2LHEA

Gb98-t25i,l20a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
TTYKLILNLKQAKEEAIKEAVDAGIAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational tipping points for switching protein folds and functions.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
molecule keywords Gb98
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2011-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2lheA00
2LUMA 1HZ5A 1FCCC 2IGDA 4HKZE 2LHEA 4IKGA 1XCQL 1UWXA 2I38A 2RPVA 1F2RC 2KACA 2ZW1A 2NMQA 1IBXB 2IGGA 2J52A 1HZ6A 2KN4A 4GLSC 5BMHA 1HEZE 3MP9A 5JXVA 1XCTL 1FCLA 4HJGE 4KGSA 1IBXA 2ONQA 5BMIA 3GB1A 1YNTE 5HI1A 2JSVX 2PTLA 1MPEA 1MHHE 4OZCA 2PLPA 1IGCA 1K53A 4KGRA 2I2YA 1PGXA 2ZW0A 2GI9A 1FD6A 2QSDA 2GB1A 4WH4A 2K0PA 2IGHA 2KQ4X 3V3XA 4D2KA 1IGDA 1MVKA 2JXTA 1GB1A 2KWDA 4OZBA 1P7FA 4IOIE 3FILB 1P7EA 2J53A 2ON8A 2N7JA 1Q10A 5HHDG 2RMMA 5HFYA 1C9FA 4MACA 2JZPA 1KH0A 1ZXHA 4OZAA 1GB4A 2OEDA 2KDMA 1XF5L 4KGTA 1MI0A 2N9LA 1D4BA 1K52A 2QMTA 1JMLA 2EELA 2JU6X 2LHDA 2LGIA 1MHXA 1PGAA 5HG2A 5BMGA 1YMHE 1F2RI 1EM7A 2PW9A 3UI3A 2N9KA 2JWUA 3FILA 1K50A 1K51A 1PGBA 1QKZA
chains in the Genus database with same CATH superfamily
1ZUD2 1JWSD 3V6EB 3OJ3A 2NVUI 3AM9A 4M02A 4BBNF 2WXLA 1I4HA 3ZW3A 2O6VA 3EFCA 4M00A 3RZWC 3H7PA 4YSYB 2AL3A 3Q3MC 2E6XA 1GPXA 1F2RC 3O13A 1Y56A 1ACCA 3QQ8B 2KHWB 4PS8A 1UNSA 2BGFA 1T6BX 1WJ4A 4LK0M 1PUTA 3NJTA 2RDBC 1NYQA 3W9CB 2KN4A 1V97A 4C00A 2GBRA 2LGDA 1V86A 2K8HA 4P6VF 3L4PA 2CU3A 1NYRA 1SB3C 2JRIB 1XCTL 1BMLC 1UGJA 3VXWA 1Q5WB 2N4FA 4WIPA 4OW0A 3I9V1 3QA8A 2C5LC 2DLBA 3IFWB 1GB1A 1MVKA 1PFDA 3ENEA 3IHPC 3CIRB 3VVWB 3U2SC 3BYYB 4O1NA 2ZCBA 4DHJB 2G45B 3RUIB 4ANUA 3KLSX 2MBHA 4N6EB 1MG4A 2M0AA 5E6OA 1T0SC 4ZRJA 2GBKA 1PDXA 3DOWA 4BKSD 1V1OA 5J2RA 2BQQA 2MJ3A 1QLBB 1VJKA 1KLVA 1DOYA 1WIAA 1WXQA 4S0RA 4C80A 3HVDA 1TTNA 3MC9A 3I63C 1EO6A 1E8XA 4J6IA 2JF5A 1T0YA 2X38A 5D3IB 4YWGG 1QF6A 2CU1A 5C2TB 1QQRA 3Q3NC 3KW5B 5EE9A 1L7YA 2WWZA 2RD0A 3BK1A 4K3CA 1Q0WB 5E6JA 3C8YA 2KWUB 4NY0A 1WMHB 2LGXA 4A6QA 3VTUA 1C1YB 1V49A 2W3RA 5G5HA 3VAWA 1T5XD 4W9FA 4FN2A 1D5ZC 3BK2A 4DXFA 2JZZA 3ZLZA 1R4NB 1WX9A 4AOFA 3A9JB 2J52A 1VZ7A 3B9JA 3TEXA 4EOYA 4MH0E 3QC8B 4LJPB 4JL9A 4KKJA 1E8YA 1NEKB 5D7GA 1VDVA 2JXXA 2Y5PA 1RWSA 4JX1C 4PYZA 1F77A 2H88B 1QT9A 4LNIA 2PLPA 1IGCA 1WXSA 4GMVA 2K5PA 3RMKC 3U7ZA 1WSPA 2AYOB 4LDTB 4CYEA 3VH3B 3SEBA 2OJWA 1WJ6A 1XLPA 4NQLB 4BKTA 3GS2A 1JRPA 2MP2B 1JWMD 3DCGA 1XT9B 3AE7B 3B2GA 4D2KA 2WXRA 4C7ZA 3KUCB 2KQSA 3OJ4B 4GXBA 1L4DB 3UINB 4QAYA 1OQRA 4BBNC 2UYZB 4WJPA 4K1RB 4W9EA 3HK0A 1J7AA 3ZYYX 1ENFA 1TGZB 2FCQA 3X0WA 2KDFB 2WDQB 3Q3FA 4OHJA 2ZVNA 3H9DA 3NVWA 4IG7B 5C1ZA 4MGYE 4XZ4A 2DYMA 5BMGA 3W2DA 2ZCCA 1ET9A 2IO3B 1KOTA 3RNEC 4HKQA 4HPPA 5T8IA 3P1MA 4W9IA 2WNMA 2QILA 4LJOB 2KTRA 5EDSA 1E0ZA 2SAKA 1TKYA 2I38A 1NI3A 2JPHA 1Q1OA 4HWIB 1P0RA 1FXIA 4GLSC 3AE2B 2ZPNA 3W5VB 3RNFC 1KTKA 1V2YA 2LWPA 1IBXA 4TSSA 1GJZA 4YSXB 4JQWC 1XLNA 1CMXB 3PSEB 3HRDD 3H7PB 2IO1B 1VLBA 3SD5A 2D11A 3VRAB 2VH1A 2NBVB 1A70A 2KQ4X 3PO0A 2LMCA 4HLEA 2KWCA 2RGFA 4OVVA 1R4MB 1YX5B 4HEA1 2Z8LA 2FCSA 2KMMA 2O2VA 1WI0A 3E56A 4IC7B 3IXSA 2DWQA 1TYGB 2Z0DB 2KVRA 2KTRB 5H92C 3B0AA 3S2AA 2Z59B 3ML8A 1KH0A 2K8BA 2BT6A 1C78A 4FULA 2LFIA 1V1PA 2MCNB 1B9RA 2GBMA 4PT5A 3VQIA 2K25A 1PQSA 3HM3A 2MBEA 2HE7A 3Q6BA 1YQBA 2N7DA 5G2NA 3I5JC 2LHDA 3AEGB 3IVFA 3H1UA 4IW0A 4M0WB 2D07B 3KUZA 2N0SB 3D32A 3BYTB 3RT3B 3WAMA 3W5UB 3L08A 3FC4A 3NUHB 4ZYSA 2L0TA 3EUB2 1G6JA 2MJEA 4IDIA 3AE8B 1E7VA 4W9GA 1EWYC 5J18A 2WXIA 2C9WB 2RPQA 1ROEA 1JRUA 3KWVA 1Z5SB 1ZDXA 3WALA 5DPSA 1AYFA 4GOCA 2WHIA 4TQ0A 3ZJUA 2CHWA 3Q14C 2K8CA 3AEEB 4LLGM 1TKGA 1YN5A 4KGSA 3R7QA 5EE1A 3PRMB 3R8BA 2PTLA 1KF6B 4MH8A 2IPKD 3ZVVA 4DBGA 1UZXB 3MHZA 2DZMA 2CKHB 3SHQA 1WM2A 2G9HD 1FNUA 3DVNV 3APCA 3AXCA 4NNJB 2IBIB 1N5WA 3DBLI 3DPDA 4HXDA 3BZDB 3P42A 3ZUNA 1N61A 2WDRB 2WXHA 1Q10A 5HHDG 4CHKA 4DDGD 4REZA 1EU4A 1IYFA 4WAAA 2QIEB 3RZFA 1D5XC 3HUIA 2W54A 2IO0B 1OEYJ 2X8XX 2V0GA 4L23A 5GXGB 3WA0A 2NS5A 4NAMA 3EC8A 1TBEA 2QMTA 1E6EB 4TKNA 3ZKJC 1KRHA 1YIWA 1IUEA 1ZOYB 2DZJA 2JU6X 5DPWA 2BBCA 1MHXA 5AUKA 1JQ4A 3TUOA 1SJHD 1T0RC 3GOEA 3ZGZA 3MFGA 1YJJA 4G50A 2LRUA 4XYCA 3KYCD 5AZFA 1PGBA 2Y5CA 1I7HA 4CO7A 2KTFA 3CWIA 4EFOA 4M8MA 3L0WB 1XLQA 2MW5A 3B08A 2L0FA 4DXGA 1RFAA 1HXYD 2LUEA 2ZW1A 4A20A 3L16A 2D3CA 5DPTA 1E7PB 1TKEA 1PYWD 2N7EA 1SGHA 2M19A 2FAZA 2BB6A 3VTVA 4ARCA 3RULA 1I4RA 1OGWA 4FBJB 3Q3JA 1L5PA 4K7WA 2VH2A 1V6EA 1TY2A 3V61A 4DWFA 4NAWA 3R7RA 3UQAA 2KANA 1OQQA 1QOAA 3AV8A 2LD9A 1GOZA 1R7SA 3ZNGC 2KVZA 2K0PA 3NVVA 1F52A 4CQNA 4B6WA 4DK5A 2LJIA 4WWOA 2RR9A 3Q3OC 2PJHA 1HQRD 1SE2A 1ET6A 3AH7A 3DBRB 3QJZA 3IAM1 3VH4B 4IWPA 4IM3A 1ZXHA 2KXJA 4JLCA 3GP7A 1IP9A 2WXOA 4AJWA 2EMTA 1L2NA 1E90A 2INPE 4A8XC 1J7CA 4HRSA 2XBBC 3VRBB 1EM7A 3Q8EA 4WAFA 1WE7A 1GNUA 4H2AA 4N59A 2AL6A 2OOBB 1AARA 3V60A 5H8YE 1MG8A 2J0MA 2INNE 1KLUD 2ZPYA 1S1QB 2GLSA 4JIOU 2I1JA 2UWQA 4RCOA 2MP2A 4P1BC 2LZ6A 2K6QA 4A3OA 3KH0A 1LFDA 2HJ8A 3HHMA 1WXVA 2FBWB 5LXIB 3RNCC 3Q8FA 3AEFB 2IDYA 2KO3A 2V3SA 2IYDB 4YTNB 1N5XA 3WAOA 3ZTDA 4MSMB 5JXVA 1FCLA 3MHSD 3NRZA 5IO9A 1ZW7A 2WXQA 3RCZA 1UGMA 3EHVA 1TZOA 4EZKA 2SEBD 1JROA 4IWQA 2HTME 2XK5B 4NJCA 3ZRCA 1AW7A 3ZDMC 2LXAA 3JSVB 4FJYA 