1FM0D

Molybdopterin synthase (moad/moae)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
81
structure length
81
Chain Sequence
MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MOLYBDOPTERIN CONVERTING FACTOR, SUBUNIT 1
publication title Crystal structure of molybdopterin synthase and its evolutionary relationship to ubiquitin activation.
pubmed doi rcsb
source organism Escherichia coli
total genus 23
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2000-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fm0D00
1YQ4B 4N59A 1ZUD2 2BS3B 2L83A 3AE2B 1A70A 3AMZA 4IDIA 5H92C 2KAJA 1L0VB 2AX5A 3PO0A 1FFUA 2WDVB 1FRRA 2WDRB 2WLBA 1FXIA 1RYJA 4HROA 3HUIA 3AECB 4WWMA 5EE9A 4A9AA 5C2TB 1TKGA 3AN1A 1PUTA 1ZP0B 5GXGB 3ABVB 5G5GA 1SIJA 2FBWB 3NVZA 1E7PB 1N5WA 1WGKA 1VLBA 2WDQB 3W5UB 2MJ3A 4JX1C 4N58A 4C7YA 4ZHOA 3AV8A 1R7SA 2QIEB 4USAA 3CIRB 1QF6A 1KRHA 3AEGB 1N60A 4YSYB 1AWDA 1ZOYB 1JRPA 2PKOA 4YTMB 4JWSC 1JQ4A 2EKIA 3NVYA 2BS2B 3NS1A 4JWUC 3EUB2 4ZOHC 1FM0D 1J7AA 4WQMA 3VRBB 2JX5A 3HVZA 3P4PB 5AUIA 1VDVA 2W55A 1NYRA 3W9CB 2MH7A 3AE7B 1DOIA 1WWTA 2L52A 4LTUA 1GPXA 2WS3B 1WYGA 1FMAD 1TJEA 2N0SB 2B76B 2M19A 3NRZA 1ROEA 1JALA 1NENB 3AE8B 2E3TA 4US8A 4YTPB 1AYFA 1E6EB 1XO3A 4ZHPA 1E10A 5EE1A 2H89B 1L6VA 1NVID 1TKYA 1OQRA 2PVGC 1JWBD 1RFKA 1N61A 1YJIA 3AEAB 3P4SB 1FRDA 1JW9D 1N63A 1DOXA 1QT9A 3AH7A 4FXCA 1N5XA 1SF0A 1GAQB 1NYQA 1WRIA 3AM9A 2DWQA 2K9XA 4US9A 4YSZB 2BT6A 3BIID 1XLQA 1L5PA 1V8CA 1ZXIA 1PFDA 3AEDB 2WP9B 1WXQA 2JQRB 3P1MA 3P63A 4P6VF 3SFEB 1J7BA 1FO4A 3AE3B 4YTNB 1XLPA 3AEFB 3SFDB 3VRAB 3AE5B 3P4RB 1FIQA 3L4PA 2H88B 1TKEA 3P4QB 1B9RA 2K5PA 2W54A 1NEKB 3LXFA 2WQYB 5EE3A 1VJKA 2WU2B 4YT0B 1YJJA 1QOBA 1CZPA 1SB3C 5MPOA 1F0ZA 2HTME 1CJEA 3NVWA 1QOAA 1TYGB 2PVOD 1FXAA 1I7HA 3B2GA 1DGJA 2QJLA 1N62A 2PIAA 4HRSA 5AUKA 5H8YE 1E9MA 3RPFC 2DBYA 3AB5A 3W5VB 4C7ZA 3ZYYX 4C80A 4YXDB 1QOFA 3B9JA 3B2FA 5C3JB 3LB8C 1RM6C 2W3RA 2WU5B 3AE4B 3VR8B 3DWMA 3AE1B 2CU3A 2OHFA 1XLNA 2ACZB 3WCQA 1UWMA 1KFYB 1J7CA 2W3SA 1EWYC 1IUEA 1T3QA 2MJDA 3FAHA 1NI3A 3NVVA 3AEEB 4N6EB 2G1EA 5EE0A 3FC4A 1OQQA 2MJEA 1DOYA 2KMMA 1V97A 3AEBB 4ITKA 1KF6B 2Q5WD 2LEKA 1JROA 4YSXB 3HRDD 3KWLA 1RWSA 3DWGC 3VR9B 1L6UA 2CJOA 1OFFA 1XLOA 1YQ3B 1PDXA 4KX6B 1JWAD 1FFVA 3AE9B 2M56B 3ETRA 2K22A 2Y5CA 3SR6A 2BS4B 3CWIA 2CJNA 3AE6B 1E0ZA 5G5HA 1QOGA 1QLBB
chains in the Genus database with same CATH superfamily
2OJWA 1KM7A 2QHOA 4RFBA 2WDVB 5BMGA 2ONQA 3HUIA 4FLHA 2N7DA 1WZ3A 3I9V1 3OAWA 4DDGD 2L3ZA 3H7PA 5G5GA 3HM3A 1E7PB 1STEA 3Q8BA 5CHVC 3IAM1 3U52E 1R7SA 4B95A 4C56C 4YSYB 2SAKA 3BYTB 3EUB2 1WY8A 2JVCA 1P7EA 3HVZA 2W55A 1UF0A 1WX9A 3TEYA 1UD7A 3ML8A 4KKIA 3ECIA 5IO9A 3SD5A 1WMHB 1L7YA 4AJWA 2V0GA 3KUCB 3OG5A 4WH4A 1WR6E 3UQAA 2NCNA 2WXOA 4IG7B 4HXDA 4R3DA 4OHJA 2WXIA 2FAZA 4I6LB 3TIXA 3EFCA 4YTNB 1XLPA 1WIAA 2GBMA 1IBXB 2D07B 2ZNVB 3JYUA 2ZCBA 5FR3A 1ZPSA 4A90A 1K8RB 2CHXA 2RMMA 3LDZE 2JRIB 1DGJA 2UWQA 1PGBA 1DYQA 2J7QB 3AB5A 4B0MA 2L8JA 3B2FA 2LGYA 2WU5B 3DWMA 2CU3A 2RDBC 2ZEQA 5IOIA 4JGHB 4ICVA 3NVVA 1WGHA 2D2QA 3PZDA 3M3JA 1A5RA 1P98A 1HXYD 2KWCA 1VD2A 4IOIE 4BVUC 5AEKB 2PW9A 1JWAD 1FFVA 2Y5CA 2L00B 1QOGA 1FXTB 1C1YB 1D5XC 2L76A 1S1QB 5H92C 4ZYNA 1P3QU 5FKAC 3VH3B 4MSMB 4FULA 4OZCA 2KTRB 1JMLA 3ABVB 4AS1A 3IT4B 2FBWB 4ZYSA 2BYFA 4NJ7A 4MGYE 1TT5B 2NBWB 4LNIA 2QIEB 2X8XX 3AI5A 3CSTA 5G55A 2INNE 3MC0B 2MHJA 2ZVNA 2RPQA 1WE7A 3I5JC 1V1OA 1UBIA 4PS7A 4TMAB 4BKSA 2Z0DB 3MHZA 4MDKE 2MH7A 2W9NA 2L52A 4GIVA 5CTRC 2KDMA 4WJNA 1JWUD 2LVQA 2KQ4X 1RAXA 4YTPB 2LVPA 4PYUA 3UI3A 4W9FA 5HI1A 3QHTA 4XZ4A 4FADA 3MFGA 1XCTL 3FKYA 1XXGA 5DPTA 4BBNC 2KN5A 1Q5WB 4W9LA 3AEFB 4IM2A 2BQQA 1FIQA 3P4QB 1ZW7A 2H88B 4MGZE 4ARIA 1LO5D 2WU2B 1YJJA 2V3PA 1KLGD 5MPOA 2HTHA 5HFYA 1TYGB 2KDEB 3FILB 2Z8LA 4CQNA 1I7HA 3L16A 1GJZA 3BZDB 3RFZB 2NPTB 4YXDB 1QOFA 2KOXA 3LB8C 1UGJA 2WXRA 4LDTB 3JSVB 3P42A 3JVZX 2DHZA 3EFUA 3C0RB 2AYOB 4JQWC 4ARCA 3R7QA 1WMHA 1DOYA 2HE7A 1T0RC 2AEHA 2MP2B 1SIFA 2QEJC 2QSDA 3ZDMC 1L6UA 2AL3A 3PV1A 3IT6B 4K81A 4BKGA 4RCOA 2C9WB 3AE2B 1IBXA 4MM3B 1RYJA 1FNVA 2M0AA 5IN7A 1TY0A 2ZJDA 1PUTA 1M4VA 4DHJD 3DVGX 3ZDTA 4JLCA 2KDFB 4P16A 2BYVE 2JZZA 1ZOYB 4JWSC 1V80A 4F7ZA 4ANXA 2A5UA 4ZOHC 4WJQA 4II2B 1FM0D 4FHJA 1CMXB 3APDA 4XDDA 3VFKA 4P7IA 1XQQA 4FBJB 3A9KB 2KDIA 1Y56A 2H89B 1EUVB 4KIKB 1JCKB 1JW9D 4WIPA 4K7UA 4JIOU 4US9A 2JZPA 4P6VF 3ML9A 1WXQA 3DHHC 2KTRA 1TS2A 2G4SA 1TKEA 1V9JA 3WIMA 3N30A 2VRRB 3KVFB 2DAJA 4MACA 2D3GA 1SE3A 4MSQB 1XCQL 5TR5A 1E7UA 2EMTA 3B9JA 1WJUA 1L4DB 2KQSA 2KWUB 1V86A 2VZKD 3L17A 2N1WA 4WJOA 2MJDA 4TQ0A 2G1EA 2LZ6A 4ITKA 4GN1A 1I4QA 5AZGA 5I4DA 2BPSA 1XF5L 1XLOA 4ACFA 1QQRA 2M56B 2WXFA 2EKEC 1SGHA 2BVCA 1RRBA 1A70A 1EF5A 2RGFA 3GZNI 2C60A 3AECB 1GG3A 3W1YA 2JXXA 5E6PA 3KLSX 3FILA 4LJOB 2DAFA 3W5UB 1OQYA 1ZKHA 2KC2A 2NPTA 5FK9C 1C4PA 4RGTA 3RNGC 2PKOA 2KYWA 2KNBA 3Q69A 2K8CA 2KXJA 3JSVA 3ENEA 2IPKD 1P7FA 2L0FA 4CYEA 3T3OA 3L0WB 3HIZA 2NS5A 1C4CA 3V05A 1I4PA 2JXTA 1NENB 1TGZB 2MP2A 3MJWA 1UELA 3PZ8A 3D32A 1Q1OA 4BAXA 1J0GA 4NPNA 4MM3A 5AZHA 1F9JA 2RR9A 3RNEC 3DQVA 4G50A 4DBGA 2N9KA 5EE3A 4IW0A 4J3OD 1C79A 2MQJA 3NJTA 4NJCA 4FA6A 3WA0A 3VUWA 2OJRA 2XBBC 4RH6A 5AUKA 1B9RA 1TZ1A 3ZUNA 3PRPB 3TEWA 3ZXRA 1GB4A 3RCZA 2JRHA 2UU7A 1S3SG 1UZXB 3A9KA 2MJEA 3L10B 1YN4A 3TEXA 4I6PA 2LWPA 2N4FA 4KGRA 2GRIA 4B9KA 3W1SA 4XGAB 2CKHB 5DPRA 4DQOC 1E0ZA 3N1XC 4GXBA 3R8BA 5FR6A 1FRRA 2LVOA 2XNAC 4WWMA 2CU1A 2EMSA 2Y5PA 4RGMA 4NQLB 1E8XA 4W9CA 4W9GA 2IY1B 4K1RB 3BVZA 3KYDD 4C4VB 2R2QA 1KTKA 3ZRFA 2D3BA 2BGFA 3NZSA 3A9JB 4EZLA 1GPXA 3BWUD 3PLUA 1P0RA 2ZCCA 2FCMA 1XT9B 5D2MB 