1KLVA

Solution structure and backbone dynamics of gabarap, gabaa receptor associated protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
GEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1H, 13C and '5N resonance assignments of GABARAP, GABAA receptor associated protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords GABA(A) Receptor associated protein
total genus 12
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2001-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1klvA00
4KSLC 3PV1A 1V5OA 2LZ6A 2PPHA 4FA6A 3VDZA 4AWJA 2AYOB 2MCNB 1RAXA 2GMIC 1V2YA 4LCDE 4NNJB 2NR2A 4JQWC 3VFKA 2M1MA 2KWUB 2Y5BB 3CSTA 1C1YB 3QARA 2YVCA 1KJTA 3X0WA 2LGXA 3AULA 2IY1B 3L16A 4ZYNA 2J0MA 2MWSB 3UQBA 1WYWB 2N9XA 2AWTA 2KDEB 4G3XB 2M8SA 3RYTA 3PTFC 3MHSD 2ZJDA 5DCNA 2KJRA 2JY6A 3L0WB 1K8RB 3KYDD 1QZEA 2K1FA 3M3JA 2JRHA 2KHWB 3DOWA 4W9FA 4DHZE 1F9JA 2KLGA 4B6WA 4B9KA 1OEYA 4MGKE 4IC7B 4IW0A 4NJ7A 3ZVVA 3DVGX 4DHJD 5AZHA 4HDOA 4WJOA 2MP2A 2OOBB 1P9DU 3APFA 3UINB 4NPNA 2N7EA 3RULA 2MBHA 3W1SC 1WM3A 4GN1A 3QC8B 3LDZE 2NCNA 3DVGY 5D6JB 1BT0A 1G6JA 3NOBA 3ZTDA 4NQLB 4FADA 2WWZA 3PT2B 4IWPA 4EZKA 3U7DA 1E5WA 4I6NB 2MX2A 2NVUI 1VD2A 2CHXA 2MLBA 3TBLD 4MGIE 4K7WA 2EMSA 2KK8A 4KDIC 4BBNC 2LJ5A 3R3MA 1H8CA 2IYDB 3HIZA 1ZGUB 1WZ3A 3QWZB 2K8CA 3C0RB 3L17A 5C1ZA 1P0RA 4TV3A 3PPAA 1WX7A 2KWVB 2IO1B 2D2QA 3N3KB 1V5TA 3DVNU 2KJHB 1NI2A 2C7MB 1WXSA 4WWPA 4E74A 1NBFC 3PZDA 1R4NI 4AUQC 4LJPB 2FCMA 4YL8A 5AZGA 4ANVA 2FUHB 3U8ZA 2KJ6A 2R2OA 3KUCB 2K25A 5G2NA 3A9JA 2N1WA 3ZDTA 2UYZB 1M94A 2KD0A 4II2B 4URKA 1C3TA 2BPSA 2C5LC 2K8HA 2KANA 3PHWB 2CHWA 3ZDMC 1OGWA 2KMAA 2L00B 3GZNI 4FHKA 5C23A 4BOSC 2KZRA 3A4SC 4G0NB 2N9EB 5E6PA 4IWOA 3H6NA 2MQJA 1WR1A 3KH0A 4EZJA 1UGMA 4GOCA 3OLMD 3DVNV 1RLFA 1H4RA 2I1JA 3JSVB 4J6IA 2BWFA 1YX6B 1SE9A 4MSQB 1WI0A 4PS7A 2KVRA 2ZZPB 5FR6A 4DK5A 3MJWA 1Q1OA 2VRRB 1J0GA 1IYFA 3IG3A 2JVCA 3A9KA 4JGHB 3VH3B 2WDTB 1WF9A 4WJQA 1YQBA 3RD2A 3UF8A 2KLCA 2EKEC 3ML9A 3SDLC 4F7ZA 2BYEA 2EMTA 4FULA 4RM9A 4FBJB 3VUYA 1UBIA 4FJZA 2LXAA 2Z0DB 2FCSA 4WJNA 4F1SA 2KNBA 1V49A 2LXCA 2OJRA 2JWZA 3PS6A 4W9LA 4W9DA 2N1VA 1XT9B 4A3PA 1YJ1A 4BKGA 2BKRB 4DWFA 3WALA 5DPSA 4FLHA 2N9PC 4DXAB 3QK0A 4HCNB 1JRUA 2KXJA 4A3OA 4OVVA 3A4RA 4EZLA 2DAFA 4NQKE 2LASA 1P1AA 3IVFA 1GJZA 1WZ0A 1WR6E 1LM8B 3ECIA 3EHVA 5HKHA 2NPTB 3JSVA 4K1RB 4CO7A 2LGDA 4HJKA 3JVZX 2DZIA 2R2QA 2A4ZA 4DBGA 3WA0A 2LUEA 4EKUA 3N30A 4KZCA 4ZRKA 4JLCA 3WAMA 1L7YA 1Z5SB 2FAZA 2YLMA 3K9PB 1WX8A 3R7QA 4W9KA 3KW5B 4WAAA 2L05A 1XQQA 1WJ6A 4EEWA 3HM3A 3TL5A 5BO4B 1P98A 4HXDA 2FNJB 1GUAB 4E3CA 4XC2A 1KLVA 2LD9A 4HWIB 2DYOA 3VQIA 2DZMA 2G3QB 3A9JB 3IFWB 2KFKA 3NS8A 1TZ1A 2ZCBA 2GBNA 1WJ4A 4W9EA 4DDID 2PEAA 2RD0A 4A20A 5TR5A 2JXXA 1FXTB 4FHJA 3I3TB 4G50A 2ZPYA 2ASQA 4NY0A 2DZKA 4MM3A 2NS5A 4ANWA 3ZNHB 4AJYB 4GMVA 3ZKJC 2N7DA 4PS3A 5JZEB 2FCQA 2LVOA 3IHPC 4GDKB 1V80A 2WX0A 3R66C 3SHQA 2XBBC 3NZUA 3VTUA 3TJPA 3DBHI 1WH3A 2RR9A 4F8CB 3ZW3A 3DQVA 2KTRB 2DYBA 1ZKHA 4JIOU 2CS4A 2ZNVB 2LRUA 3GOEA 4BKSA 2B3AA 3VTWA 4RM8A 2ZPNA 2K6DB 3JW0X 1WM2A 4M0WB 1WXVA 4EOYA 2LVQA 5GMVA 3ZRCA 5JHAA 5LXIB 5IA7A 4XZ4A 2L76A 3KUZA 2J0JA 4II3B 5CHVC 4CHKA 3APCA 3V62A 4IG7B 2MA9B 2KTFA 2IO0B 1RFAA 3RZFA 4BOZB 3WIMA 2PE6B 2KOXA 1EF5A 3ALBA 2NPTA 3EC8A 1WGYA 2ZVNA 4MH0E 5CHWA 3HK0A 2M0XA 2GBKA 2RSUA 4JL9A 4I6PA 3A9KB 4HLEA 2KC2A 2JRIB 2GOWA 2GBJA 2KX0A 4ICUA 2MSED 3M63B 2Z0EB 5D2MB 4DHJB 2G45B 2IO3B 3V6EB 5CHFA 2KFJA 2G4SA 3L08A 3OJ4B 1I35A 2JT4B 1WY8A 2BKFA 2DENB 2JUOA 3QHTA 3RT3B 1A5RA 4FN2A 4I6LB 1WGGA 1IP9A 3B1LX 1LFDA 3T8MA 2HJ8A 3CSFA 4HDQA 5KHOA 3ZIMA 3IBEA 3PSEB 2BGFA 2O6VA 2HTHA 3QJZA 2BYVE 1WE6A 2L3ZA 1OEYJ 3DBRI 4MELA 3TMPB 4LDTB 3QQ8B 1UBQA 4KZ0A 1E7VA 1WGDA 2FIDA 3N32A 2ZCCA 4GDKA 3PRMB 5DPTA 1OTRB 4TKNA 2MRPA 2D07B 1WXMA 3SU8X 4M8MA 4XX5A 2O6VD 1GC7A 5J2RA 2CKHB 4EFOA 2NBVB 2MBOA 4GXBA 1WXAA 1CMXB 1SGHA 3DDCB 3D32A 4RMAA 4OVUA 3ZO5B 3UQAA 3NY5A 3RZWC 1LXDA 2ZNVC 2M17A 3APDA 3DBLI 4AP4C 3BINA 5L83A 1LQBA 1AARA 2ZEQA 3V6CB 4W9HA 2BWES 3KVFB 3H7SA 1WE7A 2JF5A 3W1SA 4GDLA 3VXWA 3A1QB 3VTVA 1WIAA 4GGQA 4K81A 1J8CA 4ZDVA 2JZ3B 1T0YA 4KIKA 5L95C 2GBMA 2D3GA 3B08A 4WWNA 4HVBA 2NBWB 4CYEA 2CU1A 5J18A 3PLVA 4IUMB 1MG8A 3R7RA 5JHBA 3V61A 3QX1A 3S2AA 2KDBA 3QA8A 4AOFA 3VH4B 1UZXB 2V3SA 2V1YA 1WJUA 3KYCD 1PQSA 4MGYE 5CX3A 1L2NA 4KVGB 1ZW7A 5EDSA 4BVUC 2MP2B 3DBSA 2JPHA 4KSKC 2KDFB 3M62B 2PE9A 2XK5A 5D7GA 4GSWA 3WANA 2HE7A 2D11A 3PRPB 3UIPB 1Q5WB 1NDDA 2O2VA 2QHOA 2WX1A 2N4FA 5E6NA 2MBQA 3W1YA 2K39A 2V4LA 2FCNA 4W9JA 3PGEA 4MGZE 2KMCA 1KM7A 2ZVOA 2C7NB 3PREA 4HPMB 1E8YA 4TQ0A 3LJ3A 3MTNB 2CHZA 2DX5B 3DCGA 4IWQA 4ZRIA 4BFRA 1GNUA 1WGRA 3T9LA 2BYFA 1V86A 4M8NA 2AEHA 2KC1A 2G4DB 3L10B 1R4MI 2KN5A 4ZRJA 2KX3A 5G55A 4ASWC 2L8JA 4GIVA 5JH5C 3ZNID 3EFUA 5KHQA 2KDIA 4NAWA 4E71A 2LRWA 4ANXA 3H7PB 1X1MA 2IO2B 4W9GA 1WMHA 2MBBB 3ZTCA 4BBNF 1XD3B 2WYQA 4AJWA 3L54A 1WJNA 3QAQA 1WFYA 1V9JA 1V6EA 2CR5A 3H1UA 2D10A 3OJ3A 3PLUA 4N9F4 3SD5A 3QCAA 3ZNGC 2O6VB 3K9OB 3JYUA 3A33B 1E7UA 1E90A 3X23A 2C7HA 1TGZB 4IM3A 2DZJA 4WJPA 3Q3JA 1WMHB 3DPDA 4W9IA 1Z2MA 2RGFA 1IPGA 1GG3A 2UWQA 4FJYA 1TBEA 3O65B 4PS8A 3PVLA 4KV2A 3H7PA 4W9CA 1P3QU 1S1QB 3CF6E 4HK2A 3ZUNA 2HD5B 2L0FA 4WQOB 3AU5A 3ENEA 1YIWA 4K7UA 2DHZA 4LJOB 3VAWA 5D94A 2A5UA 3Q3FA 2LWPA 4HCPB 1UH6A 3P2BA 2IZVB 2IBIB 2XEWA 2GBRA 2KQSA 4NAWB 4WWOA 1S3SG 5J17A 5DPWA 1GC6A 5CTRC 2PJHA 2IY0B 2XK5B 3ZRFA 1E8ZA 3QIJA 3TIXA 1U4AA 2L0TA 2REXA 2C60A 2W9NA 2FIFA 4DHZB 3V60A 3VUWA 4X57B 4GU2A 2RPQA 4KDLB 3UGBB 4FJVB 3ZLZA 4MJSA 4TQ1A 2O2VB 2I1KA 2K8BA 4B95A 4BKSD 1YX5B 2K6QA 4MJSB 1V81A 1Y8RC 4TUUA 2KKCA 3BY4B 4K7SA 1WGHA 3RCZA 2KTRA 4KIKB 2LI5A 1WX9A 3NHEB 1EUVB 3KUDB 2M4NA 2AL3A 2KO3A 4PYUA 4EUTA 1KOTA 1J19A 4P7IA 4GDLB 4MDKE 5AZFA 5E6OA 5DPRA 1I42A 1SIFA 3PHXB 2KWCA 1D3ZA 5LXHA 1EO6A 3AI5A 3B0AA 3UIOB 3M95A 5AEKB 1Q0WB 3ZNZB 1WRDB 3U30A 2NBUA 4DDGD 1ISNA 2J7QB 1TTNA 1VCBA 1EF1A 1RRBA 3NZSA 1OQYA 2LGYA 1E8WA 3A1QA 5IAAC 2DAJA 2AL6A 2C9WB 2J0KA 2JZZA 2MW5A 3H9DA 3AXCA 1HE8A 3PRZA 2KFKB 2L7RA 1E8XA 3EECA 3HM6X 4G11A 4MEMA 4MSMB 2Z59B 3TCAA 3WAPA 4ICVA 3ML8A 3CMMB 4PYZA 2MBEA 2KQ7A 4NJ6A 3L13A 3HHMA 3OAWA 4IM0A 1YD8U 4HPLB 3AU4A 2DYMA 3RUIB 4BKTA 3VUXA 3VVWB 1UELA 1UD7A 4LDTD 3ONSA 4ANUA 4GB9A 3VHTC 5LLIA 4IM2A 3WAOA 2BF8B 2LVPA
chains in the Genus database with same CATH superfamily
