3RNEC

Structure of the toluene/o-xylene monooxygenase hydroxylase t201s/i276e double mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene o-xylene monooxygenase component
publication title Tracking a defined route for O2 migration in a dioxygen-activating diiron enzyme.
pubmed doi rcsb
source organism Pseudomonas sp. ox1
molecule tags Oxidoreductase
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.-.-:
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rneC00
3I5JC 3RNCC 1T0SC 3DHGC 1T0QC 3I63C 3N20C 4P1BC 3RNEC 3RN9C 3DHHC 3RNAC 3Q14C 3N1YC 3RMKC 3GE3C 3N1XC 2INCC 3GE8C 3RI7C 2RDBC 2INDC 1T0RC 3RNGC 3RNBC 3Q2AC 3N1ZC 3Q3OC 3DHIC 3Q3MC 3Q3NC 3RNFC 4P1CC
chains in the Genus database with same CATH superfamily
4C56C 2LGDA 3AB5A 1ZUD2 3URYA 1KRHA 1KOTA 1WX7A 2DZKA 2L83A 1AW7A 1ZW7A 3K9OB 1FO4A 1S1QB 3ZJTA 3AE7B 5AZGA 4HCNB 3GOEA 5BYQA 1WRIA 2H88B 3KWVA 4RCOA 4M8NA 4NZLB 3DBRI 4DHJB 2LWPA 2C5LC 2ZVNA 3U30A 4MH0E 4EZJA 2UYZB 4IWQA 1XEEA 3WALA 2DX5B 2BQQA 3M63B 2OJRA 2ZZPB 1FRDA 2KDFB 5TR5A 3GP7A 2K8BA 4II3B 1EWYC 2HJ8A 4ITKA 2LI5A 1DOXA 1NEKB 1JWAD 1SJED 2LVPA 2KJHB 1Q5WB 3WIMA 5E6OA 2KNBA 3FAHA 3P4SB 4YL8A 2VH2A 3IBEA 3N1XC 3VUXA 2BS4B 3W1SA 3AM9A 3Q3NC 3P4QB 3RNFC 2KKCA 2MP2A 1V1PA 1T0SC 5D7GA 3Q8EA 2HTME 4AWJA 2M17A 2MSED 5DPSA 2KWUB 5IN7A 2L05A 4PS7A 2KDIA 2KC1A 1HXYD 2WXIA 1V1OA 2FAZA 2R2OA 2XN9C 1AYFA 2PVGC 3AEAB 2D3GA 2OOBB 2KAJA 3DWMA 1GJZA 1RLFA 2W3SA 2QSDA 5BO4B 2L7RA 4DK5A 1WF9A 2MRPA 1F77A 4BKTA 3HRDD 1SF0A 1FEHA 4HDOA 4ZRPA 2K22A 3NVWA 3GZNB 4KKIA 2ASQA 1FXIA 2A5UA 1PGXA 2IDYA 4EOYA 3RZFA 3BK2A 4RGMA 1FFUA 2WXHA 3APCA 4M00A 4O1NA 1NVID 1BXTA 1XT9B 1TS5A 2BPSA 4PYUA 4HEA1 2IPKD 1JROA 3KUCB 3Q14C 2M19A 2V1YA 3TSSA 3Q8AA 1UGJA 1OTRB 2KD0A 2BYTA 1GNUA 2KLCA 3TUOA 1ET6A 3RPFC 2YVCA 1XF5L 3VQIA 2D2QA 2LD9A 3A1QA 3MHSD 1XD3B 4REZA 2QIEB 2N9XA 1IBXA 4P1BC 3VXWA 3KWLA 2K39A 5CX3A 1I4QA 3AN1A 3AULA 2D11A 2L1AA 2ZW0A 4WJOA 2PTLA 1N60A 4MJSA 2LJ5A 3M3JA 3HIZA 1JMLA 3PRPB 3K9PB 3ZNZB 4G11A 4W9KA 2WXMA 3MC8A 2HD5B 3BYYB 4B9KA 3O13A 3VUWA 4ZYNA 3ENEA 4P16A 4RF0A 3V61A 2WU5B 1HEZE 3MTNB 4LK0M 3WAOA 1R4MI 3QCAA 4HRSA 1WXAA 1WFYA 4A8XC 1R4NI 3R2TA 4D2KA 2M8SA 5KHOA 2ZPNA 1M94A 2LXCA 4B0MA 2MBOA 3GE3C 1F0ZA 1J7CA 1EO6A 2MBHA 2RDHA 5AUKA 3GE8C 2LGXA 4WAAA 2FCNA 1N61A 4RH6A 3Q3OC 2O6VB 2YLMA 5L83A 5DPWA 2VZKB 4FULA 5C23A 2Z8LA 3P4RB 1I35A 2JZPA 2W9NA 2FNJB 4FN2A 3CSTA 4KIKB 3ZXRA 2DWQA 3DHHC 1ZXHA 3L13A 4KDLB 2W55A 1WJNA 4XC2A 2KACA 3RI7C 3X23A 4WJQA 2AQ3B 3MP9A 3AXCA 2BT6A 4IWPA 2Z0DB 3DVNU 3NS1A 2OHFA 4LLGM 3U7DA 1C4CA 4ACFA 1HA5A 1SE9A 2IGHA 2KDBA 1VZ7A 3ZXVA 4RM8A 1QLBB 5J2RA 1T6BX 1C79A 3RT3B 1WMHA 1TIFA 4WWPA 1WJUA 2D3CA 1Q1OA 4BFRA 3H9DA 4F1SA 2X8XX 2BB6A 1WIAA 4K7UA 1YMHE 2GLSA 1QZEA 2AQ1B 2IGDA 1K52A 2MP2B 4J3OD 3V6CB 2GBNA 1CJEA 1V6EA 5J17A 2GMIC 1YJIA 3PZ7A 3VUYA 1YX6B 1D4BA 1YN4A 1V80A 3U52E 5AEKB 1V2YA 2NS5A 3ETRA 2G4SA 2K6DB 1AWDA 3KW5B 3RN9C 4YTMB 1FM0D 3UIOB 2HDEA 2C7MB 1BT0A 4DDID 2AL6A 4GIVA 3ZNGC 2DYOA 2KWCA 2O2VA 3EFUA 4NAWB 4DBGA 3V60A 1E7PB 2DYMA 1RWSA 3W9CB 4NQLB 1WM2A 3V6EB 1UGMA 2ON8A 3PLVA 3VR9B 2BWFA 3B2GA 4US9A 3ZTCA 1CQVA 2KXJA 3AE1B 4XX5A 4BVUC 3HM6X 2PE6B 4P6VF 1UUPA 1SXTA 2L3ZA 4MELA 3VFKA 1WJ6A 4IG7B 3IT4B 3TIXA 2J53A 2QC8A 2I1KA 1F52A 2C60A 1P98A 3MFGA 3BVZA 4EFOA 4BAXA 2MHJA 4ZHOA 2Q5WD 4WAFA 4P7IA 1WXSA 2AYOB 4E3CA 2LFIA 4HK2A 1V49A 5JXVA 2DZIA 2V4IB 1NYRA 4WURA 3RZWC 2FCQA 2ZVOA 4JWSC 5FR6A 3PV1A 5LNK1 1NI3A 1UF0A 4HWIB 4LNKA 3ALBA 3V05A 2WXFA 1QKZA 3S2AA 2KYWA 2I38A 5E6PA 4W9CA 4W9JA 5EE0A 4CHKA 1T0QC 5E6NA 2REXA 4GGQA 1L6VA 1T5XD 5LLIA 4A6QA 5EE9A 4AS1A 1J19A 4KGRA 2N0SB 1RFAA 5FK9C 2KMMA 3OAWA 2XEWA 3PHWB 2INDC 