3RNEC

Structure of the toluene/o-xylene monooxygenase hydroxylase t201s/i276e double mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene o-xylene monooxygenase component
publication title Tracking a defined route for O2 migration in a dioxygen-activating diiron enzyme.
pubmed doi rcsb
source organism Pseudomonas sp. ox1
molecule tags Oxidoreductase
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.-.-:
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rneC00
2RDBC 3Q3NC 1T0QC 1T0SC 4P1BC 3RN9C 3Q14C 3N1ZC 1T0RC 3Q2AC 3DHGC 3GE8C 3DHIC 2INCC 3RI7C 3N1XC 3GE3C 3Q3OC 3I63C 4P1CC 3RNAC 3RNCC 3RNFC 3RMKC 3Q3MC 3I5JC 2INDC 3RNBC 3RNEC 3N1YC 3DHHC 3N20C 3RNGC
chains in the Genus database with same CATH superfamily
1FRRA 1BUIC 1MHHE 3R8BA 4KKIA 2JVCA 2D3AA 2JF5A 2LFIA 3VTWA 4ZRPA 3EFCA 1K52A 1M4VA 3FILB 2Y5PA 3ZUNA 2IO3B 2ASQA 3K9OB 2GOWA 2PIAA 3B2GA 1L5PA 2RD0A 2MJEA 4W9HA 1ZGUB 4RGMA 4WJQA 1WF9A 3ZTDA 2M56B 4AOFA 2WU2B 3TEYA 5E6PA 1WJ6A 2K0PA 2V9HA 3R3MA 3SEBA 4EZLA 2MP2A 1TS2A 1WXAA 2QEJC 2N7DA 3QARA 1HEZE 1JWAD 2L05A 2KJRA 4ZYNA 2XNAC 2BYTA 5BO4B 3QQ8B 2KWCA 4ITKA 2LJIA 3Q14C 2DWQA 2KC1A 2AYOB 2D5GA 4II3B 1JWBD 3QAQA 5E6JA 3V6EB 2FUG1 3MJWA 3VAWA 4KX6B 2JYTA 3RNCC 1N63A 2J52A 2MWSB 1F52A 2VZKB 4OVUA 1FD6A 3DBSA 1Q0WB 1VJKA 3DHHC 3W1SC 3GS2A 4W9KA 3T3OA 2M4NA 3AE1B 4CO7A 2DZJA 2ZEQA 4XWWA 4DHZE 1GOZA 1WGGA 4OHJA 2ZW1A 2K25A 5CX3A 1NENB 5C3JB 4GDKB 2HJ8A 3FAHA 2WWZA 1FXAA 3QA8A 3VRAB 4KIKA 1ET9A 2LASA 1WGDA 5G55A 1V81A 2OOBB 1FO4A 5JZEB 4KVGB 2N9LA 1C1YB 4IDIA 3L54A 4JQWC 2ZZPB 1SE2A 3H9DA 1L4ZB 2DYBA 4GDLA 4KSLC 1YN3A 3H7PA 1K51A 2KX0A 4OVVA 3ZJTA 2M19A 1JRPA 4P1BC 1QLBB 2CHXA 2D11A 2Y5CA 3RCZA 2FCSA 4XDDA 1TZOA 3DWGC 4XWTA 4USAA 1DYQA 3ONSA 4FJZA 4ANXA 2E3TA 1GC7A 3VUXA 1F2RC 4BOZB 1P3QU 1WY8A 1BMLC 3LDZE 1SXTA 4XGAB 4HWIB 4W9GA 3VDZA 4G3XB 1ISNA 4WURA 3VVWB 2KDFB 1WX9A 1I35A 3U4EG 3PHXB 2UYZB 4NJ6A 3RNGC 2ZPNA 3KH0A 2WXPA 5J18A 2ZJDA 3NZUA 2QMTA 2SEBD 3SFDB 1XCTL 4KKJA 1SBBB 1ZW7A 2L00B 4KGTA 2D3GA 2NTTA 4NZLB 1MG4A 1A5RA 4C4VB 2K8HA 4LNIA 2PPHA 2K6QA 3VXWA 4TKNA 3NVVA 2CJNA 3AU4A 3P42A 4BAXA 1L7YA 4JE3B 2FBWB 1P7EA 4ARIA 1SJED 1TJEA 1E5WA 3ECIA 5D6JB 2O2VA 4KGRA 4ASWC 1S3SG 4DXFA 4I6LB 4EOYA 2O2VB 2G45B 4A3PA 3PS6A 2WDVB 2DAJA 4OZBA 1SE4A 3PZ7A 4FHJA 2IO1B 4P6VF 4NNJB 4M8NA 2M17A 2DNFA 2MRPA 1OQRA 3EC8A 4CQNA 2L7RA 1ACCA 4H2AA 1OTRB 3ZNZB 4W9LA 1J8CA 4ZRIA 1L0VB 2IY0B 1JRUA 4NAWA 3IAM1 3NG0A 4KSKC 3TL5A 1HZ6A 2XEWA 1YJJA 4ARCA 2LJ5A 4M00A 1KLGD 1WI0A 2WHIA 1FXIA 1C4CA 3VUWA 2DLBA 1ZXHA 2BVCA 2PVOD 1P0RA 1C79A 4XC2A 4MSQB 2KO3A 2MJ3A 1R4MI 2KFKB 4PYZA 1NYQA 1A70A 3AEEB 2NPTB 2DZKA 3AEFB 1IGDA 2D3BA 2Z0EB 1YIWA 3LJ3A 3QHTA 3M95A 2WXNA 2V4LA 2KD0A 3S2AA 1UWXA 4XE0A 2C7HA 4CYEA 4RF0A 4KZCA 1ENFA 1N62A 4M0WA 2KTRA 1WGKA 3JSVA 1V8CA 3MC0B 2JT4B 2UU7A 1E8YA 2K8BA 1IBXA 4A3OA 3ZGZA 4NJ7A 4URKA 2QDFA 1RFKA 4N58A 3U8ZA 2W3SA 2ZNVB 3A9JA 2WXRA 1ROEA 2BT6A 4A90A 2N4FA 4NQKE 2NVUI 3OG5A 2LZ6A 2WQYB 3CSFA 2LI5A 4LK0M 2W3RA 2PLPA 1SF0A 3PRMB 1KF6B 2OEDA 3L17A 4N6EB 1L0YB 5BMGA 1JWMD 4OW0A 1UNSA 1TBEA 1ZP0B 2W55A 3GB1A 1LM8B 4DXGA 4HJKA 5J2RA 1NDDA 4FA6A 1Z2MA 3TMPB 5E6NA 2KHWB 3C8YA 3APDA 4BKTA 4DDGD 1J7CA 2KVZA 1PYWD 1T0YA 2ONQA 1VDVA 2WX1A 4KZ0A 4US9A 1I7HA 2FCNA 4IWQA 2C5LC 4XDCA 1GJZA 2WS3B 1J7AA 3NZSA 2BPSA 1XCQL 1ZXIA 4GMVA 3RUIB 2WDRB 1WGYA 1RWSA 1F0ZA 2X8XX 3UF8A 1NVID 2INCC 1XF5L 4M02A 1CQVA 2QIEB 1CZPA 2J53A 4G11A 1FRDA 1EWYC 4JL9A 4FBJB 1V5TA 1WSPA 2DYMA 2L0FA 2JWUA 1MJDA 4LNOA 1C4AA 1JMLA 3TJPA 3TEXA 1MFWA 1QOFA 2WNMA 4FULA 3AE5B 5HHDG 1V1PB 3AE8B 1DOIA 3ZNGC 3AE4B 3DVGX 4FXCA 4AS1A 2MEKA 2KLCA 2GB1A 4NQLB 2KMAA 5DPWA 2INPE 4ZRKA 4F7ZA 3NRZA 