3RNEC

Structure of the toluene/o-xylene monooxygenase hydroxylase t201s/i276e double mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracking a defined route for O2 migration in a dioxygen-activating diiron enzyme.
pubmed doi rcsb
source organism Pseudomonas sp. ox1
molecule tags Oxidoreductase
molecule keywords Toluene o-xylene monooxygenase component
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.-.-:
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rneC00
3RNGC 3I5JC 3DHGC 3RNBC 3Q3OC 3Q3MC 3N20C 3GE8C 4P1CC 4P1BC 3RMKC 3RNAC 3RN9C 3GE3C 1T0RC 3DHHC 3RNFC 3RNEC 3I63C 2INCC 1T0QC 2INDC 3N1ZC 3N1YC 3RNCC 1T0SC 2RDBC 3DHIC 3RI7C 3N1XC 3Q2AC 3Q3NC 3Q14C
chains in the Genus database with same CATH superfamily
3B0AA 3GOEA 3CF6E 4W9LA 5FKAC 5L95C 3BWUD 2VH1A 1XLNA 2KX3A 3ZJTA 1QT9A 4XWTA 1N61A 2N9PC 2WXQA 2KWCA 3KUZA 1MG8A 1HA5A 4ARCA 2K8HA 2J0JA 4NAWA 3A1QA 3EUB2 4G3XB 4GB9A 2CJOA 3QA8A 2BBCA 2D07B 3Q8CA 4WIPA 4M8NA 2KT7A 2QIEB 1PYWD 3AU5A 1E8XA 2IBIB 5JHAA 4J3OD 1E8ZA 4W9DA 4FN2A 1GB1A 1NI3A 2LRUA 4GDKB 5JHBA 2LRWA 2KMMA 4EOYA 1LO5D 4M02A 4BBNC 1L4DB 2FCMA 1E7VA 3H1UA 2KTRB 2MBHA 4KDIC 4A3PA 3UQAA 1WXVA 2OJRA 4LCDE 2ZJDA 4WH4A 1A70A 4BKGA 4WJNA 4W9CA 2NTTA 2WYQA 1MVKA 3DVGY 2RDBC 3Q3NC 2JQRB 1SIFA 4HCPB 1CK1A 4YSXB 3V62A 3EECA 2QDFA 2K5PA 4KKJA 1X1MA 5JH5C 1SE3A 2O6VB 1RRBA 3SU8X 1T0RC 1C4CA 2FCNA 4N59A 2BVCA 2IO2B 4ANVA 3ZYYX 3N1YC 4WAFA 3LYYA 1UBQA 3EC8A 2DBYA 3J9CA 2D11A 4FXCA 2W9NA 3TJPA 3DHGC 4IC7B 1F77A 3PGEA 1SGHA 1Q10A 3I3TB 5EE9A 1YD8U 1XD3B 1IUEA 2PJHA 3N30A 1T0QC 3MHSD 3K9PB 4TUUA 4MJSB 1Q0WB 2D3CA 4LNKA 1YQ3B 3PO0A 3W5UB 3N1XC 3Q2AC 3PLUA 1L0VB 3VUXA 1JALA 2N4FA 3V6CB 2M17A 3B2FA 2R2QA 2WXKA 3T9LA 5JZEB 2IYDB 1CJEA 4KGTA 2JZ3B 4IWOA 3P1MA 2GRIA 5KHQA 2MHJA 3IXSA 3P4PB 1KLVA 3I57A 2QILA 2GLSA 4WQMA 1EF1A 1SE4A 1MPEA 3DQVA 2DYOA 4NNJB 3PT2B 2G3QB 2K3UA 5L83A 1XQQA 4FHJA 1I42A 1ZOYB 2BWES 5BMIA 3A1QB 3JSVB 4DHZB 2MP2A 4NQKE 2IGHA 1JMLA 3KYDD 4C7ZA 2LGSA 2MP2B 3RZWC 2MRPA 1UWXA 2INPE 2MX2A 3C19A 2YEPF 2WXLA 1YJJA 1KFYB 2LVPA 2KDBA 3H7PA 3DHHC 4ITKA 3AM9A 3PRZA 4DXAB 3SHQA 3KQ4A 2INCC 3H7SA 4HDOA 1XO3A 2N7EA 2IO1B 3PHXB 3A9KB 5T8IA 5G2NA 3W1YA 1NBFC 3IBEA 1VDVA 4DWFA 3VR8B 1F2RC 1WE7A 2GI9A 3PREA 4DHJD 4WURA 1YN5A 1M4VA 3WAMA 3NVWA 4IKGA 2C7HA 4KVGB 1WXQA 3KH0A 4TMAB 2IPKD 3AEFB 1D5ZC 1VJKA 1FD6A 1KH0A 3AXCA 1R7SA 5D2MB 1B1ZA 1CQVA 3DHIC 3MP9A 5DPRA 3U52E 2QMTA 2Y5BB 3ENEA 2KWDA 1YNTE 1Y8RC 1P98A 2IO0B 3R66C 1FCCC 1VZ7A 3ECIA 2PEAA 4JGHB 4YSZB 3VH4B 1ZXIA 3AV8A 3R2IA 4HJKA 2HDEA 4KX6B 1FXIA 3A9JB 4DQOC 1FNWA 2DNFA 2V1YA 2ZVOA 4C4VB 4HKQA 2KFKA 4TSSA 4MSQB 4NAMA 3HK0A 2OJWA 1S3SG 5JXVA 2QEJC 4FLHA 4PS8A 4P1CC 5D6JB 2CJNA 3AE5B 3FKYA 2AX5A 4RMAA 3Q3FA 5DCNA 3U30A 1ZE3D 2WXGA 3BYYB 2WXOA 2LGIA 2ON8A 4IW0A 4E71A 2YEPB 2K8CA 2LVOA 1WY8A 4AJWA 3HIZA 4JWSC 3WAOA 1WH3A 2Z8LA 1ZP0B 4XWWA 4JLCA 4A9AA 3O65B 2KAJA 4US8A 3TIXA 2N9KA 5EDSA 2EMTA 2GOWA 2V0GA 2K1FA 3KW5B 3N1ZC 4AJYB 5BYRA 2NR2A 3GB1A 2G1EA 4II2B 4KZCA 1JRPA 3OWEB 3L16A 3R7QA 1UUPA 3MFGA 3PTFC 3P42A 2J53A 2JRIB 5BMHA 2QCZA 1EU3A 3CSFA 4GN1A 3RULA 1GPXA 2WU2B 1FCLA 1WGKA 1WJUA 4BKSA 2FNJB 1YN4A 1WX7A 1ZPSA 3B1LX 1FNUA 1C1YB 2L7RA 2LUEA 4HWIB 4K7UA 1VLBA 3RPFC 2DZKA 1C77A 2IO3B 4KIKA 1IGDA 4B0EA 1XF5L 3T3NA 1FIQA 1C76A 3GZNI 2WXRA 4LTUA 2DAFA 1A5RA 3B9JA 1ZW7A 2N9XA 3HVDA 3DVNV 4NAWB 1L6VA 1PGBA 1DOIA 3AECB 3WAPA 2RMMA 1HE8A 2K6QA 3T3OA 1ET6A 3L13A 2JU6X 3I5JC 1OFFA 2B76B 5I4DA 2NBUA 4E3CA 2D10A 1XCTL 4BOSC 2REXA 3X0WA 2MH7A 4ANUA 5GMVA 1UD7A 2KACA 1IPGA 4FJYA 2W55A 5BMGA 1ISNA 1SJHD 2INNE 2ZPNA 5EE1A 4FJVB 4P6VF 2L83A 4XDCA 1XCQL 1RLFA 2LUMA 1P3QU 4N9F4 4MGIE 4ACFA 2KVZA 3TUOA 