1Q10A

Ensemble of 40 structures of the dimeric mutant of the b1 domain of streptococcal protein g
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
MQYKVILNGKTLKGETTTEAVDAATAEKVVKQFFNDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G binding protein G
publication title A Protein Contortionist: Core Mutations of GB1 that Induce Dimerization and Domain Swapping
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Protein binding
total genus 9
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1q10A00
1FCCC 5HFYA 1GB1A 1XCQL 2KQ4X 2LHEA 4D2KA 1K53A 1GB4A 4KGRA 1Q10A 5BMIA 2KACA 2LGIA 4OZCA 2EELA 1IBXA 1XF5L 1P7FA 2LHDA 2I2YA 3FILB 2N7JA 1MHXA 5BMGA 1P7EA 1F2RC 2JZPA 2JXTA 5JXVA 4KGTA 2K0PA 2IGHA 1MI0A 4GLSC 2QMTA 1IGDA 2KWDA 2RMMA 2GB1A 1HZ5A 1QKZA 1YMHE 4IKGA 3GB1A 1K50A 4WH4A 1C9FA 5HG2A 2ONQA 1MHHE 2IGDA 5HHDG 1D4BA 1JMLA 2JSVX 1FCLA 1IGCA 2J53A 2JWUA 1FD6A 1MVKA 3FILA 2OEDA 1F2RI 2J52A 2KDMA 2GI9A 2IGGA 2PLPA 2PW9A 3V3XA 1EM7A 1MPEA 2ZW1A 2KN4A 4IOIE 1PGAA 2ZW0A 2LUMA 4OZAA 4MACA 1ZXHA 1YNTE 1IBXB 2ON8A 1KH0A 2RPVA 2I38A 1UWXA 2N9LA 3UI3A 2QSDA 1K52A 2PTLA 1K51A 1HZ6A 1PGBA 3MP9A 1XCTL 5BMHA 2JU6X 4HKZE 5HI1A 4OZBA 2NMQA 4KGSA 4HJGE 2N9KA 1PGXA 1HEZE
chains in the Genus database with same CATH superfamily
4A3OA 3LB8C 3EFCA 2W55A 3ZW3A 1FMAD 1GB1A 4MEMA 2DLBA 1FXAA 2UYZB 4KGRA 1FNWA 3FAHA 3GE8C 4M01A 2WP9B 5C23A 3GZNB 4MM3B 3TCAA 2G1EA 2YEPB 5LLIA 2WXLA 3Q14C 5JHBA 3P63A 2QMTA 2LRUA 2W82A 2DZMA 2IY1B 2KWDA 2YEPF 2VH1A 4I6LB 4RM9A 3RCZA 2BYTA 4GDKB 1YMHE 4MJSA 5L95C 2WXNA 3BVGA 2WXIA 1T6BX 4WWPA 5D94A 1PFDA 3WA0A 1NI3A 2IY0B 3AEGB 3PRPB 4ARCA 2V3PA 1RLFA 3VDZA 3DVNV 2BYFA 3SD5A 2GOWA 1OFFA 1JMLA 5DPSA 3MC9A 1D5ZC 4DDGD 2OHFA 1KOTA 1V80A 2J52A 2IYDB 2INNE 1PYWD 2BF8B 3V6EB 4IOIE 1PGAA 1UGJA 1U4AA 1OQQA 4B9KA 2RPQA 4DK5A 1D3ZA 2RPVA 3L54A 1H8CA 4GB9A 3APDA 5EE3A 1XO3A 3UI3A 3P2BA 4K1RB 1ZDVA 1BUIC 2QHOA 4A8XC 1TKEA 2KJHB 4OZBA 5DPTA 2NMQA 1YQ3B 2ACZB 2N9KA 4HROA 2LWPA 3DHGC 1J0GA 1F52A 3PZDA 1FCCC 1TBEA 2WXQA 4USAA 4DXFA 2INCC 1NVID 2MBOA 2LRWA 2M56B 4IM2A 4IUMB 1J7AA 1YN4A 2DYBA 1RAXA 2KTRA 2G4SA 2B76B 3L17A 4XWWA 1L6UA 3L0WB 1CK1A 1WH3A 3ZLZA 4GIVA 5FR3A 4KIKA 4KKJA 4MELA 3UQAA 4O1NA 5T8IA 2NBWB 2C60A 1IPGA 2I1KA 3TEWA 3DHHC 3EA6A 1NYQA 1FFUA 1V97A 2WYQA 2PPHA 3R66C 3Q8FA 1EO6A 3MJWA 3ETRA 2BWFA 2JXXA 2PE6B 4PS7A 4FXCA 4JWUC 1ET9A 2NBVB 3ECIA 3R3MA 3L10B 5DCNA 4BVUC 1KLVA 2KMMA 3M3JA 3FILA 1UGMA 2PLPA 4S0RA 4YXDB 4ZRPA 2PW9A 3A4RA 3UQBA 1E8WA 3A9JB 4NJ6A 3KLSX 2K39A 3I3TB 3I57A 2BKFA 1DOXA 3Q8EA 1Q1OA 3OJ3A 5D3IB 2H88B 4A3PA 1V6EA 4BKGA 3PZ7A 3TIXA 3HM3A 1JWUD 3CIRB 1C3TA 3RULA 2D11A 3N1YC 1CJEA 2PTLA 1YX5B 2J0KA 1XCTL 2LVPA 4H2AA 1WXQA 1QF6A 4YSYB 2K9XA 4LNFA 4FHJA 4RF1A 4MDKE 3V05A 2XN9C 3K9OB 3DBRI 3DBLB 5H8YE 4JQWC 2MWSB 4AUQC 3ZJTA 2GBJA 3HHMA 3PZ8A 3SU8X 3EFUA 1OGWA 1TS3A 1SSNA 1WMHA 2EELA 2NR2A 2AWTA 4B95A 1TJEA 1P7FA 3T3OA 2KDBA 1MHXA 4W9EA 1L6VA 2G45B 4E3CA 4OW0A 2VRRB 1WXVA 1STEA 4M0WA 1I35A 2L32A 3T3NA 2CHWA 2MCNB 3VQIA 1YOVB 3VH3B 2RDHA 3RZFA 4N58A 4LCDE 1TZ1A 5E6NA 4GXBA 3CSTA 2KK8A 3AE7B 3P4RB 2LGDA 1T3QA 3W2DA 3VRBB 4IG7B 3Q3OC 1V49A 4TQ0A 4FJYA 4IM0A 4JLCA 2KX3A 2R2QA 1N5XA 4RGNA 5AUKA 1AW7A 3IAS1 3X23A 4GDLB 3N9YC 4GGQA 2DAJA 5BYSA 2ZCBA 4LNNA 1WXAA 2N7DA 2KC2A 2JF5A 4MGIE 2J7QB 3FC4A 2FUG1 4DXAB 3A1QB 3LYYA 3Q8CA 2L7RA 5JHAA 1VZ8A 3AE3B 1E6EB 3VR9B 4HCNB 1QQRA 2A4ZA 5E6OA 3BIID 1R4NB 2XNAC 3HRDD 3PRZA 5BYRA 4ZOHC 3RI7C 1KLUD 2KNBA 3ZO5B 2BPSA 1Q10A 3P4PB 2BB5A 1WYWB 2KACA 2KN5A 4HEA1 2FUHB 2MP2B 1WR1A 1P7EA 2AQ2B 1XLQA 2K0PA 3IG3A 2C5LC 3A33B 3AV8A 4ITKA 4US9A 2KD0A 2RMMA 2D3AA 2C7HA 2PVGC 5E6PA 1ZP0B 1S1QB 3RT3B 1L4DB 1AN8A 2M1MA 1XLOA 1WJUA 3U52E 2L0TA 4M8NA 3TBLD 2WXRA 1QOGA 3UIOB 3RZWC 3BK2A 5HHDG 4WJOA 4G3XB 2J53A 3L16A 1FD6A 3ZNID 2JQRB 2GI9A 2IGGA 2AEHA 4NQKE 4RF0A 2YVCA 1SXTA 2LUMA 2PEAA 3Q6BA 4MACA 4A20A 1JWBD 4OVVA 5MPOA 2G9HD 1R7SA 3WCQA 4K3BA 1TGZB 1WFYA 1A70A 2INPE 1QZEA 2KJ6A 1TTNA 2N0SB 1ZW7A 2V3SA 4IWOA 3L4PA 3ZUNA 3BK1A 4MJSB 3DBSA 5D7GA 2KWCA 1X1MA 2BKRB 3GZNI 4W9CA 2MSED 3DVNU 2NS5A 3R7QA 1HA5A 4FULA 4A6QA 2AX5A 2QC8A 4NJ7A 4WAFA 1V2YA 3NVZA 5J17A 4HKQA 3ZVVA 1FO4A 3JW0X 4I6NB 2L3ZA 2EMSA 1F1HA 2CR5A 4EOYA 4BKTA 2KWVB 2MJEA 3VTWA 3QX1A 2K1FA 2ZJDA 2NTTA 1I4XA 1V5OA 2ZZPB 4ZHOA 1M4VA 4HVBA 3V60A 1YQBA 2RDBC 2Y5PA 2JZ3B 5TR5A 1EF5A 1FEHA 2Z0DB 3DVGX 5JH5C 2LASA 1YD8U 3N1XC 3HVDA 1WM2A 1GC7A 2D3CA 1N60A 4CO7A 3NRZA 5C3JB 3IT4B 5CTRC 2KTRB 5CHVC 5D2MB 2RDGA 3ZRFA 2D2QA 1K8RB 1LXDA 1Q5WB 2QCZA 3N30A 1V5TA 2MBEA 3PSEB 4LJOB 4YT0B 4GU2A 3DWMA 2JRIB 3B08A 2QSDA 3PLUA 1CMXB 1SF0A 4KIKB 1UUPA 1ZKHA 3U2SC 4C80A 5LXIB 3UIPB 3PREA 1FRRA 2O6VA 1WX9A 3CWIA 1VCBA 5HFYA 3HIZA 3HUIA 2D10A 2FBWB 1VR9A 5CX3A 3O65B 1GB4A 3CMMB 4C00A 2W9NA 4YTMB 5KHQA 4OVZA 5I4DA 3M63B 1IBXA 3KYDD 4J3OD 3PGEA 2MJ3A 3FILB 4BKSA 2BT6A 1WJNA 4W9KA 1JW9D 4WQOB 1A5RA 1ET6A 2K8CA 2WXPA 2KAJA 1H4RA 3QCAA 3SR6A 5IP4D 4FA6A 1SE4A 2N9EB 1VJKA 2GBRA 3EC8A 2NBUA 1HZ5A 3VHTC 1E9MA 1NBFC 2Y5CA 1MG4A 4P16A 1WZ3A 3VRAB 5CHFA 2XEWA 4N6EB 3ZRCA 3NUHB 3NVYA 1Y8RC 2AL3A 2UU7A 2WXGA 3PV1A 3KH0A 1C9FA 3KWVA 3TSSA 4RH6A 4E71A 3QAQA 1FXTB 3OLMD 4II3B 2WQYB 1FFVA 2KDMA 3Q2AC 3Q8AA 3C19A 3WAMA 1JWSD 2ZW0A 3GS2A 