1FM0D

Molybdopterin synthase (moad/moae)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
81
structure length
81
Chain Sequence
MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDOPTERIN CONVERTING FACTOR, SUBUNIT 1
publication title Crystal structure of molybdopterin synthase and its evolutionary relationship to ubiquitin activation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 23
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2000-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fm0D00
3EUB2 4KX6B 1WGKA 2QJLA 3P4QB 1QLBB 4YSZB 1OQQA 2QIEB 1FFVA 2BT6A 3AEAB 4IDIA 1CJEA 1NI3A 1JROA 1NYQA 2DBYA 1E6EB 2DWQA 1NEKB 4YT0B 3B9JA 1FIQA 3AE8B 1N63A 5EE3A 2ACZB 3AE5B 4YSYB 1WRIA 3AH7A 1N61A 1ZP0B 2L52A 1T3QA 1TKEA 4N58A 1N5WA 1JRPA 1XLOA 1J7CA 1QOAA 3AECB 5EE9A 3AE4B 3AN1A 2K9XA 5H92C 1TYGB 2BS4B 3AE7B 3KWLA 3VR8B 1RM6C 1ZOYB 1A70A 3AV8A 2G1EA 1FXAA 2PKOA 3DWMA 1XLQA 1XO3A 1L5PA 2FBWB 3AE1B 3AEEB 1SIJA 1ZUD2 4HRSA 1F0ZA 1GPXA 1YQ4B 2WDVB 3VRAB 3WCQA 1ROEA 2CU3A 2M56B 1N5XA 2WU5B 2PIAA 2PVOD 2WLBA 3ABVB 2JQRB 1UWMA 1QT9A 4C80A 3PO0A 3LB8C 3P4PB 1FO4A 1RYJA 3P1MA 2BS2B 3NVYA 3AE3B 1DGJA 2W54A 3ZYYX 1N60A 3VRBB 2L83A 2H88B 2N0SB 1PDXA 1OFFA 1WWTA 3ETRA 1CZPA 2WDQB 1JALA 1L0VB 1VJKA 5MPOA 2WU2B 3AB5A 1I7HA 3AEDB 3AM9A 5AUIA 3AE2B 1NYRA 1JWBD 5GXGB 1J7BA 3B2FA 2K22A 2W3SA 3AMZA 2CJOA 3SFDB 3HUIA 3W5UB 2BS3B 1J7AA 2KAJA 1QF6A 2CJNA 3NRZA 4HROA 2JX5A 1E9MA 1SF0A 2B76B 2K5PA 3NS1A 4P6VF 1YJJA 2LEKA 4N59A 1AYFA 5EE0A 3SR6A 1TKYA 4JWUC 1DOIA 2WDRB 4US9A 1QOBA 5C2TB 4WQMA 1B9RA 2WS3B 1FFUA 3DWGC 1XLPA 4YTNB 5AUKA 2W3RA 3AEFB 1XLNA 1YJIA 3HVZA 1E10A 1JQ4A 1YQ3B 2HTME 1WXQA 3B2GA 4YTMB 1FRDA 4ZHPA 1AWDA 1QOFA 1V8CA 1FRRA 2Y5CA 5G5GA 1DOXA 2MJDA 1TKGA 1QOGA 1JWAD 4ZOHC 5EE1A 1TJEA 2MJEA 5H8YE 1PUTA 1E7PB 1ZXIA 2PVGC 2W55A 3P4RB 1RWSA 4US8A 1WYGA 3AEBB 1KF6B 4USAA 3HRDD 1RFKA 1SB3C 4JX1C 1E0ZA 2MJ3A 2OHFA 2KMMA 3L4PA 4LTUA 1L6UA 1R7SA 3NVVA 1OQRA 1NENB 3VR9B 1GAQB 3NVWA 1VLBA 4A9AA 3P4SB 2M19A 4JWSC 4WWMA 2EKIA 3SFEB 1FXIA 1FMAD 3CWIA 2E3TA 3P63A 2MH7A 4YSXB 1KRHA 3CIRB 3BIID 3NVZA 1DOYA 4YXDB 4YTPB 3AE6B 3FAHA 3AEGB 2H89B 3W5VB 3W9CB 4C7YA 5C3JB 4FXCA 1V97A 4ITKA 4N6EB 5G5HA 1N62A 4C7ZA 2WP9B 3LXFA 2WQYB 4ZHOA 3FC4A 3RPFC 1NVID 1VDVA 1EWYC 1FM0D 1L6VA 2AX5A 3AE9B 1KFYB 2Q5WD 1PFDA 1JW9D 1IUEA
chains in the Genus database with same CATH superfamily
2GMIC 3NZUA 4BBNC 3DBHB 3WA0A 2QCZA 2KVRA 4TV3A 3RULA 3AE8B 4YSYB 4ANVA 2AQ2B 1Z5SB 3AE4B 2FCNA 1WXSA 1FCLA 1EF5A 2K39A 4ANXA 2JVCA 4MJSB 3U30A 4MGIE 1GOZA 3Q3NC 4D2KA 2Y5PA 4B0EA 5CHFA 3L54A 4E71A 4JPSA 1EU3A 3ABVB 4AQ7A 3Q8BA 1WXAA 2MBQA 3ZYYX 4GDKA 4NQKE 2KZRA 3AEDB 4MSQB 5IKCM 1WJ6A 2CJOA 3FILA 1EUVB 2PMVA 1QF6A 2WXMA 2LEKA 4CYEA 2V3NA 2FE8A 5C2TB 2GBRA 2J7QB 3V3XA 1B9RA 3JVZX 3DWGC 5G2NA 3WANA 2W3RA 3TL5A 3H7PA 1C9FA 2Z59B 4EFOA 2LGSA 1I4XA 2IGGA 4MSMB 3PSEB 2WXFA 3GB1A 1K51A 3NUHB 4LTUA 3RN9C 3TUOA 2KFKA 2KDMA 3PREA 4YSXB 1F9JA 3Q69A 4NAWB 2YEPF 3NVZA 3W9CB 4IM0A 2N1VA 4N6EB 3R2IA 4PK1A 4IM2A 1F1HA 2AX5A 4IWOA 3T8MA 3AE9B 4DXAB 3RNGC 2D3CA 3ZUNA 2QJLA 2JYEA 2VZKD 3VH3B 4W9DA 3WAOA 2DWQA 4B95A 1GUAB 2ACZB 4GN1A 4HPMB 1WXMA 3DBLI 1WRDB 3DWMA 4A20A 2PTLA 1D5ZC 1ZUD2 3OJ4B 1T5XD 4OHJA 2N4FA 4LJOB 4OZCA 2JQRB 1SE9A 4KZCA 4IUMB 3SU8X 2LI5A 3P1MA 3BY4B 3EA6A 4BZAA 2QMTA 3WAPA 1TS5A 3N32A 1Y8RC 1WWTA 1JWUD 4G50A 1MJDA 1C1YB 3AULA 4WWOA 3VFKA 3A9KB 2M1MA 2C5LC 3N1XC 2I1JA 2ZNVC 1UBQA 2J0JA 1L2NA 2KMAA 4W9EA 2L00B 3HK0A 3ZGZA 3PZ8A 2L1AA 2MA9B 4YTNB 2ZPNA 2N1WA 2BYFA 1XLNA 3QA8A 4NPNA 1TBEA 1KM7A 1PGXA 3MC8A 5GMVA 3DVGY 3Q3MC 4RCOA 2K3UA 1JWAD 2FAZA 4EUTA 4AP4C 5HHDG 2O6VD 2AWTA 2KJRA 1E0ZA 2OHFA 2WXNA 4HWIB 4FJZA 5IO9A 2MX2A 2OJRA 1VLBA 4TQ0A 1V80A 3P4SB 2JSVX 2MBOA 4RGMA 3ZJVA 3KYDD 3KWVA 5G5HA 3IBEA 2WP9B 3VHTC 1V1PB 2KKCA 3PLUA 1M94A 3B08A 4DDGD 3MTNB 3CSTA 3WIMA 4IDIA 2BT6A 4KSKC 1HEZE 1NEKB 1FIQA 4HK2A 2G3QB 1N61A 3AH7A 2L52A 5HI1A 2JWZA 4UDUC 1GNUA 4L1BA 2HDEA 3M3JA 5C23A 1ZOYB 4GGQA 3IHPC 3BVGA 2CU3A 4OVVA 1L7YA 3QARA 4G0NB 2LXCA 3UINB 3P4PB 1OEYJ 3K9PB 4MGKE 2KO3A 4BFRA 4IC7B 2N0SB 3P2BA 2X38A 2AYOB 1T0SC 1WR6E 1JWBD 2IDYA 1WFYA 1J7AA 3NY5A 1GG3A 2HJ8A 3ZXVA 1IPGA 3NHEB 3RI7C 1F2RC 3BYYB 2K0PA 2CJNA 2GI9A 1HZ5A 3I57A 3QK0A 4FHKA 3M95A 3DHGC 2WDRB 4AJYB 4MACA 4KVGB 3I3TB 1C78A 3W1SA 1FFUA 1GC6A 2ON8A 3VUYA 3DVNU 3EFUA 2KX0A 3ECIA 3L08A 1FRRA 3L17A 1QOGA 2KJHB 1AW7A 5CHVC 1TJEA 1BUIC 4WJNA 2SAKA 4RFBA 4C00A 2KMCA 1VZ6A 4MT5A 2CHWA 1CK1A 3C19A 4II2B 1FXTB 1F77A 3BINA 2G4SA 4C7YA 3NS8A 2KFJA 4KIKA 4O1NA 1RFAA 5DCNA 3H7SA 1JWSD 5TSSA 4EZKA 4DK5A 1MG8A 3DBRI 3DVGX 4KGSA 1ET6A 1E6EB 1KLVA 4BKGA 2Z8LA 4FJYA 3VTVA 2KOXA 2Y5BB 4IWPA 1HE8A 1KH0A 2V0GA 1D5XC 3SDLC 3VR8B 5J17A 4W9FA 3DBHI 1NDDA 1XLQA 1V6EA 3U8ZA 4G11A 3APFA 3RT3B 2MBBB 3DBLB 3LB8C 2KT7A 3D32A 4YWGG 1N60A 3V6CB 1BXTA 1L4DB 3ETRA 3VTWA 1UF0A 3AM9A 1QQRA 1VRAB 5E6OA 1P7FA 2BS3B 4EKUA 2JZPA 1V2YA 1V81A 2KAJA 3VQIA 2G45B 1SJED 2JY6A 1SF0A 1VZ7A 4P1BC 3L13A 1J8CA 2ZVOA 2FUG1 2QDFA 4US9A 2BB5A 1UWXA 1TGZB 4K7WA 4RF0A 2LVPA 3IT4B 3KH0A 5D6JB 2KTRB 4WWNA 1I4GA 5D2MB 4HKZE 4ZHPA 2UU7A 4ZOHC 5EE1A 2FCSA 2JXXA 1VZ8A 3W2DA 2GB1A 3PPAA 3Q3JA 3R7RA 1ZE3D 4FADA 2W82A 2KDFB 2KTFA 4JWSC 3V05A 1WE6A 2MH7A 4YTPB 1KLUD 4ITKA 1T0QC 1FD6A 3K9OB 2JXTA 2N7EA 3ZNZB 3PLVA 1JW9D 4RF1A 3UI3A 1OQQA 3H9DA 1WIAA 1TZOA 1N63A 2XEWA 4GB9A 4BOSC 4B9KA 2CR5A 5HG2A 1V5TA 2ZJDA 4K3CA 1EM7A 1PGBA 2G1EA 3O65B 1MHHE 2LGXA 1L5PA 2K8BA 2FBWB 5FKAC 3V61A 5DPSA 2VRRB 3MJWA 3WCQA 2L7RA 1EF1A 2PVOD 1UWMA 1XXGA 4LNFA 4LCDE 2JUOA 2BQQA 1RLFA 2C7HA 3APCA 4FN2A 