5E6OA

Crystal structure of c. elegans lgg-2 bound to an aim/lir motif
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
117
structure length
117
Chain Sequence
PGSFKERRPFHERQKDVEEIRSQQPNKVPVIIERFDGERSLPLMDRCKFLVPEHITVAELMSIVRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTSQPAFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/peptide
molecule keywords Protein lgg-2
publication title Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 35
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5e6oA00
1WJUA 2XEWA 2KHWB 2NPTB 4GMVA 1EUVB 5D94A 3M95A 1V80A 2BYEA 4A20A 4F7ZA 2MBQA 4ICUA 4NY0A 2M8SA 3A33B 4YL8A 3IFWB 3VH4B 1E8YA 2L0TA 4GDKA 3DCGA 2JPHA 1WXVA 3DBSA 4EEWA 1GJZA 1NDDA 3MHSD 2LZ6A 4G50A 3RULA 2V1YA 2DX5B 3L54A 2N7DA 3H7PB 4LCDE 4RMAA 3H9DA 2D07B 2KQ7A 2MBBB 4FN2A 1NBFC 4HDOA 2K6DB 3CMMB 3Q3JA 4IM3A 3ZNZB 4ANVA 4DHZB 1V86A 4E3CA 2KJ6A 1VD2A 3ZVVA 2C9WB 2IZVB 5L83A 2CR5A 2KTRA 1YJ1A 4GOCA 1EF5A 1IYFA 3KUCB 3QHTA 3TL5A 2V4LA 3ZNHB 3U30A 4J6IA 3VDZA 2DHZA 1WE6A 3ALBA 3A9KB 3PVLA 4WJPA 3DVGX 5KHOA 1J19A 4ANXA 2RGFA 4NPNA 2Z59B 4W9IA 1ZGUB 4CYEA 3JYUA 2MW5A 5DPSA 2L05A 2L0FA 2G4SA 5GMVA 4MEMA 2CU1A 1X1MA 3UIPB 4AOFA 1HE8A 1UBIA 4CO7A 2J0KA 3H1UA 3V62A 2AWTA 4MH0E 3X0WA 4DDGD 4URKA 3VFKA 2JXXA 1K8RB 1OEYA 2MWSB 3ZRCA 4ANWA 4X57B 2YVCA 3AULA 2D2QA 2BKRB 4DHJB 2KLGA 1OEYJ 1H8CA 4DHJD 1WE7A 2HJ8A 3NY5A 5CHVC 3WAOA 2KFJA 2WX0A 3JW0X 2FCMA 5CX3A 3UQBA 3APCA 1KM7A 4HPLB 3VXWA 2IYDB 3SDLC 2UWQA 2ZNVC 3KUZA 1ZKHA 4XX5A 3M62B 2RD0A 3ZW3A 2BYVE 2ZEQA 3APDA 4M0WB 2GOWA 3OAWA 4NNJB 2KDIA 2KJHB 1G6JA 2KO3A 2KC1A 2N9EB 5LXHA 3PTFC 2LGXA 4KV2A 1UD7A 5DCNA 3UIOB 3WALA 2A4ZA 1UZXB 2MRPA 3APFA 5JHAA 1L2NA 3D32A 4AJYB 4GIVA 5E6OA 2BF8B 1YIWA 2KFKB 3C0RB 1H4RA 4IC7B 1UELA 4WWPA 2MP2A 4KDLB 2LVQA 4PS7A 4W9EA 5E6PA 2N9XA 3T8MA 2IY1B 3NHEB 2CS4A 4GB9A 3W1SC 1V5OA 4K7UA 1WXMA 1KLVA 1E5WA 4DWFA 4EKUA 3DBRI 3KVFB 4EOYA 1WMHA 3N30A 4MELA 3V60A 3A4SC 3L0WB 5TR5A 3Q3FA 1SGHA 5C23A 1WXSA 2FIDA 3ZDTA 2AEHA 3W1SA 4E71A 5EDSA 1P3QU 3R66C 3B08A 2BWFA 1KJTA 3ENEA 2KX0A 3ZNID 5DPTA 4ANUA 1WZ3A 4B6WA 4MGYE 2IBIB 4FBJB 2DYOA 4GSWA 3W1YA 1J0GA 4LJPB 4KZCA 4M8MA 2D10A 3KUDB 4GDLA 2PE6B 2L8JA 1OGWA 1WR1A 3PHWB 4NQLB 4I6NB 4NAWB 2J0MA 3AU5A 5JZEB 4ZRIA 2DZKA 1P0RA 2VRRB 2L00B 3CSFA 2NS5A 1WIAA 2O2VB 2KNBA 2O6VB 2R2OA 2RR9A 3PRZA 3ZTCA 1YD8U 4BKSA 3ZKJC 2KC2A 3HM3A 5D2MB 3VVWB 3H7PA 4G11A 2LI5A 1XD3B 3QAQA 5J17A 1TGZB 1I42A 3PV1A 2I1KA 1J8CA 1RLFA 1WYWB 4ICVA 3RCZA 3VQIA 4BKGA 4W9HA 4PS3A 4K7WA 4II3B 3NS8A 3QC8B 2FUHB 2K1FA 2PPHA 4MDKE 2WWZA 2KLCA 4TQ1A 2DZJA 3L16A 2K25A 3JVZX 1UH6A 2HTHA 3DQVA 4F8CB 2CHXA 5G55A 4MSMB 4IWOA 2RPQA 4OVUA 1YX6B 4IWPA 5CTRC 4EUTA 3ZIMA 2LGYA 1LFDA 2MX2A 2GBRA 4NJ6A 1WGRA 2FCQA 3PSEB 4AJWA 2ASQA 2BGFA 3L17A 2KWVB 2MQJA 2M1MA 4ZYNA 3GZNI 4PS8A 2ZPNA 4EFOA 5IA7A 3QCAA 2LVOA 3TIXA 1KOTA 3HIZA 2ZCCA 3VTUA 1WGYA 4TKNA 2WDTB 3X23A 2C5LC 1SIFA 4BOSC 4W9JA 1WM3A 2KWUB 4FA6A 1WR6E 5LXIB 1UBQA 1C3TA 1E7VA 2KQSA 2M17A 1IP9A 3EC8A 4W9KA 1RFAA 2FNJB 1WJ6A 2LGDA 3VH3B 2CKHB 4JQWC 3ZUNA 3ZDMC 2YLMA 4ZRJA 3U7DA 3ECIA 2OOBB 3RUIB 3PGEA 1V6EA 4K7SA 5D7GA 3S2AA 4FJYA 3P2BA 2G4DB 3ML8A 5J2RA 2DAFA 1WGDA 3ONSA 4BFRA 2N1WA 3U8ZA 4WJQA 4ZDVA 4MGKE 3UQAA 3K9PB 1P98A 1WJNA 1P9DU 4WAAA 1WRDB 2C60A 2NBVB 2JY6A 1TTNA 4P7IA 2KFKA 1C1YB 3OLMD 1AARA 4HCNB 3RT3B 4HCPB 3ZNGC 3DVNU 4FADA 5DPWA 1WM2A 4AP4C 3IG3A 2LVPA 2KMAA 3DOWA 2MCNB 2HD5B 3HHMA 2N9PC 4DBGA 1VCBA 2LRUA 2XBBC 3T9LA 3DDCB 4GXBA 4OVVA 4AWJA 2BWES 1TBEA 4BBNC 2N7EA 3QWZB 3L10B 3MJWA 4WQOB 3VUYA 3ZLZA 1WI0A 4K81A 1WFYA 4MM3A 2XK5B 1CMXB 4JLCA 3BINA 3V6EB 4CHKA 5AZHA 2AYOB 2A5UA 4LDTB 2N1VA 2C7NB 2OJRA 4XZ4A 4HXDA 3WANA 4LDTD 1RRBA 4WWOA 4BOZB 3RD2A 3PZDA 3QIJA 3RZWC 4ZRKA 1WGHA 1GNUA 3PPAA 2KD0A 2ZCBA 1EF1A 3M63B 3EFUA 5DPRA 5LLIA 4RM8A 1QZEA 3ZRFA 2UYZB 2C7HA 3VTWA 3VUXA 1IPGA 3B0AA 2GBKA 4KIKA 2BYFA 1I35A 4G0NB 2O6VA 2K6QA 1E90A 2HE7A 4BKTA 2JZ3B 2DYBA 3PS6A 3R3MA 3QJZA 1E7UA 2I1JA 4N9F4 5L95C 4LJOB 1EO6A 4W9FA 4II2B 4DXAB 2PE9A 1WX7A 2NBWB 1E8ZA 4DDID 2KZRA 2NPTA 4GU2A 2REXA 1LXDA 3EHVA 2MBOA 5CHFA 1E8XA 1XT9B 2IO0B 3A1QB 4HJKA 5CHWA 3JSVB 2L76A 1LM8B 4I6PA 1V9JA 3LJ3A 4EZJA 4WWNA 3EECA 4DHZE 2JWZA 4G3XB 3SHQA 1GC6A 1WX9A 1YQBA 1WX8A 3NOBA 2KDFB 2LJ5A 5BO4B 3WIMA 2CHWA 1MG8A 3RZFA 1T0YA 2EMSA 2LUEA 1WMHB 4FLHA 3UGBB 3IBEA 4KZ0A 2WX1A 3DVGY 1U4AA 3PT2B 3O65B 2DAJA 2DZIA 4RM9A 1V49A 2L3ZA 2Y5BB 1RAXA 3TCAA 1GG3A 2ZVNA 3GOEA 4WJNA 4JIOU 3R7RA 3B1LX 2IO2B 2NVUI 4HPMB 2JRHA 2KX3A 2RSUA 3I3TB 1UGMA 2JUOA 3HK0A 2LRWA 3ZO5B 3A9KA 1FXTB 1SE9A 2EMTA 4I6LB 3RYTA 3AXCA 1GUAB 3WAPA 5IAAC 2MA9B 4HWIB 2FIFA 3KW5B 4FHJA 2AL3A 3V61A 2K39A 3A9JB 5AZFA 3QQ8B 4KDIC 2K8HA 4KSLC 4B95A 4B9KA 4MJSB 1D3ZA 2IO1B 2G3QB 4A3OA 2MBHA 3HM6X 4TQ0A 4W9DA 2R2QA 4IUMB 1S3SG 1WGGA 5HKHA 3DPDA 2LXCA 2BKFA 4MGIE 3VHTC 1WY8A 2ZVOA 4IM2A 4HLEA 5JHBA 5D6JB 3WA0A 4TV3A 3LDZE 4GGQA 4BKSD 2IY0B 2G45B 4K1RB 2ZPYA 4HDQA 1Q5WB 2W9NA 2KVRA 3KYCD 2C7MB 4M8NA 2EKEC 2GBJA 5FR6A 4W9GA 1V2YA 4IG7B 2Z0EB 2K8CA 4EZLA 2CHZA 2KK8A 3UF8A 2N4FA 4HVBA 4BBNF 3PHXB 4E74A 5C1ZA 5J18A 4GDKB 3TBLD 2KTFA 3BY4B 4HK2A 3ML9A 2LWPA 3N3KB 3DBHI 2PJHA 3NZUA 3IHPC 3VUWA 2JF5A 1JRUA 2KJRA 2PEAA 3PLUA 1XQQA 1OQYA 1WH3A 1Z5SB 2D3GA 2XK5A 3CSTA 2DYMA 3OJ3A 1OTRB 2DZMA 2JZZA 2KWCA 4W9CA 5AEKB 3DBLI 1Q1OA 2J7QB 3PRMB 4ASWC 1A5RA 1M94A 4KSKC 2KTRB 3QK0A 1P1AA 3KYDD 2GBNA 3VAWA 2MSED 3KH0A 2K8BA 2JVCA 3VTVA 1Z2MA 2WYQA 3QX1A 4PYZA 2FAZA 3PRPB 2BPSA 3PLVA 4JL9A 1F9JA 1R4NI 4FJVB 2GBMA 4PYUA 1Y8RC 2FCSA 2LXAA 3WAMA 3NZSA 1WZ0A 3AI5A 2KN5A 2M0XA 3H6NA 3H7SA 4IW0A 3L13A 1LQBA 1NI2A 2NCNA 3QA8A 3AU4A 1V81A 3TMPB 4AUQC 2KXJA 4EZKA 4DK5A 3CF6E 2NBUA 3OJ4B 4IM0A 3IVFA 3L08A 4NAWA 2DENB 3A4RA 2JT4B 1WXAA 3A1QA 3QARA 3N32A 1TZ1A 3JSVA 2KANA 1PQSA 5JH5C 2O2VA 3SD5A 4W9LA 5AZGA 2LASA 4FJZA 4XC2A 4MGZE 2Z0DB 3M3JA 1YX5B 1V5TA 4IWQA 3UINB 1E8WA 2ZNVB 4WJOA 2KKCA 1Q0WB 2ZJDA 1S1QB 1ISNA 3DVNV 4KVGB 3SU8X 3K9OB 4NQKE 2D11A 3ZTDA 2KDBA 2LD9A 2JRIB 3V6CB 2MP2B 2M4NA 3PREA 5KHQA 1WJ4A 1WF9A 4BVUC 2J0JA 3TJPA 2KDEB 1BT0A 1ZW7A 4GN1A 1R4MI 4TUUA 2KOXA 2KMCA 4F1SA 4FHKA 4FULA 3A9JA 5G2NA 2B3AA 2ZZPB 1GC7A 5E6NA 4MJSA 2GMIC 3MTNB 4KIKB 4JGHB 1L7YA 2MLBA 4NJ7A 2NR2A 2QHOA 2O6VD 4A3PA 3R7QA 2V3SA 2FCNA 4MSQB 2IO3B 2AL6A 4GDLB 2MBEA 2L7RA
chains in the Genus database with same CATH superfamily
