3UIOB

Complex between human rangap1-sumo2, ubc9 and the ir1 domain from ranbp2 containing ir2 motif ii
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
79
structure length
79
Chain Sequence
b'NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-conjugating enzyme UBC9
publication title Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/isomerase/protein binding
total genus 15
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2011-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3uioB00
2W9NA 5AZHA 2KMAA 3QX1A 4JGHB 4ANUA 3UQBA 1UELA 2NCNA 3ZDTA 1WM3A 3HK0A 2MCNB 1XQQA 1R4MI 1RRBA 4ASWC 1WY8A 3V61A 5D2MB 5E6PA 5DPRA 4M0WB 3DDCB 2MBBB 4FHJA 3B0AA 4F1SA 4GN1A 5GMVA 1GC6A 4KDLB 2LGXA 1S3SG 2Z0EB 2GBJA 5J17A 1WE7A 3B1LX 5DPTA 3APDA 2XK5B 3L10B 3SU8X 5L83A 4ICUA 2MP2A 3DVNU 4EZLA 1J8CA 1WM2A 1C1YB 4FA6A 1WXVA 4FHKA 2JPHA 2WDTB 3A9KA 3M3JA 3ZUNA 3QWZB 3PVLA 3S2AA 4ZRJA 2KC2A 5TR5A 3TMPB 4TKNA 3ZVVA 1WMHB 4ZDVA 2K8HA 4JQWC 5EDSA 3MTNB 3ZLZA 2KTFA 2BKRB 4HVBA 1EUVB 5CX3A 2BWFA 2CHZA 2A5UA 3PREA 3PLUA 4P7IA 4TV3A 4TUUA 2LZ6A 4II3B 1SE9A 5KHOA 2K8BA 1WXMA 4IM2A 4GDKB 4XX5A 3OAWA 4HCPB 3VUYA 4DBGA 2WX0A 3RD2A 3B08A 2KO3A 2J0KA 2OJRA 4XC2A 1WYWB 4TQ1A 1EF5A 1OEYJ 1WXAA 2KD0A 1IPGA 2KKCA 3ZDMC 2MLBA 2GBKA 2DYMA 1ZKHA 3V60A 1UZXB 3DBHI 3HIZA 2FIDA 3QIJA 1LM8B 4HWIB 3X23A 1EF1A 2KWCA 4AJYB 3ZW3A 4WQOB 3DBLI 3A1QA 1KLVA 3APFA 4DHZB 4IUMB 4BBNF 1WZ0A 3L54A 3PTFC 2KC1A 3VDZA 4WJPA 1QZEA 1M94A 2KJHB 4DDGD 2GBRA 4KVGB 3ALBA 2NPTB 3Q3JA 3GOEA 3QJZA 2LGDA 2RR9A 4NQLB 4X57B 2JWZA 3A9JB 3KW5B 3NOBA 2DZIA 3PZDA 3M62B 3A4SC 3V6CB 5L95C 4GGQA 4RM8A 2N9XA 2KOXA 4JLCA 1K8RB 3DVGX 2D3GA 1WJNA 2KANA 5JH5C 2KDIA 3N30A 4LCDE 5DPWA 3BY4B 2JT4B 1T0YA 4W9DA 2ZCBA 1P1AA 2VRRB 3PHXB 2KN5A 2LWPA 4RM9A 4KV2A 1L2NA 2LVPA 1GC7A 4IWPA 3R7QA 3RZFA 1Z5SB 1WI0A 4XZ4A 3ZTDA 3L08A 1YJ1A 4M8NA 4KSKC 1V86A 3TCAA 3KYCD 2KFKA 4IM0A 3NHEB 1Q0WB 3IBEA 4ANWA 2KHWB 1I35A 3NZUA 4GU2A 4FJZA 1J19A 4ANVA 2BYFA 4LJPB 1WH3A 2K1FA 1LQBA 2B3AA 2WX1A 1FXTB 4K1RB 2JUOA 2Y5BB 3ZNZB 2FUHB 2L7RA 1UH6A 4FN2A 3R66C 4B95A 4G0NB 3JVZX 4BKGA 3SD5A 2O2VA 2N4FA 4I6PA 5CHFA 3VH4B 4W9JA 2KVRA 4MJSA 3QAQA 3QQ8B 1R4NI 2MP2B 4MM3A 1V81A 4WJQA 2KXJA 2CHXA 2L76A 2C7NB 4PS3A 3CF6E 2KDBA 2JF5A 3QARA 3VUXA 2HD5B 4ZRKA 4EOYA 2KLCA 3UIPB 4A20A 2O6VD 3WAOA 3ZO5B 2KJRA 2KZRA 3HM3A 1WE6A 4DHJB 4NQKE 4G11A 4PS7A 2M0XA 1TTNA 2LD9A 3RUIB 1E90A 4EEWA 2DAJA 3UIOB 3LDZE 3AULA 1WGDA 3L0WB 2LXCA 2RGFA 3CSTA 1ISNA 2QHOA 2N9PC 1WXSA 2DAFA 3UINB 4EZKA 2IY0B 2J0MA 3NZSA 2GOWA 2YVCA 4ANXA 2PJHA 4ZYNA 1WFYA 3AU5A 3JW0X 2O6VA 5BO4B 3EFUA 2MA9B 3APCA 2KMCA 2ZVOA 2FCNA 1X1MA 3P2BA 3R7RA 4URKA 2L8JA 2KWVB 2N7DA 2EMTA 3TL5A 2G45B 3UGBB 4K7WA 3VH3B 2KTRA 4F8CB 1E7UA 1BT0A 2LXAA 2M1MA 2PPHA 3H7PB 3V62A 2K8CA 3WIMA 1OTRB 1Q1OA 2JVCA 2KDEB 4GB9A 1GG3A 5D7GA 2JZ3B 3A1QB 2J7QB 3SHQA 5JHAA 3DVNV 2KLGA 3ENEA 3IVFA 2DX5B 3IG3A 5E6OA 4IC7B 3KYDD 2IY1B 4HJKA 3ZIMA 2PEAA 4EKUA 1GNUA 3K9OB 4HDOA 4IM3A 3Q3FA 3L13A 3MJWA 2V3SA 2V1YA 4FJVB 2MW5A 1P0RA 2AWTA 3ZNID 4WWNA 1V9JA 4GSWA 2IYDB 3IFWB 4FBJB 4RMAA 4W9CA 2G4DB 1XD3B 2G4SA 3WANA 3LJ3A 2BF8B 5DCNA 4G50A 3A33B 5J2RA 1LXDA 3ZRFA 4IW0A 4MSMB 2MWSB 1E8ZA 3VAWA 4A3PA 2BYEA 5LXHA 3PS6A 3ZTCA 2KFKB 5CTRC 2KX0A 1UBQA 3JSVB 3DPDA 2L00B 3EC8A 3U8ZA 2WYQA 1RFAA 3D32A 1E8YA 1WMHA 2KFJA 1SIFA 2JXXA 2KQSA 2NBWB 2C5LC 4K7UA 1ZGUB 2V4LA 1WGYA 1KOTA 4DK5A 5AZFA 3CSFA 3PRPB 4GDLB 2KQ7A 3DBRI 3UQAA 1RLFA 1OGWA 2MBQA 1E8WA 3ML9A 1WX9A 4NY0A 2N1WA 4I6NB 3T9LA 3QC8B 4WJOA 2LI5A 3PV1A 1ZW7A 4MELA 1WR1A 2N1VA 4EFOA 2NS5A 1KM7A 2AL3A 2UYZB 2XBBC 1WJUA 4JIOU 4W9LA 3VTUA 3X0WA 5JHBA 4MJSB 3ZRCA 1C3TA 1WGRA 2FIFA 2DHZA 5D6JB 4IWQA 4NJ7A 2GMIC 2Z59B 2NVUI 1YQBA 2FCMA 2L0FA 2ZNVB 4G3XB 3K9PB 2K39A 2R2QA 4MSQB 4PS8A 4EZJA 3W1SC 4HDQA 3L17A 2HJ8A 1LFDA 2BYVE 3H1UA 1S1QB 1U4AA 3DVGY 4W9EA 4AUQC 3JYUA 4DXAB 3PRZA 4IG7B 3HM6X 4DDID 4MDKE 3IHPC 4KSLC 1JRUA 5G2NA 4B9KA 4GMVA 1NBFC 2L3ZA 4NNJB 4AOFA 2AL6A 3C0RB 3A4RA 2RSUA 4GOCA 1V5OA 1P9DU 4HPLB 2ZZPB 3GZNI 2NPTA 3TBLD 2CHWA 4FLHA 2DZMA 4NPNA 4FJYA 3SDLC 4NAWA 1WF9A 3A9JA 3A9KB 1H8CA 5FR6A 2LASA 2OOBB 1NDDA 4DWFA 1XT9B 2IZVB 5D94A 2JY6A 2K25A 1KJTA 3WAMA 1P3QU 2LRUA 4E3CA 2WWZA 3ZNGC 2LRWA 2IBIB 2KTRB 4M8MA 1TZ1A 3OLMD 2JRIB 3CMMB 2L05A 3ONSA 1SGHA 2I1KA 2ZVNA 2ZPYA 4FULA 4YL8A 1OQYA 4BKSD 4OVUA 4FADA 1J0GA 2G3QB 3QCAA 2EMSA 4A3OA 1I42A 3VUWA 3H9DA 2BKFA 4K7SA 4LDTB 4BVUC 3QHTA 1Q5WB 2D10A 2ZNVC 3DCGA 3N32A 4BBNC 3H7SA 4LJOB 1A5RA 4WWOA 2ZJDA 2MBOA 3OJ3A 2ZCCA 2EKEC 4EUTA 1MG8A 1PQSA 2DZJA 3ZNHB 5DPSA 3PT2B 4KIKA 4GXBA 2IO2B 3DOWA 4E74A 2BWES 2KDFB 3NY5A 4W9HA 2N7EA 2DENB 3WALA 1V6EA 4BKSA 1UGMA 2M8SA 1H4RA 1V2YA 1OEYA 1VCBA 1WJ6A 1NI2A 1Z2MA 3KVFB 3EHVA 2L0TA 4MGIE 4NJ6A 5CHVC 4DHJD 3BINA 2M17A 4HCNB 3VXWA 3RZWC 2LVOA 3RCZA 4CYEA 4PYUA 1WIAA 4CO7A 2GBNA 3MHSD 2UWQA 4LDTD 4KZCA 3ML8A 1TBEA 2IO1B 4WAAA 1YD8U 2NBVB 3O65B 3TIXA 2MQJA 4E71A 3DQVA 4AJWA 1AARA 1E5WA 4ICVA 1GUAB 3PHWB 3T8MA 2JRHA 4AP4C 4HLEA 4J6IA 1GJZA 3UF8A 2NBUA 2FCSA 2AYOB 3ECIA 1IP9A 3AI5A 4W9KA 2KNBA 5J18A 2J0JA 2MSED 2FCQA 4W9FA 1L7YA 4BFRA 1Y8RC 2CR5A 4ZRIA 3DBSA 2XK5A 3VFKA 1G6JA 3RULA 1RAXA 2LJ5A 3PSEB 5JZEB 3PPAA 1HE8A 3L16A 2PE9A 2N9EB 4N9F4 2K6QA 2YLMA 3TJPA 2XEWA 5LLIA 2K6DB 3RYTA 4MEMA 1WX8A 2MBEA 4CHKA 2AEHA 2C9WB 2R2OA 4II2B 2LGYA 3AU4A 4W9GA 3KUZA 1WX7A 2I1JA 4KDIC 4OVVA 2A4ZA 5E6NA 2D07B 4IWOA 1V49A 1YX6B 2DYBA 2HE7A 3KUCB 4MGZE 3H7PA 1WRDB 3U7DA 2C60A 4HXDA 2D2QA 4MGYE 2MBHA 3OJ4B 3W1YA 2KWUB 2PE6B 5AZGA 2O2VB 1YIWA 2ZPNA 4GDKA 2DZKA 1YX5B 2ASQA 1EO6A 2FNJB 2IO0B 3N3KB 5C1ZA 1F9JA 3V6EB 5KHQA 3KH0A 4HK2A 2RPQA 4MH0E 3KUDB 4NAWB 3PRMB 1P98A 2JZZA 5HKHA 2CKHB 1VD2A 2CS4A 5IAAC 3W1SA 2GBMA 2BPSA 3QA8A 4GIVA 4BOSC 1IYFA 1TGZB 2D11A 5IA7A 3PLVA 5CHWA 4PYZA 4B6WA 2KK8A 3WA0A 3VHTC 4TQ0A 1UD7A 3I3TB 4W9IA 4K81A 3H6NA 3M63B 1V80A 4DHZE 3WAPA 4WJNA 4MGKE 4I6LB 1D3ZA 2MX2A 3QK0A 1E7VA 5G55A 2RD0A 3RT3B 3U30A 1WGHA 5LXIB 2LUEA 3JSVA 3HHMA 1V5TA 3M95A 4BKTA 3NS8A 2REXA 2O6VB 3VQIA 3EECA 3VVWB 1E8XA 4HPMB 3R3MA 3VTVA 2LVQA 3AXCA 1WR6E 2ZEQA 1WGGA 4GDLA 4KIKB 5AEKB 2CU1A 2IO3B 4BOZB 1WZ3A 2KX3A 5C23A 3ZKJC 1WJ4A 2MRPA 1UBIA 2C7HA 2Z0DB 2C7MB 3VTWA 2FAZA 2M4NA 4WWPA 3PGEA 1CMXB 2BGFA 2DYOA 4AWJA 2HTHA 4KZ0A 4F7ZA 2NR2A 2KJ6A 4JL9A
chains in the Genus database with same CATH superfamily
