2KLCA

Nmr solution structure of human ubiquitin-like domain of ubiquilin 1, northeast structural genomics consortium (nesg) target ht5a
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
79
structure length
79
Chain Sequence
PKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquilin-1
publication title Solution structure of ubiquitin-like domain of ubiquilin 1
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 19
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2klcA00
2FCNA 2GBJA 4GXBA 3W1YA 4K7UA 4W9LA 2NBWB 2G3QB 2AWTA 4NJ6A 2WX0A 4W9KA 3U7DA 4CYEA 2DZJA 3RUIB 4WJOA 1GNUA 1HE8A 2LUEA 2ZNVB 5IAAC 1P0RA 2JY6A 2UWQA 2LVOA 2NPTB 5JHBA 3CMMB 3TIXA 2C5LC 2N1VA 4IM2A 3V62A 3H7SA 2JRIB 2N9EB 4DHZE 1Q5WB 4IC7B 5CHWA 1WM3A 2DZMA 3B0AA 2AL3A 5JH5C 2KVRA 2L00B 4I6NB 1SGHA 2O6VA 1Z5SB 2N7EA 4M8MA 3ENEA 2EKEC 2L8JA 2V4LA 1EF1A 2KTFA 4W9CA 4DHZB 4W9HA 1YX5B 4WWPA 4JL9A 2JT4B 3VH3B 3N32A 3OJ4B 3V6EB 4G0NB 5CHFA 2NR2A 2IZVB 2LRUA 3D32A 3K9OB 1VCBA 2BGFA 3RCZA 3VH4B 4JGHB 1EF5A 3U8ZA 2L76A 3PRMB 2HTHA 4WWOA 3KUDB 2IY0B 3JYUA 2MCNB 4EZJA 4K81A 5E6OA 2CHXA 2AYOB 1WXMA 2K25A 1R4NI 2FUHB 5J17A 4MSMB 1I42A 3ZRCA 1EO6A 3PSEB 2LGXA 3DOWA 3UGBB 1AARA 4MSQB 2MBEA 1OEYA 3NHEB 2IO1B 1WYWB 2M8SA 2IO2B 2N1WA 3S2AA 2FCQA 4W9DA 2KD0A 2KKCA 2BF8B 1V6EA 2FCMA 3OLMD 3VFKA 2C7MB 2IBIB 2MBOA 1FXTB 2BYEA 2ZEQA 1WFYA 2MA9B 4GDLA 5AZHA 4KSKC 2RR9A 4LDTD 2YLMA 1EUVB 3MHSD 3ZW3A 3QX1A 4TKNA 3PRZA 1E8YA 4PS3A 4ZRKA 4DDID 3KYDD 2J7QB 3SD5A 3PZDA 3ZNZB 3ZIMA 4ICVA 1V5OA 3A4RA 2FNJB 2LGDA 3L16A 1P3QU 2JVCA 4KVGB 2C7HA 3A9JB 2IY1B 2IO0B 2KDEB 1R4MI 2LD9A 2LGYA 2LVQA 1Z2MA 4BBNC 1WGHA 4KDLB 3DVNV 3M63B 4LDTB 4MJSA 1WM2A 4W9FA 1WMHA 2OOBB 3NS8A 3WAMA 2KFJA 3WAPA 3A9KA 3X0WA 2BYVE 2LZ6A 3EECA 4II3B 2NBUA 3PREA 2KC2A 3IHPC 4KIKA 4E3CA 1V86A 2UYZB 4W9IA 2CHZA 4WQOB 1NI2A 3ML9A 1WX7A 5KHOA 1QZEA 3VHTC 3ML8A 2M1MA 2KQ7A 3IG3A 2MLBA 3M62B 2JZZA 2KWCA 2MP2B 2I1KA 4AJWA 4TQ0A 1NBFC 3QARA 4HCNB 3JSVB 4HDQA 2DZKA 5AZFA 1RFAA 3Q3JA 3L0WB 2LJ5A 5G55A 1YD8U 3R7RA 2CHWA 3ECIA 3V61A 1OGWA 4NJ7A 4IM0A 4NPNA 4X57B 2CU1A 4NQLB 2BKFA 1WR1A 3RD2A 5DPSA 1SIFA 4A3OA 1C3TA 4KZCA 2ZCBA 2KWVB 3QQ8B 4IUMB 4NAWA 3NY5A 1JRUA 2XBBC 1OEYJ 3APDA 4M8NA 2N4FA 1H4RA 1TBEA 3MTNB 2ZNVC 3KH0A 4ZRJA 2GBNA 3H7PA 4MM3A 2KQSA 4B95A 1LM8B 3PHWB 2KOXA 1A5RA 3SHQA 4EFOA 5LXHA 2OJRA 4MGKE 5DPRA 2M17A 1UGMA 4RM9A 1GUAB 2XEWA 5CX3A 2EMTA 2NCNA 3ZNGC 2ZVNA 2N9XA 3M3JA 3QJZA 4J6IA 1WXAA 4K1RB 3V60A 1WJ4A 3PHXB 3QAQA 2J0MA 2J0JA 2KDIA 2O6VD 3QWZB 2J0KA 3KUZA 2Z59B 3LDZE 4HLEA 1XQQA 3VDZA 4TUUA 2KN5A 2K8HA 2MBQA 2V3SA 2L3ZA 2XK5A 5DPWA 5D2MB 4HXDA 1RLFA 1J0GA 3ONSA 2BYFA 3PLVA 3DVGX 3R7QA 1WGDA 3AU5A 3ZLZA 2RD0A 2JRHA 1WI0A 2DAFA 2DYMA 3EC8A 4HWIB 4ICUA 2L05A 3IVFA 4TV3A 2D2QA 2M4NA 3TJPA 4F7ZA 3PVLA 2KXJA 4DDGD 2NPTA 4FBJB 1E8XA 2K6QA 4OVVA 1VD2A 1RRBA 4HCPB 1IYFA 1WXSA 1WZ3A 3I3TB 3AU4A 1WGYA 4JQWC 2G4DB 5G2NA 4DWFA 2KNBA 4WAAA 4LJPB 3HIZA 2AEHA 1YIWA 3N30A 4FN2A 3OJ3A 4PS8A 1WJNA 1V2YA 1KM7A 3PS6A 3QA8A 1OQYA 2CR5A 3AI5A 3DCGA 2WWZA 4G11A 1E8WA 5LXIB 3T9LA 3ZTCA 1GC7A 2REXA 3QK0A 2L7RA 3KVFB 1P98A 1WY8A 1V81A 3X23A 1WE7A 2G4SA 1YJ1A 3GOEA 4B6WA 4MGZE 3HM6X 1IP9A 2GBRA 2QHOA 2O2VB 4G3XB 5JZEB 3KW5B 4RMAA 4DXAB 4GDLB 4G50A 3L17A 5GMVA 4GDKA 2VRRB 5TR5A 2ZVOA 4IG7B 2PE9A 5AZGA 3C0RB 3NZUA 2JWZA 4B9KA 2JPHA 3B1LX 3V6CB 3P2BA 3SU8X 3VVWB 1CMXB 4A3PA 3PGEA 1L2NA 4OVUA 3CF6E 3PTFC 2MWSB 1U4AA 2KZRA 2KLGA 4FHJA 2KK8A 5CHVC 3ALBA 1T0YA 2ZPYA 4MEMA 3DDCB 3L10B 3WANA 5EDSA 2FIDA 2KANA 1GG3A 4GN1A 4ZRIA 3UIOB 1WXVA 3VQIA 3VXWA 3TMPB 1WX9A 3RZFA 3A9KB 3RZWC 1WGRA 2DYBA 3VTWA 2ZCCA 3L08A 3OAWA 4IWOA 2ZPNA 2Z0DB 3H6NA 4WJPA 2Y5BB 3NZSA 1OTRB 3APCA 2R2OA 2LWPA 3A9JA 3L54A 1KOTA 1TGZB 4ANXA 3ZKJC 4ANVA 2LI5A 4NNJB 5DCNA 2KFKB 2KHWB 3A1QA 3LJ3A 4F8CB 4EZKA 4FA6A 2W9NA 4GIVA 2KWUB 3VUYA 2HD5B 1ZKHA 1E90A 4AOFA 4BVUC 3WAOA 1UH6A 3PPAA 4WJQA 2FAZA 4JIOU 1G6JA 1UELA 4FJZA 1WJ6A 4MGYE 4BBNF 3EHVA 2N7DA 2MW5A 2ZZPB 5LLIA 3APFA 1E5WA 1WJUA 1WX8A 4HPLB 4EKUA 1WH3A 3GZNI 1YX6B 2Z0EB 3W1SC 2KLCA 4M0WB 4BKSA 4KV2A 1SE9A 5E6PA 2KTRB 4MDKE 3UF8A 3H7PB 3JSVA 4IW0A 4GB9A 3DBRI 1J19A 1UBQA 3PV1A 4GSWA 3BINA 2KMCA 5BO4B 5C1ZA 4DHJD 3VTUA 3PT2B 3EFUA 1RAXA 4FADA 3WALA 4ZDVA 4WJNA 1XT9B 2DYOA 2I1JA 2V1YA 2BWFA 3N3KB 1WF9A 4E71A 3WA0A 5CTRC 3SDLC 1M94A 2KJRA 1Q0WB 1LQBA 2LASA 5L95C 2FIFA 4HDOA 4BOZB 3MJWA 3ZUNA 2NVUI 2DAJA 4K7SA 2L0FA 3DPDA 1V9JA 3A4SC 5FR6A 2NBVB 4AJYB 4BOSC 4DK5A 4EOYA 3KUCB 3QCAA 4ANWA 3QHTA 3TBLD 2DHZA 5DPTA 4LCDE 2KX0A 4FHKA 2D11A 5JHAA 1YQBA 4IM3A 3B08A 3W1SA 2NS5A 2O6VB 4AP4C 2L0TA 2BKRB 4F1SA 2C7NB 2DZIA 4FJYA 2AL6A 2GBMA 4PYZA 4GMVA 1KJTA 2C60A 2HE7A 4AUQC 1TZ1A 4PYUA 3ZTDA 2N9PC 2MRPA 1E7UA 1S1QB 2JUOA 1WZ0A 3IBEA 4NQKE 4NY0A 4XC2A 4AWJA 2C9WB 2KDFB 4N9F4 2D07B 4MELA 2B3AA 2K8CA 1L7YA 1PQSA 2ASQA 3RYTA 2GMIC 4W9JA 2PE6B 1P1AA 3L13A 1K8RB 5AEKB 2LVPA 2WYQA 4GGQA 3K9PB 2M0XA 4XX5A 4DHJB 3VUWA 4BFRA 2A4ZA 2MX2A 4MH0E 2A5UA 1ZGUB 3ZRFA 5J2RA 1IPGA 3UQAA 1GJZA 3VTVA 5HKHA 2D3GA 4LJOB 3T8MA 3A33B 3QC8B 5J18A 1X1MA 3H9DA 1C1YB 2IO3B 2PEAA 3BY4B 1J8CA 1XD3B 3AULA 2MQJA 4GDKB 4RM8A 4HVBA 4CHKA 2YVCA 5D94A 4FULA 4W9EA 3RT3B 1E7VA 3R3MA 2GOWA 3ZO5B 5C23A 4EUTA 1P9DU 2PJHA 2RGFA 2GBKA 4TQ1A 2LXCA 2K8BA 4GU2A 2BPSA 2K1FA 3PRPB 3ZDTA 3U30A 4IWQA 3VAWA 3ZNHB 4ANUA 5D6JB 1UBIA 2KDBA 3DQVA 3TCAA 1UD7A 1WRDB 3DVNU 4ASWC 2O2VA 4HK2A 4FLHA 4KZ0A 4MJSB 2R2QA 4DBGA 3CSFA 4W9GA 1WMHB 5IA7A 4I6PA 1WE6A 4BKGA 2KC1A 3IFWB 4KIKB 3M95A 3ZVVA 4BKTA 3CSTA 2WDTB 1UZXB 4MGIE 3RULA 3R66C 3KYCD 3WIMA 1WIAA 4EZLA 3AXCA 3HK0A 3UIPB 1S3SG 3UINB 2KJHB 3JW0X 3HHMA 3ZNID 2JF5A 3A1QB 4YL8A 2ZJDA 2KMAA 3PLUA 4BKSD 3QIJA 3DBLI 3ZDMC 1E8ZA 1ISNA 1V80A 2DENB 1V49A 2JZ3B 2LRWA 2KJ6A 3H1UA 3TL5A 4KSLC 3UQBA 4JLCA 2K39A 5D7GA 1WR6E 4ZYNA 4K7WA 2BWES 2CS4A 1NDDA 2RSUA 2RPQA 1KLVA 2MSED 4NAWB 3DBHI 2MP2A 2G45B 2KFKA 3HM3A 1ZW7A 2PPHA 2KO3A 1I35A 2IYDB 1LXDA 4HPMB 4CO7A 3Q3FA 2MBHA 3JVZX 2K6DB 2WX1A 4PS7A 1MG8A 3VUXA 2CKHB 3DBSA 3O65B 2FCSA 1H8CA 1GC6A 5L83A 2EMSA 2JXXA 1BT0A 1Y8RC 2HJ8A 1LFDA 3NOBA 4HJKA 5KHQA 1Q1OA 3DVGY 2D10A 2KTRA 4II2B 4WWNA 2KX3A 4I6LB 4IWPA 1F9JA 1WGGA 2LXAA 1V5TA 4EEWA 1TTNA 4A20A 2XK5B 2MBBB 4GOCA 5E6NA 4URKA 4P7IA 4FJVB 4KDIC 4XZ4A 1D3ZA 2DX5B 4E74A
chains in the Genus database with same CATH superfamily
