2Y5PA

B-repeat of listeria monocytogenes inlb (internalin b)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
72
structure length
72
Chain Sequence
MVYTVSYDVDGTVIKTKVEAGTRITAPKPPTKQGYVFKGWYTEKNGGHEWNFNTDYMSGNDFTLYAVFKAET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Fold and Function of the Inlb B-Repeat.
pubmed doi rcsb
source organism Listeria monocytogenes egd
molecule tags Protein binding
molecule keywords INTERNALIN B
total genus 11
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.660 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2y5pA00
2Y5PA
chains in the Genus database with same CATH superfamily
3IBEA 2KOXA 5TSSA 4P1BC 1YOVB 3M95A 1FXIA 2L52A 4ZDVA 3NOBA 4I6NB 1PYWD 1QLBB 2FUHB 4HWIB 2K1FA 2MBBB 1R4NI 2V4IB 2BYTA 1H4RA 2KQSA 4A90A 3N1ZC 2PVOD 4NJ7A 3HRDD 4NAWB 3KWLA 4A55A 1HEZE 4HEA1 1E8ZA 3Q14C 2K22A 4A8XC 1KM7A 2K6DB 3DBLI 4HJKA 4LNKA 5J17A 1NI2A 2LRUA 3KUDB 3T3NA 3TIXA 3ALBA 2PPHA 3P1MA 2K5PA 2ONQA 2ZVNA 2IJ0A 1IPGA 3B2GA 3ML8A 4F7ZA 2LGSA 4ICVA 3IVFA 4W9CA 1JCKB 3DWMA 1V1OA 2K8BA 1DOYA 3ECIA 4IM0A 2KFKA 1OEYJ 1C4AA 2MJEA 2NPTA 4EFOA 5DPSA 4LJOB 1XT9B 2RMMA 2MLBA 2N7DA 3NVVA 2JYTA 3P4RB 1XXGA 3WAMA 5KHQA 1WJ6A 2WX1A 2Y5BB 2D3BA 3OAWA 4A3OA 4AUQC 3U2SC 1SBBB 3Q3OC 1UGMA 3SDLC 1CZPA 3ABVB 4M0WB 3MC0B 2AQ2B 3Q69A 4US9A 4AJYB 1WXSA 2V3PA 2FE8A 1J7CA 3HM3A 2KFJA 2FIDA 2INCC 3I63C 3R2IA 1ZGUB 3ZNGC 2OHFA 2LUMA 2L05A 3V60A 4W9JA 3DVNV 3RNEC 1FRDA 3R2TA 2FNJB 2AL3A 1QOFA 2AQ3B 4IUMB 1IP9A 2BF8B 3PTFC 2G4DB 2N1VA 2Z59B 2I1KA 3AXCA 4JL9A 2BYEA 2ZJDA 1RLFA 4MM3A 1JWMD 3VTWA 3ZJVA 3L0WB 1C4CA 4WWMA 5HKHA 3UQAA 1IGDA 4HDOA 4ANUA 1LQBA 4F1SA 2BB5A 4C00A 2OJRA 5EE9A 1FXTB 3M63B 2KQ7A 1BXTA 2WU2B 3AH7A 4AP4C 1VLBA 2GBKA 2ZPNA 3NRZA 1L5PA 4AWJA 3A4RA 3QJZA 2BYVE 2D11A 2I1JA 1WZ0A 5HI1A 3KH0A 2KACA 2IO0B 1E0ZA 3A9JA 1TJEA 1SE4A 2JZPA 2WX0A 2O6VB 4D2KA 2D3AA 2DZIA 2W54A 4XDDA 2BVCA 2RPVA 1T0QC 4KDIC 3ZDMC 2N9PC 4W9LA 1WSPA 3HIZA 2KDMA 2AWTA 3FC4A 4ZHOA 1TY0A 2E3TA 4KV2A 4MDKE 4JPSA 1KTKA 4J6IA 4A6QA 3C19A 5KHOA 1C76A 1XEEA 4UDUC 3Q2AC 3RT3B 4FHKA 4ZRJA 2NPTB 1G6JA 5E6NA 1D3ZA 3U4EG 1SSNA 3BYTB 2MBEA 2R61A 4K1RB 2M4NA 5DPRA 2JXXA 1HTOA 4WH4A 1UWMA 3APFA 3AE2B 2LWPA 2PVGC 2ASQA 1UBIA 4YTMB 1FCCC 2ZCCA 4WWNA 2E6XA 3VRAB 3DPDA 1MJDA 5BMIA 2SEBD 3ZDTA 1GC7A 5HFYA 4EZKA 4XWTA 2EKEC 1N5WA 1YMHE 4BKSA 4GDLB 2XN9C 3ZRFA 3PLUA 3PRPB 3SFDB 1YX6B 1C4PA 2LHEA 2IO1B 3ZNHB 2WXPA 1E8XA 1ESFA 3HUIA 4WIPA 2R2QA 2LXCA 1HE8A 1ZP0B 2KMMA 1DGJA 4PT5A 5AZGA 3MJWA 1EU4A 1AW7A 4NQLB 4XYCA 2GBMA 2VH1A 2ZCBA 2DAJA 3FKYA 4DHZE 1K53A 1AYFA 5IO9A 4MJSA 2JWUA 2PLPA 2B3AA 1JWAD 5E6PA 2BT6A 5C23A 3HHMA 3DWGC 3PHWB 1KLUD 3AE8B 1EWCA 2DWQA 1BMLC 2DZMA 3U7ZA 3NJTA 3TSSA 1E90A 2HTHA 2KDEB 1E7VA 1PGBA 4AS1A 2JF5A 5D2MB 4DHJB 1XLOA 1QT9A 3ENEA 2L76A 1OTRB 4ICUA 2D2QA 1PGAA 4HJGE 2WDRB 4WJPA 1E8YA 2PMVA 3NS1A 3B0AA 2GLSA 2WS3B 5IKCM 3APCA 1J7BA 3N1YC 1WXQA 1MPEA 2JRHA 4TQ0A 4N59A 3VTVA 1YIWA 3P4SB 2RDHA 3PZDA 1F0ZA 5E6OA 1JWBD 1KFYB 1WX7A 2GBJA 2CS4A 2KMCA 3AE3B 3WALA 2CKHB 1SE9A 2FCQA 2INDC 2KDBA 4HPMB 2WXFA 2GBRA 4DK5A 4PYZA 2N4FA 4EZLA 1NVID 4N6EB 2QEJC 3BWUD 3RNAC 4S0RA 1VD2A 2HJ1A 1SIJA 3AV8A 3A4SC 2WXKA 2MWSB 3A33B 3H6NA 5J18A 4W9HA 2MQJA 2MHJA 4XE0A 5DPTA 1F2RC 1GUAB 4MJSB 4R3DA 3M62B 4B6WA 2AYOB 4GDLA 1EUVB 1JMLA 3EUB2 2TSSA 2RSUA 4LNNA 1KLVA 3DHHC 4BZAA 1WM3A 4BVUC 2BWES 2JWZA 1XD3B 2C7HA 4FJVB 2LEKA 5BYQA 2LASA 3Q8BA 1F52A 1N62A 2XNAC 3E9SA 4NPNA 3JW0X 5FK9C 2J42A 4KGTA 4GDKA 4MT5A 3V62A 1VDVA 1FPYA 2JQRB 2C5LC 2V4LA 3OLMD 3V6CB 3RUIB 1C77A 2J0JA 4FULA 3R3MA 3QWZB 2KQ4X 3EA6A 2KXJA 3KLSX 1PFDA 3EFUA 2IDYA 3OWEB 1P7FA 4HLEA 1V81A 4KX6B 2IO3B 1SB3C 1QOAA 2LUEA 2O6VA 5JHBA 1XO3A 1ET6A 4FBJB 5D94A 1XLPA 4PK1A 1UGJA 3TMPB 1I4QA 1L6VA 2R2OA 1UBQA 2FCMA 4LK0M 3TL5A 1QF6A 4B9KA 3NZSA 3H9DA 3SU8X 1RM6C 4YSYB 3ZGZA 1R4NB 3Q8CA 1WXMA 4BFRA 5AUKA 4BBNC 2MP2A 3RNFC 2MH7A 3R66C 2FIFA 4RGTA 1OFFA 4Q2JA 3BK2A 1ZXHA 4KGRA 3URYA 4YWGG 1JRPA 3GP7A 3IHPC 1WGDA 2AQ1B 4WJQA 3DBLB 4OVVA 3AE1B 3D32A 1S1QB 3KYDD 2GOWA 3LXFA 4RNAA 3Q8AA 1RRBA 1EM7A 2WXHA 1Q0WB 2YEPF 1ZW7A 2LVOA 2PIAA 4NQKE 3CMMB 1FNWA 2K9XA 3V05A 3PO0A 2V1YA 3W5VB 4DDGD 1GG3A 3Q3NC 4FXCA 2DZKA 4PS7A 4MGIE 1Z2MA 1ZDXA 3SD5A 3VVWB 1WR6E 2RR9A 4IM2A 2PE9A 4EUTA 3RI7C 3TEZA 2SAKA 2BYFA 1HZ5A 1P7EA 2MCNB 2CHZA 4TSSA 3IG3A 2N7JA 4A3PA 2WDVB 3GB1A 1FFVA 3PT2B 1WH3A 4LNIA 2Z0EB 2GB1A 1UZXB 4FADA 2N9EB 1GB4A 2K25A 3PPAA 2G45B 2DYMA 3EHVA 3K9PB 3Q3JA 3TEWA 2D07B 4HKZE 2REXA 1SJHD 2K3UA 2C7MB 2LRWA 3QHTA 4IG7B 5IN7A 1WM2A 5L95C 4YL8A 1VRAB 3VXWA 3BYYB 3DBRI 2LFIA 3CF6E 4HRSA 4WWPA 1CMXB 1SEBD 4XZ4A 4OVUA 3IT4B 3RNBC 3L4PA 3CSTA 4LDTB 4BKSD 2JRIB 1WJNA 2KJ6A 4DQOC 3Q3FA 1YJIA 4GIVA 3VH3B 4MELA 4P6VF 2JVCA 5GXGB 1BT0A 3W1SC 4P16A 1K8RB 4IKGA 3PGEA 3PLVA 1ET9A 3N20C 1L0VB 5HHDG 3Q8EA 3M3JA 3WA0A 5T8IA 3FILB 3QIJA 4QAYA 1IBXB 4IWOA 2IGDA 4OZBA 4URKA 5J2RA 2ZZPB 1C1YB 1GOZA 2O6VD 1V80A 2KC1A 4BOSC 4GDKB 3S2AA 5LXIB 1E8WA 5D3IB 2VRRB 1QOBA 1T0YA 2ZEQA 3GS2A 3HK0A 3IXSA 4JWSC 1YQ4B 1SXTA 