1KLVA

Solution structure and backbone dynamics of gabarap, gabaa receptor associated protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
GEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1H, 13C and '5N resonance assignments of GABARAP, GABAA receptor associated protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords GABA(A) Receptor associated protein
total genus 12
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2001-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1klvA00
1Y8RC 2CKHB 1M94A 2FCNA 3APFA 4TQ0A 4PS8A 3ZRCA 2G4DB 1MG8A 5TR5A 1TBEA 3PS6A 2LGXA 1VCBA 2KZRA 4ANUA 4K7SA 1P1AA 3D32A 4EZJA 1V5OA 3ZNGC 2C5LC 1EF1A 3WAPA 3QHTA 4WQOB 1WJUA 1WXSA 5JHAA 4AJYB 1IPGA 2D10A 2KOXA 2IO1B 4BFRA 3ZRFA 5D2MB 2NS5A 3VH3B 2EKEC 4DDID 1Q5WB 1EO6A 1P9DU 4G0NB 1RFAA 3QIJA 1S3SG 3O65B 1GUAB 3VUWA 5IA7A 3M95A 3N30A 4W9GA 2GBJA 2JZZA 2LRUA 4CO7A 1WM2A 2MBQA 2KD0A 3GZNI 3PLVA 4MGKE 1I35A 4B95A 4BKSA 2K6QA 2PE9A 4GXBA 4P7IA 1GNUA 2DHZA 4ICUA 2JVCA 3KYCD 3PVLA 1Q1OA 1K8RB 3B08A 3ZUNA 1YD8U 2MWSB 2NBVB 2GOWA 4M8NA 3UINB 4FBJB 1G6JA 3K9PB 1YX5B 3H1UA 2N7EA 3H9DA 3MTNB 2CS4A 4HDOA 2MBOA 2CHXA 2C60A 1WXMA 2UYZB 2L05A 1L7YA 1V80A 3AULA 3ECIA 3EFUA 3H7PB 2LZ6A 2N4FA 2NBUA 1SIFA 2EMTA 2ZNVC 2O6VB 2LWPA 3A9KA 4ZRIA 2BWES 4I6PA 2ZJDA 1E5WA 2GBMA 2KVRA 2NPTB 1YQBA 2L7RA 3EC8A 1WMHB 4PYZA 2FIFA 2Z0EB 4B9KA 4MGIE 4DHZE 5G2NA 1VD2A 3PHXB 2WX0A 1X1MA 3ZDTA 1NDDA 2MCNB 4IG7B 4BKGA 4IW0A 2BKFA 2KN5A 2FCSA 3V60A 4CYEA 3BY4B 1FXTB 2FCQA 2L8JA 3HK0A 3ONSA 4GDLA 5KHQA 3KUZA 2HD5B 3A9JA 2KWUB 3ML9A 2LGYA 2K25A 4PYUA 3TMPB 3WIMA 4E3CA 1WRDB 3W1SC 4W9CA 2R2QA 3ZO5B 4RM9A 1WE6A 5E6PA 4ZDVA 2DAJA 3H7SA 3T9LA 2J7QB 2KJRA 3DBLI 4B6WA 4DBGA 4MSQB 1WI0A 1GJZA 4BKTA 4JIOU 4J6IA 4XX5A 3ZDMC 2V3SA 2BWFA 2MQJA 4KIKA 2GMIC 2LASA 3TCAA 5HKHA 3IHPC 3M62B 2CHZA 4KDIC 1UH6A 2D2QA 3KUCB 4IWOA 5DPRA 4WWPA 4F1SA 2IZVB 1V5TA 4K81A 4GIVA 1Z5SB 4GGQA 3OLMD 5CTRC 3CSFA 3PTFC 2K39A 4TQ1A 5J18A 1ZKHA 2DZJA 2FUHB 3VAWA 1J19A 2V1YA 1RAXA 3VUYA 2ZEQA 5DPSA 2Y5BB 4W9JA 5AZFA 5CHFA 3V62A 2RR9A 3A4RA 1E8ZA 2M4NA 4MSMB 2PJHA 5KHOA 4A3OA 2N1WA 1WXVA 2JWZA 4JGHB 2KQSA 3RZWC 4BBNF 1BT0A 1OTRB 2M17A 4IM0A 2KJHB 2AYOB 2BGFA 2RSUA 1R4NI 4ANWA 4EZKA 3V6CB 2BF8B 3P2BA 3PV1A 3TL5A 4HCNB 4LCDE 4DHJB 2KJ6A 4BOSC 1EUVB 2MBHA 4WWNA 1OQYA 1YJ1A 2LVPA 4MELA 4PS3A 4IC7B 3GOEA 1UBQA 4FA6A 4TKNA 4WJPA 4A20A 4DDGD 4AWJA 4W9DA 4EKUA 1KM7A 2LJ5A 2REXA 3MHSD 4MEMA 3NS8A 5CHWA 4MJSA 3VTWA 3R3MA 5D94A 5FR6A 1ZW7A 1Z2MA 1U4AA 3AU5A 1IYFA 3L0WB 3VQIA 2RGFA 3CSTA 4IUMB 3ZIMA 3X0WA 1GG3A 1P0RA 3CF6E 2NR2A 1TTNA 4I6NB 4YL8A 3W1SA 2ZVNA 3DVNU 5DPWA 3W1YA 5JZEB 3L16A 1P3QU 3B1LX 4M0WB 4KVGB 1J0GA 2G3QB 2K8CA 3EECA 5AZGA 1I42A 2PEAA 2KX3A 2DZKA 3H6NA 3S2AA 4HJKA 2ZPNA 1NI2A 4FULA 4GB9A 1CMXB 2N1VA 2DYBA 5JHBA 3PPAA 3RZFA 3DDCB 2JXXA 4ZRJA 4A3PA 2IO0B 2JRIB 2K8HA 2KC1A 2DAFA 3L08A 3AU4A 4TV3A 2CR5A 1V81A 3H7PA 3JSVB 2LXAA 2AWTA 4K1RB 2KFKB 2NBWB 2KKCA 5BO4B 2B3AA 2FCMA 4HXDA 1OEYJ 4HVBA 2MBEA 5E6OA 2KLCA 4AJWA 2KDEB 4G3XB 4GSWA 3UIPB 3NHEB 2J0MA 1WY8A 3Q3JA 1SE9A 1WGRA 2IBIB 4M8MA 3PHWB 5C23A 3HIZA 2KWCA 1KOTA 3C0RB 3DVNV 5E6NA 4KZ0A 3R7RA 5IAAC 1V9JA 1KLVA 2R2OA 4E71A 4MJSB 2KMAA 4IM3A 3UQAA 4XC2A 4FHKA 4AUQC 2WYQA 4K7WA 5AZHA 1YIWA 3HM6X 3QA8A 1C1YB 4HCPB 4KDLB 5J2RA 4MGZE 3NZUA 1AARA 2BYFA 4MGYE 4HDQA 4II3B 3IVFA 1LFDA 2BPSA 2CU1A 2NVUI 4W9FA 3L54A 2MW5A 2EMSA 1WF9A 1L2NA 2KTRB 2MP2B 2MX2A 3DVGX 2NCNA 2A4ZA 2ZNVB 3IBEA 3QX1A 4XZ4A 2UWQA 4OVVA 3ENEA 2JPHA 2RPQA 3SD5A 1WR1A 2N9PC 4HK2A 2KMCA 4W9EA 3A33B 2MBBB 3N32A 3PGEA 3VTVA 1D3ZA 2HTHA 4NJ6A 2XBBC 2D07B 2M8SA 2V4LA 1Q0WB 4NNJB 3U7DA 2AL6A 4URKA 2O2VA 2WX1A 3WAMA 3PZDA 3I3TB 2LVQA 4MH0E 2AEHA 2IO2B 3PSEB 3JYUA 4HPMB 3BINA 4RM8A 4NPNA 3APCA 4NY0A 4EUTA 1TGZB 3A1QA 4ZRKA 1E8WA 1WGYA 3DBSA 1UGMA 4KZCA 2QHOA 4JL9A 2XK5A 3WA0A 2C9WB 2MSED 2L76A 1XD3B 4W9LA 3KH0A 1HE8A 4NAWB 1WH3A 2JUOA 4FJVB 4EEWA 3IFWB 3PREA 3OAWA 3DQVA 2ZVOA 3V61A 4BVUC 2LXCA 3PRMB 3UIOB 1WGHA 3RYTA 2KFJA 4DK5A 3TJPA 3QQ8B 5D6JB 2K8BA 2JF5A 5CHVC 4DXAB 1WJ6A 1UZXB 1WE7A 1A5RA 3AI5A 2GBNA 2D3GA 4FLHA 3L13A 3VTUA 4GDLB 3K9OB 1LM8B 2L3ZA 1WIAA 3UF8A 2FIDA 4CHKA 2LI5A 2PPHA 1UBIA 2KO3A 3B0AA 4PS7A 4MM3A 2WDTB 3DOWA 3RD2A 2HE7A 1S1QB 2KX0A 3QK0A 5LXIB 4NJ7A 2KDBA 2A5UA 3VH4B 2KNBA 1WYWB 2OJRA 2RD0A 4NQLB 2BYVE 3JW0X 4JQWC 2C7MB 4W9KA 3WALA 2M0XA 3SHQA 1GC7A 3NOBA 1RRBA 4ICVA 3A4SC 3SU8X 3RCZA 4N9F4 2DZIA 3TBLD 2JRHA 2MRPA 4BOZB 5EDSA 4GN1A 4DHZB 2I1JA 1JRUA 5DPTA 2YLMA 3PRZA 4KIKB 4DWFA 3WANA 4K7UA 3VDZA 2IY0B 2BYEA 3L17A 3ZNZB 3EHVA 2JY6A 1E8XA 4LJPB 3V6EB 4LDTD 3LDZE 2Z59B 2DX5B 1NBFC 2N7DA 4LJOB 1WR6E 2D11A 1KJTA 3QC8B 5J17A 1WX7A 1QZEA 3DCGA 3JVZX 3KVFB 2JZ3B 3QWZB 3HHMA 1WM3A 1E7UA 1T0YA 1WX8A 5L83A 4FN2A 4X57B 3A9JB 4EFOA 1PQSA 1OEYA 4W9HA 1YX6B 3U30A 3ZVVA 5LLIA 3RUIB 1RLFA 4G50A 3A1QB 2MA9B 3UGBB 4WJQA 3M63B 3QCAA 2MLBA 1V6EA 2KXJA 1WFYA 3WAOA 3ZNID 3ML8A 3IG3A 1UELA 2N9XA 4TUUA 1WMHA 2NPTA 4BKSD 3HM3A 4HPLB 2ZZPB 2O6VA 3PLUA 1WGGA 2VRRB 3OJ3A 4JLCA 2Z0DB 3DBHI 2LRWA 1GC6A 4FJZA 2KTFA 3A9KB 3X23A 3UQBA 1TZ1A 5DCNA 3NY5A 4NQKE 4I6LB 2W9NA 1LQBA 2DENB 2IO3B 1XQQA 2JT4B 4ZYNA 2L00B 3R66C 2KK8A 4W9IA 4FJYA 2KC2A 3ZW3A 4WJNA 4BBNC 3LJ3A 3ZTDA 3QAQA 1E90A 2ZCBA 4ANVA 1WX9A 3MJWA 1IP9A 2OOBB 2AL3A 1V86A 3OJ4B 2KHWB 4GDKB 2L0FA 4KV2A 4F7ZA 2WWZA 1R4MI 2GBKA 4G11A 1E7VA 3RT3B 4ANXA 2K1FA 1WZ0A 2KANA 1OGWA 3VVWB 4HLEA 2O6VD 3AXCA 3ALBA 4NAWA 4MDKE 1UD7A 5JH5C 4WAAA 3KYDD 2KDFB 4II2B 4ASWC 1E8YA 2N9EB 3QARA 1H4RA 5LXHA 5D7GA 1WGDA 3Q3FA 4DHJD 2BKRB 2XK5B 1J8CA 2FAZA 2CHWA 2KFKA 2KDIA 3VUXA 2XEWA 4EZLA 3VHTC 4GOCA 2C7NB 3U8ZA 4KSLC 3T8MA 2C7HA 5GMVA 3ZNHB 1WZ3A 3PT2B 3DVGY 4HWIB 4IWPA 2O2VB 1ZGUB 4IWQA 2J0JA 4WJOA 4EOYA 1H8CA 5C1ZA 2DYMA 2YVCA 2M1MA 2L0TA 4FADA 3PRPB 2IY1B 1ISNA 4E74A 1EF5A 5L95C 1F9JA 2DZMA 3TIXA 2KTRA 2MP2A 2LVOA 1WJ4A 3KUDB 2HJ8A 4F8CB 2FNJB 1P98A 3R7QA 3VFKA 4GMVA 2K6DB 2KLGA 4LDTB 4FHJA 3VXWA 4IM2A 3SDLC 4WWOA 2J0KA 4RMAA 2IYDB 3QJZA 3M3JA 3KW5B 3ZTCA 3DPDA 3ZLZA 3N3KB 4KSKC 2ZPYA 4OVUA 5AEKB 1C3TA 2ASQA 1V2YA 2ZCCA 3CMMB 3ZKJC 3APDA 1V49A 2KQ7A 4GDKA 2PE6B 1WJNA 2KWVB 1XT9B 4GU2A 1WXAA 1SGHA 2LD9A 5G55A 1LXDA 3RULA 4AOFA 2G4SA 5CX3A 2GBRA 4AP4C 2LUEA 2DYOA 2G45B 3JSVA 3DBRI 2LGDA 2I1KA 3NZSA 3L10B
chains in the Genus database with same CATH superfamily
