1KLVA

Solution structure and backbone dynamics of gabarap, gabaa receptor associated protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
GEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords GABA(A) Receptor associated protein
publication title 1H, 13C and '5N resonance assignments of GABARAP, GABAA receptor associated protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2001-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1klvA00
2MBQA 1KLVA 2DAFA 1WGHA 2PE9A 3RUIB 2V4LA 2K39A 2FCQA 2C7HA 3VAWA 4ICVA 4JLCA 5DPWA 1HE8A 4I6NB 1WH3A 2KZRA 4AJYB 3NHEB 4TV3A 2KDIA 3L13A 3VVWB 2C9WB 2GBNA 4AOFA 4EZLA 4NAWA 3JVZX 2LGYA 1EF5A 2JWZA 1F9JA 2N9PC 3PHWB 3LDZE 3HHMA 3V61A 3ZRCA 3DOWA 4MSMB 2K1FA 4WWPA 5JHAA 2RSUA 4MM3A 2MQJA 2WYQA 4HK2A 4BBNC 2RPQA 2JXXA 1V2YA 2NR2A 2WWZA 2AYOB 4K7UA 2GBKA 5HKHA 3DVNV 3QA8A 4PYUA 2VRRB 1UH6A 2MCNB 1UGMA 1E90A 2ASQA 1YIWA 1P98A 4OVUA 4MGKE 2XK5B 3ZNGC 1WJNA 1CMXB 1WGRA 2M4NA 3VUXA 5JZEB 4KV2A 2K6DB 2LRWA 2RD0A 2GBRA 1UELA 3JYUA 4HWIB 2KWVB 1OEYA 1XD3B 2LWPA 1E8YA 2FCMA 2MSED 1TGZB 1WGDA 2JRIB 3L10B 5E6PA 4EZJA 3ZTCA 4W9GA 3TIXA 5CX3A 1E8ZA 3AU4A 4IC7B 4JL9A 1V6EA 3OJ4B 4G3XB 4KZ0A 1E5WA 2JVCA 3JSVB 3NY5A 2HJ8A 3MHSD 4IUMB 3UIPB 4BOSC 2KTRA 4GMVA 4IW0A 3OJ3A 3TCAA 2HE7A 1TTNA 4GOCA 4PS7A 2FIDA 3EC8A 3L16A 3ZKJC 1H4RA 3KUZA 1TBEA 3R3MA 4AWJA 3KUCB 2C7NB 1WX7A 1KJTA 4NY0A 1ZKHA 3PRZA 4FJVB 3W1YA 2KK8A 4P7IA 5AZGA 2OOBB 4A3PA 4IWOA 2Z59B 1WR6E 5D7GA 2NBUA 2L7RA 2O2VB 1V49A 3N3KB 5BO4B 4FHKA 4HPLB 3UGBB 3A9KB 1WE7A 4M0WB 2KOXA 4WJOA 4TQ1A 4X57B 3HM3A 4ANWA 3A9KA 1K8RB 4DHJD 1LQBA 3SDLC 4MH0E 2AEHA 1R4NI 4F8CB 3VH4B 2LXAA 2QHOA 2KQSA 1WM2A 1V80A 2DHZA 4BBNF 1J0GA 2GBJA 1D3ZA 3D32A 2MP2A 4K81A 2LUEA 4B6WA 1NI2A 3ZNID 5CHFA 2ZNVC 3EHVA 4JIOU 2V1YA 2AL3A 4G50A 1YQBA 1ZGUB 1SIFA 2BYVE 4MDKE 3TL5A 1EUVB 2IY0B 2Z0EB 1M94A 3H7PA 3PSEB 4GGQA 5EDSA 1WXMA 2FIFA 3L0WB 4GDKA 3AULA 1G6JA 1Y8RC 1P0RA 3WIMA 4BKSA 1E8XA 2BKRB 1E7VA 3R7QA 5DPRA 2FUHB 2LGDA 3EECA 3ONSA 1WY8A 2KFKA 4HVBA 1V5TA 3NS8A 3RZWC 2L0FA 2KJRA 2MRPA 4KIKB 3VHTC 3UINB 1Q1OA 3WAMA 2EMTA 2KKCA 1WGYA 2G3QB 2G4SA 2N4FA 1WX8A 2O6VB 4WWNA 3L17A 3V6CB 2DYMA 4HDOA 3T9LA 4BVUC 2NVUI 1V5OA 4HJKA 2DYBA 2KJ6A 4G0NB 2KQ7A 1L2NA 2IYDB 3ML8A 4RM8A 5DPSA 1TZ1A 3WAPA 2BPSA 3N32A 1J8CA 2UWQA 3K9OB 2B3AA 2Z0DB 3SD5A 1UD7A 4HDQA 2N1VA 5C1ZA 2IBIB 4W9DA 2MBBB 2YLMA 2LVQA 4FJZA 2BYEA 3W1SC 2MW5A 4FBJB 3AXCA 4II3B 4OVVA 4TKNA 3TMPB 4NNJB 3QCAA 1WE6A 2PPHA 4I6PA 3RZFA 2ZPNA 2GOWA 3Q3FA 2KC1A 3UQAA 1RAXA 1WZ3A 1YD8U 4MJSB 2CS4A 2LRUA 3A9JB 3V60A 4MJSA 3VXWA 1GC7A 2RR9A 3KUDB 3Q3JA 3CMMB 2BF8B 2KVRA 2N9XA 3MTNB 3RT3B 1S1QB 1WXVA 2JF5A 1E8WA 1UBIA 4CO7A 2ZVNA 2KLGA 1OEYJ 1ZW7A 3PLVA 4FULA 4MEMA 2ZNVB 1V9JA 1A5RA 2K8BA 1WJ4A 3ML9A 3PREA 3CSFA 4IG7B 2D10A 1GUAB 3ALBA 2L8JA 3T8MA 2V3SA 5DCNA 2XK5A 1OGWA 4E3CA 3A1QB 4DXAB 5FR6A 2CKHB 4XZ4A 3ZUNA 4WWOA 3U7DA 2KMCA 2J7QB 4ANUA 4WJPA 2KX0A 4BKSD 1WF9A 5LXHA 3PRPB 4NJ7A 4LDTB 2MX2A 4MSQB 2PJHA 4LCDE 5JH5C 1KM7A 3PVLA 4LJOB 1WX9A 2J0MA 3A4SC 3SHQA 5IAAC 1SE9A 3DBLI 4KVGB 2IO3B 3M3JA 3VH3B 4PS3A 3JSVA 4KDIC 4B95A 2D3GA 2MBOA 2I1JA 2LXCA 2YVCA 2L3ZA 4W9LA 2NPTB 4IM0A 5C23A 4ICUA 3DVNU 3H1UA 4KSKC 4DBGA 2KWCA 2O6VD 3WA0A 2JZ3B 3OLMD 4BOZB 4F7ZA 4PS8A 2A4ZA 3PV1A 1EF1A 2R2OA 4URKA 4BKTA 1PQSA 3NOBA 2BWES 2LASA 3JW0X 1H8CA 3NZUA 3UIOB 3QAQA 1BT0A 2O2VA 1OTRB 4M8NA 4MGIE 4HLEA 4ZRKA 3ZRFA 3DQVA 3ZO5B 1XQQA 2BGFA 1L7YA 5AEKB 2M1MA 3QK0A 3HIZA 3IG3A 3APDA 3ZDTA 2CU1A 4W9CA 3EFUA 1E7UA 2KDFB 2N1WA 2J0KA 1KOTA 3QARA 2KLCA 3WANA 3PT2B 3IHPC 2LVOA 2MLBA 3S2AA 4DWFA 2DAJA 2N9EB 3K9PB 3DBHI 3ZTDA 3B1LX 5D2MB 3VUYA 5CTRC 3PS6A 4DDGD 2WDTB 4XC2A 4JGHB 5D94A 4IM3A 4ANVA 4I6LB 3BINA 2IY1B 5LLIA 4G11A 2J0JA 3QJZA 2KC2A 3DVGY 4K1RB 2L00B 4DDID 3B08A 1C3TA 4MGYE 4FLHA 4KZCA 3TBLD 3VDZA 1MG8A 2LGXA 5J17A 4IWPA 3TJPA 1S3SG 1NDDA 2KDBA 2K6QA 3U8ZA 2JT4B 2L76A 4ASWC 1WI0A 3H6NA 4M8MA 4EKUA 3MJWA 2LVPA 1GC6A 2RGFA 2DZMA 4KDLB 1WXSA 3KW5B 4BKGA 4KIKA 2IZVB 3DVGX 4HXDA 4PYZA 2JY6A 2M8SA 3U30A 4EZKA 5J18A 1P9DU 3PRMB 4LDTD 1WZ0A 3M95A 2O6VA 2ZEQA 5L95C 3M62B 3VTUA 2CHZA 2KHWB 2EKEC 1WMHB 5GMVA 3PTFC 3V6EB 2AWTA 2G45B 5KHQA 2KJHB 2BKFA 2G4DB 2MBHA 3L08A 1J19A 2IO0B 3M63B 4AJWA 2D07B 2LZ6A 2FAZA 3APCA 4DHZE 2DZIA 2KNBA 2KANA 1WGGA 3ECIA 1RFAA 4FN2A 1V81A 4YL8A 3WAOA 3QQ8B 3QC8B 4DK5A 2W9NA 1GNUA 2JUOA 2MBEA 3A33B 3X23A 2JZZA 1VD2A 4JQWC 1P1AA 3AU5A 2AL6A 2Y5BB 3IBEA 3PHXB 1R4MI 1JRUA 2C5LC 3QX1A 2HD5B 3VTVA 3DPDA 3CF6E 4TQ0A 3DDCB 4W9IA 5CHWA 2L05A 1Z5SB 4FA6A 4A20A 2XEWA 1I35A 3A9JA 2DENB 3B0AA 2OJRA 4N9F4 4DHJB 4KSLC 2EMSA 4NAWB 3ENEA 1WYWB 2WX0A 4XX5A 5D6JB 2NBVB 4AP4C 2N7EA 5AZFA 3ZNZB 4FADA 1EO6A 4W9EA 5AZHA 2JPHA 5L83A 4GSWA 1Q5WB 4MELA 4MGZE 3A1QA 1SGHA 4EEWA 1YX6B 2CHXA 3RCZA 2K8HA 3IVFA 4GU2A 4K7SA 4A3OA 2L0TA 4E71A 2KD0A 4B9KA 2MA9B 3L54A 1WXAA 2BYFA 4RM9A 4TUUA 1IP9A 2BWFA 2KN5A 4WJNA 3ZW3A 1WIAA 5LXIB 1GJZA 3RULA 1QZEA 1WR1A 1WFYA 3ZDMC 1NBFC 3ZNHB 4W9HA 3C0RB 1P3QU 1YJ1A 4HCNB 3KH0A 4FJYA 2NPTA 1UZXB 4K7WA 5CHVC 5KHOA 1Q0WB 2KO3A 4ZYNA 2DZJA 3HM6X 4ZRIA 3HK0A 2KTFA 1XT9B 3PGEA 3AI5A 3RD2A 4IM2A 2K25A 3KYDD 4GDLB 2KTRB 2UYZB 3H7SA 2NBWB 4EFOA 2REXA 5E6NA 4FHJA 1LFDA 1WM3A 4GDLA 2D2QA 3BY4B 3DCGA 3PLUA 4F1SA 1IYFA 2NCNA 3APFA 2PEAA 2K8CA 2R2QA 2I1KA 2IO2B 5J2RA 5DPTA 3V62A 4GB9A 4GN1A 3W1SA 3LJ3A 4W9FA 4W9KA 1RRBA 3QWZB 1GG3A 1WJ6A 4EUTA 4EOYA 4ZRJA 4HCPB 5G55A 2DZKA 1UBQA 3GZNI 4GXBA 4BFRA 3ZIMA 2LI5A 4GIVA 4WAAA 2XBBC 2NS5A 3VTWA 3WALA 4IWQA 2C60A 1WJUA 4E74A 4NJ6A 4J6IA 4NQKE 3DBSA 2ZCCA 3N30A 3A4RA 3DBRI 4ZDVA 3KYCD 2ZPYA 2ZCBA 1ISNA 3GOEA 2ZVOA 4RMAA 5E6OA 3VQIA 3R7RA 3PZDA 3P2BA 4HPMB 3I3TB 4ANXA 1C1YB 2MP2B 1LM8B 1Z2MA 3IFWB 2FNJB 2GMIC 4II2B 4WJQA 3KVFB 2IO1B 2KDEB 1AARA 2N7DA 4CYEA 5JHBA 3PPAA 3UQBA 2PE6B 2CHWA 2KWUB 1V86A 3H7PB 2MWSB 3ZLZA 3RYTA 2GBMA 2WX1A 5TR5A 4GDKB 1U4AA 4AUQC 2KFJA 4DHZB 2CR5A 1X1MA 1LXDA 1VCBA 3X0WA 2M17A 2M0XA 3OAWA 2KFKB 3O65B 1IPGA 2JRHA 1WMHA 4LJPB 1I42A 2DX5B 1RLFA 3CSTA 2A5UA 2C7MB 2FCSA 2FCNA 3VFKA 2KMAA 2LJ5A 3VUWA 2KX3A 2ZZPB 4W9JA 4CHKA 4NQLB 3QHTA 3R66C 1OQYA 3ZVVA 3UF8A 2ZJDA 3H9DA 2D11A 3NZSA 3QIJA 1T0YA 2HTHA 4WQOB 5G2NA 2LD9A 3SU8X 1YX5B 4NPNA 2KXJA 5IA7A 2DYOA 1FXTB 1WRDB
chains in the Genus database with same CATH superfamily