3NZ3A 3V6CB 3GE8C 2QEJC 1AWDA 1C79A 3FILB 4US8A 2M17A 2M0XA 1RFKA 3RPFC 3U7DA 4AS1A 1V5OA 4II3B 4MACA 3FKYA 3ZIMA 4OZAA 2D3GA 3Q8AA 4MGIE 4RGOS 4BOSC 2I1KA 1N62A 3BVGA 4KGTA 4XGAB 2A5UA 4MSQB 3VUYA 5CTRC 2KQ7A 4M0WA 1WM3A 3KUDB 5C3JB 1DGJA 1WR6E 1FIQA 3HIZA 1ISNA 3IG3A 4EEWA 1SSNA 2B3AA 1TT5B 4URKA 2N9KA 3PHXB 1K50A 1J19A 1TY0A 3VDZA 4P1CC 1NDDA 3OG5A 3AMZA 3NHEB 2R2QA 2AQ2B 4KSLC 2KJ6A 2FE8A 1LQBA 2RPVA 2K9XA 1FNVA 3BVZA 1WGDA 2J42A 3RN9C 4ASWC 1IBXB 4FJVB 2J0JA 3J9CA 2DX5B 2NBWB 1C76A 3TSSA 4R3DA 1ZXIA 3T8MA 2PE6B 2BTEA 3DWMA 4GSWA 3KWLA 1CJEA 1K53A 1WE6A 4YSZB 4I6NB 1D6EC 1JWAD 5FK9C 1YD8U 2N9EB 2KLGA 2FUHB 3P4SB 4HPLB 1SEBD 4L1BA 1GG3A 4LNFA 3N30A 1FPYA 4HJKA 1FFVA 3PGEA 2LXCA 4GDLB 3R66C 1V8CA 4GB9A 3DVGX 3Q8CA 2K3UA 2GBNA 3ZNZB 2PVGC 4A9AA 1EUVB 1D5MC 2V1YA 1SIFA 3MTNB 4AP4C 3TBLD 1E8ZA 3RYTA 1E10A 3CSTA 3PHWB 3ZDTA 2JZ3B 1YMHE 3T9LA 4MEMA 2LVQA 4C7YA 1STEA 3X23A 2L52A 3UI3A 3BWUD 3AE6B 4ZHOA 3UGBB 2WGSA 4KDIC 5HKHA 4WJOA 4ICVA 4RF1A 5EE3A 5IN7A 2AQ1B 5CHFA 2RSUA 2LHEA 2C7NB 3DBHB 2L83A 3PREA 4ANVA 3EA6A 1UWXA 3SU8X 2KACA 3TEWA 1TIFA 1BUIC 3GE3C 3QCAA 2O6VD 2IGGA 4WWMA 4KSKC 1DOIA 1HZ6A 2XNAC 2KX0A 2L00B 4XX5A 1VZ8A 3A1QA 2D3BA 1WRIA 4KX6B 4IM2A 2WXNA 4YL8A 3VUWA 3NS8A 3TMPB 3FAHA 5BMIA 1P98A 3GB1A 3KVFB 1FXTB 3Q69A 5IP4D 2A4ZA 4KGRA 1ZE3D 4US9A 2GI9A 4YT0B 4DQOC 2ZVOA 4A90A 4AUQC 3OAWA 3MJWA 4F8CB 2D10A 3PS6A 4RGNA 1WXMA 2KWDA 2GMIC 4RGTA 4ANWA 4II2B 4BZAA 2KAJA 1N63A 4FLHA 2JT4B 4P7IA 3V05A 1YQ3B 1KFYB 4LDTD 4P16A 2JYTA 3N1YC 3DHHC 1E5WA 2NTTA 1L6UA 4L2YA 4KDLB 1C4AA 4EZLA 4RM9A 2G4SA 3SFDB 4ZDVA 2KDMA 5JHBA 1R4MI 2CJNA 3LYYA 3LJ3A 1V9JA 2MA9B 2J7QB 3DWGC 1XEEA 1K52A 2EELA 1PGAA 3AU4A 3SDLC 3ZJTA 1WZ0A 4W9JA 2L05A 4JWUC 5CX3A 3BY4B 2JX5A 3DVGY 3ZXRA 2LGSA 2WXFA 4PK1A 2IGDA 3QARA 1JWBD 1ZPSA 3GZNI 5AZGA 1UH6A 1UD7A 4RGMA 2C7MB 4YTPB 2HD5B 3LXFA 3CF6E 3TJPA 5D94A 5E6PA 2ZEQA 1WZ3A 2XN9C 5DPRA 1Z2MA 4EUTA 1XQQA 2MHJA 3IAS1 2D2QA 3AULA 3VR9B 3NG0A 2BB5A 4A55A 2ZNVC 5BMHA 1H8CA 3AN1A 3W1YA 1WJNA 2AX5A 3R2IA 2QDFA 4GGQA 5GMVA 1PGXA 2DENB 4KIKB 2C60A 4EE2A 2BKFA 5JZEB 2IJ0A 1YJIA 2GB1A 2KJRA 4WQMA 4PS7A 1UWMA 4W9KA 4DHZB 4WH4A 3NOBA 4RM8A 1C77A 3RNAC 2JXTA 1X1MA 1RRBA 3QX1A 4F7ZA 2HDEA 2ZZPB 3EECA 1P1AA 4G0NB 3VR8B 2RDHA 2V4IB 5BYQA 3UIOB 2YVCA 2TSSA 2NBUA 5D3DA 2MSED 1C9FA 2MLBA 2JZPA 2AQ3B 4LNKA 4ANXA 2PVOD 4FHJA 4W9CA 2BYFA 2MRPA 3U4EG 2K39A 4HCNB 5I4DA 3IBEA 2LGIA 5L83A 2WXJA 4XWWA 2QCZA 4BKSA 1SJED 1WGKA 2QJLA 3R2TA 4FA6A 4XDCA 4DXAB 1ZGUB 1EF5A 2JWZA 1HZ5A 4FHKA 4ARIA 4HKZE 3ZNHB 5LXHA 5LNK1 1WFYA 2KX3A 3JYUA 1E7UA 5TR5A 4BAXA 1HTOA 2KWVB 5JH5C 1WYGA 2V4LA 1WX8A 2J4XA 2FNJB 2N9PC 2GOWA 2UU7A 2YEPB 4DHZE 2KK8A 1P9DU 1MPEA 3DBHI 5G55A 1SBBB 4ITKA 2I2YA 2N1VA 2ZW0A 3MJ5A 3DHIC 1MJDA 3MC0B 3MC8A 4E3CA 3APDA 2FIDA 2JRHA 3SFEB 1VRAB 3CSFA 4TMAB 3TCAA 2V3PA 3L13A 4ZRIA 3ZNID 2KDEB 3PV1A 1F0ZA 4W9HA 3ML9A 3P4QB 1XXGA 4WWNA 2KFKB 4LNOA 3AEAB 2AEHA 1VD2A 1V81A 1YN3A 4EZJA 2WDVB 2MH7A 2WQYB 2KYWA 2Q5WD 1D4BA 2NCNA 2MBOA 2BS3B 3RNBC 1JCKB 3ALBA 4WJNA 1JALA 1XLOA 3WANA 4K3BA 4ZRPA 1HA5A 1UBQA 1WXAA 1K51A 2QC8A 1QKZA 1V1PB 3EGRA 4GDLA 1L0XB 2VRRB 3WAPA 2KOXA 4PYUA 2BF8B 2BPSA 2IY1B 3P63A 3A4RA 2CS4A 3P2BA 3RD2A 3JVZX 3L54A 1TS3A 5EE0A 2O2VB 3DQVA 1M4VA 1TS4A 2NMQA 1UBIA 1WGGA 2JUOA 5IOIA 1FXAA 4E71A 3Q2AC 4DHJD 4OVUA 4A3PA 4B95A 1FO4A 3HM6X 2J0KA 2Y5BB 2NTSA 5FR3A 1DYQA 1SE4A 4M01A 1FD6A 1E9MA 2WYQA 1IPGA 3BINA 2G1EA 2GBJA 4K7SA 2WX0A 2IGHA 2JQRB 4YXDB 1YOVB 2PPHA 3ZXVA 1ZDVA 3W1SC 2PEAA 3A33B 1L4ZB 2WXKA 1WYWB 2ON8A 2KN5A 2WXGA 1YN4A 3U30A 1WRDB 2DHZA 2WS3B 2KMCA 4G11A 4FXCA 3AE5B 4AJYB 3NY5A 4KZCA 3W1SA 1OQYA 1WGYA 3NZSA 3AE1B 5FKAC 4PS3A 2M4NA 1U4AA 4I6PA 1I35A 3N3KB 2YEPF 5JHAA 2DZKA 3DBRI 1QILA 4JE3B 2KLCA 3FILA 3P4PB 1TJEA 3H7SA 4MJSA 3M63B 4B9KA 2HTHA 1FCCC 3H8HA 1SE3A 3U8ZA 1SF0A 5D6JB 3WCQA 3RNGC 3ECIA 1C4PA 4KKIA 4C4VB 3ZO5B 1EF1A 2INCC 5BYSA 3L17A 5L95C 4K7UA 2LGYA 3SR6A 2WU5B 2FCMA 2MJDA 2MEKA 3PZDA 1OEYA 5IA7A 3QAQA 3WIMA 2MX2A 2L32A 3JW0X 2FCNA 5HI1A 2JSVX 1MHHE 1WX7A 3PVLA 2Z0EB 1CZPA 1VZ6A 1FEHA 3AECB 3A1QB 1XD3B 1FMAD 2M56B 3RFZB 1WMHA 3KYDD 3M95A 3AE9B 3QIJA 3UF8A 4ZYNA 4MJSB 2MBBB 1QZEA 2NPTA 4RH6A 3ABVB 5MPOA 2KD0A 2PMVA 2EMSA 2E3TA 4TV3A 3M3JA 1UUPA 3KQ4A 2XEWA 2IY0B 3UQBA 2DNFA 4YTMB 2DZIA 1NI2A 2WDTB 4C56C 3AEBB 4HPMB 2BKRB 4KVGB 2ZJDA 1V80A 3HVZA 2W3SA 2WXMA 3C0RB 4MGZE 3C19A 2JYEA 4GU2A 2BVCA 2JY6A 3N20C 1GUAB 2WX1A 2JWUA 4AQ7A 1I4PA 1YQ4B 5TSSA 4DDID 3DBLB 5FR6A 3V62A 2L76A 2IO2B 2G3QB 4ZRKA 5AZHA 3VUXA 4HCPB 2LRWA 5AUIA 1XCQL 2BWES 4MELA 2KC2A 4KIKA 1GAQB 2GRIA 2ICIA 1YX6B 2L7RA 2FIFA 1BXTA 1LO5D 4HDOA 2INDC 2WU2B 3H6NA 4W9DA 5IAAC 4ACFA 1L6VA 3LB8C 2CHZA 3CMMB 4K81A 1HEZE 3MP9A 3PPAA 4HJGE 2ONQA 4FJZA 4NAWB 2L8JA 1J8CA 3T3NA 4OZCA 4XWTA 2W55A 2BS4B 1T3QA 2BYVE 1D3ZA 1L0YB 2O6VB 3A9KB 4IUMB 3QHTA 1P7FA 2LASA 1LXDA 1YJ1A 3AEDB 1CK1A 3OLMD 1OFFA 4RNAA 2L1AA 2CR5A 4ICUA 3B2FA 2R2OA 2W9NA 3NVZA 1J7BA 1TS5A 2LI5A 4WURA 2VZKB 1I42A 4N9F4 2DYBA 2KC1A 2KMAA 4OVZA 1SE9A 2HJ1A 4BFRA 2N9XA 3BVMA 4NQKE 1KLGD 2CJOA 4XE0A 1JMLA 3URYA 4RMAA 2KFKA 2M8SA 1I4XA 4KZ0A 2ASQA 4XDDA 3VHTC 2OJRA 2PW9A 2AWTA 4NPNA 4JGHB 1ESFA 2LUMA 4HVBA 5AEKB 2KJHB 2ACZB 1FNWA 4IM0A 1FRDA 1RLFA 1RAXA 