1K8RB

Crystal structure of ras-bry2rbd complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
82
Chain Sequence
CILRFIACNGQTRAVQSRGDYQKTLAIALKKFSLEDASKFIVCVSQSSRIKLITEERDRLIIVPKEKPCPSFEDLRRSWEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ras-Byr2RBD complex: structural basis for Ras effector recognition in yeast.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Transforming protein P21/H-RAS-1
total genus 14
structure length 82
sequence length 95
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2001-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14847 Ras_bdg_2 Ras-binding domain of Byr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1k8rB00
2N1WA 4FHKA 5IAAC 4A3OA 1OGWA 1S1QB 2DZMA 2WX1A 2LUEA 3LJ3A 5J2RA 4W9IA 4ZRJA 2M8SA 4BBNC 4DXAB 3ZNID 3V61A 4RMAA 3PS6A 5AZFA 2N4FA 2PEAA 3QK0A 1LFDA 3SDLC 3H7PA 4EZLA 4F8CB 4ZRKA 3PGEA 2KDFB 2NBVB 1IP9A 3DBSA 4LCDE 4M8NA 4BOZB 4WWNA 2W9NA 1WIAA 4ANVA 3PVLA 1ZGUB 4G11A 4W9CA 2LRUA 2LGDA 3B1LX 4AJWA 2N9XA 2N7EA 4K7SA 2MW5A 1C3TA 4HVBA 5JHBA 4GGQA 1KOTA 2KMAA 2QHOA 4EFOA 1H8CA 2O2VB 4IM0A 2KDBA 3DVNU 3A9KA 3P2BA 2LZ6A 2YVCA 3U30A 2K25A 3I3TB 2O6VA 2BGFA 3Q3JA 1Q5WB 1GNUA 3JW0X 4GMVA 4F7ZA 3PZDA 2DZJA 4WJQA 4PYZA 3ZNZB 3GZNI 1YQBA 4W9FA 4EZKA 4NPNA 3WAMA 2BF8B 2BKFA 5AZHA 1LQBA 4ICVA 4K7WA 2KNBA 5JZEB 3UIPB 3VH3B 2MRPA 4ZRIA 3VH4B 5CTRC 2LD9A 3R7QA 3UIOB 3QJZA 4K1RB 4HPLB 2KD0A 1UBIA 1ZW7A 3AULA 5L83A 1GG3A 1E8YA 4KZ0A 4HLEA 3QCAA 3VUYA 2L3ZA 1EF5A 3QWZB 3VUWA 3OJ4B 4DWFA 2MBQA 1S3SG 2LGXA 2DHZA 3RD2A 5L95C 3HK0A 2CR5A 1J0GA 2Y5BB 4AP4C 2MP2A 4NQLB 4MEMA 1I42A 5GMVA 1SGHA 3DCGA 4GSWA 2XEWA 3K9OB 4DHJB 4BKSA 3N30A 5EDSA 1KLVA 2BYVE 4E74A 4KZCA 2GBRA 4K81A 2GBKA 3IFWB 2AYOB 1XQQA 3WA0A 3WAOA 2LVQA 1LM8B 2C60A 3RULA 3ZTDA 2MSED 2FIFA 1Q1OA 3AU5A 3EECA 3HM6X 4W9KA 2M4NA 4FJVB 4DK5A 3V62A 1QZEA 2DAFA 2MBOA 3WALA 3KYDD 3H6NA 1Q0WB 2RGFA 4XX5A 3H7PB 2N7DA 1E8XA 4WAAA 3ZW3A 2KFKA 2VRRB 3ALBA 3NZUA 2K8CA 2PJHA 2J0MA 2KWCA 4MGIE 4M0WB 4HDQA 3V6CB 2Z0EB 4LJPB 2NCNA 3ENEA 2B3AA 4IW0A 5BO4B 4IWOA 2MCNB 3NZSA 3CSTA 2KJRA 3JSVB 3APCA 2LRWA 1EUVB 2MWSB 3ZTCA 3ZRFA 2MQJA 2FCMA 2JF5A 3L54A 4I6PA 3SD5A 4EUTA 5D6JB 2KOXA 1WX8A 1XD3B 4FBJB 4BBNF 1TGZB 2CHXA 3H7SA 3ZIMA 3TL5A 2EKEC 3JYUA 1T0YA 4KSLC 1WZ3A 2D11A 3PTFC 2K1FA 1M94A 4NNJB 2C9WB 3CMMB 1PQSA 1L7YA 2EMSA 2NR2A 3A9JB 4EKUA 2L00B 3DPDA 1UD7A 2I1JA 5CHWA 5E6PA 2IBIB 1WMHA 4II3B 3M3JA 1P9DU 2ZNVC 4II2B 4TQ1A 2DYOA 4DDGD 4URKA 4MGYE 4YL8A 5CX3A 1RFAA 3VFKA 1IYFA 1E7VA 4LJOB 1V5OA 4WQOB 3C0RB 1VCBA 1WI0A 3WANA 3PRMB 1R4MI 5D94A 3K9PB 2KTRA 2GMIC 4HCNB 4OVVA 3KH0A 3UQAA 5LXIB 2KX0A 1J19A 2ZPNA 1UH6A 3KW5B 4XZ4A 1WXAA 4J6IA 4X57B 4IC7B 1TBEA 2JXXA 2JT4B 2R2QA 4W9EA 4NQKE 4IM3A 3X0WA 5LXHA 4EZJA 1YX5B 2AL3A 4WJPA 4BFRA 1V49A 1RRBA 3ZO5B 2LWPA 2IO3B 2BWES 2JRHA 2KTFA 2LI5A 2WYQA 3A1QA 3NS8A 4WJNA 1WGDA 4GDLB 4LDTD 4HK2A 3L17A 5DPSA 1OTRB 2KVRA 4ASWC 4GDKB 3V60A 4MSQB 1WR6E 3APFA 1UBQA 4K7UA 4JQWC 3U8ZA 3SHQA 3KYCD 2J0JA 1YD8U 2KC1A 4A3PA 3BY4B 4FJZA 1HE8A 4HWIB 1R4NI 1WYWB 2KZRA 4IWPA 3RT3B 3R66C 5C1ZA 5J18A 1Z2MA 1NBFC 4TV3A 1RAXA 3OAWA 2ZCBA 5C23A 3MHSD 3ZDTA 2NBUA 2LJ5A 2G4DB 4MDKE 4DBGA 4JIOU 3R3MA 4A20A 1D3ZA 2FAZA 3L16A 3OLMD 3T9LA 3MTNB 2N9PC 1WM2A 4KV2A 3LDZE 4RM8A 1YIWA 2FIDA 2IO2B 4FJYA 1WJ6A 1SE9A 3UF8A 3M95A 2IY0B 2L8JA 4GB9A 4KIKB 3VTUA 4ANXA 3AU4A 5IA7A 4GXBA 4LDTB 4HXDA 2KWUB 3B0AA 3PRZA 2REXA 3UGBB 4NJ6A 4DHJD 1UELA 3R7RA 4HPMB 3PRPB 2JWZA 3DVGX 1BT0A 4CYEA 4B6WA 2KFJA 3AXCA 3QA8A 2C7NB 3KVFB 2KN5A 2K39A 5DPTA 3ZRCA 4AUQC 1CMXB 4GN1A 2G3QB 4BVUC 3DBLI 1EF1A 2AWTA 2G45B 2PE6B 4M8MA 4JL9A 1V5TA 2IO1B 1WM3A 2M1MA 3B08A 5AZGA 3VQIA 2CS4A 5JH5C 1V2YA 2PPHA 3O65B 1WRDB 1WE7A 1WMHB 3NY5A 2RSUA 2HTHA 4FA6A 1K8RB 1TTNA 2V1YA 5DCNA 4MJSA 1TZ1A 4CO7A 2L05A 2RD0A 4WWOA 1WE6A 4W9JA 1OEYA 4MELA 2KQSA 1UGMA 1G6JA 4E3CA 1WR1A 1V81A 2JRIB 2JZ3B 3VVWB 1E7UA 1E8ZA 4GDKA 2KO3A 5J17A 4MJSB 2WX0A 4BKGA 4MGKE 4N9F4 1GC6A 2JVCA 5TR5A 2L0FA 4GU2A 2A4ZA 2DYMA 2A5UA 1YJ1A 4IG7B 3NOBA 2DZKA 3HHMA 3PV1A 1C1YB 2KLGA 2LXAA 2MA9B 1WXVA 2LXCA 3RZWC 3T8MA 1WJNA 3X23A 3ZKJC 5DPWA 1WX7A 2J7QB 3EHVA 3GOEA 4W9HA 3D32A 2V3SA 3TCAA 4AWJA 2HE7A 3EFUA 1SIFA 3VHTC 3VXWA 1WJ4A 3SU8X 3PSEB 3AI5A 4JGHB 5KHOA 1WY8A 1VD2A 3RUIB 1FXTB 2O6VB 3KUDB 1GJZA 1WXSA 2KXJA 4MM3A 5HKHA 2M0XA 3EC8A 4B9KA 1JRUA 2KLCA 1EO6A 1RLFA 1V6EA 3L0WB 2C5LC 3MJWA 3DOWA 4KIKA 4DHZB 2CU1A 2CHZA 1E90A 3CSFA 1UZXB 4PS7A 3U7DA 3WAPA 1WGRA 1Y8RC 3TBLD 2KC2A 3H9DA 4PYUA 1ZKHA 4JLCA 2LGYA 1WH3A 1AARA 2KJ6A 5CHVC 1YX6B 1V86A 5JHAA 2ZVNA 4KSKC 3DVNV 2FNJB 2Z59B 4W9GA 2GOWA 2KK8A 3NHEB 2O2VA 2MLBA 4ZDVA 4NAWA 3JVZX 4HCPB 3ECIA 2NBWB 2XK5B 3L13A 4TQ0A 2K6QA 3APDA 1I35A 1OQYA 3IBEA 4PS8A 3BINA 4NJ7A 3A33B 5G2NA 2G4SA 1KJTA 2JY6A 2N9EB 4B95A 2MX2A 2ASQA 3PPAA 3QX1A 3CF6E 3DBHI 4KVGB 4W9LA 3UINB 3ML9A 2D3GA 3A9KB 3S2AA 2O6VD 2XK5A 3TIXA 1L2NA 2FUHB 4G0NB 4GIVA 1V80A 2KFKB 4XC2A 3ONSA 2AL6A 2K6DB 4TKNA 2KANA 3PHWB 3RCZA 4ANUA 2D10A 2DYBA 1WGHA 2YLMA 3VAWA 3PLUA 3IVFA 2KQ7A 3A4SC 2AEHA 4KDIC 4FHJA 4IUMB 2HJ8A 4WJOA 1WZ0A 2RPQA 3ZUNA 2ZNVB 5KHQA 3N3KB 1F9JA 2MBHA 3RYTA 2NS5A 4I6LB 4HJKA 2C7MB 5D7GA 2DX5B 4G50A 2WWZA 4ANWA 4BOSC 1GC7A 4MH0E 3A1QB 3KUCB 1LXDA 1NI2A 2ZZPB 1E8WA 3DDCB 1E5WA 1X1MA 2L76A 2ZJDA 2LVPA 3PT2B 3ZVVA 1Z5SB 2UYZB 4W9DA 3A9JA 3DQVA 3H1UA 4WWPA 1P1AA 2KTRB 5AEKB 4NAWB 2PE9A 2N1VA 4MGZE 4TUUA 3DVGY 2BWFA 3QC8B 5E6OA 4BKSD 1P0RA 1WX9A 2OJRA 2MP2B 1WGGA 5D2MB 5CHFA 2NPTA 4AOFA 2IYDB 3V6EB 1OEYJ 2DAJA 2UWQA 3VDZA 1J8CA 4BKTA 4HDOA 1GUAB 1KM7A 3WIMA 4E71A 3PLVA 3VTWA 2KWVB 3VUXA 3DBRI 2BYEA 3QARA 2JUOA 4RM9A 3QIJA 4ZYNA 2ZEQA 2MBEA 4FADA 3TMPB 4FULA 3ZDMC 4FLHA 2CHWA 2DENB 2FCNA 3ZLZA 4ICUA 4I6NB 5FR6A 2IO0B 1A5RA 2HD5B 2GBMA 4GOCA 3QHTA 2D2QA 2LVOA 2WDTB 4DDID 2ZVOA 2KJHB 3M63B 2GBNA 4OVUA 1U4AA 2JPHA 3KUZA 3HM3A 2DZIA 3W1SC 2KMCA 2KX3A 5G55A 2BKRB 4FN2A 5LLIA 1NDDA 1WXMA 4IM2A 3W1SA 2M17A 3W1YA 4AJYB 3Q3FA 4G3XB 2KDIA 1WGYA 1H4RA 3A4RA 3ML8A 4DHZE 2GBJA 2KKCA 2MBBB 4P7IA 3UQBA 4KDLB 4EEWA 3ZNHB 1WJUA 4MSMB 4CHKA 2KHWB 3N32A 2LASA 2I1KA 2L7RA 2BPSA 4EOYA 3L10B 2L0TA 3QQ8B 1ISNA 2NVUI 1XT9B 2V4LA 2XBBC 5DPRA 3QAQA 3OJ3A 2BYFA 2JZZA 3PREA 1WFYA 2IY1B 4IWQA 3ZNGC 4GDLA 1P3QU 1MG8A 2KDEB 4PS3A 2ZCCA 3TJPA 3IG3A 2EMTA 3L08A 1WF9A 2FCQA 1IPGA 2J0KA 2K8BA 2ZPYA 3M62B 3PHXB 2OOBB 2R2OA 2CKHB 3HIZA 2Z0DB 2FCSA 5E6NA 2K8HA 3IHPC 1P98A 3RZFA 2C7HA 3JSVA 1V9JA 2D07B 2RR9A 4F1SA 3VTVA 2NPTB 2IZVB 4NY0A
chains in the Genus database with same CATH superfamily