1WMHB 2M8SA 3RNAC 3BINA 2LMCA 3H8HA 2UWQA 1IP9A 2KDEB 3A9KA 3DVGY 2DZJA 3NVWA 3ZTDA 4XZ4A 4RGMA 3N3KB 2JZZA 2ASQA 3DBLI 4M0WB 2KX0A 3BYTB 5IKCM 1EUVB 2M19A 2GLSA 1OQRA 1FRDA 4KGSA 4GN1A 2K8HA 2PKOA 3W1YA 2KMCA 2GBMA 1WRDB 2OJWA 1PGXA 3OWEB 3N20C 2FE8A 4ZRQA 2CKHB 3AU4A 4L1BA 4NAMA 4JX1C 3ZDTA 2KQ4X 4KV2A 4D2KA 1TKYA 2BS3B 5H92C 4KSKC 2PVOD 1KFYB 1C78A 1WY8A 1ROEA 1LFDA 1LQBA 3ZNZB 1E10A 1V86A 3KW5B 3Q3JA 4JL9A 1J8CA 3LDZE 2KOXA 1F77A 3VUYA 4BOZB 3ZNHB 4IWQA 3DHIC 3ZXRA 2WDVB 3TEYA 1DOYA 4IDIA 2INDC 3DOWA 2DBYA 3ZJUA 4F7ZA 4TQ1A 4B0MA 1VLBA 2CU3A 3ML9A 4NQLB 4C7YA 3IBEA 3NZSA 5G2NA 1V9JA 3RYTA 2BS4B 1KTKA 1V1OA 1WF9A 1SIFA 4W9FA 3GOEA 1I4RA 2O6VD 3H7PA 3J9CA 2ZW1A 1MPEA 2Z59B 1FPYA 4ICUA 4NAWA 2MEKA 3ZYYX 4WWMA 1GUAB 4AS1A 4WAAA 2ON8A 4IW0A 4AQ7A 1R4NI 1DOIA 3Q8BA 1V8CA 2HTHA 4BKSD 1SIJA 3W5UB 2KC1A 2PJHA 3ABVB 2J4XA 1HZ6A 2WX0A 2FCQA 4KSLC 2WNMA 3M95A 2JRHA 4KZCA 3SFDB 4BZAA 3U8ZA 3ZKJC 3ML8A 1ZXIA 3D32A 4WJNA 3I63C 1WR6E 2LD9A 2WS3B 3C8YA 3W1SA 2KWUB 1XCQL 4DHZE 4MT5A 1ZGUB 2N9XA 1KM7A 2NPTA 1DGJA 2N9PC 3RPFC 4Q2JA 2J0MA 3RMKC 1YIWA 1CQVA 1L4ZB 1ACCA 4BAXA 2TSSA 2AQ1B 1R4MB 3BVZA 2L05A 2WXJA 1NDDA 4RCOA 5EE1A 2WXKA 3R2IA 2ZNVC 3TUOA 4ICVA 5EE0A 1I4GA 3MHZA 2CJOA 1FM0D 2WGSA 2L83A 2BTEA 1AYFA 2QDFA 4E74A 2Q5WD 3IVFA 2REXA 2KKCA 4DWFA 3ZIMA 2J0JA 1QT9A 3PLVA 3SHQA 2KQ7A 5AZHA 2ONQA 3AE9B 1D5MC 4ANXA 2JSVX 4AP4C 3S2AA 1GAQB 4LNKA 3QA8A 1WIAA 1QOFA 3H7SA 5DPWA 2IO2B 4PS8A 2FCNA 2MH7A 3UINB 1T0QC 4PYZA 1E7PB 4ZRIA 1I4PA 2WXMA 2RGFA 3PHWB 4RMAA 1WGDA 4P1CC 2LVQA 4K3CA 1FIQA 2V4IB 1TS4A 3VUWA 1YQ4B 3P4SB 4OVUA 4TUUA 1I42A 2M0XA 4XDDA 3MC8A 3HK0A 1HEZE 3U4EG 1VZ6A 4LK0M 3P1MA 3Q3FA 1ZE3D 1SGHA 2X38A 4HPPA 3PVLA 2DWQA 4AJYB 3L08A 3T9LA 4DQOC 4PT5A 3EUB2 4XC2A 4ASWC 1ZDXA 1NYRA 2LHDA 4W9HA 1JWAD 4ZHPA 1V81A 3Q69A 1GJZA 3TEXA 3ZNGC 2JXTA 3QJZA 5IO9A 4I6PA 4XX5A 4DBGA 4L23A 2LGYA 4MSQB 2N4FA 3R7RA 2KO3A 1D5XC 1TT5B 3NZUA 3RNEC 2M17A 4C56C 4FHKA 2LXAA 3APCA 4YTNB 1VZ7A 2JYTA 4RNAA 4W9LA 4DDID 2MLBA 3OJ4B 4JPSA 1SJHD 4ANVA 4ANUA 1FXIA 2KDIA 4K7WA 2MRPA 2O6VB 3QHTA 4ZYSA 3OG5A 2ZNVB 1I4QA 1XLNA 1BMLC 1F2RI 2QIEB 3FKYA 4HWIB 2IO3B 4LDTD 2KHWB 1YN3A 1WGGA 2KZRA 1YNTE 1IBXB 3APFA 2WDRB 3DBHB 4A9AA 3BZDB 1KH0A 5AEKB 1T5XD 2W54A 2DX5B 4RGOS 3AE6B 3TMPB 1E8XA 3SDLC 2JUOA 1L0XB 3NS8A 1PGBA 2FCMA 2GBKA 2V9HA 1UF0A 1I4HA 3E9SA 5FR6A 1NI2A 1AARA 1GOZA 1QOBA 2K5PA 5KHOA 1TKGA 1OEYJ 5IN7A 1TS5A 1JRPA 1P0RA 2LHEA 2CU1A 5J18A 1UD7A 1SE9A 3RFZB 5BMIA 2JVCA 2LFIA 4OZCA 2E3TA 4K7UA 4FJVB 4L2YA 1UNSA 2JZPA 4P6VF 5FK9C 2DNFA 1MI0A 2NCNA 3W1SC 2EMTA 2L1AA 1SB3C 3A9KB 4LJPB 3V62A 1WM3A 1QKZA 3Q3NC 2ZPNA 4KDLB 3QWZB 3MFGA 1C76A 2FCSA 1VDVA 2BGFA 3JYUA 3PS6A 2J42A 1C1YB 2C7MB 1E5WA 3N32A 1Z5SB 1P98A 1NENB 2GMIC 4B6WA 2FAZA 5BO4B 4WQMA 1QOAA 1AWDA 4IM3A 3ZTCA 3NHEB 1IGCA 3PO0A 1WE7A 3AULA 4REZA 3OAWA 2QILA 5IAAC 1C4AA 4ACFA 4XGAB 4FN2A 3HVZA 1HTOA 5CHWA 4JIOU 3B2FA 2V0GA 5EDSA 2XK5A 1E8YA 3IT6B 2KQSA 3WAOA 4XE0A 1K51A 2OJRA 4QAYA 5BMHA 3EHVA 4GMVA 4TSSA 5TSSA 2KVZA 3AEBB 4PS3A 3L13A 2HE7A 3A1QA 1Z2MA 3LXFA 2JWZA 3V6CB 4US8A 4G0NB 2LEKA 4P7IA 2MQJA 2MHJA 2PIAA 2BW2A 4RFBA 4NY0A 3ENEA 2RD0A 1JQ4A 1ZOYB 2G4DB 4PYUA 4HDOA 1JCKB 5G5HA 2KANA 3IHPC 2I2YA 4LLGM 5BMGA 3H7PB 3DWGC 1PQSA 3U30A 2FIFA 4XWTA 1WJ4A 3PPAA 2K6DB 2LVOA 2ZPYA 3ZXVA 2K22A 5EE9A 5D3DA 4EUTA 2A5UA 2KLCA 3AH7A 3RN9C 3GP7A 3NJTA 4M00A 2LJIA 4HDQA 2WWZA 1MJDA 4G11A 2DENB 2MBQA 4MGKE 2LUEA 1MHHE 2WDTB 1SE2A 3NY5A 1SE3A 3RNCC 2JX5A 3IAM1 3URYA 1WGYA 4TMAB 4LDTB 1C79A 1KLGD 2WXOA 1B1ZA 3EECA 2IO0B 1XXGA 2W3SA 4WWNA 2NPTB 3AECB 3VFKA 1WGHA 3JSVA 2IDYA 3TL5A 5JZEB 2CS4A 1UH6A 1GG3A 2C9WB 2CJNA 1L7YA 2I38A 1V1PA 4HK2A 1WJ6A 4LNOA 3QC8B 4K81A 1UWXA 1WWTA 2R2OA 3QARA 5LNK1 3B0AA 1WI0A 4AOFA 4KZ0A 1UBIA 2HDEA 1SBBB 5C1ZA 3UGBB 4OHJA 3RD2A 1RWSA 3O13A 1UELA 2O2VA 3KWLA 2I1JA 3JVZX 1R4MI 3VUXA 4JWSC 4EFOA 5J2RA 1HXYD 2KFKA 1PUTA 2BB6A 3AE4B 1RYJA 3MJ5A 2LZ6A 3BYYB 3AEAB 1WX8A 1YN5A 2D3GA 4KGTA 4MGYE 4WWOA 4YWGG 3PT2B 4KX6B 3MTNB 4K7SA 1SEBD 1GPXA 3QQ8B 4C4VA 2M0AA 2MBBB 5HKHA 4PK1A 3TJPA 1FNVA 2DAFA 2QJLA 2NVUI 4HCPB 2VZKD 1E8ZA 4CHKA 2RSUA 2M4NA 1WGKA 1N62A 3GB1A 2DYOA 1WE6A 2WLBA 3KYCD 3WALA 3ALBA 4F8CB 2K25A 2IGDA 1FCLA 4BBNC 3IFWB 3A4SC 1MVKA 4HJKA 1L2NA 3KUZA 1G6JA 4WIPA 2ZCCA 1HTQA 2HJ8A 4B0EA 3W5VB 3AB5A 1ZXHA 2KVRA 3AE8B 2R61A 3NS1A 3PTFC 4FADA 3DDCB 4JE3B 1J7CA 3E56A 4AJWA 2KTFA 2KMAA 2GBNA 1BT0A 4W9IA 2WHIA 1TYGB 1N6ZA 4HKZE 1TS2A 3BY4B 3IXSA 2IBIB 4MGZE 2KFJA 4ANWA 3AI5A 2MW5A 3VR8B 2KYWA 2LGSA 2MBHA 1S3SG 5AUIA 2WX1A 4URKA 1TIFA 3MC0B 1ZUD2 5DPRA 3RNGC 1WX7A 4HRSA 2CHXA 5AZFA 2PMVA 2WXFA 3R2TA 3BVMA 1I7HA 4EEWA 3AU5A 3PHXB 4W9JA 3B2GA 1XLPA 5L83A 1JALA 1J19A 1SJED 3NZ3A 4W9GA 4IC7B 1C4PA 5AZGA 1IGDA 1HQRD 1EWCA 4CYEA 3ONSA 4R3DA 4ZRKA 1T0RC 2ZVNA 1JROA 4LNIA 1OEYA 2FIDA 3CF6E 3RUIB 2K8BA 4MSMB 4HXDA 1XEEA 2KXJA 2L0FA 1YJIA 4CQNA 5GMVA 3ZQ4A 4DHJD 1IUEA 5LXHA 2N1WA 3P4QB 1PDXA 2L52A 1ISNA 3DBHI 1ENFA 2MJDA 1VRAB 4MM3A 3AM9A 3V3XA 2WU5B 1ZPSA 4HPMB 2KN4A 1TZOA 4N9F4 5D6JB 3B1LX 2L00B 1WXSA 4XDCA 2K3UA 1WZ0A 2SAKA 3DCGA 1B9RA 1YX6B 2DZIA 2DYMA 3AE5B 4JGHB 2HTME 1P1AA 3KUDB 4GDKA 2HJ1A 4YL8A 1C4CA 2JYEA 3U7ZA 3MP9A 3VAWA 2JT4B 3T8MA 3RNFC 4HJGE 4BBNF 1CZPA 4ZRJA 2G3QB 