2KLCA

Nmr solution structure of human ubiquitin-like domain of ubiquilin 1, northeast structural genomics consortium (nesg) target ht5a
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
79
structure length
79
Chain Sequence
PKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Ubiquilin-1
publication title Solution structure of ubiquitin-like domain of ubiquilin 1
rcsb
source organism Homo sapiens
total genus 19
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2klcA00
4TKNA 2KDEB 2M4NA 3SDLC 1P98A 2MBHA 2PJHA 3PPAA 5L95C 3OJ3A 1GC7A 4K7WA 3PZDA 2KWCA 4W9DA 4HXDA 3QHTA 4II3B 3DVGY 5CHWA 2J7QB 3RYTA 4JLCA 3VTVA 4EZJA 1WR6E 2IY1B 3QAQA 4TV3A 2LUEA 3IG3A 3ZVVA 2BKRB 1WGDA 3DPDA 1SE9A 4YL8A 3A4RA 4FN2A 2NBUA 4KSLC 1V2YA 4GU2A 4ICVA 3JW0X 1WXAA 2NPTA 4ANXA 4II2B 2CR5A 4BVUC 5KHOA 2JUOA 2IZVB 2NBWB 1WJNA 1WX8A 3IFWB 1OTRB 2JF5A 3ECIA 4RM8A 3NHEB 1QZEA 4W9JA 1WYWB 3CMMB 4HCNB 2FIDA 1GJZA 2LRWA 4A3OA 3AU4A 4ZYNA 4IUMB 5DPSA 3WALA 1WFYA 3APDA 1LM8B 1Z5SB 2GBRA 3DVNU 1XD3B 3V6EB 5J18A 4FLHA 4MGIE 3PSEB 4E3CA 3A9KB 3PS6A 4IWPA 1YIWA 2L00B 2MBQA 3DQVA 3DOWA 1K8RB 1WRDB 2BYFA 1E8XA 2LVQA 1E8ZA 1Q5WB 2XK5A 2LJ5A 2N7EA 2J0MA 1CMXB 1U4AA 2GMIC 3H7PB 2KHWB 3UINB 4JGHB 2KANA 1SIFA 1WZ3A 3B0AA 3L16A 2PE9A 2IYDB 1WX9A 2G45B 2KQSA 4GDKB 4F7ZA 2HTHA 1UZXB 2EMSA 2ZPYA 2ZVNA 5E6NA 3ZO5B 5L83A 5LXIB 2XBBC 3RZFA 2GBNA 2RR9A 3X23A 1V6EA 3HHMA 1WI0A 2O6VA 1TGZB 4K1RB 2BWFA 2CS4A 4MJSA 2HE7A 4FHJA 2RPQA 4DHZE 3P2BA 2N9XA 4NQLB 3X0WA 3PTFC 4XX5A 1JRUA 5CX3A 2LGDA 2LGXA 2WYQA 1AARA 3PREA 3AU5A 2KTRB 3K9PB 3U7DA 4IM2A 3VUYA 4AUQC 1WE6A 1MG8A 2L0TA 3V62A 2QHOA 4BKSD 2K25A 3PLUA 3OJ4B 2ZEQA 4AOFA 2IO2B 3APCA 3KW5B 2KX3A 1Y8RC 1YX5B 2DAFA 1VD2A 3PLVA 3RD2A 4CHKA 4GOCA 3L13A 1GUAB 3JSVA 2KTFA 3NZSA 4FADA 4MELA 2JWZA 2PPHA 2V1YA 2KO3A 4FJYA 1D3ZA 3A9JB 3WIMA 4EEWA 4PYUA 3A33B 4IWQA 2K8BA 2DHZA 3PVLA 4IC7B 1YD8U 1TZ1A 4MGZE 4B95A 4KDLB 4EKUA 2K6DB 2KD0A 3QIJA 3WANA 3VUWA 5AZFA 2JT4B 5D2MB 4CO7A 2EKEC 4I6LB 1VCBA 4GDLA 4A3PA 2K39A 2K8CA 3C0RB 3PRMB 1NBFC 3H7SA 1OEYA 4HDQA 4W9EA 4X57B 5BO4B 3EFUA 3SU8X 3VXWA 1FXTB 4NPNA 4W9KA 3ZTDA 1V81A 5E6OA 1OGWA 2MX2A 4KIKA 4IM0A 4DWFA 2JRHA 3VTUA 4W9HA 3TCAA 1WX7A 4JL9A 4K81A 2AWTA 2YLMA 2N1WA 4WAAA 3VTWA 3ZRFA 3PHXB 1XT9B 3RUIB 4NJ7A 1UD7A 1WGHA 1WZ0A 2MBBB 2G3QB 3OAWA 4E74A 3HK0A 2Z0DB 1TTNA 1WGGA 2IO0B 1EF5A 3M63B 4WWNA 2HJ8A 2M1MA 4NY0A 2C7HA 2WDTB 1XQQA 3QQ8B 1E8YA 4BOSC 4NJ6A 2KJHB 5D7GA 2LRUA 4AP4C 2G4SA 4LCDE 1WJ6A 2DENB 4E71A 2KN5A 2DYMA 4GIVA 4MEMA 2LXAA 4P7IA 2L76A 2D11A 3ML9A 3R66C 4WJPA 1P9DU 2AL3A 2JXXA 2NBVB 3NZUA 4ZRJA 5AZGA 3CSTA 4A20A 2IY0B 2NPTB 2ZJDA 5JHBA 2Y5BB 2KDBA 3LJ3A 1OEYJ 1GC6A 2KKCA 3KUCB 1G6JA 4HWIB 2O2VA 2N7DA 4ANVA 2KFKA 4EUTA 2MQJA 1OQYA 3RZWC 4CYEA 2LASA 3VFKA 2MBEA 2Z59B 4KSKC 3PRPB 5GMVA 2N1VA 2FCQA 4TQ0A 3QCAA 1UGMA 3N3KB 4W9LA 4OVVA 1E5WA 1LQBA 3PV1A 3V61A 2RGFA 2UWQA 4ZDVA 3ONSA 4ICUA 1WXMA 2G4DB 4LJOB 4B9KA 2LWPA 3L54A 5C1ZA 3WAPA 4GB9A 3RCZA 1WXVA 2KMCA 3ZNID 3L17A 4XC2A 2D07B 2N9PC 3NOBA 2MWSB 2AEHA 2AYOB 4F1SA 3LDZE 4TUUA 1EUVB 2XK5B 2CHWA 3CF6E 3DBSA 4G3XB 1P0RA 2XEWA 2IO1B 2MLBA 2KLGA 3KUZA 4KZ0A 1WM2A 4BKGA 3A4SC 4G0NB 3VH3B 2BF8B 3QA8A 4W9CA 3ZNGC 3T9LA 3DCGA 1F9JA 1WH3A 4FJZA 5AEKB 2FUHB 4HJKA 2LVOA 2K6QA 1BT0A 1RLFA 2BYEA 3VAWA 2O6VB 3AULA 3O65B 4PS7A 4MJSB 3R7QA 3RULA 1P1AA 3UF8A 2RSUA 5FR6A 1C1YB 3R3MA 4BBNC 2ZNVB 2DZIA 3JYUA 4AJWA 2JY6A 3M3JA 1WMHA 4IWOA 4WJQA 1Q1OA 1UBIA 4KDIC 1YX6B 3Q3FA 1EF1A 1S3SG 1ZW7A 4DHJB 4IG7B 4HDOA 3ZNZB 3ZTCA 3S2AA 1H4RA 2BPSA 2DAJA 3EECA 3GOEA 4WQOB 4MM3A 3JSVB 2M17A 4KVGB 1Q0WB 3H9DA 3UIPB 3APFA 4W9IA 3TJPA 4PYZA 1LXDA 2LGYA 4HPLB 4NAWA 1V80A 1WXSA 1TBEA 5CHVC 5CTRC 1E90A 3WA0A 3A1QA 4F8CB 5J17A 3QWZB 2UYZB 1EO6A 4RM9A 2KWUB 4GGQA 1RRBA 2KX0A 2O6VD 3ML8A 4GDLB 2MA9B 4FJVB 1GG3A 3UIOB 4K7UA 3VQIA 1IPGA 4FA6A 5G2NA 1WIAA 3L10B 2KZRA 1I42A 4AJYB 3UGBB 1UBQA 3I3TB 3PGEA 3SHQA 2L7RA 3ENEA 4IW0A 3DVGX 2KC1A 2KMAA 4KIKB 4I6PA 1Z2MA 2C60A 2YVCA 3JVZX 4DHJD 1L7YA 1V86A 3TBLD 1V5OA 2C7NB 2KOXA 4BOZB 5E6PA 3V6CB 3M62B 2BWES 2GBMA 4KV2A 5TR5A 4WWOA 2I1JA 5DPRA 3B08A 3U30A 1WE7A 2MP2A 2W9NA 2KWVB 3ZKJC 5D6JB 3PHWB 2R2OA 4NQKE 4ZRIA 4DHZB 3MHSD 2ZPNA 2FCMA 3BINA 3BY4B 4ANUA 2KNBA 1IYFA 4M0WB 5EDSA 2J0KA 3N30A 1SGHA 2RD0A 1KOTA 1T0YA 5IAAC 4HLEA 1NI2A 2IBIB 4LJPB 3TL5A 1ZGUB 4DXAB 4FHKA 3TIXA 4GXBA 3ZW3A 2N4FA 1I35A 2D2QA 3D32A 1M94A 2A5UA 4IM3A 2WX1A 3DBHI 5CHFA 1A5RA 4TQ1A 2EMTA 3Q3JA 3ZDMC 3KVFB 3UQBA 4AWJA 2KDIA 1E7UA 3CSFA 2KDFB 2K8HA 4JIOU 2C9WB 4MDKE 2REXA 5LLIA 2KLCA 4URKA 2JPHA 2O2VB 3OLMD 2KFKB 2ASQA 2BGFA 2OOBB 4PS3A 4HVBA 1NDDA 2A4ZA 2D10A 2DYBA 1WGYA 2BKFA 4MSQB 4GSWA 1GNUA 2L0FA 3QC8B 2MRPA 3NY5A 2CKHB 2KJ6A 4WJNA 1RFAA 4K7SA 3T8MA 2KQ7A 2LVPA 2LI5A 2DX5B 3WAOA 3VDZA 1E7VA 4DBGA 1YJ1A 4I6NB 5AZHA 2GBKA 2ZCCA 1R4MI 2KXJA 3IBEA 4BBNF 2KFJA 3UQAA 2JZZA 2MW5A 3WAMA 4DDGD 2JVCA 1S1QB 1WR1A 1X1MA 3AI5A 3QK0A 3ZLZA 5DCNA 3QJZA 1J19A 2BYVE 5D94A 3ZNHB 3A9KA 4BKSA 3KYDD 2I1KA 4ZRKA 2MCNB 3KUDB 1LFDA 4NNJB 4OVUA 2ZNVC 2D3GA 2LXCA 3VVWB 4LDTB 4W9FA 4J6IA 2ZVOA 3R7RA 4KZCA 3PT2B 4MH0E 4MGYE 4M8NA 2DZKA 2V3SA 3DBRI 3RT3B 5IA7A 4G11A 1L2NA 1P3QU 3H7PA 3QX1A 1WMHB 1WM3A 1H8CA 5HKHA 2L8JA 4HCPB 3MTNB 5DPWA 3ZUNA 2NR2A 4GDKA 4WJOA 3DDCB 2DZMA 2HD5B 1WF9A 4DK5A 1IP9A 3L0WB 2OJRA 2K1FA 3KYCD 5KHQA 1ISNA 1RAXA 1YQBA 3H1UA 4JQWC 3N32A 5DPTA 2LD9A 3VUXA 5JZEB 3V60A 3DVNV 1E8WA 1WGRA 4ANWA 2MSED 2CHXA 3IHPC 2C5LC 1KLVA 2NCNA 5G55A 4EZLA 2KC2A 2KK8A 2L05A 3W1YA 4GN1A 2JZ3B 3VHTC 4FULA 2M0XA 2KTRA 2J0JA 3L08A 1HE8A 2MBOA 4XZ4A 3ZIMA 2LZ6A 2FNJB 4NAWB 2NS5A 2B3AA 4GMVA 2WWZA 3A1QB 3U8ZA 3HIZA 1V9JA 2R2QA 4LDTD 3VH4B 2KJRA 2PEAA 4ASWC 2ZCBA 4FBJB 4HK2A 1WJ4A 4HPMB 4G50A 3HM6X 2N9EB 4MSMB 2Z0EB 3A9JA 2FCNA 4PS8A 4RMAA 3GZNI 3W1SC 2PE6B 2WX0A 4WWPA 4W9GA 5JH5C 4BFRA 4DDID 4MGKE 2DYOA 1WY8A 2C7MB 3SD5A 5LXHA 1J0GA 3ZRCA 1KJTA 5C23A 1UELA 2V4LA 3H6NA 3HM3A 3NS8A 2GOWA 2ZZPB 2FCSA 3K9OB 3QARA 3EHVA 2MP2B 5J2RA 1C3TA 1ZKHA 1UH6A 3ZDTA 4EFOA 3MJWA 2NVUI 3IVFA 1J8CA 2L3ZA 3EC8A 3B1LX 2VRRB 3TMPB 1KM7A 3PRZA 5JHAA 4EOYA 1V49A 3DBLI 4N9F4 2FIFA 2DZJA 2FAZA 2M8SA 3W1SA 1PQSA 2CU1A 2AL6A 3KH0A 4B6WA 2KVRA 2IO3B 3M95A 2GBJA 1R4NI 2JRIB 3ALBA 4EZKA 4BKTA 1WJUA 4M8MA 3AXCA 2CHZA 1V5TA
chains in the Genus database with same CATH superfamily
