1Q10A

Ensemble of 40 structures of the dimeric mutant of the b1 domain of streptococcal protein g
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
b'MQYKVILNGKTLKGETTTEAVDAATAEKVVKQFFNDNGVDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G binding protein G
publication title A Protein Contortionist: Core Mutations of GB1 that Induce Dimerization and Domain Swapping
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Protein binding
total genus 9
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1q10A00
1K50A 4OZAA 2JWUA 1YMHE 1Q10A 1GB4A 1IBXA 1P7EA 1PGBA 3UI3A 4HJGE 1K51A 1MVKA 2ZW1A 2OEDA 1HEZE 1HZ5A 2PTLA 2GB1A 2PW9A 5HHDG 2JZPA 3FILA 1YNTE 5BMGA 4OZBA 1XCTL 2I38A 2RPVA 4GLSC 1D4BA 1PGAA 4MACA 2KACA 1QKZA 2IGGA 4OZCA 1IGDA 1UWXA 2J53A 4D2KA 1KH0A 2JXTA 1MHXA 1FD6A 4WH4A 1MPEA 2EELA 2GI9A 2KQ4X 4KGTA 2N9LA 5HI1A 2ONQA 5JXVA 4KGRA 1XF5L 1HZ6A 1C9FA 2N9KA 2K0PA 4IKGA 3GB1A 2NMQA 1JMLA 2LHDA 2KN4A 2JSVX 1XCQL 1MI0A 1P7FA 1GB1A 1IBXB 2LHEA 5HFYA 4IOIE 1ZXHA 1F2RC 2IGDA 5HG2A 2KWDA 2IGHA 1EM7A 4KGSA 3FILB 5BMHA 2JU6X 3MP9A 1K53A 2PLPA 2LUMA 4HKZE 2QSDA 1F2RI 2KDMA 1IGCA 2QMTA 2N7JA 1MHHE 2I2YA 2ON8A 2LGIA 3V3XA 1PGXA 1FCLA 2ZW0A 2RMMA 1FCCC 1K52A 2J52A 5BMIA
chains in the Genus database with same CATH superfamily
3FKYA 1KOTA 1ET9A 3VXWA 5JZEB 1R4MB 3W1SA 3TEXA 1TKEA 3LXFA 4M01A 1ROEA 1PQSA 3L10B 2IZVB 2WU2B 1C4CA 3TJPA 3VTUA 2XNAC 2EKEC 1HA5A 1CZPA 4YSXB 3Q6BA 2OJWA 3SEBA 3EECA 1D4BA 4ZRKA 2WDVB 4NAWB 1DYQA 2IYDB 1D6EC 3H1UA 2VZKB 3ZTCA 1IGDA 5H92C 4KX6B 3X23A 2G9HD 1KRHA 1OEYA 1PUTA 3J9CA 2WXFA 3BK2A 4N58A 1WJNA 1EF5A 2PVOD 4X57B 5IN7A 1N60A 2DAJA 2ZPNA 1KF6B 5I4DA 4A3PA 3DDCB 3ABVB 3A1QB 1XO3A 5CHFA 2WQYB 3PO0A 2K0PA 4IUMB 3IT6B 1NEKB 2J0KA 4W9IA 2LGDA 3I9V1 1QOAA 3NUHB 1WX8A 1P7FA 3ML9A 3AV8A 5H8YE 4BKSA 4XWWA 3APFA 1WH3A 4WQOB 4IW0A 5G5GA 1N61A 2IO2B 4NAWA 1QILA 2CS4A 1YN3A 2A4ZA 4MSQB 1TGZB 1HXYD 4F1SA 2LZ6A 2J0MA 2VZKD 2KDMA 3URYA 1XQQA 1IGCA 2K9XA 2X38A 3ZVVA 3TIXA 2FBWB 3OJ3A 4B0MA 3MHZA 5AEKB 3A1QA 1LXDA 5IKCM 2N7EA 4C00A 3I63C 4A6QA 3KWVA 3U30A 4NQLB 2V3PA 4PS7A 3AM9A 2PVGC 2RPQA 4ZDVA 2RD0A 3RNCC 4ANWA 1ZGUB 1MG8A 3I5JC 1N5WA 4YT0B 3B9JA 1XXGA 1E8YA 3U7ZA 3RULA 2R2OA 2L32A 2BPSA 4BBNF 4MEMA 4GIVA 2CKHB 3UIPB 4MM3B 3RUIB 4BBNC 2I1JA 1P3QU 1L0XB 2QILA 4ARCA 4HDQA 5EE3A 1FD6A 4JLCA 4HROA 4DHJB 1RLFA 2RDGA 2DYMA 1WYWB 4NZLB 1NENB 2KQ7A 3TSSA 3UQBA 3DVNV 2G1EA 4R3DA 3ZDTA 1C4AA 2CHZA 1WXMA 2VH2A 3DQVA 5CX3A 3L0WB 4DXGA 3N32A 3Q14C 4FJVB 4ZRPA 1WZ3A 2L1AA 2MA9B 2BVCA 1P1AA 1FO4A 2MH7A 1C77A 1J8CA 4YTPB 4XDDA 3CWIA 4TSSA 3AI5A 1U4AA 1WXSA 4K7UA 2L0TA 2LRWA 4JL9A 2M0AA 4DHJD 4MDKE 1GUAB 1B1ZA 3DBSA 2DZJA 4C56C 4W9LA 2JWZA 1A70A 4OZAA 4KZ0A 3SR6A 1C4PA 2GMIC 2CJNA 2LD9A 2BYEA 3ML8A 2BTEA 3R2TA 2GB1A 3CSFA 4F8CB 1UBQA 2FIDA 3AE1B 4HPLB 2DLBA 2OOBB 1KTKA 2BWES 3GE3C 4LNOA 1VLBA 1I42A 4ZYNA 2UWQA 3L08A 1SB3C 2KOXA 1V80A 4EE2A 4H2AA 2BB6A 2DZMA 2KFKB 2N9EB 3R3MA 3BYYB 3DPDA 3ZRCA 2LI5A 2N9KA 3P2BA 2E6XA 4K1RB 1V1PB 2Z59B 4ASWC 1EWCA 2KQSA 4XGAB 1E7UA 1JWBD 4OW0A 4DXFA 4GSWA 4HKQA 3VAWA 4TV3A 2EMSA 4YTNB 2W3RA 4N9F4 2B76B 1T3QA 3Q3FA 4B0EA 2L83A 2QSDA 2ZCCA 2KLGA 2KAJA 1YX6B 2BKFA 3AH7A 2KFKA 2MHJA 2WXNA 1FXIA 2BWFA 5GXGB 1V97A 3AU5A 4TQ1A 5TR5A 4JQWC 1V1PA 2RDHA 5C3JB 2Q5WD 4KKIA 3PGEA 1WGHA 1QOGA 2JWUA 3L13A 4I6LB 1NVID 3ZGZA 4N6EB 3A33B 2KMAA 4HK2A 4GGQA 4HLEA 2AQ1B 2RR9A 2GBNA 3QIJA 2K8HA 1JQ4A 2M56B 1FIQA 1WGKA 4CO7A 1KJTA 2KVRA 1CK1A 3PREA 3GZNB 3NVWA 1V2YA 3SHQA 4ICVA 2HTME 1PGAA 2LUEA 2ZJDA 3AECB 2IY0B 4WWNA 1J7AA 2IGGA 3ZNID 2YLMA 4FHKA 2KX0A 2QJLA 2AQ3B 3T3NA 2K6QA 3QA8A 2AYOB 3N9YC 4EOYA 5KHQA 3NY5A 4MELA 2HDEA 1FPYA 2AWTA 2KXJA 3QX1A 1D3ZA 1FFUA 4NNJB 1ZE3D 2WX1A 2ONQA 2XBBC 4KGRA 5AZFA 1SE9A 4J3OD 4MGKE 2J7QB 2W55A 4RGNA 1XT9B 1M4VA 4ARIA 4P7IA 2D07B 3AE9B 1RYJA 1ZKHA 4W9FA 1T0QC 5CHWA 1XLOA 2NBWB 4ANXA 4LNFA 3N1ZC 5C23A 4P6VF 4EUTA 3VRBB 3EFUA 3WAPA 1DOXA 2GLSA 2KMMA 4I6NB 3RI7C 4HXDA 3HIZA 2N4FA 3AU4A 3PHXB 2ON8A 1WSPA 4RNAA 3PSEB 4FJZA 2UYZB 4EZJA 1F1HA 3VR8B 3MC9A 1E5WA 2KWVB 1YMHE 1GC6A 4ITKA 4NJCA 2C7HA 3H7PB 1UGJA 3NVYA 3U2SC 1IPGA 1ESFA 2Z8LA 4IG7B 1V1OA 2KO3A 3QHTA 3AEAB 3NZ3A 1YIWA 3NOBA 1V49A 1P98A 1L6VA 4S17A 2MBBB 4LJOB 2KDIA 4GLSC 2I1KA 1NI2A 1KM7A 1VZ7A 2LGSA 3B2GA 1WX9A 2WXIA 4WJPA 2WDRB 5E6JA 1ACCA 4ZHPA 3EHVA 5GMVA 4WIPA 2BF8B 4ANVA 4RCOA 4GDLB 4WWOA 5D3DA 2LMCA 5HI1A 2LVOA 5JXVA 2BYFA 3H7PA 3V60A 2PPHA 4ZRQA 4JPSA 1EF1A 5LXIB 1M94A 2BKRB 1DOIA 1IUEA 1RRBA 1GC7A 2KN4A 2WXHA 3N3KB 1WFYA 3VVWB 1YQ4B 1GB1A 1AW7A 2H89B 2KN5A 4EFOA 2BYVE 4Q2JA 1JWAD 2V3NA 3QWZB 4IWQA 1V86A 1WI0A 2N9XA 2G4SA 4HWIB 4A55A 3FILB 2JU6X 4RGOS 3AMZA 1AWDA 2CHXA 4XZ4A 4GDLA 3U7DA 1JWUD 3PRMB 2BGFA 1D5XC 2ZW0A 3V6EB 1J0GA 4PK1A 2L00B 2ASQA 3TEWA 3P63A 5G2NA 2GBRA 2Y3AA 1MG4A 1PGBA 3UI3A 3DHGC 5IAAC 3KWLA 3QCAA 3TUOA 1NYRA 3FILA 3WAOA 4DHZE 3EFCA 4NY0A 3W5UB 3K9PB 3CMMB 1TS5A 3DBHI 4KDLB 2K25A 2NR2A 2KACA 1UWMA 3CIRB 1T6BX 1YD8U 3ZLZA 3ZJVA 1V8CA 4MGYE 2JUOA 2M19A 4D2KA 4L2YA 2YEPF 1MHXA 2Z0DB 3DOWA 4PYUA 3ZJTA 2K8BA 3B0AA 1Y56A 3N30A 4AOFA 3I57A 3HUIA 2MJ3A 3V62A 2KC1A 1C9FA 2DYBA 2HD5B 2WXMA 3JSVB 2NMQA 1GG3A 5IO9A 2DBYA 3KYCD 4JIOU 2IO0B 3LB8C 2OJRA 5AUKA 1QZEA 3PHWB 1TIFA 2WXQA 4HCPB 