5E6OA

Crystal structure of c. elegans lgg-2 bound to an aim/lir motif
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
117
structure length
117
Chain Sequence
b'PGSFKERRPFHERQKDVEEIRSQQPNKVPVIIERFDGERSLPLMDRCKFLVPEHITVAELMSIVRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTSQPAFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein lgg-2
molecule tags Protein binding/peptide
source organism Caenorhabditis elegans
publication title Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy
pubmed doi rcsb
total genus 35
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5e6oA00
1HE8A 4N9F4 4GMVA 4B6WA 1YX6B 2KFKB 2PE9A 4BFRA 2BWFA 4IW0A 3V62A 3QA8A 3HHMA 2L0FA 4W9KA 2MWSB 3SDLC 3VH4B 3A4SC 2I1JA 2XK5A 4G3XB 3AXCA 2N7DA 2LRUA 4PS7A 1YX5B 2K39A 2MP2A 2W9NA 3JYUA 2D10A 2WX1A 1UZXB 2OJRA 4PYZA 4DDGD 3EHVA 2WDTB 4II3B 1J0GA 2ZEQA 2LGXA 1ZKHA 3U7DA 1UBQA 3APFA 3I3TB 4HJKA 4RM8A 4GU2A 4HCNB 1WXAA 3GZNI 4A3OA 3DDCB 1V6EA 3L08A 3UGBB 2A5UA 3IHPC 3WAOA 2FAZA 2N1WA 4GDLA 1GJZA 3L13A 1C1YB 3HIZA 1WMHB 2G45B 3WANA 3UQBA 4ZRKA 4I6PA 3KYCD 4FULA 2CHXA 3D32A 4HPMB 3S2AA 3VAWA 4EFOA 4HDQA 5LXIB 2BPSA 1WJNA 2KLCA 3MJWA 2LVPA 2CHWA 2JZZA 3ZO5B 1WFYA 1TGZB 2M17A 2RR9A 2N7EA 3JSVA 5BO4B 3UF8A 4BKTA 1L7YA 1WXSA 5LXHA 4ICUA 1LXDA 3A33B 2Y5BB 3P2BA 2DZIA 4WJOA 3ZTCA 2DENB 1Y8RC 3R7RA 2KDEB 4HCPB 4F7ZA 1RRBA 2KC1A 2JRIB 3M63B 2ASQA 2DZKA 3A1QB 3C0RB 3V6CB 2DYBA 1WRDB 2KWVB 2V3SA 2Z0EB 4IUMB 3RULA 4EKUA 1WR1A 2KN5A 2KDFB 4FJZA 2C7MB 2MA9B 4JIOU 2BF8B 2YLMA 5CHWA 2DAJA 3QWZB 3UIOB 1SE9A 3IG3A 4HPLB 4BOZB 2IO1B 1TTNA 2K6DB 5D6JB 2NBVB 3RUIB 2MBEA 3TJPA 3W1SC 4IC7B 1D3ZA 2LD9A 1WXMA 1FXTB 1RAXA 1YIWA 2V1YA 4DXAB 1CMXB 3PZDA 3VTWA 1NBFC 3KW5B 3SHQA 2MBBB 4GDKB 1OQYA 2KJ6A 2JPHA 3SD5A 1VD2A 3DVNU 4AWJA 3NHEB 3QCAA 3JSVB 3O65B 1LM8B 4WJPA 1V2YA 2G4DB 3A9JB 3AULA 4MGIE 1WX8A 2L0TA 5J18A 2KO3A 4NQKE 2KTRB 2IO3B 5TR5A 2DAFA 5IA7A 1ZGUB 1KOTA 3B0AA 1IP9A 3JVZX 1OEYJ 4LDTB 5CTRC 2YVCA 3L16A 3V6EB 2QHOA 2N4FA 3ZNID 4FADA 3QAQA 4F8CB 4XX5A 3ONSA 1WJ6A 4WWOA 4WAAA 1WI0A 3DOWA 4KZ0A 4BBNC 1TBEA 3K9PB 3ECIA 1WY8A 1V9JA 3KVFB 3QJZA 4II2B 4JL9A 3KH0A 4KIKB 1J19A 2XBBC 1X1MA 4HDOA 2JF5A 2L05A 4MELA 1V5TA 1WMHA 2REXA 3RYTA 2L3ZA 4MJSA 2K8BA 3ZLZA 2LXCA 2BYFA 2C60A 5D2MB 2RD0A 1KLVA 4EZJA 2M1MA 4DWFA 3W1SA 2AL3A 1WYWB 1E7UA 2NS5A 4NNJB 4M8MA 2RPQA 1EUVB 3LJ3A 3MHSD 1KM7A 5G2NA 2K6QA 2BYEA 2BWES 2FCNA 2LGYA 3EECA 4JGHB 4KVGB 2FNJB 2IO2B 4A20A 2GBRA 2ZCCA 1GUAB 3QQ8B 1WR6E 2HE7A 2J7QB 4LDTD 4NAWA 2M0XA 5DPWA 1GC7A 2KDBA 4FLHA 3OLMD 4KDIC 4IM2A 2KLGA 5D94A 4OVVA 2BKRB 4FBJB 3DVNV 1BT0A 3VQIA 3QIJA 2NVUI 4KIKA 1P3QU 1P98A 1XQQA 3PHXB 5KHOA 2KKCA 2RSUA 2O2VB 5E6NA 2IBIB 4ANWA 1SGHA 1EF1A 4LCDE 5DCNA 4YL8A 4DHJD 3RT3B 3WALA 1M94A 4IWOA 4E3CA 4FA6A 1SIFA 2O6VB 5E6PA 3A9JA 3VUYA 4BOSC 4MSMB 2WYQA 3GOEA 2D2QA 2N9XA 3Q3FA 4W9LA 4FJYA 5AZHA 2ZVNA 1QZEA 3DCGA 3WAMA 2MW5A 2O6VD 4W9GA 2R2QA 3PS6A 4GSWA 1NI2A 3V60A 2DX5B 3VFKA 2IYDB 3PGEA 4WWNA 2HTHA 3T9LA 4AP4C 4K81A 2BYVE 2JUOA 2Z0DB 5JH5C 2PEAA 2ZVOA 3PLUA 4GIVA 2N9PC 2EMTA 2GOWA 5AZGA 2PJHA 2LASA 2ZNVB 3OAWA 3CF6E 2D3GA 2DHZA 2N9EB 2XK5B 1E8YA 5CHFA 1I35A 4I6NB 2L00B 1P1AA 3BY4B 4W9JA 5C23A 3CSFA 1I42A 2KMCA 2FUHB 3ZKJC 2GBKA 5LLIA 3DBLI 4M0WB 1S3SG 1UD7A 1LQBA 2G3QB 3H6NA 1K8RB 3ALBA 4CO7A 2PE6B 4ZDVA 1WX7A 5J17A 3ZW3A 4EZKA 1WF9A 2AEHA 2ZCBA 1WZ3A 3ZIMA 3H9DA 3NZUA 2CKHB 1WGGA 2D11A 3PHWB 2JZ3B 2KTFA 2KFJA 3VH3B 1UGMA 5FR6A 5DPTA 4ANUA 3DBRI 3U30A 1WM3A 2BGFA 2NBUA 1F9JA 1E8ZA 1OGWA 3VUWA 4W9EA 5E6OA 3IVFA 5IAAC 1YQBA 4NAWB 1WIAA 4BKSA 4FN2A 1YJ1A 1WGYA 2AL6A 2IO0B 3VTVA 3BINA 3PRMB 1U4AA 2KVRA 3TCAA 4URKA 1EO6A 1WX9A 5G55A 2N1VA 2ZJDA 4HVBA 4KV2A 5HKHA 3DVGY 3K9OB 3V61A 4NQLB 2M4NA 5DPRA 2CR5A 2IY0B 3L17A 1RFAA 3TBLD 3UIPB 4OVUA 4LJOB 4WWPA 3VUXA 3ENEA 2EKEC 1E90A 2L7RA 1WH3A 5D7GA 4IWPA 3APCA 3PLVA 3ZUNA 1IPGA 2KZRA 2NBWB 4K7WA 3PT2B 3TMPB 2NCNA 3N3KB 2R2OA 4ZRIA 4B9KA 1GG3A 5AEKB 5J2RA 3A9KA 4FHKA 1J8CA 1H4RA 3RCZA 1T0YA 2GMIC 1NDDA 4XZ4A 3T8MA 3DVGX 2NPTA 2JWZA 4HXDA 2OOBB 4KSKC 4W9IA 3ZDTA 3ZNGC 2NR2A 1PQSA 2KC2A 3PRPB 4JQWC 4ANXA 2KXJA 4MH0E 4M8NA 2GBMA 3IFWB 2KMAA 1P0RA 2RGFA 4GDKA 2WX0A 4GGQA 2C5LC 4X57B 3N32A 3M62B 5CHVC 4MGKE 3PPAA 2G4SA 1V5OA 4B95A 2MBQA 3QX1A 3R3MA 4IWQA 3H7PA 2V4LA 2DZMA 3QK0A 2IZVB 2Z59B 3VVWB 2ZNVC 3PSEB 4KDLB 1Z5SB 1RLFA 1WJUA 4MEMA 4NJ6A 2KX0A 3AI5A 4KZCA 4TUUA 4PYUA 5EDSA 3IBEA 4GDLB 4MSQB 4EZLA 5L83A 4ZRJA 3W1YA 5JHAA 3HK0A 4AOFA 3PVLA 1C3TA 2J0JA 3H7SA 1TZ1A 3ZVVA 2IY1B 4HWIB 1WZ0A 1OEYA 2MX2A 3NZSA 2JRHA 2ZPNA 4DBGA 2K8CA 2LVQA 1V86A 2VRRB 4IM3A 3VTUA 3EC8A 4E74A 4BBNF 4TV3A 4ANVA 2WWZA 1R4MI 1S1QB 1R4NI 5CX3A 3VXWA 4BVUC 3ZTDA 3DBHI 4PS8A 3UINB 3ZNZB 3APDA 2C7NB 2LVOA 2MLBA 3B1LX 3R66C 2LJ5A 1E5WA 1Q0WB 3R7QA 4GOCA 3U8ZA 4P7IA 2MBHA 3PV1A 1L2NA 3KUZA 3KUDB 4AJYB 3KYDD 1GNUA 5KHQA 2FCSA 1IYFA 4DHJB 4NJ7A 1AARA 3ZRCA 1YD8U 4DDID 4TKNA 3L54A 3N30A 3ZRFA 2KQSA 3AU5A 4I6LB 3CMMB 4DHZE 3A9KB 1WE6A 1WGHA 3QARA 4PS3A 2JY6A 4WQOB 4DK5A 4W9FA 2MRPA 1Z2MA 2GBNA 2LGDA 2K25A 2NPTB 4HK2A 4AUQC 4G0NB 4HLEA 1E8XA 2GBJA 4ICVA 3VHTC 1MG8A 3RD2A 4G11A 2FIFA 1P9DU 2L8JA 3QHTA 4K1RB 3H1UA 4EOYA 4W9CA 3X0WA 4AJWA 2KFKA 1EF5A 3TL5A 1OTRB 3NS8A 3KUCB 1Q1OA 3Q3JA 3QC8B 4W9DA 4G50A 3AU4A 3X23A 2MQJA 1WE7A 4MDKE 3H7PB 1E8WA 3MTNB 1UELA 4FHJA 3NOBA 2KDIA 2MP2B 4DHZB 2MCNB 5JHBA 2JVCA 2C9WB 1KJTA 4ZYNA 4IG7B 4XC2A 1JRUA 4J6IA 3L0WB 2AYOB 1WGDA 2K1FA 3LDZE 5GMVA 3CSTA 1V81A 4W9HA 2KJHB 3L10B 1WXVA 2J0KA 2KD0A 3PTFC 2DYOA 3WIMA 3ZDMC 2LZ6A 2UWQA 3HM3A 1LFDA 4MM3A 2FCQA 2C7HA 2L76A 3A4RA 2DZJA 3PREA 2KJRA 1H8CA 2KWUB 4MJSB 4GXBA 4LJPB 4JLCA 2BKFA 3ZNHB 2ZZPB 4CHKA 2MSED 2O6VA 2XEWA 3WA0A 2JT4B 2A4ZA 5DPSA 2KHWB 2CS4A 3EFUA 3PRZA 1VCBA 2PPHA 2LUEA 3M3JA 2DYMA 4IM0A 1WM2A 3OJ4B 4MGZE 2B3AA 1UH6A 2FCMA 3HM6X 3WAPA 2J0MA 2KANA 2M8SA 1WJ4A 3NY5A 3DQVA 2I1KA 4TQ1A 2ZPYA 2JXXA 1GC6A 3ML8A 2LI5A 3A1QA 5AZFA 1E7VA 1ISNA 2CU1A 2KK8A 2HD5B 4ASWC 2MBOA 2UYZB 4K7UA 4WJQA 4GB9A 2KWCA 4KSLC 1WGRA 1UBIA 3B08A 4RM9A 2D07B 3M95A 2KNBA 3OJ3A 4WJNA 4EEWA 2KTRA 5JZEB 4BKGA 1Q5WB 4CYEA 4FJVB 3RZWC 3DBSA 2KX3A 2LRWA 1G6JA 2O2VA 2AWTA 2CHZA 3DPDA 4F1SA 3JW0X 1XT9B 2EMSA 4MGYE 3UQAA 1XD3B 3SU8X 4E71A 2KOXA 4NY0A 4NPNA 3ML9A 3VDZA 4A3PA 1V80A 1ZW7A 3TIXA 1A5RA 3RZFA 2KQ7A 4EUTA 4RMAA 4TQ0A 2FIDA 4GN1A 2LWPA 4BKSD 4K7SA 2HJ8A 2LXAA 5C1ZA 2K8HA 1V49A 5L95C
chains in the Genus database with same CATH superfamily