2D3AA 2NPTB 1GC7A 1KM7A 1I4GA 3JSVA 1VR9A 4JPSA 3DHGC 5IKCM 3P4RB 3E9SA 1FRRA 3DDCB 1UF0A 3ONSA 3NVYA 2C7HA 2KZRA 5BYRA 1F1HA 2KDBA 3EFUA 3ZTCA 4RFBA 1XO3A 4RF0A 1EWCA 4MDKE 4AWJA 1RM6C 2BW2A 1MFWA 1WJUA 2K1FA 4HK2A 1EU3A 3A9JA 4OZBA 3RI7C 2YLMA 3BIID 4UDUC 4C4VA 2L3ZA 1LM8B 1WGHA 1WR1A 2J53A 2ZNVB 4GDKB 4BVUC 1ZP0B 1NVID 4WJQA 4Q2JA 1C3TA 4WWPA 2EKIA 4TUUA 1SXTA 4MT5A 2M1MA 3NZUA 2BWFA 1C4CA 3ZQ4A 3B1LX 1MI0A 3Q8BA 1ZKHA 2K22A 2KDIA 2EKEC 3TEZA 5BO4B 4TQ1A 5HG2A 1B1ZA 1F2RI 2KT7A 2OHFA 2BYEA 4NZLB 1P3QU 1QOGA 1HE8A 4J3OD 1A5RA 4MM3B 1TS2A 3AU5A 5KHOA 3PLVA 4BOZB 2LVPA 2R61A 1E8WA 2Y3AA 3APFA 1JWUD 1NBFC 1T0QC 3N1XC 4ZHPA 3AE4B 1WY8A 4HDQA 4WQOB 3NS1A 2PKOA 3A9KA 4USAA 3ZRFA 2DYOA 2KFJA 1FM0D 5C23A 2D5GA 4LTUA 2K6DB 2LJ5A 1RYJA 3ETRA 4W9LA 1TZ1A 3K9OB 4M8NA 3N32A 4N58A 5CHWA 1M94A 1AN8A 2DAJA 3PZ7A 3UIPB 1DOXA 1JW9D 4S17A 2QSDA 3N1ZC 2LVOA 4E74A 3V3XA 1IGDA 2H89B 1V5TA 3PRPB 4IOIE 4GN1A 4NJ6A 3PTFC 3OWEB 4G3XB 3U52E 3TIXA 4FADA 2WP9B 3N9YC 1BT0A 1LGRA 3QK0A 4MM3A 1N60A 1GB4A 3A4SC 2OEDA 1N6ZA 2DBYA 3VFKA 5KHQA 1WH3A 4EKUA 5DCNA 1CQVA 1NENB 2PIAA 4GDKA 3PLUA 1GC6A 5J17A 4LNNA 1WWTA 2VZKD 4B0MA 2WXPA 4HROA 4ZRQA 4F1SA 4B0EA 1Y8RC 5CHVC 2JVCA 1K8RB 2G4DB 1VCBA 1OTRB 2B76B 4IKGA 2QHOA 4NJ7A 3IT4B 1I4QA 2MQJA 4LCDE 2NR2A 2N1WA 1QOBA 1UELA 4ZOHC 2W82A 1F9JA 2FUG1 2CHXA 2XK5A 1KJTA 3PZ8A 2LEKA 2DAFA 1QOFA 3R3MA 4GIVA 1YNTE 3LDZE 2V9HA 1WGRA 2IZVB 3QWZB 2PE9A 3GZNB 3M62B 4KV2A 3DBSA 1S3SG 4XC2A 3TL5A 1FFUA 3DVNU 2KNBA 5G5GA 4JWSC 3ZJVA 3I57A 4IWOA 3O65B 4X57B 5LLIA 1R4NI 1P7EA 1WF9A 3I3TB 3TEYA 2RDGA 1L0VB 3IT6B 2BS2B 2N7JA 4I6LB 2RMMA 5HFYA 4MGKE 2MBQA 3AI5A 3K9PB 2BYTA 2KKCA 5E6NA 4BKGA 3PRZA 5D2MB 3VTWA 1XF5L 3PT2B 3AE3B 1H4RA 2N9LA 1SIJA 3T3OA 2MWSB 2WLBA 2REXA 1J0GA 3AB5A 3L10B 2V3NA 1HTQA
chains in the Genus database with same CATH topology
1ZUD2 5TSSA 1JWSD 2JX5A 3AM9A 2WXLA 1I4HA 2WXFA 3CWIA 2IGDA 1JWBD 4YSYB 1ZPSA 1XLQA 2E6XA 5AUIA 1XCQL 4RGMA 1GAQB 2GRIA 2ICIA 1F2RC 4YTPB 1GPXA 3O13A 4DXGA 1BXTA 1HXYD 1Y56A 2ZW1A 1LO5D 1ACCA 3LXFA 1UNSA 4LK0M 1T6BX 1PUTA 2XN9C 2WU2B 1E7PB 1NYQA 3W9CB 1TKEA 1V97A 2KN4A 1L6VA 3IAS1 3L4PA 4P6VF 3LB8C 1PYWD 3VR9B 2CU3A 2BB5A 4A55A 2M19A 5BMHA 1HEZE 1NYRA 1SB3C 3MP9A 1XCTL 1BMLC 2BB6A 3AN1A 1UGJA 4HJGE 4ARCA 2ONQA 4NAWB 1I4RA 2AX5A 3R2IA 1L5PA 1TY2A 3T3NA 4WIPA 4OZCA 4XWTA 1PGXA 4OW0A 2W55A 4EE2A 3I9V1 2BS4B 2IJ0A 1OQQA 1T3QA 1YJIA 1QOAA 3AV8A 1GOZA 2GB1A 4WQMA 1R7SA 1UWMA 1L0YB 4WH4A 2K0PA 2DLBA 3NVVA 1C77A 4CQNA 1GB1A 1MVKA 1PFDA 2JXTA 3CIRB 2LJIA 1P7FA 2HDEA 3AEDB 1HQRD 1SE2A 3VR8B 1CK1A 3U2SC 3BYYB 1ET6A 2RDHA 2V4IB 1OFFA 3AH7A 4O1NA 4RNAA 5BYQA 2L1AA 2TSSA 3KLSX 3IAM1 4N6EB 3B2FA 5D3DA 2M0AA 1C9FA 3NVZA 1J7BA 1TS5A 2JZPA 4WURA 1ZXHA 2AQ3B 2VZKB 1PDXA 2PVOD 3GP7A 1V1OA 2MJ3A 2WXOA 1QLBB 4OVZA 1VJKA 1DOYA 1WXQA 4C80A 3U4EG 3HVDA 3BVMA 1KLGD 2CJOA 4XE0A 1JMLA 5I4DA 2INPE 3URYA 2LGIA 4A8XC 1I4XA 2X38A 1J7CA 4XDDA 4HRSA 5D3IB 4YWGG 3VRBB 5C2TB 1QF6A 1QQRA 1EM7A 2PW9A 2WXJA 3Q8EA 4WAFA 5EE9A 4H2AA 4N59A 4XWWA 1WGKA 1SJED 2QJLA 3BK1A 3R2TA 4XDCA 1ESFA 2LUMA 5H8YE 2INNE 5E6JA 1KLUD 3C8YA 1HZ5A 2ACZB 4RCOA 1FNWA 4ARIA 4A6QA 4HKZE 2W3RA 1FRDA 5G5HA 1T5XD 2FBWB 5LNK1 1D5ZC 3BK2A 4DXFA 3Q8FA 1I4GA 1VR9A 2J52A 1VZ7A 3AEFB 2IDYA 4JPSA 3B9JA 3TEXA 1WYGA 3P4RB 4YTNB 3E9SA 1N5XA 1FRRA 2J4XA 4KKJA 5JXVA 1FCLA 1NEKB 5D7GA 1VDVA 3NVYA 2YEPB 3NRZA 2Y5PA 5BYRA 2WXQA 1RWSA 4JX1C 1F77A 1MPEA 1QT9A 1XO3A 2H88B 2PLPA 1IGCA 4RFBA 1SBBB 2K5PA 4ITKA 4RF0A 3U7ZA 2I2YA 1WSPA 1TZOA 2ZW0A 1EWCA 3MJ5A 2SEBD 3MC0B 1JROA 1RM6C 3SEBA 2HTME 2BW2A 1XLPA 4NJCA 3GS2A 1JRPA 1JWMD 3AE7B 1AW7A 3B2GA 1EU3A 4D2KA 3SFEB 2WXRA 1VRAB 4OZBA 4C7ZA 3NZ3A 4TMAB 2V3PA 2QEJC 3BIID 1AWDA 1C79A 4UDUC 3FILB 1L4DB 4US8A 2J53A 1OQRA 1F0ZA 4GDKB 1RFKA 3P4QB 1XXGA 3RPFC 4AS1A 1ZP0B 1NVID 4MACA 4Q2JA 1J7AA 3ZYYX 3AEAB 2EKIA 1ENFA 1SXTA 1YN3A 4MT5A 4OZAA 3Q8AA 2WDVB 2MH7A 2WDQB 4RGOS 1C4CA 1N62A 2WQYB 3BVGA 4KGTA 3ZQ4A 1MI0A 3Q8BA 4OHJA 2K22A 2Q5WD 1D4BA 4M0WA 3NVWA 3TEZA 5C3JB 1DGJA 2BS3B 1FIQA 1JCKB 2DYMA 4TQ1A 5HG2A 5BMGA 3W2DA 1B1ZA 1SSNA 1JALA 1F2RI 1XLOA 2OHFA 1ET9A 2N9KA 4ZRPA 4NZLB 1HA5A 1K50A 1K51A 1TY0A 1QKZA 1V1PB 3EGRA 1QOGA 4J3OD 4HKQA 1L0XB 4MM3B 5T8IA 3AMZA 1TS2A 3P1MA 2WNMA 2QILA 3P63A 1E0ZA 2R61A 2AQ2B 2Y3AA 1TS3A 2FE8A 5EE0A 2SAKA 1TKYA 1JWUD 1M4VA 2I38A 2RPVA 4ZHPA 1NI3A 3AE4B 2K9XA 1TS4A 1FNVA 3BVZA 1FXIA 2J42A 2NMQA 1IBXB 3NS1A 2PKOA 4USAA 2DYOA 3J9CA 1FM0D 4GLSC 3AE2B 2D5GA 1FXAA 1C76A 4LTUA 3TSSA 4R3DA 3W5VB 1RYJA 1ZXIA 3ETRA 1KTKA 1IBXA 4TSSA 2BTEA 4YSXB 4N58A 1FO4A 3DWMA 3KWLA 1XLNA 1CJEA 1K53A 1AN8A 2NTSA 4YSZB 5FR3A 1DYQA 1D6EC 1JWAD 1SE4A 3PZ7A 5FK9C 1DOXA 3HRDD 1FD6A 1JW9D 1E9MA 2QSDA 3P4SB 1VLBA 2G1EA 1SEBD 3VRAB 4L1BA 1A70A 2IGHA 2JQRB 2KQ4X 4YXDB 3PO0A 3V3XA 1IGDA 1FFVA 2H89B 2LMCA 4GDLB 1ZDVA 4HEA1 1V8CA 2Z8LA 2KMMA 4IOIE 1L4ZB 2WXKA 3E56A 3IXSA 3Q8CA 2K3UA 2PVGC 2ON8A 4A9AA 2DWQA 1TYGB 5H92C 3OWEB 2WXGA 3U52E 1D5MC 1YN4A 2WP9B 3N9YC 2WS3B 4FXCA 1KH0A 3AE5B 2BT6A 1C78A 1N60A 2LFIA 1V1PA 1GB4A 2OEDA 3W1SA 1B9RA 3VQIA 4PT5A 1E10A 2DBYA 3AE1B 5FKAC 2LHDA 1CQVA 3AEGB 1NENB 1YMHE 2PIAA 2YEPF 4C7YA 1STEA 2L52A 3UI3A 3BWUD 3AE6B 1QILA 4JE3B 3FILA 4ZHOA 2N0SB 3P4PB 1WWTA 1TJEA 2VZKD 