3A33B 2L83A 2BF8B 2WDQB 3MFGA 3PS6A 3SFDB 2NMQA 2ZZPB 1N6ZA 4BBNF 1ZDVA 2B3AA 1YJJA 1AYFA 1S3SG 1PQSA 1SGHA 4WQMA 2D3GA 1XLPA 5AUKA 5D3DA 3BK1A 1P7EA 1V1OA 4NY0A 1K50A 3BVMA 3M62B 3N3KB 2WX1A 3WALA 3ML8A 1VCBA 4NAWA 3E9SA 1UBIA 4ANWA 2I2YA 2NBVB 1WXVA 2IO3B 2KWUB 2BKFA 4LJPB 3I9V1 1FMAD 1WM2A 4I6NB 4EEWA 1SBBB 5JH5C 2SEBD 4C7ZA 3LXFA 2NCNA 3UIPB 5BMIA 2KN5A 4DWFA 2WXKA 3AN1A 4HKQA 1ZKHA 2L05A 3RNCC 1ZXHA 5EE3A 5J2RA 5CTRC 3URYA 3BYTB 4N58A 2RGFA 1QOAA 1WGRA 4J3OD 3U4EG 2ZW1A 2A5UA 3PV1A 3PRZA 4ICVA 4XGAB 3TEWA 2QEJC 3RNEC 4XZ4A 1PYWD 2PKOA 2DZMA 3Q2AC 3AE1B 3AEEB 2MBHA 4HRSA 4FBJB 4W9KA 2PIAA 4JGHB 2FCMA 4L23A 2HE7A 2K25A 1RYJA 3A9KA 1YN3A 3DBSA 5JHAA 3CSFA 4HCNB 2H88B 1OFFA 5BMHA 3AB5A 4GLSC 3ZVVA 1J7BA 5CHWA 1HTQA 2HD5B 2RDGA 1DYQA 4P6VF 2PE9A 4ZYSA 3HHMA 2X8XX 3TEYA 2ZNVB 3PZ7A 1V9JA 1XT9B 4J6IA 4BKTA 2KVZA 1MI0A 2JRHA 2DENB 3W1YA 3ZJTA 1C3TA 2I38A 3B2GA 2KQ4X 3TEXA 3C8YA 4DXFA 5AEKB 1QOFA 1YIWA 2O6VA 4H2AA 2MJEA 2XNAC 4N9F4 1E7PB 2MP2B 3B0AA 1UGMA 1WZ0A 1WYGA 1IBXB 3L4PA 4XWTA 1L6UA 1OQRA 4A90A 4XC2A 3DPDA 1V1PA 4NJ6A 2IYDB 1ZGUB 5AZGA 4HPLB 1I4PA 3CMMB 2WXHA 2L0FA 4RNAA 3GE3C 4HPPA 3AI5A 1PFDA 4GU2A 4ZRPA 3TMPB 3ZDMC 3EUB2 2GBNA 2YVCA 1NI3A 1NYQA 1ZPSA 2IGHA 3IT6B 1BMLC 2ICIA 5IN7A 3NZSA 3R3MA 1TYGB 4FHJA 1MHXA 1I42A 1CMXB 3JSVA 1ROEA 2MBEA 3PO0A 1D3ZA 1I35A 4XDDA 3Q3OC 3KVFB 2KX3A 2KDEB 3ZNGC 1VJKA 1A5RA 1IGDA 4EOYA 4LNNA 4A8XC 2D2QA 2CKHB 3H6NA 2QSDA 4HROA 4OW0A 5KHOA 4GSWA 5IA7A 2GOWA 4M8MA 4GXBA 2ASQA 2DYBA 2GLSA 2D07B 3ZIMA 3H8HA 3A9JB 5HFYA 1FCCC 1JQ4A 2KNBA 1WXQA 1FRDA 2V4LA 4AUQC 3QHTA 3LJ3A 5FR3A 3TCAA 1P9DU 1WGDA 4JL9A 1RFKA 3FKYA 1M4VA 3RYTA 1NENB 3U7DA 4HXDA 5BO4B 4YL8A 3FAHA 3EECA 2UWQA 1JCKB 1UNSA 3A4SC 3L16A 1FNUA 1LO5D 2MEKA 3SHQA 2E6XA 1JROA 1I4RA 1YD8U 2DBYA 2N9EB 1RRBA 5D7GA 1TKEA 4CO7A 1J7CA 2JT4B 4B6WA 2ZCBA 1RAXA 1WE7A 5J18A 3KWLA 1RM6C 2DYOA 2RPVA 5JZEB 1TT5B 1Q0WB 1YNTE 2WDVB 4K1RB 4DQOC 2NR2A 1VD2A 1XF5L 2WLBA 3ML9A 2RD0A 2J4XA 2BS2B 2MSED 1SIFA 2W54A 2J0MA 1GJZA 2KD0A 3HIZA 1CZPA 1WI0A 1YJ1A 1KOTA 1MVKA 1WF9A 2ZW0A 4AS1A 3VVWB 2UYZB 3R7QA 1E90A 2KTRA 4MGZE 5EE0A 5D94A 1GB4A 4ASWC 3L10B 1TKYA 3RNFC 5E6NA 4IKGA 1ENFA 3OLMD 3RCZA 2MRPA 4ANUA 2DAFA 1SJHD 1LM8B 4WJPA 2C9WB 3PTFC 4NJCA 4WJQA 1E8WA 2VH2A 1WGHA 3Q3FA 3E56A 1CQVA 4L2YA 5H8YE 2O2VB 2PVGC 3QCAA 1HA5A 2EMSA 1KF6B 3Q8AA 2MJ3A 1UZXB 2C7MB 2MQJA 1C4PA 4XWWA 3W5VB 3ZTDA 4E3CA 3GE8C 2PEAA 2WHIA 3GZNI 3N20C 2ZCCA 5I4DA 2FIDA 4IWQA 3UF8A 1C79A 3UQBA 1T0YA 3ENEA 3P4QB 3UIOB 4WIPA 3PRMB 4C4VB 4YT0B 2LFIA 1N5WA 1JRPA 1XLOA 3MHZA 5H92C 2BS4B 3TEZA 4PYUA 3RZFA 3R2TA 2BBCA 4W9GA 4BKSD 3NG0A 1C4AA 2CHZA 1QT9A 4AWJA 4MM3B 1YN5A 1TZ1A 1TIFA 1H8CA 2BPSA 2JZ3B 4G3XB 3SEBA 3Q14C 1JALA 4A55A 1WM3A 3LYYA 4HDOA 5CX3A 1C76A 2JF5A 3N1ZC 2WXPA 1YOVB 2NBWB 4IOIE 1E9MA 1WX9A 2OOBB 1E8YA 5E6JA 4N59A 4F7ZA 3T3NA 2KWVB 4ZYNA 1QOBA 3PVLA 4M8NA 4II3B 1TS2A 2DZJA 1E10A 5IP4D 1I4HA 1HZ6A 2KQ7A 2ONQA 2J42A 1ZXIA 4W9LA 2W55A 3X23A 3UQAA 1RWSA 1SB3C 1WR1A 2K6DB 2INDC 2MLBA 2PLPA 1R7SA 1ZW7A 3V62A 3EC8A 5JXVA 2D11A 4KSLC 4ZRJA 5TR5A 1I4QA 1KLGD 2WXJA 2NTTA 1VDVA 4KGTA 1L6VA 3Q6BA 2C60A 2LZ6A 1Q10A 1Y56A 3IAS1 4KX6B 4OZAA 1SE3A 4K81A 1QLBB 3T3OA 3AEAB 2DX5B 2C7NB 1G6JA 2CU1A 4CQNA 4A6QA 4XE0A 2LRUA 2AQ3B 3WAMA 2WXQA 2IO1B 2D10A 3PGEA 3PRPB 4FA6A 2J53A 2BVCA 3QC8B 3VAWA 3PZDA 5DPRA 2WXGA 2AL3A 4F1SA 4HDQA 2KWDA 3ALBA 2L8JA 4OVZA 1TY2A 1N5XA 1OQYA 1OGWA 4DHJD 4DHJB 2J0KA 2GBMA 3V6EB 4Q2JA 3AE3B 1QILA 2NTSA 4MJSA 2XK5B 4B0MA 3SD5A 2OEDA 2KK8A 3MC9A 4DHZB 3QJZA 2M8SA 2ZVNA 2J52A 3NRZA 2BWES 2L3ZA 2WXOA 3MP9A 2B76B 4BAXA 1Z2MA 1R4MI 2DZIA 1D6EC 1L0XB 2LRWA 3ZTCA 3A4RA 4RGOS 3J9CA 5L83A 2MP2A 2RSUA 1IBXA 2Y5CA 3BK2A 4PS8A 1QKZA 2Y3AA 3QX1A 1WYWB 4XDCA 1F2RI 2QHOA 4FLHA 1WY8A 3MJ5A 4USAA 4JX1C 2NS5A 4GDLB 3NVVA 1V5OA 4M00A 4FJVB 2BYTA 3TSSA 4WWMA 1E7UA 3PT2B 2MW5A 4AJWA 3RMKC 1AARA 1B1ZA 1GC7A 1NVID 2DLBA 2MHJA 1E8ZA 1WJUA 1V49A 4WWPA 4PYZA 3UGBB 1WGKA 3I5JC 3GZNB 4YSZB 2KACA 4WURA 4TSSA 3KUZA 2LVOA 5LXHA 2V9HA 3ZXRA 4TMAB 1SXTA 4MELA 1XO3A 2LGIA 2ZPYA 1F0ZA 2CHXA 3VRAB 2KHWB 2NPTB 3RFZB 2ZEQA 1IP9A 2BKRB 2K6QA 4K7UA 2LASA 4DXGA 2KDBA 1T6BX 4HJGE 3ZRCA 3X0WA 3U2SC 2Z0DB 3AMZA 3NOBA 2JPHA 4MGYE 4JIOU 3KLSX 4XX5A 2FUHB 2BW2A 1K52A 2D5GA 4NQLB 2LUEA 3A9JA 1OEYA 1DOIA 3A1QB 2GRIA 2WS3B 1L0YB 3W1SC 2REXA 4W9IA 2RPQA 4A3PA 4DBGA 1HXYD 1F52A 4S0RA 5G5GA 3TJPA 3KUDB 4W9CA 1UELA 5DPTA 2I1KA 3PHXB 1KJTA 3Q8CA 2KMMA 4KDLB 3VR9B 1GAQB 2LHEA 2EKIA 3MC0B 1FXIA 4QAYA 2INCC 2BB6A 2JRIB 2WDTB 4RH6A 4YXDB 2MWSB 2EELA 2WYQA 4TQ1A 2HTHA 2OJWA 3OAWA 3KUCB 3L0WB 4MDKE 3GS2A 3EFCA 3S2AA 3VTUA 2L0TA 1ET9A 1WRIA 3RD2A 4M01A 2K9XA 2AEHA 5L95C 2BYEA 1D5MC 3O13A 1JMLA 3VXWA 1HQRD 1YQ4B 2N9LA 3EHVA 2KLGA 2YEPB 4LDTD 4MH8A 2N9KA 3BZDB 4LDTB 1HTOA 4S17A 5IAAC 3DHIC 1Q1OA 5BYQA 1WJ4A 2N9PC 3GP7A 2IY0B 3TBLD 3U52E 2LUMA 4XYCA 5GXGB 2K22A 2IBIB 3W5UB 5E6PA 3NS1A 4JWUC 1C77A 3BVZA 5LNK1 4CHKA 3C0RB 2DZKA 3AEFB 2O2VA 3HVZA 1YQ3B 2N7JA 1R4MB 4RM8A 4TKNA 2HTME 2KLCA 4OVUA 1TS3A 1V8CA 2MJDA 1D4BA 2LGDA 4GIVA 3ZNID 2G4DB 3AEBB 2VZKB 3RUIB 1E8XA 4FULA 2R2OA 2M19A 4M0WB 3SFEB 3BIID 4BOZB 2H89B 1Q5WB 2JYTA 3LDZE 4W9JA 4DDID 4ZHOA 1OTRB 1NI2A 4C4VA 3NZ3A 3RPFC 4IW0A 1V86A 4RGTA 1KFYB 2LJ5A 1C4CA 1XD3B 1WMHB 4NJ7A 2QIEB 1TTNA 3IXSA 3GOEA 5IOIA 4TUUA 1STEA 2M0XA 2QC8A 3JW0X 3VUXA 2LVQA 1ESFA 4KGRA 4X57B 4PS3A 1MG4A 2JU6X 4BKSA 3QAQA 3QQ8B 4MM3A 5BMGA 3T9LA 3ZLZA 2M56B 4EZJA 3ONSA 2BGFA 4PT5A 4K7SA 2PW9A 5AZHA 4LNIA 5T8IA 3NVYA 4K3BA 4ICUA 1NYRA 3B2FA 3OWEB 5AZFA 4GDKB 3H1UA 3DOWA 3APDA 3R8BA 4NZLB 2G9HD 2JX5A 2K5PA 