4USAA 2KMAA 5EE3A 1CK1A 2FUHB 4ZRQA 4BBNC 4W9HA 3I5JC 4K7WA 4HJGE 4MGYE 3W1SC 3IXSA 4OHJA 3NJTA 1TGZB 2MBQA 2NTSA 3BINA 2WXRA 1EU4A 4TSSA 2FCSA 5TSSA 1XQQA 2BW2A 3R3MA 4BKSD 3CWIA 1WGRA 5DPTA 1E0ZA 4PT5A 4ZHPA 4ICUA 1CMXB 1PDXA 2V4LA 3CSFA 3H8HA 4HPLB 4IW0A 2A4ZA 3AEFB 3OJ3A 2KHWB 2QILA 1MI0A 1IGCA 4DWFA 3PS6A 4M0WA 2XBBC 2KVZA 2V0GA 2K6QA 3L17A 4LNIA 3DOWA 3PRMB 2IO0B 3N1ZC 1SGHA 3AE8B 1NENB 1MFWA 4P1CC 4E74A 3ZKJC 5LXIB 2JY6A 2WQYB 1WWTA 2DLBA 2INNE 1C9FA 4BOSC 2WXKA 3H1UA 3NZSA 5C2TB 1QF6A 2LUMA 4GXBA 3DBLB 3NVZA 2EMTA 2L8JA 3WAPA 2ZW1A 2R2QA 4ANVA 3UF8A 2DAFA 2K9XA 4L2YA 5IO9A 2DZMA 2LASA 2Y5BB 5JHAA 2DENB 2BS3B 1E10A 1E8WA 5FR3A 4A55A 2W3RA 4OVUA 2KC2A 2K8CA 3X0WA 3DBHI 2IY0B 2WNMA 2N9KA 1MPEA 1ZGUB 1I7HA 5G55A 2O2VB 3QX1A 4EUTA 2DBYA 3SEBA 2JU6X 1YX5B 1WXVA 1LO5D 1JCKB 4HROA 1A70A 4TKNA 1N63A 2WXJA 1ZXIA 4GB9A 2PKOA 1VZ8A 2O6VA 2NTTA 3LJ3A 4ZDVA 1P7EA 1V5TA 2CHXA 1E9MA 1XXGA 2OEDA 4FA6A 3WAMA 1GAQB 4LDTD 1TZOA 4KIKA 4CQNA 1T3QA 1PQSA 3TBLD 2B76B 3KYCD 1IUEA 5GMVA 4IM3A 2N7EA 3QWZB 4K81A 2D5GA 4ZRIA 3IVFA 4EE2A 1WI0A 4URKA 4FJZA 1WE7A 2AEHA 2GB1A 2KANA 1FD6A 3NVVA 5FKAC 1N5XA 3APDA 2MA9B 3RULA 1VLBA 2GOWA 3PPAA 2CS4A 1RYJA 1TJEA 2KN5A 2Z0EB 3VTVA 2M1MA 2PPHA 1J8CA 2GI9A 3MC9A 5BMHA 4L23A 2BS2B 2M56B 3KQ4A 1MG8A 1DOYA 1FCCC 4A20A 1C76A 5G2NA 4AJWA 2AQ2B 3RFZB 4YT0B 1NI2A 1SBBB 4MM3B 4NPNA 2PLPA 2KQSA 1FCLA 3A4SC 1VZ6A 3A33B 1E8XA 4PS3A 1U4AA 1N5WA 2ZEQA 2G3QB 4GLSC 3BYTB 2WXNA 4HKZE 2CU3A 3PZ8A 3ZJVA 4PYZA 2JYEA 5IA7A 2LGIA 1VDVA 3Q8CA 2ZPYA 1GC7A 4DDGD 2JXXA 2KOXA 2N4FA 3NUHB 5D6JB 1F2RC 5DPRA 4BOZB 2K5PA 3VVWB 4NAWA 2MEKA 1WGDA 2C7NB 1TKGA 4W9GA 1RM6C 1E8ZA 2LUEA 4ANXA 3Q3JA 1L7YA 3GZNI 4FJYA 2M0XA 2ZNVC 4FHKA 2IBIB 5MPOA 4M0WB 2LZ6A 4KDIC 1P3QU 3WANA 2KFKA 1MJDA 2JZZA 1TY0A 3VH3B 1UWXA 1OQRA 2JQRB 2NCNA 1WJ4A 2JWZA 3Q8FA 1ENFA 1SSNA 2I1JA 4G0NB 3P4PB 4JE3B 1ZOYB 4K3CA 3ZRCA 4XDDA 2KT7A 3ZUNA 2BBCA 2LMCA 2E6XA 4OVZA 2MH7A 2JWUA 2G1EA 3RNCC 5H92C 2J0JA 1TS3A 1TKEA 4IUMB 1IGDA 2KX0A 4US8A 1KF6B 1TYGB 1JQ4A 1TTNA 2IO3B 1ESFA 3MJ5A 1XLPA 2KQ4X 2D07B 1C3TA 3H7PB 4GDLB 4XE0A 2CJNA 3ZO5B 3ZTDA 2MJEA 2JRHA 1I4HA 1NYQA 3RUIB 4A90A 1YD8U 1R4NB 2JZ3B 3RD2A 1JWMD 3V62A 3KLSX 4IM2A 1GUAB 1TZ1A 1WGGA 2LHEA 4WJNA 1E7UA 1XCQL 2KMCA 4GN1A 3T3NA 1TT5B 3LXFA 2DZJA 1D6EC 3SHQA 2K1FA 4GU2A 3D32A 3QK0A 4RFBA 2PVOD 4XYCA 1IYFA 4JX1C 4GSWA 4HPMB 1K50A 2WGSA 1E5WA 2IGGA 4DHZE 4LNFA 4LTUA 1GB4A 1OEYJ 1EM7A 1QILA 1L4DB 3B0AA 4ANWA 1L2NA 1FRRA 3EUB2 5DCNA 2PEAA 3PTFC 1RFKA 1E90A 1QOGA 3AE5B 3RNAC 3ZNHB 3OJ4B 1QT9A 3ECIA 2LHDA 4N9F4 4W9LA 3QJZA 4KSLC 4C4VB 4TMAB 3KUDB 3AE2B 1D5ZC 3EFCA 3QA8A 3FILB 1J7BA 1RRBA 4EZKA 1EF5A 4JQWC 4EKUA 3TMPB 1ZDXA 2WDRB 3U7ZA 1OGWA 1ZDVA 2N7DA 2WDTB 4MACA 1WGYA 4MT5A 4NJ7A 3P1MA 4YWGG 2LEKA 4WIPA 3ZJUA 1B1ZA 2TSSA 2WXOA 4MGZE 2NR2A 3VR8B 2ZJDA 2IO2B 4GMVA 5C3JB 3UQBA 3CIRB 4RF1A 3T3OA 2WX1A 3R66C 2WHIA 1L0VB 2CR5A 2KQ7A 4HLEA 3ZLZA 3IHPC 1ISNA 1GB1A 3NS8A 3ONSA 2C7HA 1UELA 2NBWB 4G3XB 1T0RC 1RAXA 4HJKA 5KHQA 3B1LX 5EDSA 2WLBA 2ACZB 1E6EB 3H6NA 4LCDE 3QIJA 4AP4C 1D5XC 3UIPB 2L32A 5G5HA 1WXQA 3VTUA 3L0WB 3ZNID 1DGJA 2DYBA 3ZRFA 2GBKA 2PMVA 3NOBA 1KH0A 2NPTB 2WDQB 3AE6B 1SE4A 4MGIE 4Q2JA 1QOAA 4AUQC 4A9AA 2KFKB 1WGKA 1WYWB 2Y5CA 2N9PC 4DXAB 2FIDA 3GB1A 2XK5B 2PE9A 3ZYYX 5GXGB 4WWOA 2GBMA 3WCQA 4WQOB 4YSXB 4AJYB 3HUIA 4BZAA 4I6LB 4WQMA 1FNVA 1XLQA 2KJ6A 3PVLA 1YQBA 1WE6A 1BUIC 1JALA 3I63C 2L52A 3RNEC 1YNTE 4I6PA 1NDDA 2ICIA 2MBEA 2HTHA 2J52A 1LM8B 3DPDA 2WXQA 1JRUA 3PT2B 1KLVA 1BMLC 2NBUA 2N1WA 3AEDB 3BVMA 4HPPA 4ANUA 4WWMA 3Q3FA 4RGOS 1WR6E 4MM3A 3J9CA 1N62A 2X38A 2E3TA 2W54A 4NJ6A 3N30A 3QHTA 4LNNA 4OW0A 3V3XA 4I6NB 5D2MB 2AL3A 3AECB 1WGHA 