3UIOB

Complex between human rangap1-sumo2, ubc9 and the ir1 domain from ranbp2 containing ir2 motif ii
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
79
structure length
79
Chain Sequence
NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/isomerase/protein binding
molecule keywords SUMO-conjugating enzyme UBC9
publication title Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2011-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3uioB00
2CHWA 1WE6A 3B08A 2MBEA 2JVCA 4PS7A 3V62A 4G50A 2IO1B 1P9DU 2MSED 2RR9A 2GBKA 2D07B 2EMTA 2O6VA 4PYZA 3T8MA 2NVUI 4IG7B 4BKSD 2DZMA 3PT2B 2MX2A 1ZGUB 2FAZA 2MBBB 1V86A 1PQSA 2I1JA 2AWTA 4ANWA 2FIDA 2CU1A 4G11A 4ZRJA 4E74A 3DVNV 3P2BA 1BT0A 2KJ6A 4II2B 4BVUC 3PHXB 4W9IA 4A20A 3L10B 5FR6A 3NS8A 3QA8A 3DBHI 1WGHA 2MW5A 3ZW3A 5LXHA 2LVOA 5CHFA 2KC1A 3CSTA 2J7QB 2CKHB 1NBFC 4P7IA 1SIFA 2LGDA 3TJPA 2BKFA 3K9PB 3H7PB 2WYQA 4MM3A 2DAJA 3RULA 3JSVB 1S3SG 3A4RA 2LD9A 1E8YA 2BPSA 2KX0A 4GN1A 3NHEB 4GDLB 5JZEB 4EZJA 1WGRA 1RLFA 3OJ3A 3A9KA 1K8RB 2V1YA 4WJPA 4IC7B 3QHTA 2FCSA 3ALBA 4DXAB 2M17A 4EEWA 3VVWB 3VTWA 1H4RA 2PEAA 3N30A 1WZ3A 2ZCBA 3HM6X 5TR5A 2W9NA 2KOXA 2O6VD 2KLGA 4J6IA 2BKRB 3ZKJC 1NDDA 2DZKA 1R4MI 2KFJA 4GDKA 4HCNB 2LZ6A 4EOYA 2O6VB 1P1AA 3OLMD 2KWCA 5IA7A 2KKCA 4K81A 4W9CA 1WF9A 3AULA 5AZGA 4E3CA 1ZKHA 2M4NA 2MA9B 4G0NB 2DHZA 1WRDB 2CHXA 2ZPYA 1H8CA 1GC6A 3IVFA 2JF5A 4FULA 4IWPA 4YL8A 1D3ZA 3ML9A 1XQQA 2GBNA 2HJ8A 2N9PC 2IY1B 3K9OB 3M95A 1WGYA 2KQ7A 4I6LB 4MSQB 1JRUA 2L0FA 2ZNVB 5GMVA 4AJYB 2BYEA 2MQJA 4KVGB 4CYEA 1E8ZA 2N1WA 2YLMA 3GOEA 3KH0A 3KUZA 4HJKA 3JW0X 1FXTB 2ZCCA 3DCGA 4MGZE 3VQIA 3L13A 3WAPA 4DWFA 2ZJDA 4TKNA 1AARA 1P98A 2IBIB 3NZUA 3ZRCA 1J0GA 4ZRIA 2DENB 4MSMB 3HHMA 4IM0A 4LJOB 2NS5A 3VTVA 3L54A 3VH4B 3SD5A 4CHKA 4MGYE 2KC2A 4FHJA 3A9KB 3KYCD 4WAAA 3SDLC 4EZKA 3DVGX 3ZNHB 2LRUA 3HM3A 1Q5WB 3WANA 1YX6B 3A9JA 2REXA 1V2YA 1TBEA 5IAAC 2K8HA 3H9DA 3PHWB 5E6OA 1E7UA 1RAXA 3QARA 3VFKA 1WH3A 1WJUA 1YD8U 5DCNA 4F8CB 5DPSA 2C5LC 1VCBA 2K8CA 3X0WA 2EMSA 2ZNVC 2WX0A 4EKUA 2L3ZA 1WE7A 2KO3A 3A1QA 3MJWA 1WXSA 1IYFA 3PVLA 4B95A 2MWSB 1J8CA 1Z2MA 2KLCA 1OTRB 2HD5B 4WJQA 3R7RA 5D7GA 3VUYA 3UGBB 1EUVB 1C3TA 3LDZE 4MEMA 3APFA 1SGHA 2MP2A 3HIZA 2ZEQA 1WJ4A 1UH6A 4DHZB 3Q3JA 2L00B 2QHOA 1V80A 4URKA 2MBOA 3ZRFA 4ANVA 4IUMB 4IWQA 4BBNF 3N32A 1KLVA 3ZDTA 3QAQA 2IY0B 1S1QB 4JL9A 4GU2A 1E8WA 1C1YB 1LM8B 2LXAA 2N9EB 3GZNI 2KD0A 3PV1A 4MGKE 4EUTA 3IBEA 4K1RB 2KFKA 2GOWA 2Z0DB 5EDSA 1ISNA 4M0WB 1M94A 3UIOB 4PS8A 2N7DA 3ZNZB 2JWZA 1L2NA 3VDZA 1WM2A 2KMAA 3DPDA 3RD2A 5CHWA 4DHJD 1GC7A 4E71A 2JZ3B 1XD3B 2VRRB 2DZJA 1I35A 3IHPC 1WI0A 3VTUA 2A5UA 3W1SA 1WMHB 3OJ4B 2NBUA 3C0RB 4NJ6A 5J17A 1LFDA 3R66C 4GMVA 3UQBA 3VUWA 4W9DA 3ZTDA 3BY4B 2BF8B 1KJTA 1T0YA 3DOWA 3PRMB 4N9F4 4WWPA 3AI5A 1V5TA 2FCMA 1HE8A 4IW0A 1RRBA 3ZDMC 1E7VA 2GBMA 3QC8B 2MP2B 2K6QA 4BKGA 3CSFA 3MHSD 1KOTA 3EECA 1SE9A 4LCDE 2GBRA 2M8SA 3KYDD 4W9JA 2RGFA 1UGMA 2K8BA 2MBHA 2G45B 1R4NI 2C60A 2D11A 2JXXA 1V9JA 3M62B 3JVZX 4II3B 2J0JA 3AXCA 1WR6E 3QIJA 3PSEB 4HDOA 3PREA 5E6NA 5E6PA 1UELA 1WJ6A 2FIFA 2N7EA 3ML8A 3JYUA 4MJSA 2BWFA 2OOBB 2N4FA 4HPMB 2KQSA 1X1MA 3UIPB 2KFKB 2L05A 4HLEA 4DDID 2ZVNA 4BBNC 1OEYJ 2RPQA 3ECIA 2AL6A 1YX5B 4FN2A 2JRHA 2O2VA 4FHKA 5J18A 2C7MB 3PRPB 4K7WA 4WWOA 2KDFB 4HVBA 4NQKE 4B6WA 2ZPNA 3PZDA 4NPNA 2Y5BB 3ZIMA 3CF6E 4BOSC 2K25A 3L16A 1EF1A 2KMCA 1V81A 4HPLB 4M8MA 3I3TB 3B0AA 4NAWA 5J2RA 2IYDB 1IPGA 3DBLI 4NY0A 1ZW7A 1TTNA 1EO6A 1WY8A 1WX8A 2PJHA 3H1UA 4DK5A 1LXDA 2JUOA 2FNJB 1P0RA 2KNBA 4ZRKA 4IM3A 2D10A 4W9EA 1Y8RC 3A33B 3PLVA 4KSKC 2KN5A 2L7RA 1OGWA 2PE6B 2ZZPB 3KUCB 5G2NA 5G55A 3V6EB 5JH5C 2CS4A 2R2OA 3QQ8B 4TQ1A 4AUQC 2R2QA 2KDIA 3ONSA 3VH3B 3H6NA 3ZO5B 2KJHB 4F1SA 3TIXA 3W1YA 3DBRI 1V6EA 4KDLB 3N3KB 4NNJB 4RM9A 4GB9A 3WAMA 3SU8X 2WWZA 3OAWA 4KIKA 4EZLA 4JQWC 1YQBA 3R3MA 3LJ3A 2JRIB 3WAOA 2JY6A 3TL5A 2XBBC 4FBJB 4MJSB 3HK0A 3TMPB 4GDKB 1U4AA 3ZTCA 2GMIC 2AEHA 2D2QA 2G4DB 1WXVA 1NI2A 2I1KA 2K6DB 2MLBA 2IZVB 1L7YA 2PE9A 4ICVA 4K7UA 4AJWA 3O65B 2BYFA 2KDBA 1YJ1A 3KVFB 4K7SA 2NBWB 1TGZB 3NOBA 2LVQA 4BFRA 3QK0A 5KHQA 2LXCA 1WZ0A 4TV3A 1OEYA 4BOZB 1WIAA 3B1LX 3PPAA 2IO2B 3U30A 4GSWA 3WA0A 2FCQA 4W9KA 3UINB 4GDLA 4OVVA 2KXJA 2B3AA 3QCAA 1LQBA 3BINA 3CMMB 3IFWB 4NAWB 2BWES 2G3QB 2RD0A 2Z0EB 3M3JA 1V5OA 4DBGA 2A4ZA 3L08A 2MCNB 4TQ0A 3ZLZA 2IO3B 4FJZA 4HWIB 4ANUA 2WDTB 3ZNID 4KSLC 2NPTA 2D3GA 4KV2A 4WJOA 2AL3A 2RSUA 2XEWA 2BGFA 2ZVOA 4FJVB 1MG8A 3PS6A 3ZNGC 5AZHA 3A9JB 5D6JB 3S2AA 2KZRA 4FADA 3IG3A 4DHJB 4RMAA 5AEKB 2J0KA 3DQVA 3AU4A 1UZXB 3M63B 4KIKB 5KHOA 2YVCA 1WX7A 2JT4B 2PPHA 2XK5A 1E8XA 4MGIE 4PYUA 2K39A 5DPTA 1J19A 3A1QB 2KANA 5CTRC 3VHTC 4DHZE 2V4LA 1VD2A 3V6CB 1WXMA 4GGQA 4B9KA 2M1MA 1Z5SB 3KW5B 4I6PA 4XC2A 2DX5B 4MDKE 1KM7A 2LWPA 1WGDA 3H7SA 2LGYA 3DVNU 3Q3FA 3DDCB 1F9JA 2OJRA 2LASA 2C9WB 1WYWB 1WM3A 4HXDA 3WIMA 3VAWA 4LDTD 3RZWC 4ZYNA 2LUEA 3PRZA 2K1FA 3RYTA 2IO0B 5D94A 4GXBA 5JHAA 4ZDVA 1Q0WB 3EC8A 1GG3A 4FA6A 4I6NB 4LDTB 4WJNA 1I42A 4EFOA 2KWUB 5AZFA 1IP9A 5DPWA 2MRPA 4HK2A 2MBQA 2LI5A 4MELA 5DPRA 2J0MA 2KX3A 2JZZA 1WGGA 4JGHB 4CO7A 5L95C 2NPTB 4KZ0A 2KVRA 2UYZB 1WJNA 5JHBA 4TUUA 2KTRA 5BO4B 2KTFA 1Q1OA 1TZ1A 2KJRA 4M8NA 4HCPB 3L17A 4JLCA 5CX3A 3APCA 3RCZA 1QZEA 4IWOA 3TBLD 2HE7A 4DDGD 3PLUA 1UBQA 1WFYA 3NZSA 2BYVE 4LJPB 4NJ7A 4WQOB 5L83A 1A5RA 2N9XA 2KHWB 2XK5B 4AP4C 3WALA 5LLIA 4GOCA 3NY5A 2G4SA 3PGEA 1RFAA 1WX9A 3VXWA 3RT3B 4W9LA 1G6JA 1GJZA 4FLHA 3DVGY 5CHVC 2DYMA 5HKHA 2Z59B 4JIOU 4ICUA 1UBIA 1UD7A 2KDEB 2FCNA 3TCAA 3PTFC 2L76A 1E90A 2ASQA 4RM8A 3ENEA 5C23A 3MTNB 3SHQA 3DBSA 4XX5A 1YIWA 4X57B 2L0TA 3V61A 4ANXA 4KDIC 4HDQA 2V3SA 5LXIB 4WWNA 2UWQA 3V60A 3QJZA 3UQAA 4PS3A 3W1SC 4A3OA 4A3PA 4BKSA 2KK8A 3VUXA 1E5WA 2L8JA 3A4SC 2C7HA 3ZVVA 4GIVA 4ASWC 2GBJA 3U7DA 1WMHA 2O2VB 1XT9B 2C7NB 3RUIB 2NCNA 3X23A 2NBVB 3EHVA 3RZFA 2CHZA 3KUDB 3H7PA 3AU5A 4BKTA 2KWVB 2WX1A 4XZ4A 4NQLB 2HTHA 3JSVA 2DYOA 2KTRB 4F7ZA 2CR5A 1GUAB 3L0WB 1GNUA 3APDA 4G3XB 3U8ZA 4OVUA 3QX1A 3QWZB 2DAFA 4IM2A 4MH0E 3ZUNA 2LRWA 1V49A 2N1VA 4W9GA 3EFUA 1EF5A 5D2MB 4W9HA 3UF8A 2AYOB 2DZIA 2JPHA 1WXAA 3D32A 2DYBA 2FUHB 5C1ZA 2LVPA 3R7QA 1CMXB 4AWJA 3T9LA 4KZCA 2LJ5A 4FJYA 4AOFA 2LGXA 1OQYA 4W9FA 1P3QU 2EKEC 1WR1A 2M0XA 2NR2A
chains in the Genus database with same CATH superfamily