1J19A 2IGDA 3V61A 4BAXA 4FULA 1YOVB 5E6PA 3PPAA 2VRRB 2O2VB 1KLVA 2JRHA 1L5PA 1L6UA 2DX5B 1UNSA 3APCA 3VH3B 4XE0A 1EUVB 1QT9A 2MBQA 3KQ4A 3IT4B 2I2YA 1FNWA 2WS3B 2M0XA 1WF9A 3E56A 2DYOA 2KANA 3JSVA 1WE7A 1NBFC 5FKAC 1WM3A 3DBRB 3RCZA 4HJKA 2CJOA 1GJZA 3X0WA 1P7EA 2M4NA 2Y5BB 1OQQA 5E6NA 2XK5B 3NHEB 1YJIA 4MGZE 2KYWA 2AQ2B 1K51A 1ZDVA 2LJIA 4YL8A 2ACZB 4FBJB 2PW9A 1LFDA 1A5RA 3SU8X 1DGJA 1LGRA 2L52A 3C19A 3NG0A 2O2VA 4GOCA 1LM8B 3KUCB 1STEA 1JWMD 4EZLA 3W1SC 4K3CA 3M95A 4II3B 1QKZA 1QF6A 3A9KB 3AE5B 4JGHB 4W9CA 2WXJA 4US9A 2LASA 2ZVNA 3PZDA 4O1NA 4WH4A 3JW0X 4AP4C 1JALA 4KGTA 4GN1A 1VD2A 1UZXB 1ET6A 1BXTA 1TS3A 1HZ6A 3FC4A 2XK5A 1FNVA 3HHMA 4LTUA 2AEHA 2FE8A 4IKGA 2WXRA 4ZHOA 2C9WB 2JSVX 2HE7A 4PS8A 3O65B 3IVFA 1HQRD 2MSED 3BINA 2O6VB 3AE2B 1Q0WB 1KLGD 2QEJC 2IO3B 3Q69A 2KT7A 2D2QA 1F2RC 2PE6B 2NBUA 3A9KA 3DBLI 2LWPA 1FRRA 1E8XA 1WE6A 3QJZA 4G50A 2A5UA 1QOFA 3Q2AC 3UGBB 4CQNA 3DWGC 3MP9A 1I4RA 3ZXVA 4HKZE 3BVGA 2Y5CA 3WCQA 1ENFA 2QC8A 3RNBC 1N5XA 5D6JB 2VH1A 2MP2B 4W9KA 1E90A 3NS8A 5DPWA 2BB5A 3NS1A 4AJYB 1FCLA 1FMAD 2TSSA 1E6EB 1UF0A 1V5OA 4MM3A 1BMLC 5CTRC 4KDIC 1WXAA 2O6VA 1E10A 4HJGE 1WGRA 3AULA 2KJ6A 3PZ7A 2KWUB 1MVKA 2O6VD 5FK9C 4HDOA 3BK1A 2WXOA 1L0YB 2FUG1 3VDZA 3QAQA 3VQIA 4WJNA 4A3OA 3V05A 3WALA 3CF6E 3IHPC 5EDSA 3C0RB 3AE8B 2LXAA 3T3OA 2INNE 2KDEB 2LVPA 5BYSA 1FEHA 2N9PC 1ZP0B 3PS6A 4MH8A 3BZDB 4TMAB 3AEFB 2IDYA 3Q8AA 1VDVA 1ZXIA 2EMTA 1WGDA 2MWSB 2K6DB 1R4MI 1TTNA 2FCNA 3GB1A 4TKNA 3UINB 2DNFA 1E0ZA 1ZOYB 1SBBB 3R8BA 3KUZA 3PLVA 1CJEA 3Q8BA 2N1WA 2LVQA 1IBXB 5DPRA 2NBVB 2FNJB 3ZIMA 4XX5A 1EU4A 2L05A 2CU3A 1WRDB 3OLMD 4KV2A 3MJWA 4CHKA 4KGSA 3P4RB 4RGTA 5BMHA 2MBOA 1R4NI 4HRSA 2C60A 4C80A 1B9RA 1OQRA 1S1QB 2WDTB 1HTQA 4PT5A 3VH4B 2FCMA 3E9SA 4AUQC 4W9JA 2V4IB 2DZIA 5D94A 3VR9B 3ETRA 1UELA 1V5TA 2QHOA 3ZYYX 2KWCA 3DVGX 3GP7A 4YSZB 2Z0EB 1D5MC 5IA7A 4NPNA 1GB4A 1IBXA 3ZDMC 2K8CA 1EU3A 2WWZA 1H4RA 3D32A 1PDXA 1K8RB 3L17A 2M17A 3NRZA 3N1YC 4RF0A 2D3CA 3ZJUA 4IC7B 4LJPB 4YTMB 2ZNVB 1YNTE 3P4PB 2L3ZA 1G6JA 1BT0A 3MFGA 3VTWA 1QQRA 4MACA 3A4RA 3W5VB 3HVDA 5LXHA 1SEBD 1YJJA 4FJYA 2LEKA 3W9CB 4KKJA 1I4XA 4IM0A 1WMHB 3FAHA 4AJWA 1QOBA 1XD3B 1SIFA 3ZKJC 2KQ4X 3P1MA 3DBHB 2D5GA 2GOWA 4EKUA 3AXCA 1WRIA 2KK8A 4QAYA 2ZPYA 4HPPA 2LHDA 4CYEA 4G0NB 1ZPSA 2L8JA 3L16A 2D10A 1WR6E 4BFRA 3R7RA 1SSNA 1EWYC 5HG2A 2DZKA 4NAMA 1WMHA 3ZRFA 1EO6A 3AEDB 2CU1A 5JH5C 3SD5A 4NQKE 4P1CC 5KHOA 1KFYB 4WWPA 3L54A 2KJRA 1VRAB 2RMMA 2MLBA 2MX2A 4K81A 5E6OA 4KZCA 1OFFA 3IG3A 2DAFA 4ICUA 5G55A 4XDCA 3KLSX 2ZVOA 3AE3B 1YN4A 1S3SG 2JT4B 3JYUA 3UF8A 1TY0A 5BMGA 2OHFA 1VCBA 1SE3A 2JYEA 5C2TB 2V3SA 2MQJA 2G45B 1PFDA 4S0RA 4OZCA 2XN9C 1QLBB 1ZW7A 3UIOB 1N62A 1YJ1A 2B3AA 5FR6A 1XLNA 4FXCA 5LLIA 2PEAA 5CHVC 3AEGB 2QCZA 2PJHA 3Q8FA 5J2RA 5DCNA 1T0RC 1E9MA 1SXTA 4AWJA 1I4QA 5EE9A 3Q3NC 4GB9A 2L76A 3M3JA 3VRAB 2HTHA 2D3BA 2FCSA 2MBHA 1GPXA 2ZNVC 3ZO5B 4RMAA 1CQVA 3Q3JA 2H88B 4IM2A 1UUPA 4HPMB 4OVVA 3B2FA 4REZA 3MC8A 3DWMA 3V6CB 3P42A 4B6WA 4PS3A 2JPHA 2IBIB 4BZAA 1NYQA 1L4DB 1K53A 2INDC 2LXCA 3BVZA 4PYZA 4XWTA 3V3XA 4JX1C 1NDDA 5TSSA 5BMIA 1UD7A 1SE2A 2ZCBA 2WU5B 2W54A 2WGSA 1FM0D 1OEYJ 3N20C 1I35A 3W1YA 1ZDXA 1I4HA 3QARA 4WAAA 2ZW1A 1SF0A 2RGFA 4WJQA 4II2B 5HHDG 1TT5B 3I3TB 4YSYB 4DWFA 3LYYA 1IP9A 2KHWB 2N7DA 2CR5A 2RPVA 3GE8C 1V6EA 2K39A 3IBEA 3AB5A 1VZ8A 1GOZA 2L7RA 2J53A 1C76A 4USAA 2SAKA 1VJKA 2JXTA 1V9JA 1XEEA 2KDFB 1J7CA 4A9AA 3BY4B 4I6PA 3AN1A 3IAM1 3H6NA 4E71A 4URKA 2KTRB 2WDQB 4C7ZA 3QK0A 4F7ZA 1C1YB 3K9OB 4GU2A 4K3BA 4P1BC 1WWTA 2SEBD 2N0SB 1MI0A 3A4SC 1T5XD 4IOIE 3VUXA 1ZXHA 2X8XX 2KJHB 3KUDB 3QC8B 3DHIC 3MHSD 2KWDA 1EM7A 4K7SA 1I7HA 3GZNI 1BUIC 2NTTA 3OAWA 3PZ8A 4G3XB 2K22A 3RNGC 4AS1A 3PRPB 5AZGA 1OTRB 3QQ8B 2W9NA 3KW5B 1JCKB 1RWSA 4LCDE 4FLHA 2KTRA 4IDIA 4E3CA 2AL3A 2W82A 1TBEA 3OJ4B 2KC2A 1R4NB 3B1LX 5JHBA 1Q10A 4MJSB 1WZ0A 1PYWD 1T0SC 1L2NA 1F0ZA 4L23A 1RAXA 2KKCA 4XYCA 2PTLA 1XLQA 3DVNU 4OZBA 3RZFA 2I38A 2DWQA 4RGMA 3U52E 2D3AA 4MSMB 1SJHD 4M0WB 5T8IA 3BIID 2M8SA 3ALBA 4KIKB 1WYGA 2MCNB 4XC2A 3PVLA 3WA0A 3LDZE 3IAS1 4MJSA 4BKSD 2JZZA 1N6ZA 2WXPA 4ZYSA 2FAZA 3DHHC 2XEWA 2YVCA 2V0GA 3EUB2 1GNUA 1WIAA 3T8MA 4RM8A 2E3TA 2C7MB 1WXQA 4GDKB 4C4VB 2REXA 1E7VA 2WNMA 4M0WA 2IGHA 1J7BA 4KSLC 1FNUA 4KIKA 4ACFA 2INCC 2L0FA 3APDA 4RFBA 2JY6A 2IPKD 4LDTB 3T9LA 2QMTA 3U8ZA 2RDBC 3TEYA 4BOZB 3PT2B 3KH0A 5D2MB 3AEBB 1AARA 1K50A 1UBIA 3SFDB 3UQAA 3VTVA 2BS4B 3SDLC 1JRPA 2BQQA 3RPFC 2KD0A 3NVVA 3TL5A 4HCNB 4GDKA 4DXAB 4C4VA 1MFWA 4GXBA 3LJ3A 5IP4D 2OEDA 4DDID 4LNIA 4J6IA 3ZUNA 3H9DA 4FA6A 3RFZB 1I4GA 3RYTA 1KLUD 3TMPB 3ZW3A 2JVCA 2FIFA 3WANA 3ONSA 4LDTD 2MW5A 3MTNB 1C78A 3EC8A 4TUUA 4W9HA 3ZQ4A 2MBEA 5JHAA 1AYFA 1OQYA 1WJ6A 1MPEA 2EELA 4AQ7A 2LJ5A 4K7WA 1XF5L 2BS3B 3Q8CA 1JROA 4KSKC 3Q3MC 2KX3A 3B08A 4KVGB 2IJ0A 2MJDA 4WAFA 2MP2A 3C8YA 4OHJA 1P9DU 2WXKA 1TZOA 1HTOA 2LHEA 4LNKA 2LFIA 4DK5A 4B9KA 3MJ5A 4LK0M 5EE1A 2UU7A 2ZZPB 5IOIA 3RMKC 2WP9B 1F2RI 2W3SA 1TS4A 3Q3OC 1JW9D 5L83A 3BYTB 2LGIA 4JE3B 4LLGM 1K52A 2HJ8A 2JX5A 1E8ZA 1D5ZC 4YWGG 1F52A 1WJ4A 3PLUA 2EKIA 3H7SA 2JF5A 2LGXA 4HEA1 2NCNA 1E8WA 1WGYA 2IY1B 2PE9A 3VHTC 4BKGA 4DQOC 2JZPA 2V9HA 1OGWA 2BS2B 4YXDB 1RM6C 1Q5WB 1TY2A 2WXGA 3R7QA 1JWSD 1VR9A 2LRUA 4JWSC 4UDUC 2KTFA 3TBLD 4M02A 