1K8RB

Crystal structure of ras-bry2rbd complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
82
Chain Sequence
CILRFIACNGQTRAVQSRGDYQKTLAIALKKFSLEDASKFIVCVSQSSRIKLITEERDRLIIVPKEKPCPSFEDLRRSWEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein P21/H-RAS-1
publication title The Ras-Byr2RBD complex: structural basis for Ras effector recognition in yeast.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 14
structure length 82
sequence length 95
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2001-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14847 Ras_bdg_2 Ras-binding domain of Byr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1k8rB00
1WXAA 2KJHB 1OEYJ 4FJZA 2IY0B 2KN5A 2DZMA 1UZXB 2IO2B 5IAAC 3ZRFA 4HCPB 2L7RA 3VXWA 2I1KA 3HHMA 1EUVB 3VTWA 4TV3A 3RZWC 3IVFA 2L76A 3PS6A 2A4ZA 4I6PA 4GSWA 4MSQB 4ZYNA 2M4NA 1WE7A 1LXDA 3H7PB 3KYDD 3DBSA 4W9JA 3NY5A 3KH0A 4JIOU 3H1UA 4GDLB 1E8XA 4ANUA 4EOYA 3W1SC 5L83A 2MBQA 4XX5A 4RM9A 3PLVA 4ZRIA 2KMAA 2KTRB 2KWVB 1V2YA 2LZ6A 1YIWA 3BINA 4NJ6A 1WGDA 4K7UA 2O2VB 2V1YA 3AULA 4BKSA 3VH3B 3QK0A 1P0RA 3M95A 4DK5A 1VD2A 3H6NA 2BWFA 2JRHA 2N9EB 3N32A 4II3B 3UF8A 3ZLZA 2GBKA 5D7GA 2O6VA 3B0AA 4BVUC 1WRDB 3A9JB 3PV1A 1P98A 2KDFB 4EZJA 4I6NB 5G2NA 1Z5SB 3HIZA 4RM8A 1OQYA 5KHQA 4GDKA 2WX1A 2MBHA 2ASQA 2K6QA 3PT2B 4MM3A 1WI0A 1OTRB 2XEWA 4NQLB 3VTVA 3ZIMA 4FADA 3B1LX 2C9WB 2FCNA 4GXBA 2BYFA 3U8ZA 3TCAA 4W9EA 3TIXA 2C60A 4W9DA 1WJUA 2CR5A 3VFKA 4WAAA 2J0MA 1H8CA 3C0RB 4MSMB 2IY1B 1V86A 2N9PC 5D94A 3ZDTA 3KUZA 4EFOA 2MBEA 2NPTB 2XK5B 2KD0A 3GOEA 4CO7A 3UQAA 3L08A 1R4MI 1H4RA 3ML8A 4EZKA 3RULA 2FCQA 2JZ3B 5CHWA 5CHFA 1Q5WB 4GMVA 1EF5A 4ANXA 1RFAA 1S1QB 4FBJB 4HWIB 3ZNZB 2WWZA 3KUCB 1WMHA 5E6PA 1GJZA 1Y8RC 2HE7A 3VUXA 1C3TA 5AZGA 4KSLC 2ZNVC 1FXTB 2ZCCA 1WY8A 3HM3A 3N30A 4OVUA 3MTNB 3QWZB 4IWOA 3VH4B 3WALA 5DPTA 5DPWA 3IFWB 5E6NA 2RPQA 4PS8A 2K25A 2NBVB 2D07B 3PVLA 3VHTC 3VQIA 1V80A 1YX5B 2REXA 3AU5A 2L8JA 2PE6B 1TTNA 3H7SA 1WJ6A 3U30A 4X57B 2RSUA 2XBBC 1P9DU 3QIJA 2ZNVB 2KMCA 1MG8A 1WX7A 4DHZB 3DCGA 2KTRA 4EUTA 5LLIA 4NAWB 1T0YA 3SD5A 3DBRI 2O2VA 3EECA 3JSVB 3WIMA 1WIAA 3DVNU 4DDID 2DZKA 2NBUA 3PHWB 3GZNI 3R7QA 3MHSD 3ZTCA 2MP2A 3B08A 4B6WA 1L7YA 2DYMA 2J7QB 3A9JA 5KHOA 2AYOB 2BYVE 1E8YA 3KW5B 4HXDA 4GN1A 3W1SA 3SDLC 1XD3B 4TUUA 4KSKC 4A20A 3CF6E 4M8MA 2JVCA 2LI5A 4BBNF 5C23A 1RLFA 4AP4C 1WJNA 4HK2A 1V5TA 4EEWA 2DZIA 5EDSA 5IA7A 3KYCD 1U4AA 4KIKA 2FCSA 3DVGY 3ENEA 1I42A 2OJRA 1ISNA 3L10B 1E8WA 2N1VA 2UYZB 4JL9A 2K1FA 3UGBB 2N7DA 3UIPB 4HLEA 4K1RB 4XZ4A 3S2AA 2JUOA 2G4DB 2KC2A 2NPTA 4GOCA 2XK5A 4TKNA 5LXIB 1WXVA 2GBMA 2BKRB 2RGFA 2M8SA 1XT9B 1K8RB 2MBBB 3L17A 3A1QB 3IBEA 2LVPA 1LM8B 3NOBA 4NQKE 5GMVA 4G50A 3A4SC 1I35A 2OOBB 2IO0B 2MX2A 3QCAA 2GOWA 5CTRC 2JPHA 3R7RA 3O65B 3EC8A 3RUIB 1GUAB 2L05A 2CKHB 4AOFA 3TMPB 2J0KA 3DVNV 3R66C 5J2RA 4FHJA 4BOZB 3UQBA 2R2QA 2K8HA 2JT4B 2KDEB 2EKEC 4JGHB 1UD7A 2D11A 3ALBA 3K9PB 5CX3A 1HE8A 4W9KA 4IWQA 3ZNGC 4LDTD 2BKFA 3ECIA 4KZ0A 3WANA 1AARA 3LJ3A 2LASA 2L3ZA 2GBJA 3APDA 2GMIC 4ICUA 3WAMA 2CHXA 2ZCBA 3CSTA 1ZW7A 4WWNA 2PE9A 4F1SA 1IP9A 3V60A 2LUEA 3X23A 4OVVA 3DDCB 1X1MA 4ICVA 1WXSA 3AXCA 1NDDA 3M63B 2B3AA 4DHJD 4TQ0A 3KVFB 1V5OA 4G3XB 4NAWA 2HJ8A 5DCNA 2N7EA 2LGYA 1IPGA 2GBNA 3VUYA 4II2B 4JLCA 2MWSB 1F9JA 4IC7B 4DHZE 1ZGUB 2L0TA 4MGKE 3HM6X 5TR5A 4E74A 3A9KA 1VCBA 2KJRA 4WWOA 1RAXA 1LFDA 2G45B 4BBNC 4DBGA 3L13A 2RR9A 4A3OA 2G3QB 3K9OB 1WGYA 2GBRA 1GC6A 1P1AA 2BWES 3CSFA 1RRBA 3LDZE 4CYEA 5J18A 2JF5A 5FR6A 4GU2A 2D10A 2KTFA 1A5RA 3V6EB 3L0WB 2NVUI 1UBQA 3PGEA 4FA6A 4AJYB 1V49A 1E5WA 4DXAB 4URKA 4MJSB 4EKUA 2C7HA 2K8CA 3QA8A 2KFJA 3ZKJC 1WGHA 4DWFA 1KOTA 3EFUA 4M8NA 2RD0A 4WJOA 1Q0WB 2JRIB 1UELA 2DZJA 3A1QA 3ZUNA 4EZLA 1D3ZA 3QAQA 5L95C 1KJTA 2KLGA 2NCNA 2M1MA 3H7PA 2QHOA 2R2OA 2HTHA 2WYQA 1YQBA 4GDLA 3QHTA 2FUHB 2MA9B 2KZRA 3PZDA 4FLHA 4E3CA 2FNJB 4BKTA 5JHBA 3M3JA 1SIFA 3N3KB 2EMSA 1J19A 2CHZA 4WJNA 3ZDMC 2L00B 4PS3A 3DPDA 2KC1A 2L0FA 2KDBA 1PQSA 2LRWA 3RD2A 4IM3A 2KFKB 1WX9A 2IYDB 2NBWB 4HDOA 2ZZPB 3DBHI 3ZNID 1WH3A 3Q3FA 3U7DA 4KDLB 4HDQA 4ZRJA 5CHVC 4KDIC 1Z2MA 1OEYA 4FJYA 2KLCA 2KXJA 1OGWA 3P2BA 4GDKB 2Z0DB 4KVGB 2N4FA 5D6JB 1UH6A 1J8CA 4LDTB 3NS8A 2M0XA 2V3SA 1WM3A 2DYBA 5G55A 2ZPNA 4K7SA 2BYEA 3W1YA 1M94A 2CS4A 2MRPA 3ML9A 3ONSA 4MGZE 4BKGA 2LXCA 1IYFA 1TZ1A 2PEAA 1ZKHA 3DBLI 2DAFA 3WA0A 4XC2A 1UGMA 2KWCA 1CMXB 2K39A 3QQ8B 4FJVB 4LJOB 3VUWA 4N9F4 3A33B 4HCNB 1E90A 3DVGX 4HPLB 2D2QA 4PS7A 2NS5A 3RYTA 3VAWA 5JH5C 4W9HA 4GB9A 1R4NI 4BOSC 3QARA 3WAOA 2KJ6A 2ZVOA 4W9LA 1WMHB 3APCA 4E71A 2JWZA 4BKSD 3V6CB 2DENB 4PYZA 3OJ4B 1WXMA 2MLBA 2Z0EB 2FIFA 3MJWA 2HD5B 3CMMB 5JZEB 2O6VD 3X0WA 4G0NB 2IBIB 2C7NB 2DX5B 4MJSA 2KANA 4AWJA 2ZPYA 2AWTA 3ZO5B 2K8BA 5LXHA 1E7VA 4GGQA 2DAJA 3V61A 4HVBA 4PYUA 3ZRCA 1WFYA 3ZVVA 4K7WA 2WX0A 2DYOA 1L2NA 1E7UA 2UWQA 2MBOA 3RCZA 4ASWC 4MGYE 2BGFA 4W9CA 2K6DB 3NHEB 3KUDB 2KHWB 3SHQA 4ANWA 3HK0A 3PSEB 2KKCA 4IG7B 4HJKA 2LXAA 4MGIE 2PJHA 4CHKA 2AL6A 2Z59B 1E8ZA 2KVRA 3APFA 3D32A 1NI2A 2KNBA 2VRRB 4MDKE 3JSVA 2BF8B 2FCMA 1V6EA 4MH0E 4TQ1A 4A3PA 2KQSA 2LD9A 2JY6A 1UBIA 3VTUA 5AEKB 2N9XA 2MCNB 2KX3A 2JXXA 2KFKA 3TBLD 4J6IA 2MP2B 2A5UA 1WX8A 3BY4B 4RMAA 5DPSA 1EO6A 3DQVA 1P3QU 2J0JA 5HKHA 2LRUA 3WAPA 1WF9A 4YL8A 1SE9A 5BO4B 4M0WB 4NJ7A 3ZW3A 1BT0A 2Y5BB 1J0GA 4KZCA 4IWPA 1V9JA 4NPNA 2MQJA 3ZNHB 1V81A 4KIKB 4AJWA 2LJ5A 1WR1A 5E6OA 2N1WA 1WGRA 1NBFC 3OJ3A 3PLUA 2LVOA 2MSED 3EHVA 3M62B 4WJPA 2CHWA 2KOXA 4FULA 2C5LC 4WWPA 1KM7A 2W9NA 4LCDE 3Q3JA 4WQOB 4LJPB 4P7IA 2IO1B 4B95A 3A4RA 1TBEA 4DDGD 3L54A 3OLMD 4ZRKA 1C1YB 4WJQA 2ZJDA 5AZHA 5JHAA 2IO3B 3TL5A 3I3TB 2I1JA 4F8CB 1GNUA 2NR2A 3L16A 3PREA 3TJPA 2KX0A 4MELA 1WYWB 1WR6E 2KK8A 1YX6B 3PTFC 1WE6A 2AEHA 3QJZA 3DOWA 5DPRA 3AI5A 3UIOB 3NZUA 3PPAA 3RZFA 3VVWB 4W9FA 1KLVA 1YJ1A 2C7MB 2O6VB 4K81A 2KWUB 5C1ZA 2AL3A 4JQWC 4I6LB 1GC7A 2V4LA 5J17A 1EF1A 3PRMB 2DHZA 2JZZA 3PRZA 4ZDVA 2LGDA 3AU4A 1WZ0A 1TGZB 4ANVA 1S3SG 2ZVNA 2M17A 3NZSA 2G4SA 3PHXB 1Q1OA 3OAWA 4IW0A 1YD8U 1JRUA 2EMTA 1WGGA 2BPSA 2PPHA 5D2MB 3R3MA 1WZ3A 4F7ZA 1LQBA 3JW0X 2YVCA 3UINB 3SU8X 4IUMB 2LWPA 2LGXA 4DHJB 1XQQA 2FIDA 4BFRA 1WM2A 4FHKA 2ZEQA 2CU1A 3A9KB 4NNJB 3ZTDA 1GG3A 4MEMA 1G6JA 2IZVB 4B9KA 3JVZX 3JYUA 2D3GA 3T8MA 1QZEA 2LVQA 3QC8B 4FN2A 4G11A 2MW5A 4IM0A 5AZFA 3RT3B 3VDZA 1SGHA 4AUQC 3IHPC 4W9IA 3PRPB 4NY0A 1WJ4A 2KDIA 3QX1A 4W9GA 3IG3A 3H9DA 2KO3A 2WDTB 4GIVA 4HPMB 2YLMA 4KV2A 3T9LA 3V62A 4IM2A 2KQ7A 2FAZA
chains in the Genus database with same CATH superfamily
