B;  2WS3 B;  2LEK A;  3EA6 A;  2KAC A;  3RUL A;  4II3 B;  4EKU A;  1UF0 A;  5EE3 A;  4XZ4 A;  2CHW A;  1F2R I;  3SHQ A;  2YVC A;  3BK2 A;  3TEZ A;  2DX5 B;  4AP4 C;  3ZDT A;  1FEH A;  3N32 A;  3NJT A;  4DHZ B;  1WZ0 A;  2EEL A;  4W9D A;  4JE3 B;  4MEL A;  4TMA B;  2QEJ C;  1D3Z A;  3N1Z C;  2N9P C;  3LJ3 A;  4FAD A;  2BYF A;  2JYT A;  4F7Z A;  3SU8 X;  1UBQ A;  2QHO A;  5CHF A;  5LNK 1;  3AE7 B;  1GC6 A;  3KYC D;  4RNA A;  5J2R A;  4HEA 1;  2I38 A;  3RPF C;  3H9D A;  3L17 A;  4NQL B;  3TEX A;  3QWZ B;  1SSN A;  2N9K A;  1TS5 A;  1JWB D;  2KK8 A;  1YOV B;  3TUO A;  4MT5 A;  2MQJ A;  1N6Z A;  4KGR A;  4ANX A;  4CHK A;  1FXT B;  2KXJ A;  3DHH C;  4OVU A;  1T3Q A;  3RMK C;  3W9C B;  3WIM A;  4FN2 A;  4A6Q A;  4H2A A;  3A1Q A;  1I4G A;  3P1M A;  1ZGU B;  1MJD A;  2RDH A;  2K6D B;  4ZDV A;  2DYB A;  2NTT A;  2CU1 A;  3JW0 X;  2LGX A;  5CHV C;  2AX5 A;  2AL3 A;  2N7E A;  1VZ6 A;  1C76 A;  2BWE S;  3R3M A;  4ICV A;  2WXI A;  1WGR A;  3Q14 C;  1XQQ A;  2G4S A;  3GS2 A;  1T0S C;  1N5W A;  1SJH D;  2HDE A;  3JVZ X;  3MC9 A;  3JSV B;  1EU3 A;  2J0M A;  3Q3F A;  2KKC A;  2JXX A;  4JQW C;  1YX5 B;  1EF1 A;  3AI5 A;  5HFY A;  1HA5 A;  1PYW D;  5IA7 A;  3C19 A;  3RI7 C;  2MHJ A;  3GZN B;  1WJN A;  2I1K A;  1YJJ A;  2BGF A;  4BFR A;  2BB6 A;  1FCC C;  1WR6 E;  4TUU A;  3EUB 2;  4IUM B;  3JYU A;  3DQV A;  1X1M A;  2DLB A;  4JLC A;  3M62 B;  2KTF A;  1L6V A;  2KFK A;  3X23 A;  4PYZ A;  1NEK B;  3MHS D;  2O2V B;  2HJ8 A;  5IOI A;  3ZNH B;  2V3S A;  2LVP A;  2FE8 A;  3BVZ A;  2JWZ A;  3IT6 B;  4X57 B;  1YIW A;  1TKY A;  2D07 B;  4XYC A;  3I9V 1;  2KN4 A;  3O13 A;  1TBE A;  2M8S A;  2MBB B;  3Q8F A;  5DCN A;  1E6E B;  3TSS A;  2K1F A;  1WXV A;  2DWQ A;  2WP9 B;  2B76 B;  1EO6 A;  4OVZ A;  1F2R C;  3W5U B;  4G50 A;  2WXL A;  2W54 A;  1OQQ A;  3L4P A;  3TEY A;  2CR5 A;  1ZW7 A;  1E10 A;  2GOW A;  2BKR B;  2N9E B;  4LNI A;  2J0K A;  4HDO A;  4P7I A;  1RYJ A;  2PW9 A;  4LJO B;  4M0W B;  2NPT A;  2KC2 A;  2FID A;  3TL5 A;  4D2K A;  4W9E A;  2WYQ A;  2MP2 A;  4GLS C;  4L1B A;  2FCM A;  1HZ5 A;  4HKQ A;  1V86 A;  3H8H A;  4KIK B;  1B1Z A;  2WX1 A;  4JGH B;  1IGD