1K8RB

Crystal structure of ras-bry2rbd complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
82
Chain Sequence
CILRFIACNGQTRAVQSRGDYQKTLAIALKKFSLEDASKFIVCVSQSSRIKLITEERDRLIIVPKEKPCPSFEDLRRSWEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Transforming protein P21/H-RAS-1
publication title The Ras-Byr2RBD complex: structural basis for Ras effector recognition in yeast.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 82
sequence length 95
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2001-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14847 Ras_bdg_2 Ras-binding domain of Byr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1k8rB00
2LD9A 4BOSC 1AARA 4PS3A 1M94A 3KW5B 2KVRA 1WXAA 4EFOA 3GOEA 2DYMA 2MBOA 1QZEA 4MEMA 2IYDB 3ZTCA 3VH4B 3N3KB 4IM2A 3RYTA 2K8CA 1WR6E 3PPAA 4AUQC 1GNUA 1H4RA 2O6VA 2XEWA 3DVGX 1WZ0A 3ZUNA 3NOBA 1EUVB 3BY4B 4TUUA 1E7UA 1WXSA 5D7GA 3W1SC 3ZDMC 2FCQA 4DXAB 3KYDD 2JPHA 2BPSA 2N4FA 1P1AA 2CHZA 2FAZA 1V5TA 3APCA 4JGHB 2VRRB 1E8YA 3ENEA 2ZEQA 2KTRB 3PZDA 2C9WB 4WJNA 4WWOA 2K8HA 4W9LA 2KWCA 2KTFA 3T8MA 1L2NA 2FCNA 1ZKHA 2CHWA 3QCAA 4W9GA 3ZVVA 1V9JA 3APDA 3T9LA 5LXHA 2IO1B 4B9KA 4DK5A 4EOYA 1TGZB 3DVNU 4A20A 1JRUA 2BGFA 2KWVB 3NZUA 5L95C 2N1WA 2KK8A 2MBHA 1X1MA 1NBFC 2ZVOA 2ZCBA 2IY1B 1XQQA 2ZZPB 3U7DA 4AP4C 4N9F4 2EMSA 1GC7A 2JY6A 3EFUA 2FNJB 2Y5BB 4KV2A 4MGIE 2CHXA 2NPTA 2KNBA 3PRZA 1E7VA 3OLMD 3ZW3A 4DHZB 4BKSA 2IBIB 1WGRA 3LJ3A 1WJ4A 2BKFA 3C0RB 2R2QA 3DPDA 3GZNI 4KSKC 1HE8A 5AZHA 1OEYA 3TIXA 2WYQA 1Z2MA 4FJYA 3WANA 4ASWC 1E8XA 2RD0A 4IWPA 3DBLI 2DZKA 1VCBA 2MBQA 3UGBB 3VFKA 2KO3A 4J6IA 2JUOA 3X0WA 1Y8RC 1GJZA 5CHFA 5AEKB 3DQVA 3I3TB 3R3MA 4WQOB 3IHPC 5C23A 3DBHI 3R7RA 2D10A 2AL6A 5E6OA 2I1JA 4BKGA 4CHKA 2KMAA 4XX5A 1EO6A 2DX5B 2N9EB 3W1SA 4DDGD 4I6NB 2KTRA 4GGQA 2A5UA 1YQBA 1UELA 3P2BA 2EMTA 4DWFA 1YX6B 1WX9A 4GOCA 2A4ZA 1P3QU 3QHTA 3PGEA 4MM3A 3VTUA 2BYEA 3NHEB 2C5LC 2LRUA 1T0YA 1BT0A 4M0WB 4DHJD 2JZZA 2MP2B 1WX8A 2JT4B 3ML8A 4K81A 1WF9A 3TJPA 5CX3A 3QC8B 4ZRJA 2HTHA 3HIZA 2LJ5A 4JQWC 3ONSA 3VHTC 3V61A 3PLUA 4EZLA 3AI5A 2KJ6A 2ZPNA 3PT2B 3B1LX 1E5WA 4W9CA 1P0RA 3VAWA 2HD5B 1WJ6A 4HPLB 2J0KA 5CHWA 2RR9A 2C7MB 2IO0B 1WI0A 2D07B 2DENB 2Z59B 1IPGA 1XT9B 3ZRFA 2RSUA 2NVUI 3ML9A 4E3CA 5D94A 1GG3A 1WE6A 3CF6E 2L05A 3S2AA 5IA7A 2D11A 4FBJB 4WJPA 5G2NA 3SHQA 4BBNF 4TQ0A 4KZCA 3EHVA 4RM9A 2L76A 2DAFA 3NY5A 3NZSA 4EKUA 3Q3FA 2ZNVB 4ZRIA 2LXCA 4K7WA 3HHMA 3ZLZA 4JL9A 2KDBA 1H8CA 1P9DU 1WFYA 2WX1A 2KWUB 3ZO5B 4ANWA 3MHSD 4HXDA 4NQLB 3M95A 1UD7A 4M8NA 2N9XA 4M8MA 1EF1A 1U4AA 2KDIA 2C7NB 2RPQA 1Q1OA 2J0JA 2WWZA 3JYUA 4HPMB 3UQAA 2JF5A 1WXMA 2L8JA 2MP2A 4KZ0A 2WX0A 2JRIB 3JSVB 4MGYE 5JZEB 1I42A 4DBGA 4TQ1A 1RRBA 2AEHA 4GXBA 1R4NI 4PYUA 1GC6A 1WZ3A 1ZGUB 2O6VD 3QIJA 4FLHA 4I6PA 2MCNB 3VVWB 2G4DB 1ZW7A 1R4MI 3L08A 4WWPA 5DPTA 5E6PA 3U8ZA 4W9EA 2FUHB 2GBJA 3A4SC 5C1ZA 5L83A 2M17A 3SDLC 1LQBA 2R2OA 3BINA 2D3GA 3KVFB 4EZJA 4IG7B 4FJVB 2BWES 3IG3A 2JWZA 5KHQA 1EF5A 3N32A 4OVUA 5FR6A 5J18A 5LXIB 3QK0A 1SGHA 3L0WB 4HCPB 1WGHA 2BWFA 2HJ8A 1YX5B 3PLVA 3AULA 3A9KB 4E71A 1NDDA 2MBEA 3QARA 2OJRA 2ASQA 1RFAA 3ZNHB 4OVVA 3UIPB 2DAJA 4KIKA 3KUDB 4ZYNA 5GMVA 1V5OA 4F8CB 5J2RA 4TKNA 2AL3A 1YD8U 3QQ8B 4LCDE 2KXJA 2LWPA 1Q0WB 3ZNGC 3ZNZB 3EECA 3ECIA 4FN2A 3LDZE 2KMCA 2KFKB 4G11A 4KSLC 2N7EA 3UINB 2GBMA 4G50A 3VH3B 2L00B 1K8RB 2KOXA 1V49A 3PREA 1E8ZA 2FCSA 3L54A 4DHZE 2FIDA 3HM3A 3JSVA 4MSMB 4B6WA 3PSEB 3PV1A 1KLVA 1TTNA 3JVZX 2HE7A 5CTRC 2GOWA 3UIOB 2NBVB 1V86A 5LLIA 3VTWA 2BYFA 3L16A 2UWQA 3L13A 2MW5A 4NQKE 2W9NA 2XK5A 2N1VA 4RMAA 2B3AA 2MA9B 3SU8X 1FXTB 1RLFA 3DVGY 2V3SA 3PTFC 4BFRA 5HKHA 2FIFA 4E74A 3A9KA 3ZNID 1KJTA 4KVGB 2V4LA 3RD2A 3A9JA 4HJKA 2KHWB 3D32A 1WJUA 4FA6A 4BOZB 3L17A 1LXDA 1WIAA 3ZRCA 5AZGA 2UYZB 4IW0A 2BF8B 2K6DB 2MLBA 4NJ6A 3VXWA 2MRPA 4FULA 4HDOA 4II3B 2KFKA 1KOTA 2L0TA 2L7RA 4W9JA 4PS8A 2YLMA 4NJ7A 4JIOU 4WJQA 3PRPB 3V6CB 4NAWB 2KN5A 2NS5A 2RGFA 4AJWA 4BVUC 2LVOA 4W9DA 3Q3JA 3RULA 3DCGA 1KM7A 2PEAA 4P7IA 4FADA 1UBIA 4CYEA 2O2VB 1S1QB 2I1KA 2LUEA 3JW0X 3V62A 3CMMB 4URKA 4W9FA 1G6JA 4AWJA 2LGYA 3QJZA 4IWOA 5CHVC 4KIKB 2L0FA 2ZVNA 3ZIMA 4ZDVA 1V2YA 3H7PB 2XBBC 4IM3A 3QA8A 1C3TA 3PHWB 4HK2A 4ANXA 2JRHA 3WALA 1UZXB 3R66C 1OEYJ 3SD5A 5AZFA 3OJ4B 4WJOA 1YJ1A 3RUIB 1Q5WB 2KJHB 1OQYA 3VDZA 2M8SA 2IO3B 1RAXA 4RM8A 2REXA 1WRDB 4BKTA 1Z5SB 2YVCA 4HWIB 4ZRKA 3M62B 3VQIA 1SIFA 1MG8A 2GBNA 4MGKE 5J17A 4FHJA 2MX2A 4WWNA 1WE7A 2KDEB 2GBRA 3IFWB 3WAOA 2ZCCA 1J0GA 2LRWA 2NBUA 3UQBA 2KKCA 4MJSB 2M1MA 1WR1A 2FCMA 3PVLA 2CS4A 2K8BA 1LM8B 2K6QA 2BKRB 4NAWA 2XK5B 2EKEC 3H9DA 3L10B 4GDLB 3UF8A 2G45B 4IUMB 2KZRA 1SE9A 4LDTD 4MDKE 3VUXA 2MQJA 1TZ1A 3IVFA 3RT3B 2GBKA 3WA0A 3MJWA 3U30A 4KDIC 4W9HA 2KC1A 2PE9A 2O2VA 3RCZA 2PPHA 2KLCA 2GMIC 4NPNA 1OGWA 2Z0EB 1E8WA 3V6EB 2AYOB 3ZDTA 2BYVE 4II2B 2LVQA 4K7SA 3A9JB 3K9OB 5E6NA 2NCNA 3A1QB 4CO7A 1GUAB 2PJHA 2M0XA 1WJNA 3H7PA 3PRMB 4K1RB 2DZIA 3X23A 4FHKA 2DZMA 2DYBA 5KHOA 3DBSA 5D6JB 3DVNV 2K39A 3H1UA 2LVPA 4K7UA 2N9PC 4F1SA 3VUWA 4EZKA 1E90A 1WYWB 3APFA 3PS6A 3WAMA 3DOWA 1WX7A 4BKSD 1WGGA 1WGDA 3ALBA 3DBRI 3QX1A 2DYOA 1WH3A 2LI5A 4MGZE 1UH6A 3R7QA 5JHAA 2PE6B 2J0MA 3M63B 2CU1A 4DHJB 2KFJA 2G3QB 3PHXB 3K9PB 4A3PA 1UBQA 4IM0A 4GB9A 2OOBB 3H6NA 4YL8A 4MJSA 1WY8A 4XZ4A 4ANUA 4GN1A 2MBBB 2C60A 1IYFA 1XD3B 1UGMA 4I6LB 4GDLA 4MELA 2LXAA 4G3XB 4EUTA 4X57B 4ICUA 3CSTA 1NI2A 2DZJA 3H7SA 4IC7B 2KANA 4W9IA 2J7QB 3M3JA 3HM6X 4GMVA 2KX0A 4NY0A 4PYZA 3CSFA 1TBEA 3OJ3A 2NR2A 3A4RA 3A1QA 2N7DA 4JLCA 1WXVA 1CMXB 2LASA 1D3ZA 2KD0A 4GU2A 3TMPB 1PQSA 4G0NB 1P98A 2K25A 5G55A 1OTRB 3B08A 5BO4B 2KQSA 1YIWA 1V81A 3QAQA 3QWZB 4GDKB 3W1YA 4MH0E 1ISNA 1S3SG 2Z0DB 3KYCD 3ZKJC 2CKHB 2IY0B 2D2QA 2MWSB 1L7YA 1WMHB 2KC2A 1WGYA 1V80A 2IZVB 3HK0A 3MTNB 2C7HA 3WAPA 3DDCB 4LJPB 4AOFA 2AWTA 2NBWB 2CR5A 2JXXA 2MSED 2ZJDA 5JHBA 1I35A 2KLGA 2V1YA 4HCNB 4W9KA 4DDID 2O6VB 4IWQA 4TV3A 3VTVA 4BBNC 1J19A 3B0AA 4AJYB 2JVCA 3IBEA 2LGDA 3OAWA 4GSWA 4LJOB 1VD2A 3AU5A 4NNJB 4HVBA 1LFDA 2K1FA 3KH0A 4XC2A 4HDQA 2KQ7A 3V60A 4WAAA 2JZ3B 3TBLD 2WDTB 5JH5C 1F9JA 3RZWC 3WIMA 5DPSA 5DCNA 4GIVA 4F7ZA 2G4SA 4LDTB 2LZ6A 1WM3A 3KUCB 3AXCA 3ZTDA 1J8CA 4PS7A 2KJRA 2M4NA 4FJZA 2KDFB 4MSQB 3RZFA 2LGXA 3A33B 4KDLB 1V6EA 4A3OA 1WM2A 2ZNVC 2KX3A 2IO2B 4ICVA 2ZPYA 4ANVA 3NS8A 3AU4A 1IP9A 5D2MB 1A5RA 3O65B 4GDKA 2DHZA 4HLEA 2QHOA 5DPRA 1C1YB 3N30A 3KUZA 1WMHA 3EC8A 5EDSA 4B95A 2L3ZA 3TCAA 3VUYA 5TR5A 3TL5A 4EEWA 5DPWA 5IAAC 2NPTB
chains in the Genus database with same CATH superfamily
