3AEFB

Crystal structure of porcine heart mitochondrial complex ii with an empty quinone-binding pocket
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II with an empty quinone-binding pocket
rcsb
molecule tags Oxidoreductase
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 59
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3aefB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3aefB01
3VRAB 1FRDA 3HVZA 1FFUA 4YSYB 3NVZA 3AE5B 4US8A 2H89B 1NVID 1ZOYB 2WS3B 1TJEA 1H7XA 3P4QB 1XLNA 1VDVA 1YJIA 1FFVA 2N0SB 3KWLA 1FXAA 2M56B 1PUTA 1ROEA 3CWIA 4N6EB 4C7YA 1V97A 2BS3B 2CU3A 2QJLA 1JALA 3AH7A 2Y5CA 3NVWA 4FXCA 5EE1A 1NYQA 2MJDA 1F0ZA 1PFDA 2AX5A 2M19A 2KMMA 1KFYB 2PKOA 1UWMA 2L83A 3L4PA 3AB5A 1NI3A 3P63A 5EE9A 1FO4A 1SIJA 1ZXIA 1WGKA 1ZP0B 1DGJA 3AEFB 2CJOA 5EE3A 4LTUA 3P4PB 3AMZA 3VR9B 2WU5B 3AEEB 1A70A 1CJEA 1J7BA 1FRRA 1NYRA 2W3RA 1GAQB 4JWSC 3VR8B 1JQ4A 1KRHA 4N58A 2W55A 1N5XA 1VLBA 1JWBD 2DBYA 2MJ3A 4A9AA 1QOAA 1OFFA 5G5HA 1WRIA 1AYFA 5MPOA 3BIID 4C7ZA 4YT0B 1E7PB 1QOFA 1SB3C 5H92C 4WWMA 1N60A 3AE6B 3VRBB 1QT9A 1XO3A 2E3TA 2PVOD 1VJKA 2MJEA 1NENB 3SR6A 1E6EB 3P4SB 4KX6B 2WU2B 1AWDA 1J7CA 1RFKA 1TKGA 3DWGC 3P1MA 4ITKA 3AE7B 3NVYA 1L6UA 2EKIA 1WYGA 2OHFA 1QF6A 3ZYYX 2PIAA 3B2GA 3AN1A 2WDRB 1DOYA 3AE8B 3LXFA 1I7HA 1GPXA 3LB8C 5AUKA 1QOGA 1FXIA 3AV8A 3CIRB 2H88B 2KAJA 3NVVA 2PVGC 1JW9D 2BS4B 1N61A 3HUIA 2CJNA 2BS2B 3AE4B 2HTME 4P6VF 1R7SA 1YJJA 1DOIA 2WDQB 1IUEA 2WDVB 4JWUC 1EWYC 5G5GA 3W5UB 1RM6C 3EUB2 1WWTA 4C80A 3AM9A 3W9CB 2BT6A 1YQ3B 3ETRA 1RYJA 1E9MA 1JWAD 1N5WA 3SFEB 1L0VB 1JRPA 3P4RB 1OQQA 1N63A 3FC4A 3FAHA 1QLBB 3AEDB 3AE9B 2K22A 1FIQA 1PDXA 1TYGB 2MH7A 2L52A 3AE3B 4HROA 1GTEA 1QOBA 4USAA 5AUIA 2B76B 4YTPB 1RWSA 1CZPA 1XLOA 4N59A 2W3SA 2JQRB 1B9RA 2WQYB 1V8CA 2G1EA 3SFDB 2FBWB 1OQRA 2JX5A 3B2FA 2DWQA 1E0ZA 2ACZB 3AEBB 4HRSA 2WLBA 4US9A 4JX1C 1KF6B 1H7WA 1L6VA 1WXQA 3ABVB 3AE2B 3AE1B 3WCQA 1E10A 4WQMA 1TKEA 3CF4A 5C3JB 3AEGB 1FMAD 3B9JA 3DWMA 3NRZA 4ZOHC 2K5PA 2WP9B 3W5VB 5EE0A 2QIEB 3PO0A 1ZUD2 4YSXB 1YQ4B 3AEAB 4YSZB 1T3QA 1JROA 1TKYA 3HRDD 1SF0A 4YTMB 4ZHOA 1XLQA 2W54A 4ZHPA 1DOXA 3AECB 5C2TB 1XLPA 2Q5WD 4IDIA 5GXGB 4YXDB 2K9XA 1FM0D 3NS1A 5H8YE 1GT8A 3RPFC 1N62A 2LEKA 1GTHA 1NEKB 1J7AA 1L5PA 4YTNB
chains in the Genus database with same CATH superfamily
2IO2B 4DHJB 4PS8A 1FCLA 3N1YC 2QMTA 4FHKA 3CWIA 4K1RB 1V97A 4GDKA 2M17A 3NVWA 3R2IA 2MBHA 1F0ZA 1HEZE 3EFUA 2IO0B 1UGJA 2N7DA 4A8XC 4CYEA 4BOSC 3OAWA 1ZP0B 1H4RA 3AEFB 2CJOA 1WXMA 2CHWA 2K8HA 4KDIC 5EE3A 2INNE 3HIZA 3QK0A 3URYA 3JYUA 3P4PB 1L4DB 1HTOA 3VAWA 1XXGA 4IM3A 3BK1A 2D2QA 1P0RA 3VQIA 3V05A 4DDGD 5LXHA 3ZRCA 1QT9A 2PMVA 4K3BA 5D3IB 2KLCA 3ZNID 4ANUA 1QOGA 2NBUA 2WX0A 2LASA 2CJNA 2UWQA 2BS2B 3Q3NC 2AQ1B 2A5UA 4FLHA 2WHIA 1IGCA 3TEZA 3L0WB 1N5WA 2WXNA 2L52A 5IO9A 2KDBA 3IHPC 4A3OA 1CZPA 2D3CA 4KGRA 1J19A 1KJTA 4DXGA 1V49A 3VHTC 4C4VA 4II2B 4W9DA 4RM8A 2KQ7A 1VCBA 2MP2A 3AEGB 3UINB 2NCNA 3DVGX 3O13A 3VXWA 4YSZB 1WM2A 5C2TB 3UQAA 5BMGA 3NZSA 4AWJA 2LEKA 4C4VB 1TJEA 1H7XA 1WXAA 2MP2B 2I38A 1EO6A 1WSPA 3E56A 3AH7A 5EE1A 1NYQA 3MFGA 2LXAA 3Q3JA 3Q3MC 4S0RA 3P63A 1IYFA 2M0XA 4JL9A 3IXSA 4CHKA 1QILA 1L7YA 2AL3A 2HD5B 3A1QA 1FRRA 2N9EB 3GE8C 4BBNF 1V1PA 4ZRQA 1JWUD 2J0JA 4M8NA 1T0RC 1WRIA 3AU5A 4NAWB 3BIID 4JGHB 5IOIA 2E3TA 1WM3A 4HKZE 1J7CA 3NOBA 3NVYA 4IC7B 2N9XA 3AN1A 4N9F4 3B1LX 3AXCA 3N1XC 2Z8LA 4W9GA 4KGSA 3SHQA 1WFYA 4WWNA 1K50A 5D7GA 2BVCA 1XCTL 3SFEB 3FC4A 4LK0M 3RYTA 3U52E 2ZVNA 3APCA 2MBEA 3U8ZA 4ZDVA 3PZDA 3QX1A 3GZNB 3LJ3A 3QCAA 4ZYNA 4W9EA 3ZTDA 4BOZB 1TKEA 1FMAD 3H6NA 3PZ8A 2JXXA 2QDFA 5JH5C 2RDGA 1T3QA 2JRHA 1LFDA 2C7MB 3ZJUA 2UYZB 1GB4A 2KJRA 1IGDA 3TBLD 3NJTA 3RNCC 2K3UA 5JZEB 4HPLB 3RZFA 2JRIB 2WXRA 2JXTA 1MHXA 3OWEB 5CHVC 3L16A 1T0SC 2GB1A 3R2TA 4RGNA 3AMZA 3AEEB 4JWSC 1YQBA 4GU2A 4M0WA 4WAAA 4OZAA 4LNFA 1QOAA 1OFFA 1WH3A 3C0RB 1JRUA 1SB3C 4WWMA 3AE6B 2BB5A 3L54A 1P9DU 2NBWB 1ISNA 3RNFC 5IAAC 3KUDB 2FIDA 1WJNA 4II3B 4KKJA 1LO5D 2KFKB 2GBJA 2KOXA 3GS2A 4FADA 3HUIA 1N61A 2V4IB 2WXGA 1LXDA 1WGDA 1RM6C 1WWTA 1LQBA 4EZKA 5LXIB 4RF1A 2KVZA 1K53A 3HM6X 1YIWA 2WXFA 3AE3B 2N9KA 3V61A 5L83A 2LGDA 1S1QB 1YN5A 1JCKB 3SFDB 4BKTA 1QQRA 2M0AA 3WCQA 1V86A 3CF4A 3ZTCA 2WXHA 3PO0A 5IN7A 1WMHA 2K25A 3A33B 2R61A 4HJGE 4XX5A 4ZHPA 2HJ8A 2ZCCA 1E5WA 1K51A 3ZXVA 4YTNB 2WNMA 4GN1A 1YN3A 1UGMA 2WXMA 1V5OA 4MM3B 1EF5A 3KWLA 5CHWA 1YX5B 1GC6A 4EZLA 2ONQA 1JALA 2RR9A 1C1YB 4FN2A 2A4ZA 1H8CA 3UIPB 4PYUA 1R4MI 3Q2AC 4K7SA 3ZW3A 4LNIA 4LTUA 2I2YA 3QWZB 3R7QA 1P3QU 4C00A 2DNFA 1DYQA 2MBOA 2FCSA 2IYDB 4HDQA 1TIFA 3VTUA 2AEHA 2D11A 1V9JA 3KUZA 2M4NA 2KJHB 2BTEA 1GG3A 1XQQA 1BXTA 3DWGC 2OHFA 2GOWA 2J53A 3Q3OC 2G45B 2JWZA 4P6VF 4WWPA 3W5UB 4NAWA 1WX8A 1WX9A 1RYJA 2KVRA 1OEYJ 3IG3A 5BMIA 3WA0A 1ZDXA 1N63A 2K22A 1PDXA 3CSTA 2XEWA 3ZXRA 3VH4B 3EHVA 2FBWB 2Y3AA 1OQRA 3B2FA 4XDCA 2JYEA 3DBLI 2DZMA 4OZBA 3EGRA 4LDTD 1WF9A 5HI1A 3WIMA 4GDLA 4P16A 1V6EA 1YQ4B 3HRDD 4K7UA 2K6QA 1XLPA 3WAMA 4F8CB 1GT8A 2VZKB 3CMMB 1NEKB 1J7AA 2JWUA 1MG8A 3KWVA 4US8A 2JZPA 1STEA 4HJKA 3AE5B 1EF1A 4MT5A 4ZRIA 1NVID 2IPKD 2FNJB 4OW0A 4GXBA 3FILA 2CR5A 2JZ3B 2WXOA 1PFDA 2AX5A 1DGJA 4NJCA 4KIKA 5E6OA 1RLFA 4WIPA 2GBMA 1JQ4A 2DX5B 5LLIA 1C9FA 3SDLC 1PGXA 4RMAA 1HQRD 1HXYD 1AN8A 2MJEA 1NENB 2JF5A 3P4SB 3ZLZA 2WU2B 1GNUA 1TKGA 2IY1B 4NPNA 3P1MA 1F1HA 2QC8A 1L6UA 4ANVA 2KDEB 3ZYYX 5G2NA 2YVCA 3CIRB 1E8YA 3A9JB 2MCNB 2LGSA 2I1KA 1D5XC 3RNAC 1EU4A 3EUB2 4MEMA 4DHZB 3Q6BA 1QLBB 2LFIA 1L0XB 3EA6A 4RNAA 4N59A 1A5RA 2KJ6A 3RCZA 2PE9A 4S17A 1XF5L 1L4ZB 4GLSC 1KM7A 4MDKE 1L2NA 2J4XA 3PSEB 3AE2B 1WJ6A 1E10A 2IJ0A 5C3JB 4L23A 2K5PA 1SGHA 2Y5PA 1L0YB 1D5MC 2MBQA 1ESFA 1ZPSA 3NG0A 3VTWA 2LHEA 4PYZA 2BWFA 2PJHA 3VRAB 4YSYB 2WXKA 1ENFA 1YJIA 2CU3A 4BKGA 2WYQA 1KFYB 3TSSA 3OJ4B 3VVWB 3QC8B 3BYTB 2QEJC 2RDBC 3N9YC 3CSFA 2IO1B 1T0YA 1NYRA 2WU5B 1TY2A 3MC0B 1MFWA 4MELA 3PRPB 4EUTA 5FR6A 4D2KA 5J18A 4DHJD 4JE3B 3U7ZA 2ZEQA 4XE0A 2BGFA 1XO3A 4H2AA 2XK5A 2JZZA 2M8SA 2JYTA 2XNAC 3LXFA 2K1FA 2NTSA 1FXIA 1HTQA 2DZIA 3IBEA 2BW2A 3PGEA 3AE4B 4GIVA 3OJ3A 4P1BC 4XWWA 3GP7A 2LGIA 3BYYB 3H7PA 3P42A 4BFRA 1TS2A 3VH3B 1Q0WB 1I4GA 4YTPB 1WY8A 1GJZA 3JSVB 3MHZA 1NDDA 2K0PA 5BYRA 2KTRA 1XEEA 3DVGY 2EKEC 2ACZB 3AEBB 4PS3A 5D3DA 1H7WA 4ACFA 5EDSA 2KANA 3U2SC 1JWMD 1VZ8A 3W5VB 4MGIE 2YEPF 2W54A 1Q5WB 3AI5A 4IKGA 4JIOU 1XCQL 4HLEA 1L5PA 2ZZPB 3UGBB 3NVZA 4ZRJA 3R3MA 3T8MA 1R4NB 1S3SG 3MJWA 4TMAB 3RT3B 5BMHA 2JSVX 1I4RA 1QZEA 1I4PA 3GZNI 3RI7C 4HDOA 1NI2A 2J52A 4GMVA 3M63B 4GOCA 5DPSA 2MX2A 4HKQA 1YJ1A 1E8ZA 1T6BX 1F2RI 2KWVB 2BF8B 3APFA 1TGZB 1UBQA 4BKSA 3MC8A 1UH6A 4A9AA 3GE3C 2NS5A 2XBBC 4IUMB 2LHDA 4ZRPA 3BWUD 4KX6B 2DZJA 2O6VA 3BK2A 2MHJA 1I4HA 4HVBA 1D6EC 3JVZX 1U4AA 4GGQA 3PPAA 4LLGM 2AQ3B 3ZVVA 4XWTA 1HA5A 3B08A 3ML8A 3L08A 2RPVA 2PPHA 2R2QA 4IWOA 3ZDMC 4AOFA 2WXJA 3MP9A 3Q14C 4ZYSA 4M00A 1I4XA 2IGGA 2KTFA 2MRPA 4JLCA 2CS4A 2KHWB 5LNK1 2C9WB 3AU4A 2QIEB 4RFBA 3KW5B 3UF8A 2K9XA 5BO4B 3H9DA 1GTHA 1GUAB 3HHMA 3QA8A 2K8CA 1ZOYB 2SEBD 1FFVA 1V1PB 1SSNA 2N1VA 3S2AA 4AJYB 1SE4A 5CX3A 4W9CA 1WE6A 2V3NA 3QHTA 3K9OB 2GBRA 3O65B 3AB5A 4IWPA 4MH0E 3RMKC 3QAQA 2OJRA 4FJYA 1HE8A 4NZLB 2L32A 2M1MA 1PGBA 5CTRC 3K9PB 2NBVB 2O2VA 5AZGA 2DBYA 1BMLC 3KYCD 1ACCA 4C7ZA 2EELA 4TKNA 5KHQA 2KX3A 1C4AA 2N9PC 4M01A 1AWDA 2D3AA 4IG7B 1QF6A 4MGZE 3AE8B 1BT0A 2BYEA 2KK8A 3AV8A 1R4MB 1MG4A 1JW9D 2REXA 3DOWA 1KOTA 2LGXA 2WDVB 1YD8U 5TR5A 1YMHE 4BVUC 4L2YA 3TJPA 4GDLB 3NZ3A 4OVZA 4DWFA 3FAHA 1VZ7A 1L0VB 5DCNA 2MW5A 4HROA 1SIFA 2MH7A 1SE9A 1GTEA 4KIKB 2RSUA 2GI9A 2J0MA 2RDHA 4TV3A 2G1EA 2BPSA 3PRMB 3T3OA 2VZKD 3U4EG 3AULA 3GOEA 1KF6B 3A9KB 3AE1B 4NNJB 3DWMA 2CU1A 4GDKB 3ALBA 1UELA 4XDDA 3AEAB 4WQOB 4R3DA 3VUWA 1CQVA 2ASQA 2BKRB 2V3SA 3DBHI 5GXGB 4IWQA 2X8XX 2LRWA 1RAXA 4KGTA 2H89B 1UZXB 2WS3B 1VDVA 2EMTA 4N6EB 3N1ZC 2J42A 2MJDA 1HZ6A 4RGTA 2M19A 3DBLB 4I6PA 2PKOA 1P7FA 3KVFB 4J3OD 3Q8BA 5JXVA 1WGKA 1X1MA 3WAPA 1SEBD 1FNVA 2E6XA 1TS3A 3MTNB 1ZW7A 1KRHA 4EOYA 2Z0EB 4W9LA 2JY6A 2KT7A 3R7RA 2IO3B 2V4LA 1IBXA 1MHHE 1SJED 3DHHC 4DDID 4WJOA 2FE8A 2RMMA 4ITKA 2AWTA 1TT5B 1ET6A 2PIAA 3B2GA 2MEKA 4K7WA 4WAFA 3EFCA 4PS7A 2HTME 1WGYA 4RF0A 1R4NI 4RM9A 3C19A 2GLSA 1KTKA 1JWAD 5J17A 1ET9A 3ML9A 1CMXB 4IOIE 1AW7A 2L00B 1M94A 2FCQA 1WR6E 4FULA 4JX1C 1WXSA 5T8IA 2N1WA 4B9KA 4YWGG 1XLQA 3WALA 2KC1A 4QAYA 5H8YE 4YXDB 2L3ZA 4AP4C 2LVOA 4P1CC 3Q8EA 4HCPB 5GMVA 2G3QB 2BYVE 2L1AA 1FXTB 2NR2A 3SEBA 4W9HA 4B6WA 4O1NA 4BZAA 2KKCA 1P7EA 5KHOA 4FXCA 1SE3A 1V5TA 3ZIMA 2EMSA 4TUUA 3KYDD 1NI3A 5EE9A 2KMAA 1SIJA 1UWXA 1T5XD 2NPTA 1RRBA 3ZJVA 1J7BA 3DHIC 2Z0DB 1KH0A 4JPSA 3VTVA 1V2YA 5FK9C 1V1OA 4LNOA 3TEWA 3T9LA 3TEYA 1E7PB 1QOFA 1UF0A 3I5JC 2O6VD 1JWSD 4ASWC 2C7NB 5DPRA 1E6EB 4G3XB 1Q10A 3T3NA 2NVUI 3Q3FA 1P98A 2KO3A 5HFYA 2KYWA 5AUKA 2LZ6A 3PVLA 2YEPB 3ZKJC 1VD2A 1R7SA 2W9NA 3D32A 1E7VA 2QILA 3AM9A 3W9CB 2JT4B 4BBNC 2BT6A 4WURA 1KLUD 3W1YA 3IT6B 1RFAA 3P4RB 4MJSB 5G55A 3TIXA 1VR9A 1TYGB 4USAA 1VZ6A 3BINA 4IM0A 3RN9C 4OHJA 3VUXA 2DWQA 3ZQ4A 3PLUA 3A1QB 3L10B 2LWPA 5DPTA 1SBBB 3B9JA 4LDTB 2V9HA 2I1JA 3A4RA 3B0AA 2RGFA 4F1SA 4E71A 2GMIC 4HXDA 1N62A 5HHDG 4OZCA 1MPEA 3E9SA 2MWSB 2ZJDA 2MQJA 2SAKA 3P4QB 1XLNA 2KC2A 2N0SB 2M56B 1HZ5A 4W9IA 2BYFA 4XGAB 2VH2A 2Y5CA 4NY0A 4K3CA 5JHAA 3I9V1 2TSSA 3SD5A 2FCNA 1UUPA 3BVMA 2O6VB 2NPTB 4MGKE 2CHXA 4CO7A 5J2RA 2IZVB 3IT4B 1WZ0A 4HEA1 2KTRB 2PTLA 5FKAC 1JMLA 1N5XA 1VLBA 5FR3A 3FILB 1K52A 5G5HA 2WXQA 5D94A 4YT0B 3FKYA 3BY4B 3LYYA 1Z5SB 1YN4A 2L76A 1N6ZA 3TCAA 4FJZA 1QKZA 4MSMB 2DHZA 2C60A 4ZRKA 1IUEA 4BKSD 4TSSA 1YQ3B 3IAS1 4JWUC 1C76A 4AUQC 2N4FA 1UBIA 1FIQA 2LI5A 3ECIA 1RWSA 2QCZA 3W2DA 4G0NB 1I42A 3A4SC 3JSVA 2JX5A 4A90A 2WLBA 3DBRI 3N20C 3OG5A 1UNSA 1SXTA 1D4BA 4OVUA 2L7RA 4BAXA 2IDYA 2WGSA 1SF0A 2IY0B 1GPXA 4KV2A 1ZDVA 4MSQB 1WXVA 2VRRB 2Y5BB 3HVZA 4WJPA 4KZCA 3ZNHB 1WGHA 1ROEA 4A3PA 2O2VB 3I3TB 4EZJA 2OEDA 4IM2A 3H7SA 3V6CB 3DBSA 5AEKB 1EUVB 3PZ7A 3RZWC 2K6DB 2BWES 2XK5B 2AYOB 3BZDB 2KZRA 3KQ4A 3V3XA 1ZGUB 4RGOS 2PEAA 3TEXA 1Q1OA 3ZDTA 2INDC 2DYBA 1BUIC 1A70A 3APDA 1TTNA 4NJ6A 2WXIA 4CQNA 2W55A 2QHOA 1WYWB 4OVVA 3V62A 1E90A 1AYFA 2N7JA 5HKHA 1YNTE 3CF6E 3VRBB 2LUEA 1PQSA 3H1UA 2KN4A 3PT2B 4XC2A 2KMCA 4C56C 4LNKA 2BKFA 3SU8X 3BVZA 2ICIA 5D6JB 2BQQA 2KFKA 4XZ4A 4G50A 3UIOB 2BS4B 3UQBA 2DYOA 3L13A 2V1YA 3A9KA 3PHWB 4B95A 1TS4A 2HE7A 1TZ1A 1VRAB 2D10A 2ZPNA 3PRZA 1PGAA 2IGDA 4ICUA 2JQRB 2WQYB 1V8CA 2WX1A 1E0ZA 1I35A 5DPWA 4KDLB 3Q69A 1K8RB 3NZUA 1WJUA 5IKCM 2LMCA 4WH4A 5EE0A 3X0WA 2BB6A 3L17A 1WMHB 4DQOC 4ZHOA 4HWIB 1DOXA 4IDIA 4UDUC 1E7UA 1FM0D 3QQ8B 2CKHB 3DBRB 1LM8B 1F9JA 1FFUA 1TS5A 2JU6X 2LUMA 2V3PA 4C7YA 1GB1A 3P2BA 4DXAB 1C3TA 4WJQA 2KMMA 1E8WA 4ARCA 1ZXIA 2D07B 3NUHB 2PE6B 1SJHD 2J0KA 4LJPB 4LCDE 1WI0A 5HG2A 1JWBD 2LD9A 2MJ3A 2LVPA 4FA6A 3PV1A 4ICVA 2KDFB 5CHFA 2LVQA 4W9FA 1RFKA 1OEYA 1G6JA 3RD2A 2KNBA 3IAM1 4I6LB 4Q2JA 3RNGC 2OJWA 2WDQB 1EWYC 2KFJA 3N30A 5BYSA 1WX7A 4WWOA 4I6NB 1WZ3A 2L8JA 1OQQA 3ZUNA 3KH0A 2JVCA 3AEDB 3AE9B 1WGRA 2ZW1A 3C8YA 1XLOA 4EKUA 1SE2A 3VFKA 2WXLA 2RD0A 3PREA 2ZW0A 1CK1A 3PHXB 2JUOA 3M3JA 2ON8A 4MM3A 2V0GA 3QJZA 1D3ZA 2MSED 3HM3A 1GC7A 3ZNGC 3DPDA 4LJOB 4FJVB 3ONSA 2IBIB 1MJDA 3GB1A 1WIAA 3BVGA 3VDZA 2MA9B 4KKIA 3TL5A 3DCGA 4RGMA 1IBXB 1TKYA 4YTMB 2CHZA 3TMPB 3V60A 