3AEFB

Crystal structure of porcine heart mitochondrial complex ii with an empty quinone-binding pocket
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II with an empty quinone-binding pocket
rcsb
total genus 59
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3aefB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3aefB01
3B2GA 5EE3A 5C3JB 1WGKA 3AE9B 1OQQA 5AUIA 2K5PA 2G1EA 2CJNA 1FRDA 3AH7A 1TJEA 2KMMA 3P1MA 3RPFC 1PDXA 1L5PA 3DWMA 2BS3B 2WDVB 2DWQA 1GAQB 1OQRA 1N5WA 1VDVA 2KAJA 2OHFA 4WWMA 3FC4A 1EWYC 1TYGB 5EE9A 3AM9A 4HROA 2WU5B 4P6VF 5MPOA 5AUKA 1H7WA 2MJEA 1R7SA 2BS4B 4YTNB 1AWDA 1GT8A 3AEEB 3P4SB 1J7AA 1OFFA 3AEBB 1FM0D 2N0SB 2QIEB 3AB5A 3ETRA 3NRZA 4C7YA 5H92C 1WYGA 1XLQA 3HRDD 3NVYA 1JALA 1L6VA 4ZHPA 3CF4A 4WQMA 5GXGB 4JWSC 1FMAD 4C7ZA 4C80A 1QT9A 3HUIA 3HVZA 1TKEA 1J7BA 1B9RA 1XO3A 3AE1B 2CJOA 1DOXA 2Q5WD 3AEAB 3BIID 4N59A 2PVOD 4ZOHC 1QLBB 1PUTA 1QOAA 2PVGC 1E0ZA 1TKYA 1TKGA 4US9A 1ZOYB 3W5UB 3AEDB 3VR9B 1YJJA 2BT6A 3AE7B 4YSYB 1N61A 2MH7A 1FXIA 3ZYYX 2FBWB 4YXDB 4US8A 3AE4B 1FFUA 3CIRB 2QJLA 2ACZB 5G5HA 1FIQA 3NVZA 1N62A 1DOYA 3AV8A 3SFEB 2WP9B 3AEGB 2E3TA 1AYFA 1E6EB 3AMZA 3LB8C 1NVID 4USAA 2AX5A 2BS2B 2H89B 1VJKA 4HRSA 1E7PB 2B76B 1FRRA 2LEKA 4JWUC 3AE2B 1J7CA 1XLOA 2H88B 1ROEA 3NVVA 1ZP0B 1L6UA 2JQRB 2W3RA 3NVWA 3P63A 1JQ4A 1CJEA 1N60A 1FFVA 2EKIA 2L52A 1KFYB 2WLBA 3SFDB 3WCQA 1NYRA 3AEFB 1QOFA 1V8CA 1NI3A 2W54A 2W3SA 3AECB 1RFKA 3ABVB 3AE3B 2PIAA 1VLBA 2M19A 1A70A 3EUB2 3NS1A 1QOBA 4A9AA 1JROA 3LXFA 1L0VB 1PFDA 1GTEA 3P4RB 4FXCA 3DWGC 3KWLA 4IDIA 1ZUD2 2WDRB 1YQ3B 1DGJA 1SIJA 4KX6B 1IUEA 1YJIA 3AE5B 3AE8B 3CWIA 1JW9D 1YQ4B 1XLNA 4YTMB 3FAHA 3B2FA 4YSXB 3PO0A 1RM6C 3SR6A 3VR8B 4LTUA 1KF6B 3L4PA 4N6EB 2WDQB 2MJ3A 2Y5CA 1RYJA 5G5GA 2CU3A 1V97A 3AN1A 1SB3C 4ZHOA 1WXQA 1KRHA 2WS3B 1H7XA 4N58A 1XLPA 2K9XA 2WU2B 2HTME 1JRPA 1JWBD 2W55A 3W5VB 2WQYB 1QOGA 1DOIA 3AE6B 1N63A 3P4QB 1UWMA 1WWTA 3B9JA 2JX5A 5EE1A 3VRAB 4ITKA 1RWSA 2M56B 5EE0A 1T3QA 1F0ZA 5C2TB 1QF6A 4JX1C 1E10A 1NENB 1GPXA 1E9MA 1FO4A 3P4PB 4YT0B 2MJDA 4YTPB 2PKOA 1NYQA 1GTHA 2DBYA 2K22A 2L83A 1JWAD 1WRIA 1I7HA 1N5XA 1SF0A 3VRBB 1FXAA 1CZPA 1ZXIA 3W9CB 5H8YE 4YSZB 1NEKB
chains in the Genus database with same CATH superfamily
1TS4A 5IA7A 2V0GA 5IAAC 2PPHA 5G55A 2L1AA 1FCLA 3R2IA 4CHKA 1KM7A 3PSEB 4GXBA 4HJGE 1N5WA 3HHMA 4Q2JA 3AM9A 2LZ6A 3JW0X 2RPQA 4B6WA 2LUMA 1CK1A 4AWJA 3HRDD 3NVYA 1R4NI 3MHSD 1WGHA 1YX5B 1E0ZA 1P98A 4US9A 1YD8U 3LJ3A 5D2MB 3NY5A 4AP4C 5DPSA 3AE7B 2WXKA 3PZDA 1GG3A 2Z0EB 4RH6A 1N62A 5FR6A 4ASWC 1E6EB 3KYCD 3Q3FA 3MHZA 2JQRB 3OG5A 5CHWA 3SFDB 2IYDB 3AEFB 1I35A 2LRUA 1E7VA 2PIAA 3W2DA 3ZLZA 4F8CB 2D3GA 3URYA 3DWGC 4IDIA 1UWXA 1KTKA 2YEPB 1MG4A 4N6EB 4HEA1 4XDCA 2CU3A 2DNFA 1D4BA 2K9XA 3RUIB 1XXGA 4F1SA 4G0NB 1N63A 1WM3A 2MW5A 2DYBA 3RNFC 1XQQA 4ARCA 3L13A 2C7HA 2GB1A 3RNBC 1P1AA 3VTVA 4LCDE 3AI5A 3PLUA 4M8MA 1BXTA 1FPYA 1WXSA 1Q10A 4MELA 4S17A 1MFWA 1WZ3A 1MG8A 3VDZA 3EA6A 2WU5B 4I6LB 3APCA 1C79A 2BS4B 1AWDA 2N4FA 1FM0D 1WF9A 3O13A 1OEYJ 2BWES 1SXTA 2N1VA 1VD2A 4W9HA 1F2RI 2LJ5A 3CF4A 4A8XC 3MC0B 1TKEA 3IAM1 1T0RC 1B9RA 3ZNID 1K8RB 1V80A 2V9HA 1PUTA 2DX5B 4AJYB 1TKGA 4FJYA 4II3B 1HTOA 2BT6A 3VUXA 5D3DA 1SEBD 2N9LA 1YOVB 4EZKA 4HPPA 2ONQA 1FRRA 2LEKA 2WXGA 3CF6E 4OZAA 4TKNA 3MC9A 3NS1A 3VXWA 2Y5PA 1WZ0A 4IKGA 3T8MA 2Y5BB 1YQ3B 3OAWA 4IM3A 3DBRB 1XLNA 3ZDTA 4AUQC 4YSXB 2WWZA 3DBLB 3ZNZB 1V5OA 4GLSC 2C9WB 1C4CA 1VZ6A 2HE7A 2HTME 2C5LC 2IZVB 3W5VB 1QOGA 2QHOA 2UWQA 1V86A 2KACA 5HHDG 3DOWA 2KDFB 3RNCC 3ZRCA 1YIWA 3CSTA 2CHWA 2HD5B 1QQRA 2K1FA 1F1HA 1SJED 4MJSB 2KD0A 3Q6BA 1E5WA 1TYGB 5EE9A 4AJWA 4HROA 4XX5A 2QDFA 1GT8A 3BVMA 1J0GA 1WYGA 4ZHPA 3V3XA 1QT9A 3HIZA 4N59A 1QOAA 4RGOS 2FUHB 3BZDB 2IY0B 1XEEA 2WXOA 2LFIA 2NR2A 2AQ1B 4XWTA 4DHJB 5D94A 4TQ1A 3RNAC 2NBVB 3WAPA 1WFYA 1V5TA 2KWCA 1VJKA 3DVNU 5HFYA 3BWUD 1TT5B 1FFVA 2AWTA 1WJNA 3TEZA 1NI3A 2LHDA 3L0WB 2MBEA 1K51A 3L08A 2KWUB 4WAFA 3J9CA 4MJSA 2REXA 2WDRB 4BKTA 3ML8A 4B95A 1TTNA 1ZDVA 1YQ4B 2RSUA 3DHHC 2MHJA 2NTSA 1SB3C 4NJCA 4IM2A 2L8JA 2WU2B 3KVFB 2GBMA 3PRPB 1WYWB 1UWMA 1E8ZA 2BB5A 1FNUA 4KDLB 2ZPNA 5EE1A 1CQVA 2GLSA 2C7NB 4HDOA 1D6EC 3E9SA 2WXNA 4MGKE 2WYQA 4EZLA 1TZ1A 2M4NA 3X23A 4PT5A 2IGGA 2KXJA 5D3IB 2ON8A 3P1MA 2BYFA 3DWMA 2JF5A 1MHXA 3PRMB 2LGYA 2BQQA 4A90A 4LLGM 4WWMA 1HZ5A 2GMIC 1K52A 4ZRKA 1J7AA 2OJWA 3BVGA 1M4VA 2WX0A 2LGDA 4PS8A 3QA8A 4NNJB 2K8CA 1XO3A 4PS7A 2I38A 1TZOA 5TR5A 3BIID 2R61A 3K9OB 2MBBB 4W9LA 2LHEA 1I4HA 4OVZA 2WNMA 1H4RA 3ZYYX 4BBNC 4KZCA 3IHPC 3Q8FA 1WRDB 1L2NA 4GDKB 3SEBA 1C4AA 2KJHB 3PREA 3AE2B 1J7CA 1JQ4A 1ZP0B 1L6UA 4HWIB 2WX1A 2KC2A 1UNSA 5LXHA 1QOFA 3WAMA 3ZJUA 4BBNF 4W9KA 3U2SC 2LVOA 3ZUNA 4LJPB 3P4RB 2N9KA 2KZRA 2INCC 3FAHA 2FUG1 3H6NA 1T0QC 3GE3C 1WSPA 1YNTE 5AZGA 3K9PB 4IG7B 2WS3B 4G11A 4IUMB 2I1JA 3NZ3A 2ZVNA 3BK2A 3B9JA 3IXSA 2WXFA 3V60A 2XNAC 2MP2B 5C2TB 3L54A 4FLHA 2QILA 2PKOA 3EC8A 1I4PA 2DBYA 2GBJA 4WQOB 1E7UA 1I7HA 4WH4A 3RNGC 1OQYA 2EMTA 4L2YA 3MC8A 4EE2A 1OQQA 1C77A 2RDBC 2KMMA 4GDKA 5AZHA 4LNOA 4WJQA 3DBHI 2OHFA 4BKSA 1C9FA 3PGEA 3EFUA 1EWYC 3NUHB 2XK5B 4P16A 3Q8AA 3SD5A 3AEEB 2WXQA 3ETRA 4C7YA 4HPMB 5H92C 3TL5A 3UQBA 1L6VA 3QHTA 4IWQA 4HK2A 4ZRPA 1KH0A 3V61A 2PVOD 3DBSA 4EFOA 5BYSA 1IPGA 2NPTB 2DZKA 1UZXB 1PGXA 2IO1B 4BKGA 4US8A 2CKHB 2ACZB 5CTRC 4RCOA 2MP2A 4JWUC 2B76B 4HLEA 1HA5A 3NVVA 1I4GA 4LNKA 2L52A 2ASQA 2W3SA 3DDCB 3ABVB 2UYZB 2AL3A 3PHWB 1GUAB 4RGNA 1RRBA 4CQNA 1P3QU 1K50A 1SIFA 3DVGY 2PJHA 2XBBC 3KH0A 1EU4A 3LYYA 3DHIC 1T5XD 3IG3A 1JRUA 3IAS1 2PLPA 1WJ6A 2XK5A 1RAXA 1KRHA 2W9NA 1H7XA 1Z2MA 2N7JA 2W55A 2AYOB 2MQJA 3JSVB 