2JSVX 2MBEA 4G50A 2IO1B 3ZGZA 2D07B 2EMTA 1TY0A 2O6VA 3U7ZA 3PT2B 1TKGA 2FAZA 2MBBB 1PUTA 1MHXA 3HVDA 4G11A 4E74A 2KJ6A 4BVUC 5FR6A 3GP7A 2I38A 3NS8A 3ZW3A 5CHFA 3VRAB 2KC1A 2CKHB 1NBFC 2LGDA 4YSXB 1TY2A 2OEDA 5BYSA 2WYQA 4MM3A 2DAJA 3A4RA 2LD9A 1QF6A 2HJ1A 1XO3A 1AN8A 4OW0A 4RF1A 1RLFA 3OJ3A 3A9KA 3AEFB 3NS1A 2QIEB 1QKZA 3NUHB 1FXIA 4A55A 4YWGG 1XLNA 4JWSC 2M17A 1VZ6A 3VVWB 3VTWA 1V8CA 2JXTA 3N30A 3KLSX 2ZCBA 3HM6X 2W9NA 2WXJA 4J6IA 3V3XA 1NDDA 2DZKA 1R4MI 2WXGA 1P1AA 2KWCA 4E3CA 2MA9B 4G0NB 1WRDB 2CHXA 4C7ZA 4YL8A 1D3ZA 3ML9A 1XQQA 2HJ8A 2JYTA 2N9PC 2K9XA 2YEPF 1L4DB 3K9OB 2KQ7A 2QSDA 4AJYB 1F77A 1E8ZA 5EE1A 1FXTB 3DCGA 4MGZE 3WAPA 2ZJDA 2OHFA 3NZUA 1T0QC 3HRDD 3VH4B 4FHJA 1WWTA 3KYCD 3SDLC 3WANA 2REXA 1YN3A 5IAAC 2PVGC 5H92C 1E7UA 3QARA 5DPSA 2K8CA 3X0WA 3T3OA 4EKUA 3A1QA 3MJWA 4B0MA 1IYFA 2KLCA 3VUYA 4XDCA 1EUVB 3LDZE 4MEMA 1HZ5A 1WJ4A 5I4DA 2J42A 1V80A 3B9JA 4IWQA 4BBNF 3N32A 4C7YA 3QAQA 1S1QB 5IOIA 3FILB 1C1YB 3GZNI 1MHHE 2KD0A 3PV1A 4EUTA 4K1RB 2BYTA 2PMVA 2WXOA 1FIQA 1R4NB 4PS8A 2KMAA 2L83A 2LHEA 3RD2A 1GC7A 1WI0A 1I4XA 3OJ4B 4ZHOA 3DWMA 5EE3A 5GXGB 1KTKA 3R66C 3UQBA 3VUWA 3ZTDA 1WGKA 1ZPSA 1T6BX 3AI5A 2V4IB 4RGOS 1E7VA 2K6QA 1GB4A 1ZXIA 1SE9A 2M8SA 3KYDD 2WDVB 1MG4A 1UGMA 2JXXA 2C60A 1V9JA 3JVZX 4II3B 2J0JA 3OG5A 2MH7A 4S0RA 3PSEB 4CQNA 1WJ6A 2FIFA 2N7EA 2CU3A 3ML8A 3JYUA 2BWFA 1OFFA 4DDID 2LUMA 2LFIA 1OEYJ 2O2VA 4FHKA 5J18A 2H89B 2C7MB 4K7WA 3BYYB 4B6WA 1C4AA 2ZPNA 2Y5BB 3CF6E 4BOSC 3L16A 1V81A 3AH7A 3B0AA 2UU7A 2X8XX 2PW9A 1IPGA 3DBLI 1ZW7A 1EO6A 1WX8A 2PJHA 2JUOA 2FNJB 2D10A 3A33B 2L7RA 4YSZB 5G2NA 5JH5C 3QQ8B 2L32A 2R2QA 1JWMD 4N58A 2KJHB 1V6EA 3P4PB 4RNAA 3AE4B 2QILA 2WWZA 4KIKA 4DQOC 1LGRA 1JWAD 1YQBA 4MT5A 1FNUA 3TL5A 4WURA 4OZBA 1U4AA 2AEHA 2G4DB 4LNIA 2IZVB 3O65B 2BYFA 2KDBA 1YJ1A 2BT6A 3KVFB 2NBWB 2PKOA 5KHQA 4C4VA 3B1LX 2WS3B 4GSWA 2B3AA 3QCAA 3CMMB 2BWES 1ZUD2 3M3JA 1YOVB 2K0PA 4HEA1 4TQ0A 4DXFA 3ZLZA 2IO3B 2RMMA 4HWIB 2WXMA 4HJGE 2NPTA 3KWVA 4WJOA 1RM6C 2BGFA 2ZVOA 3ZNGC 2KZRA 1MI0A 4DHJB 2J0KA 1UZXB 5BMIA 2KT7A 2YVCA 1AW7A 4N59A 4MGIE 2K39A 1L6VA 2V4LA 1WXMA 1Z5SB 2IGGA 3EA6A 4I6PA 4XC2A 5FK9C 2LWPA 2C9WB 3WIMA 1WM3A 1QT9A 1F52A 3PRZA 2K1FA 1SIJA 2WNMA 3P42A 1GG3A 4I6NB 3I5JC 1EWYC 5DPWA 2MRPA 2MBQA 3EFCA 4MELA 2MJ3A 3FC4A 3GE3C 5L95C 4KZ0A 2KVRA 5JHBA 4TUUA 1Q1OA 2KJRA 2IDYA 3L17A 2HE7A 4DDGD 1UBQA 3NZSA 3AE7B 4ACFA 4KKIA 4NJ7A 5MPOA 2N9XA 3WALA 5LLIA 3RT3B 5HKHA 3AM9A 3N1XC 1CJEA 3I63C 2Z8LA 3TCAA 2L76A 2ASQA 5C23A 1YIWA 3N1YC 3NRZA 4KDIC 4PT5A 4HDQA 4WWNA 4ZYSA 3VUXA 2L8JA 4LNOA 3U7DA 1XT9B 2XNAC 3X23A 3RZFA 3U4EG 3ZXRA 5HHDG 2PIAA 4BKTA 3U2SC 1GUAB 2QEJC 1SJHD 1VRAB 2W54A 3DBHB 2N1VA 4W9GA 5D2MB 3UF8A 2JPHA 3D32A 2HTME 1HTQA 5HI1A 1TT5B 1CMXB 2CJOA 1TS4A 2LJ5A 4FJYA 2LGXA 1V1PB 2DWQA 2M0XA 3ZXVA 5TSSA 1WE6A 3V62A 4PYZA 3T8MA 4IG7B 2FUG1 1C77A 1BUIC 1PQSA 3AEBB 1UNSA 2CU1A 3P2BA 1BT0A 4II2B 4W9IA 4IDIA 2N7JA 4YTMB 1WGHA 2MW5A 4WIPA 1DOYA 3TJPA 1C4CA 4A90A 3JSVB 1S3SG 1L0YB 2BPSA 4GN1A 2E3TA 1K8RB 4WJPA 4IC7B 1SF0A 3AV8A 3J9CA 2JWUA 4XDDA 2V3PA 2JU6X 2PEAA 1WZ3A 1AYFA 2D3AA 2KLGA 4HCNB 2LZ6A 2O6VB 2KKCA 5AZGA 1WF9A 3LXFA 4L1BA 1GC6A 4FULA 2RDBC 2GBNA 3TEXA 5G5HA 2IY1B 3M95A 4XWTA 2L0FA 2ZNVB 4YSYB 5GMVA 2BB6A 2BYEA 4CYEA 4JWUC 3KUZA 3JW0X 4DWFA 3Q8EA 1AARA 4MM3B 4YTNB 2DENB 3HHMA 4IM0A 4M0WA 1D5XC 2NS5A 1P7FA 3SD5A 4MGYE 3A9KB 4WAAA 2QJLA 3ZNHB 2KAJA 2LRUA 1L6UA 1YX6B 2WXPA 3PHWB 2IGDA 2WDRB 3RNGC 1MVKA 2H88B 4F8CB 1FFUA 1XCQL 3L4PA 2C5LC 1VCBA 2ZNVC 2WX0A 1WE7A 2KO3A 4WH4A 1J8CA 2HD5B 5D7GA 4HPPA 3CIRB 1KLGD 2EKIA 4DHZB 2QHOA 2MBOA 5BYRA 1DGJA 1I4QA 4IUMB 2Y5PA 1JMLA 1KLVA 2D3BA 1LM8B 2LXAA 5G5GA 2QMTA 3MJ5A 4MGKE 2AQ3B 2KFKA 1ISNA 3UIOB 3ZNZB 2KQ4X 3IAM1 4DHJD 2DBYA 3GB1A 1HXYD 4DXGA 1ENFA 1GOZA 2NBUA 3BWUD 2V0GA 4W9DA 3N20C 3BY4B 2BF8B 1KJTA 3MC9A 3PRMB 2PVOD 1V5TA 1HE8A 4IW0A 1RRBA 4BKGA 1SE4A 3MHSD 1E7PB 5BMGA 1EU3A 4D2KA 2MBHA 1R4NI 2D11A 3AE6B 4EE2A 5E6PA 1IBXB 2NTSA 4MJSA 1N62A 4HLEA 4BBNC 3DBRB 2MJEA 2RPQA 1T5XD 3ECIA 2AL6A 4FN2A 2JRHA 1KF6B 1F0ZA 3PRPB 3MC8A 1C76A 1FPYA 2K3UA 1N5WA 1TKYA 1E9MA 4L23A 1NYRA 4HVBA 4US8A 4NQKE 3PZDA 4NPNA 2KMCA 2EELA 1ACCA 4OHJA 5H8YE 2MEKA 3I3TB 3P1MA 4NAWA 1NVID 1FD6A 3KQ4A 1P0RA 4ZRKA 1TJEA 1MJDA 1OGWA 3Q69A 3V6EB 2BS2B 2FE8A 3ONSA 3ZYYX 4NAMA 4NNJB 4RM9A 4BAXA 3OAWA 1K53A 1JWSD 3R3MA 3RNFC 1JW9D 2J52A 4XE0A 3TMPB 4GDKB 3ZTCA 4K3CA 3DHHC 5HG2A 2LVQA 3AE1B 3QK0A 3Q6BA 1WIAA 3WA0A 4P1BC 4W9KA 3Q14C 3UINB 4OVVA 3VRBB 1CK1A 3RI7C 2RD0A 2A4ZA 2MCNB 4XYCA 2LGIA 1RWSA 4HKZE 2WDTB 4KSLC 1RYJA 1STEA 3VR8B 3NJTA 2W55A 1PGBA 3NVZA 3A9JB 5D6JB 1YN4A 4RMAA 3AU4A 4KIKB 4M02A 2PPHA 2XK5A 1E8XA 4PYUA 3N1ZC 1J19A 4DHZE 1JALA 3KW5B 1R7SA 2DX5B 1QQRA 2KACA 3OWEB 3DVNU 4C80A 3DDCB 1K51A 1KLUD 1WYWB 4HXDA 4C4VB 3VAWA 3RZWC 4R3DA 4ZYNA 1V97A 3RPFC 2N0SB 4LDTB 4WJNA 4EFOA 5AZFA 1IP9A 1IGCA 1TS3A 2KX3A 1TS5A 4JGHB 2NPTB 2AQ2B 1OQQA 1WJNA 1MPEA 2KTRA 2KTFA 2R61A 1TZ1A 1XF5L 3TEWA 3APCA 3RCZA 1QZEA 3TBLD 5IP4D 1WFYA 4P16A 4RCOA 3W5UB 1QOBA 3NVVA 3FKYA 2KHWB 1G6JA 1WX9A 3DVGY 2DYMA 4JIOU 2WP9B 1ROEA 3FILA 4RGNA 3PTFC 3RNAC 1E90A 3P4RB 5BMHA 3MTNB 4XX5A 2L0TA 4ANXA 3W1SC 4A3OA 4A3PA 5T8IA 2KK8A 1E5WA 2K22A 3GZNB 3NVWA 2WLBA 2GBJA 3Q8FA 1I4PA 2SEBD 2CHZA 3KUDB 3H7PA 1L4ZB 1CZPA 4XZ4A 4NQLB 1SEBD 2HTHA 2WU5B 4F7ZA 2W82A 3QX1A 4Q2JA 2LRWA 1V49A 4WQMA 1T0RC 2SAKA 1J7AA 1JWBD 5C1ZA 3UI3A 2X38A 1NENB 3VR9B 4REZA 1WR1A 2CHWA 3B08A 4PS7A 2RR9A 4ZRQA 1QOGA 2RDGA 1Y56A 4BKSD 2WGSA 3AMZA 2I1JA 2BS4B 2FIDA 3RNCC 3DVNV 1I4HA 3PHXB 3L10B 3DBHI 5LXHA 1JWUD 2WHIA 3CSTA 3GE8C 1SIFA 4KGTA 2BKFA 3K9PB 1B9RA 4RF0A 3RULA 4O1NA 1D4BA 1M4VA 1E8YA 3E56A 2INCC 3NHEB 3URYA 1XLQA 4GDLB 5JZEB 1FO4A 1WGRA 2V1YA 2WU2B 5EE0A 3MHZA 2FCSA 4DXAB 1JROA 4EEWA 2INNE 3IAS1 5D3IB 1XLOA 1I4GA 3ZKJC 4YTPB 2CJNA 5C2TB 2ON8A 5EE9A 4EOYA 4K81A 4W9CA 3ETRA 4A6QA 2DHZA 2ZPYA 1H8CA 4IWPA 1F1HA 1WGYA 1TS2A 3ZQ4A 2YLMA 3Q3NC 3KH0A 4HJKA 4ARCA 1P98A 2IBIB 1QILA 4ZRIA 4MSMB 4LJOB 3VTVA 4TMAB 2RPVA 4CHKA 4XGAB 2KC2A 3Q8AA 4EZKA 1PGAA 3HM3A 1Q5WB 1KRHA 1V2YA 2PTLA 2VZKB 3RNEC 1EWCA 3VFKA 1WJUA 5IO9A 1HTOA 1WXSA 4B95A 2MWSB 1Z2MA 1OTRB 3R7RA 1C3TA 2I2YA 1SGHA 2MP2A 3HIZA 3ZJTA 1UH6A 3Q3JA 1CQVA 2WXRA 4WWMA 4URKA 3ZRFA 3ABVB 4ANVA 5BYQA 2BQQA 3ZDTA 1GAQB 1FRDA 1UUPA 2J4XA 3P4SB 4US9A 2N9EB 4ITKA 4OZCA 2Z0DB 5EDSA 2MHJA 4NZLB 4M0WB 2D3CA 2N7DA 3EGRA 1L2NA 1WM2A 3DPDA 1F2RI 5CHWA 2VRRB 2DZJA 1I35A 3IHPC 3LYYA 3VTUA 1WMHB 1FXAA 4C00A 4C56C 2HDEA 2WQYB 1C79A 3C0RB 4IKGA 3AEGB 4GMVA 1L0XB 3NZ3A 2GLSA 1SB3C 2FCMA 3EUB2 1P7EA 4LK0M 2GBMA 3QC8B 4USAA 4JX1C 3CSFA 3EECA 4LCDE 4L2YA 4W9JA 5JXVA 2RGFA 1D5MC 2IJ0A 1ESFA 1TKEA 3AXCA 1YJJA 1WR6E 3QIJA 2KMMA 4HDOA 5E6NA 1T3QA 1UELA 3FAHA 1Q10A 4HPMB 2KDMA 2KQSA 1X1MA 1ET9A 2GRIA 2KFKB 2L05A 3UIPB 1ZP0B 1T0SC 2ZVNA 4H2AA 3AEEB 1YX5B 2BB5A 1L5PA 3PZ7A 2LMCA 2KDFB 4A8XC 1ZE3D 3Q3MC 2GI9A 4LLGM 1EF1A 2ACZB 5J2RA 2IYDB 4NJCA 1J7CA 2E6XA 1TTNA 2LEKA 1WY8A 3H1UA 3IXSA 3SFDB 4DK5A 1LXDA 1VZ8A 4W9EA 1E0ZA 3PLVA 4KSKC 2PE6B 3KUCB 4HROA 1V1PA 2CS4A 4TQ1A 4AUQC 2KDIA 2PLPA 3H6NA 1HEZE 3TIXA 5FR3A 3DBRI 3V05A 4KDLB 3N3KB 4GB9A 4ZOHC 2VH1A 3WAOA 2JY6A 2WXHA 3AE3B 4FBJB 4MJSB 2Q5WD 3HK0A 1WXVA 4K7UA 1NI2A 2K6DB 4ICVA 1L7YA 1PDXA 1JCKB 1KFYB 4K7SA 1TGZB 4LTUA 2LXCA 5HFYA 1OEYA 3SEBA 2G1EA 3DWGC 3U30A 2KXJA 3P4QB 2IGHA 1LQBA 3BINA 4NAWB 2G3QB 1V5OA 4RFBA 3BYTB 2GB1A 4RGTA 1F2RC 1KH0A 3ZNID 4P1CC 3WCQA 4KV2A 2AL3A 2RSUA 2XEWA 1MG8A 3PS6A 5AZHA 3S2AA 3AB5A 2LHDA 4RH6A 5AEKB 1L0VB 1YJIA 4LNKA 2QC8A 1WX7A 3A1QB 5CTRC 2KANA 3VHTC 2J53A 3AEAB 4OVZA 3V6CB 1YQ4B 4RGMA 4GGQA 4ARIA 3KWLA 3H7SA 1LO5D 3Q3FA 3ZJVA 4PK1A 1F9JA 2OJRA 2LASA 2WXLA 2LUEA 4K3BA 2IO0B 4GXBA 5JHAA 4ZDVA 1Q0WB 1VZ7A 2LJIA 3E9SA 3R8BA 1I42A 2KWUB 1WYGA 2LI5A 5DPRA 2BW2A 5IKCM 2JZZA 3I9V1 2UYZB 1FM0D 4B0EA 1I4RA 1HQRD 2FBWB 5BO4B 3Q8CA 5CX3A 1I7HA 2IPKD 4WQOB 5L83A 2XK5B 4AP4C 1FRRA 2G4SA 1YN5A 4GLSC 4W9LA 3AE8B 1GJZA 4MH8A 2Z59B 1UBIA 2OJWA 2B76B 4RM8A 3SHQA 3DBSA 4X57B 2RDHA 3V61A 4XWWA 2L52A 2V3SA 3RFZB 3V60A 