3AEFB

Crystal structure of porcine heart mitochondrial complex ii with an empty quinone-binding pocket
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II with an empty quinone-binding pocket
rcsb
molecule tags Oxidoreductase
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 59
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3aefB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3aefB01
1OQQA 3AN1A 3DWGC 3AEFB 1RFKA 5EE0A 4HROA 5H8YE 1GT8A 3EUB2 2QIEB 2G1EA 3AV8A 1QLBB 4YSZB 1J7AA 1QT9A 1XLPA 1RM6C 4C7YA 1SIJA 2WP9B 3AE6B 3AE2B 1DGJA 4C7ZA 2WQYB 2MJDA 3HVZA 1NI3A 4N59A 2WDVB 3SFEB 1FM0D 3AB5A 4IDIA 1FXIA 1QOAA 3P4PB 2W55A 4C80A 1NEKB 3FAHA 3AEGB 3AEAB 1B9RA 1OFFA 1PFDA 1ZUD2 5C2TB 1ZP0B 2WU5B 1QOGA 2HTME 3LXFA 5AUIA 1GTEA 3AE9B 1QF6A 3VR9B 2WS3B 1YQ4B 1ZXIA 1FO4A 2BS3B 1N63A 1NENB 5MPOA 3W5VB 5EE9A 2K9XA 3NRZA 3B9JA 1SB3C 1FFUA 2CU3A 2MJEA 4WQMA 2LEKA 2KMMA 3AEEB 1GAQB 4ZOHC 3NVYA 1A70A 1DOYA 2WDRB 2ACZB 1L6UA 3AE1B 1N62A 2PVGC 3W9CB 5AUKA 3AE3B 1TJEA 3NS1A 5EE1A 3AE5B 1JWBD 2JX5A 1KFYB 1NYQA 3AMZA 4YTNB 1YQ3B 2JQRB 2PVOD 2Q5WD 4ZHPA 1YJIA 1T3QA 2W3SA 3VR8B 1DOXA 1E0ZA 2H88B 4JX1C 4N6EB 4US8A 1YJJA 1ZOYB 2K22A 3CWIA 1SF0A 1FFVA 1XLOA 2MJ3A 1FRDA 3AH7A 3P4SB 1V8CA 3P4QB 2BT6A 1JALA 2KAJA 1H7WA 1J7CA 1E9MA 2DWQA 3SR6A 4YTPB 1N5WA 1AYFA 1WRIA 1NYRA 3SFDB 3B2GA 4JWSC 3ZYYX 1VLBA 4WWMA 1N5XA 3PO0A 1CZPA 2PIAA 3CF4A 1AWDA 3AEBB 3CIRB 1I7HA 1EWYC 1V97A 2M56B 1TKGA 5G5GA 4YSYB 3FC4A 3B2FA 5C3JB 3DWMA 1GTHA 2OHFA 1L0VB 1XO3A 2BS2B 1QOBA 2CJOA 3VRAB 1E6EB 4P6VF 1H7XA 2PKOA 1VDVA 4US9A 2BS4B 1L5PA 3WCQA 1FMAD 2WU2B 2Y5CA 1RWSA 1KRHA 2W54A 1J7BA 1RYJA 3AE8B 2AX5A 2FBWB 3NVWA 1FXAA 1NVID 1JRPA 3ETRA 1VJKA 2N0SB 1PUTA 4A9AA 2E3TA 1L6VA 3KWLA 1FIQA 4USAA 4ZHOA 1JW9D 1JWAD 1UWMA 2L83A 2WLBA 3L4PA 4HRSA 1E7PB 4ITKA 4LTUA 3RPFC 3W5UB 1WYGA 1JQ4A 4JWUC 1ROEA 5H92C 3P1MA 3HRDD 4FXCA 3VRBB 1GPXA 1DOIA 1R7SA 3LB8C 4KX6B 4N58A 3AECB 1XLNA 2MH7A 3NVVA 1WWTA 2CJNA 1F0ZA 1QOFA 2H89B 5EE3A 1N61A 4YSXB 1OQRA 1WGKA 2W3RA 1WXQA 3P63A 3BIID 1CJEA 2M19A 3AEDB 2K5PA 2WDQB 1TYGB 1PDXA 1N60A 2QJLA 5GXGB 5G5HA 3ABVB 1IUEA 1FRRA 3P4RB 1JROA 3HUIA 3AE4B 3NVZA 1KF6B 3AE7B 2DBYA 1E10A 2L52A 1TKEA 3AM9A 4YT0B 1XLQA 4YXDB 2EKIA 1TKYA 2B76B 4YTMB
chains in the Genus database with same CATH superfamily
4FJVB 2N9KA 1GG3A 3APFA 3SU8X 1TS4A 4RH6A 4DBGA 4AUQC 4C7ZA 1DGJA 5IAAC 3EFCA 3PZ8A 1HE8A 2LFIA 3AEGB 4D2KA 1OFFA 3ZTDA 1Q10A 1GOZA 4HXDA 5E6NA 2K25A 1ZXIA 2M4NA 1UBIA 2L8JA 4IWOA 5MPOA 2BWFA 3HHMA 3UF8A 1NI2A 1WX9A 1V81A 4BBNF 4AWJA 1HQRD 3M3JA 2WNMA 2Q5WD 1YJIA 2W3SA 4AJWA 2VZKD 2MCNB 3Q3MC 1HTQA 1FRDA 4DXGA 4XYCA 4EFOA 1H7WA 4MH8A 3UIPB 4HJGE 3KVFB 1E90A 1I7HA 4RGTA 1OGWA 3C19A 3KQ4A 2BS2B 2I1JA 2HD5B 1H7XA 4G3XB 1C78A 4FN2A 5G2NA 4A8XC 3PRPB 2I2YA 4ZRKA 1I4RA 4OZCA 2CHZA 1E5WA 2WLBA 4ITKA 3DVGX 2KDBA 3QQ8B 4LNIA 1VR9A 1QKZA 4K3CA 2V3NA 2W3RA 1SJHD 3ZXVA 2B3AA 3E9SA 4BKGA 1TTNA 2KJ6A 1WH3A 5G5HA 2YVCA 2FE8A 3P4RB 2J52A 2L76A 1YX5B 3HM6X 2KTFA 1V2YA 3Q8AA 4YTMB 3AEFB 2QIEB 3M95A 3AE2B 2GOWA 4NJCA 3A1QA 1TS5A 4IOIE 3OAWA 2L32A 4TSSA 2PPHA 1ZP0B 2HTME 4OW0A 4FHJA 1GTEA 1VCBA 2JF5A 3KUCB 3R2IA 4KZCA 3EA6A 2WDRB 3UI3A 2ACZB 4KSKC 5EE1A 2IO0B 4AJYB 2DZKA 1S1QB 1Y8RC 2N4FA 3RNBC 3U7ZA 4WJQA 2NPTA 2MJ3A 1P7FA 2LGIA 4X57B 2WXHA 2C7HA 1BT0A 2PLPA 1YN4A 4MJSB 1P9DU 3A9JB 3ZDMC 1QILA 2IY0B 4YSYB 2N7EA 3N32A 4RGMA 1ZDVA 1QZEA 2IY1B 4W9EA 1LQBA 4RM9A 3DBRB 2AX5A 2L0TA 5JXVA 2JXTA 1EU3A 2EMTA 2ICIA 3R7QA 4IW0A 3BVMA 3V05A 3SEBA 2ASQA 4KX6B 4BVUC 2D3CA 4JLCA 2CJNA 3N3KB 4WWOA 1QOFA 2XEWA 3JYUA 2FCQA 1WF9A 4G0NB 3P63A 4HLEA 2G3QB 2KVRA 1TYGB 4AP4C 2ZNVC 2OJWA 3QAQA 1IYFA 1VZ7A 1WJUA 1C77A 2JY6A 2KKCA 2IGGA 2XNAC 3PLUA 4FULA 4AQ7A 2LRUA 4HWIB 3DWGC 5EE0A 1GT8A 3Q3JA 4GMVA 1QLBB 2K0PA 2JZ3B 2XN9C 1I4PA 3HVZA 2KN4A 3HIZA 1WE7A 2LWPA 3AEAB 5BYQA 2BYTA 1ZUD2 2WU5B 2HJ1A 5LXIB 2WGSA 3ZRCA 1UZXB 2QDFA 4BOZB 2NVUI 4MM3A 2K9XA 1I4QA 3NRZA 1FFUA 2PE6B 3QARA 2LI5A 1C79A 5IO9A 3EGRA 4GDKA 1NYQA 2KC1A 4K3BA 3S2AA 1PQSA 2V1YA 1J19A 3I57A 3UQAA 2ZW1A 2KAJA 1V1PA 2LHEA 1J7CA 3VQIA 4ARIA 4JQWC 3K9OB 4L1BA 4NAWA 4AS1A 1V97A 2WXIA 2DAFA 2OHFA 3DQVA 1L4ZB 1TZ1A 3I5JC 2WX1A 4KIKB 1J7BA 3ETRA 4A9AA 2AL6A 4USAA 3V3XA 1TY0A 2AWTA 2DX5B 3H7PA 3B0AA 2IJ0A 1IPGA 2WXKA 3W1SC 1WGKA 2WWZA 5IKCM 1K50A 1MHXA 3Q14C 3VUYA 1WR1A 4HVBA 1YN5A 1E10A 2JYTA 3QC8B 4TKNA 3GB1A 1F77A 1XCQL 1V6EA 4HKQA 2M8SA 1RRBA 2W82A 5E6OA 4ZDVA 3IAS1 1T0SC 2WQYB 3DBHI 4KGSA 4RM8A 3RT3B 4K7UA 5L95C 2IO1B 3AB5A 4IDIA 3SDLC 1AW7A 3TCAA 3V61A 1NEKB 3H1UA 3PRZA 1B9RA 1BMLC 1SBBB 4HKZE 5FK9C 2KQ4X 4XX5A 2JWUA 2LZ6A 3ML9A 4K7SA 4YL8A 4KDLB 2KWVB 1TS2A 1WXSA 5CHFA 2PVGC 4GN1A 3VHTC 2KJHB 2JWZA 4WAAA 2MWSB 1SF0A 4TV3A 1ET9A 3B08A 3ZRFA 5BMHA 2GRIA 2VH2A 3TEXA 3UINB 1SE9A 4A3PA 2NTTA 1PGAA 1WXAA 4OVUA 1WJNA 2GLSA 3L08A 4M01A 4G50A 3EECA 3H7SA 4GDKB 3IBEA 2YEPB 2N1WA 1V5OA 4P6VF 2PKOA 4H2AA 2GBMA 1P1AA 1RWSA 3ZYYX 4YWGG 3Q8BA 2CHWA 1M4VA 1JWUD 3W5UB 1Z5SB 4FXCA 3AECB 4BOSC 5EDSA 2PMVA 2MSED 1WWTA 2KFKA 1XQQA 4FLHA 1HA5A 4YSXB 4RCOA 4ASWC 1VZ6A 3NJTA 3AU5A 3OJ3A 3ZKJC 3GOEA 3W1YA 3NVZA 4HCNB 4HJKA 3U52E 4WJOA 2HDEA 1TKYA 2NMQA 2N9PC 1F1HA 5H8YE 4A20A 4I6LB 4LNOA 2ZVOA 1YJ1A 4MT5A 1YMHE 1C9FA 2KOXA 2OEDA 2INNE 2GBRA 1YD8U 4GOCA 2WXMA 2JYEA 2FCMA 1QOGA 3LXFA 5AUIA 3AE9B 2IO3B 1FO4A 5J17A 3DPDA 3MHZA 4ZRPA 1L0XB 2K8BA 3NZUA 3RI7C 3R8BA 2VZKB 1JWSD 4NAWB 4DWFA 2L0FA 3NY5A 5D3IB 3DCGA 4RFBA 2LJIA 1JRUA 5JH5C 2BT6A 4EE2A 4KIKA 1D5MC 3SFDB 3EC8A 4IM0A 5DPTA 3VTUA 3CF4A 2M56B 2KC2A 3IT6B 3FC4A 3WANA 4W9IA 3PSEB 1ZW7A 2KNBA 3MC0B 1QOBA 4M0WA 1OQYA 1SE3A 