4N9F4 4B6WA 1OFFA 1ZDXA 3NRZA 2BWFA 2V3NA 3Q2AC 1N63A 2L0FA 3SDLC 3VH4B 2I1JA 2XK5A 4G3XB 2N7DA 4PS7A 2K39A 2DBYA 2MP2A 2W9NA 2D10A 2OJRA 1T0SC 1STEA 4DDGD 3SFEB 3CIRB 2WDTB 3T3OA 1UBQA 4HJKA 4RM8A 4HCNB 1YN3A 3GZNI 2QDFA 3UGBB 4N58A 1I4HA 1C1YB 2JZPA 2G45B 4I6PA 1QOBA 4FULA 2CHXA 3D32A 4EFOA 1MHXA 3AEGB 3UF8A 2WDVB 1L7YA 1FNWA 5LXHA 2DZIA 3ZTCA 1Y8RC 3Q6BA 1RRBA 3RFZB 1FMAD 2BW2A 4FJZA 2D3BA 2YLMA 5CHWA 1UGJA 3LB8C 1FNVA 2IO1B 5E6JA 4HEA1 2W3SA 3RUIB 2NBVB 3ZXRA 3TJPA 3W1SC 1WYGA 1C79A 1JALA 1D5MC 1D3ZA 4OVZA 5IKCM 2ZW0A 1VD2A 3NHEB 4KX6B 3O65B 1TIFA 1MG4A 2DAFA 3E9SA 3RNGC 1OEYJ 5CTRC 4D2KA 4C7ZA 3QAQA 3HVDA 4F8CB 3ONSA 1WJ6A 4WWOA 4TMAB 4QAYA 3ECIA 1DOXA 1Q10A 2WXFA 1DYQA 3B2GA 1X1MA 2WXGA 4HDOA 1WMHA 3RYTA 1I4RA 2K8BA 3ZLZA 1FPYA 3LXFA 2RD0A 1KLVA 4EZJA 2M1MA 1I4QA 2J53A 2AL3A 1JCKB 2GB1A 1PDXA 3MHSD 1T5XD 2K6QA 3I9V1 4LNIA 4HPPA 2BYEA 4KVGB 1KH0A 2TSSA 4AQ7A 1SEBD 2J7QB 4P1CC 1WRIA 1F52A 4OVVA 2Y3AA 4FBJB 3DVNV 1R4MB 3FILA 2KMMA 2OEDA 3QIJA 4XDCA 4KIKA 1XQQA 4WAFA 5KHOA 2Y5CA 1KLUD 3R8BA 4ANWA 1E0ZA 5DCNA 1PGAA 3WALA 2L52A 3MHZA 2ACZB 2NTTA 2N9XA 4UDUC 1F0ZA 4USAA 1QZEA 1NENB 4W9GA 1D5ZC 3PS6A 4WURA 4GSWA 3V60A 2DX5B 3VFKA 2IYDB 4AP4C 3T9LA 1CJEA 3TEYA 2WXLA 1BMLC 2BYVE 1YN5A 2N9PC 2EMTA 4OHJA 1L4ZB 2DHZA 2XK5B 2QIEB 1JWUD 3KLSX 2M19A 3J9CA 2L00B 1SJHD 3CSFA 2FUHB 1FNUA 3ABVB 5LLIA 1S3SG 2HJ1A 2PE6B 5J17A 3ZW3A 1T3QA 1K51A 1WZ3A 2CKHB 1WGGA 4JPSA 5FR6A 1PYWD 4IKGA 1SSNA 5DPTA 4ANUA 1WM3A 2ZW1A 3BVZA 2NBUA 3MC9A 3AEAB 5IAAC 1FM0D 1TS3A 2WXIA 3NVYA 2N0SB 4YTMB 5HKHA 2M4NA 2G9HD 4YXDB 2CR5A 3UIPB 4WWPA 2L7RA 5D7GA 3ZUNA 4ZRIA 2QMTA 1MFWA 4FHKA 3T8MA 2NPTA 4KSKC 3BIID 1GB1A 3AE2B 4JQWC 3U4EG 3B2FA 3IFWB 4GDKA 4GGQA 4X57B 1E6EB 1WWTA 3M62B 3Q3MC 1VRAB 2MBQA 4A9AA 1PGXA 1FRRA 3H7PA 2V4LA 2DZMA 3QK0A 2K0PA 3BZDB 2IZVB 1Z5SB 1WJUA 2BS3B 4MEMA 4NAMA 4PYUA 4MSQB 1C3TA 2KN4A 3ZVVA 1OEYA 3NZSA 4ITKA 4DXGA 4LTUA 2Z8LA 2LVQA 3EC8A 3L4PA 4E74A 4TV3A 2K22A 1JWMD 5CX3A 1I4PA 3ZTDA 5HI1A 3R66C 1Q0WB 4YTPB 2MBHA 1ACCA 1IYFA 3FKYA 1ET9A 3DWMA 4NJ7A 1SB3C 1YD8U 3DBHB 4YSZB 3N30A 3ZRFA 3CMMB 1WE6A 3QARA 2GI9A 5C2TB 3RPFC 4RFBA 2LMCA 4DK5A 1AWDA 1NYQA 4AUQC 4HLEA 1E8XA 5BYRA 1L0VB 2L8JA 3X0WA 1EF5A 3TL5A 1T6BX 4W9DA 3AU4A 2PVOD 1AYFA 4M00A 1NYRA 1UELA 3NOBA 1MJDA 1QOFA 2C9WB 4ZYNA 1JRUA 4J6IA 3C19A 2V4IB 1JMLA 4ARCA 2KJHB 2KD0A 4P6VF 3WIMA 1L5PA 2LZ6A 3HM3A 4L23A 3PREA 4MJSB 2ZZPB 4CHKA 2MSED 3AE4B 2A4ZA 1C4CA 3EFUA 1VCBA 4YSYB 1DOYA 4IM0A 4MGZE 4AS1A 1WJ4A 1YNTE 3DQVA 4TQ1A 5C3JB 4KGRA 3ML8A 1ISNA 2CU1A 1L4DB 2HD5B 2MBOA 4WJQA 4ASWC 3B08A 2D07B 3M95A 4EEWA 2KTRA 5JZEB 4CYEA 2VZKB 2KX3A 2LRWA 2AWTA 3DPDA 2VH2A 1E10A 4LNNA 3SU8X 1VDVA 3AE5B 4A3PA 1JWAD 1UUPA 3TIXA 2WXJA 2AQ2B 2LWPA 2LXAA 1NI3A 5C1ZA 3AE3B 1P7EA 2KFKB 4BFRA 2WU5B 2VH1A 4W9KA 3A4SC 2LHDA 1YX5B 2K9XA 1UZXB 3EHVA 4II3B 3MC0B 4Q2JA 3U7DA 4ZYSA 3I3TB 5JXVA 1KFYB 1C78A 1FXAA 1J7AA 4A3OA 3L08A 3WAOA 4HKQA 3UQBA 4ZRKA 4HPMB 3S2AA 3TEWA 2LJIA 2BPSA 1WJNA 2KLCA 2JZZA 4BKTA 1WXSA 1LXDA 3P2BA 5BMIA 1CQVA 2DENB 4N59A 4HCPB 4F7ZA 4FXCA 2KC1A 2JRIB 4J3OD 3M63B 1XLNA 1N5XA 2ASQA 3A1QB 1TS4A 2KDMA 1WRDB 4IUMB 2Z0EB 5I4DA 1WR1A 3RNBC 2WLBA 4JIOU 1F2RC 3RNCC 3W9CB 4XYCA 3UIOB 5FKAC 4BOZB 1YQ3B 2H88B 2PVGC 2INNE 2K6DB 3ZXVA 1QQRA 3GB1A 1GOZA 2LD9A 1WXMA 4K3BA 1RAXA 1YIWA 3NZ3A 3ZGZA 1NBFC 1T0QC 2W3RA 3KW5B 3SHQA 3AE7B 3SD5A 4AWJA 3DVNU 1V8CA 1GAQB 2INPE 1HXYD 2G4DB 1ZOYB 3A9JB 3EA6A 4P16A 4MGIE 4NQKE 3RMKC 4OW0A 5TR5A 4JX1C 3B0AA 1IP9A 1F1HA 2N4FA 2Y5PA 1UF0A 1BUIC 4WAAA 3N1XC 4BBNC 2PW9A 1TBEA 3K9PB 1XXGA 1WY8A 4II2B 3KVFB 4KIKB 3AM9A 2XBBC 2L05A 2DLBA 2BT6A 1J7BA 3P42A 3IXSA 1JRPA 4DWFA 2KYWA 2QEJC 1E7UA 1JQ4A 2LHEA 2INCC 3VR9B 3NVWA 1KRHA 2IPKD 4PK1A 2WP9B 3EECA 2BWES 2FCNA 3P4QB 4JGHB 3Q3NC 4LNFA 3RNEC 1WR6E 3Q8CA 4NAWA 5DPWA 2KDBA 4FLHA 4KDIC 3DHHC 2KLGA 5D94A 2KKCA 2RSUA 2O2VB 2IBIB 3B9JA 3RT3B 1QKZA 1M94A 4FA6A 2V0GA 1SIFA 4HROA 3Q3FA 4W9LA 2INDC 2ZVNA 1SE3A 2O6VD 3TEXA 4XE0A 2HTHA 3BK1A 1SXTA 2JUOA 2JX5A 2Z0DB 3ZQ4A 3PLUA 4MM3B 2LASA 2ZNVB 3OAWA 3CF6E 2JSVX 3DHGC 1E8YA 4I6NB 1P1AA 2H89B 1TZOA 1I42A 2KMCA 2V9HA 1V97A 3H6NA 3NVZA 1TKGA 1K8RB 1M4VA 2WXRA 3ALBA 3PO0A 2LGSA 3NZUA 2JXTA 2JZ3B 2KFJA 3U30A 2PMVA 1E8ZA 1JWSD 2SEBD 2WXMA 4W9EA 3HRDD 5LNK1 1WGYA 2AL6A 1TS2A 3BINA 3VTVA 1NVID 4KV2A 5EE0A 4S0RA 4ZHOA 5TSSA 3TBLD 5IP4D 2CJOA 3VUXA 3ENEA 1E90A 1XO3A 4IWPA 2I38A 5D3IB 3PT2B 1ZP0B 3TMPB 3N3KB 2KAJA 1SE4A 3BVGA 2UU7A 5J2RA 1C4AA 3R2IA 1H4RA 3BYYB 2MJ3A 1NDDA 3DVGX 2OOBB 2RDBC 1Y56A 3ZNGC 1PQSA 2KC2A 3PRPB 2W54A 4B0MA 4M8NA 4RH6A 2KMAA 2IGHA 4KKJA 2C5LC 4MGKE 4B95A 3QX1A 1IBXB 1C76A 2Z59B 2WXKA 2K3UA 1TJEA 4TUUA 1I4XA 1EM7A 3IBEA 5L83A 1LGRA 5JHAA 3HK0A 3PVLA 1TZ1A 1C9FA 4HWIB 4OZCA 1WZ0A 2MX2A 2HDEA 3MC8A 1IUEA 1SE2A 1WXQA 1R4NI 3VXWA 3ZJTA 3UINB 4MH8A 2N9LA 2C7NB 3CWIA 2MLBA 3BK2A 1E7PB 4MACA 3R7QA 3T3NA 3U8ZA 2W82A 4AJYB 3KYDD 1GNUA 3EGRA 1AARA 4DQOC 4TKNA 4XWTA 4XWWA 2L1AA 1HTQA 2JY6A 3DBRB 1V1OA 2LGDA 2WXQA 2EELA 2KT7A 4ICVA 2GBJA 2NMQA 3OWEB 3VHTC 3RD2A 4G11A 2FIFA 1P9DU 2KFKA 5IOIA 1C77A 3QC8B 4G50A 3X23A 1WE7A 1F2RI 2MCNB 1ZDVA 4YWGG 1KJTA 4IG7B 3V05A 3AEDB 3RI7C 2E6XA 1SIJA 5GMVA 4W9HA 3N9YC 1WXVA 3PTFC 3ZDMC 2FE8A 1LFDA 4MM3A 4C80A 1RFKA 2FCQA 2C7HA 5GXGB 3KQ4A 2OJWA 4NJCA 1H8CA 1MHHE 4LJPB 4JLCA 2QJLA 2BKFA 3N20C 2O6VA 1N5WA 2JT4B 3SEBA 5DPSA 3IT4B 5D3DA 2PPHA 4RF0A 2FCMA 3HM6X 3WAPA 2KANA 2I1KA 2WDQB 2ZPYA 2JXXA 1KF6B 1XLPA 1GC6A 3RN9C 2LI5A 3A1QA 1E7VA 2KK8A 2UYZB 1WGRA 2KNBA 1Q5WB 3RZWC 4LNKA 1JWBD 3JW0X 2QC8A 4MGYE 4E71A 2KOXA 3URYA 5BYQA 1R4NB 1B9RA 2WGSA 1A5RA 5AUKA 2KQ7A 4RMAA 2FIDA 2HJ8A 4ZHPA 1P7FA 1V49A 5L95C 3MP9A 1HE8A 1YX6B 2PE9A 3BWUD 4IW0A 3QA8A 3HHMA 4REZA 1ENFA 3AXCA 1I4GA 2JQRB 4O1NA 2WX1A 1D4BA 2J42A 3U2SC 3NUHB 3UI3A 3AE1B 1IBXA 2ZEQA 2LGXA 1ZKHA 2JU6X 4XGAB 1V1PA 4HKZE 3DDCB 2A5UA 5EE1A 3W5VB 2WDRB 1AN8A 3TEZA 2FAZA 5EE3A 4GDLA 3L13A 4IOIE 5H92C 3HIZA 1WMHB 3WANA 3U7ZA 4KKIA 2IGGA 3VAWA 1SJED 1ESFA 4R3DA 2ICIA 2LVPA 2CHWA 2M17A 2RR9A 1EWCA 1PGBA 4ICUA 3A33B 4KGTA 4WJOA 3R7RA 3VRAB 2L32A 4YSXB 2DZKA 3RULA 2KN5A 2KDFB 4RGOS 2C7MB 2DAJA 3QWZB 1SE9A 4HPLB 1TTNA 5D6JB 1FO4A 4IC7B 2WNMA 1QILA 5FR3A 2V1YA 4DXAB 1CMXB 3GZNB 4A90A 5HHDG 2MBBB 4GDKB 1OQYA 3JSVB 4WJPA 1K52A 2HTME 2KO3A 2KTRB 2IO3B 1ZGUB 1KOTA 3Q8AA 2W55A 3JVZX 2I2YA 4LDTB 4LLGM 2YVCA 3V6EB 2QHOA 3BVMA 3MJ5A 3ZNID 4XX5A 1WI0A 3U52E 3GS2A 2MJDA 2PLPA 3IAM1 1TS5A 2REXA 3P63A 3FC4A 2RDHA 2C60A 2KACA 4KGSA 1F77A 4IDIA 1WYWB 4NNJB 1EUVB 3LJ3A 3GE8C 5G2NA 4L1BA 2L83A 3GP7A 2LGYA 1HA5A 3OG5A 4A20A 2GBRA 1GUAB 3QQ8B 2M0XA 3OLMD 2MH7A 4IM2A 2BKRB 1BT0A 3VQIA 1P98A 4M0WA 4WH4A 3NS1A 4CQNA 5E6NA 4LCDE 4DHJD 2XNAC 3AH7A 4IWOA 3AV8A 3NG0A 3HUIA 3VUYA 4MSMB 2WYQA 4S17A 2D2QA 4FJYA 3DCGA 3ZYYX 2R2QA 2LFIA 2QSDA 1T0RC 3PGEA 4K81A 2PEAA 2ZVOA 2GOWA 5AZGA 2N9EB 5CHFA 4US9A 1I35A 1IGCA 3MFGA 3BY4B 4W9JA 5C23A 4JWSC 3ZKJC 2GBKA 4N6EB 5H8YE 3DBLI 4RGTA 2G3QB 3Q3OC 4CO7A 1WF9A 2AEHA 2ZCBA 3ZIMA 3H9DA 2D11A 3LYYA 2KTFA 3VH3B 1UGMA 4ZOHC 3DBRI 2BGFA 1XF5L 1F9JA 1HTOA 4RCOA 3IVFA 1YQBA 1WIAA 4BKSA 4FN2A 1YJ1A 1N6ZA 1WGKA 3PRMB 3PZ7A 4URKA 1EO6A 1WX9A 1BXTA 2N1VA 3DVGY 3K9OB 3V61A 4NQLB 2WHIA 2IY0B 3L17A 4ZRQA 1RFAA 2KQ4X 4OVUA 3DWGC 1HZ6A 3APCA 3PLVA 1IPGA 2KZRA 2NBWB 4K7WA 1ZE3D 2NCNA 1GG3A 3A9KA 2GMIC 4XZ4A 4HXDA 3ZDTA 2KXJA 4RGNA 1P0RA 1JROA 2WX0A 1QOGA 4YT0B 3N32A 5CHVC 2JYTA 2G1EA 1V5OA 3P4RB 2N7JA 3R3MA 4IWQA 1QOAA 4P1BC 1IGDA 3IAS1 3IT6B 3VVWB 2ZNVC 4KDLB 1K50A 1FCLA 2KX0A 3AI5A 4KZCA 4C4VB 5HFYA 4AOFA 2J0JA 1RWSA 2JRHA 2K8CA 1V86A 2VRRB 4IM3A 3VTUA 4BBNF 4ANVA 3KWLA 2WWZA 4ZRPA 1XLOA 1ZXIA 4BVUC 3AEEB 4ACFA 3DBHI 4PS8A 1VJKA 3APDA 2LVOA 1L6UA 3AMZA 1GB4A 4TSSA 2X38A 1YJJA 1PUTA 1L2NA 3KUZA 5KHQA 4OZBA 4RF1A 1HQRD 4M01A 3ZJVA 4A55A 3ZRCA 4DDID 3Q14C 2BS2B 2KQSA 4I6LB 5BMGA 3A9KB 5BYSA 1WGHA 1A70A 2LEKA 4W9FA 2MRPA 1Z2MA 2GBNA 2NPTB 2K25A 4RGMA 4C7YA 1L6VA 1MG8A 4K1RB 1UNSA 