4NAMA 2O6VB 1P98A 4LK0M 3FILB 3OG5A 4NNJB 4WH4A 2RMMA 3DVNV 4HVBA 3QWZB 4YTMB 1WSPA 4AOFA 2IPKD 1TKGA 2PE6B 3N1YC 1PUTA 4RM9A 1L4ZB 4WJOA 3H7PB 1LGRA 3P4RB 3IFWB 1TS4A 1UUPA 2W9NA 2WXLA 2PPHA 4A9AA 1YX6B 3V60A 4BVUC 3DCGA 3CWIA 3P63A 2D3BA 1YMHE 2LMCA 3QIJA 4W9HA 4M02A 1N62A 1WJNA 4IM3A 2KFKB 2KJ6A 2N7DA 1NBFC 2V3PA 2AL6A 4HCPB 2LXAA 5JHBA 2NVUI 4WAFA 1R4NI 3NJTA 3JSVB 3ZNHB 4A3OA 1ZP0B 1T3QA 2GBJA 2IZVB 2MCNB 2K1FA 3Q8FA 1A70A 1FXAA 1P0RA 3U7ZA 3B1LX 2XK5A 2WGSA 4C80A 4KV2A 2LGYA 3VH4B 2LD9A 1EO6A 1WX7A 1ACCA 5LLIA 4ZRKA 4JQWC 1SSNA 2WX0A 5BYRA 1L0VB 2BTEA 2WU2B 1JWMD 1WH3A 4GOCA 2KN4A 2M17A 3AE2B 1K8RB 2W3SA 4EE2A 3I63C 1GB1A 2KWCA 1LQBA 1U4AA 1TY0A 1UH6A 3SR6A 1XQQA 4LNKA 2L32A 1J19A 3HVDA 2V3SA 3ZDTA 1YQBA 3AU4A 3RZWC 5EDSA 1AWDA 4WQOB 1DOXA 4MEMA 4GDLA 3ZKJC 4KKIA 2L76A 3HM3A 2DHZA 1EU4A 2NBUA 2D3AA 1SE4A 4US8A 1BT0A 3HRDD 1IYFA 2DNFA 2M4NA 2IJ0A 3NVWA 4HJKA 2CS4A 2XBBC 3AE6B 4WAAA 1SE2A 2RDBC 3FC4A 4GMVA 4KKJA 1EWYC 2Q5WD 2Z0EB 1IUEA 3MHSD 2YLMA 5HKHA 1WX8A 1FFVA 1EWCA 1CJEA 2INNE 2DAJA 1UD7A 2K8HA 3DHHC 1FNWA 4HLEA 3ZW3A 1LFDA 2EKEC 2WNMA 5EE9A 2IO0B 3N30A 3BWUD 2NPTA 3AE7B 1ISNA 2JWUA 3JYUA 1SIJA 1GPXA 1E5WA 5D3IB 2KC1A 2A4ZA 1FNVA 1FO4A 1DGJA 3VRBB 4KDIC 4PS7A 1I7HA 2KC2A 2KDIA 1MFWA 2R61A 3IVFA 1FPYA 3A1QA 2K8CA 3P42A 2LHDA 3R66C 2M0AA 2RDHA 5FK9C 3Q8EA 2WWZA 2QILA 4E74A 5KHQA 4OZBA 1JRUA 2GBKA 1WZ3A 2VH1A 2BWFA 1XEEA 1IGCA 2V1YA 2IGDA 2PJHA 1LXDA 5C1ZA 3AU5A 2AQ1B 4P7IA 1WGYA 5FR6A 1AN8A 5BYSA 3KQ4A 4ZDVA 2FCQA 2JZZA 1PGAA 3KW5B 2E3TA 2KYWA 1KRHA 3AEGB 5C3JB 4FXCA 2WQYB 1XCQL 3ZRFA 5AUIA 1E7VA 1K53A 4JLCA 4KIKB 1P1AA 2IO2B 1S1QB 4ACFA 4F8CB 4R3DA 3B9JA 3TIXA 2WXIA 3AE5B 3M63B 4P16A 1T0RC 2KXJA 3DQVA 3PHWB 4I6PA 3AECB 1FEHA 1R4NB 3AV8A 3HM6X 4RGNA 1VR9A 3ZJUA 1XCTL 4KZ0A 4I6LB 4P1CC 4REZA 2WU5B 1X1MA 2RR9A 4EZLA 2KANA 4DHZE 3RNAC 1J0GA 2WXRA 3VUWA 2FNJB 1PDXA 1QZEA 5MPOA 5G55A 3VDZA 4LNOA 1UGJA 1SEBD 1ZDXA 2IY1B 4ZRQA 5DPWA 4LLGM 3HUIA 3ZQ4A 2R2QA 3IAM1 2LWPA 3DDCB 4MH0E 2BYVE 1H4RA 3OJ3A 3N9YC 3EGRA 4C56C 4URKA 2TSSA 3KYCD 3IG3A 1YX5B 4HEA1 4ZRIA 1YJIA 3CF6E 4IG7B 3ZO5B 2LJIA 2XN9C 1KTKA 2KQSA 1MPEA 4ARIA 2DYMA 4M0WA 1P3QU 2N9XA 4ARCA 3RNBC 1YN4A 5LXIB 2INPE 3CIRB 1DOYA 3DBRB 3AXCA 1WMHA 1V97A 2FIFA 4JE3B 2EMTA 1WGGA 1FM0D 2HJ1A 4RMAA 2V4IB
chains in the Genus database with same CATH topology
1C4CA 3UI3A 3P4QB 1OQQA 2QIEB 3IXSA 4WIPA 1STEA 4YT0B 1TZOA 3AE8B 1N63A 4YSYB 2LFIA 2AQ2B 1ESFA 1N5WA 1JRPA 1XLOA 4KGRA 5HG2A 3MHZA 3AE4B 2JU6X 5H92C 1FCLA 2BS4B 1EM7A 3TEZA 5BMGA 1PGBA 2G1EA 1MHHE 5FKAC 1L5PA 2FBWB 1GOZA 4D2KA 3R2TA 2Y5PA 2BBCA 4B0EA 3WCQA 2M56B 4JPSA 1EU3A 3ABVB 2PVOD 1C4AA 1UWMA 1XXGA 4AQ7A 1QT9A 4PT5A 2PW9A 3Q8BA 4MM3B 1YN5A 5T8IA 3NVYA 3SEBA 3ZYYX 2L83A 2WDQB 1JALA 3AEDB 4A55A 1NYRA 3B2FA 3LYYA 3MFGA 3OWEB 3SFDB 2CJOA 3FILA 4GDKB 2NMQA 1C76A 2WXPA 2PMVA 4IOIE 3R8BA 4NZLB 1QF6A 2G9HD 1E9MA 2JX5A 1ZDVA 2K5PA 2WXMA 1YJJA 2LEKA 4N59A 1AYFA 4NAMA 5E6JA 4LK0M 3FILB 3T3NA 2V3NA 2FE8A 1QOBA 5C2TB 4WQMA 4WH4A 2RMMA 3V3XA 1B9RA 3DWGC 1XLPA 5AUKA 2W3RA 5D3DA 1TS2A 3BK1A 1P7EA 1E10A 1V1OA 1C9FA 4YTMB 1I4HA 1HZ6A 1WSPA 2IPKD 1K50A 1I4XA 3BVMA 2IGGA 1TKGA 1PUTA 2ONQA 1L4ZB 2J42A 1ZXIA 2WXFA 2W55A 3GB1A 1RWSA 3P4RB 3E9SA 1SB3C 1TS4A 1UUPA 1K51A 3NUHB 4LTUA 2PLPA 1R7SA 2WXLA 2I2YA 4A9AA 3TUOA 3I9V1 5JXVA 1FMAD 3CWIA 2KDMA 3P63A 4YSXB 3Q69A 4NAWB 2YEPF 3NVZA 1YMHE 1I4QA 2LMCA 1SBBB 3W9CB 2SEBD 4N6EB 3R2IA 1N62A 1KLGD 3LXFA 4C7ZA 2WXJA 2NTTA 5BMIA 1VDVA 4KGTA 2AX5A 1L6VA 3AE9B 2WXKA 3AN1A 2V3PA 1Q10A 1Y56A 3IAS1 4KX6B 4OZAA 2QJLA 1SE3A 4HKQA 2JYEA 1QLBB 2VZKD 3T3OA 3AEAB 2DWQA 4WAFA 1ZXHA 5EE3A 4A6QA 4CQNA 2ACZB 3URYA 3BYTB 1ZP0B 4XE0A 1T3QA 2AQ3B 4N58A 2WXQA 1QOAA 2J53A 4J3OD 3U4EG 3Q8FA 2ZW1A 3TEWA 1A70A 2QEJC 1FXAA 1PYWD 2PKOA 2WXGA 3DWMA 2KWDA 2PTLA 1D5ZC 3AE1B 3AEEB 1ZUD2 4HRSA 3U7ZA 4OHJA 1T5XD 1TY2A 4OVZA 1N5XA 2PIAA 4OZCA 2JQRB 4L23A 4C80A 1RYJA 3P1MA 1YN3A 4Q2JA 1ACCA 3AE3B 3EA6A 1QILA 2NTSA 2QMTA 1TS5A 2H88B 4B0MA 1OFFA 1WWTA 1SSNA 2OEDA 5BYRA 5BMHA 1L0VB 2BTEA 2WU2B 3AB5A 4GLSC 1JWUD 1JWMD 2KN4A 3AE2B 1J7BA 2W3SA 4EE2A 1GB1A 2V4IB 2RDGA 1DYQA 2J52A 3NRZA 1TY0A 2WXOA 3MP9A 2B76B 4P6VF 3SR6A 4ZYSA 3ZGZA 1D6EC 3TEYA 2L32A 3PZ8A 3HVDA 1L0XB 2L1AA 3PZ7A 4YTNB 4RGOS 1MI0A 1XLNA 3J9CA 3ZJTA 1PGXA 2I38A 2KQ4X 3B2GA 3C8YA 3TEXA 1AWDA 4DXFA 1IBXA 1QOFA 2Y5CA 1DOXA 3BK2A 4H2AA 1QKZA 2K3UA 2Y3AA 4KKIA 1JWAD 4RCOA 1EU4A 2MJEA 2XNAC 1E7PB 5HHDG 4XDCA 1F2RI 1SE4A 4US8A 1WYGA 3MJ5A 4USAA 3HRDD 1E0ZA 4JX1C 1IBXB 2OHFA 2WXNA 3L4PA 4GDLB 4XWTA 1L6UA 3NVVA 2IJ0A 1OQRA 4A90A 3NVWA 1VLBA 4TQ0A 2BYTA 1V1PA 3P4SB 4WWMA 3TSSA 2JSVX 1I4PA 3AE6B 4RGMA 3ZJVA 1SE2A 3KWVA 5G5HA 1B1ZA 2WP9B 2WXHA 1V1PB 3FC4A 4RNAA 1NVID 2DLBA 4KKJA 1EWYC 2Q5WD 1PFDA 4ZRPA 1IUEA 3EUB2 1WGKA 4YSZB 2KACA 4IDIA 1FFVA 2BT6A 1EWCA 1CJEA 1NI3A 2INNE 4WURA 1NYQA 1ZPSA 2IGHA 1HEZE 1NEKB 3IT6B 1BMLC 1FIQA 2ICIA 4TSSA 3AH7A 1FNWA 1N61A 2L52A 5HI1A 4UDUC 2WNMA 5EE9A 4L1BA 1TYGB 3BWUD 3AE7B 2HDEA 1ZOYB 4TMAB 1SXTA 1MHXA 2JWUA 1XO3A 2LGIA 3BVGA 1F0ZA 1SIJA 1GPXA 3VRAB 1ROEA 2CU3A 5D3IB 3RFZB 3PO0A 3P4PB 1FO4A 1FNVA 4XDDA 1DGJA 3VRBB 2N0SB 4DXGA 1VJKA 2X38A 1I7HA 1T6BX 4HJGE 1IGDA 2R61A 1JWBD 2IDYA 3U2SC 4A8XC 3AMZA 1J7AA 3KLSX 3P42A 2LHDA 2QSDA 1F2RC 1K52A 2BW2A 2D5GA 2CJNA 2GI9A 2K0PA 2M0AA 2RDHA 3BYYB 4HROA 1HZ5A 3I57A 5FK9C 3Q8EA 4OW0A 2QILA 4OZBA 1DOIA 2WDRB 2GRIA 4MACA 1C78A 3W1SA 2WS3B 1FFUA 2ON8A 1L0YB 3H8HA 5HFYA 1FCCC 1XEEA 1JQ4A 1IGCA 1HXYD 1WXQA 1FRDA 2IGDA 5G5GA 1FRRA 1QOGA 5FR3A 1AW7A 2AQ1B 1TJEA 1BUIC 1AN8A 2SAKA 1RFKA 3Q8CA 1M4VA 4RFBA 2KMMA 5BYSA 