1YNTE 3Q8BA 4LLGM 1WGRA 2MLBA 3RNEC 2WXJA 2AQ1B 4TUUA 2HDEA 3VH3B 3AECB 2RMMA 4YSYB 2O6VA 2V3PA 2GI9A 2EKIA 4GN1A 1KRHA 4A6QA 4JWSC 1I4HA 4WQOB 4HDQA 1T5XD 1S1QB 1NI3A 1XEEA 2KJ6A 3KW5B 5L83A 2CU1A 1E10A 1WR6E 1YMHE 4R3DA 5LXIB 1RRBA 3RNBC 3WAOA 3GOEA 2K3UA 4MM3B 1E6EB 2VRRB 1LFDA 1V6EA 4PT5A 3BK1A 1N5WA 3U2SC 4AWJA 1RLFA 2BKRB 2D10A 3KWVA 3DBRI 2D3CA 3TBLD 1UD7A 1C4PA 1VZ8A 4HEA1 4HPMB 3AH7A 2N7EA 3IHPC 2A5UA 1HQRD 2DBYA 1T0QC 2QILA 2KN5A 3FILA 4I6NB 2NS5A 1FXTB 1IPGA 3VR9B 3X0WA 3OJ3A 4ZDVA 4A55A 3IT4B 1Y56A 4W9EA 4CHKA 2WXQA 5EE9A 4ACFA 1J19A 1WYWB 4AJWA 4YT0B 1NYRA 4HCPB 3GZNB 1GG3A 1QZEA 1STEA 4XX5A 4MJSA 3ZNHB 3P4PB 3DVNV 4DBGA 3HM6X 1WJNA 1PGXA 4EUTA 4MJSB 1JALA 4FHKA 3RD2A 3UQBA 5AUKA 3Q8EA 1XO3A 5IKCM 4MH8A 5TSSA 3SU8X 4F1SA 3DBHB 2AEHA 2LD9A 3PREA 5J17A 3KUZA 4BFRA 2IGHA 2N0SB 2AQ3B 1I4QA 2FIFA 1ZE3D 2J4XA 2Z8LA 4ZOHC 3VUYA 1VLBA 2V3NA 4FN2A 4C00A 3AXCA 5BMIA 3ZQ4A 3TUOA 4PK1A 3ML9A 3P1MA 2N9PC 3HVZA 3RZWC 2GBMA 1WFYA 3JYUA 2AWTA 1HTQA 2LXCA 1FFVA 3DHGC 1K8RB 3R66C 2KNBA 4C80A 3NJTA 4GDKA 4NAMA 2N1WA 3WALA 5HKHA 4AQ7A 3U52E 1V5OA 1YJIA 2A4ZA 2LGSA 2J0MA 3NVWA 4HKQA 2PE6B 2Q5WD 2C7MB 3AM9A 2V3SA 2C9WB 4B9KA 1WX7A 5FK9C 2KZRA 2JZ3B 1WMHB 5G5HA 1UGMA 1Q1OA 1QT9A 3MFGA 4IM2A 1ESFA 2PVGC 2JPHA 2IYDB 4GU2A 5BYSA 2KDEB 4ZRQA 2D2QA 1VR9A 1XD3B 3HIZA 4HRSA 2ZPYA 4NJCA 2JXTA 3PT2B 4HJGE 3AV8A 1WM2A 1PGBA 4WJNA 2CHZA 3AMZA 4K1RB 2LGIA 2FCMA 3GE3C 1M94A 4C7YA 2NBVB 2REXA 1TKEA 3AU5A 1SGHA 3Q8CA 4DDID 3IBEA 3ZO5B 4JX1C 1WJUA 2BB5A 3U30A 1RYJA 3PZDA 3AEAB 1YX5B 5EE1A 4ZYSA 4F8CB 2MBHA 2RPQA 1T3QA 3J9CA 3RZFA 1KTKA 4EZKA 1NI2A 2BW2A 2JZZA 3HHMA 1MG8A 4P1CC 1UELA 3IVFA 2NCNA 1DGJA 1OQQA 3RT3B 2WLBA 4BKSD 1FNWA 2YLMA 4W9FA 4K3BA 2HTME 2WXHA 4PS8A 4W9DA 2GMIC 4C4VA 3VTUA 2GBNA 2MHJA 1ZOYB 5AEKB 1ZUD2 3RNAC 2JYEA 4DHJB 1E7UA 3DVNU 2M1MA 2BS3B 2OJWA 4XZ4A 4ANVA 1YOVB 3PV1A 2KXJA 1PDXA 1F9JA 2BYFA 1R4NB 3ZJUA 1J0GA 2YEPB 1EUVB 2XN9C 4RMAA 2LHDA 4MDKE 3FKYA 2W82A 1JW9D 1Q10A 3I9V1 3W1SA 2IBIB 4WQMA 3I63C 4P16A 2KLGA 3NVYA 2ZCCA 1Q5WB 3HUIA 3L10B 1QOGA 4BOSC 3P4SB 5D2MB 2DX5B 2KAJA 2J0KA 3C19A 3ZYYX 3MC9A 2AL3A 3K9PB 1FNUA 1GUAB 3APCA 2RDHA 3L08A 3TIXA 1VCBA 1RAXA 2KYWA 2L1AA 3UINB 3ZKJC 3ZDTA 3P4QB 4L2YA 5D3DA 5AZGA 3NHEB 3AE2B 2LUEA 1YX6B 1WE6A 3IT6B 3P2BA 4RM9A 3B2FA 1I42A 1K50A 1TKGA 2IGDA 2MBEA 5BYQA 4MELA 3A1QB 2L0TA 5CHFA 3NVZA 4K7SA 4EKUA 3I57A 2KVRA 1PQSA 2K1FA 2WX0A 2KKCA 4JIOU 2KFKA 4DHZB 5LNK1 3DCGA 2NPTA 3CSTA 3PVLA 1F77A 3DVGY 2KK8A 5EE0A 1KFYB 1ZKHA 3DWMA 1I4RA 1I4GA 1J7BA 4FJYA 1D3ZA 1N61A 2MQJA 4MGKE 5JHAA 3V3XA 4WJPA 3QIJA 4MGIE 4EEWA 3H6NA 4GLSC 4KV2A 5HG2A 1XLPA 4K3CA 3EECA 3N9YC 4Q2JA 2H89B 3ML8A 2MBQA 2G9HD 2KQSA 2KMMA 1GB4A 4J3OD 2C60A 2V1YA 4GOCA 1UH6A 3HK0A 3L13A 1OGWA 1VRAB 2KX3A 3PSEB 3ZXRA 5DPSA 2WXLA 4S0RA 2BTEA 2G1EA 2E6XA 3IG3A 2R2OA 3B1LX 3T9LA 1AYFA 3WCQA 2LRWA 2ZW0A 1PUTA 1YD8U 2UWQA 1E8XA 3DBLB 2AL6A 2MSED 1UF0A 5AZFA 2KQ4X 2K9XA 4BZAA 4GSWA 2N7JA 5C1ZA 3AE9B 1TT5B 1V9JA 2RSUA 2LVQA 3BY4B 3PGEA 2DZIA 2J42A 2QSDA 3O13A 3QC8B 1N60A 1T0RC 2ZCBA 1H8CA 1YQ3B 1HTOA 2MH7A 2KACA 2ON8A 1SB3C 3L4PA 3IAS1 5FR6A 3AEGB 2PW9A 1TIFA 1EM7A 1SIJA 2Z0DB 4IC7B 3UGBB 1WRDB 1TYGB 2KFJA 4HK2A 1TZ1A 5GXGB 1JROA 1CK1A 1SE9A 1ZPSA 1E0ZA 2MW5A 1TS4A 2H88B 2WDTB 3AULA 1RM6C 5HI1A 4G50A 1XLQA 4JWUC 1WXMA 2K8CA 4W9CA 2PJHA 4DXAB 1C76A 1XXGA 5T8IA 2J0JA 2I1KA 1KLVA 1TGZB 3MHZA 4JGHB 1WRIA 1NEKB 1V1PA 2YVCA 2LRUA 4BKGA 4QAYA 4TMAB 2RGFA 2MCNB 2KWUB 1PFDA 1TY2A 2AQ2B 3OAWA 2DHZA 3ALBA 2KMCA 1N6ZA 1WGHA 2WU5B 3A33B 5L95C 2N9EB 2JU6X 1YQ4B 4GB9A 4W9JA 4PS3A 4I6PA 3WAPA 5LLIA 2BWFA 2L52A 5C2TB 1IP9A 4NY0A 4IOIE 4WAAA 4YSZB 4MGZE 1ET6A 4MT5A 3BIID 1GNUA 2JZPA 