3IT4B 2LHEA 2WU5B 2C7HA 1TY2A 2Q5WD 4C56C 1XLQA 4I6NB 2KZRA 4ZOHC 3NHEB 1FEHA 4TV3A 2KDIA 2Z8LA 3L13A 3VVWB 3BVZA 2GBNA 4AOFA 3LDZE 3HHMA 3OWEB 1CQVA 5JXVA 3GS2A 2RSUA 3DHHC 4QAYA 2WYQA 4RF0A 2NR2A 1FMAD 1HTOA 4PYUA 2ASQA 1YIWA 1PYWD 2XK5B 3ZNGC 3IAM1 2QJLA 3OG5A 4YSZB 1KLGD 3N1ZC 2W55A 2K6DB 2WXFA 1UELA 4HWIB 2KWVB 4PT5A 3O13A 2MSED 1TGZB 1WGDA 5E6PA 3ZTCA 4W9GA 1E8ZA 2JX5A 4G3XB 3NY5A 4GMVA 4M01A 4IW0A 3OJ3A 2BB5A 2HE7A 2LHDA 1TTNA 3EC8A 3Q8BA 3HUIA 3W2DA 3ZKJC 3Q69A 3R3MA 3KUCB 2INDC 1L0XB 1WX7A 3TEXA 1E9MA 1FXIA 3AH7A 1I4XA 3VR9B 2V9HA 1YJJA 3I5JC 4FHKA 3UGBB 3A9KB 1WE7A 4M0WB 2KOXA 4WJOA 4TQ1A 2MH7A 3AE4B 5BMIA 2N7JA 3LB8C 1T0RC 1V80A 2NMQA 2N0SB 3AEFB 2LUEA 2AL3A 1ZGUB 3NVZA 3H7PA 1M94A 1AYFA 4C4VB 3TUOA 3WIMA 5IO9A 4IDIA 1WY8A 3RZWC 2MRPA 3TSSA 2EMTA 1ACCA 3NVYA 2O6VB 3L17A 2WNMA 1MJDA 4HDOA 5BMGA 2KJ6A 4G0NB 4A90A 1L2NA 4RM8A 1CJEA 3K9OB 2Z0DB 1UD7A 2N1VA 2INPE 2IBIB 4W9DA 3W1SC 2MW5A 2WHIA 4OVVA 3H8HA 2V4IB 4NNJB 4I6PA 1JRPA 3T3NA 3RZFA 3Q3FA 1WZ3A 2CS4A 4HKQA 2RDHA 1JROA 1TKEA 2G1EA 1FM0D 3MTNB 1WXVA 1E8WA 4CO7A 2AQ2B 3RI7C 2L8JA 3T8MA 2BYTA 2V3SA 1XF5L 5DCNA 1MFWA 1OGWA 4E3CA 3B2FA 4WURA 2KX0A 4NJ7A 2NTSA 1KM7A 2JQRB 4LJOB 2J0MA 1QILA 3VH3B 4KDIC 1JALA 3EA6A 4W9LA 3AE3B 3DVNU 4P16A 3WA0A 2QC8A 2JZ3B 3P4SB 4PS8A 3ZXVA 3BWUD 3KQ4A 5HG2A 2BWES 1F77A 3SR6A 3JW0X 2WXGA 5HFYA 3NG0A 1J7CA 4M8NA 3AE6B 2QDFA 1QLBB 1XQQA 3HIZA 3IG3A 3C19A 4W9CA 3EFUA 1E7UA 2N1WA 4DXFA 1T5XD 2LVOA 3K9PB 2IJ0A 3SFDB 4HKZE 4XC2A 3W9CB 4I6LB 5LLIA 2IGDA 3QJZA 3U52E 2D5GA 4K1RB 2L00B 5H92C 3B08A 3PZ7A 2LGXA 4IWPA 2KDBA 3NZ3A 3U8ZA 3H6NA 4M8MA 3MJWA 2LVPA 5IOIA 3FAHA 4EZKA 1P9DU 3PRMB 4LDTD 3RNEC 2ZEQA 5L95C 4DXGA 2EKEC 1WMHB 3WCQA 3URYA 2G4DB 3L08A 1J19A 1NYQA 4AJWA 3APCA 2FAZA 1YN4A 2KANA 3EUB2 3V3XA 4OW0A 1V81A 1KRHA 3P4PB 1D4BA 3QC8B 4DK5A 1YQ4B 1GNUA 2KDMA 2Y5BB 3HVZA 5IN7A 4KX6B 3CF6E 3Q8EA 5CHWA 1C76A 4A20A 4N58A 2XEWA 1JCKB 4KSLC 2W3SA 2EMSA 2SAKA 3ENEA 3U2SC 2I38A 1TT5B 1MHXA 2M19A 4AP4C 1PGXA 2M0AA 1VRAB 3B9JA 2JPHA 1Q5WB 1VR9A 2IDYA 1FCLA 3RCZA 4GU2A 4K7SA 2L0TA 3BYTB 2KD0A 2WXHA 1KF6B 3ZNHB 1WFYA 3KWVA 4W9HA 3C0RB 4HCNB 1UZXB 5KHOA 4OVZA 4ZYNA 2VZKD 2KTFA 1E6EB 2W54A 3ZJVA 4HROA 3RD2A 3H7SA 2NBWB 4JX1C 5E6NA 1T0SC 4GDLA 2ONQA 3BY4B 1IYFA 3PO0A 5J2RA 5DPTA 3NUHB 1L6UA 4W9KA 3CWIA 1N5XA 4EUTA 2PW9A 2ON8A 1UBQA 1SXTA 2LI5A 2NS5A 3VTWA 2MJ3A 4IWQA 1EWCA 3DBSA 2ZCCA 5AUKA 1XO3A 5EE0A 2KWDA 4HPMB 3RNBC 3I3TB 4ANXA 2AX5A 4II2B 3ETRA 2N7DA 2X38A 3PPAA 3Q3NC 3H7PB 2WXOA 2MWSB 3GE8C 2RDGA 4AUQC 2CR5A 1X1MA 2AQ3B 2M17A 1M4VA 1L0VB 2JRHA 4LJPB 4YTMB 2WXQA 3VFKA 4CHKA 1SB3C 1OQYA 3UF8A 2ZJDA 4LK0M 1YX5B 2TSSA 1FNUA 1XEEA 1I4RA 4A8XC 2MBQA 2DAFA 2K39A 2FCQA 2WQYB 1KH0A 2K22A 2C9WB 2OHFA 4NAWA 1F9JA 1NEKB 4MSMB 4WWPA 1JQ4A 1R4MB 5TSSA 2BBCA 4HK2A 4A6QA 2JXXA 1V2YA 2AYOB 5HKHA 3DVNV 1UH6A 2MCNB 1P98A 3V05A 2ICIA 1WJNA 1CMXB 2LRWA 1C77A 3JYUA 3DWGC 1ZP0B 1OEYA 2JRIB 4KKIA 4EZJA 4IC7B 4JL9A 1D5XC 4BOSC 3VR8B 3MHSD 2L52A 2KTRA 4NJCA 3TCAA 2L32A 4GOCA 4PS7A 2JXTA 2M56B 2WDRB 2GB1A 4NY0A 1P7EA 1ZKHA 2K5PA 2K3UA 2L7RA 4BAXA 4ZHOA 4HPLB 3AE8B 4X57B 4A55A 4DHJD 1LQBA 4MH0E 2AEHA 3P1MA 4C7YA 4F8CB 2WXMA 2KQSA 1OFFA 2DHZA 4BBNF 3D32A 2MP2A 4K81A 3ZNID 3EHVA 2V1YA 3TL5A 2BYVE 3E56A 1EUVB 2D3AA 4L23A 3DBRB 4KGSA 1HXYD 1E7VA 5DPRA 3B2GA 4ARIA 4XWTA 2L0FA 3VHTC 1N61A 3WAMA 2G3QB 2G4SA 4WWNA 2LEKA 2DYMA 3T9LA 2SEBD 4P6VF 2XN9C 4US9A 2D3CA 1FNVA 2JWUA 1QKZA 5DPSA 1TZ1A 1IBXB 2UWQA 1YJIA 1YQ3B 3BK1A 3SD5A 4XDDA 4HDQA 2QCZA 2YLMA 1PGAA 2LVQA 2BYEA 3E9SA 4C7ZA 4UDUC 4II3B 4B0EA 3MFGA 1LO5D 3QCAA 2GI9A 1DGJA 2ZPNA 2KC1A 1ESFA 4YSYB 3GE3C 2PIAA 3GB1A 4USAA 3AE2B 4MJSB 2JYEA 4BZAA 2WU2B 2KMMA 3V60A 1FIQA 2RR9A 1UNSA 1SF0A 3Q3JA 1EU4A 3RT3B 2N9XA 4R3DA 4HJGE 3RNCC 2ZVNA 4FULA 1OEYJ 4MEMA 3Q14C 4RFBA 1JWSD 3PREA 4IG7B 3CSFA 3ALBA 2JYTA 2QIEB 4XDCA 2WP9B 4DXAB 3BVMA 2YEPF 5LXHA 4OZCA 2BS4B 2MX2A 1QOAA 4LCDE 3PVLA 5IAAC 1SE9A 3ZGZA 4MACA 1K51A 4B95A 2I1JA 2W82A 2L3ZA 4IM0A 4DBGA 4AQ7A 1QF6A 2KWCA 2O6VD 2IGGA 4BOZB 3IAS1 4F7ZA 1C9FA 1EF1A 1F1HA 4URKA 4BKTA 3NOBA 1A70A 4O1NA 1SJHD 2H89B 4PK1A 4HLEA 4ZRKA 2AQ1B 3L4PA 2BGFA 5AEKB 3GP7A 2CU1A 1T3QA 3WANA 2V3PA 1XLPA 2DAJA 3ZTDA 3TEYA 1NYRA 5CTRC 1WSPA 2WXNA 2ZW1A 3BINA 3Q2AC 1VLBA 1SE4A 4OZAA 2KC2A 3HVDA 3RNFC 1C3TA 4KGRA 4FLHA 1MG8A 2PTLA 1GC6A 2RGFA 2WDVB 2DZMA 4KDLB 1YNTE 3KW5B 4BKGA 4KIKA 3DVGX 4PYZA 5J18A 2JY6A 1FRRA 4HEA1 2JSVX 3PTFC 2LUMA 5IP4D 1N5WA 2BKFA 4M00A 3HRDD 2N9KA 4DHZE 3ECIA 3P4QB 3TEZA 1RFAA 4US8A 2W9NA 3A33B 2JZZA 1VD2A 4JQWC 1V1PA 3AU5A 2AL6A 3PHXB 5BYQA 1R4MI 4AS1A 3QX1A 4NZLB 1FD6A 2HDEA 1KLUD 3DDCB 4W9IA 5D3IB 1VDVA 1I35A 3ZQ4A 2DENB 2OJRA 4N9F4 1I4GA 4NAWB 2FE8A 2ACZB 2WX0A 5EE9A 1ZUD2 4FADA 3TEWA 1EO6A 1I4HA 4W9EA 4GSWA 4MELA 3A1QA 4N6EB 1K53A 1OQRA 1QT9A 4YXDB 1FFUA 4WQMA 3ZW3A 3Q8FA 1GPXA 1GJZA 3RULA 1WR1A 4XE0A 3KH0A 5T8IA 3HK0A 2QSDA 2R61A 1XCTL 3AI5A 3LYYA 4IM2A 2K25A 3KYDD 2KTRB 2L83A 4EFOA 1ZXHA 4FHJA 1UGJA 1LFDA 1WM3A 4F1SA 2XNAC 3AE9B 2KT7A 2WXPA 3I63C 2R2QA 2I1KA 3DBLB 1RFKA 1TY0A 2KVZA 4GB9A 3QWZB 3MHZA 5FKAC 4RCOA 4EOYA 5G55A 1TZOA 3ZIMA 1TYGB 4GIVA 2XBBC 5BYSA 1FCCC 3N30A 4JPSA 2I2YA 3DBRI 3U4EG 3Q3MC 2ZCBA 2ZVOA 1BUIC 5E6OA 3NVVA 1C78A 2MP2B 2FNJB 4WJQA 4CYEA 2IO1B 2KDEB 5JHBA 2PE6B 4ACFA 2KWUB 2KAJA 1STEA 2E6XA 4K3CA 5I4DA 1D5ZC 2M0XA 2BTEA 1YN3A 1I42A 2BW2A 1TS5A 1RLFA 2JZPA 2UU7A 2KX3A 3Q8AA 4NQLB 2INCC 1C79A 4RGTA 2D11A 3NZSA 5HI1A 1T0YA 2HTHA 5G2NA 3AMZA 1B9RA 2BQQA 2LD9A 4ZHPA 2KXJA 5IA7A 2DYOA 1FXTB 1KLVA 5G5GA 1WGHA 2PE9A 2V4LA 1TS4A 1T0QC 3EGRA 4AJYB 2JU6X 3W5VB 1J7AA 1NENB 4EZLA 3JVZX 1EF5A 2JWZA 2KN4A 1GB1A 1Q10A 1XLOA 3NS1A 3UI3A 3V61A 5BMHA 1FRDA 2DBYA 4BBNC 1QOGA 2RPQA 1EU3A 3P42A 4K7UA 3QA8A 1D5MC 3Q8CA 2ZW0A 1J7BA 4TSSA 3VUXA 1WGKA 4KV2A 4NAMA 2RD0A 4ITKA 1ZDVA 1XD3B 2LWPA 2FCMA 4P1CC 4C80A 1I4PA 4XWWA 1K50A 3N1YC 2RDBC 3ZYYX 5CX3A 3AU4A 1V6EA 3OJ4B 4KZ0A 2JVCA 4IUMB 2HJ8A 1AN8A 1F52A 2FIDA 2IPKD 3L16A 3NRZA 4RGOS 4YSXB 2Y5CA 3KUZA 1TBEA 4AWJA 2C7NB 4FJVB 3W1YA 4P7IA 5AZGA 4A3PA 4IWOA 2Z59B 1N63A 5D7GA 2NBUA 1VJKA 4TMAB 5BO4B 1TS2A 4ANWA 3RMKC 3A9KA 5C3JB 1R4NI 1JW9D 3LXFA 1UWXA 1J0GA 2GBJA 1FPYA 1D3ZA 1T6BX 2QMTA 4B6WA 1NI2A 4YWGG 3BZDB 1AW7A 3GZNB 1YQBA 1SIFA 1TKGA 1SSNA 2Z0EB 2FIFA 1FFVA 3VRAB 1E8XA 1C4CA 2VH1A 3NS8A 4EE2A 4KIKB 1Q1OA 3J9CA 2KKCA 1WGYA 2J42A 3V6CB 4BVUC 4ARCA 4HJKA 2DYBA 1LGRA 2MEKA 4HPPA 4KGTA 4IOIE 4B0MA 5IKCM 2Y3AA 2BPSA 2INNE 3N32A 1J8CA 2WXLA 1ROEA 3CIRB 5C1ZA 4FJZA 1V1PB 3AXCA 3TMPB 4ZYSA 2PPHA 3R2TA 2GOWA 2KQ4X 1NI3A 4XYCA 1V97A 1YD8U 1PDXA 3U7ZA 3FILA 1JWAD 3VXWA 1GC7A 3RFZB 2KVRA 4REZA 1S1QB 1UBIA 2GRIA 1ZW7A 1V9JA 2K8BA 3ML9A 3AE5B 2D10A 1GUAB 2WXKA 1L6VA 3A1QB 5FR6A 2CKHB 2KMCA 4WJPA 4BKSD 3I57A 3MC9A 3SHQA 3DBLI 2IO3B 1JWUD 4PS3A 4WWMA 3JSVA 3FKYA 2D3GA 2LXCA 3H1UA 2HJ1A 3OLMD 2A4ZA 1XLNA 2RPVA 4RH6A 1PQSA 2LASA 4WAFA 1YN5A 1VZ7A 1BT0A 2O2VA 1FNWA 1KFYB 2M1MA 3APDA 3ZDTA 1XCQL 3AM9A 2KDFB 2J0KA 1JWBD 3MC8A 3QARA 3PT2B 2MLBA 3B1LX 5D2MB 4DDGD 2WDTB 4LTUA 4ANVA 5D94A 1E7PB 4IM3A 2IY1B 4G11A 3N1XC 4DDID 4HRSA 3VDZA 1S3SG 1NDDA 2K6QA 1WI0A 4EKUA 3MC0B 3U30A 2VH2A 4HXDA 2X8XX 1WZ0A 3M95A 3M62B 3VTUA 5GMVA 3V6EB 1HZ5A 2G45B 5KHQA 2KJHB 2IO0B 3M63B 2DZIA 1WGGA 2HTME 3WAOA 5D3DA 3AEDB 3QQ8B 2JUOA 2MBEA 3AB5A 3ZJUA 1EWYC 5HHDG 1ENFA 2C5LC 1WRIA 3DPDA 4TQ0A 1Z5SB 4IKGA 1HQRD 3A9JA 4DHJB 2WS3B 1RWSA 1ZE3D 3NVWA 1SJED 2QEJC 1WYWB 4DQOC 2WLBA 4XX5A 5D6JB 2NBVB 4ZRQA 5AZFA 1CZPA 4S0RA 5AZHA 3N20C 1SGHA 4EEWA 1YX6B 3RPFC 3BYYB 3IVFA 4E71A 2MA9B 2V0GA 4TUUA 4RM9A 2BWFA 3AEAB 1WIAA 3ZDMC 1NBFC 1ZXIA 1YJ1A 2LMCA 2NPTA 5CHVC 4M02A 3PGEA 1B1ZA 4GDLB 2PKOA 2UYZB 2D2QA 2Y5PA 3DCGA 3RNGC 3AE1B 2NCNA 4A9AA 1YMHE 3V62A 4GN1A 2CJOA 3LJ3A 1RRBA 1GG3A 3P4RB 4N59A 2EKIA 4ZRJA 2W3RA 3GZNI 3WALA 1WJUA 1EM7A 4NJ6A 2E3TA 4J6IA 4NQKE 1Y56A 3A4RA 3KYCD 1HA5A 2ZPYA 3N9YC 1UWMA 1C4AA 1ISNA 4RMAA 1LM8B 3IFWB 1R4NB 1SBBB 3FC4A 3KVFB 1AARA 3UQBA 2CHWA 2WDQB 1E0ZA 1R7SA 3RYTA 2GBMA 2RMMA 5TR5A 2WXRA 4DHZB 3DBHB 1LXDA 1GAQB 1VCBA 2V3NA 3AV8A 