3JYUA 3PHXB 2IYDB 2D10A 1MHXA 3NG0A 1JWUD 2INPE 2KTFA 2V3PA 3VHTC 2JF5A 4M02A 3EC8A 3JW0X 4FBJB 1XCTL 3L10B 2EMSA 4ARCA 2BWES 2PW9A 2JYTA 3DHIC 4KZ0A 2KO3A 4N6EB 3BIID 2KWVB 3B9JA 1JRPA 3ZVVA 3QQ8B 3NZ3A 3WA0A 4KGSA 4LDTB 3TEWA 3AU5A 4NAMA 4NJCA 1HE8A 4YSZB 1WR1A 3ZDTA 1AN8A 3A9JB 4B6WA 3A9KB 1ROEA 2GBJA 4S17A 3IAS1 3L16A 2CHWA 4OZCA 4M01A 3W1YA 2IJ0A 5G5GA 2R61A 4NQKE 1V81A 1P1AA 4ZRJA 1X1MA 4PS8A 3R7RA 2KLGA 1MVKA 1H4RA 3DCGA 5AZFA 1HTOA 3TEXA 1HQRD 3HK0A 2BGFA 4KKJA 2K0PA 2RSUA 5IP4D 4FXCA 1STEA 1R7SA 3DQVA 3DBLI 1P9DU 1OQQA 2M0AA 3B2FA 3NY5A 4YXDB 3N3KB 1QOFA 3I9V1 3TJPA 5BMGA 4M8MA 2KTRB 1OQYA 4W9FA 3SFDB 1ZKHA 3H7PA 4GDLA 5I4DA 2LXAA 4JGHB 4CYEA 4IKGA 4RM9A 2BYVE 2ZNVB 3FC4A 4C80A 1GOZA 2J0KA 1V8CA 2SAKA 3GS2A 3TEYA 4RGNA 2Y3AA 1UNSA 2QDFA 2WXLA 3AEBB 2I2YA 4OZBA 2BB5A 3LYYA 3MC0B 3NVYA 2FBWB 2PIAA 3AH7A 2WXGA 4QAYA 2KWDA 2G4DB 4LJOB 4HKQA 1KLUD 3DBRB 4GDKB 4NY0A 5HHDG 2MJ3A 1Y56A 2RPVA 2XNAC 4XDCA 5JZEB 3RNBC 2KK8A 1J0GA 4JPSA 1XLNA 3C19A 1WSPA 1L4ZB 3R7QA 5HI1A 1K53A 3DHGC 4IM0A 4TUUA 4FADA 2KDEB 3PGEA 3KVFB 3BY4B 5CHFA 1V5OA 1FMAD 3AEGB 1Y8RC 4E71A 1TS4A 3KUZA 1MG4A 2CKHB 4F8CB 3NRZA 4C4VA 3FILA 4TQ1A 5HFYA 2FE8A 2MCNB 5J18A 2M4NA 1D3ZA 3FKYA 4LNOA 1M4VA 2WYQA 2NMQA 3AEEB 3E9SA 2RDBC 1K8RB 3B08A 4XZ4A 3DWGC 1L6UA 2VRRB 3ZIMA 2QEJC 3EA6A 1Z5SB 3KYDD 3PLUA 1UH6A 2QHOA 2JT4B 5CHWA 2DAJA 3T9LA 2N9EB 2L0TA 4A3OA 1TY2A 5EE1A 1UBQA 5E6JA 3Q2AC 1QQRA 3OWEB 3MHZA 3ZDMC 3U4EG 3N32A 2WS3B 5D3DA 4EZLA 2LGYA 1Q10A 1TBEA 1SB3C 4C00A 2CHZA 2LRWA 4RNAA 3T8MA 1LXDA 2NPTA 3C0RB 4NNJB 3BK1A 2SEBD 3HHMA 4K1RB 4BKSA 4W9EA 3AMZA 4RMAA 1C1YB 1WX9A 4FLHA 4LJPB 1YIWA 1I4PA 3IT6B 4EEWA 1KFYB 4DQOC 4DHJD 1SE3A 3IAM1 2WDVB 1HZ6A 3KH0A 2MBBB 2JSVX 3SDLC 2XK5A 2G45B 2Z59B 3LDZE 3NZUA 3M95A 3A4RA 3EHVA 4II2B 1C78A 4XWTA 2J42A 2LJIA 4UDUC 1PGAA 4KSKC 1C77A 1VD2A 3UGBB 4TQ0A 2OJWA 5HG2A 2CJOA 3P2BA 4HCPB 5BYRA 3TCAA 1L5PA 4HVBA 1OFFA 3DVNV 3ZQ4A 3BWUD 4C7YA 1LFDA 2J7QB 4ICVA 3PO0A 4WJPA 2FCMA 2LVOA 1YJ1A 4W9DA 1R4MB 2AX5A 1FXTB 1ET9A 2MLBA 2JXTA 4HXDA 2HE7A 4MH8A 1KM7A 1I42A 1L0XB 3N1YC 3RMKC 2JUOA 4OVVA 4DXFA 1PGBA 1UZXB 3UI3A 1EWCA 3U8ZA 2GRIA 4R3DA 4FHJA 2EKIA 2KN4A 4MGKE 5BYSA 4DXGA 3AE9B 3IG3A 5IAAC 4W9IA 1WX8A 3VH4B 4BBNF 4N58A 5AZHA 4AQ7A 3QARA 3SU8X 1WRDB 2RGFA 4IC7B 1FFVA 1K51A 1N6ZA 3Q3MC 4IWOA 3R8BA 2V9HA 4HDQA 1YN3A 3ZW3A 5IKCM 2FIFA 2RD0A 3I3TB 3EGRA 2WWZA 2NVUI 1I4XA 3AU4A 4IOIE 1XLOA 1PYWD 2B3AA 1GG3A 3P42A 2VH1A 5D3IB 1WYGA 2ONQA 3A9JA 2H89B 1PFDA 1IPGA 2Y5PA 3A9KA 1Z2MA 2WP9B 3BVGA 1SIFA 2DNFA 4RGTA 2DHZA 1KTKA 2N9LA 3JSVA 2QMTA 1FPYA 1A5RA 3VAWA 1XO3A 1VCBA 1P0RA 4XWWA 2MJDA 1HTQA 1NBFC 1GPXA 3DDCB 5H8YE 5BMIA 1S3SG 3HVZA 2QCZA 1V1PB 3L08A 2BTEA 3OLMD 1D5MC 4CO7A 3QC8B 1JWSD 1J7AA 2INCC 2KTRA 3E56A 3O65B 5AUIA 4AOFA 3L4PA 3N9YC 1TKYA 1FNUA 2MX2A 4H2AA 1ZE3D 2EELA 2WXPA 1VJKA 1WH3A 3ML8A 1GC6A 4C7ZA 4PK1A 4BKGA 2IZVB 4K3BA 3PSEB 5C1ZA 3QAQA 1KLGD 4JL9A 3RNGC 1EUVB 2O6VD 4ASWC 2VZKD 4XGAB 3TL5A 1WZ3A 3EECA 5HKHA 1C4AA 4N59A 1ZP0B 3N20C 1E7VA 4MDKE 4J6IA 2BVCA 2BYFA 4GDKA 1EU3A 2RDGA 4WH4A 2KVRA 1Q0WB 2JX5A 1LGRA 3W5UB 3AE3B 2MWSB 4F7ZA 2W82A 3LB8C 5IOIA 5L95C 2BYEA 1FIQA 1UBIA 3ABVB 2K3UA 3A1QB 2KJRA 1YQ4B 2D3BA 2K25A 3NHEB 2N7JA 1IBXB 2JVCA 2LVQA 4K7SA 4TV3A 2FUG1 4S0RA 3H7SA 3HM3A 3P63A 2RPQA 3UINB 5CTRC 4L1BA 4G50A 4MJSB 3OG5A 1TS2A 1VR9A 1YN5A 4A3PA 2LRUA 3CF6E 4MSMB 1WM3A 3AI5A 2K8HA 5D94A 2KDMA 4MSQB 1H8CA 4FJVB 3CMMB 4IDIA 3JVZX 2ZCCA 2BKRB 3AV8A 1YOVB 1DYQA 4KGTA 3SD5A 1EF1A 4X57B 1WXMA 2C9WB 2L76A 2WX0A 2AWTA 2J0MA 1YJJA 3VRBB 4OZAA 2IY1B 2RR9A 1KJTA 1C4PA 4KX6B 1JW9D 1WY8A 3Q8BA 3TEZA 3ZGZA 2D3AA 1UWMA 3L54A 1B9RA 3R2IA 1F1HA 1FNWA 2MW5A 1VRAB 