4FA6A 2DYOA 4ZRJA 2IBIB 4K3CA 2KC1A 5L95C 1YN4A 4WIPA 2KHWB 2BYTA 1C4PA 3B08A 2NPTA 4KGSA 1IYFA 3W9CB 2CS4A 3IBEA 3OLMD 4ANXA 3NOBA 2VH2A 2IO3B 1TJEA 1AW7A 1F9JA 1Q0WB 2KN4A 4YWGG 1VDVA 4BAXA 4CO7A 4XWWA 4IW0A 1TY0A 4MDKE 1L4DB 3QC8B 3NRZA 1JALA 2WXMA 3U7DA 3HUIA 2KKCA 4WWNA 3RNEC 1ZOYB 3W5UB 4I6PA 4GSWA 2QJLA 3JSVA 3VAWA 2WGSA 2G3QB 1T6BX 2KDEB 3P63A 2CHXA 2N7EA 3AECB 1FEHA 1A70A 3PHXB 2IY1B 2INDC 2D10A 1XD3B 2KYWA 3QWZB 4DXGA 2YEPF 3M62B 4GMVA 1Z5SB 2J0JA 2W82A 1WJUA 4IM0A 1R4MB 2XEWA 4P1CC 3DVNV 1F0ZA 1FO4A 5L83A 1GTHA 3VUWA 1JWAD 2KNBA 1FNWA 2IJ0A 2XN9C 4REZA 5EE3A 5AUIA 1E8XA 5IOIA 2RR9A 4II2B 1UD7A 1C76A 4W9CA 2ICIA 4KKJA 2MX2A 1UELA 3FC4A 3H9DA 4C4VB 2LWPA 1EU3A 3ECIA 5AUKA 2WLBA 2QIEB 3H7SA 3NS8A 4B0EA 2BF8B 2LJIA 3IFWB 5LNK1 1XLQA 1OGWA 4JQWC 3BYTB 3ZIMA 4JWSC 1I4XA 4C80A 1PQSA 3EECA 2J7QB 2Z59B 5KHOA 3AEAB 5JHBA 4W9DA 1EF1A 4ZOHC 1WH3A 3I63C 1TKYA 2FCQA 1I4QA 3U52E 1BT0A 3GB1A 3VUYA 5FKAC 1NDDA 1GJZA 1PYWD 1FFUA 2VH1A 1HXYD 3ZTCA 1FCCC 2RDHA 3SFEB 2WXRA 1J19A 3ONSA 5IN7A 3V6CB 1VZ7A 3UINB 2LGIA 4E74A 1RLFA 1KFYB 2M0AA 1KJTA 1LXDA 2M19A 3DBLI 2N9PC 2VZKB 4ICUA 1I4RA 5E6PA 1WY8A 1WX9A 3A9KB 2DENB 3KUCB 4EOYA 3SDLC 4C4VA 4LNIA 3ZKJC 3EFCA 2G45B 2AEHA 4LTUA 1EM7A 3PZ8A 2R2OA 2QC8A 5KHQA 1TY2A 3ZW3A 1EWCA 2ZPYA 3C0RB 4RM8A 2M56B 4MSQB 3ZRFA 5AZFA 3NZSA 3IVFA 3CMMB 4GU2A 3Q8EA 1TS3A 2MBOA 1ZXIA 3L16A 4YSZB 4FJVB 3PV1A 4QAYA 3JYUA 1N6ZA 2PW9A 3RPFC 1L5PA 5FR3A 2KO3A 2KQ4X 3I9V1 4O1NA 3C8YA 2J4XA 3AU5A 2D3AA 1WGYA 3TEWA 2V3PA 3A4SC 5G2NA 2KQ7A 4DDID 4W9FA 2NTTA 1H7WA 1ZW7A 3LXFA 2KLGA 3DQVA 2MWSB 4HVBA 3A9KA 3KUZA 2NVUI 1WGRA 2KVRA 2KMCA 3RD2A 4MSMB 1B1ZA 4WJPA 2HJ1A 2Y3AA 4DK5A 2X8XX 3KYDD 4LDTB 1YJJA 4YSYB 5C23A 2MH7A 2KVZA 3CIRB 2KTRA 5HG2A 3AMZA 2N7DA 1NVID 2JUOA 1V9JA 2FCNA 2JT4B 3MFGA 2H88B 4RF0A 4MH8A 4EKUA 1WXVA 1WXMA 1U4AA 4KSKC 1SE3A 1VLBA 3QIJA 4LJOB 4PYZA 1QOBA 1JROA 1GTEA 1VCBA 4JIOU 1IUEA 1YJIA 2RD0A 3TIXA 4BKSD 5LLIA 1UGMA 1TS5A 1MJDA 2FAZA 2IGDA 1XCQL 4YL8A 3DVGX 2JXXA 1JWBD 4MH0E 4P1BC 1F52A 4E71A 1WWTA 3Q8BA 2K0PA 2Z0DB 1OEYA 2LXCA 1PGAA 2L83A 2KFKB 1WE6A 1EF5A 1EO6A 3B2GA 3BINA 5BYRA 2VRRB 2JU6X 1FRDA 4A55A 4GN1A 4ANWA 2FE8A 4M01A 2M8SA 4DWFA 1P7EA 2DAJA 4XGAB 2LVQA 4NAMA 3Q2AC 1SE4A 3UQAA 4ARIA 2V1YA 4RF1A 2CU1A 2BYVE 3U4EG 3OJ4B 4BZAA 3HVZA 2LXAA 3BY4B 2CJOA 2QCZA 4KGTA 4W9EA 1YX6B 2C7MB 2YVCA 1ESFA 3FILB 2MLBA 1C1YB 4ZYSA 2JYTA 3IT6B 5G5HA 4MM3B 3VH3B 3LB8C 3AEGB 2GBNA 2M17A 2HDEA 1Y56A 1CMXB 4L23A 1E8WA 2FCMA 2KFKA 4KGRA 3RULA 2JZZA 4BOSC 1GNUA 3EGRA 5D7GA 2ZW1A 2WXJA 2L05A 2WXLA 3NG0A 3EHVA 3CWIA 3RMKC 4IOIE 1E8YA 4HKQA 2V4LA 3SR6A 3ALBA 4DDGD 2BPSA 4S0RA 1WR1A 3P4QB 1X1MA 4WWOA 1L4ZB 1T3QA 2K25A 3CSFA 2MEKA 1GPXA 3T3OA 4K7WA 3FILA 2N9EB 3KLSX 5JHAA 1NI2A 1FXAA 2LMCA 3ENEA 1JWUD 2OOBB 2BVCA 4MM3A 1ACCA 2KJ6A 4G50A 3V05A 1OQRA 2ZCCA 1YMHE 4OHJA 3P42A 1R7SA 4YTNB 1MI0A 2LVPA 4RGMA 5FK9C 3AEBB 2N0SB 2MCNB 2WHIA 1RFAA 5IO9A 4BVUC 3S2AA 1WGDA 2O6VB 2L0TA 2M0XA 1TS2A 2D3BA 5E6OA 2D3CA 2JZ3B 4OVUA 3DHGC 1FXIA 4A3PA 1ZE3D 1FIQA 4JE3B 4D2KA 1UBIA 2V3NA 4ZRQA 5CHVC 3QK0A 1IBXA 2JPHA 2EKIA 1T0SC 4UDUC 3N3KB 4NY0A 1F77A 2JYEA 2M1MA 1GB4A 3NZUA 2KQSA 1JWSD 2DYMA 3AU4A 4P7IA 2ZJDA 1UH6A 2IPKD 2BKFA 4XE0A 3AE8B 5J18A 4TV3A 1BUIC 4F7ZA 5IKCM 2FNJB 4WAAA 1KF6B 2Y5CA 1P7FA 1RYJA 3M3JA 2DZIA 3M63B 3V6EB 3BYYB 1VZ8A 4ZYNA 1L0YB 2GBKA 2DZMA 4RMAA 3ZTDA 4ITKA 3R66C 1YQBA 2DAFA 2O6VA 1HZ6A 3GS2A 2GRIA 3ZJTA 1NYQA 1XCTL 2L0FA 1S1QB 2G4DB 2K6DB 3AE9B 2G1EA 2LRWA 3ZGZA 2SAKA 3R7RA 4TSSA 3ZXRA 2UU7A 2DHZA 3B1LX 2MJEA 3P4SB 3AB5A 4RM9A 4L1BA 2JWZA 1FMAD 2MBHA 2V3SA 1FNVA 2JVCA 4RGTA 3A33B 4LK0M 3R8BA 1MVKA 5BMHA 4HCNB 2FBWB 3KUDB 1MPEA 1TIFA 3OJ3A 2BKRB 4MEMA 3UI3A 3I5JC 1AYFA 2KX0A 3M95A 4DQOC 2KDBA 3H1UA 5E6JA 3BVZA 2L3ZA 5I4DA 1V49A 1GC6A 1UGJA 1SJHD 3N32A 1QZEA 4R3DA 1PFDA 2QSDA 3HM3A 2LUEA 2LD9A 2A5UA 1ZUD2 4DBGA 3BK1A 4HCPB 4ZDVA 2KFJA 3UF8A 2PTLA 2NCNA 3PO0A 1RM6C 3PVLA 4ZHOA 1WXQA 4PK1A 2K6QA 1LO5D 3WALA 1P9DU 2VZKD 2I2YA 2B3AA 3GZNB 4WJNA 3TCAA 1UF0A 3Q3OC 3VRAB 4XC2A 1E10A 2X38A 5EDSA 1UUPA 3UGBB 4NZLB 4TQ0A 1UBQA 3IT4B 1AARA 1KOTA 1SF0A 4ICVA 5DPWA 1NBFC 5H8YE 1NEKB 2AQ3B 3RFZB 4K7SA 1HEZE 3AH7A 2L7RA 3HVDA 4KDIC 2FIDA 2WDVB 2DWQA 5J2RA 1HQRD 2INNE 2K39A 3VQIA 4AS1A 4FN2A 2GOWA 5GXGB 3UIOB 2BGFA 2CR5A 3FKYA 4BFRA 5DPTA 2G4SA 4I6NB 4OVVA 3D32A 3L17A 3T3NA 5DPRA 1MHHE 2KN5A 1TBEA 1R4NB 1AN8A 2IO0B 1D5XC 2O2VB 2WP9B 4K3BA 3QQ8B 4HRSA 1ENFA 4NJ6A 3ML9A 4MT5A 3AULA 4LDTD 1S3SG 4J3OD 5HI1A 4IWOA 1V8CA 3L10B 1WI0A 2EKEC 3R3MA 4A9AA 1YN3A 2KDMA 1STEA 3WA0A 2K3UA 2NMQA 3TEYA 3GE8C 4KX6B 2KMAA 3Q14C 3PLVA 4OZBA 2CHZA 3W1SA 1D3ZA 2BYEA 1V1PB 3RI7C 5AEKB 1ZPSA 1WJ4A 2KWVB 2KOXA 4OZCA 2KWDA 4EEWA 3VH4B 3DBRI 4KV2A 1GC7A 2WQYB 2KLCA 4C56C 2KK8A 5E6NA 3APDA 4WJOA 4NAWB 1RWSA 4DHJD 4JX1C 1E9MA 2MJDA 1ZXHA 3H8HA 1K53A 2WXIA 3VRBB 1F2RC 2DZJA 1J8CA 3QX1A 2MSED 2L32A 1TGZB 1WGKA 2KJRA 1M94A 2O2VA 2RPVA 2CJNA 4ZRIA 1WX8A 3ZDMC 4LNNA 3N1XC 1GAQB 2KTRB 2N9XA 3GOEA 1SGHA 1WMHB 5CHFA 4P6VF 4MGYE 3Q3JA 2BBCA 4RNAA 3MJ5A 2JWUA 2C60A 4K7UA 1H8CA 2K8BA 5BO4B 4W9IA 4RFBA 1SE2A 3RYTA 1V1PA 3ZVVA 4M0WB 4XYCA 4H2AA 1N61A 2KANA 2BB6A 4LNFA 4OW0A 2E3TA 4GB9A 4NAWA 1I42A 1VR9A 3O65B 3RZFA 1GOZA 4A6QA 3TUOA 1LGRA 3EUB2 3KW5B 5BMGA 1YN5A 3T9LA 3VHTC 4FXCA 2ZVOA 2KTFA 2IO2B 3A9JB 2OJRA 1SIJA 1DGJA 1QKZA 4YTMB 1WMHA 4FHKA 3L4PA 1DYQA 4K1RB 1IGCA 1V97A 3AN1A 4NPNA 1L7YA 3N9YC 1V1OA 2QMTA 2D5GA 3TJPA 2GI9A 2JX5A 2N1WA 3VFKA 3WAOA 2KT7A 3RN9C 1QF6A 2NBWB 4M0WA 1WGGA 4YTPB 4ANVA 1N5XA 3U30A 3ZJVA 2HTHA 5C3JB 2ZNVC 4XZ4A 3P2BA 3DPDA 1JWMD 4NJ7A 4ANUA 4J6IA 