2LGSA 1I4XA 4FA6A 4AWJA 3Q8AA 1I4RA 1V2YA 4NNJB 3N1ZC 2M1MA 3CSTA 3QARA 2YVCA 2YEPF 4LTUA 4ZYNA 2J0MA 2D5GA 3BVZA 2IGDA 4KGTA 4P6VF 2WS3B 1B1ZA 3PTFC 1TKEA 2I2YA 2JY6A 3L0WB 3KYDD 2QJLA 2K1FA 2JRHA 2KHWB 1ZOYB 3RNGC 3C8YA 2KLGA 1QILA 4L1BA 4IC7B 3IT4B 4IW0A 2LJIA 3ZVVA 2SEBD 5HG2A 2OOBB 1P9DU 2TSSA 4A55A 3H8HA 2WHIA 2QDFA 2MBHA 4GN1A 3LDZE 1RM6C 3ZTDA 2WWZA 4HRSA 2NVUI 1VD2A 5E6JA 4BBNC 3QWZB 1N62A 3AEFB 1P0RA 1FIQA 2D2QA 3TUOA 4WWMA 2C7MB 5IO9A 4E74A 1R4NI 1EWCA 4AUQC 4ANVA 5AZGA 1C79A 3KUCB 3A9JA 3ZDTA 5D3DA 1YQ3B 2W54A 2C5LC 2K8HA 4KKIA 3ZDMC 3BIID 2KMAA 5C23A 1TKYA 4FHKA 2KVZA 2KZRA 1T0QC 4XE0A 1T0RC 2BS4B 1UGMA 4ZHOA 2JU6X 1SE9A 3B2FA 5FR6A 1Q1OA 3A9KA 5HHDG 1J7AA 3AE1B 3FILB 3V05A 3VH3B 3W9CB 4WJQA 5G5GA 3RD2A 3UF8A 3ML9A 3SDLC 4FULA 3NVZA 1TS4A 4K3CA 1UBIA 2LXAA 4F1SA 2FCSA 1PUTA 2JWZA 3NVYA 2V3PA 2N9PC 2BTEA 1DGJA 4OVVA 2LASA 2LEKA 3AEDB 4RGTA 1WZ0A 1SJHD 3ECIA 2WQYB 4OHJA 3JSVA 2KACA 3JVZX 4MM3B 5FR3A 5T8IA 4WAAA 2L05A 1WJ6A 3Q8BA 4EEWA 4C7ZA 1A70A 2FNJB 1KLVA 2LD9A 2DYOA 1C76A 2RDBC 3HRDD 2GBNA 4DDID 2JXXA 5D3IB 4Q2JA 4S0RA 1JALA 4ANWA 3B9JA 4XWWA 5JZEB 3IHPC 4GDKB 1V80A 3SHQA 3R66C 1Y56A 4F8CB 3ZW3A 2B3AA 1JWSD 1WSPA 4M0WB 3MC0B 2LVQA 2INCC 1JQ4A 1IUEA 1ZDVA 4CHKA 4US8A 3Q6BA 2IO0B 4BOZB 3EFCA 1CK1A 1EF5A 3AE9B 1WGYA 4MH0E 2RSUA 4JL9A 4HLEA 2MSED 4TSSA 5D2MB 1DYQA 2KFJA 3L08A 2DNFA 2JT4B 2BB5A 2FBWB 4FXCA 4FN2A 2INDC 3OWEB 3B2GA 3B1LX 1LFDA 2KT7A 3T8MA 4HDQA 1D5XC 3IBEA 2BGFA 2O6VA 2HTHA 2L83A 1I7HA 1UF0A 3DBRI 1UBQA 1WGDA 2FIDA 3RI7C 2MRPA 1LGRA 1WXMA 2OHFA 1K52A 5J2RA 1ZUD2 2MBOA 4GXBA 4RMAA 3RZWC 2ZNVC 3VR8B 3DBLI 3DHGC 1LQBA 2ZEQA 3AE3B 2GRIA 1WE7A 3I63C 2KDMA 2JF5A 2RDHA 3EA6A 1QKZA 2NTTA 3DWMA 4AQ7A 2JZ3B 1JWAD 2QCZA 2LUMA 2GBMA 2D3GA 4WWNA 1K51A 4HVBA 1BXTA 1HEZE 2CU1A 5J18A 2KQ4X 3QA8A 4AOFA 3VH4B 2PMVA 2V1YA 3KYCD 3EUB2 1ZW7A 2MP2B 1FD6A 2KDFB 4IOIE 5D7GA 5BYSA 3UIPB 1Q5WB 4LLGM 1NDDA 2O2VA 2QHOA 5E6NA 2K39A 4W9JA 3TEZA 4MGZE 2KMCA 4UDUC 3PREA 4HPMB 3LJ3A 3AEAB 2CHZA 2N9KA 1J7CA 3ABVB 3NVWA 1VZ7A 3T9LA 2BYFA 4M8NA 3AN1A 3Q3OC 2L8JA 3EFUA 4E71A 3CIRB 3AEEB 2ICIA 2MBBB 2WXNA 1L0XB 1XD3B 2QMTA 3ZXRA 1WJNA 3NZ3A 1WFYA 3H1UA 3P1MA 3QCAA 1N61A 3K9OB 2J4XA 1TYGB 1SIJA 1CZPA 3X23A 2JSVX 1ESFA 3Q3JA 2VH1A 4XWTA 1Z2MA 1IPGA 1GG3A 1PYWD 2VZKD 3O65B 4PS8A 4KV2A 1VZ6A 2MH7A 1P3QU 4HK2A 4MH8A 3ZUNA 2HD5B 2L0FA 2X38A 4K7UA 3Q3FA 2LWPA 3NVVA 5FKAC 3BYYB 1MVKA 5DPWA 2VH2A 4L23A 1E8ZA 1PGBA 2CU3A 2L0TA 1L6VA 3KWVA 3UGBB 1UGJA 3O13A 2O2VB 2V0GA 1YX5B 1FPYA 2KKCA 1E7PB 4LNKA 1CQVA 1F2RI 3KUDB 2M4NA 4N59A 1J19A 4P7IA 4GDLB 5AZFA 1HTQA 4YT0B 4DDGD 2K0PA 3NZSA 1RRBA 1E8WA 2MW5A 3H9DA 1KH0A 3U2SC 2Z59B 3WAPA 4ICVA 4HROA 1ACCA 2KQ7A 1RWSA 4HPLB 4HPPA 3RUIB 3VVWB 1UELA 4LDTD 4GB9A 3VHTC 2G9HD 2LVPA 2BQQA 1VDVA 4A8XC 1RAXA 2NR2A 2K3UA 4JQWC 2KWUB 1C1YB 3X0WA 4LNIA 1WYWB 2AWTA 2KDEB 4G3XB 3RYTA 3MHSD 5DCNA 1QZEA 1ZP0B 4B9KA 4DHJD 3DVGX 2MP2A 4EE2A 3TEYA 1WRIA 2WXPA 3W1SC 1WM3A 3DVGY 1F52A 2AQ2B 4JWSC 2MX2A 1ENFA 3VRAB 2Y3AA 2VZKB 2MLBA 3TBLD 1VLBA 4K7WA 2EMSA 4KDIC 1QOGA 4RGOS 1NI3A 2IYDB 3DBHB 4RGMA 2QEJC 3HUIA 3N3KB 4DXFA 3R8BA 1QLBB 1F0ZA 1V1PB 2L32A 4YL8A 1EU4A 2Z8LA 3U8ZA 4YSYB 2R2OA 1VZ8A 2UYZB 1AW7A 3N20C 2KD0A 3FKYA 4II2B 4C80A 4URKA 4KGRA 5EE1A 4GLSC 1OGWA 1FRRA 2NTSA 5E6PA 2MQJA 1PDXA 3KH0A 4EZJA 2ONQA 4GOCA 1HTOA 3OLMD 1RLFA 2J52A 4OZAA 4OZBA 4MSQB 4J6IA 4J3OD 1XXGA 4DK5A 4BAXA 1YQBA 1YN4A 4F7ZA 4FBJB 2JYTA 3VUYA 2Z0DB 3MHZA 4WJNA 1V49A 2OJRA 4W9LA 2N1VA 1D5MC 1YJ1A 3AE6B 2BKRB 1XLOA 3WALA 1L6UA 4HCNB 4EZLA 4MT5A 2CJOA 4M01A 1KTKA 1FNWA 3EHVA 5FK9C 4K1RB 4CO7A 3SFEB 3FILA 4HJKA 2R2QA 3WA0A 3EGRA 4KZCA 4P1CC 1SB3C 4D2KA 1L7YA 1Z5SB 4OZCA 3K9PB 3R7QA 3KW5B 1XQQA 3Q8EA 4E3CA 1SJED 4XC2A 2KMMA 4HWIB 1LO5D 3A9JB 3IFWB 2XN9C 4HKQA 2IDYA 4XDDA 4LNNA 1TZ1A 2BB6A 4W9EA 2PEAA 2RD0A 1YJIA 4A20A 4G50A 3LXFA 4MM3A 1CJEA 5HFYA 1WGKA 1E6EB 2N7DA 3P4SB 2WX0A 2L1AA 1OQQA 2XBBC 1UWXA 4BKSA 2LRUA 1DOXA 3VTWA 3ZJUA 2WXFA 1WM2A 2IGHA 1WXVA 2V9HA 4XZ4A 3FC4A 1QT9A 3J9CA 4IG7B 3ETRA 3WIMA 2PE6B 4OW0A 3P63A 5CHWA 2M0XA 4WQMA 4I6PA 2JRIB 4ICUA 2GBJA 2KX0A 3M63B 4C56C 1OFFA 3P4PB 2IO3B 1I35A 3WCQA 1WY8A 2DENB 4KX6B 1A5RA 1P7FA 4HJGE 1BUIC 3PSEB 1MFWA 3QJZA 1WE6A 2L3ZA 1T5XD 4MELA 1V8CA 3QQ8B 3RN9C 3N32A 1C77A 2ZCCA 3VR9B 1UWMA 2D07B 3SU8X 3NUHB 4XX5A 1TZOA 1TY0A 2EELA 1SBBB 3NY5A 4AP4C 3AE8B 4IKGA 5L83A 5IN7A 3V6CB 2PLPA 4C7YA 1D4BA 1C4PA 3W1SA 4GDLA 5JXVA 3VTVA 4K81A 1FEHA 2CJNA 4B0MA 1C9FA 2WXQA 1GAQB 3SFDB 4CYEA 2LHEA 5C3JB 4ACFA 2PVGC 3NG0A 4IUMB 3T3NA 3R7RA 3V61A 3S2AA 2V3SA 4MGYE 4BVUC 3WANA 1YQ4B 1XLPA 1FFUA 1XLQA 1FRDA 4JX1C 3W1YA 2MBQA 2D3CA 2V4LA 2FCNA 2C7NB 4TQ0A 1SE4A 2DX5B 4IWQA 5C2TB 4BFRA 1GNUA 1XEEA 3AM9A 3RNBC 2G4DB 3L10B 1R4MI 1NYRA 4GIVA 4USAA 3PZ8A 4NAWA 3AEBB 1D6EC 3H7PB 3W5VB 3L4PA 5BMIA 4W9GA 3ZTCA 2JZPA 2WYQA 3MP9A 4YTNB 2CR5A 4N9F4 2O6VB 3IT6B 3A33B 3FAHA 3DHHC 2N0SB 2DZJA 3BVMA 4WJPA 1I4GA 1WMHB 3DPDA 1B9RA 4FJYA 1R4MB 2Y5CA 4MACA 1RYJA 1VJKA 5IKCM 2J53A 3ENEA 4ITKA 2WXMA 4LJOB 4A90A 5D94A 2A5UA 2H88B 3Q14C 4XYCA 2IZVB 2IBIB 2XEWA 1S3SG 2BW2A 2KWDA 3GE3C 3ZRFA 1YMHE 3DBRB 2REXA 2SAKA 3V60A 3OG5A 3ZLZA 1N6ZA 4MJSA 4B95A 2I1KA 2K8BA 3BYTB 1ZE3D 1WWTA 1VR9A 1TS5A 3P42A 1V81A 3U7ZA 4K7SA 1E9MA 3RCZA 2KTRA 4P1BC 3I5JC 4EUTA 1PGAA 2QSDA 4M00A 4MDKE 5DPRA 1SIFA 2PTLA 3ZJVA 1F77A 1EO6A 5LXHA 3UIOB 3Q3MC 1WRDB 1L4ZB 1NENB 3HVZA 1E10A 3TSSA 4RH6A 1OQYA 4YXDB 2KFKB 3HM6X 4G11A 1AYFA 1FM0D 3ML8A 1K53A 3HVDA 1VRAB 2WDRB 3IXSA 3OAWA 4IM0A 3AE4B 3AU4A 2DYMA 3KLSX 2GLSA 3N1XC 4S17A 1UD7A 3ONSA 5LLIA 4IM2A 1FFVA 3WAOA 1V5OA 2LZ6A 2PPHA 3VDZA 2W82A 2LHDA 2PVOD 1GPXA 2FUG1 4LCDE 1FXIA 3VFKA 2WXIA 3C19A 2LGXA 3AULA 3L16A 4YTPB 2MWSB 3UQBA 1AWDA 2N9XA 2M8SA 4YSZB 4O1NA 1SXTA 1K8RB 1IBXB 3M3JA 1F9JA 4B6WA 4MGKE 4NJ7A 1QF6A 3MFGA 3DHIC 4LNOA 4C00A 4DQOC 3UINB 4YWGG 4WURA 2BVCA 2JX5A 4K3BA 3AEGB 4CQNA 2EKIA 1I4PA 2NCNA 2RMMA 5D6JB 3PT2B 4IWPA 2Q5WD 4LNFA 4EZKA 3U7DA 1E5WA 1ET9A 4JE3B 1GB1A 2BS2B 1N63A 3IAS1 2CHXA 4MGIE 2KK8A 1L5PA 1H8CA 4XDCA 3HIZA 1WZ3A 2K8CA 4TV3A 1WX7A 2KWVB 1V5TA 1YNTE 1NI2A 2MEKA 1C4CA 4LJPB 2FCMA 2R61A 3T3OA 2FUHB 1N60A 4JWUC 2KJ6A 1M94A 2K5PA 1C3TA 2BPSA 1UUPA 2KANA 2INNE 2CHWA 3GZNI 4BOSC 3AECB 4G0NB 1SE2A 2N9EB 4IWOA 3H6NA 1WR1A 2DBYA 1YN5A 2I1JA 2BWFA 1YX6B 1MPEA 1WI0A 4PS7A 1OQRA 2ZZPB 3BVGA 3MJWA 2BS3B 3IG3A 4JGHB 2WDTB 3BK1A 2KLCA 3BWUD 2EKEC 3ZXVA 2JXTA 4FJZA 1V1OA 3GZNB 3GE8C 2KNBA 2LXCA 2MJEA 3PS6A 4RFBA 1XT9B 4N58A 2Y5PA 2JWUA 4BKGA 1TT5B 4FLHA 3QK0A 1JRUA 3A4RA 2ZW0A 2DAFA 3IVFA 3SEBA 3GB1A 1GJZA 3DWGC 4HKZE 1D5ZC 1LM8B 5HKHA 2LGDA 1EWYC 2ON8A 1TS3A 2A4ZA 1R7SA 3N30A 1SE3A 2YLMA 5BMGA 3TL5A 4HXDA 1GUAB 1TKGA 2N7JA 1STEA 5AUIA 2KFKA 3GP7A 3NRZA 1WJ4A 3TEWA 1GOZA 5TR5A 1FXTB 4FHJA 2LMCA 4ZYSA 3I3TB 2ZPYA 2ASQA 4NY0A 2NS5A 2HDEA 1V1PA 4GMVA 4AJYB 4PS3A 3KQ4A 2WXGA 2FCQA 2LVOA 3AMZA 3VTUA 2XNAC 1WH3A 2RR9A 3DBHI 2KTRB 4JPSA 3R2TA 3TEXA 2CS4A 2ZNVB 1C4AA 1DOIA 3GOEA 2K6DB 1MHHE 4EOYA 5GMVA 3ZRCA 5JHAA 5LXIB 2L76A 2J0JA 3NJTA 1ZXIA 4II3B 1IBXA 3APCA 2IGGA 2KTFA 1RFAA 3RZFA 2ZVNA 3HK0A 2GBKA 2BYTA 3U4EG 2Z0EB 3N9YC 1NVID 2G45B 2G4SA 4A6QA 5BMHA 1WXQA 2BKFA 2JUOA 2UU7A 4R3DA 3RNCC 1MJDA 1PGXA 4XGAB 1IP9A 1M4VA 3ZIMA 3I9V1 2BYVE 1MI0A 1OEYJ 3TMPB 4LDTB 4KZ0A 4GDKA 3PRMB 3ZGZA 1OTRB 4TKNA 2O6VD 3P4QB 2WXOA 2NBVB 4IDIA 1WXAA 1YN3A 1CMXB 3D32A 3ZO5B 2M17A 3APDA 1JWUD 3BINA 1AARA 1FNVA 2BWES 3KVFB 5BYRA 3H7SA 3A1QB 1I4HA 1WIAA 4ZDVA 1T0YA 2QIEB 5L95C 1UNSA 1TJEA 3AE2B 3P4RB 3GS2A 1MG8A 5JHBA 1UZXB 1L2NA 4KVGB 1RFKA 2QC8A 5EDSA 3DBSA 3M62B 2PE9A 4GSWA 4HEA1 5AUKA 3AE7B 4YSXB 2WX1A 2N4FA 3E56A 1QOAA 1F1HA 2OJWA 1KM7A 1E8YA 3MTNB 1JMLA 5EE9A 1WGRA 3CWIA 1KF6B 1V86A 2GB1A 2DWQA 2KN5A 4ZRJA 5G55A 1FXAA 5JH5C 3ZNID 2KDIA 3Q8CA 1X1MA 1MG4A 4AJWA 3L54A 1EM7A 1ZDXA 3QAQA 3RNFC 1JWBD 3BZDB 3OJ3A 3ZNGC 2C7HA 1XF5L 3URYA 4IM3A 3AE5B 4W9IA 2W3RA 3PVLA 3CF6E 3BK2A 4WQOB 3IAM1 4RGNA 2DHZA 1YOVB 2ZW1A 2G1EA 2BBCA 1MHXA 4HCPB 1TIFA 2GBRA 2KQSA 4WWOA 1TS2A 