4JPSA 3SFDB 3ZRCA 4YTPB 3DWMA 4LNIA 2GBRA 5H92C 5FK9C 2K6DB 2AQ1B 2R2OA 1PDXA 3V3XA 3PVLA 4C56C 1NYRA 1T0YA 3GE3C 1NDDA 2JYEA 1WGRA 3DCGA 3I63C 4M00A 4Q2JA 4W9HA 5FR3A 3R8BA 3RCZA 2KC1A 2KXJA 3V05A 1WWTA 1I4RA 2Z59B 2O2VA 1R4NB 2BF8B 4TQ0A 1V80A 3N9YC 2RPQA 3DBSA 1HQRD 2M8SA 2UYZB 3DBLI 1BMLC 3AE8B 1WIAA 4YL8A 2O6VA 1MG4A 4GMVA 4YTNB 4OZAA 2NBWB 1HTQA 1UELA 3DBHB 3IHPC 1KLUD 2NPTA 1MI0A 2Z0DB 4CO7A 1C3TA 3ZJVA 1E8WA 3DVNU 5E6OA 4LJPB 1HZ6A 2G9HD 1QF6A 2XK5B 4KSLC 3ZW3A 1ZXHA 4CQNA 2G45B 2KTRA 1KRHA 1RFKA 3KWVA 2LD9A 2CHXA 2Y5CA 2LFIA 1YN3A 3IG3A 3W2DA 3Q3OC 2KDFB 2D5GA 1FFVA 1I35A 3Q6BA 4WWMA 2AWTA 3VAWA 1E0ZA 2KD0A 3L0WB 4TQ1A 1V86A 1FFUA 3A4RA 3B2GA 3ZLZA 2E6XA 3ZQ4A 2L00B 1JW9D 1XEEA 4KV2A 4ZOHC 2KLGA 3ZTDA 3QK0A 1K51A 1SF0A 2PTLA 4M01A 4RGNA 3JYUA 2V3NA 2ACZB 3EHVA 4HXDA 2CU3A 2W82A 1QOGA 4HROA 3UI3A 4DXGA 4NPNA 3H7PB 3NG0A 1ZDXA 3GS2A 2WLBA 3APFA 2J0MA 3NY5A 2KC2A 3Q3MC 3GE8C 1VZ8A 2X38A 4II3B 3TEZA 2PLPA 1SBBB 1NVID 2W3RA 1GC7A 3SEBA 1VCBA 1DGJA 1UGMA 1NYQA 2RD0A 2JWZA 3ZDMC 4MGZE 2PE6B 5DPSA 3VRAB 3PLVA 4BOZB 3TL5A 3AU4A 2QC8A 4L2YA 2HD5B 4DXFA 4IWQA 4S17A 3FILB 1WYWB 3VH3B 4ZYSA 1XT9B 2FCSA 4LK0M 1YIWA 2DYBA 3W1SA 2MJ3A 1WRDB 4LDTD 4RGTA 1LXDA 4HCNB 2LGXA 2BYTA 4IG7B 2WXPA 1DOXA 1C9FA 4WWOA 3R7RA 4FHKA 1H4RA 2DZIA 3VUWA 5HG2A 1N6ZA 3HM6X 1F1HA 1NEKB 1UZXB 4XC2A 2J7QB 3VTWA 1FRRA 2LJ5A 2RDHA 1L4ZB 2BGFA 2DAJA 2MBQA 4JQWC 1OGWA 4BAXA 3KVFB 3P4RB 2IGDA 2NTSA 3PZDA 2R61A 2WXMA 3RYTA 4MSMB 2AEHA 2M0AA 1YQBA 2C5LC 4QAYA 3H8HA 2M1MA 1D6EC 4YT0B 4GU2A 4YWGG 4PYZA 3NVZA 2BWFA 3IT4B 2RGFA 1GUAB 2FE8A 2EMSA 1QQRA 2C7MB 4PS3A 1V6EA 2KJHB 2KMAA 1IBXA 3E9SA 4B9KA 3AE7B 4RM9A 2K9XA 2BYFA 2DENB 1ESFA 4ZRPA 4AUQC 1RFAA 3L08A 2PKOA 2M56B 1RAXA 2WGSA 4BVUC 1STEA 2O2VB 3KUDB 1WJ6A 1WGHA 2Y5PA 1QOFA 5J18A 3A9JA 4TV3A 2KN5A 1UF0A 2FCQA 4R3DA 1SE2A 3BK2A 3QIJA 1G6JA 2DLBA 3Q8AA 4DK5A 3MJWA 4JIOU 1C79A 3KWLA 1V8CA 2BYVE 3NOBA 1IBXB 2XK5A 5BYSA 2D3BA 2KOXA 2MCNB 3MJ5A 2E3TA 3EGRA 2PPHA 1TKYA 4ICUA 1WGGA 2DX5B 4GOCA 3MTNB 3TCAA 2IY0B 1IP9A 4NZLB 2BW2A 1PGXA 4XZ4A 5C1ZA 2KDIA 1SB3C 2JRHA 1TTNA 3V61A 1EU4A 1WGDA 2GB1A 4C80A 1P7FA 1AARA 4KZ0A 3B08A 4LLGM 1H8CA 5MPOA 4ZDVA 3NS1A 1JCKB 4OVUA 2JZPA 3RT3B 1PFDA 1TYGB 3X23A 3K9OB 4RGMA 2KDEB 1LGRA 4IDIA 2AL3A 4B6WA 1BT0A 3CSTA 1YJIA 2MWSB 4WAAA 2X8XX 2VRRB 3N32A 5AEKB 1VRAB 3QC8B 5LNK1 3ETRA 2LXCA 3TEYA 2JVCA 1FRDA 2AYOB 3P4QB 2Z0EB 2G4DB 1NI2A 4H2AA 2JPHA 4A8XC 2RSUA 4IWPA 2L76A 2N7DA 2ZNVB 2K8BA 1I4QA 1UWMA 4ZRJA 1EM7A 1C78A 1L0YB 1K8RB 3AEAB 4A3OA 1Q1OA 4MEMA 1WZ3A 3M62B 4MACA 4PS7A 1ENFA 2ZEQA 2ICIA 4K81A 4URKA 3WANA 1V1PA 3I9V1 3AEGB 1N60A 1WXAA 3ALBA 4GDLA 2ZVNA 4K1RB 2GBKA 2M4NA 4B0MA 1GAQB 3ZNID 2G4SA 1OQQA 1E90A 2V9HA 1QOAA 3D32A 5D94A 2IJ0A 2KFJA 5G5HA 2KKCA 3UIPB 1E6EB 4W9GA 1WGYA 2XNAC 1V49A 2DYMA 1KJTA 5BO4B 2KQ7A 3ZO5B 3PPAA 1OEYA 4F7ZA 5D3IB 3L10B 3AE9B 4W9KA 3UIOB 4CHKA 1UBIA 3AB5A 2PMVA 1J19A 3OJ3A 5EE3A 3C8YA 2YVCA 3Q8BA 2ONQA 1L2NA 4G0NB 2EELA 3NVYA 3DPDA 1PUTA 2JYTA 4LDTB 2WWZA 5TR5A 3AE3B 3MC8A 2MSED 3ZNGC 2I38A 1F52A 2KX0A 3U7ZA 4IM0A 1U4AA 4FULA 5AZHA 2BT6A 2C60A 3KYCD 2MLBA 2CU1A 1L5PA 2CR5A 2V3SA 2NVUI 2ZNVC 3NS8A 4G11A 4GSWA 2MBOA 5TSSA 1SSNA 3UQBA 3ZGZA 4W9FA 2IZVB 2PVOD 1FNVA 3VRBB 5CHWA 3AEEB 4ICVA 1EO6A 4A90A 3AEDB 2J52A 4ARIA 1D5XC 1OQRA 1WZ0A 3NHEB 2KZRA 1SE9A 3ZDTA 2MA9B 1CZPA 2PW9A 3WCQA 3EFUA 3VR9B 3NJTA 2XEWA 2K25A 2L32A 5CHVC 3RD2A 2V4IB 3NVVA 1PQSA 2LVQA 2W54A 3NUHB 1SIJA 2WP9B 3RNFC 4HK2A 3ZUNA 1F9JA 1TIFA 1V9JA 1GB4A 4W9JA 4C4VA 2JY6A 1WE6A 2KMCA 3W1SC 2LGYA 1LFDA 1JWBD 5IN7A 1P1AA 3U4EG 2CHWA 3P4SB 2V4LA 4PT5A 2ZPYA 4UDUC 1WFYA 4IOIE 3DBLB 3PSEB 3GZNB 1JWAD 5J2RA 2MQJA 3AULA 3URYA 2L3ZA 