3Q8CA 3APFA 1PUTA 1TBEA 2BS3B 1N63A 1VCBA 2LGXA 1E10A 4XDCA 1VZ8A 3D32A 2C5LC 3WAPA 2V4IB 4WQOB 1D5MC 5JHAA 4BFRA 4KKIA 5H8YE 1Q5WB 1EO6A 4G0NB 3NVZA 4ITKA 2GI9A 5IA7A 2GBJA 4MGKE 1I35A 4P7IA 3PVLA 3ZUNA 4WQMA 3K9PB 3CWIA 2CS4A 1L0YB 4JE3B 2MBOA 5E6JA 3P4QB 2C60A 1QKZA 1V80A 3H7PB 2PVGC 2LZ6A 2ZNVC 1VZ6A 1AWDA 4ZRIA 4I6PA 2EKIA 2ZJDA 4S17A 3FILB 1YQBA 1WMHB 5JXVA 2Z0EB 5TSSA 3W2DA 3OG5A 1XEEA 4BKGA 3N9YC 4CYEA 3BY4B 1FXTB 2L8JA 1EWCA 3V05A 1XLPA 2HD5B 2LGYA 2MJEA 3GE8C 3U7ZA 4PYUA 2M0AA 4E3CA 3ZO5B 1T0QC 1WE6A 5E6PA 1B1ZA 1GOZA 1QT9A 3DBLI 2VZKD 4BKTA 4J6IA 4XX5A 3C8YA 2V3SA 2LASA 5HKHA 4KKJA 2CHZA 4ZHPA 2D2QA 1PDXA 1NENB 4WWPA 5DPRA 3OLMD 3PTFC 5J18A 1RAXA 3VUYA 1PGBA 2Y5BB 1SE3A 5CHFA 4ZRQA 2ONQA 3V62A 2RR9A 3AV8A 4A3OA 1WXVA 1SJHD 3GB1A 1N61A 1OTRB 2KJHB 1YN4A 1K51A 2BF8B 3TL5A 1ZDXA 4KX6B 4A55A 2MBHA 2LVPA 3AE1B 4PS3A 1V1OA 4IC7B 5G5GA 1AW7A 1FNVA 4WJPA 2REXA 4OZCA 3MHSD 3SR6A 2K0PA 3U52E 3RNBC 4KGTA 2B76B 1Z2MA 1U4AA 4MACA 3VQIA 2RGFA 3CSTA 2QCZA 1GG3A 3Q8AA 1TTNA 5FKAC 1WYGA 2PW9A 4LNIA 5EE9A 2WP9B 1F0ZA 5DPWA 5JZEB 1J0GA 2G3QB 2KX3A 3EA6A 3PO0A 3S2AA 4LNFA 3J9CA 5HFYA 3DDCB 1XO3A 3NG0A 2IO0B 2K8HA 2DAFA 2SAKA 3AU4A 2CR5A 1Q10A 2KKCA 2FCMA 2LJIA 4OW0A 1FPYA 4AJWA 1NVID 3NHEB 4LNNA 1SE9A 1OFFA 4M8MA 3HIZA 3BWUD 3Q6BA 4KZ0A 1V9JA 1KLVA 1SSNA 2BS2B 2J52A 2N0SB 3TEWA 2WYQA 4XDDA 2BYFA 3DWGC 3IVFA 2BPSA 2NVUI 1RYJA 2MW5A 2EMSA 1L2NA 2NCNA 2N9LA 4XYCA 3IBEA 2J42A 2JPHA 4HK2A 4W9EA 2MBBB 3N32A 2HTHA 1MFWA 3WAMA 2H89B 1XCQL 2WX1A 1TIFA 3N1YC 4RM8A 3DWMA 3APCA 4NY0A 2QEJC 1JALA 1TGZB 3A1QA 4ZRKA 1E8WA 3KH0A 1MHXA 3IFWB 1FD6A 1NYRA 2LMCA 3V61A 2LXCA 2WDRB 2N7JA 3RI7C 2LFIA 2RDHA 5D6JB 4ARCA 3SFDB 1WJ6A 1TS2A 2GBNA 2Y5CA 4AS1A 4RFBA 2KO3A 2WXHA 3DOWA 1ZPSA 3AM9A 2KX0A 3AEFB 3QK0A 4NJ7A 2KDBA 3JW0X 2C7MB 3WALA 3NOBA 1SE4A 3PZ7A 4N6EB 3RNEC 4A6QA 4DWFA 3WANA 3L17A 1XLQA 1CK1A 3MC8A 3LDZE 1IBXA 2D11A 1K52A 3ZQ4A 3JVZX 1FO4A 5L83A 2JX5A 3LXFA 4IKGA 3RNGC 1L4ZB 3AEEB 3RUIB 1RLFA 2NTSA 3UGBB 1V6EA 1OQQA 3ZNID 4D2KA 1RFKA 3HM3A 1MHHE 4ACFA 2Z0DB 2WS3B 2LRWA 2INPE 2KTFA 3A9KB 3UQBA 5DCNA 5AUIA 4NQKE 3AEBB 1LQBA 2DENB 1EU4A 4DXGA 2KK8A 2SEBD 1AYFA 5HHDG 5GXGB 3ZTDA 3QAQA 4ANVA 1WX9A 3MJWA 1L5PA 3B2GA 2AL3A 2OHFA 4ZOHC 3RT3B 1YQ3B 2Q5WD 3VVWB 2XNAC 2O6VD 3AXCA 2I2YA 3KYDD 2KDFB 1PFDA 4ASWC 5LXHA 5EE3A 5D7GA 4DHJD 3Q3FA 3NS1A 2KFKA 5C3JB 3VHTC 1C77A 4KSLC 3T8MA 4QAYA 1R7SA 2C7HA 3PT2B 1ZGUB 2J53A 5C1ZA 2YVCA 1ISNA 3BK2A 3Q14C 1F9JA 2DZMA 4F8CB 3E56A 2ZW0A 3VFKA 3Q3OC 2KLGA 4LDTB 4FHJA 3MP9A 4IM2A 4WURA 3UI3A 3ZTCA 1HTOA 5AEKB 1J7AA 3ZKJC 2PE6B 1WJNA 2KWVB 3TEYA 2G4SA 3RMKC 1TJEA 3L10B 1I4HA 4PS8A 5TR5A 3PS6A 1L4DB 4ANUA 4TSSA 1P1AA 1V5OA 4KGSA 1IGDA 3QHTA 1WJUA 4LNOA 4AJYB 1IPGA 2IO1B 4DDID 2EKEC 1P9DU 1T6BX 1PGAA 2DNFA 1GUAB 1LO5D 4W9GA 5BYQA 2LRUA 4CO7A 3PLVA 2MJDA 3Q8BA 4B95A 2WU2B 4GXBA 3IXSA 4IDIA 4ICUA 1IBXB 2JVCA 2I38A 1P7EA 1UNSA 1K8RB 2W55A 4HDOA 4ZHOA 3BVGA 1L7YA 3EFUA 2YEPF 2JXTA 2NBUA 2EMTA 3AE2B 4RNAA 3RNFC 1SE2A 2D3BA 4PYZA 1L6VA 4B9KA 3AE9B 3ZDTA 1X1MA 1NDDA 2MCNB 2WDQB 4IW0A 2BKFA 2FCQA 3ONSA 1VR9A 1MPEA 3A9JA 3ML9A 1KF6B 2DAJA 3H7SA 4O1NA 2J7QB 4B0MA 2KJRA 4B6WA 1WI0A 5LNK1 1A70A 1D5ZC 1OQRA 1YNTE 2BWFA 3URYA 4KIKA 1UH6A 4K81A 5CTRC 2FBWB 2DZJA 2FUHB 3VAWA 1J19A 1V1PB 5DPSA 2KQ4X 3AE8B 1TS5A 4JGHB 1UWXA 4IM0A 1BT0A 1XXGA 4ANWA 2AYOB 2WXGA 3KWVA 3PV1A 2OEDA 4OVZA 2D3CA 1MVKA 1J7CA 2KJ6A 1OQYA 1YJ1A 1JW9D 4DDGD 2RPVA 3TEXA 2LJ5A 4LNKA 2L83A 4K3BA 5IOIA 4XWWA 3R3MA 1ZW7A 3AU5A 1IYFA 3L0WB 1YJJA 3ZIMA 4Q2JA 1P0RA 1TS3A 4YL8A 1SIJA 2K22A 4RGOS 4WH4A 5AUKA 2JYTA 3B1LX 1KH0A 1CQVA 2K8CA 3EECA 2BYTA 2FE8A 2WDVB 2ZPNA 2N1VA 1YJIA 4ZRJA 2KC1A 1QOGA 1YOVB 4TV3A 4M01A 2DBYA 4LTUA 2E3TA 2NBWB 5BO4B 2B3AA 5BMIA 1OEYJ 3FKYA 4HVBA 2PLPA 2WXIA 1RM6C 1AN8A 2KDEB 4FXCA 4GSWA 1C78A 1WGRA 3U4EG 1R4NB 2KWCA 4YTNB 1T5XD 3R7RA 4E71A 4IM3A 3GS2A 4XC2A 4K7WA 4KDLB 3QA8A 5J2RA 1F2RC 3NZUA 2W54A 3MFGA 1CJEA 4MH8A 2CU1A 5H92C 4EE2A 5FK9C 3LYYA 5T8IA 2MX2A 3U2SC 1IUEA 2ZNVB 3ZXVA 3QX1A 4S0RA 2IGHA 2UWQA 2RPQA 3SD5A 2KACA 1WR1A 3AEDB 4NJCA 3IT4B 3PGEA 3VTVA 3DHHC 2XBBC 2D07B 3B9JA 2M8SA 1Q0WB 1R4MB 3U7DA 3C19A 3ETRA 3I3TB 2PMVA 3PSEB 3JYUA 1JWUD 1WGYA 3DBSA 3WA0A 2C9WB 2MSED 3AE3B 4WAFA 4C7ZA 4ZYSA 1VRAB 1UUPA 3EGRA 3PRMB 1SF0A 3RYTA 4HPPA 1FFUA 4DK5A 2K8BA 4HROA 5CHVC 4OZBA 2WXQA 4JPSA 1T0SC 4FLHA 2UU7A 3L13A 3K9OB 2VZKB 1QQRA 2FIDA 1L6UA 2K9XA 2WDTB 3RD2A 1S1QB 3DBHB 5LXIB 3FILA 3VH4B 2OJRA 2RD0A 2BYVE 2HJ1A 2QMTA 1TY2A 4JQWC 4W9KA 4YTMB 2WXNA 1GC7A 1QOAA 3A4SC 3RCZA 4BOZB 2DZIA 2JRHA 2MRPA 5DPTA 3VDZA 3ZNZB 1E8XA 2DX5B 1NBFC 1EU3A 5J17A 1WX7A 1QZEA 1MG4A 5BMGA 1JROA 2JZ3B 1WM3A 1T0YA 3RFZB 1EWYC 2CU3A 3HRDD 1OEYA 2X38A 4W9HA 1YX6B 3GZNB 5LLIA 4G50A 1GB4A 2MA9B 1QOFA 4WJQA 3QCAA 2MLBA 2K3UA 3IG3A 1UELA 3Q8EA 2NPTA 1YQ4B 3RN9C 2O6VA 1WGGA 2WXJA 2PKOA 2Y5PA 4J3OD 1GC6A 3X23A 2LEKA 3NY5A 4I6LB 3EFCA 3R66C 4LK0M 4FJYA 2KC2A 4YSZB 4WJNA 2KDMA 3SEBA 2ZCBA 2BBCA 2E6XA 2KHWB 3ABVB 1DOXA 1NI3A 1R4MI 2GBKA 4L23A 2INCC 4HLEA 1HQRD 2V0GA 4II2B 1E8YA 3AH7A 2AQ1B 2BVCA 2KMMA 1J8CA 1DOYA 2WXMA 2XEWA 4ARIA 4P16A 2RDGA 1TKGA 1TYGB 5GMVA 3ZNHB 2ZW1A 4IWQA 1SBBB 4EOYA 2QC8A 2DYMA 2M1MA 3P4SB 4FADA 3PRPB 4A90A 2MP2A 2HJ8A 2WXLA 1HXYD 1P98A 1V97A 3EUB2 1K53A 4PK1A 1IGCA 3QJZA 3M3JA 3KW5B 3MC0B 2ZPYA 3T3NA 1ET6A 2ASQA 4RF0A 2KQ7A 4GDKA 1ENFA 2LGDA 2LD9A 1LXDA 2HDEA 2CKHB 1SXTA 1M94A 2FCNA 3DBLB 4C4VB 1N60A 1MG8A 3KWLA 3DHIC 4K7SA 2JQRB 1EF1A 2QILA 1V1PA 1WXSA 4US9A 4IOIE 1D6EC 1T0RC 5D2MB 3VH3B 3QIJA 1S3SG 1HZ5A 3M95A 4L1BA 3KQ4A 2MBQA 2WXOA 2KD0A 3GZNI 5MPOA 2WXPA 2K6QA 2PE9A 2HTME 2ICIA 1P7FA 1YD8U 3UINB 4RH6A 1G6JA 1YX5B 3H1UA 3H9DA 2NMQA 4JWSC 1N6ZA 1WXMA 3AMZA 3AULA 3ECIA 4YWGG 2MJ3A 1UWMA 2O6VB 1JRPA 2GRIA 2LWPA 3A9KA 3ZXRA 1E5WA 2GBMA 2KVRA 2NPTB 3EC8A 2KVZA 1QLBB 2FIFA 4MGIE 4DHZE 4BAXA 3PHXB 2WX0A 4IG7B 2AQ3B 2KN5A 2D3AA 3HK0A 5KHQA 4GDLA 3VR8B 2XN9C 2K25A 3WIMA 1WRDB 2WGSA 2ON8A 3T9LA 1L0VB 2LHDA 4DBGA 4MSQB 4JIOU 2W3SA 1BUIC 3ZDMC 4XGAB 4M00A 5D3DA 2MQJA 3ZGZA 2GMIC 3TCAA 4K3CA 4KDIC 4A8XC 4IWOA 4F1SA 1V5TA 4GIVA 4TQ1A 1ZKHA 3HVDA 1HA5A 5BYRA 2BB5A 3P4RB 4OZAA 4YTPB 3A4RA 4MSMB 3N1XC 2ACZB 2N1WA 2JWZA 2KQSA 4RCOA 3W9CB 3TUOA 3RZWC 4BBNF 2KYWA 1R4NI 3V6CB 4HCNB 4LCDE 4DHJB 1YN5A 4WWNA 3RNAC 4C00A 4MELA 1JQ4A 1WSPA 5IN7A 1UBQA 4YXDB 4FA6A 3P4PB 4AWJA 4EKUA 1KM7A 4MEMA 3NS8A 4MJSA 5D94A 5FR6A 4IUMB 3X0WA 2WU5B 4US8A 1FCLA 4I6NB 1CZPA 3Q69A 1FNWA 4N58A 1P3QU 4M0WB 3AE7B 1I42A 2PEAA 1DGJA 2DZKA 4WIPA 4HJKA 2IDYA 1NI2A 1I4QA 4GB9A 5JHBA 3I63C 2JXXA 2QIEB 1EM7A 2JRIB 1V81A 2LXAA 1BXTA 4K1RB 2KFKB 4OHJA 2WNMA 3NVYA 2MBEA 3AB5A 3UIPB 1WY8A 3Q3JA 1GAQB 1FNUA 3PHWB 5C23A 4HKZE 1KOTA 3C0RB 1YMHE 5E6NA 2R2OA 3WCQA 3UQAA 5EE0A 4FHKA 5AZHA 3HM6X 4MGZE 1AARA 4MGYE 4II3B 4XE0A 1LFDA 2G1EA 4W9FA 3L54A 2KTRB 2V9HA 3DVGX 3Q2AC 3ZJVA 4XZ4A 4OVVA 3ENEA 3A33B 3AECB 1V8CA 4NJ6A 2V4LA 2AL6A 2O2VA 3PZDA 4JX1C 2LVQA 2AEHA 1VJKA 4HPMB 3BINA 4NPNA 1I4XA 4KZCA 1F1HA 2J4XA 2QHOA 2XK5A 4JL9A 2OJWA 3E9SA 2L76A 4DQOC 2WHIA 4NAWB 1WH3A 2JUOA 4GLSC 4EEWA 3PREA 2H88B 2WQYB 1XLNA 3DQVA 2K5PA 3BVMA 1KFYB 1WGHA 1K50A 2KFJA 1UGJA 3R2IA 4L2YA 3QQ8B 1ZUD2 4BZAA 2V3NA 5IO9A 4B0EA 1UZXB 1WE7A 1A5RA 4USAA 3VTUA 1LM8B 2PPHA 1UBIA 3B0AA 1KLUD 4MM3A 4A9AA 2HE7A 2L1AA 3AE4B 4DXFA 2M56B 3Q8FA 4RF1A 2AQ2B 1WYWB 1FIQA 2M0XA 3ZJTA 1L0XB 3SU8X 4ANXA 3DBRB 3GE3C 1C79A 3I9V1 1ROEA 5EDSA 1I4RA 1MI0A 3I5JC 2I1JA 4DHZB 2YLMA 3PRZA 4KIKB 2BT6A 1ESFA 2QSDA 1N5XA 4LJPB 1JCKB 4NAMA 4LDTD 2Z59B 2N7DA 3NVVA 4LJOB 1TKEA 3MJ5A 2BW2A 3ZJUA 3HHMA 1E7UA 4X57B 2IPKD 3A9JB 4EFOA 1PQSA 1M4VA 3ZVVA 3A1QB 3SFEB 2CJOA 5HI1A 4RGMA 2NTTA 1ZXIA 1ACCA 3BYTB 1DOIA 1TS4A 3BYYB 3PLUA 3OJ3A 1E0ZA 4P6VF 1LGRA 3DBHI 4FJZA 2JYEA 1TZ1A 1C76A 2IO3B 4ZYNA 2L00B 1JWSD 1ZDVA 2OOBB 1QILA 4G11A 1E7VA 3V3XA 1WZ0A 3ALBA 1UD7A 4YSYB 5JH5C 1T3QA 5BMHA 2N9EB 2DLBA 3QARA 1H4RA 3NZ3A 1WGDA 2XK5B 2FAZA 2KWDA 2CHWA 1HEZE 1WRIA 2INNE 4GOCA 2C7NB 3T3OA 5G5HA 1WZ3A 3DVGY 3FAHA 4HWIB 