2Y5PA

B-repeat of listeria monocytogenes inlb (internalin b)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
72
structure length
72
Chain Sequence
MVYTVSYDVDGTVIKTKVEAGTRITAPKPPTKQGYVFKGWYTEKNGGHEWNFNTDYMSGNDFTLYAVFKAET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords INTERNALIN B
publication title Fold and Function of the Inlb B-Repeat.
pubmed doi rcsb
source organism Listeria monocytogenes egd
total genus 11
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.660 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2y5pA00
2Y5PA
chains in the Genus database with same CATH superfamily
5J18A 2LI5A 4DBGA 4PT5A 4REZA 4C7YA 1SE2A 3JW0X 4MH8A 5AZGA 1OGWA 3HUIA 3RN9C 4BKGA 3R66C 4B0MA 3RMKC 2GRIA 3B1LX 3ETRA 1WGRA 1TKYA 4G11A 2YEPF 3HK0A 4C4VB 3AE8B 3VUXA 1XD3B 3MJWA 5FK9C 3GOEA 3X0WA 1T0SC 2G4SA 3APCA 3ZXVA 3E56A 3NVZA 4RF0A 3DBRB 4W9LA 3PSEB 2KACA 3N30A 3PLVA 3R2IA 1FNWA 1KLGD 3P4PB 1FEHA 3P42A 3RNGC 1MVKA 5TR5A 2G4DB 2D3BA 4FJYA 3W1YA 2Y5CA 4WWOA 3ONSA 3ZQ4A 3UQAA 2HDEA 4J6IA 1MPEA 5IOIA 2KJHB 3BYYB 2NBWB 4HCPB 1EO6A 2KMAA 4MGKE 4EZLA 3HM3A 2RDBC 4WAAA 4M8MA 3AE9B 5AUKA 1AW7A 1XF5L 3R7RA 4NJ7A 1IGDA 1Q10A 1AYFA 1V6EA 2FBWB 5D94A 1I7HA 4GGQA 3R7QA 2DZJA 1YJJA 2FCSA 5KHOA 4IUMB 3SFEB 4MH0E 5FR6A 3QX1A 3PZ8A 1FXIA 4A90A 3ZJUA 3PLUA 2KMMA 5AEKB 3LYYA 3ABVB 3AE3B 2BVCA 4GSWA 2DX5B 3EECA 4GOCA 4W9CA 1E5WA 2HD5B 5HHDG 4GN1A 2QIEB 3PRZA 1C4AA 2JSVX 1NYRA 2XBBC 1E0ZA 5JZEB 1QT9A 1L0XB 3WAPA 5G2NA 2JVCA 4XYCA 1NYQA 1T5XD 2LJIA 1J0GA 2ZVOA 2K6QA 4LLGM 1KH0A 3OJ3A 3IAS1 3VQIA 2JZ3B 4XWWA 1V5OA 3ENEA 3HVZA 3PHWB 1I4PA 2M19A 1FPYA 2G45B 2KAJA 4L2YA 4FBJB 1JMLA 1HZ6A 2WXKA 1UWMA 4BAXA 5CTRC 3L13A 3DOWA 3PVLA 1XEEA 4W9IA 1I4GA 3NVYA 1YIWA 1ACCA 3NG0A 2IYDB 2DYBA 3RD2A 2LVQA 3A9JA 2KHWB 3CIRB 2V4IB 4PS7A 4IM2A 1LQBA 5HI1A 4OW0A 3EGRA 2JU6X 4I6NB 4KZCA 1TY2A 5CHWA 3PGEA 4MT5A 1FM0D 3ZNHB 2MBHA 1YX6B 1SSNA 2C9WB 2NBVB 4USAA 2MA9B 5L83A 5G55A 2ZVNA 2W9NA 2WDQB 3BY4B 5BYQA 3SD5A 3M63B 4JQWC 2INPE 2AEHA 4GMVA 2BYTA 1JWSD 4HXDA 4UDUC 2C60A 2K39A 1TKEA 3P4RB 4WWNA 1ZW7A 4HDOA 2LGIA 4LNKA 3IAM1 3L0WB 2M1MA 3RCZA 2PLPA 3EFUA 4DXGA 2PVOD 2MLBA 5BO4B 1RFAA 1TT5B 1FNUA 3ZGZA 3TBLD 3AU5A 4BKTA 2JPHA 1KLUD 3ZRCA 2PE6B 2ZEQA 1TTNA 2KJRA 3V60A 1L6VA 1L4DB 4WJOA 3CSFA 1WXAA 2VH1A 1IUEA 4FXCA 1H8CA 3WAOA 2INDC 3ZRFA 3T3NA 2WP9B 4EZJA 4RFBA 2BS2B 1WZ3A 3CWIA 1P7EA 2WLBA 1V49A 1MG4A 3Q3MC 2LGDA 4W9GA 1OFFA 4E71A 2BYFA 3TSSA 3V05A 5CX3A 2EMSA 4EEWA 1IPGA 2PTLA 2NVUI 2YEPB 1FIQA 1I35A 2M56B 3AI5A 5DPSA 2C7NB 1Z5SB 1WM2A 3LXFA 4KGRA 3DBLB 2DZMA 1NEKB 2KN5A 2MCNB 4YT0B 5E6JA 4NPNA 3DQVA 1VZ7A 2I38A 3CSTA 3BYTB 2XNAC 4OZBA 3VH4B 5DPWA 3OAWA 3DVGY 4A3OA 4F7ZA 3TEWA 2KKCA 3AE7B 2GOWA 4C7ZA 4PS8A 3H7SA 2HTHA 3HM6X 3DDCB 1PGAA 4WQMA 1MJDA 2EELA 3H1UA 2C7MB 1SE3A 4A3PA 1Y56A 5IP4D 1BXTA 3W9CB 1WI0A 3NRZA 4KDLB 5EE3A 2V0GA 5CHVC 1UGJA 2D5GA 4JE3B 4ZRIA 2REXA 1WGYA 2V9HA 3W5VB 3Q8AA 4TUUA 2BKRB 2KDBA 3APFA 4HWIB 1E9MA 1RRBA 2LFIA 1J19A 3AECB 2LUMA 3P63A 1CQVA 1SIFA 2PVGC 3IXSA 2WXJA 4YSXB 4EOYA 4A9AA 4MSMB 2GBNA 1M94A 3VTVA 3LJ3A 4G0NB 2K22A 3VTUA 3RNCC 1JW9D 2DBYA 4YL8A 4ZYNA 1UBIA 1EWYC 2Y3AA 2KX3A 1N61A 4OHJA 1SF0A 2LVOA 3IG3A 2KDEB 2KK8A 3Q14C 3TJPA 3Q8CA 3V6CB 5DCNA 3QAQA 1QQRA 3AE5B 4P6VF 1NDDA 2WXRA 2KWVB 2BS3B 1UD7A 1GJZA 4RNAA 3BIID 2JF5A 3H7PA 4FHJA 1R4NB 2WX0A 1T0RC 2LUEA 3URYA 4WH4A 2XN9C 4P1CC 4ZRKA 1UZXB 1C4CA 1NENB 2KQ4X 3QJZA 3PS6A 4GU2A 2WXFA 2LHDA 2CJNA 5T8IA 1R7SA 4US9A 3FAHA 3AE4B 2M0XA 2MBQA 1F0ZA 4MGIE 1VRAB 4K7UA 2QDFA 2M4NA 4P16A 3ZKJC 3PRPB 3ZTDA 3OWEB 2ZPNA 2KTRA 2HJ8A 2J4XA 3WIMA 1RYJA 2JWZA 2Q5WD 2D3CA 3VAWA 1K51A 4J3OD 4K81A 4NQKE 3VR8B 5D6JB 4GDLA 1E8YA 3HRDD 4AOFA 4S0RA 4FULA 4II3B 4IWOA 1A5RA 1DYQA 4JWUC 5HKHA 2WXHA 1YQ3B 1XCQL 2KTRB 1SB3C 3DBLI 1VD2A 2O6VD 3Q3JA 1QZEA 3AE6B 4AQ7A 1RWSA 2MP2A 3KUDB 4YWGG 4DK5A 1MI0A 3NY5A 4GDLB 1SEBD 4WURA 2I1JA 2QC8A 3NZ3A 4XC2A 3AULA 1B9RA 2V3NA 4M00A 3Q3NC 4ZOHC 3IT4B 3Q8BA 2K8HA 3AE1B 2O6VB 1YJ1A 2MP2B 1WGHA 4RH6A 3MJ5A 3EUB2 1AN8A 3DWMA 3FILB 1DOXA 4RF1A 4XX5A 4WAFA 1JALA 1XLPA 3I57A 1GPXA 3Q3OC 5LNK1 4MACA 4DHJD 3MTNB 5AZFA 2K0PA 2MX2A 3PO0A 2PKOA 4B0EA 2QSDA 2L3ZA 2KQSA 3DBHB 3B2FA 2VZKD 2K3UA 3TEYA 2IY1B 2ON8A 2RR9A 2KJ6A 3NZUA 5C2TB 3UQBA 2LVPA 3O65B 1TS3A 1TZ1A 2A5UA 4DHJB 5JH5C 2RDHA 3CF6E 4KV2A 4OZAA 1YOVB 3U7DA 1V80A 4W9HA 2VZKB 4ZRPA 2WU2B 1TKGA 2KWUB 2CJOA 1DOYA 2E3TA 1V81A 2KN4A 1ROEA 1SIJA 3RFZB 1QOBA 2RD0A 1M4VA 2MSED 2MHJA 2J42A 3MFGA 4IWQA 2QJLA 3ALBA 3O13A 1NBFC 4LNOA 3UGBB 1PDXA 2MJ3A 2G3QB 1WGDA 2YLMA 1BMLC 3X23A 5C23A 1R4NI 1K8RB 2NPTA 2TSSA 2AQ1B 3U7ZA 3AEDB 4C4VA 1L7YA 3RNEC 1FRRA 1EU4A 2PPHA 4TSSA 4G50A 1E8ZA 5GMVA 1D5XC 2NPTB 5I4DA 2W3SA 1OEYJ 3HHMA 2KC2A 5H92C 3N1YC 2AX5A 1TZOA 4HRSA 4I6LB 3AE2B 3M3JA 1V1OA 3AEBB 1QOGA 2ZCBA 2MRPA 4KZ0A 1WGKA 4FA6A 1V9JA 2LWPA 1JWBD 1N5WA 4ARCA 1MHXA 1PGXA 3JSVA 3RZWC 3Q2AC 2LJ5A 5MPOA 1N6ZA 2EKEC 1YMHE 5JXVA 4I6PA 1OQYA 2L00B 5BYRA 2EMTA 4EFOA 3P4SB 1GOZA 2MBOA 3B2GA 1WXSA 4E3CA 3JSVB 2WS3B 4EUTA 3L17A 