1KLVA

Solution structure and backbone dynamics of gabarap, gabaa receptor associated protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
GEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GABA(A) Receptor associated protein
publication title 1H, 13C and '5N resonance assignments of GABARAP, GABAA receptor associated protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 12
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2001-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1klvA00
2R2OA 1K8RB 1WE6A 4BVUC 1H8CA 1WJNA 2DYBA 2C7MB 1I35A 2JVCA 4TKNA 4J6IA 3VTVA 4PYZA 3ZDTA 3K9PB 2BKRB 5TR5A 1IP9A 3PT2B 5C1ZA 3PZDA 2KOXA 2O6VA 1NI2A 2GBKA 2IO1B 2KO3A 4PS7A 4BBNC 1UH6A 4KZ0A 3A4SC 4NQKE 4XC2A 3PRMB 4EKUA 2D10A 4HDOA 2LASA 2LZ6A 3NHEB 4B9KA 1OQYA 4EUTA 4AP4C 2K1FA 1WX8A 1WMHA 3WA0A 1RAXA 2I1KA 2IYDB 5LLIA 2KQ7A 2KFJA 4DK5A 2KFKB 1WY8A 2BYEA 3SU8X 5CTRC 2K25A 1ZGUB 4F1SA 2K39A 2XBBC 3ZTCA 1EO6A 1WGDA 3AU4A 2RD0A 2GMIC 4RM8A 3M62B 2C60A 1NDDA 1WXMA 4W9DA 4MJSB 2DYMA 1KLVA 3IVFA 2K6QA 4DDID 1HE8A 2CU1A 1U4AA 2IY0B 3QIJA 1CMXB 1V5OA 3KUZA 4WQOB 3APCA 5AZGA 2MP2B 2Y5BB 1IYFA 3PLVA 4PS3A 2FNJB 2IO3B 2DZJA 3H7SA 1R4NI 4GDKB 3B08A 2DAFA 3O65B 1GC7A 4P7IA 3M63B 2IBIB 1V9JA 3NS8A 4HLEA 3OLMD 4K1RB 1ZKHA 1SE9A 2K6DB 3UQBA 3TJPA 2JWZA 2D2QA 5D7GA 2MSED 4E3CA 3GOEA 3QK0A 3PGEA 4OVUA 1E8ZA 2FCNA 4ICVA 5D6JB 4W9EA 1GUAB 3CSFA 2KVRA 4MH0E 4ANUA 1XT9B 4FJYA 3A1QB 3TBLD 1P9DU 4IWQA 5J17A 4FN2A 2NR2A 2WX0A 2CR5A 5LXIB 2L05A 2PJHA 1V86A 1TTNA 3H6NA 1S3SG 4M8MA 3OAWA 1XD3B 2KJRA 4GXBA 4HPMB 4BKTA 4FJVB 2ZJDA 4M0WB 1YQBA 4GIVA 1LQBA 3QWZB 2VRRB 1JRUA 2LGXA 3H7PB 2PE9A 3ZLZA 2RGFA 3WAPA 3NOBA 1E7VA 2ZZPB 5DPRA 3UIOB 1E8XA 2WX1A 4BOZB 3DBRI 3EECA 1J19A 2QHOA 2N4FA 3ONSA 2NCNA 2L8JA 1E90A 2KDEB 2JY6A 5E6PA 3QARA 4G50A 3APDA 4TV3A 4WJQA 3CF6E 3ZW3A 2A5UA 4WJPA 5DPWA 1F9JA 3UQAA 2KTRB 3DVGY 1J8CA 3DVNU 5DCNA 2M17A 3QHTA 4N9F4 3ZIMA 2FIDA 3B1LX 3IG3A 2AYOB 1R4MI 1FXTB 2KNBA 4W9LA 3DOWA 3JSVA 2I1JA 1KM7A 2ZCCA 2KJ6A 3QJZA 3HIZA 4IWOA 2JZZA 1V81A 3TL5A 2LVQA 1SGHA 3QCAA 2KMAA 3ZO5B 2HE7A 3Q3JA 2V4LA 3KUCB 2C9WB 2FCQA 3DDCB 4EOYA 5HKHA 4BKGA 3V6EB 2G3QB 4HCNB 1LM8B 2L0FA 3RD2A 3VAWA 2MLBA 5G55A 2KC1A 2O6VD 2KX3A 1A5RA 4NJ7A 4LJPB 3WIMA 3A9KA 4RM9A 2KTFA 2LUEA 4MGYE 4W9JA 4IM2A 4TUUA 4HCPB 3VUYA 3L08A 4AOFA 2BYVE 2J7QB 4MSQB 5G2NA 5JHBA 2N9EB 2RSUA 4AJYB 1WFYA 2LRWA 2PPHA 3CMMB 2MA9B 3T8MA 2KD0A 4BKSA 4DHZB 3PSEB 1Q5WB 2N9XA 4KDLB 4FJZA 3W1SC 1I42A 2NBUA 2DAJA 3LDZE 4JL9A 1YX5B 4ZRKA 2L0TA 3ZKJC 1T0YA 4A3OA 4JLCA 3ZRFA 4ANXA 4TQ1A 4E74A 4II3B 3VXWA 2KFKA 3T9LA 3NZUA 3KH0A 2O6VB 4URKA 2BF8B 3NZSA 3DVGX 1IPGA 2REXA 2Z59B 2LGYA 1VCBA 1P1AA 1WGHA 2IY1B 1UELA 4HJKA 3JW0X 3R7RA 1WGRA 3U30A 2FUHB 4B95A 4KDIC 1UBIA 2YLMA 2DHZA 3W1YA 3HM3A 1E7UA 1WMHB 2C5LC 1WZ0A 2YVCA 1XQQA 3LJ3A 4GDLB 4MJSA 4B6WA 4IM3A 4ANVA 2GBNA 2AEHA 2BWES 5CHFA 3VQIA 2BGFA 3JVZX 1L7YA 3PRPB 2ASQA 2IO2B 1YD8U 4MEMA 2KN5A 4I6NB 4LDTD 5BO4B 4AUQC 3PV1A 3DQVA 4GDKA 2N7EA 1GJZA 2K8HA 1MG8A 1LXDA 4MGKE 1WI0A 4TQ0A 4EEWA 4HVBA 2Z0EB 3RT3B 2JT4B 2LJ5A 4ZYNA 3VH4B 3R66C 5EDSA 3ECIA 4BFRA 3VH3B 2LVPA 4DXAB 2HJ8A 4CHKA 2D11A 4HK2A 2KQSA 3HM6X 4KSLC 1Z5SB 3ZUNA 2NVUI 2CHXA 2BPSA 4ZRJA 2KC2A 4ICUA 2ZNVB 4LJOB 3RUIB 4MM3A 3VTUA 2KWUB 2IZVB 3A9JB 2XK5B 1WXAA 4M8NA 3S2AA 2CKHB 4JGHB 2FAZA 4I6PA 3DBHI 2CHZA 2K8BA 2L3ZA 4LDTB 2GBRA 3P2BA 3UGBB 2KJHB 4WWNA 2M8SA 4DHZE 2B3AA 5D2MB 3ZRCA 5DPSA 3K9OB 4KSKC 5JHAA 3OJ3A 4HDQA 1Q0WB 3H7PA 1E8WA 3ZNZB 1WX9A 2J0KA 1UZXB 2O2VB 3L0WB 2GBJA 5C23A 2JUOA 3WAMA 4NPNA 3PPAA 2MBQA 1AARA 2UWQA 3ML8A 2MWSB 2BKFA 2J0JA 1WF9A 4ANWA 3MJWA 4MGIE 4WJNA 4X57B 1RLFA 2GBMA 1WH3A 3QAQA 5IA7A 4MSMB 2KLCA 2KTRA 4IG7B 3R7QA 3AU5A 2JRIB 2KLGA 1VD2A 4KIKB 2EKEC 2MW5A 1GNUA 1OGWA 5CHVC 3V61A 5AEKB 3A33B 2DZIA 2AWTA 2KDFB 4JQWC 4NY0A 1S1QB 3EC8A 5JH5C 2KXJA 2MBHA 4DHJD 3PREA 1RRBA 2GOWA 5IAAC 4W9FA 5KHOA 1WXSA 2RPQA 4NAWB 1WJ6A 3BINA 4W9KA 3DPDA 4PYUA 3ZDMC 3RULA 5AZHA 3ZNGC 3QC8B 4E71A 2HD5B 4IUMB 3SD5A 4A3PA 3C0RB 3ZNID 3M3JA 4KV2A 1D3ZA 1V2YA 3JSVB 1OEYJ 3IFWB 3V62A 4BOSC 3B0AA 1LFDA 5DPTA 3IHPC 3JYUA 3HK0A 3NY5A 5GMVA 2NPTA 4AWJA 4DWFA 2KWVB 4XX5A 1KOTA 2KDIA 1UD7A 2WYQA 2DZKA 3ZTDA 3D32A 4NJ6A 3L10B 4GSWA 2V3SA 2G4DB 3RYTA 1KJTA 2C7HA 3IBEA 4ASWC 3AULA 4WWOA 2FIFA 1UGMA 2G4SA 4HXDA 4DHJB 4EFOA 1EF1A 5CX3A 3ZNHB 2KDBA 5J18A 4IC7B 3VVWB 2LVOA 3I3TB 2KANA 2CS4A 2MCNB 3BY4B 3VDZA 1X1MA 1EUVB 3KW5B 5KHQA 2MQJA 1WZ3A 5AZFA 2LWPA 3U7DA 2R2QA 4KVGB 4BBNF 2K8CA 3PS6A 4G3XB 1BT0A 3DVNV 3KUDB 3N30A 2PE6B 4HWIB 2LXAA 4W9GA 2XEWA 4GU2A 3PTFC 4K7SA 1V5TA 3M95A 1C1YB 4GB9A 3X0WA 1E5WA 2WWZA 2LXCA 4K81A 3ZVVA 4FBJB 4MGZE 1WR6E 1WX7A 4I6LB 1GG3A 2KK8A 1NBFC 1J0GA 1P0RA 2PEAA 2M4NA 2A4ZA 4GDLA 4FHKA 1WXVA 2L76A 2V1YA 4LCDE 1Z2MA 5J2RA 2L7RA 2MP2A 2W9NA 2NBVB 1ZW7A 2MBOA 2N7DA 2OOBB 2LGDA 2ZCBA 4ZDVA 5CHWA 3L16A 5JZEB 5L95C 4W9IA 1P98A 1WJUA 2RR9A 2N9PC 4MDKE 4RMAA 2OJRA 3DBLI 3OJ4B 4NNJB 3KYCD 3H1UA 2WDTB 3R3MA 3KVFB 3ALBA 3A1QA 3VTWA 3KYDD 4MELA 3WAOA 2MBBB 3HHMA 1YIWA 3A9JA 1WM2A 2XK5A 2DENB 2DX5B 4K7WA 3RCZA 4WAAA 3RZFA 1SIFA 2KMCA 3VHTC 1WGYA 1WYWB 1WGGA 4G0NB 2EMTA 4K7UA 2UYZB 2D3GA 2AL6A 1C3TA 1V80A 3DCGA 1PQSA 3SDLC 2KKCA 4OVVA 3UIPB 1L2NA 1Q1OA 1WE7A 2JZ3B 3SHQA 2ZEQA 4ZRIA 1H4RA 2IO0B 3PRZA 3RZWC 1TBEA 4IM0A 4EZKA 1WM3A 4WWPA 2HTHA 1Y8RC 3TCAA 3L13A 3AXCA 3A4RA 2O2VA 3AI5A 3WANA 3WALA 2N1VA 3DBSA 3L17A 2L00B 2LRUA 3PVLA 4XZ4A 2NBWB 1EF5A 2J0MA 2N1WA 3APFA 3ML9A 3PLUA 4YL8A 1RFAA 3VUWA 3W1SA 2LI5A 2KHWB 3VFKA 3PHXB 1WRDB 2NS5A 3ENEA 2KX0A 3GZNI 3H9DA 2DZMA 2FCMA 3QX1A 4FULA 4KZCA 4NQLB 4CO7A 1GC6A 2BWFA 2CHWA 3MHSD 4KIKA 2EMSA 4CYEA 2D07B 1TGZB 4W9CA 2MRPA 5FR6A 1UBQA 1TZ1A 4JIOU 5E6OA 3U8ZA 4A20A 5L83A 2MX2A 4FLHA 3TIXA 1G6JA 1QZEA 1P3QU 2BYFA 2Z0DB 2ZPYA 4NAWA 4G11A 3EHVA 4EZLA 3TMPB 4DDGD 4GN1A 5D94A 3CSTA 4II2B 4GGQA 4AJWA 4PS8A 4W9HA 2ZVOA 4FA6A 1V6EA 3UF8A 1ISNA 2MBEA 2LD9A 2DYOA 1V49A 2M0XA 3MTNB 2ZVNA 4GMVA 4EZJA 5LXHA 1M94A 4IW0A 3VUXA 1OTRB 1E8YA 2M1MA 2FCSA 4HPLB 2AL3A 3V60A 3X23A 4BKSD 3V6CB 2C7NB 5E6NA 4F7ZA 1YX6B 3PHWB 4WJOA 1WR1A 3QA8A 1OEYA 4FADA 3L54A 4IWPA 1WJ4A 2ZPNA 1WIAA 2KWCA 2ZNVC 4F8CB 3EFUA 3Q3FA 3QQ8B 4FHJA 3N32A 3N3KB 1YJ1A 4DBGA 3UINB 2G45B 2JPHA 2KZRA 4GOCA 2JF5A 2NPTB 2JXXA 2JRHA 3A9KB
chains in the Genus database with same CATH superfamily