4TKNA 1P98A 2MBHA 1FNWA 3RPFC 1MFWA 1EWYC 1WGKA 1FNUA 3OJ3A 1GC7A 4W9DA 3QHTA 1DGJA 5CHWA 4FXCA 3RYTA 4JLCA 4P16A 3VTVA 4EZJA 1WR6E 3ZVVA 1V2YA 2SEBD 1WXAA 2NPTA 2CR5A 4BVUC 5KHOA 3RNAC 5FK9C 2E6XA 1E10A 1WJNA 1WX8A 1HZ6A 2JF5A 3ECIA 1WYWB 3CMMB 2BS3B 1F2RI 2UU7A 2W54A 4US8A 2FIDA 3Q8EA 3AU4A 1WFYA 3O13A 2WDRB 4E3CA 3A9KB 1YIWA 1UWXA 1K8RB 2WHIA 4MACA 1WRDB 1ESFA 1E8ZA 1I7HA 1CMXB 3IXSA 4RF0A 3E56A 3H7PB 4ZYSA 2KHWB 1V1PB 3B0AA 1N62A 2PE9A 2IYDB 1HTQA 3BVMA 2LGSA 1FD6A 2ZVNA 5LXIB 1PGBA 5T8IA 2GBNA 3X23A 3B2GA 5H8YE 4K1RB 1YNTE 2CS4A 1JWSD 3P2BA 3X0WA 4QAYA 5HG2A 1JRUA 3U4EG 4XDCA 3V62A 3NVYA 1TS4A 4AOFA 3APCA 5D3DA 2YEPB 2W82A 3PLVA 4CHKA 4GOCA 3L13A 4MELA 4RGTA 2V1YA 1YQ3B 3VRAB 3WIMA 4WH4A 2K8BA 4B95A 1YD8U 1MVKA 4KDLB 3WANA 1D4BA 2K8CA 3C0RB 3SU8X 3EFUA 4NPNA 2W3RA 1V81A 1FM0D 5E6OA 1OGWA 4IM0A 4DWFA 4W9HA 5HHDG 1QKZA 1WGHA 2MBBB 3OAWA 2E3TA 4WWMA 2KAJA 2HJ8A 2C7HA 1XQQA 3NRZA 2IJ0A 1GB1A 1MI0A 4NJ6A 2K0PA 4LCDE 4UDUC 3I5JC 3ZQ4A 3ZJVA 2DYMA 4GIVA 1VZ8A 3T3OA 2D11A 1JALA 3NZ3A 2AL3A 2K9XA 3CSTA 4KX6B 1FXAA 2KDBA 4P6VF 1QOAA 2KKCA 1SJED 1TJEA 2J42A 2O2VA 4ANVA 3P63A 4YT0B 3RZWC 2LASA 2MBEA 2Z59B 3PRPB 5GMVA 3N3KB 4AQ7A 1YMHE 1LQBA 3PV1A 4ZDVA 4N58A 3NVWA 5C1ZA 3L54A 3WAPA 4GB9A 4WURA 1TS3A 3RCZA 3ZNID 2N9PC 4F1SA 2AEHA 4TUUA 1EUVB 2X8XX 2LFIA 1EWCA 1PGAA 2PVOD 2Z8LA 2IPKD 4ITKA 4KZ0A 2AQ2B 4M02A 4BKGA 3T3NA 3NUHB 4XE0A 3QA8A 4W9CA 3T9LA 2W55A 4ZOHC 2BYEA 3AEGB 3O65B 1P1AA 1OQRA 4BBNC 1JWBD 4A55A 2DZIA 4AJWA 1WMHA 2VH2A 3Q3FA 1S3SG 2K22A 4DHJB 4IG7B 3AH7A 4HDOA 3ZTCA 3S2AA 1FFVA 1NYQA 4WQOB 3ZGZA 4MM3A 2L52A 3JSVB 5BMHA 4C80A 5MPOA 4DXFA 4W9IA 3Q8AA 1E90A 3A1QA 5J17A 4RM9A 1RRBA 2KX0A 1GG3A 4NJCA 1WIAA 3L10B 1OQQA 1UBQA 3I3TB 1SEBD 2KC1A 3MFGA 2YVCA 1L7YA 4NAMA 4BOZB 1TIFA 1R4MB 4KV2A 3N1XC 5TR5A 4NZLB 1FRRA 5DPRA 2INCC 5D6JB 3EGRA 3PHWB 4DHZB 3MHSD 4ANUA 2JQRB 2KNBA 2CJOA 1FNVA 1SGHA 3U7ZA 3WCQA 4HLEA 3Q2AC 1NI2A 2IBIB 4LJPB 3BVGA 2ACZB 1BUIC 4DXAB 3ZW3A 2L1AA 1RWSA 1N63A 3D32A 1JWUD 4WIPA 1P7EA 5CHFA 1A5RA 1F0ZA 2KDMA 3ZDMC 3KVFB 1MHXA 2KDIA 3CSFA 1E7PB 2KDFB 2LJIA 4JIOU 1DOYA 5LLIA 2GLSA 4XWTA 4URKA 1J7AA 2BW2A 2BKFA 4PK1A 2ONQA 3LYYA 2KJ6A 1RFAA 4ZRQA 1ET9A 4K7SA 2PVGC 3WAOA 4YXDB 3TUOA 1ZOYB 3RNCC 2MW5A 3WAMA 4RF1A 1L0VB 3Q8BA 1EU4A 3QJZA 1J19A 2GB1A 3ZNHB 4NNJB 4M8NA 3DBRI 3P4SB 5C2TB 1WM3A 3RFZB 4HCPB 4GDKA 4WJOA 2HD5B 2QJLA 1IP9A 3L0WB 2OJRA 1TS5A 4JQWC 1YQBA 3H1UA 5BMGA 2LD9A 4R3DA 2MSED 1R4NB 2WXIA 1KLVA 4EZLA 1JROA 2L05A 3W1YA 2IGHA 2HJ1A 4C4VA 4XZ4A 4A8XC 3U8ZA 3HIZA 1VDVA 2PEAA 4ASWC 1IBXB 4IOIE 4YTNB 4HK2A 1JCKB 2EKIA 2WXLA 1GB4A 2N9EB 3B9JA 3AEFB 4OW0A 4REZA 2WX0A 4W9GA 3CWIA 4DDID 4DXGA 5BYQA 5LXHA 1ZXIA 2FCSA 2V3PA 1IGDA 3BYYB 2WXFA 4EFOA 2KQ4X 3TMPB 2M8SA 3W1SA 1PQSA 1KLUD 3ALBA 2KDEB 1L4DB 4LK0M 1T0SC 4YTMB 3PPAA 5L95C 4K7WA 3PZDA 1ROEA 3DVGY 4O1NA 4YSZB 1VZ7A 4MH8A 2IY1B 3IG3A 1QOBA 3ZJTA 2CJNA 2BB5A 4ICVA 2IZVB 4PT5A 2LHEA 4RM8A 3NHEB 1QZEA 4XYCA 4HCNB 1N6ZA 2LRWA 4YWGG 2WXMA 2YEPF 4IUMB 5DPSA 3WALA 3APDA 1LM8B 5E6JA 1Z5SB 2GBRA 3DVNU 1SBBB 1XD3B 3V6EB 2V4IB 4MGIE 3PSEB 1XXGA 3BK2A 3DQVA 3DOWA 2BYFA 1E8XA 2LVQA 1L6VA 2XK5A 2LJ5A 2N7EA 3UINB 1WX9A 4HKZE 2EMSA 5L83A 2ZPYA 4JX1C 2XBBC 1HTOA 3RZFA 1A70A 1IGCA 3HHMA 1WI0A 4DHZE 4RFBA 3PTFC 4XX5A 1FPYA 2M56B 1HA5A 1FMAD 3VUYA 2KTRB 4IKGA 3U7DA 3I57A 4L1BA 4A6QA 5FR3A 1MG8A 2L0TA 3GE3C 2QHOA 4BKSD 3AEEB 2K25A 2ZEQA 2IO2B 3KW5B 5D3IB 3RD2A 1UGJA 1VD2A 1AYFA 2WQYB 1ZUD2 2KTFA 1T0RC 2KVZA 2OEDA 2KO3A 1D3ZA 1WXQA 4EEWA 1XF5L 4PYUA 2DHZA 1TZ1A 3AM9A 4EKUA 2K6DB 2KD0A 3QIJA 5D2MB 1GOZA 1F52A 5LNK1 4A3PA 3VXWA 1OEYA 4X57B 1FXTB 4A9AA 3B2FA 3ZTDA 3AE3B 3IT6B 1TKGA 4KIKA 2G9HD 3GE8C 4JL9A 2AWTA 2YLMA 4P1CC 3ZRFA 3PHXB 3RUIB 4YSYB 1KLGD 1BXTA 3AE6B 3BVZA 1UUPA 3M63B 4M0WA 2J4XA 2M1MA 4NY0A 1E8YA 3P4PB 2KJHB 2WDVB 2L76A 3RI7C 1P9DU 3AE7B 4ZRJA 2NBVB 5AZGA 1PUTA 1T5XD 5JHBA 1GC6A 3KUCB 2N7DA 2VZKB 4BAXA 2Y5CA 3ZJUA 4CYEA 2OJWA 1VRAB 2ON8A 4OVVA 2LMCA 4ICUA 4B9KA 3AE9B 5IN7A 1I4HA 3BK1A 5IKCM 1FFUA 2QC8A 2D07B 2MWSB 2J53A 1TKYA 2XEWA 2IO1B 2MLBA 3TEYA 4LNNA 3A4SC 2ZW0A 3MHZA 3VR8B 3ZNGC 3DCGA 1F9JA 2JWUA 1E0ZA 1BT0A 1RLFA 2O6VB 3AULA 4PS7A 4XDDA 4MJSB 3R7QA 2RPVA 2ZNVB 3M3JA 4WJQA 4KDIC 1EF1A 1ZW7A 1XLOA 2Y5PA 3RNFC 3PZ7A 5I4DA 2WU2B 1R7SA 1XLNA 3EECA 2DAJA 1KH0A 3UIPB 3APFA 3TJPA 2JYTA 4NAWA 1TBEA 3ZXVA 5CTRC 1TZOA 4L2YA 1EO6A 1JW9D 4GGQA 3ML8A 4GDLB 3SR6A 3UIOB 2BS2B 2N9LA 2L7RA 4I6PA 4K3BA 4DHJD 3E9SA 3TBLD 4DQOC 5E6PA 1V97A 3V6CB 2GBMA 4WWOA 1SJHD 3B08A 2W9NA 3AEAB 3RNEC 4ZRIA 3BY4B 5G5GA 1IYFA 3N30A 2IGGA 5IAAC 3TL5A 2PKOA 4M01A 3TIXA 4GXBA 2N4FA 2D2QA 4KGSA 1M94A 2A5UA 4CQNA 3L4PA 2WX1A 4C7YA 1GPXA 3UQBA 1SIJA 3R2IA 2K8HA 2REXA 2WXJA 2JPHA 2KFKB 2ASQA 4RH6A 4PS3A 2A4ZA 2D10A 4MSQB 4GSWA 2L0FA 3V05A 2WP9B 3NY5A 1L6UA 4JWSC 1FXIA 2LI5A 1YJ1A 2HDEA 5AZHA 2GBKA 1R4MI 4BBNF 1ZXHA 2JZZA 3DWGC 4IDIA 3GZNB 3QK0A 5GXGB 5DCNA 2BYVE 5D94A 2BT6A 5IO9A 1JQ4A 3A9KA 4BKSA 4ZRKA 2MCNB 3KUDB 1LFDA 4KKIA 3W5VB 4W9FA 2FE8A 4J6IA 4TSSA 4HROA 2I38A 2JU6X 3H7PA 4S17A 3URYA 1V1PA 1H8CA 5HKHA 1ZDVA 3MTNB 3ZUNA 3DBLB 3DDCB 3HUIA 4KKJA 4LNIA 3R8BA 2J52A 1RAXA 2DBYA 3VUXA 5IOIA 2D5GA 3MP9A 3DVNV 1WGRA 3DHIC 4N59A 2D3CA 4H2AA 2M0XA 3L08A 3ZIMA 1UNSA 2LZ6A 2NS5A 2WWZA 3VH4B 1C4AA 1IUEA 2MHJA 2ZW1A 2I2YA 3HM6X 4MSMB 3N9YC 2FCNA 4LNKA 4PS8A 4RMAA 1TKEA 2PE6B 1C79A 4BFRA 1TS2A 2DYOA 3NG0A 3SD5A 1KJTA 3H6NA 2NMQA 3K9OB 1C3TA 3EHVA 2MP2B 1SB3C 3ZDTA 1L0YB 3IVFA 1D5ZC 2L3ZA 1J8CA 3B1LX 1CJEA 5JHAA 3PRZA 1V49A 2DZJA 2AL6A 2KVRA 3M95A 1R4NI 2JRIB 3VTWA 3HM3A 1FRDA 1B1ZA 2VH1A 2PJHA 3NJTA 3N1ZC 3AEBB 1Y56A 4HXDA 2J7QB 3QAQA 4TV3A 2BKRB 2B76B 2MJDA 4YL8A 1YN5A 3A4RA 4FN2A 2NBUA 1I4XA 4P1BC 4GU2A 4ANXA 1B9RA 2NBWB 2LUMA 1OTRB 3ABVB 1SXTA 4OVZA 1GJZA 4A3OA 1HQRD 3IAS1 1KFYB 4ZYNA 1P7FA 2W3SA 1QILA 4FLHA 4IWPA 2L00B 2MBQA 1UF0A 3N20C 3AE1B 1OFFA 2IGDA 4J3OD 1RFKA 3MC0B 1Q5WB 4LLGM 2FBWB 2GMIC 2KANA 1WZ3A 3L16A 4EE2A 4F7ZA 5E6NA 4GLSC 2RR9A 1V6EA 4C56C 1TGZB 1DOIA 4OHJA 2D3BA 2HE7A 4FHJA 2N9XA 2QDFA 5CX3A 2LGXA 2WYQA 2RDGA 3AU5A 4IM2A 4AUQC 1AN8A 1HEZE 1DOXA 1YX5B 4ZHPA 4FADA 1L4ZB 3JSVA 3NZSA 2JWZA 2PPHA 5EE1A 4FJYA 3AE8B 3A9JB 1HXYD 1XEEA 2D3AA 4IC7B 2QILA 1I4PA 5EE9A 4CO7A 1VCBA 2K39A 4EOYA 4HDQA 1JRPA 2QSDA 4W9KA 3NS1A 3FILB 1J7BA 3P42A 1NYRA 4HEA1 3HRDD 2JRHA 4B0MA 3CIRB 1WX7A 4K81A 1FCLA 2H89B 4NJ7A 1UD7A 2XN9C 1WZ0A 5FKAC 2RDHA 3BIID 3HK0A 2Z0DB 3AE5B 1TTNA 1WGGA 2BQQA 1N5XA 2IO0B 1EF5A 4WWNA 3QQ8B 4BOSC 1CK1A 1TY2A 5D7GA 2LRUA 4AP4C 2G4SA 1WJ6A 5AUIA 4ZHOA 4E71A 2KN5A 2QCZA 4P7IA 4MEMA 2LXAA 3AMZA 3KWLA 1LO5D 3ML9A 3KQ4A 3R66C 2JXXA 3NZUA 3IAM1 4AS1A 2NPTB 1I4RA 1OEYJ 1ZP0B 4HWIB 4MT5A 4EUTA 3VFKA 1NENB 4KSKC 2FCQA 1UGMA 4W9LA 1E5WA 3V61A 2RGFA 2UWQA 2G4DB 3TEZA 1T0QC 2LWPA 2DNFA 2BB6A 3L17A 3NOBA 2AYOB 2CHWA 3FC4A 2IDYA 2PW9A 1STEA 3W2DA 2KLGA 3KUZA 1WM2A 4G0NB 4FJZA 1WH3A 2FUHB 2K6QA 2KYWA 2TSSA 1NEKB 2VZKD 2L32A 2RSUA 1D5MC 1C1YB 3R3MA 3JYUA 4IWOA 1C4CA 1UBIA 2LEKA 1AW7A 3AECB 1H4RA 1T6BX 3DBHB 4KVGB 3Q3MC 5BYRA 3V3XA 1Q0WB 3H9DA 1PDXA 4KGTA 1V80A 1F2RC 3SFDB 1C9FA 2BYTA 3QWZB 2UYZB 2KWUB 2O6VD 2MA9B 4FJVB 4K7UA 1IBXA 3ZXRA 3VQIA 1IPGA 1SE2A 2KZRA 4AJYB 1JMLA 1YQ4B 3ENEA 4IW0A 2KMAA 1D6EC 2N0SB 1Z2MA 2C60A 3JVZX 1YJJA 2KOXA 3M62B 1ZE3D 2BWES 4JWUC 5EE3A 2WXOA 1WE7A 1LGRA 2FCMA 2KN4A 5EDSA 1I4GA 2J0KA 4USAA 2RD0A 3FAHA 3GP7A 1FCCC 2M0AA 2WXNA 1WYGA 2PLPA 4WAFA 1KTKA 1I35A 1Q10A 4IM3A 1MPEA 3MC8A 4TQ1A 2EMTA 3Q3JA 4AWJA 1E7UA 5C3JB 1TY0A 4MDKE 1N5WA 2AQ3B 2O2VB 3OLMD 3EA6A 2OOBB 4HVBA 2DYBA 1GNUA 3QC8B 2MRPA 2NTTA 3T8MA 2KQ7A 1E7VA 4I6NB 2KXJA 1RYJA 3IBEA 3FKYA 1PFDA 1S1QB 1WR1A 3AI5A 3ZLZA 2JYEA 3U2SC 1WRIA 1YJIA 1ZPSA 5G5HA 2PTLA 5JXVA 1ACCA 3VVWB 3N1YC 4LDTB 3R7RA 4MH0E 4MGYE 2DZKA 2V3SA 3RT3B 4HRSA 5IA7A 2KWDA 1L2NA 1WMHB 2L8JA 1WSPA 5DPWA 1L0XB 4DK5A 1AWDA 5KHQA 1ISNA 5DPTA 1QQRA 3N32A 2L83A 4K3CA 5JZEB 3V60A 1XO3A 4ANWA 4ARIA 2CHXA 3IHPC 3NVZA 2C5LC 4MM3B 1XCQL 2NCNA 5G55A 2KC2A 3VHTC 2KTRA 1VJKA 2J0JA 1HE8A 2FNJB 2B3AA 4B0EA 