2JQRB 4XYCA 2KHWB 2NPTB 1I4GA 2BYEA 2D5GA 3BWUD 1GB4A 2WS3B 1WSPA 2JWUA 4EEWA 4G50A 3RULA 2DX5B 3L54A 1KLUD 4LNOA 1RM6C 2HDEA 1TKYA 3H9DA 1SJED 2D07B 1YJJA 3CMMB 3Q3JA 3ZNZB 2KJ6A 1VD2A 2CR5A 4RGOS 4A9AA 3U30A 3DVGX 5KHOA 4ANXA 2RGFA 3AEDB 4CYEA 4N59A 1JWBD 1N5WA 4CO7A 4DDGD 3H1UA 2AWTA 4MH0E 4URKA 2Y5PA 1L0VB 1TS2A 1YN5A 1OEYA 2Y5CA 3I9V1 1OEYJ 1WE7A 2IGHA 3BZDB 2D3CA 2M0AA 2QC8A 4HPLB 3ABVB 3KUZA 3SFDB 3PZ7A 2WXJA 3OAWA 1TKEA 2KC1A 1HZ6A 2A4ZA 2MRPA 3NVWA 3U4EG 1FD6A 4QAYA 4PS7A 5E6PA 4K3CA 5AUKA 1I4PA 4GB9A 1V5OA 1WXMA 1E5WA 3DBRI 3KVFB 1QOAA 4MELA 5TR5A 1TIFA 3AECB 1XLQA 2FIDA 1F0ZA 2AEHA 4E71A 1JMLA 1KJTA 2BWFA 3TEYA 5FK9C 4MGYE 4GSWA 4KZCA 4M8MA 1PDXA 3DHIC 4GDLA 4EE2A 1J7BA 1FNVA 1NI3A 2J0MA 3BVZA 3AU5A 1STEA 3CSFA 1L6UA 1WIAA 2KNBA 2WDQB 1JWSD 4S0RA 3H7PA 2IDYA 2LI5A 2YEPB 2I1KA 1J8CA 1RLFA 1WYWB 4ICVA 3RCZA 4R3DA 4W9HA 1VZ6A 3NS8A 3QC8B 1ZOYB 2PPHA 2WWZA 3L16A 3MP9A 4F8CB 2N7JA 4RFBA 2CHXA 4MSMB 1YX6B 4IWPA 5CTRC 4EUTA 1HTOA 1LFDA 2GB1A 3BK1A 1NYRA 2GBRA 4B0MA 2WU2B 3GZNI 3NVYA 3NS1A 3VTUA 2WDTB 2C5LC 1OFFA 4BOSC 1JRPA 4KX6B 1WR6E 1UBQA 2M17A 5IP4D 1IP9A 4W9KA 3RNAC 2FNJB 4RF1A 1WJ6A 2CKHB 1Y56A 2YLMA 3U7DA 1KTKA 3AEFB 1V6EA 5D7GA 3S2AA 3ONSA 4BFRA 2AQ3B 4WJQA 4ZDVA 3UQAA 3RNEC 1YJIA 2C60A 1FFVA 2Q5WD 1C1YB 5DPWA 4FADA 4KGTA 1D4BA 3AE4B 1WM2A 4AP4C 3IG3A 2HD5B 1KRHA 2N9PC 4OVVA 4P1CC 1WWTA 4WQOB 3VUYA 1N60A 4K81A 4CHKA 1LGRA 1D6EC 2A5UA 2N1VA 4XZ4A 2FBWB 4LDTD 3PZDA 1BMLC 1XEEA 4ZRKA 2W82A 3PPAA 4L23A 2ZCBA 1EF1A 5LLIA 1MG4A 1UWMA 3VTWA 3VUXA 3B0AA 1I35A 2K9XA 3IT6B 3UI3A 3PS6A 2RMMA 1QILA 1FCLA 3MFGA 1EO6A 3AH7A 4DXAB 2PE9A 2WXPA 1LXDA 1JW9D 2ICIA 5G5HA 1YN4A 2IO0B 1JCKB 4C80A 4I6PA 2BBCA 1V9JA 3GS2A 2QMTA 2JWZA 5EE1A 3HVZA 1SB3C 1GC6A 1JWUD 1WX9A 1QOGA 3SFEB 1T0YA 2EMSA 2GI9A 2WX1A 3HVDA 3O65B 2I2YA 2Y5BB 1GG3A 3R7RA 2LEKA 1KLGD 3I3TB 4GLSC 3ZO5B 1FXTB 1SE9A 3HUIA 5IAAC 2MA9B 4FHJA 3V61A 4YTPB 2M56B 4KSLC 3SR6A 3TEZA 4S17A 1N63A 4A3OA 3HM6X 4W9DA 1L4ZB 2VH2A 1FCCC 2BKFA 1WY8A 1ZPSA 4IM2A 5D6JB 3WA0A 3LDZE 2IY0B 2G45B 4N58A 2KVRA 3KYCD 2X38A 2CHZA 3UF8A 4M0WA 5J18A 1MJDA 2KTFA 3BY4B 3ML9A 1CJEA 3NZUA 2JF5A 2K3UA 1GAQB 2KJRA 4WAFA 2PEAA 3PLUA 1XQQA 2D3GA 3DWMA 1OTRB 3DBLI 3PRMB 4BAXA 1A5RA 4OZAA 1M94A 3R2IA 1XLNA 2R61A 2KTRB 3Q8FA 2JVCA 2QILA 2WYQA 3VTVA 3QX1A 1FRDA 3PRPB 5T8IA 1SF0A 2BPSA 1TS3A 2YEPF 4XWWA 2MHJA 1WYGA 2PW9A 1Y8RC 1C78A 2WU5B 2PVOD 1QLBB 4HJGE 2GRIA 2M0XA 3IAM1 1L0YB 3W9CB 2DWQA 1T0RC 4J3OD 3NVVA 3TMPB 1AW7A 2KXJA 2D3BA 3IVFA 3L08A 3A1QA 2V9HA 3HRDD 1TZ1A 1OQRA 1IBXA 1C4CA 1PQSA 5JH5C 2O2VA 3SD5A 4W9LA 5AZGA 3M3JA 2W54A 4IWQA 3TEWA 2IGGA 4WJOA 4RH6A 2ZJDA 1S1QB 3AE7B 5BMGA 4OHJA 1I7HA 3ZTDA 3AMZA 2RDHA 2LD9A 1FXIA 2JRIB 3VRAB 1JALA 3EGRA 1DYQA 2WXKA 2LMCA 1WJ4A 1FRRA 2J52A 5HFYA 1BT0A 2PLPA 2KOXA 4FULA 1K52A 5G2NA 2B3AA 4MJSA 1UNSA 3MTNB 5BMHA 1L7YA 2NR2A 2O6VD 4JE3B 5AUIA 3N1XC 2IO3B 3V05A 2NTSA 2L7RA 2XEWA 1EUVB 2INNE 3M95A 1ZDXA 4A20A 4F7ZA 2B76B 3A33B 4YL8A 3IFWB 4GDKA 3DCGA 1DOIA 1HQRD 1WXVA 3DBSA 4HKQA 1FEHA 3MHSD 4KGSA 3AE8B 2BB5A 3BK2A 2MBBB 4ANVA 4IM3A 2K6DB 1V86A 2C9WB 1EF5A 5HHDG 2QIEB 1XLOA 1E10A 3QHTA 5I4DA 3P42A 3TL5A 2V4LA 1L4DB 2DHZA 1JROA 2JZPA 3FILB 1XCQL 4NPNA 2Z59B 1ZGUB 2L0FA 3W5UB 2CU1A 4AOFA 3UIPB 1UBIA 1AWDA 3ZRCA 3AULA 4YSYB 2BKRB 3AM9A 1XLPA 4B0EA 1F2RC 1H8CA 3NY5A 3WAOA 2KFJA 3Q3OC 5CX3A 1EM7A 2FCMA 3JW0X 1KM7A 2JXTA 2ZNVC 3RFZB 3M62B 1YMHE 3APDA 4M0WB 4US9A 5LXHA 3PTFC 3TUOA 5DCNA 3WALA 1UZXB 3APFA 5JHAA 3D32A 3ZQ4A 4AJYB 1BUIC 2KFKB 3C0RB 4WURA 3W2DA 4IC7B 1UELA 1RYJA 2MP2A 4N6EB 4W9EA 2N9XA 3T8MA 4XDCA 2CS4A 1KLVA 5JXVA 1VZ8A 4EOYA 2BYTA 4ZOHC 4YWGG 3V60A 1SGHA 4HROA 1WXSA 5EDSA 2GLSA 3R66C 1JWMD 3ENEA 2KX0A 3SEBA 1WZ3A 4B6WA 1B1ZA 3W1YA 1J0GA 1WRIA 2L8JA 1WR1A 1T3QA 1ZUD2 4HPPA 2O6VB 2O2VB 2RR9A 2R2OA 1V1PB 5HI1A 3ZKJC 3HM3A 4WQMA 2WXGA 5J17A 4K7WA 2CU3A 3U2SC 2K1FA 4MDKE 3NG0A 2TSSA 4OVZA 4TQ1A 4A55A 4OVUA 1GOZA 2RPQA 3E9SA 2MX2A 1R7SA 2FCQA 5D3DA 1VLBA 1NVID 4PS8A 4L1BA 3FC4A 4EFOA 1E9MA 3HIZA 2ZCCA 1PFDA 5BYQA 1SIFA 2V3PA 1ROEA 3PZ8A 1WM3A 4FA6A 1C3TA 4KGRA 2PKOA 1E7VA 2KQSA 3EC8A 2LGIA 3MC0B 3AEEB 1NENB 3ZDMC 2INPE 3ECIA 2OOBB 5J2RA 4OW0A 3AN1A 2N1WA 1TY0A 4UDUC 4REZA 3RN9C 3B9JA 1ACCA 1WRDB 2QEJC 2KMAA 5D3IB 1ZDVA 2CJNA 1EWCA 1OQQA 3NUHB 3DDCB 4LNFA 1KF6B 4AWJA 2BWES 4BBNC 2N7EA 1FM0D 3EFCA 2J4XA 3BINA 3V6EB 4YSZB 1NEKB 3WANA 3RD2A 2KWDA 2KD0A 3M63B 1YNTE 5DPRA 1QKZA 4RM8A 1SIJA 1QZEA 3ZRFA 3P63A 2VZKB 4G0NB 4ARIA 3B2FA 4BKTA 1C4AA 1ZE3D 2HE7A 2JZ3B 3R3MA 3QJZA 4N9F4 2I1JA 5L95C 3MJ5A 4W9FA 1E8ZA 2EKIA 2KZRA 5MPOA 2REXA 4ZRQA 1SSNA 1E8XA 4PK1A 2XN9C 3JSVB 4LLGM 2MJDA 1LM8B 4EZJA 2Z8LA 3T3OA 4RGNA 1P7EA 3EECA 4AS1A 3SHQA 1YQBA 1WX8A 2LJ5A 4NAMA 1MG8A 4FLHA 3UGBB 2OJWA 3PT2B 2DAJA 2DZIA 4RM9A 2L3ZA 1RAXA 3GOEA 4WJNA 4YSXB 2IO2B 2JUOA 2LRWA 3DBHB 3A9KA 4I6LB 3AV8A 1VDVA 3EUB2 1GUAB 2BS3B 3VRBB 2DBYA 4HWIB 2K39A 2KN4A 2FUG1 4B95A 4B9KA 1D3ZA 3AE1B 2R2QA 4IUMB 1S3SG 4DXFA 3N20C 4MGIE 2ZVOA 4HLEA 5JHBA 4K1RB 2ZPYA 1Q5WB 2EKEC 3RNFC 4IG7B 4L2YA 2KK8A 3P4QB 2BS4B 4XDDA 4HK2A 2LWPA 1TZOA 4FXCA 1D5ZC 3IHPC 1Q10A 2XK5A 3CSTA 1WH3A 3DWGC 5AEKB 4W9CA 4ASWC 1QQRA 3N1YC 2QJLA 2ZW1A 1Z2MA 1XXGA 1R4NI 1ET9A 4FJVB 2GBMA 3P1MA 2W55A 4US8A 5GXGB 2LXAA 3NZSA 5G5GA 2KN5A 3H6NA 3L13A 1LQBA 3QA8A 2NCNA 4AUQC 4ARCA 2INDC 3CF6E 2WXOA 2J53A 4IM0A 2DENB 1WXAA 2PIAA 3N32A 1FXAA 3I63C 2KANA 1C79A 4FJZA 4XC2A 4MGZE 4ZRPA 2X8XX 4MH8A 1ZP0B 2KKCA 3R2TA 1PGBA 2KDBA 2FE8A 1VJKA 1RFKA 3OWEB 2ZW0A 1WF9A 1ZW7A 4TUUA 4F1SA 3A9JA 3WCQA 4ZYSA 5E6NA 3ZXRA 4RGTA 1V8CA 2QHOA 4A3PA 3R7QA 4C7ZA 2V3SA 4GDLB 2CJOA 1DOYA 4GMVA 1V80A 3Q3NC 1HZ5A 4ICUA 4NY0A 1HEZE 4TMAB 2OHFA 3VH4B 2JPHA 2HJ1A 1GJZA 2LZ6A 2N7DA 1CK1A 2LFIA 3H7PB 4LCDE 2PVGC 5E6JA 2KQ7A 4KKJA 1NBFC 4DHZB 2IZVB 5L83A 1IYFA 1AN8A 5H8YE 3KUCB 3ZNHB 4J6IA 4XWTA 4WJPA 2XNAC 3A9KB 2MEKA 1J19A 4IKGA 3JYUA 2MW5A 5DPSA 2L05A 5GMVA 2G4SA 2BT6A 2KMMA 3X0WA 3Q8BA 2M19A 3P4SB 2JXXA 2MWSB 2YVCA 4DHJB 2KLGA 4USAA 4C4VA 5CHVC 1CQVA 1WXQA 2EELA 5HG2A 2WX0A 1HXYD 3UQBA 3APCA 1SEBD 4JWSC 3VXWA 2IYDB 1ESFA 1JWAD 3ETRA 3Q8CA 2KACA 4XX5A 4YXDB 1KFYB 2BYVE 1SE2A 2ZEQA 2GOWA 4MT5A 4JPSA 2KDIA 2KJHB 1G6JA 2KO3A 2N9EB 1YN3A 1PGXA 4KV2A 1UD7A 1D5XC 3U7ZA 2ON8A 1L2NA 5E6OA 3Q6BA 1UWXA 2LVQA 3IT4B 2IY1B 1TYGB 1C77A 4K7UA 3V3XA 4EKUA 2AX5A 2JYTA 3L0WB 2WXMA 3ZDTA 1P3QU 1B9RA 3AEGB 5DPTA 4ANUA 2H89B 5IN7A 2OEDA 2IBIB 2K5PA 2DYOA 4P6VF 4LJPB 2D10A 1F52A 2PE6B 2RDGA 1OGWA 3PHWB 5JZEB 3GP7A 4ZRIA 4BZAA 4O1NA 2DZKA 3ZYYX 2NS5A 5IO9A 1I4XA 2WDVB 3ZTCA 1YD8U 4BKSA 4LK0M 4G11A 3ZXVA 1XD3B 2KQ4X 3PV1A 1TY2A 3VQIA 4PS3A 4II3B 4ACFA 3E56A 2KLCA 2DZJA 2K25A 3JVZX 1UH6A 2HTHA 5EE9A 3AE6B 1EWYC 4IWOA 4A8XC 2WXRA 2LGYA 1VZ7A 2WP9B 3Q2AC 4NJ6A 3PSEB 4AJWA 2ASQA 2BGFA 2KWVB 4ZYNA 2M1MA 3BVMA 3QCAA 2LVOA 1WGYA 3X23A 4W9JA 5TSSA 3KQ4A 3VH3B 4JQWC 3ZUNA 4D2KA 2WLBA 3VR8B 3RUIB 2N9KA 4FJYA 1WGDA 4MGKE 1E0ZA 4ZHOA 3K9PB 3KWLA 1WJNA 4WAAA 3ZJUA 1TTNA 3ZNGC 4HCPB 3R8BA 3ZGZA 2MCNB 2V4IB 3HHMA 4DBGA 1VCBA 3T9LA 1EU3A 1DGJA 1TBEA 1ZXIA 3L10B 3MJWA 1UGJA 3IXSA 2KVZA 4HKZE 1WFYA 4MM3A 3AE9B 1CMXB 1CZPA 3B2GA 4M02A 4WWOA 3C8YA 4BOZB 3RZWC 1WGHA 1GNUA 4A90A 2UYZB 2C7HA 1IPGA 1WGKA 2VZKD 1TJEA 2NBWB 4DDID 4GU2A 3EHVA 2WHIA 5EE0A 1XT9B 3A1QB 4HJKA 1IBXB 3T3NA 3LJ3A 1TT5B 4H2AA 2SEBD 3NZ3A 4DHZE 3Q3MC 2HTME 5BO4B 2KDFB 2CHWA 3RZFA 2LUEA 3IBEA 4KZ0A 3DVGY 1U4AA 1P7FA 2BB6A 1YQ3B 2NVUI 2JRHA 2KX3A 4ITKA 1UGMA 2EMTA 3RYTA 1MPEA 1I4RA 2PMVA 4RGMA 2FIFA 3KW5B 5AZFA 3QQ8B 2K8HA 4YT0B 4MJSB 5C3JB 3Q8AA 2IO1B 2G3QB 4WH4A 1WGGA 2INCC 3GE3C 1XO3A 1SE4A 3DPDA 1D5MC 3VHTC 4LNIA 4TV3A 4HEA1 4GGQA 2SAKA 4HDQA 4M8NA 5FR6A 2C7MB 2V3NA 1V2YA 4C56C 3MC8A 2Z0EB 2K8CA 3RNGC 4MACA 1QT9A 2N4FA 4HVBA 4E74A 5C1ZA 2VH1A 4GDKB 2L52A 1VR9A 4PT5A 4LNKA 2Y3AA 3DBHI 2PJHA 3NJTA 3VUWA 1OQYA 1Z5SB 2LHDA 2W3SA 3OJ3A 2KWCA 2JZZA 1Q1OA 2J7QB 2K22A 3TEXA 2GBNA 2MSED 3KH0A 2DLBA 3GE8C 2K8BA 2PTLA 4PYZA 2FAZA 3PLVA 4JL9A 3N9YC 3URYA 1WZ0A 3AI5A 3LXFA 1RWSA 3H7SA 4IW0A 2QCZA 2WXHA 1K51A 3MHZA 1R4MB 4HRSA 2L83A 2ONQA 4LNNA 4NAWA 3A4RA 3QARA 5H92C 1I4HA 2G9HD 1A70A 5FR3A 2LASA 4RF0A 2N0SB 2E3TA 2G1EA 2KYWA 2QDFA 1V5TA 3H8HA 3UINB 1KH0A 1E8WA 2ZNVB 1FO4A 1ISNA 2KAJA 3GB1A 4KVGB 1C76A 4NQKE 4MM3B 1JQ4A 3NRZA 3V6CB 2MP2B 5KHQA 1T0QC 2WNMA 2KT7A 2J0JA 3TJPA 1EU4A 3J9CA 4GN1A 1BXTA 3KLSX 2D3AA 2KMCA 4FHKA 2ZZPB 2GMIC 4NZLB 3KWVA 4IDIA 4JGHB 2JU6X 1TKGA 2MLBA 4NJ7A 1MHHE 1C9FA 4MSQB 3AE5B 3VDZA 2MBEA 1WJUA 1E7PB 5D94A 2MBQA 2M8SA 1VRAB 1E8YA 2L0TA 2JSVX 1TS5A 4P1BC 2WXFA 1K50A 3AE3B 2DNFA 1NDDA 3AB5A 2V1YA 1J7AA 1T0SC 4RMAA 4M01A 4FN2A 3MC9A 4HDOA 1IGCA 4E3CA 3ZVVA 2KTRA 1YJ1A 2K0PA 4GOCA 3U52E 3AE2B 3ALBA 1WE6A 3PVLA 2RPVA 4ZHPA 4YTMB 4W9IA 4DXGA 1K53A 4MEMA 5LNK1 4JX1C 1X1MA 1HE8A 2J0KA 3P4PB 2MJ3A 3V62A 3VFKA 1K8RB 3DBRB 4ANWA 4X57B 2D2QA 4JWUC 4DHJD 2HJ8A 3SDLC 2UWQA 4WIPA 1QF6A 1ZKHA 2RD0A 3ZW3A 3DHGC 4NNJB 1FFUA 2LGXA 1F77A 3UIOB 4A6QA 4GIVA 2BF8B 1YIWA 1H4RA 4WWPA 2E6XA 4KDLB 3NHEB 3W1SC 2RDBC 2LGSA 4DWFA 4DQOC 1WMHA 3N30A 3A4SC 2IJ0A 3Q3FA 5C23A 3W1SA 4Q2JA 3B08A 3ZNID 1UUPA 4FBJB 1MVKA 1C4PA 3RNCC 3KUDB 3EA6A 1XCTL 3GZNB 4NQLB 4I6NB 4NAWB 4CQNA 4P16A 1QOFA 1N6ZA 1P0RA 2VRRB 4AQ7A 2L00B 1GPXA 4NJCA 2IGDA 3PRZA 2J42A 3VR9B 2JYEA 4IOIE 2WXQA 2KC2A 2LJIA 3CWIA 5D2MB 3VVWB 3QAQA 1I42A 1TGZB 3IAS1 4BKGA 2FUHB 5BMIA 1E6EB 3I5JC 1PYWD 1IUEA 3DQVA 4OZCA 4RNAA 2MJEA 5G55A 3ZIMA 2WDRB 3FILA 1ENFA 3I57A 1WGRA 2W3RA 3L17A 2BW2A 2MQJA 2ACZB 3C19A 2ZPNA 5IA7A 3TIXA 1KOTA 4TKNA 1GB1A 2KWUB 5LXIB 1RFAA 1R4NB 2LGDA 4ZRJA 1HA5A 4M00A 2BVCA 1AYFA 3PGEA 4K7SA 3P2BA 2G4DB 3ML8A 2DAFA 4K3BA 3DHHC 3U8ZA 3BIID 1M4VA 4KKIA 1P98A 1P9DU 2NBVB 2JY6A 4P7IA 2KFKA 4HCNB 3OLMD 1AARA 3RT3B 1MFWA 3DVNU 2UU7A 2LVPA 3DOWA 2LRUA 2XBBC 4GXBA 2NMQA 2N9LA 3LYYA 3QWZB 1HTQA 1L6VA 3ZLZA 1WI0A 2WQYB 2XK5B 3W5VB 4JLCA 3FKYA 4XGAB 5AZHA 1DOXA 2AYOB 4LDTB 2C7NB 2OJRA 4HXDA 1RRBA 3QIJA 1V1OA 3EFUA 1FPYA 4KIKA 2GBKA 4WWMA 1LO5D 2BYFA 4LTUA 4C00A 3RPFC 2O6VA 1E90A 2K6QA 3Q69A 1V1PA 2DYBA 3FAHA 1E7UA 1ZXHA 4LJOB 4II2B 1MI0A 1WX7A 2NPTA 3BVGA 2LUMA 2MBOA 5CHFA 5CHWA 2L76A 3BYYB 4WWNA 2WGSA 4G3XB 1IGDA 3NOBA 1F1HA 3WIMA 2V0GA 2WXLA 1PUTA 1WMHB 3ZJVA 2BTEA 5EE3A 2H88B 1V49A 1L5PA 3TCAA 2ZVNA 4JIOU 3B1LX 4HPMB 2WXIA 1SXTA 2RSUA 3HK0A 1SE3A 2QSDA 3AXCA 3WAPA 2AL3A 3A9JB 3DBLB 4OZBA 4KDIC 1ET6A 4TQ0A 2MBHA 3RNBC 5HKHA 1FNUA 3LB8C 2AQ1B 2LXCA 2I38A 1T5XD 5C2TB 3PO0A 1XF5L 4BKSD 1I4QA 2W9NA 2GBJA 4W9GA 2MH7A 3Q14C 3BYTB 4EZLA 4BBNF 3PHXB 3ZJTA 3AEAB 3TBLD 3N3KB 4XE0A 1PGAA 1JRUA 1TS4A 1N61A 2DYMA 2DZMA 1SJHD 4KSKC 5IOIA 3QK0A 1P1AA 3KYDD 3VAWA 3O13A 2WXNA 5FKAC 1T6BX 4YTNB 3N1ZC 2JX5A 1F9JA 4TSSA 1J7CA 5BYRA 4PYUA 2FCSA 2NTTA 1YOVB 3WAMA 2AQ2B 3OG5A 3TSSA 1NI2A 3AU4A 1V81A 1YQ4B 2BS2B 4EZKA 4DK5A 4C4VB 2NBUA 3RMKC 1NYQA 1SBBB 3OJ4B 1N5XA 2JT4B 2L1AA 3JSVA 1FIQA 1L0XB 1V97A 5BYSA 2Z0DB 3CIRB 4C7YA 1YX5B 3Q8EA 1Q0WB 3DVNV 3SU8X 3K9OB 2D11A 2IPKD 2BQQA 3AEBB 1QOBA 5IKCM 1MHXA 2M4NA 3PREA 4BVUC 2KDEB 2L32A 1FNWA 2KDMA 1R4MI 3RI7C 3P4RB 3L4PA 1GC7A 1N62A 2LHEA 4KIKB 4RCOA 1F2RI 1FMAD 3NVZA 2FCNA 1UF0A 2AL6A
chains in the Genus database with same CATH topology
1WJUA 2XEWA 2KHWB 2NPTB 4GMVA 1EUVB 5D94A 3M95A 1V80A 2BYEA 4A20A 4F7ZA 2MBQA 4ICUA 4NY0A 2M8SA 3A33B 4YL8A 3IFWB 3VH4B 1E8YA 2L0TA 4GDKA 3DCGA 2JPHA 1WXVA 3DBSA 4EEWA 1GJZA 1NDDA 3MHSD 2LZ6A 4G50A 3RULA 2V1YA 2DX5B 3L54A 2N7DA 3H7PB 4LCDE 4RMAA 3H9DA 2D07B 2KQ7A 2MBBB 4FN2A 1NBFC 4HDOA 2K6DB 3CMMB 3Q3JA 4IM3A 3ZNZB 4ANVA 4DHZB 1V86A 4E3CA 2KJ6A 1VD2A 3ZVVA 2C9WB 2IZVB 5L83A 2CR5A 2KTRA 1YJ1A 4GOCA 1EF5A 1IYFA 3KUCB 3QHTA 3TL5A 2V4LA 3ZNHB 3U30A 4J6IA 3VDZA 2DHZA 1WE6A 3ALBA 3A9KB 3PVLA 4WJPA 3DVGX 5KHOA 1J19A 4ANXA 2RGFA 4NPNA 2Z59B 4W9IA 1ZGUB 4CYEA 3JYUA 2MW5A 5DPSA 2L05A 2L0FA 2G4SA 5GMVA 4MEMA 2CU1A 1X1MA 3UIPB 4AOFA 1HE8A 1UBIA 4CO7A 2J0KA 3H1UA 3V62A 2AWTA 4MH0E 3X0WA 4DDGD 4URKA 3VFKA 2JXXA 1K8RB 1OEYA 2MWSB 3ZRCA 4ANWA 4X57B 2YVCA 3AULA 2D2QA 2BKRB 4DHJB 2KLGA 1OEYJ 1H8CA 4DHJD 1WE7A 2HJ8A 3NY5A 5CHVC 3WAOA 2KFJA 2WX0A 3JW0X 2FCMA 5CX3A 3UQBA 3APCA 1KM7A 4HPLB 3VXWA 2IYDB 3SDLC 2UWQA 2ZNVC 3KUZA 1ZKHA 4XX5A 3M62B 2RD0A 3ZW3A 2BYVE 2ZEQA 3APDA 4M0WB 2GOWA 3OAWA 4NNJB 2KDIA 2KJHB 1G6JA 2KO3A 2KC1A 2N9EB 5LXHA 3PTFC 2LGXA 4KV2A 1UD7A 5DCNA 3UIOB 3WALA 2A4ZA 1UZXB 2MRPA 3APFA 5JHAA 1L2NA 3D32A 4AJYB 4GIVA 5E6OA 2BF8B 1YIWA 2KFKB 3C0RB 1H4RA 4IC7B 1UELA 4WWPA 2MP2A 4KDLB 2LVQA 4PS7A 4W9EA 5E6PA 2N9XA 3T8MA 2IY1B 3NHEB 2CS4A 4GB9A 3W1SC 1V5OA 4K7UA 1WXMA 1KLVA 1E5WA 4DWFA 4EKUA 3DBRI 3KVFB 4EOYA 1WMHA 3N30A 4MELA 3V60A 3A4SC 3L0WB 5TR5A 3Q3FA 1SGHA 5C23A 1WXSA 2FIDA 3ZDTA 2AEHA 3W1SA 4E71A 5EDSA 1P3QU 3R66C 3B08A 2BWFA 1KJTA 3ENEA 2KX0A 3ZNID 5DPTA 4ANUA 1WZ3A 4B6WA 4MGYE 2IBIB 4FBJB 2DYOA 4GSWA 3W1YA 1J0GA 4LJPB 4KZCA 4M8MA 2D10A 3KUDB 4GDLA 2PE6B 2L8JA 1OGWA 1WR1A 3PHWB 4NQLB 4I6NB 4NAWB 2J0MA 3AU5A 5JZEB 4ZRIA 2DZKA 1P0RA 2VRRB 2L00B 3CSFA 2NS5A 1WIAA 2O2VB 2KNBA 2O6VB 2R2OA 2RR9A 3PRZA 3ZTCA 1YD8U 4BKSA 3ZKJC 2KC2A 3HM3A 5D2MB 3VVWB 3H7PA 4G11A 2LI5A 1XD3B 3QAQA 5J17A 1TGZB 1I42A 3PV1A 2I1KA 1J8CA 1RLFA 1WYWB 4ICVA 3RCZA 3VQIA 4BKGA 4W9HA 4PS3A 4K7WA 4II3B 3NS8A 3QC8B 2FUHB 2K1FA 2PPHA 4MDKE 2WWZA 2KLCA 4TQ1A 2DZJA 3L16A 2K25A 3JVZX 1UH6A 2HTHA 3DQVA 4F8CB 2CHXA 5G55A 4MSMB 4IWOA 2RPQA 4OVUA 1YX6B 4IWPA 5CTRC 4EUTA 3ZIMA 2LGYA 1LFDA 2MX2A 2GBRA 4NJ6A 1WGRA 2FCQA 3PSEB 4AJWA 2ASQA 2BGFA 3L17A 2KWVB 2MQJA 2M1MA 4ZYNA 3GZNI 4PS8A 2ZPNA 4EFOA 5IA7A 3QCAA 2LVOA 3TIXA 1KOTA 3HIZA 2ZCCA 3VTUA 1WGYA 4TKNA 2WDTB 3X23A 2C5LC 1SIFA 4BOSC 4W9JA 1WM3A 2KWUB 4FA6A 1WR6E 5LXIB 1UBQA 1C3TA 1E7VA 2KQSA 2M17A 1IP9A 3EC8A 4W9KA 1RFAA 2FNJB 1WJ6A 2LGDA 3VH3B 2CKHB 4JQWC 3ZUNA 3ZDMC 2YLMA 4ZRJA 3U7DA 3ECIA 2OOBB 3RUIB 3PGEA 1V6EA 4K7SA 5D7GA 3S2AA 4FJYA 3P2BA 2G4DB 3ML8A 5J2RA 2DAFA 1WGDA 3ONSA 4BFRA 2N1WA 3U8ZA 4WJQA 4ZDVA 4MGKE 3UQAA 3K9PB 1P98A 1WJNA 1P9DU 4WAAA 1WRDB 2C60A 2NBVB 2JY6A 1TTNA 4P7IA 2KFKA 1C1YB 3OLMD 1AARA 4HCNB 3RT3B 4HCPB 3ZNGC 3DVNU 4FADA 5DPWA 1WM2A 4AP4C 3IG3A 2LVPA 2KMAA 3DOWA 2MCNB 2HD5B 3HHMA 2N9PC 4DBGA 1VCBA 2LRUA 2XBBC 3T9LA 3DDCB 4GXBA 4OVVA 4AWJA 2BWES 1TBEA 4BBNC 2N7EA 3QWZB 3L10B 3MJWA 4WQOB 3VUYA 3ZLZA 1WI0A 4K81A 1WFYA 4MM3A 2XK5B 1CMXB 4JLCA 3BINA 3V6EB 4CHKA 5AZHA 2AYOB 2A5UA 4LDTB 2N1VA 2C7NB 2OJRA 4XZ4A 4HXDA 3WANA 4LDTD 1RRBA 4WWOA 4BOZB 3RD2A 3PZDA 3QIJA 3RZWC 4ZRKA 1WGHA 1GNUA 3PPAA 2KD0A 2ZCBA 1EF1A 3M63B 3EFUA 5DPRA 5LLIA 4RM8A 1QZEA 3ZRFA 2UYZB 2C7HA 3VTWA 3VUXA 1IPGA 3B0AA 2GBKA 4KIKA 2BYFA 1I35A 4G0NB 2O6VA 2K6QA 1E90A 2HE7A 4BKTA 2JZ3B 2DYBA 3PS6A 3R3MA 3QJZA 1E7UA 2I1JA 4N9F4 5L95C 4LJOB 1EO6A 4W9FA 4II2B 4DXAB 2PE9A 1WX7A 2NBWB 1E8ZA 4DDID 2KZRA 2NPTA 4GU2A 2REXA 1LXDA 3EHVA 2MBOA 5CHFA 1E8XA 1XT9B 2IO0B 3A1QB 4HJKA 5CHWA 3JSVB 2L76A 1LM8B 4I6PA 1V9JA 3LJ3A 4EZJA 4WWNA 3EECA 4DHZE 2JWZA 4G3XB 3SHQA 1GC6A 1WX9A 1YQBA 1WX8A 3NOBA 2KDFB 2LJ5A 5BO4B 3WIMA 2CHWA 1MG8A 3RZFA 1T0YA 2EMSA 2LUEA 1WMHB 4FLHA 3UGBB 3IBEA 4KZ0A 2WX1A 3DVGY 1U4AA 3PT2B 3O65B 2DAJA 2DZIA 4RM9A 1V49A 2L3ZA 2Y5BB 1RAXA 3TCAA 1GG3A 2ZVNA 3GOEA 4WJNA 4JIOU 3R7RA 3B1LX 2IO2B 2NVUI 4HPMB 2JRHA 2KX3A 2RSUA 3I3TB 1UGMA 2JUOA 3HK0A 2LRWA 