3A33B 3EGRA 4WWPA 2B3AA 1JWSD 5BO4B 4RGNA 1JWBD 1RFKA 3CMMB 1MG8A 3B1LX 3O13A 4TUUA 3V3XA 2K9XA 1IGCA 3RMKC 3U30A 3AE5B 3IBEA 1VCBA 2XEWA 4EUTA 3Q8AA 4L23A 2WXLA 1MPEA 2I2YA 1CZPA 1QOAA 2FIDA 4CHKA 3KUDB 4A20A 5T8IA 2G9HD 2IO0B 1HQRD 1YX5B 1J7CA 1D5MC 3VDZA 1V97A 2LI5A 2PLPA 2Z59B 3DPDA 3GE8C 4YSXB 5BYSA 4W9JA 3DWGC 3VR9B 2J4XA 3V62A 3RNCC 3NG0A 2CJNA 2JSVX 2K39A 2MRPA 2N9PC 3MP9A 4GGQA 2PE6B 2WLBA 4XWWA 1TKGA 1P1AA 1C9FA 2BWES 3RNBC 2O2VB 4HDQA 2KWVB 2L7RA 3QWZB 3GE3C 2DZIA 1D4BA 2J42A 1OEYA 3VTUA 2LD9A 1HA5A 2KO3A 3HVDA 3APCA 4LTUA 1D3ZA 1PGXA 3PREA 4FJYA 3TL5A 3MC9A 4G11A 1WJ4A 1RFAA 1AYFA 1MFWA 2I1KA 1NVID 3IHPC 1ZXHA 3C19A 4RM8A 1E8WA 2BKRB 4HPLB 2C7NB 4ZRQA 3QAQA 3P4RB 4MELA 3HK0A 2KD0A 4DXAB 5BYQA 2N9XA 4GB9A 4PT5A 2PVOD 4C4VA 1YNTE 2DNFA 2PIAA 5H8YE 2J0MA 1LQBA 1VRAB 4XC2A 3DVGY 1WRDB 5LXHA 2KKCA 3Q3NC 3OWEB 3DBRB 2KMMA 2KFJA 5D3IB 5L83A 2M4NA 3HRDD 4QAYA 3N9YC 1OFFA 4BZAA 3UIPB 1R4NB 2K0PA 2Y5BB 3BY4B 4NZLB 4TV3A 1IGDA 3K9OB 1FXIA 4KGTA 1YIWA 5C2TB 5E6JA 2ICIA 3QK0A 3NVZA 4XWTA 1PGAA 2A4ZA 3BK1A 4NNJB 2DZJA 2IJ0A 1T6BX 3PVLA 1J19A 2HD5B 2LGIA 1NBFC 2LGDA 2B76B 3Q2AC 3AE8B 3RD2A 2JUOA 2IBIB 3OLMD 3TJPA 1K52A 1AW7A 4AUQC 1ET9A 2IZVB 4E74A 2NVUI 3P4SB 1TTNA 2PVGC 3GZNB 5JHBA 1WR1A 4OZBA 5IA7A 1N63A 1YD8U 4FXCA 3VHTC 4IC7B 4AP4C 1IP9A 2ZPNA 4MEMA 3KUZA 2LUMA 4HKZE 2JYTA 2V4IB 3DVNV 2O2VA 2C5LC 5C23A 1Y8RC 1SB3C 2DYBA 2HTME 4AQ7A 2QJLA 3KWVA 2YEPF 4HLEA 3U7ZA 2FNJB 4KZCA 4LCDE 3GOEA 1WGDA 1EWYC 1ZDXA 4L1BA 4IWQA 2ZZPB 5CHFA 3GB1A 4L2YA 1C78A 3RULA 3PPAA 1F52A 1RWSA 2V3SA 4LDTD 1PDXA 1WXMA 2NTSA 3AE9B 3ETRA 4S0RA 1YMHE 2K22A 3SR6A 2RSUA 2BS4B 2KFKB 5C1ZA 4RM9A 3DBHB 4EE2A 4N59A 1ZUD2 2BS3B 4GDKB 4GOCA 1SE2A 4J6IA 2GMIC 1YQBA 4AWJA 2JZ3B 2MX2A 4DXGA 4RF1A 2RD0A 3GP7A 3QA8A 3VVWB 4ZHOA 1QF6A 3VQIA 1OGWA 1V1PB 4WJPA 1JRPA 4WWOA 2LXCA 1JQ4A 5L95C 2D11A 1J7AA 1UNSA 2D3AA 2KJRA 4HDOA 1WYGA 1C76A 3Q8CA 1WJ6A 3ZTCA 2KK8A 1EM7A 4A55A 1OEYJ 3AU4A 3AEAB 5E6OA 3DBLB 4RF0A 2KACA 5EDSA 1ZXIA 3RN9C 1J7BA 4II3B 2K6QA 5JXVA 2KQ7A 1CK1A 2K8BA 1NEKB 3LXFA 2E6XA 2LHEA 3T9LA 1T0SC 3NZUA 2KWDA 4WQOB 1E9MA 3CSFA 3H1UA 2MBQA 5BYRA 3VAWA 3N3KB 4URKA 3KH0A 1BMLC 3LYYA 3AE4B 4WURA 1H8CA 3NZ3A 3N20C 3Q3FA 2OHFA 3E9SA 4HJGE 4KGSA 3RI7C 3WCQA 3ZJUA 5GMVA 2QMTA 3AEEB 5EE0A 1MVKA 2WYQA 4M01A 1ZDVA 3AEBB 1KF6B 2MBHA 1JROA 4ANVA 2ZW1A 4EKUA 2OOBB 2INDC 4M02A 2IY0B 1G6JA 2FIFA 2N7EA 1SBBB 1AN8A 3PS6A 2MLBA 2BF8B 4C80A 1VZ6A 1HEZE 2WX0A 2WWZA 4DHZB 2DYOA 4A9AA 3BVMA 1TY2A 2KDBA 3VTWA 2LRUA 2L32A 3PGEA 1KRHA 1ISNA 4OZAA 3NVYA 2BS2B 2QILA 2BW2A 1WGYA 3P4PB 4A8XC 3DHGC 4ANUA 3AE7B 2PPHA 4XX5A 3BINA 1ENFA 3NY5A 1FMAD 1TJEA 2N0SB 4MJSB 3NRZA 3SU8X 2VZKB 2AL6A 4DHZE 3Q8EA 1HZ5A 1HTOA 4E3CA 2K6DB 3AU5A 3ZW3A 4GDKA 1WM3A 1SE9A 3T3NA 3RZFA 3SHQA 1Q0WB 2MBBB 3A4SC 1SXTA 1WSPA 2HJ1A 1VJKA 2WXKA 2WXNA 3ZQ4A 4OVZA 1V1PA 1F0ZA 3UF8A 2D10A 2INCC 1T5XD 4EEWA 1MI0A 2JWUA 2LJ5A 4LJPB 4HCPB 2W3RA 3VR8B 3MHSD 3ZGZA 3Q6BA 1Q10A 1VR9A 1XLNA 2ACZB 3M62B 3R2TA 2KJ6A 4NAMA 3N1YC 2AWTA 3DVNU 1GOZA 4N6EB 4PK1A 2I38A 3I63C 1GB1A 1KLVA 3R7RA 4MH0E 2NTTA 1UWXA 2CJOA 4KX6B 2IO2B 2O6VB 1QLBB 1YQ4B 3AMZA 3PO0A 3QIJA 2WDRB 1MHHE 1YOVB 1WE6A 3VH4B 1GC7A 3QARA 1U4AA 1EO6A 4PS3A 1N5WA 1WGKA 3DBSA 3UGBB 4C7YA 2V9HA 4KIKA 4DXFA 1I4GA 3EC8A 5DPWA 2DZMA 2KX3A 2KX0A 2AQ3B 4YL8A 3IG3A 1F2RI 1ZE3D 3ZVVA 3PSEB 4DK5A 5J2RA 4GLSC 1QZEA 4M0WB 1K51A 2G45B 2N9LA 2WS3B 3NS8A 2JT4B 1I42A 3ZRCA 4JL9A 3PHXB 1JALA 1GC6A 2NBUA 4US8A 2RPVA 3DHIC 4C00A 1L6VA 2ZNVC 1E7VA 1IYFA 3TCAA 3U7DA 2CR5A 1NDDA 1GAQB 1TS4A 1FCLA 2BT6A 1RLFA 1XLQA 1L5PA 2PMVA 2WX1A 2LFIA 3VUYA 3SFEB 4FJZA 3TBLD 5LXIB 3C8YA 4A3PA 1WYWB 3UQBA 3WANA 1TS3A 3S2AA 3B2GA 2WXPA 3HM6X 1JWMD 2VH2A 2EELA 4MJSA 2V1YA 1KH0A 4IM0A 4K3BA 3MTNB 1OQQA 3QQ8B 2BKFA 4NJ6A 4DDID 1XD3B 2HJ8A 2LHDA 4ZRIA 4F1SA 1HTQA 2D5GA 2WXJA 4EFOA 1R4MI 1SE4A 1SEBD 3B0AA 4I6NB 1E8ZA 3AE6B 4HVBA 2L83A 2NBVB 2AX5A 2RDHA 1Z5SB 1X1MA 3QC8B 2ZPYA 1ZP0B 2VH1A 4ANWA 2BWFA 4JX1C 3VTVA 3CIRB 1BXTA 1FNWA 4WAFA 2WNMA 4MH8A 3Q8FA 1V49A 3VRBB 4BKSD 1T0YA 3W9CB 1FD6A 1WWTA 3LJ3A 5HG2A 5TSSA 4RGOS 1WF9A 2TSSA 2K3UA 3URYA 5IKCM 5HKHA 2IDYA 3DOWA 1YJIA 1QT9A 2O6VA 4KKJA 1SF0A 1V81A 3AM9A 3U8ZA 4LNFA 2GI9A 2GB1A 3BIID 2INPE 1GUAB 1EF1A 2MW5A 5KHOA 4BFRA 2GLSA 2K5PA 2W54A 3L08A 1CJEA 1KJTA 3B08A 1V6EA 1HZ6A 4REZA 4G0NB 1F2RC 1N62A 2G4DB 3W5VB 1I4XA 3V61A 1WM2A 2REXA 3WAOA 1PYWD 4NY0A 5LLIA 2DZKA 1UWMA 4RNAA 4A3OA 2GBKA 3FAHA 4PYZA 3Q3MC 4ICUA 3FC4A 4ASWC 3L54A 4XYCA 4FN2A 2LMCA 3H9DA 4HKQA 5CX3A 3J9CA 1YJ1A 3HHMA 4BOSC 4IM3A 3N1ZC 3ZIMA 3A9JA 3H7SA 2N1VA 5J18A 3VXWA 4H2AA 3ONSA 4EZKA 1SIJA 2C7MB 3BYYB 1F77A 3EA6A 2PTLA 3AV8A 4MGKE 1LGRA 1HE8A 3AEGB 2BB6A 1L0YB 3V6CB 4HJKA 3E56A 3TSSA 3DCGA 3UIOB 4EZJA 3IVFA 1DOIA 3Q3JA 3Q14C 4LNOA 4WAAA 1N6ZA 2LUEA 3RNFC 3W1SC 4JPSA 1T0QC 3M95A 1UUPA 4W9DA 2E3TA 3AXCA 1E6EB 1XO3A 1FEHA 5IAAC 3WAMA 4ZDVA 2BB5A 3QJZA 4IWOA 4NAWB 1FRDA 2GOWA 3T8MA 1NYQA 2DWQA 1ACCA 2N9EB 1WX8A 1V8CA 2MSED 1QKZA 5JHAA 2WP9B 2KLCA 2K25A 3AE3B 4TKNA 4M00A 3VRAB 3L4PA 3I57A 2QC8A 4E71A 2PEAA 4W9HA 2KC1A 1QOBA 3PLVA 4BOZB 3NUHB 4HRSA 5J17A 2KHWB 4M8NA 5IP4D 2RDGA 1B1ZA 4GSWA 1KOTA 4ZRPA 1T3QA 4W9IA 2GBJA 3GS2A 4OVVA 2ON8A 1WJNA 2WXQA 2KN4A 2JU6X 2KMAA 2SEBD 2KT7A 1WXSA 2FE8A 2KLGA 3QX1A 1WI0A 4B0EA 4KV2A 2FCSA 1C77A 1FCCC 4IDIA 5KHQA 1FFUA 5BMIA 2KVZA 2N7JA 5D6JB 3PRZA 1BT0A 4AJYB 3I3TB 1GNUA 5DPSA 5GXGB 2I1JA 2Z0EB 2MJ3A 1WX7A 2ZW0A 4USAA 3R3MA 1N60A 1AWDA 2YVCA 1TS5A 1VZ8A 1WXVA 1SJHD 2UYZB 1SJED 1Z2MA 4XE0A 4IWPA 5LNK1 4OW0A 5HHDG 1ROEA 4S17A 4KDIC 1L2NA 5CHWA 3DDCB 1N61A 2MBEA 