1KLVA

Solution structure and backbone dynamics of gabarap, gabaa receptor associated protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
GEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1H, 13C and '5N resonance assignments of GABARAP, GABAA receptor associated protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords GABA(A) Receptor associated protein
total genus 12
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2001-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1klvA00
3M63B 2L0TA 1WJUA 2N7EA 2C5LC 2MW5A 2MBEA 1KLVA 2K8HA 3VFKA 4CYEA 2AWTA 2LASA 4FA6A 2I1KA 5AZGA 3H7SA 3ZNID 3PLUA 4ICVA 3IFWB 3QX1A 4EZLA 3VHTC 2LD9A 4IC7B 5DPTA 1C1YB 1V2YA 2OOBB 3A9JB 2BWFA 3ZRFA 3EC8A 1P98A 1RAXA 2J7QB 1LXDA 3RCZA 1C3TA 2G45B 4BKGA 1OEYA 2LXAA 3QHTA 4W9KA 4DHJD 2NS5A 4K7WA 4ZRJA 4BKSA 4HWIB 3QCAA 4KSKC 3HK0A 3WALA 2DHZA 3A9KB 5BO4B 3VH4B 3ZDTA 3CSTA 4ZYNA 3LJ3A 4G0NB 1J8CA 1UBIA 4JIOU 5DPWA 2KXJA 1MG8A 2ZCCA 2MX2A 3QC8B 2MP2A 3U7DA 1E5WA 4K7UA 1QZEA 2N9PC 1V80A 4W9DA 5D94A 1L2NA 2NPTB 2IO2B 4FJZA 5J17A 2WYQA 3KUCB 1WY8A 3DBLI 3CSFA 2N7DA 2C7MB 1EF1A 2BYEA 3ZUNA 5AEKB 2KQSA 5D2MB 5C23A 4FJYA 4G3XB 4WJQA 3EHVA 2KFJA 3PGEA 4E74A 1WX9A 4LCDE 2MQJA 2M1MA 3ZNHB 2V3SA 3GOEA 2HE7A 2HTHA 4TKNA 2YLMA 2ZNVC 3APDA 3R66C 1IYFA 1V5TA 3DVNU 2O2VB 3KYCD 2Y5BB 3VUWA 4EEWA 2DYMA 4W9GA 1WR1A 4PS8A 2CHXA 1WGYA 2L76A 1WM2A 2ZEQA 2DZIA 4DK5A 4GU2A 5J2RA 1GNUA 1WI0A 1WGGA 4WWNA 1R4MI 2NBWB 2WX0A 3QA8A 2V4LA 2NBVB 2M4NA 3A1QA 2LI5A 3RUIB 5DPRA 2JWZA 3NZSA 3ZO5B 3PZDA 2KWCA 4MSQB 4CO7A 1P9DU 1S1QB 2NVUI 3QK0A 4KSLC 5AZFA 2V1YA 1LQBA 1E7VA 3ALBA 3NOBA 2A4ZA 2JUOA 1G6JA 3N32A 2MBBB 4ZRIA 3DBRI 3MJWA 2KJRA 2Z0DB 1XQQA 3KUZA 4GSWA 4PYZA 1ZGUB 3PSEB 4I6PA 3H6NA 2JY6A 1J19A 1UZXB 3DVGX 3UF8A 2KHWB 3APCA 4ANUA 2IYDB 3PRMB 2FIFA 4IWOA 2GMIC 4W9IA 2LVOA 1WF9A 1E90A 2C7NB 2Z59B 4WJOA 3WAOA 3QQ8B 2KJ6A 2L00B 3V6EB 1GJZA 5KHQA 2MBOA 2MLBA 5KHOA 4AJYB 2MBQA 4KVGB 5D7GA 1VCBA 2WWZA 3PHWB 5CHVC 1K8RB 2JF5A 2CKHB 3JSVA 4GDLA 2JZZA 1F9JA 1WGRA 2D2QA 2BGFA 2N9EB 2N9XA 1D3ZA 3ZKJC 5CHFA 4B95A 4WJNA 3VTUA 3EECA 3A9KA 3AXCA 4FHJA 2IBIB 2NR2A 3SDLC 4ANVA 3ZW3A 4DXAB 2HD5B 2N1WA 1WE7A 1R4NI 4F8CB 2LRWA 1I35A 4LDTD 1WE6A 2FCMA 4FULA 3M95A 1WIAA 3ONSA 3MTNB 2XEWA 3PS6A 3A9JA 4HK2A 5J18A 1I42A 5HKHA 1XT9B 3X0WA 3VUXA 2K6DB 1OTRB 4N9F4 3OLMD 2VRRB 4FN2A 1YIWA 3N3KB 4CHKA 2KLCA 3H7PA 3QIJA 1HE8A 2G4DB 2K6QA 3NZUA 1WM3A 3TL5A 4HDQA 3GZNI 4NJ7A 3Q3FA 2FCNA 2KJHB 4ICUA 4HVBA 2WX1A 2XBBC 4URKA 3TBLD 1P1AA 2PJHA 1WZ0A 2KTFA 3QWZB 1KM7A 2KDFB 3VTVA 2O2VA 4HDOA 1V5OA 2RSUA 4MSMB 3JW0X 3PRZA 2KMAA 1T0YA 4WWPA 4DDID 1WX7A 5DPSA 3PV1A 4AP4C 3IBEA 4K81A 4W9LA 2KX0A 4HPLB 1EO6A 4EOYA 2D10A 4G11A 4FHKA 2GOWA 1WJ4A 4FBJB 3QJZA 4RMAA 3V62A 2DX5B 5JHAA 3O65B 5G2NA 3X23A 4A3OA 2M0XA 4IM2A 2KKCA 4AOFA 2PPHA 2CU1A 2PEAA 1GC6A 3DVGY 2CR5A 2LZ6A 3PLVA 3WAMA 4G50A 5LXHA 2JRHA 2DAJA 3APFA 3DBSA 2KWVB 4EZKA 2L3ZA 4WAAA 2IO1B 5JHBA 3UQBA 3VXWA 1YJ1A 4MGIE 2L0FA 3L0WB 1WXAA 3KVFB 2HJ8A 3U8ZA 4XC2A 1UGMA 5L95C 3L13A 4ANXA 3DCGA 5G55A 3ZVVA 2KVRA 2AL3A 1ISNA 1WRDB 4GN1A 2BKRB 2L8JA 3JVZX 5E6NA 2ZPNA 4RM9A 3ZLZA 2CS4A 2LJ5A 2LVQA 2XK5A 3DDCB 4FLHA 1UELA 3IVFA 3OAWA 2CHWA 3L10B 1V86A 4B6WA 3V6CB 4BVUC 3ML9A 4DHJB 3A4SC 3R3MA 1WH3A 1PQSA 4M8MA 3H7PB 3ZIMA 3UIOB 4NPNA 2ZNVB 3DBHI 2L05A 3PTFC 1JRUA 2DENB 4PS3A 2BYFA 2LGXA 3DOWA 3VAWA 3T8MA 1WMHB 4IWQA 5JH5C 2JZ3B 3IHPC 3RZFA 4FJVB 1WZ3A 2KC2A 1U4AA 3TCAA 4BKSD 5CX3A 4MGYE 2FCQA 3HIZA 3TIXA 4KZ0A 3C0RB 4E3CA 4ZRKA 5GMVA 1RLFA 3ZNZB 2OJRA 2KMCA 4II3B 2REXA 3ECIA 1P3QU 2LXCA 3R7RA 2KO3A 4HPMB 4HCNB 3VTWA 2ZVOA 4MM3A 4DHZB 4OVUA 3B1LX 3VDZA 2L7RA 2BWES 4RM8A 1WGDA 2O6VD 3L16A 2NPTA 4IM0A 2KNBA 1WJ6A 1A5RA 2Z0EB 1UH6A 2XK5B 3ML8A 3W1YA 2KK8A 3OJ4B 1YX6B 2LRUA 3LDZE 1WX8A 4GXBA 2K39A 3SD5A 4GOCA 1E8XA 3SHQA 2C7HA 3L08A 4WWOA 3EFUA 3UGBB 3VQIA 2MCNB 2KZRA 2K25A 2RD0A 1AARA 2JT4B 2KDBA 2JRIB 1J0GA 1V6EA 3WAPA 2MSED 1WJNA 3QARA 4MJSA 4X57B 4EUTA 4GDKA 1TTNA 2ZCBA 3L17A 2BF8B 4GIVA 2PE6B 2MRPA 1LM8B 2LVPA 2IY0B 3RD2A 4MELA 4LJPB 3UIPB 3PREA 4WQOB 1OGWA 1VD2A 1TGZB 2WDTB 2RGFA 2IY1B 1WYWB 2D07B 4F1SA 3VH3B 4KV2A 3AULA 2ZZPB 2RR9A 3UINB 1OQYA 1TBEA 1ZKHA 4MEMA 4GB9A 1Q1OA 3M62B 1Z5SB 1SGHA 3H1UA 2MBHA 2B3AA 3A33B 3WANA 4AWJA 4A20A 4NAWA 4TQ1A 2MP2B 4GMVA 3CMMB 2I1JA 2D11A 2BKFA 1XD3B 4JQWC 2EMSA 5CHWA 5E6PA 4IG7B 2IZVB 4ZDVA 1UD7A 2ZPYA 4LJOB 4NNJB 3V60A 4I6NB 1SIFA 4ASWC 1UBQA 4K7SA 4MJSB 2FIDA 3PHXB 2LGDA 4W9JA 4HLEA 4KDIC 2AL6A 5E6OA 1H8CA 2R2QA 5TR5A 4GGQA 2KC1A 4XX5A 4DHZE 1L7YA 3N30A 4NJ6A 1Z2MA 2J0KA 2LUEA 4W9EA 4NQKE 3ZRCA 2UWQA 4IUMB 3TJPA 3ZDMC 3OJ3A 4P7IA 2KQ7A 3RULA 3CF6E 1KOTA 3ZNGC 2W9NA 4AJWA 5C1ZA 3AU5A 1V9JA 4PS7A 3RZWC 4MDKE 2ZVNA 1Q0WB 2KANA 2FNJB 2J0MA 2M8SA 1V81A 3JYUA 4TUUA 4DDGD 2NCNA 3AI5A 1RRBA 2AEHA 4NAWB 2JXXA 2R2OA 3V61A 3ZTCA 3ZTDA 4B9KA 1LFDA 1CMXB 5EDSA 2K1FA 1IP9A 4DBGA 4IM3A 3Q3JA 2KX3A 2IO3B 5DCNA 5JZEB 2NBUA 4OVVA 3B08A 4IW0A 1M94A 3AU4A 2N4FA 2PE9A 3RYTA 4EZJA 5L83A 4NY0A 2EKEC 2FAZA 3B0AA 1E7UA 4GDLB 2J0JA 4J6IA 4MGZE 2G3QB 3NS8A 2GBJA 1WXSA 4BOZB 3HM3A 2BYVE 1EF5A 1WXMA 4FADA 4A3PA 2CHZA 2IO0B 1ZW7A 1NI2A 2RPQA 3BINA 1NBFC 4PYUA 4EFOA 2EMTA 3K9PB 2DAFA 2GBKA 2C60A 2QHOA 3PVLA 3W1SA 1IPGA 4HCPB 3I3TB 1NDDA 3NHEB 4YL8A 3KYDD 4GDKB 4HXDA 4TV3A 4WJPA 2DYOA 3MHSD 4BBNF 4HJKA 4DWFA 3VVWB 4BKTA 1RFAA 1E8ZA 1TZ1A 2MWSB 3P2BA 4IWPA 2KFKA 3JSVB 1WMHA 3IG3A 5CTRC 2K8BA 1H4RA 2KTRA 4F7ZA 5LXIB 4KIKB 1GC7A 1KJTA 1S3SG 1WGHA 3NY5A 4JLCA 5IAAC 3U30A 1WR6E 4BFRA 2AYOB 3HHMA 2DZJA 3PT2B 4MH0E 3RT3B 2BPSA 2KFKB 2JPHA 4W9FA 1SE9A 2KLGA 1E8YA 2KTRB 3DVNV 2GBMA 4KIKA 3WA0A 2KDEB 3K9OB 1Y8RC 5FR6A 1GUAB 4I6LB 4BOSC 2K8CA 1E8WA 4TQ0A 2GBRA 3W1SC 1YQBA 2YVCA 1FXTB 1YD8U 1X1MA 2A5UA 4W9HA 3KW5B 4E71A 2FUHB 4W9CA 4JL9A 2KN5A 5IA7A 3A4RA 2D3GA 3ENEA 1WFYA 3QAQA 4KZCA 5AZHA 2ZJDA 3WIMA 3UQAA 3L54A 2M17A 1WXVA 3TMPB 4AUQC 4EKUA 4M0WB 4MGKE 2N1VA 3H9DA 1BT0A 3VUYA 3PRPB 4II2B 2DZKA 2LWPA 2KDIA 3KH0A 3DPDA 1OEYJ 2C9WB 4JGHB 3R7QA 3S2AA 2KWUB 1GG3A 2ASQA 4LDTB 3DQVA 5D6JB 3A1QB 3BY4B 3KUDB 5LLIA 2MA9B 4M8NA 4K1RB 1EUVB 4KDLB 2KOXA 2O6VB 2G4SA 3SU8X 2FCSA 4XZ4A 3M3JA 3PPAA 4BBNC 1Q5WB 2LGYA 2KD0A 1V49A 2DZMA 2DYBA 1P0RA 3HM6X 4ANWA 2GBNA 2JVCA 4NQLB 2UYZB 1YX5B 2O6VA 3D32A 3T9LA
chains in the Genus database with same CATH superfamily