4B0EA 2JRIB 2LGSA 2IO1B 3PREA 3DBSA 4ARIA 2KX3A 3U2SC 2KFJA 2BF8B 1I4RA 3UQAA 5CHVC 4KV2A 4ZOHC 1JWBD 1CZPA 2N1VA 3RCZA 2HJ1A 5JHBA 3Q69A 2GBRA 1WZ0A 2G9HD 1SE2A 1SIJA 2QJLA 3Q6BA 5LXHA 4ZRKA 3SFEB 5JH5C 1F9JA 4YTNB 1I4GA 3DVGY 3PRZA 3MJWA 4ZYSA 2CU1A 1ACCA 1SEBD 1HZ5A 4JLCA 4YTPB 4JIOU 1PUTA 2BKFA 5T8IA 1FXAA 3VRAB 1G6JA 2YEPF 1V97A 4JWUC 4WWNA 1MHHE 3JSVB 3APFA 4DHZB 2V3SA 3DVGX 4KZCA 3RYTA 1WMHB 3ML9A 1IP9A 2J4XA 3VDZA 1SJHD 1QOBA 4YSYB 3IFWB 3C8YA 2NBVB 4GOCA 1T0YA 2L0FA 2EKEC 2L00B 2V3NA 3I57A 3SR6A 2MQJA 2UU7A 2ZCBA 1P7FA 3M62B 1AARA 1DOIA 4KVGB 3PZDA 1ZPSA 3DBHB 1OEYA 1L0YB 1F2RI 3AE4B 1V9JA 2WU2B 3W5VB 3HVDA 2JPHA 2UWQA 1V86A 4MEMA 2YEPB 1E8YA 3BZDB 3W2DA 1LQBA 1YQ3B 3VTWA 4B95A 2RMMA 2PJHA 2KZRA 1UD7A
chains in the Genus database with same CATH topology
3I5JC 3RNCC 1T0SC 3DHGC 1T0QC 3I63C 3N20C 4P1BC 3RNEC 3RN9C 3DHHC 3RNAC 3Q14C 3N1YC 3RMKC 3GE3C 3N1XC 2INCC 3GE8C 3RI7C 2RDBC 2INDC 1T0RC 3RNGC 3RNBC 3Q2AC 3N1ZC 3Q3OC 3DHIC 3Q3MC 3Q3NC 3RNFC 4P1CC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5J C;  3RNC C;  1T0S C;  3DHG C;  1T0Q C;  3I63 C;  3N20 C;  4P1B C;  3RNE C;  3RN9 C;  3DHH C;  3RNA C;  3Q14 C;  3N1Y C;  3RMK C;  3GE3 C;  3N1X C;  2INC C;  3GE8 C;  3RI7 C;  2RDB C;  2IND C;  1T0R C;  3RNG C;  3RNB C;  3Q2A C;  3N1Z C;  3Q3O C;  3DHI C;  3Q3M C;  3Q3N C;  3RNF C;  4P1C C; 
#chains in the Genus database with same CATH topology
 4C56 C;  2LGD A;  3AB5 A;  1ZUD 2;  3URY A;  1KRH A;  1KOT A;  1WX7 A;  2DZK A;  2L83 A;  1AW7 A;  1ZW7 A;  3K9O B;  1FO4 A;  1S1Q B;  3ZJT A;  3AE7 B;  5AZG A;  4HCN B;  3GOE A;  5BYQ A;  1WRI A;  2H88 B;  3KWV A;  4RCO A;  4M8N A;  4NZL B;  3DBR I;  4DHJ B;  2LWP A;  2C5L C;  2ZVN A;  3U30 A;  4MH0 E;  4EZJ A;  2UYZ B;  4IWQ A;  1XEE A;  3WAL A;  2DX5 B;  2BQQ A;  3M63 B;  2OJR A;  2ZZP B;  1FRD A;  2KDF B;  5TR5 A;  3GP7 A;  2K8B A;  4II3 B;  1EWY C;  2HJ8 A;  4ITK A;  2LI5 A;  1DOX A;  1NEK B;  1JWA D;  1SJE D;  2LVP A;  2KJH B;  1Q5W B;  3WIM A;  5E6O A;  2KNB A;  3FAH A;  3P4S B;  4YL8 A;  2VH2 A;  3IBE A;  3N1X C;  3VUX A;  2BS4 B;  3W1S A;  3AM9 A;  3Q3N C;  3P4Q B;  3RNF C;  2KKC A;  2MP2 A;  1V1P A;  1T0S C;  5D7G A;  3Q8E A;  2HTM E;  4AWJ A;  2M17 A;  2MSE D;  5DPS A;  2KWU B;  5IN7 A;  2L05 A;  4PS7 A;  2KDI A;  2KC1 A;  1HXY D;  2WXI A;  1V1O A;  2FAZ A;  2R2O A;  2XN9 C;  1AYF A;  2PVG C;  3AEA B;  2D3G A;  2OOB B;  2KAJ A;  3DWM A;  1GJZ A;  1RLF A;  2W3S A;  2QSD A;  5BO4 B;  2L7R A;  4DK5 A;  1WF9 A;  2MRP A;  1F77 A;  4BKT A;  3HRD D;  1SF0 A;  1FEH A;  4HDO A;  4ZRP A;  2K22 A;  3NVW A;  3GZN B;  4KKI A;  2ASQ A;  1FXI A;  2A5U A;  1PGX A;  2IDY A;  4EOY A;  3RZF A;  3BK2 A;  4RGM A;  1FFU A;  2WXH A;  3APC A;  4M00 A;  4O1N A;  1NVI D;  1BXT A;  1XT9 B;  1TS5 A;  2BPS A;  4PYU A;  4HEA 1;  2IPK D;  1JRO A;  3KUC B;  3Q14 C;  2M19 A;  2V1Y A;  3TSS A;  3Q8A A;  1UGJ A;  1OTR B;  2KD0 A;  2BYT A;  1GNU A;  2KLC A;  3TUO A;  1ET6 A;  3RPF C;  2YVC A;  1XF5 L;  3VQI A;  2D2Q A;  2LD9 A;  3A1Q A;  3MHS D;  1XD3 B;  4REZ A;  2QIE B;  2N9X A;  1IBX A;  4P1B C;  3VXW A;  3KWL A;  2K39 A;  5CX3 A;  1I4Q A;  3AN1 A;  3AUL A;  2D11 A;  2L1A A;  2ZW0 A;  4WJO A;  2PTL A;  1N60 A;  4MJS A;  2LJ5 A;  3M3J A;  3HIZ A;  1JML A;  3PRP B;  3K9P B;  3ZNZ B;  4G11 A;  4W9K A;  2WXM A;  3MC8 A;  2HD5 B;  3BYY B;  4B9K A;  3O13 A;  3VUW A;  4ZYN A;  3ENE A;  4P16 A;  4RF0 A;  3V61 A;  2WU5 B;  1HEZ E;  3MTN B;  4LK0 M;  3WAO A;  1R4M I;  3QCA A;  4HRS A;  1WXA A;  1WFY A;  4A8X C;  1R4N I;  3R2T A;  4D2K A;  2M8S A;  5KHO A;  2ZPN A;  1M94 A;  2LXC A;  4B0M A;  2MBO A;  3GE3 C;  1F0Z A;  1J7C A;  1EO6 A;  