3KQ4A 3VR9B 1NENB 1GAQB 1VZ6A 4MT5A 1PGAA 2LHEA 2EKIA 3MC0B 1FXIA 1CK1A 2E3TA 2BB6A 1KRHA 4RH6A 1F77A 4YXDB 3FAHA 3AEGB 5C3JB 4C7YA 2EELA 4FXCA 4TQ1A 2WQYB 1JCKB 1XCQL 1UNSA 4O1NA 5AUIA 1K53A 3GS2A 1FNUA 1LO5D 2MEKA 1JWSD 5TSSA 2E6XA 1JROA 1I4RA 1ET6A 1E6EB 2DBYA 4KGSA 4R3DA 3B9JA 2WXIA 1ET9A 2Z8LA 3AE5B 4P16A 1WRIA 5D7GA 1TKEA 1KH0A 1J7CA 2V0GA 3AECB 1D5XC 2K9XA 1FEHA 3KWLA 3VR8B 1RM6C 2DYOA 3AV8A 1D5MC 2RPVA 4RGNA 3O13A 1VR9A 1XLQA 1JMLA 3ZJUA 1HQRD 1XCTL 1YNTE 1YQ4B 2N9LA 2WDVB 4DQOC 2YEPB 1XF5L 4REZA 2WU5B 2WLBA 4MH8A 2N9KA 3BZDB 3LB8C 2J4XA 2BS2B 5BYQA 2W54A 2WXRA 4YWGG 1N60A 1BXTA 1PDXA 1L4DB 3GP7A 3ETRA 1CZPA 5MPOA 1MVKA 2ZW0A 1UGJA 3AM9A 3U52E 1SEBD 2LUMA 5GXGB 1ZDXA 4ZRQA 1QQRA 2K22A 1VRAB 4LLGM 3HUIA 1P7FA 3W5UB 2BS3B 3ZQ4A 2JZPA 4AS1A 3IAM1 2KAJA 3VQIA 1SJED 1SF0A 1VZ7A 3NS1A 3N9YC 5EE0A 1GB4A 3EGRA 4C56C 1TKYA 4JWUC 2FUG1 1C77A 4US9A 4IKGA 2BB5A 1ENFA 1UWXA 3BVZA 4RF0A 2TSSA 3IT4B 5LNK1 1SJHD 3AEFB 4HEA1 1YJIA 4NJCA 3HVZA 1YQ3B 2N7JA 1I4GA 2HTME 2LJIA 2XN9C 4HKZE 4ZHPA 1TS3A 1V8CA 2MJDA 1KTKA 1D4BA 4ZOHC 3E56A 1CQVA 1MPEA 4L2YA 5EE1A 5H8YE 4ARIA 2DYMA 4M0WA 2PVGC 1VZ8A 3W2DA 1HA5A 3AEBB 1KF6B 2GB1A 3Q8AA 2VZKB 1ZE3D 2MJ3A 2W82A 4ARCA 4JWSC 2M19A 3V05A 3SFEB 1YN4A 1C4PA 2MH7A 2INPE 3CIRB 3BIID 1DOYA 4YTPB 4XWWA 2H89B 2JYTA 3W5VB 1V97A 1KLUD 4ITKA 1FD6A 4ZHOA 5I4DA 4JE3B 3NZ3A 3RPFC 1FM0D 4RGTA 1KFYB 2JXTA 1C79A 1JW9D 4RF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EUB 2;  4KX6 B;  1WGK A;  2QJL A;  3P4Q B;  1QLB B;  4YSZ B;  1OQQ A;  2QIE B;  1FFV A;  2BT6 A;  3AEA B;  4IDI A;  1CJE A;  1NI3 A;  1JRO A;  1NYQ A;  2DBY A;  1E6E B;  2DWQ A;  1NEK B;  4YT0 B;  3B9J A;  1FIQ A;  3AE8 B;  1N63 A;  5EE3 A;  2ACZ B;  3AE5 B;  4YSY B;  1WRI A;  3AH7 A;  1N61 A;  1ZP0 B;  2L52 A;  1T3Q A;  1TKE A;  4N58 A;  1N5W A;  1JRP A;  1XLO A;  1J7C A;  1QOA A;  3AEC B;  5EE9 A;  3AE4 B;  3AN1 A;  2K9X A;  5H92 C;  1TYG B;  2BS4 B;  3AE7 B;  3KWL A;  3VR8 B;  1RM6 C;  1ZOY B;  1A70 A;  3AV8 A;  2G1E A;  1FXA A;  2PKO A;  3DWM A;  1XLQ A;  1XO3 A;  1L5P A;  2FBW B;  3AE1 B;  3AEE B;  1SIJ A;  1ZUD 2;  4HRS A;  1F0Z A;  1GPX A;  1YQ4 B;  2WDV B;  3VRA B;  3WCQ A;  1ROE A;  2CU3 A;  2M56 B;  1N5X A;  2WU5 B;  2PIA A;  2PVO D;  2WLB A;  3ABV B;  2JQR B;  1UWM A;  1QT9 A;  4C80 A;  3PO0 A;  3LB8 C;  3P4P B;  1FO4 A;  1RYJ A;  3P1M A;  2BS2 B;  3NVY A;  3AE3 B;  1DGJ A;  2W54 A;  3ZYY X;  1N60 A;  3VRB B;  2L83 A;  2H88 B;  2N0S B;  1PDX A;  1OFF A;  1WWT A;  3ETR A;  1CZP A;  2WDQ B;  1JAL A;  1L0V B;  1VJK A;  5MPO A;  2WU2 B;  3AB5 A;  1I7H A;  3AED B;  3AM9 A;  5AUI A;  3AE2 B;  1NYR A;  1JWB D;  5GXG B;  1J7B A;  3B2F A;  2K22 A;  2W3S A;  3AMZ A;  2CJO A;  3SFD B;  3HUI A;  3W5U B;  2BS3 B;  1J7A A;  2KAJ A;  1QF6 A;  2CJN A;  3NRZ A;  4HRO A;  2JX5 A;  1E9M A;  1SF0 A;  2B76 B;  2K5P A;  3NS1 A;  4P6V F;  1YJJ A;  2LEK A;  4N59 A;  1AYF A;  5EE0 A;  3SR6 A;  1TKY A;  4JWU C;  1DOI A;  2WDR B;  4US9 A;  1QOB A;  5C2T B;  4WQM A;  1B9R A;  2WS3 B;  1FFU A;  3DWG C;  1XLP A;  4YTN B;  5AUK A;  2W3R A;  3AEF B;  1XLN A;  1YJI A;  3HVZ A;  1E10 A;  1JQ4 A;  1YQ3 B;  2HTM E;  1WXQ A;  3B2G A;  4YTM B;  1FRD A;  4ZHP A;  1AWD A;  1QOF A;  1V8C A;  1FRR A;  2Y5C A;  5G5G A;  1DOX A;  2MJD A;  1TKG A;  1QOG A;  1JWA D;  4ZOH C;  5EE1 A;  1TJE A;  2MJE A;  5H8Y E;  1PUT A;  1E7P B;  1ZXI A;  2PVG C;  2W55 A;  3P4R B;  1RWS A;  4US8 A;  1WYG A;  3AEB B;  1KF6 B;  4USA A;  3HRD D;  1RFK A;  1SB3 C;  4JX1 C;  1E0Z A;  2MJ3 A;  2OHF A;  2KMM A;  3L4P A;  4LTU A;  1L6U A;  1R7S A;  3NVV A;  1OQR A;  1NEN B;  3VR9 B;  1GAQ B;  3NVW A;  1VLB A;  4A9A A;  3P4S B;  2M19 A;  4JWS C;  4WWM A;  2EKI A;  3SFE B;  1FXI A;  1FMA D;  3CWI A;  2E3T A;  3P63 A;  2MH7 A;  4YSX B;  1KRH A;  3CIR B;  3BII D;  3NVZ A;  1DOY A;  4YXD B;  4YTP B;  3AE6 B;  3FAH A;  3AEG B;  2H89 B;  3W5V B;  3W9C B;  4C7Y A;  5C3J B;  4FXC A;  1V97 A;  4ITK A;  4N6E B;  5G5H A;  1N62 A;  4C7Z A;  2WP9 B;  3LXF A;  2WQY B;  4ZHO A;  3FC4 A;  3RPF C;  1NVI D;  1VDV A;  1EWY C;  1FM0 D;  1L6V A;  2AX5 A;  3AE9 B;  1KFY B;  2Q5W D;  1PFD A;  1JW9 D;  1IUE A; 
#chains in the Genus database with same CATH topology
 2GMI C;  3NZU A;  4BBN C;  3DBH B;  3WA0 A;  2QCZ A;  2KVR A;  4TV3 A;  3RUL A;  3AE8 B;  4YSY B;  4ANV A;  2AQ2 B;  1Z5S B;  3AE4 B;  2FCN A;  1WXS A;  1FCL A;  1EF5 A;  2K39 A;  4ANX A;  2JVC A;  4MJS B;  3U30 A;  4MGI E;  1GOZ A;  3Q3N C;  4D2K A;  2Y5P A;  4B0E A;  5CHF A;  3L54 A;  4E71 A;  4JPS A;  1EU3 A;  3ABV B;  4AQ7 A;  3Q8B A;  1WXA A;  2MBQ A;  3ZYY X;  4GDK A;  4NQK E;  2KZR A;  3AED B;  4MSQ B;  5IKC M;  1WJ6 A;  2CJO A;  3FIL A;  1EUV B;  2PMV A;  1QF6 A;  2WXM A;  2LEK A;  4CYE A;  2V3N A;  2FE8 A;  5C2T B;  2GBR A;  2J7Q B;  3V3X A;  1B9R A;  3JVZ X;  3DWG C;  5G2N A;  3WAN A;  2W3R A;  3TL5 A;  3H7P A;  1C9F A;  2Z59 B;  4EFO A;  2LGS A;  1I4X A;  2IGG A;  4MSM B;  3PSE B;  2WXF A;  3GB1 A;  1K51 A;  3NUH B;  4LTU A;  3RN9 C;  3TUO A;  2KFK A;  2KDM A;  3PRE A;  4YSX B;  1F9J A;  3Q69 A;  4NAW B;  2YEP F;  3NVZ A;  3W9C B;  4IM0 A;  2N1V A;  4N6E B;  3R2I A;  4PK1 A;  4IM2 A;  1F1H A;  2AX5 A;  4IWO A;  3T8M A;  3AE9 B;  4DXA B;  3RNG C;  2D3C A;  3ZUN A;  2QJL A;  2JYE A;  2VZK D;  3VH3 B;  4W9D A;  3WAO A;  2DWQ A;  4B95 A;  1GUA B;  2ACZ B;  4GN1 A;  4HPM B;  1WXM A;  3DBL I;  1WRD B;  3DWM A;  4A20 A;  2PTL A;  1D5Z C;  1ZUD 2;  3OJ4 B;  1T5X D;  4OHJ A;  2N4F A;  4LJO B;  4OZC A;  2JQR B;  1SE9 A;  4KZC A;  4IUM B;  3SU8 X;  2LI5 A;  