2WX0A 2WXJA 2KWUB 1OEYJ 2CHZA 3C0RB 2KDMA 5J17A 1UH6A 1V1PB 4FADA 1LM8B 3SD5A 5LXIB 5D3DA 3Q69A 1FM0D 1T6BX 4BFRA 4ZHPA 3RFZB 1S1QB 1TS4A 1WRIA 4KGRA 3M95A 3ML8A 2CKHB 3RUIB 1AWDA 1R4NI 1GC6A 1WYGA 3NRZA 1TBEA 3AE1B 1P7EA 5CTRC 3AH7A 2I1JA 3NZSA 2WQYB 2BQQA 1V5TA 4A20A 3HVZA 1TKEA 3MC9A 3ZIMA 3UGBB 2FUHB 2HE7A 1F0ZA 2L05A 4A55A 3VFKA 3WA0A 4J6IA 4HPPA 4GIVA 2KYWA 3BIID 5IAAC 1FEHA 4E74A 1WJ4A 3QX1A 2L8JA 1NENB 3AN1A 2FBWB 3BYTB 4XDDA 2BS3B 5AUIA 4AOFA 3JVZX 1YX5B 1AYFA 2IGGA 1Z2MA 5KHOA 2INDC 3H9DA 1KOTA 5DPTA 5IKCM 2LZ6A 4JE3B 4K7WA 5LLIA 2O6VD 4IM3A 2VZKD 3VXWA 1KF6B 2WXFA 1I4GA 3ABVB 3APCA 3RMKC 3WALA 3EA6A 1HZ5A 2VH2A 1EWCA 1MHXA 3CIRB 1ROEA 2BTEA 3U7DA 3VUYA 2KK8A 2Q5WD 3V60A 4MELA 4YTMB 3OLMD 3RZFA 1XXGA 2UWQA 2BS2B 1EWYC 1T3QA 2EKIA 1WXSA 2JXTA 3QAQA 4OVZA 3BVGA 2N7JA 5E6PA 2BYEA 2LXAA 1I4PA 2OHFA 4I6NB 2GBJA 4GXBA 1D3ZA 3OG5A 2JWUA 1Z5SB 2FUG1 2WNMA 3P63A 3W5VB 2W3SA 2BKRB 2AQ3B 5IO9A 2JZZA 5EE0A 5HKHA 3QARA 3IFWB 5IA7A 4OW0A 2QSDA 4MT5A 5AUKA 1WMHB 4DDGD 3ZRFA 1D4BA 5IOIA 4ZRQA 3PHWB 4AWJA 2NPTB 1ET9A 3TEXA 4RNAA 4DHZE 4W9IA 4HEA1 2MJEA 3LDZE 2JT4B 4LNOA 2N9EB 4IUMB 3RNEC 4EFOA 3Q8EA 3QCAA 1L6UA 1P0RA 4AQ7A 3R2TA 1YOVB 1WR6E 2NBVB 3HUIA 4EE2A 1TKGA 1RM6C 5CHFA 4BZAA 4KSKC 3H6NA 1XLQA 5C3JB 3ZXVA 2KLCA 1GJZA 4MGYE 4GDKA 5G5GA 4X57B 4BBNF 4WWPA 2BPSA 2PVGC 1E10A 1IGCA 1VD2A 2Y3AA 3BK1A 4ANWA 1QILA 2BS4B 1HXYD 1JWUD 3ZNHB 1WM3A 4JL9A 3L54A 1WSPA 1TGZB 1ZKHA 1N63A 3APDA 1YX6B 2UU7A 4N6EB 1K50A 3ZJUA 4WJQA 1YQ4B 3AEBB 1TS5A 4WJOA 4P7IA 5FR6A 1E5WA 4BKTA 5IP4D 1J8CA 1FXAA 2JX5A 4L23A 3Q14C 1R4MI 2LJIA 1I7HA 5HHDG 4RFBA 3T8MA 4ZYNA 1SEBD 2HTME 4GDLB 4ANXA 1OQYA 5HI1A 1N5XA 3U8ZA 3JSVA 1PGAA 4KIKB 2DZJA 2KANA 1JWSD 2N0SB 3DVGX 1YMHE 3PZ8A 4USAA 5BYQA 4TKNA 5AZFA 2MJDA 3ZTCA 4A6QA 3LXFA 1L0XB 1SXTA 1IYFA 4EZKA 1TT5B 1QKZA 2L1AA 1HEZE 3WIMA 4MJSA 5C2TB 2K22A 1VZ6A 1TY0A 4DDID 1ZUD2 2YLMA 3OJ4B 4D2KA 3SR6A 1ZGUB 4B95A 3NZUA 1V1OA 4HVBA 4FJZA 3M3JA 4NJ6A 3N20C 4MM3A 4PK1A 4S0RA 1J7CA 4KDLB 2K39A 2L0TA 2LMCA 3DWGC 4N58A 1FO4A 4XE0A 2JSVX 3AE6B 3RI7C 2LHDA 1J7AA 3RNGC 1OTRB 1SJED 2EKEC 3MC0B 4EZJA 4NJ7A 2WDVB 2NMQA 5LXHA 3QWZB 3FC4A 3V6EB 3CWIA 3GP7A 2RR9A 4RCOA 3LB8C 1N62A 2B3AA 4REZA 1ZDVA 2SEBD 1FMAD 2NCNA 4F8CB 1UNSA 5C23A 2WU5B 4W9EA 2DZMA 1FPYA 2KN4A 4KKIA 1J0GA 2AL6A 4O1NA 2PE9A 1WI0A 4KGSA 3VTUA 3BINA 4RGOS 3UF8A 3HRDD 3QQ8B 3QHTA 1TS2A 2KJ6A 1E7PB 3TBLD 2JXXA 2BKFA 4M0WA 1DOYA 2C7NB 3ZNZB 5G55A 1V97A 1YJ1A 3OAWA 3DOWA 3VQIA 2J42A 4MH8A 4EUTA 2GBNA 2QJLA 2PIAA 2MW5A 1JWMD 3IAM1 2DHZA 3U2SC 2K0PA 3L4PA 1TZ1A 2N1WA 4DBGA 1T5XD 3O13A 2ZCBA 1WF9A 2KWVB 1MJDA 1V5OA 2VZKB 2M0XA 4F1SA 3RNBC 3HHMA 4DHJB 3CMMB 3ZVVA 3EFCA 4HPLB 1F2RI 2I1KA 2I2YA 3HM3A 3SFEB 4FA6A 4I6LB 4PYUA 1RWSA 3BY4B 2KO3A 3A33B 3DBRI 1FXTB 2ZW0A 4NY0A 3RN9C 1QLBB 2N1VA 2D2QA 2SAKA 3VDZA 4MM3B 2CS4A 3BVZA 2KNBA 4OVVA 4G50A 1I4HA 3PZ7A 4OZCA 1UGJA 4I6PA 1EF5A 2H89B 2KFKB 2OEDA 2ZCCA 2LASA 5H8YE 4AS1A 4WWNA 2JUOA 2WDTB 4HLEA 1C4AA 2WDQB 1RYJA 4NQLB 4XX5A 1L7YA 3LJ3A 2XN9C 1Y56A 2L0FA 2WHIA 4RM8A 4P16A 2ZW1A 4OZBA 4XGAB 4YXDB 5D7GA 4L1BA 3PS6A 4HJGE 2D3GA 2MBEA 2WXHA 2KTFA 3TMPB 3AE4B 3FILA 2A5UA 1QZEA 3ONSA 4JX1C 4JWUC 2AQ2B 1E8YA 4K3CA 2GBMA 2JF5A 3PRPB 2L52A 4K3BA 1P9DU 4K7SA 3KLSX 4GLSC 1LQBA 4LNNA 5HFYA 2LHEA 2RPVA 3N3KB 4US9A 3PV1A 2V3PA 3ML9A 3ZXRA 3IT6B 4MH0E 3RNAC 4GGQA 3P2BA 4IM2A 1WMHA 1Q5WB 3AI5A 4MGKE 1K53A 4M0WB 1WJNA 4OHJA 2KQ4X 1GNUA 3S2AA 1JRUA 2WXIA 2BB6A 3SDLC 3ZKJC 2NS5A 3QJZA 1BXTA 3AE2B 1E9MA 3IAS1 5DPWA 2FIFA 3DBRB 3KUCB 4NJCA 2BB5A 4RF1A 2MEKA 1VR9A 3E56A 1TZOA 1WXMA 1WX9A 1E7UA 4BKSD 3A4SC 4ASWC 3VVWB 1WX8A 1HTOA 1TS3A 4M8MA 2XBBC 2HJ8A 2IY1B 1TJEA 1JROA 4EZLA 