3KWVA 4EOYA 3H1UA 4W9CA 3KUCB 3WCQA 3H7PB 2K5PA 1E8WA 4FHJA 1N60A 3AECB 2MP2B 4B0EA 2GRIA 2JVCA 2AX5A 4XC2A 3L0WB 2AYOB 1WGDA 4C4VA 2VZKD 3LDZE 2CU3A 3NJTA 3TUOA 2J0KA 3A4RA 2KJRA 3V3XA 2YEPF 3ZNHB 2MEKA 2E3TA 3I5JC 2KHWB 3PRZA 2LUEA 3M3JA 1N61A 3W5UB 2DYMA 3FAHA 1FRDA 2NTSA 2WXOA 4WQMA 2WXPA 3OJ4B 1UH6A 2FBWB 2M8SA 3NY5A 1TT5B 1YN4A 1B1ZA 3C8YA 4GB9A 2BB5A 4KSLC 4ARIA 1UBIA 4WJNA 4BKGA 4FJVB 4MT5A 1GPXA 3BYTB 1G6JA 2O2VA 2CHZA 4RNAA 3VRBB 4F1SA 1I7HA 1XEEA 2EMSA 3UQAA 2LUMA 4NY0A 4NPNA 1ZUD2 3ML9A 3VDZA 1V80A 1ZW7A 4EUTA 4GN1A 4BKSD 4K7SA 2FUG1 3N1YC 4GMVA 1L0XB 3V62A 2JYEA 5G5GA 5BMHA 2MWSB 3RNFC 1C4PA 1FFUA 2LRUA 3ETRA 2XN9C 2PTLA 3DBLB 3JYUA 2BVCA 1VZ8A 1FCCC 1K53A 2Q5WD 4PYZA 1J0GA 4PT5A 1YJIA 3APFA 4GU2A 1WXAA 3I57A 1TKEA 1V6EA 2QILA 3AN1A 3IHPC 2N1WA 1GJZA 5T8IA 3KYCD 5LXIB 4HDQA 3MJWA 3ZO5B 1WFYA 1TGZB 3JSVA 3SFDB 2N7EA 5BO4B 5MPOA 2WXNA 2Y5BB 2KDEB 3C0RB 3V6CB 1TY2A 2DYBA 2KWVB 2OHFA 2V3SA 4EKUA 2MA9B 2BF8B 3FILB 5EE9A 3IG3A 1EU4A 1FEHA 2MBEA 1L0YB 2BTEA 1FXTB 1YOVB 1PFDA 4BZAA 3PZDA 3VTWA 1XCTL 1JW9D 4A6QA 2KJ6A 2JPHA 2WXHA 1RYJA 3QCAA 3RNAC 1LM8B 1V2YA 2ON8A 3AULA 1WX8A 2L0TA 5J18A 1YQ4B 5IA7A 3AE6B 3TSSA 3L16A 2IJ0A 3P4SB 3AEFB 4FADA 1DGJA 3Q69A 4KZ0A 3DOWA 3Q8BA 2AQ3B 1V9JA 3QJZA 3PZ8A 4JL9A 3KH0A 1J19A 1KTKA 2JF5A 3O13A 4MELA 3Q8EA 1V5TA 1D6EC 2L3ZA 4MJSA 3P1MA 2LXCA 2BYFA 5D2MB 3AEBB 3W1SA 3E56A 1J7CA 1QLBB 2NS5A 4M8MA 2RPQA 2CJNA 4HJGE 2JWUA 2N9KA 2V3PA 1XLQA 3R2TA 1KM7A 2KVZA 1QT9A 2FNJB 2IO2B 3AE9B 2ZCCA 2PKOA 2HE7A 4LDTD 2IDYA 1GC7A 3EUB2 1EU3A 2PIAA 4XDDA 2NVUI 1P3QU 3PHXB 1FXIA 4C00A 1SGHA 1EF1A 2IGDA 4YL8A 2AQ1B 4E3CA 2O6VB 5E6PA 3A9JA 4BOSC 2M56B 3GOEA 3W2DA 5AZHA 3ZJUA 3WAMA 2MW5A 1NI2A 4WWNA 5HG2A 5JH5C 4GIVA 2EKIA 1VLBA 1SF0A 2PJHA 4H2AA 4M02A 2D3GA 4WWMA 3P4PB 4M0WB 1UD7A 1LQBA 1TKYA 4K3CA 4ZDVA 1WX7A 4EZKA 1N62A 3PHWB 3SR6A 1WSPA 1VZ7A 3VUWA 1OGWA 5E6OA 4LNOA 4NAWB 1OQRA 2IO0B 1CZPA 1CK1A 1U4AA 2KVRA 3TCAA 4HVBA 5G55A 2ZJDA 5DPRA 3VR8B 2BQQA 4LJOB 1NEKB 2EKEC 1WH3A 2RDGA 2MJEA 1SBBB 1E9MA 2R2OA 1UWXA 5G5HA 4B9KA 1R7SA 5AEKB 3H8HA 1RM6C 1J8CA 3RCZA 1T0YA 2JWZA 4C56C 4W9IA 1TYGB 4ANXA 2NR2A 2WS3B 1ZPSA 4MH0E 2GBMA 2RGFA 3PPAA 2G4SA 2SAKA 3AB5A 4BAXA 3N1ZC 1D5XC 1V1PB 3PSEB 1EWYC 1RLFA 4NJ6A 5EDSA 4GDLB 3AE8B 4EZLA 4ZRJA 5FK9C 1HZ5A 3W1YA 1FIQA 3H7SA 4NZLB 1UWMA 2IY1B 2ZPNA 4DBGA 1DOIA 2X8XX 3EFCA 1MI0A 1MVKA 1R4MI 1S1QB 3DHIC 2D3AA 2LGIA 2GLSA 2QCZA 1KLGD 3ZNZB 3B1LX 2LJ5A 1E5WA 1LO5D 4GOCA 4P7IA 3PV1A 1AW7A 3KUDB 2FCSA 2BBCA 4DHJB 2D3CA 1QF6A 4DXFA 3L54A 3HVZA 3AU5A 4DHZE 2R61A 2WU2B 4PS3A 2M0AA 4L2YA 4WQOB 1HEZE 4HK2A 1ZXHA 4G0NB 5IO9A 5AUIA 3QHTA 2D5GA 4GLSC 4AJWA 1OTRB 3NS8A 1Q1OA 3Q3JA 2YEPB 3Q8FA 2MQJA 2DWQA 4MDKE 2MHJA 1FFVA 3MTNB 1MPEA 2KDIA 4DHZB 5JHBA 2K1FA 3CSTA 1V81A 1XCQL 2BS4B 3L10B 2BYTA 2DYOA 2UWQA 2RPVA 2L76A 4OZAA 2DZJA 2KWUB 4GXBA 1ET6A 4JWUC 1VR9A 2XEWA 3WA0A 3GE3C 2BB6A 1ROEA 2CS4A 4LK0M 2J52A 2WQYB 1WM2A 4US8A 4HRSA 2B3AA 2J0MA 2RMMA 1FD6A 4A8XC 5IN7A 1YMHE 2J4XA 5AZFA 1VZ6A 3NVVA 4K7UA 2KWDA 2KWCA 4WIPA 1TY0A 1OQQA 4RM9A 2ONQA 3OJ3A 4EE2A 2DNFA 3DBSA 1XT9B 4JE3B 1XD3B 2B76B 4YTNB 3RZFA 4TQ0A 3I63C 2K8HA
chains in the Genus database with same CATH topology
1HE8A 4N9F4 4GMVA 4B6WA 1YX6B 2KFKB 2PE9A 4BFRA 2BWFA 4IW0A 3V62A 3QA8A 3HHMA 2L0FA 4W9KA 2MWSB 3SDLC 3VH4B 3A4SC 2I1JA 2XK5A 4G3XB 3AXCA 2N7DA 2LRUA 4PS7A 1YX5B 2K39A 2MP2A 2W9NA 3JYUA 2D10A 2WX1A 1UZXB 2OJRA 4PYZA 4DDGD 3EHVA 2WDTB 4II3B 1J0GA 2ZEQA 2LGXA 1ZKHA 3U7DA 1UBQA 3APFA 3I3TB 4HJKA 4RM8A 4GU2A 4HCNB 1WXAA 3GZNI 4A3OA 3DDCB 1V6EA 3L08A 3UGBB 2A5UA 3IHPC 3WAOA 2FAZA 2N1WA 4GDLA 1GJZA 3L13A 1C1YB 3HIZA 1WMHB 2G45B 3WANA 3UQBA 4ZRKA 4I6PA 3KYCD 4FULA 2CHXA 3D32A 4HPMB 3S2AA 3VAWA 4EFOA 4HDQA 5LXIB 2BPSA 1WJNA 2KLCA 3MJWA 2LVPA 2CHWA 2JZZA 3ZO5B 1WFYA 1TGZB 2M17A 2RR9A 2N7EA 3JSVA 5BO4B 3UF8A 4BKTA 1L7YA 1WXSA 5LXHA 4ICUA 1LXDA 3A33B 2Y5BB 3P2BA 2DZIA 4WJOA 3ZTCA 2DENB 1Y8RC 3R7RA 2KDEB 4HCPB 4F7ZA 1RRBA 2KC1A 2JRIB 3M63B 2ASQA 2DZKA 3A1QB 3C0RB 3V6CB 2DYBA 1WRDB 2KWVB 2V3SA 2Z0EB 4IUMB 3RULA 4EKUA 1WR1A 2KN5A 2KDFB 4FJZA 2C7MB 2MA9B 4JIOU 2BF8B 2YLMA 5CHWA 2DAJA 3QWZB 3UIOB 1SE9A 3IG3A 4HPLB 4BOZB 2IO1B 1TTNA 2K6DB 5D6JB 2NBVB 3RUIB 2MBEA 3TJPA 3W1SC 4IC7B 1D3ZA 2LD9A 1WXMA 1FXTB 1RAXA 1YIWA 2V1YA 4DXAB 1CMXB 3PZDA 3VTWA 1NBFC 3KW5B 3SHQA 2MBBB 4GDKB 1OQYA 2KJ6A 2JPHA 3SD5A 1VD2A 3DVNU 4AWJA 3NHEB 3QCAA 3JSVB 3O65B 1LM8B 4WJPA 1V2YA 2G4DB 3A9JB 3AULA 4MGIE 1WX8A 2L0TA 5J18A 2KO3A 4NQKE 2KTRB 2IO3B 5TR5A 2DAFA 5IA7A 1ZGUB 1KOTA 3B0AA 1IP9A 3JVZX 1OEYJ 4LDTB 5CTRC 2YVCA 3L16A 3V6EB 2QHOA 2N4FA 3ZNID 4FADA 3QAQA 4F8CB 4XX5A 3ONSA 1WJ6A 4WWOA 4WAAA 1WI0A 3DOWA 4KZ0A 4BBNC 1TBEA 3K9PB 3ECIA 1WY8A 1V9JA 3KVFB 3QJZA 4II2B 4JL9A 3KH0A 4KIKB 1J19A 2XBBC 1X1MA 4HDOA 2JF5A 2L05A 4MELA 1V5TA 1WMHA 2REXA 3RYTA 2L3ZA 4MJSA 2K8BA 3ZLZA 2LXCA 2BYFA 2C60A 5D2MB 2RD0A 1KLVA 4EZJA 2M1MA 4DWFA 3W1SA 2AL3A 1WYWB 1E7UA 2NS5A 4NNJB 4M8MA 2RPQA 1EUVB 3LJ3A 3MHSD 1KM7A 5G2NA 2K6QA 2BYEA 2BWES 2FCNA 2LGYA 3EECA 4JGHB 4KVGB 2FNJB 2IO2B 4A20A 2GBRA 2ZCCA 1GUAB 3QQ8B 1WR6E 2HE7A 2J7QB 4LDTD 4NAWA 2M0XA 5DPWA 1GC7A 2KDBA 4FLHA 3OLMD 4KDIC 4IM2A 2KLGA 5D94A 4OVVA 2BKRB 4FBJB 3DVNV 1BT0A 3VQIA 3QIJA 2NVUI 4KIKA 1P3QU 1P98A 1XQQA 3PHXB 5KHOA 2KKCA 2RSUA 2O2VB 5E6NA 2IBIB 4ANWA 1SGHA 1EF1A 4LCDE 5DCNA 4YL8A 4DHJD 3RT3B 3WALA 1M94A 4IWOA 4E3CA 4FA6A 1SIFA 2O6VB 5E6PA 3A9JA 3VUYA 4BOSC 4MSMB 2WYQA 3GOEA 2D2QA 2N9XA 3Q3FA 4W9LA 4FJYA 5AZHA 2ZVNA 1QZEA 3DCGA 3WAMA 2MW5A 2O6VD 4W9GA 2R2QA 3PS6A 4GSWA 1NI2A 3V60A 2DX5B 3VFKA 2IYDB 3PGEA 4WWNA 2HTHA 3T9LA 4AP4C 4K81A 2BYVE 2JUOA 2Z0DB 5JH5C 2PEAA 2ZVOA 3PLUA 4GIVA 2N9PC 2EMTA 2GOWA 5AZGA 2PJHA 2LASA 2ZNVB 3OAWA 3CF6E 2D3GA 2DHZA 2N9EB 2XK5B 1E8YA 5CHFA 1I35A 4I6NB 2L00B 1P1AA 3BY4B 4W9JA 5C23A 3CSFA 1I42A 2KMCA 2FUHB 3ZKJC 2GBKA 5LLIA 3DBLI 4M0WB 1S3SG 1UD7A 1LQBA 2G3QB 3H6NA 1K8RB 3ALBA 4CO7A 2PE6B 4ZDVA 1WX7A 5J17A 3ZW3A 4EZKA 1WF9A 2AEHA 2ZCBA 1WZ3A 3ZIMA 3H9DA 3NZUA 2CKHB 1WGGA 2D11A 3PHWB 2JZ3B 2KTFA 2KFJA 3VH3B 1UGMA 5FR6A 5DPTA 4ANUA 3DBRI 3U30A 1WM3A 2BGFA 2NBUA 1F9JA 1E8ZA 1OGWA 3VUWA 4W9EA 5E6OA 3IVFA 5IAAC 1YQBA 4NAWB 1WIAA 4BKSA 4FN2A 1YJ1A 1WGYA 2AL6A 2IO0B 3VTVA 3BINA 3PRMB 1U4AA 2KVRA 3TCAA 4URKA 1EO6A 1WX9A 5G55A 2N1VA 2ZJDA 4HVBA 4KV2A 5HKHA 3DVGY 3K9OB 3V61A 4NQLB 2M4NA 5DPRA 2CR5A 2IY0B 3L17A 1RFAA 3TBLD 3UIPB 4OVUA 4LJOB 4WWPA 3VUXA 3ENEA 2EKEC 1E90A 2L7RA 1WH3A 5D7GA 4IWPA 3APCA 3PLVA 3ZUNA 1IPGA 2KZRA 2NBWB 4K7WA 3PT2B 3TMPB 2NCNA 3N3KB 2R2OA 4ZRIA 4B9KA 1GG3A 5AEKB 5J2RA 3A9KA 4FHKA 1J8CA 1H4RA 3RCZA 1T0YA 2GMIC 1NDDA 4XZ4A 3T8MA 3DVGX 2NPTA 2JWZA 4HXDA 2OOBB 4KSKC 4W9IA 3ZDTA 3ZNGC 2NR2A 1PQSA 2KC2A 3PRPB 4JQWC 4ANXA 2KXJA 4MH0E 4M8NA 2GBMA 3IFWB 2KMAA 1P0RA 2RGFA 4GDKA 2WX0A 4GGQA 2C5LC 4X57B 3N32A 3M62B 5CHVC 4MGKE 3PPAA 2G4SA 1V5OA 4B95A 2MBQA 3QX1A 3R3MA 4IWQA 3H7PA 2V4LA 2DZMA 3QK0A 2IZVB 2Z59B 3VVWB 2ZNVC 3PSEB 4KDLB 1Z5SB 1RLFA 1WJUA 4MEMA 4NJ6A 2KX0A 3AI5A 4KZCA 4TUUA 4PYUA 5EDSA 3IBEA 4GDLB 4MSQB 4EZLA 5L83A 4ZRJA 3W1YA 5JHAA 3HK0A 4AOFA 3PVLA 1C3TA 2J0JA 3H7SA 1TZ1A 3ZVVA 2IY1B 4HWIB 1WZ0A 1OEYA 2MX2A 3NZSA 2JRHA 2ZPNA 4DBGA 2K8CA 2LVQA 1V86A 2VRRB 4IM3A 3VTUA 3EC8A 4E74A 4BBNF 4TV3A 4ANVA 2WWZA 1R4MI 1S1QB 1R4NI 5CX3A 3VXWA 4BVUC 3ZTDA 3DBHI 4PS8A 3UINB 3ZNZB 3APDA 2C7NB 2LVOA 2MLBA 3B1LX 3R66C 2LJ5A 1E5WA 1Q0WB 3R7QA 4GOCA 3U8ZA 4P7IA 2MBHA 3PV1A 1L2NA 3KUZA 3KUDB 4AJYB 3KYDD 1GNUA 5KHQA 2FCSA 1IYFA 4DHJB 4NJ7A 1AARA 3ZRCA 1YD8U 4DDID 4TKNA 3L54A 3N30A 3ZRFA 2KQSA 3AU5A 4I6LB 3CMMB 4DHZE 3A9KB 1WE6A 1WGHA 3QARA 4PS3A 2JY6A 4WQOB 4DK5A 4W9FA 2MRPA 1Z2MA 2GBNA 2LGDA 2K25A 2NPTB 4HK2A 4AUQC 4G0NB 4HLEA 1E8XA 2GBJA 4ICVA 3VHTC 1MG8A 3RD2A 4G11A 2FIFA 1P9DU 2L8JA 3QHTA 4K1RB 3H1UA 4EOYA 4W9CA 3X0WA 4AJWA 2KFKA 1EF5A 3TL5A 1OTRB 3NS8A 3KUCB 1Q1OA 3Q3JA 3QC8B 4W9DA 4G50A 3AU4A 3X23A 2MQJA 1WE7A 4MDKE 3H7PB 1E8WA 3MTNB 1UELA 4FHJA 3NOBA 2KDIA 2MP2B 4DHZB 2MCNB 5JHBA 2JVCA 2C9WB 1KJTA 4ZYNA 4IG7B 4XC2A 1JRUA 4J6IA 3L0WB 2AYOB 1WGDA 2K1FA 3LDZE 5GMVA 3CSTA 1V81A 4W9HA 2KJHB 3L10B 1WXVA 2J0KA 2KD0A 3PTFC 2DYOA 3WIMA 3ZDMC 2LZ6A 2UWQA 3HM3A 1LFDA 4MM3A 2FCQA 2C7HA 2L76A 3A4RA 2DZJA 3PREA 2KJRA 1H8CA 2KWUB 4MJSB 4GXBA 4LJPB 4JLCA 2BKFA 3ZNHB 2ZZPB 4CHKA 2MSED 2O6VA 2XEWA 3WA0A 2JT4B 2A4ZA 5DPSA 2KHWB 2CS4A 3EFUA 3PRZA 1VCBA 2PPHA 2LUEA 3M3JA 2DYMA 4IM0A 1WM2A 3OJ4B 4MGZE 2B3AA 1UH6A 2FCMA 3HM6X 3WAPA 2J0MA 2KANA 2M8SA 1WJ4A 3NY5A 3DQVA 2I1KA 4TQ1A 2ZPYA 2JXXA 1GC6A 3ML8A 2LI5A 3A1QA 5AZFA 1E7VA 1ISNA 2CU1A 2KK8A 2HD5B 4ASWC 2MBOA 2UYZB 4K7UA 4WJQA 4GB9A 2KWCA 4KSLC 1WGRA 1UBIA 3B08A 4RM9A 2D07B 3M95A 2KNBA 3OJ3A 4WJNA 4EEWA 2KTRA 5JZEB 4BKGA 1Q5WB 4CYEA 4FJVB 3RZWC 3DBSA 2KX3A 2LRWA 1G6JA 2O2VA 2AWTA 2CHZA 3DPDA 4F1SA 3JW0X 1XT9B 2EMSA 4MGYE 3UQAA 1XD3B 3SU8X 4E71A 2KOXA 4NY0A 4NPNA 3ML9A 3VDZA 4A3PA 1V80A 1ZW7A 3TIXA 1A5RA 3RZFA 2KQ7A 4EUTA 4RMAA 4TQ0A 2FIDA 4GN1A 2LWPA 4BKSD 4K7SA 2HJ8A 2LXAA 5C1ZA 2K8HA 1V49A 5L95C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HE8 A;  4N9F 4;  4GMV A;  4B6W A;  1YX6 B;  2KFK B;  2PE9 A;  4BFR A;  2BWF A;  4IW0 A;  3V62 A;  3QA8 A;  3HHM A;  2L0F A;  4W9K A;  2MWS B;  3SDL C;  3VH4 B;  3A4S C;  2I1J A;  2XK5 A;  4G3X B;  3AXC A;  2N7D A;  2LRU A;  4PS7 A;  1YX5 B;  2K39 A;  2MP2 A;  2W9N A;  3JYU A;  2D10 A;  2WX1 A;  1UZX B;  2OJR A;  4PYZ A;  4DDG D;  3EHV A;  2WDT B;  4II3 B;  1J0G A;  2ZEQ A;  2LGX A;  1ZKH A;  3U7D A;  1UBQ A;  3APF A;  3I3T B;  4HJK A;  4RM8 A;  4GU2 A;  4HCN B;  1WXA A;  3GZN I;  4A3O A;  3DDC B;  1V6E A;  3L08 A;  3UGB B;  2A5U A;  3IHP C;  3WAO A;  2FAZ A;  2N1W A;  4GDL A;  1GJZ A;  3L13 A;  1C1Y B;  3HIZ A;  1WMH B;  2G45 B;  3WAN A;  3UQB A;  4ZRK A;  4I6P A;  3KYC D;  4FUL A;  2CHX A;  3D32 A;  4HPM B;  3S2A A;  3VAW A;  4EFO A;  4HDQ A;  5LXI B;  2BPS A;  1WJN A;  2KLC A;  3MJW A;  2LVP A;  2CHW A;  2JZZ A;  3ZO5 B;  1WFY A;  1TGZ B;  2M17 A;  2RR9 A;  2N7E A;  3JSV A;  5BO4 B;  3UF8 A;  4BKT A;  1L7Y A;  1WXS A;  5LXH A;  4ICU A;  1LXD A;  3A33 B;  2Y5B B;  3P2B A;  2DZI A;  4WJO A;  3ZTC A;  2DEN B;  1Y8R C;  3R7R A;  2KDE B;  4HCP B;  4F7Z A;  1RRB A;  2KC1 A;  2JRI B;  3M63 B;  2ASQ A;  2DZK A;  3A1Q B;  3C0R B;  3V6C B;  2DYB A;  1WRD B;  2KWV B;  2V3S A;  2Z0E B;  4IUM B;  3RUL A;  4EKU A;  1WR1 A;  2KN5 A;  2KDF B;  4FJZ A;  2C7M B;  2MA9 B;  4JIO U;  2BF8 B;  2YLM A;  5CHW A;  2DAJ A;  3QWZ B;  3UIO B;  1SE9 A;  3IG3 A;  4HPL B;  4BOZ B;  2IO1 B;  1TTN A;  2K6D B;  5D6J B;  2NBV B;  3RUI B;  2MBE A;  3TJP A;  3W1S C;  4IC7 B;  1D3Z A;  2LD9 A;  1WXM A;  1FXT B;  1RAX A;  1YIW A;  2V1Y A;  4DXA B;  1CMX B;  3PZD A;  3VTW A;  1NBF C;  3KW5 B;  3SHQ A;  2MBB B;  4GDK B;  1OQY A;  2KJ6 A;  2JPH A;  3SD5 A;  1VD2 A;  3DVN U;  4AWJ A;  3NHE B;  3QCA A;  3JSV B;  3O65 B;  1LM8 B;  4WJP A;  1V2Y A;  2G4D B;  3A9J B;  3AUL A;  4MGI E;  1WX8 A;  2L0T A;  5J18 A;  2KO3 A;  4NQK E;  2KTR B;  2IO3 B;  5TR5 A;  2DAF A;  5IA7 A;  1ZGU B;  1KOT A;  3B0A A;  1IP9 A;  3JVZ X;  1OEY J;  4LDT B;  5CTR C;  2YVC A;  3L16 A;  3V6E B;  2QHO A;  2N4F A;  3ZNI D;  4FAD A;  3QAQ A;  4F8C B;  4XX5 A;  3ONS A;  1WJ6 A;  4WWO A;  4WAA A;  1WI0 A;  3DOW A;  4KZ0 A;  4BBN C;  1TBE A;  3K9P B;  3ECI A;  1WY8 A;  1V9J A;  3KVF B;  3QJZ A;  4II2 B;  4JL9 A;  3KH0 A;  4KIK B;  1J19 A;  2XBB C;  1X1M A;  4HDO A;  2JF5 A;  2L05 A;  4MEL A;  1V5T A;  1WMH A;  2REX A;  3RYT A;  2L3Z A;  4MJS A;  2K8B A;  3ZLZ A;  2LXC A;  2BYF A;  2C60 A;  5D2M B;  2RD0 A;  1KLV A;  4EZJ A;  2M1M A;  4DWF A;  3W1S A;  2AL3 A;  1WYW B;  1E7U A;  2NS5 A;  4NNJ B;  4M8M A;  2RPQ A;  1EUV B;  3LJ3 A;  3MHS D;  1KM7 A;  5G2N A;  2K6Q A;  2BYE A;  2BWE S;  2FCN A;  2LGY A;  3EEC A;  4JGH B;  4KVG B;  2FNJ B;  2IO2 B;  4A20 A;  2GBR A;  2ZCC A;  1GUA B;  3QQ8 B;  1WR6 E;  2HE7 A;  2J7Q B;  4LDT D;  4NAW A;  2M0X A;  5DPW A;  1GC7 A;  2KDB A;  4FLH A;  3OLM D;  4KDI C;  4IM2 A;  2KLG A;  5D94 A;  4OVV A;  2BKR B;  4FBJ B;  3DVN V;  1BT0 A;  3VQI A;  3QIJ A;  2NVU I;  4KIK A;  1P3Q U;  1P98 A;  1XQQ A;  3PHX B;  5KHO A;  2KKC A;  2RSU A;  2O2V B;  5E6N A;  2IBI B;  4ANW A;  1SGH A;  1EF1 A;  4LCD E;  5DCN A;  4YL8 A;  4DHJ D;  3RT3 B;  3WAL A;  1M94 A;  4IWO A;  4E3C A;  4FA6 A;  1SIF A;  2O6V B;  5E6P A;  3A9J A;  3VUY A;  4BOS C;  4MSM B;  2WYQ A;  3GOE A;  2D2Q A;  2N9X A;  3Q3F A;  4W9L A;  4FJY A;  5AZH A;  2ZVN A;  1QZE A;  3DCG A;  3WAM A;  2MW5 A;  2O6V D;  4W9G A;  2R2Q A;  3PS6 A;  4GSW A;  1NI2 A;  3V60 A;  2DX5 B;  3VFK A;  2IYD B;  3PGE A;  4WWN A;  2HTH A;  3T9L A;  4AP4 C;  4K81 A;  2BYV E;  2JUO A;  2Z0D B;  5JH5 C;  2PEA A;  2ZVO A;  3PLU A;  4GIV A;  2N9P C;  2EMT A;  2GOW A;  5AZG A;  2PJH A;  2LAS A;  2ZNV B;  3OAW A;  3CF6 E;  2D3G A;  2DHZ A;  2N9E B;  2XK5 B;  1E8Y A;  5CHF A;  1I35 A;  4I6N B;  2L00 B;  1P1A A;  3BY4 B;  4W9J A;  5C23 A;  3CSF A;  1I42 A;  2KMC A;  2FUH B;  3ZKJ C;  2GBK A;  5LLI A;  3DBL I;  4M0W B;  1S3S G;  1UD7 A;  1LQB A;  2G3Q B;  3H6N A;  1K8R B;  3ALB A;  4CO7 A;  2PE6 B;  4ZDV A;  1WX7 A;  5J17 A;  3ZW3 A;  4EZK A;  1WF9 A;  2AEH A;  2ZCB A;  1WZ3 A;  3ZIM A;  3H9D A;  3NZU A;  2CKH B;  1WGG A;  2D11 A;  3PHW B;  2JZ3 B;  2KTF A;  2KFJ A;  3VH3 B;  1UGM A;  5FR6 A;  5DPT A;  4ANU A;  3DBR I;  3U30 A;  1WM3 A;  2BGF A;  2NBU A;  1F9J A;  1E8Z A;  1OGW A;  3VUW A;  4W9E A;  5E6O A;  3IVF A;  5IAA C;  1YQB A;  4NAW B;  1WIA A;  4BKS A;  4FN2 A;  1YJ1 A;  1WGY A;  2AL6 A;  2IO0 B;  3VTV A;  3BIN A;  3PRM B;  1U4A A;  2KVR A;  3TCA A;  4URK A;  1EO6 A;  1WX9 A;  5G55 A;  2N1V A;  2ZJD A;  4HVB A;  4KV2 A;  5HKH A;  3DVG Y;  3K9O B;  3V61 A;  4NQL B;  2M4N A;  5DPR A;  2CR5 A;  2IY0 B;  3L17 A;  1RFA A;  3TBL D;  3UIP B;  4OVU A;  4LJO B;  4WWP A;  3VUX A;  3ENE A;  2EKE C;  1E90 A;  2L7R A;  1WH3 A;  5D7G A;  4IWP A;  3APC A;  3PLV A;  3ZUN A;  1IPG A;  2KZR A;  2NBW B;  4K7W A;  3PT2 B;  3TMP B;  2NCN A;  3N3K B;  2R2O A;  4ZRI A;  4B9K A;  1GG3 A;  5AEK B;  5J2R A;  3A9K A;  4FHK A;  1J8C A;  1H4R A;  3RCZ A;  1T0Y A;  2GMI C;  1NDD A;  4XZ4 A;  3T8M A;  3DVG X;  2NPT A;  2JWZ A;  4HXD A;  2OOB B;  4KSK C;  4W9I A;  3ZDT A;  3ZNG C;  2NR2 A;  1PQS A;  2KC2 A;  3PRP B;  4JQW C;  4ANX A;  2KXJ A;  4MH0 E;  4M8N A;  2GBM A;  3IFW B;  2KMA A;  1P0R A;  2RGF A;  4GDK A;  2WX0 