1GC6A 2PJHA 2IY0B 2XK5B 2N9LA 3TIXA 1U4AA 2C60A 1F2RC 4DHZB 3VUWA 4GU2A 2RPQA 4KDLB 2WXHA 4TQ1A 1KFYB 1IGDA 2K6QA 3VRBB 4RNAA 4TUUA 4TMAB 5H92C 4KIKB 3NHEB 2AL3A 2KO3A 1KOTA 2AQ3B 1KRHA 1I42A 1TY2A 1WYGA 1D3ZA 1L0YB 1HA5A 3AI5A 3B0AA 3M95A 5AEKB 3U30A 2NBUA 1ISNA 2K9XA 2J7QB 1EF1A 1IGCA 1XCQL 2LGYA 5IAAC 3A1QA 2DAJA 2WGSA 2J0KA 3AXCA 1C78A 3PRZA 3EECA 2L7RA 1E8XA 4MSMB 5I4DA 2MJ3A 4PYZA 2PKOA 1JWMD 2MBEA 2E6XA 2I38A 3L13A 3HHMA 4REZA 4OVZA 4BKTA 3VUXA 3AV8A 4ANUA 3Q8FA 2WXJA 4KSLC 3PV1A 2W3SA 4NZLB 2AX5A 3V3XA 2AYOB 5IP4D 2MCNB 4YTMB 2GMIC 3ZQ4A 2H89B 2Y5BB 1HQRD 1KJTA 2IY1B 2ZJDA 2KJRA 2IPKD 3MJ5A 2KN4A 3DOWA 4W9FA 4DHZE 4ARCA 2OEDA 1OEYA 1SSNA 5AZHA 4HDOA 4WJOA 4RF1A 3APFA 1HXYD 4NPNA 2N7EA 3RULA 1NEKB 1E0ZA 3PZ7A 3QC8B 1G6JA 4RF0A 1BT0A 3NOBA 4M0WA 4NQLB 4FADA 2JQRB 5HI1A 4I6NB 3RFZB 1HZ5A 1ZXHA 2WLBA 2B76B 2LJ5A 3R3MA 4L2YA 5H8YE 1ZGUB 3C0RB 3L17A 5C1ZA 3PPAA 2LFIA 2IO1B 3DVNU 4ZOHC 2KJHB 1P7EA 1WXSA 4WWPA 1NBFC 3PZDA 3Q69A 1GB4A 3NS1A 4PT5A 2K25A 5G2NA 2N1WA 2YEPB 1ROEA 4US9A 3PHWB 2L00B 3PO0A 3A4SC 1FO4A 2M19A 3DVNV 1T0SC 2D3BA 4PK1A 1H4RA 3JSVB 3LYYA 2KVRA 1FMAD 1J0GA 1KLGD 2VRRB 4NAMA 1IYFA 2JVCA 1YJJA 1WF9A 1FNUA 2BYEA 2EMTA 4RM9A 3RPFC 3MC9A 3MC8A 3AB5A 3N1YC 3SR6A 4KGSA 4W9DA 4A3PA 1KLUD 2W55A 4DWFA 1XLNA 5DPSA 1FCCC 4DXAB 4A3OA 2KXJA 3RNEC 4NQKE 1EU3A 1P1AA 4DXGA 1WR6E 2NPTB 2RDGA 3ZJTA 2X8XX 4WH4A 2DZIA 4DBGA 2LUEA 4EKUA 4ZRKA 1N5WA 4JLCA 3WAMA 2FAZA 4ZHPA 1WX8A 4W9KA 3Q2AC 3HM3A 1PFDA 3UI3A 5BO4B 1P98A 4AS1A 2WXKA 3VQIA 2DZMA 2G3QB 3KWLA 1ZPSA 4P16A 2WXRA 3NS8A 2ZCBA 2WDVB 1N5XA 2HTME 2DZKA 3ZNHB 2WU2B 5G5HA 3ZKJC 2PIAA 3NZUA 3TJPA 3DQVA 1JW9D 2DYBA 1ZKHA 4JIOU 3DBLB 1QOFA 2J42A 1I4QA 4RM8A 3RNAC 2ZPNA 3JW0X 2BT6A 1T3QA 5IA7A 2HJ1A 3KUZA 5CHVC 2L52A 3V62A 2MA9B 2PW9A 2KOXA 3ALBA 3W5UB 2NPTA 3EC8A 3A9KB 2KC2A 2GOWA 4DHJB 3V6EB 4RCOA 5CHFA 3OJ4B 2WP9B 3QHTA 1JROA 1L4DB 1SEBD 3RT3B 3I57A 4I6LB 1WGGA 1FCLA 2HJ8A 3CSFA 5KHOA 1JCKB 1E7VA 2KAJA 5DPTA 1Q10A 4M8MA 3E9SA 5LNK1 1GC7A 2CKHB 4EFOA 1SGHA 3DDCB 3UQAA 4OVUA 1LXDA 2RPVA 4ZRPA 2M0AA 4W9HA 4LK0M 3AH7A 2E3TA 2K22A 3VXWA 1AN8A 4GGQA 1J8CA 1R4NB 2AQ1B 4KIKA 2IJ0A 3B08A 5IOIA 2NBWB 4KKJA 4N6EB 3PLVA 3QX1A 2KDBA 4A9AA 1WJUA 1PQSA 5CX3A 3U52E 2JPHA 4KSKC 1QOBA 2XK5A 3Q3NC 2HE7A 1ET6A 2D11A 3PRPB 1K50A 1QQRA 4WIPA 2ACZB 2DLBA 3PGEA 2ZVOA 2JYEA 1J7BA 3DCGA 1HZ6A 4ZRIA 2AEHA 2KC1A 1SF0A 2KX3A 4ASWC 5KHQA 2WXLA 4C4VA 2LRWA 4ANXA 2IO2B 5EE0A 1WMHA 4B0EA 4BBNF 3LB8C 3ZYYX 2WU5B 1V9JA 1V6EA 3PLUA 2D10A 3SD5A 5TSSA 3JYUA 1E7UA 1E90A 1TGZB 1XCTL 2RGFA 1BMLC 2UWQA 1TBEA 4W9CA 3H7PA 4M02A 1S1QB 2MJDA 4C4VB 1JRPA 3AU5A 1NYQA 1YIWA 3VAWA 2KYWA 1UH6A 1XO3A 3P2BA 4NAWB 5J17A 5CTRC 2D3AA 5EE3A 2WNMA 2LGIA 3QIJA 4QAYA 2M56B 3RMKC 2MHJA 1DOYA 2W9NA 2FIFA 4X57B 4FJVB 4BKSD 2FE8A 4MJSB 4WAFA 1Y8RC 1L0VB 3BY4B 4NJCA 1WGHA 4BZAA 2LI5A 1WX9A 1EUVB 4PYUA 2V3NA 5E6OA 3PHXB 2KWCA 3R2IA 4H2AA 1Q0WB 3ZNZB 5GXGB 1TTNA 1VCBA 2GI9A 2AL6A 2C9WB 2JZZA 5BYQA 1HE8A 4MEMA 3TCAA 3W2DA 4ZRQA 2NMQA 4ARIA 3CMMB 5MPOA 2V4IB 2WDQB 1T6BX 4NJ6A 1YD8U 1V97A 2QILA 2INPE 2BF8B
chains in the Genus database with same CATH topology
4KSLC 3PV1A 1V5OA 2LZ6A 2PPHA 4FA6A 3VDZA 4AWJA 2AYOB 2MCNB 1RAXA 2GMIC 1V2YA 4LCDE 4NNJB 2NR2A 4JQWC 3VFKA 2M1MA 2KWUB 2Y5BB 3CSTA 1C1YB 3QARA 2YVCA 1KJTA 3X0WA 2LGXA 3AULA 2IY1B 3L16A 4ZYNA 2J0MA 2MWSB 3UQBA 1WYWB 2N9XA 2AWTA 2KDEB 4G3XB 2M8SA 3RYTA 3PTFC 3MHSD 2ZJDA 5DCNA 2KJRA 2JY6A 3L0WB 1K8RB 3KYDD 1QZEA 2K1FA 3M3JA 2JRHA 2KHWB 3DOWA 4W9FA 4DHZE 1F9JA 2KLGA 4B6WA 4B9KA 1OEYA 4MGKE 4IC7B 4IW0A 4NJ7A 3ZVVA 3DVGX 4DHJD 5AZHA 4HDOA 4WJOA 2MP2A 2OOBB 1P9DU 3APFA 3UINB 4NPNA 2N7EA 3RULA 2MBHA 3W1SC 1WM3A 4GN1A 3QC8B 3LDZE 2NCNA 3DVGY 5D6JB 1BT0A 1G6JA 3NOBA 3ZTDA 4NQLB 4FADA 2WWZA 3PT2B 4IWPA 4EZKA 3U7DA 1E5WA 4I6NB 2MX2A 2NVUI 1VD2A 2CHXA 2MLBA 3TBLD 4MGIE 4K7WA 2EMSA 2KK8A 4KDIC 4BBNC 2LJ5A 3R3MA 1H8CA 2IYDB 3HIZA 1ZGUB 1WZ3A 3QWZB 2K8CA 3C0RB 3L17A 5C1ZA 1P0RA 4TV3A 3PPAA 1WX7A 2KWVB 2IO1B 2D2QA 3N3KB 1V5TA 3DVNU 2KJHB 1NI2A 2C7MB 1WXSA 4WWPA 4E74A 1NBFC 3PZDA 1R4NI 4AUQC 4LJPB 2FCMA 4YL8A 5AZGA 4ANVA 2FUHB 3U8ZA 2KJ6A 2R2OA 3KUCB 2K25A 5G2NA 3A9JA 2N1WA 3ZDTA 2UYZB 1M94A 2KD0A 4II2B 4URKA 1C3TA 2BPSA 2C5LC 2K8HA 2KANA 3PHWB 2CHWA 3ZDMC 1OGWA 2KMAA 2L00B 3GZNI 4FHKA 5C23A 4BOSC 2KZRA 3A4SC 4G0NB 2N9EB 5E6PA 4IWOA 3H6NA 2MQJA 1WR1A 3KH0A 4EZJA 1UGMA 4GOCA 3OLMD 3DVNV 1RLFA 1H4RA 2I1JA 3JSVB 4J6IA 2BWFA 1YX6B 1SE9A 4MSQB 1WI0A 4PS7A 2KVRA 2ZZPB 5FR6A 4DK5A 3MJWA 1Q1OA 2VRRB 1J0GA 1IYFA 3IG3A 2JVCA 3A9KA 4JGHB 3VH3B 2WDTB 1WF9A 4WJQA 1YQBA 3RD2A 3UF8A 2KLCA 2EKEC 3ML9A 3SDLC 4F7ZA 2BYEA 2EMTA 4FULA 4RM9A 4FBJB 3VUYA 1UBIA 4FJZA 2LXAA 2Z0DB 2FCSA 4WJNA 4F1SA 2KNBA 1V49A 2LXCA 2OJRA 2JWZA 3PS6A 4W9LA 4W9DA 2N1VA 1XT9B 4A3PA 1YJ1A 4BKGA 2BKRB 4DWFA 3WALA 5DPSA 4FLHA 2N9PC 4DXAB 3QK0A 4HCNB 1JRUA 2KXJA 4A3OA 4OVVA 3A4RA 4EZLA 2DAFA 4NQKE 2LASA 1P1AA 3IVFA 1GJZA 1WZ0A 1WR6E 1LM8B 3ECIA 3EHVA 5HKHA 2NPTB 3JSVA 4K1RB 4CO7A 2LGDA 4HJKA 3JVZX 2DZIA 2R2QA 2A4ZA 4DBGA 3WA0A 2LUEA 4EKUA 3N30A 4KZCA 4ZRKA 4JLCA 3WAMA 1L7YA 1Z5SB 2FAZA 2YLMA 3K9PB 1WX8A 3R7QA 4W9KA 3KW5B 4WAAA 2L05A 1XQQA 1WJ6A 4EEWA 3HM3A 3TL5A 5BO4B 1P98A 4HXDA 2FNJB 1GUAB 4E3CA 4XC2A 1KLVA 2LD9A 4HWIB 2DYOA 3VQIA 2DZMA 2G3QB 3A9JB 3IFWB 2KFKA 3NS8A 1TZ1A 2ZCBA 2GBNA 1WJ4A 4W9EA 4DDID 2PEAA 2RD0A 4A20A 5TR5A 2JXXA 1FXTB 4FHJA 3I3TB 4G50A 2ZPYA 2ASQA 4NY0A 2DZKA 4MM3A 2NS5A 4ANWA 3ZNHB 4AJYB 4GMVA 3ZKJC 2N7DA 4PS3A 5JZEB 2FCQA 2LVOA 3IHPC 4GDKB 1V80A 2WX0A 3R66C 3SHQA 2XBBC 3NZUA 3VTUA 3TJPA 3DBHI 1WH3A 2RR9A 4F8CB 3ZW3A 3DQVA 2KTRB 2DYBA 1ZKHA 4JIOU 2CS4A 2ZNVB 2LRUA 3GOEA 4BKSA 2B3AA 3VTWA 4RM8A 2ZPNA 2K6DB 3JW0X 1WM2A 4M0WB 1WXVA 4EOYA 2LVQA 5GMVA 3ZRCA 5JHAA 5LXIB 5IA7A 4XZ4A 2L76A 3KUZA 2J0JA 4II3B 5CHVC 4CHKA 3APCA 3V62A 4IG7B 2MA9B 2KTFA 2IO0B 1RFAA 3RZFA 4BOZB 3WIMA 2PE6B 2KOXA 1EF5A 3ALBA 2NPTA 3EC8A 1WGYA 2ZVNA 4MH0E 5CHWA 3HK0A 2M0XA 2GBKA 2RSUA 4JL9A 4I6PA 3A9KB 4HLEA 2KC2A 2JRIB 2GOWA 2GBJA 2KX0A 4ICUA 2MSED 3M63B 2Z0EB 5D2MB 4DHJB 2G45B 2IO3B 3V6EB 5CHFA 2KFJA 2G4SA 3L08A 3OJ4B 1I35A 2JT4B 1WY8A 2BKFA 2DENB 2JUOA 3QHTA 3RT3B 1A5RA 4FN2A 4I6LB 1WGGA 1IP9A 3B1LX 1LFDA 3T8MA 2HJ8A 3CSFA 4HDQA 5KHOA 3ZIMA 3IBEA 3PSEB 2BGFA 2O6VA 2HTHA 3QJZA 2BYVE 1WE6A 2L3ZA 1OEYJ 3DBRI 4MELA 3TMPB 4LDTB 3QQ8B 1UBQA 4KZ0A 1E7VA 1WGDA 2FIDA 3N32A 2ZCCA 4GDKA 3PRMB 5DPTA 1OTRB 4TKNA 2MRPA 2D07B 1WXMA 3SU8X 4M8MA 4XX5A 2O6VD 1GC7A 5J2RA 2CKHB 4EFOA 2NBVB 2MBOA 4GXBA 1WXAA 1CMXB 1SGHA 3DDCB 3D32A 4RMAA 4OVUA 3ZO5B 3UQAA 3NY5A 3RZWC 1LXDA 2ZNVC 2M17A 3APDA 3DBLI 4AP4C 3BINA 5L83A 1LQBA 1AARA 2ZEQA 3V6CB 4W9HA 2BWES 3KVFB 3H7SA 1WE7A 2JF5A 3W1SA 4GDLA 3VXWA 3A1QB 3VTVA 1WIAA 4GGQA 4K81A 1J8CA 4ZDVA 2JZ3B 1T0YA 4KIKA 5L95C 2GBMA 2D3GA 3B08A 4WWNA 4HVBA 2NBWB 4CYEA 2CU1A 5J18A 3PLVA 4IUMB 1MG8A 3R7RA 5JHBA 3V61A 3QX1A 3S2AA 2KDBA 3QA8A 4AOFA 3VH4B 1UZXB 2V3SA 2V1YA 1WJUA 3KYCD 1PQSA 4MGYE 5CX3A 1L2NA 4KVGB 1ZW7A 5EDSA 4BVUC 2MP2B 3DBSA 2JPHA 4KSKC 2KDFB 3M62B 2PE9A 2XK5A 5D7GA 4GSWA 3WANA 2HE7A 2D11A 3PRPB 3UIPB 1Q5WB 1NDDA 2O2VA 2QHOA 2WX1A 2N4FA 5E6NA 2MBQA 3W1YA 2K39A 2V4LA 2FCNA 4W9JA 3PGEA 4MGZE 2KMCA 