1Q10A

Ensemble of 40 structures of the dimeric mutant of the b1 domain of streptococcal protein g
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
MQYKVILNGKTLKGETTTEAVDAATAEKVVKQFFNDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Immunoglobulin G binding protein G
publication title A Protein Contortionist: Core Mutations of GB1 that Induce Dimerization and Domain Swapping
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
total genus 9
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1q10A00
1PGBA 1FCLA 1HZ5A 1IGCA 2KQ4X 5HHDG 3FILA 2JU6X 5HG2A 1FD6A 1K53A 1XF5L 2JWUA 1MPEA 1K52A 1PGAA 1PGXA 3UI3A 4HKZE 1EM7A 2LHEA 2GI9A 4KGRA 1MHHE 2KWDA 2KDMA 2N7JA 1GB1A 2J52A 4IKGA 3GB1A 1UWXA 5JXVA 2PTLA 4D2KA 1MI0A 2NMQA 1ZXHA 1HZ6A 4WH4A 4KGSA 4GLSC 2QMTA 2JXTA 1P7EA 2QSDA 1K50A 2LUMA 1MVKA 5HI1A 2LGIA 1F2RC 2ZW1A 1HEZE 2JZPA 5HFYA 2GB1A 2PLPA 1MHXA 2KN4A 1GB4A 2EELA 1P7FA 2ON8A 2ZW0A 2I2YA 2ONQA 2PW9A 4OZAA 3V3XA 1IBXB 4OZCA 4IOIE 1YNTE 3MP9A 1XCTL 1K51A 1IBXA 1YMHE 5BMHA 2RMMA 1IGDA 4OZBA 1JMLA 2LHDA 1FCCC 1QKZA 5BMGA 1C9FA 2RPVA 1KH0A 2J53A 1Q10A 2JSVX 4KGTA 2KACA 4HJGE 1F2RI 2K0PA 2OEDA 2IGHA 1XCQL 4MACA 3FILB 2N9KA 1D4BA 5BMIA 2N9LA 2IGGA 2I38A 2IGDA
chains in the Genus database with same CATH superfamily
3ZTCA 3H6NA 1WJ4A 1HZ5A 1IGCA 1WJNA 1XEEA 4GDKB 4NAMA 2L05A 4M01A 1GNUA 3AV8A 2I1KA 1VRAB 3KWLA 2LGYA 1L4DB 3KLSX 3W1SA 2JZ3B 4US8A 2GBKA 4B95A 2BYFA 4K7UA 2CHXA 3GP7A 4E74A 2V1YA 3ONSA 4RCOA 3ZJTA 5CX3A 2L1AA 4BKSA 2ASQA 4NZLB 2EKEC 1XD3B 3DQVA 5IN7A 4P16A 2LGIA 3ZNZB 1U4AA 2IY1B 4DK5A 2GBRA 2AQ1B 4W9EA 4BFRA 1I4PA 3AEEB 3VUWA 2ZW0A 3QARA 2WWZA 3O65B 4O1NA 4B9KA 2R2OA 3DBLB 2WXPA 1QOAA 1I4XA 3UGBB 4FA6A 2WGSA 5BO4B 2KFKB 5C1ZA 2QCZA 4AP4C 1SF0A 1K51A 1L0XB 1JALA 4N59A 4TQ0A 2J7QB 1A5RA 2RMMA 3KUZA 4M0WA 1EWCA 4FJYA 1VZ8A 2DAJA 1YJ1A 2HJ8A 1XQQA 1J0GA 2KLGA 4II2B 1N62A 3EGRA 3R2IA 4FLHA 1P9DU 2N0SB 3APFA 1JWSD 3VAWA 4AQ7A 4GIVA 3EECA 5CHFA 1DOIA 4WAFA 3GS2A 2NVUI 2H88B 2INNE 2ZZPB 3PSEB 2C7HA 1ZGUB 2AEHA 5G5GA 3AU5A 1VDVA 3M62B 4LNIA 2KT7A 2AYOB 2WX0A 1D3ZA 4RGNA 4MJSA 4RF0A 1EUVB 3MC0B 1TS3A 2QEJC 4LDTB 3TIXA 5GXGB 1PGXA 2LEKA 1WSPA 4YL8A 3NUHB 3U4EG 3QCAA 4IWQA 2N9XA 3BIID 2TSSA 1SSNA 4US9A 3EFUA 5GMVA 1RLFA 4W9LA 3IHPC 3M63B 1ZOYB 3HM3A 2KMCA 4W9DA 1UWXA 5BYRA 1RFKA 2BTEA 4HDOA 1ZXHA 2W82A 1LFDA 2CR5A 1M4VA 2NR2A 3LJ3A 1TS5A 1UBIA 1P7EA 2DNFA 4NY0A 1SIJA 3L54A 4W9KA 4FJZA 4L23A 5IO9A 2MA9B 1F52A 2CHZA 4K7WA 3NOBA 3MJ5A 3QJZA 4MDKE 1SE9A 4JLCA 3Q3FA 4CYEA 2ON8A 1YX5B 2MW5A 1ZPSA 1NEKB 3P2BA 3L08A 1UD7A 2FIDA 4CQNA 2CJOA 4AS1A 3AE9B 1JRUA 2WXOA 2O2VB 1E6EB 1VCBA 4HDQA 3VRBB 5AUKA 5C2TB 2D3CA 3TSSA 3CF6E 4A6QA 1E8YA 1L5PA 1FNVA 1SJHD 4BBNF 4C80A 1UGJA 1YN5A 1QKZA 3ZO5B 1YQ3B 2WXGA 1E5WA 2MJEA 3I9V1 2KXJA 3DWGC 3Q69A 4KDLB 4BKGA 2BYEA 1XLNA 2MCNB 4XGAB 2QILA 2J42A 2LRWA 3SDLC 1XO3A 2KDBA 2HTME 3EUB2 3J9CA 1N63A 2W3SA 1L0YB 2ICIA 5AZFA 5HG2A 2MH7A 2CS4A 2FAZA 4GU2A 4BVUC 3ZGZA 5DCNA 2D5GA 3UIOB 1Q0WB 2LASA 1R4MI 4LNFA 1WGGA 2WX1A 4XZ4A 3SR6A 3ETRA 2L32A 4XDDA 1YJJA 4LNOA 4RNAA 1YOVB 3H8HA 1SE4A 3IT6B 2QMTA 2WU2B 3H9DA 1KF6B 2XBBC 5CHVC 4HK2A 3DVGX 3DVNV 2XN9C 2REXA 1P7FA 1TBEA 1T3QA 3MFGA 3TEYA 3DBLI 3DOWA 1HE8A 1QOGA 3DWMA 4A20A 2C9WB 4KX6B 4HKQA 4NJ7A 2L52A 4KSKC 2C60A 4I6PA 2WXKA 1DOXA 2NBWB 2MEKA 3A33B 3L4PA 4K7SA 4YTNB 4DWFA 2KQSA 3V61A 4EZJA 1V5OA 2MX2A 3N3KB 4ZDVA 3BK1A 1KFYB 1WWTA 2FCMA 3SU8X 1KH0A 2KC2A 4ASWC 4KGTA 3JVZX 4WWOA 3OLMD 2WDRB 4YSYB 1V2YA 4AWJA 1OGWA 1JQ4A 4HVBA 1FXTB 2FCSA 5TSSA 3RUIB 1PFDA 1EO6A 4RFBA 3KH0A 1K52A 3RZWC 4W9FA 4MM3A 2KVZA 1TZ1A 3GOEA 1WX9A 1H8CA 2MP2A 2GI9A 4KGRA 2LVOA 2WXJA 2N1WA 3AE3B 2J52A 2IO1B 3DPDA 4IKGA 1WZ0A 3RN9C 2NMQA 2KTRA 3JW0X 3TEZA 1A70A 1MVKA 3I3TB 1I42A 4IW0A 3DHHC 1ROEA 2O6VB 1Y8RC 4WJQA 3KUCB 4ZYSA 1WXVA 2UU7A 3AULA 3APCA 4MEMA 1V86A 2C7NB 5LNK1 2DENB 3QX1A 4GDLB 3AE7B 2MBOA 2K6DB 2SAKA 3MP9A 3NZ3A 1XT9B 2KX3A 2Z59B 1WGYA 2DYMA 4RM9A 3V05A 3BK2A 3KYCD 2LI5A 3CMMB 1GG3A 2PVGC 3P63A 2PMVA 1MG8A 2WDVB 2XK5B 2L0TA 4B0MA 2J0MA 3SHQA 3RNCC 4DHZB 5IA7A 4XDCA 4BKSD 3NZUA 2D07B 1NYQA 4FJVB 1UNSA 2HE7A 3P4SB 5EE9A 1BT0A 3AU4A 3A9JA 1DGJA 2JY6A 1WM2A 5BMIA 1E9MA 1JROA 1ZKHA 3PRMB 3UIPB 1FRRA 2IGDA 4JGHB 3ZKJC 2M56B 3VDZA 1WY8A 3V62A 3ZNID 3ZDMC 2BB6A 1KOTA 1XF5L 2L7RA 2WXLA 1C3TA 3AEFB 3B2GA 1YIWA 3DBHB 2R61A 2OOBB 4RF1A 4KIKA 2IO2B 1EM7A 4MH0E 2KJ6A 2JRIB 1ISNA 1SE2A 1HTQA 4F1SA 4IG7B 4HJKA 3X0WA 1VR9A 2IJ0A 3B2FA 4J6IA 1SGHA 3WALA 4A55A 2QJLA 2QSDA 2DYBA 2KDFB 4IM2A 3JYUA 4BBNC 2MBBB 3Q8BA 2WXRA 4C56C 3ZXRA 1NBFC 2DX5B 2MBEA 4H2AA 3AEAB 2PKOA 4DXGA 4I6LB 3PHWB 3TEWA 1UH6A 3AE2B 3PZ8A 4ICVA 2M1MA 2BVCA 4DHJD 1KLVA 1J7AA 4KVGB 1WJUA 4K3CA 4HEA1 1VJKA 4G11A 2LFIA 1T0YA 3NHEB 1B1ZA 3R66C 1UWMA 3M95A 3ZIMA 1WJ6A 4FXCA 2C7MB 3NY5A 4OW0A 2BF8B 1SEBD 1IGDA 4GOCA 5D3IB 3QC8B 3IVFA 4E71A 3L13A 2JXXA 3ZRCA 3N20C 4RMAA 1T5XD 4MELA 4MH8A 1BUIC 2WXIA 1RYJA 1F2RI 4HJGE 1WZ3A 1WR6E 1JRPA 3WAPA 2IGGA 2M17A 4YXDB 1C4PA 2KN5A 3FC4A 1PGBA 3GE8C 3TBLD 4PS8A 4YWGG 3FILA 3DHIC 4K1RB 2B3AA 1M94A 3NZSA 2LWPA 1PGAA 4BAXA 3V6CB 5D3DA 3UI3A 4YSXB 3PO0A 3H7PA 3AEBB 4W9IA 5G5HA 2PVOD 5D6JB 1I4RA 1C4AA 2DLBA 3VUXA 1GJZA 1MI0A 1AARA 1TTNA 4M8NA 2WQYB 1P0RA 3W2DA 