1K8RB

Crystal structure of ras-bry2rbd complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
82
Chain Sequence
b'CILRFIACNGQTRAVQSRGDYQKTLAIALKKFSLEDASKFIVCVSQSSRIKLITEERDRLIIVPKEKPCPSFEDLRRSWEIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein P21/H-RAS-1
publication title The Ras-Byr2RBD complex: structural basis for Ras effector recognition in yeast.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 14
structure length 82
sequence length 95
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2001-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14847 Ras_bdg_2 Ras-binding domain of Byr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1k8rB00
4NJ7A 5G55A 2FIFA 2LVPA 3DBHI 3X0WA 1J0GA 3AXCA 1J8CA 4FN2A 2ZVNA 1V49A 2BWFA 4M8MA 4MGYE 2FCQA 2V1YA 3ZTCA 3ZRCA 2LGXA 4MELA 1M94A 5AZGA 2XK5A 2IZVB 4A20A 3ZLZA 1KLVA 3QK0A 2MWSB 2IY1B 5EDSA 3VVWB 1WGGA 2LD9A 4DHJB 2RD0A 3NZSA 2PEAA 1WJNA 5CHWA 2JY6A 4HCPB 4BOSC 4DHJD 4BKTA 1WIAA 4K7SA 3M3JA 2LGYA 1S1QB 2VRRB 3ENEA 2JWZA 1OGWA 1P3QU 3C0RB 4EZJA 3PPAA 1WGYA 3JSVB 4WAAA 4F1SA 2Z0EB 3Q3FA 1YX5B 4RM9A 1Q5WB 1TBEA 1VCBA 2IYDB 4TKNA 3UF8A 3U8ZA 1UD7A 4DWFA 4PYUA 1D3ZA 2EMSA 4W9HA 4IM0A 2FCNA 4IG7B 2KTFA 2PE6B 1WXMA 2J0JA 3ZNZB 2KLCA 4HDOA 4NPNA 2J0MA 1F9JA 4X57B 2YLMA 3VFKA 5LXIB 3ZRFA 2MBBB 4IW0A 4OVVA 3QIJA 2KDEB 2ZVOA 4K7WA 4KIKB 1Q1OA 3ZW3A 1YD8U 3ML8A 2LXCA 3N3KB 5L95C 1IYFA 2MP2A 4CO7A 4MH0E 3K9OB 2PJHA 3T9LA 4W9IA 1RLFA 2UYZB 1YX6B 2M0XA 3DVGX 4HDQA 5DCNA 1L2NA 3MTNB 4ZRIA 2KFKB 3LDZE 3UQBA 2CHWA 1GUAB 2BYFA 2K39A 2R2OA 3TBLD 5BO4B 2Y5BB 3KH0A 3VAWA 1Z5SB 2J7QB 3VHTC 3ZO5B 2GOWA 2MBHA 4DXAB 2R2QA 4GDKA 1E8XA 2ZEQA 4ZRKA 4F7ZA 2EMTA 1WR6E 1K8RB 2KKCA 1C1YB 1BT0A 2J0KA 2KWVB 3DPDA 3A4RA 5E6NA 3W1YA 2O6VB 2HTHA 4JLCA 2IO2B 5DPTA 3UINB 3KW5B 4PS7A 2KWCA 4HXDA 1NBFC 2BWES 3KUZA 2N1VA 3U30A 2D10A 3RZWC 2KTRA 4II3B 2IO3B 3ZNGC 3VH4B 1Y8RC 2K6DB 3PREA 3N30A 3U7DA 2C60A 4ANWA 2K8CA 3TMPB 4EKUA 4FBJB 5AZHA 3ALBA 1P98A 2N7EA 1I42A 3GZNI 4ZDVA 3DVNV 1GJZA 2JXXA 4I6LB 2AEHA 5D7GA 5G2NA 1WJ6A 3EFUA 4IUMB 1WH3A 4NNJB 4TQ1A 3QX1A 1WXAA 3TIXA 2AL3A 2JF5A 2ZCCA 3B08A 4WQOB 1H8CA 4B6WA 3QA8A 2KQSA 4WJNA 4BOZB 4E71A 2NR2A 3A1QB 4FADA 3RCZA 4RMAA 2JT4B 4WWPA 2D3GA 3DOWA 1CMXB 2MQJA 1WE7A 2KANA 4N9F4 4TV3A 1YJ1A 4NQKE 3A9KB 3ECIA 3DVGY 2JUOA 3A4SC 4ASWC 4MM3A 4W9LA 4BKSA 4GDLB 1GC7A 3KUCB 3QJZA 1WJUA 4BKGA 1WXVA 3L08A 1JRUA 2AWTA 3H7PB 4ICVA 2C9WB 3JSVA 2A4ZA 3RUIB 5E6OA 2N9PC 2IBIB 2IO0B 1E8ZA 2XBBC 5LXHA 1OEYJ 3DBRI 1XD3B 2BGFA 4KSKC 3VXWA 1A5RA 3H7SA 2L8JA 2BYEA 1WM3A 4EEWA 1V2YA 2GMIC 1WI0A 3P2BA 3MJWA 1E7VA 3MHSD 3AULA 2N9XA 1ZGUB 1NI2A 5KHQA 2CHZA 5D2MB 2FUHB 3L0WB 3PV1A 4XC2A 4KIKA 2FNJB 3BINA 1P1AA 2JRIB 4MEMA 4BKSD 3DVNU 2KD0A 2DZJA 2LWPA 4A3OA 2KFJA 2MCNB 2N7DA 3OJ3A 1TTNA 3S2AA 3V60A 4DBGA 1V81A 1XT9B 2ASQA 3H9DA 4PYZA 2KFKA 5D94A 5AEKB 3Q3JA 2MRPA 4GGQA 1E90A 2MA9B 1L7YA 1Q0WB 2L00B 1H4RA 3WAOA 3AU5A 3L10B 3UIPB 1WX8A 2LXAA 2NBVB 2C7HA 3EC8A 2WYQA 3ML9A 3QC8B 3ZNID 4GU2A 3ZNHB 3ZUNA 2RR9A 2LZ6A 1FXTB 3PHXB 3HM6X 3IHPC 3PTFC 2D07B 4WJQA 3QWZB 4G11A 2KO3A 2WWZA 3CF6E 3RZFA 2NVUI 2ZCBA 2NCNA 3PLVA 1J19A 2DAFA 2O6VA 4ANUA 4AOFA 3PGEA 1EF1A 1UELA 3NZUA 1KJTA 1WZ0A 2PPHA 1E7UA 4W9JA 1V6EA 2K1FA 1RFAA 2DZIA 4TUUA 4GSWA 4W9FA 2L0FA 2BPSA 1WGRA 3BY4B 3RULA 3RYTA 2GBMA 4MGZE 1V80A 3L17A 4FHJA 1YIWA 3N32A 5L83A 2REXA 2W9NA 3I3TB 3PRMB 4KVGB 1SE9A 3QQ8B 4LJPB 4YL8A 3DQVA 4FHKA 4ANXA 4MGIE 2LASA 3L13A 2WX1A 5CHVC 2DENB 2L7RA 1IP9A 1WGDA 4HPMB 1UBIA 2AYOB 3WAMA 1EO6A 2PE9A 3EECA 3QARA 4II2B 3D32A 4EFOA 3NS8A 3T8MA 1OQYA 2ZPYA 2I1JA 2O6VD 4XX5A 2ZNVB 4DK5A 5FR6A 3A33B 2GBNA 3R3MA 3VTUA 3A1QA 1WZ3A 2FAZA 1WXSA 4FJVB 1UBQA 4FJZA 1V5TA 4M0WB 3A9JB 3PT2B 3OJ4B 3V6CB 2M17A 3SD5A 2LGDA 3OAWA 3WANA 3PZDA 2MBOA 4W9GA 2ZNVC 1E8YA 2A5UA 3A9KA 4M8NA 4ZYNA 3VUXA 4HLEA 4DDGD 3CMMB 4GXBA 3EHVA 3KVFB 4E74A 5J2RA 4DHZE 4GDLA 3IBEA 2CU1A 2GBJA 4MSQB 3V62A 2KZRA 4GIVA 4MSMB 2DZMA 4GOCA 4OVUA 2MW5A 4J6IA 1V5OA 2BKFA 1E5WA 3H7PA 1KM7A 4K7UA 3V6EB 4P7IA 3ONSA 4BFRA 4KSLC 4F8CB 1MG8A 1HE8A 3GOEA 1Z2MA 3RT3B 4G3XB 1U4AA 2DYBA 4HWIB 1S3SG 4NAWB 2LRWA 2K25A 2DAJA 4GMVA 2C5LC 3PSEB 2L76A 4XZ4A 4IWQA 2KDIA 1SGHA 4DDID 1OEYA 3HM3A 2C7NB 5TR5A 2KN5A 4A3PA 4TQ0A 2YVCA 3LJ3A 3TL5A 2BF8B 2JVCA 4ICUA 2KDBA 2KDFB 4HVBA 2FCMA 4K81A 4FJYA 1V86A 1GNUA 1YQBA 2FCSA 2K8HA 3WALA 3VUYA 5CX3A 1IPGA 2V3SA 4CYEA 2JPHA 2RGFA 1LQBA 3APFA 2KWUB 4KZ0A 1P0RA 2ZZPB 2HJ8A 2MBQA 4I6PA 1EUVB 1V9JA 2IO1B 5C23A 3VUWA 2JZ3B 3DBLI 2DX5B 4KDIC 4FA6A 3B0AA 2K6QA 2HD5B 3NY5A 1PQSA 4MGKE 3SU8X 3ZTDA 2CS4A 3DBSA 4I6NB 4PS3A 1R4MI 3APCA 3PVLA 3HHMA 2N1WA 2MX2A 4KDLB 3H6NA 4FLHA 1WF9A 3VQIA 4BBNF 1I35A 2CR5A 3PS6A 2KK8A 4NJ6A 1RRBA 2C7MB 2OJRA 4DHZB 3KUDB 3JW0X 4EZKA 2L3ZA 3B1LX 1AARA 3UIOB 4W9DA 4HK2A 2MSED 3ZIMA 4MDKE 2GBRA 1GG3A 1NDDA 4MJSB 3ZVVA 5HKHA 5JH5C 2G4DB 3APDA 4W9CA 2EKEC 2O2VB 3HIZA 1ISNA 3PLUA 5E6PA 2IY0B 2DZKA 2CKHB 1TZ1A 1LFDA 4B9KA 5CTRC 1UZXB 1E8WA 2N4FA 3WIMA 3IFWB 2M8SA 4K1RB 3VTVA 1WFYA 2KLGA 2G4SA 4IM2A 3UGBB 4EOYA 1EF5A 3PRPB 2KC2A 4AJWA 2DYMA 2LI5A 2KC1A 2AL6A 2DYOA 1WGHA 1WRDB 2KJRA 2KOXA 2UWQA 4ANVA 2JRHA 4WWNA 4ZRJA 5C1ZA 1R4NI 2LVQA 2RPQA 3VTWA 4FULA 2LUEA 4JGHB 5D6JB 3SHQA 3L54A 2LVOA 5JHAA 2NBUA 1WX9A 3R7RA 1UGMA 3QHTA 2XK5B 2Z59B 5JHBA 1C3TA 2KMCA 5CHFA 2LJ5A 5J17A 1KOTA 4EZLA 2L05A 1WX7A 4RM8A 2NBWB 1WR1A 2N9EB 3A9JA 3HK0A 4KZCA 4GB9A 3VDZA 3WAPA 4LJOB 2L0TA 2HE7A 1LM8B 4G0NB 4WJPA 4EUTA 5IA7A 3UQAA 4W9EA 2XEWA 3JYUA 3RD2A 2KHWB 4HJKA 4AUQC 4IWOA 1VD2A 5LLIA 2G3QB 2LRUA 2KQ7A 4JQWC 2NS5A 2KXJA 3VH3B 3ZDTA 2RSUA 5GMVA 5DPSA 1WY8A 4NY0A 4HPLB 2BKRB 2WDTB 1GC6A 2D2QA 4NAWA 2MLBA 2KJHB 2ZJDA 1T0YA 1UH6A 3IG3A 4E3CA 3AI5A 3AU4A 4LCDE 2M1MA 4WJOA 2WX0A 5J18A 3OLMD 4B95A 4GN1A 1QZEA 2G45B 3WA0A 5DPRA 4BBNC 5AZFA 3ZKJC 1WMHA 2DHZA 3V61A 3CSFA 3DDCB 3M63B 3KYCD 2MP2B 2NPTA 3KYDD 3PRZA 5IAAC 5KHOA 5JZEB 3R7QA 4W9KA 2B3AA 2CHXA 4URKA 2KMAA 2M4NA 4NQLB 4AWJA 3QAQA 4G50A 3W1SA 3NOBA 2FIDA 3R66C 3H1UA 4CHKA 3JVZX 4IM3A 1LXDA 1ZW7A 2KVRA 4BVUC 3M62B 4IC7B 2MBEA 2KNBA 1P9DU 2D11A 4IWPA 1OTRB 3SDLC 4GDKB 3TCAA 4AP4C 3L16A 1WMHB 3NHEB 2JZZA 2KJ6A 2GBKA 2V4LA 2NPTB 1SIFA 1WM2A 3IVFA 3QCAA 1G6JA 1WJ4A 2KX0A 4MJSA 3X23A 3PHWB 2O2VA 5DPWA 3CSTA 4LDTB 3DCGA 2KTRB 1X1MA 2QHOA 2Z0DB 2I1KA 1RAXA 1WE6A 2BYVE 4LDTD 1WYWB 4AJYB 4JL9A 4HCNB 1TGZB 2KX3A 1XQQA 3M95A 3ZDMC 2OOBB 3W1SC 2K8BA 2ZPNA 4WWOA 3O65B 4KV2A 3TJPA 4JIOU 4PS8A 3K9PB 1ZKHA
chains in the Genus database with same CATH superfamily