2L0TA 1TS2A 1KLVA 3BYYB 3GB1A 1HEZE 3P4SB 1C4CA 4ICVA 4REZA 3AV8A 3VHTC 4EZLA 5DPTA 1A70A 1VDVA 3ZRFA 1P98A 1RAXA 4P6VF 1QQRA 2Q5WD 3WALA 1HTOA 3HK0A 4LTUA 4K7UA 1QZEA 2N9PC 1V80A 1WSPA 4HEA1 2SEBD 4FJZA 4WAFA 4YXDB 3KUCB 2C7MB 1EF1A 3ZUNA 2KQSA 4G3XB 1F77A 1TS4A 5IO9A 4OVZA 3OWEB 1BMLC 4USAA 2IGDA 3APDA 2LEKA 1EU3A 3KYCD 1CJEA 2Y5BB 3Q8AA 4EEWA 2DYMA 2INDC 2CHXA 2ZEQA 1E10A 3LB8C 4LNFA 3MC9A 2M4NA 3A1QA 2LI5A 3RUIB 2BW2A 3PZDA 2ON8A 4CO7A 2FBWB 1E7VA 2A4ZA 3PZ8A 5EE1A 3KWLA 2LJIA 2RDHA 4GSWA 3UF8A 3APCA 1EWYC 2ACZB 2LVOA 2W55A 2K22A 3WAOA 1KRHA 2KJ6A 3V6EB 3DBRB 5EE3A 3SFDB 4XYCA 3W2DA 5D3IB 4GDLA 1YN3A 2JZZA 1F9JA 1L0VB 1WGRA 2BGFA 2BS3B 5CHFA 2KDMA 4B95A 4WJNA 3A9KA 4FHJA 2BTEA 2NR2A 1FM0D 3ZW3A 2N1WA 4NZLB 3VR9B 1R4NI 2FCMA 1T0SC 1ZOYB 1WIAA 3AMZA 3ONSA 2XEWA 5J18A 4KKJA 1MG4A 1XT9B 3X0WA 3ABVB 2ZW1A 4FN2A 1L0YB 3EUB2 3N3KB 3QIJA 2X38A 3NZUA 1WM3A 3TL5A 4HVBA 4ZHOA 5GXGB 1PGBA 1WZ0A 2KDFB 2QJLA 2O2VA 1V5OA 3JW0X 3PRZA 1KF6B 1E7PB 5DPSA 4PK1A 4FHKA 2GOWA 3DWGC 1WJ4A 3QJZA 3X23A 4RGTA 2PEAA 3WAMA 2LZ6A 3PLVA 4A6QA 5LXHA 3ZQ4A 3APFA 3TEZA 1NENB 4EZKA 1ZXIA 1YN5A 1WXAA 3W5UB 2HJ8A 2PKOA 1FXIA 2KVRA 2LFIA 3BWUD 2AL3A 3IT4B 2J4XA 1BXTA 3CWIA 2LVQA 1R4NB 2IGGA 1D6EC 2Y5CA 3IVFA 2VH1A 2CJOA 3RNEC 3AN1A 3U52E 1WH3A 1XXGA 1I4XA 3T8MA 2FE8A 1ROEA 3TCAA 2FCQA 3HIZA 4KGRA 3TIXA 3RFZB 4N59A 3KWVA 4II3B 1SBBB 2V0GA 1RFKA 3L4PA 4MM3A 4DHZB 1UWMA 3ZYYX 1SF0A 3IAM1 1EU4A 2LMCA 2O6VD 3E56A 3L16A 1WJ6A 3ML8A 1FPYA 2LRUA 4GOCA 4ARCA 1SIJA 2ZW0A 2MSED 1WJNA 4MJSA 4GDKA 2LVPA 2W82A 4LJPB 2V3NA 1VD2A 4OZBA 2WDTB 2D07B 2G9HD 1ZP0B 2RR9A 1TBEA 1ZKHA 4MEMA 3N1XC 1SGHA 3A33B 4TQ1A 2MP2B 4GMVA 1FRRA 2D11A 3ZJUA 1XD3B 5CHWA 1N62A 4IG7B 4ZDVA 1UD7A 4C7YA 3V60A 2LGDA 3MJ5A 1PDXA 1F2RC 5BYQA 4DHZE 3N30A 4W9EA 3TJPA 3OJ3A 3RULA 1WGKA 4D2KA 3ZNGC 4AJWA 2LHEA 1V9JA 4ZHPA 2GRIA 5AUIA 2KANA 2PW9A 2M8SA 4DDGD 1IBXA 1RRBA 3V61A 2JXXA 1C76A 3Q14C 5G5GA 2V9HA 1QOFA 4IW0A 5FKAC 2FAZA 4J6IA 1NYRA 3NS8A 4A9AA 2GBJA 1EF5A 4IDIA 2CHZA 1D5MC 3VRAB 1ZW7A 2BBCA 1V97A 4EFOA 1N5WA 2QHOA 1IPGA 4C7ZA 5D3DA 2V3PA 1KLGD 1Y56A 4HXDA 3MHSD 3B2FA 4BBNF 3AEDB 4BKTA 1T6BX 1RFAA 1TZ1A 1JWMD 1KFYB 5EE9A 3JSVB 4PT5A 5CTRC 1H4RA 2KTRA 3Q8EA 1KJTA 1HZ5A 1QOAA 5IAAC 4RNAA 1P7EA 4BFRA 4JPSA 2KFKB 1RM6C 1FFVA 2KTRB 4KIKA 1Y8RC 3I9V1 2K0PA 3W1SC 1ZPSA 4RGNA 3NRZA 1WYGA 4HKQA 3AEAB 2FUHB 4W9CA 4JL9A 1ZDVA 3Q8FA 2KN5A 1VZ6A 5IA7A 3A4RA 4YSZB 1T3QA 2M17A 3TMPB 4EKUA 3PRPB 1UF0A 3KH0A 3DPDA 4YWGG 1JWAD 1GG3A 3DQVA 3A1QB 3BY4B 4RGMA 4M8NA 4K1RB 1V1PB 2KOXA 2G4SA 3TEYA 1FNWA 3U7ZA 4XZ4A 2EKIA 1K50A 2KD0A 1V49A 1P0RA 3B9JA 4P1BC 4PS3A 1N63A 1DYQA 1R4MB 1TY2A 2N7EA 2MBEA 4CYEA 3VFKA 5IOIA 3SEBA 4FA6A 1SJED 5AZGA 3PLUA 1WWTA 3IFWB 4HKZE 4RFBA 4ZYSA 2JSVX 4IC7B 3P4RB 3A9JB 3RNAC 2BWFA 1XLPA 5HG2A 3AE3B 2G45B 4BKGA 3QHTA 1SSNA 4W9KA 4DHJD 3DBHB 4BKSA 3A9KB 5BO4B 3PO0A 5FR3A 3R2IA 4G0NB 1J8CA 4JIOU 5DPWA 2KXJA 5H92C 2ZCCA 3U7DA 1E5WA 4DXGA 4W9DA 3TUOA 1FEHA 1L2NA 1ESFA 3R2TA 2WYQA 3DBLI 1JWBD 3GZNB 3PGEA 1D4BA 2INNE 3AB5A 2MQJA 2M1MA 3ZNHB 3GOEA 2HTHA 2L52A 1IYFA 1HA5A 4BZAA 2DZIA 1ENFA 2D3CA 2KN4A 5J2RA 2KWDA 2VZKD 1R4MI 2WX0A 2V4LA 2JYEA 2BQQA 2WXLA 4M00A 2WXGA 4MH8A 1P9DU 3QK0A 4KSLC 1UGJA 1G6JA 1GPXA 1FMAD 3N1ZC 3AH7A 1YOVB 1KTKA 3N9YC 4PYZA 1L5PA 1E0ZA 3PRMB 2FIFA 2GMIC 4W9IA 3P1MA 2Z59B 4XDDA 3R8BA 1JALA 4AJYB 2MBQA 3PHWB 5CHVC 4OZAA 1K8RB 4ZRPA 1D3ZA 3ZKJC 3BVGA 3VTUA 2HJ1A 3ZJVA 1FO4A 1GB1A 2IBIB 4ANVA 2HD5B 1WE7A 2LRWA 2MJDA 1I35A 4FULA 2SAKA 1I42A 2KYWA 3WCQA 1XLNA 5HKHA 4XDCA 1NEKB 4S17A 3H7PA 2EELA 4M02A 3Q3FA 1QF6A 3BK1A 1DOYA 3QWZB 1KM7A 2I2YA 2WU2B 3DHGC 2RSUA 1CZPA 2WXJA 2NMQA 4WWPA 4DDID 1T0RC 2WXOA 3PV1A 4AP4C 2M0AA 3IBEA 4HPLB 2D10A 1I4PA 4FBJB 2JZPA 3GP7A 2JU6X 2DX5B 4YTPB 5JHAA 2IDYA 4M0WA 3DVGY 4OW0A 3GS2A 2L3ZA 4C4VA 2PVGC 1F2RI 2IO1B 3VXWA 2L0FA 2DWQA 4CQNA 4XC2A 1UGMA 3LYYA 3FAHA 3DCGA 3BIID 3LXFA 3URYA 1E6EB 4C4VB 1QKZA 1XF5L 4EE2A 1VJKA 2BKRB 2QEJC 3RNBC 3TEXA 1BUIC 3HRDD 2IPKD 4B6WA 2WDRB 3A4SC 3KQ4A 3H7PB 3ZIMA 2X8XX 3UIOB 1JRUA 2DENB 1VZ8A 5JH5C 4IWQA 2JZ3B 4FJVB 2KC2A 2H88B 1D5XC 5H8YE 5CX3A 1JWUD 1AN8A 2D5GA 4TSSA 2REXA 3ECIA 4JX1C 3IXSA 4HCNB 3VTWA 4OVUA 4DQOC 2E6XA 2NPTA 4IM0A 4C80A 2KNBA 2Z0EB 2XK5B 3W1YA 4A55A 2KK8A 3OJ4B 1WX8A 4YT0B 3SD5A 3SHQA 2C7HA 4WWOA 2MCNB 2K25A 1J7CA 1AARA 3W5VB 1V6EA 2BB5A 3NVWA 4BAXA 1SE2A 1I4HA 1MVKA 4GIVA 3NZ3A 2MRPA 3J9CA 1ZUD2 5BMHA 2WXKA 3UIPB 3PREA 4WQOB 4F1SA 1STEA 3AULA 3UINB 1OQYA 2N0SB 1I4GA 3M62B 1Z5SB 3H1UA 3WANA 2W3RA 3CMMB 2I1JA 2ICIA 2N7JA 4YTNB 4ASWC 3W9CB 2WXFA 1JW9D 3PHXB 5JXVA 3Q8BA 4HPPA 1WRIA 1ZXHA 4XX5A 5HFYA 2UWQA 1OQRA 2KQ7A 1KOTA 4A90A 2W9NA 5C1ZA 2QIEB 3AU5A 5IP4D 4PS7A 3BVZA 2ZVNA 5EE0A 2PVOD 1NYQA 2TSSA 2RDGA 1LFDA 1CMXB 1YMHE 2WDQB 4DBGA 4IM3A 2KX3A 1C4AA 2W3SA 2FUG1 3B08A 5AUKA 1K51A 2N4FA 1ZE3D 1EM7A 2KMMA 2PE9A 4NY0A 4GDLB 3BYTB 1WXSA 2CJNA 3GE8C 1T0QC 4FADA 1DOXA 1C77A 1F1HA 1NI2A 2RPQA 3Q8CA 2EMTA 2DAFA 1DOIA 2MEKA 1NDDA 4YL8A 1SE3A 4DWFA 2N9LA 4IWPA 3I63C 2JWUA 4B0EA 4F7ZA 4KIKB 1GC7A 3U30A 1WR6E 2AYOB 3N20C 3HHMA 2DZJA 3P4PB 3RT3B 2JPHA 4N58A 1SE9A 3DVNV 1HTQA 2KDEB 2MJEA 4BOSC 3V3XA 3AE9B 1YD8U 2A5UA 1FXAA 4HJGE 1B9RA 1XO3A 2D3GA 3QAQA 1TS5A 3WIMA 3UQAA 3L54A 1WXVA 4M0WB 1BT0A 2DZKA 2LWPA 2JXTA 4JGHB 2C9WB 3S2AA 1XEEA 2ASQA 2WGSA 3MC0B 1EUVB 1VLBA 1ZDXA 3H8HA 4BBNC 1Q5WB 2LGYA 2NTTA 3AE2B 1N60A 5T8IA 2WU5B 2GBNA 4RGOS 2WNMA 2UYZB 3I5JC 1YX5B 1MHHE 3T9LA 3M63B 1WJUA 2QMTA 2C5LC 3NS1A 1UUPA 2LASA 2I1KA 3ZNID 4WQMA 4MM3B 3QX1A 2G1EA 2LD9A 4XE0A 1V2YA 2M56B 1VR9A 3RCZA 1OEYA 1R7SA 4K7WA 4ZRJA 5TSSA 3VR8B 3ZDTA 3CSTA 2MHJA 4ZYNA 4AS1A 4P16A 1C9FA 2MX2A 2E3TA 2MP2A 2B76B 4US8A 5D94A 3AM9A 2NPTB 1FIQA 3AE7B 5AEKB 5C23A 5D2MB 4C56C 4JWUC 4WJQA 3EHVA 2KFJA 3RPFC 4LCDE 1SE4A 3C19A 2YLMA 2ZNVC 4ITKA 1J7AA 2KQ4X 3R66C 1V5TA 3DVNU 1OFFA 1DGJA 2O2VB 1HZ6A 1FNVA 3VUWA 1EWCA 1UNSA 1FD6A 4PS8A 1WGYA 1IBXB 2L76A 2WXIA 1GNUA 1WGGA 1YNTE 2L1AA 4YSXB 1CK1A 2NBVB 2QCZA 2UU7A 2JWZA 3NZSA 1LGRA 2KWCA 4MSQB 3AEEB 1K53A 4JE3B 2V1YA 1LQBA 2PTLA 2MBBB 2KJRA 2Z0DB 1XQQA 4US9A 4I6PA 3IAS1 3H6NA 2JY6A 1J19A 1UZXB 1SJHD 1FRDA 1WF9A 5LNK1 1E90A 2C7NB 4RF1A 3QQ8B 1GJZA 2MBOA 2MLBA 4KVGB 5D7GA 1IGDA 2WWZA 1YJIA 2CKHB 1PFDA 3AE5B 4DXAB 1HQRD 2J42A 4LK0M 2AQ3B 1WXQA 2KVZA 4MACA 3PS6A 3A9JA 1AWDA 1GB4A 3VUXA 2K6DB 4N9F4 4LNIA 2VRRB 2KLCA 1N6ZA 1HE8A 2G4DB 2K6QA 4HDQA 4HROA 3GZNI 2KJHB 2WX1A 2XBBC 2PJHA 4MSMB 1XLQA 4UDUC 3KLSX 4W9LA 1EO6A 3PZ7A 3BZDB 4A8XC 3O65B 2M0XA 4IM2A 3B2GA 1SB3C 3AEFB 1JMLA 2CR5A 1GAQB 1HXYD 4DXFA 2JRHA 2DAJA 1Q10A 2KWVB 2MJ3A 4WAAA 4XGAB 2W54A 3UQBA 1YJ1A 1ET9A 2VH2A 2IGHA 4ANXA 5G55A 3ZVVA 1K52A 1ISNA 5E6NA 3JVZX 2ZPNA 4RM9A 3ZLZA 2XK5A 1NVID 3OAWA 2CHWA 2WHIA 3L10B 4BVUC 4DHJB 3ML9A 5BMGA 3R3MA 4M8MA 2BVCA 2ZNVB 3U2SC 3PTFC 2BYFA 3DOWA 3VAWA 3AE6B 1WMHB 3UI3A 3IHPC 3RZFA 1WZ3A 4XWWA 1I7HA 1U4AA 3Q69A 4BKSD 4MGYE 2N9KA 3C0RB 4E3CA 4ZRKA 5GMVA 3ZNZB 2KMCA 3BVMA 3HVZA 1YQ3B 3ETRA 2KO3A 4HPMB 2JQRB 3B1LX 3VDZA 1VRAB 2WXMA 2OJWA 1WGDA 1C78A 1A5RA 3P4QB 4GLSC 2WXQA 4GXBA 1E8XA 4P1CC 3L08A 3VRBB 2RD0A 3CIRB 2JT4B 2KDBA 4ARIA 1L0XB 1J0GA 2PIAA 3WAPA 3QARA 1TTNA 4YTMB 1LM8B 1SXTA 1IGCA 3DHIC 3RD2A 4MELA 1V1PA 2DBYA 2RGFA 4RH6A 3VH3B 1TKGA 2WS3B 2ZZPB 1QILA 4GB9A 3NJTA 1MHXA 2MBHA 2B3AA 4AWJA 4A20A 4NAWA 4JQWC 2EMSA 5E6PA 2ZPYA 5IKCM 3N1YC 4NNJB 2QC8A 1SIFA 5C2TB 1E9MA 1UBQA 4K7SA 2FIDA 4W9JA 4TMAB 4HLEA 4KDIC 4HRSA 5E6OA 3Q3OC 2R2QA 1H8CA 5TR5A 2WP9B 2KC1A 1Z2MA 2LUEA 4IKGA 4NQKE 3ZRCA 4P7IA 4S0RA 2DNFA 2XNAC 4KX6B 3RZWC 1L4DB 4MDKE 2Y5PA 2R61A 3RNGC 1JWSD 4ZOHC 2AEHA 4NAWB 2R2OA 2QILA 1L6UA 5EDSA 1IP9A 1MJDA 3Q3JA 4MT5A 3MFGA 4OVVA 3AECB 4LNKA 5L83A 2CU3A 2EKEC 1E7UA 2J0JA 2G3QB 4BOZB 2BYVE 1WXMA 2INPE 1FNUA 4L2YA 2IO0B 4PYUA 2GBKA 2J53A 4HCPB 3I3TB 3RNFC 4M01A 2RDBC 4TV3A 4WJPA 2DYOA 2IJ0A 3AE8B 2KFKA 3IG3A 5LXIB 2OHFA 3BK2A 3NY5A 4WURA 3P63A 4H2AA 1RWSA 1YJJA 2BPSA 3EA6A 2KLGA 1E8YA 1GOZA 1TKEA 4L23A 3WA0A 2I38A 1L6VA 4I6LB 1E8WA 2YVCA 