1TY2A 1K52A 1AN8A 4RF0A 4LNFA 1V81A 3W9CB 2LI5A 1QOBA 3RNCC 1KTKA 5CX3A 5E6NA 1KM7A 1BUIC 2HJ1A 1I4XA 3Q3JA 3BVMA 5AZGA 1JQ4A 2TSSA 4C00A 3TEWA 2ASQA 1MFWA 2OOBB 2WS3B 3BZDB 4ZRKA 3NZ3A 3R3MA 1R4MB 5E6JA 1T0SC 2WXNA 1XLOA 4C7YA 2D3AA 5GXGB 4XYCA 2J0KA 2GMIC 2IDYA 2QHOA 2ZZPB 1J7BA 1KLGD 2C9WB 1DYQA 3VTVA 4EEWA 4EKUA 4HDQA 3IVFA 3DBHI 3M63B 2KVRA 4AP4C 2KQSA 2M19A 1ACCA 2LGDA 4WJPA 2WDRB 3DDCB 4FBJB 2FIDA 2LEKA 4HKZE 1GOZA 1D5MC 2LWPA 2FAZA 3Q8FA 4YSYB 1M94A 2N9LA 4RH6A 2KHWB 1C4PA 2WX1A 3L17A 1N5WA 1WR1A 3VHTC 1MHHE 1XLPA 4MDKE 3PRMB 4HRSA 4HPMB 1WM2A 3JW0X 4P1BC 2J4XA 1EUVB 2MBBB 1AW7A 3FAHA 3TSSA 4ZHOA 1B9RA 4WQOB 3A9KA 2H88B 4LJOB 2HTHA 3MHZA 4CYEA 1GG3A 3UINB 1V2YA 2A4ZA 4ZRIA 1CMXB 2KJRA 2DWQA 2RDGA 3AMZA
chains in the Genus database with same CATH topology
3RNGC 3I5JC 3DHGC 3RNBC 3Q3OC 3Q3MC 3N20C 3GE8C 4P1CC 4P1BC 3RMKC 3RNAC 3RN9C 3GE3C 1T0RC 3DHHC 3RNFC 3RNEC 3I63C 2INCC 1T0QC 2INDC 3N1ZC 3N1YC 3RNCC 1T0SC 2RDBC 3DHIC 3RI7C 3N1XC 3Q2AC 3Q3NC 3Q14C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNG C;  3I5J C;  3DHG C;  3RNB C;  3Q3O C;  3Q3M C;  3N20 C;  3GE8 C;  4P1C C;  4P1B C;  3RMK C;  3RNA C;  3RN9 C;  3GE3 C;  1T0R C;  3DHH C;  3RNF C;  3RNE C;  3I63 C;  2INC C;  1T0Q C;  2IND C;  3N1Z C;  3N1Y C;  3RNC C;  1T0S C;  2RDB C;  3DHI C;  3RI7 C;  3N1X C;  3Q2A C;  3Q3N C;  3Q14 C; 
#chains in the Genus database with same CATH topology
 3B0A A;  3GOE A;  3CF6 E;  4W9L A;  5FKA C;  5L95 C;  3BWU D;  2VH1 A;  1XLN A;  2KX3 A;  3ZJT A;  1QT9 A;  4XWT A;  1N61 A;  2N9P C;  2WXQ A;  2KWC A;  3KUZ A;  1MG8 A;  1HA5 A;  4ARC A;  2K8H A;  2J0J A;  4NAW A;  3A1Q A;  3EUB 2;  4G3X B;  4GB9 A;  2CJO A;  3QA8 A;  2BBC A;  2D07 B;  3Q8C A;  4WIP A;  4M8N A;  2KT7 A;  2QIE B;  1PYW D;  3AU5 A;  1E8X A;  2IBI B;  5JHA A;  4J3O D;  1E8Z A;  4W9D A;  4FN2 A;  1GB1 A;  1NI3 A;  2LRU A;  4GDK B;  5JHB A;  2LRW A;  2KMM A;  4EOY A;  1LO5 D;  4M02 A;  4BBN C;  1L4D B;  2FCM A;  1E7V A;  3H1U A;  2KTR B;  2MBH A;  4KDI C;  4A3P A;  3UQA A;  1WXV A;  2OJR A;  4LCD E;  2ZJD A;  4WH4 A;  1A70 A;  4BKG A;  4WJN A;  4W9C A;  2NTT A;  2WYQ A;  1MVK A;  3DVG Y;  2RDB C;  3Q3N C;  2JQR B;  1SIF A;  4HCP B;  1CK1 A;  4YSX B;  3V62 A;  3EEC A;  2QDF A;  2K5P A;  4KKJ A;  1X1M A;  5JH5 C;  1SE3 A;  2O6V B;  1RRB A;  3SU8 X;  1T0R C;  1C4C A;  2FCN A;  4N59 A;  2BVC A;  2IO2 B;  4ANV A;  3ZYY X;  3N1Y C;  4WAF A;  3LYY A;  1UBQ A;  3EC8 A;  2DBY A;  3J9C A;  2D11 A;  4FXC A;  2W9N A;  3TJP A;  3DHG C;  4IC7 B;  1F77 A;  3PGE A;  1SGH A;  1Q10 A;  3I3T B;  5EE9 A;  1YD8 U;  1XD3 B;  1IUE A;  2PJH A;  3N30 A;  1T0Q C;  3MHS D;  3K9P B;  4TUU A;  4MJS B;  1Q0W B;  2D3C A;  4LNK A;  1YQ3 B;  3PO0 A;  3W5U B;  3N1X C;  3Q2A C;  3PLU A;  1L0V B;  3VUX A;  1JAL A;  2N4F A;  3V6C B;  2M17 A;  3B2F A;  2R2Q A;  2WXK A;  3T9L A;  5JZE B;  2IYD B;  1CJE A;  4KGT A;  2JZ3 B;  4IWO A;  3P1M A;  2GRI A;  5KHQ A;  2MHJ A;  3IXS A;  3P4P B;  1KLV A;  3I57 A;  2QIL A;  2GLS A;  4WQM A;  1EF1 A;  1SE4 A;  1MPE A;  3DQV A;  2DYO A;  4NNJ B;  3PT2 B;  2G3Q B;  2K3U A;  5L83 A;  1XQQ A;  4FHJ A;  1I42 A;  1ZOY B;  2BWE S;  5BMI A;  3A1Q B;  3JSV B;  4DHZ B;  2MP2 A;  4NQK E;  2IGH A;  1JML A;  3KYD D;  4C7Z A;  2LGS A;  2MP2 B;  3RZW C;  2MRP A;  1UWX A;  2INP E;  2MX2 A;  3C19 A;  2YEP F;  2WXL A;  1YJJ A;  1KFY B;  2LVP A;  2KDB A;  3H7P A;  3DHH C;  4ITK A;  3AM9 A;  3PRZ A;  4DXA B;  3SHQ A;  3KQ4 A;  2INC C;  3H7S A;  4HDO A;  1XO3 A;  2N7E A;  2IO1 B;  3PHX B;  3A9K B;  5T8I A;  5G2N A;  3W1Y A;  1NBF C;  3IBE A;  1VDV A;  4DWF A;  3VR8 B;  1F2R C;  1WE7 A;  2GI9 A;  3PRE A;  4DHJ D;  4WUR A;  1YN5 A;  1M4V A;  3WAM A;  3NVW A;  4IKG A;  2C7H A;  4KVG B;  1WXQ A;  3KH0 A;  4TMA B;  2IPK D;  3AEF B;  1D5Z C;  1VJK A;  1FD6 A;  1KH0 A;  3AXC A;  1R7S A;  5D2M B;  1B1Z A;  1CQV A;  3DHI C;  3MP9 A;  5DPR A;  3U52 E;  2QMT A;  2Y5B B;  3ENE A;  2KWD A;  1YNT E;  1Y8R C;  1P98 A;  2IO0 B;  3R66 C;  1FCC C;  1VZ7 A;  3ECI A;  2PEA A;  4JGH B;  4YSZ B;  3VH4 B;  1ZXI A;  3AV8 A;  3R2I A;  4HJK A;  2HDE A;  4KX6 B;  1FXI A;  3A9J B;  4DQO C;  1FNW A;  2DNF A;  2V1Y A;  2ZVO A;  4C4V B;  4HKQ A;  2KFK A;  4TSS A;  4MSQ B;  4NAM A;  3HK0 A;  2OJW A;  1S3S G;  5JXV A;  2QEJ C;  4FLH A;  4PS8 A;  4P1C C;  5D6J B;  2CJN A;  3AE5 B;  3FKY A;  2AX5 A;  4RMA A;  3Q3F A;  5DCN A;  3U30 A;  1ZE3 D;  2WXG A;  3BYY B;  2WXO A;  2LGI A;  2ON8 A;  4IW0 A;  4E71 A;  2YEP B;  2K8C A;  2LVO A;  1WY8 A;  4AJW A;  3HIZ A;  4JWS C;  3WAO A;  1WH3 A;  2Z8L A;  1ZP0 B;  4XWW A;  4JLC A;  4A9A A;  3O65 B;  2KAJ A;  4US8 A;  3TIX A;  2N9K A;  5EDS A;  2EMT A;  2GOW A;  2V0G A;  2K1F A;  3KW5 B;  3N1Z C;  4AJY B;  5BYR A;  2NR2 A;  3GB1 A;  2G1E A;  4II2 B;  4KZC A;  1JRP A;  3OWE B;  3L16 A;  3R7Q A;  1UUP A;  3MFG A;  3PTF C;  3P42 A;  2J53 A;  2JRI B;  5BMH A;  2QCZ A;  1EU3 A;  3CSF A;  4GN1 A;  3RUL A;  1GPX A;  2WU2 B;  1FCL A;  1WGK A;  1WJU A;  4BKS A;  2FNJ B;  1YN4 A;  1WX7 A;  1ZPS A;  3B1L X;  1FNU A;  1C1Y B;  2L7R A;  2LUE A;  4HWI B;  4K7U A;  1VLB A;  3RPF C;  2DZK A;  1C77 A;  2IO3 B;  4KIK A;  1IGD A;  4B0E A;  1XF5 L;  3T3N A;  1FIQ A;  1C76 A;  3GZN I;  2WXR A;  4LTU A;  2DAF A;  1A5R A;  3B9J A;  1ZW7 A;  2N9X A;  3HVD A;  3DVN V;  4NAW B;  1L6V A;  1PGB A;  1DOI A;  3AEC B;  3WAP A;  2RMM A;  1HE8 A;  2K6Q A;  3T3O A;  1ET6 A;  3L13 A;  2JU6 X;  3I5J C;  1OFF A;  2B76 B;  5I4D A;  2NBU A;  4E3C A;  2D10 A;  1XCT L;  4BOS C;  2REX A;  3X0W A;  2MH7 A;  4ANU A;  5GMV A;  1UD7 A;  2KAC A;  1IPG A;  4FJY A;  2W55 A;  5BMG A;  1ISN A;  1SJH D;  2INN E;  2ZPN A;  5EE1 A;  4FJV B;  4P6V F;  2L83 A;  4XDC A;  1XCQ L;  1RLF A;  2LUM A;  1P3Q U;  4N9F 4;  4MGI E;  4ACF A;  2KVZ A;  3TUO A;  4JPS A;  3SFD B;  3ZRC A;  4YTP B;  3DWM A;  4LNI A;  2GBR A;  5H92 C;  5FK9 C;  2K6D B;  2AQ1 B;  2R2O A;  1PDX A;  3V3X A;  3PVL A;  4C56 C;  1NYR A;  1T0Y A;  3GE3 C;  1NDD A;  2JYE A;  1WGR A;  3DCG A;  3I63 C;  4M00 A;  4Q2J A;  4W9H A;  5FR3 A;  3R8B A;  3RCZ A;  2KC1 A;  2KXJ A;  3V05 A;  1WWT A;  1I4R A;  2Z59 B;  2O2V A;  1R4N B;  2BF8 B;  4TQ0 A;  1V80 A;  3N9Y C;  2RPQ A;  3DBS A;  1HQR D;  2M8S A;  2UYZ B;  3DBL I;  1BML C;  3AE8 B;  1WIA A;  4YL8 A;  2O6V A;  1MG4 A;  4GMV A;  4YTN B;  4OZA A;  2NBW B;  1HTQ A;  1UEL A;  3DBH B;  3IHP C;  1KLU D;  2NPT A;  1MI0 A;  2Z0D B;  4CO7 A;  1C3T A;  3ZJV A;  1E8W A;  3DVN U;  5E6O A;  4LJP B;  1HZ6 A;  2G9H D;  1QF6 A;  2XK5 B;  4KSL C;  3ZW3 A;  1ZXH A;  4CQN A;  2G45 B;  2KTR A;  1KRH A;  1RFK A;  3KWV A;  2LD9 A;  2CHX A;  2Y5C A;  2LFI A;  1YN3 A;  3IG3 A;  3W2D A;  3Q3O C;  2KDF B;  2D5G A;  1FFV A;  1I35 A;  3Q6B A;  4WWM A;  2AWT A;  3VAW A;  1E0Z A;  2KD0 A;  3L0W B;  4TQ1 A;  1V86 A;  1FFU A;  3A4R A;  3B2G A;  3ZLZ A;  2E6X A;  3ZQ4 A;  2L00 B;  1JW9 D;  1XEE A;  4KV2 A;  4ZOH C;  2KLG A;  3ZTD A;  3QK0 A;  1K51 A;  1SF0 A;  2PTL A;  4M01 A;  4RGN A;  3JYU A;  2V3N A;  2ACZ B;  3EHV A;  4HXD A;  2CU3 A;  2W82 A;  1QOG A;  4HRO A;  3UI3 A;  4DXG A;  4NPN A;  3H7P B;  3NG0 A;  1ZDX A;  3GS2 A;  2WLB A;  3APF A;  2J0M A;  3NY5 A;  2KC2 A;  3Q3M C;  3GE8 C;  1VZ8 A;  2X38 A;  4II3 B;  3TEZ A;  2PLP A;  1SBB B;  1NVI D;  2W3R A;  1GC7 A;  3SEB A;  1VCB A;  1DGJ A;  1UGM A;  1NYQ A;  2RD0 A;  2JWZ A;  