2MHJA 3DBHI 1J0GA 3AXCA 1V49A 2BWFA 1WRIA 1TS2A 2V1YA 2LGXA 2Y5PA 2XK5A 1KLVA 3V05A 5EDSA 2RD0A 3FAHA 1DGJA 2PEAA 1NENB 3NZSA 2JY6A 4BOSC 3NG0A 4K7SA 3M3JA 2LGYA 4JPSA 2VRRB 1OGWA 4L23A 4C80A 1EM7A 3B2FA 4XE0A 4WAAA 4M01A 4HROA 3LXFA 1VCBA 4YWGG 3U8ZA 1UD7A 5IOIA 4DWFA 3NVVA 3ZNZB 3FILA 2KLCA 1FPYA 2J0MA 2KN4A 2MBBB 4IW0A 2NTTA 4OVVA 4HRSA 2WXPA 4KIKB 3ZW3A 4MH0E 2B76B 3T9LA 3H8HA 2UYZB 1FFVA 3MTNB 2GB1A 1QOBA 2KFKB 2BYFA 5HHDG 2R61A 3TBLD 1Z5SB 1JWMD 3ZO5B 1XLPA 4ZRKA 4F7ZA 2ZEQA 2EMTA 2KWVB 4WAFA 2PMVA 2KWCA 2CJNA 4RCOA 3KUZA 2H89B 5G5GA 3EA6A 1XCQL 2D10A 3RZWC 1KTKA 4II3B 1VRAB 3Q14C 2K6DB 3U7DA 2M19A 4ANWA 4S0RA 5AZHA 1FXAA 3DVNV 1GJZA 2BB5A 4I6LB 4RGNA 2AEHA 2WXGA 4JWSC 1K53A 3TUOA 2ZCCA 4WQOB 5BYRA 4B6WA 2L1AA 4WJNA 4KKIA 4RMAA 2D3GA 3DOWA 3B9JA 2MQJA 1WE7A 3A9KB 4ASWC 1GC7A 3TEZA 4RF1A 3RUIB 2N9PC 2IBIB 2IO0B 5LXHA 1XD3B 2BGFA 2QDFA 3H7SA 1E7VA 3MHSD 3AULA 2IGHA 1YQ3B 4LTUA 5KHQA 2CHZA 1GPXA 1IGDA 3L0WB 2QEJC 4XC2A 2FNJB 2G1EA 4MEMA 2SAKA 3DVNU 2KD0A 2DZJA 2MCNB 2N7DA 3OJ3A 3T3NA 3S2AA 1V81A 4A6QA 2K22A 4PYZA 1Q0WB 2L00B 3RPFC 3AU5A 3ZYYX 3UIPB 2LXAA 4GU2A 4P16A 3ZNHB 1HXYD 1L4ZB 1UWXA 1FXTB 2WWZA 3V3XA 3N1ZC 1TIFA 1TYGB 1J19A 2W55A 1FXIA 1WZ0A 4W9JA 1CQVA 1RFAA 4GSWA 2L0FA 4YTPB 3BY4B 3RULA 1SJED 2REXA 3PRMB 2QMTA 1SE9A 1V1PA 3QQ8B 4LJPB 1TKGA 2J52A 1IP9A 4HPMB 4KGRA 4A8XC 1KFYB 1EO6A 2PE9A 1OQQA 2MEKA 4II2B 3D32A 1OQYA 2WXFA 2ZPYA 1FRDA 1ZOYB 1E7PB 4DK5A 3A33B 3R3MA 3A1QA 5IKCM 2H88B 2M17A 2LGDA 2IDYA 4ZYNA 2ZNVC 1E8YA 2A5UA 2WNMA 3CMMB 4GXBA 3KVFB 4E74A 5J2RA 2GI9A 2KZRA 3NVZA 2DZMA 2MW5A 1F2RI 1E5WA 4M00A 4KSLC 1MG8A 1HE8A 2HDEA 4G3XB 1U4AA 3P4PB 3PSEB 4IWQA 2KDIA 1SGHA 1OEYA 4A90A 4TQ0A 2YVCA 4ICUA 4A55A 2FCSA 2INPE 5CX3A 1IPGA 4CYEA 2RGFA 3APFA 4RGMA 2ZZPB 3VUWA 4KDIC 3SU8X 1PQSA 4MGKE 1TT5B 3DBSA 3APCA 2MX2A 4KDLB 3H6NA 4FLHA 4BBNF 2LFIA 3P4RB 1A70A 3Q2AC 1SBBB 2KK8A 2NTSA 4OZAA 3HUIA 3UIOB 1AARA 4W9DA 1V97A 2JYEA 2MSED 4MDKE 1MI0A 4MJSB 5JH5C 4FXCA 3HVZA 1OFFA 5HI1A 5E6PA 2N4FA 3AE3B 2WXIA 4IM2A 3IAS1 1FIQA 2UWQA 1I4PA 3PO0A 1WRDB 3R2TA 3VTWA 1TKYA 1KH0A 2JYTA 3L54A 2LVOA 4EE2A 1WX9A 1C3TA 5CHFA 5J17A 4C4VA 2WXNA 2L05A 2N9EB 4GB9A 1TY0A 1N63A 2MH7A 4G0NB 3Q3OC 3UQAA 4W9EA 1CZPA 4IWOA 1UWMA 2IPKD 1WWTA 3VH3B 2RSUA 4DXGA 4NY0A 4HPLB 2IGDA 3P42A 2DBYA 2KVZA 2RDGA 2KJHB 2XNAC 2ZJDA 4NAWA 1T0YA 3IG3A 2L52A 3AI5A 3AU4A 4LCDE 4WJOA 4GN1A 1UUPA 3MP9A 3R2IA 5AZFA 3ZKJC 2BS3B 2DHZA 1JWSD 3DDCB 3M63B 4ARIA 2KQ4X 3KYDD 3R7QA 4W9KA 4AWJA 3TEXA 3NVYA 2DNFA 4IM3A 3E9SA 1LXDA 3P63A 3N9YC 2WXMA 1BMLC 1T0QC 4GDKB 1WMHB 3NHEB 2BB6A 2AX5A 4LK0M 1G6JA 2ZW0A 1L0XB 3X23A 4LDTB 4HEA1 2I1KA 4LDTD 4JL9A 4HCNB 2K8BA 3O65B 4JIOU 3RFZB 4NJ7A 2FIFA 2OEDA 1ET6A 1UF0A 2FCQA 2IZVB 5LNK1 2LD9A 3EUB2 1I4HA 5CHWA 3C8YA 4HCPB 4ZHOA 2ICIA 1QT9A 4P1CC 3ENEA 2W54A 1DOYA 3C0RB 3JSVB 4XDCA 2Z0EB 3Q3FA 1YX5B 1D5MC 4RM9A 1Q5WB 3RMKC 3UF8A 1D3ZA 4PYUA 4IM0A 4YTMB 2FCNA 4JE3B 1E6EB 2KTFA 2PE6B 4IG7B 2AQ1B 3VFKA 2YLMA 3KLSX 3BZDB 3URYA 2ZVOA 4K7WA 1Q1OA 1YD8U 3ML8A 2LXCA 3N3KB 5L95C 1IYFA 2MP2A 4CO7A 4OW0A 3ETRA 3K9OB 3J9CA 3DVGX 5DCNA 2M0XA 4HDQA 3LDZE 1D5XC 3NRZA 3UQBA 4C7ZA 2CHWA 5IN7A 5BO4B 2Y5BB 3KH0A 2J7QB 3LYYA 2MBHA 3ZXRA 3DBRB 2N9LA 3DBLB 1ENFA 1SE4A 1BT0A 2J0KA 3W1YA 5E6NA 3A4RA 2O6VB 2HTHA 4ZHPA 4RGTA 4HXDA 3U7ZA 2BWES 2N1VA 2KTRA 3NJTA 2IO3B 1SF0A 3VH4B 1Y8RC 1EU3A 1JMLA 2C60A 4EKUA 5EE3A 2N7EA 3GZNI 4ZDVA 5EE0A 5G2NA 3PZ7A 3P4SB 2BYTA 1WH3A 1XLQA 2OJWA 3UI3A 1MJDA 3QA8A 2D3AA 2NR2A 1M4VA 3AM9A 1CMXB 1YJ1A 2JUOA 1L0VB 4MM3A 4W9LA 4GDLB 2YEPB 3AH7A 3KUCB 1WJUA 4BKGA 1WXVA 1YJJA 1JRUA 3GE8C 4ICVA 2HJ1A 2C9WB 2KDMA 3DBRI 4KSKC 3VXWA 1A5RA 1YOVB 2L8JA 2BYEA 1V2YA 2GMIC 1WI0A 4USAA 3B2GA 2N9XA 1NI2A 2JRIB 4BKSD 2LWPA 4A3OA 1TTNA 4WQMA 1XT9B 2ASQA 3H9DA 2PTLA 3BIID 1I7HA 2MRPA 3FKYA 1E90A 3WAOA 4YSYB 3AE6B 2NBVB 3AE4B 4HJGE 4XDDA 3RN9C 1JWBD 2XN9C 2RR9A 3Q8FA 1VDVA 2LZ6A 2PIAA 3QWZB 3CF6E 2NCNA 4US9A 3PLVA 2DAFA 2INNE 4ANUA 5D3IB 1UELA 3DHIC 3AB5A 2LGIA 3O13A 1PYWD 5C3JB 2DZIA 4W9FA 2BPSA 1WGRA 1N61A 4QAYA 1AW7A 3DHHC 4KVGB 4YL8A 3DQVA 2WX1A 3GE3C 2W82A 2L7RA 1NYQA 1UBIA 3GP7A 2AYOB 2LHDA 4EFOA 3EECA 3QARA 3NS8A 3T8MA 3P4QB 2ZNVB 2QSDA 3RNCC 5FR6A 3I63C 1UNSA 4FJVB 1WXSA 5IP4D 1UBQA 1V5TA 4M0WB 3A9JB 3PT2B 3OAWA 3WANA 3VUXA 4M8NA 2V0GA 1FNUA 4DHZE 3IBEA 2CU1A 4MSQB 3V62A 4GIVA 4GOCA 4R3DA 2Y5CA 1NEKB 3H7PA 4WWMA 1KM7A 3DWGC 4K7UA 2DYBA 1S3SG 4NZLB 4XZ4A 1ZP0B 2K3UA 2D3CA 1GB1A 3ZJUA 3RNEC 2BF8B 4YXDB 2KDFB 1KLGD 1GNUA 2K8HA 2ZW1A 2WXKA 2V3SA 4L2YA 2AQ2B 2JPHA 1LQBA 4IKGA 2KWUB 1P0RA 1EUVB 1V9JA 4KGTA 5C23A 2JZ3B 2DX5B 2INDC 2K6QA 3NY5A 1QOFA 1SEBD 3ZTDA 4I6NB 3VQIA 1WF9A 2WXLA 2OJRA 4DHZB 1Q10A 4EZKA 4C00A 3AE9B 2GBRA 2WQYB 2G4DB 1MPEA 2ACZB 1D5ZC 3HIZA 1JALA 3PLUA 2IY0B 3RI7C 1LFDA 4LNKA 1UZXB 3WIMA 3ZGZA 2KLGA 2G4SA 1EF5A 3PRPB 2DYMA 2AL6A 2KOXA 1E9MA 2Q5WD 2JRHA 4FULA 1JQ4A 4JGHB 3SHQA 4J3OD 5JHAA 4YTNB 2NBUA 3R7RA 3QHTA 2XK5B 2KMCA 2LJ5A 1AYFA 3L4PA 2NBWB 5FK9C 5E6JA 1T0SC 4LJOB 2L0TA 2HE7A 4EUTA 3RD2A 3BWUD 3RNGC 2V3NA 1VD2A 5FKAC 5LLIA 2KQ7A 2BVCA 4JQWC 2NS5A 5GMVA 3IT6B 3W5UB 1STEA 2MLBA 2BTEA 4E3CA 3FILB 4YSXB 1QZEA 2JWUA 5DPRA 1WMHA 1FNWA 3V61A 1UGJA 3KYCD 3FC4A 5KHOA 3MC9A 1C77A 4URKA 2KMAA 2M4NA 4G50A 3W1SA 3NOBA 3R66C 1HTOA 3ZQ4A 1ZW7A 2Z8LA 2MJEA 1IBXA 2RPVA 4TMAB 2Y3AA 1ACCA 1Y56A 3SDLC 4ZRPA 1TZOA 1N5XA 1HTQA 5BMGA 2I38A 2KJ6A 2KACA 3IVFA 1EWCA 2E6XA 1N5WA 2O2VA 1NI3A 3CSTA 4OHJA 5MPOA 4HKZE 1RAXA 2KT7A 2BYVE 1TGZB 2KX3A 3Q3MC 3W9CB 3OG5A 2ZPNA 1J7CA 3ZXVA 2M0AA 5G55A 3X0WA 2QC8A 1IUEA 1FNVA 4FN2A 2ZVNA 4M8MA 4MGYE 3ZTCA 1FM0D 1D6EC 4MELA 1M94A 5AZGA 1WGKA 3ZLZA 2MWSB 2IY1B 3VVWB 1WGGA 4DHJB 2JQRB 4DHJD 2JWZA 1P3QU 3AN1A 1WGYA 4TKNA 1DOIA 3BVMA 2EMSA 4W9HA 4CQNA 1C4CA 1N6ZA 4ZYSA 2J0JA 2VZKB 4HDOA 4X57B 3NUHB 3ZRFA 1MVKA 2KDEB 1K50A 2BQQA 1FD6A 1GOZA 2BW2A 1F2RC 4W9IA 4REZA 1YX6B 1L2NA 4ZRIA 4K3CA 2K39A 2R2OA 3I5JC 2GOWA 1C4AA 2KYWA 4RH6A 4DXAB 2WXQA 2PKOA 1WSPA 1K8RB 2KKCA 1C1YB 2AQ3B 2IO2B 1SE2A 3KW5B 1YN5A 4PS7A 1NBFC 2FBWB 2K5PA 3U30A 3I57A 4ZOHC 4LNFA 1XLNA 3PREA 2K8CA 3EFCA 2D5GA 1P98A 1V1PB 1E10A 1I42A 5D7GA 1WJ6A 4HPPA 2IJ0A 4NNJB 4P6VF 2EKIA 1FRRA 1LGRA 2AL3A 2WXJA 3TIXA 2KQSA 4BOZB 4E71A 1WXQA 3A1QB 1F1HA 2QCZA 3RNBC 3RCZA 4FADA 1QILA 4WWPA 1L6VA 1R4NB 3Q8CA 3P1MA 1JW9D 2KANA 4TV3A 4NQKE 3A4SC 2PLPA 4BKSA 1I4GA 5BMIA 3L08A 1XEEA 1D4BA 3SR6A 4S17A 1OEYJ 1T0RC 5EE1A 4XWWA 1WM3A 5T8IA 1BXTA 3U2SC 1YMHE 4L1BA 1V1OA 5FR3A 1PDXA 4KIKA 1P1AA 3DHGC 1MFWA 2KFJA 1TY2A 2KFKA 3KWLA 4GGQA 1L7YA 3L10B 3TEWA 3QC8B 2C7HA 3KWVA 2VH1A 3ZUNA 4WJQA 3PHXB 3HM6X 3IHPC 3PTFC 2D07B 2KO3A 1VJKA 2NVUI 4JX1C 3Q8BA 3VR9B 2WDRB 3PGEA 1EF1A 3NZUA 1KJTA 2YEPF 3AE2B 1E7UA 3DWMA 1MHHE 1OQRA 2K1FA 4JWUC 3RYTA 1JWUD 1V80A 3L17A 1KLUD 5L83A 5BMHA 5I4DA 2D3BA 4ANXA 4MGIE 2LASA 3L13A 4RF0A 5CHVC 2DENB 1PGBA 1SE3A 1WGDA 2JZPA 4PT5A 3Q6BA 3WAMA 3AE7B 5HG2A 3U52E 2O6VD 4XX5A 2BS4B 2GBNA 3VTUA 4C4VB 3OJ4B 3V6CB 3DBHB 3SD5A 2MBOA 1YN4A 3A9KA 2FE8A 4HLEA 2WS3B 3U4EG 3EHVA 2LHEA 4HKQA 1ESFA 1C9FA 4OVUA 1V5OA 2BKFA 3AE8B 4F8CB 4NAMA 1Z2MA 3RT3B 4NAWB 2LRWA 3HVDA 4GMVA 1FO4A 1RWSA 2C7NB 4A3PA 3TL5A 1QKZA 2JVCA 4HVBA 1YN3A 2J42A 4FJYA 4K81A 2CU3A 4I6PA 2IO1B 3DBLI 4FA6A 4AQ7A 3EGRA 1VZ6A 3HHMA 5BYSA 2HTME 4OVZA 1I35A 4NJ6A 1RRBA 3ABVB 2WXHA 3ZVVA 5HKHA 3APDA 3LB8C 4OZCA 4XWTA 3VR8B 1ISNA 2DZKA 2KAJA 1TZ1A 3VRAB 5CTRC 1E8WA 2WP9B 2M8SA 1WFYA 1FCCC 2LI5A 4WURA 2DYOA 4ANVA 1WGHA 2KJRA 4WWNA 4ZRJA 5C1ZA 2RPQA 4H2AA 5D6JB 2Z59B 5JHBA 1KOTA 1HZ6A 4EZLA 4RM8A 3ZJTA 1WR1A 1SB3C 1TKEA 3HK0A 4KZCA 2N0SB 1AWDA 3AEBB 4LLGM 1QOGA 3VDZA 1LM8B 4WJPA 1ZUD2 3OWEB 2WGSA 2KHWB 4HJKA 4YT0B 2G3QB 2LRUA 3T3OA 1QOAA 4ARCA 2WXRA 4N59A 2IGGA 2OHFA 2BKRB 1C79A 1GC6A 2D2QA 3W2DA 2CJOA 1B9RA 4PK1A 1HZ5A 5J18A 1L5PA 3OLMD 4B95A 1K51A 1ZE3D 5H92C 1GB4A 2MP2B 2RDBC 3PRZA 5IAAC 5JZEB 2B3AA 2CHXA 