1OEYJ 2EKIA 4FJZA 4HKQA 4L1BA 1PFDA 3ZRFA 4HCPB 2L7RA 3VXWA 3PS6A 4MSQB 1C79A 1LXDA 3KYDD 3NY5A 3H1UA 4GDLB 3ZXRA 4EOYA 2QDFA 5L83A 4XE0A 4RM9A 2KMAA 2MJDA 4RGOS 3BINA 4NJ6A 2V3PA 4K7UA 2V1YA 1ESFA 4BKSA 4HPPA 1F77A 2BWFA 2O6VA 3B0AA 1C77A 2IPKD 4K3CA 1MVKA 3P4PB 3OWEB 1DOXA 1P98A 2KDFB 4XDDA 1Z5SB 4RM8A 2L32A 4GDKA 4IOIE 1WI0A 2V3NA 1OTRB 3ETRA 3ZIMA 3TCAA 1QKZA 4W9EA 5IO9A 3TIXA 4Q2JA 2C60A 4W9DA 1E7PB 2CR5A 3VFKA 1SEBD 3C0RB 3DBLB 4MSMB 3ZDTA 3VRBB 4C7ZA 1R4MI 2WXMA 2B76B 2BTEA 1Q5WB 1QLBB 1S1QB 1WMHA 2W82A 5E6PA 4KSLC 2ZNVC 3RNBC 2YEPF 1EWYC 2ZCCA 3HM3A 5EE9A 3VH4B 4IWOA 5DPTA 5E6NA 3OG5A 1XEEA 3KLSX 3VHTC 3VQIA 3LB8C 1TTNA 4ZOHC 2XBBC 2OJWA 3QIJA 2WS3B 1WX7A 4DHZB 3AV8A 2KTRA 1D5XC 5LLIA 1XO3A 3EECA 1WIAA 4A9AA 1GB4A 1JWBD 1J7BA 3TEWA 2AYOB 1V97A 1YN5A 3SDLC 1XD3B 1FFUA 2GRIA 1TS3A 2JVCA 2LI5A 1WJNA 5EDSA 5IA7A 5JXVA 4PT5A 1B9RA 2K1FA 4EE2A 4K1RB 3S2AA 1YJIA 4GOCA 2G4DB 2KC2A 4TKNA 2XK5A 2GBMA 2BKRB 2RGFA 3HRDD 1K8RB 3IBEA 4NQKE 5GMVA 1F1HA 4G50A 4ARCA 1C78A 2AQ3B 2MX2A 4ZRPA 2WNMA 1YN3A 5CTRC 3R7RA 3LYYA 1CK1A 3EC8A 3RUIB 3T3OA 4FHJA 2K8HA 3MHZA 1JROA 3ALBA 1HE8A 1ZUD2 4IWQA 2BB5A 2KN4A 2RDGA 3DWGC 2BKFA 3P1MA 4LDTD 4KZ0A 3RPFC 3LJ3A 4DQOC 3WAMA 2CHXA 4HJGE 1ZW7A 4F1SA 2PE9A 1L0XB 2J53A 2SEBD 4ICVA 5AUIA 1WXSA 2B3AA 1V5OA 3U52E 4NAWA 2HJ8A 2AQ2B 2LGYA 2W3RA 4JLCA 2MWSB 4IC7B 1SXTA 1ZGUB 2L0TA 2IGDA 4MGKE 1VZ8A 2KJRA 1BXTA 4BBNC 4XDCA 3K9OB 4A3OA 1WGYA 1GC6A 1P1AA 2V4IB 5J18A 3W5UB 1I4RA 3Q14C 1YN4A 2INCC 1NI3A 2WXJA 2C7HA 2K8CA 4DWFA 1KOTA 3EFUA 4WJOA 2WDVB 2DZJA 2KLGA 2M1MA 2H89B 2VZKD 2MA9B 3PZDA 4FLHA 1RM6C 4A6QA 3NG0A 3T3NA 1GPXA 2L00B 4PS3A 5AUKA 1IGDA 2LRWA 2IYDB 3FKYA 4HDOA 3V05A 1WH3A 3U7DA 3CIRB 4NJCA 4KVGB 2Z0DB 4MM3B 5D6JB 4LK0M 4LDTB 4C4VA 1WM3A 4YSXB 3N20C 1M94A 2MRPA 3ML9A 4MGZE 3TEZA 2TSSA 1ZKHA 3WA0A 2DAFA 2BB6A 2WXIA 1I4QA 2K39A 1KRHA 4FJVB 4N9F4 3W5VB 2NMQA 3Q8CA 2NS5A 3RYTA 4W9HA 1R4NI 4BOSC 2KJ6A 2WXHA 4W9LA 1SE3A 3MC8A 5FR3A 2DENB 2HD5B 4LTUA 2C7NB 2DX5B 3EGRA 4MJSA 1GOZA 2K8BA 1DYQA 3ZVVA 1WRIA 2WX0A 4N59A 3P42A 2MBOA 4MGYE 2BGFA 3BK1A 2X8XX 4IG7B 4A8XC 2Z59B 1E8ZA 1SF0A 2V9HA 2KNBA 2BF8B 2FCMA 2VZKB 2LD9A 3VTUA 2JY6A 1UBIA 2N9XA 1UNSA 2JXXA 3DBHB 2VH1A 2BQQA 3BY4B 4RMAA 1JQ4A 1EO6A 2N9LA 4ZHOA 3NUHB 1P3QU 2J0JA 1WF9A 3FILB 5BO4B 2Y5BB 2MQJA 4KIKB 5D3DA 4AJWA 2G1EA 2LJ5A 2KVZA 1NBFC 4J3OD 2WXOA 1L0YB 4USAA 4KGSA 3Q3JA 4WQOB 1QOGA 4P7IA 2IO1B 3A4RA 3Q6BA 3OLMD 5JHAA 3RNAC 4M02A 2I1JA 1GNUA 3L16A 3PREA 3TJPA 1TS4A 2KK8A 3P4RB 3UIOB 2I2YA 2SAKA 3RZFA 2WXPA 2V4LA 4LNNA 3AU4A 1WZ0A 1TT5B 3PHXB 4RNAA 1NVID 3P4QB 2KQ4X 2DWQA 1WZ3A 1ZXIA 2J52A 3NJTA 3TEYA 4IUMB 2LGXA 2ZEQA 3ZTDA 3A9KB 1GG3A 2D3GA 2ACZB 1QZEA 4RH6A 3EUB2 4M0WA 1BUIC 3PRPB 4W9IA 1WJ4A 3QX1A 4W9GA 3IG3A 3T9LA 4KV2A 1B1ZA 3RI7C 1IBXA 3GS2A 3V62A 2PTLA 1M4VA 2KJHB 1XF5L 2IY0B 2KN5A 4YTNB 1QQRA 3VTWA 3Q2AC 4ZYNA 1L0VB 1WE7A 3H7PB 1QF6A 1E8XA 4ANUA 1NENB 2QMTA 1T0SC 5T8IA 1V2YA 2LZ6A 4LNOA 4WIPA 1V1OA 2O2VB 4DK5A 1ZP0B 1E0ZA 5D7GA 3IT6B 1D4BA 2BT6A 5HFYA 1OQYA 5KHQA 3IAM1 2WX1A 2K6QA 3PT2B 4A55A 1TKEA 1XLOA 2C9WB 4GXBA 4ZHPA 3BK2A 1WJUA 2IY1B 2NPTB 2KD0A 1V8CA 3HVDA 2JYEA 1H4RA 3ML8A 1ENFA 3RULA 2FCQA 4GMVA 1RFAA 4HWIB 3ZNZB 1PGBA 3KUCB 1GJZA 5AZGA 3WALA 4OVUA 1NEKB 3MTNB 3QWZB 2GI9A 2LHEA 3GE3C 1ET9A 1TJEA 2RPQA 1FXIA 1OQQA 3BIID 2K25A 2D07B 1V80A 3AECB 2IGHA 2PE6B 3H7SA 1WJ6A 3U30A 2QJLA 3ZJVA 3E56A 2KMCA 1PGAA 2AX5A 3DCGA 2JZPA 1NYRA 3DBRI 3JSVB 2OEDA 4YTMB 1FD6A 3WIMA 4DDID 2DZKA 3PHWB 2PW9A 2PKOA 2WXFA 3R7QA 3MHSD 3ZTCA 2MP2A 3B08A 4B6WA 2DYMA 5KHOA 4IKGA 3KW5B 4HXDA 3W1SA 5FKAC 2LJIA 5C23A 1RLFA 1TS5A 5D3IB 4EEWA 3I5JC 1WWTA 2E6XA 1T3QA 3DVGY 3ENEA 1I42A 1QOBA 2N1VA 3UGBB 2Z8LA 3UIPB 2K0PA 3VRAB 2NTSA 2BS3B 2MBBB 3AH7A 3A1QB 3NOBA 1LM8B 3A4SC 2IO0B 2JPHA 3O65B 1GUAB 4AOFA 3AE3B 3TMPB 2J0KA 3R66C 5J2RA 2XNAC 1ET6A 2Y5PA 1NYQA 4JGHB 2KYWA 3W2DA 3V3XA 5CX3A 4RGNA 3AEDB 1MJDA 2AQ1B 3ECIA 3WANA 1AARA 2LASA 2PMVA 2GMIC 4ICUA 2ZCBA 4WWNA 1IP9A 4LNFA 5EE0A 3V60A 3X23A 4OVVA 1NDDA 2K9XA 3M63B 4DHJD 3KVFB 1TY0A 1SSNA 4II2B 2WXKA 1SB3C 5TR5A 3HM6X 1K51A 1VCBA 3KWLA 1RAXA 4DBGA 3L13A 2I38A 1OFFA 2GBRA 1RRBA 3CWIA 3Q3NC 4OHJA 5FR6A 3AE9B 1FM0D 1A5RA 1QILA 2NVUI 4AJYB 1V49A 1E5WA 4DXAB 2M19A 4URKA 1J7CA 1HXYD 4EKUA 3QA8A 2QEJC 2DBYA 1WGHA 5E6JA 4MT5A 4M8NA 3RNFC 1Q0WB 1E6EB 4EZLA 3ZUNA 2IJ0A 1D3ZA 5L95C 3I9V1 2NCNA 3FAHA 1YQBA 3QHTA 2FUHB 4E3CA 4XGAB 1WSPA 1XCTL 3M3JA 2L0FA 3U2SC 3R2TA 1PDXA 4AQ7A 4IM3A 2KFKB 3RN9C 2LHDA 2NBWB 3DBHI 4MH8A 2KWDA 4KDIC 3FC4A 4C7YA 2Q5WD 2KLCA 4GDKB 2N4FA 1J8CA 2J42A 2V3SA 1WXQA 1PGXA 2DYBA 2BYEA 1F52A 3ONSA 4REZA 3AEBB 2LXCA 1TZ1A 3RNEC 1C4CA 2WLBA 1ZDVA 2MH7A 3QQ8B 5BYRA 3VUWA 3N1XC 2D2QA 2R61A 3VAWA 1Q10A 2DNFA 4GB9A 3WAOA 1WMHB 3APCA 2JWZA 3V6CB 4PYZA 4N58A 3MJWA 3CMMB 2BW2A 1SJED 3AEFB 2KANA 3BWUD 2BBCA 3ZO5B 4O1NA 4GGQA 3V61A 4HVBA 4ZYSA 1WFYA 1L2NA 3RCZA 4ASWC 2Y5CA 2K6DB 3AEGB 3NHEB 2KHWB 3SHQA 3HK0A 3PSEB 4HJKA 2LXAA 2LEKA 2WP9B 3APFA 3DBRB 3D32A 2VRRB 4MH0E 4UDUC 1MI0A 1PYWD 2KX3A 1RWSA 4K3BA 2A5UA 5DPSA 3DHHC 2BVCA 4OZCA 1J0GA 4NJ7A 3ZW3A 4D2KA 4BAXA 1F0ZA 1A70A 2LUMA 2ZW1A 4YSYB 4JWSC 4HRSA 1FRRA 1QT9A 1WGRA 3OJ3A 2LVOA 2VH2A 3M62B 2KOXA 2C5LC 1MG4A 2W9NA 1FMAD 2QC8A 4LCDE 3RNGC 1V1PA 1TBEA 2ON8A 4DDGD 3L54A 4IDIA 1C1YB 2W3SA 5AZHA 3AE8B 2IO3B 1XLNA 3TL5A 2JX5A 2NR2A 4HROA 1WYWB 1C4AA 1MHHE 1RFKA 2K22A 3DOWA 1ZPSA 1JALA 5EE3A 1AW7A 5C1ZA 4XWWA 2AL3A 1E9MA 3BVMA 1JWSD 1GC7A 4LLGM 1DOIA 3PRZA 3I57A 1ACCA 4RFBA 1I4GA 2ZVNA 2M17A 4QAYA 1N61A 1Q1OA 4XYCA 1YD8U 1JRUA 3HUIA 2BPSA 4WQMA 2PPHA 3DHGC 5D2MB 4RGMA 3JW0X 3SU8X 1XQQA 4BFRA 1WM2A 4B9KA 3JVZX 4FXCA 1YQ3B 3QC8B 1HQRD 2XN9C 2MW5A 3VDZA 5MPOA 1SGHA 4AUQC 2HTME 4B0EA 1YOVB 2KDIA 4HPMB 2KO3A 2WDTB 2KAJA 1F2RI 1WXAA 2LMCA 2DZMA 3UI3A 1ZE3D 2IO2B 3HHMA 2ONQA 3AN1A 2DLBA 1GAQB 2L76A 2A4ZA 4I6PA 4GSWA 2M4NA 3DBSA 4JIOU 3W1SC 3BVZA 4ZRIA 3VR9B 1UUPA 3AULA 1ZDXA 1WYGA 3QK0A 3VH3B 2WQYB 3H6NA 2N9EB 4II3B 2YEPB 1TYGB 4BVUC 1WRDB 3A9JB 3PV1A 4EZJA 4I6NB 4ZRQA 2MBHA 4C4VB 2XEWA 4NQLB 3VTVA 4FADA 2FCNA 2BYFA 2L1AA 4WAAA 4WWMA 2N9PC 3KUZA 2MBEA 3UQAA 4EZKA 1C4PA 4KGRA 2JZ3B 5IOIA 3MP9A 5CHWA 1EF5A 3Q8AA 3I63C 2WWZA 3TUOA 1Y8RC 2HE7A 1JRPA 1FXTB 1WY8A 1VZ6A 3N30A 1EU3A 1WGKA 4PS8A 1FNWA 5H92C 2NBVB 3AU5A 2LFIA 2L8JA 3O13A 4X57B 1UWXA 2RSUA 2INPE 1P9DU 1JWAD 2ZNVB 5IP4D 2L83A 1T0YA 1UGJA 3SD5A 2O2VA 3DVNU 2EELA 2NBUA 5BMHA 4L2YA 3W9CB 1E8YA 4GN1A 4R3DA 4ITKA 1HTOA 3P63A 4M8MA 4AP4C 4HK2A 1VR9A 1U4AA 2FCSA 1ISNA 1E8WA 1R7SA 2JUOA 2NPTA 2L52A 3KWVA 2M8SA 3L17A 1HZ6A 1JWUD 3TSSA 1MHXA 5IN7A 2GLSA 2OOBB 3QCAA 3IAS1 2GOWA 4S17A 1T0RC 1VLBA 3DVNV 2W54A 2JT4B 2KDEB 1CJEA 4LNIA 1EM7A 4CQNA 2D11A 3ZNGC 5BMIA 3ZGZA 4ARIA 2WGSA 2IGGA 2LUEA 3DDCB 1X1MA 2PVGC 4TQ0A 4G3XB 2N7EA 1JCKB 2MJ3A 1OQRA 2MJEA 3GZNB 3AE2B 4DHZE 3AE7B 2WXQA 5BMGA 5I4DA 1LFDA 2G45B 2RR9A 2G3QB 2BWES 1TKGA 3CSFA 4CYEA 1PUTA 3NVZA 2V0GA 4GU2A 4WAFA 2D10A 3L0WB 3PGEA 1UBQA 2JWUA 3IT4B 3ZKJC 4JX1C 2RD0A 1AN8A 2JRIB 1D6EC 1UELA 3A1QA 3Q8EA 4DXGA 4KKJA 2QHOA 2R2OA 3NS1A 2WYQA 4GDLA 1KFYB 2WDQB 4MACA 2FNJB 2N7JA 1SIFA 2W55A 3N3KB 4OW0A 1J19A 2CHZA 3ZDMC 1E10A 2KC1A 2K3UA 1PQSA 3RD2A 3P4SB 4P1BC 1IUEA 2ZZPB 4M00A 4A90A 3Q3FA 4HDQA 1MPEA 1Z2MA 2KXJA 1OGWA 3P2BA 1UH6A 1CZPA 3B2GA 3BZDB 5HHDG 4GLSC 3BYTB 5C2TB 3RFZB 3RNCC 5G55A 2ZPNA 4K7SA 3W1YA 3MC0B 4BKGA 2ZW0A 1IYFA 2PEAA 4XC2A 3SEBA 3AE4B 2KWCA 1YJJA 2GB1A 3IXSA 4HCNB 4TSSA 2RPVA 4PS7A 1N5WA 5TSSA 4P1CC 1UWMA 4BKSD 5HG2A 1VJKA 2Z0EB 2FIFA 2O6VD 4G0NB 2Y3AA 4AWJA 2ZPYA 2AWTA 2RMMA 5LXHA 1HTQA 5GXGB 4KGTA 1T5XD 2JYTA 3ZRCA 1I4PA 4K7WA 1E7UA 4C56C 3PZ8A 4HKZE 4W9CA 1XCQL 3KUDB 4ANWA 1TZOA 2KKCA 4MGIE 2JU6X 4TQ1A 1STEA 1V6EA 1FCCC 2MCNB 2KFKA 3TBLD 2MP2B 1WX8A 2H88B 4OZAA 2LRUA 1TIFA 3WAPA 4YL8A 1SE9A 2CJOA 3N9YC 1T0QC 4IWPA 2D5GA 2QIEB 3ZNHB 1TKYA 1V81A 1WR1A 3AE1B 3NVVA 