2LHEA

Gb98-t25i,l20a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
TTYKLILNLKQAKEEAIKEAVDAGIAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gb98
publication title Mutational tipping points for switching protein folds and functions.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2011-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2lheA00
1P7EA 3UI3A 2N9KA 1HZ6A 1C9FA 4D2KA 1IBXB 1K50A 2OEDA 2PTLA 1XF5L 2GB1A 1EM7A 1MHXA 5HHDG 1GB4A 2RPVA 2JWUA 2LHDA 5BMHA 2KWDA 2RMMA 4IOIE 4MACA 5HI1A 4OZAA 2LUMA 2EELA 1MI0A 2ZW1A 1FCCC 1P7FA 1PGBA 1XCTL 4HKZE 1MVKA 3V3XA 1XCQL 4IKGA 1IGCA 4GLSC 2J52A 2IGGA 4OZBA 1K53A 1MPEA 2KQ4X 5BMIA 1FCLA 5HG2A 4HJGE 4KGRA 2KACA 4KGTA 2KDMA 1GB1A 1YNTE 2IGHA 1HEZE 2ONQA 1PGXA 2ON8A 3FILA 3GB1A 1Q10A 1K51A 3MP9A 5BMGA 2QMTA 1HZ5A 4OZCA 1K52A 1D4BA 1IBXA 2KN4A 2N9LA 2JXTA 2NMQA 1PGAA 1MHHE 2ZW0A 1ZXHA 2PLPA 1YMHE 5HFYA 1FD6A 1F2RI 1UWXA 2PW9A 1F2RC 4WH4A 5JXVA 1KH0A 2JZPA 2JU6X 2IGDA 2GI9A 1JMLA 2JSVX 2N7JA 2LGIA 4KGSA 2I2YA 1QKZA 2K0PA 2J53A 3FILB 2LHEA 1IGDA 2QSDA 2I38A
chains in the Genus database with same CATH superfamily
3ZJTA 2IYDB 2D10A 2MBBB 4IWPA 2IO2B 2GBKA 1E8WA 3LDZE 2PMVA 2SEBD 1IPGA 4ZRJA 3ZRCA 2O2VB 4E3CA 2NTTA 3X23A 5FR3A 1YQ4B 4MGYE 3PRPB 4OHJA 4G0NB 4USAA 2RMMA 2BF8B 2ZW1A 4ITKA 3VRBB 2WDQB 5MPOA 2HJ1A 2N9PC 1Z2MA 4YSZB 1SE3A 3NJTA 1V5TA 1X1MA 5AZHA 4NAWB 2KQ4X 1I35A 2AWTA 2VZKB 3HK0A 2N1VA 1L6UA 3TEZA 1PGXA 3QAQA 4MSQB 3RN9C 2L76A 2OOBB 3P63A 3QA8A 2QHOA 1K52A 3SD5A 3DBHI 3GZNB 1IBXA 1YQBA 4WWOA 4PK1A 3U7ZA 2DYOA 3UINB 2WP9B 2NBWB 1HTQA 3N1XC 4KIKA 4ZRIA 3U8ZA 3RYTA 1TKGA 4JL9A 3DCGA 5BYSA 1FD6A 2AL3A 3BY4B 4EOYA 2K22A 4DHJB 4AS1A 1UZXB 1B9RA 2KN5A 3M3JA 3KYCD 2N1WA 2FCMA 1XEEA 2IGDA 5IP4D 3DWGC 2RPQA 2D5GA 5JHAA 1Q5WB 1F0ZA 3IBEA 1GPXA 2IO3B 3PRZA 2MCNB 3ZUNA 2QSDA 2DENB 4GDKB 1AWDA 1XLOA 2N9KA 3RNEC 1T0SC 2HTHA 3HHMA 3K9OB 3N1ZC 5LXHA 2N7EA 1UBIA 2O6VD 5EE0A 3TEWA 4LLGM 2LUMA 3V60A 3DBRB 3T3OA 1FFVA 2BQQA 5DPWA 1GAQB 3N32A 4IKGA 4A9AA 3APDA 1WM2A 2R2OA 1YN4A 2DAJA 5L83A 4RH6A 5CHFA 1PFDA 2KO3A 4DDGD 2MBHA 3U2SC 1VZ7A 4P16A 1RAXA 4FHKA 1JW9D 2Y5BB 3ZDMC 2PE6B 2LJIA 4GXBA 3BK1A 1WZ3A 3HIZA 2MSED 4LTUA 2DNFA 3IFWB 2J4XA 1ZOYB 4MSMB 2KJRA 1XLQA 3CMMB 2DX5B 5I4DA 3OLMD 1SF0A 4S0RA 1FRRA 3AULA 3Q3MC 4DXFA 3RMKC 2KYWA 4NJCA 3MC8A 1UH6A 1KJTA 1IYFA 1I4HA 1F2RI 4NNJB 1L0YB 4FN2A 4AJYB 2RDGA 4TMAB 4ANWA 2WXQA 5D3IB 3ZTDA 1HE8A 5IKCM 4RGMA 4JQWC 3RULA 3UIPB 5EE3A 2N9XA 3N3KB 1JRPA 4MT5A 3TCAA 1SBBB 5BYRA 1AW7A 2K8HA 1C4CA 2WYQA 3RI7C 4C00A 5D94A 1EU3A 4WJPA 2MRPA 1K51A 3RCZA 3ML8A 2NCNA 4NJ6A 1XO3A 1TBEA 2K8BA 4PYZA 4FULA 4US9A 2NVUI 2BBCA 3ZXVA 1V1PB 2QC8A 2WXFA 1V8CA 3A9KB 3H7SA 5HKHA 2KWDA 3WAMA 4EZJA 3M95A 2MWSB 3ZW3A 1QOGA 3DPDA 5AEKB 3MC0B 3HUIA 2KKCA 4EFOA 1FCLA 3FC4A 1I4XA 1VLBA 1V2YA 4FJYA 1J8CA 3SU8X 2ASQA 5H8YE 4MH0E 4B0EA 3OAWA 2DYBA 4I6NB 3RZWC 3GE8C 4MJSA 3VHTC 4BFRA 3AEEB 5GXGB 1YN5A 3AEGB 1YQ3B 1H8CA 4W9FA 3AE9B 4KKJA 3EFUA 3JYUA 4DBGA 2Z0EB 3VR8B 4ZRKA 3E9SA 2K9XA 2WS3B 2K6DB 2MJ3A 2WU5B 1TGZB 2CU3A 4US8A 1KH0A 1RRBA 3IHPC 5G5GA 2GI9A 2N7JA 3A4SC 3W1SC 1A70A 2LRUA 3AXCA 2K6QA 3VFKA 2UU7A 3L54A 4N9F4 4LDTB 2LD9A 1HZ6A 2BVCA 4FADA 1PUTA 4ARCA 3ZGZA 4ZHOA 3DDCB 4GB9A 3HVZA 3IAS1 1WJ4A 4I6PA 3VH3B 1BXTA 1HXYD 3O13A 4DQOC 2V3PA 1ET6A 2L3ZA 2IBIB 3PREA 1UNSA 1GG3A 4ANXA 3W1YA 1ZKHA 5HI1A 3AU5A 1MI0A 2ZCBA 4RM9A 2PE9A 3WCQA 4BOSC 4DHZE 4C56C 3IT4B 1E90A 4O1NA 1EF5A 3TEXA 1BT0A 2LUEA 3TMPB 1WXAA 2J52A 1I4GA 4DK5A 4GIVA 4B9KA 1SGHA 1RM6C 2CU1A 2K1FA 1L4DB 4HJGE 4TSSA 4KX6B 4NQKE 1VZ6A 2G4DB 2GBJA 4P6VF 1WXVA 5BYQA 4URKA 2E6XA 1MG8A 1YD8U 1KFYB 3C0RB 4FBJB 3QQ8B 1GNUA 1R4NI 2KTRB 1T6BX 4MEMA 2L52A 1FNUA 2O2VA 1S1QB 1WXSA 2WQYB 3DBSA 4BZAA 1LM8B 3B08A 4RNAA 4F7ZA 4WH4A 3DVGY 4M02A 1JWUD 2HJ8A 5J2RA 2L83A 2Y5CA 4M00A 2KFJA 2WXPA 3ZJUA 3U52E 2INPE 5C1ZA 5DCNA 1RFAA 4TQ1A 4HLEA 4NAWA 1FXIA 3W5VB 4LK0M 1WR1A 3ZIMA 4BOZB 3MTNB 2GMIC 3PS6A 1V49A 1NYQA 4C4VB 4ZOHC 1FRDA 4BKGA 1EM7A 4KDLB 3D32A 2XNAC 2JWUA 1I42A 1AN8A 4A90A 1XLNA 2C60A 3VRAB 1OQRA 2MBOA 3LXFA 1XCQL 4JPSA 1IGCA 1OFFA 2B76B 3BZDB 3Q3JA 3AE7B 4A6QA 2KDMA 1JWMD 4LNOA 1PDXA 1YX6B 3MFGA 4EE2A 1Q0WB 1PQSA 4HRSA 2DLBA 4F8CB 3GB1A 2Z8LA 1XXGA 2W82A 3EECA 4GDKA 1L5PA 3BIID 3OG5A 2L0FA 3Q3FA 2BT6A 3VTUA 1C4PA 2JXTA 2BW2A 1HA5A 3GZNI 2DBYA 3AEDB 3LYYA 4AUQC 1YN3A 1ACCA 1SIJA 2PVGC 2PW9A 1J7CA 1GC7A 1R4MB 3NVYA 3MJWA 4TV3A 1MFWA 3B9JA 3H8HA 3R66C 3ZRFA 1WE6A 3AE4B 1WFYA 2K8CA 4ACFA 2R61A 4RGOS 2QCZA 2ZJDA 4FHJA 1F9JA 2NPTB 4OW0A 1L7YA 1TTNA 3QHTA 2CS4A 3KH0A 4W9JA 2OEDA 3R7RA 2BYTA 2KLCA 1PYWD 2PIAA 4IDIA 2M8SA 3DHGC 3ZDTA 3AE8B 1DOYA 2NBVB 1WRIA 1CK1A 1C4AA 3BVZA 3C8YA 1VRAB 3BVGA 2V1YA 4H2AA 1LO5D 1FO4A 1TT5B 4GGQA 4XDDA 3ZXRA 4XDCA 3VDZA 1MVKA 2QIEB 2IJ0A 3DBRI 3E56A 2W3RA 1I4PA 1V97A 2V3NA 3CSFA 2V4IB 1TKEA 2MW5A 3AMZA 2UYZB 4KGTA 4YSYB 5KHQA 1EU4A 3P42A 4IWQA 3I9V1 3PLUA 3R3MA 1J19A 4G50A 2KVZA 3H9DA 2GBRA 4IWOA 3HVDA 4P7IA 2BYFA 2MBQA 2L00B 4G3XB 1C76A 2CR5A 3IXSA 4YL8A 1EF1A 1TJEA 2M56B 2MBEA 5AZGA 3RNAC 3WIMA 3N1YC 1EWYC 1GJZA 1V1PA 3A9KA 1T3QA 3L0WB 2X38A 2OJWA 4CQNA 5JH5C 2DYMA 1JMLA 3JSVB 3AN1A 2IZVB 2A5UA 1WY8A 2GLSA 3L16A 3PT2B 4X57B 1IGDA 3ZQ4A 3ZYYX 2SAKA 