4GIVA 4W9HA 2N1VA 2CHXA 4GGQA 2FBWB 4XC2A 1T6BX 4FA6A 4ICUA 3L4PA 1SIFA 1E7PB 1FNUA 4IM3A 1DOIA 3LB8C 3ENEA 5TR5A 1KH0A 2L1AA 4P1CC 1X1MA 2M19A 2WDQB 2MBQA 4BKTA 3RUIB 2BTEA 5BMIA 2L7RA 4XWTA 2L52A 1XLQA 2L3ZA 4PT5A 3RNCC 1NBFC 4IWQA 1WGGA 2MX2A 2DYMA 1J8CA 1T0QC 2BKFA 2JRHA 1KLGD 4YSZB 1XLPA 2D3BA 3VUWA 1J0GA 5HHDG 1TBEA 2QHOA 2D11A 4N9F4 2KYWA 2WP9B 2WX0A 1UUPA 4DDGD 1TT5B 2N9XA 3NS8A 3QHTA 2O2VB 1QOAA 2RDBC 3PHWB 4GDLA 1QQRA 4II3B 2EMSA 1E8YA 1UGMA 4ACFA 3L10B 3KYCD 3FILB 2KWCA 3P2BA 4B95A 3DHHC 3R7RA 5JHAA 4IWPA 3AEEB 2WYQA 3VH3B 4DK5A 2RD0A 1SXTA 2KT7A 1V5TA 2WXNA 1JWBD 2JX5A 4MDKE 3O65B 4S0RA 3VH4B 4BKSD 1UD7A 1C4PA 2RMMA 3PT2B 2MLBA 3T8MA 4ZRQA 1SGHA 1Z2MA 4MSMB 4NPNA 4P1BC 3BK1A 3CIRB 1YNTE 4UDUC 3CSTA 3ZJUA 5G5GA 3L0WB 3DWMA 2DAJA 1F9JA 3TIXA 1XO3A 2G4DB 1E6EB 3VXWA 2C9WB 3GZNI 2V0GA 2D3GA 2L83A 1JQ4A 3ZW3A 1SJED 2DYBA 1B1ZA 2KLCA 1MFWA 5BYRA 4LCDE 5T8IA 3PTFC 5BO4B 3BVGA 4MGIE 4WWNA 1N60A 4KDIC 1UGJA 2BYFA 5D6JB 2B76B 2ZCCA 2QC8A 4BBNC 3Q8EA 3AN1A 3VAWA 2ZJDA 1YIWA 2WXOA 5AEKB 3BINA 1WMHB 2LRWA 4GLSC 4GU2A 2V4LA 4M00A 1NI3A 3I9V1 1LXDA 5AZGA 1V1OA 1LM8B 2LVOA 3NG0A 4PK1A 5TSSA 1WGYA 5D94A 3O13A 4KSLC 4IKGA 4C4VB 2BB5A 4PS8A 3BVZA 4REZA 1DOYA 5D3DA 3QCAA 2WHIA 1N6ZA 2QILA 2WXRA 1D6EC 2D5GA 2K22A 3FILA 4MH0E 1FFVA 4C56C 3V60A 3KUZA 2ON8A 3A9KA 2CS4A 2RGFA 4PS3A 2JZPA 2KD0A 1WY8A 1MVKA 3E56A 2AEHA 2D07B 3MFGA 4ANUA 3PV1A 5DPRA 1I35A 4DQOC 2CJOA 4ZYNA 3DVGY 2KQSA 2BS4B 4US9A 3WCQA 4NJ6A 3ZJTA 2Y5CA 1WIAA 1VJKA 4B0EA 3TEYA 2AQ2B 3JW0X 3R3MA 3AXCA 1GC6A 3HRDD 1GB1A 3VRBB 4J3OD 2FCNA 1YOVB 3VFKA 4HPLB 3RYTA 1N61A 2HTHA 4BZAA 2ZVNA 2NTSA 1YX6B 3WAPA 5GXGB 1C1YB 3ZNHB 1JMLA 1TKEA 1ET6A 3U7DA 3RZWC 4K1RB 4XGAB 1V49A 1OTRB 2IZVB 2FIFA 2UU7A 3U30A 3EUB2 4RF0A 1C4AA 4EOYA 1TS3A 2Y5PA 1WXMA 3WALA 1ESFA 2W55A 2WXQA 3FAHA 3C0RB 3D32A 2X8XX 3MJ5A 2C7NB 4WIPA 1M94A 2KFKB 1K53A 3TJPA 1QF6A 2HE7A 5EE9A 1SB3C 3RN9C 1R4NB 3B1LX 1Q1OA 1GNUA 4E74A 1LGRA 4MJSA 5AZFA 4E3CA 1E0ZA 2KQ7A 3ZDTA 2A5UA 3AH7A 4IC7B 2LHDA 2RDHA 4MM3B 1N5WA 4WAFA 1UWXA 4MGZE 2C7MB 3AEBB 2LJ5A 1F2RC 3DBRI 2Y3AA 1RAXA 2O6VD 2GBNA 2JPHA 4RMAA 1IP9A 1STEA 2PTLA 4LK0M 3A4SC 4HK2A 3QX1A 2CKHB 2Z0EB 4MELA 5C23A 2DHZA 4RF1A 3WIMA 1WXQA 5HI1A 2BW2A 3M62B 3DVNV 2GI9A 1C76A 1IUEA 1WJ6A 4JIOU 3URYA 2RSUA 5E6PA 1FD6A 3Q2AC 1ZE3D 1XF5L 2EKIA 2AYOB 3RCZA 3A9JA 5D2MB 1XT9B 2ZPYA 1SEBD 3IXSA 4PYZA 1UNSA 3Q3NC 3K9PB 2FNJB 4JPSA 2IO2B 2K8HA 3U2SC 4OZAA 1V86A 5KHQA 3AE6B 2DZIA 5FR6A 2GMIC 2J0JA 1F52A 4MGYE 2NBUA 4ICVA 1D3ZA 1FNVA 3TEWA 4KV2A 5CHWA 5GMVA 5C2TB 2KMCA 3VR9B 4NNJB 4OHJA 1N63A 4PYUA 1I42A 1BXTA 2MW5A 5D7GA 3PVLA 3B9JA 3N9YC 2ZPNA 4EZJA 4NQLB 3I63C 2LGSA 1L6UA 5JHBA 2REXA 3PS6A 3H7PB 4LJPB 2MRPA 5KHOA 1UF0A 2WXPA 3ZLZA 2K8CA 2RR9A 1MPEA 3HVDA 1L7YA 2JXXA 1XLOA 4NZLB 2CR5A 1UBQA 4JGHB 3X23A 2Z0DB 4RGOS 4DHZE 3QIJA 1EWYC 3Q69A 3CMMB 2J4XA 4L23A 4LDTD 4LNFA 5DPWA 3VRAB 3TUOA 1L5PA 3MTNB 2BYVE 3L16A 3NVWA 1KRHA 1RYJA 1JRPA 1C4CA 2E3TA 2G4SA 4ANXA 4ZHOA 4EZLA 1R4MB 2XK5B 4CO7A 1D5XC 3U4EG 2H89B 3TBLD 2LXAA 3ALBA 4O1NA 3RULA 3N20C 2L05A 4B0MA 4DHJB 1TZOA 4M8MA 1PGBA 1EF5A 2HJ8A 3Q3OC 3BY4B 2KVZA 1C3TA 2CU1A 4AOFA 3NZ3A 4FJZA 1E7UA 3VTVA 3L13A 2KMAA 4W9GA 1ZKHA 4WJNA 2J0MA 2SAKA 4HDOA 2N7DA 2DYOA 1IGDA 1OEYA 2MP2B 5FKAC 2RPVA 1FXIA 4TMAB 1PFDA 4CHKA 3UQBA 1GJZA 4GB9A 2J53A 2JSVX 1ZPSA 3W5VB 2CU3A 4C00A 3BYTB 3Q8FA 4WH4A 2KANA 1A70A 3NVYA 4HPPA 3AE1B 1N62A 4W9CA 5AUKA 1Y56A 4ZHPA 1DOXA 5IOIA 4N6EB 3SHQA 3CWIA 1GUAB 1WMHA 5I4DA 1SE4A 1CK1A 4EZKA 1FPYA 2JT4B 1AYFA 1EF1A 1CZPA 2INPE 2FCSA 1ZXHA 2IGHA 3V62A 4NQKE 3B2FA 2KXJA 2INDC 4R3DA 4P7IA 4S17A 3N1YC 4LLGM 4L2YA 4HRSA 1HZ6A 4JWUC 3A1QB 2E6XA 3IAM1 3GZNB 4HDQA 2R2QA 1HTOA 3ZTCA 2LVQA 1CJEA 3MJWA 2QJLA 3NHEB 5CHVC 1BUIC 2LVPA 2DBYA 2UWQA 2QMTA 2WXGA 1FXTB 4YXDB 2XK5A 4K81A 1RFKA 4TUUA 4XDCA 1J7AA 1SSNA 1RM6C 4F1SA 2VH1A 1T5XD 2Z8LA 2BYEA 4GDLB 3SFEB 3KUDB 3TL5A 1AARA 2M1MA 1WM2A 1YQ4B 3ONSA 2O6VA 3RNGC 3GP7A 3RPFC 1LO5D 4HCPB 3AE5B 3QWZB 1L4DB 1XEEA 3TEZA 3C8YA 2O2VA 1T3QA 2MBHA 4NJ7A 4OVZA 2XBBC 3OLMD 3ZIMA 2WXLA 5LLIA 2X38A 3I3TB 2JVCA 3EFUA 3P4SB 1WFYA 3FKYA 2DWQA 4YTPB 2ZZPB 1T0YA 1NYRA 2I1KA 2MEKA 3DBLB 1EU4A 3IT4B 1GB4A 3W2DA 5IN7A 2BGFA 4DXAB 5C3JB 2EKEC 1GTHA 2YLMA 2ONQA 2BF8B 2BWES 1MJDA 2QCZA 1FMAD 3N1XC 3KLSX 1F2RI 1TY2A 1I4GA 1PUTA 4JL9A 3PHXB 4I6NB 2DZMA 3R2TA 1WX8A 4KGTA 1XLNA 3Q3FA 2L00B 3ZNID 3BIID 1HEZE 4W9JA 3AEDB 1YN3A 2YEPF 3NOBA 3PREA 2K6QA 1GC7A 2N9EB 3J9CA 3AE7B 2GBJA 1WR6E 2AQ3B 1XCTL 1VZ8A 3W1SA 2AQ1B 3L54A 1QT9A 1IBXA 3NUHB 2KTRB 2R61A 1WM3A 1WZ3A 1FCCC 2FIDA 3RZFA 4BKSA 4DHZB 2KK8A 3N1ZC 2KDIA 1RFAA 2J0KA 4PS7A 1LFDA 5HFYA 1Q5WB 1NENB 1WE6A 2NBVB 1E8ZA 4MEMA 2KWUB 2LEKA 2KMMA 1GAQB 4CYEA 3W9CB 3T9LA 3ZXRA 1KLUD 3NS1A 1VD2A 1KFYB 2Z59B 2JQRB 2LXCA 2H88B 3VUXA 1ZOYB 3NZSA 3DHIC 3PRMB 1EM7A 2BBCA 2IGDA 4BAXA 1ISNA 2RPQA 3H9DA 4JWSC 5LNK1 4OVVA 1P98A 3DDCB 3H8HA 3IHPC 2IYDB 3ZJVA 4MACA 1E7VA 3PZ7A 3ZGZA 1CMXB 1P0RA 2A4ZA 1U4AA 4E71A 2DLBA 3T3OA 4KKIA 1T0RC 4WURA 5JZEB 1VDVA 2KN5A 4G11A 1WX7A 1FXAA 4W9DA 2ZEQA 1L6VA 3WAOA 1L0YB 1UWMA 4LTUA 4LNKA 1K52A 5H92C 3WAMA 3KWVA 1WRDB 1D5ZC 1MI0A 3LJ3A 3BYYB 2C5LC 3N30A 1G6JA 1FEHA 3RFZB 1P7EA 3ABVB 2N7JA 4TQ0A 1P3QU 1V9JA 3QK0A 1Q0WB 1OQRA 3DHGC 1K51A 2BQQA 1UH6A 2OJRA 3AV8A 2KACA 3OG5A 3RNAC 1ZGUB 2MJDA 2GBKA 3ZO5B 4P16A 4C80A 1XXGA 5L83A 2QSDA 1H8CA 1PGXA 3ZUNA 4XE0A 3QA8A 2KWDA 2BS3B 5LXHA 1R4MI 4I6PA 4GSWA 3APDA 1DYQA 3UIOB 3L17A 1ENFA 2KDEB 2J42A 4KGRA 2TSSA 1WZ0A 2PE9A 2W9NA 2R2OA 4WWPA 1KOTA 2KX0A 1V8CA 1JALA 4W9LA 1D4BA 3V6CB 4BFRA 3TMPB 3PO0A 3DBHB 1HZ5A 1TKGA 1ZDXA 