2W9NA 3HUIA 2ZW0A 3QX1A 1UELA 3BK1A 3HK0A 3SR6A 2WXOA 1XQQA 4HKQA 1WY8A 1KTKA 1YN5A 5E6PA 5DPRA 4M0WB 4WH4A 2AQ1B 4GN1A 2LGXA 1S3SG 1UF0A 1AN8A 1WE7A 2MP2A 4FA6A 3ZUNA 3NS1A 1N6ZA 3TMPB 1PGBA 4TKNA 1WMHB 2BKRB 5CX3A 2BWFA 2A5UA 2WLBA 3AE8B 1EWCA 4TV3A 1SSNA 5LNK1 2LZ6A 1B9RA 1SE9A 2K8BA 4WURA 4DQOC 4P6VF 1C9FA 2QILA 4ZRQA 3Q3NC 3PO0A 1I4HA 4TQ1A 1WXAA 3C8YA 2GBKA 1ZKHA 3BYYB 3HIZA 1SF0A 2FIDA 3QIJA 3FC4A 4YXDB 1FMAD 1C4PA 5C3JB 3ZW3A 2MJDA 4WQOB 3PTFC 1XO3A 3VDZA 1XEEA 1M94A 4TSSA 4L2YA 4KVGB 4M01A 2M56B 3ALBA 2RR9A 4NQLB 3A9JB 1FCLA 3M62B 5L95C 4RM8A 2N9XA 1F2RC 1FFVA 2D3GA 3E56A 5JH5C 2W3SA 2K22A 5DPWA 2ZCBA 1P1AA 3PHXB 5E6JA 1MFWA 2LVPA 3R7QA 3RZFA 2BYTA 2WGSA 1BUIC 3TCAA 2KFKA 3NHEB 1SJHD 3IBEA 2X38A 3NZUA 4GU2A 4FJZA 2BYFA 2Y3AA 2JUOA 2L7RA 4FN2A 3W5UB 3SD5A 2IGGA 2O2VA 2N4FA 5CHFA 2WHIA 4W9JA 4MJSA 3QQ8B 3SEBA 2MP2B 5HI1A 2KXJA 2L76A 2EELA 2C7NB 4PS3A 2KDBA 4EOYA 4A20A 2KJRA 2KDMA 3LB8C 1E90A 2DAJA 4ARIA 1WGDA 2LXCA 2RGFA 2QHOA 2N9PC 3UINB 4EZKA 4ZYNA 1CJEA 1WFYA 2GI9A 2O6VA 3EFUA 1D5XC 2WDRB 3APCA 1FEHA 3LXFA 1WWTA 2FCNA 3P2BA 3R7RA 4JPSA 1GPXA 2EMTA 4F8CB 2KTRA 1BT0A 1ZDXA 2PPHA 1J7AA 4M02A 2KDEB 1GG3A 2JZ3B 3SHQA 5JHAA 4BZAA 2BT6A 2KLGA 3IVFA 4HJKA 1VLBA 2K9XA 3GE8C 3K9OB 4HDOA 3O13A 3L13A 3MJWA 2V3SA 4RGOS 2MW5A 4LTUA 4LLGM 2J53A 3IFWB 4FBJB 1XD3B 1OFFA 5DCNA 3VAWA 5LXHA 2JYTA 3PS6A 2KFKB 2L00B 3EC8A 4K7UA 2KFJA 2KQSA 4DK5A 3IT4B 3Q8AA 1L0VB 3CSFA 2KQ7A 2N7JA 3UQAA 2BW2A 2KT7A 3DHGC 1XLQA 2UYZB 4JIOU 2D3BA 1WJUA 5JHBA 4MJSB 3ZRCA 1WGRA 2FIFA 2DHZA 4RF0A 2BB6A 2NVUI 1YQBA 2FCMA 2L0FA 1JWBD 3L4PA 1TKGA 3PZ8A 2K39A 4S17A 2WU2B 1V97A 1WYGA 4W9EA 4DXAB 3PRZA 1F2RI 4IG7B 3TEYA 2LFIA 2N0SB 3HM6X 1HTOA 2IPKD 1UWMA 2J52A 4MDKE 4B9KA 4GMVA 1NBFC 1TT5B 2AL6A 3C0RB 4C7ZA 4GOCA 3I63C 1P9DU 2CHWA 3SDLC 3AH7A 5FR6A 2OOBB 1ZP0B 1ZPSA 4OZBA 1WXQA 5D94A 3DBHB 4HROA 3WAMA 4LNIA 4YSYB 3ZNGC 4E3CA 2LRWA 5IO9A 2KTRB 1TZ1A 3ONSA 2L05A 1SGHA 2ZVNA 2L52A 2ZPYA 3DBLB 1E0ZA 3SFDB 3QCAA 3H9DA 2BKFA 4LDTB 4BVUC 4RCOA 3H7SA 3HVDA 2WXMA 4EUTA 1PQSA 2DZJA 1T5XD 1D4BA 4GXBA 4WWMA 3NY5A 1VZ6A 1SIJA 4BKSA 3BK2A 2M8SA 1H4RA 1OEYA 4AJWA 3UQBA 4XDDA 4NJ6A 5CHVC 2L0TA 3NUHB 1P7EA 1SBBB 2M17A 3Q8FA 3VXWA 3RCZA 4PYUA 2GBNA 3BVMA 1MHXA 1MPEA 2UWQA 3ML8A 3DQVA 1JCKB 3MC0B 3T8MA 3PHWB 4AP4C 1C76A 2CJNA 1GJZA 1F77A 2AYOB 2YEPB 4NZLB 1NI3A 2KNBA 2J0JA 4KGSA 2Y5PA 1FO4A 1ZUD2 2CU3A 2PVOD 4ZRIA 1E10A 2KQ4X 2XK5A 2SAKA 5JZEB 1HE8A 4HRSA 3TJPA 3GS2A 3RYTA 4MEMA 2AEHA 3VR9B 1V49A 1A70A 3H7PA 1NVID 1WRDB 3V05A 3NG0A 3V3XA 3AMZA 3W2DA 4GDKA 2FNJB 2IO0B 5C1ZA 2I2YA 1F9JA 1WSPA 1IBXA 3RN9C 3PRMB 3NVVA 1VD2A 2CS4A 1ROEA 1IYFA 4OHJA 2MHJA 2KK8A 1UD7A 4W9IA 1C78A 3H6NA 4KX6B 4DHZE 1L0XB 4MGKE 2MX2A 1E7VA 3RT3B 3DWGC 3U30A 1WGHA 3DHIC 1VDVA 3RNBC 4HPMB 3R3MA 3VTVA 1QILA 3AXCA 3U4EG 1WGGA 4GDLA 2CU1A 2DLBA 4LNFA 3IAM1 5C23A 3ZKJC 2Z0DB 1MG4A 3AEEB 1RFKA 1CMXB 2INDC 4RGMA 4KZ0A 4JL9A 4JGHB 2NCNA 3ZDTA 1WM3A 3V61A 1F0ZA 1D5MC 4OZAA 2H88B 4F1SA 1SE4A 1CK1A 2Z0EB 5J17A 3B1LX 5DPTA 4US8A 2XK5B 3L10B 3SU8X 2OJWA 1GB1A 2WXKA 1N63A 4FHKA 2JPHA 3A9KA 3M3JA 1EWYC 3PVLA 3Q8CA 4P1CC 3AECB 5EDSA 1EUVB 1TJEA 3Q3MC 4A55A 1OQRA 3PREA 1Y56A 4P7IA 2PTLA 4KKIA 4IM2A 1IGDA 4GDKB 4HCPB 1IBXB 4DBGA 2QC8A 3VR8B 2J0KA 3P63A 2QMTA 3FAHA 1EF5A 2KD0A 1ZOYB 1IPGA 2KKCA 1YOVB 3AEAB 1DYQA 3ZDMC 2MLBA 3V60A 3NZ3A 4HWIB 1EF1A 3BVZA 2KWDA 3APFA 3L54A 3Q8EA 3AE3B 2KJHB 2GBRA 1ENFA 1E6EB 3N9YC 2NPTB 1T0QC 4H2AA 3KW5B 3PZDA 4GGQA 1DOXA 2BS2B 5GXGB 3N1XC 2RDBC 4LNKA 2KANA 1T0YA 2JT4B 5T8IA 2SEBD 2VRRB 2KN5A 1L2NA 4IWPA 4LNOA 1Z5SB 4XZ4A 4M8NA 4KSKC 3KYCD 1Q0WB 4ANWA 2LGSA 3P4SB 1BMLC 2J4XA 5D3DA 2E3TA 1TS3A 1WH3A 2K1FA 1LQBA 2B3AA 2WX1A 2X8XX 4C4VA 1PYWD 3R8BA 1QOFA 1STEA 3AN1A 2FUHB 1UH6A 3ZXVA 4B95A 3IT6B 3VH4B 2WXGA 3UI3A 3QAQA 1R4NI 4MM3A 4WJQA 4XGAB 4KGRA 2BTEA 4CQNA 3AV8A 2JF5A 3VUXA 4ZYSA 4ZRKA 3URYA 2O6VD 1TZOA 1ET9A 3HM3A 2W82A 4P16A 4NQKE 4G11A 2M0XA 1TTNA 4JWSC 3LDZE 2LJIA 3AULA 3CSTA 2IY0B 2GOWA 3AU5A 3JW0X 1I7HA 2DWQA 2MA9B 1X1MA 1E9MA 2GB1A 2L8JA 2N7DA 1FIQA 4ZHPA 1E7UA 2LXAA 3V62A 1QLBB 1OTRB 3FKYA 5D7GA 1UGJA 1N5WA 2FBWB 3RPFC 3ENEA 3IG3A 5E6OA 4IC7B 1T0RC 1DOIA 2PEAA 1GNUA 2WP9B 4ZOHC 4IM3A 1FNWA 2V1YA 4FJVB 1QOBA 3RNCC 1UUPA 2AWTA 5G5GA 3ZNID 2IYDB 4RMAA 4W9CA 5HG2A 3WANA 3A33B 4IKGA 3TEWA 2R61A 4A3PA 2BYEA 1TS4A 5CTRC 2KX0A 2PW9A 3JSVB 3DPDA 4JX1C 3D32A 1RFAA 1HXYD 1E8YA 2JXXA 5G5HA 2J42A 1WGYA 4C4VB 1NYRA 3DBRI 2MBQA 2LI5A 3PV1A 4B0MA 3MHZA 4EFOA 2NS5A 1KM7A 1JALA 1PGAA 2XBBC 4W9LA 3X0WA 1C3TA 3TEXA 4MM3B 4RGNA 2ZNVB 4G3XB 5BMIA 2HJ1A 2VZKD 4PS8A 3L17A 1JMLA 2HJ8A 1LFDA 2BYVE 4DXGA 1S1QB 4EE2A 1ZXHA 3GB1A 2CJOA 1IGCA 1YQ3B 2L3ZA 2INCC 2IGDA 1V5OA 4HPLB 2ZZPB 3GZNI 3TBLD 4NPNA 4FJYA 4NAWA 1H8CA 2JZPA 1FD6A 1XT9B 5EE0A 2JY6A 2K25A 1KJTA 4J3OD 4PT5A 3I5JC 1TIFA 3GE3C 4M8MA 1B1ZA 2I1KA 4YL8A 2BS3B 4BKSD 1J0GA 4OVUA 2G3QB 2EMSA 1I42A 3B9JA 4USAA 1Q5WB 4LJOB 1I4PA 4WWOA 4D2KA 2ZJDA 2ZCCA 4A90A 2LMCA 1MG8A 1FXIA 3J9CA 3ZNHB 1V1PA 3BWUD 2IO2B 4E74A 2BWES 3WALA 2GLSA 5MPOA 1TY2A 1KRHA 1VCBA 5EE1A 3RNGC 4ZHOA 2KMMA 3RZWC 1JRPA 4CO7A 4WAAA 1TBEA 2WDVB 1YD8U 3O65B 2MQJA 1MHHE 2DBYA 4HLEA 3UF8A 5HFYA 3ECIA 4W9KA 4C80A 1HA5A 1L7YA 4BFRA 3RULA 4HKZE 3PSEB 4LK0M 2WXIA 2YLMA 5H8YE 1FRDA 3E9SA 5IOIA 4CHKA 2C9WB 2R2OA 2TSSA 4W9GA 2IJ0A 2I1JA 5E6NA 4RNAA 1SE2A 4KGTA 2DYBA 2HE7A 1ET6A 2ICIA 2C60A 1DGJA 4YWGG 3W1YA 2KWUB 2PE6B 2O2VB 3RNFC 4YTPB 2DZKA 3AE9B 3N20C 3N3KB 2DNFA 2PIAA 2RPQA 1VZ7A 4NAWB 1P98A 1PGXA 2CKHB 3U7ZA 1T3QA 2GBMA 2WS3B 2JQRB 4BOSC 5IA7A 5H92C 4PYZA 4B6WA 3WA0A 1N62A 3VHTC 3B2GA 3DWMA 3WAPA 2WNMA 1P7FA 1GAQB 4C00A 2BVCA 5LXIB 3R2TA 1V5TA 3M95A 4BKTA 4P1BC 2O6VB 3EECA 2KAJA 3FILA 2LVQA 3ZJVA 2ZEQA 1V1PB 2WDQB 1WZ3A 1YQ4B 2LUMA 4XYCA 3NRZA 3ZJTA 1V8CA 2DYOA 4AWJA 4F7ZA 2NR2A 2WXFA 3HRDD 2KMAA 4ANUA 4C56C 2HTME 3EUB2 1R4MI 5D2MB 2MBBB 3B0AA 5GMVA 1GC6A 4XE0A 1FM0D 1D6EC 3APDA 5L83A 3LYYA 4ICUA 4EZLA 3DVNU 3MJ5A 1WM2A 1C1YB 1UNSA 1N60A 2WDTB 1QKZA 3QWZB 4NAMA 4L23A 4ZDVA 2K8HA 2KTFA 4HVBA 2CHZA 3PLUA 1SXTA 1AW7A 4II3B 5KHOA 1WXMA 4XX5A 2JX5A 2WX0A 2H89B 3P42A 2KO3A 2OJRA 4XC2A 4YT0B 1WYWB 3AM9A 3W5VB 2DYMA 3Q14C 3Q2AC 4MH8A 4HPPA 1LM8B 3NVWA 5BYQA 1MI0A 3X23A 5IKCM 3HVZA 4AJYB 3A1QA 1TYGB 2I38A 2BQQA 4BBNF 1WZ0A 5FKAC 4DDGD 1QZEA 2G1EA 2VZKB 2V9HA 3AE6B 3GOEA 1OQQA 2MJEA 3QJZA 1QOAA 4X57B 1K50A 2JWZA 3VRBB 1TS5A 2LGIA 2DZIA 3FILB 3NOBA 3A4SC 3V6CB 2KOXA 4JLCA 1K8RB 3DVGX 1WJNA 3RNEC 3BZDB 3KWLA 1LGRA 4S0RA 3N30A 4LCDE 1YMHE 4RM9A 1FNUA 4KV2A 2AQ2B 4ZRPA 1GC7A 4A6QA 1IUEA 1FPYA 1YJ1A 1V86A 1FCCC 4IM0A 3RFZB 2KHWB 1J19A 4ANVA 1RYJA 1D5ZC 3R66C 4WIPA 4I6PA 3CF6E 3UIPB 1TY0A 3ZO5B 2MJ3A 3AE5B 4PS7A 1RM6C 1WXSA 2DAFA 5AUKA 3NZSA 4ANXA 1E7PB 5BO4B 3W9CB 2QSDA 2KMCA 2ZVOA 3C19A 1HZ5A 4TMAB 4URKA 3KWVA 3TL5A 2KWVB 2G45B 5I4DA 3H7PB 2K8CA 3WIMA 3EGRA 4GB9A 1I4QA 3GP7A 3A1QB 2J7QB 1SEBD 1J7CA 3DVNV 1QF6A 1PFDA 2DX5B 3KYDD 1C79A 2RDHA 3ZIMA 4EKUA 4MACA 2N9LA 2INNE 3H8HA 4RFBA 4GSWA 1ESFA 3LJ3A 2BF8B 4G50A 2BBCA 3OWEB 5J2RA 1BXTA 3ZRFA 4IW0A 4MSMB 3SFEB 2MWSB 2KVZA 2Y5CA 4JWUC 4ARCA 4FXCA 1SB3C 1DOYA 3U8ZA 1WMHA 5JXVA 2C5LC 4JE3B 2E6XA 3PRPB 4GDLB 2BS4B 4YSZB 2JSVX 1E8WA 1WX9A 4NY0A 2N1WA 4I6NB 3T9LA 3QC8B 1RWSA 4WJOA 4MELA 4AQ7A 2N1VA 2AL3A 5D6JB 4IWQA 2WXLA 5BMHA 4NJ7A 2GMIC 4OZCA 3K9PB 1NYQA 1ZDVA 4MSQB 4EZJA 3W1SC 2WXRA 3B2FA 3VRAB 4QAYA 3BVGA 2OEDA 4M00A 1J7BA 3CWIA 3IHPC 2V3NA 2D3AA 4NNJB 1FFUA 1YNTE 2DZMA 1TKYA 1WF9A 1L4DB 3A9JA 3A9KB 2LASA 2WU5B 5EE3A 1QQRA 3AE7B 1C77A 1EU4A 1N61A 2LRUA 3ABVB 3OLMD 4R3DA 3CMMB 3IXSA 4FULA 3ZYYX 1N5XA 4K7SA 3QHTA 2D10A 1A5RA 3N32A 4A8XC 3TSSA 3WCQA 1QOGA 2NTSA 2YEPF 4YTMB 2KDFB 3MC9A 2N7EA 2DENB 1UGMA 2LEKA 2QIEB 3KVFB 1Z2MA 1NI2A 4DHJD 1NEKB 3BINA 4HCNB 1LO5D 1WRIA 2LVOA 4CYEA 1WIAA 3R2IA 3P4PB 1GOZA 4LDTD 2NBVB 3TIXA 2RMMA 4E71A 1AARA 4ICVA 1GUAB 2JRHA 4J6IA 2M19A 1C4AA 1IP9A 3AI5A 4L1BA 2HDEA 4O1NA 5J18A 2JU6X 2L32A 2ACZB 2FCQA 4W9FA 2WXQA 1Y8RC 3VFKA 2LJ5A 1R4NB 4C7YA 2PE9A 4N9F4 