3RNEC

Structure of the toluene/o-xylene monooxygenase hydroxylase t201s/i276e double mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Toluene o-xylene monooxygenase component
publication title Tracking a defined route for O2 migration in a dioxygen-activating diiron enzyme.
pubmed doi rcsb
source organism Pseudomonas sp. ox1
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.-.-:
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rneC00
3DHGC 3N1XC 1T0SC 3Q14C 3I5JC 3RMKC 1T0QC 3DHIC 3RNAC 3RNGC 3N1YC 2INCC 4P1CC 2RDBC 3RI7C 3RNFC 3RN9C 3RNEC 2INDC 3GE8C 3Q3MC 3Q2AC 3DHHC 4P1BC 3RNCC 1T0RC 3GE3C 3Q3OC 3RNBC 3Q3NC 3N1ZC 3I63C 3N20C
chains in the Genus database with same CATH superfamily
1S1QB 4YTNB 2N4FA 2C9WB 3LJ3A 3BZDB 3L10B 3MC8A 1WZ3A 2DX5B 1AN8A 3V60A 2LUMA 4TSSA 1I4QA 5L83A 3QWZB 1FFVA 3NHEB 1Q5WB 1PGXA 1Y56A 1NI2A 5KHOA 3MC0B 1UBIA 2O6VB 3TUOA 3S2AA 1YN3A 4MM3A 2K39A 4LCDE 1LO5D 2JUOA 4MGYE 1YMHE 3U7ZA 2GMIC 2FAZA 3Q3JA 1I35A 1WM2A 3BYTB 4F8CB 5BMIA 1WJ4A 1WIAA 3GE8C 2DZMA 1J8CA 3AU5A 1YQ4B 1AW7A 4K81A 4KZCA 3CSFA 2HD5B 4L2YA 4DHJB 4WWMA 2LI5A 2KACA 3DCGA 1N63A 3NOBA 2AL3A 1E5WA 1YN5A 1WX9A 2V4LA 4LNKA 1WGYA 1WY8A 2WXFA 1K53A 1KRHA 1YJIA 4JGHB 4AOFA 5DPSA 1OEYA 3AEAB 3BVGA 2C7NB 3I3TB 3RULA 3PSEB 3N1XC 4ACFA 3V6EB 3A9KB 3AECB 3VRBB 1CK1A 3UF8A 4XYCA 2WDVB 4AWJA 2ZJDA 2OJWA 2PJHA 4M01A 4MJSA 4HPPA 5LXIB 1TS5A 3MFGA 2I38A 2Y5CA 3W1SA 4I6LB 3V61A 1H4RA 4GDLB 2MLBA 5CX3A 4XZ4A 1QOBA 3Q3OC 4BFRA 3PRPB 2IGDA 4TKNA 4NPNA 2VZKB 3ZW3A 3TEZA 3DBSA 1V6EA 3JSVA 3UGBB 2QJLA 2LRWA 1XLNA 2LVPA 2HE7A 3AB5A 2CJOA 3LYYA 5D2MB 3HIZA 1YQ3B 4P7IA 4YT0B 5CHFA 3MHZA 4LJPB 1KLVA 2GBRA 3VFKA 1FPYA 1TS4A 4YSYB 2N9EB 3AE4B 4CHKA 4C7YA 3ZJTA 3PZ8A 4PYZA 4HDOA 2WXOA 5FK9C 3VTWA 4W9IA 3WIMA 3U30A 3R2TA 2HJ1A 2C7MB 3NJTA 1GPXA 2AYOB 1RFKA 1NENB 1PGBA 4MSMB 2KX0A 3HM3A 3EHVA 1FNWA 4PT5A 2JWZA 1GC7A 1U4AA 2AEHA 1P98A 2LVOA 2JZZA 1EF5A 4RM8A 3P63A 2PVOD 3HHMA 2LUEA 3AE7B 1NDDA 2WQYB 2ACZB 3AV8A 2BS3B 4JIOU 4BOSC 3P4PB 3EUB2 1FXTB 1V81A 1XEEA 2WYQA 4ASWC 1KFYB 1R4MB 3W1YA 3AM9A 1C3TA 1F0ZA 1AWDA 1P1AA 1QQRA 2K6DB 3W2DA 2PMVA 2WXJA 4KIKB 3VR9B 2L00B 2Z0EB 3T9LA 2KC2A 4CYEA 2K8HA 3L13A 2WWZA 1SE9A 2DENB 3H6NA 4M8NA 1J7AA 1ZW7A 5BYRA 2RD0A 4ZHOA 2PE6B 3W1SC 2LJIA 2JSVX 2R2QA 2W3SA 3PZ7A 4HCNB 1VDVA 3KUCB 4NY0A 3EGRA 1WGGA 1KM7A 1XCTL 2CHZA 3BVZA 4HJGE 1SJED 1SSNA 1Y8RC 4K1RB 4OVZA 4Q2JA 2RPQA 2X8XX 5HI1A 2NBWB 1TS2A 4GDKB 5G55A 3AU4A 2AQ3B 4C4VA 3UQBA 2ZW0A 3KQ4A 3B2GA 4NAWA 5CHVC 3EA6A 3L0WB 4IM3A 4TQ1A 4XWTA 2ZNVC 1QZEA 1IPGA 2MP2A 3VTUA 2FCMA 3OJ3A 3B1LX 4HPLB 1S3SG 3RT3B 2WXPA 4K7WA 2WXNA 3U52E 4US8A 4ZOHC 2ICIA 3V3XA 2RMMA 3VUYA 2BYTA 2CKHB 3R7RA 4RGMA 3TEXA 1E90A 5LNK1 3CMMB 2N1VA 3AE2B 4RGNA 4DXGA 1PGAA 5HFYA 1HEZE 3ZJVA 2HJ8A 3KWLA 4JL9A 3N20C 3ZNHB 2L52A 4N59A 2KWUB 3LXFA 2KMAA 2A5UA 3AEEB 3GB1A 4WJQA 5H8YE 4ZRIA 1L6UA 2LXAA 4EFOA 3P4RB 5IKCM 1VJKA 5C23A 1WYWB 1V86A 4C00A 3RPFC 3KVFB 4LNOA 1VR9A 2O6VD 1R4NB 2WXKA 3ALBA 1QLBB 1C4CA 5FR6A 1GC6A 2K5PA 3FKYA 1WE6A 3NG0A 4A90A 1JALA 1TY0A 2GBKA 4I6PA 3NS8A 1CZPA 1ZKHA 3AE8B 4GXBA 5BMGA 1YJ1A 4ZYNA 4FADA 5E6PA 2EKIA 4OVUA 3VUWA 2LJ5A 1XF5L 4RGTA 2WXIA 1WJNA 2RDHA 3FILB 4RF0A 2MSED 1JCKB 4DXAB 2L0TA 3PZDA 4DHJD 4IWQA 2CHWA 2JXXA 4PK1A 5HG2A 5EE0A 2JXTA 3RNFC 3SD5A 5LXHA 4ZRJA 3RNEC 1X1MA 3IAM1 2AX5A 4URKA 3U2SC 1YOVB 2WGSA 2BS2B 2ONQA 3N1ZC 4OVVA 3BVMA 3I57A 3CSTA 1D4BA 1V5OA 4XGAB 2LGSA 2FBWB 3BK2A 4FHKA 2MBOA 1I4RA 1E7UA 3PGEA 2KYWA 2BS4B 1K52A 1RAXA 2BWFA 2FCNA 1WMHA 4OZCA 4EEWA 3GS2A 1PDXA 1L2NA 4WJPA 1F2RC 3A33B 4JLCA 1WXMA 1WR6E 2KZRA 2MH7A 3ZNZB 3Q8BA 2PIAA 4W9DA 2WDRB 4IWPA 3E56A 4RM9A 1KH0A 2VZKD 3DVGX 