1CJEA 4NQLB 2FIDA 3H1UA 3JVZX 4TSSA 2BS2B 4IC7B 3NZ3A 2KNBA 2D11A 2NMQA 4IWPA 4ITKA 3AV8A 3TCAA 3N1YC 3L16A 4IDIA 2JZZA 2GBKA 2V4LA 2NPTB 1WM2A 3QCAA 1ZXIA 1WJ4A 4MJSA 3E56A 5JXVA 3AE1B 1VZ8A 3DCGA 2KTRB 1X1MA 1XLOA 2I2YA 1T3QA 1WYWB 2JSVX 1I4XA 1XQQA 4DQOC 3M95A 2MJDA 2OOBB 3ZDMC 1QF6A 4WWOA 4KV2A 1SSNA 4P1BC 3HRDD 1FMAD 3AEEB 4LNOA 4UDUC 2LVPA 4KX6B 2QILA 3SFEB 1J8CA 1E0ZA 2V9HA 1AN8A 2N9KA 3ZRCA 3RNAC 4A20A 3QK0A 2WLBA 4KGSA 3MFGA 1WJNA 2SEBD 1WIAA 4MM3B 1ZDXA 1S1QB 2LUMA 4EZJA 5AUIA 4WIPA 5IO9A 3PPAA 5G5HA 2QIEB 4MT5A 4F1SA 1TBEA 2IYDB 1L6UA 4ZRQA 4IOIE 4Q2JA 1WXMA 3PZ8A 4NPNA 2WU5B 1F9JA 2G9HD 4DXFA 5LXIB 3ZJVA 2UU7A 3QIJA 3CIRB 3MJ5A 1TJEA 4RGOS 4C56C 2PJHA 1EU4A 1RLFA 1KF6B 1PGAA 1VZ7A 1GUAB 1ZPSA 3GB1A 1N60A 3VAWA 1QLBB 2FUG1 2N7JA 1YQ4B 2TSSA 3VHTC 1EWYC 2R2QA 4GDKA 1E8XA 3Q3NC 3C19A 1YJIA 5D3DA 3N20C 1WR6E 5AUKA 3DPDA 4JLCA 5DPTA 3UINB 2M56B 3AEGB 1FFUA 3MHZA 2VH2A 3NVWA 3ZNGC 2WU2B 4XGAB 2LJIA 1T5XD 4RNAA 4D2KA 3N30A 3TMPB 4FBJB 3ALBA 1LO5D 4MH8A 2JXXA 1XF5L 1JCKB 2GRIA 3EFUA 4IUMB 1KRHA 4US8A 4TQ1A 1ET9A 1WYGA 1WXAA 3QX1A 2JF5A 3IAM1 3B08A 1H8CA 2WDVB 2JT4B 1TS4A 4LNNA 1L0YB 5EE9A 5BYQA 2RMMA 4N9F4 4BAXA 3ECIA 3DVGY 3I9V1 3W5VB 1I4RA 3CWIA 2DWQA 2E3TA 3QJZA 2L32A 2W3SA 2AWTA 3H7PB 2WDQB 3JSVA 2A4ZA 5E6OA 2BT6A 3TSSA 1E8ZA 1K52A 2XBBC 3BYTB 2J4XA 4LNIA 4N58A 5HFYA 1R7SA 4EEWA 3P2BA 3MJWA 4YSZB 1ZGUB 4RFBA 5D2MB 2FUHB 3PV1A 3BINA 1NVID 1V8CA 4BZAA 3V60A 4DBGA 5D94A 5AEKB 3Q3JA 2MA9B 1F0ZA 1H4RA 4N6EB 1N62A 1TS5A 1WX8A 2EELA 3EC8A 2WYQA 3ML9A 3ZNID 1ZXHA 1JROA 1TS3A 1ROEA 2VZKD 4G11A 2KMMA 3RZFA 2ZCBA 4NJCA 3BVZA 1RM6C 2LEKA 2O6VA 4AOFA 2L83A 2JX5A 2PPHA 2BBCA 1V6EA 1VLBA 4TUUA 4BKTA 2GBMA 4MGZE 1PFDA 4FHJA 1YIWA 1JWAD 3N32A 2GLSA 2W9NA 3I3TB 2JU6X 4K3BA 3AECB 4FHKA 5GXGB 1ZDVA 3Q69A 2J53A 1R4MB 1P7EA 2I1JA 2RDHA 1MHXA 1WZ3A 2FAZA 4XYCA 4FJZA 2WHIA 2PW9A 3PZDA 4W9GA 1XO3A 1PUTA 4DDGD 1SJHD 4GDLA 2GBJA 1B1ZA 3AEDB 4MSMB 5C2TB 3BK1A 4J6IA 4AS1A 4OZBA 3V6EB 4BFRA 2JXTA 3ONSA 4P7IA 3GOEA 4HWIB 2K25A 3AEAB 1J7BA 2DAJA 3SEBA 2C5LC 3WCQA 2L76A 2QJLA 1XXGA 3AEFB 2V3PA 1I4QA 4DDID 3HM3A 5TR5A 2KN5A 3LJ3A 3Q8EA 1DYQA 2KDBA 2X8XX 2FCMA 1V86A 1YQBA 3WALA 3VUYA 4ACFA 1QQRA 3MC0B 4KZ0A 2HJ8A 2MBQA 4M02A 4C7YA 3B0AA 2DLBA 2HD5B 3KQ4A 1IBXB 2CS4A 2X38A 4PS3A 1XCTL 1R4MI 3PVLA 2N1WA 2LGSA 2K0PA 1GAQB 2CR5A 3PS6A 2LMCA 2C7MB 3KUDB 3AE5B 3JW0X 1IGCA 2L3ZA 3B1LX 1HA5A 2PVGC 4HK2A 3MC8A 3ZIMA 1GG3A 1NDDA 4W9CA 4GLSC 2EKEC 2O2VB 2CKHB 4B9KA 3IFWB 4K1RB 3VTVA 1VR9A 1F52A 3GS2A 4EOYA 3UGBB 2KWDA 1FCLA 2INCC 2KC2A 2K9XA 4AJWA 4KKJA 1C76A 2KC1A 3RNFC 1R4NI 2LVQA 3IT4B 2LUEA 3TEYA 3AMZA 1SXTA 1UGMA 2V4IB 3GZNB 4MACA 3IXSA 1J7AA 1WX7A 5H8YE 4M0WA 3A9JA 4B0MA 1JRPA 3WAPA 3BK2A 1F77A 3R8BA 1PGXA 1FEHA 5IA7A 2XEWA 3JYUA 2WXOA 4AUQC 2ONQA 2PVOD 1BUIC 4A9AA 3ZDTA 1CK1A 2KXJA 5TSSA 5DPSA 1WY8A 1P7FA 2WDTB 1UH6A 3N1XC 2M1MA 3BYYB 2WX0A 2G45B 3WA0A 3BVGA 4BBNC 1HEZE 1HQRD 4B0EA 1RYJA 3CSFA 2NPTA 1SIJA 1T6BX 3QAQA 2W3RA 1MG4A 3Q8AA 4CHKA 1C78A 1C4PA 2KVRA 2MJ3A 4BVUC 3M62B 2MBEA 4O1NA 1P9DU 1OTRB 4AP4C 1YNTE 1RFKA 1NYRA 1SIFA 2KX0A 3SFDB 3PHWB 5DPWA 2QHOA 2Z0DB 1DOXA 4AJYB 1WE6A 3VRBB 3W1SC 2ON8A 3NS1A 1L4DB 3TJPA 4PS8A 3K9PB 1ZKHA 4WH4A
chains in the Genus database with same CATH topology
4NJ7A 5G55A 2FIFA 2LVPA 3DBHI 3X0WA 1J0GA 3AXCA 1J8CA 4FN2A 2ZVNA 1V49A 2BWFA 4M8MA 4MGYE 2FCQA 2V1YA 3ZTCA 3ZRCA 2LGXA 4MELA 1M94A 5AZGA 2XK5A 2IZVB 4A20A 3ZLZA 1KLVA 3QK0A 2MWSB 2IY1B 5EDSA 3VVWB 1WGGA 2LD9A 4DHJB 2RD0A 3NZSA 2PEAA 1WJNA 5CHWA 2JY6A 4HCPB 4BOSC 4DHJD 4BKTA 1WIAA 4K7SA 3M3JA 2LGYA 1S1QB 2VRRB 3ENEA 2JWZA 1OGWA 1P3QU 3C0RB 4EZJA 3PPAA 1WGYA 3JSVB 4WAAA 4F1SA 2Z0EB 3Q3FA 1YX5B 4RM9A 1Q5WB 1TBEA 1VCBA 2IYDB 4TKNA 3UF8A 3U8ZA 1UD7A 4DWFA 4PYUA 1D3ZA 2EMSA 4W9HA 4IM0A 2FCNA 4IG7B 2KTFA 2PE6B 1WXMA 2J0JA 3ZNZB 2KLCA 4HDOA 4NPNA 2J0MA 1F9JA 4X57B 2YLMA 3VFKA 5LXIB 3ZRFA 2MBBB 4IW0A 4OVVA 3QIJA 2KDEB 2ZVOA 4K7WA 4KIKB 1Q1OA 3ZW3A 1YD8U 3ML8A 2LXCA 3N3KB 5L95C 1IYFA 2MP2A 4CO7A 4MH0E 3K9OB 2PJHA 3T9LA 4W9IA 1RLFA 2UYZB 1YX6B 2M0XA 3DVGX 4HDQA 5DCNA 1L2NA 3MTNB 4ZRIA 2KFKB 3LDZE 3UQBA 2CHWA 1GUAB 2BYFA 2K39A 2R2OA 3TBLD 5BO4B 2Y5BB 3KH0A 3VAWA 1Z5SB 2J7QB 3VHTC 3ZO5B 2GOWA 2MBHA 4DXAB 2R2QA 4GDKA 1E8XA 2ZEQA 4ZRKA 4F7ZA 2EMTA 1WR6E 1K8RB 2KKCA 1C1YB 1BT0A 2J0KA 2KWVB 3DPDA 3A4RA 5E6NA 3W1YA 2O6VB 2HTHA 4JLCA 2IO2B 5DPTA 3UINB 3KW5B 4PS7A 2KWCA 4HXDA 1NBFC 2BWES 3KUZA 2N1VA 3U30A 2D10A 3RZWC 2KTRA 4II3B 2IO3B 3ZNGC 3VH4B 1Y8RC 2K6DB 3PREA 3N30A 3U7DA 2C60A 4ANWA 2K8CA 3TMPB 4EKUA 4FBJB 5AZHA 3ALBA 1P98A 2N7EA 1I42A 3GZNI 4ZDVA 3DVNV 1GJZA 2JXXA 4I6LB 2AEHA 5D7GA 5G2NA 1WJ6A 3EFUA 4IUMB 1WH3A 4NNJB 4TQ1A 3QX1A 1WXAA 3TIXA 2AL3A 2JF5A 2ZCCA 3B08A 4WQOB 1H8CA 4B6WA 3QA8A 2KQSA 4WJNA 4BOZB 4E71A 2NR2A 3A1QB 4FADA 3RCZA 4RMAA 2JT4B 4WWPA 2D3GA 3DOWA 1CMXB 2MQJA 1WE7A 2KANA 4N9F4 4TV3A 1YJ1A 4NQKE 3A9KB 3ECIA 3DVGY 2JUOA 3A4SC 4ASWC 4MM3A 4W9LA 4BKSA 4GDLB 1GC7A 3KUCB 3QJZA 1WJUA 4BKGA 1WXVA 3L08A 1JRUA 2AWTA 3H7PB 4ICVA 2C9WB 3JSVA 2A4ZA 3RUIB 5E6OA 2N9PC 2IBIB 2IO0B 1E8ZA 2XBBC 5LXHA 1OEYJ 3DBRI 1XD3B 2BGFA 4KSKC 3VXWA 1A5RA 3H7SA 2L8JA 2BYEA 1WM3A 4EEWA 1V2YA 2GMIC 1WI0A 3P2BA 3MJWA 1E7VA 3MHSD 3AULA 2N9XA 1ZGUB 1NI2A 5KHQA 2CHZA 5D2MB 2FUHB 3L0WB 3PV1A 4XC2A 4KIKA 2FNJB 3BINA 1P1AA 2JRIB 4MEMA 4BKSD 3DVNU 2KD0A 2DZJA 2LWPA 4A3OA 2KFJA 2MCNB 2N7DA 3OJ3A 1TTNA 3S2AA 3V60A 4DBGA 1V81A 1XT9B 2ASQA 3H9DA 4PYZA 2KFKA 5D94A 5AEKB 3Q3JA 2MRPA 4GGQA 1E90A 2MA9B 1L7YA 1Q0WB 2L00B 1H4RA 3WAOA 3AU5A 3L10B 3UIPB 1WX8A 2LXAA 2NBVB 2C7HA 3EC8A 2WYQA 3ML9A 3QC8B 3ZNID 4GU2A 3ZNHB 3ZUNA 2RR9A 2LZ6A 1FXTB 3PHXB 3HM6X 3IHPC 3PTFC 2D07B 4WJQA 3QWZB 4G11A 2KO3A 2WWZA 3CF6E 3RZFA 2NVUI 2ZCBA 2NCNA 3PLVA 1J19A 2DAFA 2O6VA 4ANUA 4AOFA 3PGEA 1EF1A 1UELA 3NZUA 1KJTA 1WZ0A 2PPHA 1E7UA 4W9JA 1V6EA 2K1FA 1RFAA 2DZIA 4TUUA 4GSWA 4W9FA 2L0FA 2BPSA 1WGRA 3BY4B 3RULA 3RYTA 2GBMA 4MGZE 1V80A 3L17A 4FHJA 1YIWA 3N32A 5L83A 2REXA 2W9NA 3I3TB 3PRMB 4KVGB 1SE9A 3QQ8B 4LJPB 4YL8A 3DQVA 4FHKA 4ANXA 4MGIE 2LASA 3L13A 2WX1A 5CHVC 2DENB 2L7RA 1IP9A 1WGDA 4HPMB 1UBIA 2AYOB 3WAMA 1EO6A 2PE9A 3EECA 3QARA 4II2B 3D32A 4EFOA 3NS8A 3T8MA 1OQYA 2ZPYA 2I1JA 2O6VD 4XX5A 2ZNVB 4DK5A 5FR6A 3A33B 2GBNA 3R3MA 3VTUA 3A1QA 1WZ3A 2FAZA 1WXSA 4FJVB 1UBQA 4FJZA 1V5TA 4M0WB 3A9JB 3PT2B 3OJ4B 3V6CB 2M17A 3SD5A 2LGDA 3OAWA 3WANA 3PZDA 2MBOA 4W9GA 2ZNVC 1E8YA 2A5UA 3A9KA 4M8NA 4ZYNA 3VUXA 4HLEA 4DDGD 3CMMB 4GXBA 3EHVA 3KVFB 4E74A 5J2RA 4DHZE 4GDLA 3IBEA 2CU1A 2GBJA 4MSQB 3V62A 2KZRA 4GIVA 4MSMB 2DZMA 4GOCA 4OVUA 2MW5A 4J6IA 1V5OA 2BKFA 1E5WA 3H7PA 1KM7A 4K7UA 3V6EB 4P7IA 3ONSA 4BFRA 4KSLC 4F8CB 1MG8A 1HE8A 3GOEA 1Z2MA 3RT3B 4G3XB 1U4AA 2DYBA 4HWIB 1S3SG 4NAWB 2LRWA 2K25A 2DAJA 4GMVA 2C5LC 3PSEB 2L76A 4XZ4A 4IWQA 2KDIA 1SGHA 4DDID 1OEYA 3HM3A 2C7NB 5TR5A 2KN5A 4A3PA 4TQ0A 2YVCA 3LJ3A 3TL5A 2BF8B 2JVCA 4ICUA 2KDBA 2KDFB 4HVBA 2FCMA 4K81A 4FJYA 1V86A 1GNUA 1YQBA 2FCSA 2K8HA 3WALA 3VUYA 5CX3A 1IPGA 2V3SA 4CYEA 2JPHA 2RGFA 1LQBA 3APFA 2KWUB 4KZ0A 1P0RA 2ZZPB 2HJ8A 2MBQA 4I6PA 1EUVB 1V9JA 2IO1B 5C23A 3VUWA 2JZ3B 3DBLI 2DX5B 4KDIC 4FA6A 3B0AA 2K6QA 2HD5B 3NY5A 1PQSA 4MGKE 3SU8X 3ZTDA 2CS4A 3DBSA 4I6NB 4PS3A 