3ZDM C;  4MGZ E;  2PE6 B;  5DPS A;  3VRA B;  3PLV A;  4BOZ B;  3TL5 A;  3AU4 A;  2QC8 A;  4L2Y A;  2HD5 B;  4DXF A;  4IWQ A;  4S17 A;  3FIL B;  1WYW B;  3VH3 B;  4ZYS A;  1XT9 B;  2FCS A;  4LK0 M;  1YIW A;  2DYB A;  3W1S A;  2MJ3 A;  1WRD B;  4LDT D;  4RGT A;  1LXD A;  4HCN B;  2LGX A;  2BYT A;  4IG7 B;  2WXP A;  1DOX A;  1C9F A;  4WWO A;  3R7R A;  4FHK A;  1H4R A;  2DZI A;  3VUW A;  5HG2 A;  1N6Z A;  3HM6 X;  1F1H A;  1NEK B;  1UZX B;  4XC2 A;  2J7Q B;  3VTW A;  1FRR A;  2LJ5 A;  2RDH A;  1L4Z B;  2BGF A;  2DAJ A;  2MBQ A;  4JQW C;  1OGW A;  4BAX A;  3KVF B;  3P4R B;  2IGD A;  2NTS A;  3PZD A;  2R61 A;  2WXM A;  3RYT A;  4MSM B;  2AEH A;  2M0A A;  1YQB A;  2C5L C;  4QAY A;  3H8H A;  2M1M A;  1D6E C;  4YT0 B;  4GU2 A;  4YWG G;  4PYZ A;  3NVZ A;  2BWF A;  3IT4 B;  2RGF A;  1GUA B;  2FE8 A;  2EMS A;  1QQR A;  2C7M B;  4PS3 A;  1V6E A;  2KJH B;  2KMA A;  1IBX A;  3E9S A;  4B9K A;  3AE7 B;  4RM9 A;  2K9X A;  2BYF A;  2DEN B;  1ESF A;  4ZRP A;  4AUQ C;  1RFA A;  3L08 A;  2PKO A;  2M56 B;  1RAX A;  2WGS A;  4BVU C;  1STE A;  2O2V B;  3KUD B;  1WJ6 A;  1WGH A;  2Y5P A;  1QOF A;  5J18 A;  3A9J A;  4TV3 A;  2KN5 A;  1UF0 A;  2FCQ A;  4R3D A;  1SE2 A;  3BK2 A;  3QIJ A;  1G6J A;  2DLB A;  3Q8A A;  4DK5 A;  3MJW A;  4JIO U;  1C79 A;  3KWL A;  1V8C A;  2BYV E;  3NOB A;  1IBX B;  2XK5 A;  5BYS A;  2D3B A;  2KOX A;  2MCN B;  3MJ5 A;  2E3T A;  3EGR A;  2PPH A;  1TKY A;  4ICU A;  1WGG A;  2DX5 B;  4GOC A;  3MTN B;  3TCA A;  2IY0 B;  1IP9 A;  4NZL B;  2BW2 A;  1PGX A;  4XZ4 A;  5C1Z A;  2KDI A;  1SB3 C;  2JRH A;  1TTN A;  3V61 A;  1EU4 A;  1WGD A;  2GB1 A;  4C80 A;  1P7F A;  1AAR A;  4KZ0 A;  3B08 A;  4LLG M;  1H8C A;  5MPO A;  4ZDV A;  3NS1 A;  1JCK B;  4OVU A;  2JZP A;  3RT3 B;  1PFD A;  1TYG B;  3X23 A;  3K9O B;  4RGM A;  2KDE B;  1LGR A;  4IDI A;  2AL3 A;  4B6W A;  1BT0 A;  3CST A;  1YJI A;  2MWS B;  4WAA A;  2X8X X;  2VRR B;  3N32 A;  5AEK B;  1VRA B;  3QC8 B;  5LNK 1;  3ETR A;  2LXC A;  3TEY A;  2JVC A;  1FRD A;  2AYO B;  3P4Q B;  2Z0E B;  2G4D B;  1NI2 A;  4H2A A;  2JPH A;  4A8X C;  2RSU A;  4IWP A;  2L76 A;  2N7D A;  2ZNV B;  2K8B A;  1I4Q A;  1UWM A;  4ZRJ A;  1EM7 A;  1C78 A;  1L0Y B;  1K8R B;  3AEA B;  4A3O A;  1Q1O A;  4MEM A;  1WZ3 A;  3M62 B;  4MAC A;  4PS7 A;  1ENF A;  2ZEQ A;  2ICI A;  4K81 A;  4URK A;  3WAN A;  1V1P A;  3I9V 1;  3AEG B;  1N60 A;  1WXA A;  3ALB A;  4GDL A;  2ZVN A;  4K1R B;  2GBK A;  2M4N A;  4B0M A;  1GAQ B;  3ZNI D;  2G4S A;  1OQQ A;  1E90 A;  2V9H A;  1QOA A;  3D32 A;  5D94 A;  2IJ0 A;  2KFJ A;  5G5H A;  2KKC A;  3UIP B;  1E6E B;  4W9G A;  1WGY A;  2XNA C;  1V49 A;  2DYM A;  1KJT A;  5BO4 B;  2KQ7 A;  3ZO5 B;  3PPA A;  1OEY A;  4F7Z A;  5D3I B;  3L10 B;  3AE9 B;  4W9K A;  3UIO B;  4CHK A;  1UBI A;  3AB5 A;  2PMV A;  1J19 A;  3OJ3 A;  5EE3 A;  3C8Y A;  2YVC A;  3Q8B A;  2ONQ A;  1L2N A;  4G0N B;  2EEL A;  3NVY A;  3DPD A;  1PUT A;  2JYT A;  4LDT B;  2WWZ A;  5TR5 A;  3AE3 B;  3MC8 A;  2MSE D;  3ZNG C;  2I38 A;  1F52 A;  2KX0 A;  3U7Z A;  4IM0 A;  1U4A A;  4FUL A;  5AZH A;  2BT6 A;  2C60 A;  3KYC D;  2MLB A;  2CU1 A;  1L5P A;  2CR5 A;  2V3S A;  2NVU I;  2ZNV C;  3NS8 A;  4G11 A;  4GSW A;  2MBO A;  5TSS A;  1SSN A;  3UQB A;  3ZGZ A;  4W9F A;  2IZV B;  2PVO D;  1FNV A;  3VRB B;  5CHW A;  3AEE B;  4ICV A;  1EO6 A;  4A90 A;  3AED B;  2J52 A;  4ARI A;  1D5X C;  1OQR A;  1WZ0 A;  3NHE B;  2KZR A;  1SE9 A;  3ZDT A;  2MA9 B;  1CZP A;  2PW9 A;  3WCQ A;  3EFU A;  3VR9 B;  3NJT A;  2XEW A;  2K25 A;  2L32 A;  5CHV C;  3RD2 A;  2V4I B;  3NVV A;  1PQS A;  2LVQ A;  2W54 A;  3NUH B;  1SIJ A;  2WP9 B;  3RNF C;  4HK2 A;  3ZUN A;  1F9J A;  1TIF A;  1V9J