3A1QB 2K3UA 1V9JA 2ZCBA 2WS3B 1NI3A 3BYTB 1WJ4A 4HPMB 1KF6B 1E6EB 3MJ5A 2Z0EB 1QOGA 3GZNI 3W1SC 5JH5C 3P1MA 4MGKE 1WY8A 5TSSA 2K5PA 2BBCA 1FEHA 3NS8A 2GOWA 1YN3A 4TMAB 5J2RA 3KWVA 3W9CB 1UH6A 1XCTL 3R2TA 3VRBB 3MJWA 2WXPA 1KM7A 1C4PA 3TEXA 1QLBB 3DBLI 2N9KA 2FIFA 2AX5A 1YN4A 3KH0A 5AUKA 3SEBA 4EZKA 1WJUA 1SF0A 3GB1A 3LXFA 1V5TA 3EFCA 2M4NA 3SDLC 2M19A 3RMKC 4ZRPA 3C8YA 2KWCA 3DHHC 1N61A 4II3B 1T3QA 2LUEA 1SE3A 1WGDA 3DPDA 1SE9A 1M4VA 4KSLC 3JW0X 1SSNA 4II2B 1MG4A 2JUOA 3UI3A 3HVDA 2EELA 3IFWB 1KRHA 1VZ6A 4W9JA 2WLBA 1V1OA 1QF6A 1MHHE 2AQ1B 3W5UB 2DLBA 1E9MA 3Q8FA 5J18A 2INNE 3EUB2 3PS6A 2SAKA 2H88B 3Q69A 3Q3OC 3LB8C 2J0MA 4ARCA 1U4AA 4A90A 1TYGB 3PZ8A 1K53A 4JGHB 1SIFA 2X38A 2G45B 4GDKB 2KQSA 2HTHA 1UZXB 2KT7A 3ZO5B 4WQMA 2JXTA 2MJEA 3P4RB 2O6VA 4RNAA 2BWFA 4MJSA 2RPQA 1C76A 4NQLB 1C78A 4C4VB 2LGDA 3BWUD 2INDC 1FO4A 1AARA 3PREA 3K9PB 1WE6A 3PLUA 3OJ4B 3Q3NC 2KX3A 1Y8RC 3C19A 2DAFA 3NVVA 3RNBC 1GUAB 4LTUA 1EU3A 3A33B 4IWQA 2WDQB 3PVLA 4MGZE 3VUWA 5AZFA 2HTME 2JT4B 2EKEC 4I6LB 4GDLA 3PRMB 1PYWD 1NBFC 3H7SA 4W9EA 3AE2B 5BO4B 1ENFA 3SFEB 3GS2A 2MX2A 3IT4B 3VTUA 1XLPA 2ICIA 3TCAA 4S0RA 1V8CA 4RGNA 2N1WA 4WAAA 4HJGE 3I63C 1XT9B 2PIAA 2KACA 4M00A 2G3QB 4E74A 4OZAA 4BZAA 3AEDB 2Q5WD 2WGSA 4RGMA 2WDTB 2WXRA 4L23A 2LHDA 2QIEB 1QT9A 2DENB 2LGIA 4ACFA 4N6EB 3HVZA 4WJPA 2V0GA 3OG5A 4A20A 2IY0B 2ZJDA 2RMMA 2Y5BB 1CQVA 3LJ3A 1G6JA 3I9V1 2R61A 2KFKA 2MQJA 1OQYA 2QMTA 3AE4B 4OZCA 1C77A 2N1VA 4TQ0A 3QCAA 5IP4D 4YSXB 3ONSA 4LJOB 1WXMA 3ETRA 1F1HA 3J9CA 2MH7A 1WXVA 2KMCA 4XC2A 3LDZE 2XK5B 2MEKA 3CF6E 3DBSA 4G3XB 1P0RA 4Q2JA 3VH3B 3AB5A 2BF8B 1MJDA 2N7JA 5AEKB 1I4QA 4HJKA 2LVOA 3RNGC 3VAWA 2WNMA 3RULA 3UF8A 1BMLC 5FR6A 3Q6BA 1TT5B 2JY6A 1Q1OA 3H8HA 1YX6B 3MC9A 3DWMA 3ZNZB 4YTPB 2BPSA 3GOEA 2M17A 1CZPA 1F77A 1JWAD 5H92C 2BS4B 2WXGA 2WU5B 4PYZA 1SE4A 1LXDA 2LGYA 4HPLB 1VLBA 5CHVC 1WXSA 3WA0A 4F8CB 1GAQB 3RN9C 3ZYYX 4FA6A 5G2NA 1VR9A 2V3NA 1I42A 1ET6A 3PGEA 3UGBB 3SHQA 1WWTA 3DVGX 2PMVA 4KIKB 3BZDB 1K52A 1V86A 2XNAC 2BVCA 1V5OA 2C7NB 4HPPA 4OZBA 2DWQA 2I1JA 3U30A 2MP2A 2WXHA 2KWVB 3ZKJC 2R2OA 4NQKE 2NTSA 2ZPNA 3BINA 4M0WB 1DYQA 2RDBC 1KOTA 1T0YA 1D5XC 1ZGUB 4XGAB 1QOFA 4FHKA 1N60A 3DBRB 3U52E 3DBHI 1EM7A 5HFYA 2JX5A 2GI9A 2MJ3A 2C9WB 3AV8A 2KLCA 3AN1A 4XWWA 2JSVX 1RM6C 2BGFA 2WXKA 1NDDA 4RGOS 1WGYA 2CKHB 4WJNA 4JE3B 2BTEA 2JZPA 2LVPA 2DX5B 3VDZA 4DBGA 2ZCCA 1XLQA 5EE0A 2KFJA 3UQAA 3PO0A 2V9HA 4DDGD 1UWMA 2JVCA 3Q8CA 1X1MA 1K51A 1J7CA 3P4QB 4KGRA 3VR9B 1L5PA 3KYDD 2I1KA 4OVUA 2ZNVC 2D3GA 2LXCA 2OHFA 3TSSA 2ZVOA 5HI1A 3TEWA 4KZCA 3PT2B 1NVID 4G11A 1P3QU 3QX1A 2NR2A 2DZMA 1WF9A 3KYCD 2K1FA 5BMIA 4JPSA 4HKQA 1E8WA 4C7ZA 4LNFA 2KK8A 4GN1A 2JZ3B 2KMMA 2CU3A 3KLSX 4FULA 2MBOA 1YOVB 4NAWB 1HZ5A 4GMVA 2R2QA 3DHGC 4LDTD 2KJRA 4LNOA 4FBJB 1FIQA 2INPE 4G50A 3A9JA 5BYSA 3Q14C 4WWPA 2G1EA 2GRIA 4US9A 1ZDXA 4C00A 2C7MB 2Y3AA 1J0GA 3ZRCA 3OWEB 5C23A 1UELA 2V4LA 2FUG1 2ZZPB 3QARA 1ZKHA 3FILA 1PGXA 2WXQA 1JWMD 2NVUI 3EC8A 4D2KA 2QEJC 2VRRB 4N9F4 2FAZA 1K50A 2CU1A 4B6WA 2IO3B 4RCOA 2GBJA 4BKTA 4M8MA 3AXCA 2CHZA
chains in the Genus database with same CATH topology
4TKNA 2KDEB 2M4NA 3SDLC 1P98A 2MBHA 2PJHA 3PPAA 5L95C 3OJ3A 1GC7A 4K7WA 3PZDA 2KWCA 4W9DA 4HXDA 3QHTA 4II3B 3DVGY 5CHWA 2J7QB 3RYTA 4JLCA 3VTVA 4EZJA 1WR6E 2IY1B 3QAQA 4TV3A 2LUEA 3IG3A 3ZVVA 2BKRB 1WGDA 3DPDA 1SE9A 4YL8A 3A4RA 4FN2A 2NBUA 4KSLC 1V2YA 4GU2A 4ICVA 3JW0X 1WXAA 2NPTA 4ANXA 4II2B 2CR5A 4BVUC 5KHOA 2JUOA 2IZVB 2NBWB 1WJNA 1WX8A 3IFWB 1OTRB 2JF5A 3ECIA 4RM8A 3NHEB 1QZEA 4W9JA 1WYWB 3CMMB 4HCNB 2FIDA 1GJZA 2LRWA 4A3OA 3AU4A 4ZYNA 4IUMB 5DPSA 3WALA 1WFYA 3APDA 1LM8B 1Z5SB 2GBRA 3DVNU 1XD3B 3V6EB 5J18A 4FLHA 4MGIE 3PSEB 4E3CA 3A9KB 3PS6A 4IWPA 1YIWA 2L00B 2MBQA 3DQVA 3DOWA 1K8RB 1WRDB 2BYFA 1E8XA 2LVQA 1E8ZA 1Q5WB 2XK5A 2LJ5A 2N7EA 2J0MA 1CMXB 1U4AA 2GMIC 3H7PB 2KHWB 3UINB 4JGHB 2KANA 1SIFA 1WZ3A 3B0AA 3L16A 2PE9A 2IYDB 1WX9A 2G45B 2KQSA 4GDKB 4F7ZA 2HTHA 1UZXB 2EMSA 2ZPYA 2ZVNA 5E6NA 3ZO5B 5L83A 5LXIB 2XBBC 3RZFA 2GBNA 2RR9A 3X23A 1V6EA 3HHMA 1WI0A 2O6VA 1TGZB 4K1RB 2BWFA 2CS4A 4MJSA 2HE7A 4FHJA 2RPQA 4DHZE 3P2BA 2N9XA 4NQLB 3X0WA 3PTFC 4XX5A 1JRUA 5CX3A 2LGDA 2LGXA 2WYQA 1AARA 3PREA 3AU5A 2KTRB 3K9PB 3U7DA 4IM2A 3VUYA 4AUQC 1WE6A 1MG8A 2L0TA 3V62A 2QHOA 4BKSD 2K25A 3PLUA 3OJ4B 2ZEQA 4AOFA 2IO2B 3APCA 3KW5B 2KX3A 1Y8RC 1YX5B 2DAFA 1VD2A 3PLVA 3RD2A 4CHKA 4GOCA 3L13A 1GUAB 3JSVA 2KTFA 3NZSA 4FADA 4MELA 2JWZA 2PPHA 2V1YA 2KO3A 4FJYA 1D3ZA 3A9JB 3WIMA 4EEWA 4PYUA 3A33B 4IWQA 2K8BA 2DHZA 3PVLA 4IC7B 1YD8U 1TZ1A 4MGZE 4B95A 4KDLB 4EKUA 2K6DB 2KD0A 3QIJA 3WANA 3VUWA 5AZFA 2JT4B 5D2MB 4CO7A 2EKEC 4I6LB 1VCBA 4GDLA 4A3PA 2K39A 2K8CA 3C0RB 3PRMB 1NBFC 3H7SA 1OEYA 4HDQA 4W9EA 4X57B 5BO4B 3EFUA 3SU8X 3VXWA 1FXTB 4NPNA 4W9KA 3ZTDA 1V81A 5E6OA 1OGWA 2MX2A 4KIKA 4IM0A 4DWFA 2JRHA 3VTUA 4W9HA 3TCAA 1WX7A 4JL9A 4K81A 2AWTA 2YLMA 2N1WA 4WAAA 3VTWA 3ZRFA 3PHXB 1XT9B 3RUIB 4NJ7A 1UD7A 1WGHA 1WZ0A 2MBBB 2G3QB 3OAWA 4E74A 3HK0A 2Z0DB 1TTNA 1WGGA 2IO0B 1EF5A 3M63B 4WWNA 2HJ8A 2M1MA 4NY0A 2C7HA 2WDTB 1XQQA 3QQ8B 1E8YA 4BOSC 4NJ6A 2KJHB 5D7GA 2LRUA 4AP4C 2G4SA 4LCDE 1WJ6A 2DENB 4E71A 2KN5A 2DYMA 4GIVA 4MEMA 2LXAA 4P7IA 2L76A 2D11A 3ML9A 3R66C 4WJPA 1P9DU 2AL3A 2JXXA 2NBVB 3NZUA 4ZRJA 5AZGA 3CSTA 4A20A 2IY0B 2NPTB 2ZJDA 5JHBA 2Y5BB 2KDBA 3LJ3A 1OEYJ 1GC6A 2KKCA 3KUCB 1G6JA 4HWIB 2O2VA 2N7DA 4ANVA 2KFKA 4EUTA 2MQJA 1OQYA 3RZWC 4CYEA 2LASA 3VFKA 2MBEA 2Z59B 4KSKC 3PRPB 5GMVA 2N1VA 2FCQA 4TQ0A 3QCAA 1UGMA 3N3KB 4W9LA 4OVVA 1E5WA 1LQBA 3PV1A 3V61A 2RGFA 2UWQA 4ZDVA 3ONSA 4ICUA 1WXMA 2G4DB 4LJOB 4B9KA 2LWPA 3L54A 5C1ZA 3WAPA 4GB9A 3RCZA 1WXVA 2KMCA 3ZNID 3L17A 4XC2A 2D07B 2N9PC 3NOBA 2MWSB 2AEHA 2AYOB 4F1SA 3LDZE 4TUUA 1EUVB 2XK5B 2CHWA 3CF6E 3DBSA 4G3XB 1P0RA 2XEWA 2IO1B 2MLBA 2KLGA 3KUZA 4KZ0A 1WM2A 4BKGA 3A4SC 4G0NB 3VH3B 2BF8B 3QA8A 4W9CA 3ZNGC 3T9LA 3DCGA 1F9JA 1WH3A 4FJZA 5AEKB 2FUHB 4HJKA 2LVOA 2K6QA 1BT0A 1RLFA 2BYEA 3VAWA 2O6VB 3AULA 3O65B 4PS7A 4MJSB 3R7QA 3RULA 1P1AA 3UF8A 2RSUA 5FR6A 1C1YB 3R3MA 4BBNC 2ZNVB 2DZIA 3JYUA 4AJWA 2JY6A 3M3JA 1WMHA 4IWOA 4WJQA 1Q1OA 1UBIA 4KDIC 1YX6B 3Q3FA 1EF1A 1S3SG 1ZW7A 4DHJB 4IG7B 4HDOA 3ZNZB 3ZTCA 3S2AA 1H4RA 2BPSA 2DAJA 3EECA 3GOEA 4WQOB 4MM3A 3JSVB 2M17A 4KVGB 1Q0WB 3H9DA 3UIPB 3APFA 4W9IA 3TJPA 4PYZA 1LXDA 2LGYA 4HPLB 4NAWA 1V80A 1WXSA 1TBEA 5CHVC 5CTRC 1E90A 3WA0A 3A1QA 4F8CB 5J17A 3QWZB 2UYZB 1EO6A 4RM9A 2KWUB 4GGQA 1RRBA 2KX0A 2O6VD 3ML8A 4GDLB 2MA9B 4FJVB 1GG3A 3UIOB 4K7UA 3VQIA 1IPGA 4FA6A 5G2NA 1WIAA 3L10B 2KZRA 1I42A 4AJYB 3UGBB 1UBQA 3I3TB 3PGEA 3SHQA 2L7RA 3ENEA 4IW0A 3DVGX 2KC1A 2KMAA 4KIKB 4I6PA 1Z2MA 2C60A 2YVCA 3JVZX 4DHJD 1L7YA 1V86A 3TBLD 1V5OA 2C7NB 2KOXA 4BOZB 5E6PA 3V6CB 3M62B 2BWES 2GBMA 4KV2A 5TR5A 4WWOA 2I1JA 5DPRA 3B08A 3U30A 1WE7A 2MP2A 2W9NA 2KWVB 3ZKJC 5D6JB 3PHWB 2R2OA 4NQKE 4ZRIA 4DHZB 3MHSD 2ZPNA 2FCMA 3BINA 3BY4B 4ANUA 2KNBA 1IYFA 4M0WB 5EDSA 2J0KA 3N30A 1SGHA 2RD0A 1KOTA 1T0YA 5IAAC 4HLEA 1NI2A 2IBIB 4LJPB 3TL5A 1ZGUB 4DXAB 4FHKA 3TIXA 4GXBA 3ZW3A 2N4FA 1I35A 2D2QA 3D32A 1M94A 2A5UA 4IM3A 2WX1A 3DBHI 5CHFA 1A5RA 4TQ1A 2EMTA 3Q3JA 3ZDMC 3KVFB 3UQBA 4AWJA 2KDIA 1E7UA 3CSFA 2KDFB 2K8HA 4JIOU 2C9WB 4MDKE 