2FCMA

X-ray crystal structure of a chemically synthesized [d-gln35]ubiquitin with a cubic space group
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
73
structure length
72
Chain Sequence
LQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the energetics of protein alpha-helix C-cap termination through chemical protein synthesis.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Ubiquitin
total genus 23
structure length 72
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2fcmA00
3U30A 4GN1A 3TCAA 4HLEA 3KUDB 2CR5A 5GMVA 4A3OA 1J8CA 3RZWC 1YX6B 4GOCA 4FADA 1WF9A 2HE7A 2Y5BB 4RM9A 5D2MB 3B1LX 3QA8A 4MH0E 3ML8A 2D11A 2MP2A 5D6JB 4W9JA 1WX8A 2KDBA 4DHZB 2C7NB 3H7SA 4KZCA 2V1YA 2KQSA 1WX9A 3A9JB 4P7IA 3KYCD 3CMMB 1WH3A 1KJTA 1V5TA 2D10A 2PJHA 3M63B 5IA7A 2LZ6A 3B08A 1WR1A 4FHJA 2MBEA 4CYEA 1I42A 2FIDA 4I6LB 1M94A 5L83A 1WJ6A 2PE6B 3NOBA 3PZDA 1EF5A 1LFDA 3VUYA 3EFUA 3EC8A 4WWPA 4F8CB 2IO2B 3APDA 3RCZA 1CMXB 2DAJA 4KSLC 4MGIE 1TBEA 2DZMA 3L08A 1UH6A 3HIZA 5IAAC 2NBVB 4KDLB 4BKSD 2YLMA 3A4SC 5JHBA 4FJYA 1RFAA 4II3B 2LGYA 4KIKA 2ZNVB 5E6NA 2PE9A 3PSEB 2J0JA 2C60A 2O6VD 4DWFA 2KNBA 3PVLA 4JL9A 2HJ8A 3JVZX 3ZDTA 5G2NA 2C7HA 4FULA 4IM3A 4A3PA 2MBHA 2N9XA 1S1QB 2KDIA 4HCPB 4HDQA 4IWPA 2EMTA 3AU5A 4MELA 2LXAA 2M1MA 3KUZA 3HHMA 2RR9A 3R66C 4JIOU 5D7GA 4FLHA 4NNJB 1E8XA 5KHQA 4MGKE 3ZW3A 2LXCA 2UWQA 3QAQA 4IWQA 3HM3A 2XBBC 4IUMB 3RD2A 3PTFC 2FIFA 5DPSA 3UIPB 2IZVB 3R7QA 3DBLI 3H1UA 2KFKA 2JY6A 2KX3A 3JYUA 4F7ZA 2L76A 4FJZA 1V2YA 3VAWA 1P9DU 3QWZB 2GOWA 4HVBA 3ZNZB 3LJ3A 1EF1A 1YQBA 4I6NB 4WJOA 2WWZA 2M17A 4GMVA 4MSMB 3WALA 4WJQA 4MJSB 4PS7A 3DVNV 4ZYNA 2L8JA 4MEMA 3W1YA 3DBHI 1L2NA 3V6EB 3Q3JA 3M95A 3KH0A 1EO6A 1V6EA 2LI5A 1OTRB 2CHWA 2KTRB 2LRWA 3ZRFA 1Q0WB 1WXVA 2MQJA 1GUAB 2DAFA 2O2VA 3OAWA 3AI5A 1NBFC 4BVUC 3PS6A 4HPLB 1WE6A 4M8NA 2KDEB 4AOFA 3MHSD 4ANXA 4NPNA 4GU2A 2M0XA 4K1RB 2G4DB 4FJVB 1E8ZA 1R4MI 2CKHB 3ONSA 2NBWB 3L16A 4KDIC 3GOEA 2AYOB 2V4LA 2KKCA 3T9LA 1P3QU 3WIMA 1MG8A 3TJPA 4OVUA 3RUIB 3A1QB 3EECA 1WXSA 2KHWB 3I3TB 2ZEQA 4W9EA 5DCNA 3ZDMC 2MX2A 3SU8X 3IG3A 3RT3B 4ZRIA 1SE9A 5DPWA 1OQYA 2UYZB 3VH3B 3N3KB 4ZRKA 2N7DA 2K6QA 2KN5A 2DYMA 3APCA 5JZEB 2IYDB 4HWIB 2K8HA 4MJSA 4W9KA 4K7SA 1WI0A 2BWES 3EHVA 4HDOA 4PS8A 2PPHA 3N30A 1NDDA 1UZXB 3DPDA 1LM8B 4BBNC 4G3XB 3CF6E 4E71A 3AU4A 4XZ4A 2IO1B 4EZLA 2K8CA 5C23A 3TIXA 1WXAA 2D07B 2I1KA 2KFKB 2REXA 3WAOA 2ASQA 4AWJA 2L3ZA 4WJNA 1OEYA 4GDKB 4B6WA 3JSVA 3PLUA 2KWCA 2J0KA 3H9DA 2FCQA 4K81A 3W1SA 2WDTB 3A4RA 5E6OA 2ZNVC 3IVFA 2KWVB 2BKRB 3OLMD 1YD8U 2LVOA 3VTUA 3ENEA 3QJZA 2KMAA 4EZKA 4AP4C 1WZ3A 4CO7A 2ZPNA 2KANA 1Z5SB 2KJHB 1U4AA 2JPHA 2KJ6A 3DCGA 3ECIA 1YX5B 4M0WB 2O6VA 4KV2A 2JVCA 3DBRI 2ZCCA 2DYOA 3GZNI 3D32A 4IWOA 4NJ7A 1F9JA 3KYDD 4KIKB 2DZIA 4K7WA 2WX1A 4ANWA 2IO3B 2DZJA 3KW5B 2KQ7A 3HK0A 5JH5C 4FN2A 4EKUA 3QARA 2CHXA 4IG7B 4W9IA 2C5LC 1UBIA 4WAAA 3ZLZA 1GNUA 2KLGA 5J2RA 2M8SA 3VQIA 3ZVVA 2AL3A 5LXHA 4AJWA 3DVNU 2N1WA 2BYEA 1SIFA 3A9KB 4PYZA 3O65B 2KK8A 4IM2A 2A5UA 2NBUA 2Z0EB 3VFKA 5J17A 3VDZA 4DXAB 2AWTA 2N9EB 4DHZE 1X1MA 4W9HA 3UQBA 4XX5A 4KZ0A 4G11A 1AARA 2FCSA 1WY8A 2YVCA 3K9PB 1XD3B 2PEAA 2KOXA 2XK5A 2ZPYA 2ZZPB 3M62B 1ISNA 3QCAA 4LDTB 5AZHA 4LJOB 2LGXA 2KJRA 4HJKA 3NZUA 4MM3A 4EZJA 3DOWA 2K6DB 4MSQB 1E90A 4E74A 3ZRCA 5HKHA 2W9NA 3U7DA 4HPMB 3AULA 3PREA 3L10B 3H7PB 4DK5A 2LRUA 2MLBA 4TUUA 1V86A 2GBKA 2MW5A 1J19A 1YIWA 5CHFA 1V80A 5LLIA 3ZNHB 2OOBB 2CHZA 4NAWA 2M4NA 1H4RA 2OJRA 1BT0A 3MJWA 4X57B 5CX3A 2BYVE 2JF5A 3RULA 1E8WA 2LWPA 4CHKA 4EOYA 3UF8A 4AUQC 4KSKC 4GDLA 4W9LA 5AZGA 2K1FA 2J7QB 2NPTB 2KXJA 1WR6E 3V6CB 4ASWC 5DPTA 1K8RB 3UINB 2JZZA 4DBGA 2B3AA 3C0RB 2C7MB 4MDKE 1QZEA 2RPQA 2FNJB 5JHAA 2MBQA 1V49A 4NY0A 2KZRA 4DHJB 2JWZA 4NAWB 2FCMA 3S2AA 3VH4B 2IY1B 2K8BA 2NS5A 1WZ0A 5CHWA 2KC2A 3KVFB 3VVWB 2BPSA 3NS8A 3SD5A 3VXWA 3PV1A 3DVGX 1KM7A 3SHQA 4BKSA 2KD0A 1C1YB 3DDCB 1E7UA 1Q5WB 3JW0X 4G0NB 5D94A 1KLVA 3CSTA 2JRIB 2R2QA 1WFYA 4WWOA 2MA9B 1WJ4A 4PS3A 2BKFA 4BFRA 1WRDB 2MBOA 2BF8B 2L00B 1RLFA 3V60A 2KWUB 2JT4B 3DVGY 2GMIC 2GBMA 2ZVOA 3M3JA 4WJPA 1I35A 1WMHA 4BKTA 3PT2B 3VTVA 1EUVB 1WGHA 4GDLB 2KO3A 2G4SA 3VHTC 2KVRA 3ALBA 1TGZB 4IC7B 4NQKE 1P0RA 2MBBB 3ZNID 4KVGB 2L7RA 2O6VB 4FHKA 3TL5A 1WM3A 2GBNA 1J0GA 3ZTDA 4WWNA 2FAZA 4BBNF 2BYFA 3B0AA 2MP2B 3APFA 1R4NI 4A20A 3HM6X 5FR6A 1A5RA 1WIAA 3L13A 1UD7A 1FXTB 3PHWB 3VUXA 1ZW7A 4ANUA 2DHZA 2I1JA 4ICUA 2GBRA 4EFOA 4LCDE 1E5WA 2XEWA 4DHJD 2FCNA 5L95C 2CU1A 4HK2A 1WMHB 4GGQA 3BINA 3X23A 2LUEA 4BKGA 3QHTA 1TTNA 1ZKHA 1LXDA 1Q1OA 3PLVA 4IW0A 3LDZE 3QC8B 2KTRA 2N1VA 2C9WB 2ZCBA 2L05A 4TQ1A 4ZDVA 2GBJA 3IBEA 1VCBA 3WAMA 4DDGD 3U8ZA 4ZRJA 4GIVA 3QQ8B 2WX0A 3TBLD 3PGEA 3A9KA 1GC7A 4MGYE 1XT9B 2D2QA 4EEWA 3PPAA 1WX7A 1YJ1A 3PHXB 4HXDA 2LVPA 4JLCA 4E3CA 3PRMB 2Z59B 2MCNB 2LD9A 2Z0DB 1IYFA 3NHEB 3IFWB 1H8CA 1WGRA 3PRZA 2AL6A 2L0TA 3JSVB 1WGGA 2VRRB 2JZ3B 4W9GA 5CHVC 3RZFA 1UGMA 3QX1A 3UGBB 3QIJA 3UQAA 2HD5B 2IO0B 3X0WA 2KC1A 3RYTA 1D3ZA 2IBIB 3MTNB 1NI2A 3BY4B 2LJ5A 4GB9A 2D3GA 4TV3A 4JQWC 4TQ0A 2KFJA 2JXXA 2RSUA 4G50A 3WA0A 4N9F4 2L0FA 2JRHA 1P1AA 3L0WB 3ZKJC 1OEYJ 1T0YA 2DENB 4II2B 1V5OA 3P2BA 4EUTA 2KLCA 4B9KA 2FUHB 4URKA 4AJYB 4LDTD 2XK5B 3A1QA 4ICVA 2KDFB 3ZUNA 2RGFA 3OJ3A 4IM0A 4F1SA 2G45B 2ZJDA 4XC2A 5CTRC 1HE8A 4BOZB 2JUOA 1LQBA 5AEKB 3UIOB 2LASA 2MWSB 1WGDA 1OGWA 2QHOA 2N4FA 3V61A 3DQVA 2NPTA 1SGHA 1UELA 2KX0A 3A33B 3KUCB 5E6PA 4W9DA 2NR2A 1G6JA 3CSFA 1VD2A 2NVUI 2HTHA 3WANA 2DZKA 1P98A 1WM2A 3A9JA 2BWFA 4NJ6A 4WQOB 3ZIMA 2N7EA 1C3TA 2ZVNA 3H7PA 3V62A 2IY0B 4J6IA 2MRPA 5BO4B 2WYQA 2G3QB 2V3SA 3OJ4B 4FA6A 3ZNGC 4HCNB 1JRUA 3W1SC 2BGFA 1KOTA 4NQLB 4W9CA 5AZFA 5EDSA 3IHPC 3SDLC 4BOSC 4DDID 1XQQA 4GXBA 3R3MA 3ZO5B 1UBQA 4W9FA 1WJNA 1RRBA 1WJUA 2MSED 2LGDA 4B95A 4YL8A 1IP9A 2RD0A 4MGZE 4PYUA 5LXIB 3NY5A 1Y8RC 2O2VB 3R7RA 2J0MA 3VTWA 1PQSA 3Q3FA 3ZTCA 5J18A 1WE7A 4GSWA 2N9PC 3L17A 3L54A 3AXCA 3K9OB 5TR5A 4RM8A 1WGYA 3H6NA 1ZGUB 2KTFA 1GC6A 3NZSA 3PRPB 4K7UA 4TKNA 4FBJB 3VUWA 3N32A 1E7VA 2DX5B 4ANVA 2K25A 1E8YA 1IPGA 4I6PA 3DBSA 2R2OA 1GG3A 5DPRA 2K39A 1WXMA 1L7YA 2LVQA 3WAPA 5C1ZA 2NCNA 3ML9A 3T8MA 2A4ZA 2EMSA 1GJZA 3TMPB 4GDKA 4RMAA 1V81A 3QK0A 2KMCA 4JGHB 2CS4A 1RAXA 2DYBA 1WYWB 1Z2MA 1V9JA 2AEHA 2EKEC 4M8MA 4OVVA 1S3SG 5G55A 1TZ1A 5KHOA 4LJPB
chains in the Genus database with same CATH superfamily