4MACA 4P1CC 3B08A 2KMMA 1E0ZA 2KFKB 2CS4A 1R4MI 4TQ0A 3Q8EA 3A1QA 1BXTA 3HM6X 2K8BA 4ARCA 2FNJB 3I9V1 2DAFA 5IA7A 2D3CA 1IYFA 2KX3A 3VQIA 4IKGA 5MPOA 3UIPB 5EE1A 1K50A 2MBBB 4A20A 2MEKA 2JYEA 2XK5B 3NZSA 1WE7A 3ZDTA 1I7HA 3P4QB 4L1BA 4HKZE 1FCLA 3RNAC 4LTUA 2YVCA 1MG4A 3TEWA 4GGQA 5TR5A 1WH3A 2JRIB 3SU8X 3DVNV 2LVQA 3VXWA 2V3PA 1EWYC 3LB8C 1QKZA 3Q8AA 4RCOA 1JWBD 3HK0A 4G3XB 1E8XA 2G9HD 2ZCBA 2W54A 2KDFB 4W9HA 2G45B 2LGIA 2M8SA 4ANXA 2AWTA 1KOTA 1R7SA 2EKEC 3MJWA 3NVYA 1FXIA 2D11A 4NAMA 2K1FA 4B0EA 2J42A 1N5XA 1N5WA 3CIRB 3TSSA 1WRDB 2GBJA 3PO0A 4N58A 1NVID 1GNUA 2M4NA 2IO3B 4C56C 4DK5A 3IVFA 4XDDA 4EKUA 1Z2MA 4DDGD 4DBGA 3OJ4B 2UWQA 4YTPB 1OQQA 2WS3B 1SF0A 2O2VA 3M95A 2INNE 1VD2A 4J6IA 3AMZA 1HXYD 2PPHA 3VR8B 1I4HA 5BMHA 3MC9A 2BKRB 5JXVA 3X0WA 3VAWA 2GRIA 3QC8B 1I42A 1IBXB 4A55A 2KK8A 2EMTA 3N1YC 4GB9A 3NVZA 5J17A 3HUIA 4DQOC 1JROA 1KJTA 4GMVA 3WCQA 2BTEA 2KOXA 2BQQA 3ML8A 4PS7A 3V6CB 1RRBA 1FFUA 2XNAC 3TMPB 3DOWA 1R4NI 4MH8A 4FULA 1EM7A 2HDEA 4M0WA 2BKFA 1V9JA 3IBEA 3RD2A 2D07B 3AEDB 2DYBA 1QT9A 2IO2B 3UIOB 4W9KA 1P7FA 3H7SA 1WYGA 3T3OA 4LJOB 1NI3A 4DHZE 1ZXIA 3DHGC 1TZOA 3J9CA 2MBQA 2OHFA 3H8HA 5IP4D 2KXJA 1P7EA 1T0YA 4S0RA 2PTLA 1JQ4A 3DHIC 1BT0A 1SB3C 5JHAA 3IG3A 5C2TB 1LGRA 4AQ7A 3ZO5B 2WNMA 4WAFA 3ZKJC 2JQRB 2V9HA 4A3OA 1V49A 4DDID 1STEA 2WXMA 4FJYA 3IFWB 5J18A 4KX6B 2PW9A 1QOGA 1CJEA 1GAQB 4WJOA 2WXRA 1BUIC 3VRAB 2VH2A 2GBMA 1WXQA 3DVGY 3WANA 2KKCA 1WZ0A 1UUPA 1YJJA 2JPHA 4MM3B 4QAYA 4KZ0A 1JWSD 1D5MC 3PV1A 1ACCA 4IG7B 2LRUA 1T3QA 3OWEB 4O1NA 3AE3B 5GXGB 4KV2A 2KN4A 4X57B 2V3SA 2IJ0A 3NVVA 2GB1A 1WGDA 3HVDA 2XN9C 2C5LC 1TBEA 3TJPA 1V80A 5D94A 1ZOYB 3Q8FA 4FBJB 1WM3A 3QA8A 2NBVB 3DWMA 2NPTA 2N9PC 3A9JA 3ONSA 3EFCA 1JWAD 1XXGA 5HHDG 3H7PA 3EECA 3RN9C 5D7GA 3T3NA 5CTRC 4WWPA 2VRRB 3SFDB 1M4VA 2K8CA 2YEPB 1GOZA 2D2QA 2L3ZA 4W9JA 3VVWB 4MJSB 3Q8CA 1T6BX 1T5XD 1XQQA 1J7CA 2ZZPB 2NR2A 1DYQA 4MDKE 2WU5B 1VRAB 2DYMA 2KDMA 4P6VF 3WAMA 2ZCCA 4PYUA 1T0RC 1VLBA 3RNBC 3ZUNA 4DHZB 1FEHA 1YD8U 4LNFA 3TEYA 2XBBC 2CU3A 2WXQA 3JSVB 4XDCA 3ZIMA 2MHJA 2IY1B 3MHSD 1ISNA 2LASA 4N6EB 4L23A 2OEDA 1LXDA 4WQMA 1OTRB 3R8BA 3VUXA 3O13A 1WGHA 2ZNVB 1UZXB 2N7EA 3N32A 4BKSD 5J2RA 1WSPA 2L32A 1T0QC 1WX8A 3APDA 1V5TA 3HRDD 2ZVNA 3O65B 2GLSA 2SEBD 4FN2A 2FUG1 2KD0A 1UBQA 1FD6A 2M0AA 1V97A 5D3DA 3R2IA 3VH3B 3N3KB 2KAJA 2DBYA 2JU6X 4YSXB 2WU2B 4TMAB 3D32A 3ECIA 1NYRA 1ZDVA 2RDGA 4RH6A 3NZUA 5EE9A 1N61A 3N30A 2PE9A 5E6JA 3QHTA 2A4ZA 2BWES 2UYZB 4HVBA 2KANA 2BYVE 2KVZA 2NS5A 3C0RB 2VH1A 1VZ7A 1EU3A 3QQ8B 2Z0DB 2BB5A 2KLGA 4HK2A 2D10A 2N7DA 1DOYA 5IOIA 1VZ8A 2KJRA 1E7PB 1YIWA 2IYDB 2IGHA 2KWVB 2TSSA 1ZDXA 3PLVA 2KWCA 2RSUA 2I1JA 4FA6A 4KSKC 1J7BA 3ZNID 4D2KA 1YN4A 2N9XA 2V4IB 3TIXA 5BO4B 4EUTA 4YWGG 1HZ5A 1XLOA 1WGKA 1A5RA 4LNNA 1TGZB 2IGGA 1UGJA 2K9XA 1WWTA 3ZDMC 4MGZE 4LNIA 3WAPA 2J53A 4HKQA 2K6QA 1DOXA 1NBFC 3IT4B 4KDLB 3PRZA 2KTRA 3PHXB 2KTFA 2PEAA 4F7ZA 1WJUA 1G6JA 2KHWB 3AE5B 4MGKE 4OW0A 3ZLZA 4FLHA 1GG3A 3N9YC 4C4VB 2PKOA 3RZFA 4NAWB 1SBBB 3AE1B 1FCCC 3PPAA 3RNGC 1RFAA 4NJ6A 1L0YB 2N7JA 2RDBC 5IN7A 3SHQA 3DDCB 4ZYSA 3AXCA 3M3JA 2MP2B 3P2BA 1I4XA 2C60A 2IZVB 4H2AA 1GB1A 4C7ZA 3JYUA 5AZHA 3BYYB 1WXVA 1L6VA 1ZE3D 3WAOA 3ML9A 1QF6A 4PS8A 4IW0A 3PLUA 4E74A 2DHZA 1V1PA 4EZKA 2WDQB 4US9A 1E8YA 4B0MA 1MHHE 1MJDA 1XT9B 1MPEA 1TY2A 4KKJA 3U4EG 2KNBA 2KT7A 2MBHA 1TKYA 3IXSA 3SFEB 1TTNA 1T0SC 5G2NA 5D6JB 2BF8B 2AL6A 1D6EC 2KC1A 4GLSC 3BK1A 1L4ZB 2INCC 2NTTA 4A9AA 4B95A 1UWXA 1MVKA 3DHHC 3EFUA 2LEKA 2DZJA 2JX5A 3ZRFA 2CJNA 1GUAB 1MHXA 2J7QB 4OZAA 1I4PA 2D5GA 1L0VB 3TL5A 2E6XA 3H9DA 1P3QU 3Q3MC 2RR9A 3ZTCA 3TCAA 2LZ6A 2OJRA 1B9RA 1TKEA 3RCZA 3ZXVA 1TIFA 3DBRI 3AE6B 3U7DA 3B0AA 3QK0A 