3BVGA 3OAWA 3O65B 2OJWA 2A5UA 2C7MB 2FCSA 2FCNA 1RYJA 4W9JA 1DYQA 4LNIA 3QHTA 3R66C 1IUEA 2EELA 3ZVVA 1D6EC 3EFCA 4WQOB 4NPNA 1VZ8A 2GLSA 1WRDB 1K52A 4LNOA 1HZ6A 3RUIB 1ZPSA 3VRBB 1N60A 5MPOA 3VAWA 4ICVA 4JLCA 5DPWA 1HE8A 1WH3A 2LGYA 2N9PC 3PHWB 3RN9C 3ZRCA 1PUTA 3DOWA 2K1FA 3FILB 1JMLA 5JHAA 4MM3A 2MQJA 2WWZA 4OHJA 1ET6A 2GBKA 1MVKA 1QQRA 1WYGA 2VRRB 1UGMA 1E90A 2DWQA 1I4QA 4LNFA 1JWMD 4OVUA 2PVGC 4MGKE 1WGRA 2M4NA 3ABVB 5JZEB 3Q3OC 3DHIC 1F2RC 2GBRA 2K9XA 1E8YA 3L10B 1BMLC 3TIXA 1E5WA 2H88B 3JSVB 2NTTA 3UIPB 1I7HA 3T3OA 4GLSC 5EE1A 4JWUC 2FUG1 1H4RA 1C4PA 1WWTA 1CK1A 3KLSX 2BVCA 1KJTA 3RNAC 3PRZA 2KK8A 2OOBB 1WR6E 1V8CA 2O2VB 2PLPA 1V49A 3N3KB 2MJDA 1IGDA 3HM3A 4J3OD 1K8RB 3SDLC 4LNKA 5H8YE 3VH4B 2LXAA 1TS3A 2QHOA 1WM2A 2FBWB 4OZBA 2PMVA 5CHFA 2ZNVC 4JIOU 4G50A 4MDKE 1VZ6A 3SFEB 1L4ZB 2IY0B 3PSEB 5EDSA 5C2TB 4GGQA 1WXQA 1WXMA 3L0WB 4GDKA 3AULA 2KYWA 1MI0A 1G6JA 1Y8RC 4FXCA 1P0RA 4YTNB 2LFIA 2BKRB 4BKSA 1TJEA 3R7QA 2FUHB 2LGDA 3EECA 3ONSA 2KFKA 4HVBA 1V5TA 4C00A 2KJRA 1SE3A 2PVOD 3UINB 1DOIA 2N4FA 1WX8A 1FO4A 4LNNA 4LLGM 2NVUI 1V5OA 2KQ7A 2IYDB 3ML8A 3IT6B 1L5PA 3WAPA 3SEBA 1DOXA 3P63A 2J53A 2LJIA 2B3AA 2IGHA 4YT0B 3Q6BA 1IBXA 2MBBB 1SIJA 4FBJB 4TKNA 5E6JA 1TKYA 1WE6A 1IGCA 3BK2A 4JE3B 3UQAA 1RAXA 2LRUA 3A9JB 4MJSA 3KUDB 2J4XA 3CMMB 2BF8B 2JF5A 2KLGA 3PLVA 1QOBA 1SE2A 2ZNVB 1A5RA 1WJ4A 2MJEA 4L2YA 3AEBB 2XK5A 3ZJTA 3ZUNA 4XZ4A 4WWOA 1UUPA 4CQNA 3U7DA 2J7QB 4ANUA 1WF9A 1MG4A 3PRPB 5EE3A 4LDTB 4MSQB 2PJHA 5JH5C 1WX9A 3A4SC 4KVGB 3M3JA 4ZRPA 2MBOA 2YVCA 2NPTB 5C23A 1FXAA 4ICUA 1TIFA 4KSKC 2OEDA 1P7FA 3PV1A 2R2OA 5FK9C 2G9HD 2BS3B 1H8CA 4S17A 3NZUA 3UIOB 3QAQA 1OTRB 4MGIE 4M0WA 3ZRFA 1DOYA 3DQVA 1QOFA 3ZO5B 1L7YA 3QK0A 1V1OA 3AECB 1GOZA 2B76B 4JWSC 1GB4A 1KOTA 2KLCA 1HEZE 3IHPC 3S2AA 4DWFA 2N9EB 3DBHI 2DLBA 3VUYA 4WH4A 3PS6A 4JGHB 1ZOYB 4Q2JA 2J0JA 4C4VA 3DVGY 1ZDXA 2CJNA 4MGYE 3TBLD 4KZCA 5J17A 3TJPA 1N62A 2JT4B 2L76A 3IXSA 4ASWC 3AN1A 1WXSA 5AUIA 2IZVB 1UF0A 2M8SA 2VZKB 3AEGB 2J52A 3C8YA 2O6VA 4WIPA 2CHZA 2KHWB 4MT5A 2AWTA 5FR3A 2BS2B 2MBHA 2WXIA 3ZXRA 3R2IA 1HTQA 2D07B 2LZ6A 1SEBD 2KNBA 3MJ5A 3NJTA 4FN2A 2K0PA 5G5HA 4YL8A 1KTKA 2MHJA 2LGSA 3X23A 1P1AA 3IBEA 1JRUA 1L0YB 1OQQA 4H2AA 3MP9A 5BYRA 2HD5B 3VTVA 2L05A 4FA6A 3B0AA 4P1BC 4RGNA 3AE7B 4K3BA 1RM6C 4RF1A 5LNK1 2N7EA 3ZNZB 4MM3B 4YTPB 5L83A 2DNFA 4MGZE 1F0ZA 2WXJA 2CHXA 4RNAA 2K8HA 4A3OA 2LGIA 4B9KA 2QILA 2YEPB 4KKJA 2BT6A 1WXAA 2BYFA 2CU3A 3I9V1 2KACA 3L54A 1IP9A 2KN5A 4WJNA 3BIID 5LXIB 1QZEA 1YOVB 1P3QU 2L1AA 4FJYA 4K7WA 1Q0WB 2KO3A 2DZJA 3HM6X 4ZRIA 3DHGC 1XT9B 2REXA 1BXTA 3PLUA 3APFA 2PEAA 2K8CA 2IO2B 5GXGB 1N6ZA 1PGBA 3W1SA 4W9FA 1PFDA 1WJ6A 1XXGA 4HCPB 2DZKA 4GXBA 4BFRA 4XGAB 4WAAA 1MPEA 2C60A 4E74A 1MHHE 1ET9A 4ZDVA 2D3BA 3PZ8A 3GOEA 2WGSA 3VQIA 3R7RA 1F2RI 3PZDA 3P2BA 1C1YB 1E10A 1Z2MA 2BB6A 2GMIC 4MH8A 1V86A 3ZLZA 3DWMA 2WX1A 4GDKB 1U4AA 3R8BA 2KFJA 3KWLA 3X0WA 4D2KA 1NVID 2KFKB 4L1BA 1IPGA 1WMHA 2DX5B 3CSTA 4RGMA 2KMAA 2LJ5A 3VUWA 2ZZPB 3H9DA 3AEEB 3QIJA 3W5UB 3SU8X 1AWDA 2N9LA 1L4DB
chains in the Genus database with same CATH topology
2MBQA 1KLVA 2DAFA 1WGHA 2PE9A 3RUIB 2V4LA 2K39A 2FCQA 2C7HA 3VAWA 4ICVA 4JLCA 5DPWA 1HE8A 4I6NB 1WH3A 2KZRA 4AJYB 3NHEB 4TV3A 2KDIA 3L13A 3VVWB 2C9WB 2GBNA 4AOFA 4EZLA 4NAWA 3JVZX 2LGYA 1EF5A 2JWZA 1F9JA 2N9PC 3PHWB 3LDZE 3HHMA 3V61A 3ZRCA 3DOWA 4MSMB 2K1FA 4WWPA 5JHAA 2RSUA 4MM3A 2MQJA 2WYQA 4HK2A 4BBNC 2RPQA 2JXXA 1V2YA 2NR2A 2WWZA 2AYOB 4K7UA 2GBKA 5HKHA 3DVNV 3QA8A 4PYUA 2VRRB 1UH6A 2MCNB 1UGMA 1E90A 2ASQA 1YIWA 1P98A 4OVUA 4MGKE 2XK5B 3ZNGC 1WJNA 1CMXB 1WGRA 2M4NA 3VUXA 5JZEB 4KV2A 2K6DB 2LRWA 2RD0A 2GBRA 1UELA 3JYUA 4HWIB 2KWVB 1OEYA 1XD3B 2LWPA 1E8YA 2FCMA 2MSED 1TGZB 1WGDA 2JRIB 3L10B 5E6PA 4EZJA 3ZTCA 4W9GA 3TIXA 5CX3A 1E8ZA 3AU4A 4IC7B 4JL9A 1V6EA 3OJ4B 4G3XB 4KZ0A 1E5WA 2JVCA 3JSVB 3NY5A 2HJ8A 3MHSD 4IUMB 3UIPB 4BOSC 2KTRA 4GMVA 4IW0A 3OJ3A 3TCAA 2HE7A 1TTNA 4GOCA 4PS7A 2FIDA 3EC8A 3L16A 3ZKJC 1H4RA 3KUZA 1TBEA 3R3MA 4AWJA 3KUCB 2C7NB 1WX7A 1KJTA 4NY0A 1ZKHA 3PRZA 4FJVB 3W1YA 2KK8A 4P7IA 5AZGA 2OOBB 4A3PA 4IWOA 2Z59B 1WR6E 5D7GA 2NBUA 2L7RA 2O2VB 1V49A 3N3KB 5BO4B 4FHKA 4HPLB 3UGBB 3A9KB 1WE7A 4M0WB 2KOXA 4WJOA 4TQ1A 4X57B 3HM3A 4ANWA 3A9KA 1K8RB 4DHJD 1LQBA 3SDLC 4MH0E 2AEHA 1R4NI 4F8CB 3VH4B 2LXAA 2QHOA 2KQSA 1WM2A 1V80A 2DHZA 4BBNF 1J0GA 2GBJA 1D3ZA 3D32A 2MP2A 4K81A 2LUEA 4B6WA 1NI2A 3ZNID 5CHFA 2ZNVC 3EHVA 4JIOU 2V1YA 2AL3A 4G50A 1YQBA 1ZGUB 1SIFA 2BYVE 4MDKE 3TL5A 1EUVB 2IY0B 2Z0EB 1M94A 3H7PA 3PSEB 4GGQA 5EDSA 1WXMA 2FIFA 3L0WB 4GDKA 3AULA 1G6JA 1Y8RC 1P0RA 3WIMA 4BKSA 1E8XA 2BKRB 1E7VA 3R7QA 5DPRA 2FUHB 2LGDA 3EECA 3ONSA 1WY8A 2KFKA 4HVBA 1V5TA 3NS8A 3RZWC 2L0FA 2KJRA 2MRPA 4KIKB 3VHTC 3UINB 1Q1OA 3WAMA 2EMTA 2KKCA 1WGYA 2G3QB 2G4SA 2N4FA 1WX8A 2O6VB 4WWNA 3L17A 3V6CB 2DYMA 4HDOA 3T9LA 4BVUC 2NVUI 1V5OA 4HJKA 2DYBA 2KJ6A 4G0NB 2KQ7A 1L2NA 2IYDB 3ML8A 4RM8A 5DPSA 1TZ1A 3WAPA 2BPSA 3N32A 1J8CA 2UWQA 3K9OB 2B3AA 2Z0DB 3SD5A 1UD7A 4HDQA 2N1VA 5C1ZA 2IBIB 4W9DA 2MBBB 2YLMA 2LVQA 4FJZA 2BYEA 3W1SC 2MW5A 4FBJB 3AXCA 4II3B 4OVVA 4TKNA 3TMPB 4NNJB 3QCAA 1WE6A 2PPHA 4I6PA 3RZFA 2ZPNA 2GOWA 3Q3FA 2KC1A 3UQAA 1RAXA 1WZ3A 1YD8U 4MJSB 2CS4A 2LRUA 3A9JB 3V60A 4MJSA 3VXWA 1GC7A 2RR9A 3KUDB 3Q3JA 3CMMB 2BF8B 2KVRA 2N9XA 3MTNB 3RT3B 1S1QB 1WXVA 2JF5A 1E8WA 1UBIA 4CO7A 2ZVNA 2KLGA 1OEYJ 1ZW7A 3PLVA 4FULA 4MEMA 2ZNVB 1V9JA 1A5RA 2K8BA 1WJ4A 3ML9A 3PREA 3CSFA 4IG7B 2D10A 1GUAB 3ALBA 2L8JA 3T8MA 2V3SA 5DCNA 2XK5A 1OGWA 4E3CA 3A1QB 4DXAB 5FR6A 2CKHB 4XZ4A 3ZUNA 4WWOA 3U7DA 2KMCA 2J7QB 4ANUA 4WJPA 2KX0A 4BKSD 1WF9A 5LXHA 3PRPB 4NJ7A 4LDTB 2MX2A 4MSQB 2PJHA 4LCDE 5JH5C 1KM7A 3PVLA 4LJOB 1WX9A 2J0MA 3A4SC 3SHQA 5IAAC 1SE9A 3DBLI 4KVGB 2IO3B 3M3JA 3VH3B 4PS3A 3JSVA 4KDIC 4B95A 2D3GA 2MBOA 2I1JA 2LXCA 2YVCA 2L3ZA 4W9LA 2NPTB 4IM0A 5C23A 4ICUA 3DVNU 3H1UA 4KSKC 4DBGA 2KWCA 2O6VD 3WA0A 2JZ3B 3OLMD 4BOZB 4F7ZA 4PS8A 2A4ZA 3PV1A 1EF1A 2R2OA 4URKA 4BKTA 1PQSA 3NOBA 2BWES 2LASA 3JW0X 1H8CA 3NZUA 3UIOB 3QAQA 1BT0A 2O2VA 1OTRB 4M8NA 4MGIE 4HLEA 4ZRKA 3ZRFA 3DQVA 3ZO5B 1XQQA 2BGFA 1L7YA 5AEKB 2M1MA 3QK0A 3HIZA 3IG3A 3APDA 3ZDTA 2CU1A 4W9CA 3EFUA 1E7UA 2KDFB 2N1WA 2J0KA 1KOTA 3QARA 2KLCA 3WANA 3PT2B 3IHPC 2LVOA 2MLBA 3S2AA 4DWFA 2DAJA 2N9EB 3K9PB 3DBHI 3ZTDA 3B1LX 5D2MB 3VUYA 5CTRC 3PS6A 4DDGD 2WDTB 4XC2A 4JGHB 5D94A 4IM3A 4ANVA 4I6LB 3BINA 2IY1B 5LLIA 4G11A 2J0JA 3QJZA 2KC2A 3DVGY 4K1RB 2L00B 4DDID 3B08A 1C3TA 4MGYE 4FLHA 4KZCA 3TBLD 3VDZA 1MG8A 2LGXA 5J17A 4IWPA 3TJPA 1S3SG 1NDDA 2KDBA 2K6QA 3U8ZA 2JT4B 2L76A 4ASWC 1WI0A 3H6NA 4M8MA 4EKUA 3MJWA 2LVPA 1GC6A 2RGFA 2DZMA 4KDLB 1WXSA 3KW5B 4BKGA 4KIKA 2IZVB 3DVGX 4HXDA 4PYZA 2JY6A 2M8SA 3U30A 4EZKA 5J18A 1P9DU 3PRMB 4LDTD 1WZ0A 3M95A 2O6VA 2ZEQA 5L95C 3M62B 3VTUA 2CHZA 2KHWB 2EKEC 1WMHB 5GMVA 3PTFC 3V6EB 2AWTA 2G45B 5KHQA 2KJHB 2BKFA 2G4DB 2MBHA 3L08A 1J19A 2IO0B 3M63B 4AJWA 2D07B 2LZ6A 2FAZA 3APCA 4DHZE 2DZIA 2KNBA 2KANA 1WGGA 3ECIA 1RFAA 4FN2A 1V81A 4YL8A 3WAOA 3QQ8B 3QC8B 4DK5A 2W9NA 1GNUA 2JUOA 2MBEA 3A33B 3X23A 2JZZA 1VD2A 4JQWC 1P1AA 3AU5A 2AL6A 2Y5BB 3IBEA 3PHXB 1R4MI 1JRUA 2C5LC 3QX1A 2HD5B 3VTVA 3DPDA 3CF6E 4TQ0A 3DDCB 4W9IA 5CHWA 2L05A 