3ZO5B 3A9KA 1FXTB 1SE9A 2EMTA 4I6LB 3RYTA 3AXCA 1GUAB 3WAPA 5IAAC 2MA9B 4HWIB 2FIFA 3KW5B 4FHJA 2AL3A 3V61A 2K39A 3A9JB 5AZFA 3QQ8B 4KDIC 2K8HA 4KSLC 4B95A 4B9KA 4MJSB 1D3ZA 2IO1B 2G3QB 4A3OA 2MBHA 3HM6X 4TQ0A 4W9DA 2R2QA 4IUMB 1S3SG 1WGGA 5HKHA 3DPDA 2LXCA 2BKFA 4MGIE 3VHTC 1WY8A 2ZVOA 4IM2A 4HLEA 5JHBA 5D6JB 3WA0A 4TV3A 3LDZE 4GGQA 4BKSD 2IY0B 2G45B 4K1RB 2ZPYA 4HDQA 1Q5WB 2W9NA 2KVRA 3KYCD 2C7MB 4M8NA 2EKEC 2GBJA 5FR6A 4W9GA 1V2YA 4IG7B 2Z0EB 2K8CA 4EZLA 2CHZA 2KK8A 3UF8A 2N4FA 4HVBA 4BBNF 3PHXB 4E74A 5C1ZA 5J18A 4GDKB 3TBLD 2KTFA 3BY4B 4HK2A 3ML9A 2LWPA 3N3KB 3DBHI 2PJHA 3NZUA 3IHPC 3VUWA 2JF5A 1JRUA 2KJRA 2PEAA 3PLUA 1XQQA 1OQYA 1WH3A 1Z5SB 2D3GA 2XK5A 3CSTA 2DYMA 3OJ3A 1OTRB 2DZMA 2JZZA 2KWCA 4W9CA 5AEKB 3DBLI 1Q1OA 2J7QB 3PRMB 4ASWC 1A5RA 1M94A 4KSKC 2KTRB 3QK0A 1P1AA 3KYDD 2GBNA 3VAWA 2MSED 3KH0A 2K8BA 2JVCA 3VTVA 1Z2MA 2WYQA 3QX1A 4PYZA 2FAZA 3PRPB 2BPSA 3PLVA 4JL9A 1F9JA 1R4NI 4FJVB 2GBMA 4PYUA 1Y8RC 2FCSA 2LXAA 3WAMA 3NZSA 1WZ0A 3AI5A 2KN5A 2M0XA 3H6NA 3H7SA 4IW0A 3L13A 1LQBA 1NI2A 2NCNA 3QA8A 3AU4A 1V81A 3TMPB 4AUQC 2KXJA 4EZKA 4DK5A 3CF6E 2NBUA 3OJ4B 4IM0A 3IVFA 3L08A 4NAWA 2DENB 3A4RA 2JT4B 1WXAA 3A1QA 3QARA 3N32A 1TZ1A 3JSVA 2KANA 1PQSA 5JH5C 2O2VA 3SD5A 4W9LA 5AZGA 2LASA 4FJZA 4XC2A 4MGZE 2Z0DB 3M3JA 1YX5B 1V5TA 4IWQA 3UINB 1E8WA 2ZNVB 4WJOA 2KKCA 1Q0WB 2ZJDA 1S1QB 1ISNA 3DVNV 4KVGB 3SU8X 3K9OB 4NQKE 2D11A 3ZTDA 2KDBA 2LD9A 2JRIB 3V6CB 2MP2B 2M4NA 3PREA 5KHQA 1WJ4A 1WF9A 4BVUC 2J0JA 3TJPA 2KDEB 1BT0A 1ZW7A 4GN1A 1R4MI 4TUUA 2KOXA 2KMCA 4F1SA 4FHKA 4FULA 3A9JA 5G2NA 2B3AA 2ZZPB 1GC7A 5E6NA 4MJSA 2GMIC 3MTNB 4KIKB 4JGHB 1L7YA 2MLBA 4NJ7A 2NR2A 2QHOA 2O6VD 4A3PA 3R7QA 2V3SA 2FCNA 4MSQB 2IO3B 2AL6A 4GDLB 2MBEA 2L7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJU A;  2XEW A;  2KHW B;  2NPT B;  4GMV A;  1EUV B;  5D94 A;  3M95 A;  1V80 A;  2BYE A;  4A20 A;  4F7Z A;  2MBQ A;  4ICU A;  4NY0 A;  2M8S A;  3A33 B;  4YL8 A;  3IFW B;  3VH4 B;  1E8Y A;  2L0T A;  4GDK A;  3DCG A;  2JPH A;  1WXV A;  3DBS A;  4EEW A;  1GJZ A;  1NDD A;  3MHS D;  2LZ6 A;  4G50 A;  3RUL A;  2V1Y A;  2DX5 B;  3L54 A;  2N7D A;  3H7P B;  4LCD E;  4RMA A;  3H9D A;  2D07 B;  2KQ7 A;  2MBB B;  4FN2 A;  1NBF C;  4HDO A;  2K6D B;  3CMM B;  3Q3J A;  4IM3 A;  3ZNZ B;  4ANV A;  4DHZ B;  1V86 A;  4E3C A;  2KJ6 A;  1VD2 A;  3ZVV A;  2C9W B;  2IZV B;  5L83 A;  2CR5 A;  2KTR A;  1YJ1 A;  4GOC A;  1EF5 A;  1IYF A;  3KUC B;  3QHT A;  3TL5 A;  2V4L A;  3ZNH B;  3U30 A;  4J6I A;  3VDZ A;  2DHZ A;  1WE6 A;  3ALB A;  3A9K B;  3PVL A;  4WJP A;  3DVG X;  5KHO A;  1J19 A;  4ANX A;  2RGF A;  4NPN A;  2Z59 B;  4W9I A;  1ZGU B;  4CYE A;  3JYU A;  2MW5 A;  5DPS A;  2L05 A;  2L0F A;  2G4S A;  5GMV A;  4MEM A;  2CU1 A;  1X1M A;  3UIP B;  4AOF A;  1HE8 A;  1UBI A;  4CO7 A;  2J0K A;  3H1U A;  3V62 A;  2AWT A;  4MH0 E;  3X0W A;  4DDG D;  4URK A;  3VFK A;  2JXX A;  1K8R B;  1OEY A;  2MWS B;  3ZRC A;  4ANW A;  4X57 B;  2YVC A;  3AUL A;  2D2Q A;  2BKR B;  4DHJ B;  2KLG A;  1OEY J;  1H8C A;  4DHJ D;  1WE7 A;  2HJ8 A;  3NY5 A;  5CHV C;  3WAO A;  2KFJ A;  2WX0 A;  3JW0 X;  2FCM A;  5CX3 A;  3UQB A;  3APC A;  1KM7 A;  4HPL B;  3VXW A;  2IYD B;  3SDL C;  2UWQ A;  2ZNV C;  3KUZ A;  1ZKH A;  4XX5 A;  3M62 B;  2RD0 A;  3ZW3 A;  2BYV E;  2ZEQ A;  3APD A;  4M0W B;  2GOW A;  3OAW A;  4NNJ B;  2KDI A;  2KJH B;  1G6J A;  2KO3 A;  2KC1 A;  2N9E B;  5LXH A;  3PTF C;  2LGX A;  4KV2 A;  1UD7 A;  5DCN A;  3UIO B;  3WAL A;  2A4Z A;  1UZX B;  2MRP A;  3APF A;  5JHA A;  1L2N A;  3D32 A;  4AJY B;  4GIV A;  5E6O A;  2BF8 B;  1YIW A;  2KFK B;  3C0R B;  1H4R A;  4IC7 B;  1UEL A;  4WWP A;  2MP2 A;  4KDL B;  2LVQ A;  4PS7 A;  4W9E A;  5E6P A;  2N9X A;  3T8M A;  2IY1 B;  3NHE B;  2CS4 A;  4GB9 A;  3W1S C;  1V5O A;  4K7U A;  1WXM A;  1KLV A;  1E5W A;  4DWF A;  4EKU A;  3DBR I;  3KVF B;  4EOY A;  1WMH A;  3N30 A;  4MEL A;  3V60 A;  3A4S C;  3L0W B;  5TR5 A;  3Q3F A;  1SGH A;  5C23 A;  1WXS A;  2FID A;  3ZDT A;  2AEH A;  3W1S A;  4E71 A;  5EDS A;  1P3Q U;  3R66 C;  3B08 A;  2BWF A;  1KJT A;  3ENE A;  2KX0 A;  3ZNI D;  5DPT A;  4ANU A;  1WZ3 A;  4B6W A;  4MGY E;  2IBI B;  4FBJ B;  2DYO A;  4GSW A;  3W1Y A;  1J0G A;  4LJP B;  4KZC A;  4M8M A;  2D10 A;  3KUD B;  4GDL A;  2PE6 B;  2L8J A;  1OGW A;  1WR1 A;  3PHW B;  4NQL B;  4I6N B;  4NAW B;  2J0M A;  3AU5 A;  5JZE B;  4ZRI A;  2DZK A;  1P0R A;  2VRR B;  2L00 B;  3CSF A;  2NS5 A;  1WIA A;  2O2V B;  2KNB A;  2O6V B;  2R2O A;  2RR9 A;  3PRZ A;  3ZTC A;  1YD8 U;  4BKS A;  3ZKJ C;  2KC2 A;  3HM3 A;  5D2M B;  3VVW B;  3H7P A;  4G11 A;  2LI5 A;  1XD3 B;  3QAQ A;  5J17 A;  1TGZ B;  1I42 A;  3PV1 A;  2I1K A;  1J8C A;  1RLF A;  1WYW B;  4ICV A;  3RCZ A;  3VQI A;  4BKG A;  4W9H A;  4PS3 A;  4K7W A;  4II3 B;  3NS8 A;  3QC8 B;  2FUH B;  2K1F A;  2PPH A;  4MDK E;  2WWZ A;  2KLC A;  4TQ1 A;  2DZJ A;  3L16 A;  2K25 A;  3JVZ X;  1UH6 A;  2HTH A;  3DQV A;  4F8C B;  2CHX A;  5G55 A;  4MSM B;  4IWO A;  2RPQ A;  4OVU A;  1YX6 B;  4IWP A;  5CTR C;  4EUT A;  3ZIM A;  2LGY A;  1LFD A;  2MX2 A;  2GBR A;  4NJ6 A;  1WGR A;  2FCQ A;  3PSE B;  4AJW A;  2ASQ A;  2BGF A;  3L17 A;  2KWV B;  2MQJ A;  2M1M A;  4ZYN A;  3GZN I;  4PS8 A;  2ZPN A;  4EFO A;  5IA7 A;  3QCA A;  2LVO A;  3TIX A;  1KOT A;  3HIZ A;  2ZCC A;  3VTU A;  1WGY A;  4TKN A;  2WDT B;  3X23 A;  2C5L C;  1SIF A;  4BOS C;  4W9J A;  1WM3 A;  2KWU B;  4FA6 A;  1WR6 E;  5LXI B;  1UBQ A;  1C3T A;  1E7V A;  2KQS A;  2M17 A;  1IP9 A;  3EC8 A;  4W9K A;  1RFA A;  2FNJ B;  1WJ6 A;  2LGD A;  3VH3 B;  2CKH B;  4JQW C;  3ZUN A;  3ZDM C;  2YLM A;  4ZRJ A;  3U7D A;  3ECI A;  2OOB B;  3RUI B;  3PGE A;  1V6E A;  4K7S A;  5D7G A;  3S2A A;  4FJY A;  3P2B A;  2G4D B;  3ML8 A;  5J2R A;  2DAF A;  1WGD A;  3ONS A;  4BFR A;  2N1W A;  3U8Z A;  4WJQ A;  4ZDV A;  4MGK E;  3UQA A;  3K9P B;  1P98 A;  1WJN A;  1P9D U;  4WAA A;  1WRD B;  2C60 A;  2NBV B;  2JY6 A;  1TTN A;  4P7I A;  2KFK A;  1C1Y B;  3OLM D;  1AAR A;  4HCN B;  3RT3 B;  4HCP B;  3ZNG C;  3DVN U;  4FAD A;  5DPW A;  1WM2 A;  4AP4 C;  3IG3 A;  2LVP A;  2KMA A;  3DOW A;  2MCN B;  2HD5 B;  3HHM A;  2N9P C;  4DBG A;  1VCB A;  2LRU A;  2XBB C;  3T9L A;  3DDC B;  4GXB A;  4OVV A;  4AWJ A;  2BWE S;  1TBE A;  4BBN C;  2N7E A;  3QWZ B;  3L10 B;  3MJW A;  4WQO B;  3VUY A;  3ZLZ A;  1WI0 A;  4K81 A;  1WFY A;  4MM3 A;  2XK5 B;  1CMX B;  4JLC A;  3BIN A;  3V6E B;  4CHK A;  5AZH A;  2AYO B;  2A5U A;  4LDT B;  2N1V A;  2C7N B;  2OJR A;  4XZ4 A;  4HXD A;  3WAN A;  4LDT D;  1RRB A;  4WWO A;  4BOZ B;  3RD2 A;  3PZD A;  3QIJ A;  3RZW C;  4ZRK A;  1WGH A;  1GNU A;  3PPA A;  2KD0 A;  2ZCB A;  1EF1 A;  3M63 B;  3EFU A;  5DPR A;  5LLI A;  4RM8 A;  1QZE A;  3ZRF A;  2UYZ B;  2C7H A;  3VTW A;  3VUX A;  1IPG A;  3B0A A;  2GBK A;  4KIK A;  2BYF A;  1I35 A;  4G0N B;  2O6V A;  2K6Q A;  1E90 A;  2HE7 A;  4BKT A;  2JZ3 B;  2DYB A;  3PS6 A;  3R3M A;  3QJZ A;  1E7U A;  2I1J A;  4N9F 4;  5L95 C;  4LJO B;  1EO6 A;  4W9F A;  4II2 B;  4DXA B;  2PE9 A;  1WX7 A;  2NBW B;  1E8Z A;  4DDI D;  2KZR A;  2NPT A;  4GU2 A;  2REX A;  1LXD A;  3EHV A;  2MBO A;  5CHF A;  1E8X A;  1XT9 B;  2IO0 B;  