1FXTB 4W9HA 1X1MA 3KW5B 2Z8LA 4AQ7A 1WFYA 4KZCA 2ZJDA 4QAYA 4AUQC 4MGKE 3T3OA 3VUYA 5BYSA 2KAJA 5BMIA 3R7QA 1OEYJ 4OHJA 3Q6BA 4LDTB 5D6JB 2BB6A 2MA9B 2BS2B 4KDLB 3SU8X 2FCSA 2BT6A 2L32A 2D3AA 3M3JA 3FC4A 3NVZA 2DZMA 2DYBA 3HM6X 3ZJTA 4ANWA 2JVCA 4NQLB 2O6VA 2GB1A 1I4QA 2MW5A 1AYFA 3NVVA 2K8HA 1TS3A 2AWTA 2VZKB 3H7SA 2JX5A 1IUEA 1LO5D 1C1YB 2OOBB 3EC8A 2J7QB 1LXDA 1C3TA 2LXAA 2NS5A 4HWIB 3QCAA 2RMMA 4KSKC 2DHZA 3VH4B 1JCKB 3TEWA 1P7FA 3LJ3A 4L1BA 2K3UA 1UBIA 3ZGZA 1MG8A 3QC8B 3NG0A 1PGXA 3DBLB 1XCQL 2IO2B 4JWSC 3ZXRA 5J17A 4LNNA 1WY8A 4LLGM 3CSFA 2N7DA 2BYEA 4FJYA 4LNOA 4J3OD 5HI1A 1F52A 4E74A 1WX9A 3Q3MC 2V3SA 5FK9C 2LGSA 2HE7A 4TKNA 5C3JB 3I57A 3DWMA 2V4IB 1ET6A 4W9GA 1WR1A 2M19A 1JQ4A 5G5HA 1WM2A 4DK5A 4GU2A 1WI0A 2WDVB 2J52A 2INCC 4WWNA 2NBWB 3QA8A 3HVDA 1ACCA 5DPRA 3ZO5B 1C79A 1S1QB 2NVUI 5AZFA 3ALBA 3NOBA 2JUOA 3N32A 1AW7A 4ZRIA 1B1ZA 2H89B 3DBRI 3MJWA 1V1OA 3KUZA 3HUIA 1ZGUB 1XLOA 3PSEB 3DVGX 2KHWB 4ANUA 2IYDB 4IWOA 3IT6B 2D3BA 4WIPA 4WJOA 2L00B 5KHQA 5KHOA 2AX5A 2QSDA 1VCBA 2K9XA 4R3DA 2JF5A 4ACFA 3JSVA 3AE1B 2N9XA 2D2QA 2N9EB 4RF0A 1C4PA 4XWTA 3EECA 2K5PA 3AXCA 2WXHA 3SDLC 2OEDA 2WXNA 2WXRA 5I4DA 4F8CB 1FCLA 4LDTD 1WE6A 3M95A 3MTNB 3AEBB 4HK2A 5E6JA 3ZXVA 1OTRB 3OLMD 1YIWA 1KLUD 4IOIE 4CHKA 2LGIA 4NJ7A 4ICUA 2FCNA 4URKA 3TBLD 1P1AA 2KTFA 3AE4B 3VTVA 1TZOA 4HDOA 2BS4B 2NTSA 2KMAA 3RN9C 1T0YA 2PLPA 2ONQA 1WX7A 4K81A 2KX0A 4EOYA 4G11A 4RMAA 3V62A 5G2NA 4A3OA 1I4RA 2KKCA 4AOFA 2PPHA 2CU1A 4OZCA 1GC6A 4G50A 3DBSA 1JROA 4K3BA 1TY0A 4NJCA 5JHBA 2JYTA 4MGIE 3L0WB 3KVFB 3U8ZA 5L95C 3L13A 5HHDG 4GN1A 1WRDB 2L8JA 4N6EB 1YN4A 1V8CA 2CS4A 2LJ5A 3DDCB 1J7BA 4FLHA 1UELA 3V05A 1V86A 1FCCC 3V6CB 1PQSA 2WXPA 4NPNA 3DBHI 2L05A 4FXCA 2LGXA 3T3NA 4RCOA 1L4ZB 1TKYA 1XCTL 4KZ0A 1RLFA 2OJRA 1P3QU 2LXCA 3R7RA 2WLBA 2ZVOA 2L7RA 2BWES 4RM8A 3RI7C 3SR6A 1UH6A 3EGRA 1YX6B 3LDZE 2K39A 2AQ2B 4YSYB 3UGBB 3EFUA 3VQIA 1TIFA 3RMKC 2KZRA 3MP9A 1PYWD 2JRIB 1MI0A 2KT7A 4KKIA 4X57B 3U4EG 4EUTA 5MPOA 3OG5A 1TT5B 2ZCBA 3L17A 2BF8B 2LHDA 2PE6B 3SFEB 2MH7A 2IY0B 1OGWA 2BYTA 1TGZB 2IY1B 1WYWB 4KV2A 1YQ4B 1M4VA 1TJEA 1Q1OA 3RNCC 2YEPB 2BKFA 3MC8A 2L83A 2IZVB 1VZ7A 4LJOB 4I6NB 1TYGB 4MJSB 2HTME 2AL6A 4O1NA 2HDEA 4GGQA 1QOBA 1L7YA 4NJ6A 2J0KA 1T5XD 4IUMB 3ZDMC 1MFWA 3CF6E 3P42A 1QT9A 4KGTA 1Q0WB 2FNJB 2J0MA 2LUMA 2AQ1B 1V81A 2KACA 3JYUA 4TUUA 2NCNA 3NUHB 4K3CA 3AI5A 3ZTCA 3ZTDA 1KH0A 4B9KA 3FKYA 2K1FA 2IO3B 2PMVA 1SEBD 5DCNA 5JZEB 2NBUA 1UWXA 1M94A 3AU4A 3RYTA 4EZJA 1F0ZA 3AEGB 3B0AA 1NI3A 3Q2AC 4MGZE 1N5XA 3HM3A 2WQYB 4A3PA 4WH4A 4NAMA 3BINA 1NBFC 3EFCA 3K9PB 5IN7A 2C60A 3PVLA 3W1SA 1OQQA 1CQVA 1QLBB 3Q3NC 3NHEB 3KYDD 4GDKB 4HJKA 1D5ZC 3VVWB 1E8ZA 3E9SA 2MWSB 3P2BA 1N61A 1WMHA 2GLSA 2K8BA 4JLCA 1S3SG 1WGHA 2GI9A 4ZRQA 3PT2B 2DLBA 4MH0E 4B0MA 4W9FA 3O13A 2GBMA 3K9OB 4WWMA 5FR6A 1GUAB 2RPVA 3DHHC 1RYJA 1MPEA 2K8CA 4TQ0A 2GBRA 1YQBA 4E71A 2QDFA 1JRPA 1QOGA 3ENEA 3C8YA 2YEPF 5AZHA 4C00A 3GE3C 1FFUA 1PUTA 2N1VA 3H9DA 4II2B 3NVYA 2KDIA 2KWUB 3KUDB 5LLIA 2O6VB 4KGSA 3FILA 3PPAA 4Q2JA 5BYRA 1PGAA 3MHZA 3TSSA 2Y3AA 3D32A 2XN9C 3FILB
chains in the Genus database with same CATH topology
3M63B 2L0TA 1WJUA 2N7EA 2C5LC 2MW5A 2MBEA 1KLVA 2K8HA 3VFKA 4CYEA 2AWTA 2LASA 4FA6A 2I1KA 5AZGA 3H7SA 3ZNID 3PLUA 4ICVA 3IFWB 3QX1A 4EZLA 3VHTC 2LD9A 4IC7B 5DPTA 1C1YB 1V2YA 2OOBB 3A9JB 2BWFA 3ZRFA 3EC8A 1P98A 1RAXA 2J7QB 1LXDA 3RCZA 1C3TA 2G45B 4BKGA 1OEYA 2LXAA 3QHTA 4W9KA 4DHJD 2NS5A 4K7WA 4ZRJA 4BKSA 4HWIB 3QCAA 4KSKC 3HK0A 3WALA 2DHZA 3A9KB 5BO4B 3VH4B 3ZDTA 3CSTA 4ZYNA 3LJ3A 4G0NB 1J8CA 1UBIA 4JIOU 5DPWA 2KXJA 1MG8A 2ZCCA 2MX2A 3QC8B 2MP2A 3U7DA 1E5WA 4K7UA 1QZEA 2N9PC 1V80A 4W9DA 5D94A 1L2NA 2NPTB 2IO2B 4FJZA 5J17A 2WYQA 3KUCB 1WY8A 3DBLI 3CSFA 2N7DA 2C7MB 1EF1A 2BYEA 3ZUNA 5AEKB 2KQSA 5D2MB 5C23A 4FJYA 4G3XB 4WJQA 3EHVA 2KFJA 3PGEA 4E74A 1WX9A 4LCDE 2MQJA 2M1MA 3ZNHB 2V3SA 3GOEA 2HE7A 2HTHA 4TKNA 2YLMA 2ZNVC 3APDA 3R66C 1IYFA 1V5TA 3DVNU 2O2VB 3KYCD 2Y5BB 3VUWA 4EEWA 2DYMA 4W9GA 1WR1A 4PS8A 2CHXA 1WGYA 2L76A 1WM2A 2ZEQA 2DZIA 4DK5A 4GU2A 5J2RA 1GNUA 1WI0A 1WGGA 4WWNA 1R4MI 2NBWB 2WX0A 3QA8A 2V4LA 2NBVB 2M4NA 3A1QA 2LI5A 3RUIB 5DPRA 2JWZA 3NZSA 3ZO5B 3PZDA 2KWCA 4MSQB 4CO7A 1P9DU 1S1QB 2NVUI 3QK0A 4KSLC 5AZFA 2V1YA 1LQBA 1E7VA 3ALBA 3NOBA 2A4ZA 2JUOA 1G6JA 3N32A 2MBBB 4ZRIA 3DBRI 3MJWA 2KJRA 2Z0DB 1XQQA 3KUZA 4GSWA 4PYZA 1ZGUB 3PSEB 4I6PA 3H6NA 2JY6A 1J19A 1UZXB 3DVGX 3UF8A 2KHWB 3APCA 4ANUA 2IYDB 3PRMB 2FIFA 4IWOA 2GMIC 4W9IA 2LVOA 1WF9A 1E90A 2C7NB 2Z59B 4WJOA 3WAOA 3QQ8B 2KJ6A 2L00B 3V6EB 1GJZA 5KHQA 2MBOA 2MLBA 5KHOA 4AJYB 2MBQA 4KVGB 5D7GA 1VCBA 2WWZA 3PHWB 5CHVC 1K8RB 2JF5A 2CKHB 3JSVA 4GDLA 2JZZA 1F9JA 1WGRA 2D2QA 2BGFA 2N9EB 2N9XA 1D3ZA 3ZKJC 5CHFA 4B95A 4WJNA 3VTUA 3EECA 3A9KA 3AXCA 4FHJA 2IBIB 2NR2A 3SDLC 4ANVA 3ZW3A 4DXAB 2HD5B 2N1WA 1WE7A 1R4NI 4F8CB 2LRWA 1I35A 4LDTD 1WE6A 2FCMA 4FULA 3M95A 1WIAA 3ONSA 3MTNB 2XEWA 3PS6A 3A9JA 4HK2A 5J18A 1I42A 5HKHA 1XT9B 3X0WA 3VUXA 2K6DB 1OTRB 4N9F4 3OLMD 2VRRB 4FN2A 1YIWA 3N3KB 4CHKA 2KLCA 3H7PA 3QIJA 1HE8A 2G4DB 2K6QA 3NZUA 1WM3A 3TL5A 4HDQA 3GZNI 4NJ7A 3Q3FA 2FCNA 2KJHB 4ICUA 4HVBA 2WX1A 2XBBC 4URKA 3TBLD 1P1AA 2PJHA 1WZ0A 2KTFA 3QWZB 1KM7A 2KDFB 3VTVA 2O2VA 4HDOA 1V5OA 2RSUA 4MSMB 3JW0X 3PRZA 2KMAA 1T0YA 4WWPA 4DDID 1WX7A 5DPSA 3PV1A 4AP4C 3IBEA 4K81A 4W9LA 2KX0A 4HPLB 1EO6A 4EOYA 2D10A 4G11A 4FHKA 2GOWA 1WJ4A 4FBJB 3QJZA 4RMAA 3V62A 2DX5B 5JHAA 3O65B 5G2NA 3X23A 4A3OA 2M0XA 4IM2A 2KKCA 4AOFA 2PPHA 2CU1A 2PEAA 1GC6A 3DVGY 2CR5A 2LZ6A 3PLVA 3WAMA 4G50A 5LXHA 2JRHA 2DAJA 3APFA 3DBSA 2KWVB 4EZKA 2L3ZA 4WAAA 2IO1B 5JHBA 3UQBA 3VXWA 1YJ1A 4MGIE 2L0FA 3L0WB 1WXAA 3KVFB 2HJ8A 3U8ZA 4XC2A 1UGMA 5L95C 3L13A 4ANXA 3DCGA 5G55A 3ZVVA 2KVRA 2AL3A 1ISNA 1WRDB 4GN1A 2BKRB 2L8JA 3JVZX 5E6NA 2ZPNA 4RM9A 3ZLZA 2CS4A 2LJ5A 2LVQA 2XK5A 3DDCB 4FLHA 1UELA 3IVFA 3OAWA 2CHWA 3L10B 1V86A 4B6WA 3V6CB 4BVUC 3ML9A 4DHJB 3A4SC 3R3MA 1WH3A 1PQSA 4M8MA 3H7PB 3ZIMA 3UIOB 4NPNA 2ZNVB 3DBHI 2L05A 3PTFC 1JRUA 2DENB 4PS3A 2BYFA 2LGXA 3DOWA 3VAWA 3T8MA 1WMHB 4IWQA 5JH5C 2JZ3B 3IHPC 3RZFA 4FJVB 1WZ3A 2KC2A 1U4AA 3TCAA 4BKSD 5CX3A 4MGYE 2FCQA 3HIZA 3TIXA 4KZ0A 3C0RB 4E3CA 4ZRKA 5GMVA 1RLFA 3ZNZB 2OJRA 2KMCA 4II3B 2REXA 3ECIA 1P3QU 2LXCA 3R7RA 2KO3A 4HPMB 4HCNB 3VTWA 2ZVOA 4MM3A 4DHZB 4OVUA 3B1LX 3VDZA 2L7RA 2BWES 4RM8A 1WGDA 2O6VD 3L16A 2NPTA 4IM0A 2KNBA 1WJ6A 1A5RA 2Z0EB 1UH6A 2XK5B 3ML8A 3W1YA 2KK8A 3OJ4B 1YX6B 2LRUA 3LDZE 1WX8A 4GXBA 2K39A 3SD5A 4GOCA 1E8XA 3SHQA 2C7HA 3L08A 4WWOA 3EFUA 3UGBB 3VQIA 2MCNB 2KZRA 2K25A 2RD0A 1AARA 2JT4B 2KDBA 2JRIB 1J0GA 1V6EA 3WAPA 2MSED 1WJNA 3QARA 4MJSA 4X57B 4EUTA 4GDKA 1TTNA 2ZCBA 3L17A 2BF8B 4GIVA 2PE6B 2MRPA 1LM8B 2LVPA 2IY0B 3RD2A 4MELA 4LJPB 3UIPB 3PREA 4WQOB 1OGWA 1VD2A 1TGZB 2WDTB 2RGFA 2IY1B 1WYWB 2D07B 4F1SA 3VH3B 4KV2A 3AULA 2ZZPB 2RR9A 3UINB 1OQYA 1TBEA 1ZKHA 4MEMA 4GB9A 1Q1OA 3M62B 1Z5SB 1SGHA 3H1UA 2MBHA 2B3AA 3A33B 3WANA 4AWJA 4A20A 4NAWA 4TQ1A 2MP2B 4GMVA 3CMMB 2I1JA 2D11A 2BKFA 1XD3B 4JQWC 2EMSA 5CHWA 5E6PA 4IG7B 2IZVB 4ZDVA 1UD7A 2ZPYA 4LJOB 4NNJB 3V60A 4I6NB 1SIFA 4ASWC 1UBQA 4K7SA 4MJSB 2FIDA 3PHXB 2LGDA 4W9JA 4HLEA 4KDIC 2AL6A 5E6OA 1H8CA 2R2QA 5TR5A 4GGQA 2KC1A 4XX5A 