1I4QA 3MC9A 3AECB 3RFZB 1FPYA 3U7DA 4EE2A 2GRIA 5E6JA 2DZKA 1FRDA 2KD0A 2NMQA 1IP9A 2INPE 1EU3A 3DVNU 2BS3B 3RNBC 2B3AA 3ENEA 2INCC 5E6PA 1J8CA 2KDIA 1UWMA 2L83A 3L4PA 1WE7A 3HK0A 4XYCA 2R2OA 2KQSA 3VR9B 1CJEA 4RCOA 4P7IA 4HPPA 2JPHA 1KLGD 3NHEB 2FUG1 4FHJA 3VR8B 4HCNB 3RULA 4RH6A 2VH1A 4URKA 3IFWB 4E3CA 5MPOA 4TQ0A 2HJ1A 1VJKA 3V6EB 2DYMA 4ARIA 4NQKE 4EFOA 4AJWA 3AE7B 1MVKA 1YX6B 1C4CA 2KWUB 3LB8C 1UD7A 2YLMA 3WAOA 2KAJA 2RPQA 3A9JA 1MI0A 3KLSX 4HK2A 5C1ZA 2WDTB 1OTRB 2L05A 2KXJA 3ZO5B 1TY0A 4JQWC 5L95C 1ZKHA 1E9MA 2KX0A 1XT9B 1YOVB 1C78A 4J6IA 4FBJB 2PW9A 5AUIA 1B1ZA 4M8MA 1T0QC 2FAZA 1WRDB 2PLPA 2W3SA 1B9RA 2ZNVB 3LDZE 1WJ4A 4DXFA 3W1SC 3ZGZA 2LRUA 1L6VA 2LGYA 4WJNA 2ZCBA 4NJ7A 3NRZA 1OGWA 4AQ7A 2KACA 3QIJA 3M95A 2Q5WD 3I63C 4KZ0A 4ANWA 4KSKC 3N3KB 1ZXHA 4TQ1A 3X23A 3NY5A 4A20A 1IPGA 4M0WB 4W9KA 2QJLA 2UU7A 1F2RC 4A6QA 4AS1A 2GBNA 5IA7A 5E6NA 2N7EA 5AZFA 2GBKA 2Z59B 4DHZE 3JW0X 1FO4A 2C7HA 2C5LC 4EEWA 2G4DB 4LNNA 1E8XA 1ZE3D 1GAQB 3DVNV 3MHSD 3U30A 4N58A 2KWDA 1NBFC 1Y56A 2D5GA 3ZJTA 2J7QB 1KLVA 1N60A 1XD3B 3SR6A 1D5ZC 1P1AA 4GB9A 4E74A 2FIFA 2EKIA 2LXCA 2ZVOA 1I7HA 2NTTA 2ZPYA 1FD6A 3DDCB 3NVVA 2PVGC 3H8HA 2BYTA 3PLVA 1YJJA 3R8BA 1WR1A 2LJIA 2DLBA 4C80A 3OLMD 2BBCA 3ETRA 4KVGB 2N9LA 1EM7A 3I57A 1LGRA 4MJSA 3J9CA 2L0TA 1QOBA 4IW0A 2B76B 4MACA 2HTHA 3DBHB 4DK5A 1F52A 1EWCA 3EC8A 1M4VA 2QSDA 2DAJA 3DHGC 4MH8A 4HRSA 2WXPA 1WXQA 3ABVB 1FNUA 2D3BA 5BYQA 2W82A 1ZUD2 3UI3A 4HPMB 1TBEA 2KQ4X 3NS1A 3RPFC 4W9JA 4M02A 3QARA 2KLGA 4B0EA 2DENB 2KDMA 2AQ2B 3Q8CA 5JHBA 2IGHA 1PYWD 4MGYE 1FXAA 1PUTA 2D3GA 1V80A 3PTFC 3R66C 3Q8AA 2L0FA 1V81A 3W1SA 4PT5A 4DBGA 1Y8RC 5IP4D 3HVDA 5TSSA 3EECA 1Z2MA 2HDEA 3ZNZB 4YL8A 4B0MA 4US9A 2W3RA 2FUHB 2G9HD 3TUOA 2KN5A 1GOZA 2MBBB 5I4DA 3VUYA 3MJ5A 1C4PA 4REZA 3ZRFA 3RUIB 4G11A 5H92C 2K39A 4K81A 2PVOD 4GSWA 3NS8A 3WANA 4KSLC 4NAMA 1WYGA 2KWCA 1DOYA 2WDRB 2XN9C 1AARA 3M62B 3DQVA 3Q8FA 2ZNVC 2WWZA 2H88B 5AZHA 1C77A 4A55A 1DOIA 5D2MB 1J0GA 5G5GA 3N32A 1OQYA 4X57B 4F7ZA 1JRPA 1FNWA 4NQLB 4ANXA 2OOBB 5C23A 2DAFA 1WGGA 1F77A 2X38A 3PS6A 1FEHA 4L1BA 1TZOA 4WQMA 3IVFA 4ZOHC 2MLBA 2WP9B 4PK1A 3RNEC 1C79A 4YSXB 3H7PB 1JROA 2AL6A 3KUCB 2G4SA 2LJ5A 2K8BA 1FCCC 2FCMA
chains in the Genus database with same CATH topology
3KWVA 4US8A 1FFUA 1STEA 2JZPA 3AE5B 1TS5A 2JU6X 4KGTA 2H89B 4MT5A 1FCLA 1NVID 2LUMA 2WS3B 2V3PA 1VDVA 2IPKD 2QMTA 3CWIA 4N6EB 4C7YA 1V97A 1GB1A 4OW0A 2J42A 3NVWA 3R2IA 2MJDA 3FILA 2WXOA 1HEZE 1HZ6A 1PFDA 2AX5A 2M19A 4RGTA 1F0ZA 2KMMA 2PKOA 1P7FA 1UGJA 4J3OD 3Q8BA 4A8XC 5JXVA 4ARCA 1ZXIA 1WGKA 1ZP0B 1DGJA 3AEFB 2CJOA 3NUHB 5EE3A 3URYA 2INNE 4NJCA 3P4PB 1SEBD 1FNVA 4WIPA 1L4DB 1SJHD 2E6XA 1TS3A 1XXGA 1JQ4A 5HG2A 1KRHA 3BK1A 1C9FA 1JWBD 2MJ3A 1PGXA 1HQRD 1HXYD 3V05A 3VQIA 1MHHE 1IBXA 1QT9A 1SJED 1AN8A 2MJEA 1NENB 2PMVA 3P4SB 2WU2B 1RFKA 1TKGA 2FE8A 2RMMA 3P1MA 5D3IB 4ITKA 1L6UA 1ET6A 2PIAA 3B2GA 3ZYYX 2MEKA 1QOGA 4WAFA 3CIRB 3IAM1 2CJNA 2BS2B 2HTME 1D5XC 2AQ1B 4Q2JA 2WDQB 1EWYC 4RF0A 1EU4A 3EUB2 1IGCA 3TEZA 5BYSA 1KTKA 1JWAD 1N5WA 1OQQA 1ET9A 1QLBB 3AEDB 3AE9B 2LFIA 2WXNA 2ZW1A 1L0XB 2L52A 3EA6A 3C8YA 4RNAA 1CZPA 1XLOA 4N59A 4KGRA 1SE2A 2WXLA 4IOIE 1AW7A 1XF5L 4DXGA 1L4ZB 2ZW0A 1CK1A 4GLSC 2J4XA 2ON8A 4JX1C 2V0GA 5T8IA 3AE2B 1E10A 2IJ0A 5C3JB 3AEGB 4L23A 2K5PA 3GB1A 2Y5PA 1L0YB 3BVGA 3O13A 1D5MC 4KKIA 4YSZB 4RGMA 1IBXB 1TKYA 4YWGG 1ESFA 4YTMB 1ZPSA 1XLQA 1I4QA 3AECB 5C2TB 3RFZB 5H8YE 5BMGA 4YXDB 2LHEA 2LEKA 4EE2A 2GRIA 3Q8EA 5E6JA 3VRAB 1FRDA 2NMQA 4YSYB 2L1AA 2INPE 1EU3A 1TJEA 1H7XA 3SEBA 2WXKA 1ENFA 1YJIA 4O1NA 2I38A 2BS3B 2CU3A 1WSPA 3E56A 3AH7A 1P7EA 5EE1A 4FXCA 1SE3A 1NYQA 3MFGA 1KFYB 3TSSA 1UWMA 2L83A 3L4PA 1NI3A 3P63A 5EE9A 3BYTB 1SIJA 2QEJC 1UWXA 1T5XD 3IXSA 3ZJVA 3N9YC 1QILA 3VR9B 2WU5B 1NYRA 1TY2A 1CJEA 1J7BA 1FRRA 3MC0B 4RCOA 1KLGD 1KH0A 2FUG1 1V1PA 4JPSA 3VR8B 4ZRQA 1JWUD 4D2KA 5FK9C 1V1OA 4JE3B 3U7ZA 4RH6A 1WRIA 4XE0A 3TEWA 4NAWB 5MPOA 3BIID 3TEYA 1E7PB 1QOFA 4TQ0A 1JWSD 1XO3A 2E3TA 1VJKA 4H2AA 4HKZE 1E6EB 2DYMA 3T3NA 1Q10A 4ARIA 1J7CA 3AE7B 3NVYA 1MVKA 5HFYA 1C4CA 3AN1A 2JYTA 2XNAC 3LXFA 2NTSA 3LB8C 5AUKA 1FXIA 2Z8LA 2KAJA 2YEPB 1MI0A 2BW2A 3AE4B 3KLSX 1R7SA 4KGSA 2QILA 3AM9A 3W9CB 4XWWA 2BT6A 1K50A 1TY0A 1KLUD 4WURA 5D7GA 3IT6B 1E9MA 3FC4A 1XCTL 3SFEB 3GP7A 2LGIA 3P4RB 3BYYB 4LK0M 3U52E 3P42A 1TS2A 1C78A 1VR9A 1TYGB 2PW9A 4USAA 5AUIA 1I4GA 1B1ZA 4YTPB 1VZ6A 2PLPA 2W3SA 3MHZA 1B9RA 2K0PA 4DXFA 4OHJA 5BYRA 2DWQA 3ZGZA 3ZQ4A 1XEEA 5D3DA 2ACZB 3AEBB 1H7WA 1L6VA 1TKEA 3U2SC 1FMAD 1JWMD 1SBBB 3B9JA 3NRZA 3PZ8A 1VZ8A 3W5VB 4AQ7A 2KACA 2RDGA 2YEPF 1T3QA 2W54A 2Q5WD 3ZJUA 4IKGA 1N62A 5HHDG 1GB4A 1XCQL 4OZCA 1MPEA 1L5PA 1IGDA 3E9SA 3NVZA 2SAKA 2K3UA 3P4QB 1XLNA 1ZXHA 2N0SB 4TQ1A 2M56B 1HZ5A 2QJLA 4A6QA 1F2RC 4TMAB 4AS1A 2Y5CA 5BMHA 2JSVX 1I4RA 1I4PA 3I9V1 2TSSA 2WXRA 2JXTA 2J52A 1MHXA 1FO4A 1UUPA 3OWEB 3BVMA 4HKQA 1T6BX 1F2RI 2GB1A 3R2TA 4RGNA 3AMZA 3AEEB 1ZE3D 3IT4B 1GAQB 4JWSC 4M0WA 4HEA1 2PTLA 4OZAA 5FKAC 4N58A 1JMLA 1N5XA 1VLBA 5FR3A 2KWDA 4A9AA 1QOAA 1OFFA 1K52A 3FILB 5G5HA 1Y56A 2D5GA 2WXQA 3ZJTA 4YT0B 1SB3C 4WWMA 1N60A 3AE6B 2BB5A 2LHDA 4ZRPA 3SR6A 3BWUD 1D5ZC 4KX6B 3BK2A 3LYYA 1YN4A 1I4HA 4KKJA 2EKIA 1LO5D 1QKZA 1D6EC 1I7HA 2NTTA 1FD6A 3NVVA 3GS2A 2PVGC 3HUIA 1N61A 3H8HA 2BYTA 2V4IB 4LLGM 1YJJA 2WXGA 1IUEA 2AQ3B 3R8BA 2LJIA 2DLBA 1RM6C 4C80A 1WWTA 4XWTA 4TSSA 2BBCA 1YQ3B 3ETRA 1HA5A 3IAS1 2N9LA 4JWUC 1C76A 2RPVA 1EM7A 3I57A 4RF1A 1K53A 3J9CA 1FIQA 2WXFA 2WXJA 3AE3B 1QOBA 2N9KA 3MP9A 2B76B 4MACA 1RWSA 3W2DA 1YN5A 1JCKB 3SFDB 4ZYSA 1EWCA 2JX5A 1QQRA 2M0AA 1M4VA 2QSDA 4A90A 4MH8A 4HRSA 2WLBA 1I4XA 2IGGA 