4N9F4 1BMLC 1WE7A 4DHZE 1T0YA 4EZJA 2ZZPB 3AXCA 2KX3A 4GDLB 2MBQA 1IGDA 3Q3MC 3KWVA 5GMVA 1P0RA 1OFFA 5J17A 3LDZE 4X57B 4E3CA 5JH5C 2JZPA 5TSSA 3QCAA 3C19A 4C7ZA 3A9JA 3AE1B 3ZQ4A 3PZ7A 1SBBB 3WANA 1QLBB 3OWEB 3WIMA 1FXTB 2JXTA 3TBLD 2ZNVB 3AE4B 4MACA 2ZW0A 1DOYA 2RDGA 2LGSA 2R2QA 2H89B 3R2TA 2O6VD 2TSSA 4HJKA 1ZKHA 4KIKB 2W3RA 2EELA 4B9KA 2L00B 2JRHA 3RT3B 3WCQA 3N20C 3KQ4A 4AQ7A 3TSSA 4KKIA 1RFKA 3AE3B 2D2QA 3HM6X 4XDDA 1L0VB 5C1ZA 5BMIA 1YJ1A 1Y8RC 2NS5A 4JL9A 4G3XB 4AOFA 1GB1A 1ET9A 1LFDA 3AE5B 4GDLA 4GOCA 3VR8B 3PTFC 5G5GA 2MJ3A 4MGIE 2OEDA 4K81A 3H7PB 2D11A 1FD6A 3VVWB 4CYEA 2PMVA 5EE0A 3HK0A 2LASA 3P4PB 1KLUD 2A4ZA 2NBUA 3RZWC 2J53A 5JZEB 4KVGB 4FADA 3PPAA 1KLVA 2RMMA 5CX3A 3ZO5B 2L76A 1V6EA 2E6XA 1PDXA 1JMLA 2J0KA 3ZNHB 4DXFA 2KAJA 3UIPB 2BTEA 4KIKA 4M02A 4GGQA 2QEJC 5MPOA 2GBRA 4IC7B 1IBXB 1ISNA 1WXAA 2IGHA 3SU8X 4WQMA 4DHZB 1HE8A 2WXHA 2PEAA 3N1ZC 2Z8LA 2G9HD 2PVGC 3AEDB 3VR9B 4KZ0A 1WX7A 2INPE 5HKHA 4FULA 4YXDB 2BW2A 3H7PA 2WXPA 3QJZA 4MGZE 1KLGD 2KDIA 4FHJA 3MP9A 2K8HA 3AV8A 4HXDA 2J42A 1OTRB 2BWFA 1LM8B 1ROEA 1CJEA 1N60A 3PRZA 4JLCA 1NYRA 1A5RA 3TEXA 5BYQA 1ZDXA 2J52A 1V81A 4HPLB 3APFA 4HKZE 3ZXVA 1WM2A 3NHEB 3NJTA 1LQBA 3B2FA 4B0MA 4A20A 5D6JB 3X0WA 3A1QB 2MA9B 4BOZB 1VRAB 4N58A 1XLPA 4ACFA 2ZEQA 2AQ2B 1QILA 1L0XB 1DOIA 2JY6A 4PYUA 2SEBD 5DCNA 2J0MA 2JRIB 3N1YC 3PS6A 4IWPA 1ET6A 4TMAB 4WURA 3VTWA 1E90A 1V2YA 2JSVX 3I57A 1CZPA 3A4RA 1SE9A 2K5PA 2BS3B 1Q5WB 3VTUA 1C78A 3U8ZA 3U7ZA 5IP4D 2V4IB 2AL6A 1WIAA 1JCKB 1G6JA 1WR6E 4PS3A 4DXAB 4M00A 1XF5L 2PE9A 3QAQA 4URKA 2I1KA 2LGXA 1C3TA 3DBHB 1Q1OA 2MRPA 4EUTA 4C00A 1J7BA 1DOXA 1D5ZC 2Q5WD 4W9JA 4JPSA 3I3TB 1PGBA 3TMPB 3A1QA 2EMSA 1IP9A 4W9GA 2FIFA 3Q69A 3B0AA 4HDQA 3RCZA 3V62A 5LXIB 3NVZA 2WDTB 1SSNA 3GP7A 2FCSA 4USAA 2PE6B 2AX5A 2BS2B 4FJZA 1E7PB 1XLOA 3NVWA 2IDYA 2LI5A 3PT2B 1ZGUB 4TUUA 2RGFA 2ZCBA 2W54A 3QARA 1HTQA 1EUVB 3W1YA 4FBJB 3KWLA 2D07B 4GIVA 3Q3NC 3MTNB 3GZNI 1JW9D 4NQLB 3R7QA 4WWPA 3N30A 4KSLC 3ZNGC 3Q8CA 5JXVA 5T8IA 2WDQB 2YLMA 2HJ8A 3DCGA 3MJWA 4A3OA 4M8NA 1JRPA 3SHQA 2DLBA 4NQKE 3AE6B 3E56A 3JVZX 1NENB 4YT0B 1D5MC 1XT9B 2K22A 1WRIA 3W1SC 4JGHB 1R4MI
chains in the Genus database with same CATH topology
3B2GA 2L32A 1TS4A 1WGKA 2RPVA 1OQQA 5BYRA 2V0GA 1C77A 2CJNA 1FRDA 2JU6X 3UI3A 4A55A 2KMMA 2FE8A 2L1AA 1FCLA 1P7EA 3R2IA 4HJGE 1GAQB 1N5WA 2OHFA 1C9FA 1EWYC 4Q2JA 3AM9A 4NAMA 3NUHB 4P6VF 4P16A 1SE4A 3Q8AA 3AEEB 4ARIA 2LUMA 1CK1A 2BBCA 2WXQA 3ETRA 4C7YA 4RNAA 3MJ5A 5H92C 2JWUA 3HRDD 3NVYA 4RF1A 1L6VA 3U4EG 3HVZA 2CJOA 1SE2A 4RFBA 4KGTA 4ZRPA 1KH0A 2PVOD 1E0ZA 1V1PA 4US9A 1ESFA 3FILB 5BYSA 4ZYSA 2JYTA 3AE7B 4H2AA 1N61A 1PGXA 2WXKA 4US8A 2BB6A 3IT6B 2ACZB 5G5HA 4RH6A 1N62A 4MM3B 4RCOA 4OW0A 2E3TA 3AEGB 3LB8C 1E6EB 2HDEA 1Y56A 2B76B 4JWUC 1HA5A 3NVVA 1I4GA 3MHZA 4L23A 1VR9A 2JQRB 2L52A 3SFDB 4KGRA 3AEFB 1GOZA 4A6QA 3TUOA 2W3SA 3EGRA 2PIAA 3ABVB 3EUB2 3W2DA 5BMGA 1YN5A 5D7GA 2ZW1A 2WXJA 4RGNA 4CQNA 3URYA 2WXLA 3DWGC 4FXCA 1K50A 4IDIA 1UWXA 1SIJA 1DGJA 1EU4A 3CWIA 3LYYA 1KTKA 1QKZA 2YEPB 4YTMB 4IOIE 1T5XD 4HKQA 3IAS1 2PLPA 3SR6A 3L4PA 4N6EB 4HEA1 1DYQA 4XDCA 1IGCA 1V97A 2CU3A 3AN1A 1KRHA 1H7XA 1D4BA 3N9YC 2K9XA 1V1OA 1XXGA 2N7JA 2W55A 1N63A 3P4QB 2DYOA 2QMTA 2D5GA 2GI9A 2JX5A 1L4ZB 1T3QA 1QF6A 2MEKA 1YN4A 4WIPA 4ARCA 1GPXA 4M0WA 2BYTA 3T3OA 3FILA 4YTPB 2GB1A 1C4PA 3KLSX 1N5XA 4KGSA 1FXAA 2LMCA 3W9CB 3ZJVA 1JWUD 5C3JB 1BXTA 1TJEA 1Q10A 1ACCA 1AW7A 3V05A 1JWMD 2KN4A 1BMLC 4YWGG 1OQRA 1VDVA 4GDLB 1YMHE 3EA6A 4XWWA 2WU5B 1IGDA 1TY0A 4OHJA 1L4DB 3KWVA 3P42A 1C79A 1R7SA 2BS4B 4YTNB 1AWDA 1MI0A 1OFFA 4RGMA 5FK9C 3AEBB 1FM0D 2N0SB 3NRZA 3O13A 1SXTA 2JZPA 1JALA 2WXMA 5TSSA 1F2RI 3CF4A 4A8XC 3MC0B 4C7ZA 3HUIA 1TKEA 3IAM1 1B9RA 3AE1B 3ZQ4A 3PZ7A 1SBBB 1QLBB 1PUTA 1TKGA 3OWEB 1TS2A 1ZOYB 3W5UB 2BT6A 2JXTA 5D3DA 1FXIA 1SEBD 3AE4B 2N9LA 2QJLA 1ZE3D 1FIQA 4JE3B 4MACA 2ZW0A 1DOYA 2RDGA 4D2KA 2V3NA 4ZRQA 2H89B 3R2TA 2ONQA 1FRRA 2LEKA 2TSSA 1IBXA 2W3RA 2EELA 1T6BX 2WXGA 3P63A 2EKIA 4UDUC 3WCQA 1F77A 3KQ4A 2JYEA 4OZAA 4AQ7A 1GB4A 3TSSA 4KKIA 3AECB 1RFKA 3AE3B 1FEHA 3NS1A 1A70A 2Y5PA 4XDDA 1L0VB 5BMIA 1JWSD 2DYMA 4IKGA 1GB1A 1YQ3B 1ET9A 3AE5B 2IPKD 4XE0A 3AE8B 1XLNA 1BUIC 4YSXB 4DXGA 3VR8B 2YEPF 1KF6B 5G5GA 2MJ3A 2Y5CA 1P7FA 1RYJA 4GLSC 2OEDA 4XWTA 1C4CA 1VZ6A 2HTME 3BYYB 3W5VB 1VZ8A 1QOGA 1FD6A 1L0YB 2W82A 2KACA 4ITKA 2PMVA 5HHDG 5EE0A 1F0ZA 1HZ6A 3GS2A 3P4PB 1FO4A 1KLUD 2GRIA 3ZJTA 1NYQA 1XCTL 1GTHA 2J53A 1JWAD 1FNWA 2IJ0A 2XN9C 1QQRA 2RMMA 4REZA 5EE3A 1SJED 3AE9B 5AUIA 2G1EA 2E6XA 1C76A 1PDXA 1JMLA 2ICIA 3ZGZA 4KKJA 4DXFA 2KAJA 2BTEA 3FC4A 2SAKA 1TYGB 5EE9A 4TSSA 4HROA 1EU3A 2QEJC 5MPOA 5AUKA 2MJEA 1GT8A 3P4SB 2WLBA 2QIEB 1IBXB 3AB5A 3BVMA 4B0EA 2LJIA 2IGHA 5LNK1 1WYGA 1XLQA 4L1BA 3BYTB 4ZHPA 3V3XA 4WQMA 4JWSC 1I4XA 1FMAD 4C80A 1QT9A 2WXHA 3AEAB 2Z8LA 4N59A 4ZOHC 1FNVA 4RGTA 2G9HD 1QOAA 2PVGC 4RGOS 1TKYA 4LK0M 3R8BA 3BZDB 1I4QA 1MVKA 3U52E 3AEDB 3VR9B 3GB1A 5BMHA 2INPE 1XEEA 2FBWB 4YXDB 2BW2A 2WXOA 1PYWD 2LFIA 1FFUA 2WXPA 5FKAC 1HXYD 1MPEA 1KLGD 2AQ1B 1FCCC 2RDHA 3AV8A 3SFEB 2J42A 3MP9A 4TQ1A 1AYFA 2WXRA 4DQOC 1VJKA 5HFYA 1VZ7A 3BWUD 1ROEA 2LGIA 5E6JA 3BVZA 1CJEA 1N60A 1FFVA 5I4DA 1KFYB 2M0AA 1NYRA 3TEZA 1UGJA 1NI3A 2LHDA 1SJHD 2M19A 3TEXA 1K51A 4R3DA 5BYQA 2VZKB 1PFDA 1ZDXA 2J52A 2QSDA 4WAFA 1I4RA 3J9CA 1ZUD2 3BK1A 2WDRB 4HKZE 1ZDVA 1YQ4B 2PTLA 3B2FA 4B0MA 3PO0A 1RM6C 4LTUA 1EM7A 2NTSA 4ZHOA 3PZ8A 1SB3C 4NJCA 1VRAB 1WXQA 1LO5D 4N58A 1XLPA 2AQ2B 2WU2B 2VZKD 2I2YA 1TY2A 1QILA 1L0XB 1DOIA 1UWMA 1EWCA 2BB5A 1FNUA 2SEBD 5EE1A 3VRAB 1CQVA 2M56B 1E10A 2X38A 1UUPA 1ET6A 1D6EC 3E9SA 2WXNA 