5E6OA

Crystal structure of c. elegans lgg-2 bound to an aim/lir motif
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
117
structure length
117
Chain Sequence
PGSFKERRPFHERQKDVEEIRSQQPNKVPVIIERFDGERSLPLMDRCKFLVPEHITVAELMSIVRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTSQPAFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding/peptide
molecule keywords Protein lgg-2
total genus 35
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5e6oA00
3QQ8B 2J0JA 4FJYA 2G3QB 4WJOA 4NAWB 1WR1A 2M17A 3ZDTA 2NBUA 2HD5B 2LWPA 1UGMA 2KO3A 3NZSA 3M95A 1Y8RC 3L08A 2C7NB 2CHWA 4RMAA 2KOXA 3NS8A 4DHZE 2LJ5A 1IP9A 3PRZA 4ZRJA 2ZZPB 1WZ3A 4ANUA 1ZKHA 2L8JA 3B1LX 3ZO5B 3L16A 2ZEQA 1WJ4A 2LXCA 4CHKA 2JVCA 4DDID 4HDOA 5AEKB 2BKRB 3A9JA 1UBIA 2RSUA 4FLHA 2XK5A 4A3OA 4ANVA 3CF6E 3VUYA 4IWPA 5CHFA 3QX1A 2J0KA 2DHZA 2KFJA 2CU1A 3W1YA 2KTFA 2D10A 3R7QA 2MP2B 2D2QA 2V1YA 3PTFC 4ICVA 3VFKA 1KM7A 3KUZA 2NPTB 1YX6B 4WJPA 2KXJA 2WDTB 4K81A 3ZKJC 2JZZA 3M63B 1XD3B 2N9EB 3H1UA 3H6NA 2GOWA 2UYZB 5JH5C 2K6DB 2DAJA 3UQBA 3DBLI 2IY1B 4PS8A 4W9DA 3I3TB 2K1FA 5DPWA 3QA8A 1WH3A 4RM9A 3ZIMA 2IYDB 4NJ6A 2DYOA 2AYOB 2KFKA 4K1RB 5JZEB 4FN2A 1RAXA 4WAAA 2GBNA 3R66C 2DZJA 3LJ3A 3ALBA 2Z59B 3PVLA 1H4RA 2M4NA 4W9LA 2EMTA 1FXTB 2JPHA 3A33B 3JW0X 4GOCA 4XC2A 4ANWA 4TQ1A 2MBHA 1OEYA 2DZIA 2LZ6A 4GU2A 5LLIA 3PGEA 2ZJDA 3U8ZA 4WWOA 2NPTA 2KN5A 3DVNU 3Q3JA 1OEYJ 2K8BA 3VHTC 1WJUA 1KOTA 4CYEA 5C1ZA 3JSVB 4YL8A 3HIZA 3RT3B 2BF8B 3M3JA 1GC6A 2JWZA 3ONSA 2DENB 3ML8A 1R4MI 2LASA 3CSTA 5LXIB 1EF1A 1SE9A 1UBQA 2BKFA 2G45B 2NBWB 3AU5A 3X23A 1V5TA 5JHBA 1A5RA 2DYMA 4CO7A 2KHWB 2MW5A 4KIKA 4LJPB 1V5OA 3H7PB 4IM2A 1GNUA 2V3SA 2KX3A 4GDLA 4DBGA 2REXA 4ICUA 4ZDVA 2LD9A 1EUVB 2ZPNA 1Q0WB 2FIDA 1Q5WB 2KWUB 3QIJA 4W9JA 4KIKB 3QWZB 1IPGA 3ECIA 5E6NA 3LDZE 1K8RB 1E8ZA 3ENEA 3KH0A 4PYZA 4AJYB 5AZHA 3PPAA 2MSED 4IM0A 2LRUA 2D07B 2MBQA 1U4AA 3CSFA 4DWFA 4BOZB 4ANXA 3IHPC 3TCAA 2FCQA 2YVCA 3H9DA 3EHVA 2MRPA 4HCNB 4WJQA 1V9JA 3AI5A 3RCZA 3RUIB 1YX5B 2BYVE 1V6EA 4HPLB 4JIOU 4E74A 3W1SC 3ZTCA 3QJZA 3N3KB 2BPSA 3PHWB 5CX3A 4GMVA 3RZFA 3SHQA 4IC7B 3TL5A 3AU4A 2JUOA 2KC2A 3DVGX 3O65B 2N1WA 4OVUA 2WWZA 4M0WB 4EZJA 2D11A 4N9F4 3UINB 3PLVA 2NCNA 1ZW7A 2PPHA 2KDIA 3PT2B 1V81A 1VCBA 3D32A 4IUMB 2KQ7A 5J2RA 2C5LC 1WXVA 4FHJA 4KSLC 2LUEA 4LDTD 4PYUA 3MJWA 5IAAC 3ZW3A 4GDKA 1WRDB 4W9IA 4K7UA 1NBFC 4B9KA 3KVFB 4KDLB 2WX1A 2L0TA 3QCAA 1Z2MA 4W9GA 3RD2A 3WANA 1OQYA 3QC8B 3KYCD 3UIOB 2N9PC 1UZXB 2AWTA 3B0AA 3V61A 3UQAA 5KHOA 1WFYA 3A4RA 3OJ3A 1C1YB 1WGYA 1UD7A 2OJRA 3L54A 4MSQB 4MGKE 5J18A 2YLMA 2C7MB 3BINA 3ZNHB 2ZVOA 3RULA 5EDSA 4I6LB 4ZRKA 1E7VA 1E8XA 1P3QU 3V60A 2NBVB 4F1SA 4FADA 2HJ8A 2KZRA 3VXWA 4DDGD 2B3AA 2KQSA 3JSVA 5E6OA 2ZCCA 2FNJB 2MBEA 2MP2A 4URKA 3SU8X 5J17A 3K9OB 5GMVA 1TZ1A 2BYEA 3NZUA 2L05A 4GB9A 3VVWB 2ASQA 1YQBA 4WQOB 2HTHA 1E8WA 3WALA 1P0RA 4BBNC 1GG3A 4ZYNA 2J7QB 2KD0A 2AL3A 2DZKA 1X1MA 1TTNA 3AXCA 1WE6A 2LVOA 1EO6A 3A4SC 3L10B 4W9CA 3WAMA 1WR6E 5L95C 3JYUA 1QZEA 2LGXA 1WZ0A 3QAQA 3DQVA 1LFDA 4II3B 1WI0A 3VTUA 4EFOA 4W9KA 2KFKB 1HE8A 2EMSA 2AL6A 2L00B 1JRUA 3EFUA 1EF5A 3PLUA 4WJNA 2KC1A 4OVVA 4F7ZA 3KW5B 2XBBC 5DPSA 3IG3A 2IO2B 4AWJA 2KKCA 3MHSD 3VH4B 1D3ZA 2NVUI 3WAPA 2LGDA 4NPNA 4M8MA 1WJ6A 3QK0A 4DHZB 1MG8A 3C0RB 2KJRA 3S2AA 2KVRA 3UIPB 2ZNVC 1V80A 3APCA 2M1MA 3EECA 1WX8A 3HK0A 3NY5A 4KVGB 4MGIE 4TV3A 2J0MA 2NR2A 2PEAA 2C9WB 3HHMA 1ISNA 2G4SA 4NY0A 3TJPA 1GC7A 2JT4B 2Y5BB 1WXAA 2GBKA 3TIXA 1XQQA 1RFAA 2O2VA 3SD5A 2VRRB 5D2MB 2IO1B 1LXDA 3PRPB 2KJHB 2IZVB 2KLCA 5G2NA 3T8MA 3HM6X 2WYQA 4IM3A 5DPRA 4FJVB 4GDLB 2LRWA 2UWQA 3VUWA 4HLEA 4MSMB 4NJ7A 2L3ZA 4HCPB 4NAWA 1I35A 3L0WB 5FR6A 5HKHA 1J19A 3NOBA 4EZKA 2GBRA 4JGHB 4GGQA 4BKSA 4II2B 5L83A 2KX0A 1T0YA 3QARA 1WJNA 5E6PA 4DHJB 4HPMB 2Z0DB 4F8CB 2KANA 3DVNV 3PRMB 3GOEA 3NHEB 3PHXB 2EKEC 4NQLB 1Z5SB 3W1SA 2KJ6A 4FJZA 2AEHA 2RPQA 3ZNID 2DYBA 2O6VA 3PSEB 2XEWA 2LXAA 3DCGA 1H8CA 3H7PA 2O6VD 4KSKC 4KZ0A 4W9FA 3ZUNA 4BKGA 3DBSA 4MGYE 4K7WA 5LXHA 1WXMA 2FCNA 1R4NI 4ASWC 3CMMB 2KDBA 3X0WA 2O6VB 3ZRFA 4B6WA 2I1JA 4PS7A 4HWIB 2FUHB 5DPTA 2LVQA 4BOSC 2JF5A 3B08A 1TGZB 2RD0A 4KV2A 4TQ0A 2K8CA 4XZ4A 4ZRIA 3RZWC 1LQBA 4P7IA 1WM2A 5CTRC 4DHJD 3UGBB 3TBLD 5DCNA 3U7DA 2C7HA 4B95A 2JRHA 2L7RA 3A9JB 2A5UA 3V62A 4GDKB 4IG7B 2CHXA 2IO3B 3ZNGC 1WGGA 3MTNB 1RRBA 3K9PB 1NDDA 4GIVA 3RYTA 4KZCA 2M8SA 2RR9A 4KDIC 1WIAA 2LGYA 4GXBA 4MELA 3VTWA 4G11A 3DBHI 3DBRI 3R7RA 3IFWB 1J8CA 2FCMA 2KK8A 2BGFA 1XT9B 4IWQA 4LJOB 4G0NB 2XK5B 2BWES 3N30A 3BY4B 1YIWA 2M0XA 2N9XA 2PE6B 3PREA 3ZLZA 1G6JA 2ZPYA 2ZNVB 2GBMA 2KDFB 1J0GA 2JY6A 5D94A 2MX2A 3IBEA 3L13A 3M62B 2K6QA 5AZGA 3VAWA 4AUQC 5KHQA 4JQWC 4BKSD 3A1QB 2FCSA 2K39A 4NQKE 4HVBA 2KTRA 3R3MA 5D7GA 4LCDE 1Q1OA 1IYFA 1WXSA 4X57B 3VQIA 3QHTA 3GZNI 2GBJA 2DAFA 1LM8B 5G55A 3V6EB 4I6NB 2V4LA 2CR5A 4AJWA 2KTRB 2PJHA 1SIFA 1YJ1A 1E90A 2FAZA 2OOBB 4MJSA 2IY0B 4IWOA 3ZVVA 3DPDA 4EUTA 4E3CA 3L17A 4MGZE 4FBJB 1SGHA 4I6PA 3WAOA 3PV1A 1WF9A 2L76A 4DXAB 2LI5A 2JRIB 5IA7A 3U30A 1UELA 2G4DB 1KLVA 3ZNZB 4FULA 2IO0B 3OLMD 4G50A 3ZRCA 3TMPB 4HDQA 3VTVA 3A1QA 2MCNB 2FIFA 1WX7A 2DZMA 1WMHA 4J6IA 3UF8A 1TBEA 1E5WA 1I42A 4JL9A 4BFRA 2ZCBA 2CKHB 1UH6A 3KUDB 2A4ZA 2KWCA 1BT0A 4MH0E 1WE7A 3N32A 4MJSB 4TKNA 1WMHB 2HE7A 3EC8A 5CHVC 1OTRB 1KJTA 1OGWA 5C23A 2KDEB 2PE9A 3P2BA 4WWNA 1P9DU 2QHOA 4W9HA 1F9JA 2N1VA 4AOFA 4BKTA 3HM3A 1WGDA 4FA6A 3WA0A 3KYDD 3PZDA 2KMAA 2N7DA 3ML9A 4MDKE 5AZFA 1WYWB 1RLFA 1WGHA 2BYFA 5CHWA 2JZ3B 2W9NA 4XX5A 5D6JB 3IVFA 4EKUA 1L7YA 1NI2A 3ZTDA 2JXXA 4WWPA 3PS6A 4TUUA 1WX9A 2BWFA 1GJZA 3A9KB 4GSWA 2ZVNA 3VDZA 2CS4A 2Z0EB 4EOYA 4FHKA 2L0FA 4MEMA 4MM3A 1M94A 4LDTB 1YD8U 4HXDA 2KMCA 3DOWA 3DDCB 4NNJB 2N4FA 1P98A 2MQJA 3A9KA 4JLCA 1E8YA 4BBNF 3KUCB 1WGRA 2C60A 4IW0A 5BO4B 4GN1A 1PQSA 2MLBA 2CHZA 1V2YA 2O2VB 3OAWA 1VD2A 1P1AA 3JVZX 1GUAB 2KLGA 3H7SA 2WX0A 3AULA 4K7SA 2K25A 2R2QA 3DVGY 3ZDMC 2MBBB 1WM3A 3APFA 5TR5A 3APDA 2I1KA 4AP4C 4DK5A 3WIMA 4EEWA 3VH3B 1WY8A 1S1QB 4M8NA 2D3GA 1L2NA 2K8HA 4A20A 4A3PA 3SDLC 4RM8A 4EZLA 2N7EA 2RGFA 1AARA 4G3XB 2MBOA 4E71A 4HJKA 2KWVB 4PS3A 4W9EA 4HK2A 2KNBA 2R2OA 2LVPA 4BVUC 3Q3FA 3VUXA 2IBIB 1V49A 3T9LA 3V6CB 1S3SG 1ZGUB 5JHAA 1CMXB 1E7UA 2GMIC 2DX5B 2MA9B 2NS5A 2MWSB 3OJ4B 1V86A 1C3TA
chains in the Genus database with same CATH superfamily