3QIJA 4N59A 2DHZA 1VD2A 1ESFA 1P9DU 1Y56A 3MHSD 4S17A 3ZDMC 3ZJVA 2N7JA 4WJPA 4NNJB 3ZGZA 2BYEA 1T0SC 5JXVA 2CHZA 2K6QA 1MFWA 3WAPA 4LTUA 2VZKB 1D6EC 2KT7A 1C77A 2GB1A 2BBCA 2XK5B 1IYFA 1P3QU 3VXWA 2KJRA 4NPNA 1K50A 2Y3AA 2V1YA 5HG2A 1QLBB 4EZKA 1D4BA 5C2TB 1N5WA 2XBBC 3SFEB 2IO1B 2JY6A 2MA9B 4A55A 3KQ4A 1NEKB 5GXGB 4EZJA 2L76A 2FNJB 1LM8B 3N1ZC 3AEEB 1RFKA 3M62B 4ZYNA 2D5GA 4EKUA 3VTUA 3VTVA 4YSZB 3KVFB 4EZLA 3AE2B 4WJQA 2N9LA 1XD3B 2N1VA 3NG0A 2BS2B 4YSXB 2YLMA 2IJ0A 3PRMB 4FJZA 2LGXA 4EE2A 1GNUA 1L5PA 4UDUC 3B9JA 1UBQA 2Y5BB 1E7VA 1KJTA 4F1SA 2NTSA 2E6XA 2OOBB 3UF8A 2SEBD 3C0RB 4IWPA 2N7EA 1RFAA 3A9JA 3R8BA 3DPDA 1TY0A 3AE1B 4TV3A 1XF5L 1F0ZA 2RR9A 2H89B 2V3NA 3DBRB 1DYQA 1F2RC 3Q3MC 4HPLB 1EU4A 4ZDVA 4GLSC 2V4LA 3JSVB 2KDFB 3H6NA 1MG8A 4BFRA 2WU2B 1V1PB 2BQQA 1LGRA 1UZXB 3NVVA 1FNUA 4RM8A 2BYVE 4DHJB 2ICIA 4P1BC 4MH8A 4M8MA 3KUCB 1TY2A 4KVGB 3QK0A 3I9V1 2PE9A 1E0ZA 1WRIA 2JWUA 2D07B 1N61A 2O2VB 3DQVA 3AMZA 3NOBA 2BWES 1LO5D 1EM7A 1QILA 5E6JA 4OZAA 1YJJA 1J7BA 2KFKB 4DXGA 1F9JA 2ZEQA 4KKIA 2L8JA 2WXHA 2C7NB 3BWUD 1N63A 4ARIA 3H1UA 3H9DA 1GC6A 2IPKD 4W9DA 4FBJB 4C4VB 2VH2A 2JU6X 3AEDB 5HI1A 2D3BA 2ZVOA 3AN1A 1RM6C 4TKNA 1XQQA 2AL6A 5IOIA 2WDQB 1K53A 4XYCA 2B3AA 4GDLA 1JRUA 2HD5B 1OTRB 2LGIA 3TEZA 2JPHA 3EGRA 2Z0EB 3V61A 4BOSC 1KF6B 4RGTA 3AEFB 2DZKA 3W9CB 1E90A 1WSPA 4II2B 1HE8A 3X0WA 3CSFA 5IA7A 2IGHA 3GE3C 4GSWA 4KDIC 2LJ5A 1YJ1A 4MH0E 1M94A 3VH4B 1EU3A 3K9PB 5G5GA 4IKGA 4YTPB 1EF1A 2LXCA 4WH4A 2EKIA 3U7DA 3HM6X 2AQ3B 4NAWB 1BXTA 1EWYC 4M02A 2EKEC 4FLHA 1T0YA 3SEBA 2MP2A 2OEDA 3P42A 5FKAC 3WIMA 1JWMD 1L0YB 1KRHA 1L0VB 2QEJC 2W3RA 1UWMA 1OQYA 5G55A 2GRIA 4NZLB 4C7ZA 3WANA 1WXMA 4DHZB 1WYGA 1Q0WB 1WGRA 3I5JC 4GOCA 3LJ3A 2X8XX 1K52A 4WURA 1RRBA 4X57B 2KLGA 2MX2A 4G50A 1XT9B 4NJCA 4HLEA 4J6IA 2LI5A 2Z8LA 2AYOB 5BYQA 1E7UA 3AXCA 3VVWB 3RNBC 4A90A 4AWJA 2BVCA 2IZVB
chains in the Genus database with same CATH topology
3U4EG 1VZ6A 3LB8C 4LK0M 3P1MA 3VR8B 2W55A 1GB1A 1FMAD 1ZE3D 2DLBA 2X38A 5AUIA 1HA5A 1FXAA 4KGRA 2DWQA 1FNWA 3MC0B 4A6QA 1ZUD2 2AX5A 3FAHA 4WAFA 4DQOC 3NVZA 4PT5A 3EUB2 4HKQA 4HRSA 2WP9B 1ZDXA 1FO4A 2PMVA 1NYRA 2LHDA 2WXFA 3R2TA 1JWAD 3BVMA 4ZHPA 1I7HA 3Q69A 4MM3B 3B2GA 3TEXA 1XLPA 2JXTA 2G1EA 1JALA 2YEPB 2WXLA 1SJED 3NZ3A 4L23A 2MJEA 3P63A 2QMTA 1C4PA 2W82A 1IGDA 1D5XC 1HQRD 2NTTA 2KWDA 2YEPF 1EWCA 4C56C 1I4XA 4R3DA 4ZHOA 2BYTA 4YTNB 1VZ7A 4GDKB 1M4VA 1YMHE 2JYTA 4RNAA 2WXNA 3BVGA 2WXIA 1JROA 1T6BX 1PFDA 2Y5PA 1NI3A 3AEGB 4JPSA 1SJHD 4ARCA 2V3PA 1XEEA 1FEHA 1FXIA 1YJIA 4CQNA 1OFFA 3ZQ4A 1JMLA 4ZYSA 1IUEA 3P4QB 1PDXA 1D5ZC 2L52A 3HVDA 2OHFA 1ENFA 1I4QA 1N60A 1XLNA 1BMLC 1F2RI 2J52A 2MJDA 1VRAB 3NRZA 3AM9A 3V3XA 2WU5B 5C3JB 1ZPSA 2QIEB 3IT4B 2INNE 1PYWD 2KN4A 1TZOA 4IOIE 1PGAA 1UGJA 4XDCA 2K3UA 1YN3A 2SAKA 1B9RA 1OQQA 1YNTE 2RDGA 1IBXB 2WDRB 4A9AA 2DYMA 1KH0A 2RPVA 3BZDB 3AE5B 1T5XD 2HTME 2W54A 4YT0B 3DWMA 4RGOS 3AE6B 5EE3A 1XO3A 3UI3A 2QSDA 1ZDVA 1SF0A 1BUIC 1L0XB 1C4CA 1PGBA 1UUPA 2JYEA 3U7ZA 3MP9A 4A8XC 3U2SC 4C80A 1TKEA 4OZBA 2NMQA 1FRRA 1I4HA 1YQ3B 4HJGE 3E9SA 2ACZB 2N9KA 4HROA 1GOZA 1QOBA 2K5PA 1CZPA 1TKGA 3CWIA 1FCCC 2WXQA 1TS5A 1JRPA 4USAA 4N59A 5HFYA 4DXFA 3HUIA 1NVID 2LHEA 2M56B 2FBWB 1VR9A 1ESFA 1J7AA 1GB4A 1YN4A 3RFZB 1Y56A 5BMIA 4YTMB 2LFIA 4OZCA 2E3TA 4OVZA 5I4DA 2B76B 1IBXA 4J3OD 4L2YA 4XWWA 2MJ3A 3FILB 3ZJVA 2N7JA 2BT6A 1UNSA 3ZGZA 1L6UA 1JW9D 2JZPA 4P6VF 1CK1A 5FK9C 5JXVA 1ET6A 2WXPA 5FR3A 1MI0A 2KAJA 3SR6A 4LTUA 2L1AA 2VZKB 4KKJA 1D6EC 1SB3C 1SE4A 1VJKA 1C77A 2GB1A 1HZ5A 1QKZA 2BBCA 4O1NA 5T8IA 3MFGA 1E9MA 1C76A 1VDVA 2Y5CA 3TEWA 3EA6A 1NYQA 4P16A 1FFUA 1V97A 3VRAB 2J42A 4N6EB 3NUHB 3NVYA 1K50A 2WXGA 2Y3AA 3Q8FA 1NENB 1C9FA 3ETRA 5HG2A 1QLBB 4WQMA 1QOAA 1AWDA 4FXCA 4JWUC 1ET9A 3KWVA 3TSSA 4RH6A 1D4BA 5C2TB 1N5WA 3SFEB 2KMMA 1IGCA 4A55A 3PO0A 3KQ4A 1NEKB 2WQYB 3FILA 1FFVA 5GXGB 2PLPA 2KDMA 4REZA 4YXDB 2QILA 4ZRPA 2PW9A 3Q8AA 1C4AA 3AEEB 1JWSD 2ZW0A 3GS2A 3KLSX 1DOXA 1RFKA 3I57A 2LMCA 3Q8EA 3HVZA 3H8HA 2D5GA 5D3IB 2H88B 3B2FA 2V0GA 4YSZB 3PZ7A 1JWUD 3CIRB 3AE2B 3NVWA 2N9LA 4RGMA 3IT6B 4XE0A 1CJEA 2PTLA 1K51A 3BYTB 2BS2B 4YSXB 2IJ0A 1XCTL 5BMHA 4EE2A 2M19A 4TSSA 4H2AA 1L5PA 5TSSA 1WXQA 1OQRA 4UDUC 1QF6A 1FRDA 4KGSA 4YSYB 2K9XA 3AEBB 3B9JA 4RF1A 2PKOA 1PGXA 3V05A 3OWEB 2FE8A 3LXFA 2XN9C 2NTSA 4ZRQA 2E6XA 4L1BA 4US8A 4NAMA 4JX1C 2LEKA 2KQ4X 5H8YE 4D2KA 1TKYA 2BS3B 5H92C 3ZJTA 2SEBD 2PVOD 3PZ8A 2PIAA 2BW2A 3R8BA 4RFBA 1TS3A 1SSNA 1KFYB 1TY0A 1C78A 2EELA 3AE1B 1JQ4A 1ROEA 1ZOYB 1TJEA 1XF5L 1P7FA 1F0ZA 1JCKB 2H89B 2V3NA 5G5HA 2I2YA 3T3OA 1E10A 1MHXA 4LLGM 5BMGA 1F77A 1DYQA 1F2RC 1L6VA 3DWGC 1EU4A 4XWTA 4GLSC 4OW0A 1STEA 4M0WA 2WDVB 3TEYA 2K22A 5EE9A 1DOYA 4IDIA 2WU2B 1V1PB 2L32A 5D3DA 3T3NA 3VQIA 3AH7A 2RDHA 3GP7A 4N58A 2DBYA 3ZJUA 3NVVA 3AE7B 4TQ1A 2LJIA 1FNUA 3P4RB 4B0MA 1VLBA 2CU3A 2ICIA 1T3QA 3W2DA 4MH8A 4C7YA 3VRBB 1TY2A 1MHHE 1SE2A 3I9V1 2BS4B 4TQ0A 1KTKA 1V1OA 1SE3A 1E0ZA 2JX5A 3IAM1 3URYA 1WRIA 1N5XA 4RGNA 5AUKA 4TMAB 1AW7A 2JWUA 1C79A 1N61A 1KLGD 2WXOA 1I4RA 3AMZA 3IAS1 1B1ZA 1LO5D 3J9CA 1EM7A 1MPEA 1QILA 2ZW1A 3N9YC 1XXGA 4GDLB 2MEKA 2W3SA 5E6JA 4OZAA 3ZYYX 1YJJA 3AECB 5BYSA 1J7BA 4WWMA 4DXGA 2IDYA 4AS1A 2ON8A 4KKIA 2CJNA 2I38A 1V1PA 4AQ7A 2WXHA 3FC4A 2FUG1 1UWXA 