2WXPA 1WXQA 3ABVB 3WCQA 1UNSA 3CF4A 1FNUA 5BYQA 1SXTA 5LNK1 1D4BA 2W82A 2QIEB 2WXHA 3PO0A 2IDYA 4RFBA 1ZUD2 2R61A 4HJGE 3UI3A 4ZHPA 1SF0A 1GPXA 2KQ4X 1K51A 3NS1A 2K9XA 1ZDVA 3RPFC 4B0EA 1GTHA 2KDMA 4YTNB 2AQ2B 3HVZA 3Q8CA 2WNMA 1YN3A 2WXMA 1ZOYB 2SEBD 2IGHA 1PYWD 4MM3B 1FFVA 3KWLA 1FXAA 1V1PB 1PUTA 1ROEA 1SSNA 2ONQA 1JALA 1SE4A 2OEDA 3Q8AA 3PZ7A 2V3NA 3W1SA 4PT5A 3AB5A 3BZDB 3V3XA 3KQ4A 3HVDA 4RGOS 5TSSA 4NZLB 3TEXA 4LTUA 2HDEA 2L32A 1PGBA 4B0MA 1BUIC 1A70A 4US9A 2I2YA 4CQNA 2W3RA 2WXIA 2G9HD 3TUOA 1GOZA 5I4DA 1DYQA 2W55A 2DBYA 3MJ5A 1C4PA 1BMLC 4REZA 1AYFA 1ACCA 2N7JA 4C7ZA 2EELA 1YNTE 5H92C 3VRBB 2PVOD 1C4AA 2KN4A 1AWDA 2BTEA 1BXTA 3DWGC 4NAMA 4C56C 2OHFA 1WYGA 1QF6A 3BVZA 1DOYA 2WDRB 2ICIA 3AE8B 2XN9C 2J53A 3AV8A 3Q8FA 2H88B 1JW9D 2BS4B 1C77A 2DYOA 4A55A 4P6VF 1DOIA 2WDVB 3W5UB 5G5GA 1YMHE 1TS4A 4L2YA 4GDLB 3NZ3A 1RYJA 4OVZA 3FAHA 5BMIA 1VZ7A 1L0VB 1JRPA 1VRAB 1ZDXA 1N63A 1FNWA 2K22A 1PDXA 4HROA 2MH7A 1GTEA 1PGAA 2IGDA 2GI9A 2RDHA 2JQRB 2WQYB 1V8CA 2G1EA 2FBWB 2Y3AA 1OQRA 3B2FA 4XDCA 2JYEA 3T3OA 2VZKD 3U4EG 1E0ZA 4OZBA 3EGRA 1F77A 2X38A 3Q69A 1KF6B 1FEHA 4L1BA 3AE1B 1TZOA 4WQMA 3DWMA 4ZOHC 5HI1A 4GDKB 2WP9B 2LMCA 4WH4A 5EE0A 4P16A 1C79A 4YSXB 2BB6A 1YQ4B 3AEAB 3HRDD 4XDDA 1JROA 4R3DA 4DQOC 4ZHOA 1CQVA 1DOXA 1XLPA 4IDIA 5GXGB 4UDUC 1FM0D 1GT8A 2VZKB 1FCCC 1NEKB 1J7AA 2JWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRA B;  1FRD A;  3HVZ A;  1FFU A;  4YSY B;  3NVZ A;  3AE5 B;  4US8 A;  2H89 B;  1NVI D;  1ZOY B;  2WS3 B;  1TJE A;  1H7X A;  3P4Q B;  1XLN A;  1VDV A;  1YJI A;  1FFV A;  2N0S B;  3KWL A;  1FXA A;  2M56 B;  1PUT A;  1ROE A;  3CWI A;  4N6E B;  4C7Y A;  1V97 A;  2BS3 B;  2CU3 A;  2QJL A;  1JAL A;  3AH7 A;  2Y5C A;  3NVW A;  4FXC A;  5EE1 A;  1NYQ A;  2MJD A;  1F0Z A;  1PFD A;  2AX5 A;  2M19 A;  2KMM A;  1KFY B;  2PKO A;  1UWM A;  2L83 A;  3L4P A;  3AB5 A;  1NI3 A;  3P63 A;  5EE9 A;  1FO4 A;  1SIJ A;  1ZXI A;  1WGK A;  1ZP0 B;  1DGJ A;  3AEF B;  2CJO A;  5EE3 A;  4LTU A;  3P4P B;  3AMZ A;  3VR9 B;  2WU5 B;  3AEE B;  1A70 A;  1CJE A;  1J7B A;  1FRR A;  1NYR A;  2W3R A;  1GAQ B;  4JWS C;  3VR8 B;  1JQ4 A;  1KRH A;  4N58 A;  2W55 A;  1N5X A;  1VLB A;  1JWB D;  2DBY A;  2MJ3 A;  4A9A A;  1QOA A;  1OFF A;  5G5H A;  1WRI A;  1AYF A;  5MPO A;  3BII D;  4C7Z A;  4YT0 B;  1E7P B;  1QOF A;  1SB3 C;  5H92 C;  4WWM A;  1N60 A;  3AE6 B;  3VRB B;  1QT9 A;  1XO3 A;  2E3T A;  2PVO D;  1VJK A;  2MJE A;  1NEN B;  3SR6 A;  1E6E B;  3P4S B;  4KX6 B;  2WU2 B;  1AWD A;  1J7C A;  1RFK A;  1TKG A;  3DWG C;  3P1M A;  4ITK A;  3AE7 B;  3NVY A;  1L6U A;  2EKI A;  1WYG A;  2OHF A;  1QF6 A;  3ZYY X;  2PIA A;  3B2G A;  3AN1 A;  2WDR B;  1DOY A;  3AE8 B;  3LXF A;  1I7H A;  1GPX A;  3LB8 C;  5AUK A;  1QOG A;  1FXI A;  3AV8 A;  3CIR B;  2H88 B;  2KAJ A;  3NVV A;  2PVG C;  1JW9 D;  2BS4 B;  1N61 A;  3HUI A;  2CJN A;  2BS2 B;  3AE4 B;  2HTM E;  4P6V F;  1R7S A;  1YJJ A;  1DOI A;  2WDQ B;  1IUE A;  2WDV B;  4JWU C;  1EWY C;  5G5G A;  3W5U B;  1RM6 C;  3EUB 2;  1WWT A;  4C80 A;  3AM9 A;  3W9C B;  2BT6 A;  1YQ3 B;  3ETR A;  1RYJ A;  1E9M A;  1JWA D;  1N5W A;  3SFE B;  1L0V B;  1JRP A;  3P4R B;  1OQQ A;  1N63 A;  3FC4 A;  3FAH A;  1QLB B;  3AED B;  3AE9 B;  2K22 A;  1FIQ A;  1PDX A;  1TYG B;  2MH7 A;  2L52 A;  3AE3 B;  4HRO A;  1GTE A;  1QOB A;  4USA A;  5AUI A;  2B76 B;  4YTP B;  1RWS A;  1CZP A;  1XLO A;  4N59 A;  2W3S A;  2JQR B;  1B9R A;  2WQY B;  1V8C A;  2G1E A;  3SFD B;  2FBW B;  1OQR A;  2JX5 A;  3B2F A;  2DWQ A;  1E0Z A;  2ACZ B;  3AEB B;  4HRS A;  2WLB A;  4US9 A;  4JX1 C;  1KF6 B;  1H7W A;  1L6V A;  1WXQ A;  3ABV B;  3AE2 B;  3AE1 B;  3WCQ A;  1E10 A;  4WQM A;  1TKE A;  3CF4 A;  5C3J B;  3AEG B;  1FMA D;  3B9J A;  3DWM A;  3NRZ A;  4ZOH C;  2K5P A;  2WP9 B;  3W5V B;  5EE0 A;  2QIE B;  3PO0 A;  1ZUD 2;  4YSX B;  1YQ4 B;  3AEA B;  4YSZ B;  1T3Q A;  1JRO A;  1TKY A;  3HRD D;  1SF0 A;  4YTM B;  4ZHO A;  1XLQ A;  2W54 A;  4ZHP A;  1DOX A;  3AEC B;  5C2T B;  1XLP A;  2Q5W D;  4IDI A;  5GXG B;  4YXD B;  2K9X A;  1FM0 D;  3NS1 A;  5H8Y E;  1GT8 A;  3RPF C;  1N62 A;  2LEK A;  1GTH A;  1NEK B;  1J7A A;  1L5P A;  4YTN B; 
#chains in the Genus database with same CATH topology
 2IO2 B;  4DHJ B;  4PS8 A;  1FCL A;  3N1Y C;  2QMT A;  4FHK A;  3CWI A;  4K1R B;  1V97 A;  4GDK A;  2M17 A;  3NVW A;  3R2I A;  2MBH A;  1F0Z A;  1HEZ E;  3EFU A;  2IO0 B;  1UGJ A;  2N7D A;  4A8X C;  4CYE A;  4BOS C;  3OAW A;  1ZP0 B;  1H4R A;  3AEF B;  2CJO A;  1WXM A;  2CHW A;  2K8H A;  4KDI C;  5EE3 A;  2INN E;  3HIZ A;  3QK0 A;  3URY A;  3JYU A;  3P4P B;  1L4D B;  1HTO A;  3VAW A;  1XXG A;  4IM3 A;  3BK1 A;  2D2Q A;  1P0R A;  3VQI A;  3V05 A;  4DDG D;  5LXH A;  3ZRC A;  1QT9 A;  2PMV A;  4K3B A;  5D3I B;  2KLC A;  3ZNI D;  4ANU A;  1QOG A;  2NBU A;  2WX0 A;  2LAS A;  2CJN A;  2UWQ A;  2BS2 B;  3Q3N C;  2AQ1 B;  2A5U A;  4FLH A;  2WHI A;  1IGC A;  3TEZ A;  3L0W B;  1N5W A;  2WXN A;  2L52 A;  5IO9 A;  2KDB A;  3IHP C;  4A3O A;  1CZP A;  2D3C A;  4KGR A;  1J19 A;  1KJT A;  4DXG A;  1V49 A;  3VHT C;  4C4V A;  4II2 B;  4W9D A;  4RM8 A;  2KQ7 A;  1VCB A;  2MP2 A;  3AEG B;  3UIN B;  2NCN A;  3DVG X;  3O13 A;  3VXW A;  4YSZ B;  1WM2 A;  5C2T B;  3UQA A;  5BMG A;  3NZS A;  4AWJ A;  2LEK A;  4C4V B;  1TJE A;  1H7X A;  1WXA A;  2MP2 B;  2I38 A;  1EO6 A;  1WSP A;  3E56 A;  3AH7 A;  5EE1 A;  1NYQ A;  3MFG A;  2LXA A;  3Q3J A;  3Q3M C;  4S0R A;  3P63 A;  1IYF A;  2M0X A;  4JL9 A;  3IXS A;  4CHK A;  1QIL A;  1L7Y A;  2AL3 A;  2HD5 B;  3A1Q A;  1FRR A;  2N9E B;  3GE8 C;  4BBN F;  1V1P A;  4ZRQ A;  1JWU