2MBH A;  2RDH A;  5AUK A;  3GE8 C;  2LGX A;  4WAA A;  2FCN A;  1N61 A;  4RH6 A;  3Q3O C;  2O6V B;  2YLM A;  5L83 A;  5DPW A;  2VZK B;  4FUL A;  5C23 A;  2Z8L A;  3P4R B;  1I35 A;  2JZP A;  2W9N A;  2FNJ B;  4FN2 A;  3CST A;  4KIK B;  3ZXR A;  2DWQ A;  3DHH C;  1ZXH A;  3L13 A;  4KDL B;  2W55 A;  1WJN A;  4XC2 A;  2KAC A;  3RI7 C;  3X23 A;  4WJQ A;  2AQ3 B;  3MP9 A;  3AXC A;  2BT6 A;  4IWP A;  2Z0D B;  3DVN U;  3NS1 A;  2OHF A;  4LLG M;  3U7D A;  1C4C A;  4ACF A;  1HA5 A;  1SE9 A;  2IGH A;  2KDB A;  1VZ7 A;  3ZXV A;  4RM8 A;  1QLB B;  5J2R A;  1T6B X;  1C79 A;  3RT3 B;  1WMH A;  1TIF A;  4WWP A;  1WJU A;  2D3C A;  1Q1O A;  4BFR A;  3H9D A;  4F1S A;  2X8X X;  2BB6 A;  1WIA A;  4K7U A;  1YMH E;  2GLS A;  1QZE A;  2AQ1 B;  2IGD A;  1K52 A;  2MP2 B;  4J3O D;  3V6C B;  2GBN A;  1CJE A;  1V6E A;  5J17 A;  2GMI C;  1YJI A;  3PZ7 A;  3VUY A;  1YX6 B;  1D4B A;  1YN4 A;  1V80 A;  3U52 E;  5AEK B;  1V2Y A;  2NS5 A;  3ETR A;  2G4S A;  2K6D B;  1AWD A;  3KW5 B;  3RN9 C;  4YTM B;  1FM0 D;  3UIO B;  2HDE A;  2C7M B;  1BT0 A;  4DDI D;  2AL6 A;  4GIV A;  3ZNG C;  2DYO A;  2KWC A;  2O2V A;  3EFU A;  4NAW B;  4DBG A;  3V60 A;  1E7P B;  2DYM A;  1RWS A;  3W9C B;  4NQL B;  1WM2 A;  3V6E B;  1UGM A;  2ON8 A;  3PLV A;  3VR9 B;  2BWF A;  3B2G A;  4US9 A;  3ZTC A;  1CQV A;  2KXJ A;  3AE1 B;  4XX5 A;  4BVU C;  3HM6 X;  2PE6 B;  4P6V F;  1UUP A;  1SXT A;  2L3Z A;  4MEL A;  3VFK A;  1WJ6 A;  4IG7 B;  3IT4 B;  3TIX A;  2J53 A;  2QC8 A;  2I1K A;  1F52 A;  2C60 A;  1P98 A;  3MFG A;  3BVZ A;  4EFO A;  4BAX A;  2MHJ A;  4ZHO A;  2Q5W D;  4WAF A;  4P7I A;  1WXS A;  2AYO B;  4E3C A;  2LFI A;  4HK2 A;  1V49 A;  5JXV A;  2DZI A;  2V4I B;  1NYR A;  4WUR A;  3RZW C;  2FCQ A;  2ZVO A;  4JWS C;  5FR6 A;  3PV1 A;  5LNK 1;  1NI3 A;  1UF0 A;  4HWI B;  4LNK A;  3ALB A;  3V05 A;  2WXF A;  1QKZ A;  3S2A A;  2KYW A;  2I38 A;  5E6P A;  4W9C A;  4W9J A;  5EE0 A;  4CHK A;  1T0Q C;  5E6N A;  2REX A;  4GGQ A;  1L6V A;  1T5X D;  5LLI A;  4A6Q A;  5EE9 A;  4AS1 A;  1J19 A;  4KGR A;  2N0S B;  1RFA A;  5FK9 C;  2KMM A;  3OAW A;  2XEW A;  3PHW B;  2IND C;  4USA A;  2KMA A;  5EE3 A;  1CK1 A;  2FUH B;  4ZRQ A;  4BBN C;  4W9H A;  3I5J C;  4K7W A;  4HJG E;  4MGY E;  3W1S C;  3IXS A;  4OHJ A;  3NJT A;  1TGZ B;  2MBQ A;  2NTS A;  3BIN A;  2WXR A;  1EU4 A;  4TSS A;  2FCS A;  5TSS A;  1XQQ A;  2BW2 A;  3R3M A;  4BKS D;  3CWI A;  1WGR A;  5DPT A;  1E0Z A;  4PT5 A;  4ZHP A;  4ICU A;  1CMX B;  1PDX A;  2V4L A;  3CSF A;  3H8H A;  4HPL B;  4IW0 A;  2A4Z A;  3AEF B;  3OJ3 A;  2KHW B;  2QIL A;  1MI0 A;  1IGC A;  4DWF A;  3PS6 A;  4M0W A;  2XBB C;  2KVZ A;  2V0G A;  2K6Q A;  3L17 A;  4LNI A;  3DOW A;  3PRM B;  2IO0 B;  3N1Z C;  1SGH A;  3AE8 B;  1NEN B;  1MFW A;  4P1C C;  4E74 A;  3ZKJ C;  5LXI B;  2JY6 A;  2WQY B;  1WWT A;  2DLB A;  2INN E;  1C9F A;  4BOS C;  2WXK A;  3H1U A;  3NZS A;  5C2T B;  1QF6 A;  2LUM A;  4GXB A;  3DBL B;  3NVZ A;  2EMT A;  2L8J A;  3WAP A;  2ZW1 A;  2R2Q A;  4ANV A;  3UF8 A;  2DAF A;  2K9X A;  4L2Y A;  5IO9 A;  2DZM A;  2LAS A;  2Y5B B;  5JHA A;  2DEN B;  2BS3 B;  1E10 A;  1E8W A;  5FR3 A;  4A55 A;  2W3R A;  4OVU A;  2KC2 A;  2K8C A;  3X0W A;  3DBH I;  2IY0 B;  2WNM A;  2N9K A;  1MPE A;  1ZGU B;  1I7H A;  5G55 A;  2O2V B;  3QX1 A;  4EUT A;  2DBY A;  3SEB A;  2JU6 X;  1YX5 B;  1WXV A;  1LO5 D;  1JCK B;  4HRO A;  1A70 A;  4TKN A;  1N63 A;  2WXJ A;  1ZXI A;  4GB9 A;  2PKO A;  1VZ8 A;  2O6V A;  2NTT A;  3LJ3 A;  4ZDV A;  1P7E A;  1V5T A;  2CHX A;  1E9M A;  1XXG A;  2OED A;  4FA6 A;  3WAM A;  1GAQ B;  4LDT D;  1TZO A;  4KIK A;  4CQN A;  1T3Q A;  1PQS A;  3TBL D;  2B76 B;  3KYC D;  1IUE A;  5GMV A;  