3W9CB 3QQ8B 4N59A 2M17A 2HD5B 1UWMA 4NZLB 1UGMA 2WXIA 3L08A 5BMHA 3NS8A 2LJ5A 3AE7B 1CZPA 3PRZA 4ZRJA 2ZZPB 2WDVB 4DDID 1GB1A 2NTTA 1JW9D 5HHDG 2JVCA 4CHKA 5AEKB 2BKRB 4N58A 2G9HD 1QQRA 4P1BC 1UBIA 4FLHA 4ANVA 2XK5A 1K53A 4DXGA 5CHFA 2J0KA 2CU1A 1HEZE 1RYJA 2D10A 3R7QA 3NVWA 2V1YA 4ICVA 4WH4A 5C3JB 2KXJA 2WDTB 2D5GA 4K81A 1HTOA 1XD3B 2GOWA 2IY1B 4C80A 4PS8A 5DPWA 2K1FA 2N9LA 4RM9A 2IYDB 4NJ6A 1IUEA 1FPYA 2W82A 3MC0B 4WAAA 4QAYA 3LJ3A 1CK1A 1SBBB 2KAJA 3PVLA 4P1CC 2E3TA 4OZCA 2BW2A 1FXTB 3A33B 4ANWA 4TQ1A 2MBHA 2LZ6A 4GU2A 3U8ZA 4WWOA 2NPTA 1YOVB 3Q3JA 1OEYJ 4P16A 4YL8A 2BF8B 2XN9C 3M3JA 2DENB 2WU2B 3ML8A 3CSTA 1UBQA 2BKFA 2NBWB 2V9HA 3PZ8A 2WXJA 1V5OA 4LJPB 3TSSA 2VH2A 4ZDVA 2REXA 1N62A 2LD9A 2FIDA 2KWUB 3QIJA 3QWZB 1IPGA 2QIEB 5E6NA 4S0RA 3KH0A 2D07B 3GB1A 3CSFA 1YN5A 2FCQA 2MRPA 4WJQA 2WXKA 3AI5A 3RCZA 3RNCC 3QJZA 1J7BA 3SHQA 3DVGX 1WWTA 4OVUA 4EZJA 3TUOA 5D3IB 2NMQA 2J42A 2ONQA 2PPHA 2KDIA 5EE3A 2TSSA 3P1MA 3PT2B 1V81A 2W54A 1VCBA 4IUMB 2KQ7A 4RGTA 1GPXA 1NENB 2C5LC 4PYUA 3MJWA 4JWSC 1WRDB 2L32A 4HKZE 2L52A 5LNK1 4N6EB 4B9KA 2WX1A 1SE4A 2L0TA 4OZBA 2JYTA 1N5WA 4W9GA 4NAMA 3WANA 1OQYA 3AE5B 1UZXB 3UQAA 2AQ1B 1TS5A 1WFYA 1CQVA 1WGYA 5J18A 2OJRA 3TEWA 1T0RC 4Q2JA 3U7ZA 3ZNHB 3MFGA 2NBVB 3NVYA 2V0GA 3JSVA 1JWBD 2MP2A 4DXFA 2BYEA 2L05A 2ZW1A 4GB9A 2ASQA 2IJ0A 2HTHA 3KWLA 1UUPA 1X1MA 2OEDA 3AXCA 3N1XC 2LVOA 1WR6E 5AUKA 2SAKA 4AS1A 3AE1B 2AQ2B 2L00B 2JX5A 1JRUA 4EE2A 4F7ZA 2XBBC 4LNFA 2IO2B 2KKCA 1OFFA 1TS2A 1TS3A 3MHSD 4OVZA 1AN8A 4LK0M 3V3XA 2Q5WD 1AWDA 2ZNVC 4KVGB 3FILA 1SB3C 3APCA 2PVOD 1GAQB 1ENFA 2AX5A 2GRIA 3ABVB 3LXFA 4TSSA 2O2VA 1N6ZA 1VLBA 4KGSA 5DPRA 1MHXA 3AE6B 1MI0A 2ACZB 3L0WB 1J19A 4EZKA 4JGHB 5L83A 4D2KA 1TS4A 3QARA 3DVNV 3GOEA 2FBWB 3NHEB 1QF6A 2WXFA 4FJZA 1L0VB 1GOZA 2QCZA 2O6VA 5BYQA 2LXAA 4BKGA 1SE3A 3DBSA 4MGYE 4OW0A 1KH0A 1R4NI 3CMMB 3ZRFA 4B6WA 4PS7A 5DPTA 1TGZB 1L6UA 2K8CA 4ZRIA 1LQBA 1WM2A 3W5UB 1EU3A 2DBYA 3U7DA 3HRDD 3A9JB 3BIID 3V62A 1V97A 3ZNGC 1M4VA 1L4ZB 1MJDA 1I4PA 4KZCA 2M8SA 2INNE 2WXNA 4FXCA 2RR9A 1VDVA 1WIAA 2B76B 3DBHI 1XT9B 4LJOB 4G0NB 3N30A 2N9XA 2PE6B 2GBMA 2KDFB 3VAWA 3L13A 3Q8AA 2K6QA 4ITKA 1WGKA 1XF5L 2K39A 1KLUD 4RFBA 1E6EB 3R3MA 1IYFA 3MHZA 3B2FA 3GZNI 2GBJA 3URYA 1I4HA 1E90A 2WU5B 4MJSA 4IWOA 1MPEA 4EUTA 4E3CA 3L17A 1V1PB 5IP4D 2VZKB 4I6PA 1PDXA 1SSNA 1QLBB 4DXAB 2JRIB 5IA7A 2IO0B 5MPOA 4JPSA 3U2SC 1EU4A 1FM0D 2CU3A 1E5WA 4ARCA 3KUDB 1DOXA 4TKNA 4MJSB 1R4NB 4BKTA 1XLQA 3P2BA 1FNVA 2N1VA 2LGSA 5FKAC 4MDKE 1WYWB 4XX5A 1NI2A 2JXXA 2LEKA 4WWPA 1FIQA 1ZXIA 2JXTA 3VDZA 2VH1A 3Q3MC 1YN4A 1ZE3D 4FHKA 4XDDA 4EOYA 1DOYA 4C7ZA 2MQJA 1DOIA 1E8YA 4BBNF 1N60A 2MLBA 1V2YA 3OAWA 4L1BA 3JVZX 3CIRB 2K25A 1F2RI 1WM3A 5TR5A 3BYTB 4DK5A 1FCLA 1RFKA 1S1QB 2G1EA 2D3GA 1OQQA 1TKYA 2N7EA 4WWMA 2RGFA 4E71A 4PS3A 4USAA 2KVZA 2R2OA 2LVPA 3R2TA 3V6CB 1V49A 1Q10A 2QMTA 1E7UA 4YT0B 4C00A 1JWSD 2NS5A 2CJOA 2IGGA 1V86A 1UNSA 2J0JA 4FJYA 1UWXA 3IAM1 2NBUA 3M95A 1ZP0B 1T5XD 2CHWA 1HZ5A 4DHZE 4L2YA 1ZKHA 3L16A 2LXCA 2RSUA 3CF6E 3PO0A 1FRDA 4IWPA 4JX1C 1I4RA 2KFJA 1TKGA 4REZA 3PTFC 1D6EC 3EA6A 1STEA 3KUZA 3Q8BA 1E9MA 2MJ3A 2NPTB 1YX6B 1PGBA 4RF0A 3M63B 1I7HA 3H6NA 2K6DB 3I3TB 2RMMA 3ZIMA 3VRAB 3ZXVA 1D5XC 1JWUD 1JMLA 5JZEB 4FN2A 2RDBC 2GBNA 3R66C 2DZJA 2Z59B 2M4NA 2JPHA 3RI7C 1OEYA 5LLIA 2GB1A 2GLSA 1AYFA 1WJUA 5C1ZA 3N1YC 3JSVB 3HIZA 3OG5A 2LFIA 1R4MI 1EF1A 1SE9A 1A5RA 4KIKA 3H7PB 3U52E 4NJCA 4IM2A 1D4BA 1GNUA 2V3SA 2KX3A 4B0MA 4DBGA 4JE3B 2KACA 2WXMA 4KGTA 1Q5WB 4W9JA 4B0EA 3ECIA 3ENEA 4AJYB 2UU7A 4WIPA 3PPAA 3P4SB 1U4AA 1N5XA 3EGRA 1LO5D 4ANXA 3NS1A 3H9DA 3EHVA 1V9JA 2V3NA 3I57A 5BMIA 4GLSC 1PFDA 2BYVE 4JIOU 4E74A 2YEPF 3W1SC 3N3KB 2MJEA 4GMVA 3TL5A 1BMLC 1IGDA 3AU4A 2KC2A 4M0WB 1NEKB 1R7SA 3UINB 2H89B 1QKZA 3VRBB 1QOFA 5J2RA 4C56C 2K5PA 5IAAC 3GS2A 2PMVA 4K7UA 1NBFC 5T8IA 3BVZA 3QCAA 3RD2A 2MJDA 3QC8B 2KN4A 2N9PC 5BYRA 3R8BA 3V61A 3OJ3A 3ZXRA 3L54A 3DWMA 4KKIA 2C7MB 3BINA 3AEFB 2BS4B 3RFZB 5EDSA 4I6LB 1E7VA 1E8XA 1P7FA 4KKJA 3V60A 2KZRA 2B3AA 2FNJB 2MBEA 4URKA 3P4PB 2JSVX 5J17A 3FAHA 4UDUC 1YQBA 3FILB 1P0RA 4OHJA 1GG3A 2AL3A 1RM6C 1YJJA 1V1PA 1IBXB 1QZEA 3SFDB 1WZ0A 3QAQA 4EFOA 1FFVA 3EFUA 1EF5A 3PLUA 2KC1A 4OVVA 2YEPB 5DPSA 4RGMA 1T0SC 3VH4B 2BQQA 1YN3A 4M8MA 3C0RB 3UIPB 2M1MA 3EECA 1WX8A 3NY5A 2NR2A 2OHFA 3VR8B 4NY0A 2JT4B 1NYRA 1RFAA 2VRRB 2IO1B 3PRPB 2KJHB 2WXLA 2IZVB 3HM6X 2INDC 1K51A 2WYQA 4IM3A 4FJVB 2LRWA 3VUWA 4HLEA 2NTSA 2L3ZA 4HCPB 5HKHA 3NOBA 3W5VB 2GBRA 4BKSA 2KX0A 4DHJB 3IT4B 2X38A 3ZJTA 3W1SA 4HROA 2AEHA 3ZNID 2XNAC 2XEWA 3AEGB 3H7PA 3ZUNA 3T3NA 2E6XA 2KDBA 2BBCA 2O6VB 2I1JA 2LVQA 2WGSA 3B08A 3UI3A 1L0YB 2QILA 1FRRA 3NZ3A 4P7IA 1NYQA 4AQ7A 2C7HA 3RNAC 1HTQA 2A5UA 4GDKB 3SEBA 2D3AA 1L5PA 1FO4A 3MTNB 2PW9A 3K9PB 4GIVA 4HKQA 3RYTA 1KFYB 2LGYA 2OJWA 2QDFA 2FCMA 2KK8A 2JU6X 2BWES 3PREA 2D3BA 2M0XA 3ZLZA 1XLOA 3RNEC 4AUQC 4JQWC 4BKSD 3A1QB 5EE0A 1L0XB 3N9YC 4LCDE 1WXSA 4RGOS 4X57B 3VQIA 1NI3A 3N20C 3Q8CA 1LM8B 4A55A 4AJWA 2LHEA 4P6VF 3HVZA 4HPPA 3HVDA 2MEKA 3DBRB 2IY0B 1WF9A 2L76A 1UELA 1JWMD 2QJLA 3TMPB 4HDQA 1T3QA 3AV8A 1JQ4A 3AE3B 1V1OA 2INPE 4MM3B 4BFRA 4ZHOA 1UH6A 2A4ZA 4MH0E 3N32A 3EC8A 1L4DB 1OTRB 1KJTA 1PYWD 3HM3A 3FKYA 3C19A 4FA6A 3BVGA 1SEBD 3KYDD 4IOIE 1E0ZA 2I38A 1YQ3B 1RLFA 5CHWA 2W9NA 3Q3OC 4EKUA 2LMCA 4ZYSA 4OZAA 4TUUA 4C4VB 1GJZA 3A9KB 2ZVNA 1QOBA 2L0FA 4MM3A 2KMCA 1P98A 1SF0A 3A9KA 4JLCA 1WGRA 2C60A 1PQSA 3H7SA 3APDA 4AP4C 1TYGB 3WIMA 1TJEA 2KWDA 2PIAA 1P7EA 2JZPA 4A6QA 4M01A 3ZJUA 2M56B 1AARA 4G3XB 2M19A 2N0SB 3MC8A 4W9EA 4HK2A 1T0QC 1S3SG 1ZGUB 3I63C 2GMIC 4O1NA 2DX5B 3MC9A 2MWSB 2IGDA 1C3TA 4WJOA 1ESFA 2BB5A 4NAWB 3ZDTA 3NZSA 1Y8RC 2C7NB 3AEAB 4XDCA 1WYGA 1IP9A 4ANUA 1WZ3A 3E56A 2L8JA 1PUTA 3ZO5B 2ZEQA 1WJ4A 4HDOA 3AECB 1PGAA 2IPKD 3VUYA 3QX1A 3B2GA 1KTKA 2KTFA 2MP2B 3RN9C 1B1ZA 3VFKA 3TEXA 1KM7A 2J52A 1C76A 2LUMA 1WXQA 2N9EB 3H1UA 2UYZB 2KDMA 2DAJA 3UQBA 3DBLI 4LTUA 1XEEA 2IDYA 1WH3A 1TKEA 2DYOA 2KMMA 2L83A 4K1RB 4LLGM 4MH8A 1FNWA 3ZYYX 4YTPB 2V3PA 4W9LA 2EMTA 4HJGE 4WAFA 4ZRPA 3JW0X 4XC2A 2ZJDA 2KN5A 3DVNU 4CYEA 3DWGC 1GC6A 2JWZA 3ONSA 2WLBA 2LASA 2G45B 4HRSA 2DYMA 2MW5A 3N1ZC 1UF0A 2WQYB 1XO3A 2JWUA 5BMGA 3BWUD 2ZPNA 1VZ6A 1PGXA 1E8ZA 2MSED 1XLNA 3NRZA 4XYCA 1E7PB 2LRUA 3LYYA 1N63A 5H8YE 4DWFA 4BOZB 1ZOYB 4BZAA 3H8HA 3TCAA 3GP7A 3RUIB 1ZPSA 4HPLB 2BPSA 3PHWB 4YTNB 4IC7B 2INCC 2N1WA 4S17A 2D11A 1YMHE 3T3OA 3PLVA 1EM7A 5HFYA 2R61A 1DGJA 3D32A 4PK1A 4KX6B 4FHJA 4KSLC 2LUEA 5E6JA 3ZW3A 2KYWA 1A70A 1ZXHA 3KVFB 4KDLB 3RMKC 1WSPA 3KYCD 3B0AA 5KHOA 3A4RA 3P4QB 2YLMA 2K9XA 2ZVOA 1ZDVA 3RULA 3B9JA 4YXDB 1P3QU 1KLGD 3PZ7A 5E6OA 2ZCCA 3K9OB 2PTLA 3WALA 4BBNC 4ZYNA 1TTNA 2BTEA 2L1AA 3L10B 5L95C 2LGXA 2VZKD 2RPVA 3HUIA 1LFDA 4II3B 4W9KA 2KFKB 1HE8A 4WJNA 5JHBA 1SJHD 1HXYD 2DNFA 2WS3B 1QOAA 3IG3A 4AWJA 1D3ZA 4JWUC 2NVUI 4A90A 2LGDA 4NPNA 1HZ6A 4DHZB 3QK0A 1MG8A 2IGHA 3S2AA 3W2DA 4C4VA 4MGZE 4KGRA 1LGRA 2WXPA 3DBLB 2WXQA 4TV3A 2J0MA 1SJED 3Q8FA 3HHMA 1ISNA 1XCTL 3TJPA 5H92C 1WXAA 2GBKA 2ZW0A 3TIXA 1XQQA 2CJNA 2WXGA 1F1HA 4XWTA 4ZRQA 1F2RC 2KLCA 2H88B 5G2NA 3SR6A 3T8MA 2MH7A 4HEA1 1SE2A 2UWQA 4MSMB 4NJ7A 1I35A 5FR6A 1L6VA 4GGQA 3BYYB 1T0YA 1ET9A 4HPMB 2Z0DB 5D3DA 3PRMB 3PHXB 4NQLB 2KJ6A 2RPQA 2DYBA 3L4PA 2QC8A 2GI9A 3O13A 1WXMA 4ASWC 3Q14C 3X0WA 2FE8A 4US9A 4RCOA 1MVKA 5IO9A 4PT5A 2RD0A 2DWQA 4XZ4A 3RPFC 3RZWC 1MHHE 1JALA 4DHJD 3TBLD 5DCNA 4B95A 2JRHA 4IG7B 2Z8LA 2LGIA 1YJIA 1ZUD2 4YSXB 4KDIC 4MELA 4XGAB 4GXBA 5AUIA 4K3CA 1JCKB 1J8CA 4LNNA 2BGFA 4IWQA 3FC4A 4ACFA 3BY4B 1YIWA 2Y5PA 2ZPYA 1J0GA 1MFWA 3IBEA 3M62B 5KHQA 2W3SA 1ZDXA 2FCSA 4HVBA 2QEJC 5FK9C 2D3CA 2KTRA 4TMAB 3AE8B 2BT6A 4ZHPA 3ZJVA 1E10A 5G55A 1VZ8A 2V4LA 4I6NB 1SIFA 1BXTA 3P63A 2OOBB 3DBHB 3U4EG 3DPDA 4FBJB 2Y3AA 1JROA 4H2AA 4YSZB 3PV1A 1QILA 3BK2A 3U30A 1I4QA 1EWCA 2G4DB 1KLVA 4FULA 3SFEB 2PLPA 1T6BX 3OLMD 4G50A 3ZRCA 3VTVA 2AQ3B 1ET6A 2FIFA 2MCNB 2RDGA 1K52A 1WMHA 3UF8A 1I42A 4JL9A 2ZCBA 1TY0A 1TIFA 2HTME 1BT0A 3Q8EA 1WE7A 1WMHB 2QHOA 4W9HA 1KF6B 1WGDA 5EE9A 3PZDA 2KMAA 2N7DA 3ML9A 5AZFA 