2REXA 5LLIA 2KLCA 4URKA 2JPHA 2O2VB 3OLMD 2KFKB 2ASQA 2BGFA 2OOBB 4PS3A 4HVBA 1NDDA 2A4ZA 2D10A 2DYBA 1WGYA 2BKFA 4MSQB 4GSWA 1GNUA 2L0FA 3QC8B 2MRPA 3NY5A 2CKHB 2KJ6A 4WJNA 1RFAA 4K7SA 3T8MA 2KQ7A 2LVPA 2LI5A 2DX5B 3WAOA 3VDZA 1E7VA 4DBGA 1YJ1A 4I6NB 5AZHA 2GBKA 2ZCCA 1R4MI 2KXJA 3IBEA 4BBNF 2KFJA 3UQAA 2JZZA 2MW5A 3WAMA 4DDGD 2JVCA 1S1QB 1WR1A 1X1MA 3AI5A 3QK0A 3ZLZA 5DCNA 3QJZA 1J19A 2BYVE 5D94A 3ZNHB 3A9KA 4BKSA 3KYDD 2I1KA 4ZRKA 2MCNB 3KUDB 1LFDA 4NNJB 4OVUA 2ZNVC 2D3GA 2LXCA 3VVWB 4LDTB 4W9FA 4J6IA 2ZVOA 3R7RA 4KZCA 3PT2B 4MH0E 4MGYE 4M8NA 2DZKA 2V3SA 3DBRI 3RT3B 5IA7A 4G11A 1L2NA 1P3QU 3H7PA 3QX1A 1WMHB 1WM3A 1H8CA 5HKHA 2L8JA 4HCPB 3MTNB 5DPWA 3ZUNA 2NR2A 4GDKA 4WJOA 3DDCB 2DZMA 2HD5B 1WF9A 4DK5A 1IP9A 3L0WB 2OJRA 2K1FA 3KYCD 5KHQA 1ISNA 1RAXA 1YQBA 3H1UA 4JQWC 3N32A 5DPTA 2LD9A 3VUXA 5JZEB 3V60A 3DVNV 1E8WA 1WGRA 4ANWA 2MSED 2CHXA 3IHPC 2C5LC 1KLVA 2NCNA 5G55A 4EZLA 2KC2A 2KK8A 2L05A 3W1YA 4GN1A 2JZ3B 3VHTC 4FULA 2M0XA 2KTRA 2J0JA 3L08A 1HE8A 2MBOA 4XZ4A 3ZIMA 2LZ6A 2FNJB 4NAWB 2NS5A 2B3AA 4GMVA 2WWZA 3A1QB 3U8ZA 3HIZA 1V9JA 2R2QA 4LDTD 3VH4B 2KJRA 2PEAA 4ASWC 2ZCBA 4FBJB 4HK2A 1WJ4A 4HPMB 4G50A 3HM6X 2N9EB 4MSMB 2Z0EB 3A9JA 2FCNA 4PS8A 4RMAA 3GZNI 3W1SC 2PE6B 2WX0A 4WWPA 4W9GA 5JH5C 4BFRA 4DDID 4MGKE 2DYOA 1WY8A 2C7MB 3SD5A 5LXHA 1J0GA 3ZRCA 1KJTA 5C23A 1UELA 2V4LA 3H6NA 3HM3A 3NS8A 2GOWA 2ZZPB 2FCSA 3K9OB 3QARA 3EHVA 2MP2B 5J2RA 1C3TA 1ZKHA 1UH6A 3ZDTA 4EFOA 3MJWA 2NVUI 3IVFA 1J8CA 2L3ZA 3EC8A 3B1LX 2VRRB 3TMPB 1KM7A 3PRZA 5JHAA 4EOYA 1V49A 3DBLI 4N9F4 2FIFA 2DZJA 2FAZA 2M8SA 3W1SA 1PQSA 2CU1A 2AL6A 3KH0A 4B6WA 2KVRA 2IO3B 3M95A 2GBJA 1R4NI 2JRIB 3ALBA 4EZKA 4BKTA 1WJUA 4M8MA 3AXCA 2CHZA 1V5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TKN A;  2KDE B;  2M4N A;  3SDL C;  1P98 A;  2MBH A;  2PJH A;  3PPA A;  5L95 C;  3OJ3 A;  1GC7 A;  4K7W A;  3PZD A;  2KWC A;  4W9D A;  4HXD A;  3QHT A;  4II3 B;  3DVG Y;  5CHW A;  2J7Q B;  3RYT A;  4JLC A;  3VTV A;  4EZJ A;  1WR6 E;  2IY1 B;  3QAQ A;  4TV3 A;  2LUE A;  3IG3 A;  3ZVV A;  2BKR B;  1WGD A;  3DPD A;  1SE9 A;  4YL8 A;  3A4R A;  4FN2 A;  2NBU A;  4KSL C;  1V2Y A;  4GU2 A;  4ICV A;  3JW0 X;  1WXA A;  2NPT A;  4ANX A;  4II2 B;  2CR5 A;  4BVU C;  5KHO A;  2JUO A;  2IZV B;  2NBW B;  1WJN A;  1WX8 A;  3IFW B;  1OTR B;  2JF5 A;  3ECI A;  4RM8 A;  3NHE B;  1QZE A;  4W9J A;  1WYW B;  3CMM B;  4HCN B;  2FID A;  1GJZ A;  2LRW A;  4A3O A;  3AU4 A;  4ZYN A;  4IUM B;  5DPS A;  3WAL A;  1WFY A;  3APD A;  1LM8 B;  1Z5S B;  2GBR A;  3DVN U;  1XD3 B;  3V6E B;  5J18 A;  4FLH A;  4MGI E;  3PSE B;  4E3C A;  3A9K B;  3PS6 A;  4IWP A;  1YIW A;  2L00 B;  2MBQ A;  3DQV A;  3DOW A;  1K8R B;  1WRD B;  2BYF A;  1E8X A;  2LVQ A;  1E8Z A;  1Q5W B;  2XK5 A;  2LJ5 A;  2N7E A;  2J0M A;  1CMX B;  1U4A A;  2GMI C;  3H7P B;  2KHW B;  3UIN B;  4JGH B;  2KAN A;  1SIF A;  1WZ3 A;  3B0A A;  3L16 A;  2PE9 A;  2IYD B;  1WX9 A;  2G45 B;  2KQS A;  4GDK B;  4F7Z A;  2HTH A;  1UZX B;  2EMS A;  2ZPY A;  2ZVN A;  5E6N A;  3ZO5 B;  5L83 A;  5LXI B;  2XBB C;  3RZF A;  2GBN A;  2RR9 A;  3X23 A;  1V6E A;  3HHM A;  1WI0 A;  2O6V A;  1TGZ B;  4K1R B;  2BWF A;  2CS4 A;  4MJS A;  2HE7 A;  4FHJ A;  2RPQ A;  4DHZ E;  3P2B A;  2N9X A;  4NQL B;  3X0W A;  3PTF C;  4XX5 A;  1JRU A;  5CX3 A;  2LGD A;  2LGX A;  2WYQ A;  1AAR A;  3PRE A;  3AU5 A;  2KTR B;  3K9P B;  3U7D A;  4IM2 A;  3VUY A;  4AUQ C;  1WE6 A;  1MG8 A;  2L0T A;  3V62 A;  2QHO A;  4BKS D;  2K25 A;  3PLU A;  3OJ4 B;  2ZEQ A;  4AOF A;  2IO2 B;  3APC A;  3KW5 B;  2KX3 A;  1Y8R C;  1YX5 B;  2DAF A;  1VD2 A;  3PLV A;  3RD2 A;  4CHK A;  4GOC A;  3L13 A;  1GUA B;  3JSV A;  2KTF A;  3NZS A;  4FAD A;  4MEL A;  2JWZ A;  2PPH A;  2V1Y A;  2KO3 A;  4FJY A;  1D3Z A;  3A9J B;  3WIM A;  4EEW A;  4PYU A;  3A33 B;  4IWQ A;  2K8B A;  2DHZ A;  3PVL A;  4IC7 B;  1YD8 U;  1TZ1 A;  4MGZ E;  4B95 A;  4KDL B;  4EKU A;  2K6D B;  2KD0 A;  3QIJ A;  3WAN A;  3VUW A;  5AZF A;  2JT4 B;  5D2M B;  4CO7 A;  2EKE C;  4I6L B;  1VCB A;  4GDL A;  4A3P A;  2K39 A;  2K8C A;  3C0R B;  3PRM B;  1NBF C;  3H7S A;  1OEY A;  4HDQ A;  4W9E A;  4X57 B;  5BO4 B;  3EFU A;  3SU8 X;  3VXW A;  1FXT B;  4NPN A;  4W9K A;  3ZTD A;  1V81 A;  5E6O A;  1OGW A;  2MX2 A;  4KIK A;  4IM0 A;  4DWF A;  2JRH A;  3VTU A;  4W9H A;  3TCA A;  1WX7 A;  4JL9 A;  4K81 A;  2AWT A;  2YLM A;  2N1W A;  4WAA A;  3VTW A;  3ZRF A;  3PHX B;  1XT9 B;  3RUI B;  4NJ7 A;  1UD7 A;  1WGH A;  1WZ0 A;  2MBB B;  2G3Q B;  3OAW A;  4E74 A;  3HK0 A;  2Z0D B;  1TTN A;  1WGG A;  2IO0 B;  1EF5 A;  3M63 B;  4WWN A;  2HJ8 A;  2M1M A;  4NY0 A;  2C7H A;  2WDT B;  1XQQ A;  3QQ8 B;  1E8Y A;  4BOS C;  4NJ6 A;  2KJH B;  5D7G A;  2LRU A;  4AP4 C;  2G4S A;  4LCD E;  1WJ6 A;  2DEN B;  4E71 A;  2KN5 A;  2DYM A;  4GIV A;  4MEM A;  2LXA A;  4P7I A;  2L76 A;  2D11 A;  3ML9 A;  3R66 C;  4WJP A;  1P9D U;  2AL3 A;  2JXX A;  2NBV B;  3NZU A;  4ZRJ A;  5AZG A;  3CST A;  4A20 A;  2IY0 B;  2NPT B;  2ZJD A;  5JHB A;  2Y5B B;  2KDB A;  3LJ3 A;  1OEY J;  1GC6 A;  2KKC A;  3KUC B;  1G6J A;  4HWI B;  2O2V A;  2N7D A;  4ANV A;  2KFK A;  4EUT A;  2MQJ A;  1OQY A;  3RZW C;  4CYE A;  2LAS A;  3VFK A;  2MBE A;  2Z59 B;  4KSK C;  3PRP B;  5GMV A;  2N1V A;  2FCQ A;  4TQ0 A;  3QCA A;  1UGM A;  3N3K B;  4W9L A;  4OVV A;  1E5W A;  1LQB A;  3PV1 A;  3V61 A;  2RGF A;  2UWQ A;  4ZDV A;  3ONS A;  4ICU A;  1WXM A;  2G4D B;  4LJO B;  4B9K A;  2LWP A;  3L54 A;  5C1Z A;  3WAP A;  4GB9 A;  3RCZ A;  1WXV A;  2KMC A;  3ZNI D;  3L17 A;  4XC2 A;  2D07 B;  2N9P C;  3NOB A;  2MWS B;  2AEH A;  2AYO B;  4F1S A;  3LDZ E;  4TUU A;  1EUV B;  2XK5 B;  2CHW A;  3CF6 E;  3DBS A;  4G3X B;  1P0R A;  2XEW A;  2IO1 B;  2MLB A;  2KLG A;  3KUZ A;  4KZ0 A;  1WM2 A;  4BKG A;  3A4S C;  4G0N B;  3VH3 B;  2BF8 B;  3QA8 A;  4W9C A;  3ZNG C;  3T9L A;  3DCG A;  1F9J A;  1WH3 A;  4FJZ A;  5AEK B;  2FUH B;  4HJK A;  2LVO A;  2K6Q A;  1BT0 A;  1RLF A;  2BYE A;  3VAW A;  2O6V B;  3AUL A;  3O65 B;  4PS7 A;  4MJS B;  3R7Q A;  3RUL A;  1P1A A;  3UF8 A;  2RSU A;  5FR6 A;  1C1Y B;  3R3M A;  4BBN C;  2ZNV B;  2DZI A;  3JYU A;  4AJW A;  2JY6 A;  3M3J A;  1WMH A;  4IWO A;  4WJQ A;  1Q1O A;  1UBI A;  4KDI C;  1YX6 B;  3Q3F A;  1EF1 A;  1S3S G;  1ZW7 A;  4DHJ B;  4IG7 B;  4HDO A;  3ZNZ B;  3ZTC A;  3S2A A;  1H4R A;  2BPS A;  2DAJ A;  3EEC A;  3GOE A;  4WQO B;  4MM3 A;  3JSV B;  2M17 A;  4KVG B;  1Q0W B;  3H9D A;  3UIP B;  3APF A;  4W9I A;  3TJP A;  4PYZ A;  1LXD A;  2LGY A;  4HPL B;  4NAW A;  1V80 A;  1WXS A;  1TBE A;  5CHV C;  5CTR C;  1E90 A;  3WA0 A;  3A1Q A;  4F8C B;  5J17 A;  3QWZ B;  2UYZ B;  1EO6 A;  4RM9 A;  2KWU B;  4GGQ A;  1RRB A;  2KX0 A;  2O6V D;  3ML8 A;  4GDL B;  2MA9 B;  4FJV B;  1GG3 A;  3UIO B;  4K7U A;  3VQI A;  1IPG A;  4FA6 A;  5G2N A;  1WIA A;  3L10 B;  2KZR A;  1I42 A;  4AJY B;  3UGB B;  1UBQ A;  3I3T B;  3PGE A;  3SHQ A;  2L7R A;  3ENE A;  4IW0 A;  3DVG X;  2KC1 A;  2KMA A;  4KIK B;  4I6P A;  1Z2M A;  2C60 A;  2YVC A;  3JVZ X;  4DHJ D;  1L7Y A;  1V86 A;  3TBL D;  1V5O A;  2C7N B;  2KOX A;  4BOZ B;  5E6P A;  3V6C B;  3M62 B;  2BWE S;  2GBM A;  4KV2 A;  5TR5 A;  4WWO A;  