3EHVA 5IKCM 1KF6B 1GB1A 3AB5A 4LJPB 2WXNA 1L6VA 1KLGD 4OVZA 4WJQA 3TEXA 3I3TB 1L6UA 4F8CB 2KX0A 3Q8BA 1YX6B 5DPRA 1WE6A 3AI5A 3DWMA 1C9FA 3NZUA 2WU5B 3PPAA 3BVGA 3GB1A 1KLVA 1YJ1A 2C7MB 4ACFA 2O6VB 4K81A 2KWUB 1FEHA 4I6LB 4JPSA 1KLUD 3AE6B 3EA6A 4ZDVA 2LGDA 1TGZB 4ANVA 1S3SG 2UU7A 2EMTA 1WGGA 3R3MA 1KTKA 5EE1A 4TMAB 4DHJB 1T6BX 2FIDA 1BMLC 1G6JA 2CU1A 2IZVB 1XLPA 3T8MA 2LVQA 4IM0A 5AZFA 1FNVA 4IM2A 4JE3B 2FAZA 2INDC 1UZXB 3NVYA 5IAAC 2I1KA 2QILA 1EU4A 1EUVB 1HA5A 4TV3A 2WXGA 3RZWC 3IVFA 3C8YA 2N9KA 4B0MA 4W9JA 3KH0A 3LXFA 1EWCA 2MBQA 4XX5A 3PLVA 2KTRB 2KWVB 1DOYA 1YIWA 1WGDA 1P0RA 3M95A 1N5XA 1VD2A 2JRHA 3N32A 3UF8A 3ZLZA 2GBKA 2KT7A 1MFWA 1LGRA 2PVOD 1I4HA 3C19A 3HIZA 5G2NA 2IDYA 3U4EG 3B9JA 2ASQA 4MM3A 5C3JB 3B1LX 2FUG1 3BYYB 4C00A 3U8ZA 4BZAA 1F2RC 2J0MA 3NRZA 1H8CA 5D94A 1V86A 1ZOYB 4EFOA 2XK5B 4CO7A 3GOEA 1N6ZA 4KKIA 3L08A 4WURA 4ANXA 1VDVA 5CHFA 4FBJB 3VUXA 1C3TA 1Y56A 3B2FA 5DPWA 3IFWB 2LGSA 3PVLA 4M01A 1YX5B 2REXA 2PIAA 2MEKA 1HZ5A 2LGIA 4YT0B 1I7HA 2PLPA 2M0AA 1MG8A 4US9A 3U7ZA 2JXTA 2JQRB 1P7EA 4EUTA 3ZYYX 1LO5D 4NAWB 2FBWB 2WDRB 3GZNI 2NTTA 2G9HD 1L7YA 2J7QB 3A9JA 2BYVE 4HEA1 2MHJA 4TUUA 4KSKC 4A20A 3FILA 3CF6E 4BBNF 4LNKA 1V5TA 2DZIA 3KYCD 4KIKA 5BYQA 2OJRA 4US8A 4S0RA 3L10B 2UYZB 4JL9A 2N7DA 2E3TA 4HLEA 4XZ4A 5LXIB 3ZXVA 1R4MB 3N1YC 1WXVA 1XT9B 1DGJA 3NZ3A 2LVPA 1V1PB 3MC9A 1I35A 3SFEB 2WXLA 3J9CA 1QOAA 4YWGG 2L05A 2CKHB 4OZBA 4BOZB 3UQBA 2R2QA 3Q8FA 2EKEC 1TY2A 1UD7A 1YMHE 1D5MC 3K9PB 2D3BA 4YTPB 5BYSA 4W9KA 1AYFA 4PK1A 1ROEA 2L3ZA 2GBJA 2OHFA 3APDA 3CSTA 2BS2B 1D5ZC 3AXCA 2X38A 5DCNA 1L4DB 2BS4B 5FK9C 1IPGA 2GBNA 4YSZB 3VUYA 1F9JA 4E74A 3E9SA 3A9KA 4WWOA 4DXFA 1L4ZB 3HVZA 2J4XA 1K53A 2KDMA 1JMLA 2WHIA 3LDZE 1FCLA 1N63A 2JF5A 2KTFA 3V6EB 4FA6A 1SE4A 2INNE 4MJSB 2KFJA 4AS1A 3URYA 4RGTA 1CQVA 2D3CA 3Q3MC 3QAQA 1KJTA 3MJ5A 3AEAB 3R8BA 3H7PA 1K52A 2HTHA 2KACA 1JW9D 1SE2A 2KZRA 3H8HA 4BKTA 5JHBA 2EMSA 3AM9A 4WJNA 1SIJA 1UF0A 3DPDA 2CU3A 2QSDA 4RCOA 2KDBA 3AEEB 1WX9A 4RF0A 3ZNID 4KDLB 4ZRJA 1KH0A 1SJHD 5CHVC 3ABVB 1OEYA 4FJYA 5HI1A 2HJ1A 4XWTA 3NS8A 1P7FA 3ZJTA 1K50A 2M0XA 3VR8B 3GE8C 1FIQA 1N62A 2CS4A 3AE5B 1J7AA 3Q3OC 3DBLI 1UGMA 1CMXB 3PZ7A 3Q69A 4LJOB 3ZJUA 2BYTA 5G5HA 3A33B 1FNUA 1E90A 1QOFA 1FRDA 3DVGX 4HPLB 4KX6B 5JH5C 1VRAB 3QARA 3PO0A 2ZVOA 4E71A 3NVWA 5G5GA 3OJ4B 1WXMA 2MLBA 1YNTE 5JZEB 4JWUC 2HDEA 2JSVX 3X0WA 4C80A 2IBIB 4NZLB 4RF1A 2WU2B 1E7VA 2DAJA 4PYUA 1ZXHA 1I4XA 2DYOA 2UWQA 3SR6A 1FPYA 1L5PA 1N60A 3RMKC 3SFDB 1HEZE 2KMMA 2FE8A 2PJHA 3DHIC 4CHKA 2AL6A 2KVRA 1NI2A 4MDKE 3JSVA 4A3PA 2KQSA 4L23A 5AEKB 5H8YE 5LNK1 3KQ4A 4J6IA 1FO4A 3L4PA 3DQVA 1SBBB 1VZ7A 1RYJA 5HKHA 3ZQ4A 4P16A 2N0SB 4M0WB 1BT0A 4KZCA 1IBXB 1V9JA 4NPNA 5E6OA 2N1WA 1JWMD 3PLUA 3R2IA 2MSED 3WCQA 1XLQA 4WJPA 2CHWA 4FULA 1FXAA 4WWPA 1AWDA 1KM7A 4P6VF 4B95A 1R4NB 2CJNA 2ICIA 1FFVA 4NAMA 2RDHA 4ZRKA 2ZJDA 1TS2A 2M56B 3MFGA 3N1ZC 4MELA 3GP7A 3PTFC 1WR6E 2AEHA 3QJZA 1IGCA 3VVWB 4W9FA 1C76A 2QCZA 4JQWC 5J17A 1EF1A 1XXGA 2RDBC 3PRMB 4N6EB 2DHZA 2JZZA 4H2AA 1YQ4B 3NZSA 2G4SA 3OAWA 4IW0A 4F7ZA 2D3AA 1LQBA 2YVCA 3UINB 2LWPA 3AMZA 4FHKA 4NNJB 4MEMA 2WXRA 3JYUA 4YXDB 2K5PA 4FN2A 4G11A 3RT3B 3EFCA 4WH4A 3IHPC 4NY0A 3H9DA 4GIVA 2YLMA 2KQ7A
chains in the Genus database with same CATH topology
1WXAA 2KJHB 1OEYJ 4FJZA 2IY0B 2KN5A 2DZMA 1UZXB 2IO2B 5IAAC 3ZRFA 4HCPB 2L7RA 3VXWA 2I1KA 3HHMA 1EUVB 3VTWA 4TV3A 3RZWC 3IVFA 2L76A 3PS6A 2A4ZA 4I6PA 4GSWA 4MSQB 4ZYNA 2M4NA 1WE7A 1LXDA 3H7PB 3KYDD 3DBSA 4W9JA 3NY5A 3KH0A 4JIOU 3H1UA 4GDLB 1E8XA 4ANUA 4EOYA 3W1SC 5L83A 2MBQA 4XX5A 4RM9A 3PLVA 4ZRIA 2KMAA 2KTRB 2KWVB 1V2YA 2LZ6A 1YIWA 3BINA 4NJ6A 1WGDA 4K7UA 2O2VB 2V1YA 3AULA 4BKSA 3VH3B 3QK0A 1P0RA 3M95A 4DK5A 1VD2A 3H6NA 2BWFA 2JRHA 2N9EB 3N32A 4II3B 3UF8A 3ZLZA 2GBKA 5D7GA 2O6VA 3B0AA 4BVUC 1WRDB 3A9JB 3PV1A 1P98A 2KDFB 4EZJA 4I6NB 5G2NA 1Z5SB 3HIZA 4RM8A 1OQYA 5KHQA 4GDKA 2WX1A 2MBHA 2ASQA 2K6QA 3PT2B 4MM3A 1WI0A 1OTRB 2XEWA 4NQLB 3VTVA 3ZIMA 4FADA 3B1LX 2C9WB 2FCNA 4GXBA 2BYFA 3U8ZA 3TCAA 4W9EA 3TIXA 2C60A 4W9DA 1WJUA 2CR5A 3VFKA 4WAAA 2J0MA 1H8CA 3C0RB 4MSMB 2IY1B 1V86A 2N9PC 5D94A 3ZDTA 3KUZA 4EFOA 2MBEA 2NPTB 2XK5B 2KD0A 3GOEA 4CO7A 3UQAA 3L08A 1R4MI 1H4RA 3ML8A 4EZKA 3RULA 2FCQA 2JZ3B 5CHWA 5CHFA 1Q5WB 4GMVA 1EF5A 4ANXA 1RFAA 1S1QB 4FBJB 4HWIB 3ZNZB 2WWZA 3KUCB 1WMHA 5E6PA 1GJZA 1Y8RC 2HE7A 3VUXA 1C3TA 5AZGA 4KSLC 2ZNVC 1FXTB 2ZCCA 1WY8A 3HM3A 3N30A 4OVUA 3MTNB 3QWZB 4IWOA 3VH4B 3WALA 5DPTA 5DPWA 3IFWB 5E6NA 2RPQA 4PS8A 2K25A 2NBVB 2D07B 3PVLA 3VHTC 3VQIA 1V80A 1YX5B 2REXA 3AU5A 2L8JA 2PE6B 1TTNA 3H7SA 1WJ6A 3U30A 4X57B 2RSUA 2XBBC 1P9DU 3QIJA 2ZNVB 2KMCA 1MG8A 1WX7A 4DHZB 3DCGA 2KTRA 4EUTA 5LLIA 4NAWB 1T0YA 3SD5A 3DBRI 2O2VA 3EECA 3JSVB 3WIMA 1WIAA 3DVNU 4DDID 2DZKA 2NBUA 3PHWB 3GZNI 3R7QA 3MHSD 3ZTCA 2MP2A 3B08A 4B6WA 1L7YA 2DYMA 2J7QB 3A9JA 5KHOA 2AYOB 2BYVE 1E8YA 3KW5B 4HXDA 4GN1A 3W1SA 3SDLC 1XD3B 4TUUA 4KSKC 4A20A 3CF6E 4M8MA 2JVCA 2LI5A 4BBNF 5C23A 1RLFA 4AP4C 1WJNA 4HK2A 1V5TA 4EEWA 2DZIA 5EDSA 5IA7A 3KYCD 1U4AA 4KIKA 2FCSA 3DVGY 3ENEA 1I42A 2OJRA 1ISNA 3L10B 1E8WA 2N1VA 2UYZB 4JL9A 2K1FA 3UGBB 2N7DA 3UIPB 4HLEA 4K1RB 4XZ4A 3S2AA 2JUOA 2G4DB 2KC2A 2NPTA 4GOCA 2XK5A 4TKNA 5LXIB 1WXVA 2GBMA 2BKRB 2RGFA 2M8SA 1XT9B 1K8RB 2MBBB 3L17A 3A1QB 3IBEA 2LVPA 1LM8B 3NOBA 4NQKE 5GMVA 4G50A 3A4SC 1I35A 2OOBB 2IO0B 2MX2A 3QCAA 2GOWA 5CTRC 2JPHA 3R7RA 3O65B 3EC8A 3RUIB 1GUAB 2L05A 2CKHB 4AOFA 3TMPB 2J0KA 3DVNV 3R66C 5J2RA 4FHJA 4BOZB 3UQBA 2R2QA 2K8HA 2JT4B 2KDEB 2EKEC 4JGHB 1UD7A 2D11A 3ALBA 3K9PB 5CX3A 1HE8A 4W9KA 4IWQA 3ZNGC 4LDTD 2BKFA 3ECIA 4KZ0A 3WANA 1AARA 3LJ3A 2LASA 2L3ZA 2GBJA 3APDA 2GMIC 4ICUA 3WAMA 2CHXA 2ZCBA 3CSTA 1ZW7A 4WWNA 2PE9A 4F1SA 1IP9A 3V60A 2LUEA 3X23A 4OVVA 3DDCB 1X1MA 4ICVA 1WXSA 3AXCA 1NDDA 3M63B 2B3AA 4DHJD 4TQ0A 3KVFB 1V5OA 4G3XB 4NAWA 2HJ8A 5DCNA 2N7EA 2LGYA 1IPGA 2GBNA 3VUYA 4II2B 4JLCA 2MWSB 1F9JA 4IC7B 4DHZE 1ZGUB 2L0TA 4MGKE 3HM6X 5TR5A 4E74A 3A9KA 1VCBA 2KJRA 4WWOA 1RAXA 1LFDA 2G45B 4BBNC 4DBGA 3L13A 2RR9A 4A3OA 2G3QB 3K9OB 1WGYA 2GBRA 1GC6A 1P1AA 2BWES 3CSFA 1RRBA 3LDZE 4CYEA 5J18A 2JF5A 5FR6A 4GU2A 2D10A 2KTFA 1A5RA 3V6EB 3L0WB 2NVUI 1UBQA 3PGEA 4FA6A 4AJYB 1V49A 1E5WA 4DXAB 4URKA 4MJSB 4EKUA 2C7HA 2K8CA 3QA8A 2KFJA 3ZKJC 1WGHA 4DWFA 1KOTA 3EFUA 4M8NA 2RD0A 4WJOA 1Q0WB 2JRIB 1UELA 2DZJA 3A1QA 3ZUNA 4EZLA 1D3ZA 3QAQA 5L95C 1KJTA 2KLGA 2NCNA 2M1MA 3H7PA 2QHOA 2R2OA 2HTHA 2WYQA 1YQBA 4GDLA 3QHTA 2FUHB 2MA9B 2KZRA 3PZDA 4FLHA 4E3CA 2FNJB 4BKTA 5JHBA 3M3JA 1SIFA 3N3KB 2EMSA 1J19A 2CHZA 4WJNA 3ZDMC 2L00B 4PS3A 3DPDA 2KC1A 2L0FA 2KDBA 1PQSA 2LRWA 3RD2A 4IM3A 2KFKB 1WX9A 2IYDB 2NBWB 4HDOA 2ZZPB 3DBHI 3ZNID 1WH3A 3Q3FA 3U7DA 4KDLB 4HDQA 4ZRJA 5CHVC 4KDIC 1Z2MA 1OEYA 4FJYA 2KLCA 2KXJA 1OGWA 3P2BA 4GDKB 2Z0DB 4KVGB 2N4FA 5D6JB 1UH6A 1J8CA 4LDTB 3NS8A 2M0XA 2V3SA 1WM3A 2DYBA 5G55A 2ZPNA 4K7SA 2BYEA 3W1YA 1M94A 2CS4A 2MRPA 3ML9A 3ONSA 4MGZE 4BKGA 2LXCA 1IYFA 1TZ1A 2PEAA 1ZKHA 3DBLI 2DAFA 3WA0A 4XC2A 1UGMA 2KWCA 1CMXB 2K39A 3QQ8B 4FJVB 4LJOB 3VUWA 4N9F4 3A33B 4HCNB 1E90A 3DVGX 4HPLB 2D2QA 4PS7A 2NS5A 3RYTA 3VAWA 5JH5C 4W9HA 4GB9A 1R4NI 4BOSC 3QARA 3WAOA 2KJ6A 2ZVOA 4W9LA 1WMHB 3APCA 4E71A 2JWZA 4BKSD 3V6CB 2DENB 4PYZA 