2INNE 4YSZB 3Q3NC 3GOEA 2DYMA 4JE3B 2WXGA 1QZEA 4MEMA 2IYDB 3CWIA 2K8CA 3PPAA 2J52A 1H4RA 2KMMA 3C8YA 3ZUNA 2DLBA 3W5VB 4TUUA 2WXRA 2LUMA 1E8YA 3ENEA 2ZEQA 3PZDA 4K3BA 2C9WB 2KWCA 3AEDB 2FCNA 1ZKHA 4W9GA 3ZVVA 1V9JA 1XO3A 3TEWA 5HG2A 2RPVA 5LXHA 2IO1B 4DK5A 4YWGG 4EOYA 3DVNU 4A20A 2KWVB 2IY1B 4N6EB 2EMSA 2Y5BB 1I4PA 2GRIA 2IBIB 1WGRA 2X38A 3C0RB 3GZNI 1TKYA 1Z2MA 4ASWC 2W54A 3IT4B 4J6IA 3VRAB 2WU2B 1DYQA 1GJZA 4Q2JA 2D10A 5H92C 3VR8B 3P4PB 2A5UA 3ZQ4A 1TIFA 1YQBA 4DWFA 2PMVA 3VTUA 1KFYB 1WX8A 2JT4B 4K81A 3TJPA 4ZRJA 2HTHA 2N9KA 5FR3A 2KAJA 5D3DA 3B1LX 4W9CA 4YT0B 4H2AA 2HD5B 3NJTA 4HPLB 2J0KA 5CHWA 1L0YB 1GAQB 1XCQL 2D07B 2DENB 3NZ3A 1WXQA 2QSDA 3ML9A 4E3CA 1WE6A 3E9SA 5IA7A 5IKCM 2D11A 4FBJB 4OZBA 3SHQA 4TQ0A 4KZCA 2BS3B 3AE8B 4LNIA 3Q3FA 2ZNVB 2LXCA 3HHMA 5FK9C 1H8CA 1WFYA 2KWUB 4NQLB 4M8MA 1UD7A 4JWSC 2KDIA 1GB1A 3KLSX 1WXMA 2WX0A 3JSVB 4LK0M 5JXVA 4XGAB 4DBGA 4P16A 1RRBA 2PW9A 1GC6A 2G4DB 1XXGA 1R4MI 3L08A 3R2TA 2BVCA 1V1OA 5C1ZA 3A4SC 1J7AA 5HI1A 3ZXVA 2R2OA 3BINA 1RWSA 4MH8A 2BWES 1N6ZA 3N32A 5FR6A 5J18A 3EA6A 4XWTA 3R2IA 1SGHA 3L0WB 4HCPB 1NI3A 2B76B 2HJ8A 3AB5A 3KWVA 3AULA 1VR9A 2AQ2B 4E71A 4MM3B 3QARA 2BW2A 1RFAA 3ZNHB 2QCZA 4KIKA 2MJDA 3KUDB 5GMVA 1V5OA 3I9V1 4TKNA 2AL3A 3QQ8B 3ZNZB 4FN2A 4WIPA 1FRDA 4QAYA 1K51A 1YJIA 2WHIA 1K8RB 1QKZA 1C76A 5G5HA 1N60A 3P1MA 3HM3A 1MG4A 1CK1A 3U4EG 1YN5A 5CTRC 2GOWA 1V86A 3IAS1 2UWQA 2MW5A 3ABVB 3DVGY 3C19A 1TKEA 2ONQA 3A9KA 1KJTA 2V4LA 3IT6B 3PZ7A 3A9JA 3D32A 4FA6A 3DHGC 4IW0A 2BF8B 2K6DB 4XE0A 2KFKA 2L7RA 2BS4B 1VDVA 4NJ7A 2KN5A 1TKGA 4W9DA 3RULA 1L6UA 3RNCC 2PEAA 2INDC 2SEBD 4FADA 1T5XD 4CYEA 2O2VB 3JW0X 4IWOA 4A8XC 1TJEA 4ZDVA 1SJED 1SXTA 4HK2A 4ANXA 2PKOA 1UZXB 4C56C 2HJ1A 3FC4A 2W82A 4WJOA 3VDZA 2M8SA 2IO3B 4L2YA 2REXA 3AE3B 3U52E 3FKYA 1FFVA 3M62B 4LNOA 1MG8A 4MGKE 4FHJA 2MX2A 1WE7A 2IPKD 4XDCA 2ZCCA 1PDXA 2KKCA 4MJSB 2H89B 3RNFC 3PVLA 2CS4A 3HRDD 2K6QA 1OFFA 2EKEC 1D5MC 3UF8A 4DXFA 1TZ1A 3WA0A 3RT3B 3LXFA 4KDIC 3FAHA 2Z0EB 3ZDTA 4K7SA 3K9OB 2NCNA 2M0XA 3B9JA 1GB4A 3RPFC 3AEAB 3DVNV 2HTME 1E90A 1WYWB 2RDBC 5BYQA 1WX7A 1WGDA 3ALBA 3DBRI 2DYOA 1UF0A 3PHXB 2KDMA 3ZJVA 1UBQA 1B9RA 4IM0A 3H6NA 1M4VA 5T8IA 2C60A 4IKGA 2KT7A 1QOAA 1SE2A 4GDLA 3VR9B 2LXAA 1N5WA 4G3XB 3CSTA 3LYYA 4IC7B 4W9IA 2J7QB 3M3JA 3HM6X 1JQ4A 5IOIA 3A1QA 2N7DA 4JLCA 2K25A 1OTRB 1I4HA 4MH0E 2CKHB 4HKZE 1WGYA 2IZVB 3WAPA 1V1PA 3DDCB 4LJPB 4B0EA 1YNTE 2KVZA 2TSSA 1I35A 2KLGA 3PO0A 3URYA 4PT5A 4HVBA 2CU3A 4WQMA 3T3NA 4RH6A 4N59A 3V60A 3TBLD 2GLSA 4KGRA 5DPSA 3P63A 2NMQA 3RNBC 1WM3A 3IAM1 2Y3AA 1FNUA 3AM9A 1ZPSA 4FJZA 3FILA 2LGXA 3A33B 3DBHB 4KDLB 1V6EA 1WM2A 2H88B 2ZNVC 2IO2B 1EWCA 3MHZA 4ANVA 3AU4A 5D2MB 1A5RA 3BVZA 3O65B 2DHZA 1SEBD 3Q8AA 2QHOA 5DPRA 3KUZA 4US9A 4KKJA 3TCAA 4M00A 5DPWA 1DOXA 4BOSC 5AUKA 1M94A 3KW5B 2PVOD 4AQ7A 2MBOA 2FE8A 3ZTCA 3N3KB 4IM2A 1FNVA 2O6VA 1KTKA 3DVGX 1L4ZB 3GB1A 4GLSC 1UGJA 3BY4B 3Q3OC 1WXSA 2QIEB 3O13A 3ZDMC 1XLQA 2CHZA 3APCA 4FXCA 1MJDA 1E0ZA 4WJNA 3T8MA 1VRAB 2CHWA 1LO5D 2WGSA 3T9LA 1TGZB 1SE3A 1QF6A 1X1MA 2ZCBA 1QOFA 3U7DA 1BXTA 1GC7A 2FNJB 4KV2A 2CHXA 2NPTA 2KNBA 1E7VA 3I5JC 3OLMD 3ZW3A 4DHZB 1F52A 3LJ3A 1WJ4A 3V3XA 1JW9D 2R2QA 3DPDA 5LNK1 5AZHA 2WU5B 2WYQA 2FBWB 2ACZB 2G1EA 3VFKA 5GXGB 1Y8RC 5CHFA 3KWLA 3I3TB 3IHPC 2AL6A 1E6EB 2I1JA 4XX5A 1EO6A 2CJNA 2KTRA 5C3JB 3ZXRA 1FNWA 2D3BA 5BMGA 5E6JA 1YX6B 1WX9A 1K53A 1KRHA 3QHTA 3NHEB 2C5LC 1BT0A 5CX3A 1AN8A 3TEXA 3B2GA 3HIZA 2LJ5A 4JQWC 4N58A 3VHTC 3PT2B 2ZPNA 4HEA1 2VZKD 4HJGE 1T0SC 5HHDG 2LJIA 3NVYA 2Z59B 1FEHA 1PGBA 1XT9B 3ZRFA 2RSUA 4ZHOA 4L23A 4NZLB 1GG3A 3HVDA 3AMZA 2DAFA 3NY5A 3NZSA 2WXOA 2EKIA 5IN7A 2YEPF 4RF1A 1L5PA 1RFKA 2KDBA 2WX1A 1Y56A 4ANWA 3MHSD 4LNNA 1EF1A 1U4AA 1HZ5A 4HPMB 4M0WA 2L8JA 3ZJTA 2MP2A 1I42A 2AEHA 4TSSA 1R4NI 2O6VD 3VVWB 4KGTA 3BZDB 4I6PA 2MCNB 5E6PA 5DPTA 2BS2B 3TEYA 2D3CA 3SDLC 4TMAB 4EZJA 4IG7B 3AV8A 3N1YC 5KHQA 1EF5A 3SFEB 1QOGA 1I7HA 2BWFA 3A9KB 3Q8FA 1NDDA 1K50A 4OVVA 2DAJA 2LHEA 3BYYB 5J2RA 4OW0A 4LCDE 3ZNGC 3AE6B 1IBXA 3LDZE 2KMCA 2IDYA 1C77A 1ZDXA 2KFKB 4MACA 5H8YE 4KSLC 2Z8LA 3VH3B 3L54A 3PV1A 4XWWA 1KLVA 3JVZX 1EWYC 2HE7A 1KLUD 5D3IB 2NBVB 1JWUD 2BYFA 3L16A 3L13A 4NQKE 2W9NA 2N1VA 4RMAA 3SU8X 1SSNA 2M19A 2V3SA 1F2RC 1YQ3B 2LHDA 1FO4A 1E9MA 3RD2A 1FCLA 4HJKA 4KX6B 2KHWB 4LNFA 1WJUA 1C4PA 2UYZB 4YSXB 4ARCA 3VXWA 4HDOA 2L0TA 2QJLA 4WJQA 3N9YC 2NS5A 2RGFA 4AJWA 3LB8C 3Q3JA 1KM7A 4CQNA 4P7IA 2LGIA 1UBIA 4URKA 4W9FA 3AE2B 3MC9A 2ZVNA 2BQQA 1V2YA 3SEBA 3MJ5A 2V3NA 3WALA 1JCKB 3SD5A 3GE3C 5EE3A 1OQYA 1OQRA 4RM8A 1WRDB 1QLBB 2AQ1B 3DWMA 1SIFA 5J17A 4WWNA 3AEGB 5EE1A 2GBRA 1EU3A 3UQBA 2FCMA 1L4DB 2K8BA 2XK5B 4GDLB 4ZRQA 2KZRA 1SE9A 1NENB 2GBKA 3SFDB 3MJWA 1N61A 1R7SA 4W9HA 4J3OD 2KC1A 1J7CA 2GMIC 1OGWA 1E8WA 4YTMB 2BYVE 2JSVX 2QC8A 3A1QB 1TS4A 4CO7A 1GUAB 1FRRA 2PJHA 1F2RI 1TY0A 3H7PA 1UUPA 3PRMB 3AN1A 1VZ7A 2DZMA 5KHOA 2K39A 3HUIA 2N9PC 4EZKA 3VUWA 3APFA 1WSPA 1V97A 1WGGA 3QX1A 3BK2A 2LI5A 4MGZE 1UH6A 5JHAA 3UI3A 2J0MA 2Y5PA 3M63B 4PK1A 3MC8A 4P1CC 1MHHE 3IXSA 1T3QA 1WY8A 1C4CA 2VZKB 4MELA 2ZW0A 3H7SA 4PYZA 3OJ3A 2QMTA 3BVMA 3A4RA 3FILB 1VZ8A 1CMXB 2LASA 1D3ZA 3TMPB 1PQSA 1JWMD 3TEZA 4K3CA 2L32A 3B08A 5BO4B 4ITKA 2N9LA 1VZ6A 3RNEC 3W1YA 3WCQA 3KYCD 1S3SG 2D2QA 2MWSB 2KC2A 1IUEA 4WURA 3MTNB 2C7HA 4JX1C 2AWTA 2JXXA 2ZJDA 1DGJA 4DDID 1YN3A 2O6VB 4BBNC 4AJYB 2JVCA 3IBEA 2LGDA 1VD2A 4NNJB 2QDFA 4XC2A 3GZNB 4HDQA 1SJHD 2LFIA 1DOIA 2LGSA 2ON8A 4USAA 3RZWC 3WIMA 2BB5A 2G4SA 2LZ6A 4YXDB 3ETRA 1J8CA 4RNAA 1B1ZA 1V8CA 4MSQB 4A3OA 2X8XX 4GDKA 4HLEA 1C1YB 1WMHA 5TR5A 3TL5A 1ZXIA 2NPTB 4PS3A 1XEEA 3VH4B 1GNUA 2XEWA 4RGMA 2IGHA 1EUVB 1FIQA 3Q8BA 3N1ZC 3W1SC 2FCQA 1NEKB 2JPHA 2BPSA 2N4FA 1HXYD 2FAZA 2KTRB 3BVGA 2MJ3A 2K8HA 4W9LA 3QCAA 1WYGA 3APDA 1WWTA 4C4VA 4B9KA 2BYTA 4YTPB 1JRUA 3NZUA 5L95C 2N1WA 2KK8A 2ZVOA 1GPXA 2KQ4X 2BT6A 1ZUD2 4N9F4 2JY6A 3BYTB 3EFUA 4MGIE 3PRZA 1BUIC 4ACFA 4BKSA 1HE8A 1R4MB 4L1BA 4FJYA 1MFWA 2RD0A 3DBLI 2DZKA 1VCBA 2KO3A 1AWDA 2WDQB 5AEKB 4WQOB 5C23A 3R7RA 5E6OA 1TT5B 2BBCA 4BKGA 2KMAA 1QT9A 4I6NB 4GGQA 1JMLA 3DHHC 5IO9A 1UELA 3P2BA 2EMTA 1C78A 3AE5B 1C9FA 1P3QU 2LEKA 4MM3A 3P4RB 2LRUA 4M0WB 4XDDA 2JZZA 2MP2B 1TS2A 2GB1A 3ONSA 4YTNB 3V61A 4EZLA 3AI5A 3AE4B 3VAWA 4RCOA 2WXFA 1TS5A 1WJ6A 2WXKA 2RR9A 1ET9A 3U2SC 1KLGD 3N1XC 2WP9B 5HFYA 5D94A 3CF6E 3S2AA 2L05A 4BBNF 4EKUA 3EUB2 3NRZA 1IBXB 4M8NA 1FCCC 2C7NB 1Q1OA 2J0JA 5FKAC 1TY2A 3UQAA 4YSYB 4KZ0A 4MGYE 4ARIA 1LGRA 4TQ1A 3ZNID 5TSSA 1WZ3A 3QIJA 4FLHA 3U8ZA 2GBJA 1LQBA 3ZJUA 3L4PA 3KVFB 3IG3A 2JWZA 2WXMA 1YX5B 1ROEA 1T0RC 1L0XB 2ASQA 2N0SB 4XYCA 4F8CB 2D5GA 3AE9B 2WXJA 1Q0WB 1NYQA 4RGTA 4C80A 2J42A 2IJ0A 1AYFA 1F77A 3NVZA 4G11A 2N7EA 2L00B 1JWAD 1E8ZA 2FCSA 4ZOHC 2FIDA 3AECB 4MSMB 1PUTA 3PSEB 2INPE 1MVKA 2W3SA 2WDVB 2BTEA 1SBBB 2I2YA 2WXIA 2WXHA 2PVGC 3VTWA 2JX5A 1JWSD 2K9XA 2JYTA 2B3AA 4KGSA 3PTFC 5HKHA 1YN4A 2JXTA 4E74A 2K0PA 3GP7A 2VH1A 1YMHE 4BOZB 1LXDA 1WIAA 2JYEA 3ZRCA 5AZGA 3VRBB 2MLBA 4NJ6A 1ZP0B 4II3B 1KOTA 1MPEA 4PS8A 2YLMA 3DBRB 1RYJA 3PRPB 3I57A 3V6CB 2LVOA 3DCGA 3RFZB 1QILA 3OWEB 3MP9A 1TZOA 1S1QB 2I1KA 3V62A 1NYRA 4AWJA 2DBYA 2LGYA 5CHVC 4KIKB 2KN4A 4HPPA 4EE2A 2RDHA 2E3TA 3H7PB 3QA8A 3PHWB 2NTTA 2JRHA 4US8A 3R66C 1OEYJ 1HZ6A 5AZFA 3RUIB 1YJ1A 2KJHB 1RAXA 3Q69A 4BKTA 2WNMA 2YVCA 4HWIB 5BMHA 1ENFA 1JALA 3VQIA 2SAKA 2KDEB 4S17A 3WAOA 2LRWA 1UWXA 1TS3A 1WR1A 2M1MA 4ZYSA 4A9AA 2BKRB 4NAWA 2MH7A 3DHIC 4MDKE 1FXAA 2PE9A 3RCZA 4O1NA 2AYOB 1A70A 3A9JB 1ZDVA 1FM0D 1PGXA 2G9HD 4K1RB 3X23A 1EM7A 2OJWA 3Q3MC 1F1HA 4A55A 3DBSA 5D6JB 2LVPA 4F1SA 2FUG1 3PS6A 3W5UB 3WAMA 3DOWA 1WH3A 1HA5A 2PE6B 2CU1A 2IGGA 2KFJA 2L83A 3K9PB 5BMIA 2J53A 4LLGM 2Q5WD 1JRPA 2OEDA 4GN1A 4IDIA 1IYFA 1XD3B 3N20C 4A6QA 1AW7A 4P1BC 1NI2A 2KANA 1JROA 2MJEA 3RNGC 2L52A 1T6BX 3CSFA 1TBEA 2V9HA 2NR2A 1I4QA 1WXVA 1IGCA 2XN9C 1D4BA 3MC0B 5G55A 1YIWA 4GDKB 1E7PB 1ZXHA 2Z0DB 2IY0B 