1KM7A 2ZVOA 2C7NB 3PREA 4HPMB 1E8YA 4TQ0A 3LJ3A 3MTNB 2CHZA 2DX5B 3DCGA 4IWQA 4ZRIA 4BFRA 1GNUA 1WGRA 3T9LA 2BYFA 1V86A 4M8NA 2AEHA 2KC1A 2G4DB 3L10B 1R4MI 2KN5A 4ZRJA 2KX3A 5G55A 4ASWC 2L8JA 4GIVA 5JH5C 3ZNID 3EFUA 5KHQA 2KDIA 4NAWA 4E71A 2LRWA 4ANXA 3H7PB 1X1MA 2IO2B 4W9GA 1WMHA 2MBBB 3ZTCA 4BBNF 1XD3B 2WYQA 4AJWA 3L54A 1WJNA 3QAQA 1WFYA 1V9JA 1V6EA 2CR5A 3H1UA 2D10A 3OJ3A 3PLUA 4N9F4 3SD5A 3QCAA 3ZNGC 2O6VB 3K9OB 3JYUA 3A33B 1E7UA 1E90A 3X23A 2C7HA 1TGZB 4IM3A 2DZJA 4WJPA 3Q3JA 1WMHB 3DPDA 4W9IA 1Z2MA 2RGFA 1IPGA 1GG3A 2UWQA 4FJYA 1TBEA 3O65B 4PS8A 3PVLA 4KV2A 3H7PA 4W9CA 1P3QU 1S1QB 3CF6E 4HK2A 3ZUNA 2HD5B 2L0FA 4WQOB 3AU5A 3ENEA 1YIWA 4K7UA 2DHZA 4LJOB 3VAWA 5D94A 2A5UA 3Q3FA 2LWPA 4HCPB 1UH6A 3P2BA 2IZVB 2IBIB 2XEWA 2GBRA 2KQSA 4NAWB 4WWOA 1S3SG 5J17A 5DPWA 1GC6A 5CTRC 2PJHA 2IY0B 2XK5B 3ZRFA 1E8ZA 3QIJA 3TIXA 1U4AA 2L0TA 2REXA 2C60A 2W9NA 2FIFA 4DHZB 3V60A 3VUWA 4X57B 4GU2A 2RPQA 4KDLB 3UGBB 4FJVB 3ZLZA 4MJSA 4TQ1A 2O2VB 2I1KA 2K8BA 4B95A 4BKSD 1YX5B 2K6QA 4MJSB 1V81A 1Y8RC 4TUUA 2KKCA 3BY4B 4K7SA 1WGHA 3RCZA 2KTRA 4KIKB 2LI5A 1WX9A 3NHEB 1EUVB 3KUDB 2M4NA 2AL3A 2KO3A 4PYUA 4EUTA 1KOTA 1J19A 4P7IA 4GDLB 4MDKE 5AZFA 5E6OA 5DPRA 1I42A 1SIFA 3PHXB 2KWCA 1D3ZA 5LXHA 1EO6A 3AI5A 3B0AA 3UIOB 3M95A 5AEKB 1Q0WB 3ZNZB 1WRDB 3U30A 2NBUA 4DDGD 1ISNA 2J7QB 1TTNA 1VCBA 1EF1A 1RRBA 3NZSA 1OQYA 2LGYA 1E8WA 3A1QA 5IAAC 2DAJA 2AL6A 2C9WB 2J0KA 2JZZA 2MW5A 3H9DA 3AXCA 1HE8A 3PRZA 2KFKB 2L7RA 1E8XA 3EECA 3HM6X 4G11A 4MEMA 4MSMB 2Z59B 3TCAA 3WAPA 4ICVA 3ML8A 3CMMB 4PYZA 2MBEA 2KQ7A 4NJ6A 3L13A 3HHMA 3OAWA 4IM0A 1YD8U 4HPLB 3AU4A 2DYMA 3RUIB 4BKTA 3VUXA 3VVWB 1UELA 1UD7A 4LDTD 3ONSA 4ANUA 4GB9A 3VHTC 5LLIA 4IM2A 3WAOA 2BF8B 2LVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KSL C;  3PV1 A;  1V5O A;  2LZ6 A;  2PPH A;  4FA6 A;  3VDZ A;  4AWJ A;  2AYO B;  2MCN B;  1RAX A;  2GMI C;  1V2Y A;  4LCD E;  4NNJ B;  2NR2 A;  4JQW C;  3VFK A;  2M1M A;  2KWU B;  2Y5B B;  3CST A;  1C1Y B;  3QAR A;  2YVC A;  1KJT A;  3X0W A;  2LGX A;  3AUL A;  2IY1 B;  3L16 A;  4ZYN A;  2J0M A;  2MWS B;  3UQB A;  1WYW B;  2N9X A;  2AWT A;  2KDE B;  4G3X B;  2M8S A;  3RYT A;  3PTF C;  3MHS D;  2ZJD A;  5DCN A;  2KJR A;  2JY6 A;  3L0W B;  1K8R B;  3KYD D;  1QZE A;  2K1F A;  3M3J A;  2JRH A;  2KHW B;  3DOW A;  4W9F A;  4DHZ E;  1F9J A;  2KLG A;  4B6W A;  4B9K A;  1OEY A;  4MGK E;  4IC7 B;  4IW0 A;  4NJ7 A;  3ZVV A;  3DVG X;  4DHJ D;  5AZH A;  4HDO A;  4WJO A;  2MP2 A;  2OOB B;  1P9D U;  3APF A;  3UIN B;  4NPN A;  2N7E A;  3RUL A;  2MBH A;  3W1S C;  1WM3 A;  4GN1 A;  3QC8 B;  3LDZ E;  2NCN A;  3DVG Y;  5D6J B;  1BT0 A;  1G6J A;  3NOB A;  3ZTD A;  4NQL B;  4FAD A;  2WWZ A;  3PT2 B;  4IWP A;  4EZK A;  3U7D A;  1E5W A;  4I6N B;  2MX2 A;  2NVU I;  1VD2 A;  2CHX A;  2MLB A;  3TBL D;  4MGI E;  4K7W A;  2EMS A;  2KK8 A;  4KDI C;  4BBN C;  2LJ5 A;  3R3M A;  1H8C A;  2IYD B;  3HIZ A;  1ZGU B;  1WZ3 A;  3QWZ B;  2K8C A;  3C0R B;  3L17 A;  5C1Z A;  1P0R A;  4TV3 A;  3PPA A;  1WX7 A;  2KWV B;  2IO1 B;  2D2Q A;  3N3K B;  1V5T A;  3DVN U;  2KJH B;  1NI2 A;  2C7M B;  1WXS A;  4WWP A;  4E74 A;  1NBF C;  3PZD A;  1R4N I;  4AUQ C;  4LJP B;  2FCM A;  4YL8 A;  5AZG A;  4ANV A;  2FUH B;  3U8Z A;  2KJ6 A;  2R2O A;  3KUC B;  2K25 A;  5G2N A;  3A9J A;  2N1W A;  3ZDT A;  2UYZ B;  1M94 A;  2KD0 A;  4II2 B;  4URK A;  1C3T A;  2BPS A;  2C5L C;  2K8H A;  2KAN A;  3PHW B;  2CHW A;  3ZDM C;  1OGW A;  2KMA A;  2L00 B;  3GZN I;  4FHK A;  5C23 A;  4BOS C;  2KZR A;  3A4S C;  4G0N B;  2N9E B;  5E6P A;  4IWO A;  3H6N A;  2MQJ A;  1WR1 A;  3KH0 A;  4EZJ A;  1UGM A;  4GOC A;  3OLM D;  3DVN V;  1RLF A;  1H4R A;  2I1J A;  3JSV B;  4J6I A;  2BWF A;  1YX6 B;  1SE9 A;  4MSQ B;  1WI0 A;  4PS7 A;  2KVR A;  2ZZP B;  5FR6 A;  4DK5 A;  3MJW A;  1Q1O A;  2VRR B;  1J0G A;  1IYF A;  3IG3 A;  2JVC A;  3A9K A;  4JGH B;  3VH3 B;  2WDT B;  1WF9 A;  4WJQ A;  1YQB A;  3RD2 A;  3UF8 A;  2KLC A;  2EKE C;  3ML9 A;  3SDL C;  4F7Z A;  2BYE A;  2EMT A;  4FUL A;  4RM9 A;  4FBJ B;  3VUY A;  1UBI A;  4FJZ A;  2LXA A;  2Z0D B;  2FCS A;  4WJN A;  4F1S A;  2KNB A;  1V49 A;  2LXC A;  2OJR A;  2JWZ A;  3PS6 A;  4W9L A;  4W9D A;  2N1V A;  1XT9 B;  4A3P A;  1YJ1 A;  4BKG A;  2BKR B;  4DWF A;  3WAL A;  5DPS A;  4FLH A;  2N9P C;  4DXA B;  3QK0 A;  4HCN B;  1JRU A;  2KXJ A;  4A3O A;  4OVV A;  3A4R A;  4EZL A;  2DAF A;  4NQK E;  2LAS A;  1P1A A;  3IVF A;  1GJZ A;  1WZ0 A;  1WR6 E;  1LM8 B;  3ECI A;  3EHV A;  5HKH A;  2NPT B;  3JSV A;  4K1R B;  4CO7 A;  2LGD A;  4HJK A;  3JVZ X;  2DZI A;  2R2Q A;  2A4Z A;  4DBG A;  3WA0 A;  2LUE A;  4EKU A;  3N30 A;  4KZC A;  4ZRK A;  4JLC A;  3WAM A;  1L7Y A;  1Z5S B;  2FAZ A;  2YLM A;  3K9P B;  1WX8 A;  3R7Q A;  4W9K A;  3KW5 B;  4WAA A;  2L05 A;  1XQQ A;  1WJ6 A;  4EEW A;  3HM3 A;  3TL5 A;  5BO4 B;  1P98 A;  4HXD A;  2FNJ B;  1GUA B;  4E3C A;  4XC2 A;  1KLV A;  2LD9 A;  4HWI B;  2DYO A;  3VQI A;  2DZM A;  2G3Q B;  3A9J B;  3IFW B;  2KFK A;  3NS8 A;  1TZ1 A;  2ZCB A;  2GBN A;  1WJ4 A;  4W9E A;  4DDI D;  2PEA A;  2RD0 A;  4A20 A;  5TR5 A;  2JXX A;  1FXT B;  4FHJ A;  3I3T B;  4G50 A;  2ZPY A;  2ASQ A;  4NY0 A;  2DZK A;  4MM3 A;  2NS5 A;  4ANW A;  3ZNH B;  4AJY B;  4GMV A;  3ZKJ C;  2N7D A;  4PS3 A;  5JZE B;  2FCQ A;  2LVO A;  3IHP C;  4GDK B;  1V80 A;  2WX0 A;  3R66 C;  3SHQ A;  2XBB C;  3NZU A;  3VTU A;  3TJP A;  3DBH I;  1WH3 A;  2RR9 A;  4F8C B;  3ZW3 A;  3DQV A;  2KTR B;  2DYB A;  1ZKH A;  4JIO U;  2CS4 A;  2ZNV B;  2LRU A;  3GOE A;  4BKS A;  2B3A A;  3VTW A;  4RM8 A;  2ZPN A;  2K6D B;  3JW0 X;  1WM2 A;  4M0W B;  1WXV A;  4EOY A;  2LVQ A;  5GMV A;  3ZRC A;  5JHA A;  5LXI B;  5IA7 A;  4XZ4 A;  2L76 A;  3KUZ A;  2J0J A;  4II3 B;  5CHV C;  4CHK A;  3APC A;  3V62 A;  4IG7 B;  2MA9 B;  2KTF A;  2IO0 B;  1RFA A;  3RZF A;  4BOZ B;  3WIM A;  2PE6 B;  2KOX A;  1EF5 A;  3ALB A;  2NPT A;  3EC8 A;  1WGY A;  2ZVN A;  4MH0 E;  5CHW A;  3HK0 A;  2M0X A;  2GBK A;  2RSU A;  4JL9 A;  4I6P A;  3A9K B;  4HLE A;  2KC2 A;  2JRI B;  2GOW A;  2GBJ A;  2KX0 A;  4ICU A;  2MSE D;  3M63 B;  2Z0E B;  5D2M B;  4DHJ B;  2G45 B;  2IO3 B;  3V6E B;  5CHF A;  2KFJ A;  2G4S A;  3L08 A;  3OJ4 B;  1I35 A;  2JT4 B;  1WY8 A;  2BKF A;  2DEN B;  2JUO A;  3QHT A;  3RT3 B;  1A5R A;  4FN2 A;  4I6L B;  1WGG A;  1IP9 A;  3B1L X;  1LFD A;  3T8M A;  2HJ8 A;  3CSF A;  4HDQ A;  5KHO A;  3ZIM A;  3IBE A;  3PSE B;  2BGF A;  2O6V A;  2HTH A;  3QJZ A;  2BYV E;  1WE6 A;  2L3Z A;  1OEY J;  3DBR I;  4MEL A;  3TMP B;  4LDT B;  3QQ8 B;  1UBQ A;  4KZ0 A;  1E7V A;  1WGD A;  2FID A;  3N32 A;  2ZCC A;  4GDK A;  3PRM B;  5DPT A;  1OTR B;  4TKN A;  2MRP A;  2D07 B;  1WXM A;  3SU8 X;  4M8M A;  4XX5 A;  2O6V D;  1GC7 A;  5J2R A;  2CKH B;  4EFO A;  2NBV B;  2MBO A;  4GXB A;  1WXA A;  1CMX B;  1SGH A;  3DDC B;  3D32 A;  4RMA A;  4OVU A;  3ZO5 B;  3UQA A;  3NY5 A;  3RZW C;  1LXD A;  2ZNV C;  2M17 A;  3APD A;  3DBL I;  4AP4 C;  3BIN A;  5L83 A;  1LQB A;  1AAR A;  2ZEQ A;  3V6C B;  4W9H A;  2BWE S;  3KVF B;  3H7S A;  1WE7 A;  2JF5 A;  3W1S A;  4GDL A;  3VXW A;  3A1Q B;  3VTV A;  1WIA A;  4GGQ A;  4K81 A;  1J8C A;  4ZDV A;  2JZ3 