1Z5SB 4FA6A 4A20A 2XEWA 1I35A 3A9JA 2DENB 3B0AA 2OJRA 4N9F4 4DHJB 4KSLC 2EMSA 4NAWB 3ENEA 1WYWB 2WX0A 4XX5A 5D6JB 2NBVB 4AP4C 2N7EA 5AZFA 3ZNZB 4FADA 1EO6A 4W9EA 5AZHA 2JPHA 5L83A 4GSWA 1Q5WB 4MELA 4MGZE 3A1QA 1SGHA 4EEWA 1YX6B 2CHXA 3RCZA 2K8HA 3IVFA 4GU2A 4K7SA 4A3OA 2L0TA 4E71A 2KD0A 4B9KA 2MA9B 3L54A 1WXAA 2BYFA 4RM9A 4TUUA 1IP9A 2BWFA 2KN5A 4WJNA 3ZW3A 1WIAA 5LXIB 1GJZA 3RULA 1QZEA 1WR1A 1WFYA 3ZDMC 1NBFC 3ZNHB 4W9HA 3C0RB 1P3QU 1YJ1A 4HCNB 3KH0A 4FJYA 2NPTA 1UZXB 4K7WA 5CHVC 5KHOA 1Q0WB 2KO3A 4ZYNA 2DZJA 3HM6X 4ZRIA 3HK0A 2KTFA 1XT9B 3PGEA 3AI5A 3RD2A 4IM2A 2K25A 3KYDD 4GDLB 2KTRB 2UYZB 3H7SA 2NBWB 4EFOA 2REXA 5E6NA 4FHJA 1LFDA 1WM3A 4GDLA 2D2QA 3BY4B 3DCGA 3PLUA 4F1SA 1IYFA 2NCNA 3APFA 2PEAA 2K8CA 2R2QA 2I1KA 2IO2B 5J2RA 5DPTA 3V62A 4GB9A 4GN1A 3W1SA 3LJ3A 4W9FA 4W9KA 1RRBA 3QWZB 1GG3A 1WJ6A 4EUTA 4EOYA 4ZRJA 4HCPB 5G55A 2DZKA 1UBQA 3GZNI 4GXBA 4BFRA 3ZIMA 2LI5A 4GIVA 4WAAA 2XBBC 2NS5A 3VTWA 3WALA 4IWQA 2C60A 1WJUA 4E74A 4NJ6A 4J6IA 4NQKE 3DBSA 2ZCCA 3N30A 3A4RA 3DBRI 4ZDVA 3KYCD 2ZPYA 2ZCBA 1ISNA 3GOEA 2ZVOA 4RMAA 5E6OA 3VQIA 3R7RA 3PZDA 3P2BA 4HPMB 3I3TB 4ANXA 1C1YB 2MP2B 1LM8B 1Z2MA 3IFWB 2FNJB 2GMIC 4II2B 4WJQA 3KVFB 2IO1B 2KDEB 1AARA 2N7DA 4CYEA 5JHBA 3PPAA 3UQBA 2PE6B 2CHWA 2KWUB 1V86A 3H7PB 2MWSB 3ZLZA 3RYTA 2GBMA 2WX1A 5TR5A 4GDKB 1U4AA 4AUQC 2KFJA 4DHZB 2CR5A 1X1MA 1LXDA 1VCBA 3X0WA 2M17A 2M0XA 3OAWA 2KFKB 3O65B 1IPGA 2JRHA 1WMHA 4LJPB 1I42A 2DX5B 1RLFA 3CSTA 2A5UA 2C7MB 2FCSA 2FCNA 3VFKA 2KMAA 2LJ5A 3VUWA 2KX3A 2ZZPB 4W9JA 4CHKA 4NQLB 3QHTA 3R66C 1OQYA 3ZVVA 3UF8A 2ZJDA 3H9DA 2D11A 3NZSA 3QIJA 1T0YA 2HTHA 4WQOB 5G2NA 2LD9A 3SU8X 1YX5B 4NPNA 2KXJA 5IA7A 2DYOA 1FXTB 1WRDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBQ A;  1KLV A;  2DAF A;  1WGH A;  2PE9 A;  3RUI B;  2V4L A;  2K39 A;  2FCQ A;  2C7H A;  3VAW A;  4ICV A;  4JLC A;  5DPW A;  1HE8 A;  4I6N B;  1WH3 A;  2KZR A;  4AJY B;  3NHE B;  4TV3 A;  2KDI A;  3L13 A;  3VVW B;  2C9W B;  2GBN A;  4AOF A;  4EZL A;  4NAW A;  3JVZ X;  2LGY A;  1EF5 A;  2JWZ A;  1F9J A;  2N9P C;  3PHW B;  3LDZ E;  3HHM A;  3V61 A;  3ZRC A;  3DOW A;  4MSM B;  2K1F A;  4WWP A;  5JHA A;  2RSU A;  4MM3 A;  2MQJ A;  2WYQ A;  4HK2 A;  4BBN C;  2RPQ A;  2JXX A;  1V2Y A;  2NR2 A;  2WWZ A;  2AYO B;  4K7U A;  2GBK A;  5HKH A;  3DVN V;  3QA8 A;  4PYU A;  2VRR B;  1UH6 A;  2MCN B;  1UGM A;  1E90 A;  2ASQ A;  1YIW A;  1P98 A;  4OVU A;  4MGK E;  2XK5 B;  3ZNG C;  1WJN A;  1CMX B;  1WGR A;  2M4N A;  3VUX A;  5JZE B;  4KV2 A;  2K6D B;  2LRW A;  2RD0 A;  2GBR A;  1UEL A;  3JYU A;  4HWI B;  2KWV B;  1OEY A;  1XD3 B;  2LWP A;  1E8Y A;  2FCM A;  2MSE D;  1TGZ B;  1WGD A;  2JRI B;  3L10 B;  5E6P A;  4EZJ A;  3ZTC A;  4W9G A;  3TIX A;  5CX3 A;  1E8Z A;  3AU4 A;  4IC7 B;  4JL9 A;  1V6E A;  3OJ4 B;  4G3X B;  4KZ0 A;  1E5W A;  2JVC A;  3JSV B;  3NY5 A;  2HJ8 A;  3MHS D;  4IUM B;  3UIP B;  4BOS C;  2KTR A;  4GMV A;  4IW0 A;  3OJ3 A;  3TCA A;  2HE7 A;  1TTN A;  4GOC A;  4PS7 A;  2FID A;  3EC8 A;  3L16 A;  3ZKJ C;  1H4R A;  3KUZ A;  1TBE A;  3R3M A;  4AWJ A;  3KUC B;  2C7N B;  1WX7 A;  1KJT A;  4NY0 A;  1ZKH A;  3PRZ A;  4FJV B;  3W1Y A;  2KK8 A;  4P7I A;  5AZG A;  2OOB B;  4A3P A;  4IWO A;  2Z59 B;  1WR6 E;  5D7G A;  2NBU A;  2L7R A;  2O2V B;  1V49 A;  3N3K B;  5BO4 B;  4FHK A;  4HPL B;  3UGB B;  3A9K B;  1WE7 A;  4M0W B;  2KOX A;  4WJO A;  4TQ1 A;  4X57 B;  3HM3 A;  4ANW A;  3A9K A;  1K8R B;  4DHJ D;  1LQB A;  3SDL C;  4MH0 E;  2AEH A;  1R4N I;  4F8C B;  3VH4 B;  2LXA A;  2QHO A;  2KQS A;  1WM2 A;  1V80 A;  2DHZ A;  4BBN F;  1J0G A;  2GBJ A;  1D3Z A;  3D32 A;  2MP2 A;  4K81 A;  2LUE A;  4B6W A;  1NI2 A;  3ZNI D;  5CHF A;  2ZNV C;  3EHV A;  4JIO U;  2V1Y A;  2AL3 A;  4G50 A;  1YQB A;  1ZGU B;  1SIF A;  2BYV E;  4MDK E;  3TL5 A;  1EUV B;  2IY0 B;  2Z0E B;  1M94 A;  3H7P A;  3PSE B;  4GGQ A;  5EDS A;  1WXM A;  2FIF A;  3L0W B;  4GDK A;  3AUL A;  1G6J A;  1Y8R C;  1P0R A;  3WIM A;  4BKS A;  1E8X A;  2BKR B;  1E7V A;  3R7Q A;  5DPR A;  2FUH B;  2LGD A;  3EEC A;  3ONS A;  1WY8 A;  2KFK A;  4HVB A;  1V5T A;  3NS8 A;  3RZW C;  2L0F A;  2KJR A;  2MRP A;  4KIK B;  3VHT C;  3UIN B;  1Q1O A;  3WAM A;  2EMT A;  2KKC A;  1WGY A;  2G3Q B;  2G4S A;  2N4F A;  1WX8 A;  2O6V B;  4WWN A;  3L17 A;  3V6C B;  2DYM A;  4HDO A;  3T9L A;  4BVU C;  2NVU I;  1V5O A;  4HJK A;  2DYB A;  2KJ6 A;  4G0N B;  2KQ7 A;  1L2N A;  2IYD B;  3ML8 A;  4RM8 A;  5DPS A;  1TZ1 A;  3WAP A;  2BPS A;  3N32 A;  1J8C A;  2UWQ A;  3K9O B;  2B3A A;  2Z0D B;  3SD5 A;  1UD7 A;  4HDQ A;  2N1V A;  5C1Z A;  2IBI B;  4W9D A;  2MBB B;  2YLM A;  2LVQ A;  4FJZ A;  2BYE A;  3W1S C;  2MW5 A;  4FBJ B;  3AXC A;  4II3 B;  4OVV A;  4TKN A;  3TMP B;  4NNJ B;  3QCA A;  1WE6 A;  2PPH A;  4I6P A;  3RZF A;  2ZPN A;  2GOW A;  3Q3F A;  2KC1 A;  3UQA A;  1RAX A;  1WZ3 A;  1YD8 U;  4MJS B;  2CS4 A;  2LRU A;  3A9J B;  3V60 A;  4MJS A;  3VXW A;  1GC7 A;  2RR9 A;  3KUD B;  3Q3J A;  3CMM B;  2BF8 B;  2KVR A;  2N9X A;  3MTN B;  3RT3 B;  1S1Q B;  1WXV A;  2JF5 A;  1E8W A;  1UBI A;  4CO7 A;  2ZVN A;  2KLG A;  1OEY J;  1ZW7 A;  3PLV A;  4FUL A;  4MEM A;  2ZNV B;  1V9J A;  1A5R A;  2K8B A;  1WJ4 A;  3ML9 A;  3PRE A;  3CSF A;  4IG7 B;  2D10 A;  1GUA B;  3ALB A;  2L8J A;  3T8M A;  2V3S A;  5DCN A;  2XK5 A;  1OGW A;  4E3C A;  3A1Q B;  4DXA B;  5FR6 A;  2CKH B;  4XZ4 A;  3ZUN A;  4WWO A;  3U7D A;  2KMC A;  2J7Q B;  4ANU A;  4WJP A;  2KX0 A;  4BKS D;  1WF9 A;  5LXH A;  3PRP B;  4NJ7 A;  4LDT B;  2MX2 A;  4MSQ B;  2PJH A;  4LCD E;  5JH5 C;  1KM7 A;  3PVL A;  4LJO B;  1WX9 A;  2J0M A;  3A4S C;  3SHQ A;  5IAA C;  1SE9 A;  3DBL I;  4KVG B;  2IO3 B;  3M3J A;  3VH3 B;  4PS3 A;  3JSV A;  4KDI C;  4B95 A;  2D3G A;  2MBO A;  2I1J A;  2LXC A;  2YVC A;  2L3Z A;  4W9L A;  2NPT B;  4IM0 A;  5C23 A;  4ICU A;  3DVN U;  3H1U A;  4KSK C;  4DBG A;  2KWC A;  2O6V D;  3WA0 A;  2JZ3 B;  3OLM D;  4BOZ B;  4F7Z A;  4PS8 A;  2A4Z A;  3PV1 A;  1EF1 A;  2R2O A;  4URK A;  4BKT A;  1PQS A;  3NOB A;  2BWE S;  2LAS A;  3JW0 X;  1H8C A;  3NZU A;  3UIO B;  3QAQ A;  1BT0 A;  2O2V A;  1OTR B;  4M8N A;  4MGI E;  4HLE A;  4ZRK A;  3ZRF A;  3DQV A;  3ZO5 B;  1XQQ A;  2BGF A;  1L7Y A;  5AEK B;  2M1M A;  3QK0 A;  3HIZ A;  3IG3 A;  3APD A;  3ZDT A;  2CU1 A;  4W9C A;  3EFU A;  1E7U A;  2KDF B;  2N1W A;  2J0K A;  1KOT A;  3QAR A;  2KLC A;  3WAN A;  3PT2 B;  3IHP C;  2LVO A;  2MLB A;  3S2A A;  4DWF A;  2DAJ A;  2N9E B;  3K9P B;  3DBH I;  3ZTD A;  3B1L X;  5D2M B;  3VUY A;  5CTR C;  3PS6 A;  4DDG D;  2WDT B;  4XC2 A;  4JGH B;  5D94 A;  4IM3 A;  4ANV A;  4I6L B;  3BIN A;  2IY1 B;  5LLI A;  4G11 A;  2J0J A;  3QJZ A;  2KC2 A;  3DVG Y;  4K1R B;  2L00 B;  4DDI D;  3B08 A;  1C3T A;  4MGY E;  4FLH A;  4KZC A;  3TBL D;  3VDZ A;  1MG8 A;  2LGX A;  5J17 A;  4IWP A;  3TJP A;  1S3S G;  1NDD A;  2KDB A;  2K6Q A;  3U8Z A;  2JT4 B;  2L76 A;  4ASW C;  1WI0 A;  3H6N A;  4M8M A;  4EKU A;  3MJW A;  2LVP A;  1GC6 A;  2RGF A;  2DZM A;  4KDL B;  1WXS A;  3KW5 B;  4BKG A;  4KIK A;  2IZV B;  3DVG X;  4HXD A;  4PYZ A;  2JY6 A;  2M8S A;  3U30 A;  4EZK A;  5J18 A;  1P9D U;  3PRM B;  4LDT D;  1WZ0 A;  3M95 