4WWMA 4IWPA 2O2VB 1UF0A 3H8HA 4WJOA 4HJGE 1H8CA 2L0TA 2IY1B 2W82A 2W3RA 3TIXA 2KTRA 1WJ4A 3KUDB 2FNJB 3FC4A 3R7QA 1XF5L 2D5GA 4ZRPA 2Z8LA 1SEBD 3ZYYX 3BK1A 3VXWA 4WWOA 4RMAA 3DPDA 3AN1A 3N3KB 4KSKC 4OVUA 1C3TA 4H2AA 2ZCCA 4KGRA 2LGIA 3APDA 1I4GA 1V49A 1E6EB 4GU2A 1WXAA 5G55A 5CX3A 2GBRA 5BYSA 3JSVA 2PTLA 2I1KA 3NZSA 1Y8RC 1F52A 4TQ0A 3ZRCA 2G4DB 1GB1A 5HG2A 2KZRA 1E9MA 2Y3AA 4EZJA 3ZNGC 2WXRA 1VLBA 3VRAB 4M0WA 2D10A 2KOXA 3ZRFA 2VH2A 2NS5A 1GPXA 5C2TB 1RFAA 3OWEB 3O65B 3VUWA 1FM0D 4MT5A 3N30A 2IJ0A 4REZA 2JZZA 1HTQA 1WM2A 2INDC 4BKSA 1GNUA 2DHZA 4TMAB 2LHEA 3KYCD 1Q1OA 3B08A 5IP4D 2MWSB 2NBVB 2GOWA 4M8NA 4FBJB 2N7EA 2CHXA 2UYZB 2L05A 3MHZA 4R3DA 2EELA 2N4FA 1SIFA 1ZP0B 2BS4B 2M19A 2BWES 2L7RA 3BIID 5G2NA 1VD2A 4MM3B 3TEZA 2FCSA 3V60A 2X8XX 3KUZA 2KWUB 1FXAA 3TMPB 2LUMA 3W1SC 4W9CA 4HEA1 2R2QA 3NVWA 4RM9A 4ZDVA 1B9RA 1C4AA 2R61A 3L4PA 1D4BA 3R2TA 1GJZA 4M02A 2AX5A 3P42A 1WWTA 5FR3A 1QF6A 3IHPC 4LLGM 3M62B 4XWTA 3KUCB 2WLBA 1VDVA 2IZVB 1Z5SB 4GGQA 4HRSA 3CSFA 2K39A 3B2FA 3GP7A 2V1YA 2ZEQA 4C80A 4W9JA 5AZFA 3RNCC 1E8ZA 2M4NA 5KHOA 2PJHA 1DYQA 2M17A 2MH7A 4PT5A 2BGFA 2RSUA 4UDUC 4EZKA 3P2BA 1SB3C 1JWAD 4BOSC 1EUVB 4HKQA 3GOEA 4CQNA 4TKNA 4A20A 1D5XC 4W9DA 2GB1A 5CHWA 3VTWA 2IGDA 4C7YA 2KAJA 3Q3NC 1PGXA 3NRZA 3CF6E 1YN3A 2NR2A 2LGSA 3MC9A 3W1SA 1NEKB 3P63A 2ZVNA 3DVNU 3W1YA 3L16A 2MHJA 4KVGB 2WXFA 3KLSX 2WXKA 5AZGA 3H6NA 2CJNA 4FULA 1CMXB 2DYBA 1QOBA 3PPAA 3RZFA 4A3PA 2G9HD 2FUG1 3L08A 2IGGA 3H7PA 3JSVB 1F77A 2AWTA 3P1MA 1FEHA 1Y56A 4HXDA 3BZDB 1JWMD 5E6OA 2KLCA 4G3XB 2DWQA 2J0MA 1J7BA 2IBIB 5I4DA 3W5VB 3DVNV 5IAAC 1ZOYB 1E7PB 2MEKA 4C56C 4MJSB 2KMAA 2N9KA 4AUQC 1YIWA 4AQ7A 1C1YB 4HCPB 5D3IB 4HDQA 1F2RI 3VR9B 1WF9A 2MP2B 4N59A 2QJLA 1BMLC 2A4ZA 3O13A 3Q3MC 2N9PC 2KMCA 1D3ZA 3DHGC 1FXIA 4NNJB 4URKA 4RGNA 4MH0E 1NYQA 4P1BC 2IO2B 2L32A 3R8BA 2JWUA 1VZ7A 4EUTA 1UGMA 1XD3B 2PVOD 4W9LA 1HE8A 4FJVB 3OAWA 2ZVOA 4BVUC 3AEAB 3UIOB 3TJPA 1HZ6A 2KN4A 1C9FA 2JF5A 4DXAB 3AI5A 3N1ZC 2D3GA 2JZPA 4GDLB 2L3ZA 1WIAA 3IT6B 3UF8A 1WGKA 4CHKA 2LI5A 4PS7A 1STEA 1ZXHA 1FRDA 2A5UA 2KNBA 2JSVX 4NQLB 3HUIA 3SHQA 4NZLB 1TY0A 1RRBA 4ICVA 4N9F4 3TBLD 2TSSA 4GN1A 3N20C 1JRUA 1KTKA 4K7UA 2IY0B 2BYEA 3EHVA 2JY6A 3RPFC 3V6EB 5EE1A 1RWSA 1WXQA 1I4PA 1WR6E 1KJTA 3QC8B 3AEGB 2RDBC 3DCGA 3NUHB 3CIRB 3KVFB 3QWZB 1JMLA 1WX8A 3AE6B 3NJTA 1FFVA 4FN2A 1TKYA 2YEPB 3U30A 1C4CA 1FRRA 3M63B 2KXJA 1WFYA 3WAOA 3ML8A 2JU6X 1I7HA 1TT5B 2N9XA 4TUUA 1N5WA 2RMMA 1WMHA 4BKSD 4HPLB 2ZZPB 1KLGD 2VRRB 4JLCA 4C4VA 2KT7A 4JWUC 2W9NA 2JT4B 1XQQA 5IKCM 4W9IA 3ZW3A 4BBNC 2QDFA 3LJ3A 3IAS1 1E90A 1FMAD 1IP9A 4YSXB 1V86A 3OJ4B 4GDKB 2L0FA 4KV2A 4F7ZA 2WWZA 3PZ8A 1ZE3D 3TSSA 2K1FA 2PIAA 2KANA 1OGWA 4NAWA 1C4PA 2BB6A 4MDKE 2VH1A 4WAAA 1SJED 1XLOA 3VRBB 1KRHA 2BTEA 2GLSA 1JWBD 2BKRB 2KDIA 3VUXA 4EZLA 3U8ZA 1XCTL 2J0JA 1N62A 3IAM1 2L52A 4E74A 1EF5A 5L95C 1FCCC 1MJDA 2LVOA 2V3PA 3BVZA 3AE5B 4GMVA 4RGTA 2K6DB 2BQQA 4YT0B 3SDLC 2J0KA 2IYDB 1PYWD 3W5UB 4P1CC 3ZLZA 3I57A 1V2YA 3HVZA 3CMMB 1ET9A 1XT9B 1TZOA 1SGHA 3LB8C 3RULA 4AOFA 4AP4C 2LUEA 2DYOA 2G45B 3DBRI 3MTNB
chains in the Genus database with same CATH topology
1Y8RC 2CKHB 1M94A 2FCNA 3APFA 4TQ0A 4PS8A 3ZRCA 2G4DB 1MG8A 5TR5A 1TBEA 3PS6A 2LGXA 1VCBA 2KZRA 4ANUA 4K7SA 1P1AA 3D32A 4EZJA 1V5OA 3ZNGC 2C5LC 1EF1A 3WAPA 3QHTA 4WQOB 1WJUA 1WXSA 5JHAA 4AJYB 1IPGA 2D10A 2KOXA 2IO1B 4BFRA 3ZRFA 5D2MB 2NS5A 3VH3B 2EKEC 4DDID 1Q5WB 1EO6A 1P9DU 4G0NB 1RFAA 3QIJA 1S3SG 3O65B 1GUAB 3VUWA 5IA7A 3M95A 3N30A 4W9GA 2GBJA 2JZZA 2LRUA 4CO7A 1WM2A 2MBQA 2KD0A 3GZNI 3PLVA 4MGKE 1I35A 4B95A 4BKSA 2K6QA 2PE9A 4GXBA 4P7IA 1GNUA 2DHZA 4ICUA 2JVCA 3KYCD 3PVLA 1Q1OA 1K8RB 3B08A 3ZUNA 1YD8U 2MWSB 2NBVB 2GOWA 4M8NA 3UINB 4FBJB 1G6JA 3K9PB 1YX5B 3H1UA 2N7EA 3H9DA 3MTNB 2CS4A 4HDOA 2MBOA 2CHXA 2C60A 1WXMA 2UYZB 2L05A 1L7YA 1V80A 3AULA 3ECIA 3EFUA 3H7PB 2LZ6A 2N4FA 2NBUA 1SIFA 2EMTA 2ZNVC 2O6VB 2LWPA 3A9KA 4ZRIA 2BWES 4I6PA 2ZJDA 1E5WA 2GBMA 2KVRA 2NPTB 1YQBA 2L7RA 3EC8A 1WMHB 4PYZA 2FIFA 2Z0EB 4B9KA 4MGIE 4DHZE 5G2NA 1VD2A 3PHXB 2WX0A 1X1MA 3ZDTA 1NDDA 2MCNB 4IG7B 4BKGA 4IW0A 2BKFA 2KN5A 2FCSA 3V60A 4CYEA 3BY4B 1FXTB 2FCQA 2L8JA 3HK0A 3ONSA 4GDLA 5KHQA 3KUZA 2HD5B 3A9JA 2KWUB 3ML9A 2LGYA 2K25A 4PYUA 3TMPB 3WIMA 4E3CA 1WRDB 3W1SC 4W9CA 2R2QA 3ZO5B 4RM9A 1WE6A 5E6PA 4ZDVA 2DAJA 3H7SA 3T9LA 2J7QB 2KJRA 3DBLI 4B6WA 4DBGA 4MSQB 1WI0A 1GJZA 4BKTA 4JIOU 4J6IA 4XX5A 3ZDMC 2V3SA 2BWFA 2MQJA 4KIKA 2GMIC 2LASA 3TCAA 5HKHA 3IHPC 3M62B 2CHZA 4KDIC 1UH6A 2D2QA 3KUCB 4IWOA 5DPRA 4WWPA 4F1SA 2IZVB 1V5TA 4K81A 4GIVA 1Z5SB 4GGQA 3OLMD 5CTRC 3CSFA 3PTFC 2K39A 4TQ1A 5J18A 1ZKHA 2DZJA 2FUHB 3VAWA 1J19A 2V1YA 1RAXA 3VUYA 2ZEQA 5DPSA 2Y5BB 4W9JA 5AZFA 5CHFA 3V62A 2RR9A 3A4RA 1E8ZA 2M4NA 4MSMB 2PJHA 5KHOA 4A3OA 2N1WA 1WXVA 2JWZA 4JGHB 2KQSA 3RZWC 4BBNF 1BT0A 1OTRB 2M17A 4IM0A 2KJHB 2AYOB 2BGFA 2RSUA 1R4NI 4ANWA 4EZKA 3V6CB 2BF8B 3P2BA 3PV1A 3TL5A 4HCNB 4LCDE 4DHJB 2KJ6A 4BOSC 1EUVB 2MBHA 4WWNA 1OQYA 1YJ1A 2LVPA 4MELA 4PS3A 4IC7B 3GOEA 1UBQA 4FA6A 4TKNA 4WJPA 4A20A 4DDGD 4AWJA 4W9DA 4EKUA 1KM7A 2LJ5A 2REXA 3MHSD 4MEMA 3NS8A 5CHWA 4MJSA 3VTWA 3R3MA 5D94A 5FR6A 1ZW7A 1Z2MA 1U4AA 3AU5A 1IYFA 3L0WB 3VQIA 2RGFA 3CSTA 4IUMB 3ZIMA 3X0WA 1GG3A 1P0RA 3CF6E 2NR2A 1TTNA 4I6NB 4YL8A 3W1SA 2ZVNA 3DVNU 5DPWA 3W1YA 5JZEB 3L16A 1P3QU 3B1LX 4M0WB 4KVGB 1J0GA 2G3QB 2K8CA 3EECA 5AZGA 1I42A 2PEAA 2KX3A 2DZKA 3H6NA 3S2AA 4HJKA 2ZPNA 1NI2A 4FULA 4GB9A 1CMXB 2N1VA 2DYBA 5JHBA 3PPAA 3RZFA 3DDCB 2JXXA 4ZRJA 4A3PA 2IO0B 2JRIB 2K8HA 2KC1A 2DAFA 3L08A 3AU4A 4TV3A 2CR5A 1V81A 3H7PA 3JSVB 2LXAA 2AWTA 4K1RB 2KFKB 2NBWB 2KKCA 5BO4B 2B3AA 2FCMA 4HXDA 1OEYJ 4HVBA 2MBEA 5E6OA 2KLCA 4AJWA 2KDEB 4G3XB 4GSWA 3UIPB 3NHEB 2J0MA 1WY8A 3Q3JA 1SE9A 1WGRA 2IBIB 4M8MA 3PHWB 5C23A 3HIZA 2KWCA 1KOTA 3C0RB 3DVNV 5E6NA 4KZ0A 3R7RA 5IAAC 1V9JA 1KLVA 2R2OA 4E71A 4MJSB 2KMAA 4IM3A 3UQAA 4XC2A 4FHKA 4AUQC 2WYQA 4K7WA 5AZHA 1YIWA 3HM6X 3QA8A 1C1YB 4HCPB 4KDLB 5J2RA 4MGZE 3NZUA 1AARA 2BYFA 4MGYE 4HDQA 4II3B 3IVFA 1LFDA 2BPSA 2CU1A 2NVUI 4W9FA 3L54A 2MW5A 2EMSA 1WF9A 1L2NA 2KTRB 2MP2B 2MX2A 3DVGX 2NCNA 2A4ZA 2ZNVB 3IBEA 3QX1A 4XZ4A 2UWQA 4OVVA 3ENEA 2JPHA 2RPQA 3SD5A 1WR1A 2N9PC 4HK2A 2KMCA 4W9EA 3A33B 2MBBB 3N32A 3PGEA 3VTVA 1D3ZA 2HTHA 4NJ6A 2XBBC 2D07B 2M8SA 2V4LA 1Q0WB 4NNJB 3U7DA 2AL6A 4URKA 2O2VA 2WX1A 3WAMA 3PZDA 3I3TB 2LVQA 4MH0E 2AEHA 2IO2B 3PSEB 3JYUA 4HPMB 3BINA 4RM8A 4NPNA 3APCA 4NY0A 4EUTA 1TGZB 3A1QA 4ZRKA 1E8WA 1WGYA 3DBSA 1UGMA 4KZCA 2QHOA 4JL9A 2XK5A 3WA0A 2C9WB 2MSED 2L76A 1XD3B 4W9LA 3KH0A 1HE8A 4NAWB 1WH3A 2JUOA 4FJVB 4EEWA 3IFWB 3PREA 3OAWA 3DQVA 2ZVOA 3V61A 4BVUC 2LXCA 3PRMB 3UIOB 1WGHA 3RYTA 2KFJA 4DK5A 3TJPA 3QQ8B 5D6JB 2K8BA 2JF5A 5CHVC 4DXAB 1WJ6A 1UZXB 1WE7A 1A5RA 3AI5A 2GBNA 2D3GA 4FLHA 3L13A 3VTUA 4GDLB 3K9OB 1LM8B 2L3ZA 1WIAA 3UF8A 2FIDA 4CHKA 2LI5A 2PPHA 1UBIA 2KO3A 3B0AA 4PS7A 4MM3A 2WDTB 3DOWA 3RD2A 2HE7A 1S1QB 2KX0A 3QK0A 5LXIB 4NJ7A 2KDBA 2A5UA 3VH4B 2KNBA 1WYWB 2OJRA 2RD0A 4NQLB 2BYVE 3JW0X 4JQWC 2C7MB 4W9KA 3WALA 2M0XA 3SHQA 1GC7A 3NOBA 1RRBA 4ICVA 3A4SC 3SU8X 3RCZA 4N9F4 2DZIA 3TBLD 2JRHA 2MRPA 4BOZB 5EDSA 4GN1A 4DHZB 2I1JA 1JRUA 5DPTA 2YLMA 3PRZA 4KIKB 4DWFA 3WANA 4K7UA 3VDZA 