3P1M A;  3BY4 B;  3EA6 A;  4BZA A;  2QMT A;  3WAP A;  1TS5 A;  3N32 A;  1Y8R C;  1WWT A;  1JWU D;  4G50 A;  1MJD A;  1C1Y B;  3AUL A;  4WWO A;  3VFK A;  3A9K B;  2M1M A;  2C5L C;  3N1X C;  2I1J A;  2ZNV C;  1UBQ A;  2J0J A;  1L2N A;  2KMA A;  4W9E A;  2L00 B;  3HK0 A;  3ZGZ A;  3PZ8 A;  2L1A A;  2MA9 B;  4YTN B;  2ZPN A;  2N1W A;  2BYF A;  1XLN A;  3QA8 A;  4NPN A;  1TBE A;  1KM7 A;  1PGX A;  3MC8 A;  5GMV A;  3DVG Y;  3Q3M C;  4RCO A;  2K3U A;  1JWA D;  2FAZ A;  4EUT A;  4AP4 C;  5HHD G;  2O6V D;  2AWT A;  2KJR A;  1E0Z A;  2OHF A;  2WXN A;  4HWI B;  4FJZ A;  5IO9 A;  2MX2 A;  2OJR A;  1VLB A;  4TQ0 A;  1V80 A;  3P4S B;  2JSV X;  2MBO A;  4RGM A;  3ZJV A;  3KYD D;  3KWV A;  5G5H A;  3IBE A;  2WP9 B;  3VHT C;  1V1P B;  2KKC A;  3PLU A;  1M94 A;  3B08 A;  4DDG D;  3MTN B;  3CST A;  3WIM A;  4IDI A;  2BT6 A;  4KSK C;  1HEZ E;  1NEK B;  1FIQ A;  4HK2 A;  2G3Q B;  1N61 A;  3AH7 A;  2L52 A;  5HI1 A;  2JWZ A;  4UDU C;  1GNU A;  4L1B A;  2HDE A;  3M3J A;  5C23 A;  1ZOY B;  4GGQ A;  3IHP C;  3BVG A;  2CU3 A;  4OVV A;  1L7Y A;  3QAR A;  4G0N B;  2LXC A;  3UIN B;  3P4P B;  1OEY J;  3K9P B;  4MGK E;  2KO3 A;  4BFR A;  4IC7 B;  2N0S B;  3P2B A;  2X38 A;  2AYO B;  1T0S C;  1WR6 E;  1JWB D;  2IDY A;  1WFY A;  1J7A A;  3NY5 A;  1GG3 A;  2HJ8 A;  3ZXV A;  1IPG A;  3NHE B;  3RI7 C;  1F2R C;  3BYY B;  2K0P A;  2CJN A;  2GI9 A;  1HZ5 A;  3I57 A;  3QK0 A;  4FHK A;  3M95 A;  3DHG C;  2WDR B;  4AJY B;  4MAC A;  4KVG B;  3I3T B;  1C78 A;  3W1S A;  1FFU A;  1GC6 A;  2ON8 A;  3VUY A;  3DVN U;  3EFU A;  2KX0 A;  3ECI A;  3L08 A;  1FRR A;  3L17 A;  1QOG A;  2KJH B;  1AW7 A;  5CHV C;  1TJE A;  1BUI C;  4WJN A;  2SAK A;  4RFB A;  4C00 A;  2KMC A;  1VZ6 A;  4MT5 A;  2CHW A;  1CK1 A;  3C19 A;  4II2 B;  1FXT B;  1F77 A;  3BIN A;  2G4S A;  4C7Y A;  3NS8 A;  2KFJ A;  4KIK A;  4O1N A;  1RFA A;  5DCN A;  3H7S A;  1JWS D;  5TSS A;  4EZK A;  4DK5 A;  1MG8 A;  3DBR I;  3DVG X;  4KGS A;  1ET6 A;  1E6E B;  1KLV A;  4BKG A;  2Z8L A;  4FJY A;  3VTV A;  2KOX A;  2Y5B B;  4IWP A;  1HE8 A;  1KH0 A;  2V0G A;  1D5X C;  3SDL C;  3VR8 B;  5J17 A;  4W9F A;  3DBH I;  1NDD A;  1XLQ A;  1V6E A;  3U8Z A;  4G11 A;  3APF A;  3RT3 B;  2MBB B;  3DBL B;  3LB8 C;  2KT7 A;  3D32 A;  4YWG G;  1N60 A;  3V6C B;  1BXT A;  1L4D B;  3ETR A;  3VTW A;  1UF0 A;  3AM9 A;  1QQR A;  1VRA B;  5E6O A;  1P7F A;  2BS3 B;  4EKU A;  2JZP A;  1V2Y A;  1V81 A;  2KAJ A;  3VQI A;  2G45 B;  1SJE D;  2JY6 A;  1SF0 A;  1VZ7 A;  4P1B C;  3L13 A;  1J8C A;  2ZVO A;  2FUG 1;  2QDF A;  4US9 A;  2BB5 A;  1UWX A;  1TGZ B;  4K7W A;  4RF0 A;  2LVP A;  3IT4 B;  3KH0 A;  5D6J B;  2KTR B;  4WWN A;  1I4G A;  5D2M B;  4HKZ E;  4ZHP A;  2UU7 A;  4ZOH C;  5EE1 A;  2FCS A;  2JXX A;  1VZ8 A;  3W2D A;  2GB1 A;  3PPA A;  3Q3J A;  3R7R A;  1ZE3 D;  4FAD A;  2W82 A;  2KDF B;  2KTF A;  4JWS C;  3V05 A;  1WE6 A;  2MH7 A;  4YTP B;  1KLU D;  4ITK A;  1T0Q C;  1FD6 A;  3K9O B;  2JXT A;  2N7E A;  3ZNZ B;  3PLV A;  1JW9 D;  4RF1 A;  3UI3 A;  1OQQ A;  3H9D A;  1WIA A;  1TZO A;  1N63 A;  2XEW A;  4GB9 A;  4BOS C;  4B9K A;  2CR5 A;  5HG2 A;  1V5T A;  2ZJD A;  4K3C A;  1EM7 A;  1PGB A;  2G1E A;  3O65 B;  1MHH E;  2LGX A;  1L5P A;  2K8B A;  2FBW B;  5FKA C;  3V61 A;  5DPS A;  2VRR B;  3MJW A;  3WCQ A;  2L7R A;  1EF1 A;  2PVO D;  1UWM A;  1XXG A;  4LNF A;  4LCD E;  2JUO A;  2BQQ A;  1RLF A;  2C7H A;  3APC A;  4FN2 A;  3A33 B;  2L83 A;  2BF8 B;  2WDQ B;  3MFG A;  3PS6 A;  3SFD B;  2NMQ A;  2ZZP B;  1N6Z A;  4BBN F;  1ZDV A;  2B3A A;  1YJJ A;  1AYF A;  1S3S G;  1PQS A;  1SGH A;  4WQM A;  2D3G A;  1XLP A;  5AUK A;  5D3D A;  3BK1 A;  1P7E A;  1V1O A;  4NY0 A;  1K50 A;  3BVM A;  3M62 B;  3N3K B;  2WX1 A;  3WAL A;  3ML8 A;  1VCB A;  4NAW A;  3E9S A;  1UBI A;  4ANW A;  2I2Y A;  2NBV B;  1WXV A;  2IO3 B;  2KWU B;  2BKF A;  4LJP B;  3I9V 1;  1FMA D;  1WM2 A;  4I6N B;  4EEW A;  1SBB B;  5JH5 C;  2SEB D;  4C7Z A;  3LXF A;  2NCN A;  3UIP B;  5BMI A;  2KN5 A;  4DWF A;  2WXK A;  3AN1 A;  4HKQ A;  1ZKH A;  2L05 A;  3RNC C;  1ZXH A;  5EE3 A;  5J2R A;  5CTR C;  3URY A;  3BYT B;  4N58 A;  2RGF A;  1QOA A;  1WGR A;  4J3O D;  3U4E G;  2ZW1 A;  2A5U A;  3PV1 A;  3PRZ A;  4ICV A;  4XGA B;  3TEW A;  2QEJ C;  3RNE C;  4XZ4 A;  1PYW D;  2PKO A;  2DZM A;  3Q2A C;  3AE1 B;  3AEE B;  2MBH A;  4HRS A;  4FBJ B;  4W9K A;  2PIA A;  4JGH B;  2FCM A;  4L23 A;  2HE7 A;  2K25 A;  1RYJ A;  3A9K A;  1YN3 A;  3DBS A;  5JHA A;  3CSF A;  4HCN B;  2H88 B;  1OFF A;  5BMH A;  3AB5 A;  4GLS C;  3ZVV A;  1J7B A;  5CHW A;  1HTQ A;  2HD5 B;  2RDG A;  1DYQ A;  4P6V F;  2PE9 A;  4ZYS A;  3HHM A;  2X8X X;  3TEY A;  2ZNV B;  3PZ7 A;  1V9J A;  1XT9 B;  4J6I A;  4BKT A;  2KVZ A;  1MI0 A;  2JRH A;  2DEN B;  3W1Y A;  3ZJT A;  1C3T A;  2I38 A;  3B2G A;  2KQ4 X;  3TEX A;  3C8Y A;  4DXF A;  5AEK B;  1QOF A;  1YIW A;  2O6V A;  4H2A A;  2MJE A;  2XNA C;  4N9F 4;  1E7P B;  2MP2 B;  3B0A A;  1UGM A;  1WZ0 A;  1WYG A;  1IBX B;  3L4P A;  4XWT A;  1L6U A;  1OQR A;  4A90 A;  4XC2 A;  3DPD A;  1V1P A;  4NJ6 A;  2IYD B;  1ZGU B;  5AZG A;  4HPL B;  1I4P A;  3CMM B;  2WXH A;  2L0F A;  4RNA A;  3GE3 C;  4HPP A;  3AI5 A;  1PFD A;  4GU2 A;  4ZRP A;  3TMP B;  3ZDM C;  3EUB 2;  2GBN A;  2YVC A;  1NI3 A;  1NYQ A;  1ZPS A;  2IGH A;  3IT6 B;  1BML C;  2ICI A;  5IN7 A;  3NZS A;  3R3M A;  1TYG B;  4FHJ A;  1MHX A;  1I42 A;  1CMX B;  3JSV A;  1ROE A;  2MBE A;  3PO0 A;  1D3Z A;  1I35 A;  4XDD A;  3Q3O C;  3KVF B;  2KX3 A;  2KDE B;  3ZNG C;  1VJK A;  1A5R A;  1IGD A;  4EOY A;  4LNN A;  4A8X C;  2D2Q A;  2CKH B;  3H6N