1K51A 2WX1A 2LUEA 4W9IA 4C7YA 2M8SA 1OFFA 5AZFA 2IPKD 2KDFB 1IP9A 2W9NA 4W9CA 2LRUA 1PGXA 2V3NA 4AJWA 4K7SA 4LK0M 4HVBA 4HPPA 4EFOA 1H8CA 1ZDVA 3ZJUA 1SSNA 3A9KA 3T3NA 2K25A 2O6VA 4WJQA 1D4BA 4EZKA 3WAMA 5AZHA 4C56C 1MG4A 2KNBA 5JZEB 1V97A 1TY0A 2LD9A 3DHIC 4HPLB 1FXAA 1ZW7A 3HUIA 2QDFA 1E8YA 1I4PA 4HLEA 3QWZB 1EF5A 3VUWA 1L0YB 2LGXA 1J0GA 3RD2A 3HK0A 1FM0D 2Y5BB 4AP4C 4MEMA 1I42A 2D3CA 3Q3NC 3OG5A 3V05A 3N30A 5EE1A 1QT9A 2GBKA 1SIJA 3IFWB 4P6VF 3RULA 3HM6X 3EECA 4W9KA 1QZEA 2KVZA 2RGFA 1JALA 2N7DA 2K8CA 1XCTL 3AMZA 2Z0EB 1F77A 3ENEA 2B3AA 5BO4B 2MCNB 1TY2A 1PUTA 1J7AA 2FCMA 1L4DB 2GRIA 1JMLA 4BBNF 2RPVA 2CHXA 2WXKA 4A90A 3H7SA 1N61A 3JYUA 1WZ3A 4JWUC 2D11A 1WGKA 2C9WB 2MJEA 3CMMB 4RH6A 3A9JB 4EKUA 3RNBC 2BTEA 4US9A 3PZ8A 2X38A 5E6PA 1WMHA 3RN9C 4TQ1A 2DYOA 4MGYE 3VFKA 2ACZB 1TKGA 1VCBA 1FCLA 3PRMB 2IDYA 1R4MI 3KH0A 3KW5B 1TBEA 2JXXA 2JT4B 2R2QA 4W9EA 2WXMA 4IM3A 4EZJA 3RNCC 1C9FA 2AL3A 1NVID 1V49A 1RRBA 3ZO5B 2IO3B 2LWPA 2JRHA 2WYQA 3KQ4A 3VR9B 5DPSA 2KVRA 3V60A 3SFDB 1YN3A 1TS3A 4KGTA 5AUKA 4LNNA 2KC1A 4A3PA 4FJZA 1SJED 4HWIB 1R4NI 1WYWB 5C1ZA 5J18A 3AN1A 1NBFC 1YMHE 3ZDTA 2WXIA 3U4EG 2NBUA 2LJ5A 4MDKE 4DXFA 4OZCA 5BYSA 3AEBB 1SJHD 2IO2B 3T3OA 5IKCM 3P4PB 3AU4A 2KWUB 1ZUD2 3SFEB 1UELA 1FMAD 1D5XC 3DVGX 2KFJA 3AXCA 3QA8A 1I4XA 4C00A 3KVFB 1CMXB 4GN1A 2G3QB 4BVUC 1EF1A 2AWTA 3AEAB 4KGSA 1TKEA 1L4ZB 3MJ5A 1V5TA 2IO1B 1WM3A 5JH5C 2CS4A 3NVZA 3AE3B 1EWCA 4FA6A 1K53A 2V1YA 4DQOC 2L05A 2RD0A 1GOZA 4W9JA 2XN9C 2KT7A 1TYGB 1WR1A 1IGDA 5J17A 2WX0A 3TEXA 2JVCA 4FXCA 5TR5A 2A5UA 3Q8EA 3NOBA 3PV1A 2LXAA 2MA9B 1WJNA 3D32A 2V3SA 1EU4A 3EFUA 3VHTC 3AI5A 1F2RI 1VD2A 3KUDB 2ICIA 3N1ZC 1JRUA 3U52E 3L0WB 2C5LC 4ZRPA 3DOWA 2CHZA 3CIRB 4KKIA 4PS7A 1L0VB 2BS3B 3WAPA 1WGRA 2KC2A 2RMMA 1ZKHA 1DGJA 5JHAA 1HTQA 3NG0A 4W9GA 4ZDVA 2MLBA 1ZXIA 2KN4A 2OHFA 2XK5B 2K6QA 3APDA 4PS8A 5G2NA 4RCOA 1DOIA 3UINB 3A9KB 3S2AA 1L2NA 4XC2A 1KFYB 2K6DB 4ANUA 2KANA 1I4HA 3IVFA 3RNFC 3DHHC 4FHJA 2HJ8A 5FR3A 3N3KB 4HJGE 2G1EA 2NS5A 4HJKA 2C7MB 3Q69A 4ANWA 4BOSC 1GC7A 1BUIC 2PIAA 2ZZPB 1E5WA 2L76A 3AE2B 1SE3A 2LVPA 1WYGA 2JYEA 1Z5SB 3DQVA 5IN7A 4WWPA 2ONQA 1B9RA 1NYRA 2N1VA 1ZP0B 3DVGY 1TZOA 1E0ZA 5D2MB 1WGGA 2IYDB 3V6EB 1J8CA 2UWQA 3GB1A 3AB5A 4HDOA 1KM7A 3N9YC 1R7SA 3DBRI 4RM9A 4OW0A 3MC9A 1QOAA 3TMPB 1FFUA 4FULA 4WWMA 1V1PB 3AE7B 2DLBA 4RGMA 3RI7C 3ZLZA 1C78A 1E7PB 3I9V1 2IO0B 2HD5B 3AEEB 4GOCA 3QHTA 2Y5CA 1HQRD 3M63B 4OVUA 3KUZA 1PFDA 4M00A 2KMCA 2BKRB 3AM9A 1WXMA 3ZXVA 1YQ4B 3W1SA 1MI0A 1UWXA 3AE9B 3Q3FA 2SEBD 1FFVA 4AQ7A 2KKCA 4P7IA 3UQBA 4KDLB 1WJUA 4MSMB 3Q3OC 4WAFA 5BMHA 3ZYYX 3DBHB 4O1NA 4LNOA 3Q8BA 3PREA 3WCQA 4GDLA 1P3QU 1D6EC 3ZGZA 2TSSA 3IG3A 3AE8B 3L08A 1WF9A 2K8BA 2ZPYA 2CKHB 3IHPC 4JPSA 4F1SA 1F2RC 5JXVA 2N1WA 1OGWA 3LJ3A 2KMMA 2JU6X 1FXIA 3PS6A 4P1CC 1L0XB 3I57A 3PGEA 2NBVB 2J53A 4M8NA 3TUOA 3AE4B 1QILA 3PVLA 3NS1A 1C3TA 2AQ2B 3ZXRA 2KDBA 3AEGB 2BYTA 1N5XA 3Q3JA 1Q5WB 1GNUA 3JW0X 2H89B 4GMVA 4Q2JA 1N62A 3MFGA 4US8A 3GZNI 4D2KA 1EWYC 4YT0B 2BB5A 3LXFA 3UI3A 1VJKA 2WXOA 2JX5A 3P63A 1XXGA 3R7QA 4C4VA 2G9HD 4YWGG 3MP9A 3N20C 5L83A 3VUYA 1HZ6A 1XF5L 3OJ4B 2DHZA 1YN5A 1MHXA 3J9CA 4NQLB 5GMVA 4GSWA 2XEWA 5EDSA 2BYVE 2M0AA 4KZCA 2WP9B 1I4QA 4K81A 3I5JC 2C60A 3E9SA 1N63A 2B76B 2I2YA 3AE1B 4PT5A 4FJVB 2DAFA 3KYDD 3H6NA 1VZ8A 1B1ZA 4RNAA 3ZW3A 3NZUA 3NVWA 3Q2AC 2KWCA 4QAYA 4HDQA 1ZOYB 2VH2A 1C79A 4LJPB 1TIFA 3W5UB 4IWOA 3CSTA 2KJRA 1AWDA 3JSVB 1FD6A 1EUVB 2MQJA 4A8XC 5D6JB 4A6QA 1TGZB 1XLOA 1F1HA 3PTFC 2INNE 1AN8A 2IGDA 4NNJB 2YEPF 1PQSA 3DPDA 2IBIB 2ZNVC 4YL8A 5CX3A 2BQQA 1T5XD 1V5OA 3WANA 4OVVA 3UQAA 1J19A 2ZPNA 4DXGA 4J6IA 3KLSX 4HKZE 1YX5B 4YSZB 4WJPA 2LI5A 4K3BA 2ZW1A 1WGDA 4GDLB 1OTRB 4ASWC 4P16A 1UBQA 2KACA 3SHQA 2J0JA 1YD8U 1AYFA 1R4MB 2BT6A 4TV3A 2ZCBA 1NENB 1GB1A 4JIOU 1ET9A 4RGTA 4A20A 1WM2A 4KV2A 1K50A 1YIWA 2FIDA 4FJYA 4ITKA 1SE9A 3U7ZA 2L8JA 4ANXA 4KIKB 2V4IB 3VTUA 5IA7A 2INPE 2YEPB 2REXA 5BMIA 3R7RA 4HPMB 4XWWA 1UGJA 4YSYB 3PRPB 5GXGB 4B6WA 3NUHB 3B2GA 1KF6B 2KN5A 2K39A 5DPTA 4AUQC 2L32A 3VRBB 4M8MA 2M1MA 3B08A 5AZGA 3VQIA 1FRRA 2N7JA 1V2YA 3O13A 4UDUC 2RSUA 4B0EA 4OHJA 1TT5B 1TZ1A 4WWOA 3KWVA 2KQSA 3PO0A 1V81A 2JZ3B 2WHIA 2GI9A 3VVWB 1V8CA 2MEKA 4MJSB 1YJIA 2WQYB 4GU2A 1LO5D 3IAS1 5G5GA 3HHMA 5DPWA 1WXVA 3RZWC 3T8MA 5C2TB 2J7QB 3GOEA 5H92C 3TCAA 2HE7A 2LEKA 4IOIE 4RF0A 1WJ4A 3SU8X 4JGHB 3RUIB 1FXTB 1GJZA 4LLGM 2AQ1B 2M0XA 2KLCA 4YXDB 3BVMA 1E90A 3HVDA 2WXGA 1Y8RC 3H9DA 1CZPA 2LGYA 1WH3A 1KRHA 2ZVNA 4KSKC 3V3XA 4ZYSA 2GOWA 2KK8A 3Q3MC 4HCPB 2NBWB 3L13A 5IO9A 1M4VA 1OQYA 1KTKA 3IBEA 1VZ7A 1F0ZA 2MX2A 3PPAA 3DBHI 1SF0A 4G0NB 2PTLA 1R4NB 3ONSA 4TKNA 2D10A 2DYBA 2NMQA 3PLUA 4RGNA 2KQ7A 3A4SC 3ZUNA 4WJOA 2ZNVB 2K5PA 2MBHA 4I6LB 5D7GA 2N9KA 4B0MA 1E6EB 3A1QB 2HJ1A 1NI2A 1YQ3B 2AX5A 2GB1A 3DDCB 2ZJDA 1ZDXA 1NEKB 1SE2A 2UYZB 2V0GA 5AEKB 2BWFA 2LHDA 3QC8B 5E6OA 1P0RA 2E6XA 2OJRA 2MP2B 3Q8CA 1N5WA 2LFIA 2EELA 4E71A 2IGHA 4JWSC 3HRDD 3NJTA 3VUXA 2K0PA 2BYEA 2JUOA 2JSVX 1IBXB 4ZYNA 4IDIA 2QMTA 3BK2A 4FLHA 2CHWA 3NZ3A 2WNMA 5FR6A 1QKZA 2LVOA 2WDTB 1C4PA 2KJHB 2GBNA 2DZIA 4IKGA 5IOIA 3W1SC 2WU2B 1WSPA 3BVGA 4IM2A 1HA5A 1V1OA 1P7EA 4G3XB 2KDIA 1WGYA 1TKYA 3A4RA 3N1YC 1NI3A 3ZNHB 1C4AA 4CHKA 3N32A 2LASA 2WDVB 4EOYA 2BPSA 3L10B 3QQ8B 1ISNA 2XBBC 1HZ5A 2BYFA 2KDEB 2ZCCA 2J0KA 3PHXB 2N9LA 2Z0DB 2FCSA 3EA6A 5E6NA 2K8HA 1P98A 1T3QA 2D07B 2RR9A 1F52A 2WDRB 1VDVA 4FHKA 3RNGC 2DZMA 4ZRJA 3B9JA 1MVKA 4BBNC 4DXAB 4RMAA 2PEAA 5EE9A 3SDLC 3H7PA 1JWBD 4ZRKA 2PLPA 3DBSA 4LCDE 4M02A 2VZKB 4BOZB 1RFKA 4WWNA 5MPOA 1OQQA 2LGDA 3AE5B 3B1LX 2MW5A 1HTOA 1QLBB 1KOTA 2KMAA 2JWUA 4IM0A 4WQMA 3P2BA 3U30A 3I3TB 1JWAD 2BGFA 4N58A 1Y56A 4F7ZA 4RF1A 2DZJA 2CU3A 4PYZA 1YQBA 3LB8C 4W9FA 2BKFA 1QOBA 3AH7A 4ICVA 1N6ZA 4ZRIA 2L52A 5CTRC 2LGIA 1TS5A 4K1RB 1T0SC 3AULA 5D3DA 4KZ0A 1D5MC 3QCAA 2L3ZA 4DWFA 4TSSA 1S3SG 5L95C 5E6JA 4ARCA 3DCGA 1KLVA 4L2YA 3GS2A 3I63C 1E9MA 2HTME 3ZTDA 2MSED 1Q1OA 3AU5A 1KLGD 2MBOA 3WALA 2W3RA 3P4RB 1E8XA 2KFKA 2VRRB 3PZ7A 2BW2A 2WXNA 5EE3A 2J0MA 1FRDA 4MGIE 1ZPSA 2QSDA 2NCNA 4IW0A 2KWDA 3NZSA 1SXTA 1EU3A 2MWSB 2QCZA 1ACCA 2JF5A 3L54A 4I6PA 3SD5A 1RWSA 1SB3C 2KOXA 1WX8A 1XD3B 3AEDB 3ZIMA 3TL5A 2EKEC 1T0YA 5AUIA 2K1FA 1L7YA 2EMSA 2NR2A 2L00B 1DOYA 3N1XC 1UD7A 2I1JA 5CHWA 4II2B 4WIPA 4KX6B 2J42A 1RFAA 4M01A 1XO3A 1E7VA 4LJOB 3C0RB 1UF0A 3K9PB 2KTRA 2GMIC 4HCNB 5HFYA 3GE8C 1QF6A 4X57B 4IC7B 4NZLB 2R61A 4HROA 4NQKE 2WXLA 3ZJTA 1MHHE 3LYYA 4BFRA 3A1QA 2BWES 2QJLA 4WJNA 4HK2A 1YJJA 1JWMD 4XDDA 2V3PA 4MSQB 1WR6E 3APFA 4CQNA 4JQWC 2E3TA 2WDQB 4NJCA 1HE8A 2PW9A 4IWPA 2UU7A 3W2DA 3OAWA 5C23A 1K52A 3MHSD 2BVCA 4L23A 2G4DB 1DYQA 1RM6C 1D3ZA 3L16A 3T9LA 1ROEA 3MTNB 2IJ0A 5IP4D 5FK9C 2DWQA 3RFZB 4RM8A 1DOXA 2JXTA 3UF8A 2IY0B 4GXBA 4HXDA 3PRZA 4NJ6A 4DHJD 3C8YA 2BS4B 2JWZA 4CYEA 4XWTA 4RFBA 1FNUA 3DBLI 2G45B 4XGAB 2GLSA 3NRZA 2M19A 2XNAC 4JL9A 1PDXA 4MM3B 1SEBD 1YOVB 2V9HA 2K3UA 3O65B 1WE7A 1FCCC 3W5VB 3RPFC 1K8RB 5DCNA 4MJSA 3L4PA 4CO7A 4GLSC 2D3BA 4E3CA 1UWMA 1TJEA 4XYCA 1E8ZA 4GDKA 4BKGA 2FE8A 3URYA 4N9F4 5H8YE 2H88B 1C1YB 2KLGA 2LJIA 3ZKJC 3X23A 4YTMB 4EE2A 1WX7A 3EHVA 4W9HA 4AWJA 2Y5PA 3VXWA 5KHOA 1WY8A 4USAA 1WXSA 1XLNA 4MM3A 5HKHA 3RMKC 4B9KA 2LHEA 1EO6A 1RLFA 3Q6BA 4WH4A 4DHZB 4N6EB 4KIKA 2CU1A 4C4VB 3ZQ4A 3CSFA 3U7DA 1I4GA 3TBLD 1AARA 3MHZA 2FNJB 3BZDB 1C76A 4ZOHC 3JVZX 3ECIA 4TQ0A 1I35A 1PGBA 3BINA 3Q14C 4NJ7A 4J3OD 2G4SA 2MJ3A 4B95A 2QEJC 2WXQA 2ASQA 3QX1A 1T0QC 2BS2B 4W9LA 3ML9A 2D3GA 2K9XA 3RNEC 2FUHB 4GIVA 1WWTA 1V80A 2KFKB 2J52A 2Q5WD 1XCQL 4P1BC 1KLUD 1ET6A 2YLMA 1WGHA 1I4RA 2AEHA 1CQVA 4KDIC 4IUMB 4YTPB 2RPQA 5KHQA 2PKOA 1QQRA 1SBBB 4G50A 4OVZA 4MH0E 1JQ4A 1LXDA 3GE3C 1E8WA 2HDEA 1T6BX 3PT2B 4W9DA 3A9JA 3H1UA 2KTRB 2WLBA 2Z8LA 2PE9A 3DBRB 3FILB 3KWLA 4MGZE 4TUUA 1WX9A 1I7HA 2W54A 4AOFA 4R3DA 3MC8A 1SE4A 3TEZA 2LMCA 2LGSA 3WIMA 4C80A 2WGSA 1QOFA 3QIJA 2ZEQA 3ZDMC 