A;  4PS7 A;  1OEY J;  2GBJ A;  3SD5 A;  1FXA A;  3PZ7 A;  3RUI B;  4GXB A;  1SF0 A;  2R2O A;  4ZYN A;  3FAH A;  2MA9 B;  3PHW B;  1V81 A;  4ZRI A;  1EU4 A;  3RZW C;  2D5G A;  4GOC A;  1I35 A;  2Y5C A;  1PDX A;  1M4V A;  1I4H A;  2QC8 A;  4FXC A;  1WF9 A;  1AYF A;  1WM2 A;  1IUE A;  4F8C B;  5L83 A;  2NMQ A;  1VCB A;  1AAR A;  3AUL A;  3N1Y C;  4WWN A;  2C9W B;  1WY8 A;  2XNA C;  5IAA C;  2OOB B;  3Q2A C;  1WSP A;  4WAF A;  4DDI D;  1A70 A;  5D2M B;  4NAW A;  1SIF A;  3ZW3 A;  1MG8 A;  2IO0 B;  3DWM A;  2ZCB A;  1T0Y A;  2WDQ B;  1C4P A;  5E6P A;  3CSF A;  3AMZ A;  2E3T A;  4GN1 A;  3VHT C;  3HUI A;  1TYG B;  4ANV A;  3GB1 A;  4S17 A;  1WYW B;  3MTN B;  1C3T A;  1V49 A;  4NJ7 A;  1I4R A;  1F0Z A;  2KQS A;  4G3X B;  1WMH A;  1WJ6 A;  1E8W A;  4US9 A;  1LO5 D;  3A1Q B;  4EUT A;  1Q0W B;  2A4Z A;  1XLP A;  2HE7 A;  1V80 A;  4DBG A;  4WAA A;  3R7R A;  4WQO B;  1ET9 A;  3ZJU A;  2KVR A;  2ZW1 A;  4XDD A;  2PMV A;  3IG3 A;  2LJ5 A;  4US8 A;  1J0G A;  4XE0 A;  2M0A A;  1YJ1 A;  1QQR A;  5AZH A;  4URK A;  3H6N A;  5LXI B;  4RM8 A;  3VFK A;  2Z59 B;  3BVG A;  1WJU A;  3NS1 A;  3NVY A;  4MAC A;  5AUI A;  1G6J A;  1PQS A;  4BBN F;  1GAQ B;  3HVD A;  2IJ0 A;  2C7H A;  3VTU A;  4JIO U;  3AH7 A;  1VLB A;  4F1S A;  3QIJ A;  2LZ6 A;  2JRI B;  2DAJ A;  3DVG X;  5D94 A;  2V4I B;  4GDK A;  5MPO A;  1WZ3 A;  1VDV A;  1TS3 A;  3AEB B;  2IDY A;  2KLC A;  1FRR A;  3PT2 B;  3VRB B;  2LVQ A;  3AU5 A;  3QAR A;  4WJN A;  5GMV A;  1WIA A;  2M1M A;  1IYF A;  2GB1 A;  2NBV B;  2BYE A;  3PPA A;  1QOA A;  4DHZ E;  4KKI A;  4DXF A;  2K8C A;  4RCO A;  1C9F A;  5IO9 A;  2KFK B;  4M02 A;  4KZC A;  3ZJT A;  2C5L C;  3ALB A;  3DDC B;  4KZ0 A;  1R4N B;  2MBQ A;  1UZX B;  3RYT A;  1R4N I;  4HJG E;  2XN9 C;  3ZIM A;  2BQQ A;  2V1Y A;  2C60 A;  1P0R A;  3N3K B;  1WWT A;  2KAN A;  2RDG A;  2KO3 A;  2NBU A;  1WR1 A;  2L1A A;  3DBL B;  2KX3 A;  3DBL I;  1ZDX A;  3PLU A;  2BS4 B;  2Z0E B;  2Z8L A;  1RAX A;  1E7P B;  2BB5 A;  5KHQ A;  1T5X D;  4LNK A;  2N9X A;  3GE3 C;  1F9J A;  2REX A;  1LQB A;  3RNC C;  1FIQ A;  5EDS A;  3KUC B;  4IWP A;  3OAW A;  3NVW A;  5I4D A;  2IO1 B;  3ZKJ C;  