1WMHB 2V0GA 4JWUC 3BIID 2MSED 3P42A 1E10A 4HROA 2QEJC 4LTUA 2KYWA 3ZYYX 2QILA 4IWQA 3VTVA 3PZ8A 3OAWA 4GSWA 3AU5A 2PIAA 1QOBA 3NS1A 1LFDA 2K1FA 3KH0A 1XLPA 2MEKA 2JZ3B 2DWQA 4D2KA 2YEPB 4F7ZA 2AQ3B 3DWGC 4LDTB 1HTOA 3NVWA 3AXCA 4P6VF 1YJJA 2WXNA 4PS7A 2M4NA 3Q8CA 3RZFA 4C4VB 1MI0A 3Q14C 2LMCA 2ZPYA 4RFBA 1KH0A 3P4QB 1N62A 2W3RA 5EDSA 2L3ZA 3VUYA 1I4GA 2LD9A 1AARA 2KVRA 3NUHB 4DQOC 1WXAA 1NVID 4EFOA 3GE8C 3AE1B 1IGDA 3RYTA 1WR6E 4AUQC 1GOZA 1WZ0A 1D6EC 3NOBA 1E7UA 5D7GA 4DXAB 3KYDD 4RF0A 4HKQA 4NJCA 1P1AA 2ICIA 4JGHB 1V5TA 3AEBB 2VRRB 4WWOA 2KTFA 1L2NA 1V1PB 2BGFA 1F0ZA 3AE7B 2MBHA 1NBFC 4C00A 1QQRA 1XQQA 2ZZPB 4AP4C 1OQQA 3Q8EA 2D3AA 1FFUA 1R4NB 2BKFA 4KSKC 1OEYA 3TIXA 3WANA 1E8XA 4IWPA 1FXIA 2MBQA 3UGBB 2JUOA 3X0WA 1XF5L 3DQVA 3R3MA 3DBHI 1L0VB 3P4SB 4CHKA 3W1SA 2DX5B 2N9EB 4DDGD 3RI7C 1SE4A 2PTLA 4NAMA 1VLBA 1FMAD 4GOCA 2A4ZA 1PYWD 3PGEA 2BYEA 2WXPA 1T0YA 4DHJD 3AEEB 5I4DA 2RMMA 3ML8A 1WF9A 2EELA 1N5XA 3QC8B 4IOIE 3PLUA 2KJ6A 4S0RA 1E5WA 1P0RA 3KQ4A 2WQYB 1CQVA 3AH7A 3RN9C 3EGRA 2C7MB 1HQRD 2IO0B 1WI0A 1IPGA 3Q6BA 4WWMA 4JPSA 2NVUI 1N63A 3BK1A 1XLNA 1Q10A 5BYRA 3BWUD 4WJPA 4OVZA 5G2NA 3RNAC 3EHVA 4RM9A 4RGNA 2L76A 2RDGA 4ZRIA 1ET6A 4K7WA 3ZLZA 1I4XA 1P7EA 4JL9A 1P9DU 2K22A 3ZO5B 4HXDA 1VJKA 1UNSA 3M95A 2N9XA 3GS2A 2RPQA 3JYUA 4ZHPA 2WWZA 3U7ZA 1I4RA 2JF5A 2JRIB 3HVZA 5JZEB 1ACCA 4PYUA 4GXBA 1ZGUB 2IGDA 4BZAA 1ZW7A 2K5PA 4WWPA 4W9EA 2FUHB 5L83A 2M17A 3OG5A 2JZPA 2D3GA 2DNFA 4FJVB 4OVUA 5LXIB 3QK0A 5MPOA 3T3OA 1WGHA 2XNAC 3PLVA 3W2DA 1HEZE 2MBEA 4M02A 2OJRA 1MHXA 5C2TB 3UIPB 4ZYNA 4C7YA 5AUIA 1YD8U 2KXJA 2LWPA 3EECA 3ECIA 2M0AA 4REZA 2J4XA 4A90A 1D5XC 3UINB 2GBMA 4G50A 2KOXA 3PREA 1V49A 5EE9A 4DHZE 3JSVA 1D5ZC 4B6WA 1TTNA 2HDEA 1SF0A 3B2FA 3UIOB 2OHFA 5LLIA 3SR6A 1FPYA 2XK5A 4WAFA 1XCTL 1ZOYB 2MA9B 1FXTB 2KWDA 1RLFA 4BFRA 2FIFA 4KKIA 1T0QC 2E6XA 4KVGB 3L17A 2V3PA 3MFGA 2MRPA 4FULA 4M01A 2AX5A 4W9JA 4JIOU 2MHJA 4NAWB 4BVUC 2WLBA 3R8BA 4UDUC 2UU7A 1HTQA 2LUEA 4R3DA 2WS3B 4HRSA 3CMMB 2CJOA 3W9CB 1G6JA 3QJZA 1CZPA 2KACA 2L0FA 2R61A 4BAXA 1TYGB 3H8HA 3ZIMA 1L6VA 3E56A 2WXQA 2XBBC 1WGKA 4IM3A 2GI9A 1C3TA 2JU6X 2JWUA 4DXGA 3OJ4B 1Q5WB 4ZRPA 1Z5SB 4ZRKA 2GBNA 1C79A 3J9CA 3RMKC 3IFWB 1J0GA 2K3UA 2NBUA 1PFDA 1LM8B 1BMLC 2WXLA 1J7BA 3H9DA 3L10B 4C7ZA 2G45B 4IUMB 4LDTD 3VUXA 2MQJA 3IVFA 3U30A 3AEFB 2O2VA 2PPHA 2KLCA 4NPNA 3V6EB 4II2B 2LVQA 1KF6B 5E6NA 1WJNA 1C4AA 3CIRB 2DZIA 2ZW1A 1SIJA 3ZGZA 4FHKA 2DYBA 3H1UA 4K7UA 1PGAA 2BB6A 2WDRB 4BKSD 3TSSA 5EE0A 2I38A 3R7QA 2L1AA 4DHJB 1ESFA 2G3QB 3EFCA 4A3PA 4B0MA 4GB9A 2OOBB 4YL8A 4MJSA 4XZ4A 4ANUA 2PLPA 2MBBB 1YOVB 1UGMA 2NTSA 4I6LB 2Y5CA 1RM6C 4EUTA 4X57B 4ICUA 1EU4A 2DZJA 4LNKA 1CJEA 4GMVA 1FD6A 2KX0A 4NY0A 2INCC 2KD0A 4GU2A 4G0NB 1P98A 4AS1A 3I63C 2M56B 5IP4D 1P7FA 3NG0A 2KQSA 2W55A 1V81A 3QAQA 3QWZB 2V4IB 1ISNA 1XLOA 3ZKJC 4OZAA 1L7YA 1WRIA 1ZE3D 3Q2AC 1K52A 1V80A 4OZCA 3HK0A 4MT5A 4AOFA 1JWBD 2NBWB 2CR5A 1UWMA 5JHBA 2V1YA 4HCNB 1SB3C 4W9KA 4TV3A 1J19A 3B0AA 3V05A 4LJOB 3TUOA 4RGOS 2VH2A 2KQ7A 4WAAA 5JH5C 2WDTB 1F9JA 1DOYA 1STEA 5DCNA 4GIVA 3DBLB 5G5GA 3KUCB 3ZTDA 1YQ4B 2KJRA 2KDFB 2KX3A 4ICVA 3NS8A 3NVVA 1IP9A 3N30A 2JQRB 2N7JA 4WH4A 3EC8A 4B95A 5BYSA 4OHJA 4EEWA 5IAAC
chains in the Genus database with same CATH topology
2LD9A 4BOSC 1AARA 4PS3A 1M94A 3KW5B 2KVRA 1WXAA 4EFOA 3GOEA 2DYMA 2MBOA 1QZEA 4MEMA 2IYDB 3ZTCA 3VH4B 3N3KB 4IM2A 3RYTA 2K8CA 1WR6E 3PPAA 4AUQC 1GNUA 1H4RA 2O6VA 2XEWA 3DVGX 1WZ0A 3ZUNA 3NOBA 1EUVB 3BY4B 4TUUA 1E7UA 1WXSA 5D7GA 3W1SC 3ZDMC 2FCQA 4DXAB 3KYDD 2JPHA 2BPSA 2N4FA 1P1AA 2CHZA 2FAZA 1V5TA 3APCA 4JGHB 2VRRB 1E8YA 3ENEA 2ZEQA 2KTRB 3PZDA 2C9WB 4WJNA 4WWOA 2K8HA 4W9LA 2KWCA 2KTFA 3T8MA 1L2NA 2FCNA 1ZKHA 2CHWA 3QCAA 4W9GA 3ZVVA 1V9JA 3APDA 3T9LA 5LXHA 2IO1B 4B9KA 4DK5A 4EOYA 1TGZB 3DVNU 4A20A 1JRUA 2BGFA 2KWVB 3NZUA 5L95C 2N1WA 2KK8A 2MBHA 1X1MA 1NBFC 2ZVOA 2ZCBA 2IY1B 1XQQA 2ZZPB 3U7DA 4AP4C 4N9F4 2EMSA 1GC7A 2JY6A 3EFUA 2FNJB 2Y5BB 4KV2A 4MGIE 2CHXA 2NPTA 2KNBA 3PRZA 1E7VA 3OLMD 3ZW3A 4DHZB 4BKSA 2IBIB 1WGRA 3LJ3A 1WJ4A 2BKFA 3C0RB 2R2QA 3DPDA 3GZNI 4KSKC 1HE8A 5AZHA 1OEYA 3TIXA 2WYQA 1Z2MA 4FJYA 3WANA 4ASWC 1E8XA 2RD0A 4IWPA 3DBLI 2DZKA 1VCBA 2MBQA 3UGBB 3VFKA 2KO3A 4J6IA 2JUOA 3X0WA 1Y8RC 1GJZA 5CHFA 5AEKB 3DQVA 3I3TB 3R3MA 4WQOB 3IHPC 5C23A 3DBHI 3R7RA 2D10A 2AL6A 5E6OA 2I1JA 4BKGA 4CHKA 2KMAA 4XX5A 1EO6A 2DX5B 2N9EB 3W1SA 4DDGD 4I6NB 2KTRA 4GGQA 2A5UA 1YQBA 1UELA 3P2BA 2EMTA 4DWFA 1YX6B 1WX9A 4GOCA 2A4ZA 1P3QU 3QHTA 3PGEA 4MM3A 3VTUA 2BYEA 3NHEB 2C5LC 2LRUA 1T0YA 1BT0A 4M0WB 4DHJD 2JZZA 2MP2B 1WX8A 2JT4B 3ML8A 4K81A 1WF9A 3TJPA 5CX3A 3QC8B 4ZRJA 2HTHA 3HIZA 2LJ5A 4JQWC 3ONSA 3VHTC 3V61A 3PLUA 4EZLA 3AI5A 2KJ6A 2ZPNA 3PT2B 3B1LX 1E5WA 4W9CA 1P0RA 3VAWA 2HD5B 1WJ6A 4HPLB 2J0KA 5CHWA 2RR9A 2C7MB 2IO0B 1WI0A 2D07B 2DENB 2Z59B 1IPGA 1XT9B 3ZRFA 2RSUA 2NVUI 3ML9A 4E3CA 5D94A 1GG3A 1WE6A 3CF6E 2L05A 3S2AA 5IA7A 2D11A 4FBJB 4WJPA 5G2NA 3SHQA 4BBNF 4TQ0A 4KZCA 3EHVA 4RM9A 2L76A 2DAFA 3NY5A 3NZSA 4EKUA 3Q3FA 2ZNVB 4ZRIA 2LXCA 4K7WA 3HHMA 3ZLZA 4JL9A 2KDBA 1H8CA 1P9DU 1WFYA 2WX1A 2KWUB 3ZO5B 4ANWA 3MHSD 4HXDA 4NQLB 3M95A 1UD7A 4M8NA 2N9XA 4M8MA 1EF1A 1U4AA 2KDIA 2C7NB 2RPQA 1Q1OA 2J0JA 2WWZA 3JYUA 4HPMB 3UQAA 2JF5A 1WXMA 2L8JA 2MP2A 4KZ0A 2WX0A 2JRIB 3JSVB 4MGYE 5JZEB 1I42A 4DBGA 4TQ1A 1RRBA 2AEHA 4GXBA 1R4NI 4PYUA 1GC6A 1WZ3A 1ZGUB 2O6VD 3QIJA 4FLHA 4I6PA 2MCNB 3VVWB 2G4DB 1ZW7A 1R4MI 3L08A 4WWPA 5DPTA 5E6PA 3U8ZA 4W9EA 2FUHB 2GBJA 3A4SC 5C1ZA 5L83A 2M17A 3SDLC 1LQBA 2R2OA 3BINA 2D3GA 3KVFB 4EZJA 4IG7B 4FJVB 2BWES 3IG3A 2JWZA 5KHQA 1EF5A 3N32A 4OVUA 5FR6A 5J18A 5LXIB 3QK0A 1SGHA 3L0WB 4HCPB 1WGHA 2BWFA 2HJ8A 1YX5B 3PLVA 3AULA 3A9KB 4E71A 1NDDA 2MBEA 3QARA 2OJRA 2ASQA 1RFAA 3ZNHB 4OVVA 3UIPB 2DAJA 4KIKA 3KUDB 4ZYNA 5GMVA 1V5OA 4F8CB 5J2RA 4TKNA 2AL3A 1YD8U 3QQ8B 4LCDE 2KXJA 2LWPA 1Q0WB 3ZNGC 3ZNZB 3EECA 3ECIA 4FN2A 3LDZE 2KMCA 2KFKB 4G11A 4KSLC 2N7EA 3UINB 2GBMA 4G50A 3VH3B 2L00B 1K8RB 2KOXA 1V49A 3PREA 1E8ZA 2FCSA 3L54A 4DHZE 2FIDA 3HM3A 3JSVA 4MSMB 4B6WA 3PSEB 3PV1A 1KLVA 1TTNA 3JVZX 2HE7A 5CTRC 2GOWA 3UIOB 2NBVB 1V86A 5LLIA 3VTWA 2BYFA 3L16A 2UWQA 3L13A 2MW5A 4NQKE 2W9NA 2XK5A 2N1VA 4RMAA 2B3AA 2MA9B 3SU8X 1FXTB 1RLFA 3DVGY 2V3SA 3PTFC 4BFRA 5HKHA 2FIFA 4E74A 3A9KA 3ZNID 1KJTA 4KVGB 2V4LA 3RD2A 3A9JA 4HJKA 2KHWB 3D32A 1WJUA 4FA6A 4BOZB 3L17A 1LXDA 1WIAA 3ZRCA 5AZGA 2UYZB 4IW0A 2BF8B 2K6DB 2MLBA 4NJ6A 3VXWA 2MRPA 4FULA 4HDOA 4II3B 2KFKA 1KOTA 2L0TA 2L7RA 4W9JA 4PS8A 2YLMA 4NJ7A 4JIOU 4WJQA 3PRPB 3V6CB 4NAWB 2KN5A 2NS5A 2RGFA 4AJWA 4BVUC 2LVOA 4W9DA 3Q3JA 3RULA 3DCGA 1KM7A 2PEAA 4P7IA 4FADA 1UBIA 4CYEA 2O2VB 1S1QB 2I1KA 2LUEA 3JW0X 3V62A 3CMMB 4URKA 4W9FA 1G6JA 4AWJA 2LGYA 3QJZA 4IWOA 5CHVC 4KIKB 2L0FA 2ZVNA 3ZIMA 4ZDVA 1V2YA 3H7PB 2XBBC 4IM3A 3QA8A 1C3TA 3PHWB 4HK2A 4ANXA 2JRHA 3WALA 1UZXB 3R66C 1OEYJ 3SD5A 5AZFA 3OJ4B 4WJOA 1YJ1A 3RUIB 1Q5WB 2KJHB 1OQYA 3VDZA 2M8SA 2IO3B 1RAXA 4RM8A 2REXA 1WRDB 4BKTA 1Z5SB 2YVCA 4HWIB 4ZRKA 3M62B 3VQIA 1SIFA 1MG8A 2GBNA 4MGKE 5J17A 4FHJA 2MX2A 4WWNA 1WE7A 2KDEB 2GBRA 3IFWB 3WAOA 2ZCCA 1J0GA 2LRWA 2NBUA 3UQBA 2KKCA 4MJSB 2M1MA 1WR1A 2FCMA 3PVLA 2CS4A 2K8BA 1LM8B 2K6QA 2BKRB 4NAWA 2XK5B 2EKEC 3H9DA 3L10B 4GDLB 