4B0MA 2WXPA 3BYTB 4HROA 4RF1A 3W5UB 5EE3A 4ZRQA 3FC4A 2AQ1B 4B0EA 3NUHB 4ZYSA 3EUB2 1FCCC 2MJEA 3H8HA 1SE3A 1SF0A 2LHEA 3AE8B 4IDIA 2B76B 3WCQA 2L83A 1EWYC 4IKGA 1C4PA 4KKIA 3EA6A 1UWXA 2WXIA 3IT4B 1I4QA 2KACA 1ROEA 1QOBA 3TEWA 5BYSA 3KWVA 1BUIC 2IGGA 1ZDXA 4ZOHC 4WWMA 2W82A 1HZ6A 1DOIA 2XNAC 3SR6A 1AYFA 2FUG1 1VZ8A 2WU5B 4TQ0A 1WRIA 2MEKA 2MJDA 4KX6B 3ZJUA 3PZ8A 2WXNA 3AEEB 4LLGM 2LEKA 1TKGA 1QOFA 1YN5A 2L32A 3FAHA 4KGSA 5BMIA 3GB1A 5EE1A 1YNTE 5HI1A 2JSVX 3R8BA 3Q69A 2PTLA 1KF6B 4MH8A 1MHHE 2IPKD 4KGRA 1ZE3D 4US9A 1CZPA 2GI9A 3MHZA 1VZ6A 4YT0B 4DQOC 4A90A 1FEHA 2G9HD 3AECB 3RFZB 1FMAD 2M56B 1FNUA 4RGNA 3AE9B 1FFUA 2KWDA 1N5WA 4RGTA 5G5GA 4JWSC 3ZJVA 3I57A 3BZDB 2KAJA 3P42A 4RH6A 3ABVB 1N63A 1N61A 1P7EA 2WDRB 2WXHA 5MPOA 3TEYA 2RDGA 2PMVA 1L0VB 3IT6B 2BS2B 2E3TA 3V05A 2N7JA 1Q10A 1YQ3B 5HHDG 1KFYB 2RMMA 1UUPA 4P16A 4REZA 2JYTA 5HFYA 1EU4A 2QIEB 2NTTA 1L6UA 4L2YA 3KQ4A 1C4AA 2BYTA 1D5XC 3HUIA 2W54A 3SFDB 4YTMB 2V0GA 4L23A 2KDMA 1XF5L 5GXGB 2CJNA 3LYYA 3AE3B 2N9LA 4C56C 1SIJA 3AEBB 4NAMA 3T3OA 3DWGC 1XEEA 1K52A 2QMTA 1E6EB 2EELA 3HVZA 1KRHA 2JU6X 1IUEA 1ZOYB 2W3SA 2WXMA 2BBCA 1MHXA 5AUKA 1PGAA 2WLBA 1JQ4A 2JYEA 3TUOA 1SJHD 3ZGZA 3MFGA 1YJJA 3AB5A 2V3NA 3ZJTA 2JWUA 4AQ7A 1I4PA 1PGBA 2Y5CA 1I7HA 1YQ4B 4JWUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUM A;  1HZ5 A;  1FCC C;  2IGD A;  4HKZ E;  2LHE A;  4IKG A;  1XCQ L;  1UWX A;  2I38 A;  2RPV A;  1F2R C;  2KAC A;  2ZW1 A;  2NMQ A;  1IBX B;  2IGG A;  2J52 A;  1HZ6 A;  2KN4 A;  4GLS C;  5BMH A;  1HEZ E;  3MP9 A;  5JXV A;  1XCT L;  1FCL A;  4HJG E;  4KGS A;  1IBX A;  2ONQ A;  5BMI A;  3GB1 A;  1YNT E;  5HI1 A;  2JSV X;  2PTL A;  1MPE A;  1MHH E;  4OZC A;  2PLP A;  1IGC A;  1K53 A;  4KGR A;  2I2Y A;  1PGX A;  2ZW0 A;  2GI9 A;  1FD6 A;  2QSD A;  2GB1 A;  4WH4 A;  2K0P A;  2IGH A;  2KQ4 X;  3V3X A;  4D2K A;  1IGD A;  1MVK A;  2JXT A;  1GB1 A;  2KWD A;  4OZB A;  1P7F A;  4IOI E;  3FIL B;  1P7E A;  2J53 A;  2ON8 A;  2N7J A;  1Q10 A;  5HHD G;  2RMM A;  5HFY A;  1C9F A;  4MAC A;  2JZP A;  1KH0 A;  1ZXH A;  4OZA A;  1GB4 A;  2OED A;  2KDM A;  1XF5 L;  4KGT A;  1MI0 A;  2N9L A;  1D4B A;  1K52 A;  2QMT A;  1JML A;  2EEL A;  2JU6 X;  2LHD A;  2LGI A;  1MHX A;  1PGA A;  5HG2 A;  5BMG A;  1YMH E;  1F2R I;  1EM7 A;  2PW9 A;  3UI3 A;  2N9K A;  2JWU A;  3FIL A;  1K50 A;  1K51 A;  1PGB A;  1QKZ A; 
#chains in the Genus database with same CATH topology
 1ZUD 2;  1JWS D;  3V6E B;  3OJ3 A;  2NVU I;  3AM9 A;  4M02 A;  4BBN F;  2WXL A;  1I4H A;  3ZW3 A;  2O6V A;  3EFC A;  4M00 A;  3RZW C;  3H7P A;  4YSY B;  2AL3 A;  3Q3M C;  2E6X A;  1GPX A;  1F2R C;  3O13 A;  1Y56 A;  1ACC A;  3QQ8 B;  2KHW B;  4PS8 A;  1UNS A;  2BGF A;  1T6B X;  1WJ4 A;  4LK0 M;  1PUT A;  3NJT A;  2RDB C;  1NYQ A;  3W9C B;  2KN4 A;  1V97 A;  4C00 A;  2GBR A;  2LGD A;  1V86 A;  2K8H A;  4P6V F;  3L4P A;  2CU3 A;  1NYR A;  1SB3 C;  2JRI B;  1XCT L;  1BML C;  1UGJ A;  3VXW A;  1Q5W B;  2N4F A;  4WIP A;  4OW0 A;  3I9V 1;  3QA8 A;  2C5L C;  2DLB A;  3IFW B;  1GB1 A;  1MVK A;  1PFD A;  3ENE A;  3IHP C;  3CIR B;  3VVW B;  3U2S C;  3BYY B;  4O1N A;  2ZCB A;  4DHJ B;  2G45 B;  3RUI B;  4ANU A;  3KLS X;  2MBH A;  4N6E B;  1MG4 A;  2M0A A;  5E6O A;  1T0S C;  4ZRJ A;  2GBK A;  1PDX A;  3DOW A;  4BKS D;  1V1O A;  5J2R A;  2BQQ A;  2MJ3 A;  1QLB B;  1VJK A;  1KLV A;  1DOY A;  1WIA A;  1WXQ A;  4S0R A;  4C80 A;  3HVD A;  1TTN A;  3MC9 A;  3I63 C;  1EO6 A;  1E8X A;  4J6I A;  2JF5 A;  1T0Y A;  2X38 A;  5D3I B;  4YWG G;  1QF6 A;  2CU1 A;  5C2T B;  1QQR A;  3Q3N C;  3KW5 B;  5EE9 A;  1L7Y A;  2WWZ A;  2RD0 A;  3BK1 A;  4K3C A;  1Q0W B;  5E6J A;  3C8Y A;  2KWU B;  4NY0 A;  1WMH B;  2LGX A;  4A6Q A;  3VTU A;  1C1Y B;  1V49 A;  2W3R A;  5G5H A;  3VAW A;  1T5X D;  4W9F A;  4FN2 A;  1D5Z C;  3BK2 A;  4DXF A;  2JZZ A;  3ZLZ A;  1R4N B;  1WX9 A;  4AOF A;  3A9J B;  2J52 A;  1VZ7 A;  3B9J A;  3TEX A;  4EOY A;  4MH0 E;  3QC8 B;  4LJP B;  4JL9 A;  4KKJ A;  1E8Y A;  1NEK B;  5D7G A;  1VDV A;  2JXX A;  2Y5P A;  1RWS A;  4JX1 C;  4PYZ A;  1F77 A;  2H88 B;  1QT9 A;  4LNI A;  2PLP A;  1IGC A;  1WXS A;  4GMV A;  2K5P A;  3RMK C;  3U7Z A;  1WSP A;  2AYO B;  4LDT B;  4CYE A;  3VH3 B;  3SEB A;  2OJW A;  1WJ6 A;  1XLP A;  4NQL B;  4BKT A;  3GS2 A;  1JRP A;  2MP2 B;  1JWM D;  3DCG A;  1XT9 B;  3AE7 B;  3B2G A;  4D2K A;  2WXR A;  4C7Z A;  3KUC B;  2KQS A;  3OJ4 B;  4GXB A;  1L4D B;  3UIN B;  4QAY A;  1OQR A;  4BBN C;  2UYZ B;  4WJP A;  4K1R B;  4W9E A;  3HK0 A;  1J7A A;  3ZYY X;  1ENF A;  1TGZ B;  2FCQ A;  3X0W A;  2KDF B;  2WDQ B;  3Q3F A;  4OHJ A;  2ZVN A;  3H9D A;  3NVW A;  4IG7 B;  5C1Z A;  4MGY E;  4XZ4 A;  2DYM A;  5BMG A;  3W2D A;  2ZCC A;  1ET9 A;  2IO3 B;  1KOT A;  3RNE C;  4HKQ A;  4HPP A;  5T8I A;  3P1M A;  4W9I A;  2WNM A;  2QIL A;  4LJO B;  2KTR A;  5EDS A;  1E0Z A;  2SAK A;  1TKY A;  2I38 A;  1NI3 A;  2JPH A;  1Q1O A;  4HWI B;  1P0R A;  1FXI A;  4GLS C;  3AE2 B;  2ZPN A;  3W5V B;  3RNF C;  1KTK A;  1V2Y A;  2LWP A;  1IBX A;  4TSS A;  1GJZ A;  4YSX B;  4JQW C;  1XLN A;  1CMX B;  3PSE B;  3HRD D;  3H7P B;  2IO1 B;  1VLB A;  3SD5 A;  2D11 A;  3VRA B;  2VH1 A;  2NBV B;  1A70 A;  2KQ4 X;  3PO0 A;  2LMC A;  4HLE A;  