4DHZE 1L7YA 3N30A 4NJ6A 1Z2MA 2J0KA 2LUEA 4W9EA 4NQKE 3ZRCA 2UWQA 4IUMB 3TJPA 3ZDMC 3OJ3A 4P7IA 2KQ7A 3RULA 3CF6E 1KOTA 3ZNGC 2W9NA 4AJWA 5C1ZA 3AU5A 1V9JA 4PS7A 3RZWC 4MDKE 2ZVNA 1Q0WB 2KANA 2FNJB 2J0MA 2M8SA 1V81A 3JYUA 4TUUA 4DDGD 2NCNA 3AI5A 1RRBA 2AEHA 4NAWB 2JXXA 2R2OA 3V61A 3ZTCA 3ZTDA 4B9KA 1LFDA 1CMXB 5EDSA 2K1FA 1IP9A 4DBGA 4IM3A 3Q3JA 2KX3A 2IO3B 5DCNA 5JZEB 2NBUA 4OVVA 3B08A 4IW0A 1M94A 3AU4A 2N4FA 2PE9A 3RYTA 4EZJA 5L83A 4NY0A 2EKEC 2FAZA 3B0AA 1E7UA 4GDLB 2J0JA 4J6IA 4MGZE 2G3QB 3NS8A 2GBJA 1WXSA 4BOZB 3HM3A 2BYVE 1EF5A 1WXMA 4FADA 4A3PA 2CHZA 2IO0B 1ZW7A 1NI2A 2RPQA 3BINA 1NBFC 4PYUA 4EFOA 2EMTA 3K9PB 2DAFA 2GBKA 2C60A 2QHOA 3PVLA 3W1SA 1IPGA 4HCPB 3I3TB 1NDDA 3NHEB 4YL8A 3KYDD 4GDKB 4HXDA 4TV3A 4WJPA 2DYOA 3MHSD 4BBNF 4HJKA 4DWFA 3VVWB 4BKTA 1RFAA 1E8ZA 1TZ1A 2MWSB 3P2BA 4IWPA 2KFKA 3JSVB 1WMHA 3IG3A 5CTRC 2K8BA 1H4RA 2KTRA 4F7ZA 5LXIB 4KIKB 1GC7A 1KJTA 1S3SG 1WGHA 3NY5A 4JLCA 5IAAC 3U30A 1WR6E 4BFRA 2AYOB 3HHMA 2DZJA 3PT2B 4MH0E 3RT3B 2BPSA 2KFKB 2JPHA 4W9FA 1SE9A 2KLGA 1E8YA 2KTRB 3DVNV 2GBMA 4KIKA 3WA0A 2KDEB 3K9OB 1Y8RC 5FR6A 1GUAB 4I6LB 4BOSC 2K8CA 1E8WA 4TQ0A 2GBRA 3W1SC 1YQBA 2YVCA 1FXTB 1YD8U 1X1MA 2A5UA 4W9HA 3KW5B 4E71A 2FUHB 4W9CA 4JL9A 2KN5A 5IA7A 3A4RA 2D3GA 3ENEA 1WFYA 3QAQA 4KZCA 5AZHA 2ZJDA 3WIMA 3UQAA 3L54A 2M17A 1WXVA 3TMPB 4AUQC 4EKUA 4M0WB 4MGKE 2N1VA 3H9DA 1BT0A 3VUYA 3PRPB 4II2B 2DZKA 2LWPA 2KDIA 3KH0A 3DPDA 1OEYJ 2C9WB 4JGHB 3R7QA 3S2AA 2KWUB 1GG3A 2ASQA 4LDTB 3DQVA 5D6JB 3A1QB 3BY4B 3KUDB 5LLIA 2MA9B 4M8NA 4K1RB 1EUVB 4KDLB 2KOXA 2O6VB 2G4SA 3SU8X 2FCSA 4XZ4A 3M3JA 3PPAA 4BBNC 1Q5WB 2LGYA 2KD0A 1V49A 2DZMA 2DYBA 1P0RA 3HM6X 4ANWA 2GBNA 2JVCA 4NQLB 2UYZB 1YX5B 2O6VA 3D32A 3T9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M63 B;  2L0T A;  1WJU A;  2N7E A;  2C5L C;  2MW5 A;  2MBE A;  1KLV A;  2K8H A;  3VFK A;  4CYE A;  2AWT A;  2LAS A;  4FA6 A;  2I1K A;  5AZG A;  3H7S A;  3ZNI D;  3PLU A;  4ICV A;  3IFW B;  3QX1 A;  4EZL A;  3VHT C;  2LD9 A;  4IC7 B;  5DPT A;  1C1Y B;  1V2Y A;  2OOB B;  3A9J B;  2BWF A;  3ZRF A;  3EC8 A;  1P98 A;  1RAX A;  2J7Q B;  1LXD A;  3RCZ A;  1C3T A;  2G45 B;  4BKG A;  1OEY A;  2LXA A;  3QHT A;  4W9K A;  4DHJ D;  2NS5 A;  4K7W A;  4ZRJ A;  4BKS A;  4HWI B;  3QCA A;  4KSK C;  3HK0 A;  3WAL A;  2DHZ A;  3A9K B;  5BO4 B;  3VH4 B;  3ZDT A;  3CST A;  4ZYN A;  3LJ3 A;  4G0N B;  1J8C A;  1UBI A;  4JIO U;  5DPW A;  2KXJ A;  1MG8 A;  2ZCC A;  2MX2 A;  3QC8 B;  2MP2 A;  3U7D A;  1E5W A;  4K7U A;  1QZE A;  2N9P C;  1V80 A;  4W9D A;  5D94 A;  1L2N A;  2NPT B;  2IO2 B;  4FJZ A;  5J17 A;  2WYQ A;  3KUC B;  1WY8 A;  3DBL I;  3CSF A;  2N7D A;  2C7M B;  1EF1 A;  2BYE A;  3ZUN A;  5AEK B;  2KQS A;  5D2M B;  5C23 A;  4FJY A;  4G3X B;  4WJQ A;  3EHV A;  2KFJ A;  3PGE A;  4E74 A;  1WX9 A;  4LCD E;  2MQJ A;  2M1M A;  3ZNH B;  2V3S A;  3GOE A;  2HE7 A;  2HTH A;  4TKN A;  2YLM A;  2ZNV C;  3APD A;  3R66 C;  1IYF A;  1V5T A;  3DVN U;  2O2V B;  3KYC D;  2Y5B B;  3VUW A;  4EEW A;  2DYM A;  4W9G A;  1WR1 A;  4PS8 A;  2CHX A;  1WGY A;  2L76 A;  1WM2 A;  2ZEQ A;  2DZI A;  4DK5 A;  4GU2 A;  5J2R A;  1GNU A;  1WI0 A;  1WGG A;  4WWN A;  1R4M I;  2NBW B;  2WX0 A;  3QA8 A;  2V4L A;  2NBV B;  2M4N A;  3A1Q A;  2LI5 A;  3RUI B;  5DPR A;  2JWZ A;  3NZS A;  3ZO5 B;  3PZD A;  2KWC A;  4MSQ B;  4CO7 A;  1P9D U;  1S1Q B;  2NVU I;  3QK0 A;  4KSL C;  5AZF A;  2V1Y A;  1LQB A;  1E7V A;  3ALB A;  3NOB A;  2A4Z A;  2JUO A;  1G6J A;  3N32 A;  2MBB B;  4ZRI A;  3DBR I;  3MJW A;  2KJR A;  2Z0D B;  1XQQ A;  3KUZ A;  4GSW A;  4PYZ A;  1ZGU B;  3PSE B;  4I6P A;  3H6N A;  2JY6 A;  1J19 A;  1UZX B;  3DVG X;  3UF8 A;  2KHW B;  3APC A;  4ANU A;  2IYD B;  3PRM B;  2FIF A;  4IWO A;  2GMI C;  4W9I A;  2LVO A;  1WF9 A;  1E90 A;  2C7N B;  2Z59 B;  4WJO A;  3WAO A;  3QQ8 B;  2KJ6 A;  2L00 B;  3V6E B;  1GJZ A;  5KHQ A;  2MBO A;  2MLB A;  5KHO A;  4AJY B;  2MBQ A;  4KVG B;  5D7G A;  1VCB A;  2WWZ A;  3PHW B;  5CHV C;  1K8R B;  2JF5 A;  2CKH B;  3JSV A;  4GDL A;  2JZZ A;  1F9J A;  1WGR A;  2D2Q A;  2BGF A;  2N9E B;  2N9X A;  1D3Z A;  3ZKJ C;  5CHF A;  4B95 A;  4WJN A;  3VTU A;  3EEC A;  3A9K A;  3AXC A;  4FHJ A;  2IBI B;  2NR2 A;  3SDL C;  4ANV A;  3ZW3 A;  4DXA B;  2HD5 B;  2N1W A;  1WE7 A;  1R4N I;  4F8C B;  2LRW A;  1I35 A;  4LDT D;  1WE6 A;  2FCM A;  4FUL A;  3M95 A;  1WIA A;  3ONS A;  3MTN B;  2XEW A;  3PS6 A;  3A9J A;  4HK2 A;  5J18 A;  1I42 A;  5HKH A;  1XT9 B;  3X0W A;  3VUX A;  2K6D B;  1OTR B;  4N9F 4;  3OLM D;  2VRR B;  4FN2 A;  1YIW A;  3N3K B;  4CHK A;  2KLC A;  3H7P A;  3QIJ A;  1HE8 A;  2G4D B;  2K6Q A;  3NZU A;  1WM3 A;  3TL5 A;  4HDQ A;  3GZN I;  4NJ7 A;  3Q3F A;  2FCN A;  2KJH B;  4ICU A;  4HVB A;  2WX1 A;  2XBB C;  4URK A;  3TBL D;  1P1A A;  2PJH A;  1WZ0 A;  2KTF A;  3QWZ B;  1KM7 A;  2KDF B;  3VTV A;  2O2V A;  4HDO A;  1V5O A;  2RSU A;  4MSM B;  3JW0 X;  3PRZ A;  2KMA A;  1T0Y A;  4WWP A;  4DDI D;  1WX7 A;  5DPS A;  3PV1 A;  4AP4 C;  3IBE A;  4K81 A;  4W9L A;  2KX0 A;  4HPL B;  1EO6 A;  4EOY A;  2D10 A;  4G11 A;  4FHK A;  2GOW A;  1WJ4 A;  4FBJ B;  3QJZ A;  4RMA A;  3V62 A;  2DX5 B;  5JHA A;  3O65 B;  5G2N A;  3X23 A;  4A3O A;  2M0X A;  4IM2 A;  2KKC A;  4AOF A;  2PPH A;  2CU1 A;  2PEA A;  1GC6 A;  3DVG Y;  2CR5 A;  2LZ6 A;  3PLV A;  3WAM A;  4G50 A;  5LXH A;  2JRH A;  2DAJ A;  3APF A;  3DBS A;  2KWV B;  4EZK A;  2L3Z A;  4WAA A;  2IO1 B;  5JHB A;  3UQB A;  3VXW A;  1YJ1 A;  4MGI E;  2L0F A;  3L0W B;  1WXA A;  3KVF B;  2HJ8 A;  3U8Z A;  4XC2 A;  1UGM A;  5L95 C;  3L13 A;  4ANX A;  3DCG A;  5G55 A;  3ZVV A;  2KVR A;  2AL3 A;  1ISN A;  1WRD B;  4GN1 A;  2BKR B;  2L8J A;  3JVZ X;  5E6N A;  2ZPN A;  4RM9 A;  3ZLZ A;  2CS4 A;  2LJ5 A;  2LVQ A;  2XK5 A;  3DDC B;  4FLH A;  1UEL A;  3IVF A;  3OAW A;  2CHW A;  3L10 B;  1V86 A;  4B6W A;  3V6C B;  4BVU C;  3ML9 A;  4DHJ B;  3A4S C;  3R3M A;  1WH3 A;  1PQS A;  4M8M A;  3H7P B;  3ZIM A;  3UIO B;  4NPN A;  2ZNV B;  3DBH I;  2L05 A;  3PTF C;  1JRU A;  2DEN B;  4PS3 A;  2BYF A;  2LGX A;  3DOW A;  3VAW A;  3T8M A;  1WMH B;  4IWQ A;  5JH5 C;  2JZ3 B;  3IHP C;  3RZF A;  4FJV B;  1WZ3 A;  2KC2 A;  1U4A A;  3TCA A;  4BKS D;  5CX3 A;  4MGY E;  2FCQ A;  3HIZ A;  3TIX A;  4KZ0 A;  3C0R B;  4E3C A;  4ZRK A;  5GMV A;  1RLF A;  3ZNZ B;  2OJR A;  2KMC A;  4II3 B;  2REX A;  3ECI A;  1P3Q U;  2LXC A;  3R7R A;  2KO3 A;  4HPM B;  4HCN B;  3VTW A;  2ZVO A;  4MM3 A;  4DHZ B;  4OVU A;  3B1L X;  3VDZ A;  2L7R A;  2BWE S;  4RM8 A;  1WGD A;  2O6V D;  3L16 A;  2NPT A;  4IM0 A;  2KNB A;  1WJ6 A;  1A5R A;  2Z0E B;  1UH6 A;  2XK5 B;  3ML8 A;  3W1Y A;  2KK8 A;  3OJ4 B;  1YX6 B;  2LRU A;  3LDZ E;  1WX8 A;  4GXB A;  2K39 A;  3SD5 A;  4GOC A;  1E8X A;  3SHQ A;  2C7H A;  3L08 A;  4WWO A;  3EFU A;  3UGB B;  3VQI A;  2MCN B;  2KZR A;  2K25 A;  2RD0 A;  1AAR A;  2JT4 B;  2KDB A;  2JRI B;  1J0G A;  1V6E A;  3WAP A;  2MSE D;  1WJN A;  3QAR A;  4MJS A;  4X57 B;  4EUT A;  4GDK A;  1TTN A;  2ZCB A;  3L17 A;  2BF8 B;  4GIV A;  2PE6 B;  2MRP A;  1LM8 B;  2LVP A;  2IY0 B;  3RD2 A;  4MEL A;  4LJP B;  3UIP B;  3PRE A;  4WQO B;  1OGW A;  1VD2 A;  1TGZ B;  2WDT