3UQAA 2VZKD 5AUKA 4YT0B 4BKSA 1QLBB 3BVGA 4ASWC 5C3JB 2INDC 2O2VB 2C7NB 3TSSA 3RNBC 3IT6B 1A70A 1SE3A 2DYOA 2KTRB 3NVYA 4KX6B 2CR5A 2VH2A 3PZ8A 3QWZB 3ZUNA 4IM2A 4MH0E 3EFUA 1EF5A 4W9HA 2AYOB 2DZIA 2L1AA 1WXAA 1YQ3B 3BVMA 2FUHB 2LVPA 1IUEA 3T9LA 3PO0A 4ZRPA 2W3RA 4AOFA 1OQYA 3SFEB 3AE2B 2JVCA 3C8YA 1IBXA 1P9DU 3IT4B 2MSED 2GBKA 2DNFA 1N6ZA 2NVUI 4A9AA 2DZMA 2MX2A 1ZGUB 1V86A 2D5GA 2AWTA 4ANWA 4ZRJA 4A20A 3MC0B 2KVZA 1R4MB 3QA8A 2LVOA 3NG0A 5AUIA 2J7QB 1VR9A 1UF0A 4P7IA 1GPXA 3H7PB 2KX0A 4EZJA 3P63A 3QHTA 3ALBA 4YXDB 3LB8C 2WXQA 3GS2A 5FKAC 1H4RA 3BZDB 2NMQA 3W5VB 2DLBA 5TR5A 2BS3B 2KOXA 2O6VD 2BKRB 2QCZA 2KFJA 4GDKA 4BZAA 1TYGB 3OLMD 5IA7A 1HZ6A 3AULA 1ZKHA 1NI3A 2M4NA 1KOTA 3IVFA 2JF5A 4I6LB 4MSQB 1JRUA 4S17A 2MQJA 1E10A 4KVGB 3BVZA 2N1WA 3GOEA 4J3OD 4AQ7A 2ZCCA 3VQIA 3L13A 4TKNA 3ZRCA 1J0GA 1FCLA 3L54A 1SXTA 3CWIA 3DVGX 1QOAA 1YNTE 1ZDXA 3A9JA 1TBEA 2K8HA 3H9DA 5E6OA 1UWXA 1RAXA 1GB1A 1WH3A 2BVCA 1YD8U 1WRIA 5DCNA 3AECB 2EMSA 3R2IA 1N63A 2L3ZA 1SSNA 3PVLA 4ZHPA 4WJQA 3UGBB 4N6EB 2N9LA 2AX5A 3APFA 3BK1A 3O13A 2ZEQA 2L00B 1WSPA 2IY0B 4JL9A 4GU2A 1E8WA 4M01A 1FNVA 3Q3OC 3IBEA 2JYEA 2GOWA 2XN9C 1M94A 4KGSA 1PGXA 1UGJA 2JWZA 3VDZA 1SJED 5E6JA 4OZAA 4E71A 1EU4A 2JZ3B 1XD3B 3I57A 1DOIA 2A5UA 2LGSA 3W1SA 1V1OA 3TEZA 1BXTA 4NJ6A 1B1ZA 1LFDA 5J17A 3Q2AC 1ZOYB 4IOIE 4N9F4 1T0YA 3DOWA 1AWDA 1D5ZC 4WWPA 1YMHE 3DHIC 4JPSA 3ZDMC 3SR6A 2MP2B 4MACA 2BTEA 2GBRA 3DBLB 2K8BA 2G45B 1FEHA 2TSSA 3M62B 1JQ4A 3PREA 3T3NA 2OOBB 2N4FA 1ET6A 2JQRB 1C78A 3HUIA 4AS1A 4WWOA 1VLBA 2JX5A 2ONQA 1N60A 1C4PA 3ZIMA 2K25A 4HPLB 4M8MA 1FNWA 1XLPA 3N9YC 2JZPA 4NY0A 4JE3B 2KNBA 4IM3A 1Y8RC 1QOFA 2KN5A 2ZZPB 5G55A 2Y3AA 1NEKB 2R2OA 1C9FA 3B2GA 2N9KA 3VH3B 1VJKA 2KWDA 3ZO5B 4F1SA 3AN1A 5D3DA 3W1YA 1E6EB 4HKQA 1N5XA 3WAMA 3SU8X 4EZLA 3RMKC 4JQWC 1MFWA 3LJ3A 2JRIB 1HA5A 2XBBC 3BIID 1OQRA 1UWMA 2GMIC 2D2QA 2PE9A 2I1KA 2MLBA 4AJWA 3TUOA 3NOBA 4BFRA 1IGDA 4LNFA 2ZW0A 1D6EC 3AEDB 1WZ0A 4TV3A 4KKJA 4BOZB 3PPAA 2IO2B 2FCQA 3MP9A 4GDLA 3IFWB 3RN9C 1FCCC 2Z0EB 4DBGA 3L08A 1EM7A 2K5PA 4FJZA 4ANUA 2D3GA 2V3NA 3BK2A 4FJVB 2KYWA 1SBBB 3MFGA 2BBCA 3HVZA 4FADA 3IG3A 3DQVA 4HRSA 3M63B 5KHOA 3TEYA 2JT4B 3AE9B 3W9CB 5DPTA 1VD2A 1FFVA 1TIFA 2V9HA 2M1MA 2WXIA 4B9KA 2WXNA 1ZXHA 4MDKE 1KM7A 4TSSA 1WGDA 2NTTA 2LGYA 4FXCA 2QDFA 2M56B 2ZW1A 2M0AA 4LDTD 1BMLC 3RYTA 5D94A 1XEEA 3EC8A 1PYWD 4UDUC 4FA6A 4QAYA 1SE2A 3W2DA 1XXGA 4HK2A 4LNNA 3R2TA 2J0MA 1NYQA 3DHGC 1WGGA 4CO7A 1N61A 1K50A 1DOXA 2ICIA 2Y5CA 4M8NA 4HCPB 4JLCA 4IWOA 2G9HD 2AQ1B 3PLUA 5IN7A 4M00A 1JRPA 2BYVE 4LJPB 1A5RA 4KGRA 4GOCA 3NY5A 3PGEA 1RFAA 3VXWA 1DYQA 4FLHA 2MJDA 5CHVC 3ZJUA 1RFKA 1PFDA 4ICUA 2KN4A 1UD7A 2KDEB 2FCNA 3Q8BA 1XCTL 2WXKA 3ENEA 3U52E 5LXIB 2UWQA 3QJZA 4PS3A 2WXFA 2INPE 1TZOA 5LNK1 3A4SC 2C7HA 3ZVVA 4GIVA 4P6VF 1WMHA 1J7BA 1VDVA 2W3SA 3RUIB 2NCNA 1WXQA 2NBVB 3EHVA 3B2FA 3AE5B 2YEPB 4WAFA 3AU5A 2KWVB 2WX1A 3JSVA 1FMAD 2M19A 3C19A 3L0WB 1GNUA 3APDA 4G3XB 3U8ZA 4OVUA 2DAFA 1ZDVA 2DYBA 3R7QA 3H8HA 4AWJA 2WDQB 4KZCA 4W9FA 1K52A 1P3QU 2EKEC 2NR2A
chains in the Genus database with same CATH topology
2CHWA 1WE6A 3B08A 2MBEA 2JVCA 4PS7A 3V62A 4G50A 2IO1B 1P9DU 2MSED 2RR9A 2GBKA 2D07B 2EMTA 2O6VA 4PYZA 3T8MA 2NVUI 4IG7B 4BKSD 2DZMA 3PT2B 2MX2A 1ZGUB 2FAZA 2MBBB 1V86A 1PQSA 2I1JA 2AWTA 4ANWA 2FIDA 2CU1A 4G11A 4ZRJA 4E74A 3DVNV 3P2BA 1BT0A 2KJ6A 4II2B 4BVUC 3PHXB 4W9IA 4A20A 3L10B 5FR6A 3NS8A 3QA8A 3DBHI 1WGHA 2MW5A 3ZW3A 5LXHA 2LVOA 5CHFA 2KC1A 3CSTA 2J7QB 2CKHB 1NBFC 4P7IA 1SIFA 2LGDA 3TJPA 2BKFA 3K9PB 3H7PB 2WYQA 4MM3A 2DAJA 3RULA 3JSVB 1S3SG 3A4RA 2LD9A 1E8YA 2BPSA 2KX0A 4GN1A 3NHEB 4GDLB 5JZEB 4EZJA 1WGRA 1RLFA 3OJ3A 3A9KA 1K8RB 2V1YA 4WJPA 4IC7B 3QHTA 2FCSA 3ALBA 4DXAB 2M17A 4EEWA 3VVWB 3VTWA 1H4RA 2PEAA 3N30A 1WZ3A 2ZCBA 3HM6X 5TR5A 2W9NA 2KOXA 2O6VD 2KLGA 4J6IA 2BKRB 3ZKJC 1NDDA 2DZKA 1R4MI 2KFJA 4GDKA 4HCNB 2LZ6A 4EOYA 2O6VB 1P1AA 3OLMD 2KWCA 5IA7A 2KKCA 4K81A 4W9CA 1WF9A 3AULA 5AZGA 4E3CA 1ZKHA 2M4NA 2MA9B 4G0NB 2DHZA 1WRDB 2CHXA 2ZPYA 1H8CA 1GC6A 3IVFA 2JF5A 4FULA 4IWPA 4YL8A 1D3ZA 3ML9A 1XQQA 2GBNA 2HJ8A 2N9PC 2IY1B 3K9OB 3M95A 1WGYA 2KQ7A 4I6LB 4MSQB 1JRUA 2L0FA 2ZNVB 5GMVA 4AJYB 2BYEA 2MQJA 4KVGB 4CYEA 1E8ZA 2N1WA 2YLMA 3GOEA 3KH0A 3KUZA 4HJKA 3JW0X 1FXTB 2ZCCA 3DCGA 4MGZE 3VQIA 3L13A 3WAPA 4DWFA 2ZJDA 4TKNA 1AARA 1P98A 2IBIB 3NZUA 3ZRCA 1J0GA 4ZRIA 2DENB 4MSMB 3HHMA 4IM0A 4LJOB 2NS5A 3VTVA 3L54A 3VH4B 3SD5A 4CHKA 4MGYE 2KC2A 4FHJA 3A9KB 3KYCD 4WAAA 3SDLC 4EZKA 3DVGX 3ZNHB 2LRUA 3HM3A 1Q5WB 3WANA 1YX6B 3A9JA 2REXA 1V2YA 1TBEA 5IAAC 2K8HA 3H9DA 3PHWB 5E6OA 1E7UA 1RAXA 3QARA 3VFKA 1WH3A 1WJUA 1YD8U 5DCNA 4F8CB 5DPSA 2C5LC 1VCBA 2K8CA 3X0WA 2EMSA 2ZNVC 2WX0A 4EKUA 2L3ZA 1WE7A 2KO3A 3A1QA 3MJWA 1WXSA 1IYFA 3PVLA 4B95A 2MWSB 1J8CA 1Z2MA 2KLCA 1OTRB 2HD5B 4WJQA 3R7RA 5D7GA 3VUYA 3UGBB 1EUVB 1C3TA 3LDZE 4MEMA 3APFA 1SGHA 2MP2A 3HIZA 2ZEQA 1WJ4A 1UH6A 4DHZB 3Q3JA 2L00B 2QHOA 1V80A 4URKA 2MBOA 3ZRFA 4ANVA 4IUMB 4IWQA 4BBNF 3N32A 1KLVA 3ZDTA 3QAQA 2IY0B 1S1QB 4JL9A 4GU2A 1E8WA 1C1YB 1LM8B 2LXAA 2N9EB 3GZNI 2KD0A 3PV1A 4MGKE 4EUTA 3IBEA 4K1RB 2KFKA 2GOWA 2Z0DB 5EDSA 1ISNA 4M0WB 1M94A 3UIOB 4PS8A 2N7DA 3ZNZB 2JWZA 1L2NA 3VDZA 1WM2A 2KMAA 3DPDA 3RD2A 5CHWA 4DHJD 1GC7A 4E71A 2JZ3B 1XD3B 2VRRB 2DZJA 1I35A 3IHPC 1WI0A 3VTUA 2A5UA 3W1SA 1WMHB 3OJ4B 2NBUA 3C0RB 4NJ6A 5J17A 1LFDA 3R66C 4GMVA 3UQBA 3VUWA 4W9DA 3ZTDA 3BY4B 2BF8B 1KJTA 1T0YA 3DOWA 3PRMB 4N9F4 4WWPA 3AI5A 1V5TA 2FCMA 1HE8A 4IW0A 1RRBA 3ZDMC 1E7VA 2GBMA 3QC8B 2MP2B 2K6QA 4BKGA 3CSFA 3MHSD 1KOTA 3EECA 1SE9A 4LCDE 2GBRA 2M8SA 3KYDD 4W9JA 2RGFA 1UGMA 2K8BA 2MBHA 2G45B 1R4NI 2C60A 2D11A 2JXXA 1V9JA 3M62B 3JVZX 4II3B 2J0JA 3AXCA 1WR6E 3QIJA 3PSEB 4HDOA 3PREA 5E6NA 5E6PA 1UELA 1WJ6A 2FIFA 2N7EA 3ML8A 3JYUA 4MJSA 2BWFA 2OOBB 2N4FA 4HPMB 2KQSA 1X1MA 3UIPB 2KFKB 2L05A 4HLEA 4DDID 2ZVNA 4BBNC 1OEYJ 2RPQA 3ECIA 2AL6A 1YX5B 4FN2A 2JRHA 2O2VA 4FHKA 5J18A 2C7MB 3PRPB 4K7WA 4WWOA 2KDFB 4HVBA 4NQKE 4B6WA 2ZPNA 3PZDA 4NPNA 2Y5BB 3ZIMA 3CF6E 4BOSC 2K25A 3L16A 1EF1A 2KMCA 1V81A 4HPLB 4M8MA 3I3TB 3B0AA 4NAWA 5J2RA 2IYDB 1IPGA 3DBLI 4NY0A 1ZW7A 1TTNA 1EO6A 1WY8A 1WX8A 2PJHA 3H1UA 4DK5A 1LXDA 2JUOA 2FNJB 1P0RA 2KNBA 4ZRKA 4IM3A 2D10A 4W9EA 1Y8RC 3A33B 3PLVA 4KSKC 2KN5A 2L7RA 1OGWA 2PE6B 2ZZPB 3KUCB 5G2NA 5G55A 3V6EB 5JH5C 2CS4A 2R2OA 3QQ8B 4TQ1A 4AUQC 2R2QA 2KDIA 3ONSA 3VH3B 3H6NA 3ZO5B 2KJHB 4F1SA 3TIXA 3W1YA 3DBRI 1V6EA 4KDLB 3N3KB 4NNJB 4RM9A 4GB9A 3WAMA 3SU8X 2WWZA 3OAWA 4KIKA 4EZLA 4JQWC 1YQBA 3R3MA 3LJ3A 2JRIB 3WAOA 2JY6A 3TL5A 2XBBC 4FBJB 4MJSB 3HK0A 3TMPB 4GDKB 1U4AA 3ZTCA 2GMIC 2AEHA 2D2QA 2G4DB 1WXVA 1NI2A 2I1KA 2K6DB 2MLBA 2IZVB 1L7YA 2PE9A 4ICVA 4K7UA 4AJWA 3O65B 2BYFA 2KDBA 1YJ1A 3KVFB 4K7SA 2NBWB 1TGZB 3NOBA 2LVQA 4BFRA 3QK0A 5KHQA 2LXCA 1WZ0A 4TV3A 1OEYA 4BOZB 1WIAA 3B1LX 3PPAA 2IO2B 3U30A 4GSWA 3WA0A 2FCQA 4W9KA 3UINB 4GDLA 4OVVA 2KXJA 2B3AA 3QCAA 1LQBA 3BINA 3CMMB 3IFWB 4NAWB 2BWES 2G3QB 2RD0A 2Z0EB 3M3JA 1V5OA 4DBGA 2A4ZA 3L08A 2MCNB 4TQ0A 3ZLZA 2IO3B 4FJZA 4HWIB 4ANUA 2WDTB 3ZNID 4KSLC 2NPTA 2D3GA 4KV2A 4WJOA 2AL3A 2RSUA 2XEWA 2BGFA 2ZVOA 4FJVB 1MG8A 3PS6A 3ZNGC 5AZHA 3A9JB 5D6JB 3S2AA 2KZRA 4FADA 3IG3A 4DHJB 4RMAA 