D;  2J0J A;  4M8N A;  1T0R C;  1WRI A;  3AU5 A;  4NAW B;  3BII D;  4JGH B;  5IOI A;  2E3T A;  1WM3 A;  4HKZ E;  1J7C A;  3NOB A;  3NVY A;  4IC7 B;  2N9X A;  3AN1 A;  4N9F 4;  3B1L X;  3AXC A;  3N1X C;  2Z8L A;  4W9G A;  4KGS A;  3SHQ A;  1WFY A;  4WWN A;  1K50 A;  5D7G A;  2BVC A;  1XCT L;  3SFE B;  3FC4 A;  4LK0 M;  3RYT A;  3U52 E;  2ZVN A;  3APC A;  2MBE A;  3U8Z A;  4ZDV A;  3PZD A;  3QX1 A;  3GZN B;  3LJ3 A;  3QCA A;  4ZYN A;  4W9E A;  3ZTD A;  4BOZ B;  1TKE A;  1FMA D;  3H6N A;  3PZ8 A;  2JXX A;  2QDF A;  5JH5 C;  2RDG A;  1T3Q A;  2JRH A;  1LFD A;  2C7M B;  3ZJU A;  2UYZ B;  1GB4 A;  2KJR A;  1IGD A;  3TBL D;  3NJT A;  3RNC C;  2K3U A;  5JZE B;  4HPL B;  3RZF A;  2JRI B;  2WXR A;  2JXT A;  1MHX A;  3OWE B;  5CHV C;  3L16 A;  1T0S C;  2GB1 A;  3R2T A;  4RGN A;  3AMZ A;  3AEE B;  4JWS C;  1YQB A;  4GU2 A;  4M0W A;  4WAA A;  4OZA A;  4LNF A;  1QOA A;  1OFF A;  1WH3 A;  3C0R B;  1JRU A;  1SB3 C;  4WWM A;  3AE6 B;  2BB5 A;  3L54 A;  1P9D U;  2NBW B;  1ISN A;  3RNF C;  5IAA C;  3KUD B;  2FID A;  1WJN A;  4II3 B;  4KKJ A;  1LO5 D;  2KFK B;  2GBJ A;  2KOX A;  3GS2 A;  4FAD A;  3HUI A;  1N61 A;  2V4I B;  2WXG A;  1LXD A;  1WGD A;  1RM6 C;  1WWT A;  1LQB A;  4EZK A;  5LXI B;  4RF1 A;  2KVZ A;  1K53 A;  3HM6 X;  1YIW A;  2WXF A;  3AE3 B;  2N9K A;  3V61 A;  5L83 A;  2LGD A;  1S1Q B;  1YN5 A;  1JCK B;  3SFD B;  4BKT A;  1QQR A;  2M0A A;  3WCQ A;  1V86 A;  3CF4 A;  3ZTC A;  2WXH A;  3PO0 A;  5IN7 A;  1WMH A;  2K25 A;  3A33 B;  2R61 A;  4HJG E;  4XX5 A;  4ZHP A;  2HJ8 A;  2ZCC A;  1E5W A;  1K51 A;  3ZXV A;  4YTN B;  2WNM A;  4GN1 A;  1YN3 A;  1UGM A;  2WXM A;  1V5O A;  4MM3 B;  1EF5 A;  3KWL A;  5CHW A;  1YX5 B;  1GC6 A;  4EZL A;  2ONQ A;  1JAL A;  2RR9 A;  1C1Y B;  4FN2 A;  2A4Z A;  1H8C A;  3UIP B;  4PYU A;  1R4M I;  3Q2A C;  4K7S A;  3ZW3 A;  4LNI A;  4LTU A;  2I2Y A;  3QWZ B;  3R7Q A;  1P3Q U;  4C00 A;  2DNF A;  1DYQ A;  2MBO A;  2FCS A;  2IYD B;  4HDQ A;  1TIF A;  3VTU A;  2AEH A;  2D11 A;  1V9J A;  3KUZ A;  2M4N A;  2KJH B;  2BTE A;  1GG3 A;  1XQQ A;  1BXT A;  3DWG C;  2OHF A;  2GOW A;  2J53 A;  3Q3O C;  2G45 B;  2JWZ A;  4P6V F;  4WWP A;  3W5U B;  4NAW A;  1WX8 A;  1WX9 A;  1RYJ A;  2KVR A;  1OEY J;  3IG3 A;  5BMI A;  3WA0 A;  1ZDX A;  1N63 A;  2K22 A;  1PDX A;  3CST A;  2XEW A;  3ZXR A;  3VH4 B;  3EHV A;  2FBW B;  2Y3A A;  1OQR A;  3B2F A;  4XDC A;  2JYE A;  3DBL I;  2DZM A;  4OZB A;  3EGR A;  4LDT D;  1WF9 A;  5HI1 A;  3WIM A;  4GDL A;  4P16 A;  1V6E A;  1YQ4 B;  3HRD D;  4K7U A;  2K6Q A;  1XLP A;  3WAM A;  4F8C B;  1GT8 A;  2VZK B;  3CMM B;  1NEK B;  1J7A A;  2JWU A;  1MG8 A;  3KWV A;  4US8 A;  2JZP A;  1STE A;  4HJK A;  3AE5 B;  1EF1 A;  4MT5 A;  4ZRI A;  1NVI D;  2IPK D;  2FNJ B;  4OW0 A;  4GXB A;  3FIL A;  2CR5 A;  2JZ3 B;  2WXO A;  1PFD A;  2AX5 A;  1DGJ A;  4NJC A;  4KIK A;  5E6O A;  1RLF A;  4WIP A;  2GBM A;  1JQ4 A;  2DX5 B;  5LLI A;  1C9F A;  3SDL C;  1PGX A;  4RMA A;  1HQR D;  1HXY D;  1AN8 A;  2MJE A;  1NEN B;  2JF5 A;  3P4S B;  3ZLZ A;  2WU2 B;  1GNU A;  1TKG A;  2IY1 B;  4NPN A;  3P1M A;  1F1H A;  2QC8 A;  1L6U A;  4ANV A;  2KDE B;  3ZYY X;  5G2N A;  2YVC A;  3CIR B;  1E8Y A;  3A9J B;  2MCN B;  2LGS A;  2I1K A;  1D5X C;  3RNA C;  1EU4 A;  3EUB 2;  4MEM A;  4DHZ B;  3Q6B A;  1QLB B;  2LFI A;  1L0X B;  3EA6 A;  4RNA A;  4N59 A;  1A5R A;  2KJ6 A;  3RCZ A;  2PE9 A;  4S17 A;  1XF5 L;  1L4Z B;  4GLS C;  1KM7 A;  4MDK E;  1L2N A;  2J4X A;  3PSE B;  3AE2 B;  1WJ6 A;  1E10 A;  2IJ0 A;  5C3J B;  4L23 A;  2K5P A;  1SGH A;  2Y5P A;  1L0Y B;  1D5M C;  2MBQ A;  1ESF A;  1ZPS A;  3NG0 A;  3VTW A;  2LHE A;  4PYZ A;  2BWF A;  2PJH A;  3VRA B;  4YSY B;  2WXK A;  1ENF A;  1YJI A;  2CU3 A;  4BKG A;  2WYQ A;  1KFY B;  3TSS A;  3OJ4 B;  3VVW B;  3QC8 B;  3BYT B;  2QEJ C;  2RDB C;  3N9Y C;  3CSF A;  2IO1 B;  1T0Y A;  1NYR A;  2WU5 B;  1TY2 A;  3MC0 B;  1MFW A;  4MEL A;  3PRP B;  4EUT A;  5FR6 A;  4D2K A;  5J18 A;  4DHJ D;  4JE3 B;  3U7Z A;  2ZEQ A;  4XE0 A;  2BGF A;  1XO3 A;  4H2A A;  2XK5 A;  2JZZ A;  2M8S A;  2JYT A;  2XNA C;  3LXF A;  2K1F A;  2NTS A;  1FXI A;  1HTQ A;  2DZI A;  3IBE A;  2BW2 A;  3PGE A;  3AE4 B;  4GIV A;  3OJ3 A;  4P1B C;  4XWW A;  3GP7 A;  2LGI A;  3BYY B;  3H7P A;  3P42 A;  4BFR A;  1TS2 A;  3VH3 B;  1Q0W B;  1I4G A;  4YTP B;  1WY8 A;  1GJZ A;  3JSV B;  3MHZ A;  1NDD A;  2K0P A;  5BYR A;  2KTR A;  1XEE A;  3DVG Y;  2EKE C;  2ACZ B;  3AEB B;  4PS3 A;  5D3D A;  1H7W A;  4ACF A;  5EDS A;  2KAN A;  3U2S C;  1JWM D;  1VZ8 A;  3W5V B;  4MGI E;  2YEP F;  2W54 A;  1Q5W B;  3AI5 A;  4IKG A;  4JIO U;  1XCQ L;  4HLE A;  1L5P A;  2ZZP B;  3UGB B;  3NVZ A;  4ZRJ A;  3R3M A;  3T8M A;  1R4N B;  1S3S G;  3MJW A;  4TMA B;  3RT3 B;  5BMH A;  2JSV X;  1I4R A;  1QZE A;  1I4P A;  3GZN I;  3RI7 C;  4HDO A;  1NI2 A;  2J52 A;  4GMV A;  3M63 B;  4GOC A;  5DPS A;  2MX2 A;  4HKQ A;  1YJ1 A;  1E8Z A;  1T6B X;  1F2R I;  2KWV B;  2BF8 B;  3APF A;  1TGZ B;  1UBQ A;  4BKS A;  3MC8 A;  1UH6 A;  4A9A A;  3GE3 C;  2NS5 A;  2XBB C;  4IUM B;  2LHD A;  4ZRP A;  3BWU D;  4KX6 B;  2DZJ A;  2O6V A;  3BK2 A;  2MHJ A;  1I4H A;  4HVB A;  1D6E C;  3JVZ X;  1U4A A;  4GGQ A;  3PPA A;  4LLG M;  2AQ3 B;  3ZVV A;  4XWT A;  1HA5 A;  3B08 A;  3ML8 A;  3L08 A;  2RPV A;  2PPH A;  2R2Q A;  4IWO A;  3ZDM C;  4AOF A;  2WXJ A;  3MP9 A;  3Q14 C;  4ZYS A;  4M00 A;  1I4X A;  2IGG A;  2KTF A;  2MRP A;  4JLC A;  2CS4 A;  2KHW B;  5LNK 1;  2C9W B;  3AU4 A;  2QIE B;  4RFB A;  3KW5 B;  3UF8 A;  2K9X A;  5BO4 B;  3H9D A;  1GTH A;  1GUA B;  3HHM A;  3QA8 A;  2K8C A;  1ZOY B;  2SEB D;  