1R4MI 3APCA 3PVLA 3HHMA 2N1WA 2MX2A 4KDLB 3H6NA 4FLHA 1WF9A 3VQIA 4BBNF 1I35A 2CR5A 3PS6A 2KK8A 4NJ6A 1RRBA 2C7MB 2OJRA 4DHZB 3KUDB 3JW0X 4EZKA 2L3ZA 3B1LX 1AARA 3UIOB 4W9DA 4HK2A 2MSED 3ZIMA 4MDKE 2GBRA 1GG3A 1NDDA 4MJSB 3ZVVA 5HKHA 5JH5C 2G4DB 3APDA 4W9CA 2EKEC 2O2VB 3HIZA 1ISNA 3PLUA 5E6PA 2IY0B 2DZKA 2CKHB 1TZ1A 1LFDA 4B9KA 5CTRC 1UZXB 1E8WA 2N4FA 3WIMA 3IFWB 2M8SA 4K1RB 3VTVA 1WFYA 2KLGA 2G4SA 4IM2A 3UGBB 4EOYA 1EF5A 3PRPB 2KC2A 4AJWA 2DYMA 2LI5A 2KC1A 2AL6A 2DYOA 1WGHA 1WRDB 2KJRA 2KOXA 2UWQA 4ANVA 2JRHA 4WWNA 4ZRJA 5C1ZA 1R4NI 2LVQA 2RPQA 3VTWA 4FULA 2LUEA 4JGHB 5D6JB 3SHQA 3L54A 2LVOA 5JHAA 2NBUA 1WX9A 3R7RA 1UGMA 3QHTA 2XK5B 2Z59B 5JHBA 1C3TA 2KMCA 5CHFA 2LJ5A 5J17A 1KOTA 4EZLA 2L05A 1WX7A 4RM8A 2NBWB 1WR1A 2N9EB 3A9JA 3HK0A 4KZCA 4GB9A 3VDZA 3WAPA 4LJOB 2L0TA 2HE7A 1LM8B 4G0NB 4WJPA 4EUTA 5IA7A 3UQAA 4W9EA 2XEWA 3JYUA 3RD2A 2KHWB 4HJKA 4AUQC 4IWOA 1VD2A 5LLIA 2G3QB 2LRUA 2KQ7A 4JQWC 2NS5A 2KXJA 3VH3B 3ZDTA 2RSUA 5GMVA 5DPSA 1WY8A 4NY0A 4HPLB 2BKRB 2WDTB 1GC6A 2D2QA 4NAWA 2MLBA 2KJHB 2ZJDA 1T0YA 1UH6A 3IG3A 4E3CA 3AI5A 3AU4A 4LCDE 2M1MA 4WJOA 2WX0A 5J18A 3OLMD 4B95A 4GN1A 1QZEA 2G45B 3WA0A 5DPRA 4BBNC 5AZFA 3ZKJC 1WMHA 2DHZA 3V61A 3CSFA 3DDCB 3M63B 3KYCD 2MP2B 2NPTA 3KYDD 3PRZA 5IAAC 5KHOA 5JZEB 3R7QA 4W9KA 2B3AA 2CHXA 4URKA 2KMAA 2M4NA 4NQLB 4AWJA 3QAQA 4G50A 3W1SA 3NOBA 2FIDA 3R66C 3H1UA 4CHKA 3JVZX 4IM3A 1LXDA 1ZW7A 2KVRA 4BVUC 3M62B 4IC7B 2MBEA 2KNBA 1P9DU 2D11A 4IWPA 1OTRB 3SDLC 4GDKB 3TCAA 4AP4C 3L16A 1WMHB 3NHEB 2JZZA 2KJ6A 2GBKA 2V4LA 2NPTB 1SIFA 1WM2A 3IVFA 3QCAA 1G6JA 1WJ4A 2KX0A 4MJSA 3X23A 3PHWB 2O2VA 5DPWA 3CSTA 4LDTB 3DCGA 2KTRB 1X1MA 2QHOA 2Z0DB 2I1KA 1RAXA 1WE6A 2BYVE 4LDTD 1WYWB 4AJYB 4JL9A 4HCNB 1TGZB 2KX3A 1XQQA 3M95A 3ZDMC 2OOBB 3W1SC 2K8BA 2ZPNA 4WWOA 3O65B 4KV2A 3TJPA 4JIOU 4PS8A 3K9PB 1ZKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJ7 A;  5G55 A;  2FIF A;  2LVP A;  3DBH I;  3X0W A;  1J0G A;  3AXC A;  1J8C A;  4FN2 A;  2ZVN A;  1V49 A;  2BWF A;  4M8M A;  4MGY E;  2FCQ A;  2V1Y A;  3ZTC A;  3ZRC A;  2LGX A;  4MEL A;  1M94 A;  5AZG A;  2XK5 A;  2IZV B;  4A20 A;  3ZLZ A;  1KLV A;  3QK0 A;  2MWS B;  2IY1 B;  5EDS A;  3VVW B;  1WGG A;  2LD9 A;  4DHJ B;  2RD0 A;  3NZS A;  2PEA A;  1WJN A;  5CHW A;  2JY6 A;  4HCP B;  4BOS C;  4DHJ D;  4BKT A;  1WIA A;  4K7S A;  3M3J A;  2LGY A;  1S1Q B;  2VRR B;  3ENE A;  2JWZ A;  1OGW A;  1P3Q U;  3C0R B;  4EZJ A;  3PPA A;  1WGY A;  3JSV B;  4WAA A;  4F1S A;  2Z0E B;  3Q3F A;  1YX5 B;  4RM9 A;  1Q5W B;  1TBE A;  1VCB A;  2IYD B;  4TKN A;  3UF8 A;  3U8Z A;  1UD7 A;  4DWF A;  4PYU A;  1D3Z A;  2EMS A;  4W9H A;  4IM0 A;  2FCN A;  4IG7 B;  2KTF A;  2PE6 B;  1WXM A;  2J0J A;  3ZNZ B;  2KLC A;  4HDO A;  4NPN A;  2J0M A;  1F9J A;  4X57 B;  2YLM A;  3VFK A;  5LXI B;  3ZRF A;  2MBB B;  4IW0 A;  4OVV A;  3QIJ A;  2KDE B;  2ZVO A;  4K7W A;  4KIK B;  1Q1O A;  3ZW3 A;  1YD8 U;  3ML8 A;  2LXC A;  3N3K B;  5L95 C;  1IYF A;  2MP2 A;  4CO7 A;  4MH0 E;  3K9O B;  2PJH A;  3T9L A;  4W9I A;  1RLF A;  2UYZ B;  1YX6 B;  2M0X A;  3DVG X;  4HDQ A;  5DCN A;  1L2N A;  3MTN B;  4ZRI A;  2KFK B;  3LDZ E;  3UQB A;  2CHW A;  1GUA B;  2BYF A;  2K39 A;  2R2O A;  3TBL D;  5BO4 B;  2Y5B B;  3KH0 A;  3VAW A;  1Z5S B;  2J7Q B;  3VHT C;  3ZO5 B;  2GOW A;  2MBH A;  4DXA B;  2R2Q A;  4GDK A;  1E8X A;  2ZEQ A;  4ZRK A;  4F7Z A;  2EMT A;  1WR6 E;  1K8R B;  2KKC A;  1C1Y B;  1BT0 A;  2J0K A;  2KWV B;  3DPD A;  3A4R A;  5E6N A;  3W1Y A;  2O6V B;  2HTH A;  4JLC A;  2IO2 B;  5DPT A;  3UIN B;  3KW5 B;  4PS7 A;  2KWC A;  4HXD A;  1NBF C;  2BWE S;  3KUZ A;  2N1V A;  3U30 A;  2D10 A;  3RZW C;  2KTR A;  4II3 B;  2IO3 B;  3ZNG C;  3VH4 B;  1Y8R C;  2K6D B;  3PRE A;  3N30 A;  3U7D A;  2C60 A;  4ANW A;  2K8C A;  3TMP B;  4EKU A;  4FBJ B;  5AZH A;  3ALB A;  1P98 A;  2N7E A;  1I42 A;  3GZN I;  4ZDV A;  3DVN V;  1GJZ A;  2JXX A;  4I6L B;  2AEH A;  5D7G A;  5G2N A;  1WJ6 A;  3EFU A;  4IUM B;  1WH3 A;  4NNJ B;  4TQ1 A;  3QX1 A;  1WXA A;  3TIX A;  2AL3 A;  2JF5 A;  2ZCC A;  3B08 A;  4WQO B;  1H8C A;  4B6W A;  3QA8 A;  2KQS A;  4WJN A;  4BOZ B;  4E71 A;  2NR2 A;  3A1Q B;  4FAD A;  3RCZ A;  4RMA A;  2JT4 B;  4WWP A;  2D3G A;  3DOW A;  1CMX B;  2MQJ A;  1WE7 A;  2KAN A;  4N9F 4;  4TV3 A;  1YJ1 A;  4NQK E;  3A9K B;  3ECI A;  3DVG Y;  2JUO A;  3A4S C;  4ASW C;  4MM3 A;  4W9L A;  4BKS A;  4GDL B;  1GC7 A;  3KUC B;  3QJZ A;  1WJU A;  4BKG A;  1WXV A;  3L08 A;  1JRU A;  2AWT A;  3H7P B;  4ICV A;  2C9W B;  3JSV A;  2A4Z A;  3RUI B;  5E6O A;  2N9P C;  2IBI B;  2IO0 B;  1E8Z A;  2XBB C;  5LXH A;  1OEY J;  3DBR I;  1XD3 B;  2BGF A;  4KSK C;  3VXW A;  1A5R A;  3H7S A;  2L8J A;  2BYE A;  1WM3 A;  4EEW A;  1V2Y A;  2GMI C;  1WI0 A;  3P2B A;  3MJW A;  1E7V A;  3MHS D;  3AUL A;  2N9X A;  1ZGU B;  1NI2 A;  5KHQ A;  2CHZ A;  5D2M B;  2FUH B;  3L0W B;  3PV1 A;  4XC2 A;  4KIK A;  2FNJ B;  3BIN A;  1P1A A;  2JRI B;  4MEM A;  4BKS D;  3DVN U;  2KD0 A;  2DZJ A;  2LWP A;  4A3O A;  2KFJ A;  2MCN B;  2N7D A;  3OJ3 A;  1TTN A;  3S2A A;  3V60 A;  4DBG A;  1V81 A;  1XT9 B;  2ASQ A;  3H9D A;  4PYZ A;  2KFK A;  5D94 A;  5AEK B;  3Q3J A;  2MRP A;  4GGQ A;  1E90 A;  2MA9 B;  1L7Y A;  1Q0W B;  2L00 B;  1H4R A;  3WAO A;  3AU5 A;  3L10 B;  3UIP B;  1WX8 A;  2LXA A;  2NBV B;  2C7H A;  3EC8 A;  2WYQ A;  3ML9 A;  3QC8 B;  3ZNI D;  4GU2 A;  3ZNH B;  3ZUN A;  2RR9 A;  2LZ6 A;  1FXT B;  3PHX B;  3HM6 X;  3IHP C;  3PTF C;  2D07 B;  4WJQ A;  3QWZ B;  4G11 A;  2KO3 A;  2WWZ A;  3CF6 E;  3RZF A;  2NVU I;  2ZCB A;  2NCN A;  3PLV A;  1J19 A;  2DAF A;  2O6V A;  4ANU A;  4AOF A;  3PGE A;  1EF1 A;  1UEL A;  3NZU A;  1KJT A;  1WZ0 A;  2PPH A;  1E7U A;  4W9J A;  1V6E A;  2K1F A;  1RFA A;  2DZI A;  4TUU A;  4GSW A;  4W9F A;  2L0F A;  2BPS A;  1WGR A;  3BY4 B;  3RUL A;  3RYT A;  2GBM A;  4MGZ E;  1V80 A;  3L17 A;  4FHJ A;  1YIW A;  3N32 A;  5L83 A;  2REX A;  2W9N A;  3I3T B;  3PRM B;  4KVG B;  1SE9 A;  3QQ8 B;  4LJP B;  4YL8 A;  3DQV A;  4FHK A;  4ANX A;  4MGI E;  2LAS A;  3L13 A;  2WX1 A;  5CHV C;  2DEN B;  2L7R A;  1IP9 A;  1WGD A;  4HPM B;  1UBI A;  2AYO B;  3WAM A;  1EO6 A;  2PE9 A;  3EEC A;  3QAR A;  4II2 B;  3D32 A;  4EFO A;  3NS8 A;  3T8M A;  1OQY A;  2ZPY A;  2I1J A;  2O6V D;  4XX5 A;  2ZNV B;  4DK5 A;  5FR6 A;  3A33 B;  2GBN A;  3R3M A;  3VTU A;  3A1Q A;  1WZ3 A;  2FAZ A;  1WXS A;  4FJV B;  1UBQ A;  4FJZ A;  1V5T A;  4M0W B;  3A9J B;  3PT2 B;  3OJ4 B;  3V6C B;  2M17 A;  3SD5 A;  2LGD A;  3OAW A;  3WAN A;  3PZD A;  2MBO A;  4W9G A;  2ZNV C;  1E8Y A;  2A5U A;  3A9K A;  4M8N A;  4ZYN A;  3VUX A;  4HLE A;  4DDG D;  3CMM B;  4GXB A;  3EHV A;  3KVF B;  4E74 A;  5J2R A;  4DHZ E;  4GDL A;  3IBE A;  2CU1 A;  2GBJ A;  4MSQ B;  3V62 A;  2KZR A;  4GIV A;  4MSM B;  2DZM A;  4GOC A;  4OVU A;  2MW5 A;  4J6I A;  1V5O A;  2BKF A;  1E5W A;  3H7P A;  1KM7 A;  4K7U A;  3V6E B;  4P7I A;  3ONS A;  4BFR A;  4KSL C;  4F8C B;  1MG8 A;  1HE8 A;  3GOE A;  1Z2M A;  3RT3 B;  4G3X B;  1U4A A;  2DYB A;  4HWI B;  1S3S G;  4NAW B;  2LRW A;  2K25 A;  2DAJ A;  4GMV A;  2C5L C;  3PSE B;  2L76 A;  4XZ4 A;  4IWQ A;  2KDI A;  1SGH A;  4DDI D;  1OEY A;  3HM3 A;  2C7N B;  