1DOIA 1WWTA 1N63A 3BWUD 4ARIA 2IPKD 3LYYA 3Q8CA 3Q8BA 5LNK1 1V8CA 1VZ8A 1SIJA 3W5UB 3AE3B 3ABVB 2J4XA 1E6EB 1HZ6A 3VR9B 2HDEA 2WNMA 1QQRA 2JU6X 3SFDB 1SBBB 3AEDB 5HI1A 3BIID 1ZXIA 3AN1A 4OHJA 2XNAC 3HRDD 1RM6C 5BYRA 4ZOHC 1RWSA 2WS3B 3C8YA 3O13A 3W1SA 3KWLA 1KLUD 1XCQL 2WDQB 4MT5A 1K53A 4JWSC 1Q10A 3P4PB 2BB5A 2KACA 2LGIA 3TEZA 4HEA1 1DGJA 1HXYD 3AE4B 1PUTA 2BB6A 3EGRA 1RYJA 3MJ5A 3RPFC 1KF6B 4Q2JA 4RGTA 3AEFB 1P7EA 3BYYB 3W9CB 1CQVA 1L4ZB 1ACCA 2AQ2B 3AEAB 2TSSA 2AQ1B 1YN5A 3BVZA 1WSPA 1XLQA 2WXJA 2K0PA 4KGTA 4YWGG 2IGHA 4KX6B 4RCOA 1SEBD 2WXKA 3R2IA 5EE1A 1GPXA 2M0AA 3AV8A 3TUOA 4ITKA 4US9A 5EE0A 1I4GA 3MHZA 2CJOA 1FNVA 2RMMA 2QJLA 1FM0D 1EU3A 2L83A 2VZKD 2BTEA 1AYFA 2Q5WD 2PVGC 1ZP0B 5G5GA 1WGKA 1N62A 4IKGA 4YTPB 1L4DB 3GB1A 2DYOA 4WH4A 1QT9A 1AN8A 2EKIA 2WLBA 1XLOA 2AQ3B 3U52E 4NAWB 1BXTA 1EWYC 2ONQA 2WXRA 1QOGA 2IGDA 3AE9B 3BK2A 5HHDG 1D5MC 2JSVX 1FCLA 2J53A 1FD6A 1GAQB 2JQRB 1MVKA 3SEBA 2OEDA 1QOFA 2GI9A 2IGGA 3P42A 4WIPA 5FKAC 1JWMD 4RF0A 1L0YB 4B0EA 1SXTA 1KRHA 2MH7A 1L0VB 2LUMA 2QEJC 4MACA 2W3RA 1UWMA 3W5VB 3AB5A 1ZXHA 2GRIA 4NZLB 4C7ZA 1E7PB 1I4PA 2WXMA 1JWBD 3AE8B 2R61A 5MPOA 2G9HD 1R7SA 3NS1A 1WYGA 3WCQA 4JE3B 1A70A 2INPE 1J7CA 1FIQA 3E56A 2V4IB 1K52A 1TS4A 1YQ4B 4WURA 3P4SB 2N0SB 1TYGB 4HKZE 3L4PA 4NJCA 1TS2A 2Z8LA 5BYQA 3BK1A 4XDDA 3IXSA 4A90A 5D7GA 1HEZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FCC C;  5HFY A;  1GB1 A;  1XCQ L;  2KQ4 X;  2LHE A;  4D2K A;  1K53 A;  1GB4 A;  4KGR A;  1Q10 A;  5BMI A;  2KAC A;  2LGI A;  4OZC A;  2EEL A;  1IBX A;  1XF5 L;  1P7F A;  2LHD A;  2I2Y A;  3FIL B;  2N7J A;  1MHX A;  5BMG A;  1P7E A;  1F2R C;  2JZP A;  2JXT A;  5JXV A;  4KGT A;  2K0P A;  2IGH A;  1MI0 A;  4GLS C;  2QMT A;  1IGD A;  2KWD A;  2RMM A;  2GB1 A;  1HZ5 A;  1QKZ A;  1YMH E;  4IKG A;  3GB1 A;  1K50 A;  4WH4 A;  1C9F A;  5HG2 A;  2ONQ A;  1MHH E;  2IGD A;  5HHD G;  1D4B A;  1JML A;  2JSV X;  1FCL A;  1IGC A;  2J53 A;  2JWU A;  1FD6 A;  1MVK A;  3FIL A;  2OED A;  1F2R I;  2J52 A;  2KDM A;  2GI9 A;  2IGG A;  2PLP A;  2PW9 A;  3V3X A;  1EM7 A;  1MPE A;  2ZW1 A;  2KN4 A;  4IOI E;  1PGA A;  2ZW0 A;  2LUM A;  4OZA A;  4MAC A;  1ZXH A;  1YNT E;  1IBX B;  2ON8 A;  1KH0 A;  2RPV A;  2I38 A;  1UWX A;  2N9L A;  3UI3 A;  2QSD A;  1K52 A;  2PTL A;  1K51 A;  1HZ6 A;  1PGB A;  3MP9 A;  1XCT L;  5BMH A;  2JU6 X;  4HKZ E;  5HI1 A;  4OZB A;  2NMQ A;  4KGS A;  4HJG E;  2N9K A;  1PGX A;  1HEZ E; 
#chains in the Genus database with same CATH topology
 4A3O A;  3LB8 C;  3EFC A;  2W55 A;  3ZW3 A;  1FMA D;  1GB1 A;  4MEM A;  2DLB A;  1FXA A;  2UYZ B;  4KGR A;  1FNW A;  3FAH A;  3GE8 C;  4M01 A;  2WP9 B;  5C23 A;  3GZN B;  4MM3 B;  3TCA A;  2G1E A;  2YEP B;  5LLI A;  2WXL A;  3Q14 C;  5JHB A;  3P63 A;  2QMT A;  2LRU A;  2W82 A;  2DZM A;  2IY1 B;  2KWD A;  2YEP F;  2VH1 A;  4I6L B;  4RM9 A;  3RCZ A;  2BYT A;  4GDK B;  1YMH E;  4MJS A;  5L95 C;  2WXN A;  3BVG A;  2WXI A;  1T6B X;  4WWP A;  5D94 A;  1PFD A;  3WA0 A;  1NI3 A;  2IY0 B;  3AEG B;  3PRP B;  4ARC A;  2V3P A;  1RLF A;  3VDZ A;  3DVN V;  2BYF A;  3SD5 A;  2GOW A;  1OFF A;  1JML A;  5DPS A;  3MC9 A;  1D5Z C;  4DDG D;  2OHF A;  1KOT A;  1V80 A;  2J52 A;  2IYD B;  2INN E;  1PYW D;  2BF8 B;  3V6E B;  4IOI E;  1PGA A;  1UGJ A;  1U4A A;  1OQQ A;  4B9K A;  2RPQ A;  4DK5 A;  1D3Z A;  2RPV A;  3L54 A;  1H8C A;  4GB9 A;  3APD A;  5EE3 A;  1XO3 A;  3UI3 A;  3P2B A;  4K1R B;  1ZDV A;  1BUI C;  2QHO A;  4A8X C;  1TKE A;  2KJH B;  4OZB A;  5DPT A;  2NMQ A;  1YQ3 B;  2ACZ B;  2N9K A;  4HRO A;  2LWP A;  3DHG C;  1J0G A;  1F52 A;  3PZD A;  1FCC C;  1TBE A;  2WXQ A;  4USA A;  4DXF A;  2INC C;  1NVI D;  2MBO A;  2LRW A;  2M56 B;  4IM2 A;  4IUM B;  1J7A A;  1YN4 A;  2DYB A;  1RAX A;  2KTR A;  2G4S A;  2B76 B;  3L17 A;  4XWW A;  1L6U A;  3L0W B;  1CK1 A;  1WH3 A;  3ZLZ A;  4GIV A;  5FR3 A;  4KIK A;  4KKJ A;  4MEL A;  3UQA A;  4O1N A;  5T8I A;  2NBW B;  2C60 A;  1IPG A;  2I1K A;  3TEW A;  3DHH C;  3EA6 A;  1NYQ A;  1FFU A;  1V97 A;  2WYQ A;  2PPH A;  3R66 C;  3Q8F A;  1EO6 A;  3MJW A;  3ETR A;  2BWF A;  2JXX A;  2PE6 B;  4PS7 A;  4FXC A;  4JWU C;  1ET9 A;  2NBV B;  3ECI A;  3R3M A;  3L10 B;  5DCN A;  4BVU C;  1KLV A;  2KMM A;  3M3J A;  3FIL A;  1UGM A;  2PLP A;  4S0R A;  4YXD B;  4ZRP A;  2PW9 A;  3A4R A;  3UQB A;  1E8W A;  3A9J B;  4NJ6 A;  3KLS X;  2K39 A;  3I3T B;  3I57 A;  2BKF A;  1DOX A;  3Q8E A;  1Q1O A;  3OJ3 A;  5D3I B;  2H88 B;  4A3P A;  1V6E A;  4BKG A;  3PZ7 A;  3TIX A;  3HM3 A;  1JWU D;  3CIR B;  1C3T A;  3RUL A;  2D11 A;  3N1Y C;  1CJE A;  2PTL A;  1YX5 B;  2J0K A;  1XCT L;  2LVP A;  4H2A A;  1WXQ A;  1QF6 A;  4YSY B;  2K9X A;  4LNF A;  4FHJ A;  4RF1 A;  4MDK E;  3V05 A;  2XN9 C;  3K9O B;  3DBR I;  3DBL B;  5H8Y E;  4JQW C;  2MWS B;  4AUQ C;  3ZJT A;  2GBJ A;  3HHM A;  3PZ8 A;  3SU8 X;  3EFU A;  1OGW A;  1TS3 A;  1SSN A;  1WMH A;  2EEL A;  2NR2 A;  2AWT A;  4B95 A;  1TJE A;  1P7F A;  3T3O A;  2KDB A;  1MHX A;  4W9E A;  1L6V A;  2G45 B;  4E3C A;  4OW0 A;  2VRR B;  1WXV A;  1STE A;  4M0W A;  1I35 A;  2L32 A;  3T3N A;  2CHW A;  2MCN B;  3VQI A;  1YOV B;  3VH3 B;  2RDH A;  3RZF A;  4N58 A;  4LCD E;  1TZ1 A;  5E6N A;  4GXB A;  3CST A;  2KK8 A;  3AE7 B;  