1Q10A

Ensemble of 40 structures of the dimeric mutant of the b1 domain of streptococcal protein g
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
MQYKVILNGKTLKGETTTEAVDAATAEKVVKQFFNDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G binding protein G
publication title A Protein Contortionist: Core Mutations of GB1 that Induce Dimerization and Domain Swapping
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Protein binding
total genus 9
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1q10A00
1MHHE 2ON8A 1GB1A 4GLSC 2N7JA 1UWXA 1P7FA 4HJGE 2N9KA 2ONQA 1PGXA 1MPEA 2K0PA 4KGRA 2J52A 2I2YA 5HFYA 4OZBA 2JZPA 2RPVA 5HI1A 1HZ6A 1MI0A 1K50A 2GI9A 1PGAA 4OZAA 1K52A 4OZCA 2ZW1A 1YMHE 3UI3A 1C9FA 1GB4A 2JU6X 3FILA 4MACA 1KH0A 3FILB 4KGTA 5JXVA 2GB1A 2KQ4X 2KWDA 1HZ5A 1XCTL 1FCLA 1HEZE 5BMGA 2LUMA 2EELA 1D4BA 2JXTA 3V3XA 5HG2A 1K53A 1IGCA 2IGGA 4IOIE 1EM7A 2ZW0A 1FD6A 2OEDA 4HKZE 2J53A 1XCQL 2PW9A 2QMTA 1YNTE 4WH4A 3MP9A 1JMLA 2LGIA 4D2KA 1F2RC 5BMIA 2LHDA 1QKZA 1FCCC 2PTLA 2KN4A 1Q10A 1MHXA 2I38A 1IBXA 5BMHA 1MVKA 2IGHA 1F2RI 1IBXB 2KDMA 2N9LA 5HHDG 2QSDA 2IGDA 3GB1A 2RMMA 2KACA 2JSVX 1ZXHA 1P7EA 2PLPA 2NMQA 2LHEA 4IKGA 1XF5L 1IGDA 1PGBA 2JWUA 4KGSA 1K51A
chains in the Genus database with same CATH superfamily
3RN9C 3ML8A 5DPSA 2PJHA 2DNFA 2PE6B 2WXIA 1EWCA 1Q0WB 2Y5CA 4AJYB 2BGFA 3URYA 4L23A 1NI2A 3AE4B 3LB8C 3I57A 1EUVB 3UIOB 1E0ZA 4AS1A 2KTRB 2CHZA 2WXPA 1JROA 5CHVC 4JPSA 2PE9A 2N9EB 4IG7B 3KUDB 3B9JA 2A4ZA 3TUOA 2JU6X 2DHZA 2KLCA 2RGFA 1L7YA 2WDVB 5G5HA 4EUTA 1RYJA 3Q6BA 1FXAA 1NDDA 2WXFA 2W3SA 2INPE 3H6NA 3U2SC 2BYEA 2KT7A 3IT4B 3T3NA 4GOCA 4HWIB 3Q8FA 4GDKA 5DPTA 1C4PA 2DLBA 4OVUA 1E10A 3U52E 3ONSA 2L05A 1FMAD 2JUOA 1GG3A 2BQQA 4GXBA 1F9JA 3AMZA 1NBFC 3MTNB 5DCNA 2LHDA 3R7QA 2MJ3A 2BTEA 4F1SA 2B76B 4KVGB 2Z59B 4W9HA 3A9JA 2M0AA 1MVKA 3M3JA 4ITKA 1J8CA 1WJ4A 2N9PC 2L8JA 1HE8A 1NEKB 2L0FA 4HRSA 2JZ3B 5IP4D 1GUAB 2WGSA 3GZNI 3CMMB 1UZXB 4RF1A 3PO0A 3RD2A 3UQBA 4ZHOA 2MX2A 2VRRB 2W54A 3VUYA 2MHJA 1VJKA 2X38A 1A5RA 3Q14C 4HDOA 1GOZA 1QILA 2LEKA 2XN9C 4ICVA 3V62A 1V97A 2NR2A 3L16A 4I6PA 1UF0A 1VZ8A 2FCSA 2KX0A 3QQ8B 4GU2A 2EKIA 2LWPA 2RDHA 1TZ1A 2N1WA 2V3NA 1V1OA 5AUIA 1KTKA 5C3JB 2CJNA 3FAHA 1V6EA 2KXJA 2AQ3B 3TSSA 1AW7A 4KKJA 2J0JA 3AULA 1TYGB 4YSYB 4LDTD 4RM9A 2EELA 2BB5A 2LRWA 1FNWA 1I4RA 1WZ0A 3NZ3A 5D3DA 1N5XA 3WIMA 1UH6A 3MP9A 1JMLA 2J0KA 2M1MA 2BS3B 4P1CC 1FPYA 2KN4A 2FBWB 3O13A 4E3CA 1OEYA 3B2GA 1D5XC 3UIPB 1TS5A 3VUWA 2BYVE 1SB3C 3P4RB 3ZJTA 4US8A 4RCOA 1JWAD 1TTNA 2DBYA 4ZRKA 3ZNZB 4ZDVA 2IZVB 3OLMD 4L1BA 4WWPA 2QILA 4RFBA 1JRUA 2LHEA 2JQRB 1XF5L 1XO3A 1QOBA 1T0RC 1WGRA 1X1MA 1BUIC 2RDBC 4YXDB 4FADA 2Z8LA 4FULA 4EZJA 1TGZB 1KRHA 4K7SA 4IDIA 4N9F4 4TQ0A 3GZNB 4HPLB 4IM3A 3RI7C 2AWTA 2KTRA 4LK0M 1TKYA 4MEMA 2J4XA 1DOXA 2LMCA 3ZRFA 4FA6A 1TS2A 3DBLB 1FIQA 3WAMA 1QT9A 3R2IA 2CU3A 4WQOB 2WP9B 1R7SA 5D3IB 1YQBA 3DWMA 2V0GA 1TY0A 1B9RA 4WWMA 3R7RA 5LXIB 1XCTL 4GN1A 2LI5A 1C79A 3A4RA 3DBSA 2E6XA 3TJPA 2O6VA 1C76A 1LM8B 3QCAA 1I7HA 1FEHA 1EU4A 1ET9A 1DOIA 1T6BX 1G6JA 5C23A 2JYEA 3GE8C 2SAKA 2K39A 3PRPB 4M00A 4HKQA 4WURA 5D94A 4G11A 3CSFA 4FHKA 1E8WA 2JT4B 1QOFA 1TS4A 2QC8A 1P1AA 3PT2B 2PKOA 1E9MA 2KMMA 3RYTA 5TR5A 2FCQA 5EE0A 4P16A 2IGDA 3P2BA 4DK5A 5AZGA 2KNBA 2WXNA 3HK0A 3M62B 3C0RB 4ZOHC 4MGYE 2HTHA 2Z0DB 3IFWB 2A5UA 1WYWB 2GRIA 3A4SC 2NCNA 1K8RB 4BBNC 1UWXA 2KMCA 1T0SC 2QCZA 2MA9B 2GMIC 3BYTB 1WIAA 4EKUA 3H9DA 1GNUA 3BK1A 5H92C 1HZ6A 3AEDB 2FE8A 3ZYYX 4CHKA 4LNFA 1MI0A 4OHJA 1ISNA 3TEWA 2LRUA 2BYTA 1GB4A 4R3DA 3ABVB 5EE3A 2L0TA 2YEPB 4M8MA 4KIKB 2VH1A 4GMVA 1R4NB 5JH5C 4NAWA 2AL3A 4BBNF 3MHZA 2XEWA 1WGGA 1HA5A 1HEZE 2G4SA 4DXGA 4A3OA 2M56B 3SDLC 5HG2A 4W9GA 2L76A 2K8BA 1WM3A 1FD6A 2AYOB 1Z2MA 3CWIA 5AUKA 2BS4B 1WGDA 3NJTA 1WMHB 2MEKA 4RGOS 2XK5B 2K22A 4D2KA 3E56A 2BPSA 1R4MI 2PTLA 3RCZA 3AH7A 2FUHB 1WI0A 1P3QU 3NZUA 2KZRA 4RM8A 1T3QA 2AQ2B 3VAWA 2V4LA 2WX0A 4C00A 4ZRJA 3ZNID 3Q3MC 4F7ZA 3ZXVA 1K51A 4DBGA 2VZKB 2ON8A 1V9JA 2N7JA 3QK0A 1L0VB 1SXTA 3JSVB 1SE2A 4XDCA 2JY6A 3SFDB 3VR8B 2ZEQA 3DBHB 3AE7B 1NVID 1FO4A 1BXTA 4A6QA 2IDYA 4NQKE 1TS3A 3IVFA 5KHQA 2I1KA 3NUHB 1L0YB 3FILB 3ZVVA 5BYRA 5JXVA 1E5WA 3BIID 2YEPF 2BT6A 1JALA 1I4HA 2LXCA 2C60A 1J7BA 3NZSA 2OHFA 2IGGA 2E3TA 5DPRA 2PPHA 4LJPB 3K9PB 4WJNA 4HLEA 1WGYA 2JXXA 4RF0A 1XCQL 1YJ1A 3Q3OC 4P6VF 3OJ4B 3SHQA 1YX5B 3UF8A 2MW5A 2MP2B 1F52A 1YOVB 2D3BA 2WXMA 2PVGC 2FIFA 4KSLC 3DBRI 2N1VA 3SEBA 1FRRA 1DYQA 4BZAA 2L00B 5G5GA 1T5XD 1I4QA 3E9SA 3H7PB 4DXFA 2KDMA 3P1MA 2KVZA 2TSSA 3OG5A 5HKHA 4MH8A 4NQLB 3VQIA 3UGBB 4UDUC 4ANVA 5FR3A 4ZRQA 3JYUA 1P7EA 1F0ZA 4FXCA 3ALBA 4IKGA 3N32A 4PS7A 2C7MB 3EFUA 1HTQA 1YQ4B 3P63A 4PS8A 3TMPB 1FXTB 3CSTA 2K3UA 3MC8A 2RSUA 2WU5B 5JZEB 3U7ZA 4PYZA 1XLOA 1YQ3B 5LNK1 2INCC 2WYQA 4TMAB 1L0XB 2K9XA 4EEWA 3M63B 4M01A 4S17A 2GLSA 2INNE 1PGAA 2MBEA 2Y3AA 3NVVA 4W9EA 1GAQB 3DOWA 3PPAA 4KIKA 1KH0A 2ACZB 4TV3A 1QF6A 4W9JA 1BMLC 2GB1A 2GBRA 2LD9A 2NTTA 2IO0B 1AYFA 1HZ5A 2KD0A 1T0QC 4LLGM 5D2MB 2WDRB 4DQOC 3MC0B 3HVDA 4RNAA 2D07B 1P9DU 1WJ6A 2ZW0A 3S2AA 3DQVA 1CJEA 2H89B 1ENFA 3AB5A 2RR9A 2J53A 1YNTE 4L2YA 1WXSA 1WMHA 1PUTA 1AARA 2KJRA 3ZTDA 1WH3A 4K1RB 2IY0B 4NPNA 1WX9A 2RDGA 2RPQA 3PV1A 1BT0A 2NPTB 3N20C 1TY2A 