4YSXB 2CR5A 5GMVA 1J8CA 2FBWB 1SB3C 2BYTA 3ZXRA 3QA8A 2MP2A 2L83A 2KDBA 2PVOD 3NRZA 2KQSA 1WX9A 1K53A 3KYCD 3Q3NC 2D10A 5IA7A 3AB5A 3BYTB 4CYEA 5FKAC 2INNE 4I6LB 1D5XC 1SIJA 4C56C 3AEDB 1EU3A 4KSLC 3B2GA 3Q8BA 4WURA 5JHBA 4FJYA 1RFAA 1L0XB 2GB1A 4DWFA 4JL9A 3JVZX 1RM6C 2K9XA 3ZDTA 3P4SB 4FULA 4IM3A 4A3PA 2MBHA 2KDIA 4IWPA 3AU5A 3NVVA 2DWQA 3BVMA 1SE2A 3R66C 1GOZA 5D7GA 1MFWA 3ZW3A 2LXCA 1ROEA 1V1PA 3AE3B 3PTFC 2FIFA 5DPSA 3R7QA 3TUOA 3DBLI 2KFKA 2KX3A 3AE9B 1V2YA 2QSDA 3VAWA 2CJOA 3TEYA 1I4XA 2N0SB 4I6NB 2WXIA 5EE3A 3WALA 2WWZA 2M17A 5D3IB 3RI7C 2QILA 2WXJA 3DVNV 4ZYNA 3W1YA 1L2NA 1T6BX 2PKOA 1B1ZA 1T3QA 1V6EA 3ZRFA 1OTRB 2KTRB 1YMHE 4MT5A 1I4QA 4BVUC 4YT0B 4ANXA 4GU2A 4RGOS 1D4BA 3ONSA 3L16A 3E56A 3GOEA 2V4LA 1MG8A 1QOBA 1SXTA 2KHWB 2ZEQA 5DCNA 3RT3B 5DPWA 1TKEA 3VH3B 4ARCA 1VZ8A 4HWIB 2K8HA 3NVWA 4W9KA 4K7SA 3EHVA 3IT6B 2Y3AA 2DLBA 1NDDA 4WQMA 3NZ3A 3ZQ4A 4BBNC 2IO1B 2K8CA 4AWJA 1FO4A 2V9HA 4YWGG 1HTOA 2FCQA 2INPE 3W1SA 2WDTB 3A4RA 2KWVB 1N62A 2G1EA 3BWUD 5C3JB 2KMAA 4EZKA 3DHGC 1QQRA 3Q8AA 2O6VA 1FNWA 3TEZA 4NJ7A 1F2RC 4KIKB 2WX1A 1CJEA 3W5UB 2KQ7A 3HK0A 5JH5C 4IG7B 3I63C 3NVYA 3DVNU 2N1WA 2IPKD 1UWXA 3O65B 5HI1A 1KTKA 3VFKA 4LNNA 4DHZE 1X1MA 1IGCA 2YEPB 4KZ0A 1AARA 3BVGA 4UDUC 2YVCA 3K9PB 3SFEB 3M62B 1QF6A 1V1PB 2LGXA 3N1ZC 5G5GA 3B2FA 3NZUA 4MM3A 4EZJA 2ICIA 1E90A 5BYQA 1ENFA 1E7PB 1E0ZA 4ARIA 5AUIA 3L10B 5BMIA 4DK5A 1V86A 2MW5A 1YIWA 1V80A 2M4NA 5E6JA 3R8BA 2JF5A 5IP4D 2UU7A 2W55A 1QT9A 1WR6E 1C77A 5DPTA 3VRAB 1QOGA 2JZZA 4DBGA 3C0RB 3DHIC 1QZEA 2FNJB 5HG2A 1V49A 1MHXA 2KT7A 4NY0A 4NAWB 2FCMA 2N9LA 2NS5A 2WS3B 3VVWB 3SD5A 4GLSC 3DVGX 3SHQA 1C1YB 3DDCB 2MJ3A 5BMGA 2MHJA 4YTMB 2G9HD 2R2QA 1WFYA 3P4PB 2MA9B 2BKFA 2ACZB 2BF8B 4XE0A 2I38A 1WMHA 3PT2B 1N61A 4K3CA 4IC7B 1XF5L 4P16A 2R61A 4KVGB 2WXQA 2GBNA 3V05A 2NTSA 3ZTDA 1JCKB 1JWBD 2FAZA 4TSSA 2WGSA 1UD7A 3LB8C 1ESFA 3TEXA 4L23A 2FCNA 5L95C 2CU1A 2LUEA 1TTNA 4C00A 1ZKHA 3Q6BA 3PLVA 4ZHOA 3QC8B 4EE2A 1JALA 3U8ZA 3QQ8B 3RNGC 3ZXVA 3PGEA 2VZKB 2HDEA 1WX7A 1L6UA 1XLOA 4HXDA 3U7ZA 2Z59B 4IOIE 2L0TA 3UGBB 2HD5B 2JQRB 1NI2A 4OZBA 2WXHA 1D5MC 3EUB2 2KFJA 2JXXA 4ITKA 2KYWA 1P1AA 1T0YA 2KLCA 4B9KA 3V3XA 3OWEB 2BQQA 4P1CC 4AJYB 4LDTD 2B76B 1CZPA 3A1QA 2BTEA 2RGFA 2G45B 5FR3A 5AEKB 2JUOA 4HPPA 2J52A 3UIOB 2LASA 1SJHD 1GPXA 1WGDA 1TY0A 3V61A 1SGHA 1UELA 3KUCB 2NR2A 2HTHA 2PTLA 3BYYB 4NJ6A 3ZIMA 1XO3A 1D5ZC 2FUG1 4J6IA 3R2IA 4YSYB 4LNOA 2DNFA 2OEDA 5AZFA 4BOSC 4DDID 3N20C 3ZO5B 4HEA1 1PGXA 1QILA 1RRBA 2MSED 1TS3A 4XYCA 3BK2A 2V4IB 5T8IA 2GI9A 2J0MA 1PQSA 2N9PC 3L54A 1YQ4B 4RM8A 2L32A 4TKNA 2KTFA 3H6NA 1GC6A 3PRPB 5EE9A 3N32A 2K25A 4I6PA 5DPRA 1WXMA 4RCOA 1TS2A 1GJZA 3MJ5A 3TMPB 4GDKA 2K3UA 3QK0A 1RAXA 2DYBA 1WYWB 5G55A 2KQ4X 5KHOA 1PGBA 4PT5A 2VH1A 4WAFA 2K22A 4ZHPA 1YX6B 2WXPA 5D2MB 3B1LX 4MH0E 2JWUA 1KH0A 4W9JA 1I7HA 3MC9A 4N6EB 2C7NB 3H7SA 2V1YA 3A9JB 1WRIA 2X8XX 2KACA 1WH3A 2SEBD 4JX1C 1YNTE 1WR1A 3B08A 2WU2B 1FD6A 2FIDA 4RGMA 5L83A 4P1BC 5H92C 4D2KA 1JMLA 3EC8A 4WWPA 2WXRA 2BT6A 2IO2B 3APDA 3TSSA 4MGIE 1UH6A 4KDLB 4BKSD 1VR9A 2ZNVB 3PSEB 2KNBA 2HJ8A 2EELA 1TKGA 1XCTL 4HDQA 2BS3B 1OQQA 1SSNA 2WNMA 2M1MA 3KUZA 4M01A 4C80A 1LGRA 4FLHA 4KKIA 2AQ1B 4KGSA 2LUMA 2XBBC 2J53A 2IZVB 3JYUA 3GZNB 2K5PA 2GOWA 4HVBA 3ZNZB 4GMVA 4MSMB 4WJQA 4MJSB 4PS7A 4MEMA 3DBHI 5IOIA 3NUHB 3M95A 3AE6B 1EO6A 2LI5A 2LRWA 1Q0WB 1WXVA 4MH8A 4HROA 4P6VF 1MPEA 2DAFA 2WDRB 4M00A 1NBFC 3PS6A 1WE6A 4M8NA 2KDEB 5FK9C 3RPFC 2LFIA 3LYYA 1E8ZA 2NBWB 4KDIC 2AYOB 2KKCA 3WIMA 1P3QU 3I3TB 3SU8X 3MFGA 1I4RA 3IG3A 3I57A 3N1XC 1OQYA 2UYZB 3N3KB 1T0QC 4ZRKA 3APCA 5JZEB 3P63A 1MG4A 3N9YC 2LHEA 3AE8B 1I4GA 2TSSA 4S0RA 4G3XB 3BVZA 2XN9C 3AE7B 4E71A 4C4VA 1J7BA 1HZ5A 2IDYA 3AEGB 3PLUA 2KWCA 2J0KA 4M02A 3H9DA 4DQOC 3FILA 3IVFA 2WU5B 2BKRB 2WXLA 1YD8U 3ENEA 3QJZA 4AP4C 2RPVA 4CO7A 2KJHB 1Z5SB 2W54A 4YXDB 2JVCA 3DBRI 2ZCCA 2DYOA 3GZNI 4IWOA 1F9JA 4K7WA 2KDMA 4ANWA 3FAHA 2DZJA 4JWSC 4EKUA 5BYRA 2CHXA 2WLBA 4W9IA 2C5LC 1UBIA 1F2RI 1FFVA 3GS2A 2KLGA 2M8SA 2AL3A 1XEEA 4AJWA 4A55A 2BYEA 3A9KB 3W5VB 1UF0A 4IM2A 2A5UA 2NBUA 3VDZA 4QAYA 3UQBA 4W9HA 4XX5A 1DOXA 4G11A 3AE5B 2FCSA 2WXNA 1VZ7A 3O13A 3QCAA 4LNIA 2M56B 3DOWA 2K6DB 3T3NA 4E74A 3ZRCA 1WYGA 3U7DA 3AULA 3PREA 2LRUA 2GBKA 1J19A 2OOBB 1ET6A 1N5WA 2CHZA 3DWMA 2OJRA 3MC8A 1BT0A 4NAWA 4RF1A 3MJWA 5CX3A 2BYVE 1E8WA 2Y5PA 2LWPA 1FPYA 4FXCA 4EOYA 3UF8A 1A70A 3ZGZA 3IXSA 1VRAB 4ASWC 1WWTA 1UGJA 1K8RB 5I4DA 1C4AA 4MDKE 1OQRA 2IGDA 5JHAA 1ACCA 4DHJB 2JWZA 3S2AA 2IY1B 2K8BA 1WZ0A 3VXWA 3PV1A 2JU6X 2ON8A 1E7UA 1Q5WB 1IUEA 3JW0X 1KLVA 4XDCA 2JRIB 4WWOA 2LJIA 1WRDB 2W82A 3VRBB 2L00B 1D6EC 5EE1A 3C8YA 2GMIC 1WGKA 2GRIA 4BKTA 1NENB 2PMVA 3HRDD 1EUVB 1WGHA 4GDLB 2KO3A 4NQKE 2MBBB 3TL5A 2O6VB 4XDDA 1CK1A 4WH4A 4ZRPA 4BBNF 2J42A 2BYFA 3B0AA 3ETRA 1QKZA 2MP2B 3APFA 4A20A 5FR6A 3P4RB 1FEHA 5JXVA 2IGHA 1WIAA 3PHWB 3VUXA 2QDFA 4ANUA 2DHZA 2MJEA 3RNFC 2Z8LA 2XEWA 2N7JA 3BINA 1Y56A 2V3PA 3QHTA 1LXDA 1KLGD 2V3NA 3LDZE 2N1VA 2C9WB 2ZCBA 1V8CA 2L05A 3HVZA 2GBJA 1VCBA 3WAMA 4ZRJA 4YTNB 1GC7A 3U4EG 3L4PA 3PO0A 1YJ1A 1NYQA 4JLCA 1R4MB 2LD9A 3NHEB 1WGRA 3PRZA 4HRSA 2JZ3B 3P42A 5CHVC 2WXOA 3QIJA 4JPSA 1TY2A 2IO0B 2KC1A 3RYTA 3MTNB 3BY4B 4NZLB 4TV3A 2RSUA 4G50A 3WA0A 4N9F4 2JRHA 2L52A 1F0ZA 4KGRA 4EUTA 1HA5A 1JWMD 2XK5B 2KDFB 4IM0A 5CTRC 1MI0A 3SFDB 2WXMA 2QHOA 1KFYB 3DQVA 2NPTA 3A33B 5EE0A 1DOYA 5E6PA 1G6JA 3WANA 1P98A 3A9JA 2BWFA 2N7EA 3E9SA 1C3TA 1JROA 2ZVNA 3H7PA 3V62A 5BMHA 5BO4B 4A8XC 2BGFA 4NQLB 5EDSA 2I2YA 1XLQA 1WJNA 4K3BA 2D5GA 4YSZB 4YL8A 5HFYA 3R7RA 1TKYA 4L2YA 4L1BA 4GSWA 1T0SC 3L17A 3K9OB 1FRDA 1ZGUB 3NZSA 4K7UA 4FBJB 2WHIA 3DBSA 1PDXA 1GG3A 2M19A 2Q5WD 4AQ7A 2NCNA 3P1MA 1JWUD 2WDVB 3URYA 1TZ1A 3KUDB 3RZWC 4GOCA 4FADA 1WF9A 2HE7A 2Y5BB 4RM9A 2LGIA 3ML8A 5D6JB 1L5PA 1WX8A 4IKGA 4Q2JA 4DHZB 2KVZA 1SEBD 2WXKA 4HKZE 3RNAC 1KJTA 1FCLA 2LZ6A 2MBEA 1VZ6A 1I42A 3ABVB 2BB6A 3DBLB 3NOBA 3PZDA 1P7EA 3VUYA 3RCZA 1CMXB 5IAAC 3L08A 2JSVX 3HIZA 2YLMA 4KIKA 5E6NA 2LGYA 2J0JA 1F77A 2C60A 3P4QB 5G2NA 2C7HA 3J9CA 1S1QB 1UUPA 4HCPB 3AEAB 4MELA 2LXAA 2RR9A 4RF0A 5KHQA 3BIID 2UWQA 2JYTA 3UIPB 3H1UA 2JY6A 2QIEB 4F7ZA 2L76A 1VLBA 3QWZB 3GE3C 2BW2A 1N60A 4HJGE 1EF1A 4WJOA 3FKYA 1JRPA 2L8JA 3Q3JA 3KH0A 1E10A 1WXQA 4AS1A 1F52A 2O2VA 3AI5A 1JQ4A 3KWLA 3B9JA 1HTQA 4HPLB 4AOFA 4NPNA 2BVCA 2G4DB 3R2TA 3HVDA 4FJVB 3RNBC 1R4MI 3GE8C 3FC4A 1AYFA 2BS2B 3C19A 1F1HA 2WXGA 3TJPA 4OVUA 3RUIB 3EECA 3AEBB 1WXSA 4W9EA 2AQ2B 2MX2A 1IBXA 3Q14C 1ZOYB 1TIFA 2N7DA 2H89B 2KMMA 1WI0A 4PS8A 2PPHA 1UZXB 1LM8B 3AU4A 3AECB 3RFZB 5C23A 3TIXA 1WXAA 2REXA 2I1KA 3WAOA 4WJNA 1OEYA 3Q3OC 5G5HA 4B6WA 2E3TA 1SF0A 3U52E 4K81A 1BUIC 3OLMD 1ZDVA 1WZ3A 2VZKD 1GAQB 2ZPNA 2KANA 3DWGC 1U4AA 2JPHA 4OHJA 3DBHB 3DCGA 3ECIA 2QC8A 3ZJUA 4KV2A 3UI3A 3KYDD 2DZIA 1EM7A 1WSPA 3KW5B 2V0GA 1M4VA 1GNUA 3OG5A 5J2RA 2X38A 3ZVVA 5LXHA 3H8HA 2SAKA 2AQ3B 4PYZA 2KK8A 2Z0EB 4C7ZA 4DXAB 1OFFA 4NJCA 1SE4A 1XD3B 2PEAA 2KOXA 2ZZPB 3AEEB 4LJOB 1ET9A 3DBRB 1YN5A 1QOAA 1TS4A 3CWIA 1MJDA 4HPMB 3Q2AC 3H7PB 2MLBA 1V1OA 3EGRA 5CHFA 5LLIA 2M0AA 4CHKA 1Q10A 4REZA 4AUQC 4KSKC 5AZGA 2J7QB 2KXJA 4YTPB 3UINB 2B3AA 1EU4A 2INCC 2MBQA 2KZRA 2WP9B 4WWMA 1HZ6A 5CHWA 1XLPA 1STEA 1KM7A 1JW9D 2KD0A 3GB1A 4RGNA 4G0NB 1XCQL 5D94A 3CSTA 1WJ4A 4BFRA 1QOFA 3PZ7A 1RLFA 4RFBA 2KWUB 3W2DA 1CQVA 1T5XD 2WXFA 2GBMA 5IN7A 2ZVOA 4WJPA 1FXAA 2KVRA 1TGZB 2JYEA 1DYQA 2L7RA 1C4PA 1WM3A 4ZRQA 1J0GA 4WWNA 1N6ZA 2WQYB 1R4NI 3HM6X 3AH7A 1A5RA 1K52A 1TJEA 2KWDA 1FXTB 1RFKA 4ICUA 2GBRA 4EFOA 4LCDE 4DHJD 1C4CA 4N59A 2AX5A 2VH2A 3X23A 1L0YB 4BKGA 2RDGA 1Q1OA 4OZAA 1K50A 2KTRA 4A6QA 3IT4B 3AE2B 3IBEA 4DDGD 4GIVA 3AEFB 3MC0B 2WX0A 1GB1A 4DXGA 4MGYE 4EEWA 2MEKA 3PPAA 1IBXB 4RH6A 2JXTA 3PRMB 2MCNB 1YQ3B 2Z0DB 3IFWB 2RDHA 2AL6A 3JSVB 1WGGA 4W9GA 3KLSX 2QJLA 1UGMA 2WDQB 3QX1A 3RZFA 2IGGA 3DHHC 2INDC 1N63A 2QMTA 3X0WA 4KX6B 3U2SC 4GB9A 4JQWC 5D3DA 5IKCM 3L0WB 3ZKJC 2DENB 1V5OA 4N58A 2FUHB 2LMCA 1PGAA 3MHZA 3VR8B 2Y5CA 2OJWA 3ZUNA 1XXGA 2LHDA 4XC2A 1HE8A 4BOZB 4MM3B 1LQBA 