2I1J A;  5DPR A;  3B08 A;  3U30 A;  1WE7 A;  2MP2 A;  2W9N A;  2KWV B;  3ZKJ C;  5D6J B;  3PHW B;  2R2O A;  4NQK E;  4ZRI A;  4DHZ B;  3MHS D;  2ZPN A;  2FCM A;  3BIN A;  3BY4 B;  4ANU A;  2KNB A;  1IYF A;  4M0W B;  5EDS A;  2J0K A;  3N30 A;  1SGH A;  2RD0 A;  1KOT A;  1T0Y A;  5IAA C;  4HLE A;  1NI2 A;  2IBI B;  4LJP B;  3TL5 A;  1ZGU B;  4DXA B;  4FHK A;  3TIX A;  4GXB A;  3ZW3 A;  2N4F A;  1I35 A;  2D2Q A;  3D32 A;  1M94 A;  2A5U A;  4IM3 A;  2WX1 A;  3DBH I;  5CHF A;  1A5R A;  4TQ1 A;  2EMT A;  3Q3J A;  3ZDM C;  3KVF B;  3UQB A;  4AWJ A;  2KDI A;  1E7U A;  3CSF A;  2KDF B;  2K8H A;  4JIO U;  2C9W B;  4MDK E;  2REX A;  5LLI A;  2KLC A;  4URK A;  2JPH A;  2O2V B;  3OLM D;  2KFK B;  2ASQ A;  2BGF A;  2OOB B;  4PS3 A;  4HVB A;  1NDD A;  2A4Z A;  2D10 A;  2DYB A;  1WGY A;  2BKF A;  4MSQ B;  4GSW A;  1GNU A;  2L0F A;  3QC8 B;  2MRP A;  3NY5 A;  2CKH B;  2KJ6 A;  4WJN A;  1RFA A;  4K7S A;  3T8M A;  2KQ7 A;  2LVP A;  2LI5 A;  2DX5 B;  3WAO A;  3VDZ A;  1E7V A;  4DBG A;  1YJ1 A;  4I6N B;  5AZH A;  2GBK A;  2ZCC A;  1R4M I;  2KXJ A;  3IBE A;  4BBN F;  2KFJ A;  3UQA A;  2JZZ A;  2MW5 A;  3WAM A;  4DDG D;  2JVC A;  1S1Q B;  1WR1 A;  1X1M A;  3AI5 A;  3QK0 A;  3ZLZ A;  5DCN A;  3QJZ A;  1J19 A;  2BYV E;  5D94 A;  3ZNH B;  3A9K A;  4BKS A;  3KYD D;  2I1K A;  4ZRK A;  2MCN B;  3KUD B;  1LFD A;  4NNJ B;  4OVU A;  2ZNV C;  2D3G A;  2LXC A;  3VVW B;  4LDT B;  4W9F A;  4J6I A;  2ZVO A;  3R7R A;  4KZC A;  3PT2 B;  4MH0 E;  4MGY E;  4M8N A;  2DZK A;  2V3S A;  3DBR I;  3RT3 B;  5IA7 A;  4G11 A;  1L2N A;  1P3Q U;  3H7P A;  3QX1 A;  1WMH B;  1WM3 A;  1H8C A;  5HKH A;  2L8J A;  4HCP B;  3MTN B;  5DPW A;  3ZUN A;  2NR2 A;  4GDK A;  4WJO A;  3DDC B;  2DZM A;  2HD5 B;  1WF9 A;  4DK5 A;  1IP9 A;  3L0W B;  2OJR A;  2K1F A;  3KYC D;  5KHQ A;  1ISN A;  1RAX A;  1YQB A;  3H1U A;  4JQW C;  3N32 A;  5DPT A;  2LD9 A;  3VUX A;  5JZE B;  3V60 A;  3DVN V;  1E8W A;  1WGR A;  4ANW A;  2MSE D;  2CHX A;  3IHP C;  2C5L C;  1KLV A;  2NCN A;  5G55 A;  4EZL A;  2KC2 A;  2KK8 A;  2L05 A;  3W1Y A;  4GN1 A;  2JZ3 B;  3VHT C;  4FUL A;  2M0X A;  2KTR A;  2J0J A;  3L08 A;  1HE8 A;  2MBO A;  4XZ4 A;  3ZIM A;  2LZ6 A;  2FNJ B;  4NAW B;  2NS5 A;  2B3A A;  4GMV A;  2WWZ A;  3A1Q B;  3U8Z A;  3HIZ A;  1V9J A;  2R2Q A;  4LDT D;  3VH4 B;  2KJR A;  2PEA A;  4ASW C;  2ZCB A;  4FBJ B;  4HK2 A;  1WJ4 A;  4HPM B;  4G50 A;  3HM6 X;  2N9E B;  4MSM B;  2Z0E B;  3A9J A;  2FCN A;  4PS8 A;  4RMA A;  3GZN I;  3W1S C;  2PE6 B;  2WX0 A;  4WWP A;  4W9G A;  5JH5 C;  4BFR A;  4DDI D;  4MGK E;  2DYO A;  1WY8 A;  2C7M B;  3SD5 A;  5LXH A;  1J0G A;  3ZRC A;  1KJT A;  5C23 A;  1UEL A;  2V4L A;  3H6N A;  3HM3 A;  3NS8 A;  2GOW A;  2ZZP B;  2FCS A;  3K9O B;  3QAR A;  3EHV A;  2MP2 B;  5J2R A;  1C3T A;  1ZKH A;  1UH6 A;  3ZDT A;  4EFO A;  3MJW A;  2NVU I;  3IVF A;  1J8C A;  2L3Z A;  3EC8 A;  3B1L X;  2VRR B;  3TMP B;  1KM7 A;  3PRZ A;  5JHA A;  4EOY A;  1V49 A;  3DBL I;  4N9F 4;  2FIF A;  2DZJ A;  2FAZ A;  2M8S A;  3W1S A;  1PQS A;  2CU1 A;  2AL6 A;  3KH0 A;  4B6W A;  2KVR A;  2IO3 B;  3M95 A;  2GBJ A;  1R4N I;  2JRI B;  3ALB A;  4EZK A;  4BKT A;  1WJU A;  4M8M A;  3AXC A;  2CHZ A;  1V5T A; 
#chains in the Genus database with same CATH topology
 4TKN A;  1P98 A;  2MBH A;  1FNW A;  3RPF C;  1MFW A;  1EWY C;  1WGK A;  1FNU A;  3OJ3 A;  1GC7 A;  4W9D A;  3QHT A;  1DGJ A;  5CHW A;  4FXC A;  3RYT A;  4JLC A;  4P16 A;  3VTV A;  4EZJ A;  1WR6 E;  3ZVV A;  1V2Y A;  2SEB D;  1WXA A;  2NPT A;  2CR5 A;  4BVU C;  5KHO A;  3RNA C;  5FK9 C;  2E6X A;  1E10 A;  1WJN A;  1WX8 A;  1HZ6 A;  2JF5 A;  3ECI A;  1WYW B;  3CMM B;  2BS3 B;  1F2R I;  2UU7 A;  2W54 A;  4US8 A;  2FID A;  3Q8E A;  3AU4 A;  1WFY A;  3O13 A;  2WDR B;  4E3C A;  3A9K B;  1YIW A;  1UWX A;  1K8R B;  2WHI A;  4MAC A;  1WRD B;  1ESF A;  1E8Z A;  1I7H A;  1CMX B;  3IXS A;  4RF0 A;  3E56 A;  3H7P B;  4ZYS A;  2KHW B;  1V1P B;  3B0A A;  1N62 A;  2PE9 A;  2IYD B;  1HTQ A;  3BVM A;  2LGS A;  1FD6 A;  2ZVN A;  5LXI B;  1PGB A;  5T8I A;  2GBN A;  3X23 A;  3B2G A;  5H8Y E;  4K1R B;  1YNT E;  2CS4 A;  1JWS D;  3P2B A;  3X0W A;  4QAY A;  5HG2 A;  1JRU A;  3U4E G;  4XDC A;  3V62 A;  3NVY A;  1TS4 A;  4AOF A;  3APC A;  5D3D A;  2YEP B;  2W82 A;  3PLV A;  4CHK A;  4GOC A;  3L13 A;  4MEL A;  4RGT A;  2V1Y A;  1YQ3 B;  3VRA B;  3WIM A;  4WH4 A;  2K8B A;  4B95 A;  1YD8 U;  1MVK A;  4KDL B;  3WAN A;  1D4B A;  2K8C A;  3C0R B;  3SU8 X;  3EFU A;  4NPN A;  2W3R A;  1V81 A;  1FM0 D;  5E6O A;  1OGW A;  4IM0 A;  4DWF A;  4W9H A;  5HHD G;  1QKZ A;  1WGH A;  2MBB B;  3OAW A;  2E3T A;  4WWM A;  2KAJ A;  2HJ8 A;  2C7H A;  1XQQ A;  3NRZ A;  2IJ0 A;  1GB1 A;  1MI0 A;  4NJ6 A;  2K0P A;  4LCD E;  4UDU C;  3I5J C;  3ZQ4 A;  3ZJV A;  2DYM A;  4GIV A;  1VZ8 A;  3T3O A;  2D11 A;  1JAL A;  3NZ3 A;  2AL3 A;  2K9X A;  3CST A;  4KX6 B;  1FXA A;  2KDB A;  4P6V F;  1QOA A;  2KKC A;  1SJE D;  1TJE A;  2J42 A;  2O2V A;  4ANV A;  3P63 A;  4YT0 B;  3RZW C;  2LAS A;  2MBE A;  2Z59 B;  3PRP B;  5GMV A;  3N3K B;  4AQ7 A;  1YMH E;  1LQB A;  3PV1 A;  4ZDV A;  4N58 A;  3NVW A;  5C1Z A;  3L54 A;  3WAP A;  4GB9 A;  4WUR A;  1TS3 A;  3RCZ A;  3ZNI D;  2N9P C;  4F1S A;  2AEH A;  4TUU A;  1EUV B;  2X8X X;  2LFI A;  1EWC A;  1PGA A;  2PVO D;  2Z8L A;  2IPK D;  4ITK A;  4KZ0 A;  2AQ2 B;  4M02 A;  4BKG A;  3T3N A;  3NUH B;  4XE0 A;  3QA8 A;  4W9C A;  3T9L A;  2W55 A;  4ZOH C;  2BYE A;  3AEG B;  3O65 B;  1P1A A;  1OQR A;  4BBN C;  1JWB D;  4A55 A;  2DZI A;  4AJW A;  1WMH A;  2VH2 A;  3Q3F A;  1S3S G;  2K22 A;  4DHJ B;  4IG7 B;  3AH7 A;  4HDO A;  3ZTC A;  3S2A A;  1FFV A;  1NYQ A;  4WQO B;  3ZGZ A;  4MM3 A;  2L52 A;  3JSV B;  5BMH A;  4C80 A;  5MPO A;  4DXF A;  4W9I A;  3Q8A A;  1E90 A;  3A1Q A;  5J17 A;  4RM9 A;  1RRB A;  2KX0 A;  1GG3 A;  4NJC A;  1WIA A;  3L10 B;  1OQQ A;  1UBQ A;  3I3T B;  1SEB D;  2KC1 A;  3MFG A;  2YVC A;  1L7Y A;  4NAM A;  4BOZ B;  1TIF A;  1R4M B;  4KV2 A;  3N1X C;  5TR5 A;  4NZL B;  1FRR A;  5DPR A;  2INC C;  5D6J B;  3EGR A;  3PHW B;  4DHZ B;  3MHS D;  4ANU A;  2JQR B;  2KNB A;  2CJO A;  1FNV A;  1SGH A;  3U7Z A;  3WCQ A;  4HLE A;  3Q2A C;  1NI2 A;  2IBI B;  4LJP B;  3BVG A;  2ACZ B;  1BUI C;  4DXA B;  3ZW3 A;  2L1A A;  1RWS A;  1N63 A;  3D32 A;  1JWU D;  4WIP A;  1P7E A;  5CHF A;  1A5R A;  1F0Z A;  2KDM A;  3ZDM C;  3KVF B;  1MHX A;  2KDI A;  3CSF A;  1E7P B;  2KDF B;  2LJI A;  4JIO U;  1DOY A;  5LLI A;  2GLS A;  4XWT A;  4URK A;  1J7A A;  2BW2 A;  2BKF A;  4PK1 A;  2ONQ A;  3LYY A;  2KJ6 A;  1RFA A;  4ZRQ A;  1ET9 A;  4K7S A;  2PVG C;  3WAO A;  4YXD B;  3TUO A;  1ZOY B;  3RNC C;  2MW5 A;  3WAM A;  4RF1 A;  1L0V B;  3Q8B A;  1EU4 A;  3QJZ A;  1J19 A;  2GB1 A;  3ZNH B;  4NNJ B;  4M8N A;  3DBR I;  3P4S B;  5C2T B;  1WM3 A;  3RFZ B;  4HCP B;  4GDK A;  4WJO A;  2HD5 B;  2QJL A;  1IP9 A;  3L0W B;  2OJR A;  1TS5 A;  4JQW C;  1YQB A;  3H1U A;  5BMG A;  2LD9 A;  4R3D A;  2MSE D;  1R4N B;  2WXI A;  1KLV A;  4EZL A;  1JRO A;  2L05 A;  3W1Y A;  2IGH A;  2HJ1 A;  4C4V A;  4XZ4 A;  4A8X C;  3U8Z A;  3HIZ A;  1VDV A;  2PEA A;  4ASW C;  1IBX B;  4IOI