5EE3A 1ENFA 3CF6E 4IM2A 3AN1A 4S17A 1EO6A 1TZ1A 1XO3A 4A8XC 5DCNA 3IHPC 2NVUI 2I2YA 4LDTB 5AZFA 2SAKA 2WXLA 4HXDA 4ANUA 3B2FA 4OZBA 1DOIA 2WXHA 3AH7A 1BMLC 4KDIC 1KTKA 1WXAA 1WMHB 4HROA 4ICUA 3M62B 3ZQ4A 2FIDA 3I63C 2L83A 4KVGB 1AARA 3R7QA 1J0GA 1HTQA 1IGDA 2BB6A 4W9EA 3OLMD 4ZRQA 4CO7A 2LMCA 1HQRD 3WA0A 1H8CA 5IAAC 2Z59B 5I4DA 5DPWA 4GN1A 4JE3B 3A1QB 1RWSA 1C1YB 1E8ZA 5FKAC 4ARIA 3VHTC 4LK0M 4W9LA 5DPTA 1WF9A 3KW5B 3QX1A 3OG5A 3NS1A 4M8MA 2K3UA 2O6VA 1N60A 2QEJC 1WR1A 2LGYA 3DWGC 3P42A 4GSWA 2QHOA 2JRHA 2WLBA 4BBNC 3NRZA 3T8MA 4MT5A 2HTHA 1WGRA 4MEMA 4RNAA 1L0XB 1F1HA 1PQSA 1K8RB 4JWSC 2KQ7A 1LQBA 1Q0WB 4P1BC 2HTME 2IY0B 3PS6A 2JVCA 4NJCA 2INPE 3VH4B 4XC2A 2YLMA 2ZEQA 4GIVA 2MCNB 2Y5BB 2E3TA 1WX7A 4MELA 3BIID 4BVUC 1SGHA 1I4GA 3ABVB 2KQ4X 3AEGB 2K22A 3KYCD 3W5VB 4DWFA 1GJZA 3Q2AC 2L7RA 4HRSA 2V1YA 3BWUD 2BPSA 5AUKA 2IPKD 4G0NB 3L16A 3DPDA 4BZAA 2XEWA 1C4AA 2D3BA 1F2RI 2N9KA 3A9KA 3DBHI 4BBNF 1TS3A 1F52A 1JRPA 2IO1B 4ZRPA 2L8JA 2BVCA 4PS3A 1ZUD2 2PVGC 4GDLA 3JW0X 2O2VB 2BBCA 2LGDA 2G1EA 1ET9A 1RLFA 4HDQA 3SEBA 2LHDA 1C9FA 2L76A 2KJ6A 2BYEA 3Q3FA 4RF1A 3ZYYX 2I1KA 2NMQA 4BAXA 1EU4A 2FCQA 1M94A 5L95C 1NYQA 1SXTA 4K3BA 5EDSA 3MTNB 4ITKA 4FHJA 3P4SB 4FXCA 4ZHPA 2MJEA 3KH0A 4GOCA 1P9DU 2MQJA 3RFZB 1L5PA 3RUIB 4AJWA 2DLBA 4WQOB 3ETRA 3X23A 4AUQC 1XLQA 2DWQA 3UQAA 3AULA 2OOBB 2WDTB 5E6NA 4K7UA 5KHQA 1UELA 1ET6A 1KF6B 4M0WB 4E71A 1KLGD 2CHXA 4NQLB 1N62A 1E7VA 2DYOA 4YTMB 2JT4B 1WRIA 2LXCA 2MWSB 2WXGA 2K0PA 1C76A 3ZJUA 2R61A 4ANWA 1L7YA 3FAHA 2LWPA 1UNSA 2MRPA 4BOZB 2JZPA 3C8YA 3MP9A 1XLPA 1FMAD 2J0MA 3UINB 3EC8A 2L0FA 1SE2A 1A70A 2CR5A 3QIJA 2FCSA 1LM8B 3K9PB 4ICVA 2M1MA 3L54A 1FNUA 2REXA 3FC4A 4RGOS 1V8CA 1FRRA 3QJZA 4HEA1 2H88B 5G5GA 3RMKC 4REZA 1FM0D 2DZKA 1SIFA 3BY4B 1OQYA 3GOEA 3GP7A 4XX5A 4KIKA 4W9CA 1IP9A 4DXFA 2RPVA 1C77A 3DVNU 4KGRA 1PYWD 2MJDA 3R3MA 4W9GA 3Q3NC 2KFJA 1EF1A 1C4PA 3W5UB 1YQBA 1TT5B 3L17A 1CQVA 3R66C 2WHIA 4USAA 2J52A 3PREA 2C7HA 2JZ3B 5JHBA 1VCBA 2CU1A 1FRDA 2KMCA 1RYJA 1CMXB 4WURA 2D3AA 2FUHB 4NNJB 3L4PA 1QOAA 2QSDA 2NPTB 1TJEA 1OEYJ 4ANVA 2ZW1A 3A9JB 2V0GA 4B9KA 3DBRB 3ENEA 1JRUA 1MG8A 1SEBD 2KDIA 3H7PB 1C78A 1UD7A 3APFA 4GDKA 3ZRCA 4NJ7A 3A4RA 5TSSA 4IM0A 3B9JA 3DBLB 4WWOA 2INDC 5JH5C 5AUIA 1LFDA 3GZNB 4WAAA 1FNVA 2NBUA 3A4SC 4LDTD 5BYQA 2M17A 4FJVB 1QOFA 3Q6BA 4ZDVA 1JW9D 5C1ZA 3SDLC 1WFYA 3TBLD 2ON8A 1D3ZA 4NZLB 4EOYA 2Y3AA 4JWUC 3IT6B 2KDEB 4M00A 2AQ2B 4G50A 1P0RA 1IUEA 1JWMD 1UWMA 3QARA 2FE8A 2KDBA 2QC8A 3NZ3A 3OAWA 4II2B 2KLCA 3CWIA 4HCPB 5IO9A 4II3B 4WH4A 4HPMB 4AP4C 5DPRA 5E6OA 2QILA 2V3NA 2NTSA 1MI0A 3AI5A 1PFDA 2W82A 1Q1OA 1OQRA 1QILA 5AEKB 1F9JA 2Y5PA 1ESFA 4A6QA 1UF0A 2X38A 2IDYA 1D5XC 2G3QB 4FJZA 5AZGA 1N6ZA 2YEPF 4GU2A 3VTVA 2D3GA 2QDFA 3ZTDA 2JYTA 4HJKA 2JWUA 4OHJA 2PLPA 2KJHB 2B3AA 2DAJA 4RMAA 4JQWC 4K7SA 3AE9B 1ZXHA 2IO0B 3FILA 3MJ5A 3RYTA 4IUMB 4AS1A 3U8ZA 3PT2B 4MGIE 3W9CB 2WP9B 2MX2A 4XE0A 2N0SB 1ZPSA 2KN5A 3KWVA 3ZNGC 3Q14C 3K9OB 2R2OA 2J4XA 3PHWB 1FXAA 4C80A 2M19A 2LGXA 2JY6A 2NCNA 1HA5A 2LHEA 4LLGM 3URYA 2G4DB 3DBHB 2N9LA 2WX1A 4YSZB 1WXSA 2FIFA 1PUTA 4KGTA 1TKGA 3KYDD 1E8WA 1HTOA 1OGWA 1WI0A 2MBEA 1OFFA 3I5JC 4I6NB 2MW5A 3DQVA 4R3DA 3SR6A 4TV3A 2MA9B 4E3CA 2UU7A 2BYFA 4B6WA 2BW2A 1YNTE 2LFIA 3WALA 3V62A 5T8IA 4K3CA 2KFKA 2Q5WD 1ROEA 4BKSA 2DNFA 2KTRB 4IOIE 1XD3B 4ZRKA 2L1AA 3QCAA 2KWDA 3P1MA 2AQ1B 2QCZA 3HVZA 4J3OD 3RI7C 1FO4A 2BGFA 3ZXRA 2QIEB 3NVWA 4MSQB 4YL8A 4KSLC 4XWWA 3Q69A 2WX0A 3AEFB 5G5HA 2KO3A 2EMSA 2XK5A 4CQNA 2GOWA 2BT6A 4F1SA 2KVRA 1EUVB 4W9FA 3PRMB 4WJNA 1IGCA 2L05A 4JPSA 2M0XA 5GMVA 5LLIA 3L08A 1D5ZC 2QMTA 4AJYB 3GE3C 1UH6A 2IBIB 3ZGZA 1XCQL 1UGMA 1AYFA 3KLSX 1RM6C 4UDUC 1KLUD 1V1PB 3JVZX 