2K6QA 1JWAD 4GLSC 3EA6A 5LLIA 2K6DB 2EKIA 2PMVA 4II2B 2LGYA 3AU4A 3KUZA 1WX7A 4KDIC 4OVVA 2D07B 4IWOA 1YX6B 2L1AA 3KUCB 4MGZE 3U7DA 4HXDA 1VR9A 2MBHA 3U2SC 5IN7A 2Q5WD 3I57A 1JWMD 5AZGA 5BMGA 1EO6A 2KN4A 2BB5A 5KHQA 4HK2A 4MH0E 3T3NA 2JZZA 5HKHA 4DXFA 3W1SA 1XCTL 2BPSA 4GIVA 4PK1A 3PLVA 3Q3OC 4XWWA 4K81A 3M63B 2QEJC 1V80A 4WJNA 4I6LB 1D3ZA 3QK0A 2RD0A 2GRIA 2MEKA 2LUEA 3HHMA 2W3RA 2WXPA 2REXA 3VQIA 2WXNA 3VVWB 1I4GA 2K5PA 4YTNB 4B0EA 4ACFA 2IO3B 4AS1A 2FUG1 1WJ4A 1MVKA 1XLPA 3P1MA 1T6BX 3KLSX 1T0SC 4WWPA 3PGEA 2HTHA 5AZHA 4K3BA 2NTTA 2MCNB 1RRBA 4ASWC 1YN4A 3DBRB 3DDCB 4FHJA 4IDIA 2W54A 4KKJA 4KDLB 3Q8BA 1HTQA 1PDXA 1L5PA 2GBJA 1J8CA 4XDCA 1WXVA 3AEBB 5TSSA 3S2AA 4ZRJA 2KC2A 5TR5A 3MFGA 1K53A 3ZVVA 4JQWC 3MTNB 4RF1A 3ZLZA 1SJED 4TUUA 1MJDA 1CZPA 2WXHA 3ZXRA 1I4XA 3OAWA 3VUYA 1YN3A 3RD2A 3GZNB 3B08A 1HQRD 1AYFA 2XN9C 1OEYJ 1KLUD 1JW9D 1QT9A 1UZXB 3DBHI 4RGTA 3IAS1 2PVGC 1XLOA 1YJIA 2KWCA 1JROA 3DBLI 1KLVA 4DHZB 4IUMB 2KC1A 4WJPA 1ZE3D 1XXGA 3ZGZA 3Q3JA 2LGDA 1FRRA 2QJLA 3P4QB 3AEFB 2KDIA 3BY4B 1XCQL 4W9DA 2LWPA 2AX5A 1EU3A 1L6VA 1WI0A 3ZTDA 3L08A 4WAFA 2D5GA 1JWUD 1I35A 2FE8A 3N1ZC 4LJPB 3AEDB 1FXTB 4K1RB 1FNVA 2Y5BB 3ZNZB 3MP9A 3AB5A 1VJKA 4G0NB 3JVZX 4REZA 4BKGA 2RDGA 2KVRA 3TEZA 3DHHC 1V81A 3OG5A 2CHXA 2B76B 3QARA 1JQ4A 2HD5B 1PUTA 2KLCA 3WAOA 2IDYA 2KZRA 1WE6A 4DHJB 1UWXA 2RPVA 4US9A 3ZJUA 2NMQA 5C2TB 2LD9A 3RUIB 4EEWA 3UIOB 3L0WB 1ISNA 1M4VA 2ON8A 4N59A 3BYTB 2J0MA 4Q2JA 4BAXA 2YVCA 4IOIE 2PJHA 2AQ3B 2WQYB 5BYSA 2INPE 1F52A 2KACA 4OW0A 3AEGB 3UGBB 3VH3B 5FR3A 4K7WA 2M1MA 2V4IB 1Q1OA 1C4CA 2JVCA 4NJCA 1XLNA 3Q69A 5BYRA 1EM7A 2IY1B 4OVZA 3Q3FA 1P0RA 4WWNA 2K3UA 3N1YC 1V9JA 4N6EB 2MH7A 2G4DB 2G4SA 1L0YB 3EFCA 3TUOA 2JYEA 2PLPA 3RMKC 1LXDA 3P4RB 1E8ZA 1JWSD 2QDFA 3NVYA 1HZ6A 3ZTCA 2W55A 1UBQA 2WYQA 1TS2A 2K0PA 1SIFA 2NBWB 2KYWA 3PZ7A 1ZGUB 2V4LA 1KOTA 1R4MB 5AZFA 2VH2A 1ACCA 1RLFA 1OGWA 3ML9A 2WXJA 1ZW7A 1WR1A 3VTUA 2XNAC 4XWTA 4K3CA 2JXTA 2L83A 2Z59B 3AE1B 2R2QA 4LNNA 4HDQA 2V0GA 4N58A 3H1UA 4WQMA 3DVGY 1U4AA 1KLGD 3RNAC 4AUQC 3JYUA 5D3IB 4MT5A 4DDID 1F1HA 4A9AA 4KSLC 1JRUA 4HEA1 5G2NA 3AE2B 4RH6A 1V1OA 4AOFA 3A4RA 2RSUA 2G9HD 2NPTA 1FXAA 4FLHA 3AE4B 1ZXIA 1AWDA 3T3OA 1NDDA 2PKOA 2VH1A 4DWFA 3U52E 2IZVB 3RI7C 3ETRA 1P3QU 3NJTA 2WWZA 2IBIB 2JRIB 4FADA 1OQYA 1SE3A 2V3PA 3Q6BA 3CIRB 4A3OA 3VUWA 5EE9A 2LHDA 2ZNVC 3DCGA 4BBNC 2MBOA 2D3CA 3OJ3A 2EKEC 1KH0A 3I9V1 1KF6B 5DPSA 3PT2B 4KIKA 3DOWA 1KFYB 2ZW1A 4W9HA 2OHFA 1TKEA 1V6EA 5HHDG 2N9KA 1HEZE 1V2YA 1WJ6A 4MGIE 3EHVA 1I4RA 5AUIA 2QCZA 3MHSD 2IO1B 2UU7A 1E5WA 1K51A 2NBUA 2FCSA 4M0WA 2MSED 2CR5A 4HJGE 3DBSA 1G6JA 1RAXA 3PPAA 3L16A 2N9EB 1Q10A 2XEWA 1WX8A 2MBEA 2A4ZA 1XF5L 1VRAB 2D2QA 4MGYE 3OJ4B 2ZPNA 1YIWA 3NVZA 1YX5B 2ASQA 1L6UA 2IGHA 3V6EB 3KH0A 1K52A 2JWUA 1L4ZB 3KUDB 5IAAC 3QA8A 4ITKA 3MC8A 1TGZB 2D11A 5CHWA 4TQ0A 5IP4D 3I3TB 3BIID 1YJJA 5G55A 3JSVA 1R7SA 2M0AA 2Z8LA 3KQ4A 1VZ8A 3NS8A 5FK9C 1E8XA 1WR6E 4KIKB 5AEKB 4BOZB 2KX3A 1WGKA 2MRPA 3ZQ4A 1UBIA 2C7HA 2C7MB 2ONQA 3VTWA 1NENB 2FAZA 1GB4A 2M4NA 1CQVA 2BGFA 4UDUC 2LHEA 2KJ6A 4YSXB 4KZCA
chains in the Genus database with same CATH topology
2W9NA 5AZHA 2KMAA 3QX1A 4JGHB 4ANUA 3UQBA 1UELA 2NCNA 3ZDTA 1WM3A 3HK0A 2MCNB 1XQQA 1R4MI 1RRBA 4ASWC 1WY8A 3V61A 5D2MB 5E6PA 5DPRA 4M0WB 3DDCB 2MBBB 4FHJA 3B0AA 4F1SA 4GN1A 5GMVA 1GC6A 4KDLB 2LGXA 1S3SG 2Z0EB 2GBJA 5J17A 1WE7A 3B1LX 5DPTA 3APDA 2XK5B 3L10B 3SU8X 5L83A 4ICUA 2MP2A 3DVNU 4EZLA 1J8CA 1WM2A 1C1YB 4FA6A 1WXVA 4FHKA 2JPHA 2WDTB 3A9KA 3M3JA 3ZUNA 3QWZB 3PVLA 3S2AA 4ZRJA 2KC2A 5TR5A 3TMPB 4TKNA 3ZVVA 1WMHB 4ZDVA 2K8HA 4JQWC 5EDSA 3MTNB 3ZLZA 2KTFA 2BKRB 4HVBA 1EUVB 5CX3A 2BWFA 2CHZA 2A5UA 3PREA 3PLUA 4P7IA 4TV3A 4TUUA 2LZ6A 4II3B 1SE9A 5KHOA 2K8BA 1WXMA 4IM2A 4GDKB 4XX5A 3OAWA 4HCPB 3VUYA 4DBGA 2WX0A 3RD2A 3B08A 2KO3A 2J0KA 2OJRA 4XC2A 1WYWB 4TQ1A 1EF5A 1OEYJ 1WXAA 2KD0A 1IPGA 2KKCA 3ZDMC 2MLBA 2GBKA 2DYMA 1ZKHA 3V60A 1UZXB 3DBHI 3HIZA 2FIDA 3QIJA 1LM8B 4HWIB 3X23A 1EF1A 2KWCA 4AJYB 3ZW3A 4WQOB 3DBLI 3A1QA 1KLVA 3APFA 4DHZB 4IUMB 4BBNF 1WZ0A 3L54A 3PTFC 2KC1A 3VDZA 4WJPA 1QZEA 1M94A 2KJHB 4DDGD 2GBRA 4KVGB 3ALBA 2NPTB 3Q3JA 3GOEA 3QJZA 2LGDA 2RR9A 4NQLB 4X57B 2JWZA 3A9JB 3KW5B 3NOBA 2DZIA 3PZDA 3M62B 3A4SC 3V6CB 5L95C 4GGQA 4RM8A 2N9XA 2KOXA 4JLCA 1K8RB 3DVGX 2D3GA 1WJNA 2KANA 5JH5C 2KDIA 3N30A 4LCDE 5DPWA 3BY4B 2JT4B 1T0YA 4W9DA 2ZCBA 1P1AA 2VRRB 3PHXB 2KN5A 2LWPA 4RM9A 4KV2A 1L2NA 2LVPA 1GC7A 4IWPA 3R7QA 3RZFA 1Z5SB 1WI0A 4XZ4A 3ZTDA 3L08A 1YJ1A 4M8NA 4KSKC 1V86A 3TCAA 3KYCD 2KFKA 4IM0A 3NHEB 1Q0WB 3IBEA 4ANWA 2KHWB 1I35A 3NZUA 4GU2A 4FJZA 1J19A 4ANVA 2BYFA 4LJPB 1WH3A 2K1FA 1LQBA 2B3AA 2WX1A 1FXTB 4K1RB 2JUOA 2Y5BB 3ZNZB 2FUHB 2L7RA 1UH6A 4FN2A 3R66C 4B95A 4G0NB 3JVZX 4BKGA 3SD5A 2O2VA 2N4FA 4I6PA 5CHFA 3VH4B 4W9JA 2KVRA 4MJSA 3QAQA 3QQ8B 1R4NI 2MP2B 4MM3A 1V81A 4WJQA 2KXJA 2CHXA 2L76A 2C7NB 4PS3A 3CF6E 2KDBA 2JF5A 3QARA 3VUXA 2HD5B 4ZRKA 4EOYA 2KLCA 3UIPB 4A20A 2O6VD 3WAOA 3ZO5B 2KJRA 2KZRA 3HM3A 1WE6A 4DHJB 4NQKE 4G11A 4PS7A 2M0XA 1TTNA 2LD9A 3RUIB 1E90A 4EEWA 2DAJA 3UIOB 3LDZE 3AULA 1WGDA 3L0WB 2LXCA 2RGFA 3CSTA 1ISNA 2QHOA 2N9PC 1WXSA 2DAFA 3UINB 4EZKA 2IY0B 2J0MA 3NZSA 2GOWA 2YVCA 4ANXA 2PJHA 4ZYNA 1WFYA 3AU5A 3JW0X 2O6VA 5BO4B 3EFUA 2MA9B 3APCA 2KMCA 2ZVOA 2FCNA 1X1MA 3P2BA 3R7RA 4URKA 2L8JA 2KWVB 2N7DA 2EMTA 3TL5A 2G45B 3UGBB 4K7WA 3VH3B 2KTRA 4F8CB 1E7UA 1BT0A 2LXAA 2M1MA 2PPHA 3H7PB 3V62A 2K8CA 3WIMA 1OTRB 1Q1OA 2JVCA 2KDEB 4GB9A 1GG3A 5D7GA 2JZ3B 3A1QB 2J7QB 3SHQA 5JHAA 3DVNV 2KLGA 3ENEA 3IVFA 2DX5B 3IG3A 5E6OA 4IC7B 3KYDD 2IY1B 4HJKA 3ZIMA 2PEAA 4EKUA 1GNUA 3K9OB 4HDOA 4IM3A 3Q3FA 3L13A 3MJWA 2V3SA 2V1YA 4FJVB 2MW5A 1P0RA 2AWTA 3ZNID 4WWNA 1V9JA 4GSWA 2IYDB 3IFWB 4FBJB 4RMAA 4W9CA 2G4DB 1XD3B 2G4SA 3WANA 3LJ3A 2BF8B 5DCNA 4G50A 3A33B 5J2RA 1LXDA 3ZRFA 4IW0A 4MSMB 2MWSB 1E8ZA 3VAWA 4A3PA 2BYEA 5LXHA 3PS6A 3ZTCA 2KFKB 5CTRC 2KX0A 1UBQA 3JSVB 3DPDA 2L00B 3EC8A 3U8ZA 2WYQA 1RFAA 3D32A 1E8YA 1WMHA 2KFJA 1SIFA 2JXXA 2KQSA 2NBWB 2C5LC 4K7UA 1ZGUB 2V4LA 1WGYA 1KOTA 4DK5A 5AZFA 3CSFA 3PRPB 4GDLB 2KQ7A 3DBRI 3UQAA 1RLFA 1OGWA 2MBQA 1E8WA 3ML9A 1WX9A 4NY0A 2N1WA 4I6NB 3T9LA 3QC8B 4WJOA 2LI5A 3PV1A 1ZW7A 4MELA 1WR1A 2N1VA 4EFOA 2NS5A 1KM7A 2AL3A 2UYZB 2XBBC 1WJUA 4JIOU 4W9LA 3VTUA 3X0WA 5JHBA 4MJSB 3ZRCA 1C3TA 1WGRA 2FIFA 2DHZA 5D6JB 4IWQA 4NJ7A 2GMIC 2Z59B 2NVUI 1YQBA 2FCMA 2L0FA 2ZNVB 4G3XB 3K9PB 2K39A 2R2QA 4MSQB 4PS8A 4EZJA 3W1SC 4HDQA 3L17A 2HJ8A 1LFDA 2BYVE 3H1UA 1S1QB 1U4AA 3DVGY 4W9EA 4AUQC 3JYUA 4DXAB 3PRZA 4IG7B 3HM6X 4DDID 4MDKE 3IHPC 4KSLC 1JRUA 5G2NA 4B9KA 4GMVA 1NBFC 2L3ZA 4NNJB 4AOFA 2AL6A 3C0RB 3A4RA 2RSUA 4GOCA 1V5OA 1P9DU 4HPLB 2ZZPB 3GZNI 2NPTA 3TBLD 2CHWA 4FLHA 2DZMA 4NPNA 4FJYA 3SDLC 4NAWA 1WF9A 3A9JA 3A9KB 1H8CA 5FR6A 2LASA 2OOBB 1NDDA 4DWFA 1XT9B 2IZVB 5D94A 2JY6A 2K25A 1KJTA 3WAMA 1P3QU 2LRUA 4E3CA 2WWZA 3ZNGC 2LRWA 2IBIB 2KTRB 4M8MA 1TZ1A 3OLMD 2JRIB 3CMMB 2L05A 3ONSA 1SGHA 2I1KA 2ZVNA 2ZPYA 4FULA 4YL8A 1OQYA 4BKSD 4OVUA 4FADA 1J0GA 2G3QB 3QCAA 2EMSA 4A3OA 1I42A 3VUWA 3H9DA 2BKFA 4K7SA 4LDTB 4BVUC 3QHTA 1Q5WB 2D10A 2ZNVC 3DCGA 3N32A 4BBNC 3H7SA 4LJOB 1A5RA 4WWOA 2ZJDA 2MBOA 3OJ3A 2ZCCA 2EKEC 4EUTA 1MG8A 