2V4IB 2XK5B 1SJHD 4TQ1A 4ZHOA 2JRIB 1BXTA 3GZNI 4RF1A 2K22A 2JWZA 3N1XC 3ZDMC 2WXKA 3B08A 4MM3A 4WWNA 1TKYA 2G4SA 1TY0A 4S17A 1FPYA 1V1OA 1P9DU 5CHVC 4C56C 4N9F4 1V80A 2NTSA 4EFOA 1FFUA 1SEBD 2KTFA 4YTNB 1DOYA 1WZ3A 3DBHI 1R7SA 3ZTCA 1D5XC 3HM3A 3W5VB 3WA0A 5CHWA 2BS2B 3RNFC 4DWFA 3UIOB 1Y8RC 1T6BX 3CWIA 4M01A 4AP4C 2K6DB 3Q8AA 3BVZA 3QWZB 4YSXB 3KYDD 2NMQA 1GC6A 3BWUD 4D2KA 3VFKA 4L1BA 3W1YA 1FMAD 3PLVA 4RH6A 4MGYE 3KLSX 1WM3A 5IAAC 1D5MC 2RDBC 2RDGA 2GLSA 4EE2A 4YL8A 1KJTA 1XT9B 1LGRA 2KT7A 3ZVVA 4LNKA 1P7FA 2OJRA 3O65B 2L83A 2VH2A 5D94A 1KLUD 3BK2A 4KDLB 3DOWA 5IOIA 3P4RB 1FM0D 4K7WA 3DQVA 5AUIA 3GP7A 4IW0A 3ZJVA 3M63B 2MBBB 1JCKB 2BBCA 1HA5A 2KJHB 3VR8B 5IP4D 2IO2B 2BKFA 3ENEA 2X38A 2TSSA 4HDOA 1MI0A 3L0WB 3AE7B 5IN7A 3BINA 5BMHA 1KM7A 1FIQA 2MP2B 1UZXB 1V49A 3BYTB 3H8HA 2WXGA 3DBRB 3FC4A 4HPPA 3SFEB 2ZVOA 1UBQA 1ZDVA 3UIPB 4WJOA 2CR5A 1WWTA 2BGFA 1XLNA 2IDYA 2AX5A 2ICIA 1AWDA 1LXDA 2QJLA 4EZJA 3NS8A 4WWMA 5HFYA 2FNJB 2KWDA 4L23A 5FR3A 3LYYA 4IKGA 4P7IA 3U7DA 4LNFA 4HVBA 3R7RA 1WMHA 2LUMA 3D32A 3SD5A 4NPNA 2CHWA 3N1ZC 3R2TA 4PS7A 3UI3A 5KHQA 3BVGA 2KWVB 2DENB 2IY1B 2FCQA 2NBWB 1EF1A 1E7VA 3QX1A 3QK0A 1JWUD 4KDIC 1L4DB 4LJPB 3NY5A 1UGJA 3ZIMA 1YJ1A 5H92C 2WXOA 4KIKB 1T0SC 2PE9A 3Q69A 3V60A 3MTNB 4II2B 3VTVA 3RPFC 3EGRA 2INNE 2QHOA 2V0GA 2BYVE 1WH3A 1TS5A 1QQRA 1P1AA 1E8ZA 2Z59B 2GBJA 3R2IA 2BS4B 1R4NI 4TQ0A 2JQRB 3N30A 1EF5A 4BBNF 4B6WA 3TEWA 4PYUA 1EWCA 1HXYD 3L16A 2Y5BB 4GDLB 1C78A 4JPSA 2N9KA 2M8SA 3H7PB 1I4XA 1IGCA 1D5ZC 3DDCB 3EUB2 4IWPA 5G2NA 3U7ZA 3JVZX 1DOXA 2K39A 2JX5A 2L3ZA 4YTMB 4WWOA 3B0AA 2W9NA 4E74A 2BWES 3B9JA 1NBFC 2MX2A 3VRBB 4FJVB 2B76B 1I4PA 4J6IA 2PKOA 3CIRB 1WX8A 2JSVX 2KANA 1MHXA 1EU3A 3BYYB 5D7GA 3ZRFA 1VZ7A 5EDSA 1SE3A 2BB6A 2KDBA 4LNNA 1UBIA 2WXIA 3A4RA 1WZ0A 1LO5D 3EFUA 3R7QA 2DZMA 3TEZA 1LQBA 2LGDA 2NR2A 1OFFA 3PZ8A 4M8MA 3PRPB 3QCAA 4K81A 5EE3A 2DAFA 4K7UA 3WAMA 2HJ1A 1VZ6A 3SDLC 5D3IB 3AN1A 3KYCD 2FE8A 3IXSA 1SIFA 1V86A 4MACA 5IO9A 3WANA 4G0NB 1KOTA 1MVKA 3T8MA 3GE8C 4MSMB 2BF8B 2R2QA 4KGSA 4X57B 4O1NA 2ZNVC 2G4DB 1E7PB 1QKZA 2INDC 4LDTD 2I2YA 3N3KB 4ICUA 2IPKD 4ZRJA 3VQIA 4BVUC 2LVPA 3PLUA 4LJOB 2WYQA 2MA9B 1FCLA 3Q6BA 2L76A 1N5XA 2LWPA 2ACZB 1GAQB 1F2RI 2HTHA 2LMCA 3LXFA 2HD5B 1TS3A 3DHIC 4DQOC 1IUEA 3Q3OC 4ANWA 1C77A 1E9MA 4DK5A 1HE8A 3ZLZA 2M0XA 2LXAA 2CU3A 1QOAA 4C7ZA 5JH5C 5AZHA 2JXXA 3SHQA 1V97A 2IO0B 2N1VA 2LEKA 1U4AA 1SSNA 4GXBA 5H8YE 3MJ5A 4OVZA 3RYTA 3I3TB 1L0XB 4MH0E 1YQBA 3NZ3A 2DYOA 2O6VD 1D4BA 2EKEC 3T3NA 3CMMB 1QF6A 3AE3B 3A1QA 4WH4A 2D07B 1IYFA 1CMXB 3Q3FA 2CS4A 3TSSA 3BVMA 5E6OA 1Z5SB 5DPTA 4IWOA 2HE7A 3IFWB 4GIVA 1ZDXA 4UDUC 3V62A 3MC8A 4NAWB 3AEBB 2LGYA 1B1ZA 4RFBA 3Q8FA 5I4DA 2RR9A 3DBLI 1FCCC 1MPEA 2KN4A 1YN5A 2PTLA 2I1JA 3PRZA 2I38A 1EU4A 3AI5A 3AB5A 3ZXVA 1JQ4A 1OEYA 3URYA 1F1HA 2BQQA 2MBOA 3PPAA 4WIPA 4RNAA 2K5PA 4IM3A 3H7SA 4LTUA 4MEMA 4BBNC 1WXVA 4HXDA 3ABVB 1X1MA 3PHWB 2KOXA 1WE7A 4A8XC 3HVDA 3KQ4A 3A4SC 4GGQA 1WIAA 1OEYJ 2QC8A 1TTNA 4RGOS 3KWLA 1FNVA 4M0WB 2KQ7A 3APFA 1D6EC 2KTRB 3RMKC 3UQAA 3DPDA 4AJYB 3C0RB 4B0EA 3JSVB 2GBKA 2XBBC 2G3QB 4ANUA 4HPLB 4A9AA 2ZVNA 4LCDE 3W5UB 3KUCB 1IBXB 2JRHA 5DPRA 2EMSA 2JY6A 4HKZE 3V05A 2B3AA 4IG7B 3RFZB 1XQQA 3A9JB 3X23A 2R61A 4E71A 1XLOA 3H1UA 3ZW3A 1C9FA 3ZRCA 2VZKD 3EA6A 4TSSA 3TCAA 1AN8A 1WYGA 2WXMA 1YN4A 4N59A 2OHFA 3W2DA 1R4MB 1WXQA 5MPOA 3Q2AC 2LVOA 2QCZA 3NOBA 1V2YA 4JLCA 5C23A 3LB8C 3MHSD 3V6CB 3Q3MC 4W9IA 2J7QB 5TR5A 3N1YC 2EMTA 2PMVA 3HRDD 3OWEB 2M0AA 4RM8A 1WR1A 4YTPB 4A20A 2JUOA 4US8A 2W54A 2MJDA 2BYEA 1RFAA 3PO0A 2KC2A 2Y3AA 4WWPA 4BKSA 1GB1A 2FUHB 1EO6A 1L6VA 3VHTC 3NS1A 5IA7A 2PEAA 2EELA 4E3CA 3Q3NC 2N9XA 1AW7A 2LHEA 4RCOA 1H4RA 4HCNB 