4F7ZA 3JVZX 1WSPA 4M0WB 4EEWA 2AL3A 3MHSD 4FADA 5HKHA 1NVID 3R66C 2VRRB 2NS5A 1EUVB 4LNNA 3PLVA 1V80A 3P1MA 3APCA 3NVVA 4MGKE 5HG2A 3UGBB 3AI5A 3H6NA 4DXFA 3OJ4B 2NR2A 1V1PB 3SD5A 4YT0B 1RLFA 4TQ1A 3GE3C 1EWCA 5CX3A 4HROA 4A55A 2BVCA 1XD3B 2G1EA 2D3AA 4C7YA 2D10A 3HK0A 1PYWD 2OOBB 3IVFA 2INCC 4CQNA 2IDYA 1CQVA 2GB1A 1FCLA 1R4NI 2IPKD 4J6IA 5C1ZA 5E6JA 3MC8A 4W9KA 4XWWA 3MC9A 3ZVVA 4IM2A 3ZQ4A 4ZOHC 1JCKB 3ZNZB 5J18A 5J2RA 1TJEA 2KHWB 1KM7A 3PPAA 1YQ3B 3RD2A 1VRAB 5DCNA 2QEJC 3VR8B 2JRIB 2KFJA 2J7QB 1IGCA 2MQJA 3A4RA 4ZRIA 2I38A 3Q8CA 2D2QA 1WRIA 3LYYA 2KX3A 1VLBA 3U8ZA 4JE3B 4WWMA 1N5XA 2PW9A 2WDTB 1MG4A 3IG3A 1KLVA 1L0VB 2JU6X 1FNWA 4B9KA 2KLGA 2RDGA 2BKRB 1JWMD 3KWLA 1FIQA 1JW9D 2MHJA 3KH0A 5FR3A 1GPXA 4EUTA 3QJZA 3VTWA 1I4HA 2MH7A 1F0ZA 3AU4A 3P42A 3M63B 1H4RA 4B6WA 3VVWB 4KZ0A 2K39A 3A9KB 3RMKC 3JSVB 3CSFA 3AE4B 1K8RB 1KTKA 4EKUA 3ML8A 5BMGA 2IBIB 3DBLI 3RNFC 2LD9A 3RNEC 3BK2A 3ZNGC 2N9LA 4A3OA 3OWEB 1WGDA 1SIJA 2V4IB 3KYDD 4IUMB 4RNAA 4WJPA 2MBBB 5IA7A 2FUG1 3EHVA 2UYZB 2MBOA 2V3SA 1I4XA 4HEA1 2WS3B 3TSSA 2V9HA 1MHHE 2FUHB 3IFWB 4WQMA 2WXJA 1E8XA 2M17A 1HXYD 4II2B 3AE3B 4M02A 3AMZA 4KKJA 4M8NA 1TIFA 2PVOD 4GXBA 4NY0A 2DENB 4JX1C 1YJJA 4NAMA 3P4QB 1IBXB 3ECIA 3SR6A 2BB6A 3B2GA 4KVGB 1AWDA 3LDZE 3PZDA 3T3NA 4LJOB 4A6QA 2JUOA 3BWUD 2KZRA 1TGZB 2JZZA 3X0WA 4LDTB 1SE2A 3HM3A 2W54A 2PJHA 2M0XA 3Q6BA 2N0SB 3DOWA 4ANWA 2LMCA 2C60A 2LGXA 4IG7B 1YQBA 1ROEA 4XDDA 1R7SA 1EO6A 2LUMA 2WXFA 4K7WA 4FBJB 1WGRA 5DPSA 2K5PA 1PDXA 4C4VA 1NDDA 1FRRA 4DHJD 2LASA 1L2NA 2LUEA 3AM9A 3VDZA 2SEBD 1OQQA 2MA9B 4F8CB 4HPMB 1WJ4A 2G45B 2KTRA 1A5RA 4N59A 3PGEA 2WDVB 3JSVA 1FM0D 3WA0A 4RGNA 2ZW0A 3P4PB 3DVNU 3V6EB 4DDID 2LGYA 4OZBA 2NBWB 2ZNVB 2BPSA 3MP9A 3GS2A 5AZHA 4A90A 4ARCA 2MJEA 2KJRA 5BYSA 2DNFA 2Y5BB 2PEAA 2DZJA 4Q2JA 1AN8A 4YTNB 3BZDB 3CF6E 5IP4D 1WXVA 4ANVA 1WI0A 1E9MA 4URKA 3GE8C 4W9FA 2PIAA 2MP2A 2KDMA 5G55A 2NPTB 2KDFB 1ACCA 2FAZA 4WQOB 2ZCBA 2K6DB 2EELA 2WU2B 4US8A 3AE8B 1JWAD 4FJYA 1WYGA 2K3UA 3DBSA 2KO3A 4FHKA 1WYWB 3A33B 4N58A 1E8WA 2O6VB 2K1FA 2MBEA 1OEYJ 4ZRJA 2LGDA 5EE3A 2M0AA 2V3PA 4ZYSA 2G9HD 3AULA 1MG8A 5CTRC 4MSQB 1JROA 3HUIA 4QAYA 1S3SG 1WGHA 1KF6B 3KW5B 1KJTA 2NCNA 4XZ4A 1UELA
chains in the Genus database with same CATH topology
1K51A 2N9KA 1SEBD 5H8YE 3IXSA 1UNSA 2KACA 1TS4A 3AV8A 4JPSA 4MT5A 4RH6A 1YMHE 1C9FA 3U2SC 4OZAA 3AE6B 1DGJA 2OEDA 4C7ZA 2MJDA 2INNE 3PZ8A 4P16A 4C80A 2WXMA 2LFIA 3AEGB 1XXGA 2JYEA 4D2KA 2QSDA 1FNVA 3TEWA 1OFFA 5C2TB 1QOGA 1Q10A 3LXFA 5AUIA 3AE9B 1GOZA 1PGXA 3VR9B 4XE0A 1ZXIA 1FO4A 2KWDA 4OHJA 2BS3B 1N63A 3MHZA 1BXTA 5MPOA 5D7GA 4ZRPA 1L0XB 3B9JA 3N9YC 3R8BA 2VZKB 1JWSD 1L6UA 4NAWB 1HQRD 1DYQA 2WNMA 1ENFA 2Q5WD 1YJIA 2J42A 2W3SA 2WXPA 4KGRA 2TSSA 5D3IB 2VZKD 1MPEA 3HVDA 4RFBA 1XLOA 1FRDA 2LJIA 1V8CA 2BT6A 4NZLB 1JALA 4DXGA 4EE2A 1H7WA 1D4BA 4MH8A 4RGOS 1D5MC 3SFDB 3PO0A 4HJGE 3CF4A 1I7HA 4RGTA 1EWYC 2M56B 1HZ5A 1TKGA 1ZDXA 3IT6B 3Q69A 1WSPA 3FC4A 2J4XA 3KQ4A 3MC0B 4L23A 2BS2B 1QOBA 3VRAB 4M0WA 3TUOA 1H7XA 1L5PA 1SE3A 1C78A 3NVWA 1KRHA 1RYJA 4A8XC 2FBWB 1NVID 2I2YA 1JRPA 1T6BX 1I4RA 4OZCA 1C4CA 2E3TA 4ZHOA 2WLBA 3L4PA 1E7PB 4ITKA 1FNUA 3P1MA 1DOIA 3LB8C 1VR9A 3NVVA 1D5XC 1KH0A 1QKZA 2L1AA 3U4EG 2H89B 5HG2A 2V3NA 2W3RA 1SJHD 3E9SA 2M19A 2WDQB 4O1NA 4DXFA 4B0MA 5G5HA 2FE8A 3P4RB 1TZOA 1V1PB 5BMIA 2BTEA 4XWTA 1PGBA 2J52A 2L52A 4YT0B 1XLQA 3NZ3A 3Q8AA 4YTMB 4TQ1A 4PT5A 1EWCA 3AEFB 4HROA 4A55A 2DYMA 2QIEB 2SAKA 2G1EA 1KLGD 4YSZB 4C7YA 1XLPA 5HHDG 2DYOA 2WP9B 3AE2B 1IGDA 1PYWD 1UUPA 5FKAC 2RPVA 4NJCA 1FXIA 1QOAA 4TMAB 2IDYA 4CQNA 1TS5A 1CQVA 4IOIE 2GB1A 1FCLA 1PFDA 1QQRA 2L32A 4TSSA 1ZP0B 2HTME 4OW0A 1GTEA 2IPKD 2J53A 2JSVX 3FILB 1ZPSA 5E6JA 3R2IA 4XWWA 3W5VB 3ZQ4A 2CU3A 4ZOHC 3BYTB 3AEEB 3Q8FA 4WH4A 3NVYA 1A70A 3EA6A 1JCKB 2WDRB 3UI3A 2ACZB 1SXTA 3AE1B 1N62A 5AUKA 1TJEA 5EE1A 2WXNA 1JWBD 2JX5A 1YQ3B 1VRAB 1Y56A 4ZHPA 2QEJC 1DOXA 3VR8B 3U7ZA 4N6EB 1IGCA 3CWIA 1C4PA 2RMMA 5I4DA 2MJ3A 1P7FA 2LGIA 1SE4A 2WXHA 4ZRQA 1CK1A 2I38A 2PLPA 3Q8CA 1AYFA 1WRIA 1YN4A 3LYYA 1VLBA 4JE3B 4WWMA 1N5XA 2INPE 1CZPA 3BK1A 3CIRB 1YNTE 2PW9A 4UDUC 1QILA 1ZXHA 3ZJUA 2IGHA 5G5GA 4YSYB 3B2FA 3DWMA 4RGMA 1ZDVA 1L0VB 2JU6X 1XO3A 1FNWA 1E6EB 4R3DA 2RDGA 4LLGM 4L2YA 2AX5A 1JWMD 5JXVA 3KWLA 2V0GA 1FIQA 2JXTA 1JW9D 2L83A 4HRSA 1EU3A 2ICIA 1JQ4A 1HZ6A 3BVMA 4JWUC 3V05A 1SJED 5FR3A 1GPXA 2E6XA 3IAM1 3SEBA 1B1ZA 4KX6B 1I4HA 2MH7A 5BYRA 1F0ZA 2CJNA 5T8IA 1QOFA 3BVGA 3P42A 3P63A 1CJEA 1TYGB 1N60A 2QJLA 1VZ7A 1BUIC 3AE4B 1C77A 1UGJA 1KTKA 2DBYA 2QMTA 2IGGA 2WXGA 5BMGA 4YXDB 2XNAC 2B76B 4AQ7A 3Q8EA 3AN1A 3DWGC 1RFKA 5EE0A 3BK2A 1GT8A 2WXOA 1QLBB 2K0PA 1J7AA 1SSNA 4XDCA 1RM6C 2N9LA 3OWEB 1SIJA 2V4IB 2XN9C 1I4PA 4GLSC 1T5XD 2Z8LA 4RNAA 3HVZA 1NI3A 2KN4A 2FUG1 4GDLB 3SFEB 3I9V1 1V1OA 3AEAB 5BYQA 2BYTA 1ZUD2 2WU5B 1I4XA 4HEA1 5TSSA 2WS3B 1YQ4B 3TSSA 1MHHE 3GP7A 3O13A 2K9XA 1I4QA 3NRZA 4WQMA 1FFUA 3RPFC 2WXJA 4IKGA 2BB5A 1HXYD 3BVZA 4REZA 1DOYA 5D3DA 1LO5D 1C79A 3EGRA 3AE3B 3AE5B 1L4DB 1NYQA 1XEEA 2QILA 3AMZA 3C8YA 4KKJA 2WXRA 3TEZA 2PVOD 1T3QA 4OVZA 4JX1C 1D6EC 2D5GA 1YJJA 2K22A 4NAMA 2WXLA 3FILA 4C56C 1FFVA 3I57A 2X38A 2ZW1A 3P4SB 3P4QB 1IBXB 2KAJA 1V1PA 2LHEA 2ON8A 1J7CA 3SR6A 2BB6A 2DWQA 4YTPB 3VQIA 4ARIA 1NYRA 2MEKA 3B2GA 4L1BA 1EU4A 3IT4B 2JZPA 1MVKA 1AWDA 1GB4A 3W2DA 3T3NA 4AS1A 1V97A 3E56A 4A6QA 2WXIA 3BWUD 5C3JB 3MFGA 1GTHA 2OHFA 2ONQA 1L4ZB 4DQOC 2CJOA 4US9A 2BS4B 3WCQA 1FMAD 1SE2A 2Y5CA 3ZJTA 2W54A 1J7BA 3KLSX 1F2RI 1TY2A 3ETRA 1I4GA 1VJKA 2N0SB 1PUTA 4A9AA 4B0EA 3TEYA 2LMCA 4USAA 2AQ2B 3V3XA 1ROEA 1TY0A 4XDDA 3HRDD 1GB1A 3VRBB 4J3OD 1R7SA 3R2TA 4KGTA 