1ZP0B 2MWSB 4KKJA 1OGWA 2N4FA 4USAA 3CSFA 4XWTA 1C79A 3Q69A 2DZKA 1R4NB 1WM2A 1EWYC 3MP9A 2IY0B 2MRPA 5BYSA 3N1YC 2G3QB 2V3SA 4FA6A 4BAXA 3ZNGC 4HCNB 2CJNA 1JRUA 3Q8EA 1KOTA 3SEBA 3IHPC 3SDLC 3AV8A 4GXBA 3R3MA 1UBQA 4W9FA 1WJUA 2LGDA 4B95A 4JE3B 1I4HA 2RD0A 1E9MA 3NVZA 4MGZE 4PYUA 5LXIB 3NY5A 2O2VB 3ZTCA 2HJ1A 1WE7A 3FILB 3AXCA 5TR5A 1FM0D 4ANVA 1E8YA 3KQ4A 2R2OA 4A90A 1FIQA 3WAPA 5C1ZA 3ML9A 1N5XA 4LNFA 3T3OA 1V81A 2BS4B 1ZDXA 4JGHB 2CS4A 2EKEC 1Z2MA 4M8MA 1V9JA 4OVVA 4WIPA 4OW0A 4LJPB 2NTTA 3U30A 4GN1A 3TCAA 4HLEA 5MPOA 1PFDA 1RYJA 3AE1B 4A3OA 2N9KA 1BXTA 2D11A 4KZCA 4P7IA 3CMMB 4BZAA 1V5TA 2PJHA 3M63B 3CIRB 4CQNA 4FHJA 1M94A 1WJ6A 2PE6B 1EF5A 1LFDA 3EFUA 4XGAB 1SJED 4C4VB 4F8CB 2DAJA 1TBEA 1MVKA 2DZMA 2H88B 5H8YE 2NBVB 3A4SC 4J3OD 4II3B 1NEKB 2PE9A 1ZE3D 2O6VD 3PVLA 1L0VB 2N9XA 1TZOA 2EMTA 3HHMA 2ONQA 4JIOU 1K51A 4NNJB 1E8XA 4MGKE 4IWQA 3QAQA 3HM3A 3RD2A 4IUMB 4LTUA 4FJZA 3RNCC 1UNSA 1P9DU 2QCZA 4PK1A 3LJ3A 1LO5D 1YQBA 3V6EB 2QEJC 3AE4B 2CHWA 2ZW1A 2MQJA 1J7AA 1ZPSA 1GUAB 1JWAD 3OAWA 4S17A 1DOIA 3MHSD 2M0XA 4K1RB 3WCQA 2CKHB 3GP7A 3T9LA 1ZXHA 4RGTA 3A1QB 3ZDMC 3AN1A 3ZYYX 4ZRIA 1SE9A 3Q8FA 1YN4A 2K6QA 2KN5A 2DYMA 2IYDB 4MJSA 2BWES 4HDOA 1B9RA 3N30A 3DPDA 2JX5A 4IDIA 4XWWA 3CF6E 4EZLA 1BMLC 1ZUD2 2BB5A 4XZ4A 2D07B 2KFKB 3SR6A 2ASQA 2K0PA 2L3ZA 4GDKB 3JSVA 1PYWD 1MHHE 5AUKA 5E6OA 2ZNVC 4H2AA 1L4ZB 2LVOA 2YEPF 3VTUA 3W9CB 4C7YA 2MH7A 1NYRA 2EKIA 4B0EA 1AN8A 2KJ6A 2J4XA 1YX5B 4M0WB 4O1NA 3D32A 1UWMA 3TEWA 2IO3B 1V97A 1NI3A 4FN2A 3QARA 1FFUA 2CU3A 4US8A 4WAAA 3ZLZA 3IAM1 3VR9B 2RDBC 3VQIA 3ZJTA 4TMAB 2LEKA 1SIFA 3ZJVA 1YOVB 1YJIA 5J17A 2W3SA 2AWTA 2N9EB 1WY8A 2KAJA 2ZPYA 2XK5A 4LDTB 1ISNA 5AZHA 5IO9A 2KJRA 4HJKA 5HHDG 1VJKA 4MSQB 5C2TB 1HXYD 1PUTA 1AWDA 2FE8A 5HKHA 2W9NA 1I4PA 1R7SA 2BBCA 4TUUA 4OVZA 3ZNHB 1H4RA 4X57B 3AMZA 3RULA 4JWUC 1YJJA 4GDLA 4W9LA 2K1FA 2NPTB 3V6CB 2OHFA 1FXIA 1XLNA 3I5JC 2C7MB 2KN4A 2RPQA 1L6VA 3VH4B 5LNK1 1NVID 2KC2A 3KVFB 2BPSA 3NS8A 4BKSA 4DXFA 1HEZE 3EA6A 2PIAA 3IAS1 1VDVA 4PS3A 4A9AA 1AW7A 1KLUD 2MBOA 3V60A 1ZXIA 2JT4B 3DVGY 3M3JA 1I35A 3VTVA 4B0MA 3VHTC 2G4SA 3ALBA 1P0RA 3BK1A 3ZNID 4FHKA 4KGTA 2L1AA 1FCCC 3L13A 4LNKA 3NS1A 1ZW7A 2I1JA 1SBBB 1E5WA 2RMMA 4HK2A 1T0RC 1TS5A 1C9FA 1WMHB 1C78A 4GGQA 4ZYSA 4HKQA 2W3RA 4IW0A 3AM9A 3NJTA 1FMAD 1TYGB 2PLPA 4TQ1A 4ZDVA 4ACFA 2GLSA 3TBLD 3A9KA 1EWCA 1XT9B 2D2QA 2D3AA 1QLBB 3PHXB 2PW9A 2LVPA 4E3CA 1IYFA 3LXFA 1H8CA 2VRRB 1HQRD 1YN3A 2JZPA 1RWSA 4ZOHC 3UQAA 2ZW0A 1D3ZA 2IBIB 2IJ0A 2E6XA 2LJ5A 2D3GA 4TQ0A 1P7FA 2L0FA 2MJDA 1OEYJ 3BZDB 4II2B 1E6EB 3P2BA 2PVGC 4URKA 1SE3A 4US9A 4ICVA 3PZ8A 2NMQA 3OJ3A 4F1SA 2ZJDA 4NAMA 3Q3MC 1KF6B 4LK0M 1J7CA 4R3DA 3RMKC 1IGDA 2KX0A 1GB4A 4W9DA 1VD2A 4OZCA 2NVUI 1KRHA 2D3BA 2HTME 1FNUA 4WQOB 3RN9C 3HUIA 2WYQA 3KWVA 4MACA 3OJ4B 3W1SC 2DBYA 4W9CA 1C76A 5TSSA 1DGJA 1XQQA 4M0WA 1IP9A 2LGSA 1FRRA 5GXGB 3NG0A 3Q8CA 1TT5B 1Y8RC 3VTWA 3Q3FA 5J18A 3I9V1 3RNEC 3EFCA 1WGYA 1FNVA 1JWSD 3VUWA 1E7VA 2DX5B 1IPGA 2K39A 1L7YA 2LVQA 3T8MA 2A4ZA 2EMSA 4RMAA 4RNAA 2KMCA 2XNAC 2AEHA 1L4DB 1S3SG 4LLGM 2D3CA
chains in the Genus database with same CATH topology
3U30A 4GN1A 3TCAA 4HLEA 3KUDB 2CR5A 5GMVA 4A3OA 1J8CA 3RZWC 1YX6B 4GOCA 4FADA 1WF9A 2HE7A 2Y5BB 4RM9A 5D2MB 3B1LX 3QA8A 4MH0E 3ML8A 2D11A 2MP2A 5D6JB 4W9JA 1WX8A 2KDBA 4DHZB 2C7NB 3H7SA 4KZCA 2V1YA 2KQSA 1WX9A 3A9JB 4P7IA 3KYCD 3CMMB 1WH3A 1KJTA 1V5TA 2D10A 2PJHA 3M63B 5IA7A 2LZ6A 3B08A 1WR1A 4FHJA 2MBEA 4CYEA 1I42A 2FIDA 4I6LB 1M94A 5L83A 1WJ6A 2PE6B 3NOBA 3PZDA 1EF5A 1LFDA 3VUYA 3EFUA 3EC8A 4WWPA 4F8CB 2IO2B 3APDA 3RCZA 1CMXB 2DAJA 4KSLC 4MGIE 1TBEA 2DZMA 3L08A 1UH6A 3HIZA 5IAAC 2NBVB 4KDLB 4BKSD 2YLMA 3A4SC 5JHBA 4FJYA 1RFAA 4II3B 2LGYA 4KIKA 2ZNVB 5E6NA 2PE9A 3PSEB 2J0JA 2C60A 2O6VD 4DWFA 2KNBA 3PVLA 4JL9A 2HJ8A 3JVZX 3ZDTA 5G2NA 2C7HA 4FULA 4IM3A 4A3PA 2MBHA 2N9XA 1S1QB 2KDIA 4HCPB 4HDQA 4IWPA 2EMTA 3AU5A 4MELA 2LXAA 2M1MA 3KUZA 3HHMA 2RR9A 3R66C 4JIOU 5D7GA 4FLHA 4NNJB 1E8XA 5KHQA 4MGKE 3ZW3A 2LXCA 2UWQA 3QAQA 4IWQA 3HM3A 2XBBC 4IUMB 3RD2A 3PTFC 2FIFA 5DPSA 3UIPB 2IZVB 3R7QA 3DBLI 3H1UA 2KFKA 2JY6A 2KX3A 3JYUA 4F7ZA 2L76A 4FJZA 1V2YA 3VAWA 1P9DU 3QWZB 2GOWA 4HVBA 3ZNZB 3LJ3A 1EF1A 1YQBA 4I6NB 4WJOA 2WWZA 2M17A 4GMVA 4MSMB 3WALA 4WJQA 4MJSB 4PS7A 3DVNV 4ZYNA 2L8JA 4MEMA 3W1YA 3DBHI 1L2NA 3V6EB 3Q3JA 3M95A 3KH0A 1EO6A 1V6EA 2LI5A 1OTRB 2CHWA 2KTRB 2LRWA 3ZRFA 1Q0WB 1WXVA 2MQJA 1GUAB 2DAFA 2O2VA 3OAWA 3AI5A 1NBFC 4BVUC 3PS6A 4HPLB 1WE6A 4M8NA 2KDEB 4AOFA 3MHSD 4ANXA 4NPNA 4GU2A 2M0XA 4K1RB 2G4DB 4FJVB 1E8ZA 1R4MI 2CKHB 3ONSA 2NBWB 3L16A 4KDIC 3GOEA 2AYOB 2V4LA 2KKCA 3T9LA 1P3QU 3WIMA 1MG8A 3TJPA 4OVUA 3RUIB 3A1QB 3EECA 1WXSA 2KHWB 3I3TB 2ZEQA 4W9EA 5DCNA 3ZDMC 2MX2A 3SU8X 3IG3A 3RT3B 4ZRIA 1SE9A 5DPWA 1OQYA 2UYZB 3VH3B 3N3KB 4ZRKA 2N7DA 2K6QA 2KN5A 2DYMA 3APCA 5JZEB 2IYDB 4HWIB 2K8HA 4MJSA 4W9KA 4K7SA 1WI0A 2BWES 3EHVA 4HDOA 4PS8A 2PPHA 3N30A 1NDDA 1UZXB 3DPDA 1LM8B 4BBNC 4G3XB 3CF6E 4E71A 3AU4A 4XZ4A 2IO1B 4EZLA 2K8CA 5C23A 3TIXA 1WXAA 2D07B 2I1KA 2KFKB 2REXA 3WAOA 2ASQA 4AWJA 2L3ZA 4WJNA 1OEYA 4GDKB 4B6WA 3JSVA 3PLUA 2KWCA 2J0KA 3H9DA 2FCQA 4K81A 3W1SA 2WDTB 3A4RA 5E6OA 2ZNVC 3IVFA 2KWVB 2BKRB 3OLMD 1YD8U 2LVOA 3VTUA 3ENEA 3QJZA 2KMAA 4EZKA 4AP4C 1WZ3A 4CO7A 2ZPNA 2KANA 1Z5SB 2KJHB 1U4AA 2JPHA 2KJ6A 3DCGA 3ECIA 1YX5B 4M0WB 2O6VA 4KV2A 2JVCA 3DBRI 2ZCCA 2DYOA 3GZNI 3D32A 4IWOA 4NJ7A 1F9JA 3KYDD 4KIKB 2DZIA 4K7WA 2WX1A 4ANWA 2IO3B 2DZJA 3KW5B 2KQ7A 3HK0A 5JH5C 4FN2A 4EKUA 3QARA 2CHXA 4IG7B 4W9IA 2C5LC 1UBIA 4WAAA 3ZLZA 1GNUA 2KLGA 5J2RA 2M8SA 3VQIA 3ZVVA 2AL3A 5LXHA 4AJWA 3DVNU 2N1WA 2BYEA 1SIFA 3A9KB 4PYZA 3O65B 2KK8A 4IM2A 2A5UA 2NBUA 2Z0EB 3VFKA 5J17A 3VDZA 4DXAB 2AWTA 2N9EB 4DHZE 1X1MA 4W9HA 3UQBA 4XX5A 4KZ0A 4G11A 1AARA 2FCSA 1WY8A 2YVCA 3K9PB 1XD3B 2PEAA 2KOXA 2XK5A 2ZPYA 2ZZPB 3M62B 1ISNA 3QCAA 4LDTB 5AZHA 4LJOB 2LGXA 2KJRA 4HJKA 3NZUA 4MM3A 4EZJA 3DOWA 2K6DB 4MSQB 1E90A 4E74A 3ZRCA 5HKHA 2W9NA 3U7DA 4HPMB 3AULA 3PREA 3L10B 3H7PB 4DK5A 2LRUA 2MLBA 4TUUA 1V86A 2GBKA 2MW5A 1J19A 1YIWA 5CHFA 1V80A 5LLIA 3ZNHB 2OOBB 2CHZA 4NAWA 2M4NA 1H4RA 2OJRA 1BT0A 3MJWA 4X57B 5CX3A 2BYVE 2JF5A 3RULA 1E8WA 2LWPA 4CHKA 4EOYA 3UF8A 4AUQC 4KSKC 4GDLA 4W9LA 5AZGA 2K1FA 2J7QB 2NPTB 2KXJA 1WR6E 3V6CB 4ASWC 5DPTA 1K8RB 3UINB 2JZZA 4DBGA 2B3AA 3C0RB 2C7MB 4MDKE 1QZEA 2RPQA 2FNJB 5JHAA 2MBQA 1V49A 4NY0A 2KZRA 4DHJB 2JWZA 4NAWB 2FCMA 3S2AA 3VH4B 2IY1B 2K8BA 2NS5A 1WZ0A 5CHWA 2KC2A 3KVFB 3VVWB 2BPSA 3NS8A 3SD5A 3VXWA 3PV1A 3DVGX 1KM7A 3SHQA 4BKSA 2KD0A 1C1YB 3DDCB 1E7UA 1Q5WB 3JW0X 4G0NB 5D94A 1KLVA 3CSTA 2JRIB 2R2QA 1WFYA 4WWOA 2MA9B 1WJ4A 4PS3A 2BKFA 4BFRA 1WRDB 2MBOA 2BF8B 2L00B 1RLFA 3V60A 2KWUB 2JT4B 3DVGY 2GMIC 2GBMA 2ZVOA 3M3JA 4WJPA 1I35A 1WMHA 4BKTA 3PT2B 3VTVA 1EUVB 1WGHA 4GDLB 2KO3A 2G4SA 3VHTC 2KVRA 3ALBA 1TGZB 4IC7B 4NQKE 1P0RA 2MBBB 3ZNID 4KVGB 2L7RA 2O6VB 4FHKA 3TL5A 1WM3A 2GBNA 1J0GA 3ZTDA 4WWNA 2FAZA 4BBNF 2BYFA 3B0AA 2MP2B 3APFA 1R4NI 4A20A 3HM6X 5FR6A 1A5RA 1WIAA 3L13A 1UD7A 1FXTB 3PHWB 3VUXA 1ZW7A 4ANUA 2DHZA 2I1JA 4ICUA 2GBRA 4EFOA 4LCDE 1E5WA 2XEWA 4DHJD 2FCNA 5L95C 2CU1A 4HK2A 1WMHB 4GGQA 3BINA 3X23A 2LUEA 4BKGA 3QHTA 1TTNA 1ZKHA 1LXDA 1Q1OA 