4DHZB 4JGHB 1MHHE 3FC4A 2BKFA 3APDA 3D32A 4XDCA 1V97A 4HKZE 3VUWA 4E74A 1GC7A 1V1PA 4DWFA 2ACZB 5C1ZA 2ASQA 2NBUA 1P9DU 3VH3B 2N7JA 5LLIA 2N7EA 2KLGA 1E90A 3AH7A 2WWZA 3ZYYX 3B9JA 2WXGA 2FE8A 1T0QC 1E7PB 3DBHI 2N9LA 2JWUA 1V1PB 4NJCA 2KDIA 3AXCA 3OG5A 3ZUNA 4W9EA 2MEKA 1QOFA 3HIZA 2L8JA 5D2MB 1HQRD 2LGSA 5LXIB 3KUZA 1I4XA 3M62B 2KVZA 1HEZE 3B08A 1WGGA 1C1YB 2K25A 1JWMD 1E6EB 4DDID 3UI3A 1SXTA 3AN1A 1BUIC 3I63C 4KGTA 3V61A 2MBEA 2UU7A 4GXBA 3RNAC 1E8XA 3VDZA 1FXAA 1Q0WB 1UBQA 2JYEA 4IOIE 1R4MB 4LNNA 1QOAA 1WJUA 3DHHC 4NJ6A 1T3QA 3A33B 3GE3C 4IWPA 2I1KA 4AWJA 3P4QB 2BPSA 3E9SA 3W2DA 3NS8A 1PGBA 1TBEA 2FUG1 3IHPC 4ZDVA 1CMXB 2CHWA 3EFCA 5IA7A 3A1QB 3ZTCA 2LXCA 1WFYA 1V2YA 4NY0A 1WF9A 1E7UA 1HTOA 2ZJDA 4GDKB 4XE0A 1PYWD 1RM6C 1TIFA 3OJ4B 1MFWA 2KYWA 1EU3A 1AARA 1ZXIA 3DBRI 2KT7A 1WXQA 1T6BX 4F8CB 4R3DA 1IYFA 5E6PA 4BBNF 5DPRA 1D5ZC 5D3DA 2A4ZA 4ANWA 1LO5D 3H6NA 3ZNID 2JXTA 2V4LA 1WJNA 2WXIA 4L23A 3WAMA 3SR6A 2M17A 3IVFA 3K9PB 4DXAB 1C77A 4HLEA 2H88B 4NQLB 1VZ8A 2DAJA 3T8MA 2XEWA 4WQOB 2D3GA 3TMPB 3DHGC 2L05A 1BT0A 3C19A 1WRIA 2MBBB 4ANXA 2GBKA 1E10A 1IGCA 3EA6A 5HFYA 2LASA 2JYTA 2FCMA 1ISNA 1J7CA 2SEBD 4ACFA 1TJEA 1JWAD 2WHIA 3QARA 2PE9A 4TQ0A 2D07B 4CO7A 2R2QA 4N9F4 4RM8A 3GS2A 3AM9A 4RCOA 5EE0A 2CS4A 4LDTD 5IN7A 4DQOC 2BWFA 2L52A 1YQ4B 1L6UA 2Y5PA 3QIJA 3RZFA 1GNUA 5CHFA 2C7HA 3ZDMC 4RMAA 4P1BC 1IP9A 2WNMA 4IC7B 4ZRQA 3TL5A 4ITKA 4JWSC 3VXWA 3K9OB 1X1MA 2OEDA 4LDTB 4NAWA 3PTFC 2ONQA 4FJVB 2DYOA 2FIDA 3DBSA 1R4MI 2DYMA 1D3ZA 3NVWA 3ZNZB 3I5JC 2M0AA 3BVMA 1LFDA 4WJPA 4NAWB 5IKCM 1JCKB 4KSKC 5G5GA 4KDIC 1WR6E 4EE2A 3FKYA 4OVZA 2ZZPB 1VJKA 3KH0A 2WDVB 3QWZB 2NCNA 3KYCD 3BWUD 3IT6B 1UH6A 2K8BA 2N1VA 4XZ4A 1JRPA 2IZVB 2CKHB 1YN3A 3M95A 4NZLB 1WZ0A 4FN2A 3AEFB 5HG2A 3VUYA 3TCAA 5E6NA 4ANVA 3PT2B 4FLHA 1ZDVA 2G1EA 1F52A 2N9EB 1F1HA 1AWDA 5BMIA 2ZW1A 3SU8X 3GE8C 1XLQA 1SBBB 1Q1OA 4HPPA 3T3OA 5J2RA 1YQBA 1QF6A 3W5UB 4W9FA 3TEZA 2UWQA 2G9HD 2NTSA 3EHVA 1UGMA 3LB8C 2KWDA 4IG7B 2JY6A 1F77A 4KIKA 4YSYB 1JRUA 4JIOU 2Z8LA 2LEKA 1E8WA 2W82A 1VLBA 1ZKHA 2IO0B 5FR3A 4OVUA 3PHXB 4D2KA 2J0JA 2KO3A 4W9DA 1TY0A 4A6QA 5EE9A 4A55A 1UWXA 2V3PA 4KIKB 1V5TA 5BMHA 1RLFA 2DAFA 1KRHA 3SEBA 4PS3A 4A20A 1P3QU 2QHOA 5H8YE 2O6VA 3A9KA 1KLVA 2WXOA 2L0FA 3QHTA 3R3MA 3FILA 3VRAB 3RYTA 2PEAA 2O2VA 3Q3FA 4BFRA 2JZPA 4ICUA 1V86A 4HPMB 2IGGA 2H89B 1Y8RC 3LDZE 2WGSA 2GBRA 3A9KB 1PQSA 4QAYA 4RGMA 2KANA 3L4PA 2O2VB 5J17A 1UELA 2R2OA 1T0YA 1WMHB 1VDVA 2INCC 3VRBB 1ZDXA 4ASWC 5G5HA 1N60A 1WX8A 2PMVA 2OHFA 1J7BA 4B95A 3W1SC 3MC8A 3VVWB 3JYUA 2QMTA 3IBEA 1ZXHA 1D4BA 1UF0A 2C5LC 3SFDB 2LD9A 3ZLZA 1FXTB 3SHQA 1LXDA 2WX1A 1P7FA 3RT3B 2KQ7A 4AJYB 4YXDB 2YVCA 3NVVA 1MG8A 1A70A 1ZPSA 4LJOB 4BKSD 1JQ4A 3AEGB 3KQ4A 1XXGA 2HE7A 4GB9A 2ZNVB 2MW5A 2BT6A 3B0AA 1J8CA 2CHXA 3WA0A 1XCTL 4W9JA 4XGAB 1YN4A 3NZSA 2BYEA 3PV1A 2FUHB 1H4RA 2CR5A 1ET9A 1FFUA 2N7DA 2JUOA 5EE1A 4LNIA 4CYEA 3ZIMA 1XT9B 2KNBA 1P98A 2AYOB 2LRUA 2LRWA 4HPLB 2PW9A 1C3TA 1K53A 1I4RA 2OJRA 3H9DA 4JL9A 2IO1B 3U8ZA 1CK1A 3Q6BA 1WWTA 3UIPB 2WU5B 3S2AA 2KZRA 2J0KA 3DVNV 3AB5A 3L10B 2LMCA 4MJSA 1ZE3D 4RGNA 2NS5A 2WDRB 1C4PA 2V1YA 1WM3A 1ZP0B 3PRMB 3JVZX 2IDYA 2DLBA 3IFWB 2MH7A 3N3KB 5JHAA 1N5XA 1OEYA 2B76B 1SE9A 2W55A 1STEA 2K9XA 2GBJA 1VCBA 4RGTA 4K3CA 4MJSB 1OTRB 4P7IA 4WWMA 2BQQA 1ZGUB 5JHBA 2IO3B 2DZIA 2R61A 4KSLC 4M02A 2N9XA 2LZ6A 3KWLA 3ZJTA 1ENFA 3DHIC 4BVUC 2D2QA 1SJHD 2M8SA 4B6WA 2GI9A 3DWGC 4KVGB 3GB1A 3ZVVA 2QCZA 5KHQA 3GZNB 4FHKA 2Z0EB 1FO4A 3H8HA 4IM3A 4BZAA 4YTPB 2KDFB 3R8BA 1OQQA 4N59A 2KC1A 1ET6A 3L08A 2CU3A 5BYSA 2JX5A 3A4RA 2AQ3B 3ECIA 2AL6A 3UINB 4C56C 3U2SC 4BBNC 1FCLA 4GIVA 2RPQA 4YSZB 4M8NA 4C80A 4RGOS 3NS1A 2DNFA 4M01A 3N1XC 4JX1C 2BB6A 1FCCC 1KJTA 2LXAA 5IAAC 2FNJB 2ZPYA 2WQYB 2J53A 1Q5WB 2WXLA 4H2AA 1WR1A 1GUAB 1P1AA 1QLBB 1F9JA 1HXYD 3DPDA 2PIAA 3I9V1 2ICIA 2CHZA 5LXHA 2PJHA 2VH2A 4C00A 2K5PA 1FRDA 3QCAA 2IGDA 1L4ZB 3UF8A 3MHZA 2V3SA 1XQQA 4HJKA 4JPSA 1TGZB 5EDSA 2LGXA 3OLMD 3Q69A 3P1MA 4JLCA 4TV3A 2RDGA 1WJ4A 4CQNA 1NI2A 3A1QA 2N4FA 3ZJVA 1WH3A 3V6EB 3N9YC 2OJWA 5IO9A 2FIFA 4GDKA 1L5PA 2HTME 1QILA 3QA8A 3KUCB 3BINA 4X57B 2ZNVC 2JZZA 2EKIA 1TYGB 2BBCA 1KF6B 2UYZB 2J7QB 3BVZA 3Q8FA 1WXVA 2IO2B 3ZNGC 5GXGB 2RSUA 2D3AA 3V62A 2D10A 2BS4B 3KWVA 1B1ZA 4AUQC 3PPAA 4TQ1A 1HZ5A 3A9JB 3WCQA 5E6OA 3VTWA 2WXPA 3BK2A 3VHTC 4F1SA 4MGYE 4MDKE 2KFKA 3U52E 4W9KA 2IGHA 3P2BA 4KKJA 2MJDA 4PYZA 3I3TB 4WIPA 1C9FA 2WDTB 2Z0DB 3NUHB 3L54A 2KWCA 3ML8A 4EKUA 1C76A 4NNJB 3ZW3A 3SDLC 4M0WA 1VZ6A 2KFKB 4IW0A 3KW5B 4ICVA 2AWTA 1JWUD 3C8YA 4BOSC 1YX5B 3U4EG 4LK0M 1WX7A 1WY8A 4WJNA 3AMZA 1WSPA 1D6EC 1GC6A 4HROA 1HA5A 4II2B 1ZUD2 1F2RI 2IJ0A 3A4SC 3GP7A 4M0WB 4K3BA 3R2TA 3MC0B 3W1SA 3Q8EA 3GZNI 1WXMA 2BW2A 4RM9A 2W54A 2GLSA 2GMIC 4LTUA 1TS2A 3MP9A 1WJ6A 2N9PC 3EC8A 4EZKA 2DENB 2MJEA 2L76A 1IBXA 2BGFA 5AUIA 5FKAC 4HVBA 2WXQA 4K7SA 3AU4A 1RAXA 2L0TA 1I42A 1P0RA 2N0SB 4XWTA 1ESFA 1ZOYB 1F2RC 4BOZB 1FD6A 1KFYB 1FNVA 2BWES 3RNBC 1IBXB 1WYWB 4MELA 3NOBA 1FFVA 4MSQB 3ZXRA 5D3IB 1DGJA 4B9KA 3RI7C 2QILA 2AL3A 