3VR9B 1WE6A 1YMHE 1H8CA 2C7MB 1I35A 2W3RA 1ACCA 3ZJVA 4PS7A 3A4SC 3Q8EA 1T0RC 2D10A 3AE3B 4P6VF 2LZ6A 1OQYA 2BYTA 1N6ZA 2V3PA 1WX8A 1N60A 2I1KA 2IYDB 5LLIA 2KQ7A 4UDUC 1ZGUB 4F1SA 2PIAA 3ZTCA 2JX5A 4US9A 2C60A 2H89B 5G5GA 1PGBA 2BT6A 1L0YB 4W9DA 1SJED 2DYMA 1KLVA 3TEZA 3IVFA 4YXDB 1HE8A 2CU1A 3QIJA 2MP2B 2WXHA 2Y5BB 2CJNA 3PLVA 4PS3A 2WU2B 1TY2A 1R4NI 3O65B 2WXRA 2JYTA 1V9JA 3U7ZA 4K1RB 1VR9A 2VH1A 3UQBA 2JWZA 2WXMA 4E3CA 3AB5A 3PGEA 4ICVA 2KVRA 4MH0E 5JXVA 4ANUA 1K51A 3A1QB 3FC4A 4IWQA 5J17A 3H6NA 1V86A 1S3SG 2WXPA 4GXBA 2FUG1 4M0WB 4GIVA 1JRUA 1NEKB 4ZRQA 3EGRA 3NOBA 3UIOB 5GXGB 4ZYSA 2L8JA 4ZHPA 2KDEB 4YSZB 1AWDA 1N5WA 3CF6E 3ZW3A 1J8CA 3DVNU 4JPSA 2OEDA 1AN8A 1MHXA 2Q5WD 4JE3B 3EFCA 1N62A 2JZZA 1L0XB 3MC8A 2LVQA 3N1YC 3KUCB 3IT6B 2C9WB 1FXIA 1HTOA 3V3XA 4ACFA 3RD2A 1MG4A 3N9YC 1XF5L 2O6VD 1I4RA 3FAHA 4MGYE 4ZOHC 4NJCA 3L08A 3EUB2 2BYVE 2LEKA 3ZXRA 5JHBA 2N9EB 4AJYB 5HI1A 2PPHA 4DHZB 1AYFA 3LDZE 1C4CA 2XN9C 4JL9A 4ZRKA 3Q3MC 2OHFA 4JLCA 1UNSA 3ZRFA 4HKZE 4II3B 2KFKA 3T9LA 3NZUA 4URKA 2GI9A 2PVOD 1NVID 3NZSA 2IY1B 1WGHA 3JW0X 3R7RA 4KDIC 2YLMA 4S0RA 1WMHB 1XQQA 1F2RI 2GBNA 2X8XX 2KN5A 4I6NB 4AUQC 3BWUD 4GDKA 1JWSD 2LJ5A 3VH4B 3IT4B 2HJ8A 4CHKA 5BMIA 1E7PB 1AW7A 1Z5SB 3E56A 3MC9A 2KC2A 1J7AA 4LJOB 2IZVB 2XK5B 4I6PA 2CHZA 2GBRA 2J52A 3Q69A 2M8SA 3OJ3A 4HDQA 1WX9A 3I63C 4L1BA 1UZXB 3L0WB 1D4BA 3PPAA 1QLBB 2MBQA 1YJIA 4WWMA 4X57B 5EE1A 3R7QA 5IN7A 4O1NA 3AU5A 2BS4B 1GNUA 4M02A 3V61A 3A33B 1M4VA 3NVZA 2DZIA 5T8IA 5EE9A 4NAWB 4AQ7A 5AZHA 3ZNGC 3QC8B 2HD5B 4A3PA 1F77A 1XO3A 3M3JA 3JSVB 1LFDA 2Z8LA 3IHPC 1XCQL 5H8YE 4AWJA 1XLNA 1JMLA 2EELA 5BYRA 4L2YA 1BUIC 2ONQA 2DZKA 1SE4A 3D32A 4NJ6A 4YSXB 4ARCA 2V3NA 1LGRA 3DHGC 2FIFA 4HXDA 4DHJB 2K9XA 4EFOA 3Q8CA 4IC7B 3N20C 3I3TB 4XWTA 1EUVB 1JWAD 2R2QA 2RDHA 4G3XB 1XXGA 1ZUD2 2H88B 4W9GA 3GP7A 2WWZA 2LXCA 4MT5A 5C3JB 1SE2A 1F0ZA 1ZDVA 1T6BX 2M4NA 2L76A 3I57A 1UGJA 2QILA 1Z2MA 2AQ3B 1I4HA 2PTLA 3AE1B 2VZKD 2OOBB 5CHWA 2LGSA 2HDEA 1LO5D 1UWXA 3L16A 5JZEB 4C7ZA 3GE3C 4MACA 2WDTB 3R3MA 3AEFB 4C7YA 3U2SC 2MBBB 3HHMA 3RNCC 3AE9B 3ZJTA 2KMCA 1IBXA 1WGYA 4OZBA 1WGGA 1C3TA 3SDLC 2KKCA 1ET6A 3SFEB 3KWVA 3R2TA 1WE7A 4RF0A 4MM3B 1FRDA 3RZWC 4M00A 4EZKA 4WWPA 3TCAA 2HTHA 1N63A 3A4RA 5EE0A 3WANA 3WALA 2N1VA 2LRUA 3PVLA 2J0MA 2KT7A 2W3SA 2KHWB 3VFKA 3PHXB 2D3CA 3QX1A 3AV8A 2BWFA 3MHSD 4KIKA 2EMSA 1FNWA 1G6JA 1P3QU 2Z0DB 4C4VB 3TMPB 4DDGD 3BYYB 4GGQA 4YSYB 4FA6A 2YEPB 1ISNA 2MBEA 2LD9A 2DYOA 1V49A 3MTNB 1JALA 2BBCA 1OTRB 1E8YA 1ZXIA 3X23A 3V6CB 4A8XC 2JYEA 5E6NA 4FADA 3RPFC 1WIAA 2KWCA 4F8CB 3Q3FA 4FHJA 4DQOC 1YJ1A 2QIEB 4C56C 5IOIA 2JF5A 2NPTB 1XLPA 2JZPA 3A9KB 3GS2A 3U4EG 2QCZA 4B0EA 1DYQA 4TKNA 3VTVA 4PYZA 3ZDTA 2BKRB 3PT2B 5C1ZA 2O6VA 3NZ3A 2IO1B 4BBNC 4NQKE 4IKGA 4HDOA 3NHEB 1TZOA 4P16A 3EA6A 3W2DA 1TJEA 2L32A 2RPVA 4JWUC 1KTKA 1WXQA 2BYEA 2LFIA 2K39A 2XBBC 3Q8AA 1WGDA 4HJGE 1L4ZB 2RD0A 2GMIC 2ACZB 3TEXA 2DLBA 3WCQA 1SIJA 4N6EB 4D2KA 3DWGC 1XLQA 4MJSB 3VR8B 3P4QB 3B2GA 2K6QA 4DDID 2IY0B 1CMXB 3APCA 2LHDA 2WGSA 1ZDXA 4RGTA 2RDGA 2FNJB 2IO3B 2KACA 2MJEA 4XDDA 1KRHA 3B08A 2AX5A 4XGAB 3NS8A 4HLEA 4LNNA 2IGHA 2K6DB 5D7GA 2D2QA 4EE2A 1E9MA 1EU3A 3AEBB 1E8ZA 4W9EA 3CSFA 3TBLD 2BS3B 2IPKD 1YJJA 4FN2A 2NR2A 1T0SC 2WX0A 1FFVA 2PJHA 1CJEA 3HVDA 1KF6B 4HPMB 2KJRA 4KKJA 3PO0A 1YQBA 2CJOA 2LGXA 1DGJA 3H7PB 3ZJUA 3P4RB 1E7VA 2ZZPB 1EWCA 2NCNA 1E90A 3W5UB 3QARA 4K3BA 1VZ6A 2G1EA 3APDA 4TV3A 2WXFA 4WJPA 2KTRB 5DCNA 1QOFA 3QHTA 2FIDA 1ZXHA 2AYOB 1R4MI 1FXTB 4US8A 4PK1A 2KNBA 2KDMA 3DHIC 2RMMA 2I1JA 3DOWA 4ZRPA 4IWOA 3Q6BA 3DBLB 1VJKA 1SGHA 3QCAA 4OZAA 5HHDG 2KMAA 2JSVX 2V4LA 4YTMB 3VRAB 5HKHA 3MJ5A 1NYQA 2MLBA 2OJWA 5G55A 2KC1A 2KX3A 4RGNA 3WIMA 4RM9A 2LUEA 4AOFA 2J7QB 4RH6A 1E10A 2MA9B 2XNAC 2KD0A 3SR6A 4BKSA 3PSEB 2N9XA 4KDLB 1C4AA 1EWYC 1SSNA 1ZE3D 1YX5B 1T0YA 3GB1A 3GZNB 1JCKB 3DVGX 3AEDB 1ZP0B 3RMKC 4USAA 3W1YA 1VZ7A 1E7UA 3FILB 4GDLB 4ANVA 1JW9D 1ZPSA 2BGFA 2CU3A 1YD8U 4QAYA 4MEMA 2WXNA 4WQMA 3N1XC 4TMAB 2WP9B 4NAMA 2N7EA 1GJZA 1LXDA 1SXTA 1WI0A 4TQ0A 4OHJA 4EEWA 2JT4B 4ZYNA 3R66C 1UF0A 3ZYYX 4BFRA 2LVPA 3B2FA 2D11A 4HK2A 2NTTA 2KQSA 3AEAB 1OQQA 1TS3A 2ZNVB 3RUIB 2KWUB 1ENFA 3AN1A 3A9JB 2SAKA 3ZQ4A 2CKHB 4JGHB 3DBHI 3TUOA 4LDTB 4WWNA 3ETRA 2QC8A 5D2MB 5DPSA 3K9OB 5JHAA 3T3NA 1Q0WB 3ZNZB 1JQ4A 4DXGA 2O2VB 3NRZA 2GBJA 3WAMA 2UWQA 2BKFA 2J0JA 3MJWA 2J53A 1D5XC 2GBMA 1WH3A 1MHHE 4IG7B 5FKAC 2JRIB 1Y56A 4PT5A 2AQ1B 1OGWA 1HZ6A 3Q14C 3URYA 1FO4A 1L6UA 2KXJA 2GOWA 5IAAC 5KHOA 1D5MC 1WXSA 2RPQA 3C0RB 4L23A 3V62A 1OEYJ 5DPTA 3I9V1 1MFWA 2PVGC 2I2YA 2KDIA 2WYQA 3SFDB 3ZTDA 3L10B 1WRIA 2V3SA 2G4DB 3RYTA 2BQQA 2C7HA 4ASWC 1UGMA 2G4SA 1EU4A 5CX3A 5J18A 1X1MA 1JROA 3ZGZA 1MPEA 3U7DA 1UWMA 5AZFA 4KVGB 1WSPA 2K8CA 3N30A 2LXAA 4K7SA 4BZAA 3SEBA 1QQRA 1V1PB 3ZVVA 4MGZE 3VRBB 1SJHD 3ZXVA 4LNOA 1GG3A 2KK8A 1NBFC 2QSDA 3BK1A 1P0RA 2A4ZA 2WLBA 4FHKA 1GOZA 4LCDE 2LGIA 1L4DB 1QOGA 2KQ4X 3Q3NC 2W9NA 4IDIA 2LGDA 2ZCBA 1HZ5A 3UI3A 5L95C 4XYCA 1WJUA 2RR9A 2K22A 4RMAA 1C77A 5BYQA 1Q10A 3DWMA 1PFDA 1R7SA 5HG2A 1FCLA 5D3IB 1SB3C 1YIWA 2XK5A 4WURA 2DX5B 4K7WA 2D5GA 4RF1A 3VHTC 4G0NB 1TYGB 2UYZB 2D3GA 3BIID 3DCGA 3TEYA 1V1OA 1L2NA 1MJDA 1Q1OA 2JZ3B 1FXAA 4N59A 3BYTB 2LHEA 2IO0B 1GB1A 2INPE 5IP4D 1Y8RC 3AI5A 4JWSC 2Y5CA 4XZ4A 3MFGA 2NBWB 2NS5A 3LB8C 4KZCA 5IO9A 2FCMA 4FULA 1GB4A 2CHWA 4CYEA 1TGZB 3U52E 1XLOA 1UBQA 1TZ1A 1IGCA 4JIOU 5E6OA 4A20A 2MX2A 1QZEA 2ZPYA 2WU5B 4NAWA 4EZLA 1KLUD 4PS8A 1TKGA 4HEA1 5LXHA 2ZVNA 4IW0A 4HPLB 1TT5B 2AL3A 2INDC 2WDRB 3V60A 4BKSD 2UU7A 2C7NB 2WS3B 4WJOA 3W5VB 1PUTA 3L54A 3HRDD 3QQ8B 3N3KB 3GE8C 4DBGA 4GOCA 3AEEB 2WHIA 3AEGB 2JXXA 2JRHA 1HA5A 2R2OA 1K8RB 4BVUC 1WJNA 4J3OD 2JVCA 4J6IA 4ARIA 2GRIA 5TR5A 3DBRB 5BYSA 1NI2A 5MPOA 2KO3A 3KQ4A 4KZ0A 4XC2A 4EKUA 3PRMB 2KMMA 4B9KA 2HJ1A 4HPPA 4Q2JA 4TSSA 4AP4C 3WA0A 2KFJA 3SU8X 1RWSA 5CTRC 2K25A 1EO6A 3AU4A 1JWBD 2KN4A 2BW2A 4RM8A 1WXMA 1TS2A 2ON8A 1FNUA 1DOIA 1U4AA 4WQOB 5AZGA 5TSSA 1L0VB 3KUZA 1IYFA 3PZ8A 1NYRA 3C8YA 1GC7A 3M63B 1V8CA 5AUKA 1QILA 1SE9A 2VH2A 2MSED 3QK0A 1P7EA 3NVWA 4WH4A 3BVMA 2PKOA 5D6JB 1GUAB 3AH7A 1QOAA 2ZW1A 1YN3A 1PYWD 5LXIB 2L05A 1TTNA 4M8MA 3OAWA 2M0AA 1IBXB 2K0PA 1XD3B 3Q8FA 5HFYA 4BKTA 4FJVB 2ZJDA 1LQBA 3QWZB 3MHZA 2RGFA 3WAPA 1D5ZC 4BOZB 1E8XA 2WX1A 3DBRI 3EECA 1J19A 3BK2A 3ONSA 2WXJA 2N9KA 1XEEA 5AUIA 4G50A 1BMLC 2QEJC 1K53A 4C4VA 2A5UA 1F9JA 3DVGY 2M17A 3IG3A 3AE5B 1J7CA 1L5PA 1FM0D 2ZCCA 3QJZA 4RCOA 2LJIA 4YTPB 3DDCB 4EOYA 1PGAA 2G3QB 3Q2AC 1LM8B 1FNVA 1C76A 4OW0A 1A5RA 2D3AA 3A9KA 2KTFA 4A90A 1CQVA 4IOIE 1YN4A 5G2NA 2W54A 1WFYA 2LRWA 3CMMB 1IGDA 3RFZB 1Q5WB 4FJZA 3W1SC 4LK0M 1I42A 2DAJA 2WNMA 4ZHOA 2L0TA 5FR3A 2WDQB 4ANXA 1TS5A 4TQ1A 4E74A 3VXWA 3KH0A 1HXYD 2O6VB 2BF8B 2Z59B 2YEPF 3H8HA 2LGYA 1QT9A 1P1AA 1VCBA 3KLSX 1UELA 1V97A 4HJKA 1WGRA 2FE8A 2BVCA 2FUHB 1UBIA 2DHZA 3TSSA 1WZ0A 2YVCA 4MJSA 4N58A 2AEHA 2BWES 5CHFA 3JVZX 2IO2B 1JWUD 1HEZE 4MGKE 2DWQA 2Z0EB 2N0SB 5EDSA 3ECIA 3HUIA 3VH3B 3HM6X 4KSLC 2KYWA 2NVUI 3ZUNA 2CHXA 2BPSA 4ZRJA 2K5PA 4ICUA 5EE3A 3VTUA 2INCC 3S2AA 3AE4B 2FAZA 2K8BA 2L3ZA 4OZCA 3R2IA 2KJHB 4HKQA 2BTEA 4ITKA 4DHZE 3ZRCA 1RYJA 4KSKC 1E0ZA 3H7PA 2J0KA 2D3BA 2L52A 5C23A 2GB1A 1K50A 2JUOA 1AARA 4CQNA 1T5XD 2MWSB 1YQ3B 1WF9A 4MGIE 1RLFA 3QAQA 5IA7A 4MSMB 2KLCA 2KTRA 1IUEA 2KLGA 1YNTE 2R61A 5AEKB 2AWTA 2KDFB 4JQWC 3TEWA 1S1QB 3EC8A 4DHJD 2MBHA 1SBBB 5D3DA 3RNEC 4PYUA 3ZDMC 3RULA 1R4NB 3ZNID 3IFWB 1WYGA 4LNFA 3JYUA 3P63A 1NENB 2X38A 1KOTA 2W82A 1UD7A 2WXQA 1F1HA 4GSWA 1QF6A 2DBYA 3ABVB 1KJTA 3IBEA 1GPXA 3AULA 4WWOA 1VDVA 3ZNHB 3P4SB 2LVOA 3C19A 2CS4A 1OQRA 2K3UA 2MCNB 3VDZA 2JXTA 2MQJA 2LWPA 4BBNF 3DVNV 3KUDB 2PE6B 2NMQA 4GU2A 3PTFC 1V5TA 1C1YB 4NZLB 1E5WA 4XE0A 4K81A 4FBJB 1F2RC 4AS1A 2J42A 1WX7A 4JX1C 3R8BA 3CIRB 2WXLA 2PEAA 3FILA 2L83A 4GDLA 1GAQB 5J2RA 2L7RA 2MP2A 1ZW7A 2N7JA 4BAXA 4W9IA 2OJRA 3DBLI 4NNJB 1K52A 3BVZA 1VLBA 3KYCD 2G9HD 3H1UA 5C2TB 3RI7C 4P1CC 1EM7A 3A1QA 3VTWA 1DOYA 3WAOA 1QOBA 2RDBC 1WM2A 3A9JA 1CZPA 3AM9A 4WAAA 3RZFA 1SIFA 