3OJ4B 1WXMA 2MLBA 2Z0EB 2FIFA 3MJWA 2HD5B 3CMMB 5JZEB 2O6VD 3X0WA 4G0NB 2IBIB 2C7NB 2DX5B 4MJSA 2KANA 4AWJA 2ZPYA 2AWTA 3ZO5B 2K8BA 5LXHA 1E7VA 4GGQA 2DAJA 3V61A 4HVBA 4PYUA 3ZRCA 1WFYA 3ZVVA 4K7WA 2WX0A 2DYOA 1L2NA 1E7UA 2UWQA 2MBOA 3RCZA 4ASWC 4MGYE 2BGFA 4W9CA 2K6DB 3NHEB 3KUDB 2KHWB 3SHQA 4ANWA 3HK0A 3PSEB 2KKCA 4IG7B 4HJKA 2LXAA 4MGIE 2PJHA 4CHKA 2AL6A 2Z59B 1E8ZA 2KVRA 3APFA 3D32A 1NI2A 2KNBA 2VRRB 4MDKE 3JSVA 2BF8B 2FCMA 1V6EA 4MH0E 4TQ1A 4A3PA 2KQSA 2LD9A 2JY6A 1UBIA 3VTUA 5AEKB 2N9XA 2MCNB 2KX3A 2JXXA 2KFKA 3TBLD 4J6IA 2MP2B 2A5UA 1WX8A 3BY4B 4RMAA 5DPSA 1EO6A 3DQVA 1P3QU 2J0JA 5HKHA 2LRUA 3WAPA 1WF9A 4YL8A 1SE9A 5BO4B 4M0WB 4NJ7A 3ZW3A 1BT0A 2Y5BB 1J0GA 4KZCA 4IWPA 1V9JA 4NPNA 2MQJA 3ZNHB 1V81A 4KIKB 4AJWA 2LJ5A 1WR1A 5E6OA 2N1WA 1WGRA 1NBFC 3OJ3A 3PLUA 2LVOA 2MSED 3EHVA 3M62B 4WJPA 2CHWA 2KOXA 4FULA 2C5LC 4WWPA 1KM7A 2W9NA 4LCDE 3Q3JA 4WQOB 4LJPB 4P7IA 2IO1B 4B95A 3A4RA 1TBEA 4DDGD 3L54A 3OLMD 4ZRKA 1C1YB 4WJQA 2ZJDA 5AZHA 5JHAA 2IO3B 3TL5A 3I3TB 2I1JA 4F8CB 1GNUA 2NR2A 3L16A 3PREA 3TJPA 2KX0A 4MELA 1WYWB 1WR6E 2KK8A 1YX6B 3PTFC 1WE6A 2AEHA 3QJZA 3DOWA 5DPRA 3AI5A 3UIOB 3NZUA 3PPAA 3RZFA 3VVWB 4W9FA 1KLVA 1YJ1A 2C7MB 2O6VB 4K81A 2KWUB 5C1ZA 2AL3A 4JQWC 4I6LB 1GC7A 2V4LA 5J17A 1EF1A 3PRMB 2DHZA 2JZZA 3PRZA 4ZDVA 2LGDA 3AU4A 1WZ0A 1TGZB 4ANVA 1S3SG 2ZVNA 2M17A 3NZSA 2G4SA 3PHXB 1Q1OA 3OAWA 4IW0A 1YD8U 1JRUA 2EMTA 1WGGA 2BPSA 2PPHA 5D2MB 3R3MA 1WZ3A 4F7ZA 1LQBA 3JW0X 2YVCA 3UINB 3SU8X 4IUMB 2LWPA 2LGXA 4DHJB 1XQQA 2FIDA 4BFRA 1WM2A 4FHKA 2ZEQA 2CU1A 3A9KB 4NNJB 3ZTDA 1GG3A 4MEMA 1G6JA 2IZVB 4B9KA 3JVZX 3JYUA 2D3GA 3T8MA 1QZEA 2LVQA 3QC8B 4FN2A 4G11A 2MW5A 4IM0A 5AZFA 3RT3B 3VDZA 1SGHA 4AUQC 3IHPC 4W9IA 3PRPB 4NY0A 1WJ4A 2KDIA 3QX1A 4W9GA 3IG3A 3H9DA 2KO3A 2WDTB 4GIVA 4HPMB 2YLMA 4KV2A 3T9LA 3V62A 4IM2A 2KQ7A 2FAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXA A;  2KJH B;  1OEY J;  4FJZ A;  2IY0 B;  2KN5 A;  2DZM A;  1UZX B;  2IO2 B;  5IAA C;  3ZRF A;  4HCP B;  2L7R A;  3VXW A;  2I1K A;  3HHM A;  1EUV B;  3VTW A;  4TV3 A;  3RZW C;  3IVF A;  2L76 A;  3PS6 A;  2A4Z A;  4I6P A;  4GSW A;  4MSQ B;  4ZYN A;  2M4N A;  1WE7 A;  1LXD A;  3H7P B;  3KYD D;  3DBS A;  4W9J A;  3NY5 A;  3KH0 A;  4JIO U;  3H1U A;  4GDL B;  1E8X A;  4ANU A;  4EOY A;  3W1S C;  5L83 A;  2MBQ A;  4XX5 A;  4RM9 A;  3PLV A;  4ZRI A;  2KMA A;  2KTR B;  2KWV B;  1V2Y A;  2LZ6 A;  1YIW A;  3BIN A;  4NJ6 A;  1WGD A;  4K7U A;  2O2V B;  2V1Y A;  3AUL A;  4BKS A;  3VH3 B;  3QK0 A;  1P0R A;  3M95 A;  4DK5 A;  1VD2 A;  3H6N A;  2BWF A;  2JRH A;  2N9E B;  3N32 A;  4II3 B;  3UF8 A;  3ZLZ A;  2GBK A;  5D7G A;  2O6V A;  3B0A A;  4BVU C;  1WRD B;  3A9J B;  3PV1 A;  1P98 A;  2KDF B;  4EZJ A;  4I6N B;  5G2N A;  1Z5S B;  3HIZ A;  4RM8 A;  1OQY A;  5KHQ A;  4GDK A;  2WX1 A;  2MBH A;  2ASQ A;  2K6Q A;  3PT2 B;  4MM3 A;  1WI0 A;  1OTR B;  2XEW A;  4NQL B;  3VTV A;  3ZIM A;  4FAD A;  3B1L X;  2C9W B;  2FCN A;  4GXB A;  2BYF A;  3U8Z A;  3TCA A;  4W9E A;  3TIX A;  2C60 A;  4W9D A;  1WJU A;  2CR5 A;  3VFK A;  4WAA A;  2J0M A;  1H8C A;  3C0R B;  4MSM B;  2IY1 B;  1V86 A;  2N9P C;  5D94 A;  3ZDT A;  3KUZ A;  4EFO A;  2MBE A;  2NPT B;  2XK5 B;  2KD0 A;  3GOE A;  4CO7 A;  3UQA A;  3L08 A;  1R4M I;  1H4R A;  3ML8 A;  4EZK A;  3RUL A;  2FCQ A;  2JZ3 B;  5CHW A;  5CHF A;  1Q5W B;  4GMV A;  1EF5 A;  4ANX A;  1RFA A;  1S1Q B;  4FBJ B;  4HWI B;  3ZNZ B;  2WWZ A;  3KUC B;  1WMH A;  5E6P A;  1GJZ A;  1Y8R C;  2HE7 A;  3VUX A;  1C3T A;  5AZG A;  4KSL C;  2ZNV C;  1FXT B;  2ZCC A;  1WY8 A;  3HM3 A;  3N30 A;  4OVU A;  3MTN B;  3QWZ B;  4IWO A;  3VH4 B;  3WAL A;  5DPT A;  5DPW A;  3IFW B;  5E6N A;  2RPQ A;  4PS8 A;  2K25 A;  2NBV B;  2D07 B;  3PVL A;  3VHT C;  3VQI A;  1V80 A;  1YX5 B;  2REX A;  3AU5 A;  2L8J A;  2PE6 B;  1TTN A;  3H7S A;  1WJ6 A;  3U30 A;  4X57 B;  2RSU A;  2XBB C;  1P9D U;  3QIJ A;  2ZNV B;  2KMC A;  1MG8 A;  1WX7 A;  4DHZ B;  3DCG A;  2KTR A;  4EUT A;  5LLI A;  4NAW B;  1T0Y A;  3SD5 A;  3DBR I;  2O2V A;  3EEC A;  3JSV B;  3WIM A;  1WIA A;  3DVN U;  4DDI D;  2DZK A;  2NBU A;  3PHW B;  3GZN I;  3R7Q A;  3MHS D;  3ZTC A;  2MP2 A;  3B08 A;  4B6W A;  1L7Y A;  2DYM A;  2J7Q B;  3A9J A;  5KHO A;  2AYO B;  2BYV E;  1E8Y A;  3KW5 B;  4HXD A;  4GN1 A;  3W1S A;  3SDL C;  1XD3 B;  4TUU A;  4KSK C;  4A20 A;  3CF6 E;  4M8M A;  2JVC A;  2LI5 A;  4BBN F;  5C23 A;  1RLF A;  4AP4 C;  1WJN A;  4HK2 A;  1V5T A;  4EEW A;  2DZI A;  5EDS A;  5IA7 A;  3KYC D;  1U4A A;  4KIK A;  2FCS A;  3DVG Y;  3ENE A;  1I42 A;  2OJR A;  1ISN A;  3L10 B;  1E8W A;  2N1V A;  2UYZ B;  4JL9 A;  2K1F A;  3UGB B;  2N7D A;  3UIP B;  4HLE A;  4K1R B;  4XZ4 A;  3S2A A;  2JUO A;  2G4D B;  2KC2 A;  2NPT A;  4GOC A;  2XK5 A;  4TKN A;  5LXI B;  1WXV A;  2GBM A;  2BKR B;  2RGF A;  2M8S A;  1XT9 B;  1K8R B;  2MBB B;  3L17 A;  3A1Q B;  3IBE A;  2LVP A;  1LM8 B;  3NOB A;  4NQK E;  5GMV A;  4G50 A;  3A4S C;  1I35 A;  2OOB B;  2IO0 B;  2MX2 A;  3QCA A;  2GOW A;  5CTR C;  2JPH A;  3R7R A;  3O65 B;  3EC8 A;  3RUI B;  1GUA B;  2L05 A;  2CKH B;  4AOF A;  3TMP B;  2J0K A;  3DVN V;  3R66 C;  5J2R A;  4FHJ A;  4BOZ B;  3UQB A;  2R2Q A;  2K8H A;  2JT4 B;  2KDE B;  2EKE C;  4JGH B;  1UD7 A;  2D11 A;  3ALB A;  3K9P B;  5CX3 A;  1HE8 A;  4W9K A;  4IWQ A;  3ZNG C;  4LDT D;  2BKF A;  3ECI A;  4KZ0 A;  3WAN A;  1AAR A;  3LJ3 A;  2LAS A;  2L3Z A;  2GBJ A;  3APD A;  2GMI C;  4ICU A;  3WAM A;  2CHX A;  2ZCB A;  3CST A;  1ZW7 A;  4WWN A;  2PE9 A;  4F1S A;  1IP9 A;  3V60 A;  2LUE A;  3X23 A;  4OVV A;  3DDC B;  1X1M A;  4ICV A;  1WXS A;  3AXC A;  1NDD A;  3M63 B;  2B3A A;  4DHJ D;  4TQ0 A;  3KVF B;  1V5O A;  4G3X B;  4NAW A;  2HJ8 A;  5DCN A;  2N7E A;  2LGY A;  1IPG A;  2GBN A;  3VUY A;  4II2 B;  4JLC A;  2MWS B;  1F9J A;  4IC7 B;  4DHZ E;  1ZGU B;  2L0T A;  4MGK E;  3HM6 X;  5TR5 A;  4E74 A;  3A9K A;  1VCB A;  2KJR A;  4WWO A;  1RAX A;  1LFD A;  2G45 B;  4BBN C;  4DBG A;  3L13 A;  2RR9 A;  4A3O A;  2G3Q B;  3K9O B;  1WGY A;  2GBR A;  1GC6 A;  1P1A A;  2BWE S;  3CSF A;  1RRB A;  3LDZ E;  4CYE A;  5J18 A;  2JF5 A;  5FR6 A;  4GU2 A;  2D10 A;  2KTF A;  1A5R A;  3V6E B;  3L0W B;  2NVU I;  1UBQ A;  3PGE A;  4FA6 A;  4AJY B;  1V49 A;  1E5W A;  4DXA B;  4URK A;  4MJS B;  4EKU A;  2C7H A;  2K8C A;  3QA8 A;  2KFJ A;  3ZKJ C;  1WGH A;  4DWF A;  1KOT A;  3EFU A;  4M8N A;  2RD0 A;  4WJO A;  1Q0W B;  2JRI B;  1UEL A;  2DZJ A;  3A1Q A;  3ZUN A;  4EZL A;  1D3Z A;  3QAQ A;  5L95 C;  1KJT A;  2KLG A;  2NCN A;  2M1M A;  3H7P A;  2QHO A;  2R2O A;  2HTH A;  2WYQ A;  1YQB A;  4GDL A;  3QHT A;  2FUH B;  2MA9 B;  2KZR A;  3PZD A;  4FLH A;  4E3C A;  2FNJ B;  4BKT A;  5JHB A;  3M3J A;  1SIF A;  3N3K B;  2EMS A;  1J19 A;  2CHZ A;  4WJN A;  3ZDM C;  2L00 B;  4PS3 A;  3DPD A;  2KC1 A;  2L0F A;  2KDB A;  1PQS A;  2LRW A;  3RD2 A;  4IM3 A;  2KFK B;  1WX9 A;  2IYD B;  2NBW B;  4HDO A;  2ZZP B;  3DBH I;  3ZNI D;  1WH3 A;  3Q3F A;  3U7D A;  4KDL B;  4HDQ A;  4ZRJ A;  5CHV C;  4KDI C;  1Z2M A;  1OEY A;  4FJY A;  2KLC A;  2KXJ A;  1OGW A;  3P2B A;  4GDK B;  2Z0D B;  4KVG B;  2N4F A;  5D6J B;  1UH6 A;  1J8C A;  4LDT B;  3NS8 A;  2M0X A;  2V3S A;  1WM3 