2I38A 2DENB 4ICUA 1FNVA 4KKJA 3FILA 2GBMA 1XLQA 2D2QA 2OEDA 4DDID 2VZKD 4BZAA 2FBWB 4S17A 1N60A 1FO4A 1U4AA 2NTSA 3HM3A 2KX3A 5G55A 5I4DA 2MJDA 3ZJVA 4FN2A 1L6VA 1UUPA 4MACA 2M17A 4AJYB 3DBLB 1IGCA 4ZRQA 3ML8A 2GBJA 3AECB 1JWSD 2CJNA 2WS3B 3SR6A 2I1KA 2L7RA 1MFWA 4BAXA 1FNWA 5DPRA 2X8XX 5G5HA 1WFYA 3FC4A 3VRAB 4LNFA 3TJPA 2EMTA 1C77A 2FCQA 1IPGA 1CK1A 2FUG1 2OOBB 2R2OA 3HIZA 1EM7A 2C7HA 3JSVA 5C3JB 1V9JA 4MT5A 3VTVA 2NPTB 2IZVB 2JZPA 5HI1A 5IAAC 3GZNB 4A3OA 1S1QB 5J2RA 3ZNID 3V61A 2N4FA 4JX1C 3QK0A 1LFDA 4EZLA 4F8CB 4N59A 3DWMA 2D3AA 3P4QB 1ZE3D 1WIAA 4ANVA 1ZGUB 4G11A 2D5GA 2N9XA 2N7EA 1AW7A 5JHBA 4GGQA 2QHOA 2O2VB 4ZHPA 3DVNU 4PK1A 2LZ6A 1J7BA 2YVCA 2OJWA 2M56B 3IAM1 3OWEB 3PZDA 1KH0A 3ZNZB 4HKQA 3AEFB 4NPNA 2BF8B 2L1AA 1LQBA 4K7WA 1D5ZC 2K22A 3BVZA 3UIPB 3VH3B 2MRPA 1NYQA 3VH4B 3UIOB 3QJZA 1JW9D 4KGRA 2KD0A 3P1MA 1UBIA 5BYRA 1HXYD 1GG3A 3BYYB 3AE6B 2KDMA 2MBQA 2CR5A 2MP2A 3AV8A 2PVOD 1SGHA 1QOGA 3K9OB 4DHJB 4BKSA 4E74A 2GBRA 2AYOB 4MH8A 1XQQA 3WA0A 3WAOA 2LVQA 1LM8B 3B2FA 2INDC 2FIFA 2ZW0A 2M4NA 4DK5A 3V62A 1Q0WB 2AQ3B 4XX5A 3H7PB 4WAAA 3R8BA 3ALBA 2N0SB 3ABVB 2PJHA 4LTUA 3MC0B 4M0WB 3V6CB 1C4CA 5HHDG 1ENFA 1JROA 3IT4B 3APCA 3U2SC 2LRWA 3ZTCA 3ZRFA 4EUTA 3ETRA 2VH1A 4FBJB 5HG2A 1V1PA 2KAJA 4KSLC 1M94A 3EGRA 4YSXB 2RDBC 3BK1A 1FIQA 1WRIA 2RDHA 4II3B 3M3JA 1GB4A 1P9DU 4URKA 4DDGD 2MHJA 3GP7A 4RGOS 1IYFA 1IUEA 4WQOB 2KQ4X 2WXRA 1WI0A 5D94A 4LNKA 5LXIB 2KX0A 1UH6A 4XZ4A 1WXAA 1TS2A 1CJEA 1ZXHA 3X0WA 1IBXA 4TMAB 1L5PA 5LXHA 2EKIA 2KTFA 3NS8A 4LDTD 3L17A 1VR9A 5LNK1 4GDKB 1OQRA 3IXSA 4K7UA 4A9AA 3U8ZA 1L6UA 3KYCD 1A70A 3BY4B 2KZRA 3RT3B 3R66C 1Z2MA 1RAXA 2DBYA 5TSSA 4HRSA 4DBGA 3R3MA 2FAZA 3OLMD 2JQRB 2N9PC 1YNTE 3LDZE 4JE3B 1WJ6A 3M95A 4GB9A 3NVVA 4LDTB 1LGRA 3B0AA 3UGBB 2KYWA 1BT0A 2WXPA 5FKAC 2C7NB 3ZRCA 4XDCA 2PE6B 1MJDA 4ZHOA 1UNSA 5BYQA 4M0WA 2PPHA 2MH7A 1WRDB 1WMHB 3NY5A 3SEBA 2HTHA 1TTNA 1WE6A 1XLPA 1OEYA 4MELA 1UGMA 1G6JA 2NTTA 2WU5B 2JRIB 1PGAA 1E7UA 3VR8B 2KO3A 5BMGA 4MGKE 1GC6A 2QC8A 2L0FA 2A4ZA 2DYMA 1YJ1A 4IG7B 2DZKA 1STEA 2LXCA 2BB6A 1YN4A 3Q8FA 3R2IA 1SIFA 2CJOA 2J4XA 3PSEB 1GAQB 2O6VB 2KXJA 1VZ6A 3Q8AA 4OZAA 4OZBA 3EC8A 1V6EA 3MJWA 3FAHA 1UZXB 4PYUA 4JLCA 5EE0A 2WXFA 3TEYA 1MPEA 2KJ6A 5CHVC 1YX6B 1V86A 3DVNV 2Z59B 3TEWA 2Y3AA 3NHEB 2O2VA 2L83A 2SAKA 4NAWA 4HEA1 1FPYA 3A33B 1KJTA 2JY6A 2N9EB 4H2AA 1RYJA 3CF6E 4KVGB 2QIEB 2O6VD 2XK5A 3TIXA 1BXTA 2AL6A 2PVGC 3PHWB 1PYWD 3RCZA 3FKYA 2W55A 3C19A 3VAWA 2JYTA 2WXHA 5D3IB 1WZ0A 2QILA 1T0RC 1F9JA 4YTNB 3RYTA 2DX5B 2WWZA 3KUCB 3IT6B 2W82A 3R2TA 4ACFA 1X1MA 3ZVVA 1JRPA 1P1AA 4NAWB 2RDGA 4S0RA 3H8HA 2DNFA 4BKSD 1TS4A 2IGGA 5CHFA 5T8IA 2NPTA 4AS1A 1P7FA 1BMLC 1OEYJ 2DAJA 2W3SA 3BYTB 3VDZA 4BKTA 1GUAB 3PLVA 3HVZA 4XE0A 3VTWA 3DHGC 2KWVB 3QARA 1ESFA 2MBEA 2LUMA 4FADA 1J7CA 4LNIA 2FCNA 4A55A 4I6NB 1HEZE 1A5RA 3E56A 3DWGC 2ZVOA 1FEHA 1JWUD 3BWUD 2JPHA 1WXQA 4L1BA 3P4SB 3TSSA 4K3CA 1VRAB 1XEEA 5LLIA 1NDDA 3EUB2 1E10A 1GPXA 3W1YA 1VLBA 1H4RA 4DHZE 3NVYA 2MBBB 4EEWA 2BBCA 2KHWB 2WXJA 2L0TA 3EFCA 3RNAC 2NVUI 1XT9B 2V4LA 3BIID 3QAQA 3OJ3A 4NAMA 2JZZA 4IWQA 4ARIA 2IY1B 3ZNGC 2INCC 1MG8A 3CWIA 4PS3A 1Q10A 3M62B 4WURA 2ON8A 3P42A 1JCKB 4C7ZA 4REZA 3RZFA 2PMVA 3W9CB 4NY0A
chains in the Genus database with same CATH topology
2N1WA 4FHKA 5IAAC 4A3OA 1OGWA 1S1QB 2DZMA 2WX1A 2LUEA 3LJ3A 5J2RA 4W9IA 4ZRJA 2M8SA 4BBNC 4DXAB 3ZNID 3V61A 4RMAA 3PS6A 5AZFA 2N4FA 2PEAA 3QK0A 1LFDA 3SDLC 3H7PA 4EZLA 4F8CB 4ZRKA 3PGEA 2KDFB 2NBVB 1IP9A 3DBSA 4LCDE 4M8NA 4BOZB 4WWNA 2W9NA 1WIAA 4ANVA 3PVLA 1ZGUB 4G11A 4W9CA 2LRUA 2LGDA 3B1LX 4AJWA 2N9XA 2N7EA 4K7SA 2MW5A 1C3TA 4HVBA 5JHBA 4GGQA 1KOTA 2KMAA 2QHOA 4EFOA 1H8CA 2O2VB 4IM0A 2KDBA 3DVNU 3A9KA 3P2BA 2LZ6A 2YVCA 3U30A 2K25A 3I3TB 2O6VA 2BGFA 3Q3JA 1Q5WB 1GNUA 3JW0X 4GMVA 4F7ZA 3PZDA 2DZJA 4WJQA 4PYZA 3ZNZB 3GZNI 1YQBA 4W9FA 4EZKA 4NPNA 3WAMA 2BF8B 2BKFA 5AZHA 1LQBA 4ICVA 4K7WA 2KNBA 5JZEB 3UIPB 3VH3B 2MRPA 4ZRIA 3VH4B 5CTRC 2LD9A 3R7QA 3UIOB 3QJZA 4K1RB 4HPLB 2KD0A 1UBIA 1ZW7A 3AULA 5L83A 1GG3A 1E8YA 4KZ0A 4HLEA 3QCAA 3VUYA 2L3ZA 1EF5A 3QWZB 3VUWA 3OJ4B 4DWFA 2MBQA 1S3SG 2LGXA 2DHZA 3RD2A 5L95C 3HK0A 2CR5A 1J0GA 2Y5BB 4AP4C 2MP2A 4NQLB 4MEMA 1I42A 5GMVA 1SGHA 3DCGA 4GSWA 2XEWA 3K9OB 4DHJB 4BKSA 3N30A 5EDSA 1KLVA 2BYVE 4E74A 4KZCA 2GBRA 4K81A 2GBKA 3IFWB 2AYOB 1XQQA 3WA0A 3WAOA 2LVQA 1LM8B 2C60A 3RULA 3ZTDA 2MSED 2FIFA 1Q1OA 3AU5A 3EECA 3HM6X 4W9KA 2M4NA 4FJVB 4DK5A 3V62A 1QZEA 2DAFA 2MBOA 3WALA 3KYDD 3H6NA 1Q0WB 2RGFA 4XX5A 3H7PB 2N7DA 1E8XA 4WAAA 3ZW3A 2KFKA 2VRRB 3ALBA 3NZUA 2K8CA 2PJHA 2J0MA 2KWCA 4MGIE 4M0WB 4HDQA 3V6CB 2Z0EB 4LJPB 2NCNA 3ENEA 2B3AA 4IW0A 5BO4B 4IWOA 2MCNB 3NZSA 3CSTA 2KJRA 3JSVB 3APCA 2LRWA 1EUVB 2MWSB 3ZTCA 3ZRFA 2MQJA 2FCMA 2JF5A 3L54A 4I6PA 3SD5A 4EUTA 5D6JB 2KOXA 1WX8A 1XD3B 4FBJB 4BBNF 1TGZB 2CHXA 3H7SA 3ZIMA 3TL5A 2EKEC 3JYUA 1T0YA 4KSLC 1WZ3A 2D11A 3PTFC 2K1FA 1M94A 4NNJB 2C9WB 3CMMB 1PQSA 1L7YA 2EMSA 2NR2A 3A9JB 4EKUA 2L00B 3DPDA 1UD7A 2I1JA 5CHWA 5E6PA 2IBIB 1WMHA 4II3B 3M3JA 1P9DU 2ZNVC 4II2B 4TQ1A 2DYOA 4DDGD 4URKA 4MGYE 4YL8A 5CX3A 1RFAA 3VFKA 1IYFA 1E7VA 4LJOB 1V5OA 4WQOB 3C0RB 1VCBA 1WI0A 3WANA 3PRMB 1R4MI 5D94A 3K9PB 2KTRA 2GMIC 4HCNB 4OVVA 3KH0A 3UQAA 5LXIB 2KX0A 1J19A 2ZPNA 1UH6A 3KW5B 4XZ4A 1WXAA 4J6IA 4X57B 4IC7B 1TBEA 2JXXA 2JT4B 2R2QA 4W9EA 4NQKE 4IM3A 3X0WA 5LXHA 4EZJA 1YX5B 2AL3A 4WJPA 4BFRA 1V49A 1RRBA 3ZO5B 2LWPA 2IO3B 2BWES 2JRHA 2KTFA 2LI5A 2WYQA 3A1QA 3NS8A 4WJNA 1WGDA 4GDLB 4LDTD 4HK2A 3L17A 5DPSA 1OTRB 2KVRA 4ASWC 4GDKB 3V60A 4MSQB 1WR6E 3APFA 1UBQA 4K7UA 4JQWC 3U8ZA 3SHQA 3KYCD 2J0JA 1YD8U 2KC1A 4A3PA 3BY4B 4FJZA 1HE8A 4HWIB 1R4NI 1WYWB 2KZRA 4IWPA 3RT3B 3R66C 5C1ZA 5J18A 1Z2MA 1NBFC 4TV3A 1RAXA 3OAWA 2ZCBA 5C23A 3MHSD 3ZDTA 2NBUA 2LJ5A 2G4DB 4MDKE 4DBGA 4JIOU 3R3MA 4A20A 1D3ZA 2FAZA 3L16A 3OLMD 3T9LA 3MTNB 2N9PC 1WM2A 4KV2A 3LDZE 4RM8A 1YIWA 2FIDA 2IO2B 4FJYA 1WJ6A 1SE9A 3UF8A 3M95A 2IY0B 2L8JA 4GB9A 4KIKB 3VTUA 4ANXA 3AU4A 5IA7A 4GXBA 4LDTB 4HXDA 2KWUB 3B0AA 3PRZA 2REXA 3UGBB 4NJ6A 4DHJD 1UELA 3R7RA 4HPMB 3PRPB 2JWZA 3DVGX 1BT0A 4CYEA 4B6WA 2KFJA 3AXCA 3QA8A 2C7NB 3KVFB 2KN5A 2K39A 5DPTA 3ZRCA 4AUQC 1CMXB 4GN1A 2G3QB 4BVUC 3DBLI 1EF1A 2AWTA 2G45B 2PE6B 4M8MA 4JL9A 1V5TA 2IO1B 1WM3A 2M1MA 3B08A 5AZGA 3VQIA 2CS4A 5JH5C 1V2YA 2PPHA 3O65B 1WRDB 1WE7A 1WMHB 3NY5A 2RSUA 2HTHA 4FA6A 1K8RB 1TTNA 2V1YA 5DCNA 4MJSA 1TZ1A 4CO7A 2L05A 2RD0A 4WWOA 1WE6A 4W9JA 1OEYA 4MELA 2KQSA 1UGMA 1G6JA 4E3CA 1WR1A 1V81A 2JRIB 2JZ3B 3VVWB 1E7UA 1E8ZA 4GDKA 2KO3A 5J17A 4MJSB 2WX0A 4BKGA 4MGKE 4N9F4 1GC6A 2JVCA 5TR5A 2L0FA 4GU2A 2A4ZA 2DYMA 2A5UA 1YJ1A 4IG7B 3NOBA 2DZKA 3HHMA 3PV1A 1C1YB 2KLGA 2LXAA 2MA9B 1WXVA 2LXCA 3RZWC 3T8MA 1WJNA 3X23A 3ZKJC 5DPWA 1WX7A 2J7QB 3EHVA 3GOEA 4W9HA 3D32A 2V3SA 3TCAA 4AWJA 2HE7A 3EFUA 1SIFA 3VHTC 3VXWA 1WJ4A 3SU8X 3PSEB 3AI5A 4JGHB 5KHOA 1WY8A 1VD2A 3RUIB 1FXTB 2O6VB 3KUDB 1GJZA 1WXSA 2KXJA 4MM3A 5HKHA 2M0XA 3EC8A 4B9KA 1JRUA 2KLCA 1EO6A 1RLFA 1V6EA 3L0WB 2C5LC 3MJWA 3DOWA 4KIKA 4DHZB 2CU1A 2CHZA 1E90A 3CSFA 1UZXB 4PS7A 3U7DA 3WAPA 1WGRA 1Y8RC 3TBLD 2KC2A 3H9DA 4PYUA 1ZKHA 4JLCA 2LGYA 1WH3A 1AARA 2KJ6A 5CHVC 1YX6B 1V86A 5JHAA 2ZVNA 4KSKC 3DVNV 2FNJB 2Z59B 4W9GA 2GOWA 2KK8A 