3OWEB 4K7UA 1WYWB 4WAFA 2EMTA 2KWDA 4RGOS 4XDCA 3PZ7A 1I4XA 1PQSA 2VZKB 4M0WA 1YQ4B 2EKIA 4WIPA 3I5JC 2BS2B 2ZEQA 4ZRIA 1H4RA 2TSSA 1TBEA 4IM0A 2MH7A 3L13A 2O2VA 1TKYA 1ZOYB 2MJDA 3L17A 1F52A 2L00B 3P4PB 3PLUA 3APFA 4YL8A 3ML9A 3VUWA 1RFAA 2PLPA 1WRDB 3ENEA 3GZNI 5IKCM 3H9DA 2DZMA 2BB5A 4CO7A 4NQLB 2SEBD 2D07B 4W9CA 3P42A 5FR6A 3U8ZA 3AE2B 4YWGG 4FLHA 4H2AA 2BYFA 1SF0A 3EHVA 4G11A 1C79A 4GN1A 5D94A 4W9HA 2ZVOA 1V6EA 1TY0A 4REZA 3UF8A 1FFUA 2M0XA 4GMVA 1J7BA 4R3DA 1FPYA 1FEHA 2WQYB 3VUXA 2M1MA 4F7ZA 1YX6B 3PHWB 1OEYA 2DNFA 2ZPNA 3N32A 2G45B 3E9SA 1E6EB 2DYBA 3K9PB 1IP9A 3PZDA 2KOXA 1N5XA 1B9RA 1V1PA 2GBKA 3AE8B 1UH6A 2ZW0A 2JQRB 2LASA 4EUTA 5BMGA 3IAS1 2K1FA 1WMHA 1RAXA 4DK5A 2KFKB 1WY8A 2IGGA 4A55A 3NJTA 5LNK1 3M62B 1WWTA 1NDDA 3RNBC 2GLSA 1V5OA 3HVZA 2DZJA 3H7SA 4GDKB 2DAFA 4P7IA 2IBIB 3OLMD 1ZKHA 2QMTA 3TJPA 3NVYA 3GOEA 4OVUA 1ROEA 2FCNA 1XT9B 4FJYA 4HROA 1P9DU 3OG5A 2CR5A 3L4PA 2NTSA 1TKEA 4KGRA 4A9AA 2VRRB 4LTUA 2PE9A 3ZLZA 1JWMD 5DPRA 2QHOA 2N4FA 3T3OA 2JY6A 5E6PA 5H92C 1DOXA 4LLGM 4S17A 4WJQA 5DPWA 1PGXA 3UQAA 1P7FA 2MEKA 4N9F4 3ZIMA 3B1LX 2PMVA 4W9LA 3JSVA 1KM7A 2KJ6A 3HIZA 1YN5A 1V81A 3TL5A 3ZO5B 2HE7A 3Q3JA 2FCQA 4DXFA 3LYYA 4BKGA 3V6EB 4HRSA 4HCNB 2M56B 2L0FA 2HTME 2KVZA 3VAWA 1I7HA 4LNKA 4NJ7A 4FXCA 4LJPB 1A70A 1D6EC 4W9JA 4IM2A 4TUUA 4HCPB 2WXKA 3VUYA 1QKZA 2E6XA 4MSQB 2RSUA 3MP9A 2INNE 3T8MA 1C4PA 1N61A 3IAM1 2NBUA 2WXGA 4A6QA 3ZKJC 4A3OA 2J4XA 2IJ0A 3RN9C 1C9FA 2Y3AA 1IPGA 1TIFA 2REXA 1KLGD 1MI0A 4P1BC 2I38A 3U30A 4B95A 1FCCC 3HM3A 2C5LC 4B6WA 3LJ3A 4IM3A 3VQIA 1L7YA 3PRPB 2ASQA 4LDTD 5BO4B 2MJ3A 3PV1A 3DQVA 1RM6C 1XCTL 2K8HA 1MG8A 1WGKA 4HVBA 3RT3B 2V0GA 3BZDB 4DXAB 4KKIA 2JU6X 2ICIA 1SE3A 4MM3A 2MHJA 1WXAA 4M8NA 2AQ2B 2Y5PA 3P2BA 3UGBB 3MC0B 2B3AA 3AE7B 1T0QC 1FRRA 4M01A 1E8WA 3RNFC 5E6JA 1VZ8A 4RNAA 4NPNA 3ML8A 2WDVB 3RNGC 4ANWA 3KWLA 4WJNA 5FK9C 3W9CB 2V9HA 3NS1A 1VD2A 4KIKB 2EKEC 2MW5A 5CHVC 2QJLA 4NY0A 5JH5C 3PREA 1RRBA 2IDYA 4W9FA 1ESFA 1HQRD 1WJ6A 2B76B 3BINA 4W9KA 3DPDA 2LUMA 4E71A 1L6VA 4IUMB 1C78A 4K3CA 3SD5A 4KV2A 1D3ZA 1V2YA 4YTNB 4BOSC 1SEBD 3B0AA 1JRPA 3LXFA 3HK0A 5I4DA 3NY5A 5GMVA 2NPTA 4DWFA 1CK1A 2KWVB 3IXSA 4KGTA 4XX5A 2PW9A 1NI3A 3V05A 1RFKA 1OFFA 4YT0B 1EF1A 3AECB 2KDBA 3VVWB 2IGDA 2KANA 3BY4B 3KW5B 5KHQA 1WZ3A 3PS6A 1BT0A 4HWIB 1STEA 2XEWA 4C00A 1BXTA 1I4PA 1HTQA 3M95A 4GB9A 3X0WA 3Q8BA 1WR6E 1I4QA 4I6LB 3FKYA 1J0GA 3NVVA 3RNAC 1TS4A 2QDFA 2V1YA 1R4MB 1WXVA 3CWIA 4OVZA 2NBVB 2MBOA 2N7DA 2WXIA 3BVGA 3AMZA 4ZDVA 3Q3OC 3N1ZC 1P98A 2L1AA 2N9PC 4MDKE 4GLSC 3OJ4B 2KAJA 2JWUA 3KVFB 4C80A 3ALBA 3KYDD 4MELA 4LNIA 1FIQA 1PDXA 2DENB 2BB6A 1FD6A 3RCZA 1UUPA 1FMAD 1VRAB 2WXOA 2AL6A 1V80A 4OVVA 5BMHA 3UIPB 1T3QA 3SHQA 2LMCA 3PRZA 2V4IB 1ET9A 1KH0A 1WM3A 3AXCA 3DBSA 5G5HA 1EF5A 2N1WA 3O13A 4MH8A 3W1SA 2LI5A 3J9CA 2KX0A 3P1MA 1B1ZA 3NUHB 4KGSA 1GC6A 3DHHC 2MRPA 5L83A 2W55A 3B9JA 4KX6B 3TIXA 3AE6B 4RFBA 4B0MA 1KFYB 3CSTA 4II2B 4AJWA 4EZJA 1M94A 2M19A 2FCSA 3NG0A 2FBWB 2E3TA 1WR1A 1YOVB 3QA8A 1I4GA 4IWPA 2N9LA 1WJ4A 2ZNVC 3EFUA 4RGMA 3UINB 4XWWA 2JPHA 2KZRA 3DBHB 1MVKA
chains in the Genus database with same CATH topology
2R2OA 1K8RB 1WE6A 4BVUC 1H8CA 1WJNA 2DYBA 2C7MB 1I35A 2JVCA 4TKNA 4J6IA 3VTVA 4PYZA 3ZDTA 3K9PB 2BKRB 5TR5A 1IP9A 3PT2B 5C1ZA 3PZDA 2KOXA 2O6VA 1NI2A 2GBKA 2IO1B 2KO3A 4PS7A 4BBNC 1UH6A 4KZ0A 3A4SC 4NQKE 4XC2A 3PRMB 4EKUA 2D10A 4HDOA 2LASA 2LZ6A 3NHEB 4B9KA 1OQYA 4EUTA 4AP4C 2K1FA 1WX8A 1WMHA 3WA0A 1RAXA 2I1KA 2IYDB 5LLIA 2KQ7A 2KFJA 4DK5A 2KFKB 1WY8A 2BYEA 3SU8X 5CTRC 2K25A 1ZGUB 4F1SA 2K39A 2XBBC 3ZTCA 1EO6A 1WGDA 3AU4A 2RD0A 2GMIC 4RM8A 3M62B 2C60A 1NDDA 1WXMA 4W9DA 4MJSB 2DYMA 1KLVA 3IVFA 2K6QA 4DDID 1HE8A 2CU1A 1U4AA 2IY0B 3QIJA 1CMXB 1V5OA 3KUZA 4WQOB 3APCA 5AZGA 2MP2B 2Y5BB 1IYFA 3PLVA 4PS3A 2FNJB 2IO3B 2DZJA 3H7SA 1R4NI 4GDKB 3B08A 2DAFA 3O65B 1GC7A 4P7IA 3M63B 2IBIB 1V9JA 3NS8A 4HLEA 3OLMD 4K1RB 1ZKHA 1SE9A 2K6DB 3UQBA 3TJPA 2JWZA 2D2QA 5D7GA 2MSED 4E3CA 3GOEA 3QK0A 3PGEA 4OVUA 1E8ZA 2FCNA 4ICVA 5D6JB 4W9EA 1GUAB 3CSFA 2KVRA 4MH0E 4ANUA 1XT9B 4FJYA 3A1QB 3TBLD 1P9DU 4IWQA 5J17A 4FN2A 2NR2A 2WX0A 2CR5A 5LXIB 2L05A 2PJHA 1V86A 1TTNA 3H6NA 1S3SG 4M8MA 3OAWA 1XD3B 2KJRA 4GXBA 4HPMB 4BKTA 4FJVB 2ZJDA 4M0WB 1YQBA 4GIVA 1LQBA 3QWZB 2VRRB 1JRUA 2LGXA 3H7PB 2PE9A 3ZLZA 2RGFA 3WAPA 3NOBA 1E7VA 2ZZPB 5DPRA 3UIOB 1E8XA 2WX1A 4BOZB 3DBRI 3EECA 1J19A 2QHOA 2N4FA 3ONSA 2NCNA 2L8JA 1E90A 2KDEB 2JY6A 5E6PA 3QARA 4G50A 3APDA 4TV3A 4WJQA 3CF6E 3ZW3A 2A5UA 4WJPA 5DPWA 1F9JA 3UQAA 2KTRB 3DVGY 1J8CA 3DVNU 5DCNA 2M17A 3QHTA 4N9F4 3ZIMA 2FIDA 3B1LX 3IG3A 2AYOB 1R4MI 1FXTB 2KNBA 4W9LA 3DOWA 3JSVA 2I1JA 1KM7A 2ZCCA 2KJ6A 3QJZA 3HIZA 4IWOA 2JZZA 1V81A 3TL5A 2LVQA 1SGHA 3QCAA 2KMAA 3ZO5B 2HE7A 3Q3JA 2V4LA 3KUCB 2C9WB 2FCQA 3DDCB 4EOYA 5HKHA 4BKGA 3V6EB 2G3QB 4HCNB 1LM8B 2L0FA 3RD2A 3VAWA 2MLBA 5G55A 2KC1A 2O6VD 2KX3A 1A5RA 4NJ7A 4LJPB 3WIMA 3A9KA 4RM9A 2KTFA 2LUEA 4MGYE 4W9JA 4IM2A 4TUUA 4HCPB 3VUYA 3L08A 4AOFA 2BYVE 2J7QB 4MSQB 5G2NA 5JHBA 2N9EB 2RSUA 4AJYB 1WFYA 2LRWA 2PPHA 3CMMB 2MA9B 3T8MA 2KD0A 4BKSA 4DHZB 3PSEB 1Q5WB 2N9XA 4KDLB 4FJZA 3W1SC 1I42A 2NBUA 2DAJA 3LDZE 4JL9A 1YX5B 4ZRKA 2L0TA 3ZKJC 1T0YA 4A3OA 4JLCA 3ZRFA 4ANXA 4TQ1A 4E74A 4II3B 3VXWA 2KFKA 3T9LA 3NZUA 3KH0A 2O6VB 4URKA 2BF8B 3NZSA 3DVGX 1IPGA 2REXA 2Z59B 2LGYA 1VCBA 1P1AA 1WGHA 2IY1B 1UELA 4HJKA 3JW0X 3R7RA 1WGRA 3U30A 2FUHB 4B95A 4KDIC 1UBIA 2YLMA 2DHZA 3W1YA 3HM3A 1E7UA 1WMHB 2C5LC 1WZ0A 2YVCA 1XQQA 3LJ3A 4GDLB 4MJSA 4B6WA 4IM3A 4ANVA 2GBNA 2AEHA 2BWES 5CHFA 3VQIA 2BGFA 3JVZX 1L7YA 3PRPB 2ASQA 2IO2B 1YD8U 4MEMA 2KN5A 4I6NB 4LDTD 5BO4B 4AUQC 3PV1A 3DQVA 4GDKA 2N7EA 1GJZA 2K8HA 1MG8A 1LXDA 4MGKE 1WI0A 4TQ0A 4EEWA 4HVBA 2Z0EB 3RT3B 2JT4B 2LJ5A 4ZYNA 3VH4B 3R66C 5EDSA 3ECIA 4BFRA 3VH3B 2LVPA 4DXAB 2HJ8A 4CHKA 2D11A 4HK2A 2KQSA 3HM6X 4KSLC 1Z5SB 3ZUNA 2NVUI 2CHXA 2BPSA 4ZRJA 2KC2A 4ICUA 2ZNVB 4LJOB 3RUIB 4MM3A 3VTUA 2KWUB 2IZVB 3A9JB 2XK5B 1WXAA 4M8NA 3S2AA 2CKHB 4JGHB 2FAZA 4I6PA 3DBHI 2CHZA 2K8BA 2L3ZA 4LDTB 2GBRA 3P2BA 3UGBB 2KJHB 4WWNA 2M8SA 4DHZE 2B3AA 5D2MB 3ZRCA 5DPSA 3K9OB 4KSKC 5JHAA 3OJ3A 4HDQA 1Q0WB 3H7PA 1E8WA 3ZNZB 1WX9A 2J0KA 1UZXB 2O2VB 3L0WB 2GBJA 5C23A 2JUOA 3WAMA 4NPNA 3PPAA 2MBQA 1AARA 2UWQA 3ML8A 2MWSB 2BKFA 2J0JA 1WF9A 4ANWA 3MJWA 4MGIE 4WJNA 4X57B 1RLFA 2GBMA 1WH3A 3QAQA 5IA7A 4MSMB 2KLCA 2KTRA 4IG7B 3R7QA 3AU5A 2JRIB 2KLGA 1VD2A 4KIKB 2EKEC 2MW5A 1GNUA 1OGWA 5CHVC 3V61A 5AEKB 3A33B 2DZIA 2AWTA 2KDFB 4JQWC 4NY0A 1S1QB 3EC8A 5JH5C 2KXJA 2MBHA 4DHJD 3PREA 1RRBA 2GOWA 5IAAC 4W9FA 5KHOA 1WXSA 2RPQA 4NAWB 1WJ6A 3BINA 4W9KA 3DPDA 4PYUA 3ZDMC 3RULA 5AZHA 3ZNGC 3QC8B 4E71A 2HD5B 4IUMB 3SD5A 4A3PA 3C0RB 3ZNID 3M3JA 4KV2A 1D3ZA 1V2YA 3JSVB 1OEYJ 3IFWB 3V62A 4BOSC 3B0AA 1LFDA 5DPTA 3IHPC 3JYUA 3HK0A 3NY5A 5GMVA 2NPTA 4AWJA 4DWFA 2KWVB 4XX5A 1KOTA 2KDIA 1UD7A 2WYQA 2DZKA 3ZTDA 3D32A 4NJ6A 3L10B 4GSWA 2V3SA 2G4DB 3RYTA 1KJTA 2C7HA 3IBEA 4ASWC 3AULA 4WWOA 2FIFA 1UGMA 2G4SA 4HXDA 4DHJB 4EFOA 1EF1A 5CX3A 3ZNHB 2KDBA 5J18A 4IC7B 3VVWB 2LVOA 3I3TB 2KANA 2CS4A 2MCNB 3BY4B 3VDZA 1X1MA 1EUVB 3KW5B 5KHQA 2MQJA 1WZ3A 5AZFA 2LWPA 3U7DA 2R2QA 4KVGB 4BBNF 2K8CA 3PS6A 4G3XB 1BT0A 3DVNV 3KUDB 3N30A 