3A1Q B;  4HJK A;  5CHW A;  3JSV B;  2L76 A;  1LM8 B;  4I6P A;  1V9J A;  3LJ3 A;  4EZJ A;  4WWN A;  3EEC A;  4DHZ E;  2JWZ A;  4G3X B;  3SHQ A;  1GC6 A;  1WX9 A;  1YQB A;  1WX8 A;  3NOB A;  2KDF B;  2LJ5 A;  5BO4 B;  3WIM A;  2CHW A;  1MG8 A;  3RZF A;  1T0Y A;  2EMS A;  2LUE A;  1WMH B;  4FLH A;  3UGB B;  3IBE A;  4KZ0 A;  2WX1 A;  3DVG Y;  1U4A A;  3PT2 B;  3O65 B;  2DAJ A;  2DZI A;  4RM9 A;  1V49 A;  2L3Z A;  2Y5B B;  1RAX A;  3TCA A;  1GG3 A;  2ZVN A;  3GOE A;  4WJN A;  4JIO U;  3R7R A;  3B1L X;  2IO2 B;  2NVU I;  4HPM B;  2JRH A;  2KX3 A;  2RSU A;  3I3T B;  1UGM A;  2JUO A;  3HK0 A;  2LRW A;  3ZO5 B;  3A9K A;  1FXT B;  1SE9 A;  2EMT A;  4I6L B;  3RYT A;  3AXC A;  1GUA B;  3WAP A;  5IAA C;  2MA9 B;  4HWI B;  2FIF A;  3KW5 B;  4FHJ A;  2AL3 A;  3V61 A;  2K39 A;  3A9J B;  5AZF A;  3QQ8 B;  4KDI C;  2K8H A;  4KSL C;  4B95 A;  4B9K A;  4MJS B;  1D3Z A;  2IO1 B;  2G3Q B;  4A3O A;  2MBH A;  3HM6 X;  4TQ0 A;  4W9D A;  2R2Q A;  4IUM B;  1S3S G;  1WGG A;  5HKH A;  3DPD A;  2LXC A;  2BKF A;  4MGI E;  3VHT C;  1WY8 A;  2ZVO A;  4IM2 A;  4HLE A;  5JHB A;  5D6J B;  3WA0 A;  4TV3 A;  3LDZ E;  4GGQ A;  4BKS D;  2IY0 B;  2G45 B;  4K1R B;  2ZPY A;  4HDQ A;  1Q5W B;  2W9N A;  2KVR A;  3KYC D;  2C7M B;  4M8N A;  2EKE C;  2GBJ A;  5FR6 A;  4W9G A;  1V2Y A;  4IG7 B;  2Z0E B;  2K8C A;  4EZL A;  2CHZ A;  2KK8 A;  3UF8 A;  2N4F A;  4HVB A;  4BBN F;  3PHX B;  4E74 A;  5C1Z A;  5J18 A;  4GDK B;  3TBL D;  2KTF A;  3BY4 B;  4HK2 A;  3ML9 A;  2LWP A;  3N3K B;  3DBH I;  2PJH A;  3NZU A;  3IHP C;  3VUW A;  2JF5 A;  1JRU A;  2KJR A;  2PEA A;  3PLU A;  1XQQ A;  1OQY A;  1WH3 A;  1Z5S B;  2D3G A;  2XK5 A;  3CST A;  2DYM A;  3OJ3 A;  1OTR B;  2DZM A;  2JZZ A;  2KWC A;  4W9C A;  5AEK B;  3DBL I;  1Q1O A;  2J7Q B;  3PRM B;  4ASW C;  1A5R A;  1M94 A;  4KSK C;  2KTR B;  3QK0 A;  1P1A A;  3KYD D;  2GBN A;  3VAW A;  2MSE D;  3KH0 A;  2K8B A;  2JVC A;  3VTV A;  1Z2M A;  2WYQ A;  3QX1 A;  4PYZ A;  2FAZ A;  3PRP B;  2BPS A;  3PLV A;  4JL9 A;  1F9J A;  1R4N I;  4FJV B;  2GBM A;  4PYU A;  1Y8R C;  2FCS A;  2LXA A;  3WAM A;  3NZS A;  1WZ0 A;  3AI5 A;  2KN5 A;  2M0X A;  3H6N A;  3H7S A;  4IW0 A;  3L13 A;  1LQB A;  1NI2 A;  2NCN A;  3QA8 A;  3AU4 A;  1V81 A;  3TMP B;  4AUQ C;  2KXJ A;  4EZK A;  4DK5 A;  3CF6 E;  2NBU A;  3OJ4 B;  4IM0 A;  3IVF A;  3L08 A;  4NAW A;  2DEN B;  3A4R A;  2JT4 B;  1WXA A;  3A1Q A;  3QAR A;  3N32 A;  1TZ1 A;  3JSV A;  2KAN A;  1PQS A;  5JH5 C;  2O2V A;  3SD5 A;  4W9L A;  5AZG A;  2LAS A;  4FJZ A;  4XC2 A;  4MGZ E;  2Z0D B;  3M3J A;  1YX5 B;  1V5T A;  4IWQ A;  3UIN B;  1E8W A;  2ZNV B;  4WJO A;  2KKC A;  1Q0W B;  2ZJD A;  1S1Q B;  1ISN A;  3DVN V;  4KVG B;  3SU8 X;  3K9O B;  4NQK E;  2D11 A;  3ZTD A;  2KDB A;  2LD9 A;  2JRI B;  3V6C B;  2MP2 B;  2M4N A;  3PRE A;  5KHQ A;  1WJ4 A;  1WF9 A;  4BVU C;  2J0J A;  3TJP A;  2KDE B;  1BT0 A;  1ZW7 A;  4GN1 A;  1R4M I;  4TUU A;  2KOX A;  2KMC A;  4F1S A;  4FHK A;  4FUL A;  3A9J A;  5G2N A;  2B3A A;  2ZZP B;  1GC7 A;  5E6N A;  4MJS A;  2GMI C;  3MTN B;  4KIK B;  4JGH B;  1L7Y A;  2MLB A;  4NJ7 A;  2NR2 A;  2QHO A;  2O6V D;  4A3P A;  3R7Q A;  2V3S A;  2FCN A;  4MSQ B;  2IO3 B;  2AL6 A;  4GDL B;  2MBE A;  2L7R A; 
#chains in the Genus database with same CATH topology
 2JQR B;  4XYC A;  2KHW B;  2NPT B;  1I4G A;  2BYE A;  2D5G A;  3BWU D;  1GB4 A;  2WS3 B;  1WSP A;  2JWU A;  4EEW A;  4G50 A;  3RUL A;  2DX5 B;  3L54 A;  1KLU D;  4LNO A;  1RM6 C;  2HDE A;  1TKY A;  3H9D A;  1SJE D;  2D07 B;  1YJJ A;  3CMM B;  3Q3J A;  3ZNZ B;  2KJ6 A;  1VD2 A;  2CR5 A;  4RGO S;  4A9A A;  3U30 A;  3DVG X;  5KHO A;  4ANX A;  2RGF A;  3AED B;  4CYE A;  4N59 A;  1JWB D;  1N5W A;  4CO7 A;  4DDG D;  3H1U A;  2AWT A;  4MH0 E;  4URK A;  2Y5P A;  1L0V B;  1TS2 A;  1YN5 A;  1OEY A;  2Y5C A;  3I9V 1;  1OEY J;  1WE7 A;  2IGH A;  3BZD B;  2D3C A;  2M0A A;  2QC8 A;  4HPL B;  3ABV B;  3KUZ A;  3SFD B;  3PZ7 A;  2WXJ A;  3OAW A;  1TKE A;  2KC1 A;  1HZ6 A;  2A4Z A;  2MRP A;  3NVW A;  3U4E G;  1FD6 A;  4QAY A;  4PS7 A;  5E6P A;  4K3C A;  5AUK A;  1I4P A;  4GB9 A;  1V5O A;  1WXM A;  1E5W A;  3DBR I;  3KVF B;  1QOA A;  4MEL A;  5TR5 A;  1TIF A;  3AEC B;  1XLQ A;  2FID A;  1F0Z A;  2AEH A;  4E71 A;  1JML A;  1KJT A;  2BWF A;  3TEY A;  5FK9 C;  4MGY E;  4GSW A;  4KZC A;  4M8M A;  1PDX A;  3DHI C;  4GDL A;  4EE2 A;  1J7B A;  1FNV A;  1NI3 A;  2J0M A;  3BVZ A;  3AU5 A;  1STE A;  3CSF A;  1L6U A;  1WIA A;  2KNB A;  2WDQ B;  1JWS D;  4S0R A;  3H7P A;  2IDY A;  2LI5 A;  2YEP B;  2I1K A;  1J8C A;  1RLF A;  1WYW B;  4ICV A;  3RCZ A;  4R3D A;  4W9H A;  1VZ6 A;  3NS8 A;  3QC8 B;  1ZOY B;  2PPH A;  2WWZ A;  3L16 A;  3MP9 A;  4F8C B;  2N7J A;  4RFB A;  2CHX A;  4MSM B;  1YX6 B;  4IWP A;  5CTR C;  4EUT A;  1HTO A;  1LFD A;  2GB1 A;  3BK1 A;  1NYR A;  2GBR A;  4B0M A;  2WU2 B;  3GZN I;  3NVY A;  3NS1 A;  3VTU A;  2WDT B;  2C5L C;  1OFF A;  4BOS C;  1JRP A;  4KX6 B;  1WR6 E;  1UBQ A;  2M17 A;  5IP4 D;  1IP9 A;  4W9K A;  3RNA C;  2FNJ B;  4RF1 A;  1WJ6 A;  2CKH B;  1Y56 A;  2YLM A;  3U7D A;  1KTK A;  3AEF B;  1V6E A;  5D7G A;  3S2A A;  3ONS A;  4BFR A;  2AQ3 B;  4WJQ A;  4ZDV A;  3UQA A;  3RNE C;  1YJI A;  2C60 A;  1FFV A;  2Q5W D;  1C1Y B;  5DPW A;  4FAD A;  4KGT A;  1D4B A;  3AE4 B;  1WM2 A;  4AP4 C;  3IG3 A;  2HD5 B;  1KRH A;  2N9P C;  4OVV A;  4P1C C;  1WWT A;  4WQO B;  3VUY A;  1N60 A;  4K81 A;  4CHK A;  1LGR A;  1D6E C;  2A5U A;  2N1V A;  4XZ4 A;  2FBW B;  4LDT D;  3PZD A;  1BML C;  1XEE A;  4ZRK A;  2W82 A;  3PPA A;  4L23 A;  2ZCB A;  1EF1 A;  5LLI A;  1MG4 A;  1UWM A;  3VTW A;  3VUX A;  3B0A A;  1I35 A;  2K9X A;  3IT6 B;  3UI3 A;  3PS6 A;  2RMM A;  1QIL A;  1FCL A;  3MFG A;  1EO6 A;  3AH7 A;  4DXA B;  2PE9 A;  2WXP A;  1LXD A;  1JW9 D;  2ICI A;  5G5H A;  1YN4 A;  2IO0 B;  1JCK B;  4C80 A;  4I6P A;  2BBC A;  1V9J A;  3GS2 A;  2QMT A;  2JWZ A;  5EE1 A;  3HVZ A;  1SB3 C;  1GC6 A;  1JWU D;  1WX9 A;  1QOG A;  3SFE B;  1T0Y A;  2EMS A;  2GI9 A;  2WX1 A;  3HVD A;  3O65 B;  2I2Y A;  2Y5B B;  1GG3 A;  3R7R A;  2LEK A;  1KLG D;  3I3T B;  4GLS C;  3ZO5 B;  1FXT B;  1SE9 A;  3HUI A;  5IAA C;  2MA9 B;  4FHJ A;  3V61 A;  4YTP B;  2M56 B;  4KSL C;  3SR6 A;  3TEZ A;  4S17 A;  1N63 A;  4A3O A;  3HM6 X;  4W9D A;  1L4Z B;  2VH2 A;  1FCC C;  2BKF A;  1WY8 A;  1ZPS A;  4IM2 A;  5D6J B;  3WA0 A;  3LDZ E;  2IY0 B;  2G45 B;  4N58 A;  2KVR A;  3KYC D;  2X38 A;  2CHZ A;  3UF8 A;  4M0W A;  5J18 A;  1MJD A;  2KTF A;  3BY4 B;  3ML9 A;  1CJE A;  3NZU A;  2JF5 A;  2K3U A;  1GAQ B;  2KJR A;  4WAF A;  2PEA A;  3PLU A;  1XQQ A;  2D3G A;  3DWM A;  1OTR B;  3DBL I;  3PRM B;  4BAX A;  1A5R A;  4OZA A;  1M94 A;  3R2I A;  1XLN A;  2R61 A;  2KTR B;  3Q8F A;  2JVC A;  2QIL A;  2WYQ A;  3VTV A;  3QX1 A;  1FRD A;  3PRP B;  5T8I A;  1SF0 A;  2BPS A;  1TS3 A;  2YEP F;  4XWW A;  2MHJ A;  1WYG A;  2PW9 A;  1Y8R C;  1C78 A;  2WU5 B;  2PVO D;  1QLB B;  4HJG E;  2GRI A;  2M0X A;  3IAM 1;  1L0Y B;  3W9C B;  2DWQ A;  1T0R C;  4J3O D;  3NVV A;  3TMP B;  1AW7 A;  2KXJ A;  2D3B A;  3IVF A;  3L08 A;  3A1Q A;  2V9H A;  3HRD D;  1TZ1 A;  1OQR A;  1IBX A;  1C4C A;  