2WDQB 1WGHA 2JZ3B 3IVFA 4YTMB 3PS6A 1WX9A 1FMAD 2MHJA 4GSWA 3AE2B 2CS4A 2Z0EB 1K50A 1GB4A 3ZQ4A 4K3BA 3DOWA 3DDCB 2N4FA 5BO4B 4GN1A 2O2VB 1VD2A 4IKGA 1GUAB 4K7SA 3DVGY 3ZDMC 4R3DA 3RNGC 2WXRA 2K0PA 4EEWA 1VZ7A 3BK1A 4A20A 4A3PA 3SDLC 4RM8A 5GXGB 3BZDB 4EZLA 3R2IA 3EUB2 4HJKA 2KWVB 4A9AA 4C7YA 1HA5A 4BVUC 3Q3FA 3VUXA 2IBIB 3T9LA 3NG0A 5JHAA 1CMXB 2WXHA 2WNMA 5IOIA 3OJ4B 2G3QB 1FD6A 1WR1A 4J3OD 2SEBD 2LWPA 2KO3A 1VJKA 4RMAA 2KOXA 1F52A 5G5GA 3I9V1 3B1LX 3A9JA 4A3OA 3P4RB 4RGNA 2DHZA 3W1YA 3J9CA 2D2QA 3DHIC 3ETRA 1SIJA 3DHGC 3GE3C 4WJPA 4YWGG 3ZKJC 3MP9A 2JZZA 1QOGA 5JH5C 2N9KA 4W9DA 3QA8A 2AYOB 2KFKA 1V8CA 1C78A 3CWIA 1J7AA 1RAXA 3ALBA 1C9FA 1NVID 1H4RA 3IXSA 4GOCA 1FEHA 4CQNA 1YNTE 2DZIA 3PGEA 1XXGA 2K8BA 3VHTC 1KOTA 2N7JA 3BVMA 3RT3B 1ROEA 3IT6B 5LXIB 1MG4A 3AU5A 2EKIA 3X23A 4LNKA 1J7CA 1V5TA 3TEZA 3AB5A 4CO7A 2KHWB 5HI1A 4GDLA 4ICUA 1Y56A 1EUVB 1Q0WB 4KIKB 1I4XA 3TEYA 3LDZE 1K8RB 4PYZA 5AZHA 4IM0A 3NJTA 2MBQA 2LJIA 3E9SA 3IHPC 2WDRB 2YVCA 4HCNB 4MACA 2KT7A 1FCCC 1YX5B 2RDHA 1V6EA 1C79A 1TZOA 2K3UA 3RNFC 3ZTCA 5CX3A 3RZFA 5IN7A 3O65B 2JUOA 2BS2B 2WWZA 4N9F4 3ZGZA 2NCNA 1I4GA 1ZW7A 3MJ5A 3AM9A 1XLPA 2WP9B 1RWSA 5C2TB 1WXVA 4LDTD 4LNOA 1VR9A 4GDKA 1QT9A 4W9IA 1Z2MA 4WQMA 3UIOB 1SXTA 3AH7A 2AWTA 3KWVA 1C1YB 1UD7A 4MSQB 4MGKE 1BUIC 1JRPA 4ZRKA 4FADA 4F1SA 3WCQA 2HJ8A 3VXWA 4DDGD 2KQSA 3SU8X 3Q69A 5GMVA 1TZ1A 3NZUA 2FUG1 3VVWB 4WQOB 3NUHB 1E8WA 3LB8C 2J7QB 2KD0A 2DZKA 3DHHC 3NVZA 2HJ1A 1WE6A 1EO6A 3A4SC 3AEBB 4W9CA 3WAMA 3JYUA 2I2YA 3DQVA 3P42A 3VTUA 1WI0A 3AN1A 3VR9B 2EMSA 2AL6A 2W55A 3KW5B 2J53A 4DQOC 5JXVA 2DLBA 3NVVA 3WAPA 2EELA 1WJ6A 1VRAB 2KJRA 2KVRA 1V80A 3HK0A 4RNAA 2PVGC 4MGIE 1IBXA 2PEAA 2C9WB 5BYSA 2G4SA 1GC7A 2Y5BB 1CJEA 2HDEA 2V4IB 3SD5A 5D2MB 1LXDA 1TT5B 1B9RA 3AEDB 3Q2AC 1C4CA 3AMZA 4GDLB 1WRIA 1C77A 2BYTA 2PKOA 4NAWA 1IGCA 4II2B 2ON8A 5E6PA 1WJNA 4F8CB 2KANA 5HG2A 1C4PA 2EKEC 1Z5SB 3PSEB 1F0ZA 4MT5A 3DCGA 1H8CA 4KSKC 2O6VD 4KZ0A 4W9FA 2X8XX 4K7WA 5LXHA 2FCNA 3AEEB 1UGJA 3AE4B 4HWIB 2FUHB 4M02A 4BOSC 2JF5A 1D5ZC 1FNUA 4KV2A 4TQ0A 3AE9B 5FR3A 5CTRC 3UGBB 2L7RA 2CHXA 2IO3B 2JYEA 1WGGA 1RRBA 1NDDA 4RH6A 5EE1A 3KLSX 1N61A 3IAS1 1EWYC 3VTWA 4G11A 3DBRI 3R7RA 3IFWB 2Y5CA 2J4XA 4L23A 4YSYB 5G5HA 2XK5B 2WHIA 3GE8C 1KRHA 1G6JA 2ZNVB 2JY6A 5D94A 1TY2A 2MX2A 2WXOA 5AZGA 1FXAA 2ICIA 2LHDA 3OWEB 4NQKE 4A8XC 5TSSA 2KQ4X 2M0AA 5D7GA 1Q1OA 3QHTA 2DAFA 3V6EB 2CR5A 2KTRB 2PJHA 1AW7A 1YJ1A 3EFCA 2FAZA 3ZVVA 1SGHA 3WAOA 4ZOHC 2QSDA 2LI5A 3ZNZB 1YQ4B 2JQRB 2BS3B 1D5MC 4LNIA 3A1QA 4RF1A 2W3RA 3Q3NC 1WX7A 2DZMA 1DYQA 4J6IA 1XCQL 1TBEA 2CKHB 2KWCA 1OQRA 5CHVC 5IKCM 3C8YA 2HE7A 1OGWA 5C23A 2KDEB 2PE9A 4WWNA 1P9DU 4AOFA 1F9JA 2BVCA 3WA0A 3I5JC 4BAXA 3GZNB 5D6JB 2BYFA 1JWAD 1L7YA 3ZTDA 1HQRD 2K22A 4M00A 4IDIA 2BWFA 2BB6A 4MEMA 4XE0A 3V05A 1M94A 1R4MB 4LDTB 1YD8U 4HXDA 4NNJB 1FXIA 5I4DA 3KUCB 4IW0A 2CHZA 4XWWA 1P1AA 1C4AA 2KLGA 2WX0A 3AULA 3KQ4A 2R2QA 2MBBB 3APFA 2I1KA 3VH3B 1WY8A 4M8NA 1L2NA 4ARIA 2K8HA 3RNBC 2MBOA 1ACCA 4M0WA 2KNBA 3Q6BA 1FFUA 4US8A 2MA9B 4WURA 1F77A
chains in the Genus database with same CATH topology
3QQ8B 2J0JA 4FJYA 2G3QB 4WJOA 4NAWB 1WR1A 2M17A 3ZDTA 2NBUA 2HD5B 2LWPA 1UGMA 2KO3A 3NZSA 3M95A 1Y8RC 3L08A 2C7NB 2CHWA 4RMAA 2KOXA 3NS8A 4DHZE 2LJ5A 1IP9A 3PRZA 4ZRJA 2ZZPB 1WZ3A 4ANUA 1ZKHA 2L8JA 3B1LX 3ZO5B 3L16A 2ZEQA 1WJ4A 2LXCA 4CHKA 2JVCA 4DDID 4HDOA 5AEKB 2BKRB 3A9JA 1UBIA 2RSUA 4FLHA 2XK5A 4A3OA 4ANVA 3CF6E 3VUYA 4IWPA 5CHFA 3QX1A 2J0KA 2DHZA 2KFJA 2CU1A 3W1YA 2KTFA 2D10A 3R7QA 2MP2B 2D2QA 2V1YA 3PTFC 4ICVA 3VFKA 1KM7A 3KUZA 2NPTB 1YX6B 4WJPA 2KXJA 2WDTB 4K81A 3ZKJC 2JZZA 3M63B 1XD3B 2N9EB 3H1UA 3H6NA 2GOWA 2UYZB 5JH5C 2K6DB 2DAJA 3UQBA 3DBLI 2IY1B 4PS8A 4W9DA 3I3TB 2K1FA 5DPWA 3QA8A 1WH3A 4RM9A 3ZIMA 2IYDB 4NJ6A 2DYOA 2AYOB 2KFKA 4K1RB 5JZEB 4FN2A 1RAXA 4WAAA 2GBNA 3R66C 2DZJA 3LJ3A 3ALBA 2Z59B 3PVLA 1H4RA 2M4NA 4W9LA 2EMTA 1FXTB 2JPHA 3A33B 3JW0X 4GOCA 4XC2A 4ANWA 4TQ1A 2MBHA 1OEYA 2DZIA 2LZ6A 4GU2A 5LLIA 3PGEA 2ZJDA 3U8ZA 4WWOA 2NPTA 2KN5A 3DVNU 3Q3JA 1OEYJ 2K8BA 3VHTC 1WJUA 1KOTA 4CYEA 5C1ZA 3JSVB 4YL8A 3HIZA 3RT3B 2BF8B 3M3JA 1GC6A 2JWZA 3ONSA 2DENB 3ML8A 1R4MI 2LASA 3CSTA 5LXIB 1EF1A 1SE9A 1UBQA 2BKFA 2G45B 2NBWB 3AU5A 3X23A 1V5TA 5JHBA 1A5RA 2DYMA 4CO7A 2KHWB 2MW5A 4KIKA 4LJPB 1V5OA 3H7PB 4IM2A 1GNUA 2V3SA 2KX3A 4GDLA 4DBGA 2REXA 4ICUA 4ZDVA 2LD9A 1EUVB 2ZPNA 1Q0WB 2FIDA 1Q5WB 2KWUB 3QIJA 4W9JA 4KIKB 3QWZB 1IPGA 3ECIA 5E6NA 3LDZE 1K8RB 1E8ZA 3ENEA 3KH0A 4PYZA 4AJYB 5AZHA 3PPAA 2MSED 4IM0A 2LRUA 2D07B 2MBQA 1U4AA 3CSFA 4DWFA 4BOZB 4ANXA 3IHPC 3TCAA 2FCQA 2YVCA 3H9DA 3EHVA 2MRPA 4HCNB 4WJQA 1V9JA 3AI5A 3RCZA 3RUIB 1YX5B 2BYVE 1V6EA 4HPLB 4JIOU 4E74A 3W1SC 3ZTCA 3QJZA 3N3KB 2BPSA 3PHWB 5CX3A 4GMVA 3RZFA 3SHQA 4IC7B 3TL5A 3AU4A 2JUOA 2KC2A 3DVGX 3O65B 2N1WA 4OVUA 2WWZA 4M0WB 4EZJA 2D11A 4N9F4 3UINB 3PLVA 2NCNA 1ZW7A 2PPHA 2KDIA 3PT2B 1V81A 1VCBA 3D32A 4IUMB 2KQ7A 5J2RA 2C5LC 1WXVA 4FHJA 4KSLC 2LUEA 4LDTD 4PYUA 3MJWA 5IAAC 3ZW3A 4GDKA 1WRDB 4W9IA 4K7UA 1NBFC 4B9KA 3KVFB 4KDLB 2WX1A 2L0TA 3QCAA 1Z2MA 4W9GA 3RD2A 3WANA 1OQYA 3QC8B 3KYCD 3UIOB 2N9PC 1UZXB 2AWTA 3B0AA 3V61A 3UQAA 5KHOA 1WFYA 3A4RA 3OJ3A 1C1YB 1WGYA 1UD7A 2OJRA 3L54A 4MSQB 4MGKE 5J18A 2YLMA 2C7MB 3BINA 3ZNHB 2ZVOA 3RULA 5EDSA 4I6LB 4ZRKA 1E7VA 1E8XA 1P3QU 3V60A 2NBVB 4F1SA 4FADA 2HJ8A 2KZRA 3VXWA 4DDGD 2B3AA 2KQSA 3JSVA 5E6OA 2ZCCA 2FNJB 2MBEA 2MP2A 4URKA 3SU8X 5J17A 3K9OB 5GMVA 1TZ1A 2BYEA 3NZUA 2L05A 4GB9A 3VVWB 2ASQA 1YQBA 4WQOB 2HTHA 1E8WA 3WALA 1P0RA 4BBNC 1GG3A 4ZYNA 2J7QB 2KD0A 2AL3A 2DZKA 1X1MA 1TTNA 3AXCA 1WE6A 2LVOA 1EO6A 3A4SC 3L10B 4W9CA 3WAMA 1WR6E 5L95C 3JYUA 1QZEA 2LGXA 1WZ0A 3QAQA 3DQVA 1LFDA 4II3B 1WI0A 3VTUA 4EFOA 4W9KA 2KFKB 1HE8A 2EMSA 2AL6A 2L00B 1JRUA 3EFUA 1EF5A 3PLUA 4WJNA 2KC1A 4OVVA 4F7ZA 3KW5B 2XBBC 5DPSA 3IG3A 2IO2B 4AWJA 2KKCA 3MHSD 3VH4B 1D3ZA 2NVUI 3WAPA 2LGDA 4NPNA 4M8MA 1WJ6A 3QK0A 4DHZB 1MG8A 3C0RB 2KJRA 3S2AA 2KVRA 3UIPB 2ZNVC 1V80A 3APCA 2M1MA 3EECA 1WX8A 3HK0A 3NY5A 4KVGB 4MGIE 4TV3A 2J0MA 2NR2A 2PEAA 2C9WB 3HHMA 1ISNA 2G4SA 4NY0A 3TJPA 1GC7A 2JT4B 2Y5BB 1WXAA 2GBKA 3TIXA 1XQQA 1RFAA 2O2VA 3SD5A 2VRRB 5D2MB 2IO1B 1LXDA 3PRPB 2KJHB 2IZVB 2KLCA 5G2NA 3T8MA 3HM6X 2WYQA 4IM3A 5DPRA 4FJVB 4GDLB 2LRWA 2UWQA 3VUWA 4HLEA 4MSMB 4NJ7A 2L3ZA 4HCPB 4NAWA 1I35A 3L0WB 5FR6A 5HKHA 1J19A 3NOBA 4EZKA 2GBRA 4JGHB 4GGQA 4BKSA 4II2B 5L83A 2KX0A 1T0YA 3QARA 1WJNA 5E6PA 4DHJB 4HPMB 2Z0DB 4F8CB 2KANA 3DVNV 3PRMB 3GOEA 3NHEB 3PHXB 2EKEC 4NQLB 1Z5SB 3W1SA 2KJ6A 4FJZA 2AEHA 2RPQA 3ZNID 2DYBA 2O6VA 3PSEB 2XEWA 2LXAA 3DCGA 1H8CA 3H7PA 2O6VD 4KSKC 4KZ0A 4W9FA 3ZUNA 4BKGA 3DBSA 4MGYE 4K7WA 5LXHA 1WXMA 2FCNA 1R4NI 4ASWC 3CMMB 2KDBA 3X0WA 2O6VB 3ZRFA 4B6WA 2I1JA 4PS7A 4HWIB 2FUHB 5DPTA 2LVQA 4BOSC 2JF5A 3B08A 1TGZB 2RD0A 4KV2A 4TQ0A 2K8CA 4XZ4A 4ZRIA 3RZWC 1LQBA 4P7IA 1WM2A 5CTRC 4DHJD 3UGBB 3TBLD 5DCNA 3U7DA 2C7HA 4B95A 2JRHA 2L7RA 3A9JB 2A5UA 3V62A 4GDKB 4IG7B 2CHXA 2IO3B 3ZNGC 1WGGA 3MTNB 1RRBA 3K9PB 1NDDA 4GIVA 3RYTA 4KZCA 2M8SA 2RR9A 4KDIC 1WIAA 2LGYA 4GXBA 4MELA 3VTWA 4G11A 3DBHI 3DBRI 3R7RA 3IFWB 1J8CA 2FCMA 2KK8A 2BGFA 1XT9B 4IWQA 4LJOB 4G0NB 2XK5B 2BWES 3N30A 3BY4B 1YIWA 2M0XA 2N9XA 