2LD9A 4TUUA 3BINA 4P16A 1EWCA 1HZ6A 3KUZA 4KGSA 1MFWA 3QAQA 5D3IB 3DBLI 2Z8LA 2ZVOA 3LDZE 2MJ3A 1TYGB 3H1UA 3GZNI 4G11A 1SE4A 5CHWA 4BKGA 4EZLA 3PVLA 1V2YA 5FR3A 5HKHA 2W55A 1K51A 1V1OA 4WIPA 2W3RA 1F77A 1E9MA 3NUHB 2ZPYA 3C19A 1FIQA 5JZEB 3NY5A 4YXDB 3UI3A 1B1ZA 1E10A 1Z5SB 1ZGUB 4A3PA 4EE2A 1IBXA 4IWOA 1NEKB 5BYSA 2M56B 2B76B 2K25A 2G4SA 1WJ6A 4MH0E 1YX5B 4NQKE 2J0JA 2KQSA 3RNCC 5C3JB 1JWUD 1GB4A 3AEBB 4KKIA 1JMLA 3APCA 3VDZA 2GI9A 1C79A 1L4DB 3PTFC 3ZVVA 2GBNA 2RGFA 4N9F4 3RZWC 4HWIB 4EZJA 4WWNA 1DGJA 1YX6B 1SJHD 2DZIA 2JF5A 1VZ6A 5H92C 1HE8A 2N1WA 2W9NA 2ASQA 4HLEA 3IAS1 4RFBA 3M63B 2H89B 1SIJA 1SE3A 3KUDB 2J0KA 2EELA 1ZP0B 4IDIA 3E9SA 4JX1C 1E6EB 1J19A 4IC7B 3V05A 1Q10A 4BKTA 2ZPNA 4M02A
chains in the Genus database with same CATH topology
3DHGC 3N1XC 1T0SC 3Q14C 3I5JC 3RMKC 1T0QC 3DHIC 3RNAC 3RNGC 3N1YC 2INCC 4P1CC 2RDBC 3RI7C 3RNFC 3RN9C 3RNEC 2INDC 3GE8C 3Q3MC 3Q2AC 3DHHC 4P1BC 3RNCC 1T0RC 3GE3C 3Q3OC 3RNBC 3Q3NC 3N1ZC 3I63C 3N20C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DHG C;  3N1X C;  1T0S C;  3Q14 C;  3I5J C;  3RMK C;  1T0Q C;  3DHI C;  3RNA C;  3RNG C;  3N1Y C;  2INC C;  4P1C C;  2RDB C;  3RI7 C;  3RNF C;  3RN9 C;  3RNE C;  2IND C;  3GE8 C;  3Q3M C;  3Q2A C;  3DHH C;  4P1B C;  3RNC C;  1T0R C;  3GE3 C;  3Q3O C;  3RNB C;  3Q3N C;  3N1Z C;  3I63 C;  3N20 C; 
#chains in the Genus database with same CATH topology
 1S1Q B;  4YTN B;  2N4F A;  2C9W B;  3LJ3 A;  3BZD B;  3L10 B;  3MC8 A;  1WZ3 A;  2DX5 B;  1AN8 A;  3V60 A;  2LUM A;  4TSS A;  1I4Q A;  5L83 A;  3QWZ B;  1FFV A;  3NHE B;  1Q5W B;  1PGX A;  1Y56 A;  1NI2 A;  5KHO A;  3MC0 B;  1UBI A;  2O6V B;  3TUO A;  3S2A A;  1YN3 A;  4MM3 A;  2K39 A;  4LCD E;  1LO5 D;  2JUO A;  4MGY E;  1YMH E;  3U7Z A;  2GMI C;  2FAZ A;  3Q3J A;  1I35 A;  1WM2 A;  3BYT B;  4F8C B;  5BMI A;  1WJ4 A;  1WIA A;  3GE8 C;  2DZM A;  1J8C A;  3AU5 A;  1YQ4 B;  1AW7 A;  4K81 A;  4KZC A;  3CSF A;  2HD5 B;  4L2Y A;  4DHJ B;  4WWM A;  2LI5 A;  2KAC A;  3DCG A;  1N63 A;  3NOB A;  2AL3 A;  1E5W A;  1YN5 A;  1WX9 A;  2V4L A;  4LNK A;  1WGY A;  1WY8 A;  2WXF A;  1K53 A;  1KRH A;  1YJI A;  4JGH B;  4AOF A;  5DPS A;  1OEY A;  3AEA B;  3BVG A;  2C7N B;  3I3T B;  3RUL A;  3PSE B;  3N1X C;  4ACF A;  3V6E B;  3A9K B;  3AEC B;  3VRB B;  1CK1 A;  3UF8 A;  4XYC A;  2WDV B;  4AWJ A;  2ZJD A;  2OJW A;  2PJH A;  4M01 A;  4MJS A;  4HPP A;  5LXI B;  1TS5 A;  3MFG A;  2I38 A;  2Y5C A;  3W1S A;  4I6L B;  3V61 A;  1H4R A;  4GDL B;  2MLB A;  5CX3 A;  4XZ4 A;  1QOB A;  3Q3O C;  4BFR A;  3PRP B;  2IGD A;  4TKN A;  4NPN A;  2VZK B;  3ZW3 A;  3TEZ A;  3DBS A;  1V6E A;  3JSV A;  3UGB B;  2QJL A;  2LRW A;  1XLN A;  2LVP A;  2HE7 A;  3AB5 A;  2CJO A;  3LYY A;  5D2M B;  3HIZ A;  1YQ3 B;  4P7I A;  4YT0 B;  5CHF A;  3MHZ A;  4LJP B;  1KLV A;  2GBR A;  3VFK A;  1FPY A;  1TS4 A;  4YSY B;  2N9E B;  3AE4 B;  4CHK A;  4C7Y A;  3ZJT A;  3PZ8 A;  4PYZ A;  4HDO A;  2WXO A;  5FK9 C;  3VTW A;  4W9I A;  3WIM A;  3U30 A;  3R2T A;  2HJ1 A;  2C7M B;  3NJT A;  1GPX A;  2AYO B;  1RFK A;  1NEN B;  1PGB A;  4MSM B;  2KX0 A;  3HM3 A;  3EHV A;  1FNW A;  4PT5 A;  2JWZ A;  1GC7 A;  1U4A A;  2AEH A;  1P98 A;  2LVO A;  2JZZ A;  1EF5 A;  4RM8 A;  3P63 A;  2PVO D;  3HHM A;  2LUE A;  3AE7 B;  1NDD A;  2WQY B;  2ACZ B;  3AV8 A;  2BS3 B;  4JIO U;  4BOS C;  3P4P B;  3EUB 2;  1FXT B;  1V81 A;  1XEE A;  2WYQ A;  4ASW C;  1KFY B;  1R4M B;  3W1Y A;  3AM9 A;  1C3T A;  1F0Z A;  1AWD A;  1P1A A;  1QQR A;  2K6D B;  3W2D A;  2PMV A;  2WXJ A;  4KIK B;  3VR9 B;  2L00 B;  2Z0E B;  3T9L A;  2KC2 A;  4CYE A;  2K8H A;  3L13 A;  2WWZ A;  1SE9 A;  2DEN B;  3H6N A;  4M8N A;  1J7A A;  