E;  4YTN B;  4HK2 A;  1JCK B;  2EKI A;  2WXL A;  1GB4 A;  2N9E B;  3B9J A;  3AEF B;  4OW0 A;  4REZ A;  2WX0 A;  4W9G A;  3CWI A;  4DDI D;  4DXG A;  5BYQ A;  5LXH A;  1ZXI A;  2FCS A;  2V3P A;  1IGD A;  3BYY B;  2WXF A;  4EFO A;  2KQ4 X;  3TMP B;  2M8S A;  3W1S A;  1PQS A;  1KLU D;  3ALB A;  2KDE B;  1L4D B;  4LK0 M;  1T0S C;  4YTM B;  3PPA A;  5L95 C;  4K7W A;  3PZD A;  1ROE A;  3DVG Y;  4O1N A;  4YSZ B;  1VZ7 A;  4MH8 A;  2IY1 B;  3IG3 A;  1QOB A;  3ZJT A;  2CJN A;  2BB5 A;  4ICV A;  2IZV B;  4PT5 A;  2LHE A;  4RM8 A;  3NHE B;  1QZE A;  4XYC A;  4HCN B;  1N6Z A;  2LRW A;  4YWG G;  2WXM A;  2YEP F;  4IUM B;  5DPS A;  3WAL A;  3APD A;  1LM8 B;  5E6J A;  1Z5S B;  2GBR A;  3DVN U;  1SBB B;  1XD3 B;  3V6E B;  2V4I B;  4MGI E;  3PSE B;  1XXG A;  3BK2 A;  3DQV A;  3DOW A;  2BYF A;  1E8X A;  2LVQ A;  1L6V A;  2XK5 A;  2LJ5 A;  2N7E A;  3UIN B;  1WX9 A;  4HKZ E;  2EMS A;  5L83 A;  2ZPY A;  4JX1 C;  2XBB C;  1HTO A;  3RZF A;  1A70 A;  1IGC A;  3HHM A;  1WI0 A;  4DHZ E;  4RFB A;  3PTF C;  4XX5 A;  1FPY A;  2M56 B;  1HA5 A;  1FMA D;  3VUY A;  2KTR B;  4IKG A;  3U7D A;  3I57 A;  4L1B A;  4A6Q A;  5FR3 A;  1MG8 A;  2L0T A;  3GE3 C;  2QHO A;  4BKS D;  3AEE B;  2K25 A;  2ZEQ A;  2IO2 B;  3KW5 B;  5D3I B;  3RD2 A;  1UGJ A;  1VD2 A;  1AYF A;  2WQY B;  1ZUD 2;  2KTF A;  1T0R C;  2KVZ A;  2OED A;  2KO3 A;  1D3Z A;  1WXQ A;  4EEW A;  1XF5 L;  4PYU A;  2DHZ A;  1TZ1 A;  3AM9 A;  4EKU A;  2K6D B;  2KD0 A;  3QIJ A;  5D2M B;  1GOZ A;  1F52 A;  5LNK 1;  4A3P A;  3VXW A;  1OEY A;  4X57 B;  1FXT B;  4A9A A;  3B2F A;  3ZTD A;  3AE3 B;  3IT6 B;  1TKG A;  4KIK A;  2G9H D;  3GE8 C;  4JL9 A;  2AWT A;  2YLM A;  4P1C C;  3ZRF A;  3PHX B;  3RUI B;  4YSY B;  1KLG D;  1BXT A;  3AE6 B;  3BVZ A;  1UUP A;  3M63 B;  4M0W A;  2J4X A;  2M1M A;  4NY0 A;  1E8Y A;  3P4P B;  2KJH B;  2WDV B;  2L76 A;  3RI7 C;  1P9D U;  3AE7 B;  4ZRJ A;  2NBV B;  5AZG A;  1PUT A;  1T5X D;  5JHB A;  1GC6 A;  3KUC B;  2N7D A;  2VZK B;  4BAX A;  2Y5C A;  3ZJU A;  4CYE A;  2OJW A;  1VRA B;  2ON8 A;  4OVV A;  2LMC A;  4ICU A;  4B9K A;  3AE9 B;  5IN7 A;  1I4H A;  3BK1 A;  5IKC M;  1FFU A;  2QC8 A;  2D07 B;  2MWS B;  2J53 A;  1TKY A;  2XEW A;  2IO1 B;  2MLB A;  3TEY A;  4LNN A;  3A4S C;  2ZW0 A;  3MHZ A;  3VR8 B;  3ZNG C;  3DCG A;  1F9J A;  2JWU A;  1E0Z A;  1BT0 A;  1RLF A;  2O6V B;  3AUL A;  4PS7 A;  4XDD A;  4MJS B;  3R7Q A;  2RPV A;  2ZNV B;  3M3J A;  4WJQ A;  4KDI C;  1EF1 A;  1ZW7 A;  1XLO A;  2Y5P A;  3RNF C;  3PZ7 A;  5I4D A;  2WU2 B;  1R7S A;  1XLN A;  3EEC A;  2DAJ A;  1KH0 A;  3UIP B;  3APF A;  3TJP A;  2JYT A;  4NAW A;  1TBE A;  3ZXV A;  5CTR C;  1TZO A;  4L2Y A;  1EO6 A;  1JW9 D;  4GGQ A;  3ML8 A;  4GDL B;  3SR6 A;  3UIO B;  2BS2 B;  2N9L A;  2L7R A;  4I6P A;  4K3B A;  4DHJ D;  3E9S A;  3TBL D;  4DQO C;  5E6P A;  1V97 A;  3V6C B;  2GBM A;  4WWO A;  1SJH D;  3B08 A;  2W9N A;  3AEA B;  3RNE C;  4ZRI A;  3BY4 B;  5G5G A;  1IYF A;  3N30 A;  2IGG A;  5IAA C;  3TL5 A;  2PKO A;  4M01 A;  3TIX A;  4GXB A;  2N4F A;  2D2Q A;  4KGS A;  1M94 A;  2A5U A;  4CQN A;  3L4P A;  2WX1 A;  4C7Y A;  1GPX A;  3UQB A;  1SIJ A;  3R2I A;  2K8H A;  2REX A;  2WXJ A;  2JPH A;  2KFK B;  2ASQ A;  4RH6 A;  4PS3 A;  2A4Z A;  2D10 A;  4MSQ B;  4GSW A;  2L0F A;  3V05 A;  2WP9 B;  3NY5 A;  1L6U A;  4JWS C;  1FXI A;  2LI5 A;  1YJ1 A;  2HDE A;  5AZH A;  2GBK A;  1R4M I;  4BBN F;  1ZXH A;  2JZZ A;  3DWG C;  4IDI A;  3GZN B;  3QK0 A;  5GXG B;  5DCN A;  2BYV E;  5D94 A;  2BT6 A;  5IO9 A;  1JQ4 A;  3A9K A;  4BKS A;  4ZRK A;  2MCN B;  3KUD B;  1LFD A;  4KKI A;  3W5V B;  4W9F A;  2FE8 A;  4J6I A;  4TSS A;  4HRO A;  2I38 A;  2JU6 X;  3H7P A;  4S17 A;  3URY A;  1V1P A;  1H8C A;  5HKH A;  1ZDV A;  3MTN B;  3ZUN A;  3DBL B;  3DDC B;  3HUI A;  4KKJ A;  4LNI A;  3R8B A;  2J52 A;  1RAX A;  2DBY A;  3VUX A;  5IOI A;  2D5G A;  3MP9 A;  3DVN V;  1WGR A;  3DHI C;  4N59 A;  2D3C A;  4H2A A;  2M0X A;  3L08 A;  3ZIM A;  1UNS A;  2LZ6 A;  2NS5 A;  2WWZ A;  3VH4 B;  1C4A A;  1IUE A;  2MHJ A;  2ZW1 A;  2I2Y A;  3HM6 X;  4MSM B;  3N9Y C;  2FCN A;  4LNK A;  4PS8 A;  4RMA A;  1TKE A;  2PE6 B;  1C79 A;  4BFR A;  1TS2 A;  2DYO A;  3NG0 A;  3SD5 A;  1KJT A;  3H6N A;  2NMQ A;  3K9O B;  1C3T A;  3EHV A;  2MP2 B;  1SB3 C;  3ZDT A;  1L0Y B;  3IVF A;  1D5Z C;  2L3Z A;  1J8C A;  3B1L X;  1CJE A;  5JHA A;  3PRZ A;  1V49 A;  2DZJ A;  2AL6 A;  2KVR A;  3M95 A;  1R4N I;  2JRI B;  3VTW A;  3HM3 A;  1FRD A;  1B1Z A;  2VH1 A;  2PJH A;  3NJT A;  3N1Z C;  3AEB B;  1Y56 A;  4HXD A;  2J7Q B;  3QAQ A;  4TV3 A;  2BKR B;  2B76 B;  2MJD A;  4YL8 A;  1YN5 A;  3A4R A;  4FN2 A;  2NBU A;  1I4X A;  4P1B C;  4GU2 A;  4ANX A;  1B9R A;  2NBW B;  2LUM A;  1OTR B;  3ABV B;  1SXT A;  4OVZ A;  1GJZ A;  4A3O A;  1HQR D;  3IAS 1;  1KFY B;  4ZYN A;  1P7F A;  2W3S A;  1QIL A;  4FLH A;  4IWP A;  2L00 B;  2MBQ A;  1UF0 A;  3N20 C;  3AE1 B;  1OFF A;  2IGD A;  4J3O D;  1RFK A;  3MC0 B;  1Q5W B;  4LLG M;  2FBW B;  2GMI C;  2KAN A;  1WZ3 A;  3L16 A;  4EE2 A;  4F7Z A;  5E6N A;  4GLS C;  2RR9 A;  1V6E A;  4C56 C;  1TGZ B;  1DOI A;  4OHJ A;  2D3B A;  2HE7 A;  4FHJ A;  2N9X A;  2QDF A;  5CX3 A;  2LGX A;  2WYQ A;  2RDG A;  3AU5 A;  4IM2 A;  4AUQ C;  1AN8 A;  1HEZ E;  1DOX A;  1YX5 B;  4ZHP A;  4FAD A;  1L4Z B;  3JSV A;  3NZS A;  2JWZ A;  2PPH A;  5EE1 A;  4FJY A;  3AE8 B;  3A9J B;  1HXY D;  1XEE A;  2D3A A;  4IC7 B;  2QIL A;  1I4P A;  5EE9 A;  4CO7 A;  1VCB A;  2K39 A;  4EOY A;  4HDQ A;  1JRP A;  2QSD A;  4W9K A;  3NS1 A;  3FIL B;  1J7B A;  3P42 A;  1NYR A;  4HEA 1;  3HRD D;  2JRH A;  4B0M A;  3CIR B;  1WX7 A;  4K81 A;  1FCL A;  2H89 B;  4NJ7 A;  1UD7 A;  2XN9 C;  1WZ0 A;  5FKA C;  2RDH A;  3BII D;  3HK0 A;  2Z0D B;  3AE5 B;  1TTN A;  1WGG A;  2BQQ A;  1N5X A;  2IO0 B;  1EF5 A;  4WWN A;  3QQ8 B;  4BOS C;  1CK1 A;  1TY2 A;  5D7G A;  2LRU A;  4AP4 C;  2G4S A;  1WJ6 A;  5AUI A;  4ZHO A;  4E71 A;  2KN5 A;  2QCZ A;  4P7I A;  4MEM A;  2LXA A;  3AMZ A;  3KWL A;  1LO5 D;  3ML9 A;  3KQ4 A;  3R66 C;  2JXX A;  3NZU A;  3IAM 1;  4AS1 A;  2NPT B;  1I4R A;  1OEY J;  1ZP0 B;  4HWI B;  4MT5 A;  4EUT A;  3VFK A;  1NEN B;  4KSK C;  2FCQ A;  1UGM A;  4W9L A;  1E5W A;  3V61 A;  2RGF A;  2UWQ A;  2G4D B;  3TEZ A;  1T0Q C;  2LWP A;  2DNF A;  2BB6 A;  3L17 A;  3NOB A;  2AYO B;  2CHW A;  3FC4 A;  2IDY A;  2PW9 A;  1STE A;  3W2D A;  2KLG A;  3KUZ A;  1WM2 A;  4G0N B;  4FJZ A;  1WH3 A;  2FUH B;  2K6Q A;  2KYW A;  2TSS A;  1NEK B;  2VZK D;  2L32 A;  2RSU A;  1D5M C;  1C1Y B;  3R3M A;  3JYU A;  4IWO A;  1C4C A;  1UBI A;  2LEK A;  1AW7 A;  3AEC B;  1H4R A;  1T6B X;  3DBH B;  4KVG B;  3Q3M C;  5BYR A;  3V3X A;  1Q0W B;  3H9D A;  1PDX A;  4KGT A;  1V80 A;  1F2R C;  3SFD B;  1C9F A;  2BYT A;  3QWZ B;  2UYZ B;  2KWU B;  2O6V D;  2MA9 B;  4FJV B;  4K7U A;  1IBX A;  3ZXR A;  3VQI A;  1IPG A;  1SE2 A;  2KZR A;  4AJY B;  1JML A;  1YQ4 B;  3ENE A;  4IW0 A;  2KMA A;  1D6E C;  2N0S B;  1Z2M A;  2C60 A;  3JVZ X;  1YJJ A;  2KOX A;  3M62 B;  1ZE3 D;  2BWE S;  4JWU C;  5EE3 A;  2WXO A;  1WE7 A;  1LGR A;  2FCM A;  2KN4 A;  5EDS A;  1I4G A;  2J0K A;  4USA A;  2RD0 A;  3FAH A;  3GP7 A;  