3UF8A 2G45B 4IUMB 2KZRA 1SE9A 4LDTD 4MDKE 3VUXA 2MQJA 1TZ1A 3IVFA 3RT3B 2GBKA 3WA0A 3MJWA 3U30A 4KDIC 4W9HA 2KC1A 2PE9A 2O2VA 3RCZA 2PPHA 2KLCA 2GMIC 4NPNA 1OGWA 2Z0EB 1E8WA 3V6EB 2AYOB 3ZDTA 2BYVE 4II2B 2LVQA 4K7SA 3A9JB 3K9OB 5E6NA 2NCNA 3A1QB 4CO7A 1GUAB 2PJHA 2M0XA 1WJNA 3H7PA 3PRMB 4K1RB 2DZIA 3X23A 4FHKA 2DZMA 2DYBA 5KHOA 3DBSA 5D6JB 3DVNV 2K39A 3H1UA 2LVPA 4K7UA 2N9PC 4F1SA 3VUWA 4EZKA 1E90A 1WYWB 3APFA 3PS6A 3WAMA 3DOWA 1WX7A 4BKSD 1WGGA 1WGDA 3ALBA 3DBRI 3QX1A 2DYOA 1WH3A 2LI5A 4MGZE 1UH6A 3R7QA 5JHAA 2PE6B 2J0MA 3M63B 2CU1A 4DHJB 2KFJA 2G3QB 3PHXB 3K9PB 4A3PA 1UBQA 4IM0A 4GB9A 2OOBB 3H6NA 4YL8A 4MJSA 1WY8A 4XZ4A 4ANUA 4GN1A 2MBBB 2C60A 1IYFA 1XD3B 1UGMA 4I6LB 4GDLA 4MELA 2LXAA 4G3XB 4EUTA 4X57B 4ICUA 3CSTA 1NI2A 2DZJA 3H7SA 4IC7B 2KANA 4W9IA 2J7QB 3M3JA 3HM6X 4GMVA 2KX0A 4NY0A 4PYZA 3CSFA 1TBEA 3OJ3A 2NR2A 3A4RA 3A1QA 2N7DA 4JLCA 1WXVA 1CMXB 2LASA 1D3ZA 2KD0A 4GU2A 3TMPB 1PQSA 4G0NB 1P98A 2K25A 5G55A 1OTRB 3B08A 5BO4B 2KQSA 1YIWA 1V81A 3QAQA 3QWZB 4GDKB 3W1YA 4MH0E 1ISNA 1S3SG 2Z0DB 3KYCD 3ZKJC 2CKHB 2IY0B 2D2QA 2MWSB 1L7YA 1WMHB 2KC2A 1WGYA 1V80A 2IZVB 3HK0A 3MTNB 2C7HA 3WAPA 3DDCB 4LJPB 4AOFA 2AWTA 2NBWB 2CR5A 2JXXA 2MSED 2ZJDA 5JHBA 1I35A 2KLGA 2V1YA 4HCNB 4W9KA 4DDID 2O6VB 4IWQA 4TV3A 3VTVA 4BBNC 1J19A 3B0AA 4AJYB 2JVCA 3IBEA 2LGDA 3OAWA 4GSWA 4LJOB 1VD2A 3AU5A 4NNJB 4HVBA 1LFDA 2K1FA 3KH0A 4XC2A 4HDQA 2KQ7A 3V60A 4WAAA 2JZ3B 3TBLD 2WDTB 5JH5C 1F9JA 3RZWC 3WIMA 5DPSA 5DCNA 4GIVA 4F7ZA 2G4SA 4LDTB 2LZ6A 1WM3A 3KUCB 3AXCA 3ZTDA 1J8CA 4PS7A 2KJRA 2M4NA 4FJZA 2KDFB 4MSQB 3RZFA 2LGXA 3A33B 4KDLB 1V6EA 4A3OA 1WM2A 2ZNVC 2KX3A 2IO2B 4ICVA 2ZPYA 4ANVA 3NS8A 3AU4A 1IP9A 5D2MB 1A5RA 3O65B 4GDKA 2DHZA 4HLEA 2QHOA 5DPRA 1C1YB 3N30A 3KUZA 1WMHA 3EC8A 5EDSA 4B95A 2L3ZA 3TCAA 3VUYA 5TR5A 3TL5A 4EEWA 5DPWA 5IAAC 2NPTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LD9 A;  4BOS C;  1AAR A;  4PS3 A;  1M94 A;  3KW5 B;  2KVR A;  1WXA A;  4EFO A;  3GOE A;  2DYM A;  2MBO A;  1QZE A;  4MEM A;  2IYD B;  3ZTC A;  3VH4 B;  3N3K B;  4IM2 A;  3RYT A;  2K8C A;  1WR6 E;  3PPA A;  4AUQ C;  1GNU A;  1H4R A;  2O6V A;  2XEW A;  3DVG X;  1WZ0 A;  3ZUN A;  3NOB A;  1EUV B;  3BY4 B;  4TUU A;  1E7U A;  1WXS A;  5D7G A;  3W1S C;  3ZDM C;  2FCQ A;  4DXA B;  3KYD D;  2JPH A;  2BPS A;  2N4F A;  1P1A A;  2CHZ A;  2FAZ A;  1V5T A;  3APC A;  4JGH B;  2VRR B;  1E8Y A;  3ENE A;  2ZEQ A;  2KTR B;  3PZD A;  2C9W B;  4WJN A;  4WWO A;  2K8H A;  4W9L A;  2KWC A;  2KTF A;  3T8M A;  1L2N A;  2FCN A;  1ZKH A;  2CHW A;  3QCA A;  4W9G A;  3ZVV A;  1V9J A;  3APD A;  3T9L A;  5LXH A;  2IO1 B;  4B9K A;  4DK5 A;  4EOY A;  1TGZ B;  3DVN U;  4A20 A;  1JRU A;  2BGF A;  2KWV B;  3NZU A;  5L95 C;  2N1W A;  2KK8 A;  2MBH A;  1X1M A;  1NBF C;  2ZVO A;  2ZCB A;  2IY1 B;  1XQQ A;  2ZZP B;  3U7D A;  4AP4 C;  4N9F 4;  2EMS A;  1GC7 A;  2JY6 A;  3EFU A;  2FNJ B;  2Y5B B;  4KV2 A;  4MGI E;  2CHX A;  2NPT A;  2KNB A;  3PRZ A;  1E7V A;  3OLM D;  3ZW3 A;  4DHZ B;  4BKS A;  2IBI B;  1WGR A;  3LJ3 A;  1WJ4 A;  2BKF A;  3C0R B;  2R2Q A;  3DPD A;  3GZN I;  4KSK C;  1HE8 A;  5AZH A;  1OEY A;  3TIX A;  2WYQ A;  1Z2M A;  4FJY A;  3WAN A;  4ASW C;  1E8X A;  2RD0 A;  4IWP A;  3DBL I;  2DZK A;  1VCB A;  2MBQ A;  3UGB B;  3VFK A;  2KO3 A;  4J6I A;  2JUO A;  3X0W A;  1Y8R C;  1GJZ A;  5CHF A;  5AEK B;  3DQV A;  3I3T B;  3R3M A;  4WQO B;  3IHP C;  5C23 A;  3DBH I;  3R7R A;  2D10 A;  2AL6 A;  5E6O A;  2I1J A;  4BKG A;  4CHK A;  2KMA A;  4XX5 A;  1EO6 A;  2DX5 B;  2N9E B;  3W1S A;  4DDG D;  4I6N B;  2KTR A;  4GGQ A;  2A5U A;  1YQB A;  1UEL A;  3P2B A;  2EMT A;  4DWF A;  1YX6 B;  1WX9 A;  4GOC A;  2A4Z A;  1P3Q U;  3QHT A;  3PGE A;  4MM3 A;  3VTU A;  2BYE A;  3NHE B;  2C5L C;  2LRU A;  1T0Y A;  1BT0 A;  4M0W B;  4DHJ D;  2JZZ A;  2MP2 B;  1WX8 A;  2JT4 B;  3ML8 A;  4K81 A;  1WF9 A;  3TJP A;  5CX3 A;  3QC8 B;  4ZRJ A;  2HTH A;  3HIZ A;  2LJ5 A;  4JQW C;  3ONS A;  3VHT C;  3V61 A;  3PLU A;  4EZL A;  3AI5 A;  2KJ6 A;  2ZPN A;  3PT2 B;  3B1L X;  1E5W A;  4W9C A;  1P0R A;  3VAW A;  2HD5 B;  1WJ6 A;  4HPL B;  2J0K A;  5CHW A;  2RR9 A;  2C7M B;  2IO0 B;  1WI0 A;  2D07 B;  2DEN B;  2Z59 B;  1IPG A;  1XT9 B;  3ZRF A;  2RSU A;  2NVU I;  3ML9 A;  4E3C A;  5D94 A;  1GG3 A;  1WE6 A;  3CF6 E;  2L05 A;  3S2A A;  5IA7 A;  2D11 A;  4FBJ B;  4WJP A;  5G2N A;  3SHQ A;  4BBN F;  4TQ0 A;  4KZC A;  3EHV A;  4RM9 A;  2L76 A;  2DAF A;  3NY5 A;  3NZS A;  4EKU A;  3Q3F A;  2ZNV B;  4ZRI A;  2LXC A;  4K7W A;  3HHM A;  3ZLZ A;  4JL9 A;  2KDB A;  1H8C A;  1P9D U;  1WFY A;  2WX1 A;  2KWU B;  3ZO5 B;  4ANW A;  3MHS D;  4HXD A;  4NQL B;  3M95 A;  1UD7 A;  4M8N A;  2N9X A;  4M8M A;  1EF1 A;  1U4A A;  2KDI A;  2C7N B;  2RPQ A;  1Q1O A;  2J0J A;  2WWZ A;  3JYU A;  4HPM B;  3UQA A;  2JF5 A;  1WXM A;  2L8J A;  2MP2 A;  4KZ0 A;  2WX0 A;  2JRI B;  3JSV B;  4MGY E;  5JZE B;  1I42 A;  4DBG A;  4TQ1 A;  1RRB A;  2AEH A;  4GXB A;  1R4N I;  4PYU A;  1GC6 A;  1WZ3 A;  1ZGU B;  2O6V D;  3QIJ A;  4FLH A;  4I6P A;  2MCN B;  3VVW B;  2G4D B;  1ZW7 A;  1R4M I;  3L08 A;  4WWP A;  5DPT A;  5E6P A;  3U8Z A;  4W9E A;  2FUH B;  2GBJ A;  3A4S C;  5C1Z A;  5L83 A;  2M17 A;  3SDL C;  1LQB A;  2R2O A;  3BIN A;  2D3G A;  3KVF B;  4EZJ A;  4IG7 B;  4FJV B;  2BWE S;  3IG3 A;  2JWZ A;  5KHQ A;  1EF5 A;  3N32 A;  4OVU A;  5FR6 A;  5J18 A;  5LXI B;  3QK0 A;  1SGH A;  3L0W B;  4HCP B;  1WGH A;  2BWF A;  2HJ8 A;  1YX5 B;  3PLV A;  3AUL A;  3A9K B;  4E71 A;  1NDD A;  2MBE A;  3QAR A;  2OJR A;  2ASQ A;  1RFA A;  3ZNH B;  4OVV A;  3UIP B;  2DAJ A;  4KIK A;  3KUD B;  4ZYN A;  5GMV A;  1V5O A;  4F8C B;  5J2R A;  4TKN A;  2AL3 A;  1YD8 U;  3QQ8 B;  4LCD E;  2KXJ A;  2LWP A;  1Q0W B;  3ZNG C;  3ZNZ B;  3EEC A;  3ECI A;  4FN2 A;  3LDZ E;  2KMC A;  2KFK B;  4G11 A;  4KSL C;  2N7E A;  3UIN B;  2GBM A;  4G50 A;  3VH3 B;  2L00 B;  1K8R B;  2KOX A;  1V49 A;  3PRE A;  1E8Z A;  2FCS A;  3L54 A;  4DHZ E;  2FID A;  3HM3 A;  3JSV A;  4MSM B;  4B6W A;  3PSE B;  3PV1 A;  1KLV A;  1TTN A;  3JVZ X;  2HE7 A;  5CTR C;  2GOW A;  3UIO B;  2NBV B;  1V86 A;  5LLI A;  3VTW A;  2BYF A;  3L16 A;  2UWQ A;  3L13 A;  2MW5 A;  4NQK E;  2W9N A;  2XK5 A;  2N1V A;  4RMA A;  2B3A A;  2MA9 B;  3SU8 X;  1FXT B;  1RLF A;  3DVG Y;  2V3S A;  3PTF C;  4BFR A;  5HKH A;  2FIF A;  4E74 A;  3A9K A;  3ZNI D;  1KJT A;  4KVG B;  2V4L A;  3RD2 A;  3A9J A;  4HJK A;  2KHW B;  3D32 A;  1WJU A;  4FA6 A;  4BOZ B;  3L17 A;  1LXD A;  1WIA A;  3ZRC A;  5AZG A;  2UYZ B;  4IW0 A;  2BF8 B;  2K6D B;  2MLB A;  4NJ6 A;  3VXW A;  2MRP A;  4FUL A;  4HDO A;  4II3 B;  2KFK A;  1KOT A;  2L0T A;  2L7R A;  4W9J A;  4PS8 A;  2YLM A;  4NJ7 A;  4JIO U;  4WJQ A;  3PRP B;  3V6C B;  4NAW B;  2KN5 A;  2NS5 A;  2RGF A;  4AJW A;  4BVU C;  2LVO A;  4W9D A;  3Q3J A;  3RUL A;  3DCG A;  1KM7 A;  2PEA A;  4P7I A;  4FAD A;  1UBI A;  4CYE A;  2O2V B;  1S1Q B;  2I1K A;  2LUE A;  3JW0 X;  3V62 A;  3CMM B;  4URK A;  4W9F A;  1G6J A;  4AWJ A;  2LGY A;  3QJZ A;  4IWO A;  5CHV C;  4KIK B;  2L0F A;  2ZVN A;  3ZIM A;  4ZDV A;  1V2Y A;  3H7P B;  2XBB C;  4IM3 A;  3QA8 A;  1C3T A;  3PHW B;  4HK2 A;  4ANX A;  2JRH A;  3WAL A;  1UZX