1F9JA 4JWUC 3OG5A 1KH0A 2V1YA 1FFVA 4RM9A 1RFAA 3N1XC 1L0VB 2BBCA 1X1MA 4N59A 3A9JB 2LGYA 2AX5A 2V4LA 2HJ1A 1E7PB 4WQMA 5J18A 2J0JA 1Q1OA 2GBJA 1XLPA 5BYQA 2FUHB 3ZXRA 3DBRI 3AEEB 4DBGA 4BVUC 3PRZA 5FR3A 2AL6A 4ZRIA 2KNBA 2IO1B 1NI3A 3ECIA 2C7NB 2NPTB 1ZUD2 2G3QB 1IYFA 1TS2A 4ZRJA 4W9GA 3WAMA 4OVZA 2NTSA 1WGGA 3O13A 2KVZA 1VZ6A 2LUMA 1WM2A 4HVBA 2R61A 2J42A 3RN9C 3DCGA 2N7JA 3A9JA 3PTFC 1MHHE 2PIAA 3RNAC 2JYTA 3AE4B 3RZWC 1RFKA 4RF1A 2J4XA 3KYDD 4NJ7A 4WJOA 5EE0A 2G4DB 4ZOHC 2NVUI 2FCQA 4IWOA 4DDGD 4MH0E 5DPSA 3S2AA 5D3IB 4DHZB 2NPTA 3NVZA 2CHWA 1WXVA 1HEZE 1DOYA 3EGRA 2JQRB 2PMVA 1Y8RC 3EA6A 4IWPA 4LNNA 2PKOA 4A20A 3IFWB 2MJEA 2N1VA 1WY8A 4C7YA 5MPOA 4M8NA 2KMCA 1UWXA 1C79A 1P0RA 5BO4B 2ZEQA 4MGIE 3AE6B 3ENEA 5AZHA 2MEKA 3ZTDA 4NJ6A 2N9LA 1WR1A 4A8XC 1R7SA 3ZNHB 1Z2MA 4L1BA 2M1MA 1TJEA 1N63A 4B95A 5AUIA 3GS2A 3NJTA 4FHJA 3WIMA 2C5LC 3P4SB 3BVMA 1FXAA 5DPTA 2BT6A 2WX0A 4G11A 1TKGA 5C1ZA 2KDBA 2QIEB 4WURA 3HM3A 2D3GA 2YEPB 1TYGB 1UH6A 1MJDA 3GOEA 2JXXA 3U4EG 1V81A 2K3UA 2DHZA 4US8A 5L95C 3OWEB 1FCCC 4IM3A 4P16A 3RNEC 2MRPA 1HE8A 3NZSA 5LNK1 4GMVA 1WX7A 3AE7B 4FADA 1C3TA 3CSTA 2KFJA 1FRDA 1AN8A 3HK0A 1L7YA 1UGMA 2QDFA 1SJED 2ICIA 1HZ5A 3HVZA 2Y5PA 3W2DA 5J17A 3DBLB 1XCTL 4EZKA 4BOSC 3RNFC 2BYTA 4RH6A 3BWUD 3RT3B 2WLBA 1WJUA 3ZNGC 2D11A 3NZUA 2GRIA 1I4PA 5G5HA 1TKYA 2K1FA 1YQBA 2NS5A 1F77A 3SFEB 2WXLA 3HM6X 1YQ3B 3KVFB 4MT5A 2GI9A 3PV1A 1H8CA 5D7GA 4E74A 3RD2A 1SE4A 3R66C 1L4ZB 4OVUA 2BW2A 3IXSA 3TEZA 3M62B 3L4PA 2KLCA 1JMLA 3R2IA 2JRIB 3TCAA 4TQ0A 1XCQL 2WYQA 1FXTB 2K5PA 2KZRA 3ZNZB 2WHIA 5HFYA 1YN5A 4EEWA 1JRUA 3JVZX 4BKTA 2JZ3B 4M00A 2R2QA 3MC0B 3Q8EA 4W9EA 1T0YA 1LQBA 1Z5SB 1LO5D 4ANUA 2GBKA 1SIJA 3M63B 1ISNA 1YX5B 2INPE 4FN2A 2DENB 2RSUA 2PLPA 5HKHA 3HRDD 4W9DA 3VUWA 3VFKA 4M8MA 2GBMA 1TZ1A 4WWMA 1GAQB 3VUYA 3P4QB 1CMXB 4A90A 3DVGY 1PGXA 5BYRA 3H8HA 1SGHA 2J52A
chains in the Genus database with same CATH topology
1K50A 3VR8B 1ET9A 3VR9B 3ETRA 3SFDB 3ZYYX 4YSZB 3GP7A 1YMHE 3W1SA 1D5MC 2BS4B 4ITKA 3TEXA 1JRPA 1GB4A 1TKEA 3LXFA 3RPFC 4NJCA 1IBXA 1ROEA 1EU3A 3NVVA 1UGJA 3NVYA 3U2SC 1PDXA 2WU2B 1C4CA 1ESFA 2Z8LA 3NRZA 1V1OA 2OEDA 4RF0A 3AEAB 3NZ3A 3ZJUA 1L6VA 2XNAC 4YTMB 1HA5A 1CZPA 1YNTE 3P4PB 4YSXB 3RFZB 3MFGA 3SEBA 4GLSC 1I4GA 1QQRA 1D4BA 4MACA 1KLUD 2WDVB 4NAWB 3W5VB 3HVDA 1DYQA 1VZ7A 1D6EC 1SEBD 3B2GA 1YJJA 2VZKB 2LEKA 2WXIA 3W9CB 2WDRB 1I4XA 1IGDA 4KKJA 5H92C 3FAHA 4KX6B 1QOBA 2G9HD 1ACCA 1KRHA 1C78A 1PUTA 5E6JA 3J9CA 2WXFA 4ZHPA 3BK2A 4N58A 3ZQ4A 4WIPA 2PVOD 4RCOA 1AYFA 1MPEA 4GDLB 2EELA 1N60A 2KQ4X 4AQ7A 5D3DA 3P1MA 2LMCA 5HI1A 2D5GA 5JXVA 1KF6B 5I4DA 1XF5L 2BS3B 3ABVB 1XO3A 2WQYB 3PO0A 3Q8CA 4ZRQA 1WRIA 2K0PA 3IT6B 1JROA 4JPSA 1NEKB 1DOIA 1IUEA 2LHDA 2IJ0A 2KN4A 2MJDA 1QOAA 1ZPSA 3I9V1 4WAFA 4OHJA 2WXHA 3C8YA 3NUHB 2WXKA 1TZOA 1YQ4B 1P7FA 1GB1A 1AW7A 2LHEA 3AV8A 2H89B 5H8YE 4XWWA 2LFIA 4Q2JA 1JWAD 1N61A 5G5GA 2V3NA 1QILA 1SSNA 1EWYC 5HG2A 1YN3A 3MJ5A 4LK0M 4A55A 5EE1A 4NAMA 3FILB 1HXYD 2JU6X 2WP9B 4RGOS 2VZKD 3AEDB 3AMZA 1F2RI 2W3SA 1AWDA 2KDMA 3URYA 1IGCA 2K9XA 1TS4A 1JW9D 2X38A 1JWUD 1KFYB 3BYTB 2FBWB 2LGIA 4B0MA 1D5XC 3MHZA 1VRAB 4JE3B 2ZW0A 2RMMA 4LLGM 1K52A 2JX5A 3TEWA 1D5ZC 4YWGG 4A6QA 3P63A 3KWVA 1OFFA 2V3PA 2EKIA 3AM9A 2PVGC 2Y3AA 1PGBA 4XDCA 3UI3A 3KLSX 3KWLA 4HEA1 1N5WA 4YT0B 3B9JA 3AE3B 1YN4A 1XXGA 4DQOC 3TUOA 1NYRA 2JZPA 4YXDB 2BS2B 3FILA 3U7ZA 1RM6C 1TY0A 5BMGA 2OHFA 2L32A 3W5UB 1SE3A 1TY2A 2WXGA 1JWSD 1TS5A 1VR9A 4JWSC 4UDUC 2KACA 4MM3B 2JYEA 5C2TB 1UWMA 3CIRB 1T6BX 1PFDA 3ZJVA 4OZCA 1L0XB 1QLBB 1V8CA 2QILA 2XN9C 4ARCA 1N62A 2M19A 4JWUC 4D2KA 1KH0A 4L2YA 1XLNA 4FXCA 1FFVA 2YEPF 1MHXA 5EE3A 1L0VB 2BBCA 3AEGB 1FD6A 4HROA 3ZJTA 4N59A 3Q8FA 2RDGA 2AX5A 1E9MA 1SXTA 1Y56A 2DYMA 1NENB 4NZLB 3I57A 3TSSA 3HUIA 1E7PB 4WQMA 2MJ3A 2G1EA 1I4QA 5EE9A 1C9FA 4R3DA 1XLPA 1C4AA 2WXMA 5BYQA 2NMQA 3AEEB 3VRAB 2DBYA 1GPXA 5FR3A 4DXGA 3LB8C 1NI3A 5AUKA 1CQVA 4ZRPA 2H88B 2WXQA 2L1AA 1UUPA 2IGDA 1ZUD2 1TS2A 3B2FA 4REZA 1FO4A 3DWMA 3P42A 2MH7A 4OVZA 2NTSA 1C77A 1NYQA 1L4DB 3O13A 1L5PA 1K53A 4YTPB 1VZ6A 2LUMA 1L6UA 4XDDA 1UNSA 3BVZA 2R61A 4XE0A 3CWIA 2J42A 4TSSA 1QT9A 3KQ4A 2N7JA 3IT4B 1MHHE 2I2YA 1FNWA 2WS3B 2PIAA 2JYTA 3AE4B 1RFKA 4XWTA 4RF1A 2M0AA 2J4XA 3V3XA 4JX1C 5TSSA 3E56A 2DYOA 1B1ZA 4C56C 5BMIA 5EE0A 1A70A 4OZAA 4ZOHC 1SE2A 5FKAC 3SR6A 1C4PA 2CJNA 2CJOA 2WU5B 2W54A 1P7EA 1FM0D 1OQQA 5D3IB 1ZDXA 1YJIA 1I4HA 2AQ2B 1K51A 1ZDVA 3NVZA 2LJIA 2ZW1A 1SF0A 2BTEA 3R2TA 2ACZB 1HEZE 2PW9A 5HHDG 2GB1A 1DOYA 3EGRA 1DGJA 2L52A 3AE1B 4YSYB 3LYYA 2JQRB 2PMVA 3EA6A 2DLBA 2PKOA 1STEA 2RPVA 1JWMD 1KTKA 1VLBA 1QKZA 2MJEA 1QF6A 3AE5B 3AB5A 1VZ8A 4C7YA 5MPOA 2WXJA 1GOZA 1UWXA 2J53A 4US9A 1C76A 4USAA 1C79A 2SAKA 1VJKA 2JXTA 1SB3C 1XEEA 1J7CA 4A9AA 3AE6B 2MEKA 4O1NA 4WH4A 1JALA 4KGTA 4EE2A 3AN1A 2N9LA 2BB6A 4H2AA 1ET6A 3IAM1 1BXTA 1TS3A 3BYYB 2WDQB 1HZ6A 4A8XC 4C7ZA 3FC4A 2N9KA 1FNVA 2E6XA 1R7SA 2FE8A 4LTUA 1V1PB 4IKGA 2WXRA 4ZHOA 2JSVX 1WWTA 2SEBD 1EWCA 4L1BA 1TJEA 1MI0A 2N0SB 1N63A 1JWBD 1HQRD 5AUIA 3GS2A 3AE2B 4OW0A 1T5XD 4IOIE 1KLGD 4DXFA 2QEJC 3P4SB 4HKQA 1ZXHA 3Q69A 3BVMA 1FXAA 1F2RC 2BT6A 1TKGA 2KWDA 1FRRA 1EM7A 2W3RA 4YTNB 1I7HA 1BUIC 2NTTA 2QIEB 4WURA 1QOFA 2B76B 3PZ8A 1T3QA 4B0EA 4CQNA 3DWGC 2YEPB 1TYGB 