B;  2RGF A;  2IY1 B;  1WYW B;  2D07 B;  4F1S A;  3VH3 B;  4KV2 A;  3AUL A;  2ZZP B;  2RR9 A;  3UIN B;  1OQY A;  1TBE A;  1ZKH A;  4MEM A;  4GB9 A;  1Q1O A;  3M62 B;  1Z5S B;  1SGH A;  3H1U A;  2MBH A;  2B3A A;  3A33 B;  3WAN A;  4AWJ A;  4A20 A;  4NAW A;  4TQ1 A;  2MP2 B;  4GMV A;  3CMM B;  2I1J A;  2D11 A;  2BKF A;  1XD3 B;  4JQW C;  2EMS A;  5CHW A;  5E6P A;  4IG7 B;  2IZV B;  4ZDV A;  1UD7 A;  2ZPY A;  4LJO B;  4NNJ B;  3V60 A;  4I6N B;  1SIF A;  4ASW C;  1UBQ A;  4K7S A;  4MJS B;  2FID A;  3PHX B;  2LGD A;  4W9J A;  4HLE A;  4KDI C;  2AL6 A;  5E6O A;  1H8C A;  2R2Q A;  5TR5 A;  4GGQ A;  2KC1 A;  4XX5 A;  4DHZ E;  1L7Y A;  3N30 A;  4NJ6 A;  1Z2M A;  2J0K A;  2LUE A;  4W9E A;  4NQK E;  3ZRC A;  2UWQ A;  4IUM B;  3TJP A;  3ZDM C;  3OJ3 A;  4P7I A;  2KQ7 A;  3RUL A;  3CF6 E;  1KOT A;  3ZNG C;  2W9N A;  4AJW A;  5C1Z A;  3AU5 A;  1V9J A;  4PS7 A;  3RZW C;  4MDK E;  2ZVN A;  1Q0W B;  2KAN A;  2FNJ B;  2J0M A;  2M8S A;  1V81 A;  3JYU A;  4TUU A;  4DDG D;  2NCN A;  3AI5 A;  1RRB A;  2AEH A;  4NAW B;  2JXX A;  2R2O A;  3V61 A;  3ZTC A;  3ZTD A;  4B9K A;  1LFD A;  1CMX B;  5EDS A;  2K1F A;  1IP9 A;  4DBG A;  4IM3 A;  3Q3J A;  2KX3 A;  2IO3 B;  5DCN A;  5JZE B;  2NBU A;  4OVV A;  3B08 A;  4IW0 A;  1M94 A;  3AU4 A;  2N4F A;  2PE9 A;  3RYT A;  4EZJ A;  5L83 A;  4NY0 A;  2EKE C;  2FAZ A;  3B0A A;  1E7U A;  4GDL B;  2J0J A;  4J6I A;  4MGZ E;  2G3Q B;  3NS8 A;  2GBJ A;  1WXS A;  4BOZ B;  3HM3 A;  2BYV E;  1EF5 A;  1WXM A;  4FAD A;  4A3P A;  2CHZ A;  2IO0 B;  1ZW7 A;  1NI2 A;  2RPQ A;  3BIN A;  1NBF C;  4PYU A;  4EFO A;  2EMT A;  3K9P B;  2DAF A;  2GBK A;  2C60 A;  2QHO A;  3PVL A;  3W1S A;  1IPG A;  4HCP B;  3I3T B;  1NDD A;  3NHE B;  4YL8 A;  3KYD D;  4GDK B;  4HXD A;  4TV3 A;  4WJP A;  2DYO A;  3MHS D;  4BBN F;  4HJK A;  4DWF A;  3VVW B;  4BKT A;  1RFA A;  1E8Z A;  1TZ1 A;  2MWS B;  3P2B A;  4IWP A;  2KFK A;  3JSV B;  1WMH A;  3IG3 A;  5CTR C;  2K8B A;  1H4R A;  2KTR A;  4F7Z A;  5LXI B;  4KIK B;  1GC7 A;  1KJT A;  1S3S G;  1WGH A;  3NY5 A;  4JLC A;  5IAA C;  3U30 A;  1WR6 E;  4BFR A;  2AYO B;  3HHM A;  2DZJ A;  3PT2 B;  4MH0 E;  3RT3 B;  2BPS A;  2KFK B;  2JPH A;  4W9F A;  1SE9 A;  2KLG A;  1E8Y A;  2KTR B;  3DVN V;  2GBM A;  4KIK A;  3WA0 A;  2KDE B;  3K9O B;  1Y8R C;  5FR6 A;  1GUA B;  4I6L B;  4BOS C;  2K8C A;  1E8W A;  4TQ0 A;  2GBR A;  3W1S C;  1YQB A;  2YVC A;  1FXT B;  1YD8 U;  1X1M A;  2A5U A;  4W9H A;  3KW5 B;  4E71 A;  2FUH B;  4W9C A;  4JL9 A;  2KN5 A;  5IA7 A;  3A4R A;  2D3G A;  3ENE A;  1WFY A;  3QAQ A;  4KZC A;  5AZH A;  2ZJD A;  3WIM A;  3UQA A;  3L54 A;  2M17 A;  1WXV A;  3TMP B;  4AUQ C;  4EKU A;  4M0W B;  4MGK E;  2N1V A;  3H9D A;  1BT0 A;  3VUY A;  3PRP B;  4II2 B;  2DZK A;  2LWP A;  2KDI A;  3KH0 A;  3DPD A;  1OEY J;  2C9W B;  4JGH B;  3R7Q A;  3S2A A;  2KWU B;  1GG3 A;  2ASQ A;  4LDT B;  3DQV A;  5D6J B;  3A1Q B;  3BY4 B;  3KUD B;  5LLI A;  2MA9 B;  4M8N A;  4K1R B;  1EUV B;  4KDL B;  2KOX A;  2O6V B;  2G4S A;  3SU8 X;  2FCS A;  4XZ4 A;  3M3J A;  3PPA A;  4BBN C;  1Q5W B;  2LGY A;  2KD0 A;  1V49 A;  2DZM A;  2DYB A;  1P0R A;  3HM6 X;  4ANW A;  2GBN A;  2JVC A;  4NQL B;  2UYZ B;  1YX5 B;  2O6V A;  3D32 A;  3T9L A; 
#chains in the Genus database with same CATH topology
 2L0T A;  1TS2 A;  1KLV A;  3BYY B;  3GB1 A;  1HEZ E;  3P4S B;  1C4C A;  4ICV A;  4REZ A;  3AV8 A;  3VHT C;  4EZL A;  5DPT A;  1A70 A;  1VDV A;  3ZRF A;  1P98 A;  1RAX A;  4P6V F;  1QQR A;  2Q5W D;  3WAL A;  1HTO A;  3HK0 A;  4LTU A;  4K7U A;  1QZE A;  2N9P C;  1V80 A;  1WSP A;  4HEA 1;  2SEB D;  4FJZ A;  4WAF A;  4YXD B;  3KUC B;  2C7M B;  1EF1 A;  3ZUN A;  2KQS A;  4G3X B;  1F77 A;  1TS4 A;  5IO9 A;  4OVZ A;  3OWE B;  1BML C;  4USA A;  2IGD A;  3APD A;  2LEK A;  1EU3 A;  3KYC D;  1CJE A;  2Y5B B;  3Q8A A;  4EEW A;  2DYM A;  2IND C;  2CHX A;  2ZEQ A;  1E10 A;  3LB8 C;  4LNF A;  3MC9 A;  2M4N A;  3A1Q A;  2LI5 A;  3RUI B;  2BW2 A;  3PZD A;  2ON8 A;  4CO7 A;  2FBW B;  1E7V A;  2A4Z A;  3PZ8 A;  5EE1 A;  3KWL A;  2LJI A;  2RDH A;  4GSW A;  3UF8 A;  3APC A;  1EWY C;  2ACZ B;  2LVO A;  2W55 A;  2K22 A;  3WAO A;  1KRH A;  2KJ6 A;  3V6E B;  3DBR B;  5EE3 A;  3SFD B;  4XYC A;  3W2D A;  5D3I B;  4GDL A;  1YN3 A;  2JZZ A;  1F9J A;  1L0V B;  1WGR A;  2BGF A;  2BS3 B;  5CHF A;  2KDM A;  4B95 A;  4WJN A;  3A9K A;  4FHJ A;  2BTE A;  2NR2 A;  1FM0 D;  3ZW3 A;  2N1W A;  4NZL B;  3VR9 B;  1R4N I;  2FCM A;  1T0S C;  1ZOY B;  1WIA A;  3AMZ A;  3ONS A;  2XEW A;  5J18 A;  4KKJ A;  1MG4 A;  1XT9 B;  3X0W A;  3ABV B;  2ZW1 A;  4FN2 A;  1L0Y B;  3EUB 2;  3N3K B;  3QIJ A;  2X38 A;  3NZU A;  1WM3 A;  3TL5 A;  4HVB A;  4ZHO A;  5GXG B;  1PGB A;  1WZ0 A;  2KDF B;  2QJL A;  2O2V A;  1V5O A;  3JW0 X;  3PRZ A;  1KF6 B;  1E7P B;  5DPS A;  4PK1 A;  4FHK A;  2GOW A;  3DWG C;  1WJ4 A;  3QJZ A;  3X23 A;  4RGT A;  2PEA A;  3WAM A;  2LZ6 A;  3PLV A;  4A6Q A;  5LXH A;  3ZQ4 A;  3APF A;  3TEZ A;  1NEN B;  4EZK A;  1ZXI A;  1YN5 A;  1WXA A;  3W5U B;  2HJ8 A;  2PKO A;  1FXI A;  2KVR A;  2LFI A;  3BWU D;  2AL3 A;  3IT4 B;  2J4X A;  1BXT A;  3CWI A;  2LVQ A;  1R4N B;  2IGG A;  1D6E C;  2Y5C A;  3IVF A;  2VH1 A;  2CJO A;  3RNE C;  3AN1 A;  3U52 E;  1WH3 A;  1XXG A;  1I4X A;  3T8M A;  2FE8 A;  1ROE A;  3TCA A;  2FCQ A;  3HIZ A;  4KGR A;  3TIX A;  3RFZ B;  4N59 A;  3KWV A;  4II3 B;  1SBB B;  2V0G A;  1RFK A;  3L4P A;  4MM3 A;  4DHZ B;  1UWM A;  3ZYY X;  1SF0 A;  3IAM 1;  1EU4 A;  2LMC A;  2O6V D;  3E56 A;  3L16 A;  1WJ6 A;  3ML8 A;  1FPY A;  2LRU A;  4GOC A;  4ARC A;  1SIJ A;  2ZW0 A;  2MSE D;  1WJN A;  4MJS A;  4GDK A;  2LVP A;  2W82 A;  4LJP B;  2V3N A;  1VD2 A;  4OZB A;  2WDT B;  2D07 B;  2G9H D;  1ZP0 B;  2RR9 A;  1TBE A;  1ZKH A;  4MEM A;  3N1X C;  1SGH A;  3A33 B;  4TQ1 A;  2MP2 B;  4GMV A;  1FRR A;  2D11 A;  3ZJU A;  1XD3 B;  5CHW A;  1N62 A;  4IG7 B;  4ZDV A;  1UD7 A;  4C7Y A;  3V60 A;  2LGD A;  3MJ5 A;  1PDX A;  1F2R C;  5BYQ A;  4DHZ E;  3N30 A;  4W9E A;  3TJP A;  3OJ3 A;  3RUL A;  1WGK A;  4D2K A;  3ZNG C;  4AJW A;  2LHE A;  1V9J A;  4ZHP A;  2GRI A;  5AUI A;  2KAN A;  2PW9 A;  2M8S A;  4DDG D;  1IBX A;  1RRB A;  3V61 A;  2JXX A;  1C76 A;  3Q14 C;  5G5G A;  2V9H A;  1QOF A;  4IW0 A;  5FKA C;  2FAZ A;  4J6I A;  1NYR A;  3NS8 A;  4A9A A;  2GBJ A;  1EF5 A;  4IDI A;  2CHZ A;  1D5M C;  3VRA B;  1ZW7 A;  2BBC A;  1V97 A;  4EFO A;  1N5W A;  2QHO A;  1IPG A;  4C7Z A;  5D3D A;  2V3P A;  1KLG D;  1Y56 A;  4HXD A;  3MHS D;  3B2F A;  4BBN F;  3AED B;  4BKT A;  1T6B X;  1RFA A;  1TZ1 A;  1JWM D;  1KFY B;  5EE9 A;  3JSV B;  4PT5 A;  5CTR C;  1H4R A;  2KTR A;  3Q8E A;  1KJT A;  1HZ5 A;  1QOA A;  5IAA C;  4RNA A;  1P7E A;  4BFR A;  4JPS A;  2KFK B;  1RM6 C;  1FFV A;  2KTR B;  4KIK A;  1Y8R C;  3I9V 1;  2K0P A;  3W1S C;  1ZPS A;  4RGN A;  3NRZ A;  1WYG A;  4HKQ A;  3AEA B;  2FUH B;  4W9C A;  4JL9 A;  1ZDV A;  3Q8F A;  2KN5 A;  1VZ6 A;  5IA7 A;  3A4R A;  4YSZ B;  1T3Q A;  2M17 A;  3TMP B;  4EKU A;  3PRP B;  1UF0 A;  3KH0 A;  3DPD A;  4YWG G;  1JWA D;  1GG3 A;  3DQV A;  3A1Q B;  3BY4 B;  4RGM A;  4M8N A;  4K1R B;  1V1P B;  2KOX A;  2G4S A;  3TEY A;  1FNW