4IM3 A;  2N7E A;  3QWZ B;  4K81 A;  2D5G A;  4ZRI A;  3IVF A;  4EE2 A;  1WI0 A;  4URK A;  4FJZ A;  1WE7 A;  2AEH A;  2GB1 A;  2KAN A;  1FD6 A;  3NVV A;  5FKA C;  1N5X A;  3APD A;  2MA9 B;  3RUL A;  1VLB A;  2GOW A;  3PPA A;  2CS4 A;  1RYJ A;  1TJE A;  2KN5 A;  2Z0E B;  3VTV A;  2M1M A;  2PPH A;  1J8C A;  2GI9 A;  3MC9 A;  5BMH A;  4L23 A;  2BS2 B;  2M56 B;  3KQ4 A;  1MG8 A;  1DOY A;  1FCC C;  4A20 A;  1C76 A;  5G2N A;  4AJW A;  2AQ2 B;  3RFZ B;  4YT0 B;  1NI2 A;  1SBB B;  4MM3 B;  4NPN A;  2PLP A;  2KQS A;  1FCL A;  3A4S C;  1VZ6 A;  3A33 B;  1E8X A;  4PS3 A;  1U4A A;  1N5W A;  2ZEQ A;  2G3Q B;  4GLS C;  3BYT B;  2WXN A;  4HKZ E;  2CU3 A;  3PZ8 A;  3ZJV A;  4PYZ A;  2JYE A;  5IA7 A;  2LGI A;  1VDV A;  3Q8C A;  2ZPY A;  1GC7 A;  4DDG D;  2JXX A;  2KOX A;  2N4F A;  3NUH B;  5D6J B;  1F2R C;  5DPR A;  4BOZ B;  2K5P A;  3VVW B;  4NAW A;  2MEK A;  1WGD A;  2C7N B;  1TKG A;  4W9G A;  1RM6 C;  1E8Z A;  2LUE A;  4ANX A;  3Q3J A;  1L7Y A;  3GZN I;  4FJY A;  2M0X A;  2ZNV C;  4FHK A;  2IBI B;  5MPO A;  4M0W B;  2LZ6 A;  4KDI C;  1P3Q U;  3WAN A;  2KFK A;  1MJD A;  2JZZ A;  1TY0 A;  3VH3 B;  1UWX A;  1OQR A;  2JQR B;  2NCN A;  1WJ4 A;  2JWZ A;  3Q8F A;  1ENF A;  1SSN A;  2I1J A;  4G0N B;  3P4P B;  4JE3 B;  1ZOY B;  4K3C A;  3ZRC A;  4XDD A;  2KT7 A;  3ZUN A;  2BBC A;  2LMC A;  2E6X A;  4OVZ A;  2MH7 A;  2JWU A;  2G1E A;  3RNC C;  5H92 C;  2J0J A;  1TS3 A;  1TKE A;  4IUM B;  1IGD A;  2KX0 A;  4US8 A;  1KF6 B;  1TYG B;  1JQ4 A;  1TTN A;  2IO3 B;  1ESF A;  3MJ5 A;  1XLP A;  2KQ4 X;  2D07 B;  1C3T A;  3H7P B;  4GDL B;  4XE0 A;  2CJN A;  3ZO5 B;  3ZTD A;  2MJE A;  2JRH A;  1I4H A;  1NYQ A;  3RUI B;  4A90 A;  1YD8 U;  1R4N B;  2JZ3 B;  3RD2 A;  1JWM D;  3V62 A;  3KLS X;  4IM2 A;  1GUA B;  1TZ1 A;  1WGG A;  2LHE A;  4WJN A;  1E7U A;  1XCQ L;  2KMC A;  4GN1 A;  3T3N A;  1TT5 B;  3LXF A;  2DZJ A;  1D6E C;  3SHQ A;  2K1F A;  4GU2 A;  3D32 A;  3QK0 A;  4RFB A;  2PVO D;  4XYC A;  1IYF A;  4JX1 C;  4GSW A;  4HPM B;  1K50 A;  2WGS A;  1E5W A;  2IGG A;  4DHZ E;  4LNF A;  4LTU A;  1GB4 A;  1OEY J;  1EM7 A;  1QIL A;  1L4D B;  3B0A A;  4ANW A;  1L2N A;  1FRR A;  3EUB 2;  5DCN A;  2PEA A;  3PTF C;  1RFK A;  1E90 A;  1QOG A;  3AE5 B;  3RNA C;  3ZNH B;  3OJ4 B;  1QT9 A;  3ECI A;  2LHD A;  4N9F 4;  4W9L A;  3QJZ A;  4KSL C;  4C4V B;  4TMA B;  3KUD B;  3AE2 B;  1D5Z C;  3EFC A;  3QA8 A;  3FIL B;  1J7B A;  1RRB A;  4EZK A;  1EF5 A;  4JQW C;  4EKU A;  3TMP B;  1ZDX A;  2WDR B;  3U7Z A;  1OGW A;  1ZDV A;  2N7D A;  2WDT B;  4MAC A;  1WGY A;  4MT5 A;  4NJ7 A;  3P1M A;  4YWG G;  2LEK A;  4WIP A;  3ZJU A;  1B1Z A;  2TSS A;  2WXO A;  4MGZ E;  2NR2 A;  3VR8 B;  2ZJD A;  2IO2 B;  4GMV A;  5C3J B;  3UQB A;  3CIR B;  4RF1 A;  3T3O A;  2WX1 A;  3R66 C;  2WHI A;  1L0V B;  2CR5 A;  2KQ7 A;  4HLE A;  3ZLZ A;  3IHP C;  1ISN A;  1GB1 A;  3NS8 A;  3ONS A;  2C7H A;  1UEL A;  2NBW B;  4G3X B;  1T0R C;  1RAX A;  4HJK A;  5KHQ A;  3B1L X;  5EDS A;  2WLB A;  2ACZ B;  1E6E B;  3H6N A;  4LCD E;  3QIJ A;  4AP4 C;  1D5X C;  3UIP B;  2L32 A;  5G5H A;  1WXQ A;  3VTU A;  3L0W B;  3ZNI D;  1DGJ A;  2DYB A;  3ZRF A;  2GBK A;  2PMV A;  3NOB A;  1KH0 A;  2NPT B;  2WDQ B;  3AE6 B;  1SE4 A;  4MGI E;  4Q2J A;  1QOA A;  4AUQ C;  4A9A A;  2KFK B;  1WGK A;  1WYW B;  2Y5C A;  2N9P C;  4DXA B;  2FID A;  3GB1 A;  2XK5 B;  2PE9 A;  3ZYY X;  5GXG B;  4WWO A;  2GBM A;  3WCQ A;  4WQO B;  4YSX B;  4AJY B;  3HUI A;  4BZA A;  4I6L B;  4WQM A;  1FNV A;  1XLQ A;  2KJ6 A;  3PVL A;  1YQB A;  1WE6 A;  1BUI C;  1JAL A;  3I63 C;  2L52 A;  3RNE C;  1YNT E;  4I6P A;  1NDD A;  2ICI A;  2MBE A;  2HTH A;  2J52 A;  1LM8 B;  3DPD A;  2WXQ A;  1JRU