4NZLB 4TMAB 4WURA 4TQ0A 3IT4B 3Q8EA 1TS3A 1SF0A 2JSVX 3I57A 1CZPA 1ZXIA 5H8YE 4YSZB 4PT5A 1NEKB 2IGGA 2AQ3B 3RFZB 5D3IB 2K5PA 1HEZE 2ON8A 3AH7A 2PW9A 3P1MA 3RPFC 3HVDA 1L5PA 3DWMA 5FR3A 1MHXA 2BS3B 2KQ4X 3I9V1 4O1NA 3C8YA 2J4XA 2WDVB 2DWQA 4A90A 1HQRD 1C78A 4LLGM 4WWMA 1HZ5A 3U7ZA 2V4IB 3TEWA 2V3PA 1JCKB 2INNE 2NTTA 1K52A 1H7WA 3LXFA 1J7AA 3VQIA 4AS1A 1XF5L 3BVGA 1M4VA 5GXGB 1J7BA 1DOXA 1D5ZC 1XO3A 2I38A 2Q5WD 1TZOA 4JPSA 3BIID 3T3NA 1B1ZA 1PGBA 2R61A 2Y3AA 1MHHE 1YJJA 2LHEA 1I4HA 4OVZA 3Q69A 4YSYB 1AN8A 2WNMA 2MH7A 3ZYYX 3CIRB 1D5XC 3NVZA 3Q8FA 1SSNA 5HG2A 2WP9B 3AMZA 4GDKB 3GP7A 1NVID 4USAA 1C4AA 3SEBA 2AX5A 2BS2B 4HRSA 1ENFA 1E7PB 4MT5A 3AE2B 1J7CA 1XLOA 3MFGA 2H88B 3NVWA 1JQ4A 1ZP0B 1L6UA 4MH8A 4RF0A 2IDYA 1UNSA 4J3OD 5HI1A 1QOFA 1V8CA 3ZJUA 2W54A 1SE3A 1VLBA 4A9AA 1YN3A 1QOBA 3U2SC 1JROA 2KDMA 1GTEA 3P4RB 1STEA 2N9KA 2K3UA 2NMQA 3TEYA 3KWLA 4KX6B 1IUEA 1YJIA 4OZBA 1JW9D 3FAHA 2FUG1 3W1SA 1V1PB 1TS5A 1WSPA 1YNTE 3Q8CA 5JXVA 5T8IA 2WDQB 1ZPSA 2IGDA 2WS3B 1XCQL 4OZCA 2KWDA 3NZ3A 1JRPA 1JWBD 2WQYB 2DLBA 3BK2A 3AE6B 4C56C 1WWTA 3B9JA 3Q8BA 3E56A 3IXSA 2WXFA 2XNAC 1RWSA 4NAWB 2K0PA 5C2TB 4JX1C 1NENB 2QILA 1E9MA 4YT0B 1D5MC 1PGAA 2MJDA 1ZXHA 2PKOA 1I4PA 2DBYA 2K22A 2L83A 1WRIA 3H8HA 1I7HA 4WH4A 1K53A 2WXIA 3VRBB 1F2RC 4L2YA 4EE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B2G A;  5EE3 A;  5C3J B;  1WGK A;  3AE9 B;  1OQQ A;  5AUI A;  2K5P A;  2G1E A;  2CJN A;  1FRD A;  3AH7 A;  1TJE A;  2KMM A;  3P1M A;  3RPF C;  1PDX A;  1L5P A;  3DWM A;  2BS3 B;  2WDV B;  2DWQ A;  1GAQ B;  1OQR A;  1N5W A;  1VDV A;  2KAJ A;  2OHF A;  4WWM A;  3FC4 A;  1EWY C;  1TYG B;  5EE9 A;  3AM9 A;  4HRO A;  2WU5 B;  4P6V F;  5MPO A;  5AUK A;  1H7W A;  2MJE A;  1R7S A;  2BS4 B;  4YTN B;  1AWD A;  1GT8 A;  3AEE B;  3P4S B;  1J7A A;  1OFF A;  3AEB B;  1FM0 D;  2N0S B;  2QIE B;  3AB5 A;  3ETR A;  3NRZ A;  4C7Y A;  5H92 C;  1WYG A;  1XLQ A;  3HRD D;  3NVY A;  1JAL A;  1L6V A;  4ZHP A;  3CF4 A;  4WQM A;  5GXG B;  4JWS C;  1FMA D;  4C7Z A;  4C80 A;  1QT9 A;  3HUI A;  3HVZ A;  1TKE A;  1J7B A;  1B9R A;  1XO3 A;  3AE1 B;  2CJO A;  1DOX A;  2Q5W D;  3AEA B;  3BII D;  4N59 A;  2PVO D;  4ZOH C;  1QLB B;  1PUT A;  1QOA A;  2PVG C;  1E0Z A;  1TKY A;  1TKG A;  4US9 A;  1ZOY B;  3W5U B;  3AED B;  3VR9 B;  1YJJ A;  2BT6 A;  3AE7 B;  4YSY B;  1N61 A;  2MH7 A;  1FXI A;  3ZYY X;  2FBW B;  4YXD B;  4US8 A;  3AE4 B;  1FFU A;  3CIR B;  2QJL A;  2ACZ B;  5G5H A;  1FIQ A;  3NVZ A;  1N62 A;  1DOY A;  3AV8 A;  3SFE B;  2WP9 B;  3AEG B;  2E3T A;  1AYF A;  1E6E B;  3AMZ A;  3LB8 C;  1NVI D;  4USA A;  2AX5 A;  2BS2 B;  2H89 B;  1VJK A;  4HRS A;  1E7P B;  2B76 B;  1FRR A;  2LEK A;  4JWU C;  3AE2 B;  1J7C A;  1XLO A;  2H88 B;  1ROE A;  3NVV A;  1ZP0 B;  1L6U A;  2JQR B;  2W3R A;  3NVW A;  3P63 A;  1JQ4 A;  1CJE A;  1N60 A;  1FFV A;  2EKI A;  2L52 A;  1KFY B;  2WLB A;  3SFD B;  3WCQ A;  1NYR A;  3AEF B;  1QOF A;  1V8C A;  1NI3 A;  2W54 A;  2W3S A;  3AEC B;  1RFK A;  3ABV B;  3AE3 B;  2PIA A;  1VLB A;  2M19 A;  1A70 A;  3EUB 2;  3NS1 A;  1QOB A;  4A9A A;  1JRO A;  3LXF A;  1L0V B;  1PFD A;  1GTE A;  3P4R B;  4FXC A;  3DWG C;  3KWL A;  4IDI A;  1ZUD 2;  2WDR B;  1YQ3 B;  1DGJ A;  1SIJ A;  4KX6 B;  1IUE A;  1YJI A;  3AE5 B;  3AE8 B;  3CWI A;  1JW9 D;  1YQ4 B;  1XLN A;  4YTM B;  3FAH A;  3B2F A;  4YSX B;  3PO0 A;  1RM6 C;  3SR6 A;  3VR8 B;  4LTU A;  1KF6 B;  3L4P A;  4N6E B;  2WDQ B;  2MJ3 A;  2Y5C A;  1RYJ A;  5G5G A;  2CU3 A;  1V97 A;  3AN1 A;  1SB3 C;  4ZHO A;  1WXQ A;  1KRH A;  2WS3 B;  1H7X A;  4N58 A;  1XLP A;  2K9X A;  2WU2 B;  2HTM E;  1JRP A;  1JWB D;  2W55 A;  3W5V B;  2WQY B;  1QOG A;  1DOI A;  3AE6 B;  1N63 A;  3P4Q B;  1UWM A;  1WWT A;  3B9J A;  2JX5 A;  5EE1 A;  3VRA B;  4ITK A;  1RWS A;  2M56 B;  5EE0 A;  1T3Q A;  1F0Z A;  5C2T B;  1QF6 A;  4JX1 C;  1E10 A;  1NEN B;  1GPX A;  1E9M A;  1FO4 A;  3P4P B;  4YT0 B;  2MJD A;  4YTP B;  2PKO A;  1NYQ A;  1GTH A;  2DBY A;  2K22 A;  2L83 A;  1JWA D;  1WRI A;  1I7H A;  1N5X A;  1SF0 A;  3VRB B;  1FXA A;  1CZP A;  1ZXI A;  3W9C B;  5H8Y E;  4YSZ B;  1NEK B; 
#chains in the Genus database with same CATH topology
 1TS4 A;  5IA7 A;  2V0G A;  5IAA C;  2PPH A;  5G55 A;  2L1A A;  1FCL A;  3R2I A;  4CHK A;  1KM7 A;  3PSE B;  4GXB A;  4HJG E;  1N5W A;  3HHM A;  4Q2J A;  3AM9 A;  2LZ6 A;  3JW0 X;  2RPQ A;  4B6W A;  2LUM A;  1CK1 A;  4AWJ A;  3HRD D;  3NVY A;  1R4N I;  3MHS D;  1WGH A;  1YX5 B;  1E0Z A;  1P98 A;  4US9 A;  1YD8 U;  3LJ3 A;  5D2M B;  3NY5 A;  4AP4 C;  5DPS A;  3AE7 B;  2WXK A;  3PZD A;  1GG3 A;  2Z0E B;  4RH6 A;  1N62 A;  5FR6 A;  4ASW C;  1E6E B;  3KYC D;  3Q3F A;  3MHZ A;  2JQR B;  3OG5 A;  5CHW A;  3SFD B;  2IYD B;  3AEF B;  1I35 A;  2LRU A;  1E7V A;  2PIA A;  3W2D A;  3ZLZ A;  4F8C B;  2D3G A;  3URY A;  3DWG C;  4IDI A;  1UWX A;  1KTK A;  2YEP B;  1MG4 A;  4N6E B;  4HEA 1;  4XDC A;  2CU3 A;  2DNF A;  1D4B A;  2K9X A;  3RUI B;  1XXG A;  4F1S A;  4G0N B;  1N63 A;  1WM3 A;  2MW5 A;  2DYB A;  3RNF C;  1XQQ A;  4ARC A;  3L13 A;  2C7H A;  2GB1 A;  3RNB C;  1P1A A;  3VTV A;  4LCD E;  3AI5 A;  3PLU A;  4M8M A;  1BXT A;  1FPY A;  1WXS A;  1Q10 A;  4MEL A;  4S17 A;  1MFW A;  1WZ3 A;  1MG8 A;  3VDZ A;  3EA6 A;  2WU5 B;  4I6L B;  3APC A;  1C79 A;  2BS4 B;  1AWD A;  2N4F A;  1FM0 D;  1WF9 A;  3O13 A;  1OEY J;  2BWE S;  1SXT A;  2N1V A;  1VD2 A;  4W9H A;  1F2R I;  2LJ5 A;  3CF4 A;  4A8X C;  3MC0 B;  1TKE A;  3IAM 1;  1T0R C;  1B9R A;  3ZNI D;  1K8R B;  1V80 A;  2V9H A;  1PUT A;  2DX5 B;  4AJY B;  1TKG A;  4FJY A;  4II3 B;  1HTO A;  2BT6 