B;  3R66 C;  1OEY J;  3SD5 A;  5AZF A;  3OJ4 B;  4WJO A;  1YJ1 A;  3RUI B;  1Q5W B;  2KJH B;  1OQY A;  3VDZ A;  2M8S A;  2IO3 B;  1RAX A;  4RM8 A;  2REX A;  1WRD B;  4BKT A;  1Z5S B;  2YVC A;  4HWI B;  4ZRK A;  3M62 B;  3VQI A;  1SIF A;  1MG8 A;  2GBN A;  4MGK E;  5J17 A;  4FHJ A;  2MX2 A;  4WWN A;  1WE7 A;  2KDE B;  2GBR A;  3IFW B;  3WAO A;  2ZCC A;  1J0G A;  2LRW A;  2NBU A;  3UQB A;  2KKC A;  4MJS B;  2M1M A;  1WR1 A;  2FCM A;  3PVL A;  2CS4 A;  2K8B A;  1LM8 B;  2K6Q A;  2BKR B;  4NAW A;  2XK5 B;  2EKE C;  3H9D A;  3L10 B;  4GDL B;  3UF8 A;  2G45 B;  4IUM B;  2KZR A;  1SE9 A;  4LDT D;  4MDK E;  3VUX A;  2MQJ A;  1TZ1 A;  3IVF A;  3RT3 B;  2GBK A;  3WA0 A;  3MJW A;  3U30 A;  4KDI C;  4W9H A;  2KC1 A;  2PE9 A;  2O2V A;  3RCZ A;  2PPH A;  2KLC A;  2GMI C;  4NPN A;  1OGW A;  2Z0E B;  1E8W A;  3V6E B;  2AYO B;  3ZDT A;  2BYV E;  4II2 B;  2LVQ A;  4K7S A;  3A9J B;  3K9O B;  5E6N A;  2NCN A;  3A1Q B;  4CO7 A;  1GUA B;  2PJH A;  2M0X A;  1WJN A;  3H7P A;  3PRM B;  4K1R B;  2DZI A;  3X23 A;  4FHK A;  2DZM A;  2DYB A;  5KHO A;  3DBS A;  5D6J B;  3DVN V;  2K39 A;  3H1U A;  2LVP A;  4K7U A;  2N9P C;  4F1S A;  3VUW A;  4EZK A;  1E90 A;  1WYW B;  3APF A;  3PS6 A;  3WAM A;  3DOW A;  1WX7 A;  4BKS D;  1WGG A;  1WGD A;  3ALB A;  3DBR I;  3QX1 A;  2DYO A;  1WH3 A;  2LI5 A;  4MGZ E;  1UH6 A;  3R7Q A;  5JHA A;  2PE6 B;  2J0M A;  3M63 B;  2CU1 A;  4DHJ B;  2KFJ A;  2G3Q B;  3PHX B;  3K9P B;  4A3P A;  1UBQ A;  4IM0 A;  4GB9 A;  2OOB B;  3H6N A;  4YL8 A;  4MJS A;  1WY8 A;  4XZ4 A;  4ANU A;  4GN1 A;  2MBB B;  2C60 A;  1IYF A;  1XD3 B;  1UGM A;  4I6L B;  4GDL A;  4MEL A;  2LXA A;  4G3X B;  4EUT A;  4X57 B;  4ICU A;  3CST A;  1NI2 A;  2DZJ A;  3H7S A;  4IC7 B;  2KAN A;  4W9I A;  2J7Q B;  3M3J A;  3HM6 X;  4GMV A;  2KX0 A;  4NY0 A;  4PYZ A;  3CSF A;  1TBE A;  3OJ3 A;  2NR2 A;  3A4R A;  3A1Q A;  2N7D A;  4JLC A;  1WXV A;  1CMX B;  2LAS A;  1D3Z A;  2KD0 A;  4GU2 A;  3TMP B;  1PQS A;  4G0N B;  1P98 A;  2K25 A;  5G55 A;  1OTR B;  3B08 A;  5BO4 B;  2KQS A;  1YIW A;  1V81 A;  3QAQ A;  3QWZ B;  4GDK B;  3W1Y A;  4MH0 E;  1ISN A;  1S3S G;  2Z0D B;  3KYC D;  3ZKJ C;  2CKH B;  2IY0 B;  2D2Q A;  2MWS B;  1L7Y A;  1WMH B;  2KC2 A;  1WGY A;  1V80 A;  2IZV B;  3HK0 A;  3MTN B;  2C7H A;  3WAP A;  3DDC B;  4LJP B;  4AOF A;  2AWT A;  2NBW B;  2CR5 A;  2JXX A;  2MSE D;  2ZJD A;  5JHB A;  1I35 A;  2KLG A;  2V1Y A;  4HCN B;  4W9K A;  4DDI D;  2O6V B;  4IWQ A;  4TV3 A;  3VTV A;  4BBN C;  1J19 A;  3B0A A;  4AJY B;  2JVC A;  3IBE A;  2LGD A;  3OAW A;  4GSW A;  4LJO B;  1VD2 A;  3AU5 A;  4NNJ B;  4HVB A;  1LFD A;  2K1F A;  3KH0 A;  4XC2 A;  4HDQ A;  2KQ7 A;  3V60 A;  4WAA A;  2JZ3 B;  3TBL D;  2WDT B;  5JH5 C;  1F9J A;  3RZW C;  3WIM A;  5DPS A;  5DCN A;  4GIV A;  4F7Z A;  2G4S A;  4LDT B;  2LZ6 A;  1WM3 A;  3KUC B;  3AXC A;  3ZTD A;  1J8C A;  4PS7 A;  2KJR A;  2M4N A;  4FJZ A;  2KDF B;  4MSQ B;  3RZF A;  2LGX A;  3A33 B;  4KDL B;  1V6E A;  4A3O A;  1WM2 A;  2ZNV C;  2KX3 A;  2IO2 B;  4ICV A;  2ZPY A;  4ANV A;  3NS8 A;  3AU4 A;  1IP9 A;  5D2M B;  1A5R A;  3O65 B;  4GDK A;  2DHZ A;  4HLE A;  2QHO A;  5DPR A;  1C1Y B;  3N30 A;  3KUZ A;  1WMH A;  3EC8 A;  5EDS A;  4B95 A;  2L3Z A;  3TCA A;  3VUY A;  5TR5 A;  3TL5 A;  4EEW A;  5DPW A;  5IAA C;  2NPT B; 
#chains in the Genus database with same CATH topology
 2INN E;  4YSZ B;  3Q3N C;  3GOE A;  2DYM A;  4JE3 B;  2WXG A;  1QZE A;  4MEM A;  2IYD B;  3CWI A;  2K8C A;  3PPA A;  2J52 A;  1H4R A;  2KMM A;  3C8Y A;  3ZUN A;  2DLB A;  3W5V B;  4TUU A;  2WXR A;  2LUM A;  1E8Y A;  3ENE A;  2ZEQ A;  3PZD A;  4K3B A;  2C9W B;  2KWC A;  3AED B;  2FCN A;  1ZKH A;  4W9G A;  3ZVV A;  1V9J A;  1XO3 A;  3TEW A;  5HG2 A;  2RPV A;  5LXH A;  2IO1 B;  4DK5 A;  4YWG G;  4EOY A;  3DVN U;  4A20 A;  2KWV B;  2IY1 B;  4N6E B;  2EMS A;  2Y5B B;  1I4P A;  2GRI A;  2IBI B;  1WGR A;  2X38 A;  3C0R B;  3GZN I;  1TKY A;  1Z2M A;  4ASW C;  2W54 A;  3IT4 B;  4J6I A;  3VRA B;  2WU2 B;  1DYQ A;  1GJZ A;  4Q2J A;  2D10 A;  5H92 C;  3VR8 B;  3P4P B;  2A5U A;  3ZQ4 A;  1TIF A;  1YQB A;  4DWF A;  2PMV A;  3VTU A;  1KFY B;  1WX8 A;  2JT4 B;  4K81 A;  3TJP A;  4ZRJ A;  2HTH A;  2N9K A;  5FR3 A;  2KAJ A;  5D3D A;  3B1L X;  4W9C A;  4YT0 B;  4H2A A;  2HD5 B;  3NJT A;  4HPL B;  2J0K A;  5CHW A;  1L0Y B;  1GAQ B;  1XCQ L;  2D07 B;  2DEN B;  3NZ3 A;  1WXQ A;  2QSD A;  3ML9 A;  4E3C A;  1WE6 A;  3E9S A;  5IA7 A;  5IKC M;  2D11 A;  4FBJ B;  4OZB A;  3SHQ A;  4TQ0 A;  4KZC A;  2BS3 B;  3AE8 B;  4LNI A;  3Q3F A;  2ZNV B;  2LXC A;  3HHM A;  5FK9 C;  1H8C A;  1WFY A;  2KWU B;  4NQL B;  4M8M A;  1UD7 A;  4JWS C;  2KDI A;  1GB1 A;  3KLS X;  1WXM A;  2WX0 A;  3JSV B;  4LK0 M;  5JXV A;  4XGA B;  4DBG A;  4P16 A;  1RRB A;  2PW9 A;  1GC6 A;  2G4D B;  1XXG A;  1R4M I;  3L08 A;  3R2T A;  2BVC A;  1V1O A;  5C1Z A;  3A4S C;  1J7A A;  5HI1 A;  3ZXV A;  2R2O A;  3BIN A;  1RWS A;  4MH8 A;  2BWE S;  1N6Z A;  3N32 A;  5FR6 A;  5J18 A;  3EA6 A;  4XWT A;  3R2I A;  1SGH A;  3L0W B;  4HCP B;  1NI3 A;  2B76 B;  2HJ8 A;  3AB5 A;  3KWV A;  3AUL A;  1VR9 A;  2AQ2 B;  4E71 A;  4MM3 B;  3QAR A;  2BW2 A;  1RFA A;  3ZNH B;  2QCZ A;  4KIK A;  2MJD A;  3KUD B;  5GMV A;  1V5O A;  3I9V 1;  4TKN A;  2AL3 A;  3QQ8 B;  3ZNZ B;  4FN2 A;  4WIP A;  1FRD A;  4QAY A;  1K51 A;  1YJI A;  2WHI A;  1K8R B;  1QKZ A;  1C76 A;  5G5H A;  1N60 A;  3P1M A;  3HM3 A;  1MG4 A;  1CK1 A;  3U4E G;  1YN5 A;  5CTR C;  2GOW A;  1V86 A;  3IAS 1;  2UWQ A;  2MW5 A;  3ABV B;  3DVG Y;  3C19 A;  1TKE A;  2ONQ A;  3A9K A;  1KJT A;  2V4L A;  3IT6 B;  3PZ7 A;  3A9J A;  3D32 A;  4FA6 A;  3DHG C;  4IW0 A;  2BF8 B;  2K6D B;  4XE0 A;  2KFK A;  2L7R A;  2BS4 B;  1VDV A;  4NJ7 A;  2KN5 A;  1TKG A;  4W9D A;  3RUL A;  1L6U A;  3RNC C;  2PEA A;  2IND C;  2SEB D;  4FAD A;  1T5X D;  4CYE A;  2O2V B;  3JW0 X;  4IWO A;  4A8X C;  1TJE A;  4ZDV A;  1SJE D;  1SXT A;  4HK2 A;  4ANX A;  2PKO A;  1UZX B;  4C56 C;  2HJ1 A;  3FC4 A;  2W82 A;  4WJO A;  3VDZ A;  2M8S A;  2IO3 B;  4L2Y A;  2REX A;  3AE3 B;  3U52 E;  3FKY A;  1FFV A;  3M62 B;  4LNO A;  1MG8 A;  4MGK E;  4FHJ A;  2MX2 A;  1WE7 A;  2IPK D;  4XDC A;  2ZCC A;  1PDX A;  2KKC A;  4MJS B;  2H89 B;  3RNF C;  3PVL A;  2CS4 A;  3HRD D;  2K6Q A;  1OFF A;  2EKE C;  1D5M C;  3UF8 A;  4DXF A;  1TZ1 A;  3WA0 A;  3RT3 B;  3LXF A;  4KDI C;  3FAH A;  2Z0E B;  3ZDT A;  4K7S A;  3K9O B;  2NCN A;  2M0X A;  3B9J A;  1GB4 A;  3RPF C;  3AEA B;  3DVN V;  2HTM E;  1E90 A;  1WYW B;  2RDB C;  5BYQ A;  1WX7 A;  1WGD A;  3ALB A;  3DBR I;  2DYO A;  1UF0 A;  3PHX B;  2KDM A;  3ZJV A;  1UBQ A;  1B9R A;  4IM0 A;  3H6N A;  1M4V A;  5T8I A;  2C60 A;  4IKG A;  2KT7 A;  1QOA A;  1SE2 A;  4GDL A;  3VR9 B;  2LXA A;  1N5W A;  4G3X B;  3CST A;  3LYY A;  4IC7 B;  4W9I A;  2J7Q B;  3M3J A;  3HM6 X;  1JQ4 A;  5IOI A;  3A1Q A;  2N7D A;  4JLC A;  2K25 A;  1OTR B;  1I4H A;  4MH0 E;  2CKH B;  4HKZ E;  1WGY A;  2IZV B;  3WAP A;  1V1P A;  3DDC B;  4LJP B;  4B0E A;  1YNT E;  2KVZ A;  2TSS A;  1I35 A;  2KLG A;  3PO0 A;  3URY A;  4PT5 A;  4HVB A;  2CU3 A;  4WQM A;  3T3N A;  4RH6 A;  4N59 A;  3V60 A;  3TBL D;  2GLS A;  4KGR