4FJYA 2KACA 1C4CA 1Q1OA 4PT5A 4BFRA 4LTUA 1XT9B 1ZDXA 4JIOU 2HE7A 5J2RA 3DBRB 3EGRA 2D3GA 1PGBA 5BYSA 1PQSA 4EZLA 2VZKD 1ZPSA 3JSVA 3DPDA 3ZJUA 4ASWC 3W2DA 3BINA 2GBMA 3V60A 1NYQA 2CJOA 4IWQA 4OZBA 3APCA 2REXA 4S0RA 2N7EA 3C19A 4A9AA 3U4EG 1JWBD 3DBLI 2M19A 1XLNA 3FILA 3ZW3A 4W9KA 2UWQA 1JW9D 4AJWA 4HPMB 3AE3B 1P98A 2WXGA 2V3SA 3AI5A 2KQ4X 4ARCA 1FRDA 1P0RA 2HJ1A 4JGHB 3KUZA 4JQWC 4MSQB 1WSPA 3H8HA 1WYGA 1LGRA 2D3AA 3QC8B 2HJ8A 3TEZA 3TCAA 4FJVB 1C3TA 2L3ZA 5MPOA 1RLFA 1QQRA 2MP2A 4JX1C 2KC1A 4JLCA 3TBLD 2BW2A 1ZDVA 2KN5A 3NOBA 3ZNGC 4DDID 5I4DA 4WAAA 3IBEA 5GXGB 4USAA 3H7PA 1TBEA 2NBWB 3NS8A 3ZDTA 2MCNB 1SEBD 3I9V1 4ARIA 3DVGX 2HTME 1H4RA 1TIFA 2Q5WD 4GIVA 2M17A 4O1NA 2JRHA 3AM9A 1EWYC 4YTPB 3APFA 4BOZB 1AN8A 5IAAC 3P4SB 3GS2A 1Y8RC 3TEXA 3N1XC 4ZHPA 3NS1A 4WWNA 1GC7A 3DWGC 2DZJA 3TEYA 1WR6E 1P7FA 3DHIC 2KDEB 4G3XB 2JVCA 1V1PB 2C9WB 3PTFC 4IM2A 4IM0A 4DHZE 4TSSA 1PGXA 4MDKE 2ZPNA 3L54A 1H8CA 3CIRB 2I2YA 2VH2A 3AEAB 3N1YC 4IWOA 1JWSD 1VR9A 2FUG1 1FXIA 2ZNVB 1K50A 1D6EC 3R66C 2WU2B 3RZWC 3L17A 1YMHE 3IT6B 3J9CA 1YN4A 4MGIE 4NNJB 1WXAA 2L1AA 5BYQA 4YSZB 1XLQA 1WRIA 2D11A 2IJ0A 2KVRA 2MRPA 2KWDA 4TQ1A 2DYMA 1R4NI 3OAWA 3VUXA 3V3XA 4C4VB 3TL5A 2KKCA 1EM7A 3IHPC 5KHOA 2WS3B 2AEHA 2DAJA 2JRIB 2NTSA 3B08A 3IAS1 3PGEA 3ZXRA 5JHBA 2NS5A 2IO2B 3B0AA 2Z0EB 5LLIA 1FCCC 4LNIA 3DCGA 2ZZPB 4M0WB 1OFFA 1ZP0B 4WAFA 2AQ1B 3PZ8A 4NY0A 3BZDB 3RNBC 1WZ3A 2JZZA 2M0XA 2CHXA 5FR6A 2G9HD 2K5PA 2JYTA 3HUIA 1C1YB 3R2TA 4I6NB 3EC8A 2ZNVC 1HXYD 4BKGA 5E6JA 2WHIA 2PLPA 2DWQA 2IO3B 1UBIA 3AEFB 1KLGD 3EECA 4GGQA 4RGNA 4XWTA 2KDBA 2K6QA 2JPHA 5IN7A 3Q8EA 2LZ6A 1WR1A 1VZ6A 1WE7A 4HK2A 3WALA 4YSXB 4MJSB 2MSED 4ACFA 2BVCA 1L6UA 5D7GA 3DBHI 2WXLA 1WE6A 4K81A 4AOFA 2NVUI 2GI9A 2LGXA 4OZCA 4I6LB 4AWJA 1L2NA 1YJJA 2IYDB 4HCPB 1E90A 4CYEA 2N4FA 4IC7B 2V1YA 3DHHC 1CZPA 2CR5A 2O2VB 3OWEB 5L83A 2KWVB 4P7IA 1FCLA 3PHWB 2MLBA 2X8XX 1JWUD 2CS4A 3W9CB 3KUCB 2LGYA 2BBCA 4JWUC 3HIZA 1L4DB 1VRAB 4P1BC 2DENB 2WXRA 1SBBB 2DYOA 4JE3B 1Q10A 1ZGUB 2IGHA 2LJIA 2QHOA 4NZLB 3IAM1 3AE9B 2FNJB 3GB1A 3MC9A 3PRZA 2WXOA 2JSVX 3L0WB 1DGJA 3VVWB 4W9DA 1VDVA 1XEEA 3LDZE 5L95C 1WGKA 4KGSA 4YT0B 3Q3FA 3PZDA 3QHTA 3MJWA 1V1PA 2NBUA 4II3B 4ANWA 2IO1B 2RD0A 4HJGE 3P4PB 2QIEB 2FIDA 2I1JA 2ONQA 1OQQA 4YTNB 3Q3JA 1MPEA 3OJ3A 3VTWA 2GBNA 3TIXA 4LNKA 1S3SG 2C5LC 3QJZA 1TT5B 5J18A 3KWLA 2KTFA 1MG8A 3GP7A 4GDKB 4OW0A 3VFKA 3Q69A 4J6IA 1FFUA 1QOGA 5H8YE 4NAMA 1N63A 2WXKA 2BF8B 4C7YA 2MBBB 4MGZE 1UELA 5D6JB 4Q2JA 4XWWA 2KHWB 2HDEA 3SFEB 4ZRPA 3IG3A 1NYRA 1N61A 2MWSB 1K53A 2FAZA 4A20A 1TKGA 3P4QB 2G45B 4LNNA 4F8CB 4HKZE 4PYUA 1OTRB 1ZOYB 4M02A 2G4DB 4EFOA 1WWTA 4NJCA 3GE3C 2ICIA 3UINB 4A3PA 2KJHB 5EE1A 1V5OA 3KW5B 4GB9A 4M0WA 4XX5A 4MSMB 1QKZA 3VTUA 3QAQA 2KC2A 3B1LX 1UGJA 4EZKA 2WQYB 2K25A 2EMTA 2AX5A 4K3BA 4XZ4A 3ZRCA 2YLMA 2KWCA 4WQMA 1ACCA 2GBJA 2QSDA 1V86A 1ZE3D 2IBIB 2CHWA 1ZXHA 1WXMA 2LVPA 5CX3A 5CHWA 1YD8U 1WM2A 3LJ3A 2WX1A 4ANXA 3L4PA 3N3KB 2PVOD 1GB1A 3FC4A 5E6OA 1XXGA 2BB6A 3BK2A 4FJZA 2JWZA 4LNOA 2WDQB 1WGHA 3DHGC 2L7RA 4FLHA 3SU8X 2KAJA 1IP9A 4OVVA 3WAOA 3ZGZA 2BYFA 4WJQA 3T3OA 3ETRA 3IXSA 3RNAC 1KOTA 1M4VA 3KH0A 4HPPA 1SIJA 4NJ7A 2C7HA 3N1ZC 2YVCA 4LJOB 3KYCD 1JWMD 4KDIC 1K52A 1GJZA 3UI3A 1FFVA 2INDC 1QLBB 1ZXIA 4RGMA 3HM6X 1T0YA 3V6EB 3RNEC 4PK1A 2D2QA 2DZKA 3QA8A 4JWSC 3VRAB 3ENEA 1ESFA 4WWOA 2PW9A 4TUUA 2H88B 4G50A 4B0EA 1RM6C 2L52A 2QEJC 3QX1A 4IWPA 5T8IA 2N9XA 1F1HA 3ZLZA 3U8ZA 1YJIA 1SE4A 2LVQA 1SE9A 4DWFA 1XLPA 1UUPA 3WCQA 4DXAB 5HHDG 4C80A 1E7VA 1CMXB 2XK5A 4AUQC 3PHXB 2LVOA 4XC2A 4BKTA 4RGTA 4KKIA 2ZCBA 1IGDA 5TSSA 2WNMA 5EDSA 4US9A 4CO7A 1UNSA 4GLSC 3AE8B 2HD5B 3AE5B 1D3ZA 2N9KA 2KFKB 1GPXA 3X0WA 4II2B 1C77A 1FM0D 2KANA 3ZJVA 2FCNA 2KDFB 1V2YA 3AE6B 3W1SC 3KWVA 4A55A 4URKA 5EE9A 3WAPA 1UBQA 3KVFB 4WJPA 2O6VB 4DHJD 2W9NA 2LJ5A 2MBHA 2KO3A 4N59A 4PS3A 5BO4B 3D32A 4AP4C 1J0GA 4B9KA 3CF6E 2SEBD 3DVNU 2EMSA 3MFGA 3AV8A 2UU7A 2D3CA 2KWUB 4HXDA 4ANUA 3EUB2 1IUEA 4BVUC 3PLVA 2K1FA 3HM3A 1E7UA 3Q8AA 2KMAA 4W9IA 2WXQA 2K8HA 3T9LA 2OJRA 4E71A 1VZ7A 1OQYA 2NBVB 3HRDD 2LGIA 3A1QB 5E6NA 2MBOA 3FKYA 2MJDA 3NY5A 1EU3A 1L6VA 2DYBA 4HEA1 2W55A 4CQNA 3LXFA 1TZOA 2N9LA 4E74A 2RMMA 1DOYA 3R3MA 1RWSA 2V9HA 2DZIA 4DDGD 1N62A 4QAYA 3VHTC 2JWUA 3PSEB 3EFCA 3PREA 1SJED 4LCDE 3A9KB 3VRBB 3BVMA 5IKCM 4XGAB 3KQ4A 4KGRA 2J52A 1N60A 1KLUD 2ZVNA 4NAWB 2UYZB 1CQVA 1I4XA 3A33B 3C8YA 1MFWA 4WJOA 3RUIB 1L4ZB 3B2FA 5AEKB 3K9OB 3L08A 5IOIA 5FK9C 4H2AA 3APDA 4X57B 1JRPA 3N30A 1SSNA 4KZ0A 1VLBA 1LXDA 3W1SA 2LUMA 4K7WA 5E6PA 1I4PA 1NI3A 4B95A 1SF0A 4ZYSA 4IOIE 4MH0E 2OEDA 5LXHA 4KDLB 2QMTA 1N5WA 3V61A 4WH4A 2PMVA 3H1UA 3W1YA 3RNGC 1J7CA 1LQBA 1V49A 2J0MA 2V3PA 3BY4B 3W5UB 1FNUA 5BMIA 3VH3B 4XYCA 4BAXA 2M8SA 3AXCA 1F77A 2I38A 4BOSC 2KQ7A 1C78A 5C2TB 3VR9B 2K8CA 1F2RI 3L13A 4HROA 2ZVOA 3V05A 3H7SA 5GMVA 3NRZA 3Q8CA 1UGMA 3BWUD 5IO9A 3HHMA 4IUMB 2NMQA 1SGHA 3U7DA 2R2QA 3EA6A 1YX6B 4TKNA 3LYYA 5CHFA 3VDZA 3BVZA 2IY1B 1MHHE 2NPTA 3P42A 2KYWA 2KFKA 3ZDMC 4FN2A 3ML9A 1MG4A 3KLSX 3NVWA 4ICUA 4MGKE 2K0PA 4RMAA 1SIFA 3QWZB 5HFYA 1WXVA 4MM3B 1OQRA 1S1QB 1A70A 2JZPA 3QIJA 1J19A 2RPVA 4W9LA 1PFDA 2V4IB 5G2NA 4J3OD 2KLGA 3RNFC 4C7ZA 1Q5WB 2DZMA 2O6VD 4OZAA 3HVZA 3ZNHB 4B0MA 2ZW1A 1ZKHA 4GSWA 2GBKA 1ROEA 