3NHEB 2O2VA 2MLBA 4ZDVA 4NAWA 3JVZX 4HCPB 3ECIA 2NBWB 2XK5B 3L13A 4TQ0A 2K6QA 3APDA 1I35A 1OQYA 3IBEA 4PS8A 3BINA 4NJ7A 3A33B 5G2NA 2G4SA 1KJTA 2JY6A 2N9EB 4B95A 2MX2A 2ASQA 3PPAA 3QX1A 3CF6E 3DBHI 4KVGB 4W9LA 3UINB 3ML9A 2D3GA 3A9KB 3S2AA 2O6VD 2XK5A 3TIXA 1L2NA 2FUHB 4G0NB 4GIVA 1V80A 2KFKB 4XC2A 3ONSA 2AL6A 2K6DB 4TKNA 2KANA 3PHWB 3RCZA 4ANUA 2D10A 2DYBA 1WGHA 2YLMA 3VAWA 3PLUA 3IVFA 2KQ7A 3A4SC 2AEHA 4KDIC 4FHJA 4IUMB 2HJ8A 4WJOA 1WZ0A 2RPQA 3ZUNA 2ZNVB 5KHQA 3N3KB 1F9JA 2MBHA 3RYTA 2NS5A 4I6LB 4HJKA 2C7MB 5D7GA 2DX5B 4G50A 2WWZA 4ANWA 4BOSC 1GC7A 4MH0E 3A1QB 3KUCB 1LXDA 1NI2A 2ZZPB 1E8WA 3DDCB 1E5WA 1X1MA 2L76A 2ZJDA 2LVPA 3PT2B 3ZVVA 1Z5SB 2UYZB 4W9DA 3A9JA 3DQVA 3H1UA 4WWPA 1P1AA 2KTRB 5AEKB 4NAWB 2PE9A 2N1VA 4MGZE 4TUUA 3DVGY 2BWFA 3QC8B 5E6OA 4BKSD 1P0RA 1WX9A 2OJRA 2MP2B 1WGGA 5D2MB 5CHFA 2NPTA 4AOFA 2IYDB 3V6EB 1OEYJ 2DAJA 2UWQA 3VDZA 1J8CA 4BKTA 4HDOA 1GUAB 1KM7A 3WIMA 4E71A 3PLVA 3VTWA 2KWVB 3VUXA 3DBRI 2BYEA 3QARA 2JUOA 4RM9A 3QIJA 4ZYNA 2ZEQA 2MBEA 4FADA 3TMPB 4FULA 3ZDMC 4FLHA 2CHWA 2DENB 2FCNA 3ZLZA 4ICUA 4I6NB 5FR6A 2IO0B 1A5RA 2HD5B 2GBMA 4GOCA 3QHTA 2D2QA 2LVOA 2WDTB 4DDID 2ZVOA 2KJHB 3M63B 2GBNA 4OVUA 1U4AA 2JPHA 3KUZA 3HM3A 2DZIA 3W1SC 2KMCA 2KX3A 5G55A 2BKRB 4FN2A 5LLIA 1NDDA 1WXMA 4IM2A 3W1SA 2M17A 3W1YA 4AJYB 3Q3FA 4G3XB 2KDIA 1WGYA 1H4RA 3A4RA 3ML8A 4DHZE 2GBJA 2KKCA 2MBBB 4P7IA 3UQBA 4KDLB 4EEWA 3ZNHB 1WJUA 4MSMB 4CHKA 2KHWB 3N32A 2LASA 2I1KA 2L7RA 2BPSA 4EOYA 3L10B 2L0TA 3QQ8B 1ISNA 2NVUI 1XT9B 2V4LA 2XBBC 5DPRA 3QAQA 3OJ3A 2BYFA 2JZZA 3PREA 1WFYA 2IY1B 4IWQA 3ZNGC 4GDLA 1P3QU 1MG8A 2KDEB 4PS3A 2ZCCA 3TJPA 3IG3A 2EMTA 3L08A 1WF9A 2FCQA 1IPGA 2J0KA 2K8BA 2ZPYA 3M62B 3PHXB 2OOBB 2R2OA 2CKHB 3HIZA 2Z0DB 2FCSA 5E6NA 2K8HA 3IHPC 1P98A 3RZFA 2C7HA 3JSVA 1V9JA 2D07B 2RR9A 4F1SA 3VTVA 2NPTB 2IZVB 4NY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1W A;  4FHK A;  5IAA C;  4A3O A;  1OGW A;  1S1Q B;  2DZM A;  2WX1 A;  2LUE A;  3LJ3 A;  5J2R A;  4W9I A;  4ZRJ A;  2M8S A;  4BBN C;  4DXA B;  3ZNI D;  3V61 A;  4RMA A;  3PS6 A;  5AZF A;  2N4F A;  2PEA A;  3QK0 A;  1LFD A;  3SDL C;  3H7P A;  4EZL A;  4F8C B;  4ZRK A;  3PGE A;  2KDF B;  2NBV B;  1IP9 A;  3DBS A;  4LCD E;  4M8N A;  4BOZ B;  4WWN A;  2W9N A;  1WIA A;  4ANV A;  3PVL A;  1ZGU B;  4G11 A;  4W9C A;  2LRU A;  2LGD A;  3B1L X;  4AJW A;  2N9X A;  2N7E A;  4K7S A;  2MW5 A;  1C3T A;  4HVB A;  5JHB A;  4GGQ A;  1KOT A;  2KMA A;  2QHO A;  4EFO A;  1H8C A;  2O2V B;  4IM0 A;  2KDB A;  3DVN U;  3A9K A;  3P2B A;  2LZ6 A;  2YVC A;  3U30 A;  2K25 A;  3I3T B;  2O6V A;  2BGF A;  3Q3J A;  1Q5W B;  1GNU A;  3JW0 X;  4GMV A;  4F7Z A;  3PZD A;  2DZJ A;  4WJQ A;  4PYZ A;  3ZNZ B;  3GZN I;  1YQB A;  4W9F A;  4EZK A;  4NPN A;  3WAM A;  2BF8 B;  2BKF A;  5AZH A;  1LQB A;  4ICV A;  4K7W A;  2KNB A;  5JZE B;  3UIP B;  3VH3 B;  2MRP A;  4ZRI A;  3VH4 B;  5CTR C;  2LD9 A;  3R7Q A;  3UIO B;  3QJZ A;  4K1R B;  4HPL B;  2KD0 A;  1UBI A;  1ZW7 A;  3AUL A;  5L83 A;  1GG3 A;  1E8Y A;  4KZ0 A;  4HLE A;  3QCA A;  3VUY A;  2L3Z A;  1EF5 A;  3QWZ B;  3VUW A;  3OJ4 B;  4DWF A;  2MBQ A;  1S3S G;  2LGX A;  2DHZ A;  3RD2 A;  5L95 C;  3HK0 A;  2CR5 A;  1J0G A;  2Y5B B;  4AP4 C;  2MP2 A;  4NQL B;  4MEM A;  1I42 A;  5GMV A;  1SGH A;  3DCG A;  4GSW A;  2XEW A;  3K9O B;  4DHJ B;  4BKS A;  3N30 A;  5EDS A;  1KLV A;  2BYV E;  4E74 A;  4KZC A;  2GBR A;  4K81 A;  2GBK A;  3IFW B;  2AYO B;  1XQQ A;  3WA0 A;  3WAO A;  2LVQ A;  1LM8 B;  2C60 A;  3RUL A;  3ZTD A;  2MSE D;  2FIF A;  1Q1O A;  3AU5 A;  3EEC A;  3HM6 X;  4W9K A;  2M4N A;  4FJV B;  4DK5 A;  3V62 A;  1QZE A;  2DAF A;  2MBO A;  3WAL A;  3KYD D;  3H6N A;  1Q0W B;  2RGF A;  4XX5 A;  3H7P B;  2N7D A;  1E8X A;  4WAA A;  3ZW3 A;  2KFK A;  2VRR B;  3ALB A;  3NZU A;  2K8C A;  2PJH A;  2J0M A;  2KWC A;  4MGI E;  4M0W B;  4HDQ A;  3V6C B;  2Z0E B;  4LJP B;  2NCN A;  3ENE A;  2B3A A;  4IW0 A;  5BO4 B;  4IWO A;  2MCN B;  3NZS A;  3CST A;  2KJR A;  3JSV B;  3APC A;  2LRW A;  1EUV B;  2MWS B;  3ZTC A;  3ZRF A;  2MQJ A;  2FCM A;  2JF5 A;  3L54 A;  4I6P A;  3SD5 A;  4EUT A;  5D6J B;  2KOX A;  1WX8 A;  1XD3 B;  4FBJ B;  4BBN F;  1TGZ B;  2CHX A;  3H7S A;  3ZIM A;  3TL5 A;  2EKE C;  3JYU A;  1T0Y A;  4KSL C;  1WZ3 A;  2D11 A;  3PTF C;  2K1F A;  1M94 A;  4NNJ B;  2C9W B;  3CMM B;  1PQS A;  1L7Y A;  2EMS A;  2NR2 A;  3A9J B;  4EKU A;  2L00 B;  3DPD A;  1UD7 A;  2I1J A;  5CHW A;  5E6P A;  2IBI B;  1WMH A;  4II3 B;  3M3J A;  1P9D U;  2ZNV C;  4II2 B;  4TQ1 A;  2DYO A;  4DDG D;  4URK A;  4MGY E;  4YL8 A;  5CX3 A;  1RFA A;  3VFK A;  1IYF A;  1E7V A;  4LJO B;  1V5O A;  4WQO B;  3C0R B;  1VCB A;  1WI0 A;  3WAN A;  3PRM B;  1R4M I;  5D94 A;  3K9P B;  2KTR A;  2GMI C;  4HCN B;  4OVV A;  3KH0 A;  3UQA A;  5LXI B;  2KX0 A;  1J19 A;  2ZPN A;  1UH6 A;  3KW5 B;  4XZ4 A;  1WXA A;  4J6I A;  4X57 B;  4IC7 B;  1TBE A;  2JXX A;  2JT4 B;  2R2Q A;  4W9E A;  4NQK E;  4IM3 A;  3X0W A;  5LXH A;  4EZJ A;  1YX5 B;  2AL3 A;  4WJP A;  4BFR A;  1V49 A;  1RRB A;  3ZO5 B;  2LWP A;  2IO3 B;  2BWE S;  2JRH A;  2KTF A;  2LI5 A;  2WYQ A;  3A1Q A;  3NS8 A;  4WJN A;  1WGD A;  4GDL B;  4LDT D;  4HK2 A;  3L17 A;  5DPS A;  1OTR B;  2KVR A;  4ASW C;  4GDK B;  3V60 A;  4MSQ B;  1WR6 E;  3APF A;  1UBQ A;  4K7U A;  4JQW C;  3U8Z A;  3SHQ A;  3KYC D;  2J0J A;  1YD8 U;  2KC1 A;  4A3P A;  3BY4 B;  4FJZ A;  1HE8 A;  4HWI B;  1R4N I;  1WYW B;  2KZR A;  4IWP A;  3RT3 B;  3R66 C;  5C1Z A;  5J18 A;  1Z2M A;  1NBF C;  4TV3 A;  1RAX A;  3OAW A;  2ZCB A;  5C23 A;  3MHS D;  3ZDT A;  2NBU A;  2LJ5 A;  2G4D B;  4MDK E;  4DBG A;  4JIO U;  3R3M A;  4A20 A;  1D3Z A;  2FAZ A;  3L16 A;  3OLM D;  3T9L A;  3MTN B;  2N9P C;  1WM2 A;  4KV2 A;  3LDZ E;  4RM8 A;  1YIW A;  2FID A;  2IO2 B;  4FJY A;  1WJ6 A;  1SE9 A;  3UF8 A;  3M95 A;  2IY0 B;  2L8J A;  4GB9 A;  4KIK B;  3VTU A;  4ANX A;  3AU4 A;  5IA7 A;  4GXB A;  4LDT B;  4HXD A;  2KWU B;  3B0A A;  3PRZ A;  2REX A;  3UGB B;  4NJ6 A;  4DHJ D;  1UEL A;  3R7R A;  4HPM B;  3PRP B;  2JWZ A;  3DVG X;  1BT0 A;  4CYE A;  4B6W A;  2KFJ A;  3AXC A;  3QA8 A;  2C7N B;  3KVF B;  2KN5 A;  2K39 A;  5DPT A;  3ZRC A;  4AUQ C;  1CMX B;  4GN1 A;  2G3Q B;  4BVU C;  3DBL I;  1EF1 A;  2AWT A;  2G45 B;  2PE6 B;  4M8M A;  4JL9 A;  1V5T A;  2IO1 B;  1WM3 A;  2M1M A;  3B08 A;  5AZG A;  3VQI A;  2CS4 A;  5JH5 C;  1V2Y A;  2PPH A;  3O65 B;  1WRD B;  1WE7 A;  1WMH B;  3NY5 A;  2RSU A;  2HTH A;  4FA6 A;  1K8R B;  1TTN A;  2V1Y A;  5DCN A;  4MJS A;  1TZ1 A;  4CO7 A;  2L05 A;  2RD0 A;  4WWO A;  1WE6 A;  4W9J A;  1OEY A;  4MEL A;  2KQS A;  1UGM A;  1G6J A;  4E3C A;  1WR1 A;  1V81 A;  2JRI B;  2JZ3 B;  3VVW B;  1E7U A;  1E8Z A;  4GDK A;  2KO3 A;  5J17 A;  4MJS B;  2WX0 A;  4BKG A;  4MGK E;  4N9F 4;  1GC6 A;  2JVC A;  5TR5 A;  2L0F A;  4GU2 A;  2A4Z A;  2DYM A;  2A5U A;  1YJ1 A;  4IG7 B;  3NOB A;  2DZK A;  3HHM A;  3PV1 A;  1C1Y B;  2KLG A;  2LXA A;  2MA9 B;  1WXV A;  2LXC A;  3RZW C;  3T8M A;  1WJN A;  3X23 A;  3ZKJ C;  5DPW A;  1WX7 A;  2J7Q B;  3EHV A;  3GOE A;  4W9H A;  3D32 A;  2V3S A;  3TCA A;  4AWJ A;  2HE7 A;  3EFU A;  1SIF A;  3VHT C;  3VXW A;  1WJ4 A;  3SU8 X;  3PSE B;  