1XLNA 2LUMA 2IJ0A 2WXFA 2WXKA 1N61A 1WGKA 2NTSA 3BIID 1HEZE 3AEDB 2K5PA 1YN3A 1PDXA 1K50A 2YEPF 1MHXA 5GXGB 1FRRA 3J9CA 3AE7B 1E10A 1YN5A 1JMLA 1TKEA 3AM9A 1ET6A 2JYTA 2SEBD 3GB1A 1F77A 1XCQL 2AQ3B 1OQQA 1XCTL 4HKQA 1VZ8A 3EUB2 3W1SA 2AQ1B 2W82A 4RF0A 1C4AA 1QT9A 3IAS1 1IBXA 3NUHB 1TS3A 2R61A 2WQYB 2Y5PA 4KGSA 4N59A 1FCCC 2WDVB 3AB5A 1FM0D 4IDIA 1AW7A 4RGNA 2ZW0A 1ESFA 3P4PB 2W55A 2WXQA 1NEKB 3FAHA 1B9RA 1BMLC 1SBBB 4HKZE 3MJ5A 4WIPA 5HFYA 5FK9C 4OZBA 1K53A 1QF6A 2KQ4X 1NENB 2JWUA 5EE9A 3MP9A 3GS2A 4A90A 4ARCA 1SB3C 2MJEA 1TS2A 2LEKA 2KMMA 1GAQB 5BYSA 2PVGC 3W9CB 1KLUD 3NS1A 1KFYB 4Q2JA 1AN8A 4YTNB 2JQRB 3BZDB 1E0ZA 2H88B 1ZOYB 1SF0A 1ET9A 3AH7A 1EM7A 2BBCA 2IGDA 5BMHA 2GRIA 3TEXA 2LHDA 1E9MA 2RDHA 4MM3B 1N5WA 2NTTA 4JWSC 1PGAA 5LNK1 4WAFA 1UWXA 2PIAA 4GDKB 3H8HA 3AEBB 3ZJVA 4MACA 1F2RC 3PZ7A 3ZGZA 2KDMA 2DLBA 3T3OA 1ACCA 2Y3AA 2YEPB 4KKIA 4WURA 4P6VF 2PKOA 4H2AA 1VDVA 2EELA 2WU2B 1RWSA 3ZYYX 4US8A 3AE8B 1FXAA 4YWGG 3Q8BA 1L6VA 1STEA 1M4VA 1JWAD 1L0YB 1UWMA 1JWUD 2PTLA 3W5UB 4LTUA 1WYGA 1K52A 2K3UA 5H92C 4LK0M 4FXCA 4N58A 3AECB 3KWVA 2PMVA 1D5ZC 1WWTA 4RF1A 1HA5A 5EE3A 1MI0A 4YSXB 4RCOA 3BYYB 1WXQA 2M0AA 2V3PA 5HI1A 4ZYSA 1VZ6A 2BW2A 2G9HD 1FEHA 3RFZB 1P7EA 2GI9A 1C76A 3ABVB 1IUEA 2N7JA 4TQ0A 1JROA 3HUIA 3NVZA 3URYA 1KF6B 3U52E 1FD6A 1ZE3D 1XF5L 2EKIA 2HDEA 1TKYA 1OQRA 2NMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQQ A;  3AN1 A;  3DWG C;  3AEF B;  1RFK A;  5EE0 A;  4HRO A;  5H8Y E;  1GT8 A;  3EUB 2;  2QIE B;  2G1E A;  3AV8 A;  1QLB B;  4YSZ B;  1J7A A;  1QT9 A;  1XLP A;  1RM6 C;  4C7Y A;  1SIJ A;  2WP9 B;  3AE6 B;  3AE2 B;  1DGJ A;  4C7Z A;  2WQY B;  2MJD A;  3HVZ A;  1NI3 A;  4N59 A;  2WDV B;  3SFE B;  1FM0 D;  3AB5 A;  4IDI A;  1FXI A;  1QOA A;  3P4P B;  2W55 A;  4C80 A;  1NEK B;  3FAH A;  3AEG B;  3AEA B;  1B9R A;  1OFF A;  1PFD A;  1ZUD 2;  5C2T B;  1ZP0 B;  2WU5 B;  1QOG A;  2HTM E;  3LXF A;  5AUI A;  1GTE A;  3AE9 B;  1QF6 A;  3VR9 B;  2WS3 B;  1YQ4 B;  1ZXI A;  1FO4 A;  2BS3 B;  1N63 A;  1NEN B;  5MPO A;  3W5V B;  5EE9 A;  2K9X A;  3NRZ A;  3B9J A;  1SB3 C;  1FFU A;  2CU3 A;  2MJE A;  4WQM A;  2LEK A;  2KMM A;  3AEE B;  1GAQ B;  4ZOH C;  3NVY A;  1A70 A;  1DOY A;  2WDR B;  2ACZ B;  1L6U A;  3AE1 B;  1N62 A;  2PVG C;  3W9C B;  5AUK A;  3AE3 B;  1TJE A;  3NS1 A;  5EE1 A;  3AE5 B;  1JWB D;  2JX5 A;  1KFY B;  1NYQ A;  3AMZ A;  4YTN B;  1YQ3 B;  2JQR B;  2PVO D;  2Q5W D;  4ZHP A;  1YJI A;  1T3Q A;  2W3S A;  3VR8 B;  1DOX A;  1E0Z A;  2H88 B;  4JX1 C;  4N6E B;  4US8 A;  1YJJ A;  1ZOY B;  2K22 A;  3CWI A;  1SF0 A;  1FFV A;  1XLO A;  2MJ3 A;  1FRD A;  3AH7 A;  3P4S B;  1V8C A;  3P4Q B;  2BT6 A;  1JAL A;  2KAJ A;  1H7W A;  1J7C A;  1E9M A;  2DWQ A;  3SR6 A;  4YTP B;  1N5W A;  1AYF A;  1WRI A;  1NYR A;  3SFD B;  3B2G A;  4JWS C;  3ZYY X;  1VLB A;  4WWM A;  1N5X A;  3PO0 A;  1CZP A;  2PIA A;  3CF4 A;  1AWD A;  3AEB B;  3CIR B;  1I7H A;  1EWY C;  1V97 A;  2M56 B;  1TKG A;  5G5G A;  4YSY B;  3FC4 A;  3B2F A;  5C3J B;  3DWM A;  1GTH A;  2OHF A;  1L0V B;  1XO3 A;  2BS2 B;  1QOB A;  2CJO A;  3VRA B;  1E6E B;  4P6V F;  1H7X A;  2PKO A;  1VDV A;  4US9 A;  2BS4 B;  1L5P A;  3WCQ A;  1FMA D;  2WU2 B;  2Y5C A;  1RWS A;  1KRH A;  2W54 A;  1J7B A;  1RYJ A;  3AE8 B;  2AX5 A;  2FBW B;  3NVW A;  1FXA A;  1NVI D;  1JRP A;  3ETR A;  1VJK A;  2N0S B;  1PUT A;  4A9A A;  2E3T A;  1L6V A;  3KWL A;  1FIQ A;  4USA A;  4ZHO A;  1JW9 D;  1JWA D;  1UWM A;  2L83 A;  2WLB A;  3L4P A;  4HRS A;  1E7P B;  4ITK A;  4LTU A;  3RPF C;  3W5U B;  1WYG A;  1JQ4 A;  4JWU C;  1ROE A;  5H92 C;  3P1M A;  3HRD D;  4FXC A;  3VRB B;  1GPX A;  1DOI A;  1R7S A;  3LB8 C;  4KX6 B;  4N58 A;  3AEC B;  1XLN A;  2MH7 A;  3NVV A;  1WWT A;  2CJN A;  1F0Z A;  1QOF A;  2H89 B;  5EE3 A;  1N61 A;  4YSX B;  1OQR A;  1WGK A;  2W3R A;  1WXQ A;  3P63 A;  3BII D;  1CJE A;  2M19 A;  3AED B;  2K5P A;  2WDQ B;  1TYG B;  1PDX A;  1N60 A;  2QJL A;  5GXG B;  5G5H A;  3ABV B;  1IUE A;  1FRR A;  3P4R B;  1JRO A;  3HUI A;  3AE4 B;  3NVZ A;  1KF6 B;  3AE7 B;  2DBY A;  1E10 A;  2L52 A;  1TKE A;  3AM9 A;  4YT0 B;  1XLQ A;  4YXD B;  2EKI A;  1TKY A;  2B76 B;  4YTM B; 
#chains in the Genus database with same CATH topology
 4FJV B;  2N9K A;  1GG3 A;  3APF A;  3SU8 X;  1TS4 A;  4RH6 A;  4DBG A;  4AUQ C;  4C7Z A;  1DGJ A;  5IAA C;  3EFC A;  3PZ8 A;  1HE8 A;  2LFI A;  3AEG B;  4D2K A;  1OFF A;  3ZTD A;  1Q10 A;  1GOZ A;  4HXD A;  5E6N A;  2K25 A;  1ZXI A;  2M4N A;  1UBI A;  2L8J A;  4IWO A;  5MPO A;  2BWF A;  3HHM A;  3UF8 A;  1NI2 A;  1WX9 A;  1V81 A;  4BBN F;  4AWJ A;  1HQR D;  3M3J A;  2WNM A;  2Q5W D;  1YJI A;  2W3S A;  4AJW A;  2VZK D;  2MCN B;  3Q3M C;  1HTQ A;  1FRD A;  4DXG A;  4XYC A;  4EFO A;  1H7W A;  4MH8 A;  3UIP B;  4HJG E;  3KVF B;  1E90 A;  1I7H A;  4RGT A;  1OGW A;  3C19 A;  3KQ4 A;  2BS2 B;  2I1J A;  2HD5 B;  1H7X A;  4G3X B;  1C78 A;  4FN2 A;  5G2N A;  4A8X C;  3PRP B;  2I2Y A;  4ZRK A;  1I4R A;  4OZC A;  2CHZ A;  1E5W A;  2WLB A;  4ITK A;  3DVG X;  2KDB A;  3QQ8 B;  4LNI A;  1VR9 A;  1QKZ A;  4K3C A;  2V3N A;  2W3R A;  1SJH D;  3ZXV A;  2B3A A;  3E9S A;  4BKG A;  1TTN A;  2KJ6 A;  1WH3 A;  5G5H A;  2YVC A;  2FE8 A;  3P4R B;  2J52 A;  2L76 A;  1YX5 B;  3HM6 X;  2KTF A;  1V2Y A;  3Q8A A;  4YTM B;  3AEF B;  2QIE B;  3M95 A;  3AE2 B;  2GOW A;  4NJC A;  3A1Q A;  1TS5 A;  4IOI E;  3OAW A;  2L32 A;  4TSS A;  2PPH A;  1ZP0 B;  2HTM E;  4OW0 A;  4FHJ A;  1GTE A;  1VCB A;  2JF5 A;  3KUC B;  3R2I A;  4KZC A;  3EA6 A;  2WDR B;  3UI3 A;  2ACZ B;  4KSK C;  5EE1 A;  2IO0 B;  4AJY B;  2DZK A;  1S1Q B;  1Y8R