A;  2QSD A;  4HRO A;  4OW0 A;  5KHO A;  4GSW A;  5IA7 A;  2GOW A;  4M8M A;  4GXB A;  2ASQ A;  2DYB A;  2GLS A;  2D07 B;  3ZIM A;  3H8H A;  3A9J B;  5HFY A;  1FCC C;  1JQ4 A;  2KNB A;  1WXQ A;  1FRD A;  2V4L A;  4AUQ C;  3QHT A;  3LJ3 A;  5FR3 A;  3TCA A;  1P9D U;  1WGD A;  4JL9 A;  1RFK A;  3FKY A;  1M4V A;  3RYT A;  1NEN B;  3U7D A;  4HXD A;  5BO4 B;  4YL8 A;  3FAH A;  3EEC A;  2UWQ A;  1JCK B;  1UNS A;  3A4S C;  3L16 A;  1FNU A;  1LO5 D;  2MEK A;  3SHQ A;  2E6X A;  1JRO A;  1I4R A;  1YD8 U;  2DBY A;  2N9E B;  1RRB A;  5D7G A;  1TKE A;  4CO7 A;  1J7C A;  2JT4 B;  4B6W A;  2ZCB A;  1RAX A;  1WE7 A;  5J18 A;  3KWL A;  1RM6 C;  2DYO A;  2RPV A;  5JZE B;  1TT5 B;  1Q0W B;  1YNT E;  2WDV B;  4K1R B;  4DQO C;  2NR2 A;  1VD2 A;  1XF5 L;  2WLB A;  3ML9 A;  2RD0 A;  2J4X A;  2BS2 B;  2MSE D;  1SIF A;  2W54 A;  2J0M A;  1GJZ A;  2KD0 A;  3HIZ A;  1CZP A;  1WI0 A;  1YJ1 A;  1KOT A;  1MVK A;  1WF9 A;  2ZW0 A;  4AS1 A;  3VVW B;  2UYZ B;  3R7Q A;  1E90 A;  2KTR A;  4MGZ E;  5EE0 A;  5D94 A;  1GB4 A;  4ASW C;  3L10 B;  1TKY A;  3RNF C;  5E6N A;  4IKG A;  1ENF A;  3OLM D;  3RCZ A;  2MRP A;  4ANU A;  2DAF A;  1SJH D;  1LM8 B;  4WJP A;  2C9W B;  3PTF C;  4NJC A;  4WJQ A;  1E8W A;  2VH2 A;  1WGH A;  3Q3F A;  3E56 A;  1CQV A;  4L2Y A;  5H8Y E;  2O2V B;  2PVG C;  3QCA A;  1HA5 A;  2EMS A;  1KF6 B;  3Q8A A;  2MJ3 A;  1UZX B;  2C7M B;  2MQJ A;  1C4P A;  4XWW A;  3W5V B;  3ZTD A;  4E3C A;  3GE8 C;  2PEA A;  2WHI A;  3GZN I;  3N20 C;  2ZCC A;  5I4D A;  2FID A;  4IWQ A;  3UF8 A;  1C79 A;  3UQB A;  1T0Y A;  3ENE A;  3P4Q B;  3UIO B;  4WIP A;  3PRM B;  4C4V B;  4YT0 B;  2LFI A;  1N5W A;  1JRP A;  1XLO A;  3MHZ A;  5H92 C;  2BS4 B;  3TEZ A;  4PYU A;  3RZF A;  3R2T A;  2BBC A;  4W9G A;  4BKS D;  3NG0 A;  1C4A A;  2CHZ A;  1QT9 A;  4AWJ A;  4MM3 B;  1YN5 A;  1TZ1 A;  1TIF A;  1H8C A;  2BPS A;  2JZ3 B;  4G3X B;  3SEB A;  3Q14 C;  1JAL A;  4A55 A;  1WM3 A;  3LYY A;  4HDO A;  5CX3 A;  1C76 A;  2JF5 A;  3N1Z C;  2WXP A;  1YOV B;  2NBW B;  4IOI E;  1E9M A;  1WX9 A;  2OOB B;  1E8Y A;  5E6J A;  4N59 A;  4F7Z A;  3T3N A;  2KWV B;  4ZYN A;  1QOB A;  3PVL A;  4M8N A;  4II3 B;  1TS2 A;  2DZJ A;  1E10 A;  5IP4 D;  1I4H A;  1HZ6 A;  2KQ7 A;  2ONQ A;  2J42 A;  1ZXI A;  4W9L A;  2W55 A;  3X23 A;  3UQA A;  1RWS A;  1SB3 C;  1WR1 A;  2K6D B;  2IND C;  2MLB A;  2PLP A;  1R7S A;  1ZW7 A;  3V62 A;  3EC8 A;  5JXV A;  2D11 A;  4KSL C;  4ZRJ A;  5TR5 A;  1I4Q A;  1KLG D;  2WXJ A;  2NTT A;  1VDV A;  4KGT A;  1L6V A;  3Q6B A;  2C60 A;  2LZ6 A;  1Q10 A;  1Y56 A;  3IAS 1;  4KX6 B;  4OZA A;  1SE3 A;  4K81 A;  1QLB B;  3T3O A;  3AEA B;  2DX5 B;  2C7N B;  1G6J A;  2CU1 A;  4CQN A;  4A6Q A;  4XE0 A;  2LRU A;  2AQ3 B;  3WAM A;  2WXQ A;  2IO1 B;  2D10 A;  3PGE A;  3PRP B;  4FA6 A;  2J53 A;  2BVC A;  3QC8 B;  3VAW A;  3PZD A;  5DPR A;  2WXG A;  2AL3 A;  4F1S A;  4HDQ A;  2KWD A;  3ALB A;  2L8J A;  4OVZ A;  1TY2 A;  1N5X A;  1OQY A;  1OGW A;  4DHJ D;  4DHJ B;  2J0K A;  2GBM A;  3V6E B;  4Q2J A;  3AE3 B;  1QIL A;  2NTS A;  4MJS A;  2XK5 B;  4B0M A;  3SD5 A;  2OED A;  2KK8 A;  3MC9 A;  4DHZ B;  3QJZ A;  2M8S A;  2ZVN A;  2J52 A;  3NRZ A;  2BWE S;  2L3Z A;  2WXO A;  3MP9 A;  2B76 B;  4BAX A;  1Z2M A;  1R4M I;  2DZI A;  1D6E C;  1L0X B;  2LRW A;  3ZTC A;  3A4R A;  4RGO S;  3J9C A;  5L83 A;  2MP2 A;  2RSU A;  1IBX A;  2Y5C A;  3BK2 A;  4PS8 A;  1QKZ A;  2Y3A A;  3QX1 A;  1WYW B;  4XDC A;  1F2R I;  2QHO A;  4FLH A;  1WY8 A;  3MJ5 A;  4USA A;  4JX1 C;  2NS5 A;  4GDL B;  3NVV A;  1V5O A;  4M00 A;  4FJV B;  2BYT A;  3TSS A;  4WWM A;  1E7U A;  3PT2 B;  2MW5 A;  4AJW A;  3RMK C;  1AAR A;  1B1Z A;  1GC7 A;  1NVI D;  2DLB A;  2MHJ A;  1E8Z A;  1WJU A;  1V49 A;  4WWP A;  4PYZ A;  3UGB B;  1WGK A;  3I5J C;  3GZN B;  4YSZ B;  2KAC A;  4WUR A;  4TSS A;  3KUZ A;  2LVO A;  5LXH A;  2V9H A;  3ZXR A;  4TMA B;  1SXT A;  4MEL A;  1XO3 A;  2LGI A;  2ZPY A;  1F0Z A;  2CHX A;  3VRA B;  2KHW B;  2NPT B;  3RFZ B;  2ZEQ A;  1IP9 A;  2BKR B;  2K6Q A;  4K7U A;  2LAS A;  4DXG A;  2KDB A;  1T6B X;  4HJG E;  3ZRC A;  3X0W A;  3U2S C;  2Z0D B;  3AMZ A;  3NOB A;  2JPH A;  4MGY E;  4JIO U;  3KLS X;  4XX5 A;  2FUH B;  2BW2 A;  1K52 A;  2D5G A;  4NQL B;  2LUE A;  3A9J A;  1OEY A;  1DOI A;  3A1Q B;  2GRI A;  2WS3 B;  1L0Y B;  3W1S C;  2REX A;  4W9I A;  2RPQ A;  4A3P A;  4DBG A;  1HXY D;  1F52 A;  4S0R A;  5G5G A;  3TJP A;  3KUD B;  4W9C A;  1UEL A;  5DPT A;  2I1K A;  3PHX B;  1KJT A;  3Q8C A;  2KMM A;  4KDL B;  3VR9 B;  1GAQ B;  2LHE A;  2EKI A;  3MC0 B;  1FXI A;  4QAY A;  2INC C;  2BB6 A;  2JRI B;  2WDT B;  4RH6 A;  4YXD B;  2MWS B;  2EEL A;  2WYQ A;  4TQ1 A;  2HTH A;  2OJW A;  3OAW A;  3KUC B;  3L0W B;  4MDK E;  3GS2 A;  3EFC A;  3S2A A;  3VTU A;  2L0T A;  1ET9 A;  1WRI A;  3RD2 A;  4M01 A;  2K9X A;  2AEH A;  5L95 C;  2BYE A;  1D5M C;  3O13 A;  1JML A;  3VXW A;  1HQR D;  1YQ4 B;  2N9L A;  3EHV A;  2KLG A;  2YEP B;  4LDT D;  4MH8 A;  2N9K A;  3BZD B;  4LDT B;  1HTO A;  4S17 A;  5IAA C;  3DHI C;  1Q1O A;  5BYQ A;  1WJ4 A;  2N9P C;  3GP7 A;  2IY0 B;  3TBL D;  3U52 E;  2LUM A;  4XYC A;  5GXG B;  2K22 A;  2IBI B;  3W5U B;  5E6P A;  3NS1 A;  4JWU C;  1C77 A;  3BVZ A;  5LNK 1;  4CHK A;  3C0R B;  2DZK A;  3AEF B;  2O2V A;  3HVZ A;  1YQ3 B;  2N7J A;  1R4M B;  4RM8 A;  4TKN A;  2HTM E;  2KLC A;  4OVU A;  1TS3 A;  1V8C A;  2MJD A;  1D4B A;  2LGD A;  4GIV A;  3ZNI D;  2G4D B;  3AEB B;  2VZK B;  3RUI B;  1E8X A;  4FUL A;  2R2O A;  2M19 A;  4M0W B;  3SFE B;  3BII D;  4BOZ B;  2H89 B;  1Q5W B;  2JYT A;  3LDZ E;  4W9J A;  4DDI D;  