3AI5 A;  4JGH B;  5KHO A;  1WY8 A;  1VD2 A;  3RUI B;  1FXT B;  2O6V B;  3KUD B;  1GJZ A;  1WXS A;  2KXJ A;  4MM3 A;  5HKH A;  2M0X A;  3EC8 A;  4B9K A;  1JRU A;  2KLC A;  1EO6 A;  1RLF A;  1V6E A;  3L0W B;  2C5L C;  3MJW A;  3DOW A;  4KIK A;  4DHZ B;  2CU1 A;  2CHZ A;  1E90 A;  3CSF A;  1UZX B;  4PS7 A;  3U7D A;  3WAP A;  1WGR A;  1Y8R C;  3TBL D;  2KC2 A;  3H9D A;  4PYU A;  1ZKH A;  4JLC A;  2LGY A;  1WH3 A;  1AAR A;  2KJ6 A;  5CHV C;  1YX6 B;  1V86 A;  5JHA A;  2ZVN A;  4KSK C;  3DVN V;  2FNJ B;  2Z59 B;  4W9G A;  2GOW A;  2KK8 A;  3NHE B;  2O2V A;  2MLB A;  4ZDV A;  4NAW A;  3JVZ X;  4HCP B;  3ECI A;  2NBW B;  2XK5 B;  3L13 A;  4TQ0 A;  2K6Q A;  3APD A;  1I35 A;  1OQY A;  3IBE A;  4PS8 A;  3BIN A;  4NJ7 A;  3A33 B;  5G2N A;  2G4S A;  1KJT A;  2JY6 A;  2N9E B;  4B95 A;  2MX2 A;  2ASQ A;  3PPA A;  3QX1 A;  3CF6 E;  3DBH I;  4KVG B;  4W9L A;  3UIN B;  3ML9 A;  2D3G A;  3A9K B;  3S2A A;  2O6V D;  2XK5 A;  3TIX A;  1L2N A;  2FUH B;  4G0N B;  4GIV A;  1V80 A;  2KFK B;  4XC2 A;  3ONS A;  2AL6 A;  2K6D B;  4TKN A;  2KAN A;  3PHW B;  3RCZ A;  4ANU A;  2D10 A;  2DYB A;  1WGH A;  2YLM A;  3VAW A;  3PLU A;  3IVF A;  2KQ7 A;  3A4S C;  2AEH A;  4KDI C;  4FHJ A;  4IUM B;  2HJ8 A;  4WJO A;  1WZ0 A;  2RPQ A;  3ZUN A;  2ZNV B;  5KHQ A;  3N3K B;  1F9J A;  2MBH A;  3RYT A;  2NS5 A;  4I6L B;  4HJK A;  2C7M B;  5D7G A;  2DX5 B;  4G50 A;  2WWZ A;  4ANW A;  4BOS C;  1GC7 A;  4MH0 E;  3A1Q B;  3KUC B;  1LXD A;  1NI2 A;  2ZZP B;  1E8W A;  3DDC B;  1E5W A;  1X1M A;  2L76 A;  2ZJD A;  2LVP A;  3PT2 B;  3ZVV A;  1Z5S B;  2UYZ B;  4W9D A;  3A9J A;  3DQV A;  3H1U A;  4WWP A;  1P1A A;  2KTR B;  5AEK B;  4NAW B;  2PE9 A;  2N1V A;  4MGZ E;  4TUU A;  3DVG Y;  2BWF A;  3QC8 B;  5E6O A;  4BKS D;  1P0R A;  1WX9 A;  2OJR A;  2MP2 B;  1WGG A;  5D2M B;  5CHF A;  2NPT A;  4AOF A;  2IYD B;  3V6E B;  1OEY J;  2DAJ A;  2UWQ A;  3VDZ A;  1J8C A;  4BKT A;  4HDO A;  1GUA B;  1KM7 A;  3WIM A;  4E71 A;  3PLV A;  3VTW A;  2KWV B;  3VUX A;  3DBR I;  2BYE A;  3QAR A;  2JUO A;  4RM9 A;  3QIJ A;  4ZYN A;  2ZEQ A;  2MBE A;  4FAD A;  3TMP B;  4FUL A;  3ZDM C;  4FLH A;  2CHW A;  2DEN B;  2FCN A;  3ZLZ A;  4ICU A;  4I6N B;  5FR6 A;  2IO0 B;  1A5R A;  2HD5 B;  2GBM A;  4GOC A;  3QHT A;  2D2Q A;  2LVO A;  2WDT B;  4DDI D;  2ZVO A;  2KJH B;  3M63 B;  2GBN A;  4OVU A;  1U4A A;  2JPH A;  3KUZ A;  3HM3 A;  2DZI A;  3W1S C;  2KMC A;  2KX3 A;  5G55 A;  2BKR B;  4FN2 A;  5LLI A;  1NDD A;  1WXM A;  4IM2 A;  3W1S A;  2M17 A;  3W1Y A;  4AJY B;  3Q3F A;  4G3X B;  2KDI A;  1WGY A;  1H4R A;  3A4R A;  3ML8 A;  4DHZ E;  2GBJ A;  2KKC A;  2MBB B;  4P7I A;  3UQB A;  4KDL B;  4EEW A;  3ZNH B;  1WJU A;  4MSM B;  4CHK A;  2KHW B;  3N32 A;  2LAS A;  2I1K A;  2L7R A;  2BPS A;  4EOY A;  3L10 B;  2L0T A;  3QQ8 B;  1ISN A;  2NVU I;  1XT9 B;  2V4L A;  2XBB C;  5DPR A;  3QAQ A;  3OJ3 A;  2BYF A;  2JZZ A;  3PRE A;  1WFY A;  2IY1 B;  4IWQ A;  3ZNG C;  4GDL A;  1P3Q U;  1MG8 A;  2KDE B;  4PS3 A;  2ZCC A;  3TJP A;  3IG3 A;  2EMT A;  3L08 A;  1WF9 A;  2FCQ A;  1IPG A;  2J0K A;  2K8B A;  2ZPY A;  3M62 B;  3PHX B;  2OOB B;  2R2O A;  2CKH B;  3HIZ A;  2Z0D B;  2FCS A;  5E6N A;  2K8H A;  3IHP C;  1P98 A;  3RZF A;  2C7H A;  3JSV A;  1V9J A;  2D07 B;  2RR9 A;  4F1S A;  3VTV A;  2NPT B;  2IZV B;  4NY0 A; 
#chains in the Genus database with same CATH topology
 1K51 A;  2WX1 A;  2LUE A;  4W9I A;  4C7Y A;  2M8S A;  1OFF A;  5AZF A;  2IPK D;  2KDF B;  1IP9 A;  2W9N A;  4W9C A;  2LRU A;  1PGX A;  2V3N A;  4AJW A;  4K7S A;  4LK0 M;  4HVB A;  4HPP A;  4EFO A;  1H8C A;  1ZDV A;  3ZJU A;  1SSN A;  3A9K A;  3T3N A;  2K25 A;  2O6V A;  4WJQ A;  1D4B A;  4EZK A;  3WAM A;  5AZH A;  4C56 C;  1MG4 A;  2KNB A;  5JZE B;  1V97 A;  1TY0 A;  2LD9 A;  3DHI C;  4HPL B;  1FXA A;  1ZW7 A;  3HUI A;  2QDF A;  1E8Y A;  1I4P A;  4HLE A;  3QWZ B;  1EF5 A;  3VUW A;  1L0Y B;  2LGX A;  1J0G A;  3RD2 A;  3HK0 A;  1FM0 D;  2Y5B B;  4AP4 C;  4MEM A;  1I42 A;  2D3C A;  3Q3N C;  3OG5 A;  3V05 A;  3N30 A;  5EE1 A;  1QT9 A;  2GBK A;  1SIJ A;  3IFW B;  4P6V F;  3RUL A;  3HM6 X;  3EEC A;  4W9K A;  1QZE A;  2KVZ A;  2RGF A;  1JAL A;  2N7D A;  2K8C A;  1XCT L;  3AMZ A;  2Z0E B;  1F77 A;  3ENE A;  2B3A A;  5BO4 B;  2MCN B;  1TY2 A;  1PUT A;  1J7A A;  2FCM A;  1L4D B;  2GRI A;  1JML A;  4BBN F;  2RPV A;  2CHX A;  2WXK A;  4A90 A;  3H7S A;  1N61 A;  3JYU A;  1WZ3 A;  4JWU C;  2D11 A;  1WGK A;  2C9W B;  2MJE A;  3CMM B;  4RH6 A;  3A9J B;  4EKU A;  3RNB C;  2BTE A;  4US9 A;  3PZ8 A;  2X38 A;  5E6P A;  1WMH A;  3RN9 C;  4TQ1 A;  2DYO A;  4MGY E;  3VFK A;  2ACZ B;  1TKG A;  1VCB A;  1FCL A;  3PRM B;  2IDY A;  1R4M I;  3KH0 A;  3KW5 B;  1TBE A;  2JXX A;  2JT4 B;  2R2Q A;  4W9E A;  2WXM A;  4IM3 A;  4EZJ A;  3RNC C;  1C9F A;  2AL3 A;  1NVI D;  1V49 A;  1RRB A;  3ZO5 B;  2IO3 B;  2LWP A;  2JRH A;  2WYQ A;  3KQ4 A;  3VR9 B;  5DPS A;  2KVR A;  3V60 A;  3SFD B;  1YN3 A;  1TS3 A;  4KGT A;  5AUK A;  4LNN A;  2KC1 A;  4A3P A;  4FJZ A;  1SJE D;  4HWI B;  1R4N I;  1WYW B;  5C1Z A;  5J18 A;  3AN1 A;  1NBF C;  1YMH E;  3ZDT A;  2WXI A;  3U4E G;  2NBU A;  2LJ5 A;  4MDK E;  4DXF A;  4OZC A;  5BYS A;  3AEB B;  1SJH D;  2IO2 B;  3T3O A;  5IKC M;  3P4P B;  3AU4 A;  2KWU B;  1ZUD 2;  3SFE B;  1UEL A;  1FMA D;  1D5X C;  3DVG X;  2KFJ A;  3AXC A;  3QA8 A;  1I4X A;  4C00 A;  3KVF B;  1CMX B;  4GN1 A;  2G3Q B;  4BVU C;  1EF1 A;  2AWT A;  3AEA B;  4KGS A;  1TKE A;  1L4Z B;  3MJ5 A;  1V5T A;  2IO1 B;  1WM3 A;  5JH5 C;  2CS4 A;  3NVZ A;  3AE3 B;  1EWC A;  4FA6 A;  1K53 A;  2V1Y A;  4DQO C;  2L05 A;  2RD0 A;  1GOZ A;  4W9J A;  2XN9 C;  2KT7 A;  1TYG B;  1WR1 A;  1IGD A;  5J17 A;  2WX0 A;  3TEX A;  2JVC A;  4FXC A;  5TR5 A;  2A5U A;  3Q8E A;  3NOB A;  3PV1 A;  2LXA A;  2MA9 B;  1WJN A;  3D32 A;  2V3S A;  1EU4 A;  3EFU A;  3VHT C;  3AI5 A;  1F2R I;  1VD2 A;  3KUD B;  2ICI A;  3N1Z C;  1JRU A;  3U52 E;  3L0W B;  2C5L C;  4ZRP A;  3DOW A;  2CHZ A;  3CIR B;  4KKI A;  4PS7 A;  1L0V B;  2BS3 B;  3WAP A;  1WGR A;  2KC2 A;  2RMM A;  1ZKH A;  1DGJ A;  5JHA A;  1HTQ A;  3NG0 A;  4W9G A;  4ZDV A;  2MLB A;  1ZXI A;  2KN4 A;  2OHF A;  2XK5 B;  2K6Q A;  3APD A;  4PS8 A;  5G2N A;  4RCO A;  1DOI A;  3UIN B;  3A9K B;  3S2A A;  1L2N A;  4XC2 A;  1KFY B;  2K6D B;  4ANU A;  2KAN A;  1I4H A;  3IVF A;  3RNF C;  3DHH C;  4FHJ A;  2HJ8 A;  5FR3 A;  3N3K B;  4HJG E;  2G1E A;  2NS5 A;  4HJK A;  2C7M B;  3Q69 A;  4ANW A;  4BOS C;  1GC7 A;  1BUI C;  2PIA A;  2ZZP B;  1E5W A;  2L76 A;  3AE2 B;  1SE3 A;  2LVP A;  1WYG A;  2JYE A;  1Z5S B;  3DQV A;  5IN7 A;  4WWP A;  2ONQ A;  1B9R A;  1NYR A;  2N1V A;  1ZP0 B;  3DVG Y;  1TZO A;  1E0Z A;  5D2M B;  1WGG A;  2IYD B;  3V6E B;  1J8C A;  2UWQ A;  3GB1 A;  3AB5 A;  4HDO A;  1KM7 A;  3N9Y C;  1R7S A;  3DBR I;  4RM9 A;  4OW0 A;  3MC9 A;  1QOA A;  3TMP B;  1FFU A;  4FUL A;  4WWM A;  1V1P B;  3AE7 B;  2DLB A;  4RGM A;  3RI7 C;  3ZLZ A;  1C78 A;  1E7P B;  3I9V 1;  2IO0 B;  2HD5 B;  3AEE B;  4GOC A;  3QHT A;  2Y5C A;  1HQR D;  3M63 B;  4OVU A;  3KUZ A;  1PFD A;  4M00 A;  2KMC A;  2BKR B;  3AM9 A;  1WXM A;  3ZXV A;  1YQ4 B;  3W1S A;  1MI0 A;  1UWX A;  3AE9 B;  3Q3F