1FCC C;  2M0A A;  2WXN A;  1WYG A;  2PLP A;  4WAF A;  1KTK A;  1I35 A;  1Q10 A;  4IM3 A;  1MPE A;  3MC8 A;  4TQ1 A;  2EMT A;  3Q3J A;  4AWJ A;  1E7U A;  5C3J B;  1TY0 A;  4MDK E;  1N5W A;  2AQ3 B;  2O2V B;  3OLM D;  3EA6 A;  2OOB B;  4HVB A;  2DYB A;  1GNU A;  3QC8 B;  2MRP A;  2NTT A;  3T8M A;  2KQ7 A;  1E7V A;  4I6N B;  2KXJ A;  1RYJ A;  3IBE A;  3FKY A;  1PFD A;  1S1Q B;  1WR1 A;  3AI5 A;  3ZLZ A;  2JYE A;  3U2S C;  1WRI A;  1YJI A;  1ZPS A;  5G5H A;  2PTL A;  5JXV A;  1ACC A;  3VVW B;  3N1Y C;  4LDT B;  3R7R A;  4MH0 E;  4MGY E;  2DZK A;  2V3S A;  3RT3 B;  4HRS A;  5IA7 A;  2KWD A;  1L2N A;  1WMH B;  2L8J A;  1WSP A;  5DPW A;  1L0X B;  4DK5 A;  1AWD A;  5KHQ A;  1ISN A;  5DPT A;  1QQR A;  3N32 A;  2L83 A;  4K3C A;  5JZE B;  3V60 A;  1XO3 A;  4ANW A;  4ARI A;  2CHX A;  3IHP C;  3NVZ A;  2C5L C;  4MM3 B;  1XCQ L;  2NCN A;  5G55 A;  2KC2 A;  3VHT C;  2KTR A;  1VJK A;  2J0J A;  1HE8 A;  2FNJ B;  2B3A A;  4B0E A;  3A1Q B;  2K3U A;  1V9J A;  2ZCB A;  2WS3 B;  1NI3 A;  3BYT B;  1WJ4 A;  4HPM B;  1KF6 B;  1E6E B;  3MJ5 A;  2Z0E B;  1QOG A;  3GZN I;  3W1S C;  5JH5 C;  3P1M A;  4MGK E;  1WY8 A;  5TSS A;  2K5P A;  2BBC A;  1FEH A;  3NS8 A;  2GOW A;  1YN3 A;  4TMA B;  5J2R A;  3KWV A;  3W9C B;  1UH6 A;  1XCT L;  3R2T A;  3VRB B;  3MJW A;  2WXP A;  1KM7 A;  1C4P A;  3TEX A;  1QLB B;  3DBL I;  2N9K A;  2FIF A;  2AX5 A;  1YN4 A;  3KH0 A;  5AUK A;  3SEB A;  4EZK A;  1WJU A;  1SF0 A;  3GB1 A;  3LXF A;  1V5T A;  3EFC A;  2M4N A;  3SDL C;  2M19 A;  3RMK C;  4ZRP A;  3C8Y A;  2KWC A;  3DHH C;  1N61 A;  4II3 B;  1T3Q A;  2LUE A;  1SE3 A;  1WGD A;  3DPD A;  1SE9 A;  1M4V A;  4KSL C;  3JW0 X;  1SSN A;  4II2 B;  1MG4 A;  2JUO A;  3UI3 A;  3HVD A;  2EEL A;  3IFW B;  1KRH A;  1VZ6 A;  4W9J A;  2WLB A;  1V1O A;  1QF6 A;  1MHH E;  2AQ1 B;  3W5U B;  2DLB A;  1E9M A;  3Q8F A;  5J18 A;  2INN E;  3EUB 2;  3PS6 A;  2SAK A;  2H88 B;  3Q69 A;  3Q3O C;  3LB8 C;  2J0M A;  4ARC A;  1U4A A;  4A90 A;  1TYG B;  3PZ8 A;  1K53 A;  4JGH B;  1SIF A;  2X38 A;  2G45 B;  4GDK B;  2KQS A;  2HTH A;  1UZX B;  2KT7 A;  3ZO5 B;  4WQM A;  2JXT A;  2MJE A;  3P4R B;  2O6V A;  4RNA A;  2BWF A;  4MJS A;  2RPQ A;  1C76 A;  4NQL B;  1C78 A;  4C4V B;  2LGD A;  3BWU D;  2IND C;  1FO4 A;  1AAR A;  3PRE A;  3K9P B;  1WE6 A;  3PLU A;  3OJ4 B;  3Q3N C;  2KX3 A;  1Y8R C;  3C19 A;  2DAF A;  3NVV A;  3RNB C;  1GUA B;  4LTU A;  1EU3 A;  3A33 B;  4IWQ A;  2WDQ B;  3PVL A;  4MGZ E;  3VUW A;  5AZF A;  2HTM E;  2JT4 B;  2EKE C;  4I6L B;  4GDL A;  3PRM B;  1PYW D;  1NBF C;  3H7S A;  4W9E A;  3AE2 B;  5BO4 B;  1ENF A;  3SFE B;  3GS2 A;  2MX2 A;  3IT4 B;  3VTU A;  1XLP A;  2ICI A;  3TCA A;  4S0R A;  1V8C A;  4RGN A;  2N1W A;  4WAA A;  4HJG E;  3I63 C;  1XT9 B;  2PIA A;  2KAC A;  4M00 A;  2G3Q B;  4E74 A;  4OZA A;  4BZA A;  3AED B;  2Q5W D;  2WGS A;  4RGM A;  2WDT B;  2WXR A;  4L23 A;  2LHD A;  2QIE B;  1QT9 A;  2DEN B;  2LGI A;  4ACF A;  4N6E B;  3HVZ A;  4WJP A;  2V0G A;  3OG5 A;  4A20 A;  2IY0 B;  2ZJD A;  2RMM A;  2Y5B B;  1CQV A;  3LJ3 A;  1G6J A;  3I9V 1;  2R61 A;  2KFK A;  2MQJ A;  1OQY A;  2QMT A;  3AE4 B;  4OZC A;  1C77 A;  2N1V A;  4TQ0 A;  3QCA A;  5IP4 D;  4YSX B;  3ONS A;  4LJO B;  1WXM A;  3ETR A;  1F1H A;  3J9C A;  2MH7 A;  1WXV A;  2KMC A;  4XC2 A;  3LDZ E;  2XK5 B;  2MEK A;  3CF6 E;  3DBS A;  4G3X B;  1P0R A;  4Q2J A;  3VH3 B;  3AB5 A;  2BF8 B;  1MJD A;  2N7J A;  5AEK B;  1I4Q A;  4HJK A;  2LVO A;  3RNG C;  3VAW A;  2WNM A;  3RUL A;  3UF8 A;  1BML C;  5FR6 A;  3Q6B A;  1TT5 B;  2JY6 A;  1Q1O A;  3H8H A;  1YX6 B;  3MC9 A;  3DWM A;  3ZNZ B;  4YTP B;  2BPS A;  3GOE A;  2M17 A;  1CZP A;  1F77 A;  1JWA D;  5H92 C;  2BS4 B;  2WXG A;  2WU5 B;  4PYZ A;  1SE4 A;  1LXD A;  2LGY A;  4HPL B;  1VLB A;  5CHV C;  1WXS A;  3WA0 A;  4F8C B;  1GAQ B;  3RN9 C;  3ZYY X;  4FA6 A;  5G2N A;  1VR9 A;  2V3N A;  1I42 A;  1ET6 A;  3PGE A;  3UGB B;  3SHQ A;  1WWT A;  3DVG X;  2PMV A;  4KIK B;  3BZD B;  1K52 A;  1V86 A;  2XNA C;  2BVC A;  1V5O A;  2C7N B;  4HPP A;  4OZB A;  2DWQ A;  2I1J A;  3U30 A;  2MP2 A;  2WXH A;  2KWV B;  3ZKJ C;  2R2O A;  4NQK E;  2NTS A;  2ZPN A;  3BIN A;  4M0W B;  1DYQ A;  2RDB C;  1KOT A;  1T0Y A;  1D5X C;  1ZGU B;  4XGA B;  1QOF A;  4FHK A;  1N60 A;  3DBR B;  3U52 E;  3DBH I;  1EM7 A;  5HFY A;  2JX5 A;  2GI9 A;  2MJ3 A;  2C9W B;  3AV8 A;  2KLC A;  3AN1 A;  4XWW A;  2JSV X;  1RM6 C;  2BGF A;  2WXK A;  1NDD A;  4RGO S;  1WGY A;  2CKH B;  4WJN A;  4JE3 B;  2BTE A;  2JZP A;  2LVP A;  2DX5 B;  3VDZ A;  4DBG A;  2ZCC A;  1XLQ A;  5EE0 A;  2KFJ A;  3UQA A;  3PO0 A;  2V9H A;  4DDG D;  1UWM A;  2JVC A;  3Q8C A;  1X1M A;  1K51 A;  1J7C A;  3P4Q B;  4KGR A;  3VR9 B;  1L5P A;  3KYD D;  2I1K A;  4OVU A;  2ZNV C;  2D3G A;  2LXC A;  2OHF A;  3TSS A;  2ZVO A;  5HI1 A;  3TEW A;  4KZC A;  3PT2 B;  1NVI D;  4G11 A;  1P3Q U;  3QX1 A;  2NR2 A;  2DZM A;  1WF9 A;  3KYC D;  2K1F A;  5BMI A;  4JPS A;  4HKQ A;  1E8W A;  4C7Z A;  4LNF A;  2KK8 A;  4GN1 A;  2JZ3 B;  2KMM A;  2CU3 A;  3KLS X;  4FUL A;  2MBO A;  1YOV B;  4NAW B;  1HZ5 A;  4GMV A;  2R2Q A;  3DHG C;  4LDT D;  2KJR A;  4LNO A;  4FBJ B;  1FIQ A;  2INP E;  4G50 A;  3A9J A;  5BYS A;  3Q14 C;  4WWP A;  2G1E A;  2GRI A;  4US9 A;  1ZDX A;  4C00 A;  2C7M B;  2Y3A A;  1J0G A;  3ZRC A;  3OWE B;  5C23 A;  1UEL A;  2V4L A;  2FUG 1;  2ZZP B;  3QAR A;  1ZKH A;  3FIL A;  1PGX A;  2WXQ A;  1JWM D;  2NVU I;  3EC8 A;  4D2K A;  2QEJ C;  2VRR B;  4N9F 4;  2FAZ A;  1K50 A;  2CU1 A;  4B6W A;  2IO3 B;  4RCO A;  2GBJ A;  4BKT A;  4M8M A;  3AXC A;  2CHZ A; 
#chains in the Genus database with same CATH homology
 4TKN A;  2KDE B;  2M4N A;  3SDL C;  1P98 A;  2MBH A;  2PJH A;  3PPA A;  5L95 C;  3OJ3 A;  1GC7 A;  4K7W A;  3PZD A;  2KWC A;  4W9D A;  4HXD A;  3QHT A;  4II3 B;  3DVG Y;  5CHW A;  2J7Q B;  3RYT A;  4JLC A;  3VTV A;  4EZJ A;  1WR6 E;  2IY1 B;  3QAQ A;  4TV3 A;  2LUE A;  3IG3 A;  3ZVV A;  2BKR B;  1WGD A;  3DPD A;  1SE9 A;  4YL8 A;  3A4R A;  4FN2 A;  2NBU A;  4KSL C;  1V2Y A;  4GU2 A;  4ICV A;  3JW0 X;  1WXA A;  2NPT A;  4ANX A;  4II2 B;  2CR5 A;  4BVU C;  5KHO A;  2JUO A;  2IZV B;  2NBW B;  1WJN A;  1WX8 A;  3IFW B;  1OTR B;  2JF5 A;  3ECI A;  4RM8 A;  3NHE B;  1QZE A;  4W9J A;  1WYW B;  3CMM B;  4HCN B;  2FID A;  1GJZ A;  2LRW A;  4A3O A;  3AU4 A;  4ZYN A;  4IUM B;  5DPS A;  3WAL A;  1WFY A;  3APD A;  1LM8 B;  1Z5S B;  2GBR A;  3DVN U;  1XD3 B;  3V6E B;  5J18 A;  4FLH A;  4MGI E;  3PSE B;  4E3C A;  3A9K B;  3PS6 A;  4IWP A;  1YIW A;  2L00 B;  2MBQ A;  3DQV A;  3DOW A;  1K8R B;  1WRD B;  2BYF A;  1E8X A;  2LVQ A;  1E8Z A;  1Q5W B;  2XK5 A;  2LJ5 A;  2N7E A;  2J0M A;  1CMX B;  1U4A A;  2GMI C;  3H7P B;  2KHW B;  3UIN B;  4JGH B;  2KAN A;  1SIF A;  1WZ3 A;  3B0A A;  3L16 A;  2PE9 A;  2IYD B;  1WX9 A;  2G45 B;  2KQS A;  4GDK B;  4F7Z A;  2HTH A;  1UZX B;  2EMS A;  2ZPY A;  2ZVN A;  5E6N A;  3ZO5 B;  5L83 A;  5LXI B;  2XBB C;  3RZF A;  2GBN A;  2RR9 A;  3X23 A;  1V6E A;  3HHM A;  1WI0 A;  2O6V A;  1TGZ B;  4K1R B;  2BWF A;  2CS4 A;  4MJS A;  2HE7 A;  4FHJ A;  2RPQ A;  4DHZ E;  3P2B A;  2N9X A;  4NQL B;  3X0W A;  3PTF C;  