A;  3PT2 B;  1KLV A;  1BML C;  2NBU A;  2N1W A;  3AED B;  3BVM A;  4HPP A;  4ANU A;  4WWM A;  3Q3F A;  4RGO S;  1WR6 E;  4MM3 A;  3J9C A;  1N62 A;  2X38 A;  2E3T A;  2W54 A;  4NJ6 A;  3N30 A;  3QHT A;  4LNN A;  4OW0 A;  3V3X A;  4I6N B;  5D2M B;  2AL3 A;  3AEC B;  1WGH A;  3JYU A;  3PHX B;  2IYD B;  2D10 A;  1MHX A;  3NG0 A;  1JWU D;  2INP E;  2KTF A;  2V3P A;  3VHT C;  2JF5 A;  4M02 A;  3EC8 A;  3JW0 X;  4FBJ B;  1XCT L;  3L10 B;  2EMS A;  4ARC A;  2BWE S;  2PW9 A;  2JYT A;  3DHI C;  4KZ0 A;  2KO3 A;  4N6E B;  3BII D;  2KWV B;  3B9J A;  1JRP A;  3ZVV A;  3QQ8 B;  3NZ3 A;  3WA0 A;  4KGS A;  4LDT B;  3TEW A;  3AU5 A;  4NAM A;  4NJC A;  1HE8 A;  4YSZ B;  1WR1 A;  3ZDT A;  1AN8 A;  3A9J B;  4B6W A;  3A9K B;  1ROE A;  2GBJ A;  4S17 A;  3IAS 1;  3L16 A;  2CHW A;  4OZC A;  4M01 A;  3W1Y A;  2IJ0 A;  5G5G A;  2R61 A;  4NQK E;  1V81 A;  1P1A A;  4ZRJ A;  1X1M A;  4PS8 A;  3R7R A;  2KLG A;  1MVK A;  1H4R A;  3DCG A;  5AZF A;  1HTO A;  3TEX A;  1HQR D;  3HK0 A;  2BGF A;  4KKJ A;  2K0P A;  2RSU A;  5IP4 D;  4FXC A;  1STE A;  1R7S A;  3DQV A;  3DBL I;  1P9D U;  1OQQ A;  2M0A A;  3B2F A;  3NY5 A;  4YXD B;  3N3K B;  1QOF A;  3I9V 1;  3TJP A;  5BMG A;  4M8M A;  2KTR B;  1OQY A;  4W9F A;  3SFD B;  1ZKH A;  3H7P A;  4GDL A;  5I4D A;  2LXA A;  4JGH B;  4CYE A;  4IKG A;  4RM9 A;  2BYV E;  2ZNV B;  3FC4 A;  4C80 A;  1GOZ A;  2J0K A;  1V8C A;  2SAK A;  3GS2 A;  3TEY A;  4RGN A;  2Y3A A;  1UNS A;  2QDF A;  2WXL A;  3AEB B;  2I2Y A;  4OZB A;  2BB5 A;  3LYY A;  3MC0 B;  3NVY A;  2FBW B;  2PIA A;  3AH7 A;  2WXG A;  4QAY A;  2KWD A;  2G4D B;  4LJO B;  4HKQ A;  1KLU D;  3DBR B;  4GDK B;  4NY0 A;  5HHD G;  2MJ3 A;  1Y56 A;  2RPV A;  2XNA C;  4XDC A;  5JZE B;  3RNB C;  2KK8 A;  1J0G A;  4JPS A;  1XLN A;  3C19 A;  1WSP A;  1L4Z B;  3R7Q A;  5HI1 A;  1K53 A;  3DHG C;  4IM0 A;  4TUU A;  4FAD A;  2KDE B;  3PGE A;  3KVF B;  3BY4 B;  5CHF A;  1V5O A;  1FMA D;  3AEG B;  1Y8R C;  4E71 A;  1TS4 A;  3KUZ A;  1MG4 A;  2CKH B;  4F8C B;  3NRZ A;  4C4V A;  3FIL A;  4TQ1 A;  5HFY A;  2FE8 A;  2MCN B;  5J18 A;  2M4N A;  1D3Z A;  3FKY A;  4LNO A;  1M4V A;  2WYQ A;  2NMQ A;  3AEE B;  3E9S A;  2RDB C;  1K8R B;  3B08 A;  4XZ4 A;  3DWG C;  1L6U A;  2VRR B;  3ZIM A;  2QEJ C;  3EA6 A;  1Z5S B;  3KYD D;  3PLU A;  1UH6 A;  2QHO A;  2JT4 B;  5CHW A;  2DAJ A;  3T9L A;  2N9E B;  2L0T A;  4A3O A;  1TY2 A;  5EE1 A;  1UBQ A;  5E6J A;  3Q2A C;  1QQR A;  3OWE B;  3MHZ A;  3ZDM C;  3U4E G;  3N32 A;  2WS3 B;  5D3D A;  4EZL A;  2LGY A;  1Q10 A;  1TBE A;  1SB3 C;  4C00 A;  2CHZ A;  2LRW A;  4RNA A;  3T8M A;  1LXD A;  2NPT A;  3C0R B;  4NNJ B;  3BK1 A;  2SEB D;  3HHM A;  4K1R B;  4BKS A;  4W9E A;  3AMZ A;  4RMA A;  1C1Y B;  1WX9 A;  4FLH A;  4LJP B;  1YIW A;  1I4P A;  3IT6 B;  4EEW A;  1KFY B;  4DQO C;  4DHJ D;  1SE3 A;  3IAM 1;  2WDV B;  1HZ6 A;  3KH0 A;  2MBB B;  2JSV X;  3SDL C;  2XK5 A;  2G45 B;  2Z59 B;  3LDZ E;  3NZU A;  3M95 A;  3A4R A;  3EHV A;  4II2 B;  1C78 A;  4XWT A;  2J42 A;  2LJI A;  4UDU C;  1PGA A;  4KSK C;  1C77 A;  1VD2 A;  3UGB B;  4TQ0 A;  2OJW A;  5HG2 A;  2CJO A;  3P2B A;  4HCP B;  5BYR A;  3TCA A;  1L5P A;  4HVB A;  1OFF A;  3DVN V;  3ZQ4 A;  3BWU D;  4C7Y A;  1LFD A;  2J7Q B;  4ICV A;  3PO0 A;  4WJP A;  2FCM A;  2LVO A;  1YJ1 A;  4W9D A;  1R4M B;  2AX5 A;  1FXT B;  1ET9 A;  2MLB A;  2JXT A;  4HXD A;  2HE7 A;  4MH8 A;  1KM7 A;  1I42 A;  1L0X B;  3N1Y C;  3RMK C;  2JUO A;  4OVV A;  4DXF A;  1PGB A;  1UZX B;  3UI3 A;  1EWC A;  3U8Z A;  2GRI A;  4R3D A;  4FHJ A;  2EKI A;  2KN4 A;  4MGK E;  5BYS A;  4DXG A;  3AE9 B;  3IG3 A;  5IAA C;  4W9I A;  1WX8 A;  3VH4 B;  4BBN F;  4N58 A;  5AZH A;  4AQ7 