C;  2N4F A;  3RNB C;  3U7Z A;  4WJQ A;  2NPT A;  2MJ3 A;  1P7F A;  2LGI A;  4X57 B;  2WXH A;  2C7H A;  1BT0 A;  2PLP A;  1YN4 A;  4MJS B;  1P9D U;  3A9J B;  3ZDM C;  1QIL A;  2IY0 B;  4YSY B;  2N7E A;  3N32 A;  4RGM A;  1ZDV A;  1QZE A;  2IY1 B;  4W9E A;  1LQB A;  4RM9 A;  3DBR B;  2AX5 A;  2L0T A;  5JXV A;  2JXT A;  1EU3 A;  2EMT A;  2ICI A;  3R7Q A;  4IW0 A;  3BVM A;  3V05 A;  3SEB A;  2ASQ A;  4KX6 B;  4BVU C;  2D3C A;  4JLC A;  2CJN A;  3N3K B;  4WWO A;  1QOF A;  2XEW A;  3JYU A;  2FCQ A;  1WF9 A;  4G0N B;  3P63 A;  4HLE A;  2G3Q B;  2KVR A;  1TYG B;  4AP4 C;  2ZNV C;  2OJW A;  3QAQ A;  1IYF A;  1VZ7 A;  1WJU A;  1C77 A;  2JY6 A;  2KKC A;  2IGG A;  2XNA C;  3PLU A;  4FUL A;  4AQ7 A;  2LRU A;  4HWI B;  3DWG C;  5EE0 A;  1GT8 A;  3Q3J A;  4GMV A;  1QLB B;  2K0P A;  2JZ3 B;  2XN9 C;  1I4P A;  3HVZ A;  2KN4 A;  3HIZ A;  1WE7 A;  2LWP A;  3AEA B;  5BYQ A;  2BYT A;  1ZUD 2;  2WU5 B;  2HJ1 A;  5LXI B;  2WGS A;  3ZRC A;  1UZX B;  2QDF A;  4BOZ B;  2NVU I;  4MM3 A;  2K9X A;  1I4Q A;  3NRZ A;  1FFU A;  2PE6 B;  3QAR A;  2LI5 A;  1C79 A;  5IO9 A;  3EGR A;  4GDK A;  1NYQ A;  2KC1 A;  4K3B A;  3S2A A;  1PQS A;  2V1Y A;  1J19 A;  3I57 A;  3UQA A;  2ZW1 A;  2KAJ A;  1V1P A;  2LHE A;  1J7C A;  3VQI A;  4ARI A;  4JQW C;  3K9O B;  4L1B A;  4NAW A;  4AS1 A;  1V97 A;  2WXI A;  2DAF A;  2OHF A;  3DQV A;  1L4Z B;  1TZ1 A;  3I5J C;  2WX1 A;  4KIK B;  1J7B A;  3ETR A;  4A9A A;  2AL6 A;  4USA A;  3V3X A;  1TY0 A;  2AWT A;  2DX5 B;  3H7P A;  3B0A A;  2IJ0 A;  1IPG A;  2WXK A;  3W1S C;  1WGK A;  2WWZ A;  5IKC M;  1K50 A;  1MHX A;  3Q14 C;  3VUY A;  1WR1 A;  4HVB A;  1YN5 A;  1E10 A;  2JYT A;  3QC8 B;  4TKN A;  3GB1 A;  1F77 A;  1XCQ L;  1V6E A;  4HKQ A;  2M8S A;  1RRB A;  2W82 A;  5E6O A;  4ZDV A;  3IAS 1;  1T0S C;  2WQY B;  3DBH I;  4KGS A;  4RM8 A;  3RT3 B;  4K7U A;  5L95 C;  2IO1 B;  3AB5 A;  4IDI A;  3SDL C;  1AW7 A;  3TCA A;  3V61 A;  1NEK B;  3H1U A;  3PRZ A;  1B9R A;  1BML C;  1SBB B;  4HKZ E;  5FK9 C;  2KQ4 X;  4XX5 A;  2JWU A;  2LZ6 A;  3ML9 A;  4K7S A;  4YL8 A;  4KDL B;  2KWV B;  1TS2 A;  1WXS A;  5CHF A;  2PVG C;  4GN1 A;  3VHT C;  2KJH B;  2JWZ A;  4WAA A;  2MWS B;  1SF0 A;  4TV3 A;  1ET9 A;  3B08 A;  3ZRF A;  5BMH A;  2GRI A;  2VH2 A;  3TEX A;  3UIN B;  1SE9 A;  4A3P A;  2NTT A;  1PGA A;  1WXA A;  4OVU A;  1WJN A;  2GLS A;  3L08 A;  4M01 A;  4G50 A;  3EEC A;  3H7S A;  4GDK B;  3IBE A;  2YEP B;  2N1W A;  1V5O A;  4P6V F;  2PKO A;  4H2A A;  2GBM A;  1P1A A;  1RWS A;  3ZYY X;  4YWG G;  3Q8B A;  2CHW A;  1M4V A;  1JWU D;  3W5U B;  1Z5S B;  4FXC A;  3AEC B;  4BOS C;  5EDS A;  2PMV A;  2MSE D;  1WWT A;  2KFK A;  1XQQ A;  4FLH A;  1HA5 A;  4YSX B;  4RCO A;  4ASW C;  1VZ6 A;  3NJT A;  3AU5 A;  3OJ3 A;  3ZKJ C;  3GOE A;  3W1Y A;  3NVZ A;  4HCN B;  4HJK A;  3U52 E;  4WJO A;  2HDE A;  1TKY A;  2NMQ A;  2N9P C;  1F1H A;  5H8Y E;  4A20 A;  4I6L B;  4LNO A;  2ZVO A;  1YJ1 A;  4MT5 A;  1YMH E;  1C9F A;  2KOX A;  2OED A;  2INN E;  2GBR A;  1YD8 U;  4GOC A;  2WXM A;  2JYE A;  2FCM A;  1QOG A;  3LXF A;  5AUI A;  3AE9 B;  2IO3 B;  1FO4 A;  5J17 A;  3DPD A;  3MHZ A;  4ZRP A;  1L0X B;  2K8B A;  3NZU A;  3RI7 C;  3R8B A;  2VZK B;  1JWS D;  4NAW B;  4DWF A;  2L0F A;  3NY5 A;  5D3I B;  3DCG A;  4RFB A;  2LJI A;  1JRU A;  5JH5 C;  2BT6 A;  4EE2 A;  4KIK A;  1D5M C;  3SFD B;  3EC8 A;  4IM0 A;  5DPT A;  3VTU A;  3CF4 A;  2M56 B;  2KC2 A;  3IT6 B;  3FC4 A;  3WAN A;  4W9I A;  3PSE B;  1ZW7 A;  2KNB A;  3MC0 B;  1QOB A;  4M0W A;  1OQY A;  1SE3 A;  4GIV A;  4W9H A;  2N1V A;  2CHX A;  4GGQ A;  2FBW B;  4XC2 A;  1T6B X;  4FA6 A;  4ICU A;  3L4P A;  1SIF A;  1E7P B;  1FNU A;  4IM3 A;  1DOI A;  3LB8 C;  3ENE A;  5TR5 A;  1KH0 A;  2L1A A;  4P1C C;  1X1M A;  2M19 A;  2WDQ B;  2MBQ A;  4BKT A;  3RUI B;  2BTE A;  5BMI A;  2L7R A;  4XWT A;  2L52 A;  1XLQ A;  2L3Z A;  4PT5 A;  3RNC C;  1NBF C;  4IWQ A;  1WGG A;  2MX2 A;  2DYM A;  1J8C A;  1T0Q C;  2BKF A;  2JRH A;  1KLG D;  4YSZ B;  1XLP A;  2D3B A;  3VUW A;  1J0G A;  5HHD G;  1TBE A;  2QHO A;  2D11 A;  4N9F 4;  2KYW A;  2WP9 B;  2WX0 A;  1UUP A;  4DDG D;  1TT5 B;  2N9X A;  3NS8 A;  3QHT A;  2O2V B;  1QOA A;  2RDB C;  3PHW B;  4GDL A;  1QQR A;  4II3 B;  2EMS A;  1E8Y A;  1UGM A;  4ACF A;  3L10 B;  3KYC D;  3FIL B;  2KWC A;  3P2B A;  4B95 A;  3DHH C;  3R7R A;  5JHA A;  4IWP A;  3AEE B;  2WYQ A;  3VH3 B;  4DK5 A;  2RD0 A;  1SXT A;  2KT7 A;  1V5T A;  2WXN A;  1JWB D;  2JX5 A;  4MDK E;  3O65 B;  4S0R A;  3VH4 B;  4BKS D;  1UD7 A;  1C4P A;  2RMM A;  3PT2 B;  2MLB A;  3T8M A;  4ZRQ A;  1SGH A;  1Z2M A;  4MSM B;  4NPN A;  4P1B C;  3BK1 A;  3CIR B;  1YNT E;  4UDU C;  3CST A;  3ZJU A;  5G5G A;  3L0W B;  3DWM A;  2DAJ A;  1F9J A;  3TIX A;  1XO3 A;  2G4D B;  1E6E B;  3VXW A;  2C9W B;  3GZN I;  2V0G A;  2D3G A;  2L83 A;  1JQ4 A;  3ZW3 A;  1SJE D;  2DYB A;  1B1Z A;  2KLC A;  1MFW A;  5BYR A;  4LCD E;  5T8I A;  3PTF C;  5BO4 B;  3BVG A;  4MGI E;  4WWN A;  1N60 A;  4KDI C;  1UGJ A;  2BYF A;  5D6J B;  2B76 B;  2ZCC A;  2QC8 A;  4BBN C;  3Q8E A;  3AN1 A;  3VAW A;  2ZJD A;  1YIW A;  2WXO A;  5AEK B;  3BIN A;  1WMH B;  2LRW A;  4GLS C;  4GU2 A;  2V4L A;  4M00 A;  1NI3 A;  3I9V 1;  1LXD A;  5AZG A;  1V1O A;  1LM8 B;  2LVO A;  3NG0 A;  4PK1 A;  5TSS A;  1WGY A;  5D94 A;  3O13 A;  4KSL C;  4IKG A;  4C4V B;  2BB5 A;  4PS8 A;  3BVZ A;  4REZ A;  1DOY A;  5D3D A;  3QCA A;  2WHI A;  1N6Z A;  2QIL A;  2WXR A;  1D6E C;  2D5G A;  2K22 A;  3FIL A;  4MH0 E;  1FFV A;  4C56 C;  3V60 A;  3KUZ A;  2ON8 A;  3A9K A;  2CS4 A;  2RGF A;  4PS3 A;  2JZP A;  2KD0 A;  1WY8 A;  