3P4R B;  2LGD A;  1T3Q A;  3W2D A;  3VRB B;  4IG7 B;  3Q3O C;  1V49 A;  4TQ0 A;  4FJY A;  4IM0 A;  4JLC A;  2KX3 A;  2R2Q A;  1N5X A;  4RGN A;  5AUK A;  1AW7 A;  3IAS 1;  3X23 A;  4GDL B;  3N9Y C;  4GGQ A;  2DAJ A;  5BYS A;  2ZCB A;  4LNN A;  1WXA A;  2N7D A;  2KC2 A;  2JF5 A;  4MGI E;  2J7Q B;  3FC4 A;  2FUG 1;  4DXA B;  3A1Q B;  3LYY A;  3Q8C A;  2L7R A;  5JHA A;  1VZ8 A;  3AE3 B;  1E6E B;  3VR9 B;  4HCN B;  1QQR A;  2A4Z A;  5E6O A;  3BII D;  1R4N B;  2XNA C;  3HRD D;  3PRZ A;  5BYR A;  4ZOH C;  3RI7 C;  1KLU D;  2KNB A;  3ZO5 B;  2BPS A;  1Q10 A;  3P4P B;  2BB5 A;  1WYW B;  2KAC A;  2KN5 A;  4HEA 1;  2FUH B;  2MP2 B;  1WR1 A;  1P7E A;  2AQ2 B;  1XLQ A;  2K0P A;  3IG3 A;  2C5L C;  3A33 B;  3AV8 A;  4ITK A;  4US9 A;  2KD0 A;  2RMM A;  2D3A A;  2C7H A;  2PVG C;  5E6P A;  1ZP0 B;  1S1Q B;  3RT3 B;  1L4D B;  1AN8 A;  2M1M A;  1XLO A;  1WJU A;  3U52 E;  2L0T A;  4M8N A;  3TBL D;  2WXR A;  1QOG A;  3UIO B;  3RZW C;  3BK2 A;  5HHD G;  4WJO A;  4G3X B;  2J53 A;  3L16 A;  1FD6 A;  3ZNI D;  2JQR B;  2GI9 A;  2IGG A;  2AEH A;  4NQK E;  4RF0 A;  2YVC A;  1SXT A;  2LUM A;  2PEA A;  3Q6B A;  4MAC A;  4A20 A;  1JWB D;  4OVV A;  5MPO A;  2G9H D;  1R7S A;  3WCQ A;  4K3B A;  1TGZ B;  1WFY A;  1A70 A;  2INP E;  1QZE A;  2KJ6 A;  1TTN A;  2N0S B;  1ZW7 A;  2V3S A;  4IWO A;  3L4P A;  3ZUN A;  3BK1 A;  4MJS B;  3DBS A;  5D7G A;  2KWC A;  1X1M A;  2BKR B;  3GZN I;  4W9C A;  2MSE D;  3DVN U;  2NS5 A;  3R7Q A;  1HA5 A;  4FUL A;  4A6Q A;  2AX5 A;  2QC8 A;  4NJ7 A;  4WAF A;  1V2Y A;  3NVZ A;  5J17 A;  4HKQ A;  3ZVV A;  1FO4 A;  3JW0 X;  4I6N B;  2L3Z A;  2EMS A;  1F1H A;  2CR5 A;  4EOY A;  4BKT A;  2KWV B;  2MJE A;  3VTW A;  3QX1 A;  2K1F A;  2ZJD A;  2NTT A;  1I4X A;  1V5O A;  2ZZP B;  4ZHO A;  1M4V A;  4HVB A;  3V60 A;  1YQB A;  2RDB C;  2Y5P A;  2JZ3 B;  5TR5 A;  1EF5 A;  1FEH A;  2Z0D B;  3DVG X;  5JH5 C;  2LAS A;  1YD8 U;  3N1X C;  3HVD A;  1WM2 A;  1GC7 A;  2D3C A;  1N60 A;  4CO7 A;  3NRZ A;  5C3J B;  3IT4 B;  5CTR C;  2KTR B;  5CHV C;  5D2M B;  2RDG A;  3ZRF A;  2D2Q A;  1K8R B;  1LXD A;  1Q5W B;  2QCZ A;  3N30 A;  1V5T A;  2MBE A;  3PSE B;  4LJO B;  4YT0 B;  4GU2 A;  3DWM A;  2JRI B;  3B08 A;  2QSD A;  3PLU A;  1CMX B;  1SF0 A;  4KIK B;  1UUP A;  1ZKH A;  3U2S C;  4C80 A;  5LXI B;  3UIP B;  3PRE A;  1FRR A;  2O6V A;  1WX9 A;  3CWI A;  1VCB A;  5HFY A;  3HIZ A;  3HUI A;  2D10 A;  2FBW B;  1VR9 A;  5CX3 A;  3O65 B;  1GB4 A;  3CMM B;  4C00 A;  2W9N A;  4YTM B;  5KHQ A;  4OVZ A;  5I4D A;  3M63 B;  1IBX A;  3KYD D;  4J3O D;  3PGE A;  2MJ3 A;  3FIL B;  4BKS A;  2BT6 A;  1WJN A;  4W9K A;  1JW9 D;  4WQO B;  1A5R A;  1ET6 A;  2K8C A;  2WXP A;  2KAJ A;  1H4R A;  3QCA A;  3SR6 A;  5IP4 D;  4FA6 A;  1SE4 A;  2N9E B;  1VJK A;  2GBR A;  3EC8 A;  2NBU A;  1HZ5 A;  3VHT C;  1E9M A;  1NBF C;  2Y5C A;  1MG4 A;  4P16 A;  1WZ3 A;  3VRA B;  5CHF A;  2XEW A;  4N6E B;  3ZRC A;  3NUH B;  3NVY A;  1Y8R C;  2AL3 A;  2UU7 A;  2WXG A;  3PV1 A;  3KH0 A;  1C9F A;  3KWV A;  3TSS A;  4RH6 A;  4E71 A;  3QAQ A;  1FXT B;  3OLM D;  4II3 B;  2WQY B;  1FFV A;  2KDM A;  3Q2A C;  3Q8A A;  3C19 A;  3WAM A;  1JWS D;  2ZW0 A;  3GS2 A;  1WMH B;  2M8S A;  3RNA C;  3BIN A;  2LMC A;  3H8H A;  2UWQ A;  1IP9 A;  2KDE B;  3A9K A;  3DVG Y;  2DZJ A;  3NVW A;  3ZTD A;  4XZ4 A;  4RGM A;  3N3K B;  2JZZ A;  2ASQ A;  3DBL I;  4M0W B;  2KX0 A;  3BYT B;  5IKC M;  1EUV B;  2M19 A;  2GLS A;  1OQR A;  1FRD A;  4KGS A;  4GN1 A;  2K8H A;  2PKO A;  3W1Y A;  2KMC A;  2GBM A;  1WRD B;  2OJW A;  1PGX A;  3OWE B;  3N20 C;  2FE8 A;  4ZRQ A;  2CKH B;  3AU4 A;  4L1B A;  4NAM A;  4JX1 C;  3ZDT A;  2KQ4 X;  4KV2 A;  4D2K A;  1TKY A;  2BS3 B;  5H92 C;  4KSK C;  2PVO D;  1KFY B;  1C78 A;  1WY8 A;  1ROE A;  1LFD A;  1LQB A;  3ZNZ B;  1E10 A;  1V86 A;  3KW5 B;  3Q3J A;  4JL9 A;  1J8C A;  3LDZ E;  2KOX A;  1F77 A;  3VUY A;  4BOZ B;  3ZNH B;  4IWQ A;  3DHI C;  3ZXR A;  2WDV B;  3TEY A;  1DOY A;  4IDI A;  2IND C;  3DOW A;  2DBY A;  3ZJU A;  4F7Z A;  4TQ1 A;  4B0M A;  1VLB A;  2CU3 A;  3ML9 A;  4NQL B;  4C7Y A;  3IBE A;  3NZS A;  5G2N A;  1V9J A;  3RYT A;  2BS4 B;  1KTK A;  1V1O A;  1WF9 A;  1SIF A;  4W9F A;  3GOE A;  1I4R A;  2O6V D;  3H7P A;  3J9C A;  2ZW1 A;  1MPE A;  2Z59 B;  1FPY A;  4ICU A;  4NAW A;  2MEK A;  3ZYY X;  4WWM A;  1GUA B;  4AS1 A;  4WAA A;  2ON8 A;  4IW0 A;  4AQ7 A;  1R4N I;  1DOI A;  3Q8B A;  1V8C A;  2HTH A;  4BKS D;  1SIJ A;  3W5U B;  2KC1 A;  2PJH A;  3ABV B;  2J4X A;  1HZ6 A;  2WX0 A;  2FCQ A;  4KSL C;  2WNM A;  3M95 A;  2JRH A;  4KZC A;  3SFD B;  4BZA A;  3U8Z A;  3ZKJ C;  3ML8 A;  1ZXI A;  3D32 A;  4WJN A;  3I63 C;  1WR6 E;  2LD9 A;  2WS3 B;  3C8Y A;  3W1S A;  2KWU B;  1XCQ L;  4DHZ E;  4MT5 A;  1ZGU B;  2N9X A;  1KM7 A;  2NPT A;  1DGJ A;  2N9P C;  3RPF C;  4Q2J A;  2J0M A;  3RMK C;  1YIW A;  1CQV A;  1L4Z B;  1ACC A;  4BAX A;  2TSS A;  2AQ1 B;  1R4M B;  3BVZ A;  2L05 A;  2WXJ A;  1NDD A;  4RCO A;  5EE1 A;  2WXK A;  3R2I A;  2ZNV C;  3TUO A;  4ICV A;  5EE0 A;  1I4G A;  3MHZ A;  2CJO A;  1FM0 D;  2WGS A;  2L83 A;  2BTE A;  1AYF A;  2QDF A;  4E74 A;  2Q5W D;  3IVF A;  2REX A;  2KKC A;  4DWF A;  3ZIM A;  2J0J A;  1QT9 A;  3PLV A;  3SHQ A;  2KQ7 A;  5AZH A;  2ONQ A;  