2GBMA 3PREA 4XDDA 4ZHOA 4MGZE 4ZRJA 3WALA 4Q2JA 4DDGD 2CU1A 1S3SG 4HK2A 1CJEA 3ZDTA 1WE6A 4TMAB 3CMMB 2ZCCA 3HVDA 2X38A 1HTQA 4O1NA 4AP4C 1YD8U 2BTEA 3NHEB 2RGFA 3DVNU 2NTTA 2K1FA 4DHZE 4G3XB 1WIAA 1KTKA 4OVVA 2D11A 2OOBB 2N1WA 5TSSA 1VR9A 4KGSA 1SJED 2IBIB 1U4AA 4MEMA 2W3RA 2JQRB 1XLOA 2KTFA 2BB5A 3AEEB 4HKQA 1TS5A 3TIXA 1EWCA 1K52A 3DCGA 4WWPA 2GB1A 2HJ1A 2J0MA 4ZHPA 2IY0B 4CHKA 3QK0A 2JXXA 2KOXA 1HE8A 4LNFA 1EM7A 3L16A 1E7VA 2K6DB 1GB4A 1NI3A 3VR9B 4PYUA 3PZ7A 2MWSB 5DPTA 1TS4A 4HDQA 1GG3A 3T9LA 1WRDB 4IM0A 3ML9A 1EUVB 2JRHA 2RPVA 2N9KA 1WYGA 1EF1A 2SAKA 1L0YB 2K8CA 2B3AA 1FMAD 1GAQB 1SGHA 4AJWA 4LJPB 3TEXA 4NAMA 2VRRB 3N20C 1C79A 3H7PB 2L83A 4PK1A 1EF5A 4N6EB 1N62A 2RMMA 4HCNB 3PZDA 4IDIA 5C3JB 3QC8B 2QEJC 4L1BA 5L95C 1L0VB 4FJZA 1JROA 1XLNA 5AZHA 4HJGE 2WXNA 1N63A 4MM3A 1WX9A 4S17A 3MHSD 3V3XA 2L7RA 3MC9A 1V8CA 4ANUA 1WMHA 4LCDE 1LGRA 3KLSX 3RPFC 1SE4A 1Z2MA 4MM3B 2NMQA 4HEA1 2MQJA 1DOIA 1CZPA 2JT4B 2BF8B 2KVRA 2I2YA 3N1ZC 1GB1A 3NJTA 2KDMA 1NVID 4DXFA 4A8XC 2IPKD 2LHEA 4IKGA 2J52A 4AS1A 4K7WA 1J7AA 2INNE 4US8A 1KOTA 2Z59B 3C0RB 4KX6B 1QKZA 3AEAB 3BVGA 1PUTA 1WE7A 3TUOA 1S1QB 1C78A 2DWQA 1YJIA 3RNFC 4N58A 4GLSC 2Y5BB 2ZW0A 2DHZA 4YTNB 3ZO5B 1YNTE 2LGYA 2KFJA 1UNSA 1XO3A 5BMGA 4FADA 3N32A 3VFKA 5D7GA 1UUPA 2FCQA 1I4QA 2JRIB 1LM8B 3UIOB 3KYDD 1RFKA 2AQ2B 4BKSA 2KMCA 3QQ8B 4URKA 1OQRA 2L1AA 4ZYSA 3AV8A 1L2NA 2KXJA 4YTMB 2BYVE 2L32A 2NR2A 2KX0A 1YN5A 3RULA 3DVGX 2XK5A 3RUIB 3U30A 3WANA 1K50A 2KLCA 2KD0A 2WXMA 1I4HA 4KKIA 4OZCA 4K1RB 3KVFB 3J9CA 2DZKA 4ARIA 1G6JA 3BK1A 2FAZA 2X8XX 1PFDA 2WYQA 4TKNA 1D5MC 3BZDB 2E6XA 1KM7A 4WJQA 2FCNA 2XK5B
chains in the Genus database with same CATH topology
1JWAD 1VRAB 4P16A 4PT5A 4TQ0A 4REZA 4C7YA 1SE2A 2K5PA 3OWEB 1FRDA 2J4XA 2IGDA 4MH8A 1RYJA 1L4ZB 3MHZA 3GS2A 2Q5WD 3AM9A 3HUIA 4JPSA 4RCOA 5EE0A 3Q69A 1K51A 4J3OD 3P1MA 3VR8B 4B0MA 2RDGA 4DQOC 2GRIA 3ETRA 4CQNA 2L52A 1YQ4B 1L6UA 2Y5PA 3HRDD 1DYQA 4JWUC 2WXHA 1TKYA 1YQ3B 3ZJVA 1XCQL 1SB3C 3N9YC 2YEPF 2WNMA 4ZRQA 1L5PA 3AE8B 3AE6B 4ITKA 2HTME 1QILA 4AQ7A 1RWSA 4JWSC 5FK9C 2EKIA 4YWGG 1TYGB 2BBCA 1KF6B 1MI0A 2OEDA 1SEBD 4GDLB 4WURA 2ONQA 3E56A 3BVZA 3NVZA 2DYOA 3Q8FA 4RF0A 5GXGB 3NZ3A 1B9RA 2DYMA 2V3NA 4ZOHC 3IT4B 3NVWA 2BS4B 3Q8BA 3AE1B 3KWVA 1B1ZA 4TQ1A 2KACA 2M0AA 4RH6A 3MJ5A 1HZ5A 1AN8A 3DWMA 3BVMA 3EUB2 3FILB 3R2IA 1FNWA 1DOXA 1KLGD 4RF1A 3P4PB 4WAFA 1JALA 3WCQA 1FEHA 3P42A 1XLPA 3I57A 4NAWB 2WXPA 1GPXA 1MVKA 3BK2A 1JCKB 5G5GA 5LNK1 4MACA 3U52E 2Y5CA 4EE2A 2IGHA 2K0PA 4KKJA 2MJDA 4OVZA 3PO0A 1VJKA 2PKOA 2WDVB 4WIPA 1C9FA 3ZQ4A 2QSDA 4B0EA 2HDEA 3BWUD 3IT6B 3NUHB 1MPEA 3B2FA 2VZKD 1C76A 2K3UA 3BYYB 1JRPA 3TEYA 2ON8A 4M0WA 1VZ6A 1YN3A 4NZLB 5C2TB 3AEFB 5HG2A 1TS3A 1JWUD 3C8YA 3AE9B 5AUKA 3U4EG 4LK0M 1AW7A 2RDHA 1XF5L 4OZAA 1IGDA 1Q10A 1AYFA 1WSPA 1D6EC 2FBWB 3AMZA 1HA5A 4HROA 1I7HA 1ZUD2 1F2RI 2IJ0A 3GP7A 1ZDVA 1YJJA 2VZKB 2G1EA 3SFEB 4ZRPA 2WU2B 3PZ8A 1AWDA 1FXIA 5BMIA 1TKGA 3MC0B 3R2TA 4A90A 3ZJUA 2CJOA 3W1SA 2ZW1A 3Q8EA 1DOYA 2KMMA 2BW2A 1XLQA 2E3TA 2W54A 3LYYA 3ABVB 3AE3B 1SBBB 3T3OA 2KN4A 1ROEA 1SIJA 3RFZB 4LTUA 1QOBA 1TS2A 3MP9A 1QF6A 3W5UB 1M4VA 5HHDG 2MJEA 2J42A 3TEZA 2QIEB 3MFGA 2G9HD 1IBXA 1C4AA 2JSVX 2NTSA 1NYRA 2QJLA 1E0ZA 5AUIA 3O13A 5FKAC 1QT9A 1L0XB 3LB8C 2KWDA 2WXQA 1PDXA 1F77A 2MJ3A 4YSYB 2Z8LA 1NYQA 1BMLC 2LEKA 1T5XD 2N0SB 4XWTA 1ESFA 1ZOYB 1F2RC 2LJIA 2TSSA 2W82A 1FD6A 2AQ1B 3U7ZA 3AEDB 1KFYB 1VLBA 1FNVA 5FR3A 1FRRA 4LLGM 1IBXB 1EU4A 1KH0A 3IAS1 3VQIA 4XWWA 4D2KA 4A6QA 1TY0A 3HVZA 1I4PA 2M19A 5EE9A 4TSSA 4A55A 1UWXA 2V3PA 2KAJA 1FFVA 4L2YA 1JMLA 5BMHA 1HZ6A 2WXKA 1UWMA 1KRHA 1D5XC 1DGJA 5D3IB 3SEBA 2QILA 1XEEA 5I4DA 2W3SA 4XDDA 1I4GA 5H8YE 4ZHOA 3NVYA 1ACCA 2WXOA 4Q2JA 5H92C 3FILA 3VRAB 3CIRB 2V4IB 1CJEA 2AX5A 4TMAB 1TZOA 4HRSA 5HI1A 3AE2B 4OW0A 2JZPA 1V1OA 3AEBB 3EGRA 2JU6X 1TY2A 3HVDA 2X38A 4MT5A 1FM0D 1QOGA 2IGGA 2H89B 4O1NA 1WGKA 1SSNA 2BTEA 1JWBD 1N5WA 4USAA 4ARCA 1MHXA 1PGXA 2NTTA 2WDQB 3L4PA 4RGMA 5MPOA 1YMHE 5JXVA 5BYQA 1KTKA 2INPE 1VDVA 5BYRA 3VRBB 2BYTA 1JWSD 1ZDXA 4UDUC 5G5HA 5TSSA 1N60A 1TKEA 2PMVA 3P4RB 2OHFA 1J7BA 3P4SB 1GOZA 2LGIA 3B2GA 1VR9A 3IAM1 4KGSA 1SJED 2QMTA 1ZXHA 2WS3B 1D4BA 2PLPA 2W3RA 2JQRB 3SFDB 4DXGA 2PVOD 1XLOA 1MHHE 3FC4A 1FNUA 4XDCA 3ZGZA 2BB5A 1P7FA 1V97A 3AEEB 4HKZE 4HKQA 1KLUD 1TS5A 1EWCA 1K52A 1V1PA 2ACZB 4YXDB 2GB1A 4ZHPA 3NVVA 1L6VA 1L4DB 1A70A 2N7JA 1EM7A 3AH7A 1ZPSA 3ZYYX 1JQ4A 3B9JA 1IUEA 1GB4A 3AEGB 4FXCA 3KQ4A 1XXGA 2WXGA 2FE8A 1NI3A 3VR9B 3PZ7A 1E7PB 3T3NA 2WP9B 2BT6A 2N9LA 2JWUA 1V1PB 4NJCA 1TS4A 4RFBA 2BS2B 3CWIA 2MEKA 1P7EA 1QOFA 2WLBA 2RPVA 1OFFA 1XCTL 1HQRD 2N9KA 1WYGA 1YN4A 3TSSA 3V05A 1F0ZA 2SAKA 1I4XA 2PTLA 1L0YB 1FMAD 2YEPB 1FIQA 1GAQB 2M56B 3TEXA 4NAMA 1ET9A 1C79A 1FFUA 1HEZE 3LXFA 4KGRA 2L83A 1NEKB 5EE1A 1JWMD 4YT0B 5E6JA 4N6EB 1E6EB 1N62A 2RMMA 4IDIA 5C3JB 3UI3A 4L1BA 2QEJC 1SXTA 1VZ7A 3AN1A 1BUIC 2I38A 3BYTB 2XNAC 4OZBA 1L0VB 4KGTA 2PW9A 1JROA 1XLNA 1FXAA 3TEWA 4HJGE 2WXNA 3AE7B 4C7ZA 2JYEA 4IOIE 1K53A 1I4RA 1N63A 1PGAA 1CK1A 4WQMA 