A;  2O6V A;  2ZEQ A;  5L95 C;  3M62 B;  3VTU A;  2CHZ A;  2KHW B;  2EKE C;  1WMH B;  5GMV A;  3PTF C;  3V6E B;  2AWT A;  2G45 B;  5KHQ A;  2KJH B;  2BKF A;  2G4D B;  2MBH A;  3L08 A;  1J19 A;  2IO0 B;  3M63 B;  4AJW A;  2D07 B;  2LZ6 A;  2FAZ A;  3APC A;  4DHZ E;  2DZI A;  2KNB A;  2KAN A;  1WGG A;  3ECI A;  1RFA A;  4FN2 A;  1V81 A;  4YL8 A;  3WAO A;  3QQ8 B;  3QC8 B;  4DK5 A;  2W9N A;  1GNU A;  2JUO A;  2MBE A;  3A33 B;  3X23 A;  2JZZ A;  1VD2 A;  4JQW C;  1P1A A;  3AU5 A;  2AL6 A;  2Y5B B;  3IBE A;  3PHX B;  1R4M I;  1JRU A;  2C5L C;  3QX1 A;  2HD5 B;  3VTV A;  3DPD A;  3CF6 E;  4TQ0 A;  3DDC B;  4W9I A;  5CHW A;  2L05 A;  1Z5S B;  4FA6 A;  4A20 A;  2XEW A;  1I35 A;  3A9J A;  2DEN B;  3B0A A;  2OJR A;  4N9F 4;  4DHJ B;  4KSL C;  2EMS A;  4NAW B;  3ENE A;  1WYW B;  2WX0 A;  4XX5 A;  5D6J B;  2NBV B;  4AP4 C;  2N7E A;  5AZF A;  3ZNZ B;  4FAD A;  1EO6 A;  4W9E A;  5AZH A;  2JPH A;  5L83 A;  4GSW A;  1Q5W B;  4MEL A;  4MGZ E;  3A1Q A;  1SGH A;  4EEW A;  1YX6 B;  2CHX A;  3RCZ A;  2K8H A;  3IVF A;  4GU2 A;  4K7S A;  4A3O A;  2L0T A;  4E71 A;  2KD0 A;  4B9K A;  2MA9 B;  3L54 A;  1WXA A;  2BYF A;  4RM9 A;  4TUU A;  1IP9 A;  2BWF A;  2KN5 A;  4WJN A;  3ZW3 A;  1WIA A;  5LXI B;  1GJZ A;  3RUL A;  1QZE A;  1WR1 A;  1WFY A;  3ZDM C;  1NBF C;  3ZNH B;  4W9H A;  3C0R B;  1P3Q U;  1YJ1 A;  4HCN B;  3KH0 A;  4FJY A;  2NPT A;  1UZX B;  4K7W A;  5CHV C;  5KHO A;  1Q0W B;  2KO3 A;  4ZYN A;  2DZJ A;  3HM6 X;  4ZRI A;  3HK0 A;  2KTF A;  1XT9 B;  3PGE A;  3AI5 A;  3RD2 A;  4IM2 A;  2K25 A;  3KYD D;  4GDL B;  2KTR B;  2UYZ B;  3H7S A;  2NBW B;  4EFO A;  2REX A;  5E6N A;  4FHJ A;  1LFD A;  1WM3 A;  4GDL A;  2D2Q A;  3BY4 B;  3DCG A;  3PLU A;  4F1S A;  1IYF A;  2NCN A;  3APF A;  2PEA A;  2K8C A;  2R2Q A;  2I1K A;  2IO2 B;  5J2R A;  5DPT A;  3V62 A;  4GB9 A;  4GN1 A;  3W1S A;  3LJ3 A;  4W9F A;  4W9K A;  1RRB A;  3QWZ B;  1GG3 A;  1WJ6 A;  4EUT A;  4EOY A;  4ZRJ A;  4HCP B;  5G55 A;  2DZK A;  1UBQ A;  3GZN I;  4GXB A;  4BFR A;  3ZIM A;  2LI5 A;  4GIV A;  4WAA A;  2XBB C;  2NS5 A;  3VTW A;  3WAL A;  4IWQ A;  2C60 A;  1WJU A;  4E74 A;  4NJ6 A;  4J6I A;  4NQK E;  3DBS A;  2ZCC A;  3N30 A;  3A4R A;  3DBR I;  4ZDV A;  3KYC D;  2ZPY A;  2ZCB A;  1ISN A;  3GOE A;  2ZVO A;  4RMA A;  5E6O A;  3VQI A;  3R7R A;  3PZD A;  3P2B A;  4HPM B;  3I3T B;  4ANX A;  1C1Y B;  2MP2 B;  1LM8 B;  1Z2M A;  3IFW B;  2FNJ B;  2GMI C;  4II2 B;  4WJQ A;  3KVF B;  2IO1 B;  2KDE B;  1AAR A;  2N7D A;  4CYE A;  5JHB A;  3PPA A;  3UQB A;  2PE6 B;  2CHW A;  2KWU B;  1V86 A;  3H7P B;  2MWS B;  3ZLZ A;  3RYT A;  2GBM A;  2WX1 A;  5TR5 A;  4GDK B;  1U4A A;  4AUQ C;  2KFJ A;  4DHZ B;  2CR5 A;  1X1M A;  1LXD A;  1VCB A;  3X0W A;  2M17 A;  2M0X A;  3OAW A;  2KFK B;  3O65 B;  1IPG A;  2JRH A;  1WMH A;  4LJP B;  1I42 A;  2DX5 B;  1RLF A;  3CST A;  2A5U A;  2C7M B;  2FCS A;  2FCN A;  3VFK A;  2KMA A;  2LJ5 A;  3VUW A;  2KX3 A;  2ZZP B;  4W9J A;  4CHK A;  4NQL B;  3QHT A;  3R66 C;  1OQY A;  3ZVV A;  3UF8 A;  2ZJD A;  3H9D A;  2D11 A;  3NZS A;  3QIJ A;  1T0Y A;  2HTH A;  4WQO B;  5G2N A;  2LD9 A;  3SU8 X;  1YX5 B;  4NPN A;  2KXJ A;  5IA7 A;  2DYO A;  1FXT B;  1WRD B; 
#chains in the Genus database with same CATH topology
 3IT4 B;  2LHE A;  2WU5 B;  2C7H A;  1TY2 A;  2Q5W D;  4C56 C;  1XLQ A;  4I6N B;  2KZR A;  4ZOH C;  3NHE B;  1FEH A;  4TV3 A;  2KDI A;  2Z8L A;  3L13 A;  3VVW B;  3BVZ A;  2GBN A;  4AOF A;  3LDZ E;  3HHM A;  3OWE B;  1CQV A;  5JXV A;  3GS2 A;  2RSU A;  3DHH C;  4QAY A;  2WYQ A;  4RF0 A;  2NR2 A;  1FMA D;  1HTO A;  4PYU A;  2ASQ A;  1YIW A;  1PYW D;  2XK5 B;  3ZNG C;  3IAM 1;  2QJL A;  3OG5 A;  4YSZ B;  1KLG D;  3N1Z C;  2W55 A;  2K6D B;  2WXF A;  1UEL A;  4HWI B;  2KWV B;  4PT5 A;  3O13 A;  2MSE D;  1TGZ B;  1WGD A;  5E6P A;  3ZTC A;  4W9G A;  1E8Z A;  2JX5 A;  4G3X B;  3NY5 A;  4GMV A;  4M01 A;  4IW0 A;  3OJ3 A;  2BB5 A;  2HE7 A;  2LHD A;  1TTN A;  3EC8 A;  3Q8B A;  3HUI A;  3W2D A;  3ZKJ C;  3Q69 A;  3R3M A;  3KUC B;  2IND C;  1L0X B;  1WX7 A;  3TEX A;  1E9M A;  1FXI A;  3AH7 A;  1I4X A;  3VR9 B;  2V9H A;  1YJJ A;  3I5J C;  4FHK A;  3UGB B;  3A9K B;  1WE7 A;  4M0W B;  2KOX A;  4WJO A;  4TQ1 A;  2MH7 A;  3AE4 B;  5BMI A;  2N7J A;  3LB8 C;  1T0R C;  1V80 A;  2NMQ A;  2N0S B;  3AEF B;  2LUE A;  2AL3 A;  1ZGU B;  3NVZ A;  3H7P A;  1M94 A;  1AYF A;  4C4V B;  3TUO A;  3WIM A;  5IO9 A;  4IDI A;  1WY8 A;  3RZW C;  2MRP A;  3TSS A;  2EMT A;  1ACC A;  3NVY A;  2O6V B;  3L17 A;  2WNM A;  1MJD A;  4HDO A;  5BMG A;  2KJ6 A;  4G0N B;  4A90 A;  1L2N A;  4RM8 A;  1CJE A;  3K9O B;  2Z0D B;  1UD7 A;  2N1V A;  2INP E;  2IBI B;  4W9D A;  3W1S C;  2MW5 A;  2WHI A;  4OVV A;  3H8H A;  2V4I B;  4NNJ B;  4I6P A;  1JRP A;  3T3N A;  3RZF A;  3Q3F A;  1WZ3 A;  2CS4 A;  4HKQ A;  2RDH A;  1JRO A;  1TKE A;  2G1E A;  1FM0 D;  3MTN B;  1WXV A;  1E8W A;  4CO7 A;  2AQ2 B;  3RI7 C;  2L8J A;  3T8M A;  2BYT A;  2V3S A;  1XF5 L;  5DCN A;  1MFW A;  1OGW A;  4E3C A;  3B2F A;  4WUR A;  2KX0 A;  4NJ7 A;  2NTS A;  1KM7 A;  2JQR B;  4LJO B;  2J0M A;  1QIL A;  3VH3 B;  4KDI C;  1JAL A;  3EA6 A;  4W9L A;  3AE3 B;  3DVN U;  4P16 A;  3WA0 A;  2QC8 A;  2JZ3 B;  3P4S B;  4PS8 A;  3ZXV A;  3BWU D;  3KQ4 A;  5HG2 A;  2BWE S;  1F77 A;  3SR6 A;  3JW0 X;  2WXG A;  5HFY A;  3NG0 A;  1J7C A;  4M8N A;  3AE6 B;  2QDF A;  1QLB B;  1XQQ A;  3HIZ A;  3IG3 A;  3C19 A;  4W9C A;  3EFU A;  1E7U A;  2N1W A;  4DXF A;  1T5X D;  2LVO A;  3K9P B;  2IJ0 A;  3SFD B;  4HKZ E;  4XC2 A;  3W9C B;  4I6L B;  5LLI A;  2IGD A;  3QJZ A;  3U52 E;  2D5G A;  4K1R B;  2L00 B;  5H92 C;  3B08 A;  3PZ7 A;  2LGX A;  4IWP A;  2KDB A;  3NZ3 A;  3U8Z A;  3H6N A;  4M8M A;  3MJW A;  2LVP A;  5IOI A;  3FAH A;  4EZK A;  1P9D U;  3PRM B;  4LDT D;  3RNE C;  2ZEQ A;  5L95 C;  4DXG A;  2EKE C;  1WMH B;  3WCQ A;  3URY A;  2G4D B;  3L08 A;  1J19 A;  1NYQ A;  4AJW A;  3APC A;  2FAZ A;  1YN4 A;  2KAN A;  3EUB 2;  3V3X A;  4OW0 A;  1V81 A;  1KRH A;  3P4P B;  1D4B A;  3QC8 B;  4DK5 A;  1YQ4 B;  1GNU A;  2KDM A;  2Y5B B;  3HVZ A;  5IN7 A;  4KX6 B;  3CF6 E;  3Q8E A;  5CHW A;  1C76 A;  4A20 A;  4N58 A;  2XEW A;  1JCK B;  4KSL C;  2W3S A;  2EMS A;  2SAK A;  3ENE A;  3U2S C;  2I38 A;  1TT5 B;  1MHX A;  2M19 A;  4AP4 C;  1PGX A;  2M0A A;  1VRA B;  3B9J A;  2JPH A;  1Q5W B;  1VR9 A;  2IDY A;  1FCL A;  3RCZ A;  4GU2 A;  4K7S A;  2L0T A;  3BYT B;  2KD0 A;  2WXH A;  1KF6 B;  3ZNH B;  1WFY A;  3KWV A;  4W9H A;  3C0R B;  4HCN B;  1UZX B;  5KHO A;  4OVZ A;  4ZYN A;  2VZK D;  2KTF A;  1E6E B;  2W54 A;  3ZJV A;  4HRO A;  3RD2 A;  3H7S A;  2NBW B;  4JX1 C;  5E6N A;  1T0S C;  4GDL A;  2ONQ A;  3BY4 B;  1IYF A;  3PO0 A;  5J2R A;  5DPT A;  3NUH B;  1L6U A;  4W9K A;  3CWI A;  1N5X A;  4EUT A;  2PW9 A;  2ON8 A;  1UBQ A;  1SXT A;  2LI5 A;  2NS5 A;  3VTW A;  2MJ3 A;  4IWQ A;  1EWC A;  3DBS A;  2ZCC A;  5AUK A;  1XO3 A;  5EE0 A;  2KWD A;  4HPM B;  3RNB C;  3I3T B;  4ANX A;  2AX5 A;  4II2 B;  3ETR A;  2N7D A;  2X38 A;  3PPA A;  3Q3N C;  3H7P B;  2WXO A;  2MWS B;  3GE8 C;  2RDG A;  4AUQ C;  2CR5 A;  1X1M A;  2AQ3 B;  2M17 A;  1M4V A;  1L0V B;  2JRH