A;  5DPS A;  3P63 A;  2NMQ A;  3RNB C;  1WM3 A;  3IAM 1;  2Y3A A;  1FNU A;  3AM9 A;  1ZPS A;  4FJZ A;  3FIL A;  2LGX A;  3A33 B;  3DBH B;  4KDL B;  1V6E A;  1WM2 A;  2H88 B;  2ZNV C;  2IO2 B;  1EWC A;  3MHZ A;  4ANV A;  3AU4 A;  5D2M B;  1A5R A;  3BVZ A;  3O65 B;  2DHZ A;  1SEB D;  3Q8A A;  2QHO A;  5DPR A;  3KUZ A;  4US9 A;  4KKJ A;  3TCA A;  4M00 A;  5DPW A;  1DOX A;  4BOS C;  5AUK A;  1M94 A;  3KW5 B;  2PVO D;  4AQ7 A;  2MBO A;  2FE8 A;  3ZTC A;  3N3K B;  4IM2 A;  1FNV A;  2O6V A;  1KTK A;  3DVG X;  1L4Z B;  3GB1 A;  4GLS C;  1UGJ A;  3BY4 B;  3Q3O C;  1WXS A;  2QIE B;  3O13 A;  3ZDM C;  1XLQ A;  2CHZ A;  3APC A;  4FXC A;  1MJD A;  1E0Z A;  4WJN A;  3T8M A;  1VRA B;  2CHW A;  1LO5 D;  2WGS A;  3T9L A;  1TGZ B;  1SE3 A;  1QF6 A;  1X1M A;  2ZCB A;  1QOF A;  3U7D A;  1BXT A;  1GC7 A;  2FNJ B;  4KV2 A;  2CHX A;  2NPT A;  2KNB A;  1E7V A;  3I5J C;  3OLM D;  3ZW3 A;  4DHZ B;  1F52 A;  3LJ3 A;  1WJ4 A;  3V3X A;  1JW9 D;  2R2Q A;  3DPD A;  5LNK 1;  5AZH A;  2WU5 B;  2WYQ A;  2FBW B;  2ACZ B;  2G1E A;  3VFK A;  5GXG B;  1Y8R C;  5CHF A;  3KWL A;  3I3T B;  3IHP C;  2AL6 A;  1E6E B;  2I1J A;  4XX5 A;  1EO6 A;  2CJN A;  2KTR A;  5C3J B;  3ZXR A;  1FNW A;  2D3B A;  5BMG A;  5E6J A;  1YX6 B;  1WX9 A;  1K53 A;  1KRH A;  3QHT A;  3NHE B;  2C5L C;  1BT0 A;  5CX3 A;  1AN8 A;  3TEX A;  3B2G A;  3HIZ A;  2LJ5 A;  4JQW C;  4N58 A;  3VHT C;  3PT2 B;  2ZPN A;  4HEA 1;  2VZK D;  4HJG E;  1T0S C;  5HHD G;  2LJI A;  3NVY A;  2Z59 B;  1FEH A;  1PGB A;  1XT9 B;  3ZRF A;  2RSU A;  4ZHO A;  4L23 A;  4NZL B;  1GG3 A;  3HVD A;  3AMZ A;  2DAF A;  3NY5 A;  3NZS A;  2WXO A;  2EKI A;  5IN7 A;  2YEP F;  4RF1 A;  1L5P A;  1RFK A;  2KDB A;  2WX1 A;  1Y56 A;  4ANW A;  3MHS D;  4LNN A;  1EF1 A;  1U4A A;  1HZ5 A;  4HPM B;  4M0W A;  2L8J A;  3ZJT A;  2MP2 A;  1I42 A;  2AEH A;  4TSS A;  1R4N I;  2O6V D;  3VVW B;  4KGT A;  3BZD B;  4I6P A;  2MCN B;  5E6P A;  5DPT A;  2BS2 B;  3TEY A;  2D3C A;  3SDL C;  4TMA B;  4EZJ A;  4IG7 B;  3AV8 A;  3N1Y C;  5KHQ A;  1EF5 A;  3SFE B;  1QOG A;  1I7H A;  2BWF A;  3A9K B;  3Q8F A;  1NDD A;  1K50 A;  4OVV A;  2DAJ A;  2LHE A;  3BYY B;  5J2R A;  4OW0 A;  4LCD E;  3ZNG C;  3AE6 B;  1IBX A;  3LDZ E;  2KMC A;  2IDY A;  1C77 A;  1ZDX A;  2KFK B;  4MAC A;  5H8Y E;  4KSL C;  2Z8L A;  3VH3 B;  3L54 A;  3PV1 A;  4XWW A;  1KLV A;  3JVZ X;  1EWY C;  2HE7 A;  1KLU D;  5D3I B;  2NBV B;  1JWU D;  2BYF A;  3L16 A;  3L13 A;  4NQK E;  2W9N A;  2N1V A;  4RMA A;  3SU8 X;  1SSN A;  2M19 A;  2V3S A;  1F2R C;  1YQ3 B;  2LHD A;  1FO4 A;  1E9M A;  3RD2 A;  1FCL A;  4HJK A;  4KX6 B;  2KHW B;  4LNF A;  1WJU A;  1C4P A;  2UYZ B;  4YSX B;  4ARC A;  3VXW A;  4HDO A;  2L0T A;  2QJL A;  4WJQ A;  3N9Y C;  2NS5 A;  2RGF A;  4AJW A;  3LB8 C;  3Q3J A;  1KM7 A;  4CQN A;  4P7I A;  2LGI A;  1UBI A;  4URK A;  4W9F A;  3AE2 B;  3MC9 A;  2ZVN A;  2BQQ A;  1V2Y A;  3SEB A;  3MJ5 A;  2V3N A;  3WAL A;  1JCK B;  3SD5 A;  3GE3 C;  5EE3 A;  1OQY A;  1OQR A;  4RM8 A;  1WRD B;  1QLB B;  2AQ1 B;  3DWM A;  1SIF A;  5J17 A;  4WWN A;  3AEG B;  5EE1 A;  2GBR A;  1EU3 A;  3UQB A;  2FCM A;  1L4D B;  2K8B A;  2XK5 B;  4GDL B;  4ZRQ A;  2KZR A;  1SE9 A;  1NEN B;  2GBK A;  3SFD B;  3MJW A;  1N61 A;  1R7S A;  4W9H A;  4J3O D;  2KC1 A;  1J7C A;  2GMI C;  1OGW A;  1E8W A;  4YTM B;  2BYV E;  2JSV X;  2QC8 A;  3A1Q B;  1TS4 A;  4CO7 A;  1GUA B;  1FRR A;  2PJH A;  1F2R I;  1TY0 A;  3H7P A;  1UUP A;  3PRM B;  3AN1 A;  1VZ7 A;  2DZM A;  5KHO A;  2K39 A;  3HUI A;  2N9P C;  4EZK A;  3VUW A;  3APF A;  1WSP A;  1V97 A;  1WGG A;  3QX1 A;  3BK2 A;  2LI5 A;  4MGZ E;  1UH6 A;  5JHA A;  3UI3 A;  2J0M A;  2Y5P A;  3M63 B;  4PK1 A;  3MC8 A;  4P1C C;  1MHH E;  3IXS A;  1T3Q A;  1WY8 A;  1C4C A;  2VZK B;  4MEL A;  2ZW0 A;  3H7S A;  4PYZ A;  3OJ3 A;  2QMT A;  3BVM A;  3A4R A;  3FIL B;  1VZ8 A;  1CMX B;  2LAS A;  1D3Z A;  3TMP B;  1PQS A;  1JWM D;  3TEZ A;  4K3C A;  2L32 A;  3B08 A;  5BO4 B;  4ITK A;  2N9L A;  1VZ6 A;  3RNE C;  3W1Y A;  3WCQ A;  3KYC D;  1S3S G;  2D2Q A;  2MWS B;  2KC2 A;  1IUE A;  4WUR A;  3MTN B;  2C7H A;  4JX1 C;  2AWT A;  2JXX A;  2ZJD A;  1DGJ A;  4DDI D;  1YN3 A;  2O6V B;  4BBN C;  4AJY B;  2JVC A;  3IBE A;  2LGD A;  1VD2 A;  4NNJ B;  2QDF A;  4XC2 A;  3GZN B;  4HDQ A;  1SJH D;  2LFI A;  1DOI A;  2LGS A;  2ON8 A;  4USA A;  3RZW C;  3WIM A;  2BB5 A;  2G4S A;  2LZ6 A;  4YXD B;  3ETR A;  1J8C A;  4RNA A;  1B1Z A;  1V8C A;  4MSQ B;  4A3O A;  2X8X X;  4GDK A;  4HLE A;  1C1Y B;  1WMH A;  5TR5 A;  3TL5 A;  1ZXI A;  2NPT B;  4PS3 A;  1XEE A;  3VH4 B;  1GNU A;  2XEW A;  4RGM A;  2IGH A;  1EUV B;  1FIQ A;  3Q8B A;  3N1Z C;  3W1S C;  2FCQ A;  1NEK B;  2JPH A;  2BPS A;  2N4F A;  1HXY D;  2FAZ A;  2KTR B;  3BVG A;  2MJ3 A;  2K8H A;  4W9L A;  3QCA A;  1WYG A;  3APD A;  1WWT A;  4C4V A;  4B9K A;  2BYT A;  4YTP B;  1JRU A;  3NZU A;  5L95 C;  2N1W A;  2KK8 A;  2ZVO A;  1GPX A;  2KQ4 X;  2BT6 A;  1ZUD 2;  4N9F 4;  2JY6 A;  3BYT B;  3EFU A;  4MGI E;  3PRZ A;  1BUI C;  4ACF A;  4BKS A;  1HE8 A;  1R4M B;  4L1B A;  4FJY A;  1MFW A;  2RD0 A;  3DBL I;  2DZK A;  1VCB A;  2KO3 A;  1AWD A;  2WDQ B;  5AEK B;  4WQO B;  5C23 A;  3R7R A;  5E6O A;  1TT5 B;  2BBC A;  4BKG A;  2KMA A;  1QT9 A;  4I6N B;  4GGQ A;  1JML A;  3DHH C;  5IO9 A;  1UEL A;  3P2B A;  2EMT A;  1C78 A;  3AE5 B;  1C9F A;  1P3Q U;  2LEK A;  4MM3 A;  3P4R B;  2LRU A;  4M0W B;  4XDD A;  2JZZ A;  2MP2 B;  1TS2 A;  2GB1 A;  3ONS A;  4YTN B;  3V61 A;  4EZL A;  3AI5 A;  3AE4 B;  3VAW A;  4RCO A;  2WXF A;  1TS5 A;  1WJ6 A;  2WXK A;  2RR9 A;  1ET9 A;  3U2S C;  1KLG D;  3N1X C;  2WP9 B;  5HFY A;  5D94 A;  3CF6 E;  3S2A A;  2L05 A;  4BBN F;  4EKU A;  3EUB 2;  3NRZ A;  1IBX B;  4M8N A;  1FCC C;  2C7N B;  1Q1O A;  2J0J A;  5FKA C;  1TY2 A;  3UQA A;  4YSY B;  4KZ0 A;  4MGY E;  4ARI A;  1LGR A;  4TQ1 A;  3ZNI D;  5TSS A;  1WZ3 A;  3QIJ A;  4FLH A;  3U8Z A;  2GBJ A;  1LQB A;  3ZJU A;  3L4P A;  3KVF B;  3IG3 A;  2JWZ A;  2WXM A;  1YX5 B;  1ROE A;  1T0R C;  1L0X B;  2ASQ A;  2N0S B;  4XYC A;  4F8C B;  2D5G A;  3AE9 B;  2WXJ A;  1Q0W B;  1NYQ A;  4RGT A;  4C80 A;  2J42 A;  2IJ0 A;  1AYF A;  1F77 A;  3NVZ A;  4G11 A;  2N7E A;  2L00 B;  1JWA D;  1E8Z A;  2FCS A;  4ZOH C;  2FID A;  3AEC B;  4MSM B;  1PUT A;  3PSE B;  2INP E;  1MVK A;  2W3S A;  2WDV B;  2BTE A;  1SBB B;  2I2Y A;  2WXI A;  2WXH A;  2PVG C;  3VTW A;  2JX5 A;  1JWS D;  2K9X A;  2JYT A;  2B3A A;  4KGS A;  3PTF C;  5HKH A;  1YN4 A;  2JXT A;  4E74 A;  2K0P A;  3GP7 A;  2VH1 A;  1YMH E;  4BOZ B;  1LXD A;  1WIA A;  2JYE A;  3ZRC A;  5AZG A;  3VRB B;  2MLB A;  4NJ6 A;  1ZP0 B;  4II3 B;  1KOT A;  1MPE A;  4PS8 A;  2YLM A;  3DBR B;  1RYJ A;  3PRP B;  3I57 A;  3V6C B;  2LVO A;  3DCG A;  3RFZ B;  1QIL A;  3OWE B;  3MP9 A;  1TZO A;  1S1Q B;  2I1K A;  3V62 A;  1NYR A;  4AWJ A;  2DBY A;  2LGY A;  5CHV C;  4KIK B;  2KN4 A;  4HPP A;  4EE2 A;  2RDH A;  2E3T A;  3H7P B;  3QA8 A;  3PHW B;  2NTT A;  2JRH A;  4US8 A;  3R66 C;  1OEY J;  1HZ6 A;  5AZF A;  3RUI B;  1YJ1 A;  2KJH B;  1RAX A;  3Q69 A;  4BKT A;  2WNM A;  2YVC A;  4HWI B;  5BMH A;  1ENF A;  1JAL A;  3VQI A;  2SAK A;  2KDE B;  4S17 A;  3WAO A;  