5AEKB 2J0KA 3DQVA 3AU4A 1UZXB 3M63B 4KIKB 5KHOA 2YVCA 1WX7A 2JT4B 2PPHA 2XK5A 1E8XA 4MGIE 4PYUA 2K39A 5DPTA 1J19A 3A1QB 2KANA 5CTRC 3VHTC 4DHZE 2V4LA 1VD2A 3V6CB 1WXMA 4GGQA 4B9KA 2M1MA 1Z5SB 3KW5B 4I6PA 4XC2A 2DX5B 4MDKE 1KM7A 2LWPA 1WGDA 3H7SA 2LGYA 3DVNU 3Q3FA 3DDCB 1F9JA 2OJRA 2LASA 2C9WB 1WYWB 1WM3A 4HXDA 3WIMA 3VAWA 4LDTD 3RZWC 4ZYNA 2LUEA 3PRZA 2K1FA 3RYTA 2IO0B 5D94A 4GXBA 5JHAA 4ZDVA 1Q0WB 3EC8A 1GG3A 4FA6A 4I6NB 4LDTB 4WJNA 1I42A 4EFOA 2KWUB 5AZFA 1IP9A 5DPWA 2MRPA 4HK2A 2MBQA 2LI5A 4MELA 5DPRA 2J0MA 2KX3A 2JZZA 1WGGA 4JGHB 4CO7A 5L95C 2NPTB 4KZ0A 2KVRA 2UYZB 1WJNA 5JHBA 4TUUA 2KTRA 5BO4B 2KTFA 1Q1OA 1TZ1A 2KJRA 4M8NA 4HCPB 3L17A 4JLCA 5CX3A 3APCA 3RCZA 1QZEA 4IWOA 3TBLD 2HE7A 4DDGD 3PLUA 1UBQA 1WFYA 3NZSA 2BYVE 4LJPB 4NJ7A 4WQOB 5L83A 1A5RA 2N9XA 2KHWB 2XK5B 4AP4C 3WALA 5LLIA 4GOCA 3NY5A 2G4SA 3PGEA 1RFAA 1WX9A 3VXWA 3RT3B 4W9LA 1G6JA 1GJZA 4FLHA 3DVGY 5CHVC 2DYMA 5HKHA 2Z59B 4JIOU 4ICUA 1UBIA 1UD7A 2KDEB 2FCNA 3TCAA 3PTFC 2L76A 1E90A 2ASQA 4RM8A 3ENEA 5C23A 3MTNB 3SHQA 3DBSA 4XX5A 1YIWA 4X57B 2L0TA 3V61A 4ANXA 4KDIC 4HDQA 2V3SA 5LXIB 4WWNA 2UWQA 3V60A 3QJZA 3UQAA 4PS3A 3W1SC 4A3OA 4A3PA 4BKSA 2KK8A 3VUXA 1E5WA 2L8JA 3A4SC 2C7HA 3ZVVA 4GIVA 4ASWC 2GBJA 3U7DA 1WMHA 2O2VB 1XT9B 2C7NB 3RUIB 2NCNA 3X23A 2NBVB 3EHVA 3RZFA 2CHZA 3KUDB 3H7PA 3AU5A 4BKTA 2KWVB 2WX1A 4XZ4A 4NQLB 2HTHA 3JSVA 2DYOA 2KTRB 4F7ZA 2CR5A 1GUAB 3L0WB 1GNUA 3APDA 4G3XB 3U8ZA 4OVUA 3QX1A 3QWZB 2DAFA 4IM2A 4MH0E 3ZUNA 2LRWA 1V49A 2N1VA 4W9GA 3EFUA 1EF5A 5D2MB 4W9HA 3UF8A 2AYOB 2DZIA 2JPHA 1WXAA 3D32A 2DYBA 2FUHB 5C1ZA 2LVPA 3R7QA 1CMXB 4AWJA 3T9LA 4KZCA 2LJ5A 4FJYA 4AOFA 2LGXA 1OQYA 4W9FA 1P3QU 2EKEC 1WR1A 2M0XA 2NR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHW A;  1WE6 A;  3B08 A;  2MBE A;  2JVC A;  4PS7 A;  3V62 A;  4G50 A;  2IO1 B;  1P9D U;  2MSE D;  2RR9 A;  2GBK A;  2D07 B;  2EMT A;  2O6V A;  4PYZ A;  3T8M A;  2NVU I;  4IG7 B;  4BKS D;  2DZM A;  3PT2 B;  2MX2 A;  1ZGU B;  2FAZ A;  2MBB B;  1V86 A;  1PQS A;  2I1J A;  2AWT A;  4ANW A;  2FID A;  2CU1 A;  4G11 A;  4ZRJ A;  4E74 A;  3DVN V;  3P2B A;  1BT0 A;  2KJ6 A;  4II2 B;  4BVU C;  3PHX B;  4W9I A;  4A20 A;  3L10 B;  5FR6 A;  3NS8 A;  3QA8 A;  3DBH I;  1WGH A;  2MW5 A;  3ZW3 A;  5LXH A;  2LVO A;  5CHF A;  2KC1 A;  3CST A;  2J7Q B;  2CKH B;  1NBF C;  4P7I A;  1SIF A;  2LGD A;  3TJP A;  2BKF A;  3K9P B;  3H7P B;  2WYQ A;  4MM3 A;  2DAJ A;  3RUL A;  3JSV B;  1S3S G;  3A4R A;  2LD9 A;  1E8Y A;  2BPS A;  2KX0 A;  4GN1 A;  3NHE B;  4GDL B;  5JZE B;  4EZJ A;  1WGR A;  1RLF A;  3OJ3 A;  3A9K A;  1K8R B;  2V1Y A;  4WJP A;  4IC7 B;  3QHT A;  2FCS A;  3ALB A;  4DXA B;  2M17 A;  4EEW A;  3VVW B;  3VTW A;  1H4R A;  2PEA A;  3N30 A;  1WZ3 A;  2ZCB A;  3HM6 X;  5TR5 A;  2W9N A;  2KOX A;  2O6V D;  2KLG A;  4J6I A;  2BKR B;  3ZKJ C;  1NDD A;  2DZK A;  1R4M I;  2KFJ A;  4GDK A;  4HCN B;  2LZ6 A;  4EOY A;  2O6V B;  1P1A A;  3OLM D;  2KWC A;  5IA7 A;  2KKC A;  4K81 A;  4W9C A;  1WF9 A;  3AUL A;  5AZG A;  4E3C A;  1ZKH A;  2M4N A;  2MA9 B;  4G0N B;  2DHZ A;  1WRD B;  2CHX A;  2ZPY A;  1H8C A;  1GC6 A;  3IVF A;  2JF5 A;  4FUL A;  4IWP A;  4YL8 A;  1D3Z A;  3ML9 A;  1XQQ A;  2GBN A;  2HJ8 A;  2N9P C;  2IY1 B;  3K9O B;  3M95 A;  1WGY A;  2KQ7 A;  4I6L B;  4MSQ B;  1JRU A;  2L0F A;  2ZNV B;  5GMV A;  4AJY B;  2BYE A;  2MQJ A;  4KVG B;  4CYE A;  1E8Z A;  2N1W A;  2YLM A;  3GOE A;  3KH0 A;  3KUZ A;  4HJK A;  3JW0 X;  1FXT B;  2ZCC A;  3DCG A;  4MGZ E;  3VQI A;  3L13 A;  3WAP A;  4DWF A;  2ZJD A;  4TKN A;  1AAR A;  1P98 A;  2IBI B;  3NZU A;  3ZRC A;  1J0G A;  4ZRI A;  2DEN B;  4MSM B;  3HHM A;  4IM0 A;  4LJO B;  2NS5 A;  3VTV A;  3L54 A;  3VH4 B;  3SD5 A;  4CHK A;  4MGY E;  2KC2 A;  4FHJ A;  3A9K B;  3KYC D;  4WAA A;  3SDL C;  4EZK A;  3DVG X;  3ZNH B;  2LRU A;  3HM3 A;  1Q5W B;  3WAN A;  1YX6 B;  3A9J A;  2REX A;  1V2Y A;  1TBE A;  5IAA C;  2K8H A;  3H9D A;  3PHW B;  5E6O A;  1E7U A;  1RAX A;  3QAR A;  3VFK A;  1WH3 A;  1WJU A;  1YD8 U;  5DCN A;  4F8C B;  5DPS A;  2C5L C;  1VCB A;  2K8C A;  3X0W A;  2EMS A;  2ZNV C;  2WX0 A;  4EKU A;  2L3Z A;  1WE7 A;  2KO3 A;  3A1Q A;  3MJW A;  1WXS A;  1IYF A;  3PVL A;  4B95 A;  2MWS B;  1J8C A;  1Z2M A;  2KLC A;  1OTR B;  2HD5 B;  4WJQ A;  3R7R A;  5D7G A;  3VUY A;  3UGB B;  1EUV B;  1C3T A;  3LDZ E;  4MEM A;  3APF A;  1SGH A;  2MP2 A;  3HIZ A;  2ZEQ A;  1WJ4 A;  1UH6 A;  4DHZ B;  3Q3J A;  2L00 B;  2QHO A;  1V80 A;  4URK A;  2MBO A;  3ZRF A;  4ANV A;  4IUM B;  4IWQ A;  4BBN F;  3N32 A;  1KLV A;  3ZDT A;  3QAQ A;  2IY0 B;  1S1Q B;  4JL9 A;  4GU2 A;  1E8W A;  1C1Y B;  1LM8 B;  2LXA A;  2N9E B;  3GZN I;  2KD0 A;  3PV1 A;  4MGK E;  4EUT A;  3IBE A;  4K1R B;  2KFK A;  2GOW A;  2Z0D B;  5EDS A;  1ISN A;  4M0W B;  1M94 A;  3UIO B;  4PS8 A;  2N7D A;  3ZNZ B;  2JWZ A;  1L2N A;  3VDZ A;  1WM2 A;  2KMA A;  3DPD A;  3RD2 A;  5CHW A;  4DHJ D;  1GC7 A;  4E71 A;  2JZ3 B;  1XD3 B;  2VRR B;  2DZJ A;  1I35 A;  3IHP C;  1WI0 A;  3VTU A;  2A5U A;  3W1S A;  1WMH B;  3OJ4 B;  2NBU A;  3C0R B;  4NJ6 A;  5J17 A;  1LFD A;  3R66 C;  4GMV A;  3UQB A;  3VUW A;  4W9D A;  3ZTD A;  3BY4 B;  2BF8 B;  1KJT A;  1T0Y A;  3DOW A;  3PRM B;  4N9F 4;  4WWP A;  3AI5 A;  1V5T A;  2FCM A;  1HE8 A;  4IW0 A;  1RRB A;  3ZDM C;  1E7V A;  2GBM A;  3QC8 B;  2MP2 B;  2K6Q A;  4BKG A;  3CSF A;  3MHS D;  1KOT A;  3EEC A;  1SE9 A;  4LCD E;  2GBR A;  2M8S A;  3KYD D;  4W9J A;  2RGF A;  1UGM A;  2K8B A;  2MBH A;  2G45 B;  1R4N I;  2C60 A;  2D11 A;  2JXX A;  1V9J A;  3M62 B;  3JVZ X;  4II3 B;  2J0J A;  3AXC A;  1WR6 E;  3QIJ A;  3PSE B;  4HDO A;  3PRE A;  5E6N A;  5E6P A;  1UEL A;  1WJ6 A;  2FIF A;  2N7E A;  3ML8 A;  3JYU A;  4MJS A;  2BWF A;  2OOB B;  2N4F A;  4HPM B;  2KQS A;  1X1M A;  3UIP B;  2KFK B;  2L05 A;  4HLE A;  4DDI D;  2ZVN A;  4BBN C;  1OEY J;  2RPQ A;  3ECI A;  2AL6 A;  1YX5 B;  4FN2 A;  2JRH A;  2O2V A;  4FHK A;  5J18 A;  2C7M B;  3PRP B;  4K7W A;  4WWO A;  2KDF B;  4HVB A;  4NQK E;  4B6W A;  2ZPN A;  3PZD A;  4NPN A;  2Y5B B;  3ZIM A;  3CF6 E;  4BOS C;  2K25 A;  3L16 A;  1EF1 A;  2KMC A;  1V81 A;  4HPL B;  4M8M A;  3I3T B;  3B0A A;  4NAW A;  5J2R A;  2IYD B;  1IPG A;  3DBL I;  4NY0 A;  1ZW7 A;  1TTN A;  1EO6 A;  1WY8 A;  1WX8 A;  2PJH A;  3H1U A;  4DK5 A;  1LXD A;  2JUO A;  2FNJ B;  1P0R A;  2KNB A;  4ZRK A;  4IM3 A;  2D10 A;  4W9E A;  1Y8R C;  3A33 B;  3PLV A;  4KSK C;  2KN5 A;  2L7R A;  1OGW A;  2PE6 B;  2ZZP B;  3KUC B;  5G2N A;  5G55 A;  3V6E B;  5JH5 C;  2CS4 A;  2R2O A;  3QQ8 B;  4TQ1 A;  4AUQ C;  2R2Q A;  2KDI A;  3ONS A;  3VH3 B;  3H6N A;  3ZO5 B;  2KJH B;  4F1S A;  3TIX A;  3W1Y A;  3DBR I;  1V6E A;  4KDL B;  3N3K B;  4NNJ B;  4RM9 A;  4GB9 A;  3WAM A;  3SU8 X;  2WWZ A;  3OAW A;  4KIK A;  4EZL A;  4JQW C;  1YQB A;  3R3M A;  3LJ3 A;  2JRI B;  3WAO A;  2JY6 A;  3TL5 A;  2XBB C;  4FBJ B;  4MJS B;  3HK0 A;  3TMP B;  4GDK B;  1U4A A;  3ZTC A;  2GMI C;  2AEH A;  2D2Q A;  2G4D B;  1WXV A;  1NI2 A;  2I1K A;  2K6D B;  2MLB A;  2IZV B;  1L7Y A;  2PE9 A;  4ICV A;  4K7U A;  4AJW A;  3O65 B;  2BYF A;  2KDB A;  1YJ1 A;  3KVF B;  4K7S A;  2NBW B;  1TGZ B;  3NOB A;  