3AE9 B;  1D5M C;  4ANX A;  2JSV X;  4AP4 C;  3S2A A;  1GAQ B;  4LNK A;  3QA8 A;  1WIA A;  1QOF A;  3H7S A;  5DPW A;  2IO2 B;  4PS8 A;  2FCN A;  2MH7 A;  3UIN B;  1T0Q C;  4PYZ A;  1E7P B;  4ZRI A;  1I4P A;  2WXM A;  2RGF A;  3PHW B;  4RMA A;  1WGD A;  4P1C C;  2LVQ A;  4K3C A;  1FIQ A;  2V4I B;  1TS4 A;  3VUW A;  1YQ4 B;  3P4S B;  4OVU A;  4TUU A;  1I42 A;  2M0X A;  4XDD A;  3MC8 A;  3HK0 A;  1HEZ E;  3U4E G;  1VZ6 A;  4LK0 M;  3P1M A;  3Q3F A;  1ZE3 D;  1SGH A;  2X38 A;  4HPP A;  3PVL A;  2DWQ A;  4AJY B;  3L08 A;  3T9L A;  4DQO C;  4PT5 A;  3EUB 2;  4XC2 A;  4ASW C;  1ZDX A;  1NYR A;  2LHD A;  4W9H A;  1JWA D;  4ZHP A;  1V81 A;  3Q69 A;  1GJZ A;  3TEX A;  3ZNG C;  2JXT A;  3QJZ A;  5IO9 A;  4I6P A;  4XX5 A;  4DBG A;  4L23 A;  2LGY A;  4MSQ B;  2N4F A;  3R7R A;  2KO3 A;  1D5X C;  1TT5 B;  3NZU A;  3RNE C;  2M17 A;  4C56 C;  4FHK A;  2LXA A;  3APC A;  4YTN B;  1VZ7 A;  2JYT A;  4RNA A;  4W9L A;  4DDI D;  2MLB A;  3OJ4 B;  4JPS A;  1SJH D;  4ANV A;  4ANU A;  1FXI A;  2KDI A;  4K7W A;  2MRP A;  2O6V B;  3QHT A;  4ZYS A;  3OG5 A;  2ZNV B;  1I4Q A;  1XLN A;  1BML C;  1F2R I;  2QIE B;  3FKY A;  4HWI B;  2IO3 B;  4LDT D;  2KHW B;  1YN3 A;  1WGG A;  2KZR A;  1YNT E;  1IBX B;  3APF A;  2WDR B;  3DBH B;  4A9A A;  3BZD B;  1KH0 A;  5AEK B;  1T5X D;  2W54 A;  2DX5 B;  4RGO S;  3AE6 B;  3TMP B;  1E8X A;  3SDL C;  2JUO A;  1L0X B;  3NS8 A;  1PGB A;  2FCM A;  2GBK A;  2V9H A;  1UF0 A;  1I4H A;  3E9S A;  5FR6 A;  1NI2 A;  1AAR A;  1GOZ A;  1QOB A;  2K5P A;  5KHO A;  1TKG A;  1OEY J;  5IN7 A;  1TS5 A;  1JRP A;  1P0R A;  2LHE A;  2CU1 A;  5J18 A;  1UD7 A;  1SE9 A;  3RFZ B;  5BMI A;  2JVC A;  2LFI A;  4OZC A;  2E3T A;  4K7U A;  4FJV B;  4L2Y A;  1UNS A;  2JZP A;  4P6V F;  5FK9 C;  2DNF A;  1MI0 A;  2NCN A;  3W1S C;  2EMT A;  2L1A A;  1SB3 C;  3A9K B;  4LJP B;  3V62 A;  1WM3 A;  1QKZ A;  3Q3N C;  2ZPN A;  4KDL B;  3QWZ B;  3MFG A;  1C76 A;  2FCS A;  1VDV A;  2BGF A;  3JYU A;  3PS6 A;  2J42 A;  1C1Y B;  2C7M B;  1E5W A;  3N32 A;  1Z5S B;  1P98 A;  1NEN B;  2GMI C;  4B6W A;  2FAZ A;  5BO4 B;  4WQM A;  1QOA A;  1AWD A;  4IM3 A;  3ZTC A;  3NHE B;  1IGC A;  3PO0 A;  1WE7 A;  3AUL A;  4REZ A;  3OAW A;  2QIL A;  5IAA C;  1C4A A;  4ACF A;  4XGA B;  4FN2 A;  3HVZ A;  1HTO A;  5CHW A;  4JIO U;  3B2F A;  2V0G A;  5EDS A;  2XK5 A;  1E8Y A;  3IT6 B;  2KQS A;  3WAO A;  4XE0 A;  1K51 A;  2OJR A;  4QAY A;  5BMH A;  3EHV A;  4GMV A;  4TSS A;  5TSS A;  2KVZ A;  3AEB B;  4PS3 A;  3L13 A;  2HE7 A;  3A1Q A;  1Z2M A;  3LXF A;  2JWZ A;  3V6C B;  4US8 A;  4G0N B;  2LEK A;  4P7I A;  2MQJ A;  2MHJ A;  2PIA A;  2BW2 A;  4RFB A;  4NY0 A;  3ENE A;  2RD0 A;  1JQ4 A;  1ZOY B;  2G4D B;  4PYU A;  4HDO A;  1JCK B;  5G5H A;  2KAN A;  3IHP C;  2I2Y A;  4LLG M;  5BMG A;  3H7P B;  3DWG C;  1PQS A;  3U30 A;  2FIF A;  4XWT A;  1WJ4 A;  3PPA A;  2K6D B;  2LVO A;  2ZPY A;  3ZXV A;  2K22 A;  5EE9 A;  5D3D A;  4EUT A;  2A5U A;  2KLC A;  3AH7 A;  3RN9 C;  3GP7 A;  3NJT A;  4M00 A;  2LJI A;  4HDQ A;  2WWZ A;  1MJD A;  4G11 A;  2DEN B;  2MBQ A;  4MGK E;  2LUE A;  1MHH E;  2WDT B;  1SE2 A;  3NY5 A;  1SE3 A;  3RNC C;  2JX5 A;  3IAM 1;  3URY A;  1WGY A;  4TMA B;  4LDT B;  1C79 A;  1KLG D;  2WXO A;  1B1Z A;  3EEC A;  2IO0 B;  1XXG A;  2W3S A;  4WWN A;  2NPT B;  3AEC B;  3VFK A;  1WGH A;  3JSV A;  2IDY A;  3TL5 A;  5JZE B;  2CS4 A;  1UH6 A;  1GG3 A;  2C9W B;  2CJN A;  1L7Y A;  2I38 A;  1V1P A;  4HK2 A;  1WJ6 A;  4LNO A;  3QC8 B;  4K81 A;  1UWX A;  1WWT A;  2R2O A;  3QAR A;  5LNK 1;  3B0A A;  1WI0 A;  4AOF A;  4KZ0 A;  1UBI A;  2HDE A;  1SBB B;  5C1Z A;  3UGB B;  4OHJ A;  3RD2 A;  1RWS A;  3O13 A;  1UEL A;  2O2V A;  3KWL A;  2I1J A;  3JVZ X;  1R4M I;  3VUX A;  4JWS C;  4EFO A;  5J2R A;  1HXY D;  2KFK A;  1PUT A;  2BB6 A;  3AE4 B;  1RYJ A;  3MJ5 A;  2LZ6 A;  3BYY B;  3AEA B;  1WX8 A;  1YN5 A;  2D3G A;  4KGT A;  4MGY E;  4WWO A;  4YWG G;  3PT2 B;  4KX6 B;  3MTN B;  4K7S A;  1SEB D;  1GPX A;  3QQ8 B;  4C4V A;  2M0A A;  2MBB B;  5HKH A;  4PK1 A;  3TJP A;  1FNV A;  2DAF A;  2QJL A;  2NVU I;  4HCP B;  2VZK D;  1E8Z A;  4CHK A;  2RSU A;  2M4N A;  1WGK A;  1N62 A;  3GB1 A;  2DYO A;  1WE6 A;  2WLB A;  3KYC D;  3WAL A;  3ALB A;  4F8C B;  2K25 A;  2IGD A;  1FCL A;  4BBN C;  3IFW B;  3A4S C;  1MVK A;  4HJK A;  1L2N A;  3KUZ A;  1G6J A;  4WIP A;  2ZCC A;  1HTQ A;  2HJ8 A;  4B0E A;  3W5V B;  3AB5 A;  1ZXH A;  2KVR A;  3AE8 B;  2R61 A;  3NS1 A;  3PTF C;  4FAD A;  3DDC B;  4JE3 B;  1J7C A;  3E56 A;  4AJW A;  2KTF A;  2KMA A;  2GBN A;  1BT0 A;  4W9I A;  2WHI A;  1TYG B;  1N6Z A;  4HKZ E;  1TS2 A;  3BY4 B;  3IXS A;  2IBI B;  4MGZ E;  2KFJ A;  4ANW A;  3AI5 A;  2MW5 A;  3VR8 B;  2KYW A;  2LGS A;  2MBH A;  1S3S G;  5AUI A;  2WX1 A;  4URK A;  1TIF A;  3MC0 B;  1ZUD 2;  5DPR A;  3RNG C;  1WX7 A;  4HRS A;  2CHX A;  5AZF A;  2PMV A;  2WXF A;  3R2T A;  3BVM A;  1I7H A;  4EEW A;  3AU5 A;  3PHX B;  4W9J A;  3B2G A;  1XLP A;  5L83 A;  1JAL A;  1J19 A;  1SJE D;  3NZ3 A;  4W9G A;  4IC7 B;  1C4P A;  5AZG A;  1IGD A;  1HQR D;  1EWC A;  4CYE A;  3ONS A;  4R3D A;  4ZRK A;  1T0R C;  2ZVN A;  1JRO A;  4LNI A;  1OEY A;  2FID A;  3CF6 E;  3RUI B;  2K8B A;  4MSM B;  4HXD A;  1XEE A;  2KXJ A;  2L0F A;  