1FFV A;  1V1P B;  1SSN A;  2N1V A;  3S2A A;  4AJY B;  1SE4 A;  5CX3 A;  4W9C A;  1WE6 A;  2V3N A;  3QHT A;  3K9O B;  2GBR A;  3O65 B;  3AB5 A;  4IWP A;  4MH0 E;  3RMK C;  3QAQ A;  2OJR A;  4FJY A;  1HE8 A;  4NZL B;  2L32 A;  2M1M A;  1PGB A;  5CTR C;  3K9P B;  2NBV B;  2O2V A;  5AZG A;  2DBY A;  1BML C;  3KYC D;  1ACC A;  4C7Z A;  2EEL A;  4TKN A;  5KHQ A;  2KX3 A;  1C4A A;  2N9P C;  4M01 A;  1AWD A;  2D3A A;  4IG7 B;  1QF6 A;  4MGZ E;  3AE8 B;  1BT0 A;  2BYE A;  2KK8 A;  3AV8 A;  1R4M B;  1MG4 A;  1JW9 D;  2REX A;  3DOW A;  1KOT A;  2LGX A;  2WDV B;  1YD8 U;  5TR5 A;  1YMH E;  4BVU C;  4L2Y A;  3TJP A;  4GDL B;  3NZ3 A;  4OVZ A;  4DWF A;  3FAH A;  1VZ7 A;  1L0V B;  5DCN A;  2MW5 A;  4HRO A;  1SIF A;  2MH7 A;  1SE9 A;  1GTE A;  4KIK B;  2RSU A;  2GI9 A;  2J0M A;  2RDH A;  4TV3 A;  2G1E A;  2BPS A;  3PRM B;  3T3O A;  2VZK D;  3U4E G;  3AUL A;  3GOE A;  1KF6 B;  3A9K B;  3AE1 B;  4NNJ B;  3DWM A;  2CU1 A;  4GDK B;  3ALB A;  1UEL A;  4XDD A;  3AEA B;  4WQO B;  4R3D A;  3VUW A;  1CQV A;  2ASQ A;  2BKR B;  2V3S A;  3DBH I;  5GXG B;  4IWQ A;  2X8X X;  2LRW A;  1RAX A;  4KGT A;  2H89 B;  1UZX B;  2WS3 B;  1VDV A;  2EMT A;  4N6E B;  3N1Z C;  2J42 A;  2MJD A;  1HZ6 A;  4RGT A;  2M19 A;  3DBL B;  4I6P A;  2PKO A;  1P7F A;  3KVF B;  4J3O D;  3Q8B A;  5JXV A;  1WGK A;  1X1M A;  3WAP A;  1SEB D;  1FNV A;  2E6X A;  1TS3 A;  3MTN B;  1ZW7 A;  1KRH A;  4EOY A;  2Z0E B;  4W9L A;  2JY6 A;  2KT7 A;  3R7R A;  2IO3 B;  2V4L A;  1IBX A;  1MHH E;  1SJE D;  3DHH C;  4DDI D;  4WJO A;  2FE8 A;  2RMM A;  4ITK A;  2AWT A;  1TT5 B;  1ET6 A;  2PIA A;  3B2G A;  2MEK A;  4K7W A;  4WAF A;  3EFC A;  4PS7 A;  2HTM E;  1WGY A;  4RF0 A;  1R4N I;  4RM9 A;  3C19 A;  2GLS A;  1KTK A;  1JWA D;  5J17 A;  1ET9 A;  3ML9 A;  1CMX B;  4IOI E;  1AW7 A;  2L00 B;  1M94 A;  2FCQ A;  1WR6 E;  4FUL A;  4JX1 C;  1WXS A;  5T8I A;  2N1W A;  4B9K A;  4YWG G;  1XLQ A;  3WAL A;  2KC1 A;  4QAY A;  5H8Y E;  4YXD B;  2L3Z A;  4AP4 C;  2LVO A;  4P1C C;  3Q8E A;  4HCP B;  5GMV A;  2G3Q B;  2BYV E;  2L1A A;  1FXT B;  2NR2 A;  3SEB A;  4W9H A;  4B6W A;  4O1N A;  4BZA A;  2KKC A;  1P7E A;  5KHO A;  4FXC A;  1SE3 A;  1V5T A;  3ZIM A;  2EMS A;  4TUU A;  3KYD D;  1NI3 A;  5EE9 A;  2KMA A;  1SIJ A;  1UWX A;  1T5X D;  2NPT A;  1RRB A;  3ZJV A;  1J7B A;  3DHI C;  2Z0D B;  1KH0 A;  4JPS A;  3VTV A;  1V2Y A;  5FK9 C;  1V1O A;  4LNO A;  3TEW A;  3T9L A;  3TEY A;  1E7P B;  1QOF A;  1UF0 A;  3I5J C;  2O6V D;  1JWS D;  4ASW C;  2C7N B;  5DPR A;  1E6E B;  4G3X B;  1Q10 A;  3T3N A;  2NVU I;  3Q3F A;  1P98 A;  2KO3 A;  5HFY A;  2KYW A;  5AUK A;  2LZ6 A;  3PVL A;  2YEP B;  3ZKJ C;  1VD2 A;  1R7S A;  2W9N A;  3D32 A;  1E7V A;  2QIL A;  3AM9 A;  3W9C B;  2JT4 B;  4BBN C;  2BT6 A;  4WUR A;  1KLU D;  3W1Y A;  3IT6 B;  1RFA A;  3P4R B;  4MJS B;  5G55 A;  3TIX A;  1VR9 A;  1TYG B;  4USA A;  1VZ6 A;  3BIN A;  4IM0 A;  3RN9 C;  4OHJ A;  3VUX A;  2DWQ A;  3ZQ4 A;  3PLU A;  3A1Q B;  3L10 B;  2LWP A;  5DPT A;  1SBB B;  3B9J A;  4LDT B;  2V9H A;  2I1J A;  3A4R A;  3B0A A;  2RGF A;  4F1S A;  4E71 A;  2GMI C;  4HXD A;  1N62 A;  5HHD G;  4OZC A;  1MPE A;  3E9S A;  2MWS B;  2ZJD A;  2MQJ A;  2SAK A;  3P4Q B;  1XLN A;  2KC2 A;  2N0S B;  2M56 B;  1HZ5 A;  4W9I A;  2BYF A;  4XGA B;  2VH2 A;  2Y5C A;  4NY0 A;  4K3C A;  5JHA A;  3I9V 1;  2TSS A;  3SD5 A;  2FCN A;  1UUP A;  3BVM A;  2O6V B;  2NPT B;  4MGK E;  2CHX A;  4CO7 A;  5J2R A;  2IZV B;  3IT4 B;  1WZ0 A;  4HEA 1;  2KTR B;  2PTL A;  5FKA C;  1JML A;  1N5X A;  1VLB A;  5FR3 A;  3FIL B;  1K52 A;  5G5H A;  2WXQ A;  5D94 A;  4YT0 B;  3FKY A;  3BY4 B;  3LYY A;  1Z5S B;  1YN4 A;  2L76 A;  1N6Z A;  3TCA A;  4FJZ A;  1QKZ A;  4MSM B;  2DHZ A;  2C60 A;  4ZRK A;  1IUE A;  4BKS D;  4TSS A;  1YQ3 B;  3IAS 1;  4JWU C;  1C76 A;  4AUQ C;  2N4F A;  1UBI A;  1FIQ A;  2LI5 A;  3ECI A;  1RWS A;  2QCZ A;  3W2D A;  4G0N B;  1I42 A;  3A4S C;  3JSV A;  2JX5 A;  4A90 A;  2WLB A;  3DBR I;  3N20 C;  3OG5 A;  1UNS A;  1SXT A;  1D4B A;  4OVU A;  2L7R A;  4BAX A;  2IDY A;  2WGS A;  1SF0 A;  2IY0 B;  1GPX A;  4KV2 A;  1ZDV A;  4MSQ B;  1WXV A;  2VRR B;  2Y5B B;  3HVZ A;  4WJP A;  4KZC A;  3ZNH B;  1WGH A;  1ROE A;  4A3P A;  2O2V B;  3I3T B;  4EZJ A;  2OED A;  4IM2 A;  3H7S A;  3V6C B;  3DBS A;  5AEK B;  1EUV B;  3PZ7 A;  3RZW C;  2K6D B;  2BWE S;  2XK5 B;  2AYO B;  3BZD B;  2KZR A;  3KQ4 A;  3V3X A;  1ZGU B;  4RGO S;  2PEA A;  3TEX A;  1Q1O A;  3ZDT A;  2IND C;  2DYB A;  1BUI C;  1A70 A;  3APD A;  1TTN A;  4NJ6 A;  2WXI A;  4CQN A;  2W55 A;  2QHO A;  1WYW B;  4OVV A;  3V62 A;  1E90 A;  1AYF A;  2N7J A;  5HKH A;  1YNT E;  3CF6 E;  3VRB B;  2LUE A;  1PQS A;  3H1U A;  2KN4 A;  3PT2 B;  4XC2 A;  2KMC A;  4C56 C;  4LNK A;  2BKF A;  3SU8 X;  3BVZ A;  2ICI A;  5D6J B;  2BQQ A;  2KFK A;  4XZ4 A;  4G50 A;  3UIO B;  2BS4 B;  3UQB A;  2DYO A;  3L13 A;  2V1Y A;  3A9K A;  3PHW B;  4B95 A;  1TS4 A;  2HE7 A;  1TZ1 A;  1VRA B;  2D10 A;  2ZPN A;  3PRZ A;  1PGA A;  2IGD A;  4ICU A;  2JQR B;  2WQY B;  1V8C A;  2WX1 A;  1E0Z A;  1I35 A;  5DPW A;  4KDL B;  3Q69 A;  1K8R B;  3NZU A;  1WJU A;  5IKC M;  2LMC A;  4WH4 A;  5EE0 A;  3X0W A;  2BB6 A;  3L17 A;  1WMH B;  4DQO C;  4ZHO A;  4HWI B;  1DOX A;  4IDI A;  4UDU C;  1E7U A;  1FM0 D;  3QQ8 B;  2CKH B;  3DBR B;  1LM8 B;  1F9J A;  1FFU A;  1TS5 A;  2JU6 X;  2LUM A;  2V3P A;  4C7Y A;  1GB1 A;  3P2B A;  4DXA B;  1C3T A;  4WJQ A;  2KMM A;  1E8W A;  4ARC A;  1ZXI A;  2D07 B;  3NUH B;  2PE6 B;  1SJH D;  2J0K A;  4LJP B;  4LCD E;  1WI0 A;  5HG2 A;  1JWB D;  2LD9 A;  2MJ3 A;  2LVP A;  4FA6 