2MP2 B;  2YEP B;  2FUH B;  3TMP B;  4DQO C;  2J52 A;  2EKI A;  3DBR B;  3HRD D;  1BXT A;  2KFJ A;  3PRM B;  3AV8 A;  2J53 A;  1NI3 A;  3DBR I;  1R4M B;  1WE6 A;  2IND C;  1R4M I;  3B9J A;  2ACZ B;  1WGD A;  4PK1 A;  3WAP A;  2JT4 B;  4YSX B;  1RFA A;  3KW5 B;  1QOF A;  3ZNZ B;  3CF6 E;  3A4R A;  4BBN C;  2FCQ A;  1FRD A;  2JY6 A;  5EE0 A;  5BYQ A;  4WIP A;  3TEW A;  2KQ7 A;  1EM7 A;  3HHM A;  1ZE3 D;  2ON8 A;  3V60 A;  2AQ2 B;  3AXC A;  3RNF C;  1WXS A;  1DYQ A;  3P4Q B;  5H8Y E;  1K8R B;  2IGD A;  2YEP F;  4OZB A;  3HM6 X;  3NRZ A;  3DBS A;  1GG3 A;  1XD3 B;  4K7U A;  1SE3 A;  1NVI D;  4ZRJ A;  4HCP B;  3PO0 A;  3C0R B;  1NYQ A;  3NHE B;  2ZZP B;  3ZUN A;  4A20 A;  3E9S A;  3VH4 B;  4HDQ A;  1C79 A;  1KLU D;  1ROE A;  4P6V F;  3H7P B;  4IC7 B;  1A5R A;  2GMI C;  4WUR A;  3APD A;  2VZK B;  4Q2J A;  3A4S C;  2FBW B;  1VZ8 A;  1QOB A;  1XEE A;  2JF5 A;  4IOI E;  4MM3 B;  5HKH A;  2LHE A;  3LYY A;  2N0S B;  4LNF A;  4FBJ B;  2SAK A;  3PV1 A;  3R8B A;  3AEC B;  1VRA B;  2MRP A;  3V6C B;  2D3A A;  4K1R B;  2MCN B;  1LM8 B;  2OJW A;  1JW9 D;  1E9M A;  2FUG 1;  3DBH B;  4AJW A;  1HQR D;  2D3G A;  2OJR A;  5BYS A;  2BVC A;  2XK5 A;  2Z0D B;  3DBH I;  2HTH A;  3I57 A;  3OG5 A;  4P16 A;  3Q8B A;  3RNB C;  4ITK A;  1UWM A;  2D3C A;  4OZC A;  2VZK D;  3Q3O C;  1GNU A;  4KGT A;  5JXV A;  3PRP B;  1DOX A;  2O6V A;  1RFK A;  2KDE B;  4CYE A;  1R7S A;  2VH1 A;  4FLH A;  4HK2 A;  3PLV A;  2ASQ A;  3HVZ A;  4K81 A;  4E74 A;  1P1A A;  5JH5 C;  1PFD A;  1WGG A;  1Y8R C;  3ZRC A;  3ZXV A;  1YN4 A;  2KDI A;  2PE9 A;  1WM3 A;  4YTN B;  3L54 A;  4GDL B;  2KYW A;  1F77 A;  3S2A A;  2LVO A;  5IKC M;  2K3U A;  4HWI B;  1XLQ A;  1V2Y A;  4MJS A;  1OGW A;  1FFU A;  4YT0 B;  3ZXR A;  5LXH A;  1KLV A;  1KFY B;  1IBX B;  2LFI A;  4EZJ A;  1JRP A;  2WGS A;  1ISN A;  2CJN A;  4TV3 A;  1L0Y B;  2KNB A;  2KAJ A;  4TKN A;  1IP9 A;  3VRA B;  2M19 A;  2LUM A;  1ZUD 2;  1N60 A;  4ZRK A;  1Q1O A;  4W9I A;  3DWG C;  2JYE A;  1FFV A;  5EE9 A;  1PGX A;  1CJE A;  2V3N A;  5TSS A;  3AEG B;  3WAO A;  4USA A;  4BVU C;  3UQB A;  3ETR A;  4IDI A;  4JWS C;  1D5X C;  3FC4 A;  2XEW A;  