A;  4GGQ A;  2C5L C;  4X57 B;  3N32 A;  3M62 B;  5CHV C;  4MGK E;  3PPA A;  2G4S A;  1V5O A;  4B95 A;  2MBQ A;  3QX1 A;  3R3M A;  4IWQ A;  3H7P A;  2V4L A;  2DZM A;  3QK0 A;  2IZV B;  2Z59 B;  3VVW B;  2ZNV C;  3PSE B;  4KDL B;  1Z5S B;  1RLF A;  1WJU A;  4MEM A;  4NJ6 A;  2KX0 A;  3AI5 A;  4KZC A;  4TUU A;  4PYU A;  5EDS A;  3IBE A;  4GDL B;  4MSQ B;  4EZL A;  5L83 A;  4ZRJ A;  3W1Y A;  5JHA A;  3HK0 A;  4AOF A;  3PVL A;  1C3T A;  2J0J A;  3H7S A;  1TZ1 A;  3ZVV A;  2IY1 B;  4HWI B;  1WZ0 A;  1OEY A;  2MX2 A;  3NZS A;  2JRH A;  2ZPN A;  4DBG A;  2K8C A;  2LVQ A;  1V86 A;  2VRR B;  4IM3 A;  3VTU A;  3EC8 A;  4E74 A;  4BBN F;  4TV3 A;  4ANV A;  2WWZ A;  1R4M I;  1S1Q B;  1R4N I;  5CX3 A;  3VXW A;  4BVU C;  3ZTD A;  3DBH I;  4PS8 A;  3UIN B;  3ZNZ B;  3APD A;  2C7N B;  2LVO A;  2MLB A;  3B1L X;  3R66 C;  2LJ5 A;  1E5W A;  1Q0W B;  3R7Q A;  4GOC A;  3U8Z A;  4P7I A;  2MBH A;  3PV1 A;  1L2N A;  3KUZ A;  3KUD B;  4AJY B;  3KYD D;  1GNU A;  5KHQ A;  2FCS A;  1IYF A;  4DHJ B;  4NJ7 A;  1AAR A;  3ZRC A;  1YD8 U;  4DDI D;  4TKN A;  3L54 A;  3N30 A;  3ZRF A;  2KQS A;  3AU5 A;  4I6L B;  3CMM B;  4DHZ E;  3A9K B;  1WE6 A;  1WGH A;  3QAR A;  4PS3 A;  2JY6 A;  4WQO B;  4DK5 A;  4W9F A;  2MRP A;  1Z2M A;  2GBN A;  2LGD A;  2K25 A;  2NPT B;  4HK2 A;  4AUQ C;  4G0N B;  4HLE A;  1E8X A;  2GBJ A;  4ICV A;  3VHT C;  1MG8 A;  3RD2 A;  4G11 A;  2FIF A;  1P9D U;  2L8J A;  3QHT A;  4K1R B;  3H1U A;  4EOY A;  4W9C A;  3X0W A;  4AJW A;  2KFK A;  1EF5 A;  3TL5 A;  1OTR B;  3NS8 A;  3KUC B;  1Q1O A;  3Q3J A;  3QC8 B;  4W9D A;  4G50 A;  3AU4 A;  3X23 A;  2MQJ A;  1WE7 A;  4MDK E;  3H7P B;  1E8W A;  3MTN B;  1UEL A;  4FHJ A;  3NOB A;  2KDI A;  2MP2 B;  4DHZ B;  2MCN B;  5JHB A;  2JVC A;  2C9W B;  1KJT A;  4ZYN A;  4IG7 B;  4XC2 A;  1JRU A;  4J6I A;  3L0W B;  2AYO B;  1WGD A;  2K1F A;  3LDZ E;  5GMV A;  3CST A;  1V81 A;  4W9H A;  2KJH B;  3L10 B;  1WXV A;  2J0K A;  2KD0 A;  3PTF C;  2DYO A;  3WIM A;  3ZDM C;  2LZ6 A;  2UWQ A;  3HM3 A;  1LFD A;  4MM3 A;  2FCQ A;  2C7H A;  2L76 A;  3A4R A;  2DZJ A;  3PRE A;  2KJR A;  1H8C A;  2KWU B;  4MJS B;  4GXB A;  4LJP B;  4JLC A;  2BKF A;  3ZNH B;  2ZZP B;  4CHK A;  2MSE D;  2O6V A;  2XEW A;  3WA0 A;  2JT4 B;  2A4Z A;  5DPS A;  2KHW B;  2CS4 A;  3EFU A;  3PRZ A;  1VCB A;  2PPH A;  2LUE A;  3M3J A;  2DYM A;  4IM0 A;  1WM2 A;  3OJ4 B;  4MGZ E;  2B3A A;  1UH6 A;  2FCM A;  3HM6 X;  3WAP A;  2J0M A;  2KAN A;  2M8S A;  1WJ4 A;  3NY5 A;  3DQV A;  2I1K A;  4TQ1 A;  2ZPY A;  2JXX A;  1GC6 A;  3ML8 A;  2LI5 A;  3A1Q A;  5AZF A;  1E7V A;  1ISN A;  2CU1 A;  2KK8 A;  2HD5 B;  4ASW C;  2MBO A;  2UYZ B;  4K7U A;  4WJQ A;  4GB9 A;  2KWC A;  4KSL C;  1WGR A;  1UBI A;  3B08 A;  4RM9 A;  2D07 B;  3M95 A;  2KNB A;  3OJ3 A;  4WJN A;  4EEW A;  2KTR A;  5JZE B;  4BKG A;  1Q5W B;  4CYE A;  4FJV B;  3RZW C;  3DBS A;  2KX3 A;  2LRW A;  1G6J A;  2O2V A;  2AWT A;  2CHZ A;  3DPD A;  4F1S A;  3JW0 X;  1XT9 B;  2EMS A;  4MGY E;  3UQA A;  1XD3 B;  3SU8 X;  4E71 A;  2KOX A;  4NY0 A;  4NPN A;  3ML9 A;  3VDZ A;  4A3P A;  1V80 A;  1ZW7 A;  3TIX A;  1A5R A;  3RZF A;  2KQ7 A;  4EUT A;  4RMA A;  4TQ0 A;  2FID A;  4GN1 A;  2LWP A;  4BKS D;  4K7S A;  2HJ8 A;  2LXA A;  5C1Z A;  2K8H A;  1V49 A;  5L95 C; 
#chains in the Genus database with same CATH topology
 4N9F 4;  4B6W A;  1OFF A;  1ZDX A;  3NRZ A;  2BWF A;  2V3N A;  3Q2A C;  1N63 A;  2L0F A;  3SDL C;  3VH4 B;  2I1J A;  2XK5 A;  4G3X B;  2N7D A;  4PS7 A;  2K39 A;  2DBY A;  2MP2 A;  2W9N A;  2D10 A;  2OJR A;  1T0S C;  1STE A;  4DDG D;  3SFE B;  3CIR B;  2WDT B;  3T3O A;  1UBQ A;  4HJK A;  4RM8 A;  4HCN B;  1YN3 A;  3GZN I;  2QDF A;  3UGB B;  4N58 A;  1I4H A;  1C1Y B;  2JZP A;  2G45 B;  4I6P A;  1QOB A;  4FUL A;  2CHX A;  3D32 A;  4EFO A;  1MHX A;  3AEG B;  3UF8 A;  2WDV B;  1L7Y A;  1FNW A;  5LXH A;  2DZI A;  3ZTC A;  1Y8R C;  3Q6B A;  1RRB A;  3RFZ B;  1FMA D;  2BW2 A;  4FJZ A;  2D3B A;  2YLM A;  5CHW A;  1UGJ A;  3LB8 C;  1FNV A;  2IO1 B;  5E6J A;  4HEA 1;  2W3S A;  3RUI B;  2NBV B;  3ZXR A;  3TJP A;  3W1S C;  1WYG A;  1C79 A;  1JAL A;  1D5M C;  1D3Z A;  4OVZ A;  5IKC M;  2ZW0 A;  1VD2 A;  3NHE B;  4KX6 B;  3O65 B;  1TIF A;  1MG4 A;  2DAF A;  3E9S A;  3RNG C;  1OEY J;  5CTR C;  4D2K A;  4C7Z A;  3QAQ A;  3HVD A;  4F8C B;  3ONS A;  1WJ6 A;  4WWO A;  4TMA B;  4QAY A;  3ECI A;  1DOX A;  1Q10 A;  2WXF A;  1DYQ A;  3B2G A;  1X1M A;  2WXG A;  4HDO A;  1WMH A;  3RYT A;  1I4R A;  2K8B A;  3ZLZ A;  1FPY A;  3LXF A;  2RD0 A;  1KLV A;  4EZJ A;  2M1M A;  1I4Q A;  2J53 A;  2AL3 A;  1JCK B;  2GB1 A;  1PDX A;  3MHS D;  1T5X D;  2K6Q A;  3I9V 1;  4LNI A;  4HPP A;  2BYE A;  4KVG B;  1KH0 A;  2TSS A;  4AQ7 A;  1SEB D;  2J7Q B;  4P1C C;  1WRI A;  1F52 A;  4OVV A;  2Y3A A;  4FBJ B;  3DVN V;  1R4M B;  3FIL A;  2KMM A;  2OED A;  3QIJ A;  4XDC A;  4KIK A;  1XQQ A;  4WAF A;  5KHO A;  2Y5C A;  1KLU D;  3R8B A;  4ANW A;  1E0Z A;  5DCN A;  1PGA A;  3WAL A;  2L52 A;  3MHZ A;  2ACZ B;  2NTT A;  2N9X A;  4UDU C;  1F0Z A;  4USA A;  1QZE A;  1NEN B;  4W9G A;  1D5Z C;  3PS6 A;  4WUR A;  4GSW A;  3V60 A;  2DX5 B;  3VFK A;  2IYD B;  4AP4 C;  3T9L A;  1CJE A;  3TEY A;  2WXL A;  1BML C;  2BYV E;  1YN5 A;  2N9P C;  2EMT A;  4OHJ A;  1L4Z B;  2DHZ A;  2XK5 B;  2QIE B;  1JWU D;  3KLS X;  2M19 A;  3J9C A;  2L00 B;  1SJH D;  3CSF A;  2FUH B;  1FNU A;  3ABV B;  5LLI A;  1S3S G;  2HJ1 A;  2PE6 B;  5J17 A;  3ZW3 A;  1T3Q A;  1K51 A;  1WZ3 A;  2CKH B;  1WGG A;  4JPS A;  5FR6 A;  1PYW D;  4IKG A;  1SSN A;  5DPT A;  4ANU A;  1WM3 A;  2ZW1 A;  3BVZ A;  2NBU A;  3MC9 A;  3AEA B;  5IAA C;  1FM0 D;  1TS3 A;  2WXI A;  3NVY A;  2N0S B;  4YTM B;  5HKH A;  2M4N A;  2G9H D;  4YXD B;  2CR5 A;  3UIP B;  4WWP A;  2L7R A;  5D7G A;  3ZUN A;  4ZRI A;  2QMT A;  1MFW A;  4FHK A;  3T8M A;  2NPT A;  4KSK C;  3BII D;  1GB1 A;  3AE2 B;  4JQW C;  3U4E G;  3B2F A;  3IFW B;  4GDK A;  4GGQ A;  4X57 B;  1E6E B;  1WWT A;  3M62 B;  3Q3M C;  1VRA B;  2MBQ A;  4A9A A;  1PGX A;  1FRR A;  3H7P A;  2V4L A;  2DZM A;  3QK0 A;  2K0P A;  3BZD B;  2IZV B;  1Z5S B;  1WJU A;  2BS3 B;  4MEM A;  4NAM A;  4PYU A;  4MSQ B;  1C3T A;  2KN4 A;  3ZVV A;  1OEY A;  3NZS A;  4ITK A;  4DXG A;  4LTU A;  2Z8L A;  2LVQ A;  3EC8 A;  3L4P A;  4E74 A;  4TV3 A;  2K22 A;  1JWM D;  5CX3 A;  1I4P A;  3ZTD A;  5HI1 A;  3R66 C;  1Q0W B;  4YTP B;  2MBH A;  1ACC A;  1IYF A;  3FKY A;  1ET9 A;  3DWM A;  4NJ7 A;  1SB3 C;  1YD8 U;  3DBH B;  4YSZ B;  3N30 A;  3ZRF A;  3CMM B;  1WE6 A;  3QAR A;  2GI9 A;  5C2T B;  3RPF C;  4RFB A;  2LMC A;  4DK5 A;  1AWD A;  1NYQ A;  4AUQ C;  4HLE A;  1E8X A;  5BYR A;  1L0V B;  2L8J A;  3X0W A;  1EF5 A;  3TL5 A;  1T6B X;  4W9D A;  3AU4 A;  2PVO D;  1AYF A;  4M00 A;  1NYR A;  1UEL A;  3NOB A;  1MJD A;  1QOF A;  2C9W B;  4ZYN A;  1JRU A;  4J6I A;  3C19 A;  2V4I B;  1JML A;  4ARC A;  2KJH B;  2KD0 A;  4P6V F;  3WIM A;  1L5P A;  2LZ6 A;  3HM3 A;  4L23 A;  3PRE A;  4MJS B;  2ZZP B;  4CHK A;  2MSE D;  3AE4 B;  2A4Z A;  1C4C A;  3EFU A;  1VCB A;  4YSY B;  1DOY A;  4IM0 A;  4MGZ E;  4AS1 A;  1WJ4 A;  1YNT E;  3DQV A;  4TQ1 A;  5C3J B;  4KGR A;  3ML8 A;  1ISN A;  