A;  1GB4 A;  4W9J A;  4C4V A;  2JY6 A;  1WE6 A;  2KMC A;  3W1S C;  2LGY A;  1LFD A;  1JWB D;  5IN7 A;  1P1A A;  3U4E G;  2CHW A;  3P4S B;  2V4L A;  4PT5 A;  2ZPY A;  4UDU C;  1WFY A;  4IOI E;  3DBL B;  3PSE B;  3GZN B;  1JWA D;  5J2R A;  2MQJ A;  3AUL A;  3URY A;  2L3Z A;  2WX0 A;  2WXJ A;  2KWU B;  1OEY J;  2CHZ A;  3C0R B;  2KDM A;  5J17 A;  1UH6 A;  1V1P B;  4FAD A;  1LM8 B;  3SD5 A;  5LXI B;  5D3D A;  3Q69 A;  1FM0 D;  1T6B X;  4BFR A;  4ZHP A;  3RFZ B;  1S1Q B;  1TS4 A;  1WRI A;  4KGR A;  3M95 A;  3ML8 A;  2CKH B;  3RUI B;  1AWD A;  1R4N I;  1GC6 A;  1WYG A;  3NRZ A;  1TBE A;  3AE1 B;  1P7E A;  5CTR C;  3AH7 A;  2I1J A;  3NZS A;  2WQY B;  2BQQ A;  1V5T A;  4A20 A;  3HVZ A;  1TKE A;  3MC9 A;  3ZIM A;  3UGB B;  2FUH B;  2HE7 A;  1F0Z A;  2L05 A;  4A55 A;  3VFK A;  3WA0 A;  4J6I A;  4HPP A;  4GIV A;  2KYW A;  3BII D;  5IAA C;  1FEH A;  4E74 A;  1WJ4 A;  3QX1 A;  2L8J A;  1NEN B;  3AN1 A;  2FBW B;  3BYT B;  4XDD A;  2BS3 B;  5AUI A;  4AOF A;  3JVZ X;  1YX5 B;  1AYF A;  2IGG A;  1Z2M A;  5KHO A;  2IND C;  3H9D A;  1KOT A;  5DPT A;  5IKC M;  2LZ6 A;  4JE3 B;  4K7W A;  5LLI A;  2O6V D;  4IM3 A;  2VZK D;  3VXW A;  1KF6 B;  2WXF A;  1I4G A;  3ABV B;  3APC A;  3RMK C;  3WAL A;  3EA6 A;  1HZ5 A;  2VH2 A;  1EWC A;  1MHX A;  3CIR B;  1ROE A;  2BTE A;  3U7D A;  3VUY A;  2KK8 A;  2Q5W D;  3V60 A;  4MEL A;  4YTM B;  3OLM D;  3RZF A;  1XXG A;  2UWQ A;  2BS2 B;  1EWY C;  1T3Q A;  2EKI A;  1WXS A;  2JXT A;  3QAQ A;  4OVZ A;  3BVG A;  2N7J A;  5E6P A;  2BYE A;  2LXA A;  1I4P A;  2OHF A;  4I6N B;  2GBJ A;  4GXB A;  1D3Z A;  3OG5 A;  2JWU A;  1Z5S B;  2FUG 1;  2WNM A;  3P63 A;  3W5V B;  2W3S A;  2BKR B;  2AQ3 B;  5IO9 A;  2JZZ A;  5EE0 A;  5HKH A;  3QAR A;  3IFW B;  5IA7 A;  4OW0 A;  2QSD A;  4MT5 A;  5AUK A;  1WMH B;  4DDG D;  3ZRF A;  1D4B A;  5IOI A;  4ZRQ A;  3PHW B;  4AWJ A;  2NPT B;  1ET9 A;  3TEX A;  4RNA A;  4DHZ E;  4W9I A;  4HEA 1;  2MJE A;  3LDZ E;  2JT4 B;  4LNO A;  2N9E B;  4IUM B;  3RNE C;  4EFO A;  3Q8E A;  3QCA A;  1L6U A;  1P0R A;  4AQ7 A;  3R2T A;  1YOV B;  1WR6 E;  2NBV B;  3HUI A;  4EE2 A;  1TKG A;  1RM6 C;  5CHF A;  4BZA A;  4KSK C;  3H6N A;  1XLQ A;  5C3J B;  3ZXV A;  2KLC A;  1GJZ A;  4MGY E;  4GDK A;  5G5G A;  4X57 B;  4BBN F;  4WWP A;  2BPS A;  2PVG C;  1E10 A;  1IGC A;  1VD2 A;  2Y3A A;  3BK1 A;  4ANW A;  1QIL A;  2BS4 B;  1HXY D;  1JWU D;  3ZNH B;  1WM3 A;  4JL9 A;  3L54 A;  1WSP A;  1TGZ B;  1ZKH A;  1N63 A;  3APD A;  1YX6 B;  2UU7 A;  4N6E B;  1K50 A;  3ZJU A;  4WJQ A;  1YQ4 B;  3AEB B;  1TS5 A;  4WJO A;  4P7I A;  5FR6 A;  1E5W A;  4BKT A;  5IP4 D;  1J8C A;  1FXA A;  2JX5 A;  4L23 A;  3Q14 C;  1R4M I;  2LJI A;  1I7H A;  5HHD G;  4RFB A;  3T8M A;  4ZYN A;  1SEB D;  2HTM E;  4GDL B;  4ANX A;  1OQY A;  5HI1 A;  1N5X A;  3U8Z A;  3JSV A;  1PGA A;  4KIK B;  2DZJ A;  2KAN A;  1JWS D;  2N0S B;  3DVG X;  1YMH E;  3PZ8 A;  4USA A;  5BYQ A;  4TKN A;  5AZF A;  2MJD A;  3ZTC A;  4A6Q A;  3LXF A;  1L0X B;  1SXT A;  1IYF A;  4EZK A;  1TT5 B;  1QKZ A;  2L1A A;  1HEZ E;  3WIM A;  4MJS A;  5C2T B;  2K22 A;  1VZ6 A;  1TY0 A;  4DDI D;  1ZUD 2;  2YLM A;  3OJ4 B;  4D2K A;  3SR6 A;  1ZGU B;  4B95 A;  3NZU A;  1V1O A;  4HVB A;  4FJZ A;  3M3J A;  4NJ6 A;  3N20 C;  4MM3 A;  4PK1 A;  4S0R A;  1J7C A;  4KDL B;  2K39 A;  2L0T A;  2LMC A;  3DWG C;  4N58 A;  1FO4 A;  4XE0 A;  2JSV X;  3AE6 B;  3RI7 C;  2LHD A;  1J7A A;  3RNG C;  1OTR B;  1SJE D;  2EKE C;  3MC0 B;  4EZJ A;  4NJ7 A;  2WDV B;  2NMQ A;  5LXH A;  3QWZ B;  3FC4 A;  3V6E B;  3CWI A;  3GP7 A;  2RR9 A;  4RCO A;  3LB8 C;  1N62 A;  2B3A A;  4REZ A;  1ZDV A;  2SEB D;  1FMA D;  2NCN A;  4F8C B;  1UNS A;  5C23 