A;  2SEB D;  1FFV A;  4AQ7 A;  2KKC A;  4P7I A;  3UQB A;  4KDL B;  1WJU A;  4MSM B;  3Q3O C;  4WAF A;  5BMH A;  3ZYY X;  3DBH B;  4O1N A;  4LNO A;  3Q8B A;  3PRE A;  3WCQ A;  4GDL A;  1P3Q U;  1D6E C;  3ZGZ A;  2TSS A;  3IG3 A;  3AE8 B;  3L08 A;  1WF9 A;  2K8B A;  2ZPY A;  2CKH B;  3IHP C;  4JPS A;  4F1S A;  1F2R C;  5JXV A;  2N1W A;  1OGW A;  3LJ3 A;  2KMM A;  2JU6 X;  1FXI A;  3PS6 A;  4P1C C;  1L0X B;  3I57 A;  3PGE A;  2NBV B;  2J53 A;  4M8N A;  3TUO A;  3AE4 B;  1QIL A;  3PVL A;  3NS1 A;  1C3T A;  2AQ2 B;  3ZXR A;  2KDB A;  3AEG B;  2BYT A;  1N5X A;  3Q3J A;  1Q5W B;  1GNU A;  3JW0 X;  2H89 B;  4GMV A;  4Q2J A;  1N62 A;  3MFG A;  4US8 A;  3GZN I;  4D2K A;  1EWY C;  4YT0 B;  2BB5 A;  3LXF A;  3UI3 A;  1VJK A;  2WXO A;  2JX5 A;  3P63 A;  1XXG A;  3R7Q A;  4C4V A;  2G9H D;  4YWG G;  3MP9 A;  3N20 C;  5L83 A;  3VUY A;  1HZ6 A;  1XF5 L;  3OJ4 B;  2DHZ A;  1YN5 A;  1MHX A;  3J9C A;  4NQL B;  5GMV A;  4GSW A;  2XEW A;  5EDS A;  2BYV E;  2M0A A;  4KZC A;  2WP9 B;  1I4Q A;  4K81 A;  3I5J C;  2C60 A;  3E9S A;  1N63 A;  2B76 B;  2I2Y A;  3AE1 B;  4PT5 A;  4FJV B;  2DAF A;  3KYD D;  3H6N A;  1VZ8 A;  1B1Z A;  4RNA A;  3ZW3 A;  3NZU A;  3NVW A;  3Q2A C;  2KWC A;  4QAY A;  4HDQ A;  1ZOY B;  2VH2 A;  1C79 A;  4LJP B;  1TIF A;  3W5U B;  4IWO A;  3CST A;  2KJR A;  1AWD A;  3JSV B;  1FD6 A;  1EUV B;  2MQJ A;  4A8X C;  5D6J B;  4A6Q A;  1TGZ B;  1XLO A;  1F1H A;  3PTF C;  2INN E;  1AN8 A;  2IGD A;  4NNJ B;  2YEP F;  1PQS A;  3DPD A;  2IBI B;  2ZNV C;  4YL8 A;  5CX3 A;  2BQQ A;  1T5X D;  1V5O A;  3WAN A;  4OVV A;  3UQA A;  1J19 A;  2ZPN A;  4DXG A;  4J6I A;  3KLS X;  4HKZ E;  1YX5 B;  4YSZ B;  4WJP A;  2LI5 A;  4K3B A;  2ZW1 A;  1WGD A;  4GDL B;  1OTR B;  4ASW C;  4P16 A;  1UBQ A;  2KAC A;  3SHQ A;  2J0J A;  1YD8 U;  1AYF A;  1R4M B;  2BT6 A;  4TV3 A;  2ZCB A;  1NEN B;  1GB1 A;  4JIO U;  1ET9 A;  4RGT A;  4A20 A;  1WM2 A;  4KV2 A;  1K50 A;  1YIW A;  2FID A;  4FJY A;  4ITK A;  1SE9 A;  3U7Z A;  2L8J A;  4ANX A;  4KIK B;  2V4I B;  3VTU A;  5IA7 A;  2INP E;  2YEP B;  2REX A;  5BMI A;  3R7R A;  4HPM B;  4XWW A;  1UGJ A;  4YSY B;  3PRP B;  5GXG B;  4B6W A;  3NUH B;  3B2G A;  1KF6 B;  2KN5 A;  2K39 A;  5DPT A;  4AUQ C;  2L32 A;  3VRB B;  4M8M A;  2M1M A;  3B08 A;  5AZG A;  3VQI A;  1FRR A;  2N7J A;  1V2Y A;  3O13 A;  4UDU C;  2RSU A;  4B0E A;  4OHJ A;  1TT5 B;  1TZ1 A;  4WWO A;  3KWV A;  2KQS A;  3PO0 A;  1V81 A;  2JZ3 B;  2WHI A;  2GI9 A;  3VVW B;  1V8C A;  2MEK A;  4MJS B;  1YJI A;  2WQY B;  4GU2 A;  1LO5 D;  3IAS 1;  5G5G A;  3HHM A;  5DPW A;  1WXV A;  3RZW C;  3T8M A;  5C2T B;  2J7Q B;  3GOE A;  5H92 C;  3TCA A;  2HE7 A;  2LEK A;  4IOI E;  4RF0 A;  1WJ4 A;  3SU8 X;  4JGH B;  3RUI B;  1FXT B;  1GJZ A;  4LLG M;  2AQ1 B;  2M0X A;  2KLC A;  4YXD B;  3BVM A;  1E90 A;  3HVD A;  2WXG A;  1Y8R C;  3H9D A;  1CZP A;  2LGY A;  1WH3 A;  1KRH A;  2ZVN A;  4KSK C;  3V3X A;  4ZYS A;  2GOW A;  2KK8 A;  3Q3M C;  4HCP B;  2NBW B;  3L13 A;  5IO9 A;  1M4V A;  1OQY A;  1KTK A;  3IBE A;  1VZ7 A;  1F0Z A;  2MX2 A;  3PPA A;  3DBH I;  1SF0 A;  4G0N B;  2PTL A;  1R4N B;  3ONS A;  4TKN A;  2D10 A;  2DYB A;  2NMQ A;  3PLU A;  4RGN A;  2KQ7 A;  3A4S C;  3ZUN A;  4WJO A;  2ZNV B;  2K5P A;  2MBH A;  4I6L B;  5D7G A;  2N9K A;  4B0M A;  1E6E B;  3A1Q B;  2HJ1 A;  1NI2 A;  1YQ3 B;  2AX5 A;  2GB1 A;  3DDC B;  2ZJD A;  1ZDX A;  1NEK B;  1SE2 A;  2UYZ B;  2V0G A;  5AEK B;  2BWF A;  2LHD A;  3QC8 B;  5E6O A;  1P0R A;  2E6X A;  2OJR A;  2MP2 B;  3Q8C A;  1N5W A;  2LFI A;  2EEL A;  4E71 A;  2IGH A;  4JWS C;  3HRD D;  3NJT A;  3VUX A;  2K0P A;  2BYE A;  2JUO A;  2JSV X;  1IBX B;  4ZYN A;  4IDI A;  2QMT A;  3BK2 A;  4FLH A;  2CHW A;  3NZ3 A;  2WNM A;  5FR6 A;  1QKZ A;  2LVO A;  2WDT B;  1C4P A;  2KJH B;  2GBN A;  2DZI A;  4IKG A;  5IOI A;  3W1S C;  2WU2 B;  1WSP A;  3BVG A;  4IM2 A;  1HA5 A;  1V1O A;  1P7E A;  4G3X B;  2KDI A;  1WGY A;  1TKY A;  3A4R A;  3N1Y C;  1NI3 A;  3ZNH B;  1C4A A;  4CHK A;  3N32 A;  2LAS A;  2WDV B;  4EOY A;  2BPS A;  3L10 B;  3QQ8 B;  1ISN A;  2XBB C;  1HZ5 A;  2BYF A;  2KDE B;  2ZCC A;  2J0K A;  3PHX B;  2N9L A;  2Z0D B;  2FCS A;  3EA6 A;  5E6N A;  2K8H A;  1P98 A;  1T3Q A;  2D07 B;  2RR9 A;  1F52 A;  2WDR B;  1VDV A;  4FHK A;  3RNG C;  2DZM A;  4ZRJ A;  3B9J A;  1MVK A;  4BBN C;  4DXA B;  4RMA A;  2PEA A;  5EE9 A;  3SDL C;  3H7P A;  1JWB D;  4ZRK A;  2PLP A;  3DBS A;  4LCD E;  4M02 A;  2VZK B;  4BOZ B;  1RFK A;  4WWN A;  5MPO A;  1OQQ A;  2LGD A;  3AE5 B;  3B1L X;  2MW5 A;  1HTO A;  1QLB B;  1KOT A;  2KMA A;  2JWU A;  4IM0 A;  4WQM A;  3P2B A;  3U30 A;  3I3T B;  1JWA D;  2BGF A;  4N58 A;  1Y56 A;  4F7Z A;  4RF1 A;  2DZJ A;  2CU3 A;  4PYZ A;  1YQB A;  3LB8 C;  4W9F A;  2BKF A;  1QOB A;  3AH7 A;  4ICV A;  1N6Z A;  4ZRI A;  2L52 A;  5CTR C;  2LGI A;  1TS5 A;  4K1R B;  1T0S C;  3AUL A;  5D3D A;  4KZ0 A;  1D5M C;  3QCA A;  2L3Z A;  4DWF A;  4TSS A;  1S3S G;  5L95 C;  5E6J A;  4ARC A;  3DCG A;  1KLV A;  4L2Y A;  3GS2 A;  3I63 C;  1E9M A;  2HTM E;  3ZTD A;  2MSE D;  1Q1O A;  3AU5 A;  1KLG D;  2MBO A;  3WAL A;  2W3R A;  3P4R B;  1E8X A;  2KFK A;  2VRR B;  3PZ7 A;  2BW2 A;  2WXN A;  5EE3 A;  2J0M A;  1FRD A;  4MGI E;  1ZPS A;  2QSD A;  2NCN A;  4IW0 A;  2KWD A;  3NZS A;  1SXT A;  1EU3 A;  2MWS B;  2QCZ A;  1ACC A;  2JF5 A;  3L54 A;  4I6P A;  3SD5 A;  1RWS A;  1SB3 C;  2KOX A;  1WX8 A;  1XD3 B;  3AED B;  3ZIM A;  3TL5 A;  2EKE C;  1T0Y A;  5AUI A;  2K1F A;  1L7Y A;  2EMS A;  2NR2 A;  2L00 B;  1DOY A;  3N1X C;  1UD7 A;  2I1J A;  5CHW A;  4II2 B;  4WIP A;  4KX6 B;  2J42 A;  1RFA A;  4M01 A;  1XO3 A;  1E7V A;  4LJO B;  3C0R B;  1UF0 A;  3K9P B;  2KTR A;  2GMI C;  4HCN B;  5HFY A;  3GE8 C;  1QF6 A;  4X57 B;  4IC7 B;  4NZL B;  2R61 A;  4HRO A;  4NQK E;  2WXL A;  3ZJT A;  1MHH E;  3LYY A;  4BFR A;  3A1Q A;  2BWE S;  2QJL A;  4WJN A;  4HK2 A;  1YJJ A;  1JWM D;  4XDD A;  2V3P A;  4MSQ B;  1WR6 E;  3APF A;  4CQN A;  4JQW C;  2E3T A;  2WDQ B;  4NJC A;  1HE8 A;  2PW9 A;  4IWP A;  2UU7 A;  3W2D A;  3OAW A;  5C23 A;  1K52 A;  3MHS D;  2BVC A;  4L23 A;  2G4D B;  1DYQ A;  1RM6 C;  1D3Z A;  3L16 A;  3T9L A;  1ROE A;  3MTN B;  2IJ0 A;  5IP4 D;  5FK9 C;  2DWQ A;  3RFZ B;  4RM8 A;  1DOX A;  2JXT A;  3UF8 A;  2IY0 B;  4GXB A;  4HXD A;  3PRZ A;  4NJ6 A;  4DHJ D;  3C8Y A;  2BS4 B;  2JWZ A;  4CYE A;  4XWT A;  4RFB A;  1FNU A;  3DBL I;  2G45 B;  4XGA B;  2GLS A;  3NRZ A;  2M19 A;  2XNA C;  4JL9 A;  1PDX A;  4MM3 B;  1SEB D;  1YOV B;  2V9H A;  2K3U A;  3O65 B;  1WE7 A;  1FCC C;  3W5V B;  3RPF C;  1K8R B;  5DCN A;  4MJS A;  3L4P A;  4CO7 A;  4GLS C;  2D3B A;  4E3C A;  1UWM A;  1TJE A;  4XYC A;  1E8Z A;  4GDK A;  4BKG A;  2FE8 A;  3URY A;  4N9F 4;  5H8Y E;  2H88 B;  1C1Y B;  2KLG A;  2LJI A;  3ZKJ C;  3X23 A;  4YTM B;  4EE2 A;  1WX7 A;  3EHV A;  4W9H A;  4AWJ A;  2Y5P A;  3VXW A;  5KHO A;  1WY8 A;  4USA A;  1WXS A;  1XLN A;  4MM3 A;  5HKH A;  3RMK C;  4B9K A;  2LHE A;  1EO6 A;  1RLF A;  3Q6B A;  4WH4 A;  4DHZ B;  4N6E B;  4KIK A;  2CU1 A;  4C4V B;  3ZQ4 A;  3CSF A;  3U7D A;  1I4G A;  3TBL D;  1AAR A;  3MHZ A;  2FNJ B;  3BZD B;  1C76 A;  4ZOH C;  3JVZ X;  3ECI A;  