2IY0B 2BYEA 3L17A 3ZNZB 3EHVA 2JY6A 1E8XA 4LJPB 3V6EB 4LDTD 3LDZE 2Z59B 2DX5B 1NBFC 2N7DA 4LJOB 1WR6E 2D11A 1KJTA 3QC8B 5J17A 1WX7A 1QZEA 3DCGA 3JVZX 3KVFB 2JZ3B 3QWZB 3HHMA 1WM3A 1E7UA 1T0YA 1WX8A 5L83A 4FN2A 4X57B 3A9JB 4EFOA 1PQSA 1OEYA 4W9HA 1YX6B 3U30A 3ZVVA 5LLIA 3RUIB 1RLFA 4G50A 3A1QB 2MA9B 3UGBB 4WJQA 3M63B 3QCAA 2MLBA 1V6EA 2KXJA 1WFYA 3WAOA 3ZNID 3ML8A 3IG3A 1UELA 2N9XA 4TUUA 1WMHA 2NPTA 4BKSD 3HM3A 4HPLB 2ZZPB 2O6VA 3PLUA 1WGGA 2VRRB 3OJ3A 4JLCA 2Z0DB 3DBHI 2LRWA 1GC6A 4FJZA 2KTFA 3A9KB 3X23A 3UQBA 1TZ1A 5DCNA 3NY5A 4NQKE 4I6LB 2W9NA 1LQBA 2DENB 2IO3B 1XQQA 2JT4B 4ZYNA 2L00B 3R66C 2KK8A 4W9IA 4FJYA 2KC2A 3ZW3A 4WJNA 4BBNC 3LJ3A 3ZTDA 3QAQA 1E90A 2ZCBA 4ANVA 1WX9A 3MJWA 1IP9A 2OOBB 2AL3A 1V86A 3OJ4B 2KHWB 4GDKB 2L0FA 4KV2A 4F7ZA 2WWZA 1R4MI 2GBKA 4G11A 1E7VA 3RT3B 4ANXA 2K1FA 1WZ0A 2KANA 1OGWA 3VVWB 4HLEA 2O6VD 3AXCA 3ALBA 4NAWA 4MDKE 1UD7A 5JH5C 4WAAA 3KYDD 2KDFB 4II2B 4ASWC 1E8YA 2N9EB 3QARA 1H4RA 5LXHA 5D7GA 1WGDA 3Q3FA 4DHJD 2BKRB 2XK5B 1J8CA 2FAZA 2CHWA 2KFKA 2KDIA 3VUXA 2XEWA 4EZLA 3VHTC 4GOCA 2C7NB 3U8ZA 4KSLC 3T8MA 2C7HA 5GMVA 3ZNHB 1WZ3A 3PT2B 3DVGY 4HWIB 4IWPA 2O2VB 1ZGUB 4IWQA 2J0JA 4WJOA 4EOYA 1H8CA 5C1ZA 2DYMA 2YVCA 2M1MA 2L0TA 4FADA 3PRPB 2IY1B 1ISNA 4E74A 1EF5A 5L95C 1F9JA 2DZMA 3TIXA 2KTRA 2MP2A 2LVOA 1WJ4A 3KUDB 2HJ8A 4F8CB 2FNJB 1P98A 3R7QA 3VFKA 4GMVA 2K6DB 2KLGA 4LDTB 4FHJA 3VXWA 4IM2A 3SDLC 4WWOA 2J0KA 4RMAA 2IYDB 3QJZA 3M3JA 3KW5B 3ZTCA 3DPDA 3ZLZA 3N3KB 4KSKC 2ZPYA 4OVUA 5AEKB 1C3TA 2ASQA 1V2YA 2ZCCA 3CMMB 3ZKJC 3APDA 1V49A 2KQ7A 4GDKA 2PE6B 1WJNA 2KWVB 1XT9B 4GU2A 1WXAA 1SGHA 2LD9A 5G55A 1LXDA 3RULA 4AOFA 2G4SA 5CX3A 2GBRA 4AP4C 2LUEA 2DYOA 2G45B 3JSVA 3DBRI 2LGDA 2I1KA 3NZSA 3L10B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8R C;  2CKH B;  1M94 A;  2FCN A;  3APF A;  4TQ0 A;  4PS8 A;  3ZRC A;  2G4D B;  1MG8 A;  5TR5 A;  1TBE A;  3PS6 A;  2LGX A;  1VCB A;  2KZR A;  4ANU A;  4K7S A;  1P1A A;  3D32 A;  4EZJ A;  1V5O A;  3ZNG C;  2C5L C;  1EF1 A;  3WAP A;  3QHT A;  4WQO B;  1WJU A;  1WXS A;  5JHA A;  4AJY B;  1IPG A;  2D10 A;  2KOX A;  2IO1 B;  4BFR A;  3ZRF A;  5D2M B;  2NS5 A;  3VH3 B;  2EKE C;  4DDI D;  1Q5W B;  1EO6 A;  1P9D U;  4G0N B;  1RFA A;  3QIJ A;  1S3S G;  3O65 B;  1GUA B;  3VUW A;  5IA7 A;  3M95 A;  3N30 A;  4W9G A;  2GBJ A;  2JZZ A;  2LRU A;  4CO7 A;  1WM2 A;  2MBQ A;  2KD0 A;  3GZN I;  3PLV A;  4MGK E;  1I35 A;  4B95 A;  4BKS A;  2K6Q A;  2PE9 A;  4GXB A;  4P7I A;  1GNU A;  2DHZ A;  4ICU A;  2JVC A;  3KYC D;  3PVL A;  1Q1O A;  1K8R B;  3B08 A;  3ZUN A;  1YD8 U;  2MWS B;  2NBV B;  2GOW A;  4M8N A;  3UIN B;  4FBJ B;  1G6J A;  3K9P B;  1YX5 B;  3H1U A;  2N7E A;  3H9D A;  3MTN B;  2CS4 A;  4HDO A;  2MBO A;  2CHX A;  2C60 A;  1WXM A;  2UYZ B;  2L05 A;  1L7Y A;  1V80 A;  3AUL A;  3ECI A;  3EFU A;  3H7P B;  2LZ6 A;  2N4F A;  2NBU A;  1SIF A;  2EMT A;  2ZNV C;  2O6V B;  2LWP A;  3A9K A;  4ZRI A;  2BWE S;  4I6P A;  2ZJD A;  1E5W A;  2GBM A;  2KVR A;  2NPT B;  1YQB A;  2L7R A;  3EC8 A;  1WMH B;  4PYZ A;  2FIF A;  2Z0E B;  4B9K A;  4MGI E;  4DHZ E;  5G2N A;  1VD2 A;  3PHX B;  2WX0 A;  1X1M A;  3ZDT A;  1NDD A;  2MCN B;  4IG7 B;  4BKG A;  4IW0 A;  2BKF A;  2KN5 A;  2FCS A;  3V60 A;  4CYE A;  3BY4 B;  1FXT B;  2FCQ A;  2L8J A;  3HK0 A;  3ONS A;  4GDL A;  5KHQ A;  3KUZ A;  2HD5 B;  3A9J A;  2KWU B;  3ML9 A;  2LGY A;  2K25 A;  4PYU A;  3TMP B;  3WIM A;  4E3C A;  1WRD B;  3W1S C;  4W9C A;  2R2Q A;  3ZO5 B;  4RM9 A;  1WE6 A;  5E6P A;  4ZDV A;  2DAJ A;  3H7S A;  3T9L A;  2J7Q B;  2KJR A;  3DBL I;  4B6W A;  4DBG A;  4MSQ B;  1WI0 A;  1GJZ A;  4BKT A;  4JIO U;  4J6I A;  4XX5 A;  3ZDM C;  2V3S A;  2BWF A;  2MQJ A;  4KIK A;  2GMI C;  2LAS A;  3TCA A;  5HKH A;  3IHP C;  3M62 B;  2CHZ A;  4KDI C;  1UH6 A;  2D2Q A;  3KUC B;  4IWO A;  5DPR A;  4WWP A;  4F1S A;  2IZV B;  1V5T A;  4K81 A;  4GIV A;  1Z5S B;  4GGQ A;  3OLM D;  5CTR C;  3CSF A;  3PTF C;  2K39 A;  4TQ1 A;  5J18 A;  1ZKH A;  2DZJ A;  2FUH B;  3VAW A;  1J19 A;  2V1Y A;  1RAX A;  3VUY A;  2ZEQ A;  5DPS A;  2Y5B B;  4W9J A;  5AZF A;  5CHF A;  3V62 A;  2RR9 A;  3A4R A;  1E8Z A;  2M4N A;  4MSM B;  2PJH A;  5KHO A;  4A3O A;  2N1W A;  1WXV A;  2JWZ A;  4JGH B;  2KQS A;  3RZW C;  4BBN F;  1BT0 A;  1OTR B;  2M17 A;  4IM0 A;  2KJH B;  2AYO B;  2BGF A;  2RSU A;  1R4N I;  4ANW A;  4EZK A;  3V6C B;  2BF8 B;  3P2B A;  3PV1 A;  3TL5 A;  4HCN B;  4LCD E;  4DHJ B;  2KJ6 A;  4BOS C;  1EUV B;  2MBH A;  4WWN A;  1OQY A;  1YJ1 A;  2LVP A;  4MEL A;  4PS3 A;  4IC7 B;  3GOE A;  1UBQ A;  4FA6 A;  4TKN A;  4WJP A;  4A20 A;  4DDG D;  4AWJ A;  4W9D A;  4EKU A;  1KM7 A;  2LJ5 A;  2REX A;  3MHS D;  4MEM A;  3NS8 A;  5CHW A;  4MJS A;  3VTW A;  3R3M A;  5D94 A;  5FR6 A;  1ZW7 A;  1Z2M A;  1U4A A;  3AU5 A;  1IYF A;  3L0W B;  3VQI A;  2RGF A;  3CST A;  4IUM B;  3ZIM A;  3X0W A;  1GG3 A;  1P0R A;  3CF6 E;  2NR2 A;  1TTN A;  4I6N B;  4YL8 A;  3W1S A;  2ZVN A;  3DVN U;  5DPW A;  3W1Y A;  5JZE B;  3L16 A;  1P3Q U;  3B1L X;  4M0W B;  4KVG B;  1J0G A;  2G3Q B;  2K8C A;  3EEC A;  5AZG A;  1I42 A;  2PEA A;  2KX3 A;  2DZK A;  3H6N A;  3S2A A;  4HJK A;  2ZPN A;  1NI2 A;  4FUL A;  4GB9 A;  1CMX B;  2N1V A;  2DYB A;  5JHB A;  3PPA A;  3RZF A;  3DDC B;  2JXX A;  4ZRJ A;  4A3P A;  2IO0 B;  2JRI B;  2K8H A;  2KC1 A;  2DAF A;  3L08 A;  3AU4 A;  4TV3 A;  2CR5 A;  1V81 A;  3H7P A;  3JSV B;  2LXA A;  2AWT A;  4K1R B;  2KFK B;  2NBW B;  2KKC A;  5BO4 B;  2B3A A;  2FCM A;  4HXD A;  1OEY J;  4HVB A;  2MBE A;  5E6O A;  2KLC A;  4AJW A;  2KDE B;  4G3X B;  4GSW A;  3UIP B;  3NHE B;  2J0M A;  1WY8 A;  3Q3J A;  1SE9 A;  1WGR A;  2IBI B;  4M8M A;  3PHW B;  5C23 A;  3HIZ A;  2KWC A;  1KOT A;  3C0R B;  3DVN V;  5E6N A;  4KZ0 A;  3R7R A;  5IAA C;  1V9J A;  1KLV A;  2R2O A;  4E71 A;  4MJS B;  2KMA A;  4IM3 A;  3UQA A;  4XC2 A;  4FHK A;  4AUQ C;  2WYQ A;  4K7W A;  5AZH A;  1YIW A;  3HM6 X;  3QA8 A;  1C1Y B;  4HCP B;  4KDL B;  5J2R A;  4MGZ E;  3NZU A;  1AAR A;  2BYF A;  4MGY E;  4HDQ A;  4II3 B;  3IVF A;  1LFD A;  2BPS A;  2CU1 A;  2NVU I;  4W9F A;  3L54 A;  2MW5 A;  2EMS A;  1WF9 A;  1L2N A;  2KTR B;  2MP2 B;  2MX2 A;  3DVG X;  2NCN A;  2A4Z A;  2ZNV B;  3IBE A;  3QX1 A;  4XZ4 A;  2UWQ A;  4OVV A;  3ENE A;  2JPH A;  2RPQ A;  3SD5 A;  1WR1 A;  2N9P C;  4HK2 A;  2KMC A;  4W9E A;  3A33 B;  2MBB B;  3N32 A;  3PGE A;  3VTV A;  1D3Z A;  2HTH A;  4NJ6 A;  2XBB C;  2D07 B;  2M8S A;  2V4L A;  1Q0W B;  4NNJ B;  3U7D A;  2AL6 A;  4URK A;  2O2V A;  2WX1 A;  3WAM A;  3PZD A;  3I3T B;  2LVQ A;  4MH0 E;  2AEH A;  2IO2 B;  3PSE B;  3JYU A;  4HPM B;  3BIN A;  4RM8 A;  4NPN A;  3APC A;  4NY0 A;  4EUT A;  1TGZ B;  3A1Q A;  4ZRK A;  1E8W A;  1WGY A;  3DBS A;  1UGM A;  4KZC A;  2QHO A;  4JL9 A;  2XK5 A;  3WA0 A;  2C9W B;  2MSE D;  2L76 A;  1XD3 B;  4W9L A;  3KH0 A;  1HE8 A;  4NAW B;  1WH3 A;  2JUO A;  4FJV B;  4EEW A;  3IFW B;  3PRE A;  3OAW A;  3DQV A;  2ZVO A;  3V61 A;  4BVU C;  2LXC A;  3PRM B;  3UIO B;  1WGH A;  3RYT A;  2KFJ A;  4DK5 A;  3TJP A;  3QQ8 B;  5D6J B;  2K8B A;  2JF5 A;  5CHV C;  4DXA B;  1WJ6 A;  1UZX B;  1WE7 A;  1A5R A;  3AI5 A;  2GBN A;  2D3G A;  4FLH