2PE6B 3PREA 3ZLZA 1G6JA 2ZPYA 2ZNVB 2GBMA 2KDFB 1J0GA 2JY6A 5D94A 2MX2A 3IBEA 3L13A 3M62B 2K6QA 5AZGA 3VAWA 4AUQC 5KHQA 4JQWC 4BKSD 3A1QB 2FCSA 2K39A 4NQKE 4HVBA 2KTRA 3R3MA 5D7GA 4LCDE 1Q1OA 1IYFA 1WXSA 4X57B 3VQIA 3QHTA 3GZNI 2GBJA 2DAFA 1LM8B 5G55A 3V6EB 4I6NB 2V4LA 2CR5A 4AJWA 2KTRB 2PJHA 1SIFA 1YJ1A 1E90A 2FAZA 2OOBB 4MJSA 2IY0B 4IWOA 3ZVVA 3DPDA 4EUTA 4E3CA 3L17A 4MGZE 4FBJB 1SGHA 4I6PA 3WAOA 3PV1A 1WF9A 2L76A 4DXAB 2LI5A 2JRIB 5IA7A 3U30A 1UELA 2G4DB 1KLVA 3ZNZB 4FULA 2IO0B 3OLMD 4G50A 3ZRCA 3TMPB 4HDQA 3VTVA 3A1QA 2MCNB 2FIFA 1WX7A 2DZMA 1WMHA 4J6IA 3UF8A 1TBEA 1E5WA 1I42A 4JL9A 4BFRA 2ZCBA 2CKHB 1UH6A 3KUDB 2A4ZA 2KWCA 1BT0A 4MH0E 1WE7A 3N32A 4MJSB 4TKNA 1WMHB 2HE7A 3EC8A 5CHVC 1OTRB 1KJTA 1OGWA 5C23A 2KDEB 2PE9A 3P2BA 4WWNA 1P9DU 2QHOA 4W9HA 1F9JA 2N1VA 4AOFA 4BKTA 3HM3A 1WGDA 4FA6A 3WA0A 3KYDD 3PZDA 2KMAA 2N7DA 3ML9A 4MDKE 5AZFA 1WYWB 1RLFA 1WGHA 2BYFA 5CHWA 2JZ3B 2W9NA 4XX5A 5D6JB 3IVFA 4EKUA 1L7YA 1NI2A 3ZTDA 2JXXA 4WWPA 3PS6A 4TUUA 1WX9A 2BWFA 1GJZA 3A9KB 4GSWA 2ZVNA 3VDZA 2CS4A 2Z0EB 4EOYA 4FHKA 2L0FA 4MEMA 4MM3A 1M94A 4LDTB 1YD8U 4HXDA 2KMCA 3DOWA 3DDCB 4NNJB 2N4FA 1P98A 2MQJA 3A9KA 4JLCA 1E8YA 4BBNF 3KUCB 1WGRA 2C60A 4IW0A 5BO4B 4GN1A 1PQSA 2MLBA 2CHZA 1V2YA 2O2VB 3OAWA 1VD2A 1P1AA 3JVZX 1GUAB 2KLGA 3H7SA 2WX0A 3AULA 4K7SA 2K25A 2R2QA 3DVGY 3ZDMC 2MBBB 1WM3A 3APFA 5TR5A 3APDA 2I1KA 4AP4C 4DK5A 3WIMA 4EEWA 3VH3B 1WY8A 1S1QB 4M8NA 2D3GA 1L2NA 2K8HA 4A20A 4A3PA 3SDLC 4RM8A 4EZLA 2N7EA 2RGFA 1AARA 4G3XB 2MBOA 4E71A 4HJKA 2KWVB 4PS3A 4W9EA 4HK2A 2KNBA 2R2OA 2LVPA 4BVUC 3Q3FA 3VUXA 2IBIB 1V49A 3T9LA 3V6CB 1S3SG 1ZGUB 5JHAA 1CMXB 1E7UA 2GMIC 2DX5B 2MA9B 2NS5A 2MWSB 3OJ4B 1V86A 1C3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QQ8 B;  2J0J A;  4FJY A;  2G3Q B;  4WJO A;  4NAW B;  1WR1 A;  2M17 A;  3ZDT A;  2NBU A;  2HD5 B;  2LWP A;  1UGM A;  2KO3 A;  3NZS A;  3M95 A;  1Y8R C;  3L08 A;  2C7N B;  2CHW A;  4RMA A;  2KOX A;  3NS8 A;  4DHZ E;  2LJ5 A;  1IP9 A;  3PRZ A;  4ZRJ A;  2ZZP B;  1WZ3 A;  4ANU A;  1ZKH A;  2L8J A;  3B1L X;  3ZO5 B;  3L16 A;  2ZEQ A;  1WJ4 A;  2LXC A;  4CHK A;  2JVC A;  4DDI D;  4HDO A;  5AEK B;  2BKR B;  3A9J A;  1UBI A;  2RSU A;  4FLH A;  2XK5 A;  4A3O A;  4ANV A;  3CF6 E;  3VUY A;  4IWP A;  5CHF A;  3QX1 A;  2J0K A;  2DHZ A;  2KFJ A;  2CU1 A;  3W1Y A;  2KTF A;  2D10 A;  3R7Q A;  2MP2 B;  2D2Q A;  2V1Y A;  3PTF C;  4ICV A;  3VFK A;  1KM7 A;  3KUZ A;  2NPT B;  1YX6 B;  4WJP A;  2KXJ A;  2WDT B;  4K81 A;  3ZKJ C;  2JZZ A;  3M63 B;  1XD3 B;  2N9E B;  3H1U A;  3H6N A;  2GOW A;  2UYZ B;  5JH5 C;  2K6D B;  2DAJ A;  3UQB A;  3DBL I;  2IY1 B;  4PS8 A;  4W9D A;  3I3T B;  2K1F A;  5DPW A;  3QA8 A;  1WH3 A;  4RM9 A;  3ZIM A;  2IYD B;  4NJ6 A;  2DYO A;  2AYO B;  2KFK A;  4K1R B;  5JZE B;  4FN2 A;  1RAX A;  4WAA A;  2GBN A;  3R66 C;  2DZJ A;  3LJ3 A;  3ALB A;  2Z59 B;  3PVL A;  1H4R A;  2M4N A;  4W9L A;  2EMT A;  1FXT B;  2JPH A;  3A33 B;  3JW0 X;  4GOC A;  4XC2 A;  4ANW A;  4TQ1 A;  2MBH A;  1OEY A;  2DZI A;  2LZ6 A;  4GU2 A;  5LLI A;  3PGE A;  2ZJD A;  3U8Z A;  4WWO A;  2NPT A;  2KN5 A;  3DVN U;  3Q3J A;  1OEY J;  2K8B A;  3VHT C;  1WJU A;  1KOT A;  4CYE A;  5C1Z A;  3JSV B;  4YL8 A;  3HIZ A;  3RT3 B;  2BF8 B;  3M3J A;  1GC6 A;  2JWZ A;  3ONS A;  2DEN B;  3ML8 A;  1R4M I;  2LAS A;  3CST A;  5LXI B;  1EF1 A;  1SE9 A;  1UBQ A;  2BKF A;  2G45 B;  2NBW B;  3AU5 A;  3X23 A;  1V5T A;  5JHB A;  1A5R A;  2DYM A;  4CO7 A;  2KHW B;  2MW5 A;  4KIK A;  4LJP B;  1V5O A;  3H7P B;  4IM2 A;  1GNU A;  2V3S A;  2KX3 A;  4GDL A;  4DBG A;  2REX A;  4ICU A;  4ZDV A;  2LD9 A;  1EUV B;  2ZPN A;  1Q0W B;  2FID A;  1Q5W B;  2KWU B;  3QIJ A;  4W9J A;  4KIK B;  3QWZ B;  1IPG A;  3ECI A;  5E6N A;  3LDZ E;  1K8R B;  1E8Z A;  3ENE A;  3KH0 A;  4PYZ A;  4AJY B;  5AZH A;  3PPA A;  2MSE D;  4IM0 A;  2LRU A;  2D07 B;  2MBQ A;  1U4A A;  3CSF A;  4DWF A;  4BOZ B;  4ANX A;  3IHP C;  3TCA A;  2FCQ A;  2YVC A;  3H9D A;  3EHV A;  2MRP A;  4HCN B;  4WJQ A;  1V9J A;  3AI5 A;  3RCZ A;  3RUI B;  1YX5 B;  2BYV E;  1V6E A;  4HPL B;  4JIO U;  4E74 A;  3W1S C;  3ZTC A;  3QJZ A;  3N3K B;  2BPS A;  3PHW B;  5CX3 A;  4GMV A;  3RZF A;  3SHQ A;  4IC7 B;  3TL5 A;  3AU4 A;  2JUO A;  2KC2 A;  3DVG X;  3O65 B;  2N1W A;  4OVU A;  2WWZ A;  4M0W B;  4EZJ A;  2D11 A;  4N9F 4;  3UIN B;  3PLV A;  2NCN A;  1ZW7 A;  2PPH A;  2KDI A;  3PT2 B;  1V81 A;  1VCB A;  3D32 A;  4IUM B;  2KQ7 A;  5J2R A;  2C5L C;  1WXV A;  4FHJ A;  4KSL C;  2LUE A;  4LDT D;  4PYU A;  3MJW A;  5IAA C;  3ZW3 A;  4GDK A;  1WRD B;  4W9I A;  4K7U A;  1NBF C;  4B9K A;  3KVF B;  4KDL B;  2WX1 A;  2L0T A;  3QCA A;  1Z2M A;  4W9G A;  3RD2 A;  3WAN A;  1OQY A;  3QC8 B;  3KYC D;  3UIO B;  2N9P C;  1UZX B;  2AWT A;  3B0A A;  3V61 A;  3UQA A;  5KHO A;  1WFY A;  3A4R A;  3OJ3 A;  1C1Y B;  1WGY A;  1UD7 A;  2OJR A;  3L54 A;  4MSQ B;  4MGK E;  5J18 A;  2YLM A;  2C7M B;  3BIN A;  3ZNH B;  2ZVO A;  3RUL A;  5EDS A;  4I6L B;  4ZRK A;  1E7V A;  1E8X A;  1P3Q U;  3V60 A;  2NBV B;  4F1S A;  4FAD A;  2HJ8 A;  2KZR A;  3VXW A;  4DDG D;  2B3A A;  2KQS A;  3JSV A;  5E6O A;  2ZCC A;  2FNJ B;  2MBE A;  2MP2 A;  4URK A;  3SU8 X;  5J17 A;  3K9O B;  5GMV A;  1TZ1 A;  2BYE A;  3NZU A;  2L05 A;  4GB9 A;  3VVW B;  2ASQ A;  1YQB A;  4WQO B;  2HTH A;  1E8W A;  3WAL A;  1P0R A;  4BBN C;  1GG3 A;  4ZYN A;  2J7Q B;  2KD0 A;  2AL3 A;  2DZK A;  1X1M A;  1TTN A;  3AXC A;  1WE6 A;  2LVO A;  1EO6 A;  3A4S C;  3L10 B;  4W9C A;  3WAM A;  1WR6 E;  5L95 C;  3JYU A;  1QZE A;  2LGX A;  1WZ0 A;  3QAQ A;  3DQV A;  1LFD A;  4II3 B;  1WI0 A;  3VTU A;  4EFO A;  4W9K A;  2KFK B;  1HE8 A;  2EMS A;  2AL6 A;  2L00 B;  1JRU A;  3EFU A;  1EF5 A;  3PLU A;  4WJN A;  2KC1 A;  4OVV A;  4F7Z A;  3KW5 B;  2XBB C;  5DPS A;  3IG3 A;  2IO2 B;  4AWJ A;  2KKC A;  3MHS D;  3VH4 B;  1D3Z A;  2NVU I;  3WAP A;  2LGD A;  4NPN A;  4M8M A;  1WJ6 A;  3QK0 A;  4DHZ B;  1MG8 A;  3C0R B;  2KJR A;  3S2A A;  2KVR A;  3UIP B;  2ZNV C;  1V80 A;  3APC A;  2M1M A;  3EEC A;  1WX8 A;  3HK0 A;  3NY5 A;  4KVG B;  4MGI E;  4TV3 A;  2J0M A;  2NR2 A;  2PEA A;  2C9W B;  3HHM A;  1ISN A;  2G4S A;  4NY0 A;  3TJP A;  1GC7 A;  2JT4 B;  2Y5B B;  1WXA A;  2GBK A;  3TIX A;  1XQQ A;  1RFA A;  2O2V A;  3SD5 A;  2VRR B;  5D2M B;  2IO1 B;  1LXD A;  3PRP B;  2KJH B;  2IZV B;  2KLC A;  5G2N A;  3T8M A;  3HM6 X;  2WYQ A;  4IM3 A;  5DPR A;  4FJV B;  4GDL B;  2LRW A;  2UWQ A;  3VUW A;  4HLE A;  4MSM B;  4NJ7 A;  2L3Z A;  4HCP B;  4NAW A;  1I35 A;  3L0W B;  5FR6 A;  5HKH A;  1J19 A;  3NOB A;  4EZK A;  2GBR A;  4JGH B;  4GGQ A;  4BKS A;  4II2 B;  5L83 A;  2KX0 A;  1T0Y A;  3QAR A;  1WJN A;  5E6P A;  4DHJ B;  4HPM B;  2Z0D B;  4F8C B;  2KAN A;  3DVN V;  3PRM B;  3GOE A;  3NHE B;  3PHX B;  2EKE C;  4NQL B;  1Z5S B;  3W1S A;  2KJ6 A;  4FJZ A;  2AEH A;  2RPQ A;  3ZNI D;  2DYB A;  2O6V A;  3PSE B;  2XEW A;  2LXA A;  3DCG A;  1H8C A;  3H7P A;  2O6V D;  4KSK C;  4KZ0 A;  4W9F A;  3ZUN A;  4BKG A;  3DBS A;  4MGY E;  4K7W A;  5LXH A;  1WXM A;  2FCN A;  1R4N I;  4ASW C;  3CMM B;  2KDB A;  3X0W A;  2O6V B;  3ZRF A;  4B6W A;  2I1J A;  4PS7 A;  4HWI B;  2FUH B;  