1PQS A;  5JH5 C;  2O2V A;  3SD5 A;  4W9L A;  5AZG A;  3M3J A;  2W54 A;  4IWQ A;  3TEW A;  2IGG A;  4WJO A;  4RH6 A;  2ZJD A;  1S1Q B;  3AE7 B;  5BMG A;  4OHJ A;  1I7H A;  3ZTD A;  3AMZ A;  2RDH A;  2LD9 A;  1FXI A;  2JRI B;  3VRA B;  1JAL A;  3EGR A;  1DYQ A;  2WXK A;  2LMC A;  1WJ4 A;  1FRR A;  2J52 A;  5HFY A;  1BT0 A;  2PLP A;  2KOX A;  4FUL A;  1K52 A;  5G2N A;  2B3A A;  4MJS A;  1UNS A;  3MTN B;  5BMH A;  1L7Y A;  2NR2 A;  2O6V D;  4JE3 B;  5AUI A;  3N1X C;  2IO3 B;  3V05 A;  2NTS A;  2L7R A;  2XEW A;  1EUV B;  2INN E;  3M95 A;  1ZDX A;  4A20 A;  4F7Z A;  2B76 B;  3A33 B;  4YL8 A;  3IFW B;  4GDK A;  3DCG A;  1DOI A;  1HQR D;  1WXV A;  3DBS A;  4HKQ A;  1FEH A;  3MHS D;  4KGS A;  3AE8 B;  2BB5 A;  3BK2 A;  2MBB B;  4ANV A;  4IM3 A;  2K6D B;  1V86 A;  2C9W B;  1EF5 A;  5HHD G;  2QIE B;  1XLO A;  1E10 A;  3QHT A;  5I4D A;  3P42 A;  3TL5 A;  2V4L A;  1L4D B;  2DHZ A;  1JRO A;  2JZP A;  3FIL B;  1XCQ L;  4NPN A;  2Z59 B;  1ZGU B;  2L0F A;  3W5U B;  2CU1 A;  4AOF A;  3UIP B;  1UBI A;  1AWD A;  3ZRC A;  3AUL A;  4YSY B;  2BKR B;  3AM9 A;  1XLP A;  4B0E A;  1F2R C;  1H8C A;  3NY5 A;  3WAO A;  2KFJ A;  3Q3O C;  5CX3 A;  1EM7 A;  2FCM A;  3JW0 X;  1KM7 A;  2JXT A;  2ZNV C;  3RFZ B;  3M62 B;  1YMH E;  3APD A;  4M0W B;  4US9 A;  5LXH A;  3PTF C;  3TUO A;  5DCN A;  3WAL A;  1UZX B;  3APF A;  5JHA A;  3D32 A;  3ZQ4 A;  4AJY B;  1BUI C;  2KFK B;  3C0R B;  4WUR A;  3W2D A;  4IC7 B;  1UEL A;  1RYJ A;  2MP2 A;  4N6E B;  4W9E A;  2N9X A;  3T8M A;  4XDC A;  2CS4 A;  1KLV A;  5JXV A;  1VZ8 A;  4EOY A;  2BYT A;  4ZOH C;  4YWG G;  3V60 A;  1SGH A;  4HRO A;  1WXS A;  5EDS A;  2GLS A;  3R66 C;  1JWM D;  3ENE A;  2KX0 A;  3SEB A;  1WZ3 A;  4B6W A;  1B1Z A;  3W1Y A;  1J0G A;  1WRI A;  2L8J A;  1WR1 A;  1T3Q A;  1ZUD 2;  4HPP A;  2O6V B;  2O2V B;  2RR9 A;  2R2O A;  1V1P B;  5HI1 A;  3ZKJ C;  3HM3 A;  4WQM A;  2WXG A;  5J17 A;  4K7W A;  2CU3 A;  3U2S C;  2K1F A;  4MDK E;  3NG0 A;  2TSS A;  4OVZ A;  4TQ1 A;  4A55 A;  4OVU A;  1GOZ A;  2RPQ A;  3E9S A;  2MX2 A;  1R7S A;  2FCQ A;  5D3D A;  1VLB A;  1NVI D;  4PS8 A;  4L1B A;  3FC4 A;  4EFO A;  1E9M A;  3HIZ A;  2ZCC A;  1PFD A;  5BYQ A;  1SIF A;  2V3P A;  1ROE A;  3PZ8 A;  1WM3 A;  4FA6 A;  1C3T A;  4KGR A;  2PKO A;  1E7V A;  2KQS A;  3EC8 A;  2LGI A;  3MC0 B;  3AEE B;  1NEN B;  3ZDM C;  2INP E;  3ECI A;  2OOB B;  5J2R A;  4OW0 A;  3AN1 A;  2N1W A;  1TY0 A;  4UDU C;  4REZ A;  3RN9 C;  3B9J A;  1ACC A;  1WRD B;  2QEJ C;  2KMA A;  5D3I B;  1ZDV A;  2CJN A;  1EWC A;  1OQQ A;  3NUH B;  3DDC B;  4LNF A;  1KF6 B;  4AWJ A;  2BWE S;  4BBN C;  2N7E A;  1FM0 D;  3EFC A;  2J4X A;  3BIN A;  3V6E B;  4YSZ B;  1NEK B;  3WAN A;  3RD2 A;  2KWD A;  2KD0 A;  3M63 B;  1YNT E;  5DPR A;  1QKZ A;  4RM8 A;  1SIJ A;  1QZE A;  3ZRF A;  3P63 A;  2VZK B;  4G0N B;  4ARI A;  3B2F A;  4BKT A;  1C4A A;  1ZE3 D;  2HE7 A;  2JZ3 B;  3R3M A;  3QJZ A;  4N9F 4;  2I1J A;  5L95 C;  3MJ5 A;  4W9F A;  1E8Z A;  2EKI A;  2KZR A;  5MPO A;  2REX A;  4ZRQ A;  1SSN A;  1E8X A;  4PK1 A;  2XN9 C;  3JSV B;  4LLG M;  2MJD A;  1LM8 B;  4EZJ A;  2Z8L A;  3T3O A;  4RGN A;  1P7E A;  3EEC A;  4AS1 A;  3SHQ A;  1YQB A;  1WX8 A;  2LJ5 A;  4NAM A;  1MG8 A;  4FLH A;  3UGB B;  2OJW A;  3PT2 B;  2DAJ A;  2DZI A;  4RM9 A;  2L3Z A;  1RAX A;  3GOE A;  4WJN A;  4YSX B;  2IO2 B;  2JUO A;  2LRW A;  3DBH B;  3A9K A;  4I6L B;  3AV8 A;  1VDV A;  3EUB 2;  1GUA B;  2BS3 B;  3VRB B;  2DBY A;  4HWI B;  2K39 A;  2KN4 A;  2FUG 1;  4B95 A;  4B9K A;  1D3Z A;  3AE1 B;  2R2Q A;  4IUM B;  1S3S G;  4DXF A;  3N20 C;  4MGI E;  2ZVO A;  4HLE A;  5JHB A;  4K1R B;  2ZPY A;  1Q5W B;  2EKE C;  3RNF C;  4IG7 B;  4L2Y A;  2KK8 A;  3P4Q B;  2BS4 B;  4XDD A;  4HK2 A;  2LWP A;  1TZO A;  4FXC A;  1D5Z C;  3IHP C;  1Q10 A;  2XK5 A;  3CST A;  1WH3 A;  3DWG C;  5AEK B;  4W9C A;  4ASW C;  1QQR A;  3N1Y C;  2QJL A;  2ZW1 A;  1Z2M A;  1XXG A;  1R4N I;  1ET9 A;  4FJV B;  2GBM A;  3P1M A;  2W55 A;  4US8 A;  5GXG B;  2LXA A;  3NZS A;  5G5G A;  2KN5 A;  3H6N A;  3L13 A;  1LQB A;  3QA8 A;  2NCN A;  4AUQ C;  4ARC A;  2IND C;  3CF6 E;  2WXO A;  2J53 A;  4IM0 A;  2DEN B;  1WXA A;  2PIA A;  3N32 A;  1FXA A;  3I63 C;  2KAN A;  1C79 A;  4FJZ A;  4XC2 A;  4MGZ E;  4ZRP A;  2X8X X;  4MH8 A;  1ZP0 B;  2KKC A;  3R2T A;  1PGB A;  2KDB A;  2FE8 A;  1VJK A;  1RFK A;  3OWE B;  2ZW0 A;  1WF9 A;  1ZW7 A;  4TUU A;  4F1S A;  3A9J A;  3WCQ A;  4ZYS A;  5E6N A;  3ZXR A;  4RGT A;  1V8C A;  2QHO A;  4A3P A;  3R7Q A;  4C7Z A;  2V3S A;  4GDL B;  2CJO A;  1DOY A;  4GMV A;  1V80 A;  3Q3N C;  1HZ5 A;  4ICU A;  4NY0 A;  1HEZ E;  4TMA B;  2OHF A;  3VH4 B;  2JPH A;  2HJ1 A;  1GJZ A;  2LZ6 A;  2N7D A;  1CK1 A;  2LFI A;  3H7P B;  4LCD E;  2PVG C;  5E6J A;  2KQ7 A;  4KKJ A;  1NBF C;  4DHZ B;  2IZV B;  5L83 A;  1IYF A;  1AN8 A;  5H8Y E;  3KUC B;  3ZNH B;  4J6I A;  4XWT A;  4WJP A;  2XNA C;  3A9K B;  2MEK A;  1J19 A;  4IKG A;  3JYU A;  2MW5 A;  5DPS A;  2L05 A;  5GMV A;  2G4S A;  2BT6 A;  2KMM A;  3X0W A;  3Q8B A;  2M19 A;  3P4S B;  2JXX A;  2MWS B;  2YVC A;  4DHJ B;  2KLG A;  4USA A;  4C4V A;  5CHV C;  1CQV A;  1WXQ A;  2EEL A;  5HG2 A;  2WX0 A;  1HXY D;  3UQB A;  3APC A;  1SEB D;  4JWS C;  3VXW A;  2IYD B;  1ESF A;  1JWA D;  3ETR A;  3Q8C A;  2KAC A;  4XX5 A;  4YXD B;  1KFY B;  2BYV E;  1SE2 A;  2ZEQ A;  2GOW A;  4MT5 A;  4JPS A;  2KDI A;  2KJH B;  1G6J A;  2KO3 A;  2N9E B;  1YN3 A;  1PGX A;  4KV2 A;  1UD7 A;  1D5X C;  3U7Z A;  2ON8 A;  1L2N A;  5E6O A;  3Q6B A;  1UWX A;  2LVQ A;  3IT4 B;  2IY1 B;  1TYG B;  1C77 A;  4K7U A;  3V3X A;  4EKU A;  2AX5 A;  2JYT A;  3L0W B;  2WXM A;  3ZDT A;  1P3Q U;  1B9R A;  3AEG B;  5DPT A;  4ANU A;  2H89 B;  5IN7 A;  2OED A;  2IBI B;  2K5P A;  2DYO A;  4P6V F;  4LJP B;  2D10 A;  1F52 A;  2PE6 B;  2RDG A;  1OGW A;  3PHW B;  5JZE B;  3GP7 A;  4ZRI A;  4BZA A;  4O1N A;  2DZK A;  3ZYY X;  2NS5 A;  5IO9 A;  1I4X A;  2WDV B;  3ZTC A;  1YD8 U;  4BKS A;  4LK0 M;  4G11 A;  3ZXV A;  1XD3 B;  2KQ4 X;  3PV1 A;  1TY2 A;  3VQI A;  4PS3 A;  4II3 B;  4ACF A;  3E56 A;  2KLC A;  2DZJ A;  2K25 A;  3JVZ X;  1UH6 A;  2HTH A;  5EE9 A;  3AE6 B;  1EWY C;  4IWO A;  4A8X C;  2WXR A;  2LGY A;  1VZ7 A;  2WP9 B;  3Q2A C;  4NJ6 A;  3PSE B;  4AJW A;  2ASQ A;  2BGF A;  2KWV B;  4ZYN A;  2M1M A;  3BVM A;  3QCA A;  2LVO A;  1WGY A;  3X23 A;  4W9J A;  5TSS A;  3KQ4 A;  3VH3 B;  4JQW C;  3ZUN A;  4D2K A;  2WLB A;  3VR8 B;  3RUI B;  2N9K A;  4FJY A;  1WGD A;  4MGK E;  1E0Z A;  4ZHO A;  3K9P B;  3KWL A;  1WJN A;  4WAA A;  3ZJU A;  1TTN A;  3ZNG C;  4HCP B;  3R8B A;  3ZGZ A;  2MCN B;  2V4I B;  3HHM A;  4DBG A;  1VCB A;  3T9L A;  1EU3 A;  1DGJ A;  1TBE A;  1ZXI A;  3L10 B;  3MJW A;  1UGJ A;  3IXS A;  2KVZ A;  4HKZ E;  1WFY A;  4MM3 A;  3AE9 B;  1CMX B;  1CZP A;  3B2G A;  4M02 A;  4WWO A;  3C8Y A;  4BOZ B;  3RZW C;  1WGH A;  1GNU A;  4A90 A;  2UYZ B;  2C7H A;  1IPG A;  1WGK A;  2VZK D;  1TJE A;  2NBW B;  4DDI D;  4GU2 A;  3EHV A;  2WHI A;  5EE0 A;  1XT9 B;  3A1Q B;  4HJK A;  1IBX B;  3T3N A;  3LJ3 A;  1TT5 B;  4H2A A;  2SEB D;  3NZ3 A;  4DHZ E;  3Q3M C;  2HTM E;  5BO4 B;  2KDF B;  2CHW A;  3RZF A;  2LUE