1QOAA 1WWTA 2EELA 2WU5B 1T3QA 3V3XA 1SE3A 1Y56A 3AB5A 1V8CA 3P4QB 1BXTA 3W9CB 2LMCA 3E9SA 1ZE3D 3NRZA 4RGNA 3KLSX 5EE3A 2WDRB 3RPFC 3W2DA 2V0GA 1SE4A 1PGBA 2FUG1 1C4PA 1UGJA 1ZP0B 2D5GA 4JE3B 2NMQA 4HEA1 4MM3B 2IDYA 1DOIA 2DLBA 2MH7A 3Q8AA 3W5VB 1CZPA 1N5XA 2B76B 2W55A 1STEA 1E9MA 2LFIA 2I2YA 2K9XA 1GB1A 4RGTA 2KDMA 1NVID 3AECB 2LUMA 4DXFA 4A8XC 2IPKD 3P63A 1CQVA 2LHEA 4IKGA 2PVGC 3IXSA 2J52A 4WWMA 4AS1A 2WXJA 4GDKB 4XE0A 1PYWD 1RM6C 4A9AA 4YSXB 1J7AA 2R61A 1EU3A 2INNE 4US8A 2K22A 3KWLA 3ZJTA 4KX6B 1ZXIA 1ENFA 1QKZA 1JW9D 1SJHD 1WXQA 1PUTA 3AEAB 2GI9A 3BVGA 3TUOA 2DBYA 1T6BX 1C78A 2DWQA 4R3DA 3DWGC 1EWYC 1YJIA 2Y3AA 1N61A 3GB1A 4N58A 4GLSC 2ZW0A 4OHJA 4YTNB 1SF0A 1YNTE 1FO4A 1D5ZC 3H8HA 5D3DA 1UNSA 1XO3A 5BMGA 4YTPB 1LO5D 3R8BA 1OQQA 5D7GA 1UUPA 3Q8CA 2JXTA 4N59A 1I4QA 1QQRA 1ET6A 3AE5B 2CU3A 2WXIA 2JX5A 4L23A 5BYSA 1RFKA 4P6VF 2AQ2B 2WXRA 3SR6A 2BS3B 2AQ3B 4RNAA 3BIID 1OQRA 2L1AA 1C77A 4ZYSA 2H88B 3AV8A 4C56C 4YTMB 3U2SC 1VZ8A 1FCLA 2L32A 4YSZB 3URYA 1YN5A 4C80A 4RGOS 4WH4A 2XN9C 3NS1A 4JX1C 2BB6A 1FCCC 1K50A 2WXMA 1I4HA 4KKIA 4OZCA 1C4CA 1NENB 2KQ4X 2WQYB 1WRIA 2J53A 3J9CA 2WXLA 2WXFA 2LHDA 2CJNA 4ARIA 3BK1A 5T8IA 1R7SA 4H2AA 4US9A 1PFDA 3FAHA 1QLBB 1D5MC 1HXYD 3BZDB 2E6XA 1E10A 1IGCA 3EA6A 5HFYA 3AE4B 2JYTA 2PIAA 3I9V1 2ICIA 1J7CA 2SEBD 1TJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y5P A; 
#chains in the Genus database with same CATH topology
 5J18 A;  2LI5 A;  4DBG A;  4PT5 A;  4REZ A;  4C7Y A;  1SE2 A;  3JW0 X;  4MH8 A;  5AZG A;  1OGW A;  3HUI A;  3RN9 C;  4BKG A;  3R66 C;  4B0M A;  3RMK C;  2GRI A;  3B1L X;  3ETR A;  1WGR A;  1TKY A;  4G11 A;  2YEP F;  3HK0 A;  4C4V B;  3AE8 B;  3VUX A;  1XD3 B;  3MJW A;  5FK9 C;  3GOE A;  3X0W A;  1T0S C;  2G4S A;  3APC A;  3ZXV A;  3E56 A;  3NVZ A;  4RF0 A;  3DBR B;  4W9L A;  3PSE B;  2KAC A;  3N30 A;  3PLV A;  3R2I A;  1FNW A;  1KLG D;  3P4P B;  1FEH A;  3P42 A;  3RNG C;  1MVK A;  5TR5 A;  2G4D B;  2D3B A;  4FJY A;  3W1Y A;  2Y5C A;  4WWO A;  3ONS A;  3ZQ4 A;  3UQA A;  2HDE A;  4J6I A;  1MPE A;  5IOI A;  2KJH B;  3BYY B;  2NBW B;  4HCP B;  1EO6 A;  2KMA A;  4MGK E;  4EZL A;  3HM3 A;  2RDB C;  4WAA A;  4M8M A;  3AE9 B;  5AUK A;  1AW7 A;  1XF5 L;  3R7R A;  4NJ7 A;  1IGD A;  1Q10 A;  1AYF A;  1V6E A;  2FBW B;  5D94 A;  1I7H A;  4GGQ A;  3R7Q A;  2DZJ A;  1YJJ A;  2FCS A;  5KHO A;  4IUM B;  3SFE B;  4MH0 E;  5FR6 A;  3QX1 A;  3PZ8 A;  1FXI A;  4A90 A;  3ZJU A;  3PLU A;  2KMM A;  5AEK B;  3LYY A;  3ABV B;  3AE3 B;  2BVC A;  4GSW A;  2DX5 B;  3EEC A;  4GOC A;  4W9C A;  1E5W A;  2HD5 B;  5HHD G;  4GN1 A;  2QIE B;  3PRZ A;  1C4A A;  2JSV X;  1NYR A;  2XBB C;  1E0Z A;  5JZE B;  1QT9 A;  1L0X B;  3WAP A;  5G2N A;  2JVC A;  4XYC A;  1NYQ A;  1T5X D;  2LJI A;  1J0G A;  2ZVO A;  2K6Q A;  4LLG M;  1KH0 A;  3OJ3 A;  3IAS 1;  3VQI A;  2JZ3 B;  4XWW A;  1V5O A;  3ENE A;  3HVZ A;  3PHW B;  1I4P A;  2M19 A;  1FPY A;  2G45 B;  2KAJ A;  4L2Y A;  4FBJ B;  1JML A;  1HZ6 A;  2WXK A;  1UWM A;  4BAX A;  5CTR C;  3L13 A;  3DOW A;  3PVL A;  1XEE A;  4W9I A;  1I4G A;  3NVY A;  1YIW A;  1ACC A;  3NG0 A;  2IYD B;  2DYB A;  3RD2 A;  2LVQ A;  3A9J A;  2KHW B;  3CIR B;  2V4I B;  4PS7 A;  4IM2 A;  1LQB A;  5HI1 A;  4OW0 A;  3EGR A;  2JU6 X;  4I6N B;  4KZC A;  1TY2 A;  5CHW A;  3PGE A;  4MT5 A;  1FM0 D;  3ZNH B;  2MBH A;  1YX6 B;  1SSN A;  2C9W B;  2NBV B;  4USA A;  2MA9 B;  5L83 A;  5G55 A;  2ZVN A;  2W9N A;  2WDQ B;  3BY4 B;  5BYQ A;  3SD5 A;  3M63 B;  4JQW C;  2INP E;  2AEH A;  4GMV A;  2BYT A;  1JWS D;  4HXD A;  4UDU C;  2C60 A;  2K39 A;  1TKE A;  3P4R B;  4WWN A;  1ZW7 A;  4HDO A;  2LGI A;  4LNK A;  3IAM 1;  3L0W B;  2M1M A;  3RCZ A;  2PLP A;  3EFU A;  4DXG A;  2PVO D;  2MLB A;  5BO4 B;  1RFA A;  1TT5 B;  1FNU A;  3ZGZ A;  3TBL D;  3AU5 A;  4BKT A;  2JPH A;  1KLU D;  3ZRC A;  2PE6 B;  2ZEQ A;  1TTN A;  2KJR A;  3V60 A;  1L6V A;  1L4D B;  4WJO A;  3CSF A;  1WXA A;  2VH1 A;  1IUE A;  4FXC A;  1H8C A;  3WAO A;  2IND C;  3ZRF A;  3T3N A;  2WP9 B;  4EZJ A;  4RFB A;  2BS2 B;  1WZ3 A;  3CWI A;  1P7E A;  2WLB A;  1V49 A;  1MG4 A;  3Q3M C;  2LGD A;  4W9G A;  1OFF A;  4E71 A;  2BYF A;  3TSS A;  3V05 A;  5CX3 A;  2EMS A;  4EEW A;  1IPG A;  2PTL A;  2NVU I;  2YEP B;  1FIQ A;  1I35 A;  2M56 B;  3AI5 A;  5DPS A;  2C7N B;  1Z5S B;  1WM2 A;  3LXF A;  4KGR A;  3DBL B;  2DZM A;  1NEK B;  2KN5 A;  2MCN B;  4YT0 B;  5E6J A;  4NPN A;  3DQV A;  1VZ7 A;  2I38 A;  3CST A;  3BYT B;  2XNA C;  4OZB A;  3VH4 B;  5DPW A;  3OAW A;  3DVG Y;  4A3O A;  4F7Z A;  3TEW A;  2KKC A;  3AE7 B;  2GOW A;  4C7Z A;  4PS8 A;  3H7S A;  2HTH A;  3HM6 X;  3DDC B;  1PGA A;  4WQM A;  1MJD A;  2EEL A;  3H1U A;  2C7M B;  1SE3 A;  4A3P A;  1Y56 A;  5IP4 D;  1BXT A;  3W9C B;  1WI0 A;  3NRZ A;  4KDL B;  5EE3 A;  2V0G A;  5CHV C;  1UGJ A;  2D5G A;  4JE3 B;  4ZRI A;  2REX A;  1WGY A;  2V9H A;  3W5V B;  3Q8A A;  4TUU A;  2BKR B;  2KDB A;  3APF A;  4HWI B;  1E9M A;  1RRB A;  2LFI A;  1J19 A;  3AEC B;  2LUM A;  3P63 A;  1CQV A;  