3NG0A 4GDLB 1NENB 3KYDD 3ZKJC 2W82A 1B1ZA 2JF5A 3AEBB 4N6EB 2GOWA 3BVGA 1KLVA 1D4BA 4YWGG 1WX8A 2KFJA 3M95A 4MT5A 2ZJDA 4HVBA 1V81A 3VH4B 1KM7A 4KSKC 1XQQA 4YL8A 1WJUA 1ZW7A 3SD5A 1WY8A 2K6DB 3A1QA 2CKHB 2BWFA 2WWZA 1EO6A 2G1EA 1C4AA 1U4AA 1V80A 1PYWD 5C1ZA 2WXHA 3ZIMA 3V6CB 3U30A 3PZ7A 1HQRD 2XNAC 3VXWA 2PEAA 3RT3B 1QOAA 5BMHA 2N0SB 3AU5A 3NVYA 5DPWA 1EF5A 1QZEA 1ET6A 1IBXB 5G55A 2B3AA 1WF9A 2ASQA 3NHEB 1OEYJ 2R2OA 2JX5A 2OOBB 2MJEA 3PS6A 1V5TA 1UD7A 3RULA 1YN5A 3GOEA 4HDQA 2WLBA 4DHZB 3ZTCA 1ZUD2 1RRBA 3A9KA 3VTVA 1EF1A 2LGDA 2BKFA 2KQSA 1CK1A 3I63C 2KJ6A 3Q3NC 1E8ZA 2WXJA 2QDFA 4BKSA 1IYFA 3DDCB 1TJEA 4BKSD 1I35A 5HI1A 2FCMA 2AL6A 1E8YA 3BYYB 2PIAA 3Q2AC 3X23A 4HCNB 3AU4A 1D5MC 2MQJA 2LFIA 3WA0A 2BS2B 3AEEB 4FBJB 4MACA 1WX7A 3RNCC 4A90A 1WJNA 1KJTA 2D10A 4AQ7A 3NVZA 2LASA 1I4GA 1RFAA 3EHVA 5BMGA 1OGWA 2JXTA 4ZRIA 1L5PA 3JVZX 3Q8BA 1IGCA 1RAXA 2DX5B 3R8BA 3PRMB 3WANA 4A8XC 1GC6A 2LGSA 4DHJB 2R61A 1YN3A 2D5GA 3DVGY 1E8XA 3MJ5A 2CU1A 1HTOA 1LO5D 5IA7A 1Y56A 1F2RC 1XD3B 2KDIA 3RZFA 1JCKB 3AEGB 3AECB 4KV2A 1KFYB 2LUEA 4K3CA 1VCBA 2J42A 3ZUNA 4C4VA 4XDDA 2L83A 1Z5SB 5AZHA 1WFYA 2DAFA 3A9JB 4KX6B 4YTMB 4NJ6A 4B6WA 1TKEA 3W5VB 3ZO5B 2XBBC 3N9YC 3L10B 3I5JC 5JHAA 4OVZA 1VD2A 2J7QB 2Y5BB 1MJDA 2OJWA 1J7AA 4MELA 2ZCCA 1SJHD 1RFKA 3RPFC 4FHJA 1E6EB 4REZA 1PDXA 3JW0X 1FNVA 4W9CA 4M8NA 2N7DA 2ZPYA 4MM3A 1M94A 4EOYA 1N6ZA 3ZQ4A 2LXAA 4G0NB 3PLUA 3SR6A 1I42A 2Y5PA 4XE0A 4WIPA 1E7PB 3O65B 4C56C 1C9FA 3PVLA 1D5ZC 4MJSA 2M4NA 5AZFA 3AE1B 4GDLA 3I3TB 2MBQA 2BKRB 4KGTA 3RFZB 1WXQA 3ECIA 2KOXA 4K7UA 2IPKD 4LDTB 3T8MA 2BWES 4N58A 4HJKA 4RH6A 2G3QB 1WRDB 4JL9A 3QARA 4W9FA 4KZCA 1LFDA 3RMKC 1KF6B 1R4MB 2KX3A 2O2VA 2KK8A 1SE3A 3AN1A 1MHXA 2QJLA 2EKEC 4IW0A 1IBXA 1YIWA 2WDTB 1STEA 5J17A 2C7NB 5FKAC 1V8CA 2W3RA 3MHSD 1IPGA 4EE2A 2L32A 3AE2B 2MH7A 4ZYNA 1JQ4A 3DVNV 3UQAA 1UWMA 1AWDA 5CTRC
chains in the Genus database with same CATH topology
2VZKB 2ON8A 3Q8EA 1SJED 1VZ6A 2N7JA 2WXIA 1EWCA 1L0VB 3VRBB 2Y5CA 1SXTA 1SE2A 4YSXB 4XDCA 3URYA 4L23A 3BVMA 3SFDB 3VR8B 3AE4B 3LB8C 3KQ4A 3AE7B 4KGRA 3I57A 1NVID 2J52A 1FO4A 1L6UA 5D7GA 1E0ZA 4AS1A 2WXLA 1N60A 1BXTA 1KLUD 1JROA 2WXPA 4NAWB 4A6QA 2IDYA 1CQVA 1TS3A 4JPSA 1I4XA 3C8YA 2GI9A 4OZCA 1L4ZB 3B9JA 3B2FA 3TUOA 2JU6X 3NUHB 1L0YB 1YJJA 3FILB 5FK9C 4H2AA 2WDVB 5G5HA 5BYRA 1RYJA 5JXVA 1FXAA 3U2SC 2WXFA 2W3SA 1JRPA 2INPE 3T3NA 3IT4B 1CZPA 1SSNA 1VLBA 3Q8FA 3OWEB 3BIID 2YEPF 1FCLA 3W1SA 2BT6A 2LUMA 1C4PA 1JALA 2DLBA 1I4PA 1I4HA 1NI3A 1J7BA 1SF0A 4ZYSA 1JWUD 1E10A 2OHFA 3W9CB 2IGGA 3U52E 4IOIE 2E3TA 2BBCA 4JWUC 1L4DB 2OEDA 1VRAB 1FMAD 4RF0A 2QMTA 1XCQL 1N5WA 4P6VF 4WH4A 2WXRA 2PMVA 1SBBB 1J7CA 3AMZA 2V3PA 3W5UB 1FNUA 5BMIA 2LHDA 2WXMA 2PVGC 2DYOA 4JE3B 1F77A 2MJ3A 2BTEA 1Q10A 2B76B 3SEBA 2I38A 1FRRA 1DYQA 1C78A 2M0AA 1T5XD 1I4QA 5G5GA 5C2TB 1MVKA 2IGHA 2LJIA 1F2RI 4NZLB 4ITKA 3VR9B 3E9SA 4HROA 3IAM1 2KDMA 3AE9B 3V05A 4DXFA 3P1MA 3NRZA 3Q8CA 1NEKB 3GB1A 2TSSA 4HRSA 2WXOA 3BWUD 4MH8A 2JSVX 3VQIA 4UDUC 5FR3A 4ZRQA 1P7EA 4RF1A 1F0ZA 1DGJA 3PO0A 2NMQA 4FXCA 3EA6A 1VDVA 1XEEA 4IKGA 4ZHOA 1WGKA 4KGSA 4YT0B 3LYYA 2W54A 3BVZA 1YQ4B 3P63A 1VJKA 2X38A 1MHHE 3P42A 1V1PA 1GOZA 2K3UA 4HJGE 1QILA 2LEKA 2XN9C 3P4PB 2QIEB 3KLSX 1V97A 2WU5B 3NVWA 2ONQA 1OQQA 4YTNB 3U7ZA 1MPEA 2K0PA 1VZ8A 1XLOA 5HFYA 4MM3B 1YQ3B 1OQRA 2JZPA 1A70A 5LNK1 2RPVA 4TMAB 3KWLA 1PFDA 1L0XB 2K9XA 2EKIA 2V4IB 4J3OD 2RDHA 2V3NA 1V1OA 3GP7A 5AUIA 4C7ZA 4GDKB 1KTKA 4OW0A 5C3JB 2INNE 1PGAA 3Q69A 1FFUA 3HVZA 4OZAA 4B0MA 1QOGA 2CJNA 2ZW1A 3FAHA 5H8YE 2Y3AA 4NAMA 3NVVA 1N63A 1GAQB 2AQ3B 2WXKA 3TSSA 4C7YA 1KH0A 1ROEA 1AW7A 2ACZB 4KKJA 1QF6A 4GDLB 1NENB 1BMLC 2GB1A 2NTTA 4Q2JA 4XWWA 1AYFA 2W82A 1B1ZA 1HZ5A 3AEBB 4N6EB 1TYGB 2HDEA 4LLGM 4YSYB 2WDRB 3SFEB 4ZRPA 4DQOC 3BVGA 1NYRA 1N61A 2EELA 4YWGG 1D4BA 1K53A 3MC0B 2BB5A 3HVDA 4MT5A 4RNAA 1TKGA 3P4QB 2ZW0A 1FNWA 1CJEA 1I4RA 2H89B 4HKZE 1ENFA 3NZ3A 5D3DA 1ZOYB 3AB5A 2J53A 1WWTA 1YNTE 4L2YA 4NJCA 1PUTA 1N5XA 2ICIA 3MP9A 1JMLA 5EE1A 2G1EA 1C4AA 2BS3B 4M0WA 1PYWD 1QKZA 2WXHA 2KN4A 1HQRD 2FBWB 2XNAC 3PZ7A 1UGJA 1QOAA 5BMHA 2RDGA 3O13A 2N0SB 3NVYA 2WQYB 2AX5A 1ET6A 3B2GA 1IBXB 1D5XC 4WQMA 1ACCA 1TS5A 2QSDA 1ZE3D 1TY2A 1SB3C 3P4RB 3ZJTA 2JX5A 4US8A 4RCOA 2KACA 1C4CA 2MJEA 1JWAD 4PT5A 2DBYA 4LTUA 1ZXHA 1YN5A 1ZDXA 4L1BA 2QILA 4RFBA 2WLBA 3L4PA 2LHEA 3EGRA 2JQRB 1XF5L 1XO3A 1QOBA 1PGBA 5BYSA 2PVOD 1ZUD2 2VZKD 1ZPSA 3FC4A 1GB1A 1BUIC 1XXGA 2BB6A 4YXDB 3BK2A 2WDQB 2Z8LA 3ZJUA 3W2DA 1KRHA 4IDIA 1CK1A 4TQ0A 2KAJA 1NYQA 4LK0M 2CJOA 1TKYA 2WXJA 3ZGZA 4OZBA 3T3OA 2J4XA 3ETRA 1TJEA 1DOXA 2LMCA 3IXSA 1TS2A 5HI1A 1M4VA 1FIQA 1SIJA 1QT9A 4A9AA 3U4EG 3R2IA 1JWBD 3BYYB 2CU3A 2PIAA 2M19A 1JWMD 1K52A 2WP9B 1R7SA 5D3IB 1D5MC 1XLNA 3UI3A 2LFIA 3FILA 2BS2B 1FFVA 3AEEB 1JW9D 1QLBB 4MACA 3DWMA 1ZXIA 4RGMA 2V0GA 1TY0A 3AE3B 2WXGA 1B9RA 4WWMA 4A90A 2KQ4X 4ARCA 1FRDA 4AQ7A 3NVZA 1XCTL 1I4GA 1C79A 1WSPA 5BMGA 2E6XA 4JWSC 1C76A 2JXTA 3H8HA 3VRAB 1L5PA 3Q8BA 1WYGA 1I7HA 1FEHA 1IGCA 1EU4A 3R8BA 1ESFA 4A8XC 1ET9A 1DOIA 1T6BX 2R61A 3TEZA 1YN3A 2D5GA 2PW9A 5MPOA 2JYEA 3MJ5A 2H88B 2SAKA 4B0EA 1RM6C 1LO5D 1QQRA 4WURA 4HKQA 2L52A 4JX1C 2BW2A 2QEJC 1ZDVA 1Y56A 5T8IA 1QOFA 5I4DA 1F2RC 1TS4A 5GXGB 1JCKB 3AEGB 3AECB 1KFYB 2J42A 2PKOA 