2FCNA 4RCOA 4W9LA 4QAYA 2G3QB 4W9KA 2WX0A 4CYEA 2DZJA 1L6VA 4YTMB 5IAAC 1EWCA 2YEPF 3I57A 3H7SA 4IC7B 3KQ4A 1WM3A 2DZMA 2BS2B 2V4LA 1YX5B 3VH3B 1N5WA 4G0NB 5CHFA 4KX6B 2G9HD 1XCTL 3NZ3A 1YN3A 2AQ2B 3BYYB 1WXMA 2INNE 1I42A 1EO6A 4L2YA 3NHEB 2IO2B 3P4RB 2FCQA 2KD0A 2KKCA 2BF8B 3OG5A 1WFYA 2M0AA 3ZNZB 3SD5A 3A4RA 2LGDA 3L16A 1P3QU 2JVCA 1SSNA 2FE8A 3U52E 3A9JB 2IY1B 2KDEB 4BBNC 2CU3A 2LVQA 1Z2MA 3DVNV 1ZXIA 3M63B 4MJSA 1WMHA 3WAPA 2BYVE 1L0XB 2W3RA 3EECA 4KIKA 3PREA 1V86A 1UUPA 2UYZB 2CHZA 3NVWA 3VHTC 2QC8A 2MH7A 1I7HA 1ET9A 3BK1A 4XGAB 2KWCA 2MP2B 2I1KA 4TQ0A 3RNCC 1GB1A 4YTPB 1NBFC 5IOIA 5AZFA 1RFAA 2RMMA 3L0WB 1WSPA 3Q3NC 4AQ7A 4IM0A 1HXYD 2CU1A 4NQLB 1VRAB 4JE3B 4KZCA 1SF0A 4IUMB 1MJDA 3NY5A 1XCQL 4ZRJA 3H7PA 3U4EG 2Z8LA 3SHQA 5LXHA 2OJRA 1JROA 1BMLC 3Q8BA 4OVZA 4RM9A 2LUMA 4USAA 1MFWA 3U7ZA 2EMTA 3ZNGC 2ZVNA 2N9XA 1WJ4A 3QAQA 3T3NA 3QWZB 3VR9B 2MBQA 2V3SA 2L3ZA 2XK5A 3TEWA 2QMTA 3RFZB 3AE8B 2RD0A 3MJ5A 1WI0A 2INDC 1RYJA 2DYMA 4HWIB 4ICUA 4TV3A 3TJPA 2D2QA 5BYQA 3KWVA 1V1PA 1C4CA 1WXSA 1WZ3A 3I3TB 1UNSA 1HQRD 1WGYA 3W9CB 1YIWA 1PGBA 1K52A 4UDUC 1WJNA 1KM7A 1J7AA 3AI5A 1JALA 1E8WA 2MJ3A 2RPVA 1KLUD 2BTEA 4MACA 3RMKC 3AM9A 1WY8A 2JX5A 2G4SA 1YJ1A 4J3OD 4MGZE 1TS3A 4GDLB 1XO3A 5TR5A 3FILB 3C0RB 3V6CB 3P2BA 3SU8X 3VVWB 1L2NA 3Q8EA 3PTFC 2WDQB 1U4AA 2KLGA 4FHJA 2KK8A 5CHVC 2ZPYA 4MEMA 1GG3A 4GN1A 4ZRIA 3A9KB 1E7PB 1WGRA 2DYBA 2QDFA 3OAWA 4IWOA 4HRSA 2ZPNA 2Z0DB 3H6NA 5HI1A 2Y5BB 4KKIA 4WAFA 1SXTA 2LWPA 1KOTA 3ZKJC 2LI5A 4NNJB 2KHWB 3LJ3A 2V0GA 2W9NA 1PFDA 4GIVA 4MT5A 2HD5B 1ZKHA 3Q69A 1E90A 2FAZA 1G6JA 1QOBA 3EHVA 1T3QA 2N7DA 2WP9B 4EKUA 1F2RC 3W1SC 4L23A 2V4IB 2KLCA 2NTTA 1SE9A 1BXTA 5E6PA 3NVYA 4MDKE 3UF8A 4ARIA 1WYGA 4HPPA 3WCQA 1RAXA 4WJNA 2DYOA 2VZKD 2V3NA 5FK9C 3PZ8A 3MC8A 4HDOA 3ZUNA 2NVUI 2GI9A 4K7SA 3A4SC 5HHDG 4R3DA 2DHZA 4YSYB 2X38A 4A55A 5D3DA 3AH7A 2H89B 2PMVA 2NS5A 5BYSA 1V8CA 1FXAA 2C7NB 1QKZA 1A70A 5JXVA 2HE7A 4M01A 1KH0A 4AWJA 2JUOA 1WZ0A 2C9WB 1KRHA 3ETRA 2K8CA 4ZHOA 1JQ4A 4W9JA 2PE6B 1AYFA 1FPYA 5AEKB 2LVPA 2WYQA 2LMCA 2BS3B 3K9PB 1ZOYB 2M0XA 3N1YC 4DHJB 3GE3C 2MX2A 4MH0E 5FKAC 5J2RA 1E0ZA 2WXIA 3T8MA 4ACFA 3QC8B 2X8XX 1VDVA 2PEAA 3BY4B 1J8CA 4HVBA 2YVCA 2UU7A 3RT3B 3R3MA 1TKEA 4A8XC 4EUTA 2PJHA 4TQ1A 2LXCA 3PRPB 2K1FA 2K9XA 5AUKA 4IWQA 5D6JB 3TCAA 4DBGA 1TZOA 2O2VA 4MJSB 4US9A 2QILA 2PVGC 1WMHB 3MFGA 2PLPA 4O1NA 3P63A 4KIKB 3M95A 4ITKA 3ZVVA 2WDTB 2LFIA 3KYCD 4BZAA 3ZNID 3A1QB 2WQYB 3AE6B 3QIJA 4RF0A 2DENB 1V49A 2LRWA 4KSLC 4JLCA 1ET6A 1D4BA 1QLBB 4BAXA 5LNK1 2RSUA 3AE5B 4B0EA 2LHDA 2MP2A 1UGJA 2KO3A 1R4MB 3ZJUA 5G5HA 1JWSD 4CO7A 2K6DB 2WX1A 3VUXA 1MG8A 3AEAB 3DBSA 2L32A 3O65B 1GC6A 2EMSA 2KMMA 1LFDA 5KHQA 5E6JA 3RNEC 2D10A 2INCC 1VZ8A 2KX3A 4I6LB 4EEWA 4A20A 2XK5B 5E6NA 3TEYA 1YOVB 4FJVB 2WXFA 2DX5B 4E74A 3W1YA 4K7UA 5EE0A 3RNFC 3AE3B 2AWTA 2WLBA 3RUIB 3ZQ4A 1GNUA 1HE8A 2D5GA 2INPE 1SJHD 2SEBD 2C5LC 1C79A 4NJCA 2LEKA 2ZW0A 3B0AA 2KVRA 3I9V1 2O6VA 3ENEA 4DHZB 4W9HA 1XEEA 2HJ1A 3PO0A 4YSZB 4LNIA 4C00A 2NR2A 2IZVB 4RGMA 1N63A 3EUB2 3BWUD 1VCBA 1EWYC 1MG4A 3RCZA 2IPKD 4JGHB 3PRMB 3KUDB 2IY0B 3HRDD 4K81A 2CHXA 1R4NI 2DWQA 1HTOA 2LGXA 3UGBB 1C78A 1YMHE 1OEYA 5IP4D 5GXGB 1GB4A 2W55A 4YT0B 3OLMD 2PTLA 3VFKA 1FXTB 2BYEA 4GDLA 5AZHA 3MHSD 3ZW3A 4RNAA 4DDID 1R4NB 2IDYA 2FNJB 4XYCA 5EE9A 2JYTA 3Q3MC 2C7HA 4RFBA 1IGDA 2IO0B 3TEXA 1ZDVA 4KDLB 4LDTB 1KF6B 4HKZE 1XXGA 2WXMA 3NS8A 2KFJA 4LNKA 3A9KA 3X0WA 1C77A 2KQ4X 2QEJC 1NVID 4LNFA 3FAHA 2BB5A 4W9IA 4WQOB 3ML9A 5KHOA 1QZEA 3Q3OC 1FCLA 3C8YA 2KQ7A 3IG3A 2KWDA 2DZKA 3AE7B 1YD8U 3R7RA 3V61A 3LB8C 4NZLB 1L4ZB 3ZXRA 1WR1A 4A3OA 1UF0A 4YSXB 2KWVB 4NAWA 1CQVA 1SIJA 3APDA 1D5XC 2MJDA 2N4FA 4LNNA 3MTNB 5AUIA 2N9KA 4B95A 4TSSA 3PHWB 4MGKE 1LO5D 4AS1A 1DGJA 3DHGC 1GUAB 2XEWA 1R7SA 5CX3A 2NCNA 3AE9B 2O6VD 4TUUA 2KN5A 5MPOA 2K8HA 1VZ6A 3E56A 4ZOHC 1RLFA 1J0GA 3ONSA 1TS2A 2BYFA 3PLVA 3R7QA 1WGDA 2DAFA 3AMZA 4F7ZA 3IVFA 3PVLA 2KXJA 4FBJB 1E8XA 2CJNA 4HCPB 2CJOA 1IYFA 4JQWC 5G2NA 4DWFA 2KNBA 3I63C 4WAAA 2L83A 3HIZA 2AEHA 3N1XC 4FN2A 4PS8A 4XWTA 2I2YA 3GE8C 2WXNA 3PS6A 3QA8A 1OQYA 3DCGA 3RNBC 1YQ4B 5LXIB 1Q10A 1DOXA 3T9LA 3QK0A 5EE3A 3W5UB 2JZPA 4B6WA 2V3PA 2GBRA 2QHOA 2O2VB 3KW5B 1B1ZA 1NYQA 4Q2JA 3IT4B 2WXLA 1VLBA 2W54A 3AECB 3WANA 3ALBA 1T0YA 3DDCB 2KANA 1IBXB 1C4AA 3VXWA 1QOAA 3VTWA 1FIQA 1OQQA 1NI3A 1OTRB 4FXCA 3N20C 4ANVA 5IN7A 3A1QA 4EZKA 2KWUB 1I4QA 1MHXA 4BVUC 1F2RI 4WURA 2WU2B 3PPAA 1NYRA 4JIOU 1TT5B 1UELA 1WJ6A 4BBNF 2JYEA 3APFA 1PYWD 1XLOA 1WH3A 2PVOD 2RDGA 4BKSA 1ZE3D 3JSVA 4IW0A 3RI7C 1YNTE 2KMCA 3VTUA 3EFUA 1C76A 4FADA 3WALA 2I1JA 2XN9C 1PGAA 3DBLB 5T8IA 2GB1A 3N3KB 4E71A 3WA0A 3SDLC 1Q0WB 2KJRA 2LASA 2KAJA 2FIFA 4BOZB 2J52A 3DPDA 1V9JA 3L4PA 3AB5A 1D5MC 3DBHB 3Q8FA 4BOSC 4DK5A 1MHHE 4JX1C 2WNMA 3QHTA 5DPTA 1F0ZA 1ESFA 4IM3A 2O6VB 4AP4C 2L0TA 4A9AA 4H2AA 4FJYA 3AEFB 2GBMA 1V1OA 4GMVA 1KJTA 2C60A 4C7YA 2N9PC 1E7UA 1S1QB 3IBEA 4DHJD 2IJ0A 4YWGG 2KDFB 4N9F4 2B3AA 4OZBA 4LK0M 1TIFA 2MEKA 2GMIC 4CQNA 4KKJA 1K8RB 1J7CA 4GGQA 2KVZA 4XX5A 4BFRA 5H8YE 3BK2A 2A5UA 3I5JC 2I38A 2Y3AA 1JW9D 3SFDB 3UQAA 5HKHA 2D3GA 3DHHC 5I4DA 2VH1A 1X1MA 3E9SA 2IO3B 3AULA 2MQJA 4GDKB 1EM7A 2QSDA 4RM8A 2GOWA 2KACA 3ZO5B 2RGFA 2GBKA 2K8BA 2Y5CA 3U30A 2ON8A 4ANUA 2KDBA 1UD7A 3HVZA 2FUG1 2R2QA 3BZDB 2W3SA 3IFWB 1P7EA 1UZXB 2E6XA 1PGXA 1PDXA 3WIMA 3HVDA 3AXCA 3HK0A 1S3SG 3HHMA 4YL8A 2KMAA 4BKSD 1E10A 2VH2A 1ISNA 2KJ6A 2JZ3B 3TL5A 3IXSA 1UWXA 5D7GA 1WR6E 1SB3C 2EKIA 1NDDA 4NAMA 2RPQA 1C9FA 3IAS1 4NAWB 2G45B 3HM3A 4HPMB 1JMLA 2CKHB 2K22A 1TKYA 4M0WA 3DWMA 4WWNA 1F9JA 1WGGA 1TTNA 4XE0A 4GOCA 4URKA 4P7IA 3TEZA 4XZ4A 2GBJA 2WXPA 4GXBA 5HFYA 4NJ6A 3U7DA 2AX5A 2ZNVB 1MVKA 4OHJA 5JHBA 3CMMB 2WXOA 1QOFA 2N1VA 3MHZA 2EELA 4IM2A 2HTME 2JRIB 2N9EB 1Q5WB 5CHWA 1HTQA 2KDMA 2WXHA 2N7EA 2EKEC 2L8JA 1EF1A 1DOIA 2JU6X 4C4VB 4WWPA 4JL9A 2BYTA 3N32A 3OJ4B 3SR6A 1VR9A 2LRUA 3K9OB 1HZ5A 1AWDA 3VH4B 1EF5A 1HZ6A 2L76A 2HTHA 4WWOA 1N62A 2K25A 2FUHB 1SE4A 1FNUA 1FO4A 4P1CC 3PSEB 3DOWA 1F52A 1L5PA 4MSQB 2MBEA 1WYWB 4WIPA 2N1WA 1GPXA 3KLSX 3IT6B 2FCMA 1V6EA 4P6VF 2C7MB 1K50A 2MA9B 5EE1A 1MI0A 4LDTD 2RR9A 3LYYA 2YLMA 1EUVB 2WDRB 4TKNA 1E8YA 4PS3A 3KYDD 4ICVA 1V5OA 4N6EB 1MPEA 3SEBA 2KN4A 1TS5A 1R4MI 1JWMD 2JQRB 3VRAB 4HROA 1IBXA 1WM2A 3WAMA 2RDHA 2J4XA 4II3B 4E3CA 2LGIA 1CK1A 4TMAB 1WX7A 4OZCA 3T3OA 3URYA 2DLBA 5BYRA 1SEBD 4AJWA 2JZZA 1YJJA 3EGRA 3JSVB 5G55A 2LJ5A 3ZJVA 2TSSA 4NPNA 4X57B 3Q2AC 2BKFA 3RD2A 1SIFA 2ZCBA 3TSSA 1OQRA 4ARCA 1H4RA 2ZNVC 3KH0A 2GBNA 2KQSA 1ZPSA 4OZAA 4EE2A 1LM8B 5BMIA 5DPRA 2M17A 2WXKA 1QF6A 1QQRA 2MHJA 3QJZA 3O13A 4J6IA 4K1RB 3V60A 3PHXB 1SE2A 3MC0B 2J0MA 2J0JA 2KDIA 3KUZA 1CJEA 1XQQA 3GZNB 1K53A 2YEPB 5DPWA 4HXDA 1QOGA 1M4VA 3AU5A 3DBRB 2JRHA 2D3CA 2L05A 4ZRPA 2ICIA 1FXIA 2NPTA 2W82A 1VD2A 4KGRA 3NS1A 1STEA 3AU4A 2G4DB 3Q14C 3N30A 3OJ3A 1V2YA 3R2TA 2BBCA 4OW0A 2Q5WD 3ZTCA 1YN5A 2L7RA 3KVFB 1P98A 4DXFA 1V81A 3R8BA 1WE7A 3GOEA 2QCZA 4YTNB 3GB1A 2BVCA 4G3XB 2BQQA 5JZEB 4G50A 3L17A 4GDKA 3U2SC 2VRRB 3FKYA 2WS3B 4IG7B 1ENFA 3AEGB 2JPHA 4A3PA 3PGEA 2MWSB 3L10B 2QJLA 1KTKA 2DBYA 3TMPB 1WX9A 3RZWC 3ZGZA 2N9LA 3N1ZC 1T6BX 1FNVA 1RFKA 3NZSA 3APCA 3BVZA 2ONQA 5DCNA 1I4GA 4IDIA 4WJQA 3AN1A 2AQ1B 1XLQA 4MGYE 1JWUD 1T0RC 3NRZA 2Z0EB 4M0WB 3DHIC 1DYQA 4KV2A 1ZUD2 3BYTB 4PK1A 4MM3B 4GB9A 1J19A 1UBQA 3PV1A 3BINA 5BO4B 4WQMA 5C1ZA 1B9RA 1P7FA 3PT2B 4ZRQA 1KFYB 2V1YA 2BWFA 1WF9A 5CTRC 4RGNA 1FNWA 1M94A 1LQBA 5BMHA 2DAJA 2J53A 2L0FA 2NBVB 2QIEB 4EOYA 2JXTA 3KUCB 4REZA 3QCAA 1J7BA 3TBLD 3AE2B 2G1EA 2D11A 5JHAA 3B08A 1BUIC 2Y5PA 2N7JA 2AL6A 4PYZA 3UI3A 3ZTDA 1N6ZA 4XC2A 4NQKE 1LGRA 4DQOC 5FR3A 2SAKA 1L7YA 2IGDA 4ZHPA 3RYTA 2LHEA 2R61A 4DXGA 3AE4B 4C4VA 3J9CA 3VUWA 1CZPA 1ZGUB 1JRPA 1GJZA 3VTVA 1TKGA 3P4SB 3CIRB 4LJOB 1E6EB 3A33B 5J18A 3H9DA 1FRDA 3NVVA 1XD3B 2XNAC 2DNFA 4CHKA 5D94A 1E7VA 4RGOS 2BS4B 4GU2A 2BPSA 3LXFA 3V3XA 3ZNHB 4ASWC 3DVNU 4HK2A 4FLHA 4WWMA 1ROEA 4W9GA 4IOIE 5IA7A 4I6PA 1FMAD 3RPFC 5IO9A 4LTUA 3CSTA 3RULA 2K0PA 3R66C 4EZLA 3UINB 1JCKB 3JW0X 2PW9A 