2PE6B 4HWIB 2LXAA 4W9GA 2XEWA 4GU2A 3PTFC 4K7SA 1V5TA 3M95A 1C1YB 4GB9A 3X0WA 1E5WA 2WWZA 2LXCA 4K81A 3ZVVA 4FBJB 4MGZE 1WR6E 1WX7A 4I6LB 1GG3A 2KK8A 1NBFC 1J0GA 1P0RA 2PEAA 2M4NA 2A4ZA 4GDLA 4FHKA 1WXVA 2L76A 2V1YA 4LCDE 1Z2MA 5J2RA 2L7RA 2MP2A 2W9NA 2NBVB 1ZW7A 2MBOA 2N7DA 2OOBB 2LGDA 2ZCBA 4ZDVA 5CHWA 3L16A 5JZEB 5L95C 4W9IA 1P98A 1WJUA 2RR9A 2N9PC 4MDKE 4RMAA 2OJRA 3DBLI 3OJ4B 4NNJB 3KYCD 3H1UA 2WDTB 3R3MA 3KVFB 3ALBA 3A1QA 3VTWA 3KYDD 4MELA 3WAOA 2MBBB 3HHMA 1YIWA 3A9JA 1WM2A 2XK5A 2DENB 2DX5B 4K7WA 3RCZA 4WAAA 3RZFA 1SIFA 2KMCA 3VHTC 1WGYA 1WYWB 1WGGA 4G0NB 2EMTA 4K7UA 2UYZB 2D3GA 2AL6A 1C3TA 1V80A 3DCGA 1PQSA 3SDLC 2KKCA 4OVVA 3UIPB 1L2NA 1Q1OA 1WE7A 2JZ3B 3SHQA 2ZEQA 4ZRIA 1H4RA 2IO0B 3PRZA 3RZWC 1TBEA 4IM0A 4EZKA 1WM3A 4WWPA 2HTHA 1Y8RC 3TCAA 3L13A 3AXCA 3A4RA 2O2VA 3AI5A 3WANA 3WALA 2N1VA 3DBSA 3L17A 2L00B 2LRUA 3PVLA 4XZ4A 2NBWB 1EF5A 2J0MA 2N1WA 3APFA 3ML9A 3PLUA 4YL8A 1RFAA 3VUWA 3W1SA 2LI5A 2KHWB 3VFKA 3PHXB 1WRDB 2NS5A 3ENEA 2KX0A 3GZNI 3H9DA 2DZMA 2FCMA 3QX1A 4FULA 4KZCA 4NQLB 4CO7A 1GC6A 2BWFA 2CHWA 3MHSD 4KIKA 2EMSA 4CYEA 2D07B 1TGZB 4W9CA 2MRPA 5FR6A 1UBQA 1TZ1A 4JIOU 5E6OA 3U8ZA 4A20A 5L83A 2MX2A 4FLHA 3TIXA 1G6JA 1QZEA 1P3QU 2BYFA 2Z0DB 2ZPYA 4NAWA 4G11A 3EHVA 4EZLA 3TMPB 4DDGD 4GN1A 5D94A 3CSTA 4II2B 4GGQA 4AJWA 4PS8A 4W9HA 2ZVOA 4FA6A 1V6EA 3UF8A 1ISNA 2MBEA 2LD9A 2DYOA 1V49A 2M0XA 3MTNB 2ZVNA 4GMVA 4EZJA 5LXHA 1M94A 4IW0A 3VUXA 1OTRB 1E8YA 2M1MA 2FCSA 4HPLB 2AL3A 3V60A 3X23A 4BKSD 3V6CB 2C7NB 5E6NA 4F7ZA 1YX6B 3PHWB 4WJOA 1WR1A 3QA8A 1OEYA 4FADA 3L54A 4IWPA 1WJ4A 2ZPNA 1WIAA 2KWCA 2ZNVC 4F8CB 3EFUA 3Q3FA 3QQ8B 4FHJA 3N32A 3N3KB 1YJ1A 4DBGA 3UINB 2G45B 2JPHA 2KZRA 4GOCA 2JF5A 2NPTB 2JXXA 2JRHA 3A9KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R2O A;  1K8R B;  1WE6 A;  4BVU C;  1H8C A;  1WJN A;  2DYB A;  2C7M B;  1I35 A;  2JVC A;  4TKN A;  4J6I A;  3VTV A;  4PYZ A;  3ZDT A;  3K9P B;  2BKR B;  5TR5 A;  1IP9 A;  3PT2 B;  5C1Z A;  3PZD A;  2KOX A;  2O6V A;  1NI2 A;  2GBK A;  2IO1 B;  2KO3 A;  4PS7 A;  4BBN C;  1UH6 A;  4KZ0 A;  3A4S C;  4NQK E;  4XC2 A;  3PRM B;  4EKU A;  2D10 A;  4HDO A;  2LAS A;  2LZ6 A;  3NHE B;  4B9K A;  1OQY A;  4EUT A;  4AP4 C;  2K1F A;  1WX8 A;  1WMH A;  3WA0 A;  1RAX A;  2I1K A;  2IYD B;  5LLI A;  2KQ7 A;  2KFJ A;  4DK5 A;  2KFK B;  1WY8 A;  2BYE A;  3SU8 X;  5CTR C;  2K25 A;  1ZGU B;  4F1S A;  2K39 A;  2XBB C;  3ZTC A;  1EO6 A;  1WGD A;  3AU4 A;  2RD0 A;  2GMI C;  4RM8 A;  3M62 B;  2C60 A;  1NDD A;  1WXM A;  4W9D A;  4MJS B;  2DYM A;  1KLV A;  3IVF A;  2K6Q A;  4DDI D;  1HE8 A;  2CU1 A;  1U4A A;  2IY0 B;  3QIJ A;  1CMX B;  1V5O A;  3KUZ A;  4WQO B;  3APC A;  5AZG A;  2MP2 B;  2Y5B B;  1IYF A;  3PLV A;  4PS3 A;  2FNJ B;  2IO3 B;  2DZJ A;  3H7S A;  1R4N I;  4GDK B;  3B08 A;  2DAF A;  3O65 B;  1GC7 A;  4P7I A;  3M63 B;  2IBI B;  1V9J A;  3NS8 A;  4HLE A;  3OLM D;  4K1R B;  1ZKH A;  1SE9 A;  2K6D B;  3UQB A;  3TJP A;  2JWZ A;  2D2Q A;  5D7G A;  2MSE D;  4E3C A;  3GOE A;  3QK0 A;  3PGE A;  4OVU A;  1E8Z A;  2FCN A;  4ICV A;  5D6J B;  4W9E A;  1GUA B;  3CSF A;  2KVR A;  4MH0 E;  4ANU A;  1XT9 B;  4FJY A;  3A1Q B;  3TBL D;  1P9D U;  4IWQ A;  5J17 A;  4FN2 A;  2NR2 A;  2WX0 A;  2CR5 A;  5LXI B;  2L05 A;  2PJH A;  1V86 A;  1TTN A;  3H6N A;  1S3S G;  4M8M A;  3OAW A;  1XD3 B;  2KJR A;  4GXB A;  4HPM B;  4BKT A;  4FJV B;  2ZJD A;  4M0W B;  1YQB A;  4GIV A;  1LQB A;  3QWZ B;  2VRR B;  1JRU A;  2LGX A;  3H7P B;  2PE9 A;  3ZLZ A;  2RGF A;  3WAP A;  3NOB A;  1E7V A;  2ZZP B;  5DPR A;  3UIO B;  1E8X A;  2WX1 A;  4BOZ B;  3DBR I;  3EEC A;  1J19 A;  2QHO A;  2N4F A;  3ONS A;  2NCN A;  2L8J A;  1E90 A;  2KDE B;  2JY6 A;  5E6P A;  3QAR A;  4G50 A;  3APD A;  4TV3 A;  4WJQ A;  3CF6 E;  3ZW3 A;  2A5U A;  4WJP A;  5DPW A;  1F9J A;  3UQA A;  2KTR B;  3DVG Y;  1J8C A;  3DVN U;  5DCN A;  2M17 A;  3QHT A;  4N9F 4;  3ZIM A;  2FID A;  3B1L X;  3IG3 A;  2AYO B;  1R4M I;  1FXT B;  2KNB A;  4W9L A;  3DOW A;  3JSV A;  2I1J A;  1KM7 A;  2ZCC A;  2KJ6 A;  3QJZ A;  3HIZ A;  4IWO A;  2JZZ A;  1V81 A;  3TL5 A;  2LVQ A;  1SGH A;  3QCA A;  2KMA A;  3ZO5 B;  2HE7 A;  3Q3J A;  2V4L A;  3KUC B;  2C9W B;  2FCQ A;  3DDC B;  4EOY A;  5HKH A;  4BKG A;  3V6E B;  2G3Q B;  4HCN B;  1LM8 B;  2L0F A;  3RD2 A;  3VAW A;  2MLB A;  5G55 A;  2KC1 A;  2O6V D;  2KX3 A;  1A5R A;  4NJ7 A;  4LJP B;  3WIM A;  3A9K A;  4RM9 A;  2KTF A;  2LUE A;  4MGY E;  4W9J A;  4IM2 A;  4TUU A;  4HCP B;  3VUY A;  3L08 A;  4AOF A;  2BYV E;  2J7Q B;  4MSQ B;  5G2N A;  5JHB A;  2N9E B;  2RSU A;  4AJY B;  1WFY A;  2LRW A;  2PPH A;  3CMM B;  2MA9 B;  3T8M A;  2KD0 A;  4BKS A;  4DHZ B;  3PSE B;  1Q5W B;  2N9X A;  4KDL B;  4FJZ A;  3W1S C;  1I42 A;  2NBU A;  2DAJ A;  3LDZ E;  4JL9 A;  1YX5 B;  4ZRK A;  2L0T A;  3ZKJ C;  1T0Y A;  4A3O A;  4JLC A;  3ZRF A;  4ANX A;  4TQ1 A;  4E74 A;  4II3 B;  3VXW A;  2KFK A;  3T9L A;  3NZU A;  3KH0 A;  2O6V B;  4URK A;  2BF8 B;  3NZS A;  3DVG X;  1IPG A;  2REX A;  2Z59 B;  2LGY A;  1VCB A;  1P1A A;  1WGH A;  2IY1 B;  1UEL A;  4HJK A;  3JW0 X;  3R7R A;  1WGR A;  3U30 A;  2FUH B;  4B95 A;  4KDI C;  1UBI A;  2YLM A;  2DHZ A;  3W1Y A;  3HM3 A;  1E7U A;  1WMH B;  2C5L C;  1WZ0 A;  2YVC A;  1XQQ A;  3LJ3 A;  4GDL B;  4MJS A;  4B6W A;  4IM3 A;  4ANV A;  2GBN A;  2AEH A;  2BWE S;  5CHF A;  3VQI A;  2BGF A;  3JVZ X;  1L7Y A;  3PRP B;  2ASQ A;  2IO2 B;  1YD8 U;  4MEM A;  2KN5 A;  4I6N B;  4LDT D;  5BO4 B;  4AUQ C;  3PV1 A;  3DQV A;  4GDK A;  2N7E A;  1GJZ A;  2K8H A;  1MG8 A;  1LXD A;  4MGK E;  1WI0 A;  4TQ0 A;  4EEW A;  4HVB A;  2Z0E B;  3RT3 B;  2JT4 B;  2LJ5 A;  4ZYN A;  3VH4 B;  3R66 C;  5EDS A;  3ECI A;  4BFR A;  3VH3 B;  2LVP A;  4DXA B;  2HJ8 A;  4CHK A;  2D11 A;  4HK2 A;  2KQS A;  3HM6 X;  4KSL C;  1Z5S B;  3ZUN A;  2NVU I;  2CHX A;  2BPS A;  4ZRJ A;  2KC2 A;  4ICU A;  2ZNV B;  4LJO B;  3RUI B;  4MM3 A;  3VTU A;  2KWU B;  2IZV B;  3A9J B;  2XK5 B;  1WXA A;  4M8N A;  3S2A A;  2CKH B;  4JGH B;  2FAZ A;  4I6P A;  3DBH I;  2CHZ A;  2K8B A;  2L3Z A;  4LDT B;  2GBR A;  3P2B A;  3UGB B;  2KJH B;  4WWN A;  2M8S A;  4DHZ E;  2B3A A;  5D2M B;  3ZRC A;  5DPS A;  3K9O B;  4KSK C;  5JHA A;  3OJ3 A;  4HDQ A;  1Q0W B;  3H7P A;  1E8W A;  3ZNZ B;  1WX9 A;  2J0K A;  1UZX B;  2O2V B;  3L0W B;  2GBJ A;  5C23 A;  2JUO A;  3WAM A;  4NPN A;  3PPA A;  2MBQ A;  1AAR A;  2UWQ A;  3ML8 A;  2MWS B;  2BKF A;  2J0J A;  1WF9 A;  4ANW A;  3MJW A;  4MGI E;  4WJN A;  4X57 B;  1RLF A;  2GBM A;  1WH3 A;  3QAQ A;  5IA7 A;  4MSM B;  2KLC A;  2KTR A;  4IG7 B;  3R7Q A;  3AU5 A;  2JRI B;  2KLG A;  1VD2 A;  4KIK B;  2EKE C;  2MW5 A;  1GNU A;  1OGW A;  5CHV C;  3V61 A;  5AEK B;  3A33 B;  2DZI A;  2AWT A;  2KDF B;  4JQW C;  4NY0 A;  1S1Q B;  3EC8 A;  5JH5 C;  2KXJ A;  2MBH A;  4DHJ D;  3PRE A;  1RRB A;  2GOW A;  5IAA C;  4W9F A;  5KHO A;  1WXS A;  2RPQ A;  4NAW B;  1WJ6 A;  3BIN A;  4W9K A;  3DPD A;  4PYU A;  3ZDM C;  3RUL A;  5AZH A;  3ZNG C;  3QC8 B;  4E71 A;  2HD5 B;  4IUM B;  3SD5 A;  4A3P A;  3C0R B;  3ZNI D;  3M3J A;  4KV2 A;  1D3Z A;  1V2Y A;  3JSV B;  1OEY J;  3IFW B;  3V62 A;  4BOS C;  3B0A A;  1LFD A;  5DPT A;  3IHP