A;  3U7Z A;  4XZ4 A;  2EKI A;  1K50 A;  2KD0 A;  1V49 A;  1P0R A;  3B9J A;  4P1B C;  4PS3 A;  1N63 A;  1DYQ A;  1R4M B;  1TY2 A;  2N7E A;  2MBE A;  4CYE A;  3VFK A;  5IOI A;  3SEB A;  4FA6 A;  1SJE D;  5AZG A;  3PLU A;  1WWT A;  3IFW B;  4HKZ E;  4RFB A;  4ZYS A;  2JSV X;  4IC7 B;  3P4R B;  3A9J B;  3RNA C;  2BWF A;  1XLP A;  5HG2 A;  3AE3 B;  2G45 B;  4BKG A;  3QHT A;  1SSN A;  4W9K A;  4DHJ D;  3DBH B;  4BKS A;  3A9K B;  5BO4 B;  3PO0 A;  5FR3 A;  3R2I A;  4G0N B;  1J8C A;  4JIO U;  5DPW A;  2KXJ A;  5H92 C;  2ZCC A;  3U7D A;  1E5W A;  4DXG A;  4W9D A;  3TUO A;  1FEH A;  1L2N A;  1ESF A;  3R2T A;  2WYQ A;  3DBL I;  1JWB D;  3GZN B;  3PGE A;  1D4B A;  2INN E;  3AB5 A;  2MQJ A;  2M1M A;  3ZNH B;  3GOE A;  2HTH A;  2L52 A;  1IYF A;  1HA5 A;  4BZA A;  2DZI A;  1ENF A;  2D3C A;  2KN4 A;  5J2R A;  2KWD A;  2VZK D;  1R4M I;  2WX0 A;  2V4L A;  2JYE A;  2BQQ A;  2WXL A;  4M00 A;  2WXG A;  4MH8 A;  1P9D U;  3QK0 A;  4KSL C;  1UGJ A;  1G6J A;  1GPX A;  1FMA D;  3N1Z C;  3AH7 A;  1YOV B;  1KTK A;  3N9Y C;  4PYZ A;  1L5P A;  1E0Z A;  3PRM B;  2FIF A;  2GMI C;  4W9I A;  3P1M A;  2Z59 B;  4XDD A;  3R8B A;  1JAL A;  4AJY B;  2MBQ A;  3PHW B;  5CHV C;  4OZA A;  1K8R B;  4ZRP A;  1D3Z A;  3ZKJ C;  3BVG A;  3VTU A;  2HJ1 A;  3ZJV A;  1FO4 A;  1GB1 A;  2IBI B;  4ANV A;  2HD5 B;  1WE7 A;  2LRW A;  2MJD A;  1I35 A;  4FUL A;  2SAK A;  1I42 A;  2KYW A;  3WCQ A;  1XLN A;  5HKH A;  4XDC A;  1NEK B;  4S17 A;  3H7P A;  2EEL A;  4M02 A;  3Q3F A;  1QF6 A;  3BK1 A;  1DOY A;  3QWZ B;  1KM7 A;  2I2Y A;  2WU2 B;  3DHG C;  2RSU A;  1CZP A;  2WXJ A;  2NMQ A;  4WWP A;  4DDI D;  1T0R C;  2WXO A;  3PV1 A;  4AP4 C;  2M0A A;  3IBE A;  4HPL B;  2D10 A;  1I4P A;  4FBJ B;  2JZP A;  3GP7 A;  2JU6 X;  2DX5 B;  4YTP B;  5JHA A;  2IDY A;  4M0W A;  3DVG Y;  4OW0 A;  3GS2 A;  2L3Z A;  4C4V A;  2PVG C;  1F2R I;  2IO1 B;  3VXW A;  2L0F A;  2DWQ A;  4CQN A;  4XC2 A;  1UGM A;  3LYY A;  3FAH A;  3DCG A;  3BII D;  3LXF A;  3URY A;  1E6E B;  4C4V B;  1QKZ A;  1XF5 L;  4EE2 A;  1VJK A;  2BKR B;  2QEJ C;  3RNB C;  3TEX A;  1BUI C;  3HRD D;  2IPK D;  4B6W A;  2WDR B;  3A4S C;  3KQ4 A;  3H7P B;  3ZIM A;  2X8X X;  3UIO B;  1JRU A;  2DEN B;  1VZ8 A;  5JH5 C;  4IWQ A;  2JZ3 B;  4FJV B;  2KC2 A;  2H88 B;  1D5X C;  5H8Y E;  5CX3 A;  1JWU D;  1AN8 A;  2D5G A;  4TSS A;  2REX A;  3ECI A;  4JX1 C;  3IXS A;  4HCN B;  3VTW A;  4OVU A;  4DQO C;  2E6X A;  2NPT A;  4IM0 A;  4C80 A;  2KNB A;  2Z0E B;  2XK5 B;  3W1Y A;  4A55 A;  2KK8 A;  3OJ4 B;  1WX8 A;  4YT0 B;  3SD5 A;  3SHQ A;  2C7H A;  4WWO A;  2MCN B;  2K25 A;  1J7C A;  1AAR A;  3W5V B;  1V6E A;  2BB5 A;  3NVW A;  4BAX A;  1SE2 A;  1I4H A;  1MVK A;  4GIV A;  3NZ3 A;  2MRP A;  3J9C A;  1ZUD 2;  5BMH A;  2WXK A;  3UIP B;  3PRE A;  4WQO B;  4F1S A;  1STE A;  3AUL A;  3UIN B;  1OQY A;  2N0S B;  1I4G A;  3M62 B;  1Z5S B;  3H1U A;  3WAN A;  2W3R A;  3CMM B;  2I1J A;  2ICI A;  2N7J A;  4YTN B;  4ASW C;  3W9C B;  2WXF A;  1JW9 D;  3PHX B;  5JXV A;  3Q8B A;  4HPP A;  1WRI A;  1ZXH A;  4XX5 A;  5HFY A;  2UWQ A;  1OQR A;  2KQ7 A;  1KOT A;  4A90 A;  2W9N A;  5C1Z A;  2QIE B;  3AU5 A;  5IP4 D;  4PS7 A;  3BVZ A;  2ZVN A;  5EE0 A;  2PVO D;  1NYQ A;  2TSS A;  2RDG A;  1LFD A;  1CMX B;  1YMH E;  2WDQ B;  4DBG A;  4IM3 A;  2KX3 A;  1C4A A;  2W3S A;  2FUG 1;  3B08 A;  5AUK A;  1K51 A;  2N4F A;  1ZE3 D;  1EM7 A;  2KMM A;  2PE9 A;  4NY0 A;  4GDL B;  3BYT B;  1WXS A;  2CJN A;  3GE8 C;  1T0Q C;  4FAD A;  1DOX A;  1C77 A;  1F1H A;  1NI2 A;  2RPQ A;  3Q8C A;  2EMT A;  2DAF A;  1DOI A;  2MEK A;  1NDD A;  4YL8 A;  1SE3 A;  4DWF A;  2N9L A;  4IWP A;  3I63 C;  2JWU A;  4B0E A;  4F7Z A;  4KIK B;  1GC7 A;  3U30 A;  1WR6 E;  2AYO B;  3N20 C;  3HHM A;  2DZJ A;  3P4P B;  3RT3 B;  2JPH A;  4N58 A;  1SE9 A;  3DVN V;  1HTQ A;  2KDE B;  2MJE A;  4BOS C;  3V3X A;  3AE9 B;  1YD8 U;  2A5U A;  1FXA A;  4HJG E;  1B9R A;  1XO3 A;  2D3G A;  3QAQ A;  1TS5 A;  3WIM A;  3UQA A;  3L54 A;  1WXV A;  4M0W B;  1BT0 A;  2DZK A;  2LWP A;  2JXT A;  4JGH B;  2C9W B;  3S2A A;  1XEE A;  2ASQ A;  2WGS A;  3MC0 B;  1EUV B;  1VLB A;  1ZDX A;  3H8H A;  4BBN C;  1Q5W B;  2LGY A;  2NTT A;  3AE2 B;  1N60 A;  5T8I A;  2WU5 B;  2GBN A;  4RGO S;  2WNM A;  2UYZ B;  3I5J C;  1YX5 B;  1MHH E;  3T9L A;  3M63 B;  1WJU A;  2QMT A;  2C5L C;  3NS1 A;  1UUP A;  2LAS A;  2I1K A;  3ZNI D;  4WQM A;  4MM3 B;  3QX1 A;  2G1E A;  2LD9 A;  4XE0 A;  1V2Y A;  2M56 B;  1VR9 A;  3RCZ A;  1OEY A;  1R7S A;  4K7W A;  4ZRJ A;  5TSS A;  3VR8 B;  3ZDT A;  3CST A;  2MHJ A;  4ZYN A;  4AS1 A;  4P16 A;  1C9F A;  2MX2 A;  2E3T A;  2MP2 A;  2B76 B;  4US8 A;  5D94 A;  3AM9 A;  2NPT B;  1FIQ A;  3AE7 B;  5AEK B;  5C23 A;  5D2M B;  4C56 C;  4JWU C;  4WJQ A;  3EHV A;  2KFJ A;  3RPF C;  4LCD E;  1SE4 A;  3C19 A;  2YLM A;  2ZNV C;  4ITK A;  1J7A A;  2KQ4 X;  3R66 C;  1V5T A;  3DVN U;  1OFF A;  1DGJ A;  2O2V B;  1HZ6 A;  1FNV A;  3VUW A;  1EWC A;  1UNS A;  1FD6 A;  4PS8 A;  1WGY A;  1IBX B;  2L76 A;  2WXI A;  1GNU A;  1WGG A;  1YNT E;  2L1A A;  4YSX B;  1CK1 A;  2NBV B;  2QCZ A;  2UU7 A;  2JWZ A;  3NZS A;  1LGR A;  2KWC A;  4MSQ B;  3AEE B;  1K53 A;  4JE3 B;  2V1Y A;  1LQB A;  2PTL A;  2MBB B;  2KJR A;  2Z0D B;  1XQQ A;  4US9 A;  4I6P A;  3IAS 1;  3H6N A;  2JY6 A;  1J19 A;  1UZX B;  1SJH D;  1FRD A;  1WF9 A;  5LNK 1;  1E90 A;  2C7N B;  4RF1 A;  3QQ8 B;  1GJZ A;  2MBO A;  2MLB A;  4KVG B;  5D7G A;  1IGD A;  2WWZ A;  1YJI A;  2CKH B;  1PFD A;  3AE5 B;  4DXA B;  1HQR D;  2J42 A;  4LK0 M;  2AQ3 B;  1WXQ A;  2KVZ A;  4MAC A;  3PS6 A;  3A9J A;  1AWD A;  1GB4 A;  3VUX A;  2K6D B;  4N9F 4;  4LNI A;  2VRR B;  2KLC A;  1N6Z A;  1HE8 A;  2G4D B;  2K6Q A;  4HDQ A;  4HRO A;  3GZN I;  2KJH B;  2WX1 A;  2XBB C;  2PJH A;  4MSM B;  1XLQ A;  4UDU C;  3KLS X;  4W9L A;  1EO6 A;  3PZ7 A;  3BZD B;  4A8X C;  3O65 B;  2M0X A;  4IM2 A;  3B2G A;  1SB3 C;  3AEF B;  1JML A;  2CR5 A;  1GAQ B;  1HXY D;  4DXF A;  2JRH A;  2DAJ A;  1Q10 A;  2KWV B;  2MJ3 A;  4WAA A;  4XGA B;  2W54 A;  3UQB A;  1YJ1 A;  1ET9 A;  2VH2 A;  2IGH A;  4ANX A;  5G55 A;  3ZVV A;  1K52 A;  1ISN A;  5E6N A;  3JVZ X;  2ZPN A;  4RM9 A;  3ZLZ A;  2XK5 A;  1NVI D;  3OAW A;  2CHW A;  2WHI A;  3L10 B;  4BVU C;  4DHJ B;  3ML9 A;  5BMG A;  3R3M A;  4M8M A;  2BVC A;  2ZNV B;  3U2S C;  3PTF C;  2BYF A;  3DOW A;  3VAW A;  3AE6 B;  1WMH B;  3UI3 A;  3IHP C;  3RZF A;  1WZ3 A;  4XWW A;  1I7H A;  1U4A A;  3Q69 A;  4BKS D;  4MGY E;  2N9K A;  3C0R B;  4E3C A;  4ZRK A;  5GMV A;  3ZNZ B;  2KMC A;  3BVM A;  3HVZ A;  1YQ3 B;  3ETR A;  2KO3 A;  4HPM B;  2JQR B;  3B1L X;  3VDZ A;  1VRA B;  2WXM A;  2OJW A;  1WGD A;  1C78 A;  1A5R A;  3P4Q B;  4GLS C;  2WXQ A;  4GXB A;  1E8X A;  4P1C C;  3L08 A;  3VRB B;  2RD0 A;  3CIR B;  2JT4 B;  2KDB A;  4ARI A;  1L0X B;  1J0G A;  2PIA A;  3WAP A;  3QAR A;  1TTN A;  4YTM B;  1LM8 B;  1SXT A;  1IGC A;  3DHI C;  3RD2 A;  4MEL A;  1V1P A;  2DBY A;  2RGF A;  4RH6 A;  3VH3 B;  1TKG A;  2WS3 B;  2ZZP B;  1QIL A;  4GB9 A;  3NJT A;  1MHX A;  2MBH A;  2B3A A;  4AWJ A;  4A20 A;  4NAW A;  4JQW C;  2EMS A;  5E6P A;  2ZPY A;  5IKC M;  3N1Y C;  4NNJ B;  2QC8 