1YJI A;  4CQN A;  5GMV A;  3ZQ4 A;  4DHJ D;  1IUE A;  5LXH A;  2N1W A;  3P4Q B;  1PDX A;  2L52 A;  1ISN A;  3DBH I;  1ENF A;  2MJD A;  1VRA B;  4MM3 A;  3AM9 A;  3V3X A;  2WU5 B;  1ZPS A;  4HPM B;  2KN4 A;  1TZO A;  4N9F 4;  5D6J B;  3B1L X;  2L00 B;  1WXS A;  4XDC A;  2K3U A;  1WZ0 A;  2SAK A;  3DCG A;  1B9R A;  1YX6 B;  2DZI A;  2DYM A;  3AE5 B;  4JGH B;  2HTM E;  1P1A A;  3KUD B;  4GDK A;  2HJ1 A;  4YL8 A;  1C4C A;  2JYE A;  3U7Z A;  3MP9 A;  3VAW A;  2JT4 B;  3T8M A;  3RNF C;  4HJG E;  4BBN F;  1CZP A;  4ZRJ A;  2G3Q B;  3QIJ A;  4N59 A;  2DHZ A;  1VD2 A;  1ESF A;  1P9D U;  1Y56 A;  3MHS D;  4S17 A;  3ZDM C;  3ZJV A;  2N7J A;  4WJP A;  4NNJ B;  3ZGZ A;  2BYE A;  1T0S C;  5JXV A;  2CHZ A;  2K6Q A;  1MFW A;  3WAP A;  4LTU A;  2VZK B;  1D6E C;  2KT7 A;  1C77 A;  2GB1 A;  2BBC A;  2XK5 B;  1IYF A;  1P3Q U;  3VXW A;  2KJR A;  4NPN A;  1K50 A;  2Y3A A;  2V1Y A;  5HG2 A;  1QLB B;  4EZK A;  1D4B A;  5C2T B;  1N5W A;  2XBB C;  3SFE B;  2IO1 B;  2JY6 A;  2MA9 B;  4A55 A;  3KQ4 A;  1NEK B;  5GXG B;  4EZJ A;  2L76 A;  2FNJ B;  1LM8 B;  3N1Z C;  3AEE B;  1RFK A;  3M62 B;  4ZYN A;  2D5G A;  4EKU A;  3VTU A;  3VTV A;  4YSZ B;  3KVF B;  4EZL A;  3AE2 B;  4WJQ A;  2N9L A;  1XD3 B;  2N1V A;  3NG0 A;  2BS2 B;  4YSX B;  2YLM A;  2IJ0 A;  3PRM B;  4FJZ A;  2LGX A;  4EE2 A;  1GNU A;  1L5P A;  4UDU C;  3B9J A;  1UBQ A;  2Y5B B;  1E7V A;  1KJT A;  4F1S A;  2NTS A;  2E6X A;  2OOB B;  3UF8 A;  2SEB D;  3C0R B;  4IWP A;  2N7E A;  1RFA A;  3A9J A;  3R8B A;  3DPD A;  1TY0 A;  3AE1 B;  4TV3 A;  1XF5 L;  1F0Z A;  2RR9 A;  2H89 B;  2V3N A;  3DBR B;  1DYQ A;  1F2R C;  3Q3M C;  4HPL B;  1EU4 A;  4ZDV A;  4GLS C;  2V4L A;  3JSV B;  2KDF B;  3H6N A;  1MG8 A;  4BFR A;  2WU2 B;  1V1P B;  2BQQ A;  1LGR A;  1UZX B;  3NVV A;  1FNU A;  4RM8 A;  2BYV E;  4DHJ B;  2ICI A;  4P1B C;  4MH8 A;  4M8M A;  3KUC B;  1TY2 A;  4KVG B;  3QK0 A;  3I9V 1;  2PE9 A;  1E0Z A;  1WRI A;  2JWU A;  2D07 B;  1N61 A;  2O2V B;  3DQV A;  3AMZ A;  3NOB A;  2BWE S;  1LO5 D;  1EM7 A;  1QIL A;  5E6J A;  4OZA A;  1YJJ A;  1J7B A;  2KFK B;  4DXG A;  1F9J A;  2ZEQ A;  4KKI A;  2L8J A;  2WXH A;  2C7N B;  3BWU D;  1N63 A;  4ARI A;  3H1U A;  3H9D A;  1GC6 A;  2IPK D;  4W9D A;  4FBJ B;  4C4V B;  2VH2 A;  2JU6 X;  3AED B;  5HI1 A;  2D3B A;  2ZVO A;  3AN1 A;  1RM6 C;  4TKN A;  1XQQ A;  2AL6 A;  5IOI A;  2WDQ B;  1K53 A;  4XYC A;  2B3A A;  4GDL A;  1JRU A;  2HD5 B;  1OTR B;  2LGI A;  3TEZ A;  2JPH A;  3EGR A;  2Z0E B;  3V61 A;  4BOS C;  1KF6 B;  4RGT A;  3AEF B;  2DZK A;  3W9C B;  1E90 A;  1WSP A;  4II2 B;  1HE8 A;  3X0W A;  3CSF A;  5IA7 A;  2IGH A;  3GE3 C;  4GSW A;  4KDI C;  2LJ5 A;  1YJ1 A;  4MH0 E;  1M94 A;  3VH4 B;  1EU3 A;  3K9P B;  5G5G A;  4IKG A;  4YTP B;  1EF1 A;  2LXC A;  4WH4 A;  2EKI A;  3U7D A;  3HM6 X;  2AQ3 B;  4NAW B;  1BXT A;  1EWY C;  4M02 A;  2EKE C;  4FLH A;  1T0Y A;  3SEB A;  2MP2 A;  2OED A;  3P42 A;  5FKA C;  3WIM A;  1JWM D;  1L0Y B;  1KRH A;  1L0V B;  2QEJ C;  2W3R A;  1UWM A;  1OQY A;  5G55 A;  2GRI A;  4NZL B;  4C7Z A;  3WAN A;  1WXM A;  4DHZ B;  1WYG A;  1Q0W B;  1WGR A;  3I5J C;  4GOC A;  3LJ3 A;  2X8X X;  1K52 A;  4WUR A;  1RRB A;  4X57 B;  2KLG A;  2MX2 A;  4G50 A;  1XT9 B;  4NJC A;  4HLE A;  4J6I A;  2LI5 A;  2Z8L A;  2AYO B;  5BYQ A;  1E7U A;  3AXC A;  3VVW B;  3RNB C;  4A90 A;  4AWJ A;  2BVC A;  2IZV B; 
#chains in the Genus database with same CATH homology
 3U4E G;  1VZ6 A;  3LB8 C;  4LK0 M;  3P1M A;  3VR8 B;  2W55 A;  1GB1 A;  1FMA D;  1ZE3 D;  2DLB A;  2X38 A;  5AUI A;  1HA5 A;  1FXA A;  4KGR A;  2DWQ A;  1FNW A;  3MC0 B;  4A6Q A;  1ZUD 2;  2AX5 A;  3FAH A;  4WAF A;  4DQO C;  3NVZ A;  4PT5 A;  3EUB 2;  4HKQ A;  4HRS A;  2WP9 B;  1ZDX A;  1FO4 A;  2PMV A;  1NYR A;  2LHD A;  2WXF A;  3R2T A;  1JWA D;  3BVM A;  4ZHP A;  1I7H A;  3Q69 A;  4MM3 B;  3B2G A;  3TEX A;  1XLP A;  2JXT A;  2G1E A;  1JAL A;  2YEP B;  2WXL A;  1SJE D;  3NZ3 A;  4L23 A;  2MJE A;  3P63 A;  2QMT A;  1C4P A;  2W82 A;  1IGD A;  1D5X C;  1HQR D;  2NTT A;  2KWD A;  2YEP F;  1EWC A;  4C56 C;  1I4X A;  4R3D A;  4ZHO A;  2BYT A;  4YTN B;  1VZ7 A;  4GDK B;  1M4V A;  1YMH E;  2JYT A;  4RNA A;  2WXN A;  3BVG A;  2WXI A;  1JRO A;  1T6B X;  1PFD A;  2Y5P A;  1NI3 A;  3AEG B;  4JPS A;  1SJH D;  4ARC A;  2V3P A;  1XEE A;  1FEH A;  1FXI A;  1YJI A;  4CQN A;  1OFF A;  3ZQ4 A;  1JML A;  4ZYS A;  1IUE A;  3P4Q B;  1PDX A;  1D5Z C;  2L52 A;  3HVD A;  2OHF A;  1ENF A;  1I4Q A;  1N60 A;  1XLN A;  1BML C;  1F2R I;  2J52 A;  2MJD A;  1VRA B;  3NRZ A;  3AM9 A;  3V3X A;  2WU5 B;  5C3J B;  1ZPS A;  2QIE B;  3IT4 B;  2INN E;  1PYW D;  2KN4 A;  1TZO A;  4IOI E;  1PGA A;  1UGJ A;  4XDC A;  2K3U A;  1YN3 A;  2SAK A;  1B9R A;  1OQQ A;  1YNT E;  2RDG A;  1IBX B;  2WDR B;  4A9A A;  2DYM A;  1KH0 A;  2RPV A;  3BZD B;  3AE5 B;  1T5X D;  2HTM E;  2W54 A;  4YT0 B;  3DWM A;  4RGO S;  3AE6 B;  5EE3 A;  1XO3 A;  3UI3 A;  2QSD A;  1ZDV A;  1SF0 A;  1BUI C;  1L0X B;  1C4C A;  1PGB A;  1UUP A;  2JYE A;  3U7Z A;  3MP9 A;  4A8X C;  3U2S C;  4C80 A;  1TKE A;  4OZB A;  2NMQ A;  1FRR A;  1I4H A;  1YQ3 B;  4HJG E;  3E9S A;  2ACZ B;  2N9K A;  4HRO A;  1GOZ A;  1QOB A;  2K5P A;  1CZP A;  1TKG A;  3CWI A;  1FCC