2JUOA 3C0RB 2XK5A 1DOXA 2V0GA 2OJWA 5AUIA 1KRHA 5JHAA 3HVDA 1TS3A 2X8XX 1NI3A 1TT5B 3QA8A 1DYQA 2L83A 1TIFA 3BINA 2A5UA 2C9WB 1TZ1A 2KWVB 2N0SB 3N30A 2HJ8A 1OQQA 1V1PA 3RN9C 2WXLA 2L32A 3AEFB 2MBOA 4G3XB 1MI0A 3ZIMA 1WIAA 3PREA 4EKUA 1GB1A 3KW5B 4KIKB 2L1AA 4JIOU 4KZCA 4DHJD 3MFGA 3RPFC 3BVMA 1C79A 3P4QB 1JALA 2M0AA 2QIEB 2YVCA 1GNUA 4MH0E 3MHSD 2MP2B 2C7NB 4MACA 4M00A 1T3QA 1GC6A 1WXVA 5G5GA 4RGMA 1ZXIA 1IUEA 1K51A 2BWFA 4FA6A 3VR8B 4O1NA 2VH2A 2ZVOA 3MC9A 3P4PB 4GU2A 4ZOHC 2PEAA 1KH0A 1B9RA 4WAAA 1UELA 3JSVB 1P0RA 2ON8A 1N61A 2D10A 3UIPB 3RZWC 3L16A 3I5JC 3JYUA 1XCTL 1ZOYB 3I9V1 3DDCB 3FAHA 4GLSC 2C60A 1MVKA 3VH4B 1AWDA 3ETRA 5H92C 4ZRIA 4EOYA 1V97A 3AB5A 2NCNA 1I4HA 4OVZA 3A9KA 1WX9A 2MJ3A 2QHOA 4C4VB 4LLGM 5D6JB 4RF1A 4HDQA 4DXGA 2N9LA 1SJED 1FRRA 4HPPA 1I7HA 3AEDB 2EMSA 4TQ1A 1UF0A 5JH5C 5EE0A 4CQNA 4YT0B 2L7RA 4LNFA 4KZ0A 4IDIA 4E74A 2FUG1 3ZVVA 2FCSA 2QSDA 3W2DA 1P1AA 1J0GA 3RCZA 3RNCC 3VAWA 3W9CB 2M0XA 2HTME 4JX1C 4NJCA 4W9IA 5EDSA 4LDTD 2BW2A 4HPLB 1WJUA 2Z8LA 1KOTA 2AEHA 1YJJA 2JXTA 3AE5B 2DYOA 4BKGA 3GOEA 4C80A 2QDFA 2IY0B 2EELA 2NMQA 2FBWB 2V9HA 1YNTE 3H8HA 4P7IA 1RYJA 1WZ3A 5C1ZA 2BPSA 1RFAA 1XLNA 4PS8A 2O2VB 2NBWB 4BAXA 3LB8C 5LNK1 3BVZA 2LVPA 2UYZB 2JX5A 4IOIE 3ZQ4A 5BMHA 2M17A 2BQQA 1WGKA 3LJ3A 2ZW0A 2G1EA 1WYWB 4XC2A 1TS4A 2NBVB 4NNJB 3K9OB 3ZJTA 5EE1A 2IGHA 1DOIA 3RULA 4HVBA 4KIKA 4M02A 1N63A 4ASWC 3TEXA 1TKGA 2K0PA 1V1PB 3E56A 1JWSD 3ONSA 1STEA 3MC8A 1NDDA 3RYTA 1ROEA 4KSLC 4CHKA 1QZEA 2HDEA 3DBHB 1V5OA 3DVNU 2DBYA 2LI5A 5JXVA 2RD0A 4ANVA 2CJNA 2J52A 2KC2A 4LCDE 1N5XA 2LD9A 2X38A 5CHFA 1YJ1A 5LXHA 2EMTA 4MSQB 4GN1A 3T8MA 4DXFA 3AU5A 1E7PB 1EU3A 1WRDB 1WF9A 3Q8FA 1L7YA 3T3OA 1FIQA 1J8CA 1UD7A 4HCPB 1P9DU 2NTTA 3BY4B 1KLGD 3LYYA 2KHWB 2BS4B 4GXBA 3DQVA 3N3KB 3L08A 1V5TA 1JW9D 3VDZA 3NZ3A 1SGHA 4JGHB 4MSMB 2LGIA 1WE6A 4G0NB 1OGWA 1N60A 2W82A 3PVLA 1NENB 3O65B 2W3RA 4JE3B 1F77A 3N1XC 2WXQA 3R7QA 2J0MA 4US8A 3PV1A 2NTSA 1NBFC 3PS6A 3WIMA 3TJPA 1UNSA 4TUUA 1Q10A 1NYQA 2WDTB 4CO7A 1WY8A 1FEHA 5CHWA 1Y8RC 2ACZB 3QC8B 1A5RA 1B1ZA 1L0YB 3AE9B 4YSZB 5IA7A 2KJHB 1SE2A 1ZPSA 3DVGX 2PE6B 4JLCA 1NYRA 3A9JB 4KKJA 5G2NA 2NR2A 1YX5B 1Q5WB 3HVZA 3AEGB 4KDLB 4RGNA 5IP4D 2KZRA 3B08A 4KSKC 3B9JA 5LLIA 4FJZA 1E9MA 1CQVA 2N9XA 2BS2B 1WJ4A 1TTNA 2LJ5A 4HCNB 5G5HA 3AE7B 4MM3B 2DLBA 1Z5SB 2ICIA 2MBQA 3WANA 4KGSA 3VTUA 3VUXA 4RM9A 3PZ7A 5AZFA 2JSVX 5IOIA 4HKQA 5EE3A 2Y5CA 4KVGB 4KKIA 3X23A 2WXNA 1PDXA 5I4DA 3GZNB 2YLMA 1L2NA 3L13A 3OG5A 2WXOA 1FCLA 2KAJA 3DBRB 3U7DA 5JZEB 1ZDVA 4W9KA 3KQ4A 5CHVC 1IGCA 5AZHA 2W55A 3EFCA 4A9AA 3QARA 2CHWA 2FCNA 4NZLB 3UGBB 2D3GA 1LO5D 1H8CA 4K7SA 4K3CA 2LGXA 5C3JB 3MP9A 1FNUA 1BUIC 2BKRB 2JU6X 3KWVA 1I4GA 2D5GA 2CHXA 5BYSA 3OJ3A 4AOFA 2BBCA 4MEMA 2NBUA 2O2VA 1AN8A 4RH6A 4K3BA 2MSED 2LMCA 2KLGA 3P42A 2KK8A 5CTRC 3QK0A 3SEBA 3DHGC 3N32A 4ARIA 2KT7A 3GZNI 4WAFA 1WRIA 3AE6B 1T0RC 1UH6A 4XDCA 1SIFA 3NVYA 5CX3A 3KUCB 1ZUD2 2JYEA 5FR6A 5HG2A 4H2AA 2W9NA 4YXDB 4HROA 2LJIA 3ZTDA 1MG4A 3SR6A 2W3SA 4IWPA 4WQOB 4L2YA 1E6EB 1PQSA 1ACCA 2WXMA 3MJ5A 2M8SA 4RMAA 2GBNA 2DENB 2H89B 2LHDA 1F1HA 3QAQA 2KTRA 5E6JA 2WU5B 1Q1OA 3NG0A 4WJOA 4PYUA 4L1BA 3UINB 2D3CA 1WGYA 1F9JA 3PRZA 1VZ8A 2RGFA 3Q3MC 2CU1A 1FD6A 3T9LA 1I42A 2KKCA 3V3XA 2PTLA 1N6ZA 1PGXA 4X57B 3AEEB 2JY6A 3R7RA 1C3TA 1RFKA 4MGKE 2JZ3B 2PW9A 1IYFA 3DBSA 1Y56A 2KLCA 2KTRB 1MG8A 2IYDB 4IC7B 2JT4B 1RWSA 2OEDA 2IBIB 1GPXA 5MPOA 2YEPB 4FLHA 1D5MC 4XX5A 4B0EA 4L23A 1OEYA 3UQBA 3VUYA 2J0KA 4OW0A 3AULA 3PRMB 1YN4A 1LM8B 1L4DB 4M8MA 3EGRA 2KYWA 4P1CC 4C4VA 3JVZX 3P2BA 2UWQA 2N9KA 3QCAA 2G3QB 2LGDA 4N9F4 3A1QA 1HQRD 2CJOA 1P3QU 3OJ4B 3PZ8A 2M56B 4OHJA 4REZA 3SFEB 4PS3A 1LXDA 2KX3A 1FM0D 3VHTC 3CSFA 4TKNA 3AU4A 2MA9B 4YSXB 4W9GA 3AEAB 4DDID 4RFBA 4K7UA 2WHIA 3GE8C 2IO2B 5FR3A 1OQYA 2WXJA 4WURA 1TS5A 1HZ6A 2DAFA 3N9YC 3RMKC 3VRBB 4B95A 1SF0A 3VQIA 2XK5B 1I35A 4AJWA 5G55A 3DCGA 2EKIA 2WYQA 3NZUA 1XQQA 2KNBA 2GMIC 2Z0DB 2WXGA 3VUWA 3ML9A 1CK1A 1NEKB 3UI3A 4GOCA 5BYRA 4MGZE 2IPKD 1TZOA 2LVQA 2QMTA 3QX1A 1XF5L 3NVWA 1YQBA 4JWUC 1YD8U 4E71A 3I3TB 2IY1B 3KYCD 3RD2A 3WAOA 1HTQA 1WMHA 2N7EA 3U8ZA 4G50A 1IBXA 1TKYA 2KVRA 2LXAA 4MH8A 1UUPA 1JROA 2WDQB 3VR9B 1WGRA 2PJHA 3NY5A 4TMAB 2CR5A 1EF5A 2I38A 2PKOA 1UWXA 2KD0A 4IW0A 2DHZA 3PHXB 3QQ8B 3ZNID 1TYGB 4ZRKA 3ZKJC 2AL6A 3GE3C 2G4SA 2MEKA 2MRPA 2N1WA 1QILA 3BZDB 4K81A 2KMAA 4G11A 3ZNZB 3AECB 2L3ZA 2ZPYA 3P63A 3H1UA 1K52A 4GGQA 5L83A 2WXIA 1QOGA 3ZTCA 3KUZA 1E10A 3ZRCA 2DYBA 1F2RI 2Y3AA 3FILA 4BOZB 5DPWA 2LZ6A 3U30A 2I2YA 4W9EA 4JQWC 1L4ZB 1ENFA 4WWOA 3V61A 2JZZA 1V49A 1AARA 1V6EA 2KN4A 2M1MA 2Y5PA 3O13A 4ANXA 1WI0A 3ZYYX 4DBGA 2NS5A 2DNFA 5D3DA 4EZJA 3DOWA 3ZO5B 4I6LB 2INNE 4A20A 4C7YA 4S17A 2K8CA 4MGYE 1M4VA 3ZLZA 4K7WA 5DCNA 1I4RA 4FHJA 1CJEA 2LGYA 2L00B 1MFWA 5IAAC 1PUTA 2DX5B 3MHZA 4AQ7A 3ZXVA 2RDBC 2KDFB 3W1SA 5BMGA 3NVZA 1FO4A 4XWWA 2ZNVC 1R4MB 2H88B 2INPE 3RZFA 1HA5A 1FNVA 1GAQB 3AMZA 2WP9B 2BS3B 1VZ7A 3SHQA 4LJPB 4NY0A 1ISNA 3W1YA 3X0WA 3H7PA 2RPQA 1QQRA 4BKTA 4GSWA 3CIRB 1EF1A 2QCZA 1M94A 2HD5B 3H7PB 