2NR2 A;  4HVB A;  2AYO B;  2BKF A;  5BO4 B;  2KMA A;  1VJK A;  2IO3 B;  4HPM B;  4UDU C;  2WDV B;  3P4R B;  2KTR A;  2HJ1 A;  2K8B A;  2BTE A;  4AOF A;  3SR6 A;  1L5P A;  3DHI C;  3PRZ A;  3FIL B;  1FD6 A;  4OW0 A;  1ZP0 B;  5BYR A;  1D6E C;  2K9X A;  3KUZ A;  2BBC A;  2Q5W D;  3HIZ A;  3W1S A;  4S0R A;  4ZYS A;  1EUV B;  2KLG A;  1FNV A;  3M3J A;  4WJP A;  2PVG C;  4ZHO A;  3QC8 B;  2EKE C;  4RFB A;  2ZNV B;  4HCN B;  4MDK E;  1GJZ A;  1VD2 A;  4OHJ A;  4KDI C;  5G2N A;  3W1Y A;  3EEC A;  4DK5 A;  1XLN A;  4HPL B;  4A3P A;  1YNT E;  5G5G A;  3URY A;  3PZ8 A;  5J17 A;  1SB3 C;  4TSS A;  4C56 C;  2PKO A;  4XDC A;  2TSS A;  1N61 A;  3KH0 A;  5D3D A;  1V1P A;  2LWP A;  2RPV A;  3IHP C;  4WJO A;  3AEA B;  1KRH A;  4O1N A;  4BAX A;  2NVU I;  3SEB A;  2IGG A;  3ZGZ A;  1B9R A;  3AB5 A;  2L52 A;  1OEY A;  3ZTD A;  3UF8 A;  1C78 A;  4L2Y A;  4EOY A;  1SXT A;  3A9J A;  3Q69 A;  2PE6 B;  2MJ3 A;  2G1E A;  1J19 A;  2MBH A;  3T9L A;  2DNF A;  1QT9 A;  2KWC A;  5HHD G;  1YJI A;  3J9C A;  4MSQ B;  2GBM A;  1V5O A;  4BKT A;  4WWO A;  2IO2 B;  4EE2 A;  3ZDM C;  2JZ3 B;  4FJZ A;  2NTS A;  3U7Z A;  2FNJ B;  3I3T B;  3Q3M C;  3TIX A;  2CS4 A;  3KWL A;  2XK5 B;  4MGY E;  5BMG A;  4RGN A;  1C4C A;  3ZTC A;  3ZLZ A;  4W9F A;  3UIP B;  1PGA A;  2WXJ A;  4KSK C;  2D11 A;  2AQ3 B;  4R3D A;  4KVG B;  1XT9 B;  2INN E;  3M95 A;  1I42 A;  3KQ4 A;  1FPY A;  3P42 A;  3T3N A;  2WXO A;  4K3B A;  1KH0 A;  4RH6 A;  2PEA A;  4NJC A;  2RD0 A;  1JCK B;  4IM2 A;  2KC1 A;  2IBI B;  1NI2 A;  1ZOY B;  4A90 A;  1UWX A;  2PVO D;  2ZPN A;  2BS3 B;  1T0Q C;  3DVN V;  2G9H D;  2DHZ A;  4A9A A;  4C7Z A;  1V9J A;  3N20 C;  4IWO A;  4HJK A;  4MGI E;  5HG2 A;  3Q3N C;  1H8C A;  3C8Y A;  2INP E;  4WQM A;  3NS8 A;  4ICU A;  2KJH B;  4ANU A;  4C4V A;  2ZVO A;  3T3O A;  1D5Z C;  1NYR A;  3ABV B;  1T6B X;  4KKJ A;  2DYM A;  5G55 A;  3AU4 A;  1RLF A;  1QOG A;  1WJ4 A;  2KVZ A;  2EMT A;  1QLB B;  5FR3 A;  1ZXI A;  4FJY A;  3L10 B;  1L2N A;  2M0X A;  3MP9 A;  2J0J A;  2VRR B;  2ZNV C;  3RD2 A;  3W2D A;  1YN3 A;  1V97 A;  2UU7 A;  3WA0 A;  4AWJ A;  2WHI A;  4EZK A;  3QCA A;  1I4Q A; 