2K22A 2L83A 1I4RA 3MP9A 4HKZE 4AS1A 2QSDA 2Y5CA 3BVGA 3WCQA 1ENFA 3U4EG 2K3UA 1N5XA 1JCKB 2KAJA 3AH7A 4US8A 1RWSA 2WXNA 1FXIA 3OWEB 5GXGB 2BB5A 3NS1A 4IDIA 1V97A 1FCLA 1FMAD 2TSSA 1E6EB 1FCCC 4TQ1A 1V1PA 2RDHA 5C3JB 2Q5WD 4KKIA 4P16A 2W82A 1BMLC 1QOGA 2JWUA 5LNK1 1NVID 1Q10A 3ZGZA 3AE7B 4N6EB 1PYWD 1FRDA 1F0ZA 1E10A 2AQ1B 1AN8A 4HJGE 4L23A 1JQ4A 3PZ7A 1MVKA 2M56B 1SJED 5FK9C 2ICIA 1FIQA 1HZ5A 2PTLA 1XLQA 3BK1A 1WGKA 2WXOA 1L0YB 2FUG1 2Y5PA 3HVZA 3W2DA 3VQIA 1CK1A 3V05A 4OZBA 1XCTL 3NVWA 2I38A 2DWQA 2HTME 4RGMA 2BYTA 4RH6A 3AE8B 1PGAA 3BWUD 3U52E 1SJHD 2WLBA 3AECB 1J7AA 3BIID 2IGGA 5T8IA 3T3OA 2INNE 2GRIA 1I4PA 5G5HA 1TKYA 5BYSA 2QJLA 2AQ3B 3T3NA 1FEHA 1F77A 3N9YC 3SFEB 2WXLA 1WYGA 1ZP0B 2HDEA 4MH8A 3BZDB 4TMAB 3AEFB 2IDYA 1YQ3B 1FFUA 4MT5A 1ZE3D 2GI9A 3IAS1 3Q8AA 1VDVA 5D7GA 1ZXIA 2ONQA 2WXPA 4KGRA 4ZYSA 1SE4A 4J3OD 1L4ZB 2W55A 4RGNA 2BW2A 3EUB2 3IXSA 3TEZA 2V0GA 3GB1A 3L4PA 1JMLA 3R2IA 1M4VA 4ARIA 4TQ0A 1E0ZA 1XCQL 1ZOYB 1SBBB 2K5PA 3R8BA 2E3TA 3AE9B 1CJEA 3Q8BA 1IBXB 1RYJA 5HFYA 1YN5A 1WXQA 1XLOA 4GDKB 3MC0B 1EU4A 3Q8EA 2WNMA 4M0WA 2CU3A 4P6VF 2IGHA 3VRBB 1J7BA 1DOXA 4KGSA 1LO5D 3P4RB 1SIJA 4RGTA 5BMHA 2INPE 1FNUA 4RFBA 2KMMA 2PLPA 4HRSA 3HRDD 2IPKD 4C80A 1B9RA 2QMTA 1OQRA 3TEYA 4WWMA 2ON8A 4PT5A 1GAQB 3P4QB 3E9SA 1WSPA 4RNAA 4A90A 1PGXA 3AEBB 5BYRA 3H8HA 2J52A 2V4IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K50 A;  4OZA A;  2JWU A;  1YMH E;  1Q10 A;  1GB4 A;  1IBX A;  1P7E A;  1PGB A;  3UI3 A;  4HJG E;  1K51 A;  1MVK A;  2ZW1 A;  2OED A;  1HEZ E;  1HZ5 A;  2PTL A;  2GB1 A;  2PW9 A;  5HHD G;  2JZP A;  3FIL A;  1YNT E;  5BMG A;  4OZB A;  1XCT L;  2I38 A;  2RPV A;  4GLS C;  1D4B A;  1PGA A;  4MAC A;  2KAC A;  1QKZ A;  2IGG A;  4OZC A;  1IGD A;  1UWX A;  2J53 A;  4D2K A;  1KH0 A;  2JXT A;  1MHX A;  1FD6 A;  4WH4 A;  1MPE A;  2EEL A;  2GI9 A;  2KQ4 X;  4KGT A;  2N9L A;  5HI1 A;  2ONQ A;  5JXV A;  4KGR A;  1XF5 L;  1HZ6 A;  1C9F A;  2N9K A;  2K0P A;  4IKG A;  3GB1 A;  2NMQ A;  1JML A;  2LHD A;  2KN4 A;  2JSV X;  1XCQ L;  1MI0 A;  1P7F A;  1GB1 A;  1IBX B;  2LHE A;  5HFY A;  4IOI E;  1ZXH A;  1F2R C;  2IGD A;  5HG2 A;  2KWD A;  2IGH A;  1EM7 A;  4KGS A;  3FIL B;  5BMH A;  2JU6 X;  3MP9 A;  1K53 A;  2PLP A;  2LUM A;  4HKZ E;  2QSD A;  1F2R I;  2KDM A;  1IGC A;  2QMT A;  2N7J A;  1MHH E;  2I2Y A;  2ON8 A;  2LGI A;  3V3X A;  1PGX A;  1FCL A;  2ZW0 A;  2RMM A;  1FCC C;  1K52 A;  2J52 A;  5BMI A; 
#chains in the Genus database with same CATH topology
 3FKY A;  1KOT A;  1ET9 A;  3VXW A;  5JZE B;  1R4M B;  3W1S A;  3TEX A;  1TKE A;  3LXF A;  4M01 A;  1ROE A;  1PQS A;  3L10 B;  2IZV B;  2WU2 B;  1C4C A;  3TJP A;  3VTU A;  2XNA C;  2EKE C;  1HA5 A;  1CZP A;  4YSX B;  3Q6B A;  2OJW A;  3SEB A;  3EEC A;  1D4B A;  4ZRK A;  2WDV B;  4NAW B;  1DYQ A;  2IYD B;  1D6E C;  3H1U A;  2VZK B;  3ZTC A;  1IGD A;  5H92 C;  4KX6 B;  3X23 A;  2G9H D;  1KRH A;  1OEY A;  1PUT A;  3J9C A;  2WXF A;  3BK2 A;  4N58 A;  1WJN A;  1EF5 A;  2PVO D;  4X57 B;  5IN7 A;  1N60 A;  2DAJ A;  2ZPN A;  1KF6 B;  5I4D A;  4A3P A;  3DDC B;  3ABV B;  3A1Q B;  1XO3 A;  5CHF A;  2WQY B;  3PO0 A;  2K0P A;  4IUM B;  3IT6 B;  1NEK B;  2J0K A;  4W9I A;  2LGD A;  3I9V 1;  1QOA A;  3NUH B;  1WX8 A;  1P7F A;  3ML9 A;  3AV8 A;  5H8Y E;  4BKS A;  4XWW A;  3APF A;  1WH3 A;  4WQO B;  4IW0 A;  5G5G A;  1N61 A;  2IO2 B;  4NAW A;  1QIL A;  2CS4 A;  1YN3 A;  2A4Z A;  4MSQ B;  1TGZ B;  1HXY D;  4F1S A;  2LZ6 A;  2J0M A;  2VZK D;  2KDM A;  3URY A;  1XQQ A;  1IGC A;  2K9X A;  2X38 A;  3ZVV A;  3TIX A;  2FBW B;  3OJ3 A;  4B0M A;  3MHZ A;  5AEK B;  3A1Q A;  1LXD A;  5IKC M;  2N7E A;  4C00 A;  3I63 C;  4A6Q A;  3KWV A;  3U30 A;  4NQL B;  2V3P A;  4PS7 A;  3AM9 A;  2PVG C;  2RPQ A;  4ZDV A;  2RD0 A;  3RNC C;  4ANW A;  1ZGU B;  1MG8 A;  3I5J C;  1N5W A;  4YT0 B;  3B9J A;  1XXG A;  1E8Y A;  3U7Z A;  3RUL A;  2R2O A;  2L32 A;  2BPS A;  4BBN F;  4MEM A;  4GIV A;  2CKH B;  3UIP B;  4MM3 B;  3RUI B;  4BBN C;  2I1J A;  1P3Q U;  1L0X B;  2QIL A;  4ARC A;  4HDQ A;  5EE3 A;  1FD6 A;  4JLC A;  4HRO A;  4DHJ B;  1RLF A;  2RDG A;  2DYM A;  1WYW B;  4NZL B;  1NEN B;  2KQ7 A;  3TSS A;  3UQB A;  3DVN V;  2G1E A;  4R3D A;  3ZDT A;  1C4A A;  2CHZ A;  1WXM A;  2VH2 A;  3DQV A;  5CX3 A;  3L0W B;  4DXG A;  3N32 A;  3Q14 C;  4FJV B;  4ZRP A;  1WZ3 A;  2L1A A;  2MA9 B;  2BVC A;  1P1A A;  1FO4 A;  2MH7 A;  1C77 A;  1J8C A;  4YTP B;  4XDD A;  3CWI A;  4TSS A;  3AI5 A;  1U4A A;  1WXS A;  4K7U A;  2L0T A;  2LRW A;  4JL9 A;  2M0A A;  4DHJ D;  4MDK E;  1GUA B;  1B1Z A;  3DBS A;  2DZJ A;  4C56 C;  4W9L A;  2JWZ A;  1A70 A;  4OZA A;  4KZ0 A;  3SR6 A;  1C4P A;  2GMI C;  2CJN A;  2LD9 A;  2BYE A;  3ML8 A;  2BTE A;  3R2T A;  2GB1 A;  3CSF A;  4F8C B;  1UBQ A;  2FID A;  3AE1 B;  4HPL B;  2DLB A;  2OOB B;  1KTK A;  2BWE S;  3GE3 C;  4LNO A;  1VLB A;  1I42 A;  4ZYN A;  2UWQ A;  3L08 A;  1SB3 C;  2KOX A;  1V80 A;  4EE2 A;  4H2A A;  2BB6 A;  2DZM A;  2KFK B;  2N9E B;  3R3M A;  3BYY B;  3DPD A;  3ZRC A;  2LI5 A;  2N9K A;  3P2B A;  2E6X A;  4K1R B;  1V1P B;  2Z59 B;  4ASW C;  1EWC A;  2KQS A;  4XGA B;  1E7U A;  1JWB D;  4OW0 A;  4DXF A;  4GSW A;  4HKQ A;  3VAW A;  4TV3 A;  2EMS A;  4YTN B;  2W3R A;  