A;  3VUX A;  5D3D A;  1SEB D;  2N9L A;  1YOV B;  4EZK A;  4HPP A;  2ONQ A;  1FRR A;  2LEK A;  2WXG A;  3CF6 E;  4OZA A;  4TKN A;  3MC9 A;  3NS1 A;  3VXW A;  2Y5P A;  1WZ0 A;  4IKG A;  3T8M A;  2Y5B B;  1YQ3 B;  3OAW A;  4IM3 A;  3DBR B;  1XLN A;  3ZDT A;  4AUQ C;  4YSX B;  2WWZ A;  3DBL B;  3ZNZ B;  1V5O A;  4GLS C;  2C9W B;  1C4C A;  1VZ6 A;  2HE7 A;  2HTM E;  2C5L C;  2IZV B;  3W5V B;  1QOG A;  2QHO A;  2UWQ A;  1V86 A;  2KAC A;  5HHD G;  3DOW A;  2KDF B;  3RNC C;  3ZRC A;  1YIW A;  3CST A;  2CHW A;  2HD5 B;  1QQR A;  2K1F A;  1F1H A;  1SJE D;  4MJS B;  2KD0 A;  3Q6B A;  1E5W A;  1TYG B;  5EE9 A;  4AJW A;  4HRO A;  4XX5 A;  2QDF A;  1GT8 A;  3BVM A;  1J0G A;  1WYG A;  4ZHP A;  3V3X A;  1QT9 A;  3HIZ A;  4N59 A;  1QOA A;  4RGO S;  2FUH B;  3BZD B;  2IY0 B;  1XEE A;  2WXO A;  2LFI A;  2NR2 A;  2AQ1 B;  4XWT A;  4DHJ B;  5D94 A;  4TQ1 A;  3RNA C;  2NBV B;  3WAP A;  1WFY A;  1V5T A;  2KWC A;  1VJK A;  3DVN U;  5HFY A;  3BWU D;  1TT5 B;  1FFV A;  2AWT A;  1WJN A;  3TEZ A;  1NI3 A;  2LHD A;  3L0W B;  2MBE A;  1K51 A;  3L08 A;  2KWU B;  4WAF A;  3J9C A;  4MJS A;  2REX A;  2WDR B;  4BKT A;  3ML8 A;  4B95 A;  1TTN A;  1ZDV A;  1YQ4 B;  2RSU A;  3DHH C;  2MHJ A;  2NTS A;  1SB3 C;  4NJC A;  4IM2 A;  2L8J A;  2WU2 B;  3KVF B;  2GBM A;  3PRP B;  1WYW B;  1UWM A;  1E8Z A;  2BB5 A;  1FNU A;  4KDL B;  2ZPN A;  5EE1 A;  1CQV A;  2GLS A;  2C7N B;  4HDO A;  1D6E C;  3E9S A;  2WXN A;  4MGK E;  2WYQ A;  4EZL A;  1TZ1 A;  2M4N A;  3X23 A;  4PT5 A;  2IGG A;  2KXJ A;  5D3I B;  2ON8 A;  3P1M A;  2BYF A;  3DWM A;  2JF5 A;  1MHX A;  3PRM B;  2LGY A;  2BQQ A;  4A90 A;  4LLG M;  4WWM A;  1HZ5 A;  2GMI C;  1K52 A;  4ZRK A;  1J7A A;  2OJW A;  3BVG A;  1M4V A;  2WX0 A;  2LGD A;  4PS8 A;  3QA8 A;  4NNJ B;  2K8C A;  1XO3 A;  4PS7 A;  2I38 A;  1TZO A;  5TR5 A;  3BII D;  2R61 A;  3K9O B;  2MBB B;  4W9L A;  2LHE A;  1I4H A;  4OVZ A;  2WNM A;  1H4R A;  3ZYY X;  4BBN C;  4KZC A;  3IHP C;  3Q8F A;  1WRD B;  1L2N A;  4GDK B;  3SEB A;  1C4A A;  2KJH B;  3PRE A;  3AE2 B;  1J7C A;  1JQ4 A;  1ZP0 B;  1L6U A;  4HWI B;  2WX1 A;  2KC2 A;  1UNS A;  5LXH A;  1QOF A;  3WAM A;  3ZJU A;  4BBN F;  4W9K A;  3U2S C;  2LVO A;  3ZUN A;  4LJP B;  3P4R B;  2N9K A;  2KZR A;  2INC C;  3FAH A;  2FUG 1;  3H6N A;  1T0Q C;  3GE3 C;  1WSP A;  1YNT E;  5AZG A;  3K9P B;  4IG7 B;  2WS3 B;  4G11 A;  4IUM B;  2I1J A;  3NZ3 A;  2ZVN A;  3BK2 A;  3B9J A;  3IXS A;  2WXF A;  3V60 A;  2XNA C;  2MP2 B;  5C2T B;  3L54 A;  4FLH A;  2QIL A;  2PKO A;  3EC8 A;  1I4P A;  2DBY A;  2GBJ A;  4WQO B;  1E7U A;  1I7H A;  4WH4 A;  3RNG C;  1OQY A;  2EMT A;  4L2Y A;  3MC8 A;  4EE2 A;  1OQQ A;  1C77 A;  2RDB C;  2KMM A;  4GDK A;  5AZH A;  4LNO A;  4WJQ A;  3DBH I;  2OHF A;  4BKS A;  1C9F A;  3PGE A;  3EFU A;  1EWY C;  3NUH B;  2XK5 B;  4P16 A;  3Q8A A;  3SD5 A;  3AEE B;  2WXQ A;  3ETR A;  4C7Y A;  4HPM B;  5H92 C;  3TL5 A;  3UQB A;  1L6V A;  3QHT A;  4IWQ A;  4HK2 A;  4ZRP A;  1KH0 A;  3V61 A;  2PVO D;  3DBS A;  4EFO A;  5BYS A;  1IPG A;  2NPT B;  2DZK A;  1UZX B;  1PGX A;  2IO1 B;  4BKG A;  4US8 A;  2CKH B;  2ACZ B;  5CTR C;  4RCO A;  2MP2 A;  4JWU C;  2B76 B;  4HLE A;  1HA5 A;  3NVV A;  1I4G A;  4LNK A;  2L52 A;  2ASQ A;  2W3S A;  3DDC B;  3ABV B;  2UYZ B;  2AL3 A;  3PHW B;  1GUA B;  4RGN A;  1RRB A;  4CQN A;  1P3Q U;  1K50 A;  1SIF A;  3DVG Y;  2PJH A;  2XBB C;  3KH0 A;  1EU4 A;  3LYY A;  3DHI C;  1T5X D;  3IG3 A;  1JRU A;  3IAS 1;  2PLP A;  1WJ6 A;  2XK5 A;  1RAX A;  1KRH A;  2W9N A;  1H7X A;  1Z2M A;  2N7J A;  2W55 A;  2AYO B;  2MQJ A;  3JSV B;  4FA6 A;  2DYO A;  4ZRJ A;  2IBI B;  4K3C A;  2KC1 A;  5L95 C;  1YN4 A;  4WIP A;  2KHW B;  2BYT A;  1C4P A;  3B08 A;  2NPT A;  4KGS A;  1IYF A;  3W9C B;  2CS4 A;  3IBE A;  3OLM D;  4ANX A;  3NOB A;  2VH2 A;  2IO3 B;  1TJE A;  1AW7 A;  1F9J A;  1Q0W B;  2KN4 A;  4YWG G;  1VDV A;  4BAX A;  4CO7 A;  4XWW A;  4IW0 A;  1TY0 A;  4MDK E;  1L4D B;  3QC8 B;  3NRZ A;  1JAL A;  2WXM A;  3U7D A;  3HUI A;  2KKC A;  4WWN A;  3RNE C;  1ZOY B;  3W5U B;  4I6P A;  4GSW A;  2QJL A;  3JSV A;  3VAW A;  2WGS A;  2G3Q B;  1T6B X;  2KDE B;  3P63 A;  2CHX A;  2N7E A;  3AEC B;  1FEH A;  1A70 A;  3PHX B;  2IY1 B;  2IND C;  2D10 A;  1XD3 B;  2KYW A;  3QWZ B;  4DXG A;  2YEP F;  3M62 B;  4GMV A;  1Z5S B;  2J0J A;  2W82 A;  1WJU A;  4IM0 A;  1R4M B;  2XEW A;  4P1C C;  3DVN V;  1F0Z A;  1FO4 A;  5L83 A;  1GTH A;  3VUW A;  1JWA D;  2KNB A;  1FNW A;  2IJ0 A;  2XN9 C;  4REZ A;  5EE3 A;  5AUI A;  1E8X A;  5IOI A;  2RR9 A;  4II2 B;  1UD7 A;  1C76 A;  4W9C A;  2ICI A;  4KKJ A;  2MX2 A;  1UEL A;  3FC4 A;  3H9D A;  4C4V B;  2LWP A;  1EU3 A;  3ECI A;  5AUK A;  2WLB A;  2QIE B;  3H7S A;  3NS8 A;  4B0E A;  2BF8 B;  2LJI A;  3IFW B;  5LNK 1;  1XLQ A;  1OGW A;  4JQW C;  3BYT B;  3ZIM A;  4JWS C;  1I4X A;  4C80 A;  1PQS A;  3EEC A;  2J7Q B;  2Z59 B;  5KHO A;  3AEA B;  5JHB A;  4W9D A;  1EF1 A;  4ZOH C;  1WH3 A;  3I63 C;  1TKY A;  2FCQ A;  1I4Q A;  3U52 E;  1BT0 A;  3GB1 A;  3VUY A;  5FKA C;  1NDD A;  1GJZ A;  1PYW D;  1FFU A;  2VH1 A;  1HXY D;  3ZTC A;  1FCC C;  2RDH A;  3SFE B;  2WXR A;  1J19 A;  3ONS A;  5IN7 A;  3V6C B;  1VZ7 A;  3UIN B;  2LGI A;  4E74 A;  1RLF A;  1KFY B;  2M0A A;  1KJT A;  1LXD A;  2M19 A;  3DBL I;  2N9P C;  2VZK B;  4ICU A;  1I4R A;  5E6P A;  1WY8 A;  1WX9 A;  3A9K B;  2DEN B;  3KUC B;  4EOY A;  3SDL C;  4C4V A;  4LNI A;  3ZKJ C;  3EFC A;  2G45 B;  2AEH A;  4LTU A;  1EM7 A;  3PZ8 A;  2R2O A;  2QC8 A;  5KHQ A;  1TY2 A;  3ZW3 A;  1EWC A;  2ZPY A;  3C0R B;  4RM8 A;  2M56 B;  4MSQ B;  3ZRF A;  