3UIOB

Complex between human rangap1-sumo2, ubc9 and the ir1 domain from ranbp2 containing ir2 motif ii
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
79
structure length
79
Chain Sequence
NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-conjugating enzyme UBC9
publication title Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/isomerase/protein binding
total genus 15
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2011-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3uioB00
3IG3A 4MSMB 3UGBB 3QK0A 2KXJA 4MJSA 3VHTC 4MELA 2KANA 5IA7A 4FA6A 4PS7A 4JLCA 4GGQA 2PE6B 1Q5WB 3K9PB 2IO3B 1ZW7A 2AEHA 3VH4B 2C60A 2K39A 4KV2A 4EUTA 2ZCCA 3QC8B 4F1SA 1QZEA 4ICUA 3NOBA 3ZO5B 4BOSC 4MSQB 2EMSA 4G3XB 3W1SC 3TMPB 3NS8A 5G2NA 4GN1A 2C7HA 1E90A 3PHWB 1GNUA 2VRRB 2N9XA 2IO0B 1J19A 1P3QU 2KDEB 1JRUA 5CHVC 5E6NA 2G3QB 2KOXA 1EO6A 3DBHI 2LD9A 2KQ7A 2N7EA 2ZVNA 3A4SC 2KWUB 3ZNHB 2Y5BB 3M62B 3JSVB 1OGWA 4P7IA 3U7DA 1WX8A 4XZ4A 1WYWB 5GMVA 2LGXA 3OLMD 2LASA 5DPWA 1UBIA 3ECIA 4M8MA 5D2MB 2XBBC 3PSEB 2L76A 3ZUNA 4WJNA 4GXBA 2N1VA 3KUZA 2C9WB 3DDCB 1WXSA 2FCNA 2JF5A 3PS6A 4NY0A 2KDIA 4HCPB 4W9EA 4IM0A 5CHFA 3TCAA 2IY0B 3DBLI 2ZPYA 1IYFA 2CHZA 4IC7B 1V5TA 3PV1A 2IO2B 5IAAC 2ASQA 4IUMB 1WXMA 3PREA 2M4NA 3A33B 3AXCA 4W9JA 4II3B 2CU1A 4DDID 2AWTA 1WY8A 4YL8A 2RGFA 4W9IA 2KKCA 1Q1OA 2EKEC 3B0AA 4AWJA 3VAWA 2L00B 1LXDA 1E7VA 3ZNID 4BKGA 2ZJDA 5JH5C 1ZKHA 1GC6A 3NZSA 4BKTA 3BINA 2NBVB 1K8RB 4J6IA 4NAWA 3WALA 3QX1A 4ZRIA 1WX9A 4EZKA 1GG3A 2LRUA 2DZJA 2I1KA 3PTFC 4IG7B 2LUEA 3N30A 3H1UA 4FHJA 2JY6A 5C1ZA 4GDKB 4K1RB 3ZDTA 4BKSD 3RYTA 4NQLB 4LJPB 2MX2A 4HK2A 1L7YA 2K1FA 2MP2B 3ZIMA 2XEWA 3H7PA 2L8JA 3PZDA 4ZRJA 4EZJA 1C3TA 3Q3FA 1G6JA 3PRZA 4EFOA 4FJZA 4I6PA 2J0MA 4ANXA 4EKUA 5J2RA 5EDSA 2KNBA 1MG8A 5JHAA 1WJ6A 1KOTA 2DZIA 4NNJB 1TZ1A 3CSTA 1PQSA 2A5UA 2C5LC 2V4LA 2GBRA 1TGZB 3IHPC 2JT4B 2GBKA 3QWZB 4MGYE 4WAAA 4ANUA 2N4FA 2K8BA 5L83A 3EHVA 3M3JA 2A4ZA 2R2OA 1C1YB 3RZWC 1EF5A 2KTFA 3DVGY 2KQSA 3W1SA 4CHKA 3APFA 2IO1B 1Y8RC 5CX3A 5KHQA 1LM8B 3PGEA 3A4RA 3SHQA 5TR5A 4MGKE 4M8NA 2RSUA 1NI2A 1R4MI 2HE7A 3SU8X 5AEKB 5DPSA 2FUHB 2M1MA 2ZZPB 4A3PA 4BKSA 1I42A 2BPSA 4DDGD 1WJ4A 4LJOB 4XX5A 3TBLD 2DAFA 4HWIB 2G45B 1YJ1A 2LZ6A 3ML8A 3JSVA 3MHSD 4W9GA 3T9LA 2K6DB 3U30A 3WAPA 2BKRB 2ZEQA 3QA8A 3LDZE 2IBIB 2UWQA 3ZLZA 2L3ZA 2KFKB 4HPMB 2IZVB 2KHWB 2PE9A 1P98A 3CF6E 4W9KA 3A1QB 4DK5A 4ANWA 3KVFB 5AZHA 1E8ZA 3ZKJC 2KWVB 2OJRA 3DPDA 2MW5A 3ONSA 3PHXB 2N9EB 3A9KB 3TJPA 4JL9A 3UQBA 4RM8A 2PPHA 3EECA 3KYDD 1WM3A 3V6CB 4GMVA 5DPTA 1Z5SB 1V6EA 2LVOA 2G4SA 2ZPNA 2KFJA 2K6QA 4FBJB 4KZCA 1FXTB 1XD3B 4KZ0A 3PRPB 4E71A 1ISNA 4KDIC 4PS8A 3B08A 4JGHB 2KN5A 1WE7A 3DQVA 3JW0X 1YQBA 3NHEB 4E3CA 1P9DU 3DBSA 1UZXB 3HM3A 2YLMA 1KLVA 1IP9A 1CMXB 2KVRA 4HJKA 4IWQA 2RR9A 1RRBA 2CHWA 2DX5B 1UBQA 2JWZA 3HK0A 2Z0EB 3HHMA 4IWOA 1P0RA 2BWES 4KSLC 4FULA 4GDKA 2LJ5A 3O65B 2NBUA 3PT2B 2MQJA 2MBOA 3V61A 2G4DB 1UD7A 1ZGUB 3DVNU 1WIAA 3WAMA 4AOFA 3VTVA 5L95C 1VCBA 2MBBB 5BO4B 3N3KB 3DOWA 3N32A 2K8HA 4NQKE 3VFKA 5DPRA 2KJRA 2MP2A 4G0NB 3L17A 2BYVE 4DHJB 2JXXA 3RCZA 3A9JB 2D11A 3ZNZB 2KX3A 2KD0A 3L08A 4MM3A 3TL5A 2L0TA 2PJHA 2HJ8A 3P2BA 4IM3A 5D7GA 3QCAA 3SD5A 4F8CB 1H4RA 2KLGA 5KHOA 1F9JA 2GBMA 1P1AA 3EC8A 1TTNA 4HDQA 4XC2A 4N9F4 1J0GA 1E8WA 2N9PC 4NJ6A 2RPQA 3RD2A 3VUXA 2MCNB 1E5WA 2NPTB 1YIWA 2FCSA 1WM2A 2LXCA 2D10A 4LDTB 3SDLC 4K7WA 1KM7A 5LXIB 4A20A 2MSED 3TIXA 2J0JA 4W9LA 1UGMA 2C7MB 2MA9B 2DHZA 3QAQA 4FJVB 4BFRA 3OJ4B 4EOYA 1WZ3A 2KO3A 2D3GA 4W9FA 2FCQA 3V6EB 1V86A 4BBNC 3DVNV 4GSWA 4B6WA 1U4AA 2MRPA 1EUVB 2BF8B 1UELA 2KDBA 2O6VA 3ML9A 5FR6A 1WRDB 3EFUA 4F7ZA 5JHBA 4PYUA 3L16A 3ZRCA 4WWNA 2NR2A 2NS5A 2DAJA 2KDFB 3KUDB 4CYEA 3IVFA 2DZMA 3OJ3A 2KMCA 2K25A 1WJNA 3RT3B 2HTHA 2IY1B 1GUAB 2KFKA 2NBWB 3UINB 2Z59B 1WFYA 4HXDA 2YVCA 4ICVA 3JVZX 1WGYA 2M17A 4GOCA 3A1QA 1D3ZA 1SE9A 3QHTA 4TQ0A 2DYBA 2O2VB 2ZVOA 2L0FA 4MEMA 2FNJB 2KMAA 3IBEA 3M63B 4FHKA 3VVWB 1X1MA 1WF9A 3ZNGC 4MGIE 3A9KA 4WJQA 1GC7A 3PVLA 2KWCA 2XK5B 1LQBA 3ENEA 4PS3A 3HM6X 1WMHB 1S1QB 4TKNA 2J7QB 2OOBB 2GBNA 2KX0A 2JZ3B 3UIPB 2BWFA 3PLVA 4URKA 2LGYA 4KDLB 2O6VB 1UH6A 4ANVA 1V81A 5J18A 2EMTA 4X57B 4BBNF 4MGZE 3UIOB 3ALBA 2LVQA 2KC1A 4K7SA 4TV3A 2M8SA 4WWOA 4ZYNA 2JZZA 1GJZA 3DBRI 4NJ7A 5D94A 3ZTDA 2KJHB 2ZNVB 1LFDA 2KZRA 3JYUA 4WJPA 4AJWA 5C23A 1VD2A 4KIKB 2ZNVC 5LXHA 4WQOB 2LVPA 3R3MA 4GDLB 5E6PA 2UYZB 2W9NA 1V80A 3QJZA 1RLFA 3C0RB 4JQWC 3PLUA 3H9DA 4FJYA 4IM2A 5LLIA 3R7RA 2BYEA 4I6LB 1I35A 3GOEA 1A5RA 2LXAA 3DCGA 4JIOU 4LCDE 3WAOA 1L2NA 3APCA 4K7UA 1OEYA 3A9JA 4HVBA 1E8XA 2DYOA 1HE8A 2KK8A 3UF8A 4FLHA 4OVUA 2JPHA 2WX1A 4BVUC 3RUIB 4IWPA 2K8CA 3GZNI 3D32A 2FIFA 2LWPA 3T8MA 2IYDB 3L13A 4RMAA 3WA0A 1V5OA 3KW5B 4TQ1A 2KJ6A 2REXA 1WGRA 3H7SA 1KJTA 2MWSB 5DCNA 3ZW3A 3CMMB 2NPTA 2DZKA 2O6VD 3LJ3A 2ZCBA 4MJSB 1J8CA 1S3SG 1WGGA 3ZTCA 4I6NB 3QQ8B 4KSKC 1Z2MA 3MTNB 3OAWA 1WI0A 2DYMA 1XT9B 4OVVA 5E6OA 2BKFA 2WYQA 4GB9A 3AU5A 4AUQC 2WDTB 3VUYA 4HDOA 1NBFC 2KTRA 5D6JB 1WE6A 5CHWA 4W9HA 3L0WB 4MDKE 1RFAA 5AZGA 3WANA 4DHZE 1V49A 4IW0A 1IPGA 4WWPA 4DBGA 3DVGX 1R4NI 2V3SA 3APDA 2LRWA 3VXWA 2BGFA 3R66C 2CHXA 4CO7A 1AARA 3U8ZA 4AP4C 2FCMA 1V2YA 3VTUA 5HKHA 1YX5B 1WXAA 1E7UA 3KUCB 3VDZA 3S2AA 3V60A 1TBEA 1V9JA 3VTWA 2O2VA 3AU4A 4MH0E 3ZVVA 1WJUA 2DENB 1OQYA 2LI5A 3X23A 3ZRFA 2AL6A 2JUOA 3WIMA 3BY4B 2N7DA 2XK5A 2FIDA 1WXVA 1WMHA 2GBJA 4HPLB 1SIFA 4BOZB 3UQAA 2KTRB 2BYFA 2AYOB 2RD0A 4G11A 1M94A 3L10B 5AZFA 4HLEA 4M0WB 5G55A 2M0XA 3NZUA 2MBQA 2L05A 4WJOA 2QHOA 2NCNA 3AI5A 3M95A 3QARA 3NY5A 4FN2A 2JVCA 2Z0DB 1YX6B 3Q3JA 4GU2A 2FAZA 1YD8U 1EF1A 4II2B 3I3TB 2I1JA 4DWFA 3ZDMC 4G50A 4K81A 2MBHA 1WH3A 2N1WA 2V1YA 2L7RA 4RM9A 3CSFA 4EEWA 4FADA 1T0YA 2CKHB 1WX7A 4DHJD 4KIKA 1OEYJ 3PRMB 1H8CA 2PEAA 4NAWB 2J0KA 3KYCD 1WGDA 4ZRKA 2GMIC 4GDLA 1Q0WB 3VUWA 5JZEB 4KVGB 2C7NB 4PYZA 4AJYB 3X0WA 1OTRB 2GOWA 1XQQA 3AULA 2MBEA 3W1YA 2KC2A 3RZFA 3MJWA 2WX0A 4ZDVA 2JRIB 2CS4A 5J17A 2AL3A 4DXAB 4E74A 1BT0A 1WGHA 4DHZB 2B3AA 3VQIA 2R2QA 1NDDA 2WWZA 2HD5B 3QIJA 3VH3B 1E8YA 2D2QA 4W9DA 2LGDA 3H7PB 4LDTD 4GIVA 4A3OA 3IFWB 5CTRC 2JRHA 4TUUA 1WR1A 2D07B 3B1LX 3K9OB 4HCNB 1WZ0A 3HIZA 3PPAA 4W9CA 1WR6E 3V62A 3RULA 1SGHA 4ASWC 3R7QA 2MLBA 4B9KA 2NVUI 2KLCA 2CR5A 3KH0A 3H6NA 4EZLA 3L54A 1RAXA 4NPNA 4B95A
chains in the Genus database with same CATH superfamily