2JF5A 2WDVB 1OFFA 2ZJDA 1TY2A 2M19A 1GAQB 1EU3A 3DBLI 4RH6A 4ZYNA 2BWES 3DBHI 2BT6A 5HG2A 2KFKA 2PPHA 1I35A 2IYDB 3Q3FA 2MBHA 3P42A 3MC9A 2WXJA 2JXXA 1BT0A 2HJ8A 1FEHA 3NOBA 4RF1A 1Q1OA 5C2TB 4MH8A 2KTRA 3TUOA 4IWPA 1V5TA 1UWMA 1XLNA 2MBBB 4B0MA 3Q6BA 1D3ZA 3ZXVA 1F1HA 2NBWB 2JWUA 4WJOA 2LUEA 1Y56A 1P0RA 2JY6A 1TYGB 2UWQA 2LVOA 2NPTB 3TIXA 2HDEA 3EFCA 3V62A 4DHZE 3RNAC 2AL3A 5JH5C 2L00B 4I6NB 1SGHA 3IAM1 1Z5SB 1ZDXA 4M8MA 2BB6A 4W9CA 2KTFA 5C3JB 4YXDB 4K3BA 2JT4B 4HJGE 1WWTA 2PIAA 3V6EB 2M56B 4HEA1 1QT9A 4C7ZA 1C4PA 3D32A 2BGFA 3U8ZA 1HA5A 2MCNB 3JYUA 4EZJA 5J17A 5E6OA 2AYOB 4MSMB 3ZRCA 1AARA 2L1AA 2WXQA 3GS2A 2IO1B 2M8SA 1FFUA 1I4RA 3S2AA 3Q8AA 4W9DA 2MBOA 2IBIB 1JWBD 2ZEQA 4M00A 4KSKC 3QX1A 3PRZA 4ZRKA 2J7QB 3ZIMA 3PZDA 4KVGB 2LGYA 2LD9A 3P4QB 1WGHA 1VJKA 4W9FA 2OOBB 2LZ6A 4M02A 3RNGC 2NBUA 2N0SB 2KC2A 3IHPC 3B2FA 2IGGA 1NI2A 4XDCA 1SE3A 3ML8A 2M1MA 3BVGA 3R2IA 2MLBA 3M62B 4K3CA 3QARA 4HCNB 4HDQA 4ZYSA 3Q3JA 1ZXHA 2CHWA 3ECIA 1N61A 1OGWA 4NJ7A 3RN9C 3FC4A 5DPSA 4XDDA 1C3TA 3QQ8B 4US8A 1JRUA 2XBBC 1OEYJ 4M8NA 1SBBB 1TBEA 1NENB 4MM3A 5G5GA 1TJEA 2KOXA 1A5RA 2RDBC 4EFOA 3HUIA 4GLSC 1WRIA 1UGMA 5D3IB 1AW7A 3M3JA 1TS4A 3P1MA 1WXAA 1WXQA 1K51A 2J0KA 3LDZE 2Z59B 4HLEA 3VDZA 3Q8CA 2NMQA 2WXRA 5D2MB 3DVGX 1AN8A 3ZLZA 4L1BA 1QILA 3AEBB 3EC8A 1ACCA 1L0YB 2M4NA 4C80A 4DDGD 2ACZB 2K6QA 3N9YC 4OVVA 1RRBA 3VR8B 3OWEB 1PUTA 4LJPB 1XF5L 1HEZE 2CR5A 2WWZA 4G11A 3DWGC 1D5ZC 1GC7A 2REXA 4PT5A 1T0QC 3CWIA 4XWWA 3X23A 1N5XA 4KGSA 3HM6X 1IP9A 3BVMA 2IGHA 3AE1B 4RMAA 4DXAB 5GMVA 2H88B 2D3BA 3ABVB 2ZVOA 5AZGA 2PE9A 3SFEB 2K3UA 3NZUA 2K5PA 2JWZA 4S17A 4B9KA 3B1LX 1CMXB 4OVUA 3CF6E 1V97A 2KZRA 2FBWB 3EA6A 1YN4A 1FM0D 5EDSA 2FIDA 2ZW1A 3UIOB 1WXVA 3VQIA 1NEKB 3MP9A 3RZFA 4WH4A 4KGTA 2ZCCA 3L08A 4WJPA 1FRRA 1VZ7A 2OHFA 2R2OA 3A9JA 3L54A 1TGZB 4ANXA 2WGSA 3KWLA 2KFKB 4F8CB 4FA6A 1YJIA 3VUYA 4AOFA 3WAOA 1UH6A 2KT7A 4FJZA 2KYWA 1WGKA 1FCCC 2MW5A 2ZZPB 5LLIA 1E5WA 1WJUA 1WX8A 4HPLB 3GZNI 1YX6B 2E3TA 2J42A 1I4HA 1IUEA 2GRIA 2KTRB 3NUHB 3H7PB 4C56C 3DBRI 4GSWA 4N58A 1N60A 4IKGA 1L6UA 1L0VB 1SJED 3BIID 4S0RA 4ZDVA 1I4PA 1XT9B 2LGSA 1D6EC 2WXGA 5H92C 4JWUC 5IKCM 5L95C 3MJWA 5FR6A 4AJYB 4ANWA 2VZKB 4LCDE 2KX0A 4FHKA 1YQBA 4N59A 3W1SA 2BKRB 4F1SA 2DZIA 2OEDA 4HKQA 4A90A 4AUQC 1TZ1A 4PYUA 4NY0A 1GOZA 2MRPA 2LJIA 4JPSA 2L52A 1V1PB 1EU4A 2MJEA 2WHIA 2D07B 4MELA 1PQSA 2ASQA 3B9JA 2B76B 1P1AA 2V9HA 3L13A 3W2DA 2A4ZA 3ZRFA 1YQ3B 4P16A 1IPGA 1FD6A 2BW2A 2PKOA 1L4DB 5BMGA 1C1YB 1XLPA 1T0SC 1IGCA 3AEEB 2OJWA 4FULA 4W9EA 3NG0A 2WU5B 3AEDB 1F77A 5C23A 1P9DU 1JWAD 3ZDTA 3VAWA 1UBIA 3DQVA 1TY0A 1WRDB 4KZ0A 3CSFA 2AQ3B 1ZP0B 2D3AA 3PZ7A 3B2GA 3GP7A 4D2KA 4JWSC 1WE6A 1E9MA 3VRBB 4BKGA 2KC1A 3W5VB 1T5XD 3FILA 4BKTA 3V05A 4MGIE 1WIAA 3UIPB 1FFVA 2KJHB 3AV8A 3PLUA 3ZDMC 1E8ZA 1V80A 2GLSA 3H1UA 3UQBA 2K39A 1RWSA 1RM6C 4K7WA 1KLGD 2CS4A 1I4XA 1DOYA 1KLVA 2MSED 3NVZA 3ZYYX 1ZW7A 3H8HA 3NJTA 4LLGM 1LXDA 4RGTA 3JVZX 4PS7A 2FCSA 1H8CA 5L83A 3C19A 1Y8RC 2NTSA 4HJKA 4P1BC 5TSSA 3DVGY 4A6QA 3ZJTA 4II2B 2LXAA 3P4PB 2JSVX 4LNOA 4KDIC
chains in the Genus database with same CATH topology
2FCNA 2GBJA 4GXBA 3W1YA 4K7UA 4W9LA 2NBWB 2G3QB 2AWTA 4NJ6A 2WX0A 4W9KA 3U7DA 4CYEA 2DZJA 3RUIB 4WJOA 1GNUA 1HE8A 2LUEA 2ZNVB 5IAAC 1P0RA 2JY6A 2UWQA 2LVOA 2NPTB 5JHBA 3CMMB 3TIXA 2C5LC 2N1VA 4IM2A 3V62A 3H7SA 2JRIB 2N9EB 4DHZE 1Q5WB 4IC7B 5CHWA 1WM3A 2DZMA 3B0AA 2AL3A 5JH5C 2KVRA 2L00B 4I6NB 1SGHA 2O6VA 1Z5SB 2N7EA 4M8MA 3ENEA 2EKEC 2L8JA 2V4LA 1EF1A 2KTFA 4W9CA 4DHZB 4W9HA 1YX5B 4WWPA 4JL9A 2JT4B 3VH3B 3N32A 3OJ4B 3V6EB 4G0NB 5CHFA 2NR2A 2IZVB 2LRUA 3D32A 3K9OB 1VCBA 2BGFA 3RCZA 3VH4B 4JGHB 1EF5A 3U8ZA 2L76A 3PRMB 2HTHA 4WWOA 3KUDB 2IY0B 3JYUA 2MCNB 4EZJA 4K81A 5E6OA 2CHXA 2AYOB 1WXMA 2K25A 1R4NI 2FUHB 5J17A 4MSMB 1I42A 3ZRCA 1EO6A 3PSEB 2LGXA 3DOWA 3UGBB 1AARA 4MSQB 2MBEA 1OEYA 3NHEB 2IO1B 1WYWB 2M8SA 2IO2B 2N1WA 3S2AA 2FCQA 4W9DA 2KD0A 2KKCA 2BF8B 1V6EA 2FCMA 3OLMD 3VFKA 2C7MB 2IBIB 2MBOA 1FXTB 2BYEA 2ZEQA 1WFYA 2MA9B 4GDLA 5AZHA 4KSKC 2RR9A 4LDTD 2YLMA 1EUVB 3MHSD 3ZW3A 3QX1A 4TKNA 3PRZA 1E8YA 4PS3A 4ZRKA 4DDID 3KYDD 2J7QB 3SD5A 3PZDA 3ZNZB 3ZIMA 4ICVA 1V5OA 3A4RA 2FNJB 2LGDA 3L16A 1P3QU 2JVCA 4KVGB 2C7HA 3A9JB 2IY1B 2IO0B 2KDEB 1R4MI 2LD9A 2LGYA 2LVQA 1Z2MA 4BBNC 1WGHA 4KDLB 3DVNV 3M63B 4LDTB 4MJSA 1WM2A 4W9FA 1WMHA 2OOBB 3NS8A 3WAMA 2KFJA 3WAPA 3A9KA 3X0WA 2BYVE 2LZ6A 3EECA 4II3B 2NBUA 3PREA 2KC2A 3IHPC 4KIKA 4E3CA 1V86A 2UYZB 4W9IA 2CHZA 4WQOB 1NI2A 3ML9A 1WX7A 5KHOA 1QZEA 3VHTC 3ML8A 2M1MA 2KQ7A 3IG3A 2MLBA 3M62B 2JZZA 2KWCA 2MP2B 2I1KA 4AJWA 4TQ0A 1NBFC 3QARA 4HCNB 3JSVB 4HDQA 2DZKA 5AZFA 1RFAA 3Q3JA 3L0WB 2LJ5A 5G55A 1YD8U 3R7RA 2CHWA 3ECIA 3V61A 1OGWA 4NJ7A 4IM0A 4NPNA 4X57B 2CU1A 4NQLB 2BKFA 1WR1A 3RD2A 5DPSA 1SIFA 4A3OA 1C3TA 4KZCA 2ZCBA 2KWVB 3QQ8B 4IUMB 4NAWA 3NY5A 1JRUA 2XBBC 1OEYJ 3APDA 4M8NA 2N4FA 1H4RA 1TBEA 3MTNB 2ZNVC 3KH0A 4ZRJA 2GBNA 3H7PA 4MM3A 2KQSA 4B95A 1LM8B 3PHWB 2KOXA 1A5RA 3SHQA 4EFOA 5LXHA 2OJRA 4MGKE 5DPRA 2M17A 1UGMA 4RM9A 1GUAB 2XEWA 5CX3A 2EMTA 2NCNA 3ZNGC 2ZVNA 2N9XA 3M3JA 3QJZA 4J6IA 1WXAA 4K1RB 3V60A 1WJ4A 3PHXB 3QAQA 2J0MA 2J0JA 2KDIA 2O6VD 3QWZB 2J0KA 3KUZA 2Z59B 3LDZE 4HLEA 1XQQA 3VDZA 4TUUA 2KN5A 2K8HA 2MBQA 2V3SA 2L3ZA 2XK5A 5DPWA 5D2MB 4HXDA 1RLFA 1J0GA 3ONSA 2BYFA 3PLVA 3DVGX 3R7QA 1WGDA 3AU5A 3ZLZA 2RD0A 2JRHA 1WI0A 2DAFA 2DYMA 3EC8A 4HWIB 4ICUA 2L05A 3IVFA 4TV3A 2D2QA 2M4NA 3TJPA 4F7ZA 3PVLA 2KXJA 4DDGD 2NPTA 4FBJB 1E8XA 2K6QA 4OVVA 1VD2A 1RRBA 4HCPB 1IYFA 1WXSA 1WZ3A 3I3TB 3AU4A 1WGYA 4JQWC 2G4DB 5G2NA 4DWFA 2KNBA 4WAAA 4LJPB 3HIZA 2AEHA 1YIWA 3N30A 4FN2A 3OJ3A 4PS8A 1WJNA 1V2YA 1KM7A 3PS6A 3QA8A 1OQYA 2CR5A 3AI5A 3DCGA 2WWZA 4G11A 1E8WA 5LXIB 3T9LA 3ZTCA 1GC7A 2REXA 3QK0A 2L7RA 3KVFB 1P98A 1WY8A 1V81A 3X23A 1WE7A 2G4SA 1YJ1A 3GOEA 4B6WA 4MGZE 3HM6X 1IP9A 2GBRA 2QHOA 2O2VB 4G3XB 5JZEB 3KW5B 4RMAA 4DXAB 4GDLB 4G50A 3L17A 5GMVA 4GDKA 2VRRB 5TR5A 2ZVOA 4IG7B 2PE9A 5AZGA 3C0RB 3NZUA 2JWZA 4B9KA 2JPHA 3B1LX 3V6CB 3P2BA 3SU8X 3VVWB 1CMXB 4A3PA 3PGEA 1L2NA 4OVUA 3CF6E 3PTFC 2MWSB 1U4AA 2KZRA 2KLGA 4FHJA 2KK8A 5CHVC 3ALBA 1T0YA 2ZPYA 4MEMA 3DDCB 3L10B 3WANA 5EDSA 2FIDA 2KANA 1GG3A 4GN1A 4ZRIA 3UIOB 1WXVA 3VQIA 3VXWA 3TMPB 1WX9A 3RZFA 3A9KB 3RZWC 1WGRA 2DYBA 3VTWA 2ZCCA 3L08A 3OAWA 4IWOA 2ZPNA 2Z0DB 3H6NA 4WJPA 2Y5BB 3NZSA 1OTRB 3APCA 2R2OA 2LWPA 3A9JA 3L54A 1KOTA 1TGZB 4ANXA 3ZKJC 4ANVA 2LI5A 4NNJB 5DCNA 2KFKB 2KHWB 3A1QA 3LJ3A 4F8CB 4EZKA 4FA6A 2W9NA 4GIVA 2KWUB 3VUYA 2HD5B 1ZKHA 1E90A 4AOFA 4BVUC 3WAOA 1UH6A 3PPAA 4WJQA 2FAZA 4JIOU 1G6JA 1UELA 4FJZA 1WJ6A 4MGYE 4BBNF 3EHVA 2N7DA 2MW5A 2ZZPB 5LLIA 3APFA 1E5WA 1WJUA 1WX8A 4HPLB 4EKUA 1WH3A 3GZNI 1YX6B 2Z0EB 3W1SC 2KLCA 4M0WB 4BKSA 4KV2A 1SE9A 5E6PA 2KTRB 4MDKE 3UF8A 3H7PB 3JSVA 4IW0A 4GB9A 3DBRI 1J19A 1UBQA 3PV1A 4GSWA 3BINA 2KMCA 5BO4B 5C1ZA 4DHJD 3VTUA 3PT2B 3EFUA 1RAXA 4FADA 3WALA 4ZDVA 4WJNA 1XT9B 2DYOA 2I1JA 2V1YA 2BWFA 3N3KB 1WF9A 4E71A 3WA0A 5CTRC 3SDLC 1M94A 2KJRA 1Q0WB 1LQBA 2LASA 5L95C 2FIFA 4HDOA 4BOZB 3MJWA 3ZUNA 2NVUI 2DAJA 4K7SA 2L0FA 3DPDA 1V9JA 3A4SC 5FR6A 2NBVB 4AJYB 4BOSC 4DK5A 4EOYA 3KUCB 3QCAA 4ANWA 3QHTA 3TBLD 2DHZA 5DPTA 4LCDE 2KX0A 4FHKA 2D11A 