5AZF A;  3NZS A;  3IVF A;  3CMM B;  4GU2 A;  3Q8E A;  1TS3 A;  2MBO A;  1ZXI A;  3L16 A;  4YSZ B;  4FJV B;  3PV1 A;  4QAY A;  3JYU A;  1N6Z A;  2PW9 A;  3RPF C;  1L5P A;  5FR3 A;  2KO3 A;  2KQ4 X;  3I9V 1;  4O1N A;  3C8Y A;  2J4X A;  3AU5 A;  2D3A A;  1WGY A;  3TEW A;  2V3P A;  3A4S C;  5G2N A;  2KQ7 A;  4DDI D;  4W9F A;  2NTT A;  1H7W A;  1ZW7 A;  3LXF A;  2KLG A;  3DQV A;  2MWS B;  4HVB A;  3A9K A;  3KUZ A;  2NVU I;  1WGR A;  2KVR A;  2KMC A;  3RD2 A;  4MSM B;  1B1Z A;  4WJP A;  2HJ1 A;  2Y3A A;  4DK5 A;  2X8X X;  3KYD D;  4LDT B;  1YJJ A;  4YSY B;  5C23 A;  2MH7 A;  2KVZ A;  3CIR B;  2KTR A;  5HG2 A;  3AMZ A;  2N7D A;  1NVI D;  2JUO A;  1V9J A;  2FCN A;  2JT4 B;  3MFG A;  2H88 B;  4RF0 A;  4MH8 A;  4EKU A;  1WXV A;  1WXM A;  1U4A A;  4KSK C;  1SE3 A;  1VLB A;  3QIJ A;  4LJO B;  4PYZ A;  1QOB A;  1JRO A;  1GTE A;  1VCB A;  4JIO U;  1IUE A;  1YJI A;  2RD0 A;  3TIX A;  4BKS D;  5LLI A;  1UGM A;  1TS5 A;  1MJD A;  2FAZ A;  2IGD A;  1XCQ L;  4YL8 A;  3DVG X;  2JXX A;  1JWB D;  4MH0 E;  4P1B C;  1F52 A;  4E71 A;  1WWT A;  3Q8B A;  2K0P A;  2Z0D B;  1OEY A;  2LXC A;  1PGA A;  2L83 A;  2KFK B;  1WE6 A;  1EF5 A;  1EO6 A;  3B2G A;  3BIN A;  5BYR A;  2VRR B;  2JU6 X;  1FRD A;  4A55 A;  4GN1 A;  4ANW A;  2FE8 A;  4M01 A;  2M8S A;  4DWF A;  1P7E A;  2DAJ A;  4XGA B;  2LVQ A;  4NAM A;  3Q2A C;  1SE4 A;  3UQA A;  4ARI A;  2V1Y A;  4RF1 A;  2CU1 A;  2BYV E;  3U4E G;  3OJ4 B;  4BZA A;  3HVZ A;  2LXA A;  3BY4 B;  2CJO A;  2QCZ A;  4KGT A;  4W9E A;  1YX6 B;  2C7M B;  2YVC A;  1ESF A;  3FIL B;  2MLB A;  1C1Y B;  4ZYS A;  2JYT A;  3IT6 B;  5G5H A;  4MM3 B;  3VH3 B;  3LB8 C;  3AEG B;  2GBN A;  2M17 A;  2HDE A;  1Y56 A;  1CMX B;  4L23 A;  1E8W A;  2FCM A;  2KFK A;  4KGR A;  3RUL A;  2JZZ A;  4BOS C;  1GNU A;  3EGR A;  5D7G A;  2ZW1 A;  2WXJ A;  2L05 A;  2WXL A;  3NG0 A;  3EHV A;  3CWI A;  3RMK C;  4IOI E;  1E8Y A;  4HKQ A;  2V4L A;  3SR6 A;  3ALB A;  4DDG D;  2BPS A;  4S0R A;  1WR1 A;  3P4Q B;  1X1M A;  4WWO A;  1L4Z B;  1T3Q A;  2K25 A;  3CSF A;  2MEK A;  1GPX A;  3T3O A;  4K7W A;  3FIL A;  2N9E B;  3KLS X;  5JHA A;  1NI2 A;  1FXA A;  2LMC A;  3ENE A;  1JWU D;  2OOB B;  2BVC A;  4MM3 A;  1ACC A;  2KJ6 A;  4G50 A;  3V05 A;  1OQR A;  2ZCC A;  1YMH E;  4OHJ A;  3P42 A;  1R7S A;  4YTN B;  1MI0 A;  2LVP A;  4RGM A;  5FK9 C;  3AEB B;  2N0S B;  2MCN B;  2WHI A;  1RFA A;  5IO9 A;  4BVU C;  3S2A A;  1WGD A;  2O6V B;  2L0T A;  2M0X A;  1TS2 A;  2D3B A;  5E6O A;  2D3C A;  2JZ3 B;  4OVU A;  3DHG C;  1FXI A;  4A3P A;  1ZE3 D;  1FIQ A;  4JE3 B;  4D2K A;  1UBI A;  2V3N A;  4ZRQ A;  5CHV C;  3QK0 A;  1IBX A;  2JPH A;  2EKI A;  1T0S C;  4UDU C;  3N3K B;  4NY0 A;  1F77 A;  2JYE A;  2M1M A;  1GB4 A;  3NZU A;  2KQS A;  1JWS D;  2DYM A;  3AU4 A;  4P7I A;  2ZJD A;  1UH6 A;  2IPK D;  2BKF A;  4XE0 A;  3AE8 B;  5J18 A;  4TV3 A;  1BUI C;  4F7Z A;  5IKC M;  2FNJ B;  4WAA A;  1KF6 B;  2Y5C A;  1P7F A;  1RYJ A;  3M3J A;  2DZI A;  3M63 B;  3V6E B;  3BYY B;  1VZ8 A;  4ZYN A;  1L0Y B;  2GBK A;  2DZM A;  4RMA A;  3ZTD A;  4ITK A;  3R66 C;  1YQB A;  2DAF A;  2O6V A;  1HZ6 A;  3GS2 A;  2GRI A;  3ZJT A;  1NYQ A;  1XCT L;  2L0F A;  1S1Q B;  2G4D B;  2K6D B;  3AE9 B;  2G1E A;  2LRW A;  3ZGZ A;  2SAK A;  3R7R A;  4TSS A;  3ZXR A;  2UU7 A;  2DHZ A;  3B1L X;  2MJE A;  3P4S B;  3AB5 A;  4RM9 A;  4L1B A;  2JWZ A;  1FMA D;  2MBH A;  2V3S A;  1FNV A;  2JVC A;  4RGT A;  3A33 B;  4LK0 M;  3R8B A;  1MVK A;  5BMH A;  4HCN B;  2FBW B;  3KUD B;  1MPE A;  1TIF A;  3OJ3 A;  2BKR B;  4MEM A;  3UI3 A;  3I5J C;  1AYF A;  2KX0 A;  3M95 A;  4DQO C;  2KDB A;  3H1U A;  5E6J A;  3BVZ A;  2L3Z A;  5I4D A;  1V49 A;  1GC6 A;  1UGJ A;  1SJH D;  3N32 A;  1QZE A;  4R3D A;  1PFD A;  2QSD A;  3HM3 A;  2LUE A;  2LD9 A;  2A5U A;  1ZUD 2;  4DBG A;  3BK1 A;  4HCP B;  4ZDV A;  2KFJ A;  3UF8 A;  2PTL A;  2NCN A;  3PO0 A;  1RM6 C;  3PVL A;  4ZHO A;  1WXQ A;  4PK1 A;  2K6Q A;  1LO5 D;  3WAL A;  1P9D U;  2VZK D;  2I2Y A;  2B3A A;  3GZN B;  4WJN A;  3TCA A;  1UF0 A;  3Q3O C;  3VRA B;  4XC2 A;  1E10 A;  2X38 A;  5EDS A;  1UUP A;  3UGB B;  4NZL B;  4TQ0 A;  1UBQ A;  3IT4 B;  1AAR A;  1KOT A;  1SF0 A;  4ICV A;  5DPW A;  1NBF C;  5H8Y E;  1NEK B;  2AQ3 B;  3RFZ B;  4K7S A;  1HEZ E;  3AH7 A;  2L7R A;  3HVD A;  4KDI C;  2FID A;  2WDV B;  2DWQ A;  5J2R A;  1HQR D;  2INN E;  2K39 A;  3VQI A;  4AS1 A;  4FN2 A;  2GOW A;  5GXG B;  3UIO B;  2BGF A;  2CR5 A;  3FKY A;  4BFR A;  5DPT A;  2G4S A;  4I6N B;  4OVV A;  3D32 A;  3L17 A;  3T3N A;  5DPR A;  1MHH E;  2KN5 A;  1TBE A;  1R4N B;  1AN8 A;  2IO0 B;  1D5X C;  2O2V B;  2WP9 B;  4K3B A;  3QQ8 B;  4HRS A;  1ENF A;  4NJ6 A;  3ML9 A;  4MT5 A;  3AUL A;  4LDT D;  1S3S G;  4J3O D;  5HI1 A;  4IWO A;  1V8C A;  3L10 B;  1WI0 A;  2EKE C;  3R3M A;  4A9A A;  1YN3 A;  2KDM A;  1STE A;  3WA0 A;  2K3U A;  2NMQ A;  3TEY A;  3GE8 C;  4KX6 B;  2KMA A;  3Q14 C;  3PLV A;  4OZB A;  2CHZ A;  3W1S A;  1D3Z A;  2BYE A;  1V1P B;  3RI7 C;  5AEK B;  1ZPS A;  1WJ4 A;  2KWV B;  2KOX A;  4OZC A;  2KWD A;  4EEW A;  3VH4 B;  3DBR I;  4KV2 A;  1GC7 A;  2WQY B;  2KLC A;  4C56 C;  2KK8 A;  5E6N A;  3APD A;  4WJO A;  4NAW B;  1RWS A;  4DHJ D;  4JX1 C;  1E9M A;  2MJD A;  1ZXH A;  3H8H A;  1K53 A;  2WXI A;  3VRB B;  1F2R C;  2DZJ A;  1J8C A;  3QX1 A;  2MSE D;  2L32 A;  1TGZ B;  1WGK A;  2KJR A;  1M94 A;  2O2V A;  2RPV A;  2CJN A;  4ZRI A;  1WX8 A;  3ZDM C;  4LNN A;  3N1X C;  1GAQ B;  2KTR B;  2N9X A;  3GOE A;  1SGH A;  1WMH B;  5CHF A;  4P6V F;  4MGY E;  3Q3J A;  2BBC A;  4RNA A;  3MJ5 A;  2JWU A;  2C60 A;  4K7U A;  1H8C