2MJDA 1P98A 4N58A 1SE3A 1S3SG 1WE7A 2KWUB 1L6UA 3KVFB 4ACFA 1I4PA 3RFZB 2BB6A 4W9DA 3TCAA 3TUOA 1VR9A 3DVGY 3IT6B 4E3CA 2L0FA 1R7SA 3EECA 3DHIC 3VFKA 3LDZE 1XCQL 4M0WA 1KJTA 4WJNA 4IWQA 3NUHB 4C56C 3L54A 1WR1A 1R4MI 4II2B 1T0SC 1TY2A 2GI9A 2KANA 1C78A 1X1MA 2FAZA 1TGZB 4W9FA 3AI5A 2XBBC 2XEWA 2WQYB 3UF8A 1TBEA 2QC8A 3HM6X 1FFUA 5TR5A 4ZYSA 2KFKB 5H8YE 3MTNB 3CWIA 3APDA 1WWTA 5D7GA 3U52E 4ARCA 4DXAB 4FN2A 4CYEA 3R8BA 3TEYA 3ZW3A 4I6PA 3L17A 1VZ6A 1WYGA 1V8CA 4ZRQA 4WQMA 4F8CB 2OOBB 1J7AA 2A4ZA 1TS2A 1WGGA 1E7UA 1RAXA 1A70A 1C9FA 4ZHPA 3NS8A 2GRIA 2BKFA 1JWUD 1EO6A 2B76B 1GJZA 1FMAD 4RF0A 4DWFA 2WNMA 4B0MA 2KN5A 4LTUA 4IM3A 3Q6BA 5GMVA 3BIID 1YN3A 4OZAA 2KDIA 3AN1A 2KO3A 3NHEB 4BBNF 1L0XB 4YTNB 3ZXRA 2V3SA 1J19A 4FJYA 2K6QA 1ZKHA 1JRUA 1WMHB 2ZW1A 3AEBB 3V6EB 1VJKA 4GB9A 4YTPB 1WGHA 2L8JA 3B2FA 4ANWA 2VZKB 1HXYD 4M8NA 2WGSA 1LGRA 4M01A 2MBHA 4NAMA 2IZVB 1MHXA 2K8HA 1EWYC 4HXDA 3A9KB 3AE4B 4EE2A 3BVGA 3DBHI 2J53A 4XGAB 1KF6B 2KJRA 4ZYNA 3PSEB 4NAWA 2NVUI 4ZRPA 1FXAA 2KTFA 4LNOA 2KVZA 3IAM1 1OQRA 2WLBA 3ZJUA 1YN5A 2K39A 2Q5WD 2IGGA 4USAA 3JSVA 1YQ3B 3I57A 2G9HD 2RDGA 2AX5A 3C8YA 1WXAA 4II3B 2QJLA 1K50A 1U4AA 3TBLD 4DHZB 3B1LX 5FKAC 4NJ6A 5C2TB 2V3NA 4J3OD 3H7SA 2L0TA 1D4BA 3AM9A 1D6EC 2JPHA 2BGFA 2MX2A 4ITKA 4TV3A 3EC8A 1WFYA 2KWDA 1V86A 2J7QB 5BO4B 3W5UB 1WX8A 1D5ZC 2MW5A 4RM8A 3A1QB 1MHHE 2KWCA 4GMVA 2UU7A 4OZCA 4EEWA 2VZKD 3WCQA 1E5WA 2M19A 3BK1A 2CU3A 3WAPA 2BTEA 4C7ZA 2WWZA 3J9CA 3ZUNA 1V9JA 2ZNVB 2QILA 2HE7A 2WXRA 1D5XC 1XLQA 1T5XD 3L10B 4RCOA 1I4XA 3RNGC 1QKZA 1VCBA 1JQ4A 5AEKB 4RGOS 1V2YA 1T6BX 3UIOB 2KX0A 3IFWB 3IAS1 2J4XA 1LFDA 2DZJA 1ZE3D 1TKEA 4HK2A
chains in the Genus database with same CATH topology
3BVZA 5FK9C 2J42A 4KGTA 4MT5A 1VDVA 2JQRB 5TSSA 2JX5A 1FXIA 4IOIE 3ZQ4A 5FR3A 5BMHA 1C77A 2WXJA 1WGKA 4WURA 2L52A 1TS5A 1HZ6A 2KQ4X 1PYWD 2ZW0A 3EA6A 3N9YC 3VRBB 1SF0A 1QLBB 3VQIA 2G1EA 3KLSX 2EKIA 1PFDA 1TS4A 2IDYA 3OWEB 2V4IB 1P7FA 4KX6B 3ZJTA 2BYTA 5EE1A 2IGHA 1DOIA 1SB3C 1QOAA 4A90A 2PVOD 1XO3A 1ET6A 3HRDD 2WXGA 4NAWB 3KWLA 4A55A 1HEZE 4HEA1 1N63A 2K22A 1XLPA 1CK1A 3TEXA 1NEKB 3UI3A 4A8XC 1UGJA 1TKGA 5BYRA 2K0PA 1I4QA 1L6VA 1V1PB 1TZOA 2IPKD 2QMTA 3E56A 1XF5L 1JWSD 3NVWA 4JWUC 1STEA 4LK0M 1QF6A 1ROEA 1RM6C 3T3NA 4YSYB 3ZGZA 2HDEA 3Q8CA 5AUKA 2DBYA 3P1MA 5JXVA 2K5PA 2CJNA 2J52A 2ONQA 2MH7A 2IJ0A 3B2GA 1IBXA 4RGTA 1OFFA 1TKYA 1N5XA 4Q2JA 3BK2A 1ZXHA 4KGRA 1JCKB 4MH8A 3URYA 3DWMA 1UUPA 2X38A 4YWGG 1JRPA 1JROA 1V1OA 2WDQB 3VR9B 3GP7A 1DOYA 2AQ1B 4TMAB 2I38A 2PKOA 1UWXA 4DXFA 3AE1B 1E7PB 1C4AA 1EU3A 2MJEA 3Q8FA 3T3OA 1TYGB 3LXFA 1FIQA 4RNAA 3Q8AA 2NTTA 3LYYA 1KLGD 2RMMA 2MEKA 1EM7A 1QILA 3BZDB 2WXHA 2BS4B 3NVVA 2JYTA 2YEPF 3AECB 3P4RB 1JW9D 1XXGA 3P63A 3NZ3A 2PIAA 1K52A 2WXIA 1QOGA 1E10A 1FNWA 2LGIA 1F2RI 2K9XA 2Y3AA 3FILA 2I2YA 1N60A 2W82A 3V05A 3U2SC 1SBBB 3PO0A 3W5VB 1CZPA 1L4ZB 3ABVB 1NENB 4FXCA 3MC0B 1ENFA 2AQ2B 2W3RA 3Q69A 4JE3B 4US9A 2KN4A 1F77A 2Y5PA 3O13A 2V3PA 2FE8A 2WXQA 1J7CA 3ZYYX 1ZDXA 5D3DA 4US8A 2NTSA 3R2IA 2INNE 3TEZA 4C7YA 2SAKA 2OHFA 2LUMA 1HZ5A 1P7EA 4TSSA 1UNSA 1M4VA 2N7JA 2WDVB 3GB1A 1I4RA 1CJEA 1FFVA 1FRDA 1NYQA 1Q10A 3R2TA 1FEHA 2GB1A 1QOFA 1PUTA 3MHZA 4AQ7A 2AQ3B 2ACZB 1GB4A 1B1ZA 1L0YB 3AE9B 4YSZB 2DYMA 1SE2A 3W1SA 5BMGA 1ZPSA 3TEWA 3NVZA 4HKZE 1FO4A 4XWWA 1NYRA 4KKJA 1SJHD 2K3UA 2H88B 2INPE 1HA5A 1FNVA 1GAQB 3AMZA 2WP9B 2BS3B 1JWMD 1VZ7A 3ZJVA 3HVZA 1C4CA 4WWMA 3AEGB 4RGNA 1VRAB 1IGDA 3BYYB 1QQRA 2LFIA 2BB5A 3CIRB 4HRSA 5EE9A 1SEBD 3IT4B 3L4PA 3B9JA 1BXTA 2MJDA 2WU2B 4N58A 3AH7A 1SE3A 1VLBA 3NRZA 1L5PA 1E9MA 1L6UA 3RFZB 1CQVA 1I4PA 2BB6A 4DQOC 2BS2B 3TUOA 5G5HA 3AE7B 1VR9A 2DLBA 4MM3B 1YJIA 3IT6B 2ICIA 5HI1A 4KGSA 4P6VF 5GXGB 2KACA 4P16A 1R7SA 4IKGA 1E0ZA 3PZ7A 1TJEA 1SE4A 2JSVX 1ET9A 2JZPA 1XCQL 4M0WA 4D2KA 4HKQA 2W54A 1L0VB 4XDDA 5EE3A 2RPVA 2Y5CA 3Q8EA 5HHDG 3NUHB 5T8IA 3FILB 4C56C 4KKIA 1IBXB 1WSPA 2KDMA 1TY2A 3FC4A 2IGDA 4ZHOA 2WXNA 2GI9A 4OZBA 1TY0A 2E3TA 1C78A 1PDXA 1GOZA 5I4DA 4JPSA 1KTKA 4A6QA 1C76A 1XEEA 4UDUC 4GDKB 2WQYB 2WXOA 5D3IB 1FCLA 2KAJA 1ZDVA 1FFUA 3U4EG 4ZYSA 1QOBA 1SSNA 3KQ4A 3BYTB 5H8YE 2R61A 1IGCA 2W55A 3CWIA 4A9AA 1WWTA 4WH4A 5D7GA 1UWMA 3U52E 3AE2B 4ARCA 3GS2A 2PVGC 4YTMB 1FCCC 3IXSA 3R8BA 2E6XA 4JWSC 3TEYA 1YQ4B 1SXTA 3VRAB 4NZLB 5BMIA 1VZ6A 2SEBD 1WYGA 1V8CA 4ZRQA 4WQMA 1DOXA 1LO5D 1J7AA 2V0GA 5AUIA 5HFYA 1TS2A 4XWTA 1N5WA 1KRHA 5C3JB 3HVDA 1TS3A 1YMHE 2XN9C 1NI3A 1A70A 3MP9A 4GDLB 1C9FA 1FNUA 1BUIC 2JU6X 2GRIA 4ZHPA 3KWVA 3SFDB 1I4GA 1DYQA 2D5GA 1JWUD 5BYSA 2L83A 2B76B 1FMAD 1C4PA 2BBCA 2LHEA 2N0SB 4RF0A 2WNMA 4B0MA 4LTUA 1OQQA 1V1PA 1AN8A 2WXLA 2L32A 3AEFB 3BIID 2WXPA 4RH6A 2LMCA 1YN3A 1MI0A 1ESFA 4OZAA 3HUIA 3P42A 3AN1A 1GB1A 4WIPA 2L1AA 1L0XB 3SEBA 1ZP0B 3MFGA 4YTNB 4ARIA 3RPFC 2KMMA 1DGJA 4PT5A 3BVMA 1C79A 4WAFA 1WRIA 3AE6B 1EU4A 3P4QB 1JALA 2M0AA 1AW7A 2QIEB 4XDCA 2ZW1A 3AEBB 3NVYA 1VJKA 4YTPB 1ZUD2 4MACA 1T3QA 2JYEA 3B2FA 5HG2A 2VZKB 4H2AA 1HXYD 5G5GA 4YXDB 2LJIA 1ZXIA 1K53A 1AYFA 1IUEA 4HROA 4RGMA 2JWUA 1K51A 2PLPA 2W3SA 4NAMA 1JWAD 