2LRWA 2DYMA 3AH7A 1N5XA 4EOYA 3H6NA 4YSZB 1V5TA 3OJ4B 3H8HA 3AEDB 2MA9B 2FCNA 2J0JA 2W82A 2HDEA 4HPMB 3VUXA 2WQYB 2IYDB 1H4RA 3R2IA 1KLUD 4GMVA 3BVGA 1D6EC 1UH6A 3RPFC 2BBCA 3CF6E 3ZYYX 2J53A 1YN3A 5BMHA 4CO7A 3MC8A 1UGMA 3RT3B 3L13A 1PQSA 2IGDA 2J0KA 2W3SA 1IUEA 1V5OA 2WGSA 1VZ7A 2PJHA 4NAWA 2LEKA 1E8YA 3Q3OC 2K1FA 1M94A 2YEPB 3KWLA 4G3XB 4DHJB 1FNUA 2J52A 3V60A 1WXAA 1QILA 2L1AA 2DENB 3CWIA 2FCQA 5G5HA 1K53A 3R66C 4NQKE 4D2KA 1TZOA 3UINB 2JY6A 5DCNA 3PRMB 5E6NA 3KQ4A 3AN1A 1ESFA 1VLBA 2WDQB 1LFDA 2FUG1 3DBRI 3IXSA 2EKIA 3NS1A 4HEA1 4KDLB 4BBNF 2JYEA 1NYRA 4M8MA 4MT5A 2IO3B 4KVGB 1R4NI 2M19A 1R4MB 3MJ5A 4O1NA 4LNNA 4LK0M 1K50A 5EE1A 1MJDA 1CQVA 1TIFA 1ZGUB 1OQRA 4XDCA 4W9KA 1LXDA 2KTFA 2PE9A 4IUMB 3APFA 4W9EA 2K8HA 4A6QA 2ASQA 2MWSB 4JE3B 1WFYA 1WZ0A 2YLMA 1EWCA 2BYEA 2X38A 3KYCD 3NVWA 4FHKA 4HCNB 4KSLC 4ZRKA 2KFKA 2KZRA 1FPYA 3ZTDA 2BYTA 5C3JB 1RM6C 2CS4A 1C4AA 1I35A 3ZKJC 1JRUA 3AE1B 1OTRB 4HPPA 5AZFA 1L4ZB 2Q5WD 1UBQA 3ZO5B 1L0XB 1E90A 2M17A 4KZ0A 5G2NA 2M1MA 3M63B 3V6EB 4GU2A 4K7WA 2Y3AA 5JZEB 4IKGA 4AOFA 4HROA 4RMAA 1SSNA 2AQ2B 4LLGM 5EE9A 1MHXA 1I4HA 2G3QB 3ZLZA 4N58A 2JF5A 4Q2JA 4X57B 2CHWA 2O6VD 3SEBA 3IAS1 1EU3A 5D7GA 2M0XA 4WQMA 2R2OA 4TSSA 2JX5A 2L05A 3BK2A 2LGXA 3NOBA 5D94A 1I4RA 3RUIB 2C7HA 3DBHI 1V2YA 4TQ1A 3ZXVA 1MG4A 3ZNHB 1E10A 2OEDA 4UDUC 5D3DA 4OVUA 1TKYA 3A4RA 3O65B 1DOXA 3A1QB 2XK5B 2WXGA 1WRIA 3IFWB 2IO1B 1PFDA 4N9F4 2JQRB 1FO4A 3W2DA 4GDLB 3TMPB 1NI2A 5JH5C 1P9DU 4HK2A 4P1BC 1XEEA 4YT0B 2AQ1B 3H7PB 3K9PB 3ZNID 3TEZA 3KW5B 3TUOA 4BKTA 3ZNZB 2DBYA 1EU4A 4PS8A 2WDTB 2DX5B 2IGGA 3X23A 3DBLI 1NI3A 2D3CA 4F8CB 3WAPA 2M8SA 3RYTA 4LNKA 2QDFA 2FUHB 3PZ7A 2R61A 3U2SC 2V4LA 2KANA 3P2BA 4P1CC 2GBRA 4HWIB 2KJHB 1E5WA 1WGGA 2LJIA 1F1HA 2KAJA 2WXHA 1L0VB 1TBEA 3OJ3A 2JPHA 3JW0X 3PHWB 1WH3A 2LGSA 3NHEB 4YTMB 3X0WA 2MCNB 1BUIC 3AULA 3SDLC 2LXAA 4JWUC 4MGIE 1LM8B 2DLBA 5AUIA 1VDVA 4KSKC 1YX6B 4K3CA 2XN9C 3ALBA 3N32A 4ZHPA 4ZRJA 1C3TA 4FJVB 3RNAC 2JWZA 1YN5A 2QCZA 3EECA 2KVRA 3P1MA 3P63A 2MEKA 2ZVOA 3SFDB 2L0TA 2NR2A 2GBNA 4K7SA 1J8CA 4YWGG 2BTEA 1FXAA 4DWFA 4WWNA 4C7ZA 2KMCA 3RZWC 2NMQA 1IPGA 1D5ZC 3ZNGC 1KFYB 1ET6A 2MBOA 4B6WA 3PT2B 2CHZA 3PTFC 2WHIA 3ZJVA 3QCAA 2LASA 3EHVA 3ZJTA 3U4EG 2IGHA 3A1QA 2XK5A 2WXMA 1YQ3B 2V3NA 3WALA 1AARA 4M0WA 4GDLA 1WGRA
chains in the Genus database with same CATH topology
1VZ6A 4IDIA 1HEZE 4RFBA 3R8BA 1FFUA 2WDVB 1FRRA 5BMGA 5BMIA 2N7JA 2XNAC 2ONQA 3HUIA 2DYOA 3I9V1 4WWMA 1E0ZA 4A9AA 2Y5PA 3BVMA 5GXGB 1TY2A 4RGMA 5G5GA 1E7PB 1STEA 3Q8BA 2MJ3A 3IAM1 2L32A 3U52E 1R7SA 2ZW0A 4USAA 4C56C 1KRHA 1N60A 4YSYB 1AWDA 1TS5A 1VZ8A 3BVZA 2SAKA 4OZAA 3BYTB 3NVYA 1SJHD 2BS2B 2QILA 2BW2A 3EUB2 1KTKA 1SJED 1P7EA 3HVZA 3P4PB 4A8XC 2W55A 4XE0A 3AE7B 5LNK1 3BWUD 4OW0A 1GPXA 3TEYA 5HHDG 1ENFA 1FMAD 1TJEA 2N0SB 3NRZA 1ROEA 2VZKB 4KKIA 3EGRA 3Q8EA 1JWSD 1HZ5A 2V0GA 4RGNA 4WH4A 1JWBD 1RFKA 1N61A 2WXOA 2DYMA 3AH7A 3O13A 1N5XA 3V3XA 4R3DA 4OHJA 2K9XA 4YSZB 2WXIA 3H8HA 3AEDB 3T3NA 1IGCA 4YTNB 1XLPA 2W82A 1SXTA 2HDEA 3AE5B 1IBXB 1WSPA 3Q8AA 4L23A 2WXLA 1MPEA 2WQYB 1VJKA 5FR3A 2WXKA 2I2YA 3R2IA 1CZPA 1KLUD 2WXNA 3ZQ4A 4OVZA 1V1PA 1F0ZA 1ZPSA 4A90A 1QOAA 3BVGA 2RMMA 1D6EC 1T5XD 1DGJA 1PGBA 3RPFC 1DYQA 3AB5A 4B0MA 1MI0A 2BBCA 2JWUA 3ZYYX 2J53A 1YN3A 3B2FA 2W3RA 5BMHA 5T8IA 2WU5B 3VR8B 2G9HD 3ZGZA 1Q10A 1VR9A 3DWMA 2CU3A 1HQRD 1XLNA 2ACZB 3R2TA 4NAMA 1J7CA 1GOZA 2IGDA 2W3SA 1IUEA 1D5MC 3NVVA 4N6EB 1VZ7A 2I38A 1V97A 1GB1A 2LEKA 2PLPA 4YSXB 5BYSA 1HXYD 2YEPB 3KWLA 3DWGC 2NTTA 4IOIE 3VR9B 1UWXA 2J52A 1FNUA 2CJOA 2J4XA 4KX6B 2PW9A 1JWAD 1FFVA 1QILA 2L1AA 2Y5CA 3CWIA 2CJNA 2JSVX 5G5HA 1QOGA 1QLBB 1K53A 4D2KA 1D5XC 1YQ4B 3AMZA 3MP9A 5H92C 5FKAC 3PO0A 2WLBA 2WDRB 1TZOA 1MHHE 4XWWA 4OZCA 1TKGA 3AN1A 3KQ4A 1JMLA 3ABVB 4AS1A 1ESFA 3IT4B 2FBWB 1C9FA 4ZYSA 1N5WA 1WGKA 1VLBA 2WDQB 4C7YA 4DXFA 2QIEB 1I4GA 2FUG1 2INNE 1D4BA 3IXSA 2J42A 2AQ3B 3MC0B 1F2RI 2EKIA 1ZE3D 3NS1A 4HEA1 1V1OA 1HA5A 4GLSC 2JYEA 4TMAB 1K51A 1NYRA 3HVDA 3MHZA 2MH7A 2L52A 4LTUA 2N9LA 2WS3B 1PGXA 4MT5A 2KDMA 1JWUD 2M19A 1JALA 2KQ4X 3MJ5A 4O1NA 4US8A 2RPVA 4YTPB 4LK0M 1AYFA 1K50A 3UI3A 5EE1A 1CQVA 1L6VA 1NVID 1ZXHA 5HI1A 1OQRA 4XDCA 3MFGA 1XCTL 1GAQB 1XXGA 1TS4A 1FCLA 2BT6A 1XLQA 1L5PA 2PMVA 2LFIA 3SFEB 4ZRQA 3C8YA 3AEFB 4A6QA 3P4RB 4JE3B 1FIQA 3P4QB 2H88B 4ARIA 1EWCA 1LO5D 2WU2B 1YJJA 2V3PA 1KLGD 2X38A 5MPOA 5BYQA 3NVWA 4PT5A 5HFYA 1TYGB 2PVOD 1TS3A 3FILB 2Z8LA 4CQNA 1YNTE 1I7HA 3B2GA 2PIAA 3BZDB 5H8YE 2WXPA 3RFZB 4YXDB 1QOFA 1JWMD 2BYTA 5C3JB 1VRAB 1RM6C 3LB8C 1C4AA 1UGJA 2WXRA 3AE1B 2EELA 3P42A 1KH0A 4ARCA 3OWEB 1OQQA 1L4ZB 2KMMA 1DOYA 5D3IB 2Q5WD 2LHDA 3HRDD 2QEJC 1L0XB 2QSDA 2D5GA 1L6UA 2WXJA 1OFFA 3N9YC 1SE4A 1SEBD 3IT6B 2Y3AA 2K0PA 3AE6B 4IKGA 4RCOA 3AE2B 2L83A 4NZLB 1IBXA 4MM3B 2AX5A 4HROA 1IGDA 2RDHA 1SSNA 1FXIA 1RYJA 4KGTA 2AQ2B 1FNVA 2M0AA 4LLGM 5EE9A 5C2TB 1TY0A 1PUTA 1ZP0B 1MHXA 1M4VA 2ICIA 5E6JA 1I4HA 3NVZA 4XWTA 1PGAA 4JX1C 4N58A 4P16A 4Q2JA 3CIRB 1BXTA 1ZOYB 1FNWA 4WAFA 4JWSC 2WNMA 3BK1A 4MH8A 4ZOHC 3SEBA 3IAS1 1EU3A 1FM0D 2IJ0A 5D7GA 3Q8FA 4WQMA 4TSSA 3VRBB 2JX5A 1T6BX 3BK2A 3W9CB 1FD6A 1WWTA 2LGIA 4XDDA 1I4RA 5HG2A 5TSSA 4RGOS 2B76B 3AE8B 2TSSA 4TQ1A 2K3UA 1Y56A 1E10A 3URYA 2H89B 2OEDA 1K52A 4UDUC 5D3DA 1AW7A 1ET9A 1TKYA 2IDYA 2PVGC 3P4SB 1JCKB 1YJIA 1JW9D 4OZBA 1N63A 4WIPA 1DOXA 1QT9A 4FXCA 4KKJA 1SF0A 2WXGA 1WRIA 3AM9A 4US9A 2GI9A 2LUMA 2GB1A 3BIID 2JZPA 1PFDA 4P6VF 2INPE 1WXQA 2JQRB 4HKZE 3W2DA 1FO4A 4GDLB 2JYTA 1TS2A 2V4IB 1TKEA 2K5PA 2W54A 1XEEA 4YT0B 2AQ1B 1SB3C 3TEZA 4MACA 2HTME 1CJEA 1SE3A 1HZ6A 4REZA 4AQ7A 1F2RC 2QJLA 1N62A 3TUOA 