3PLVA 4IW0A 3LDZE 3QC8B 2KTRA 2N1VA 2C9WB 2ZCBA 2L05A 4TQ1A 4ZDVA 2GBJA 3IBEA 1VCBA 3WAMA 4DDGD 3U8ZA 4ZRJA 4GIVA 3QQ8B 2WX0A 3TBLD 3PGEA 3A9KA 1GC7A 4MGYE 1XT9B 2D2QA 4EEWA 3PPAA 1WX7A 1YJ1A 3PHXB 4HXDA 2LVPA 4JLCA 4E3CA 3PRMB 2Z59B 2MCNB 2LD9A 2Z0DB 1IYFA 3NHEB 3IFWB 1H8CA 1WGRA 3PRZA 2AL6A 2L0TA 3JSVB 1WGGA 2VRRB 2JZ3B 4W9GA 5CHVC 3RZFA 1UGMA 3QX1A 3UGBB 3QIJA 3UQAA 2HD5B 2IO0B 3X0WA 2KC1A 3RYTA 1D3ZA 2IBIB 3MTNB 1NI2A 3BY4B 2LJ5A 4GB9A 2D3GA 4TV3A 4JQWC 4TQ0A 2KFJA 2JXXA 2RSUA 4G50A 3WA0A 4N9F4 2L0FA 2JRHA 1P1AA 3L0WB 3ZKJC 1OEYJ 1T0YA 2DENB 4II2B 1V5OA 3P2BA 4EUTA 2KLCA 4B9KA 2FUHB 4URKA 4AJYB 4LDTD 2XK5B 3A1QA 4ICVA 2KDFB 3ZUNA 2RGFA 3OJ3A 4IM0A 4F1SA 2G45B 2ZJDA 4XC2A 5CTRC 1HE8A 4BOZB 2JUOA 1LQBA 5AEKB 3UIOB 2LASA 2MWSB 1WGDA 1OGWA 2QHOA 2N4FA 3V61A 3DQVA 2NPTA 1SGHA 1UELA 2KX0A 3A33B 3KUCB 5E6PA 4W9DA 2NR2A 1G6JA 3CSFA 1VD2A 2NVUI 2HTHA 3WANA 2DZKA 1P98A 1WM2A 3A9JA 2BWFA 4NJ6A 4WQOB 3ZIMA 2N7EA 1C3TA 2ZVNA 3H7PA 3V62A 2IY0B 4J6IA 2MRPA 5BO4B 2WYQA 2G3QB 2V3SA 3OJ4B 4FA6A 3ZNGC 4HCNB 1JRUA 3W1SC 2BGFA 1KOTA 4NQLB 4W9CA 5AZFA 5EDSA 3IHPC 3SDLC 4BOSC 4DDID 1XQQA 4GXBA 3R3MA 3ZO5B 1UBQA 4W9FA 1WJNA 1RRBA 1WJUA 2MSED 2LGDA 4B95A 4YL8A 1IP9A 2RD0A 4MGZE 4PYUA 5LXIB 3NY5A 1Y8RC 2O2VB 3R7RA 2J0MA 3VTWA 1PQSA 3Q3FA 3ZTCA 5J18A 1WE7A 4GSWA 2N9PC 3L17A 3L54A 3AXCA 3K9OB 5TR5A 4RM8A 1WGYA 3H6NA 1ZGUB 2KTFA 1GC6A 3NZSA 3PRPB 4K7UA 4TKNA 4FBJB 3VUWA 3N32A 1E7VA 2DX5B 4ANVA 2K25A 1E8YA 1IPGA 4I6PA 3DBSA 2R2OA 1GG3A 5DPRA 2K39A 1WXMA 1L7YA 2LVQA 3WAPA 5C1ZA 2NCNA 3ML9A 3T8MA 2A4ZA 2EMSA 1GJZA 3TMPB 4GDKA 4RMAA 1V81A 3QK0A 2KMCA 4JGHB 2CS4A 1RAXA 2DYBA 1WYWB 1Z2MA 1V9JA 2AEHA 2EKEC 4M8MA 4OVVA 1S3SG 5G55A 1TZ1A 5KHOA 4LJPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U30 A;  4GN1 A;  3TCA A;  4HLE A;  3KUD B;  2CR5 A;  5GMV A;  4A3O A;  1J8C A;  3RZW C;  1YX6 B;  4GOC A;  4FAD A;  1WF9 A;  2HE7 A;  2Y5B B;  4RM9 A;  5D2M B;  3B1L X;  3QA8 A;  4MH0 E;  3ML8 A;  2D11 A;  2MP2 A;  5D6J B;  4W9J A;  1WX8 A;  2KDB A;  4DHZ B;  2C7N B;  3H7S A;  4KZC A;  2V1Y A;  2KQS A;  1WX9 A;  3A9J B;  4P7I A;  3KYC D;  3CMM B;  1WH3 A;  1KJT A;  1V5T A;  2D10 A;  2PJH A;  3M63 B;  5IA7 A;  2LZ6 A;  3B08 A;  1WR1 A;  4FHJ A;  2MBE A;  4CYE A;  1I42 A;  2FID A;  4I6L B;  1M94 A;  5L83 A;  1WJ6 A;  2PE6 B;  3NOB A;  3PZD A;  1EF5 A;  1LFD A;  3VUY A;  3EFU A;  3EC8 A;  4WWP A;  4F8C B;  2IO2 B;  3APD A;  3RCZ A;  1CMX B;  2DAJ A;  4KSL C;  4MGI E;  1TBE A;  2DZM A;  3L08 A;  1UH6 A;  3HIZ A;  5IAA C;  2NBV B;  4KDL B;  4BKS D;  2YLM A;  3A4S C;  5JHB A;  4FJY A;  1RFA A;  4II3 B;  2LGY A;  4KIK A;  2ZNV B;  5E6N A;  2PE9 A;  3PSE B;  2J0J A;  2C60 A;  2O6V D;  4DWF A;  2KNB A;  3PVL A;  4JL9 A;  2HJ8 A;  3JVZ X;  3ZDT A;  5G2N A;  2C7H A;  4FUL A;  4IM3 A;  4A3P A;  2MBH A;  2N9X A;  1S1Q B;  2KDI A;  4HCP B;  4HDQ A;  4IWP A;  2EMT A;  3AU5 A;  4MEL A;  2LXA A;  2M1M A;  3KUZ A;  3HHM A;  2RR9 A;  3R66 C;  4JIO U;  5D7G A;  4FLH A;  4NNJ B;  1E8X A;  5KHQ A;  4MGK E;  3ZW3 A;  2LXC A;  2UWQ A;  3QAQ A;  4IWQ A;  3HM3 A;  2XBB C;  4IUM B;  3RD2 A;  3PTF C;  2FIF A;  5DPS A;  3UIP B;  2IZV B;  3R7Q A;  3DBL I;  3H1U A;  2KFK A;  2JY6 A;  2KX3 A;  3JYU A;  4F7Z A;  2L76 A;  4FJZ A;  1V2Y A;  3VAW A;  1P9D U;  3QWZ B;  2GOW A;  4HVB A;  3ZNZ B;  3LJ3 A;  1EF1 A;  1YQB A;  4I6N B;  4WJO A;  2WWZ A;  2M17 A;  4GMV A;  4MSM B;  3WAL A;  4WJQ A;  4MJS B;  4PS7 A;  3DVN V;  4ZYN A;  2L8J A;  4MEM A;  3W1Y A;  3DBH I;  1L2N A;  3V6E B;  3Q3J A;  3M95 A;  3KH0 A;  1EO6 A;  1V6E A;  2LI5 A;  1OTR B;  2CHW A;  2KTR B;  2LRW A;  3ZRF A;  1Q0W B;  1WXV A;  2MQJ A;  1GUA B;  2DAF A;  2O2V A;  3OAW A;  3AI5 A;  1NBF C;  4BVU C;  3PS6 A;  4HPL B;  1WE6 A;  4M8N A;  2KDE B;  4AOF A;  3MHS D;  4ANX A;  4NPN A;  4GU2 A;  2M0X A;  4K1R B;  2G4D B;  4FJV B;  1E8Z A;  1R4M I;  2CKH B;  3ONS A;  2NBW B;  3L16 A;  4KDI C;  3GOE A;  2AYO B;  2V4L A;  2KKC A;  3T9L A;  1P3Q U;  3WIM A;  1MG8 A;  3TJP A;  4OVU A;  3RUI B;  3A1Q B;  3EEC A;  1WXS A;  2KHW B;  3I3T B;  2ZEQ A;  4W9E A;  5DCN A;  3ZDM C;  2MX2 A;  3SU8 X;  3IG3 A;  3RT3 B;  4ZRI A;  1SE9 A;  5DPW A;  1OQY A;  2UYZ B;  3VH3 B;  3N3K B;  4ZRK A;  2N7D A;  2K6Q A;  2KN5 A;  2DYM A;  3APC A;  5JZE B;  2IYD B;  4HWI B;  2K8H A;  4MJS A;  4W9K A;  4K7S A;  1WI0 A;  2BWE S;  3EHV A;  4HDO A;  4PS8 A;  2PPH A;  3N30 A;  1NDD A;  1UZX B;  3DPD A;  1LM8 B;  4BBN C;  4G3X B;  3CF6 E;  4E71 A;  3AU4 A;  4XZ4 A;  2IO1 B;  4EZL A;  2K8C A;  5C23 A;  3TIX A;  1WXA A;  2D07 B;  2I1K A;  2KFK B;  2REX A;  3WAO A;  2ASQ A;  4AWJ A;  2L3Z A;  4WJN A;  1OEY A;  4GDK B;  4B6W A;  3JSV A;  3PLU A;  2KWC A;  2J0K A;  3H9D A;  2FCQ A;  4K81 A;  3W1S A;  2WDT B;  3A4R A;  5E6O A;  2ZNV C;  3IVF A;  2KWV B;  2BKR B;  3OLM D;  1YD8 U;  2LVO A;  3VTU A;  3ENE A;  3QJZ A;  2KMA A;  4EZK A;  4AP4 C;  1WZ3 A;  4CO7 A;  2ZPN A;  2KAN A;  1Z5S B;  2KJH B;  1U4A A;  2JPH A;  2KJ6 A;  3DCG A;  3ECI A;  1YX5 B;  4M0W B;  2O6V A;  4KV2 A;  2JVC A;  3DBR I;  2ZCC A;  2DYO A;  3GZN I;  3D32 A;  4IWO A;  4NJ7 A;  1F9J A;  3KYD D;  4KIK B;  2DZI A;  4K7W A;  2WX1 A;  4ANW A;  2IO3 B;  2DZJ A;  3KW5 B;  2KQ7 A;  3HK0 A;  5JH5 C;  4FN2 A;  4EKU A;  3QAR A;  2CHX A;  4IG7 B;  4W9I A;  2C5L C;  1UBI A;  4WAA A;  3ZLZ A;  1GNU A;  2KLG A;  5J2R A;  2M8S A;  3VQI A;  3ZVV A;  2AL3 A;  5LXH A;  4AJW A;  3DVN U;  2N1W A;  2BYE A;  1SIF A;  3A9K B;  4PYZ A;  3O65 B;  2KK8 A;  4IM2 A;  2A5U A;  2NBU A;  2Z0E B;  3VFK A;  5J17 A;  3VDZ A;  4DXA B;  2AWT A;  2N9E B;  4DHZ E;  1X1M A;  4W9H A;  3UQB A;  4XX5 A;  4KZ0 A;  4G11 A;  1AAR A;  2FCS A;  1WY8 A;  2YVC A;  3K9P B;  1XD3 B;  2PEA A;  2KOX A;  2XK5 A;  2ZPY A;  2ZZP B;  3M62 B;  1ISN A;  3QCA A;  4LDT B;  5AZH A;  4LJO B;  2LGX A;  2KJR A;  4HJK A;  3NZU A;  4MM3 A;  4EZJ A;  3DOW A;  2K6D B;  4MSQ B;  1E90 A;  4E74 A;  3ZRC A;  5HKH A;  2W9N A;  3U7D A;  4HPM B;  3AUL A;  3PRE A;  3L10 B;  3H7P B;  4DK5 A;  2LRU A;  2MLB A;  4TUU A;  1V86 A;  2GBK A;  2MW5 A;  1J19 A;  1YIW A;  5CHF A;  1V80 A;  5LLI A;  3ZNH B;  2OOB B;  2CHZ A;  4NAW A;  2M4N A;  1H4R A;  2OJR A;  1BT0 A;  3MJW A;  4X57 B;  5CX3 A;  2BYV E;  2JF5 A;  3RUL A;  1E8W A;  2LWP A;  4CHK A;  4EOY A;  3UF8 A;  4AUQ C;  4KSK C;  4GDL A;  4W9L A;  5AZG A;  2K1F A;  2J7Q B;  2NPT B;  2KXJ A;  1WR6 E;  3V6C B;  4ASW C;  5DPT A;  1K8R B;  3UIN B;  2JZZ A;  4DBG A;  2B3A A;  3C0R B;  2C7M B;  4MDK E;  1QZE A;  2RPQ A;  2FNJ B;  5JHA A;  2MBQ A;  1V49 A;  4NY0 A;  2KZR A;  4DHJ B;  2JWZ A;  4NAW B;  2FCM A;  3S2A A;  3VH4 B;  2IY1 B;  2K8B A;  2NS5 A;  1WZ0 A;  5CHW A;  2KC2 A;  3KVF B;  3VVW B;  2BPS A;  3NS8 A;  3SD5 A;  3VXW A;  3PV1 A;  3DVG X;  1KM7 A;  3SHQ A;  4BKS A;  2KD0 A;  1C1Y B;  3DDC B;  1E7U A;  1Q5W B;  3JW0 X;  4G0N B;  5D94 A;  1KLV A;  3CST A;  2JRI B;  2R2Q A;  1WFY A;  4WWO A;  2MA9 B;  1WJ4 A;  4PS3 A;  2BKF A;  4BFR A;  1WRD B;  2MBO A;  2BF8 B;  2L00 B;  1RLF A;  3V60 A;  2KWU B;  2JT4 B;  3DVG Y;  2GMI C;  2GBM A;  2ZVO A;  3M3J A;  4WJP A;  1I35 A;  1WMH A;  4BKT A;  3PT2 B;  