#chains in the Genus database with same CATH homology
 4JL9 A;  2JY6 A;  3QHT A;  3WIM A;  4FN2 A;  5DPS A;  3HM3 A;  3A1Q A;  4I6P A;  4NQK E;  2KQ7 A;  2N7D A;  3HHM A;  3KUD B;  4NPN A;  2MBO A;  4W9J A;  1ZGU B;  3V60 A;  2DAF A;  2KWU B;  3VXW A;  3AXC A;  1WXS A;  4GU2 A;  2CHX A;  2K6D B;  3GOE A;  2N1V A;  2A5U A;  4ZDV A;  1K8R B;  2LI5 A;  3T8M A;  3OLM D;  3HM6 X;  2DYB A;  3DBS A;  1GG3 A;  2NCN A;  4II2 B;  3PSE B;  2CU1 A;  3JW0 X;  2LGX A;  5CHV C;  1XD3 B;  4K7U A;  4B6W A;  2ZVN A;  2AL3 A;  4TQ1 A;  2N7E A;  1P3Q U;  3PS6 A;  4PYU A;  2BWE S;  3DVN U;  3R3M A;  4ICV A;  4IWQ A;  4ZRJ A;  4HCP B;  4MSM B;  3C0R B;  2DZJ A;  2L3Z A;  5AZG A;  3NHE B;  1WGR A;  1Z2M A;  3RCZ A;  3KVF B;  2ZZP B;  3ZUN A;  4A20 A;  1XQQ A;  2G4S A;  1UBI A;  3JVZ X;  2O6V B;  3VH4 B;  2BPS A;  2KX0 A;  4HDQ A;  3JSV B;  3L13 A;  4EZL A;  1E8Y A;  4XC2 A;  4WWP A;  1S1Q B;  1WX7 A;  2J0M A;  3ZVV A;  4DWF A;  3Q3F A;  2K8H A;  2KKC A;  3H7P B;  4IC7 B;  3ML9 A;  1A5R A;  2GMI C;  2JXX A;  4JQW C;  3WAM A;  4DDG D;  1YX5 B;  1EF1 A;  2JPH A;  3AI5 A;  3APD A;  4LJP B;  2NS5 A;  4BOZ B;  2DEN B;  3A4S C;  3LDZ E;  1S3S G;  2BYV E;  5DPW A;  5IA7 A;  1JRU A;  1NBF C;  1UGM A;  4E71 A;  4M8N A;  2JF5 A;  3IBE A;  5HKH A;  2L7R A;  1WGY A;  3QX1 A;  3X0W A;  4FBJ B;  2N1W A;  3PV1 A;  1WJN A;  2I1K A;  4EEW A;  2BGF A;  2KJ6 A;  3ZRF A;  2M17 A;  4BFR A;  2MRP A;  3V6C B;  1WX9 A;  4W9G A;  4B95 A;  5LLI A;  4FJV B;  4GMV A;  4K1R B;  4I6N B;  2MCN B;  3K9P B;  1LM8 B;  2L0F A;  4WJQ A;  1WR6 E;  5DPR A;  4TUU A;  3PZD A;  2ZPY A;  4AJW A;  3UQA A;  4IUM B;  2D3G A;  2OJR A;  3JYU A;  3DQV A;  3DBH I;  2XK5 A;  1HE8 A;  2KJR A;  2HTH A;  2Z0D B;  4MJS B;  2O6V D;  1WI0 A;  1X1M A;  4GIV A;  4JLC A;  3U8Z A;  4J6I A;  3IFW B;  3M62 B;  4W9C A;  1KJT A;  2KTF A;  3QJZ A;  4PS3 A;  3DCG A;  2KFK A;  3UIN B;  3X23 A;  4PYZ A;  1GNU A;  1YX6 B;  3PRP B;  4DHJ B;  3MHS D;  2O2V B;  2O6V A;  3PGE A;  2HJ8 A;  3ZNH B;  2C7M B;  2KWV B;  2V3S A;  2KDE B;  4KDL B;  4CYE A;  2NBW B;  2LVP A;  3H7P A;  3CMM B;  4FLH A;  4HK2 A;  3PLV A;  4W9H A;  2JWZ A;  2ASQ A;  