1PQSA 2DZJA 3ZNHB 5DPSA 3PT2B 4KIKA 4GXBA 2IO2B 3DOWA 4E74A 2BWES 2KDFB 3NY5A 4W9HA 2N7EA 2DENB 3WALA 1V6EA 4BKSA 1UGMA 2M8SA 1H4RA 1V2YA 1OEYA 1VCBA 1WJ6A 1NI2A 1Z2MA 3KVFB 3EHVA 2L0TA 4MGIE 4NJ6A 5CHVC 4DHJD 3BINA 2M17A 4HCNB 3VXWA 3RZWC 2LVOA 3RCZA 4CYEA 4PYUA 1WIAA 4CO7A 2GBNA 3MHSD 2UWQA 4LDTD 4KZCA 3ML8A 1TBEA 2IO1B 4WAAA 1YD8U 2NBVB 3O65B 3TIXA 2MQJA 4E71A 3DQVA 4AJWA 1AARA 1E5WA 4ICVA 1GUAB 3PHWB 3T8MA 2JRHA 4AP4C 4HLEA 4J6IA 1GJZA 3UF8A 2NBUA 2FCSA 2AYOB 3ECIA 1IP9A 3AI5A 4W9KA 2KNBA 5J18A 2J0JA 2MSED 2FCQA 4W9FA 1L7YA 4BFRA 1Y8RC 2CR5A 4ZRIA 3DBSA 2XK5A 3VFKA 1G6JA 3RULA 1RAXA 2LJ5A 3PSEB 5JZEB 3PPAA 1HE8A 3L16A 2PE9A 2N9EB 4N9F4 2K6QA 2YLMA 3TJPA 2XEWA 5LLIA 2K6DB 3RYTA 4MEMA 1WX8A 2MBEA 4CHKA 2AEHA 2C9WB 2R2OA 4II2B 2LGYA 3AU4A 4W9GA 3KUZA 1WX7A 2I1JA 4KDIC 4OVVA 2A4ZA 5E6NA 2D07B 4IWOA 1V49A 1YX6B 2DYBA 2HE7A 3KUCB 4MGZE 3H7PA 1WRDB 3U7DA 2C60A 4HXDA 2D2QA 4MGYE 2MBHA 3OJ4B 3W1YA 2KWUB 2PE6B 5AZGA 2O2VB 1YIWA 2ZPNA 4GDKA 2DZKA 1YX5B 2ASQA 1EO6A 2FNJB 2IO0B 3N3KB 5C1ZA 1F9JA 3V6EB 5KHQA 3KH0A 4HK2A 2RPQA 4MH0E 3KUDB 4NAWB 3PRMB 1P98A 2JZZA 5HKHA 2CKHB 1VD2A 2CS4A 5IAAC 3W1SA 2GBMA 2BPSA 3QA8A 4GIVA 4BOSC 1IYFA 1TGZB 2D11A 5IA7A 3PLVA 5CHWA 4PYZA 4B6WA 2KK8A 3WA0A 3VHTC 4TQ0A 1UD7A 3I3TB 4W9IA 4K81A 3H6NA 3M63B 1V80A 4DHZE 3WAPA 4WJNA 4MGKE 4I6LB 1D3ZA 2MX2A 3QK0A 1E7VA 5G55A 2RD0A 3RT3B 3U30A 1WGHA 5LXIB 2LUEA 3JSVA 3HHMA 1V5TA 3M95A 4BKTA 3NS8A 2REXA 2O6VB 3VQIA 3EECA 3VVWB 1E8XA 4HPMB 3R3MA 3VTVA 2LVQA 3AXCA 1WR6E 2ZEQA 1WGGA 4GDLA 4KIKB 5AEKB 2CU1A 2IO3B 4BOZB 1WZ3A 2KX3A 5C23A 3ZKJC 1WJ4A 2MRPA 1UBIA 2C7HA 2Z0DB 2C7MB 3VTWA 2FAZA 2M4NA 4WWPA 3PGEA 1CMXB 2BGFA 2DYOA 4AWJA 2HTHA 4KZ0A 4F7ZA 2NR2A 2KJ6A 4JL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W9N A;  5AZH A;  2KMA A;  3QX1 A;  4JGH B;  4ANU A;  3UQB A;  1UEL A;  2NCN A;  3ZDT A;  1WM3 A;  3HK0 A;  2MCN B;  1XQQ A;  1R4M I;  1RRB A;  4ASW C;  1WY8 A;  3V61 A;  5D2M B;  5E6P A;  5DPR A;  4M0W B;  3DDC B;  2MBB B;  4FHJ A;  3B0A A;  4F1S A;  4GN1 A;  5GMV A;  1GC6 A;  4KDL B;  2LGX A;  1S3S G;  2Z0E B;  2GBJ A;  5J17 A;  1WE7 A;  3B1L X;  5DPT A;  3APD A;  2XK5 B;  3L10 B;  3SU8 X;  5L83 A;  4ICU A;  2MP2 A;  3DVN U;  4EZL A;  1J8C A;  1WM2 A;  1C1Y B;  4FA6 A;  1WXV A;  4FHK A;  2JPH A;  2WDT B;  3A9K A;  3M3J A;  3ZUN A;  3QWZ B;  3PVL A;  3S2A A;  4ZRJ A;  2KC2 A;  5TR5 A;  3TMP B;  4TKN A;  3ZVV A;  1WMH B;  4ZDV A;  2K8H A;  4JQW C;  5EDS A;  3MTN B;  3ZLZ A;  2KTF A;  2BKR B;  4HVB A;  1EUV B;  5CX3 A;  2BWF A;  2CHZ A;  2A5U A;  3PRE A;  3PLU A;  4P7I A;  4TV3 A;  4TUU A;  2LZ6 A;  4II3 B;  1SE9 A;  5KHO A;  2K8B A;  1WXM A;  4IM2 A;  4GDK B;  4XX5 A;  3OAW A;  4HCP B;  3VUY A;  4DBG A;  2WX0 A;  3RD2 A;  3B08 A;  2KO3 A;  2J0K A;  2OJR A;  4XC2 A;  1WYW B;  4TQ1 A;  1EF5 A;  1OEY J;  1WXA A;  2KD0 A;  1IPG A;  2KKC A;  3ZDM C;  2MLB A;  2GBK A;  2DYM A;  1ZKH A;  3V60 A;  1UZX B;  3DBH I;  3HIZ A;  2FID A;  3QIJ A;  1LM8 B;  4HWI B;  3X23 A;  1EF1 A;  2KWC A;  4AJY B;  3ZW3 A;  4WQO B;  3DBL I;  3A1Q A;  1KLV A;  3APF A;  4DHZ B;  4IUM B;  4BBN F;  1WZ0 A;  3L54 A;  3PTF C;  2KC1 A;  3VDZ A;  4WJP A;  1QZE A;  1M94 A;  2KJH B;  4DDG D;  2GBR A;  4KVG B;  3ALB A;  2NPT B;  3Q3J A;  3GOE A;  3QJZ A;  2LGD A;  2RR9 A;  4NQL B;  4X57 B;  2JWZ A;  3A9J B;  3KW5 B;  3NOB A;  2DZI A;  3PZD A;  3M62 B;  3A4S C;  3V6C B;  5L95 C;  4GGQ A;  4RM8 A;  2N9X A;  2KOX A;  4JLC A;  1K8R B;  3DVG X;  2D3G A;  1WJN A;  2KAN A;  5JH5 C;  2KDI A;  3N30 A;  4LCD E;  5DPW A;  3BY4 B;  2JT4 B;  1T0Y A;  4W9D A;  2ZCB A;  1P1A A;  2VRR B;  3PHX B;  2KN5 A;  2LWP A;  4RM9 A;  4KV2 A;  1L2N A;  2LVP A;  1GC7 A;  4IWP A;  3R7Q A;  3RZF A;  1Z5S B;  1WI0 A;  4XZ4 A;  3ZTD A;  3L08 A;  1YJ1 A;  4M8N A;  4KSK C;  1V86 A;  3TCA A;  3KYC D;  2KFK A;  4IM0 A;  3NHE B;  1Q0W B;  3IBE A;  4ANW A;  2KHW B;  1I35 A;  3NZU A;  4GU2 A;  4FJZ A;  1J19 A;  4ANV A;  2BYF A;  4LJP B;  1WH3 A;  2K1F A;  1LQB A;  2B3A A;  2WX1 A;  1FXT B;  4K1R B;  2JUO A;  2Y5B B;  3ZNZ B;  2FUH B;  2L7R A;  1UH6 A;  4FN2 A;  3R66 C;  4B95 A;  4G0N B;  3JVZ X;  4BKG A;  3SD5 A;  2O2V A;  2N4F A;  4I6P A;  5CHF A;  3VH4 B;  4W9J A;  2KVR A;  4MJS A;  3QAQ A;  3QQ8 B;  1R4N I;  2MP2 B;  4MM3 A;  1V81 A;  4WJQ A;  2KXJ A;  2CHX A;  2L76 A;  2C7N B;  4PS3 A;  3CF6 E;  2KDB A;  2JF5 A;  3QAR A;  3VUX A;  2HD5 B;  4ZRK A;  4EOY A;  2KLC A;  3UIP B;  4A20 A;  2O6V D;  3WAO A;  3ZO5 B;  2KJR A;  2KZR A;  3HM3 A;  1WE6 A;  4DHJ B;  4NQK E;  4G11 A;  4PS7 A;  2M0X A;  1TTN A;  2LD9 A;  3RUI B;  1E90 A;  4EEW A;  2DAJ A;  3UIO B;  3LDZ E;  3AUL A;  1WGD A;  3L0W B;  2LXC A;  2RGF A;  3CST A;  1ISN A;  2QHO A;  2N9P C;  1WXS A;  2DAF A;  3UIN B;  4EZK A;  2IY0 B;  2J0M A;  3NZS A;  2GOW A;  2YVC A;  4ANX A;  2PJH A;  4ZYN A;  1WFY A;  3AU5 A;  3JW0 X;  2O6V A;  5BO4 B;  3EFU A;  2MA9 B;  3APC A;  2KMC A;  2ZVO A;  2FCN A;  1X1M A;  3P2B A;  3R7R A;  4URK A;  2L8J A;  2KWV B;  2N7D A;  2EMT A;  3TL5 A;  2G45 B;  3UGB B;  4K7W A;  3VH3 B;  2KTR A;  4F8C B;  1E7U A;  1BT0 A;  2LXA A;  2M1M A;  2PPH A;  3H7P B;  3V62 A;  2K8C A;  3WIM A;  1OTR B;  1Q1O A;  2JVC A;  2KDE B;  4GB9 A;  1GG3 A;  5D7G A;  2JZ3 B;  3A1Q B;  2J7Q B;  3SHQ A;  5JHA A;  3DVN V;  2KLG A;  3ENE A;  3IVF A;  2DX5 B;  3IG3 A;  5E6O A;  4IC7 B;  3KYD D;  2IY1 B;  4HJK A;  3ZIM A;  2PEA A;  4EKU A;  1GNU A;  3K9O B;  4HDO A;  4IM3 A;  3Q3F A;  3L13 A;  3MJW A;  2V3S A;  2V1Y A;  4FJV B;  2MW5 A;  1P0R A;  2AWT A;  3ZNI D;  4WWN A;  1V9J A;  4GSW A;  2IYD B;  3IFW B;  4FBJ B;  4RMA A;  4W9C A;  2G4D B;  1XD3 B;  2G4S A;  3WAN A;  3LJ3 A;  2BF8 B;  5DCN A;  4G50 A;  3A33 B;  5J2R A;  1LXD A;  3ZRF A;  4IW0 A;  4MSM B;  2MWS B;  1E8Z A;  3VAW A;  4A3P A;  2BYE A;  5LXH A;  3PS6 A;  3ZTC A;  2KFK B;  5CTR C;  2KX0 A;  1UBQ A;  3JSV B;  3DPD A;  2L00 B;  3EC8 A;  3U8Z A;  2WYQ A;  1RFA A;  3D32 A;  1E8Y A;  1WMH A;  2KFJ A;  1SIF A;  2JXX A;  2KQS A;  2NBW B;  2C5L C;  4K7U A;  1ZGU B;  2V4L A;  1WGY A;  1KOT A;  4DK5 A;  5AZF A;  3CSF A;  3PRP B;  4GDL B;  2KQ7 A;  3DBR I;  3UQA A;  1RLF A;  1OGW A;  2MBQ A;  1E8W A;  3ML9 A;  1WX9 A;  4NY0 A;  2N1W A;  4I6N B;  3T9L A;  3QC8 B;  4WJO A;  2LI5 A;  3PV1 A;  1ZW7 A;  4MEL A;  1WR1 A;  2N1V A;  4EFO A;  2NS5 A;  1KM7 A;  2AL3 A;  2UYZ B;  2XBB C;  1WJU A;  4JIO U;  4W9L A;  3VTU A;  3X0W A;  5JHB A;  4MJS B;  3ZRC A;  1C3T A;  1WGR A;  2FIF A;  2DHZ A;  5D6J B;  4IWQ A;  4NJ7 A;  2GMI C;  2Z59 B;  2NVU I;  1YQB A;  2FCM A;  2L0F A;  2ZNV B;  4G3X B;  3K9P B;  2K39 A;  2R2Q A;  4MSQ B;  4PS8 A;  4EZJ A;  3W1S C;  4HDQ A;  3L17 A;  2HJ8 A;  1LFD A;  2BYV E;  3H1U A;  1S1Q B;  1U4A A;  3DVG Y;  4W9E A;  4AUQ C;  3JYU A;  4DXA B;  3PRZ A;  4IG7 B;  3HM6 X;  4DDI D;  4MDK E;  3IHP C;  4KSL C;  1JRU A;  5G2N A;  4B9K A;  4GMV A;  1NBF C;  2L3Z A;  4NNJ B;  4AOF A;  2AL6 A;  3C0R B;  3A4R A;  2RSU A;  4GOC A;  1V5O A;  1P9D U;  4HPL B;  2ZZP B;  3GZN I;  2NPT A;  3TBL D;  2CHW A;  4FLH A;  2DZM A;  4NPN A;  4FJY A;  3SDL C;  4NAW A;  1WF9 A;  3A9J A;  3A9K B;  1H8C