3VTV A;  1EUV B;  1WGH A;  4GDL B;  2KO3 A;  2G4S A;  3VHT C;  2KVR A;  3ALB A;  1TGZ B;  4IC7 B;  4NQK E;  1P0R A;  2MBB B;  3ZNI D;  4KVG B;  2L7R A;  2O6V B;  4FHK A;  3TL5 A;  1WM3 A;  2GBN A;  1J0G A;  3ZTD A;  4WWN A;  2FAZ A;  4BBN F;  2BYF A;  3B0A A;  2MP2 B;  3APF A;  1R4N I;  4A20 A;  3HM6 X;  5FR6 A;  1A5R A;  1WIA A;  3L13 A;  1UD7 A;  1FXT B;  3PHW B;  3VUX A;  1ZW7 A;  4ANU A;  2DHZ A;  2I1J A;  4ICU A;  2GBR A;  4EFO A;  4LCD E;  1E5W A;  2XEW A;  4DHJ D;  2FCN A;  5L95 C;  2CU1 A;  4HK2 A;  1WMH B;  4GGQ A;  3BIN A;  3X23 A;  2LUE A;  4BKG A;  3QHT A;  1TTN A;  1ZKH A;  1LXD A;  1Q1O A;  3PLV A;  4IW0 A;  3LDZ E;  3QC8 B;  2KTR A;  2N1V A;  2C9W B;  2ZCB A;  2L05 A;  4TQ1 A;  4ZDV A;  2GBJ A;  3IBE A;  1VCB A;  3WAM A;  4DDG D;  3U8Z A;  4ZRJ A;  4GIV A;  3QQ8 B;  2WX0 A;  3TBL D;  3PGE A;  3A9K A;  1GC7 A;  4MGY E;  1XT9 B;  2D2Q A;  4EEW A;  3PPA A;  1WX7 A;  1YJ1 A;  3PHX B;  4HXD A;  2LVP A;  4JLC A;  4E3C A;  3PRM B;  2Z59 B;  2MCN B;  2LD9 A;  2Z0D B;  1IYF A;  3NHE B;  3IFW B;  1H8C A;  1WGR A;  3PRZ A;  2AL6 A;  2L0T A;  3JSV B;  1WGG A;  2VRR B;  2JZ3 B;  4W9G A;  5CHV C;  3RZF A;  1UGM A;  3QX1 A;  3UGB B;  3QIJ A;  3UQA A;  2HD5 B;  2IO0 B;  3X0W A;  2KC1 A;  3RYT A;  1D3Z A;  2IBI B;  3MTN B;  1NI2 A;  3BY4 B;  2LJ5 A;  4GB9 A;  2D3G A;  4TV3 A;  4JQW C;  4TQ0 A;  2KFJ A;  2JXX A;  2RSU A;  4G50 A;  3WA0 A;  4N9F 4;  2L0F A;  2JRH A;  1P1A A;  3L0W B;  3ZKJ C;  1OEY J;  1T0Y A;  2DEN B;  4II2 B;  1V5O A;  3P2B A;  4EUT A;  2KLC A;  4B9K A;  2FUH B;  4URK A;  4AJY B;  4LDT D;  2XK5 B;  3A1Q A;  4ICV A;  2KDF B;  3ZUN A;  2RGF A;  3OJ3 A;  4IM0 A;  4F1S A;  2G45 B;  2ZJD A;  4XC2 A;  5CTR C;  1HE8 A;  4BOZ B;  2JUO A;  1LQB A;  5AEK B;  3UIO B;  2LAS A;  2MWS B;  1WGD A;  1OGW A;  2QHO A;  2N4F A;  3V61 A;  3DQV A;  2NPT A;  1SGH A;  1UEL A;  2KX0 A;  3A33 B;  3KUC B;  5E6P A;  4W9D A;  2NR2 A;  1G6J A;  3CSF A;  1VD2 A;  2NVU I;  2HTH A;  3WAN A;  2DZK A;  1P98 A;  1WM2 A;  3A9J A;  2BWF A;  4NJ6 A;  4WQO B;  3ZIM A;  2N7E A;  1C3T A;  2ZVN A;  3H7P A;  3V62 A;  2IY0 B;  4J6I A;  2MRP A;  5BO4 B;  2WYQ A;  2G3Q B;  2V3S A;  3OJ4 B;  4FA6 A;  3ZNG C;  4HCN B;  1JRU A;  3W1S C;  2BGF A;  1KOT A;  4NQL B;  4W9C A;  5AZF A;  5EDS A;  3IHP C;  3SDL C;  4BOS C;  4DDI D;  1XQQ A;  4GXB A;  3R3M A;  3ZO5 B;  1UBQ A;  4W9F A;  1WJN A;  1RRB A;  1WJU A;  2MSE D;  2LGD A;  4B95 A;  4YL8 A;  1IP9 A;  2RD0 A;  4MGZ E;  4PYU A;  5LXI B;  3NY5 A;  1Y8R C;  2O2V B;  3R7R A;  2J0M A;  3VTW A;  1PQS A;  3Q3F A;  3ZTC A;  5J18 A;  1WE7 A;  4GSW A;  2N9P C;  3L17 A;  3L54 A;  3AXC A;  3K9O B;  5TR5 A;  4RM8 A;  1WGY A;  3H6N A;  1ZGU B;  2KTF A;  1GC6 A;  3NZS A;  3PRP B;  4K7U A;  4TKN A;  4FBJ B;  3VUW A;  3N32 A;  1E7V A;  2DX5 B;  4ANV A;  2K25 A;  1E8Y A;  1IPG A;  4I6P A;  3DBS A;  2R2O A;  1GG3 A;  5DPR A;  2K39 A;  1WXM A;  1L7Y A;  2LVQ A;  3WAP A;  5C1Z A;  2NCN A;  3ML9 A;  3T8M A;  2A4Z A;  2EMS A;  1GJZ A;  3TMP B;  4GDK A;  4RMA A;  1V81 A;  3QK0 A;  2KMC A;  4JGH B;  2CS4 A;  1RAX A;  2DYB A;  1WYW B;  1Z2M A;  1V9J A;  2AEH A;  2EKE C;  4M8M A;  4OVV A;  1S3S G;  5G55 A;  1TZ1 A;  5KHO A;  4LJP B; 
#chains in the Genus database with same CATH topology
 4YSX B;  2CR5 A;  5GMV A;  1J8C A;  2FBW B;  1SB3 C;  2BYT A;  3ZXR A;  3QA8 A;  2MP2 A;  2L83 A;  2KDB A;  2PVO D;  3NRZ A;  2KQS A;  1WX9 A;  1K53 A;  3KYC D;  3Q3N C;  2D10 A;  5IA7 A;  3AB5 A;  3BYT B;  4CYE A;  5FKA C;  2INN E;  4I6L B;  1D5X C;  1SIJ A;  4C56 C;  3AED B;  1EU3 A;  4KSL C;  3B2G A;  3Q8B A;  4WUR A;  5JHB A;  4FJY A;  1RFA A;  1L0X B;  2GB1 A;  4DWF A;  4JL9 A;  3JVZ X;  1RM6 C;  2K9X A;  3ZDT A;  3P4S B;  4FUL A;  4IM3 A;  4A3P A;  2MBH A;  2KDI A;  4IWP A;  3AU5 A;  3NVV A;  2DWQ A;  3BVM A;  1SE2 A;  3R66 C;  1GOZ A;  5D7G A;  1MFW A;  3ZW3 A;  2LXC A;  1ROE A;  1V1P A;  3AE3 B;  3PTF C;  2FIF A;  5DPS A;  3R7Q A;  3TUO A;  3DBL I;  2KFK A;  2KX3 A;  3AE9 B;  1V2Y A;  2QSD A;  3VAW A;  2CJO A;  3TEY A;  1I4X A;  2N0S B;  4I6N B;  2WXI A;  5EE3 A;  3WAL A;  2WWZ A;  2M17 A;  5D3I B;  3RI7 C;  2QIL A;  2WXJ A;  3DVN V;  4ZYN A;  3W1Y A;  1L2N A;  1T6B X;  2PKO A;  1B1Z A;  1T3Q A;  1V6E A;  3ZRF A;  1OTR B;  2KTR B;  1YMH E;  4MT5 A;  1I4Q A;  4BVU C;  4YT0 B;  4ANX A;  4GU2 A;  4RGO S;  1D4B A;  3ONS A;  3L16 A;  3E56 A;  3GOE A;  2V4L A;  1MG8 A;  1QOB A;  1SXT A;  2KHW B;  2ZEQ A;  5DCN A;  3RT3 B;  5DPW A;  1TKE A;  3VH3 B;  4ARC A;  1VZ8 A;  4HWI B;  2K8H A;  3NVW A;  4W9K A;  4K7S A;  3EHV A;  3IT6 B;  2Y3A A;  2DLB A;  1NDD A;  4WQM A;  3NZ3 A;  3ZQ4 A;  4BBN C;  2IO1 B;  2K8C A;  4AWJ A;  1FO4 A;  2V9H A;  4YWG G;  1HTO A;  2FCQ A;  2INP E;  3W1S A;  2WDT B;  3A4R A;  2KWV B;  1N62 A;  2G1E A;  3BWU D;  5C3J B;  2KMA A;  4EZK A;  3DHG C;  1QQR A;  3Q8A A;  2O6V A;  1FNW A;  3TEZ A;  4NJ7 A;  1F2R C;  4KIK B;  2WX1 A;  1CJE A;  3W5U B;  2KQ7 A;  3HK0 A;  5JH5 C;  4IG7 B;  3I63 C;  3NVY A;  3DVN U;  2N1W A;  2IPK D;  1UWX A;  3O65 B;  5HI1 A;  1KTK A;  3VFK A;  4LNN A;  4DHZ E;  1X1M A;  1IGC A;  2YEP B;  4KZ0 A;  1AAR A;  3BVG A;  4UDU C;  2YVC A;  3K9P B;  3SFE B;  3M62 B;  1QF6 A;  1V1P B;  2LGX A;  3N1Z C;  5G5G A;  3B2F A;  3NZU A;  4MM3 A;  4EZJ A;  2ICI A;  1E90 A;  5BYQ A;  1ENF A;  1E7P B;  1E0Z A;  4ARI A;  5AUI A;  3L10 B;  5BMI A;  4DK5 A;  1V86 A;  2MW5 A;  1YIW A;  1V80 A;  2M4N A;  5E6J A;  3R8B A;  2JF5 A;  5IP4 D;  2UU7 A;  2W55 A;  1QT9 A;  1WR6 E;  1C77 A;  5DPT A;  3VRA B;  1QOG A;  2JZZ A;  4DBG A;  3C0R B;  3DHI C;  1QZE A;  2FNJ B;  5HG2 A;  1V49 A;  1MHX A;  2KT7 A;  4NY0 A;  4NAW B;  2FCM A;  2N9L A;  2NS5 A;  2WS3 B;  3VVW B;  3SD5 A;  4GLS C;  3DVG X;  3SHQ A;  1C1Y B;  3DDC B;  2MJ3 A;  5BMG A;  2MHJ A;  4YTM B;  2G9H D;  2R2Q A;  1WFY A;  3P4P B;  2MA9 B;  2BKF A;  2ACZ B;  2BF8 B;  4XE0 A;  2I38 A;  1WMH A;  3PT2 B;  1N61 A;  4K3C A;  4IC7 B;  1XF5 L;  4P16 A;  2R61 A;  4KVG B;  2WXQ A;  2GBN A;  3V05 A;  2NTS A;  3ZTD A;  1JCK B;  1JWB D;  2FAZ A;  4TSS A;  2WGS A;  1UD7 A;  3LB8 C;  1ESF A;  3TEX A;  4L23 A;  2FCN A;  5L95 C;  2CU1 A;  2LUE A;  1TTN A;  4C00 A;  1ZKH A;  3Q6B A;  3PLV A;  4ZHO A;  3QC8 B;  4EE2 A;  1JAL A;  3U8Z A;  3QQ8 B;  3RNG C;  3ZXV A;  3PGE A;  2VZK B;  2HDE A;  1WX7 A;  1L6U A;  1XLO A;  4HXD A;  3U7Z A;  2Z59 B;  4IOI E;  2L0T A;  3UGB B;  2HD5 B;  2JQR B;  1NI2 A;  4OZB A;  2WXH A;  1D5M C;  3EUB 2;  2KFJ A;  2JXX A;  4ITK A;  2KYW A;  1P1A A;  1T0Y A;  2KLC A;  4B9K A;  3V3X A;  3OWE B;  2BQQ A;  4P1C C;  4AJY B;  4LDT D;  2B76 B;  1CZP A;  3A1Q A;  2BTE A;  2RGF A;  2G45 B;  5FR3 A;  5AEK B;  2JUO A;  4HPP A;  2J52 A;  3UIO B;  2LAS A;  1SJH D;  1GPX A;  1WGD A;  1TY0 A;  3V61 A;  1SGH A;  1UEL A;  3KUC B;  2NR2 A;  2HTH A;  2PTL A;  3BYY B;  4NJ6 A;  3ZIM A;  1XO3 A;  1D5Z C;  2FUG 1;  4J6I A;  3R2I A;  4YSY B;  4LNO A;  2DNF A;  2OED A;  5AZF A;  4BOS C;  4DDI D;  3N20 C;  3ZO5 B;  4HEA 1;  1PGX A;  1QIL A;  1RRB A;  2MSE D;  1TS3 A;  4XYC A;  3BK2 A;  2V4I B;  5T8I A;  2GI9 A;  2J0M A;  1PQS A;  2N9P C;  3L54 A;  