1MVK A;  3E56 A;  2AEH A;  2D07 B;  3MFG A;  4ANU A;  3PV1 A;  5DPR A;  1I35 A;  4DQO C;  2CJO A;  4ZYN A;  3DVG Y;  2KQS A;  2BS4 B;  4US9 A;  3WCQ A;  4NJ6 A;  3ZJT A;  2Y5C A;  1WIA A;  1VJK A;  4B0E A;  3TEY A;  2AQ2 B;  3JW0 X;  3R3M A;  3AXC A;  1GC6 A;  3HRD D;  1GB1 A;  3VRB B;  4J3O D;  2FCN A;  1YOV B;  3VFK A;  4HPL B;  3RYT A;  1N61 A;  2HTH A;  4BZA A;  2ZVN A;  2NTS A;  1YX6 B;  3WAP A;  5GXG B;  1C1Y B;  3ZNH B;  1JML A;  1TKE A;  1ET6 A;  3U7D A;  3RZW C;  4K1R B;  4XGA B;  1V49 A;  1OTR B;  2IZV B;  2FIF A;  2UU7 A;  3U30 A;  3EUB 2;  4RF0 A;  1C4A A;  4EOY A;  1TS3 A;  2Y5P A;  1WXM A;  3WAL A;  1ESF A;  2W55 A;  2WXQ A;  3FAH A;  3C0R B;  3D32 A;  2X8X X;  3MJ5 A;  2C7N B;  4WIP A;  1M94 A;  2KFK B;  1K53 A;  3TJP A;  1QF6 A;  2HE7 A;  5EE9 A;  1SB3 C;  3RN9 C;  1R4N B;  3B1L X;  1Q1O A;  1GNU A;  4E74 A;  1LGR A;  4MJS A;  5AZF A;  4E3C A;  1E0Z A;  2KQ7 A;  3ZDT A;  2A5U A;  3AH7 A;  4IC7 B;  2LHD A;  2RDH A;  4MM3 B;  1N5W A;  4WAF A;  1UWX A;  4MGZ E;  2C7M B;  3AEB B;  2LJ5 A;  1F2R C;  3DBR I;  2Y3A A;  1RAX A;  2O6V D;  2GBN A;  2JPH A;  4RMA A;  1IP9 A;  1STE A;  2PTL A;  4LK0 M;  3A4S C;  4HK2 A;  3QX1 A;  2CKH B;  2Z0E B;  4MEL A;  5C23 A;  2DHZ A;  4RF1 A;  3WIM A;  1WXQ A;  5HI1 A;  2BW2 A;  3M62 B;  3DVN V;  2GI9 A;  1C76 A;  1IUE A;  1WJ6 A;  4JIO U;  3URY A;  2RSU A;  5E6P A;  1FD6 A;  3Q2A C;  1ZE3 D;  1XF5 L;  2EKI A;  2AYO B;  3RCZ A;  3A9J A;  5D2M B;  1XT9 B;  2ZPY A;  1SEB D;  3IXS A;  4PYZ A;  1UNS A;  3Q3N C;  3K9P B;  2FNJ B;  4JPS A;  2IO2 B;  2K8H A;  3U2S C;  4OZA A;  1V86 A;  5KHQ A;  3AE6 B;  2DZI A;  5FR6 A;  2GMI C;  2J0J A;  1F52 A;  4MGY E;  2NBU A;  4ICV A;  1D3Z A;  1FNV A;  3TEW A;  4KV2 A;  5CHW A;  5GMV A;  5C2T B;  2KMC A;  3VR9 B;  4NNJ B;  4OHJ A;  1N63 A;  4PYU A;  1I42 A;  1BXT A;  2MW5 A;  5D7G A;  3PVL A;  3B9J A;  3N9Y C;  2ZPN A;  4EZJ A;  4NQL B;  3I63 C;  2LGS A;  1L6U A;  5JHB A;  2REX A;  3PS6 A;  3H7P B;  4LJP B;  2MRP A;  5KHO A;  1UF0 A;  2WXP A;  3ZLZ A;  2K8C A;  2RR9 A;  1MPE A;  3HVD A;  1L7Y A;  2JXX A;  1XLO A;  4NZL B;  2CR5 A;  1UBQ A;  4JGH B;  3X23 A;  2Z0D B;  4RGO S;  4DHZ E;  3QIJ A;  1EWY C;  3Q69 A;  3CMM B;  2J4X A;  4L23 A;  4LDT D;  4LNF A;  5DPW A;  3VRA B;  3TUO A;  1L5P A;  3MTN B;  2BYV E;  3L16 A;  3NVW A;  1KRH A;  1RYJ A;  1JRP A;  1C4C A;  2E3T A;  2G4S A;  4ANX A;  4ZHO A;  4EZL A;  1R4M B;  2XK5 B;  4CO7 A;  1D5X C;  3U4E G;  2H89 B;  3TBL D;  2LXA A;  3ALB A;  4O1N A;  3RUL A;  3N20 C;  2L05 A;  4B0M A;  4DHJ B;  1TZO A;  4M8M A;  1PGB A;  1EF5 A;  2HJ8 A;  3Q3O C;  3BY4 B;  2KVZ A;  1C3T A;  2CU1 A;  4AOF A;  3NZ3 A;  4FJZ A;  1E7U A;  3VTV A;  3L13 A;  2KMA A;  4W9G A;  1ZKH A;  4WJN A;  2J0M A;  2SAK A;  4HDO A;  2N7D A;  2DYO A;  1IGD A;  1OEY A;  2MP2 B;  5FKA C;  2RPV A;  1FXI A;  4TMA B;  1PFD A;  4CHK A;  3UQB A;  1GJZ A;  4GB9 A;  2J53 A;  2JSV X;  1ZPS A;  3W5V B;  2CU3 A;  4C00 A;  3BYT B;  3Q8F A;  4WH4 A;  2KAN A;  1A70 A;  3NVY A;  4HPP A;  3AE1 B;  1N62 A;  4W9C A;  5AUK A;  1Y56 A;  4ZHP A;  1DOX A;  5IOI A;  4N6E B;  3SHQ A;  3CWI A;  1GUA B;  1WMH A;  5I4D A;  1SE4 A;  1CK1 A;  4EZK A;  1FPY A;  2JT4 B;  1AYF A;  1EF1 A;  1CZP A;  2INP E;  2FCS A;  1ZXH A;  2IGH A;  3V62 A;  4NQK E;  3B2F A;  2KXJ A;  2IND C;  4R3D A;  4P7I A;  4S17 A;  3N1Y C;  4LLG M;  4L2Y A;  4HRS A;  1HZ6 A;  4JWU C;  3A1Q B;  2E6X A;  3IAM 1;  3GZN B;  4HDQ A;  2R2Q A;  1HTO A;  3ZTC A;  2LVQ A;  1CJE A;  3MJW A;  2QJL A;  3NHE B;  5CHV C;  1BUI C;  2LVP A;  2DBY A;  2UWQ A;  2QMT A;  2WXG A;  1FXT B;  4YXD B;  2XK5 A;  4K81 A;  1RFK A;  4TUU A;  4XDC A;  1J7A A;  1SSN A;  1RM6 C;  4F1S A;  2VH1 A;  1T5X D;  2Z8L A;  2BYE A;  4GDL B;  3SFE B;  3KUD B;  3TL5 A;  1AAR A;  2M1M A;  1WM2 A;  1YQ4 B;  3ONS A;  2O6V A;  3RNG C;  3GP7 A;  3RPF C;  1LO5 D;  4HCP B;  3AE5 B;  3QWZ B;  1L4D B;  1XEE A;  3TEZ A;  3C8Y A;  2O2V A;  1T3Q A;  2MBH A;  4NJ7 A;  4OVZ A;  2XBB C;  3OLM D;  3ZIM A;  2WXL A;  5LLI A;  2X38 A;  3I3T B;  2JVC A;  3EFU A;  3P4S B;  1WFY A;  3FKY A;  2DWQ A;  4YTP B;  2ZZP B;  1T0Y A;  1NYR A;  2I1K A;  2MEK A;  3DBL B;  1EU4 A;  3IT4 B;  1GB4 A;  3W2D A;  5IN7 A;  2BGF A;  4DXA B;  5C3J B;  2EKE C;  1GTH A;  2YLM A;  2ONQ A;  2BF8 B;  2BWE S;  1MJD A;  2QCZ A;  1FMA D;  3N1X C;  3KLS X;  1F2R I;  1TY2 A;  1I4G A;  1PUT A;  4JL9 A;  3PHX B;  4I6N B;  2DZM A;  3R2T A;  1WX8 A;  4KGT A;  1XLN A;  3Q3F A;  2L00 B;  3ZNI D;  3BII D;  1HEZ E;  4W9J A;  3AED B;  1YN3 A;  2YEP F;  3NOB A;  3PRE A;  2K6Q A;  1GC7 A;  2N9E B;  3J9C A;  3AE7 B;  2GBJ A;  1WR6 E;  2AQ3 B;  1XCT L;  1VZ8 A;  3W1S A;  2AQ1 B;  3L54 A;  1QT9 A;  1IBX A;  3NUH B;  2KTR B;  2R61 A;  1WM3 A;  1WZ3 A;  1FCC C;  2FID A;  3RZF A;  4BKS A;  4DHZ B;  2KK8 A;  3N1Z C;  2KDI A;  1RFA A;  2J0K A;  4PS7 A;  1LFD A;  5HFY A;  1Q5W B;  1NEN B;  1WE6 A;  2NBV B;  1E8Z A;  4MEM A;  2KWU B;  2LEK A;  2KMM A;  1GAQ B;  4CYE A;  3W9C B;  3T9L A;  3ZXR A;  1KLU D;  3NS1 A;  1VD2 A;  1KFY B;  2Z59 B;  2JQR B;  2LXC A;  2H88 B;  3VUX A;  1ZOY B;  3NZS A;  3DHI C;  3PRM B;  1EM7 A;  2BBC A;  2IGD A;  4BAX A;  1ISN A;  2RPQ A;  3H9D A;  4JWS C;  5LNK 1;  4OVV A;  1P98 A;  3DDC B;  3H8H A;  3IHP C;  2IYD B;  3ZJV A;  4MAC A;  1E7V A;  3PZ7 A;  3ZGZ A;  1CMX B;  1P0R A;  2A4Z A;  1U4A A;  4E71 A;  2DLB A;  3T3O A;  4KKI A;  1T0R C;  4WUR A;  5JZE B;  1VDV A;  2KN5 A;  4G11 A;  1WX7 A;  1FXA A;  4W9D A;  2ZEQ A;  1L6V A;  3WAO A;  1L0Y B;  1UWM A;  4LTU A;  4LNK A;  1K52 A;  5H92 C;  3WAM