C;  3JYU A;  3HK0 A;  3NY5 A;  5GMV A;  2NPT A;  4AWJ A;  4DWF A;  2KWV B;  4XX5 A;  1KOT A;  2KDI A;  1UD7 A;  2WYQ A;  2DZK A;  3ZTD A;  3D32 A;  4NJ6 A;  3L10 B;  4GSW A;  2V3S A;  2G4D B;  3RYT A;  1KJT A;  2C7H A;  3IBE A;  4ASW C;  3AUL A;  4WWO A;  2FIF A;  1UGM A;  2G4S A;  4HXD A;  4DHJ B;  4EFO A;  1EF1 A;  5CX3 A;  3ZNH B;  2KDB A;  5J18 A;  4IC7 B;  3VVW B;  2LVO A;  3I3T B;  2KAN A;  2CS4 A;  2MCN B;  3BY4 B;  3VDZ A;  1X1M A;  1EUV B;  3KW5 B;  5KHQ A;  2MQJ A;  1WZ3 A;  5AZF A;  2LWP A;  3U7D A;  2R2Q A;  4KVG B;  4BBN F;  2K8C A;  3PS6 A;  4G3X B;  1BT0 A;  3DVN V;  3KUD B;  3N30 A;  2PE6 B;  4HWI B;  2LXA A;  4W9G A;  2XEW A;  4GU2 A;  3PTF C;  4K7S A;  1V5T A;  3M95 A;  1C1Y B;  4GB9 A;  3X0W A;  1E5W A;  2WWZ A;  2LXC A;  4K81 A;  3ZVV A;  4FBJ B;  4MGZ E;  1WR6 E;  1WX7 A;  4I6L B;  1GG3 A;  2KK8 A;  1NBF C;  1J0G A;  1P0R A;  2PEA A;  2M4N A;  2A4Z A;  4GDL A;  4FHK A;  1WXV A;  2L76 A;  2V1Y A;  4LCD E;  1Z2M A;  5J2R A;  2L7R A;  2MP2 A;  2W9N A;  2NBV B;  1ZW7 A;  2MBO A;  2N7D A;  2OOB B;  2LGD A;  2ZCB A;  4ZDV A;  5CHW A;  3L16 A;  5JZE B;  5L95 C;  4W9I A;  1P98 A;  1WJU A;  2RR9 A;  2N9P C;  4MDK E;  4RMA A;  2OJR A;  3DBL I;  3OJ4 B;  4NNJ B;  3KYC D;  3H1U A;  2WDT B;  3R3M A;  3KVF B;  3ALB A;  3A1Q A;  3VTW A;  3KYD D;  4MEL A;  3WAO A;  2MBB B;  3HHM A;  1YIW A;  3A9J A;  1WM2 A;  2XK5 A;  2DEN B;  2DX5 B;  4K7W A;  3RCZ A;  4WAA A;  3RZF A;  1SIF A;  2KMC A;  3VHT C;  1WGY A;  1WYW B;  1WGG A;  4G0N B;  2EMT A;  4K7U A;  2UYZ B;  2D3G A;  2AL6 A;  1C3T A;  1V80 A;  3DCG A;  1PQS A;  3SDL C;  2KKC A;  4OVV A;  3UIP B;  1L2N A;  1Q1O A;  1WE7 A;  2JZ3 B;  3SHQ A;  2ZEQ A;  4ZRI A;  1H4R A;  2IO0 B;  3PRZ A;  3RZW C;  1TBE A;  4IM0 A;  4EZK A;  1WM3 A;  4WWP A;  2HTH A;  1Y8R C;  3TCA A;  3L13 A;  3AXC A;  3A4R A;  2O2V A;  3AI5 A;  3WAN A;  3WAL A;  2N1V A;  3DBS A;  3L17 A;  2L00 B;  2LRU A;  3PVL A;  4XZ4 A;  2NBW B;  1EF5 A;  2J0M A;  2N1W A;  3APF A;  3ML9 A;  3PLU A;  4YL8 A;  1RFA A;  3VUW A;  3W1S A;  2LI5 A;  2KHW B;  3VFK A;  3PHX B;  1WRD B;  2NS5 A;  3ENE A;  2KX0 A;  3GZN I;  3H9D A;  2DZM A;  2FCM A;  3QX1 A;  4FUL A;  4KZC A;  4NQL B;  4CO7 A;  1GC6 A;  2BWF A;  2CHW A;  3MHS D;  4KIK A;  2EMS A;  4CYE A;  2D07 B;  1TGZ B;  4W9C A;  2MRP A;  5FR6 A;  1UBQ A;  1TZ1 A;  4JIO U;  5E6O A;  3U8Z A;  4A20 A;  5L83 A;  2MX2 A;  4FLH A;  3TIX A;  1G6J A;  1QZE A;  1P3Q U;  2BYF A;  2Z0D B;  2ZPY A;  4NAW A;  4G11 A;  3EHV A;  4EZL A;  3TMP B;  4DDG D;  4GN1 A;  5D94 A;  3CST A;  4II2 B;  4GGQ A;  4AJW A;  4PS8 A;  4W9H A;  2ZVO A;  4FA6 A;  1V6E A;  3UF8 A;  1ISN A;  2MBE A;  2LD9 A;  2DYO A;  1V49 A;  2M0X A;  3MTN B;  2ZVN A;  4GMV A;  4EZJ A;  5LXH A;  1M94 A;  4IW0 A;  3VUX A;  1OTR B;  1E8Y A;  2M1M A;  2FCS A;  4HPL B;  2AL3 A;  3V60 A;  3X23 A;  4BKS D;  3V6C B;  2C7N B;  5E6N A;  4F7Z A;  1YX6 B;  3PHW B;  4WJO A;  1WR1 A;  3QA8 A;  1OEY A;  4FAD A;  3L54 A;  4IWP A;  1WJ4 A;  2ZPN A;  1WIA A;  2KWC A;  2ZNV C;  4F8C B;  3EFU A;  3Q3F A;  3QQ8 B;  4FHJ A;  3N32 A;  3N3K B;  1YJ1 A;  4DBG A;  3UIN B;  2G45 B;  2JPH A;  2KZR A;  4GOC A;  2JF5 A;  2NPT B;  2JXX A;  2JRH A;  3A9K B; 
#chains in the Genus database with same CATH topology
 3VR9 B;  1WE6 A;  1YMH E;  1H8C A;  2C7M B;  1I35 A;  2W3R A;  1ACC A;  3ZJV A;  4PS7 A;  3A4S C;  3Q8E A;  1T0R C;  2D10 A;  3AE3 B;  4P6V F;  2LZ6 A;  1OQY A;  2BYT A;  1N6Z A;  2V3P A;  1WX8 A;  1N60 A;  2I1K A;  2IYD B;  5LLI A;  2KQ7 A;  4UDU C;  1ZGU B;  4F1S A;  2PIA A;  3ZTC A;  2JX5 A;  4US9 A;  2C60 A;  2H89 B;  5G5G A;  1PGB A;  2BT6 A;  1L0Y B;  4W9D A;  1SJE D;  2DYM A;  1KLV A;  3TEZ A;  3IVF A;  4YXD B;  1HE8 A;  2CU1 A;  3QIJ A;  2MP2 B;  2WXH A;  2Y5B B;  2CJN A;  3PLV A;  4PS3 A;  2WU2 B;  1TY2 A;  1R4N I;  3O65 B;  2WXR A;  2JYT A;  1V9J A;  3U7Z A;  4K1R B;  1VR9 A;  2VH1 A;  3UQB A;  2JWZ A;  2WXM A;  4E3C A;  3AB5 A;  3PGE A;  4ICV A;  2KVR A;  4MH0 E;  5JXV A;  4ANU A;  1K51 A;  3A1Q B;  3FC4 A;  4IWQ A;  5J17 A;  3H6N A;  1V86 A;  1S3S G;  2WXP A;  4GXB A;  2FUG 1;  4M0W B;  4GIV A;  1JRU A;  1NEK B;  4ZRQ A;  3EGR A;  3NOB A;  3UIO B;  5GXG B;  4ZYS A;  2L8J A;  4ZHP A;  2KDE B;  4YSZ B;  1AWD A;  1N5W A;  3CF6 E;  3ZW3 A;  1J8C A;  3DVN U;  4JPS A;  2OED A;  1AN8 A;  1MHX A;  2Q5W D;  4JE3 B;  3EFC A;  1N62 A;  2JZZ A;  1L0X B;  3MC8 A;  2LVQ A;  3N1Y C;  3KUC B;  3IT6 B;  2C9W B;  1FXI A;  1HTO A;  3V3X A;  4ACF A;  3RD2 A;  1MG4 A;  3N9Y C;  1XF5 L;  2O6V D;  1I4R A;  3FAH A;  4MGY E;  4ZOH C;  4NJC A;  3L08 A;  3EUB 2;  2BYV E;  2LEK A;  3ZXR A;  5JHB A;  2N9E B;  4AJY B;  5HI1 A;  2PPH A;  4DHZ B;  1AYF A;  3LDZ E;  1C4C A;  2XN9 C;  4JL9 A;  4ZRK A;  3Q3M C;  2OHF A;  4JLC A;  1UNS A;  3ZRF A;  4HKZ E;  4II3 B;  2KFK A;  3T9L A;  3NZU A;  4URK A;  2GI9 A;  2PVO D;  1NVI D;  3NZS A;  2IY1 B;  1WGH A;  3JW0 X;  3R7R A;  4KDI C;  2YLM A;  4S0R A;  1WMH B;  1XQQ A;  1F2R I;  2GBN A;  2X8X X;  2KN5 A;  4I6N B;  4AUQ C;  3BWU D;  4GDK A;  1JWS D;  2LJ5 A;  3VH4 B;  3IT4 B;  2HJ8 A;  4CHK A;  5BMI A;  1E7P B;  1AW7 A;  1Z5S B;  3E56 A;  3MC9 A;  2KC2 A;  1J7A A;  4LJO B;  2IZV B;  2XK5 B;  4I6P A;  2CHZ A;  2GBR A;  2J52 A;  3Q69 A;  2M8S A;  3OJ3 A;  4HDQ A;  1WX9 A;  3I63 C;  4L1B A;  1UZX B;  3L0W B;  1D4B A;  3PPA A;  1QLB B;  2MBQ A;  1YJI A;  4WWM A;  4X57 B;  5EE1 A;  3R7Q A;  5IN7 A;  4O1N A;  3AU5 A;  2BS4 B;  1GNU A;  4M02 A;  3V61 A;  3A33 B;  1M4V A;  3NVZ A;  2DZI A;  5T8I A;  5EE9 A;  4NAW B;  4AQ7 A;  5AZH A;  3ZNG C;  3QC8 B;  2HD5 B;  4A3P A;  1F77 A;  1XO3 A;  3M3J A;  3JSV B;  1LFD A;  2Z8L A;  3IHP C;  1XCQ L;  5H8Y E;  4AWJ A;  1XLN A;  1JML A;  2EEL A;  5BYR A;  4L2Y A;  1BUI C;  2ONQ A;  2DZK A;  1SE4 A;  3D32 A;  4NJ6 A;  4YSX B;  4ARC A;  2V3N A;  1LGR A;  3DHG C;  2FIF A;  4HXD A;  4DHJ B;  2K9X A;  4EFO A;  3Q8C A;  4IC7 B;  3N20 C;  3I3T B;  4XWT A;  1EUV B;  1JWA D;  2R2Q A;  2RDH A;  4G3X B;  1XXG A;  1ZUD 2;  2H88 B;  4W9G A;  3GP7 A;  2WWZ A;  2LXC A;  4MT5 A;  5C3J B;  1SE2 A;  1F0Z A;  1ZDV A;  1T6B X;  2M4N A;  2L76 A;  3I57 A;  1UGJ A;  2QIL A;  1Z2M A;  2AQ3 B;  1I4H A;  2PTL A;  3AE1 B;  2VZK D;  2OOB B;  5CHW A;  2LGS A;  2HDE A;  1LO5 D;  1UWX A;  3L16 A;  5JZE B;  4C7Z A;  3GE3 C;  4MAC A;  2WDT B;  3R3M A;  3AEF B;  4C7Y A;  3U2S C;  2MBB B;  3HHM A;  3RNC C;  3AE9 B;  3ZJT A;  2KMC A;  1IBX A;  1WGY A;  4OZB A;  1WGG A;  1C3T A;  3SDL C;  2KKC A;  1ET6 A;  3SFE B;  3KWV A;  3R2T A;  1WE7 A;  4RF0 A;  4MM3 B;  1FRD A;  3RZW C;  4M00 A;  4EZK A;  4WWP A;  3TCA A;  2HTH A;  1N63 A;  3A4R A;  5EE0 A;  3WAN A;  3WAL A;  2N1V A;  2LRU A;  3PVL A;  2J0M A;  2KT7 A;  2W3S A;  2KHW B;  3VFK A;  3PHX B;  2D3C A;  3QX1 A;  3AV8 A;  2BWF A;  3MHS D;  4KIK A;  2EMS A;  1FNW A;  1G6J A;  1P3Q U;  2Z0D B;  4C4V B;  3TMP B;  4DDG D;  3BYY B;  4GGQ A;  4YSY B;  4FA6 A;  2YEP B;  1ISN A;  2MBE A;  2LD9 A;  2DYO A;  1V49 A;  3MTN B;  1JAL A;  2BBC A;  1OTR B;  1E8Y A;  1ZXI A;  3X23 A;  3V6C B;  4A8X C;  2JYE A;  5E6N A;  4FAD A;  3RPF C;  1WIA A;  2KWC