3SR6A 1MHXA 1EWYC 3VR8B 4L2YA 1E6EB 4O1NA 3AE4B 4EE2A 2BT6A 1ACCA 3DWGC 3BVGA 3P4PB 2WXMA 2J53A 4ZOHC 1KLUD 1KH0A 3AE8B 3MJ5A 1B9RA 1KF6B 1EWCA 2DWQA 2ON8A 1N61A 1BMLC 3U7ZA 4ZRPA 1FXAA 3TSSA 2H89B 3IAM1 1OQRA 2WLBA 2LHDA 1XCTL 3ZJUA 1ZOYB 3I9V1 5E6JA 1PGBA 1YN5A 2WU5B 3FAHA 2Q5WD 4AS1A 4GLSC 2IGGA 4USAA 1MVKA 1XLOA 1AWDA 3ETRA 5H92C 4L1BA 1YQ3B 1QT9A 1V97A 2G9HD 3I57A 2RDGA 3AB5A 1VZ8A 1PGAA 2AX5A 3C8YA 4HJGE 1I4HA 4OVZA 2WDRB 2PMVA 2MJ3A 3NS1A 2QJLA 2WS3B 4LLGM 4RF1A 1FD6A 1J7BA 4DXGA 2N9LA 1K50A 1WXQA 1MPEA 1SJED 1FRRA 4N59A 4TQ0A 5FKAC 3V3XA 2PTLA 5C2TB 3P4SB 1I7HA 1PGXA 2RDHA 3AEDB 2V3NA 3AEEB 4J3OD 1F0ZA 1JWBD 4TQ1A 1RFKA 1D4BA 2PW9A 1KFYB 3AM9A 1D6EC 5EE0A 3AE3B 4CQNA 1Y56A 4YT0B 2WXFA 4ITKA 2OEDA 1RWSA 2KWDA 1NVID 4IDIA 3W5UB 4N6EB 1GPXA 5MPOA 2QEJC 2FUG1 1D5ZC 2YEPB 3BWUD 1MHHE 1D5MC 2QSDA 3W2DA 4B0EA 4L23A 1SIJA 4OZCA 3W9CB 2VZKD 3WCQA 3AV8A 2M19A 2HTME 2WXKA 4OW0A 3BK1A 4JX1C 4XE0A 1YN4A 1F2RC 1L4DB 4R3DA 2CU3A 3EGRA 4NJCA 2BTEA 4C7ZA 3J9CA 2N9KA 2BW2A 1JMLA 3LB8C 2Z8LA 3EUB2 2TSSA 1HQRD 1YJJA 2CJOA 2JXTA 2QILA 3AE5B 3PZ8A 2WXRA 1D5XC 2M56B 1XLQA 4OHJA 4REZA 2DYOA 3SFEB 1T5XD 4C80A 4RCOA 1I4XA 1QKZA 2EELA 1JQ4A 2NMQA 2FBWB 3H8HA 1YNTE 1FM0D 4RGOS 1RYJA 1T6BX 2LEKA 4YSXB 5BYQA 1XLNA 3IAS1 2J4XA 3AEAB 1ZE3D 3Q8BA 4RFBA 1TKEA 1N62A 2XNAC 3E9SA 5LNK1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y5P A; 
#chains in the Genus database with same CATH topology
 3IBE A;  2KOX A;  5TSS A;  4P1B C;  1YOV B;  3M95 A;  1FXI A;  2L52 A;  4ZDV A;  3NOB A;  4I6N B;  1PYW D;  1QLB B;  2FUH B;  4HWI B;  2K1F A;  2MBB B;  1R4N I;  2V4I B;  2BYT A;  1H4R A;  2KQS A;  4A90 A;  3N1Z C;  2PVO D;  4NJ7 A;  3HRD D;  4NAW B;  3KWL A;  4A55 A;  1HEZ E;  4HEA 1;  1E8Z A;  3Q14 C;  2K22 A;  4A8X C;  1KM7 A;  2K6D B;  3DBL I;  4HJK A;  4LNK A;  5J17 A;  1NI2 A;  2LRU A;  3KUD B;  3T3N A;  3TIX A;  3ALB A;  2PPH A;  3P1M A;  2K5P A;  2ONQ A;  2ZVN A;  2IJ0 A;  1IPG A;  3B2G A;  3ML8 A;  4F7Z A;  2LGS A;  4ICV A;  3IVF A;  4W9C A;  1JCK B;  3DWM A;  1V1O A;  2K8B A;  1DOY A;  3ECI A;  4IM0 A;  2KFK A;  1OEY J;  1C4A A;  2MJE A;  2NPT A;  4EFO A;  5DPS A;  4LJO B;  1XT9 B;  2RMM A;  2MLB A;  2N7D A;  3NVV A;  2JYT A;  3P4R B;  1XXG A;  3WAM A;  5KHQ A;  1WJ6 A;  2WX1 A;  2Y5B B;  2D3B A;  3OAW A;  4A3O A;  4AUQ C;  3U2S C;  1SBB B;  3Q3O C;  1UGM A;  3SDL C;  1CZP A;  3ABV B;  4M0W B;  3MC0 B;  2AQ2 B;  3Q69 A;  4US9 A;  4AJY B;  1WXS A;  2V3P A;  2FE8 A;  1J7C A;  3HM3 A;  2KFJ A;  2FID A;  2INC C;  3I63 C;  3R2I A;  1ZGU B;  3ZNG C;  2OHF A;  2LUM A;  2L05 A;  3V60 A;  4W9J A;  3DVN V;  3RNE C;  1FRD A;  3R2T A;  2FNJ B;  2AL3 A;  1QOF A;  2AQ3 B;  4IUM B;  1IP9 A;  2BF8 B;  3PTF C;  2G4D B;  2N1V A;  2Z59 B;  2I1K A;  3AXC A;  4JL9 A;  2BYE A;  2ZJD A;  1RLF A;  4MM3 A;  1JWM D;  3VTW A;  3ZJV A;  3L0W B;  1C4C A;  4WWM A;  5HKH A;  3UQA A;  1IGD A;  4HDO A;  4ANU A;  1LQB A;  4F1S A;  2BB5 A;  4C00 A;  2OJR A;  5EE9 A;  1FXT B;  3M63 B;  2KQ7 A;  1BXT A;  2WU2 B;  3AH7 A;  4AP4 C;  1VLB A;  2GBK A;  2ZPN A;  3NRZ A;  1L5P A;  4AWJ A;  3A4R A;  3QJZ A;  2BYV E;  2D11 A;  2I1J A;  1WZ0 A;  5HI1 A;  3KH0 A;  2KAC A;  2IO0 B;  1E0Z A;  3A9J A;  1TJE A;  1SE4 A;  2JZP A;  2WX0 A;  2O6V B;  4D2K A;  2D3A A;  2DZI A;  2W54 A;  4XDD A;  2BVC A;  2RPV A;  1T0Q C;  4KDI C;  3ZDM C;  2N9P C;  4W9L A;  1WSP A;  3HIZ A;  2KDM A;  2AWT A;  3FC4 A;  4ZHO A;  1TY0 A;  2E3T A;  4KV2 A;  4MDK E;  4JPS A;  1KTK A;  4J6I A;  4A6Q A;  3C19 A;  5KHO A;  1C76 A;  1XEE A;  4UDU C;  3Q2A C;  3RT3 B;  4FHK A;  4ZRJ A;  2NPT B;  1G6J A;  5E6N A;  1D3Z A;  3U4E G;  1SSN A;  3BYT B;  2MBE A;  2R61 A;  4K1R B;  2M4N A;  5DPR A;  2JXX A;  1HTO A;  4WH4 A;  1UWM A;  3APF A;  3AE2 B;  2LWP A;  2PVG C;  2ASQ A;  1UBI A;  4YTM B;  1FCC C;  2ZCC A;  4WWN A;  2E6X A;  3VRA B;  3DPD A;  1MJD A;  5BMI A;  2SEB D;  3ZDT A;  1GC7 A;  5HFY A;  4EZK A;  4XWT A;  2EKE C;  1N5W A;  1YMH E;  4BKS A;  4GDL B;  2XN9 C;  3ZRF A;  3PLU A;  3PRP B;  3SFD B;  1YX6 B;  1C4P A;  2LHE A;  2IO1 B;  3ZNH B;  2WXP A;  1E8X A;  1ESF A;  3HUI A;  4WIP A;  2R2Q A;  2LXC A;  1HE8 A;  1ZP0 B;  2KMM A;  1DGJ A;  4PT5 A;  5AZG A;  3MJW A;  1EU4 A;  1AW7 A;  4NQL B;  4XYC A;  2GBM A;  2VH1 A;  2ZCB A;  2DAJ A;  3FKY A;  4DHZ E;  1K53 A;  1AYF A;  5IO9 A;  4MJS A;  2JWU A;  2PLP A;  2B3A A;  1JWA D;  5E6P A;  2BT6 A;  5C23 A;  3HHM A;  3DWG C;  3PHW B;  1KLU D;  3AE8 B;  1EWC A;  2DWQ A;  1BML C;  2DZM A;  3U7Z A;  3NJT A;  3TSS A;  1E90 A;  2HTH A;  2KDE B;  1E7V A;  1PGB A;  4AS1 A;  2JF5 A;  5D2M B;  4DHJ B;  1XLO A;  1QT9 A;  3ENE A;  2L76 A;  1OTR B;  4ICU A;  2D2Q A;  1PGA A;  4HJG E;  2WDR B;  4WJP A;  1E8Y A;  2PMV A;  3NS1 A;  3B0A A;  2GLS A;  2WS3 B;  5IKC M;  3APC A;  1J7B A;  3N1Y C;  1WXQ A;  1MPE A;  2JRH A;  4TQ0 A;  4N59 A;  3VTV A;  1YIW A;  3P4S B;  2RDH A;  3PZD A;  1F0Z A;  5E6O A;  1JWB D;  1KFY B;  1WX7 A;  2GBJ A;  2CS4 A;  2KMC A;  3AE3 B;  3WAL