A;  3L13 A;  3VTU A;  4GDL B;  3K9O B;  1LM8 B;  2L3Z A;  1WIA A;  3UF8 A;  2FID A;  4CHK A;  2LI5 A;  2PPH A;  1UBI A;  2KO3 A;  3B0A A;  4PS7 A;  4MM3 A;  2WDT B;  3DOW A;  3RD2 A;  2HE7 A;  1S1Q B;  2KX0 A;  3QK0 A;  5LXI B;  4NJ7 A;  2KDB A;  2A5U A;  3VH4 B;  2KNB A;  1WYW B;  2OJR A;  2RD0 A;  4NQL B;  2BYV E;  3JW0 X;  4JQW C;  2C7M B;  4W9K A;  3WAL A;  2M0X A;  3SHQ A;  1GC7 A;  3NOB A;  1RRB A;  4ICV A;  3A4S C;  3SU8 X;  3RCZ A;  4N9F 4;  2DZI A;  3TBL D;  2JRH A;  2MRP A;  4BOZ B;  5EDS A;  4GN1 A;  4DHZ B;  2I1J A;  1JRU A;  5DPT A;  2YLM A;  3PRZ A;  4KIK B;  4DWF A;  3WAN A;  4K7U A;  3VDZ A;  2IY0 B;  2BYE A;  3L17 A;  3ZNZ B;  3EHV A;  2JY6 A;  1E8X A;  4LJP B;  3V6E B;  4LDT D;  3LDZ E;  2Z59 B;  2DX5 B;  1NBF C;  2N7D A;  4LJO B;  1WR6 E;  2D11 A;  1KJT A;  3QC8 B;  5J17 A;  1WX7 A;  1QZE A;  3DCG A;  3JVZ X;  3KVF B;  2JZ3 B;  3QWZ B;  3HHM A;  1WM3 A;  1E7U A;  1T0Y A;  1WX8 A;  5L83 A;  4FN2 A;  4X57 B;  3A9J B;  4EFO A;  1PQS A;  1OEY A;  4W9H A;  1YX6 B;  3U30 A;  3ZVV A;  5LLI A;  3RUI B;  1RLF A;  4G50 A;  3A1Q B;  2MA9 B;  3UGB B;  4WJQ A;  3M63 B;  3QCA A;  2MLB A;  1V6E A;  2KXJ A;  1WFY A;  3WAO A;  3ZNI D;  3ML8 A;  3IG3 A;  1UEL A;  2N9X A;  4TUU A;  1WMH A;  2NPT A;  4BKS D;  3HM3 A;  4HPL B;  2ZZP B;  2O6V A;  3PLU A;  1WGG A;  2VRR B;  3OJ3 A;  4JLC A;  2Z0D B;  3DBH I;  2LRW A;  1GC6 A;  4FJZ A;  2KTF A;  3A9K B;  3X23 A;  3UQB A;  1TZ1 A;  5DCN A;  3NY5 A;  4NQK E;  4I6L B;  2W9N A;  1LQB A;  2DEN B;  2IO3 B;  1XQQ A;  2JT4 B;  4ZYN A;  2L00 B;  3R66 C;  2KK8 A;  4W9I A;  4FJY A;  2KC2 A;  3ZW3 A;  4WJN A;  4BBN C;  3LJ3 A;  3ZTD A;  3QAQ A;  1E90 A;  2ZCB A;  4ANV A;  1WX9 A;  3MJW A;  1IP9 A;  2OOB B;  2AL3 A;  1V86 A;  3OJ4 B;  2KHW B;  4GDK B;  2L0F A;  4KV2 A;  4F7Z A;  2WWZ A;  1R4M I;  2GBK A;  4G11 A;  1E7V A;  3RT3 B;  4ANX A;  2K1F A;  1WZ0 A;  2KAN A;  1OGW A;  3VVW B;  4HLE A;  2O6V D;  3AXC A;  3ALB A;  4NAW A;  4MDK E;  1UD7 A;  5JH5 C;  4WAA A;  3KYD D;  2KDF B;  4II2 B;  4ASW C;  1E8Y A;  2N9E B;  3QAR A;  1H4R A;  5LXH A;  5D7G A;  1WGD A;  3Q3F A;  4DHJ D;  2BKR B;  2XK5 B;  1J8C A;  2FAZ A;  2CHW A;  2KFK A;  2KDI A;  3VUX A;  2XEW A;  4EZL A;  3VHT C;  4GOC A;  2C7N B;  3U8Z A;  4KSL C;  3T8M A;  2C7H A;  5GMV A;  3ZNH B;  1WZ3 A;  3PT2 B;  3DVG Y;  4HWI B;  4IWP A;  2O2V B;  1ZGU B;  4IWQ A;  2J0J A;  4WJO A;  4EOY A;  1H8C A;  5C1Z A;  2DYM A;  2YVC A;  2M1M A;  2L0T A;  4FAD A;  3PRP B;  2IY1 B;  1ISN A;  4E74 A;  1EF5 A;  5L95 C;  1F9J A;  2DZM A;  3TIX A;  2KTR A;  2MP2 A;  2LVO A;  1WJ4 A;  3KUD B;  2HJ8 A;  4F8C B;  2FNJ B;  1P98 A;  3R7Q A;  3VFK A;  4GMV A;  2K6D B;  2KLG A;  4LDT B;  4FHJ A;  3VXW A;  4IM2 A;  3SDL C;  4WWO A;  2J0K A;  4RMA A;  2IYD B;  3QJZ A;  3M3J A;  3KW5 B;  3ZTC A;  3DPD A;  3ZLZ A;  3N3K B;  4KSK C;  2ZPY A;  4OVU A;  5AEK B;  1C3T A;  2ASQ A;  1V2Y A;  2ZCC A;  3CMM B;  3ZKJ C;  3APD A;  1V49 A;  2KQ7 A;  4GDK A;  2PE6 B;  1WJN A;  2KWV B;  1XT9 B;  4GU2 A;  1WXA A;  1SGH A;  2LD9 A;  5G55 A;  1LXD A;  3RUL A;  4AOF A;  2G4S A;  5CX3 A;  2GBR A;  4AP4 C;  2LUE A;  2DYO A;  2G45 B;  3JSV A;  3DBR I;  2LGD A;  2I1K A;  3NZS A;  3L10 B; 
#chains in the Genus database with same CATH topology
 3Q8C A;  3APF A;  1PUT A;  1TBE A;  2BS3 B;  1N63 A;  1VCB A;  2LGX A;  1E10 A;  4XDC A;  1VZ8 A;  3D32 A;  2C5L C;  3WAP A;  2V4I B;  4WQO B;  1D5M C;  5JHA A;  4BFR A;  4KKI A;  5H8Y E;  1Q5W B;  1EO6 A;  4G0N B;  3NVZ A;  4ITK A;  2GI9 A;  5IA7 A;  2GBJ A;  4MGK E;  1I35 A;  4P7I A;  3PVL A;  3ZUN A;  4WQM A;  3K9P B;  3CWI A;  2CS4 A;  1L0Y B;  4JE3 B;  2MBO A;  5E6J A;  3P4Q B;  2C60 A;  1QKZ A;  1V80 A;  3H7P B;  2PVG C;  2LZ6 A;  2ZNV C;  1VZ6 A;  1AWD A;  4ZRI A;  4I6P A;  2EKI A;  2ZJD A;  4S17 A;  3FIL B;  1YQB A;  1WMH B;  5JXV A;  2Z0E B;  5TSS A;  3W2D A;  3OG5 A;  1XEE A;  4BKG A;  3N9Y C;  4CYE A;  3BY4 B;  1FXT B;  2L8J A;  1EWC A;  3V05 A;  1XLP A;  2HD5 B;  2LGY A;  2MJE A;  3GE8 C;  3U7Z A;  4PYU A;  2M0A A;  4E3C A;  3ZO5 B;  1T0Q C;  1WE6 A;  5E6P A;  1B1Z A;  1GOZ A;  1QT9 A;  3DBL I;  2VZK D;  4BKT A;  4J6I A;  4XX5 A;  3C8Y A;  2V3S A;  2LAS A;  5HKH A;  4KKJ A;  2CHZ A;  4ZHP A;  2D2Q A;  1PDX A;  1NEN B;  4WWP A;  5DPR A;  3OLM D;  3PTF C;  5J18 A;  1RAX A;  3VUY A;  1PGB A;  2Y5B B;  1SE3 A;  5CHF A;  4ZRQ A;  2ONQ A;  3V62 A;  2RR9 A;  3AV8 A;  4A3O A;  1WXV A;  1SJH D;  3GB1 A;  1N61 A;  1OTR B;  2KJH B;  1YN4 A;  1K51 A;  2BF8 B;  3TL5 A;  1ZDX A;  4KX6 B;  4A55 A;  2MBH A;  2LVP A;  3AE1 B;  4PS3 A;  1V1O A;  4IC7 B;  5G5G A;  1AW7 A;  1FNV A;  4WJP A;  2REX A;  4OZC A;  3MHS D;  3SR6 A;  2K0P A;  3U52 E;  3RNB C;  4KGT A;  2B76 B;  1Z2M A;  1U4A A;  4MAC A;  3VQI A;  2RGF A;  3CST A;  2QCZ A;  1GG3 A;  3Q8A A;  1TTN A;  5FKA C;  1WYG A;  2PW9 A;  4LNI A;  5EE9 A;  2WP9 B;  1F0Z A;  5DPW A;  5JZE B;  1J0G A;  2G3Q B;  2KX3 A;  3EA6 A;  3PO0 A;  3S2A A;  4LNF A;  3J9C A;  5HFY A;  3DDC B;  1XO3 A;  3NG0 A;  2IO0 B;  2K8H A;  2DAF A;  2SAK A;  3AU4 A;  2CR5 A;  1Q10 A;  2KKC A;  2FCM A;  2LJI A;  4OW0 A;  1FPY A;  4AJW A;  1NVI D;  3NHE B;  4LNN A;  1SE9 A;  1OFF A;  4M8M A;  3HIZ A;  3BWU D;  3Q6B A;  4KZ0 A;  1V9J A;  1KLV A;  1SSN A;  2BS2 B;  2J52 A;  2N0S B;  3TEW A;  2WYQ A;  4XDD A;  2BYF A;  3DWG C;  3IVF A;  2BPS A;  2NVU I;  1RYJ A;  2MW5 A;  2EMS A;  1L2N A;  2NCN A;  2N9L A;  4XYC A;  3IBE A;  2J42 A;  2JPH A;  4HK2 A;  4W9E A;  2MBB B;  3N32 A;  2HTH A;  1MFW A;  3WAM A;  2H89 B;  1XCQ L;  2WX1 A;  1TIF A;  3N1Y C;  4RM8 A;  3DWM A;  3APC A;  4NY0 A;  2QEJ C;  1JAL A;  1TGZ B;  3A1Q A;  4ZRK A;  1E8W A;  3KH0 A;  1MHX A;  3IFW B;  1FD6 A;  1NYR A;  2LMC A;  3V61 A;  2LXC A;  2WDR B;  2N7J A;  3RI7 C;  2LFI A;  2RDH A;  5D6J B;  4ARC A;  3SFD B;  1WJ6 A;  1TS2 A;  2GBN A;  2Y5C A;  4AS1 A;  4RFB A;  2KO3 A;  2WXH A;  3DOW A;  1ZPS A;  3AM9 A;  2KX0 A;  3AEF B;  3QK0 A;  4NJ7 A;  2KDB A;  3JW0 X;  2C7M B;  3WAL A;  3NOB A;  1SE4 A;  3PZ7 A;  4N6E B;  3RNE C;  4A6Q A;  4DWF A;  3WAN A;  3L17 A;  1XLQ A;  1CK1 A;  3MC8 A;  3LDZ E;  1IBX A;  2D11 A;  1K52 A;  3ZQ4 A;  3JVZ X;  1FO4 A;  5L83 A;  2JX5 A;  3LXF A;  4IKG A;  3RNG C;  1L4Z B;  3AEE B;  3RUI B;  1RLF A;  2NTS A;  3UGB B;  1V6E A;  1OQQ A;  3ZNI D;  4D2K A;  1RFK A;  3HM3 A;  1MHH E;  4ACF A;  2Z0D B;  2WS3 B;  2LRW A;  2INP E;  2KTF A;  3A9K B;  3UQB A;  5DCN A;  5AUI A;  4NQK E;  3AEB B;  1LQB A;  2DEN B;  1EU4 A;  4DXG A;  2KK8 A;  2SEB D;  1AYF A;  5HHD G;  5GXG B;  3ZTD A;  3QAQ A;  4ANV A;  1WX9 A;  3MJW A;  1L5P A;  3B2G A;  2AL3 A;  2OHF A;  4ZOH C;  3RT3 B;  1YQ3 B;  2Q5W D;  3VVW B;  2XNA C;  2O6V D;  3AXC A;  2I2Y A;  3KYD D;  2KDF B;  1PFD A;  4ASW C;  5LXH A;  5EE3 A;  5D7G A;  4DHJ D;  3Q3F A;  3NS1 A;  2KFK A;  5C3J B;  3VHT C;  1C77 A;  4KSL C;  3T8M A;  4QAY A;  1R7S A;  2C7H A;  3PT2 B;  1ZGU B;  2J53 A;  5C1Z A;  2YVC A;  1ISN A;  3BK2 A;  3Q14 C;  1F9J A;  2DZM A;  4F8C B;  3E56 A;  2ZW0 A;  3VFK A;  3Q3O C;  2KLG A;  4LDT B;  4FHJ A;  3MP9 A;  4IM2 A;  4WUR A;  3UI3 A;  3ZTC A;  1HTO