A;  4LJP B;  4YTM B;  2WXQ A;  3VFK A;  4CHK A;  1SB3 C;  1OQY A;  3UF8 A;  2ZJD A;  4LK0 M;  1YX5 B;  2TSS A;  1FNU A;  1XEE A;  1I4R A;  4A8X C;  2MBQ A;  2DAF A;  2K39 A;  2FCQ A;  2WQY B;  1KH0 A;  2K22 A;  2C9W B;  2OHF A;  4NAW A;  1F9J A;  1NEK B;  4MSM B;  4WWP A;  1JQ4 A;  1R4M B;  5TSS A;  2BBC A;  4HK2 A;  4A6Q A;  2JXX A;  1V2Y A;  2AYO B;  5HKH A;  3DVN V;  1UH6 A;  2MCN B;  1P98 A;  3V05 A;  2ICI A;  1WJN A;  1CMX B;  2LRW A;  1C77 A;  3JYU A;  3DWG C;  1ZP0 B;  1OEY A;  2JRI B;  4KKI A;  4EZJ A;  4IC7 B;  4JL9 A;  1D5X C;  4BOS C;  3VR8 B;  3MHS D;  2L52 A;  2KTR A;  4NJC A;  3TCA A;  2L32 A;  4GOC A;  4PS7 A;  2JXT A;  2M56 B;  2WDR B;  2GB1 A;  4NY0 A;  1P7E A;  1ZKH A;  2K5P A;  2K3U A;  2L7R A;  4BAX A;  4ZHO A;  4HPL B;  3AE8 B;  4X57 B;  4A55 A;  4DHJ D;  1LQB A;  4MH0 E;  2AEH A;  3P1M A;  4C7Y A;  4F8C B;  2WXM A;  2KQS A;  1OFF A;  2DHZ A;  4BBN F;  3D32 A;  2MP2 A;  4K81 A;  3ZNI D;  3EHV A;  2V1Y A;  3TL5 A;  2BYV E;  3E56 A;  1EUV B;  2D3A A;  4L23 A;  3DBR B;  4KGS A;  1HXY D;  1E7V A;  5DPR A;  3B2G A;  4ARI A;  4XWT A;  2L0F A;  3VHT C;  1N61 A;  3WAM A;  2G3Q B;  2G4S A;  4WWN A;  2LEK A;  2DYM A;  3T9L A;  2SEB D;  4P6V F;  2XN9 C;  4US9 A;  2D3C A;  1FNV A;  2JWU A;  1QKZ A;  5DPS A;  1TZ1 A;  1IBX B;  2UWQ A;  1YJI A;  1YQ3 B;  3BK1 A;  3SD5 A;  4XDD A;  4HDQ A;  2QCZ A;  2YLM A;  1PGA A;  2LVQ A;  2BYE A;  3E9S A;  4C7Z A;  4UDU C;  4II3 B;  4B0E A;  3MFG A;  1LO5 D;  3QCA A;  2GI9 A;  1DGJ A;  2ZPN A;  2KC1 A;  1ESF A;  4YSY B;  3GE3 C;  2PIA A;  3GB1 A;  4USA A;  3AE2 B;  4MJS B;  2JYE A;  4BZA A;  2WU2 B;  2KMM A;  3V60 A;  1FIQ A;  2RR9 A;  1UNS A;  1SF0 A;  3Q3J A;  1EU4 A;  3RT3 B;  2N9X A;  4R3D A;  4HJG E;  3RNC C;  2ZVN A;  4FUL A;  1OEY J;  4MEM A;  3Q14 C;  4RFB A;  1JWS D;  3PRE A;  4IG7 B;  3CSF A;  3ALB A;  2JYT A;  2QIE B;  4XDC A;  2WP9 B;  4DXA B;  3BVM A;  2YEP F;  5LXH A;  4OZC A;  2BS4 B;  2MX2 A;  1QOA A;  4LCD E;  3PVL A;  5IAA C;  1SE9 A;  3ZGZ A;  4MAC A;  1K51 A;  4B95 A;  2I1J A;  2W82 A;  2L3Z A;  4IM0 A;  4DBG A;  4AQ7 A;  1QF6 A;  2KWC A;  2O6V D;  2IGG A;  4BOZ B;  3IAS 1;  4F7Z A;  1C9F A;  1EF1 A;  1F1H A;  4URK A;  4BKT A;  3NOB A;  1A70 A;  4O1N A;  1SJH D;  2H89 B;  4PK1 A;  4HLE A;  4ZRK A;  2AQ1 B;  3L4P A;  2BGF A;  5AEK B;  3GP7 A;  2CU1 A;  1T3Q A;  3WAN A;  2V3P A;  1XLP A;  2DAJ A;  3ZTD A;  3TEY A;  1NYR A;  5CTR C;  1WSP A;  2WXN A;  2ZW1 A;  3BIN A;  3Q2A C;  1VLB A;  1SE4 A;  4OZA A;  2KC2 A;  3HVD A;  3RNF C;  1C3T A;  4KGR A;  4FLH A;  1MG8 A;  2PTL A;  1GC6 A;  2RGF A;  2WDV B;  2DZM A;  4KDL B;  1YNT E;  3KW5 B;  4BKG A;  4KIK A;  3DVG X;  4PYZ A;  5J18 A;  2JY6 A;  1FRR A;  4HEA 1;  2JSV X;  3PTF C;  2LUM A;  5IP4 D;  1N5W A;  2BKF A;  4M00 A;  3HRD D;  2N9K A;  4DHZ E;  3ECI A;  3P4Q B;  3TEZ A;  1RFA A;  4US8 A;  2W9N A;  3A33 B;  2JZZ A;  1VD2 A;  4JQW C;  1V1P A;  3AU5 A;  2AL6 A;  3PHX B;  5BYQ A;  1R4M I;  4AS1 A;  3QX1 A;  4NZL B;  1FD6 A;  2HDE A;  1KLU D;  3DDC B;  4W9I A;  5D3I B;  1VDV A;  1I35 A;  3ZQ4 A;  2DEN B;  2OJR A;  4N9F 4;  1I4G A;  4NAW B;  2FE8 A;  2ACZ B;  2WX0 A;  5EE9 A;  1ZUD 2;  4FAD A;  3TEW A;  1EO6 A;  1I4H A;  4W9E A;  4GSW A;  4MEL A;  3A1Q A;  4N6E B;  1K53 A;  1OQR A;  1QT9 A;  4YXD B;  1FFU A;  4WQM A;  3ZW3 A;  3Q8F A;  1GPX A;  1GJZ A;  3RUL A;  1WR1 A;  4XE0 A;  3KH0 A;  5T8I A;  3HK0 A;  2QSD A;  2R61 A;  1XCT L;  3AI5 A;  3LYY A;  4IM2 A;  2K25 A;  3KYD D;  2KTR B;  2L83 A;  4EFO A;  1ZXH A;  4FHJ A;  1UGJ A;  1LFD A;  1WM3 A;  4F1S A;  2XNA C;  3AE9 B;  2KT7 A;  2WXP A;  3I63 C;  2R2Q A;  2I1K A;  3DBL B;  1RFK A;  1TY0 A;  2KVZ A;  4GB9 A;  3QWZ B;  3MHZ A;  5FKA C;  4RCO A;  4EOY A;  5G55 A;  1TZO A;  3ZIM A;  1TYG B;  4GIV A;  2XBB C;  5BYS A;  1FCC C;  3N30 A;  4JPS A;  2I2Y A;  3DBR I;  3U4E G;  3Q3M C;  2ZCB A;  2ZVO A;  1BUI C;  5E6O A;  3NVV A;  1C78 A;  2MP2 B;  2FNJ B;  4WJQ A;  4CYE A;  2IO1 B;  2KDE B;  5JHB A;  2PE6 B;  4ACF A;  2KWU B;  2KAJ A;  1STE A;  2E6X A;  4K3C A;  5I4D A;  1D5Z C;  2M0X A;  2BTE A;  1YN3 A;  1I42 A;  2BW2 A;  1TS5 A;  1RLF A;  2JZP A;  2UU7 A;  2KX3 A;  3Q8A A;  4NQL B;  2INC C;  1C79 A;  4RGT A;  2D11 A;  3NZS A;  5HI1 A;  1T0Y A;  2HTH A;  5G2N A;  3AMZ A;  1B9R A;  2BQQ A;  2LD9 A;  4ZHP A;  2KXJ A;  5IA7 A;  2DYO A;  1FXT B;  1KLV A;  5G5G A;  1WGH A;  2PE9 A;  2V4L A;  1TS4 A;  1T0Q C;  3EGR A;  4AJY B;  2JU6 X;  3W5V B;  1J7A A;  1NEN B;  4EZL A;  3JVZ X;  1EF5 A;  2JWZ A;  2KN4 A;  1GB1 A;  1Q10 A;  1XLO A;  3NS1 A;  3UI3 A;  3V61 A;  5BMH A;  1FRD A;  2DBY A;  4BBN C;  1QOG A;  2RPQ A;  1EU3 A;  3P42 A;  4K7U A;  3QA8 A;  1D5M C;  3Q8C A;  2ZW0 A;  1J7B A;  4TSS A;  3VUX A;  1WGK A;  4KV2 A;  4NAM A;  2RD0 A;  4ITK A;  1ZDV A;  1XD3 B;  2LWP A;  2FCM A;  4P1C C;  4C80 A;  1I4P A;  4XWW A;  1K50 A;  3N1Y C;  2RDB C;  3ZYY X;  5CX3 A;  3AU4 A;  1V6E A;  3OJ4 B;  4KZ0 A;  2JVC A;  4IUM B;  2HJ8 A;  1AN8 A;  1F52 A;  2FID A;  2IPK D;  3L16 A;  3NRZ A;  4RGO S;  4YSX B;  2Y5C A;  3KUZ A;  1TBE A;  4AWJ A;  2C7N B;  4FJV B;  3W1Y A;  4P7I A;  5AZG A;  4A3P A;  4IWO A;  2Z59 B;  1N63 A;  5D7G A;  2NBU A;  1VJK A;  4TMA B;  5BO4 B;  1TS2 A;  4ANW A;  3RMK C;  3A9K A;  5C3J B;  1R4N I;  1JW9 D;  3LXF A;  1UWX A;  1J0G A;  2GBJ A;  1FPY A;  1D3Z A;  1T6B X;  2QMT A;  4B6W A;  1NI2 A;  4YWG G;  3BZD B;  1AW7 A;  3GZN B;  1YQB A;  1SIF A;  1TKG A;  1SSN A;  2Z0E B;  2FIF A;  1FFV A;  3VRA B;  1E8X A;  1C4C A;  2VH1 A;  3NS8 A;  4EE2 A;  4KIK B;  1Q1O A;  3J9C A;  2KKC A;  1WGY A;  2J42 A;  3V6C B;  4BVU C;  4ARC A;  4HJK A;  2DYB A;  1LGR A;  2MEK A;  4HPP A;  4KGT A;  4IOI E;  4B0M A;  5IKC M;  2Y3A A;  2BPS A;  2INN E;  3N32 A;  1J8C A;  2WXL A;  1ROE A;  3CIR B;  5C1Z A;  4FJZ A;  1V1P B;  3AXC A;  3TMP B;  4ZYS A;  2PPH A;  3R2T A;  2GOW A;  2KQ4 X;  1NI3 A;  4XYC A;  1V97 A;  1YD8 U;  1PDX A;  3U7Z A;  3FIL A;  1JWA D;  3VXW A;  1GC7 A;  3RFZ B;  2KVR A;  4REZ A;  1S1Q B;  1UBI A;  2GRI A;  1ZW7 A;  1V9J A;  2K8B A;  3ML9 A;  3AE5 B;  2D10 A;  1GUA B;  2WXK A;  1L6V A;  3A1Q B;  5FR6 A;  2CKH B;  2KMC A;  4WJP A;  4BKS D;  3I57 A;  3MC9 A;  3SHQ A;  3DBL I;  2IO3 B;  1JWU D;  4PS3 A;  4WWM A;  3JSV A;  3FKY A;  2D3G A;  2LXC A;  3H1U A;  2HJ1 A;  3OLM D;  2A4Z A;  1XLN A;  2RPV A;  4RH6 A;  1PQS A;  2LAS A;  4WAF A;  1YN5 A;  1VZ7 A;  1BT0 A;  2O2V A;  1FNW A;  1KFY B;  2M1M A;  3APD A;  3ZDT A;  1XCQ L;  3AM9 A;  2KDF B;  2J0K A;  1JWB D;  3MC8 A;  3QAR A;  3PT2 B;  2MLB A;  3B1L X;  5D2M B;  4DDG D;  2WDT B;  4LTU A;  4ANV A;  5D94 A;  1E7P B;  4IM3 A;  2IY1 B;  4G11 A;  3N1X C;  4DDI D;  4HRS A;  3VDZ A;  1S3S G;  1NDD A;  2K6Q A;  1WI0 A;  4EKU A;  3MC0 B;  3U30 A;  2VH2 A;  4HXD A;  2X8X X;  1WZ0 A;  3M95 A;  3M62 B;  3VTU A;  5GMV A;  3V6E B;  1HZ5 A;  2G45 B;  5KHQ A;  2KJH B;  2IO0 B;  3M63 B;  2DZI A;  1WGG A;  2HTM E;  3WAO A;  5D3D A;  3AED B;  3QQ8 B;  2JUO A;  2MBE A;  3AB5 A;  3ZJU A;  1EWY C;  5HHD G;  1ENF A;  2C5L C;  1WRI A;  3DPD A;  4TQ0 A;  1Z5S B;  4IKG A;  1HQR D;  3A9J A;  4DHJ B;  