2KWC A;  2RGF A;  4OVV A;  1R4M B;  1YX5 B;  4HEA 1;  2Z8L A;  2FCS A;  2KMM A;  2O2V A;  1WI0 A;  3E56 A;  4IC7 B;  3IXS A;  2DWQ A;  1TYG B;  2Z0D B;  2KVR A;  2KTR B;  5H92 C;  3B0A A;  3S2A A;  2Z59 B;  3ML8 A;  1KH0 A;  2K8B A;  2BT6 A;  1C78 A;  4FUL A;  2LFI A;  1V1P A;  2MCN B;  1B9R A;  2GBM A;  4PT5 A;  3VQI A;  2K25 A;  1PQS A;  3HM3 A;  2MBE A;  2HE7 A;  3Q6B A;  1YQB A;  2N7D A;  5G2N A;  3I5J C;  2LHD A;  3AEG B;  3IVF A;  3H1U A;  4IW0 A;  4M0W B;  2D07 B;  3KUZ A;  2N0S B;  3D32 A;  3BYT B;  3RT3 B;  3WAM A;  3W5U B;  3L08 A;  3FC4 A;  3NUH B;  4ZYS A;  2L0T A;  3EUB 2;  1G6J A;  2MJE A;  4IDI A;  3AE8 B;  1E7V A;  4W9G A;  1EWY C;  5J18 A;  2WXI A;  2C9W B;  2RPQ A;  1ROE A;  1JRU A;  3KWV A;  1Z5S B;  1ZDX A;  3WAL A;  5DPS A;  1AYF A;  4GOC A;  2WHI A;  4TQ0 A;  3ZJU A;  2CHW A;  3Q14 C;  2K8C A;  3AEE B;  4LLG M;  1TKG A;  1YN5 A;  4KGS A;  3R7Q A;  5EE1 A;  3PRM B;  3R8B A;  2PTL A;  1KF6 B;  4MH8 A;  2IPK D;  3ZVV A;  4DBG A;  1UZX B;  3MHZ A;  2DZM A;  2CKH B;  3SHQ A;  1WM2 A;  2G9H D;  1FNU A;  3DVN V;  3APC A;  3AXC A;  4NNJ B;  2IBI B;  1N5W A;  3DBL I;  3DPD A;  4HXD A;  3BZD B;  3P42 A;  3ZUN A;  1N61 A;  2WDR B;  2WXH A;  1Q10 A;  5HHD G;  4CHK A;  4DDG D;  4REZ A;  1EU4 A;  1IYF A;  4WAA A;  2QIE B;  3RZF A;  1D5X C;  3HUI A;  2W54 A;  2IO0 B;  1OEY J;  2X8X X;  2V0G A;  4L23 A;  5GXG B;  3WA0 A;  2NS5 A;  4NAM A;  3EC8 A;  1TBE A;  2QMT A;  1E6E B;  4TKN A;  3ZKJ C;  1KRH A;  1YIW A;  1IUE A;  1ZOY B;  2DZJ A;  2JU6 X;  5DPW A;  2BBC A;  1MHX A;  5AUK A;  1JQ4 A;  3TUO A;  1SJH D;  1T0R C;  3GOE A;  3ZGZ A;  3MFG A;  1YJJ A;  4G50 A;  2LRU A;  4XYC A;  3KYC D;  5AZF A;  1PGB A;  2Y5C A;  1I7H A;  4CO7 A;  2KTF A;  3CWI A;  4EFO A;  4M8M A;  3L0W B;  1XLQ A;  2MW5 A;  3B08 A;  2L0F A;  4DXG A;  1RFA A;  1HXY D;  2LUE A;  2ZW1 A;  4A20 A;  3L16 A;  2D3C A;  5DPT A;  1E7P B;  1TKE A;  1PYW D;  2N7E A;  1SGH A;  2M19 A;  2FAZ A;  2BB6 A;  3VTV A;  4ARC A;  3RUL A;  1I4R A;  1OGW A;  4FBJ B;  3Q3J A;  1L5P A;  4K7W A;  2VH2 A;  1V6E A;  1TY2 A;  3V61 A;  4DWF A;  4NAW A;  3R7R A;  3UQA A;  2KAN A;  1OQQ A;  1QOA A;  3AV8 A;  2LD9 A;  1GOZ A;  1R7S A;  3ZNG C;  2KVZ A;  2K0P A;  3NVV A;  1F52 A;  4CQN A;  4B6W A;  4DK5 A;  2LJI A;  4WWO A;  2RR9 A;  3Q3O C;  2PJH A;  1HQR D;  1SE2 A;  1ET6 A;  3AH7 A;  3DBR B;  3QJZ A;  3IAM 1;  3VH4 B;  4IWP A;  4IM3 A;  1ZXH A;  2KXJ A;  4JLC A;  3GP7 A;  1IP9 A;  2WXO A;  4AJW A;  2EMT A;  1L2N A;  1E90 A;  2INP E;  4A8X C;  1J7C A;  4HRS A;  2XBB C;  3VRB B;  1EM7 A;  3Q8E A;  4WAF A;  1WE7 A;  1GNU A;  4H2A A;  4N59 A;  2AL6 A;  2OOB B;  1AAR A;  3V60 A;  5H8Y E;  1MG8 A;  2J0M A;  2INN E;  1KLU D;  2ZPY A;  1S1Q B;  2GLS A;  4JIO U;  2I1J A;  2UWQ A;  4RCO A;  2MP2 A;  4P1B C;  2LZ6 A;  2K6Q A;  4A3O A;  3KH0 A;  1LFD A;  2HJ8 A;  3HHM A;  1WXV A;  2FBW B;  5LXI B;  3RNC C;  3Q8F A;  3AEF B;  2IDY A;  2KO3 A;  2V3S A;  2IYD B;  4YTN B;  1N5X A;  3WAO A;  3ZTD A;  4MSM B;  5JXV A;  1FCL A;  3MHS D;  3NRZ A;  5IO9 A;  1ZW7 A;  2WXQ A;  3RCZ A;  1UGM A;  3EHV A;  1TZO A;  4EZK A;  2SEB D;  1JRO A;  4IWQ A;  2HTM E;  2XK5 B;  4NJC A;  3ZRC A;  1AW7 A;  3ZDM C;  2LXA A;  3JSV B;  4FJY A;  3NZ3 A;  3V6C B;  3GE8 C;  2QEJ C;  1AWD A;  1C79 A;  3FIL B;  4US8 A;  2M17 A;  2M0X A;  1RFK A;  3RPF C;  3U7D A;  4AS1 A;  1V5O A;  4II3 B;  4MAC A;  3FKY A;  3ZIM A;  4OZA A;  2D3G A;  3Q8A A;  4MGI E;  4RGO S;  4BOS C;  2I1K A;  1N62 A;  3BVG A;  4KGT A;  4XGA B;  2A5U A;  4MSQ B;  3VUY A;  5CTR C;  2KQ7 A;  4M0W A;  1WM3 A;  3KUD B;  5C3J B;  1DGJ A;  1WR6 E;  1FIQ A;  3HIZ A;  1ISN A;  3IG3 A;  4EEW A;  1SSN A;  2B3A A;  1TT5 B;  4URK A;  2N9K A;  3PHX B;  1K50 A;  1J19 A;  1TY0 A;  3VDZ A;  4P1C C;  1NDD A;  3OG5 A;  3AMZ A;  3NHE B;  2R2Q A;  2AQ2 B;  4KSL C;  2KJ6 A;  2FE8 A;  1LQB A;  2RPV A;  2K9X A;  1FNV A;  3BVZ A;  1WGD A;  2J42 A;  3RN9 C;  4ASW C;  1IBX B;  4FJV B;  2J0J A;  3J9C A;  2DX5 B;  2NBW B;  1C76 A;  3TSS A;  4R3D A;  1ZXI A;  3T8M A;  2PE6 B;  2BTE A;  3DWM A;  4GSW A;  3KWL A;  1CJE A;  1K53 A;  1WE6 A;  4YSZ B;  4I6N B;  1D6E C;  1JWA D;  5FK9 C;  1YD8 U;  2N9E B;  2KLG A;  2FUH B;  3P4S B;  4HPL B;  1SEB D;  4L1B A;  1GG3 A;  4LNF A;  3N30 A;  1FPY A;  4HJK A;  1FFV A;  3PGE A;  2LXC A;  4GDL B;  3R66 C;  1V8C A;  4GB9 A;  3DVG X;  3Q8C A;  2K3U A;  2GBN A;  3ZNZ B;  2PVG C;  4A9A A;  1EUV B;  1D5M C;  2V1Y A;  1SIF A;  3MTN B;  4AP4 C;  3TBL D;  1E8Z A;  3RYT A;  1E10 A;  3CST A;  3PHW B;  3ZDT A;  2JZ3 B;  1YMH E;  3T9L A;  4MEM A;  2LVQ A;  4C7Y A;  1STE A;  3X23 A;  2L52 A;  3UI3 A;  3BWU D;  3AE6 B;  4ZHO A;  3UGB B;  2WGS A;  4KDI C;  5HKH A;  4WJO A;  4ICV A;  4RF1 A;  5EE3 A;  5IN7 A;  2AQ1 B;  5CHF A;  2RSU A;  2LHE A;  2C7N B;  3DBH B;  2L83 A;  3PRE A;  4ANV A;  3EA6 A;  1UWX A;  3SU8 X;  2KAC A;  3TEW A;  1TIF A;  1BUI C;  3GE3 C;  3QCA A;  2O6V D;  2IGG A;  4WWM A;  4KSK C;  1DOI A;  1HZ6 A;  2XNA C;  2KX0 A;  2L00 B;  4XX5 A;  1VZ8 A;  3A1Q A;  2D3B A;  1WRI A;  4KX6 B;  4IM2 A;  2WXN A;  4YL8 A;  3VUW A;  3NS8 A;  3TMP B;  3FAH A;  5BMI A;  1P98 A;  3GB1 A;  3KVF B;  1FXT B;  3Q69 A;  5IP4 D;  2A4Z A;  4KGR A;  1ZE3 D;  4US9 A;  2GI9 A;  4YT0 B;  4DQO C;  2ZVO A;  4A90 A;  4AUQ C;  3OAW A;  3MJW A;  4F8C B;  2D10 A;  3PS6 A;  4RGN A;  1WXM A;  2KWD A;  2GMI C;  4RGT A;  4ANW A;  4II2 B;  4BZA A;  2KAJ A;  1N63 A;  4FLH A;  2JT4 B;  4P7I A;  3V05 A;  1YQ3 B;  1KFY B;  4LDT D;  4P16 A;  2JYT A;  3N1Y C;  3DHH C;  1E5W A;  2NTT A;  1L6U A;  4L2Y A;  4KDL B;  1C4A A;  4EZL A;  4RM9 A;  2G4S A;  3SFD B;  4ZDV A;  2KDM A;  5JHB A;  1R4M I;  2CJN A;  3LYY A;  3LJ3 A;  1V9J A;  2MA9 B;  2J7Q B;  3DWG C;  1XEE A;  1K52 A;  2EEL A;  1PGA A;  3AU4 A;  3SDL C;  3ZJT A;  1WZ0 A;  4W9J A;  2L05 A;  4JWU C;  5CX3 A;  3BY4 B;  2JX5 A;  3DVG Y;  3ZXR A;  2LGS A;  2WXF A;  4PK1 A;  2IGD A;  3QAR A;  1JWB D;  1ZPS A;  3GZN I;  5AZG A;  1UH6 A;  1UD7 A;  4RGM A;  2C7M B;  4YTP B;  2HD5 B;  3LXF A;  3CF6 E;  3TJP A;  5D94 A;  5E6P A;  2ZEQ A;  1WZ3 A;  2XN9 C;  5DPR A;  1Z2M A;  4EUT A;  1XQQ A;  2MHJ A;  3IAS 1;  2D2Q A;  3AUL A;  3VR9 B;  3NG0 A;  2BB5 A;  4A55 A;  2ZNV C;  5BMH A;  1H8C A;  3AN1 A;  3W1Y A;  1WJN A;  2AX5 A;  3R2I A;  2QDF A;  4GGQ A;  5GMV A;  1PGX A;  2DEN B;  4KIK B;  2C60 A;  4EE2 A;  2BKF A;  5JZE B;  2IJ0 A;  1YJI A;  2GB1 A;  2KJR A;  4WQM A;  4PS7 A;  1UWM A;  4W9K A;  4DHZ B;  4WH4 A;  3NOB A;  4RM8 A;  1C77 A;  3RNA C;  2JXT A;  1X1M A;  1RRB A;  3QX1 A;  4F7Z A;  2HDE A;  2ZZP B;  3EEC A;  1P1A A;  4G0N B;  3VR8 B;  2RDH A;  2V4I B;  5BYQ A;  3UIO B;  2YVC A;  2TSS A;  2NBU A;  5D3D A;  2MSE D;  1C9F A;  2MLB A;  2JZP A;  2AQ3 B;  4LNK A;  4ANX A;  2PVO D;  4FHJ A;  4W9C A;  2BYF A;  2MRP A;  3U4E G;  2K39 A;  4HCN B;  5I4D A;  3IBE A;  2LGI A;  5L83 A;  2WXJ A;  4XWW A;  2QCZ A;  4BKS A;  1SJE D;  1WGK A;  2QJL A;  3R2T A;  4FA6 A;  4XDC A;  4DXA B;  1ZGU B;  1EF5 A;  2JWZ A;  1HZ5 A;  4FHK A;  4ARI A;  4HKZ E;  3ZNH B;  5LXH A;  5LNK 1;  1WFY A;  2KX3 A;  3JYU A;  1E7U A;  5TR5 A;  4BAX A;  1HTO A;  2KWV B;  5JH5 C;  1WYG A;  2V4L A;  1WX8 A;  2J4X A;  2FNJ B;  2N9P C;  2GOW A;  2UU7 A;  2YEP B;  4DHZ E;  2KK8 A;  1P9D U;  1MPE A;  3DBH I;  5G55 A;  1SBB B;  4ITK A;  2I2Y A;  2N1V A;  2ZW0 A;  3MJ5 A;  3DHI C;  1MJD A;  3MC0 B;  3MC8 A;  4E3C A;  3APD A;  2FID A;  2JRH A;  3SFE B;  1VRA B;  3CSF A;  4TMA B;  3TCA A;  2V3P A;  3L13 A;  4ZRI A;  3ZNI D;  2KDE B;  3PV1 A;  1F0Z A;  4W9H A;  3ML9 A;  3P4Q B;  1XXG A;  4WWN A;  2KFK B;  4LNO A;  3AEA B;  2AEH A;  1VD2 A;  1V81 A;  1YN3 A;  4EZJ A;  2WDV B;  2MH7 A;  2WQY B;  2KYW A;  2Q5W D;  1D4B A;  2NCN A;  2MBO A;  2BS3 B;  3RNB C;  1JCK B;  3ALB A;  4WJN A;  1JAL A;  1XLO A;  3WAN A;  4K3B A;  4ZRP A;  1HA5 A;  1UBQ A;  1WXA A;  1K51 A;  2QC8 A;  1QKZ A;  1V1P B;  3EGR A;  4GDL A;  1L0X B;  2VRR B;  3WAP A;  2KOX A;  4PYU A;  2BF8 B;  2BPS A;  2IY1 B;  3P63 A;  3A4R A;  2CS4 A;  3P2B A;  3RD2 A;  3JVZ X;  3L54 A;  1TS3 A;  5EE0 A;  2O2V B;  3DQV A;  1M4V A;  1TS4 A;  2NMQ A;  1UBI A;  1WGG A;  2JUO A;  5IOI A;  1FXA A;  4E71 A;  3Q2A C;  4DHJ D;  4OVU A;  4A3P A;  4B95 A;  1FO4 A;  3HM6 X;  2J0K A;  2Y5B B;  2NTS A;  5FR3 A;  1DYQ A;  1SE4 A;  4M01 A;  1FD6 A;  1E9M A;  2WYQ A;  1IPG A;  3BIN A;  2G1E A;  2GBJ A;  4K7S A;  2WX0 A;  2IGH A;  2JQR B;  4YXD B;  1YOV B;  2PPH A;  3ZXV A;  1ZDV A;  3W1S C;  2PEA A;  3A33 B;  1L4Z B;  2WXK A;  1WYW B;  2ON8 A;  2KN5 A;  2WXG A;  1YN4 A;  3U30 A;  1WRD B;  2DHZ A;  2WS3 B;  2KMC A;  4G11 A;  4FXC A;  3AE5 B;  4AJY B;  3NY5 A;  4KZC A;  3W1S A;  1OQY A;  1WGY A;  3NZS A;  3AE1 B;  5FKA C;  4PS3 A;  2M4N A;  1U4A A;  4I6P A;  1I35 A;  3N3K B;  2YEP F;  5JHA A;  2DZK A;  3DBR I;  1QIL A;  4JE3 B;  2KLC A;  3FIL A;  3P4P B;  1TJE A;  3H7S A;  4MJS A;  3M63 B;  4B9K A;  2HTH A;  1FCC C;  3H8H A;  1SE3 A;  3U8Z A;  1SF0 A;  5D6J B;  3WCQ A;  3RNG C;  3ECI A;  1C4P A;  4KKI A;  4C4V B;  3ZO5 B;  1EF1 A;  2INC C;  5BYS A;  3L17 A;  5L95 C;  4K7U A;  2LGY A;  3SR6 A;  2WU5 B;  2FCM A;  2MJD A;  2MEK A;  3PZD A;  1OEY A;  5IA7 A;  3QAQ A;  3WIM A;  2MX2 A;  2L32 A;  3JW0 X;  2FCN A;  5HI1 A;  2JSV X;  1MHH E;  1WX7 A;  3PVL A;  2Z0E B;  1CZP A;  1VZ6 A;  1FEH A;  3AEC B;  3A1Q B;  1XD3 B;  1FMA D;  2M56 B;  3RFZ B;  1WMH A;  3KYD D;  3M95 A;  3AE9 B;  3QIJ A;  3UF8 A;  4ZYN A;  4MJS B;  2MBB B;  1QZE A;  2NPT A;  4RH6 A;  3ABV B;  5MPO A;  2KD0 A;  2PMV A;  2EMS A;  2E3T A;  4TV3 A;  3M3J A;  1UUP A;  3KQ4 A;  2XEW A;  2IY0 B;  3UQB A;  2DNF A;  4YTM B;  2DZI A;  1NI2 A;  2WDT B;  4C56 C;  3AEB B;  4HPM B;  2BKR B;  4KVG B;  2ZJD A;  1V80 A;  3HVZ A;  2W3S A;  2WXM A;  3C0R B;  4MGZ E;  3C19 A;  2JYE A;  4GU2 A;  2BVC A;  2JY6 A;  3N20 C;  1GUA B;  2WX1 A;  2JWU A;  4AQ7 A;  1I4P A;  1YQ4 B;  5TSS A;  4DDI D;  3DBL B;  5FR6 A;  3V62 A;  2L76 A;  2IO2 B;  2G3Q B;  4ZRK A;  5AZH A;  3VUX A;  4HCP B;  2LRW A;  5AUI A;  1XCQ L;  2BWE S;  4MEL A;  2KC2 A;  4KIK A;  1GAQ B;  2GRI A;  2ICI A;  1YX6 B;  2L7R A;  2FIF A;  1BXT A;  1LO5 D;  4HDO A;  2IND C;  2WU2 B;  3H6N A;  4W9D A;  5IAA C;  4ACF A;  1L6V A;  3LB8 C;  2CHZ A;  3CMM B;  4K81 A;  1HEZ E;  3MP9 A;  3PPA A;  4HJG E;  2ONQ A;  4FJZ A;  4NAW B;  2L8J A;  1J8C A;  3T3N A;  4OZC A;  4XWT A;  2W55 A;  2BS4 B;  1T3Q A;  