4XX5 A;  1JRU A;  5CX3 A;  2LGD A;  2LGX A;  2WYQ A;  1AAR A;  3PRE A;  3AU5 A;  2KTR B;  3K9P B;  3U7D A;  4IM2 A;  3VUY A;  4AUQ C;  1WE6 A;  1MG8 A;  2L0T A;  3V62 A;  2QHO A;  4BKS D;  2K25 A;  3PLU A;  3OJ4 B;  2ZEQ A;  4AOF A;  2IO2 B;  3APC A;  3KW5 B;  2KX3 A;  1Y8R C;  1YX5 B;  2DAF A;  1VD2 A;  3PLV A;  3RD2 A;  4CHK A;  4GOC A;  3L13 A;  1GUA B;  3JSV A;  2KTF A;  3NZS A;  4FAD A;  4MEL A;  2JWZ A;  2PPH A;  2V1Y A;  2KO3 A;  4FJY A;  1D3Z A;  3A9J B;  3WIM A;  4EEW A;  4PYU A;  3A33 B;  4IWQ A;  2K8B A;  2DHZ A;  3PVL A;  4IC7 B;  1YD8 U;  1TZ1 A;  4MGZ E;  4B95 A;  4KDL B;  4EKU A;  2K6D B;  2KD0 A;  3QIJ A;  3WAN A;  3VUW A;  5AZF A;  2JT4 B;  5D2M B;  4CO7 A;  2EKE C;  4I6L B;  1VCB A;  4GDL A;  4A3P A;  2K39 A;  2K8C A;  3C0R B;  3PRM B;  1NBF C;  3H7S A;  1OEY A;  4HDQ A;  4W9E A;  4X57 B;  5BO4 B;  3EFU A;  3SU8 X;  3VXW A;  1FXT B;  4NPN A;  4W9K A;  3ZTD A;  1V81 A;  5E6O A;  1OGW A;  2MX2 A;  4KIK A;  4IM0 A;  4DWF A;  2JRH A;  3VTU A;  4W9H A;  3TCA A;  1WX7 A;  4JL9 A;  4K81 A;  2AWT A;  2YLM A;  2N1W A;  4WAA A;  3VTW A;  3ZRF A;  3PHX B;  1XT9 B;  3RUI B;  4NJ7 A;  1UD7 A;  1WGH A;  1WZ0 A;  2MBB B;  2G3Q B;  3OAW A;  4E74 A;  3HK0 A;  2Z0D B;  1TTN A;  1WGG A;  2IO0 B;  1EF5 A;  3M63 B;  4WWN A;  2HJ8 A;  2M1M A;  4NY0 A;  2C7H A;  2WDT B;  1XQQ A;  3QQ8 B;  1E8Y A;  4BOS C;  4NJ6 A;  2KJH B;  5D7G A;  2LRU A;  4AP4 C;  2G4S A;  4LCD E;  1WJ6 A;  2DEN B;  4E71 A;  2KN5 A;  2DYM A;  4GIV A;  4MEM A;  2LXA A;  4P7I A;  2L76 A;  2D11 A;  3ML9 A;  3R66 C;  4WJP A;  1P9D U;  2AL3 A;  2JXX A;  2NBV B;  3NZU A;  4ZRJ A;  5AZG A;  3CST A;  4A20 A;  2IY0 B;  2NPT B;  2ZJD A;  5JHB A;  2Y5B B;  2KDB A;  3LJ3 A;  1OEY J;  1GC6 A;  2KKC A;  3KUC B;  1G6J A;  4HWI B;  2O2V A;  2N7D A;  4ANV A;  2KFK A;  4EUT A;  2MQJ A;  1OQY A;  3RZW C;  4CYE A;  2LAS A;  3VFK A;  2MBE A;  2Z59 B;  4KSK C;  3PRP B;  5GMV A;  2N1V A;  2FCQ A;  4TQ0 A;  3QCA A;  1UGM A;  3N3K B;  4W9L A;  4OVV A;  1E5W A;  1LQB A;  3PV1 A;  3V61 A;  2RGF A;  2UWQ A;  4ZDV A;  3ONS A;  4ICU A;  1WXM A;  2G4D B;  4LJO B;  4B9K A;  2LWP A;  3L54 A;  5C1Z A;  3WAP A;  4GB9 A;  3RCZ A;  1WXV A;  2KMC A;  3ZNI D;  3L17 A;  4XC2 A;  2D07 B;  2N9P C;  3NOB A;  2MWS B;  2AEH A;  2AYO B;  4F1S A;  3LDZ E;  4TUU A;  1EUV B;  2XK5 B;  2CHW A;  3CF6 E;  3DBS A;  4G3X B;  1P0R A;  2XEW A;  2IO1 B;  2MLB A;  2KLG A;  3KUZ A;  4KZ0 A;  1WM2 A;  4BKG A;  3A4S C;  4G0N B;  3VH3 B;  2BF8 B;  3QA8 A;  4W9C A;  3ZNG C;  3T9L A;  3DCG A;  1F9J A;  1WH3 A;  4FJZ A;  5AEK B;  2FUH B;  4HJK A;  2LVO A;  2K6Q A;  1BT0 A;  1RLF A;  2BYE A;  3VAW A;  2O6V B;  3AUL A;  3O65 B;  4PS7 A;  4MJS B;  3R7Q A;  3RUL A;  1P1A A;  3UF8 A;  2RSU A;  5FR6 A;  1C1Y B;  3R3M A;  4BBN C;  2ZNV B;  2DZI A;  3JYU A;  4AJW A;  2JY6 A;  3M3J A;  1WMH A;  4IWO A;  4WJQ A;  1Q1O A;  1UBI A;  4KDI C;  1YX6 B;  3Q3F A;  1EF1 A;  1S3S G;  1ZW7 A;  4DHJ B;  4IG7 B;  4HDO A;  3ZNZ B;  3ZTC A;  3S2A A;  1H4R A;  2BPS A;  2DAJ A;  3EEC A;  3GOE A;  4WQO B;  4MM3 A;  3JSV B;  2M17 A;  4KVG B;  1Q0W B;  3H9D A;  3UIP B;  3APF A;  4W9I A;  3TJP A;  4PYZ A;  1LXD A;  2LGY A;  4HPL B;  4NAW A;  1V80 A;  1WXS A;  1TBE A;  5CHV C;  5CTR C;  1E90 A;  3WA0 A;  3A1Q A;  4F8C B;  5J17 A;  3QWZ B;  2UYZ B;  1EO6 A;  4RM9 A;  2KWU B;  4GGQ A;  1RRB A;  2KX0 A;  2O6V D;  3ML8 A;  4GDL B;  2MA9 B;  4FJV B;  1GG3 A;  3UIO B;  4K7U A;  3VQI A;  1IPG A;  4FA6 A;  5G2N A;  1WIA A;  3L10 B;  2KZR A;  1I42 A;  4AJY B;  3UGB B;  1UBQ A;  3I3T B;  3PGE A;  3SHQ A;  2L7R A;  3ENE A;  4IW0 A;  3DVG X;  2KC1 A;  2KMA A;  4KIK B;  4I6P A;  1Z2M A;  2C60 A;  2YVC A;  3JVZ X;  4DHJ D;  1L7Y A;  1V86 A;  3TBL D;  1V5O A;  2C7N B;  2KOX A;  4BOZ B;  5E6P A;  3V6C B;  3M62 B;  2BWE S;  2GBM A;  4KV2 A;  5TR5 A;  4WWO A;  2I1J A;  5DPR A;  3B08 A;  3U30 A;  1WE7 A;  2MP2 A;  2W9N A;  2KWV B;  3ZKJ C;  5D6J B;  3PHW B;  2R2O A;  4NQK E;  4ZRI A;  4DHZ B;  3MHS D;  2ZPN A;  2FCM A;  3BIN A;  3BY4 B;  4ANU A;  2KNB A;  1IYF A;  4M0W B;  5EDS A;  2J0K A;  3N30 A;  1SGH A;  2RD0 A;  1KOT A;  1T0Y A;  5IAA C;  4HLE A;  1NI2 A;  2IBI B;  4LJP B;  3TL5 A;  1ZGU B;  4DXA B;  4FHK A;  3TIX A;  4GXB A;  3ZW3 A;  2N4F A;  1I35 A;  2D2Q A;  3D32 A;  1M94 A;  2A5U A;  4IM3 A;  2WX1 A;  3DBH I;  5CHF A;  1A5R A;  4TQ1 A;  2EMT A;  3Q3J A;  3ZDM C;  3KVF B;  3UQB A;  4AWJ A;  2KDI A;  1E7U A;  3CSF A;  2KDF B;  2K8H A;  4JIO U;  2C9W B;  4MDK E;  2REX A;  5LLI A;  2KLC A;  4URK A;  2JPH A;  2O2V B;  3OLM D;  2KFK B;  2ASQ A;  2BGF A;  2OOB B;  4PS3 A;  4HVB A;  1NDD A;  2A4Z A;  2D10 A;  2DYB A;  1WGY A;  2BKF A;  4MSQ B;  4GSW A;  1GNU A;  2L0F A;  3QC8 B;  2MRP A;  3NY5 A;  2CKH B;  2KJ6 A;  4WJN A;  1RFA A;  4K7S A;  3T8M A;  2KQ7 A;  2LVP A;  2LI5 A;  2DX5 B;  3WAO A;  3VDZ A;  1E7V A;  4DBG A;  1YJ1 A;  4I6N B;  5AZH A;  2GBK A;  2ZCC A;  1R4M I;  2KXJ A;  3IBE A;  4BBN F;  2KFJ A;  3UQA A;  2JZZ A;  2MW5 A;  3WAM A;  4DDG D;  2JVC A;  1S1Q B;  1WR1 A;  1X1M A;  3AI5 A;  3QK0 A;  3ZLZ A;  5DCN A;  3QJZ A;  1J19 A;  2BYV E;  5D94 A;  3ZNH B;  3A9K A;  4BKS A;  3KYD D;  2I1K A;  4ZRK A;  2MCN B;  3KUD B;  1LFD A;  4NNJ B;  4OVU A;  2ZNV C;  2D3G A;  2LXC A;  3VVW B;  4LDT B;  4W9F A;  4J6I A;  2ZVO A;  3R7R A;  4KZC A;  3PT2 B;  4MH0 E;  4MGY E;  4M8N A;  2DZK A;  2V3S A;  3DBR I;  3RT3 B;  5IA7 A;  4G11 A;  1L2N A;  1P3Q U;  3H7P A;  3QX1 A;  1WMH B;  1WM3 A;  1H8C A;  5HKH A;  2L8J A;  4HCP B;  3MTN B;  5DPW A;  3ZUN A;  2NR2 A;  4GDK A;  4WJO A;  3DDC B;  2DZM A;  2HD5 B;  1WF9 A;  4DK5 A;  1IP9 A;  3L0W B;  2OJR A;  2K1F A;  3KYC D;  5KHQ A;  1ISN A;  1RAX A;  1YQB A;  3H1U A;  4JQW C;  3N32 A;  5DPT A;  2LD9 A;  3VUX A;  5JZE B;  3V60 A;  3DVN V;  1E8W A;  1WGR A;  4ANW A;  2MSE D;  2CHX A;  3IHP C;  2C5L C;  1KLV A;  2NCN A;  5G55 A;  4EZL A;  2KC2 A;  2KK8 A;  2L05 A;  3W1Y A;  4GN1 A;  2JZ3 B;  3VHT C;  4FUL A;  2M0X A;  2KTR A;  2J0J A;  3L08 A;  1HE8 A;  2MBO A;  4XZ4 A;  3ZIM A;  2LZ6 A;  2FNJ B;  4NAW B;  2NS5 A;  2B3A A;  4GMV A;  2WWZ A;  3A1Q B;  3U8Z A;  3HIZ A;  1V9J A;  2R2Q A;  4LDT D;  3VH4 B;  2KJR A;  2PEA A;  4ASW C;  2ZCB A;  4FBJ B;  4HK2 A;  1WJ4 A;  4HPM B;  4G50 A;  3HM6 X;  2N9E B;  4MSM B;  2Z0E B;  3A9J A;  2FCN A;  4PS8 A;  4RMA A;  3GZN I;  3W1S C;  2PE6 B;  2WX0 A;  4WWP A;  4W9G A;  5JH5 C;  4BFR A;  4DDI D;  4MGK E;  2DYO A;  1WY8 A;  2C7M B;  3SD5 A;  5LXH A;  1J0G A;  3ZRC A;  1KJT A;  5C23 A;  1UEL A;  2V4L A;  3H6N A;  3HM3 A;  3NS8 A;  2GOW A;  2ZZP B;  2FCS A;  3K9O B;  3QAR A;  3EHV A;  2MP2 B;  5J2R A;  1C3T A;  1ZKH A;  1UH6 A;  3ZDT A;  4EFO A;  3MJW A;  2NVU I;  3IVF A;  1J8C A;  2L3Z A;  3EC8 A;  3B1L X;  2VRR B;  3TMP B;  1KM7 A;  3PRZ A;  5JHA A;  4EOY A;  1V49 A;  3DBL I;  4N9F 4;  2FIF A;  2DZJ A;  2FAZ A;  2M8S A;  3W1S A;  1PQS A;  2CU1 A;  2AL6 A;  3KH0 A;  4B6W A;  2KVR A;  2IO3 B;  3M95 A;  2GBJ A;  1R4N I;  2JRI B;  3ALB A;  4EZK A;  4BKT A;  1WJU A;  4M8M A;  3AXC A;  2CHZ A;  1V5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...