1UBQA 2ICIA 2LVOA 3RNFC 2I38A 4K3BA 3AE6B 1QLBB 4ANVA 1YX5B 4L2YA 2BWES 4G11A 3VTWA 2AQ1B 4BAXA 1L0XB 2PTLA 2D3BA 2C7MB 1V81A 5TSSA 3V62A 2WXHA 2RPVA 1N5WA 4ICUA 2WXRA 3PO0A 3VUXA 2OJRA 2LHDA 2A4ZA 1YJJA 3OWEB 3JW0X 3TSSA 1AYFA 3NG0A 5J17A 2MQJA 2CJOA 4GLSC 1M94A 1T0YA 2L8JA 3P4PB 2KACA 2LJ5A 5IAAC 2KDEB 3Q8FA 2FCNA 2IGHA 2JPHA 5FR6A 2WXOA 2FUG1 3CSTA 3KUZA 4ZYNA 3KLSX 3ECIA 2AX5A 1LQBA 2MLBA 4LNNA 2ZNVC 4II3B 2YLMA 2G1EA 4QAYA 1C3TA 2HDEA 4L23A 2BYEA 4YWGG 3MC9A 1ZXHA 5C23A 1QILA 5DPTA 1CJEA 1KRHA 1XLPA 2LI5A 3QK0A 3TBLD 4N6EB 2WXNA 3L17A 5IN7A 5DPSA 3VUYA 3V05A 4FJVB 1FXTB 3AEAB 5JXVA 3DOWA 4M01A 4IC7B 4FA6A 2LGIA 4KGSA 2K3UA 2KQSA 2Y5PA 2I2YA 2KMCA 3ENEA 2J53A 3FILB 2LHEA 3Q8BA 3ZNHB 2AL6A 3DWMA 1NBFC 1T0QC 1P7EA 1UF0A 2D3CA 2LWPA 2JQRB 3PZDA 4GMVA 2AYOB 2PKOA 4IG7B 1A5RA 3URYA 2WXJA 4JWUC 5D6JB 3DBLB 2WWZA 4XYCA 2PPHA 1F77A 1WE7A 2WDRB 4P1BC 4HEA1 2KTRA 4WWMA 3QX1A 5AUIA 4K7UA 2C9WB 3N9YC 3PPAA 1WGRA 4N59A 2KJ6A 2KFKB 4JGHB 1MPEA 4IW0A 3NS1A 4PYUA 2H89B 1NI2A 3U7DA 4KGRA 1B1ZA 2KWCA 2XK5B 3IAM1 1HEZE 2M4NA 3GP7A 3W2DA 1WYGA 1WSPA 3KYDD 4TQ0A 1CQVA 4HDQA 3UIOB 2C5LC 1V9JA 1HZ5A 3BYYB 2H88B 1FEHA 1ZW7A 1LXDA 2W55A 5J18A 2N9LA 3SEBA 2AQ2B 1NI3A 4HCNB 4HPLB 4MGIE 4A20A 4C4VA 3NUHB 2LXAA 3WAOA 1YMHE 3AE2B 2MJDA 2L7RA 1N6ZA 2Q5WD 4YTMB 4HK2A 4LNIA 3A1QB 3PGEA 2MH7A 2LMCA 4YSXB 1I4QA 3ZNZB 1EUVB 4A8XC 3ZNID 2V9HA 1BUIC 3W9CB 3NVZA 1U4AA 2V3SA 2KOXA 2IO0B 4DHJD 3MJ5A 4M0WB 2CJNA 3RD2A 4HWIB 1D5ZC 1XF5L 1DYQA 2GB1A 2WHIA 3LB8C 5G5HA 4ARIA 1FPYA 1WX8A 2D3AA 1TKYA 1KF6B 3NRZA 2J42A 2FCQA 1ZDVA 1F52A 4W9HA 1WZ0A 4IOIE 3ABVB 1R7SA 5FK9C 2L05A 3ZO5B 2L1AA 4BKTA 4ZYSA 2LGSA 4NAMA 1C1YB 3GOEA 1WJ6A 4KDIC 4WAFA 1E0ZA 3SR6A 3M62B 4GDLB 3R2IA 1E8YA 3Q6BA 1GB1A 2DZJA 1DOIA 1P3QU 1TS3A 2JF5A 1WGYA 3NZ3A 2ON8A 4MGZE 2YEPB 1WGHA 1WF9A 2RR9A 2NPTA 3DHIC 4OZCA 2KXJA 1UD7A 4LCDE 2KN4A 3NS8A 4YTNB 1H4RA 1CMXB 3K9PB 2WXMA 5LNK1 2X8XX 2KLGA 2ZW0A 5G2NA 2KTFA 4WAAA 2FE8A 4W9CA 4A3PA 4EZKA 1GC6A 4WQOB 1Y56A 1WWTA 2J0JA 2DAFA 4HCPB 1KM7A 3AE5B 4WQMA 4C7ZA 4LJPB 3KWVA 2JU6X 2FIDA 1XD3B 2LGDA 4P1CC 4XC2A 1R4MI 1V6EA 1S3SG 2Z0DB 1QKZA 4YTPB 3H6NA 3N30A 4NQLB 4GN1A 1KLGD 2MHJA 1GOZA 3PHWB 2KX3A 2KAJA 2J7QB 4DDID 4KKIA 4JIOU 3EC8A 1RYJA 4ZRPA 1GUAB 1WYWB 2FIFA 2LRWA 4KSKC 2C7NB 4A55A 1MHXA 4EKUA 4N58A 3V6EB 5GMVA 3MHZA 2LXCA 5AZFA 2XBBC 3UQAA 4MACA 3V61A 4W9EA 2WGSA 3SFEB 3A9JB 1N5XA 1TZ1A 1E7UA 1STEA 1L4ZB 2QDFA 5CHVC 5BMIA 1V80A 4HXDA 4CO7A 3P1MA 3EFCA 3JSVA 2M17A 3Q14C 1P9DU 3VUWA 5CX3A 1FFUA 4TKNA 4MGKE 2L0TA 3KQ4A 3PRMB 1E6EB 5C3JB 3H1UA 1E7VA 2ZPYA 2M1MA 1ZE3D 4CHKA 5E6PA 3VAWA 3QCAA 1WM3A 2IDYA 3AV8A 2KMAA 3PZ7A 2KWVB 4KSLC 3KWLA 3TEYA 1FMAD 1SE2A 4A3OA 1JWBD 3H7PB 4DWFA 1NVID 3QJZA 4K81A 2Z59B 3EGRA 4E71A 1D5XC 2WXKA 2BGFA 1YOVB 3AEFB 2ZVOA 3I3TB 4IM2A 2O6VB 3HM3A 3W5UB 2WDVB 2FCSA 2LGYA 1QF6A 1L2NA 2D11A 2JT4B 1C9FA 3AH7A 1WI0A 3KUCB 2AEHA 2WX1A 3Q69A 1ROEA 1ZP0B 4MM3B 3AE3B 4RCOA 3R7QA 2I1KA 3SFDB 2ZVNA 2CHZA 5JZEB 3ZLZA 2V0GA 4MELA 1GB4A 4DXGA 4RGTA 2INDC 1OGWA 2INNE 5BMHA 1YIWA 2DZKA 2EELA 5D7GA 3UGBB 2M19A 2KDBA 4Q2JA 4LDTD 2B3AA 4DXAB 3WAPA 2M0AA 4CYEA 2EKEC 2LZ6A 2KJHB 3BK2A 5HG2A 4F1SA 4GOCA 4FLHA 2JWZA 3NZUA 4KV2A 3BWUD 2ONQA 2D2QA 1OQQA 2KC1A 1TY2A 2KD0A 1WX7A 3FILA 3FAHA 3TUOA 4AOFA 2FNJB 2LASA 4XWTA 5LXIB 4LJOB 3TJPA 1FXAA 2D3GA 1D4BA 4ZDVA 3ZKJC 2PJHA 3I5JC 2PEAA 3EA6A 2UWQA 2PLPA 5HFYA 5C2TB 4HPMB 2KT7A 3L4PA 1E7PB 3BVMA 4C80A 4IUMB 1F2RC 4LNKA 5D3DA 1N60A 2BKRB 3OJ3A 2FAZA 3B0AA 1DGJA 2KFKA 2JYTA 3VVWB 1JROA 4M8NA 5IO9A 1C77A 1JQ4A 1E8XA 2XK5A 3S2AA 2KZRA 3UI3A 5DPRA 1UUPA 1K50A 1N63A 1ENFA 2ZZPB 1VD2A 4WJOA 2GBNA 4HDOA 3ZNGC 2KHWB 4RFBA 3NVWA 2BWFA 4JX1C 1QOBA 3RNBC 5L95C 1WH3A 2N7DA 3GE3C 4W9LA 2HTME 3DBLI 2RSUA 4YT0B 1HTOA 2MP2B 1SJHD 1SSNA 3EUB2 3L13A 3L08A 3R2TA 2WDTB 3AB5A 4EUTA 4K7SA 3Q3NC 1WGGA 1Y8RC 4AP4C 2G9HD 1K53A 2JZ3B 2GRIA 3A1QA 5JHBA 3Q8EA 1UELA 2K39A 3HRDD 4BKSA 3ZVVA 3VXWA 1YNTE 5AUKA 4NPNA 1TZOA 4HJKA 1K8RB 4JWSC 2DZIA 4REZA 2IY1B 2FUHB 2DHZA 3PSEB 1P0RA 2WXLA 4IM3A 4WWPA 1FNVA 1V86A 1WRDB 2JZZA 4IM0A 3JVZX 5CTRC 3NY5A 1BMLC 4WWNA 4M0WA 1IUEA 4M8MA 2IO1B 2D07B 2QILA 3PTFC 3LJ3A 4R3DA 3APCA 1WMHB 4NZLB 4HPPA 5LLIA 4EZLA 2KMMA 2G45B 2MJEA 1XQQA 1SXTA 3DVNV 1JWSD 3WANA 4KZ0A 4BVUC 2KC2A 2L32A 3PV1A 1TY0A 1L6VA 2NBUA 3ZJVA 2W9NA 3HM6X 4LNFA 1E10A 3V6CB 2JVCA 4GDLA 2KWUB 2JRIB 1TS2A 2WLBA 2E3TA 3PHXB 2CHXA 2HD5B 4MDKE 3CF6E 5EE1A 3WA0A 3SHQA 4WJQA 2WNMA 3ALBA 4AJWA 3RUIB 3PZ8A 2BB5A 1JWAD 3IT6B 1N61A 4I6LB 1QOFA 2G4SA 3TIXA 3TL5A 2KX0A 1P7FA 2JY6A 3RPFC 1DOXA 4HKZE 2AQ3B 3VH4B 3V3XA 4RM8A 3ZTCA 1KOTA 1J0GA 1D5MC 3QWZB 1NENB 1I4RA 2FBWB 4L1BA 4RMAA 1IP9A 1WXMA 3DQVA 2BS4B 2KQ7A 1F1HA 3B2GA 3DVNU 1YJIA 3DBHB 3O65B 1Q10A 4NJ7A 4JE3B 2INCC 2LGXA 2LFIA 4BBNF 1SE9A 1ISNA 4S17A 1T0RC 2BS2B 4HROA 1PGAA 1MHHE 1JALA 3RZFA 4PS8A 1Q1OA 2EKIA 2KANA 3P2BA 1OEYA 4WJNA 5E6OA 3DHHC 4ASWC 3U4EG 2VRRB 3SDLC 3UF8A 3QARA 3NOBA 4W9GA 4ICVA 3VQIA 3A9JA 4K1RB 1OQYA 4KZCA 2DWQA 2JSVX 4AWJA 2JYEA 1C78A 4PS7A 2VZKD 1D3ZA 4ZHPA 1D6EC 1XT9B 1IBXB 1Z5SB 1HQRD 5KHOA 3AE1B 2Y3AA 2NR2A 1N62A 4KIKB 3A4RA 3RFZB 4OVUA 1SIFA 1OTRB 2RD0A 1ZXIA 2MEKA 1M4VA 2GOWA 4GSWA 2JUOA 2BB6A 2VH2A 1FCCC 4OVZA 4PS3A 