2LRW A;  1UWX A;  1TS3 A;  1WR1 A;  2M1M A;  4ZYS A;  4A9A A;  2BKR B;  4NAW A;  2MH7 A;  3DHI C;  4MDK E;  1FXA A;  2PE9 A;  3RCZ A;  4O1N A;  2AYO B;  1A70 A;  3A9J B;  1ZDV A;  1FM0 D;  1PGX A;  2G9H D;  4K1R B;  3X23 A;  1EM7 A;  2OJW A;  3Q3M C;  1F1H A;  4A55 A;  3DBS A;  5D6J B;  2LVP A;  4F1S A;  2FUG 1;  3PS6 A;  3W5U B;  3WAM A;  3DOW A;  1WH3 A;  1HA5 A;  2PE6 B;  2CU1 A;  2IGG A;  2KFJ A;  2L83 A;  3K9P B;  5BMI A;  2J53 A;  4LLG M;  2Q5W D;  1JRP A;  2OED A;  4GN1 A;  4IDI A;  1IYF A;  1XD3 B;  3N20 C;  4A6Q A;  1AW7 A;  4P1B C;  1NI2 A;  2KAN A;  1JRO A;  2MJE A;  3RNG C;  2L52 A;  1T6B X;  3CSF A;  1TBE A;  2V9H A;  2NR2 A;  1I4Q A;  1WXV A;  1IGC A;  2XN9 C;  1D4B A;  3MC0 B;  5G55 A;  1YIW A;  4GDK B;  1E7P B;  1ZXH A;  2Z0D B;  2IY0 B;  1WMH B;  2V0G A;  4JWU C;  3BII D;  2MSE D;  3P42 A;  1E10 A;  4HRO A;  2QEJ C;  4LTU A;  2KYW A;  3ZYY X;  2QIL A;  4IWQ A;  3VTV A;  3PZ8 A;  3OAW A;  4GSW A;  3AU5 A;  2PIA A;  1QOB A;  3NS1 A;  1LFD A;  2K1F A;  3KH0 A;  1XLP A;  2MEK A;  2JZ3 B;  2DWQ A;  4D2K A;  2YEP B;  4F7Z A;  2AQ3 B;  3DWG C;  4LDT B;  1HTO A;  3NVW A;  3AXC A;  4P6V F;  1YJJ A;  2WXN A;  4PS7 A;  2M4N A;  3Q8C A;  3RZF A;  4C4V B;  1MI0 A;  3Q14 C;  2LMC A;  2ZPY A;  4RFB A;  1KH0 A;  3P4Q B;  1N62 A;  2W3R A;  5EDS A;  2L3Z A;  3VUY A;  1I4G A;  2LD9 A;  1AAR A;  2KVR A;  3NUH B;  4DQO C;  1WXA A;  1NVI D;  4EFO A;  3GE8 C;  3AE1 B;  1IGD A;  3RYT A;  1WR6 E;  4AUQ C;  1GOZ A;  1WZ0 A;  1D6E C;  3NOB A;  1E7U A;  5D7G A;  4DXA B;  3KYD D;  4RF0 A;  4HKQ A;  4NJC A;  1P1A A;  2ICI A;  4JGH B;  1V5T A;  3AEB B;  2VRR B;  4WWO A;  2KTF A;  1L2N A;  1V1P B;  2BGF A;  1F0Z A;  3AE7 B;  2MBH A;  1NBF C;  4C00 A;  1QQR A;  1XQQ A;  2ZZP B;  4AP4 C;  1OQQ A;  3Q8E A;  2D3A A;  1FFU A;  1R4N B;  2BKF A;  4KSK C;  1OEY A;  3TIX A;  3WAN A;  1E8X A;  4IWP A;  1FXI A;  2MBQ A;  3UGB B;  2JUO A;  3X0W A;  1XF5 L;  3DQV A;  3R3M A;  3DBH I;  1L0V B;  3P4S B;  4CHK A;  3W1S A;  2DX5 B;  2N9E B;  4DDG D;  3RI7 C;  1SE4 A;  2PTL A;  4NAM A;  1VLB A;  1FMA D;  4GOC A;  2A4Z A;  1PYW D;  3PGE A;  2BYE A;  2WXP A;  1T0Y A;  4DHJ D;  3AEE B;  5I4D A;  2RMM A;  3ML8 A;  1WF9 A;  2EEL A;  1N5X A;  3QC8 B;  4IOI E;  3PLU A;  2KJ6 A;  4S0R A;  1E5W A;  1P0R A;  3KQ4 A;  2WQY B;  1CQV A;  3AH7 A;  3RN9 C;  3EGR A;  2C7M B;  1HQR D;  2IO0 B;  1WI0 A;  1IPG A;  3Q6B A;  4WWM A;  4JPS A;  2NVU I;  1N63 A;  3BK1 A;  1XLN A;  1Q10 A;  5BYR A;  3BWU D;  4WJP A;  4OVZ A;  5G2N A;  3RNA C;  3EHV A;  4RM9 A;  4RGN A;  2L76 A;  2RDG A;  4ZRI A;  1ET6 A;  4K7W A;  3ZLZ A;  1I4X A;  1P7E A;  4JL9 A;  1P9D U;  2K22 A;  3ZO5 B;  4HXD A;  1VJK A;  1UNS A;  3M95 A;  2N9X A;  3GS2 A;  2RPQ A;  3JYU A;  4ZHP A;  2WWZ A;  3U7Z A;  1I4R A;  2JF5 A;  2JRI B;  3HVZ A;  5JZE B;  1ACC A;  4PYU A;  4GXB A;  1ZGU B;  2IGD A;  4BZA A;  1ZW7 A;  2K5P A;  4WWP A;  4W9E A;  2FUH B;  5L83 A;  2M17 A;  3OG5 A;  2JZP A;  2D3G A;  2DNF A;  4FJV B;  4OVU A;  5LXI B;  3QK0 A;  5MPO A;  3T3O A;  1WGH A;  2XNA C;  3PLV A;  3W2D A;  1HEZ E;  2MBE A;  4M02 A;  2OJR A;  1MHX A;  5C2T B;  3UIP B;  4ZYN A;  4C7Y A;  5AUI A;  1YD8 U;  2KXJ A;  2LWP A;  3EEC A;  3ECI A;  2M0A A;  4REZ A;  2J4X A;  4A90 A;  1D5X C;  3UIN B;  2GBM A;  4G50 A;  2KOX A;  3PRE A;  1V49 A;  5EE9 A;  4DHZ E;  3JSV A;  1D5Z C;  4B6W A;  1TTN A;  2HDE A;  1SF0 A;  3B2F A;  3UIO B;  2OHF A;  5LLI A;  3SR6 A;  1FPY A;  2XK5 A;  4WAF A;  1XCT L;  1ZOY B;  2MA9 B;  1FXT B;  2KWD A;  1RLF A;  4BFR A;  2FIF A;  4KKI A;  1T0Q C;  2E6X A;  4KVG B;  3L17 A;  2V3P A;  3MFG A;  2MRP A;  4FUL A;  4M01 A;  2AX5 A;  4W9J A;  4JIO U;  2MHJ A;  4NAW B;  4BVU C;  2WLB A;  3R8B A;  4UDU C;  2UU7 A;  1HTQ A;  2LUE A;  4R3D A;  2WS3 B;  4HRS A;  3CMM B;  2CJO A;  3W9C B;  1G6J A;  3QJZ A;  1CZP A;  2KAC A;  2L0F A;  2R61 A;  4BAX A;  1TYG B;  3H8H A;  3ZIM A;  1L6V A;  3E56 A;  2WXQ A;  2XBB C;  1WGK A;  4IM3 A;  2GI9 A;  1C3T A;  2JU6 X;  2JWU A;  4DXG A;  3OJ4 B;  1Q5W B;  4ZRP A;  1Z5S B;  4ZRK A;  2GBN A;  1C79 A;  3J9C A;  3RMK C;  3IFW B;  1J0G A;  2K3U A;  2NBU A;  1PFD A;  1LM8 B;  1BML C;  2WXL A;  1J7B A;  3H9D A;  3L10 B;  4C7Z A;  2G45 B;  4IUM B;  4LDT D;  3VUX A;  2MQJ A;  3IVF A;  3U30 A;  3AEF B;  2O2V A;  2PPH A;  2KLC A;  4NPN A;  3V6E B;  4II2 B;  2LVQ A;  1KF6 B;  5E6N A;  1WJN A;  1C4A A;  3CIR B;  2DZI A;  2ZW1 A;  1SIJ A;  3ZGZ A;  4FHK A;  2DYB A;  3H1U A;  4K7U A;  1PGA A;  2BB6 A;  2WDR B;  4BKS D;  3TSS A;  5EE0 A;  2I38 A;  3R7Q A;  2L1A A;  4DHJ B;  1ESF A;  2G3Q B;  3EFC A;  4A3P A;  4B0M A;  4GB9 A;  2OOB B;  4YL8 A;  4MJS A;  4XZ4 A;  4ANU A;  2PLP A;  2MBB B;  1YOV B;  1UGM A;  2NTS A;  4I6L B;  2Y5C A;  1RM6 C;  4EUT A;  4X57 B;  4ICU A;  1EU4 A;  2DZJ A;  4LNK A;  1CJE A;  4GMV A;  1FD6 A;  2KX0 A;  4NY0 A;  2INC C;  2KD0 A;  4GU2 A;  4G0N B;  1P98 A;  4AS1 A;  3I63 C;  2M56 B;  5IP4 D;  1P7F A;  3NG0 A;  2KQS A;  2W55 A;  1V81 A;  3QAQ A;  3QWZ B;  2V4I B;  1ISN A;  1XLO A;  3ZKJ C;  4OZA A;  1L7Y A;  1WRI A;  1ZE3 D;  3Q2A C;  1K52 A;  1V80 A;  4OZC A;  3HK0 A;  4MT5 A;  4AOF A;  1JWB D;  2NBW B;  2CR5 A;  1UWM A;  5JHB A;  2V1Y A;  4HCN B;  1SB3 C;  4W9K A;  4TV3 A;  1J19 A;  3B0A A;  3V05 A;  4LJO B;  3TUO A;  4RGO S;  2VH2 A;  2KQ7 A;  4WAA A;  5JH5 C;  2WDT B;  1F9J A;  1DOY A;  1STE A;  5DCN A;  4GIV A;  3DBL B;  5G5G A;  3KUC B;  3ZTD A;  1YQ4 B;  2KJR A;  2KDF B;  2KX3 A;  4ICV A;  3NS8 A;  3NVV A;  1IP9 A;  3N30 A;  2JQR B;  2N7J A;  4WH4 A;  3EC8 A;  4B95 A;  5BYS A;  4OHJ A;  4EEW A;  5IAA C; 
#chains in the Genus database with same CATH homology
 2LD9 A;  4BOS C;  1AAR A;  4PS3 A;  1M94 A;  3KW5 B;  2KVR A;  1WXA A;  4EFO A;  3GOE A;  2DYM A;  2MBO A;  1QZE A;  4MEM A;  2IYD B;  3ZTC A;  3VH4 B;  3N3K B;  4IM2 A;  3RYT A;  2K8C A;  1WR6 E;  3PPA A;  4AUQ C;  1GNU A;  1H4R A;  2O6V A;  2XEW A;  3DVG X;  1WZ0 A;  3ZUN A;  3NOB A;  1EUV B;  3BY4 B;  4TUU A;  1E7U A;  1WXS A;  5D7G A;  3W1S C;  3ZDM C;  2FCQ A;  4DXA B;  3KYD D;  2JPH A;  2BPS A;  2N4F A;  1P1A A;  2CHZ A;  2FAZ A;  1V5T A;  3APC A;  4JGH B;  2VRR B;  1E8Y A;  3ENE A;  2ZEQ A;  2KTR B;  3PZD A;  2C9W B;  4WJN A;  4WWO A;  2K8H A;  4W9L A;  2KWC A;  2KTF A;  3T8M A;  1L2N A;  2FCN A;  1ZKH A;  2CHW A;  3QCA A;  4W9G A;  3ZVV A;  1V9J A;  3APD A;  3T9L A;  5LXH A;  2IO1 B;  4B9K A;  4DK5 A;  4EOY A;  1TGZ B;  3DVN U;  4A20 A;  1JRU A;  2BGF A;  2KWV B;  3NZU A;  5L95 C;  2N1W A;  2KK8 A;  2MBH A;  1X1M A;  1NBF C;  2ZVO A;  2ZCB A;  2IY1 B;  1XQQ A;  2ZZP B;  3U7D A;  4AP4 C;  4N9F 4;  2EMS A;  1GC7 A;  2JY6 A;  3EFU A;  2FNJ B;  2Y5B B;  4KV2 A;  4MGI E;  2CHX A;  2NPT A;  2KNB A;  3PRZ A;  1E7V A;  3OLM D;  3ZW3 A;  4DHZ B;  4BKS A;  2IBI B;  1WGR A;  3LJ3 A;  1WJ4 A;  2BKF A;  3C0R B;  2R2Q A;  3DPD A;  3GZN I;  4KSK C;  1HE8 A;  5AZH A;  1OEY A;  3TIX A;  2WYQ A;  1Z2M A;  4FJY A;  3WAN A;  4ASW C;  1E8X A;  2RD0 A;  4IWP A;  3DBL I;  2DZK A;  1VCB A;  2MBQ A;  3UGB B;  3VFK A;  2KO3 A;  4J6I A;  2JUO A;  3X0W A;  1Y8R C;  1GJZ A;  5CHF A;  5AEK B;  3DQV A;  3I3T B;  3R3M