1ZW7 A;  5BYR A;  2RD0 A;  4ZHO A;  2PE6 B;  3W1S C;  2LJI A;  2JSV X;  2R2Q A;  2W3S A;  3PZ7 A;  4HCN B;  1VDV A;  3KUC B;  4NY0 A;  3EGR A;  1WGG A;  1KM7 A;  1XCT L;  2CHZ A;  3BVZ A;  4HJG E;  1SJE D;  1SSN A;  1Y8R C;  4K1R B;  4OVZ A;  4Q2J A;  2RPQ A;  2X8X X;  5HI1 A;  2NBW B;  1TS2 A;  4GDK B;  5G55 A;  3AU4 A;  2AQ3 B;  4C4V A;  3UQB A;  2ZW0 A;  3KQ4 A;  3B2G A;  4NAW A;  5CHV C;  3EA6 A;  3L0W B;  4IM3 A;  4TQ1 A;  4XWT A;  2ZNV C;  1QZE A;  1IPG A;  2MP2 A;  3VTU A;  2FCM A;  3OJ3 A;  3B1L X;  4HPL B;  1S3S G;  3RT3 B;  2WXP A;  4K7W A;  2WXN A;  3U52 E;  4US8 A;  4ZOH C;  2ICI A;  3V3X A;  2RMM A;  3VUY A;  2BYT A;  2CKH B;  3R7R A;  4RGM A;  3TEX A;  1E90 A;  5LNK 1;  3CMM B;  2N1V A;  3AE2 B;  4RGN A;  4DXG A;  1PGA A;  5HFY A;  1HEZ E;  3ZJV A;  2HJ8 A;  3KWL A;  4JL9 A;  3N20 C;  3ZNH B;  2L52 A;  4N59 A;  2KWU B;  3LXF A;  2KMA A;  2A5U A;  3AEE B;  3GB1 A;  4WJQ A;  5H8Y E;  4ZRI A;  1L6U A;  2LXA A;  4EFO A;  3P4R B;  5IKC M;  1VJK A;  5C23 A;  1WYW B;  1V86 A;  4C00 A;  3RPF C;  3KVF B;  4LNO A;  1VR9 A;  2O6V D;  1R4N B;  2WXK A;  3ALB A;  1QLB B;  1C4C A;  5FR6 A;  1GC6 A;  2K5P A;  3FKY A;  1WE6 A;  3NG0 A;  4A90 A;  1JAL A;  1TY0 A;  2GBK A;  4I6P A;  3NS8 A;  1CZP A;  1ZKH A;  3AE8 B;  4GXB A;  5BMG A;  1YJ1 A;  4ZYN A;  4FAD A;  5E6P A;  2EKI A;  4OVU A;  3VUW A;  2LJ5 A;  1XF5 L;  4RGT A;  2WXI A;  1WJN A;  2RDH A;  3FIL B;  4RF0 A;  2MSE D;  1JCK B;  4DXA B;  2L0T A;  3PZD A;  4DHJ D;  4IWQ A;  2CHW A;  2JXX A;  4PK1 A;  5HG2 A;  5EE0 A;  2JXT A;  3RNF C;  3SD5 A;  5LXH A;  4ZRJ A;  3RNE C;  1X1M A;  3IAM 1;  2AX5 A;  4URK A;  3U2S C;  1YOV B;  2WGS A;  2BS2 B;  2ONQ A;  3N1Z C;  4OVV A;  3BVM A;  3I57 A;  3CST A;  1D4B A;  1V5O A;  4XGA B;  2LGS A;  2FBW B;  3BK2 A;  4FHK A;  2MBO A;  1I4R A;  1E7U A;  3PGE A;  2KYW A;  2BS4 B;  1K52 A;  1RAX A;  2BWF A;  2FCN A;  1WMH A;  4OZC A;  4EEW A;  3GS2 A;  1PDX A;  1L2N A;  4WJP A;  1F2R C;  3A33 B;  4JLC A;  1WXM A;  1WR6 E;  2KZR A;  2MH7 A;  3ZNZ B;  3Q8B A;  2PIA A;  4W9D A;  2WDR B;  4IWP A;  3E56 A;  4RM9 A;  1KH0 A;  2VZK D;  3DVG X;  4MAC A;  4P1C C;  3B08 A;  2KMM A;  1E0Z A;  2KFK B;  2CS4 A;  1R4M I;  4TQ0 A;  3Q8E A;  3A1Q A;  1BXT A;  3HM6 X;  2K8B A;  4ARC A;  2FNJ B;  3I9V 1;  2DAF A;  5IA7 A;  2D3C A;  1IYF A;  2KX3 A;  3VQI A;  4IKG A;  5MPO A;  3UIP B;  5EE1 A;  1K50 A;  2MBB B;  4A20 A;  2MEK A;  2JYE A;  2XK5 B;  3NZS A;  1WE7 A;  3ZDT A;  1I7H A;  3P4Q B;  4L1B A;  4HKZ E;  1FCL A;  3RNA C;  4LTU A;  2YVC A;  1MG4 A;  3TEW A;  4GGQ A;  5TR5 A;  1WH3 A;  2JRI B;  3SU8 X;  3DVN V;  2LVQ A;  3VXW A;  2V3P A;  1EWY C;  3LB8 C;  1QKZ A;  3Q8A A;  4RCO A;  1JWB D;  3HK0 A;  4G3X B;  1E8X A;  2G9H D;  2ZCB A;  2W54 A;  2KDF B;  4W9H A;  2G45 B;  2LGI A;  2M8S A;  4ANX A;  2AWT A;  1KOT A;  1R7S A;  2EKE C;  3MJW A;  3NVY A;  1FXI A;  2D11 A;  4NAM A;  2K1F A;  4B0E A;  2J42 A;  1N5X A;  1N5W A;  3CIR B;  3TSS A;  1WRD B;  2GBJ A;  3PO0 A;  4N58 A;  1NVI D;  1GNU A;  2M4N A;  2IO3 B;  4C56 C;  4DK5 A;  3IVF A;  4XDD A;  4EKU A;  1Z2M A;  4DDG D;  4DBG A;  3OJ4 B;  2UWQ A;  4YTP B;  1OQQ A;  2WS3 B;  1SF0 A;  2O2V A;  3M95 A;  2INN E;  1VD2 A;  4J6I A;  3AMZ A;  1HXY D;  2PPH A;  3VR8 B;  1I4H A;  5BMH A;  3MC9 A;  2BKR B;  5JXV A;  3X0W A;  3VAW A;  2GRI A;  3QC8 B;  1I42 A;  1IBX B;  4A55 A;  2KK8 A;  2EMT A;  3N1Y C;  4GB9 A;  3NVZ A;  5J17 A;  3HUI A;  4DQO C;  1JRO A;  1KJT A;  4GMV A;  3WCQ A;  2BTE A;  2KOX A;  2BQQ A;  3ML8 A;  4PS7 A;  3V6C B;  1RRB A;  1FFU A;  2XNA C;  3TMP B;  3DOW A;  1R4N I;  4MH8 A;  4FUL A;  1EM7 A;  2HDE A;  4M0W A;  2BKF A;  