A;  3PV1 A;  4ICV A;  2KDF B;  5CHF A;  2LVQ A;  4W9F A;  1RFK A;  1OEY A;  1G6J A;  3RD2 A;  2KNB A;  3IAM 1;  4I6L B;  4Q2J A;  3RNG C;  2OJW A;  2WDQ B;  1EWY C;  2KFJ A;  3N30 A;  5BYS A;  1WX7 A;  4WWO A;  4I6N B;  1WZ3 A;  2L8J A;  1OQQ A;  3ZUN A;  3KH0 A;  2JVC A;  3AED B;  3AE9 B;  1WGR A;  2ZW1 A;  3C8Y A;  1XLO A;  4EKU A;  1SE2 A;  3VFK A;  2WXL A;  2RD0 A;  3PRE A;  2ZW0 A;  1CK1 A;  3PHX B;  2JUO A;  3M3J A;  2ON8 A;  4MM3 A;  2V0G A;  3QJZ A;  1D3Z A;  2MSE D;  3HM3 A;  1GC7 A;  3ZNG C;  3DPD A;  4LJO B;  4FJV B;  3ONS A;  2IBI B;  1MJD A;  3GB1 A;  1WIA A;  3BVG A;  3VDZ A;  2MA9 B;  4KKI A;  3TL5 A;  3DCG A;  4RGM A;  1IBX B;  1TKY A;  4YTM B;  2CHZ A;  3TMP B;  3V60 A;  1I4Q A;  3MC9 A;  3AEC B;  3RFZ B;  1FPY A;  3U7D A;  4EE2 A;  2GRI A;  5E6J A;  2DZK A;  1FRD A;  2KD0 A;  2NMQ A;  1IP9 A;  2INP E;  1EU3 A;  3DVN U;  2BS3 B;  3RNB C;  2B3A A;  3ENE A;  2INC C;  5E6P A;  1J8C A;  2KDI A;  1UWM A;  2L83 A;  3L4P A;  1WE7 A;  3HK0 A;  4XYC A;  2R2O A;  2KQS A;  3VR9 B;  1CJE A;  4RCO A;  4P7I A;  4HPP A;  2JPH A;  1KLG D;  3NHE B;  2FUG 1;  4FHJ A;  3VR8 B;  4HCN B;  3RUL A;  4RH6 A;  2VH1 A;  4URK A;  3IFW B;  4E3C A;  5MPO A;  4TQ0 A;  2HJ1 A;  1VJK A;  3V6E B;  2DYM A;  4ARI A;  4NQK E;  4EFO A;  4AJW A;  3AE7 B;  1MVK A;  1YX6 B;  1C4C A;  2KWU B;  3LB8 C;  1UD7 A;  2YLM A;  3WAO A;  2KAJ A;  2RPQ A;  3A9J A;  1MI0 A;  3KLS X;  4HK2 A;  5C1Z A;  2WDT B;  1OTR B;  2L05 A;  2KXJ A;  3ZO5 B;  1TY0 A;  4JQW C;  5L95 C;  1ZKH A;  1E9M A;  2KX0 A;  1XT9 B;  1YOV B;  1C78 A;  4J6I A;  4FBJ B;  2PW9 A;  5AUI A;  1B1Z A;  4M8M A;  1T0Q C;  2FAZ A;  1WRD B;  2PLP A;  2W3S A;  1B9R A;  2ZNV B;  3LDZ E;  1WJ4 A;  4DXF A;  3W1S C;  3ZGZ A;  2LRU A;  1L6V A;  2LGY A;  4WJN A;  2ZCB A;  4NJ7 A;  3NRZ A;  1OGW A;  4AQ7 A;  2KAC A;  3QIJ A;  3M95 A;  2Q5W D;  3I63 C;  4KZ0 A;  4ANW A;  4KSK C;  3N3K B;  1ZXH A;  4TQ1 A;  3X23 A;  3NY5 A;  4A20 A;  1IPG A;  4M0W B;  4W9K A;  2QJL A;  2UU7 A;  1F2R C;  4A6Q A;  4AS1 A;  2GBN A;  5IA7 A;  5E6N A;  2N7E A;  5AZF A;  2GBK A;  2Z59 B;  4DHZ E;  3JW0 X;  1FO4 A;  2C7H A;  2C5L C;  4EEW A;  2G4D B;  4LNN A;  1E8X A;  1ZE3 D;  1GAQ B;  3DVN V;  3MHS D;  3U30 A;  4N58 A;  2KWD A;  1NBF C;  1Y56 A;  2D5G A;  3ZJT A;  2J7Q B;  1KLV A;  1N60 A;  1XD3 B;  3SR6 A;  1D5Z C;  1P1A A;  4GB9 A;  4E74 A;  2FIF A;  2EKI A;  2LXC A;  2ZVO A;  1I7H A;  2NTT A;  2ZPY A;  1FD6 A;  3DDC B;  3NVV A;  2PVG C;  3H8H A;  2BYT A;  3PLV A;  1YJJ A;  3R8B A;  1WR1 A;  2LJI A;  2DLB A;  4C80 A;  3OLM D;  2BBC A;  3ETR A;  4KVG B;  2N9L A;  1EM7 A;  3I57 A;  1LGR A;  4MJS A;  3J9C A;  2L0T A;  1QOB A;  4IW0 A;  2B76 B;  4MAC A;  2HTH A;  3DBH B;  4DK5 A;  1F52 A;  1EWC A;  3EC8 A;  1M4V A;  2QSD A;  2DAJ A;  3DHG C;  4MH8 A;  4HRS A;  2WXP A;  1WXQ A;  3ABV B;  1FNU A;  2D3B A;  5BYQ A;  2W82 A;  1ZUD 2;  3UI3 A;  4HPM B;  1TBE A;  2KQ4 X;  3NS1 A;  3RPF C;  4W9J A;  4M02 A;  3QAR A;  2KLG A;  4B0E A;  2DEN B;  2KDM A;  2AQ2 B;  3Q8C A;  5JHB A;  2IGH A;  1PYW D;  4MGY E;  1FXA A;  1PUT A;  2D3G A;  1V80 A;  3PTF C;  3R66 C;  3Q8A A;  2L0F A;  1V81 A;  3W1S A;  4PT5 A;  4DBG A;  1Y8R C;  5IP4 D;  3HVD A;  5TSS A;  3EEC A;  1Z2M A;  2HDE A;  3ZNZ B;  4YL8 A;  4B0M A;  4US9 A;  2W3R A;  2FUH B;  2G9H D;  3TUO A;  2KN5 A;  1GOZ A;  2MBB B;  5I4D A;  3VUY A;  3MJ5 A;  1C4P A;  4REZ A;  3ZRF A;  3RUI B;  4G11 A;  5H92 C;  2K39 A;  4K81 A;  2PVO D;  4GSW A;  3NS8 A;  3WAN A;  4KSL C;  4NAM A;  1WYG A;  2KWC A;  1DOY A;  2WDR B;  2XN9 C;  1AAR A;  3M62 B;  3DQV A;  3Q8F A;  2ZNV C;  2WWZ A;  2H88 B;  5AZH A;  1C77 A;  4A55 A;  1DOI A;  5D2M B;  1J0G A;  5G5G A;  3N32 A;  1OQY A;  4X57 B;  4F7Z A;  1JRP A;  1FNW A;  4NQL B;  4ANX A;  2OOB B;  5C23 A;  2DAF A;  1WGG A;  1F77 A;  2X38 A;  3PS6 A;  1FEH A;  4L1B A;  1TZO A;  4WQM A;  3IVF A;  4ZOH C;  2MLB A;  2WP9 B;  4PK1 A;  3RNE C;  1C79 A;  4YSX B;  3H7P B;  1JRO A;  2AL6 A;  3KUC B;  2G4S A;  2LJ5 A;  2K8B A;  1FCC C;  2FCM A; 
#chains in the Genus database with same CATH homology
 3KWV A;  4US8 A;  1FFU A;  1STE A;  2JZP A;  3AE5 B;  1TS5 A;  2JU6 X;  4KGT A;  2H89 B;  4MT5 A;  1FCL A;  1NVI D;  2LUM A;  2WS3 B;  2V3P A;  1VDV A;  2IPK D;  2QMT A;  3CWI A;  4N6E B;  4C7Y A;  1V97 A;  1GB1 A;  4OW0 A;  2J42 A;  3NVW A;  3R2I A;  2MJD A;  3FIL A;  2WXO A;  1HEZ E;  1HZ6 A;  1PFD A;  2AX5 A;  2M19 A;  4RGT A;  1F0Z A;  2KMM A;  2PKO A;  1P7F A;  1UGJ A;  4J3O D;  3Q8B A;  4A8X C;  5JXV A;  4ARC A;  1ZXI A;  1WGK A;  1ZP0 B;  1DGJ A;  3AEF B;  2CJO A;  3NUH B;  5EE3 A;  3URY A;  2INN E;  4NJC A;  3P4P B;  1SEB D;  1FNV A;  4WIP A;  1L4D B;  1SJH D;  2E6X A;  1TS3 A;  1XXG A;  1JQ4 A;  5HG2 A;  1KRH A;  3BK1 A;  1C9F A;  1JWB D;  2MJ3 A;  1PGX A;  1HQR D;  1HXY D;  3V05 A;  3VQI A;  1MHH E;  1IBX A;  1QT9 A;  1SJE D;  1AN8 A;  2MJE A;  1NEN B;  2PMV A;  3P4S B;  2WU2 B;  1RFK A;  1TKG A;  2FE8 A;  2RMM A;  3P1M A;  5D3I B;  4ITK A;  1L6U A;  1ET6 A;  2PIA A;  3B2G A;  3ZYY X;  2MEK A;  1QOG A;  4WAF A;  3CIR B;  3IAM 1;  2CJN A;  2BS2 B;  2HTM E;  1D5X C;  2AQ1 B;  4Q2J A;  2WDQ B;  1EWY C;  4RF0 A;  1EU4 A;  3EUB 2;  1IGC A;  3TEZ A;  5BYS A;  1KTK A;  1JWA D;  1N5W A;  1OQQ A;  1ET9 A;  1QLB B;  3AED B;  3AE9 B;  2LFI A;  2WXN A;  2ZW1 A;  1L0X B;  2L52 A;  3EA6 A;  3C8Y A;  4RNA A;  1CZP A;  1XLO A;  4N59 A;  4KGR A;  1SE2 A;  2WXL A;  4IOI E;  1AW7 A;  1XF5 L;  4DXG A;  1L4Z B;  2ZW0 A;  1CK1 A;  4GLS C;  2J4X A;  2ON8 A;  4JX1 C;  2V0G A;  5T8I A;  3AE2 B;  1E10 A;  