4RGTA 5G5GA 3Q3JA 2YEPF 2CJOA 1JWSD 4AUQC 4YXDB 4ZHPA 1WJ4A 2IJ0A 3PTFC 4ICVA 1KH0A 2C7NB 2NBUA 1HZ5A 3E56A 4IUMB 4REZA 1C3TA 2FAZA 2SAKA 2IZVB 3ZNID 5JHBA 3KVFB 4OZCA 2WXFA 4IM0A 1L6UA 4HROA 4LDTB 2WP9B 1E8WA 3VH4B 1UUPA 3V61A 2XK5A 4RGNA 2WGSA 1FEHA 2CKHB 1BT0A 4HLEA 3WIMA 3SR6A 5JXVA 3RN9C 1P98A 3BZDB 3CF6E 1VD2A 4FLHA 3RULA 4TV3A 1QILA 1GPXA 1QOBA 3M62B 3KUDB 3RI7C 5BYRA 1L2NA 4XYCA 2GBRA 3M3JA 3NUHB 1G6JA 1K53A 4DHJD 3ETRA 3A9KA 3OJ4B 3AE6B 2FIDA 2IGGA 4B0MA 3JW0X 5DCNA 3P63A 3A9KB 1PGAA 1UWMA 1OQYA 2O6VB 2VH1A 2L32A 4B95A 3N32A 2GRIA 2RPVA 3QJZA 2L8JA 1E90A 5KHOA 2KDMA 4FADA 2WDQB 4YWGG 5LXHA 1AARA 1CJEA 1B9RA 1WXSA 3MP9A 4OZAA 3W9CB 3OLMD 2LGXA 5GMVA 3AEDB 5CTRC 3EHVA 4WAFA 3I5JC 5FKAC 3E9SA 2KDIA 3N20C
chains in the Genus database with same CATH topology
2RDBC 3Q3NC 1T0QC 1T0SC 4P1BC 3RN9C 3Q14C 3N1ZC 1T0RC 3Q2AC 3DHGC 3GE8C 3DHIC 2INCC 3RI7C 3N1XC 3GE3C 3Q3OC 3I63C 4P1CC 3RNAC 3RNCC 3RNFC 3RMKC 3Q3MC 3I5JC 2INDC 3RNBC 3RNEC 3N1YC 3DHHC 3N20C 3RNGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RDB C;  3Q3N C;  1T0Q C;  1T0S C;  4P1B C;  3RN9 C;  3Q14 C;  3N1Z C;  1T0R C;  3Q2A C;  3DHG C;  3GE8 C;  3DHI C;  2INC C;  3RI7 C;  3N1X C;  3GE3 C;  3Q3O C;  3I63 C;  4P1C C;  3RNA C;  3RNC C;  3RNF C;  3RMK C;  3Q3M C;  3I5J C;  2IND C;  3RNB C;  3RNE C;  3N1Y C;  3DHH C;  3N20 C;  3RNG C; 
#chains in the Genus database with same CATH topology
 1FRR A;  1BUI C;  1MHH E;  3R8B A;  4KKI A;  2JVC A;  2D3A A;  2JF5 A;  2LFI A;  3VTW A;  4ZRP A;  3EFC A;  1K52 A;  1M4V A;  3FIL B;  2Y5P A;  3ZUN A;  2IO3 B;  2ASQ A;  3K9O B;  2GOW A;  2PIA A;  3B2G A;  1L5P A;  2RD0 A;  2MJE A;  4W9H A;  1ZGU B;  4RGM A;  4WJQ A;  1WF9 A;  3ZTD A;  2M56 B;  4AOF A;  2WU2 B;  3TEY A;  5E6P A;  1WJ6 A;  2K0P A;  2V9H A;  3R3M A;  3SEB A;  4EZL A;  2MP2 A;  1TS2 A;  1WXA A;  2QEJ C;  2N7D A;  3QAR A;  1HEZ E;  1JWA D;  2L05 A;  2KJR A;  4ZYN A;  2XNA C;  2BYT A;  5BO4 B;  3QQ8 B;  2KWC A;  4ITK A;  2LJI A;  3Q14 C;  2DWQ A;  2KC1 A;  2AYO B;  2D5G A;  4II3 B;  1JWB D;  3QAQ A;  5E6J A;  3V6E B;  2FUG 1;  3MJW A;  3VAW A;  4KX6 B;  2JYT A;  3RNC C;  1N63 A;  2J52 A;  2MWS B;  1F52 A;  2VZK B;  4OVU A;  1FD6 A;  3DBS A;  1Q0W B;  1VJK A;  3DHH C;  3W1S C;  3GS2 A;  4W9K A;  3T3O A;  2M4N A;  3AE1 B;  4CO7 A;  2DZJ A;  2ZEQ A;  4XWW A;  4DHZ E;  1GOZ A;  1WGG A;  4OHJ A;  2ZW1 A;  2K25 A;  5CX3 A;  1NEN B;  5C3J B;  4GDK B;  2HJ8 A;  3FAH A;  2WWZ A;  1FXA A;  3QA8 A;  3VRA B;  4KIK A;  1ET9 A;  2LAS A;  1WGD A;  5G55 A;  1V81 A;  2OOB B;  1FO4 A;  5JZE B;  4KVG B;  2N9L A;  1C1Y B;  4IDI A;  3L54 A;  4JQW C;  2ZZP B;  1SE2 A;  3H9D A;  1L4Z B;  2DYB A;  4GDL A;  4KSL C;  1YN3 A;  3H7P A;  1K51 A;  2KX0 A;  4OVV A;  3ZJT A;  2M19 A;  1JRP A;  4P1B C;  1QLB B;  2CHX A;  2D11 A;  2Y5C A;  3RCZ A;  2FCS A;  4XDD A;  1TZO A;  3DWG C;  4XWT A;  4USA A;  1DYQ A;  3ONS A;  4FJZ A;  4ANX A;  2E3T A;  1GC7 A;  3VUX A;  1F2R C;  4BOZ B;  1P3Q U;  1WY8 A;  1BML C;  3LDZ E;  1SXT A;  4XGA B;  4HWI B;  4W9G A;  3VDZ A;  4G3X B;  1ISN A;  4WUR A;  3VVW B;  2KDF B;  1WX9 A;  1I35 A;  3U4E G;  3PHX B;  2UYZ B;  4NJ6 A;  3RNG C;  2ZPN A;  3KH0 A;  2WXP A;  5J18 A;  2ZJD A;  3NZU A;  2QMT A;  2SEB D;  3SFD B;  1XCT L;  4KKJ A;  1SBB B;  1ZW7 A;  2L00 B;  4KGT A;  2D3G A;  2NTT A;  4NZL B;  1MG4 A;  1A5R A;  4C4V B;  2K8H A;  4LNI A;  2PPH A;  2K6Q A;  3VXW A;  4TKN A;  3NVV A;  2CJN A;  3AU4 A;  3P42 A;  4BAX A;  1L7Y A;  4JE3 B;  2FBW B;  1P7E A;  4ARI A;  1SJE D;  1TJE A;  1E5W A;  3ECI A;  5D6J B;  2O2V A;  4KGR A;  4ASW C;  1S3S G;  4DXF A;  4I6L B;  4EOY A;  2O2V B;  2G45 B;  4A3P A;  