A;  2K8B A;  5BO4 B;  4W9I A;  4RFB A;  1SE2 A;  3RYT A;  1V1P A;  3ZVV A;  4M0W B;  4XYC A;  4H2A A;  1N61 A;  2KAN A;  2BB6 A;  4LNF A;  4OW0 A;  2E3T A;  4GB9 A;  4NAW A;  1I42 A;  1VR9 A;  3O65 B;  3RZF A;  1GOZ A;  4A6Q A;  3TUO A;  1LGR A;  3EUB 2;  3KW5 B;  5BMG A;  1YN5 A;  3T9L A;  3VHT C;  4FXC A;  2ZVO A;  2KTF A;  2IO2 B;  3A9J B;  2OJR A;  1SIJ A;  1DGJ A;  1QKZ A;  4YTM B;  1WMH A;  4FHK A;  3L4P A;  1DYQ A;  4K1R B;  1IGC A;  1V97 A;  3AN1 A;  4NPN A;  1L7Y A;  3N9Y C;  1V1O A;  2QMT A;  2D5G A;  3TJP A;  2GI9 A;  2JX5 A;  2N1W A;  3VFK A;  3WAO A;  2KT7 A;  3RN9 C;  1QF6 A;  2NBW B;  4M0W A;  1WGG A;  4YTP B;  4ANV A;  1N5X A;  3U30 A;  3ZJV A;  2HTH A;  5C3J B;  2ZNV C;  4XZ4 A;  3P2B A;  3DPD A;  1JWM D;  4NJ7 A;  4ANU A;  4J6I A;  4N9F 4;  1BML C;  1WE7 A;  4DHZ E;  1T0Y A;  4EZJ A;  2ZZP B;  3AXC A;  2KX3 A;  4GDL B;  2MBQ A;  1IGD A;  3Q3M C;  3KWV A;  5GMV A;  1P0R A;  1OFF A;  5J17 A;  3LDZ E;  4X57 B;  4E3C A;  5JH5 C;  2JZP A;  5TSS A;  3QCA A;  3C19 A;  4C7Z A;  3A9J A;  3AE1 B;  3ZQ4 A;  3PZ7 A;  1SBB B;  3WAN A;  1QLB B;  3OWE B;  3WIM A;  1FXT B;  2JXT A;  3TBL D;  2ZNV B;  3AE4 B;  4MAC A;  2ZW0 A;  1DOY A;  2RDG A;  2LGS A;  2R2Q A;  2H89 B;  3R2T A;  2O6V D;  2TSS A;  4HJK A;  1ZKH A;  4KIK B;  2W3R A;  2EEL A;  4B9K A;  2L00 B;  2JRH A;  3RT3 B;  3WCQ A;  3N20 C;  3KQ4 A;  4AQ7 A;  3TSS A;  4KKI A;  1RFK A;  3AE3 B;  2D2Q A;  3HM6 X;  4XDD A;  1L0V B;  5C1Z A;  5BMI A;  1YJ1 A;  1Y8R C;  2NS5 A;  4JL9 A;  4G3X B;  4AOF A;  1GB1 A;  1ET9 A;  1LFD A;  3AE5 B;  4GDL A;  4GOC A;  3VR8 B;  3PTF C;  5G5G A;  2MJ3 A;  4MGI E;  2OED A;  4K81 A;  3H7P B;  2D11 A;  1FD6 A;  3VVW B;  4CYE A;  2PMV A;  5EE0 A;  3HK0 A;  2LAS A;  3P4P B;  1KLU D;  2A4Z A;  2NBU A;  3RZW C;  2J53 A;  5JZE B;  4KVG B;  4FAD A;  3PPA A;  1KLV A;  2RMM A;  5CX3 A;  3ZO5 B;  2L76 A;  1V6E A;  2E6X A;  1PDX A;  1JML A;  2J0K A;  3ZNH B;  4DXF A;  2KAJ A;  3UIP B;  2BTE A;  4KIK A;  4M02 A;  4GGQ A;  2QEJ C;  5MPO A;  2GBR A;  4IC7 B;  1IBX B;  1ISN A;  1WXA A;  2IGH A;  3SU8 X;  4WQM A;  4DHZ B;  1HE8 A;  2WXH A;  2PEA A;  3N1Z C;  2Z8L A;  2G9H D;  2PVG C;  3AED B;  3VR9 B;  4KZ0 A;  1WX7 A;  2INP E;  5HKH A;  4FUL A;  4YXD B;  2BW2 A;  3H7P A;  2WXP A;  3QJZ A;  4MGZ E;  1KLG D;  2KDI A;  4FHJ A;  3MP9 A;  2K8H A;  3AV8 A;  4HXD A;  2J42 A;  1OTR B;  2BWF A;  1LM8 B;  1ROE A;  1CJE A;  1N60 A;  3PRZ A;  4JLC A;  1NYR A;  1A5R A;  3TEX A;  5BYQ A;  1ZDX A;  2J52 A;  1V81 A;  4HPL B;  3APF A;  4HKZ E;  3ZXV A;  1WM2 A;  3NHE B;  3NJT A;  1LQB A;  3B2F A;  4B0M A;  4A20 A;  5D6J B;  3X0W A;  3A1Q B;  2MA9 B;  4BOZ B;  1VRA B;  4N58 A;  1XLP A;  4ACF A;  2ZEQ A;  2AQ2 B;  1QIL A;  1L0X B;  1DOI A;  2JY6 A;  4PYU A;  2SEB D;  5DCN A;  2J0M A;  2JRI B;  3N1Y C;  3PS6 A;  4IWP A;  1ET6 A;  4TMA B;  4WUR A;  3VTW A;  1E90 A;  1V2Y A;  2JSV X;  3I57 A;  1CZP A;  3A4R A;  1SE9 A;  2K5P A;  2BS3 B;  1Q5W B;  3VTU A;  1C78 A;  3U8Z A;  3U7Z A;  5IP4 D;  2V4I B;  2AL6 A;  1WIA A;  1JCK B;  1G6J A;  1WR6 E;  4PS3 A;  4DXA B;  4M00 A;  1XF5 L;  2PE9 A;  3QAQ A;  4URK A;  2I1K A;  2LGX A;  1C3T A;  3DBH B;  1Q1O A;  2MRP A;  4EUT A;  4C00 A;  1J7B A;  1DOX A;  1D5Z C;  2Q5W D;  4W9J A;  4JPS A;  3I3T B;  1PGB A;  3TMP B;  3A1Q A;  2EMS A;  1IP9 A;  4W9G A;  2FIF A;  3Q69 A;  3B0A A;  4HDQ A;  3RCZ A;  3V62 A;  5LXI B;  3NVZ A;  2WDT B;  1SSN A;  3GP7 A;  2FCS A;  4USA A;  2PE6 B;  2AX5 A;  2BS2 B;  4FJZ A;  1E7P B;  1XLO A;  3NVW A;  2IDY A;  2LI5 A;  3PT2 B;  1ZGU B;  4TUU A;  2RGF A;  2ZCB A;  2W54 A;  3QAR A;  1HTQ A;  1EUV B;  3W1Y A;  4FBJ B;  3KWL A;  2D07 B;  4GIV A;  3Q3N C;  3MTN B;  3GZN I;  1JW9 D;  4NQL B;  3R7Q A;  4WWP A;  3N30 A;  4KSL C;  3ZNG C;  3Q8C A;  5JXV A;  5T8I A;  2WDQ B;  2YLM A;  2HJ8 A;  3DCG A;  3MJW A;  4A3O A;  4M8N A;  1JRP A;  3SHQ A;  2DLB A;  4NQK E;  3AE6 B;  3E56 A;  3JVZ X;  1NEN B;  4YT0 B;  1D5M C;  1XT9 B;  2K22 A;  1WRI A;  3W1S C;  4JGH B;  1R4M I; 
#chains in the Genus database with same CATH homology
 3B2G A;  2L32 A;  1TS4 A;  1WGK A;  2RPV A;  1OQQ A;  5BYR A;  2V0G A;  1C77 A;  2CJN A;  1FRD A;  2JU6 X;  3UI3 A;  4A55 A;  2KMM A;  2FE8 A;  2L1A A;  1FCL A;  1P7E A;  3R2I A;  4HJG E;  1GAQ B;  1N5W A;  2OHF A;  1C9F A;  1EWY C;  4Q2J A;  3AM9 A;  4NAM A;  3NUH B;  4P6V F;  4P16 A;  1SE4 A;  3Q8A A;  3AEE B;  4ARI A;  2LUM A;  1CK1 A;  2BBC A;  2WXQ A;  3ETR A;  4C7Y A;  4RNA A;  3MJ5 A;  5H92 C;  2JWU A;  3HRD D;  3NVY A;  4RF1 A;  1L6V A;  3U4E G;  3HVZ A;  2CJO A;  1SE2 A;  4RFB A;  4KGT A;  4ZRP A;  1KH0 A;  2PVO D;  1E0Z A;  1V1P A;  4US9 A;  1ESF A;  3FIL B;  5BYS A;  4ZYS A;  2JYT A;  3AE7 B;  4H2A A;  1N61 A;  1PGX A;  2WXK A;  4US8 A;  2BB6 A;  3IT6 B;  2ACZ B;  5G5H A;  4RH6 A;  1N62 A;  4MM3 B;  4RCO A;  4OW0 A;  2E3T A;  3AEG B;  3LB8 C;  1E6E B;  2HDE A;  1Y56 A;  2B76 B;  4JWU C;  1HA5 A;  3NVV A;  1I4G A;  3MHZ A;  4L23 A;  1VR9 A;  2JQR B;  2L52 A;  3SFD B;  4KGR A;  3AEF B;  1GOZ A;  4A6Q A;  3TUO A;  2W3S A;  3EGR A;  2PIA A;  3ABV B;  3EUB 2;  3W2D A;  5BMG A;  1YN5 A;  5D7G A;  2ZW1 A;  2WXJ A;  4RGN A;  4CQN A;  3URY A;  2WXL A;  3DWG C;  4FXC A;  1K50 A;  4IDI A;  1UWX A;  1SIJ A;  1DGJ A;  1EU4 A;  3CWI A;  3LYY A;  1KTK A;  1QKZ A;  2YEP B;  4YTM B;  4IOI E;  1T5X D;  4HKQ A;  3IAS 1;  2PLP A;  3SR6 A;  3L4P A;  4N6E B;  4HEA 1;  1DYQ A;  4XDC A;  1IGC A;  1V97 A;  2CU3 A;  3AN1 A;  1KRH A;  1H7X A;  1D4B A;  3N9Y C;  2K9X A;  1V1O A;  1XXG A;  2N7J A;  2W55 A;  1N63 A;  