4F7ZA 1G6JA 3JSVA 1I4HA 3L0WB 3PS6A 3U7DA 1N61A 3RYTA 2GB1A 3RT3B 2KN4A 1R4MB 3DVNU 3U52E 4DXFA 5I4DA 5AUIA 2KQ7A 5IOIA 2ACZB 3HRDD 2ONQA 2PW9A 3ZQ4A 1TS2A 3EC8A 1DOYA 3Q3OC 2IPKD 3V6EB 5J2RA 2V0GA 1P98A 1BMLC 2KD0A 1IBXA 1L7YA 2KMAA 3BY4B 2IYDB 3PZDA 3DCGA 3Q3MC 1CMXB 2MP2B 3WANA 3IBEA 2MWSB 3SD5A 2J53A 3AXCA 3LB8C 1FXAA 2OJWA 2ZNVC 1E90A 2RDGA 4BZAA 1R4NB 3FKYA 3I5JC 4ANVA 4NAWB 1ZDXA 2BW2A 3PHXB 1STEA 4W9GA 2KTRB 1D4BA 3WIMA 1GUAB 2W3RA 3TCAA 3OG5A 2KWUB 1WX8A 2K8HA 2KX0A 4WURA 3E9SA 3HVDA 1L4ZB 3DBHI 4MGIE 3HVZA 3IAS1 3Q8CA 1WM3A 2HTHA 5L95C 1AWDA 2N9EB 4BOZB 3AI5A 2QHOA 5JXVA 2LZ6A 3QIJA 3ABVB 4HLEA 4TV3A 1QT9A 4KGSA 2XEWA 3C19A 1E7VA 5IKCM 2QC8A 4IC7B 2OJRA 2LGDA 2K25A 3KQ4A 3SEBA 2LJ5A 3AH7A 2LUEA 2BBCA 4EZKA 2LGXA 3A9JB 2KMMA 4M00A 2UYZB 3O13A 3V3XA 4AUQC 4EUTA 3SFDB 3T8MA 4A8XC 3AM9A 3UQAA 2ZNVB 3L10B 3VTWA 1Z5SB 4ZRPA 2Z0EB 1H4RA 1RRBA 1ESFA 3R8BA 3OJ3A 3PLVA 5CHWA 2LXCA 4R3DA 3ECIA 4REZA 2ZPYA 2NPTB 2PE9A 4CHKA 3NRZA 4KIKB 4W9CA 3WAMA 1UBQA 4GSWA 4L1BA 5FK9C 2JWZA 4ANXA 3A9KA 4M02A 1V97A 2KACA 4LLGM 4JE3B 2BT6A 3HUIA 2FCQA 2IO0B 2N9KA 3W5VB 3Q8AA 1ZUD2 5TR5A 5G55A 4WWPA 1YQBA 1V9JA 4C4VB 1D5ZC 4WAAA 3RNAC 3SFEB 3VR8B 3I63C 2KAJA 4ANWA 1TY0A 2JT4B 4W9HA 2RDHA 1X1MA 2X8XX 2DBYA 2W54A 3Q8EA 3NVYA 4KKIA 4LNNA 1GB1A 1HTOA 2LD9A 3W1SC 1PQSA 3APDA 4E3CA 3P4RB 1XLOA 1HZ6A 4WH4A 3GZNB 1N5XA 2D10A 5JHBA 2G1EA 3E56A 4OVUA 1F0ZA 1F2RC 3AECB 1FPYA 1GB4A 3M3JA 2EELA 1AYFA 3RI7C 1VD2A 2X38A 4C7YA 2RR9A 3RNFC 3PGEA 4WJOA 1XXGA 3U2SC 3HM6X 3KWVA 1UUPA 5MPOA 4HPMB 3RMKC 1NI2A 3NS8A 1D5MC 3LYYA 2DYOA 3P4PB 4HRSA 4WQMA 1V1PA 4JWSC 1JW9D 2BYVE 4Q2JA 3C8YA 2V4LA 3RFZB 2L83A 2WXNA 2CHWA 2JQRB 3GE3C 1R4NI 2RDBC 1C79A 2DZJA 2IDYA 1JWUD 2WLBA 2V3SA 3ZVVA 4P1BC 1TKGA 3H1UA 3L17A 2IZVB 2JU6X 2KJHB 1FD6A 2BKRB 5JH5C 4OVVA 4PS3A 1VLBA 2BPSA 1TYGB 1FFVA 1F9JA 4GDKA 4QAYA 4ITKA 4K3BA 1HXYD 1MHHE 1CJEA 2KDMA 4IWOA 1WGKA 2KVRA 2NBVB 1ACCA 1UELA 3B9JA 5AZGA 3EFCA 1I4QA 2JXTA 4KDIC 2WXMA 1JWBD 2MJDA 3QAQA 4XX5A 1WI0A 4BOSC 5HFYA 4N6EB 2BQQA 2K5PA 2PLPA 4NJCA 5E6PA 4GB9A 3H7SA 1FNWA 2NTSA 1FRDA 5J18A 1WGHA 4ZHPA 1WR1A 4N9F4 5HKHA 1WE6A 1ZDVA 4OZCA 2MJ3A 4GMVA 2D3AA 1YNTE 4KKJA 4M0WB 1XCTL 5IAAC 5C3JB 4X57B 1RFAA 1WYGA 1YMHE 3AE4B 1V8CA 2JUOA 3ZXVA 4ACFA 1CZPA 2KFKA 1OQQA 2V3PA 3HHMA 4XYCA 4TKNA 2E6XA 2AQ3B 1QOFA 3P42A 1L0VB 3NJTA 1SJED 2LHDA 2RPQA 1WRDB 1C77A 4A3PA 3NVWA 3OJ4B 4NQLB 2K3UA 4JX1C 3B0AA 4KSLC 2D3BA 1S3SG 2CU1A 3W9CB 3TEXA 2K9XA 4MJSB 3VVWB 2GBMA 5D7GA 4DHJB 3URYA 3R2TA 2FIFA 3ZW3A 4MT5A 1FCLA 2KQ4X 1PDXA 1J7BA 2CU3A 3Q6BA 5E6OA 2E3TA 1UZXB 4RM8A 4M8MA 2N7DA 2PEAA 5H92C 1RM6C 2PJHA 1N5WA 4JPSA 4ZRQA 4IM0A 2DWQA 3GB1A 1KTKA 1UF0A 3UF8A 2G9HD 3GZNI 2N9PC 4FULA 1GC7A 2MBHA 1WFYA 2WYQA 3PZ7A 3WCQA 4FN2A 2PPHA 2WXFA 3RCZA 1VZ7A 4WJNA 4I6NB 2D2QA 2ZEQA 2ZCBA 2GLSA 2JYEA 2YEPF 3T3NA 1FO4A 4IOIE 3KUDB 1EU4A 5BYQA 4DDGD 4P7IA 2HJ1A 5FR3A 4FHKA 1T0RC 3NS1A 5EE3A 4LTUA 2LMCA 2R2QA 3BWUD 2ZCCA 2RGFA 3RNGC 2O2VA 4AJYB 1JMLA 3MHSD 3RNBC 4PYZA 2A5UA 3AE5B 1WXQA 3ZRFA 3ZDTA 5BYSA 1IPGA 3BVGA 2IY0B 3NVVA 3T9LA 3U8ZA 2ZJDA 4IM3A 3VHTC 1L6VA 1GPXA 1FM0D 1T0QC 1AW7A 2BKFA 4HCPB 1MPEA 4RGMA 4HKZE 3VFKA 2GOWA 1NYRA 4JQWC 2K8CA 2BS2B 2KNBA 2MQJA 5FKAC 3ZUNA 3QQ8B 4NJ6A 1C78A 1OTRB 1XLPA 4XWWA 2NTTA 3B08A 1IP9A 2PTLA 1I35A 5G2NA 1ENFA 1ZP0B 3Q14C 3NG0A 1V1PB 2QDFA 3C0RB 2MRPA 2JPHA 3A4RA 1SBBB 2B76B 4HXDA 2ZVNA 2K6QA 1WXSA 3BYTB 4G0NB 1B9RA 2A4ZA 3LXFA 3ZJUA 1WMHA 2L8JA 2L3ZA 3N1YC 4OZAA 4WJPA 2JRHA 4HPLB 2M4NA 5T8IA 3DBRI 2IBIB 2V9HA 4BKTA 2NCNA 5KHOA 1OQYA 2G3QB 3UINB 4YTMB 2WP9B 2EMTA 1MFWA 4PYUA 3AN1A 1C1YB 4RGOS 2M0XA 3A1QA 3AEDB 3BVMA 3HIZA 4WWNA 1N6ZA 4IDIA 3AE1B 1KM7A 1V81A 2C5LC 1OQRA 4DQOC 1QF6A 3AE6B 5L83A 3N1ZC 5C23A 1J19A 1V5TA 3OAWA 2GRIA 1QILA 1XCQL 5EDSA 1E8XA 4CO7A 3ZJVA 5DPSA 2GMIC 3VTUA 4ARIA 3PT2B 3X23A 4MM3B 3RNEC 2WHIA 3LDZE 2CJNA 1YN4A 5IP4D 2N7EA 1DYQA 3VH3B 4RGTA 4URKA 3UQBA 2IO3B 3DBSA 4WWMA 1NVID 2UWQA 3PRZA 1Y56A 4TMAB 3N30A 4FADA 5EE1A 5DPTA 2N7JA 4ZRJA 1D6EC 1YQ4B 2GBNA 3PLUA 5LLIA 1ET6A 1OEYA 4WIPA 1C4CA 5CTRC 4USAA 2JX5A 4AOFA 5HI1A 4GGQA 2KO3A 2KKCA 4PT5A 1HEZE 2DZIA 3CSTA 2FUHB 2KWCA 1JCKB 1BXTA 3WAOA 2OHFA 2G4DB 3QK0A 1LO5D 2VZKD 5D2MB 4YSZB 2O6VA 4MSQB 3T3OA 4DHZE 4TUUA 1KJTA 2KK8A 2LJIA 5AEKB 1ZW7A 2INCC 3QWZB 1Z2MA 4GDLA 3ML9A 4A90A 1WH3A 2BS4B 3U30A 1GAQB 1P3QU 1YD8U 2J0KA 3PPAA 4ZRIA 5E6NA 1SIFA 4S17A 4PK1A 3ZYYX 4EOYA 1N60A 3VR9B 2H89B 2M0AA 4KZCA 1C9FA 2RPVA 3FAHA 1Q10A 1GC6A 2XK5A 4RH6A 1WE7A 4G3XB 1HQRD 1TKEA 4B6WA 2FE8A 2K1FA 2KLCA 2IGHA 1R7SA 4PS7A 1L6UA 5LXHA 1E8WA 2BS3B 4GN1A 4JIOU 3R3MA 1UGMA 1TIFA 1MJDA 2WDTB 1ET9A 2Z8LA 2JWUA 3TJPA 2KJRA 3CIRB 1EWYC 3VXWA 3DHGC 2KWDA 1T6BX 2M8SA 2Y5PA 1GOZA 1FEHA 4EZLA 1CK1A 1NENB 2WXHA 1J8CA 4HROA 4TQ1A 3DDCB 1WGRA 1K50A 5FR6A 4HCNB 3VQIA 4C7ZA 4L2YA 1KRHA 1I4GA 2FUG1 2JF5A 3VH4B 3BINA 2DAFA 1ZE3D 1MHXA 2BYTA 3NVZA 1I7HA 1EF1A 1QZEA 2VRRB 3KVFB 3PREA 4ZHOA 2RSUA 2M19A 2CKHB 2MLBA 4LCDE 2N4FA 5JHAA 4XWTA 1WF9A 4LDTD 3Q8FA 3BVZA 2JYTA 3ZTDA 1YN3A 3MJWA 2D3GA 5H8YE 1QLBB 1FCCC 1FMAD 4ICUA 4MSMB 2WS3B 2YVCA 2V3NA 2L00B 2WNMA 2JSVX 3ZNHB 1WX7A 1V1OA 4LK0M 3FILB 3VTVA 1SB3C 4NNJB 1XLQA 2AWTA 2YEPB 2I38A 5D94A 3RPFC 1PUTA 1SXTA 3MC9A 1WIAA 1TT5B 1D5XC 