3IG3A 2QSDA 3QK0A 2KWDA 4JLCA 4GGQA 2PE6B 3Q8CA 3BVMA 1Q5WB 3VH4B 2K39A 1QZEA 5IO9A 3IXSA 3ZO5B 2LHEA 1FD6A 5G2NA 4GN1A 2KDMA 2WDVB 1J19A 2DBYA 3U4EG 2B76B 1JRUA 5G5HA 2BS2B 3N20C 4A9AA 3BVGA 1TKEA 4JX1C 3DBLB 3M62B 2DWQA 4P7IA 4B0MA 2AQ1B 1WYWB 3OLMD 2PVGC 4RGTA 3KUZA 2C9WB 2KDIA 4W9EA 4IM0A 3TCAA 4M0WA 3T3OA 2IO2B 4II3B 1V97A 2INNE 3VR8B 1WXQA 1RM6C 3VAWA 1FCCC 5G5GA 1E7VA 2V3PA 3ZNID 1ZKHA 1GC6A 3NZSA 4BKTA 1I4XA 3BINA 4NAWA 4J6IA 3QX1A 4YXDB 2QILA 3MFGA 4EE2A 3TSSA 1D5XC 2AQ2B 2JY6A 4K1RB 2WLBA 1QILA 1NYQA 4HK2A 2K1FA 2MP2B 3ZIMA 2XEWA 4ZRJA 3Q3FA 4KGSA 1G6JA 4FJZA 4I6PA 4MM3B 4ANXA 4EKUA 5EDSA 1FCLA 3W9CB 1QQRA 2KNBA 5H8YE 1KOTA 1WJ6A 3U2SC 3DHHC 3CSTA 2A5UA 2GBKA 2JT4B 3QWZB 5L83A 3RZWC 2KTFA 3DVGY 2KQSA 4CHKA 2IO1B 3SHQA 5TR5A 2M56B 3AEAB 2BPSA 1YJ1A 3WAPA 5IN7A 2K6DB 1TIFA 2L3ZA 1N6ZA 4W9KA 4DK5A 2JU6X 3ZXVA 2KWVB 1VZ6A 3ONSA 2MW5A 3BYTB 3Q8FA 1N62A 2WXRA 3TEZA 3UQBA 4RM8A 2PPHA 3EECA 2PIAA 1WM3A 5BYSA 3PZ7A 1Z5SB 3ZJVA 2K6QA 1FXTB 1XD3B 4KZ0A 3PRPB 3AEGB 3B08A 1YQBA 4KKJA 1N5WA 4L23A 2QCZA 3DBSA 1KLVA 4M00A 2KVRA 1UUPA 1TY0A 2WXLA 1P0RA 2BWES 2W54A 4FULA 3PT2B 2MQJA 4RH6A 1WIAA 2MBBB 3N3KB 4NQKE 2WHIA 4DHJB 1HEZE 5D3DA 2L0TA 5KHOA 1F2RI 1N5XA 3ZQ4A 4RNAA 3EC8A 1J0GA 4NJ6A 3DHGC 3VUXA 1RWSA 2D10A 3SDLC 2MSED 1UGMA 2DHZA 3QAQA 4BFRA 3V6EB 1V86A 3RNCC 4B6WA 1VR9A 3ML9A 1FPYA 5JHBA 3L16A 4XDCA 5LNK1 4CYEA 3OJ3A 2DZMA 1MVKA 2KMCA 1T0SC 4OZBA 2IY1B 2Z59B 1WFYA 3AE9B 4HXDA 3JVZX 1WGYA 4OHJA 1D3ZA 1SE9A 2DYBA 2FNJB 1X1MA 1WF9A 2M0AA 4ACFA 1GC7A 5D3IB 1LQBA 3HM6X 1WMHB 4TKNA 3BK1A 2JZ3B 4YTMB 3AV8A 4KDLB 4IOIE 1TS4A 1UH6A 3N9YC 1Y56A 5J18A 2EMTA 3CIRB 4YSXB 2X38A 3NG0A 4WWOA 1ET6A 2JZZA 5D94A 3ZTDA 1L5PA 1VZ7A 5E6PA 1EU4A 1UF0A 5FKAC 1CJEA 1VZ8A 2BYEA 1I35A 4US8A 1A5RA 2LXAA 4LCDE 3APCA 1JROA 2LJIA 1OEYA 3A9JA 1PFDA 4RGNA 1HTQA 4P6VF 3NZ3A 4OVUA 2JPHA 4YSYB 2KQ4X 1MFWA 4IWPA 4YTNB 3GZNI 2G1EA 1OQRA 2DNFA 3KW5B 3BIID 1WGRA 1NYRA 1N63A 5DCNA 3MHZA 3RNFC 2DZKA 2O6VD 3BYYB 1S3SG 1WGGA 1L0XB 4I6NB 3DWMA 2QC8A 2DYMA 1XT9B 4OVVA 5E6OA 2BKFA 1Q10A 1XLPA 4GB9A 4HROA 3VUYA 5AZGA 2PTLA 2WXJA 1VRAB 4IW0A 2MH7A 1XLQA 2LRWA 4LK0M 2CHXA 4CO7A 1AARA 2VH1A 2I38A 2ON8A 1V2YA 3VDZA 1E7UA 4XE0A 3NVYA 2O2VA 4MH0E 3ZVVA 2AL6A 3WIMA 2XK5A 2V3NA 3UQAA 2AYOB 1V8CA 2QHOA 1FO4A 1C9FA 2JX5A 2JXTA 2RMMA 3M95A 4QAYA 2NTSA 1XLNA 1XF5L 1YD8U 1EF1A 3I3TB 2I1JA 4REZA 4K81A 2MBHA 2L7RA 2WDQB 1OEYJ 2YEPB 1IBXA 2PEAA 3KYCD 4A55A 3GE8C 2GMIC 1Q0WB 3VUWA 4AJYB 3AE7B 3FKYA 2MBEA 3RZFA 2WX0A 4M02A 1JQ4A 2D3BA 3R2IA 2Y3AA 3P4RB 3H8HA 4DHZB 2OJWA 2B3AA 2CU3A 2R2QA 3VH3B 1PGXA 4W9DA 5C3JB 3GS2A 5EE3A 4A3OA 3IFWB 2ICIA 1WZ0A 4ASWC 2WQYB 2NVUI 3AB5A 3H6NA 2OHFA 3UGBB 4MJSA 3KWLA 4MELA 1D5MC 3I9V1 4ZOHC 2D3AA 1I7HA 2AEHA 2C60A 2ZCCA 3QC8B 1MG4A 3Q3NC 3HVZA 4G3XB 3TMPB 3SFEB 1GNUA 1HZ6A 1BMLC 2IO0B 1IGDA 2KDEB 5CHVC 1YNTE 1QOGA 2KOXA 3A4SC 3ZNHB 3JSVB 1HXYD 4ARIA 1E7PB 2ZW1A 2V0GA 1ACCA 5DPWA 1UBIA 4M8MA 4WJNA 4GXBA 4C4VB 5BMIA 2GRIA 4HCPB 3I5JC 2IY0B 3DBLI 1PYWD 4LNOA 2CHZA 1GOZA 2V4IB 4IC7B 2JZPA 1F1HA 3B2GA 5IAAC 4IUMB 1WXMA 3PREA 2M4NA 1UNSA 2R61A 2AWTA 4DDID 2RGFA 2Y5CA 1PGBA 1Q1OA 2EKEC 3B0AA 1FFVA 1TS2A 4HJGE 4XGAB 2ZJDA 4BKGA 4MACA 1K8RB 3NVVA 2K5PA 3ETRA 4ZRIA 4EZKA 2LRUA 1MJDA 1P7EA 1V1PB 3H1UA 4DXFA 3MJ5A 1P7FA 3RYTA 4ZHPA 4LJPB 1ZXIA 1QKZA 2M19A 2LGSA 4HRSA 3H7PA 1PUTA 4EZJA 3RPFC 3PRZA 2J42A 5J2RA 3AM9A 5JHAA 1DOYA 2C5LC 2V4LA 5JXVA 1R4MB 4N58A 4MGYE 2VZKD 5C2TB 2K8BA 3V3XA 2MJ3A 1OFFA 2BS4B 3APFA 3I63C 1Y8RC 5CX3A 3PGEA 1JWBD 2INCC 4C7YA 2RSUA 1NI2A 2HE7A 5HFYA 4C80A 2FUHB 2ZZPB 1ZPSA 4A3PA 1I42A 4DDGD 3TBLD 4HWIB 2G45B 2LZ6A 1K50A 4W9GA 3T9LA 3MHSD 2N9LA 3LDZE 2IBIB 1FEHA 2KFKB 1KF6B 2IZVB 2PE9A 2BTEA 1P98A 4HKQA 3KVFB 1E8ZA 2E3TA 3ZYYX 2PVOD 3DPDA 3PHXB 3A9KB 3W5UB 3TJPA 2AQ3B 1B9RA 5H92C 3GP7A 3KYDD 3B9JA 2J52A 2G4SA 2LVOA 3FC4A 2KFJA 3V05A 2LGIA 4FBJB 4HPPA 1WSPA 3RN9C 1ISNA 4KDIC 1XXGA 4JGHB 2KN5A 1GB4A 1I4HA 3ZJUA 3DQVA 1P9DU 2BT6A 3HM3A 1N61A 1CMXB 2K0PA 3PO0A 4IWQA 4WH4A 2CHWA 3AE1B 2IGHA 1T0RC 2JWZA 3HK0A 1SJHD 1LGRA 4GDKA 3O65B 2MEKA 1ZDXA 2WU2B 3U7ZA 1ZGUB 3DVNU 3WAMA 4N6EB 2KJRA 3L17A 2JXXA 3AMZA 1FNVA 2IJ0A 3ZNZB 4XWWA 2KD0A 3L08A 4IM3A 2HJ8A 5D7GA 4F8CB 2KLGA 2GBMA 1JWMD 4HDQA 1TTNA 3FAHA 3UI3A 1E8WA 1KLGD 1R7SA 1E5WA 2FCSA 1WM2A 3SR6A 1DOXA 3GE3C 4FJVB 1UWMA 4W9FA 2KO3A 2D3GA 2WXNA 2FCQA 4TMAB 4BBNC 4GSWA 2KACA 2MRPA 1EUVB 1VDVA 1WRDB 3EFUA 2K22A 2PMVA 1JWSD 3FILA 1AW7A 2NR2A 1T0QC 3O13A 2NS5A 4OVZA 1L6VA 1GUAB 4S17A 3UINB 1FNWA 4GOCA 3A1QA 2KMAA 3IBEA 3VVWB 3DBRB 1S1QB 3E56A 2KX0A 2VH2A 3ZXRA 2X8XX 3EA6A 1NENB 4BBNF 1ESFA 1N60A 1EWCA 3ALBA 4RF0A 4C7ZA 2KC1A 4ZYNA 4LNKA 3WCQA 4NJ7A 1XCQL 2ZNVB 2KZRA 5C23A 1VD2A 2QDFA 2ACZB 4KIKB 4GDLB 2UYZB 1V80A 3EFCA 1TZOA 3PLUA 3Q6BA 4IM2A 5LLIA 1SIJA 3GOEA 4K7UA 4HVBA 1HE8A 1F52A 5IKCM 3AECB 2KK8A 3UF8A 2WX1A 2BVCA 4RMAA 1V5OA 3H7SA 4JWUC 2NPTA 1HZ5A 2ZCBA 1R4NB 1J8CA 1HQRD 2OEDA 1DYQA 3AN1A 1WI0A 2CJNA 2WDTB 4HDOA 1XLOA 4ZRQA 1WE6A 5CHWA 3L0WB 3WANA 1V49A 1IPGA 1SSNA 3NRZA 2VZKB 3NUHB 1TS5A 2BB5A 2BGFA 5HKHA 3VTUA 1BUIC 4DXGA 3S2AA 3V60A 4D2KA 1TBEA 3VTWA 1OQYA 3X23A 1L0VB 1JW9D 3BY4B 2FIDA 2GBJA 2W82A 1AYFA 2KTRB 2RD0A 3KLSX 4HLEA 1YJJA 4M0WB 2M0XA 2L05A 3AI5A 3QARA 3NY5A 3RNBC 1SE3A 3N1XC 4RM9A 1TKGA 1WX7A 1YJIA 1H8CA 4NAWB 2J0KA 1GAQB 1WGDA 4ZRKA 2C7NB 3TEWA 4M01A 1OTRB 3AULA 3W1YA 4N59A 3MJWA 2KT7A 5J17A 4DXAB 3OG5A 1I4QA 1BT0A 1WGHA 3VQIA 3Q8AA 2L1AA 2Z8LA 4LDTD 1VLBA 2Y5PA 2Q5WD 1FRRA 2D07B 4HCNB 5BYRA 1WR6E 5I4DA 3RULA 3R7QA 4B9KA 2CR5A 1KH0A 2L83A 4NPNA 4B95A 2KXJA 2YEPF 3VHTC 4XDDA 1MHXA 2KANA 4FA6A 4PS7A 2GB1A 1ZW7A 1SBBB 5TSSA 3E9SA 1E9MA 4BOSC 3W1SC 2UU7A 3NS8A 5BMHA 4KGRA 2C7HA 1F77A 1P3QU 3AE6B 2KVZA 3KWVA 3DBHI 2LD9A 1NEKB 2KQ7A 2N7EA 2FBWB 3N1YC 2Y5BB 4WIPA 5GMVA 2BS3B 2LGXA 3Q8EA 3L4PA 5D2MB 1L4ZB 3P4QB 3DDCB 2FCNA 3PV1A 4JWSC 3CWIA 3P4SB 2ASQA 4YT0B 2E6XA 3A33B 4W9JA 1ZDVA 2CU1A 1WY8A 4W9IA 2KKCA 1YQ3B 4AWJA 1MHHE 1LXDA 1JWAD 2WGSA 1JALA 5JH5C 3WALA 4RF1A 1WX9A 5EE9A 1GG3A 4RFBA 2DZJA 1XEEA 2I1KA 2WS3B 1D4BA 3PTFC 2W3RA 2H89B 4IG7B 1SE4A 4LTUA 4P16A 4FHJA 2L52A 2BW2A 2LHDA 1YN5A 2WP9B 2L8JA 3PZDA 1C3TA 2HDEA 5IP4D 3SFDB 1XCTL 3GB1A 3VRAB 1MG8A 5BMGA 1TZ1A 2SAKA 1D5ZC 1PQSA 2GBRA 1TGZB 1E6EB 1VJKA 3EHVA 2QMTA 1J7CA 3DHIC 1YN3A 4FXCA 5KHQA 1LM8B 5BYQA 3A4RA 4MGKE 2EELA 2MJEA 4M8NA 2KYWA 4L2YA 1R4MI 3RNEC 3SU8X 1KTKA 1HA5A 1OQQA 1WJ4A 4LJOB 3W5VB 4NZLB 4XX5A 3ML8A 3U30A 2LEKA 2BKRB 3QA8A 2G9HD 3R8BA 3ZLZA 3Q3OC 3CF6E 5AZHA 3IAS1 2NMQA 3ZKJC 3Q3MC 2N0SB 3Q2AC 2N9EB 3BK2A 4JL9A 1TJEA 4GMVA 5DPTA 2RDHA 1V6EA 3C8YA 3AE8B 4ZHOA 1SEBD 4E71A 1WE7A 1IUEA 3JW0X 1TT5B 4E3CA 3AE2B 5HG2A 5HI1A 2YLMA 2RR9A 1RRBA 1MI0A 2D5GA 4IWOA 4KSLC 2Z0EB 2JWUA 4K3CA 2LJ5A 2NTTA 2NBUA 3V61A 2G4DB 5L95C 4AOFA 5EE0A 1VCBA 3AE4B 5BO4B 3DOWA 3VFKA 5DPRA 2MP2A 4G0NB 2BYVE 3A9JB 3OWEB 2D11A 4MM3A 4GLSC 1QOAA 1H4RA 1F9JA 4XC2A 1FIQA 4N9F4 2N9PC 1TY2A 3RNGC 1BXTA 3R2TA 5IOIA 1L6UA 2ONQA 4LDTB 1EM7A 1YOVB 1SXTA 2J0JA 2C7MB 1QF6A 2WXPA 3OJ4B 3AEFB 4EOYA 3DVNV 5FR6A 4F7ZA 1CZPA 4PYUA 4WWNA 5E6JA 2DAJA 1ZE3D 2KDFB 3IVFA 3RT3B 2NBWB 2YVCA 2ZW0A 2N9KA 4HKZE 3QHTA 2QEJC 4TQ0A 2O2VB 1FMAD 4IDIA 3M63B 3ZNGC 1WRIA 4MGIE 4WJQA 3PVLA 2XK5B 4PS3A 2J7QB 3UIPB 2BWFA 4URKA 1CK1A 2O6VB 3TEYA 1NI3A 4ANVA 4KGTA 4MGZE 3UIOB 3AE5B 2INDC 4TV3A 2M8SA 4YWGG 1YMHE 3DBRI 1J7AA 3JYUA 2ZNVC 1IBXB 2LVPA 3C19A 1WYGA 3R3MA 2W9NA 1JRPA 3QJZA 3C0RB 4JQWC 3H9DA 2H88B 3R7RA 2RPVA 3DWGC 3DCGA 4JIOU 1L0YB 2WDRB 1C76A 2DYOA 4C00A 4FLHA 4BVUC 2K8CA 3D32A 2FIFA 3T8MA 3WA0A 4TQ1A 2KJ6A 2REXA 4K3BA 1KJTA 2LUMA 2MWSB 2KMMA 3CMMB 3LJ3A 1RFKA 4MJSB 3ZTCA 3QQ8B 4KSKC 1Z2MA 3MTNB 1ZUD2 3OAWA 4LNIA 2WYQA 3P42A 3AU5A 4AUQC 5FR3A 2KTRA 1RFAA 4DHZE 4DBGA 2W55A 3MC9A 1R4NI 3B2FA 3VXWA 2DLBA 5HHDG 1ET9A 4NAMA 3RI7C 1SB3C 1D6EC 3KUCB 1C77A 1V9JA 1QLBB 1FXIA 3AU4A 1FRDA 1MPEA 1WJUA 2LI5A 3ZRFA 2N7DA 1WXVA 1WMHA 4HPLB 1SIFA 4BOZB 4G11A 3VRBB 3L10B 2MBQA 4FN2A 2WXMA 2Z0DB 1YX6B 3Q3JA 4GU2A 4DWFA 