1E9MA 1YJIA 2KMMA 1SE4A 4USAA 4XDDA 2L83A 1XLPA 1UUPA 5EE0A 3WCQA 4P16A 1SEBD 5HHDG 3I9V1 4ARIA 2IGDA 4C80A 4KX6B 4YTMB 2HTME 1TKEA 3W5VB 2Q5WD 4O1NA 3AM9A 1EWYC 4YTPB 3N9YC 2WXNA 4RGTA 4KKIA 1AN8A 1IGDA 4ZOHC 5TSSA 2WNMA 3P4SB 3GS2A 4OVZA 4US9A 3TEXA 4ZHPA 2GRIA 3NS1A 1UNSA 4GLSC 1J7AA 3AE8B 3DWGC 3AE5B 3TEYA 1UWXA 1P7FA 1SJHD 1RFKA 3RPFC 1V1PB 2N9KA 1E6EB 4REZA 1GPXA 1PDXA 1C77A 1FM0D 1FNVA 3BYTB 4TSSA 1PGXA 3ZJVA 3CIRB 2I2YA 3ZQ4A 3BK1A 3AEAB 3AE6B 5H92C 3SR6A 1JWSD 1HZ6A 3AEDB 1VR9A 2FUG1 3KWVA 2FE8A 3ZYYX 4A55A 1FXIA 2Y5PA 5EE9A 4XE0A 4WIPA 1E7PB 1MI0A 4OHJA 1K50A 1D6EC 3TEWA 2WU2B 1YMHE 3IT6B 3J9CA 4C56C 1YN4A 2BYTA 1C9FA 1GB4A 4N59A 1D5ZC 4YSZB 2L1AA 5BYQA 2SEBD 3AE1B 4R3DA 1XLQA 1WRIA 2IJ0A 3ABVB 5EE3A 4KGTA 3MFGA 2YEPB 3AV8A 1WXQA 3RFZB 2KWDA 4TQ1A 3EUB2 3MHZA 1HA5A 2DYMA 1HEZE 1IUEA 2IPKD 4DXGA 2M56B 3V3XA 5HG2A 4N58A 1EM7A 4RH6A 3Q8AA 1FD6A 2WXQA 2WS3B 2NTSA 1VZ7A 3CWIA 5AUKA 1KF6B 2BS4B 3IAS1 3HRDD 4RGOS 2MEKA 2LGIA 2K22A 4D2KA 3E56A 2MJDA 1EU3A 1FCCC 1SE3A 3AN1A 2PTLA 1L6VA 1OFFA 1MHXA 1ZP0B 2QJLA 1IBXA 4HEA1 4WAFA 3AH7A 2AQ1B 2W55A 3PZ8A 4CQNA 3BZDB 1STEA 3LXFA 1TZOA 2N9LA 2RMMA 1DOYA 5FKAC 1RWSA 2G9HD 1T3QA 2AQ2B 1V8CA 2K5PA 2JYTA 2W3RA 3HUIA 3R2TA 4EE2A 2L32A 1HXYD 1N62A 3AE2B 5E6JA 2PLPA 2DWQA 3AEFB 1KLGD 2MH7A 1JQ4A 4RGNA 4XWTA 2JWUA 1UWMA 1AWDA 1K51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHH E;  2ON8 A;  1GB1 A;  4GLS C;  2N7J A;  1UWX A;  1P7F A;  4HJG E;  2N9K A;  2ONQ A;  1PGX A;  1MPE A;  2K0P A;  4KGR A;  2J52 A;  2I2Y A;  5HFY A;  4OZB A;  2JZP A;  2RPV A;  5HI1 A;  1HZ6 A;  1MI0 A;  1K50 A;  2GI9 A;  1PGA A;  4OZA A;  1K52 A;  4OZC A;  2ZW1 A;  1YMH E;  3UI3 A;  1C9F A;  1GB4 A;  2JU6 X;  3FIL A;  4MAC A;  1KH0 A;  3FIL B;  4KGT A;  5JXV A;  2GB1 A;  2KQ4 X;  2KWD A;  1HZ5 A;  1XCT L;  1FCL A;  1HEZ E;  5BMG A;  2LUM A;  2EEL A;  1D4B A;  2JXT A;  3V3X A;  5HG2 A;  1K53 A;  1IGC A;  2IGG A;  4IOI E;  1EM7 A;  2ZW0 A;  1FD6 A;  2OED A;  4HKZ E;  2J53 A;  1XCQ L;  2PW9 A;  2QMT A;  1YNT E;  4WH4 A;  3MP9 A;  1JML A;  2LGI A;  4D2K A;  1F2R C;  5BMI A;  2LHD A;  1QKZ A;  1FCC C;  2PTL A;  2KN4 A;  1Q10 A;  1MHX A;  2I38 A;  1IBX A;  5BMH A;  1MVK A;  2IGH A;  1F2R I;  1IBX B;  2KDM A;  2N9L A;  5HHD G;  2QSD A;  2IGD A;  3GB1 A;  2RMM A;  2KAC A;  2JSV X;  1ZXH A;  1P7E A;  2PLP A;  2NMQ A;  2LHE A;  4IKG A;  1XF5 L;  1IGD A;  1PGB A;  2JWU A;  4KGS A;  1K51 A; 
#chains in the Genus database with same CATH topology
 3RN9 C;  3ML8 A;  5DPS A;  2PJH A;  2DNF A;  2PE6 B;  2WXI A;  1EWC A;  1Q0W B;  2Y5C A;  4AJY B;  2BGF A;  3URY A;  4L23 A;  1NI2 A;  3AE4 B;  3LB8 C;  3I57 A;  1EUV B;  3UIO B;  1E0Z A;  4AS1 A;  2KTR B;  2CHZ A;  2WXP A;  1JRO A;  5CHV C;  4JPS A;  2PE9 A;  2N9E B;  4IG7 B;  3KUD B;  3B9J A;  2A4Z A;  3TUO A;  2JU6 X;  2DHZ A;  2KLC A;  2RGF A;  1L7Y A;  2WDV B;  5G5H A;  4EUT A;  1RYJ A;  3Q6B A;  1FXA A;  1NDD A;  2WXF A;  2W3S A;  2INP E;  3H6N A;  3U2S C;  2BYE A;  2KT7 A;  3IT4 B;  3T3N A;  4GOC A;  4HWI B;  3Q8F A;  4GDK A;  5DPT A;  1C4P A;  2DLB A;  4OVU A;  1E10 A;  3U52 E;  3ONS A;  2L05 A;  1FMA D;  2JUO A;  1GG3 A;  2BQQ A;  4GXB A;  1F9J A;  3AMZ A;  1NBF C;  3MTN B;  5DCN A;  2LHD A;  3R7Q A;  2MJ3 A;  2BTE A;  4F1S A;  2B76 B;  4KVG B;  2Z59 B;  4W9H A;  3A9J A;  2M0A A;  1MVK A;  3M3J A;  4ITK A;  1J8C A;  1WJ4 A;  2N9P C;  2L8J A;  1HE8 A;  1NEK B;  2L0F A;  4HRS A;  2JZ3 B;  5IP4 D;  1GUA B;  2WGS A;  3GZN I;  3CMM B;  1UZX B;  4RF1 A;  3PO0 A;  3RD2 A;  3UQB A;  4ZHO A;  2MX2 A;  2VRR B;  2W54 A;  3VUY A;  2MHJ A;  1VJK A;  2X38 A;  1A5R A;  3Q14 C;  4HDO A;  1GOZ A;  1QIL A;  2LEK A;  2XN9 C;  4ICV A;  3V62 A;  1V97 A;  2NR2 A;  3L16 A;  4I6P A;  1UF0 A;  1VZ8 A;  2FCS A;  2KX0 A;  3QQ8 B;  4GU2 A;  2EKI A;  2LWP A;  2RDH A;  1TZ1 A;  2N1W A;  2V3N A;  1V1O A;  5AUI A;  1KTK A;  5C3J B;  2CJN A;  3FAH A;  1V6E A;  2KXJ A;  2AQ3 B;  3TSS A;  1AW7 A;  4KKJ A;  2J0J A;  3AUL A;  1TYG B;  4YSY B;  4LDT D;  4RM9 A;  2EEL A;  2BB5 A;  2LRW A;  1FNW A;  1I4R A;  1WZ0 A;  3NZ3 A;  5D3D A;  1N5X A;  3WIM A;  1UH6 A;  3MP9 A;  1JML A;  2J0K A;  2M1M A;  2BS3 B;  4P1C C;  1FPY A;  2KN4 A;  2FBW B;  3O13 A;  4E3C A;  1OEY A;  3B2G A;  1D5X C;  3UIP B;  1TS5 A;  3VUW A;  2BYV E;  1SB3 C;  3P4R B;  3ZJT A;  4US8 A;  4RCO A;  1JWA D;  1TTN A;  2DBY A;  4ZRK A;  3ZNZ B;  4ZDV A;  2IZV B;  3OLM D;  4L1B A;  4WWP A;  2QIL A;  4RFB A;  1JRU A;  2LHE A;  2JQR B;  1XF5 L;  1XO3 A;  1QOB A;  1T0R C;  1WGR A;  1X1M A;  1BUI C;  2RDB C;  4YXD B;  4FAD A;  2Z8L A;  4FUL A;  4EZJ A;  1TGZ B;  1KRH A;  4K7S A;  4IDI A;  4N9F 4;  4TQ0 A;  3GZN B;  4HPL B;  4IM3 A;  3RI7 C;  2AWT A;  2KTR A;  4LK0 M;  1TKY A;  4MEM A;  2J4X A;  1DOX A;  2LMC A;  3ZRF A;  4FA6 A;  1TS2 A;  3DBL B;  1FIQ A;  3WAM A;  1QT9 A;  3R2I A;  2CU3 A;  4WQO B;  2WP9 B;  1R7S A;  5D3I B;  1YQB A;  3DWM A;  2V0G A;  1TY0 A;  1B9R A;  4WWM A;  3R7R A;  5LXI B;  1XCT L;  4GN1 A;  2LI5 A;  1C79 A;  3A4R A;  3DBS A;  2E6X A;  3TJP A;  2O6V A;  1C76 A;  1LM8 B;  3QCA A;  1I7H A;  1FEH A;  1EU4 A;  1ET9 A;  1DOI A;  1T6B X;  1G6J A;  5C23 A;  2JYE A;  3GE8 C;  2SAK A;  2K39 A;  3PRP B;  