A;  4F8C B;  3Q3F A;  4FHJ A;  4DQO C;  1YJ1 A;  2QIE B;  4C56 C;  5IOI A;  2JF5 A;  2NPT B;  1XLP A;  2JZP A;  3A9K B;  3GS2 A;  3U4E G;  2QCZ A;  4B0E A;  1DYQ A;  4TKN A;  3VTV A;  4PYZ A;  3ZDT A;  2BKR B;  3PT2 B;  5C1Z A;  2O6V A;  3NZ3 A;  2IO1 B;  4BBN C;  4NQK E;  4IKG A;  4HDO A;  3NHE B;  1TZO A;  4P16 A;  3EA6 A;  3W2D A;  1TJE A;  2L32 A;  2RPV A;  4JWU C;  1KTK A;  1WXQ A;  2BYE A;  2LFI A;  2K39 A;  2XBB C;  3Q8A A;  1WGD A;  4HJG E;  1L4Z B;  2RD0 A;  2GMI C;  2ACZ B;  3TEX A;  2DLB A;  3WCQ A;  1SIJ A;  4N6E B;  4D2K A;  3DWG C;  1XLQ A;  4MJS B;  3VR8 B;  3P4Q B;  3B2G A;  2K6Q A;  4DDI D;  2IY0 B;  1CMX B;  3APC A;  2LHD A;  2WGS A;  1ZDX A;  4RGT A;  2RDG A;  2FNJ B;  2IO3 B;  2KAC A;  2MJE A;  4XDD A;  1KRH A;  3B08 A;  2AX5 A;  4XGA B;  3NS8 A;  4HLE A;  4LNN A;  2IGH A;  2K6D B;  5D7G A;  2D2Q A;  4EE2 A;  1E9M A;  1EU3 A;  3AEB B;  1E8Z A;  4W9E A;  3CSF A;  3TBL D;  2BS3 B;  2IPK D;  1YJJ A;  4FN2 A;  2NR2 A;  1T0S C;  2WX0 A;  1FFV A;  2PJH A;  1CJE A;  3HVD A;  1KF6 B;  4HPM B;  2KJR A;  4KKJ A;  3PO0 A;  1YQB A;  2CJO A;  2LGX A;  1DGJ A;  3H7P B;  3ZJU A;  3P4R B;  1E7V A;  2ZZP B;  1EWC A;  2NCN A;  1E90 A;  3W5U B;  3QAR A;  4K3B A;  1VZ6 A;  2G1E A;  3APD A;  4TV3 A;  2WXF A;  4WJP A;  2KTR B;  5DCN A;  1QOF A;  3QHT A;  2FID A;  1ZXH A;  2AYO B;  1R4M I;  1FXT B;  4US8 A;  4PK1 A;  2KNB A;  2KDM A;  3DHI C;  2RMM A;  2I1J A;  3DOW A;  4ZRP A;  4IWO A;  3Q6B A;  3DBL B;  1VJK A;  1SGH A;  3QCA A;  4OZA A;  5HHD G;  2KMA A;  2JSV X;  2V4L A;  4YTM B;  3VRA B;  5HKH A;  3MJ5 A;  1NYQ A;  2MLB A;  2OJW A;  5G55 A;  2KC1 A;  2KX3 A;  4RGN A;  3WIM A;  4RM9 A;  2LUE A;  4AOF A;  2J7Q B;  4RH6 A;  1E10 A;  2MA9 B;  2XNA C;  2KD0 A;  3SR6 A;  4BKS A;  3PSE B;  2N9X A;  4KDL B;  1C4A A;  1EWY C;  1SSN A;  1ZE3 D;  1YX5 B;  1T0Y A;  3GB1 A;  3GZN B;  1JCK B;  3DVG X;  3AED B;  1ZP0 B;  3RMK C;  4USA A;  3W1Y A;  1VZ7 A;  1E7U A;  3FIL B;  4GDL B;  4ANV A;  1JW9 D;  1ZPS A;  2BGF A;  2CU3 A;  1YD8 U;  4QAY A;  4MEM A;  2WXN A;  4WQM A;  3N1X C;  4TMA B;  2WP9 B;  4NAM A;  2N7E A;  1GJZ A;  1LXD A;  1SXT A;  1WI0 A;  4TQ0 A;  4OHJ A;  4EEW A;  2JT4 B;  4ZYN A;  3R66 C;  1UF0 A;  3ZYY X;  4BFR A;  2LVP A;  3B2F A;  2D11 A;  4HK2 A;  2NTT A;  2KQS A;  3AEA B;  1OQQ A;  1TS3 A;  2ZNV B;  3RUI B;  2KWU B;  1ENF A;  3AN1 A;  3A9J B;  2SAK A;  3ZQ4 A;  2CKH B;  4JGH B;  3DBH I;  3TUO A;  4LDT B;  4WWN A;  3ETR A;  2QC8 A;  5D2M B;  5DPS A;  3K9O B;  5JHA A;  3T3N A;  1Q0W B;  3ZNZ B;  1JQ4 A;  4DXG A;  2O2V B;  3NRZ A;  2GBJ A;  3WAM A;  2UWQ A;  2BKF A;  2J0J A;  3MJW A;  2J53 A;  1D5X C;  2GBM A;  1WH3 A;  1MHH E;  4IG7 B;  5FKA C;  2JRI B;  1Y56 A;  4PT5 A;  2AQ1 B;  1OGW A;  1HZ6 A;  3Q14 C;  3URY A;  1FO4 A;  1L6U A;  2KXJ A;  2GOW A;  5IAA C;  5KHO A;  1D5M C;  1WXS A;  2RPQ A;  3C0R B;  4L23 A;  3V62 A;  1OEY J;  5DPT A;  3I9V 1;  1MFW A;  2PVG C;  2I2Y A;  2KDI A;  2WYQ A;  3SFD B;  3ZTD A;  3L10 B;  1WRI A;  2V3S A;  2G4D B;  3RYT A;  2BQQ A;  2C7H A;  4ASW C;  1UGM A;  2G4S A;  1EU4 A;  5CX3 A;  5J18 A;  1X1M A;  1JRO A;  3ZGZ A;  1MPE A;  3U7D A;  1UWM A;  5AZF A;  4KVG B;  1WSP A;  2K8C A;  3N30 A;  2LXA A;  4K7S A;  4BZA A;  3SEB A;  1QQR A;  1V1P B;  3ZVV A;  4MGZ E;  3VRB B;  1SJH D;  3ZXV A;  4LNO A;  1GG3 A;  2KK8 A;  1NBF C;  2QSD A;  3BK1 A;  1P0R A;  2A4Z A;  2WLB A;  4FHK A;  1GOZ A;  4LCD E;  2LGI A;  1L4D B;  1QOG A;  2KQ4 X;  3Q3N C;  2W9N A;  4IDI A;  2LGD A;  2ZCB A;  1HZ5 A;  3UI3 A;  5L95 C;  4XYC A;  1WJU A;  2RR9 A;  2K22 A;  4RMA A;  1C77 A;  5BYQ A;  1Q10 A;  3DWM A;  1PFD A;  1R7S A;  5HG2 A;  1FCL A;  5D3I B;  1SB3 C;  1YIW A;  2XK5 A;  4WUR A;  2DX5 B;  4K7W A;  2D5G A;  4RF1 A;  3VHT C;  4G0N B;  1TYG B;  2UYZ B;  2D3G A;  3BII D;  3DCG A;  3TEY A;  1V1O A;  1L2N A;  1MJD A;  1Q1O A;  2JZ3 B;  1FXA A;  4N59 A;  3BYT B;  2LHE A;  2IO0 B;  1GB1 A;  2INP E;  5IP4 D;  1Y8R C;  3AI5 A;  4JWS C;  2Y5C A;  4XZ4 A;  3MFG A;  2NBW B;  2NS5 A;  3LB8 C;  4KZC A;  5IO9 A;  2FCM A;  4FUL A;  1GB4 A;  2CHW A;  4CYE A;  1TGZ B;  3U52 E;  1XLO A;  1UBQ A;  1TZ1 A;  1IGC A;  4JIO U;  5E6O A;  4A20 A;  2MX2 A;  1QZE A;  2ZPY A;  2WU5 B;  4NAW A;  4EZL A;  1KLU D;  4PS8 A;  1TKG A;  4HEA 1;  5LXH A;  2ZVN A;  4IW0 A;  4HPL B;  1TT5 B;  2AL3 A;  2IND C;  2WDR B;  3V60 A;  4BKS D;  2UU7 A;  2C7N B;  2WS3 B;  4WJO A;  3W5V B;  1PUT A;  3L54 A;  3HRD D;  3QQ8 B;  3N3K B;  3GE8 C;  4DBG A;  4GOC A;  3AEE B;  2WHI A;  3AEG B;  2JXX A;  2JRH A;  1HA5 A;  2R2O A;  1K8R B;  4BVU C;  1WJN A;  4J3O D;  2JVC A;  4J6I A;  4ARI A;  2GRI A;  5TR5 A;  3DBR B;  5BYS A;  1NI2 A;  5MPO A;  2KO3 A;  3KQ4 A;  4KZ0 A;  4XC2 A;  4EKU A;  3PRM B;  2KMM A;  4B9K A;  2HJ1 A;  4HPP A;  4Q2J A;  4TSS A;  4AP4 C;  3WA0 A;  2KFJ A;  3SU8 X;  1RWS A;  5CTR C;  2K25 A;  1EO6 A;  3AU4 A;  1JWB D;  2KN4 A;  2BW2 A;  4RM8 A;  1WXM A;  1TS2 A;  2ON8 A;  1FNU A;  1DOI A;  1U4A A;  4WQO B;  5AZG A;  5TSS A;  1L0V B;  3KUZ A;  1IYF A;  3PZ8 A;  1NYR A;  3C8Y A;  1GC7 A;  3M63 B;  1V8C A;  5AUK A;  1QIL A;  1SE9 A;  2VH2 A;  2MSE D;  3QK0 A;  1P7E A;  3NVW A;  4WH4 A;  3BVM A;  2PKO A;  5D6J B;  1GUA B;  3AH7 A;  1QOA A;  2ZW1 A;  1YN3 A;  1PYW D;  5LXI B;  2L05 A;  1TTN A;  4M8M A;  3OAW A;  2M0A A;  1IBX B;  2K0P A;  1XD3 B;  3Q8F A;  5HFY A;  4BKT A;  4FJV B;  2ZJD A;  1LQB A;  3QWZ B;  3MHZ A;  2RGF A;  3WAP A;  1D5Z C;  4BOZ B;  1E8X A;  2WX1 A;  3DBR I;  3EEC A;  1J19 A;  3BK2 A;  3ONS A;  2WXJ A;  2N9K A;  1XEE A;  5AUI A;  4G50 A;  1BML C;  2QEJ C;  1K53 A;  4C4V A;  2A5U A;  1F9J A;  3DVG Y;  2M17 A;  3IG3 A;  3AE5 B;  1J7C A;  1L5P A;  1FM0 D;  2ZCC A;  3QJZ A;  4RCO A;  2LJI A;  4YTP B;  3DDC B;  4EOY A;  1PGA A;  2G3Q B;  3Q2A C;  1LM8 B;  1FNV A;  1C76 A;  4OW0 A;  1A5R A;  2D3A A;  3A9K A;  2KTF A;  4A90 A;  1CQV A;  4IOI E;  1YN4 A;  5G2N A;  2W54 A;  1WFY A;  2LRW A;  3CMM B;  1IGD A;  3RFZ B;  1Q5W B;  4FJZ A;  3W1S C;  4LK0 M;  1I42 A;  2DAJ A;  2WNM A;  4ZHO A;  2L0T A;  5FR3 A;  2WDQ B;  4ANX A;  1TS5 A;  4TQ1 A;  4E74 A;  3VXW A;  3KH0 A;  1HXY D;  2O6V B;  2BF8 B;  2Z59 B;  2YEP F;  3H8H A;  2LGY A;  1QT9 A;  1P1A A;  1VCB A;  3KLS X;  1UEL A;  1V97 A;  4HJK A;  1WGR A;  2FE8 A;  2BVC A;  2FUH B;  1UBI A;  2DHZ A;  3TSS A;  1WZ0 A;  2YVC A;  4MJS A;  4N58 A;  2AEH A;  2BWE S;  5CHF A;  3JVZ X;  2IO2 B;  1JWU D;  1HEZ E;  4MGK E;  2DWQ A;  2Z0E B;  2N0S B;  5EDS A;  3ECI A;  3HUI A;  3VH3 B;  3HM6 X;  4KSL C;  2KYW A;  2NVU I;  3ZUN A;  2CHX A;  2BPS A;  4ZRJ A;  2K5P A;  4ICU A;  5EE3 A;  3VTU A;  2INC C;  3S2A A;  3AE4 B;  2FAZ A;  2K8B A;  2L3Z A;  4OZC A;  3R2I A;  2KJH B;  4HKQ A;  2BTE A;  4ITK A;  4DHZ E;  3ZRC A;  1RYJ A;  4KSK C;  1E0Z A;  3H7P A;  2J0K A;  2D3B A;  2L52 A;  5C23 A;  2GB1 A;  1K50 A;  2JUO A;  1AAR A;  4CQN A;  1T5X D;  2MWS B;  1YQ3 B;  1WF9 A;  4MGI E;  1RLF A;  3QAQ A;  5IA7 A;  4MSM B;  2KLC A;  2KTR A;  1IUE A;  2KLG A;  1YNT E;  2R61 A;  5AEK B;  2AWT A;  2KDF B;  4JQW C;  3TEW A;  1S1Q B;  3EC8 A;  4DHJ D;  2MBH A;  1SBB B;  5D3D