4OW0A 3ZDMC 4G50A 1WH3A 1SJED 2N1WA 2V1YA 4EEWA 2QJLA 4FADA 3KQ4A 3NVWA 4KVGB 3X0WA 1XQQA 3TUOA 2RDGA 1C4PA 4XWTA 2KN4A 4O1NA 4UDUC 3MC0B 2HD5B 3BWUD 1I4RA 1E8YA 4PT5A 1JCKB 2LGDA 3H7PB 2IDYA 5CTRC 3B1LX 4BZAA 3K9OB 3HIZA 1SGHA 1CQVA 4EZLA 3KH0A 4P1BC 3EGRA 4MSMB 1TS3A 1V1OA 3MC8A 5IA7A 1JWUD 3K9PB 1SF0A 2IO3B 4F1SA 4KV2A 4EUTA 4HEA1 4ICUA 3NOBA 4MSQB 2EMSA 1AWDA 1FNUA 1M4VA 1E90A 3PHWB 2D3CA 1QOBA 1K52A 2N9XA 2VRRB 5E6NA 2G3QB 1EO6A 2ZVNA 3RFZB 3P4PB 2KWUB 1OGWA 3U7DA 2JQRB 1WX8A 4XZ4A 3HRDD 2I2YA 2LASA 3ECIA 1IGCA 2XBBC 3PSEB 2L76A 4LNNA 3ZUNA 1UGJA 1FFUA 3LXFA 2N1VA 1EWYC 4AS1A 1WXSA 2JF5A 3PS6A 4NY0A 5CHFA 5EE1A 2ZPYA 1IYFA 3IT6B 3URYA 1PDXA 1V5TA 2QIEB 1JMLA 1GB1A 3AXCA 1F2RC 4YL8A 4DQOC 1E10A 2L00B 1GPXA 2NBVB 1QT9A 1AN8A 3P63A 2WXGA 2LUEA 3N30A 2N7JA 2SEBD 4GDKB 5C1ZA 4LLGM 3ZDTA 4BKSD 2INPE 2K3UA 4NQLB 2MX2A 2JYEA 1L7YA 1I4PA 1I4GA 4EFOA 2J0MA 1QOFA 3SEBA 2DZIA 4NNJB 1C78A 1L4DB 3IHPC 1KLUD 3P1MA 4WAAA 4ANUA 2N4FA 3M3JA 2A4ZA 2R2OA 1C1YB 1EF5A 2J4XA 3W1SA 3NS1A 1C79A 3RMKC 3AEEB 2PW9A 3Q14C 3N1ZC 1C4CA 4R3DA 5AEKB 4JE3B 5DPSA 2M1MA 4BKSA 3HVDA 4ITKA 3FILB 1YQ4B 2DAFA 3JSVA 4ZYSA 1E0ZA 2ZEQA 3AEBB 2FE8A 2UWQA 1TKYA 4HPMB 2KHWB 3A1QB 4C4VA 2HTME 5AUIA 4ANWA 2RDBC 2OJRA 3W2DA 1B1ZA 3ZJTA 1T5XD 3LB8C 3V6CB 2WU5B 3IT4B 1C4AA 2ZPNA 4LNFA 4KZCA 4PS8A 2JSVX 4KX6B 3NHEB 1UZXB 1IP9A 1WGKA 4HJKA 1K51A 3ABVB 2DX5B 4A8XC 1UBQA 1V1PA 3HHMA 3I57A 2IGDA 2MBOA 1UD7A 5GXGB 3VTVA 1T3QA 1KRHA 2GLSA 3N32A 2K8HA 3RCZA 2KX3A 3TL5A 2PJHA 3P2BA 5FK9C 3QCAA 3SD5A 4OZCA 1WWTA 1LO5D 4OZAA 1P1AA 4YTPB 4RGMA 2MJDA 4CQNA 2RPQA 4Q2JA 3RD2A 2MCNB 1YN4A 2NPTB 1SE2A 1YIWA 2LXCA 2HJ1A 4K7WA 3BZDB 1KM7A 5LXIB 4A20A 3TIXA 4W9LA 1PGAA 4B0EA 2MA9B 1WZ3A 2LFIA 2PLPA 1U4AA 3BVZA 2BF8B 1UELA 2KDBA 2O6VA 2BYTA 2WXFA 1F0ZA 3T3NA 2WXOA 3AEDB 3ZRCA 2TSSA 2CJOA 3KUDB 2W3SA 4YSZB 3PZ8A 2K25A 1WJNA 2HTHA 2KFKA 4ICVA 2M17A 2IGGA 3Q8BA 2ZVOA 2L0FA 4L1BA 4MEMA 4FHKA 3A9KA 2KWCA 3ENEA 2OOBB 2GBNA 5AUKA 3PLVA 2LGYA 1V81A 1FXAA 4BAXA 4MH8A 1T6BX 4X57B 4RGOS 1HTOA 2LVQA 4TSSA 4K7SA 1GJZA 4JPSA 1K53A 2XNAC 2KJHB 4C56C 1LFDA 4AJWA 4WJPA 1J7BA 2PKOA 5LXHA 4J3OD 4WQOB 1A70A 2WXHA 1ROEA 1RLFA 2EKIA 4KKIA 3GZNB 4FJYA 4I6LB 2FUG1 3ZGZA 2WXIA 3EUB2 3TEXA 4XYCA 3DBHB 3WAOA 1L2NA 2KAJA 2L32A 1E8XA 4MT5A 1EU3A 1XO3A 3J9CA 4NJCA 3RUIB 3U52E 2WXKA 4WAFA 2LWPA 4A90A 2IYDB 3L13A 2GI9A 2WXQA 2XN9C 3ZW3A 2BB6A 2AX5A 4US9A 5MPOA 1TYGB 4H2AA 3AH7A 1NBFC 2V9HA 5D6JB 1KFYB 3Q69A 4W9HA 4MDKE 4WWPA 3DVGX 1DGJA 2MHJA 2V3SA 3APDA 4S0RA 4PK1A 4RCOA 1FM0D 3R66C 3LYYA 3NVZA 3U8ZA 4AP4C 2FCMA 1YX5B 1WXAA 4WQMA 2IPKD 2DENB 2JUOA 4AQ7A 4A6QA 1ENFA 2BQQA 3MP9A 2BYFA 1M94A 5AZFA 5G55A 3NZUA 4WJOA 2NCNA 2JYTA 4WURA 1DOIA 2JVCA 3NJTA 2FAZA 4II2B 2WNMA 1UWXA 4WWMA 2BBCA 1NVID 3CSFA 1T0YA 2CKHB 3IAM1 4DHJD 4KIKA 3PRMB 4P1CC 2K9XA 2LMCA 4GDLA 5JZEB 4PYZA 2GOWA 3HUIA 1ZXHA 2J53A 3RNAC 2KC2A 1RYJA 4ZDVA 2JRIB 2CS4A 2AL3A 5T8IA 3AE3B 4E74A 1ZP0B 1STEA 1NDDA 2WWZA 3QIJA 2D2QA 4IKGA 4GIVA 4ARCA 2JRHA 3VR9B 4TUUA 1WR1A 4ZRPA 4USAA 3PPAA 4W9CA 3V62A 1ZOYB 2MLBA 2KLCA 3L54A 1RAXA
chains in the Genus database with same CATH topology
3IG3A 4MSMB 3UGBB 3QK0A 2KXJA 4MJSA 3VHTC 4MELA 2KANA 5IA7A 4FA6A 4PS7A 4JLCA 4GGQA 2PE6B 1Q5WB 3K9PB 2IO3B 1ZW7A 2AEHA 3VH4B 2C60A 2K39A 4KV2A 4EUTA 2ZCCA 3QC8B 4F1SA 1QZEA 4ICUA 3NOBA 3ZO5B 4BOSC 4MSQB 2EMSA 4G3XB 3W1SC 3TMPB 3NS8A 5G2NA 4GN1A 2C7HA 1E90A 3PHWB 1GNUA 2VRRB 2N9XA 2IO0B 1J19A 1P3QU 2KDEB 1JRUA 5CHVC 5E6NA 2G3QB 2KOXA 1EO6A 3DBHI 2LD9A 2KQ7A 2N7EA 2ZVNA 3A4SC 2KWUB 3ZNHB 2Y5BB 3M62B 3JSVB 1OGWA 4P7IA 3U7DA 1WX8A 4XZ4A 1WYWB 5GMVA 2LGXA 3OLMD 2LASA 5DPWA 1UBIA 3ECIA 4M8MA 5D2MB 2XBBC 3PSEB 2L76A 3ZUNA 4WJNA 4GXBA 2N1VA 3KUZA 2C9WB 3DDCB 1WXSA 2FCNA 2JF5A 3PS6A 4NY0A 2KDIA 4HCPB 4W9EA 4IM0A 5CHFA 3TCAA 2IY0B 3DBLI 2ZPYA 1IYFA 2CHZA 4IC7B 1V5TA 3PV1A 2IO2B 5IAAC 2ASQA 4IUMB 1WXMA 3PREA 2M4NA 3A33B 3AXCA 4W9JA 4II3B 2CU1A 4DDID 2AWTA 1WY8A 4YL8A 2RGFA 4W9IA 2KKCA 1Q1OA 2EKEC 3B0AA 4AWJA 3VAWA 2L00B 1LXDA 1E7VA 3ZNID 4BKGA 2ZJDA 5JH5C 1ZKHA 1GC6A 3NZSA 4BKTA 3BINA 2NBVB 1K8RB 4J6IA 4NAWA 3WALA 3QX1A 4ZRIA 1WX9A 4EZKA 1GG3A 2LRUA 2DZJA 2I1KA 3PTFC 4IG7B 2LUEA 3N30A 3H1UA 4FHJA 2JY6A 5C1ZA 4GDKB 4K1RB 3ZDTA 4BKSD 3RYTA 4NQLB 4LJPB 2MX2A 4HK2A 1L7YA 2K1FA 2MP2B 3ZIMA 2XEWA 3H7PA 2L8JA 3PZDA 4ZRJA 4EZJA 1C3TA 3Q3FA 1G6JA 3PRZA 4EFOA 4FJZA 4I6PA 2J0MA 4ANXA 4EKUA 5J2RA 5EDSA 2KNBA 1MG8A 5JHAA 1WJ6A 1KOTA 2DZIA 4NNJB 1TZ1A 3CSTA 1PQSA 2A5UA 2C5LC 2V4LA 2GBRA 1TGZB 3IHPC 2JT4B 2GBKA 3QWZB 4MGYE 4WAAA 4ANUA 2N4FA 2K8BA 5L83A 3EHVA 3M3JA 2A4ZA 2R2OA 1C1YB 3RZWC 1EF5A 2KTFA 3DVGY 2KQSA 3W1SA 4CHKA 3APFA 2IO1B 1Y8RC 5CX3A 5KHQA 1LM8B 3PGEA 3A4RA 3SHQA 5TR5A 4MGKE 4M8NA 2RSUA 1NI2A 1R4MI 2HE7A 3SU8X 5AEKB 5DPSA 2FUHB 2M1MA 2ZZPB 4A3PA 4BKSA 1I42A 2BPSA 4DDGD 1WJ4A 4LJOB 4XX5A 3TBLD 2DAFA 4HWIB 2G45B 1YJ1A 2LZ6A 3ML8A 3JSVA 3MHSD 4W9GA 3T9LA 2K6DB 3U30A 3WAPA 2BKRB 2ZEQA 3QA8A 3LDZE 2IBIB 2UWQA 3ZLZA 2L3ZA 2KFKB 4HPMB 2IZVB 2KHWB 2PE9A 1P98A 3CF6E 4W9KA 3A1QB 4DK5A 4ANWA 3KVFB 5AZHA 1E8ZA 3ZKJC 2KWVB 2OJRA 3DPDA 2MW5A 3ONSA 3PHXB 2N9EB 3A9KB 3TJPA 4JL9A 3UQBA 4RM8A 2PPHA 3EECA 3KYDD 1WM3A 3V6CB 4GMVA 5DPTA 1Z5SB 1V6EA 2LVOA 2G4SA 2ZPNA 2KFJA 2K6QA 4FBJB 4KZCA 1FXTB 1XD3B 4KZ0A 3PRPB 4E71A 1ISNA 4KDIC 4PS8A 3B08A 4JGHB 2KN5A 1WE7A 3DQVA 3JW0X 1YQBA 3NHEB 4E3CA 1P9DU 3DBSA 1UZXB 3HM3A 2YLMA 1KLVA 1IP9A 1CMXB 2KVRA 4HJKA 4IWQA 2RR9A 1RRBA 2CHWA 2DX5B 1UBQA 2JWZA 3HK0A 2Z0EB 3HHMA 4IWOA 1P0RA 2BWES 4KSLC 4FULA 4GDKA 2LJ5A 3O65B 2NBUA 3PT2B 2MQJA 2MBOA 3V61A 2G4DB 1UD7A 1ZGUB 3DVNU 1WIAA 3WAMA 4AOFA 3VTVA 5L95C 1VCBA 2MBBB 5BO4B 3N3KB 3DOWA 3N32A 2K8HA 4NQKE 3VFKA 5DPRA 2KJRA 2MP2A 4G0NB 3L17A 2BYVE 4DHJB 2JXXA 3RCZA 3A9JB 2D11A 3ZNZB 2KX3A 2KD0A 3L08A 4MM3A 3TL5A 2L0TA 2PJHA 2HJ8A 3P2BA 4IM3A 5D7GA 3QCAA 3SD5A 4F8CB 1H4RA 2KLGA 5KHOA 1F9JA 2GBMA 1P1AA 3EC8A 1TTNA 4HDQA 4XC2A 4N9F4 1J0GA 1E8WA 2N9PC 4NJ6A 2RPQA 3RD2A 3VUXA 2MCNB 1E5WA 2NPTB 1YIWA 2FCSA 1WM2A 2LXCA 2D10A 4LDTB 3SDLC 4K7WA 1KM7A 5LXIB 4A20A 2MSED 3TIXA 2J0JA 4W9LA 1UGMA 2C7MB 2MA9B 2DHZA 3QAQA 4FJVB 4BFRA 3OJ4B 4EOYA 1WZ3A 2KO3A 2D3GA 4W9FA 2FCQA 3V6EB 1V86A 4BBNC 3DVNV 4GSWA 4B6WA 1U4AA 2MRPA 1EUVB 2BF8B 1UELA 2KDBA 2O6VA 3ML9A 5FR6A 1WRDB 3EFUA 4F7ZA 5JHBA 4PYUA 3L16A 3ZRCA 4WWNA 2NR2A 2NS5A 2DAJA 2KDFB 3KUDB 4CYEA 3IVFA 2DZMA 3OJ3A 2KMCA 2K25A 1WJNA 3RT3B 2HTHA 2IY1B 1GUAB 2KFKA 2NBWB 3UINB 2Z59B 1WFYA 4HXDA 2YVCA 4ICVA 3JVZX 1WGYA 2M17A 4GOCA 3A1QA 1D3ZA 1SE9A 3QHTA 4TQ0A 2DYBA 2O2VB 2ZVOA 2L0FA 4MEMA 2FNJB 2KMAA 3IBEA 3M63B 4FHKA 3VVWB 1X1MA 1WF9A 3ZNGC 4MGIE 3A9KA 4WJQA 1GC7A 3PVLA 2KWCA 2XK5B 1LQBA 3ENEA 4PS3A 3HM6X 1WMHB 1S1QB 4TKNA 2J7QB 2OOBB 2GBNA 2KX0A 2JZ3B 3UIPB 2BWFA 3PLVA 4URKA 2LGYA 4KDLB 2O6VB 1UH6A 4ANVA 1V81A 5J18A 2EMTA 4X57B 4BBNF 4MGZE 3UIOB 3ALBA 2LVQA 2KC1A 4K7SA 4TV3A 2M8SA 4WWOA 4ZYNA 2JZZA 1GJZA 3DBRI 4NJ7A 5D94A 3ZTDA 2KJHB 2ZNVB 1LFDA 2KZRA 3JYUA 4WJPA 4AJWA 5C23A 1VD2A 4KIKB 2ZNVC 5LXHA 4WQOB 2LVPA 3R3MA 4GDLB 5E6PA 2UYZB 2W9NA 1V80A 3QJZA 1RLFA 3C0RB 4JQWC 3PLUA 3H9DA 4FJYA 4IM2A 5LLIA 3R7RA 2BYEA 4I6LB 1I35A 3GOEA 1A5RA 2LXAA 3DCGA 4JIOU 4LCDE 3WAOA 1L2NA 