1PGBA 3I63C 1FIQA 1QT9A 3H7PA 2DZMA 1CZPA 3Q3OC 1TIFA 3KVFB 2KDFB 4W9IA 1E5WA 2O6VA 2IPKD 3RNCC 3P4SB 3X0WA 3RNGC 2WX0A 1NDDA 5BMGA 5BO4B 4E74A 3AECB 4XZ4A 2RGFA 2OHFA 2R2QA 4GU2A 4YXDB 2PVOD 4MM3A 1E8ZA 3P4QB 1LFDA 4FXCA 4W9KA 3T3NA 3OJ4B 2BYVE 5CHWA 1MG4A 2VH1A 1MJDA 3A33B 2K5PA 1OEYJ 1RWSA 2MA9B 2CHWA 3ONSA 2N9EB 4B95A 1ZGUB 1ZUD2 1QOAA 2JRHA 3EHVA 2JXXA 2YEPF 1SJED 1WXQA 1ET9A 3Q8CA 2ZCCA 5IOIA 3T9LA 1NYRA 4D2KA 1WX9A 2TSSA 2QJLA 3CWIA 1C79A 3AEBB 3AM9A 1VR9A 2W54A 3KW5B 1EO6A 4MH8A 1VCBA 2EMSA 1SB3C 4XWWA 5HHDG 4OVVA 1P1AA 1UGJA 1V1OA 5EDSA 5D2MB 4OZAA 5E6NA 3VR9B 5IA7A 2WXIA 2M0XA 2QEJC 1UWMA 1XCTL 4RF0A 2KDIA 1L0VB 2JX5A 2NTSA 3N20C 1TS5A 3U30A 4ZRQA 2XEWA 3IG3A 2K25A 5H92C 4K3CA 1I7HA 1WJUA 2ZEQA 2BTEA 1WGKA 5FKAC 1AARA 1LGRA 4XGAB 1SE4A 3AU4A 3APFA 1JRUA 4WIPA 3MHSD 3W1SA 3ML9A 3Q2AC 3T8MA 3I57A 2NS5A 4XX5A 2ZPNA 1WGDA 2HE7A 2ZNVB 2NMQA 2KK8A 1UGMA 1ZDXA 5TR5A 3J9CA 3C19A 4UDUC 4RF1A 2RDBC 1J7BA 4II2B 3GS2A 2CKHB 3QIJA 4C7YA 3KUDB 2GBMA 2W3SA 3RT3B 2KVRA 2JZPA 3CIRB 2MP2A 5EE9A 1SEBD 2LVPA 2BS3B 5G55A 2K0PA 4DHZB 2IY0B 1NEKB 1ZPSA 4HVBA 4TUUA 4MJSB 2LEKA 3ETRA 1TS4A 4JLCA 4BBNC 1WJNA 1KLVA 4W9DA 2KNBA 4EEWA 3R8BA 4NY0A 2N0SB 3IVFA 1E9MA 1KTKA 2REXA 4BKSD 2BPSA 3PLVA 3FKYA 4WURA 2MX2A 4B6WA 3QC8B 2V4LA 1EWCA 3NZSA 3L10B 2C7HA 1QQRA 1WMHA 3BYTB 4AQ7A 4HKQA 3WALA 5E6JA 2IGGA 4OZBA 2J0KA 3AI5A 2N4FA 4ANUA 4XE0A 1P98A 4K7WA 1KLUD 4RGNA 3VTVA 2LVQA 3M63B 2EMTA 3MP9A 3B2FA 1J7AA 2XN9C 2ACZB 2QMTA 1FM0D 1JCKB 1WR6E 1R4NB 2BKFA 4FJZA 4B0MA 1T5XD 3PVLA 4KVGB 1VJKA 1RFKA 3DVGX 1VDVA 3BINA 1UWXA 3Q8AA 4J3OD 3NHEB 1ESFA 1RLFA 1VZ8A 2RDHA 5T8IA 2J0MA 2WU2B 1YJ1A 1G6JA 2YVCA 1V5OA 1WIAA 4PT5A 2I1JA 1QZEA 3P4RB 1FNWA 4J6IA 3B1LX 1TYGB 2G3QB 3NVVA 2WXGA 3UQBA
chains in the Genus database with same CATH topology
3ZJTA 1TS2A 3MJ5A 2WLBA 2CJNA 1NYQA 2E3TA 1D5ZC 1XF5L 1DYQA 2GB1A 5G5HA 3LB8C 1FRDA 4ZOHC 1EM7A 4ARIA 2PMVA 2SEBD 1TKYA 1KF6B 3NRZA 2J42A 5EE1A 2XNAC 2JWUA 2WNMA 2NTTA 1ZDVA 3PZ8A 1YQ4B 2BB5A 1JWAD 5FR3A 3IT6B 1N61A 1AN8A 4OHJA 4A90A 1XLNA 4USAA 1QOFA 2RMMA 4IOIE 3ABVB 3VRAB 1R7SA 1OQRA 4ITKA 2ZW1A 5FK9C 3LXFA 1P7FA 2WDQB 2L1AA 3VRBB 3RPFC 4ZYSA 5MPOA 1DOXA 4HKZE 2AQ3B 4YSZB 4NAMA 3V3XA 1SE3A 1XCQL 4JPSA 1IGCA 1D5MC 1OFFA 4NAWB 2KQ4X 4WAFA 1E0ZA 2B76B 3BZDB 1NENB 1I4RA 3SR6A 2FBWB 3AE7B 4A6QA 4L1BA 2VZKB 2KDMA 1JWMD 4GDLB 3R2IA 1PDXA 3MFGA 1GB1A 1L6UA 1DOIA 1TS3A 3TEZA 4EE2A 2BS4B 3B2GA 1PGXA 4HRSA 2DLBA 1YJIA 3NZ3A 2ON8A 3GB1A 1Q10A 2Z8LA 2YEPB 1XXGA 2W82A 4OZCA 3P63A 4JE3B 1L5PA 1K52A 2LFIA 3BIID 1IBXA 2KN4A 2BT6A 4YTNB 3U7ZA 2BS2B 1C4PA 2DYOA 2JXTA 2WP9B 2BW2A 2WXMA 5LNK1 4HROA 1PGAA 1HA5A 1MHHE 2ZW0A 1JALA 2FE8A 2DBYA 3AEDB 3LYYA 1YN3A 2EKIA 1ACCA 1TKGA 5BYSA 1FD6A 1Y56A 1WWTA 3U4EG 1SIJA 2K22A 4AS1A 2PVGC 2PW9A 1B9RA 1J7CA 3AE5B 3NVYA 4WQMA 4C7ZA 3VQIA 1XEEA 3KWVA 2JU6X 2IGDA 3B9JA 2DWQA 3H8HA 2JSVX 3AE4B 3DWGC 2R61A 2JYEA 2D5GA 4RGOS 1QKZA 1C78A 1F0ZA 4YTPB 1GPXA 2VZKD 1KLGD 4ZHPA 4OW0A 2QSDA 1D6EC 4GDKB 1GOZA 1AWDA 1XLOA 2N9KA 1IBXB 1HQRD 2KAJA 3AE1B 2Y3AA 2OEDA 4KKIA 2BYTA 1N62A 1RYJA 4ZRPA 1PYWD 2PIAA 3RFZB 4IDIA 4A55A 1MHXA 3AE8B 4N58A 1DOYA 1ZXIA 2MEKA 3MHZA 5EE0A 1M4VA 3TEWA 1WRIA 1CK1A 1C4AA 3BVZA 4LLGM 3C8YA 4MACA 1VRAB 3BVGA 2BB6A 2LUMA 4H2AA 1LO5D 1FCCC 3SFEB 1FO4A 4OVZA 1FFVA 1PGBA 1N5XA 1FIQA 4XDDA 3T3OA 4XDCA 1MVKA 2QIEB 1STEA 1QT9A 1GAQB 1CZPA 4IKGA 4A9AA 2IJ0A 1L4ZB 3E56A 1YN4A 2W3RA 1I4PA 1V97A 2V3NA 5BMIA 2V4IB 1TKEA 4RH6A 1PFDA 3AMZA 4KGTA 3P1MA 1VZ7A 4P16A 4YSYB 3U2SC 1EU4A 1JW9D 3P42A 3I9V1 2IPKD 3P4SB 2LJIA 1FFUA 3BK1A 4LTUA 3KQ4A 2J4XA 5BMGA 1ZOYB 1XLQA 1E6EB 5I4DA 3AECB 3HVDA 1SF0A 5C3JB 2OHFA 1FRRA 4YXDB 1C76A 1ZE3D 2PVOD 3IXSA 3P4QB 4DXFA 2IDYA 3AV8A 4FXCA 1TJEA 4NJCA 2M56B 3PZ7A 3T3NA 1I4HA 3KWLA 1F2RI 3TEYA 1FMAD 1SE2A 1EWYC 1JWBD 1L0YB 1NVID 1V1PA 3EGRA 1D5XC 2WXKA 2RDGA 4TMAB 1T3QA 3AEFB 2WXQA 5D3IB 2X38A 4CQNA 4RGMA 2K5PA 1RWSA 5EE3A 2DYMA 1JMLA 1JRPA 4MT5A 1SBBB 3W5UB 3AN1A 2WDVB 1ZUD2 1AW7A 1QOAA 5BYRA 1C4CA 1QF6A 1IGDA 3ZQ4A 2YEPF 1EU3A 3ZYYX 1SJED 2SAKA 2ICIA 1WXQA 1ET9A 3Q8CA 2I38A 1K51A 3AE6B 1C9FA 1NYRA 1QLBB 1XO3A 3AH7A 2TSSA 4L2YA 4D2KA 2AQ1B 2QJLA 3CWIA 3Q69A 1ROEA 1ZP0B 4MM3B 1L0XB 1C79A 2PTLA 3AE3B 4RCOA 3AEBB 3AM9A 1VR9A 2W54A 3SFDB 4US9A 4MH8A 5TSSA 2V0GA 1SB3C 4XWWA 5HHDG 2WXHA 1GB4A 2RPVA 1N5WA 1UGJA 1V1OA 4DXGA 2WXRA 2BBCA 4RGTA 3PO0A 1V1PB 2WXFA 1V8CA 2LHDA 2INNE 5BMHA 2KWDA 1YJJA 4OZAA 3OWEB 3VR9B 2EELA 5D7GA 2M19A 4Q2JA 2WXIA 3TSSA 2QEJC 1UWMA 1XCTL 4RF0A 1AYFA 1L0VB 2JX5A 1QOGA 2M0AA 2NTSA 1TS5A 2CJOA 4GLSC 4ZRQA 3MC0B 3HUIA 3BK2A 1FCLA 5HG2A 3FC4A 5H92C 1I7HA 3P4PB 2KACA 1I4XA 3BWUD 1VLBA 3Q8FA 2IGHA 2ONQA 2WXOA 2FUG1 2BTEA 3KLSX 1OQQA 1WGKA 5FKAC 5H8YE 2AX5A 4B0EA 1SE4A 1TY2A 3FILA 3FAHA 3TUOA 3AEEB 4XWTA 4WIPA 5GXGB 3W1SA 1FXAA 1YN5A 3I57A 1D4BA 3AEGB 2G1EA 1YQ3B 3AE9B 4KKJA 2NMQA 2HDEA 1ZDXA 4L23A 3J9CA 4YWGG 3EA6A 1ZXHA 4UDUC 2PLPA 4RF1A 3VR8B 5HFYA 1QILA 1J7BA 5C2TB 1CJEA 1KRHA 3L4PA 1XLPA 2K9XA 3E9SA 1E7PB 2WS3B 3GS2A 3BVMA 4N6EB 2MJ3A 2WU5B 2WXNA 4C80A 3V05A 1F2RC 4C7YA 2CU3A 2W3SA 4US8A 5D3DA 3AEAB 5JXVA 1KH0A 2JZPA 3CIRB 1N60A 5G5GA 2GI9A 2N7JA 5EE9A 2LGIA 4KGSA 2K3UA 1DGJA 1A70A 1SEBD 2JYTA 2Y5PA 2I2YA 2BS3B 