2WS3 B;  1RWS A;  1ZE3 D;  3NVW A;  1SJE D;  2QEJ C;  1WYW B;  4DQO C;  2WLB A;  4XX5 A;  5D6J B;  2NBV B;  4ZRQ A;  5AZF A;  1CZP A;  4S0R A;  5AZH A;  3N20 C;  1SGH A;  4EEW A;  1YX6 B;  3RPF C;  3BYY B;  3IVF A;  4E71 A;  2MA9 B;  2V0G A;  4TUU A;  4RM9 A;  2BWF A;  3AEA B;  1WIA A;  3ZDM C;  1NBF C;  1ZXI A;  1YJ1 A;  2LMC A;  2NPT A;  5CHV C;  4M02 A;  3PGE A;  1B1Z A;  4GDL B;  2PKO A;  2UYZ B;  2D2Q A;  2Y5P A;  3DCG A;  3RNG C;  3AE1 B;  2NCN A;  4A9A A;  1YMH E;  3V62 A;  4GN1 A;  2CJO A;  3LJ3 A;  1RRB A;  1GG3 A;  3P4R B;  4N59 A;  2EKI A;  4ZRJ A;  2W3R A;  3GZN I;  3WAL A;  1WJU A;  1EM7 A;  4NJ6 A;  2E3T A;  4J6I A;  4NQK E;  1Y56 A;  3A4R A;  3KYC D;  1HA5 A;  2ZPY A;  3N9Y C;  1UWM A;  1C4A A;  1ISN A;  4RMA A;  1LM8 B;  3IFW B;  1R4N B;  1SBB B;  3FC4 A;  3KVF B;  1AAR A;  3UQB A;  2CHW A;  2WDQ B;  1E0Z A;  1R7S A;  3RYT A;  2GBM A;  2RMM A;  5TR5 A;  2WXR A;  4DHZ B;  3DBH B;  1LXD A;  1GAQ B;  1VCB A;  2V3N A;  3AV8 A;  3BVG A;  3OAW A;  3O65 B;  2OJW A;  2A5U A;  2C7M B;  2FCS A;  2FCN A;  1RYJ A;  4W9J A;  1DYQ A;  4LNI A;  3QHT A;  3R66 C;  1IUE A;  2EEL A;  3ZVV A;  1D6E C;  3EFC A;  4WQO B;  4NPN A;  1VZ8 A;  2GLS A;  1WRD B;  1K52 A;  4LNO A;  1HZ6 A;  3RUI B;  1ZPS A;  3VRB B;  1N60 A;  5MPO A;  3VAW A;  4ICV A;  4JLC A;  5DPW A;  1HE8 A;  1WH3 A;  2LGY A;  2N9P C;  3PHW B;  3RN9 C;  3ZRC A;  1PUT A;  3DOW A;  2K1F A;  3FIL B;  1JML A;  5JHA A;  4MM3 A;  2MQJ A;  2WWZ A;  4OHJ A;  1ET6 A;  2GBK A;  1MVK A;  1QQR A;  1WYG A;  2VRR B;  1UGM A;  1E90 A;  2DWQ A;  1I4Q A;  4LNF A;  1JWM D;  4OVU A;  2PVG C;  4MGK E;  1WGR A;  2M4N A;  3ABV B;  5JZE B;  3Q3O C;  3DHI C;  1F2R C;  2GBR A;  2K9X A;  1E8Y A;  3L10 B;  1BML C;  3TIX A;  1E5W A;  2H88 B;  3JSV B;  2NTT A;  3UIP B;  1I7H A;  3T3O A;  4GLS C;  5EE1 A;  4JWU C;  2FUG 1;  1H4R A;  1C4P A;  1WWT A;  1CK1 A;  3KLS X;  2BVC A;  1KJT A;  3RNA C;  3PRZ A;  2KK8 A;  2OOB B;  1WR6 E;  1V8C A;  2O2V B;  2PLP A;  1V49 A;  3N3K B;  2MJD A;  1IGD A;  3HM3 A;  4J3O D;  1K8R B;  3SDL C;  4LNK A;  5H8Y E;  3VH4 B;  2LXA A;  1TS3 A;  2QHO A;  1WM2 A;  2FBW B;  4OZB A;  2PMV A;  5CHF A;  2ZNV C;  4JIO U;  4G50 A;  4MDK E;  1VZ6 A;  3SFE B;  1L4Z B;  2IY0 B;  3PSE B;  5EDS A;  5C2T B;  4GGQ A;  1WXQ A;  1WXM A;  3L0W B;  4GDK A;  3AUL A;  2KYW A;  1MI0 A;  1G6J A;  1Y8R C;  4FXC A;  1P0R A;  4YTN B;  2LFI A;  2BKR B;  4BKS A;  1TJE A;  3R7Q A;  2FUH B;  2LGD A;  3EEC A;  3ONS A;  2KFK A;  4HVB A;  1V5T A;  4C00 A;  2KJR A;  1SE3 A;  2PVO D;  3UIN B;  1DOI A;  2N4F A;  1WX8 A;  1FO4 A;  4LNN A;  4LLG M;  2NVU I;  1V5O A;  2KQ7 A;  2IYD B;  3ML8 A;  3IT6 B;  1L5P A;  3WAP A;  3SEB A;  1DOX A;  3P63 A;  2J53 A;  2LJI A;  2B3A A;  2IGH A;  4YT0 B;  3Q6B A;  1IBX A;  2MBB B;  1SIJ A;  4FBJ B;  4TKN A;  5E6J A;  1TKY A;  1WE6 A;  1IGC A;  3BK2 A;  4JE3 B;  3UQA A;  1RAX A;  2LRU A;  3A9J B;  4MJS A;  3KUD B;  2J4X A;  3CMM B;  2BF8 B;  2JF5 A;  2KLG A;  3PLV A;  1QOB A;  1SE2 A;  2ZNV B;  1A5R A;  1WJ4 A;  2MJE A;  4L2Y A;  3AEB B;  2XK5 A;  3ZJT A;  3ZUN A;  4XZ4 A;  4WWO A;  1UUP A;  4CQN A;  3U7D A;  2J7Q B;  4ANU A;  1WF9 A;  1MG4 A;  3PRP B;  5EE3 A;  4LDT B;  4MSQ B;  2PJH A;  5JH5 C;  1WX9 A;  3A4S C;  4KVG B;  3M3J A;  4ZRP A;  2MBO A;  2YVC A;  2NPT B;  5C23 A;  1FXA A;  4ICU A;  1TIF A;  4KSK C;  2OED A;  1P7F A;  3PV1 A;  2R2O A;  5FK9 C;  2G9H D;  2BS3 B;  1H8C A;  4S17 A;  3NZU A;  3UIO B;  3QAQ A;  1OTR B;  4MGI E;  4M0W A;  3ZRF A;  1DOY A;  3DQV A;  1QOF A;  3ZO5 B;  1L7Y A;  3QK0 A;  1V1O A;  3AEC B;  1GOZ A;  2B76 B;  4JWS C;  1GB4 A;  1KOT A;  2KLC A;  1HEZ E;  3IHP C;  3S2A A;  4DWF A;  2N9E B;  3DBH I;  2DLB A;  3VUY A;  4WH4 A;  3PS6 A;  4JGH B;  1ZOY B;  4Q2J A;  2J0J A;  4C4V A;  3DVG Y;  1ZDX A;  2CJN A;  4MGY E;  3TBL D;  4KZC A;  5J17 A;  3TJP A;  1N62 A;  2JT4 B;  2L76 A;  3IXS A;  4ASW C;  3AN1 A;  1WXS A;  5AUI A;  2IZV B;  1UF0 A;  2M8S A;  2VZK B;  3AEG B;  2J52 A;  3C8Y A;  2O6V A;  4WIP A;  2CHZ A;  2KHW B;  4MT5 A;  2AWT A;  5FR3 A;  2BS2 B;  2MBH A;  2WXI A;  3ZXR A;  3R2I A;  1HTQ A;  2D07 B;  2LZ6 A;  1SEB D;  2KNB A;  3MJ5 A;  3NJT A;  4FN2 A;  2K0P A;  5G5H A;  4YL8 A;  1KTK A;  2MHJ A;  2LGS A;  3X23 A;  1P1A A;  3IBE A;  1JRU A;  1L0Y B;  1OQQ A;  4H2A A;  3MP9 A;  5BYR A;  2HD5 B;  3VTV A;  2L05 A;  4FA6 A;  3B0A A;  4P1B C;  4RGN A;  3AE7 B;  4K3B A;  1RM6 C;  4RF1 A;  5LNK 1;  2N7E A;  3ZNZ B;  4MM3 B;  4YTP B;  5L83 A;  2DNF A;  4MGZ E;  1F0Z A;  2WXJ A;  2CHX A;  4RNA A;  2K8H A;  4A3O A;  2LGI A;  4B9K A;  2QIL A;  2YEP B;  4KKJ A;  2BT6 A;  1WXA A;  2BYF A;  2CU3 A;  3I9V 1;  2KAC A;  3L54 A;  1IP9 A;  2KN5 A;  4WJN A;  3BII D;  5LXI B;  1QZE A;  1YOV B;  1P3Q U;  2L1A A;  4FJY A;  4K7W A;  1Q0W B;  2KO3 A;  2DZJ A;  3HM6 X;  4ZRI A;  3DHG C;  1XT9 B;  2REX A;  1BXT A;  3PLU A;  3APF A;  2PEA A;  2K8C A;  2IO2 B;  5GXG B;  1N6Z A;  1PGB A;  3W1S A;  4W9F A;  1PFD A;  1WJ6 A;  1XXG A;  4HCP B;  2DZK A;  4GXB A;  4BFR A;  4XGA B;  4WAA A;  1MPE A;  2C60 A;  4E74 A;  1MHH E;  1ET9 A;  4ZDV A;  2D3B A;  3PZ8 A;  3GOE A;  2WGS A;  3VQI A;  3R7R A;  1F2R I;  3PZD A;  3P2B A;  1C1Y B;  1E10 A;  1Z2M A;  2BB6 A;  2GMI C;  4MH8 A;  1V86 A;  3ZLZ A;  3DWM A;  2WX1 A;  4GDK B;  1U4A A;  3R8B A;  2KFJ A;  3KWL A;  3X0W A;  4D2K A;  1NVI D;  2KFK B;  4L1B A;  1IPG A;  1WMH A;  2DX5 B;  3CST A;  4RGM A;  2KMA A;  2LJ5 A;  3VUW A;  2ZZP B;  3H9D A;  3AEE B;  3QIJ A;  3W5U B;  3SU8 X;  1AWD A;  2N9L A;  1L4D B; 
#chains in the Genus database with same CATH homology
 2MBQ A;  1KLV A;  2DAF A;  1WGH A;  2PE9 A;  3RUI B;  2V4L A;  2K39 A;  2FCQ A;  2C7H A;  3VAW A;  4ICV A;  4JLC A;  5DPW A;  1HE8 A;  4I6N B;  1WH3 A;  2KZR A;  4AJY B;  3NHE B;  4TV3 A;  2KDI A;  3L13 A;  3VVW B;  2C9W B;  2GBN A;  4AOF A;  4EZL A;  4NAW A;  3JVZ X;  2LGY A;  1EF5 A;  2JWZ A;  1F9J A;  2N9P C;  3PHW B;  3LDZ E;  3HHM A;  3V61 A;  3ZRC A;  3DOW A;  4MSM B;  2K1F A;  4WWP A;  5JHA A;  2RSU A;  4MM3 A;  2MQJ A;  2WYQ A;  4HK2 A;  4BBN C;  2RPQ A;  2JXX A;  1V2Y A;  2NR2 A;  2WWZ A;  2AYO B;  4K7U A;  2GBK A;  5HKH A;  3DVN V;  3QA8 A;  4PYU A;  2VRR B;  1UH6 A;  2MCN B;  1UGM A;  1E90 A;  2ASQ A;  1YIW A;  1P98 A;  4OVU A;  4MGK E;  2XK5 B;  3ZNG C;  1WJN A;  1CMX B;  1WGR A;  2M4N A;  3VUX A;  5JZE B;  4KV2 A;  2K6D B;  2LRW A;  2RD0 A;  2GBR A;  1UEL A;  3JYU A;  4HWI B;  2KWV B;  1OEY A;  1XD3 B;  2LWP A;  1E8Y A;  2FCM A;  2MSE D;  1TGZ B;  1WGD A;  2JRI B;  3L10 B;  5E6P A;  4EZJ A;  3ZTC A;  4W9G A;  3TIX A;  5CX3 A;  1E8Z A;  3AU4 A;  4IC7 B;  4JL9 A;  1V6E A;  3OJ4 B;  4G3X B;  4KZ0 A;  1E5W A;  2JVC A;  3JSV B;  3NY5 A;  2HJ8 A;  3MHS D;  4IUM B;  3UIP B;  4BOS C;  2KTR A;  4GMV A;  4IW0 A;  3OJ3 A;  3TCA A;  2HE7 A;  1TTN A;  4GOC A;  4PS7 A;  2FID A;  3EC8 A;  3L16 A;  3ZKJ C;  1H4R A;  3KUZ A;  1TBE A;  3R3M A;  4AWJ A;  3KUC B;  2C7N B;  1WX7 A;  1KJT A;  4NY0 A;  1ZKH A;  3PRZ A;  4FJV B;  3W1Y A;  2KK8 A;  4P7I A;  5AZG A;  2OOB B;  4A3P A;  4IWO A;  2Z59 B;  1WR6 E;  5D7G A;  2NBU A;  2L7R