3KWVA 1XCQL 3W5VB 2DBYA 1EU4A 2YEPF 3U7ZA 1I4XA 3B9JA 1PYWD 1L4DB 2IGGA 1UWMA 2VZKD 4RNAA 1EWYC 2MJDA 1ZDXA 3FAHA 4L1BA 4TQ0A 1NI3A 2G1EA 3GB1A 3FC4A 4L2YA 1C78A 4ITKA 3PZ7A 1I4QA 2R61A 3U2SC 2LMCA 1RWSA 4HKQA 5I4DA 1XF5L 1XLOA 1PDXA 1QQRA 2NTSA 2M56B 2WXFA 3AE9B 1YMHE 2K22A 3ETRA 3J9CA 3SR6A 2BS4B 4EE2A 4N59A 1ZUD2 2BS3B 4GDKB 1A70A 2LJIA 2WXHA 2KAJA 1L0VB 1SE2A 4H2AA 3AECB 4DXGA 1SIJA 4RF1A 3GP7A 3KLSX 3BYYB 1F77A 3FILA 3W5UB 3EA6A 2PTLA 4ZHOA 3AV8A 1QF6A 3VQIA 1V1PB 5FK9C 1C4PA 2BB6A 3AEGB 4RGTA 2PKOA 1BUIC 1JRPA 4YTMB 1L0YB 3Q69A 1JQ4A 4JWUC 2DLBA 3E56A 3TSSA 1J7AA 1UNSA 5AUIA 1VDVA 2IPKD 1DOIA 1P7FA 3T3OA 1WYGA 1C4CA 3V05A 1C76A 1I4PA 2JXTA 3Q8CA 4JPSA 1NENB 1UUPA 2XN9C 2E3TA 1EM7A 1E6EB 1XO3A 4A55A 1FEHA 4ZHPA 2BB5A 3PZ8A 4NAWB 3AEAB 1FRDA 1YN5A 4RF0A 1NYQA 2KACA 2DWQA 1ACCA 1V8CA 1ZXIA 1QKZA 3P1MA 2WP9B 3P63A 1J7BA 3AE3B 2MEKA 5JXVA 3SFDB 3VRAB 1CK1A 3L4PA 3I57A 1NEKB 2N9KA 3LXFA 5EE3A 2E6XA 4J3OD 1C79A 1QOBA 2LHEA 4NJCA 4YWGG 2BTEA 3NUHB 1FXAA 2KWDA 4RH6A 5AUKA 4HRSA 1B9RA 1E9MA 4C7ZA 3TEWA 5BYRA 1BMLC 3LYYA 2NMQA 3AE4B 1GB4A 4WURA 3NZ3A 2RDGA 1D5ZC 2OHFA 1B1ZA 3E9SA 4HJGE 4KGSA 3WCQA 3ZJUA 4ZRPA 1KFYB 1ET6A 1T3QA 2QMTA 3AEEB 5EE0A 1MVKA 3GS2A 2MJEA 1ZDVA 3AEBB 1YN4A 3ZJVA 3TEXA 1KF6B 1JROA 2ON8A 2ZW1A 3ZJTA 3U4EG 2IGHA 2WXQA 4KGRA 2KN4A 2WXMA 2JU6X 1YQ3B 2GRIA 2SEBD 2V3NA 2FE8A 3W1SA 1SBBB 1AN8A 4B0EA 4M0WA 4DQOC 4C80A 1C77A 1FCCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ4 B;  4N59 A;  1ZUD 2;  2BS3 B;  2L83 A;  3AE2 B;  1A70 A;  3AMZ A;  4IDI A;  5H92 C;  2KAJ A;  1L0V B;  2AX5 A;  3PO0 A;  1FFU A;  2WDV B;  1FRR A;  2WDR B;  2WLB A;  1FXI A;  1RYJ A;  4HRO A;  3HUI A;  3AEC B;  4WWM A;  5EE9 A;  4A9A A;  5C2T B;  1TKG A;  3AN1 A;  1PUT A;  1ZP0 B;  5GXG B;  3ABV B;  5G5G A;  1SIJ A;  2FBW B;  3NVZ A;  1E7P B;  1N5W A;  1WGK A;  1VLB A;  2WDQ B;  3W5U B;  2MJ3 A;  4JX1 C;  4N58 A;  4C7Y A;  4ZHO A;  3AV8 A;  1R7S A;  2QIE B;  4USA A;  3CIR B;  1QF6 A;  1KRH A;  3AEG B;  1N60 A;  4YSY B;  1AWD A;  1ZOY B;  1JRP A;  2PKO A;  4YTM B;  4JWS C;  1JQ4 A;  2EKI A;  3NVY A;  2BS2 B;  3NS1 A;  4JWU C;  3EUB 2;  4ZOH C;  1FM0 D;  1J7A A;  4WQM A;  3VRB B;  2JX5 A;  3HVZ A;  3P4P B;  5AUI A;  1VDV A;  2W55 A;  1NYR A;  3W9C B;  2MH7 A;  3AE7 B;  1DOI A;  1WWT A;  2L52 A;  4LTU A;  1GPX A;  2WS3 B;  1WYG A;  1FMA D;  1TJE A;  2N0S B;  2B76 B;  2M19 A;  3NRZ A;  1ROE A;  1JAL A;  1NEN B;  3AE8 B;  2E3T A;  4US8 A;  4YTP B;  1AYF A;  1E6E B;  1XO3 A;  4ZHP A;  1E10 A;  5EE1 A;  2H89 B;  1L6V A;  1NVI D;  1TKY A;  1OQR A;  2PVG C;  1JWB D;  1RFK A;  1N61 A;  1YJI A;  3AEA B;  3P4S B;  1FRD A;  1JW9 D;  1N63 A;  1DOX A;  1QT9 A;  3AH7 A;  4FXC A;  1N5X A;  1SF0 A;  1GAQ B;  1NYQ A;  1WRI A;  3AM9 A;  2DWQ A;  2K9X A;  4US9 A;  4YSZ B;  2BT6 A;  3BII D;  1XLQ A;  1L5P A;  1V8C A;  1ZXI A;  1PFD A;  3AED B;  2WP9 B;  1WXQ A;  2JQR B;  3P1M A;  3P63 A;  4P6V F;  3SFE B;  1J7B A;  1FO4 A;  3AE3 B;  4YTN B;  1XLP A;  3AEF B;  3SFD B;  3VRA B;  3AE5 B;  3P4R B;  1FIQ A;  3L4P A;  2H88 B;  1TKE A;  3P4Q B;  1B9R A;  2K5P A;  2W54 A;  1NEK B;  3LXF A;  2WQY B;  5EE3 A;  1VJK A;  2WU2 B;  4YT0 B;  1YJJ A;  1QOB A;  1CZP A;  1SB3 C;  5MPO A;  1F0Z A;  2HTM E;  1CJE A;  3NVW A;  1QOA A;  1TYG B;  2PVO D;  1FXA A;  1I7H A;  3B2G A;  1DGJ A;  2QJL A;  1N62 A;  2PIA A;  4HRS A;  5AUK A;  5H8Y E;  1E9M A;  3RPF C;  2DBY A;  3AB5 A;  3W5V B;  4C7Z A;  3ZYY X;  4C80 A;  4YXD B;  1QOF A;  3B9J A;  3B2F A;  5C3J B;  3LB8 C;  1RM6 C;  2W3R A;  2WU5 B;  3AE4 B;  3VR8 B;  3DWM A;  3AE1 B;  2CU3 A;  2OHF A;  1XLN A;  2ACZ B;  3WCQ A;  1UWM A;  1KFY B;  1J7C A;  2W3S A;  1EWY C;  1IUE A;  1T3Q A;  2MJD A;  3FAH A;  1NI3 A;  3NVV A;  3AEE B;  4N6E B;  2G1E A;  5EE0 A;  3FC4 A;  1OQQ A;  2MJE A;  1DOY A;  2KMM A;  1V97 A;  3AEB B;  4ITK A;  1KF6 B;  2Q5W D;  2LEK A;  1JRO A;  4YSX B;  3HRD D;  3KWL A;  1RWS A;  3DWG C;  3VR9 B;  1L6U A;  2CJO A;  1OFF A;  1XLO A;  1YQ3 B;  1PDX A;  4KX6 B;  1JWA D;  1FFV A;  3AE9 B;  2M56 B;  3ETR A;  2K22 A;  2Y5C A;  3SR6 A;  2BS4 B;  3CWI A;  2CJN A;  3AE6 B;  1E0Z A;  5G5H A;  1QOG A;  1QLB B; 
#chains in the Genus database with same CATH topology
 2OJW A;  1KM7 A;  2QHO A;  4RFB A;  2WDV B;  5BMG A;  2ONQ A;  3HUI A;  4FLH A;  2N7D A;  1WZ3 A;  3I9V 1;  3OAW A;  4DDG D;  2L3Z A;  3H7P A;  5G5G A;  3HM3 A;  1E7P B;  1STE A;  3Q8B A;  5CHV C;  3IAM 1;  3U52 E;  1R7S A;  4B95 A;  4C56 C;  4YSY B;  2SAK A;  3BYT B;  3EUB 2;  1WY8 A;  2JVC A;  1P7E A;  3HVZ A;  2W55 A;  1UF0 A;  1WX9 A;  3TEY A;  1UD7 A;  3ML8 A;  4KKI A;  3ECI A;  5IO9 A;  3SD5 A;  1WMH B;  1L7Y A;  4AJW A;  2V0G A;  3KUC B;  3OG5 A;  4WH4 A;  1WR6 E;  3UQA A;  2NCN A;  2WXO A;  4IG7 B;  4HXD A;  4R3D A;  4OHJ A;  2WXI A;  2FAZ A;  4I6L B;  3TIX A;  3EFC A;  4YTN B;  1XLP A;  1WIA A;  2GBM A;  1IBX B;  2D07 B;  2ZNV B;  3JYU A;  2ZCB A;  5FR3 A;  1ZPS A;  4A90 A;  1K8R B;  2CHX A;  2RMM A;  3LDZ E;  2JRI B;  1DGJ A;  2UWQ A;  1PGB A;  1DYQ A;  2J7Q B;  3AB5 A;  4B0M A;  2L8J A;  3B2F A;  2LGY A;  2WU5 B;  3DWM A;  2CU3 A;  2RDB C;  2ZEQ A;  5IOI A;  4JGH B;  4ICV A;  3NVV A;  1WGH A;  2D2Q A;  3PZD A;  3M3J A;  1A5R A;  1P98 A;  1HXY D;  2KWC A;  1VD2 A;  4IOI E;  4BVU C;  5AEK B;  2PW9 A;  1JWA D;  1FFV A;  2Y5C A;  2L00 B;  1QOG A;  1FXT B;  1C1Y B;  1D5X C;  2L76 A;  1S1Q B;  5H92 C;  4ZYN A;  1P3Q U;  5FKA C;  3VH3 B;  4MSM B;  4FUL A;  4OZC A;  2KTR B;  1JML A;  3ABV B;  4AS1 A;  3IT4 B;  2FBW B;  4ZYS A;  2BYF A;  4NJ7 A;  4MGY