2LVQ A;  4BFR A;  3QK0 A;  5KHQ A;  2LXC A;  1WZ0 A;  4TV3 A;  1OEY A;  4BOZ B;  1WIA A;  3B1L X;  3PPA A;  2IO2 B;  3U30 A;  4GSW A;  3WA0 A;  2FCQ A;  4W9K A;  3UIN B;  4GDL A;  4OVV A;  2KXJ A;  2B3A A;  3QCA A;  1LQB A;  3BIN A;  3CMM B;  3IFW B;  4NAW B;  2BWE S;  2G3Q B;  2RD0 A;  2Z0E B;  3M3J A;  1V5O A;  4DBG A;  2A4Z A;  3L08 A;  2MCN B;  4TQ0 A;  3ZLZ A;  2IO3 B;  4FJZ A;  4HWI B;  4ANU A;  2WDT B;  3ZNI D;  4KSL C;  2NPT A;  2D3G A;  4KV2 A;  4WJO A;  2AL3 A;  2RSU A;  2XEW A;  2BGF A;  2ZVO A;  4FJV B;  1MG8 A;  3PS6 A;  3ZNG C;  5AZH A;  3A9J B;  5D6J B;  3S2A A;  2KZR A;  4FAD A;  3IG3 A;  4DHJ B;  4RMA A;  5AEK B;  2J0K A;  3DQV A;  3AU4 A;  1UZX B;  3M63 B;  4KIK B;  5KHO A;  2YVC A;  1WX7 A;  2JT4 B;  2PPH A;  2XK5 A;  1E8X A;  4MGI E;  4PYU A;  2K39 A;  5DPT A;  1J19 A;  3A1Q B;  2KAN A;  5CTR C;  3VHT C;  4DHZ E;  2V4L A;  1VD2 A;  3V6C B;  1WXM A;  4GGQ A;  4B9K A;  2M1M A;  1Z5S B;  3KW5 B;  4I6P A;  4XC2 A;  2DX5 B;  4MDK E;  1KM7 A;  2LWP A;  1WGD A;  3H7S A;  2LGY A;  3DVN U;  3Q3F A;  3DDC B;  1F9J A;  2OJR A;  2LAS A;  2C9W B;  1WYW B;  1WM3 A;  4HXD A;  3WIM A;  3VAW A;  4LDT D;  3RZW C;  4ZYN A;  2LUE A;  3PRZ A;  2K1F A;  3RYT A;  2IO0 B;  5D94 A;  4GXB A;  5JHA A;  4ZDV A;  1Q0W B;  3EC8 A;  1GG3 A;  4FA6 A;  4I6N B;  4LDT B;  4WJN A;  1I42 A;  4EFO A;  2KWU B;  5AZF A;  1IP9 A;  5DPW A;  2MRP A;  4HK2 A;  2MBQ A;  2LI5 A;  4MEL A;  5DPR A;  2J0M A;  2KX3 A;  2JZZ A;  1WGG A;  4JGH B;  4CO7 A;  5L95 C;  2NPT B;  4KZ0 A;  2KVR A;  2UYZ B;  1WJN A;  5JHB A;  4TUU A;  2KTR A;  5BO4 B;  2KTF A;  1Q1O A;  1TZ1 A;  2KJR A;  4M8N A;  4HCP B;  3L17 A;  4JLC A;  5CX3 A;  3APC A;  3RCZ A;  1QZE A;  4IWO A;  3TBL D;  2HE7 A;  4DDG D;  3PLU A;  1UBQ A;  1WFY A;  3NZS A;  2BYV E;  4LJP B;  4NJ7 A;  4WQO B;  5L83 A;  1A5R A;  2N9X A;  2KHW B;  2XK5 B;  4AP4 C;  3WAL A;  5LLI A;  4GOC A;  3NY5 A;  2G4S A;  3PGE A;  1RFA A;  1WX9 A;  3VXW A;  3RT3 B;  4W9L A;  1G6J A;  1GJZ A;  4FLH A;  3DVG Y;  5CHV C;  2DYM A;  5HKH A;  2Z59 B;  4JIO U;  4ICU A;  1UBI A;  1UD7 A;  2KDE B;  2FCN A;  3TCA A;  3PTF C;  2L76 A;  1E90 A;  2ASQ A;  4RM8 A;  3ENE A;  5C23 A;  3MTN B;  3SHQ A;  3DBS A;  4XX5 A;  1YIW A;  4X57 B;  2L0T A;  3V61 A;  4ANX A;  4KDI C;  4HDQ A;  2V3S A;  5LXI B;  4WWN A;  2UWQ A;  3V60 A;  3QJZ A;  3UQA A;  4PS3 A;  3W1S C;  4A3O A;  4A3P A;  4BKS A;  2KK8 A;  3VUX A;  1E5W A;  2L8J A;  3A4S C;  2C7H A;  3ZVV A;  4GIV A;  4ASW C;  2GBJ A;  3U7D A;  1WMH A;  2O2V B;  1XT9 B;  2C7N B;  3RUI B;  2NCN A;  3X23 A;  2NBV B;  3EHV A;  3RZF A;  2CHZ A;  3KUD B;  3H7P A;  3AU5 A;  4BKT A;  2KWV B;  2WX1 A;  4XZ4 A;  4NQL B;  2HTH A;  3JSV A;  2DYO A;  2KTR B;  4F7Z A;  2CR5 A;  1GUA B;  3L0W B;  1GNU A;  3APD A;  4G3X B;  3U8Z A;  4OVU A;  3QX1 A;  3QWZ B;  2DAF A;  4IM2 A;  4MH0 E;  3ZUN A;  2LRW A;  1V49 A;  2N1V A;  4W9G A;  3EFU A;  1EF5 A;  5D2M B;  4W9H A;  3UF8 A;  2AYO B;  2DZI A;  2JPH A;  1WXA A;  3D32 A;  2DYB A;  2FUH B;  5C1Z A;  2LVP A;  3R7Q A;  1CMX B;  4AWJ A;  3T9L A;  4KZC A;  2LJ5 A;  4FJY A;  4AOF A;  2LGX A;  1OQY A;  4W9F A;  1P3Q U;  2EKE C;  1WR1 A;  2M0X A;  2NR2 A; 
#chains in the Genus database with same CATH topology
 2JSV X;  2MBE A;  4G50 A;  2IO1 B;  3ZGZ A;  2D07 B;  2EMT A;  1TY0 A;  2O6V A;  3U7Z A;  3PT2 B;  1TKG A;  2FAZ A;  2MBB B;  1PUT A;  1MHX A;  3HVD A;  4G11 A;  4E74 A;  2KJ6 A;  4BVU C;  5FR6 A;  3GP7 A;  2I38 A;  3NS8 A;  3ZW3 A;  5CHF A;  3VRA B;  2KC1 A;  2CKH B;  1NBF C;  2LGD A;  4YSX B;  1TY2 A;  2OED A;  5BYS A;  2WYQ A;  4MM3 A;  2DAJ A;  3A4R A;  2LD9 A;  1QF6 A;  2HJ1 A;  1XO3 A;  1AN8 A;  4OW0 A;  4RF1 A;  1RLF A;  3OJ3 A;  3A9K A;  3AEF B;  3NS1 A;  2QIE B;  1QKZ A;  3NUH B;  1FXI A;  4A55 A;  4YWG G;  1XLN A;  4JWS C;  2M17 A;  1VZ6 A;  3VVW B;  3VTW A;  1V8C A;  2JXT A;  3N30 A;  3KLS X;  2ZCB A;  3HM6 X;  2W9N A;  2WXJ A;  4J6I A;  3V3X A;  1NDD A;  2DZK A;  1R4M I;  2WXG A;  1P1A A;  2KWC A;  4E3C A;  2MA9 B;  4G0N B;  1WRD B;  2CHX A;  4C7Z A;  4YL8 A;  1D3Z A;  3ML9 A;  1XQQ A;  2HJ8 A;  2JYT A;  2N9P C;  2K9X A;  2YEP F;  1L4D B;  3K9O B;  2KQ7 A;  2QSD A;  4AJY B;  1F77 A;  1E8Z A;  5EE1 A;  1FXT B;  3DCG A;  4MGZ E;  3WAP A;  2ZJD A;  2OHF A;  3NZU A;  1T0Q C;  3HRD D;  3VH4 B;  4FHJ A;  1WWT A;  3KYC D;  3SDL C;  3WAN A;  2REX A;  1YN3 A;  5IAA C;  2PVG C;  5H92 C;  1E7U A;  3QAR A;  5DPS A;  2K8C A;  3X0W A;  3T3O A;  4EKU A;  3A1Q A;  3MJW A;  4B0M A;  1IYF A;  2KLC A;  3VUY A;  4XDC A;  1EUV B;  3LDZ E;  4MEM A;  1HZ5 A;  1WJ4 A;  5I4D A;  2J42 A;  1V80 A;  3B9J A;  4IWQ A;  4BBN F;  3N32 A;  4C7Y A;  3QAQ A;  1S1Q B;  5IOI A;  3FIL B;  1C1Y B;  3GZN I;  1MHH E;  2KD0 A;  3PV1 A;  4EUT A;  4K1R B;  2BYT A;  2PMV A;  2WXO A;  1FIQ A;  1R4N B;  4PS8 A;  2KMA A;  2L83 A;  2LHE A;  3RD2 A;  1GC7 A;  1WI0 A;  1I4X A;  3OJ4 B;  4ZHO A;  3DWM A;  5EE3 A;  5GXG B;  1KTK A;  3R66 C;  3UQB A;  3VUW A;  3ZTD A;  1WGK A;  1ZPS A;  1T6B X;  3AI5 A;  2V4I B;  4RGO S;  1E7V A;  2K6Q A;  1GB4 A;  1ZXI A;  1SE9 A;  2M8S A;  3KYD D;  2WDV B;  1MG4 A;  1UGM A;  2JXX A;  2C60 A;  1V9J A;  3JVZ X;  4II3 B;  2J0J A;  3OG5 A;  2MH7 A;  4S0R A;  3PSE B;  4CQN A;  1WJ6 A;  2FIF A;  2N7E A;  2CU3 A;  3ML8 A;  3JYU A;  2BWF A;  1OFF A;  4DDI D;  2LUM A;  2LFI A;  1OEY J;  2O2V A;  4FHK A;  5J18 A;  2H89 B;  2C7M B;  4K7W A;  3BYY B;  4B6W A;  1C4A A;  2ZPN A;  2Y5B B;  3CF6 E;  4BOS C;  3L16 A;  1V81 A;  3AH7 A;  3B0A A;  2UU7 A;  2X8X X;  2PW9 A;  1IPG A;  3DBL I;  1ZW7 A;  1EO6 A;  1WX8 A;  2PJH A;  2JUO A;  2FNJ B;  2D10 A;  3A33 B;  2L7R A;  4YSZ B;  5G2N A;  5JH5 C;  3QQ8 B;  2L32 A;  2R2Q A;  1JWM D;  4N58 A;  2KJH B;  1V6E A;  3P4P B;  4RNA A;  3AE4 B;  2QIL A;  2WWZ A;  4KIK A;  4DQO C;  1LGR A;  1JWA D;  1YQB A;  4MT5 A;  1FNU A;  3TL5 A;  4WUR A;  4OZB A;  1U4A A;  2AEH A;  2G4D B;  4LNI A;  2IZV B;  3O65 B;  2BYF A;  2KDB A;  1YJ1 A;  2BT6 A;  3KVF B;  2NBW B;  2PKO A;  5KHQ A;  4C4V A;  3B1L X;  2WS3 B;  4GSW A;  2B3A A;  3QCA A;  3CMM B;  2BWE S;  1ZUD 2;  3M3J A;  1YOV B;  2K0P A;  4HEA 1;  4TQ0 A;  4DXF A;  3ZLZ A;  2IO3 B;  2RMM A;  4HWI B;  2WXM A;  4HJG E;  2NPT A;  3KWV A;  4WJO A;  1RM6 C;  2BGF A;  2ZVO A;  3ZNG C;  2KZR A;  1MI0 A;  4DHJ B;  2J0K A;  1UZX B;  5BMI A;  2KT7 A;  2YVC A;  1AW7 A;  4N59 A;  4MGI E;  2K39 A;  1L6V A;  2V4L A;  1WXM A;  1Z5S B;  2IGG A;  3EA6 A;  4I6P A;  4XC2 A;  5FK9 C;  2LWP A;  2C9W B;  3WIM A;  1WM3 A;  1QT9 A;  1F52 A;  3PRZ A;  2K1F A;  1SIJ A;  2WNM A;  3P42 A;  1GG3 A;  4I6N B;  3I5J C;  1EWY C;  5DPW A;  2MRP A;  2MBQ A;  3EFC A;  4MEL A;  2MJ3 A;  3FC4 A;  3GE3 C;  5L95 C;  4KZ0 A;  2KVR A;  5JHB A;  4TUU A;  1Q1O A;  2KJR A;  2IDY A;  3L17 A;  2HE7 A;  4DDG D;  1UBQ A;  3NZS A;  3AE7 B;  4ACF A;  4KKI A;  4NJ7 A;  5MPO A;  2N9X A;  3WAL A;  5LLI A;  3RT3 B;  5HKH A;  3AM9 A;  3N1X C;  1CJE A;  3I63 C;  2Z8L A;  3TCA A;  2L76 A;  2ASQ A;  5C23 A;  1YIW A;  3N1Y C;  3NRZ A;  4KDI C;  4PT5 A;  4HDQ A;  4WWN A;  4ZYS A;  3VUX A;  2L8J A;  4LNO A;  3U7D A;  1XT9 