2BYV E;  1D3Z A;  1L0Y B;  2O6V B;  3A9K B;  4IUM B;  3QHT A;  1P7F A;  2LAS A;  1LXD A;  1YJ1 A;  3AED B;  1CK1 A;  3OLM D;  1OFF A;  4RNA A;  2L1A A;  2CR5 A;  4ICU A;  3B2F A;  2R2O A;  2W9N A;  3NVZ A;  1J7B A;  1TS5 A;  2LI5 A;  4WUR A;  2VZK B;  1I42 A;  4N9F 4;  2DYB A;  2KC1 A;  2KMA A;  4OVZ A;  1SE9 A;  2HJ1 A;  4BFR A;  2N9X A;  3BVM A;  4NQK E;  1KLG D;  2CJO A;  4XE0 A;  1JML A;  3URY A;  4RMA A;  2KFK A;  2M8S A;  1I4X A;  4KZ0 A;  2ASQ A;  4XDD A;  3VHT C;  2OJR A;  2PW9 A;  2AWT A;  4NPN A;  4JGH B;  1ESF A;  2LUM A;  4HVB A;  5AEK B;  2KJH B;  2ACZ B;  1FNW A;  4IM0 A;  1FRD A;  1RLF A;  1RAX A;  2D3A A;  2NPT B;  1GC7 A;  1KM7 A;  1I4G A;  3JSV A;  1VR9 A;  4JPS A;  3DHG C;  5IKC M;  3P4R B;  3E9S A;  1FRR A;  3DDC B;  1UF0 A;  3ONS A;  3NVY A;  2C7H A;  2KZR A;  5BYR A;  1F1H A;  2KDB A;  3EFU A;  3ZTC A;  4RFB A;  1XO3 A;  4RF0 A;  1EWC A;  4MDK E;  4AWJ A;  1RM6 C;  2BW2 A;  1MFW A;  1WJU A;  2K1F A;  4HK2 A;  1EU3 A;  3A9J A;  4OZB A;  3RI7 C;  2YLM A;  3BII D;  4UDU C;  4C4V A;  2L3Z A;  1LM8 B;  1WGH A;  1WR1 A;  2J53 A;  2ZNV B;  4GDK B;  4BVU C;  1ZP0 B;  1NVI D;  4WJQ A;  4Q2J A;  1C3T A;  4WWP A;  2EKI A;  4TUU A;  1SXT A;  4MT5 A;  2M1M A;  3NZU A;  2BWF A;  1C4C A;  3ZQ4 A;  3B1L X;  1MI0 A;  3Q8B A;  1ZKH A;  2K22 A;  2KDI A;  2EKE C;  3TEZ A;  5BO4 B;  4TQ1 A;  5HG2 A;  1B1Z A;  1F2R I;  2KT7 A;  2OHF A;  2BYE A;  4NZL B;  1P3Q U;  1QOG A;  1HE8 A;  4J3O D;  1A5R A;  4MM3 B;  1TS2 A;  3AU5 A;  5KHO A;  3PLV A;  4BOZ B;  2LVP A;  2R61 A;  1E8W A;  2Y3A A;  3APF A;  1JWU D;  1NBF C;  1T0Q C;  3N1X C;  4ZHP A;  3AE4 B;  1WY8 A;  4HDQ A;  4WQO B;  3NS1 A;  2PKO A;  3A9K A;  4USA A;  3ZRF A;  2DYO A;  2KFJ A;  1FM0 D;  5C23 A;  2D5G A;  4LTU A;  2K6D B;  2LJ5 A;  1RYJ A;  3ETR A;  4W9L A;  1TZ1 A;  3K9O B;  4M8N A;  3N32 A;  4N58 A;  5CHW A;  1M94 A;  1AN8 A;  2DAJ A;  3PZ7 A;  3UIP B;  1DOX A;  1JW9 D;  4S17 A;  2QSD A;  3N1Z C;  2LVO A;  4E74 A;  3V3X A;  1IGD A;  2H89 B;  1V5T A;  3PRP B;  4IOI E;  4GN1 A;  4NJ6 A;  3PTF C;  3OWE B;  4G3X B;  3U52 E;  3TIX A;  4FAD A;  2WP9 B;  3N9Y C;  1BT0 A;  1LGR A;  3QK0 A;  4MM3 A;  1N60 A;  1GB4 A;  3A4S C;  2OED A;  1N6Z A;  2DBY A;  3VFK A;  5KHQ A;  1WH3 A;  4EKU A;  5DCN A;  1CQV A;  1NEN B;  2PIA A;  4GDK A;  3PLU A;  1GC6 A;  5J17 A;  4LNN A;  1WWT A;  2VZK D;  4B0M A;  2WXP A;  4HRO A;  4ZRQ A;  4F1S A;  4B0E A;  1Y8R C;  5CHV C;  2JVC A;  1K8R B;  2G4D B;  1VCB A;  1OTR B;  2B76 B;  4IKG A;  2QHO A;  4NJ7 A;  3IT4 B;  1I4Q A;  2MQJ A;  4LCD E;  2NR2 A;  2N1W A;  1QOB A;  1UEL A;  4ZOH C;  2W82 A;  1F9J A;  2FUG 1;  2CHX A;  2XK5 A;  1KJT A;  3PZ8 A;  2LEK A;  2DAF A;  1QOF A;  3R3M A;  4GIV A;  1YNT E;  3LDZ E;  2V9H A;  1WGR A;  2IZV B;  3QWZ B;  2PE9 A;  3GZN B;  3M62 B;  4KV2 A;  3DBS A;  1S3S G;  4XC2 A;  3TL5 A;  1FFU A;  3DVN U;  2KNB A;  5G5G A;  4JWS C;  3ZJV A;  3I57 A;  4IWO A;  3O65 B;  4X57 B;  5LLI A;  1R4N I;  1P7E A;  1WF9 A;  3I3T B;  3TEY A;  2RDG A;  1L0V B;  3IT6 B;  2BS2 B;  2N7J A;  4I6L B;  2RMM A;  5HFY A;  4MGK E;  2MBQ A;  3AI5 A;  3K9P B;  2BYT A;  2KKC A;  5E6N A;  4BKG A;  3PRZ A;  5D2M B;  3VTW A;  1XF5 L;  3PT2 B;  3AE3 B;  1H4R A;  2N9L A;  1SIJ A;  3T3O A;  2MWS B;  2WLB A;  2REX A;  1J0G A;  3AB5 A;  3L10 B;  2V3N A;  1HTQ A; 
#chains in the Genus database with same CATH homology
 1ZUD 2;  5TSS A;  1JWS D;  2JX5 A;  3AM9 A;  2WXL A;  1I4H A;  2WXF A;  3CWI A;  2IGD A;  1JWB D;  4YSY B;  1ZPS A;  1XLQ A;  2E6X A;  5AUI A;  1XCQ L;  4RGM A;  1GAQ B;  2GRI A;  2ICI A;  1F2R C;  4YTP B;  1GPX A;  3O13 A;  4DXG A;  1BXT A;  1HXY D;  1Y56 A;  2ZW1 A;  1LO5 D;  1ACC A;  3LXF A;  1UNS A;  4LK0 M;  1T6B X;  1PUT A;  2XN9 C;  2WU2 B;  1E7P B;  1NYQ A;  3W9C B;  1TKE A;  1V97 A;  2KN4 A;  1L6V A;  3IAS 1;  3L4P A;  4P6V F;  3LB8 C;  1PYW D;  3VR9 B;  2CU3 A;  2BB5 A;  4A55 A;  2M19 A;  5BMH A;  1HEZ E;  1NYR A;  1SB3 C;  3MP9 A;  1XCT L;  1BML C;  2BB6 A;  3AN1 A;  1UGJ A;  4HJG E;  4ARC A;  2ONQ A;  4NAW B;  1I4R A;  2AX5 A;  3R2I A;  1L5P A;  1TY2 A;  3T3N A;  4WIP A;  4OZC A;  4XWT A;  1PGX A;  4OW0 A;  2W55 A;  4EE2 A;  3I9V 1;  2BS4 B;  2IJ0 A;  1OQQ A;  1T3Q A;  1YJI A;  1QOA A;  3AV8 A;  1GOZ A;  2GB1 A;  4WQM A;  1R7S A;  1UWM A;  1L0Y B;  4WH4 A;  2K0P A;  2DLB A;  3NVV A;  1C77 A;  4CQN A;  1GB1 A;  1MVK A;  1PFD A;  2JXT A;  3CIR B;  2LJI A;  1P7F A;  2HDE A;  3AED B;  1HQR D;  1SE2 A;  3VR8 B;  1CK1 A;  3U2S C;  3BYY B;  1ET6 A;  2RDH A;  2V4I B;  1OFF A;  3AH7 A;  4O1N A;  4RNA A;  5BYQ A;  2L1A A;  2TSS A;  3KLS X;  3IAM 1;  4N6E B;  3B2F A;  5D3D A;  2M0A A;  1C9F A;  3NVZ A;  1J7B A;  1TS5 A;  2JZP A;  4WUR A;  1ZXH A;  2AQ3 B;  2VZK B;  1PDX A;  2PVO D;  3GP7 A;  1V1O A;  2MJ3 A;  2WXO A;  1QLB B;  4OVZ A;  1VJK A;  1DOY A;  1WXQ A;  4C80 A;  3U4E G;  3HVD A;  3BVM A;  1KLG D;  2CJO A;  4XE0 A;  1JML A;  5I4D A;  2INP E;  3URY A;  2LGI A;  4A8X C;  1I4X A;  2X38 A;  1J7C A;  4XDD A;  4HRS A;  5D3I B;  4YWG G;  3VRB B;  5C2T B;  1QF6 A;  1QQR A;  1EM7 A;  2PW9 A;  2WXJ A;  3Q8E A;  4WAF A;  5EE9 A;  4H2A A;  4N59 A;  4XWW A;  1WGK A;  1SJE D;  2QJL A;  3BK1 A;  