A;  2WU5 B;  4W9E A;  2DZM A;  1FPY A;  2KN4 A;  4KKI A;  1J0G A;  2AL6 A;  4O1N A;  2PE9 A;  1WI0 A;  4KGS A;  3VTU A;  3BIN A;  4RGO S;  3UF8 A;  3HRD D;  3QQ8 B;  3QHT A;  1TS2 A;  2KJ6 A;  1E7P B;  3TBL D;  2JXX A;  2BKF A;  4M0W A;  1DOY A;  2C7N B;  3ZNZ B;  5G55 A;  1V97 A;  1YJ1 A;  3OAW A;  3DOW A;  3VQI A;  2J42 A;  4MH8 A;  4EUT A;  2GBN A;  2QJL A;  2PIA A;  2MW5 A;  1JWM D;  3IAM 1;  2DHZ A;  3U2S C;  2K0P A;  3L4P A;  1TZ1 A;  2N1W A;  4DBG A;  1T5X D;  3O13 A;  2ZCB A;  1WF9 A;  2KWV B;  1MJD A;  1V5O A;  2VZK B;  2M0X A;  4F1S A;  3RNB C;  3HHM A;  4DHJ B;  3CMM B;  3ZVV A;  3EFC A;  4HPL B;  1F2R I;  2I1K A;  2I2Y A;  3HM3 A;  3SFE B;  4FA6 A;  4I6L B;  4PYU A;  1RWS A;  3BY4 B;  2KO3 A;  3A33 B;  3DBR I;  1FXT B;  2ZW0 A;  4NY0 A;  3RN9 C;  1QLB B;  2N1V A;  2D2Q A;  2SAK A;  3VDZ A;  4MM3 B;  2CS4 A;  3BVZ A;  2KNB A;  4OVV A;  4G50 A;  1I4H A;  3PZ7 A;  4OZC A;  1UGJ A;  4I6P A;  1EF5 A;  2H89 B;  2KFK B;  2OED A;  2ZCC A;  2LAS A;  5H8Y E;  4AS1 A;  4WWN A;  2JUO A;  2WDT B;  4HLE A;  1C4A A;  2WDQ B;  1RYJ A;  4NQL B;  4XX5 A;  1L7Y A;  3LJ3 A;  2XN9 C;  1Y56 A;  2L0F A;  2WHI A;  4RM8 A;  4P16 A;  2ZW1 A;  4OZB A;  4XGA B;  4YXD B;  5D7G A;  4L1B A;  3PS6 A;  4HJG E;  2D3G A;  2MBE A;  2WXH A;  2KTF A;  3TMP B;  3AE4 B;  3FIL A;  2A5U A;  1QZE A;  3ONS A;  4JX1 C;  4JWU C;  2AQ2 B;  1E8Y A;  4K3C A;  2GBM A;  2JF5 A;  3PRP B;  2L52 A;  4K3B A;  1P9D U;  4K7S A;  3KLS X;  4GLS C;  1LQB A;  4LNN A;  5HFY A;  2LHE A;  2RPV A;  3N3K B;  4US9 A;  3PV1 A;  2V3P A;  3ML9 A;  3ZXR A;  3IT6 B;  4MH0 E;  3RNA C;  4GGQ A;  3P2B A;  4IM2 A;  1WMH A;  1Q5W B;  3AI5 A;  4MGK E;  1K53 A;  4M0W B;  1WJN A;  4OHJ A;  2KQ4 X;  1GNU A;  3S2A A;  1JRU A;  2WXI A;  2BB6 A;  3SDL C;  3ZKJ C;  2NS5 A;  3QJZ A;  1BXT A;  3AE2 B;  1E9M A;  3IAS 1;  5DPW A;  2FIF A;  3DBR B;  3KUC B;  4NJC A;  2BB5 A;  4RF1 A;  2MEK A;  1VR9 A;  3E56 A;  1TZO A;  1WXM A;  1WX9 A;  1E7U A;  4BKS D;  3A4S C;  4ASW C;  3VVW B;  1WX8 A;  1HTO A;  1TS3 A;  4M8M A;  2XBB C;  2HJ8 A;  2IY1 B;  1TJE A;  1JRO A;  4EZL A;  1TY2 A;  1K52 A;  1AN8 A;  4RF0 A;  4LNF A;  1V81 A;  3W9C B;  2LI5 A;  1QOB A;  3RNC C;  1KTK A;  5CX3 A;  5E6N A;  1KM7 A;  1BUI C;  2HJ1 A;  1I4X A;  3Q3J A;  3BVM A;  5AZG A;  1JQ4 A;  2TSS A;  4C00 A;  3TEW A;  2ASQ A;  1MFW A;  2OOB B;  2WS3 B;  3BZD B;  4ZRK A;  3NZ3 A;  3R3M A;  1R4M B;  5E6J A;  1T0S C;  2WXN A;  1XLO A;  4C7Y A;  2D3A A;  5GXG B;  4XYC A;  2J0K A;  2GMI C;  2IDY A;  2QHO A;  2ZZP B;  1J7B A;  1KLG D;  2C9W B;  1DYQ A;  3VTV A;  4EEW A;  4EKU A;  4HDQ A;  3IVF A;  3DBH I;  3M63 B;  2KVR A;  4AP4 C;  2KQS A;  2M19 A;  1ACC A;  2LGD A;  4WJP A;  2WDR B;  3DDC B;  4FBJ B;  2FID A;  2LEK A;  4HKZ E;  1GOZ A;  1D5M C;  2LWP A;  2FAZ A;  3Q8F A;  4YSY B;  1M94 A;  2N9L A;  4RH6 A;  2KHW B;  1C4P A;  2WX1 A;  3L17 A;  1N5W A;  1WR1 A;  3VHT C;  1MHH E;  1XLP A;  4MDK E;  3PRM B;  4HRS A;  4HPM B;  1WM2 A;  3JW0 X;  4P1B C;  2J4X A;  1EUV B;  2MBB B;  1AW7 A;  3FAH A;  3TSS A;  4ZHO A;  1B9R A;  4WQO B;  3A9K A;  2H88 B;  4LJO B;  2HTH A;  3MHZ A;  4CYE A;  1GG3 A;  3UIN B;  1V2Y A;  2A4Z A;  4ZRI A;  1CMX B;  2KJR A;  2DWQ A;  2RDG A;  3AMZ A; 
#chains in the Genus database with same CATH homology
 3RNG C;  3I5J C;  3DHG C;  3RNB C;  3Q3O C;  3Q3M C;  3N20 C;  3GE8 C;  4P1C C;  4P1B C;  3RMK C;  3RNA C;  3RN9 C;  3GE3 C;  1T0R C;  3DHH C;  3RNF C;  3RNE C;  3I63 C;  2INC C;  1T0Q C;  2IND C;  3N1Z C;  3N1Y C;  3RNC C;  1T0S C;  2RDB C;  3DHI C;  3RI7 C;  3N1X C;  3Q2A C;  3Q3N C;  3Q14 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...