3PS6 A;  2WDV B;  2DAJ A;  4OZB A;  1SE4 A;  3PZ7 A;  4FHJ A;  2IO1 B;  4P6V F;  4NNJ B;  4M8N A;  2M17 A;  2DNF A;  2MRP A;  1OQR A;  3EC8 A;  4CQN A;  2L7R A;  1ACC A;  4H2A A;  1OTR B;  3ZNZ B;  4W9L A;  1J8C A;  4ZRI A;  1L0V B;  2IY0 B;  1JRU A;  4NAW A;  3IAM 1;  3NG0 A;  4KSK C;  3TL5 A;  1HZ6 A;  2XEW A;  1YJJ A;  4ARC A;  2LJ5 A;  4M00 A;  1KLG D;  1WI0 A;  2WHI A;  1FXI A;  1C4C A;  3VUW A;  2DLB A;  1ZXH A;  2BVC A;  2PVO D;  1P0R A;  1C79 A;  4XC2 A;  4MSQ B;  2KO3 A;  2MJ3 A;  1R4M I;  2KFK B;  4PYZ A;  1NYQ A;  1A70 A;  3AEE B;  2NPT B;  2DZK A;  3AEF B;  1IGD A;  2D3B A;  2Z0E B;  1YIW A;  3LJ3 A;  3QHT A;  3M95 A;  2WXN A;  2V4L A;  2KD0 A;  3S2A A;  1UWX A;  4XE0 A;  2C7H A;  4CYE A;  4RF0 A;  4KZC A;  1ENF A;  1N62 A;  4M0W A;  2KTR A;  1WGK A;  3JSV A;  1V8C A;  3MC0 B;  2JT4 B;  2UU7 A;  1E8Y A;  2K8B A;  1IBX A;  4A3O A;  3ZGZ A;  4NJ7 A;  4URK A;  2QDF A;  1RFK A;  4N58 A;  3U8Z A;  2W3S A;  2ZNV B;  3A9J A;  2WXR A;  1ROE A;  2BT6 A;  4A90 A;  2N4F A;  4NQK E;  2NVU I;  3OG5 A;  2LZ6 A;  2WQY B;  3CSF A;  2LI5 A;  4LK0 M;  2W3R A;  2PLP A;  1SF0 A;  3PRM B;  1KF6 B;  2OED A;  3L17 A;  4N6E B;  1L0Y B;  5BMG A;  1JWM D;  4OW0 A;  1UNS A;  1TBE A;  1ZP0 B;  2W55 A;  3GB1 A;  1LM8 B;  4DXG A;  4HJK A;  5J2R A;  1NDD A;  4FA6 A;  1Z2M A;  3TMP B;  5E6N A;  2KHW B;  3C8Y A;  3APD A;  4BKT A;  4DDG D;  1J7C A;  2KVZ A;  1PYW D;  1T0Y A;  2ONQ A;  1VDV A;  2WX1 A;  4KZ0 A;  4US9 A;  1I7H A;  2FCN A;  4IWQ A;  2C5L C;  4XDC A;  1GJZ A;  2WS3 B;  1J7A A;  3NZS A;  2BPS A;  1XCQ L;  1ZXI A;  4GMV A;  3RUI B;  2WDR B;  1WGY A;  1RWS A;  1F0Z A;  2X8X X;  3UF8 A;  1NVI D;  2INC C;  1XF5 L;  4M02 A;  1CQV A;  2QIE B;  1CZP A;  2J53 A;  4G11 A;  1FRD A;  1EWY C;  4JL9 A;  4FBJ B;  1V5T A;  1WSP A;  2DYM A;  2L0F A;  2JWU A;  1MJD A;  4LNO A;  1C4A A;  1JML A;  3TJP A;  3TEX A;  1MFW A;  1QOF A;  2WNM A;  4FUL A;  3AE5 B;  5HHD G;  1V1P B;  3AE8 B;  1DOI A;  3ZNG C;  3AE4 B;  3DVG X;  4FXC A;  4AS1 A;  2MEK A;  2KLC A;  2GB1 A;  4NQL B;  2KMA A;  5DPW A;  2INP E;  4ZRK A;  4F7Z A;  3NRZ A;  1YNT E;  3Q8B A;  4LLG M;  1WGR A;  2MLB A;  3RNE C;  2WXJ A;  2AQ1 B;  4TUU A;  2HDE A;  3VH3 B;  3AEC B;  2RMM A;  4YSY B;  2O6V A;  2V3P A;  2GI9 A;  2EKI A;  4GN1 A;  1KRH A;  4A6Q A;  4JWS C;  1I4H A;  4WQO B;  4HDQ A;  1T5X D;  1S1Q B;  1NI3 A;  1XEE A;  2KJ6 A;  3KW5 B;  5L83 A;  2CU1 A;  1E10 A;  1WR6 E;  1YMH E;  4R3D A;  5LXI B;  1RRB A;  3RNB C;  3WAO A;  3GOE A;  2K3U A;  4MM3 B;  1E6E B;  2VRR B;  1LFD A;  1V6E A;  4PT5 A;  3BK1 A;  1N5W A;  3U2S C;  4AWJ A;  1RLF A;  2BKR B;  2D10 A;  3KWV A;  3DBR I;  2D3C A;  3TBL D;  1UD7 A;  1C4P A;  1VZ8 A;  4HEA 1;  4HPM B;  3AH7 A;  2N7E A;  3IHP C;  2A5U A;  1HQR D;  2DBY A;  1T0Q C;  2QIL A;  2KN5 A;  3FIL A;  4I6N B;  2NS5 A;  1FXT B;  1IPG A;  3VR9 B;  3X0W A;  3OJ3 A;  4ZDV A;  4A55 A;  3IT4 B;  1Y56 A;  4W9E A;  4CHK A;  2WXQ A;  5EE9 A;  4ACF A;  1J19 A;  1WYW B;  4AJW A;  4YT0 B;  1NYR A;  4HCP B;  3GZN B;  1GG3 A;  1QZE A;  1STE A;  4XX5 A;  4MJS A;  3ZNH B;  3P4P B;  3DVN V;  4DBG A;  3HM6 X;  1WJN A;  1PGX A;  4EUT A;  4MJS B;  1JAL A;  4FHK A;  3RD2 A;  3UQB A;  5AUK A;  3Q8E A;  1XO3 A;  5IKC M;  4MH8 A;  5TSS A;  3SU8 X;  4F1S A;  3DBH B;  2AEH A;  2LD9 A;  3PRE A;  5J17 A;  3KUZ A;  4BFR A;  2IGH A;  2N0S B;  2AQ3 B;  1I4Q A;  2FIF A;  1ZE3 D;  2J4X A;  2Z8L A;  4ZOH C;  3VUY A;  1VLB A;  2V3N A;  4FN2 A;  4C00 A;  3AXC A;  5BMI A;  3ZQ4 A;  3TUO A;  4PK1 A;  3ML9 A;  3P1M A;  2N9P C;  3HVZ A;  3RZW C;  2GBM A;  1WFY A;  3JYU A;  2AWT A;  1HTQ A;  2LXC A;  1FFV A;  3DHG C;  1K8R B;  