5JHAA 1YQBA 4IM3A 3B08A 3W1SA 2NS5A 2O6VB 4AP4C 2L0TA 2BKRB 4F1SA 2C7NB 2DZIA 4FJYA 2AL6A 2GBMA 4PYZA 4GMVA 1KJTA 2C60A 2HE7A 4AUQC 1TZ1A 4PYUA 3ZTDA 2N9PC 2MRPA 1E7UA 1S1QB 2JUOA 1WZ0A 3IBEA 4NQKE 4NY0A 4XC2A 4AWJA 2C9WB 2KDFB 4N9F4 2D07B 4MELA 2B3AA 2K8CA 1L7YA 1PQSA 2ASQA 3RYTA 2GMIC 4W9JA 2PE6B 1P1AA 3L13A 1K8RB 5AEKB 2LVPA 2WYQA 4GGQA 3K9PB 2M0XA 4XX5A 4DHJB 3VUWA 4BFRA 2A4ZA 2MX2A 4MH0E 2A5UA 1ZGUB 3ZRFA 5J2RA 1IPGA 3UQAA 1GJZA 3VTVA 5HKHA 2D3GA 4LJOB 3T8MA 3A33B 3QC8B 5J18A 1X1MA 3H9DA 1C1YB 2IO3B 2PEAA 3BY4B 1J8CA 1XD3B 3AULA 2MQJA 4GDKB 4RM8A 4HVBA 4CHKA 2YVCA 5D94A 4FULA 4W9EA 3RT3B 1E7VA 3R3MA 2GOWA 3ZO5B 5C23A 4EUTA 1P9DU 2PJHA 2RGFA 2GBKA 4TQ1A 2LXCA 2K8BA 4GU2A 2BPSA 2K1FA 3PRPB 3ZDTA 3U30A 4IWQA 3VAWA 3ZNHB 4ANUA 5D6JB 1UBIA 2KDBA 3DQVA 3TCAA 1UD7A 1WRDB 3DVNU 4ASWC 2O2VA 4HK2A 4FLHA 4KZ0A 4MJSB 2R2QA 4DBGA 3CSFA 4W9GA 1WMHB 5IA7A 4I6PA 1WE6A 4BKGA 2KC1A 3IFWB 4KIKB 3M95A 3ZVVA 4BKTA 3CSTA 2WDTB 1UZXB 4MGIE 3RULA 3R66C 3KYCD 3WIMA 1WIAA 4EZLA 3AXCA 3HK0A 3UIPB 1S3SG 3UINB 2KJHB 3JW0X 3HHMA 3ZNID 2JF5A 3A1QB 4YL8A 2ZJDA 2KMAA 3PLUA 4BKSD 3QIJA 3DBLI 3ZDMC 1E8ZA 1ISNA 1V80A 2DENB 1V49A 2JZ3B 2LRWA 2KJ6A 3H1UA 3TL5A 4KSLC 3UQBA 4JLCA 2K39A 5D7GA 1WR6E 4ZYNA 4K7WA 2BWES 2CS4A 1NDDA 2RSUA 2RPQA 1KLVA 2MSED 4NAWB 3DBHI 2MP2A 2G45B 2KFKA 3HM3A 1ZW7A 2PPHA 2KO3A 1I35A 2IYDB 1LXDA 4HPMB 4CO7A 3Q3FA 2MBHA 3JVZX 2K6DB 2WX1A 4PS7A 1MG8A 3VUXA 2CKHB 3DBSA 3O65B 2FCSA 1H8CA 1GC6A 5L83A 2EMSA 2JXXA 1BT0A 1Y8RC 2HJ8A 1LFDA 3NOBA 4HJKA 5KHQA 1Q1OA 3DVGY 2D10A 2KTRA 4II2B 4WWNA 2KX3A 4I6LB 4IWPA 1F9JA 1WGGA 2LXAA 1V5TA 4EEWA 1TTNA 4A20A 2XK5B 2MBBB 4GOCA 5E6NA 4URKA 4P7IA 4FJVB 4KDIC 4XZ4A 1D3ZA 2DX5B 4E74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCN A;  2GBJ A;  4GXB A;  3W1Y A;  4K7U A;  4W9L A;  2NBW B;  2G3Q B;  2AWT A;  4NJ6 A;  2WX0 A;  4W9K A;  3U7D A;  4CYE A;  2DZJ A;  3RUI B;  4WJO A;  1GNU A;  1HE8 A;  2LUE A;  2ZNV B;  5IAA C;  1P0R A;  2JY6 A;  2UWQ A;  2LVO A;  2NPT B;  5JHB A;  3CMM B;  3TIX A;  2C5L C;  2N1V A;  4IM2 A;  3V62 A;  3H7S A;  2JRI B;  2N9E B;  4DHZ E;  1Q5W B;  4IC7 B;  5CHW A;  1WM3 A;  2DZM A;  3B0A A;  2AL3 A;  5JH5 C;  2KVR A;  2L00 B;  4I6N B;  1SGH A;  2O6V A;  1Z5S B;  2N7E A;  4M8M A;  3ENE A;  2EKE C;  2L8J A;  2V4L A;  1EF1 A;  2KTF A;  4W9C A;  4DHZ B;  4W9H A;  1YX5 B;  4WWP A;  4JL9 A;  2JT4 B;  3VH3 B;  3N32 A;  3OJ4 B;  3V6E B;  4G0N B;  5CHF A;  2NR2 A;  2IZV B;  2LRU A;  3D32 A;  3K9O B;  1VCB A;  2BGF A;  3RCZ A;  3VH4 B;  4JGH B;  1EF5 A;  3U8Z A;  2L76 A;  3PRM B;  2HTH A;  4WWO A;  3KUD B;  2IY0 B;  3JYU A;  2MCN B;  4EZJ A;  4K81 A;  5E6O A;  2CHX A;  2AYO B;  1WXM A;  2K25 A;  1R4N I;  2FUH B;  5J17 A;  4MSM B;  1I42 A;  3ZRC A;  1EO6 A;  3PSE B;  2LGX A;  3DOW A;  3UGB B;  1AAR A;  4MSQ B;  2MBE A;  1OEY A;  3NHE B;  2IO1 B;  1WYW B;  2M8S A;  2IO2 B;  2N1W A;  3S2A A;  2FCQ A;  4W9D A;  2KD0 A;  2KKC A;  2BF8 B;  1V6E A;  2FCM A;  3OLM D;  3VFK A;  2C7M B;  2IBI B;  2MBO A;  1FXT B;  2BYE A;  2ZEQ A;  1WFY A;  2MA9 B;  4GDL A;  5AZH A;  4KSK C;  2RR9 A;  4LDT D;  2YLM A;  1EUV B;  3MHS D;  3ZW3 A;  3QX1 A;  4TKN A;  3PRZ A;  1E8Y A;  4PS3 A;  4ZRK A;  4DDI D;  3KYD D;  2J7Q B;  3SD5 A;  3PZD A;  3ZNZ B;  3ZIM A;  4ICV A;  1V5O A;  3A4R A;  2FNJ B;  2LGD A;  3L16 A;  1P3Q U;  2JVC A;  4KVG B;  2C7H A;  3A9J B;  2IY1 B;  2IO0 B;  2KDE B;  1R4M I;  2LD9 A;  2LGY A;  2LVQ A;  1Z2M A;  4BBN C;  1WGH A;  4KDL B;  3DVN V;  3M63 B;  4LDT B;  4MJS A;  1WM2 A;  4W9F A;  1WMH A;  2OOB B;  3NS8 A;  3WAM A;  2KFJ A;  3WAP A;  3A9K A;  3X0W A;  2BYV E;  2LZ6 A;  3EEC A;  4II3 B;  2NBU A;  3PRE A;  2KC2 A;  3IHP C;  4KIK A;  4E3C A;  1V86 A;  2UYZ B;  4W9I A;  2CHZ A;  4WQO B;  1NI2 A;  3ML9 A;  1WX7 A;  5KHO A;  1QZE A;  3VHT C;  3ML8 A;  2M1M A;  2KQ7 A;  3IG3 A;  2MLB A;  3M62 B;  2JZZ A;  2KWC A;  2MP2 B;  2I1K A;  4AJW A;  4TQ0 A;  1NBF C;  3QAR A;  4HCN B;  3JSV B;  4HDQ A;  2DZK A;  5AZF A;  1RFA A;  3Q3J A;  3L0W B;  2LJ5 A;  5G55 A;  1YD8 U;  3R7R A;  2CHW A;  3ECI A;  3V61 A;  1OGW A;  4NJ7 A;  4IM0 A;  4NPN A;  4X57 B;  2CU1 A;  4NQL B;  2BKF A;  1WR1 A;  3RD2 A;  5DPS A;  1SIF A;  4A3O A;  1C3T A;  4KZC A;  2ZCB A;  2KWV B;  3QQ8 B;  4IUM B;  4NAW A;  3NY5 A;  1JRU A;  2XBB C;  1OEY J;  3APD A;  4M8N A;  2N4F A;  1H4R A;  1TBE A;  3MTN B;  2ZNV C;  3KH0 A;  4ZRJ A;  2GBN A;  3H7P A;  4MM3 A;  2KQS A;  4B95 A;  1LM8 B;  3PHW B;  2KOX A;  1A5R A;  3SHQ A;  4EFO A;  5LXH A;  2OJR A;  4MGK E;  5DPR A;  2M17 A;  1UGM A;  4RM9 A;  1GUA B;  2XEW A;  5CX3 A;  2EMT A;  2NCN A;  3ZNG C;  2ZVN A;  2N9X A;  3M3J A;  3QJZ A;  4J6I A;  1WXA A;  4K1R B;  3V60 A;  1WJ4 A;  3PHX B;  3QAQ A;  2J0M A;  2J0J A;  2KDI A;  2O6V D;  3QWZ B;  2J0K A;  3KUZ A;  2Z59 B;  3LDZ E;  4HLE A;  1XQQ A;  3VDZ A;  4TUU A;  2KN5 A;  2K8H A;  2MBQ A;  2V3S A;  2L3Z A;  2XK5 A;  5DPW A;  5D2M B;  4HXD A;  1RLF A;  1J0G A;  3ONS A;  2BYF A;  3PLV A;  3DVG X;  3R7Q A;  1WGD A;  3AU5 A;  3ZLZ A;  2RD0 A;  2JRH A;  1WI0 A;  2DAF A;  2DYM A;  3EC8 A;  4HWI B;  4ICU A;  2L05 A;  3IVF A;  4TV3 A;  2D2Q A;  2M4N A;  3TJP A;  4F7Z A;  3PVL A;  2KXJ A;  4DDG D;  2NPT A;  4FBJ B;  1E8X A;  2K6Q A;  4OVV A;  1VD2 A;  1RRB A;  4HCP B;  1IYF A;  1WXS A;  1WZ3 A;  3I3T B;  3AU4 A;  1WGY A;  4JQW C;  2G4D B;  5G2N A;  4DWF A;  2KNB A;  4WAA A;  4LJP B;  3HIZ A;  2AEH A;  1YIW A;  3N30 A;  4FN2 A;  3OJ3 A;  4PS8 A;  1WJN A;  1V2Y A;  1KM7 A;  3PS6 A;  3QA8 A;  1OQY A;  2CR5 A;  3AI5 A;  3DCG A;  2WWZ A;  4G11 A;  1E8W A;  5LXI B;  3T9L A;  3ZTC A;  1GC7 A;  2REX A;  3QK0 A;  2L7R A;  3KVF B;  1P98 A;  1WY8 A;  1V81 A;  3X23 A;  1WE7 A;  2G4S A;  1YJ1 A;  3GOE A;  4B6W A;  4MGZ E;  3HM6 X;  1IP9 A;  2GBR A;  2QHO A;  2O2V B;  4G3X B;  5JZE B;  3KW5 B;  4RMA A;  4DXA B;  4GDL B;  4G50 A;  3L17 A;  5GMV A;  4GDK A;  2VRR B;  5TR5 A;  2ZVO A;  4IG7 B;  2PE9 A;  5AZG A;  3C0R B;  3NZU A;  2JWZ A;  4B9K A;  2JPH A;  3B1L X;  3V6C B;  3P2B A;  3SU8 X;  3VVW B;  1CMX B;  4A3P A;  3PGE A;  1L2N A;  4OVU A;  3CF6 E;  3PTF C;  2MWS B;  1U4A A;  2KZR A;  2KLG A;  4FHJ A;  2KK8 A;  5CHV C;  3ALB A;  1T0Y A;  2ZPY A;  4MEM A;  3DDC B;  3L10 B;  3WAN A;  5EDS A;  2FID A;  2KAN A;  1GG3 A;  4GN1 A;  4ZRI A;  3UIO B;  1WXV A;  3VQI A;  3VXW A;  3TMP B;  1WX9 A;  3RZF A;  3A9K B;  3RZW C;  1WGR A;  2DYB A;  3VTW A;  2ZCC A;  3L08 A;  3OAW A;  4IWO A;  2ZPN A;  2Z0D B;  3H6N A;  4WJP A;  2Y5B B;  3NZS A;  1OTR B;  3APC A;  2R2O A;  2LWP A;  3A9J A;  3L54 A;  1KOT A;  1TGZ B;  4ANX A;  3ZKJ C;  4ANV A;  2LI5 A;  4NNJ B;  5DCN A;  2KFK B;  2KHW B;  3A1Q A;  3LJ3 A;  4F8C B;  4EZK A;  4FA6 A;  2W9N A;  4GIV A;  2KWU B;  3VUY A;  2HD5 B;  1ZKH A;  1E90 A;  4AOF A;  4BVU C;  3WAO A;  1UH6 A;  3PPA A;  4WJQ A;  2FAZ A;  4JIO U;  1G6J A;  1UEL A;  4FJZ A;  1WJ6 A;  4MGY E;  4BBN F;  3EHV A;  2N7D A;  2MW5 A;  2ZZP B;  5LLI A;  3APF A;  1E5W A;  1WJU A;  1WX8 A;  4HPL B;  4EKU A;  1WH3 A;  3GZN I;  1YX6 B;  2Z0E B;  3W1S C;  2KLC A;  4M0W B;  4BKS A;  4KV2 A;  1SE9 A;  5E6P A;  2KTR B;  4MDK