4M00 A;  4HKQ A;  4WUR A;  5D94 A;  4G11 A;  3CSF A;  4FHK A;  1E8W A;  2JT4 B;  1QOF A;  1TS4 A;  2QC8 A;  1P1A A;  3PT2 B;  2PKO A;  1E9M A;  2KMM A;  3RYT A;  5TR5 A;  2FCQ A;  5EE0 A;  4P16 A;  2IGD A;  3P2B A;  4DK5 A;  5AZG A;  2KNB A;  2WXN A;  3HK0 A;  3M62 B;  3C0R B;  4ZOH C;  4MGY E;  2HTH A;  2Z0D B;  3IFW B;  2A5U A;  1WYW B;  2GRI A;  3A4S C;  2NCN A;  1K8R B;  4BBN C;  1UWX A;  2KMC A;  1T0S C;  2QCZ A;  2MA9 B;  2GMI C;  3BYT B;  1WIA A;  4EKU A;  3H9D A;  1GNU A;  3BK1 A;  5H92 C;  1HZ6 A;  3AED B;  2FE8 A;  3ZYY X;  4CHK A;  4LNF A;  1MI0 A;  4OHJ A;  1ISN A;  3TEW A;  2LRU A;  2BYT A;  1GB4 A;  4R3D A;  3ABV B;  5EE3 A;  2L0T A;  2YEP B;  4M8M A;  4KIK B;  2VH1 A;  4GMV A;  1R4N B;  5JH5 C;  4NAW A;  2AL3 A;  4BBN F;  3MHZ A;  2XEW A;  1WGG A;  1HA5 A;  1HEZ E;  2G4S A;  4DXG A;  4A3O A;  2M56 B;  3SDL C;  5HG2 A;  4W9G A;  2L76 A;  2K8B A;  1WM3 A;  1FD6 A;  2AYO B;  1Z2M A;  3CWI A;  5AUK A;  2BS4 B;  1WGD A;  3NJT A;  1WMH B;  2MEK A;  4RGO S;  2XK5 B;  2K22 A;  4D2K A;  3E56 A;  2BPS A;  1R4M I;  2PTL A;  3RCZ A;  3AH7 A;  2FUH B;  1WI0 A;  1P3Q U;  3NZU A;  2KZR A;  4RM8 A;  1T3Q A;  2AQ2 B;  3VAW A;  2V4L A;  2WX0 A;  4C00 A;  4ZRJ A;  3ZNI D;  3Q3M C;  4F7Z A;  3ZXV A;  1K51 A;  4DBG A;  2VZK B;  2ON8 A;  1V9J A;  2N7J A;  3QK0 A;  1L0V B;  1SXT A;  3JSV B;  1SE2 A;  4XDC A;  2JY6 A;  3SFD B;  3VR8 B;  2ZEQ A;  3DBH B;  3AE7 B;  1NVI D;  1FO4 A;  1BXT A;  4A6Q A;  2IDY A;  4NQK E;  1TS3 A;  3IVF A;  5KHQ A;  2I1K A;  3NUH B;  1L0Y B;  3FIL B;  3ZVV A;  5BYR A;  5JXV A;  1E5W A;  3BII D;  2YEP F;  2BT6 A;  1JAL A;  1I4H A;  2LXC A;  2C60 A;  1J7B A;  3NZS A;  2OHF A;  2IGG A;  2E3T A;  5DPR A;  2PPH A;  4LJP B;  3K9P B;  4WJN A;  4HLE A;  1WGY A;  2JXX A;  4RF0 A;  1XCQ L;  1YJ1 A;  3Q3O C;  4P6V F;  3OJ4 B;  3SHQ A;  1YX5 B;  3UF8 A;  2MW5 A;  2MP2 B;  1F52 A;  1YOV B;  2D3B A;  2WXM A;  2PVG C;  2FIF A;  4KSL C;  3DBR I;  2N1V A;  3SEB A;  1FRR A;  1DYQ A;  4BZA A;  2L00 B;  5G5G A;  1T5X D;  1I4Q A;  3E9S A;  3H7P B;  4DXF A;  2KDM A;  3P1M A;  2KVZ A;  2TSS A;  3OG5 A;  5HKH A;  4MH8 A;  4NQL B;  3VQI A;  3UGB B;  4UDU C;  4ANV A;  5FR3 A;  4ZRQ A;  3JYU A;  1P7E A;  1F0Z A;  4FXC A;  3ALB A;  4IKG A;  3N32 A;  4PS7 A;  2C7M B;  3EFU A;  1HTQ A;  1YQ4 B;  3P63 A;  4PS8 A;  3TMP B;  1FXT B;  3CST A;  2K3U A;  3MC8 A;  2RSU A;  2WU5 B;  5JZE B;  3U7Z A;  4PYZ A;  1XLO A;  1YQ3 B;  5LNK 1;  2INC C;  2WYQ A;  4TMA B;  1L0X B;  2K9X A;  4EEW A;  3M63 B;  4M01 A;  4S17 A;  2GLS A;  2INN E;  1PGA A;  2MBE A;  2Y3A A;  3NVV A;  4W9E A;  1GAQ B;  3DOW A;  3PPA A;  4KIK A;  1KH0 A;  2ACZ B;  4TV3 A;  1QF6 A;  4W9J A;  1BML C;  2GB1 A;  2GBR A;  2LD9 A;  2NTT A;  2IO0 B;  1AYF A;  1HZ5 A;  2KD0 A;  1T0Q C;  4LLG M;  5D2M B;  2WDR B;  4DQO C;  3MC0 B;  3HVD A;  4RNA A;  2D07 B;  1P9D U;  1WJ6 A;  2ZW0 A;  3S2A A;  3DQV A;  1CJE A;  2H89 B;  1ENF A;  3AB5 A;  2RR9 A;  2J53 A;  1YNT E;  4L2Y A;  1WXS A;  1WMH A;  1PUT A;  1AAR A;  2KJR A;  3ZTD A;  1WH3 A;  4K1R B;  2IY0 B;  4NPN A;  1WX9 A;  2RDG A;  2RPQ A;  3PV1 A;  1BT0 A;  2NPT B;  3N20 C;  1TY2 A;  4FJY A;  2KAC A;  1C4C A;  1Q1O A;  4PT5 A;  4BFR A;  4LTU A;  1XT9 B;  1ZDX A;  4JIO U;  2HE7 A;  5J2R A;  3DBR B;  3EGR A;  2D3G A;  1PGB A;  5BYS A;  1PQS A;  4EZL A;  2VZK D;  1ZPS A;  3JSV A;  3DPD A;  3ZJU A;  4ASW C;  3W2D A;  3BIN A;  2GBM A;  3V60 A;  1NYQ A;  2CJO A;  4IWQ A;  4OZB A;  3APC A;  2REX A;  4S0R A;  2N7E A;  3C19 A;  4A9A A;  3U4E G;  1JWB D;  3DBL I;  2M19 A;  1XLN A;  3FIL A;  3ZW3 A;  4W9K A;  2UWQ A;  1JW9 D;  4AJW A;  4HPM B;  3AE3 B;  1P98 A;  2WXG A;  2V3S A;  3AI5 A;  2KQ4 X;  4ARC A;  1FRD A;  1P0R A;  2HJ1 A;  4JGH B;  3KUZ A;  4JQW C;  4MSQ B;  1WSP A;  3H8H A;  1WYG A;  1LGR A;  2D3A A;  3QC8 B;  2HJ8 A;  3TEZ A;  3TCA A;  4FJV B;  1C3T A;  2L3Z A;  5MPO A;  1RLF A;  1QQR A;  2MP2 A;  4JX1 C;  2KC1 A;  4JLC A;  3TBL D;  2BW2 A;  1ZDV A;  2KN5 A;  3NOB A;  3ZNG C;  4DDI D;  5I4D A;  4WAA A;  3IBE A;  5GXG B;  4USA A;  3H7P A;  1TBE A;  2NBW B;  3NS8 A;  3ZDT A;  2MCN B;  1SEB D;  3I9V 1;  4ARI A;  3DVG X;  2HTM E;  1H4R A;  1TIF A;  2Q5W D;  4GIV A;  2M17 A;  4O1N A;  2JRH A;  3AM9 A;  1EWY C;  4YTP B;  3APF A;  4BOZ B;  1AN8 A;  5IAA C;  3P4S B;  3GS2 A;  1Y8R C;  3TEX A;  3N1X C;  4ZHP A;  3NS1 A;  4WWN A;  1GC7 A;  3DWG C;  2DZJ A;  3TEY A;  1WR6 E;  1P7F A;  3DHI C;  2KDE B;  4G3X B;  2JVC A;  1V1P B;  2C9W B;  3PTF C;  4IM2 A;  4IM0 A;  4DHZ E;  4TSS A;  1PGX A;  4MDK E;  2ZPN A;  3L54 A;  1H8C A;  3CIR B;  2I2Y A;  2VH2 A;  3AEA B;  3N1Y C;  4IWO A;  1JWS D;  1VR9 A;  2FUG 1;  1FXI A;  2ZNV B;  1K50 A;  1D6E C;  3R66 C;  2WU2 B;  3RZW C;  3L17 A;  1YMH E;  3IT6 B;  3J9C A;  1YN4 A;  4MGI E;  4NNJ B;  1WXA A;  2L1A A;  5BYQ A;  4YSZ B;  1XLQ A;  1WRI A;  2D11 A;  2IJ0 A;  2KVR A;  2MRP A;  2KWD A;  4TQ1 A;  2DYM A;  1R4N I;  3OAW A;  3VUX A;  3V3X A;  4C4V B;  3TL5 A;  2KKC A;  1EM7 A;  3IHP C;  5KHO A;  2WS3 B;  2AEH A;  2DAJ A;  2JRI B;  2NTS A;  3B08 A;  3IAS 1;  3PGE A;  3ZXR A;  5JHB A;  2NS5 A;  2IO2 B;  3B0A A;  2Z0E B;  5LLI A;  1FCC C;  4LNI A;  3DCG A;  2ZZP B;  4M0W B;  1OFF A;  