3R66 C;  2KNB A;  4C80 A;  3NJT A;  4GDK A;  4NAM A;  2N1W A;  3WAL A;  5HKH A;  4AQ7 A;  3U52 E;  1V5O A;  1YJI A;  2A4Z A;  2LGS A;  2J0M A;  3NVW A;  4HKQ A;  2PE6 B;  2Q5W D;  2C7M B;  3AM9 A;  2V3S A;  2C9W B;  4B9K A;  1WX7 A;  5FK9 C;  2KZR A;  2JZ3 B;  1WMH B;  5G5H A;  1UGM A;  1Q1O A;  1QT9 A;  3MFG A;  4IM2 A;  1ESF A;  2PVG C;  2JPH A;  2IYD B;  4GU2 A;  5BYS A;  2KDE B;  4ZRQ A;  2D2Q A;  1VR9 A;  1XD3 B;  3HIZ A;  4HRS A;  2ZPY A;  4NJC A;  2JXT A;  3PT2 B;  4HJG E;  3AV8 A;  1WM2 A;  1PGB A;  4WJN A;  2CHZ A;  3AMZ A;  4K1R B;  2LGI A;  2FCM A;  3GE3 C;  1M94 A;  4C7Y A;  2NBV B;  2REX A;  1TKE A;  3AU5 A;  1SGH A;  3Q8C A;  4DDI D;  3IBE A;  3ZO5 B;  4JX1 C;  1WJU A;  2BB5 A;  3U30 A;  1RYJ A;  3PZD A;  3AEA B;  1YX5 B;  5EE1 A;  4ZYS A;  4F8C B;  2MBH A;  2RPQ A;  1T3Q A;  3J9C A;  3RZF A;  1KTK A;  4EZK A;  1NI2 A;  2BW2 A;  2JZZ A;  3HHM A;  1MG8 A;  4P1C C;  1UEL A;  3IVF A;  2NCN A;  1DGJ A;  1OQQ A;  3RT3 B;  2WLB A;  4BKS D;  1FNW A;  2YLM A;  4W9F A;  4K3B A;  2HTM E;  2WXH A;  4PS8 A;  4W9D A;  2GMI C;  4C4V A;  3VTU A;  2GBN A;  2MHJ A;  1ZOY B;  5AEK B;  1ZUD 2;  3RNA C;  2JYE A;  4DHJ B;  1E7U A;  3DVN U;  2M1M A;  2BS3 B;  2OJW A;  4XZ4 A;  4ANV A;  1YOV B;  3PV1 A;  2KXJ A;  1PDX A;  1F9J A;  2BYF A;  1R4N B;  3ZJU A;  1J0G A;  2YEP B;  1EUV B;  2XN9 C;  4RMA A;  2LHD A;  4MDK E;  3FKY A;  2W82 A;  1JW9 D;  1Q10 A;  3I9V 1;  3W1S A;  2IBI B;  4WQM A;  3I63 C;  4P16 A;  2KLG A;  3NVY A;  2ZCC A;  1Q5W B;  3HUI A;  3L10 B;  1QOG A;  4BOS C;  3P4S B;  5D2M B;  2DX5 B;  2KAJ A;  2J0K A;  3C19 A;  3ZYY X;  3MC9 A;  2AL3 A;  3K9P B;  1FNU A;  1GUA B;  3APC A;  2RDH A;  3L08 A;  3TIX A;  1VCB A;  1RAX A;  2KYW A;  2L1A A;  3UIN B;  3ZKJ C;  3ZDT A;  3P4Q B;  4L2Y A;  5D3D A;  5AZG A;  3NHE B;  3AE2 B;  2LUE A;  1YX6 B;  1WE6 A;  3IT6 B;  3P2B A;  4RM9 A;  3B2F A;  1I42 A;  1K50 A;  1TKG A;  2IGD A;  2MBE A;  5BYQ A;  4MEL A;  3A1Q B;  2L0T A;  5CHF A;  3NVZ A;  4K7S A;  4EKU A;  3I57 A;  2KVR A;  1PQS A;  2K1F A;  2WX0 A;  2KKC A;  4JIO U;  2KFK A;  4DHZ B;  5LNK 1;  3DCG A;  2NPT A;  3CST A;  3PVL A;  1F77 A;  3DVG Y;  2KK8 A;  5EE0 A;  1KFY B;  1ZKH A;  3DWM A;  1I4R A;  1I4G A;  1J7B A;  4FJY A;  1D3Z A;  1N61 A;  2MQJ A;  4MGK E;  5JHA A;  3V3X A;  4WJP A;  3QIJ A;  4MGI E;  4EEW A;  3H6N A;  4GLS C;  4KV2 A;  5HG2 A;  1XLP A;  4K3C A;  3EEC A;  3N9Y C;  4Q2J A;  2H89 B;  3ML8 A;  2MBQ A;  2G9H D;  2KQS A;  2KMM A;  1GB4 A;  4J3O D;  2C60 A;  2V1Y A;  4GOC A;  1UH6 A;  3HK0 A;  3L13 A;  1OGW A;  1VRA B;  2KX3 A;  3PSE B;  3ZXR A;  5DPS A;  2WXL A;  4S0R A;  2BTE A;  2G1E A;  2E6X A;  3IG3 A;  2R2O A;  3B1L X;  3T9L A;  1AYF A;  3WCQ A;  2LRW A;  2ZW0 A;  1PUT A;  1YD8 U;  2UWQ A;  1E8X A;  3DBL B;  2AL6 A;  2MSE D;  1UF0 A;  5AZF A;  2KQ4 X;  2K9X A;  4BZA A;  4GSW A;  2N7J A;  5C1Z A;  3AE9 B;  1TT5 B;  1V9J A;  2RSU A;  2LVQ A;  3BY4 B;  3PGE A;  2DZI A;  2J42 A;  2QSD A;  3O13 A;  3QC8 B;  1N60 A;  1T0R C;  2ZCB A;  1H8C A;  1YQ3 B;  1HTO A;  2MH7 A;  2KAC A;  2ON8 A;  1SB3 C;  3L4P A;  3IAS 1;  5FR6 A;  3AEG B;  2PW9 A;  1TIF A;  1EM7 A;  1SIJ A;  2Z0D B;  4IC7 B;  3UGB B;  1WRD B;  1TYG B;  2KFJ A;  4HK2 A;  1TZ1 A;  5GXG B;  1JRO A;  1CK1 A;  1SE9 A;  1ZPS A;  1E0Z A;  2MW5 A;  1TS4 A;  2H88 B;  2WDT B;  3AUL A;  1RM6 C;  5HI1 A;  4G50 A;  1XLQ A;  4JWU C;  1WXM A;  2K8C A;  4W9C A;  2PJH A;  4DXA B;  1C76 A;  1XXG A;  5T8I A;  2J0J A;  2I1K A;  1KLV A;  1TGZ B;  3MHZ A;  4JGH B;  1WRI A;  1NEK B;  1V1P A;  2YVC A;  2LRU A;  4BKG A;  4QAY A;  4TMA B;  2RGF A;  2MCN B;  2KWU B;  1PFD A;  1TY2 A;  2AQ2 B;  3OAW A;  2DHZ A;  3ALB A;  2KMC A;  1N6Z A;  1WGH A;  2WU5 B;  3A33 B;  5L95 C;  2N9E B;  2JU6 X;  1YQ4 B;  4GB9 A;  4W9J A;  4PS3 A;  4I6P A;  3WAP A;  5LLI A;  2BWF A;  2L52 A;  5C2T B;  1IP9 A;  4NY0 A;  4IOI E;  4WAA A;  4YSZ B;  4MGZ E;  1ET6 A;  4MT5 A;  3BII D;  1GNU A;  2JZP A;  2V4I B;  2XK5 B;  1SJH D;  4TQ1 A;  4ZHO A;  2JRI B;  1BXT A;  3GZN I;  4RF1 A;  2K22 A;  2JWZ A;  3N1X C;  3ZDM C;  2WXK A;  3B08 A;  4MM3 A;  4WWN A;  1TKY A;  2G4S A;  1TY0 A;  4S17 A;  1FPY A;  1V1O A;  1P9D U;  5CHV C;  4C56 C;  4N9F 4;  1V80 A;  2NTS A;  4EFO A;  1FFU A;  1SEB D;  2KTF A;  4YTN B;  1DOY A;  1WZ3 A;  3DBH I;  1R7S A;  3ZTC A;  1D5X C;  3HM3 A;  3W5V B;  3WA0 A;  5CHW A;  2BS2 B;  3RNF C;  4DWF A;  3UIO B;  1Y8R C;  1T6B X;  3CWI A;  4M01 A;  4AP4 C;  2K6D B;  3Q8A A;  3BVZ A;  3QWZ B;  4YSX B;  3KYD D;  2NMQ A;  1GC6 A;  3BWU D;  4D2K A;  3VFK A;  4L1B A;  3W1Y A;  1FMA D;  3PLV A;  4RH6 A;  4MGY E;  3KLS X;  1WM3 A;  5IAA C;  1D5M C;  2RDB C;  2RDG A;  2GLS A;  4EE2 A;  4YL8 A;  1KJT A;  1XT9 B;  1LGR A;  2KT7 A;  3ZVV A;  4LNK A;  1P7F A;  2OJR A;  3O65 B;  2L83 A;  2VH2 A;  5D94 A;  1KLU D;  3BK2 A;  4KDL B;  3DOW A;  5IOI A;  3P4R B;  1FM0 D;  4K7W A;  3DQV A;  5AUI A;  3GP7 A;  4IW0 A;  3ZJV A;  3M63 B;  2MBB B;  1JCK B;  2BBC A;  1HA5 A;  2KJH B;  3VR8 B;  5IP4 D;  2IO2 B;  2BKF A;  3ENE A;  2X38 A;  2TSS A;  4HDO A;  1MI0 A;  3L0W B;  3AE7 B;  5IN7 A;  3BIN A;  5BMH A;  1KM7 A;  1FIQ A;  2MP2 B;  1UZX B;  1V49 A;  3BYT B;  3H8H A;  2WXG A;  3DBR B;  3FC4 A;  4HPP A;  3SFE B;  2ZVO A;  1UBQ A;  1ZDV A;  3UIP B;  4WJO A;  2CR5 A;  1WWT A;  2BGF A;  1XLN A;  2IDY A;  2AX5 A;  2ICI A;  1AWD A;  1LXD A;  2QJL A;  4EZJ A;  3NS8 A;  4WWM A;  5HFY A;  2FNJ B;  2KWD A;  4L23 A;  5FR3 A;  3LYY A;  4IKG A;  4P7I A;  3U7D A;  4LNF A;  4HVB A;  3R7R A;  1WMH A;  2LUM A;  3D32 A;  3SD5 A;  4NPN A;  2CHW A;  3N1Z C;  3R2T A;  4PS7 A;  3UI3 A;  5KHQ A;  3BVG A;  2KWV B;  2DEN B;  2IY1 B;  2FCQ A;  2NBW B;  1EF1 A;  1E7V A;  3QX1 A;  3QK0 A;  1JWU D;  4KDI C;  1L4D B;  4LJP B;  3NY5 A;  1UGJ A;  3ZIM A;  1YJ1 A;  5H92 C;  2WXO A;  4KIK B;  1T0S C;  2PE9 A;  3Q69 A;  3V60 A;  3MTN B;  4II2 B;  3VTV A;  3RPF C;  3EGR A;  2INN E;  2QHO A;  2V0G A;  2BYV E;  1WH3 A;  1TS5 A;  1QQR A;  1P1A A;  1E8Z A;  2Z59 B;  2GBJ A;  3R2I A;  2BS4 B;  1R4N I;  4TQ0 A;  2JQR B;  3N30 A;  1EF5 A;  4BBN F;  4B6W A;  3TEW A;  4PYU A;  1EWC A;  1HXY D;  3L16 A;  2Y5B B;  4GDL B;  1C78 A;  4JPS A;  2N9K A;  2M8S A;  3H7P B;  1I4X A;  1IGC A;  1D5Z C;  3DDC B;  3EUB 2;  4IWP A;  5G2N A;  3U7Z A;  3JVZ X;  1DOX A;  2K39 A;  2JX5 A;  2L3Z A;  4YTM B;  4WWO A;  3B0A A;  2W9N A;  4E74 A;  2BWE S;  3B9J A;  1NBF C;  2MX2 A;  3VRB B;  4FJV B;  2B76 B;  1I4P A;  4J6I A;  2PKO A;  3CIR B;  1WX8 A;  2JSV X;  2KAN A;  1MHX A;  1EU3 A;  3BYY B;  5D7G A;  3ZRF A;  1VZ7 A;  5EDS A;  1SE3 A;  2BB6 A;  2KDB A;  4LNN A;  1UBI A;  2WXI A;  3A4R A;  1WZ0 A;  1LO5 D;  3EFU A;  3R7Q A;  2DZM A;  3TEZ A;  1LQB A;  2LGD A;  2NR2 A;  1OFF A;  3PZ8 A;  4M8M A;  3PRP B;  3QCA A;  4K81 A;  5EE3 A;  2DAF A;  4K7U A;  3WAM A;  2HJ1 A;  1VZ6 A;  3SDL C;  5D3I B;  3AN1 A;  3KYC D;  2FE8 A;  3IXS A;  1SIF A;  1V86 A;  4MAC A;  5IO9 A;  3WAN A;  4G0N B;  1KOT A;  1MVK A;  3T8M A;  3GE8 C;  4MSM B;  2BF8 B;  2R2Q A;  4KGS A;  4X57 B;  4O1N A;  2ZNV C;  2G4D B;  1E7P B;  1QKZ A;  2IND C;  4LDT D;  2I2Y A;  3N3K B;  4ICU A;  2IPK D;  4ZRJ A;  3VQI A;  4BVU C;  2LVP A;  3PLU A;  4LJO B;  2WYQ A;  2MA9 B;  1FCL A;  3Q6B A;  2L76 A;  1N5X A;  2LWP A;  2ACZ B;  1GAQ B;  1F2R I;  2HTH A;  2LMC A;  3LXF A;  2HD5 B;  1TS3 A;  3DHI