A;  5FR6 A;  2LAS A;  2OOB B;  1NDD A;  4DWF A;  1XT9 B;  2IZV B;  5D94 A;  2JY6 A;  2K25 A;  1KJT A;  3WAM A;  1P3Q U;  2LRU A;  4E3C A;  2WWZ A;  3ZNG C;  2LRW A;  2IBI B;  2KTR B;  4M8M A;  1TZ1 A;  3OLM D;  2JRI B;  3CMM B;  2L05 A;  3ONS A;  1SGH A;  2I1K A;  2ZVN A;  2ZPY A;  4FUL A;  4YL8 A;  1OQY A;  4BKS D;  4OVU A;  4FAD A;  1J0G A;  2G3Q B;  3QCA A;  2EMS A;  4A3O A;  1I42 A;  3VUW A;  3H9D A;  2BKF A;  4K7S A;  4LDT B;  4BVU C;  3QHT A;  1Q5W B;  2D10 A;  2ZNV C;  3DCG A;  3N32 A;  4BBN C;  3H7S A;  4LJO B;  1A5R A;  4WWO A;  2ZJD A;  2MBO A;  3OJ3 A;  2ZCC A;  2EKE C;  4EUT A;  1MG8 A;  1PQS A;  2DZJ A;  3ZNH B;  5DPS A;  3PT2 B;  4KIK A;  4GXB A;  2IO2 B;  3DOW A;  4E74 A;  2BWE S;  2KDF B;  3NY5 A;  4W9H A;  2N7E A;  2DEN B;  3WAL A;  1V6E A;  4BKS A;  1UGM A;  2M8S A;  1H4R A;  1V2Y A;  1OEY A;  1VCB A;  1WJ6 A;  1NI2 A;  1Z2M A;  3KVF B;  3EHV A;  2L0T A;  4MGI E;  4NJ6 A;  5CHV C;  4DHJ D;  3BIN A;  2M17 A;  4HCN B;  3VXW A;  3RZW C;  2LVO A;  3RCZ A;  4CYE A;  4PYU A;  1WIA A;  4CO7 A;  2GBN A;  3MHS D;  2UWQ A;  4LDT D;  4KZC A;  3ML8 A;  1TBE A;  2IO1 B;  4WAA A;  1YD8 U;  2NBV B;  3O65 B;  3TIX A;  2MQJ A;  4E71 A;  3DQV A;  4AJW A;  1AAR A;  1E5W A;  4ICV A;  1GUA B;  3PHW B;  3T8M A;  2JRH A;  4AP4 C;  4HLE A;  4J6I A;  1GJZ A;  3UF8 A;  2NBU A;  2FCS A;  2AYO B;  3ECI A;  1IP9 A;  3AI5 A;  4W9K A;  2KNB A;  5J18 A;  2J0J A;  2MSE D;  2FCQ A;  4W9F A;  1L7Y A;  4BFR A;  1Y8R C;  2CR5 A;  4ZRI A;  3DBS A;  2XK5 A;  3VFK A;  1G6J A;  3RUL A;  1RAX A;  2LJ5 A;  3PSE B;  5JZE B;  3PPA A;  1HE8 A;  3L16 A;  2PE9 A;  2N9E B;  4N9F 4;  2K6Q A;  2YLM A;  3TJP A;  2XEW A;  5LLI A;  2K6D B;  3RYT A;  4MEM A;  1WX8 A;  2MBE A;  4CHK A;  2AEH A;  2C9W B;  2R2O A;  4II2 B;  2LGY A;  3AU4 A;  4W9G A;  3KUZ A;  1WX7 A;  2I1J A;  4KDI C;  4OVV A;  2A4Z A;  5E6N A;  2D07 B;  4IWO A;  1V49 A;  1YX6 B;  2DYB A;  2HE7 A;  3KUC B;  4MGZ E;  3H7P A;  1WRD B;  3U7D A;  2C60 A;  4HXD A;  2D2Q A;  4MGY E;  2MBH A;  3OJ4 B;  3W1Y A;  2KWU B;  2PE6 B;  5AZG A;  2O2V B;  1YIW A;  2ZPN A;  4GDK A;  2DZK A;  1YX5 B;  2ASQ A;  1EO6 A;  2FNJ B;  2IO0 B;  3N3K B;  5C1Z A;  1F9J A;  3V6E B;  5KHQ A;  3KH0 A;  4HK2 A;  2RPQ A;  4MH0 E;  3KUD B;  4NAW B;  3PRM B;  1P98 A;  2JZZ A;  5HKH A;  2CKH B;  1VD2 A;  2CS4 A;  5IAA C;  3W1S A;  2GBM A;  2BPS A;  3QA8 A;  4GIV A;  4BOS C;  1IYF A;  1TGZ B;  2D11 A;  5IA7 A;  3PLV A;  5CHW A;  4PYZ A;  4B6W A;  2KK8 A;  3WA0 A;  3VHT C;  4TQ0 A;  1UD7 A;  3I3T B;  4W9I A;  4K81 A;  3H6N A;  3M63 B;  1V80 A;  4DHZ E;  3WAP A;  4WJN A;  4MGK E;  4I6L B;  1D3Z A;  2MX2 A;  3QK0 A;  1E7V A;  5G55 A;  2RD0 A;  3RT3 B;  3U30 A;  1WGH A;  5LXI B;  2LUE A;  3JSV A;  3HHM A;  1V5T A;  3M95 A;  4BKT A;  3NS8 A;  2REX A;  2O6V B;  3VQI A;  3EEC A;  3VVW B;  1E8X A;  4HPM B;  3R3M A;  3VTV A;  2LVQ A;  3AXC A;  1WR6 E;  2ZEQ A;  1WGG A;  4GDL A;  4KIK B;  5AEK B;  2CU1 A;  2IO3 B;  4BOZ B;  1WZ3 A;  2KX3 A;  5C23 A;  3ZKJ C;  1WJ4 A;  2MRP A;  1UBI A;  2C7H A;  2Z0D B;  2C7M B;  3VTW A;  2FAZ A;  2M4N A;  4WWP A;  3PGE A;  1CMX B;  2BGF A;  2DYO A;  4AWJ A;  2HTH A;  4KZ0 A;  4F7Z A;  2NR2 A;  2KJ6 A;  4JL9 A; 
#chains in the Genus database with same CATH topology
 2W9N A;  3HUI A;  2ZW0 A;  3QX1 A;  1UEL A;  3BK1 A;  3HK0 A;  3SR6 A;  2WXO A;  1XQQ A;  4HKQ A;  1WY8 A;  1KTK A;  1YN5 A;  5E6P A;  5DPR A;  4M0W B;  4WH4 A;  2AQ1 B;  4GN1 A;  2LGX A;  1S3S G;  1UF0 A;  1AN8 A;  1WE7 A;  2MP2 A;  4FA6 A;  3ZUN A;  3NS1 A;  1N6Z A;  3TMP B;  1PGB A;  4TKN A;  1WMH B;  2BKR B;  5CX3 A;  2BWF A;  2A5U A;  2WLB A;  3AE8 B;  1EWC A;  4TV3 A;  1SSN A;  5LNK 1;  2LZ6 A;  1B9R A;  1SE9 A;  2K8B A;  4WUR A;  4DQO C;  4P6V F;  1C9F A;  2QIL A;  4ZRQ A;  3Q3N C;  3PO0 A;  1I4H A;  4TQ1 A;  1WXA A;  3C8Y A;  2GBK A;  1ZKH A;  3BYY B;  3HIZ A;  1SF0 A;  2FID A;  3QIJ A;  3FC4 A;  4YXD B;  1FMA D;  1C4P A;  5C3J B;  3ZW3 A;  2MJD A;  4WQO B;  3PTF C;  1XO3 A;  3VDZ A;  1XEE A;  1M94 A;  4TSS A;  4L2Y A;  4KVG B;  4M01 A;  2M56 B;  3ALB A;  2RR9 A;  4NQL B;  3A9J B;  1FCL A;  3M62 B;  5L95 C;  4RM8 A;  2N9X A;  1F2R C;  1FFV A;  2D3G A;  3E56 A;  5JH5 C;  2W3S A;  2K22 A;  5DPW A;  2ZCB A;  1P1A A;  3PHX B;  5E6J A;  1MFW A;  2LVP A;  3R7Q A;  3RZF A;  2BYT A;  2WGS A;  1BUI C;  3TCA A;  2KFK A;  3NHE B;  1SJH D;  3IBE A;  2X38 A;  3NZU A;  4GU2 A;  4FJZ A;  2BYF A;  2Y3A A;  2JUO A;  2L7R A;  4FN2 A;  3W5U B;  3SD5 A;  2IGG A;  2O2V A;  2N4F A;  5CHF A;  2WHI A;  4W9J A;  4MJS A;  3QQ8 B;  3SEB A;  2MP2 B;  5HI1 A;  2KXJ A;  2L76 A;  2EEL A;  2C7N B;  4PS3 A;  2KDB A;  4EOY A;  4A20 A;  2KJR A;  2KDM A;  3LB8 C;  1E90 A;  2DAJ A;  4ARI A;  1WGD A;  2LXC A;  2RGF A;  2QHO A;  2N9P C;  3UIN B;  4EZK A;  4ZYN A;  1CJE A;  1WFY A;  2GI9 A;  2O6V A;  3EFU A;  1D5X C;  2WDR B;  3APC A;  1FEH A;  3LXF A;  1WWT A;  2FCN A;  3P2B A;  3R7R A;  4JPS A;  1GPX A;  2EMT A;  4F8C B;  2KTR A;  1BT0 A;  1ZDX A;  2PPH A;  1J7A A;  4M02 A;  2KDE B;  1GG3 A;  2JZ3 B;  3SHQ A;  5JHA A;  4BZA A;  2BT6 A;  2KLG A;  3IVF A;  4HJK A;  1VLB A;  2K9X A;  3GE8 C;  3K9O B;  4HDO A;  3O13 A;  3L13 A;  3MJW A;  2V3S A;  4RGO S;  2MW5 A;  4LTU A;  4LLG M;  2J53 A;  3IFW B;  4FBJ B;  1XD3 B;  1OFF A;  5DCN A;  3VAW A;  5LXH A;  2JYT A;  3PS6 A;  2KFK B;  2L00 B;  3EC8 A;  4K7U A;  2KFJ A;  2KQS A;  4DK5 A;  3IT4 B;  3Q8A A;  1L0V B;  3CSF A;  2KQ7 A;  2N7J A;  3UQA A;  2BW2 A;  2KT7 A;  3DHG C;  1XLQ A;  2UYZ B;  4JIO U;  2D3B A;  1WJU A;  5JHB A;  4MJS B;  3ZRC A;  1WGR A;  2FIF A;  2DHZ A;  4RF0 A;  2BB6 A;  2NVU I;  1YQB A;  2FCM A;  2L0F A;  1JWB D;  3L4P A;  1TKG A;  3PZ8 A;  2K39 A;  4S17 A;  2WU2 B;  1V97 A;  1WYG A;  4W9E A;  4DXA B;  3PRZ A;  1F2R I;  4IG7 B;  3TEY A;  2LFI A;  2N0S B;  3HM6 X;  1HTO A;  2IPK D;  1UWM A;  2J52 A;  4MDK E;  4B9K A;  4GMV A;  1NBF C;  1TT5 B;  2AL6 A;  3C0R B;  4C7Z A;  4GOC A;  3I63 C;  1P9D U;  2CHW A;  3SDL C;  3AH7 A;  5FR6 A;  2OOB B;  1ZP0 B;  1ZPS A;  4OZB A;  1WXQ A;  5D94 A;  3DBH B;  4HRO A;  3WAM A;  4LNI A;  4YSY B;  3ZNG C;  4E3C A;  2LRW A;  5IO9 A;  2KTR B;  1TZ1 A;  3ONS A;  2L05 A;  1SGH A;  2ZVN A;  2L52 A;  2ZPY A;  3DBL B;  1E0Z A;  3SFD B;  3QCA A;  3H9D A;  2BKF A;  4LDT B;  4BVU C;  4RCO A;  3H7S A;  3HVD A;  2WXM A;  4EUT A;  1PQS A;  2DZJ A;  1T5X D;  1D4B A;  4GXB A;  4WWM A;  3NY5 A;  1VZ6 A;  1SIJ A;  4BKS A;  3BK2 A;  2M8S A;  1H4R A;  1OEY A;  4AJW A;  3UQB A;  4XDD A;  4NJ6 A;  5CHV C;  2L0T A;  3NUH B;  1P7E A;  1SBB B;  2M17 A;  3Q8F A;  3VXW A;  3RCZ A;  4PYU A;  2GBN A;  3BVM A;  1MHX A;  1MPE A;  2UWQ A;  3ML8 A;  3DQV A;  1JCK B;  3MC0 B;  3T8M A;  3PHW B;  4AP4 C;  1C76 A;  2CJN A;  1GJZ A;  1F77 A;  2AYO B;  2YEP B;  4NZL B;  1NI3 A;  2KNB A;  2J0J A;  4KGS A;  2Y5P A;  1FO4 A;  1ZUD 2;  2CU3 A;  2PVO D;  4ZRI A;  1E10 A;  2KQ4 X;  2XK5 A;  2SAK A;  5JZE B;  1HE8 A;  4HRS A;  3TJP A;  3GS2 A;  3RYT A;  4MEM A;  2AEH A;  3VR9 B;  1V49 A;  1A70 A;  3H7P A;  1NVI D;  1WRD B;  3V05 A;  3NG0 A;  3V3X A;  3AMZ A;  3W2D A;  4GDK A;  2FNJ B;  2IO0 B;  5C1Z A;  2I2Y A;  1F9J A;  1WSP A;  1IBX A;  3RN9 C;  3PRM B;  3NVV A;  1VD2 A;  2CS4 A;  1ROE A;  1IYF A;  4OHJ A;  2MHJ A;  2KK8 A;  1UD7 A;  4W9I A;  1C78 A;  3H6N A;  4KX6 B;  4DHZ E;  1L0X B;  4MGK E;  2MX2 A;  1E7V A;  3RT3 B;  3DWG C;  3U30 A;  1WGH A;  3DHI C;  1VDV A;  3RNB C;  4HPM B;  3R3M A;  3VTV A;  1QIL A;  3AXC A;  3U4E G;  1WGG A;  4GDL A;  2CU1 A;  2DLB A;  4LNF A;  3IAM 1;  5C23 A;  3ZKJ C;  2Z0D B;  1MG4 A;  3AEE B;  1RFK A;  1CMX B;  2IND C;  4RGM A;  4KZ0 A;  4JL9 A;  4JGH B;  2NCN A;  3ZDT A;  1WM3 A;  3V61 A;  1F0Z A;  1D5M C;  4OZA A;  2H88 B;  4F1S A;  1SE4 A;  1CK1 A;  2Z0E B;  5J17 A;  3B1L X;  5DPT A;  4US8 A;  2XK5 B;  3L10 B;  3SU8 X;  2OJW A;  1GB1 A;  2WXK A;  1N63 A;  4FHK A;  2JPH A;  3A9K A;  3M3J A;  1EWY C;  3PVL A;  3Q8C A;  4P1C C;  3AEC B;  5EDS A;  1EUV B;  1TJE A;  3Q3M C;  4A55 A;  1OQR A;  3PRE A;  1Y56 A;  4P7I A;  2PTL A;  4KKI A;  4IM2 A;  1IGD A;  4GDK B;  4HCP B;  1IBX B;  4DBG A;  2QC8 A;  3VR8 B;  2J0K A;  3P63 A;  2QMT A;  3FAH A;  1EF5 A;  2KD0 A;  1ZOY B;  1IPG A;  2KKC A;  1YOV B;  3AEA B;  1DYQ A;  3ZDM C;  2MLB A;  3V60 A;  3NZ3 A;  4HWI B;  1EF1 A;  3BVZ A;  2KWD A;  3APF A;  3L54 A;  3Q8E A;  3AE3 B;  2KJH B;  2GBR A;  1ENF A;  1E6E B;  3N9Y C;  2NPT B;  1T0Q C;  4H2A A;  3KW5 B;  3PZD A;  4GGQ A;  1DOX A;  2BS2 B;  5GXG B;  3N1X C;  2RDB C;  4LNK A;  2KAN A;  1T0Y A;  2JT4 B;  5T8I A;  2SEB D;  2VRR B;  2KN5 A;  1L2N A;  4IWP A;  4LNO A;  1Z5S B;  4XZ4 A;  4M8N A;  4KSK C;  3KYC D;  1Q0W B;  4ANW A;  2LGS A;  3P4S B;  1BML C;  2J4X A;  5D3D A;  2E3T A;  1TS3 A;  1WH3 A;  2K1F A;  1LQB A;  2B3A A;  2WX1 A;  2X8X X;  4C4V A;  1PYW D;  3R8B A;  1QOF A;  1STE A;  3AN1 A;  2FUH B;  1UH6 A;  3ZXV A;  4B95 A;  3IT6 B;  3VH4 B;  2WXG A;  3UI3 A;  3QAQ A;  1R4N I;  4MM3 A;  4WJQ A;  4XGA B;  4KGR A;  2BTE A;  4CQN A;  3AV8 A;  2JF5 A;  3VUX A;  4ZYS A;  4ZRK A;  3URY A;  2O6V D;  1TZO A;  1ET9 A;  3HM3 A;  2W82 A;  4P16 A;  4NQK E;  4G11 A;  2M0X A;  1TTN A;  4JWS C;  3LDZ E;  2LJI A;  3AUL A;  3CST A;  2IY0 B;  2GOW A;  3AU5 A;  3JW0 X;  1I7H A;  2DWQ A;  2MA9 B;  1X1M A;  1E9M A;  2GB1 A;  2L8J A;  2N7D A;  1FIQ A;  4ZHP A;  1E7U A;  2LXA A;  3V62 A;  1QLB B;  1OTR B;  3FKY A;  5D7G A;  1UGJ A;  1N5W A;  2FBW B;  3RPF C;  3ENE A;  3IG3 A;  5E6O A;  4IC7 B;  1T0R C;  1DOI A;  2PEA A;  1GNU A;  2WP9 B;  4ZOH C;  4IM3 A;  1FNW A;  2V1Y A;  4FJV B;  1QOB A;  3RNC C;  1UUP A;  2AWT A;  5G5G A;  3ZNI D;  2IYD B;  4RMA A;  4W9C A;  5HG2 A;  3WAN A;  3A33 B;  4IKG A;  3TEW A;  2R61 A;  4A3P A;  2BYE A;  1TS4 A;  5CTR C;  2KX0 A;  2PW9 A;  3JSV B;  3DPD A;  4JX1 C;  3D32 A;  1RFA A;  1HXY D;  1E8Y A;  2JXX A;  5G5H A;  2J42 A;  1WGY A;  4C4V B;  1NYR A;  3DBR I;  2MBQ A;  2LI5 A;  3PV1 A;  4B0M A;  3MHZ A;  4EFO A;  2NS5 A;  1KM7 A;  1JAL A;  1PGA A;  2XBB C;  4W9L A;  3X0W A;  1C3T A;  3TEX A;  4MM3 B;  4RGN A;  2ZNV B;  4G3X B;  5BMI A;  2HJ1 A;  2VZK D;  4PS8 A;  3L17 A;  1JML A;  2HJ8 A;  1LFD A;  2BYV E;  4DXG A;  1S1Q B;  4EE2 A;  1ZXH A;  3GB1 A;  2CJO A;  1IGC A;  1YQ3 B;  2L3Z A;  2INC C;  2IGD A;  1V5O A;  4HPL B;  2ZZP B;  3GZN I;  3TBL D;  4NPN A;  4FJY A;  4NAW A;  1H8C A;  2JZP A;  1FD6 A;  1XT9 B;  5EE0 A;  2JY6 A;  2K25 A;  1KJT A;  4J3O D;  4PT5 A;  3I5J C;  1TIF A;  3GE3 C;  4M8M A;  1B1Z A;  2I1K A;  4YL8 A;  2BS3 B;  4BKS D;  1J0G A;  4OVU A;  2G3Q B;  2EMS A;  1I42 A;  3B9J A;  4USA A;  1Q5W B;  4LJO B;  1I4P A;  4WWO A;  4D2K A;  2ZJD A;  2ZCC A;  4A90 A;  2LMC A;  1MG8 A;  1FXI A;  3J9C A;  3ZNH B;  1V1P A;  3BWU D;  2IO2 B;  4E74 A;  2BWE S;  3WAL A;  2GLS A;  5MPO A;  1TY2 A;  1KRH A;  1VCB A;  5EE1 A;  3RNG C;  4ZHO A;  2KMM A;  3RZW C;  1JRP A;  4CO7 A;  4WAA A;  1TBE A;  2WDV B;  1YD8 U;  3O65 B;  2MQJ A;  1MHH E;  2DBY A;  4HLE A;  3UF8 A;  5HFY A;  3ECI A;  4W9K A;  4C80 A;  1HA5 A;  1L7Y A;  4BFR A;  3RUL A;  4HKZ E;  3PSE B;  4LK0 M;  2WXI A;  2YLM A;  5H8Y E;  1FRD A;  3E9S A;  5IOI A;  4CHK A;  2C9W B;  2R2O A;  2TSS A;  4W9G A;  2IJ0 A;  2I1J A;  5E6N A;  4RNA A;  1SE2 A;  4KGT A;  2DYB A;  2HE7 A;  1ET6 A;  2ICI A;  2C60 A;  1DGJ A;  4YWG G;  3W1Y A;  2KWU B;  2PE6 B;  2O2V B;  3RNF C;  4YTP B;  2DZK A;  3AE9 B;  3N20 C;  3N3K B;  2DNF A;  2PIA A;  2RPQ A;  1VZ7 A;  4NAW B;  1P98 A;  1PGX A;  2CKH B;  3U7Z A;  1T3Q A;  2GBM A;  2WS3 B;  2JQR B;  4BOS C;  5IA7 A;  5H92 C;  4PYZ A;  4B6W A;  3WA0 A;  1N62 A;  3VHT C;  3B2G A;  3DWM A;  3WAP A;  2WNM A;  1P7F A;  1GAQ B;  4C00 A;  2BVC A;  5LXI B;  3R2T A;  1V5T A;  3M95 A;  4BKT A;  4P1B C;  2O6V B;  3EEC A;  2KAJ A;  3FIL A;  2LVQ A;  3ZJV A;  2ZEQ A;  1V1P B;  2WDQ B;  1WZ3 A;  1YQ4 B;  2LUM A;  4XYC A;  3NRZ A;  3ZJT A;  1V8C A;  2DYO A;  4AWJ A;  4F7Z A;  2NR2 A;  2WXF A;  3HRD D;  2KMA A;  4ANU A;  4C56 C;  2HTM E;  3EUB 2;  1R4M I;  5D2M B;  2MBB B;  3B0A A;  5GMV A;  1GC6 A;  4XE0 A;  1FM0 D;  1D6E C;  3APD A;  5L83 A;  3LYY A;  4ICU A;  4EZL A;  3DVN U;  3MJ5 A;  1WM2 A;  1C1Y B;  1UNS A;  1N60 A;  2WDT B;  1QKZ A;  3QWZ B;  4NAM A;  4L23 A;  4ZDV A;  2K8H A;  2KTF A;  4HVB A;  2CHZ A;  3PLU A;  1SXT A;  1AW7 A;  4II3 B;  5KHO A;  1WXM A;  4XX5 A;  2JX5 A;  2WX0 A;  2H89 B;  3P42 A;  2KO3 A;  2OJR A;  4XC2 A;  4YT0 B;  1WYW B;  3AM9 A;  3W5V B;  2DYM A;  3Q14 C;  3Q2A C;  4MH8 A;  4HPP A;  1LM8 B;  3NVW A;  5BYQ A;  1MI0 A;  3X23 A;  5IKC M;  3HVZ A;  4AJY B;  3A1Q A;  1TYG B;  2I38 A;  2BQQ A;  4BBN F;  1WZ0 A;  5FKA C;  4DDG D;  1QZE A;  2G1E A;  2VZK B;  2V9H A;  3AE6 B;  3GOE A;  1OQQ A;  2MJE A;  3QJZ A;  1QOA A;  4X57 B;  1K50 A;  2JWZ A;  3VRB B;  1TS5 A;  2LGI A;  2DZI A;  3FIL B;  3NOB A;  3A4S C;  3V6C B;  2KOX A;  4JLC A;  1K8R B;  3DVG X;  1WJN A;  3RNE C;  3BZD B;  3KWL A;  1LGR A;  4S0R A;  3N30 A;  4LCD E;  1YMH E;  4RM9 A;  1FNU A;  4KV2 A;  2AQ2 B;  4ZRP A;  1GC7 A;  4A6Q A;  1IUE A;  1FPY A;  1YJ1 A;  1V86 A;  1FCC C;  4IM0 A;  3RFZ B;  2KHW B;  1J19 A;  4ANV A;  1RYJ A;  1D5Z C;  3R66 C;  4WIP A;  4I6P A;  3CF6 E;  3UIP B;  1TY0 A;  3ZO5 B;  2MJ3 A;  3AE5 B;  4PS7 A;  1RM6 C;  1WXS A;  2DAF A;  5AUK A;  3NZS A;  4ANX A;  1E7P B;  5BO4 B;  3W9C B;  2QSD A;  2KMC A;  2ZVO A;  3C19 A;  1HZ5 A;  4TMA B;  4URK A;  3KWV A;  3TL5 A;  2KWV B;  2G45 B;  5I4D A;  3H7P B;  2K8C A;  3WIM A;  3EGR A;  4GB9 A;  1I4Q A;  3GP7 A;  3A1Q B;  2J7Q B;  1SEB D;  1J7C A;  3DVN V;  1QF6 A;  1PFD A;  2DX5 B;  3KYD D;  1C79 A;  2RDH A;  3ZIM A;  4EKU A;  4MAC A;  2N9L A;  2INN E;  3H8H A;  4RFB A;  4GSW A;  1ESF A;  3LJ3 A;  2BF8 B;  4G50 A;  2BBC A;  3OWE B;  5J2R A;  1BXT A;  3ZRF A;  4IW0 A;  4MSM B;  3SFE B;  2MWS B;  2KVZ A;  2Y5C A;  4JWU C;  4ARC A;  4FXC A;  1SB3 C;  1DOY A;  3U8Z A;  1WMH A;  5JXV A;  2C5L C;  4JE3 B;  2E6X A;  3PRP B;  4GDL B;  2BS4 B;  4YSZ B;  2JSV X;  1E8W A;  1WX9 A;  4NY0 A;  2N1W A;  4I6N B;  3T9L A;  3QC8 B;  1RWS A;  4WJO A;  4MEL A;  4AQ7 A;  2N1V A;  2AL3 A;  5D6J B;  4IWQ A;  2WXL A;  5BMH A;  4NJ7 A;  2GMI C;  4OZC A;  3K9P B;  1NYQ A;  1ZDV A;  4MSQ B;  4EZJ A;  3W1S C;  2WXR A;  3B2F A;  3VRA