4TQ0 A;  1I35 A;  1PGB A;  3BIN A;  3Q14 C;  4NJ7 A;  4J3O D;  2G4S A;  2MJ3 A;  4B95 A;  2QEJ C;  2WXQ A;  2ASQ A;  3QX1 A;  1T0Q C;  2BS2 B;  4W9L A;  3ML9 A;  2D3G A;  2K9X A;  3RNE C;  2FUH B;  4GIV A;  1WWT A;  1V80 A;  2KFK B;  2J52 A;  2Q5W D;  1XCQ L;  4P1B C;  1KLU D;  1ET6 A;  2YLM A;  1WGH A;  1I4R A;  2AEH A;  1CQV A;  4KDI C;  4IUM B;  4YTP B;  2RPQ A;  5KHQ A;  2PKO A;  1QQR A;  1SBB B;  4G50 A;  4OVZ A;  4MH0 E;  1JQ4 A;  1LXD A;  3GE3 C;  1E8W A;  2HDE A;  1T6B X;  3PT2 B;  4W9D A;  3A9J A;  3H1U A;  2KTR B;  2WLB A;  2Z8L A;  2PE9 A;  3DBR B;  3FIL B;  3KWL A;  4MGZ E;  4TUU A;  1WX9 A;  1I7H A;  2W54 A;  4AOF A;  4R3D A;  3MC8 A;  1SE4 A;  3TEZ A;  2LMC A;  2LGS A;  3WIM A;  4C80 A;  2WGS A;  1QOF A;  3QIJ A;  2ZEQ A;  3ZDM C;  2I38 A;  2DEN B;  4ICU A;  1FNV A;  4KKJ A;  3FIL A;  2GBM A;  1XLQ A;  2D2Q A;  2OED A;  4DDI D;  2VZK D;  4BZA A;  2FBW B;  4S17 A;  1N60 A;  1FO4 A;  1U4A A;  2NTS A;  3HM3 A;  2KX3 A;  5G55 A;  5I4D A;  2MJD A;  3ZJV A;  4FN2 A;  1L6V A;  1UUP A;  4MAC A;  2M17 A;  4AJY B;  3DBL B;  1IGC A;  4ZRQ A;  3ML8 A;  2GBJ A;  3AEC B;  1JWS D;  2CJN A;  2WS3 B;  3SR6 A;  2I1K A;  2L7R A;  1MFW A;  4BAX A;  1FNW A;  5DPR A;  2X8X X;  5G5H A;  1WFY A;  3FC4 A;  3VRA B;  4LNF A;  3TJP A;  2EMT A;  1C77 A;  2FCQ A;  1IPG A;  1CK1 A;  2FUG 1;  2OOB B;  2R2O A;  3HIZ A;  1EM7 A;  2C7H A;  3JSV A;  5C3J B;  1V9J A;  4MT5 A;  3VTV A;  2NPT B;  2IZV B;  2JZP A;  5HI1 A;  5IAA C;  3GZN B;  4A3O A;  1S1Q B;  5J2R A;  3ZNI D;  3V61 A;  2N4F A;  4JX1 C;  3QK0 A;  1LFD A;  4EZL A;  4F8C B;  4N59 A;  3DWM A;  2D3A A;  3P4Q B;  1ZE3 D;  1WIA A;  4ANV A;  1ZGU B;  4G11 A;  2D5G A;  2N9X A;  2N7E A;  1AW7 A;  5JHB A;  4GGQ A;  2QHO A;  2O2V B;  4ZHP A;  3DVN U;  4PK1 A;  2LZ6 A;  1J7B A;  2YVC A;  2OJW A;  2M56 B;  3IAM 1;  3OWE B;  3PZD A;  1KH0 A;  3ZNZ B;  4HKQ A;  3AEF B;  4NPN A;  2BF8 B;  2L1A A;  1LQB A;  4K7W A;  1D5Z C;  2K22 A;  3BVZ A;  3UIP B;  3VH3 B;  2MRP A;  1NYQ A;  3VH4 B;  3UIO B;  3QJZ A;  1JW9 D;  4KGR A;  2KD0 A;  3P1M A;  1UBI A;  5BYR A;  1HXY D;  1GG3 A;  3BYY B;  3AE6 B;  2KDM A;  2MBQ A;  2CR5 A;  2MP2 A;  3AV8 A;  2PVO D;  1SGH A;  1QOG A;  3K9O B;  4DHJ B;  4BKS A;  4E74 A;  2GBR A;  2AYO B;  4MH8 A;  1XQQ A;  3WA0 A;  3WAO A;  2LVQ A;  1LM8 B;  3B2F A;  2IND C;  2FIF A;  2ZW0 A;  2M4N A;  4DK5 A;  3V62 A;  1Q0W B;  2AQ3 B;  4XX5 A;  3H7P B;  4WAA A;  3R8B A;  3ALB A;  2N0S B;  3ABV B;  2PJH A;  4LTU A;  3MC0 B;  4M0W B;  3V6C B;  1C4C A;  5HHD G;  1ENF A;  1JRO A;  3IT4 B;  3APC A;  3U2S C;  2LRW A;  3ZTC A;  3ZRF A;  4EUT A;  3ETR A;  2VH1 A;  4FBJ B;  5HG2 A;  1V1P A;  2KAJ A;  4KSL C;  1M94 A;  3EGR A;  4YSX B;  2RDB C;  3BK1 A;  1FIQ A;  1WRI A;  2RDH A;  4II3 B;  3M3J A;  1GB4 A;  1P9D U;  4URK A;  4DDG D;  2MHJ A;  3GP7 A;  4RGO S;  1IYF A;  1IUE A;  4WQO B;  2KQ4 X;  2WXR A;  1WI0 A;  5D94 A;  4LNK A;  5LXI B;  2KX0 A;  1UH6 A;  4XZ4 A;  1WXA A;  1TS2 A;  1CJE A;  1ZXH A;  3X0W A;  1IBX A;  4TMA B;  1L5P A;  5LXH A;  2EKI A;  2KTF A;  3NS8 A;  4LDT D;  3L17 A;  1VR9 A;  5LNK 1;  4GDK B;  1OQR A;  3IXS A;  4K7U A;  4A9A A;  3U8Z A;  1L6U A;  3KYC D;  1A70 A;  3BY4 B;  2KZR A;  3RT3 B;  3R66 C;  1Z2M A;  1RAX A;  2DBY A;  5TSS A;  4HRS A;  4DBG A;  3R3M A;  2FAZ A;  3OLM D;  2JQR B;  2N9P C;  1YNT E;  3LDZ E;  4JE3 B;  1WJ6 A;  3M95 A;  4GB9 A;  3NVV A;  4LDT B;  1LGR A;  3B0A A;  3UGB B;  2KYW A;  1BT0 A;  2WXP A;  5FKA C;  2C7N B;  3ZRC A;  4XDC A;  2PE6 B;  1MJD A;  4ZHO A;  1UNS A;  5BYQ A;  4M0W A;  2PPH A;  2MH7 A;  1WRD B;  1WMH B;  3NY5 A;  3SEB A;  2HTH A;  1TTN A;  1WE6 A;  1XLP A;  1OEY A;  4MEL A;  1UGM A;  1G6J A;  2NTT A;  2WU5 B;  2JRI B;  1PGA A;  1E7U A;  3VR8 B;  2KO3 A;  5BMG A;  4MGK E;  1GC6 A;  2QC8 A;  2L0F A;  2A4Z A;  2DYM A;  1YJ1 A;  4IG7 B;  2DZK A;  1STE A;  2LXC A;  2BB6 A;  1YN4 A;  3Q8F A;  3R2I A;  1SIF A;  2CJO A;  2J4X A;  3PSE B;  1GAQ B;  2O6V B;  2KXJ A;  1VZ6 A;  3Q8A A;  4OZA A;  4OZB A;  3EC8 A;  1V6E A;  3MJW A;  3FAH A;  1UZX B;  4PYU A;  4JLC A;  5EE0 A;  2WXF A;  3TEY A;  1MPE A;  2KJ6 A;  5CHV C;  1YX6 B;  1V86 A;  3DVN V;  2Z59 B;  3TEW A;  2Y3A A;  3NHE B;  2O2V A;  2L83 A;  2SAK A;  4NAW A;  4HEA 1;  1FPY A;  3A33 B;  1KJT A;  2JY6 A;  2N9E B;  4H2A A;  1RYJ A;  3CF6 E;  4KVG B;  2QIE B;  2O6V D;  2XK5 A;  3TIX A;  1BXT A;  2AL6 A;  2PVG C;  3PHW B;  1PYW D;  3RCZ A;  3FKY A;  2W55 A;  3C19 A;  3VAW A;  2JYT A;  2WXH A;  5D3I B;  1WZ0 A;  2QIL A;  1T0R C;  1F9J A;  4YTN B;  3RYT A;  2DX5 B;  2WWZ A;  3KUC B;  3IT6 B;  2W82 A;  3R2T A;  4ACF A;  1X1M A;  3ZVV A;  1JRP A;  1P1A A;  4NAW B;  2RDG A;  4S0R A;  3H8H A;  2DNF A;  4BKS D;  1TS4 A;  2IGG A;  5CHF A;  5T8I A;  2NPT A;  4AS1 A;  1P7F A;  1BML C;  1OEY J;  2DAJ A;  2W3S A;  3BYT B;  3VDZ A;  4BKT A;  1GUA B;  3PLV A;  3HVZ A;  4XE0 A;  3VTW A;  3DHG C;  2KWV B;  3QAR A;  1ESF A;  2MBE A;  2LUM A;  4FAD A;  1J7C A;  4LNI A;  2FCN A;  4A55 A;  4I6N B;  1HEZ E;  1A5R A;  3E56 A;  3DWG C;  2ZVO A;  1FEH A;  1JWU D;  3BWU D;  2JPH A;  1WXQ A;  4L1B A;  3P4S B;  3TSS A;  4K3C A;  1VRA B;  1XEE A;  5LLI A;  1NDD A;  3EUB 2;  1E10 A;  1GPX A;  3W1Y A;  1VLB A;  1H4R A;  4DHZ E;  3NVY A;  2MBB B;  4EEW A;  2BBC A;  2KHW B;  2WXJ A;  2L0T A;  3EFC A;  3RNA C;  2NVU I;  1XT9 B;  2V4L A;  3BII D;  3QAQ A;  3OJ3 A;  4NAM A;  2JZZ A;  4IWQ A;  4ARI A;  2IY1 B;  3ZNG C;  2INC C;  1MG8 A;  3CWI A;  4PS3 A;  1Q10 A;  3M62 B;  4WUR A;  2ON8 A;  3P42 A;  1JCK B;  4C7Z A;  4REZ A;  3RZF A;  2PMV A;  3W9C B;  4NY0 A; 
#chains in the Genus database with same CATH homology
 2N1W A;  4FHK A;  5IAA C;  4A3O A;  1OGW A;  1S1Q B;  2DZM A;  2WX1 A;  2LUE A;  3LJ3 A;  5J2R A;  4W9I A;  4ZRJ A;  2M8S A;  4BBN C;  4DXA B;  3ZNI D;  3V61 A;  4RMA A;  3PS6 A;  5AZF A;  2N4F A;  2PEA A;  3QK0 A;  1LFD A;  3SDL C;  3H7P A;  4EZL A;  4F8C B;  4ZRK A;  3PGE A;  2KDF B;  2NBV B;  1IP9 A;  3DBS A;  4LCD E;  4M8N A;  4BOZ B;  4WWN A;  2W9N A;  1WIA A;  4ANV A;  3PVL A;  1ZGU B;  4G11 A;  4W9C A;  2LRU A;  2LGD A;  3B1L X;  4AJW A;  2N9X A;  2N7E A;  4K7S A;  2MW5 A;  1C3T A;  4HVB A;  5JHB A;  4GGQ A;  1KOT A;  2KMA A;  2QHO A;  4EFO A;  1H8C A;  2O2V B;  4IM0 A;  2KDB A;  3DVN U;  3A9K A;  3P2B A;  2LZ6 A;  2YVC A;  3U30 A;  2K25 A;  3I3T B;  2O6V A;  2BGF A;  3Q3J A;  1Q5W B;  1GNU A;  3JW0 X;  4GMV A;  4F7Z A;  3PZD A;  2DZJ A;  4WJQ A;  4PYZ A;  3ZNZ B;  3GZN I;  1YQB A;  4W9F A;  4EZK A;  4NPN A;  3WAM A;  2BF8 B;  2BKF A;  5AZH A;  1LQB A;  4ICV A;  4K7W A;  2KNB A;  5JZE B;  3UIP B;  3VH3 B;  2MRP A;  4ZRI A;  3VH4 B;  5CTR C;  2LD9 A;  3R7Q A;  3UIO B;  3QJZ A;  4K1R B;  4HPL B;  2KD0 A;  1UBI A;  1ZW7 A;  3AUL A;  5L83 A;  1GG3 A;  1E8Y A;  4KZ0 A;  4HLE A;  3QCA A;  3VUY A;  2L3Z A;  1EF5 A;  3QWZ B;  3VUW A;  3OJ4 B;  4DWF A;  2MBQ A;  1S3S G;  2LGX A;  2DHZ A;  3RD2 A;  5L95 C;  3HK0 A;  2CR5 A;  1J0G A;  2Y5B B;  4AP4 C;  2MP2 A;  4NQL B;  4MEM A;  1I42 A;  5GMV A;  1SGH A;  3DCG A;  4GSW A;  2XEW A;  3K9O B;  4DHJ B;  4BKS A;  3N30 A;  5EDS A;  1KLV A;  2BYV E;  