1V9J A;  3IBE A;  3RD2 A;  2D07 B;  3AED B;  2DYB A;  1QT9 A;  2IO2 B;  3UIO B;  4W9K A;  1P7F A;  3H7S A;  1WYG A;  3T3O A;  4LJO B;  1NI3 A;  4DHZ E;  1ZXI A;  3DHG C;  1TZO A;  3J9C A;  2MBQ A;  2OHF A;  3H8H A;  5IP4 D;  2KXJ A;  1P7E A;  1T0Y A;  4S0R A;  2PTL A;  1JQ4 A;  3DHI C;  1BT0 A;  1SB3 C;  5JHA A;  3IG3 A;  5C2T B;  1LGR A;  4AQ7 A;  3ZO5 B;  2WNM A;  4WAF A;  3ZKJ C;  2JQR B;  2V9H A;  4A3O A;  1V49 A;  4DDI D;  1STE A;  2WXM A;  4FJY A;  3IFW B;  5J18 A;  4KX6 B;  2PW9 A;  1QOG A;  1CJE A;  1GAQ B;  4WJO A;  2WXR A;  1BUI C;  3VRA B;  2VH2 A;  2GBM A;  1WXQ A;  3DVG Y;  3WAN A;  2KKC A;  1WZ0 A;  1UUP A;  1YJJ A;  2JPH A;  4MM3 B;  4QAY A;  4KZ0 A;  1JWS D;  1D5M C;  3PV1 A;  1ACC A;  4IG7 B;  2LRU A;  1T3Q A;  3OWE B;  4O1N A;  3AE3 B;  5GXG B;  4KV2 A;  2KN4 A;  4X57 B;  2V3S A;  2IJ0 A;  3NVV A;  2GB1 A;  1WGD A;  3HVD A;  2XN9 C;  2C5L C;  1TBE A;  3TJP A;  1V80 A;  5D94 A;  1ZOY B;  3Q8F A;  4FBJ B;  1WM3 A;  3QA8 A;  2NBV B;  3DWM A;  2NPT A;  2N9P C;  3A9J A;  3ONS A;  3EFC A;  1JWA D;  1XXG A;  5HHD G;  3H7P A;  3EEC A;  3RN9 C;  5D7G A;  3T3N A;  5CTR C;  4WWP A;  2VRR B;  3SFD B;  1M4V A;  2K8C A;  2YEP B;  1GOZ A;  2D2Q A;  2L3Z A;  4W9J A;  3VVW B;  4MJS B;  3Q8C A;  1T6B X;  1T5X D;  1XQQ A;  1J7C A;  2ZZP B;  2NR2 A;  1DYQ A;  4MDK E;  2WU5 B;  1VRA B;  2DYM A;  2KDM A;  4P6V F;  3WAM A;  2ZCC A;  4PYU A;  1T0R C;  1VLB A;  3RNB C;  3ZUN A;  4DHZ B;  1FEH A;  1YD8 U;  4LNF A;  3TEY A;  2XBB C;  2CU3 A;  2WXQ A;  3JSV B;  4XDC A;  3ZIM A;  2MHJ A;  2IY1 B;  3MHS D;  1ISN A;  2LAS A;  4N6E B;  4L23 A;  2OED A;  1LXD A;  4WQM A;  1OTR B;  3R8B A;  3VUX A;  3O13 A;  1WGH A;  2ZNV B;  1UZX B;  2N7E A;  3N32 A;  4BKS D;  5J2R A;  1WSP A;  2L32 A;  1T0Q C;  1WX8 A;  3APD A;  1V5T A;  3HRD D;  2ZVN A;  3O65 B;  2GLS A;  2SEB D;  4FN2 A;  2FUG 1;  2KD0 A;  1UBQ A;  1FD6 A;  2M0A A;  1V97 A;  5D3D A;  3R2I A;  3VH3 B;  3N3K B;  2KAJ A;  2DBY A;  2JU6 X;  4YSX B;  2WU2 B;  4TMA B;  3D32 A;  3ECI A;  1NYR A;  1ZDV A;  2RDG A;  4RH6 A;  3NZU A;  5EE9 A;  1N61 A;  3N30 A;  2PE9 A;  5E6J A;  3QHT A;  2A4Z A;  2BWE S;  2UYZ B;  4HVB A;  2KAN A;  2BYV E;  2KVZ A;  2NS5 A;  3C0R B;  2VH1 A;  1VZ7 A;  1EU3 A;  3QQ8 B;  2Z0D B;  2BB5 A;  2KLG A;  4HK2 A;  2D10 A;  2N7D A;  1DOY A;  5IOI A;  1VZ8 A;  2KJR A;  1E7P B;  1YIW A;  2IYD B;  2IGH A;  2KWV B;  2TSS A;  1ZDX A;  3PLV A;  2KWC A;  2RSU A;  2I1J A;  4FA6 A;  4KSK C;  1J7B A;  3ZNI D;  4D2K A;  1YN4 A;  2N9X A;  2V4I B;  3TIX A;  5BO4 B;  4EUT A;  4YWG G;  1HZ5 A;  1XLO A;  1WGK A;  1A5R A;  4LNN A;  1TGZ B;  2IGG A;  1UGJ A;  2K9X A;  1WWT A;  3ZDM C;  4MGZ E;  4LNI A;  3WAP A;  2J53 A;  4HKQ A;  2K6Q A;  1DOX A;  1NBF C;  3IT4 B;  4KDL B;  3PRZ A;  2KTR A;  3PHX B;  2KTF A;  2PEA A;  4F7Z A;  1WJU A;  1G6J A;  2KHW B;  3AE5 B;  4MGK E;  4OW0 A;  3ZLZ A;  4FLH A;  1GG3 A;  3N9Y C;  4C4V B;  2PKO A;  3RZF A;  4NAW B;  1SBB B;  3AE1 B;  1FCC C;  3PPA A;  3RNG C;  1RFA A;  4NJ6 A;  1L0Y B;  2N7J A;  2RDB C;  5IN7 A;  3SHQ A;  3DDC B;  4ZYS A;  3AXC A;  3M3J A;  2MP2 B;  3P2B A;  1I4X A;  2C60 A;  2IZV B;  4H2A A;  1GB1 A;  4C7Z A;  3JYU A;  5AZH A;  3BYY B;  1WXV A;  1L6V A;  1ZE3 D;  3WAO A;  3ML9 A;  1QF6 A;  4PS8 A;  4IW0 A;  3PLU A;  4E74 A;  2DHZ A;  1V1P A;  4EZK A;  2WDQ B;  4US9 A;  1E8Y A;  4B0M A;  1MHH E;  1MJD A;  1XT9 B;  1MPE A;  1TY2 A;  4KKJ A;  3U4E G;  2KNB A;  2KT7 A;  2MBH A;  1TKY A;  3IXS A;  3SFE B;  1TTN A;  1T0S C;  5G2N A;  5D6J B;  2BF8 B;  2AL6 A;  1D6E C;  2KC1 A;  4GLS C;  3BK1 A;  1L4Z B;  2INC C;  2NTT A;  4A9A A;  4B95 A;  1UWX A;  1MVK A;  3DHH C;  