3APCA 4K7UA 1OEYA 3A9JA 4HVBA 1E8XA 2DYOA 1HE8A 2KK8A 3UF8A 4FLHA 4OVUA 2JPHA 2WX1A 4BVUC 3RUIB 4IWPA 2K8CA 3GZNI 3D32A 2FIFA 2LWPA 3T8MA 2IYDB 3L13A 4RMAA 3WA0A 1V5OA 3KW5B 4TQ1A 2KJ6A 2REXA 1WGRA 3H7SA 1KJTA 2MWSB 5DCNA 3ZW3A 3CMMB 2NPTA 2DZKA 2O6VD 3LJ3A 2ZCBA 4MJSB 1J8CA 1S3SG 1WGGA 3ZTCA 4I6NB 3QQ8B 4KSKC 1Z2MA 3MTNB 3OAWA 1WI0A 2DYMA 1XT9B 4OVVA 5E6OA 2BKFA 2WYQA 4GB9A 3AU5A 4AUQC 2WDTB 3VUYA 4HDOA 1NBFC 2KTRA 5D6JB 1WE6A 5CHWA 4W9HA 3L0WB 4MDKE 1RFAA 5AZGA 3WANA 4DHZE 1V49A 4IW0A 1IPGA 4WWPA 4DBGA 3DVGX 1R4NI 2V3SA 3APDA 2LRWA 3VXWA 2BGFA 3R66C 2CHXA 4CO7A 1AARA 3U8ZA 4AP4C 2FCMA 1V2YA 3VTUA 5HKHA 1YX5B 1WXAA 1E7UA 3KUCB 3VDZA 3S2AA 3V60A 1TBEA 1V9JA 3VTWA 2O2VA 3AU4A 4MH0E 3ZVVA 1WJUA 2DENB 1OQYA 2LI5A 3X23A 3ZRFA 2AL6A 2JUOA 3WIMA 3BY4B 2N7DA 2XK5A 2FIDA 1WXVA 1WMHA 2GBJA 4HPLB 1SIFA 4BOZB 3UQAA 2KTRB 2BYFA 2AYOB 2RD0A 4G11A 1M94A 3L10B 5AZFA 4HLEA 4M0WB 5G55A 2M0XA 3NZUA 2MBQA 2L05A 4WJOA 2QHOA 2NCNA 3AI5A 3M95A 3QARA 3NY5A 4FN2A 2JVCA 2Z0DB 1YX6B 3Q3JA 4GU2A 2FAZA 1YD8U 1EF1A 4II2B 3I3TB 2I1JA 4DWFA 3ZDMC 4G50A 4K81A 2MBHA 1WH3A 2N1WA 2V1YA 2L7RA 4RM9A 3CSFA 4EEWA 4FADA 1T0YA 2CKHB 1WX7A 4DHJD 4KIKA 1OEYJ 3PRMB 1H8CA 2PEAA 4NAWB 2J0KA 3KYCD 1WGDA 4ZRKA 2GMIC 4GDLA 1Q0WB 3VUWA 5JZEB 4KVGB 2C7NB 4PYZA 4AJYB 3X0WA 1OTRB 2GOWA 1XQQA 3AULA 2MBEA 3W1YA 2KC2A 3RZFA 3MJWA 2WX0A 4ZDVA 2JRIB 2CS4A 5J17A 2AL3A 4DXAB 4E74A 1BT0A 1WGHA 4DHZB 2B3AA 3VQIA 2R2QA 1NDDA 2WWZA 2HD5B 3QIJA 3VH3B 1E8YA 2D2QA 4W9DA 2LGDA 3H7PB 4LDTD 4GIVA 4A3OA 3IFWB 5CTRC 2JRHA 4TUUA 1WR1A 2D07B 3B1LX 3K9OB 4HCNB 1WZ0A 3HIZA 3PPAA 4W9CA 1WR6E 3V62A 3RULA 1SGHA 4ASWC 3R7QA 2MLBA 4B9KA 2NVUI 2KLCA 2CR5A 3KH0A 3H6NA 4EZLA 3L54A 1RAXA 4NPNA 4B95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IG3 A;  4MSM B;  3UGB B;  3QK0 A;  2KXJ A;  4MJS A;  3VHT C;  4MEL A;  2KAN A;  5IA7 A;  4FA6 A;  4PS7 A;  4JLC A;  4GGQ A;  2PE6 B;  1Q5W B;  3K9P B;  2IO3 B;  1ZW7 A;  2AEH A;  3VH4 B;  2C60 A;  2K39 A;  4KV2 A;  4EUT A;  2ZCC A;  3QC8 B;  4F1S A;  1QZE A;  4ICU A;  3NOB A;  3ZO5 B;  4BOS C;  4MSQ B;  2EMS A;  4G3X B;  3W1S C;  3TMP B;  3NS8 A;  5G2N A;  4GN1 A;  2C7H A;  1E90 A;  3PHW B;  1GNU A;  2VRR B;  2N9X A;  2IO0 B;  1J19 A;  1P3Q U;  2KDE B;  1JRU A;  5CHV C;  5E6N A;  2G3Q B;  2KOX A;  1EO6 A;  3DBH I;  2LD9 A;  2KQ7 A;  2N7E A;  2ZVN A;  3A4S C;  2KWU B;  3ZNH B;  2Y5B B;  3M62 B;  3JSV B;  1OGW A;  4P7I A;  3U7D A;  1WX8 A;  4XZ4 A;  1WYW B;  5GMV A;  2LGX A;  3OLM D;  2LAS A;  5DPW A;  1UBI A;  3ECI A;  4M8M A;  5D2M B;  2XBB C;  3PSE B;  2L76 A;  3ZUN A;  4WJN A;  4GXB A;  2N1V A;  3KUZ A;  2C9W B;  3DDC B;  1WXS A;  2FCN A;  2JF5 A;  3PS6 A;  4NY0 A;  2KDI A;  4HCP B;  4W9E A;  4IM0 A;  5CHF A;  3TCA A;  2IY0 B;  3DBL I;  2ZPY A;  1IYF A;  2CHZ A;  4IC7 B;  1V5T A;  3PV1 A;  2IO2 B;  5IAA C;  2ASQ A;  4IUM B;  1WXM A;  3PRE A;  2M4N A;  3A33 B;  3AXC A;  4W9J A;  4II3 B;  2CU1 A;  4DDI D;  2AWT A;  1WY8 A;  4YL8 A;  2RGF A;  4W9I A;  2KKC A;  1Q1O A;  2EKE C;  3B0A A;  4AWJ A;  3VAW A;  2L00 B;  1LXD A;  1E7V A;  3ZNI D;  4BKG A;  2ZJD A;  5JH5 C;  1ZKH A;  1GC6 A;  3NZS A;  4BKT A;  3BIN A;  2NBV B;  1K8R B;  4J6I A;  4NAW A;  3WAL A;  3QX1 A;  4ZRI A;  1WX9 A;  4EZK A;  1GG3 A;  2LRU A;  2DZJ A;  2I1K A;  3PTF C;  4IG7 B;  2LUE A;  3N30 A;  3H1U A;  4FHJ A;  2JY6 A;  5C1Z A;  4GDK B;  4K1R B;  3ZDT A;  4BKS D;  3RYT A;  4NQL B;  4LJP B;  2MX2 A;  4HK2 A;  1L7Y A;  2K1F A;  2MP2 B;  3ZIM A;  2XEW A;  3H7P A;  2L8J A;  3PZD A;  4ZRJ A;  4EZJ A;  1C3T A;  3Q3F A;  1G6J A;  3PRZ A;  4EFO A;  4FJZ A;  4I6P A;  2J0M A;  4ANX A;  4EKU A;  5J2R A;  5EDS A;  2KNB A;  1MG8 A;  5JHA A;  1WJ6 A;  1KOT A;  2DZI A;  4NNJ B;  1TZ1 A;  3CST A;  1PQS A;  2A5U A;  2C5L C;  2V4L A;  2GBR A;  1TGZ B;  3IHP C;  2JT4 B;  2GBK A;  3QWZ B;  4MGY E;  4WAA A;  4ANU A;  2N4F A;  2K8B A;  5L83 A;  3EHV A;  3M3J A;  2A4Z A;  2R2O A;  1C1Y B;  3RZW C;  1EF5 A;  2KTF A;  3DVG Y;  2KQS A;  3W1S A;  4CHK A;  3APF A;  2IO1 B;  1Y8R C;  5CX3 A;  5KHQ A;  1LM8 B;  3PGE A;  3A4R A;  3SHQ A;  5TR5 A;  4MGK E;  4M8N A;  2RSU A;  1NI2 A;  1R4M I;  2HE7 A;  3SU8 X;  5AEK B;  5DPS A;  2FUH B;  2M1M A;  2ZZP B;  4A3P A;  4BKS A;  1I42 A;  2BPS A;  4DDG D;  1WJ4 A;  4LJO B;  4XX5 A;  3TBL D;  2DAF A;  4HWI B;  2G45 B;  1YJ1 A;  2LZ6 A;  3ML8 A;  3JSV A;  3MHS D;  4W9G A;  3T9L A;  2K6D B;  3U30 A;  3WAP A;  2BKR B;  2ZEQ A;  3QA8 A;  3LDZ E;  2IBI B;  2UWQ A;  3ZLZ A;  2L3Z A;  2KFK B;  4HPM B;  2IZV B;  2KHW B;  2PE9 A;  1P98 A;  3CF6 E;  4W9K A;  3A1Q B;  4DK5 A;  4ANW A;  3KVF B;  5AZH A;  1E8Z A;  3ZKJ C;  2KWV B;  2OJR A;  3DPD A;  2MW5 A;  3ONS A;  3PHX B;  2N9E B;  3A9K B;  3TJP A;  4JL9 A;  3UQB A;  4RM8 A;  2PPH A;  3EEC A;  3KYD D;  1WM3 A;  3V6C B;  4GMV A;  5DPT A;  1Z5S B;  1V6E A;  2LVO A;  2G4S A;  2ZPN A;  2KFJ A;  2K6Q A;  4FBJ B;  4KZC A;  1FXT B;  1XD3 B;  4KZ0 A;  3PRP B;  4E71 A;  1ISN A;  4KDI C;  4PS8 A;  3B08 A;  4JGH B;  2KN5 A;  1WE7 A;  3DQV A;  3JW0 X;  1YQB A;  3NHE B;  4E3C A;  1P9D U;  3DBS A;  1UZX B;  3HM3 A;  2YLM A;  1KLV A;  1IP9 A;  1CMX B;  2KVR A;  4HJK A;  4IWQ A;  2RR9 A;  1RRB A;  2CHW A;  2DX5 B;  1UBQ A;  2JWZ A;  3HK0 A;  2Z0E B;  3HHM A;  4IWO A;  1P0R A;  2BWE S;  4KSL C;  4FUL A;  4GDK A;  2LJ5 A;  3O65 B;  2NBU A;  3PT2 B;  2MQJ A;  2MBO A;  3V61 A;  2G4D B;  1UD7 A;  1ZGU B;  3DVN U;  1WIA A;  3WAM A;  4AOF A;  3VTV A;  5L95 C;  1VCB A;  2MBB B;  5BO4 B;  3N3K B;  3DOW A;  3N32 A;  2K8H A;  4NQK E;  3VFK A;  5DPR A;  2KJR A;  2MP2 A;  4G0N B;  3L17 A;  2BYV E;  4DHJ B;  2JXX A;  3RCZ A;  3A9J B;  2D11 A;  3ZNZ B;  2KX3 A;  2KD0 A;  3L08 A;  4MM3 A;  3TL5 A;  2L0T A;  2PJH A;  2HJ8 A;  3P2B A;  4IM3 A;  5D7G A;  3QCA A;  3SD5 A;  4F8C B;  1H4R A;  2KLG A;  5KHO A;  1F9J A;  2GBM A;  1P1A A;  3EC8 A;  1TTN A;  4HDQ A;  4XC2 A;  4N9F 4;  1J0G A;  1E8W A;  2N9P C;  4NJ6 A;  2RPQ A;  3RD2 A;  3VUX A;  2MCN B;  1E5W A;  2NPT B;  1YIW A;  2FCS A;  1WM2 A;  2LXC A;  2D10 A;  4LDT B;  3SDL C;  4K7W A;  1KM7 A;  5LXI B;  4A20 A;  2MSE D;  3TIX A;  2J0J A;  4W9L A;  1UGM A;  2C7M B;  2MA9 B;  2DHZ A;  3QAQ A;  4FJV B;  4BFR A;  3OJ4 B;  4EOY A;  1WZ3 A;  2KO3 A;  2D3G A;  4W9F A;  2FCQ A;  3V6E B;  1V86 A;  4BBN C;  3DVN V;  4GSW A;  4B6W A;  1U4A A;  2MRP A;  1EUV B;  2BF8 B;  1UEL A;  2KDB A;  2O6V A;  3ML9 A;  5FR6 A;  1WRD B;  3EFU A;  4F7Z A;  5JHB A;  4PYU A;  3L16 A;  3ZRC A;  4WWN A;  2NR2 A;  2NS5 A;  2DAJ A;  2KDF B;  3KUD B;  4CYE A;  3IVF A;  2DZM A;  3OJ3 A;  2KMC A;  2K25 A;  1WJN A;  3RT3 B;  2HTH A;  2IY1 B;  1GUA B;  2KFK A;  2NBW B;  3UIN B;  2Z59 B;  1WFY A;  4HXD A;  2YVC A;  4ICV A;  3JVZ X;  1WGY A;  2M17 A;  4GOC A;  3A1Q A;  1D3Z A;  1SE9 A;  3QHT A;  4TQ0 A;  2DYB A;  2O2V B;  2ZVO A;  2L0F A;  4MEM A;  2FNJ B;  2KMA A;  3IBE A;  3M63 B;  4FHK A;  3VVW B;  1X1M A;  1WF9 A;  3ZNG C;  4MGI E;  3A9K A;  4WJQ A;  1GC7 A;  3PVL A;  2KWC A;  2XK5 B;  1LQB A;  3ENE A;  4PS3 A;  3HM6 X;  1WMH B;  1S1Q B;  4TKN A;  2J7Q B;  2OOB B;  2GBN A;  2KX0 A;  2JZ3 B;  3UIP B;  2BWF A;  3PLV