A;  3KWV A;  1WRD B;  1D5Z C;  1MI0 A;  3LJ3 A;  3BYY B;  2C5L C;  3N30 A;  1G6J A;  1FEH A;  3RFZ B;  1P7E A;  3ABV B;  2N7J A;  4TQ0 A;  1P3Q U;  1V9J A;  3QK0 A;  1Q0W B;  1OQR A;  3DHG C;  1K51 A;  2BQQ A;  1UH6 A;  2OJR A;  3AV8 A;  2KAC A;  3OG5 A;  3RNA C;  1ZGU B;  2MJD A;  2GBK A;  3ZO5 B;  4P16 A;  4C80 A;  1XXG A;  5L83 A;  2QSD A;  1H8C A;  1PGX A;  3ZUN A;  4XE0 A;  3QA8 A;  2KWD A;  2BS3 B;  5LXH A;  1R4M I;  4I6P A;  4GSW A;  3APD A;  1DYQ A;  3UIO B;  3L17 A;  1ENF A;  2KDE B;  2J42 A;  4KGR A;  2TSS A;  1WZ0 A;  2PE9 A;  2W9N A;  2R2O A;  4WWP A;  1KOT A;  2KX0 A;  1V8C A;  1JAL A;  4W9L A;  1D4B A;  3V6C B;  4BFR A;  3TMP B;  3PO0 A;  3DBH B;  1HZ5 A;  1TKG A;  1ZDX A;  4F7Z A;  3JVZ X;  1WSP A;  4M0W B;  4EEW A;  2AL3 A;  3MHS D;  4FAD A;  5HKH A;  1NVI D;  3R66 C;  2VRR B;  2NS5 A;  1EUV B;  4LNN A;  3PLV A;  1V80 A;  3P1M A;  3APC A;  3NVV A;  4MGK E;  5HG2 A;  3UGB B;  3AI5 A;  3H6N A;  4DXF A;  3OJ4 B;  2NR2 A;  1V1P B;  3SD5 A;  4YT0 B;  1RLF A;  4TQ1 A;  3GE3 C;  1EWC A;  5CX3 A;  4HRO A;  4A55 A;  2BVC A;  1XD3 B;  2G1E A;  2D3A A;  4C7Y A;  2D10 A;  3HK0 A;  1PYW D;  2OOB B;  3IVF A;  2INC C;  4CQN A;  2IDY A;  1CQV A;  2GB1 A;  1FCL A;  1R4N I;  2IPK D;  4J6I A;  5C1Z A;  5E6J A;  3MC8 A;  4W9K A;  4XWW A;  3MC9 A;  3ZVV A;  4IM2 A;  3ZQ4 A;  4ZOH C;  1JCK B;  3ZNZ B;  5J18 A;  5J2R A;  1TJE A;  2KHW B;  1KM7 A;  3PPA A;  1YQ3 B;  3RD2 A;  1VRA B;  5DCN A;  2QEJ C;  3VR8 B;  2JRI B;  2KFJ A;  2J7Q B;  1IGC A;  2MQJ A;  3A4R A;  4ZRI A;  2I38 A;  3Q8C A;  2D2Q A;  1WRI A;  3LYY A;  2KX3 A;  1VLB A;  3U8Z A;  4JE3 B;  4WWM A;  1N5X A;  2PW9 A;  2WDT B;  1MG4 A;  3IG3 A;  1KLV A;  1L0V B;  2JU6 X;  1FNW A;  4B9K A;  2KLG A;  2RDG A;  2BKR B;  1JWM D;  3KWL A;  1FIQ A;  1JW9 D;  2MHJ A;  3KH0 A;  5FR3 A;  1GPX A;  4EUT A;  3QJZ A;  3VTW A;  1I4H A;  2MH7 A;  1F0Z A;  3AU4 A;  3P42 A;  3M63 B;  1H4R A;  4B6W A;  3VVW B;  4KZ0 A;  2K39 A;  3A9K B;  3RMK C;  3JSV B;  3CSF A;  3AE4 B;  1K8R B;  1KTK A;  4EKU A;  3ML8 A;  5BMG A;  2IBI B;  3DBL I;  3RNF C;  2LD9 A;  3RNE C;  3BK2 A;  3ZNG C;  2N9L A;  4A3O A;  3OWE B;  1WGD A;  1SIJ A;  2V4I B;  3KYD D;  4IUM B;  4RNA A;  4WJP A;  2MBB B;  5IA7 A;  2FUG 1;  3EHV A;  2UYZ B;  2MBO A;  2V3S A;  1I4X A;  4HEA 1;  2WS3 B;  3TSS A;  2V9H A;  1MHH E;  2FUH B;  3IFW B;  4WQM A;  2WXJ A;  1E8X A;  2M17 A;  1HXY D;  4II2 B;  3AE3 B;  4M02 A;  3AMZ A;  4KKJ A;  4M8N A;  1TIF A;  2PVO D;  4GXB A;  4NY0 A;  2DEN B;  4JX1 C;  1YJJ A;  4NAM A;  3P4Q B;  1IBX B;  3ECI A;  3SR6 A;  2BB6 A;  3B2G A;  4KVG B;  1AWD A;  3LDZ E;  3PZD A;  3T3N A;  4LJO B;  4A6Q A;  2JUO A;  3BWU D;  2KZR A;  1TGZ B;  2JZZ A;  3X0W A;  4LDT B;  1SE2 A;  3HM3 A;  2W54 A;  2PJH A;  2M0X A;  3Q6B A;  2N0S B;  3DOW A;  4ANW A;  2LMC A;  2C60 A;  2LGX A;  4IG7 B;  1YQB A;  1ROE A;  4XDD A;  1R7S A;  1EO6 A;  2LUM A;  2WXF A;  4K7W A;  4FBJ B;  1WGR A;  5DPS A;  2K5P A;  1PDX A;  4C4V A;  1NDD A;  1FRR A;  4DHJ D;  2LAS A;  1L2N A;  2LUE A;  3AM9 A;  3VDZ A;  2SEB D;  1OQQ A;  2MA9 B;  4F8C B;  4HPM B;  1WJ4 A;  2G45 B;  2KTR A;  1A5R A;  4N59 A;  3PGE A;  2WDV B;  3JSV A;  1FM0 D;  3WA0 A;  4RGN A;  2ZW0 A;  3P4P B;  3DVN U;  3V6E B;  4DDI D;  2LGY A;  4OZB A;  2NBW B;  2ZNV B;  2BPS A;  3MP9 A;  3GS2 A;  5AZH A;  4A90 A;  4ARC A;  2MJE A;  2KJR A;  5BYS A;  2DNF A;  2Y5B B;  2PEA A;  2DZJ A;  4Q2J A;  1AN8 A;  4YTN B;  3BZD B;  3CF6 E;  5IP4 D;  1WXV A;  4ANV A;  1WI0 A;  1E9M A;  4URK A;  3GE8 C;  4W9F A;  2PIA A;  2MP2 A;  2KDM A;  5G55 A;  2NPT B;  2KDF B;  1ACC A;  2FAZ A;  4WQO B;  2ZCB A;  2K6D B;  2EEL A;  2WU2 B;  4US8 A;  3AE8 B;  1JWA D;  4FJY A;  1WYG A;  2K3U A;  3DBS A;  2KO3 A;  4FHK A;  1WYW B;  3A33 B;  4N58 A;  1E8W A;  2O6V B;  2K1F A;  2MBE A;  1OEY J;  4ZRJ A;  2LGD A;  5EE3 A;  2M0A A;  2V3P A;  4ZYS A;  2G9H D;  3AUL A;  1MG8 A;  5CTR C;  4MSQ B;  1JRO A;  3HUI A;  4QAY A;  1S3S G;  1WGH A;  1KF6 B;  3KW5 B;  1KJT A;  2NCN A;  4XZ4 A;  1UEL A; 
#chains in the Genus database with same CATH homology
 1K51 A;  2N9K A;  1SEB D;  5H8Y E;  3IXS A;  1UNS A;  2KAC A;  1TS4 A;  3AV8 A;  4JPS A;  4MT5 A;  4RH6 A;  1YMH E;  1C9F A;  3U2S C;  4OZA A;  3AE6 B;  1DGJ A;  2OED A;  4C7Z A;  2MJD A;  2INN E;  3PZ8 A;  4P16 A;  4C80 A;  2WXM A;  2LFI A;  3AEG B;  1XXG A;  2JYE A;  4D2K A;  2QSD A;  1FNV A;  3TEW A;  1OFF A;  5C2T B;  1QOG A;  1Q10 A;  3LXF A;  5AUI A;  3AE9 B;  1GOZ A;  1PGX A;  3VR9 B;  4XE0 A;  1ZXI A;  1FO4 A;  2KWD A;  4OHJ A;  2BS3 B;  1N63 A;  3MHZ A;  1BXT A;  5MPO A;  5D7G A;  4ZRP A;  1L0X B;  3B9J A;  3N9Y C;  3R8B A;  2VZK B;  1JWS D;  1L6U A;  4NAW B;  1HQR D;  1DYQ A;  2WNM A;  1ENF A;  2Q5W D;  1YJI A;  2J42 A;  2W3S A;  2WXP A;  4KGR A;  2TSS A;  5D3I B;  2VZK D;  1MPE A;  3HVD A;  4RFB A;  1XLO A;  1FRD A;  2LJI A;  1V8C A;  2BT6 A;  4NZL B;  1JAL A;  4DXG A;  4EE2 A;  1H7W A;  1D4B A;  4MH8 A;  4RGO S;  1D5M C;  3SFD B;  3PO0 A;  4HJG E;  3CF4 A;  1I7H A;  4RGT A;  1EWY C;  2M56 B;  1HZ5 A;  1TKG A;  1ZDX A;  3IT6 B;  3Q69 A;  1WSP A;  3FC4 A;  2J4X A;  3KQ4 A;  3MC0 B;  4L23 A;  2BS2 B;  1QOB A;  3VRA B;  4M0W A;  3TUO A;  1H7X A;  1L5P A;  1SE3 A;  1C78 A;  3NVW A;  1KRH A;  1RYJ A;  4A8X C;  2FBW B;  1NVI D;  2I2Y A;  1JRP A;  1T6B X;  1I4R A;  4OZC A;  1C4C A;  2E3T A;  4ZHO A;  2WLB A;  3L4P A;  1E7P B;  4ITK A;  1FNU A;  3P1M A;  1DOI A;  3LB8 C;  1VR9 A;  3NVV A;  1D5X C;  1KH0 A;  1QKZ A;  2L1A A;  3U4E G;  2H89 B;  5HG2 A;  2V3N A;  2W3R A;  1SJH D;  3E9S A;  