C;  4DQO C;  1IUE A;  3Q3O C;  4ANW A;  1C77 A;  1E9M A;  4DK5 A;  1HE8 A;  3ZLZ A;  2M0X A;  2LXA A;  2CU3 A;  1QOA A;  4C7Z A;  5JH5 C;  5AZH A;  2JXX A;  3SHQ A;  1V97 A;  2IO0 B;  2N1V A;  2LEK A;  1U4A A;  1SSN A;  4GXB A;  5H8Y E;  3MJ5 A;  4OVZ A;  3RYT A;  3I3T B;  1L0X B;  4MH0 E;  1YQB A;  3NZ3 A;  2DYO A;  2O6V D;  1D4B A;  2EKE C;  3T3N A;  3CMM B;  1QF6 A;  3AE3 B;  3A1Q A;  4WH4 A;  2D07 B;  1IYF A;  1CMX B;  3Q3F A;  2CS4 A;  3TSS A;  3BVM A;  5E6O A;  1Z5S B;  5DPT A;  4IWO A;  2HE7 A;  3IFW B;  4GIV A;  1ZDX A;  4UDU C;  3V62 A;  3MC8 A;  4NAW B;  3AEB B;  2LGY A;  1B1Z A;  4RFB A;  3Q8F A;  5I4D A;  2RR9 A;  3DBL I;  1FCC C;  1MPE A;  2KN4 A;  1YN5 A;  2PTL A;  2I1J A;  3PRZ A;  2I38 A;  1EU4 A;  3AI5 A;  3AB5 A;  3ZXV A;  1JQ4 A;  1OEY A;  3URY A;  1F1H A;  2BQQ A;  2MBO A;  3PPA A;  4WIP A;  4RNA A;  2K5P A;  4IM3 A;  3H7S A;  4LTU A;  4MEM A;  4BBN C;  1WXV A;  4HXD A;  3ABV B;  1X1M A;  3PHW B;  2KOX A;  1WE7 A;  4A8X C;  3HVD A;  3KQ4 A;  3A4S C;  4GGQ A;  1WIA A;  1OEY J;  2QC8 A;  1TTN A;  4RGO S;  3KWL A;  1FNV A;  4M0W B;  2KQ7 A;  3APF A;  1D6E C;  2KTR B;  3RMK C;  3UQA A;  3DPD A;  4AJY B;  3C0R B;  4B0E A;  3JSV B;  2GBK A;  2XBB C;  2G3Q B;  4ANU A;  4HPL B;  4A9A A;  2ZVN A;  4LCD E;  3W5U B;  3KUC B;  1IBX B;  2JRH A;  5DPR A;  2EMS A;  2JY6 A;  4HKZ E;  3V05 A;  2B3A A;  4IG7 B;  3RFZ B;  1XQQ A;  3A9J B;  3X23 A;  2R61 A;  4E71 A;  1XLO A;  3H1U A;  3ZW3 A;  1C9F A;  3ZRC A;  2VZK D;  3EA6 A;  4TSS A;  3TCA A;  1AN8 A;  1WYG A;  2WXM A;  1YN4 A;  4N59 A;  2OHF A;  3W2D A;  1R4M B;  1WXQ A;  5MPO A;  3Q2A C;  2LVO A;  2QCZ A;  3NOB A;  1V2Y A;  4JLC A;  5C23 A;  3LB8 C;  3MHS D;  3V6C B;  3Q3M C;  4W9I A;  2J7Q B;  5TR5 A;  3N1Y C;  2EMT A;  2PMV A;  3HRD D;  3OWE B;  2M0A A;  4RM8 A;  1WR1 A;  4YTP B;  4A20 A;  2JUO A;  4US8 A;  2W54 A;  2MJD A;  2BYE A;  1RFA A;  3PO0 A;  2KC2 A;  2Y3A A;  4WWP A;  4BKS A;  1GB1 A;  2FUH B;  1EO6 A;  1L6V A;  3VHT C;  3NS1 A;  5IA7 A;  2PEA A;  2EEL A;  4E3C A;  3Q3N C;  2N9X A;  1AW7 A;  2LHE A;  4RCO A;  1H4R A;  4HCN B;  4RGT A;  5G5G A;  3Q3J A;  2YEP F;  2CJO A;  1JWS D;  4AUQ C;  4YXD B;  4ZHP A;  1WJ4 A;  2IJ0 A;  3PTF C;  4ICV A;  1KH0 A;  2C7N B;  2NBU A;  1HZ5 A;  3E56 A;  4IUM B;  4REZ A;  1C3T A;  2FAZ A;  2SAK A;  2IZV B;  3ZNI D;  5JHB A;  3KVF B;  4OZC A;  2WXF A;  4IM0 A;  1L6U A;  4HRO A;  4LDT B;  2WP9 B;  1E8W A;  3VH4 B;  1UUP A;  3V61 A;  2XK5 A;  4RGN A;  2WGS A;  1FEH A;  2CKH B;  1BT0 A;  4HLE A;  3WIM A;  3SR6 A;  5JXV A;  3RN9 C;  1P98 A;  3BZD B;  3CF6 E;  1VD2 A;  4FLH A;  3RUL A;  4TV3 A;  1QIL A;  1GPX A;  1QOB A;  3M62 B;  3KUD B;  3RI7 C;  5BYR A;  1L2N A;  4XYC A;  2GBR A;  3M3J A;  3NUH B;  1G6J A;  1K53 A;  4DHJ D;  3ETR A;  3A9K A;  3OJ4 B;  3AE6 B;  2FID A;  2IGG A;  4B0M A;  3JW0 X;  5DCN A;  3P63 A;  3A9K B;  1PGA A;  1UWM A;  1OQY A;  2O6V B;  2VH1 A;  2L32 A;  4B95 A;  3N32 A;  2GRI A;  2RPV A;  3QJZ A;  2L8J A;  1E90 A;  5KHO A;  2KDM A;  4FAD A;  2WDQ B;  4YWG G;  5LXH A;  1AAR A;  1CJE A;  1B9R A;  1WXS A;  3MP9 A;  4OZA A;  3W9C B;  3OLM D;  2LGX A;  5GMV A;  3AED B;  5CTR C;  3EHV A;  4WAF A;  3I5J C;  5FKA C;  3E9S A;  2KDI A;  3N20 C; 
#chains in the Genus database with same CATH homology
 2RDB C;  3Q3N C;  1T0Q C;  1T0S C;  4P1B C;  3RN9 C;  3Q14 C;  3N1Z C;  1T0R C;  3Q2A C;  3DHG C;  3GE8 C;  3DHI C;  2INC C;  3RI7 C;  3N1X C;  3GE3 C;  3Q3O C;  3I63 C;  4P1C C;  3RNA C;  3RNC C;  3RNF C;  3RMK C;  3Q3M C;  3I5J C;  2IND C;  3RNB C;  3RNE C;  3N1Y C;  3DHH C;  3N20 C;  3RNG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...