4N9F 4;  2B76 B;  1T3Q A;  3Q3F A;  4B0E A;  2L83 A;  2QSD A;  2ZCC A;  2KLG A;  2KAJ A;  1YX6 B;  2BKF A;  3AH7 A;  2KFK A;  2MHJ A;  2WXN A;  1FXI A;  2BWF A;  5GXG B;  1V97 A;  3AU5 A;  4TQ1 A;  5TR5 A;  4JQW C;  1V1P A;  2RDH A;  5C3J B;  2Q5W D;  4KKI A;  3PGE A;  1WGH A;  1QOG A;  2JWU A;  3L13 A;  4I6L B;  1NVI D;  3ZGZ A;  4N6E B;  3A33 B;  2KMA A;  4HK2 A;  4GGQ A;  4HLE A;  2AQ1 B;  2RR9 A;  2GBN A;  3QIJ A;  2K8H A;  1JQ4 A;  2M56 B;  1FIQ A;  1WGK A;  4CO7 A;  1KJT A;  2KVR A;  1CK1 A;  3PRE A;  3GZN B;  3NVW A;  1V2Y A;  3SHQ A;  4ICV A;  2HTM E;  1PGA A;  2LUE A;  2ZJD A;  3AEC B;  2IY0 B;  4WWN A;  1J7A A;  2IGG A;  3ZNI D;  2YLM A;  4FHK A;  2KX0 A;  2QJL A;  2AQ3 B;  3T3N A;  2K6Q A;  3QA8 A;  2AYO B;  3N9Y C;  4EOY A;  5KHQ A;  3NY5 A;  4MEL A;  2HDE A;  1FPY A;  2AWT A;  2KXJ A;  3QX1 A;  1D3Z A;  1FFU A;  4NNJ B;  1ZE3 D;  2WX1 A;  2ONQ A;  2XBB C;  4KGR A;  5AZF A;  1SE9 A;  4J3O D;  4MGK E;  2J7Q B;  2W55 A;  4RGN A;  1XT9 B;  1M4V A;  4ARI A;  4P7I A;  2D07 B;  3AE9 B;  1RYJ A;  1ZKH A;  4W9F A;  1T0Q C;  5CHW A;  1XLO A;  2NBW B;  4ANX A;  4LNF A;  3N1Z C;  5C23 A;  4P6V F;  4EUT A;  3VRB B;  3EFU A;  3WAP A;  1DOX A;  2GLS A;  2KMM A;  4I6N B;  3RI7 C;  4HXD A;  3HIZ A;  2N4F A;  3AU4 A;  3PHX B;  2ON8 A;  1WSP A;  4RNA A;  3PSE B;  4FJZ A;  2UYZ B;  4EZJ A;  1F1H A;  3VR8 B;  3MC9 A;  1E5W A;  2KWV B;  1YMH E;  1GC6 A;  4ITK A;  4NJC A;  2C7H A;  3H7P B;  1UGJ A;  3NVY A;  3U2S C;  1IPG A;  1ESF A;  2Z8L A;  4IG7 B;  1V1O A;  2KO3 A;  3QHT A;  3AEA B;  3NZ3 A;  1YIW A;  3NOB A;  1V49 A;  1P98 A;  1L6V A;  4S17 A;  2MBB B;  4LJO B;  2KDI A;  4GLS C;  2I1K A;  1NI2 A;  1KM7 A;  1VZ7 A;  2LGS A;  3B2G A;  1WX9 A;  2WXI A;  4WJP A;  2WDR B;  5E6J A;  1ACC A;  4ZHP A;  3EHV A;  5GMV A;  4WIP A;  2BF8 B;  4ANV A;  4RCO A;  4GDL B;  4WWO A;  5D3D A;  2LMC A;  5HI1 A;  2LVO A;  5JXV A;  2BYF A;  3H7P A;  3V60 A;  2PPH A;  4ZRQ A;  4JPS A;  1EF1 A;  5LXI B;  1M94 A;  2BKR B;  1DOI A;  1IUE A;  1RRB A;  1GC7 A;  2KN4 A;  2WXH A;  3N3K B;  1WFY A;  3VVW B;  1YQ4 B;  1GB1 A;  1AW7 A;  2H89 B;  2KN5 A;  4EFO A;  2BYV E;  4Q2J A;  1JWA D;  2V3N A;  3QWZ B;  4IWQ A;  1V86 A;  1WI0 A;  2N9X A;  2G4S A;  4HWI B;  4A55 A;  3FIL B;  2JU6 X;  4RGO S;  3AMZ A;  1AWD A;  2CHX A;  4XZ4 A;  4GDL A;  3U7D A;  1JWU D;  3PRM B;  2BGF A;  1D5X C;  2ZW0 A;  3V6E B;  1J0G A;  4PK1 A;  2L00 B;  2ASQ A;  3TEW A;  3P63 A;  5G2N A;  2GBR A;  2Y3A A;  1MG4 A;  1PGB A;  3UI3 A;  3DHG C;  5IAA C;  3KWL A;  3QCA A;  3TUO A;  1NYR A;  3FIL A;  3WAO A;  4DHZ E;  3EFC A;  4NY0 A;  3W5U B;  3K9P B;  3CMM B;  1TS5 A;  3DBH I;  4KDL B;  2K25 A;  2NR2 A;  2KAC A;  1UWM A;  3CIR B;  1T6B X;  1YD8 U;  3ZLZ A;  3ZJV A;  1V8C A;  4MGY E;  2JUO A;  2M19 A;  4D2K A;  4L2Y A;  2YEP F;  1MHX A;  2Z0D B;  3DOW A;  4PYU A;  3ZJT A;  2K8B A;  3B0A A;  1Y56 A;  3N30 A;  4AOF A;  3I57 A;  3HUI A;  2MJ3 A;  3V62 A;  2KC1 A;  1C9F A;  2DYB A;  2HD5 B;  2WXM A;  3JSV B;  2NMQ A;  1GG3 A;  5IO9 A;  2DBY A;  3KYC D;  4JIO U;  2IO0 B;  3LB8 C;  2OJR A;  5AUK A;  1QZE A;  3PHW B;  1TIF A;  2WXQ A;  4HCP B;  1J19 A;  2IGD A;  3V61 A;  4BAX A;  4FUL A;  1YOV B;  5E6P A;  3PPA A;  2VRR B;  2O2V B;  1KLV A;  2JRH A;  1L5P A;  1L6U A;  2DX5 B;  1UNS A;  3APC A;  3VH3 B;  4XE0 A;  1EUV B;  1QT9 A;  2MBQ A;  3KQ4 A;  3IT4 B;  2I2Y A;  1FNW A;  2WS3 B;  2M0X A;  1WF9 A;  3E56 A;  2DYO A;  2KAN A;  3JSV A;  1WE7 A;  1NBF C;  5FKA C;  1WM3 A;  3DBR B;  3RCZ A;  4HJK A;  2CJO A;  1GJZ A;  3X0W A;  1P7E A;  2M4N A;  2Y5B B;  1OQQ A;  5E6N A;  2XK5 B;  3NHE B;  1YJI A;  4MGZ E;  2KYW A;  2AQ2 B;  1K51 A;  1ZDV A;  2LJI A;  4YL8 A;  2ACZ B;  4FBJ B;  2PW9 A;  1LFD A;  1A5R A;  3SU8 X;  1DGJ A;  1LGR A;  2L52 A;  3C19 A;  3NG0 A;  2O2V A;  4GOC A;  1LM8 B;  3KUC B;  1STE A;  1JWM D;  4EZL A;  3W1S C;  4K3C A;  3M95 A;  4II3 B;  1QKZ A;  1QF6 A;  3A9K B;  3AE5 B;  4JGH B;  4W9C A;  2WXJ A;  4US9 A;  2LAS A;  2ZVN A;  3PZD A;  4O1N A;  4WH4 A;  3JW0 X;  4AP4 C;  1JAL A;  4KGT A;  4GN1 A;  1VD2 A;  1UZX B;  1ET6 A;  1BXT A;  1TS3 A;  1HZ6 A;  3FC4 A;  2XK5 A;  1FNV A;  3HHM A;  4LTU A;  2AEH A;  2FE8 A;  4IKG A;  2WXR A;  4ZHO A;  2C9W B;  2JSV X;  2HE7 A;  4PS8 A;  3O65 B;  3IVF A;  1HQR D;  2MSE D;  3BIN A;  2O6V B;  3AE2 B;  1Q0W B;  1KLG D;  2QEJ C;  2IO3 B;  3Q69 A;  2KT7 A;  2D2Q A;  1F2R C;  2PE6 B;  2NBU A;  3A9K A;  3DBL I;  2LWP A;  1FRR A;  1E8X A;  1WE6 A;  3QJZ A;  4G50 A;  2A5U A;  1QOF A;  3Q2A C;  3UGB B;  4CQN A;  3DWG C;  3MP9 A;  1I4R A;  3ZXV A;  4HKZ E;  3BVG A;  2Y5C A;  3WCQ A;  1ENF A;  2QC8 A;  3RNB C;  1N5X A;  5D6J B;  2VH1 A;  2MP2 B;  4W9K A;  1E90 A;  3NS8 A;  5DPW A;  2BB5 A;  3NS1 A;  4AJY B;  1FCL A;  1FMA D;  2TSS A;  1E6E B;  1UF0 A;  1V5O A;  4MM3 A;  1BML C;  5CTR C;  4KDI C;  1WXA A;  2O6V A;  1E10 A;  4HJG E;  1WGR A;  3AUL A;  2KJ6 A;  3PZ7 A;  2KWU B;  1MVK A;  2O6V D;  5FK9 C;  4HDO A;  3BK1 A;  2WXO A;  1L0Y B;  2FUG 1;  3VDZ A;  3QAQ A;  3VQI A;  4WJN A;  4A3O A;  3V05 A;  3WAL A;  3CF6 E;  3IHP C;  5EDS A;  3C0R B;  3AE8 B;  2LXA A;  3T3O A;  2INN E;  2KDE B;  2LVP A;  5BYS A;  1FEH A;  2N9P C;  1ZP0 B;  