2IJ0 A;  5C3J B;  3AEG B;  4L23 A;  2K5P A;  3GB1 A;  2Y5P A;  1L0Y B;  3BVG A;  3O13 A;  1D5M C;  4KKI A;  4YSZ B;  4RGM A;  1IBX B;  1TKY A;  4YWG G;  1ESF A;  4YTM B;  1ZPS A;  1XLQ A;  1I4Q A;  3AEC B;  5C2T B;  3RFZ B;  5H8Y E;  5BMG A;  4YXD B;  2LHE A;  2LEK A;  4EE2 A;  2GRI A;  3Q8E A;  5E6J A;  3VRA B;  1FRD A;  2NMQ A;  4YSY B;  2L1A A;  2INP E;  1EU3 A;  1TJE A;  1H7X A;  3SEB A;  2WXK A;  1ENF A;  1YJI A;  4O1N A;  2I38 A;  2BS3 B;  2CU3 A;  1WSP A;  3E56 A;  3AH7 A;  1P7E A;  5EE1 A;  4FXC A;  1SE3 A;  1NYQ A;  3MFG A;  1KFY B;  3TSS A;  1UWM A;  2L83 A;  3L4P A;  1NI3 A;  3P63 A;  5EE9 A;  3BYT B;  1SIJ A;  2QEJ C;  1UWX A;  1T5X D;  3IXS A;  3ZJV A;  3N9Y C;  1QIL A;  3VR9 B;  2WU5 B;  1NYR A;  1TY2 A;  1CJE A;  1J7B A;  1FRR A;  3MC0 B;  4RCO A;  1KLG D;  1KH0 A;  2FUG 1;  1V1P A;  4JPS A;  3VR8 B;  4ZRQ A;  1JWU D;  4D2K A;  5FK9 C;  1V1O A;  4JE3 B;  3U7Z A;  4RH6 A;  1WRI A;  4XE0 A;  3TEW A;  4NAW B;  5MPO A;  3BII D;  3TEY A;  1E7P B;  1QOF A;  4TQ0 A;  1JWS D;  1XO3 A;  2E3T A;  1VJK A;  4H2A A;  4HKZ E;  1E6E B;  2DYM A;  3T3N A;  1Q10 A;  4ARI A;  1J7C A;  3AE7 B;  3NVY A;  1MVK A;  5HFY A;  1C4C A;  3AN1 A;  2JYT A;  2XNA C;  3LXF A;  2NTS A;  3LB8 C;  5AUK A;  1FXI A;  2Z8L A;  2KAJ A;  2YEP B;  1MI0 A;  2BW2 A;  3AE4 B;  3KLS X;  1R7S A;  4KGS A;  2QIL A;  3AM9 A;  3W9C B;  4XWW A;  2BT6 A;  1K50 A;  1TY0 A;  1KLU D;  4WUR A;  5D7G A;  3IT6 B;  1E9M A;  3FC4 A;  1XCT L;  3SFE B;  3GP7 A;  2LGI A;  3P4R B;  3BYY B;  4LK0 M;  3U52 E;  3P42 A;  1TS2 A;  1C78 A;  1VR9 A;  1TYG B;  2PW9 A;  4USA A;  5AUI A;  1I4G A;  1B1Z A;  4YTP B;  1VZ6 A;  2PLP A;  2W3S A;  3MHZ A;  1B9R A;  2K0P A;  4DXF A;  4OHJ A;  5BYR A;  2DWQ A;  3ZGZ A;  3ZQ4 A;  1XEE A;  5D3D A;  2ACZ B;  3AEB B;  1H7W A;  1L6V A;  1TKE A;  3U2S C;  1FMA D;  1JWM D;  1SBB B;  3B9J A;  3NRZ A;  3PZ8 A;  1VZ8 A;  3W5V B;  4AQ7 A;  2KAC A;  2RDG A;  2YEP F;  1T3Q A;  2W54 A;  2Q5W D;  3ZJU A;  4IKG A;  1N62 A;  5HHD G;  1GB4 A;  1XCQ L;  4OZC A;  1MPE A;  1L5P A;  1IGD A;  3E9S A;  3NVZ A;  2SAK A;  2K3U A;  3P4Q B;  1XLN A;  1ZXH A;  2N0S B;  4TQ1 A;  2M56 B;  1HZ5 A;  2QJL A;  4A6Q A;  1F2R C;  4TMA B;  4AS1 A;  2Y5C A;  5BMH A;  2JSV X;  1I4R A;  1I4P A;  3I9V 1;  2TSS A;  2WXR A;  2JXT A;  2J52 A;  1MHX A;  1FO4 A;  1UUP A;  3OWE B;  3BVM A;  4HKQ A;  1T6B X;  1F2R I;  2GB1 A;  3R2T A;  4RGN A;  3AMZ A;  3AEE B;  1ZE3 D;  3IT4 B;  1GAQ B;  4JWS C;  4M0W A;  4HEA 1;  2PTL A;  4OZA A;  5FKA C;  4N58 A;  1JML A;  1N5X A;  1VLB A;  5FR3 A;  2KWD A;  4A9A A;  1QOA A;  1OFF A;  1K52 A;  3FIL B;  5G5H A;  1Y56 A;  2D5G A;  2WXQ A;  3ZJT A;  4YT0 B;  1SB3 C;  4WWM A;  1N60 A;  3AE6 B;  2BB5 A;  2LHD A;  4ZRP A;  3SR6 A;  3BWU D;  1D5Z C;  4KX6 B;  3BK2 A;  3LYY A;  1YN4 A;  1I4H A;  4KKJ A;  2EKI A;  1LO5 D;  1QKZ A;  1D6E C;  1I7H A;  2NTT A;  1FD6 A;  3NVV A;  3GS2 A;  2PVG C;  3HUI A;  1N61 A;  3H8H A;  2BYT A;  2V4I B;  4LLG M;  1YJJ A;  2WXG A;  1IUE A;  2AQ3 B;  3R8B A;  2LJI A;  2DLB A;  1RM6 C;  4C80 A;  1WWT A;  4XWT A;  4TSS A;  2BBC A;  1YQ3 B;  3ETR A;  1HA5 A;  3IAS 1;  2N9L A;  4JWU C;  1C76 A;  2RPV A;  1EM7 A;  3I57 A;  4RF1 A;  1K53 A;  3J9C A;  1FIQ A;  2WXF A;  2WXJ A;  3AE3 B;  1QOB A;  2N9K A;  3MP9 A;  2B76 B;  4MAC A;  1RWS A;  3W2D A;  1YN5 A;  1JCK B;  3SFD B;  4ZYS A;  1EWC A;  2JX5 A;  1QQR A;  2M0A A;  1M4V A;  2QSD A;  4A90 A;  4MH8 A;  4HRS A;  2WLB A;  1I4X A;  2IGG A;  2WXP A;  1WXQ A;  3ABV B;  3WCQ A;  1UNS A;  3CF4 A;  1FNU A;  5BYQ A;  1SXT A;  5LNK 1;  1D4B A;  2W82 A;  2QIE B;  2WXH A;  3PO0 A;  2IDY A;  4RFB A;  1ZUD 2;  2R61 A;  4HJG E;  3UI3 A;  4ZHP A;  1SF0 A;  1GPX A;  2KQ4 X;  1K51 A;  3NS1 A;  2K9X A;  1ZDV A;  3RPF C;  4B0E A;  1GTH A;  2KDM A;  4YTN B;  2AQ2 B;  3HVZ A;  3Q8C A;  2WNM A;  1YN3 A;  2WXM A;  1ZOY B;  2SEB D;  2IGH A;  1PYW D;  4MM3 B;  1FFV A;  3KWL A;  1FXA A;  1V1P B;  1PUT A;  1ROE A;  1SSN A;  2ONQ A;  1JAL A;  1SE4 A;  2OED A;  3Q8A A;  3PZ7 A;  2V3N A;  3W1S A;  4PT5 A;  3AB5 A;  3BZD B;  3V3X A;  3KQ4 A;  3HVD A;  4RGO S;  5TSS A;  4NZL B;  3TEX A;  4LTU A;  2HDE A;  2L32 A;  1PGB A;  4B0M A;  1BUI C;  1A70 A;  4US9 A;  2I2Y A;  4CQN A;  2W3R A;  2WXI A;  2G9H D;  3TUO A;  1GOZ A;  5I4D A;  1DYQ A;  2W55 A;  2DBY A;  3MJ5 A;  1C4P A;  1BML C;  4REZ A;  1AYF A;  1ACC A;  2N7J A;  4C7Z A;  2EEL A;  1YNT E;  5H92 C;  3VRB B;  2PVO D;  1C4A A;  2KN4 A;  1AWD A;  2BTE A;  1BXT A;  3DWG C;  4NAM A;  4C56 C;  2OHF A;  1WYG A;  1QF6 A;  3BVZ A;  1DOY A;  2WDR B;  2ICI A;  3AE8 B;  2XN9 C;  2J53 A;  3AV8 A;  3Q8F A;  2H88 B;  1JW9 D;  2BS4 B;  1C77 A;  2DYO A;  4A55 A;  4P6V F;  1DOI A;  2WDV B;  3W5U B;  5G5G A;  1YMH E;  1TS4 A;  4L2Y A;  4GDL B;  3NZ3 A;  1RYJ A;  4OVZ A;  3FAH A;  5BMI A;  1VZ7 A;  1L0V B;  1JRP A;  1VRA B;  1ZDX A;  1N63 A;  1FNW A;  2K22 A;  1PDX A;  4HRO A;  2MH7 A;  1GTE A;  1PGA A;  2IGD A;  2GI9 A;  2RDH A;  2JQR B;  2WQY B;  1V8C A;  2G1E A;  2FBW B;  2Y3A A;  1OQR A;  3B2F A;  4XDC A;  2JYE A;  3T3O A;  2VZK D;  3U4E G;  1E0Z A;  4OZB A;  3EGR A;  1F77 A;  2X38 A;  3Q69 A;  1KF6 B;  1FEH A;  4L1B A;  3AE1 B;  1TZO A;  4WQM A;  3DWM A;  4ZOH C;  5HI1 A;  4GDK B;  2WP9 B;  2LMC A;  4WH4 A;  5EE0 A;  4P16 A;  1C79 A;  4YSX B;  2BB6 A;  1YQ4 B;  3AEA B;  3HRD D;  4XDD A;  1JRO A;  4R3D A;  4DQO C;  4ZHO A;  1CQV A;  1DOX A;  1XLP A;  4IDI A;  5GXG B;  4UDU C;  1FM0 D;  1GT8 A;  2VZK B;  1FCC C;  1NEK B;  1J7A A;  2JWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...