A;  3QAR A;  3SU8 X;  1WRD B;  2RGF A;  4IC7 B;  1FFV A;  1K51 A;  1N6Z A;  3Q3M C;  4IWO A;  3R8B A;  2V9H A;  4HDQ A;  1YN3 A;  3ZW3 A;  5IKC M;  2FIF A;  2RD0 A;  3I3T B;  3EGR A;  2WWZ A;  2NVU I;  1I4X A;  3AU4 A;  4IOI E;  1XLO A;  1PYW D;  2B3A A;  1GG3 A;  3P42 A;  2VH1 A;  5D3I B;  1WYG A;  2ONQ A;  3A9J A;  2H89 B;  1PFD A;  1IPG A;  2Y5P A;  3A9K A;  1Z2M A;  2WP9 B;  3BVG A;  1SIF A;  2DNF A;  4RGT A;  2DHZ A;  1KTK A;  2N9L A;  3JSV A;  2QMT A;  1FPY A;  1A5R A;  3VAW A;  1XO3 A;  1VCB A;  1P0R A;  4XWW A;  2MJD A;  1HTQ A;  1NBF C;  1GPX A;  3DDC B;  5H8Y E;  5BMI A;  1S3S G;  3HVZ A;  2QCZ A;  1V1P B;  3L08 A;  2BTE A;  3OLM D;  1D5M C;  4CO7 A;  3QC8 B;  1JWS D;  1J7A A;  2INC C;  2KTR A;  3E56 A;  3O65 B;  5AUI A;  4AOF A;  3L4P A;  3N9Y C;  1TKY A;  1FNU A;  2MX2 A;  4H2A A;  1ZE3 D;  2EEL A;  2WXP A;  1VJK A;  1WH3 A;  3ML8 A;  1GC6 A;  4C7Z A;  4PK1 A;  4BKG A;  2IZV B;  4K3B A;  3PSE B;  5C1Z A;  3QAQ A;  1KLG D;  4JL9 A;  3RNG C;  1EUV B;  2O6V D;  4ASW C;  2VZK D;  4XGA B;  3TL5 A;  1WZ3 A;  3EEC A;  5HKH A;  1C4A A;  4N59 A;  1ZP0 B;  3N20 C;  1E7V A;  4MDK E;  4J6I A;  2BVC A;  2BYF A;  4GDK A;  1EU3 A;  2RDG A;  4WH4 A;  2KVR A;  1Q0W B;  2JX5 A;  1LGR A;  3W5U B;  3AE3 B;  2MWS B;  4F7Z A;  2W82 A;  3LB8 C;  5IOI A;  5L95 C;  2BYE A;  1FIQ A;  1UBI A;  3ABV B;  2K3U A;  3A1Q B;  2KJR A;  1YQ4 B;  2D3B A;  2K25 A;  3NHE B;  2N7J A;  1IBX B;  2JVC A;  2LVQ A;  4K7S A;  4TV3 A;  2FUG 1;  4S0R A;  3H7S A;  3HM3 A;  3P63 A;  2RPQ A;  3UIN B;  5CTR C;  4L1B A;  4G50 A;  4MJS B;  3OG5 A;  1TS2 A;  1VR9 A;  1YN5 A;  4A3P A;  2LRU A;  3CF6 E;  4MSM B;  1WM3 A;  3AI5 A;  2K8H A;  5D94 A;  2KDM A;  4MSQ B;  1H8C A;  4FJV B;  3CMM B;  4IDI A;  3JVZ X;  2ZCC A;  2BKR B;  3AV8 A;  1YOV B;  1DYQ A;  4KGT A;  3SD5 A;  1EF1 A;  4X57 B;  1WXM A;  2C9W B;  2L76 A;  2WX0 A;  2AWT A;  2J0M A;  1YJJ A;  3VRB B;  4OZA A;  2IY1 B;  2RR9 A;  1KJT A;  1C4P A;  4KX6 B;  1JW9 D;  1WY8 A;  3Q8B A;  3TEZ A;  3ZGZ A;  2D3A A;  1UWM A;  3L54 A;  1B9R A;  3R2I A;  1F1H A;  1FNW A;  2MW5 A;  1VRA B;  4B0E A;  2JRI B;  2LGS A;  2IO1 B;  3PRE A;  3DBS A;  4ARI A;  2KX3 A;  3U2S C;  2KFJ A;  2BF8 B;  1I4R A;  3UQA A;  5CHV C;  4KV2 A;  4ZOH C;  1JWB D;  1CZP A;  2N1V A;  3RCZ A;  2HJ1 A;  5JHB A;  3Q69 A;  2GBR A;  1WZ0 A;  2G9H D;  1SE2 A;  1SIJ A;  2QJL A;  3Q6B A;  5LXH A;  4ZRK A;  3SFE B;  5JH5 C;  1F9J A;  4YTN B;  1I4G A;  3DVG Y;  3PRZ A;  3MJW A;  4ZYS A;  2CU1 A;  1ACC A;  1SEB D;  1HZ5 A;  4JLC A;  4YTP B;  4JIO U;  1PUT A;  2BKF A;  5T8I A;  1FXA A;  3VRA B;  1G6J A;  2YEP F;  1V97 A;  4JWU C;  4WWN A;  1MHH E;  3JSV B;  3APF A;  4DHZ B;  2V3S A;  3DVG X;  4KZC A;  3RYT A;  1WMH B;  3ML9 A;  1IP9 A;  2J4X A;  3VDZ A;  1SJH D;  1QOB A;  4YSY B;  3IFW B;  3C8Y A;  2NBV B;  4GOC A;  1T0Y A;  2L0F A;  2EKE C;  2L00 B;  2V3N A;  3I57 A;  3SR6 A;  2MQJ A;  2UU7 A;  2ZCB A;  1P7F A;  3M62 B;  1AAR A;  1DOI A;  4KVG B;  3PZD A;  1ZPS A;  3DBH B;  1OEY A;  1L0Y B;  1F2R I;  3AE4 B;  1V9J A;  2WU2 B;  3W5V B;  3HVD A;  2JPH A;  2UWQ A;  1V86 A;  4MEM A;  2YEP B;  1E8Y A;  3BZD B;  3W2D A;  1LQB A;  1YQ3 B;  3VTW A;  4B95 A;  2RMM A;  2PJH A;  2KZR A;  1UD7 A; 
#chains in the Genus database with same CATH homology
 3I5J C;  3RNC C;  1T0S C;  3DHG C;  1T0Q C;  3I63 C;  3N20 C;  4P1B C;  3RNE C;  3RN9 C;  3DHH C;  3RNA C;  3Q14 C;  3N1Y C;  3RMK C;  3GE3 C;  3N1X C;  2INC C;  3GE8 C;  3RI7 C;  2RDB C;  2IND C;  1T0R C;  3RNG C;  3RNB C;  3Q2A C;  3N1Z C;  3Q3O C;  3DHI C;  3Q3M C;  3Q3N C;  3RNF C;  4P1C C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...