E;  3UF8 A;  3H7P B;  3JSV A;  4IW0 A;  4GB9 A;  3DBR I;  1J19 A;  1UBQ A;  3PV1 A;  4GSW A;  3BIN A;  2KMC A;  5BO4 B;  5C1Z A;  4DHJ D;  3VTU A;  3PT2 B;  3EFU A;  1RAX A;  4FAD A;  3WAL A;  4ZDV A;  4WJN A;  1XT9 B;  2DYO A;  2I1J A;  2V1Y A;  2BWF A;  3N3K B;  1WF9 A;  4E71 A;  3WA0 A;  5CTR C;  3SDL C;  1M94 A;  2KJR A;  1Q0W B;  1LQB A;  2LAS A;  5L95 C;  2FIF A;  4HDO A;  4BOZ B;  3MJW A;  3ZUN A;  2NVU I;  2DAJ A;  4K7S A;  2L0F A;  3DPD A;  1V9J A;  3A4S C;  5FR6 A;  2NBV B;  4AJY B;  4BOS C;  4DK5 A;  4EOY A;  3KUC B;  3QCA A;  4ANW A;  3QHT A;  3TBL D;  2DHZ A;  5DPT A;  4LCD E;  2KX0 A;  4FHK A;  2D11 A;  5JHA A;  1YQB A;  4IM3 A;  3B08 A;  3W1S A;  2NS5 A;  2O6V B;  4AP4 C;  2L0T A;  2BKR B;  4F1S A;  2C7N B;  2DZI A;  4FJY A;  2AL6 A;  2GBM A;  4PYZ A;  4GMV A;  1KJT A;  2C60 A;  2HE7 A;  4AUQ C;  1TZ1 A;  4PYU A;  3ZTD A;  2N9P C;  2MRP A;  1E7U A;  1S1Q B;  2JUO A;  1WZ0 A;  3IBE A;  4NQK E;  4NY0 A;  4XC2 A;  4AWJ A;  2C9W B;  2KDF B;  4N9F 4;  2D07 B;  4MEL A;  2B3A A;  2K8C A;  1L7Y A;  1PQS A;  2ASQ A;  3RYT A;  2GMI C;  4W9J A;  2PE6 B;  1P1A A;  3L13 A;  1K8R B;  5AEK B;  2LVP A;  2WYQ A;  4GGQ A;  3K9P B;  2M0X A;  4XX5 A;  4DHJ B;  3VUW A;  4BFR A;  2A4Z A;  2MX2 A;  4MH0 E;  2A5U A;  1ZGU B;  3ZRF A;  5J2R A;  1IPG A;  3UQA A;  1GJZ A;  3VTV A;  5HKH A;  2D3G A;  4LJO B;  3T8M A;  3A33 B;  3QC8 B;  5J18 A;  1X1M A;  3H9D A;  1C1Y B;  2IO3 B;  2PEA A;  3BY4 B;  1J8C A;  1XD3 B;  3AUL A;  2MQJ A;  4GDK B;  4RM8 A;  4HVB A;  4CHK A;  2YVC A;  5D94 A;  4FUL A;  4W9E A;  3RT3 B;  1E7V A;  3R3M A;  2GOW A;  3ZO5 B;  5C23 A;  4EUT A;  1P9D U;  2PJH A;  2RGF A;  2GBK A;  4TQ1 A;  2LXC A;  2K8B A;  4GU2 A;  2BPS A;  2K1F A;  3PRP B;  3ZDT A;  3U30 A;  4IWQ A;  3VAW A;  3ZNH B;  4ANU A;  5D6J B;  1UBI A;  2KDB A;  3DQV A;  3TCA A;  1UD7 A;  1WRD B;  3DVN U;  4ASW C;  2O2V A;  4HK2 A;  4FLH A;  4KZ0 A;  4MJS B;  2R2Q A;  4DBG A;  3CSF A;  4W9G A;  1WMH B;  5IA7 A;  4I6P A;  1WE6 A;  4BKG A;  2KC1 A;  3IFW B;  4KIK B;  3M95 A;  3ZVV A;  4BKT A;  3CST A;  2WDT B;  1UZX B;  4MGI E;  3RUL A;  3R66 C;  3KYC D;  3WIM A;  1WIA A;  4EZL A;  3AXC A;  3HK0 A;  3UIP B;  1S3S G;  3UIN B;  2KJH B;  3JW0 X;  3HHM A;  3ZNI D;  2JF5 A;  3A1Q B;  4YL8 A;  2ZJD A;  2KMA A;  3PLU A;  4BKS D;  3QIJ A;  3DBL I;  3ZDM C;  1E8Z A;  1ISN A;  1V80 A;  2DEN B;  1V49 A;  2JZ3 B;  2LRW A;  2KJ6 A;  3H1U A;  3TL5 A;  4KSL C;  3UQB A;  4JLC A;  2K39 A;  5D7G A;  1WR6 E;  4ZYN A;  4K7W A;  2BWE S;  2CS4 A;  1NDD A;  2RSU A;  2RPQ A;  1KLV A;  2MSE D;  4NAW B;  3DBH I;  2MP2 A;  2G45 B;  2KFK A;  3HM3 A;  1ZW7 A;  2PPH A;  2KO3 A;  1I35 A;  2IYD B;  1LXD A;  4HPM B;  4CO7 A;  3Q3F A;  2MBH A;  3JVZ X;  2K6D B;  2WX1 A;  4PS7 A;  1MG8 A;  3VUX A;  2CKH B;  3DBS A;  3O65 B;  2FCS A;  1H8C A;  1GC6 A;  5L83 A;  2EMS A;  2JXX A;  1BT0 A;  1Y8R C;  2HJ8 A;  1LFD A;  3NOB A;  4HJK A;  5KHQ A;  1Q1O A;  3DVG Y;  2D10 A;  2KTR A;  4II2 B;  4WWN A;  2KX3 A;  4I6L B;  4IWP A;  1F9J A;  1WGG A;  2LXA A;  1V5T A;  4EEW A;  1TTN A;  4A20 A;  2XK5 B;  2MBB B;  4GOC A;  5E6N A;  4URK A;  4P7I A;  4FJV B;  4KDI C;  4XZ4 A;  1D3Z A;  2DX5 B;  4E74 A; 
#chains in the Genus database with same CATH topology
 2FCN A;  4RCO A;  4W9L A;  4QAY A;  2G3Q B;  4W9K A;  2WX0 A;  4CYE A;  2DZJ A;  1L6V A;  4YTM B;  5IAA C;  1EWC A;  2YEP F;  3I57 A;  3H7S A;  4IC7 B;  3KQ4 A;  1WM3 A;  2DZM A;  2BS2 B;  2V4L A;  1YX5 B;  3VH3 B;  1N5W A;  4G0N B;  5CHF A;  4KX6 B;  2G9H D;  1XCT L;  3NZ3 A;  1YN3 A;  2AQ2 B;  3BYY B;  1WXM A;  2INN E;  1I42 A;  1EO6 A;  4L2Y A;  3NHE B;  2IO2 B;  3P4R B;  2FCQ A;  2KD0 A;  2KKC A;  2BF8 B;  3OG5 A;  1WFY A;  2M0A A;  3ZNZ B;  3SD5 A;  3A4R A;  2LGD A;  3L16 A;  1P3Q U;  2JVC A;  1SSN A;  2FE8 A;  3U52 E;  3A9J B;  2IY1 B;  2KDE B;  4BBN C;  2CU3 A;  2LVQ A;  1Z2M A;  3DVN V;  1ZXI A;  3M63 B;  4MJS A;  1WMH A;  3WAP A;  2BYV E;  1L0X B;  2W3R A;  3EEC A;  4KIK A;  3PRE A;  1V86 A;  1UUP A;  2UYZ B;  2CHZ A;  3NVW A;  3VHT C;  2QC8 A;  2MH7 A;  1I7H A;  1ET9 A;  3BK1 A;  4XGA B;  2KWC A;  2MP2 B;  2I1K A;  4TQ0 A;  3RNC C;  1GB1 A;  4YTP B;  1NBF C;  5IOI A;  5AZF A;  1RFA A;  2RMM A;  3L0W B;  1WSP A;  3Q3N C;  4AQ7 A;  4IM0 A;  1HXY D;  2CU1 A;  4NQL B;  1VRA B;  4JE3 B;  4KZC A;  1SF0 A;  4IUM B;  1MJD A;  3NY5 A;  1XCQ L;  4ZRJ A;  3H7P A;  3U4E G;  2Z8L A;  3SHQ A;  5LXH A;  2OJR A;  1JRO A;  1BML C;  3Q8B A;  4OVZ A;  4RM9 A;  2LUM A;  4USA A;  1MFW A;  3U7Z A;  2EMT A;  3ZNG C;  2ZVN A;  2N9X A;  1WJ4 A;  3QAQ A;  3T3N A;  3QWZ B;  3VR9 B;  2MBQ A;  2V3S A;  2L3Z A;  2XK5 A;  3TEW A;  2QMT A;  3RFZ B;  3AE8 B;  2RD0 A;  3MJ5 A;  1WI0 A;  2IND C;  1RYJ A;  2DYM A;  4HWI B;  4ICU A;  4TV3 A;  3TJP A;  2D2Q A;  5BYQ A;  3KWV A;  1V1P A;  1C4C A;  1WXS A;  1WZ3 A;  3I3T B;  1UNS A;  1HQR D;  1WGY A;  3W9C B;  1YIW A;  1PGB A;  1K52 A;  4UDU C;  1WJN A;  1KM7 A;  1J7A A;  3AI5 A;  1JAL A;  1E8W A;  2MJ3 A;  2RPV A;  1KLU D;  2BTE A;  4MAC A;  3RMK C;  3AM9 A;  1WY8 A;  2JX5 A;  2G4S A;  1YJ1 A;  4J3O D;  4MGZ E;  1TS3 A;  4GDL B;  1XO3 A;  5TR5 A;  3FIL B;  3C0R B;  3V6C B;  3P2B A;  3SU8 X;  3VVW B;  1L2N A;  3Q8E A;  3PTF C;  2WDQ B;  1U4A A;  2KLG A;  4FHJ A;  2KK8 A;  5CHV C;  2ZPY A;  4MEM A;  1GG3 A;  4GN1 A;  4ZRI A;  3A9K B;  1E7P B;  1WGR A;  2DYB A;  2QDF A;  3OAW A;  4IWO A;  4HRS A;  2ZPN A;  2Z0D B;  3H6N A;  5HI1 A;  2Y5B B;  4KKI A;  4WAF A;  1SXT A;  2LWP A;  1KOT A;  3ZKJ C;  2LI5 A;  4NNJ B;  2KHW B;  3LJ3 A;  2V0G A;  2W9N A;  1PFD A;  4GIV A;  4MT5 A;  2HD5 B;  1ZKH A;  3Q69 A;  1E90 A;  2FAZ A;  1G6J A;  1QOB A;  3EHV A;  1T3Q A;  2N7D A;  2WP9 B;  4EKU A;  1F2R C;  3W1S C;  4L23 A;  2V4I B;  2KLC A;  2NTT A;  1SE9 A;  1BXT A;  5E6P A;  3NVY A;  4MDK E;  3UF8 A;  4ARI A;  1WYG A;  4HPP A;  3WCQ A;  1RAX A;  4WJN A;  2DYO A;  2VZK D;  2V3N A;  5FK9 C;  3PZ8 A;  3MC8 A;  4HDO A;  3ZUN A;  2NVU I;  2GI9 A;  4K7S A;  3A4S C;  5HHD G;  4R3D A;  2DHZ A;  4YSY B;  2X38 A;  4A55 A;  5D3D A;  3AH7 A;  2H89 B;  2PMV A;  2NS5 A;  5BYS A;  1V8C A;  1FXA A;  2C7N B;  1QKZ A;  1A70 A;  5JXV A;  2HE7 A;  4M01 A;  1KH0 A;  4AWJ A;  2JUO A;  1WZ0 A;  2C9W B;  1KRH A;  3ETR A;  2K8C A;  4ZHO A;  1JQ4 A;  4W9J A;  2PE6 B;  1AYF A;  1FPY A;  5AEK B;  2LVP A;  2WYQ A;  2LMC A;  2BS3 B;  3K9P B;  1ZOY B;  2M0X A;  3N1Y C;  4DHJ B;  3GE3 C;  2MX2 A;  4MH0 E;  5FKA C;  5J2R A;  1E0Z A;  2WXI A;  3T8M A;  4ACF A;  3QC8 B;  2X8X X;  1VDV A;  2PEA A;  3BY4 B;  1J8C A;  4HVB A;  2YVC A;  2UU7 A;  3RT3 B;  3R3M A;  1TKE A;  4A8X C;  4EUT A;  2PJH A;  4TQ1 A;  2LXC A;  3PRP B;  2K1F A;  2K9X A;  5AUK A;  4IWQ A;  5D6J B;  3TCA A;  4DBG A;  1TZO A;  2O2V A;  4MJS B;  4US9 A;  2QIL A;  2PVG C;  1WMH B;  3MFG A;  2PLP A;  4O1N A;  3P63 A;  4KIK B;  3M95 A;  4ITK A;  3ZVV A;  2WDT B;  2LFI A;  3KYC D;  4BZA A;  3ZNI D;  3A1Q B;  2WQY B;  3AE6 B;  3QIJ A;  4RF0 A;  2DEN B;  1V49 A;  2LRW A;  4KSL C;  4JLC A;  1ET6 A;  1D4B A;  1QLB B;  4BAX A;  5LNK 1;  2RSU A;  3AE5 B;  4B0E A;  2LHD A;  2MP2 A;  1UGJ A;  2KO3 A;  1R4M B;  3ZJU A;  5G5H A;  1JWS D;  4CO7 A;  2K6D B;  2WX1 A;  3VUX A;  1MG8 A;  3AEA B;  3DBS A;  2L32 A;  3O65 B;  1GC6 A;  2EMS A;  2KMM A;  1LFD A;  5KHQ A;  5E6J A;  3RNE C;  2D10 A;  2INC C;  1VZ8 A;  2KX3 A;  4I6L B;  4EEW A;  4A20 A;  2XK5 B;  5E6N A;  3TEY A;  1YOV B;  4FJV B;  2WXF A;  2DX5 B;  4E74 A;  3W1Y A;  4K7U A;  5EE0 A;  3RNF C;  3AE3 B;  2AWT A;  2WLB A;  3RUI B;  3ZQ4 A;  1GNU A;  1HE8 A;  2D5G A;  2INP E;  1SJH D;  2SEB D;  2C5L C;  1C79 A;  4NJC A;  2LEK A;  2ZW0 A;  3B0A A;  2KVR A;  3I9V 1;  2O6V A;  3ENE A;  4DHZ B;  4W9H A;  1XEE A;  2HJ1 A;  3PO0 A;  4YSZ B;  4LNI A;  4C00 A;  2NR2 A;  2IZV B;  4RGM A;  1N63 A;  3EUB 2;  3BWU D;  1VCB A;  1EWY C;  1MG4 A;  3RCZ A;  2IPK D;  4JGH B;  3PRM B;  3KUD B;  2IY0 B;  3HRD D;  4K81 A;  2CHX A;  1R4N I;  2DWQ A;  1HTO A;  2LGX A;  3UGB B;  1C78 A;  1YMH E;  1OEY A;  5IP4 D;  5GXG B;  1GB4 A;  2W55 A;  4YT0 B;  3OLM D;  2PTL A;  3VFK A;  1FXT B;  2BYE A;  4GDL A;  5AZH A;  3MHS D;  3ZW3 A;  4RNA A;  4DDI D;  1R4N B;  2IDY A;  2FNJ B;  4XYC A;  5EE9 A;  2JYT A;  3Q3M C;  2C7H A;  4RFB A;  1IGD A;  2IO0 B;  3TEX A;  1ZDV A;  4KDL B;  4LDT B;  1KF6 B;  4HKZ E;  1XXG A;  2WXM A;  3NS8 A;  2KFJ A;  4LNK A;  3A9K A;  3X0W A;  1C77 A;  2KQ4 X;  2QEJ C;  1NVI D;  4LNF A;  3FAH A;  2BB5 A;  4W9I A;  4WQO B;  3ML9 A;  5KHO A;  1QZE A;  3Q3O C;  1FCL A;  3C8Y A;  2KQ7 A;  3IG3 A;  2KWD A;  2DZK A;  3AE7 B;  1YD8 U;  3R7R A;  3V61 A;  3LB8 C;  4NZL B;  1L4Z B;  3ZXR A;  1WR1 A;  4A3O A;  1UF0 A;  4YSX B;  2KWV B;  4NAW A;  1CQV A;  1SIJ A;  3APD A;  1D5X C;  2MJD A;  2N4F A;  4LNN A;  3MTN B;  5AUI A;  2N9K A;  4B95 A;  4TSS A;  3PHW B;  4MGK E;  1LO5 D;  4AS1 A;  1DGJ A;  3DHG C;  1GUA B;  2XEW A;  1R7S A;  5CX3 A;  2NCN A;  3AE9 B;  2O6V D;  4TUU A;  2KN5 A;  5MPO A;  2K8H A;  1VZ6 A;  3E56 A;  4ZOH C;  1RLF A;  1J0G A;  3ONS A;  1TS2 A;  2BYF A;  3PLV A;  3R7Q A;  1WGD A;  2DAF A;  3AMZ A;  4F7Z A;  3IVF A;  3PVL A;  2KXJ A;  4FBJ B;  1E8X A;  2CJN A;  4HCP B;  2CJO A;  1IYF A;  4JQW C;  5G2N A;  4DWF A;  2KNB A;  3I63 C;  4WAA A;  2L83 A;  3HIZ A;  2AEH A;  3N1X C;  4FN2 A;  4PS8 A;  4XWT A;  2I2Y A;  3GE8 C;  2WXN A;  3PS6 A;  3QA8 A;  1OQY A;  3DCG A;  3RNB C;  1YQ4 B;  5LXI B;  1Q10 A;  1DOX A;  3T9L A;  3QK0 A;  5EE3 A;  3W5U B;  2JZP A;  4B6W A;  2V3P A;  2GBR A;  2QHO A;  2O2V B;  3KW5 B;  1B1Z A;  1NYQ A;  4Q2J A;  3IT4 B;  2WXL A;  1VLB A;  2W54 A;  3AEC B;  3WAN A;  3ALB A;  1T0Y A;  3DDC B;  2KAN A;  1IBX B;  1C4A A;  3VXW A;  1QOA A;  3VTW A;  1FIQ A;  1OQQ A;  1NI3 A;  1OTR B;  4FXC A;  3N20 C;  4ANV A;  5IN7 A;  3A1Q A;  4EZK A;  2KWU B;  1I4Q A;  1MHX A;  4BVU C;  1F2R I;  4WUR A;  2WU2 B;  3PPA A;  1NYR A;  4JIO U;  1TT5 B;  1UEL A;  1WJ6 A;  4BBN F;  2JYE A;  3APF A;  1PYW D;  1XLO A;  1WH3 A;  2PVO D;  2RDG A;  4BKS A;  1ZE3 D;  3JSV A;  4IW0 A;  3RI7 C;  1YNT E;  2KMC A;  3VTU A;  3EFU A;  1C76 A;  4FAD A;  3WAL A;  2I1J A;  2XN9 C;  1PGA A;  3DBL B;  5T8I A;  2GB1 A;  3N3K B;  4E71 A;  3WA0 A;  3SDL C;  1Q0W B;  2KJR A;  2LAS A;  2KAJ A;  2FIF A;  4BOZ B;  2J52 A;  3DPD A;  1V9J A;  3L4P A;  3AB5 A;  1D5M C;  3DBH B;  3Q8F A;  4BOS C;  4DK5 A;  1MHH E;  4JX1 C;  2WNM A;  3QHT A;  5DPT A;  1F0Z A;  1ESF A;  4IM3 A;  2O6V B;  4AP4 C;  2L0T A;  4A9A A;  4H2A A;  4FJY A;  3AEF B;  2GBM A;  1V1O A;  4GMV A;  1KJT A;  2C60 A;  4C7Y A;  2N9P C;  1E7U A;  1S1Q B;  3IBE A;  4DHJ D;  2IJ0 A;  4YWG G;  2KDF B;  4N9F 4;  2B3A A;  4OZB A;  4LK0 M;  1TIF A;  2MEK A;  2GMI C;  4CQN A;  4KKJ A;  1K8R B;  1J7C A;  4GGQ A;  2KVZ A;  4XX5 A;  4BFR A;  5H8Y E;  3BK2 A;  2A5U A;  3I5J C;  2I38 A;  2Y3A A;  1JW9 D;  3SFD B;  3UQA A;  5HKH A;  2D3G A;  3DHH C;  5I4D A;  2VH1 A;  1X1M A;  3E9S A;  2IO3 B;  3AUL A;  2MQJ A;  4GDK B;  1EM7 A;  2QSD A;  4RM8 A;  2GOW A;  2KAC A;  3ZO5 B;  2RGF A;  2GBK A;  2K8B A;  2Y5C A;  3U30 A;  2ON8 A;  4ANU A;  2KDB A;  1UD7 A;  3HVZ A;  2FUG 1;  2R2Q A;  3BZD B;  2W3S A;  3IFW B;  1P7E A;  1UZX B;  2E6X A;  1PGX A;  1PDX A;  3WIM A;  3HVD A;  3AXC A;  3HK0 A;  1S3S G;  3HHM A;  4YL8 A;  2KMA A;  4BKS D;  1E10 A;  2VH2 A;  1ISN A;  2KJ6 A;  2JZ3 B;  3TL5 A;  3IXS A;  1UWX A;  5D7G A;  1WR6 E;  1SB3 C;  2EKI A;  1NDD A;  4NAM A;  2RPQ A;  1C9F A;  3IAS 1;  4NAW B;  2G45 B;  3HM3 A;  4HPM B;  1JML A;  2CKH B;  2K22 A;  1TKY A;  4M0W A;  3DWM A;  4WWN A;  1F9J A;  1WGG A;  1TTN A;  4XE0 A;  4GOC A;  4URK A;  4P7I A;  3TEZ A;  4XZ4 A;  2GBJ A;  2WXP A;  4GXB A;  5HFY A;  4NJ6 A;  3U7D A;  2AX5 A;  2ZNV B;  1MVK A;  4OHJ A;  5JHB A;  3CMM B;  2WXO A;  1QOF A;  2N1V A;  3MHZ A;  2EEL A;  4IM2 A;  2HTM E;  2JRI B;  2N9E B;  1Q5W B;  5CHW A;  1HTQ A;  2KDM A;  2WXH A;  2N7E A;  2EKE C;  2L8J A;  1EF1 A;  1DOI A;  2JU6 X;  4C4V B;  4WWP A;  4JL9 A;  2BYT A;  3N32 A;  3OJ4 B;  3SR6 A;  1VR9 A;  2LRU A;  3K9O B;  1HZ5 A;  1AWD A;  3VH4 B;  1EF5 A;  1HZ6 A;  2L76 A;  2HTH A;  4WWO A;  1N62 A;  2K25 A;  2FUH B;  1SE4 A;  1FNU A;  1FO4 A;  4P1C C;  3PSE B;  3DOW A;  1F52 A;  1L5P A;  4MSQ B;  2MBE A;  1WYW B;  4WIP A;  2N1W A;  1GPX A;  3KLS X;  3IT6 B;  2FCM A;  1V6E A;  4P6V F;  2C7M B;  1K50 A;  2MA9 B;  5EE1 A;  1MI0 A;  4LDT D;  2RR9 A;  3LYY A;  2YLM A;  1EUV B;  2WDR B;  4TKN A;  1E8Y A;  4PS3 A;  3KYD D;  4ICV A;  1V5O A;  4N6E B;  1MPE A;  3SEB A;  2KN4 A;  1TS5 A;  1R4M I;  1JWM D;  2JQR B;  3VRA B;  4HRO A;  1IBX A;  1WM2 A;  3WAM A;  2RDH A;  2J4X A;  4II3 B;  4E3C A;  2LGI A;  1CK1 A;  4TMA B;  1WX7 A;  4OZC A;  3T3O A;  3URY A;  2DLB A;  5BYR A;  1SEB D;  4AJW A;  2JZZ A;  1YJJ A;  3EGR A;  3JSV B;  5G55 A;  2LJ5 A;  3ZJV A;  2TSS A;  4NPN A;  4X57 B;  3Q2A C;  2BKF A;  3RD2 A;  1SIF A;  2ZCB A;  3TSS A;  1OQR A;  4ARC A;  1H4R A;  2ZNV C;  3KH0 A;  2GBN A;  2KQS A;  1ZPS A;  4OZA A;  4EE2 A;  1LM8 B;  5BMI A;  5DPR A;  2M17 A;  2WXK A;  1QF6 A;  1QQR A;  2MHJ A;  3QJZ A;  3O13 A;  4J6I A;  4K1R B;  3V60 A;  3PHX B;  1SE2 A;  3MC0 B;  2J0M A;  2J0J A;  2KDI A;  3KUZ A;  1CJE A;  1XQQ A;  3GZN B;  1K53 A;  2YEP B;  5DPW A;  4HXD A;  1QOG A;  1M4V A;  3AU5 A;  3DBR B;  2JRH A;  2D3C A;  2L05 A;  4ZRP A;  2ICI A;  1FXI A;  2NPT A;  2W82 A;  1VD2 A;  4KGR A;  3NS1 A;  1STE A;  3AU4 A;  2G4D B;  3Q14 C;  3N30 A;  3OJ3 A;  1V2Y A;  3R2T A;  2BBC A;  4OW0 A;  2Q5W D;  3ZTC A;  1YN5 A;  2L7R A;  3KVF B;  1P98 A;  4DXF A;  1V81 A;  3R8B A;  1WE7 A;  3GOE A;  2QCZ A;  4YTN B;  3GB1 A;  2BVC A;  4G3X B;  2BQQ A;  5JZE B;  4G50 A;  3L17 A;  4GDK A;  3U2S C;  2VRR B;  3FKY A;  2WS3 B;  4IG7 B;  1ENF A;  3AEG B;  2JPH A;  4A3P A;  3PGE A;  2MWS B;  3L10 B;  2QJL A;  1KTK A;  2DBY A;  3TMP B;  1WX9 A;  3RZW C;  3ZGZ A;  2N9L A;  3N1Z C;  1T6B X;  1FNV A;  1RFK A;  3NZS A;  3APC A;  3BVZ A;  2ONQ A;  5DCN A;  1I4G A;  4IDI A;  4WJQ A;  3AN1 A;  2AQ1 B;  1XLQ A;  4MGY E;  1JWU D;  1T0R C;  3NRZ A;  2Z0E B;  4M0W B;  3DHI C;  1DYQ A;  4KV2 A;  1ZUD 2;  3BYT B;  4PK1 A;  4MM3 B;  4GB9 A;  1J19 A;  1UBQ A;  3PV1 A;  3BIN A;  5BO4 B;  4WQM A;  5C1Z A;  1B9R A;  1P7F A;  3PT2 B;  4ZRQ A;  