1ZP0 B;  4WAF A;  2AQ1 B;  3PZ8 A;  4NY0 A;  3BZD B;  3RNB C;  1WZ3 A;  2JZZ A;  2M0X A;  2CHX A;  5FR6 A;  2G9H D;  2K5P A;  2JYT A;  3HUI A;  1C1Y B;  3R2T A;  4I6N B;  3EC8 A;  2ZNV C;  1HXY D;  4BKG A;  5E6J A;  2WHI A;  2PLP A;  2DWQ A;  2IO3 B;  1UBI A;  3AEF B;  1KLG D;  3EEC A;  4GGQ A;  4RGN A;  4XWT A;  2KDB A;  2K6Q A;  2JPH A;  5IN7 A;  3Q8E A;  2LZ6 A;  1WR1 A;  1VZ6 A;  1WE7 A;  4HK2 A;  3WAL A;  4YSX B;  4MJS B;  2MSE D;  4ACF A;  2BVC A;  1L6U A;  5D7G A;  3DBH I;  2WXL A;  1WE6 A;  4K81 A;  4AOF A;  2NVU I;  2GI9 A;  2LGX A;  4OZC A;  4I6L B;  4AWJ A;  1L2N A;  1YJJ A;  2IYD B;  4HCP B;  1E90 A;  4CYE A;  2N4F A;  4IC7 B;  2V1Y A;  3DHH C;  1CZP A;  2CR5 A;  2O2V B;  3OWE B;  5L83 A;  2KWV B;  4P7I A;  1FCL A;  3PHW B;  2MLB A;  2X8X X;  1JWU D;  2CS4 A;  3W9C B;  3KUC B;  2LGY A;  2BBC A;  4JWU C;  3HIZ A;  1L4D B;  1VRA B;  4P1B C;  2DEN B;  2WXR A;  1SBB B;  2DYO A;  4JE3 B;  1Q10 A;  1ZGU B;  2IGH A;  2LJI A;  2QHO A;  4NZL B;  3IAM 1;  3AE9 B;  2FNJ B;  3GB1 A;  3MC9 A;  3PRZ A;  2WXO A;  2JSV X;  3L0W B;  1DGJ A;  3VVW B;  4W9D A;  1VDV A;  1XEE A;  3LDZ E;  5L95 C;  1WGK A;  4KGS A;  4YT0 B;  3Q3F A;  3PZD A;  3QHT A;  3MJW A;  1V1P A;  2NBU A;  4II3 B;  4ANW A;  2IO1 B;  2RD0 A;  4HJG E;  3P4P B;  2QIE B;  2FID A;  2I1J A;  2ONQ A;  1OQQ A;  4YTN B;  3Q3J A;  1MPE A;  3OJ3 A;  3VTW A;  2GBN A;  3TIX A;  4LNK A;  1S3S G;  2C5L C;  3QJZ A;  1TT5 B;  5J18 A;  3KWL A;  2KTF A;  1MG8 A;  3GP7 A;  4GDK B;  4OW0 A;  3VFK A;  3Q69 A;  4J6I A;  1FFU A;  1QOG A;  5H8Y E;  4NAM A;  1N63 A;  2WXK A;  2BF8 B;  4C7Y A;  2MBB B;  4MGZ E;  1UEL A;  5D6J B;  4Q2J A;  4XWW A;  2KHW B;  2HDE A;  3SFE B;  4ZRP A;  3IG3 A;  1NYR A;  1N61 A;  2MWS B;  1K53 A;  2FAZ A;  4A20 A;  1TKG A;  3P4Q B;  2G45 B;  4LNN A;  4F8C B;  4HKZ E;  4PYU A;  1OTR B;  1ZOY B;  4M02 A;  2G4D B;  4EFO A;  1WWT A;  4NJC A;  3GE3 C;  2ICI A;  3UIN B;  4A3P A;  2KJH B;  5EE1 A;  1V5O A;  3KW5 B;  4GB9 A;  4M0W A;  4XX5 A;  4MSM B;  1QKZ A;  3VTU A;  3QAQ A;  2KC2 A;  3B1L X;  1UGJ A;  4EZK A;  2WQY B;  2K25 A;  2EMT A;  2AX5 A;  4K3B A;  4XZ4 A;  3ZRC A;  2YLM A;  2KWC A;  4WQM A;  1ACC A;  2GBJ A;  2QSD A;  1V86 A;  1ZE3 D;  2IBI B;  2CHW A;  1ZXH A;  1WXM A;  2LVP A;  5CX3 A;  5CHW A;  1YD8 U;  1WM2 A;  3LJ3 A;  2WX1 A;  4ANX A;  3L4P A;  3N3K B;  2PVO D;  1GB1 A;  3FC4 A;  5E6O A;  1XXG A;  2BB6 A;  3BK2 A;  4FJZ A;  2JWZ A;  4LNO A;  2WDQ B;  1WGH A;  3DHG C;  2L7R A;  4FLH A;  3SU8 X;  2KAJ A;  1IP9 A;  4OVV A;  3WAO A;  3ZGZ A;  2BYF A;  4WJQ A;  3T3O A;  3ETR A;  3IXS A;  3RNA C;  1KOT A;  1M4V A;  3KH0 A;  4HPP A;  1SIJ A;  4NJ7 A;  2C7H A;  3N1Z C;  2YVC A;  4LJO B;  3KYC D;  1JWM D;  4KDI C;  1K52 A;  1GJZ A;  3UI3 A;  1FFV A;  2IND C;  1QLB B;  1ZXI A;  4RGM A;  3HM6 X;  1T0Y A;  3V6E B;  3RNE C;  4PK1 A;  2D2Q A;  2DZK A;  3QA8 A;  4JWS C;  3VRA B;  3ENE A;  1ESF A;  4WWO A;  2PW9 A;  4TUU A;  2H88 B;  4G50 A;  4B0E A;  1RM6 C;  2L52 A;  2QEJ C;  3QX1 A;  4IWP A;  5T8I A;  2N9X A;  1F1H A;  3ZLZ A;  3U8Z A;  1YJI A;  1SE4 A;  2LVQ A;  1SE9 A;  4DWF A;  1XLP A;  1UUP A;  3WCQ A;  4DXA B;  5HHD G;  4C80 A;  1E7V A;  1CMX B;  2XK5 A;  4AUQ C;  3PHX B;  2LVO A;  4XC2 A;  4BKT A;  4RGT A;  4KKI A;  2ZCB A;  1IGD A;  5TSS A;  2WNM A;  5EDS A;  4US9 A;  4CO7 A;  1UNS A;  4GLS C;  3AE8 B;  2HD5 B;  3AE5 B;  1D3Z A;  2N9K A;  2KFK B;  1GPX A;  3X0W A;  4II2 B;  1C77 A;  1FM0 D;  2KAN A;  3ZJV A;  2FCN A;  2KDF B;  1V2Y A;  3AE6 B;  3W1S C;  3KWV A;  4A55 A;  4URK A;  5EE9 A;  3WAP A;  1UBQ A;  3KVF B;  4WJP A;  2O6V B;  4DHJ D;  2W9N A;  2LJ5 A;  2MBH A;  2KO3 A;  4N59 A;  4PS3 A;  5BO4 B;  3D32 A;  4AP4 C;  1J0G A;  4B9K A;  3CF6 E;  2SEB D;  3DVN U;  2EMS A;  3MFG A;  3AV8 A;  2UU7 A;  2D3C A;  2KWU B;  4HXD A;  4ANU A;  3EUB 2;  1IUE A;  4BVU C;  3PLV A;  2K1F A;  3HM3 A;  1E7U A;  3Q8A A;  2KMA A;  4W9I A;  2WXQ A;  2K8H A;  3T9L A;  2OJR A;  4E71 A;  1VZ7 A;  1OQY A;  2NBV B;  3HRD D;  2LGI A;  3A1Q B;  5E6N A;  2MBO A;  3FKY A;  2MJD A;  3NY5 A;  1EU3 A;  1L6V A;  2DYB A;  4HEA 1;  2W55 A;  4CQN A;  3LXF A;  1TZO A;  2N9L A;  4E74 A;  2RMM A;  1DOY A;  3R3M A;  1RWS A;  2V9H A;  2DZI A;  4DDG D;  1N62 A;  4QAY A;  3VHT C;  2JWU A;  3PSE B;  3EFC A;  3PRE A;  1SJE D;  4LCD E;  3A9K B;  3VRB B;  3BVM A;  5IKC M;  4XGA B;  3KQ4 A;  4KGR A;  2J52 A;  1N60 A;  1KLU D;  2ZVN A;  4NAW B;  2UYZ B;  1CQV A;  1I4X A;  3A33 B;  3C8Y A;  1MFW A;  4WJO A;  3RUI B;  1L4Z B;  3B2F A;  5AEK B;  3K9O B;  3L08 A;  5IOI A;  5FK9 C;  4H2A A;  3APD A;  4X57 B;  1JRP A;  3N30 A;  1SSN A;  4KZ0 A;  1VLB A;  1LXD A;  3W1S A;  2LUM A;  4K7W A;  5E6P A;  1I4P A;  1NI3 A;  4B95 A;  1SF0 A;  4ZYS A;  4IOI E;  4MH0 E;  2OED A;  5LXH A;  4KDL B;  2QMT A;  1N5W A;  3V61 A;  4WH4 A;  2PMV A;  3H1U A;  3W1Y A;  3RNG C;  1J7C A;  1LQB A;  1V49 A;  2J0M A;  2V3P A;  3BY4 B;  3W5U B;  1FNU A;  5BMI A;  3VH3 B;  4XYC A;  4BAX A;  2M8S A;  3AXC A;  1F77 A;  2I38 A;  4BOS C;  2KQ7 A;  1C78 A;  5C2T B;  3VR9 B;  2K8C A;  1F2R I;  3L13 A;  4HRO A;  2ZVO A;  3V05 A;  3H7S A;  5GMV A;  3NRZ A;  3Q8C A;  1UGM A;  3BWU D;  5IO9 A;  3HHM A;  4IUM B;  