5DPT A;  2LVQ A;  4BOS C;  2JF5 A;  3B08 A;  1TGZ B;  2RD0 A;  4KV2 A;  4TQ0 A;  2K8C A;  4XZ4 A;  4ZRI A;  3RZW C;  1LQB A;  4P7I A;  1WM2 A;  5CTR C;  4DHJ D;  3UGB B;  3TBL D;  5DCN A;  3U7D A;  2C7H A;  4B95 A;  2JRH A;  2L7R A;  3A9J B;  2A5U A;  3V62 A;  4GDK B;  4IG7 B;  2CHX A;  2IO3 B;  3ZNG C;  1WGG A;  3MTN B;  1RRB A;  3K9P B;  1NDD A;  4GIV A;  3RYT A;  4KZC A;  2M8S A;  2RR9 A;  4KDI C;  1WIA A;  2LGY A;  4GXB A;  4MEL A;  3VTW A;  4G11 A;  3DBH I;  3DBR I;  3R7R A;  3IFW B;  1J8C A;  2FCM A;  2KK8 A;  2BGF A;  1XT9 B;  4IWQ A;  4LJO B;  4G0N B;  2XK5 B;  2BWE S;  3N30 A;  3BY4 B;  1YIW A;  2M0X A;  2N9X A;  2PE6 B;  3PRE A;  3ZLZ A;  1G6J A;  2ZPY A;  2ZNV B;  2GBM A;  2KDF B;  1J0G A;  2JY6 A;  5D94 A;  2MX2 A;  3IBE A;  3L13 A;  3M62 B;  2K6Q A;  5AZG A;  3VAW A;  4AUQ C;  5KHQ A;  4JQW C;  4BKS D;  3A1Q B;  2FCS A;  2K39 A;  4NQK E;  4HVB A;  2KTR A;  3R3M A;  5D7G A;  4LCD E;  1Q1O A;  1IYF A;  1WXS A;  4X57 B;  3VQI A;  3QHT A;  3GZN I;  2GBJ A;  2DAF A;  1LM8 B;  5G55 A;  3V6E B;  4I6N B;  2V4L A;  2CR5 A;  4AJW A;  2KTR B;  2PJH A;  1SIF A;  1YJ1 A;  1E90 A;  2FAZ A;  2OOB B;  4MJS A;  2IY0 B;  4IWO A;  3ZVV A;  3DPD A;  4EUT A;  4E3C A;  3L17 A;  4MGZ E;  4FBJ B;  1SGH A;  4I6P A;  3WAO A;  3PV1 A;  1WF9 A;  2L76 A;  4DXA B;  2LI5 A;  2JRI B;  5IA7 A;  3U30 A;  1UEL A;  2G4D B;  1KLV A;  3ZNZ B;  4FUL A;  2IO0 B;  3OLM D;  4G50 A;  3ZRC A;  3TMP B;  4HDQ A;  3VTV A;  3A1Q A;  2MCN B;  2FIF A;  1WX7 A;  2DZM A;  1WMH A;  4J6I A;  3UF8 A;  1TBE A;  1E5W A;  1I42 A;  4JL9 A;  4BFR A;  2ZCB A;  2CKH B;  1UH6 A;  3KUD B;  2A4Z A;  2KWC A;  1BT0 A;  4MH0 E;  1WE7 A;  3N32 A;  4MJS B;  4TKN A;  1WMH B;  2HE7 A;  3EC8 A;  5CHV C;  1OTR B;  1KJT A;  1OGW A;  5C23 A;  2KDE B;  2PE9 A;  3P2B A;  4WWN A;  1P9D U;  2QHO A;  4W9H A;  1F9J A;  2N1V A;  4AOF A;  4BKT A;  3HM3 A;  1WGD A;  4FA6 A;  3WA0 A;  3KYD D;  3PZD A;  2KMA A;  2N7D A;  3ML9 A;  4MDK E;  5AZF A;  1WYW B;  1RLF A;  1WGH A;  2BYF A;  5CHW A;  2JZ3 B;  2W9N A;  4XX5 A;  5D6J B;  3IVF A;  4EKU A;  1L7Y A;  1NI2 A;  3ZTD A;  2JXX A;  4WWP A;  3PS6 A;  4TUU A;  1WX9 A;  2BWF A;  1GJZ A;  3A9K B;  4GSW A;  2ZVN A;  3VDZ A;  2CS4 A;  2Z0E B;  4EOY A;  4FHK A;  2L0F A;  4MEM A;  4MM3 A;  1M94 A;  4LDT B;  1YD8 U;  4HXD A;  2KMC A;  3DOW A;  3DDC B;  4NNJ B;  2N4F A;  1P98 A;  2MQJ A;  3A9K A;  4JLC A;  1E8Y A;  4BBN F;  3KUC B;  1WGR A;  2C60 A;  4IW0 A;  5BO4 B;  4GN1 A;  1PQS A;  2MLB A;  2CHZ A;  1V2Y A;  2O2V B;  3OAW A;  1VD2 A;  1P1A A;  3JVZ X;  1GUA B;  2KLG A;  3H7S A;  2WX0 A;  3AUL A;  4K7S A;  2K25 A;  2R2Q A;  3DVG Y;  3ZDM C;  2MBB B;  1WM3 A;  3APF A;  5TR5 A;  3APD A;  2I1K A;  4AP4 C;  4DK5 A;  3WIM A;  4EEW A;  3VH3 B;  1WY8 A;  1S1Q B;  4M8N A;  2D3G A;  1L2N A;  2K8H A;  4A20 A;  4A3P A;  3SDL C;  4RM8 A;  4EZL A;  2N7E A;  2RGF A;  1AAR A;  4G3X B;  2MBO A;  4E71 A;  4HJK A;  2KWV B;  4PS3 A;  4W9E A;  4HK2 A;  2KNB A;  2R2O A;  2LVP A;  4BVU C;  3Q3F A;  3VUX A;  2IBI B;  1V49 A;  3T9L A;  3V6C B;  1S3S G;  1ZGU B;  5JHA A;  1CMX B;  1E7U A;  2GMI C;  2DX5 B;  2MA9 B;  2NS5 A;  2MWS B;  3OJ4 B;  1V86 A;  1C3T A; 
#chains in the Genus database with same CATH topology
 3W9C B;  3QQ8 B;  4N59 A;  2M17 A;  2HD5 B;  1UWM A;  4NZL B;  1UGM A;  2WXI A;  3L08 A;  5BMH A;  3NS8 A;  2LJ5 A;  3AE7 B;  1CZP A;  3PRZ A;  4ZRJ A;  2ZZP B;  2WDV B;  4DDI D;  1GB1 A;  2NTT A;  1JW9 D;  5HHD G;  2JVC A;  4CHK A;  5AEK B;  2BKR B;  4N58 A;  2G9H D;  1QQR A;  4P1B C;  1UBI A;  4FLH A;  4ANV A;  2XK5 A;  1K53 A;  4DXG A;  5CHF A;  2J0K A;  2CU1 A;  1HEZ E;  1RYJ A;  2D10 A;  3R7Q A;  3NVW A;  2V1Y A;  4ICV A;  4WH4 A;  5C3J B;  2KXJ A;  2WDT B;  2D5G A;  4K81 A;  1HTO A;  1XD3 B;  2GOW A;  2IY1 B;  4C80 A;  4PS8 A;  5DPW A;  2K1F A;  2N9L A;  4RM9 A;  2IYD B;  4NJ6 A;  1IUE A;  1FPY A;  2W82 A;  3MC0 B;  4WAA A;  4QAY A;  3LJ3 A;  1CK1 A;  1SBB B;  2KAJ A;  3PVL A;  4P1C C;  2E3T A;  4OZC A;  2BW2 A;  1FXT B;  3A33 B;  4ANW A;  4TQ1 A;  2MBH A;  2LZ6 A;  4GU2 A;  3U8Z A;  4WWO A;  2NPT A;  1YOV B;  3Q3J A;  1OEY J;  4P16 A;  4YL8 A;  2BF8 B;  2XN9 C;  3M3J A;  2DEN B;  2WU2 B;  3ML8 A;  3CST A;  1UBQ A;  2BKF A;  2NBW B;  2V9H A;  3PZ8 A;  2WXJ A;  1V5O A;  4LJP B;  3TSS A;  2VH2 A;  4ZDV A;  2REX A;  1N62 A;  2LD9 A;  2FID A;  2KWU B;  3QIJ A;  3QWZ B;  1IPG A;  2QIE B;  5E6N A;  4S0R A;  3KH0 A;  2D07 B;  3GB1 A;  3CSF A;  1YN5 A;  2FCQ A;  2MRP A;  4WJQ A;  2WXK A;  3AI5 A;  3RCZ A;  3RNC C;  3QJZ A;  1J7B A;  3SHQ A;  3DVG X;  1WWT A;  4OVU A;  4EZJ A;  3TUO A;  5D3I B;  2NMQ A;  2J42 A;  2ONQ A;  2PPH A;  2KDI A;  5EE3 A;  2TSS A;  3P1M A;  3PT2 B;  1V81 A;  2W54 A;  1VCB A;  4IUM B;  2KQ7 A;  4RGT A;  1GPX A;  1NEN B;  2C5L C;  4PYU A;  3MJW A;  4JWS C;  1WRD B;  2L32 A;  4HKZ E;  2L52 A;  5LNK 1;  4N6E B;  4B9K A;  2WX1 A;  1SE4 A;  2L0T A;  4OZB A;  2JYT A;  1N5W A;  4W9G A;  4NAM A;  3WAN A;  1OQY A;  3AE5 B;  1UZX B;  3UQA A;  2AQ1 B;  1TS5 A;  1WFY A;  1CQV A;  1WGY A;  5J18 A;  2OJR A;  3TEW A;  1T0R C;  4Q2J A;  3U7Z A;  3ZNH B;  3MFG A;  2NBV B;  3NVY A;  2V0G A;  3JSV A;  1JWB D;  2MP2 A;  4DXF A;  2BYE A;  2L05 A;  2ZW1 A;  4GB9 A;  2ASQ A;  2IJ0 A;  2HTH A;  3KWL A;  1UUP A;  1X1M A;  2OED A;  3AXC A;  3N1X C;  2LVO A;  1WR6 E;  5AUK A;  2SAK A;  4AS1 A;  3AE1 B;  2AQ2 B;  2L00 B;  2JX5 A;  1JRU A;  4EE2 A;  4F7Z A;  2XBB C;  4LNF A;  2IO2 B;  2KKC A;  1OFF A;  1TS2 A;  1TS3 A;  3MHS D;  4OVZ A;  1AN8 A;  4LK0 M;  3V3X A;  2Q5W D;  1AWD A;  2ZNV C;  4KVG B;  3FIL A;  1SB3 C;  3APC A;  2PVO D;  1GAQ B;  1ENF A;  2AX5 A;  2GRI A;  3ABV B;  3LXF A;  4TSS A;  2O2V A;  1N6Z A;  1VLB A;  4KGS A;  5DPR A;  1MHX A;  3AE6 B;  1MI0 A;  2ACZ B;  3L0W B;  1J19 A;  4EZK A;  4JGH B;  5L83 A;  4D2K A;  1TS4 A;  3QAR A;  3DVN V;  3GOE A;  2FBW B;  3NHE B;  1QF6 A;  2WXF A;  4FJZ A;  1L0V B;  1GOZ A;  2QCZ A;  2O6V A;  5BYQ A;  2LXA A;  4BKG A;  1SE3 A;  3DBS A;  4MGY E;  4OW0 A;  1KH0 A;  1R4N I;  3CMM B;  3ZRF A;  4B6W A;  4PS7 A;  5DPT A;  1TGZ B;  1L6U A;  2K8C A;  4ZRI A;  1LQB A;  1WM2 A;  3W5U B;  1EU3 A;  2DBY A;  3U7D A;  3HRD D;  3A9J B;  3BII D;  3V62 A;  1V97 A;  3ZNG C;  1M4V A;  1L4Z B;  1MJD A;  1I4P A;  4KZC A;  2M8S A;  2INN E;  2WXN A;  4FXC A;  2RR9 A;  1VDV A;  1WIA A;  2B76 B;  3DBH I;  1XT9 B;  4LJO B;  4G0N B;  3N30 A;  2N9X A;  2PE6 B;  2GBM A;  2KDF B;  3VAW A;  3L13 A;  3Q8A A;  2K6Q A;  4ITK A;  1WGK A;  1XF5 L;  2K39 A;  1KLU D;  4RFB A;  1E6E B;  3R3M A;  1IYF A;  3MHZ A;  3B2F A;  3GZN I;  2GBJ A;  3URY A;  1I4H A;  1E90 A;  2WU5 B;  4MJS A;  4IWO A;  1MPE A;  4EUT A;  4E3C A;  3L17 A;  1V1P B;  5IP4 D;  2VZK B;  4I6P A;  1PDX A;  1SSN A;  1QLB B;  4DXA B;  2JRI B;  5IA7 A;  2IO0 B;  5MPO A;  4JPS A;  3U2S C;  1EU4 A;  1FM0 D;  2CU3 A;  1E5W A;  4ARC A;  3KUD B;  1DOX A;  4TKN A;  4MJS B;  1R4N B;  4BKT A;  1XLQ A;  3P2B A;  1FNV A;  2N1V A;  2LGS A;  5FKA C;  4MDK E;  1WYW B;  4XX5 A;  1NI2 A;  2JXX A;  2LEK A;  4WWP A;  1FIQ A;  1ZXI A;  2JXT A;  3VDZ A;  2VH1 A;  3Q3M