1KFY B;  2V1Y A;  2BWF A;  1WF9 A;  5CTR C;  4RGN A;  1FNW A;  1M94 A;  1LQB A;  5BMH A;  2DAJ A;  2J53 A;  2L0F A;  2NBV B;  2QIE B;  4EOY A;  2JXT A;  3KUC B;  4REZ A;  3QCA A;  1J7B A;  3TBL D;  3AE2 B;  2G1E A;  2D11 A;  5JHA A;  3B08 A;  1BUI C;  2Y5P A;  2N7J A;  2AL6 A;  4PYZ A;  3UI3 A;  3ZTD A;  1N6Z A;  4XC2 A;  4NQK E;  1LGR A;  4DQO C;  5FR3 A;  2SAK A;  1L7Y A;  2IGD A;  4ZHP A;  3RYT A;  2LHE A;  2R61 A;  4DXG A;  3AE4 B;  4C4V A;  3J9C A;  3VUW A;  1CZP A;  1ZGU B;  1JRP A;  1GJZ A;  3VTV A;  1TKG A;  3P4S B;  3CIR B;  4LJO B;  1E6E B;  3A33 B;  5J18 A;  3H9D A;  1FRD A;  3NVV A;  1XD3 B;  2XNA C;  2DNF A;  4CHK A;  5D94 A;  1E7V A;  4RGO S;  2BS4 B;  4GU2 A;  2BPS A;  3LXF A;  3V3X A;  3ZNH B;  4ASW C;  3DVN U;  4HK2 A;  4FLH A;  4WWM A;  1ROE A;  4W9G A;  4IOI E;  5IA7 A;  4I6P A;  1FMA D;  3RPF C;  5IO9 A;  4LTU A;  3CST A;  3RUL A;  2K0P A;  3R66 C;  4EZL A;  3UIN B;  1JCK B;  3JW0 X;  2PW9 A;  2JF5 A;  2WDV B;  1OFF A;  2ZJD A;  1TY2 A;  2M19 A;  1GAQ B;  1EU3 A;  3DBL I;  4RH6 A;  4ZYN A;  2BWE S;  3DBH I;  2BT6 A;  5HG2 A;  2KFK A;  2PPH A;  1I35 A;  2IYD B;  3Q3F A;  2MBH A;  3P42 A;  3MC9 A;  2WXJ A;  2JXX A;  1BT0 A;  2HJ8 A;  1FEH A;  3NOB A;  4RF1 A;  1Q1O A;  5C2T B;  4MH8 A;  2KTR A;  3TUO A;  4IWP A;  1V5T A;  1UWM A;  1XLN A;  2MBB B;  4B0M A;  3Q6B A;  1D3Z A;  3ZXV A;  1F1H A;  2NBW B;  2JWU A;  4WJO A;  2LUE A;  1Y56 A;  1P0R A;  2JY6 A;  1TYG B;  2UWQ A;  2LVO A;  2NPT B;  3TIX A;  2HDE A;  3EFC A;  3V62 A;  4DHZ E;  3RNA C;  2AL3 A;  5JH5 C;  2L00 B;  4I6N B;  1SGH A;  3IAM 1;  1Z5S B;  1ZDX A;  4M8M A;  2BB6 A;  4W9C A;  2KTF A;  5C3J B;  4YXD B;  4K3B A;  2JT4 B;  4HJG E;  1WWT A;  2PIA A;  3V6E B;  2M56 B;  4HEA 1;  1QT9 A;  4C7Z A;  1C4P A;  3D32 A;  2BGF A;  3U8Z A;  1HA5 A;  2MCN B;  3JYU A;  4EZJ A;  5J17 A;  5E6O A;  2AYO B;  4MSM B;  3ZRC A;  1AAR A;  2L1A A;  2WXQ A;  3GS2 A;  2IO1 B;  2M8S A;  1FFU A;  1I4R A;  3S2A A;  3Q8A A;  4W9D A;  2MBO A;  2IBI B;  1JWB D;  2ZEQ A;  4M00 A;  4KSK C;  3QX1 A;  3PRZ A;  4ZRK A;  2J7Q B;  3ZIM A;  3PZD A;  4KVG B;  2LGY A;  2LD9 A;  3P4Q B;  1WGH A;  1VJK A;  4W9F A;  2OOB B;  2LZ6 A;  4M02 A;  3RNG C;  2NBU A;  2N0S B;  2KC2 A;  3IHP C;  3B2F A;  2IGG A;  1NI2 A;  4XDC A;  1SE3 A;  3ML8 A;  2M1M A;  3BVG A;  3R2I A;  2MLB A;  3M62 B;  4K3C A;  3QAR A;  4HCN B;  4HDQ A;  4ZYS A;  3Q3J A;  1ZXH A;  2CHW A;  3ECI A;  1N61 A;  1OGW A;  4NJ7 A;  3RN9 C;  3FC4 A;  5DPS A;  4XDD A;  1C3T A;  3QQ8 B;  4US8 A;  1JRU A;  2XBB C;  1OEY J;  4M8N A;  1SBB B;  1TBE A;  1NEN B;  4MM3 A;  5G5G A;  1TJE A;  2KOX A;  1A5R A;  2RDB C;  4EFO A;  3HUI A;  4GLS C;  1WRI A;  1UGM A;  5D3I B;  1AW7 A;  3M3J A;  1TS4 A;  3P1M A;  1WXA A;  1WXQ A;  1K51 A;  2J0K A;  3LDZ E;  2Z59 B;  4HLE A;  3VDZ A;  3Q8C A;  2NMQ A;  2WXR A;  5D2M B;  3DVG X;  1AN8 A;  3ZLZ A;  4L1B A;  1QIL A;  3AEB B;  3EC8 A;  1ACC A;  1L0Y B;  2M4N A;  4C80 A;  4DDG D;  2ACZ B;  2K6Q A;  3N9Y C;  4OVV A;  1RRB A;  3VR8 B;  3OWE B;  1PUT A;  4LJP B;  1XF5 L;  1HEZ E;  2CR5 A;  2WWZ A;  4G11 A;  3DWG C;  1D5Z C;  1GC7 A;  2REX A;  4PT5 A;  1T0Q C;  3CWI A;  4XWW A;  3X23 A;  1N5X A;  4KGS A;  3HM6 X;  1IP9 A;  3BVM A;  2IGH A;  3AE1 B;  4RMA A;  4DXA B;  5GMV A;  2H88 B;  2D3B A;  3ABV B;  2ZVO A;  5AZG A;  2PE9 A;  3SFE B;  2K3U A;  3NZU A;  2K5P A;  2JWZ A;  4S17 A;  4B9K A;  3B1L X;  1CMX B;  4OVU A;  3CF6 E;  1V97 A;  2KZR A;  2FBW B;  3EA6 A;  1YN4 A;  1FM0 D;  5EDS A;  2FID A;  2ZW1 A;  3UIO B;  1WXV A;  3VQI A;  1NEK B;  3MP9 A;  3RZF A;  4WH4 A;  4KGT A;  2ZCC A;  3L08 A;  4WJP A;  1FRR A;  1VZ7 A;  2OHF A;  2R2O A;  3A9J A;  3L54 A;  1TGZ B;  4ANX A;  2WGS A;  3KWL A;  2KFK B;  4F8C B;  4FA6 A;  1YJI A;  3VUY A;  4AOF A;  3WAO A;  1UH6 A;  2KT7 A;  4FJZ A;  2KYW A;  1WGK A;  1FCC C;  2MW5 A;  2ZZP B;  5LLI A;  1E5W A;  1WJU A;  1WX8 A;  4HPL B;  3GZN I;  1YX6 B;  2E3T A;  2J42 A;  1I4H A;  1IUE A;  2GRI A;  2KTR B;  3NUH B;  3H7P B;  4C56 C;  3DBR I;  4GSW A;  4N58 A;  1N60 A;  4IKG A;  1L6U A;  1L0V B;  1SJE D;  3BII D;  4S0R A;  4ZDV A;  1I4P A;  1XT9 B;  2LGS A;  1D6E C;  2WXG A;  5H92 C;  4JWU C;  5IKC M;  5L95 C;  3MJW A;  5FR6 A;  4AJY B;  4ANW A;  2VZK B;  4LCD E;  2KX0 A;  4FHK A;  1YQB A;  4N59 A;  3W1S A;  2BKR B;  4F1S A;  2DZI A;  2OED A;  4HKQ A;  4A90 A;  4AUQ C;  1TZ1 A;  4PYU A;  4NY0 A;  1GOZ A;  2MRP A;  2LJI A;  4JPS A;  2L52 A;  1V1P B;  1EU4 A;  2MJE A;  2WHI A;  2D07 B;  4MEL A;  1PQS A;  2ASQ A;  3B9J A;  2B76 B;  1P1A A;  2V9H A;  3L13 A;  3W2D A;  2A4Z A;  3ZRF A;  1YQ3 B;  4P16 A;  1IPG A;  1FD6 A;  2BW2 A;  2PKO A;  1L4D B;  5BMG A;  1C1Y B;  1XLP A;  1T0S C;  1IGC A;  3AEE B;  2OJW A;  4FUL A;  4W9E A;  3NG0 A;  2WU5 B;  3AED B;  1F77 A;  5C23 A;  1P9D U;  1JWA D;  3ZDT A;  3VAW A;  1UBI A;  3DQV A;  1TY0 A;  1WRD B;  4KZ0 A;  3CSF A;  2AQ3 B;  1ZP0 B;  2D3A A;  3PZ7 A;  3B2G A;  3GP7 A;  4D2K A;  4JWS C;  1WE6 A;  1E9M A;  3VRB B;  4BKG A;  2KC1 A;  3W5V B;  1T5X D;  3FIL A;  4BKT A;  3V05 A;  4MGI E;  1WIA A;  3UIP B;  1FFV A;  2KJH B;  3AV8 A;  3PLU A;  3ZDM C;  1E8Z A;  1V80 A;  2GLS A;  3H1U A;  3UQB A;  2K39 A;  1RWS A;  1RM6 C;  4K7W A;  1KLG D;  2CS4 A;  1I4X A;  1DOY A;  1KLV A;  2MSE D;  3NVZ A;  3ZYY X;  1ZW7 A;  3H8H A;  3NJT A;  4LLG M;  1LXD A;  4RGT A;  3JVZ X;  4PS7 A;  2FCS A;  1H8C A;  5L83 A;  3C19 A;  1Y8R C;  2NTS A;  4HJK A;  4P1B C;  5TSS A;  3DVG Y;  4A6Q A;  3ZJT A;  4II2 B;  2LXA A;  3P4P B;  2JSV X;  4LNO A;  4KDI C; 
#chains in the Genus database with same CATH homology
 2FCN A;  2GBJ A;  4GXB A;  3W1Y A;  4K7U A;  4W9L A;  2NBW B;  2G3Q B;  2AWT A;  4NJ6 A;  2WX0 A;  4W9K A;  3U7D A;  4CYE A;  2DZJ A;  3RUI B;  4WJO A;  1GNU A;  1HE8 A;  2LUE A;  2ZNV B;  5IAA C;  1P0R A;  2JY6 A;  2UWQ A;  2LVO A;  2NPT B;  5JHB A;  3CMM B;  3TIX A;  2C5L C;  2N1V A;  4IM2 A;  3V62 A;  3H7S A;  2JRI B;  2N9E B;  4DHZ E;  1Q5W B;  4IC7 B;  5CHW A;  1WM3 A;  2DZM A;  3B0A A;  2AL3 A;  5JH5 C;  2KVR A;  2L00 B;  4I6N B;  1SGH A;  2O6V A;  1Z5S B;  2N7E A;  4M8M A;  3ENE A;  2EKE C;  2L8J A;  2V4L A;  1EF1 A;  2KTF A;  4W9C A;  4DHZ B;  4W9H A;  1YX5 B;  4WWP A;  4JL9 A;  2JT4 B;  3VH3 B;  3N32 A;  3OJ4 B;  3V6E B;  4G0N B;  5CHF A;  2NR2 A;  2IZV B;  2LRU A;  3D32 A;  3K9O B;  1VCB A;  2BGF A;  3RCZ A;  3VH4 B;  4JGH B;  1EF5 A;  3U8Z A;  2L76 A;  3PRM B;  2HTH A;  4WWO A;  3KUD B;  2IY0 B;  3JYU A;  2MCN B;  4EZJ A;  4K81 A;  5E6O A;  2CHX A;  2AYO B;  1WXM A;  2K25 A;  1R4N I;  2FUH B;  5J17 A;  4MSM B;  1I42 A;  3ZRC A;  1EO6 A;  3PSE B;  2LGX A;  3DOW A;  3UGB B;  1AAR A;  4MSQ B;  2MBE A;  1OEY A;  3NHE B;  2IO1 B;  1WYW B;  2M8S A;  2IO2 B;  2N1W A;  3S2A A;  2FCQ A;  4W9D A;  2KD0 A;  2KKC A;  2BF8 B;  1V6E A;  2FCM A;  3OLM D;  3VFK A;  2C7M B;  2IBI B;  2MBO A;  1FXT B;  2BYE A;  2ZEQ A;  1WFY A;  2MA9 B;  4GDL A;  5AZH A;  4KSK C;  2RR9 A;  4LDT D;  2YLM A;  1EUV B;  3MHS D;  3ZW3 A;  3QX1 A;  4TKN A;  3PRZ A;  1E8Y A;  4PS3 A;  4ZRK A;  4DDI D;  3KYD D;  2J7Q B;  3SD5 A;  3PZD A;  3ZNZ B;  