A;  2CKH B;  1SE9 A;  2FCQ A;  2IND C;  2KDB A;  4HPM B;  2WXF A;  2GBR A;  4DK5 A;  4PYZ A;  2N4F A;  4EZL A;  1NVI D;  4N6E B;  2QEJ C;  3BWU D;  3RNA C;  4S0R A;  1VD2 A;  2HJ1 A;  1SIJ A;  3AV8 A;  3A4S C;  2WXK A;  2MWS B;  3A33 B;  3H6N A;  5J18 A;  4W9H A;  2MQJ A;  2MHJ A;  4XE0 A;  5DPT A;  1F2R C;  1GUA B;  4MJS B;  4R3D A;  3M62 B;  4B6W A;  2AYO B;  4GDL A;  1EUV B;  1JML A;  3EUB 2;  2TSS A;  2RSU A;  4LNN A;  1KLV A;  3DHH C;  4BZA A;  1WM3 A;  4BVU C;  2BWE S;  2JWZ A;  1XD3 B;  2C7H A;  4FJV B;  2LEK A;  5BYQ A;  2LAS A;  3Q8B A;  1F52 A;  1N62 A;  2XNA C;  3E9S A;  4NPN A;  3JW0 X;  5FK9 C;  2J42 A;  4KGT A;  4GDK A;  4MT5 A;  3V62 A;  1VDV A;  1FPY A;  2JQR B;  2C5L C;  2V4L A;  3OLM D;  3V6C B;  3RUI B;  1C77 A;  2J0J A;  4FUL A;  3R3M A;  3QWZ B;  2KQ4 X;  3EA6 A;  2KXJ A;  3KLS X;  1PFD A;  3EFU A;  2IDY A;  3OWE B;  1P7F A;  4HLE A;  1V81 A;  4KX6 B;  2IO3 B;  1SB3 C;  1QOA A;  2LUE A;  2O6V A;  5JHB A;  1XO3 A;  1ET6 A;  4FBJ B;  5D94 A;  1XLP A;  4PK1 A;  1UGJ A;  3TMP B;  1I4Q A;  1L6V A;  2R2O A;  1UBQ A;  2FCM A;  4LK0 M;  3TL5 A;  1QF6 A;  4B9K A;  3NZS A;  3H9D A;  3SU8 X;  1RM6 C;  4YSY B;  3ZGZ A;  1R4N B;  3Q8C A;  1WXM A;  4BFR A;  5AUK A;  4BBN C;  2MP2 A;  3RNF C;  2MH7 A;  3R66 C;  2FIF A;  4RGT A;  1OFF A;  4Q2J A;  3BK2 A;  1ZXH A;  4KGR A;  3URY A;  4YWG G;  1JRP A;  3GP7 A;  3IHP C;  1WGD A;  2AQ1 B;  4WJQ A;  3DBL B;  4OVV A;  3AE1 B;  3D32 A;  1S1Q B;  3KYD D;  2GOW A;  3LXF A;  4RNA A;  3Q8A A;  1RRB A;  1EM7 A;  2WXH A;  1Q0W B;  2YEP F;  1ZW7 A;  2LVO A;  2PIA A;  4NQK E;  3CMM B;  1FNW A;  2K9X A;  3V05 A;  3PO0 A;  2V1Y A;  3W5V B;  4DDG D;  1GG3 A;  3Q3N C;  4FXC A;  2DZK A;  4PS7 A;  4MGI E;  1Z2M A;  1ZDX A;  3SD5 A;  3VVW B;  1WR6 E;  2RR9 A;  4IM2 A;  2PE9 A;  4EUT A;  3RI7 C;  3TEZ A;  2SAK A;  2BYF A;  1HZ5 A;  1P7E A;  2MCN B;  2CHZ A;  4TSS A;  3IG3 A;  2N7J A;  4A3P A;  2WDV B;  3GB1 A;  1FFV A;  3PT2 B;  1WH3 A;  4LNI A;  2Z0E B;  2GB1 A;  1UZX B;  4FAD A;  2N9E B;  1GB4 A;  2K25 A;  3PPA A;  2G45 B;  2DYM A;  3EHV A;  3K9P B;  3Q3J A;  3TEW A;  2D07 B;  4HKZ E;  2REX A;  1SJH D;  2K3U A;  2C7M B;  2LRW A;  3QHT A;  4IG7 B;  5IN7 A;  1WM2 A;  5L95 C;  4YL8 A;  1VRA B;  3VXW A;  3BYY B;  3DBR I;  2LFI A;  3CF6 E;  4HRS A;  4WWP A;  1CMX B;  1SEB D;  4XZ4 A;  4OVU A;  3IT4 B;  3RNB C;  3L4P A;  3CST A;  4LDT B;  4BKS D;  2JRI B;  1WJN A;  2KJ6 A;  4DQO C;  3Q3F A;  1YJI A;  4GIV A;  3VH3 B;  4MEL A;  4P6V F;  2JVC A;  5GXG B;  1BT0 A;  3W1S C;  4P16 A;  1K8R B;  4IKG A;  3PGE A;  3PLV A;  1ET9 A;  3N20 C;  1L0V B;  5HHD G;  3Q8E A;  3M3J A;  3WA0 A;  5T8I A;  3FIL B;  3QIJ A;  4QAY A;  1IBX B;  4IWO A;  2IGD A;  4OZB A;  4URK A;  5J2R A;  2ZZP B;  1C1Y B;  1GOZ A;  2O6V D;  1V80 A;  2KC1 A;  4BOS C;  4GDK B;  3S2A A;  5LXI B;  1E8W A;  5D3I B;  2VRR B;  1QOB A;  1T0Y A;  2ZEQ A;  3GS2 A;  3HK0 A;  3IXS A;  4JWS C;  1YQ4 B;  1SXT A;  2JUO A;  3C0R B;  2XK5 A;  1DOX A;  2V0G A;  2OJW A;  5AUI A;  1KRH A;  5JHA A;  3HVD A;  1TS3 A;  2X8X X;  1NI3 A;  1TT5 B;  3QA8 A;  1DYQ A;  2L83 A;  1TIF A;  3BIN A;  2A5U A;  2C9W B;  1TZ1 A;  2KWV B;  2N0S B;  3N30 A;  2HJ8 A;  1OQQ A;  1V1P A;  3RN9 C;  2WXL A;  2L32 A;  3AEF B;  2MBO A;  4G3X B;  1MI0 A;  3ZIM A;  1WIA A;  3PRE A;  4EKU A;  1GB1 A;  3KW5 B;  4KIK B;  2L1A A;  4JIO U;  4KZC A;  4DHJ D;  3MFG A;  3RPF C;  3BVM A;  1C79 A;  3P4Q B;  1JAL A;  2M0A A;  2QIE B;  2YVC A;  1GNU A;  4MH0 E;  3MHS D;  2MP2 B;  2C7N B;  4MAC A;  4M00 A;  1T3Q A;  1GC6 A;  1WXV A;  5G5G A;  4RGM A;  1ZXI A;  1IUE A;  1K51 A;  2BWF A;  4FA6 A;  3VR8 B;  4O1N A;  2VH2 A;  2ZVO A;  3MC9 A;  3P4P B;  4GU2 A;  4ZOH C;  2PEA A;  1KH0 A;  1B9R A;  4WAA A;  1UEL A;  3JSV B;  1P0R A;  2ON8 A;  1N61 A;  2D10 A;  3UIP B;  3RZW C;  3L16 A;  3I5J C;  3JYU A;  1XCT L;  1ZOY B;  3I9V 1;  3DDC B;  3FAH A;  4GLS C;  2C60 A;  1MVK A;  3VH4 B;  1AWD A;  3ETR A;  5H92 C;  4ZRI A;  4EOY A;  1V97 A;  3AB5 A;  2NCN A;  1I4H A;  4OVZ A;  3A9K A;  1WX9 A;  2MJ3 A;  2QHO A;  4C4V B;  4LLG M;  5D6J B;  4RF1 A;  4HDQ A;  4DXG A;  2N9L A;  1SJE D;  1FRR A;  4HPP A;  1I7H A;  3AED B;  2EMS A;  4TQ1 A;  1UF0 A;  5JH5 C;  5EE0 A;  4CQN A;  4YT0 B;  2L7R A;  4LNF A;  4KZ0 A;  4IDI A;  4E74 A;  2FUG 1;  3ZVV A;  2FCS A;  2QSD A;  3W2D A;  1P1A A;  1J0G A;  3RCZ A;  3RNC C;  3VAW A;  3W9C B;  2M0X A;  2HTM E;  4JX1 C;  4NJC A;  4W9I A;  5EDS A;  4LDT D;  2BW2 A;  4HPL B;  1WJU A;  2Z8L A;  1KOT A;  2AEH A;  1YJJ A;  2JXT A;  3AE5 B;  2DYO A;  4BKG A;  3GOE A;  4C80 A;  2QDF A;  2IY0 B;  2EEL A;  2NMQ A;  2FBW B;  2V9H A;  1YNT E;  3H8H A;  4P7I A;  1RYJ A;  1WZ3 A;  5C1Z A;  2BPS A;  1RFA A;  1XLN A;  4PS8 A;  2O2V B;  2NBW B;  4BAX A;  3LB8 C;  5LNK 1;  3BVZ A;  2LVP A;  2UYZ B;  2JX5 A;  4IOI E;  3ZQ4 A;  5BMH A;  2M17 A;  2BQQ A;  1WGK A;  3LJ3 A;  2ZW0 A;  2G1E A;  1WYW B;  4XC2 A;  1TS4 A;  2NBV B;  4NNJ B;  3K9O B;  3ZJT A;  5EE1 A;  2IGH A;  1DOI