A;  2O2V B;  1V49 A;  3N3K B;  5BO4 B;  4FHK A;  4HPL B;  3UGB B;  3A9K B;  1WE7 A;  4M0W B;  2KOX A;  4WJO A;  4TQ1 A;  4X57 B;  3HM3 A;  4ANW A;  3A9K A;  1K8R B;  4DHJ D;  1LQB A;  3SDL C;  4MH0 E;  2AEH A;  1R4N I;  4F8C B;  3VH4 B;  2LXA A;  2QHO A;  2KQS A;  1WM2 A;  1V80 A;  2DHZ A;  4BBN F;  1J0G A;  2GBJ A;  1D3Z A;  3D32 A;  2MP2 A;  4K81 A;  2LUE A;  4B6W A;  1NI2 A;  3ZNI D;  5CHF A;  2ZNV C;  3EHV A;  4JIO U;  2V1Y A;  2AL3 A;  4G50 A;  1YQB A;  1ZGU B;  1SIF A;  2BYV E;  4MDK E;  3TL5 A;  1EUV B;  2IY0 B;  2Z0E B;  1M94 A;  3H7P A;  3PSE B;  4GGQ A;  5EDS A;  1WXM A;  2FIF A;  3L0W B;  4GDK A;  3AUL A;  1G6J A;  1Y8R C;  1P0R A;  3WIM A;  4BKS A;  1E8X A;  2BKR B;  1E7V A;  3R7Q A;  5DPR A;  2FUH B;  2LGD A;  3EEC A;  3ONS A;  1WY8 A;  2KFK A;  4HVB A;  1V5T A;  3NS8 A;  3RZW C;  2L0F A;  2KJR A;  2MRP A;  4KIK B;  3VHT C;  3UIN B;  1Q1O A;  3WAM A;  2EMT A;  2KKC A;  1WGY A;  2G3Q B;  2G4S A;  2N4F A;  1WX8 A;  2O6V B;  4WWN A;  3L17 A;  3V6C B;  2DYM A;  4HDO A;  3T9L A;  4BVU C;  2NVU I;  1V5O A;  4HJK A;  2DYB A;  2KJ6 A;  4G0N B;  2KQ7 A;  1L2N A;  2IYD B;  3ML8 A;  4RM8 A;  5DPS A;  1TZ1 A;  3WAP A;  2BPS A;  3N32 A;  1J8C A;  2UWQ A;  3K9O B;  2B3A A;  2Z0D B;  3SD5 A;  1UD7 A;  4HDQ A;  2N1V A;  5C1Z A;  2IBI B;  4W9D A;  2MBB B;  2YLM A;  2LVQ A;  4FJZ A;  2BYE A;  3W1S C;  2MW5 A;  4FBJ B;  3AXC A;  4II3 B;  4OVV A;  4TKN A;  3TMP B;  4NNJ B;  3QCA A;  1WE6 A;  2PPH A;  4I6P A;  3RZF A;  2ZPN A;  2GOW A;  3Q3F A;  2KC1 A;  3UQA A;  1RAX A;  1WZ3 A;  1YD8 U;  4MJS B;  2CS4 A;  2LRU A;  3A9J B;  3V60 A;  4MJS A;  3VXW A;  1GC7 A;  2RR9 A;  3KUD B;  3Q3J A;  3CMM B;  2BF8 B;  2KVR A;  2N9X A;  3MTN B;  3RT3 B;  1S1Q B;  1WXV A;  2JF5 A;  1E8W A;  1UBI A;  4CO7 A;  2ZVN A;  2KLG A;  1OEY J;  1ZW7 A;  3PLV A;  4FUL A;  4MEM A;  2ZNV B;  1V9J A;  1A5R A;  2K8B A;  1WJ4 A;  3ML9 A;  3PRE A;  3CSF A;  4IG7 B;  2D10 A;  1GUA B;  3ALB A;  2L8J A;  3T8M A;  2V3S A;  5DCN A;  2XK5 A;  1OGW A;  4E3C A;  3A1Q B;  4DXA B;  5FR6 A;  2CKH B;  4XZ4 A;  3ZUN A;  4WWO A;  3U7D A;  2KMC A;  2J7Q B;  4ANU A;  4WJP A;  2KX0 A;  4BKS D;  1WF9 A;  5LXH A;  3PRP B;  4NJ7 A;  4LDT B;  2MX2 A;  4MSQ B;  2PJH A;  4LCD E;  5JH5 C;  1KM7 A;  3PVL A;  4LJO B;  1WX9 A;  2J0M A;  3A4S C;  3SHQ A;  5IAA C;  1SE9 A;  3DBL I;  4KVG B;  2IO3 B;  3M3J A;  3VH3 B;  4PS3 A;  3JSV A;  4KDI C;  4B95 A;  2D3G A;  2MBO A;  2I1J A;  2LXC A;  2YVC A;  2L3Z A;  4W9L A;  2NPT B;  4IM0 A;  5C23 A;  4ICU A;  3DVN U;  3H1U A;  4KSK C;  4DBG A;  2KWC A;  2O6V D;  3WA0 A;  2JZ3 B;  3OLM D;  4BOZ B;  4F7Z A;  4PS8 A;  2A4Z A;  3PV1 A;  1EF1 A;  2R2O A;  4URK A;  4BKT A;  1PQS A;  3NOB A;  2BWE S;  2LAS A;  3JW0 X;  1H8C A;  3NZU A;  3UIO B;  3QAQ A;  1BT0 A;  2O2V A;  1OTR B;  4M8N A;  4MGI E;  4HLE A;  4ZRK A;  3ZRF A;  3DQV A;  3ZO5 B;  1XQQ A;  2BGF A;  1L7Y A;  5AEK B;  2M1M A;  3QK0 A;  3HIZ A;  3IG3 A;  3APD A;  3ZDT A;  2CU1 A;  4W9C A;  3EFU A;  1E7U A;  2KDF B;  2N1W A;  2J0K A;  1KOT A;  3QAR A;  2KLC A;  3WAN A;  3PT2 B;  3IHP C;  2LVO A;  2MLB A;  3S2A A;  4DWF A;  2DAJ A;  2N9E B;  3K9P B;  3DBH I;  3ZTD A;  3B1L X;  5D2M B;  3VUY A;  5CTR C;  3PS6 A;  4DDG D;  2WDT B;  4XC2 A;  4JGH B;  5D94 A;  4IM3 A;  4ANV A;  4I6L B;  3BIN A;  2IY1 B;  5LLI A;  4G11 A;  2J0J A;  3QJZ A;  2KC2 A;  3DVG Y;  4K1R B;  2L00 B;  4DDI D;  3B08 A;  1C3T A;  4MGY E;  4FLH A;  4KZC A;  3TBL D;  3VDZ A;  1MG8 A;  2LGX A;  5J17 A;  4IWP A;  3TJP A;  1S3S G;  1NDD A;  2KDB A;  2K6Q A;  3U8Z A;  2JT4 B;  2L76 A;  4ASW C;  1WI0 A;  3H6N A;  4M8M A;  4EKU A;  3MJW A;  2LVP A;  1GC6 A;  2RGF A;  2DZM A;  4KDL B;  1WXS A;  3KW5 B;  4BKG A;  4KIK A;  2IZV B;  3DVG X;  4HXD A;  4PYZ A;  2JY6 A;  2M8S A;  3U30 A;  4EZK A;  5J18 A;  1P9D U;  3PRM B;  4LDT D;  1WZ0 A;  3M95 A;  2O6V A;  2ZEQ A;  5L95 C;  3M62 B;  3VTU A;  2CHZ A;  2KHW B;  2EKE C;  1WMH B;  5GMV A;  3PTF C;  3V6E B;  2AWT A;  2G45 B;  5KHQ A;  2KJH B;  2BKF A;  2G4D B;  2MBH A;  3L08 A;  1J19 A;  2IO0 B;  3M63 B;  4AJW A;  2D07 B;  2LZ6 A;  2FAZ A;  3APC A;  4DHZ E;  2DZI A;  2KNB A;  2KAN A;  1WGG A;  3ECI A;  1RFA A;  4FN2 A;  1V81 A;  4YL8 A;  3WAO A;  3QQ8 B;  3QC8 B;  4DK5 A;  2W9N A;  1GNU A;  2JUO A;  2MBE A;  3A33 B;  3X23 A;  2JZZ A;  1VD2 A;  4JQW C;  1P1A A;  3AU5 A;  2AL6 A;  2Y5B B;  3IBE A;  3PHX B;  1R4M I;  1JRU A;  2C5L C;  3QX1 A;  2HD5 B;  3VTV A;  3DPD A;  3CF6 E;  4TQ0 A;  3DDC B;  4W9I A;  5CHW A;  2L05 A;  1Z5S B;  4FA6 A;  4A20 A;  2XEW A;  1I35 A;  3A9J A;  2DEN B;  3B0A A;  2OJR A;  4N9F 4;  4DHJ B;  4KSL C;  2EMS A;  4NAW B;  3ENE A;  1WYW B;  2WX0 A;  4XX5 A;  5D6J B;  2NBV B;  4AP4 C;  2N7E A;  5AZF A;  3ZNZ B;  4FAD A;  1EO6 A;  4W9E A;  5AZH A;  2JPH A;  5L83 A;  4GSW A;  1Q5W B;  4MEL A;  4MGZ E;  3A1Q A;  1SGH A;  4EEW A;  1YX6 B;  2CHX A;  3RCZ A;  2K8H A;  3IVF A;  4GU2 A;  4K7S A;  4A3O A;  2L0T A;  4E71 A;  2KD0 A;  4B9K A;  2MA9 B;  3L54 A;  1WXA A;  2BYF A;  4RM9 A;  4TUU A;  1IP9 A;  2BWF A;  2KN5 A;  4WJN A;  3ZW3 A;  1WIA A;  5LXI B;  1GJZ A;  3RUL A;  1QZE A;  1WR1 A;  1WFY A;  3ZDM C;  1NBF C;  3ZNH B;  4W9H A;  3C0R B;  1P3Q U;  1YJ1 A;  4HCN B;  3KH0 A;  4FJY A;  2NPT A;  1UZX B;  4K7W A;  5CHV C;  5KHO A;  1Q0W B;  2KO3 A;  4ZYN A;  2DZJ A;  3HM6 X;  4ZRI A;  3HK0 A;  2KTF A;  1XT9 B;  3PGE A;  3AI5 A;  3RD2 A;  4IM2 A;  2K25 A;  3KYD D;  4GDL B;  2KTR B;  2UYZ B;  3H7S A;  2NBW B;  4EFO A;  2REX A;  5E6N A;  4FHJ A;  1LFD A;  1WM3 A;  4GDL A;  2D2Q A;  3BY4 B;  3DCG A;  3PLU A;  4F1S A;  1IYF A;  2NCN A;  3APF A;  2PEA A;  2K8C A;  2R2Q A;  2I1K A;  2IO2 B;  5J2R A;  5DPT A;  3V62 A;  4GB9 A;  4GN1 A;  3W1S A;  3LJ3 A;  4W9F A;  4W9K A;  1RRB A;  3QWZ B;  1GG3 A;  1WJ6 A;  4EUT A;  4EOY A;  4ZRJ A;  4HCP B;  5G55 A;  2DZK A;  1UBQ A;  3GZN I;  4GXB A;  4BFR A;  3ZIM A;  2LI5 A;  4GIV A;  4WAA A;  2XBB C;  2NS5 A;  3VTW A;  3WAL A;  4IWQ A;  2C60 A;  1WJU A;  4E74 A;  4NJ6 A;  4J6I A;  4NQK E;  3DBS A;  2ZCC A;  3N30 A;  3A4R A;  3DBR I;  4ZDV A;  3KYC D;  2ZPY A;  2ZCB A;  1ISN A;  3GOE A;  2ZVO A;  4RMA A;  5E6O A;  3VQI A;  3R7R A;  3PZD A;  3P2B A;  4HPM B;  3I3T B;  4ANX A;  1C1Y B;  2MP2 B;  1LM8 B;  1Z2M A;  3IFW B;  2FNJ B;  2GMI C;  4II2 B;  4WJQ A;  3KVF B;  2IO1 B;  2KDE B;  1AAR A;  2N7D A;  4CYE A;  5JHB A;  3PPA A;  3UQB A;  2PE6 B;  2CHW A;  2KWU B;  1V86 A;  3H7P B;  2MWS B;  3ZLZ A;  3RYT A;  2GBM A;  2WX1 A;  5TR5 A;  4GDK B;  1U4A A;  4AUQ C;  2KFJ A;  4DHZ B;  2CR5 A;  1X1M A;  1LXD A;  1VCB A;  3X0W A;  2M17 A;  2M0X A;  3OAW A;  2KFK B;  3O65 B;  1IPG A;  2JRH A;  1WMH A;  4LJP B;  1I42 A;  2DX5 B;  1RLF A;  3CST A;  2A5U A;  2C7M B;  2FCS A;  2FCN A;  3VFK A;  2KMA A;  2LJ5 A;  3VUW A;  2KX3 A;  2ZZP B;  4W9J A;  4CHK A;  4NQL B;  3QHT A;  3R66 C;  1OQY A;  3ZVV A;  3UF8 A;  2ZJD A;  3H9D A;  2D11 A;  3NZS A;  3QIJ A;  1T0Y A;  2HTH A;  4WQO B;  5G2N A;  2LD9 A;  3SU8 X;  1YX5 B;  4NPN A;  2KXJ A;  5IA7 A;  2DYO A;  1FXT B;  1WRD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...