1JROA 2K0PA 2J53A 1NEKB 1ZPSA 2LHEA 3FILB 3Q8BA 1C77A 1JQ4A 2LEKA 3DWMA 1P7EA 3ETRA 3UI3A 1TS4A 1HZ6A 1UUPA 1K50A 1PUTA 4ARCA 2JQRB 3ZGZA 1N63A 1ENFA 4ZHOA 2PKOA 3R8BA 2N0SB 3HVZA 1E9MA 1KTKA 3URYA 3IAS1 2WXJA 1BXTA 4JWUC 4RFBA 4WURA 1HXYD 3NVWA 3O13A 4DQOC 2V3PA 1QOBA 4JX1C 1ET6A 1EWCA 1F77A 2WDRB 1UNSA 2HTME 5HI1A 3WCQA 1MI0A 4HEA1 1QQRA 4YT0B 4C56C 3IT4B 4WWMA 1SJHD 3BYTB 5AUIA 4AQ7A 1SSNA 4HKQA 4O1NA 3EUB2 3N9YC 3TEXA 3R2TA 4N59A 3AB5A 2J52A 5E6JA 2IGGA 2G9HD 1I4GA 1K53A 4OZBA 1MPEA 2GRIA 3Q8EA 1RM6C 3NS1A 2H89B 1L4DB 4HJGE 4TSSA 4KGRA 1B1ZA 4KX6B 3HRDD 4XE0A 3IAM1 1YNTE 5AUKA 1HEZE 1TZOA 1VZ6A 3GP7A 3W2DA 1KLUD 4JWSC 4RGNA 1WYGA 1WSPA 4REZA 4TQ0A 4P6VF 1CQVA 3MP9A 3B2FA 1J7AA 5BYQA 2WXLA 2XN9C 2E6XA 1FNVA 2ACZB 1HZ5A 2QMTA 3BYYB 2H88B 1FEHA 2W55A 1BMLC 1FM0D 1JCKB 1KFYB 2N9LA 3SEBA 4M0WA 1IUEA 4B0MA 2AQ2B 1NI3A 1T5XD 1VJKA 1RFKA 3NUHB 2QILA 1YMHE 3AE2B 4R3DA 2MJDA 1VDVA 1T6BX 2L52A 2Q5WD 1FNUA 4NZLB 1UWXA 4YTMB 3Q8AA 4J3OD 2WQYB 2KMMA 1ESFA 2MJEA 1VZ8A 2RDHA 4RNAA 5T8IA 1SXTA 4WH4A 2WU2B 1JWSD 1JWUD 2MH7A 2LMCA 4YSXB 2L83A 2Y5CA 1I4QA 2WXPA 3U52E 3ZJUA 4PT5A 2INPE 2L32A 3P4RB 1FNWA 4A8XC 1TY0A 4TQ1A 1L6VA 3ZJVA 1BUIC 1TYGB 3W9CB 3NVZA 1FXIA 3NVVA 3W5VB 1E10A 4LK0M 2WXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P7E A;  3UI3 A;  2N9K A;  1HZ6 A;  1C9F A;  4D2K A;  1IBX B;  1K50 A;  2OED A;  2PTL A;  1XF5 L;  2GB1 A;  1EM7 A;  1MHX A;  5HHD G;  1GB4 A;  2RPV A;  2JWU A;  2LHD A;  5BMH A;  2KWD A;  2RMM A;  4IOI E;  4MAC A;  5HI1 A;  4OZA A;  2LUM A;  2EEL A;  1MI0 A;  2ZW1 A;  1FCC C;  1P7F A;  1PGB A;  1XCT L;  4HKZ E;  1MVK A;  3V3X A;  1XCQ L;  4IKG A;  1IGC A;  4GLS C;  2J52 A;  2IGG A;  4OZB A;  1K53 A;  1MPE A;  2KQ4 X;  5BMI A;  1FCL A;  5HG2 A;  4HJG E;  4KGR A;  2KAC A;  4KGT A;  2KDM A;  1GB1 A;  1YNT E;  2IGH A;  1HEZ E;  2ONQ A;  1PGX A;  2ON8 A;  3FIL A;  3GB1 A;  1Q10 A;  1K51 A;  3MP9 A;  5BMG A;  2QMT A;  1HZ5 A;  4OZC A;  1K52 A;  1D4B A;  1IBX A;  2KN4 A;  2N9L A;  2JXT A;  2NMQ A;  1PGA A;  1MHH E;  2ZW0 A;  1ZXH A;  2PLP A;  1YMH E;  5HFY A;  1FD6 A;  1F2R I;  1UWX A;  2PW9 A;  1F2R C;  4WH4 A;  5JXV A;  1KH0 A;  2JZP A;  2JU6 X;  2IGD A;  2GI9 A;  1JML A;  2JSV X;  2N7J A;  2LGI A;  4KGS A;  2I2Y A;  1QKZ A;  2K0P A;  2J53 A;  3FIL B;  2LHE A;  1IGD A;  2QSD A;  2I38 A; 
#chains in the Genus database with same CATH topology
 3ZJT A;  2IYD B;  2D10 A;  2MBB B;  4IWP A;  2IO2 B;  2GBK A;  1E8W A;  3LDZ E;  2PMV A;  2SEB D;  1IPG A;  4ZRJ A;  3ZRC A;  2O2V B;  4E3C A;  2NTT A;  3X23 A;  5FR3 A;  1YQ4 B;  4MGY E;  3PRP B;  4OHJ A;  4G0N B;  4USA A;  2RMM A;  2BF8 B;  2ZW1 A;  4ITK A;  3VRB B;  2WDQ B;  5MPO A;  2HJ1 A;  2N9P C;  1Z2M A;  4YSZ B;  1SE3 A;  3NJT A;  1V5T A;  1X1M A;  5AZH A;  4NAW B;  2KQ4 X;  1I35 A;  2AWT A;  2VZK B;  3HK0 A;  2N1V A;  1L6U A;  3TEZ A;  1PGX A;  3QAQ A;  4MSQ B;  3RN9 C;  2L76 A;  2OOB B;  3P63 A;  3QA8 A;  2QHO A;  1K52 A;  3SD5 A;  3DBH I;  3GZN B;  1IBX A;  1YQB A;  4WWO A;  4PK1 A;  3U7Z A;  2DYO A;  3UIN B;  2WP9 B;  2NBW B;  1HTQ A;  3N1X C;  4KIK A;  4ZRI A;  3U8Z A;  3RYT A;  1TKG A;  4JL9 A;  3DCG A;  5BYS A;  1FD6 A;  2AL3 A;  3BY4 B;  4EOY A;  2K22 A;  4DHJ B;  4AS1 A;  1UZX B;  1B9R A;  2KN5 A;  3M3J A;  3KYC D;  2N1W A;  2FCM A;  1XEE A;  2IGD A;  5IP4 D;  3DWG C;  2RPQ A;  2D5G A;  5JHA A;  1Q5W B;  1F0Z A;  3IBE A;  1GPX A;  2IO3 B;  3PRZ A;  2MCN B;  3ZUN A;  2QSD A;  2DEN B;  4GDK B;  1AWD A;  1XLO A;  2N9K A;  3RNE C;  1T0S C;  2HTH A;  3HHM A;  3K9O B;  3N1Z C;  5LXH A;  2N7E A;  1UBI A;  2O6V D;  5EE0 A;  3TEW A;  4LLG M;  2LUM A;  3V60 A;  3DBR B;  3T3O A;  1FFV A;  2BQQ A;  5DPW A;  1GAQ B;  3N32 A;  4IKG A;  4A9A A;  3APD A;  1WM2 A;  2R2O A;  1YN4 A;  2DAJ A;  5L83 A;  4RH6 A;  5CHF A;  1PFD A;  2KO3 A;  4DDG D;  2MBH A;  3U2S C;  1VZ7 A;  4P16 A;  1RAX A;  4FHK A;  1JW9 D;  2Y5B B;  3ZDM C;  2PE6 B;  2LJI A;  4GXB A;  3BK1 A;  1WZ3 A;  3HIZ A;  2MSE D;  4LTU A;  2DNF A;  3IFW B;  2J4X A;  1ZOY B;  4MSM B;  2KJR A;  1XLQ A;  3CMM B;  2DX5 B;  5I4D A;  3OLM D;  1SF0 A;  4S0R A;  1FRR A;  3AUL A;  3Q3M C;  4DXF A;  3RMK C;  2KYW A;  4NJC A;  3MC8 A;  1UH6 A;  1KJT A;  1IYF A;  1I4H A;  1F2R I;  4NNJ B;  1L0Y B;  4FN2 A;  4AJY B;  2RDG A;  4TMA B;  4ANW A;  2WXQ A;  5D3I B;  3ZTD A;  1HE8 A;  5IKC M;  4RGM A;  4JQW C;  3RUL A;  3UIP B;  5EE3 A;  2N9X A;  3N3K B;  1JRP A;  4MT5 A;  3TCA A;  1SBB B;  5BYR A;  1AW7 A;  2K8H A;  1C4C A;  2WYQ A;  3RI7 C;  4C00 A;  5D94 A;  1EU3 A;  4WJP A;  2MRP A;  1K51 A;  3RCZ A;  3ML8 A;  2NCN A;  4NJ6 A;  1XO3 A;  1TBE A;  2K8B A;  4PYZ A;  4FUL A;  4US9 A;  2NVU I;  2BBC A;  3ZXV A;  1V1P B;  2QC8 A;  2WXF A;  1V8C A;  3A9K B;  3H7S A;  5HKH A;  2KWD A;  3WAM A;  4EZJ A;  3M95 A;  2MWS B;  3ZW3 A;  1QOG A;  3DPD A;  5AEK B;  3MC0 B;  3HUI A;  2KKC A;  4EFO A;  1FCL A;  3FC4 A;  1I4X A;  1VLB A;  1V2Y A;  4FJY A;  1J8C A;  3SU8 X;  2ASQ A;  5H8Y E;  4MH0 E;  4B0E A;  3OAW A;  2DYB A;  4I6N B;  3RZW C;  3GE8 C;  4MJS A;  3VHT C;  4BFR A;  3AEE B;  5GXG B;  1YN5 A;  3AEG B;  1YQ3 B;  1H8C A;  4W9F A;  3AE9 B;  4KKJ A;  3EFU A;  3JYU A;  4DBG A;  2Z0E B;  3VR8 