E;  1TT5 B;  2NBW B;  4LNI A;  2QIE B;  2X8X X;  3AI5 A;  3CST A;  5G55 A;  2INN E;  3MC0 B;  2MHJ A;  2ZVN A;  2RPQ A;  1WE7 A;  3I5J C;  1V1O A;  1UBI A;  4PS7 A;  4TMA B;  4BKS A;  2Z0D B;  3MHZ A;  4MDK E;  2MH7 A;  2W9N A;  2L52 A;  4GIV A;  5CTR C;  2KDM A;  4WJN A;  1JWU D;  2LVQ A;  2KQ4 X;  1RAX A;  4YTP B;  2LVP A;  4PYU A;  3UI3 A;  4W9F A;  5HI1 A;  3QHT A;  4XZ4 A;  4FAD A;  3MFG A;  1XCT L;  3FKY A;  1XXG A;  5DPT A;  4BBN C;  2KN5 A;  1Q5W B;  4W9L A;  3AEF B;  4IM2 A;  2BQQ A;  1FIQ A;  3P4Q B;  1ZW7 A;  2H88 B;  4MGZ E;  4ARI A;  1LO5 D;  2WU2 B;  1YJJ A;  2V3P A;  1KLG D;  5MPO A;  2HTH A;  5HFY A;  1TYG B;  2KDE B;  3FIL B;  2Z8L A;  4CQN A;  1I7H A;  3L16 A;  1GJZ A;  3BZD B;  3RFZ B;  2NPT B;  4YXD B;  1QOF A;  2KOX A;  3LB8 C;  1UGJ A;  2WXR A;  4LDT B;  3JSV B;  3P42 A;  3JVZ X;  2DHZ A;  3EFU A;  3C0R B;  2AYO B;  4JQW C;  4ARC A;  3R7Q A;  1WMH A;  1DOY A;  2HE7 A;  1T0R C;  2AEH A;  2MP2 B;  1SIF A;  2QEJ C;  2QSD A;  3ZDM C;  1L6U A;  2AL3 A;  3PV1 A;  3IT6 B;  4K81 A;  4BKG A;  4RCO A;  2C9W B;  3AE2 B;  1IBX A;  4MM3 B;  1RYJ A;  1FNV A;  2M0A A;  5IN7 A;  1TY0 A;  2ZJD A;  1PUT A;  1M4V A;  4DHJ D;  3DVG X;  3ZDT A;  4JLC A;  2KDF B;  4P16 A;  2BYV E;  2JZZ A;  1ZOY B;  4JWS C;  1V80 A;  4F7Z A;  4ANX A;  2A5U A;  4ZOH C;  4WJQ A;  4II2 B;  1FM0 D;  4FHJ A;  1CMX B;  3APD A;  4XDD A;  3VFK A;  4P7I A;  1XQQ A;  4FBJ B;  3A9K B;  2KDI A;  1Y56 A;  2H89 B;  1EUV B;  4KIK B;  1JCK B;  1JW9 D;  4WIP A;  4K7U A;  4JIO U;  4US9 A;  2JZP A;  4P6V F;  3ML9 A;  1WXQ A;  3DHH C;  2KTR A;  1TS2 A;  2G4S A;  1TKE A;  1V9J A;  3WIM A;  3N30 A;  2VRR B;  3KVF B;  2DAJ A;  4MAC A;  2D3G A;  1SE3 A;  4MSQ B;  1XCQ L;  5TR5 A;  1E7U A;  2EMT A;  3B9J A;  1WJU A;  1L4D B;  2KQS A;  2KWU B;  1V86 A;  2VZK D;  3L17 A;  2N1W A;  4WJO A;  2MJD A;  4TQ0 A;  2G1E A;  2LZ6 A;  4ITK A;  4GN1 A;  1I4Q A;  5AZG A;  5I4D A;  2BPS A;  1XF5 L;  1XLO A;  4ACF A;  1QQR A;  2M56 B;  2WXF A;  2EKE C;  1SGH A;  2BVC A;  1RRB A;  1A70 A;  1EF5 A;  2RGF A;  3GZN I;  2C60 A;  3AEC B;  1GG3 A;  3W1Y A;  2JXX A;  5E6P A;  3KLS X;  3FIL A;  4LJO B;  2DAF A;  3W5U B;  1OQY A;  1ZKH A;  2KC2 A;  2NPT A;  5FK9 C;  1C4P A;  4RGT A;  3RNG C;  2PKO A;  2KYW A;  2KNB A;  3Q69 A;  2K8C A;  2KXJ A;  3JSV A;  3ENE A;  2IPK D;  1P7F A;  2L0F A;  4CYE A;  3T3O A;  3L0W B;  3HIZ A;  2NS5 A;  1C4C A;  3V05 A;  1I4P A;  2JXT A;  1NEN B;  1TGZ B;  2MP2 A;  3MJW A;  1UEL A;  3PZ8 A;  3D32 A;  1Q1O A;  4BAX A;  1J0G A;  4NPN A;  4MM3 A;  5AZH A;  1F9J A;  2RR9 A;  3RNE C;  3DQV A;  4G50 A;  4DBG A;  2N9K A;  5EE3 A;  4IW0 A;  4J3O D;  1C79 A;  2MQJ A;  3NJT A;  4NJC A;  4FA6 A;  3WA0 A;  3VUW A;  2OJR A;  2XBB C;  4RH6 A;  5AUK A;  1B9R A;  1TZ1 A;  3ZUN A;  3PRP B;  3TEW A;  3ZXR A;  1GB4 A;  3RCZ A;  2JRH A;  2UU7 A;  1S3S G;  1UZX B;  3A9K A;  2MJE A;  3L10 B;  1YN4 A;  3TEX A;  4I6P A;  2LWP A;  2N4F A;  4KGR A;  2GRI A;  4B9K A;  3W1S A;  4XGA B;  2CKH B;  5DPR A;  4DQO C;  1E0Z A;  3N1X C;  4GXB A;  3R8B A;  5FR6 A;  1FRR A;  2LVO A;  2XNA C;  4WWM A;  2CU1 A;  2EMS A;  2Y5P A;  4RGM A;  4NQL B;  1E8X A;  4W9C A;  4W9G A;  2IY1 B;  4K1R B;  3BVZ A;  3KYD D;  4C4V B;  2R2Q A;  1KTK A;  3ZRF A;  2D3B A;  2BGF A;  3NZS A;  3A9J B;  4EZL A;  1GPX A;  3BWU D;  3PLU A;  1P0R A;  2ZCC A;  2FCM A;  1XT9 B;  5D2M B;  3A33 B;  3EGR A;  4WWP A;  2B3A A;  1JWS D;  5BO4 B;  4RGN A;  1JWB D;  1RFK A;  3CMM B;  1MG8 A;  3B1L X;  3O13 A;  4TUU A;  3V3X A;  2K9X A;  1IGC A;  3RMK C;  3U30 A;  3AE5 B;  3IBE A;  1VCB A;  2XEW A;  4EUT A;  3Q8A A;  4L23 A;  2WXL A;  1MPE A;  2I2Y A;  1CZP A;  1QOA A;  2FID A;  4CHK A;  3KUD B;  4A20 A;  5T8I A;  2G9H D;  2IO0 B;  1HQR D;  1YX5 B;  1J7C A;  1D5M C;  3VDZ A;  1V97 A;  2LI5 A;  2PLP A;  2Z59 B;  3DPD A;  3GE8 C;  4YSX B;  5BYS A;  4W9J A;  3DWG C;  3VR9 B;  2J4X A;  3V62 A;  3RNC C;  3NG0 A;  2CJN A;  2JSV X;  2K39 A;  2MRP A;  2N9P C;  3MP9 A;  4GGQ A;  2PE6 B;  2WLB A;  4XWW A;  1TKG A;  1P1A A;  1C9F A;  2BWE S;  3RNB C;  2O2V B;  4HDQ A;  2KWV B;  2L7R A;  3QWZ B;  3GE3 C;  2DZI A;  1D4B A;  2J42 A;  1OEY A;  3VTU A;  2LD9 A;  1HA5 A;  2KO3 A;  3HVD A;  3APC A;  4LTU A;  1D3Z A;  1PGX A;  3PRE A;  4FJY A;  3TL5 A;  3MC9 A;  4G11 A;  1WJ4 A;  1RFA A;  1AYF A;  1MFW A;  2I1K A;  1NVI D;  3IHP C;  1ZXH A;  3C19 A;  4RM8 A;  1E8W A;  2BKR B;  4HPL B;  2C7N B;  4ZRQ A;  3QAQ A;  3P4R B;  4MEL A;  3HK0 A;  2KD0 A;  4DXA B;  5BYQ A;  2N9X A;  4GB9 A;  4PT5 A;  2PVO D;  4C4V A;  1YNT E;  2DNF A;  2PIA A;  5H8Y E;  2J0M A;  1LQB A;  1VRA B;  4XC2 A;  3DVG Y;  1WRD B;  5LXH A;  2KKC A;  3Q3N C;  3OWE B;  3DBR B;  2KMM A;  2KFJ A;  5D3I B;  5L83 A;  2M4N A;  3HRD D;  4QAY A;  3N9Y C;  1OFF A;  4BZA A;  3UIP B;  1R4N B;  2K0P A;  2Y5B B;  3BY4 B;  4NZL B;  4TV3 A;  1IGD A;  3K9O B;  1FXI A;  4KGT A;  1YIW A;  5C2T B;  5E6J A;  2ICI A;  3QK0 A;  3NVZ A;  4XWT A;  1PGA A;  2A4Z A;  3BK1 A;  4NNJ B;  2DZJ A;  2IJ0 A;  1T6B X;  3PVL A;  1J19 A;  2HD5 B;  2LGI A;  1NBF C;  2LGD A;  2B76 B;  3Q2A C;  3AE8 B;  3RD2 A;  2JUO A;  2IBI B;  3OLM D;  3TJP A;  1K52 A;  1AW7 A;  4AUQ C;  1ET9 A;  2IZV B;  4E74 A;  2NVU I;  3P4S B;  1TTN A;  2PVG C;  3GZN B;  5JHB A;  1WR1 A;  4OZB A;  5IA7 A;  1N63 A;  1YD8 U;  4FXC A;  3VHT C;  4IC7 B;  4AP4 C;  1IP9 A;  2ZPN A;  4MEM A;  3KUZ A;  2LUM A;  4HKZ E;  2JYT A;  2V4I B;  3DVN V;  2O2V A;  2C5L C;  5C23 A;  1Y8R C;  1SB3 C;  2DYB A;  2HTM E;  4AQ7 A;  2QJL A;  3KWV A;  2YEP F;  4HLE A;  