4ZHO A;  1OTR B;  1NI2 A;  4C4V A;  3NZ3 A;  3RPF C;  4IW0 A;  1V86 A;  4RGT A;  1KFY B;  2LJ5 A;  1C4C A;  1XD3 B;  1WMH B;  4NJ7 A;  2QIE B;  1TTN A;  3IXS A;  3GOE A;  5IOI A;  4TUU A;  1STE A;  2M0X A;  2QC8 A;  3JW0 X;  3VUX A;  2LVQ A;  1ESF A;  4KGR A;  4X57 B;  4PS3 A;  1MG4 A;  2JU6 X;  4BKS A;  3QAQ A;  3QQ8 B;  4MM3 A;  5BMG A;  3T9L A;  3ZLZ A;  2M56 B;  4EZJ A;  3ONS A;  2BGF A;  4PT5 A;  4K7S A;  2PW9 A;  5AZH A;  4LNI A;  5T8I A;  3NVY A;  4K3B A;  4ICU A;  1NYR A;  3B2F A;  3OWE B;  5AZF A;  4GDK B;  3H1U A;  3DOW A;  3APD A;  3R8B A;  4NZL B;  2G9H D;  2JX5 A;  2K5P A;  4NAM A;  2O6V B;  1P98 A;  4LK0 M;  3FIL B;  3OG5 A;  4NNJ B;  4WH4 A;  2RMM A;  3DVN V;  4HVB A;  3QWZ B;  4YTM B;  1WSP A;  4AOF A;  2IPK D;  1TKG A;  2PE6 B;  3N1Y C;  1PUT A;  4RM9 A;  1L4Z B;  4WJO A;  3H7P B;  1LGR A;  3P4R B;  3IFW B;  1TS4 A;  1UUP A;  2W9N A;  2WXL A;  2PPH A;  4A9A A;  1YX6 B;  3V60 A;  4BVU C;  3DCG A;  3CWI A;  3P63 A;  2D3B A;  1YMH E;  2LMC A;  3QIJ A;  4W9H A;  4M02 A;  1N62 A;  1WJN A;  4IM3 A;  2KFK B;  2KJ6 A;  2N7D A;  1NBF C;  2V3P A;  2AL6 A;  4HCP B;  2LXA A;  5JHB A;  2NVU I;  4WAF A;  1R4N I;  3NJT A;  3JSV B;  3ZNH B;  4A3O A;  1ZP0 B;  1T3Q A;  2GBJ A;  2IZV B;  2MCN B;  2K1F A;  3Q8F A;  1A70 A;  1FXA A;  1P0R A;  3U7Z A;  3B1L X;  2XK5 A;  2WGS A;  4C80 A;  4KV2 A;  2LGY A;  3VH4 B;  2LD9 A;  1EO6 A;  1WX7 A;  1ACC A;  5LLI A;  4ZRK A;  4JQW C;  1SSN A;  2WX0 A;  5BYR A;  1L0V B;  2BTE A;  2WU2 B;  1JWM D;  1WH3 A;  4GOC A;  2KN4 A;  2M17 A;  3AE2 B;  1K8R B;  2W3S A;  4EE2 A;  3I63 C;  1GB1 A;  2KWC A;  1LQB A;  1U4A A;  1TY0 A;  1UH6 A;  3SR6 A;  1XQQ A;  4LNK A;  2L32 A;  1J19 A;  3HVD A;  2V3S A;  3ZDT A;  1YQB A;  3AU4 A;  3RZW C;  5EDS A;  1AWD A;  4WQO B;  1DOX A;  4MEM A;  4GDL A;  3ZKJ C;  4KKI A;  2L76 A;  3HM3 A;  2DHZ A;  1EU4 A;  2NBU A;  2D3A A;  1SE4 A;  4US8 A;  1BT0 A;  3HRD D;  1IYF A;  2DNF A;  2M4N A;  2IJ0 A;  3NVW A;  4HJK A;  2CS4 A;  2XBB C;  3AE6 B;  4WAA A;  1SE2 A;  2RDB C;  3FC4 A;  4GMV A;  4KKJ A;  1EWY C;  2Q5W D;  2Z0E B;  1IUE A;  3MHS D;  2YLM A;  5HKH A;  1WX8 A;  1FFV A;  1EWC A;  1CJE A;  2INN E;  2DAJ A;  1UD7 A;  2K8H A;  3DHH C;  1FNW A;  4HLE A;  3ZW3 A;  1LFD A;  2EKE C;  2WNM A;  5EE9 A;  2IO0 B;  3N30 A;  3BWU D;  2NPT A;  3AE7 B;  1ISN A;  2JWU A;  3JYU A;  1SIJ A;  1GPX A;  1E5W A;  5D3I B;  2KC1 A;  2A4Z A;  1FNV A;  1FO4 A;  1DGJ A;  3VRB B;  4KDI C;  4PS7 A;  1I7H A;  2KC2 A;  2KDI A;  1MFW A;  2R61 A;  3IVF A;  1FPY A;  3A1Q A;  2K8C A;  3P42 A;  2LHD A;  3R66 C;  2M0A A;  2RDH A;  5FK9 C;  3Q8E A;  2WWZ A;  2QIL A;  4E74 A;  5KHQ A;  4OZB A;  1JRU A;  2GBK A;  1WZ3 A;  2VH1 A;  2BWF A;  1XEE A;  1IGC A;  2V1Y A;  2IGD A;  2PJH A;  1LXD A;  5C1Z A;  3AU5 A;  2AQ1 B;  4P7I A;  1WGY A;  5FR6 A;  1AN8 A;  5BYS A;  3KQ4 A;  4ZDV A;  2FCQ A;  2JZZ A;  1PGA A;  3KW5 B;  2E3T A;  2KYW A;  1KRH A;  3AEG B;  5C3J B;  4FXC A;  2WQY B;  1XCQ L;  3ZRF A;  5AUI A;  1E7V A;  1K53 A;  4JLC A;  4KIK B;  1P1A A;  2IO2 B;  1S1Q B;  4ACF A;  4F8C B;  4R3D A;  3B9J A;  3TIX A;  2WXI A;  3AE5 B;  3M63 B;  4P16 A;  1T0R C;  2KXJ A;  3DQV A;  3PHW B;  4I6P A;  3AEC B;  1FEH A;  1R4N B;  3AV8 A;  3HM6 X;  4RGN A;  1VR9 A;  3ZJU A;  1XCT L;  4KZ0 A;  4I6L B;  4P1C C;  4REZ A;  2WU5 B;  1X1M A;  2RR9 A;  4EZL A;  2KAN A;  4DHZ E;  3RNA C;  1J0G A;  2WXR A;  3VUW A;  2FNJ B;  1PDX A;  1QZE A;  5MPO A;  5G55 A;  3VDZ A;  4LNO A;  1UGJ A;  1SEB D;  1ZDX A;  2IY1 B;  4ZRQ A;  5DPW A;  4LLG M;  3HUI A;  3ZQ4 A;  2R2Q A;  3IAM 1;  2LWP A;  3DDC B;  4MH0 E;  2BYV E;  1H4R A;  3OJ3 A;  3N9Y C;  3EGR A;  4C56 C;  4URK A;  2TSS A;  3KYC D;  3IG3 A;  1YX5 B;  4HEA 1;  4ZRI A;  1YJI A;  3CF6 E;  4IG7 B;  3ZO5 B;  2LJI A;  2XN9 C;  1KTK A;  2KQS A;  1MPE A;  4ARI A;  2DYM A;  4M0W A;  1P3Q U;  2N9X A;  4ARC A;  3RNB C;  1YN4 A;  5LXI B;  2INP E;  3CIR B;  1DOY A;  3DBR B;  3AXC A;  1WMH A;  1V97 A;  2FIF A;  4JE3 B;  2EMT A;  1WGG A;  1FM0 D;  2HJ1 A;  4RMA A;  2V4I B; 
#chains in the Genus database with same CATH homology
 1C4C A;  3UI3 A;  3P4Q B;  1OQQ A;  2QIE B;  3IXS A;  4WIP A;  1STE A;  4YT0 B;  1TZO A;  3AE8 B;  1N63 A;  4YSY B;  2LFI A;  2AQ2 B;  1ESF A;  1N5W A;  1JRP A;  1XLO A;  4KGR A;  5HG2 A;  3MHZ A;  3AE4 B;  2JU6 X;  5H92 C;  1FCL A;  2BS4 B;  1EM7 A;  3TEZ A;  5BMG A;  1PGB A;  2G1E A;  1MHH E;  5FKA C;  1L5P A;  2FBW B;  1GOZ A;  4D2K A;  3R2T A;  2Y5P A;  2BBC A;  4B0E A;  3WCQ A;  2M56 B;  4JPS A;  1EU3 A;  3ABV B;  2PVO D;  1C4A A;  1UWM A;  1XXG A;  4AQ7 A;  1QT9 A;  4PT5 A;  2PW9 A;  3Q8B A;  4MM3 B;  1YN5 A;  5T8I A;  3NVY A;  3SEB A;  3ZYY X;  2L83 A;  2WDQ B;  1JAL A;  3AED B;  4A55 A;  1NYR A;  3B2F A;  3LYY A;  3MFG A;  3OWE B;  3SFD B;  2CJO A;  3FIL A;  4GDK B;  2NMQ A;  1C76 A;  2WXP A;  2PMV A;  4IOI E;  3R8B A;  4NZL B;  1QF6 A;  2G9H D;  1E9M A;  2JX5 A;  1ZDV A;  2K5P A;  2WXM A;  1YJJ A;  2LEK A;  4N59 A;  1AYF A;  4NAM A;  5E6J A;  4LK0 M;  3FIL B;  3T3N A;  2V3N A;  2FE8 A;  1QOB A;  5C2T B;  4WQM A;  4WH4 A;  2RMM A;  3V3X A;  1B9R A;  3DWG C;  1XLP A;  5AUK A;  2W3R A;  5D3D A;  1TS2 A;  3BK1 A;  1P7E A;  1E10 A;  1V1O A;  1C9F A;  4YTM B;  1I4H A;  1HZ6 A;  1WSP A;  2IPK D;  1K50 A;  1I4X A;  3BVM A;  2IGG A;  1TKG A;  1PUT A;  2ONQ A;  1L4Z B;  2J42 A;  1ZXI A;  2WXF A;  2W55 A;  3GB1 A;  1RWS A;  3P4R B;  3E9S A;  1SB3 C;  1TS4 A;  1UUP A;  1K51 A;  3NUH B;  4LTU A;  2PLP A;  1R7S A;  2WXL A;  2I2Y A;  4A9A A;  3TUO A;  3I9V 1;  