1SIF A;  2PVG C;  3IXS A;  2WXJ A;  4YSX B;  4EOY A;  4A9A A;  4MSM B;  2GBN A;  1M94 A;  3VTV A;  3LJ3 A;  4G0N B;  2K22 A;  3VTU A;  3RNC C;  1JW9 D;  2DBY A;  4YL8 A;  4ZYN A;  1UBI A;  1EWY C;  2Y3A A;  2KX3 A;  1N61 A;  4OHJ A;  1SF0 A;  2LVO A;  3IG3 A;  2KDE B;  2KK8 A;  3Q14 C;  3TJP A;  3Q8C A;  3V6C B;  5DCN A;  3QAQ A;  1QQR A;  3AE5 B;  4P6V F;  1NDD A;  2WXR A;  2KWV B;  2BS3 B;  1UD7 A;  1GJZ A;  4RNA A;  3BII D;  2JF5 A;  3H7P A;  4FHJ A;  1R4N B;  2WX0 A;  1T0R C;  2LUE A;  3URY A;  4WH4 A;  2XN9 C;  4P1C C;  4ZRK A;  1UZX B;  1C4C A;  1NEN B;  2KQ4 X;  3QJZ A;  3PS6 A;  4GU2 A;  2WXF A;  2LHD A;  2CJN A;  5T8I A;  1R7S A;  4US9 A;  3FAH A;  3AE4 B;  2M0X A;  2MBQ A;  1F0Z A;  4MGI E;  1VRA B;  4K7U A;  2QDF A;  2M4N A;  4P16 A;  3ZKJ C;  3PRP B;  3ZTD A;  3OWE B;  2ZPN A;  2KTR A;  2HJ8 A;  2J4X A;  3WIM A;  1RYJ A;  2JWZ A;  2Q5W D;  2D3C A;  3VAW A;  1K51 A;  4J3O D;  4K81 A;  4NQK E;  3VR8 B;  5D6J B;  4GDL A;  1E8Y A;  3HRD D;  4AOF A;  4S0R A;  4FUL A;  4II3 B;  4IWO A;  1A5R A;  1DYQ A;  4JWU C;  5HKH A;  2WXH A;  1YQ3 B;  1XCQ L;  2KTR B;  1SB3 C;  3DBL I;  1VD2 A;  2O6V D;  3Q3J A;  1QZE A;  3AE6 B;  4AQ7 A;  1RWS A;  2MP2 A;  3KUD B;  4YWG G;  4DK5 A;  1MI0 A;  3NY5 A;  4GDL B;  1SEB D;  4WUR A;  2I1J A;  2QC8 A;  3NZ3 A;  4XC2 A;  3AUL A;  1B9R A;  2V3N A;  4M00 A;  3Q3N C;  4ZOH C;  3IT4 B;  3Q8B A;  2K8H A;  3AE1 B;  2O6V B;  1YJ1 A;  2MP2 B;  1WGH A;  4RH6 A;  3MJ5 A;  3EUB 2;  1AN8 A;  3DWM A;  3FIL B;  1DOX A;  4RF1 A;  4XX5 A;  4WAF A;  1JAL A;  1XLP A;  3I57 A;  1GPX A;  3Q3O C;  5LNK 1;  4MAC A;  4DHJ D;  3MTN B;  5AZF A;  2K0P A;  2MX2 A;  3PO0 A;  2PKO A;  4B0E A;  2QSD A;  2L3Z A;  2KQS A;  3DBH B;  3B2F A;  2VZK D;  2K3U A;  3TEY A;  2IY1 B;  2ON8 A;  2RR9 A;  2KJ6 A;  3NZU A;  5C2T B;  3UQB A;  2LVP A;  3O65 B;  1TS3 A;  1TZ1 A;  2A5U A;  4DHJ B;  5JH5 C;  2RDH A;  3CF6 E;  4KV2 A;  4OZA A;  1YOV B;  3U7D A;  1V80 A;  4W9H A;  2VZK B;  4ZRP A;  2WU2 B;  1TKG A;  2KWU B;  2CJO A;  1DOY A;  2E3T A;  1V81 A;  2KN4 A;  1ROE A;  1SIJ A;  3RFZ B;  1QOB A;  2RD0 A;  1M4V A;  2MSE D;  2MHJ A;  2J42 A;  3MFG A;  4IWQ A;  2QJL A;  3ALB A;  3O13 A;  1NBF C;  4LNO A;  3UGB B;  1PDX A;  2MJ3 A;  2G3Q B;  1WGD A;  2YLM A;  1BML C;  3X23 A;  5C23 A;  1R4N I;  1K8R B;  2NPT A;  2TSS A;  2AQ1 B;  3U7Z A;  3AED B;  4C4V A;  1L7Y A;  3RNE C;  1FRR A;  1EU4 A;  2PPH A;  4TSS A;  4G50 A;  1E8Z A;  5GMV A;  1D5X C;  2NPT B;  5I4D A;  2W3S A;  1OEY J;  3HHM A;  2KC2 A;  5H92 C;  3N1Y C;  2AX5 A;  1TZO A;  4HRS A;  4I6L B;  3AE2 B;  3M3J A;  1V1O A;  3AEB B;  1QOG A;  2ZCB A;  2MRP A;  4KZ0 A;  1WGK A;  4FA6 A;  1V9J A;  2LWP A;  1JWB D;  1N5W A;  4ARC A;  1MHX A;  1PGX A;  3JSV A;  3RZW C;  3Q2A C;  2LJ5 A;  5MPO A;  1N6Z A;  2EKE C;  1YMH E;  5JXV A;  4I6P A;  1OQY A;  2L00 B;  5BYR A;  2EMT A;  4EFO A;  3P4S B;  1GOZ A;  2MBO A;  3B2G A;  1WXS A;  4E3C A;  3JSV B;  2WS3 B;  4EUT A;  3L17 A;  4DHZ B;  4JGH B;  1MHH E;  3FC4 A;  2BKF A;  3APD A;  3D32 A;  4XDC A;  1V97 A;  4HKZ E;  3VUW A;  4E74 A;  1GC7 A;  1V1P A;  4DWF A;  2ACZ B;  5C1Z A;  2ASQ A;  2NBU A;  1P9D U;  3VH3 B;  2N7J A;  5LLI A;  2N7E A;  2KLG A;  1E90 A;  3AH7 A;  2WWZ A;  3ZYY X;  3B9J A;  2WXG A;  2FE8 A;  1T0Q C;  1E7P B;  3DBH I;  2N9L A;  2JWU A;  1V1P B;  4NJC A;  2KDI A;  3AXC A;  3OG5 A;  3ZUN A;  4W9E A;  2MEK A;  1QOF A;  3HIZ A;  2L8J A;  5D2M B;  1HQR D;  2LGS A;  5LXI B;  3KUZ A;  1I4X A;  3M62 B;  2KVZ A;  1HEZ E;  3B08 A;  1WGG A;  1C1Y B;  2K25 A;  1JWM D;  1E6E B;  4DDI D;  3UI3 A;  1SXT A;  3AN1 A;  1BUI C;  3I63 C;  4KGT A;  3V61 A;  2MBE A;  2UU7 A;  4GXB A;  3RNA C;  1E8X A;  3VDZ A;  1FXA A;  1Q0W B;  1UBQ A;  2JYE A;  4IOI E;  1R4M B;  4LNN A;  1QOA A;  1WJU A;  3DHH C;  4NJ6 A;  1T3Q A;  3A33 B;  3GE3 C;  4IWP A;  2I1K A;  4AWJ A;  3P4Q B;  2BPS A;  3E9S A;  3W2D A;  3NS8 A;  1PGB A;  1TBE A;  2FUG 1;  3IHP C;  4ZDV A;  1CMX B;  2CHW A;  3EFC A;  5IA7 A;  3A1Q B;  3ZTC A;  2LXC A;  1WFY A;  1V2Y A;  4NY0 A;  1WF9 A;  1E7U A;  1HTO A;  2ZJD A;  4GDK B;  4XE0 A;  1PYW D;  1RM6 C;  1TIF A;  3OJ4 B;  1MFW A;  2KYW A;  1EU3 A;  1AAR A;  1ZXI A;  3DBR I;  2KT7 A;  1WXQ A;  1T6B X;  4F8C B;  4R3D A;  1IYF A;  5E6P A;  4BBN F;  5DPR A;  1D5Z C;  5D3D A;  2A4Z A;  4ANW A;  1LO5 D;  3H6N A;  3ZNI D;  2JXT A;  2V4L A;  1WJN A;  2WXI A;  4L23 A;  3WAM A;  3SR6 A;  2M17 A;  3IVF A;  3K9P B;  4DXA B;  1C77 A;  4HLE A;  2H88 B;  4NQL B;  1VZ8 A;  2DAJ A;  3T8M A;  2XEW A;  4WQO B;  2D3G A;  3TMP B;  3DHG C;  2L05 A;  1BT0 A;  3C19 A;  1WRI A;  2MBB B;  4ANX A;  2GBK A;  1E10 A;  1IGC A;  3EA6 A;  5HFY A;  2LAS A;  2JYT A;  2FCM A;  1ISN A;  1J7C A;  2SEB D;  4ACF A;  1TJE A;  1JWA D;  2WHI A;  3QAR A;  2PE9 A;  4TQ0 A;  2D07 B;  4CO7 A;  2R2Q A;  4N9F 4;  4RM8 A;  3GS2 A;  3AM9 A;  4RCO A;  5EE0 A;  2CS4 A;  4LDT D;  5IN7 A;  4DQO C;  2BWF A;  2L52 A;  1YQ4 B;  1L6U A;  2Y5P A;  3QIJ A;  3RZF A;  1GNU