2NPT B;  1YIW A;  4X57 B;  4K81 A;  1E7V A;  4E74 A;  1P1A A;  5JH5 C;  2D07 B;  1WGG A;  1ZKH A;  1Y8R C;  3QK0 A;  3ZRC A;  4FHK A;  4MM3 A;  2LRW A;  1TBE A;  3B08 A;  1BT0 A;  4M8M A;  5TR5 A;  2KDI A;  2L00 B;  3NOB A;  2PE9 A;  1WM3 A;  2M8S A;  2MBB B;  3P2B A;  2R2Q A;  3L54 A;  1Z5S B;  4GDL B;  5KHO A;  3ZNG C;  2IZV B;  4NY0 A;  3S2A A;  1TGZ B;  5DCN A;  2LVO A;  3ZO5 B;  4FHJ A;  4HWI B;  3RZF A;  2K1F A;  1WXV A;  1V2Y A;  5E6N A;  4KV2 A;  4YL8 A;  2RPQ A;  2MLB A;  4MJS A;  2LXA A;  1EO6 A;  4DHJ D;  1OGW A;  2PPH A;  4G50 A;  2KN5 A;  2ZCC A;  3MJW A;  2LGD A;  5LXH A;  2W9N A;  3TCA A;  2CR5 A;  1KLV A;  1Q5W B;  1ZW7 A;  2LGY A;  2UWQ A;  3ZNI D;  2GOW A;  2BKR B;  4EZJ A;  1H4R A;  1ISN A;  4MGZ E;  1E8Z A;  4TV3 A;  2G3Q B;  2N9E B;  4IM3 A;  3VVW B;  2J0K A;  3TBL D;  2KNB A;  3HK0 A;  4HDO A;  4P7I A;  4BKS D;  4TQ0 A;  3K9O B;  1C1Y B;  4LJO B;  4M0W B;  2NPT A;  5JHA A;  2KC2 A;  2KTR B;  3VUW A;  2FID A;  3TL5 A;  4TKN A;  4W9E A;  2WYQ A;  1IP9 A;  2D10 A;  3EFU A;  2MP2 A;  2FCM A;  4ZRK A;  1Q1O A;  2LXC A;  4W9I A;  1V86 A;  3SDL C;  3TJP A;  4KIK B;  2WX1 A;  5J18 A;  1IPG A;  4GDL A;  3R7Q A;  4N9F 4;  1M94 A;  3OJ4 B;  4JGH B;  1QZE A;  3NY5 A;  4NAW B;  4PS7 A;  4G0N B;  1E8X A;  2GBR A;  1OEY J;  3QA8 A;  2GBJ A;  2WWZ A;  2D2Q A;  3WAO A;  3OJ3 A;  2K25 A;  3SD5 A;  4DXA B;  3R66 C;  3RUI B;  4GXB A;  2R2O A;  4LCD E;  4ZYN A;  3ECI A;  4BVU C;  3UQB A;  2ZJD A;  3EC8 A;  3Q3J A;  4I6L B;  2I1J A;  2MA9 B;  4B9K A;  3PHW B;  2XEW A;  1V81 A;  3DOW A;  3NZU A;  2NR2 A;  4ZRI A;  4FUL A;  3RZW C;  5CX3 A;  4HVB A;  2MSE D;  4K7S A;  2AYO B;  2BKF A;  3B0A A;  4GOC A;  4W9K A;  5BO4 B;  2AEH A;  1V6E A;  2KMA A;  1I35 A;  2IO3 B;  4GGQ A;  2LAS A;  4HPM B;  2FAZ A;  1WMH B;  2KTR A;  3QQ8 B;  2K8B A;  3V6E B;  4AOF A;  1WF9 A;  3A33 B;  3L16 A;  5JHB A;  1WM2 A;  3DVG Y;  3PRZ A;  2YLM A;  4F8C B;  5L83 A;  4KSL C;  2FCS A;  1VCB A;  1E7U A;  1AAR A;  2KZR A;  3AUL A;  4KIK A;  4WWN A;  3B1L X;  2C9W B;  1E90 A;  1WY8 A;  1WX8 A;  3BIN A;  3KUZ A;  5IAA C;  2OOB B;  3HIZ A;  1E5W A;  3W1S A;  1WRD B;  3PHX