2CU1 A;  1L4D B;  2HD5 B;  2MBO A;  4WJQ A;  4ASW C;  3B08 A;  2D07 B;  3M95 A;  4EEW A;  2KTR A;  5JZE B;  4CYE A;  2VZK B;  2KX3 A;  2LRW A;  2AWT A;  3DPD A;  2VH2 A;  1E10 A;  4LNN A;  3SU8 X;  1VDV A;  3AE5 B;  4A3P A;  1JWA D;  1UUP A;  3TIX A;  2WXJ A;  2AQ2 B;  2LWP A;  2LXA A;  1NI3 A;  5C1Z A;  3AE3 B;  1P7E A;  2KFK B;  4BFR A;  2WU5 B;  2VH1 A;  4W9K A;  3A4S C;  2LHD A;  1YX5 B;  2K9X A;  1UZX B;  3EHV A;  4II3 B;  3MC0 B;  4Q2J A;  3U7D A;  4ZYS A;  3I3T B;  5JXV A;  1KFY B;  1C78 A;  1FXA A;  1J7A A;  4A3O A;  3L08 A;  3WAO A;  4HKQ A;  3UQB A;  4ZRK A;  4HPM B;  3S2A A;  3TEW A;  2LJI A;  2BPS A;  1WJN A;  2KLC A;  2JZZ A;  4BKT A;  1WXS A;  1LXD A;  3P2B A;  5BMI A;  1CQV A;  2DEN B;  4N59 A;  4HCP B;  4F7Z A;  4FXC A;  2KC1 A;  2JRI B;  4J3O D;  3M63 B;  1XLN A;  1N5X A;  2ASQ A;  3A1Q B;  1TS4 A;  2KDM A;  1WRD B;  4IUM B;  2Z0E B;  5I4D A;  1WR1 A;  3RNB C;  2WLB A;  4JIO U;  1F2R C;  3RNC C;  3W9C B;  4XYC A;  3UIO B;  5FKA C;  4BOZ B;  1YQ3 B;  2H88 B;  2PVG C;  2INN E;  2K6D B;  3ZXV A;  1QQR A;  3GB1 A;  1GOZ A;  2LD9 A;  1WXM A;  4K3B A;  1RAX A;  1YIW A;  3NZ3 A;  3ZGZ A;  1NBF C;  1T0Q C;  2W3R A;  3KW5 B;  3SHQ A;  3AE7 B;  3SD5 A;  4AWJ A;  3DVN U;  1V8C A;  1GAQ B;  2INP E;  1HXY D;  2G4D B;  1ZOY B;  3A9J B;  3EA6 A;  4P16 A;  4MGI E;  4NQK E;  3RMK C;  4OW0 A;  5TR5 A;  4JX1 C;  3B0A A;  1IP9 A;  1F1H A;  2N4F A;  2Y5P A;  1UF0 A;  1BUI C;  4WAA A;  3N1X C;  4BBN C;  2PW9 A;  1TBE A;  3K9P B;  1XXG A;  1WY8 A;  4II2 B;  3KVF B;  4KIK B;  3AM9 A;  2XBB C;  2L05 A;  2DLB A;  2BT6 A;  1J7B A;  3P42 A;  3IXS A;  1JRP A;  4DWF A;  2KYW A;  2QEJ C;  1E7U A;  1JQ4 A;  2LHE A;  2INC C;  3VR9 B;  3NVW A;  1KRH A;  2IPK D;  4PK1 A;  2WP9 B;  3EEC A;  2BWE S;  2FCN A;  3P4Q B;  4JGH B;  3Q3N C;  4LNF A;  3RNE C;  1WR6 E;  3Q8C A;  4NAW A;  5DPW A;  2KDB A;  4FLH A;  4KDI C;  3DHH C;  2KLG A;  5D94 A;  2KKC A;  2RSU A;  2O2V B;  2IBI B;  3B9J A;  3RT3 B;  1QKZ A;  1M94 A;  4FA6 A;  2V0G A;  1SIF A;  4HRO A;  3Q3F A;  4W9L A;  2IND C;  2ZVN A;  1SE3 A;  2O6V D;  3TEX A;  4XE0 A;  2HTH A;  3BK1 A;  1SXT A;  2JUO A;  2JX5 A;  2Z0D B;  3ZQ4 A;  3PLU A;  4MM3 B;  2LAS A;  2ZNV B;  3OAW A;  3CF6 E;  2JSV X;  3DHG C;  1E8Y A;  4I6N B;  1P1A A;  2H89 B;  1TZO A;  1I42 A;  2KMC A;  2V9H A;  1V97 A;  3H6N A;  3NVZ A;  1TKG A;  1K8R B;  1M4V A;  2WXR A;  3ALB A;  3PO0 A;  2LGS A;  3NZU A;  2JXT A;  2JZ3 B;  2KFJ A;  3U30 A;  2PMV A;  1E8Z A;  1JWS D;  2SEB D;  2WXM A;  4W9E A;  3HRD D;  5LNK 1;  1WGY A;  2AL6 A;  1TS2 A;  3BIN A;  3VTV A;  1NVI D;  4KV2 A;  5EE0 A;  4S0R A;  4ZHO A;  5TSS A;  3TBL D;  5IP4 D;  2CJO A;  3VUX A;  3ENE A;  1E90 A;  1XO3 A;  4IWP A;  2I38 A;  5D3I B;  3PT2 B;  1ZP0 B;  3TMP B;  3N3K B;  2KAJ A;  1SE4 A;  3BVG A;  2UU7 A;  5J2R A;  1C4A A;  3R2I A;  1H4R A;  3BYY B;  2MJ3 A;  1NDD A;  3DVG X;  2OOB B;  2RDB C;  1Y56 A;  3ZNG C;  1PQS A;  2KC2 A;  3PRP B;  2W54 A;  4B0M A;  4M8N A;  4RH6 A;  2KMA A;  2IGH A;  4KKJ A;  2C5L C;  4MGK E;  4B95 A;  3QX1 A;  1IBX B;  1C76 A;  2Z59 B;  2WXK A;  2K3U A;  1TJE A;  4TUU A;  1I4X A;  1EM7 A;  3IBE A;  5L83 A;  1LGR A;  5JHA A;  3HK0 A;  3PVL A;  1TZ1 A;  1C9F A;  4HWI B;  4OZC A;  1WZ0 A;  2MX2 A;  2HDE A;  3MC8 A;  1IUE A;  1SE2 A;  1WXQ A;  1R4N I;  3VXW A;  3ZJT A;  3UIN B;  4MH8 A;  2N9L A;  2C7N B;  3CWI A;  2MLB A;  3BK2 A;  1E7P B;  4MAC A;  3R7Q A;  3T3N A;  3U8Z A;  2W82 A;  4AJY B;  3KYD D;  1GNU A;  3EGR A;  1AAR A;  4DQO C;  4TKN A;  4XWT A;  4XWW A;  2L1A A;  1HTQ A;  2JY6 A;  3DBR B;  1V1O A;  2LGD A;  2WXQ A;  2EEL A;  2KT7 A;  4ICV A;  2GBJ A;  2NMQ A;  3OWE B;  3VHT C;  3RD2 A;  4G11 A;  2FIF A;  1P9D U;  2KFK A;  5IOI A;  1C77 A;  3QC8 B;  4G50 A;  3X23 A;  1WE7 A;  1F2R I;  2MCN B;  1ZDV A;  4YWG G;  1KJT A;  4IG7 B;  3V05 A;  3AED B;  3RI7 C;  2E6X A;  1SIJ A;  5GMV A;  4W9H A;  3N9Y C;  1WXV A;  3PTF C;  3ZDM C;  2FE8 A;  1LFD A;  4MM3 A;  4C80 A;  1RFK A;  2FCQ A;  2C7H A;  5GXG B;  3KQ4 A;  2OJW A;  4NJC A;  1H8C A;  1MHH E;  4LJP B;  4JLC A;  2QJL A;  2BKF A;  3N20 C;  2O6V A;  1N5W A;  2JT4 B;  3SEB A;  5DPS A;  3IT4 B;  5D3D A;  2PPH A;  4RF0 A;  2FCM A;  3HM6 X;  3WAP A;  2KAN A;  2I1K A;  2WDQ B;  2ZPY A;  2JXX A;  1KF6 B;  1XLP A;  1GC6 A;  3RN9 C;  2LI5 A;  3A1Q A;  1E7V A;  2KK8 A;  2UYZ B;  1WGR A;  2KNB A;  1Q5W B;  3RZW C;  4LNK A;  1JWB D;  3JW0 X;  2QC8 A;  4MGY E;  4E71 A;  2KOX A;  3URY A;  5BYQ A;  1R4N B;  1B9R A;  2WGS A;  1A5R A;  5AUK A;  2KQ7 A;  4RMA A;  2FID A;  2HJ8 A;  4ZHP A;  1P7F A;  1V49 A;  5L95 C;  3MP9 A;  1HE8 A;  1YX6 B;  2PE9 A;  3BWU D;  4IW0 A;  3QA8 A;  3HHM A;  4REZ A;  1ENF A;  3AXC A;  1I4G A;  2JQR B;  4O1N A;  2WX1 A;  1D4B A;  2J42 A;  3U2S C;  3NUH B;  3UI3 A;  3AE1 B;  1IBX A;  2ZEQ A;  2LGX A;  1ZKH A;  2JU6 X;  4XGA B;  1V1P A;  4HKZ E;  3DDC B;  2A5U A;  5EE1 A;  3W5V B;  2WDR B;  1AN8 A;  3TEZ A;  2FAZ A;  5EE3 A;  4GDL A;  3L13 A;  4IOI E;  5H92 C;  3HIZ A;  1WMH B;  3WAN A;  3U7Z A;  4KKI A;  2IGG A;  3VAW A;  1SJE D;  1ESF A;  4R3D A;  2ICI A;  2LVP A;  2CHW A;  2M17 A;  2RR9 A;  1EWC A;  1PGB A;  4ICU A;  3A33 B;  4KGT A;  4WJO A;  3R7R A;  3VRA B;  2L32 A;  4YSX B;  2DZK A;  3RUL A;  2KN5 A;  2KDF B;  4RGO S;  2C7M B;  2DAJ A;  3QWZ B;  1SE9 A;  4HPL B;  1TTN A;  5D6J B;  1FO4 A;  4IC7 B;  2WNM A;  1QIL A;  5FR3 A;  2V1Y A;  4DXA B;  1CMX B;  3GZN B;  4A90 A;  5HHD G;  2MBB B;  4GDK B;  1OQY A;  3JSV B;  4WJP A;  1K52 A;  2HTM E;  2KO3 A;  2KTR B;  2IO3 B;  1ZGU B;  1KOT A;  3Q8A A;  2W55 A;  3JVZ X;  2I2Y A;  4LDT B;  4LLG M;  2YVC A;  3V6E B;  2QHO A;  3BVM A;  3MJ5 A;  3ZNI D;  4XX5 A;  1WI0 A;  3U52 E;  3GS2 A;  2MJD A;  2PLP A;  3IAM 1;  1TS5 A;  2REX A;  3P63 A;  3FC4 A;  2RDH A;  2C60 A;  2KAC A;  4KGS A;  1F77 A;  4IDI A;  1WYW B;  4NNJ B;  1EUV B;  3LJ3 A;  3GE8 C;  5G2N A;  4L1B A;  2L83 A;  3GP7 A;  2LGY A;  1HA5 A;  3OG5 A;  4A20 A;  2GBR A;  1GUA B;  3QQ8 B;  2M0X A;  3OLM D;  2MH7 A;  4IM2 A;  2BKR B;  1BT0 A;  3VQI A;  1P98 A;  4M0W A;  4WH4 A;  3NS1 A;  4CQN A;  5E6N A;  4LCD E;  4DHJ D;  2XNA C;  3AH7 A;  4IWO A;  3AV8 A;  3NG0 A;  3HUI A;  3VUY A;  4MSM B;  2WYQ A;  4S17 A;  2D2Q A;  4FJY A;  3DCG A;  3ZYY X;  2R2Q A;  2LFI A;  2QSD A;  1T0R C;  3PGE A;  4K81 A;  2PEA A;  2ZVO A;  2GOW A;  5AZG A;  2N9E B;  5CHF A;  4US9 A;  1I35 A;  1IGC A;  3MFG A;  3BY4 B;  4W9J A;  5C23 A;  4JWS C;  3ZKJ C;  2GBK A;  4N6E B;  5H8Y E;  3DBL I;  4RGT A;  2G3Q B;  3Q3O C;  4CO7 A;  1WF9 A;  2AEH A;  2ZCB A;  3ZIM A;  3H9D A;  2D11 A;  3LYY A;  2KTF A;  3VH3 B;  1UGM A;  4ZOH C;  3DBR I;  2BGF A;  1XF5 L;  1F9J A;  1HTO A;  4RCO A;  3IVF A;  1YQB A;  1WIA A;  4BKS A;  4FN2 A;  1YJ1 A;  1N6Z A;  1WGK A;  3PRM B;  3PZ7 A;  4URK A;  1EO6 A;  1WX9 A;  1BXT A;  2N1V A;  3DVG Y;  3K9O B;  3V61 A;  4NQL B;  2WHI A;  2IY0 B;  3L17 A;  4ZRQ A;  1RFA A;  2KQ4 X;  4OVU A;  3DWG C;  1HZ6 A;  3APC A;  3PLV A;  1IPG A;  2KZR A;  2NBW B;  4K7W A;  1ZE3 D;  2NCN A;  1GG3 A;  3A9K A;  2GMI C;  4XZ4 A;  4HXD A;  3ZDT A;  2KXJ A;  4RGN A;  1P0R A;  