3EFU A;  2LEK A;  2DZJ A;  2JX5 A;  3ZRF A;  2CJN A;  1GUA B;  1MHX A;  2J7Q B;  4OZA A;  1I4P A;  2D5G A;  1L0V B;  3TL5 A;  2E6X A;  3H9D A;  1P3Q U;  3Q3M C;  2RR9 A;  3ZTC A;  3TCA A;  2LZ6 A;  2OJR A;  1B9R A;  1TKE A;  3RCZ A;  3ZXV A;  1TIF A;  3DBR I;  3AE6 B;  3U7D A;  3B0A A;  3QK0 A;  5EE3 A;  1ENF A;  3CF6 E;  4IM2 A;  3AN1 A;  4S17 A;  1EO6 A;  1TZ1 A;  1XO3 A;  4A8X C;  5DCN A;  3IHP C;  2NVU I;  2I2Y A;  4LDT B;  5AZF A;  2SAK A;  2WXL A;  4HXD A;  4ANU A;  3B2F A;  4OZB A;  1DOI A;  2WXH A;  3AH7 A;  1BML C;  4KDI C;  1KTK A;  1WXA A;  1WMH B;  4HRO A;  4ICU A;  3M62 B;  3ZQ4 A;  2FID A;  3I63 C;  2L83 A;  4KVG B;  1AAR A;  3R7Q A;  1J0G A;  1HTQ A;  1IGD A;  2BB6 A;  4W9E A;  3OLM D;  4ZRQ A;  4CO7 A;  2LMC A;  1HQR D;  3WA0 A;  1H8C A;  5IAA C;  2Z59 B;  5I4D A;  5DPW A;  4GN1 A;  4JE3 B;  3A1Q B;  1RWS A;  1C1Y B;  1E8Z A;  5FKA C;  4ARI A;  3VHT C;  4LK0 M;  4W9L A;  5DPT A;  1WF9 A;  3KW5 B;  3QX1 A;  3OG5 A;  3NS1 A;  4M8M A;  2K3U A;  2O6V A;  1N60 A;  2QEJ C;  1WR1 A;  2LGY A;  3DWG C;  3P42 A;  4GSW A;  2QHO A;  2JRH A;  2WLB A;  4BBN C;  3NRZ A;  3T8M A;  4MT5 A;  2HTH A;  1WGR A;  4MEM A;  4RNA A;  1L0X B;  1F1H A;  1PQS A;  1K8R B;  4JWS C;  2KQ7 A;  1LQB A;  1Q0W B;  4P1B C;  2HTM E;  2IY0 B;  3PS6 A;  2JVC A;  4NJC A;  2INP E;  3VH4 B;  4XC2 A;  2YLM A;  2ZEQ A;  4GIV A;  2MCN B;  2Y5B B;  2E3T A;  1WX7 A;  4MEL A;  3BII D;  4BVU C;  1SGH A;  1I4G A;  3ABV B;  2KQ4 X;  3AEG B;  2K22 A;  3KYC D;  3W5V B;  4DWF A;  1GJZ A;  3Q2A C;  2L7R A;  4HRS A;  2V1Y A;  3BWU D;  2BPS A;  5AUK A;  2IPK D;  4G0N B;  3L16 A;  3DPD A;  4BZA A;  2XEW A;  1C4A A;  2D3B A;  1F2R I;  2N9K A;  3A9K A;  3DBH I;  4BBN F;  1TS3 A;  1F52 A;  1JRP A;  2IO1 B;  4ZRP A;  2L8J A;  2BVC A;  4PS3 A;  1ZUD 2;  2PVG C;  4GDL A;  3JW0 X;  2O2V B;  2BBC A;  2LGD A;  2G1E A;  1ET9 A;  1RLF A;  4HDQ A;  3SEB A;  2LHD A;  1C9F A;  2L76 A;  2KJ6 A;  2BYE A;  3Q3F A;  4RF1 A;  3ZYY X;  2I1K A;  2NMQ A;  4BAX A;  1EU4 A;  2FCQ A;  1M94 A;  5L95 C;  1NYQ A;  1SXT A;  4K3B A;  5EDS A;  3MTN B;  4ITK A;  4FHJ A;  3P4S B;  4FXC A;  4ZHP A;  2MJE A;  3KH0 A;  4GOC A;  1P9D U;  2MQJ A;  3RFZ B;  1L5P A;  3RUI B;  4AJW A;  2DLB A;  4WQO B;  3ETR A;  3X23 A;  4AUQ C;  1XLQ A;  2DWQ A;  3UQA A;  3AUL A;  2OOB B;  2WDT B;  5E6N A;  4K7U A;  5KHQ A;  1UEL A;  1ET6 A;  1KF6 B;  4M0W B;  4E71 A;  1KLG D;  2CHX A;  4NQL B;  1N62 A;  1E7V A;  2DYO A;  4YTM B;  2JT4 B;  1WRI A;  2LXC A;  2MWS B;  2WXG A;  2K0P A;  1C76 A;  3ZJU A;  2R61 A;  4ANW A;  1L7Y A;  3FAH A;  2LWP A;  1UNS A;  2MRP A;  4BOZ B;  2JZP A;  3C8Y A;  3MP9 A;  1XLP A;  1FMA D;  2J0M A;  3UIN B;  3EC8 A;  2L0F A;  1SE2 A;  1A70 A;  2CR5 A;  3QIJ A;  2FCS A;  1LM8 B;  3K9P B;  4ICV A;  2M1M A;  3L54 A;  1FNU A;  2REX A;  3FC4 A;  4RGO S;  1V8C A;  1FRR A;  3QJZ A;  4HEA 1;  2H88 B;  5G5G A;  3RMK C;  4REZ A;  1FM0 D;  2DZK A;  1SIF A;  3BY4 B;  1OQY A;  3GOE A;  3GP7 A;  4XX5 A;  4KIK A;  4W9C A;  1IP9 A;  4DXF A;  2RPV A;  1C77 A;  3DVN U;  4KGR A;  1PYW D;  2MJD A;  3R3M A;  4W9G A;  3Q3N C;  2KFJ A;  1EF1 A;  1C4P A;  3W5U B;  1YQB A;  1TT5 B;  3L17 A;  1CQV A;  3R66 C;  2WHI A;  4USA A;  2J52 A;  3PRE A;  2C7H A;  2JZ3 B;  5JHB A;  1VCB A;  2CU1 A;  1FRD A;  2KMC A;  1RYJ A;  1CMX B;  4WUR A;  2D3A A;  2FUH B;  4NNJ B;  3L4P A;  1QOA A;  2QSD A;  2NPT B;  1TJE A;  1OEY J;  4ANV A;  2ZW1 A;  3A9J B;  2V0G A;  4B9K A;  3DBR B;  3ENE A;  1JRU A;  1MG8 A;  1SEB D;  2KDI A;  3H7P B;  1C78 A;  1UD7 A;  3APF A;  4GDK A;  3ZRC A;  4NJ7 A;  3A4R A;  5TSS A;  4IM0 A;  3B9J A;  3DBL B;  4WWO A;  2IND C;  5JH5 C;  