C;  1YN4 A;  1ZE3 D;  4FHK A;  4XDD A;  4EOY A;  1DOY A;  4C7Z A;  2MQJ A;  1DOI A;  1E8Y A;  4BBN F;  1N60 A;  2MLB A;  1V2Y A;  3OAW A;  4L1B A;  3JVZ X;  3CIR B;  2K25 A;  1F2R I;  1WM3 A;  5TR5 A;  3BYT B;  4DK5 A;  1FCL A;  1RFK A;  1S1Q B;  2G1E A;  2D3G A;  1OQQ A;  1TKY A;  2N7E A;  4WWM A;  2RGF A;  4E71 A;  4PS3 A;  4USA A;  2KVZ A;  2R2O A;  2LVP A;  3R2T A;  3V6C B;  1V49 A;  1Q10 A;  2QMT A;  1E7U A;  4YT0 B;  4C00 A;  1JWS D;  2NS5 A;  2CJO A;  2IGG A;  1V86 A;  1UNS A;  2J0J A;  4FJY A;  1UWX A;  3IAM 1;  2NBU A;  3M95 A;  1ZP0 B;  1T5X D;  2CHW A;  1HZ5 A;  4DHZ E;  4L2Y A;  1ZKH A;  3L16 A;  2LXC A;  2RSU A;  3CF6 E;  3PO0 A;  1FRD A;  4IWP A;  4JX1 C;  1I4R A;  2KFJ A;  1TKG A;  4REZ A;  3PTF C;  1D6E C;  3EA6 A;  1STE A;  3KUZ A;  3Q8B A;  1E9M A;  2MJ3 A;  2NPT B;  1YX6 B;  1PGB A;  4RF0 A;  3M63 B;  1I7H A;  3H6N A;  2K6D B;  3I3T B;  2RMM A;  3ZIM A;  3VRA B;  3ZXV A;  1D5X C;  1JWU D;  1JML A;  5JZE B;  4FN2 A;  2RDB C;  2GBN A;  3R66 C;  2DZJ A;  2Z59 B;  2M4N A;  2JPH A;  3RI7 C;  1OEY A;  5LLI A;  2GB1 A;  2GLS A;  1AYF A;  1WJU A;  5C1Z A;  3N1Y C;  3JSV B;  3HIZ A;  3OG5 A;  2LFI A;  1R4M I;  1EF1 A;  1SE9 A;  1A5R A;  4KIK A;  3H7P B;  3U52 E;  4NJC A;  4IM2 A;  1D4B A;  1GNU A;  2V3S A;  2KX3 A;  4B0M A;  4DBG A;  4JE3 B;  2KAC A;  2WXM A;  4KGT A;  1Q5W B;  4W9J A;  4B0E A;  3ECI A;  3ENE A;  4AJY B;  2UU7 A;  4WIP A;  3PPA A;  3P4S B;  1U4A A;  1N5X A;  3EGR A;  1LO5 D;  4ANX A;  3NS1 A;  3H9D A;  3EHV A;  1V9J A;  2V3N A;  3I57 A;  5BMI A;  4GLS C;  1PFD A;  2BYV E;  4JIO U;  4E74 A;  2YEP F;  3W1S C;  3N3K B;  2MJE A;  4GMV A;  3TL5 A;  1BML C;  1IGD A;  3AU4 A;  2KC2 A;  4M0W B;  1NEK B;  1R7S A;  3UIN B;  2H89 B;  1QKZ A;  3VRB B;  1QOF A;  5J2R A;  4C56 C;  2K5P A;  5IAA C;  3GS2 A;  2PMV A;  4K7U A;  1NBF C;  5T8I A;  3BVZ A;  3QCA A;  3RD2 A;  2MJD A;  3QC8 B;  2KN4 A;  2N9P C;  5BYR A;  3R8B A;  3V61 A;  3OJ3 A;  3ZXR A;  3L54 A;  3DWM A;  4KKI A;  2C7M B;  3BIN A;  3AEF B;  2BS4 B;  3RFZ B;  5EDS A;  4I6L B;  1E7V A;  1E8X A;  1P7F A;  4KKJ A;  3V60 A;  2KZR A;  2B3A A;  2FNJ B;  2MBE A;  4URK A;  3P4P B;  2JSV X;  5J17 A;  3FAH A;  4UDU C;  1YQB A;  3FIL B;  1P0R A;  4OHJ A;  1GG3 A;  2AL3 A;  1RM6 C;  1YJJ A;  1V1P A;  1IBX B;  1QZE A;  3SFD B;  1WZ0 A;  3QAQ A;  4EFO A;  1FFV A;  3EFU A;  1EF5 A;  3PLU A;  2KC1 A;  4OVV A;  2YEP B;  5DPS A;  4RGM A;  1T0S C;  3VH4 B;  2BQQ A;  1YN3 A;  4M8M A;  3C0R B;  3UIP B;  2M1M A;  3EEC A;  1WX8 A;  3NY5 A;  2NR2 A;  2OHF A;  3VR8 B;  4NY0 A;  2JT4 B;  1NYR A;  1RFA A;  2VRR B;  2IO1 B;  3PRP B;  2KJH B;  2WXL A;  2IZV B;  3HM6 X;  2IND C;  1K51 A;  2WYQ A;  4IM3 A;  4FJV B;  2LRW A;  3VUW A;  4HLE A;  2NTS A;  2L3Z A;  4HCP B;  5HKH A;  3NOB A;  3W5V B;  2GBR A;  4BKS A;  2KX0 A;  4DHJ B;  3IT4 B;  2X38 A;  3ZJT A;  3W1S A;  4HRO A;  2AEH A;  3ZNI D;  2XNA C;  2XEW A;  3AEG B;  3H7P A;  3ZUN A;  3T3N A;  2E6X A;  2KDB A;  2BBC A;  2O6V B;  2I1J A;  2LVQ A;  2WGS A;  3B08 A;  3UI3 A;  1L0Y B;  2QIL A;  1FRR A;  3NZ3 A;  4P7I A;  1NYQ A;  4AQ7 A;  2C7H A;  3RNA C;  1HTQ A;  2A5U A;  4GDK B;  3SEB A;  2D3A A;  1L5P A;  1FO4 A;  3MTN B;  2PW9 A;  3K9P B;  4GIV A;  4HKQ A;  3RYT A;  1KFY B;  2LGY A;  2OJW A;  2QDF A;  2FCM A;  2KK8 A;  2JU6 X;  2BWE S;  3PRE A;  2D3B A;  2M0X A;  3ZLZ A;  1XLO A;  3RNE C;  4AUQ C;  4JQW C;  4BKS D;  3A1Q B;  5EE0 A;  1L0X B;  3N9Y C;  4LCD E;  1WXS A;  4RGO S;  4X57 B;  3VQI A;  1NI3 A;  3N20 C;  3Q8C A;  1LM8 B;  4A55 A;  4AJW A;  2LHE A;  4P6V F;  3HVZ A;  4HPP A;  3HVD A;  2MEK A;  3DBR B;  2IY0 B;  1WF9 A;  2L76 A;  1UEL A;  1JWM D;  2QJL A;  3TMP B;  4HDQ A;  1T3Q A;  3AV8 A;  1JQ4 A;  3AE3 B;  1V1O A;  2INP E;  4MM3 B;  4BFR A;  4ZHO A;  1UH6 A;  2A4Z A;  4MH0 E;  3N32 A;  3EC8 A;  1L4D B;  1OTR B;  1KJT A;  1PYW D;  3HM3 A;  3FKY A;  3C19 A;  4FA6 A;  3BVG A;  1SEB D;  3KYD D;  4IOI E;  1E0Z A;  2I38 A;  1YQ3 B;  1RLF A;  5CHW A;  2W9N A;  3Q3O C;  4EKU A;  2LMC A;  4ZYS A;  4OZA A;  4TUU A;  4C4V B;  1GJZ A;  3A9K B;  2ZVN A;  1QOB A;  2L0F A;  4MM3 A;  2KMC A;  1P98 A;  1SF0 A;  3A9K A;  4JLC A;  1WGR A;  2C60 A;  1PQS A;  3H7S A;  3APD A;  4AP4 C;  1TYG B;  3WIM A;  1TJE A;  2KWD A;  2PIA A;  1P7E A;  2JZP A;  4A6Q A;  4M01 A;  3ZJU A;  2M56 B;  1AAR A;  4G3X B;  2M19 A;  2N0S B;  3MC8 A;  4W9E A;  4HK2 A;  1T0Q C;  1S3S G;  1ZGU B;  3I63 C;  2GMI C;  4O1N A;  2DX5 B;  3MC9 A;  2MWS B;  2IGD A;  1C3T A;  4WJO A;  1ESF A;  2BB5 A;  4NAW B;  3ZDT A;  3NZS A;  1Y8R C;  2C7N B;  3AEA B;  4XDC A;  1WYG A;  1IP9 A;  4ANU A;  1WZ3 A;  3E56 A;  2L8J A;  1PUT A;  3ZO5 B;  2ZEQ A;  1WJ4 A;  4HDO A;  3AEC B;  1PGA A;  2IPK D;  3VUY A;  3QX1 A;  3B2G A;  1KTK A;  2KTF A;  2MP2 B;  3RN9 C;  1B1Z A;  3VFK A;  3TEX A;  1KM7 A;  2J52 A;  1C76 A;  2LUM A;  1WXQ A;  2N9E B;  3H1U A;  2UYZ B;  2KDM A;  2DAJ A;  3UQB A;  3DBL I;  4LTU A;  1XEE A;  2IDY A;  1WH3 A;  1TKE A;  2DYO A;  2KMM A;  2L83 A;  4K1R B;  4LLG M;  4MH8 A;  1FNW A;  3ZYY X;  4YTP B;  2V3P A;  4W9L A;  2EMT A;  4HJG E;  4WAF A;  4ZRP A;  3JW0 X;  4XC2 A;  2ZJD A;  2KN5 A;  3DVN U;  4CYE A;  3DWG C;  1GC6 A;  2JWZ A;  3ONS A;  2WLB A;  2LAS A;  2G45 B;  4HRS A;  2DYM A;  2MW5 A;  3N1Z C;  1UF0 A;  2WQY B;  1XO3 A;  2JWU A;  5BMG A;  3BWU D;  2ZPN A;  1VZ6 A;  1PGX A;  1E8Z A;  2MSE D;  1XLN A;  3NRZ A;  4XYC A;  1E7P B;  2LRU A;  3LYY A;  1N63 A;  5H8Y E;  4DWF A;  4BOZ B;  1ZOY B;  4BZA A;  3H8H A;  3TCA A;  3GP7 A;  3RUI B;  1ZPS A;  4HPL B;  2BPS A;  3PHW B;  4YTN B;  4IC7 B;  2INC C;  2N1W A;  4S17 A;  2D11 A;  1YMH E;  3T3O A;  3PLV A;  1EM7 A;  5HFY A;  2R61 A;  1DGJ A;  3D32 A;  4PK1 A;  4KX6 B;  4FHJ A;  4KSL C;  2LUE A;  5E6J A;  3ZW3 A;  2KYW A;  1A70 A;  1ZXH A;  3KVF B;  4KDL B;  3RMK C;  1WSP A;  3KYC D;  3B0A A;  5KHO A;  3A4R A;  3P4Q B;  2YLM A;  2K9X A;  2ZVO A;  1ZDV A;  3RUL A;  3B9J A;  4YXD B;  1P3Q U;  1KLG D;  3PZ7 A;  5E6O A;  2ZCC A;  3K9O B;  2PTL A;  3WAL A;  4BBN C;  4ZYN A;  1TTN A;  2BTE A;  2L1A A;  3L10 B;  5L95 C;  2LGX A;  2VZK D;  2RPV A;  3HUI A;  1LFD A;  4II3 B;  4W9K A;  2KFK B;  1HE8 A;  4WJN A;  5JHB A;  1SJH D;  1HXY D;  2DNF A;  2WS3 B;  1QOA A;  3IG3 A;  4AWJ A;  1D3Z A;  4JWU C;  2NVU I;  4A90 A;  2LGD A;  4NPN A;  1HZ6 A;  4DHZ B;  3QK0 A;  1MG8 A;  2IGH A;  3S2A A;  3W2D A;  4C4V A;  4MGZ E;  4KGR A;  1LGR A;  2WXP A;  3DBL B;  2WXQ A;  4TV3 A;  2J0M A;  1SJE D;  3Q8F A;  3HHM A;  1ISN A;  1XCT L;  3TJP A;  5H92 C;  1WXA A;  2GBK A;  2ZW0 A;  3TIX A;  1XQQ A;  2CJN A;  2WXG A;  1F1H A;  4XWT A;  4ZRQ A;  1F2R C;  2KLC A;  2H88 B;  5G2N A;  3SR6 A;  3T8M A;  2MH7 A;  4HEA 1;  1SE2 A;  2UWQ A;  4MSM B;  4NJ7 A;  1I35 A;  5FR6 A;  1L6V A;  4GGQ A;  3BYY B;  1T0Y A;  1ET9 A;  4HPM B;  2Z0D B;  5D3D A;  3PRM B;  3PHX B;  4NQL B;  2KJ6 A;  2RPQ A;  2DYB A;  3L4P A;  2QC8 A;  2GI9 A;  3O13 A;  1WXM A;  4ASW C;  3Q14 C;  3X0W A;  2FE8 A;  4US9 A;  4RCO A;  1MVK A;  5IO9 A;  4PT5 A;  2RD0 A;  2DWQ A;  4XZ4 A;  3RPF C;  3RZW C;  1MHH E;  1JAL A;  4DHJ D;  3TBL D;  