B;  4QAY A;  3BVG A;  2OED A;  4M00 A;  1J7B A;  3CWI A;  3IHP C;  2V3N A;  2D3A A;  4NNJ B;  1FFU A;  1YNT E;  2DZM A;  1TKY A;  1WF9 A;  1L4D B;  3A9J A;  3A9K B;  2LAS A;  2WU5 B;  5EE3 A;  1QQR A;  3AE7 B;  1C77 A;  1EU4 A;  1N61 A;  2LRU A;  3ABV B;  3OLM D;  4R3D A;  3CMM B;  3IXS A;  4FUL A;  3ZYY X;  1N5X A;  4K7S A;  3QHT A;  2D10 A;  1A5R A;  3N32 A;  4A8X C;  3TSS A;  3WCQ A;  1QOG A;  2NTS A;  2YEP F;  4YTM B;  2KDF B;  3MC9 A;  2N7E A;  2DEN B;  1UGM A;  2LEK A;  2QIE B;  3KVF B;  1Z2M A;  1NI2 A;  4DHJ D;  1NEK B;  3BIN A;  4HCN B;  1LO5 D;  1WRI A;  2LVO A;  4CYE A;  1WIA A;  3R2I A;  3P4P B;  1GOZ A;  4LDT D;  2NBV B;  3TIX A;  2RMM A;  4E71 A;  1AAR A;  4ICV A;  1GUA B;  2JRH A;  4J6I A;  2M19 A;  1C4A A;  1IP9 A;  3AI5 A;  4L1B A;  2HDE A;  4O1N A;  5J18 A;  2JU6 X;  2L32 A;  2ACZ B;  2FCQ A;  4W9F A;  2WXQ A;  1Y8R C;  3VFK A;  2LJ5 A;  1R4N B;  4C7Y A;  2PE9 A;  4N9F 4;  2K6Q A;  1JWA D;  4GLS C;  3EA6 A;  5LLI A;  2K6D B;  2EKI A;  2PMV A;  4II2 B;  2LGY A;  3AU4 A;  3KUZ A;  1WX7 A;  4KDI C;  4OVV A;  2D07 B;  4IWO A;  1YX6 B;  2L1A A;  3KUC B;  4MGZ E;  3U7D A;  4HXD A;  1VR9 A;  2MBH A;  3U2S C;  5IN7 A;  2Q5W D;  3I57 A;  1JWM D;  5AZG A;  5BMG A;  1EO6 A;  2KN4 A;  2BB5 A;  5KHQ A;  4HK2 A;  4MH0 E;  3T3N A;  2JZZ A;  5HKH A;  4DXF A;  3W1S A;  1XCT L;  2BPS A;  4GIV A;  4PK1 A;  3PLV A;  3Q3O C;  4XWW A;  4K81 A;  3M63 B;  2QEJ C;  1V80 A;  4WJN A;  4I6L B;  1D3Z A;  3QK0 A;  2RD0 A;  2GRI A;  2MEK A;  2LUE A;  3HHM A;  2W3R A;  2WXP A;  2REX A;  3VQI A;  2WXN A;  3VVW B;  1I4G A;  2K5P A;  4YTN B;  4B0E A;  4ACF A;  2IO3 B;  4AS1 A;  2FUG 1;  1WJ4 A;  1MVK A;  1XLP A;  3P1M A;  1T6B X;  3KLS X;  1T0S C;  4WWP A;  3PGE A;  2HTH A;  5AZH A;  4K3B A;  2NTT A;  2MCN B;  1RRB A;  4ASW C;  1YN4 A;  3DBR B;  3DDC B;  4FHJ A;  4IDI A;  2W54 A;  4KKJ A;  4KDL B;  3Q8B A;  1HTQ A;  1PDX A;  1L5P A;  2GBJ A;  1J8C A;  4XDC A;  1WXV A;  3AEB B;  5TSS A;  3S2A A;  4ZRJ A;  2KC2 A;  5TR5 A;  3MFG A;  1K53 A;  3ZVV A;  4JQW C;  3MTN B;  4RF1 A;  3ZLZ A;  1SJE D;  4TUU A;  1MJD A;  1CZP A;  2WXH A;  3ZXR A;  1I4X A;  3OAW A;  3VUY A;  1YN3 A;  3RD2 A;  3GZN B;  3B08 A;  1HQR D;  1AYF A;  2XN9 C;  1OEY J;  1KLU D;  1JW9 D;  1QT9 A;  1UZX B;  3DBH I;  4RGT A;  3IAS 1;  2PVG C;  1XLO A;  1YJI A;  2KWC A;  1JRO A;  3DBL I;  1KLV A;  4DHZ B;  4IUM B;  2KC1 A;  4WJP A;  1ZE3 D;  1XXG A;  3ZGZ A;  3Q3J A;  2LGD A;  1FRR A;  2QJL A;  3P4Q B;  3AEF B;  2KDI A;  3BY4 B;  1XCQ L;  4W9D A;  2LWP A;  2AX5 A;  1EU3 A;  1L6V A;  1WI0 A;  3ZTD A;  3L08 A;  4WAF A;  2D5G A;  1JWU D;  1I35 A;  2FE8 A;  3N1Z C;  4LJP B;  3AED B;  1FXT B;  4K1R B;  1FNV A;  2Y5B B;  3ZNZ B;  3MP9 A;  3AB5 A;  1VJK A;  4G0N B;  3JVZ X;  4REZ A;  4BKG A;  2RDG A;  2KVR A;  3TEZ A;  3DHH C;  1V81 A;  3OG5 A;  2CHX A;  2B76 B;  3QAR A;  1JQ4 A;  2HD5 B;  1PUT A;  2KLC A;  3WAO A;  2IDY A;  2KZR A;  1WE6 A;  4DHJ B;  1UWX A;  2RPV A;  4US9 A;  3ZJU A;  2NMQ A;  5C2T B;  2LD9 A;  3RUI B;  4EEW A;  3UIO B;  3L0W B;  1ISN A;  1M4V A;  2ON8 A;  4N59 A;  3BYT B;  2J0M A;  4Q2J A;  4BAX A;  2YVC A;  4IOI E;  2PJH A;  2AQ3 B;  2WQY B;  5BYS A;  2INP E;  1F52 A;  2KAC A;  4OW0 A;  3AEG B;  3UGB B;  3VH3 B;  5FR3 A;  4K7W A;  2M1M A;  2V4I B;  1Q1O A;  1C4C A;  2JVC A;  4NJC A;  1XLN A;  3Q69 A;  5BYR A;  1EM7 A;  2IY1 B;  4OVZ A;  3Q3F A;  1P0R A;  4WWN A;  2K3U A;  3N1Y C;  1V9J A;  4N6E B;  2MH7 A;  2G4D B;  2G4S A;  1L0Y B;  3EFC A;  3TUO A;  2JYE A;  2PLP A;  3RMK C;  1LXD A;  3P4R B;  1E8Z A;  1JWS D;  2QDF A;  3NVY A;  1HZ6 A;  3ZTC A;  2W55 A;  1UBQ A;  2WYQ A;  1TS2 A;  2K0P A;  1SIF A;  2NBW B;  2KYW A;  3PZ7 A;  1ZGU B;  2V4L A;  1KOT A;  1R4M B;  5AZF A;  2VH2 A;  1ACC A;  1RLF A;  1OGW A;  3ML9 A;  2WXJ A;  1ZW7 A;  1WR1 A;  3VTU A;  2XNA C;  4XWT A;  4K3C A;  2JXT A;  2L83 A;  2Z59 B;  3AE1 B;  2R2Q A;  4LNN A;  4HDQ A;  2V0G A;  4N58 A;  3H1U A;  4WQM A;  3DVG Y;  1U4A A;  1KLG D;  3RNA C;  4AUQ C;  3JYU A;  5D3I B;  4MT5 A;  4DDI D;  1F1H A;  4A9A A;  4KSL C;  1JRU A;  4HEA 1;  5G2N A;  3AE2 B;  4RH6 A;  1V1O A;  4AOF A;  3A4R A;  2RSU A;  2G9H D;  2NPT A;  1FXA A;  4FLH A;  3AE4 B;  1ZXI A;  1AWD A;  3T3O A;  1NDD A;  2PKO A;  2VH1 A;  4DWF A;  3U52 E;  2IZV B;  3RI7 C;  3ETR A;  1P3Q U;  3NJT A;  2WWZ A;  2IBI B;  2JRI B;  4FAD A;  1OQY A;  1SE3 A;  2V3P A;  3Q6B A;  3CIR B;  4A3O A;  3VUW A;  5EE9 A;  2LHD A;  2ZNV C;  3DCG A;  4BBN C;  2MBO A;  2D3C A;  3OJ3 A;  2EKE C;  1KH0 A;  3I9V 1;  1KF6 B;  5DPS A;  3PT2 B;  4KIK A;  3DOW A;  1KFY B;  2ZW1 A;  4W9H A;  2OHF A;  1TKE A;  1V6E A;  5HHD G;  2N9K A;  1HEZ E;  1V2Y A;  1WJ6 A;  4MGI E;  3EHV A;  1I4R A;  5AUI A;  2QCZ A;  3MHS D;  2IO1 B;  2UU7 A;  1E5W A;  1K51 A;  2NBU A;  2FCS A;  4M0W A;  2MSE D;  2CR5 A;  4HJG E;  3DBS A;  1G6J A;  1RAX A;  3PPA A;  3L16 A;  2N9E B;  1Q10 A;  2XEW A;  1WX8 A;  2MBE A;  2A4Z A;  1XF5 L;  1VRA B;  2D2Q A;  4MGY E;  3OJ4 B;  2ZPN A;  1YIW A;  3NVZ A;  1YX5 B;  2ASQ A;  1L6U A;  2IGH A;  3V6E B;  3KH0 A;  1K52 A;  2JWU A;  1L4Z B;  3KUD B;  5IAA C;  3QA8 A;  4ITK A;  3MC8 A;  1TGZ B;  2D11 A;  5CHW A;  4TQ0 A;  5IP4 D;  3I3T B;  3BII D;  1YJJ A;  5G55 A;  3JSV A;  1R7S A;  2M0A A;  2Z8L A;  3KQ4 A;  1VZ8 A;  3NS8 A;  5FK9 C;  1E8X A;  1WR6 E;  4KIK B;  5AEK B;  4BOZ B;  2KX3 A;  1WGK A;  2MRP A;  3ZQ4 A;  1UBI A;  2C7H A;  2C7M B;  2ONQ A;  3VTW A;  1NEN B;  2FAZ A;  1GB4 A;  2M4N A;  1CQV A;  2BGF A;  4UDU C;  2LHE A;  2KJ6 A;  4YSX B;  4KZC A; 
#chains in the Genus database with same CATH homology
 2W9N A;  5AZH A;  2KMA A;  3QX1 A;  4JGH B;  4ANU A;  3UQB A;  1UEL A;  2NCN A;  3ZDT A;  1WM3 A;  3HK0 A;  2MCN B;  1XQQ A;  1R4M I;  1RRB A;  4ASW C;  1WY8 A;  3V61 A;  5D2M B;  5E6P A;  5DPR A;  4M0W B;  3DDC B;  2MBB B;  4FHJ A;  3B0A A;  4F1S A;  4GN1 A;  5GMV A;  1GC6 A;  4KDL B;  2LGX A;  1S3S G;  2Z0E B;  2GBJ A;  5J17 A;  1WE7 A;  3B1L X;  5DPT A;  3APD A;  2XK5 B;  3L10 B;  3SU8 X;  5L83 A;  4ICU A;  2MP2 A;  3DVN U;  4EZL A;  1J8C A;  1WM2 A;  1C1Y B;  4FA6 A;  1WXV A;  4FHK A;  2JPH A;  2WDT B;  3A9K A;  3M3J A;  3ZUN A;  3QWZ B;  3PVL A;  3S2A A;  4ZRJ A;  2KC2 A;  5TR5 A;  3TMP B;  4TKN A;  3ZVV A;  1WMH B;  4ZDV A;  2K8H A;  4JQW C;  5EDS A;  3MTN B;  3ZLZ A;  2KTF A;  2BKR B;  4HVB A;  1EUV B;  5CX3 A;  2BWF A;  2CHZ A;  2A5U A;  3PRE A;  3PLU A;  4P7I A;  4TV3 A;  4TUU A;  2LZ6 A;  4II3 B;  1SE9 A;  5KHO A;  2K8B A;  1WXM A;  4IM2 A;  4GDK B;  4XX5 A;  3OAW A;  4HCP B;  3VUY A;  4DBG A;  2WX0 A;  3RD2 A;  3B08 A;  2KO3 A;  2J0K A;  2OJR A;  4XC2 A;  1WYW B;  4TQ1 A;  1EF5 A;  1OEY J;  1WXA A;  2KD0 A;  1IPG A;  2KKC A;  3ZDM C;  2MLB A;  2GBK A;  2DYM A;  1ZKH A;  3V60 A;  1UZX B;  3DBH I;  3HIZ A;  2FID A;  3QIJ A;  1LM8 B;  4HWI B;  3X23 A;  1EF1 A;  2KWC A;  4AJY B;  3ZW3 A;  4WQO B;  3DBL I;  3A1Q A;  1KLV A;  3APF A;  4DHZ B;  4IUM B;  4BBN F;  1WZ0 A;  3L54 A;  3PTF C;  2KC1 A;  3VDZ A;  4WJP A;  1QZE A;  1M94 A;  2KJH B;  4DDG D;  2GBR A;  4KVG B;  3ALB A;  2NPT B;  3Q3J A;  3GOE A;  3QJZ A;  2LGD A;  2RR9 A;  4NQL B;  4X57 B;  2JWZ A;  3A9J B;  3KW5 B;  3NOB A;  2DZI A;  3PZD A;  3M62 B;  3A4S C;  3V6C B;  5L95 C;  4GGQ A;  4RM8 A;  2N9X A;  2KOX A;  4JLC A;  1K8R B;  3DVG X;  2D3G A;  1WJN A;  2KAN A;  5JH5 C;  2KDI A;  3N30 A;  4LCD E;  5DPW A;  3BY4 B;  2JT4 B;  1T0Y A;  4W9D A;  2ZCB A;  1P1A A;  2VRR B;  3PHX B;  2KN5 A;  2LWP A;  4RM9 A;  4KV2 A;  1L2N A;  2LVP A;  1GC7 A;  4IWP A;  3R7Q A;  3RZF A;  1Z5S B;  1WI0 A;  4XZ4 A;  3ZTD A;  3L08 A;  1YJ1 A;  4M8N A;  4KSK C;  1V86 A;  3TCA A;  3KYC D;  2KFK A;  4IM0 A;  3NHE B;  1Q0W B;  3IBE A;  4ANW A;  2KHW B;  1I35 A;  3NZU A;  4GU2 A;  4FJZ A;  1J19 A;  4ANV A;  2BYF A;  4LJP B;  1WH3 A;  2K1F A;  1LQB A;  2B3A A;  2WX1 A;  1FXT B;  4K1R B;  2JUO A;  2Y5B B;  3ZNZ B;  2FUH B;  2L7R A;  1UH6 A;  4FN2 A;  3R66 C;  4B95 A;  4G0N B;  3JVZ X;  4BKG A;  3SD5 A;  2O2V A;  2N4F A;  4I6P A;  5CHF A;  3VH4 B;  4W9J A;  2KVR A;  4MJS A;  3QAQ A;  3QQ8 B;  1R4N I;  2MP2 B;  4MM3 A;  1V81 A;  4WJQ A;  2KXJ A;  2CHX A;  2L76 A;  2C7N B;  4PS3 A;  3CF6 E;  2KDB A;  2JF5 A;  3QAR A;  3VUX A;  2HD5 B;  4ZRK A;  4EOY A;  2KLC A;  3UIP B;  4A20 A;  2O6V D;  3WAO A;  3ZO5 B;  2KJR A;  2KZR A;  3HM3 A;  1WE6 A;  4DHJ B;  4NQK E;  4G11 A;  4PS7 A;  2M0X A;  1TTN A;  2LD9 A;  3RUI B;  1E90 A;  4EEW A;  2DAJ A;  3UIO B;  3LDZ E;  3AUL A;  1WGD A;  3L0W B;  2LXC A;  2RGF A;  3CST A;  1ISN A;  2QHO A;  2N9P C;  1WXS A;  2DAF A;  3UIN B;  4EZK A;  2IY0 B;  2J0M A;  3NZS A;  2GOW A;  2YVC A;  4ANX A;  2PJH A;  4ZYN A;  1WFY A;  3AU5 A;  3JW0 X;  2O6V A;  5BO4 B;  3EFU A;  2MA9 B;  3APC A;  2KMC A;  2ZVO A;  2FCN A;  1X1M A;  3P2B A;  3R7R A;  4URK A;  2L8J A;  2KWV B;  2N7D A;  2EMT A;  3TL5 A;  2G45 B;  3UGB B;  4K7W A;  3VH3 B;  2KTR A;  4F8C B;  1E7U A;  1BT0 A;  2LXA A;  2M1M A;  2PPH A;  3H7P B;  3V62 A;  2K8C A;  3WIM A;  1OTR B;  1Q1O A;  2JVC A;  2KDE B;  4GB9 A;  1GG3 A;  5D7G A;  2JZ3 B;  3A1Q B;  2J7Q B;  3SHQ A;  5JHA A;  3DVN V;  2KLG A;  3ENE A;  3IVF A;  2DX5 B;  3IG3 A;  5E6O A;  4IC7 B;  3KYD D;  2IY1 B;  4HJK A;  3ZIM A;  2PEA A;  4EKU A;  1GNU A;  3K9O B;  4HDO A;  4IM3 A;  3Q3F A;  3L13 A;  3MJW A;  2V3S A;  2V1Y A;  4FJV B;  2MW5 A;  1P0R A;  2AWT A;  3ZNI D;  4WWN A;  1V9J A;  4GSW A;  2IYD B;  3IFW B;  4FBJ B;  4RMA A;  4W9C A;  2G4D B;  1XD3 B;  2G4S A;  3WAN A;  3LJ3 A;  2BF8 B;  5DCN A;  4G50 A;  3A33 B;  5J2R A;  1LXD A;  3ZRF A;  4IW0 A;  4MSM B;  2MWS B;  1E8Z A;  3VAW A;  4A3P A;  2BYE A;  5LXH A;  3PS6 A;  3ZTC A;  2KFK B;  5CTR C;  2KX0 A;  1UBQ A;  3JSV B;  3DPD A;  2L00 B;  3EC8 A;  3U8Z A;  2WYQ A;  1RFA A;  3D32 A;  1E8Y A;  1WMH A;  2KFJ A;  1SIF A;  2JXX A;  2KQS A;  2NBW B;  2C5L C;  4K7U A;  1ZGU B;  2V4L A;  1WGY A;  1KOT A;  4DK5 A;  5AZF A;  3CSF A;  3PRP B;  4GDL B;  2KQ7 A;  3DBR I;  3UQA A;  1RLF A;  1OGW A;  2MBQ A;  1E8W A;  3ML9 A;  1WX9 A;  4NY0 A;  2N1W A;  4I6N B;  3T9L A;  3QC8 B;  4WJO A;  2LI5 A;  3PV1 A;  1ZW7 A;  4MEL A;  1WR1 A;  2N1V A;  4EFO A;  2NS5 A;  1KM7 A;  2AL3 A;  2UYZ B;  2XBB C;  1WJU A;  4JIO U;  4W9L A;  3VTU A;  3X0W A;  5JHB A;  4MJS B;  3ZRC A;  1C3T A;  1WGR A;  2FIF A;  2DHZ A;  5D6J B;  4IWQ A;  4NJ7 A;  2GMI C;  2Z59 B;  2NVU I;  1YQB A;  2FCM A;  2L0F A;  2ZNV B;  4G3X B;  3K9P B;  2K39 A;  2R2Q A;  4MSQ B;  4PS8 A;  4EZJ A;  3W1S C;  4HDQ A;  3L17 A;  2HJ8 A;  1LFD A;  2BYV E;  3H1U A;  1S1Q B;  1U4A A;  3DVG Y;  4W9E A;  4AUQ C;  3JYU A;  4DXA B;  3PRZ A;  4IG7 B;  3HM6 X;  4DDI D;  4MDK E;  3IHP C;  4KSL C;  1JRU A;  5G2N A;  4B9K A;  4GMV A;  1NBF C;  2L3Z A;  4NNJ B;  4AOF A;  2AL6 A;  3C0R B;  3A4R A;  2RSU A;  4GOC A;  1V5O A;  1P9D U;  4HPL B;  2ZZP B;  3GZN I;  2NPT A;  3TBL D;  2CHW A;  4FLH A;  2DZM A;  4NPN A;  4FJY A;  3SDL C;  4NAW A;  1WF9 A;  3A9J A;  3A9K B;  1H8C A;  5FR6 A;  2LAS A;  2OOB B;  1NDD A;  4DWF A;  1XT9 B;  2IZV B;  5D94 A;  2JY6 A;  2K25 A;  1KJT A;  3WAM A;  1P3Q U;  2LRU A;  4E3C A;  2WWZ A;  3ZNG C;  2LRW A;  2IBI B;  2KTR B;  4M8M A;  1TZ1 A;  3OLM D;  2JRI B;  3CMM B;  2L05 A;  3ONS A;  1SGH A;  2I1K A;  2ZVN A;  2ZPY A;  4FUL A;  4YL8 A;  1OQY A;  4BKS D;  4OVU A;  4FAD A;  1J0G A;  2G3Q B;  3QCA A;  2EMS A;  4A3O A;  1I42 A;  3VUW A;  3H9D A;  2BKF A;  4K7S A;  4LDT B;  4BVU C;  3QHT A;  1Q5W B;  2D10 A;  2ZNV C;  3DCG A;  3N32 A;  4BBN C;  3H7S A;  4LJO B;  1A5R A;  4WWO A;  2ZJD A;  2MBO A;  3OJ3 A;  2ZCC A;  2EKE C;  4EUT A;  1MG8 A;  1PQS A;  2DZJ A;  3ZNH B;  5DPS A;  3PT2 B;  4KIK A;  4GXB A;  2IO2 B;  3DOW A;  4E74 A;  2BWE S;  2KDF B;  3NY5 A;  4W9H A;  2N7E A;  2DEN B;  3WAL A;  1V6E A;  4BKS A;  1UGM A;  2M8S A;  1H4R A;  1V2Y A;  1OEY A;  1VCB A;  1WJ6 A;  1NI2 A;  1Z2M A;  3KVF B;  3EHV A;  2L0T A;  4MGI E;  4NJ6 A;  5CHV C;  4DHJ D;  3BIN A;  2M17 A;  4HCN B;  3VXW A;  3RZW C;  2LVO A;  3RCZ A;  4CYE A;  4PYU A;  1WIA A;  4CO7 A;  2GBN A;  3MHS D;  2UWQ A;  4LDT D;  4KZC A;  3ML8 A;  1TBE A;  2IO1 B;  4WAA A;  1YD8 U;  2NBV B;  3O65 B;  3TIX A;  2MQJ A;  4E71 A;  3DQV A;  4AJW A;  1AAR A;  1E5W A;  4ICV A;  1GUA B;  3PHW B;  3T8M A;  2JRH A;  4AP4 C;  4HLE A;  4J6I A;  1GJZ A;  3UF8 A;  2NBU A;  2FCS A;  2AYO B;  3ECI A;  1IP9 A;  3AI5 A;  4W9K A;  2KNB A;  5J18 A;  2J0J A;  2MSE D;  2FCQ A;  4W9F A;  1L7Y A;  4BFR A;  1Y8R C;  2CR5 A;  4ZRI A;  3DBS A;  2XK5 A;  3VFK A;  1G6J A;  3RUL A;  1RAX A;  2LJ5 A;  3PSE B;  5JZE B;  3PPA A;  1HE8 A;  3L16 A;  2PE9 A;  2N9E B;  4N9F 4;  2K6Q A;  2YLM A;  3TJP A;  2XEW A;  5LLI A;  2K6D B;  3RYT A;  4MEM A;  1WX8 A;  2MBE A;  4CHK A;  2AEH A;  2C9W B;  2R2O A;  4II2 B;  2LGY A;  3AU4 A;  4W9G A;  3KUZ A;  1WX7 A;  2I1J A;  4KDI C;  4OVV A;  2A4Z A;  5E6N A;  2D07 B;  4IWO A;  1V49 A;  1YX6 B;  2DYB A;  2HE7 A;  3KUC B;  4MGZ E;  3H7P A;  1WRD B;  3U7D A;  2C60 A;  4HXD A;  2D2Q A;  4MGY E;  2MBH A;  3OJ4 B;  3W1Y A;  2KWU B;  2PE6 B;  5AZG A;  2O2V B;  1YIW A;  2ZPN A;  4GDK A;  2DZK A;  1YX5 B;  2ASQ A;  1EO6 A;  2FNJ B;  2IO0 B;  3N3K B;  5C1Z A;  1F9J A;  3V6E B;  5KHQ A;  3KH0 A;  4HK2 A;  2RPQ A;  4MH0 E;  3KUD B;  4NAW B;  3PRM B;  1P98 A;  2JZZ A;  5HKH A;  2CKH B;  1VD2 A;  2CS4 A;  5IAA C;  3W1S A;  2GBM A;  2BPS A;  3QA8 A;  4GIV A;  4BOS C;  1IYF A;  1TGZ B;  2D11 A;  5IA7 A;  3PLV A;  5CHW A;  4PYZ A;  4B6W A;  2KK8 A;  3WA0 A;  3VHT C;  4TQ0 A;  1UD7 A;  3I3T B;  4W9I A;  4K81 A;  3H6N A;  3M63 B;  1V80 A;  4DHZ E;  3WAP A;  4WJN A;  4MGK E;  4I6L B;  1D3Z A;  2MX2 A;  3QK0 A;  1E7V A;  5G55 A;  2RD0 A;  3RT3 B;  3U30 A;  1WGH A;  5LXI B;  2LUE A;  3JSV A;  3HHM A;  1V5T A;  3M95 A;  4BKT A;  3NS8 A;  2REX A;  2O6V B;  3VQI A;  3EEC A;  3VVW B;  1E8X A;  4HPM B;  3R3M A;  3VTV A;  2LVQ A;  3AXC A;  1WR6 E;  2ZEQ A;  1WGG A;  4GDL A;  4KIK B;  5AEK B;  2CU1 A;  2IO3 B;  4BOZ B;  1WZ3 A;  2KX3 A;  5C23 A;  3ZKJ C;  1WJ4 A;  2MRP A;  1UBI A;  2C7H A;  2Z0D B;  2C7M B;  3VTW A;  2FAZ A;  2M4N A;  4WWP A;  3PGE A;  1CMX B;  2BGF A;  2DYO A;  4AWJ A;  2HTH A;  4KZ0 A;  4F7Z A;  2NR2 A;  2KJ6 A;  4JL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...