A;  3RUL A;  4HVB A;  4KIK A;  4M02 A;  1N63 A;  4ASW C;  3TEX A;  1TKG A;  2K0P A;  1V1P B;  3E56 A;  1JWS D;  3ONS A;  1STE A;  3MC8 A;  1NDD A;  3RYT A;  1ROE A;  4KSL C;  4CHK A;  1QZE A;  2HDE A;  3DBH B;  1V5O A;  3DVN U;  2DBY A;  2LI5 A;  5JXV A;  2RD0 A;  4ANV A;  2CJN A;  2J52 A;  2KC2 A;  4LCD E;  1N5X A;  2LD9 A;  2X38 A;  5CHF A;  1YJ1 A;  5LXH A;  2EMT A;  4MSQ B;  4GN1 A;  3T8M A;  4DXF A;  3AU5 A;  1E7P B;  1EU3 A;  1WRD B;  1WF9 A;  3Q8F A;  1L7Y A;  3T3O A;  1FIQ A;  1J8C A;  1UD7 A;  4HCP B;  1P9D U;  2NTT A;  3BY4 B;  1KLG D;  3LYY A;  2KHW B;  2BS4 B;  4GXB A;  3DQV A;  3N3K B;  3L08 A;  1V5T A;  1JW9 D;  3VDZ A;  3NZ3 A;  1SGH A;  4JGH B;  4MSM B;  2LGI A;  1WE6 A;  4G0N B;  1OGW A;  1N60 A;  2W82 A;  3PVL A;  1NEN B;  3O65 B;  2W3R A;  4JE3 B;  1F77 A;  3N1X C;  2WXQ A;  3R7Q A;  2J0M A;  4US8 A;  3PV1 A;  2NTS A;  1NBF C;  3PS6 A;  3WIM A;  3TJP A;  1UNS A;  4TUU A;  1Q10 A;  1NYQ A;  2WDT B;  4CO7 A;  1WY8 A;  1FEH A;  5CHW A;  1Y8R C;  2ACZ B;  3QC8 B;  1A5R A;  1B1Z A;  1L0Y B;  3AE9 B;  4YSZ B;  5IA7 A;  2KJH B;  1SE2 A;  1ZPS A;  3DVG X;  2PE6 B;  4JLC A;  1NYR A;  3A9J B;  4KKJ A;  5G2N A;  2NR2 A;  1YX5 B;  1Q5W B;  3HVZ A;  3AEG B;  4KDL B;  4RGN A;  5IP4 D;  2KZR A;  3B08 A;  4KSK C;  3B9J A;  5LLI A;  4FJZ A;  1E9M A;  1CQV A;  2N9X A;  2BS2 B;  1WJ4 A;  1TTN A;  2LJ5 A;  4HCN B;  5G5H A;  3AE7 B;  4MM3 B;  2DLB A;  1Z5S B;  2ICI A;  2MBQ A;  3WAN A;  4KGS A;  3VTU A;  3VUX A;  4RM9 A;  3PZ7 A;  5AZF A;  2JSV X;  5IOI A;  4HKQ A;  5EE3 A;  2Y5C A;  4KVG B;  4KKI A;  3X23 A;  2WXN A;  1PDX A;  5I4D A;  3GZN B;  2YLM A;  1L2N A;  3L13 A;  3OG5 A;  2WXO A;  1FCL A;  2KAJ A;  3DBR B;  3U7D A;  5JZE B;  1ZDV A;  4W9K A;  3KQ4 A;  5CHV C;  1IGC A;  5AZH A;  2W55 A;  3EFC A;  4A9A A;  3QAR A;  2CHW A;  2FCN A;  4NZL B;  3UGB B;  2D3G A;  1LO5 D;  1H8C A;  4K7S A;  4K3C A;  2LGX A;  5C3J B;  3MP9 A;  1FNU A;  1BUI C;  2BKR B;  2JU6 X;  3KWV A;  1I4G A;  2D5G A;  2CHX A;  5BYS A;  3OJ3 A;  4AOF A;  2BBC A;  4MEM A;  2NBU A;  2O2V A;  1AN8 A;  4RH6 A;  4K3B A;  2MSE D;  2LMC A;  2KLG A;  3P42 A;  2KK8 A;  5CTR C;  3QK0 A;  3SEB A;  3DHG C;  3N32 A;  4ARI A;  2KT7 A;  3GZN I;  4WAF A;  1WRI A;  3AE6 B;  1T0R C;  1UH6 A;  4XDC A;  1SIF A;  3NVY A;  5CX3 A;  3KUC B;  1ZUD 2;  2JYE A;  5FR6 A;  5HG2 A;  4H2A A;  2W9N A;  4YXD B;  4HRO A;  2LJI A;  3ZTD A;  1MG4 A;  3SR6 A;  2W3S A;  4IWP A;  4WQO B;  4L2Y A;  1E6E B;  1PQS A;  1ACC A;  2WXM A;  3MJ5 A;  2M8S A;  4RMA A;  2GBN A;  2DEN B;  2H89 B;  2LHD A;  1F1H A;  3QAQ A;  2KTR A;  5E6J A;  2WU5 B;  1Q1O A;  3NG0 A;  4WJO A;  4PYU A;  4L1B A;  3UIN B;  2D3C A;  1WGY A;  1F9J A;  3PRZ A;  1VZ8 A;  2RGF A;  3Q3M C;  2CU1 A;  1FD6 A;  3T9L A;  1I42 A;  2KKC A;  3V3X A;  2PTL A;  1N6Z A;  1PGX A;  4X57 B;  3AEE B;  2JY6 A;  3R7R A;  1C3T A;  1RFK A;  4MGK E;  2JZ3 B;  2PW9 A;  1IYF A;  3DBS A;  1Y56 A;  2KLC A;  2KTR B;  1MG8 A;  2IYD B;  4IC7 B;  2JT4 B;  1RWS A;  2OED A;  2IBI B;  1GPX A;  5MPO A;  2YEP B;  4FLH A;  1D5M C;  4XX5 A;  4B0E A;  4L23 A;  1OEY A;  3UQB A;  3VUY A;  2J0K A;  4OW0 A;  3AUL A;  3PRM B;  1YN4 A;  1LM8 B;  1L4D B;  4M8M A;  3EGR A;  2KYW A;  4P1C C;  4C4V A;  3JVZ X;  3P2B A;  2UWQ A;  2N9K A;  3QCA A;  2G3Q B;  2LGD A;  4N9F 4;  3A1Q A;  1HQR D;  2CJO A;  1P3Q U;  3OJ4 B;  3PZ8 A;  2M56 B;  4OHJ A;  4REZ A;  3SFE B;  4PS3 A;  1LXD A;  2KX3 A;  1FM0 D;  3VHT C;  3CSF A;  4TKN A;  3AU4 A;  2MA9 B;  4YSX B;  4W9G A;  3AEA B;  4DDI D;  4RFB A;  4K7U A;  2WHI A;  3GE8 C;  2IO2 B;  5FR3 A;  1OQY A;  2WXJ A;  4WUR A;  1TS5 A;  1HZ6 A;  2DAF A;  3N9Y C;  3RMK C;  3VRB B;  4B95 A;  1SF0 A;  3VQI A;  2XK5 B;  1I35 A;  4AJW A;  5G55 A;  3DCG A;  2EKI A;  2WYQ A;  3NZU A;  1XQQ A;  2KNB A;  2GMI C;  2Z0D B;  2WXG A;  3VUW A;  3ML9 A;  1CK1 A;  1NEK B;  3UI3 A;  4GOC A;  5BYR A;  4MGZ E;  2IPK D;  1TZO A;  2LVQ A;  2QMT A;  3QX1 A;  1XF5 L;  3NVW A;  1YQB A;  4JWU C;  1YD8 U;  4E71 A;  3I3T B;  2IY1 B;  3KYC D;  3RD2 A;  3WAO A;  1HTQ A;  1WMH A;  2N7E A;  3U8Z A;  4G50 A;  1IBX A;  1TKY A;  2KVR A;  2LXA A;  4MH8 A;  1UUP A;  1JRO A;  2WDQ B;  3VR9 B;  1WGR A;  2PJH A;  3NY5 A;  4TMA B;  2CR5 A;  1EF5 A;  2I38 A;  2PKO A;  1UWX A;  2KD0 A;  4IW0 A;  2DHZ A;  3PHX B;  3QQ8 B;  3ZNI D;  1TYG B;  4ZRK A;  3ZKJ C;  2AL6 A;  3GE3 C;  2G4S A;  2MEK A;  2MRP A;  2N1W A;  1QIL A;  3BZD B;  4K81 A;  2KMA A;  4G11 A;  3ZNZ B;  3AEC B;  2L3Z A;  2ZPY A;  3P63 A;  3H1U A;  1K52 A;  4GGQ A;  5L83 A;  2WXI A;  1QOG A;  3ZTC A;  3KUZ A;  1E10 A;  3ZRC A;  2DYB A;  1F2R I;  2Y3A A;  3FIL A;  4BOZ B;  5DPW A;  2LZ6 A;  3U30 A;  2I2Y A;  4W9E A;  4JQW C;  1L4Z B;  1ENF A;  4WWO A;  3V61 A;  2JZZ A;  1V49 A;  1AAR A;  1V6E A;  2KN4 A;  2M1M A;  2Y5P A;  3O13 A;  4ANX A;  1WI0 A;  3ZYY X;  4DBG A;  2NS5 A;  2DNF A;  5D3D A;  4EZJ A;  3DOW A;  3ZO5 B;  4I6L B;  2INN E;  4A20 A;  4C7Y A;  4S17 A;  2K8C A;  4MGY E;  1M4V A;  3ZLZ A;  4K7W A;  5DCN A;  1I4R A;  4FHJ A;  1CJE A;  2LGY A;  2L00 B;  1MFW A;  5IAA C;  1PUT A;  2DX5 B;  3MHZ A;  4AQ7 A;  3ZXV A;  2RDB C;  2KDF B;  3W1S A;  5BMG A;  3NVZ A;  1FO4 A;  4XWW A;  2ZNV C;  1R4M B;  2H88 B;  2INP E;  3RZF A;  1HA5 A;  1FNV A;  1GAQ B;  3AMZ A;  2WP9 B;  2BS3 B;  1VZ7 A;  3SHQ A;  4LJP B;  4NY0 A;  1ISN A;  3W1Y A;  3X0W A;  3H7P A;  2RPQ A;  1QQR A;  4BKT A;  4GSW A;  3CIR B;  1EF1 A;  2QCZ A;  1M94 A;  2HD5 B;  3H7P B;  2MJD A;  1P98 A;  4N58 A;  1SE3 A;  1S3S G;  1WE7 A;  2KWU B;  1L6U A;  3KVF B;  4ACF A;  1I4P A;  3RFZ B;  2BB6 A;  4W9D A;  3TCA A;  3TUO A;  1VR9 A;  3DVG Y;  3IT6 B;  4E3C A;  2L0F A;  1R7S A;  3EEC A;  3DHI C;  3VFK A;  3LDZ E;  1XCQ L;  4M0W A;  1KJT A;  4WJN A;  4IWQ A;  3NUH B;  4C56 C;  3L54 A;  1WR1 A;  1R4M I;  4II2 B;  1T0S C;  1TY2 A;  2GI9 A;  2KAN A;  1C78 A;  1X1M A;  2FAZ A;  1TGZ B;  4W9F A;  3AI5 A;  2XBB C;  2XEW A;  2WQY B;  3UF8 A;  1TBE A;  2QC8 A;  3HM6 X;  1FFU A;  5TR5 A;  4ZYS A;  2KFK B;  5H8Y E;  3MTN B;  3CWI A;  3APD A;  1WWT A;  5D7G A;  3U52 E;  4ARC A;  4DXA B;  4FN2 A;  4CYE A;  3R8B A;  3TEY A;  3ZW3 A;  4I6P A;  3L17 A;  1VZ6 A;  1WYG A;  1V8C A;  4ZRQ A;  4WQM A;  4F8C B;  2OOB B;  1J7A A;  2A4Z A;  1TS2 A;  1WGG A;  1E7U A;  1RAX A;  1A70 A;  1C9F A;  4ZHP A;  3NS8 A;  2GRI A;  2BKF A;  1JWU D;  1EO6 A;  2B76 B;  1GJZ A;  1FMA D;  4RF0 A;  4DWF A;  2WNM A;  4B0M A;  2KN5 A;  4LTU A;  4IM3 A;  3Q6B A;  5GMV A;  3BII D;  1YN3 A;  4OZA A;  2KDI A;  3AN1 A;  2KO3 A;  3NHE B;  4BBN F;  1L0X B;  4YTN B;  3ZXR A;  2V3S A;  1J19 A;  4FJY A;  2K6Q A;  1ZKH A;  1JRU A;  1WMH B;  2ZW1 A;  3AEB B;  3V6E B;  1VJK A;  4GB9 A;  4YTP B;  1WGH A;  2L8J A;  3B2F A;  4ANW A;  2VZK B;  1HXY D;  4M8N A;  2WGS A;  1LGR A;  4M01 A;  2MBH A;  4NAM A;  2IZV B;  1MHX A;  2K8H A;  1EWY C;  4HXD A;  3A9K B;  3AE4 B;  4EE2 A;  3BVG A;  3DBH I;  2J53 A;  4XGA B;  1KF6 B;  2KJR A;  4ZYN A;  3PSE B;  4NAW A;  2NVU I;  4ZRP A;  1FXA A;  2KTF A;  4LNO A;  2KVZ A;  3IAM 1;  1OQR A;  2WLB A;  3ZJU A;  1YN5 A;  2K39 A;  2Q5W D;  2IGG A;  4USA A;  3JSV A;  1YQ3 B;  3I57 A;  2G9H D;  2RDG A;  2AX5 A;  3C8Y A;  1WXA A;  4II3 B;  2QJL A;  1K50 A;  1U4A A;  3TBL D;  4DHZ B;  3B1L X;  5FKA C;  4NJ6 A;  5C2T B;  2V3N A;  4J3O D;  3H7S A;  2L0T A;  1D4B A;  3AM9 A;  1D6E C;  2JPH A;  2BGF A;  2MX2 A;  4ITK A;  4TV3 A;  3EC8 A;  1WFY A;  2KWD A;  1V86 A;  2J7Q B;  5BO4 B;  3W5U B;  1WX8 A;  1D5Z C;  2MW5 A;  4RM8 A;  3A1Q B;  1MHH E;  2KWC A;  4GMV A;  2UU7 A;  4OZC A;  4EEW A;  2VZK D;  3WCQ A;  1E5W A;  2M19 A;  3BK1 A;  2CU3 A;  3WAP A;  2BTE A;  4C7Z A;  2WWZ A;  3J9C A;  3ZUN A;  1V9J A;  2ZNV B;  2QIL A;  2HE7 A;  2WXR A;  1D5X C;  1XLQ A;  1T5X D;  3L10 B;  4RCO A;  1I4X A;  3RNG C;  1QKZ A;  1VCB A;  1JQ4 A;  5AEK B;  4RGO S;  1V2Y A;  1T6B X;  3UIO B;  2KX0 A;  3IFW B;  3IAS 1;  2J4X A;  1LFD A;  2DZJ A;  1ZE3 D;  1TKE A;  4HK2 A; 
#chains in the Genus database with same CATH homology
 3BVZ A;  5FK9 C;  2J42 A;  4KGT A;  4MT5 A;  1VDV A;  2JQR B;  5TSS A;  2JX5 A;  1FXI A;  4IOI E;  3ZQ4 A;  5FR3 A;  5BMH A;  1C77 A;  2WXJ A;  1WGK A;  4WUR A;  2L52 A;  1TS5 A;  1HZ6 A;  2KQ4 X;  1PYW D;  2ZW0 A;  3EA6 A;  3N9Y C;  3VRB B;  1SF0 A;  1QLB B;  3VQI A;  2G1E A;  3KLS X;  2EKI A;  1PFD A;  1TS4 A;  2IDY A;  3OWE B;  2V4I B;  1P7F A;  4KX6 B;  3ZJT A;  2BYT A;  5EE1 A;  2IGH A;  1DOI A;  1SB3 C;  1QOA A;  4A90 A;  2PVO D;  1XO3 A;  1ET6 A;  3HRD D;  2WXG A;  4NAW B;  3KWL A;  4A55 A;  1HEZ E;  4HEA 1;  1N63 A;  2K22 A;  1XLP A;  1CK1 A;  3TEX A;  1NEK B;  3UI3 A;  4A8X C;  1UGJ A;  1TKG A;  5BYR A;  2K0P A;  1I4Q A;  1L6V A;  1V1P B;  1TZO A;  2IPK D;  2QMT A;  3E56 A;  1XF5 L;  1JWS D;  3NVW A;  4JWU C;  1STE A;  4LK0 M;  1QF6 A;  1ROE A;  1RM6 C;  3T3N A;  4YSY B;  3ZGZ A;  2HDE A;  3Q8C A;  5AUK A;  2DBY A;  3P1M A;  5JXV A;  2K5P A;  2CJN A;  2J52 A;  2ONQ A;  2MH7 A;  2IJ0 A;  3B2G A;  1IBX A;  4RGT A;  1OFF A;  1TKY A;  1N5X A;  4Q2J A;  3BK2 A;  1ZXH A;  4KGR A;  1JCK B;  4MH8 A;  3URY A;  3DWM A;  1UUP A;  2X38 A;  4YWG G;  1JRP A;  1JRO A;  1V1O A;  2WDQ B;  3VR9 B;  3GP7 A;  1DOY A;  2AQ1 B;  4TMA B;  2I38 A;  2PKO A;  1UWX A;  4DXF A;  3AE1 B;  1E7P B;  1C4A A;  1EU3 A;  2MJE A;  3Q8F A;  3T3O A;  1TYG B;  3LXF A;  1FIQ A;  4RNA A;  3Q8A A;  2NTT A;  3LYY A;  1KLG D;  2RMM A;  2MEK A;  1EM7 A;  1QIL A;  3BZD B;  2WXH A;  2BS4 B;  3NVV A;  2JYT A;  2YEP F;  3AEC B;  3P4R B;  1JW9 D;  1XXG A;  3P63 A;  3NZ3 A;  2PIA A;  1K52 A;  2WXI A;  1QOG A;  1E10 A;  1FNW A;  2LGI A;  1F2R I;  2K9X A;  2Y3A A;  3FIL A;  2I2Y A;  1N60 A;  2W82 A;  3V05 A;  3U2S C;  1SBB B;  3PO0 A;  3W5V B;  1CZP A;  1L4Z B;  3ABV B;  1NEN B;  4FXC A;  3MC0 B;  1ENF A;  2AQ2 B;  2W3R A;  3Q69 A;  4JE3 B;  4US9 A;  2KN4 A;  1F77 A;  2Y5P A;  3O13 A;  2V3P A;  2FE8 A;  2WXQ A;  1J7C A;  3ZYY X;  1ZDX A;  5D3D A;  4US8 A;  2NTS A;  3R2I A;  2INN E;  3TEZ A;  4C7Y A;  2SAK A;  2OHF A;  