B;  1T0Y A;  4KIK A;  5L95 C;  2GBM A;  2D3G A;  3B08 A;  4WWN A;  4HVB A;  2NBW B;  4CYE A;  2CU1 A;  5J18 A;  3PLV A;  4IUM B;  1MG8 A;  3R7R A;  5JHB A;  3V61 A;  3QX1 A;  3S2A A;  2KDB A;  3QA8 A;  4AOF A;  3VH4 B;  1UZX B;  2V3S A;  2V1Y A;  1WJU A;  3KYC D;  1PQS A;  4MGY E;  5CX3 A;  1L2N A;  4KVG B;  1ZW7 A;  5EDS A;  4BVU C;  2MP2 B;  3DBS A;  2JPH A;  4KSK C;  2KDF B;  3M62 B;  2PE9 A;  2XK5 A;  5D7G A;  4GSW A;  3WAN A;  2HE7 A;  2D11 A;  3PRP B;  3UIP B;  1Q5W B;  1NDD A;  2O2V A;  2QHO A;  2WX1 A;  2N4F A;  5E6N A;  2MBQ A;  3W1Y A;  2K39 A;  2V4L A;  2FCN A;  4W9J A;  3PGE A;  4MGZ E;  2KMC A;  1KM7 A;  2ZVO A;  2C7N B;  3PRE A;  4HPM B;  1E8Y A;  4TQ0 A;  3LJ3 A;  3MTN B;  2CHZ A;  2DX5 B;  3DCG A;  4IWQ A;  4ZRI A;  4BFR A;  1GNU A;  1WGR A;  3T9L A;  2BYF A;  1V86 A;  4M8N A;  2AEH A;  2KC1 A;  2G4D B;  3L10 B;  1R4M I;  2KN5 A;  4ZRJ A;  2KX3 A;  5G55 A;  4ASW C;  2L8J A;  4GIV A;  5JH5 C;  3ZNI D;  3EFU A;  5KHQ A;  2KDI A;  4NAW A;  4E71 A;  2LRW A;  4ANX A;  3H7P B;  1X1M A;  2IO2 B;  4W9G A;  1WMH A;  2MBB B;  3ZTC A;  4BBN F;  1XD3 B;  2WYQ A;  4AJW A;  3L54 A;  1WJN A;  3QAQ A;  1WFY A;  1V9J A;  1V6E A;  2CR5 A;  3H1U A;  2D10 A;  3OJ3 A;  3PLU A;  4N9F 4;  3SD5 A;  3QCA A;  3ZNG C;  2O6V B;  3K9O B;  3JYU A;  3A33 B;  1E7U A;  1E90 A;  3X23 A;  2C7H A;  1TGZ B;  4IM3 A;  2DZJ A;  4WJP A;  3Q3J A;  1WMH B;  3DPD A;  4W9I A;  1Z2M A;  2RGF A;  1IPG A;  1GG3 A;  2UWQ A;  4FJY A;  1TBE A;  3O65 B;  4PS8 A;  3PVL A;  4KV2 A;  3H7P A;  4W9C A;  1P3Q U;  1S1Q B;  3CF6 E;  4HK2 A;  3ZUN A;  2HD5 B;  2L0F A;  4WQO B;  3AU5 A;  3ENE A;  1YIW A;  4K7U A;  2DHZ A;  4LJO B;  3VAW A;  5D94 A;  2A5U A;  3Q3F A;  2LWP A;  4HCP B;  1UH6 A;  3P2B A;  2IZV B;  2IBI B;  2XEW A;  2GBR A;  2KQS A;  4NAW B;  4WWO A;  1S3S G;  5J17 A;  5DPW A;  1GC6 A;  5CTR C;  2PJH A;  2IY0 B;  2XK5 B;  3ZRF A;  1E8Z A;  3QIJ A;  3TIX A;  1U4A A;  2L0T A;  2REX A;  2C60 A;  2W9N A;  2FIF A;  4DHZ B;  3V60 A;  3VUW A;  4X57 B;  4GU2 A;  2RPQ A;  4KDL B;  3UGB B;  4FJV B;  3ZLZ A;  4MJS A;  4TQ1 A;  2O2V B;  2I1K A;  2K8B A;  4B95 A;  4BKS D;  1YX5 B;  2K6Q A;  4MJS B;  1V81 A;  1Y8R C;  4TUU A;  2KKC A;  3BY4 B;  4K7S A;  1WGH A;  3RCZ A;  2KTR A;  4KIK B;  2LI5 A;  1WX9 A;  3NHE B;  1EUV B;  3KUD B;  2M4N A;  2AL3 A;  2KO3 A;  4PYU A;  4EUT A;  1KOT A;  1J19 A;  4P7I A;  4GDL B;  4MDK E;  5AZF A;  5E6O A;  5DPR A;  1I42 A;  1SIF A;  3PHX B;  2KWC A;  1D3Z A;  5LXH A;  1EO6 A;  3AI5 A;  3B0A A;  3UIO B;  3M95 A;  5AEK B;  1Q0W B;  3ZNZ B;  1WRD B;  3U30 A;  2NBU A;  4DDG D;  1ISN A;  2J7Q B;  1TTN A;  1VCB A;  1EF1 A;  1RRB A;  3NZS A;  1OQY A;  2LGY A;  1E8W A;  3A1Q A;  5IAA C;  2DAJ A;  2AL6 A;  2C9W B;  2J0K A;  2JZZ A;  2MW5 A;  3H9D A;  3AXC A;  1HE8 A;  3PRZ A;  2KFK B;  2L7R A;  1E8X A;  3EEC A;  3HM6 X;  4G11 A;  4MEM A;  4MSM B;  2Z59 B;  3TCA A;  3WAP A;  4ICV A;  3ML8 A;  3CMM B;  4PYZ A;  2MBE A;  2KQ7 A;  4NJ6 A;  3L13 A;  3HHM A;  3OAW A;  4IM0 A;  1YD8 U;  4HPL B;  3AU4 A;  2DYM A;  3RUI B;  4BKT A;  3VUX A;  3VVW B;  1UEL A;  1UD7 A;  4LDT D;  3ONS A;  4ANU A;  4GB9 A;  3VHT C;  5LLI A;  4IM2 A;  3WAO A;  2BF8 B;  2LVP A; 
#chains in the Genus database with same CATH topology
 2LGS A;  1I4X A;  4FA6 A;  4AWJ A;  3Q8A A;  1I4R A;  1V2Y A;  4NNJ B;  3N1Z C;  2M1M A;  3CST A;  3QAR A;  2YVC A;  2YEP F;  4LTU A;  4ZYN A;  2J0M A;  2D5G A;  3BVZ A;  2IGD A;  4KGT A;  4P6V F;  2WS3 B;  1B1Z A;  3PTF C;  1TKE A;  2I2Y A;  2JY6 A;  3L0W B;  3KYD D;  2QJL A;  2K1F A;  2JRH A;  2KHW B;  1ZOY B;  3RNG C;  3C8Y A;  2KLG A;  1QIL A;  4L1B A;  4IC7 B;  3IT4 B;  4IW0 A;  2LJI A;  3ZVV A;  2SEB D;  5HG2 A;  2OOB B;  1P9D U;  2TSS A;  4A55 A;  3H8H A;  2WHI A;  2QDF A;  2MBH A;  4GN1 A;  3LDZ E;  1RM6 C;  3ZTD A;  2WWZ A;  4HRS A;  2NVU I;  1VD2 A;  5E6J A;  4BBN C;  3QWZ B;  1N62 A;  3AEF B;  1P0R A;  1FIQ A;  2D2Q A;  3TUO A;  4WWM A;  2C7M B;  5IO9 A;  4E74 A;  1R4N I;  1EWC A;  4AUQ C;  4ANV A;  5AZG A;  1C79 A;  3KUC B;  3A9J A;  3ZDT A;  5D3D A;  1YQ3 B;  2W54 A;  2C5L C;  2K8H A;  4KKI A;  3ZDM C;  3BII D;  2KMA A;  5C23 A;  1TKY A;  4FHK A;  2KVZ A;  2KZR A;  1T0Q C;  4XE0 A;  1T0R C;  2BS4 B;  1UGM A;  4ZHO A;  2JU6 X;  1SE9 A;  3B2F A;  5FR6 A;  1Q1O A;  3A9K A;  5HHD G;  1J7A A;  3AE1 B;  3FIL B;  3V05 A;  3VH3 B;  3W9C B;  4WJQ A;  5G5G A;  3RD2 A;  3UF8 A;  3ML9 A;  3SDL C;  4FUL A;  3NVZ A;  1TS4 A;  4K3C A;  1UBI A;  2LXA A;  4F1S A;  2FCS A;  1PUT A;  2JWZ A;  3NVY A;  2V3P A;  2N9P C;  2BTE A;  1DGJ A;  4OVV A;  2LAS A;  2LEK A;  3AED B;  4RGT A;  1WZ0 A;  1SJH D;  3ECI A;  2WQY B;  4OHJ A;  3JSV A;  2KAC A;  3JVZ X;  4MM3 B;  5FR3 A;  5T8I A;  4WAA A;  2L05 A;  1WJ6 A;  3Q8B A;  4EEW A;  4C7Z A;  1A70 A;  2FNJ B;  1KLV A;  2LD9 A;  2DYO A;  1C76 A;  2RDB C;  3HRD D;  2GBN A;  4DDI D;  2JXX A;  5D3I B;  4Q2J A;  4S0R A;  1JAL A;  4ANW A;  3B9J A;  4XWW A;  5JZE B;  3IHP C;  4GDK B;  1V80 A;  3SHQ A;  3R66 C;  1Y56 A;  4F8C B;  3ZW3 A;  2B3A A;  1JWS D;  1WSP A;  4M0W B;  3MC0 B;  2LVQ A;  2INC C;  1JQ4 A;  1IUE A;  1ZDV A;  4CHK A;  4US8 A;  3Q6B A;  2IO0 B;  4BOZ B;  3EFC A;  1CK1 A;  1EF5 A;  3AE9 B;  1WGY A;  4MH0 E;  2RSU A;  4JL9 A;  4HLE A;  2MSE D;  4TSS A;  5D2M B;  1DYQ A;  2KFJ A;  3L08 A;  2DNF A;  2JT4 B;  2BB5 A;  2FBW B;  4FXC A;  4FN2 A;  2IND C;  3OWE B;  3B2G A;  3B1L X;  1LFD A;  2KT7 A;  3T8M A;  4HDQ A;  1D5X C;  3IBE A;  2BGF A;  2O6V A;  2HTH A;  2L83 A;  1I7H A;  1UF0 A;  3DBR I;  1UBQ A;  1WGD A;  2FID A;  3RI7 C;  2MRP A;  1LGR A;  1WXM A;  2OHF A;  1K52 A;  5J2R A;  1ZUD 2;  2MBO A;  4GXB A;  4RMA A;  3RZW C;  2ZNV C;  3VR8 B;  3DBL I;  3DHG C;  1LQB A;  2ZEQ A;  3AE3 B;  2GRI A;  1WE7 A;  3I63 C;  2KDM A;  2JF5 A;  2RDH A;  3EA6 A;  1QKZ A;  2NTT A;  3DWM A;  4AQ7 A;  2JZ3 B;  1JWA D;  2QCZ A;  2LUM A;  2GBM A;  2D3G A;  4WWN A;  1K51 A;  4HVB A;  1BXT A;  1HEZ E;  2CU1 A;  5J18 A;  2KQ4 X;  3QA8 A;  4AOF A;  3VH4 B;  2PMV A;  2V1Y A;  3KYC D;  3EUB 2;  1ZW7 A;  2MP2 B;  1FD6 A;  2KDF B;  4IOI E;  5D7G A;  5BYS A;  3UIP B;  1Q5W B;  4LLG M;  1NDD A;  2O2V A;  2QHO A;  5E6N A;  2K39 A;  4W9J A;  3TEZ A;  4MGZ E;  2KMC A;  4UDU C;  3PRE A;  4HPM B;  3LJ3 A;  3AEA B;  2CHZ A;  2N9K A;  1J7C A;  3ABV B;  3NVW A;  1VZ7 A;  3T9L A;  2BYF A;  4M8N A;  3AN1 A;  3Q3O C;  2L8J A;  3EFU A;  4E71 A;  3CIR B;  3AEE B;  2ICI A;  2MBB B;  2WXN A;  1L0X B;  1XD3 B;  2QMT A;  3ZXR A;  1WJN A;  3NZ3 A;  1WFY A;  3H1U A;  3P1M A;  3QCA A;  1N61 A;  3K9O B;  2J4X A;  1TYG B;  1SIJ A;  1CZP A;  3X23 A;  2JSV X;  1ESF A;  3Q3J A;  2VH1 A;  4XWT A;  1Z2M A;  1IPG A;  1GG3 A;  1PYW D;  2VZK D;  3O65 B;  4PS8 A;  4KV2 A;  1VZ6 A;  2MH7 A;  1P3Q U;  4HK2 A;  4MH8 A;  3ZUN A;  2HD5 B;  2L0F A;  2X38 A;  4K7U A;  3Q3F A;  2LWP A;  3NVV A;  5FKA C;  3BYY B;  1MVK A;  5DPW A;  2VH2 A;  4L23 A;  1E8Z A;  1PGB A;  2CU3 A;  2L0T A;  1L6V A;  3KWV A;  3UGB B;  1UGJ A;  3O13 A;  2O2V B;  2V0G A;  1YX5 B;  1FPY A;  2KKC A;  1E7P B;  4LNK A;  1CQV A;  1F2R I;  3KUD B;  2M4N A;  4N59 