B;  4BOS C;  4DDI D;  1EUV B;  2KLG A;  5D2M B;  4NAW A;  3M3J A;  1GC7 A;  4WJP A;  1SIF A;  2MBE A;  3ZW3 A;  4RM9 A;  1MG8 A;  3A9K B;  3QC8 B;  2EKE C;  3APC A;  5E6O A;  3W1S C;  5C1Z A;  2IO0 B;  2ZNV B;  3H1U A;  4HCN B;  1WGH A;  4MDK E;  2LRU A;  2ZCB A;  1T0Y A;  1TZ1 A;  1TTN A;  1VD2 A;  2DZI A;  1WFY A;  2FIF A;  3JSV A;  2BF8 B;  3A9J B;  3CSF A;  1V5T A;  4KDI C;  5E6P A;  3RT3 B;  5G2N A;  4HLE A;  4GN1 A;  1WE7 A;  3VHT C;  3W1Y A;  2K39 A;  4FA6 A;  1LFD A;  2JVC A;  4AJY B;  2UYZ B;  2L0T A;  5D7G A;  4ANV A;  3EEC A;  4NJ6 A;  4DK5 A;  4A3P A;  4HPL B;  2LD9 A;  3VH3 B;  1WYW B;  3MTN B;  1C3T A;  1V49 A;  2M4N A;  4NJ7 A;  2ZEQ A;  1CMX B;  2KQS A;  5J17 A;  1UH6 A;  3PTF C;  3O65 B;  2L76 A;  4G3X B;  1WMH A;  4MH0 E;  2JRH A;  2RSU A;  2J7Q B;  3IVF A;  1WJ6 A;  1E8W A;  3A1Q B;  4GDK B;  2JUO A;  3KH0 A;  1NDD A;  2CKH B;  4EUT A;  4IW0 A;  2N4F A;  1Q0W B;  3UIO B;  2A4Z A;  2LWP A;  2DYO A;  3IHP C;  2HD5 B;  2EMS A;  2HE7 A;  4LDT B;  4WJO A;  1V80 A;  4DBG A;  4WAA A;  3R7R A;  4WQO B;  2WX0 A;  1SE9 A;  2NVU I;  1LXD A;  3WAN A;  2PJH A;  2KVR A;  3M63 B;  3IG3 A;  2AWT A;  2LJ5 A;  3VTW A;  1J0G A;  5C23 A;  4GSW A;  1OEY A;  1YJ1 A;  3ZTD A;  1SGH A;  5JZE B;  3D32 A;  5AZH A;  3H6N A;  3UF8 A;  4URK A;  5L95 C;  5LXI B;  4RM8 A;  2O2V A;  2Z59 B;  3VFK A;  4MGK E;  4EOY A;  1WJU A;  3A9J A;  3L0W B;  2PE6 B;  2IY0 B;  1UEL A;  1G6J A;  2MBH A;  1J19 A;  1PQS A;  2MX2 A;  3T9L A;  4BBN F;  3PRE A;  4MEM A;  4A3O A;  3ONS A;  4OVV A;  2KDF B;  2KWC A;  4EFO A;  2C7H A;  3VTU A;  4JIO U;  5AZF A;  1YD8 U;  4MSQ B;  4F1S A;  2K6Q A;  3PVL A;  3QIJ A;  2LZ6 A;  2JRI B;  4XX5 A;  2GBM A;  1V5O A;  2DAJ A;  1RRB A;  3H7S A;  4LDT D;  4BKT A;  4BKS A;  3DVG X;  2MWS B;  5D94 A;  3WAL A;  2G4D B;  4GDK A;  4BKG A;  4WWO A;  2IO2 B;  1WZ3 A;  4IM0 A;  3ZDM C;  2JZ3 B;  2KLC A;  4FJZ A;  3PT2 B;  3ENE A;  4AUQ C;  2DZM A;  2Y5B B;  2LVQ A;  2FNJ B;  2G45 B;  2LUE A;  3AU5 A;  3I3T B;  2DZK A;  3QAR A;  4WJN A;  5GMV A;  1WH3 A;  1WIA A;  2M1M A;  1IYF A;  2KDB A;  2MW5 A;  2KMC A;  1UD7 A;  2L8J A;  4PS8 A;  2B3A