A;  4URK A;  2LGY A;  4KDL B;  2O6V B;  1UH6 A;  4ANV A;  1V81 A;  5J18 A;  2EMT A;  4X57 B;  4BBN F;  4MGZ E;  3UIO B;  3ALB A;  2LVQ A;  2KC1 A;  4K7S A;  4TV3 A;  2M8S A;  4WWO A;  4ZYN A;  2JZZ A;  1GJZ A;  3DBR I;  4NJ7 A;  5D94 A;  3ZTD A;  2KJH B;  2ZNV B;  1LFD A;  2KZR A;  3JYU A;  4WJP A;  4AJW A;  5C23 A;  1VD2 A;  4KIK B;  2ZNV C;  5LXH A;  4WQO B;  2LVP A;  3R3M A;  4GDL B;  5E6P A;  2UYZ B;  2W9N A;  1V80 A;  3QJZ A;  1RLF A;  3C0R B;  4JQW C;  3PLU A;  3H9D A;  4FJY A;  4IM2 A;  5LLI A;  3R7R A;  2BYE A;  4I6L B;  1I35 A;  3GOE A;  1A5R A;  2LXA A;  3DCG A;  4JIO U;  4LCD E;  3WAO A;  1L2N A;  3APC A;  4K7U A;  1OEY A;  3A9J A;  4HVB A;  1E8X A;  2DYO A;  1HE8 A;  2KK8 A;  3UF8 A;  4FLH A;  4OVU A;  2JPH A;  2WX1 A;  4BVU C;  3RUI B;  4IWP A;  2K8C A;  3GZN I;  3D32 A;  2FIF A;  2LWP A;  3T8M A;  2IYD B;  3L13 A;  4RMA A;  3WA0 A;  1V5O A;  3KW5 B;  4TQ1 A;  2KJ6 A;  2REX A;  1WGR A;  3H7S A;  1KJT A;  2MWS B;  5DCN A;  3ZW3 A;  3CMM B;  2NPT A;  2DZK A;  2O6V D;  3LJ3 A;  2ZCB A;  4MJS B;  1J8C A;  1S3S G;  1WGG A;  3ZTC A;  4I6N B;  3QQ8 B;  4KSK C;  1Z2M A;  3MTN B;  3OAW A;  1WI0 A;  2DYM A;  1XT9 B;  4OVV A;  5E6O A;  2BKF A;  2WYQ A;  4GB9 A;  3AU5 A;  4AUQ C;  2WDT B;  3VUY A;  4HDO A;  1NBF C;  2KTR A;  5D6J B;  1WE6 A;  5CHW A;  4W9H A;  3L0W B;  4MDK E;  1RFA A;  5AZG A;  3WAN A;  4DHZ E;  1V49 A;  4IW0 A;  1IPG A;  4WWP A;  4DBG A;  3DVG X;  1R4N I;  2V3S A;  3APD A;  2LRW A;  3VXW A;  2BGF A;  3R66 C;  2CHX A;  4CO7 A;  1AAR A;  3U8Z A;  4AP4 C;  2FCM A;  1V2Y A;  3VTU A;  5HKH A;  1YX5 B;  1WXA A;  1E7U A;  3KUC B;  3VDZ A;  3S2A A;  3V60 A;  1TBE A;  1V9J A;  3VTW A;  2O2V A;  3AU4 A;  4MH0 E;  3ZVV A;  1WJU A;  2DEN B;  1OQY A;  2LI5 A;  3X23 A;  3ZRF A;  2AL6 A;  2JUO A;  3WIM A;  3BY4 B;  2N7D A;  2XK5 A;  2FID A;  1WXV A;  1WMH A;  2GBJ A;  4HPL B;  1SIF A;  4BOZ B;  3UQA A;  2KTR B;  2BYF A;  2AYO B;  2RD0 A;  4G11 A;  1M94 A;  3L10 B;  5AZF A;  4HLE A;  4M0W B;  5G55 A;  2M0X A;  3NZU A;  2MBQ A;  2L05 A;  4WJO A;  2QHO A;  2NCN A;  3AI5 A;  3M95 A;  3QAR A;  3NY5 A;  4FN2 A;  2JVC A;  2Z0D B;  1YX6 B;  3Q3J A;  4GU2 A;  2FAZ A;  1YD8 U;  1EF1 A;  4II2 B;  3I3T B;  2I1J A;  4DWF A;  3ZDM C;  4G50 A;  4K81 A;  2MBH A;  1WH3 A;  2N1W A;  2V1Y A;  2L7R A;  4RM9 A;  3CSF A;  4EEW A;  4FAD A;  1T0Y A;  2CKH B;  1WX7 A;  4DHJ D;  4KIK A;  1OEY J;  3PRM B;  1H8C A;  2PEA A;  4NAW B;  2J0K A;  3KYC D;  1WGD A;  4ZRK A;  2GMI C;  4GDL A;  1Q0W B;  3VUW A;  5JZE B;  4KVG B;  2C7N B;  4PYZ A;  4AJY B;  3X0W A;  1OTR B;  2GOW A;  1XQQ A;  3AUL A;  2MBE A;  3W1Y A;  2KC2 A;  3RZF A;  3MJW A;  2WX0 A;  4ZDV A;  2JRI B;  2CS4 A;  5J17 A;  2AL3 A;  4DXA B;  4E74 A;  1BT0 A;  1WGH A;  4DHZ B;  2B3A A;  3VQI A;  2R2Q A;  1NDD A;  2WWZ A;  2HD5 B;  3QIJ A;  3VH3 B;  1E8Y A;  2D2Q A;  4W9D A;  2LGD A;  3H7P B;  4LDT D;  4GIV A;  4A3O A;  3IFW B;  5CTR C;  2JRH A;  4TUU A;  1WR1 A;  2D07 B;  3B1L X;  3K9O B;  4HCN B;  1WZ0 A;  3HIZ A;  3PPA A;  4W9C A;  1WR6 E;  3V62 A;  3RUL A;  1SGH A;  4ASW C;  3R7Q A;  2MLB A;  4B9K A;  2NVU I;  2KLC A;  2CR5 A;  3KH0 A;  3H6N A;  4EZL A;  3L54 A;  1RAX A;  4NPN A;  4B95 A; 
#chains in the Genus database with same CATH topology
 3IG3 A;  2QSD A;  3QK0 A;  2KWD A;  4JLC A;  4GGQ A;  2PE6 B;  3Q8C A;  3BVM A;  1Q5W B;  3VH4 B;  2K39 A;  1QZE A;  5IO9 A;  3IXS A;  3ZO5 B;  2LHE A;  1FD6 A;  5G2N A;  4GN1 A;  2KDM A;  2WDV B;  1J19 A;  2DBY A;  3U4E G;  2B76 B;  1JRU A;  5G5H A;  2BS2 B;  3N20 C;  4A9A A;  3BVG A;  1TKE A;  4JX1 C;  3DBL B;  3M62 B;  2DWQ A;  4P7I A;  4B0M A;  2AQ1 B;  1WYW B;  3OLM D;  2PVG C;  4RGT A;  3KUZ A;  2C9W B;  2KDI A;  4W9E A;  4IM0 A;  3TCA A;  4M0W A;  3T3O A;  2IO2 B;  4II3 B;  1V97 A;  2INN E;  3VR8 B;  1WXQ A;  1RM6 C;  3VAW A;  1FCC C;  5G5G A;  1E7V A;  2V3P A;  3ZNI D;  1ZKH A;  1GC6 A;  3NZS A;  4BKT A;  1I4X A;  3BIN A;  4NAW A;  4J6I A;  3QX1 A;  4YXD B;  2QIL A;  3MFG A;  4EE2 A;  3TSS A;  1D5X C;  2AQ2 B;  2JY6 A;  4K1R B;  2WLB A;  1QIL A;  1NYQ A;  4HK2 A;  2K1F A;  2MP2 B;  3ZIM A;  2XEW A;  4ZRJ A;  3Q3F A;  4KGS A;  1G6J A;  4FJZ A;  4I6P A;  4MM3 B;  4ANX A;  4EKU A;  5EDS A;  1FCL A;  3W9C B;  1QQR A;  2KNB A;  5H8Y E;  1KOT A;  1WJ6 A;  3U2S C;  3DHH C;  3CST A;  2A5U A;  2GBK A;  2JT4 B;  3QWZ B;  5L83 A;  3RZW C;  2KTF A;  3DVG Y;  2KQS A;  4CHK A;  2IO1 B;  3SHQ A;  5TR5 A;  2M56 B;  3AEA B;  2BPS A;  1YJ1 A;  3WAP A;  5IN7 A;  2K6D B;  1TIF A;  2L3Z A;  1N6Z A;  4W9K A;  4DK5 A;  2JU6 X;  3ZXV A;  2KWV B;  1VZ6 A;  3ONS A;  2MW5 A;  3BYT B;  3Q8F A;  1N62 A;  2WXR A;  3TEZ A;  3UQB A;  4RM8 A;  2PPH A;  3EEC A;  2PIA A;  1WM3 A;  5BYS A;  3PZ7 A;  1Z5S B;  3ZJV A;  2K6Q A;  1FXT B;  1XD3 B;  4KZ0 A;  3PRP B;  3AEG B;  3B08 A;  1YQB A;  4KKJ A;  1N5W A;  4L23 A;  2QCZ A;  3DBS A;  1KLV A;  4M00 A;  2KVR A;  1UUP A;  1TY0 A;  2WXL A;  1P0R A;  2BWE S;  2W54 A;  4FUL A;  3PT2 B;  2MQJ A;  4RH6 A;  1WIA A;  2MBB B;  3N3K B;  4NQK E;  2WHI A;  4DHJ B;  1HEZ E;  5D3D A;  2L0T A;  5KHO A;  1F2R I;  1N5X A;  3ZQ4 A;  4RNA A;  3EC8 A;  1J0G A;  4NJ6 A;  3DHG C;  3VUX A;  1RWS A;  2D10 A;  3SDL C;  2MSE D;  1UGM A;  2DHZ A;  3QAQ A;  4BFR A;  3V6E B;  1V86 A;  3RNC C;  4B6W A;  1VR9 A;  3ML9 A;  1FPY A;  5JHB A;  3L16 A;  4XDC A;  5LNK 1;  4CYE A;  3OJ3 A;  2DZM A;  1MVK A;  2KMC A;  1T0S C;  4OZB A;  2IY1 B;  2Z59 B;  1WFY A;  3AE9 B;  4HXD A;  3JVZ X;  1WGY A;  4OHJ A;  1D3Z A;  1SE9 A;  2DYB A;  2FNJ B;  1X1M A;  1WF9 A;  2M0A A;  4ACF A;  1GC7 A;  5D3I B;  1LQB A;  3HM6 X;  1WMH B;  4TKN A;  3BK1 A;  2JZ3 B;  4YTM B;  3AV8 A;  4KDL B;  4IOI E;  1TS4 A;  1UH6 A;  3N9Y C;  1Y56 A;  5J18 A;  2EMT A;  3CIR B;  4YSX B;  2X38 A;  3NG0 A;  4WWO A;  1ET6 A;  2JZZ A;  5D94 A;  3ZTD A;  1L5P A;  1VZ7 A;  5E6P A;  1EU4 A;  1UF0 A;  5FKA C;  1CJE A;  1VZ8 A;  2BYE A;  1I35 A;  4US8 A;  1A5R A;  2LXA A;  4LCD E;  3APC A;  1JRO A;  2LJI A;  1OEY A;  3A9J A;  1PFD A;  4RGN A;  1HTQ A;  4P6V F;  3NZ3 A;  4OVU A;  2JPH A;  4YSY B;  2KQ4 X;  1MFW A;  4IWP A;  4YTN B;  3GZN I;  2G1E A;  1OQR A;  2DNF A;  3KW5 B;  3BII D;  1WGR A;  1NYR A;  1N63 A;  5DCN A;  3MHZ A;  3RNF C;  2DZK A;  2O6V D;  3BYY B;  1S3S G;  1WGG A;  1L0X B;  4I6N B;  3DWM A;  2QC8 A;  2DYM A;  1XT9 B;  4OVV A;  5E6O A;  2BKF A;  1Q10 A;  1XLP A;  4GB9 A;  4HRO A;  3VUY A;  5AZG A;  2PTL A;  2WXJ A;  1VRA B;  4IW0 A;  2MH7 A;  1XLQ A;  2LRW A;  4LK0 M;  2CHX A;  4CO7 A;  1AAR A;  2VH1 A;  2I38 A;  2ON8 A;  1V2Y A;  3VDZ A;  1E7U A;  4XE0 A;  3NVY A;  2O2V A;  4MH0 E;  3ZVV A;  2AL6 A;  3WIM A;  2XK5 A;  2V3N A;  3UQA A;  2AYO B;  1V8C A;  2QHO A;  1FO4 A;  1C9F A;  2JX5 A;  2JXT A;  2RMM A;  3M95 A;  4QAY A;  2NTS A;  1XLN A;  1XF5 L;  1YD8 U;  1EF1 A;  3I3T B;  2I1J A;  4REZ A;  4K81 A;  2MBH A;  2L7R A;  2WDQ B;  1OEY J;  2YEP B;  1IBX A;  2PEA A;  3KYC D;  4A55 A;  3GE8 C;  2GMI C;  1Q0W B;  3VUW A;  4AJY B;  3AE7 B;  3FKY A;  2MBE A;  3RZF A;  2WX0 A;  4M02 A;  1JQ4 A;  2D3B A;  3R2I A;  2Y3A A;  3P4R B;  3H8H A;  4DHZ B;  2OJW