2M19 A;  2WDQ B;  4O1N A;  4DXF A;  4B0M A;  5G5H A;  2FE8 A;  3P4R B;  1TZO A;  1V1P B;  5BMI A;  2BTE A;  4XWT A;  1PGB A;  2J52 A;  2L52 A;  4YT0 B;  1XLQ A;  3NZ3 A;  3Q8A A;  4YTM B;  4TQ1 A;  4PT5 A;  1EWC A;  3AEF B;  4HRO A;  4A55 A;  2DYM A;  2QIE B;  2SAK A;  2G1E A;  1KLG D;  4YSZ B;  4C7Y A;  1XLP A;  5HHD G;  2DYO A;  2WP9 B;  3AE2 B;  1IGD A;  1PYW D;  1UUP A;  5FKA C;  2RPV A;  4NJC A;  1FXI A;  1QOA A;  4TMA B;  2IDY A;  4CQN A;  1TS5 A;  1CQV A;  4IOI E;  2GB1 A;  1FCL A;  1PFD A;  1QQR A;  2L32 A;  4TSS A;  1ZP0 B;  2HTM E;  4OW0 A;  1GTE A;  2IPK D;  2J53 A;  2JSV X;  3FIL B;  1ZPS A;  5E6J A;  3R2I A;  4XWW A;  3W5V B;  3ZQ4 A;  2CU3 A;  4ZOH C;  3BYT B;  3AEE B;  3Q8F A;  4WH4 A;  3NVY A;  1A70 A;  3EA6 A;  1JCK B;  2WDR B;  3UI3 A;  2ACZ B;  1SXT A;  3AE1 B;  1N62 A;  5AUK A;  1TJE A;  5EE1 A;  2WXN A;  1JWB D;  2JX5 A;  1YQ3 B;  1VRA B;  1Y56 A;  4ZHP A;  2QEJ C;  1DOX A;  3VR8 B;  3U7Z A;  4N6E B;  1IGC A;  3CWI A;  1C4P A;  2RMM A;  5I4D A;  2MJ3 A;  1P7F A;  2LGI A;  1SE4 A;  2WXH A;  4ZRQ A;  1CK1 A;  2I38 A;  2PLP A;  3Q8C A;  1AYF A;  1WRI A;  1YN4 A;  3LYY A;  1VLB A;  4JE3 B;  4WWM A;  1N5X A;  2INP E;  1CZP A;  3BK1 A;  3CIR B;  1YNT E;  2PW9 A;  4UDU C;  1QIL A;  1ZXH A;  3ZJU A;  2IGH A;  5G5G A;  4YSY B;  3B2F A;  3DWM A;  4RGM A;  1ZDV A;  1L0V B;  2JU6 X;  1XO3 A;  1FNW A;  1E6E B;  4R3D A;  2RDG A;  4LLG M;  4L2Y A;  2AX5 A;  1JWM D;  5JXV A;  3KWL A;  2V0G A;  1FIQ A;  2JXT A;  1JW9 D;  2L83 A;  4HRS A;  1EU3 A;  2ICI A;  1JQ4 A;  1HZ6 A;  3BVM A;  4JWU C;  3V05 A;  1SJE D;  5FR3 A;  1GPX A;  2E6X A;  3IAM 1;  3SEB A;  1B1Z A;  4KX6 B;  1I4H A;  2MH7 A;  5BYR A;  1F0Z A;  2CJN A;  5T8I A;  1QOF A;  3BVG A;  3P42 A;  3P63 A;  1CJE A;  1TYG B;  1N60 A;  2QJL A;  1VZ7 A;  1BUI C;  3AE4 B;  1C77 A;  1UGJ A;  1KTK A;  2DBY A;  2QMT A;  2IGG A;  2WXG A;  5BMG A;  4YXD B;  2XNA C;  2B76 B;  4AQ7 A;  3Q8E A;  3AN1 A;  3DWG C;  1RFK A;  5EE0 A;  3BK2 A;  1GT8 A;  2WXO A;  1QLB B;  2K0P A;  1J7A A;  1SSN A;  4XDC A;  1RM6 C;  2N9L A;  3OWE B;  1SIJ A;  2V4I B;  2XN9 C;  1I4P A;  4GLS C;  1T5X D;  2Z8L A;  4RNA A;  3HVZ A;  1NI3 A;  2KN4 A;  2FUG 1;  4GDL B;  3SFE B;  3I9V 1;  1V1O A;  3AEA B;  5BYQ A;  2BYT A;  1ZUD 2;  2WU5 B;  1I4X A;  4HEA 1;  5TSS A;  2WS3 B;  1YQ4 B;  3TSS A;  1MHH E;  3GP7 A;  3O13 A;  2K9X A;  1I4Q A;  3NRZ A;  4WQM A;  1FFU A;  3RPF C;  2WXJ A;  4IKG A;  2BB5 A;  1HXY D;  3BVZ A;  4REZ A;  1DOY A;  5D3D A;  1LO5 D;  1C79 A;  3EGR A;  3AE3 B;  3AE5 B;  1L4D B;  1NYQ A;  1XEE A;  2QIL A;  3AMZ A;  3C8Y A;  4KKJ A;  2WXR A;  3TEZ A;  2PVO D;  1T3Q A;  4OVZ A;  4JX1 C;  1D6E C;  2D5G A;  1YJJ A;  2K22 A;  4NAM A;  2WXL A;  3FIL A;  4C56 C;  1FFV A;  3I57 A;  2X38 A;  2ZW1 A;  3P4S B;  3P4Q B;  1IBX B;  2KAJ A;  1V1P A;  2LHE A;  2ON8 A;  1J7C A;  3SR6 A;  2BB6 A;  2DWQ A;  4YTP B;  3VQI A;  4ARI A;  1NYR A;  2MEK A;  3B2G A;  4L1B A;  1EU4 A;  3IT4 B;  2JZP A;  1MVK A;  1AWD A;  1GB4 A;  3W2D A;  3T3N A;  4AS1 A;  1V97 A;  3E56 A;  4A6Q A;  2WXI A;  3BWU D;  5C3J B;  3MFG A;  1GTH A;  2OHF A;  2ONQ A;  1L4Z B;  4DQO C;  2CJO A;  4US9 A;  2BS4 B;  3WCQ A;  1FMA D;  1SE2 A;  2Y5C A;  3ZJT A;  2W54 A;  1J7B A;  3KLS X;  1F2R I;  1TY2 A;  3ETR A;  1I4G A;  1VJK A;  2N0S B;  1PUT A;  4A9A A;  4B0E A;  3TEY A;  2LMC A;  4USA A;  2AQ2 B;  3V3X A;  1ROE A;  1TY0 A;  4XDD A;  3HRD D;  1GB1 A;  3VRB B;  4J3O D;  1R7S A;  3R2T A;  4KGT A;  1XLN A;  2LUM A;  2IJ0 A;  2WXF A;  2WXK A;  1N61 A;  1WGK A;  2NTS A;  3BII D;  1HEZ E;  3AED B;  2K5P A;  1YN3 A;  1PDX A;  1K50 A;  2YEP F;  1MHX A;  5GXG B;  1FRR A;  3J9C A;  3AE7 B;  1E10 A;  1YN5 A;  1JML A;  1TKE A;  3AM9 A;  1ET6 A;  2JYT A;  2SEB D;  3GB1 A;  1F77 A;  1XCQ L;  2AQ3 B;  1OQQ A;  1XCT L;  4HKQ A;  1VZ8 A;  3EUB 2;  3W1S A;  2AQ1 B;  2W82 A;  4RF0 A;  1C4A A;  1QT9 A;  3IAS 1;  1IBX A;  3NUH B;  1TS3 A;  2R61 A;  2WQY B;  2Y5P A;  4KGS A;  4N59 A;  1FCC C;  2WDV B;  3AB5 A;  1FM0 D;  4IDI A;  1AW7 A;  4RGN A;  2ZW0 A;  1ESF A;  3P4P B;  2W55 A;  2WXQ A;  1NEK B;  3FAH A;  1B9R A;  1BML C;  1SBB B;  4HKZ E;  3MJ5 A;  4WIP A;  5HFY A;  5FK9 C;  4OZB A;  1K53 A;  1QF6 A;  2KQ4 X;  1NEN B;  2JWU A;  5EE9 A;  3MP9 A;  3GS2 A;  4A90 A;  4ARC A;  1SB3 C;  2MJE A;  1TS2 A;  2LEK A;  2KMM A;  1GAQ B;  5BYS A;  2PVG C;  3W9C B;  1KLU D;  3NS1 A;  1KFY B;  4Q2J A;  1AN8 A;  4YTN B;  2JQR B;  3BZD B;  1E0Z A;  2H88 B;  1ZOY B;  1SF0 A;  1ET9 A;  3AH7 A;  1EM7 A;  2BBC A;  2IGD A;  5BMH A;  2GRI A;  3TEX A;  2LHD A;  1E9M A;  2RDH A;  4MM3 B;  1N5W A;  2NTT A;  4JWS C;  1PGA A;  5LNK 1;  4WAF A;  1UWX A;  2PIA A;  4GDK B;  3H8H A;  3AEB B;  3ZJV A;  4MAC A;  1F2R C;  3PZ7 A;  3ZGZ A;  2KDM A;  2DLB A;  3T3O A;  1ACC A;  2Y3A A;  2YEP B;  4KKI A;  4WUR A;  4P6V F;  2PKO A;  4H2A A;  1VDV A;  2EEL A;  2WU2 B;  1RWS A;  3ZYY X;  4US8 A;  3AE8 B;  1FXA A;  4YWG G;  3Q8B A;  1L6V A;  1STE A;  1M4V A;  1JWA D;  1L0Y B;  1UWM A;  1JWU D;  2PTL A;  3W5U B;  4LTU A;  1WYG A;  1K52 A;  2K3U A;  5H92 C;  4LK0 M;  4FXC A;  4N58 A;  3AEC B;  3KWV A;  2PMV A;  1D5Z C;  1WWT A;  4RF1 A;  1HA5 A;  5EE3 A;  1MI0 A;  4YSX B;  4RCO A;  3BYY B;  1WXQ A;  2M0A A;  2V3P A;  5HI1 A;  4ZYS A;  1VZ6 A;  2BW2 A;  2G9H D;  1FEH A;  3RFZ B;  1P7E A;  2GI9 A;  1C76 A;  3ABV B;  1IUE A;  2N7J A;  4TQ0 A;  1JRO A;  3HUI A;  3NVZ A;  3URY A;  1KF6 B;  3U52 E;  1FD6 A;  1ZE3 D;  1XF5 L;  2EKI A;  2HDE A;  1TKY A;  1OQR A;  2NMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...