A;  5AEK B;  1J7A A;  3ZKJ C;  2PE6 B;  1WJN A;  2KWV B;  3TEY A;  2G4S A;  3RMK C;  1TJE A;  3L10 B;  1I4H A;  4PS8 A;  5TR5 A;  3PS6 A;  1L4D B;  4ANU A;  4TSS A;  1P1A A;  1V5O A;  4KGS A;  1IGD A;  3QHT A;  1WJU A;  4LNO A;  4AJY B;  1IPG A;  2IO1 B;  4DDI D;  2EKE C;  1P9D U;  1T6B X;  1PGA A;  2DNF A;  1GUA B;  1LO5 D;  4W9G A;  5BYQ A;  2LRU A;  4CO7 A;  3PLV A;  2MJD A;  3Q8B A;  4B95 A;  2WU2 B;  4GXB A;  3IXS A;  4IDI A;  4ICU A;  1IBX B;  2JVC A;  2I38 A;  1P7E A;  1UNS A;  1K8R B;  2W55 A;  4HDO A;  4ZHO A;  3BVG A;  1L7Y A;  3EFU A;  2YEP F;  2JXT A;  2NBU A;  2EMT A;  3AE2 B;  4RNA A;  3RNF C;  1SE2 A;  2D3B A;  4PYZ A;  1L6V A;  4B9K A;  3AE9 B;  3ZDT A;  1X1M A;  1NDD A;  2MCN B;  2WDQ B;  4IW0 A;  2BKF A;  2FCQ A;  3ONS A;  1VR9 A;  1MPE A;  3A9J A;  3ML9 A;  1KF6 B;  2DAJ A;  3H7S A;  4O1N A;  2J7Q B;  4B0M A;  2KJR A;  4B6W A;  1WI0 A;  5LNK 1;  1A70 A;  1D5Z C;  1OQR A;  1YNT E;  2BWF A;  3URY A;  4KIK A;  1UH6 A;  4K81 A;  5CTR C;  2FBW B;  2DZJ A;  2FUH B;  3VAW A;  1J19 A;  1V1P B;  5DPS A;  2KQ4 X;  3AE8 B;  1TS5 A;  4JGH B;  1UWX A;  4IM0 A;  1BT0 A;  1XXG A;  4ANW A;  2AYO B;  2WXG A;  3KWV A;  3PV1 A;  2OED A;  4OVZ A;  2D3C A;  1MVK A;  1J7C A;  2KJ6 A;  1OQY A;  1YJ1 A;  1JW9 D;  4DDG D;  2RPV A;  3TEX A;  2LJ5 A;  4LNK A;  2L83 A;  4K3B A;  5IOI A;  4XWW A;  3R3M A;  1ZW7 A;  3AU5 A;  1IYF A;  3L0W B;  1YJJ A;  3ZIM A;  4Q2J A;  1P0R A;  1TS3 A;  4YL8 A;  1SIJ A;  2K22 A;  4RGO S;  4WH4 A;  5AUK A;  2JYT A;  3B1L X;  1KH0 A;  1CQV A;  2K8C A;  3EEC A;  2BYT A;  2FE8 A;  2WDV B;  2ZPN A;  2N1V A;  1YJI A;  4ZRJ A;  2KC1 A;  1QOG A;  1YOV B;  4TV3 A;  4M01 A;  2DBY A;  4LTU A;  2E3T A;  2NBW B;  5BO4 B;  2B3A A;  5BMI A;  1OEY J;  3FKY A;  4HVB A;  2PLP A;  2WXI A;  1RM6 C;  1AN8 A;  2KDE B;  4FXC A;  4GSW A;  1C78 A;  1WGR A;  3U4E G;  1R4N B;  2KWC A;  4YTN B;  1T5X D;  3R7R A;  4E71 A;  4IM3 A;  3GS2 A;  4XC2 A;  4K7W A;  4KDL B;  3QA8 A;  5J2R A;  1F2R C;  3NZU A;  2W54 A;  3MFG A;  1CJE A;  4MH8 A;  2CU1 A;  5H92 C;  4EE2 A;  5FK9 C;  3LYY A;  5T8I A;  2MX2 A;  3U2S C;  1IUE A;  2ZNV B;  3ZXV A;  3QX1 A;  4S0R A;  2IGH A;  2UWQ A;  2RPQ A;  3SD5 A;  2KAC A;  1WR1 A;  3AED B;  4NJC A;  3IT4 B;  3PGE A;  3VTV A;  3DHH C;  2XBB C;  2D07 B;  3B9J A;  2M8S A;  1Q0W B;  1R4M B;  3U7D A;  3C19 A;  3ETR A;  3I3T B;  2PMV A;  3PSE B;  3JYU A;  1JWU D;  1WGY A;  3DBS A;  3WA0 A;  2C9W B;  2MSE D;  3AE3 B;  4WAF A;  4C7Z A;  4ZYS A;  1VRA B;  1UUP A;  3EGR A;  3PRM B;  1SF0 A;  3RYT A;  4HPP A;  1FFU A;  4DK5 A;  2K8B A;  4HRO A;  5CHV C;  4OZB A;  2WXQ A;  4JPS A;  1T0S C;  4FLH A;  2UU7 A;  3L13 A;  3K9O B;  2VZK B;  1QQR A;  2FID A;  1L6U A;  2K9X A;  2WDT B;  3RD2 A;  1S1Q B;  3DBH B;  5LXI B;  3FIL A;  3VH4 B;  2OJR A;  2RD0 A;  2BYV E;  2HJ1 A;  2QMT A;  1TY2 A;  4JQW C;  4W9K A;  4YTM B;  2WXN A;  1GC7 A;  1QOA A;  3A4S C;  3RCZ A;  4BOZ B;  2DZI A;  2JRH A;  2MRP A;  5DPT A;  3VDZ A;  3ZNZ B;  1E8X A;  2DX5 B;  1NBF C;  1EU3 A;  5J17 A;  1WX7 A;  1QZE A;  1MG4 A;  5BMG A;  1JRO A;  2JZ3 B;  1WM3 A;  1T0Y A;  3RFZ B;  1EWY C;  2CU3 A;  3HRD D;  1OEY A;  2X38 A;  4W9H A;  1YX6 B;  3GZN B;  5LLI A;  4G50 A;  1GB4 A;  2MA9 B;  1QOF A;  4WJQ A;  3QCA A;  2MLB A;  2K3U A;  3IG3 A;  1UEL A;  3Q8E A;  2NPT A;  1YQ4 B;  3RN9 C;  2O6V A;  1WGG A;  2WXJ A;  2PKO A;  2Y5P A;  4J3O D;  1GC6 A;  3X23 A;  2LEK A;  3NY5 A;  4I6L B;  3EFC A;  3R66 C;  4LK0 M;  4FJY A;  2KC2 A;  4YSZ B;  4WJN A;  2KDM A;  3SEB A;  2ZCB A;  2BBC A;  2E6X A;  2KHW B;  3ABV B;  1DOX A;  1NI3 A;  1R4M I;  2GBK A;  4L23 A;  2INC C;  4HLE A;  1HQR D;  2V0G A;  4II2 B;  1E8Y A;  3AH7 A;  2AQ1 B;  2BVC A;  2KMM A;  1J8C A;  1DOY A;  2WXM A;  2XEW A;  4ARI A;  4P16 A;  2RDG A;  1TKG A;  1TYG B;  5GMV A;  3ZNH B;  2ZW1 A;  4IWQ A;  1SBB B;  4EOY A;  2QC8 A;  2DYM A;  2M1M A;  3P4S B;  4FAD A;  3PRP B;  4A90 A;  2MP2 A;  2HJ8 A;  2WXL A;  1HXY D;  1P98 A;  1V97 A;  3EUB 2;  1K53 A;  4PK1 A;  1IGC A;  3QJZ A;  3M3J A;  3KW5 B;  3MC0 B;  2ZPY A;  3T3N A;  1ET6 A;  2ASQ A;  4RF0 A;  2KQ7 A;  4GDK A;  1ENF A;  2LGD A;  2LD9 A;  1LXD A;  2HDE A;  2CKH B;  1SXT A;  1M94 A;  2FCN A;  3DBL B;  4C4V B;  1N60 A;  1MG8 A;  3KWL A;  3DHI C;  4K7S A;  2JQR B;  1EF1 A;  2QIL A;  1V1P A;  1WXS A;  4US9 A;  4IOI E;  1D6E C;  1T0R C;  5D2M B;  3VH3 B;  3QIJ A;  1S3S G;  1HZ5 A;  3M95 A;  4L1B A;  3KQ4 A;  2MBQ A;  2WXO A;  2KD0 A;  3GZN I;  5MPO A;  2WXP A;  2K6Q A;  2PE9 A;  2HTM E;  2ICI A;  1P7F A;  1YD8 U;  3UIN B;  4RH6 A;  1G6J A;  1YX5 B;  3H1U A;  3H9D A;  2NMQ A;  4JWS C;  1N6Z A;  1WXM A;  3AMZ A;  3AUL A;  3ECI A;  4YWG G;  2MJ3 A;  1UWM A;  2O6V B;  1JRP A;  2GRI A;  2LWP A;  3A9K A;  3ZXR A;  1E5W A;  2GBM A;  2KVR A;  2NPT B;  3EC8 A;  2KVZ A;  1QLB B;  2FIF A;  4MGI E;  4DHZ E;  4BAX A;  3PHX B;  2WX0 A;  4IG7 B;  2AQ3 B;  2KN5 A;  2D3A A;  3HK0 A;  5KHQ A;  4GDL A;  3VR8 B;  2XN9 C;  2K25 A;  3WIM A;  1WRD B;  2WGS A;  2ON8 A;  3T9L A;  1L0V B;  2LHD A;  4DBG A;  4MSQ B;  4JIO U;  2W3S A;  1BUI C;  3ZDM C;  4XGA B;  4M00 A;  5D3D A;  2MQJ A;  3ZGZ A;  2GMI C;  3TCA A;  4K3C A;  4KDI C;  4A8X C;  4IWO A;  4F1S A;  1V5T A;  4GIV A;  4TQ1 A;  1ZKH A;  3HVD A;  1HA5 A;  5BYR A;  2BB5 A;  3P4R B;  4OZA A;  4YTP B;  3A4R A;  4MSM B;  3N1X C;  2ACZ B;  2N1W A;  2JWZ A;  2KQS A;  4RCO A;  3W9C B;  3TUO A;  3RZW C;  4BBN F;  2KYW A;  1R4N I;  3V6C B;  4HCN B;  4LCD E;  4DHJ B;  1YN5 A;  4WWN A;  3RNA C;  4C00 A;  4MEL A;  1JQ4 A;  1WSP A;  5IN7 A;  1UBQ A;  4YXD B;  4FA6 A;  3P4P B;  4AWJ A;  4EKU A;  1KM7 A;  4MEM A;  3NS8 A;  4MJS A;  5D94 A;  5FR6 A;  4IUM B;  3X0W A;  2WU5 B;  4US8 A;  1FCL A;  4I6N B;  1CZP A;  3Q69 A;  1FNW A;  4N58 A;  1P3Q U;  4M0W B;  3AE7 B;  1I42 A;  2PEA A;  1DGJ A;  2DZK A;  4WIP A;  4HJK A;  2IDY A;  1NI2 A;  1I4Q A;  4GB9 A;  5JHB A;  3I63 C;  2JXX A;  2QIE B;  1EM7 A;  2JRI B;  1V81 A;  2LXA A;  1BXT A;  4K1R B;  2KFK B;  4OHJ A;  2WNM A;  3NVY A;  2MBE A;  3AB5 A;  3UIP B;  1WY8 A;  3Q3J A;  1GAQ B;  1FNU A;  3PHW B;  5C23 A;  4HKZ E;  1KOT A;  3C0R B;  1YMH E;  5E6N A;  2R2O A;  3WCQ A;  3UQA A;  5EE0 A;  4FHK A;  5AZH A;  3HM6 X;  4MGZ E;  1AAR A;  4MGY E;  4II3 B;  4XE0 A;  1LFD A;  2G1E A;  4W9F A;  3L54 A;  2KTR B;  2V9H A;  3DVG X;  3Q2A C;  3ZJV A;  4XZ4 A;  4OVV A;  3ENE A;  3A33 B;  3AEC B;  1V8C A;  4NJ6 A;  2V4L A;  2AL6 A;  2O2V A;  3PZD A;  4JX1 C;  2LVQ A;  2AEH A;  1VJK A;  4HPM B;  3BIN A;  4NPN A;  1I4X A;  4KZC A;  1F1H A;  2J4X A;  2QHO A;  2XK5 A;  4JL9 A;  2OJW A;  3E9S A;  2L76 A;  4DQO C;  2WHI A;  4NAW B;  1WH3 A;  2JUO A;  4GLS C;  4EEW A;  3PRE A;  2H88 B;  2WQY B;  1XLN A;  3DQV A;  2K5P A;  3BVM A;  1KFY B;  1WGH A;  1K50 A;  2KFJ A;  1UGJ A;  3R2I A;  4L2Y A;  3QQ8 B;  1ZUD 2;  4BZA A;  2V3N A;  5IO9 A;  4B0E A;  1UZX B;  1WE7 A;  1A5R A;  4USA A;  3VTU A;  1LM8 B;  2PPH A;  1UBI A;  3B0A A;  1KLU D;  4MM3 A;  4A9A A;  2HE7 A;  2L1A A;  3AE4 B;  4DXF A;  2M56 B;  3Q8F A;  4RF1 A;  2AQ2 B;  1WYW B;  1FIQ A;  2M0X A;  3ZJT A;  1L0X B;  3SU8 