2NMQ A;  1SGH A;  3U7D A;  2R2Q A;  3EA6 A;  1YX6 B;  4TKN A;  3LYY A;  5CHF A;  3VDZ A;  3BVZ A;  2IY1 B;  1MHH E;  2NPT A;  3P42 A;  2KYW A;  2KFK A;  3ZDM C;  4FN2 A;  3ML9 A;  1MG4 A;  3KLS X;  3NVW A;  4ICU A;  4MGK E;  2K0P A;  4RMA A;  1SIF A;  3QWZ B;  5HFY A;  1WXV A;  4MM3 B;  1OQR A;  1S1Q B;  1A70 A;  2JZP A;  3QIJ A;  1J19 A;  2RPV A;  4W9L A;  1PFD A;  2V4I B;  5G2N A;  4J3O D;  2KLG A;  3RNF C;  4C7Z A;  1Q5W B;  2DZM A;  2O6V D;  4OZA A;  3HVZ A;  3ZNH B;  4B0M A;  2ZW1 A;  1ZKH A;  4GSW A;  2GBK A;  1ROE A;  3NG0 A;  4GDL B;  1NEN B;  3KYD D;  3ZKJ C;  2W82 A;  1B1Z A;  2JF5 A;  3AEB B;  4N6E B;  2GOW A;  3BVG A;  1KLV A;  1D4B A;  4YWG G;  1WX8 A;  2KFJ A;  3M95 A;  4MT5 A;  2ZJD A;  4HVB A;  1V81 A;  3VH4 B;  1KM7 A;  4KSK C;  1XQQ A;  4YL8 A;  1WJU A;  1ZW7 A;  3SD5 A;  1WY8 A;  2K6D B;  3A1Q A;  2CKH B;  2BWF A;  2WWZ A;  1EO6 A;  2G1E A;  1C4A A;  1U4A A;  1V80 A;  1PYW D;  5C1Z A;  2WXH A;  3ZIM A;  3V6C B;  3U30 A;  3PZ7 A;  1HQR D;  2XNA C;  3VXW A;  2PEA A;  3RT3 B;  1QOA A;  5BMH A;  2N0S B;  3AU5 A;  3NVY A;  5DPW A;  1EF5 A;  1QZE A;  1ET6 A;  1IBX B;  5G55 A;  2B3A A;  1WF9 A;  2ASQ A;  3NHE B;  1OEY J;  2R2O A;  2JX5 A;  2OOB B;  2MJE A;  3PS6 A;  1V5T A;  1UD7 A;  3RUL A;  1YN5 A;  3GOE A;  4HDQ A;  2WLB A;  4DHZ B;  3ZTC A;  1ZUD 2;  1RRB A;  3A9K A;  3VTV A;  1EF1 A;  2LGD A;  2BKF A;  2KQS A;  1CK1 A;  3I63 C;  2KJ6 A;  3Q3N C;  1E8Z A;  2WXJ A;  2QDF A;  4BKS A;  1IYF A;  3DDC B;  1TJE A;  4BKS D;  1I35 A;  5HI1 A;  2FCM A;  2AL6 A;  1E8Y A;  3BYY B;  2PIA A;  3Q2A C;  3X23 A;  4HCN B;  3AU4 A;  1D5M C;  2MQJ A;  2LFI A;  3WA0 A;  2BS2 B;  3AEE B;  4FBJ B;  4MAC A;  1WX7 A;  3RNC C;  4A90 A;  1WJN A;  1KJT A;  2D10 A;  4AQ7 A;  3NVZ A;  2LAS A;  1I4G A;  1RFA A;  3EHV A;  5BMG A;  1OGW A;  2JXT A;  4ZRI A;  1L5P A;  3JVZ X;  3Q8B A;  1IGC A;  1RAX A;  2DX5 B;  3R8B A;  3PRM B;  3WAN A;  4A8X C;  1GC6 A;  2LGS A;  4DHJ B;  2R61 A;  1YN3 A;  2D5G A;  3DVG Y;  1E8X A;  3MJ5 A;  2CU1 A;  1HTO A;  1LO5 D;  5IA7 A;  1Y56 A;  1F2R C;  1XD3 B;  2KDI A;  3RZF A;  1JCK B;  3AEG B;  3AEC B;  4KV2 A;  1KFY B;  2LUE A;  4K3C A;  1VCB A;  2J42 A;  3ZUN A;  4C4V A;  4XDD A;  2L83 A;  1Z5S B;  5AZH A;  1WFY A;  2DAF A;  3A9J B;  4KX6 B;  4YTM B;  4NJ6 A;  4B6W A;  1TKE A;  3W5V B;  3ZO5 B;  2XBB C;  3N9Y C;  3L10 B;  3I5J C;  5JHA A;  4OVZ A;  1VD2 A;  2J7Q B;  2Y5B B;  1MJD A;  2OJW A;  1J7A A;  4MEL A;  2ZCC A;  1SJH D;  1RFK A;  3RPF C;  4FHJ A;  1E6E B;  4REZ A;  1PDX A;  3JW0 X;  1FNV A;  4W9C A;  4M8N A;  2N7D A;  2ZPY A;  4MM3 A;  1M94 A;  4EOY A;  1N6Z A;  3ZQ4 A;  2LXA A;  4G0N B;  3PLU A;  3SR6 A;  1I42 A;  2Y5P A;  4XE0 A;  4WIP A;  1E7P B;  3O65 B;  4C56 C;  1C9F A;  3PVL A;  1D5Z C;  4MJS A;  2M4N A;  5AZF A;  3AE1 B;  4GDL A;  3I3T B;  2MBQ A;  2BKR B;  4KGT A;  3RFZ B;  1WXQ A;  3ECI A;  2KOX A;  4K7U A;  2IPK D;  4LDT B;  3T8M A;  2BWE S;  4N58 A;  4HJK A;  4RH6 A;  2G3Q B;  1WRD B;  4JL9 A;  3QAR A;  4W9F A;  4KZC A;  1LFD A;  3RMK C;  1KF6 B;  1R4M B;  2KX3 A;  2O2V A;  2KK8 A;  1SE3 A;  3AN1 A;  1MHX A;  2QJL A;  2EKE C;  4IW0 A;  1IBX A;  1YIW A;  2WDT B;  1STE A;  5J17 A;  2C7N B;  5FKA C;  1V8C A;  2W3R A;  3MHS D;  1IPG A;  4EE2 A;  2L32 A;  3AE2 B;  2MH7 A;  4ZYN A;  1JQ4 A;  3DVN V;  3UQA A;  1UWM A;  1AWD A;  5CTR C; 
#chains in the Genus database with same CATH homology
 2VZK B;  2ON8 A;  3Q8E A;  1SJE D;  1VZ6 A;  2N7J A;  2WXI A;  1EWC A;  1L0V B;  3VRB B;  2Y5C A;  1SXT A;  1SE2 A;  4YSX B;  4XDC A;  3URY A;  4L23 A;  3BVM A;  3SFD B;  3VR8 B;  3AE4 B;  3LB8 C;  3KQ4 A;  3AE7 B;  4KGR A;  3I57 A;  1NVI D;  2J52 A;  1FO4 A;  1L6U A;  5D7G A;  1E0Z A;  4AS1 A;  2WXL A;  1N60 A;  1BXT A;  1KLU D;  1JRO A;  2WXP A;  4NAW B;  4A6Q A;  2IDY A;  1CQV A;  1TS3 A;  4JPS A;  1I4X A;  3C8Y A;  2GI9 A;  4OZC A;  1L4Z B;  3B9J A;  3B2F A;  3TUO A;  2JU6 X;  3NUH B;  1L0Y B;  1YJJ A;  3FIL B;  5FK9 C;  4H2A A;  2WDV B;  5G5H A;  5BYR A;  1RYJ A;  5JXV A;  1FXA A;  3U2S C;  2WXF A;  2W3S A;  1JRP A;  2INP E;  3T3N A;  3IT4 B;  1CZP A;  1SSN A;  1VLB A;  3Q8F A;  3OWE B;  3BII D;  2YEP F;  1FCL A;  3W1S A;  2BT6 A;  2LUM A;  1C4P A;  1JAL A;  2DLB A;  1I4P A;  1I4H A;  1NI3 A;  1J7B A;  1SF0 A;  4ZYS A;  1JWU D;  1E10 A;  2OHF A;  3W9C B;  2IGG A;  3U52 E;  4IOI E;  2E3T A;  2BBC A;  4JWU C;  1L4D B;  2OED A;  1VRA B;  1FMA D;  4RF0 A;  2QMT A;  1XCQ L;  1N5W A;  4P6V F;  4WH4 A;  2WXR A;  2PMV A;  1SBB B;  1J7C A;  3AMZ A;  2V3P A;  3W5U B;  1FNU A;  5BMI A;  2LHD A;  2WXM A;  2PVG C;  2DYO A;  4JE3 B;  1F77 A;  2MJ3 A;  2BTE A;  1Q10 A;  2B76 B;  3SEB A;  2I38 A;  1FRR A;  1DYQ A;  1C78 A;  2M0A A;  1T5X D;  1I4Q A;  5G5G A;  5C2T B;  1MVK A;  2IGH A;  2LJI A;  1F2R I;  4NZL B;  4ITK A;  3VR9 B;  3E9S A;  4HRO A;  3IAM 1;  2KDM A;  3AE9 B;  3V05 A;  4DXF A;  3P1M A;  3NRZ A;  3Q8C A;  1NEK B;  3GB1 A;  2TSS A;  4HRS A;  2WXO A;  3BWU D;  4MH8 A;  2JSV X;  3VQI A;  4UDU C;  5FR3 A;  4ZRQ A;  1P7E A;  4RF1 A;  1F0Z A;  1DGJ A;  3PO0 A;  2NMQ A;  4FXC A;  3EA6 A;  1VDV A;  1XEE A;  4IKG A;  4ZHO A;  1WGK A;  4KGS A;  4YT0 B;  3LYY A;  2W54 A;  3BVZ A;  1YQ4 