A;  5CHF A;  2C7H A;  3ZDM C;  4RMA A;  4P1B C;  1IP9 A;  2WNM A;  4IC7 B;  4ZRQ A;  3TL5 A;  4ITK A;  4JWS C;  3VXW A;  3K9O B;  1X1M A;  2OED A;  4LDT B;  4NAW A;  3PTF C;  2ONQ A;  4FJV B;  2DYO A;  2FID A;  3DBS A;  1R4M I;  2DYM A;  1D3Z A;  3NVW A;  3ZNZ B;  3I5J C;  2M0A A;  3BVM A;  1LFD A;  4WJP A;  4NAW B;  5IKC M;  1JCK B;  4KSK C;  5G5G A;  4KDI C;  1WR6 E;  4EE2 A;  3FKY A;  4OVZ A;  2ZZP B;  1VJK A;  3KH0 A;  2WDV B;  3QWZ B;  2NCN A;  3KYC D;  3BWU D;  3IT6 B;  1UH6 A;  2K8B A;  2N1V A;  4XZ4 A;  1JRP A;  2IZV B;  2CKH B;  1YN3 A;  3M95 A;  4NZL B;  1WZ0 A;  4FN2 A;  3AEF B;  5HG2 A;  3VUY A;  3TCA A;  5E6N A;  4ANV A;  3PT2 B;  4FLH A;  1ZDV A;  2G1E A;  1F52 A;  2N9E B;  1F1H A;  1AWD A;  5BMI A;  2ZW1 A;  3SU8 X;  3GE8 C;  1XLQ A;  1SBB B;  1Q1O A;  4HPP A;  3T3O A;  5J2R A;  1YQB A;  1QF6 A;  3W5U B;  4W9F A;  3TEZ A;  2UWQ A;  2G9H D;  2NTS A;  3EHV A;  1UGM A;  3LB8 C;  2KWD A;  4IG7 B;  2JY6 A;  1F77 A;  4KIK A;  4YSY B;  1JRU A;  4JIO U;  2Z8L A;  2LEK A;  1E8W A;  2W82 A;  1VLB A;  1ZKH A;  2IO0 B;  5FR3 A;  4OVU A;  3PHX B;  4D2K A;  2J0J A;  2KO3 A;  4W9D A;  1TY0 A;  4A6Q A;  5EE9 A;  4A55 A;  1UWX A;  2V3P A;  4KIK B;  1V5T A;  5BMH A;  1RLF A;  2DAF A;  1KRH A;  3SEB A;  4PS3 A;  4A20 A;  1P3Q U;  2QHO A;  5H8Y E;  2O6V A;  3A9K A;  1KLV A;  2WXO A;  2L0F A;  3QHT A;  3R3M A;  3FIL A;  3VRA B;  3RYT A;  2PEA A;  2O2V A;  3Q3F A;  4BFR A;  2JZP A;  4ICU A;  1V86 A;  4HPM B;  2IGG A;  2H89 B;  1Y8R C;  3LDZ E;  2WGS A;  2GBR A;  3A9K B;  1PQS A;  4QAY A;  4RGM A;  2KAN A;  3L4P A;  2O2V B;  5J17 A;  1UEL A;  2R2O A;  1T0Y A;  1WMH B;  1VDV A;  2INC C;  3VRB B;  1ZDX A;  4ASW C;  5G5H A;  1N60 A;  1WX8 A;  2PMV A;  2OHF A;  1J7B A;  4B95 A;  3W1S C;  3MC8 A;  3VVW B;  3JYU A;  2QMT A;  3IBE A;  1ZXH A;  1D4B A;  1UF0 A;  2C5L C;  3SFD B;  2LD9 A;  3ZLZ A;  1FXT B;  3SHQ A;  1LXD A;  2WX1 A;  1P7F A;  3RT3 B;  2KQ7 A;  4AJY B;  4YXD B;  2YVC A;  3NVV A;  1MG8 A;  1A70 A;  1ZPS A;  4LJO B;  4BKS D;  1JQ4 A;  3AEG B;  3KQ4 A;  1XXG A;  2HE7 A;  4GB9 A;  2ZNV B;  2MW5 A;  2BT6 A;  3B0A A;  1J8C A;  2CHX A;  3WA0 A;  1XCT L;  4W9J A;  4XGA B;  1YN4 A;  3NZS A;  2BYE A;  3PV1 A;  2FUH B;  1H4R A;  2CR5 A;  1ET9 A;  1FFU A;  2N7D A;  2JUO A;  5EE1 A;  4LNI A;  4CYE A;  3ZIM A;  1XT9 B;  2KNB A;  1P98 A;  2AYO B;  2LRU A;  2LRW A;  4HPL B;  2PW9 A;  1C3T A;  1K53 A;  1I4R A;  2OJR A;  3H9D A;  4JL9 A;  2IO1 B;  3U8Z A;  1CK1 A;  3Q6B A;  1WWT A;  3UIP B;  2WU5 B;  3S2A A;  2KZR A;  2J0K A;  3DVN V;  3AB5 A;  3L10 B;  2LMC A;  4MJS A;  1ZE3 D;  4RGN A;  2NS5 A;  2WDR B;  1C4P A;  2V1Y A;  1WM3 A;  1ZP0 B;  3PRM B;  3JVZ X;  2IDY A;  2DLB A;  3IFW B;  2MH7 A;  3N3K B;  5JHA A;  1N5X A;  1OEY A;  2B76 B;  1SE9 A;  2W55 A;  1STE A;  2K9X A;  2GBJ A;  1VCB A;  4RGT A;  4K3C A;  4MJS B;  1OTR B;  4P7I A;  4WWM A;  2BQQ A;  1ZGU B;  5JHB A;  2IO3 B;  2DZI A;  2R61 A;  4KSL C;  4M02 A;  2N9X A;  2LZ6 A;  3KWL A;  3ZJT A;  1ENF A;  3DHI C;  4BVU C;  2D2Q A;  1SJH D;  2M8S A;  4B6W A;  2GI9 A;  3DWG C;  4KVG B;  3GB1 A;  3ZVV A;  2QCZ A;  5KHQ A;  3GZN B;  4FHK A;  2Z0E B;  1FO4 A;  3H8H A;  4IM3 A;  4BZA A;  4YTP B;  2KDF B;  3R8B A;  1OQQ A;  4N59 A;  2KC1 A;  1ET6 A;  3L08 A;  2CU3 A;  5BYS A;  2JX5 A;  3A4R A;  2AQ3 B;  3ECI A;  2AL6 A;  3UIN B;  4C56 C;  3U2S C;  4BBN C;  1FCL A;  4GIV A;  2RPQ A;  4YSZ B;  4M8N A;  4C80 A;  4RGO S;  3NS1 A;  2DNF A;  4M01 A;  3N1X C;  4JX1 C;  2BB6 A;  1FCC C;  1KJT A;  2LXA A;  5IAA C;  2FNJ B;  2ZPY A;  2WQY B;  2J53 A;  1Q5W B;  2WXL A;  4H2A A;  1WR1 A;  1GUA B;  1P1A A;  1QLB B;  1F9J A;  1HXY D;  3DPD A;  2PIA A;  3I9V 1;  2ICI A;  2CHZ A;  5LXH A;  2PJH A;  2VH2 A;  4C00 A;  2K5P A;  1FRD A;  3QCA A;  2IGD A;  1L4Z B;  3UF8 A;  3MHZ A;  2V3S A;  1XQQ A;  4HJK A;  4JPS A;  1TGZ B;  5EDS A;  2LGX A;  3OLM D;  3Q69 A;  3P1M A;  4JLC A;  4TV3 A;  2RDG A;  1WJ4 A;  4CQN A;  1NI2 A;  3A1Q A;  2N4F A;  3ZJV A;  1WH3 A;  3V6E B;  3N9Y C;  2OJW A;  5IO9 A;  2FIF A;  4GDK A;  1L5P A;  2HTM E;  1QIL A;  3QA8 A;  3KUC B;  3BIN A;  4X57 B;  2ZNV C;  2JZZ A;  2EKI A;  1TYG B;  2BBC A;  1KF6 B;  2UYZ B;  2J7Q B;  3BVZ A;  3Q8F A;  1WXV A;  2IO2 B;  3ZNG C;  5GXG B;  2RSU A;  2D3A A;  3V62 A;  2D10 A;  2BS4 B;  3KWV A;  1B1Z A;  4AUQ C;  3PPA A;  4TQ1 A;  1HZ5 A;  3A9J B;  3WCQ A;  5E6O A;  3VTW A;  2WXP A;  3BK2 A;  3VHT C;  4F1S A;  4MGY E;  4MDK E;  2KFK A;  3U52 E;  4W9K A;  2IGH A;  3P2B A;  4KKJ A;  2MJD A;  4PYZ A;  3I3T B;  4WIP A;  1C9F A;  2WDT B;  2Z0D B;  3NUH B;  3L54 A;  2KWC A;  3ML8 A;  4EKU A;  1C76 A;  4NNJ B;  3ZW3 A;  3SDL C;  4M0W A;  1VZ6 A;  2KFK B;  4IW0 A;  3KW5 B;  4ICV A;  2AWT A;  1JWU D;  3C8Y A;  4BOS C;  1YX5 B;  3U4E G;  4LK0 M;  1WX7 A;  1WY8 A;  4WJN A;  3AMZ A;  1WSP A;  1D6E C;  1GC6 A;  4HRO A;  1HA5 A;  4II2 B;  1ZUD 2;  1F2R I;  2IJ0 A;  3A4S C;  3GP7 A;  4M0W B;  4K3B A;  3R2T A;  3MC0 B;  3W1S A;  3Q8E A;  3GZN I;  