C;  2WXQ A;  1TS5 A;  1JRP A;  4USA A;  4N59 A;  5HFY A;  4DXF A;  3HUI A;  1NVI D;  2LHE A;  2M56 B;  2FBW B;  1VR9 A;  1ESF A;  1J7A A;  1GB4 A;  1YN4 A;  3RFZ B;  1Y56 A;  5BMI A;  4YTM B;  2LFI A;  4OZC A;  2E3T A;  4OVZ A;  5I4D A;  2B76 B;  1IBX A;  4J3O D;  4L2Y A;  4XWW A;  2MJ3 A;  3FIL B;  3ZJV A;  2N7J A;  2BT6 A;  1UNS A;  3ZGZ A;  1L6U A;  1JW9 D;  2JZP A;  4P6V F;  1CK1 A;  5FK9 C;  5JXV A;  1ET6 A;  2WXP A;  5FR3 A;  1MI0 A;  2KAJ A;  3SR6 A;  4LTU A;  2L1A A;  2VZK B;  4KKJ A;  1D6E C;  1SB3 C;  1SE4 A;  1VJK A;  1C77 A;  2GB1 A;  1HZ5 A;  1QKZ A;  2BBC A;  4O1N A;  5T8I A;  3MFG A;  1E9M A;  1C76 A;  1VDV A;  2Y5C A;  3TEW A;  3EA6 A;  1NYQ A;  4P16 A;  1FFU A;  1V97 A;  3VRA B;  2J42 A;  4N6E B;  3NUH B;  3NVY A;  1K50 A;  2WXG A;  2Y3A A;  3Q8F A;  1NEN B;  1C9F A;  3ETR A;  5HG2 A;  1QLB B;  4WQM A;  1QOA A;  1AWD A;  4FXC A;  4JWU C;  1ET9 A;  3KWV A;  3TSS A;  4RH6 A;  1D4B A;  5C2T B;  1N5W A;  3SFE B;  2KMM A;  1IGC A;  4A55 A;  3PO0 A;  3KQ4 A;  1NEK B;  2WQY B;  3FIL A;  1FFV A;  5GXG B;  2PLP A;  2KDM A;  4REZ A;  4YXD B;  2QIL A;  4ZRP A;  2PW9 A;  3Q8A A;  1C4A A;  3AEE B;  1JWS D;  2ZW0 A;  3GS2 A;  3KLS X;  1DOX A;  1RFK A;  3I57 A;  2LMC A;  3Q8E A;  3HVZ A;  3H8H A;  2D5G A;  5D3I B;  2H88 B;  3B2F A;  2V0G A;  4YSZ B;  3PZ7 A;  1JWU D;  3CIR B;  3AE2 B;  3NVW A;  2N9L A;  4RGM A;  3IT6 B;  4XE0 A;  1CJE A;  2PTL A;  1K51 A;  3BYT B;  2BS2 B;  4YSX B;  2IJ0 A;  1XCT L;  5BMH A;  4EE2 A;  2M19 A;  4TSS A;  4H2A A;  1L5P A;  5TSS A;  1WXQ A;  1OQR A;  4UDU C;  1QF6 A;  1FRD A;  4KGS A;  4YSY B;  2K9X A;  3AEB B;  3B9J A;  4RF1 A;  2PKO A;  1PGX A;  3V05 A;  3OWE B;  2FE8 A;  3LXF A;  2XN9 C;  2NTS A;  4ZRQ A;  2E6X A;  4L1B A;  4US8 A;  4NAM A;  4JX1 C;  2LEK A;  2KQ4 X;  5H8Y E;  4D2K A;  1TKY A;  2BS3 B;  5H92 C;  3ZJT A;  2SEB D;  2PVO D;  3PZ8 A;  2PIA A;  2BW2 A;  3R8B A;  4RFB A;  1TS3 A;  1SSN A;  1KFY B;  1TY0 A;  1C78 A;  2EEL A;  3AE1 B;  1JQ4 A;  1ROE A;  1ZOY B;  1TJE A;  1XF5 L;  1P7F A;  1F0Z A;  1JCK B;  2H89 B;  2V3N A;  5G5H A;  2I2Y A;  3T3O A;  1E10 A;  1MHX A;  4LLG M;  5BMG A;  1F77 A;  1DYQ A;  1F2R C;  1L6V A;  3DWG C;  1EU4 A;  4XWT A;  4GLS C;  4OW0 A;  1STE A;  4M0W A;  2WDV B;  3TEY A;  2K22 A;  5EE9 A;  1DOY A;  4IDI A;  2WU2 B;  1V1P B;  2L32 A;  5D3D A;  3T3N A;  3VQI A;  3AH7 A;  2RDH A;  3GP7 A;  4N58 A;  2DBY A;  3ZJU A;  3NVV A;  3AE7 B;  4TQ1 A;  2LJI A;  1FNU A;  3P4R B;  4B0M A;  1VLB A;  2CU3 A;  2ICI A;  1T3Q A;  3W2D A;  4MH8 A;  4C7Y A;  3VRB B;  1TY2 A;  1MHH E;  1SE2 A;  3I9V 1;  2BS4 B;  4TQ0 A;  1KTK A;  1V1O A;  1SE3 A;  1E0Z A;  2JX5 A;  3IAM 1;  3URY A;  1WRI A;  1N5X A;  4RGN A;  5AUK A;  4TMA B;  1AW7 A;  2JWU A;  1C79 A;  1N61 A;  1KLG D;  2WXO A;  1I4R A;  3AMZ A;  3IAS 1;  1B1Z A;  1LO5 D;  3J9C A;  1EM7 A;  1MPE A;  1QIL A;  2ZW1 A;  3N9Y C;  1XXG A;  4GDL B;  2MEK A;  2W3S A;  5E6J A;  4OZA A;  3ZYY X;  1YJJ A;  3AEC B;  5BYS A;  1J7B A;  4WWM A;  4DXG A;  2IDY A;  4AS1 A;  2ON8 A;  4KKI A;  2CJN A;  2I38 A;  1V1P A;  4AQ7 A;  2WXH A;  3FC4 A;  2FUG 1;  1UWX A;  1DOI A;  1WWT A;  1N63 A;  3BWU D;  4ARI A;  2IPK D;  3LYY A;  3Q8C A;  3Q8B A;  5LNK 1;  1V8C A;  1VZ8 A;  1SIJ A;  3W5U B;  3AE3 B;  3ABV B;  2J4X A;  1E6E B;  1HZ6 A;  3VR9 B;  2HDE A;  2WNM A;  1QQR A;  2JU6 X;  3SFD B;  1SBB B;  3AED B;  5HI1 A;  3BII D;  1ZXI A;  3AN1 A;  4OHJ A;  2XNA C;  3HRD D;  1RM6 C;  5BYR A;  4ZOH C;  1RWS A;  2WS3 B;  3C8Y A;  3O13 A;  3W1S A;  3KWL A;  1KLU D;  1XCQ L;  2WDQ B;  4MT5 A;  1K53 A;  4JWS C;  1Q10 A;  3P4P B;  2BB5 A;  2KAC A;  2LGI A;  3TEZ A;  4HEA 1;  1DGJ A;  1HXY D;  3AE4 B;  1PUT A;  2BB6 A;  3EGR A;  1RYJ A;  3MJ5 A;  3RPF C;  1KF6 B;  4Q2J A;  4RGT A;  3AEF B;  1P7E A;  3BYY B;  3W9C B;  1CQV A;  1L4Z B;  1ACC A;  2AQ2 B;  3AEA B;  2TSS A;  2AQ1 B;  1YN5 A;  3BVZ A;  1WSP A;  1XLQ A;  2WXJ A;  2K0P A;  4KGT A;  4YWG G;  2IGH A;  4KX6 B;  4RCO A;  1SEB D;  2WXK A;  3R2I A;  5EE1 A;  1GPX A;  2M0A A;  3AV8 A;  3TUO A;  4ITK A;  4US9 A;  5EE0 A;  1I4G A;  3MHZ A;  2CJO A;  1FNV A;  2RMM A;  2QJL A;  1FM0 D;  1EU3 A;  2L83 A;  2VZK D;  2BTE A;  1AYF A;  2Q5W D;  2PVG C;  1ZP0 B;  5G5G A;  1WGK A;  1N62 A;  4IKG A;  4YTP B;  1L4D B;  3GB1 A;  2DYO A;  4WH4 A;  1QT9 A;  1AN8 A;  2EKI A;  2WLB A;  1XLO A;  2AQ3 B;  3U52 E;  4NAW B;  1BXT A;  1EWY C;  2ONQ A;  2WXR A;  1QOG A;  2IGD A;  3AE9 B;  3BK2 A;  5HHD G;  1D5M C;  2JSV X;  1FCL A;  2J53 A;  1FD6 A;  1GAQ B;  2JQR B;  1MVK A;  3SEB A;  2OED A;  1QOF A;  2GI9 A;  2IGG A;  3P42 A;  4WIP A;  5FKA C;  1JWM D;  4RF0 A;  1L0Y B;  4B0E A;  1SXT A;  1KRH A;  2MH7 A;  1L0V B;  2LUM A;  2QEJ C;  4MAC A;  2W3R A;  1UWM A;  3W5V B;  3AB5 A;  1ZXH A;  2GRI A;  4NZL B;  4C7Z A;  1E7P B;  1I4P A;  2WXM A;  1JWB D;  3AE8 B;  2R61 A;  5MPO A;  2G9H D;  1R7S A;  3NS1 A;  1WYG A;  3WCQ A;  4JE3 B;  1A70 A;  2INP E;  1J7C A;  1FIQ A;  3E56 A;  2V4I B;  1K52 A;  1TS4 A;  1YQ4 B;  4WUR A;  3P4S B;  2N0S B;  1TYG B;  4HKZ E;  3L4P A;  4NJC A;  1TS2 A;  2Z8L A;  5BYQ A;  3BK1 A;  4XDD A;  3IXS A;  4A90 A;  5D7G A;  1HEZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...