5AUI A;  1LFD A;  3GZN B;  4WAA A;  1FNV A;  2NBU A;  3A4S C;  4LDT D;  5BYQ A;  2M17 A;  4FJV B;  1QOF A;  3Q6B A;  4ZDV A;  1JW9 D;  5C1Z A;  3SDL C;  1WFY A;  3TBL D;  2ON8 A;  1D3Z A;  4NZL B;  4EOY A;  2Y3A A;  4JWU C;  3IT6 B;  2KDE B;  4M00 A;  2AQ2 B;  4G50 A;  1P0R A;  1IUE A;  1JWM D;  1UWM A;  3QAR A;  2FE8 A;  2KDB A;  2QC8 A;  3NZ3 A;  3OAW A;  4II2 B;  2KLC A;  3CWI A;  4HCP B;  5IO9 A;  4II3 B;  4WH4 A;  4HPM B;  4AP4 C;  5DPR A;  5E6O A;  2QIL A;  2V3N A;  2NTS A;  1MI0 A;  3AI5 A;  1PFD A;  2W82 A;  1Q1O A;  1OQR A;  1QIL A;  5AEK B;  1F9J A;  2Y5P A;  1ESF A;  4A6Q A;  1UF0 A;  2X38 A;  2IDY A;  1D5X C;  2G3Q B;  4FJZ A;  5AZG A;  1N6Z A;  2YEP F;  4GU2 A;  3VTV A;  2D3G A;  2QDF A;  3ZTD A;  2JYT A;  4HJK A;  2JWU A;  4OHJ A;  2PLP A;  2KJH B;  2B3A A;  2DAJ A;  4RMA A;  4JQW C;  4K7S A;  3AE9 B;  1ZXH A;  2IO0 B;  3FIL A;  3MJ5 A;  3RYT A;  4IUM B;  4AS1 A;  3U8Z A;  3PT2 B;  4MGI E;  3W9C B;  2WP9 B;  2MX2 A;  4XE0 A;  2N0S B;  1ZPS A;  2KN5 A;  3KWV A;  3ZNG C;  3Q14 C;  3K9O B;  2R2O A;  2J4X A;  3PHW B;  1FXA A;  4C80 A;  2M19 A;  2LGX A;  2JY6 A;  2NCN A;  1HA5 A;  2LHE A;  4LLG M;  3URY A;  2G4D B;  3DBH B;  2N9L A;  2WX1 A;  4YSZ B;  1WXS A;  2FIF A;  1PUT A;  4KGT A;  1TKG A;  3KYD D;  1E8W A;  1HTO A;  1OGW A;  1WI0 A;  2MBE A;  1OFF A;  3I5J C;  4I6N B;  2MW5 A;  3DQV A;  4R3D A;  3SR6 A;  4TV3 A;  2MA9 B;  4E3C A;  2UU7 A;  2BYF A;  4B6W A;  2BW2 A;  1YNT E;  2LFI A;  3WAL A;  3V62 A;  5T8I A;  4K3C A;  2KFK A;  2Q5W D;  1ROE A;  4BKS A;  2DNF A;  2KTR B;  4IOI E;  1XD3 B;  4ZRK A;  2L1A A;  3QCA A;  2KWD A;  3P1M A;  2AQ1 B;  2QCZ A;  3HVZ A;  4J3O D;  3RI7 C;  1FO4 A;  2BGF A;  3ZXR A;  2QIE B;  3NVW A;  4MSQ B;  4YL8 A;  4KSL C;  4XWW A;  3Q69 A;  2WX0 A;  3AEF B;  5G5H A;  2KO3 A;  2EMS A;  2XK5 A;  4CQN A;  2GOW A;  2BT6 A;  4F1S A;  2KVR A;  1EUV B;  4W9F A;  3PRM B;  4WJN A;  1IGC A;  2L05 A;  4JPS A;  2M0X A;  5GMV A;  5LLI A;  3L08 A;  1D5Z C;  2QMT A;  4AJY B;  3GE3 C;  1UH6 A;  2IBI B;  3ZGZ A;  1XCQ L;  1UGM A;  1AYF A;  3KLS X;  1RM6 C;  4UDU C;  1KLU D;  1V1P B;  3JVZ X;  2LD9 A;  4TUU A;  3BIN A;  4P16 A;  1EWC A;  1HZ6 A;  3KUZ A;  4KGS A;  1MFW A;  3QAQ A;  5D3I B;  3DBL I;  2Z8L A;  2ZVO A;  3LDZ E;  2MJ3 A;  1TYG B;  3H1U A;  3GZN I;  4G11 A;  1SE4 A;  5CHW A;  4BKG A;  4EZL A;  3PVL A;  1V2Y A;  5FR3 A;  5HKH A;  2W55 A;  1K51 A;  1V1O A;  4WIP A;  2W3R A;  1F77 A;  1E9M A;  3NUH B;  2ZPY A;  3C19 A;  1FIQ A;  5JZE B;  3NY5 A;  4YXD B;  3UI3 A;  1B1Z A;  1E10 A;  1Z5S B;  1ZGU B;  4A3P A;  4EE2 A;  1IBX A;  4IWO A;  1NEK B;  5BYS A;  2M56 B;  2B76 B;  2K25 A;  2G4S A;  1WJ6 A;  4MH0 E;  1YX5 B;  4NQK E;  2J0J A;  2KQS A;  3RNC C;  5C3J B;  1JWU D;  1GB4 A;  3AEB B;  4KKI A;  1JML A;  3APC A;  3VDZ A;  2GI9 A;  1C79 A;  1L4D B;  3PTF C;  3ZVV A;  2GBN A;  2RGF A;  4N9F 4;  3RZW C;  4HWI B;  4EZJ A;  4WWN A;  1DGJ A;  1YX6 B;  1SJH D;  2DZI A;  2JF5 A;  1VZ6 A;  5H92 C;  1HE8 A;  2N1W A;  2W9N A;  2ASQ A;  4HLE A;  3IAS 1;  4RFB A;  3M63 B;  2H89 B;  1SIJ A;  1SE3 A;  3KUD B;  2J0K A;  2EEL A;  1ZP0 B;  4IDI A;  3E9S A;  4JX1 C;  1E6E B;  1J19 A;  4IC7 B;  3V05 A;  1Q10 A;  4BKT A;  2ZPN A;  4M02 A; 
#chains in the Genus database with same CATH homology
 3DHG C;  3N1X C;  1T0S C;  3Q14 C;  3I5J C;  3RMK C;  1T0Q C;  3DHI C;  3RNA C;  3RNG C;  3N1Y C;  2INC C;  4P1C C;  2RDB C;  3RI7 C;  3RNF C;  3RN9 C;  3RNE C;  2IND C;  3GE8 C;  3Q3M C;  3Q2A C;  3DHH C;  4P1B C;  3RNC C;  1T0R C;  3GE3 C;  3Q3O C;  3RNB C;  3Q3N C;  3N1Z C;  3I63 C;  3N20 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...