A;  3L08 A;  4IG7 B;  2NBV B;  2BYE A;  2KOX A;  3TIX A;  2CS4 A;  5FR6 A;  4E3C A;  1YQB A;  3PPA A;  4DHZ E;  2XK5 B;  1J8C A;  5D6J B;  4MGY E;  2K8C A;  3U30 A;  3ZTC A;  2IY1 B;  3ZLZ A;  4W9F A;  2FCN A;  3UIP B;  2XBB C;  2KFK B;  3VAW A;  1L7Y A;  4KZC A;  4KSK C;  2D11 A;  4K7W A;  3VDZ A;  4CO7 A;  2C5L C;  3V62 A;  3VTV A;  3ALB A;  3DDC B;  3VQI A;  4KVG B;  4KZ0 A;  1EF5 A;  2MBQ A;  1XT9 B;  1UZX B;  3RYT A;  3APF A;  1R4N I;  2KHW B;  3M95 A;  1OQY A;  1I42 A;  1WXM A;  4RMA A;  3DPD A;  4W9L A;  3ZIM A;  3EHV A;  4NNJ B;  2V1Y A;  3VUY A;  3U7D A;  4ANW A;  2C60 A;  2RR9 A;  2JZZ A;  2PEA A;  1P0R A;  3N3K B;  2GBK A;  4GB9 A;  2KAN A;  4HXD A;  2GBN A;  2RGF A;  2RD0 A;  1KM7 A;  2KO3 A;  2NBU A;  2KC1 A;  4IM2 A;  1GUA B;  1WR1 A;  3GZN I;  2KX3 A;  2IBI B;  1NI2 A;  3DBL I;  3RUL A;  4II3 B;  4EKU A;  3PLU A;  4XZ4 A;  2CHW A;  1KOT A;  2Z0E B;  2ZPN A;  3SHQ A;  2YVC A;  1RAX A;  2DX5 B;  3DVN V;  4AP4 C;  3ZDT A;  2DHZ A;  1V9J A;  3N32 A;  4DHZ B;  4IWO A;  4HJK A;  4MGI E;  1WZ0 A;  5KHQ A;  1H8C A;  4W9D A;  2N9X A;  1F9J A;  3NS8 A;  2REX A;  4ICU A;  2C7N B;  2KJH B;  4MEL A;  1LQB A;  2AL6 A;  5DPT A;  3QAQ A;  4ASW C;  4ANU A;  2WDT B;  1P98 A;  2ZVO A;  5EDS A;  2L05 A;  1P9D U;  1D3Z A;  3KUC B;  4IWP A;  5CHW A;  2N9P C;  3OAW A;  3LJ3 A;  4FAD A;  1WXA A;  2BYF A;  4F7Z A;  2IO1 B;  3SU8 X;  5G55 A;  2DYM A;  2IYD B;  3ZKJ C;  1UBQ A;  2QHO A;  3AU4 A;  1RLF A;  2MP2 B;  5CHF A;  3TMP B;  2FUH B;  1WJ4 A;  3VUX A;  1GC6 A;  2EMT A;  3KYC D;  5J2R A;  3NZS A;  2KFJ A;  3A9K A;  3PRM B;  3N30 A;  3DBR I;  3H9D A;  5AEK B;  3L17 A;  4NQL B;  2BWF A;  4G11 A;  4FJY A;  1WE6 A;  3L10 B;  5CTR C;  1R4M I;  1L2N A;  3QWZ B;  2M0X A;  1WGD A;  1OTR B;  2J0J A;  2JT4 B;  2KK8 A;  2VRR B;  1RFA A;  2ZNV C;  3ML8 A;  3RD2 A;  3WAP A;  2CHZ A;  2MQJ A;  1GJZ A;  3KW5 B;  3UGB B;  1U4A A;  3CST A;  3WA0 A;  3ZNZ B;  4AWJ A;  2V4L A;  4ANX A;  4CHK A;  1FXT B;  4EZK A;  3CF6 E;  2KD0 A;  2KXJ A;  3QCA A;  3V61 A;  3KYD D;  4OVU A;  3A4R A;  4BBN C;  2FCQ A;  3BY4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...