3U7Z A;  2FNJ B;  4KZC A;  4LCD E;  3GOE A;  1WGD A;  1EWY C;  1ZDX A;  4L1B A;  4IWQ A;  2ZZP B;  5CHF A;  3GB1 A;  4L2Y A;  1C78 A;  3RUL A;  3PPA A;  1F52 A;  1RWS A;  2V3S A;  4LDT D;  1PDX A;  1WXM A;  2NTS A;  3AE9 B;  3ETR A;  4S0R A;  1YMH E;  2K22 A;  3SR6 A;  2RSU A;  2BS4 B;  2KFK B;  5C1Z A;  4RM9 A;  3DBH B;  4EE2 A;  4N59 A;  1ZUD 2;  2BS3 B;  4GDK B;  4GOC A;  1SE2 A;  4J6I A;  2GMI C;  1YQB A;  4AWJ A;  2JZ3 B;  2MX2 A;  4DXG A;  4RF1 A;  2RD0 A;  3GP7 A;  3QA8 A;  3VVW B;  4ZHO A;  1QF6 A;  3VQI A;  1OGW A;  1V1P B;  4WJP A;  1JRP A;  4WWO A;  2LXC A;  1JQ4 A;  5L95 C;  2D11 A;  1J7A A;  1UNS A;  2D3A A;  2KJR A;  4HDO A;  1WYG A;  1C76 A;  3Q8C A;  1WJ6 A;  3ZTC A;  2KK8 A;  1EM7 A;  4A55 A;  1OEY J;  3AU4 A;  3AEA B;  5E6O A;  3DBL B;  4RF0 A;  2KAC A;  5EDS A;  1ZXI A;  3RN9 C;  1J7B A;  4II3 B;  2K6Q A;  5JXV A;  2KQ7 A;  1CK1 A;  2K8B A;  1NEK B;  3LXF A;  2E6X A;  2LHE A;  3T9L A;  1T0S C;  3NZU A;  2KWD A;  4WQO B;  1E9M A;  3CSF A;  3H1U A;  2MBQ A;  5BYR A;  3VAW A;  3N3K B;  4URK A;  3KH0 A;  1BML C;  3LYY A;  3AE4 B;  4WUR A;  1H8C A;  3NZ3 A;  3N20 C;  3Q3F A;  2OHF A;  3E9S A;  4HJG E;  4KGS A;  3RI7 C;  3WCQ A;  3ZJU A;  5GMV A;  2QMT A;  3AEE B;  5EE0 A;  1MVK A;  2WYQ A;  4M01 A;  1ZDV A;  3AEB B;  1KF6 B;  2MBH A;  1JRO A;  4ANV A;  2ZW1 A;  4EKU A;  2OOB B;  2IND C;  4M02 A;  2IY0 B;  1G6J A;  2FIF A;  2N7E A;  1SBB B;  1AN8 A;  3PS6 A;  2MLB A;  2BF8 B;  4C80 A;  1VZ6 A;  1HEZ E;  2WX0 A;  2WWZ A;  4DHZ B;  2DYO A;  4A9A A;  3BVM A;  1TY2 A;  2KDB A;  3VTW A;  2LRU A;  2L32 A;  3PGE A;  1KRH A;  1ISN A;  4OZA A;  3NVY A;  2BS2 B;  2QIL A;  2BW2 A;  1WGY A;  3P4P B;  4A8X C;  3DHG C;  4ANU A;  3AE7 B;  2PPH A;  4XX5 A;  3BIN A;  1ENF A;  3NY5 A;  1FMA D;  1TJE A;  2N0S B;  4MJS B;  3NRZ A;  3SU8 X;  2VZK B;  2AL6 A;  4DHZ E;  3Q8E A;  1HZ5 A;  1HTO A;  4E3C A;  2K6D B;  3AU5 A;  3ZW3 A;  4GDK A;  1WM3 A;  1SE9 A;  3T3N A;  3RZF A;  3SHQ A;  1Q0W B;  2MBB B;  3A4S C;  1SXT A;  1WSP A;  2HJ1 A;  1VJK A;  2WXK A;  2WXN A;  3ZQ4 A;  4OVZ A;  1V1P A;  1F0Z A;  3UF8 A;  2D10 A;  2INC C;  1T5X D;  4EEW A;  1MI0 A;  2JWU A;  2LJ5 A;  4LJP B;  4HCP B;  2W3R A;  3VR8 B;  3MHS D;  3ZGZ A;  3Q6B A;  1Q10 A;  1VR9 A;  1XLN A;  2ACZ B;  3M62 B;  3R2T A;  2KJ6 A;  4NAM A;  3N1Y C;  2AWT A;  3DVN U;  1GOZ A;  4N6E B;  4PK1 A;  2I38 A;  3I63 C;  1GB1 A;  1KLV A;  3R7R A;  4MH0 E;  2NTT A;  1UWX A;  2CJO A;  4KX6 B;  2IO2 B;  2O6V B;  1QLB B;  1YQ4 B;  3AMZ A;  3PO0 A;  3QIJ A;  2WDR B;  1MHH E;  1YOV B;  1WE6 A;  3VH4 B;  1GC7 A;  3QAR A;  1U4A A;  1EO6 A;  4PS3 A;  1N5W A;  1WGK A;  3DBS A;  3UGB B;  4C7Y A;  2V9H A;  4KIK A;  4DXF A;  1I4G A;  3EC8 A;  5DPW A;  2DZM A;  2KX3 A;  2KX0 A;  2AQ3 B;  4YL8 A;  3IG3 A;  1F2R I;  1ZE3 D;  3ZVV A;  3PSE B;  4DK5 A;  5J2R A;  4GLS C;  1QZE A;  4M0W B;  1K51 A;  2G45 B;  2N9L A;  2WS3 B;  3NS8 A;  2JT4 B;  1I42 A;  3ZRC A;  4JL9 A;  3PHX B;  1JAL A;  1GC6 A;  2NBU A;  4US8 A;  2RPV A;  3DHI C;  4C00 A;  1L6V A;  2ZNV C;  1E7V A;  1IYF A;  3TCA A;  3U7D A;  2CR5 A;  1NDD A;  1GAQ B;  1TS4 A;  1FCL A;  2BT6 A;  1RLF A;  1XLQ A;  1L5P A;  2PMV A;  2WX1 A;  2LFI A;  3VUY A;  3SFE B;  4FJZ A;  3TBL D;  5LXI B;  3C8Y A;  4A3P A;  1WYW B;  3UQB A;  3WAN A;  1TS3 A;  3S2A A;  3B2G A;  2WXP A;  3HM6 X;  1JWM D;  2VH2 A;  2EEL A;  4MJS A;  2V1Y A;  1KH0 A;  4IM0 A;  4K3B A;  3MTN B;  1OQQ A;  3QQ8 B;  2BKF A;  4NJ6 A;  4DDI D;  1XD3 B;  2HJ8 A;  2LHD A;  4ZRI A;  4F1S A;  1HTQ A;  2D5G A;  2WXJ A;  4EFO A;  1R4M I;  1SE4 A;  1SEB D;  3B0A A;  4I6N B;  1E8Z A;  3AE6 B;  4HVB A;  2L83 A;  2NBV B;  2AX5 A;  2RDH A;  1Z5S B;  1X1M A;  3QC8 B;  2ZPY A;  1ZP0 B;  2VH1 A;  4ANW A;  2BWF A;  4JX1 C;  3VTV A;  3CIR B;  1BXT A;  1FNW A;  4WAF A;  2WNM A;  4MH8 A;  3Q8F A;  1V49 A;  3VRB B;  4BKS D;  1T0Y A;  3W9C B;  1FD6 A;  1WWT A;  3LJ3 A;  5HG2 A;  5TSS A;  4RGO S;  1WF9 A;  2TSS A;  2K3U A;  3URY A;  5IKC M;  5HKH A;  2IDY A;  3DOW A;  1YJI A;  1QT9 A;  2O6V A;  4KKJ A;  1SF0 A;  1V81 A;  3AM9 A;  3U8Z A;  4LNF A;  2GI9 A;  2GB1 A;  3BII D;  2INP E;  1GUA B;  1EF1 A;  2MW5 A;  5KHO A;  4BFR A;  2GLS A;  2K5P A;  2W54 A;  3L08 A;  1CJE A;  1KJT A;  3B08 A;  1V6E A;  1HZ6 A;  4REZ A;  4G0N B;  1F2R C;  1N62 A;  2G4D B;  3W5V B;  1I4X A;  3V61 A;  1WM2 A;  2REX A;  3WAO A;  1PYW D;  4NY0 A;  5LLI A;  2DZK A;  1UWM A;  4RNA A;  4A3O A;  2GBK A;  3FAH A;  4PYZ A;  3Q3M C;  4ICU A;  3FC4 A;  4ASW C;  3L54 A;  4XYC A;  4FN2 A;  2LMC A;  3H9D A;  4HKQ A;  5CX3 A;  3J9C A;  1YJ1 A;  3HHM A;  4BOS C;  4IM3 A;  3N1Z C;  3ZIM A;  3A9J A;  3H7S A;  2N1V A;  5J18 A;  3VXW A;  4H2A A;  3ONS A;  4EZK A;  1SIJ A;  2C7M B;  3BYY B;  1F77 A;  3EA6 A;  2PTL A;  3AV8 A;  4MGK E;  1LGR A;  1HE8 A;  3AEG B;  2BB6 A;  1L0Y B;  3V6C B;  4HJK A;  3E56 A;  3TSS A;  3DCG A;  3UIO B;  4EZJ A;  3IVF A;  1DOI A;  3Q3J A;  3Q14 C;  4LNO A;  4WAA A;  1N6Z A;  2LUE A;  3RNF C;  3W1S C;  4JPS A;  1T0Q C;  3M95 A;  1UUP A;  4W9D A;  2E3T A;  3AXC A;  1E6E B;  1XO3 A;  1FEH A;  5IAA C;  3WAM A;  4ZDV A;  2BB5 A;  3QJZ A;  4IWO A;  4NAW B;  1FRD A;  2GOW A;  3T8M A;  1NYQ A;  2DWQ A;  1ACC A;  2N9E B;  1WX8 A;  1V8C A;  2MSE D;  1QKZ A;  5JHA A;  2WP9 B;  2KLC A;  2K25 A;  3AE3 B;  4TKN A;  4M00 A;  3VRA B;  3L4P A;  3I57 A;  2QC8 A;  4E71 A;  2PEA A;  4W9H A;  2KC1 A;  1QOB A;  3PLV A;  4BOZ B;  3NUH B;  4HRS A;  5J17 A;  2KHW B;  4M8N A;  5IP4 D;  2RDG A;  1B1Z A;  4GSW A;  1KOT A;  4ZRP A;  1T3Q A;  4W9I