1YQ4 B;  4RM8 A;  2L32 A;  4TKN A;  2KTF A;  3H6N A;  1GC6 A;  3PRP B;  5EE9 A;  3N32 A;  2K25 A;  4I6P A;  5DPR A;  1WXM A;  4RCO A;  1TS2 A;  1GJZ A;  3MJ5 A;  3TMP B;  4GDK A;  2K3U A;  3QK0 A;  1RAX A;  2DYB A;  1WYW B;  5G55 A;  2KQ4 X;  5KHO A;  1PGB A;  4PT5 A;  2VH1 A;  4WAF A;  2K22 A;  4ZHP A;  1YX6 B;  2WXP A;  5D2M B;  3B1L X;  4MH0 E;  2JWU A;  1KH0 A;  4W9J A;  1I7H A;  3MC9 A;  4N6E B;  2C7N B;  3H7S A;  2V1Y A;  3A9J B;  1WRI A;  2X8X X;  2KAC A;  1WH3 A;  2SEB D;  4JX1 C;  1YNT E;  1WR1 A;  3B08 A;  2WU2 B;  1FD6 A;  2FID A;  4RGM A;  5L83 A;  4P1B C;  5H92 C;  4D2K A;  1JML A;  3EC8 A;  4WWP A;  2WXR A;  2BT6 A;  2IO2 B;  3APD A;  3TSS A;  4MGI E;  1UH6 A;  4KDL B;  4BKS D;  1VR9 A;  2ZNV B;  3PSE B;  2KNB A;  2HJ8 A;  2EEL A;  1TKG A;  1XCT L;  4HDQ A;  2BS3 B;  1OQQ A;  1SSN A;  2WNM A;  2M1M A;  3KUZ A;  4M01 A;  4C80 A;  1LGR A;  4FLH A;  4KKI A;  2AQ1 B;  4KGS A;  2LUM A;  2XBB C;  2J53 A;  2IZV B;  3JYU A;  3GZN B;  2K5P A;  2GOW A;  4HVB A;  3ZNZ B;  4GMV A;  4MSM B;  4WJQ A;  4MJS B;  4PS7 A;  4MEM A;  3DBH I;  5IOI A;  3NUH B;  3M95 A;  3AE6 B;  1EO6 A;  2LI5 A;  2LRW A;  1Q0W B;  1WXV A;  4MH8 A;  4HRO A;  4P6V F;  1MPE A;  2DAF A;  2WDR B;  4M00 A;  1NBF C;  3PS6 A;  1WE6 A;  4M8N A;  2KDE B;  5FK9 C;  3RPF C;  2LFI A;  3LYY A;  1E8Z A;  2NBW B;  4KDI C;  2AYO B;  2KKC A;  3WIM A;  1P3Q U;  3I3T B;  3SU8 X;  3MFG A;  1I4R A;  3IG3 A;  3I57 A;  3N1X C;  1OQY A;  2UYZ B;  3N3K B;  1T0Q C;  4ZRK A;  3APC A;  5JZE B;  3P63 A;  1MG4 A;  3N9Y C;  2LHE A;  3AE8 B;  1I4G A;  2TSS A;  4S0R A;  4G3X B;  3BVZ A;  2XN9 C;  3AE7 B;  4E71 A;  4C4V A;  1J7B A;  1HZ5 A;  2IDY A;  3AEG B;  3PLU A;  2KWC A;  2J0K A;  4M02 A;  3H9D A;  4DQO C;  3FIL A;  3IVF A;  2WU5 B;  2BKR B;  2WXL A;  1YD8 U;  3ENE A;  3QJZ A;  4AP4 C;  2RPV A;  4CO7 A;  2KJH B;  1Z5S B;  2W54 A;  4YXD B;  2JVC A;  3DBR I;  2ZCC A;  2DYO A;  3GZN I;  4IWO A;  1F9J A;  4K7W A;  2KDM A;  4ANW A;  3FAH A;  2DZJ A;  4JWS C;  4EKU A;  5BYR A;  2CHX A;  2WLB A;  4W9I A;  2C5L C;  1UBI A;  1F2R I;  1FFV A;  3GS2 A;  2KLG A;  2M8S A;  2AL3 A;  1XEE A;  4AJW A;  4A55 A;  2BYE A;  3A9K B;  3W5V B;  1UF0 A;  4IM2 A;  2A5U A;  2NBU A;  3VDZ A;  4QAY A;  3UQB A;  4W9H A;  4XX5 A;  1DOX A;  4G11 A;  3AE5 B;  2FCS A;  2WXN A;  1VZ7 A;  3O13 A;  3QCA A;  4LNI A;  2M56 B;  3DOW A;  2K6D B;  3T3N A;  4E74 A;  3ZRC A;  1WYG A;  3U7D A;  3AUL A;  3PRE A;  2LRU A;  2GBK A;  1J19 A;  2OOB B;  1ET6 A;  1N5W A;  2CHZ A;  3DWM A;  2OJR A;  3MC8 A;  1BT0 A;  4NAW A;  4RF1 A;  3MJW A;  5CX3 A;  2BYV E;  1E8W A;  2Y5P A;  2LWP A;  1FPY A;  4FXC A;  4EOY A;  3UF8 A;  1A70 A;  3ZGZ A;  3IXS A;  1VRA B;  4ASW C;  1WWT A;  1UGJ A;  1K8R B;  5I4D A;  1C4A A;  4MDK E;  1OQR A;  2IGD A;  5JHA A;  1ACC A;  4DHJ B;  2JWZ A;  3S2A A;  2IY1 B;  2K8B A;  1WZ0 A;  3VXW A;  3PV1 A;  2JU6 X;  2ON8 A;  1E7U A;  1Q5W B;  1IUE A;  3JW0 X;  1KLV A;  4XDC A;  2JRI B;  4WWO A;  2LJI A;  1WRD B;  2W82 A;  3VRB B;  2L00 B;  1D6E C;  5EE1 A;  3C8Y A;  2GMI C;  1WGK A;  2GRI A;  4BKT A;  1NEN B;  2PMV A;  3HRD D;  1EUV B;  1WGH A;  4GDL B;  2KO3 A;  4NQK E;  2MBB B;  3TL5 A;  2O6V B;  4XDD A;  1CK1 A;  4WH4 A;  4ZRP A;  4BBN F;  2J42 A;  2BYF A;  3B0A A;  3ETR A;  1QKZ A;  2MP2 B;  3APF A;  4A20 A;  5FR6 A;  3P4R B;  1FEH A;  5JXV A;  2IGH A;  1WIA A;  3PHW B;  3VUX A;  2QDF A;  4ANU A;  2DHZ A;  2MJE A;  3RNF C;  2Z8L A;  2XEW A;  2N7J A;  3BIN A;  1Y56 A;  2V3P A;  3QHT A;  1LXD A;  1KLG D;  2V3N A;  3LDZ E;  2N1V A;  2C9W B;  2ZCB A;  1V8C A;  2L05 A;  3HVZ A;  2GBJ A;  1VCB A;  3WAM A;  4ZRJ A;  4YTN B;  1GC7 A;  3U4E G;  3L4P A;  3PO0 A;  1YJ1 A;  1NYQ A;  4JLC A;  1R4M B;  2LD9 A;  3NHE B;  1WGR A;  3PRZ A;  4HRS A;  2JZ3 B;  3P42 A;  5CHV C;  2WXO A;  3QIJ A;  4JPS A;  1TY2 A;  2IO0 B;  2KC1 A;  3RYT A;  3MTN B;  3BY4 B;  4NZL B;  4TV3 A;  2RSU A;  4G50 A;  3WA0 A;  4N9F 4;  2JRH A;  2L52 A;  1F0Z A;  4KGR A;  4EUT A;  1HA5 A;  1JWM D;  2XK5 B;  2KDF B;  4IM0 A;  5CTR C;  1MI0 A;  3SFD B;  2WXM A;  2QHO A;  1KFY B;  3DQV A;  2NPT A;  3A33 B;  5EE0 A;  1DOY A;  5E6P A;  1G6J A;  3WAN A;  1P98 A;  3A9J A;  2BWF A;  2N7E A;  3E9S A;  1C3T A;  1JRO A;  2ZVN A;  3H7P A;  3V62 A;  5BMH A;  5BO4 B;  4A8X C;  2BGF A;  4NQL B;  5EDS A;  2I2Y A;  1XLQ A;  1WJN A;  4K3B A;  2D5G A;  4YSZ B;  4YL8 A;  5HFY A;  3R7R A;  1TKY A;  4L2Y A;  4L1B A;  4GSW A;  1T0S C;  3L17 A;  3K9O B;  1FRD A;  1ZGU B;  3NZS A;  4K7U A;  4FBJ B;  2WHI A;  3DBS A;  1PDX A;  1GG3 A;  2M19 A;  2Q5W D;  4AQ7 A;  2NCN A;  3P1M A;  1JWU D;  2WDV B;  3URY A;  1TZ1 A;  3KUD B;  3RZW C;  4GOC A;  4FAD A;  1WF9 A;  2HE7 A;  2Y5B B;  4RM9 A;  2LGI A;  3ML8 A;  5D6J B;  1L5P A;  1WX8 A;  4IKG A;  4Q2J A;  4DHZ B;  2KVZ A;  1SEB D;  2WXK A;  4HKZ E;  3RNA C;  1KJT A;  1FCL A;  2LZ6 A;  2MBE A;  1VZ6 A;  1I42 A;  3ABV B;  2BB6 A;  3DBL B;  3NOB A;  3PZD A;  1P7E A;  3VUY A;  3RCZ A;  1CMX B;  5IAA C;  3L08 A;  2JSV X;  3HIZ A;  2YLM A;  4KIK A;  5E6N A;  2LGY A;  2J0J A;  1F77 A;  2C60 A;  3P4Q B;  5G2N A;  2C7H A;  3J9C A;  1S1Q B;  1UUP A;  4HCP B;  3AEA B;  4MEL A;  2LXA A;  2RR9 A;  4RF0 A;  5KHQ A;  3BII D;  2UWQ A;  2JYT A;  3UIP B;  3H1U A;  2JY6 A;  2QIE B;  4F7Z A;  2L76 A;  1VLB A;  3QWZ B;  3GE3 C;  2BW2 A;  1N60 A;  4HJG E;  1EF1 A;  4WJO A;  3FKY A;  1JRP A;  2L8J A;  3Q3J A;  3KH0 A;  1E10 A;  1WXQ A;  4AS1 A;  1F52 A;  2O2V A;  3AI5 A;  1JQ4 A;  3KWL A;  3B9J A;  1HTQ A;  4HPL B;  4AOF A;  4NPN A;  2BVC A;  2G4D B;  3R2T A;  3HVD A;  4FJV B;  3RNB C;  1R4M I;  3GE8 C;  3FC4 A;  1AYF A;  2BS2 B;  3C19 A;  1F1H A;  2WXG A;  3TJP A;  4OVU A;  3RUI B;  3EEC A;  3AEB B;  1WXS A;  4W9E A;  2AQ2 B;  2MX2 A;  1IBX A;  3Q14 C;  1ZOY B;  1TIF A;  2N7D A;  2H89 B;  2KMM A;  1WI0 A;  4PS8 A;  2PPH A;  1UZX B;  1LM8 B;  3AU4 A;  3AEC B;  3RFZ B;  5C23 A;  3TIX A;  1WXA A;  2REX A;  2I1K A;  3WAO A;  4WJN A;  1OEY A;  3Q3O C;  5G5H A;  4B6W A;  2E3T A;  1SF0 A;  3U52 E;  4K81 A;  1BUI C;  3OLM D;  1ZDV A;  1WZ3 A;  2VZK D;  1GAQ B;  2ZPN A;  2KAN A;  3DWG C;  1U4A A;  2JPH A;  4OHJ A;  3DBH B;  3DCG A;  3ECI A;  2QC8 A;  3ZJU A;  4KV2 A;  3UI3 A;  3KYD D;  2DZI A;  1EM7 A;  1WSP A;  3KW5 B;  2V0G A;  1M4V A;  1GNU A;  3OG5 A;  5J2R A;  2X38 A;  3ZVV A;  5LXH A;  3H8H A;  2SAK A;  2AQ3 B;  4PYZ A;  2KK8 A;  2Z0E B;  4C7Z A;  4DXA B;  1OFF A;  4NJC A;  1SE4 A;  1XD3 B;  2PEA A;  2KOX A;  2ZZP B;  3AEE B;  4LJO B;  1ET9 A;  3DBR B;  1YN5 A;  1QOA A;  1TS4 A;  3CWI A;  1MJD A;  4HPM B;  3Q2A C;  3H7P B;  2MLB A;  1V1O A;  3EGR A;  5CHF A;  5LLI A;  2M0A A;  4CHK A;  1Q10 A;  4REZ A;  4AUQ C;  4KSK C;  5AZG A;  2J7Q B;  2KXJ A;  4YTP B;  3UIN B;  2B3A A;  1EU4 A;  2INC C;  2MBQ A;  2KZR A;  2WP9 B;  4WWM A;  1HZ6 A;  5CHW A;  1XLP A;  1STE A;  1KM7 A;  1JW9 D;  2KD0 A;  3GB1 A;  4RGN A;  4G0N B;  1XCQ L;  5D94 A;  3CST A;  1WJ4 A;  4BFR A;  1QOF A;  3PZ7 A;  1RLF A;  4RFB A;  2KWU B;  3W2D A;  1CQV A;  1T5X D;  2WXF A;  2GBM A;  5IN7 A;  2ZVO A;  4WJP A;  1FXA A;  2KVR A;  1TGZ B;  2JYE A;  