A;  2DYB A;  5G55 A;  2ZPN A;  4K7S A;  2BYE A;  3W1Y A;  1M94 A;  2CS4 A;  2MRP A;  3ML9 A;  3ONS A;  4MGZ E;  4BKG A;  2LXC A;  1IYF A;  1TZ1 A;  2PEA A;  1ZKH A;  3DBL I;  2DAF A;  3WA0 A;  4XC2 A;  1UGM A;  2KWC A;  1CMX B;  2K39 A;  3QQ8 B;  4FJV B;  4LJO B;  3VUW A;  4N9F 4;  3A33 B;  4HCN B;  1E90 A;  3DVG X;  4HPL B;  2D2Q A;  4PS7 A;  2NS5 A;  3RYT A;  3VAW A;  5JH5 C;  4W9H A;  4GB9 A;  1R4N I;  4BOS C;  3QAR A;  3WAO A;  2KJ6 A;  2ZVO A;  4W9L A;  1WMH B;  3APC A;  4E71 A;  2JWZ A;  4BKS D;  3V6C B;  2DEN B;  4PYZ A;  3OJ4 B;  1WXM A;  2MLB A;  2Z0E B;  2FIF A;  3MJW A;  2HD5 B;  3CMM B;  5JZE B;  2O6V D;  3X0W A;  4G0N B;  2IBI B;  2C7N B;  2DX5 B;  4MJS A;  2KAN A;  4AWJ A;  2ZPY A;  2AWT A;  3ZO5 B;  2K8B A;  5LXH A;  1E7V A;  4GGQ A;  2DAJ A;  3V61 A;  4HVB A;  4PYU A;  3ZRC A;  1WFY A;  3ZVV A;  4K7W A;  2WX0 A;  2DYO A;  1L2N A;  1E7U A;  2UWQ A;  2MBO A;  3RCZ A;  4ASW C;  4MGY E;  2BGF A;  4W9C A;  2K6D B;  3NHE B;  3KUD B;  2KHW B;  3SHQ A;  4ANW A;  3HK0 A;  3PSE B;  2KKC A;  4IG7 B;  4HJK A;  2LXA A;  4MGI E;  2PJH A;  4CHK A;  2AL6 A;  2Z59 B;  1E8Z A;  2KVR A;  3APF A;  3D32 A;  1NI2 A;  2KNB A;  2VRR B;  4MDK E;  3JSV A;  2BF8 B;  2FCM A;  1V6E A;  4MH0 E;  4TQ1 A;  4A3P A;  2KQS A;  2LD9 A;  2JY6 A;  1UBI A;  3VTU A;  5AEK B;  2N9X A;  2MCN B;  2KX3 A;  2JXX A;  2KFK A;  3TBL D;  4J6I A;  2MP2 B;  2A5U A;  1WX8 A;  3BY4 B;  4RMA A;  5DPS A;  1EO6 A;  3DQV A;  1P3Q U;  2J0J A;  5HKH A;  2LRU A;  3WAP A;  1WF9 A;  4YL8 A;  1SE9 A;  5BO4 B;  4M0W B;  4NJ7 A;  3ZW3 A;  1BT0 A;  2Y5B B;  1J0G A;  4KZC A;  4IWP A;  1V9J A;  4NPN A;  2MQJ A;  3ZNH B;  1V81 A;  4KIK B;  4AJW A;  2LJ5 A;  1WR1 A;  5E6O A;  2N1W A;  1WGR A;  1NBF C;  3OJ3 A;  3PLU A;  2LVO A;  2MSE D;  3EHV A;  3M62 B;  4WJP A;  2CHW A;  2KOX A;  4FUL A;  2C5L C;  4WWP A;  1KM7 A;  2W9N A;  4LCD E;  3Q3J A;  4WQO B;  4LJP B;  4P7I A;  2IO1 B;  4B95 A;  3A4R A;  1TBE A;  4DDG D;  3L54 A;  3OLM D;  4ZRK A;  1C1Y B;  4WJQ A;  2ZJD A;  5AZH A;  5JHA A;  2IO3 B;  3TL5 A;  3I3T B;  2I1J A;  4F8C B;  1GNU A;  2NR2 A;  3L16 A;  3PRE A;  3TJP A;  2KX0 A;  4MEL A;  1WYW B;  1WR6 E;  2KK8 A;  1YX6 B;  3PTF C;  1WE6 A;  2AEH A;  3QJZ A;  3DOW A;  5DPR A;  3AI5 A;  3UIO B;  3NZU A;  3PPA A;  3RZF A;  3VVW B;  4W9F A;  1KLV A;  1YJ1 A;  2C7M B;  2O6V B;  4K81 A;  2KWU B;  5C1Z A;  2AL3 A;  4JQW C;  4I6L B;  1GC7 A;  2V4L A;  5J17 A;  1EF1 A;  3PRM B;  2DHZ A;  2JZZ A;  3PRZ A;  4ZDV A;  2LGD A;  3AU4 A;  1WZ0 A;  1TGZ B;  4ANV A;  1S3S G;  2ZVN A;  2M17 A;  3NZS A;  2G4S A;  3PHX B;  1Q1O A;  3OAW A;  4IW0 A;  1YD8 U;  1JRU A;  2EMT A;  1WGG A;  2BPS A;  2PPH A;  5D2M B;  3R3M A;  1WZ3 A;  4F7Z A;  1LQB A;  3JW0 X;  2YVC A;  3UIN B;  3SU8 X;  4IUM B;  2LWP A;  2LGX A;  4DHJ B;  1XQQ A;  2FID A;  4BFR A;  1WM2 A;  4FHK A;  2ZEQ A;  2CU1 A;  3A9K B;  4NNJ B;  3ZTD A;  1GG3 A;  4MEM A;  1G6J A;  2IZV B;  4B9K A;  3JVZ X;  3JYU A;  2D3G A;  3T8M A;  1QZE A;  2LVQ A;  3QC8 B;  4FN2 A;  4G11 A;  2MW5 A;  4IM0 A;  5AZF A;  3RT3 B;  3VDZ A;  1SGH A;  4AUQ C;  3IHP C;  4W9I A;  3PRP B;  4NY0 A;  1WJ4 A;  2KDI A;  3QX1 A;  4W9G A;  3IG3 A;  3H9D A;  2KO3 A;  2WDT B;  4GIV A;  4HPM B;  2YLM A;  4KV2 A;  3T9L A;  3V62 A;  4IM2 A;  2KQ7 A;  2FAZ A; 
#chains in the Genus database with same CATH topology
 1OEY J;  2EKI A;  4FJZ A;  4HKQ A;  4L1B A;  1PFD A;  3ZRF A;  4HCP B;  2L7R A;  3VXW A;  3PS6 A;  4MSQ B;  1C79 A;  1LXD A;  3KYD D;  3NY5 A;  3H1U A;  4GDL B;  3ZXR A;  4EOY A;  2QDF A;  5L83 A;  4XE0 A;  4RM9 A;  2KMA A;  2MJD A;  4RGO S;  3BIN A;  4NJ6 A;  2V3P A;  4K7U A;  2V1Y A;  1ESF A;  4BKS A;  4HPP A;  1F77 A;  2BWF A;  2O6V A;  3B0A A;  1C77 A;  2IPK D;  4K3C A;  1MVK A;  3P4P B;  3OWE B;  1DOX A;  1P98 A;  2KDF B;  4XDD A;  1Z5S B;  4RM8 A;  2L32 A;  4GDK A;  4IOI E;  1WI0 A;  2V3N A;  1OTR B;  3ETR A;  3ZIM A;  3TCA A;  1QKZ A;  4W9E A;  5IO9 A;  3TIX A;  4Q2J A;  2C60 A;  4W9D A;  1E7P B;  2CR5 A;  3VFK A;  1SEB D;  3C0R B;  3DBL B;  4MSM B;  3ZDT A;  3VRB B;  4C7Z A;  1R4M I;  2WXM A;  2B76 B;  2BTE A;  1Q5W B;  1QLB B;  1S1Q B;  1WMH A;  2W82 A;  5E6P A;  4KSL C;  2ZNV C;  3RNB C;  2YEP F;  1EWY C;  2ZCC A;  3HM3 A;  5EE9 A;  3VH4 B;  4IWO A;  5DPT A;  5E6N A;  3OG5 A;  1XEE A;  3KLS X;  3VHT C;  3VQI A;  3LB8 C;  1TTN A;  4ZOH C;  2XBB C;  2OJW A;  3QIJ A;  2WS3 B;  1WX7 A;  4DHZ B;  3AV8 A;  2KTR A;  1D5X C;  5LLI A;  1XO3 A;  3EEC A;  1WIA A;  4A9A A;  1GB4 A;  1JWB D;  1J7B A;  3TEW A;  2AYO B;  1V97 A;  1YN5 A;  3SDL C;  1XD3 B;  1FFU A;  2GRI A;  1TS3 A;  2JVC A;  2LI5 A;  1WJN A;  5EDS A;  5IA7 A;  5JXV A;  4PT5 A;  1B9R A;  2K1F A;  4EE2 A;  4K1R B;  3S2A A;  1YJI A;  4GOC A;  2G4D B;  2KC2 A;  4TKN A;  2XK5 A;  2GBM A;  2BKR B;  2RGF A;  3HRD D;  1K8R B;  3IBE A;  4NQK E;  5GMV A;  1F1H A;  4G50 A;  4ARC A;  1C78 A;  2AQ3 B;  2MX2 A;  4ZRP A;  2WNM A;  1YN3 A;  5CTR C;  3R7R A;  3LYY A;  1CK1 A;  3EC8 A;  3RUI B;  3T3O A;  4FHJ A;  2K8H A;  3MHZ A;  1JRO A;  3ALB A;  1HE8 A;  1ZUD 2;  4IWQ A;  2BB5 A;  2KN4 A;  2RDG A;  3DWG C;  2BKF A;  3P1M A;  4LDT D;  4KZ0 A;  3RPF C;  3LJ3 A;  4DQO C;  3WAM A;  2CHX A;  4HJG E;  1ZW7 A;  4F1S A;  2PE9 A;  1L0X B;  2J53 A;  2SEB D;  4ICV A;  5AUI A;  1WXS A;  2B3A A;  1V5O A;  3U52 E;  4NAW A;  2HJ8 A;  2AQ2 B;  2LGY A;  2W3R A;  4JLC A;  2MWS B;  4IC7 B;  1SXT A;  1ZGU B;  2L0T A;  2IGD A;  4MGK E;  1VZ8 A;  2KJR A;  1BXT A;  4BBN C;  4XDC A;  3K9O B;  4A3O A;  1WGY A;  1GC6 A;  1P1A A;  2V4I B;  5J18 A;  3W5U B;  1I4R A;  3Q14 C;  1YN4 A;  2INC C;  1NI3 A;  2WXJ A;  2C7H A;  2K8C A;  4DWF A;  1KOT A;  3EFU A;  4WJO A;  2WDV B;  2DZJ A;  2KLG A;  2M1M A;  2H89 B;  2VZK D;  2MA9 B;  3PZD A;  4FLH A;  1RM6 C;  4A6Q A;  3NG0 A;  3T3N A;  1GPX A;  2L00 B;  4PS3 A;  5AUK A;  1IGD A;  2LRW A;  2IYD B;  3FKY A;  4HDO A;  3V05 A;  1WH3 A;  3U7D A;  3CIR B;  4NJC A;  4KVG B;  2Z0D B;  4MM3 B;  5D6J B;  4LK0 M;  4LDT B;  4C4V A;  1WM3 A;  4YSX B;  3N20 C;  1M94 A;  2MRP A;  3ML9 A;  4MGZ E;  3TEZ A;  2TSS A;  1ZKH A;  3WA0 A;  2DAF A;  2BB6 A;  2WXI A;  1I4Q A;  2K39 A;  1KRH A;  4FJV B;  4N9F 4;  3W5V B;  2NMQ A;  3Q8C A;  2NS5 A;  3RYT A;  4W9H A;  1R4N I;  4BOS C;  2KJ6 A;  2WXH A;  4W9L A;  1SE3 A;  3MC8 A;  5FR3 A;  2DEN B;  2HD5 B;  4LTU A;  2C7N B;  2DX5 B;  3EGR A;  4MJS A;  1GOZ A;  2K8B A;  1DYQ A;  3ZVV A;  1WRI A;  2WX0 A;  4N59 A;  3P42 A;  2MBO A;  4MGY E;  2BGF A;  3BK1 A;  2X8X X;  4IG7 B;  4A8X C;  2Z59 B;  1E8Z A;  1SF0 A;  2V9H A;  2KNB A;  2BF8 B;  2FCM A;  2VZK B;  2LD9 A;  3VTU A;  2JY6 A;  1UBI A;  2N9X A;  1UNS A;  2JXX A;  3DBH B;  2VH1 A;  2BQQ A;  3BY4 B;  4RMA A;  1JQ4 A;  1EO6 A;  2N9L A;  4ZHO A;  3NUH B;  1P3Q U;  2J0J A;  1WF9 A;  3FIL B;  5BO4 B;  2Y5B B;  2MQJ A;  4KIK B;  5D3D A;  4AJW A;  2G1E A;  2LJ5 A;  2KVZ A;  1NBF C;  4J3O D;  2WXO A;  1L0Y B;  4USA A;  4KGS A;  3Q3J A;  4WQO B;  1QOG A;  4P7I A;  2IO1 B;  3A4R A;  3Q6B A;  3OLM D;  5JHA A;  3RNA C;  4M02 A;  2I1J A;  1GNU A;  3L16 A;  3PRE A;  3TJP A;  1TS4 A;  2KK8 A;  3P4R B;  3UIO B;  2I2Y