1QQRA 3H7PB 2W55A 1QOBA 2DZKA 4KZ0A 2JZZA 3PTFC 2K8BA 1PYWD 2MBQA 2YLMA 3HK0A 4WQOB 4JL9A 2SEBD 1WMHB 2Z0DB 4MGZE 1T0SC 2Y3AA 4XC2A 2GBJA 3PV1A 2DHZA 1K8RB 1Q5WB 1IUEA 2J4XA 3JSVB 3Q3NC 1P1AA 2KC1A 3RZFA 3K9OB 2Q5WD 4NPNA 3TL5A 2LUMA 4N58A 4ZYNA 5KHQA 3A1QB 2ZPNA 1V80A 1E7PB 4NQKE 1J7CA 1OEYJ 1WYWB 1LXDA 3AB5A 1TKYA 4EFOA 3N9YC 2WDQB 2KANA 2I2YA 4TSSA 1TGZB 1E7UA 1IBXB 1TZOA 2NBUA 1JWAD 3V60A 1WXMA 2FCNA 4II3B 3IFWB 3W5UB 3RD2A 5LXIB 3MC8A 3WA0A 3S2AA 5BMHA 1CQVA 2PIAA 4OZBA 3TMPB 1YJIA 4OHJA 4IUMB 4ZOHC 4A9AA 4ZRKA 3DBRB 3I57A 4MGKE 1OFFA 3P4QB 3K9PB 2KZRA 2G4SA 2K0PA 3QHTA 2KDEB 3RULA 3ML8A 1E0ZA 1WGDA 3ALBA 3VRAB 2WXQA 1E10A 3N1XC 1NI3A 2DZMA 1FXIA 3B1LX 2INPE 4YT0B 4NAWA 3EHVA 1AN8A 1V49A 1K53A 2KHWB 2PE6B 4DXAB 1KLUD 4ARCA 5DPRA 4LJPB 1E8ZA 1V6EA 3AEGB 2VH2A 1FFUA 1KLGD 1LM8B 3IG3A 1NDDA 2Y5BB 3AMZA 1TY2A 2WU5B 3ZNGC 2BWFA 1IYFA 2W9NA 3VUYA 2KTFA 4GLSC 4ANUA 2AX5A 3R7QA 4DBGA 1YX6B 1F1HA 4C00A 2HDEA 2V4IB 3OWEB 5E6JA 1FNUA 2FBWB 2JZPA 2AL6A 2EKIA 3MHZA 2G45B 2NS5A 2KOXA 1FIQA 2AQ2B 3CWIA 2INDC 4EE2A 2K39A 2RD0A 1TJEA 1F77A 2EMSA 1WRIA 4XE0A 1TS4A 4DDID 2L0FA 1C76A 2N1VA 1EF5A 2MHJA 3DVGY 1LGRA 1RAXA 1L2NA 4B0EA 3U7ZA 4UDUC 4YTPB 1MG4A 3A9KB 4AJWA 4FBJB 3N32A 1S1QB 2JVCA 4LJOB 5BMGA 4P1CC 2MSED 2NPTA 2KWVB 4J3OD 1WXAA 4MACA 2J0JA 3QA8A 2N9LA 2AL3A 3AE8B 2VH1A 4F8CB 2QIEB 2O6VD 4K81A 5HHDG 3PRPB 4S0RA 2BGFA 3CSFA 4EKUA 3TUOA 1VZ6A 3BYYB 4HPPA 2LHEA 4OVZA 4C4VA 2FNJB 2Y5CA 4HWIB 2LXAA 2LVPA 4IWPA 2L76A 4D2KA 2KYWA 3Q2AC 2LRUA 2HD5B 3P1MA 2ZVOA 2LVQA 2XNAC 1RWSA 3W1YA 5AZHA 2KDIA 3L16A 3A4SC 4G50A 1LQBA 4EEWA 2ZW1A 4A3OA 4FHJA 1ZXIA 1EU3A 2BB5A 4LNKA 4P6VF 2I1JA 2KFJA 3PVLA 4GXBA 2LGSA 3IT4B 4KV2A 2K22A 1Q1OA 3ZLZA 3EA6A 2D11A 3MTNB 5J17A 5DPWA 3IXSA 3BZDB 4MGYE 2BWES 5JZEB 3R7RA 4W9JA 4JWUC 3IAM1 1JWMD 1SE3A 3KYDD 2OEDA 5EE0A 3Q3JA 3ENEA 3KW5B 3D32A 2VZKB 1HA5A
chains in the Genus database with same CATH topology
2WLBA 2BS3B 2M56B 1TKGA 1HZ5A 1IGCA 1XEEA 4GDKB 4NAMA 2JU6X 2BB6A 1ET9A 1FD6A 2Z8LA 1XF5L 2JWUA 3AV8A 2WXLA 3AEFB 3B2GA 2R61A 1VLBA 1VRAB 3KWLA 4RF1A 1L4DB 1TYGB 3KLSX 1EM7A 1FFVA 3CIRB 1EWYC 3W1SA 4ITKA 4US8A 1SE2A 1HXYD 1MHHE 2KWDA 1CJEA 2KDMA 1WGKA 1T6BX 2Y5PA 1GOZA 3GP7A 1FEHA 1VR9A 2IJ0A 1ACCA 1CK1A 3B2FA 1NENB 2WXHA 3B9JA 4RCOA 4A55A 3ZJTA 2L1AA 4HROA 1I4QA 2QJLA 2JXTA 4TQ1A 2QSDA 4NZLB 1K50A 2WXMA 1JWBD 2MJDA 4P16A 2LGIA 3VQIA 4C7ZA 3Q8BA 4L2YA 2WXRA 4C56C 1KRHA 1I4GA 2FUG1 5HFYA 4N6EB 2K5PA 2PLPA 2AQ1B 1ZE3D 4NJCA 4H2AA 3AEAB 1MHXA 2BYTA 2PKOA 1FNWA 1I4PA 3AEEB 4DXGA 2NTSA 1FRDA 3NVZA 2ZW0A 3TEWA 1I7HA 3AE2B 3PZ8A 4ZHPA 4O1NA 1J7AA 2WXPA 1ZDVA 1QOAA 1I4XA 1VJKA 4HEA1 4OZCA 2LFIA 4ZHOA 2MJ3A 1YNTE 2M19A 4KKJA 1B1ZA 1XCTL 5C3JB 1UWMA 1SF0A 1K51A 1L0XB 1JALA 1WYGA 4N59A 1YMHE 3AE4B 4XWTA 4FXCA 1V8CA 4TQ0A 3Q8FA 1CZPA 3BVZA 2RMMA 1OQQA 2JYTA 2V3PA 4OW0A 4M0WA 1EWCA 2E6XA 1SEBD 1YN3A 2AQ3B 1IGDA 1QOFA 3P42A 1L0VB 1VZ8A 5H8YE 5D3IB 1SJED 2LHDA 1QLBB 1FCCC 1FMAD 1N62A 1C77A 3EGRA 3R2IA 2WS3B 3NVWA 2K3UA 4JX1C 2N0SB 1T5XD 1JWSD 4MH8A 2V3NA 4AQ7A 1BUIC 2WXIA 2WNMA 1DOIA 2JSVX 4WAFA 3GS2A 3W9CB 1RYJA 1F2RI 2H88B 4HJGE 3TEXA 2INNE 1V1OA 1JRPA 2K9XA 4LK0M 3FILB 5G5GA 5D7GA 1SB3C 3URYA 2IGGA 1XLQA 2YEPB 3R2TA 4YXDB 1VDVA 2I38A 1C4PA 3FC4A 1PGBA 4MT5A 1FCLA 4YWGG 4RGNA 3RPFC 1PUTA 2KQ4X 1SXTA 3FILA 1PDXA 1D5XC 1J7BA 2CU3A 1QQRA 4RF0A 2W55A 3MC0B 1TS3A 1QOBA 2E3TA 2QEJC 1PGAA 1PYWD 5GXGB 5D3DA 1PGXA 2LEKA 3UI3A 1WSPA 2SEBD 3NUHB 3U4EG 4YSXB 3PO0A 2Y3AA 3BIID 2TSSA 1SSNA 5H92C 3AEBB 4US9A 1IUEA 1RM6C 2J4XA 4JPSA 1N5WA 5G5HA 4ZRQA 2PVOD 1ZOYB 1I4RA 1C4AA 2DLBA 2DWQA 3GB1A 1UWXA 5BYRA 1KTKA 1RFKA 1MI0A 2BTEA 1ZXHA 2W82A 2G9HD 1M4VA 2WQYB 3W2DA 1TS5A 1P7EA 2Q5WD 2LUMA 4N58A 1SIJA 1I4HA 4L23A 1E7PB 3PZ7A 3WCQA 1J7CA 1N61A 3MJ5A 2WXFA 3AB5A 2GB1A 1TKYA 2KN4A 3U52E 4DXFA 5I4DA 1VZ7A 5AUIA 3N9YC 2ON8A 2WDQB 2ACZB 3HRDD 1ZPSA 2I2YA 2ONQA 2PW9A 3ZQ4A 4TSSA 1TS2A 2JYEA 1NEKB 1DOYA 2YEPF 3T3NA 1IBXB 1TZOA 1FO4A 4IOIE 1EU4A 5BYQA 4CQNA 1JWAD 2CJOA 2IPKD 4AS1A 3AE9B 3W5UB 2V0GA 2WXOA 1E6EB 1BMLC 5FR3A 1IBXA 3VRBB 5AUKA 5C2TB 3TSSA 3NS1A 5EE3A 5BMHA 4LTUA 1CQVA 4A6QA 1L5PA 2LMCA 1FNVA 3BWUD 2PIAA 1SJHD 4OZBA 1YJIA 4OHJA 4C80A 1JMLA 1UGJA 1YN5A 1QKZA 4ZOHC 1YQ3B 4A9AA 2WXGA 2J53A 3I57A 2MJEA 3LB8C 3AE5B 3I9V1 1FXAA 1WXQA 1OFFA 2RDGA 3P4QB 5BYSA 3BVGA 3DWGC 3Q69A 2K0PA 3NVVA 4NAWB 1ZDXA 2BW2A 1STEA 1E0ZA 1XLNA 1D4BA 2QILA 3VRAB 2WXQA 1E10A 2J42A 2W3RA 1NI3A 1XO3A 1L6VA 1FXIA 2HTME 3EUB2 3J9CA 1N63A 2INPE 2W3SA 4YT0B 1L0YB 1GPXA 1FM0D 1AN8A 4WURA 2ICIA 1AW7A 3E9SA 3HVDA 5HG2A 1K53A 2MH7A 1L4ZB 1MPEA 1KLUD 4RGMA 4ARCA 3HVZA 4HKZE 3IAS1 3Q8CA 3ZGZA 3AEGB 2D5GA 1FFUA 1NYRA 1AWDA 1KLGD 2BS2B 5FKAC 3AMZA 1TY2A 1C78A 2WU5B 1XLPA 4XWWA 2NTTA 3ETRA 3SR6A 2L32A 4XDDA 1YJJA 5JXVA 2PTLA 3ABVB 4RNAA 1ENFA 1QT9A 4KGSA 3H8HA 1SE4A 1ZP0B 4GLSC 3IT6B 2QMTA 2WU2B 2AX5A 1V1PB 2HDEA 1KF6B 2V4IB 3OWEB 5E6JA 1SBBB 2B76B 1FNUA 2FBWB 2JZPA 2EKIA 3MHZA 3KQ4A 3BYTB 3SEBA 2XN9C 1B9RA 1FIQA 3AH7A 1P7FA 2AQ2B 2BBCA 3CWIA 1T3QA 3LXFA 3MFGA 4EE2A 3ZJUA 2KMMA 3TEYA 1TJEA 1F77A 4OZAA 3O13A 3V3XA 1WRIA 1QOGA 5T8IA 3DWMA 4XE0A 3SFDB 1TS4A 4A8XC 4YTMB 3AM9A 4KX6B 4HKQA 2WP9B 1C76A 2L52A 4ZRPA 2WXKA 1DOXA 2MEKA 1ESFA 3AN1A 3R8BA 3U7ZA 4UDUC 