B;  4ZRK A;  3E9S A;  2K9X A;  2WS3 B;  2K6D B;  2MJ3 A;  2WU5 B;  1TGZ B;  2CU3 A;  4US8 A;  1KH0 A;  1RRB A;  3IHP C;  5G5G A;  2GI9 A;  2N7J A;  3A4S C;  3W1S C;  1A70 A;  2LRU A;  3AXC A;  2K6Q A;  3VFK A;  2UU7 A;  3L54 A;  4N9F 4;  4LDT B;  2LD9 A;  1HZ6 A;  2BVC A;  4FAD A;  1PUT A;  4ARC A;  3ZGZ A;  4ZHO A;  3DDC B;  4GB9 A;  3HVZ A;  3IAS 1;  1WJ4 A;  4I6P A;  3VH3 B;  1BXT A;  1HXY D;  3O13 A;  4DQO C;  2V3P A;  1ET6 A;  2L3Z A;  2IBI B;  3PRE A;  1UNS A;  1GG3 A;  4ANX A;  3W1Y A;  1ZKH A;  5HI1 A;  3AU5 A;  1MI0 A;  2ZCB A;  4RM9 A;  2PE9 A;  3WCQ A;  4BOS C;  4DHZ E;  4C56 C;  3IT4 B;  1E90 A;  4O1N A;  1EF5 A;  3TEX A;  1BT0 A;  2LUE A;  3TMP B;  1WXA A;  2J52 A;  1I4G A;  4DK5 A;  4GIV A;  4B9K A;  1SGH A;  1RM6 C;  2CU1 A;  2K1F A;  1L4D B;  4HJG E;  4TSS A;  4KX6 B;  4NQK E;  1VZ6 A;  2G4D B;  2GBJ A;  4P6V F;  1WXV A;  5BYQ A;  4URK A;  2E6X A;  1MG8 A;  1YD8 U;  1KFY B;  3C0R B;  4FBJ B;  3QQ8 B;  1GNU A;  1R4N I;  2KTR B;  1T6B X;  4MEM A;  2L52 A;  1FNU A;  2O2V A;  1S1Q B;  1WXS A;  2WQY B;  3DBS A;  4BZA A;  1LM8 B;  3B08 A;  4RNA A;  4F7Z A;  4WH4 A;  3DVG Y;  4M02 A;  1JWU D;  2HJ8 A;  5J2R A;  2L83 A;  2Y5C A;  4M00 A;  2KFJ A;  2WXP A;  3ZJU A;  3U52 E;  2INP E;  5C1Z A;  5DCN A;  1RFA A;  4TQ1 A;  4HLE A;  4NAW A;  1FXI A;  3W5V B;  4LK0 M;  1WR1 A;  3ZIM A;  4BOZ B;  3MTN B;  2GMI C;  3PS6 A;  1V49 A;  1NYQ A;  4C4V B;  4ZOH C;  1FRD A;  4BKG A;  1EM7 A;  4KDL B;  3D32 A;  2XNA C;  2JWU A;  1I42 A;  1AN8 A;  4A90 A;  1XLN A;  2C60 A;  3VRA B;  1OQR A;  2MBO A;  3LXF A;  1XCQ L;  4JPS A;  1IGC A;  1OFF A;  2B76 B;  3BZD B;  3Q3J A;  3AE7 B;  4A6Q A;  2KDM A;  1JWM D;  4LNO A;  1PDX A;  1YX6 B;  3MFG A;  4EE2 A;  1Q0W B;  1PQS A;  4HRS A;  2DLB A;  4F8C B;  3GB1 A;  2Z8L A;  1XXG A;  2W82 A;  3EEC A;  4GDK A;  1L5P A;  3BII D;  3OG5 A;  2L0F A;  3Q3F A;  2BT6 A;  3VTU A;  1C4P A;  2JXT A;  2BW2 A;  1HA5 A;  3GZN I;  2DBY A;  3AED B;  3LYY A;  4AUQ C;  1YN3 A;  1ACC A;  1SIJ A;  2PVG C;  2PW9 A;  1J7C A;  1GC7 A;  1R4M B;  3NVY A;  3MJW A;  4TV3 A;  1MFW A;  3B9J A;  3H8H A;  3R66 C;  3ZRF A;  1WE6 A;  3AE4 B;  1WFY A;  2K8C A;  4ACF A;  2R61 A;  4RGO S;  2QCZ A;  2ZJD A;  4FHJ A;  1F9J A;  2NPT B;  4OW0 A;  1L7Y A;  1TTN A;  3QHT A;  2CS4 A;  3KH0 A;  4W9J A;  2OED A;  3R7R A;  2BYT A;  2KLC A;  1PYW D;  2PIA A;  4IDI A;  2M8S A;  3DHG C;  3ZDT A;  3AE8 B;  1DOY A;  2NBV B;  1WRI A;  1CK1 A;  1C4A A;  3BVZ A;  3C8Y A;  1VRA B;  3BVG A;  2V1Y A;  4H2A A;  1LO5 D;  1FO4 A;  1TT5 B;  4GGQ A;  4XDD A;  3ZXR A;  4XDC A;  3VDZ A;  1MVK A;  2QIE B;  2IJ0 A;  3DBR I;  3E56 A;  2W3R A;  1I4P A;  1V97 A;  2V3N A;  3CSF A;  2V4I B;  1TKE A;  2MW5 A;  3AMZ A;  2UYZ B;  4KGT A;  4YSY B;  5KHQ A;  1EU4 A;  3P42 A;  4IWQ A;  3I9V 1;  3PLU A;  3R3M A;  1J19 A;  4G50 A;  2KVZ A;  3H9D A;  2GBR A;  4IWO A;  3HVD A;  4P7I A;  2BYF A;  2MBQ A;  2L00 B;  4G3X B;  1C76 A;  2CR5 A;  3IXS A;  4YL8 A;  1EF1 A;  1TJE A;  2M56 B;  2MBE A;  5AZG A;  3RNA C;  3WIM A;  3N1Y C;  1EWY C;  1GJZ A;  1V1P A;  3A9K A;  1T3Q A;  3L0W B;  2X38 A;  2OJW A;  4CQN A;  5JH5 C;  2DYM A;  1JML A;  3JSV B;  3AN1 A;  2IZV B;  2A5U A;  1WY8 A;  2GLS A;  3L16 A;  3PT2 B;  4X57 B;  1IGD A;  3ZQ4 A;  3ZYY X;  2SAK A;  1UBQ A;  2ICI A;  2LVO A;  3RNF C;  2I38 A;  4K3B A;  3AE6 B;  1QLB B;  4ANV A;  1YX5 B;  4L2Y A;  2BWE S;  4G11 A;  3VTW A;  2AQ1 B;  4BAX A;  1L0X B;  2PTL A;  2D3B A;  2C7M B;  1V81 A;  5TSS A;  3V62 A;  2WXH A;  2RPV A;  1N5W A;  4ICU A;  2WXR A;  3PO0 A;  3VUX A;  2OJR A;  2LHD A;  2A4Z A;  1YJJ A;  3OWE B;  3JW0 X;  3TSS A;  1AYF A;  3NG0 A;  5J17 A;  2MQJ A;  2CJO A;  4GLS C;  1M94 A;  1T0Y A;  2L8J A;  3P4P B;  2KAC A;  2LJ5 A;  5IAA C;  2KDE B;  3Q8F A;  2FCN A;  2IGH A;  2JPH A;  5FR6 A;  2WXO A;  2FUG 1;  3CST A;  3KUZ A;  4ZYN A;  3KLS X;  3ECI A;  2AX5 A;  1LQB A;  2MLB A;  4LNN A;  2ZNV C;  4II3 B;  2YLM A;  2G1E A;  4QAY A;  1C3T A;  2HDE A;  4L23 A;  2BYE A;  4YWG G;  3MC9 A;  1ZXH A;  5C23 A;  1QIL A;  5DPT A;  1CJE A;  1KRH A;  1XLP A;  2LI5 A;  3QK0 A;  3TBL D;  4N6E B;  2WXN A;  3L17 A;  5IN7 A;  5DPS A;  3VUY A;  3V05 A;  4FJV B;  1FXT B;  3AEA B;  5JXV A;  3DOW A;  4M01 A;  4IC7 B;  4FA6 A;  2LGI A;  4KGS A;  2K3U A;  2KQS A;  2Y5P A;  2I2Y A;  2KMC A;  3ENE A;  2J53 A;  3FIL B;  2LHE A;  3Q8B A;  3ZNH B;  2AL6 A;  3DWM A;  1NBF C;  1T0Q C;  1P7E A;  1UF0 A;  2D3C A;  2LWP A;  2JQR B;  3PZD A;  4GMV A;  2AYO B;  2PKO A;  4IG7 B;  1A5R A;  3URY A;  2WXJ A;  4JWU C;  5D6J B;  3DBL B;  2WWZ A;  4XYC A;  2PPH A;  1F77 A;  1WE7 A;  2WDR B;  4P1B C;  4HEA 1;  2KTR A;  4WWM A;  3QX1 A;  5AUI A;  4K7U A;  2C9W B;  3N9Y C;  3PPA A;  1WGR A;  4N59 A;  2KJ6 A;  2KFK B;  4JGH B;  1MPE A;  4IW0 A;  3NS1 A;  4PYU A;  2H89 B;  1NI2 A;  3U7D A;  4KGR A;  1B1Z A;  2KWC A;  2XK5 B;  3IAM 1;  1HEZ E;  2M4N A;  3GP7 A;  3W2D A;  1WYG A;  1WSP A;  3KYD D;  4TQ0 A;  1CQV A;  4HDQ A;  3UIO B;  2C5L C;  1V9J A;  1HZ5 A;  3BYY B;  2H88 B;  1FEH A;  1ZW7 A;  1LXD A;  2W55 A;  5J18 A;  2N9L A;  3SEB A;  2AQ2 B;  1NI3 A;  4HCN B;  4HPL B;  4MGI E;  4A20 A;  4C4V A;  3NUH B;  2LXA A;  3WAO