B;  2XNA C;  3X23 A;  3RZF A;  3U4E G;  3ZXR A;  5HHD G;  2PIA A;  4BKT A;  3U2S C;  1GUA B;  2QEJ C;  1SJH D;  1VRA B;  2W54 A;  3DBH B;  2N1V A;  4W9G A;  5D2M B;  3UF8 A;  2JPH A;  3D32 A;  2HTM E;  1HTQ A;  5HI1 A;  1TT5 B;  1CMX B;  2CJO A;  1TS4 A;  2LJ5 A;  4FJY A;  2LGX A;  1V1P B;  2DWQ A;  2M0X A;  3ZXV A;  5TSS A;  1WE6 A;  3V62 A;  4PYZ A;  3T8M A;  4IG7 B;  2FUG 1;  1C77 A;  1BUI C;  1PQS A;  3AEB B;  1UNS A;  2CU1 A;  3P2B A;  1BT0 A;  4II2 B;  4W9I A;  4IDI A;  2N7J A;  4YTM B;  1WGH A;  2MW5 A;  4WIP A;  1DOY A;  3TJP A;  1C4C A;  4A90 A;  3JSV B;  1S3S G;  1L0Y B;  2BPS A;  4GN1 A;  2E3T A;  1K8R B;  4WJP A;  4IC7 B;  1SF0 A;  3AV8 A;  3J9C A;  2JWU A;  4XDD A;  2V3P A;  2JU6 X;  2PEA A;  1WZ3 A;  1AYF A;  2D3A A;  2KLG A;  4HCN B;  2LZ6 A;  2O6V B;  2KKC A;  5AZG A;  1WF9 A;  3LXF A;  4L1B A;  1GC6 A;  4FUL A;  2RDB C;  2GBN A;  3TEX A;  5G5H A;  2IY1 B;  3M95 A;  4XWT A;  2L0F A;  2ZNV B;  4YSY B;  5GMV A;  2BB6 A;  2BYE A;  4CYE A;  4JWU C;  3KUZ A;  3JW0 X;  4DWF A;  3Q8E A;  1AAR A;  4MM3 B;  4YTN B;  2DEN B;  3HHM A;  4IM0 A;  4M0W A;  1D5X C;  2NS5 A;  1P7F A;  3SD5 A;  4MGY E;  3A9K B;  4WAA A;  2QJL A;  3ZNH B;  2KAJ A;  2LRU A;  1L6U A;  1YX6 B;  2WXP A;  3PHW B;  2IGD A;  2WDR B;  3RNG C;  1MVK A;  2H88 B;  4F8C B;  1FFU A;  1XCQ L;  3L4P A;  2C5L C;  1VCB A;  2ZNV C;  2WX0 A;  1WE7 A;  2KO3 A;  4WH4 A;  1J8C A;  2HD5 B;  5D7G A;  4HPP A;  3CIR B;  1KLG D;  2EKI A;  4DHZ B;  2QHO A;  2MBO A;  5BYR A;  1DGJ A;  1I4Q A;  4IUM B;  2Y5P A;  1JML A;  1KLV A;  2D3B A;  1LM8 B;  2LXA A;  5G5G A;  2QMT A;  3MJ5 A;  4MGK E;  2AQ3 B;  2KFK A;  1ISN A;  3UIO B;  3ZNZ B;  2KQ4 X;  3IAM 1;  4DHJ D;  2DBY A;  3GB1 A;  1HXY D;  4DXG A;  1ENF A;  1GOZ A;  2NBU A;  3BWU D;  2V0G A;  4W9D A;  3N20 C;  3BY4 B;  2BF8 B;  1KJT A;  3MC9 A;  3PRM B;  2PVO D;  1V5T A;  1HE8 A;  4IW0 A;  1RRB A;  4BKG A;  1SE4 A;  3MHS D;  1E7P B;  5BMG A;  1EU3 A;  4D2K A;  2MBH A;  1R4N I;  2D11 A;  3AE6 B;  4EE2 A;  5E6P A;  1IBX B;  2NTS A;  4MJS A;  1N62 A;  4HLE A;  4BBN C;  3DBR B;  2MJE A;  2RPQ A;  1T5X D;  3ECI A;  2AL6 A;  4FN2 A;  2JRH A;  1KF6 B;  1F0Z A;  3PRP B;  3MC8 A;  1C76 A;  1FPY A;  2K3U A;  1N5W A;  1TKY A;  1E9M A;  4L23 A;  1NYR A;  4HVB A;  4US8 A;  4NQK E;  3PZD A;  4NPN A;  2KMC A;  2EEL A;  1ACC A;  4OHJ A;  5H8Y E;  2MEK A;  3I3T B;  3P1M A;  4NAW A;  1NVI D;  1FD6 A;  3KQ4 A;  1P0R A;  4ZRK A;  1TJE A;  1MJD A;  1OGW A;  3Q69 A;  3V6E B;  2BS2 B;  2FE8 A;  3ONS A;  3ZYY X;  4NAM A;  4NNJ B;  4RM9 A;  4BAX A;  3OAW A;  1K53 A;  1JWS D;  3R3M A;  3RNF C;  1JW9 D;  2J52 A;  4XE0 A;  3TMP B;  4GDK B;  3ZTC A;  4K3C A;  3DHH C;  5HG2 A;  2LVQ A;  3AE1 B;  3QK0 A;  3Q6B A;  1WIA A;  3WA0 A;  4P1B C;  4W9K A;  3Q14 C;  3UIN B;  4OVV A;  3VRB B;  1CK1 A;  3RI7 C;  2RD0 A;  2A4Z A;  2MCN B;  4XYC A;  2LGI A;  1RWS A;  4HKZ E;  2WDT B;  4KSL C;  1RYJ A;  1STE A;  3VR8 B;  3NJT A;  2W55 A;  1PGB A;  3NVZ A;  3A9J B;  5D6J B;  1YN4 A;  4RMA A;  3AU4 A;  4KIK B;  4M02 A;  2PPH A;  2XK5 A;  1E8X A;  4PYU A;  3N1Z C;  1J19 A;  4DHZ E;  1JAL A;  3KW5 B;  1R7S A;  2DX5 B;  1QQR A;  2KAC A;  3OWE B;  3DVN U;  4C80 A;  3DDC B;  1K51 A;  1KLU D;  1WYW B;  4HXD A;  4C4V B;  3VAW A;  3RZW C;  4R3D A;  4ZYN A;  1V97 A;  3RPF C;  2N0S B;  4LDT B;  4WJN A;  4EFO A;  5AZF A;  1IP9 A;  1IGC A;  1TS3 A;  2KX3 A;  1TS5 A;  4JGH B;  2NPT B;  2AQ2 B;  1OQQ A;  1WJN A;  1MPE A;  2KTR A;  2KTF A;  2R61 A;  1TZ1 A;  1XF5 L;  3TEW A;  3APC A;  3RCZ A;  1QZE A;  3TBL D;  5IP4 D;  1WFY A;  4P16 A;  4RCO A;  3W5U B;  1QOB A;  3NVV A;  3FKY A;  2KHW B;  1G6J A;  1WX9 A;  3DVG Y;  2DYM A;  4JIO U;  2WP9 B;  1ROE A;  3FIL A;  4RGN A;  3PTF C;  3RNA C;  1E90 A;  3P4R B;  5BMH A;  3MTN B;  4XX5 A;  2L0T A;  4ANX A;  3W1S C;  4A3O A;  4A3P A;  5T8I A;  2KK8 A;  1E5W A;  2K22 A;  3GZN B;  3NVW A;  2WLB A;  2GBJ A;  3Q8F A;  1I4P A;  2SEB D;  2CHZ A;  3KUD B;  3H7P A;  1L4Z B;  1CZP A;  4XZ4 A;  4NQL B;  1SEB D;  2HTH A;  2WU5 B;  4F7Z A;  2W82 A;  3QX1 A;  4Q2J A;  2LRW A;  1V49 A;  4WQM A;  1T0R C;  2SAK A;  1J7A A;  1JWB D;  5C1Z A;  3UI3 A;  2X38 A;  1NEN B;  3VR9 B;  4REZ A;  1WR1 A;  2CHW A;  3B08 A;  4PS7 A;  2RR9 A;  4ZRQ A;  1QOG A;  2RDG A;  1Y56 A;  4BKS D;  2WGS A;  3AMZ A;  2I1J A;  2BS4 B;  2FID A;  3RNC C;  3DVN V;  1I4H A;  3PHX B;  3L10 B;  3DBH I;  5LXH A;  1JWU D;  2WHI A;  3CST A;  3GE8 C;  1SIF A;  4KGT A;  2BKF A;  3K9P B;  1B9R A;  4RF0 A;  3RUL A;  4O1N A;  1D4B A;  1M4V A;  1E8Y A;  3E56 A;  2INC C;  3NHE B;  3URY A;  1XLQ A;  4GDL B;  5JZE B;  1FO4 A;  1WGR A;  2V1Y A;  2WU2 B;  5EE0 A;  3MHZ A;  2FCS A;  4DXA B;  1JRO A;  4EEW A;  2INN E;  3IAS 1;  5D3I B;  1XLO A;  1I4G A;  3ZKJ C;  4YTP B;  2CJN A;  5C2T B;  2ON8 A;  5EE9 A;  4EOY A;  4K81 A;  4W9C A;  3ETR A;  4A6Q A;  2DHZ A;  2ZPY A;  1H8C A;  4IWP A;  1F1H A;  1WGY A;  1TS2 A;  3ZQ4 A;  2YLM A;  3Q3N C;  3KH0 A;  4HJK A;  4ARC A;  1P98 A;  2IBI B;  1QIL A;  4ZRI A;  4MSM B;  4LJO B;  3VTV A;  4TMA B;  2RPV A;  4CHK A;  4XGA B;  2KC2 A;  3Q8A A;  4EZK A;  1PGA A;  3HM3 A;  1Q5W B;  1KRH A;  1V2Y A;  2PTL A;  2VZK B;  3RNE C;  1EWC A;  3VFK A;  1WJU A;  5IO9 A;  1HTO A;  1WXS A;  4B95 A;  2MWS B;  1Z2M A;  1OTR B;  3R7R A;  1C3T A;  2I2Y A;  1SGH A;  2MP2 A;  3HIZ A;  3ZJT A;  1UH6 A;  3Q3J A;  1CQV A;  2WXR A;  4WWM A;  4URK A;  3ZRF A;  3ABV B;  4ANV A;  5BYQ A;  2BQQ A;  3ZDT A;  1GAQ B;  1FRD A;  1UUP A;  2J4X A;  3P4S B;  4US9 A;  2N9E B;  4ITK A;  4OZC A;  2Z0D B;  5EDS A;  2MHJ A;  4NZL B;  4M0W B;  2D3C A;  2N7D A;  3EGR A;  1L2N A;  1WM2 A;  3DPD A;  1F2R I;  5CHW A;  2VRR B;  2DZJ A;  1I35 A;  3IHP C;  3LYY A;  3VTU A;  1WMH B;  1FXA A;  4C00 A;  4C56 C;  2HDE A;  2WQY B;  1C79 A;  3C0R B;  4IKG A;  3AEG B;  4GMV A;  1L0X B;  3NZ3 A;  2GLS A;  1SB3 C;  2FCM A;  3EUB 2;  1P7E A;  4LK0 M;  2GBM A;  3QC8 B;  4USA A;  4JX1 C;  3CSF A;  3EEC A;  4LCD E;  4L2Y A;  4W9J A;  5JXV A;  2RGF A;  1D5M C;  2IJ0 A;  1ESF A;  1TKE A;  3AXC A;  1YJJ A;  1WR6 E;  3QIJ A;  2KMM A;  4HDO A;  5E6N A;  1T3Q A;  1UEL A;  3FAH A;  1Q10 A;  4HPM B;  2KDM A;  2KQS A;  1X1M A;  1ET9 A;  2GRI A;  2KFK B;  2L05 A;  3UIP B;  1ZP0 B;  1T0S C;  2ZVN A;  4H2A A;  3AEE B;  1YX5 B;  2BB5 A;  1L5P A;  3PZ7 A;  2LMC A;  2KDF B;  4A8X C;  1ZE3 D;  3Q3M C;  2GI9 A;  4LLG M;  1EF1 A;  2ACZ B;  5J2R A;  2IYD B;  4NJC A;  1J7C A;  2E6X A;  1TTN A;  2LEK A;  1WY8 A;  3H1U A;  3IXS A;  3SFD B;  4DK5 A;  1LXD A;  1VZ8 A;  4W9E A;  1E0Z A;  3PLV A;  4KSK C;  2PE6 B;  3KUC B;  4HRO A;  1V1P A;  2CS4 A;  4TQ1 A;  4AUQ C;  2KDI A;  2PLP A;  3H6N A;  1HEZ E;  3TIX A;  5FR3 A;  3DBR I;  3V05 A;  4KDL B;  3N3K B;  4GB9 A;  4ZOH C;  2VH1 A;  3WAO A;  2JY6 A;  2WXH A;  3AE3 B;  4FBJ B;  4MJS B;  2Q5W D;  3HK0 A;  1WXV A;  4K7U A;  1NI2 A;  2K6D B;  4ICV A;  1L7Y A;  1PDX A;  1JCK B;  1KFY B;  4K7S A;  1TGZ B;  4LTU A;  2LXC A;  5HFY A;  1OEY A;  3SEB A;  2G1E A;  3DWG C;  3U30 A;  2KXJ A;  3P4Q B;  2IGH A;  1LQB A;  3BIN A;  4NAW B;  2G3Q B;  1V5O A;  4RFB A;  