4B0EA 3L4PA 4R3DA 4RGOS 4YTNB 4YTPB 4REZA 3AEDB 3BVMA 3NRZA 4IDIA 3BK1A 3AE1B 1KFYB 1WWTA 5BMGA 1OQRA 4DQOC 1QF6A 3AE6B 4L1BA 1KH0A 5FK9C 4KGTA 2KACA 1V97A 4LLGM 4JE3B 2BT6A 3HUIA 4J3OD 2GRIA 1QILA 1XCQL 2WDRB 4MACA 4YSYB 2N9KA 2N9LA 3ZJVA 3W5VB 4ARIA 3Q8AA 1JQ4A 3AE8B 4MM3B 1ZUD2 2QIEB 2CJNA 1YN4A 5HHDG 5TSSA 1PFDA 4RFBA 1D5ZC 1DYQA 1K52A 4RGTA 3SFEB 3TUOA 1VZ6A 3VR8B 2KAJA 1TY0A 4WWMA 2RDHA 1NVID 3BYYB 1Y56A 4TMAB 2DBYA 2W54A 5EE1A 2LHEA 3Q8EA 3NVYA 4OVZA 4KKIA 2GI9A 4KGRA 2Y5CA 2WXJA 2N7JA 3AE3B 1GB1A 2J52A 1D6EC 1YQ4B 4IKGA 4D2KA 3P4RB 1XLOA 2NMQA 1HZ6A 1ET6A 4WH4A 3P1MA 1N5XA 3TEZA 1A70A 4WIPA 1C4CA 4USAA 2G1EA 2JX5A 3E56A 2XNAC 1MVKA 1RWSA 5HI1A 1F0ZA 1F2RC 4PT5A 1ROEA 2ZW1A 1HEZE 3AECB 1ZXIA 1GB4A 1EU3A 4ZYSA 2EELA 1JCKB 1AYFA 2BB5A 4P6VF 1BXTA 2X38A 4C7YA 5LNK1 2OHFA 4GDLB 1LO5D 2VZKD 4YSZB 3T3OA 3AE7B 2LJIA 1XXGA 2SAKA 3IT4B 3MP9A 3NZ3A 3U2SC 2K22A 3KWVA 1UUPA 4A90A 2DYMA 3V05A 5MPOA 3BK2A 2BS4B 1D5MC 1GAQB 3LYYA 2DYOA 3EA6A 3P4PB 2PVGC 3P63A 4HRSA 4WQMA 2PMVA 1V1PA 4JWSC 1JW9D 2WDVB 4Q2JA 4B0MA 3IXSA 3C8YA 3BZDB 3ZYYX 1N60A 4XDCA 3VR9B 2H89B 3RFZB 2M0AA 1C9FA 1NYQA 2RPVA 2L83A 3FAHA 1UNSA 1Q10A 2WXNA 3P4SB 4JWUC 5EE9A 4RH6A 3IAM1 1JWMD 2JQRB 1SE3A 1DGJA 1C79A 1HQRD 1TKEA 2IDYA 2FE8A 2OEDA 2IGHA 5EE0A 5BMIA 1E9MA 1JWUD 2VZKB 1JROA 1R7SA 1HA5A 1L6UA 1FRRA 2IGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PGB A;  1FCL A;  1HZ5 A;  1IGC A;  2KQ4 X;  5HHD G;  3FIL A;  2JU6 X;  5HG2 A;  1FD6 A;  1K53 A;  1XF5 L;  2JWU A;  1MPE A;  1K52 A;  1PGA A;  1PGX A;  3UI3 A;  4HKZ E;  1EM7 A;  2LHE A;  2GI9 A;  4KGR A;  1MHH E;  2KWD A;  2KDM A;  2N7J A;  1GB1 A;  2J52 A;  4IKG A;  3GB1 A;  1UWX A;  5JXV A;  2PTL A;  4D2K A;  1MI0 A;  2NMQ A;  1ZXH A;  1HZ6 A;  4WH4 A;  4KGS A;  4GLS C;  2QMT A;  2JXT A;  1P7E A;  2QSD A;  1K50 A;  2LUM A;  1MVK A;  5HI1 A;  2LGI A;  1F2R C;  2ZW1 A;  1HEZ E;  2JZP A;  5HFY A;  2GB1 A;  2PLP A;  1MHX A;  2KN4 A;  1GB4 A;  2EEL A;  1P7F A;  2ON8 A;  2ZW0 A;  2I2Y A;  2ONQ A;  2PW9 A;  4OZA A;  3V3X A;  1IBX B;  4OZC A;  4IOI E;  1YNT E;  3MP9 A;  1XCT L;  1K51 A;  1IBX A;  1YMH E;  5BMH A;  2RMM A;  1IGD A;  4OZB A;  1JML A;  2LHD A;  1FCC C;  1QKZ A;  5BMG A;  1C9F A;  2RPV A;  1KH0 A;  2J53 A;  1Q10 A;  2JSV X;  4KGT A;  2KAC A;  4HJG E;  1F2R I;  2K0P A;  2OED A;  2IGH A;  1XCQ L;  4MAC A;  3FIL B;  2N9K A;  1D4B A;  5BMI A;  2N9L A;  2IGG A;  2I38 A;  2IGD A; 
#chains in the Genus database with same CATH topology
 3ZTC A;  3H6N A;  1WJ4 A;  1HZ5 A;  1IGC A;  1WJN A;  1XEE A;  4GDK B;  4NAM A;  2L05 A;  4M01 A;  1GNU A;  3AV8 A;  2I1K A;  1VRA B;  3KWL A;  2LGY A;  1L4D B;  3KLS X;  3W1S A;  2JZ3 B;  4US8 A;  2GBK A;  4B95 A;  2BYF A;  4K7U A;  2CHX A;  3GP7 A;  4E74 A;  2V1Y A;  3ONS A;  4RCO A;  3ZJT A;  5CX3 A;  2L1A A;  4BKS A;  2ASQ A;  4NZL B;  2EKE C;  1XD3 B;  3DQV A;  5IN7 A;  4P16 A;  2LGI A;  3ZNZ B;  1U4A A;  2IY1 B;  4DK5 A;  2GBR A;  2AQ1 B;  4W9E A;  4BFR A;  1I4P A;  3AEE B;  3VUW A;  2ZW0 A;  3QAR A;  2WWZ A;  3O65 B;  4O1N A;  4B9K A;  2R2O A;  3DBL B;  2WXP A;  1QOA A;  1I4X A;  3UGB B;  4FA6 A;  2WGS A;  5BO4 B;  2KFK B;  5C1Z A;  2QCZ A;  4AP4 C;  1SF0 A;  1K51 A;  1L0X B;  1JAL A;  4N59 A;  4TQ0 A;  2J7Q B;  1A5R A;  2RMM A;  3KUZ A;  4M0W A;  1EWC A;  4FJY A;  1VZ8 A;  2DAJ A;  1YJ1 A;  2HJ8 A;  1XQQ A;  1J0G A;  2KLG A;  4II2 B;  1N62 A;  3EGR A;  3R2I A;  4FLH A;  1P9D U;  2N0S B;  3APF A;  1JWS D;  3VAW A;  4AQ7 A;  4GIV A;  3EEC A;  5CHF A;  1DOI A;  4WAF A;  3GS2 A;  2NVU I;  2H88 B;  2INN E;  2ZZP B;  3PSE B;  2C7H A;  1ZGU B;  2AEH A;  5G5G A;  3AU5 A;  1VDV A;  3M62 B;  4LNI A;  2KT7 A;  2AYO B;  2WX0 A;  1D3Z A;  4RGN A;  4MJS A;  4RF0 A;  1EUV B;  3MC0 B;  1TS3 A;  2QEJ C;  4LDT B;  3TIX A;  5GXG B;  1PGX A;  2LEK A;  1WSP A;  4YL8 A;  3NUH B;  3U4E G;  3QCA A;  4IWQ A;  2N9X A;  3BII D;  2TSS A;  1SSN A;  4US9 A;  3EFU A;  5GMV A;  1RLF A;  4W9L A;  3IHP C;  3M63 B;  1ZOY B;  3HM3 A;  2KMC A;  4W9D A;  1UWX A;  5BYR A;  1RFK A;  2BTE A;  4HDO A;  1ZXH A;  2W82 A;  1LFD A;  2CR5 A;  1M4V A;  2NR2 A;  3LJ3 A;  1TS5 A;  1UBI A;  1P7E A;  2DNF A;  4NY0 A;  1SIJ A;  3L54 A;  4W9K A;  4FJZ A;  4L23 A;  5IO9 A;  2MA9 B;  1F52 A;  2CHZ A;  4K7W A;  3NOB A;  3MJ5 A;  3QJZ A;  4MDK E;  1SE9 A;  4JLC A;  3Q3F A;  4CYE A;  2ON8 A;  1YX5 B;  2MW5 A;  1ZPS A;  1NEK B;  3P2B A;  3L08 A;  1UD7 A;  2FID A;  4CQN A;  2CJO A;  4AS1 A;  3AE9 B;  1JRU A;  2WXO A;  2O2V B;  1E6E B;  1VCB A;  4HDQ A;  3VRB B;  5AUK A;  5C2T B;  2D3C A;  3TSS A;  3CF6 E;  4A6Q A;  1E8Y A;  1L5P A;  1FNV A;  1SJH D;  4BBN F;  4C80 A;  1UGJ A;  1YN5 A;  1QKZ A;  3ZO5 B;  1YQ3 B;  2WXG A;  1E5W A;  2MJE A;  3I9V 1;  2KXJ A;  3DWG C;  3Q69 A;  4KDL B;  4BKG A;  2BYE A;  1XLN A;  2MCN B;  4XGA B;  2QIL A;  2J42 A;  2LRW A;  3SDL C;  1XO3 A;  2KDB A;  2HTM E;  3EUB 2;  3J9C A;  1N63 A;  2W3S A;  1L0Y B;  2ICI A;  5AZF A;  5HG2 A;  2MH7 A;  2CS4 A;  2FAZ A;  4GU2 A;  4BVU C;  3ZGZ A;  5DCN A;  2D5G A;  3UIO B;  1Q0W B;  2LAS A;  1R4M I;  4LNF A;  1WGG A;  2WX1 A;  4XZ4 A;  3SR6 A;  3ETR A;  2L32 A;  4XDD A;  1YJJ A;  4LNO A;  4RNA A;  1YOV B;  3H8H A;  1SE4 A;  3IT6 B;  