5DCN A;  4B95 A;  2JRH A;  4IG7 B;  2Z8L A;  2LGI A;  1YJI A;  1ZUD 2;  4YSX B;  4KDI C;  4MEL A;  4XGA B;  4GXB A;  5AUI A;  4K3C A;  1JCK B;  1J8C A;  4LNN A;  2BGF A;  4IWQ A;  3FC4 A;  4ACF A;  3BY4 B;  1YIW A;  2Y5P A;  2ZPY A;  1J0G A;  1MFW A;  3IBE A;  3M62 B;  5KHQ A;  2W3S A;  1ZDX A;  2FCS A;  4HVB A;  2QEJ C;  5FK9 C;  2D3C A;  2KTR A;  4TMA B;  3AE8 B;  2BT6 A;  4ZHP A;  3ZJV A;  1E10 A;  5G55 A;  1VZ8 A;  2V4L A;  4I6N B;  1SIF A;  1BXT A;  3P63 A;  2OOB B;  3DBH B;  3U4E G;  3DPD A;  4FBJ B;  2Y3A A;  1JRO A;  4H2A A;  4YSZ B;  3PV1 A;  1QIL A;  3BK2 A;  3U30 A;  1I4Q A;  1EWC A;  2G4D B;  1KLV A;  4FUL A;  3SFE B;  2PLP A;  1T6B X;  3OLM D;  4G50 A;  3ZRC A;  3VTV A;  2AQ3 B;  1ET6 A;  2FIF A;  2MCN B;  2RDG A;  1K52 A;  1WMH A;  3UF8 A;  1I42 A;  4JL9 A;  2ZCB A;  1TY0 A;  1TIF A;  2HTM E;  1BT0 A;  3Q8E A;  1WE7 A;  1WMH B;  2QHO A;  4W9H A;  1KF6 B;  1WGD A;  5EE9 A;  3PZD A;  2KMA A;  2N7D A;  3ML9 A;  5AZF A;  2WDQ B;  1WGH A;  2JZ3 B;  3IVF A;  4YTM B;  3PS6 A;  1WX9 A;  1FMA D;  2MHJ A;  4GSW A;  3AE2 B;  2CS4 A;  2Z0E B;  1K50 A;  1GB4 A;  3ZQ4 A;  4K3B A;  3DOW A;  3DDC B;  2N4F A;  5BO4 B;  4GN1 A;  2O2V B;  1VD2 A;  4IKG A;  1GUA B;  4K7S A;  3DVG Y;  3ZDM C;  4R3D A;  3RNG C;  2WXR A;  2K0P A;  4EEW A;  1VZ7 A;  3BK1 A;  4A20 A;  4A3P A;  3SDL C;  4RM8 A;  5GXG B;  3BZD B;  4EZL A;  3R2I A;  3EUB 2;  4HJK A;  2KWV B;  4A9A A;  4C7Y A;  1HA5 A;  4BVU C;  3Q3F A;  3VUX A;  2IBI B;  3T9L A;  3NG0 A;  5JHA A;  1CMX B;  2WXH A;  2WNM A;  5IOI A;  3OJ4 B;  2G3Q B;  1FD6 A;  1WR1 A;  4J3O D;  2SEB D;  2LWP A;  2KO3 A;  1VJK A;  4RMA A;  2KOX A;  1F52 A;  5G5G A;  3I9V 1;  3B1L X;  3A9J A;  4A3O A;  3P4R B;  4RGN A;  2DHZ A;  3W1Y A;  3J9C A;  2D2Q A;  3DHI C;  3ETR A;  1SIJ A;  3DHG C;  3GE3 C;  4WJP A;  4YWG G;  3ZKJ C;  3MP9 A;  2JZZ A;  1QOG A;  5JH5 C;  2N9K A;  4W9D A;  3QA8 A;  2AYO B;  2KFK A;  1V8C A;  1C78 A;  3CWI A;  1J7A A;  1RAX A;  3ALB A;  1C9F A;  1NVI D;  1H4R A;  3IXS A;  4GOC A;  1FEH A;  4CQN A;  1YNT E;  2DZI A;  3PGE A;  1XXG A;  2K8B A;  3VHT C;  1KOT A;  2N7J A;  3BVM A;  3RT3 B;  1ROE A;  3IT6 B;  5LXI B;  1MG4 A;  3AU5 A;  2EKI A;  3X23 A;  4LNK A;  1J7C A;  1V5T A;  3TEZ A;  3AB5 A;  4CO7 A;  2KHW B;  5HI1 A;  4GDL A;  4ICU A;  1Y56 A;  1EUV B;  1Q0W B;  4KIK B;  1I4X A;  3TEY A;  3LDZ E;  1K8R B;  4PYZ A;  5AZH A;  4IM0 A;  3NJT A;  2MBQ A;  2LJI A;  3E9S A;  3IHP C;  2WDR B;  2YVC A;  4HCN B;  4MAC A;  2KT7 A;  1FCC C;  1YX5 B;  2RDH A;  1V6E A;  1C79 A;  1TZO A;  2K3U A;  3RNF C;  3ZTC A;  5CX3 A;  3RZF A;  5IN7 A;  3O65 B;  2JUO A;  2BS2 B;  2WWZ A;  4N9F 4;  3ZGZ A;  2NCN A;  1I4G A;  1ZW7 A;  3MJ5 A;  3AM9 A;  1XLP A;  2WP9 B;  1RWS A;  5C2T B;  1WXV A;  4LDT D;  4LNO A;  1VR9 A;  4GDK A;  1QT9 A;  4W9I A;  1Z2M A;  4WQM A;  3UIO B;  1SXT A;  3AH7 A;  2AWT A;  3KWV A;  1C1Y B;  1UD7 A;  4MSQ B;  4MGK E;  1BUI C;  1JRP A;  4ZRK A;  4FAD A;  4F1S A;  3WCQ A;  2HJ8 A;  3VXW A;  4DDG D;  2KQS A;  3SU8 X;  3Q69 A;  5GMV A;  1TZ1 A;  3NZU A;  2FUG 1;  3VVW B;  4WQO B;  3NUH B;  1E8W A;  3LB8 C;  2J7Q B;  2KD0 A;  2DZK A;  3DHH C;  3NVZ A;  2HJ1 A;  1WE6 A;  1EO6 A;  3A4S C;  3AEB B;  4W9C A;  3WAM A;  3JYU A;  2I2Y A;  3DQV A;  3P42 A;  3VTU A;  1WI0 A;  3AN1 A;  3VR9 B;  2EMS A;  2AL6 A;  2W55 A;  3KW5 B;  2J53 A;  4DQO C;  5JXV A;  2DLB A;  3NVV A;  3WAP A;  2EEL A;  1WJ6 A;  1VRA B;  2KJR A;  2KVR A;  1V80 A;  3HK0 A;  4RNA A;  2PVG C;  4MGI E;  1IBX A;  2PEA A;  2C9W B;  5BYS A;  2G4S A;  1GC7 A;  2Y5B B;  1CJE A;  2HDE A;  2V4I B;  3SD5 A;  5D2M B;  1LXD A;  1TT5 B;  1B9R A;  3AED B;  3Q2A C;  1C4C A;  3AMZ A;  4GDL B;  1WRI A;  1C77 A;  2BYT A;  2PKO A;  4NAW A;  1IGC A;  4II2 B;  2ON8 A;  5E6P A;  1WJN A;  4F8C B;  2KAN A;  5HG2 A;  1C4P A;  2EKE C;  1Z5S B;  3PSE B;  1F0Z A;  4MT5 A;  3DCG A;  1H8C A;  4KSK C;  2O6V D;  4KZ0 A;  4W9F A;  2X8X X;  4K7W A;  5LXH A;  2FCN A;  3AEE B;  1UGJ A;  3AE4 B;  4HWI B;  2FUH B;  4M02 A;  4BOS C;  2JF5 A;  1D5Z C;  1FNU A;  4KV2 A;  4TQ0 A;  3AE9 B;  5FR3 A;  5CTR C;  3UGB B;  2L7R A;  2CHX A;  2IO3 B;  2JYE A;  1WGG A;  1RRB A;  1NDD A;  4RH6 A;  5EE1 A;  3KLS X;  1N61 A;  3IAS 1;  1EWY C;  3VTW A;  4G11 A;  3DBR I;  3R7R A;  3IFW B;  2Y5C A;  2J4X A;  4L23 A;  4YSY B;  5G5H A;  2XK5 B;  2WHI A;  3GE8 C;  1KRH A;  1G6J A;  2ZNV B;  2JY6 A;  5D94 A;  1TY2 A;  2MX2 A;  2WXO A;  5AZG A;  1FXA A;  2ICI A;  2LHD A;  3OWE B;  4NQK E;  4A8X C;  5TSS A;  2KQ4 X;  2M0A A;  5D7G A;  1Q1O A;  3QHT A;  2DAF A;  3V6E B;  2CR5 A;  2KTR B;  2PJH A;  1AW7 A;  1YJ1 A;  3EFC A;  2FAZ A;  3ZVV A;  1SGH A;  3WAO A;  4ZOH C;  2QSD A;  2LI5 A;  3ZNZ B;  1YQ4 B;  2JQR B;  2BS3 B;  1D5M C;  4LNI A;  3A1Q A;  4RF1 A;  2W3R A;  3Q3N C;  1WX7 A;  2DZM A;  1DYQ A;  4J6I A;  1XCQ L;  1TBE A;  2CKH B;  2KWC A;  1OQR A;  5CHV C;  5IKC M;  3C8Y A;  2HE7 A;  1OGW A;  5C23 A;  2KDE B;  2PE9 A;  4WWN A;  1P9D U;  4AOF A;  1F9J A;  2BVC A;  3WA0 A;  3I5J C;  4BAX A;  3GZN B;  5D6J B;  2BYF A;  1JWA D;  1L7Y A;  3ZTD A;  1HQR D;  2K22 A;  4M00 A;  4IDI A;  2BWF A;  2BB6 A;  4MEM A;  4XE0 A;  3V05 A;  1M94 A;  1R4M B;  4LDT B;  1YD8 U;  4HXD A;  4NNJ B;  1FXI A;  5I4D A;  3KUC B;  4IW0 A;  2CHZ A;  4XWW A;  1P1A A;  1C4A A;  2KLG A;  2WX0 A;  3AUL A;  3KQ4 A;  2R2Q A;  2MBB B;  3APF A;  2I1K A;  3VH3 B;  1WY8 A;  4M8N A;  1L2N A;  4ARI A;  2K8H A;  3RNB C;  2MBO A;  1ACC A;  4M0W A;  2KNB A;  3Q6B A;  1FFU A;  4US8 A;  2MA9 B;  4WUR A;  1F77 A; 
#chains in the Genus database with same CATH homology
 3QQ8 B;  2J0J A;  4FJY A;  2G3Q B;  4WJO A;  4NAW B;  1WR1 A;  2M17 A;  3ZDT A;  2NBU A;  2HD5 B;  2LWP A;  1UGM A;  2KO3 A;  3NZS A;  3M95 A;  1Y8R C;  3L08 A;  2C7N B;  2CHW A;  4RMA A;  2KOX A;  3NS8 A;  4DHZ E;  2LJ5 A;  1IP9 A;  3PRZ A;  4ZRJ A;  2ZZP B;  1WZ3 A;  4ANU A;  1ZKH A;  2L8J A;  3B1L X;  3ZO5 B;  3L16 A;  2ZEQ A;  1WJ4 A;  2LXC A;  4CHK A;  2JVC A;  4DDI D;  4HDO A;  5AEK B;  2BKR B;  3A9J A;  1UBI A;  2RSU A;  4FLH A;  2XK5 A;  4A3O A;  4ANV A;  3CF6 E;  3VUY A;  4IWP A;  5CHF A;  3QX1 A;  2J0K A;  2DHZ A;  2KFJ A;  2CU1 A;  3W1Y A;  2KTF A;  2D10 A;  3R7Q A;  2MP2 B;  2D2Q A;  2V1Y A;  3PTF C;  4ICV A;  3VFK A;  1KM7 A;  3KUZ A;  2NPT B;  1YX6 B;  4WJP A;  2KXJ A;  2WDT B;  4K81 A;  3ZKJ C;  2JZZ A;  3M63 B;  1XD3 B;  2N9E B;  3H1U A;  3H6N A;  2GOW A;  2UYZ B;  5JH5 C;  2K6D B;  2DAJ A;  3UQB A;  3DBL I;  2IY1 B;  4PS8 A;  4W9D A;  3I3T B;  2K1F A;  5DPW A;  3QA8 A;  1WH3 A;  4RM9 A;  3ZIM A;  2IYD B;  4NJ6 A;  2DYO A;  2AYO B;  2KFK A;  4K1R B;  5JZE B;  4FN2 A;  1RAX A;  4WAA A;  2GBN A;  3R66 C;  2DZJ A;  3LJ3 A;  3ALB A;  2Z59 B;  3PVL A;  1H4R A;  2M4N A;  4W9L A;  2EMT A;  1FXT B;  2JPH A;  3A33 B;  3JW0 X;  4GOC A;  4XC2 A;  4ANW A;  4TQ1 A;  2MBH A;  1OEY A;  2DZI A;  2LZ6 A;  4GU2 A;  5LLI A;  3PGE A;  2ZJD A;  3U8Z A;  4WWO A;  2NPT A;  2KN5 A;  3DVN U;  3Q3J A;  1OEY J;  2K8B A;  3VHT C;  1WJU A;  1KOT A;  4CYE A;  5C1Z A;  3JSV B;  4YL8 A;  3HIZ A;  3RT3 B;  2BF8 B;  3M3J A;  1GC6 A;  