A;  3RNE C;  4PYU A;  3ZDM C;  3RUL A;  1R4N B;  3ZNI D;  3IFW B;  1WYG A;  4LNF A;  3JYU A;  3P63 A;  1NEN B;  2X38 A;  1KOT A;  2W82 A;  1UD7 A;  2WXQ A;  1F1H A;  4GSW A;  1QF6 A;  2DBY A;  3ABV B;  1KJT A;  3IBE A;  1GPX A;  3AUL A;  4WWO A;  1VDV A;  3ZNH B;  3P4S B;  2LVO A;  3C19 A;  2CS4 A;  1OQR A;  2K3U A;  2MCN B;  3VDZ A;  2JXT A;  2MQJ A;  2LWP A;  4BBN F;  3DVN V;  3KUD B;  2PE6 B;  2NMQ A;  4GU2 A;  3PTF C;  1V5T A;  1C1Y B;  4NZL B;  1E5W A;  4XE0 A;  4K81 A;  4FBJ B;  1F2R C;  4AS1 A;  2J42 A;  1WX7 A;  4JX1 C;  3R8B A;  3CIR B;  2WXL A;  2PEA A;  3FIL A;  2L83 A;  4GDL A;  1GAQ B;  5J2R A;  2L7R A;  2MP2 A;  1ZW7 A;  2N7J A;  4BAX A;  4W9I A;  2OJR A;  3DBL I;  4NNJ B;  1K52 A;  3BVZ A;  1VLB A;  3KYC D;  2G9H D;  3H1U A;  5C2T B;  3RI7 C;  4P1C C;  1EM7 A;  3A1Q A;  3VTW A;  1DOY A;  3WAO A;  1QOB A;  2RDB C;  1WM2 A;  3A9J A;  1CZP A;  3AM9 A;  4WAA A;  3RZF A;  1SIF A;  3OWE B;  4K7U A;  1WYW B;  4WAF A;  2EMT A;  2KWD A;  4RGO S;  4XDC A;  3PZ7 A;  1I4X A;  1PQS A;  2VZK B;  4M0W A;  1YQ4 B;  2EKI A;  4WIP A;  3I5J C;  2BS2 B;  2ZEQ A;  4ZRI A;  1H4R A;  2TSS A;  1TBE A;  4IM0 A;  2MH7 A;  3L13 A;  2O2V A;  1TKY A;  1ZOY B;  2MJD A;  3L17 A;  1F52 A;  2L00 B;  3P4P B;  3PLU A;  3APF A;  4YL8 A;  3ML9 A;  3VUW A;  1RFA A;  2PLP A;  1WRD B;  3ENE A;  3GZN I;  5IKC M;  3H9D A;  2DZM A;  2BB5 A;  4CO7 A;  4NQL B;  2SEB D;  2D07 B;  4W9C A;  3P42 A;  5FR6 A;  3U8Z A;  3AE2 B;  4YWG G;  4FLH A;  4H2A A;  2BYF A;  1SF0 A;  3EHV A;  4G11 A;  1C79 A;  4GN1 A;  5D94 A;  4W9H A;  2ZVO A;  1V6E A;  1TY0 A;  4REZ A;  3UF8 A;  1FFU A;  2M0X A;  4GMV A;  1J7B A;  4R3D A;  1FPY A;  1FEH A;  2WQY B;  3VUX A;  2M1M A;  4F7Z A;  1YX6 B;  3PHW B;  1OEY A;  2DNF A;  2ZPN A;  3N32 A;  2G45 B;  3E9S A;  1E6E B;  2DYB A;  3K9P B;  1IP9 A;  3PZD A;  2KOX A;  1N5X A;  1B9R A;  1V1P A;  2GBK A;  3AE8 B;  1UH6 A;  2ZW0 A;  2JQR B;  2LAS A;  4EUT A;  5BMG A;  3IAS 1;  2K1F A;  1WMH A;  1RAX A;  4DK5 A;  2KFK B;  1WY8 A;  2IGG A;  4A55 A;  3NJT A;  5LNK 1;  3M62 B;  1WWT A;  1NDD A;  3RNB C;  2GLS A;  1V5O A;  3HVZ A;  2DZJ A;  3H7S A;  4GDK B;  2DAF A;  4P7I A;  2IBI B;  3OLM D;  1ZKH A;  2QMT A;  3TJP A;  3NVY A;  3GOE A;  4OVU A;  1ROE A;  2FCN A;  1XT9 B;  4FJY A;  4HRO A;  1P9D U;  3OG5 A;  2CR5 A;  3L4P A;  2NTS A;  1TKE A;  4KGR A;  4A9A A;  2VRR B;  4LTU A;  2PE9 A;  3ZLZ A;  1JWM D;  5DPR A;  2QHO A;  2N4F A;  3T3O A;  2JY6 A;  5E6P A;  5H92 C;  1DOX A;  4LLG M;  4S17 A;  4WJQ A;  5DPW A;  1PGX A;  3UQA A;  1P7F A;  2MEK A;  4N9F 4;  3ZIM A;  3B1L X;  2PMV A;  4W9L A;  3JSV A;  1KM7 A;  2KJ6 A;  3HIZ A;  1YN5 A;  1V81 A;  3TL5 A;  3ZO5 B;  2HE7 A;  3Q3J A;  2FCQ A;  4DXF A;  3LYY A;  4BKG A;  3V6E B;  4HRS A;  4HCN B;  2M56 B;  2L0F A;  2HTM E;  2KVZ A;  3VAW A;  1I7H A;  4LNK A;  4NJ7 A;  4FXC A;  4LJP B;  1A70 A;  1D6E C;  4W9J A;  4IM2 A;  4TUU A;  4HCP B;  2WXK A;  3VUY A;  1QKZ A;  2E6X A;  4MSQ B;  2RSU A;  3MP9 A;  2INN E;  3T8M A;  1C4P A;  1N61 A;  3IAM 1;  2NBU A;  2WXG A;  4A6Q A;  3ZKJ C;  4A3O A;  2J4X A;  2IJ0 A;  3RN9 C;  1C9F A;  2Y3A A;  1IPG A;  1TIF A;  2REX A;  1KLG D;  1MI0 A;  4P1B C;  2I38 A;  3U30 A;  4B95 A;  1FCC C;  3HM3 A;  2C5L C;  4B6W A;  3LJ3 A;  4IM3 A;  3VQI A;  1L7Y A;  3PRP B;  2ASQ A;  4LDT D;  5BO4 B;  2MJ3 A;  3PV1 A;  3DQV A;  1RM6 C;  1XCT L;  2K8H A;  1MG8 A;  1WGK A;  4HVB A;  3RT3 B;  2V0G A;  3BZD B;  4DXA B;  4KKI A;  2JU6 X;  2ICI A;  1SE3 A;  4MM3 A;  2MHJ A;  1WXA A;  4M8N A;  2AQ2 B;  2Y5P A;  3P2B A;  3UGB B;  3MC0 B;  2B3A A;  3AE7 B;  1T0Q C;  1FRR A;  4M01 A;  1E8W A;  3RNF C;  5E6J A;  1VZ8 A;  4RNA A;  4NPN A;  3ML8 A;  2WDV B;  3RNG C;  4ANW A;  3KWL A;  4WJN A;  5FK9 C;  3W9C B;  2V9H A;  3NS1 A;  1VD2 A;  4KIK B;  2EKE C;  2MW5 A;  5CHV C;  2QJL A;  4NY0 A;  5JH5 C;  3PRE A;  1RRB A;  2IDY A;  4W9F A;  1ESF A;  1HQR D;  1WJ6 A;  2B76 B;  3BIN A;  4W9K A;  3DPD A;  2LUM A;  4E71 A;  1L6V A;  4IUM B;  1C78 A;  4K3C A;  3SD5 A;  4KV2 A;  1D3Z A;  1V2Y A;  4YTN B;  4BOS C;  1SEB D;  3B0A A;  1JRP A;  3LXF A;  3HK0 A;  5I4D A;  3NY5 A;  5GMV A;  2NPT A;  4DWF A;  1CK1 A;  2KWV B;  3IXS A;  4KGT A;  4XX5 A;  2PW9 A;  1NI3 A;  3V05 A;  1RFK A;  1OFF A;  4YT0 B;  1EF1 A;  3AEC B;  2KDB A;  3VVW B;  2IGD A;  2KAN A;  3BY4 B;  3KW5 B;  5KHQ A;  1WZ3 A;  3PS6 A;  1BT0 A;  4HWI B;  1STE A;  2XEW A;  4C00 A;  1BXT A;  1I4P A;  1HTQ A;  3M95 A;  4GB9 A;  3X0W A;  3Q8B A;  1WR6 E;  1I4Q A;  4I6L B;  3FKY A;  1J0G A;  3NVV A;  3RNA C;  1TS4 A;  2QDF A;  2V1Y A;  1R4M B;  1WXV A;  3CWI A;  4OVZ A;  2NBV B;  2MBO A;  2N7D A;  2WXI A;  3BVG A;  3AMZ A;  4ZDV A;  3Q3O C;  3N1Z C;  1P98 A;  2L1A A;  2N9P C;  4MDK E;  4GLS C;  3OJ4 B;  2KAJ A;  2JWU A;  3KVF B;  4C80 A;  3ALB A;  3KYD D;  4MEL A;  4LNI A;  1FIQ A;  1PDX A;  2DEN B;  2BB6 A;  1FD6 A;  3RCZ A;  1UUP A;  1FMA D;  1VRA B;  2WXO A;  2AL6 A;  1V80 A;  4OVV A;  5BMH A;  3UIP B;  1T3Q A;  3SHQ A;  2LMC A;  3PRZ A;  2V4I B;  1ET9 A;  1KH0 A;  1WM3 A;  3AXC A;  3DBS A;  5G5H A;  1EF5 A;  2N1W A;  3O13 A;  4MH8 A;  3W1S A;  2LI5 A;  3J9C A;  2KX0 A;  3P1M A;  1B1Z A;  3NUH B;  4KGS A;  1GC6 A;  3DHH C;  2MRP A;  5L83 A;  2W55 A;  3B9J A;  4KX6 B;  3TIX A;  3AE6 B;  4RFB A;  4B0M A;  1KFY B;  3CST A;  4II2 B;  4AJW A;  4EZJ A;  1M94 A;  2M19 A;  2FCS A;  3NG0 A;  2FBW B;  2E3T A;  1WR1 A;  1YOV B;  3QA8 A;  1I4G A;  4IWP A;  2N9L A;  1WJ4 A;  2ZNV C;  3EFU A;  4RGM A;  3UIN B;  4XWW A;  2JPH A;  2KZR A;  3DBH B;  1MVK A; 
#chains in the Genus database with same CATH homology
 2R2O A;  1K8R B;  1WE6 A;  4BVU C;  1H8C A;  1WJN A;  2DYB A;  2C7M B;  1I35 A;  2JVC A;  4TKN A;  4J6I A;  3VTV A;  4PYZ A;  3ZDT A;  3K9P B;  2BKR B;  5TR5 A;  1IP9 A;  3PT2 B;  5C1Z A;  3PZD A;  2KOX A;  2O6V A;  1NI2 A;  2GBK A;  2IO1 B;  2KO3 A;  4PS7 A;  4BBN C;  1UH6 A;  4KZ0 A;  3A4S C;  4NQK E;  4XC2 A;  3PRM B;  4EKU A;  2D10 A;  4HDO A;  2LAS A;  2LZ6 A;  3NHE B;  4B9K A;  1OQY A;  4EUT A;  4AP4 C;  2K1F A;  1WX8 A;  1WMH A;  3WA0 A;  1RAX A;  2I1K A;  2IYD B;  5LLI A;  2KQ7 A;  2KFJ A;  4DK5 A;  2KFK B;  1WY8 A;  2BYE A;  3SU8 X;  5CTR C;  2K25 A;  1ZGU B;  4F1S A;  2K39 A;  2XBB C;  3ZTC A;  1EO6 A;  1WGD A;  3AU4 A;  2RD0 A;  2GMI C;  4RM8 A;  3M62 B;  2C60 A;  1NDD A;  1WXM A;  4W9D A;  4MJS B;  2DYM A;  1KLV A;  3IVF A;  2K6Q A;  4DDI D;  1HE8 A;  2CU1 A;  1U4A A;  2IY0 B;  3QIJ A;  1CMX B;  1V5O A;  3KUZ A;  4WQO B;  3APC A;  5AZG A;  2MP2 B;  2Y5B B;  1IYF A;  3PLV A;  4PS3 A;  2FNJ B;  2IO3 B;  2DZJ A;  3H7S A;  1R4N I;  4GDK B;  3B08 A;  2DAF A;  3O65 B;  1GC7 A;  4P7I A;  3M63 B;  2IBI B;  1V9J A;  3NS8 A;  4HLE A;  3OLM D;  4K1R B;  1ZKH A;  1SE9 A;  2K6D B;  3UQB A;  3TJP A;  2JWZ A;  2D2Q A;  5D7G A;  2MSE D;  4E3C A;  3GOE A;  3QK0 A;  3PGE A;  4OVU A;  1E8Z A;  2FCN A;  4ICV A;  5D6J B;  4W9E A;  1GUA B;  3CSF A;  2KVR A;  4MH0 E;  4ANU A;  1XT9 B;  4FJY A;  3A1Q B;  3TBL D;  1P9D U;  4IWQ A;  5J17 A;  4FN2 A;  2NR2 A;  2WX0 A;  2CR5 A;  5LXI B;  2L05 A;  2PJH A;  1V86 A;  1TTN A;  3H6N