A;  1SIF A;  5C2T B;  1E9M A;  1UBQ A;  4K7S A;  2FID A;  4W9J A;  4TMA B;  4HLE A;  4KDI C;  4HRS A;  5E6O A;  3Q3O C;  2R2Q A;  1H8C A;  5TR5 A;  2WP9 B;  2KC1 A;  1Z2M A;  2LUE A;  4IKG A;  4NQK E;  3ZRC A;  4P7I A;  4S0R A;  2DNF A;  2XNA C;  4KX6 B;  3RZW C;  1L4D B;  4MDK E;  2Y5P A;  2R61 A;  3RNG C;  1JWS D;  4ZOH C;  2AEH A;  4NAW B;  2R2O A;  2QIL A;  1L6U A;  5EDS A;  1IP9 A;  1MJD A;  3Q3J A;  4MT5 A;  3MFG A;  4OVV A;  3AEC B;  4LNK A;  5L83 A;  2CU3 A;  2EKE C;  1E7U A;  2J0J A;  2G3Q B;  4BOZ B;  2BYV E;  1WXM A;  2INP E;  1FNU A;  4L2Y A;  2IO0 B;  4PYU A;  2GBK A;  2J53 A;  4HCP B;  3I3T B;  3RNF C;  4M01 A;  2RDB C;  4TV3 A;  4WJP A;  2DYO A;  2IJ0 A;  3AE8 B;  2KFK A;  3IG3 A;  5LXI B;  2OHF A;  3BK2 A;  3NY5 A;  4WUR A;  3P63 A;  4H2A A;  1RWS A;  1YJJ A;  2BPS A;  3EA6 A;  2KLG A;  1E8Y A;  1GOZ A;  1TKE A;  4L23 A;  3WA0 A;  2I38 A;  1L6V A;  4I6L B;  1E8W A;  2YVC A;  1FXT B;  4W9H A;  1X1M A;  3KW5 B;  2Z8L A;  4AQ7 A;  1WFY A;  4KZC A;  2ZJD A;  4QAY A;  4AUQ C;  4MGK E;  3T3O A;  3VUY A;  5BYS A;  2KAJ A;  5BMI A;  3R7Q A;  1OEY J;  4OHJ A;  3Q6B A;  4LDT B;  5D6J B;  2BB6 A;  2MA9 B;  2BS2 B;  4KDL B;  3SU8 X;  2FCS A;  2BT6 A;  2L32 A;  2D3A A;  3M3J A;  3FC4 A;  3NVZ A;  2DZM A;  2DYB A;  3HM6 X;  3ZJT A;  4ANW A;  2JVC A;  4NQL B;  2O6V A;  2GB1 A;  1I4Q A;  2MW5 A;  1AYF A;  3NVV A;  2K8H A;  1TS3 A;  2AWT A;  2VZK B;  3H7S A;  2JX5 A;  1IUE A;  1LO5 D;  1C1Y B;  2OOB B;  3EC8 A;  2J7Q B;  1LXD A;  1C3T A;  2LXA A;  2NS5 A;  4HWI B;  3QCA A;  2RMM A;  4KSK C;  2DHZ A;  3VH4 B;  1JCK B;  3TEW A;  1P7F A;  3LJ3 A;  4L1B A;  2K3U A;  1UBI A;  3ZGZ A;  1MG8 A;  3QC8 B;  3NG0 A;  1PGX A;  3DBL B;  1XCQ L;  2IO2 B;  4JWS C;  3ZXR A;  5J17 A;  4LNN A;  1WY8 A;  4LLG M;  3CSF A;  2N7D A;  2BYE A;  4FJY A;  4LNO A;  4J3O D;  5HI1 A;  1F52 A;  4E74 A;  1WX9 A;  3Q3M C;  2V3S A;  5FK9 C;  2LGS A;  2HE7 A;  4TKN A;  5C3J B;  3I57 A;  3DWM A;  2V4I B;  1ET6 A;  4W9G A;  1WR1 A;  2M19 A;  1JQ4 A;  5G5H A;  1WM2 A;  4DK5 A;  4GU2 A;  1WI0 A;  2WDV B;  2J52 A;  2INC C;  4WWN A;  2NBW B;  3QA8 A;  3HVD A;  1ACC A;  5DPR A;  3ZO5 B;  1C79 A;  1S1Q B;  2NVU I;  5AZF A;  3ALB A;  3NOB A;  2JUO A;  3N32 A;  1AW7 A;  4ZRI A;  1B1Z A;  2H89 B;  3DBR I;  3MJW A;  1V1O A;  3KUZ A;  3HUI A;  1ZGU B;  1XLO A;  3PSE B;  3DVG X;  2KHW B;  4ANU A;  2IYD B;  4IWO A;  3IT6 B;  2D3B A;  4WIP A;  4WJO A;  2L00 B;  5KHQ A;  5KHO A;  2AX5 A;  2QSD A;  1VCB A;  2K9X A;  4R3D A;  2JF5 A;  4ACF A;  3JSV A;  3AE1 B;  2N9X A;  2D2Q A;  2N9E B;  4RF0 A;  1C4P A;  4XWT A;  3EEC A;  2K5P A;  3AXC A;  2WXH A;  3SDL C;  2OED A;  2WXN A;  2WXR A;  5I4D A;  4F8C B;  1FCL A;  4LDT D;  1WE6 A;  3M95 A;  3MTN B;  3AEB B;  4HK2 A;  5E6J A;  3ZXV A;  1OTR B;  3OLM D;  1YIW A;  1KLU D;  4IOI E;  4CHK A;  2LGI A;  4NJ7 A;  4ICU A;  2FCN A;  4URK A;  3TBL D;  1P1A A;  2KTF A;  3AE4 B;  3VTV A;  1TZO A;  4HDO A;  2BS4 B;  2NTS A;  2KMA A;  3RN9 C;  1T0Y A;  2PLP A;  2ONQ A;  1WX7 A;  4K81 A;  2KX0 A;  4EOY A;  4G11 A;  4RMA A;  3V62 A;  5G2N A;  4A3O A;  1I4R A;  2KKC A;  4AOF A;  2PPH A;  2CU1 A;  4OZC A;  1GC6 A;  4G50 A;  3DBS A;  1JRO A;  4K3B A;  1TY0 A;  4NJC A;  5JHB A;  2JYT A;  4MGI E;  3L0W B;  3KVF B;  3U8Z A;  5L95 C;  3L13 A;  5HHD G;  4GN1 A;  1WRD B;  2L8J A;  4N6E B;  1YN4 A;  1V8C A;  2CS4 A;  2LJ5 A;  3DDC B;  1J7B A;  4FLH A;  1UEL A;  3V05 A;  1V86 A;  1FCC C;  3V6C B;  1PQS A;  2WXP A;  4NPN A;  3DBH I;  2L05 A;  4FXC A;  2LGX A;  3T3N A;  4RCO A;  1L4Z B;  1TKY A;  1XCT L;  4KZ0 A;  1RLF A;  2OJR A;  1P3Q U;  2LXC A;  3R7R A;  2WLB A;  2ZVO A;  2L7R A;  2BWE S;  4RM8 A;  3RI7 C;  3SR6 A;  1UH6 A;  3EGR A;  1YX6 B;  3LDZ E;  2K39 A;  2AQ2 B;  4YSY B;  3UGB B;  3EFU A;  3VQI A;  1TIF A;  3RMK C;  2KZR A;  3MP9 A;  1PYW D;  2JRI B;  1MI0 A;  2KT7 A;  4KKI A;  4X57 B;  3U4E G;  4EUT A;  5MPO A;  3OG5 A;  1TT5 B;  2ZCB A;  3L17 A;  2BF8 B;  2LHD A;  2PE6 B;  3SFE B;  2MH7 A;  2IY0 B;  1OGW A;  2BYT A;  1TGZ B;  2IY1 B;  1WYW B;  4KV2 A;  1YQ4 B;  1M4V A;  1TJE A;  1Q1O A;  3RNC C;  2YEP B;  2BKF A;  3MC8 A;  2L83 A;  2IZV B;  1VZ7 A;  4LJO B;  4I6N B;  1TYG B;  4MJS B;  2HTM E;  2AL6 A;  4O1N A;  2HDE A;  4GGQ A;  1QOB A;  1L7Y A;  4NJ6 A;  2J0K A;  1T5X D;  4IUM B;  3ZDM C;  1MFW A;  3CF6 E;  3P42 A;  1QT9 A;  4KGT A;  1Q0W B;  2FNJ B;  2J0M A;  2LUM A;  2AQ1 B;  1V81 A;  2KAC A;  3JYU A;  4TUU A;  2NCN A;  3NUH B;  4K3C A;  3AI5 A;  3ZTC A;  3ZTD A;  1KH0 A;  4B9K A;  3FKY A;  2K1F A;  2IO3 B;  2PMV A;  1SEB D;  5DCN A;  5JZE B;  2NBU A;  1UWX A;  1M94 A;  3AU4 A;  3RYT A;  4EZJ A;  1F0Z A;  3AEG B;  3B0A A;  1NI3 A;  3Q2A C;  4MGZ E;  1N5X A;  3HM3 A;  2WQY B;  4A3P A;  4WH4 A;  4NAM A;  3BIN A;  1NBF C;  3EFC A;  3K9P B;  5IN7 A;  2C60 A;  3PVL A;  3W1S A;  1OQQ A;  1CQV A;  1QLB B;  3Q3N C;  3NHE B;  3KYD D;  4GDK B;  4HJK A;  1D5Z C;  3VVW B;  1E8Z A;  3E9S A;  2MWS B;  3P2B A;  1N61 A;  1WMH A;  2GLS A;  2K8B A;  4JLC A;  1S3S G;  1WGH A;  2GI9 A;  4ZRQ A;  3PT2 B;  2DLB A;  4MH0 E;  4B0M A;  4W9F A;  3O13 A;  2GBM A;  3K9O B;  4WWM A;  5FR6 A;  1GUA B;  2RPV A;  3DHH C;  1RYJ A;  1MPE A;  2K8C A;  4TQ0 A;  2GBR A;  1YQB A;  4E71 A;  2QDF A;  1JRP A;  1QOG A;  3ENE A;  3C8Y A;  2YEP F;  5AZH A;  4C00 A;  3GE3 C;  1FFU A;  1PUT A;  2N1V A;  3H9D A;  4II2 B;  3NVY A;  2KDI A;  2KWU B;  3KUD B;  5LLI A;  2O6V B;  4KGS A;  3FIL A;  3PPA A;  4Q2J A;  5BYR A;  1PGA A;  3MHZ A;  3TSS A;  2Y3A A;  3D32 A;  2XN9 C;  3FIL B; 
#chains in the Genus database with same CATH homology
 3M63 B;  2L0T A;  1WJU A;  2N7E A;  2C5L C;  2MW5 A;  2MBE A;  1KLV A;  2K8H A;  3VFK A;  4CYE A;  2AWT A;  2LAS A;  4FA6 A;  2I1K A;  5AZG A;  3H7S A;  3ZNI D;  3PLU A;  4ICV A;  3IFW B;  3QX1 A;  4EZL A;  3VHT C;  2LD9 A;  4IC7 B;  5DPT A;  1C1Y B;  1V2Y A;  2OOB B;  3A9J B;  2BWF A;  3ZRF A;  3EC8 A;  1P98 A;  1RAX A;  2J7Q B;  1LXD A;  3RCZ A;  1C3T A;  2G45 B;  4BKG A;  1OEY A;  2LXA A;  3QHT A;  4W9K A;  4DHJ D;  2NS5 A;  4K7W A;  4ZRJ A;  4BKS A;  4HWI B;  3QCA A;  4KSK C;  3HK0 A;  3WAL A;  2DHZ A;  3A9K B;  5BO4 B;  3VH4 B;  3ZDT A;  3CST A;  4ZYN A;  3LJ3 A;  4G0N B;  1J8C A;  1UBI A;  4JIO U;  5DPW A;  2KXJ A;  1MG8 A;  2ZCC A;  2MX2 A;  3QC8 B;  2MP2 A;  3U7D A;  1E5W A;  4K7U A;  1QZE A;  2N9P C;  1V80 A;  4W9D A;  5D94 A;  1L2N A;  2NPT B;  2IO2 B;  4FJZ A;  5J17 A;  2WYQ A;  3KUC B;  1WY8 A;  3DBL I;  3CSF A;  2N7D A;  2C7M B;  1EF1 A;  2BYE A;  3ZUN A;  5AEK B;  2KQS A;  5D2M B;  5C23 A;  4FJY A;  4G3X B;  4WJQ A;  3EHV A;  2KFJ A;  3PGE A;  4E74 A;  1WX9 A;  4LCD E;  2MQJ A;  2M1M A;  3ZNH B;  2V3S A;  3GOE A;  2HE7 A;  2HTH A;  4TKN A;  2YLM A;  2ZNV C;  3APD A;  3R66 C;  1IYF A;  1V5T A;  3DVN U;  2O2V B;  3KYC D;  2Y5B B;  3VUW A;  4EEW A;  2DYM A;  4W9G A;  1WR1 A;  4PS8 A;  2CHX A;  1WGY A;  2L76 A;  1WM2 A;  2ZEQ A;  2DZI A;  4DK5 A;  4GU2 A;  5J2R A;  1GNU A;  1WI0 A;  1WGG A;  4WWN A;  1R4M I;  2NBW B;  2WX0 A;  3QA8 A;  2V4L A;  2NBV B;  2M4N A;  3A1Q A;  2LI5 A;  3RUI B;  5DPR A;  2JWZ A;  3NZS A;  3ZO5 B;  3PZD A;  2KWC A;  4MSQ B;  4CO7 A;  1P9D U;  1S1Q B;  2NVU I;  3QK0 A;  4KSL C;  5AZF A;  2V1Y A;  1LQB A;  1E7V A;  3ALB A;  3NOB A;  2A4Z A;  2JUO A;  1G6J A;  3N32 A;  2MBB B;  4ZRI A;  3DBR I;  3MJW A;  2KJR A;  2Z0D B;  1XQQ A;  3KUZ A;  4GSW A;  4PYZ A;  1ZGU B;  3PSE B;  4I6P A;  3H6N A;  2JY6 A;  1J19 A;  1UZX B;  3DVG X;  3UF8 A;  2KHW B;  3APC A;  4ANU A;  2IYD B;  3PRM B;  2FIF A;  4IWO A;  2GMI C;  4W9I A;  2LVO A;  1WF9 A;  1E90 A;  2C7N B;  2Z59 B;  4WJO A;  3WAO A;  3QQ8 B;  2KJ6 A;  2L00 B;  3V6E B;  1GJZ A;  5KHQ A;  2MBO A;  2MLB A;  5KHO A;  4AJY B;  2MBQ A;  4KVG B;  5D7G A;  1VCB A;  2WWZ A;  3PHW B;  5CHV C;  1K8R B;  2JF5 A;  2CKH B;  3JSV A;  4GDL A;  2JZZ A;  1F9J A;  1WGR A;  2D2Q A;  2BGF A;  2N9E B;  2N9X A;  1D3Z A;  3ZKJ C;  5CHF A;  4B95 A;  4WJN A;  3VTU A;  3EEC A;  3A9K A;  3AXC A;  4FHJ A;  2IBI B;  2NR2 A;  3SDL C;  4ANV A;  3ZW3 A;  4DXA B;  2HD5 B;  2N1W A;  1WE7 A;  1R4N I;  4F8C B;  2LRW A;  1I35 A;  4LDT D;  1WE6 A;  2FCM A;  4FUL A;  3M95 A;  1WIA A;  3ONS A;  3MTN B;  2XEW A;  3PS6 A;  3A9J A;  4HK2 A;  5J18 A;  1I42 A;  5HKH A;  1XT9 B;  3X0W A;  3VUX A;  2K6D B;  1OTR B;  4N9F 4;  3OLM D;  2VRR B;  4FN2 A;  1YIW A;  3N3K B;  4CHK A;  2KLC A;  3H7P A;  3QIJ A;  1HE8 A;  2G4D B;  2K6Q A;  3NZU A;  1WM3 A;  3TL5 A;  4HDQ A;  3GZN I;  4NJ7 A;  3Q3F A;  2FCN A;  2KJH B;  4ICU A;  4HVB A;  2WX1 A;  2XBB C;  4URK A;  3TBL D;  1P1A A;  2PJH A;  1WZ0 A;  2KTF A;  3QWZ B;  1KM7 A;  2KDF B;  3VTV A;  2O2V A;  4HDO A;  1V5O A;  2RSU A;  4MSM B;  3JW0 X;  3PRZ A;  2KMA A;  1T0Y A;  4WWP A;  4DDI D;  1WX7 A;  5DPS A;  3PV1 A;  4AP4 C;  3IBE A;  4K81 A;  4W9L A;  2KX0 A;  4HPL B;  1EO6 A;  4EOY A;  2D10 A;  4G11 A;  4FHK A;  2GOW A;  1WJ4 A;  4FBJ B;  3QJZ A;  4RMA A;  3V62 A;  2DX5 B;  5JHA A;  3O65 B;  5G2N A;  3X23 A;  4A3O A;  2M0X A;  4IM2 A;  2KKC A;  4AOF A;  2PPH A;  2CU1 A;  2PEA A;  1GC6 A;  3DVG Y;  2CR5 A;  2LZ6 A;  3PLV A;  3WAM A;  4G50 A;  5LXH A;  2JRH A;  2DAJ A;  3APF A;  3DBS A;  2KWV B;  4EZK A;  2L3Z A;  4WAA A;  2IO1 B;  5JHB A;  3UQB A;  3VXW A;  1YJ1 A;  4MGI E;  2L0F A;  3L0W B;  1WXA A;  3KVF B;  2HJ8 A;  3U8Z A;  4XC2 A;  1UGM A;  5L95 C;  3L13 A;  4ANX A;  3DCG A;  5G55 A;  3ZVV A;  2KVR A;  2AL3 A;  1ISN A;  1WRD B;  4GN1 A;  2BKR B;  2L8J A;  3JVZ X;  5E6N A;  2ZPN A;  4RM9 A;  3ZLZ A;  2CS4 A;  2LJ5 A;  2LVQ A;  2XK5 A;  3DDC B;  4FLH A;  1UEL A;  3IVF A;  3OAW A;  2CHW A;  3L10 B;  1V86 A;  4B6W A;  3V6C B;  4BVU C;  3ML9 A;  4DHJ B;  3A4S C;  3R3M A;  1WH3 A;  1PQS A;  4M8M A;  3H7P B;  3ZIM A;  3UIO B;  4NPN A;  2ZNV B;  3DBH I;  2L05 A;  3PTF C;  1JRU A;  2DEN B;  4PS3 A;  2BYF A;  2LGX A;  3DOW A;  3VAW A;  3T8M A;  1WMH B;  4IWQ A;  5JH5 C;  2JZ3 B;  3IHP C;  3RZF A;  4FJV B;  1WZ3 A;  2KC2 A;  1U4A A;  3TCA A;  4BKS D;  5CX3 A;  4MGY E;  2FCQ A;  3HIZ A;  3TIX A;  4KZ0 A;  3C0R B;  4E3C A;  4ZRK A;  5GMV A;  1RLF A;  3ZNZ B;  2OJR A;  2KMC A;  4II3 B;  2REX A;  3ECI A;  1P3Q U;  2LXC A;  3R7R A;  2KO3 A;  4HPM B;  4HCN B;  3VTW A;  2ZVO A;  4MM3 A;  4DHZ B;  4OVU A;  3B1L X;  3VDZ A;  2L7R A;  2BWE S;  4RM8 A;  1WGD A;  2O6V D;  3L16 A;  2NPT A;  4IM0 A;  2KNB A;  1WJ6 A;  1A5R A;  2Z0E B;  1UH6 A;  2XK5 B;  3ML8 A;  3W1Y A;  2KK8 A;  3OJ4 B;  1YX6 B;  2LRU A;  3LDZ E;  1WX8 A;  4GXB A;  2K39 A;  3SD5 A;  4GOC A;  1E8X A;  3SHQ A;  2C7H A;  3L08 A;  4WWO A;  3EFU A;  3UGB B;  3VQI A;  2MCN B;  2KZR A;  2K25 A;  2RD0 A;  1AAR A;  2JT4 B;  2KDB A;  2JRI B;  1J0G A;  1V6E A;  3WAP A;  2MSE D;  1WJN A;  3QAR A;  4MJS A;  4X57 B;  4EUT A;  4GDK A;  1TTN A;  2ZCB A;  3L17 A;  2BF8 B;  4GIV A;  2PE6 B;  2MRP A;  1LM8 B;  2LVP A;  2IY0 B;  3RD2 A;  4MEL A;  4LJP B;  3UIP B;  3PRE A;  4WQO B;  1OGW A;  1VD2 A;  1TGZ B;  2WDT B;  2RGF A;  2IY1 B;  1WYW B;  2D07 B;  4F1S A;  3VH3 B;  4KV2 A;  3AUL A;  2ZZP B;  2RR9 A;  3UIN B;  1OQY A;  1TBE A;  1ZKH A;  4MEM A;  4GB9 A;  1Q1O A;  3M62 B;  1Z5S B;  1SGH A;  3H1U A;  2MBH A;  2B3A A;  3A33 B;  3WAN A;  4AWJ A;  4A20 A;  4NAW A;  4TQ1 A;  2MP2 B;  4GMV A;  3CMM B;  2I1J A;  2D11 A;  2BKF A;  1XD3 B;  4JQW C;  2EMS A;  5CHW A;  5E6P A;  4IG7 B;  2IZV B;  4ZDV A;  1UD7 A;  2ZPY A;  4LJO B;  4NNJ B;  3V60 A;  4I6N B;  1SIF A;  4ASW C;  1UBQ A;  4K7S A;  4MJS B;  2FID A;  3PHX B;  2LGD A;  4W9J A;  4HLE A;  4KDI C;  2AL6 A;  5E6O A;  1H8C A;  2R2Q A;  5TR5 A;  4GGQ A;  2KC1 A;  4XX5 A;  4DHZ E;  1L7Y A;  3N30 A;  4NJ6 A;  1Z2M A;  2J0K A;  2LUE A;  4W9E A;  4NQK E;  3ZRC A;  2UWQ A;  4IUM B;  3TJP A;  3ZDM C;  3OJ3 A;  4P7I A;  2KQ7 A;  3RUL A;  3CF6 E;  1KOT A;  3ZNG C;  2W9N A;  4AJW A;  5C1Z A;  3AU5 A;  1V9J A;  4PS7 A;  3RZW C;  4MDK E;  2ZVN A;  1Q0W B;  2KAN A;  2FNJ B;  2J0M A;  2M8S A;  1V81 A;  3JYU A;  4TUU A;  4DDG D;  2NCN A;  3AI5 A;  1RRB A;  2AEH A;  4NAW B;  2JXX A;  2R2O A;  3V61 A;  3ZTC A;  3ZTD A;  4B9K A;  1LFD A;  1CMX B;  5EDS A;  2K1F A;  1IP9 A;  4DBG A;  4IM3 A;  3Q3J A;  2KX3 A;  2IO3 B;  5DCN A;  5JZE B;  2NBU A;  4OVV A;  3B08 A;  4IW0 A;  1M94 A;  3AU4 A;  2N4F A;  2PE9 A;  3RYT A;  4EZJ A;  5L83 A;  4NY0 A;  2EKE C;  2FAZ A;  3B0A A;  1E7U A;  4GDL B;  2J0J A;  4J6I A;  4MGZ E;  2G3Q B;  3NS8 A;  2GBJ A;  1WXS A;  4BOZ B;  3HM3 A;  2BYV E;  1EF5 A;  1WXM A;  4FAD A;  4A3P A;  2CHZ A;  2IO0 B;  1ZW7 A;  1NI2 A;  2RPQ A;  3BIN A;  1NBF C;  4PYU A;  4EFO A;  2EMT A;  3K9P B;  2DAF A;  2GBK A;  2C60 A;  2QHO A;  3PVL A;  3W1S A;  1IPG A;  4HCP B;  3I3T B;  1NDD A;  3NHE B;  4YL8 A;  3KYD D;  4GDK B;  4HXD A;  4TV3 A;  4WJP A;  2DYO A;  3MHS D;  4BBN F;  4HJK A;  4DWF A;  3VVW B;  4BKT A;  1RFA A;  1E8Z A;  1TZ1 A;  2MWS B;  3P2B A;  4IWP A;  2KFK A;  3JSV B;  1WMH A;  3IG3 A;  5CTR C;  2K8B A;  1H4R A;  2KTR A;  4F7Z A;  5LXI B;  4KIK B;  1GC7 A;  1KJT A;  1S3S G;  1WGH A;  3NY5 A;  4JLC A;  5IAA C;  3U30 A;  1WR6 E;  4BFR A;  2AYO B;  3HHM A;  2DZJ A;  3PT2 B;  4MH0 E;  3RT3 B;  2BPS A;  2KFK B;  2JPH A;  4W9F A;  1SE9 A;  2KLG A;  1E8Y A;  2KTR B;  3DVN V;  2GBM A;  4KIK A;  3WA0 A;  2KDE B;  3K9O B;  1Y8R C;  5FR6 A;  1GUA B;  4I6L B;  4BOS C;  2K8C A;  1E8W A;  4TQ0 A;  2GBR A;  3W1S C;  1YQB A;  2YVC A;  1FXT B;  1YD8 U;  1X1M A;  2A5U A;  4W9H A;  3KW5 B;  4E71 A;  2FUH B;  4W9C A;  4JL9 A;  2KN5 A;  5IA7 A;  3A4R A;  2D3G A;  3ENE A;  1WFY A;  3QAQ A;  4KZC A;  5AZH A;  2ZJD A;  3WIM A;  3UQA A;  3L54 A;  2M17 A;  1WXV A;  3TMP B;  4AUQ C;  4EKU A;  4M0W B;  4MGK E;  2N1V A;  3H9D A;  1BT0 A;  3VUY A;  3PRP B;  4II2 B;  2DZK A;  2LWP A;  2KDI A;  3KH0 A;  3DPD A;  1OEY J;  2C9W B;  4JGH B;  3R7Q A;  3S2A A;  2KWU B;  1GG3 A;  2ASQ A;  4LDT B;  3DQV A;  5D6J B;  3A1Q B;  3BY4 B;  3KUD B;  5LLI A;  2MA9 B;  4M8N A;  4K1R B;  1EUV B;  4KDL B;  2KOX A;  2O6V B;  2G4S A;  3SU8 X;  2FCS A;  4XZ4 A;  3M3J A;  3PPA A;  4BBN C;  1Q5W B;  2LGY A;  2KD0 A;  1V49 A;  2DZM A;  2DYB A;  1P0R A;  3HM6 X;  4ANW A;  2GBN A;  2JVC A;  4NQL B;  2UYZ B;  1YX5 B;  2O6V A;  3D32 A;  3T9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...