1WXM A;  2BW2 A;  4RM9 A;  2W54 A;  2GLS A;  2GMI C;  4LTU A;  1TS2 A;  3MP9 A;  1WJ6 A;  2N9P C;  3EC8 A;  4EZK A;  2DEN B;  2MJE A;  2L76 A;  1IBX A;  2BGF A;  5AUI A;  5FKA C;  4HVB A;  2WXQ A;  4K7S A;  3AU4 A;  1RAX A;  2L0T A;  1I42 A;  1P0R A;  2N0S B;  4XWT A;  1ESF A;  1ZOY B;  1F2R C;  4BOZ B;  1FD6 A;  1KFY B;  1FNV A;  2BWE S;  3RNB C;  1IBX B;  1WYW B;  4MEL A;  3NOB A;  1FFV A;  4MSQ B;  3ZXR A;  5D3I B;  1DGJ A;  4B9K A;  3RI7 C;  2QIL A;  2AL3 A;  2GBM A;  3PRE A;  4XDD A;  4ZHO A;  4MGZ E;  4ZRJ A;  3WAL A;  4Q2J A;  4DDG D;  2CU1 A;  1S3S G;  4HK2 A;  1CJE A;  3ZDT A;  1WE6 A;  4TMA B;  3CMM B;  2ZCC A;  3HVD A;  2X38 A;  1HTQ A;  4O1N A;  4AP4 C;  1YD8 U;  2BTE A;  3NHE B;  2RGF A;  3DVN U;  2NTT A;  2K1F A;  4DHZ E;  4G3X B;  1WIA A;  1KTK A;  4OVV A;  2D11 A;  2OOB B;  2N1W A;  5TSS A;  1VR9 A;  4KGS A;  1SJE D;  2IBI B;  1U4A A;  4MEM A;  2W3R A;  2JQR B;  1XLO A;  2KTF A;  2BB5 A;  3AEE B;  4HKQ A;  1TS5 A;  3TIX A;  1EWC A;  1K52 A;  3DCG A;  4WWP A;  2GB1 A;  2HJ1 A;  2J0M A;  4ZHP A;  2IY0 B;  4CHK A;  3QK0 A;  2JXX A;  2KOX A;  1HE8 A;  4LNF A;  1EM7 A;  3L16 A;  1E7V A;  2K6D B;  1GB4 A;  1NI3 A;  3VR9 B;  4PYU A;  3PZ7 A;  2MWS B;  5DPT A;  1TS4 A;  4HDQ A;  1GG3 A;  3T9L A;  1WRD B;  4IM0 A;  3ML9 A;  1EUV B;  2JRH A;  2RPV A;  2N9K A;  1WYG A;  1EF1 A;  2SAK A;  1L0Y B;  2K8C A;  2B3A A;  1FMA D;  1GAQ B;  1SGH A;  4AJW A;  4LJP B;  3TEX A;  4NAM A;  2VRR B;  3N20 C;  1C79 A;  3H7P B;  2L83 A;  4PK1 A;  1EF5 A;  4N6E B;  1N62 A;  2RMM A;  4HCN B;  3PZD A;  4IDI A;  5C3J B;  3QC8 B;  2QEJ C;  4L1B A;  5L95 C;  1L0V B;  4FJZ A;  1JRO A;  1XLN A;  5AZH A;  4HJG E;  2WXN A;  1N63 A;  4MM3 A;  1WX9 A;  4S17 A;  3MHS D;  3V3X A;  2L7R A;  3MC9 A;  1V8C A;  4ANU A;  1WMH A;  4LCD E;  1LGR A;  3KLS X;  3RPF C;  1SE4 A;  1Z2M A;  4MM3 B;  2NMQ A;  4HEA 1;  2MQJ A;  1DOI A;  1CZP A;  2JT4 B;  2BF8 B;  2KVR A;  2I2Y A;  3N1Z C;  1GB1 A;  3NJT A;  2KDM A;  1NVI D;  4DXF A;  4A8X C;  2IPK D;  2LHE A;  4IKG A;  2J52 A;  4AS1 A;  4K7W A;  1J7A A;  2INN E;  4US8 A;  1KOT A;  2Z59 B;  3C0R B;  4KX6 B;  1QKZ A;  3AEA B;  3BVG A;  1PUT A;  1WE7 A;  3TUO A;  1S1Q B;  1C78 A;  2DWQ A;  1YJI A;  3RNF C;  4N58 A;  4GLS C;  2Y5B B;  2ZW0 A;  2DHZ A;  4YTN B;  3ZO5 B;  1YNT E;  2LGY A;  2KFJ A;  1UNS A;  1XO3 A;  5BMG A;  4FAD A;  3N32 A;  3VFK A;  5D7G A;  1UUP A;  2FCQ A;  1I4Q A;  2JRI B;  1LM8 B;  3UIO B;  3KYD D;  1RFK A;  2AQ2 B;  4BKS A;  2KMC A;  3QQ8 B;  4URK A;  1OQR A;  2L1A A;  4ZYS A;  3AV8 A;  1L2N A;  2KXJ A;  4YTM B;  2BYV E;  2L32 A;  2NR2 A;  2KX0 A;  1YN5 A;  3RUL A;  3DVG X;  2XK5 A;  3RUI B;  3U30 A;  3WAN A;  1K50 A;  2KLC A;  2KD0 A;  2WXM A;  1I4H A;  4KKI A;  4OZC A;  4K1R B;  3KVF B;  3J9C A;  2DZK A;  4ARI A;  1G6J A;  3BK1 A;  2FAZ A;  2X8X X;  1PFD A;  2WYQ A;  4TKN A;  1D5M C;  3BZD B;  2E6X A;  1KM7 A;  4WJQ A;  2FCN A;  2XK5 B; 
#chains in the Genus database with same CATH homology
 1JWA D;  1VRA B;  4P16 A;  4PT5 A;  4TQ0 A;  4REZ A;  4C7Y A;  1SE2 A;  2K5P A;  3OWE B;  1FRD A;  2J4X A;  2IGD A;  4MH8 A;  1RYJ A;  1L4Z B;  3MHZ A;  3GS2 A;  2Q5W D;  3AM9 A;  3HUI A;  4JPS A;  4RCO A;  5EE0 A;  3Q69 A;  1K51 A;  4J3O D;  3P1M A;  3VR8 B;  4B0M A;  2RDG A;  4DQO C;  2GRI A;  3ETR A;  4CQN A;  2L52 A;  1YQ4 B;  1L6U A;  2Y5P A;  3HRD D;  1DYQ A;  4JWU C;  2WXH A;  1TKY A;  1YQ3 B;  3ZJV A;  1XCQ L;  1SB3 C;  3N9Y C;  2YEP F;  2WNM A;  4ZRQ A;  1L5P A;  3AE8 B;  3AE6 B;  4ITK A;  2HTM E;  1QIL A;  4AQ7 A;  1RWS A;  4JWS C;  5FK9 C;  2EKI A;  4YWG G;  1TYG B;  2BBC A;  1KF6 B;  1MI0 A;  2OED A;  1SEB D;  4GDL B;  4WUR A;  2ONQ A;  3E56 A;  3BVZ A;  3NVZ A;  2DYO A;  3Q8F A;  4RF0 A;  5GXG B;  3NZ3 A;  1B9R A;  2DYM A;  2V3N A;  4ZOH C;  3IT4 B;  3NVW A;  2BS4 B;  3Q8B A;  3AE1 B;  3KWV A;  1B1Z A;  4TQ1 A;  2KAC A;  2M0A A;  4RH6 A;  3MJ5 A;  1HZ5 A;  1AN8 A;  3DWM A;  3BVM A;  3EUB 2;  3FIL B;  3R2I A;  1FNW A;  1DOX A;  1KLG D;  4RF1 A;  3P4P B;  4WAF A;  1JAL A;  3WCQ A;  1FEH A;  3P42 A;  1XLP A;  3I57 A;  4NAW B;  2WXP A;  1GPX A;  1MVK A;  3BK2 A;  1JCK B;  5G5G A;  5LNK 1;  4MAC A;  3U52 E;  2Y5C A;  4EE2 A;  2IGH A;  2K0P A;  4KKJ A;  2MJD A;  4OVZ A;  3PO0 A;  1VJK A;  2PKO A;  2WDV B;  4WIP A;  1C9F A;  3ZQ4 A;  2QSD A;  4B0E A;  2HDE A;  3BWU D;  3IT6 B;  3NUH B;  1MPE A;  3B2F A;  2VZK D;  1C76 A;  2K3U A;  3BYY B;  1JRP A;  3TEY A;  2ON8 A;  4M0W A;  1VZ6 A;  1YN3 A;  4NZL B;  5C2T B;  3AEF B;  5HG2 A;  1TS3 A;  1JWU D;  3C8Y A;  3AE9 B;  5AUK A;  3U4E G;  4LK0 M;  1AW7 A;  2RDH A;  1XF5 L;  4OZA A;  1IGD A;  1Q10 A;  1AYF A;  1WSP A;  1D6E C;  2FBW B;  3AMZ A;  1HA5 A;  4HRO A;  1I7H A;  1ZUD 2;  1F2R I;  2IJ0 A;  3GP7 A;  1ZDV A;  1YJJ A;  2VZK B;  2G1E A;  3SFE B;  4ZRP A;  2WU2 B;  3PZ8 A;  1AWD A;  1FXI A;  5BMI A;  1TKG A;  3MC0 B;  3R2T A;  4A90 A;  3ZJU A;  2CJO A;  3W1S A;  2ZW1 A;  3Q8E A;  1DOY A;  2KMM A;  2BW2 A;  1XLQ A;  2E3T A;  