3PS6 A;  4MH8 A;  3BZD B;  4TMA B;  3AEF B;  2IDY A;  3Q8A A;  1VDV A;  1ZXI A;  2EMT A;  1WGD A;  2MWS B;  2K6D B;  1R4M I;  1TTN A;  2FCN A;  3GB1 A;  4TKN A;  3UIN B;  2DNF A;  1E0Z A;  1ZOY B;  1SBB B;  3R8B A;  3KUZ A;  3PLV A;  1CJE A;  3Q8B A;  2N1W A;  2LVQ A;  1IBX B;  5DPR A;  2NBV B;  2FNJ B;  3ZIM A;  4XX5 A;  1EU4 A;  2L05 A;  2CU3 A;  1WRD B;  3OLM D;  4KV2 A;  3MJW A;  4CHK A;  4KGS A;  3P4R B;  4RGT A;  5BMH A;  2MBO A;  1R4N I;  4HRS A;  2C60 A;  4C80 A;  1B9R A;  1OQR A;  1S1Q B;  2WDT B;  1HTQ A;  4PT5 A;  3VH4 B;  2FCM A;  3E9S A;  4AUQ C;  4W9J A;  2V4I B;  2DZI A;  5D94 A;  3VR9 B;  3ETR A;  1UEL A;  1V5T A;  2QHO A;  3ZYY X;  2KWC A;  3DVG X;  3GP7 A;  4YSZ B;  2Z0E B;  1D5M C;  5IA7 A;  4NPN A;  1GB4 A;  1IBX A;  3ZDM C;  2K8C A;  1EU3 A;  2WWZ A;  1H4R A;  3D32 A;  1PDX A;  1K8R B;  3L17 A;  2M17 A;  3NRZ A;  3N1Y C;  4RF0 A;  2D3C A;  3ZJU A;  4IC7 B;  4LJP B;  4YTM B;  2ZNV B;  1YNT E;  3P4P B;  2L3Z A;  1G6J A;  1BT0 A;  3MFG A;  3VTW A;  1QQR A;  4MAC A;  3A4R A;  3W5V B;  3HVD A;  5LXH A;  1SEB D;  1YJJ A;  4FJY A;  2LEK A;  3W9C B;  4KKJ A;  1I4X A;  4IM0 A;  1WMH B;  3FAH A;  4AJW A;  1QOB A;  1XD3 B;  1SIF A;  3ZKJ C;  2KQ4 X;  3P1M A;  3DBH B;  2D5G A;  2GOW A;  4EKU A;  3AXC A;  1WRI A;  2KK8 A;  4QAY A;  2ZPY A;  4HPP A;  2LHD A;  4CYE A;  4G0N B;  1ZPS A;  2L8J A;  3L16 A;  2D10 A;  1WR6 E;  4BFR A;  3R7R A;  1SSN A;  1EWY C;  5HG2 A;  2DZK A;  4NAM A;  1WMH A;  3ZRF A;  1EO6 A;  3AED B;  2CU1 A;  5JH5 C;  3SD5 A;  4NQK E;  4P1C C;  5KHO A;  1KFY B;  4WWP A;  3L54 A;  2KJR A;  1VRA B;  2RMM A;  2MLB A;  2MX2 A;  4K81 A;  5E6O A;  4KZC A;  1OFF A;  3IG3 A;  2DAF A;  4ICU A;  5G55 A;  4XDC A;  3KLS X;  2ZVO A;  3AE3 B;  1YN4 A;  1S3S G;  2JT4 B;  3JYU A;  3UF8 A;  1TY0 A;  5BMG A;  2OHF A;  1VCB A;  1SE3 A;  2JYE A;  5C2T B;  2V3S A;  2MQJ A;  2G45 B;  1PFD A;  4S0R A;  4OZC A;  2XN9 C;  1QLB B;  1ZW7 A;  3UIO B;  1N62 A;  1YJ1 A;  2B3A A;  5FR6 A;  1XLN A;  4FXC A;  5LLI A;  2PEA A;  5CHV C;  3AEG B;  2QCZ A;  2PJH A;  3Q8F A;  5J2R A;  5DCN A;  1T0R C;  1E9M A;  1SXT A;  4AWJ A;  1I4Q A;  5EE9 A;  3Q3N C;  4GB9 A;  2L76 A;  3M3J A;  3VRA B;  2HTH A;  2D3B A;  2FCS A;  2MBH A;  1GPX A;  2ZNV C;  3ZO5 B;  4RMA A;  1CQV A;  3Q3J A;  2H88 B;  4IM2 A;  1UUP A;  4HPM B;  4OVV A;  3B2F A;  4REZ A;  3MC8 A;  3DWM A;  3V6C B;  3P42 A;  4B6W A;  4PS3 A;  2JPH A;  2IBI B;  4BZA A;  1NYQ A;  1L4D B;  1K53 A;  2IND C;  2LXC A;  3BVZ A;  4PYZ A;  4XWT A;  3V3X A;  4JX1 C;  1NDD A;  5TSS A;  5BMI A;  1UD7 A;  1SE2 A;  2ZCB A;  2WU5 B;  2W54 A;  2WGS A;  1FM0 D;  1OEY J;  3N20 C;  1I35 A;  3W1Y A;  1ZDX A;  1I4H A;  3QAR A;  4WAA A;  2ZW1 A;  1SF0 A;  2RGF A;  4WJQ A;  4II2 B;  5HHD G;  1TT5 B;  3I3T B;  4YSY B;  4DWF A;  3LYY A;  1IP9 A;  2KHW B;  2N7D A;  2CR5 A;  2RPV A;  3GE8 C;  1V6E A;  2K39 A;  3IBE A;  3AB5 A;  1VZ8 A;  1GOZ A;  2L7R A;  2J53 A;  1C76 A;  4USA A;  2SAK A;  1VJK A;  2JXT A;  1V9J A;  1XEE A;  2KDF B;  1J7C A;  4A9A A;  3BY4 B;  4I6P A;  3AN1 A;  3IAM 1;  3H6N A;  4E71 A;  4URK A;  2KTR B;  2WDQ B;  4C7Z A;  3QK0 A;  4F7Z A;  1C1Y B;  3K9O B;  4GU2 A;  4K3B A;  4P1B C;  1WWT A;  2SEB D;  2N0S B;  1MI0 A;  3A4S C;  1T5X D;  4IOI E;  3VUX A;  1ZXH A;  2X8X X;  2KJH B;  3KUD B;  3QC8 B;  3DHI C;  3MHS D;  2KWD A;  1EM7 A;  4K7S A;  1I7H A;  3GZN I;  1BUI C;  2NTT A;  3OAW A;  3PZ8 A;  4G3X B;  2K22 A;  3RNG C;  4AS1 A;  3PRP B;  5AZG A;  1OTR B;  3QQ8 B;  2W9N A;  3KW5 B;  1JCK B;  1RWS A;  4LCD E;  4FLH A;  2KTR A;  4IDI A;  4E3C A;  2AL3 A;  2W82 A;  1TBE A;  3OJ4 B;  2KC2 A;  1R4N B;  3B1L X;  5JHB A;  1Q10 A;  4MJS B;  1WZ0 A;  1PYW D;  1T0S C;  1L2N A;  1F0Z A;  4L23 A;  1RAX A;  2KKC A;  4XYC A;  2PTL A;  1XLQ A;  3DVN U;  4OZB A;  3RZF A;  2I38 A;  2DWQ A;  4RGM A;  3U52 E;  2D3A A;  4MSM B;  1SJH D;  4M0W B;  5T8I A;  3BII D;  2M8S A;  3ALB A;  4KIK B;  1WYG A;  2MCN B;  4XC2 A;  3PVL A;  3WA0 A;  3LDZ E;  3IAS 1;  4MJS A;  4BKS D;  2JZZ A;  1N6Z A;  2WXP A;  4ZYS A;  2FAZ A;  3DHH C;  2XEW A;  2YVC A;  2V0G A;  3EUB 2;  1GNU A;  1WIA A;  3T8M A;  4RM8 A;  2E3T A;  2C7M B;  1WXQ A;  4GDK B;  4C4V B;  2REX A;  1E7V A;  2WNM A;  4M0W A;  2IGH A;  1J7B A;  4KSL C;  1FNU A;  4KIK A;  4ACF A;  2INC C;  2L0F A;  3APD A;  4RFB A;  2JY6 A;  2IPK D;  4LDT B;  3T9L A;  2QMT A;  3U8Z A;  2RDB C;  3TEY A;  4BOZ B;  3PT2 B;  3KH0 A;  5D2M B;  3AEB B;  1AAR A;  1K50 A;  1UBI A;  3SFD B;  3UQA A;  3VTV A;  2BS4 B;  3SDL C;  1JRP A;  2BQQ A;  3RPF C;  2KD0 A;  3NVV A;  3TL5 A;  4HCN B;  4GDK A;  4DXA B;  4C4V A;  1MFW A;  4GXB A;  3LJ3 A;  5IP4 D;  2OED A;  4DDI D;  4LNI A;  4J6I A;  3ZUN A;  3H9D A;  4FA6 A;  3RFZ B;  1I4G A;  3RYT A;  1KLU D;  3TMP B;  3ZW3 A;  2JVC A;  2FIF A;  3WAN A;  3ONS A;  4LDT D;  2MW5 A;  3MTN B;  1C78 A;  3EC8 A;  4TUU A;  4W9H A;  3ZQ4 A;  2MBE A;  5JHA A;  1AYF A;  1OQY A;  1WJ6 A;  1MPE A;  2EEL A;  4AQ7 A;  2LJ5 A;  4K7W A;  1XF5 L;  2BS3 B;  3Q8C A;  1JRO A;  4KSK C;  3Q3M C;  2KX3 A;  3B08 A;  4KVG B;  2IJ0 A;  2MJD A;  4WAF A;  2MP2 A;  3C8Y A;  4OHJ A;  1P9D U;  2WXK A;  1TZO A;  1HTO A;  2LHE A;  4LNK A;  2LFI A;  4DK5 A;  