A;  1YMH E;  3AE2 B;  2MJD A;  2L7R A;  1N6Z A;  2Q5W D;  4YTM B;  4HK2 A;  4LNI A;  3A1Q B;  3PGE A;  2MH7 A;  2LMC A;  4YSX B;  1I4Q A;  3ZNZ B;  1EUV B;  4A8X C;  3ZNI D;  2V9H A;  1BUI C;  3W9C B;  3NVZ A;  1U4A A;  2V3S A;  2KOX A;  2IO0 B;  4DHJ D;  3MJ5 A;  4M0W B;  2CJN A;  3RD2 A;  4HWI B;  1D5Z C;  1XF5 L;  1DYQ A;  2GB1 A;  2WHI A;  3LB8 C;  5G5H A;  4ARI A;  1FPY A;  1WX8 A;  2D3A A;  1TKY A;  1KF6 B;  3NRZ A;  2J42 A;  2FCQ A;  1ZDV A;  1F52 A;  4W9H A;  1WZ0 A;  4IOI E;  3ABV B;  1R7S A;  5FK9 C;  2L05 A;  3ZO5 B;  2L1A A;  4BKT A;  4ZYS A;  2LGS A;  4NAM A;  1C1Y B;  3GOE A;  1WJ6 A;  4KDI C;  4WAF A;  1E0Z A;  3SR6 A;  3M62 B;  4GDL B;  3R2I A;  1E8Y A;  3Q6B A;  1GB1 A;  2DZJ A;  1DOI A;  1P3Q U;  1TS3 A;  2JF5 A;  1WGY A;  3NZ3 A;  2ON8 A;  4MGZ E;  2YEP B;  1WGH A;  1WF9 A;  2RR9 A;  2NPT A;  3DHI C;  4OZC A;  2KXJ A;  1UD7 A;  4LCD E;  2KN4 A;  3NS8 A;  4YTN B;  1H4R A;  1CMX B;  3K9P B;  2WXM A;  5LNK 1;  2X8X X;  2KLG A;  2ZW0 A;  5G2N A;  2KTF A;  4WAA A;  2FE8 A;  4W9C A;  4A3P A;  4EZK A;  1GC6 A;  4WQO B;  1Y56 A;  1WWT A;  2J0J A;  2DAF A;  4HCP B;  1KM7 A;  3AE5 B;  4WQM A;  4C7Z A;  4LJP B;  3KWV A;  2JU6 X;  2FID A;  1XD3 B;  2LGD A;  4P1C C;  4XC2 A;  1R4M I;  1V6E A;  1S3S G;  2Z0D B;  1QKZ A;  4YTP B;  3H6N A;  3N30 A;  4NQL B;  4GN1 A;  1KLG D;  2MHJ A;  1GOZ A;  3PHW B;  2KX3 A;  2KAJ A;  2J7Q B;  4DDI D;  4KKI A;  4JIO U;  3EC8 A;  1RYJ A;  4ZRP A;  1GUA B;  1WYW B;  2FIF A;  2LRW A;  4KSK C;  2C7N B;  4A55 A;  1MHX A;  4EKU A;  4N58 A;  3V6E B;  5GMV A;  3MHZ A;  2LXC A;  5AZF A;  2XBB C;  3UQA A;  4MAC A;  3V61 A;  4W9E A;  2WGS A;  3SFE B;  3A9J B;  1N5X A;  1TZ1 A;  1E7U A;  1STE A;  1L4Z B;  2QDF A;  5CHV C;  5BMI A;  1V80 A;  4HXD A;  4CO7 A;  3P1M A;  3EFC A;  3JSV A;  2M17 A;  3Q14 C;  1P9D U;  3VUW A;  5CX3 A;  1FFU A;  4TKN A;  4MGK E;  2L0T A;  3KQ4 A;  3PRM B;  1E6E B;  5C3J B;  3H1U A;  1E7V A;  2ZPY A;  2M1M A;  1ZE3 D;  4CHK A;  5E6P A;  3VAW A;  3QCA A;  1WM3 A;  2IDY A;  3AV8 A;  2KMA A;  3PZ7 A;  2KWV B;  4KSL C;  3KWL A;  3TEY A;  1FMA D;  1SE2 A;  4A3O A;  1JWB D;  3H7P B;  4DWF A;  1NVI D;  3QJZ A;  4K81 A;  2Z59 B;  3EGR A;  4E71 A;  1D5X C;  2WXK A;  2BGF A;  1YOV B;  3AEF B;  2ZVO A;  3I3T B;  4IM2 A;  2O6V B;  3HM3 A;  3W5U B;  2WDV B;  2FCS A;  2LGY A;  1QF6 A;  1L2N A;  2D11 A;  2JT4 B;  1C9F A;  3AH7 A;  1WI0 A;  3KUC B;  2AEH A;  2WX1 A;  3Q69 A;  1ROE A;  1ZP0 B;  4MM3 B;  3AE3 B;  4RCO A;  3R7Q A;  2I1K A;  3SFD B;  2ZVN A;  2CHZ A;  5JZE B;  3ZLZ A;  2V0G A;  4MEL A;  1GB4 A;  4DXG A;  4RGT A;  2IND C;  1OGW A;  2INN E;  5BMH A;  1YIW A;  2DZK A;  2EEL A;  5D7G A;  3UGB B;  2M19 A;  2KDB A;  4Q2J A;  4LDT D;  2B3A A;  4DXA B;  3WAP A;  2M0A A;  4CYE A;  2EKE C;  2LZ6 A;  2KJH B;  3BK2 A;  5HG2 A;  4F1S A;  4GOC A;  4FLH A;  2JWZ A;  3NZU A;  4KV2 A;  3BWU D;  2ONQ A;  2D2Q A;  1OQQ A;  2KC1 A;  1TY2 A;  2KD0 A;  1WX7 A;  3FIL A;  3FAH A;  3TUO A;  4AOF A;  2FNJ B;  2LAS A;  4XWT A;  5LXI B;  4LJO B;  3TJP A;  1FXA A;  2D3G A;  1D4B A;  4ZDV A;  3ZKJ C;  2PJH A;  3I5J C;  2PEA A;  3EA6 A;  2UWQ A;  2PLP A;  5HFY A;  5C2T B;  4HPM B;  2KT7 A;  3L4P A;  1E7P B;  3BVM A;  4C80 A;  4IUM B;  1F2R C;  4LNK A;  5D3D A;  1N60 A;  2BKR B;  3OJ3 A;  2FAZ A;  3B0A A;  1DGJ A;  2KFK A;  2JYT A;  3VVW B;  1JRO A;  4M8N A;  5IO9 A;  1C77 A;  1JQ4 A;  1E8X A;  2XK5 A;  3S2A A;  2KZR A;  3UI3 A;  5DPR A;  1UUP A;  1K50 A;  1N63 A;  1ENF A;  2ZZP B;  1VD2 A;  4WJO A;  2GBN A;  4HDO A;  3ZNG C;  2KHW B;  4RFB A;  3NVW A;  2BWF A;  4JX1 C;  1QOB A;  3RNB C;  5L95 C;  1WH3 A;  2N7D A;  3GE3 C;  4W9L A;  2HTM E;  3DBL I;  2RSU A;  4YT0 B;  1HTO A;  2MP2 B;  1SJH D;  1SSN A;  3EUB 2;  3L13 A;  3L08 A;  3R2T A;  2WDT B;  3AB5 A;  4EUT A;  4K7S A;  3Q3N C;  1WGG A;  1Y8R C;  4AP4 C;  2G9H D;  1K53 A;  2JZ3 B;  2GRI A;  3A1Q A;  5JHB A;  3Q8E A;  1UEL A;  2K39 A;  3HRD D;  4BKS A;  3ZVV A;  3VXW A;  1YNT E;  5AUK A;  4NPN A;  1TZO A;  4HJK A;  1K8R B;  4JWS C;  2DZI A;  4REZ A;  2IY1 B;  2FUH B;  2DHZ A;  3PSE B;  1P0R A;  2WXL A;  4IM3 A;  4WWP A;  1FNV A;  1V86 A;  1WRD B;  2JZZ A;  4IM0 A;  3JVZ X;  5CTR C;  3NY5 A;  1BML C;  4WWN A;  4M0W A;  1IUE A;  4M8M A;  2IO1 B;  2D07 B;  2QIL A;  3PTF C;  3LJ3 A;  4R3D A;  3APC A;  1WMH B;  4NZL B;  4HPP A;  5LLI A;  4EZL A;  2KMM A;  2G45 B;  2MJE A;  1XQQ A;  1SXT A;  3DVN V;  1JWS D;  3WAN A;  4KZ0 A;  4BVU C;  2KC2 A;  2L32 A;  3PV1 A;  1TY0 A;  1L6V A;  2NBU A;  3ZJV A;  2W9N A;  3HM6 X;  4LNF A;  1E10 A;  3V6C B;  2JVC A;  4GDL A;  2KWU B;  2JRI B;  1TS2 A;  2WLB A;  2E3T A;  3PHX B;  2CHX A;  2HD5 B;  4MDK E;  3CF6 E;  5EE1 A;  3WA0 A;  3SHQ A;  4WJQ A;  2WNM A;  3ALB A;  4AJW A;  3RUI B;  3PZ8 A;  2BB5 A;  1JWA D;  3IT6 B;  1N61 A;  4I6L B;  1QOF A;  2G4S A;  3TIX A;  3TL5 A;  2KX0 A;  1P7F A;  2JY6 A;  3RPF C;  1DOX A;  4HKZ E;  2AQ3 B;  3VH4 B;  3V3X A;  4RM8 A;  3ZTC A;  1KOT A;  1J0G A;  1D5M C;  3QWZ B;  1NEN B;  1I4R A;  2FBW B;  4L1B A;  4RMA A;  1IP9 A;  1WXM A;  3DQV A;  2BS4 B;  2KQ7 A;  1F1H A;  3B2G A;  3DVN U;  1YJI A;  3DBH B;  3O65 B;  1Q10 A;  4NJ7 A;  4JE3 B;  