3R2T A;  4XDC A;  1ESF A;  2LUM A;  5H8Y E;  2INN E;  5E6J A;  1KLU D;  3C8Y A;  1HZ5 A;  2ACZ B;  4RCO A;  1FNW A;  4ARI A;  4A6Q A;  4HKZ E;  2W3R A;  1FRD A;  5G5H A;  1T5X D;  2FBW B;  5LNK 1;  1D5Z C;  3BK2 A;  4DXF A;  3Q8F A;  1I4G A;  1VR9 A;  2J52 A;  1VZ7 A;  3AEF B;  2IDY A;  4JPS A;  3B9J A;  3TEX A;  1WYG A;  3P4R B;  4YTN B;  3E9S A;  1N5X A;  1FRR A;  2J4X A;  4KKJ A;  5JXV A;  1FCL A;  1NEK B;  5D7G A;  1VDV A;  3NVY A;  2YEP B;  3NRZ A;  2Y5P A;  5BYR A;  2WXQ A;  1RWS A;  4JX1 C;  1F77 A;  1MPE A;  1QT9 A;  1XO3 A;  2H88 B;  2PLP A;  1IGC A;  4RFB A;  1SBB B;  2K5P A;  4ITK A;  4RF0 A;  3U7Z A;  2I2Y A;  1WSP A;  1TZO A;  2ZW0 A;  1EWC A;  3MJ5 A;  2SEB D;  3MC0 B;  1JRO A;  1RM6 C;  3SEB A;  2HTM E;  2BW2 A;  1XLP A;  4NJC A;  3GS2 A;  1JRP A;  1JWM D;  3AE7 B;  1AW7 A;  3B2G A;  1EU3 A;  4D2K A;  3SFE B;  2WXR A;  1VRA B;  4OZB A;  4C7Z A;  3NZ3 A;  4TMA B;  2V3P A;  2QEJ C;  3BII D;  1AWD A;  1C79 A;  4UDU C;  3FIL B;  1L4D B;  4US8 A;  2J53 A;  1OQR A;  1F0Z A;  4GDK B;  1RFK A;  3P4Q B;  1XXG A;  3RPF C;  4AS1 A;  1ZP0 B;  1NVI D;  4MAC A;  4Q2J A;  1J7A A;  3ZYY X;  3AEA B;  2EKI A;  1ENF A;  1SXT A;  1YN3 A;  4MT5 A;  4OZA A;  3Q8A A;  2WDV B;  2MH7 A;  2WDQ B;  4RGO S;  1C4C A;  1N62 A;  2WQY B;  3BVG A;  4KGT A;  3ZQ4 A;  1MI0 A;  3Q8B A;  4OHJ A;  2K22 A;  2Q5W D;  1D4B A;  4M0W A;  3NVW A;  3TEZ A;  5C3J B;  1DGJ A;  2BS3 B;  1FIQ A;  1JCK B;  2DYM A;  4TQ1 A;  5HG2 A;  5BMG A;  3W2D A;  1B1Z A;  1SSN A;  1JAL A;  1F2R I;  1XLO A;  2OHF A;  1ET9 A;  2N9K A;  4ZRP A;  4NZL B;  1HA5 A;  1K50 A;  1K51 A;  1TY0 A;  1QKZ A;  1V1P B;  3EGR A;  1QOG A;  4J3O D;  4HKQ A;  1L0X B;  4MM3 B;  5T8I A;  3AMZ A;  1TS2 A;  3P1M A;  2WNM A;  2QIL A;  3P63 A;  1E0Z A;  2R61 A;  2AQ2 B;  2Y3A A;  1TS3 A;  2FE8 A;  5EE0 A;  2SAK A;  1TKY A;  1JWU D;  1M4V A;  2I38 A;  2RPV A;  4ZHP A;  1NI3 A;  3AE4 B;  2K9X A;  1TS4 A;  1FNV A;  3BVZ A;  1FXI A;  2J42 A;  2NMQ A;  1IBX B;  3NS1 A;  2PKO A;  4USA A;  2DYO A;  3J9C A;  1FM0 D;  4GLS C;  3AE2 B;  2D5G A;  1FXA A;  1C76 A;  4LTU A;  3TSS A;  4R3D A;  3W5V B;  1RYJ A;  1ZXI A;  3ETR A;  1KTK A;  1IBX A;  4TSS A;  2BTE A;  4YSX B;  4N58 A;  1FO4 A;  3DWM A;  3KWL A;  1XLN A;  1CJE A;  1K53 A;  1AN8 A;  2NTS A;  4YSZ B;  5FR3 A;  1DYQ A;  1D6E C;  1JWA D;  1SE4 A;  3PZ7 A;  5FK9 C;  1DOX A;  3HRD D;  1FD6 A;  1JW9 D;  1E9M A;  2QSD A;  3P4S B;  1VLB A;  2G1E A;  1SEB D;  3VRA B;  4L1B A;  1A70 A;  2IGH A;  2JQR B;  2KQ4 X;  4YXD B;  3PO0 A;  3V3X A;  1IGD A;  1FFV A;  2H89 B;  2LMC A;  4GDL B;  1ZDV A;  4HEA 1;  1V8C A;  2Z8L A;  2KMM A;  4IOI E;  1L4Z B;  2WXK A;  3E56 A;  3IXS A;  3Q8C A;  2K3U A;  2PVG C;  2ON8 A;  4A9A A;  2DWQ A;  1TYG B;  5H92 C;  3OWE B;  2WXG A;  3U52 E;  1D5M C;  1YN4 A;  2WP9 B;  3N9Y C;  2WS3 B;  4FXC A;  1KH0 A;  3AE5 B;  2BT6 A;  1C78 A;  1N60 A;  2LFI A;  1V1P A;  1GB4 A;  2OED A;  3W1S A;  1B9R A;  3VQI A;  4PT5 A;  1E10 A;  2DBY A;  3AE1 B;  5FKA C;  2LHD A;  1CQV A;  3AEG B;  1NEN B;  1YMH E;  2PIA A;  2YEP F;  4C7Y A;  1STE A;  2L52 A;  3UI3 A;  3BWU D;  3AE6 B;  1QIL A;  4JE3 B;  3FIL A;  4ZHO A;  2N0S B;  3P4P B;  1WWT A;  1TJE A;  2VZK D;  4B0M A;  2WXP A;  3BYT B;  4HRO A;  4RF1 A;  3W5U B;  5EE3 A;  4ZRQ A;  3FC4 A;  2AQ1 B;  4B0E A;  3NUH B;  4ZYS A;  3EUB 2;  1FCC C;  2MJE A;  3H8H A;  1SE3 A;  1SF0 A;  2LHE A;  3AE8 B;  4IDI A;  2B76 B;  3WCQ A;  2L83 A;  1EWY C;  4IKG A;  1C4P A;  4KKI A;  3EA6 A;  1UWX A;  2WXI A;  3IT4 B;  1I4Q A;  2KAC A;  1ROE A;  1QOB A;  3TEW A;  5BYS A;  3KWV A;  1BUI C;  2IGG A;  1ZDX A;  4ZOH C;  4WWM A;  2W82 A;  1HZ6 A;  1DOI A;  2XNA C;  3SR6 A;  1AYF A;  2FUG 1;  1VZ8 A;  2WU5 B;  4TQ0 A;  1WRI A;  2MEK A;  2MJD A;  4KX6 B;  3ZJU A;  3PZ8 A;  2WXN A;  3AEE B;  4LLG M;  2LEK A;  1TKG A;  1QOF A;  1YN5 A;  2L32 A;  3FAH A;  4KGS A;  5BMI A;  3GB1 A;  5EE1 A;  1YNT E;  5HI1 A;  2JSV X;  3R8B A;  3Q69 A;  2PTL A;  1KF6 B;  4MH8 A;  1MHH E;  2IPK D;  4KGR A;  1ZE3 D;  4US9 A;  1CZP A;  2GI9 A;  3MHZ A;  1VZ6 A;  4YT0 B;  4DQO C;  4A90 A;  1FEH A;  2G9H D;  3AEC B;  3RFZ B;  1FMA D;  2M56 B;  1FNU A;  4RGN A;  3AE9 B;  1FFU A;  2KWD A;  1N5W A;  4RGT A;  5G5G A;  4JWS C;  3ZJV A;  3I57 A;  3BZD B;  2KAJ A;  3P42 A;  4RH6 A;  3ABV B;  1N63 A;  1N61 A;  1P7E A;  2WDR B;  2WXH A;  5MPO A;  3TEY A;  2RDG A;  2PMV A;  1L0V B;  3IT6 B;  2BS2 B;  2E3T A;  3V05 A;  2N7J A;  1Q10 A;  1YQ3 B;  5HHD G;  1KFY B;  2RMM A;  1UUP A;  4P16 A;  4REZ A;  2JYT A;  5HFY A;  1EU4 A;  2QIE B;  2NTT A;  1L6U A;  4L2Y A;  3KQ4 A;  1C4A A;  2BYT A;  1D5X C;  3HUI A;  2W54 A;  3SFD B;  4YTM B;  2V0G A;  4L23 A;  2KDM A;  1XF5 L;  5GXG B;  2CJN A;  3LYY A;  3AE3 B;  2N9L A;  4C56 C;  1SIJ A;  3AEB B;  4NAM A;  3T3O A;  3DWG C;  1XEE A;  1K52 A;  2QMT A;  1E6E B;  2EEL A;  3HVZ A;  1KRH A;  2JU6 X;  1IUE A;  1ZOY B;  2W3S A;  2WXM A;  2BBC A;  1MHX A;  5AUK A;  1PGA A;  2WLB A;  1JQ4 A;  2JYE A;  3TUO A;  1SJH D;  3ZGZ A;  3MFG A;  1YJJ A;  3AB5 A;  2V3N A;  3ZJT A;  2JWU A;  4AQ7 A;  1I4P A;  1PGB A;  2Y5C A;  1I7H A;  1YQ4 B;  4JWU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...