A;  1S3S G;  4M8M A;  3OAW A;  1XD3 B;  2KJR A;  4GXB A;  4HPM B;  4BKT A;  4FJV B;  2ZJD A;  4M0W B;  1YQB A;  4GIV A;  1LQB A;  3QWZ B;  2VRR B;  1JRU A;  2LGX A;  3H7P B;  2PE9 A;  3ZLZ A;  2RGF A;  3WAP A;  3NOB A;  1E7V A;  2ZZP B;  5DPR A;  3UIO B;  1E8X A;  2WX1 A;  4BOZ B;  3DBR I;  3EEC A;  1J19 A;  2QHO A;  2N4F A;  3ONS A;  2NCN A;  2L8J A;  1E90 A;  2KDE B;  2JY6 A;  5E6P A;  3QAR A;  4G50 A;  3APD A;  4TV3 A;  4WJQ A;  3CF6 E;  3ZW3 A;  2A5U A;  4WJP A;  5DPW A;  1F9J A;  3UQA A;  2KTR B;  3DVG Y;  1J8C A;  3DVN U;  5DCN A;  2M17 A;  3QHT A;  4N9F 4;  3ZIM A;  2FID A;  3B1L X;  3IG3 A;  2AYO B;  1R4M I;  1FXT B;  2KNB A;  4W9L A;  3DOW A;  3JSV A;  2I1J A;  1KM7 A;  2ZCC A;  2KJ6 A;  3QJZ A;  3HIZ A;  4IWO A;  2JZZ A;  1V81 A;  3TL5 A;  2LVQ A;  1SGH A;  3QCA A;  2KMA A;  3ZO5 B;  2HE7 A;  3Q3J A;  2V4L A;  3KUC B;  2C9W B;  2FCQ A;  3DDC B;  4EOY A;  5HKH A;  4BKG A;  3V6E B;  2G3Q B;  4HCN B;  1LM8 B;  2L0F A;  3RD2 A;  3VAW A;  2MLB A;  5G55 A;  2KC1 A;  2O6V D;  2KX3 A;  1A5R A;  4NJ7 A;  4LJP B;  3WIM A;  3A9K A;  4RM9 A;  2KTF A;  2LUE A;  4MGY E;  4W9J A;  4IM2 A;  4TUU A;  4HCP B;  3VUY A;  3L08 A;  4AOF A;  2BYV E;  2J7Q B;  4MSQ B;  5G2N A;  5JHB A;  2N9E B;  2RSU A;  4AJY B;  1WFY A;  2LRW A;  2PPH A;  3CMM B;  2MA9 B;  3T8M A;  2KD0 A;  4BKS A;  4DHZ B;  3PSE B;  1Q5W B;  2N9X A;  4KDL B;  4FJZ A;  3W1S C;  1I42 A;  2NBU A;  2DAJ A;  3LDZ E;  4JL9 A;  1YX5 B;  4ZRK A;  2L0T A;  3ZKJ C;  1T0Y A;  4A3O A;  4JLC A;  3ZRF A;  4ANX A;  4TQ1 A;  4E74 A;  4II3 B;  3VXW A;  2KFK A;  3T9L A;  3NZU A;  3KH0 A;  2O6V B;  4URK A;  2BF8 B;  3NZS A;  3DVG X;  1IPG A;  2REX A;  2Z59 B;  2LGY A;  1VCB A;  1P1A A;  1WGH A;  2IY1 B;  1UEL A;  4HJK A;  3JW0 X;  3R7R A;  1WGR A;  3U30 A;  2FUH B;  4B95 A;  4KDI C;  1UBI A;  2YLM A;  2DHZ A;  3W1Y A;  3HM3 A;  1E7U A;  1WMH B;  2C5L C;  1WZ0 A;  2YVC A;  1XQQ A;  3LJ3 A;  4GDL B;  4MJS A;  4B6W A;  4IM3 A;  4ANV A;  2GBN A;  2AEH A;  2BWE S;  5CHF A;  3VQI A;  2BGF A;  3JVZ X;  1L7Y A;  3PRP B;  2ASQ A;  2IO2 B;  1YD8 U;  4MEM A;  2KN5 A;  4I6N B;  4LDT D;  5BO4 B;  4AUQ C;  3PV1 A;  3DQV A;  4GDK A;  2N7E A;  1GJZ A;  2K8H A;  1MG8 A;  1LXD A;  4MGK E;  1WI0 A;  4TQ0 A;  4EEW A;  4HVB A;  2Z0E B;  3RT3 B;  2JT4 B;  2LJ5 A;  4ZYN A;  3VH4 B;  3R66 C;  5EDS A;  3ECI A;  4BFR A;  3VH3 B;  2LVP A;  4DXA B;  2HJ8 A;  4CHK A;  2D11 A;  4HK2 A;  2KQS A;  3HM6 X;  4KSL C;  1Z5S B;  3ZUN A;  2NVU I;  2CHX A;  2BPS A;  4ZRJ A;  2KC2 A;  4ICU A;  2ZNV B;  4LJO B;  3RUI B;  4MM3 A;  3VTU A;  2KWU B;  2IZV B;  3A9J B;  2XK5 B;  1WXA A;  4M8N A;  3S2A A;  2CKH B;  4JGH B;  2FAZ A;  4I6P A;  3DBH I;  2CHZ A;  2K8B A;  2L3Z A;  4LDT B;  2GBR A;  3P2B A;  3UGB B;  2KJH B;  4WWN A;  2M8S A;  4DHZ E;  2B3A A;  5D2M B;  3ZRC A;  5DPS A;  3K9O B;  4KSK C;  5JHA A;  3OJ3 A;  4HDQ A;  1Q0W B;  3H7P A;  1E8W A;  3ZNZ B;  1WX9 A;  2J0K A;  1UZX B;  2O2V B;  3L0W B;  2GBJ A;  5C23 A;  2JUO A;  3WAM A;  4NPN A;  3PPA A;  2MBQ A;  1AAR A;  2UWQ A;  3ML8 A;  2MWS B;  2BKF A;  2J0J A;  1WF9 A;  4ANW A;  3MJW A;  4MGI E;  4WJN A;  4X57 B;  1RLF A;  2GBM A;  1WH3 A;  3QAQ A;  5IA7 A;  4MSM B;  2KLC A;  2KTR A;  4IG7 B;  3R7Q A;  3AU5 A;  2JRI B;  2KLG A;  1VD2 A;  4KIK B;  2EKE C;  2MW5 A;  1GNU A;  1OGW A;  5CHV C;  3V61 A;  5AEK B;  3A33 B;  2DZI A;  2AWT A;  2KDF B;  4JQW C;  4NY0 A;  1S1Q B;  3EC8 A;  5JH5 C;  2KXJ A;  2MBH A;  4DHJ D;  3PRE A;  1RRB A;  2GOW A;  5IAA C;  4W9F A;  5KHO A;  1WXS A;  2RPQ A;  4NAW B;  1WJ6 A;  3BIN A;  4W9K A;  3DPD A;  4PYU A;  3ZDM C;  3RUL A;  5AZH A;  3ZNG C;  3QC8 B;  4E71 A;  2HD5 B;  4IUM B;  3SD5 A;  4A3P A;  3C0R B;  3ZNI D;  3M3J A;  4KV2 A;  1D3Z A;  1V2Y A;  3JSV B;  1OEY J;  3IFW B;  3V62 A;  4BOS C;  3B0A A;  1LFD A;  5DPT A;  3IHP C;  3JYU A;  3HK0 A;  3NY5 A;  5GMV A;  2NPT A;  4AWJ A;  4DWF A;  2KWV B;  4XX5 A;  1KOT A;  2KDI A;  1UD7 A;  2WYQ A;  2DZK A;  3ZTD A;  3D32 A;  4NJ6 A;  3L10 B;  4GSW A;  2V3S A;  2G4D B;  3RYT A;  1KJT A;  2C7H A;  3IBE A;  4ASW C;  3AUL A;  4WWO A;  2FIF A;  1UGM A;  2G4S A;  4HXD A;  4DHJ B;  4EFO A;  1EF1 A;  5CX3 A;  3ZNH B;  2KDB A;  5J18 A;  4IC7 B;  3VVW B;  2LVO A;  3I3T B;  2KAN A;  2CS4 A;  2MCN B;  3BY4 B;  3VDZ A;  1X1M A;  1EUV B;  3KW5 B;  5KHQ A;  2MQJ A;  1WZ3 A;  5AZF A;  2LWP A;  3U7D A;  2R2Q A;  4KVG B;  4BBN F;  2K8C A;  3PS6 A;  4G3X B;  1BT0 A;  3DVN V;  3KUD B;  3N30 A;  2PE6 B;  4HWI B;  2LXA A;  4W9G A;  2XEW A;  4GU2 A;  3PTF C;  4K7S A;  1V5T A;  3M95 A;  1C1Y B;  4GB9 A;  3X0W A;  1E5W A;  2WWZ A;  2LXC A;  4K81 A;  3ZVV A;  4FBJ B;  4MGZ E;  1WR6 E;  1WX7 A;  4I6L B;  1GG3 A;  2KK8 A;  1NBF C;  1J0G A;  1P0R A;  2PEA A;  2M4N A;  2A4Z A;  4GDL A;  4FHK A;  1WXV A;  2L76 A;  2V1Y A;  4LCD E;  1Z2M A;  5J2R A;  2L7R A;  2MP2 A;  2W9N A;  2NBV B;  1ZW7 A;  2MBO A;  2N7D A;  2OOB B;  2LGD A;  2ZCB A;  4ZDV A;  5CHW A;  3L16 A;  5JZE B;  5L95 C;  4W9I A;  1P98 A;  1WJU A;  2RR9 A;  2N9P C;  4MDK E;  4RMA A;  2OJR A;  3DBL I;  3OJ4 B;  4NNJ B;  3KYC D;  3H1U A;  2WDT B;  3R3M A;  3KVF B;  3ALB A;  3A1Q A;  3VTW A;  3KYD D;  4MEL A;  3WAO A;  2MBB B;  3HHM A;  1YIW A;  3A9J A;  1WM2 A;  2XK5 A;  2DEN B;  2DX5 B;  4K7W A;  3RCZ A;  4WAA A;  3RZF A;  1SIF A;  2KMC A;  3VHT C;  1WGY A;  1WYW B;  1WGG A;  4G0N B;  2EMT A;  4K7U A;  2UYZ B;  2D3G A;  2AL6 A;  1C3T A;  1V80 A;  3DCG A;  1PQS A;  3SDL C;  2KKC A;  4OVV A;  3UIP B;  1L2N A;  1Q1O A;  1WE7 A;  2JZ3 B;  3SHQ A;  2ZEQ A;  4ZRI A;  1H4R A;  2IO0 B;  3PRZ A;  3RZW C;  1TBE A;  4IM0 A;  4EZK A;  1WM3 A;  4WWP A;  2HTH A;  1Y8R C;  3TCA A;  3L13 A;  3AXC A;  3A4R A;  2O2V A;  3AI5 A;  3WAN A;  3WAL A;  2N1V A;  3DBS A;  3L17 A;  2L00 B;  2LRU A;  3PVL A;  4XZ4 A;  2NBW B;  1EF5 A;  2J0M A;  2N1W A;  3APF A;  3ML9 A;  3PLU A;  4YL8 A;  1RFA A;  3VUW A;  3W1S A;  2LI5 A;  2KHW B;  3VFK A;  3PHX B;  1WRD B;  2NS5 A;  3ENE A;  2KX0 A;  3GZN I;  3H9D A;  2DZM A;  2FCM A;  3QX1 A;  4FUL A;  4KZC A;  4NQL B;  4CO7 A;  1GC6 A;  2BWF A;  2CHW A;  3MHS D;  4KIK A;  2EMS A;  4CYE A;  2D07 B;  1TGZ B;  4W9C A;  2MRP A;  5FR6 A;  1UBQ A;  1TZ1 A;  4JIO U;  5E6O A;  3U8Z A;  4A20 A;  5L83 A;  2MX2 A;  4FLH A;  3TIX A;  1G6J A;  1QZE A;  1P3Q U;  2BYF A;  2Z0D B;  2ZPY A;  4NAW A;  4G11 A;  3EHV A;  4EZL A;  3TMP B;  4DDG D;  4GN1 A;  5D94 A;  3CST A;  4II2 B;  4GGQ A;  4AJW A;  4PS8 A;  4W9H A;  2ZVO A;  4FA6 A;  1V6E A;  3UF8 A;  1ISN A;  2MBE A;  2LD9 A;  2DYO A;  1V49 A;  2M0X A;  3MTN B;  2ZVN A;  4GMV A;  4EZJ A;  5LXH A;  1M94 A;  4IW0 A;  3VUX A;  1OTR B;  1E8Y A;  2M1M A;  2FCS A;  4HPL B;  2AL3 A;  3V60 A;  3X23 A;  4BKS D;  3V6C B;  2C7N B;  5E6N A;  4F7Z A;  1YX6 B;  3PHW B;  4WJO A;  1WR1 A;  3QA8 A;  1OEY A;  4FAD A;  3L54 A;  4IWP A;  1WJ4 A;  2ZPN A;  1WIA A;  2KWC A;  2ZNV C;  4F8C B;  3EFU A;  3Q3F A;  3QQ8 B;  4FHJ A;  3N32 A;  3N3K B;  1YJ1 A;  4DBG A;  3UIN B;  2G45 B;  2JPH A;  2KZR A;  4GOC A;  2JF5 A;  2NPT B;  2JXX A;  2JRH A;  3A9K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...