4B9K A;  3MJ5 A;  4LK0 M;  5EE1 A;  2UU7 A;  2ZZP B;  5IOI A;  3RMK C;  2WP9 B;  1F2R I;  2W3S A;  1TS4 A;  3Q3O C;  1JW9 D;  5L83 A;  3BYT B;  2LGI A;  4JE3 B;  4LLG M;  1K52 A;  2HJ8 A;  2JX5 A;  1E8Z A;  1D5Z C;  4YWG G;  1F52 A;  1WJ4 A;  3PLU A;  2EKI A;  3H7S A;  2JF5 A;  2LGX A;  4HEA 1;  2NCN A;  1E8W A;  1WGY A;  2IY1 B;  2PE9 A;  3VHT C;  4BKG A;  4DQO C;  2JZP A;  2V9H A;  1OGW A;  2BS2 B;  4YXD B;  1RM6 C;  1Q5W B;  1TY2 A;  2WXG A;  3R7Q A;  1JWS D;  1VR9 A;  2LRU A;  4JWS C;  4UDU C;  2KTF A;  3TBL D;  4M02 A;  1F9J A;  4JWU C;  3OG5 A;  1KH0 A;  2V1Y A;  1FFV A;  4RM9 A;  1RFA A;  3N1X C;  1L0V B;  2BBC A;  1X1M A;  4N59 A;  3A9J B;  2LGY A;  2AX5 A;  2V4L A;  2HJ1 A;  1E7P B;  4WQM A;  5J18 A;  2J0J A;  1Q1O A;  2GBJ A;  1XLP A;  5BYQ A;  2FUH B;  3ZXR A;  3DBR I;  3AEE B;  4DBG A;  4BVU C;  3PRZ A;  5FR3 A;  2AL6 A;  4ZRI A;  2KNB A;  2IO1 B;  1NI3 A;  3ECI A;  2C7N B;  2NPT B;  1ZUD 2;  2G3Q B;  1IYF A;  1TS2 A;  4ZRJ A;  4W9G A;  3WAM A;  4OVZ A;  2NTS A;  1WGG A;  3O13 A;  2KVZ A;  1VZ6 A;  2LUM A;  1WM2 A;  4HVB A;  2R61 A;  2J42 A;  3RN9 C;  3DCG A;  2N7J A;  3A9J A;  3PTF C;  1MHH E;  2PIA A;  3RNA C;  2JYT A;  3AE4 B;  3RZW C;  1RFK A;  4RF1 A;  2J4X A;  3KYD D;  4NJ7 A;  4WJO A;  5EE0 A;  2G4D B;  4ZOH C;  2NVU I;  2FCQ A;  4IWO A;  4DDG D;  4MH0 E;  5DPS A;  3S2A A;  5D3I B;  4DHZ B;  2NPT A;  3NVZ A;  2CHW A;  1WXV A;  1HEZ E;  1DOY A;  3EGR A;  2JQR B;  2PMV A;  1Y8R C;  3EA6 A;  4IWP A;  4LNN A;  2PKO A;  4A20 A;  3IFW B;  2MJE A;  2N1V A;  1WY8 A;  4C7Y A;  5MPO A;  4M8N A;  2KMC A;  1UWX A;  1C79 A;  1P0R A;  5BO4 B;  2ZEQ A;  4MGI E;  3AE6 B;  3ENE A;  5AZH A;  2MEK A;  3ZTD A;  4NJ6 A;  2N9L A;  1WR1 A;  4A8X C;  1R7S A;  3ZNH B;  1Z2M A;  4L1B A;  2M1M A;  1TJE A;  1N63 A;  4B95 A;  5AUI A;  3GS2 A;  3NJT A;  4FHJ A;  3WIM A;  2C5L C;  3P4S B;  3BVM A;  1FXA A;  5DPT A;  2BT6 A;  2WX0 A;  4G11 A;  1TKG A;  5C1Z A;  2KDB A;  2QIE B;  4WUR A;  3HM3 A;  2D3G A;  2YEP B;  1TYG B;  1UH6 A;  1MJD A;  3GOE A;  2JXX A;  3U4E G;  1V81 A;  2K3U A;  2DHZ A;  4US8 A;  5L95 C;  3OWE B;  1FCC C;  4IM3 A;  4P16 A;  3RNE C;  2MRP A;  1HE8 A;  3NZS A;  5LNK 1;  4GMV A;  1WX7 A;  3AE7 B;  4FAD A;  1C3T A;  3CST A;  2KFJ A;  1FRD A;  1AN8 A;  3HK0 A;  1L7Y A;  1UGM A;  2QDF A;  1SJE D;  2ICI A;  1HZ5 A;  3HVZ A;  2Y5P A;  3W2D A;  5J17 A;  3DBL B;  1XCT L;  4EZK A;  4BOS C;  3RNF C;  2BYT A;  4RH6 A;  3BWU D;  3RT3 B;  2WLB A;  1WJU A;  3ZNG C;  2D11 A;  3NZU A;  2GRI A;  1I4P A;  5G5H A;  1TKY A;  2K1F A;  1YQB A;  2NS5 A;  1F77 A;  3SFE B;  2WXL A;  3HM6 X;  1YQ3 B;  3KVF B;  4MT5 A;  2GI9 A;  3PV1 A;  1H8C A;  5D7G A;  4E74 A;  3RD2 A;  1SE4 A;  3R66 C;  1L4Z B;  4OVU A;  2BW2 A;  3IXS A;  3TEZ A;  3M62 B;  3L4P A;  2KLC A;  1JML A;  3R2I A;  2JRI B;  3TCA A;  4TQ0 A;  1XCQ L;  2WYQ A;  1FXT B;  2K5P A;  2KZR A;  3ZNZ B;  2WHI A;  5HFY A;  1YN5 A;  4EEW A;  1JRU A;  3JVZ X;  4BKT A;  2JZ3 B;  4M00 A;  2R2Q A;  3MC0 B;  3Q8E A;  4W9E A;  1T0Y A;  1LQB A;  1Z5S B;  1LO5 D;  4ANU A;  2GBK A;  1SIJ A;  3M63 B;  1ISN A;  1YX5 B;  2INP E;  4FN2 A;  2DEN B;  2RSU A;  2PLP A;  5HKH A;  3HRD D;  4W9D A;  3VUW A;  3VFK A;  4M8M A;  2GBM A;  1TZ1 A;  4WWM A;  1GAQ B;  3VUY A;  3P4Q B;  1CMX B;  4A90 A;  3DVG Y;  1PGX A;  5BYR A;  3H8H A;  1SGH A;  2J52 A; 
#chains in the Genus database with same CATH homology
 1K50 A;  3VR8 B;  1ET9 A;  3VR9 B;  3ETR A;  3SFD B;  3ZYY X;  4YSZ B;  3GP7 A;  1YMH E;  3W1S A;  1D5M C;  2BS4 B;  4ITK A;  3TEX A;  1JRP A;  1GB4 A;  1TKE A;  3LXF A;  3RPF C;  4NJC A;  1IBX A;  1ROE A;  1EU3 A;  3NVV A;  1UGJ A;  3NVY A;  3U2S C;  1PDX A;  2WU2 B;  1C4C A;  1ESF A;  2Z8L A;  3NRZ A;  1V1O A;  2OED A;  4RF0 A;  3AEA B;  3NZ3 A;  3ZJU A;  1L6V A;  2XNA C;  4YTM B;  1HA5 A;  1CZP A;  1YNT E;  3P4P B;  4YSX B;  3RFZ B;  3MFG A;  3SEB A;  4GLS C;  1I4G A;  1QQR A;  1D4B A;  4MAC A;  1KLU D;  2WDV B;  4NAW B;  3W5V B;  3HVD A;  1DYQ A;  1VZ7 A;  1D6E C;  1SEB D;  3B2G A;  1YJJ A;  2VZK B;  2LEK A;  2WXI A;  3W9C B;  2WDR B;  1I4X A;  1IGD A;  4KKJ A;  5H92 C;  3FAH A;  4KX6 B;  1QOB A;  2G9H D;  1ACC A;  1KRH A;  1C78 A;  1PUT A;  5E6J A;  3J9C A;  2WXF A;  4ZHP A;  3BK2 A;  4N58 A;  3ZQ4 A;  4WIP A;  2PVO D;  4RCO A;  1AYF A;  1MPE A;  4GDL B;  2EEL A;  1N60 A;  2KQ4 X;  4AQ7 A;  5D3D A;  3P1M A;  2LMC A;  5HI1 A;  2D5G A;  5JXV A;  1KF6 B;  5I4D A;  1XF5 L;  2BS3 B;  3ABV B;  1XO3 A;  2WQY B;  3PO0 A;  3Q8C A;  4ZRQ A;  1WRI A;  2K0P A;  3IT6 B;  1JRO A;  4JPS A;  1NEK B;  1DOI A;  1IUE A;  2LHD A;  2IJ0 A;  2KN4 A;  2MJD A;  1QOA A;  1ZPS A;  3I9V 1;  4WAF A;  4OHJ A;  2WXH A;  3C8Y A;  3NUH B;  2WXK A;  1TZO A;  1YQ4 B;  1P7F A;  1GB1 A;  1AW7 A;  2LHE A;  3AV8 A;  2H89 B;  5H8Y E;  4XWW A;  2LFI A;  4Q2J A;  1JWA D;  1N61 A;  5G5G A;  2V3N A;  1QIL A;  1SSN A;  1EWY C;  5HG2 A;  1YN3 A;  3MJ5 A;  4LK0 M;  4A55 A;  5EE1 A;  4NAM A;  3FIL B;  1HXY D;  2JU6 X;  2WP9 B;  4RGO S;  2VZK D;  3AED B;  3AMZ A;  1F2R I;  2W3S A;  1AWD A;  2KDM A;  3URY A;  1IGC A;  2K9X A;  1TS4 A;  1JW9 D;  2X38 A;  1JWU D;  1KFY B;  3BYT B;  2FBW B;  2LGI A;  4B0M A;  1D5X C;  3MHZ A;  1VRA B;  4JE3 B;  2ZW0 A;  2RMM A;  4LLG M;  1K52 A;  2JX5 A;  3TEW A;  1D5Z C;  4YWG G;  4A6Q A;  3P63 A;  3KWV A;  1OFF A;  2V3P A;  2EKI A;  3AM9 A;  2PVG C;  2Y3A A;  1PGB A;  4XDC A;  3UI3 A;  3KLS X;  3KWL A;  4HEA 1;  1N5W A;  4YT0 B;  3B9J A;  3AE3 B;  1YN4 A;  1XXG A;  4DQO C;  3TUO A;  1NYR A;  2JZP A;  4YXD B;  2BS2 B;  3FIL A;  3U7Z A;  1RM6 C;  1TY0 A;  5BMG A;  2OHF A;  2L32 A;  3W5U B;  1SE3 A;  1TY2 A;  2WXG A;  1JWS D;  1TS5 A;  1VR9 A;  4JWS C;  4UDU C;  2KAC A;  4MM3 B;  2JYE A;  5C2T B;  1UWM A;  3CIR B;  1T6B X;  1PFD A;  3ZJV A;  4OZC A;  1L0X B;  1QLB B;  1V8C A;  2QIL A;  2XN9 C;  4ARC A;  1N62 A;  2M19 A;  4JWU C;  4D2K A;  1KH0 A;  4L2Y A;  1XLN A;  4FXC A;  1FFV A;  2YEP F;  1MHX A;  5EE3 A;  1L0V B;  2BBC A;  3AEG B;  1FD6 A;  4HRO A;  3ZJT A;  4N59 A;  3Q8F A;  2RDG A;  2AX5 A;  1E9M A;  1SXT A;  1Y56 A;  2DYM A;  1NEN B;  4NZL B;  3I57 A;  3TSS A;  3HUI A;  1E7P B;  4WQM A;  2MJ3 A;  2G1E A;  1I4Q A;  5EE9 A;  1C9F A;  4R3D A;  1XLP A;  1C4A A;  2WXM A;  5BYQ A;  2NMQ A;  3AEE B;  3VRA B;  2DBY A;  1GPX A;  5FR3 A;  4DXG A;  3LB8 C;  1NI3 A;  5AUK A;  1CQV A;  4ZRP A;  2H88 B;  2WXQ A;  2L1A A;  1UUP A;  2IGD A;  1ZUD 2;  1TS2 A;  3B2F A;  4REZ A;  1FO4 A;  3DWM A;  3P42 A;  2MH7 A;  4OVZ A;  2NTS A;  1C77 A;  1NYQ A;  1L4D B;  3O13 A;  1L5P A;  1K53 A;  4YTP B;  1VZ6 A;  2LUM A;  1L6U A;  4XDD A;  1UNS A;  3BVZ A;  2R61 A;  4XE0 A;  3CWI A;  2J42 A;  4TSS A;  1QT9 A;  3KQ4 A;  2N7J A;  3IT4 B;  1MHH E;  2I2Y A;  1FNW A;  2WS3 B;  2PIA A;  2JYT A;  3AE4 B;  1RFK A;  4XWT A;  4RF1 A;  2M0A A;  2J4X A;  3V3X A;  4JX1 C;  5TSS A;  3E56 A;  2DYO A;  1B1Z A;  4C56 C;  5BMI A;  5EE0 A;  1A70 A;  4OZA A;  4ZOH C;  1SE2 A;  5FKA C;  3SR6 A;  1C4P A;  2CJN A;  2CJO A;  2WU5 B;  2W54 A;  1P7E A;  1FM0 D;  1OQQ A;  5D3I B;  1ZDX A;  1YJI A;  1I4H A;  2AQ2 B;  1K51 A;  1ZDV A;  3NVZ A;  2LJI A;  2ZW1 A;  1SF0 A;  2BTE A;  3R2T A;  2ACZ B;  1HEZ E;  2PW9 A;  5HHD G;  2GB1 A;  1DOY A;  3EGR A;  1DGJ A;  2L52 A;  3AE1 B;  4YSY B;  3LYY A;  2JQR B;  2PMV A;  3EA6 A;  2DLB A;  2PKO A;  1STE A;  2RPV A;  1JWM D;  1KTK A;  1VLB A;  1QKZ A;  2MJE A;  1QF6 A;  3AE5 B;  3AB5 A;  1VZ8 A;  4C7Y A;  5MPO A;  2WXJ A;  1GOZ A;  1UWX A;  2J53 A;  4US9 A;  1C76 A;  4USA A;  1C79 A;  2SAK A;  1VJK A;  2JXT A;  1SB3 C;  1XEE A;  1J7C A;  4A9A A;  3AE6 B;  2MEK A;  4O1N A;  4WH4 A;  1JAL A;  4KGT A;  4EE2 A;  3AN1 A;  2N9L A;  2BB6 A;  4H2A A;  1ET6 A;  3IAM 1;  1BXT A;  1TS3 A;  3BYY B;  2WDQ B;  1HZ6 A;  4A8X C;  4C7Z A;  3FC4 A;  2N9K A;  1FNV A;  2E6X A;  1R7S A;  2FE8 A;  4LTU A;  1V1P B;  4IKG A;  2WXR A;  4ZHO A;  2JSV X;  1WWT A;  2SEB D;  1EWC A;  4L1B A;  1TJE A;  1MI0 A;  2N0S B;  1N63 A;  1JWB D;  1HQR D;  5AUI A;  3GS2 A;  3AE2 B;  4OW0 A;  1T5X D;  4IOI E;  1KLG D;  4DXF A;  2QEJ C;  3P4S B;  4HKQ A;  1ZXH A;  3Q69 A;  3BVM A;  1FXA A;  1F2R C;  2BT6 A;  1TKG A;  2KWD A;  1FRR A;  1EM7 A;  2W3R A;  4YTN B;  1I7H A;  1BUI C;  2NTT A;  2QIE B;  4WUR A;  1QOF A;  2B76 B;  3PZ8 A;  1T3Q A;  4B0E A;  4CQN A;  3DWG C;  2YEP B;  1TYG B;  2K22 A;  2L83 A;  1I4R A;  3MP9 A;  4HKZ E;  4AS1 A;  2QSD A;  2Y5C A;  3BVG A;  3WCQ A;  1ENF A;  3U4E G;  2K3U A;  1N5X A;  1JCK B;  2KAJ A;  3AH7 A;  4US8 A;  1RWS A;  2WXN A;  1FXI A;  3OWE B;  5GXG B;  2BB5 A;  3NS1 A;  4IDI A;  1V97 A;  1FCL A;  1FMA D;  2TSS A;  1E6E B;  1FCC C;  4TQ1 A;  1V1P A;  2RDH A;  5C3J B;  2Q5W D;  4KKI A;  4P16 A;  2W82 A;  1BML C;  1QOG A;  2JWU A;  5LNK 1;  1NVI D;  1Q10 A;  3ZGZ A;  3AE7 B;  4N6E B;  1PYW D;  1FRD A;  1F0Z A;  1E10 A;  2AQ1 B;  1AN8 A;  4HJG E;  4L23 A;  1JQ4 A;  3PZ7 A;  1MVK A;  2M56 B;  1SJE D;  5FK9 C;  2ICI A;  1FIQ A;  1HZ5 A;  2PTL A;  1XLQ A;  3BK1 A;  1WGK A;  2WXO A;  1L0Y B;  2FUG 1;  2Y5P A;  3HVZ A;  3W2D A;  3VQI A;  1CK1 A;  3V05 A;  4OZB A;  1XCT L;  3NVW A;  2I38 A;  2DWQ A;  2HTM E;  4RGM A;  2BYT A;  4RH6 A;  3AE8 B;  1PGA A;  3BWU D;  3U52 E;  1SJH D;  2WLB A;  3AEC B;  1J7A A;  3BII D;  2IGG A;  5T8I A;  3T3O A;  2INN E;  2GRI A;  1I4P A;  5G5H A;  1TKY A;  5BYS A;  2QJL A;  2AQ3 B;  3T3N A;  1FEH A;  1F77 A;  3N9Y C;  3SFE B;  2WXL A;  1WYG A;  1ZP0 B;  2HDE A;  4MH8 A;  3BZD B;  4TMA B;  3AEF B;  2IDY A;  1YQ3 B;  1FFU A;  4MT5 A;  1ZE3 D;  2GI9 A;  3IAS 1;  3Q8A A;  1VDV A;  5D7G A;  1ZXI A;  2ONQ A;  2WXP A;  4KGR A;  4ZYS A;  1SE4 A;  4J3O D;  1L4Z B;  2W55 A;  4RGN A;  2BW2 A;  3EUB 2;  3IXS A;  3TEZ A;  2V0G A;  3GB1 A;  3L4P A;  1JML A;  3R2I A;  1M4V A;  4ARI A;  4TQ0 A;  1E0Z A;  1XCQ L;  1ZOY B;  1SBB B;  2K5P A;  3R8B A;  2E3T A;  3AE9 B;  1CJE A;  3Q8B A;  1IBX B;  1RYJ A;  5HFY A;  1YN5 A;  1WXQ A;  1XLO A;  4GDK B;  3MC0 B;  1EU4 A;  3Q8E A;  2WNM A;  4M0W A;  2CU3 A;  4P6V F;  2IGH A;  3VRB B;  1J7B A;  1DOX A;  4KGS A;  1LO5 D;  3P4R B;  1SIJ A;  4RGT A;  5BMH A;  2INP E;  1FNU A;  4RFB A;  2KMM A;  2PLP A;  4HRS A;  3HRD D;  2IPK D;  4C80 A;  1B9R A;  2QMT A;  1OQR A;  3TEY A;  4WWM A;  2ON8 A;  4PT5 A;  1GAQ B;  3P4Q B;  3E9S A;  1WSP A;  4RNA A;  4A90 A;  1PGX A;  3AEB B;  5BYR A;  3H8H A;  2J52 A;  2V4I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...