A;  2GBJ A;  3GS2 A;  4OVV A;  2ON8 A;  1WJN A;  2WXQ A;  2KN4 A;  2JU6 X;  2KMA A;  2SEB D;  2KT7 A;  1WXS A;  2FE8 A;  2KLG A;  3QX1 A;  1WI0 A;  4B0E A;  4KV2 A;  2FCS A;  1C77 A;  1FCC C;  4IDI A;  5KHQ A;  1FFU A;  5BMI A;  2KVZ A;  2N7J A;  5D6J B;  3PRZ A;  1BT0 A;  4AJY B;  3I3T B;  1GNU A;  5DPS A;  5GXG B;  2I1J A;  2Z0E B;  2MJ3 A;  1WX7 A;  2ZW0 A;  4USA A;  3R3M A;  1N60 A;  1AWD A;  2YVC A;  1TS5 A;  1VZ8 A;  1WXV A;  1SJH D;  2UYZ B;  1SJE D;  1Z2M A;  4XE0 A;  4IWP A;  5LNK 1;  4OW0 A;  5HHD G;  1ROE A;  4S17 A;  4KDI C;  1L2N A;  5CHW A;  3DDC B;  1N61 A;  2MBE A;  2LRW A;  2DYM A;  3AH7 A;  1N5X A;  4EOY A;  3H6N A;  4YSZ B;  1V5T A;  3OJ4 B;  3H8H A;  3AED B;  2MA9 B;  2FCN A;  2J0J A;  2W82 A;  2HDE A;  4HPM B;  3VUX A;  2WQY B;  2IYD B;  1H4R A;  3R2I A;  1KLU D;  4GMV A;  3BVG A;  1D6E C;  1UH6 A;  3RPF C;  2BBC A;  3CF6 E;  3ZYY X;  2J53 A;  1YN3 A;  5BMH A;  4CO7 A;  3MC8 A;  1UGM A;  3RT3 B;  3L13 A;  1PQS A;  2IGD A;  2J0K A;  2W3S A;  1IUE A;  1V5O A;  2WGS A;  1VZ7 A;  2PJH A;  4NAW A;  2LEK A;  1E8Y A;  3Q3O C;  2K1F A;  1M94 A;  2YEP B;  3KWL A;  4G3X B;  4DHJ B;  1FNU A;  2J52 A;  3V60 A;  1WXA A;  1QIL A;  2L1A A;  2DEN B;  3CWI A;  2FCQ A;  5G5H A;  1K53 A;  3R66 C;  4NQK E;  4D2K A;  1TZO A;  3UIN B;  2JY6 A;  5DCN A;  3PRM B;  5E6N A;  3KQ4 A;  3AN1 A;  1ESF A;  1VLB A;  2WDQ B;  1LFD A;  2FUG 1;  3DBR I;  3IXS A;  2EKI A;  3NS1 A;  4HEA 1;  4KDL B;  4BBN F;  2JYE A;  1NYR A;  4M8M A;  4MT5 A;  2IO3 B;  4KVG B;  1R4N I;  2M19 A;  1R4M B;  3MJ5 A;  4O1N A;  4LNN A;  4LK0 M;  1K50 A;  5EE1 A;  1MJD A;  1CQV A;  1TIF A;  1ZGU B;  1OQR A;  4XDC A;  4W9K A;  1LXD A;  2KTF A;  2PE9 A;  4IUM B;  3APF A;  4W9E A;  2K8H A;  4A6Q A;  2ASQ A;  2MWS B;  4JE3 B;  1WFY A;  1WZ0 A;  2YLM A;  1EWC A;  2BYE A;  2X38 A;  3KYC D;  3NVW A;  4FHK A;  4HCN B;  4KSL C;  4ZRK A;  2KFK A;  2KZR A;  1FPY A;  3ZTD A;  2BYT A;  5C3J B;  1RM6 C;  2CS4 A;  1C4A A;  1I35 A;  3ZKJ C;  1JRU A;  3AE1 B;  1OTR B;  4HPP A;  5AZF A;  1L4Z B;  2Q5W D;  1UBQ A;  3ZO5 B;  1L0X B;  1E90 A;  2M17 A;  4KZ0 A;  5G2N A;  2M1M A;  3M63 B;  3V6E B;  4GU2 A;  4K7W A;  2Y3A A;  5JZE B;  4IKG A;  4AOF A;  4HRO A;  4RMA A;  1SSN A;  2AQ2 B;  4LLG M;  5EE9 A;  1MHX A;  1I4H A;  2G3Q B;  3ZLZ A;  4N58 A;  2JF5 A;  4Q2J A;  4X57 B;  2CHW A;  2O6V D;  3SEB A;  3IAS 1;  1EU3 A;  5D7G A;  2M0X A;  4WQM A;  2R2O A;  4TSS A;  2JX5 A;  2L05 A;  3BK2 A;  2LGX A;  3NOB A;  5D94 A;  1I4R A;  3RUI B;  2C7H A;  3DBH I;  1V2Y A;  4TQ1 A;  3ZXV A;  1MG4 A;  3ZNH B;  1E10 A;  2OED A;  4UDU C;  5D3D A;  4OVU A;  1TKY A;  3A4R A;  3O65 B;  1DOX A;  3A1Q B;  2XK5 B;  2WXG A;  1WRI A;  3IFW B;  2IO1 B;  1PFD A;  4N9F 4;  2JQR B;  1FO4 A;  3W2D A;  4GDL B;  3TMP B;  1NI2 A;  5JH5 C;  1P9D U;  4HK2 A;  4P1B C;  1XEE A;  4YT0 B;  2AQ1 B;  3H7P B;  3K9P B;  3ZNI D;  3TEZ A;  3KW5 B;  3TUO A;  4BKT A;  3ZNZ B;  2DBY A;  1EU4 A;  4PS8 A;  2WDT B;  2DX5 B;  2IGG A;  3X23 A;  3DBL I;  1NI3 A;  2D3C A;  4F8C B;  3WAP A;  2M8S A;  3RYT A;  4LNK A;  2QDF A;  2FUH B;  3PZ7 A;  2R61 A;  3U2S C;  2V4L A;  2KAN A;  3P2B A;  4P1C C;  2GBR A;  4HWI B;  2KJH B;  1E5W A;  1WGG A;  2LJI A;  1F1H A;  2KAJ A;  2WXH A;  1L0V B;  1TBE A;  3OJ3 A;  2JPH A;  3JW0 X;  3PHW B;  1WH3 A;  2LGS A;  3NHE B;  4YTM B;  3X0W A;  2MCN B;  1BUI C;  3AUL A;  3SDL C;  2LXA A;  4JWU C;  4MGI E;  1LM8 B;  2DLB A;  5AUI A;  1VDV A;  4KSK C;  1YX6 B;  4K3C A;  2XN9 C;  3ALB A;  3N32 A;  4ZHP A;  4ZRJ A;  1C3T A;  4FJV B;  3RNA C;  2JWZ A;  1YN5 A;  2QCZ A;  3EEC A;  2KVR A;  3P1M A;  3P63 A;  2MEK A;  2ZVO A;  3SFD B;  2L0T A;  2NR2 A;  2GBN A;  4K7S A;  1J8C A;  4YWG G;  2BTE A;  1FXA A;  4DWF A;  4WWN A;  4C7Z A;  2KMC A;  3RZW C;  2NMQ A;  1IPG A;  1D5Z C;  3ZNG C;  1KFY B;  1ET6 A;  2MBO A;  4B6W A;  3PT2 B;  2CHZ A;  3PTF C;  2WHI A;  3ZJV A;  3QCA A;  2LAS A;  3EHV A;  3ZJT A;  3U4E G;  2IGH A;  3A1Q A;  2XK5 A;  2WXM A;  1YQ3 B;  2V3N A;  3WAL A;  1AAR A;  4M0W A;  4GDL A;  1WGR A; 
#chains in the Genus database with same CATH homology
 1VZ6 A;  4IDI A;  1HEZ E;  4RFB A;  3R8B A;  1FFU A;  2WDV B;  1FRR A;  5BMG A;  5BMI A;  2N7J A;  2XNA C;  2ONQ A;  3HUI A;  2DYO A;  3I9V 1;  4WWM A;  1E0Z A;  4A9A A;  2Y5P A;  3BVM A;  5GXG B;  1TY2 A;  4RGM A;  5G5G A;  1E7P B;  1STE A;  3Q8B A;  2MJ3 A;  3IAM 1;  2L32 A;  3U52 E;  1R7S A;  2ZW0 A;  4USA A;  4C56 C;  1KRH A;  1N60 A;  4YSY B;  1AWD A;  1TS5 A;  1VZ8 A;  3BVZ A;  2SAK A;  4OZA A;  3BYT B;  3NVY A;  1SJH D;  2BS2 B;  2QIL A;  2BW2 A;  3EUB 2;  1KTK A;  1SJE D;  1P7E A;  3HVZ A;  3P4P B;  4A8X C;  2W55 A;  4XE0 A;  3AE7 B;  5LNK 1;  3BWU D;  4OW0 A;  1GPX A;  3TEY A;  5HHD G;  1ENF A;  1FMA D;  1TJE A;  2N0S B;  3NRZ A;  1ROE A;  2VZK B;  4KKI A;  3EGR A;  3Q8E A;  1JWS D;  1HZ5 A;  2V0G A;  4RGN A;  4WH4 A;  1JWB D;  1RFK A;  1N61 A;  2WXO A;  2DYM A;  3AH7 A;  3O13 A;  1N5X A;  3V3X A;  4R3D A;  4OHJ A;  2K9X A;  4YSZ B;  2WXI A;  3H8H A;  3AED B;  3T3N A;  1IGC A;  4YTN B;  1XLP A;  2W82 A;  1SXT A;  2HDE A;  3AE5 B;  1IBX B;  1WSP A;  3Q8A A;  4L23 A;  2WXL A;  1MPE A;  2WQY B;  1VJK A;  5FR3 A;  2WXK A;  2I2Y A;  3R2I A;  1CZP A;  1KLU D;  2WXN A;  3ZQ4 A;  4OVZ A;  1V1P A;  1F0Z A;  1ZPS A;  4A90 A;  1QOA A;  3BVG A;  2RMM A;  1D6E C;  1T5X D;  1DGJ A;  1PGB A;  3RPF C;  1DYQ A;  3AB5 A;  4B0M A;  1MI0 A;  2BBC A;  2JWU A;  3ZYY X;  2J53 A;  1YN3 A;  3B2F A;  2W3R A;  5BMH A;  5T8I A;  2WU5 B;  3VR8 B;  2G9H D;  3ZGZ A;  1Q10 A;  