A;  2SAK A;  3RZF A;  2WXP A;  2V4L A;  4LNN A;  3AU4 A;  1WZ0 A;  1TT5 B;  3PHX B;  4RNA A;  1NVI D;  3P4Q B;  2KQ4 X;  2DWQ A;  1WZ3 A;  1ZXI A;  2J52 A;  3NJT A;  3TEY A;  4IUM B;  2LGX A;  2ZEQ A;  3ZTD A;  3A9K B;  1GG3 A;  2D3G A;  2ACZ B;  1QZE A;  4RH6 A;  3EUB 2;  4M0W A;  1BUI C;  3PRP B;  4W9I A;  1WJ4 A;  3QX1 A;  4W9G A;  3IG3 A;  3T9L A;  4KV2 A;  1B1Z A;  3RI7 C;  1IBX A;  3GS2 A;  3V62 A;  2PTL A;  1M4V A;  2KJH B;  1XF5 L;  2IY0 B;  2KN5 A;  4YTN B;  1QQR A;  3VTW A;  3Q2A C;  4ZYN A;  1L0V B;  1WE7 A;  3H7P B;  1QF6 A;  1E8X A;  4ANU A;  1NEN B;  2QMT A;  1T0S C;  5T8I A;  1V2Y A;  2LZ6 A;  4LNO A;  4WIP A;  1V1O A;  2O2V B;  4DK5 A;  1ZP0 B;  1E0Z A;  5D7G A;  3IT6 B;  1D4B A;  2BT6 A;  5HFY A;  1OQY A;  5KHQ A;  3IAM 1;  2WX1 A;  2K6Q A;  3PT2 B;  4A55 A;  1TKE A;  1XLO A;  2C9W B;  4GXB A;  4ZHP A;  3BK2 A;  1WJU A;  2IY1 B;  2NPT B;  2KD0 A;  1V8C A;  3HVD A;  2JYE A;  1H4R A;  3ML8 A;  1ENF A;  3RUL A;  2FCQ A;  4GMV A;  1RFA A;  4HWI B;  3ZNZ B;  1PGB A;  3KUC B;  1GJZ A;  5AZG A;  3WAL A;  4OVU A;  1NEK B;  3MTN B;  3QWZ B;  2GI9 A;  2LHE A;  3GE3 C;  1ET9 A;  1TJE A;  2RPQ A;  1FXI A;  1OQQ A;  3BII D;  2K25 A;  2D07 B;  1V80 A;  3AEC B;  2IGH A;  2PE6 B;  3H7S A;  1WJ6 A;  3U30 A;  2QJL A;  3ZJV A;  3E56 A;  2KMC A;  1PGA A;  2AX5 A;  3DCG A;  2JZP A;  1NYR A;  3DBR I;  3JSV B;  2OED A;  4YTM B;  1FD6 A;  3WIM A;  4DDI D;  2DZK A;  3PHW B;  2PW9 A;  2PKO A;  2WXF A;  3R7Q A;  3MHS D;  3ZTC A;  2MP2 A;  3B08 A;  4B6W A;  2DYM A;  5KHO A;  4IKG A;  3KW5 B;  4HXD A;  3W1S A;  5FKA C;  2LJI A;  5C23 A;  1RLF A;  1TS5 A;  5D3I B;  4EEW A;  3I5J C;  1WWT A;  2E6X A;  1T3Q A;  3DVG Y;  3ENE A;  1I42 A;  1QOB A;  2N1V A;  3UGB B;  2Z8L A;  3UIP B;  2K0P A;  3VRA B;  2NTS A;  2BS3 B;  2MBB B;  3AH7 A;  3A1Q B;  3NOB A;  1LM8 B;  3A4S C;  2IO0 B;  2JPH A;  3O65 B;  1GUA B;  4AOF A;  3AE3 B;  3TMP B;  2J0K A;  3R66 C;  5J2R A;  2XNA C;  1ET6 A;  2Y5P A;  1NYQ A;  4JGH B;  2KYW A;  3W2D A;  3V3X A;  5CX3 A;  4RGN A;  3AED B;  1MJD A;  2AQ1 B;  3ECI A;  3WAN A;  1AAR A;  2LAS A;  2PMV A;  2GMI C;  4ICU A;  2ZCB A;  4WWN A;  1IP9 A;  4LNF A;  5EE0 A;  3V60 A;  3X23 A;  4OVV A;  1NDD A;  2K9X A;  3M63 B;  4DHJ D;  3KVF B;  1TY0 A;  1SSN A;  4II2 B;  2WXK A;  1SB3 C;  5TR5 A;  3HM6 X;  1K51 A;  1VCB A;  3KWL A;  1RAX A;  4DBG A;  3L13 A;  2I38 A;  1OFF A;  2GBR A;  1RRB A;  3CWI A;  3Q3N C;  4OHJ A;  5FR6 A;  3AE9 B;  1FM0 D;  1A5R A;  1QIL A;  2NVU I;  4AJY B;  1V49 A;  1E5W A;  4DXA B;  2M19 A;  4URK A;  1J7C A;  1HXY D;  4EKU A;  3QA8 A;  2QEJ C;  2DBY A;  1WGH A;  5E6J A;  4MT5 A;  4M8N A;  3RNF C;  1Q0W B;  1E6E B;  4EZL A;  3ZUN A;  2IJ0 A;  1D3Z A;  5L95 C;  3I9V 1;  2NCN A;  3FAH A;  1YQB A;  3QHT A;  2FUH B;  4E3C A;  4XGA B;  1WSP A;  1XCT L;  3M3J A;  2L0F A;  3U2S C;  3R2T A;  1PDX A;  4AQ7 A;  4IM3 A;  2KFK B;  3RN9 C;  2LHD A;  2NBW B;  3DBH I;  4MH8 A;  2KWD A;  4KDI C;  3FC4 A;  4C7Y A;  2Q5W D;  2KLC A;  4GDK B;  2N4F A;  1J8C A;  2J42 A;  2V3S A;  1WXQ A;  1PGX A;  2DYB A;  2BYE A;  1F52 A;  3ONS A;  4REZ A;  3AEB B;  2LXC A;  1TZ1 A;  3RNE C;  1C4C A;  2WLB A;  1ZDV A;  2MH7 A;  3QQ8 B;  5BYR A;  3VUW A;  3N1X C;  2D2Q A;  2R61 A;  3VAW A;  1Q10 A;  2DNF A;  4GB9 A;  3WAO A;  1WMH B;  3APC A;  2JWZ A;  3V6C B;  4PYZ A;  4N58 A;  3MJW A;  3CMM B;  2BW2 A;  1SJE D;  3AEF B;  2KAN A;  3BWU D;  2BBC A;  3ZO5 B;  4O1N A;  4GGQ A;  3V61 A;  4HVB A;  4ZYS A;  1WFY A;  1L2N A;  3RCZ A;  4ASW C;  2Y5C A;  2K6D B;  3AEG B;  3NHE B;  2KHW B;  3SHQ A;  3HK0 A;  3PSE B;  4HJK A;  2LXA A;  2LEK A;  2WP9 B;  3APF A;  3DBR B;  3D32 A;  2VRR B;  4MH0 E;  4UDU C;  1MI0 A;  1PYW D;  2KX3 A;  1RWS A;  4K3B A;  2A5U A;  5DPS A;  3DHH C;  2BVC A;  4OZC A;  1J0G A;  4NJ7 A;  3ZW3 A;  4D2K A;  4BAX A;  1F0Z A;  1A70 A;  2LUM A;  2ZW1 A;  4YSY B;  4JWS C;  4HRS A;  1FRR A;  1QT9 A;  1WGR A;  3OJ3 A;  2LVO A;  2VH2 A;  3M62 B;  2KOX A;  2C5L C;  1MG4 A;  2W9N A;  1FMA D;  2QC8 A;  4LCD E;  3RNG C;  1V1P A;  1TBE A;  2ON8 A;  4DDG D;  3L54 A;  4IDI A;  1C1Y B;  2W3S A;  5AZH A;  3AE8 B;  2IO3 B;  1XLN A;  3TL5 A;  2JX5 A;  2NR2 A;  4HRO A;  1WYW B;  1C4A A;  1MHH E;  1RFK A;  2K22 A;  3DOW A;  1ZPS A;  1JAL A;  5EE3 A;  1AW7 A;  5C1Z A;  4XWW A;  2AL3 A;  1E9M A;  3BVM A;  1JWS D;  1GC7 A;  4LLG M;  1DOI A;  3PRZ A;  3I57 A;  1ACC A;  4RFB A;  1I4G A;  2ZVN A;  2M17 A;  4QAY A;  1N61 A;  1Q1O A;  4XYC A;  1YD8 U;  1JRU A;  3HUI A;  2BPS A;  4WQM A;  2PPH A;  3DHG C;  5D2M B;  4RGM A;  3JW0 X;  3SU8 X;  1XQQ A;  4BFR A;  1WM2 A;  4B9K A;  3JVZ X;  4FXC A;  1YQ3 B;  3QC8 B;  1HQR D;  2XN9 C;  2MW5 A;  3VDZ A;  5MPO A;  1SGH A;  4AUQ C;  2HTM E;  4B0E A;  1YOV B;  2KDI A;  4HPM B;  2KO3 A;  2WDT B;  2KAJ A;  1F2R I;  1WXA A;  2LMC A;  2DZM A;  3UI3 A;  1ZE3 D;  2IO2 B;  3HHM A;  2ONQ A;  3AN1 A;  2DLB A;  1GAQ B;  2L76 A;  2A4Z A;  4I6P A;  4GSW A;  2M4N A;  3DBS A;  4JIO U;  3W1S C;  3BVZ A;  4ZRI A;  3VR9 B;  1UUP A;  3AUL A;  1ZDX A;  1WYG A;  3QK0 A;  3VH3 B;  2WQY B;  3H6N A;  2N9E B;  4II3 B;  2YEP B;  1TYG B;  4BVU C;  1WRD B;  3A9J B;  3PV1 A;  4EZJ A;  4I6N B;  4ZRQ A;  2MBH A;  4C4V B;  2XEW A;  4NQL B;  3VTV A;  4FAD A;  2FCN A;  2BYF A;  2L1A A;  4WAA A;  4WWM A;  2N9P C;  3KUZ A;  2MBE A;  3UQA A;  4EZK A;  1C4P A;  4KGR A;  2JZ3 B;  5IOI A;  3MP9 A;  5CHW A;  1EF5 A;  3Q8A A;  3I63 C;  2WWZ A;  3TUO A;  1Y8R C;  2HE7 A;  1JRP A;  1FXT B;  1WY8 A;  1VZ6 A;  3N30 A;  1EU3 A;  1WGK A;  4PS8 A;  1FNW A;  5H92 C;  2NBV B;  3AU5 A;  2LFI A;  2L8J A;  3O13 A;  4X57 B;  1UWX A;  2RSU A;  2INP E;  1P9D U;  1JWA D;  2ZNV B;  5IP4 D;  2L83 A;  1T0Y A;  1UGJ A;  3SD5 A;  2O2V A;  3DVN U;  2EEL A;  2NBU A;  5BMH A;  4L2Y A;  3W9C B;  1E8Y A;  4GN1 A;  4R3D A;  4ITK A;  1HTO A;  3P63 A;  4M8M A;  4AP4 C;  4HK2 A;  1VR9 A;  1U4A A;  2FCS A;  1ISN A;  1E8W A;  1R7S A;  2JUO A;  2NPT A;  2L52 A;  3KWV A;  2M8S A;  3L17 A;  1HZ6 A;  1JWU D;  3TSS A;  1MHX A;  5IN7 A;  2GLS A;  2OOB B;  3QCA A;  3IAS 1;  2GOW A;  4S17 A;  1T0R C;  1VLB A;  3DVN V;  2W54 A;  2JT4 B;  2KDE B;  1CJE A;  4LNI A;  1EM7 A;  4CQN A;  2D11 A;  3ZNG C;  5BMI A;  3ZGZ A;  4ARI A;  2WGS A;  2IGG A;  2LUE A;  3DDC B;  1X1M A;  2PVG C;  4TQ0 A;  4G3X B;  2N7E A;  1JCK B;  2MJ3 A;  1OQR A;  2MJE A;  3GZN B;  3AE2 B;  4DHZ E;  3AE7 B;  2WXQ A;  5BMG A;  5I4D A;  1LFD A;  2G45 B;  2RR9 A;  2G3Q B;  2BWE S;  1TKG A;  3CSF A;  4CYE A;  1PUT A;  3NVZ A;  2V0G A;  4GU2 A;  4WAF A;  2D10 A;  3L0W B;  3PGE A;  1UBQ A;  2JWU A;  3IT4 B;  3ZKJ C;  4JX1 C;  2RD0 A;  1AN8 A;  2JRI B;  1D6E C;  1UEL A;  3A1Q A;  3Q8E A;  4DXG A;  4KKJ A;  2QHO A;  2R2O A;  3NS1 A;  2WYQ A;  4GDL A;  1KFY B;  2WDQ B;  4MAC A;  2FNJ B;  2N7J A;  1SIF A;  2W55 A;  3N3K B;  4OW0 A;  1J19 A;  2CHZ A;  3ZDM C;  1E10 A;  2KC1 A;  2K3U A;  1PQS A;  3RD2 A;  3P4S B;  4P1B C;  1IUE A;  2ZZP B;  4M00 A;  4A90 A;  3Q3F A;  4HDQ A;  1MPE A;  1Z2M A;  2KXJ A;  1OGW A;  3P2B A;  1UH6 A;  1CZP A;  3B2G A;  3BZD B;  5HHD G;  4GLS C;  3BYT B;  5C2T B;  3RFZ B;  3RNC C;  5G55 A;  