2JWZ A;  3ONS A;  2DEN B;  3ML8 A;  1R4M I;  2LAS A;  3CST A;  5LXI B;  1EF1 A;  1SE9 A;  1UBQ A;  2BKF A;  2G45 B;  2NBW B;  3AU5 A;  3X23 A;  1V5T A;  5JHB A;  1A5R A;  2DYM A;  4CO7 A;  2KHW B;  2MW5 A;  4KIK A;  4LJP B;  1V5O A;  3H7P B;  4IM2 A;  1GNU A;  2V3S A;  2KX3 A;  4GDL A;  4DBG A;  2REX A;  4ICU A;  4ZDV A;  2LD9 A;  1EUV B;  2ZPN A;  1Q0W B;  2FID A;  1Q5W B;  2KWU B;  3QIJ A;  4W9J A;  4KIK B;  3QWZ B;  1IPG A;  3ECI A;  5E6N A;  3LDZ E;  1K8R B;  1E8Z A;  3ENE A;  3KH0 A;  4PYZ A;  4AJY B;  5AZH A;  3PPA A;  2MSE D;  4IM0 A;  2LRU A;  2D07 B;  2MBQ A;  1U4A A;  3CSF A;  4DWF A;  4BOZ B;  4ANX A;  3IHP C;  3TCA A;  2FCQ A;  2YVC A;  3H9D A;  3EHV A;  2MRP A;  4HCN B;  4WJQ A;  1V9J A;  3AI5 A;  3RCZ A;  3RUI B;  1YX5 B;  2BYV E;  1V6E A;  4HPL B;  4JIO U;  4E74 A;  3W1S C;  3ZTC A;  3QJZ A;  3N3K B;  2BPS A;  3PHW B;  5CX3 A;  4GMV A;  3RZF A;  3SHQ A;  4IC7 B;  3TL5 A;  3AU4 A;  2JUO A;  2KC2 A;  3DVG X;  3O65 B;  2N1W A;  4OVU A;  2WWZ A;  4M0W B;  4EZJ A;  2D11 A;  4N9F 4;  3UIN B;  3PLV A;  2NCN A;  1ZW7 A;  2PPH A;  2KDI A;  3PT2 B;  1V81 A;  1VCB A;  3D32 A;  4IUM B;  2KQ7 A;  5J2R A;  2C5L C;  1WXV A;  4FHJ A;  4KSL C;  2LUE A;  4LDT D;  4PYU A;  3MJW A;  5IAA C;  3ZW3 A;  4GDK A;  1WRD B;  4W9I A;  4K7U A;  1NBF C;  4B9K A;  3KVF B;  4KDL B;  2WX1 A;  2L0T A;  3QCA A;  1Z2M A;  4W9G A;  3RD2 A;  3WAN A;  1OQY A;  3QC8 B;  3KYC D;  3UIO B;  2N9P C;  1UZX B;  2AWT A;  3B0A A;  3V61 A;  3UQA A;  5KHO A;  1WFY A;  3A4R A;  3OJ3 A;  1C1Y B;  1WGY A;  1UD7 A;  2OJR A;  3L54 A;  4MSQ B;  4MGK E;  5J18 A;  2YLM A;  2C7M B;  3BIN A;  3ZNH B;  2ZVO A;  3RUL A;  5EDS A;  4I6L B;  4ZRK A;  1E7V A;  1E8X A;  1P3Q U;  3V60 A;  2NBV B;  4F1S A;  4FAD A;  2HJ8 A;  2KZR A;  3VXW A;  4DDG D;  2B3A A;  2KQS A;  3JSV A;  5E6O A;  2ZCC A;  2FNJ B;  2MBE A;  2MP2 A;  4URK A;  3SU8 X;  5J17 A;  3K9O B;  5GMV A;  1TZ1 A;  2BYE A;  3NZU A;  2L05 A;  4GB9 A;  3VVW B;  2ASQ A;  1YQB A;  4WQO B;  2HTH A;  1E8W A;  3WAL A;  1P0R A;  4BBN C;  1GG3 A;  4ZYN A;  2J7Q B;  2KD0 A;  2AL3 A;  2DZK A;  1X1M A;  1TTN A;  3AXC A;  1WE6 A;  2LVO A;  1EO6 A;  3A4S C;  3L10 B;  4W9C A;  3WAM A;  1WR6 E;  5L95 C;  3JYU A;  1QZE A;  2LGX A;  1WZ0 A;  3QAQ A;  3DQV A;  1LFD A;  4II3 B;  1WI0 A;  3VTU A;  4EFO A;  4W9K A;  2KFK B;  1HE8 A;  2EMS A;  2AL6 A;  2L00 B;  1JRU A;  3EFU A;  1EF5 A;  3PLU A;  4WJN A;  2KC1 A;  4OVV A;  4F7Z A;  3KW5 B;  2XBB C;  5DPS A;  3IG3 A;  2IO2 B;  4AWJ A;  2KKC A;  3MHS D;  3VH4 B;  1D3Z A;  2NVU I;  3WAP A;  2LGD A;  4NPN A;  4M8M A;  1WJ6 A;  3QK0 A;  4DHZ B;  1MG8 A;  3C0R B;  2KJR A;  3S2A A;  2KVR A;  3UIP B;  2ZNV C;  1V80 A;  3APC A;  2M1M A;  3EEC A;  1WX8 A;  3HK0 A;  3NY5 A;  4KVG B;  4MGI E;  4TV3 A;  2J0M A;  2NR2 A;  2PEA A;  2C9W B;  3HHM A;  1ISN A;  2G4S A;  4NY0 A;  3TJP A;  1GC7 A;  2JT4 B;  2Y5B B;  1WXA A;  2GBK A;  3TIX A;  1XQQ A;  1RFA A;  2O2V A;  3SD5 A;  2VRR B;  5D2M B;  2IO1 B;  1LXD A;  3PRP B;  2KJH B;  2IZV B;  2KLC A;  5G2N A;  3T8M A;  3HM6 X;  2WYQ A;  4IM3 A;  5DPR A;  4FJV B;  4GDL B;  2LRW A;  2UWQ A;  3VUW A;  4HLE A;  4MSM B;  4NJ7 A;  2L3Z A;  4HCP B;  4NAW A;  1I35 A;  3L0W B;  5FR6 A;  5HKH A;  1J19 A;  3NOB A;  4EZK A;  2GBR A;  4JGH B;  4GGQ A;  4BKS A;  4II2 B;  5L83 A;  2KX0 A;  1T0Y A;  3QAR A;  1WJN A;  5E6P A;  4DHJ B;  4HPM B;  2Z0D B;  4F8C B;  2KAN A;  3DVN V;  3PRM B;  3GOE A;  3NHE B;  3PHX B;  2EKE C;  4NQL B;  1Z5S B;  3W1S A;  2KJ6 A;  4FJZ A;  2AEH A;  2RPQ A;  3ZNI D;  2DYB A;  2O6V A;  3PSE B;  2XEW A;  2LXA A;  3DCG A;  1H8C A;  3H7P A;  2O6V D;  4KSK C;  4KZ0 A;  4W9F A;  3ZUN A;  4BKG A;  3DBS A;  4MGY E;  4K7W A;  5LXH A;  1WXM A;  2FCN A;  1R4N I;  4ASW C;  3CMM B;  2KDB A;  3X0W A;  2O6V B;  3ZRF A;  4B6W A;  2I1J A;  4PS7 A;  4HWI B;  2FUH B;  5DPT A;  2LVQ A;  4BOS C;  2JF5 A;  3B08 A;  1TGZ B;  2RD0 A;  4KV2 A;  4TQ0 A;  2K8C A;  4XZ4 A;  4ZRI A;  3RZW C;  1LQB A;  4P7I A;  1WM2 A;  5CTR C;  4DHJ D;  3UGB B;  3TBL D;  5DCN A;  3U7D A;  2C7H A;  4B95 A;  2JRH A;  2L7R A;  3A9J B;  2A5U A;  3V62 A;  4GDK B;  4IG7 B;  2CHX A;  2IO3 B;  3ZNG C;  1WGG A;  3MTN B;  1RRB A;  3K9P B;  1NDD A;  4GIV A;  3RYT A;  4KZC A;  2M8S A;  2RR9 A;  4KDI C;  1WIA A;  2LGY A;  4GXB A;  4MEL A;  3VTW A;  4G11 A;  3DBH I;  3DBR I;  3R7R A;  3IFW B;  1J8C A;  2FCM A;  2KK8 A;  2BGF A;  1XT9 B;  4IWQ A;  4LJO B;  4G0N B;  2XK5 B;  2BWE S;  3N30 A;  3BY4 B;  1YIW A;  2M0X A;  2N9X A;  2PE6 B;  3PRE A;  3ZLZ A;  1G6J A;  2ZPY A;  2ZNV B;  2GBM A;  2KDF B;  1J0G A;  2JY6 A;  5D94 A;  2MX2 A;  3IBE A;  3L13 A;  3M62 B;  2K6Q A;  5AZG A;  3VAW A;  4AUQ C;  5KHQ A;  4JQW C;  4BKS D;  3A1Q B;  2FCS A;  2K39 A;  4NQK E;  4HVB A;  2KTR A;  3R3M A;  5D7G A;  4LCD E;  1Q1O A;  1IYF A;  1WXS A;  4X57 B;  3VQI A;  3QHT A;  3GZN I;  2GBJ A;  2DAF A;  1LM8 B;  5G55 A;  3V6E B;  4I6N B;  2V4L A;  2CR5 A;  4AJW A;  2KTR B;  2PJH A;  1SIF A;  1YJ1 A;  1E90 A;  2FAZ A;  2OOB B;  4MJS A;  2IY0 B;  4IWO A;  3ZVV A;  3DPD A;  4EUT A;  4E3C A;  3L17 A;  4MGZ E;  4FBJ B;  1SGH A;  4I6P A;  3WAO A;  3PV1 A;  1WF9 A;  2L76 A;  4DXA B;  2LI5 A;  2JRI B;  5IA7 A;  3U30 A;  1UEL A;  2G4D B;  1KLV A;  3ZNZ B;  4FUL A;  2IO0 B;  3OLM D;  4G50 A;  3ZRC A;  3TMP B;  4HDQ A;  3VTV A;  3A1Q A;  2MCN B;  2FIF A;  1WX7 A;  2DZM A;  1WMH A;  4J6I A;  3UF8 A;  1TBE A;  1E5W A;  1I42 A;  4JL9 A;  4BFR A;  2ZCB A;  2CKH B;  1UH6 A;  3KUD B;  2A4Z A;  2KWC A;  1BT0 A;  4MH0 E;  1WE7 A;  3N32 A;  4MJS B;  4TKN A;  1WMH B;  2HE7 A;  3EC8 A;  5CHV C;  1OTR B;  1KJT A;  1OGW A;  5C23 A;  2KDE B;  2PE9 A;  3P2B A;  4WWN A;  1P9D U;  2QHO A;  4W9H A;  1F9J A;  2N1V A;  4AOF A;  4BKT A;  3HM3 A;  1WGD A;  4FA6 A;  3WA0 A;  3KYD D;  3PZD A;  2KMA A;  2N7D A;  3ML9 A;  4MDK E;  5AZF A;  1WYW B;  1RLF A;  1WGH A;  2BYF A;  5CHW A;  2JZ3 B;  2W9N A;  4XX5 A;  5D6J B;  3IVF A;  4EKU A;  1L7Y A;  1NI2 A;  3ZTD A;  2JXX A;  4WWP A;  3PS6 A;  4TUU A;  1WX9 A;  2BWF A;  1GJZ A;  3A9K B;  4GSW A;  2ZVN A;  3VDZ A;  2CS4 A;  2Z0E B;  4EOY A;  4FHK A;  2L0F A;  4MEM A;  4MM3 A;  1M94 A;  4LDT B;  1YD8 U;  4HXD A;  2KMC A;  3DOW A;  3DDC B;  4NNJ B;  2N4F A;  1P98 A;  2MQJ A;  3A9K A;  4JLC A;  1E8Y A;  4BBN F;  3KUC B;  1WGR A;  2C60 A;  4IW0 A;  5BO4 B;  4GN1 A;  1PQS A;  2MLB A;  2CHZ A;  1V2Y A;  2O2V B;  3OAW A;  1VD2 A;  1P1A A;  3JVZ X;  1GUA B;  2KLG A;  3H7S A;  2WX0 A;  3AUL A;  4K7S A;  2K25 A;  2R2Q A;  3DVG Y;  3ZDM C;  2MBB B;  1WM3 A;  3APF A;  5TR5 A;  3APD A;  2I1K A;  4AP4 C;  4DK5 A;  3WIM A;  4EEW A;  3VH3 B;  1WY8 A;  1S1Q B;  4M8N A;  2D3G A;  1L2N A;  2K8H A;  4A20 A;  4A3P A;  3SDL C;  4RM8 A;  4EZL A;  2N7E A;  2RGF A;  1AAR A;  4G3X B;  2MBO A;  4E71 A;  4HJK A;  2KWV B;  4PS3 A;  4W9E A;  4HK2 A;  2KNB A;  2R2O A;  2LVP A;  4BVU C;  3Q3F A;  3VUX A;  2IBI B;  1V49 A;  3T9L A;  3V6C B;  1S3S G;  1ZGU B;  5JHA A;  1CMX B;  1E7U A;  2GMI C;  2DX5 B;  2MA9 B;  2NS5 A;  2MWS B;  3OJ4 B;  1V86 A;  1C3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...