3BYT B;  2GB1 A;  4RGT A;  1F2R C;  1KH0 A;  3ZNI D;  4P1C C;  3WCQ A;  4KV2 A;  2AL3 A;  2RSU A;  2XEW A;  1MG8 A;  3PS6 A;  5AZH A;  3S2A A;  3AB5 A;  2LHD A;  4RH6 A;  5AEK B;  1L0V B;  1YJI A;  4LNK A;  2QC8 A;  1WX7 A;  3A1Q B;  5CTR C;  2KAN A;  3VHT C;  2J53 A;  3AEA B;  4OVZ A;  3V6C B;  1YQ4 B;  4RGM A;  4GGQ A;  4ARI A;  3KWL A;  3H7S A;  1LO5 D;  3Q3F A;  3ZJV A;  4PK1 A;  1F9J A;  2OJR A;  2LAS A;  2WXL A;  2LUE A;  4K3B A;  2IO0 B;  4GXB A;  5JHA A;  4ZDV A;  1Q0W B;  1VZ7 A;  2LJI A;  3E9S A;  3R8B A;  1I42 A;  2KWU B;  1WYG A;  2LI5 A;  5DPR A;  2BW2 A;  5IKC M;  2JZZ A;  3I9V 1;  2UYZ B;  1FM0 D;  4B0E A;  1I4R A;  1HQR D;  2FBW B;  5BO4 B;  3Q8C A;  5CX3 A;  1I7H A;  2IPK D;  4WQO B;  5L83 A;  2XK5 B;  4AP4 C;  1FRR A;  2G4S A;  1YN5 A;  4GLS C;  4W9L A;  3AE8 B;  1GJZ A;  4MH8 A;  2Z59 B;  1UBI A;  2OJW A;  2B76 B;  4RM8 A;  3SHQ A;  3DBS A;  4X57 B;  2RDH A;  3V61 A;  4XWW A;  2L52 A;  2V3S A;  3RFZ B;  3V60 A;  3UQA A;  2VZK D;  5AUK A;  4YT0 B;  4BKS A;  1QLB B;  3BVG A;  4ASW C;  5C3J B;  2IND C;  2O2V B;  2C7N B;  3TSS A;  3RNB C;  3IT6 B;  1A70 A;  1SE3 A;  2DYO A;  2KTR B;  3NVY A;  4KX6 B;  2CR5 A;  2VH2 A;  3PZ8 A;  3QWZ B;  3ZUN A;  4IM2 A;  4MH0 E;  3EFU A;  1EF5 A;  4W9H A;  2AYO B;  2DZI A;  2L1A A;  1WXA A;  1YQ3 B;  3BVM A;  2FUH B;  2LVP A;  1IUE A;  3T9L A;  3PO0 A;  4ZRP A;  2W3R A;  4AOF A;  1OQY A;  3SFE B;  3AE2 B;  2JVC A;  3C8Y A;  1IBX A;  1P9D U;  3IT4 B;  2MSE D;  2GBK A;  2DNF A;  1N6Z A;  2NVU I;  4A9A A;  2DZM A;  2MX2 A;  1ZGU B;  1V86 A;  2D5G A;  2AWT A;  4ANW A;  4ZRJ A;  4A20 A;  3MC0 B;  2KVZ A;  1R4M B;  3QA8 A;  2LVO A;  3NG0 A;  5AUI A;  2J7Q B;  1VR9 A;  1UF0 A;  4P7I A;  1GPX A;  3H7P B;  2KX0 A;  4EZJ A;  3P63 A;  3QHT A;  3ALB A;  4YXD B;  3LB8 C;  2WXQ A;  3GS2 A;  5FKA C;  1H4R A;  3BZD B;  2NMQ A;  3W5V B;  2DLB A;  5TR5 A;  2BS3 B;  2KOX A;  2O6V D;  2BKR B;  2QCZ A;  2KFJ A;  4GDK A;  4BZA A;  1TYG B;  3OLM D;  5IA7 A;  1HZ6 A;  3AUL A;  1ZKH A;  1NI3 A;  2M4N A;  1KOT A;  3IVF A;  2JF5 A;  4I6L B;  4MSQ B;  1JRU A;  4S17 A;  2MQJ A;  1E10 A;  4KVG B;  3BVZ A;  2N1W A;  3GOE A;  4J3O D;  4AQ7 A;  2ZCC A;  3VQI A;  3L13 A;  4TKN A;  3ZRC A;  1J0G A;  1FCL A;  3L54 A;  1SXT A;  3CWI A;  3DVG X;  1QOA A;  1YNT E;  1ZDX A;  3A9J A;  1TBE A;  2K8H A;  3H9D A;  5E6O A;  1UWX A;  1RAX A;  1GB1 A;  1WH3 A;  2BVC A;  1YD8 U;  1WRI A;  5DCN A;  3AEC B;  2EMS A;  3R2I A;  1N63 A;  2L3Z A;  1SSN A;  3PVL A;  4ZHP A;  4WJQ A;  3UGB B;  4N6E B;  2N9L A;  2AX5 A;  3APF A;  3BK1 A;  3O13 A;  2ZEQ A;  2L00 B;  1WSP A;  2IY0 B;  4JL9 A;  4GU2 A;  1E8W A;  4M01 A;  1FNV A;  3Q3O C;  3IBE A;  2JYE A;  2GOW A;  2XN9 C;  1M94 A;  4KGS A;  1PGX A;  1UGJ A;  2JWZ A;  3VDZ A;  1SJE D;  5E6J A;  4OZA A;  4E71 A;  1EU4 A;  2JZ3 B;  1XD3 B;  3I57 A;  1DOI A;  2A5U A;  2LGS A;  3W1S A;  1V1O A;  3TEZ A;  1BXT A;  4NJ6 A;  1B1Z A;  1LFD A;  5J17 A;  3Q2A C;  1ZOY B;  4IOI E;  4N9F 4;  1T0Y A;  3DOW A;  1AWD A;  1D5Z C;  4WWP A;  1YMH E;  3DHI C;  4JPS A;  3ZDM C;  3SR6 A;  2MP2 B;  4MAC A;  2BTE A;  2GBR A;  3DBL B;  2K8B A;  2G45 B;  1FEH A;  2TSS A;  3M62 B;  1JQ4 A;  3PRE A;  3T3N A;  2OOB B;  2N4F A;  1ET6 A;  2JQR B;  1C78 A;  3HUI A;  4AS1 A;  4WWO A;  1VLB A;  2JX5 A;  2ONQ A;  1N60 A;  1C4P A;  3ZIM A;  2K25 A;  4HPL B;  4M8M A;  1FNW A;  1XLP A;  3N9Y C;  2JZP A;  4NY0 A;  4JE3 B;  2KNB A;  4IM3 A;  1Y8R C;  1QOF A;  2KN5 A;  2ZZP B;  5G55 A;  2Y3A A;  1NEK B;  2R2O A;  1C9F A;  3B2G A;  2N9K A;  3VH3 B;  1VJK A;  2KWD A;  3ZO5 B;  4F1S A;  3AN1 A;  5D3D A;  3W1Y A;  1E6E B;  4HKQ A;  1N5X A;  3WAM A;  3SU8 X;  4EZL A;  3RMK C;  4JQW C;  1MFW A;  3LJ3 A;  2JRI B;  1HA5 A;  2XBB C;  3BII D;  1OQR A;  1UWM A;  2GMI C;  2D2Q A;  2PE9 A;  2I1K A;  2MLB A;  4AJW A;  3TUO A;  3NOB A;  4BFR A;  1IGD A;  4LNF A;  2ZW0 A;  1D6E C;  3AED B;  1WZ0 A;  4TV3 A;  4KKJ A;  4BOZ B;  3PPA A;  2IO2 B;  2FCQ A;  3MP9 A;  4GDL A;  3IFW B;  3RN9 C;  1FCC C;  2Z0E B;  4DBG A;  3L08 A;  1EM7 A;  2K5P A;  4FJZ A;  4ANU A;  2D3G A;  2V3N A;  3BK2 A;  4FJV B;  2KYW A;  1SBB B;  3MFG A;  2BBC A;  3HVZ A;  4FAD A;  3IG3 A;  3DQV A;  4HRS A;  3M63 B;  5KHO A;  3TEY A;  2JT4 B;  3AE9 B;  3W9C B;  5DPT A;  1VD2 A;  1FFV A;  1TIF A;  2V9H A;  2M1M A;  2WXI A;  4B9K A;  2WXN A;  1ZXH A;  4MDK E;  1KM7 A;  4TSS A;  1WGD A;  2NTT A;  2LGY A;  4FXC A;  2QDF A;  2M56 B;  2ZW1 A;  2M0A A;  4LDT D;  1BML C;  3RYT A;  5D94 A;  1XEE A;  3EC8 A;  1PYW D;  4UDU C;  4FA6 A;  4QAY A;  1SE2 A;  3W2D A;  1XXG A;  4HK2 A;  4LNN A;  3R2T A;  2J0M A;  1NYQ A;  3DHG C;  1WGG A;  4CO7 A;  1N61 A;  1K50 A;  1DOX A;  2ICI A;  2Y5C A;  4M8N A;  4HCP B;  4JLC A;  4IWO A;  2G9H D;  2AQ1 B;  3PLU A;  5IN7 A;  4M00 A;  1JRP A;  2BYV E;  4LJP B;  1A5R A;  4KGR A;  4GOC A;  3NY5 A;  3PGE A;  1RFA A;  3VXW A;  1DYQ A;  4FLH A;  2MJD A;  5CHV C;  3ZJU A;  1RFK A;  1PFD A;  4ICU A;  2KN4 A;  1UD7 A;  2KDE B;  2FCN A;  3Q8B A;  1XCT L;  2WXK A;  3ENE A;  3U52 E;  5LXI B;  2UWQ A;  3QJZ A;  4PS3 A;  2WXF A;  2INP E;  1TZO A;  5LNK 1;  3A4S C;  2C7H A;  3ZVV A;  4GIV A;  4P6V F;  1WMH A;  1J7B A;  1VDV A;  2W3S A;  3RUI B;  2NCN A;  1WXQ A;  2NBV B;  3EHV A;  3B2F A;  3AE5 B;  2YEP B;  4WAF A;  3AU5 A;  2KWV B;  2WX1 A;  3JSV A;  1FMA D;  2M19 A;  3C19 A;  3L0W B;  1GNU A;  3APD A;  4G3X B;  3U8Z A;  4OVU A;  2DAF A;  1ZDV A;  2DYB A;  3R7Q A;  3H8H A;  4AWJ A;  2WDQ B;  4KZC A;  4W9F A;  1K52 A;  1P3Q U;  2EKE C;  2NR2 A; 
#chains in the Genus database with same CATH homology
 2CHW A;  1WE6 A;  3B08 A;  2MBE A;  2JVC A;  4PS7 A;  3V62 A;  4G50 A;  2IO1 B;  1P9D U;  2MSE D;  2RR9 A;  2GBK A;  2D07 B;  2EMT A;  2O6V A;  4PYZ A;  3T8M A;  2NVU I;  4IG7 B;  4BKS D;  2DZM A;  3PT2 B;  2MX2 A;  1ZGU B;  2FAZ A;  2MBB B;  1V86 A;  1PQS A;  2I1J A;  2AWT A;  4ANW A;  2FID A;  2CU1 A;  4G11 A;  4ZRJ A;  4E74 A;  3DVN V;  3P2B A;  1BT0 A;  2KJ6 A;  4II2 B;  4BVU C;  3PHX B;  4W9I A;  4A20 A;  3L10 B;  5FR6 A;  3NS8 A;  3QA8 A;  3DBH I;  1WGH A;  2MW5 A;  3ZW3 A;  5LXH A;  2LVO A;  5CHF A;  2KC1 A;  3CST A;  2J7Q B;  2CKH B;  1NBF C;  4P7I A;  1SIF A;  2LGD A;  3TJP A;  2BKF A;  3K9P B;  3H7P B;  2WYQ A;  4MM3 A;  2DAJ A;  3RUL A;  3JSV B;  1S3S G;  3A4R A;  2LD9 A;  1E8Y A;  2BPS A;  2KX0 A;  4GN1 A;  3NHE B;  4GDL B;  5JZE B;  4EZJ A;  1WGR A;  1RLF A;  3OJ3 A;  3A9K A;  1K8R B;  2V1Y A;  4WJP A;  4IC7 B;  3QHT A;  2FCS A;  3ALB A;  4DXA B;  2M17 A;  4EEW A;  3VVW B;  3VTW A;  1H4R A;  2PEA A;  3N30 A;  1WZ3 A;  2ZCB A;  3HM6 X;  5TR5 A;  2W9N A;  2KOX A;  2O6V D;  2KLG A;  4J6I A;  2BKR B;  3ZKJ C;  1NDD A;  2DZK A;  1R4M I;  2KFJ A;  4GDK A;  4HCN B;  2LZ6 A;  4EOY A;  2O6V B;  1P1A A;  3OLM D;  2KWC A;  5IA7 A;  2KKC A;  4K81 A;  4W9C A;  1WF9 A;  3AUL A;  5AZG A;  4E3C A;  1ZKH A;  2M4N A;  2MA9 B;  4G0N B;  2DHZ A;  1WRD B;  2CHX A;  2ZPY A;  1H8C A;  1GC6 A;  3IVF A;  2JF5 A;  4FUL A;  4IWP A;  4YL8 A;  1D3Z A;  3ML9 A;  1XQQ A;  2GBN A;  2HJ8 A;  2N9P C;  2IY1 B;  3K9O B;  3M95 A;  1WGY A;  