1VR9 A;  3DWM A;  2CU3 A;  1HQR D;  1XLN A;  2ACZ B;  3R2T A;  4NAM A;  1J7C A;  1GOZ A;  2IGD A;  2W3S A;  1IUE A;  1D5M C;  3NVV A;  4N6E B;  1VZ7 A;  2I38 A;  1V97 A;  1GB1 A;  2LEK A;  2PLP A;  4YSX B;  5BYS A;  1HXY D;  2YEP B;  3KWL A;  3DWG C;  2NTT A;  4IOI E;  3VR9 B;  1UWX A;  2J52 A;  1FNU A;  2CJO A;  2J4X A;  4KX6 B;  2PW9 A;  1JWA D;  1FFV A;  1QIL A;  2L1A A;  2Y5C A;  3CWI A;  2CJN A;  2JSV X;  5G5H A;  1QOG A;  1QLB B;  1K53 A;  4D2K A;  1D5X C;  1YQ4 B;  3AMZ A;  3MP9 A;  5H92 C;  5FKA C;  3PO0 A;  2WLB A;  2WDR B;  1TZO A;  1MHH E;  4XWW A;  4OZC A;  1TKG A;  3AN1 A;  3KQ4 A;  1JML A;  3ABV B;  4AS1 A;  1ESF A;  3IT4 B;  2FBW B;  1C9F A;  4ZYS A;  1N5W A;  1WGK A;  1VLB A;  2WDQ B;  4C7Y A;  4DXF A;  2QIE B;  1I4G A;  2FUG 1;  2INN E;  1D4B A;  3IXS A;  2J42 A;  2AQ3 B;  3MC0 B;  1F2R I;  2EKI A;  1ZE3 D;  3NS1 A;  4HEA 1;  1V1O A;  1HA5 A;  4GLS C;  2JYE A;  4TMA B;  1K51 A;  1NYR A;  3HVD A;  3MHZ A;  2MH7 A;  2L52 A;  4LTU A;  2N9L A;  2WS3 B;  1PGX A;  4MT5 A;  2KDM A;  1JWU D;  2M19 A;  1JAL A;  2KQ4 X;  3MJ5 A;  4O1N A;  4US8 A;  2RPV A;  4YTP B;  4LK0 M;  1AYF A;  1K50 A;  3UI3 A;  5EE1 A;  1CQV A;  1L6V A;  1NVI D;  1ZXH A;  5HI1 A;  1OQR A;  4XDC A;  3MFG A;  1XCT L;  1GAQ B;  1XXG A;  1TS4 A;  1FCL A;  2BT6 A;  1XLQ A;  1L5P A;  2PMV A;  2LFI A;  3SFE B;  4ZRQ A;  3C8Y A;  3AEF B;  4A6Q A;  3P4R B;  4JE3 B;  1FIQ A;  3P4Q B;  2H88 B;  4ARI A;  1EWC A;  1LO5 D;  2WU2 B;  1YJJ A;  2V3P A;  1KLG D;  2X38 A;  5MPO A;  5BYQ A;  3NVW A;  4PT5 A;  5HFY A;  1TYG B;  2PVO D;  1TS3 A;  3FIL B;  2Z8L A;  4CQN A;  1YNT E;  1I7H A;  3B2G A;  2PIA A;  3BZD B;  5H8Y E;  2WXP A;  3RFZ B;  4YXD B;  1QOF A;  1JWM D;  2BYT A;  5C3J B;  1VRA B;  1RM6 C;  3LB8 C;  1C4A A;  1UGJ A;  2WXR A;  3AE1 B;  2EEL A;  3P42 A;  1KH0 A;  4ARC A;  3OWE B;  1OQQ A;  1L4Z B;  2KMM A;  1DOY A;  5D3I B;  2Q5W D;  2LHD A;  3HRD D;  2QEJ C;  1L0X B;  2QSD A;  2D5G A;  1L6U A;  2WXJ A;  1OFF A;  3N9Y C;  1SE4 A;  1SEB D;  3IT6 B;  2Y3A A;  2K0P A;  3AE6 B;  4IKG A;  4RCO A;  3AE2 B;  2L83 A;  4NZL B;  1IBX A;  4MM3 B;  2AX5 A;  4HRO A;  1IGD A;  2RDH A;  1SSN A;  1FXI A;  1RYJ A;  4KGT A;  2AQ2 B;  1FNV A;  2M0A A;  4LLG M;  5EE9 A;  5C2T B;  1TY0 A;  1PUT A;  1ZP0 B;  1MHX A;  1M4V A;  2ICI A;  5E6J A;  1I4H A;  3NVZ A;  4XWT A;  1PGA A;  4JX1 C;  4N58 A;  4P16 A;  4Q2J A;  3CIR B;  1BXT A;  1ZOY B;  1FNW A;  4WAF A;  4JWS C;  2WNM A;  3BK1 A;  4MH8 A;  4ZOH C;  3SEB A;  3IAS 1;  1EU3 A;  1FM0 D;  2IJ0 A;  5D7G A;  3Q8F A;  4WQM A;  4TSS A;  3VRB B;  2JX5 A;  1T6B X;  3BK2 A;  3W9C B;  1FD6 A;  1WWT A;  2LGI A;  4XDD A;  1I4R A;  5HG2 A;  5TSS A;  4RGO S;  2B76 B;  3AE8 B;  2TSS A;  4TQ1 A;  2K3U A;  1Y56 A;  1E10 A;  3URY A;  2H89 B;  2OED A;  1K52 A;  4UDU C;  5D3D A;  1AW7 A;  1ET9 A;  1TKY A;  2IDY A;  2PVG C;  3P4S B;  1JCK B;  1YJI A;  1JW9 D;  4OZB A;  1N63 A;  4WIP A;  1DOX A;  1QT9 A;  4FXC A;  4KKJ A;  1SF0 A;  2WXG A;  1WRI A;  3AM9 A;  4US9 A;  2GI9 A;  2LUM A;  2GB1 A;  3BII D;  2JZP A;  1PFD A;  4P6V F;  2INP E;  1WXQ A;  2JQR B;  4HKZ E;  3W2D A;  1FO4 A;  4GDL B;  2JYT A;  1TS2 A;  2V4I B;  1TKE A;  2K5P A;  2W54 A;  1XEE A;  4YT0 B;  2AQ1 B;  1SB3 C;  3TEZ A;  4MAC A;  2HTM E;  1CJE A;  1SE3 A;  1HZ6 A;  4REZ A;  4AQ7 A;  1F2R C;  2QJL A;  1N62 A;  3TUO A;  3KWV A;  1XCQ L;  3W5V B;  2DBY A;  1EU4 A;  2YEP F;  3U7Z A;  1I4X A;  3B9J A;  1PYW D;  1L4D B;  2IGG A;  1UWM A;  2VZK D;  4RNA A;  1EWY C;  2MJD A;  1ZDX A;  3FAH A;  4L1B A;  4TQ0 A;  1NI3 A;  2G1E A;  3GB1 A;  3FC4 A;  4L2Y A;  1C78 A;  4ITK A;  3PZ7 A;  1I4Q A;  2R61 A;  3U2S C;  2LMC A;  1RWS A;  4HKQ A;  5I4D A;  1XF5 L;  1XLO A;  1PDX A;  1QQR A;  2NTS A;  2M56 B;  2WXF A;  3AE9 B;  1YMH E;  2K22 A;  3ETR A;  3J9C A;  3SR6 A;  2BS4 B;  4EE2 A;  4N59 A;  1ZUD 2;  2BS3 B;  4GDK B;  1A70 A;  2LJI A;  2WXH A;  2KAJ A;  1L0V B;  1SE2 A;  4H2A A;  3AEC B;  4DXG A;  1SIJ A;  4RF1 A;  3GP7 A;  3KLS X;  3BYY B;  1F77 A;  3FIL A;  3W5U B;  3EA6 A;  2PTL A;  4ZHO A;  3AV8 A;  1QF6 A;  3VQI A;  1V1P B;  5FK9 C;  1C4P A;  2BB6 A;  3AEG B;  4RGT A;  2PKO A;  1BUI C;  1JRP A;  4YTM B;  1L0Y B;  3Q69 A;  1JQ4 A;  4JWU C;  2DLB A;  3E56 A;  3TSS A;  1J7A A;  1UNS A;  5AUI A;  1VDV A;  2IPK D;  1DOI A;  1P7F A;  3T3O A;  1WYG A;  1C4C A;  3V05 A;  1C76 A;  1I4P A;  2JXT A;  3Q8C A;  4JPS A;  1NEN B;  1UUP A;  2XN9 C;  2E3T A;  1EM7 A;  1E6E B;  1XO3 A;  4A55 A;  1FEH A;  4ZHP A;  2BB5 A;  3PZ8 A;  4NAW B;  3AEA B;  1FRD A;  1YN5 A;  4RF0 A;  1NYQ A;  2KAC A;  2DWQ A;  1ACC A;  1V8C A;  1ZXI A;  1QKZ A;  3P1M A;  2WP9 B;  3P63 A;  1J7B A;  3AE3 B;  2MEK A;  5JXV A;  3SFD B;  3VRA B;  1CK1 A;  3L4P A;  3I57 A;  1NEK B;  2N9K A;  3LXF A;  5EE3 A;  2E6X A;  4J3O D;  1C79 A;  1QOB A;  2LHE A;  4NJC A;  4YWG G;  2BTE A;  3NUH B;  1FXA A;  2KWD A;  4RH6 A;  5AUK A;  4HRS A;  1B9R A;  1E9M A;  4C7Z A;  3TEW A;  5BYR A;  1BML C;  3LYY A;  2NMQ A;  3AE4 B;  1GB4 A;  4WUR A;  3NZ3 A;  2RDG A;  1D5Z C;  2OHF A;  1B1Z A;  3E9S A;  4HJG E;  4KGS A;  3WCQ A;  3ZJU A;  4ZRP A;  1KFY B;  1ET6 A;  1T3Q A;  2QMT A;  3AEE B;  5EE0 A;  1MVK A;  3GS2 A;  2MJE A;  1ZDV A;  3AEB B;  1YN4 A;  3ZJV A;  3TEX A;  1KF6 B;  1JRO A;  2ON8 A;  2ZW1 A;  3ZJT A;  3U4E G;  2IGH A;  2WXQ A;  4KGR A;  2KN4 A;  2WXM A;  2JU6 X;  1YQ3 B;  2GRI A;  2SEB D;  2V3N A;  2FE8 A;  3W1S A;  1SBB B;  1AN8 A;  4B0E A;  4M0W A;  4DQO C;  4C80 A;  1C77 A;  1FCC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...