5JXV A;  1FMA D;  3CWI A;  2KDM A;  3P63 A;  4YSX B;  3Q69 A;  4NAW B;  2YEP F;  3NVZ A;  1YMH E;  1I4Q A;  2LMC A;  1SBB B;  3W9C B;  2SEB D;  4N6E B;  3R2I A;  1N62 A;  1KLG D;  3LXF A;  4C7Z A;  2WXJ A;  2NTT A;  5BMI A;  1VDV A;  4KGT A;  2AX5 A;  1L6V A;  3AE9 B;  2WXK A;  3AN1 A;  2V3P A;  1Q10 A;  1Y56 A;  3IAS 1;  4KX6 B;  4OZA A;  2QJL A;  1SE3 A;  4HKQ A;  2JYE A;  1QLB B;  2VZK D;  3T3O A;  3AEA B;  2DWQ A;  4WAF A;  1ZXH A;  5EE3 A;  4A6Q A;  4CQN A;  2ACZ B;  3URY A;  3BYT B;  1ZP0 B;  4XE0 A;  1T3Q A;  2AQ3 B;  4N58 A;  2WXQ A;  1QOA A;  2J53 A;  4J3O D;  3U4E G;  3Q8F A;  2ZW1 A;  3TEW A;  1A70 A;  2QEJ C;  1FXA A;  1PYW D;  2PKO A;  2WXG A;  3DWM A;  2KWD A;  2PTL A;  1D5Z C;  3AE1 B;  3AEE B;  1ZUD 2;  4HRS A;  3U7Z A;  4OHJ A;  1T5X D;  1TY2 A;  4OVZ A;  1N5X A;  2PIA A;  4OZC A;  2JQR B;  4L23 A;  4C80 A;  1RYJ A;  3P1M A;  1YN3 A;  4Q2J A;  1ACC A;  3AE3 B;  3EA6 A;  1QIL A;  2NTS A;  2QMT A;  1TS5 A;  2H88 B;  4B0M A;  1OFF A;  1WWT A;  1SSN A;  2OED A;  5BYR A;  5BMH A;  1L0V B;  2BTE A;  2WU2 B;  3AB5 A;  4GLS C;  1JWU D;  1JWM D;  2KN4 A;  3AE2 B;  1J7B A;  2W3S A;  4EE2 A;  1GB1 A;  2V4I B;  2RDG A;  1DYQ A;  2J52 A;  3NRZ A;  1TY0 A;  2WXO A;  3MP9 A;  2B76 B;  4P6V F;  3SR6 A;  4ZYS A;  3ZGZ A;  1D6E C;  3TEY A;  2L32 A;  3PZ8 A;  3HVD A;  1L0X B;  2L1A A;  3PZ7 A;  4YTN B;  4RGO S;  1MI0 A;  1XLN A;  3J9C A;  3ZJT A;  1PGX A;  2I38 A;  2KQ4 X;  3B2G A;  3C8Y A;  3TEX A;  1AWD A;  4DXF A;  1IBX A;  1QOF A;  2Y5C A;  1DOX A;  3BK2 A;  4H2A A;  1QKZ A;  2K3U A;  2Y3A A;  4KKI A;  1JWA D;  4RCO A;  1EU4 A;  2MJE A;  2XNA C;  1E7P B;  5HHD G;  4XDC A;  1F2R I;  1SE4 A;  4US8 A;  1WYG A;  3MJ5 A;  4USA A;  3HRD D;  1E0Z A;  4JX1 C;  1IBX B;  2OHF A;  2WXN A;  3L4P A;  4GDL B;  4XWT A;  1L6U A;  3NVV A;  2IJ0 A;  1OQR A;  4A90 A;  3NVW A;  1VLB A;  4TQ0 A;  2BYT A;  1V1P A;  3P4S B;  4WWM A;  3TSS A;  2JSV X;  1I4P A;  3AE6 B;  4RGM A;  3ZJV A;  1SE2 A;  3KWV A;  5G5H A;  1B1Z A;  2WP9 B;  2WXH A;  1V1P B;  3FC4 A;  4RNA A;  1NVI D;  2DLB A;  4KKJ A;  1EWY C;  2Q5W D;  1PFD A;  4ZRP A;  1IUE A;  3EUB 2;  1WGK A;  4YSZ B;  2KAC A;  4IDI A;  1FFV A;  2BT6 A;  1EWC A;  1CJE A;  1NI3 A;  2INN E;  4WUR A;  1NYQ A;  1ZPS A;  2IGH A;  1HEZ E;  1NEK B;  3IT6 B;  1BML C;  1FIQ A;  2ICI A;  4TSS A;  3AH7 A;  1FNW A;  1N61 A;  2L52 A;  5HI1 A;  4UDU C;  2WNM A;  5EE9 A;  4L1B A;  1TYG B;  3BWU D;  3AE7 B;  2HDE A;  1ZOY B;  4TMA B;  1SXT A;  1MHX A;  2JWU A;  1XO3 A;  2LGI A;  3BVG A;  1F0Z A;  1SIJ A;  1GPX A;  3VRA B;  1ROE A;  2CU3 A;  5D3I B;  3RFZ B;  3PO0 A;  3P4P B;  1FO4 A;  1FNV A;  4XDD A;  1DGJ A;  3VRB B;  2N0S B;  4DXG A;  1VJK A;  2X38 A;  1I7H A;  1T6B X;  4HJG E;  1IGD A;  2R61 A;  1JWB D;  2IDY A;  3U2S C;  4A8X C;  3AMZ A;  1J7A A;  3KLS X;  3P42 A;  2LHD A;  2QSD A;  1F2R C;  1K52 A;  2BW2 A;  2D5G A;  2CJN A;  2GI9 A;  2K0P A;  2M0A A;  2RDH A;  3BYY B;  4HRO A;  1HZ5 A;  3I57 A;  5FK9 C;  3Q8E A;  4OW0 A;  2QIL A;  4OZB A;  1DOI A;  2WDR B;  2GRI A;  4MAC A;  1C78 A;  3W1S A;  2WS3 B;  1FFU A;  2ON8 A;  1L0Y B;  3H8H A;  5HFY A;  1FCC C;  1XEE A;  1JQ4 A;  1IGC A;  1HXY D;  1WXQ A;  1FRD A;  2IGD A;  5G5G A;  1FRR A;  1QOG A;  5FR3 A;  1AW7 A;  2AQ1 B;  1TJE A;  1BUI C;  1AN8 A;  2SAK A;  1RFK A;  3Q8C A;  1M4V A;  4RFB A;  2KMM A;  5BYS A;  3KQ4 A;  3VR9 B;  1NEN B;  1GAQ B;  1VZ6 A;  4MT5 A;  1PGA A;  2LHE A;  2EKI A;  3MC0 B;  1FXI A;  1CK1 A;  2E3T A;  2BB6 A;  1KRH A;  4RH6 A;  1F77 A;  4YXD B;  3FAH A;  3AEG B;  5C3J B;  4C7Y A;  2EEL A;  4FXC A;  4TQ1 A;  2WQY B;  1JCK B;  1XCQ L;  1UNS A;  4O1N A;  5AUI A;  1K53 A;  3GS2 A;  1FNU A;  1LO5 D;  2MEK A;  1JWS D;  5TSS A;  2E6X A;  1JRO A;  1I4R A;  1ET6 A;  1E6E B;  2DBY A;  4KGS A;  4R3D A;  3B9J A;  2WXI A;  1ET9 A;  2Z8L A;  3AE5 B;  4P16 A;  1WRI A;  5D7G A;  1TKE A;  1KH0 A;  1J7C A;  2V0G A;  3AEC B;  1D5X C;  2K9X A;  1FEH A;  3KWL A;  3VR8 B;  1RM6 C;  2DYO A;  3AV8 A;  1D5M C;  2RPV A;  4RGN A;  3O13 A;  1VR9 A;  1XLQ A;  1JML A;  3ZJU A;  1HQR D;  1XCT L;  1YNT E;  1YQ4 B;  2N9L A;  2WDV B;  4DQO C;  2YEP B;  1XF5 L;  4REZ A;  2WU5 B;  2WLB A;  4MH8 A;  2N9K A;  3BZD B;  3LB8 C;  2J4X A;  2BS2 B;  5BYQ A;  2W54 A;  2WXR A;  4YWG G;  1N60 A;  1BXT A;  1PDX A;  1L4D B;  3GP7 A;  3ETR A;  1CZP A;  5MPO A;  1MVK A;  2ZW0 A;  1UGJ A;  3AM9 A;  3U52 E;  1SEB D;  2LUM A;  5GXG B;  1ZDX A;  4ZRQ A;  1QQR A;  2K22 A;  1VRA B;  4LLG M;  3HUI A;  1P7F A;  3W5U B;  2BS3 B;  3ZQ4 A;  2JZP A;  4AS1 A;  3IAM 1;  2KAJ A;  3VQI A;  1SJE D;  1SF0 A;  1VZ7 A;  3NS1 A;  3N9Y C;  5EE0 A;  1GB4 A;  3EGR A;  4C56 C;  1TKY A;  4JWU C;  2FUG 1;  1C77 A;  4US9 A;  4IKG A;  2BB5 A;  1ENF A;  1UWX A;  3BVZ A;  4RF0 A;  2TSS A;  3IT4 B;  5LNK 1;  1SJH D;  3AEF B;  4HEA 1;  1YJI A;  4NJC A;  3HVZ A;  1YQ3 B;  2N7J A;  1I4G A;  2HTM E;  2LJI A;  2XN9 C;  4HKZ E;  4ZHP A;  1TS3 A;  1V8C A;  2MJD A;  1KTK A;  1D4B A;  4ZOH C;  3E56 A;  1CQV A;  1MPE A;  4L2Y A;  5EE1 A;  5H8Y E;  4ARI A;  2DYM A;  4M0W A;  2PVG C;  1VZ8 A;  3W2D A;  1HA5 A;  3AEB B;  1KF6 B;  2GB1 A;  3Q8A A;  2VZK B;  1ZE3 D;  2MJ3 A;  2W82 A;  4ARC A;  4JWS C;  2M19 A;  3V05 A;  3SFE B;  1YN4 A;  1C4P A;  2MH7 A;  2INP E;  3CIR B;  3BII D;  1DOY A;  4YTP B;  4XWW A;  2H89 B;  2JYT A;  3W5V B;  1V97 A;  1KLU D;  4ITK A;  1FD6 A;  4ZHO A;  5I4D A;  4JE3 B;  3NZ3 A;  3RPF C;  1FM0 D;  4RGT A;  1KFY B;  2JXT A;  1C79 A;  1JW9 D;  4RF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...