A;  1J19 A;  4P7I A;  4GDL B;  5AZF A;  1HTQ A;  4YT0 B;  4DDG D;  2K0P A;  3NZS A;  1RRB A;  1E8W A;  2MW5 A;  3H9D A;  1KH0 A;  3U2S C;  2Z59 B;  3WAP A;  4ICV A;  4HRO A;  1ACC A;  2KQ7 A;  1RWS A;  4HPL B;  4HPP A;  3RUI B;  3VVW B;  1UEL A;  4LDT D;  4GB9 A;  3VHT C;  2G9H D;  2LVP A;  2BQQ A;  1VDV A;  4A8X C;  1RAX A;  2NR2 A;  2K3U A;  4JQW C;  2KWU B;  1C1Y B;  3X0W A;  4LNI A;  1WYW B;  2AWT A;  2KDE B;  4G3X B;  3RYT A;  3MHS D;  5DCN A;  1QZE A;  1ZP0 B;  4B9K A;  4DHJ D;  3DVG X;  2MP2 A;  4EE2 A;  3TEY A;  1WRI A;  2WXP A;  3W1S C;  1WM3 A;  3DVG Y;  1F52 A;  2AQ2 B;  4JWS C;  2MX2 A;  1ENF A;  3VRA B;  2Y3A A;  2VZK B;  2MLB A;  3TBL D;  1VLB A;  4K7W A;  2EMS A;  4KDI C;  1QOG A;  4RGO S;  1NI3 A;  2IYD B;  3DBH B;  4RGM A;  2QEJ C;  3HUI A;  3N3K B;  4DXF A;  3R8B A;  1QLB B;  1F0Z A;  1V1P B;  2L32 A;  4YL8 A;  1EU4 A;  2Z8L A;  3U8Z A;  4YSY B;  2R2O A;  1VZ8 A;  2UYZ B;  1AW7 A;  3N20 C;  2KD0 A;  3FKY A;  4II2 B;  4C80 A;  4URK A;  4KGR A;  5EE1 A;  4GLS C;  1OGW A;  1FRR A;  2NTS A;  5E6P A;  2MQJ A;  1PDX A;  3KH0 A;  4EZJ A;  2ONQ A;  4GOC A;  1HTO A;  3OLM D;  1RLF A;  2J52 A;  4OZA A;  4OZB A;  4MSQ B;  4J6I A;  4J3O D;  1XXG A;  4DK5 A;  4BAX A;  1YQB A;  1YN4 A;  4F7Z A;  4FBJ B;  2JYT A;  3VUY A;  2Z0D B;  3MHZ A;  4WJN A;  1V49 A;  2OJR A;  4W9L A;  2N1V A;  1D5M C;  1YJ1 A;  3AE6 B;  2BKR B;  1XLO A;  3WAL A;  1L6U A;  4HCN B;  4EZL A;  4MT5 A;  2CJO A;  4M01 A;  1KTK A;  1FNW A;  3EHV A;  5FK9 C;  4K1R B;  4CO7 A;  3SFE B;  3FIL A;  4HJK A;  2R2Q A;  3WA0 A;  3EGR A;  4KZC A;  4P1C C;  1SB3 C;  4D2K A;  1L7Y A;  1Z5S B;  4OZC A;  3K9P B;  3R7Q A;  3KW5 B;  1XQQ A;  3Q8E A;  4E3C A;  1SJE D;  4XC2 A;  2KMM A;  4HWI B;  1LO5 D;  3A9J B;  3IFW B;  2XN9 C;  4HKQ A;  2IDY A;  4XDD A;  4LNN A;  1TZ1 A;  2BB6 A;  4W9E A;  2PEA A;  2RD0 A;  1YJI A;  4A20 A;  4G50 A;  3LXF A;  4MM3 A;  1CJE A;  5HFY A;  1WGK A;  1E6E B;  2N7D A;  3P4S B;  2WX0 A;  2L1A A;  1OQQ A;  2XBB C;  1UWX A;  4BKS A;  2LRU A;  1DOX A;  3VTW A;  3ZJU A;  2WXF A;  1WM2 A;  2IGH A;  1WXV A;  2V9H A;  4XZ4 A;  3FC4 A;  1QT9 A;  3J9C A;  4IG7 B;  3ETR A;  3WIM A;  2PE6 B;  4OW0 A;  3P63 A;  5CHW A;  2M0X A;  4WQM A;  4I6P A;  2JRI B;  4ICU A;  2GBJ A;  2KX0 A;  3M63 B;  4C56 C;  1OFF A;  3P4P B;  2IO3 B;  1I35 A;  3WCQ A;  1WY8 A;  2DEN B;  4KX6 B;  1A5R A;  1P7F A;  4HJG E;  1BUI C;  3PSE B;  1MFW A;  3QJZ A;  1WE6 A;  2L3Z A;  1T5X D;  4MEL A;  1V8C A;  3QQ8 B;  3RN9 C;  3N32 A;  1C77 A;  2ZCC A;  3VR9 B;  1UWM A;  2D07 B;  3SU8 X;  3NUH B;  4XX5 A;  1TZO A;  1TY0 A;  2EEL A;  1SBB B;  3NY5 A;  4AP4 C;  3AE8 B;  4IKG A;  5L83 A;  5IN7 A;  3V6C B;  2PLP A;  4C7Y A;  1D4B A;  1C4P A;  3W1S A;  4GDL A;  5JXV A;  3VTV A;  4K81 A;  1FEH A;  2CJN A;  4B0M A;  1C9F A;  2WXQ A;  1GAQ B;  3SFD B;  4CYE A;  2LHE A;  5C3J B;  4ACF A;  2PVG C;  3NG0 A;  4IUM B;  3T3N A;  3R7R A;  3V61 A;  3S2A A;  2V3S A;  4MGY E;  4BVU C;  3WAN A;  1YQ4 B;  1XLP A;  1FFU A;  1XLQ A;  1FRD A;  4JX1 C;  3W1Y A;  2MBQ A;  2D3C A;  2V4L A;  2FCN A;  2C7N B;  4TQ0 A;  1SE4 A;  2DX5 B;  4IWQ A;  5C2T B;  4BFR A;  1GNU A;  1XEE A;  3AM9 A;  3RNB C;  2G4D B;  3L10 B;  1R4M I;  1NYR A;  4GIV A;  4USA A;  3PZ8 A;  4NAW A;  3AEB B;  1D6E C;  3H7P B;  3W5V B;  3L4P A;  5BMI A;  4W9G A;  3ZTC A;  2JZP A;  2WYQ A;  3MP9 A;  4YTN B;  2CR5 A;  4N9F 4;  2O6V B;  3IT6 B;  3A33 B;  3FAH A;  3DHH C;  2N0S B;  2DZJ A;  3BVM A;  4WJP A;  1I4G A;  1WMH B;  3DPD A;  1B9R A;  4FJY A;  1R4M B;  2Y5C A;  4MAC A;  1RYJ A;  1VJK A;  5IKC M;  2J53 A;  3ENE A;  4ITK A;  2WXM A;  4LJO B;  4A90 A;  5D94 A;  2A5U A;  2H88 B;  3Q14 C;  4XYC A;  2IZV B;  2IBI B;  2XEW A;  1S3S G;  2BW2 A;  2KWD A;  3GE3 C;  3ZRF A;  1YMH E;  3DBR B;  2REX A;  2SAK A;  3V60 A;  3OG5 A;  3ZLZ A;  1N6Z A;  4MJS A;  4B95 A;  2I1K A;  2K8B A;  3BYT B;  1ZE3 D;  1WWT A;  1VR9 A;  1TS5 A;  3P42 A;  1V81 A;  3U7Z A;  4K7S A;  1E9M A;  3RCZ A;  2KTR A;  4P1B C;  3I5J C;  4EUT A;  1PGA A;  2QSD A;  4M00 A;  4MDK E;  5DPR A;  1SIF A;  2PTL A;  3ZJV A;  1F77 A;  1EO6 A;  5LXH A;  3UIO B;  3Q3M C;  1WRD B;  1L4Z B;  1NEN B;  3HVZ A;  1E10 A;  3TSS A;  4RH6 A;  1OQY A;  4YXD B;  2KFK B;  3HM6 X;  4G11 A;  1AYF A;  1FM0 D;  3ML8 A;  1K53 A;  3HVD A;  1VRA B;  2WDR B;  3IXS A;  3OAW A;  4IM0 A;  3AE4 B;  3AU4 A;  2DYM A;  3KLS X;  2GLS A;  3N1X C;  4S17 A;  1UD7 A;  3ONS A;  5LLI A;  4IM2 A;  1FFV A;  3WAO A;  1V5O A;  2LZ6 A;  2PPH A;  3VDZ A;  2W82 A;  2LHD A;  2PVO D;  1GPX A;  2FUG 1;  4LCD E;  1FXI A;  3VFK A;  2WXI A;  3C19 A;  2LGX A;  3AUL A;  3L16 A;  4YTP B;  2MWS B;  3UQB A;  1AWD A;  2N9X A;  2M8S A;  4YSZ B;  4O1N A;  1SXT A;  1K8R B;  1IBX B;  3M3J A;  1F9J A;  4B6W A;  4MGK E;  4NJ7 A;  1QF6 A;  3MFG A;  3DHI C;  4LNO A;  4C00 A;  4DQO C;  3UIN B;  4YWG G;  4WUR A;  2BVC A;  2JX5 A;  4K3B A;  3AEG B;  4CQN A;  2EKI A;  1I4P A;  2NCN A;  2RMM A;  5D6J B;  3PT2 B;  4IWP A;  2Q5W D;  4LNF A;  4EZK A;  3U7D A;  1E5W A;  1ET9 A;  4JE3 B;  1GB1 A;  2BS2 B;  1N63 A;  3IAS 1;  2CHX A;  4MGI E;  2KK8 A;  1L5P A;  1H8C A;  4XDC A;  3HIZ A;  1WZ3 A;  2K8C A;  4TV3 A;  1WX7 A;  2KWV B;  1V5T A;  1YNT E;  1NI2 A;  2MEK A;  1C4C A;  4LJP B;  2FCM A;  2R61 A;  3T3O A;  2FUH B;  1N60 A;  4JWU C;  2KJ6 A;  1M94 A;  2K5P A;  1C3T A;  2BPS A;  1UUP A;  2KAN A;  2INN E;  2CHW A;  3GZN I;  4BOS C;  3AEC B;  4G0N B;  1SE2 A;  2N9E B;  4IWO A;  3H6N A;  1WR1 A;  2DBY A;  1YN5 A;  2I1J A;  2BWF A;  1YX6 B;  1MPE A;  1WI0 A;  4PS7 A;  1OQR A;  2ZZP B;  3BVG A;  3MJW A;  2BS3 B;  3IG3 A;  4JGH B;  2WDT B;  3BK1 A;  2KLC A;  3BWU D;  2EKE C;  3ZXV A;  2JXT A;  4FJZ A;  1V1O A;  3GZN B;  3GE8 C;  2KNB A;  2LXC A;  2MJE A;  3PS6 A;  4RFB A;  1XT9 B;  4N58 A;  2Y5P A;  2JWU A;  4BKG A;  1TT5 B;  4FLH A;  3QK0 A;  1JRU A;  3A4R A;  2ZW0 A;  2DAF A;  3IVF A;  3SEB A;  3GB1 A;  1GJZ A;  3DWG C;  4HKZ E;  1D5Z C;  1LM8 B;  5HKH A;  2LGD A;  1EWY C;  2ON8 A;  1TS3 A;  2A4Z A;  1R7S A;  3N30 A;  1SE3 A;  2YLM A;  5BMG A;  3TL5 A;  4HXD A;  1GUA B;  1TKG A;  2N7J A;  1STE A;  5AUI A;  2KFK A;  3GP7 A;  3NRZ A;  1WJ4 A;  3TEW A;  1GOZ A;  5TR5 A;  1FXT B;  4FHJ A;  2LMC A;  4ZYS A;  3I3T B;  2ZPY A;  2ASQ A;  4NY0 A;  2NS5 A;  2HDE A;  1V1P A;  4GMV A;  4AJY B;  4PS3 A;  3KQ4 A;  2WXG A;  2FCQ A;  2LVO A;  3AMZ A;  3VTU A;  2XNA C;  1WH3 A;  2RR9 A;  3DBH I;  2KTR B;  4JPS A;  3R2T A;  3TEX A;  2CS4 A;  2ZNV B;  1C4A A;  1DOI A;  3GOE A;  2K6D B;  1MHH E;  4EOY A;  5GMV A;  3ZRC A;  5JHA A;  5LXI B;  2L76 A;  2J0J A;  3NJT A;  1ZXI A;  4II3 B;  1IBX A;  3APC A;  2IGG A;  2KTF A;  1RFA A;  3RZF A;  2ZVN A;  3HK0 A;  2GBK A;  2BYT A;  3U4E G;  2Z0E B;  3N9Y C;  1NVI D;  2G45 B;  2G4S A;  4A6Q A;  5BMH A;  1WXQ A;  2BKF A;  2JUO A;  2UU7 A;  4R3D A;  3RNC C;  1MJD A;  1PGX A;  4XGA B;  1IP9 A;  1M4V A;  3ZIM A;  3I9V 1;  2BYV E;  1MI0 A;  1OEY J;  3TMP B;  4LDT B;  4KZ0 A;  4GDK A;  3PRM B;  3ZGZ A;  1OTR B;  4TKN A;  2O6V D;  3P4Q B;  2WXO A;  2NBV B;  4IDI A;  1WXA A;  1YN3 A;  1CMX B;  3D32 A;  3ZO5 