2KQ7 A;  4I6L B;  4MSQ B;  1JRU A;  2L0F A;  2ZNV B;  5GMV A;  4AJY B;  2BYE A;  2MQJ A;  4KVG B;  4CYE A;  1E8Z A;  2N1W A;  2YLM A;  3GOE A;  3KH0 A;  3KUZ A;  4HJK A;  3JW0 X;  1FXT B;  2ZCC A;  3DCG A;  4MGZ E;  3VQI A;  3L13 A;  3WAP A;  4DWF A;  2ZJD A;  4TKN A;  1AAR A;  1P98 A;  2IBI B;  3NZU A;  3ZRC A;  1J0G A;  4ZRI A;  2DEN B;  4MSM B;  3HHM A;  4IM0 A;  4LJO B;  2NS5 A;  3VTV A;  3L54 A;  3VH4 B;  3SD5 A;  4CHK A;  4MGY E;  2KC2 A;  4FHJ A;  3A9K B;  3KYC D;  4WAA A;  3SDL C;  4EZK A;  3DVG X;  3ZNH B;  2LRU A;  3HM3 A;  1Q5W B;  3WAN A;  1YX6 B;  3A9J A;  2REX A;  1V2Y A;  1TBE A;  5IAA C;  2K8H A;  3H9D A;  3PHW B;  5E6O A;  1E7U A;  1RAX A;  3QAR A;  3VFK A;  1WH3 A;  1WJU A;  1YD8 U;  5DCN A;  4F8C B;  5DPS A;  2C5L C;  1VCB A;  2K8C A;  3X0W A;  2EMS A;  2ZNV C;  2WX0 A;  4EKU A;  2L3Z A;  1WE7 A;  2KO3 A;  3A1Q A;  3MJW A;  1WXS A;  1IYF A;  3PVL A;  4B95 A;  2MWS B;  1J8C A;  1Z2M A;  2KLC A;  1OTR B;  2HD5 B;  4WJQ A;  3R7R A;  5D7G A;  3VUY A;  3UGB B;  1EUV B;  1C3T A;  3LDZ E;  4MEM A;  3APF A;  1SGH A;  2MP2 A;  3HIZ A;  2ZEQ A;  1WJ4 A;  1UH6 A;  4DHZ B;  3Q3J A;  2L00 B;  2QHO A;  1V80 A;  4URK A;  2MBO A;  3ZRF A;  4ANV A;  4IUM B;  4IWQ A;  4BBN F;  3N32 A;  1KLV A;  3ZDT A;  3QAQ A;  2IY0 B;  1S1Q B;  4JL9 A;  4GU2 A;  1E8W A;  1C1Y B;  1LM8 B;  2LXA A;  2N9E B;  3GZN I;  2KD0 A;  3PV1 A;  4MGK E;  4EUT A;  3IBE A;  4K1R B;  2KFK A;  2GOW A;  2Z0D B;  5EDS A;  1ISN A;  4M0W B;  1M94 A;  3UIO B;  4PS8 A;  2N7D A;  3ZNZ B;  2JWZ A;  1L2N A;  3VDZ A;  1WM2 A;  2KMA A;  3DPD A;  3RD2 A;  5CHW A;  4DHJ D;  1GC7 A;  4E71 A;  2JZ3 B;  1XD3 B;  2VRR B;  2DZJ A;  1I35 A;  3IHP C;  1WI0 A;  3VTU A;  2A5U A;  3W1S A;  1WMH B;  3OJ4 B;  2NBU A;  3C0R B;  4NJ6 A;  5J17 A;  1LFD A;  3R66 C;  4GMV A;  3UQB A;  3VUW A;  4W9D A;  3ZTD A;  3BY4 B;  2BF8 B;  1KJT A;  1T0Y A;  3DOW A;  3PRM B;  4N9F 4;  4WWP A;  3AI5 A;  1V5T A;  2FCM A;  1HE8 A;  4IW0 A;  1RRB A;  3ZDM C;  1E7V A;  2GBM A;  3QC8 B;  2MP2 B;  2K6Q A;  4BKG A;  3CSF A;  3MHS D;  1KOT A;  3EEC A;  1SE9 A;  4LCD E;  2GBR A;  2M8S A;  3KYD D;  4W9J A;  2RGF A;  1UGM A;  2K8B A;  2MBH A;  2G45 B;  1R4N I;  2C60 A;  2D11 A;  2JXX A;  1V9J A;  3M62 B;  3JVZ X;  4II3 B;  2J0J A;  3AXC A;  1WR6 E;  3QIJ A;  3PSE B;  4HDO A;  3PRE A;  5E6N A;  5E6P A;  1UEL A;  1WJ6 A;  2FIF A;  2N7E A;  3ML8 A;  3JYU A;  4MJS A;  2BWF A;  2OOB B;  2N4F A;  4HPM B;  2KQS A;  1X1M A;  3UIP B;  2KFK B;  2L05 A;  4HLE A;  4DDI D;  2ZVN A;  4BBN C;  1OEY J;  2RPQ A;  3ECI A;  2AL6 A;  1YX5 B;  4FN2 A;  2JRH A;  2O2V A;  4FHK A;  5J18 A;  2C7M B;  3PRP B;  4K7W A;  4WWO A;  2KDF B;  4HVB A;  4NQK E;  4B6W A;  2ZPN A;  3PZD A;  4NPN A;  2Y5B B;  3ZIM A;  3CF6 E;  4BOS C;  2K25 A;  3L16 A;  1EF1 A;  2KMC A;  1V81 A;  4HPL B;  4M8M A;  3I3T B;  3B0A A;  4NAW A;  5J2R A;  2IYD B;  1IPG A;  3DBL I;  4NY0 A;  1ZW7 A;  1TTN A;  1EO6 A;  1WY8 A;  1WX8 A;  2PJH A;  3H1U A;  4DK5 A;  1LXD A;  2JUO A;  2FNJ B;  1P0R A;  2KNB A;  4ZRK A;  4IM3 A;  2D10 A;  4W9E A;  1Y8R C;  3A33 B;  3PLV A;  4KSK C;  2KN5 A;  2L7R A;  1OGW A;  2PE6 B;  2ZZP B;  3KUC B;  5G2N A;  5G55 A;  3V6E B;  5JH5 C;  2CS4 A;  2R2O A;  3QQ8 B;  4TQ1 A;  4AUQ C;  2R2Q A;  2KDI A;  3ONS A;  3VH3 B;  3H6N A;  3ZO5 B;  2KJH B;  4F1S A;  3TIX A;  3W1Y A;  3DBR I;  1V6E A;  4KDL B;  3N3K B;  4NNJ B;  4RM9 A;  4GB9 A;  3WAM A;  3SU8 X;  2WWZ A;  3OAW A;  4KIK A;  4EZL A;  4JQW C;  1YQB A;  3R3M A;  3LJ3 A;  2JRI B;  3WAO A;  2JY6 A;  3TL5 A;  2XBB C;  4FBJ B;  4MJS B;  3HK0 A;  3TMP B;  4GDK B;  1U4A A;  3ZTC A;  2GMI C;  2AEH A;  2D2Q A;  2G4D B;  1WXV A;  1NI2 A;  2I1K A;  2K6D B;  2MLB A;  2IZV B;  1L7Y A;  2PE9 A;  4ICV A;  4K7U A;  4AJW A;  3O65 B;  2BYF A;  2KDB A;  1YJ1 A;  3KVF B;  4K7S A;  2NBW B;  1TGZ B;  3NOB A;  2LVQ A;  4BFR A;  3QK0 A;  5KHQ A;  2LXC A;  1WZ0 A;  4TV3 A;  1OEY A;  4BOZ B;  1WIA A;  3B1L X;  3PPA A;  2IO2 B;  3U30 A;  4GSW A;  3WA0 A;  2FCQ A;  4W9K A;  3UIN B;  4GDL A;  4OVV A;  2KXJ A;  2B3A A;  3QCA A;  1LQB A;  3BIN A;  3CMM B;  3IFW B;  4NAW B;  2BWE S;  2G3Q B;  2RD0 A;  2Z0E B;  3M3J A;  1V5O A;  4DBG A;  2A4Z A;  3L08 A;  2MCN B;  4TQ0 A;  3ZLZ A;  2IO3 B;  4FJZ A;  4HWI B;  4ANU A;  2WDT B;  3ZNI D;  4KSL C;  2NPT A;  2D3G A;  4KV2 A;  4WJO A;  2AL3 A;  2RSU A;  2XEW A;  2BGF A;  2ZVO A;  4FJV B;  1MG8 A;  3PS6 A;  3ZNG C;  5AZH A;  3A9J B;  5D6J B;  3S2A A;  2KZR A;  4FAD A;  3IG3 A;  4DHJ B;  4RMA A;  5AEK B;  2J0K A;  3DQV A;  3AU4 A;  1UZX B;  3M63 B;  4KIK B;  5KHO A;  2YVC A;  1WX7 A;  2JT4 B;  2PPH A;  2XK5 A;  1E8X A;  4MGI E;  4PYU A;  2K39 A;  5DPT A;  1J19 A;  3A1Q B;  2KAN A;  5CTR C;  3VHT C;  4DHZ E;  2V4L A;  1VD2 A;  3V6C B;  1WXM A;  4GGQ A;  4B9K A;  2M1M A;  1Z5S B;  3KW5 B;  4I6P A;  4XC2 A;  2DX5 B;  4MDK E;  1KM7 A;  2LWP A;  1WGD A;  3H7S A;  2LGY A;  3DVN U;  3Q3F A;  3DDC B;  1F9J A;  2OJR A;  2LAS A;  2C9W B;  1WYW B;  1WM3 A;  4HXD A;  3WIM A;  3VAW A;  4LDT D;  3RZW C;  4ZYN A;  2LUE A;  3PRZ A;  2K1F A;  3RYT A;  2IO0 B;  5D94 A;  4GXB A;  5JHA A;  4ZDV A;  1Q0W B;  3EC8 A;  1GG3 A;  4FA6 A;  4I6N B;  4LDT B;  4WJN A;  1I42 A;  4EFO A;  2KWU B;  5AZF A;  1IP9 A;  5DPW A;  2MRP A;  4HK2 A;  2MBQ A;  2LI5 A;  4MEL A;  5DPR A;  2J0M A;  2KX3 A;  2JZZ A;  1WGG A;  4JGH B;  4CO7 A;  5L95 C;  2NPT B;  4KZ0 A;  2KVR A;  2UYZ B;  1WJN A;  5JHB A;  4TUU A;  2KTR A;  5BO4 B;  2KTF A;  1Q1O A;  1TZ1 A;  2KJR A;  4M8N A;  4HCP B;  3L17 A;  4JLC A;  5CX3 A;  3APC A;  3RCZ A;  1QZE A;  4IWO A;  3TBL D;  2HE7 A;  4DDG D;  3PLU A;  1UBQ A;  1WFY A;  3NZS A;  2BYV E;  4LJP B;  4NJ7 A;  4WQO B;  5L83 A;  1A5R A;  2N9X A;  2KHW B;  2XK5 B;  4AP4 C;  3WAL A;  5LLI A;  4GOC A;  3NY5 A;  2G4S A;  3PGE A;  1RFA A;  1WX9 A;  3VXW A;  3RT3 B;  4W9L A;  1G6J A;  1GJZ A;  4FLH A;  3DVG Y;  5CHV C;  2DYM A;  5HKH A;  2Z59 B;  4JIO U;  4ICU A;  1UBI A;  1UD7 A;  2KDE B;  2FCN A;  3TCA A;  3PTF C;  2L76 A;  1E90 A;  2ASQ A;  4RM8 A;  3ENE A;  5C23 A;  3MTN B;  3SHQ A;  3DBS A;  4XX5 A;  1YIW A;  4X57 B;  2L0T A;  3V61 A;  4ANX A;  4KDI C;  4HDQ A;  2V3S A;  5LXI B;  4WWN A;  2UWQ A;  3V60 A;  3QJZ A;  3UQA A;  4PS3 A;  3W1S C;  4A3O A;  4A3P A;  4BKS A;  2KK8 A;  3VUX A;  1E5W A;  2L8J A;  3A4S C;  2C7H A;  3ZVV A;  4GIV A;  4ASW C;  2GBJ A;  3U7D A;  1WMH A;  2O2V B;  1XT9 B;  2C7N B;  3RUI B;  2NCN A;  3X23 A;  2NBV B;  3EHV A;  3RZF A;  2CHZ A;  3KUD B;  3H7P A;  3AU5 A;  4BKT A;  2KWV B;  2WX1 A;  4XZ4 A;  4NQL B;  2HTH A;  3JSV A;  2DYO A;  2KTR B;  4F7Z A;  2CR5 A;  1GUA B;  3L0W B;  1GNU A;  3APD A;  4G3X B;  3U8Z A;  4OVU A;  3QX1 A;  3QWZ B;  2DAF A;  4IM2 A;  4MH0 E;  3ZUN A;  2LRW A;  1V49 A;  2N1V A;  4W9G A;  3EFU A;  1EF5 A;  5D2M B;  4W9H A;  3UF8 A;  2AYO B;  2DZI A;  2JPH A;  1WXA A;  3D32 A;  2DYB A;  2FUH B;  5C1Z A;  2LVP A;  3R7Q A;  1CMX B;  4AWJ A;  3T9L A;  4KZC A;  2LJ5 A;  4FJY A;  4AOF A;  2LGX A;  1OQY A;  4W9F A;  1P3Q U;  2EKE C;  1WR1 A;  2M0X A;  2NR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...