3P4Q B;  2DYO A;  2QMT A;  2D5G A;  2GI9 A;  2JX5 A;  1L4Z B;  1T3Q A;  1QF6 A;  2MEK A;  1YN4 A;  4WIP A;  4ARC A;  1GPX A;  4M0W A;  2BYT A;  3T3O A;  3FIL A;  4YTP B;  2GB1 A;  1C4P A;  3KLS X;  1N5X A;  4KGS A;  1FXA A;  2LMC A;  3W9C B;  3ZJV A;  1JWU D;  5C3J B;  1BXT A;  1TJE A;  1Q10 A;  1ACC A;  1AW7 A;  3V05 A;  1JWM D;  2KN4 A;  1BML C;  4YWG G;  1OQR A;  1VDV A;  4GDL B;  1YMH E;  3EA6 A;  4XWW A;  2WU5 B;  1IGD A;  1TY0 A;  4OHJ A;  1L4D B;  3KWV A;  3P42 A;  1C79 A;  1R7S A;  2BS4 B;  4YTN B;  1AWD A;  1MI0 A;  1OFF A;  4RGM A;  5FK9 C;  3AEB B;  1FM0 D;  2N0S B;  3NRZ A;  3O13 A;  1SXT A;  2JZP A;  1JAL A;  2WXM A;  5TSS A;  1F2R I;  3CF4 A;  4A8X C;  3MC0 B;  4C7Z A;  3HUI A;  1TKE A;  3IAM 1;  1B9R A;  3AE1 B;  3ZQ4 A;  3PZ7 A;  1SBB B;  1QLB B;  1PUT A;  1TKG A;  3OWE B;  1TS2 A;  1ZOY B;  3W5U B;  2BT6 A;  2JXT A;  5D3D A;  1FXI A;  1SEB D;  3AE4 B;  2N9L A;  2QJL A;  1ZE3 D;  1FIQ A;  4JE3 B;  4MAC A;  2ZW0 A;  1DOY A;  2RDG A;  4D2K A;  2V3N A;  4ZRQ A;  2H89 B;  3R2T A;  2ONQ A;  1FRR A;  2LEK A;  2TSS A;  1IBX A;  2W3R A;  2EEL A;  1T6B X;  2WXG A;  3P63 A;  2EKI A;  4UDU C;  3WCQ A;  1F77 A;  3KQ4 A;  2JYE A;  4OZA A;  4AQ7 A;  1GB4 A;  3TSS A;  4KKI A;  3AEC B;  1RFK A;  3AE3 B;  1FEH A;  3NS1 A;  1A70 A;  2Y5P A;  4XDD A;  1L0V B;  5BMI A;  1JWS D;  2DYM A;  4IKG A;  1GB1 A;  1YQ3 B;  1ET9 A;  3AE5 B;  2IPK D;  4XE0 A;  3AE8 B;  1XLN A;  1BUI C;  4YSX B;  4DXG A;  3VR8 B;  2YEP F;  1KF6 B;  5G5G A;  2MJ3 A;  2Y5C A;  1P7F A;  1RYJ A;  4GLS C;  2OED A;  4XWT A;  1C4C A;  1VZ6 A;  2HTM E;  3BYY B;  3W5V B;  1VZ8 A;  1QOG A;  1FD6 A;  1L0Y B;  2W82 A;  2KAC A;  4ITK A;  2PMV A;  5HHD G;  5EE0 A;  1F0Z A;  1HZ6 A;  3GS2 A;  3P4P B;  1FO4 A;  1KLU D;  2GRI A;  3ZJT A;  1NYQ A;  1XCT L;  1GTH A;  2J53 A;  1JWA D;  1FNW A;  2IJ0 A;  2XN9 C;  1QQR A;  2RMM A;  4REZ A;  5EE3 A;  1SJE D;  3AE9 B;  5AUI A;  2G1E A;  2E6X A;  1C76 A;  1PDX A;  1JML A;  2ICI A;  3ZGZ A;  4KKJ A;  4DXF A;  2KAJ A;  2BTE A;  3FC4 A;  2SAK A;  1TYG B;  5EE9 A;  4TSS A;  4HRO A;  1EU3 A;  2QEJ C;  5MPO A;  5AUK A;  2MJE A;  1GT8 A;  3P4S B;  2WLB A;  2QIE B;  1IBX B;  3AB5 A;  3BVM A;  4B0E A;  2LJI A;  2IGH A;  5LNK 1;  1WYG A;  1XLQ A;  4L1B A;  3BYT B;  4ZHP A;  3V3X A;  4WQM A;  4JWS C;  1I4X A;  1FMA D;  4C80 A;  1QT9 A;  2WXH A;  3AEA B;  2Z8L A;  4N59 A;  4ZOH C;  1FNV A;  4RGT A;  2G9H D;  1QOA A;  2PVG C;  4RGO S;  1TKY A;  4LK0 M;  3R8B A;  3BZD B;  1I4Q A;  1MVK A;  3U52 E;  3AED B;  3VR9 B;  3GB1 A;  5BMH A;  2INP E;  1XEE A;  2FBW B;  4YXD B;  2BW2 A;  2WXO A;  1PYW D;  2LFI A;  1FFU A;  2WXP A;  5FKA C;  1HXY D;  1MPE A;  1KLG D;  2AQ1 B;  1FCC C;  2RDH A;  3AV8 A;  3SFE B;  2J42 A;  3MP9 A;  4TQ1 A;  1AYF A;  2WXR A;  4DQO C;  1VJK A;  5HFY A;  1VZ7 A;  3BWU D;  1ROE A;  2LGI A;  5E6J A;  3BVZ A;  1CJE A;  1N60 A;  1FFV A;  5I4D A;  1KFY B;  2M0A A;  1NYR A;  3TEZ A;  1UGJ A;  1NI3 A;  2LHD A;  1SJH D;  2M19 A;  3TEX A;  1K51 A;  4R3D A;  5BYQ A;  2VZK B;  1PFD A;  1ZDX A;  2J52 A;  2QSD A;  4WAF A;  1I4R A;  3J9C A;  1ZUD 2;  3BK1 A;  2WDR B;  4HKZ E;  1ZDV A;  1YQ4 B;  2PTL A;  3B2F A;  4B0M A;  3PO0 A;  1RM6 C;  4LTU A;  1EM7 A;  2NTS A;  4ZHO A;  3PZ8 A;  1SB3 C;  4NJC A;  1VRA B;  1WXQ A;  1LO5 D;  4N58 A;  1XLP A;  2AQ2 B;  2WU2 B;  2VZK D;  2I2Y A;  1TY2 A;  1QIL A;  1L0X B;  1DOI A;  1UWM A;  1EWC A;  2BB5 A;  1FNU A;  2SEB D;  5EE1 A;  3VRA B;  1CQV A;  2M56 B;  1E10 A;  2X38 A;  1UUP A;  1ET6 A;  1D6E C;  3E9S A;  2WXN A;  4NZL B;  4TMA B;  4WUR A;  4TQ0 A;  3IT4 B;  3Q8E A;  1TS3 A;  1SF0 A;  2JSV X;  3I57 A;  1CZP A;  1ZXI A;  5H8Y E;  4YSZ B;  4PT5 A;  1NEK B;  2IGG A;  2AQ3 B;  3RFZ B;  5D3I B;  2K5P A;  1HEZ E;  2ON8 A;  3AH7 A;  2PW9 A;  3P1M A;  3RPF C;  3HVD A;  1L5P A;  3DWM A;  5FR3 A;  1MHX A;  2BS3 B;  2KQ4 X;  3I9V 1;  4O1N A;  3C8Y A;  2J4X A;  2WDV B;  2DWQ A;  4A90 A;  1HQR D;  1C78 A;  4LLG M;  4WWM A;  1HZ5 A;  3U7Z A;  2V4I B;  3TEW A;  2V3P A;  1JCK B;  2INN E;  2NTT A;  1K52 A;  1H7W A;  3LXF A;  1J7A A;  3VQI A;  4AS1 A;  1XF5 L;  3BVG A;  1M4V A;  5GXG B;  1J7B A;  1DOX A;  1D5Z C;  1XO3 A;  2I38 A;  2Q5W D;  1TZO A;  4JPS A;  3BII D;  3T3N A;  1B1Z A;  1PGB A;  2R61 A;  2Y3A A;  1MHH E;  1YJJ A;  2LHE A;  1I4H A;  4OVZ A;  3Q69 A;  4YSY B;  1AN8 A;  2WNM A;  2MH7 A;  3ZYY X;  3CIR B;  1D5X C;  3NVZ A;  3Q8F A;  1SSN A;  5HG2 A;  2WP9 B;  3AMZ A;  4GDK B;  3GP7 A;  1NVI D;  4USA A;  1C4A A;  3SEB A;  2AX5 A;  2BS2 B;  4HRS A;  1ENF A;  1E7P B;  4MT5 A;  3AE2 B;  1J7C A;  1XLO A;  3MFG A;  2H88 B;  3NVW A;  1JQ4 A;  1ZP0 B;  1L6U A;  4MH8 A;  4RF0 A;  2IDY A;  1UNS A;  4J3O D;  5HI1 A;  1QOF A;  1V8C A;  3ZJU A;  2W54 A;  1SE3 A;  1VLB A;  4A9A A;  1YN3 A;  1QOB A;  3U2S C;  1JRO A;  2KDM A;  1GTE A;  3P4R B;  1STE A;  2N9K A;  2K3U A;  2NMQ A;  3TEY A;  3KWL A;  4KX6 B;  1IUE A;  1YJI A;  4OZB A;  1JW9 D;  3FAH A;  2FUG 1;  3W1S A;  1V1P B;  1TS5 A;  1WSP A;  1YNT E;  3Q8C A;  5JXV A;  5T8I A;  2WDQ B;  1ZPS A;  2IGD A;  2WS3 B;  1XCQ L;  4OZC A;  2KWD A;  3NZ3 A;  1JRP A;  1JWB D;  2WQY B;  2DLB A;  3BK2 A;  3AE6 B;  4C56 C;  1WWT A;  3B9J A;  3Q8B A;  3E56 A;  3IXS A;  2WXF A;  2XNA C;  1RWS A;  4NAW B;  2K0P A;  5C2T B;  4JX1 C;  1NEN B;  2QIL A;  1E9M A;  4YT0 B;  1D5M C;  1PGA A;  2MJD A;  1ZXH A;  2PKO A;  1I4P A;  2DBY A;  2K22 A;  2L83 A;  1WRI A;  3H8H A;  1I7H A;  4WH4 A;  1K53 A;  2WXI A;  3VRB B;  1F2R C;  4L2Y A;  4EE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...