A;  2B3A A;  2CU3 A;  2R2Q A;  3VH3 B;  1PGX A;  4W9D A;  5C3J B;  3GS2 A;  5EE3 A;  4A3O A;  3IFW B;  2ICI A;  1WZ0 A;  4ASW C;  2WQY B;  2NVU I;  3AB5 A;  3H6N A;  2OHF A;  3UGB B;  4MJS A;  3KWL A;  4MEL A;  1D5M C;  3I9V 1;  4ZOH C;  2D3A A;  1I7H A;  2AEH A;  2C60 A;  2ZCC A;  3QC8 B;  1MG4 A;  3Q3N C;  3HVZ A;  4G3X B;  3TMP B;  3SFE B;  1GNU A;  1HZ6 A;  1BML C;  2IO0 B;  1IGD A;  2KDE B;  5CHV C;  1YNT E;  1QOG A;  2KOX A;  3A4S C;  3ZNH B;  3JSV B;  1HXY D;  4ARI A;  1E7P B;  2ZW1 A;  2V0G A;  1ACC A;  5DPW A;  1UBI A;  4M8M A;  4WJN A;  4GXB A;  4C4V B;  5BMI A;  2GRI A;  4HCP B;  3I5J C;  2IY0 B;  3DBL I;  1PYW D;  4LNO A;  2CHZ A;  1GOZ A;  2V4I B;  4IC7 B;  2JZP A;  1F1H A;  3B2G A;  5IAA C;  4IUM B;  1WXM A;  3PRE A;  2M4N A;  1UNS A;  2R61 A;  2AWT A;  4DDI D;  2RGF A;  2Y5C A;  1PGB A;  1Q1O A;  2EKE C;  3B0A A;  1FFV A;  1TS2 A;  4HJG E;  4XGA B;  2ZJD A;  4BKG A;  4MAC A;  1K8R B;  3NVV A;  2K5P A;  3ETR A;  4ZRI A;  4EZK A;  2LRU A;  1MJD A;  1P7E A;  1V1P B;  3H1U A;  4DXF A;  3MJ5 A;  1P7F A;  3RYT A;  4ZHP A;  4LJP B;  1ZXI A;  1QKZ A;  2M19 A;  2LGS A;  4HRS A;  3H7P A;  1PUT A;  4EZJ A;  3RPF C;  3PRZ A;  2J42 A;  5J2R A;  3AM9 A;  5JHA A;  1DOY A;  2C5L C;  2V4L A;  5JXV A;  1R4M B;  4N58 A;  4MGY E;  2VZK D;  5C2T B;  2K8B A;  3V3X A;  2MJ3 A;  1OFF A;  2BS4 B;  3APF A;  3I63 C;  1Y8R C;  5CX3 A;  3PGE A;  1JWB D;  2INC C;  4C7Y A;  2RSU A;  1NI2 A;  2HE7 A;  5HFY A;  4C80 A;  2FUH B;  2ZZP B;  1ZPS A;  4A3P A;  1I42 A;  4DDG D;  3TBL D;  4HWI B;  2G45 B;  2LZ6 A;  1K50 A;  4W9G A;  3T9L A;  3MHS D;  2N9L A;  3LDZ E;  2IBI B;  1FEH A;  2KFK B;  1KF6 B;  2IZV B;  2PE9 A;  2BTE A;  1P98 A;  4HKQ A;  3KVF B;  1E8Z A;  2E3T A;  3ZYY X;  2PVO D;  3DPD A;  3PHX B;  3A9K B;  3W5U B;  3TJP A;  2AQ3 B;  1B9R A;  5H92 C;  3GP7 A;  3KYD D;  3B9J A;  2J52 A;  2G4S A;  2LVO A;  3FC4 A;  2KFJ A;  3V05 A;  2LGI A;  4FBJ B;  4HPP A;  1WSP A;  3RN9 C;  1ISN A;  4KDI C;  1XXG A;  4JGH B;  2KN5 A;  1GB4 A;  1I4H A;  3ZJU A;  3DQV A;  1P9D U;  2BT6 A;  3HM3 A;  1N61 A;  1CMX B;  2K0P A;  3PO0 A;  4IWQ A;  4WH4 A;  2CHW A;  3AE1 B;  2IGH A;  1T0R C;  2JWZ A;  3HK0 A;  1SJH D;  1LGR A;  4GDK A;  3O65 B;  2MEK A;  1ZDX A;  2WU2 B;  3U7Z A;  1ZGU B;  3DVN U;  3WAM A;  4N6E B;  2KJR A;  3L17 A;  2JXX A;  3AMZ A;  1FNV A;  2IJ0 A;  3ZNZ B;  4XWW A;  2KD0 A;  3L08 A;  4IM3 A;  2HJ8 A;  5D7G A;  4F8C B;  2KLG A;  2GBM A;  1JWM D;  4HDQ A;  1TTN A;  3FAH A;  3UI3 A;  1E8W A;  1KLG D;  1R7S A;  1E5W A;  2FCS A;  1WM2 A;  3SR6 A;  1DOX A;  3GE3 C;  4FJV B;  1UWM A;  4W9F A;  2KO3 A;  2D3G A;  2WXN A;  2FCQ A;  4TMA B;  4BBN C;  4GSW A;  2KAC A;  2MRP A;  1EUV B;  1VDV A;  1WRD B;  3EFU A;  2K22 A;  2PMV A;  1JWS D;  3FIL A;  1AW7 A;  2NR2 A;  1T0Q C;  3O13 A;  2NS5 A;  4OVZ A;  1L6V A;  1GUA B;  4S17 A;  3UIN B;  1FNW A;  4GOC A;  3A1Q A;  2KMA A;  3IBE A;  3VVW B;  3DBR B;  1S1Q B;  3E56 A;  2KX0 A;  2VH2 A;  3ZXR A;  2X8X X;  3EA6 A;  1NEN B;  4BBN F;  1ESF A;  1N60 A;  1EWC A;  3ALB A;  4RF0 A;  4C7Z A;  2KC1 A;  4ZYN A;  4LNK A;  3WCQ A;  4NJ7 A;  1XCQ L;  2ZNV B;  2KZR A;  5C23 A;  1VD2 A;  2QDF A;  2ACZ B;  4KIK B;  4GDL B;  2UYZ B;  1V80 A;  3EFC A;  1TZO A;  3PLU A;  3Q6B A;  4IM2 A;  5LLI A;  1SIJ A;  3GOE A;  4K7U A;  4HVB A;  1HE8 A;  1F52 A;  5IKC M;  3AEC B;  2KK8 A;  3UF8 A;  2WX1 A;  2BVC A;  4RMA A;  1V5O A;  3H7S A;  4JWU C;  2NPT A;  1HZ5 A;  2ZCB A;  1R4N B;  1J8C A;  1HQR D;  2OED A;  1DYQ A;  3AN1 A;  1WI0 A;  2CJN A;  2WDT B;  4HDO A;  1XLO A;  4ZRQ A;  1WE6 A;  5CHW A;  3L0W B;  3WAN A;  1V49 A;  1IPG A;  1SSN A;  3NRZ A;  2VZK B;  3NUH B;  1TS5 A;  2BB5 A;  2BGF A;  5HKH A;  3VTU A;  1BUI C;  4DXG A;  3S2A A;  3V60 A;  4D2K A;  1TBE A;  3VTW A;  1OQY A;  3X23 A;  1L0V B;  1JW9 D;  3BY4 B;  2FID A;  2GBJ A;  2W82 A;  1AYF A;  2KTR B;  2RD0 A;  3KLS X;  4HLE A;  1YJJ A;  4M0W B;  2M0X A;  2L05 A;  3AI5 A;  3QAR A;  3NY5 A;  3RNB C;  1SE3 A;  3N1X C;  4RM9 A;  1TKG A;  1WX7 A;  1YJI A;  1H8C A;  4NAW B;  2J0K A;  1GAQ B;  1WGD A;  4ZRK A;  2C7N B;  3TEW A;  4M01 A;  1OTR B;  3AUL A;  3W1Y A;  4N59 A;  3MJW A;  2KT7 A;  5J17 A;  4DXA B;  3OG5 A;  1I4Q A;  1BT0 A;  1WGH A;  3VQI A;  3Q8A A;  2L1A A;  2Z8L A;  4LDT D;  1VLB A;  2Y5P A;  2Q5W D;  1FRR A;  2D07 B;  4HCN B;  5BYR A;  1WR6 E;  5I4D A;  3RUL A;  3R7Q A;  4B9K A;  2CR5 A;  1KH0 A;  2L83 A;  4NPN A;  4B95 A;  2KXJ A;  2YEP F;  3VHT C;  4XDD A;  1MHX A;  2KAN A;  4FA6 A;  4PS7 A;  2GB1 A;  1ZW7 A;  1SBB B;  5TSS A;  3E9S A;  1E9M A;  4BOS C;  3W1S C;  2UU7 A;  3NS8 A;  5BMH A;  4KGR A;  2C7H A;  1F77 A;  1P3Q U;  3AE6 B;  2KVZ A;  3KWV A;  3DBH I;  2LD9 A;  1NEK B;  2KQ7 A;  2N7E A;  2FBW B;  3N1Y C;  2Y5B B;  4WIP A;  5GMV A;  2BS3 B;  2LGX A;  3Q8E A;  3L4P A;  5D2M B;  1L4Z B;  3P4Q B;  3DDC B;  2FCN A;  3PV1 A;  4JWS C;  3CWI A;  3P4S B;  2ASQ A;  4YT0 B;  2E6X A;  3A33 B;  4W9J A;  1ZDV A;  2CU1 A;  1WY8 A;  4W9I A;  2KKC A;  1YQ3 B;  4AWJ A;  1MHH E;  1LXD A;  1JWA D;  2WGS A;  1JAL A;  5JH5 C;  3WAL A;  4RF1 A;  1WX9 A;  5EE9 A;  1GG3 A;  4RFB A;  2DZJ A;  1XEE A;  2I1K A;  2WS3 B;  1D4B A;  3PTF C;  2W3R A;  2H89 B;  4IG7 B;  1SE4 A;  4LTU A;  4P16 A;  4FHJ A;  2L52 A;  2BW2 A;  2LHD A;  1YN5 A;  2WP9 B;  2L8J A;  3PZD A;  1C3T A;  2HDE A;  5IP4 D;  3SFD B;  1XCT L;  3GB1 A;  3VRA B;  1MG8 A;  5BMG A;  1TZ1 A;  2SAK A;  1D5Z C;  1PQS A;  2GBR A;  1TGZ B;  1E6E B;  1VJK A;  3EHV A;  2QMT A;  1J7C A;  3DHI C;  1YN3 A;  4FXC A;  5KHQ A;  1LM8 B;  5BYQ A;  3A4R A;  4MGK E;  2EEL A;  2MJE A;  4M8N A;  2KYW A;  4L2Y A;  1R4M I;  3RNE C;  3SU8 X;  1KTK A;  1HA5 A;  1OQQ A;  1WJ4 A;  4LJO B;  3W5V B;  4NZL B;  4XX5 A;  3ML8 A;  3U30 A;  2LEK A;  2BKR B;  3QA8 A;  2G9H D;  3R8B A;  3ZLZ A;  3Q3O C;  3CF6 E;  5AZH A;  3IAS 1;  2NMQ A;  3ZKJ C;  3Q3M C;  2N0S B;  3Q2A C;  2N9E B;  3BK2 A;  4JL9 A;  1TJE A;  4GMV A;  5DPT A;  2RDH A;  1V6E A;  3C8Y A;  3AE8 B;  4ZHO A;  1SEB D;  4E71 A;  1WE7 A;  1IUE A;  3JW0 X;  1TT5 B;  4E3C A;  3AE2 B;  5HG2 A;  5HI1 A;  2YLM A;  2RR9 A;  1RRB A;  1MI0 A;  2D5G A;  4IWO A;  4KSL C;  2Z0E B;  2JWU A;  4K3C A;  2LJ5 A;  2NTT A;  2NBU A;  3V61 A;  2G4D B;  5L95 C;  4AOF A;  5EE0 A;  1VCB A;  3AE4 B;  5BO4 B;  3DOW A;  3VFK A;  5DPR A;  2MP2 A;  4G0N B;  2BYV E;  3A9J B;  3OWE B;  2D11 A;  4MM3 A;  4GLS C;  1QOA A;  1H4R A;  1F9J A;  4XC2 A;  1FIQ A;  4N9F 4;  2N9P C;  1TY2 A;  3RNG C;  1BXT A;  3R2T A;  5IOI A;  1L6U A;  2ONQ A;  4LDT B;  1EM7 A;  1YOV B;  1SXT A;  2J0J A;  2C7M B;  1QF6 A;  2WXP A;  3OJ4 B;  3AEF B;  4EOY A;  3DVN V;  5FR6 A;  4F7Z A;  1CZP A;  4PYU A;  4WWN A;  5E6J A;  2DAJ A;  1ZE3 D;  2KDF B;  3IVF A;  3RT3 B;  2NBW B;  2YVC A;  2ZW0 A;  2N9K A;  4HKZ E;  3QHT A;  2QEJ C;  4TQ0 A;  2O2V B;  1FMA D;  4IDI A;  3M63 B;  3ZNG C;  1WRI A;  4MGI E;  4WJQ A;  3PVL A;  2XK5 B;  4PS3 A;  2J7Q B;  3UIP B;  2BWF A;  4URK A;  1CK1 A;  2O6V B;  3TEY A;  1NI3 A;  4ANV A;  4KGT A;  4MGZ E;  3UIO B;  3AE5 B;  2IND C;  4TV3 A;  2M8S A;  4YWG G;  1YMH E;  3DBR I;  1J7A