2INC C;  2LGX A;  2LFI A;  4BBN F;  1SE9 A;  1ISN A;  4S17 A;  1T0R C;  2BS2 B;  4HRO A;  1PGA A;  1MHH E;  1JAL A;  3RZF A;  4PS8 A;  1Q1O A;  2EKI A;  2KAN A;  3P2B A;  1OEY A;  4WJN A;  5E6O A;  3DHH C;  4ASW C;  3U4E G;  2VRR B;  3SDL C;  3UF8 A;  3QAR A;  3NOB A;  4W9G A;  4ICV A;  3VQI A;  3A9J A;  4K1R B;  1OQY A;  4KZC A;  2DWQ A;  2JSV X;  4AWJ A;  2JYE A;  1C78 A;  4PS7 A;  2VZK D;  1D3Z A;  4ZHP A;  1D6E C;  1XT9 B;  1IBX B;  1Z5S B;  1HQR D;  5KHO A;  3AE1 B;  2Y3A A;  2NR2 A;  1N62 A;  4KIK B;  3A4R A;  3RFZ B;  4OVU A;  1SIF A;  1OTR B;  2RD0 A;  1ZXI A;  2MEK A;  1M4V A;  2GOW A;  4GSW A;  2JUO A;  2BB6 A;  2VH2 A;  1FCC C;  4OVZ A;  4PS3 A;  1PGB A;  3I63 C;  1FIQ A;  1QT9 A;  3H7P A;  2DZM A;  1CZP A;  3Q3O C;  1TIF A;  3KVF B;  2KDF B;  4W9I A;  1E5W A;  2O6V A;  2IPK D;  3RNC C;  3P4S B;  3X0W A;  3RNG C;  2WX0 A;  1NDD A;  5BMG A;  5BO4 B;  4E74 A;  3AEC B;  4XZ4 A;  2RGF A;  2OHF A;  2R2Q A;  4GU2 A;  4YXD B;  2PVO D;  4MM3 A;  1E8Z A;  3P4Q B;  1LFD A;  4FXC A;  4W9K A;  3T3N A;  3OJ4 B;  2BYV E;  5CHW A;  1MG4 A;  2VH1 A;  1MJD A;  3A33 B;  2K5P A;  1OEY J;  1RWS A;  2MA9 B;  2CHW A;  3ONS A;  2N9E B;  4B95 A;  1ZGU B;  1ZUD 2;  1QOA A;  2JRH A;  3EHV A;  2JXX A;  2YEP F;  1SJE D;  1WXQ A;  1ET9 A;  3Q8C A;  2ZCC A;  5IOI A;  3T9L A;  1NYR A;  4D2K A;  1WX9 A;  2TSS A;  2QJL A;  3CWI A;  1C79 A;  3AEB B;  3AM9 A;  1VR9 A;  2W54 A;  3KW5 B;  1EO6 A;  4MH8 A;  1VCB A;  2EMS A;  1SB3 C;  4XWW A;  5HHD G;  4OVV A;  1P1A A;  1UGJ A;  1V1O A;  5EDS A;  5D2M B;  4OZA A;  5E6N A;  3VR9 B;  5IA7 A;  2WXI A;  2M0X A;  2QEJ C;  1UWM A;  1XCT L;  4RF0 A;  2KDI A;  1L0V B;  2JX5 A;  2NTS A;  3N20 C;  1TS5 A;  3U30 A;  4ZRQ A;  2XEW A;  3IG3 A;  2K25 A;  5H92 C;  4K3C A;  1I7H A;  1WJU A;  2ZEQ A;  2BTE A;  1WGK A;  5FKA C;  1AAR A;  1LGR A;  4XGA B;  1SE4 A;  3AU4 A;  3APF A;  1JRU A;  4WIP A;  3MHS D;  3W1S A;  3ML9 A;  3Q2A C;  3T8M A;  3I57 A;  2NS5 A;  4XX5 A;  2ZPN A;  1WGD A;  2HE7 A;  2ZNV B;  2NMQ A;  2KK8 A;  1UGM A;  1ZDX A;  5TR5 A;  3J9C A;  3C19 A;  4UDU C;  4RF1 A;  2RDB C;  1J7B A;  4II2 B;  3GS2 A;  2CKH B;  3QIJ A;  4C7Y A;  3KUD B;  2GBM A;  2W3S A;  3RT3 B;  2KVR A;  2JZP A;  3CIR B;  2MP2 A;  5EE9 A;  1SEB D;  2LVP A;  2BS3 B;  5G55 A;  2K0P A;  4DHZ B;  2IY0 B;  1NEK B;  1ZPS A;  4HVB A;  4TUU A;  4MJS B;  2LEK A;  3ETR A;  1TS4 A;  4JLC A;  4BBN C;  1WJN A;  1KLV A;  4W9D A;  2KNB A;  4EEW A;  3R8B A;  4NY0 A;  2N0S B;  3IVF A;  1E9M A;  1KTK A;  2REX A;  4BKS D;  2BPS A;  3PLV A;  3FKY A;  4WUR A;  2MX2 A;  4B6W A;  3QC8 B;  2V4L A;  1EWC A;  3NZS A;  3L10 B;  2C7H A;  1QQR A;  1WMH A;  3BYT B;  4AQ7 A;  4HKQ A;  3WAL A;  5E6J A;  2IGG A;  4OZB A;  2J0K A;  3AI5 A;  2N4F A;  4ANU A;  4XE0 A;  1P98 A;  4K7W A;  1KLU D;  4RGN A;  3VTV A;  2LVQ A;  3M63 B;  2EMT A;  3MP9 A;  3B2F A;  1J7A A;  2XN9 C;  2ACZ B;  2QMT A;  1FM0 D;  1JCK B;  1WR6 E;  1R4N B;  2BKF A;  4FJZ A;  4B0M A;  1T5X D;  3PVL A;  4KVG B;  1VJK A;  1RFK A;  3DVG X;  1VDV A;  3BIN A;  1UWX A;  3Q8A A;  4J3O D;  3NHE B;  1ESF A;  1RLF A;  1VZ8 A;  2RDH A;  5T8I A;  2J0M A;  2WU2 B;  1YJ1 A;  1G6J A;  2YVC A;  1V5O A;  1WIA A;  4PT5 A;  2I1J A;  1QZE A;  3P4R B;  1FNW A;  4J6I A;  3B1L X;  1TYG B;  2G3Q B;  3NVV A;  2WXG A;  3UQB A; 
#chains in the Genus database with same CATH homology
 3ZJT A;  1TS2 A;  3MJ5 A;  2WLB A;  2CJN A;  1NYQ A;  2E3T A;  1D5Z C;  1XF5 L;  1DYQ A;  2GB1 A;  5G5H A;  3LB8 C;  1FRD A;  4ZOH C;  1EM7 A;  4ARI A;  2PMV A;  2SEB D;  1TKY A;  1KF6 B;  3NRZ A;  2J42 A;  5EE1 A;  2XNA C;  2JWU A;  2WNM A;  2NTT A;  1ZDV A;  3PZ8 A;  1YQ4 B;  2BB5 A;  1JWA D;  5FR3 A;  3IT6 B;  1N61 A;  1AN8 A;  4OHJ A;  4A90 A;  1XLN A;  4USA A;  1QOF A;  2RMM A;  4IOI E;  3ABV B;  3VRA B;  1R7S A;  1OQR A;  4ITK A;  2ZW1 A;  5FK9 C;  3LXF A;  1P7F A;  2WDQ B;  2L1A A;  3VRB B;  3RPF C;  4ZYS A;  5MPO A;  1DOX A;  4HKZ E;  2AQ3 B;  4YSZ B;  4NAM A;  3V3X A;  1SE3 A;  1XCQ L;  4JPS A;  1IGC A;  1D5M C;  1OFF A;  4NAW B;  2KQ4 X;  4WAF A;  1E0Z A;  2B76 B;  3BZD B;  1NEN B;  1I4R A;  3SR6 A;  2FBW B;  3AE7 B;  4A6Q A;  4L1B A;  2VZK B;  2KDM A;  1JWM D;  4GDL B;  3R2I A;  1PDX A;  3MFG A;  1GB1 A;  1L6U A;  1DOI A;  1TS3 A;  3TEZ A;  4EE2 A;  2BS4 B;  3B2G A;  1PGX A;  4HRS A;  2DLB A;  1YJI A;  3NZ3 A;  2ON8 A;  3GB1 A;  1Q10 A;  2Z8L A;  2YEP B;  1XXG A;  2W82 A;  4OZC A;  3P63 A;  4JE3 B;  1L5P A;  1K52 A;  2LFI A;  3BII D;  1IBX A;  2KN4 A;  2BT6 A;  4YTN B;  3U7Z A;  2BS2 B;  1C4P A;  2DYO A;  2JXT A;  2WP9 B;  2BW2 A;  2WXM A;  5LNK 1;  4HRO A;  1PGA A;  1HA5 A;  1MHH E;  2ZW0 A;  1JAL A;  2FE8 A;  2DBY A;  3AED B;  3LYY A;  1YN3 A;  2EKI A;  1ACC A;  1TKG A;  5BYS A;  1FD6 A;  1Y56 A;  1WWT A;  3U4E G;  1SIJ A;  2K22 A;  4AS1 A;  2PVG C;  2PW9 A;  1B9R A;  1J7C A;  3AE5 B;  3NVY A;  4WQM A;  4C7Z A;  3VQI A;  1XEE A;  3KWV A;  2JU6 X;  2IGD A;  3B9J A;  2DWQ A;  3H8H A;  2JSV X;  3AE4 B;  3DWG C;  2R61 A;  2JYE A;  2D5G A;  4RGO S;  1QKZ A;  1C78 A;  1F0Z A;  4YTP B;  1GPX A;  2VZK D;  1KLG D;  4ZHP A;  4OW0 A;  2QSD A;  1D6E C;  4GDK B;  1GOZ A;  1AWD A;  1XLO A;  2N9K A;  