5TR5 A;  2KN5 A;  4A3P A;  4TQ0 A;  2YVC A;  3LJ3 A;  3TL5 A;  2BF8 B;  2JVC A;  4ICU A;  2KDB A;  2KDF B;  4HVB A;  2FCM A;  4K81 A;  4FJY A;  1V86 A;  1GNU A;  1YQB A;  2FCS A;  2K8H A;  3WAL A;  3VUY A;  5CX3 A;  1IPG A;  2V3S A;  4CYE A;  2JPH A;  2RGF A;  1LQB A;  3APF A;  2KWU B;  4KZ0 A;  1P0R A;  2ZZP B;  2HJ8 A;  2MBQ A;  4I6P A;  1EUV B;  1V9J A;  2IO1 B;  5C23 A;  3VUW A;  2JZ3 B;  3DBL I;  2DX5 B;  4KDI C;  4FA6 A;  3B0A A;  2K6Q A;  2HD5 B;  3NY5 A;  1PQS A;  4MGK E;  3SU8 X;  3ZTD A;  2CS4 A;  3DBS A;  4I6N B;  4PS3 A;  1R4M I;  3APC A;  3PVL A;  3HHM A;  2N1W A;  2MX2 A;  4KDL B;  3H6N A;  4FLH A;  1WF9 A;  3VQI A;  4BBN F;  1I35 A;  2CR5 A;  3PS6 A;  2KK8 A;  4NJ6 A;  1RRB A;  2C7M B;  2OJR A;  4DHZ B;  3KUD B;  3JW0 X;  4EZK A;  2L3Z A;  3B1L X;  1AAR A;  3UIO B;  4W9D A;  4HK2 A;  2MSE D;  3ZIM A;  4MDK E;  2GBR A;  1GG3 A;  1NDD A;  4MJS B;  3ZVV A;  5HKH A;  5JH5 C;  2G4D B;  3APD A;  4W9C A;  2EKE C;  2O2V B;  3HIZ A;  1ISN A;  3PLU A;  5E6P A;  2IY0 B;  2DZK A;  2CKH B;  1TZ1 A;  1LFD A;  4B9K A;  5CTR C;  1UZX B;  1E8W A;  2N4F A;  3WIM A;  3IFW B;  2M8S A;  4K1R B;  3VTV A;  1WFY A;  2KLG A;  2G4S A;  4IM2 A;  3UGB B;  4EOY A;  1EF5 A;  3PRP B;  2KC2 A;  4AJW A;  2DYM A;  2LI5 A;  2KC1 A;  2AL6 A;  2DYO A;  1WGH A;  1WRD B;  2KJR A;  2KOX A;  2UWQ A;  4ANV A;  2JRH A;  4WWN A;  4ZRJ A;  5C1Z A;  1R4N I;  2LVQ A;  2RPQ A;  3VTW A;  4FUL A;  2LUE A;  4JGH B;  5D6J B;  3SHQ A;  3L54 A;  2LVO A;  5JHA A;  2NBU A;  1WX9 A;  3R7R A;  1UGM A;  3QHT A;  2XK5 B;  2Z59 B;  5JHB A;  1C3T A;  2KMC A;  5CHF A;  2LJ5 A;  5J17 A;  1KOT A;  4EZL A;  2L05 A;  1WX7 A;  4RM8 A;  2NBW B;  1WR1 A;  2N9E B;  3A9J A;  3HK0 A;  4KZC A;  4GB9 A;  3VDZ A;  3WAP A;  4LJO B;  2L0T A;  2HE7 A;  1LM8 B;  4G0N B;  4WJP A;  4EUT A;  5IA7 A;  3UQA A;  4W9E A;  2XEW A;  3JYU A;  3RD2 A;  2KHW B;  4HJK A;  4AUQ C;  4IWO A;  1VD2 A;  5LLI A;  2G3Q B;  2LRU A;  2KQ7 A;  4JQW C;  2NS5 A;  2KXJ A;  3VH3 B;  3ZDT A;  2RSU A;  5GMV A;  5DPS A;  1WY8 A;  4NY0 A;  4HPL B;  2BKR B;  2WDT B;  1GC6 A;  2D2Q A;  4NAW A;  2MLB A;  2KJH B;  2ZJD A;  1T0Y A;  1UH6 A;  3IG3 A;  4E3C A;  3AI5 A;  3AU4 A;  4LCD E;  2M1M A;  4WJO A;  2WX0 A;  5J18 A;  3OLM D;  4B95 A;  4GN1 A;  1QZE A;  2G45 B;  3WA0 A;  5DPR A;  4BBN C;  5AZF A;  3ZKJ C;  1WMH A;  2DHZ A;  3V61 A;  3CSF A;  3DDC B;  3M63 B;  3KYC D;  2MP2 B;  2NPT A;  3KYD D;  3PRZ A;  5IAA C;  5KHO A;  5JZE B;  3R7Q A;  4W9K A;  2B3A A;  2CHX A;  4URK A;  2KMA A;  2M4N A;  4NQL B;  4AWJ A;  3QAQ A;  4G50 A;  3W1S A;  3NOB A;  2FID A;  3R66 C;  3H1U A;  4CHK A;  3JVZ X;  4IM3 A;  1LXD A;  1ZW7 A;  2KVR A;  4BVU C;  3M62 B;  4IC7 B;  2MBE A;  2KNB A;  1P9D U;  2D11 A;  4IWP A;  1OTR B;  3SDL C;  4GDK B;  3TCA A;  4AP4 C;  3L16 A;  1WMH B;  3NHE B;  2JZZ A;  2KJ6 A;  2GBK A;  2V4L A;  2NPT B;  1SIF A;  1WM2 A;  3IVF A;  3QCA A;  1G6J A;  1WJ4 A;  2KX0 A;  4MJS A;  3X23 A;  3PHW B;  2O2V A;  5DPW A;  3CST A;  4LDT B;  3DCG A;  2KTR B;  1X1M A;  2QHO A;  2Z0D B;  2I1K A;  1RAX A;  1WE6 A;  2BYV E;  4LDT D;  1WYW B;  4AJY B;  4JL9 A;  4HCN B;  1TGZ B;  2KX3 A;  1XQQ A;  3M95 A;  3ZDM C;  2OOB B;  3W1S C;  2K8B A;  2ZPN A;  4WWO A;  3O65 B;  4KV2 A;  3TJP A;  4JIO U;  4PS8 A;  3K9P B;  1ZKH A; 
#chains in the Genus database with same CATH topology
 2MHJ A;  3DBH I;  1J0G A;  3AXC A;  1V49 A;  2BWF A;  1WRI A;  1TS2 A;  2V1Y A;  2LGX A;  2Y5P A;  2XK5 A;  1KLV A;  3V05 A;  5EDS A;  2RD0 A;  3FAH A;  1DGJ A;  2PEA A;  1NEN B;  3NZS A;  2JY6 A;  4BOS C;  3NG0 A;  4K7S A;  3M3J A;  2LGY A;  4JPS A;  2VRR B;  1OGW A;  4L23 A;  4C80 A;  1EM7 A;  3B2F A;  4XE0 A;  4WAA A;  4M01 A;  4HRO A;  3LXF A;  1VCB A;  4YWG G;  3U8Z A;  1UD7 A;  5IOI A;  4DWF A;  3NVV A;  3ZNZ B;  3FIL A;  2KLC A;  1FPY A;  2J0M A;  2KN4 A;  2MBB B;  4IW0 A;  2NTT A;  4OVV A;  4HRS A;  2WXP A;  4KIK B;  3ZW3 A;  4MH0 E;  2B76 B;  3T9L A;  3H8H A;  2UYZ B;  1FFV A;  3MTN B;  2GB1 A;  1QOB A;  2KFK B;  2BYF A;  5HHD G;  2R61 A;  3TBL D;  1Z5S B;  1JWM D;  3ZO5 B;  1XLP A;  4ZRK A;  4F7Z A;  2ZEQ A;  2EMT A;  2KWV B;  4WAF A;  2PMV A;  2KWC A;  2CJN A;  4RCO A;  3KUZ A;  2H89 B;  5G5G A;  3EA6 A;  1XCQ L;  2D10 A;  3RZW C;  1KTK A;  4II3 B;  1VRA B;  3Q14 C;  2K6D B;  3U7D A;  2M19 A;  4ANW A;  4S0R A;  5AZH A;  1FXA A;  3DVN V;  1GJZ A;  2BB5 A;  4I6L B;  4RGN A;  2AEH A;  2WXG A;  4JWS C;  1K53 A;  3TUO A;  2ZCC A;  4WQO B;  5BYR A;  4B6W A;  2L1A A;  4WJN A;  4KKI A;  4RMA A;  2D3G A;  3DOW A;  3B9J A;  2MQJ A;  1WE7 A;  3A9K B;  4ASW C;  1GC7 A;  3TEZ A;  4RF1 A;  3RUI B;  2N9P C;  2IBI B;  2IO0 B;  5LXH A;  1XD3 B;  2BGF A;  2QDF A;  3H7S A;  1E7V A;  3MHS D;  3AUL A;  2IGH A;  1YQ3 B;  4LTU A;  5KHQ A;  2CHZ A;  1GPX A;  1IGD A;  3L0W B;  2QEJ C;  4XC2 A;  2FNJ B;  2G1E A;  4MEM A;  2SAK A;  3DVN U;  2KD0 A;  2DZJ A;  2MCN B;  2N7D A;  3OJ3 A;  3T3N A;  3S2A A;  1V81 A;  4A6Q A;  2K22 A;  4PYZ A;  1Q0W B;  2L00 B;  3RPF C;  3AU5 A;  3ZYY X;  3UIP B;  2LXA A;  4GU2 A;  4P16 A;  3ZNH B;  1HXY D;  1L4Z B;  1UWX A;  1FXT B;  2WWZ A;  3V3X A;  3N1Z C;  1TIF A;  1TYG B;  1J19 A;  2W55 A;  1FXI A;  1WZ0 A;  4W9J A;  1CQV A;  1RFA A;  4GSW A;  2L0F A;  4YTP B;  3BY4 B;  3RUL A;  1SJE D;  2REX A;  3PRM B;  2QMT A;  1SE9 A;  1V1P A;  3QQ8 B;  4LJP B;  1TKG A;  2J52 A;  1IP9 A;  4HPM B;  4KGR A;  4A8X C;  1KFY B;  1EO6 A;  2PE9 A;  1OQQ A;  2MEK A;  4II2 B;  3D32 A;  1OQY A;  2WXF A;  2ZPY A;  1FRD A;  1ZOY B;  1E7P B;  4DK5 A;  3A33 B;  3R3M A;  3A1Q A;  5IKC M;  2H88 B;  2M17 A;  2LGD A;  2IDY A;  4ZYN A;  2ZNV C;  1E8Y A;  2A5U A;  2WNM A;  3CMM B;  4GXB A;  3KVF B;  4E74 A;  5J2R A;  2GI9 A;  2KZR A;  3NVZ A;  2DZM A;  2MW5 A;  1F2R I;  1E5W A;  4M00 A;  4KSL C;  1MG8 A;  1HE8 A;  2HDE A;  4G3X B;  1U4A A;  3P4P B;  3PSE B;  4IWQ A;  2KDI A;  1SGH A;  1OEY A;  4A90 A;  4TQ0 A;  2YVC A;  4ICU A;  4A55 A;  2FCS A;  2INP E;  5CX3 A;  1IPG A;  4CYE A;  2RGF A;  3APF A;  4RGM A;  2ZZP B;  3VUW A;  4KDI C;  3SU8 X;  1PQS A;  4MGK E;  1TT5 B;  3DBS A;  3APC A;  2MX2 A;  4KDL B;  3H6N A;  4FLH A;  4BBN F;  2LFI A;  3P4R B;  1A70 A;  3Q2A C;  1SBB B;  2KK8 A;  2NTS A;  4OZA A;  3HUI A;  3UIO B;  1AAR A;  4W9D A;  1V97 A;  2JYE A;  2MSE D;  4MDK E;  1MI0 A;  4MJS B;  5JH5 C;  4FXC A;  3HVZ A;  1OFF A;  5HI1 A;  5E6P A;  2N4F A;  3AE3 B;  2WXI A;  4IM2 A;  3IAS 1;  1FIQ A;  2UWQ A;  1I4P A;  3PO0 A;  1WRD B;  3R2T A;  3VTW A;  1TKY A;  1KH0 A;  2JYT A;  3L54 A;  2LVO A;  4EE2 A;  1WX9 A;  1C3T A;  5CHF A;  5J17 A;  4C4V A;  2WXN A;  2L05 A;  2N9E B;  4GB9 A;  1TY0 A;  1N63 A;  2MH7 A;  4G0N B;  3Q3O C;  3UQA A;  4W9E A;  1CZP A;  4IWO A;  1UWM A;  2IPK D;  1WWT A;  3VH3 B;  2RSU A;  4DXG A;  4NY0 A;  4HPL B;  2IGD A;  3P42 A;  2DBY A;  2KVZ A;  2RDG A;  2KJH B;  2XNA C;  2ZJD A;  4NAW A;  1T0Y A;  3IG3 A;  2L52 A;  3AI5 A;  3AU4 A;  4LCD E;  4WJO A;  4GN1 A;  1UUP A;  3MP9 A;  3R2I A;  5AZF A;  3ZKJ C;  2BS3 B;  2DHZ A;  1JWS D;  3DDC B;  3M63 B;  4ARI A;  2KQ4 X;  3KYD D;  3R7Q A;  4W9K A;  4AWJ A;  3TEX A;  3NVY A;  2DNF A;  4IM3 