A;  3IBE A;  4KZ0 A;  3DVG Y;  1U4A A;  1P7F A;  2BB6 A;  1YQ3 B;  2NVU I;  2JRH A;  2KX3 A;  4ITK A;  1UGM A;  2EMT A;  3RYT A;  1MPE A;  1I4R A;  2PMV A;  4RGM A;  2FIF A;  3KW5 B;  5AZF A;  3QQ8 B;  2K8H A;  4YT0 B;  4MJS B;  5C3J B;  3Q8A A;  2IO1 B;  2G3Q B;  4WH4 A;  1WGG A;  2INC C;  3GE3 C;  1XO3 A;  1SE4 A;  3DPD A;  1D5M C;  3VHT C;  4LNI A;  4TV3 A;  4HEA 1;  4GGQ A;  2SAK A;  4HDQ A;  4M8N A;  5FR6 A;  2C7M B;  2V3N A;  1V2Y A;  4C56 C;  3MC8 A;  2Z0E B;  2K8C A;  3RNG C;  4MAC A;  1QT9 A;  2N4F A;  4HVB A;  4E74 A;  5C1Z A;  2VH1 A;  4GDK B;  2L52 A;  1VR9 A;  4PT5 A;  4LNK A;  2Y3A A;  3DBH I;  2PJH A;  3NJT A;  3VUW A;  1OQY A;  1Z5S B;  2LHD A;  2W3S A;  3OJ3 A;  2KWC A;  2JZZ A;  1Q1O A;  2J7Q B;  2K22 A;  3TEX A;  2GBN A;  2MSE D;  3KH0 A;  2DLB A;  3GE8 C;  2K8B A;  2PTL A;  4PYZ A;  2FAZ A;  3PLV A;  4JL9 A;  3N9Y C;  3URY A;  1WZ0 A;  3AI5 A;  3LXF A;  1RWS A;  3H7S A;  4IW0 A;  2QCZ A;  2WXH A;  1K51 A;  3MHZ A;  1R4M B;  4HRS A;  2L83 A;  2ONQ A;  4LNN A;  4NAW A;  3A4R A;  3QAR A;  5H92 C;  1I4H A;  2G9H D;  1A70 A;  5FR3 A;  2LAS A;  4RF0 A;  2N0S B;  2E3T A;  2G1E A;  2KYW A;  2QDF A;  1V5T A;  3H8H A;  3UIN B;  1KH0 A;  1E8W A;  2ZNV B;  1FO4 A;  1ISN A;  2KAJ A;  3GB1 A;  4KVG B;  1C76 A;  4NQK E;  4MM3 B;  1JQ4 A;  3NRZ A;  3V6C B;  2MP2 B;  5KHQ A;  1T0Q C;  2WNM A;  2KT7 A;  2J0J A;  3TJP A;  1EU4 A;  3J9C A;  4GN1 A;  1BXT A;  3KLS X;  2D3A A;  2KMC A;  4FHK A;  2ZZP B;  2GMI C;  4NZL B;  3KWV A;  4IDI A;  4JGH B;  2JU6 X;  1TKG A;  2MLB A;  4NJ7 A;  1MHH E;  1C9F A;  4MSQ B;  3AE5 B;  3VDZ A;  2MBE A;  1WJU A;  1E7P B;  5D94 A;  2MBQ A;  2M8S A;  1VRA B;  1E8Y A;  2L0T A;  2JSV X;  1TS5 A;  4P1B C;  2WXF A;  1K50 A;  3AE3 B;  2DNF A;  1NDD A;  3AB5 A;  2V1Y A;  1J7A A;  1T0S C;  4RMA A;  4M01 A;  4FN2 A;  3MC9 A;  4HDO A;  1IGC A;  4E3C A;  3ZVV A;  2KTR A;  1YJ1 A;  2K0P A;  4GOC A;  3U52 E;  3AE2 B;  3ALB A;  1WE6 A;  3PVL A;  2RPV A;  4ZHP A;  4YTM B;  4W9I A;  4DXG A;  1K53 A;  4MEM A;  5LNK 1;  4JX1 C;  1X1M A;  1HE8 A;  2J0K A;  3P4P B;  2MJ3 A;  3V62 A;  3VFK A;  1K8R B;  3DBR B;  4ANW A;  4X57 B;  2D2Q A;  4JWU C;  4DHJ D;  2HJ8 A;  3SDL C;  2UWQ A;  4WIP A;  1QF6 A;  1ZKH A;  2RD0 A;  3ZW3 A;  3DHG C;  4NNJ B;  1FFU A;  2LGX A;  1F77 A;  3UIO B;  4A6Q A;  4GIV A;  2BF8 B;  1YIW A;  1H4R A;  4WWP A;  2E6X A;  4KDL B;  3NHE B;  3W1S C;  2RDB C;  2LGS A;  4DWF A;  4DQO C;  1WMH A;  3N30 A;  3A4S C;  2IJ0 A;  3Q3F A;  5C23 A;  3W1S A;  4Q2J A;  3B08 A;  3ZNI D;  1UUP A;  4FBJ B;  1MVK A;  1C4P A;  3RNC C;  3KUD B;  3EA6 A;  1XCT L;  3GZN B;  4NQL B;  4I6N B;  4NAW B;  4CQN A;  4P16 A;  1QOF A;  1N6Z A;  1P0R A;  2VRR B;  4AQ7 A;  2L00 B;  1GPX A;  4NJC A;  2IGD A;  3PRZ A;  2J42 A;  3VR9 B;  2JYE A;  4IOI E;  2WXQ A;  2KC2 A;  2LJI A;  3CWI A;  5D2M B;  3VVW B;  3QAQ A;  1I42 A;  1TGZ B;  3IAS 1;  4BKG A;  2FUH B;  5BMI A;  1E6E B;  3I5J C;  1PYW D;  1IUE A;  3DQV A;  4OZC A;  4RNA A;  2MJE A;  5G55 A;  3ZIM A;  2WDR B;  3FIL A;  1ENF A;  3I57 A;  1WGR A;  2W3R A;  3L17 A;  2BW2 A;  2MQJ A;  2ACZ B;  3C19 A;  2ZPN A;  5IA7 A;  3TIX A;  1KOT A;  4TKN A;  1GB1 A;  2KWU B;  5LXI B;  1RFA A;  1R4N B;  2LGD A;  4ZRJ A;  1HA5 A;  4M00 A;  2BVC A;  1AYF A;  3PGE A;  4K7S A;  3P2B A;  2G4D B;  3ML8 A;  2DAF A;  4K3B A;  3DHH C;  3U8Z A;  3BII D;  1M4V A;  4KKI A;  1P98 A;  1P9D U;  2NBV B;  2JY6 A;  4P7I A;  2KFK A;  4HCN B;  3OLM D;  1AAR A;  3RT3 B;  1MFW A;  3DVN U;  2UU7 A;  2LVP A;  3DOW A;  2LRU A;  2XBB C;  4GXB A;  2NMQ A;  2N9L A;  3LYY A;  3QWZ B;  1HTQ A;  1L6V A;  3ZLZ A;  1WI0 A;  2WQY B;  2XK5 B;  3W5V B;  4JLC A;  3FKY A;  4XGA B;  5AZH A;  1DOX A;  2AYO B;  4LDT B;  2C7N B;  2OJR A;  4HXD A;  1RRB A;  3QIJ A;  1V1O A;  3EFU A;  1FPY A;  4KIK A;  2GBK A;  4WWM A;  1LO5 D;  2BYF A;  4LTU A;  4C00 A;  3RPF C;  2O6V A;  1E90 A;  2K6Q A;  3Q69 A;  1V1P A;  2DYB A;  3FAH A;  1E7U A;  1ZXH A;  4LJO B;  4II2 B;  1MI0 A;  1WX7 A;  2NPT A;  3BVG A;  2LUM A;  2MBO A;  5CHF A;  5CHW A;  2L76 A;  3BYY B;  4WWN A;  2WGS A;  4G3X B;  1IGD A;  3NOB A;  1F1H A;  3WIM A;  2V0G A;  2WXL A;  1PUT A;  1WMH B;  3ZJV A;  2BTE A;  5EE3 A;  2H88 B;  1V49 A;  1L5P A;  3TCA A;  2ZVN A;  4JIO U;  3B1L X;  4HPM B;  2WXI A;  1SXT A;  2RSU A;  3HK0 A;  1SE3 A;  2QSD A;  3AXC A;  3WAP A;  2AL3 A;  3A9J B;  3DBL B;  4OZB A;  4KDI C;  1ET6 A;  4TQ0 A;  2MBH A;  3RNB C;  5HKH A;  1FNU A;  3LB8 C;  2AQ1 B;  2LXC A;  2I38 A;  1T5X D;  5C2T B;  3PO0 A;  1XF5 L;  4BKS D;  1I4Q A;  2W9N A;  2GBJ A;  4W9G A;  2MH7 A;  3Q14 C;  3BYT B;  4EZL A;  4BBN F;  3PHX B;  3ZJT A;  3AEA B;  3TBL D;  3N3K B;  4XE0 A;  1PGA A;  1JRU A;  1TS4 A;  1N61 A;  2DYM A;  2DZM A;  1SJH D;  4KSK C;  5IOI A;  3QK0 A;  1P1A A;  3KYD D;  3VAW A;  3O13 A;  2WXN A;  5FKA C;  1T6B X;  4YTN B;  3N1Z C;  2JX5 A;  1F9J A;  4TSS A;  1J7C A;  5BYR A;  4PYU A;  2FCS A;  2NTT A;  1YOV B;  3WAM A;  2AQ2 B;  3OG5 A;  3TSS A;  1NI2 A;  3AU4 A;  1V81 A;  1YQ4 B;  2BS2 B;  4EZK A;  4DK5 A;  4C4V B;  2NBU A;  3RMK C;  1NYQ A;  1SBB B;  3OJ4 B;  1N5X A;  2JT4 B;  2L1A A;  3JSV A;  1FIQ A;  1L0X B;  1V97 A;  5BYS A;  2Z0D B;  3CIR B;  4C7Y A;  1YX5 B;  3Q8E A;  1Q0W B;  3DVN V;  3SU8 X;  3K9O B;  2D11 A;  2IPK D;  2BQQ A;  3AEB B;  1QOB A;  5IKC M;  1MHX A;  2M4N A;  3PRE A;  4BVU C;  2KDE B;  2L32 A;  1FNW A;  2KDM A;  1R4M I;  3RI7 C;  3P4R B;  3L4P A;  1GC7 A;  1N62 A;  2LHE A;  4KIK B;  4RCO A;  1F2R I;  1FMA D;  3NVZ A;  2FCN A;  1UF0 A;  2AL6 A; 
#chains in the Genus database with same CATH homology
 1WJU A;  2XEW A;  2KHW B;  2NPT B;  4GMV A;  1EUV B;  5D94 A;  3M95 A;  1V80 A;  2BYE A;  4A20 A;  4F7Z A;  2MBQ A;  4ICU A;  4NY0 A;  2M8S A;  3A33 B;  4YL8 A;  3IFW B;  3VH4 B;  1E8Y A;  2L0T A;  4GDK A;  3DCG A;  2JPH A;  1WXV A;  3DBS A;  4EEW A;  1GJZ A;  1NDD A;  3MHS D;  2LZ6 A;  4G50 A;  3RUL A;  2V1Y A;  2DX5 B;  3L54 A;  2N7D A;  3H7P B;  4LCD E;  4RMA A;  3H9D A;  2D07 B;  2KQ7 A;  2MBB B;  4FN2 A;  1NBF C;  4HDO A;  2K6D B;  3CMM B;  3Q3J A;  4IM3 A;  3ZNZ B;  4ANV A;  4DHZ B;  1V86 A;  4E3C A;  2KJ6 A;  1VD2 A;  3ZVV A;  2C9W B;  2IZV B;  5L83 A;  2CR5 A;  2KTR A;  1YJ1 A;  4GOC A;  1EF5 A;  1IYF A;  3KUC B;  3QHT A;  3TL5 A;  2V4L A;  3ZNH B;  3U30 A;  4J6I A;  3VDZ A;  2DHZ A;  1WE6 A;  3ALB A;  3A9K B;  3PVL A;  4WJP A;  3DVG X;  5KHO A;  1J19 A;  4ANX A;  2RGF A;  4NPN A;  2Z59 B;  4W9I A;  1ZGU B;  4CYE A;  3JYU A;  2MW5 A;  5DPS A;  2L05 A;  2L0F A;  2G4S A;  5GMV A;  4MEM A;  2CU1 A;  1X1M A;  3UIP B;  4AOF A;  1HE8 A;  1UBI A;  4CO7 A;  2J0K A;  3H1U A;  3V62 A;  2AWT A;  4MH0 E;  3X0W A;  4DDG D;  4URK A;  3VFK A;  2JXX A;  1K8R B;  1OEY A;  2MWS B;  3ZRC A;  4ANW A;  4X57 B;  2YVC A;  3AUL A;  2D2Q A;  2BKR B;  4DHJ B;  2KLG A;  1OEY J;  1H8C A;  4DHJ D;  1WE7 A;  2HJ8 A;  3NY5 A;  5CHV C;  3WAO A;  2KFJ A;  2WX0 A;  3JW0 X;  2FCM A;  5CX3 A;  3UQB A;  3APC A;  1KM7 A;  4HPL B;  3VXW A;  2IYD B;  3SDL C;  2UWQ A;  2ZNV C;  3KUZ A;  1ZKH A;  4XX5 A;  3M62 B;  2RD0 A;  3ZW3 A;  2BYV E;  2ZEQ A;  3APD A;  4M0W B;  2GOW A;  3OAW A;  4NNJ B;  2KDI A;  2KJH B;  1G6J A;  2KO3 A;  2KC1 A;  2N9E B;  5LXH A;  3PTF C;  2LGX A;  4KV2 A;  1UD7 A;  5DCN A;  3UIO B;  3WAL A;  2A4Z A;  1UZX B;  2MRP A;  3APF A;  5JHA A;  1L2N A;  3D32 A;  4AJY B;  4GIV A;  5E6O A;  2BF8 B;  1YIW A;  2KFK B;  3C0R B;  1H4R A;  4IC7 B;  1UEL A;  4WWP A;  2MP2 A;  4KDL B;  2LVQ A;  4PS7 A;  4W9E A;  5E6P A;  2N9X A;  3T8M A;  2IY1 B;  3NHE B;  2CS4 A;  4GB9 A;  3W1S C;  1V5O A;  4K7U A;  1WXM A;  1KLV A;  1E5W A;  4DWF A;  4EKU A;  3DBR I;  3KVF B;  4EOY A;  1WMH A;  3N30 A;  4MEL A;  3V60 A;  3A4S C;  3L0W B;  5TR5 A;  3Q3F A;  1SGH A;  5C23 A;  1WXS A;  2FID A;  3ZDT A;  2AEH A;  3W1S A;  4E71 A;  5EDS A;  1P3Q U;  3R66 C;  3B08 A;  2BWF A;  1KJT A;  3ENE A;  2KX0 A;  3ZNI D;  5DPT A;  4ANU A;  1WZ3 A;  4B6W A;  4MGY E;  2IBI B;  4FBJ B;  2DYO A;  4GSW A;  3W1Y A;  1J0G A;  4LJP B;  4KZC A;  4M8M A;  2D10 A;  3KUD B;  4GDL A;  2PE6 B;  2L8J A;  1OGW A;  1WR1 A;  3PHW B;  4NQL B;  4I6N B;  4NAW B;  2J0M A;  3AU5 A;  5JZE B;  4ZRI A;  2DZK A;  1P0R A;  2VRR B;  2L00 B;  3CSF A;  2NS5 A;  1WIA A;  2O2V B;  2KNB A;  2O6V B;  2R2O A;  2RR9 A;  3PRZ A;  3ZTC A;  1YD8 U;  4BKS A;  3ZKJ C;  2KC2 A;  3HM3 A;  5D2M B;  3VVW B;  3H7P A;  4G11 A;  2LI5 A;  1XD3 B;  3QAQ A;  5J17 A;  1TGZ B;  1I42 A;  3PV1 A;  2I1K A;  1J8C A;  1RLF A;  1WYW B;  4ICV A;  3RCZ A;  3VQI A;  4BKG A;  4W9H A;  4PS3 A;  4K7W A;  4II3 B;  3NS8 A;  3QC8 B;  2FUH B;  2K1F A;  2PPH A;  4MDK E;  2WWZ A;  2KLC A;  4TQ1 A;  2DZJ A;  3L16 A;  2K25 A;  3JVZ X;  1UH6 A;  2HTH A;  3DQV A;  4F8C B;  2CHX A;  5G55 A;  4MSM B;  4IWO A;  2RPQ A;  4OVU A;  1YX6 B;  4IWP A;  5CTR C;  4EUT A;  3ZIM A;  2LGY A;  1LFD A;  2MX2 A;  2GBR A;  4NJ6 A;  1WGR A;  2FCQ A;  3PSE B;  4AJW A;  2ASQ A;  2BGF A;  3L17 A;  2KWV B;  2MQJ A;  2M1M A;  4ZYN A;  3GZN I;  4PS8 A;  2ZPN A;  4EFO A;  5IA7 A;  3QCA A;  2LVO A;  3TIX A;  1KOT A;  3HIZ A;  2ZCC A;  3VTU A;  1WGY A;  4TKN A;  2WDT B;  3X23 A;  2C5L C;  1SIF A;  4BOS C;  4W9J A;  1WM3 A;  2KWU B;  4FA6 A;  1WR6 E;  5LXI B;  1UBQ A;  1C3T A;  1E7V A;  2KQS A;  2M17 A;  1IP9 A;  3EC8 A;  4W9K A;  1RFA A;  2FNJ B;  1WJ6 A;  2LGD A;  3VH3 B;  2CKH B;  4JQW C;  3ZUN A;  3ZDM C;  2YLM A;  4ZRJ A;  3U7D A;  3ECI A;  2OOB B;  3RUI B;  3PGE A;  1V6E A;  4K7S A;  5D7G A;  3S2A A;  4FJY A;  3P2B A;  2G4D B;  3ML8 A;  5J2R A;  2DAF A;  1WGD A;  3ONS A;  4BFR A;  2N1W A;  3U8Z A;  4WJQ A;  4ZDV A;  4MGK E;  3UQA A;  3K9P B;  1P98 A;  1WJN A;  1P9D U;  4WAA A;  1WRD B;  2C60 A;  2NBV B;  2JY6 A;  1TTN A;  4P7I A;  2KFK A;  1C1Y B;  3OLM D;  1AAR A;  4HCN B;  3RT3 B;  4HCP B;  3ZNG C;  3DVN U;  4FAD A;  5DPW A;  1WM2 A;  4AP4 C;  3IG3 A;  2LVP A;  2KMA A;  3DOW A;  2MCN B;  2HD5 B;  3HHM A;  2N9P C;  4DBG A;  1VCB A;  2LRU A;  2XBB C;  3T9L A;  3DDC B;  4GXB A;  4OVV A;  4AWJ A;  2BWE S;  1TBE A;  4BBN C;  2N7E A;  3QWZ B;  3L10 B;  3MJW A;  4WQO B;  3VUY A;  3ZLZ A;  1WI0 A;  4K81 A;  1WFY A;  4MM3 A;  2XK5 B;  1CMX B;  4JLC A;  3BIN A;  3V6E B;  4CHK A;  5AZH A;  2AYO B;  2A5U A;  4LDT B;  2N1V A;  2C7N B;  2OJR A;  4XZ4 A;  4HXD A;  3WAN A;  4LDT D;  1RRB A;  4WWO A;  4BOZ B;  3RD2 A;  3PZD A;  3QIJ A;  3RZW C;  4ZRK A;  1WGH A;  1GNU A;  3PPA A;  2KD0 A;  2ZCB A;  1EF1 A;  3M63 B;  3EFU A;  5DPR A;  5LLI A;  4RM8 A;  1QZE A;  3ZRF A;  2UYZ B;  2C7H A;  3VTW A;  3VUX A;  1IPG A;  3B0A A;  2GBK A;  4KIK A;  2BYF A;  1I35 A;  4G0N B;  2O6V A;  2K6Q A;  1E90 A;  2HE7 A;  4BKT A;  2JZ3 B;  2DYB A;  3PS6 A;  3R3M A;  3QJZ A;  1E7U A;  2I1J A;  4N9F 4;  5L95 C;  4LJO B;  1EO6 A;  4W9F A;  4II2 B;  4DXA B;  2PE9 A;  1WX7 A;  2NBW B;  1E8Z A;  4DDI D;  2KZR A;  2NPT A;  4GU2 A;  2REX A;  1LXD A;  3EHV A;  2MBO A;  5CHF A;  1E8X A;  1XT9 B;  2IO0 B;  3A1Q B;  4HJK A;  5CHW A;  3JSV B;  2L76 A;  1LM8 B;  4I6P A;  1V9J A;  3LJ3 A;  4EZJ A;  4WWN A;  3EEC A;  4DHZ E;  2JWZ A;  4G3X B;  3SHQ A;  1GC6 A;  1WX9 A;  1YQB A;  1WX8 A;  3NOB A;  2KDF B;  2LJ5 A;  5BO4 B;  3WIM A;  2CHW A;  1MG8 A;  3RZF A;  1T0Y A;  2EMS A;  2LUE A;  1WMH B;  4FLH A;  3UGB B;  3IBE A;  4KZ0 A;  2WX1 A;  3DVG Y;  1U4A A;  3PT2 B;  3O65 B;  2DAJ A;  2DZI A;  4RM9 A;  1V49 A;  2L3Z A;  2Y5B B;  1RAX A;  3TCA A;  1GG3 A;  2ZVN A;  3GOE A;  4WJN A;  4JIO U;  3R7R A;  3B1L X;  2IO2 B;  2NVU I;  4HPM B;  2JRH A;  2KX3 A;  2RSU A;  3I3T B;  1UGM A;  2JUO A;  3HK0 A;  2LRW A;  3ZO5 B;  3A9K A;  1FXT B;  1SE9 A;  2EMT A;  4I6L B;  3RYT A;  3AXC A;  1GUA B;  3WAP A;  5IAA C;  2MA9 B;  4HWI B;  2FIF A;  3KW5 B;  4FHJ A;  2AL3 A;  3V61 A;  2K39 A;  3A9J B;  5AZF A;  3QQ8 B;  4KDI C;  2K8H A;  4KSL C;  4B95 A;  4B9K A;  4MJS B;  1D3Z A;  2IO1 B;  2G3Q B;  4A3O A;  2MBH A;  3HM6 X;  4TQ0 A;  4W9D A;  2R2Q A;  4IUM B;  1S3S G;  1WGG A;  5HKH A;  3DPD A;  2LXC A;  2BKF A;  4MGI E;  3VHT C;  1WY8 A;  2ZVO A;  4IM2 A;  4HLE A;  5JHB A;  5D6J B;  3WA0 A;  4TV3 A;  3LDZ E;  4GGQ A;  4BKS D;  2IY0 B;  2G45 B;  4K1R B;  2ZPY A;  4HDQ A;  1Q5W B;  2W9N A;  2KVR A;  3KYC D;  2C7M B;  4M8N A;  2EKE C;  2GBJ A;  5FR6 A;  4W9G A;  1V2Y A;  4IG7 B;  2Z0E B;  2K8C A;  4EZL A;  2CHZ A;  2KK8 A;  3UF8 A;  2N4F A;  4HVB A;  4BBN F;  3PHX B;  4E74 A;  5C1Z A;  5J18 A;  4GDK B;  3TBL D;  2KTF A;  3BY4 B;  4HK2 A;  3ML9 A;  2LWP A;  3N3K B;  3DBH I;  2PJH A;  3NZU A;  3IHP C;  3VUW A;  2JF5 A;  1JRU A;  2KJR A;  2PEA A;  3PLU A;  1XQQ A;  1OQY A;  1WH3 A;  1Z5S B;  2D3G A;  2XK5 A;  3CST A;  2DYM A;  3OJ3 A;  1OTR B;  2DZM A;  2JZZ A;  2KWC A;  4W9C A;  5AEK B;  3DBL I;  1Q1O A;  2J7Q B;  3PRM B;  4ASW C;  1A5R A;  1M94 A;  4KSK C;  2KTR B;  3QK0 A;  1P1A A;  3KYD D;  2GBN A;  3VAW A;  2MSE D;  3KH0 A;  2K8B A;  2JVC A;  3VTV A;  1Z2M A;  2WYQ A;  3QX1 A;  4PYZ A;  2FAZ A;  3PRP B;  2BPS A;  3PLV A;  4JL9 A;  1F9J A;  1R4N I;  4FJV B;  2GBM A;  4PYU A;  1Y8R C;  2FCS A;  2LXA A;  3WAM A;  3NZS A;  1WZ0 A;  3AI5 A;  2KN5 A;  2M0X A;  3H6N A;  3H7S A;  4IW0 A;  3L13 A;  1LQB A;  1NI2 A;  2NCN A;  3QA8 A;  3AU4 A;  1V81 A;  3TMP B;  4AUQ C;  2KXJ A;  4EZK A;  4DK5 A;  3CF6 E;  2NBU A;  3OJ4 B;  4IM0 A;  3IVF A;  3L08 A;  4NAW A;  2DEN B;  3A4R A;  2JT4 B;  1WXA A;  3A1Q A;  3QAR A;  3N32 A;  1TZ1 A;  3JSV A;  2KAN A;  1PQS A;  5JH5 C;  2O2V A;  3SD5 A;  4W9L A;  5AZG A;  2LAS A;  4FJZ A;  4XC2 A;  4MGZ E;  2Z0D B;  3M3J A;  1YX5 B;  1V5T A;  4IWQ A;  3UIN B;  1E8W A;  2ZNV B;  4WJO A;  2KKC A;  1Q0W B;  2ZJD A;  1S1Q B;  1ISN A;  3DVN V;  4KVG B;  3SU8 X;  3K9O B;  4NQK E;  2D11 A;  3ZTD A;  2KDB A;  2LD9 A;  2JRI B;  3V6C B;  2MP2 B;  2M4N A;  3PRE A;  5KHQ A;  1WJ4 A;  1WF9 A;  4BVU C;  2J0J A;  3TJP A;  2KDE B;  1BT0 A;  1ZW7 A;  4GN1 A;  1R4M I;  4TUU A;  2KOX A;  2KMC A;  4F1S A;  4FHK A;  4FUL A;  3A9J A;  5G2N A;  2B3A A;  2ZZP B;  1GC7 A;  5E6N A;  4MJS A;  2GMI C;  3MTN B;  4KIK B;  4JGH B;  1L7Y A;  2MLB A;  4NJ7 A;  2NR2 A;  2QHO A;  2O6V D;  4A3P A;  3R7Q A;  2V3S A;  2FCN A;  4MSQ B;  2IO3 B;  2AL6 A;  4GDL B;  2MBE A;  2L7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...