2W54 A;  3LYY A;  3ABV B;  3AE3 B;  1SBB B;  3T3O A;  2KN4 A;  1ROE A;  1SIJ A;  3RFZ B;  4LTU A;  1QOB A;  1TS2 A;  3MP9 A;  1QF6 A;  3W5U B;  1M4V A;  5HHD G;  2MJE A;  2J42 A;  3TEZ A;  2QIE B;  3MFG A;  2G9H D;  1IBX A;  1C4A A;  2JSV X;  2NTS A;  1NYR A;  2QJL A;  1E0Z A;  5AUI A;  3O13 A;  5FKA C;  1QT9 A;  1L0X B;  3LB8 C;  2KWD A;  2WXQ A;  1PDX A;  1F77 A;  2MJ3 A;  4YSY B;  2Z8L A;  1NYQ A;  1BML C;  2LEK A;  1T5X D;  2N0S B;  4XWT A;  1ESF A;  1ZOY B;  1F2R C;  2LJI A;  2TSS A;  2W82 A;  1FD6 A;  2AQ1 B;  3U7Z A;  3AED B;  1KFY B;  1VLB A;  1FNV A;  5FR3 A;  1FRR A;  4LLG M;  1IBX B;  1EU4 A;  1KH0 A;  3IAS 1;  3VQI A;  4XWW A;  4D2K A;  4A6Q A;  1TY0 A;  3HVZ A;  1I4P A;  2M19 A;  5EE9 A;  4TSS A;  4A55 A;  1UWX A;  2V3P A;  2KAJ A;  1FFV A;  4L2Y A;  1JML A;  5BMH A;  1HZ6 A;  2WXK A;  1UWM A;  1KRH A;  1D5X C;  1DGJ A;  5D3I B;  3SEB A;  2QIL A;  1XEE A;  5I4D A;  2W3S A;  4XDD A;  1I4G A;  5H8Y E;  4ZHO A;  3NVY A;  1ACC A;  2WXO A;  4Q2J A;  5H92 C;  3FIL A;  3VRA B;  3CIR B;  2V4I B;  1CJE A;  2AX5 A;  4TMA B;  1TZO A;  4HRS A;  5HI1 A;  3AE2 B;  4OW0 A;  2JZP A;  1V1O A;  3AEB B;  3EGR A;  2JU6 X;  1TY2 A;  3HVD A;  2X38 A;  4MT5 A;  1FM0 D;  1QOG A;  2IGG A;  2H89 B;  4O1N A;  1WGK A;  1SSN A;  2BTE A;  1JWB D;  1N5W A;  4USA A;  4ARC A;  1MHX A;  1PGX A;  2NTT A;  2WDQ B;  3L4P A;  4RGM A;  5MPO A;  1YMH E;  5JXV A;  5BYQ A;  1KTK A;  2INP E;  1VDV A;  5BYR A;  3VRB B;  2BYT A;  1JWS D;  1ZDX A;  4UDU C;  5G5H A;  5TSS A;  1N60 A;  1TKE A;  2PMV A;  3P4R B;  2OHF A;  1J7B A;  3P4S B;  1GOZ A;  2LGI A;  3B2G A;  1VR9 A;  3IAM 1;  4KGS A;  1SJE D;  2QMT A;  1ZXH A;  2WS3 B;  1D4B A;  2PLP A;  2W3R A;  2JQR B;  3SFD B;  4DXG A;  2PVO D;  1XLO A;  1MHH E;  3FC4 A;  1FNU A;  4XDC A;  3ZGZ A;  2BB5 A;  1P7F A;  1V97 A;  3AEE B;  4HKZ E;  4HKQ A;  1KLU D;  1TS5 A;  1EWC A;  1K52 A;  1V1P A;  2ACZ B;  4YXD B;  2GB1 A;  4ZHP A;  3NVV A;  1L6V A;  1L4D B;  1A70 A;  2N7J A;  1EM7 A;  3AH7 A;  1ZPS A;  3ZYY X;  1JQ4 A;  3B9J A;  1IUE A;  1GB4 A;  3AEG B;  4FXC A;  3KQ4 A;  1XXG A;  2WXG A;  2FE8 A;  1NI3 A;  3VR9 B;  3PZ7 A;  1E7P B;  3T3N A;  2WP9 B;  2BT6 A;  2N9L A;  2JWU A;  1V1P B;  4NJC A;  1TS4 A;  4RFB A;  2BS2 B;  3CWI A;  2MEK A;  1P7E A;  1QOF A;  2WLB A;  2RPV A;  1OFF A;  1XCT L;  1HQR D;  2N9K A;  1WYG A;  1YN4 A;  3TSS A;  3V05 A;  1F0Z A;  2SAK A;  1I4X A;  2PTL A;  1L0Y B;  1FMA D;  2YEP B;  1FIQ A;  1GAQ B;  2M56 B;  3TEX A;  4NAM A;  1ET9 A;  1C79 A;  1FFU A;  1HEZ E;  3LXF A;  4KGR A;  2L83 A;  1NEK B;  5EE1 A;  1JWM D;  4YT0 B;  5E6J A;  4N6E B;  1E6E B;  1N62 A;  2RMM A;  4IDI A;  5C3J B;  3UI3 A;  4L1B A;  2QEJ C;  1SXT A;  1VZ7 A;  3AN1 A;  1BUI C;  2I38 A;  3BYT B;  2XNA C;  4OZB A;  1L0V B;  4KGT A;  2PW9 A;  1JRO A;  1XLN A;  1FXA A;  3TEW A;  4HJG E;  2WXN A;  3AE7 B;  4C7Z A;  2JYE A;  4IOI E;  1K53 A;  1I4R A;  1N63 A;  1PGA A;  1CK1 A;  4WQM A;  1QOA A;  1WWT A;  2EEL A;  2WU5 B;  1T3Q A;  3V3X A;  1SE3 A;  1Y56 A;  3AB5 A;  1V8C A;  3P4Q B;  1BXT A;  3W9C B;  2LMC A;  3E9S A;  1ZE3 D;  3NRZ A;  4RGN A;  3KLS X;  5EE3 A;  2WDR B;  3RPF C;  3W2D A;  2V0G A;  1SE4 A;  1PGB A;  2FUG 1;  1C4P A;  1UGJ A;  1ZP0 B;  2D5G A;  4JE3 B;  2NMQ A;  4HEA 1;  4MM3 B;  2IDY A;  1DOI A;  2DLB A;  2MH7 A;  3Q8A A;  3W5V B;  1CZP A;  1N5X A;  2B76 B;  2W55 A;  1STE A;  1E9M A;  2LFI A;  2I2Y A;  2K9X A;  1GB1 A;  4RGT A;  2KDM A;  1NVI D;  3AEC B;  2LUM A;  4DXF A;  4A8X C;  2IPK D;  3P63 A;  1CQV A;  2LHE A;  4IKG A;  2PVG C;  3IXS A;  2J52 A;  4WWM A;  4AS1 A;  2WXJ A;  4GDK B;  4XE0 A;  1PYW D;  1RM6 C;  4A9A A;  4YSX B;  1J7A A;  2R61 A;  1EU3 A;  2INN E;  4US8 A;  2K22 A;  3KWL A;  3ZJT A;  4KX6 B;  1ZXI A;  1ENF A;  1QKZ A;  1JW9 D;  1SJH D;  1WXQ A;  1PUT A;  3AEA B;  2GI9 A;  3BVG A;  3TUO A;  2DBY A;  1T6B X;  1C78 A;  2DWQ A;  4R3D A;  3DWG C;  1EWY C;  1YJI A;  2Y3A A;  1N61 A;  3GB1 A;  4N58 A;  4GLS C;  2ZW0 A;  4OHJ A;  4YTN B;  1SF0 A;  1YNT E;  1FO4 A;  1D5Z C;  3H8H A;  5D3D A;  1UNS A;  1XO3 A;  5BMG A;  4YTP B;  1LO5 D;  3R8B A;  1OQQ A;  5D7G A;  1UUP A;  3Q8C A;  2JXT A;  4N59 A;  1I4Q A;  1QQR A;  1ET6 A;  3AE5 B;  2CU3 A;  2WXI A;  2JX5 A;  4L23 A;  5BYS A;  1RFK A;  4P6V F;  2AQ2 B;  2WXR A;  3SR6 A;  2BS3 B;  2AQ3 B;  4RNA A;  3BII D;  1OQR A;  2L1A A;  1C77 A;  4ZYS A;  2H88 B;  3AV8 A;  4C56 C;  4YTM B;  3U2S C;  1VZ8 A;  1FCL A;  2L32 A;  4YSZ B;  3URY A;  1YN5 A;  4C80 A;  4RGO S;  4WH4 A;  2XN9 C;  3NS1 A;  4JX1 C;  2BB6 A;  1FCC C;  1K50 A;  2WXM A;  1I4H A;  4KKI A;  4OZC A;  1C4C A;  1NEN B;  2KQ4 X;  2WQY B;  1WRI A;  2J53 A;  3J9C A;  2WXL A;  2WXF A;  2LHD A;  2CJN A;  4ARI A;  3BK1 A;  5T8I A;  1R7S A;  4H2A A;  4US9 A;  1PFD A;  3FAH A;  1QLB B;  1D5M C;  1HXY D;  3BZD B;  2E6X A;  1E10 A;  1IGC A;  3EA6 A;  5HFY A;  3AE4 B;  2JYT A;  2PIA A;  3I9V 1;  2ICI A;  1J7C A;  2SEB D;  1TJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...