1DYQ A;  2L7R A;  1C4P A;  1WM3 A;  4ZRQ A;  1J0G A;  4WWN A;  1N6Z A;  2WQY B;  1R4N I;  3HM6 X;  3AH7 A;  1A5R A;  1K52 A;  1TJE A;  2KWD A;  1FXT B;  1RFK A;  4ICU A;  2GBR A;  4EFO A;  4LCD E;  4DHJ D;  1C4C A;  4N59 A;  2AX5 A;  2VH2 A;  3X23 A;  1L0Y B;  4BKG A;  2RDG A;  1Q1O A;  4OZA A;  1K50 A;  2KTR A;  4A6Q A;  3IT4 B;  3AE2 B;  3IBE A;  4DDG D;  4GIV A;  3AEF B;  3MC0 B;  2WX0 A;  1GB1 A;  4DXG A;  4MGY E;  4EEW A;  2MEK A;  3PPA A;  1IBX B;  4RH6 A;  2JXT A;  3PRM B;  2MCN B;  1YQ3 B;  2Z0D B;  3IFW B;  2RDH A;  2AL6 A;  3JSV B;  1WGG A;  4W9G A;  3KLS X;  2QJL A;  1UGM A;  2WDQ B;  3QX1 A;  3RZF A;  2IGG A;  3DHH C;  2IND C;  1N63 A;  2QMT A;  3X0W A;  4KX6 B;  3U2S C;  4GB9 A;  4JQW C;  5D3D A;  5IKC M;  3L0W B;  3ZKJ C;  2DEN B;  1V5O A;  4N58 A;  2FUH B;  2LMC A;  1PGA A;  3MHZ A;  3VR8 B;  2Y5C A;  2OJW A;  3ZUN A;  1XXG A;  2LHD A;  4XC2 A;  1HE8 A;  4BOZ B;  4MM3 B;  1LQB A;  1ZP0 B;  2MWS B;  4KKJ A;  1OGW A;  2N4F A;  4USA A;  3CSF A;  4XWT A;  1C79 A;  3Q69 A;  2DZK A;  1R4N B;  1WM2 A;  1EWY C;  3MP9 A;  2IY0 B;  2MRP A;  5BYS A;  3N1Y C;  2G3Q B;  2V3S A;  4FA6 A;  4BAX A;  3ZNG C;  4HCN B;  2CJN A;  1JRU A;  3Q8E A;  1KOT A;  3SEB A;  3IHP C;  3SDL C;  3AV8 A;  4GXB A;  3R3M A;  1UBQ A;  4W9F A;  1WJU A;  2LGD A;  4B95 A;  4JE3 B;  1I4H A;  2RD0 A;  1E9M A;  3NVZ A;  4MGZ E;  4PYU A;  5LXI B;  3NY5 A;  2O2V B;  3ZTC A;  2HJ1 A;  1WE7 A;  3FIL B;  3AXC A;  5TR5 A;  1FM0 D;  4ANV A;  1E8Y A;  3KQ4 A;  2R2O A;  4A90 A;  1FIQ A;  3WAP A;  5C1Z A;  3ML9 A;  1N5X A;  4LNF A;  3T3O A;  1V81 A;  2BS4 B;  1ZDX A;  4JGH B;  2CS4 A;  2EKE C;  1Z2M A;  4M8M A;  1V9J A;  4OVV A;  4WIP A;  4OW0 A;  4LJP B;  2NTT A;  3U30 A;  4GN1 A;  3TCA A;  4HLE A;  5MPO A;  1PFD A;  1RYJ A;  3AE1 B;  4A3O A;  2N9K A;  1BXT A;  2D11 A;  4KZC A;  4P7I A;  3CMM B;  4BZA A;  1V5T A;  2PJH A;  3M63 B;  3CIR B;  4CQN A;  4FHJ A;  1M94 A;  1WJ6 A;  2PE6 B;  1EF5 A;  1LFD A;  3EFU A;  4XGA B;  1SJE D;  4C4V B;  4F8C B;  2DAJ A;  1TBE A;  1MVK A;  2DZM A;  2H88 B;  5H8Y E;  2NBV B;  3A4S C;  4J3O D;  4II3 B;  1NEK B;  2PE9 A;  1ZE3 D;  2O6V D;  3PVL A;  1L0V B;  2N9X A;  1TZO A;  2EMT A;  3HHM A;  2ONQ A;  4JIO U;  1K51 A;  4NNJ B;  1E8X A;  4MGK E;  4IWQ A;  3QAQ A;  3HM3 A;  3RD2 A;  4IUM B;  4LTU A;  4FJZ A;  3RNC C;  1UNS A;  1P9D U;  2QCZ A;  4PK1 A;  3LJ3 A;  1LO5 D;  1YQB A;  3V6E B;  2QEJ C;  3AE4 B;  2CHW A;  2ZW1 A;  2MQJ A;  1J7A A;  1ZPS A;  1GUA B;  1JWA D;  3OAW A;  4S17 A;  1DOI A;  3MHS D;  2M0X A;  4K1R B;  3WCQ A;  2CKH B;  3GP7 A;  3T9L A;  1ZXH A;  4RGT A;  3A1Q B;  3ZDM C;  3AN1 A;  3ZYY X;  4ZRI A;  1SE9 A;  3Q8F A;  1YN4 A;  2K6Q A;  2KN5 A;  2DYM A;  2IYD B;  4MJS A;  2BWE S;  4HDO A;  1B9R A;  3N30 A;  3DPD A;  2JX5 A;  4IDI A;  4XWW A;  3CF6 E;  4EZL A;  1BML C;  1ZUD 2;  2BB5 A;  4XZ4 A;  2D07 B;  2KFK B;  3SR6 A;  2ASQ A;  2K0P A;  2L3Z A;  4GDK B;  3JSV A;  1PYW D;  1MHH E;  5AUK A;  5E6O A;  2ZNV C;  4H2A A;  1L4Z B;  2LVO A;  2YEP F;  3VTU A;  3W9C B;  4C7Y A;  2MH7 A;  1NYR A;  2EKI A;  4B0E A;  1AN8 A;  2KJ6 A;  2J4X A;  1YX5 B;  4M0W B;  4O1N A;  3D32 A;  1UWM A;  3TEW A;  2IO3 B;  1V97 A;  1NI3 A;  4FN2 A;  3QAR A;  1FFU A;  2CU3 A;  4US8 A;  4WAA A;  3ZLZ A;  3IAM 1;  3VR9 B;  2RDB C;  3VQI A;  3ZJT A;  4TMA B;  2LEK A;  1SIF A;  3ZJV A;  1YOV B;  1YJI A;  5J17 A;  2W3S A;  2AWT A;  2N9E B;  1WY8 A;  2KAJ A;  2ZPY A;  2XK5 A;  4LDT B;  1ISN A;  5AZH A;  5IO9 A;  2KJR A;  4HJK A;  5HHD G;  1VJK A;  4MSQ B;  5C2T B;  1HXY D;  1PUT A;  1AWD A;  2FE8 A;  5HKH A;  2W9N A;  1I4P A;  1R7S A;  2BBC A;  4TUU A;  4OVZ A;  3ZNH B;  1H4R A;  4X57 B;  3AMZ A;  3RUL A;  4JWU C;  1YJJ A;  4GDL A;  4W9L A;  2K1F A;  2NPT B;  3V6C B;  2OHF A;  1FXI A;  1XLN A;  3I5J C;  2C7M B;  2KN4 A;  2RPQ A;  1L6V A;  3VH4 B;  5LNK 1;  1NVI D;  2KC2 A;  3KVF B;  2BPS A;  3NS8 A;  4BKS A;  4DXF A;  1HEZ E;  3EA6 A;  2PIA A;  3IAS 1;  1VDV A;  4PS3 A;  4A9A A;  1AW7 A;  1KLU D;  2MBO A;  3V60 A;  1ZXI A;  2JT4 B;  3DVG Y;  3M3J A;  1I35 A;  3VTV A;  4B0M A;  3VHT C;  2G4S A;  3ALB A;  1P0R A;  3BK1 A;  3ZNI D;  4FHK A;  4KGT A;  2L1A A;  1FCC C;  3L13 A;  4LNK A;  3NS1 A;  1ZW7 A;  2I1J A;  1SBB B;  1E5W A;  2RMM A;  4HK2 A;  1T0R C;  1TS5 A;  1C9F A;  1WMH B;  1C78 A;  4GGQ A;  4ZYS A;  4HKQ A;  2W3R A;  4IW0 A;  3AM9 A;  3NJT A;  1FMA D;  1TYG B;  2PLP A;  4TQ1 A;  4ZDV A;  4ACF A;  2GLS A;  3TBL D;  3A9K A;  1EWC A;  1XT9 B;  2D2Q A;  2D3A A;  1QLB B;  3PHX B;  2PW9 A;  2LVP A;  4E3C A;  1IYF A;  3LXF A;  1H8C A;  2VRR B;  1HQR D;  1YN3 A;  2JZP A;  1RWS A;  4ZOH C;  3UQA A;  2ZW0 A;  1D3Z A;  2IBI B;  2IJ0 A;  2E6X A;  2LJ5 A;  2D3G A;  4TQ0 A;  1P7F A;  2L0F A;  2MJD A;  1OEY J;  3BZD B;  4II2 B;  1E6E B;  3P2B A;  2PVG C;  4URK A;  1SE3 A;  4US9 A;  4ICV A;  3PZ8 A;  2NMQ A;  3OJ3 A;  4F1S A;  2ZJD A;  4NAM A;  3Q3M C;  1KF6 B;  4LK0 M;  1J7C A;  4R3D A;  3RMK C;  1IGD A;  2KX0 A;  1GB4 A;  4W9D A;  1VD2 A;  4OZC A;  2NVU I;  1KRH A;  2D3B A;  2HTM E;  1FNU A;  4WQO B;  3RN9 C;  3HUI A;  2WYQ A;  3KWV A;  4MAC A;  3OJ4 B;  3W1S C;  2DBY A;  4W9C A;  1C76 A;  5TSS A;  1DGJ A;  1XQQ A;  4M0W A;  1IP9 A;  2LGS A;  1FRR A;  5GXG B;  3NG0 A;  3Q8C A;  1TT5 B;  1Y8R C;  3VTW A;  3Q3F A;  5J18 A;  3I9V 1;  3RNE C;  3EFC A;  1WGY A;  1FNV A;  1JWS D;  3VUW A;  1E7V A;  2DX5 B;  1IPG A;  2K39 A;  1L7Y A;  2LVQ A;  3T8M A;  2A4Z A;  2EMS A;  4RMA A;  4RNA A;  2KMC A;  2XNA C;  2AEH A;  1L4D B;  1S3S G;  4LLG M;  2D3C A; 
#chains in the Genus database with same CATH homology
 3U30 A;  4GN1 A;  3TCA A;  4HLE A;  3KUD B;  2CR5 A;  5GMV A;  4A3O A;  1J8C A;  3RZW C;  1YX6 B;  4GOC A;  4FAD A;  1WF9 A;  2HE7 A;  2Y5B B;  4RM9 A;  5D2M B;  3B1L X;  3QA8 A;  4MH0 E;  3ML8 A;  2D11 A;  2MP2 A;  5D6J B;  4W9J A;  1WX8 A;  2KDB A;  4DHZ B;  2C7N B;  3H7S A;  4KZC A;  2V1Y A;  2KQS A;  1WX9 A;  3A9J B;  4P7I A;  3KYC D;  3CMM B;  1WH3 A;  1KJT A;  1V5T A;  2D10 A;  2PJH A;  3M63 B;  5IA7 A;  2LZ6 A;  3B08 A;  1WR1 A;  4FHJ A;  2MBE A;  4CYE A;  1I42 A;  2FID A;  4I6L B;  1M94 A;  5L83 A;  1WJ6 A;  2PE6 B;  3NOB A;  3PZD A;  1EF5 A;  1LFD A;  3VUY A;  3EFU A;  3EC8 A;  4WWP A;  4F8C B;  2IO2 B;  3APD A;  3RCZ A;  1CMX B;  2DAJ A;  4KSL C;  4MGI E;  1TBE A;  2DZM A;  3L08 A;  1UH6 A;  3HIZ A;  5IAA C;  2NBV B;  4KDL B;  4BKS D;  2YLM A;  3A4S C;  5JHB A;  4FJY A;  1RFA A;  4II3 B;  2LGY A;  4KIK A;  2ZNV B;  5E6N A;  2PE9 A;  3PSE B;  2J0J A;  2C60 A;  2O6V D;  4DWF A;  2KNB A;  3PVL A;  4JL9 A;  2HJ8 A;  3JVZ X;  3ZDT A;  5G2N A;  2C7H A;  4FUL A;  4IM3 A;  4A3P A;  2MBH A;  2N9X A;  1S1Q B;  2KDI A;  4HCP B;  4HDQ A;  4IWP A;  2EMT A;  3AU5 A;  4MEL A;  2LXA A;  2M1M A;  3KUZ A;  3HHM A;  2RR9 A;  3R66 C;  4JIO U;  5D7G A;  4FLH A;  4NNJ B;  1E8X A;  5KHQ A;  4MGK E;  3ZW3 A;  2LXC A;  2UWQ A;  3QAQ A;  4IWQ A;  3HM3 A;  2XBB C;  4IUM B;  3RD2 A;  3PTF C;  2FIF A;  5DPS A;  3UIP B;  2IZV B;  3R7Q A;  3DBL I;  3H1U A;  2KFK A;  2JY6 A;  2KX3 A;  3JYU A;  4F7Z A;  2L76 A;  4FJZ A;  1V2Y A;  3VAW