A;  3E9S A;  1LXD A;  3P63 A;  3N9Y C;  2WXM A;  1BML C;  1T0Q C;  4GDK B;  1WMH B;  3NHE B;  2BB6 A;  2AX5 A;  4LK0 M;  1G6J A;  2ZW0 A;  1L0X B;  3X23 A;  4LDT B;  4HEA 1;  2I1K A;  4LDT D;  4JL9 A;  4HCN B;  2K8B A;  3O65 B;  4JIO U;  3RFZ B;  4NJ7 A;  2FIF A;  2OED A;  1ET6 A;  1UF0 A;  2FCQ A;  2IZV B;  5LNK 1;  2LD9 A;  3EUB 2;  1I4H A;  5CHW A;  3C8Y A;  4HCP B;  4ZHO A;  2ICI A;  1QT9 A;  4P1C C;  3ENE A;  2W54 A;  1DOY A;  3C0R B;  3JSV B;  4XDC A;  2Z0E B;  3Q3F A;  1YX5 B;  1D5M C;  4RM9 A;  1Q5W B;  3RMK C;  3UF8 A;  1D3Z A;  4PYU A;  4IM0 A;  4YTM B;  2FCN A;  4JE3 B;  1E6E B;  2KTF A;  2PE6 B;  4IG7 B;  2AQ1 B;  3VFK A;  2YLM A;  3KLS X;  3BZD B;  3URY A;  2ZVO A;  4K7W A;  1Q1O A;  1YD8 U;  3ML8 A;  2LXC A;  3N3K B;  5L95 C;  1IYF A;  2MP2 A;  4CO7 A;  4OW0 A;  3ETR A;  3K9O B;  3J9C A;  3DVG X;  5DCN A;  2M0X A;  4HDQ A;  3LDZ E;  1D5X C;  3NRZ A;  3UQB A;  4C7Z A;  2CHW A;  5IN7 A;  5BO4 B;  2Y5B B;  3KH0 A;  2J7Q B;  3LYY A;  2MBH A;  3ZXR A;  3DBR B;  2N9L A;  3DBL B;  1ENF A;  1SE4 A;  1BT0 A;  2J0K A;  3W1Y A;  5E6N A;  3A4R A;  2O6V B;  2HTH A;  4ZHP A;  4RGT A;  4HXD A;  3U7Z A;  2BWE S;  2N1V A;  2KTR A;  3NJT A;  2IO3 B;  1SF0 A;  3VH4 B;  1Y8R C;  1EU3 A;  1JML A;  2C60 A;  4EKU A;  5EE3 A;  2N7E A;  3GZN I;  4ZDV A;  5EE0 A;  5G2N A;  3PZ7 A;  3P4S B;  2BYT A;  1WH3 A;  1XLQ A;  2OJW A;  3UI3 A;  1MJD A;  3QA8 A;  2D3A A;  2NR2 A;  1M4V A;  3AM9 A;  1CMX B;  1YJ1 A;  2JUO A;  1L0V B;  4MM3 A;  4W9L A;  4GDL B;  2YEP B;  3AH7 A;  3KUC B;  1WJU A;  4BKG A;  1WXV A;  1YJJ A;  1JRU A;  3GE8 C;  4ICV A;  2HJ1 A;  2C9W B;  2KDM A;  3DBR I;  4KSK C;  3VXW A;  1A5R A;  1YOV B;  2L8J A;  2BYE A;  1V2Y A;  2GMI C;  1WI0 A;  4USA A;  3B2G A;  2N9X A;  1NI2 A;  2JRI B;  4BKS D;  2LWP A;  4A3O A;  1TTN A;  4WQM A;  1XT9 B;  2ASQ A;  3H9D A;  2PTL A;  3BII D;  1I7H A;  2MRP A;  3FKY A;  1E90 A;  3WAO A;  4YSY B;  3AE6 B;  2NBV B;  3AE4 B;  4HJG E;  4XDD A;  3RN9 C;  1JWB D;  2XN9 C;  2RR9 A;  3Q8F A;  1VDV A;  2LZ6 A;  2PIA A;  3QWZ B;  3CF6 E;  2NCN A;  4US9 A;  3PLV A;  2DAF A;  2INN E;  4ANU A;  5D3I B;  1UEL A;  3DHI C;  3AB5 A;  2LGI A;  3O13 A;  1PYW D;  5C3J B;  2DZI A;  4W9F A;  2BPS A;  1WGR A;  1N61 A;  4QAY A;  1AW7 A;  3DHH C;  4KVG B;  4YL8 A;  3DQV A;  2WX1 A;  3GE3 C;  2W82 A;  2L7R A;  1NYQ A;  1UBI A;  3GP7 A;  2AYO B;  2LHD A;  4EFO A;  3EEC A;  3QAR A;  3NS8 A;  3T8M A;  3P4Q B;  2ZNV B;  2QSD A;  3RNC C;  5FR6 A;  3I63 C;  1UNS A;  4FJV B;  1WXS A;  5IP4 D;  1UBQ A;  1V5T A;  4M0W B;  3A9J B;  3PT2 B;  3OAW A;  3WAN A;  3VUX A;  4M8N A;  2V0G A;  1FNU A;  4DHZ E;  3IBE A;  2CU1 A;  4MSQ B;  3V62 A;  4GIV A;  4GOC A;  4R3D A;  2Y5C A;  1NEK B;  3H7P A;  4WWM A;  1KM7 A;  3DWG C;  4K7U A;  2DYB A;  1S3S G;  4NZL B;  4XZ4 A;  1ZP0 B;  2K3U A;  2D3C A;  1GB1 A;  3ZJU A;  3RNE C;  2BF8 B;  4YXD B;  2KDF B;  1KLG D;  1GNU A;  2K8H A;  2ZW1 A;  2WXK A;  2V3S A;  4L2Y A;  2AQ2 B;  2JPH A;  1LQB A;  4IKG A;  2KWU B;  1P0R A;  1EUV B;  1V9J A;  4KGT A;  5C23 A;  2JZ3 B;  2DX5 B;  2IND C;  2K6Q A;  3NY5 A;  1QOF A;  1SEB D;  3ZTD A;  4I6N B;  3VQI A;  1WF9 A;  2WXL A;  2OJR A;  4DHZ B;  1Q10 A;  4EZK A;  4C00 A;  3AE9 B;  2GBR A;  2WQY B;  2G4D B;  1MPE A;  2ACZ B;  1D5Z C;  3HIZ A;  1JAL A;  3PLU A;  2IY0 B;  3RI7 C;  1LFD A;  4LNK A;  1UZX B;  3WIM A;  3ZGZ A;  2KLG A;  2G4S A;  1EF5 A;  3PRP B;  2DYM A;  2AL6 A;  2KOX A;  1E9M A;  2Q5W D;  2JRH A;  4FUL A;  1JQ4 A;  4JGH B;  3SHQ A;  4J3O D;  5JHA A;  4YTN B;  2NBU A;  3R7R A;  3QHT A;  2XK5 B;  2KMC A;  2LJ5 A;  1AYF A;  3L4P A;  2NBW B;  5FK9 C;  5E6J A;  1T0S C;  4LJO B;  2L0T A;  2HE7 A;  4EUT A;  3RD2 A;  3BWU D;  3RNG C;  2V3N A;  1VD2 A;  5FKA C;  5LLI A;  2KQ7 A;  2BVC A;  4JQW C;  2NS5 A;  5GMV A;  3IT6 B;  3W5U B;  1STE A;  2MLB A;  2BTE A;  4E3C A;  3FIL B;  4YSX B;  1QZE A;  2JWU A;  5DPR A;  1WMH A;  1FNW A;  3V61 A;  1UGJ A;  3KYC D;  3FC4 A;  5KHO A;  3MC9 A;  1C77 A;  4URK A;  2KMA A;  2M4N A;  4G50 A;  3W1S A;  3NOB A;  3R66 C;  1HTO A;  3ZQ4 A;  1ZW7 A;  2Z8L A;  2MJE A;  1IBX A;  2RPV A;  4TMA B;  2Y3A A;  1ACC A;  1Y56 A;  3SDL C;  4ZRP A;  1TZO A;  1N5X A;  1HTQ A;  5BMG A;  2I38 A;  2KJ6 A;  2KAC A;  3IVF A;  1EWC A;  2E6X A;  1N5W A;  2O2V A;  1NI3 A;  3CST A;  4OHJ A;  5MPO A;  4HKZ E;  1RAX A;  2KT7 A;  2BYV E;  1TGZ B;  2KX3 A;  3Q3M C;  3W9C B;  3OG5 A;  2ZPN A;  1J7C A;  3ZXV A;  2M0A A;  5G55 A;  3X0W A;  2QC8 A;  1IUE A;  1FNV A;  4FN2 A;  2ZVN A;  4M8M A;  4MGY E;  3ZTC A;  1FM0 D;  1D6E C;  4MEL A;  1M94 A;  5AZG A;  1WGK A;  3ZLZ A;  2MWS B;  2IY1 B;  3VVW B;  1WGG A;  4DHJ B;  2JQR B;  4DHJ D;  2JWZ A;  1P3Q U;  3AN1 A;  1WGY A;  4TKN A;  1DOI A;  3BVM A;  2EMS A;  4W9H A;  4CQN A;  1C4C A;  1N6Z A;  4ZYS A;  2J0J A;  2VZK B;  4HDO A;  4X57 B;  3NUH B;  3ZRF A;  1MVK A;  2KDE B;  1K50 A;  2BQQ A;  1FD6 A;  1GOZ A;  2BW2 A;  1F2R C;  4W9I A;  4REZ A;  1YX6 B;  1L2N A;  4ZRI A;  4K3C A;  2K39 A;  2R2O A;  3I5J C;  2GOW A;  1C4A A;  2KYW A;  4RH6 A;  4DXA B;  2WXQ A;  2PKO A;  1WSP A;  1K8R B;  2KKC A;  1C1Y B;  2AQ3 B;  2IO2 B;  1SE2 A;  3KW5 B;  1YN5 A;  4PS7 A;  1NBF C;  2FBW B;  2K5P A;  3U30 A;  3I57 A;  4ZOH C;  4LNF A;  1XLN A;  3PRE A;  2K8C A;  3EFC A;  2D5G A;  1P98 A;  1V1P B;  1E10 A;  1I42 A;  5D7G A;  1WJ6 A;  4HPP A;  2IJ0 A;  4NNJ B;  4P6V F;  2EKI A;  1FRR A;  1LGR A;  2AL3 A;  2WXJ A;  3TIX A;  2KQS A;  4BOZ B;  4E71 A;  1WXQ A;  3A1Q B;  1F1H A;  2QCZ A;  3RNB C;  3RCZ A;  4FAD A;  1QIL A;  4WWP A;  1L6V A;  1R4N B;  3Q8C A;  3P1M A;  1JW9 D;  2KAN A;  4TV3 A;  4NQK E;  3A4S C;  2PLP A;  4BKS A;  1I4G A;  5BMI A;  3L08 A;  1XEE A;  1D4B A;  3SR6 A;  4S17 A;  1OEY J;  1T0R C;  5EE1 A;  4XWW A;  1WM3 A;  5T8I A;  1BXT A;  3U2S C;  1YMH E;  4L1B A;  1V1O A;  5FR3 A;  1PDX A;  4KIK A;  1P1A A;  3DHG C;  1MFW A;  2KFJ A;  1TY2 A;  2KFK A;  3KWL A;  4GGQ A;  1L7Y A;  3L10 B;  3TEW A;  3QC8 B;  2C7H A;  3KWV A;  2VH1 A;  3ZUN A;  4WJQ A;  3PHX B;  3HM6 X;  3IHP C;  3PTF C;  2D07 B;  2KO3 A;  1VJK A;  2NVU I;  4JX1 C;  3Q8B A;  3VR9 B;  2WDR B;  3PGE A;  1EF1 A;  3NZU A;  1KJT A;  2YEP F;  3AE2 B;  1E7U A;  3DWM A;  1MHH E;  1OQR A;  2K1F A;  4JWU C;  3RYT A;  1JWU D;  1V80 A;  3L17 A;  1KLU D;  5L83 A;  5BMH A;  5I4D A;  2D3B A;  4ANX A;  4MGI E;  2LAS A;  3L13 A;  4RF0 A;  5CHV C;  2DEN B;  1PGB A;  1SE3 A;  1WGD A;  2JZP A;  4PT5 A;  3Q6B A;  3WAM A;  3AE7 B;  5HG2 A;  3U52 E;  2O6V D;  4XX5 A;  2BS4 B;  2GBN A;  3VTU A;  4C4V B;  3OJ4 B;  3V6C B;  3DBH B;  3SD5 A;  2MBO A;  1YN4 A;  3A9K A;  2FE8 A;  4HLE A;  2WS3 B;  3U4E G;  3EHV A;  2LHE A;  4HKQ A;  1ESF A;  1C9F A;  4OVU A;  1V5O A;  2BKF A;  3AE8 B;  4F8C B;  4NAM A;  1Z2M A;  3RT3 B;  4NAW B;  2LRW A;  3HVD A;  4GMV A;  1FO4 A;  1RWS A;  2C7N B;  4A3P A;  3TL5 A;  1QKZ A;  2JVC A;  4HVB A;  1YN3 A;  2J42 A;  4FJY A;  4K81 A;  2CU3 A;  4I6P A;  2IO1 B;  3DBL I;  4FA6 A;  4AQ7 A;  3EGR A;  1VZ6 A;  3HHM A;  5BYS A;  2HTM E;  4OVZ A;  1I35 A;  4NJ6 A;  1RRB A;  3ABV B;  2WXH A;  3ZVV A;  5HKH A;  3APD A;  3LB8 C;  4OZC A;  4XWT A;  3VR8 B;  1ISN A;  2DZK A;  2KAJ A;  1TZ1 A;  3VRA B;  5CTR C;  1E8W A;  2WP9 B;  2M8S A;  1WFY A;  1FCC C;  2LI5 A;  4WUR A;  2DYO A;  4ANV A;  1WGH A;  2KJR A;  4WWN A;  4ZRJ A;  5C1Z A;  2RPQ A;  4H2A A;  5D6J B;  2Z59 B;  5JHB A;  1KOT A;  1HZ6 A;  4EZL A;  4RM8 A;  3ZJT A;  1WR1 A;  1SB3 C;  1TKE A;  3HK0 A;  4KZC A;  2N0S B;  1AWD A;  3AEB B;  4LLG M;  1QOG A;  3VDZ A;  1LM8 B;  4WJP A;  1ZUD 2;  3OWE B;  2WGS A;  2KHW B;  4HJK A;  4YT0 B;  2G3Q B;  2LRU A;  3T3O A;  1QOA A;  4ARC A;  2WXR A;  4N59 A;  2IGG A;  2OHF A;  2BKR B;  1C79 A;  1GC6 A;  2D2Q A;  3W2D A;  2CJO A;  1B9R A;  4PK1 A;  1HZ5 A;  5J18 A;  1L5P A;  3OLM D;  4B95 A;  1K51 A;  1ZE3 D;  5H92 C;  1GB4 A;  2MP2 B;  2RDB C;  3PRZ A;  5IAA C;  5JZE B;  2B3A A;  2CHX A;  1CJE A;  4NQL B;  2FID A;  3H1U A;  3JVZ X;  4TSS A;  2BS2 B;  4IC7 B;  3NZ3 A;  2KNB A;  2D11 A;  2NMQ A;  4IWP A;  4ITK A;  3AV8 A;  3TCA A;  3N1Y C;  3L16 A;  4IDI A;  2JZZ A;  2GBK A;  2V4L A;  2NPT B;  1WM2 A;  3QCA A;  1ZXI A;  1WJ4 A;  4MJS A;  3E56 A;  5JXV A;  3AE1 B;  1VZ8 A;  3DCG A;  2KTR B;  1X1M A;  1XLO A;  2I2Y A;  1T3Q A;  1WYW B;  2JSV X;  1I4X A;  1XQQ A;  4DQO C;  3M95 A;  2MJD A;  2OOB B;  3ZDM C;  1QF6 A;  4WWO A;  4KV2 A;  1SSN A;  4P1B C;  3HRD D;  1FMA D;  3AEE B;  4LNO A;  4UDU C;  2LVP A;  4KX6 B;  2QIL A;  3SFE B;  1J8C A;  1E0Z A;  2V9H A;  1AN8 A;  2N9K A;  3ZRC A;  3RNA C;  4A20 A;  3QK0 A;  2WLB A;  4KGS A;  3MFG A;  1WJN A;  2SEB D;  1WIA A;  4MM3 B;  1ZDX A;  1S1Q B;  2LUM A;  4EZJ A;  5AUI A;  4WIP A;  5IO9 A;  3PPA A;  5G5H A;  2QIE B;  4MT5 A;  4F1S A;  1TBE A;  2IYD B;  1L6U A;  4ZRQ A;  4IOI E;  4Q2J A;  1WXM A;  3PZ8 A;  4NPN A;  2WU5 B;  1F9J A;  2G9H D;  4DXF A;  5LXI B;  3ZJV A;  2UU7 A;  3QIJ A;  3CIR B;  3MJ5 A;  1TJE A;  4RGO S;  4C56 C;  2PJH A;  1EU4 A;  1RLF A;  1KF6 B;  1PGA A;  1VZ7 A;  1GUA B;  1ZPS A;  3GB1 A;  1N60 A;  3VAW A;  1QLB B;  2FUG 1;  2N7J A;  1YQ4 B;  2TSS A;  3VHT C;  1EWY C;  2R2Q A;  4GDK A;  1E8X A;  3Q3N C;  3C19 A;  1YJI A;  5D3D A;  3N20 C;  1WR6 E;  5AUK A;  3DPD A;  4JLC A;  5DPT A;  3UIN B;  2M56 B;  3AEG B;  1FFU A;  3MHZ A;  2VH2 A;  3NVW A;  3ZNG C;  2WU2 B;  4XGA B;  2LJI A;  1T5X D;  4RNA A;  4D2K A;  3N30 A;  3TMP B;  4FBJ B;  3ALB A;  1LO5 D;  4MH8 A;  2JXX A;  1XF5 L;  1JCK B;  2GRI A;  3EFU A;  4IUM B;  1KRH A;  4US8 A;  4TQ1 A;  1ET9 A;  1WYG A;  1WXA A;  3QX1 A;  2JF5 A;  3IAM 1;  3B08 A;  1H8C A;  2WDV B;  2JT4 B;  1TS4 A;  4LNN A;  1L0Y B;  5EE9 A;  5BYQ A;  2RMM A;  4N9F 4;  4BAX A;  3ECI A;  3DVG Y;  3I9V 1;  3W5V B;  1I4R A;  3CWI A;  2DWQ A;  2E3T A;  3QJZ A;  2L32 A;  2W3S A;  2AWT A;  3H7P B;  2WDQ B;  3JSV A;  2A4Z A;  5E6O A;  2BT6 A;  3TSS A;  1E8Z A;  1K52 A;  2XBB C;  3BYT B;  2J4X A;  4LNI A;  4N58 A;  5HFY A;  1R7S A;  4EEW A;  3P2B A;  3MJW A;  4YSZ B;  1ZGU B;  4RFB A;  5D2M B;  2FUH B;  3PV1 A;  3BIN A;  1NVI D;  1V8C A;  4BZA A;  3V60 A;  4DBG A;  5D94 A;  5AEK B;  3Q3J A;  2MA9 B;  1F0Z A;  1H4R A;  4N6E B;  1N62 A;  1TS5 A;  1WX8 A;  2EEL A;  3EC8 A;  2WYQ A;  3ML9 A;  3ZNI D;  1ZXH A;  1JRO A;  1TS3 A;  1ROE A;  2VZK D;  4G11 A;  2KMM A;  3RZF A;  2ZCB A;  4NJC A;  3BVZ A;  1RM6 C;  2LEK A;  2O6V A;  4AOF A;  2L83 A;  2JX5 A;  2PPH A;  2BBC A;  1V6E A;  1VLB A;  4TUU A;  4BKT A;  2GBM A;  4MGZ E;  1PFD A;  4FHJ A;  1YIW A;  1JWA D;  3N32 A;  2GLS A;  2W9N A;  3I3T B;  2JU6 X;  4K3B A;  3AEC B;  4FHK A;  5GXG B;  1ZDV A;  3Q69 A;  2J53 A;  1R4M B;  1P7E A;  2I1J A;  2RDH A;  1MHX A;  1WZ3 A;  2FAZ A;  4XYC A;  4FJZ A;  2WHI A;  2PW9 A;  3PZD A;  4W9G A;  1XO3 A;  1PUT A;  4DDG D;  1SJH D;  4GDL A;  2GBJ A;  1B1Z A;  3AED B;  4MSM B;  5C2T B;  3BK1 A;  4J6I A;  4AS1 A;  4OZB A;  3V6E B;  4BFR A;  2JXT A;  3ONS A;  4P7I A;  3GOE A;  4HWI B;  2K25 A;  3AEA B;  1J7B A;  2DAJ A;  3SEB A;  2C5L C;  3WCQ A;  2L76 A;  2QJL A;  1XXG A;  3AEF B;  2V3P A;  1I4Q A;  4DDI D;  3HM3 A;  5TR5 A;  2KN5 A;  3LJ3 A;  3Q8E A;  1DYQ A;  2KDB A;  2X8X X;  2FCM A;  1V86 A;  1YQB A;  3WAL A;  3VUY A;  4ACF A;  1QQR A;  3MC0 B;  4KZ0 A;  2HJ8 A;  2MBQ A;  4M02 A;  4C7Y A;  3B0A A;  2DLB A;  2HD5 B;  3KQ4 A;  1IBX B;  2CS4 A;  2X38 A;  4PS3 A;  1XCT L;  1R4M I;  3PVL A;  2N1W A;  2LGS A;  2K0P A;  1GAQ B;  2CR5 A;  3PS6 A;  2LMC A;  2C7M B;  3KUD B;  3AE5 B;  3JW0 X;  1IGC A;  2L3Z A;  3B1L X;  1HA5 A;  2PVG C;  4HK2 A;  3MC8 A;  3ZIM A;  1GG3 A;  1NDD A;  4W9C A;  4GLS C;  2EKE C;  2O2V B;  2CKH B;  4B9K A;  3IFW B;  4K1R B;  3VTV A;  1VR9 A;  1F52 A;  3GS2 A;  4EOY A;  3UGB B;  2KWD A;  1FCL A;  2INC C;  2KC2 A;  2K9X A;  4AJW A;  4KKJ A;  1C76 A;  2KC1 A;  3RNF C;  1R4N I;  2LVQ A;  3IT4 B;  2LUE A;  3TEY A;  3AMZ A;  1SXT A;  1UGM A;  2V4I B;  3GZN B;  4MAC A;  3IXS A;  1J7A A;  1WX7 A;  5H8Y E;  4M0W A;  3A9J A;  4B0M A;  1JRP A;  3WAP A;  3BK2 A;  1F77 A;  3R8B A;  1PGX A;  1FEH A;  5IA7 A;  2XEW A;  3JYU A;  2WXO A;  4AUQ C;  2ONQ A;  2PVO D;  1BUI C;  4A9A A;  3ZDT A;  1CK1 A;  2KXJ A;  5TSS A;  5DPS A;  1WY8 A;  1P7F A;  2WDT B;  1UH6 A;  3N1X C;  2M1M A;  3BYY B;  2WX0 A;  2G45 B;  3WA0 A;  3BVG A;  4BBN C;  1HEZ E;  1HQR D;  4B0E A;  1RYJ A;  3CSF A;  2NPT A;  1SIJ A;  1T6B X;  3QAQ A;  2W3R A;  1MG4 A;  3Q8A A;  4CHK A;  1C78 A;  1C4P A;  2KVR A;  2MJ3 A;  4BVU C;  3M62 B;  2MBE A;  4O1N A;  1P9D U;  1OTR B;  4AP4 C;  1YNT E;  1RFK A;  1NYR A;  1SIF A;  2KX0 A;  3SFD B;  3PHW B;  5DPW A;  2QHO A;  2Z0D B;  1DOX A;  4AJY B;  1WE6 A;  3VRB B;  3W1S C;  2ON8 A;  3NS1 A;  1L4D B;  3TJP A;  4PS8 A;  3K9P B;  1ZKH A;  4WH4 A; 
#chains in the Genus database with same CATH homology
 4NJ7 A;  5G55 A;  2FIF A;  2LVP A;  3DBH I;  3X0W A;  1J0G A;  3AXC A;  1J8C A;  4FN2 A;  2ZVN A;  1V49 A;  2BWF A;  4M8M A;  4MGY E;  2FCQ A;  2V1Y A;  3ZTC A;  3ZRC A;  2LGX A;  4MEL A;  1M94 A;  5AZG A;  2XK5 A;  2IZV B;  4A20 A;  3ZLZ A;  1KLV A;  3QK0 A;  2MWS B;  2IY1 B;  5EDS A;  3VVW B;  1WGG A;  2LD9 A;  4DHJ B;  2RD0 A;  3NZS A;  2PEA A;  1WJN A;  5CHW A;  2JY6 A;  4HCP B;  4BOS C;  4DHJ D;  4BKT A;  1WIA A;  4K7S A;  3M3J A;  2LGY A;  1S1Q B;  2VRR B;  3ENE A;  2JWZ A;  1OGW A;  1P3Q U;  3C0R B;  4EZJ A;  3PPA A;  1WGY A;  3JSV B;  4WAA A;  4F1S A;  2Z0E B;  3Q3F A;  1YX5 B;  4RM9 A;  1Q5W B;  1TBE A;  1VCB A;  2IYD B;  4TKN A;  3UF8 A;  3U8Z A;  1UD7 A;  4DWF A;  4PYU A;  1D3Z A;  2EMS A;  4W9H A;  4IM0 A;  2FCN A;  4IG7 B;  2KTF A;  2PE6 B;  1WXM A;  2J0J A;  3ZNZ B;  2KLC A;  4HDO A;  4NPN A;  2J0M A;  1F9J A;  4X57 B;  2YLM A;  3VFK A;  5LXI B;  3ZRF A;  2MBB B;  4IW0 A;  4OVV A;  3QIJ A;  2KDE B;  2ZVO A;  4K7W A;  4KIK B;  1Q1O A;  3ZW3 A;  1YD8 U;  3ML8 A;  2LXC A;  3N3K B;  5L95 C;  1IYF A;  2MP2 A;  4CO7 A;  4MH0 E;  3K9O B;  2PJH A;  3T9L A;  4W9I A;  1RLF A;  2UYZ B;  1YX6 B;  2M0X A;  3DVG X;  4HDQ A;  5DCN A;  1L2N A;  3MTN B;  4ZRI A;  2KFK B;  3LDZ E;  3UQB A;  2CHW A;  1GUA B;  2BYF A;  2K39 A;  2R2O A;  3TBL D;  5BO4 B;  2Y5B B;  3KH0 A;  3VAW A;  1Z5S B;  2J7Q B;  3VHT C;  3ZO5 B;  2GOW A;  2MBH A;  4DXA B;  2R2Q A;  4GDK A;  1E8X A;  2ZEQ A;  4ZRK A;  4F7Z A;  