2QMT A;  2WU2 B;  3H9D A;  1KF6 B;  2XBB C;  5CHV C;  4HK2 A;  3DVG X;  3DVN V;  2XN9 C;  2REX A;  1P7F A;  1TBE A;  1T3Q A;  3MFG A;  3TEY A;  3DBL I;  3DOW A;  1HE8 A;  1QOG A;  3DWM A;  4A20 A;  2C9W B;  4KX6 B;  4HKQ A;  4NJ7 A;  2L52 A;  4KSK C;  2C60 A;  4I6P A;  2WXK A;  1DOX A;  2NBW B;  2MEK A;  3A33 B;  3L4P A;  4K7S A;  4YTN B;  4DWF A;  2KQS A;  3V61 A;  4EZJ A;  1V5O A;  2MX2 A;  3N3K B;  4ZDV A;  3BK1 A;  1KFY B;  1WWT A;  2FCM A;  3SU8 X;  1KH0 A;  2KC2 A;  4ASW C;  4KGT A;  3JVZ X;  4WWO A;  3OLM D;  2WDR B;  4YSY B;  1V2Y A;  4AWJ A;  1OGW A;  1JQ4 A;  4HVB A;  1FXT B;  2FCS A;  5TSS A;  3RUI B;  1PFD A;  1EO6 A;  4RFB A;  3KH0 A;  1K52 A;  3RZW C;  4W9F A;  4MM3 A;  2KVZ A;  1TZ1 A;  3GOE A;  1WX9 A;  1H8C A;  2MP2 A;  2GI9 A;  4KGR A;  2LVO A;  2WXJ A;  2N1W A;  3AE3 B;  2J52 A;  2IO1 B;  3DPD A;  4IKG A;  1WZ0 A;  3RN9 C;  2NMQ A;  2KTR A;  3JW0 X;  3TEZ A;  1A70 A;  1MVK A;  3I3T B;  1I42 A;  4IW0 A;  3DHH C;  1ROE A;  2O6V B;  1Y8R C;  4WJQ A;  3KUC B;  4ZYS A;  1WXV A;  2UU7 A;  3AUL A;  3APC A;  4MEM A;  1V86 A;  2C7N B;  5LNK 1;  2DEN B;  3QX1 A;  4GDL B;  3AE7 B;  2MBO A;  2K6D B;  2SAK A;  3MP9 A;  3NZ3 A;  1XT9 B;  2KX3 A;  2Z59 B;  1WGY A;  2DYM A;  4RM9 A;  3V05 A;  3BK2 A;  3KYC D;  2LI5 A;  3CMM B;  1GG3 A;  2PVG C;  3P63 A;  2PMV A;  1MG8 A;  2WDV B;  2XK5 B;  2L0T A;  4B0M A;  2J0M A;  3SHQ A;  3RNC C;  4DHZ B;  5IA7 A;  4XDC A;  4BKS D;  3NZU A;  2D07 B;  1NYQ A;  4FJV B;  1UNS A;  2HE7 A;  3P4S B;  5EE9 A;  1BT0 A;  3AU4 A;  3A9J A;  1DGJ A;  2JY6 A;  1WM2 A;  5BMI A;  1E9M A;  1JRO A;  1ZKH A;  3PRM B;  3UIP B;  1FRR A;  2IGD A;  4JGH B;  3ZKJ C;  2M56 B;  3VDZ A;  1WY8 A;  3V62 A;  3ZNI D;  3ZDM C;  2BB6 A;  1KOT A;  1XF5 L;  2L7R A;  2WXL A;  1C3T A;  3AEF B;  3B2G A;  1YIW A;  3DBH B;  2R61 A;  2OOB B;  4RF1 A;  4KIK A;  2IO2 B;  1EM7 A;  4MH0 E;  2KJ6 A;  2JRI B;  1ISN A;  1SE2 A;  1HTQ A;  4F1S A;  4IG7 B;  4HJK A;  3X0W A;  1VR9 A;  2IJ0 A;  3B2F A;  4J6I A;  1SGH A;  3WAL A;  4A55 A;  2QJL A;  2QSD A;  2DYB A;  2KDF B;  4IM2 A;  3JYU A;  4BBN C;  2MBB B;  3Q8B A;  2WXR A;  4C56 C;  3ZXR A;  1NBF C;  2DX5 B;  2MBE A;  4H2A A;  3AEA B;  2PKO A;  4DXG A;  4I6L B;  3PHW B;  3TEW A;  1UH6 A;  3AE2 B;  3PZ8 A;  4ICV A;  2M1M A;  2BVC A;  4DHJ D;  1KLV A;  1J7A A;  4KVG B;  1WJU A;  4K3C A;  4HEA 1;  1VJK A;  4G11 A;  2LFI A;  1T0Y A;  3NHE B;  1B1Z A;  3R66 C;  1UWM A;  3M95 A;  3ZIM A;  1WJ6 A;  4FXC A;  2C7M B;  3NY5 A;  4OW0 A;  2BF8 B;  1SEB D;  1IGD A;  4GOC A;  5D3I B;  3QC8 B;  3IVF A;  4E71 A;  3L13 A;  2JXX A;  3ZRC A;  3N20 C;  4RMA A;  1T5X D;  4MEL A;  4MH8 A;  1BUI C;  2WXI A;  1RYJ A;  1F2R I;  4HJG E;  1WZ3 A;  1WR6 E;  1JRP A;  3WAP A;  2IGG A;  2M17 A;  4YXD B;  1C4P A;  2KN5 A;  3FC4 A;  1PGB A;  3GE8 C;  3TBL D;  4PS8 A;  4YWG G;  3FIL A;  3DHI C;  4K1R B;  2B3A A;  1M94 A;  3NZS A;  2LWP A;  1PGA A;  4BAX A;  3V6C B;  5D3D A;  3UI3 A;  4YSX B;  3PO0 A;  3H7P A;  3AEB B;  4W9I A;  5G5H A;  2PVO D;  5D6J B;  1I4R A;  1C4A A;  2DLB A;  3VUX A;  1GJZ A;  1MI0 A;  1AAR A;  1TTN A;  4M8N A;  2WQY B;  1P0R A;  3W2D A;  4F7Z A;  1G6J A;  3JSV A;  1I4H A;  3L0W B;  3PS6 A;  3U7D A;  1N61 A;  3RYT A;  2GB1 A;  3RT3 B;  2KN4 A;  1R4M B;  3DVN U;  3U52 E;  4DXF A;  5I4D A;  5AUI A;  2KQ7 A;  5IOI A;  2ACZ B;  3HRD D;  2ONQ A;  2PW9 A;  3ZQ4 A;  1TS2 A;  3EC8 A;  1DOY A;  3Q3O C;  2IPK D;  3V6E B;  5J2R A;  2V0G A;  1P98 A;  1BML C;  2KD0 A;  1IBX A;  1L7Y A;  2KMA A;  3BY4 B;  2IYD B;  3PZD A;  3DCG A;  3Q3M C;  1CMX B;  2MP2 B;  3WAN A;  3IBE A;  2MWS B;  3SD5 A;  2J53 A;  3AXC A;  3LB8 C;  1FXA A;  2OJW A;  2ZNV C;  1E90 A;  2RDG A;  4BZA A;  1R4N B;  3FKY A;  3I5J C;  4ANV A;  4NAW B;  1ZDX A;  2BW2 A;  3PHX B;  1STE A;  4W9G A;  2KTR B;  1D4B A;  3WIM A;  1GUA B;  2W3R A;  3TCA A;  3OG5 A;  2KWU B;  1WX8 A;  2K8H A;  2KX0 A;  4WUR A;  3E9S A;  3HVD A;  1L4Z B;  3DBH I;  4MGI E;  3HVZ A;  3IAS 1;  3Q8C A;  1WM3 A;  2HTH A;  5L95 C;  1AWD A;  2N9E B;  4BOZ B;  3AI5 A;  2QHO A;  5JXV A;  2LZ6 A;  3QIJ A;  3ABV B;  4HLE A;  4TV3 A;  1QT9 A;  4KGS A;  2XEW A;  3C19 A;  1E7V A;  5IKC M;  2QC8 A;  4IC7 B;  2OJR A;  2LGD A;  2K25 A;  3KQ4 A;  3SEB A;  2LJ5 A;  3AH7 A;  2LUE A;  2BBC A;  4EZK A;  2LGX A;  3A9J B;  2KMM A;  4M00 A;  2UYZ B;  3O13 A;  3V3X A;  4AUQ C;  4EUT A;  3SFD B;  3T8M A;  4A8X C;  3AM9 A;  3UQA A;  2ZNV B;  3L10 B;  3VTW A;  1Z5S B;  4ZRP A;  2Z0E B;  1H4R A;  1RRB A;  1ESF A;  3R8B A;  3OJ3 A;  3PLV A;  5CHW A;  2LXC A;  4R3D A;  3ECI A;  4REZ A;  2ZPY A;  2NPT B;  2PE9 A;  4CHK A;  3NRZ A;  4KIK B;  4W9C A;  3WAM A;  1UBQ A;  4GSW A;  4L1B A;  5FK9 C;  2JWZ A;  4ANX A;  3A9K A;  4M02 A;  1V97 A;  2KAC A;  4LLG M;  4JE3 B;  2BT6 A;  3HUI A;  2FCQ A;  2IO0 B;  2N9K A;  3W5V B;  3Q8A A;  1ZUD 2;  5TR5 A;  5G55 A;  4WWP A;  1YQB A;  1V9J A;  4C4V B;  1D5Z C;  4WAA A;  3RNA C;  3SFE B;  3VR8 B;  3I63 C;  2KAJ A;  4ANW A;  1TY0 A;  2JT4 B;  4W9H A;  2RDH A;  1X1M A;  2X8X X;  2DBY A;  2W54 A;  3Q8E A;  3NVY A;  4KKI A;  4LNN A;  1GB1 A;  1HTO A;  2LD9 A;  3W1S C;  1PQS A;  3APD A;  4E3C A;  3P4R B;  1XLO A;  1HZ6 A;  4WH4 A;  3GZN B;  