3ZIM A;  4ICV A;  1V5O A;  3A4R A;  2FNJ B;  2LGD A;  3L16 A;  1P3Q U;  2JVC A;  4KVG B;  2C7H A;  3A9J B;  2IY1 B;  2IO0 B;  2KDE B;  1R4M I;  2LD9 A;  2LGY A;  2LVQ A;  1Z2M A;  4BBN C;  1WGH A;  4KDL B;  3DVN V;  3M63 B;  4LDT B;  4MJS A;  1WM2 A;  4W9F A;  1WMH A;  2OOB B;  3NS8 A;  3WAM A;  2KFJ A;  3WAP A;  3A9K A;  3X0W A;  2BYV E;  2LZ6 A;  3EEC A;  4II3 B;  2NBU A;  3PRE A;  2KC2 A;  3IHP C;  4KIK A;  4E3C A;  1V86 A;  2UYZ B;  4W9I A;  2CHZ A;  4WQO B;  1NI2 A;  3ML9 A;  1WX7 A;  5KHO A;  1QZE A;  3VHT C;  3ML8 A;  2M1M A;  2KQ7 A;  3IG3 A;  2MLB A;  3M62 B;  2JZZ A;  2KWC A;  2MP2 B;  2I1K A;  4AJW A;  4TQ0 A;  1NBF C;  3QAR A;  4HCN B;  3JSV B;  4HDQ A;  2DZK A;  5AZF A;  1RFA A;  3Q3J A;  3L0W B;  2LJ5 A;  5G55 A;  1YD8 U;  3R7R A;  2CHW A;  3ECI A;  3V61 A;  1OGW A;  4NJ7 A;  4IM0 A;  4NPN A;  4X57 B;  2CU1 A;  4NQL B;  2BKF A;  1WR1 A;  3RD2 A;  5DPS A;  1SIF A;  4A3O A;  1C3T A;  4KZC A;  2ZCB A;  2KWV B;  3QQ8 B;  4IUM B;  4NAW A;  3NY5 A;  1JRU A;  2XBB C;  1OEY J;  3APD A;  4M8N A;  2N4F A;  1H4R A;  1TBE A;  3MTN B;  2ZNV C;  3KH0 A;  4ZRJ A;  2GBN A;  3H7P A;  4MM3 A;  2KQS A;  4B95 A;  1LM8 B;  3PHW B;  2KOX A;  1A5R A;  3SHQ A;  4EFO A;  5LXH A;  2OJR A;  4MGK E;  5DPR A;  2M17 A;  1UGM A;  4RM9 A;  1GUA B;  2XEW A;  5CX3 A;  2EMT A;  2NCN A;  3ZNG C;  2ZVN A;  2N9X A;  3M3J A;  3QJZ A;  4J6I A;  1WXA A;  4K1R B;  3V60 A;  1WJ4 A;  3PHX B;  3QAQ A;  2J0M A;  2J0J A;  2KDI A;  2O6V D;  3QWZ B;  2J0K A;  3KUZ A;  2Z59 B;  3LDZ E;  4HLE A;  1XQQ A;  3VDZ A;  4TUU A;  2KN5 A;  2K8H A;  2MBQ A;  2V3S A;  2L3Z A;  2XK5 A;  5DPW A;  5D2M B;  4HXD A;  1RLF A;  1J0G A;  3ONS A;  2BYF A;  3PLV A;  3DVG X;  3R7Q A;  1WGD A;  3AU5 A;  3ZLZ A;  2RD0 A;  2JRH A;  1WI0 A;  2DAF A;  2DYM A;  3EC8 A;  4HWI B;  4ICU A;  2L05 A;  3IVF A;  4TV3 A;  2D2Q A;  2M4N A;  3TJP A;  4F7Z A;  3PVL A;  2KXJ A;  4DDG D;  2NPT A;  4FBJ B;  1E8X A;  2K6Q A;  4OVV A;  1VD2 A;  1RRB A;  4HCP B;  1IYF A;  1WXS A;  1WZ3 A;  3I3T B;  3AU4 A;  1WGY A;  4JQW C;  2G4D B;  5G2N A;  4DWF A;  2KNB A;  4WAA A;  4LJP B;  3HIZ A;  2AEH A;  1YIW A;  3N30 A;  4FN2 A;  3OJ3 A;  4PS8 A;  1WJN A;  1V2Y A;  1KM7 A;  3PS6 A;  3QA8 A;  1OQY A;  2CR5 A;  3AI5 A;  3DCG A;  2WWZ A;  4G11 A;  1E8W A;  5LXI B;  3T9L A;  3ZTC A;  1GC7 A;  2REX A;  3QK0 A;  2L7R A;  3KVF B;  1P98 A;  1WY8 A;  1V81 A;  3X23 A;  1WE7 A;  2G4S A;  1YJ1 A;  3GOE A;  4B6W A;  4MGZ E;  3HM6 X;  1IP9 A;  2GBR A;  2QHO A;  2O2V B;  4G3X B;  5JZE B;  3KW5 B;  4RMA A;  4DXA B;  4GDL B;  4G50 A;  3L17 A;  5GMV A;  4GDK A;  2VRR B;  5TR5 A;  2ZVO A;  4IG7 B;  2PE9 A;  5AZG A;  3C0R B;  3NZU A;  2JWZ A;  4B9K A;  2JPH A;  3B1L X;  3V6C B;  3P2B A;  3SU8 X;  3VVW B;  1CMX B;  4A3P A;  3PGE A;  1L2N A;  4OVU A;  3CF6 E;  3PTF C;  2MWS B;  1U4A A;  2KZR A;  2KLG A;  4FHJ A;  2KK8 A;  5CHV C;  3ALB A;  1T0Y A;  2ZPY A;  4MEM A;  3DDC B;  3L10 B;  3WAN A;  5EDS A;  2FID A;  2KAN A;  1GG3 A;  4GN1 A;  4ZRI A;  3UIO B;  1WXV A;  3VQI A;  3VXW A;  3TMP B;  1WX9 A;  3RZF A;  3A9K B;  3RZW C;  1WGR A;  2DYB A;  3VTW A;  2ZCC A;  3L08 A;  3OAW A;  4IWO A;  2ZPN A;  2Z0D B;  3H6N A;  4WJP A;  2Y5B B;  3NZS A;  1OTR B;  3APC A;  2R2O A;  2LWP A;  3A9J A;  3L54 A;  1KOT A;  1TGZ B;  4ANX A;  3ZKJ C;  4ANV A;  2LI5 A;  4NNJ B;  5DCN A;  2KFK B;  2KHW B;  3A1Q A;  3LJ3 A;  4F8C B;  4EZK A;  4FA6 A;  2W9N A;  4GIV A;  2KWU B;  3VUY A;  2HD5 B;  1ZKH A;  1E90 A;  4AOF A;  4BVU C;  3WAO A;  1UH6 A;  3PPA A;  4WJQ A;  2FAZ A;  4JIO U;  1G6J A;  1UEL A;  4FJZ A;  1WJ6 A;  4MGY E;  4BBN F;  3EHV A;  2N7D A;  2MW5 A;  2ZZP B;  5LLI A;  3APF A;  1E5W A;  1WJU A;  1WX8 A;  4HPL B;  4EKU A;  1WH3 A;  3GZN I;  1YX6 B;  2Z0E B;  3W1S C;  2KLC A;  4M0W B;  4BKS A;  4KV2 A;  1SE9 A;  5E6P A;  2KTR B;  4MDK E;  3UF8 A;  3H7P B;  3JSV A;  4IW0 A;  4GB9 A;  3DBR I;  1J19 A;  1UBQ A;  3PV1 A;  4GSW A;  3BIN A;  2KMC A;  5BO4 B;  5C1Z A;  4DHJ D;  3VTU A;  3PT2 B;  3EFU A;  1RAX A;  4FAD A;  3WAL A;  4ZDV A;  4WJN A;  1XT9 B;  2DYO A;  2I1J A;  2V1Y A;  2BWF A;  3N3K B;  1WF9 A;  4E71 A;  3WA0 A;  5CTR C;  3SDL C;  1M94 A;  2KJR A;  1Q0W B;  1LQB A;  2LAS A;  5L95 C;  2FIF A;  4HDO A;  4BOZ B;  3MJW A;  3ZUN A;  2NVU I;  2DAJ A;  4K7S A;  2L0F A;  3DPD A;  1V9J A;  3A4S C;  5FR6 A;  2NBV B;  4AJY B;  4BOS C;  4DK5 A;  4EOY A;  3KUC B;  3QCA A;  4ANW A;  3QHT A;  3TBL D;  2DHZ A;  5DPT A;  4LCD E;  2KX0 A;  4FHK A;  2D11 A;  5JHA A;  1YQB A;  4IM3 A;  3B08 A;  3W1S A;  2NS5 A;  2O6V B;  4AP4 C;  2L0T A;  2BKR B;  4F1S A;  2C7N B;  2DZI A;  4FJY A;  2AL6 A;  2GBM A;  4PYZ A;  4GMV A;  1KJT A;  2C60 A;  2HE7 A;  4AUQ C;  1TZ1 A;  4PYU A;  3ZTD A;  2N9P C;  2MRP A;  1E7U A;  1S1Q B;  2JUO A;  1WZ0 A;  3IBE A;  4NQK E;  4NY0 A;  4XC2 A;  4AWJ A;  2C9W B;  2KDF B;  4N9F 4;  2D07 B;  4MEL A;  2B3A A;  2K8C A;  1L7Y A;  1PQS A;  2ASQ A;  3RYT A;  2GMI C;  4W9J A;  2PE6 B;  1P1A A;  3L13 A;  1K8R B;  5AEK B;  2LVP A;  2WYQ A;  4GGQ A;  3K9P B;  2M0X A;  4XX5 A;  4DHJ B;  3VUW A;  4BFR A;  2A4Z A;  2MX2 A;  4MH0 E;  2A5U A;  1ZGU B;  3ZRF A;  5J2R A;  1IPG A;  3UQA A;  1GJZ A;  3VTV A;  5HKH A;  2D3G A;  4LJO B;  3T8M A;  3A33 B;  3QC8 B;  5J18 A;  1X1M A;  3H9D A;  1C1Y B;  2IO3 B;  2PEA A;  3BY4 B;  1J8C A;  1XD3 B;  3AUL A;  2MQJ A;  4GDK B;  4RM8 A;  4HVB A;  4CHK A;  2YVC A;  5D94 A;  4FUL A;  4W9E A;  3RT3 B;  1E7V A;  3R3M A;  2GOW A;  3ZO5 B;  5C23 A;  4EUT A;  1P9D U;  2PJH A;  2RGF A;  2GBK A;  4TQ1 A;  2LXC A;  2K8B A;  4GU2 A;  2BPS A;  2K1F A;  3PRP B;  3ZDT A;  3U30 A;  4IWQ A;  3VAW A;  3ZNH B;  4ANU A;  5D6J B;  1UBI A;  2KDB A;  3DQV A;  3TCA A;  1UD7 A;  1WRD B;  3DVN U;  4ASW C;  2O2V A;  4HK2 A;  4FLH A;  4KZ0 A;  4MJS B;  2R2Q A;  4DBG A;  3CSF A;  4W9G A;  1WMH B;  5IA7 A;  4I6P A;  1WE6 A;  4BKG A;  2KC1 A;  3IFW B;  4KIK B;  3M95 A;  3ZVV A;  4BKT A;  3CST A;  2WDT B;  1UZX B;  4MGI E;  3RUL A;  3R66 C;  3KYC D;  3WIM A;  1WIA A;  4EZL A;  3AXC A;  3HK0 A;  3UIP B;  1S3S G;  3UIN B;  2KJH B;  3JW0 X;  3HHM A;  3ZNI D;  2JF5 A;  3A1Q B;  4YL8 A;  2ZJD A;  2KMA A;  3PLU A;  4BKS D;  3QIJ A;  3DBL I;  3ZDM C;  1E8Z A;  1ISN A;  1V80 A;  2DEN B;  1V49 A;  2JZ3 B;  2LRW A;  2KJ6 A;  3H1U A;  3TL5 A;  4KSL C;  3UQB A;  4JLC A;  2K39 A;  5D7G A;  1WR6 E;  4ZYN A;  4K7W A;  2BWE S;  2CS4 A;  1NDD A;  2RSU A;  2RPQ A;  1KLV A;  2MSE D;  4NAW B;  3DBH I;  2MP2 A;  2G45 B;  2KFK A;  3HM3 A;  1ZW7 A;  2PPH A;  2KO3 A;  1I35 A;  2IYD B;  1LXD A;  4HPM B;  4CO7 A;  3Q3F A;  2MBH A;  3JVZ X;  2K6D B;  2WX1 A;  4PS7 A;  1MG8 A;  3VUX A;  2CKH B;  3DBS A;  3O65 B;  2FCS A;  1H8C A;  1GC6 A;  5L83 A;  2EMS A;  2JXX A;  1BT0 A;  1Y8R C;  2HJ8 A;  1LFD A;  3NOB A;  4HJK A;  5KHQ A;  1Q1O A;  3DVG Y;  2D10 A;  2KTR A;  4II2 B;  4WWN A;  2KX3 A;  4I6L B;  4IWP A;  1F9J A;  1WGG A;  2LXA A;  1V5T A;  4EEW A;  1TTN A;  4A20 A;  2XK5 B;  2MBB B;  4GOC A;  5E6N A;  4URK A;  4P7I A;  4FJV B;  4KDI C;  4XZ4 A;  1D3Z A;  2DX5 B;  4E74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...