B;  2M17 A;  3APD A;  1JWU D;  3BIN A;  1AAR A;  1FNV A;  2BWE S;  3KVF B;  5BYR A;  3H7S A;  3A1Q B;  1I4H A;  1WIA A;  4ZDV A;  1T0Y A;  2QIE B;  5L95 C;  1UNS A;  1TJE A;  3AE2 B;  3P4R B;  3GS2 A;  1MG8 A;  5JHB A;  1UZX B;  1L2N A;  4KVG B;  1RFK A;  2QC8 A;  5EDS A;  3DBS A;  3M62 B;  2PE9 A;  4GSW A;  4HEA 1;  5AUK A;  3AE7 B;  4YSX B;  2WX1 A;  2N4F A;  3E56 A;  1QOA A;  1F1H A;  2OJW A;  1KM7 A;  1E8Y A;  3MTN B;  1JML A;  5EE9 A;  1WGR A;  3CWI A;  1KF6 B;  1V86 A;  2GB1 A;  2DWQ A;  2KN5 A;  4ZRJ A;  5G55 A;  1FXA A;  5JH5 C;  3ZNI D;  2KDI A;  3Q8C A;  1X1M A;  1MG4 A;  4AJW A;  3L54 A;  1EM7 A;  1ZDX A;  3QAQ A;  3RNF C;  1JWB D;  3BZD B;  3OJ3 A;  3ZNG C;  2C7H A;  1XF5 L;  3URY A;  4IM3 A;  3AE5 B;  4W9I A;  2W3R A;  3PVL A;  3CF6 E;  3BK2 A;  4WQO B;  3IAM 1;  4RGN A;  2DHZ A;  1YOV B;  2ZW1 A;  2G1E A;  2BBC A;  1MHX A;  4HCP B;  1TIF A;  2GBR A;  2KQS A;  4WWO A;  1TS2 A;  1GC6 A;  2PJH A;  2IY0 B;  2XK5 B;  2N9L A;  3TIX A;  1U4A A;  2C60 A;  1F2R C;  4DHZ B;  3VUW A;  4GU2 A;  2RPQ A;  4KDL B;  2WXH A;  4TQ1 A;  1KFY B;  1IGD A;  2K6Q A;  3VRB B;  4RNA A;  4TUU A;  4TMA B;  5H92 C;  4KIK B;  3NHE B;  2AL3 A;  2KO3 A;  1KOT A;  2AQ3 B;  1KRH A;  1I42 A;  1TY2 A;  1WYG A;  1D3Z A;  1L0Y B;  1HA5 A;  3AI5 A;  3B0A A;  3M95 A;  5AEK B;  3U30 A;  2NBU A;  1ISN A;  2K9X A;  2J7Q B;  1EF1 A;  1IGC A;  1XCQ L;  2LGY A;  5IAA C;  3A1Q A;  2DAJ A;  2WGS A;  2J0K A;  3AXC A;  1C78 A;  3PRZ A;  3EEC A;  2L7R A;  1E8X A;  4MSM B;  5I4D A;  2MJ3 A;  4PYZ A;  2PKO A;  1JWM D;  2MBE A;  2E6X A;  2I38 A;  3L13 A;  3HHM A;  4REZ A;  4OVZ A;  4BKT A;  3VUX A;  3AV8 A;  4ANU A;  3Q8F A;  2WXJ A;  4KSL C;  3PV1 A;  2W3S A;  4NZL B;  2AX5 A;  3V3X A;  2AYO B;  5IP4 D;  2MCN B;  4YTM B;  2GMI C;  3ZQ4 A;  2H89 B;  2Y5B B;  1HQR D;  1KJT A;  2IY1 B;  2ZJD A;  2KJR A;  2IPK D;  3MJ5 A;  2KN4 A;  3DOW A;  4W9F A;  4DHZ E;  4ARC A;  2OED A;  1OEY A;  1SSN A;  5AZH A;  4HDO A;  4WJO A;  4RF1 A;  3APF A;  1HXY D;  4NPN A;  2N7E A;  3RUL A;  1NEK B;  1E0Z A;  3PZ7 A;  3QC8 B;  1G6J A;  4RF0 A;  1BT0 A;  3NOB A;  4M0W A;  4NQL B;  4FAD A;  2JQR B;  5HI1 A;  4I6N B;  3RFZ B;  1HZ5 A;  1ZXH A;  2WLB A;  2B76 B;  2LJ5 A;  3R3M A;  4L2Y A;  5H8Y E;  1ZGU B;  3C0R B;  3L17 A;  5C1Z A;  3PPA A;  2LFI A;  2IO1 B;  3DVN U;  4ZOH C;  2KJH B;  1P7E A;  1WXS A;  4WWP A;  1NBF C;  3PZD A;  3Q69 A;  1GB4 A;  3NS1 A;  4PT5 A;  2K25 A;  5G2N A;  2N1W A;  2YEP B;  1ROE A;  4US9 A;  3PHW B;  2L00 B;  3PO0 A;  3A4S C;  1FO4 A;  2M19 A;  3DVN V;  1T0S C;  2D3B A;  4PK1 A;  1H4R A;  3JSV B;  3LYY A;  2KVR A;  1FMA D;  1J0G A;  1KLG D;  2VRR B;  4NAM A;  1IYF A;  2JVC A;  1YJJ A;  1WF9 A;  1FNU A;  2BYE A;  2EMT A;  4RM9 A;  3RPF C;  3MC9 A;  3MC8 A;  3AB5 A;  3N1Y C;  3SR6 A;  4KGS A;  4W9D A;  4A3P A;  1KLU D;  2W55 A;  4DWF A;  1XLN A;  5DPS A;  1FCC C;  4DXA B;  4A3O A;  2KXJ A;  3RNE C;  4NQK E;  1EU3 A;  1P1A A;  4DXG A;  1WR6 E;  2NPT B;  2RDG A;  3ZJT A;  2X8X X;  4WH4 A;  2DZI A;  4DBG A;  2LUE A;  4EKU A;  4ZRK A;  1N5W A;  4JLC A;  3WAM A;  2FAZ A;  4ZHP A;  1WX8 A;  4W9K A;  3Q2A C;  3HM3 A;  1PFD A;  3UI3 A;  5BO4 B;  1P98 A;  4AS1 A;  2WXK A;  3VQI A;  2DZM A;  2G3Q B;  3KWL A;  1ZPS A;  4P16 A;  2WXR A;  3NS8 A;  2ZCB A;  2WDV B;  1N5X A;  2HTM E;  2DZK A;  3ZNH B;  2WU2 B;  5G5H A;  3ZKJ C;  2PIA A;  3NZU A;  3TJP A;  3DQV A;  1JW9 D;  2DYB A;  1ZKH A;  4JIO U;  3DBL B;  1QOF A;  2J42 A;  1I4Q A;  4RM8 A;  3RNA C;  2ZPN A;  3JW0 X;  2BT6 A;  1T3Q A;  5IA7 A;  2HJ1 A;  3KUZ A;  5CHV C;  2L52 A;  3V62 A;  2MA9 B;  2PW9 A;  2KOX A;  3ALB A;  3W5U B;  2NPT A;  3EC8 A;  3A9K B;  2KC2 A;  2GOW A;  4DHJ B;  3V6E B;  4RCO A;  5CHF A;  3OJ4 B;  2WP9 B;  3QHT A;  1JRO A;  1L4D B;  1SEB D;  3RT3 B;  3I57 A;  4I6L B;  1WGG A;  1FCL A;  2HJ8 A;  3CSF A;  5KHO A;  1JCK B;  1E7V A;  2KAJ A;  5DPT A;  1Q10 A;  4M8M A;  3E9S A;  5LNK 1;  1GC7 A;  2CKH B;  4EFO A;  1SGH A;  3DDC B;  3UQA A;  4OVU A;  1LXD A;  2RPV A;  4ZRP A;  2M0A A;  4W9H A;  4LK0 M;  3AH7 A;  2E3T A;  2K22 A;  3VXW A;  1AN8 A;  4GGQ A;  1J8C A;  1R4N B;  2AQ1 B;  4KIK A;  2IJ0 A;  3B08 A;  5IOI A;  2NBW B;  4KKJ A;  4N6E B;  3PLV A;  3QX1 A;  2KDB A;  4A9A A;  1WJU A;  1PQS A;  5CX3 A;  3U52 E;  2JPH A;  4KSK C;  1QOB A;  2XK5 A;  3Q3N C;  2HE7 A;  1ET6 A;  2D11 A;  3PRP B;  1K50 A;  1QQR A;  4WIP A;  2ACZ B;  2DLB A;  3PGE A;  2ZVO A;  2JYE A;  1J7B A;  3DCG A;  1HZ6 A;  4ZRI A;  2AEH A;  2KC1 A;  1SF0 A;  2KX3 A;  4ASW C;  5KHQ A;  2WXL A;  4C4V A;  2LRW A;  4ANX A;  2IO2 B;  5EE0 A;  1WMH A;  4B0E A;  4BBN F;  3LB8 C;  3ZYY X;  2WU5 B;  1V9J A;  1V6E A;  3PLU A;  2D10 A;  3SD5 A;  5TSS A;  3JYU A;  1E7U A;  1E90 A;  1TGZ B;  1XCT L;  2RGF A;  1BML C;  2UWQ A;  1TBE A;  4W9C A;  3H7P A;  4M02 A;  1S1Q B;  2MJD A;  4C4V B;  1JRP A;  3AU5 A;  1NYQ A;  1YIW A;  3VAW A;  2KYW A;  1UH6 A;  1XO3 A;  3P2B A;  4NAW B;  5J17 A;  5CTR C;  2D3A A;  5EE3 A;  2WNM A;  2LGI A;  3QIJ A;  4QAY A;  2M56 B;  3RMK C;  2MHJ A;  1DOY A;  2W9N A;  2FIF A;  4X57 B;  4FJV B;  4BKS D;  2FE8 A;  4MJS B;  4WAF A;  1Y8R C;  1L0V B;  3BY4 B;  4NJC A;  1WGH A;  4BZA A;  2LI5 A;  1WX9 A;  1EUV B;  4PYU A;  2V3N A;  5E6O A;  3PHX B;  2KWC A;  3R2I A;  4H2A A;  1Q0W B;  3ZNZ B;  5GXG B;  1TTN A;  1VCB A;  2GI9 A;  2AL6 A;  2C9W B;  2JZZ A;  5BYQ A;  1HE8 A;  4MEM A;  3TCA A;  3W2D A;  4ZRQ A;  2NMQ A;  4ARI A;  3CMM B;  5MPO A;  2V4I B;  2WDQ B;  1T6B X;  4NJ6 A;  1YD8 U;  1V97 A;  2QIL A;  2INP E;  2BF8 B; 
#chains in the Genus database with same CATH homology
 4KSL C;  3PV1 A;  1V5O A;  2LZ6 A;  2PPH A;  4FA6 A;  3VDZ A;  4AWJ A;  2AYO B;  2MCN B;  1RAX A;  2GMI C;  1V2Y A;  4LCD E;  4NNJ B;  2NR2 A;  4JQW C;  3VFK A;  2M1M A;  2KWU B;  2Y5B B;  3CST A;  1C1Y B;  3QAR A;  2YVC A;  1KJT A;  3X0W A;  2LGX A;  3AUL A;  2IY1 B;  3L16 A;  4ZYN A;  2J0M A;  2MWS B;  3UQB A;  1WYW B;  2N9X A;  2AWT A;  2KDE B;  4G3X B;  2M8S A;  3RYT A;  3PTF C;  3MHS D;  2ZJD A;  5DCN A;  2KJR A;  2JY6 A;  3L0W B;  1K8R B;  3KYD D;  1QZE A;  2K1F A;  3M3J A;  2JRH A;  2KHW B;  3DOW A;  4W9F A;  4DHZ E;  1F9J A;  2KLG A;  4B6W A;  4B9K A;  1OEY A;  4MGK E;  4IC7 B;  4IW0 A;  4NJ7 A;  3ZVV A;  3DVG X;  4DHJ D;  5AZH A;  4HDO A;  4WJO A;  2MP2 A;  2OOB B;  1P9D U;  3APF A;  3UIN B;  4NPN A;  2N7E A;  3RUL A;  2MBH A;  3W1S C;  1WM3 A;  4GN1 A;  3QC8 B;  3LDZ E;  2NCN A;  3DVG Y;  5D6J B;  1BT0 A;  1G6J A;  3NOB A;  3ZTD A;  4NQL B;  4FAD A;  2WWZ A;  3PT2 B;  4IWP A;  4EZK A;  3U7D A;  1E5W A;  4I6N B;  2MX2 A;  2NVU I;  1VD2 A;  2CHX A;  2MLB A;  3TBL D;  4MGI E;  4K7W A;  2EMS A;  2KK8 A;  4KDI C;  4BBN C;  2LJ5 A;  3R3M A;  1H8C A;  2IYD B;  3HIZ A;  1ZGU B;  1WZ3 A;  3QWZ B;  2K8C A;  3C0R B;  3L17 A;  5C1Z A;  1P0R A;  4TV3 A;  3PPA A;  1WX7 A;  2KWV B;  2IO1 B;  2D2Q A;  3N3K B;  1V5T A;  3DVN U;  2KJH B;  1NI2 A;  2C7M B;  1WXS A;  4WWP A;  4E74 A;  1NBF C;  3PZD A;  1R4N I;  4AUQ C;  4LJP B;  2FCM A;  4YL8 A;  5AZG A;  4ANV A;  2FUH B;  3U8Z A;  2KJ6 A;  2R2O A;  3KUC B;  2K25 A;  5G2N