1N5X A;  2D10 A;  5JHB A;  2G1E A;  3E56 A;  4OVU A;  1F0Z A;  1F2R C;  3AEC B;  1FPY A;  1GB4 A;  3M3J A;  2EEL A;  1AYF A;  3RI7 C;  1VD2 A;  2X38 A;  4C7Y A;  2RR9 A;  3RNF C;  3PGE A;  4WJO A;  1XXG A;  3U2S C;  3HM6 X;  3KWV A;  1UUP A;  5MPO A;  4HPM B;  3RMK C;  1NI2 A;  3NS8 A;  1D5M C;  3LYY A;  2DYO A;  3P4P B;  4HRS A;  4WQM A;  1V1P A;  4JWS C;  1JW9 D;  2BYV E;  4Q2J A;  3C8Y A;  2V4L A;  3RFZ B;  2L83 A;  2WXN A;  2CHW A;  2JQR B;  3GE3 C;  1R4N I;  2RDB C;  1C79 A;  2DZJ A;  2IDY A;  1JWU D;  2WLB A;  2V3S A;  3ZVV A;  4P1B C;  1TKG A;  3H1U A;  3L17 A;  2IZV B;  2JU6 X;  2KJH B;  1FD6 A;  2BKR B;  5JH5 C;  4OVV A;  4PS3 A;  1VLB A;  2BPS A;  1TYG B;  1FFV A;  1F9J A;  4GDK A;  4QAY A;  4ITK A;  4K3B A;  1HXY D;  1MHH E;  1CJE A;  2KDM A;  4IWO A;  1WGK A;  2KVR A;  2NBV B;  1ACC A;  1UEL A;  3B9J A;  5AZG A;  3EFC A;  1I4Q A;  2JXT A;  4KDI C;  2WXM A;  1JWB D;  2MJD A;  3QAQ A;  4XX5 A;  1WI0 A;  4BOS C;  5HFY A;  4N6E B;  2BQQ A;  2K5P A;  2PLP A;  4NJC A;  5E6P A;  4GB9 A;  3H7S A;  1FNW A;  2NTS A;  1FRD A;  5J18 A;  1WGH A;  4ZHP A;  1WR1 A;  4N9F 4;  5HKH A;  1WE6 A;  1ZDV A;  4OZC A;  2MJ3 A;  4GMV A;  2D3A A;  1YNT E;  4KKJ A;  4M0W B;  1XCT L;  5IAA C;  5C3J B;  4X57 B;  1RFA A;  1WYG A;  1YMH E;  3AE4 B;  1V8C A;  2JUO A;  3ZXV A;  4ACF A;  1CZP A;  2KFK A;  1OQQ A;  2V3P A;  3HHM A;  4XYC A;  4TKN A;  2E6X A;  2AQ3 B;  1QOF A;  3P42 A;  1L0V B;  3NJT A;  1SJE D;  2LHD A;  2RPQ A;  1WRD B;  1C77 A;  4A3P A;  3NVW A;  3OJ4 B;  4NQL B;  2K3U A;  4JX1 C;  3B0A A;  4KSL C;  2D3B A;  1S3S G;  2CU1 A;  3W9C B;  3TEX A;  2K9X A;  4MJS B;  3VVW B;  2GBM A;  5D7G A;  4DHJ B;  3URY A;  3R2T A;  2FIF A;  3ZW3 A;  4MT5 A;  1FCL A;  2KQ4 X;  1PDX A;  1J7B A;  2CU3 A;  3Q6B A;  5E6O A;  2E3T A;  1UZX B;  4RM8 A;  4M8M A;  2N7D A;  2PEA A;  5H92 C;  1RM6 C;  2PJH A;  1N5W A;  4JPS A;  4ZRQ A;  4IM0 A;  2DWQ A;  3GB1 A;  1KTK A;  1UF0 A;  3UF8 A;  2G9H D;  3GZN I;  2N9P C;  4FUL A;  1GC7 A;  2MBH A;  1WFY A;  2WYQ A;  3PZ7 A;  3WCQ A;  4FN2 A;  2PPH A;  2WXF A;  3RCZ A;  1VZ7 A;  4WJN A;  4I6N B;  2D2Q A;  2ZEQ A;  2ZCB A;  2GLS A;  2JYE A;  2YEP F;  3T3N A;  1FO4 A;  4IOI E;  3KUD B;  1EU4 A;  5BYQ A;  4DDG D;  4P7I A;  2HJ1 A;  5FR3 A;  4FHK A;  1T0R C;  3NS1 A;  5EE3 A;  4LTU A;  2LMC A;  2R2Q A;  3BWU D;  2ZCC A;  2RGF A;  3RNG C;  2O2V A;  4AJY B;  1JML A;  3MHS D;  3RNB C;  4PYZ A;  2A5U A;  3AE5 B;  1WXQ A;  3ZRF A;  3ZDT A;  5BYS A;  1IPG A;  3BVG A;  2IY0 B;  3NVV A;  3T9L A;  3U8Z A;  2ZJD A;  4IM3 A;  3VHT C;  1L6V A;  1GPX A;  1FM0 D;  1T0Q C;  1AW7 A;  2BKF A;  4HCP B;  1MPE A;  4RGM A;  4HKZ E;  3VFK A;  2GOW A;  1NYR A;  4JQW C;  2K8C A;  2BS2 B;  2KNB A;  2MQJ A;  5FKA C;  3ZUN A;  3QQ8 B;  4NJ6 A;  1C78 A;  1OTR B;  1XLP A;  4XWW A;  2NTT A;  3B08 A;  1IP9 A;  2PTL A;  1I35 A;  5G2N A;  1ENF A;  1ZP0 B;  3Q14 C;  3NG0 A;  1V1P B;  2QDF A;  3C0R B;  2MRP A;  2JPH A;  3A4R A;  1SBB B;  2B76 B;  4HXD A;  2ZVN A;  2K6Q A;  1WXS A;  3BYT B;  4G0N B;  1B9R A;  2A4Z A;  3LXF A;  3ZJU A;  1WMH A;  2L8J A;  2L3Z A;  3N1Y C;  4OZA A;  4WJP A;  2JRH A;  4HPL B;  2M4N A;  5T8I A;  3DBR I;  2IBI B;  2V9H A;  4BKT A;  2NCN A;  5KHO A;  1OQY A;  2G3Q B;  3UIN B;  4YTM B;  2WP9 B;  2EMT A;  1MFW A;  4PYU A;  3AN1 A;  1C1Y B;  4RGO S;  2M0X A;  3A1Q A;  3AED B;  3BVM A;  3HIZ A;  4WWN A;  1N6Z A;  4IDI A;  3AE1 B;  1KM7 A;  1V81 A;  2C5L C;  1OQR A;  4DQO C;  1QF6 A;  3AE6 B;  5L83 A;  3N1Z C;  5C23 A;  1J19 A;  1V5T A;  3OAW A;  2GRI A;  1QIL A;  1XCQ L;  5EDS A;  1E8X A;  4CO7 A;  3ZJV A;  5DPS A;  2GMI C;  3VTU A;  4ARI A;  3PT2 B;  3X23 A;  4MM3 B;  3RNE C;  2WHI A;  3LDZ E;  2CJN A;  1YN4 A;  5IP4 D;  2N7E A;  1DYQ A;  3VH3 B;  4RGT A;  4URK A;  3UQB A;  2IO3 B;  3DBS A;  4WWM A;  1NVI D;  2UWQ A;  3PRZ A;  1Y56 A;  4TMA B;  3N30 A;  4FAD A;  5EE1 A;  5DPT A;  2N7J A;  4ZRJ A;  1D6E C;  1YQ4 B;  2GBN A;  3PLU A;  5LLI A;  1ET6 A;  1OEY A;  4WIP A;  1C4C A;  5CTR C;  4USA A;  2JX5 A;  4AOF A;  5HI1 A;  4GGQ A;  2KO3 A;  2KKC A;  4PT5 A;  1HEZ E;  2DZI A;  3CST A;  2FUH B;  2KWC A;  1JCK B;  1BXT A;  3WAO A;  2OHF A;  2G4D B;  3QK0 A;  1LO5 D;  2VZK D;  5D2M B;  4YSZ B;  2O6V A;  4MSQ B;  3T3O A;  4DHZ E;  4TUU A;  1KJT A;  2KK8 A;  2LJI A;  5AEK B;  1ZW7 A;  2INC C;  3QWZ B;  1Z2M A;  4GDL A;  3ML9 A;  4A90 A;  1WH3 A;  2BS4 B;  3U30 A;  1GAQ B;  1P3Q U;  1YD8 U;  2J0K A;  3PPA A;  4ZRI A;  5E6N A;  1SIF A;  4S17 A;  4PK1 A;  3ZYY X;  4EOY A;  1N60 A;  3VR9 B;  2H89 B;  2M0A A;  4KZC A;  1C9F A;  2RPV A;  3FAH A;  1Q10 A;  1GC6 A;  2XK5 A;  4RH6 A;  1WE7 A;  4G3X B;  1HQR D;  1TKE A;  4B6W A;  2FE8 A;  2K1F A;  2KLC A;  2IGH A;  1R7S A;  4PS7 A;  1L6U A;  5LXH A;  1E8W A;  2BS3 B;  4GN1 A;  4JIO U;  3R3M A;  1UGM A;  1TIF A;  1MJD A;  2WDT B;  1ET9 A;  2Z8L A;  2JWU A;  3TJP A;  2KJR A;  3CIR B;  1EWY C;  3VXW A;  3DHG C;  2KWD A;  1T6B X;  2M8S A;  2Y5P A;  1GOZ A;  1FEH A;  4EZL A;  1CK1 A;  1NEN B;  2WXH A;  1J8C A;  4HRO A;  4TQ1 A;  3DDC B;  1WGR A;  1K50 A;  5FR6 A;  4HCN B;  3VQI A;  4C7Z A;  4L2Y A;  1KRH A;  1I4G A;  2FUG 1;  2JF5 A;  3VH4 B;  3BIN A;  2DAF A;  1ZE3 D;  1MHX A;  2BYT A;  3NVZ A;  1I7H A;  1EF1 A;  1QZE A;  2VRR B;  3KVF B;  3PRE A;  4ZHO A;  2RSU A;  2M19 A;  2CKH B;  2MLB A;  4LCD E;  2N4F A;  5JHA A;  4XWT A;  1WF9 A;  4LDT D;  3Q8F A;  3BVZ A;  2JYT A;  3ZTD A;  1YN3 A;  3MJW A;  2D3G A;  5H8Y E;  1QLB B;  1FCC C;  1FMA D;  4ICU A;  4MSM B;  2WS3 B;  2YVC A;  2V3N A;  2L00 B;  2WNM A;  2JSV X;  3ZNH B;  1WX7 A;  1V1O A;  4LK0 M;  3FIL B;  3VTV A;  1SB3 C;  4NNJ B;  1XLQ A;  2AWT A;  2YEP B;  2I38 A;  5D94 A;  3RPF C;  1PUT A;  1SXT A;  3MC9 A;  1WIA A;  1TT5 B;  1D5X C;  1QQR A;  3H7P B;  2W55 A;  1QOB A;  2DZK A;  4KZ0 A;  2JZZ A;  3PTF C;  2K8B A;  1PYW D;  2MBQ A;  2YLM A;  3HK0 A;  4WQO B;  4JL9 A;  2SEB D;  1WMH B;  2Z0D B;  4MGZ E;  1T0S C;  2Y3A A;  4XC2 A;  2GBJ A;  3PV1 A;  2DHZ A;  1K8R B;  1Q5W B;  1IUE A;  2J4X A;  3JSV B;  3Q3N C;  1P1A A;  2KC1 A;  3RZF A;  3K9O B;  2Q5W D;  4NPN A;  3TL5 A;  2LUM A;  4N58 A;  4ZYN A;  5KHQ A;  3A1Q B;  2ZPN A;  1V80 A;  1E7P B;  4NQK E;  1J7C A;  1OEY J;  1WYW B;  1LXD A;  3AB5 A;  1TKY A;  4EFO A;  3N9Y C;  2WDQ B;  2KAN A;  2I2Y A;  4TSS A;  1TGZ B;  1E7U A;  1IBX B;  1TZO A;  2NBU A;  1JWA D;  3V60 A;  1WXM A;  2FCN A;  4II3 B;  3IFW B;  3W5U B;  3RD2 A;  5LXI B;  3MC8 A;  3WA0 A;  3S2A A;  5BMH A;  1CQV A;  2PIA A;  4OZB A;  3TMP B;  1YJI A;  4OHJ A;  4IUM B;  4ZOH C;  4A9A A;  4ZRK A;  3DBR B;  3I57 A;  4MGK E;  1OFF A;  3P4Q B;  3K9P B;  2KZR A;  2G4S A;  2K0P A;  3QHT A;  2KDE B;  3RUL A;  3ML8 A;  1E0Z A;  1WGD A;  3ALB A;  3VRA B;  2WXQ A;  1E10 A;  3N1X C;  1NI3 A;  2DZM A;  1FXI A;  3B1L X;  2INP E;  4YT0 B;  4NAW A;  3EHV A;  1AN8 A;  1V49 A;  1K53 A;  2KHW B;  2PE6 B;  4DXA B;  1KLU D;  4ARC A;  5DPR A;  4LJP B;  1E8Z A;  1V6E A;  3AEG B;  2VH2 A;  1FFU A;  1KLG D;  1LM8 B;  3IG3 A;  1NDD A;  2Y5B B;  3AMZ A;  1TY2 A;  2WU5 B;  3ZNG C;  2BWF A;  1IYF A;  2W9N A;  3VUY A;  2KTF A;  4GLS C;  4ANU A;  2AX5 A;  3R7Q A;  4DBG A;  1YX6 B;  1F1H A;  4C00 A;  2HDE A;  2V4I B;  3OWE B;  5E6J A;  1FNU A;  2FBW B;  2JZP A;  2AL6 A;  2EKI A;  3MHZ A;  2G45 B;  2NS5 A;  2KOX A;  1FIQ A;  2AQ2 B;  3CWI A;  2IND C;  4EE2 A;  2K39 A;  2RD0 A;  1TJE A;  1F77 A;  2EMS A;  1WRI A;  4XE0 A;  1TS4 A;  4DDI D;  2L0F A;  1C76 A;  2N1V A;  1EF5 A;  2MHJ A;  3DVG Y;  1LGR A;  1RAX A;  1L2N A;  4B0E A;  3U7Z A;  4UDU C;  4YTP B;  1MG4 A;  3A9K B;  4AJW A;  4FBJ B;  3N32 A;  1S1Q B;  2JVC A;  4LJO B;  5BMG A;  4P1C C;  2MSE D;  2NPT A;  2KWV B;  4J3O D;  1WXA A;  4MAC A;  2J0J A;  3QA8 A;  2N9L A;  2AL3 A;  3AE8 B;  2VH1 A;  4F8C B;  2QIE B;  2O6V D;  4K81 A;  5HHD G;  3PRP B;  4S0R A;  2BGF A;  3CSF A;  4EKU A;  3TUO A;  1VZ6 A;  3BYY B;  4HPP A;  2LHE A;  4OVZ A;  4C4V A;  2FNJ B;  2Y5C A;  4HWI B;  2LXA A;  2LVP A;  4IWP A;  2L76 A;  4D2K A;  2KYW A;  3Q2A C;  2LRU A;  2HD5 B;  3P1M A;  2ZVO A;  2LVQ A;  2XNA C;  1RWS A;  3W1Y A;  5AZH A;  2KDI A;  3L16 A;  3A4S C;  4G50 A;  1LQB A;  4EEW A;  2ZW1 A;  4A3O A;  4FHJ A;  1ZXI A;  1EU3 A;  2BB5 A;  4LNK A;  4P6V F;  2I1J A;  2KFJ A;  3PVL A;  4GXB A;  2LGS A;  3IT4 B;  4KV2 A;  2K22 A;  1Q1O A;  3ZLZ A;  3EA6 A;  2D11 A;  3MTN B;  5J17 A;  5DPW A;  3IXS A;  3BZD B;  4MGY E;  2BWE S;  5JZE B;  3R7R A;  4W9J A;  4JWU C;  3IAM 1;  1JWM D;  1SE3 A;  3KYD D;  2OED A;  5EE0 A;  3Q3J A;  3ENE A;  3KW5 B;  3D32 A;  2VZK B;  1HA5 A; 
#chains in the Genus database with same CATH homology
 2WLB A;  2BS3 B;  2M56 B;  1TKG A;  1HZ5 A;  1IGC A;  1XEE A;  4GDK B;  4NAM A;  2JU6 X;  2BB6 A;  1ET9 A;  1FD6 A;  2Z8L A;  1XF5 L;  2JWU A;  3AV8 A;  2WXL A;  3AEF B;  3B2G A;  2R61 A;  1VLB A;  1VRA B;  3KWL A;  4RF1 A;  1L4D B;  1TYG B;  3KLS X;  1EM7 A;  1FFV A;  3CIR B;  1EWY C;  3W1S A;  4ITK A;  4US8 A;  1SE2 A;  1HXY D;  1MHH E;  2KWD A;  1CJE A;  2KDM A;  1WGK A;  1T6B X;  2Y5P A;  1GOZ A;  3GP7 A;  1FEH A;  1VR9 A;  2IJ0 A;  1ACC A;  1CK1 A;  3B2F A;  1NEN B;  2WXH A;  3B9J A;  4RCO A;  4A55 A;  3ZJT A;  2L1A A;  4HRO A;  1I4Q A;  2QJL A;  2JXT A;  4TQ1 A;  2QSD A;  4NZL B;  1K50 A;  2WXM A;  1JWB D;  2MJD A;  4P16 A;  2LGI A;  3VQI A;  4C7Z A;  3Q8B A;  4L2Y A;  2WXR A;  4C56 C;  1KRH A;  1I4G A;  2FUG 1;  5HFY A;  4N6E B;  2K5P A;  2PLP A;  2AQ1 B;  1ZE3 D;  4NJC A;  4H2A A;  3AEA B;  1MHX A;  2BYT A;  2PKO A;  1FNW A;  1I4P A;  3AEE B;  4DXG A;  2NTS A;  1FRD A;  3NVZ A;  2ZW0 A;  3TEW A;  1I7H A;  3AE2 B;  3PZ8 A;  4ZHP A;  4O1N A;  1J7A A;  2WXP A;  1ZDV A;  1QOA A;  1I4X A;  1VJK A;  4HEA 1;  4OZC A;  2LFI A;  4ZHO A;  2MJ3 A;  1YNT E;  2M19 A;  4KKJ A;  1B1Z A;  1XCT L;  5C3J B;  1UWM A;  1SF0 A;  1K51 A;  1L0X B;  1JAL A;  1WYG A;  4N59 A;  1YMH E;  3AE4 B;  4XWT A;  4FXC A;  1V8C A;  4TQ0 A;  3Q8F A;  1CZP A;  3BVZ A;  2RMM A;  1OQQ A;  2JYT A;  2V3P A;  4OW0 A;  4M0W A;  1EWC A;  2E6X A;  1SEB D;  1YN3 A;  2AQ3 B;  1IGD A;  1QOF A;  3P42 A;  1L0V B;  1VZ8 A;  5H8Y E;  5D3I B;  1SJE D;  2LHD A;  1QLB B;  1FCC C;  1FMA D;  1N62 A;  1C77 A;  3EGR A;  3R2I A;  2WS3 B;  3NVW A;  2K3U A;  4JX1 C;  2N0S B;  1T5X D;  1JWS D;  4MH8 A;  2V3N A;  4AQ7 A;  1BUI C;  2WXI A;  2WNM A;  1DOI A;  2JSV X;  4WAF A;  3GS2 A;  3W9C B;  1RYJ A;  1F2R I;  2H88 B;  4HJG E;  3TEX