1JRO A;  2WX0 A;  1QOG A;  4YT0 B;  3N32 A;  5CHV C;  2JYT A;  2G1E A;  1V5O A;  3P4R B;  2N7J A;  3R3M A;  4IWQ A;  1QOA A;  4P1B C;  1IGD A;  3IAS 1;  3IT6 B;  3VVW B;  2ZNV C;  4KDL B;  1K50 A;  1FCL A;  2KX0 A;  3AI5 A;  4KZC A;  4C4V B;  5HFY A;  4AOF A;  2J0J A;  1RWS A;  2JRH A;  2K8C A;  1V86 A;  2VRR B;  4IM3 A;  3VTU A;  4BBN F;  4ANV A;  3KWL A;  2WWZ A;  4ZRP A;  1XLO A;  1ZXI A;  4BVU C;  3AEE B;  4ACF A;  3DBH I;  4PS8 A;  1VJK A;  3APD A;  2LVO A;  1L6U A;  3AMZ A;  1GB4 A;  4TSS A;  2X38 A;  1YJJ A;  1PUT A;  1L2N A;  3KUZ A;  5KHQ A;  4OZB A;  4RF1 A;  1HQR D;  4M01 A;  3ZJV A;  4A55 A;  3ZRC A;  4DDI D;  3Q14 C;  2BS2 B;  2KQS A;  4I6L B;  5BMG A;  3A9K B;  5BYS A;  1WGH A;  1A70 A;  2LEK A;  4W9F A;  2MRP A;  1Z2M A;  2GBN A;  2NPT B;  2K25 A;  4RGM A;  4C7Y A;  1L6V A;  1MG8 A;  4K1R B;  1UNS A;  3KWV A;  4EOY A;  3H1U A;  4W9C A;  3KUC B;  3WCQ A;  3H7P B;  2K5P A;  1E8W A;  4FHJ A;  1N60 A;  3AEC B;  2MP2 B;  4B0E A;  2GRI A;  2JVC A;  2AX5 A;  4XC2 A;  3L0W B;  2AYO B;  1WGD A;  4C4V A;  2VZK D;  3LDZ E;  2CU3 A;  3NJT A;  3TUO A;  2J0K A;  3A4R A;  2KJR A;  3V3X A;  2YEP F;  3ZNH B;  2MEK A;  2E3T A;  3I5J C;  2KHW B;  3PRZ A;  2LUE A;  3M3J A;  1N61 A;  3W5U B;  2DYM A;  3FAH A;  1FRD A;  2NTS A;  2WXO A;  4WQM A;  2WXP A;  3OJ4 B;  1UH6 A;  2FBW B;  2M8S A;  3NY5 A;  1TT5 B;  1YN4 A;  1B1Z A;  3C8Y A;  4GB9 A;  2BB5 A;  4KSL C;  4ARI A;  1UBI A;  4WJN A;  4BKG A;  4FJV B;  4MT5 A;  1GPX A;  3BYT B;  1G6J A;  2O2V A;  2CHZ A;  4RNA A;  3VRB B;  4F1S A;  1I7H A;  1XEE A;  2EMS A;  3UQA A;  2LUM A;  4NY0 A;  4NPN A;  1ZUD 2;  3ML9 A;  3VDZ A;  1V80 A;  1ZW7 A;  4EUT A;  4GN1 A;  4BKS D;  4K7S A;  2FUG 1;  3N1Y C;  4GMV A;  1L0X B;  3V62 A;  2JYE A;  5G5G A;  5BMH A;  2MWS B;  3RNF C;  1C4P A;  1FFU A;  2LRU A;  3ETR A;  2XN9 C;  2PTL A;  3DBL B;  3JYU A;  2BVC A;  1VZ8 A;  1FCC C;  1K53 A;  2Q5W D;  4PYZ A;  1J0G A;  4PT5 A;  1YJI A;  3APF A;  4GU2 A;  1WXA A;  3I57 A;  1TKE A;  1V6E A;  2QIL A;  3AN1 A;  3IHP C;  2N1W A;  1GJZ A;  5T8I A;  3KYC D;  5LXI B;  4HDQ A;  3MJW A;  3ZO5 B;  1WFY A;  1TGZ B;  3JSV A;  3SFD B;  2N7E A;  5BO4 B;  5MPO A;  2WXN A;  2Y5B B;  2KDE B;  3C0R B;  3V6C B;  1TY2 A;  2DYB A;  2KWV B;  2OHF A;  2V3S A;  4EKU A;  2MA9 B;  2BF8 B;  3FIL B;  5EE9 A;  3IG3 A;  1EU4 A;  1FEH A;  2MBE A;  1L0Y B;  2BTE A;  1FXT B;  1YOV B;  1PFD A;  4BZA A;  3PZD A;  3VTW A;  1XCT L;  1JW9 D;  4A6Q A;  2KJ6 A;  2JPH A;  2WXH A;  1RYJ A;  3QCA A;  3RNA C;  1LM8 B;  1V2Y A;  2ON8 A;  3AUL A;  1WX8 A;  2L0T A;  5J18 A;  1YQ4 B;  5IA7 A;  3AE6 B;  3TSS A;  3L16 A;  2IJ0 A;  3P4S B;  3AEF B;  4FAD A;  1DGJ A;  3Q69 A;  4KZ0 A;  3DOW A;  3Q8B A;  2AQ3 B;  1V9J A;  3QJZ A;  3PZ8 A;  4JL9 A;  3KH0 A;  1J19 A;  1KTK A;  2JF5 A;  3O13 A;  4MEL A;  3Q8E A;  1V5T A;  1D6E C;  2L3Z A;  4MJS A;  3P1M A;  2LXC A;  2BYF A;  5D2M B;  3AEB B;  3W1S A;  3E56 A;  1J7C A;  1QLB B;  2NS5 A;  4M8M A;  2RPQ A;  2CJN A;  4HJG E;  2JWU A;  2N9K A;  2V3P A;  1XLQ A;  3R2T A;  1KM7 A;  2KVZ A;  1QT9 A;  2FNJ B;  2IO2 B;  3AE9 B;  2ZCC A;  2PKO A;  2HE7 A;  4LDT D;  2IDY A;  1GC7 A;  3EUB 2;  1EU3 A;  2PIA A;  4XDD A;  2NVU I;  1P3Q U;  3PHX B;  1FXI A;  4C00 A;  1SGH A;  1EF1 A;  2IGD A;  4YL8 A;  2AQ1 B;  4E3C A;  2O6V B;  5E6P A;  3A9J A;  4BOS C;  2M56 B;  3GOE A;  3W2D A;  5AZH A;  3ZJU A;  3WAM A;  2MW5 A;  1NI2 A;  4WWN A;  5HG2 A;  5JH5 C;  4GIV A;  2EKI A;  1VLB A;  1SF0 A;  2PJH A;  4H2A A;  4M02 A;  2D3G A;  4WWM A;  3P4P B;  4M0W B;  1UD7 A;  1LQB A;  1TKY A;  4K3C A;  4ZDV A;  1WX7 A;  4EZK A;  1N62 A;  3PHW B;  3SR6 A;  1WSP A;  1VZ7 A;  3VUW A;  1OGW A;  5E6O A;  4LNO A;  4NAW B;  1OQR A;  2IO0 B;  1CZP A;  1CK1 A;  1U4A A;  2KVR A;  3TCA A;  4HVB A;  5G55 A;  2ZJD A;  5DPR A;  3VR8 B;  2BQQ A;  4LJO B;  1NEK B;  2EKE C;  1WH3 A;  2RDG A;  2MJE A;  1SBB B;  1E9M A;  2R2O A;  1UWX A;  5G5H A;  4B9K A;  1R7S A;  5AEK B;  3H8H A;  1RM6 C;  1J8C A;  3RCZ A;  1T0Y A;  2JWZ A;  4C56 C;  4W9I A;  1TYG B;  4ANX A;  2NR2 A;  2WS3 B;  1ZPS A;  4MH0 E;  2GBM A;  2RGF A;  3PPA A;  2G4S A;  2SAK A;  3AB5 A;  4BAX A;  3N1Z C;  1D5X C;  1V1P B;  3PSE B;  1EWY C;  1RLF A;  4NJ6 A;  5EDS A;  4GDL B;  3AE8 B;  4EZL A;  4ZRJ A;  5FK9 C;  1HZ5 A;  3W1Y A;  1FIQ A;  3H7S A;  4NZL B;  1UWM A;  2IY1 B;  2ZPN A;  4DBG A;  1DOI A;  2X8X X;  3EFC A;  1MI0 A;  1MVK A;  1R4M I;  1S1Q B;  3DHI C;  2D3A A;  2LGI A;  2GLS A;  2QCZ A;  1KLG D;  3ZNZ B;  3B1L X;  2LJ5 A;  1E5W A;  1LO5 D;  4GOC A;  4P7I A;  3PV1 A;  1AW7 A;  3KUD B;  2FCS A;  2BBC A;  4DHJ B;  2D3C A;  1QF6 A;  4DXF A;  3L54 A;  3HVZ A;  3AU5 A;  4DHZ E;  2R61 A;  2WU2 B;  4PS3 A;  2M0A A;  4L2Y A;  4WQO B;  1HEZ E;  4HK2 A;  1ZXH A;  4G0N B;  5IO9 A;  5AUI A;  3QHT A;  2D5G A;  4GLS C;  4AJW A;  1OTR B;  3NS8 A;  1Q1O A;  3Q3J A;  2YEP B;  3Q8F A;  2MQJ A;  2DWQ A;  4MDK E;  2MHJ A;  1FFV A;  3MTN B;  1MPE A;  2KDI A;  4DHZ B;  5JHB A;  2K1F A;  3CST A;  1V81 A;  1XCQ L;  2BS4 B;  3L10 B;  2BYT A;  2DYO A;  2UWQ A;  2RPV A;  2L76 A;  4OZA A;  2DZJ A;  2KWU B;  4GXB A;  1ET6 A;  4JWU C;  1VR9 A;  2XEW A;  3WA0 A;  3GE3 C;  2BB6 A;  1ROE A;  2CS4 A;  4LK0 M;  2J52 A;  2WQY B;  1WM2 A;  4US8 A;  4HRS A;  2B3A A;  2J0M A;  2RMM A;  1FD6 A;  4A8X C;  5IN7 A;  1YMH E;  2J4X A;  5AZF A;  1VZ6 A;  3NVV A;  4K7U A;  2KWD A;  2KWC A;  4WIP A;  1TY0 A;  1OQQ A;  4RM9 A;  2ONQ A;  3OJ3 A;  4EE2 A;  2DNF A;  3DBS A;  1XT9 B;  4JE3 B;  1XD3 B;  2B76 B;  4YTN B;  3RZF A;  4TQ0 A;  3I63 C;  2K8H A; 
#chains in the Genus database with same CATH homology
 1HE8 A;  4N9F 4;  4GMV A;  4B6W A;  1YX6 B;  2KFK B;  2PE9 A;  4BFR A;  2BWF A;  4IW0 A;  3V62 A;  3QA8 A;  3HHM A;  2L0F A;  4W9K A;  2MWS B;  3SDL C;  3VH4 B;  3A4S C;  2I1J A;  2XK5 A;  4G3X B;  3AXC A;  2N7D A;  2LRU A;  4PS7 A;  1YX5 B;  2K39 A;  2MP2 A;  2W9N A;  3JYU A;  2D10 A;  2WX1 A;  1UZX B;  2OJR A;  4PYZ A;  4DDG D;  3EHV A;  2WDT B;  4II3 B;  1J0G A;  2ZEQ A;  2LGX A;  1ZKH A;  3U7D A;  1UBQ A;  3APF A;  3I3T B;  4HJK A;  4RM8 A;  4GU2 A;  4HCN B;  1WXA A;  3GZN I;  4A3O A;  3DDC B;  1V6E A;  3L08 A;  3UGB B;  2A5U A;  3IHP C;  3WAO A;  2FAZ A;  2N1W A;  4GDL A;  1GJZ A;  3L13 A;  1C1Y B;  3HIZ A;  1WMH B;  2G45 B;  3WAN A;  3UQB A;  4ZRK A;  4I6P A;  3KYC D;  4FUL A;  2CHX A;  3D32 A;  4HPM B;  3S2A A;  3VAW A;  4EFO A;  4HDQ A;  5LXI B;  2BPS A;  1WJN A;  2KLC A;  3MJW A;  2LVP A;  2CHW A;  2JZZ A;  3ZO5 B;  1WFY A;  1TGZ B;  2M17 A;  2RR9 A;  2N7E A;  3JSV A;  5BO4 B;  3UF8 A;  4BKT A;  1L7Y A;  1WXS A;  5LXH A;  4ICU A;  1LXD A;  3A33 B;  2Y5B B;  3P2B A;  2DZI A;  4WJO A;  3ZTC A;  2DEN B;  1Y8R C;  3R7R A;  2KDE B;  4HCP B;  4F7Z A;  1RRB A;  2KC1 A;  2JRI B;  3M63 B;  2ASQ A;  2DZK A;  3A1Q B;  3C0R B;  3V6C B;  2DYB A;  1WRD B;  2KWV B;  2V3S A;  2Z0E B;  4IUM B;  3RUL A;  4EKU A;  1WR1 A;  2KN5 A;  2KDF B;  4FJZ A;  2C7M B;  2MA9 B;  4JIO U;  2BF8 B;  2YLM A;  5CHW A;  2DAJ A;  3QWZ B;  3UIO B;  1SE9 A;  3IG3 A;  4HPL B;  4BOZ B;  2IO1 B;  1TTN A;  2K6D B;  5D6J B;  2NBV B;  3RUI