A;  4WQO B;  3IHP C;  5C23 A;  3DBH I;  3R7R A;  2D10 A;  2AL6 A;  5E6O A;  2I1J A;  4BKG A;  4CHK A;  2KMA A;  4XX5 A;  1EO6 A;  2DX5 B;  2N9E B;  3W1S A;  4DDG D;  4I6N B;  2KTR A;  4GGQ A;  2A5U A;  1YQB A;  1UEL A;  3P2B A;  2EMT A;  4DWF A;  1YX6 B;  1WX9 A;  4GOC A;  2A4Z A;  1P3Q U;  3QHT A;  3PGE A;  4MM3 A;  3VTU A;  2BYE A;  3NHE B;  2C5L C;  2LRU A;  1T0Y A;  1BT0 A;  4M0W B;  4DHJ D;  2JZZ A;  2MP2 B;  1WX8 A;  2JT4 B;  3ML8 A;  4K81 A;  1WF9 A;  3TJP A;  5CX3 A;  3QC8 B;  4ZRJ A;  2HTH A;  3HIZ A;  2LJ5 A;  4JQW C;  3ONS A;  3VHT C;  3V61 A;  3PLU A;  4EZL A;  3AI5 A;  2KJ6 A;  2ZPN A;  3PT2 B;  3B1L X;  1E5W A;  4W9C A;  1P0R A;  3VAW A;  2HD5 B;  1WJ6 A;  4HPL B;  2J0K A;  5CHW A;  2RR9 A;  2C7M B;  2IO0 B;  1WI0 A;  2D07 B;  2DEN B;  2Z59 B;  1IPG A;  1XT9 B;  3ZRF A;  2RSU A;  2NVU I;  3ML9 A;  4E3C A;  5D94 A;  1GG3 A;  1WE6 A;  3CF6 E;  2L05 A;  3S2A A;  5IA7 A;  2D11 A;  4FBJ B;  4WJP A;  5G2N A;  3SHQ A;  4BBN F;  4TQ0 A;  4KZC A;  3EHV A;  4RM9 A;  2L76 A;  2DAF A;  3NY5 A;  3NZS A;  4EKU A;  3Q3F A;  2ZNV B;  4ZRI A;  2LXC A;  4K7W A;  3HHM A;  3ZLZ A;  4JL9 A;  2KDB A;  1H8C A;  1P9D U;  1WFY A;  2WX1 A;  2KWU B;  3ZO5 B;  4ANW A;  3MHS D;  4HXD A;  4NQL B;  3M95 A;  1UD7 A;  4M8N A;  2N9X A;  4M8M A;  1EF1 A;  1U4A A;  2KDI A;  2C7N B;  2RPQ A;  1Q1O A;  2J0J A;  2WWZ A;  3JYU A;  4HPM B;  3UQA A;  2JF5 A;  1WXM A;  2L8J A;  2MP2 A;  4KZ0 A;  2WX0 A;  2JRI B;  3JSV B;  4MGY E;  5JZE B;  1I42 A;  4DBG A;  4TQ1 A;  1RRB A;  2AEH A;  4GXB A;  1R4N I;  4PYU A;  1GC6 A;  1WZ3 A;  1ZGU B;  2O6V D;  3QIJ A;  4FLH A;  4I6P A;  2MCN B;  3VVW B;  2G4D B;  1ZW7 A;  1R4M I;  3L08 A;  4WWP A;  5DPT A;  5E6P A;  3U8Z A;  4W9E A;  2FUH B;  2GBJ A;  3A4S C;  5C1Z A;  5L83 A;  2M17 A;  3SDL C;  1LQB A;  2R2O A;  3BIN A;  2D3G A;  3KVF B;  4EZJ A;  4IG7 B;  4FJV B;  2BWE S;  3IG3 A;  2JWZ A;  5KHQ A;  1EF5 A;  3N32 A;  4OVU A;  5FR6 A;  5J18 A;  5LXI B;  3QK0 A;  1SGH A;  3L0W B;  4HCP B;  1WGH A;  2BWF A;  2HJ8 A;  1YX5 B;  3PLV A;  3AUL A;  3A9K B;  4E71 A;  1NDD A;  2MBE A;  3QAR A;  2OJR A;  2ASQ A;  1RFA A;  3ZNH B;  4OVV A;  3UIP B;  2DAJ A;  4KIK A;  3KUD B;  4ZYN A;  5GMV A;  1V5O A;  4F8C B;  5J2R A;  4TKN A;  2AL3 A;  1YD8 U;  3QQ8 B;  4LCD E;  2KXJ A;  2LWP A;  1Q0W B;  3ZNG C;  3ZNZ B;  3EEC A;  3ECI A;  4FN2 A;  3LDZ E;  2KMC A;  2KFK B;  4G11 A;  4KSL C;  2N7E A;  3UIN B;  2GBM A;  4G50 A;  3VH3 B;  2L00 B;  1K8R B;  2KOX A;  1V49 A;  3PRE A;  1E8Z A;  2FCS A;  3L54 A;  4DHZ E;  2FID A;  3HM3 A;  3JSV A;  4MSM B;  4B6W A;  3PSE B;  3PV1 A;  1KLV A;  1TTN A;  3JVZ X;  2HE7 A;  5CTR C;  2GOW A;  3UIO B;  2NBV B;  1V86 A;  5LLI A;  3VTW A;  2BYF A;  3L16 A;  2UWQ A;  3L13 A;  2MW5 A;  4NQK E;  2W9N A;  2XK5 A;  2N1V A;  4RMA A;  2B3A A;  2MA9 B;  3SU8 X;  1FXT B;  1RLF A;  3DVG Y;  2V3S A;  3PTF C;  4BFR A;  5HKH A;  2FIF A;  4E74 A;  3A9K A;  3ZNI D;  1KJT A;  4KVG B;  2V4L A;  3RD2 A;  3A9J A;  4HJK A;  2KHW B;  3D32 A;  1WJU A;  4FA6 A;  4BOZ B;  3L17 A;  1LXD A;  1WIA A;  3ZRC A;  5AZG A;  2UYZ B;  4IW0 A;  2BF8 B;  2K6D B;  2MLB A;  4NJ6 A;  3VXW A;  2MRP A;  4FUL A;  4HDO A;  4II3 B;  2KFK A;  1KOT A;  2L0T A;  2L7R A;  4W9J A;  4PS8 A;  2YLM A;  4NJ7 A;  4JIO U;  4WJQ A;  3PRP B;  3V6C B;  4NAW B;  2KN5 A;  2NS5 A;  2RGF A;  4AJW A;  4BVU C;  2LVO A;  4W9D A;  3Q3J A;  3RUL A;  3DCG A;  1KM7 A;  2PEA A;  4P7I A;  4FAD A;  1UBI A;  4CYE A;  2O2V B;  1S1Q B;  2I1K A;  2LUE A;  3JW0 X;  3V62 A;  3CMM B;  4URK A;  4W9F A;  1G6J A;  4AWJ A;  2LGY A;  3QJZ A;  4IWO A;  5CHV C;  4KIK B;  2L0F A;  2ZVN A;  3ZIM A;  4ZDV A;  1V2Y A;  3H7P B;  2XBB C;  4IM3 A;  3QA8 A;  1C3T A;  3PHW B;  4HK2 A;  4ANX A;  2JRH A;  3WAL A;  1UZX B;  3R66 C;  1OEY J;  3SD5 A;  5AZF A;  3OJ4 B;  4WJO A;  1YJ1 A;  3RUI B;  1Q5W B;  2KJH B;  1OQY A;  3VDZ A;  2M8S A;  2IO3 B;  1RAX A;  4RM8 A;  2REX A;  1WRD B;  4BKT A;  1Z5S B;  2YVC A;  4HWI B;  4ZRK A;  3M62 B;  3VQI A;  1SIF A;  1MG8 A;  2GBN A;  4MGK E;  5J17 A;  4FHJ A;  2MX2 A;  4WWN A;  1WE7 A;  2KDE B;  2GBR A;  3IFW B;  3WAO A;  2ZCC A;  1J0G A;  2LRW A;  2NBU A;  3UQB A;  2KKC A;  4MJS B;  2M1M A;  1WR1 A;  2FCM A;  3PVL A;  2CS4 A;  2K8B A;  1LM8 B;  2K6Q A;  2BKR B;  4NAW A;  2XK5 B;  2EKE C;  3H9D A;  3L10 B;  4GDL B;  3UF8 A;  2G45 B;  4IUM B;  2KZR A;  1SE9 A;  4LDT D;  4MDK E;  3VUX A;  2MQJ A;  1TZ1 A;  3IVF A;  3RT3 B;  2GBK A;  3WA0 A;  3MJW A;  3U30 A;  4KDI C;  4W9H A;  2KC1 A;  2PE9 A;  2O2V A;  3RCZ A;  2PPH A;  2KLC A;  2GMI C;  4NPN A;  1OGW A;  2Z0E B;  1E8W A;  3V6E B;  2AYO B;  3ZDT A;  2BYV E;  4II2 B;  2LVQ A;  4K7S A;  3A9J B;  3K9O B;  5E6N A;  2NCN A;  3A1Q B;  4CO7 A;  1GUA B;  2PJH A;  2M0X A;  1WJN A;  3H7P A;  3PRM B;  4K1R B;  2DZI A;  3X23 A;  4FHK A;  2DZM A;  2DYB A;  5KHO A;  3DBS A;  5D6J B;  3DVN V;  2K39 A;  3H1U A;  2LVP A;  4K7U A;  2N9P C;  4F1S A;  3VUW A;  4EZK A;  1E90 A;  1WYW B;  3APF A;  3PS6 A;  3WAM A;  3DOW A;  1WX7 A;  4BKS D;  1WGG A;  1WGD A;  3ALB A;  3DBR I;  3QX1 A;  2DYO A;  1WH3 A;  2LI5 A;  4MGZ E;  1UH6 A;  3R7Q A;  5JHA A;  2PE6 B;  2J0M A;  3M63 B;  2CU1 A;  4DHJ B;  2KFJ A;  2G3Q B;  3PHX B;  3K9P B;  4A3P A;  1UBQ A;  4IM0 A;  4GB9 A;  2OOB B;  3H6N A;  4YL8 A;  4MJS A;  1WY8 A;  4XZ4 A;  4ANU A;  4GN1 A;  2MBB B;  2C60 A;  1IYF A;  1XD3 B;  1UGM A;  4I6L B;  4GDL A;  4MEL A;  2LXA A;  4G3X B;  4EUT A;  4X57 B;  4ICU A;  3CST A;  1NI2 A;  2DZJ A;  3H7S A;  4IC7 B;  2KAN A;  4W9I A;  2J7Q B;  3M3J A;  3HM6 X;  4GMV A;  2KX0 A;  4NY0 A;  4PYZ A;  3CSF A;  1TBE A;  3OJ3 A;  2NR2 A;  3A4R A;  3A1Q A;  2N7D A;  4JLC A;  1WXV A;  1CMX B;  2LAS A;  1D3Z A;  2KD0 A;  4GU2 A;  3TMP B;  1PQS A;  4G0N B;  1P98 A;  2K25 A;  5G55 A;  1OTR B;  3B08 A;  5BO4 B;  2KQS A;  1YIW A;  1V81 A;  3QAQ A;  3QWZ B;  4GDK B;  3W1Y A;  4MH0 E;  1ISN A;  1S3S G;  2Z0D B;  3KYC D;  3ZKJ C;  2CKH B;  2IY0 B;  2D2Q A;  2MWS B;  1L7Y A;  1WMH B;  2KC2 A;  1WGY A;  1V80 A;  2IZV B;  3HK0 A;  3MTN B;  2C7H A;  3WAP A;  3DDC B;  4LJP B;  4AOF A;  2AWT A;  2NBW B;  2CR5 A;  2JXX A;  2MSE D;  2ZJD A;  5JHB A;  1I35 A;  2KLG A;  2V1Y A;  4HCN B;  4W9K A;  4DDI D;  2O6V B;  4IWQ A;  4TV3 A;  3VTV A;  4BBN C;  1J19 A;  3B0A A;  4AJY B;  2JVC A;  3IBE A;  2LGD A;  3OAW A;  4GSW A;  4LJO B;  1VD2 A;  3AU5 A;  4NNJ B;  4HVB A;  1LFD A;  2K1F A;  3KH0 A;  4XC2 A;  4HDQ A;  2KQ7 A;  3V60 A;  4WAA A;  2JZ3 B;  3TBL D;  2WDT B;  5JH5 C;  1F9J A;  3RZW C;  3WIM A;  5DPS A;  5DCN A;  4GIV A;  4F7Z A;  2G4S A;  4LDT B;  2LZ6 A;  1WM3 A;  3KUC B;  3AXC A;  3ZTD A;  1J8C A;  4PS7 A;  2KJR A;  2M4N A;  4FJZ A;  2KDF B;  4MSQ B;  3RZF A;  2LGX A;  3A33 B;  4KDL B;  1V6E A;  4A3O A;  1WM2 A;  2ZNV C;  2KX3 A;  2IO2 B;  4ICV A;  2ZPY A;  4ANV A;  3NS8 A;  3AU4 A;  1IP9 A;  5D2M B;  1A5R A;  3O65 B;  4GDK A;  2DHZ A;  4HLE A;  2QHO A;  5DPR A;  1C1Y B;  3N30 A;  3KUZ A;  1WMH A;  3EC8 A;  5EDS A;  4B95 A;  2L3Z A;  3TCA A;  3VUY A;  5TR5 A;  3TL5 A;  4EEW A;  5DPW A;  5IAA C;  2NPT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...