A;  3JYU A;  2ZNV C;  1IBX B;  2LVP A;  3C19 A;  1WYG A;  3R3M A;  2W9N A;  1JRP A;  3QJZ A;  3C0R B;  4JQW C;  3H9D A;  2H88 B;  3R7R A;  2RPV A;  3DWG C;  3DCG A;  4JIO U;  1L0Y B;  2WDR B;  1C76 A;  2DYO A;  4C00 A;  4FLH A;  4BVU C;  2K8C A;  3D32 A;  2FIF A;  3T8M A;  3WA0 A;  4TQ1 A;  2KJ6 A;  2REX A;  4K3B A;  1KJT A;  2LUM A;  2MWS B;  2KMM A;  3CMM B;  3LJ3 A;  1RFK A;  4MJS B;  3ZTC A;  3QQ8 B;  4KSK C;  1Z2M A;  3MTN B;  1ZUD 2;  3OAW A;  4LNI A;  2WYQ A;  3P42 A;  3AU5 A;  4AUQ C;  5FR3 A;  2KTR A;  1RFA A;  4DHZ E;  4DBG A;  2W55 A;  3MC9 A;  1R4N I;  3B2F A;  3VXW A;  2DLB A;  5HHD G;  1ET9 A;  4NAM A;  3RI7 C;  1SB3 C;  1D6E C;  3KUC B;  1C77 A;  1V9J A;  1QLB B;  1FXI A;  3AU4 A;  1FRD A;  1MPE A;  1WJU A;  2LI5 A;  3ZRF A;  2N7D A;  1WXV A;  1WMH A;  4HPL B;  1SIF A;  4BOZ B;  4G11 A;  3VRB B;  3L10 B;  2MBQ A;  4FN2 A;  2WXM A;  2Z0D B;  1YX6 B;  3Q3J A;  4GU2 A;  4DWF A;  4OW0 A;  3ZDM C;  4G50 A;  1WH3 A;  1SJE D;  2N1W A;  2V1Y A;  4EEW A;  2QJL A;  4FAD A;  3KQ4 A;  3NVW A;  4KVG B;  3X0W A;  1XQQ A;  3TUO A;  2RDG A;  1C4P A;  4XWT A;  2KN4 A;  4O1N A;  4UDU C;  3MC0 B;  2HD5 B;  3BWU D;  1I4R A;  1E8Y A;  4PT5 A;  1JCK B;  2LGD A;  3H7P B;  2IDY A;  5CTR C;  3B1L X;  4BZA A;  3K9O B;  3HIZ A;  1SGH A;  1CQV A;  4EZL A;  3KH0 A;  4P1B C;  3EGR A;  4MSM B;  1TS3 A;  1V1O A;  3MC8 A;  5IA7 A;  1JWU D;  3K9P B;  1SF0 A;  2IO3 B;  4F1S A;  4KV2 A;  4EUT A;  4HEA 1;  4ICU A;  3NOB A;  4MSQ B;  2EMS A;  1AWD A;  1FNU A;  1M4V A;  1E90 A;  3PHW B;  2D3C A;  1QOB A;  1K52 A;  2N9X A;  2VRR B;  5E6N A;  2G3Q B;  1EO6 A;  2ZVN A;  3RFZ B;  3P4P B;  2KWU B;  1OGW A;  3U7D A;  2JQR B;  1WX8 A;  4XZ4 A;  3HRD D;  2I2Y A;  2LAS A;  3ECI A;  1IGC A;  2XBB C;  3PSE B;  2L76 A;  4LNN A;  3ZUN A;  1UGJ A;  1FFU A;  3LXF A;  2N1V A;  1EWY C;  4AS1 A;  1WXS A;  2JF5 A;  3PS6 A;  4NY0 A;  5CHF A;  5EE1 A;  2ZPY A;  1IYF A;  3IT6 B;  3URY A;  1PDX A;  1V5T A;  2QIE B;  1JML A;  1GB1 A;  3AXC A;  1F2R C;  4YL8 A;  4DQO C;  1E10 A;  2L00 B;  1GPX A;  2NBV B;  1QT9 A;  1AN8 A;  3P63 A;  2WXG A;  2LUE A;  3N30 A;  2N7J A;  2SEB D;  4GDK B;  5C1Z A;  4LLG M;  3ZDT A;  4BKS D;  2INP E;  2K3U A;  4NQL B;  2MX2 A;  2JYE A;  1L7Y A;  1I4P A;  1I4G A;  4EFO A;  2J0M A;  1QOF A;  3SEB A;  2DZI A;  4NNJ B;  1C78 A;  1L4D B;  3IHP C;  1KLU D;  3P1M A;  4WAA A;  4ANU A;  2N4F A;  3M3J A;  2A4Z A;  2R2O A;  1C1Y B;  1EF5 A;  2J4X A;  3W1S A;  3NS1 A;  1C79 A;  3RMK C;  3AEE B;  2PW9 A;  3Q14 C;  3N1Z C;  1C4C A;  4R3D A;  5AEK B;  4JE3 B;  5DPS A;  2M1M A;  4BKS A;  3HVD A;  4ITK A;  3FIL B;  1YQ4 B;  2DAF A;  3JSV A;  4ZYS A;  1E0Z A;  2ZEQ A;  3AEB B;  2FE8 A;  2UWQ A;  1TKY A;  4HPM B;  2KHW B;  3A1Q B;  4C4V A;  2HTM E;  5AUI A;  4ANW A;  2RDB C;  2OJR A;  3W2D A;  1B1Z A;  3ZJT A;  1T5X D;  3LB8 C;  3V6C B;  2WU5 B;  3IT4 B;  1C4A A;  2ZPN A;  4LNF A;  4KZC A;  4PS8 A;  2JSV X;  4KX6 B;  3NHE B;  1UZX B;  1IP9 A;  1WGK A;  4HJK A;  1K51 A;  3ABV B;  2DX5 B;  4A8X C;  1UBQ A;  1V1P A;  3HHM A;  3I57 A;  2IGD A;  2MBO A;  1UD7 A;  5GXG B;  3VTV A;  1T3Q A;  1KRH A;  2GLS A;  3N32 A;  2K8H A;  3RCZ A;  2KX3 A;  3TL5 A;  2PJH A;  3P2B A;  5FK9 C;  3QCA A;  3SD5 A;  4OZC A;  1WWT A;  1LO5 D;  4OZA A;  1P1A A;  4YTP B;  4RGM A;  2MJD A;  4CQN A;  2RPQ A;  4Q2J A;  3RD2 A;  2MCN B;  1YN4 A;  2NPT B;  1SE2 A;  1YIW A;  2LXC A;  2HJ1 A;  4K7W A;  3BZD B;  1KM7 A;  5LXI B;  4A20 A;  3TIX A;  4W9L A;  1PGA A;  4B0E A;  2MA9 B;  1WZ3 A;  2LFI A;  2PLP A;  1U4A A;  3BVZ A;  2BF8 B;  1UEL A;  2KDB A;  2O6V A;  2BYT A;  2WXF A;  1F0Z A;  3T3N A;  2WXO A;  3AED B;  3ZRC A;  2TSS A;  2CJO A;  3KUD B;  2W3S A;  4YSZ B;  3PZ8 A;  2K25 A;  1WJN A;  2HTH A;  2KFK A;  4ICV A;  2M17 A;  2IGG A;  3Q8B A;  2ZVO A;  2L0F A;  4L1B A;  4MEM A;  4FHK A;  3A9K A;  2KWC A;  3ENE A;  2OOB B;  2GBN A;  5AUK A;  3PLV A;  2LGY A;  1V81 A;  1FXA A;  4BAX A;  4MH8 A;  1T6B X;  4X57 B;  4RGO S;  1HTO A;  2LVQ A;  4TSS A;  4K7S A;  1GJZ A;  4JPS A;  1K53 A;  2XNA C;  2KJH B;  4C56 C;  1LFD A;  4AJW A;  4WJP A;  1J7B A;  2PKO A;  5LXH A;  4J3O D;  4WQO B;  1A70 A;  2WXH A;  1ROE A;  1RLF A;  2EKI A;  4KKI A;  3GZN B;  4FJY A;  4I6L B;  2FUG 1;  3ZGZ A;  2WXI A;  3EUB 2;  3TEX A;  4XYC A;  3DBH B;  3WAO A;  1L2N A;  2KAJ A;  2L32 A;  1E8X A;  4MT5 A;  1EU3 A;  1XO3 A;  3J9C A;  4NJC A;  3RUI B;  3U52 E;  2WXK A;  4WAF A;  2LWP A;  4A90 A;  2IYD B;  3L13 A;  2GI9 A;  2WXQ A;  2XN9 C;  3ZW3 A;  2BB6 A;  2AX5 A;  4US9 A;  5MPO A;  1TYG B;  4H2A A;  3AH7 A;  1NBF C;  2V9H A;  5D6J B;  1KFY B;  3Q69 A;  4W9H A;  4MDK E;  4WWP A;  3DVG X;  1DGJ A;  2MHJ A;  2V3S A;  3APD A;  4S0R A;  4PK1 A;  4RCO A;  1FM0 D;  3R66 C;  3LYY A;  3NVZ A;  3U8Z A;  4AP4 C;  2FCM A;  1YX5 B;  1WXA A;  4WQM A;  2IPK D;  2DEN B;  2JUO A;  4AQ7 A;  4A6Q A;  1ENF A;  2BQQ A;  3MP9 A;  2BYF A;  1M94 A;  5AZF A;  5G55 A;  3NZU A;  4WJO A;  2NCN A;  2JYT A;  4WUR A;  1DOI A;  2JVC A;  3NJT A;  2FAZ A;  4II2 B;  2WNM A;  1UWX A;  4WWM A;  2BBC A;  1NVI D;  3CSF A;  1T0Y A;  2CKH B;  3IAM 1;  4DHJ D;  4KIK A;  3PRM B;  4P1C C;  2K9X A;  2LMC A;  4GDL A;  5JZE B;  4PYZ A;  2GOW A;  3HUI A;  1ZXH A;  2J53 A;  3RNA C;  2KC2 A;  1RYJ A;  4ZDV A;  2JRI B;  2CS4 A;  2AL3 A;  5T8I A;  3AE3 B;  4E74 A;  1ZP0 B;  1STE A;  1NDD A;  2WWZ A;  3QIJ A;  2D2Q A;  4IKG A;  4GIV A;  4ARC A;  2JRH A;  3VR9 B;  4TUU A;  1WR1 A;  4ZRP A;  4USA A;  3PPA A;  4W9C A;  3V62 A;  1ZOY B;  2MLB A;  2KLC A;  3L54 A;  1RAX A; 
#chains in the Genus database with same CATH homology
 3IG3 A;  4MSM B;  3UGB B;  3QK0 A;  2KXJ A;  4MJS A;  3VHT C;  4MEL A;  2KAN A;  5IA7 A;  4FA6 A;  4PS7 A;  4JLC A;  4GGQ A;  2PE6 B;  1Q5W B;  3K9P B;  2IO3 B;  1ZW7 A;  2AEH A;  3VH4 B;  2C60 A;  2K39 A;  4KV2 A;  4EUT A;  2ZCC A;  3QC8 B;  4F1S A;  1QZE A;  4ICU A;  3NOB A;  3ZO5 B;  4BOS C;  4MSQ B;  2EMS A;  4G3X B;  3W1S C;  3TMP B;  3NS8 A;  5G2N A;  4GN1 A;  2C7H A;  1E90 A;  3PHW B;  1GNU A;  2VRR B;  2N9X A;  2IO0 B;  1J19 A;  1P3Q U;  2KDE B;  1JRU A;  5CHV C;  5E6N A;  2G3Q B;  2KOX A;  1EO6 A;  3DBH I;  2LD9 A;  2KQ7 A;  2N7E A;  2ZVN A;  3A4S C;  2KWU B;  3ZNH B;  2Y5B B;  3M62 B;  3JSV B;  1OGW A;  4P7I A;  3U7D A;  1WX8 A;  4XZ4 A;  1WYW B;  5GMV A;  2LGX A;  3OLM D;  2LAS A;  5DPW A;  1UBI A;  3ECI A;  4M8M A;  5D2M B;  2XBB C;  3PSE B;  2L76 A;  3ZUN A;  4WJN A;  4GXB A;  2N1V A;  3KUZ A;  2C9W B;  3DDC B;  1WXS A;  2FCN A;  2JF5 A;  3PS6 A;  4NY0 A;  2KDI A;  4HCP B;  4W9E A;  4IM0 A;  5CHF A;  3TCA A;  2IY0 B;  3DBL I;  2ZPY A;  1IYF A;  2CHZ A;  4IC7 B;  1V5T A;  3PV1 A;  2IO2 B;  5IAA C;  2ASQ A;  4IUM B;  1WXM A;  3PRE A;  2M4N A;  3A33 B;  3AXC A;  4W9J A;  4II3 B;  2CU1 A;  4DDI D;  2AWT A;  1WY8 A;  4YL8 A;  2RGF A;  4W9I A;  2KKC A;  1Q1O A;  2EKE C;  3B0A A;  4AWJ A;  3VAW A;  2L00 B;  1LXD A;  1E7V A;  3ZNI D;  4BKG A;  2ZJD A;  5JH5 C;  1ZKH A;  1GC6 A;  3NZS A;  4BKT A;  3BIN A;  2NBV B;  1K8R B;  4J6I A;  4NAW A;  3WAL A;  3QX1 A;  4ZRI A;  1WX9 A;  4EZK A;  1GG3 A;  2LRU A;  2DZJ A;  2I1K A;  3PTF C;  4IG7 B;  2LUE A;  3N30 A;  3H1U A;  4FHJ A;  2JY6 A;  5C1Z A;  4GDK B;  4K1R B;  3ZDT A;  4BKS D;  3RYT A;  4NQL B;  4LJP B;  2MX2 A;  4HK2 A;  1L7Y A;  2K1F A;  2MP2 B;  3ZIM A;  2XEW A;  3H7P A;  2L8J A;  3PZD A;  4ZRJ A;  4EZJ A;  1C3T A;  3Q3F A;  1G6J A;  3PRZ A;  4EFO A;  4FJZ A;  4I6P A;  2J0M A;  4ANX A;  4EKU A;  5J2R A;  5EDS A;  2KNB A;  1MG8 A;  5JHA A;  1WJ6 A;  1KOT A;  2DZI A;  4NNJ B;  1TZ1 A;  3CST A;  1PQS A;  2A5U A;  2C5L C;  2V4L A;  2GBR A;  1TGZ B;  3IHP C;  2JT4 B;  2GBK A;  3QWZ B;  4MGY E;  4WAA A;  4ANU A;  2N4F A;  2K8B A;  5L83 A;  3EHV A;  3M3J A;  2A4Z A;  2R2O A;  1C1Y B;  3RZW C;  1EF5 A;  2KTF A;  3DVG Y;  2KQS A;  3W1S A;  4CHK A;  3APF A;  2IO1 B;  1Y8R C;  5CX3 A;  5KHQ A;  1LM8 B;  3PGE A;  3A4R A;  3SHQ A;  5TR5 A;  4MGK E;  4M8N A;  2RSU A;  1NI2 A;  1R4M I;  2HE7 A;  3SU8 X;  5AEK B;  5DPS A;  2FUH B;  2M1M A;  2ZZP B;  4A3P A;  4BKS A;  1I42 A;  2BPS A;  4DDG D;  1WJ4 A;  4LJO B;  4XX5 A;  3TBL D;  2DAF A;  4HWI B;  2G45 B;  1YJ1 A;  2LZ6 A;  3ML8 A;  3JSV A;  3MHS D;  4W9G A;  3T9L A;  2K6D B;  3U30 A;  3WAP A;  2BKR B;  2ZEQ A;  3QA8 A;  3LDZ E;  2IBI B;  2UWQ A;  3ZLZ A;  2L3Z A;  2KFK B;  4HPM B;  2IZV B;  2KHW B;  2PE9 A;  1P98 A;  3CF6 E;  4W9K A;  3A1Q B;  4DK5 A;  4ANW A;  3KVF B;  5AZH A;  1E8Z A;  3ZKJ C;  2KWV B;  2OJR A;  3DPD A;  2MW5 A;  3ONS A;  3PHX B;  2N9E B;  3A9K B;  3TJP A;  4JL9 A;  3UQB A;  4RM8 A;  2PPH A;  3EEC A;  3KYD D;  1WM3 A;  3V6C B;  4GMV A;  5DPT A;  1Z5S B;  1V6E A;  2LVO A;  2G4S A;  2ZPN A;  2KFJ A;  2K6Q A;  4FBJ B;  4KZC A;  1FXT B;  1XD3 B;  4KZ0 A;  3PRP B;  4E71 A;  1ISN A;  4KDI C;  4PS8 A;  3B08 A;  4JGH B;  2KN5 A;  1WE7 A;  3DQV A;  3JW0 X;  1YQB A;  3NHE B;  4E3C A;  1P9D U;  3DBS A;  1UZX B;  3HM3 A;  2YLM A;  1KLV A;  1IP9 A;  1CMX B;  2KVR A;  4HJK A;  4IWQ A;  2RR9 A;  1RRB A;  2CHW A;  2DX5 B;  1UBQ A;  2JWZ A;  3HK0 A;  2Z0E B;  3HHM A;  4IWO A;  1P0R A;  2BWE S;  4KSL C;  4FUL A;  4GDK A;  2LJ5 A;  3O65 B;  2NBU A;  3PT2 B;  2MQJ A;  2MBO A;  3V61 A;  2G4D B;  1UD7 A;  1ZGU B;  3DVN U;  1WIA A;  3WAM A;  4AOF A;  3VTV A;  5L95 C;  1VCB A;  2MBB B;  5BO4 B;  3N3K B;  3DOW A;  3N32 A;  2K8H A;  4NQK E;  3VFK A;  5DPR A;  2KJR A;  2MP2 A;  4G0N B;  3L17 A;  2BYV E;  4DHJ B;  2JXX A;  3RCZ A;  3A9J B;  2D11 A;  3ZNZ B;  2KX3 A;  2KD0 A;  3L08 A;  4MM3 A;  3TL5 A;  2L0T A;  2PJH A;  2HJ8 A;  3P2B A;  4IM3 A;  5D7G A;  3QCA A;  3SD5 A;  4F8C B;  1H4R A;  2KLG A;  5KHO A;  1F9J A;  2GBM A;  1P1A A;  3EC8 A;  1TTN A;  4HDQ A;  4XC2 A;  4N9F 4;  1J0G A;  1E8W A;  2N9P C;  4NJ6 A;  2RPQ A;  3RD2 A;  3VUX A;  2MCN B;  1E5W A;  2NPT B;  1YIW A;  2FCS A;  1WM2 A;  2LXC A;  2D10 A;  4LDT B;  3SDL C;  4K7W A;  1KM7 A;  5LXI B;  4A20 A;  2MSE D;  3TIX A;  2J0J A;  4W9L A;  1UGM A;  2C7M B;  2MA9 B;  2DHZ A;  3QAQ A;  4FJV B;  4BFR A;  3OJ4 B;  4EOY A;  1WZ3 A;  2KO3 A;  2D3G A;  4W9F A;  2FCQ A;  3V6E B;  1V86 A;  4BBN C;  3DVN V;  4GSW A;  4B6W A;  1U4A A;  2MRP A;  1EUV B;  2BF8 B;  1UEL A;  2KDB A;  2O6V A;  3ML9 A;  5FR6 A;  1WRD B;  3EFU A;  4F7Z A;  5JHB A;  4PYU A;  3L16 A;  3ZRC A;  4WWN A;  2NR2 A;  2NS5 A;  2DAJ A;  2KDF B;  3KUD B;  4CYE A;  3IVF A;  2DZM A;  3OJ3 A;  2KMC A;  2K25 A;  1WJN A;  3RT3 B;  2HTH A;  2IY1 B;  1GUA B;  2KFK A;  2NBW B;  3UIN B;  2Z59 B;  1WFY A;  4HXD A;  2YVC A;  4ICV A;  3JVZ X;  1WGY A;  2M17 A;  4GOC A;  3A1Q A;  1D3Z A;  1SE9 A;  3QHT A;  4TQ0 A;  2DYB A;  2O2V B;  2ZVO A;  2L0F A;  4MEM A;  2FNJ B;  2KMA A;  3IBE A;  3M63 B;  4FHK A;  3VVW B;  1X1M A;  1WF9 A;  3ZNG C;  4MGI E;  3A9K A;  4WJQ A;  1GC7 A;  3PVL A;  2KWC A;  2XK5 B;  1LQB A;  3ENE A;  4PS3 A;  3HM6 X;  1WMH B;  1S1Q B;  4TKN A;  2J7Q B;  2OOB B;  2GBN A;  2KX0 A;  2JZ3 B;  3UIP B;  2BWF A;  3PLV A;  4URK A;  2LGY A;  4KDL B;  2O6V B;  1UH6 A;  4ANV A;  1V81 A;  5J18 A;  2EMT A;  4X57 B;  4BBN F;  4MGZ E;  3UIO B;  3ALB A;  2LVQ A;  2KC1 A;  4K7S A;  4TV3 A;  2M8S A;  4WWO A;  4ZYN A;  2JZZ A;  1GJZ A;  3DBR I;  4NJ7 A;  5D94 A;  3ZTD A;  2KJH B;  2ZNV B;  1LFD A;  2KZR A;  3JYU A;  4WJP A;  4AJW A;  5C23 A;  1VD2 A;  4KIK B;  2ZNV C;  5LXH A;  4WQO B;  2LVP A;  3R3M A;  4GDL B;  5E6P A;  2UYZ B;  2W9N A;  1V80 A;  3QJZ A;  1RLF A;  3C0R B;  4JQW C;  3PLU A;  3H9D A;  4FJY A;  4IM2 A;  5LLI A;  3R7R A;  2BYE A;  4I6L B;  1I35 A;  3GOE A;  1A5R A;  2LXA A;  3DCG A;  4JIO U;  4LCD E;  3WAO A;  1L2N A;  3APC A;  4K7U A;  1OEY A;  3A9J A;  4HVB A;  1E8X A;  2DYO A;  1HE8 A;  2KK8 A;  3UF8 A;  4FLH A;  4OVU A;  2JPH A;  2WX1 A;  4BVU C;  3RUI B;  4IWP A;  2K8C A;  3GZN I;  3D32 A;  2FIF A;  2LWP A;  3T8M A;  2IYD B;  3L13 A;  4RMA A;  3WA0 A;  1V5O A;  3KW5 B;  4TQ1 A;  2KJ6 A;  2REX A;  1WGR A;  3H7S A;  1KJT A;  2MWS B;  5DCN A;  3ZW3 A;  3CMM B;  2NPT A;  2DZK A;  2O6V D;  3LJ3 A;  2ZCB A;  4MJS B;  1J8C A;  1S3S G;  1WGG A;  3ZTC A;  4I6N B;  3QQ8 B;  4KSK C;  1Z2M A;  3MTN B;  3OAW A;  1WI0 A;  2DYM A;  1XT9 B;  4OVV A;  5E6O A;  2BKF A;  2WYQ A;  4GB9 A;  3AU5 A;  4AUQ C;  2WDT B;  3VUY A;  4HDO A;  1NBF C;  2KTR A;  5D6J B;  1WE6 A;  5CHW A;  4W9H A;  3L0W B;  4MDK E;  1RFA A;  5AZG A;  3WAN A;  4DHZ E;  1V49 A;  4IW0 A;  1IPG A;  4WWP A;  4DBG A;  3DVG X;  1R4N I;  2V3S A;  3APD A;  2LRW A;  3VXW A;  2BGF A;  3R66 C;  2CHX A;  4CO7 A;  1AAR A;  3U8Z A;  4AP4 C;  2FCM A;  1V2Y A;  3VTU A;  5HKH A;  1YX5 B;  1WXA A;  1E7U A;  3KUC B;  3VDZ A;  3S2A A;  3V60 A;  1TBE A;  1V9J A;  3VTW A;  2O2V A;  3AU4 A;  4MH0 E;  3ZVV A;  1WJU A;  2DEN B;  1OQY A;  2LI5 A;  3X23 A;  3ZRF A;  2AL6 A;  2JUO A;  3WIM A;  3BY4 B;  2N7D A;  2XK5 A;  2FID A;  1WXV A;  1WMH A;  2GBJ A;  4HPL B;  1SIF A;  4BOZ B;  3UQA A;  2KTR B;  2BYF A;  2AYO B;  2RD0 A;  4G11 A;  1M94 A;  3L10 B;  5AZF A;  4HLE A;  4M0W B;  5G55 A;  2M0X A;  3NZU A;  2MBQ A;  2L05 A;  4WJO A;  2QHO A;  2NCN A;  3AI5 A;  3M95 A;  3QAR A;  3NY5 A;  4FN2 A;  2JVC A;  2Z0D B;  1YX6 B;  3Q3J A;  4GU2 A;  2FAZ A;  1YD8 U;  1EF1 A;  4II2 B;  3I3T B;  2I1J A;  4DWF A;  3ZDM C;  4G50 A;  4K81 A;  2MBH A;  1WH3 A;  2N1W A;  2V1Y A;  2L7R A;  4RM9 A;  3CSF A;  4EEW A;  4FAD A;  1T0Y A;  2CKH B;  1WX7 A;  4DHJ D;  4KIK A;  1OEY J;  3PRM B;  1H8C A;  2PEA A;  4NAW B;  2J0K A;  3KYC D;  1WGD A;  4ZRK A;  2GMI C;  4GDL A;  1Q0W B;  3VUW A;  5JZE B;  4KVG B;  2C7N B;  4PYZ A;  4AJY B;  3X0W A;  1OTR B;  2GOW A;  1XQQ A;  3AUL A;  2MBE A;  3W1Y A;  2KC2 A;  3RZF A;  3MJW A;  2WX0 A;  4ZDV A;  2JRI B;  2CS4 A;  5J17 A;  2AL3 A;  4DXA B;  4E74 A;  1BT0 A;  1WGH A;  4DHZ B;  2B3A A;  3VQI A;  2R2Q A;  1NDD A;  2WWZ A;  2HD5 B;  3QIJ A;  3VH3 B;  1E8Y A;  2D2Q A;  4W9D A;  2LGD A;  3H7P B;  4LDT D;  4GIV A;  4A3O A;  3IFW B;  5CTR C;  2JRH A;  4TUU A;  1WR1 A;  2D07 B;  3B1L X;  3K9O B;  4HCN B;  1WZ0 A;  3HIZ A;  3PPA A;  4W9C A;  1WR6 E;  3V62 A;  3RUL A;  1SGH A;  4ASW C;  3R7Q A;  2MLB A;  4B9K A;  2NVU I;  2KLC A;  2CR5 A;  3KH0 A;  3H6N A;  4EZL A;  3L54 A;  1RAX A;  4NPN A;  4B95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...