1IBX B;  1HQR D;  2KAJ A;  3AE1 B;  2Y3A A;  2OED A;  4KKI A;  2BYT A;  1N62 A;  1RYJ A;  4ZRP A;  1PYW D;  2PIA A;  3RFZ B;  4IDI A;  4A55 A;  1MHX A;  3AE8 B;  4N58 A;  1DOY A;  1ZXI A;  2MEK A;  3MHZ A;  5EE0 A;  1M4V A;  3TEW A;  1WRI A;  1CK1 A;  1C4A A;  3BVZ A;  4LLG M;  3C8Y A;  4MAC A;  1VRA B;  3BVG A;  2BB6 A;  2LUM A;  4H2A A;  1LO5 D;  1FCC C;  3SFE B;  1FO4 A;  4OVZ A;  1FFV A;  1PGB A;  1N5X A;  1FIQ A;  4XDD A;  3T3O A;  4XDC A;  1MVK A;  2QIE B;  1STE A;  1QT9 A;  1GAQ B;  1CZP A;  4IKG A;  4A9A A;  2IJ0 A;  1L4Z B;  3E56 A;  1YN4 A;  2W3R A;  1I4P A;  1V97 A;  2V3N A;  5BMI A;  2V4I B;  1TKE A;  4RH6 A;  1PFD A;  3AMZ A;  4KGT A;  3P1M A;  1VZ7 A;  4P16 A;  4YSY B;  3U2S C;  1EU4 A;  1JW9 D;  3P42 A;  3I9V 1;  2IPK D;  3P4S B;  2LJI A;  1FFU A;  3BK1 A;  4LTU A;  3KQ4 A;  2J4X A;  5BMG A;  1ZOY B;  1XLQ A;  1E6E B;  5I4D A;  3AEC B;  3HVD A;  1SF0 A;  5C3J B;  2OHF A;  1FRR A;  4YXD B;  1C76 A;  1ZE3 D;  2PVO D;  3IXS A;  3P4Q B;  4DXF A;  2IDY A;  3AV8 A;  4FXC A;  1TJE A;  4NJC A;  2M56 B;  3PZ7 A;  3T3N A;  1I4H A;  3KWL A;  1F2R I;  3TEY A;  1FMA D;  1SE2 A;  1EWY C;  1JWB D;  1L0Y B;  1NVI D;  1V1P A;  3EGR A;  1D5X C;  2WXK A;  2RDG A;  4TMA B;  1T3Q A;  3AEF B;  2WXQ A;  5D3I B;  2X38 A;  4CQN A;  4RGM A;  2K5P A;  1RWS A;  5EE3 A;  2DYM A;  1JML A;  1JRP A;  4MT5 A;  1SBB B;  3W5U B;  3AN1 A;  2WDV B;  1ZUD 2;  1AW7 A;  1QOA A;  5BYR A;  1C4C A;  1QF6 A;  1IGD A;  3ZQ4 A;  2YEP F;  1EU3 A;  3ZYY X;  1SJE D;  2SAK A;  2ICI A;  1WXQ A;  1ET9 A;  3Q8C A;  2I38 A;  1K51 A;  3AE6 B;  1C9F A;  1NYR A;  1QLB B;  1XO3 A;  3AH7 A;  2TSS A;  4L2Y A;  4D2K A;  2AQ1 B;  2QJL A;  3CWI A;  3Q69 A;  1ROE A;  1ZP0 B;  4MM3 B;  1L0X B;  1C79 A;  2PTL A;  3AE3 B;  4RCO A;  3AEB B;  3AM9 A;  1VR9 A;  2W54 A;  3SFD B;  4US9 A;  4MH8 A;  5TSS A;  2V0G A;  1SB3 C;  4XWW A;  5HHD G;  2WXH A;  1GB4 A;  2RPV A;  1N5W A;  1UGJ A;  1V1O A;  4DXG A;  2WXR A;  2BBC A;  4RGT A;  3PO0 A;  1V1P B;  2WXF A;  1V8C A;  2LHD A;  2INN E;  5BMH A;  2KWD A;  1YJJ A;  4OZA A;  3OWE B;  3VR9 B;  2EEL A;  5D7G A;  2M19 A;  4Q2J A;  2WXI A;  3TSS A;  2QEJ C;  1UWM A;  1XCT L;  4RF0 A;  1AYF A;  1L0V B;  2JX5 A;  1QOG A;  2M0A A;  2NTS A;  1TS5 A;  2CJO A;  4GLS C;  4ZRQ A;  3MC0 B;  3HUI A;  3BK2 A;  1FCL A;  5HG2 A;  3FC4 A;  5H92 C;  1I7H A;  3P4P B;  2KAC A;  1I4X A;  3BWU D;  1VLB A;  3Q8F A;  2IGH A;  2ONQ A;  2WXO A;  2FUG 1;  2BTE A;  3KLS X;  1OQQ A;  1WGK A;  5FKA C;  5H8Y E;  2AX5 A;  4B0E A;  1SE4 A;  1TY2 A;  3FIL A;  3FAH A;  3TUO A;  3AEE B;  4XWT A;  4WIP A;  5GXG B;  3W1S A;  1FXA A;  1YN5 A;  3I57 A;  1D4B A;  3AEG B;  2G1E A;  1YQ3 B;  3AE9 B;  4KKJ A;  2NMQ A;  2HDE A;  1ZDX A;  4L23 A;  3J9C A;  4YWG G;  3EA6 A;  1ZXH A;  4UDU C;  2PLP A;  4RF1 A;  3VR8 B;  5HFY A;  1QIL A;  1J7B A;  5C2T B;  1CJE A;  1KRH A;  3L4P A;  1XLP A;  2K9X A;  3E9S A;  1E7P B;  2WS3 B;  3GS2 A;  3BVM A;  4N6E B;  2MJ3 A;  2WU5 B;  2WXN A;  4C80 A;  3V05 A;  1F2R C;  4C7Y A;  2CU3 A;  2W3S A;  4US8 A;  5D3D A;  3AEA B;  5JXV A;  1KH0 A;  2JZP A;  3CIR B;  1N60 A;  5G5G A;  2GI9 A;  2N7J A;  5EE9 A;  2LGI A;  4KGS A;  2K3U A;  1DGJ A;  1A70 A;  1SEB D;  2JYT A;  2Y5P A;  2I2Y A;  2BS3 B;  1JRO A;  2K0P A;  2J53 A;  1NEK B;  1ZPS A;  2LHE A;  3FIL B;  3Q8B A;  1C77 A;  1JQ4 A;  2LEK A;  3DWM A;  1P7E A;  3ETR A;  3UI3 A;  1TS4 A;  1HZ6 A;  1UUP A;  1K50 A;  1PUT A;  4ARC A;  2JQR B;  3ZGZ A;  1N63 A;  1ENF A;  4ZHO A;  2PKO A;  3R8B A;  2N0S B;  3HVZ A;  1E9M A;  1KTK A;  3URY A;  3IAS 1;  2WXJ A;  1BXT A;  4JWU C;  4RFB A;  4WUR A;  1HXY D;  3NVW A;  3O13 A;  4DQO C;  2V3P A;  1QOB A;  4JX1 C;  1ET6 A;  1EWC A;  1F77 A;  2WDR B;  1UNS A;  2HTM E;  5HI1 A;  3WCQ A;  1MI0 A;  4HEA 1;  1QQR A;  4YT0 B;  4C56 C;  3IT4 B;  4WWM A;  1SJH D;  3BYT B;  5AUI A;  4AQ7 A;  1SSN A;  4HKQ A;  4O1N A;  3EUB 2;  3N9Y C;  3TEX A;  3R2T A;  4N59 A;  3AB5 A;  2J52 A;  5E6J A;  2IGG A;  2G9H D;  1I4G A;  1K53 A;  4OZB A;  1MPE A;  2GRI A;  3Q8E A;  1RM6 C;  3NS1 A;  2H89 B;  1L4D B;  4HJG E;  4TSS A;  4KGR A;  1B1Z A;  4KX6 B;  3HRD D;  4XE0 A;  3IAM 1;  1YNT E;  5AUK A;  1HEZ E;  1TZO A;  1VZ6 A;  3GP7 A;  3W2D A;  1KLU D;  4JWS C;  4RGN A;  1WYG A;  1WSP A;  4REZ A;  4TQ0 A;  4P6V F;  1CQV A;  3MP9 A;  3B2F A;  1J7A A;  5BYQ A;  2WXL A;  2XN9 C;  2E6X A;  1FNV A;  2ACZ B;  1HZ5 A;  2QMT A;  3BYY B;  2H88 B;  1FEH A;  2W55 A;  1BML C;  1FM0 D;  1JCK B;  1KFY B;  2N9L A;  3SEB A;  4M0W A;  1IUE A;  4B0M A;  2AQ2 B;  1NI3 A;  1T5X D;  1VJK A;  1RFK A;  3NUH B;  2QIL A;  1YMH E;  3AE2 B;  4R3D A;  2MJD A;  1VDV A;  1T6B X;  2L52 A;  2Q5W D;  1FNU A;  4NZL B;  1UWX A;  4YTM B;  3Q8A A;  4J3O D;  2WQY B;  2KMM A;  1ESF A;  2MJE A;  1VZ8 A;  2RDH A;  4RNA A;  5T8I A;  1SXT A;  4WH4 A;  2WU2 B;  1JWS D;  1JWU D;  2MH7 A;  2LMC A;  4YSX B;  2L83 A;  2Y5C A;  1I4Q A;  2WXP A;  3U52 E;  3ZJU A;  4PT5 A;  2INP E;  2L32 A;  3P4R B;  1FNW A;  4A8X C;  1TY0 A;  4TQ1 A;  1L6V A;  3ZJV A;  1BUI C;  1TYG B;  3W9C B;  3NVZ A;  1FXI A;  3NVV A;  3W5V B;  1E10 A;  4LK0 M;  2WXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...