B;  3P63 A;  1VJK A;  2X38 A;  1MHH E;  3P42 A;  1V1P A;  1GOZ A;  2K3U A;  4HJG E;  1QIL A;  2LEK A;  2XN9 C;  3P4P B;  2QIE B;  3KLS X;  1V97 A;  2WU5 B;  3NVW A;  2ONQ A;  1OQQ A;  4YTN B;  3U7Z A;  1MPE A;  2K0P A;  1VZ8 A;  1XLO A;  5HFY A;  4MM3 B;  1YQ3 B;  1OQR A;  2JZP A;  1A70 A;  5LNK 1;  2RPV A;  4TMA B;  3KWL A;  1PFD A;  1L0X B;  2K9X A;  2EKI A;  2V4I B;  4J3O D;  2RDH A;  2V3N A;  1V1O A;  3GP7 A;  5AUI A;  4C7Z A;  4GDK B;  1KTK A;  4OW0 A;  5C3J B;  2INN E;  1PGA A;  3Q69 A;  1FFU A;  3HVZ A;  4OZA A;  4B0M A;  1QOG A;  2CJN A;  2ZW1 A;  3FAH A;  5H8Y E;  2Y3A A;  4NAM A;  3NVV A;  1N63 A;  1GAQ B;  2AQ3 B;  2WXK A;  3TSS A;  4C7Y A;  1KH0 A;  1ROE A;  1AW7 A;  2ACZ B;  4KKJ A;  1QF6 A;  4GDL B;  1NEN B;  1BML C;  2GB1 A;  2NTT A;  4Q2J A;  4XWW A;  1AYF A;  2W82 A;  1B1Z A;  1HZ5 A;  3AEB B;  4N6E B;  1TYG B;  2HDE A;  4LLG M;  4YSY B;  2WDR B;  3SFE B;  4ZRP A;  4DQO C;  3BVG A;  1NYR A;  1N61 A;  2EEL A;  4YWG G;  1D4B A;  1K53 A;  3MC0 B;  2BB5 A;  3HVD A;  4MT5 A;  4RNA A;  1TKG A;  3P4Q B;  2ZW0 A;  1FNW A;  1CJE A;  1I4R A;  2H89 B;  4HKZ E;  1ENF A;  3NZ3 A;  5D3D A;  1ZOY B;  3AB5 A;  2J53 A;  1WWT A;  1YNT E;  4L2Y A;  4NJC A;  1PUT A;  1N5X A;  2ICI A;  3MP9 A;  1JML A;  5EE1 A;  2G1E A;  1C4A A;  2BS3 B;  4M0W A;  1PYW D;  1QKZ A;  2WXH A;  2KN4 A;  1HQR D;  2FBW B;  2XNA C;  3PZ7 A;  1UGJ A;  1QOA A;  5BMH A;  2RDG A;  3O13 A;  2N0S B;  3NVY A;  2WQY B;  2AX5 A;  1ET6 A;  3B2G A;  1IBX B;  1D5X C;  4WQM A;  1ACC A;  1TS5 A;  2QSD A;  1ZE3 D;  1TY2 A;  1SB3 C;  3P4R B;  3ZJT A;  2JX5 A;  4US8 A;  4RCO A;  2KAC A;  1C4C A;  2MJE A;  1JWA D;  4PT5 A;  2DBY A;  4LTU A;  1ZXH A;  1YN5 A;  1ZDX A;  4L1B A;  2QIL A;  4RFB A;  2WLB A;  3L4P A;  2LHE A;  3EGR A;  2JQR B;  1XF5 L;  1XO3 A;  1QOB A;  1PGB A;  5BYS A;  2PVO D;  1ZUD 2;  2VZK D;  1ZPS A;  3FC4 A;  1GB1 A;  1BUI C;  1XXG A;  2BB6 A;  4YXD B;  3BK2 A;  2WDQ B;  2Z8L A;  3ZJU A;  3W2D A;  1KRH A;  4IDI A;  1CK1 A;  4TQ0 A;  2KAJ A;  1NYQ A;  4LK0 M;  2CJO A;  1TKY A;  2WXJ A;  3ZGZ A;  4OZB A;  3T3O A;  2J4X A;  3ETR A;  1TJE A;  1DOX A;  2LMC A;  3IXS A;  1TS2 A;  5HI1 A;  1M4V A;  1FIQ A;  1SIJ A;  1QT9 A;  4A9A A;  3U4E G;  3R2I A;  1JWB D;  3BYY B;  2CU3 A;  2PIA A;  2M19 A;  1JWM D;  1K52 A;  2WP9 B;  1R7S A;  5D3I B;  1D5M C;  1XLN A;  3UI3 A;  2LFI A;  3FIL A;  2BS2 B;  1FFV A;  3AEE B;  1JW9 D;  1QLB B;  4MAC A;  3DWM A;  1ZXI A;  4RGM A;  2V0G A;  1TY0 A;  3AE3 B;  2WXG A;  1B9R A;  4WWM A;  4A90 A;  2KQ4 X;  4ARC A;  1FRD A;  4AQ7 A;  3NVZ A;  1XCT L;  1I4G A;  1C79 A;  1WSP A;  5BMG A;  2E6X A;  4JWS C;  1C76 A;  2JXT A;  3H8H A;  3VRA B;  1L5P A;  3Q8B A;  1WYG A;  1I7H A;  1FEH A;  1IGC A;  1EU4 A;  3R8B A;  1ESF A;  4A8X C;  1ET9 A;  1DOI A;  1T6B X;  2R61 A;  3TEZ A;  1YN3 A;  2D5G A;  2PW9 A;  5MPO A;  2JYE A;  3MJ5 A;  2H88 B;  2SAK A;  4B0E A;  1RM6 C;  1LO5 D;  1QQR A;  4WUR A;  4HKQ A;  2L52 A;  4JX1 C;  2BW2 A;  2QEJ C;  1ZDV A;  1Y56 A;  5T8I A;  1QOF A;  5I4D A;  1F2R C;  1TS4 A;  5GXG B;  1JCK B;  3AEG B;  3AEC B;  1KFY B;  2J42 A;  2PKO A;  1E9M A;  1YJI A;  2KMM A;  1SE4 A;  4USA A;  4XDD A;  2L83 A;  1XLP A;  1UUP A;  5EE0 A;  3WCQ A;  4P16 A;  1SEB D;  5HHD G;  3I9V 1;  4ARI A;  2IGD A;  4C80 A;  4KX6 B;  4YTM B;  2HTM E;  1TKE A;  3W5V B;  2Q5W D;  4O1N A;  3AM9 A;  1EWY C;  4YTP B;  3N9Y C;  2WXN A;  4RGT A;  4KKI A;  1AN8 A;  1IGD A;  4ZOH C;  5TSS A;  2WNM A;  3P4S B;  3GS2 A;  4OVZ A;  4US9 A;  3TEX A;  4ZHP A;  2GRI A;  3NS1 A;  1UNS A;  4GLS C;  1J7A A;  3AE8 B;  3DWG C;  3AE5 B;  3TEY A;  1UWX A;  1P7F A;  1SJH D;  1RFK A;  3RPF C;  1V1P B;  2N9K A;  1E6E B;  4REZ A;  1GPX A;  1PDX A;  1C77 A;  1FM0 D;  1FNV A;  3BYT B;  4TSS A;  1PGX A;  3ZJV A;  3CIR B;  2I2Y A;  3ZQ4 A;  3BK1 A;  3AEA B;  3AE6 B;  5H92 C;  3SR6 A;  1JWS D;  1HZ6 A;  3AED B;  1VR9 A;  2FUG 1;  3KWV A;  2FE8 A;  3ZYY X;  4A55 A;  1FXI A;  2Y5P A;  5EE9 A;  4XE0 A;  4WIP A;  1E7P B;  1MI0 A;  4OHJ A;  1K50 A;  1D6E C;  3TEW A;  2WU2 B;  1YMH E;  3IT6 B;  3J9C A;  4C56 C;  1YN4 A;  2BYT A;  1C9F A;  1GB4 A;  4N59 A;  1D5Z C;  4YSZ B;  2L1A A;  5BYQ A;  2SEB D;  3AE1 B;  4R3D A;  1XLQ A;  1WRI A;  2IJ0 A;  3ABV B;  5EE3 A;  4KGT A;  3MFG A;  2YEP B;  3AV8 A;  1WXQ A;  3RFZ B;  2KWD A;  4TQ1 A;  3EUB 2;  3MHZ A;  1HA5 A;  2DYM A;  1HEZ E;  1IUE A;  2IPK D;  4DXG A;  2M56 B;  3V3X A;  5HG2 A;  4N58 A;  1EM7 A;  4RH6 A;  3Q8A A;  1FD6 A;  2WXQ A;  2WS3 B;  2NTS A;  1VZ7 A;  3CWI A;  5AUK A;  1KF6 B;  2BS4 B;  3IAS 1;  3HRD D;  4RGO S;  2MEK A;  2LGI A;  2K22 A;  4D2K A;  3E56 A;  2MJD A;  1EU3 A;  1FCC C;  1SE3 A;  3AN1 A;  2PTL A;  1L6V A;  1OFF A;  1MHX A;  1ZP0 B;  2QJL A;  1IBX A;  4HEA 1;  4WAF A;  3AH7 A;  2AQ1 B;  2W55 A;  3PZ8 A;  4CQN A;  3BZD B;  1STE A;  3LXF A;  1TZO A;  2N9L A;  2RMM A;  1DOY A;  5FKA C;  1RWS A;  2G9H D;  1T3Q A;  2AQ2 B;  1V8C A;  2K5P A;  2JYT A;  2W3R A;  3HUI A;  3R2T A;  4EE2 A;  2L32 A;  1HXY D;  1N62 A;  3AE2 B;  5E6J A;  2PLP A;  2DWQ A;  3AEF B;  1KLG D;  2MH7 A;  1JQ4 A;  4RGN A;  4XWT A;  2JWU A;  1UWM A;  1AWD A;  1K51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...