A;  2INN E;  1V1O A;  1JRP A;  2K9X A;  4LK0 M;  3FIL B;  5G5G A;  5D7G A;  1SB3 C;  3URY A;  2IGG A;  1XLQ A;  2YEP B;  3R2T A;  4YXD B;  1VDV A;  2I38 A;  1C4P A;  3FC4 A;  1PGB A;  4MT5 A;  1FCL A;  4YWG G;  4RGN A;  3RPF C;  1PUT A;  2KQ4 X;  1SXT A;  3FIL A;  1PDX A;  1D5X C;  1J7B A;  2CU3 A;  1QQR A;  4RF0 A;  2W55 A;  3MC0 B;  1TS3 A;  1QOB A;  2E3T A;  2QEJ C;  1PGA A;  1PYW D;  5GXG B;  5D3D A;  1PGX A;  2LEK A;  3UI3 A;  1WSP A;  2SEB D;  3NUH B;  3U4E G;  4YSX B;  3PO0 A;  2Y3A A;  3BII D;  2TSS A;  1SSN A;  5H92 C;  3AEB B;  4US9 A;  1IUE A;  1RM6 C;  2J4X A;  4JPS A;  1N5W A;  5G5H A;  4ZRQ A;  2PVO D;  1ZOY B;  1I4R A;  1C4A A;  2DLB A;  2DWQ A;  3GB1 A;  1UWX A;  5BYR A;  1KTK A;  1RFK A;  1MI0 A;  2BTE A;  1ZXH A;  2W82 A;  2G9H D;  1M4V A;  2WQY B;  3W2D A;  1TS5 A;  1P7E A;  2Q5W D;  2LUM A;  4N58 A;  1SIJ A;  1I4H A;  4L23 A;  1E7P B;  3PZ7 A;  3WCQ A;  1J7C A;  1N61 A;  3MJ5 A;  2WXF A;  3AB5 A;  2GB1 A;  1TKY A;  2KN4 A;  3U52 E;  4DXF A;  5I4D A;  1VZ7 A;  5AUI A;  3N9Y C;  2ON8 A;  2WDQ B;  2ACZ B;  3HRD D;  1ZPS A;  2I2Y A;  2ONQ A;  2PW9 A;  3ZQ4 A;  4TSS A;  1TS2 A;  2JYE A;  1NEK B;  1DOY A;  2YEP F;  3T3N A;  1IBX B;  1TZO A;  1FO4 A;  4IOI E;  1EU4 A;  5BYQ A;  4CQN A;  1JWA D;  2CJO A;  2IPK D;  4AS1 A;  3AE9 B;  3W5U B;  2V0G A;  2WXO A;  1E6E B;  1BML C;  5FR3 A;  1IBX A;  3VRB B;  5AUK A;  5C2T B;  3TSS A;  3NS1 A;  5EE3 A;  5BMH A;  4LTU A;  1CQV A;  4A6Q A;  1L5P A;  2LMC A;  1FNV A;  3BWU D;  2PIA A;  1SJH D;  4OZB A;  1YJI A;  4OHJ A;  4C80 A;  1JML A;  1UGJ A;  1YN5 A;  1QKZ A;  4ZOH C;  1YQ3 B;  4A9A A;  2WXG A;  2J53 A;  3I57 A;  2MJE A;  3LB8 C;  3AE5 B;  3I9V 1;  1FXA A;  1WXQ A;  1OFF A;  2RDG A;  3P4Q B;  5BYS A;  3BVG A;  3DWG C;  3Q69 A;  2K0P A;  3NVV A;  4NAW B;  1ZDX A;  2BW2 A;  1STE A;  1E0Z A;  1XLN A;  1D4B A;  2QIL A;  3VRA B;  2WXQ A;  1E10 A;  2J42 A;  2W3R A;  1NI3 A;  1XO3 A;  1L6V A;  1FXI A;  2HTM E;  3EUB 2;  3J9C A;  1N63 A;  2INP E;  2W3S A;  4YT0 B;  1L0Y B;  1GPX A;  1FM0 D;  1AN8 A;  4WUR A;  2ICI A;  1AW7 A;  3E9S A;  3HVD A;  5HG2 A;  1K53 A;  2MH7 A;  1L4Z B;  1MPE A;  1KLU D;  4RGM A;  4ARC A;  3HVZ A;  4HKZ E;  3IAS 1;  3Q8C A;  3ZGZ A;  3AEG B;  2D5G A;  1FFU A;  1NYR A;  1AWD A;  1KLG D;  2BS2 B;  5FKA C;  3AMZ A;  1TY2 A;  1C78 A;  2WU5 B;  1XLP A;  4XWW A;  2NTT A;  3ETR A;  3SR6 A;  2L32 A;  4XDD A;  1YJJ A;  5JXV A;  2PTL A;  3ABV B;  4RNA A;  1ENF A;  1QT9 A;  4KGS A;  3H8H A;  1SE4 A;  1ZP0 B;  4GLS C;  3IT6 B;  2QMT A;  2WU2 B;  2AX5 A;  1V1P B;  2HDE A;  1KF6 B;  2V4I B;  3OWE B;  5E6J A;  1SBB B;  2B76 B;  1FNU A;  2FBW B;  2JZP A;  2EKI A;  3MHZ A;  3KQ4 A;  3BYT B;  3SEB A;  2XN9 C;  1B9R A;  1FIQ A;  3AH7 A;  1P7F A;  2AQ2 B;  2BBC A;  3CWI A;  1T3Q A;  3LXF A;  3MFG A;  4EE2 A;  3ZJU A;  2KMM A;  3TEY A;  1TJE A;  1F77 A;  4OZA A;  3O13 A;  3V3X A;  1WRI A;  1QOG A;  5T8I A;  3DWM A;  4XE0 A;  3SFD B;  1TS4 A;  4A8X C;  4YTM B;  3AM9 A;  4KX6 B;  4HKQ A;  2WP9 B;  1C76 A;  2L52 A;  4ZRP A;  2WXK A;  1DOX A;  2MEK A;  1ESF A;  3AN1 A;  3R8B A;  3U7Z A;  4UDU C;  4B0E A;  3L4P A;  4R3D A;  4RGO S;  4YTN B;  4YTP B;  4REZ A;  3AED B;  3BVM A;  3NRZ A;  4IDI A;  3BK1 A;  3AE1 B;  1KFY B;  1WWT A;  5BMG A;  1OQR A;  4DQO C;  1QF6 A;  3AE6 B;  4L1B A;  1KH0 A;  5FK9 C;  4KGT A;  2KAC A;  1V97 A;  4LLG M;  4JE3 B;  2BT6 A;  3HUI A;  4J3O D;  2GRI A;  1QIL A;  1XCQ L;  2WDR B;  4MAC A;  4YSY B;  2N9K A;  2N9L A;  3ZJV A;  3W5V B;  4ARI A;  3Q8A A;  1JQ4 A;  3AE8 B;  4MM3 B;  1ZUD 2;  2QIE B;  2CJN A;  1YN4 A;  5HHD G;  5TSS A;  1PFD A;  4RFB A;  1D5Z C;  1DYQ A;  1K52 A;  4RGT A;  3SFE B;  3TUO A;  1VZ6 A;  3VR8 B;  2KAJ A;  1TY0 A;  4WWM A;  2RDH A;  1NVI D;  3BYY B;  1Y56 A;  4TMA B;  2DBY A;  2W54 A;  5EE1 A;  2LHE A;  3Q8E A;  3NVY A;  4OVZ A;  4KKI A;  2GI9 A;  4KGR A;  2Y5C A;  2WXJ A;  2N7J A;  3AE3 B;  1GB1 A;  2J52 A;  1D6E C;  1YQ4 B;  4IKG A;  4D2K A;  3P4R B;  1XLO A;  2NMQ A;  1HZ6 A;  1ET6 A;  4WH4 A;  3P1M A;  1N5X A;  3TEZ A;  1A70 A;  4WIP A;  1C4C A;  4USA A;  2G1E A;  2JX5 A;  3E56 A;  2XNA C;  1MVK A;  1RWS A;  5HI1 A;  1F0Z A;  1F2R C;  4PT5 A;  1ROE A;  2ZW1 A;  1HEZ E;  3AEC B;  1ZXI A;  1GB4 A;  1EU3 A;  4ZYS A;  2EEL A;  1JCK B;  1AYF A;  2BB5 A;  4P6V F;  1BXT A;  2X38 A;  4C7Y A;  5LNK 1;  2OHF A;  4GDL B;  1LO5 D;  2VZK D;  4YSZ B;  3T3O A;  3AE7 B;  2LJI A;  1XXG A;  2SAK A;  3IT4 B;  3MP9 A;  3NZ3 A;  3U2S C;  2K22 A;  3KWV A;  1UUP A;  4A90 A;  2DYM A;  3V05 A;  5MPO A;  3BK2 A;  2BS4 B;  1D5M C;  1GAQ B;  3LYY A;  2DYO A;  3EA6 A;  3P4P B;  2PVG C;  3P63 A;  4HRS A;  4WQM A;  2PMV A;  1V1P A;  4JWS C;  1JW9 D;  2WDV B;  4Q2J A;  4B0M A;  3IXS A;  3C8Y A;  3BZD B;  3ZYY X;  1N60 A;  4XDC A;  3VR9 B;  2H89 B;  3RFZ B;  2M0A A;  1C9F A;  1NYQ A;  2RPV A;  2L83 A;  3FAH A;  1UNS A;  1Q10 A;  2WXN A;  3P4S B;  4JWU C;  5EE9 A;  4RH6 A;  3IAM 1;  1JWM D;  2JQR B;  1SE3 A;  1DGJ A;  1C79 A;  1HQR D;  1TKE A;  2IDY A;  2FE8 A;  2OED A;  2IGH A;  5EE0 A;  5BMI A;  1E9M A;  1JWU D;  2VZK B;  1JRO A;  1R7S A;  1HA5 A;  1L6U A;  1FRR A;  2IGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...