X;  4ANX A;  3DBR B;  3GE3 C;  1C79 A;  3I9V 1;  1ROE A;  5EDS A;  1I4R A;  1MI0 A;  3I5J C;  2I1J A;  4DHZ B;  2YLM A;  3PRZ A;  4KIK B;  2BT6 A;  1ESF A;  2QSD A;  1N5X A;  4LJP B;  1JCK B;  4NAM A;  4LDT D;  2Z59 B;  2N7D A;  3NVV A;  4LJO B;  1TKE A;  3MJ5 A;  2BW2 A;  3ZJU A;  3HHM A;  1E7U A;  4X57 B;  2IPK D;  3A9J B;  4EFO A;  1PQS A;  1M4V A;  3ZVV A;  3A1Q B;  3SFE B;  2CJO A;  5HI1 A;  4RGM A;  2NTT A;  1ZXI A;  1ACC A;  3BYT B;  1DOI A;  1TS4 A;  3BYY B;  3PLU A;  3OJ3 A;  1E0Z A;  4P6V F;  1LGR A;  3DBH I;  4FJZ A;  2JYE A;  1TZ1 A;  1C76 A;  2IO3 B;  4ZYN A;  2L00 B;  1JWS D;  1ZDV A;  2OOB B;  1QIL A;  4G11 A;  1E7V A;  3V3X A;  1WZ0 A;  3ALB A;  1UD7 A;  4YSY B;  5JH5 C;  1T3Q A;  5BMH A;  2N9E B;  2DLB A;  3QAR A;  1H4R A;  3NZ3 A;  1WGD A;  2XK5 B;  2FAZ A;  2KWD A;  2CHW A;  1HEZ E;  1WRI A;  2INN E;  4GOC A;  2C7N B;  3T3O A;  5G5H A;  1WZ3 A;  3DVG Y;  3FAH A;  4HWI B;  4WWM A;  4IWP A;  2O2V B;  1UF0 A;  3H8H A;  4WJO A;  4HJG E;  1H8C A;  2L0T A;  2IY1 B;  2W82 A;  2W3R A;  3TIX A;  2KTR A;  1WJ4 A;  3KUD B;  2FNJ B;  3FC4 A;  3R7Q A;  1XF5 L;  2D5G A;  4ZRP A;  2Z8L A;  1SEB D;  3ZYY X;  3BK1 A;  3VXW A;  4WWO A;  4RMA A;  3DPD A;  3AN1 A;  3N3K B;  4KSK C;  4OVU A;  1C3T A;  4H2A A;  2ZCC A;  4KGR A;  2LGI A;  3APD A;  1I4G A;  1V49 A;  1E6E B;  4GU2 A;  1WXA A;  5G55 A;  5CX3 A;  2GBR A;  5BYS A;  3JSV A;  2PTL A;  2I1K A;  3NZS A;  1Y8R C;  1F52 A;  4TQ0 A;  3ZRC A;  2G4D B;  1GB1 A;  5HG2 A;  2KZR A;  1E9M A;  2Y3A A;  4EZJ A;  3ZNG C;  2WXR A;  1VLB A;  3VRA B;  4M0W A;  2D10 A;  2KOX A;  3ZRF A;  2VH2 A;  2NS5 A;  1GPX A;  5C2T B;  1RFA A;  3OWE B;  3O65 B;  3VUW A;  1FM0 D;  4MT5 A;  3N30 A;  2IJ0 A;  4REZ A;  2JZZ A;  1HTQ A;  1WM2 A;  2IND C;  4BKS A;  1GNU A;  2DHZ A;  4TMA B;  2LHE A;  3KYC D;  1Q1O A;  3B08 A;  5IP4 D;  2MWS B;  2NBV B;  2GOW A;  4M8N A;  4FBJ B;  2N7E A;  2CHX A;  2UYZ B;  2L05 A;  3MHZ A;  4R3D A;  2EEL A;  2N4F A;  1SIF A;  1ZP0 B;  2BS4 B;  2M19 A;  2BWE S;  2L7R A;  3BII D;  5G2N A;  1VD2 A;  4MM3 B;  3TEZ A;  2FCS A;  3V60 A;  2X8X X;  3KUZ A;  2KWU B;  1FXA A;  3TMP B;  2LUM A;  3W1S C;  4W9C A;  4HEA 1;  2R2Q A;  3NVW A;  4RM9 A;  4ZDV A;  1B9R A;  1C4A A;  2R61 A;  3L4P A;  1D4B A;  3R2T A;  1GJZ A;  4M02 A;  2AX5 A;  3P42 A;  1WWT A;  5FR3 A;  1QF6 A;  3IHP C;  4LLG M;  3M62 B;  4XWT A;  3KUC B;  2WLB A;  1VDV A;  2IZV B;  1Z5S B;  4GGQ A;  4HRS A;  3CSF A;  2K39 A;  3B2F A;  3GP7 A;  2V1Y A;  2ZEQ A;  4C80 A;  4W9J A;  5AZF A;  3RNC C;  1E8Z A;  2M4N A;  5KHO A;  2PJH A;  1DYQ A;  2M17 A;  2MH7 A;  4PT5 A;  2BGF A;  2RSU A;  4UDU C;  4EZK A;  3P2B A;  1SB3 C;  1JWA D;  4BOS C;  1EUV B;  4HKQ A;  3GOE A;  4CQN A;  4TKN A;  4A20 A;  1D5X C;  4W9D A;  2GB1 A;  5CHW A;  3VTW A;  2IGD A;  4C7Y A;  2KAJ A;  3Q3N C;  1PGX A;  3NRZ A;  3CF6 E;  1YN3 A;  2NR2 A;  2LGS A;  3MC9 A;  3W1S A;  1NEK B;  3P63 A;  2ZVN A;  3DVN U;  3W1Y A;  3L16 A;  2MHJ A;  4KVG B;  2WXF A;  3KLS X;  2WXK A;  5AZG A;  3H6N A;  2CJN A;  4FUL A;  1CMX B;  2DYB A;  1QOB A;  3PPA A;  3RZF A;  4A3P A;  2G9H D;  2FUG 1;  3L08 A;  2IGG A;  3H7P A;  3JSV B;  1F77 A;  2AWT A;  3P1M A;  1FEH A;  1Y56 A;  4HXD A;  3BZD B;  1JWM D;  5E6O A;  2KLC A;  4G3X B;  2DWQ A;  2J0M A;  1J7B A;  2IBI B;  5I4D A;  3W5V B;  3DVN V;  5IAA C;  1ZOY B;  1E7P B;  2MEK A;  4C56 C;  4MJS B;  2KMA A;  2N9K A;  4AUQ C;  1YIW A;  4AQ7 A;  1C1Y B;  4HCP B;  5D3I B;  4HDQ A;  1F2R I;  3VR9 B;  1WF9 A;  2MP2 B;  4N59 A;  2QJL A;  1BML C;  2A4Z A;  3O13 A;  3Q3M C;  2N9P C;  2KMC A;  1D3Z A;  3DHG C;  1FXI A;  4NNJ B;  4URK A;  4RGN A;  4MH0 E;  1NYQ A;  4P1B C;  2IO2 B;  2L32 A;  3R8B A;  2JWU A;  1VZ7 A;  4EUT A;  1UGM A;  1XD3 B;  2PVO D;  4W9L A;  1HE8 A;  4FJV B;  3OAW A;  2ZVO A;  4BVU C;  3AEA B;  3UIO B;  3TJP A;  1HZ6 A;  2KN4 A;  1C9F A;  2JF5 A;  4DXA B;  3AI5 A;  3N1Z C;  2D3G A;  2JZP A;  4GDL B;  2L3Z A;  1WIA A;  3IT6 B;  3UF8 A;  1WGK A;  4CHK A;  2LI5 A;  4PS7 A;  1STE A;  1ZXH A;  1FRD A;  2A5U A;  2KNB A;  2JSV X;  4NQL B;  3HUI A;  3SHQ A;  4NZL B;  1TY0 A;  1RRB A;  4ICV A;  4N9F 4;  3TBL D;  2TSS A;  4GN1 A;  3N20 C;  1JRU A;  1KTK A;  4K7U A;  2IY0 B;  2BYE A;  3EHV A;  2JY6 A;  3RPF C;  3V6E B;  5EE1 A;  1RWS A;  1WXQ A;  1I4P A;  1WR6 E;  1KJT A;  3QC8 B;  3AEG B;  2RDB C;  3DCG A;  3NUH B;  3CIR B;  3KVF B;  3QWZ B;  1JML A;  1WX8 A;  3AE6 B;  3NJT A;  1FFV A;  4FN2 A;  1TKY A;  2YEP B;  3U30 A;  1C4C A;  1FRR A;  3M63 B;  2KXJ A;  1WFY A;  3WAO A;  3ML8 A;  2JU6 X;  1I7H A;  1TT5 B;  2N9X A;  4TUU A;  1N5W A;  2RMM A;  1WMH A;  4BKS D;  4HPL B;  2ZZP B;  1KLG D;  2VRR B;  4JLC A;  4C4V A;  2KT7 A;  4JWU C;  2W9N A;  2JT4 B;  1XQQ A;  5IKC M;  4W9I A;  3ZW3 A;  4BBN C;  2QDF A;  3LJ3 A;  3IAS 1;  1E90 A;  1FMA D;  1IP9 A;  4YSX B;  1V86 A;  3OJ4 B;  4GDK B;  2L0F A;  4KV2 A;  4F7Z A;  2WWZ A;  3PZ8 A;  1ZE3 D;  3TSS A;  2K1F A;  2PIA A;  2KAN A;  1OGW A;  4NAW A;  1C4P A;  2BB6 A;  4MDK E;  2VH1 A;  4WAA A;  1SJE D;  1XLO A;  3VRB B;  1KRH A;  2BTE A;  2GLS A;  1JWB D;  2BKR B;  2KDI A;  3VUX A;  4EZL A;  3U8Z A;  1XCT L;  2J0J A;  1N62 A;  3IAM 1;  2L52 A;  4E74 A;  1EF5 A;  5L95 C;  1FCC C;  1MJD A;  2LVO A;  2V3P A;  3BVZ A;  3AE5 B;  4GMV A;  4RGT A;  2K6D B;  2BQQ A;  4YT0 B;  3SDL C;  2J0K A;  2IYD B;  1PYW D;  3W5U B;  4P1C C;  3ZLZ A;  3I57 A;  1V2Y A;  3HVZ A;  3CMM B;  1ET9 A;  1XT9 B;  1TZO A;  1SGH A;  3LB8 C;  3RUL A;  4AOF A;  4AP4 C;  2LUE A;  2DYO A;  2G45 B;  3DBR I;  3MTN B; 
#chains in the Genus database with same CATH homology
 1Y8R C;  2CKH B;  1M94 A;  2FCN A;  3APF A;  4TQ0 A;  4PS8 A;  3ZRC A;  2G4D B;  1MG8 A;  5TR5 A;  1TBE A;  3PS6 A;  2LGX A;  1VCB A;  2KZR A;  4ANU A;  4K7S A;  1P1A A;  3D32 A;  4EZJ A;  1V5O A;  3ZNG C;  2C5L C;  1EF1 A;  3WAP A;  3QHT A;  4WQO B;  1WJU A;  1WXS A;  5JHA A;  4AJY B;  1IPG A;  2D10 A;  2KOX A;  2IO1 B;  4BFR A;  3ZRF A;  5D2M B;  2NS5 A;  3VH3 B;  2EKE C;  4DDI D;  1Q5W B;  1EO6 A;  1P9D U;  4G0N B;  1RFA A;  3QIJ A;  1S3S G;  3O65 B;  1GUA B;  3VUW A;  5IA7 A;  3M95 A;  3N30 A;  4W9G A;  2GBJ A;  2JZZ A;  2LRU A;  4CO7 A;  1WM2 A;  2MBQ A;  2KD0 A;  3GZN I;  3PLV A;  4MGK E;  1I35 A;  4B95 A;  4BKS A;  2K6Q A;  2PE9 A;  4GXB A;  4P7I A;  1GNU A;  2DHZ A;  4ICU A;  2JVC A;  3KYC D;  3PVL A;  1Q1O A;  1K8R B;  3B08 A;  3ZUN A;  1YD8 U;  2MWS B;  2NBV B;  2GOW A;  4M8N A;  3UIN B;  4FBJ B;  1G6J A;  3K9P B;  1YX5 B;  3H1U A;  2N7E A;  3H9D A;  3MTN B;  2CS4 A;  4HDO A;  2MBO A;  2CHX A;  2C60 A;  1WXM A;  2UYZ B;  2L05 A;  1L7Y A;  1V80 A;  3AUL A;  3ECI A;  3EFU A;  3H7P B;  2LZ6 A;  2N4F A;  2NBU A;  1SIF A;  2EMT A;  2ZNV C;  2O6V B;  2LWP A;  3A9K A;  4ZRI A;  2BWE S;  4I6P A;  2ZJD A;  1E5W A;  2GBM A;  2KVR A;  2NPT B;  1YQB A;  2L7R A;  3EC8 A;  1WMH B;  4PYZ A;  2FIF A;  2Z0E B;  4B9K A;  4MGI E;  4DHZ E;  5G2N A;  1VD2 A;  3PHX B;  2WX0 A;  1X1M A;  3ZDT A;  1NDD A;  2MCN B;  4IG7 B;  4BKG A;  4IW0 A;  2BKF A;  2KN5 A;  2FCS A;  3V60 A;  4CYE A;  3BY4 B;  1FXT B;  2FCQ A;  2L8J A;  3HK0 