4E74 A;  4KZC A;  2GBR A;  4K81 A;  2GBK A;  3IFW B;  2AYO B;  1XQQ A;  3WA0 A;  3WAO A;  2LVQ A;  1LM8 B;  2C60 A;  3RUL A;  3ZTD A;  2MSE D;  2FIF A;  1Q1O A;  3AU5 A;  3EEC A;  3HM6 X;  4W9K A;  2M4N A;  4FJV B;  4DK5 A;  3V62 A;  1QZE A;  2DAF A;  2MBO A;  3WAL A;  3KYD D;  3H6N A;  1Q0W B;  2RGF A;  4XX5 A;  3H7P B;  2N7D A;  1E8X A;  4WAA A;  3ZW3 A;  2KFK A;  2VRR B;  3ALB A;  3NZU A;  2K8C A;  2PJH A;  2J0M A;  2KWC A;  4MGI E;  4M0W B;  4HDQ A;  3V6C B;  2Z0E B;  4LJP B;  2NCN A;  3ENE A;  2B3A A;  4IW0 A;  5BO4 B;  4IWO A;  2MCN B;  3NZS A;  3CST A;  2KJR A;  3JSV B;  3APC A;  2LRW A;  1EUV B;  2MWS B;  3ZTC A;  3ZRF A;  2MQJ A;  2FCM A;  2JF5 A;  3L54 A;  4I6P A;  3SD5 A;  4EUT A;  5D6J B;  2KOX A;  1WX8 A;  1XD3 B;  4FBJ B;  4BBN F;  1TGZ B;  2CHX A;  3H7S A;  3ZIM A;  3TL5 A;  2EKE C;  3JYU A;  1T0Y A;  4KSL C;  1WZ3 A;  2D11 A;  3PTF C;  2K1F A;  1M94 A;  4NNJ B;  2C9W B;  3CMM B;  1PQS A;  1L7Y A;  2EMS A;  2NR2 A;  3A9J B;  4EKU A;  2L00 B;  3DPD A;  1UD7 A;  2I1J A;  5CHW A;  5E6P A;  2IBI B;  1WMH A;  4II3 B;  3M3J A;  1P9D U;  2ZNV C;  4II2 B;  4TQ1 A;  2DYO A;  4DDG D;  4URK A;  4MGY E;  4YL8 A;  5CX3 A;  1RFA A;  3VFK A;  1IYF A;  1E7V A;  4LJO B;  1V5O A;  4WQO B;  3C0R B;  1VCB A;  1WI0 A;  3WAN A;  3PRM B;  1R4M I;  5D94 A;  3K9P B;  2KTR A;  2GMI C;  4HCN B;  4OVV A;  3KH0 A;  3UQA A;  5LXI B;  2KX0 A;  1J19 A;  2ZPN A;  1UH6 A;  3KW5 B;  4XZ4 A;  1WXA A;  4J6I A;  4X57 B;  4IC7 B;  1TBE A;  2JXX A;  2JT4 B;  2R2Q A;  4W9E A;  4NQK E;  4IM3 A;  3X0W A;  5LXH A;  4EZJ A;  1YX5 B;  2AL3 A;  4WJP A;  4BFR A;  1V49 A;  1RRB A;  3ZO5 B;  2LWP A;  2IO3 B;  2BWE S;  2JRH A;  2KTF A;  2LI5 A;  2WYQ A;  3A1Q A;  3NS8 A;  4WJN A;  1WGD A;  4GDL B;  4LDT D;  4HK2 A;  3L17 A;  5DPS A;  1OTR B;  2KVR A;  4ASW C;  4GDK B;  3V60 A;  4MSQ B;  1WR6 E;  3APF A;  1UBQ A;  4K7U A;  4JQW C;  3U8Z A;  3SHQ A;  3KYC D;  2J0J A;  1YD8 U;  2KC1 A;  4A3P A;  3BY4 B;  4FJZ A;  1HE8 A;  4HWI B;  1R4N I;  1WYW B;  2KZR A;  4IWP A;  3RT3 B;  3R66 C;  5C1Z A;  5J18 A;  1Z2M A;  1NBF C;  4TV3 A;  1RAX A;  3OAW A;  2ZCB A;  5C23 A;  3MHS D;  3ZDT A;  2NBU A;  2LJ5 A;  2G4D B;  4MDK E;  4DBG A;  4JIO U;  3R3M A;  4A20 A;  1D3Z A;  2FAZ A;  3L16 A;  3OLM D;  3T9L A;  3MTN B;  2N9P C;  1WM2 A;  4KV2 A;  3LDZ E;  4RM8 A;  1YIW A;  2FID A;  2IO2 B;  4FJY A;  1WJ6 A;  1SE9 A;  3UF8 A;  3M95 A;  2IY0 B;  2L8J A;  4GB9 A;  4KIK B;  3VTU A;  4ANX A;  3AU4 A;  5IA7 A;  4GXB A;  4LDT B;  4HXD A;  2KWU B;  3B0A A;  3PRZ A;  2REX A;  3UGB B;  4NJ6 A;  4DHJ D;  1UEL A;  3R7R A;  4HPM B;  3PRP B;  2JWZ A;  3DVG X;  1BT0 A;  4CYE A;  4B6W A;  2KFJ A;  3AXC A;  3QA8 A;  2C7N B;  3KVF B;  2KN5 A;  2K39 A;  5DPT A;  3ZRC A;  4AUQ C;  1CMX B;  4GN1 A;  2G3Q B;  4BVU C;  3DBL I;  1EF1 A;  2AWT A;  2G45 B;  2PE6 B;  4M8M A;  4JL9 A;  1V5T A;  2IO1 B;  1WM3 A;  2M1M A;  3B08 A;  5AZG A;  3VQI A;  2CS4 A;  5JH5 C;  1V2Y A;  2PPH A;  3O65 B;  1WRD B;  1WE7 A;  1WMH B;  3NY5 A;  2RSU A;  2HTH A;  4FA6 A;  1K8R B;  1TTN A;  2V1Y A;  5DCN A;  4MJS A;  1TZ1 A;  4CO7 A;  2L05 A;  2RD0 A;  4WWO A;  1WE6 A;  4W9J A;  1OEY A;  4MEL A;  2KQS A;  1UGM A;  1G6J A;  4E3C A;  1WR1 A;  1V81 A;  2JRI B;  2JZ3 B;  3VVW B;  1E7U A;  1E8Z A;  4GDK A;  2KO3 A;  5J17 A;  4MJS B;  2WX0 A;  4BKG A;  4MGK E;  4N9F 4;  1GC6 A;  2JVC A;  5TR5 A;  2L0F A;  4GU2 A;  2A4Z A;  2DYM A;  2A5U A;  1YJ1 A;  4IG7 B;  3NOB A;  2DZK A;  3HHM A;  3PV1 A;  1C1Y B;  2KLG A;  2LXA A;  2MA9 B;  1WXV A;  2LXC A;  3RZW C;  3T8M A;  1WJN A;  3X23 A;  3ZKJ C;  5DPW A;  1WX7 A;  2J7Q B;  3EHV A;  3GOE A;  4W9H A;  3D32 A;  2V3S A;  3TCA A;  4AWJ A;  2HE7 A;  3EFU A;  1SIF A;  3VHT C;  3VXW A;  1WJ4 A;  3SU8 X;  3PSE B;  3AI5 A;  4JGH B;  5KHO A;  1WY8 A;  1VD2 A;  3RUI B;  1FXT B;  2O6V B;  3KUD B;  1GJZ A;  1WXS A;  2KXJ A;  4MM3 A;  5HKH A;  2M0X A;  3EC8 A;  4B9K A;  1JRU A;  2KLC A;  1EO6 A;  1RLF A;  1V6E A;  3L0W B;  2C5L C;  3MJW A;  3DOW A;  4KIK A;  4DHZ B;  2CU1 A;  2CHZ A;  1E90 A;  3CSF A;  1UZX B;  4PS7 A;  3U7D A;  3WAP A;  1WGR A;  1Y8R C;  3TBL D;  2KC2 A;  3H9D A;  4PYU A;  1ZKH A;  4JLC A;  2LGY A;  1WH3 A;  1AAR A;  2KJ6 A;  5CHV C;  1YX6 B;  1V86 A;  5JHA A;  2ZVN A;  4KSK C;  3DVN V;  2FNJ B;  2Z59 B;  4W9G A;  2GOW A;  2KK8 A;  3NHE B;  2O2V A;  2MLB A;  4ZDV A;  4NAW A;  3JVZ X;  4HCP B;  3ECI A;  2NBW B;  2XK5 B;  3L13 A;  4TQ0 A;  2K6Q A;  3APD A;  1I35 A;  1OQY A;  3IBE A;  4PS8 A;  3BIN A;  4NJ7 A;  3A33 B;  5G2N A;  2G4S A;  1KJT A;  2JY6 A;  2N9E B;  4B95 A;  2MX2 A;  2ASQ A;  3PPA A;  3QX1 A;  3CF6 E;  3DBH I;  4KVG B;  4W9L A;  3UIN B;  3ML9 A;  2D3G A;  3A9K B;  3S2A A;  2O6V D;  2XK5 A;  3TIX A;  1L2N A;  2FUH B;  4G0N B;  4GIV A;  1V80 A;  2KFK B;  4XC2 A;  3ONS A;  2AL6 A;  2K6D B;  4TKN A;  2KAN A;  3PHW B;  3RCZ A;  4ANU A;  2D10 A;  2DYB A;  1WGH A;  2YLM A;  3VAW A;  3PLU A;  3IVF A;  2KQ7 A;  3A4S C;  2AEH A;  4KDI C;  4FHJ A;  4IUM B;  2HJ8 A;  4WJO A;  1WZ0 A;  2RPQ A;  3ZUN A;  2ZNV B;  5KHQ A;  3N3K B;  1F9J A;  2MBH A;  3RYT A;  2NS5 A;  4I6L B;  4HJK A;  2C7M B;  5D7G A;  2DX5 B;  4G50 A;  2WWZ A;  4ANW A;  4BOS C;  1GC7 A;  4MH0 E;  3A1Q B;  3KUC B;  1LXD A;  1NI2 A;  2ZZP B;  1E8W A;  3DDC B;  1E5W A;  1X1M A;  2L76 A;  2ZJD A;  2LVP A;  3PT2 B;  3ZVV A;  1Z5S B;  2UYZ B;  4W9D A;  3A9J A;  3DQV A;  3H1U A;  4WWP A;  1P1A A;  2KTR B;  5AEK B;  4NAW B;  2PE9 A;  2N1V A;  4MGZ E;  4TUU A;  3DVG Y;  2BWF A;  3QC8 B;  5E6O A;  4BKS D;  1P0R A;  1WX9 A;  2OJR A;  2MP2 B;  1WGG A;  5D2M B;  5CHF A;  2NPT A;  4AOF A;  2IYD B;  3V6E B;  1OEY J;  2DAJ A;  2UWQ A;  3VDZ A;  1J8C A;  4BKT A;  4HDO A;  1GUA B;  1KM7 A;  3WIM A;  4E71 A;  3PLV A;  3VTW A;  2KWV B;  3VUX A;  3DBR I;  2BYE A;  3QAR A;  2JUO A;  4RM9 A;  3QIJ A;  4ZYN A;  2ZEQ A;  2MBE A;  4FAD A;  3TMP B;  4FUL A;  3ZDM C;  4FLH A;  2CHW A;  2DEN B;  2FCN A;  3ZLZ A;  4ICU A;  4I6N B;  5FR6 A;  2IO0 B;  1A5R A;  2HD5 B;  2GBM A;  4GOC A;  3QHT A;  2D2Q A;  2LVO A;  2WDT B;  4DDI D;  2ZVO A;  2KJH B;  3M63 B;  2GBN A;  4OVU A;  1U4A A;  2JPH A;  3KUZ A;  3HM3 A;  2DZI A;  3W1S C;  2KMC A;  2KX3 A;  5G55 A;  2BKR B;  4FN2 A;  5LLI A;  1NDD A;  1WXM A;  4IM2 A;  3W1S A;  2M17 A;  3W1Y A;  4AJY B;  3Q3F A;  4G3X B;  2KDI A;  1WGY A;  1H4R A;  3A4R A;  3ML8 A;  4DHZ E;  2GBJ A;  2KKC A;  2MBB B;  4P7I A;  3UQB A;  4KDL B;  4EEW A;  3ZNH B;  1WJU A;  4MSM B;  4CHK A;  2KHW B;  3N32 A;  2LAS A;  2I1K A;  2L7R A;  2BPS A;  4EOY A;  3L10 B;  2L0T A;  3QQ8 B;  1ISN A;  2NVU I;  1XT9 B;  2V4L A;  2XBB C;  5DPR A;  3QAQ A;  3OJ3 A;  2BYF A;  2JZZ A;  3PRE A;  1WFY A;  2IY1 B;  4IWQ A;  3ZNG C;  4GDL A;  1P3Q U;  1MG8 A;  2KDE B;  4PS3 A;  2ZCC A;  3TJP A;  3IG3 A;  2EMT A;  3L08 A;  1WF9 A;  2FCQ A;  1IPG A;  2J0K A;  2K8B A;  2ZPY A;  3M62 B;  3PHX B;  2OOB B;  2R2O A;  2CKH B;  3HIZ A;  2Z0D B;  2FCS A;  5E6N A;  2K8H A;  3IHP C;  1P98 A;  3RZF A;  2C7H A;  3JSV A;  1V9J A;  2D07 B;  2RR9 A;  4F1S A;  3VTV A;  2NPT B;  2IZV B;  4NY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...