2EMT A;  1WR6 E;  1K8R B;  2KKC A;  1C1Y B;  1BT0 A;  2J0K A;  2KWV B;  3DPD A;  3A4R A;  5E6N A;  3W1Y A;  2O6V B;  2HTH A;  4JLC A;  2IO2 B;  5DPT A;  3UIN B;  3KW5 B;  4PS7 A;  2KWC A;  4HXD A;  1NBF C;  2BWE S;  3KUZ A;  2N1V A;  3U30 A;  2D10 A;  3RZW C;  2KTR A;  4II3 B;  2IO3 B;  3ZNG C;  3VH4 B;  1Y8R C;  2K6D B;  3PRE A;  3N30 A;  3U7D A;  2C60 A;  4ANW A;  2K8C A;  3TMP B;  4EKU A;  4FBJ B;  5AZH A;  3ALB A;  1P98 A;  2N7E A;  1I42 A;  3GZN I;  4ZDV A;  3DVN V;  1GJZ A;  2JXX A;  4I6L B;  2AEH A;  5D7G A;  5G2N A;  1WJ6 A;  3EFU A;  4IUM B;  1WH3 A;  4NNJ B;  4TQ1 A;  3QX1 A;  1WXA A;  3TIX A;  2AL3 A;  2JF5 A;  2ZCC A;  3B08 A;  4WQO B;  1H8C A;  4B6W A;  3QA8 A;  2KQS A;  4WJN A;  4BOZ B;  4E71 A;  2NR2 A;  3A1Q B;  4FAD A;  3RCZ A;  4RMA A;  2JT4 B;  4WWP A;  2D3G A;  3DOW A;  1CMX B;  2MQJ A;  1WE7 A;  2KAN A;  4N9F 4;  4TV3 A;  1YJ1 A;  4NQK E;  3A9K B;  3ECI A;  3DVG Y;  2JUO A;  3A4S C;  4ASW C;  4MM3 A;  4W9L A;  4BKS A;  4GDL B;  1GC7 A;  3KUC B;  3QJZ A;  1WJU A;  4BKG A;  1WXV A;  3L08 A;  1JRU A;  2AWT A;  3H7P B;  4ICV A;  2C9W B;  3JSV A;  2A4Z A;  3RUI B;  5E6O A;  2N9P C;  2IBI B;  2IO0 B;  1E8Z A;  2XBB C;  5LXH A;  1OEY J;  3DBR I;  1XD3 B;  2BGF A;  4KSK C;  3VXW A;  1A5R A;  3H7S A;  2L8J A;  2BYE A;  1WM3 A;  4EEW A;  1V2Y A;  2GMI C;  1WI0 A;  3P2B A;  3MJW A;  1E7V A;  3MHS D;  3AUL A;  2N9X A;  1ZGU B;  1NI2 A;  5KHQ A;  2CHZ A;  5D2M B;  2FUH B;  3L0W B;  3PV1 A;  4XC2 A;  4KIK A;  2FNJ B;  3BIN A;  1P1A A;  2JRI B;  4MEM A;  4BKS D;  3DVN U;  2KD0 A;  2DZJ A;  2LWP A;  4A3O A;  2KFJ A;  2MCN B;  2N7D A;  3OJ3 A;  1TTN A;  3S2A A;  3V60 A;  4DBG A;  1V81 A;  1XT9 B;  2ASQ A;  3H9D A;  4PYZ A;  2KFK A;  5D94 A;  5AEK B;  3Q3J A;  2MRP A;  4GGQ A;  1E90 A;  2MA9 B;  1L7Y A;  1Q0W B;  2L00 B;  1H4R A;  3WAO A;  3AU5 A;  3L10 B;  3UIP B;  1WX8 A;  2LXA A;  2NBV B;  2C7H A;  3EC8 A;  2WYQ A;  3ML9 A;  3QC8 B;  3ZNI D;  4GU2 A;  3ZNH B;  3ZUN A;  2RR9 A;  2LZ6 A;  1FXT B;  3PHX B;  3HM6 X;  3IHP C;  3PTF C;  2D07 B;  4WJQ A;  3QWZ B;  4G11 A;  2KO3 A;  2WWZ A;  3CF6 E;  3RZF A;  2NVU I;  2ZCB A;  2NCN A;  3PLV A;  1J19 A;  2DAF A;  2O6V A;  4ANU A;  4AOF A;  3PGE A;  1EF1 A;  1UEL A;  3NZU A;  1KJT A;  1WZ0 A;  2PPH A;  1E7U A;  4W9J A;  1V6E A;  2K1F A;  1RFA A;  2DZI A;  4TUU A;  4GSW A;  4W9F A;  2L0F A;  2BPS A;  1WGR A;  3BY4 B;  3RUL A;  3RYT A;  2GBM A;  4MGZ E;  1V80 A;  3L17 A;  4FHJ A;  1YIW A;  3N32 A;  5L83 A;  2REX A;  2W9N A;  3I3T B;  3PRM B;  4KVG B;  1SE9 A;  3QQ8 B;  4LJP B;  4YL8 A;  3DQV A;  4FHK A;  4ANX A;  4MGI E;  2LAS A;  3L13 A;  2WX1 A;  5CHV C;  2DEN B;  2L7R A;  1IP9 A;  1WGD A;  4HPM B;  1UBI A;  2AYO B;  3WAM A;  1EO6 A;  2PE9 A;  3EEC A;  3QAR A;  4II2 B;  3D32 A;  4EFO A;  3NS8 A;  3T8M A;  1OQY A;  2ZPY A;  2I1J A;  2O6V D;  4XX5 A;  2ZNV B;  4DK5 A;  5FR6 A;  3A33 B;  2GBN A;  3R3M A;  3VTU A;  3A1Q A;  1WZ3 A;  2FAZ A;  1WXS A;  4FJV B;  1UBQ A;  4FJZ A;  1V5T A;  4M0W B;  3A9J B;  3PT2 B;  3OJ4 B;  3V6C B;  2M17 A;  3SD5 A;  2LGD A;  3OAW A;  3WAN A;  3PZD A;  2MBO A;  4W9G A;  2ZNV C;  1E8Y A;  2A5U A;  3A9K A;  4M8N A;  4ZYN A;  3VUX A;  4HLE A;  4DDG D;  3CMM B;  4GXB A;  3EHV A;  3KVF B;  4E74 A;  5J2R A;  4DHZ E;  4GDL A;  3IBE A;  2CU1 A;  2GBJ A;  4MSQ B;  3V62 A;  2KZR A;  4GIV A;  4MSM B;  2DZM A;  4GOC A;  4OVU A;  2MW5 A;  4J6I A;  1V5O A;  2BKF A;  1E5W A;  3H7P A;  1KM7 A;  4K7U A;  3V6E B;  4P7I A;  3ONS A;  4BFR A;  4KSL C;  4F8C B;  1MG8 A;  1HE8 A;  3GOE A;  1Z2M A;  3RT3 B;  4G3X B;  1U4A A;  2DYB A;  4HWI B;  1S3S G;  4NAW B;  2LRW A;  2K25 A;  2DAJ A;  4GMV A;  2C5L C;  3PSE B;  2L76 A;  4XZ4 A;  4IWQ A;  2KDI A;  1SGH A;  4DDI D;  1OEY A;  3HM3 A;  2C7N B;  5TR5 A;  2KN5 A;  4A3P A;  4TQ0 A;  2YVC A;  3LJ3 A;  3TL5 A;  2BF8 B;  2JVC A;  4ICU A;  2KDB A;  2KDF B;  4HVB A;  2FCM A;  4K81 A;  4FJY A;  1V86 A;  1GNU A;  1YQB A;  2FCS A;  2K8H A;  3WAL A;  3VUY A;  5CX3 A;  1IPG A;  2V3S A;  4CYE A;  2JPH A;  2RGF A;  1LQB A;  3APF A;  2KWU B;  4KZ0 A;  1P0R A;  2ZZP B;  2HJ8 A;  2MBQ A;  4I6P A;  1EUV B;  1V9J A;  2IO1 B;  5C23 A;  3VUW A;  2JZ3 B;  3DBL I;  2DX5 B;  4KDI C;  4FA6 A;  3B0A A;  2K6Q A;  2HD5 B;  3NY5 A;  1PQS A;  4MGK E;  3SU8 X;  3ZTD A;  2CS4 A;  3DBS A;  4I6N B;  4PS3 A;  1R4M I;  3APC A;  3PVL A;  3HHM A;  2N1W A;  2MX2 A;  4KDL B;  3H6N A;  4FLH A;  1WF9 A;  3VQI A;  4BBN F;  1I35 A;  2CR5 A;  3PS6 A;  2KK8 A;  4NJ6 A;  1RRB A;  2C7M B;  2OJR A;  4DHZ B;  3KUD B;  3JW0 X;  4EZK A;  2L3Z A;  3B1L X;  1AAR A;  3UIO B;  4W9D A;  4HK2 A;  2MSE D;  3ZIM A;  4MDK E;  2GBR A;  1GG3 A;  1NDD A;  4MJS B;  3ZVV A;  5HKH A;  5JH5 C;  2G4D B;  3APD A;  4W9C A;  2EKE C;  2O2V B;  3HIZ A;  1ISN A;  3PLU A;  5E6P A;  2IY0 B;  2DZK A;  2CKH B;  1TZ1 A;  1LFD A;  4B9K A;  5CTR C;  1UZX B;  1E8W A;  2N4F A;  3WIM A;  3IFW B;  2M8S A;  4K1R B;  3VTV A;  1WFY A;  2KLG A;  2G4S A;  4IM2 A;  3UGB B;  4EOY A;  1EF5 A;  3PRP B;  2KC2 A;  4AJW A;  2DYM A;  2LI5 A;  2KC1 A;  2AL6 A;  2DYO A;  1WGH A;  1WRD B;  2KJR A;  2KOX A;  2UWQ A;  4ANV A;  2JRH A;  4WWN A;  4ZRJ A;  5C1Z A;  1R4N I;  2LVQ A;  2RPQ A;  3VTW A;  4FUL A;  2LUE A;  4JGH B;  5D6J B;  3SHQ A;  3L54 A;  2LVO A;  5JHA A;  2NBU A;  1WX9 A;  3R7R A;  1UGM A;  3QHT A;  2XK5 B;  2Z59 B;  5JHB A;  1C3T A;  2KMC A;  5CHF A;  2LJ5 A;  5J17 A;  1KOT A;  4EZL A;  2L05 A;  1WX7 A;  4RM8 A;  2NBW B;  1WR1 A;  2N9E B;  3A9J A;  3HK0 A;  4KZC A;  4GB9 A;  3VDZ A;  3WAP A;  4LJO B;  2L0T A;  2HE7 A;  1LM8 B;  4G0N B;  4WJP A;  4EUT A;  5IA7 A;  3UQA A;  4W9E A;  2XEW A;  3JYU A;  3RD2 A;  2KHW B;  4HJK A;  4AUQ C;  4IWO A;  1VD2 A;  5LLI A;  2G3Q B;  2LRU A;  2KQ7 A;  4JQW C;  2NS5 A;  2KXJ A;  3VH3 B;  3ZDT A;  2RSU A;  5GMV A;  5DPS A;  1WY8 A;  4NY0 A;  4HPL B;  2BKR B;  2WDT B;  1GC6 A;  2D2Q A;  4NAW A;  2MLB A;  2KJH B;  2ZJD A;  1T0Y A;  1UH6 A;  3IG3 A;  4E3C A;  3AI5 A;  3AU4 A;  4LCD E;  2M1M A;  4WJO A;  2WX0 A;  5J18 A;  3OLM D;  4B95 A;  4GN1 A;  1QZE A;  2G45 B;  3WA0 A;  5DPR A;  4BBN C;  5AZF A;  3ZKJ C;  1WMH A;  2DHZ A;  3V61 A;  3CSF A;  3DDC B;  3M63 B;  3KYC D;  2MP2 B;  2NPT A;  3KYD D;  3PRZ A;  5IAA C;  5KHO A;  5JZE B;  3R7Q A;  4W9K A;  2B3A A;  2CHX A;  4URK A;  2KMA A;  2M4N A;  4NQL B;  4AWJ A;  3QAQ A;  4G50 A;  3W1S A;  3NOB A;  2FID A;  3R66 C;  3H1U A;  4CHK A;  3JVZ X;  4IM3 A;  1LXD A;  1ZW7 A;  2KVR A;  4BVU C;  3M62 B;  4IC7 B;  2MBE A;  2KNB A;  1P9D U;  2D11 A;  4IWP A;  1OTR B;  3SDL C;  4GDK B;  3TCA A;  4AP4 C;  3L16 A;  1WMH B;  3NHE B;  2JZZ A;  2KJ6 A;  2GBK A;  2V4L A;  2NPT B;  1SIF A;  1WM2 A;  3IVF A;  3QCA A;  1G6J A;  1WJ4 A;  2KX0 A;  4MJS A;  3X23 A;  3PHW B;  2O2V A;  5DPW A;  3CST A;  4LDT B;  3DCG A;  2KTR B;  1X1M A;  2QHO A;  2Z0D B;  2I1K A;  1RAX A;  1WE6 A;  2BYV E;  4LDT D;  1WYW B;  4AJY B;  4JL9 A;  4HCN B;  1TGZ B;  2KX3 A;  1XQQ A;  3M95 A;  3ZDM C;  2OOB B;  3W1S C;  2K8B A;  2ZPN A;  4WWO A;  3O65 B;  4KV2 A;  3TJP A;  4JIO U;  4PS8 A;  3K9P B;  1ZKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...