A;  3ONS A;  4GDL A;  5KHQ A;  3KUZ A;  2HD5 B;  3A9J A;  2KWU B;  3ML9 A;  2LGY A;  2K25 A;  4PYU A;  3TMP B;  3WIM A;  4E3C A;  1WRD B;  3W1S C;  4W9C A;  2R2Q A;  3ZO5 B;  4RM9 A;  1WE6 A;  5E6P A;  4ZDV A;  2DAJ A;  3H7S A;  3T9L A;  2J7Q B;  2KJR A;  3DBL I;  4B6W A;  4DBG A;  4MSQ B;  1WI0 A;  1GJZ A;  4BKT A;  4JIO U;  4J6I A;  4XX5 A;  3ZDM C;  2V3S A;  2BWF A;  2MQJ A;  4KIK A;  2GMI C;  2LAS A;  3TCA A;  5HKH A;  3IHP C;  3M62 B;  2CHZ A;  4KDI C;  1UH6 A;  2D2Q A;  3KUC B;  4IWO A;  5DPR A;  4WWP A;  4F1S A;  2IZV B;  1V5T A;  4K81 A;  4GIV A;  1Z5S B;  4GGQ A;  3OLM D;  5CTR C;  3CSF A;  3PTF C;  2K39 A;  4TQ1 A;  5J18 A;  1ZKH A;  2DZJ A;  2FUH B;  3VAW A;  1J19 A;  2V1Y A;  1RAX A;  3VUY A;  2ZEQ A;  5DPS A;  2Y5B B;  4W9J A;  5AZF A;  5CHF A;  3V62 A;  2RR9 A;  3A4R A;  1E8Z A;  2M4N A;  4MSM B;  2PJH A;  5KHO A;  4A3O A;  2N1W A;  1WXV A;  2JWZ A;  4JGH B;  2KQS A;  3RZW C;  4BBN F;  1BT0 A;  1OTR B;  2M17 A;  4IM0 A;  2KJH B;  2AYO B;  2BGF A;  2RSU A;  1R4N I;  4ANW A;  4EZK A;  3V6C B;  2BF8 B;  3P2B A;  3PV1 A;  3TL5 A;  4HCN B;  4LCD E;  4DHJ B;  2KJ6 A;  4BOS C;  1EUV B;  2MBH A;  4WWN A;  1OQY A;  1YJ1 A;  2LVP A;  4MEL A;  4PS3 A;  4IC7 B;  3GOE A;  1UBQ A;  4FA6 A;  4TKN A;  4WJP A;  4A20 A;  4DDG D;  4AWJ A;  4W9D A;  4EKU A;  1KM7 A;  2LJ5 A;  2REX A;  3MHS D;  4MEM A;  3NS8 A;  5CHW A;  4MJS A;  3VTW A;  3R3M A;  5D94 A;  5FR6 A;  1ZW7 A;  1Z2M A;  1U4A A;  3AU5 A;  1IYF A;  3L0W B;  3VQI A;  2RGF A;  3CST A;  4IUM B;  3ZIM A;  3X0W A;  1GG3 A;  1P0R A;  3CF6 E;  2NR2 A;  1TTN A;  4I6N B;  4YL8 A;  3W1S A;  2ZVN A;  3DVN U;  5DPW A;  3W1Y A;  5JZE B;  3L16 A;  1P3Q U;  3B1L X;  4M0W B;  4KVG B;  1J0G A;  2G3Q B;  2K8C A;  3EEC A;  5AZG A;  1I42 A;  2PEA A;  2KX3 A;  2DZK A;  3H6N A;  3S2A A;  4HJK A;  2ZPN A;  1NI2 A;  4FUL A;  4GB9 A;  1CMX B;  2N1V A;  2DYB A;  5JHB A;  3PPA A;  3RZF A;  3DDC B;  2JXX A;  4ZRJ A;  4A3P A;  2IO0 B;  2JRI B;  2K8H A;  2KC1 A;  2DAF A;  3L08 A;  3AU4 A;  4TV3 A;  2CR5 A;  1V81 A;  3H7P A;  3JSV B;  2LXA A;  2AWT A;  4K1R B;  2KFK B;  2NBW B;  2KKC A;  5BO4 B;  2B3A A;  2FCM A;  4HXD A;  1OEY J;  4HVB A;  2MBE A;  5E6O A;  2KLC A;  4AJW A;  2KDE B;  4G3X B;  4GSW A;  3UIP B;  3NHE B;  2J0M A;  1WY8 A;  3Q3J A;  1SE9 A;  1WGR A;  2IBI B;  4M8M A;  3PHW B;  5C23 A;  3HIZ A;  2KWC A;  1KOT A;  3C0R B;  3DVN V;  5E6N A;  4KZ0 A;  3R7R A;  5IAA C;  1V9J A;  1KLV A;  2R2O A;  4E71 A;  4MJS B;  2KMA A;  4IM3 A;  3UQA A;  4XC2 A;  4FHK A;  4AUQ C;  2WYQ A;  4K7W A;  5AZH A;  1YIW A;  3HM6 X;  3QA8 A;  1C1Y B;  4HCP B;  4KDL B;  5J2R A;  4MGZ E;  3NZU A;  1AAR A;  2BYF A;  4MGY E;  4HDQ A;  4II3 B;  3IVF A;  1LFD A;  2BPS A;  2CU1 A;  2NVU I;  4W9F A;  3L54 A;  2MW5 A;  2EMS A;  1WF9 A;  1L2N A;  2KTR B;  2MP2 B;  2MX2 A;  3DVG X;  2NCN A;  2A4Z A;  2ZNV B;  3IBE A;  3QX1 A;  4XZ4 A;  2UWQ A;  4OVV A;  3ENE A;  2JPH A;  2RPQ A;  3SD5 A;  1WR1 A;  2N9P C;  4HK2 A;  2KMC A;  4W9E A;  3A33 B;  2MBB B;  3N32 A;  3PGE A;  3VTV A;  1D3Z A;  2HTH A;  4NJ6 A;  2XBB C;  2D07 B;  2M8S A;  2V4L A;  1Q0W B;  4NNJ B;  3U7D A;  2AL6 A;  4URK A;  2O2V A;  2WX1 A;  3WAM A;  3PZD A;  3I3T B;  2LVQ A;  4MH0 E;  2AEH A;  2IO2 B;  3PSE B;  3JYU A;  4HPM B;  3BIN A;  4RM8 A;  4NPN A;  3APC A;  4NY0 A;  4EUT A;  1TGZ B;  3A1Q A;  4ZRK A;  1E8W A;  1WGY A;  3DBS A;  1UGM A;  4KZC A;  2QHO A;  4JL9 A;  2XK5 A;  3WA0 A;  2C9W B;  2MSE D;  2L76 A;  1XD3 B;  4W9L A;  3KH0 A;  1HE8 A;  4NAW B;  1WH3 A;  2JUO A;  4FJV B;  4EEW A;  3IFW B;  3PRE A;  3OAW A;  3DQV A;  2ZVO A;  3V61 A;  4BVU C;  2LXC A;  3PRM B;  3UIO B;  1WGH A;  3RYT A;  2KFJ A;  4DK5 A;  3TJP A;  3QQ8 B;  5D6J B;  2K8B A;  2JF5 A;  5CHV C;  4DXA B;  1WJ6 A;  1UZX B;  1WE7 A;  1A5R A;  3AI5 A;  2GBN A;  2D3G A;  4FLH A;  3L13 A;  3VTU A;  4GDL B;  3K9O B;  1LM8 B;  2L3Z A;  1WIA A;  3UF8 A;  2FID A;  4CHK A;  2LI5 A;  2PPH A;  1UBI A;  2KO3 A;  3B0A A;  4PS7 A;  4MM3 A;  2WDT B;  3DOW A;  3RD2 A;  2HE7 A;  1S1Q B;  2KX0 A;  3QK0 A;  5LXI B;  4NJ7 A;  2KDB A;  2A5U A;  3VH4 B;  2KNB A;  1WYW B;  2OJR A;  2RD0 A;  4NQL B;  2BYV E;  3JW0 X;  4JQW C;  2C7M B;  4W9K A;  3WAL A;  2M0X A;  3SHQ A;  1GC7 A;  3NOB A;  1RRB A;  4ICV A;  3A4S C;  3SU8 X;  3RCZ A;  4N9F 4;  2DZI A;  3TBL D;  2JRH A;  2MRP A;  4BOZ B;  5EDS A;  4GN1 A;  4DHZ B;  2I1J A;  1JRU A;  5DPT A;  2YLM A;  3PRZ A;  4KIK B;  4DWF A;  3WAN A;  4K7U A;  3VDZ A;  2IY0 B;  2BYE A;  3L17 A;  3ZNZ B;  3EHV A;  2JY6 A;  1E8X A;  4LJP B;  3V6E B;  4LDT D;  3LDZ E;  2Z59 B;  2DX5 B;  1NBF C;  2N7D A;  4LJO B;  1WR6 E;  2D11 A;  1KJT A;  3QC8 B;  5J17 A;  1WX7 A;  1QZE A;  3DCG A;  3JVZ X;  3KVF B;  2JZ3 B;  3QWZ B;  3HHM A;  1WM3 A;  1E7U A;  1T0Y A;  1WX8 A;  5L83 A;  4FN2 A;  4X57 B;  3A9J B;  4EFO A;  1PQS A;  1OEY A;  4W9H A;  1YX6 B;  3U30 A;  3ZVV A;  5LLI A;  3RUI B;  1RLF A;  4G50 A;  3A1Q B;  2MA9 B;  3UGB B;  4WJQ A;  3M63 B;  3QCA A;  2MLB A;  1V6E A;  2KXJ A;  1WFY A;  3WAO A;  3ZNI D;  3ML8 A;  3IG3 A;  1UEL A;  2N9X A;  4TUU A;  1WMH A;  2NPT A;  4BKS D;  3HM3 A;  4HPL B;  2ZZP B;  2O6V A;  3PLU A;  1WGG A;  2VRR B;  3OJ3 A;  4JLC A;  2Z0D B;  3DBH I;  2LRW A;  1GC6 A;  4FJZ A;  2KTF A;  3A9K B;  3X23 A;  3UQB A;  1TZ1 A;  5DCN A;  3NY5 A;  4NQK E;  4I6L B;  2W9N A;  1LQB A;  2DEN B;  2IO3 B;  1XQQ A;  2JT4 B;  4ZYN A;  2L00 B;  3R66 C;  2KK8 A;  4W9I A;  4FJY A;  2KC2 A;  3ZW3 A;  4WJN A;  4BBN C;  3LJ3 A;  3ZTD A;  3QAQ A;  1E90 A;  2ZCB A;  4ANV A;  1WX9 A;  3MJW A;  1IP9 A;  2OOB B;  2AL3 A;  1V86 A;  3OJ4 B;  2KHW B;  4GDK B;  2L0F A;  4KV2 A;  4F7Z A;  2WWZ A;  1R4M I;  2GBK A;  4G11 A;  1E7V A;  3RT3 B;  4ANX A;  2K1F A;  1WZ0 A;  2KAN A;  1OGW A;  3VVW B;  4HLE A;  2O6V D;  3AXC A;  3ALB A;  4NAW A;  4MDK E;  1UD7 A;  5JH5 C;  4WAA A;  3KYD D;  2KDF B;  4II2 B;  4ASW C;  1E8Y A;  2N9E B;  3QAR A;  1H4R A;  5LXH A;  5D7G A;  1WGD A;  3Q3F A;  4DHJ D;  2BKR B;  2XK5 B;  1J8C A;  2FAZ A;  2CHW A;  2KFK A;  2KDI A;  3VUX A;  2XEW A;  4EZL A;  3VHT C;  4GOC A;  2C7N B;  3U8Z A;  4KSL C;  3T8M A;  2C7H A;  5GMV A;  3ZNH B;  1WZ3 A;  3PT2 B;  3DVG Y;  4HWI B;  4IWP A;  2O2V B;  1ZGU B;  4IWQ A;  2J0J A;  4WJO A;  4EOY A;  1H8C A;  5C1Z A;  2DYM A;  2YVC A;  2M1M A;  2L0T A;  4FAD A;  3PRP B;  2IY1 B;  1ISN A;  4E74 A;  1EF5 A;  5L95 C;  1F9J A;  2DZM A;  3TIX A;  2KTR A;  2MP2 A;  2LVO A;  1WJ4 A;  3KUD B;  2HJ8 A;  4F8C B;  2FNJ B;  1P98 A;  3R7Q A;  3VFK A;  4GMV A;  2K6D B;  2KLG A;  4LDT B;  4FHJ A;  3VXW A;  4IM2 A;  3SDL C;  4WWO A;  2J0K A;  4RMA A;  2IYD B;  3QJZ A;  3M3J A;  3KW5 B;  3ZTC A;  3DPD A;  3ZLZ A;  3N3K B;  4KSK C;  2ZPY A;  4OVU A;  5AEK B;  1C3T A;  2ASQ A;  1V2Y A;  2ZCC A;  3CMM B;  3ZKJ C;  3APD A;  1V49 A;  2KQ7 A;  4GDK A;  2PE6 B;  1WJN A;  2KWV B;  1XT9 B;  4GU2 A;  1WXA A;  1SGH A;  2LD9 A;  5G55 A;  1LXD A;  3RUL A;  4AOF A;  2G4S A;  5CX3 A;  2GBR A;  4AP4 C;  2LUE A;  2DYO A;  2G45 B;  3JSV A;  3DBR I;  2LGD A;  2I1K A;  3NZS A;  3L10 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...