A;  3A9J A;  2N1W A;  3ZDT A;  2UYZ B;  1M94 A;  2KD0 A;  4II2 B;  4URK A;  1C3T A;  2BPS A;  2C5L C;  2K8H A;  2KAN A;  3PHW B;  2CHW A;  3ZDM C;  1OGW A;  2KMA A;  2L00 B;  3GZN I;  4FHK A;  5C23 A;  4BOS C;  2KZR A;  3A4S C;  4G0N B;  2N9E B;  5E6P A;  4IWO A;  3H6N A;  2MQJ A;  1WR1 A;  3KH0 A;  4EZJ A;  1UGM A;  4GOC A;  3OLM D;  3DVN V;  1RLF A;  1H4R A;  2I1J A;  3JSV B;  4J6I A;  2BWF A;  1YX6 B;  1SE9 A;  4MSQ B;  1WI0 A;  4PS7 A;  2KVR A;  2ZZP B;  5FR6 A;  4DK5 A;  3MJW A;  1Q1O A;  2VRR B;  1J0G A;  1IYF A;  3IG3 A;  2JVC A;  3A9K A;  4JGH B;  3VH3 B;  2WDT B;  1WF9 A;  4WJQ A;  1YQB A;  3RD2 A;  3UF8 A;  2KLC A;  2EKE C;  3ML9 A;  3SDL C;  4F7Z A;  2BYE A;  2EMT A;  4FUL A;  4RM9 A;  4FBJ B;  3VUY A;  1UBI A;  4FJZ A;  2LXA A;  2Z0D B;  2FCS A;  4WJN A;  4F1S A;  2KNB A;  1V49 A;  2LXC A;  2OJR A;  2JWZ A;  3PS6 A;  4W9L A;  4W9D A;  2N1V A;  1XT9 B;  4A3P A;  1YJ1 A;  4BKG A;  2BKR B;  4DWF A;  3WAL A;  5DPS A;  4FLH A;  2N9P C;  4DXA B;  3QK0 A;  4HCN B;  1JRU A;  2KXJ A;  4A3O A;  4OVV A;  3A4R A;  4EZL A;  2DAF A;  4NQK E;  2LAS A;  1P1A A;  3IVF A;  1GJZ A;  1WZ0 A;  1WR6 E;  1LM8 B;  3ECI A;  3EHV A;  5HKH A;  2NPT B;  3JSV A;  4K1R B;  4CO7 A;  2LGD A;  4HJK A;  3JVZ X;  2DZI A;  2R2Q A;  2A4Z A;  4DBG A;  3WA0 A;  2LUE A;  4EKU A;  3N30 A;  4KZC A;  4ZRK A;  4JLC A;  3WAM A;  1L7Y A;  1Z5S B;  2FAZ A;  2YLM A;  3K9P B;  1WX8 A;  3R7Q A;  4W9K A;  3KW5 B;  4WAA A;  2L05 A;  1XQQ A;  1WJ6 A;  4EEW A;  3HM3 A;  3TL5 A;  5BO4 B;  1P98 A;  4HXD A;  2FNJ B;  1GUA B;  4E3C A;  4XC2 A;  1KLV A;  2LD9 A;  4HWI B;  2DYO A;  3VQI A;  2DZM A;  2G3Q B;  3A9J B;  3IFW B;  2KFK A;  3NS8 A;  1TZ1 A;  2ZCB A;  2GBN A;  1WJ4 A;  4W9E A;  4DDI D;  2PEA A;  2RD0 A;  4A20 A;  5TR5 A;  2JXX A;  1FXT B;  4FHJ A;  3I3T B;  4G50 A;  2ZPY A;  2ASQ A;  4NY0 A;  2DZK A;  4MM3 A;  2NS5 A;  4ANW A;  3ZNH B;  4AJY B;  4GMV A;  3ZKJ C;  2N7D A;  4PS3 A;  5JZE B;  2FCQ A;  2LVO A;  3IHP C;  4GDK B;  1V80 A;  2WX0 A;  3R66 C;  3SHQ A;  2XBB C;  3NZU A;  3VTU A;  3TJP A;  3DBH I;  1WH3 A;  2RR9 A;  4F8C B;  3ZW3 A;  3DQV A;  2KTR B;  2DYB A;  1ZKH A;  4JIO U;  2CS4 A;  2ZNV B;  2LRU A;  3GOE A;  4BKS A;  2B3A A;  3VTW A;  4RM8 A;  2ZPN A;  2K6D B;  3JW0 X;  1WM2 A;  4M0W B;  1WXV A;  4EOY A;  2LVQ A;  5GMV A;  3ZRC A;  5JHA A;  5LXI B;  5IA7 A;  4XZ4 A;  2L76 A;  3KUZ A;  2J0J A;  4II3 B;  5CHV C;  4CHK A;  3APC A;  3V62 A;  4IG7 B;  2MA9 B;  2KTF A;  2IO0 B;  1RFA A;  3RZF A;  4BOZ B;  3WIM A;  2PE6 B;  2KOX A;  1EF5 A;  3ALB A;  2NPT A;  3EC8 A;  1WGY A;  2ZVN A;  4MH0 E;  5CHW A;  3HK0 A;  2M0X A;  2GBK A;  2RSU A;  4JL9 A;  4I6P A;  3A9K B;  4HLE A;  2KC2 A;  2JRI B;  2GOW A;  2GBJ A;  2KX0 A;  4ICU A;  2MSE D;  3M63 B;  2Z0E B;  5D2M B;  4DHJ B;  2G45 B;  2IO3 B;  3V6E B;  5CHF A;  2KFJ A;  2G4S A;  3L08 A;  3OJ4 B;  1I35 A;  2JT4 B;  1WY8 A;  2BKF A;  2DEN B;  2JUO A;  3QHT A;  3RT3 B;  1A5R A;  4FN2 A;  4I6L B;  1WGG A;  1IP9 A;  3B1L X;  1LFD A;  3T8M A;  2HJ8 A;  3CSF A;  4HDQ A;  5KHO A;  3ZIM A;  3IBE A;  3PSE B;  2BGF A;  2O6V A;  2HTH A;  3QJZ A;  2BYV E;  1WE6 A;  2L3Z A;  1OEY J;  3DBR I;  4MEL A;  3TMP B;  4LDT B;  3QQ8 B;  1UBQ A;  4KZ0 A;  1E7V A;  1WGD A;  2FID A;  3N32 A;  2ZCC A;  4GDK A;  3PRM B;  5DPT A;  1OTR B;  4TKN A;  2MRP A;  2D07 B;  1WXM A;  3SU8 X;  4M8M A;  4XX5 A;  2O6V D;  1GC7 A;  5J2R A;  2CKH B;  4EFO A;  2NBV B;  2MBO A;  4GXB A;  1WXA A;  1CMX B;  1SGH A;  3DDC B;  3D32 A;  4RMA A;  4OVU A;  3ZO5 B;  3UQA A;  3NY5 A;  3RZW C;  1LXD A;  2ZNV C;  2M17 A;  3APD A;  3DBL I;  4AP4 C;  3BIN A;  5L83 A;  1LQB A;  1AAR A;  2ZEQ A;  3V6C B;  4W9H A;  2BWE S;  3KVF B;  3H7S A;  1WE7 A;  2JF5 A;  3W1S A;  4GDL A;  3VXW A;  3A1Q B;  3VTV A;  1WIA A;  4GGQ A;  4K81 A;  1J8C A;  4ZDV A;  2JZ3 B;  1T0Y A;  4KIK A;  5L95 C;  2GBM A;  2D3G A;  3B08 A;  4WWN A;  4HVB A;  2NBW B;  4CYE A;  2CU1 A;  5J18 A;  3PLV A;  4IUM B;  1MG8 A;  3R7R A;  5JHB A;  3V61 A;  3QX1 A;  3S2A A;  2KDB A;  3QA8 A;  4AOF A;  3VH4 B;  1UZX B;  2V3S A;  2V1Y A;  1WJU A;  3KYC D;  1PQS A;  4MGY E;  5CX3 A;  1L2N A;  4KVG B;  1ZW7 A;  5EDS A;  4BVU C;  2MP2 B;  3DBS A;  2JPH A;  4KSK C;  2KDF B;  3M62 B;  2PE9 A;  2XK5 A;  5D7G A;  4GSW A;  3WAN A;  2HE7 A;  2D11 A;  3PRP B;  3UIP B;  1Q5W B;  1NDD A;  2O2V A;  2QHO A;  2WX1 A;  2N4F A;  5E6N A;  2MBQ A;  3W1Y A;  2K39 A;  2V4L A;  2FCN A;  4W9J A;  3PGE A;  4MGZ E;  2KMC A;  1KM7 A;  2ZVO A;  2C7N B;  3PRE A;  4HPM B;  1E8Y A;  4TQ0 A;  3LJ3 A;  3MTN B;  2CHZ A;  2DX5 B;  3DCG A;  4IWQ A;  4ZRI A;  4BFR A;  1GNU A;  1WGR A;  3T9L A;  2BYF A;  1V86 A;  4M8N A;  2AEH A;  2KC1 A;  2G4D B;  3L10 B;  1R4M I;  2KN5 A;  4ZRJ A;  2KX3 A;  5G55 A;  4ASW C;  2L8J A;  4GIV A;  5JH5 C;  3ZNI D;  3EFU A;  5KHQ A;  2KDI A;  4NAW A;  4E71 A;  2LRW A;  4ANX A;  3H7P B;  1X1M A;  2IO2 B;  4W9G A;  1WMH A;  2MBB B;  3ZTC A;  4BBN F;  1XD3 B;  2WYQ A;  4AJW A;  3L54 A;  1WJN A;  3QAQ A;  1WFY A;  1V9J A;  1V6E A;  2CR5 A;  3H1U A;  2D10 A;  3OJ3 A;  3PLU A;  4N9F 4;  3SD5 A;  3QCA A;  3ZNG C;  2O6V B;  3K9O B;  3JYU A;  3A33 B;  1E7U A;  1E90 A;  3X23 A;  2C7H A;  1TGZ B;  4IM3 A;  2DZJ A;  4WJP A;  3Q3J A;  1WMH B;  3DPD A;  4W9I A;  1Z2M A;  2RGF A;  1IPG A;  1GG3 A;  2UWQ A;  4FJY A;  1TBE A;  3O65 B;  4PS8 A;  3PVL A;  4KV2 A;  3H7P A;  4W9C A;  1P3Q U;  1S1Q B;  3CF6 E;  4HK2 A;  3ZUN A;  2HD5 B;  2L0F A;  4WQO B;  3AU5 A;  3ENE A;  1YIW A;  4K7U A;  2DHZ A;  4LJO B;  3VAW A;  5D94 A;  2A5U A;  3Q3F A;  2LWP A;  4HCP B;  1UH6 A;  3P2B A;  2IZV B;  2IBI B;  2XEW A;  2GBR A;  2KQS A;  4NAW B;  4WWO A;  1S3S G;  5J17 A;  5DPW A;  1GC6 A;  5CTR C;  2PJH A;  2IY0 B;  2XK5 B;  3ZRF A;  1E8Z A;  3QIJ A;  3TIX A;  1U4A A;  2L0T A;  2REX A;  2C60 A;  2W9N A;  2FIF A;  4DHZ B;  3V60 A;  3VUW A;  4X57 B;  4GU2 A;  2RPQ A;  4KDL B;  3UGB B;  4FJV B;  3ZLZ A;  4MJS A;  4TQ1 A;  2O2V B;  2I1K A;  2K8B A;  4B95 A;  4BKS D;  1YX5 B;  2K6Q A;  4MJS B;  1V81 A;  1Y8R C;  4TUU A;  2KKC A;  3BY4 B;  4K7S A;  1WGH A;  3RCZ A;  2KTR A;  4KIK B;  2LI5 A;  1WX9 A;  3NHE B;  1EUV B;  3KUD B;  2M4N A;  2AL3 A;  2KO3 A;  4PYU A;  4EUT A;  1KOT A;  1J19 A;  4P7I A;  4GDL B;  4MDK E;  5AZF A;  5E6O A;  5DPR A;  1I42 A;  1SIF A;  3PHX B;  2KWC A;  1D3Z A;  5LXH A;  1EO6 A;  3AI5 A;  3B0A A;  3UIO B;  3M95 A;  5AEK B;  1Q0W B;  3ZNZ B;  1WRD B;  3U30 A;  2NBU A;  4DDG D;  1ISN A;  2J7Q B;  1TTN A;  1VCB A;  1EF1 A;  1RRB A;  3NZS A;  1OQY A;  2LGY A;  1E8W A;  3A1Q A;  5IAA C;  2DAJ A;  2AL6 A;  2C9W B;  2J0K A;  2JZZ A;  2MW5 A;  3H9D A;  3AXC A;  1HE8 A;  3PRZ A;  2KFK B;  2L7R A;  1E8X A;  3EEC A;  3HM6 X;  4G11 A;  4MEM A;  4MSM B;  2Z59 B;  3TCA A;  3WAP A;  4ICV A;  3ML8 A;  3CMM B;  4PYZ A;  2MBE A;  2KQ7 A;  4NJ6 A;  3L13 A;  3HHM A;  3OAW A;  4IM0 A;  1YD8 U;  4HPL B;  3AU4 A;  2DYM A;  3RUI B;  4BKT A;  3VUX A;  3VVW B;  1UEL A;  1UD7 A;  4LDT D;  3ONS A;  4ANU A;  4GB9 A;  3VHT C;  5LLI A;  4IM2 A;  3WAO A;  2BF8 B;  2LVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...