2LUM A;  1HZ5 A;  1P7E A;  4TSS A;  1UNS A;  1M4V A;  2N7J A;  2WDV B;  3GB1 A;  1I4R A;  1CJE A;  1FFV A;  1FRD A;  1NYQ A;  1Q10 A;  3R2T A;  1FEH A;  2GB1 A;  1QOF A;  1PUT A;  3MHZ A;  4AQ7 A;  2AQ3 B;  2ACZ B;  1GB4 A;  1B1Z A;  1L0Y B;  3AE9 B;  4YSZ B;  2DYM A;  1SE2 A;  3W1S A;  5BMG A;  1ZPS A;  3TEW A;  3NVZ A;  4HKZ E;  1FO4 A;  4XWW A;  1NYR A;  4KKJ A;  1SJH D;  2K3U A;  2H88 B;  2INP E;  1HA5 A;  1FNV A;  1GAQ B;  3AMZ A;  2WP9 B;  2BS3 B;  1JWM D;  1VZ7 A;  3ZJV A;  3HVZ A;  1C4C A;  4WWM A;  3AEG B;  4RGN A;  1VRA B;  1IGD A;  3BYY B;  1QQR A;  2LFI A;  2BB5 A;  3CIR B;  4HRS A;  5EE9 A;  1SEB D;  3IT4 B;  3L4P A;  3B9J A;  1BXT A;  2MJD A;  2WU2 B;  4N58 A;  3AH7 A;  1SE3 A;  1VLB A;  3NRZ A;  1L5P A;  1E9M A;  1L6U A;  3RFZ B;  1CQV A;  1I4P A;  2BB6 A;  4DQO C;  2BS2 B;  3TUO A;  5G5H A;  3AE7 B;  1VR9 A;  2DLB A;  4MM3 B;  1YJI A;  3IT6 B;  2ICI A;  5HI1 A;  4KGS A;  4P6V F;  5GXG B;  2KAC A;  4P16 A;  1R7S A;  4IKG A;  1E0Z A;  3PZ7 A;  1TJE A;  1SE4 A;  2JSV X;  1ET9 A;  2JZP A;  1XCQ L;  4M0W A;  4D2K A;  4HKQ A;  2W54 A;  1L0V B;  4XDD A;  5EE3 A;  2RPV A;  2Y5C A;  3Q8E A;  5HHD G;  3NUH B;  5T8I A;  3FIL B;  4C56 C;  4KKI A;  1IBX B;  1WSP A;  2KDM A;  1TY2 A;  3FC4 A;  2IGD A;  4ZHO A;  2WXN A;  2GI9 A;  4OZB A;  1TY0 A;  2E3T A;  1C78 A;  1PDX A;  1GOZ A;  5I4D A;  4JPS A;  1KTK A;  4A6Q A;  1C76 A;  1XEE A;  4UDU C;  4GDK B;  2WQY B;  2WXO A;  5D3I B;  1FCL A;  2KAJ A;  1ZDV A;  1FFU A;  3U4E G;  4ZYS A;  1QOB A;  1SSN A;  3KQ4 A;  3BYT B;  5H8Y E;  2R61 A;  1IGC A;  2W55 A;  3CWI A;  4A9A A;  1WWT A;  4WH4 A;  5D7G A;  1UWM A;  3U52 E;  3AE2 B;  4ARC A;  3GS2 A;  2PVG C;  4YTM B;  1FCC C;  3IXS A;  3R8B A;  2E6X A;  4JWS C;  3TEY A;  1YQ4 B;  1SXT A;  3VRA B;  4NZL B;  5BMI A;  1VZ6 A;  2SEB D;  1WYG A;  1V8C A;  4ZRQ A;  4WQM A;  1DOX A;  1LO5 D;  1J7A A;  2V0G A;  5AUI A;  5HFY A;  1TS2 A;  4XWT A;  1N5W A;  1KRH A;  5C3J B;  3HVD A;  1TS3 A;  1YMH E;  2XN9 C;  1NI3 A;  1A70 A;  3MP9 A;  4GDL B;  1C9F A;  1FNU A;  1BUI C;  2JU6 X;  2GRI A;  4ZHP A;  3KWV A;  3SFD B;  1I4G A;  1DYQ A;  2D5G A;  1JWU D;  5BYS A;  2L83 A;  2B76 B;  1FMA D;  1C4P A;  2BBC A;  2LHE A;  2N0S B;  4RF0 A;  2WNM A;  4B0M A;  4LTU A;  1OQQ A;  1V1P A;  1AN8 A;  2WXL A;  2L32 A;  3AEF B;  3BII D;  2WXP A;  4RH6 A;  2LMC A;  1YN3 A;  1MI0 A;  1ESF A;  4OZA A;  3HUI A;  3P42 A;  3AN1 A;  1GB1 A;  4WIP A;  2L1A A;  1L0X B;  3SEB A;  1ZP0 B;  3MFG A;  4YTN B;  4ARI A;  3RPF C;  2KMM A;  1DGJ A;  4PT5 A;  3BVM A;  1C79 A;  4WAF A;  1WRI A;  3AE6 B;  1EU4 A;  3P4Q B;  1JAL A;  2M0A A;  1AW7 A;  2QIE B;  4XDC A;  2ZW1 A;  3AEB B;  3NVY A;  1VJK A;  4YTP B;  1ZUD 2;  4MAC A;  1T3Q A;  2JYE A;  3B2F A;  5HG2 A;  2VZK B;  4H2A A;  1HXY D;  5G5G A;  4YXD B;  2LJI A;  1ZXI A;  1K53 A;  1AYF A;  1IUE A;  4HRO A;  4RGM A;  2JWU A;  1K51 A;  2PLP A;  2W3S A;  4NAM A;  1JWA D;  3SR6 A;  1MHX A;  1EWY C;  3VR8 B;  4L2Y A;  1E6E B;  4O1N A;  3AE4 B;  4EE2 A;  2BT6 A;  1ACC A;  3DWG C;  3BVG A;  3P4P B;  2WXM A;  2J53 A;  4ZOH C;  1KLU D;  1KH0 A;  3AE8 B;  3MJ5 A;  1B9R A;  1KF6 B;  1EWC A;  2DWQ A;  2ON8 A;  1N61 A;  1BML C;  3U7Z A;  4ZRP A;  1FXA A;  3TSS A;  2H89 B;  3IAM 1;  1OQR A;  2WLB A;  2LHD A;  1XCT L;  3ZJU A;  1ZOY B;  3I9V 1;  5E6J A;  1PGB A;  1YN5 A;  2WU5 B;  3FAH A;  2Q5W D;  4AS1 A;  4GLS C;  2IGG A;  4USA A;  1MVK A;  1XLO A;  1AWD A;  3ETR A;  5H92 C;  4L1B A;  1YQ3 B;  1QT9 A;  1V97 A;  2G9H D;  3I57 A;  2RDG A;  3AB5 A;  1VZ8 A;  1PGA A;  2AX5 A;  3C8Y A;  4HJG E;  1I4H A;  4OVZ A;  2WDR B;  2PMV A;  2MJ3 A;  3NS1 A;  2QJL A;  2WS3 B;  4LLG M;  4RF1 A;  1FD6 A;  1J7B A;  4DXG A;  2N9L A;  1K50 A;  1WXQ A;  1MPE A;  1SJE D;  1FRR A;  4N59 A;  4TQ0 A;  5FKA C;  3V3X A;  2PTL A;  5C2T B;  3P4S B;  1I7H A;  1PGX A;  2RDH A;  3AED B;  2V3N A;  3AEE B;  4J3O D;  1F0Z A;  1JWB D;  4TQ1 A;  1RFK A;  1D4B A;  2PW9 A;  1KFY B;  3AM9 A;  1D6E C;  5EE0 A;  3AE3 B;  4CQN A;  1Y56 A;  4YT0 B;  2WXF A;  4ITK A;  2OED A;  1RWS A;  2KWD A;  1NVI D;  4IDI A;  3W5U B;  4N6E B;  1GPX A;  5MPO A;  2QEJ C;  2FUG 1;  1D5Z C;  2YEP B;  3BWU D;  1MHH E;  1D5M C;  2QSD A;  3W2D A;  4B0E A;  4L23 A;  1SIJ A;  4OZC A;  3W9C B;  2VZK D;  3WCQ A;  3AV8 A;  2M19 A;  2HTM E;  2WXK A;  4OW0 A;  3BK1 A;  4JX1 C;  4XE0 A;  1YN4 A;  1F2R C;  1L4D B;  4R3D A;  2CU3 A;  3EGR A;  4NJC A;  2BTE A;  4C7Z A;  3J9C A;  2N9K A;  2BW2 A;  1JML A;  3LB8 C;  2Z8L A;  3EUB 2;  2TSS A;  1HQR D;  1YJJ A;  2CJO A;  2JXT A;  2QIL A;  3AE5 B;  3PZ8 A;  2WXR A;  1D5X C;  2M56 B;  1XLQ A;  4OHJ A;  4REZ A;  2DYO A;  3SFE B;  1T5X D;  4C80 A;  4RCO A;  1I4X A;  1QKZ A;  2EEL A;  1JQ4 A;  2NMQ A;  2FBW B;  3H8H A;  1YNT E;  1FM0 D;  4RGO S;  1RYJ A;  1T6B X;  2LEK A;  4YSX B;  5BYQ A;  1XLN A;  3IAS 1;  2J4X A;  3AEA B;  1ZE3 D;  3Q8B A;  4RFB A;  1TKE A;  1N62 A;  2XNA C;  3E9S A;  5LNK 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...