2ZPN A;  4K7S A;  3W1Y A;  3MC0 B;  4BKG A;  2ZW0 A;  1IYF A;  2PEA A;  4XC2 A;  3SEB A;  3AE4 B;  2KWC A;  1YJJ A;  2GB1 A;  3IXS A;  4HCN B;  4TSS A;  2RPV A;  4PS7 A;  1N5W A;  5TSS A;  4P1C C;  1UWM A;  4BKS D;  5HG2 A;  1VJK A;  2Z0E B;  2FIF A;  2O6V D;  4G0N B;  2Y3A A;  4AWJ A;  2ZPY A;  2AWT A;  2RMM A;  5LXH A;  1HTQ A;  5GXG B;  4KGT A;  1T5X D;  2JYT A;  3ZRC A;  1I4P A;  4K7W A;  1E7U A;  4C56 C;  3PZ8 A;  4HKZ E;  4W9C A;  1XCQ L;  3KUD B;  4ANW A;  1TZO A;  2KKC A;  4MGI E;  2JU6 X;  4TQ1 A;  1STE A;  1V6E A;  1FCC C;  2MCN B;  2KFK A;  3TBL D;  2MP2 B;  1WX8 A;  2H88 B;  4OZA A;  2LRU A;  1TIF A;  3WAP A;  4YL8 A;  1SE9 A;  2CJO A;  3N9Y C;  1T0Q C;  4IWP A;  2D5G A;  2QIE B;  3ZNH B;  1TKY A;  1V81 A;  1WR1 A;  3AE1 B;  3NVV A;  3EHV A;  5IKC M;  1KF6 B;  1GB1 A;  3AB5 A;  4LJP B;  2WXN A;  1L6V A;  1KLG D;  4OVZ A;  4WJQ A;  3TEX A;  3I3T B;  1L6U A;  4F8C B;  2KX0 A;  3Q8B A;  1YX6 B;  5DPR A;  1WE6 A;  3AI5 A;  3DWM A;  1C9F A;  3NZU A;  2WU5 B;  3PPA A;  3BVG A;  3GB1 A;  1KLV A;  1YJ1 A;  2C7M B;  4ACF A;  2O6V B;  4K81 A;  2KWU B;  1FEH A;  4I6L B;  4JPS A;  1KLU D;  3AE6 B;  3EA6 A;  4ZDV A;  2LGD A;  1TGZ B;  4ANV A;  1S3S G;  2UU7 A;  2EMT A;  1WGG A;  3R3M A;  1KTK A;  5EE1 A;  4TMA B;  4DHJ B;  1T6B X;  2FID A;  1BML C;  1G6J A;  2CU1 A;  2IZV B;  1XLP A;  3T8M A;  2LVQ A;  4IM0 A;  5AZF A;  1FNV A;  4IM2 A;  4JE3 B;  2FAZ A;  2IND C;  1UZX B;  3NVY A;  5IAA C;  2I1K A;  2QIL A;  1EU4 A;  1EUV B;  1HA5 A;  4TV3 A;  2WXG A;  3RZW C;  3IVF A;  3C8Y A;  2N9K A;  4B0M A;  4W9J A;  3KH0 A;  3LXF A;  1EWC A;  2MBQ A;  4XX5 A;  3PLV A;  2KTR B;  2KWV B;  1DOY A;  1YIW A;  1WGD A;  1P0R A;  3M95 A;  1N5X A;  1VD2 A;  2JRH A;  3N32 A;  3UF8 A;  3ZLZ A;  2GBK A;  2KT7 A;  1MFW A;  1LGR A;  2PVO D;  1I4H A;  3C19 A;  3HIZ A;  5G2N A;  2IDY A;  3U4E G;  3B9J A;  2ASQ A;  4MM3 A;  5C3J B;  3B1L X;  2FUG 1;  3BYY B;  4C00 A;  3U8Z A;  4BZA A;  1F2R C;  2J0M A;  3NRZ A;  1H8C A;  5D94 A;  1V86 A;  1ZOY B;  4EFO A;  2XK5 B;  4CO7 A;  3GOE A;  1N6Z A;  4KKI A;  3L08 A;  4WUR A;  4ANX A;  1VDV A;  5CHF A;  4FBJ B;  3VUX A;  1C3T A;  1Y56 A;  3B2F A;  5DPW A;  3IFW B;  2LGS A;  3PVL A;  4M01 A;  1YX5 B;  2REX A;  2PIA A;  2MEK A;  1HZ5 A;  2LGI A;  4YT0 B;  1I7H A;  2PLP A;  2M0A A;  1MG8 A;  4US9 A;  3U7Z A;  2JXT A;  2JQR B;  1P7E A;  4EUT A;  3ZYY X;  1LO5 D;  4NAW B;  2FBW B;  2WDR B;  3GZN I;  2NTT A;  2G9H D;  1L7Y A;  2J7Q B;  3A9J A;  2BYV E;  4HEA 1;  2MHJ A;  4TUU A;  4KSK C;  4A20 A;  3FIL A;  3CF6 E;  4BBN F;  4LNK A;  1V5T A;  2DZI A;  3KYC D;  4KIK A;  5BYQ A;  2OJR A;  4US8 A;  4S0R A;  3L10 B;  2UYZ B;  4JL9 A;  2N7D A;  2E3T A;  4HLE A;  4XZ4 A;  5LXI B;  3ZXV A;  1R4M B;  3N1Y C;  1WXV A;  1XT9 B;  1DGJ A;  3NZ3 A;  2LVP A;  1V1P B;  3MC9 A;  1I35 A;  3SFE B;  2WXL A;  3J9C A;  1QOA A;  4YWG G;  2L05 A;  2CKH B;  4OZB A;  4BOZ B;  3UQB A;  2R2Q A;  3Q8F A;  2EKE C;  1TY2 A;  1UD7 A;  1YMH E;  1D5M C;  3K9P B;  2D3B A;  4YTP B;  5BYS A;  4W9K A;  1AYF A;  4PK1 A;  1ROE A;  2L3Z A;  2GBJ A;  2OHF A;  3APD A;  3CST A;  2BS2 B;  1D5Z C;  3AXC A;  2X38 A;  5DCN A;  1L4D B;  2BS4 B;  5FK9 C;  1IPG A;  2GBN A;  4YSZ B;  3VUY A;  1F9J A;  4E74 A;  3E9S A;  3A9K A;  4WWO A;  4DXF A;  1L4Z B;  3HVZ A;  2J4X A;  1K53 A;  2KDM A;  1JML A;  2WHI A;  3LDZ E;  1FCL A;  1N63 A;  2JF5 A;  2KTF A;  3V6E B;  4FA6 A;  1SE4 A;  2INN E;  4MJS B;  2KFJ A;  4AS1 A;  3URY A;  4RGT A;  1CQV A;  2D3C A;  3Q3M C;  3QAQ A;  1KJT A;  3MJ5 A;  3AEA B;  3R8B A;  3H7P A;  1K52 A;  2HTH A;  2KAC A;  1JW9 D;  1SE2 A;  2KZR A;  3H8H A;  4BKT A;  5JHB A;  2EMS A;  3AM9 A;  4WJN A;  1SIJ A;  1UF0 A;  3DPD A;  2CU3 A;  2QSD A;  4RCO A;  2KDB A;  3AEE B;  1WX9 A;  4RF0 A;  3ZNI D;  4KDL B;  4ZRJ A;  1KH0 A;  1SJH D;  5CHV C;  3ABV B;  1OEY A;  4FJY A;  5HI1 A;  2HJ1 A;  4XWT A;  3NS8 A;  1P7F A;  3ZJT A;  1K50 A;  2M0X A;  3VR8 B;  3GE8 C;  1FIQ A;  1N62 A;  2CS4 A;  3AE5 B;  1J7A A;  3Q3O C;  3DBL I;  1UGM A;  1CMX B;  3PZ7 A;  3Q69 A;  4LJO B;  3ZJU A;  2BYT A;  5G5H A;  3A33 B;  1FNU A;  1E90 A;  1QOF A;  1FRD A;  3DVG X;  4HPL B;  4KX6 B;  5JH5 C;  1VRA B;  3QAR A;  3PO0 A;  2ZVO A;  4E71 A;  3NVW A;  5G5G A;  3OJ4 B;  1WXM A;  2MLB A;  1YNT E;  5JZE B;  4JWU C;  2HDE A;  2JSV X;  3X0W A;  4C80 A;  2IBI B;  4NZL B;  4RF1 A;  2WU2 B;  1E7V A;  2DAJ A;  4PYU A;  1ZXH A;  1I4X A;  2DYO A;  2UWQ A;  3SR6 A;  1FPY A;  1L5P A;  1N60 A;  3RMK C;  3SFD B;  1HEZ E;  2KMM A;  2FE8 A;  2PJH A;  3DHI C;  4CHK A;  2AL6 A;  2KVR A;  1NI2 A;  4MDK E;  3JSV A;  4A3P A;  2KQS A;  4L23 A;  5AEK B;  5H8Y E;  5LNK 1;  3KQ4 A;  4J6I A;  1FO4 A;  3L4P A;  3DQV A;  1SBB B;  1VZ7 A;  1RYJ A;  5HKH A;  3ZQ4 A;  4P16 A;  2N0S B;  4M0W B;  1BT0 A;  4KZC A;  1IBX B;  1V9J A;  4NPN A;  5E6O A;  2N1W A;  1JWM D;  3PLU A;  3R2I A;  2MSE D;  3WCQ A;  1XLQ A;  4WJP A;  2CHW A;  4FUL A;  1FXA A;  4WWP A;  1AWD A;  1KM7 A;  4P6V F;  4B95 A;  1R4N B;  2CJN A;  2ICI A;  1FFV A;  4NAM A;  2RDH A;  4ZRK A;  2ZJD A;  1TS2 A;  2M56 B;  3MFG A;  3N1Z C;  4MEL A;  3GP7 A;  3PTF C;  1WR6 E;  2AEH A;  3QJZ A;  1IGC A;  3VVW B;  4W9F A;  1C76 A;  2QCZ A;  4JQW C;  5J17 A;  1EF1 A;  1XXG A;  2RDB C;  3PRM B;  4N6E B;  2DHZ A;  2JZZ A;  4H2A A;  1YQ4 B;  3NZS A;  2G4S A;  3OAW A;  4IW0 A;  4F7Z A;  2D3A A;  1LQB A;  2YVC A;  3UIN B;  2LWP A;  3AMZ A;  4FHK A;  4NNJ B;  4MEM A;  2WXR A;  3JYU A;  4YXD B;  2K5P A;  4FN2 A;  4G11 A;  3RT3 B;  3EFC A;  4WH4 A;  3IHP C;  4NY0 A;  3H9D A;  4GIV A;  2YLM A;  2KQ7 A; 
#chains in the Genus database with same CATH homology
 1WXA A;  2KJH B;  1OEY J;  4FJZ A;  2IY0 B;  2KN5 A;  2DZM A;  1UZX B;  2IO2 B;  5IAA C;  3ZRF A;  4HCP B;  2L7R A;  3VXW A;  2I1K A;  3HHM A;  1EUV B;  3VTW A;  4TV3 A;  3RZW C;  3IVF A;  2L76 A;  3PS6 A;  2A4Z A;  4I6P A;  4GSW A;  4MSQ B;  4ZYN A;  2M4N A;  1WE7 A;  1LXD A;  3H7P B;  3KYD D;  3DBS A;  4W9J A;  3NY5 A;  3KH0 A;  4JIO U;  3H1U A;  4GDL B;  1E8X A;  4ANU A;  4EOY A;  3W1S C;  5L83 A;  2MBQ A;  4XX5 A;  4RM9 A;  3PLV A;  4ZRI A;  2KMA A;  2KTR B;  2KWV B;  1V2Y A;  2LZ6 A;  1YIW A;  3BIN A;  4NJ6 A;  1WGD A;  4K7U A;  2O2V B;  2V1Y A;  3AUL A;  4BKS A;  3VH3 B;  3QK0 A;  1P0R A;  3M95 A;  4DK5 A;  1VD2 A;  3H6N A;  2BWF A;  2JRH A;  2N9E B;  3N32 A;  4II3 B;  3UF8 A;  3ZLZ A;  2GBK A;  5D7G A;  2O6V A;  3B0A A;  4BVU C;  1WRD B;  3A9J B;  3PV1 A;  1P98 A;  2KDF B;  4EZJ A;  4I6N B;  5G2N A;  1Z5S B;  3HIZ A;  4RM8 A;  1OQY A;  5KHQ A;  4GDK A;  2WX1 A;  2MBH A;  2ASQ A;  2K6Q A;  3PT2 B;  4MM3 A;  1WI0 A;  1OTR B;  2XEW A;  4NQL B;  3VTV A;  3ZIM A;  4FAD A;  3B1L X;  2C9W B;  2FCN A;  4GXB A;  2BYF A;  3U8Z A;  3TCA A;  4W9E A;  3TIX A;  2C60 A;  4W9D A;  1WJU A;  2CR5 A;  3VFK A;  4WAA A;  2J0M A;  1H8C A;  3C0R B;  4MSM B;  2IY1 B;  1V86 A;  2N9P C;  5D94 A;  3ZDT A;  3KUZ A;  4EFO A;  2MBE A;  2NPT B;  2XK5 B;  2KD0 A;  3GOE A;  4CO7 A;  3UQA A;  3L08 A;  1R4M I;  1H4R A;  3ML8 A;  4EZK A;  3RUL A;  2FCQ A;  2JZ3 B;  5CHW A;  5CHF A;  1Q5W B;  4GMV A;  1EF5 A;  4ANX A;  1RFA A;  1S1Q B;  4FBJ B;  4HWI B;  3ZNZ B;  2WWZ A;  3KUC B;  1WMH A;  5E6P A;  1GJZ A;  1Y8R C;  2HE7 A;  3VUX A;  1C3T A;  5AZG A;  4KSL C;  2ZNV C;  1FXT B;  2ZCC A;  1WY8 A;  3HM3 A;  3N30 A;  4OVU A;  3MTN B;  3QWZ B;  4IWO A;  3VH4 B;  3WAL A;  5DPT A;  5DPW A;  3IFW B;  5E6N A;  2RPQ A;  4PS8 A;  2K25 A;  2NBV B;  2D07 B;  3PVL A;  3VHT C;  3VQI A;  1V80 A;  1YX5 B;  2REX A;  3AU5 A;  2L8J A;  2PE6 B;  1TTN A;  3H7S A;  1WJ6 A;  3U30 A;  4X57 B;  2RSU A;  2XBB C;  1P9D U;  3QIJ A;  2ZNV B;  2KMC A;  1MG8 A;  1WX7 A;  4DHZ B;  3DCG A;  2KTR A;  4EUT A;  5LLI A;  4NAW B;  1T0Y A;  3SD5 A;  3DBR I;  2O2V A;  3EEC A;  3JSV B;  3WIM A;  1WIA A;  3DVN U;  4DDI D;  2DZK A;  2NBU A;  3PHW B;  3GZN I;  3R7Q A;  3MHS D;  3ZTC A;  2MP2 A;  3B08 A;  4B6W A;  1L7Y A;  2DYM A;  2J7Q B;  3A9J A;  5KHO A;  2AYO B;  2BYV E;  1E8Y A;  3KW5 B;  4HXD A;  4GN1 A;  3W1S A;  3SDL C;  1XD3 B;  4TUU A;  4KSK C;  4A20 A;  3CF6 E;  4M8M A;  2JVC A;  2LI5 A;  4BBN F;  5C23 A;  1RLF A;  4AP4 C;  1WJN A;  4HK2 A;  1V5T A;  4EEW A;  2DZI A;  5EDS A;  5IA7 A;  3KYC D;  1U4A A;  4KIK A;  2FCS A;  3DVG Y;  3ENE A;  1I42 A;  2OJR A;  1ISN A;  3L10 B;  1E8W A;  2N1V A;  2UYZ B;  4JL9 A;  2K1F A;  3UGB B;  2N7D A;  3UIP B;  4HLE A;  4K1R B;  4XZ4 A;  3S2A A;  2JUO A;  2G4D B;  2KC2 A;  2NPT A;  4GOC A;  2XK5 A;  4TKN A;  5LXI B;  1WXV A;  2GBM A;  2BKR B;  2RGF A;  2M8S A;  1XT9 B;  1K8R B;  2MBB B;  3L17 A;  3A1Q B;  3IBE A;  2LVP A;  1LM8 B;  3NOB A;  4NQK E;  5GMV A;  4G50 A;  3A4S C;  1I35 A;  2OOB B;  2IO0 B;  2MX2 A;  3QCA A;  2GOW A;  5CTR C;  2JPH A;  3R7R A;  3O65 B;  3EC8 A;  3RUI B;  1GUA B;  2L05 A;  2CKH B;  4AOF A;  3TMP B;  2J0K A;  3DVN V;  3R66 C;  5J2R A;  4FHJ A;  4BOZ B;  3UQB A;  2R2Q A;  2K8H A;  2JT4 B;  2KDE B;  2EKE C;  4JGH B;  1UD7 A;  2D11 A;  3ALB A;  3K9P B;  5CX3 A;  1HE8 A;  4W9K A;  4IWQ A;  3ZNG C;  4LDT D;  2BKF A;  3ECI A;  4KZ0 A;  3WAN A;  1AAR A;  3LJ3 A;  2LAS A;  2L3Z A;  2GBJ A;  3APD A;  2GMI C;  4ICU A;  3WAM A;  2CHX A;  2ZCB A;  3CST A;  1ZW7 A;  4WWN A;  2PE9 A;  4F1S A;  1IP9 A;  3V60 A;  2LUE A;  3X23 A;  4OVV A;  3DDC B;  1X1M A;  4ICV A;  1WXS A;  3AXC A;  1NDD A;  3M63 B;  2B3A A;  4DHJ D;  4TQ0 A;  3KVF B;  1V5O A;  4G3X B;  4NAW A;  2HJ8 A;  5DCN A;  2N7E A;  2LGY A;  1IPG A;  2GBN A;  3VUY A;  4II2 B;  4JLC A;  2MWS B;  1F9J A;  4IC7 B;  4DHZ E;  1ZGU B;  2L0T A;  4MGK E;  3HM6 X;  5TR5 A;  4E74 A;  3A9K A;  1VCB A;  2KJR A;  4WWO A;  1RAX A;  1LFD A;  2G45 B;  4BBN C;  4DBG A;  3L13 A;  2RR9 A;  4A3O A;  2G3Q B;  3K9O B;  1WGY A;  2GBR A;  1GC6 A;  1P1A A;  2BWE S;  3CSF A;  1RRB A;  3LDZ E;  4CYE A;  5J18 A;  2JF5 A;  5FR6 A;  4GU2 A;  2D10 A;  2KTF A;  1A5R A;  3V6E B;  3L0W B;  2NVU I;  1UBQ A;  3PGE A;  4FA6 A;  4AJY B;  1V49 A;  1E5W A;  4DXA B;  4URK A;  4MJS B;  4EKU A;  2C7H A;  2K8C A;  3QA8 A;  2KFJ A;  3ZKJ C;  1WGH A;  4DWF A;  1KOT A;  3EFU A;  4M8N A;  2RD0 A;  4WJO A;  1Q0W B;  2JRI B;  1UEL A;  2DZJ A;  3A1Q A;  3ZUN A;  4EZL A;  1D3Z A;  3QAQ A;  5L95 C;  1KJT A;  2KLG A;  2NCN A;  2M1M A;  3H7P A;  2QHO A;  2R2O A;  2HTH A;  2WYQ A;  1YQB A;  4GDL A;  3QHT A;  2FUH B;  2MA9 B;  2KZR A;  3PZD A;  4FLH A;  4E3C A;  2FNJ B;  4BKT A;  5JHB A;  3M3J A;  1SIF A;  3N3K B;  2EMS A;  1J19 A;  2CHZ A;  4WJN A;  3ZDM C;  2L00 B;  4PS3 A;  3DPD A;  2KC1 A;  2L0F A;  2KDB A;  1PQS A;  2LRW A;  3RD2 A;  4IM3 A;  2KFK B;  1WX9 A;  2IYD B;  2NBW B;  4HDO A;  2ZZP B;  3DBH I;  3ZNI D;  1WH3 A;  3Q3F A;  3U7D A;  4KDL B;  4HDQ A;  4ZRJ A;  5CHV C;  4KDI C;  1Z2M A;  1OEY A;  4FJY A;  2KLC A;  2KXJ A;  1OGW A;  3P2B A;  4GDK B;  2Z0D B;  4KVG B;  2N4F A;  5D6J B;  1UH6 A;  1J8C A;  4LDT B;  3NS8 A;  2M0X A;  2V3S A;  1WM3 A;  2DYB A;  5G55 A;  2ZPN A;  4K7S A;  2BYE A;  3W1Y A;  1M94 A;  2CS4 A;  2MRP A;  3ML9 A;  3ONS A;  4MGZ E;  4BKG A;  2LXC A;  1IYF A;  1TZ1 A;  2PEA A;  1ZKH A;  3DBL I;  2DAF A;  3WA0 A;  4XC2 A;  1UGM A;  2KWC A;  1CMX B;  2K39 A;  3QQ8 B;  4FJV B;  4LJO B;  3VUW A;  4N9F 4;  3A33 B;  4HCN B;  1E90 A;  3DVG X;  4HPL B;  2D2Q A;  4PS7 A;  2NS5 A;  3RYT A;  3VAW A;  5JH5 C;  4W9H A;  4GB9 A;  1R4N I;  4BOS C;  3QAR A;  3WAO A;  2KJ6 A;  2ZVO A;  4W9L A;  1WMH B;  3APC A;  4E71 A;  2JWZ A;  4BKS D;  3V6C B;  2DEN B;  4PYZ A;  3OJ4 B;  1WXM A;  2MLB A;  2Z0E B;  2FIF A;  3MJW A;  2HD5 B;  3CMM B;  5JZE B;  2O6V D;  3X0W A;  4G0N B;  2IBI B;  2C7N B;  2DX5 B;  4MJS A;  2KAN A;  4AWJ A;  2ZPY A;  2AWT A;  3ZO5 B;  2K8B A;  5LXH A;  1E7V A;  4GGQ A;  2DAJ A;  3V61 A;  4HVB A;  4PYU A;  3ZRC A;  1WFY A;  3ZVV A;  4K7W A;  2WX0 A;  2DYO A;  1L2N A;  1E7U A;  2UWQ A;  2MBO A;  3RCZ A;  4ASW C;  4MGY E;  2BGF A;  4W9C A;  2K6D B;  3NHE B;  3KUD B;  2KHW B;  3SHQ A;  4ANW A;  3HK0 A;  3PSE B;  2KKC A;  4IG7 B;  4HJK A;  2LXA A;  4MGI E;  2PJH A;  4CHK A;  2AL6 A;  2Z59 B;  1E8Z A;  2KVR A;  3APF A;  3D32 A;  1NI2 A;  2KNB A;  2VRR B;  4MDK E;  3JSV A;  2BF8 B;  2FCM A;  1V6E A;  4MH0 E;  4TQ1 A;  4A3P A;  2KQS A;  2LD9 A;  2JY6 A;  1UBI A;  3VTU A;  5AEK B;  2N9X A;  2MCN B;  2KX3 A;  2JXX A;  2KFK A;  3TBL D;  4J6I A;  2MP2 B;  2A5U A;  1WX8 A;  3BY4 B;  4RMA A;  5DPS A;  1EO6 A;  3DQV A;  1P3Q U;  2J0J A;  5HKH A;  2LRU A;  3WAP A;  1WF9 A;  4YL8 A;  1SE9 A;  5BO4 B;  4M0W B;  4NJ7 A;  3ZW3 A;  1BT0 A;  2Y5B B;  1J0G A;  4KZC A;  4IWP A;  1V9J A;  4NPN A;  2MQJ A;  3ZNH B;  1V81 A;  4KIK B;  4AJW A;  2LJ5 A;  1WR1 A;  5E6O A;  2N1W A;  1WGR A;  1NBF C;  3OJ3 A;  3PLU A;  2LVO A;  2MSE D;  3EHV A;  3M62 B;  4WJP A;  2CHW A;  2KOX A;  4FUL A;  2C5L C;  4WWP A;  1KM7 A;  2W9N A;  4LCD E;  3Q3J A;  4WQO B;  4LJP B;  4P7I A;  2IO1 B;  4B95 A;  3A4R A;  1TBE A;  4DDG D;  3L54 A;  3OLM D;  4ZRK A;  1C1Y B;  4WJQ A;  2ZJD A;  5AZH A;  5JHA A;  2IO3 B;  3TL5 A;  3I3T B;  2I1J A;  4F8C B;  1GNU A;  2NR2 A;  3L16 A;  3PRE A;  3TJP A;  2KX0 A;  4MEL A;  1WYW B;  1WR6 E;  2KK8 A;  1YX6 B;  3PTF C;  1WE6 A;  2AEH A;  3QJZ A;  3DOW A;  5DPR A;  3AI5 A;  3UIO B;  3NZU A;  3PPA A;  3RZF A;  3VVW B;  4W9F A;  1KLV A;  1YJ1 A;  2C7M B;  2O6V B;  4K81 A;  2KWU B;  5C1Z A;  2AL3 A;  4JQW C;  4I6L B;  1GC7 A;  2V4L A;  5J17 A;  1EF1 A;  3PRM B;  2DHZ A;  2JZZ A;  3PRZ A;  4ZDV A;  2LGD A;  3AU4 A;  1WZ0 A;  1TGZ B;  4ANV A;  1S3S G;  2ZVN A;  2M17 A;  3NZS A;  2G4S A;  3PHX B;  1Q1O A;  3OAW A;  4IW0 A;  1YD8 U;  1JRU A;  2EMT A;  1WGG A;  2BPS A;  2PPH A;  5D2M B;  3R3M A;  1WZ3 A;  4F7Z A;  1LQB A;  3JW0 X;  2YVC A;  3UIN B;  3SU8 X;  4IUM B;  2LWP A;  2LGX A;  4DHJ B;  1XQQ A;  2FID A;  4BFR A;  1WM2 A;  4FHK A;  2ZEQ A;  2CU1 A;  3A9K B;  4NNJ B;  3ZTD A;  1GG3 A;  4MEM A;  1G6J A;  2IZV B;  4B9K A;  3JVZ X;  3JYU A;  2D3G A;  3T8M A;  1QZE A;  2LVQ A;  3QC8 B;  4FN2 A;  4G11 A;  2MW5 A;  4IM0 A;  5AZF A;  3RT3 B;  3VDZ A;  1SGH A;  4AUQ C;  3IHP C;  4W9I A;  3PRP B;  4NY0 A;  1WJ4 A;  2KDI A;  3QX1 A;  4W9G A;  3IG3 A;  3H9D A;  2KO3 A;  2WDT B;  4GIV A;  4HPM B;  2YLM A;  4KV2 A;  3T9L A;  3V62 A;  4IM2 A;  2KQ7 A;  2FAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...