A;  1P9D U;  3QWZ B;  2GOW A;  4HVB A;  3ZNZ B;  3LJ3 A;  1EF1 A;  1YQB A;  4I6N B;  4WJO A;  2WWZ A;  2M17 A;  4GMV A;  4MSM B;  3WAL A;  4WJQ A;  4MJS B;  4PS7 A;  3DVN V;  4ZYN A;  2L8J A;  4MEM A;  3W1Y A;  3DBH I;  1L2N A;  3V6E B;  3Q3J A;  3M95 A;  3KH0 A;  1EO6 A;  1V6E A;  2LI5 A;  1OTR B;  2CHW A;  2KTR B;  2LRW A;  3ZRF A;  1Q0W B;  1WXV A;  2MQJ A;  1GUA B;  2DAF A;  2O2V A;  3OAW A;  3AI5 A;  1NBF C;  4BVU C;  3PS6 A;  4HPL B;  1WE6 A;  4M8N A;  2KDE B;  4AOF A;  3MHS D;  4ANX A;  4NPN A;  4GU2 A;  2M0X A;  4K1R B;  2G4D B;  4FJV B;  1E8Z A;  1R4M I;  2CKH B;  3ONS A;  2NBW B;  3L16 A;  4KDI C;  3GOE A;  2AYO B;  2V4L A;  2KKC A;  3T9L A;  1P3Q U;  3WIM A;  1MG8 A;  3TJP A;  4OVU A;  3RUI B;  3A1Q B;  3EEC A;  1WXS A;  2KHW B;  3I3T B;  2ZEQ A;  4W9E A;  5DCN A;  3ZDM C;  2MX2 A;  3SU8 X;  3IG3 A;  3RT3 B;  4ZRI A;  1SE9 A;  5DPW A;  1OQY A;  2UYZ B;  3VH3 B;  3N3K B;  4ZRK A;  2N7D A;  2K6Q A;  2KN5 A;  2DYM A;  3APC A;  5JZE B;  2IYD B;  4HWI B;  2K8H A;  4MJS A;  4W9K A;  4K7S A;  1WI0 A;  2BWE S;  3EHV A;  4HDO A;  4PS8 A;  2PPH A;  3N30 A;  1NDD A;  1UZX B;  3DPD A;  1LM8 B;  4BBN C;  4G3X B;  3CF6 E;  4E71 A;  3AU4 A;  4XZ4 A;  2IO1 B;  4EZL A;  2K8C A;  5C23 A;  3TIX A;  1WXA A;  2D07 B;  2I1K A;  2KFK B;  2REX A;  3WAO A;  2ASQ A;  4AWJ A;  2L3Z A;  4WJN A;  1OEY A;  4GDK B;  4B6W A;  3JSV A;  3PLU A;  2KWC A;  2J0K A;  3H9D A;  2FCQ A;  4K81 A;  3W1S A;  2WDT B;  3A4R A;  5E6O A;  2ZNV C;  3IVF A;  2KWV B;  2BKR B;  3OLM D;  1YD8 U;  2LVO A;  3VTU A;  3ENE A;  3QJZ A;  2KMA A;  4EZK A;  4AP4 C;  1WZ3 A;  4CO7 A;  2ZPN A;  2KAN A;  1Z5S B;  2KJH B;  1U4A A;  2JPH A;  2KJ6 A;  3DCG A;  3ECI A;  1YX5 B;  4M0W B;  2O6V A;  4KV2 A;  2JVC A;  3DBR I;  2ZCC A;  2DYO A;  3GZN I;  3D32 A;  4IWO A;  4NJ7 A;  1F9J A;  3KYD D;  4KIK B;  2DZI A;  4K7W A;  2WX1 A;  4ANW A;  2IO3 B;  2DZJ A;  3KW5 B;  2KQ7 A;  3HK0 A;  5JH5 C;  4FN2 A;  4EKU A;  3QAR A;  2CHX A;  4IG7 B;  4W9I A;  2C5L C;  1UBI A;  4WAA A;  3ZLZ A;  1GNU A;  2KLG A;  5J2R A;  2M8S A;  3VQI A;  3ZVV A;  2AL3 A;  5LXH A;  4AJW A;  3DVN U;  2N1W A;  2BYE A;  1SIF A;  3A9K B;  4PYZ A;  3O65 B;  2KK8 A;  4IM2 A;  2A5U A;  2NBU A;  2Z0E B;  3VFK A;  5J17 A;  3VDZ A;  4DXA B;  2AWT A;  2N9E B;  4DHZ E;  1X1M A;  4W9H A;  3UQB A;  4XX5 A;  4KZ0 A;  4G11 A;  1AAR A;  2FCS A;  1WY8 A;  2YVC A;  3K9P B;  1XD3 B;  2PEA A;  2KOX A;  2XK5 A;  2ZPY A;  2ZZP B;  3M62 B;  1ISN A;  3QCA A;  4LDT B;  5AZH A;  4LJO B;  2LGX A;  2KJR A;  4HJK A;  3NZU A;  4MM3 A;  4EZJ A;  3DOW A;  2K6D B;  4MSQ B;  1E90 A;  4E74 A;  3ZRC A;  5HKH A;  2W9N A;  3U7D A;  4HPM B;  3AUL A;  3PRE A;  3L10 B;  3H7P B;  4DK5 A;  2LRU A;  2MLB A;  4TUU A;  1V86 A;  2GBK A;  2MW5 A;  1J19 A;  1YIW A;  5CHF A;  1V80 A;  5LLI A;  3ZNH B;  2OOB B;  2CHZ A;  4NAW A;  2M4N A;  1H4R A;  2OJR A;  1BT0 A;  3MJW A;  4X57 B;  5CX3 A;  2BYV E;  2JF5 A;  3RUL A;  1E8W A;  2LWP A;  4CHK A;  4EOY A;  3UF8 A;  4AUQ C;  4KSK C;  4GDL A;  4W9L A;  5AZG A;  2K1F A;  2J7Q B;  2NPT B;  2KXJ A;  1WR6 E;  3V6C B;  4ASW C;  5DPT A;  1K8R B;  3UIN B;  2JZZ A;  4DBG A;  2B3A A;  3C0R B;  2C7M B;  4MDK E;  1QZE A;  2RPQ A;  2FNJ B;  5JHA A;  2MBQ A;  1V49 A;  4NY0 A;  2KZR A;  4DHJ B;  2JWZ A;  4NAW B;  2FCM A;  3S2A A;  3VH4 B;  2IY1 B;  2K8B A;  2NS5 A;  1WZ0 A;  5CHW A;  2KC2 A;  3KVF B;  3VVW B;  2BPS A;  3NS8 A;  3SD5 A;  3VXW A;  3PV1 A;  3DVG X;  1KM7 A;  3SHQ A;  4BKS A;  2KD0 A;  1C1Y B;  3DDC B;  1E7U A;  1Q5W B;  3JW0 X;  4G0N B;  5D94 A;  1KLV A;  3CST A;  2JRI B;  2R2Q A;  1WFY A;  4WWO A;  2MA9 B;  1WJ4 A;  4PS3 A;  2BKF A;  4BFR A;  1WRD B;  2MBO A;  2BF8 B;  2L00 B;  1RLF A;  3V60 A;  2KWU B;  2JT4 B;  3DVG Y;  2GMI C;  2GBM A;  2ZVO A;  3M3J A;  4WJP A;  1I35 A;  1WMH A;  4BKT A;  3PT2 B;  3VTV A;  1EUV B;  1WGH A;  4GDL B;  2KO3 A;  2G4S A;  3VHT C;  2KVR A;  3ALB A;  1TGZ B;  4IC7 B;  4NQK E;  1P0R A;  2MBB B;  3ZNI D;  4KVG B;  2L7R A;  2O6V B;  4FHK A;  3TL5 A;  1WM3 A;  2GBN A;  1J0G A;  3ZTD A;  4WWN A;  2FAZ A;  4BBN F;  2BYF A;  3B0A A;  2MP2 B;  3APF A;  1R4N I;  4A20 A;  3HM6 X;  5FR6 A;  1A5R A;  1WIA A;  3L13 A;  1UD7 A;  1FXT B;  3PHW B;  3VUX A;  1ZW7 A;  4ANU A;  2DHZ A;  2I1J A;  4ICU A;  2GBR A;  4EFO A;  4LCD E;  1E5W A;  2XEW A;  4DHJ D;  2FCN A;  5L95 C;  2CU1 A;  4HK2 A;  1WMH B;  4GGQ A;  3BIN A;  3X23 A;  2LUE A;  4BKG A;  3QHT A;  1TTN A;  1ZKH A;  1LXD A;  1Q1O A;  3PLV A;  4IW0 A;  3LDZ E;  3QC8 B;  2KTR A;  2N1V A;  2C9W B;  2ZCB A;  2L05 A;  4TQ1 A;  4ZDV A;  2GBJ A;  3IBE A;  1VCB A;  3WAM A;  4DDG D;  3U8Z A;  4ZRJ A;  4GIV A;  3QQ8 B;  2WX0 A;  3TBL D;  3PGE A;  3A9K A;  1GC7 A;  4MGY E;  1XT9 B;  2D2Q A;  4EEW A;  3PPA A;  1WX7 A;  1YJ1 A;  3PHX B;  4HXD A;  2LVP A;  4JLC A;  4E3C A;  3PRM B;  2Z59 B;  2MCN B;  2LD9 A;  2Z0D B;  1IYF A;  3NHE B;  3IFW B;  1H8C A;  1WGR A;  3PRZ A;  2AL6 A;  2L0T A;  3JSV B;  1WGG A;  2VRR B;  2JZ3 B;  4W9G A;  5CHV C;  3RZF A;  1UGM A;  3QX1 A;  3UGB B;  3QIJ A;  3UQA A;  2HD5 B;  2IO0 B;  3X0W A;  2KC1 A;  3RYT A;  1D3Z A;  2IBI B;  3MTN B;  1NI2 A;  3BY4 B;  2LJ5 A;  4GB9 A;  2D3G A;  4TV3 A;  4JQW C;  4TQ0 A;  2KFJ A;  2JXX A;  2RSU A;  4G50 A;  3WA0 A;  4N9F 4;  2L0F A;  2JRH A;  1P1A A;  3L0W B;  3ZKJ C;  1OEY J;  1T0Y A;  2DEN B;  4II2 B;  1V5O A;  3P2B A;  4EUT A;  2KLC A;  4B9K A;  2FUH B;  4URK A;  4AJY B;  4LDT D;  2XK5 B;  3A1Q A;  4ICV A;  2KDF B;  3ZUN A;  2RGF A;  3OJ3 A;  4IM0 A;  4F1S A;  2G45 B;  2ZJD A;  4XC2 A;  5CTR C;  1HE8 A;  4BOZ B;  2JUO A;  1LQB A;  5AEK B;  3UIO B;  2LAS A;  2MWS B;  1WGD A;  1OGW A;  2QHO A;  2N4F A;  3V61 A;  3DQV A;  2NPT A;  1SGH A;  1UEL A;  2KX0 A;  3A33 B;  3KUC B;  5E6P A;  4W9D A;  2NR2 A;  1G6J A;  3CSF A;  1VD2 A;  2NVU I;  2HTH A;  3WAN A;  2DZK A;  1P98 A;  1WM2 A;  3A9J A;  2BWF A;  4NJ6 A;  4WQO B;  3ZIM A;  2N7E A;  1C3T A;  2ZVN A;  3H7P A;  3V62 A;  2IY0 B;  4J6I A;  2MRP A;  5BO4 B;  2WYQ A;  2G3Q B;  2V3S A;  3OJ4 B;  4FA6 A;  3ZNG C;  4HCN B;  1JRU A;  3W1S C;  2BGF A;  1KOT A;  4NQL B;  4W9C A;  5AZF A;  5EDS A;  3IHP C;  3SDL C;  4BOS C;  4DDI D;  1XQQ A;  4GXB A;  3R3M A;  3ZO5 B;  1UBQ A;  4W9F A;  1WJN A;  1RRB A;  1WJU A;  2MSE D;  2LGD A;  4B95 A;  4YL8 A;  1IP9 A;  2RD0 A;  4MGZ E;  4PYU A;  5LXI B;  3NY5 A;  1Y8R C;  2O2V B;  3R7R A;  2J0M A;  3VTW A;  1PQS A;  3Q3F A;  3ZTC A;  5J18 A;  1WE7 A;  4GSW A;  2N9P C;  3L17 A;  3L54 A;  3AXC A;  3K9O B;  5TR5 A;  4RM8 A;  1WGY A;  3H6N A;  1ZGU B;  2KTF A;  1GC6 A;  3NZS A;  3PRP B;  4K7U A;  4TKN A;  4FBJ B;  3VUW A;  3N32 A;  1E7V A;  2DX5 B;  4ANV A;  2K25 A;  1E8Y A;  1IPG A;  4I6P A;  3DBS A;  2R2O A;  1GG3 A;  5DPR A;  2K39 A;  1WXM A;  1L7Y A;  2LVQ A;  3WAP A;  5C1Z A;  2NCN A;  3ML9 A;  3T8M A;  2A4Z A;  2EMS A;  1GJZ A;  3TMP B;  4GDK A;  4RMA A;  1V81 A;  3QK0 A;  2KMC A;  4JGH B;  2CS4 A;  1RAX A;  2DYB A;  1WYW B;  1Z2M A;  1V9J A;  2AEH A;  2EKE C;  4M8M A;  4OVV A;  1S3S G;  5G55 A;  1TZ1 A;  5KHO A;  4LJP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...