B;  2MBE A;  3TJP A;  3W1S C;  4IC7 B;  1D3Z A;  2LD9 A;  1WXM A;  1FXT B;  1RAX A;  1YIW A;  2V1Y A;  4DXA B;  1CMX B;  3PZD A;  3VTW A;  1NBF C;  3KW5 B;  3SHQ A;  2MBB B;  4GDK B;  1OQY A;  2KJ6 A;  2JPH A;  3SD5 A;  1VD2 A;  3DVN U;  4AWJ A;  3NHE B;  3QCA A;  3JSV B;  3O65 B;  1LM8 B;  4WJP A;  1V2Y A;  2G4D B;  3A9J B;  3AUL A;  4MGI E;  1WX8 A;  2L0T A;  5J18 A;  2KO3 A;  4NQK E;  2KTR B;  2IO3 B;  5TR5 A;  2DAF A;  5IA7 A;  1ZGU B;  1KOT A;  3B0A A;  1IP9 A;  3JVZ X;  1OEY J;  4LDT B;  5CTR C;  2YVC A;  3L16 A;  3V6E B;  2QHO A;  2N4F A;  3ZNI D;  4FAD A;  3QAQ A;  4F8C B;  4XX5 A;  3ONS A;  1WJ6 A;  4WWO A;  4WAA A;  1WI0 A;  3DOW A;  4KZ0 A;  4BBN C;  1TBE A;  3K9P B;  3ECI A;  1WY8 A;  1V9J A;  3KVF B;  3QJZ A;  4II2 B;  4JL9 A;  3KH0 A;  4KIK B;  1J19 A;  2XBB C;  1X1M A;  4HDO A;  2JF5 A;  2L05 A;  4MEL A;  1V5T A;  1WMH A;  2REX A;  3RYT A;  2L3Z A;  4MJS A;  2K8B A;  3ZLZ A;  2LXC A;  2BYF A;  2C60 A;  5D2M B;  2RD0 A;  1KLV A;  4EZJ A;  2M1M A;  4DWF A;  3W1S A;  2AL3 A;  1WYW B;  1E7U A;  2NS5 A;  4NNJ B;  4M8M A;  2RPQ A;  1EUV B;  3LJ3 A;  3MHS D;  1KM7 A;  5G2N A;  2K6Q A;  2BYE A;  2BWE S;  2FCN A;  2LGY A;  3EEC A;  4JGH B;  4KVG B;  2FNJ B;  2IO2 B;  4A20 A;  2GBR A;  2ZCC A;  1GUA B;  3QQ8 B;  1WR6 E;  2HE7 A;  2J7Q B;  4LDT D;  4NAW A;  2M0X A;  5DPW A;  1GC7 A;  2KDB A;  4FLH A;  3OLM D;  4KDI C;  4IM2 A;  2KLG A;  5D94 A;  4OVV A;  2BKR B;  4FBJ B;  3DVN V;  1BT0 A;  3VQI A;  3QIJ A;  2NVU I;  4KIK A;  1P3Q U;  1P98 A;  1XQQ A;  3PHX B;  5KHO A;  2KKC A;  2RSU A;  2O2V B;  5E6N A;  2IBI B;  4ANW A;  1SGH A;  1EF1 A;  4LCD E;  5DCN A;  4YL8 A;  4DHJ D;  3RT3 B;  3WAL A;  1M94 A;  4IWO A;  4E3C A;  4FA6 A;  1SIF A;  2O6V B;  5E6P A;  3A9J A;  3VUY A;  4BOS C;  4MSM B;  2WYQ A;  3GOE A;  2D2Q A;  2N9X A;  3Q3F A;  4W9L A;  4FJY A;  5AZH A;  2ZVN A;  1QZE A;  3DCG A;  3WAM A;  2MW5 A;  2O6V D;  4W9G A;  2R2Q A;  3PS6 A;  4GSW A;  1NI2 A;  3V60 A;  2DX5 B;  3VFK A;  2IYD B;  3PGE A;  4WWN A;  2HTH A;  3T9L A;  4AP4 C;  4K81 A;  2BYV E;  2JUO A;  2Z0D B;  5JH5 C;  2PEA A;  2ZVO A;  3PLU A;  4GIV A;  2N9P C;  2EMT A;  2GOW A;  5AZG A;  2PJH A;  2LAS A;  2ZNV B;  3OAW A;  3CF6 E;  2D3G A;  2DHZ A;  2N9E B;  2XK5 B;  1E8Y A;  5CHF A;  1I35 A;  4I6N B;  2L00 B;  1P1A A;  3BY4 B;  4W9J A;  5C23 A;  3CSF A;  1I42 A;  2KMC A;  2FUH B;  3ZKJ C;  2GBK A;  5LLI A;  3DBL I;  4M0W B;  1S3S G;  1UD7 A;  1LQB A;  2G3Q B;  3H6N A;  1K8R B;  3ALB A;  4CO7 A;  2PE6 B;  4ZDV A;  1WX7 A;  5J17 A;  3ZW3 A;  4EZK A;  1WF9 A;  2AEH A;  2ZCB A;  1WZ3 A;  3ZIM A;  3H9D A;  3NZU A;  2CKH B;  1WGG A;  2D11 A;  3PHW B;  2JZ3 B;  2KTF A;  2KFJ A;  3VH3 B;  1UGM A;  5FR6 A;  5DPT A;  4ANU A;  3DBR I;  3U30 A;  1WM3 A;  2BGF A;  2NBU A;  1F9J A;  1E8Z A;  1OGW A;  3VUW A;  4W9E A;  5E6O A;  3IVF A;  5IAA C;  1YQB A;  4NAW B;  1WIA A;  4BKS A;  4FN2 A;  1YJ1 A;  1WGY A;  2AL6 A;  2IO0 B;  3VTV A;  3BIN A;  3PRM B;  1U4A A;  2KVR A;  3TCA A;  4URK A;  1EO6 A;  1WX9 A;  5G55 A;  2N1V A;  2ZJD A;  4HVB A;  4KV2 A;  5HKH A;  3DVG Y;  3K9O B;  3V61 A;  4NQL B;  2M4N A;  5DPR A;  2CR5 A;  2IY0 B;  3L17 A;  1RFA A;  3TBL D;  3UIP B;  4OVU A;  4LJO B;  4WWP A;  3VUX A;  3ENE A;  2EKE C;  1E90 A;  2L7R A;  1WH3 A;  5D7G A;  4IWP A;  3APC A;  3PLV A;  3ZUN A;  1IPG A;  2KZR A;  2NBW B;  4K7W A;  3PT2 B;  3TMP B;  2NCN A;  3N3K B;  2R2O A;  4ZRI A;  4B9K A;  1GG3 A;  5AEK B;  5J2R A;  3A9K A;  4FHK A;  1J8C A;  1H4R A;  3RCZ A;  1T0Y A;  2GMI C;  1NDD A;  4XZ4 A;  3T8M A;  3DVG X;  2NPT A;  2JWZ A;  4HXD A;  2OOB B;  4KSK C;  4W9I A;  3ZDT A;  3ZNG C;  2NR2 A;  1PQS A;  2KC2 A;  3PRP B;  4JQW C;  4ANX A;  2KXJ A;  4MH0 E;  4M8N A;  2GBM A;  3IFW B;  2KMA A;  1P0R A;  2RGF A;  4GDK A;  2WX0 A;  4GGQ A;  2C5L C;  4X57 B;  3N32 A;  3M62 B;  5CHV C;  4MGK E;  3PPA A;  2G4S A;  1V5O A;  4B95 A;  2MBQ A;  3QX1 A;  3R3M A;  4IWQ A;  3H7P A;  2V4L A;  2DZM A;  3QK0 A;  2IZV B;  2Z59 B;  3VVW B;  2ZNV C;  3PSE B;  4KDL B;  1Z5S B;  1RLF A;  1WJU A;  4MEM A;  4NJ6 A;  2KX0 A;  3AI5 A;  4KZC A;  4TUU A;  4PYU A;  5EDS A;  3IBE A;  4GDL B;  4MSQ B;  4EZL A;  5L83 A;  4ZRJ A;  3W1Y A;  5JHA A;  3HK0 A;  4AOF A;  3PVL A;  1C3T A;  2J0J A;  3H7S A;  1TZ1 A;  3ZVV A;  2IY1 B;  4HWI B;  1WZ0 A;  1OEY A;  2MX2 A;  3NZS A;  2JRH A;  2ZPN A;  4DBG A;  2K8C A;  2LVQ A;  1V86 A;  2VRR B;  4IM3 A;  3VTU A;  3EC8 A;  4E74 A;  4BBN F;  4TV3 A;  4ANV A;  2WWZ A;  1R4M I;  1S1Q B;  1R4N I;  5CX3 A;  3VXW A;  4BVU C;  3ZTD A;  3DBH I;  4PS8 A;  3UIN B;  3ZNZ B;  3APD A;  2C7N B;  2LVO A;  2MLB A;  3B1L X;  3R66 C;  2LJ5 A;  1E5W A;  1Q0W B;  3R7Q A;  4GOC A;  3U8Z A;  4P7I A;  2MBH A;  3PV1 A;  1L2N A;  3KUZ A;  3KUD B;  4AJY B;  3KYD D;  1GNU A;  5KHQ A;  2FCS A;  1IYF A;  4DHJ B;  4NJ7 A;  1AAR A;  3ZRC A;  1YD8 U;  4DDI D;  4TKN A;  3L54 A;  3N30 A;  3ZRF A;  2KQS A;  3AU5 A;  4I6L B;  3CMM B;  4DHZ E;  3A9K B;  1WE6 A;  1WGH A;  3QAR A;  4PS3 A;  2JY6 A;  4WQO B;  4DK5 A;  4W9F A;  2MRP A;  1Z2M A;  2GBN A;  2LGD A;  2K25 A;  2NPT B;  4HK2 A;  4AUQ C;  4G0N B;  4HLE A;  1E8X A;  2GBJ A;  4ICV A;  3VHT C;  1MG8 A;  3RD2 A;  4G11 A;  2FIF A;  1P9D U;  2L8J A;  3QHT A;  4K1R B;  3H1U A;  4EOY A;  4W9C A;  3X0W A;  4AJW A;  2KFK A;  1EF5 A;  3TL5 A;  1OTR B;  3NS8 A;  3KUC B;  1Q1O A;  3Q3J A;  3QC8 B;  4W9D A;  4G50 A;  3AU4 A;  3X23 A;  2MQJ A;  1WE7 A;  4MDK E;  3H7P B;  1E8W A;  3MTN B;  1UEL A;  4FHJ A;  3NOB A;  2KDI A;  2MP2 B;  4DHZ B;  2MCN B;  5JHB A;  2JVC A;  2C9W B;  1KJT A;  4ZYN A;  4IG7 B;  4XC2 A;  1JRU A;  4J6I A;  3L0W B;  2AYO B;  1WGD A;  2K1F A;  3LDZ E;  5GMV A;  3CST A;  1V81 A;  4W9H A;  2KJH B;  3L10 B;  1WXV A;  2J0K A;  2KD0 A;  3PTF C;  2DYO A;  3WIM A;  3ZDM C;  2LZ6 A;  2UWQ A;  3HM3 A;  1LFD A;  4MM3 A;  2FCQ A;  2C7H A;  2L76 A;  3A4R A;  2DZJ A;  3PRE A;  2KJR A;  1H8C A;  2KWU B;  4MJS B;  4GXB A;  4LJP B;  4JLC A;  2BKF A;  3ZNH B;  2ZZP B;  4CHK A;  2MSE D;  2O6V A;  2XEW A;  3WA0 A;  2JT4 B;  2A4Z A;  5DPS A;  2KHW B;  2CS4 A;  3EFU A;  3PRZ A;  1VCB A;  2PPH A;  2LUE A;  3M3J A;  2DYM A;  4IM0 A;  1WM2 A;  3OJ4 B;  4MGZ E;  2B3A A;  1UH6 A;  2FCM A;  3HM6 X;  3WAP A;  2J0M A;  2KAN A;  2M8S A;  1WJ4 A;  3NY5 A;  3DQV A;  2I1K A;  4TQ1 A;  2ZPY A;  2JXX A;  1GC6 A;  3ML8 A;  2LI5 A;  3A1Q A;  5AZF A;  1E7V A;  1ISN A;  2CU1 A;  2KK8 A;  2HD5 B;  4ASW C;  2MBO A;  2UYZ B;  4K7U A;  4WJQ A;  4GB9 A;  2KWC A;  4KSL C;  1WGR A;  1UBI A;  3B08 A;  4RM9 A;  2D07 B;  3M95 A;  2KNB A;  3OJ3 A;  4WJN A;  4EEW A;  2KTR A;  5JZE B;  4BKG A;  1Q5W B;  4CYE A;  4FJV B;  3RZW C;  3DBS A;  2KX3 A;  2LRW A;  1G6J A;  2O2V A;  2AWT A;  2CHZ A;  3DPD A;  4F1S A;  3JW0 X;  1XT9 B;  2EMS A;  4MGY E;  3UQA A;  1XD3 B;  3SU8 X;  4E71 A;  2KOX A;  4NY0 A;  4NPN A;  3ML9 A;  3VDZ A;  4A3P A;  1V80 A;  1ZW7 A;  3TIX A;  1A5R A;  3RZF A;  2KQ7 A;  4EUT A;  4RMA A;  4TQ0 A;  2FID A;  4GN1 A;  2LWP A;  4BKS D;  4K7S A;  2HJ8 A;  2LXA A;  5C1Z A;  2K8H A;  1V49 A;  5L95 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...